2L52A

Solution structure of the small archaeal modifier protein 1 (samp1) from methanosarcina acetivorans
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
99
structure length
99
Chain Sequence
GHMAEVKVKLFANLREAAGTPELPLSGEKVIDVLLSLTDKYPALKYVIFEKGDEKSEILILCGSINILINGNNIRHLEGLETLLKDSDEIGILPPVSGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords METHANOSARCINA ACETIVORANS SAMP1 HOMOLOG
publication title Solution structure and activation mechanism of ubiquitin-like small archaeal modifier proteins.
pubmed doi rcsb
source organism Methanosarcina acetivorans
molecule tags Protein binding
total genus 17
structure length 99
sequence length 99
ec nomenclature
pdb deposition date 2010-10-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02597 ThiS ThiS family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 2l52A00
3HVZA 2PKOA 1E7PB 1V97A 3P4SB 1XLOA 3AEBB 3P1MA 2MJEA 1XLNA 1YJIA 1N5WA 3BIID 1RYJA 3AE4B 5G5HA 3VRBB 1NYQA 1DOIA 3RPFC 2WP9B 1DGJA 1TYGB 1SIJA 3DWMA 3W9CB 1L5PA 3AE3B 1CZPA 2QIEB 2E3TA 3AM9A 4HRSA 1QF6A 5G5GA 2DBYA 2WU2B 5H92C 1JW9D 2EKIA 3L4PA 4KX6B 5AUKA 1KRHA 3AEGB 1NVID 3AECB 4US9A 4ZHOA 5EE3A 2Y5CA 1A70A 1AYFA 2WU5B 3AE1B 2MJDA 1FFVA 1GAQB 1FIQA 3HUIA 3AEDB 1TJEA 4YSYB 2BS3B 2QJLA 1ZXIA 3NRZA 4N59A 1TKGA 4JWUC 4IDIA 2MH7A 1OFFA 2CU3A 3AE5B 1R7SA 1DOYA 2CJNA 3CWIA 4A9AA 1WGKA 4USAA 1XLQA 3NS1A 4LTUA 1N5XA 1YQ4B 1NENB 2W54A 1N62A 2K22A 3NVZA 5MPOA 1JQ4A 1SF0A 3AB5A 2WS3B 2N0SB 5EE9A 1KF6B 1FMAD 1OQRA 2KAJA 2PIAA 1CJEA 2WDQB 2KMMA 3P4PB 4JWSC 3ZYYX 3W5VB 1J7AA 3VRAB 2JQRB 2FBWB 1TKYA 2ACZB 1AWDA 4YT0B 5C3JB 1VJKA 2M56B 2Q5WD 2W3RA 3CIRB 1L6UA 1JROA 2K5PA 3P63A 2CJOA 2PVGC 4JX1C 1JWBD 1FRDA 4YTPB 3DWGC 2MJ3A 1JALA 3AE9B 1UWMA 3AE8B 3FAHA 4C7ZA 4ZHPA 1WRIA 1E10A 1IUEA 1RM6C 3B2FA 3NVYA 1PUTA 1YJJA 1F0ZA 2DWQA 2K9XA 1WYGA 2WDRB 3AV8A 3PO0A 3SR6A 1J7BA 4YSXB 1NEKB 2L83A 1WXQA 5EE0A 1ZUD2 1E6EB 2L52A 1QOFA 2PVOD 2OHFA 3AN1A 1PDXA 1QLBB 2H88B 2H89B 1FRRA 1FO4A 1RWSA 3ETRA 3W5UB 4C80A 1T3QA 1QOBA 3FC4A 3SFEB 1QOAA 1YQ3B 2JX5A 1TKEA 2W55A 2BS2B 4FXCA 1JRPA 3AE6B 3B2GA 3HRDD 5C2TB 1PFDA 1N63A 3P4RB 3KWLA 4WQMA 1E9MA 3ABVB 2BT6A 5AUIA 1FM0D 1NI3A 1FXAA 1QT9A 2HTME 3VR8B 4C7YA 3AE7B 1V8CA 1L6VA 1SB3C 4YSZB 1RFKA 4US8A 1N60A 1B9RA 1GPXA 1WWTA 2M19A 3AE2B 1ROEA 2BS4B 3SFDB 3AH7A 3AMZA 2B76B 1XLPA 4N6EB 1ZOYB 1DOXA 2WLBA 3AEEB 4YXDB 4N58A 4ZOHC 3NVWA 1L0VB 1I7HA 3AEAB 1XO3A 3EUB2 1FFUA 1J7CA 1N61A 1JWAD 3B9JA 5GXGB 3LB8C 3NVVA 1NYRA 2G1EA 5H8YE 4YTMB 1ZP0B 1VLBA 2AX5A 2LEKA 2WDVB 1VDVA 3P4QB 1E0ZA 2W3SA 1QOGA 4HROA 2WQYB 4P6VF 1FXIA 3LXFA 4YTNB 5EE1A 3WCQA 1EWYC 4WWMA 3AEFB 4ITKA 3VR9B 1OQQA 1KFYB
chains in the Genus database with same CATH superfamily
4DXAB 3I3TB 3CSTA 2C9WB 1QZEA 4C4VB 1F9JA 2LRWA 3L4PA 3AEGB 2BYVE 3BVMA 1MPEA 2KDFB 1YNTE 2GBRA 3GE8C 4XWWA 4IKGA 4NJCA 1TKGA 3MHSD 2MH7A 2DAFA 4G3XB 3VTUA 3RMKC 4BKTA 1WH3A 2N7JA 1LGRA 4B9KA 4JLCA 1D5MC 4A8XC 2UU7A 4NZLB 1R4MI 1FMAD 4DXFA 4C00A 5E6OA 2M56B 4TKNA 3DWGC 3UGBB 2D2QA 2M1MA 1HZ5A 5KHQA 1WYGA 2O6VD 2M0XA 2LRUA 3VUWA 4AJWA 2IO3B 3AULA 4WAFA 4KIKA 2EELA 2VRRB 4EKUA 3FC4A 1KJTA 1N6ZA 4FHJA 3I9V1 4GGQA 4HJKA 2BT6A 3UIOB 3PGEA 1N60A 3V6CB 2IY0B 1T0SC 4HPPA 3C0RB 1ZOYB 2V3NA 3BY4B 2WXFA 3N1XC 4AWJA 3GB1A 2DENB 2KWDA 5BYRA 1XO3A 1Z2MA 4M02A 1ZDVA 1BUIC 2FCMA 2IPKD 1ZDXA 2D10A 4II2B 2W3SA 5JZEB 1FCCC 1KLVA 4WWMA 2NVUI 2KFKA 1GUAB 2B3AA 2IBIB 2ON8A 2LD9A 1XLNA 1QKZA 1XCQL 3W9CB 5FR6A 4PS7A 4W9EA 3GZNB 4ZHOA 4IM2A 4E74A 4ZRQA 4K3BA 1TZ1A 5HHDG 2SAKA 2RD0A 1XD3B 3PTFC 4EE2A 1KH0A 1FPYA 1JRUA 4ARIA 1OFFA 2MBEA 2DX5B 2N9PC 2SEBD 3U8ZA 4W9CA 1XEEA 2MP2B 3H6NA 4JGHB 2D11A 4BKGA 2PIAA 1V80A 2K8BA 1J7AA 1ZE3D 5C3JB 1I35A 4N9F4 2BW2A 3NOBA 2K6QA 3AE9B 2WXLA 3ZVVA 3NVYA 3DQVA 3PO0A 5CHVC 4NQKE 4IOIE 1FO4A 2JF5A 3W5UB 2BWES 1QOBA 2ZNVC 2W55A 3AE6B 4MJSA 1BXTA 1R4MB 3VDZA 1QT9A 3L0WB 2PLPA 5IKCM 3KQ4A 1RFKA 1STEA 3H7PB 2AL3A 1L7YA 3EECA 3O13A 2JWUA 1C4CA 2X8XX 3FILA 4N6EB 2Z59B 5BYQA 3KYCD 1N61A 2JXXA 3ECIA 3LB8C 3PHXB 3ZRCA 3IG3A 5LNK1 5KHOA 4PS8A 3AI5A 1JWSD 5AZHA 3QA8A 4OZBA 4W9DA 1KFYB 1EM7A 4WJPA 1E7PB 2BPSA 3N32A 1C77A 3ZJVA 3P1MA 4CHKA 2JVCA 1PGBA 4ARCA 1DGJA 1TS3A 4HRSA 2FNJB 3Q3MC 1HEZE 3IHPC 1GC6A 3EHVA 1NVID 2KDEB 4US9A 4HDQA 5C1ZA 3HM3A 3VH4B 3ZTCA 3KWVA 2HJ8A 2DLBA 4W9IA 1P9DU 2O6VB 1TGZB 1XLQA 3NS1A 1QQRA 3I5JC 2FUG1 1N62A 1V86A 1EU4A 4NNJB 3ZW3A 2LGXA 1WMHA 1WX8A 2KMMA 4GDLA 1C1YB 2OOBB 1G6JA 4KSLC 2PE9A 1I4HA 1WRIA 4WJOA 3B2FA 4B95A 1PUTA 2IYDB 4DHJD 1JWMD 2M8SA 5BMIA 1QLBB 2D5GA 2H88B 3ML9A 2V4IB 4C80A 3SD5A 2LGDA 1UELA 4NQLB 2JZ3B 1GG3A 2MSED 1WWTA 2WXJA 4AQ7A 4DK5A 2J42A 3DBHI 4XDDA 1ZW7A 1ZXHA 2V9HA 2PTLA 3A33B 3AU4A 3RYTA 2KDMA 1L0VB 2IY1B 2WYQA 3ZUNA 1J7CA 2IO1B 4NAMA 3DBLI 2I2YA 4G0NB 2CKHB 3TL5A 2D3BA 2J0KA 2KQSA 2GRIA 3N20C 3HVZA 1UWXA 1QILA 3RNFC 3AEBB 2KC2A 3JVZX 2WGSA 1WE6A 1TS5A 2ZEQA 2RPVA 1NYQA 2LXAA 1TYGB 2KTRB 4LNIA 4W9FA 1YX5B 2JXTA 4G11A 5AUKA 3WALA 3WAMA 2KWVB 2RDHA 2QEJC 2WU5B 1ET6A 1TS4A 1WGRA 2FIDA 4KVGB 2QJLA 1OGWA 4IC7B 3OLMD 3RZFA 1R7SA 3Q8AA 2KQ7A 3APFA 3HK0A 3EGRA 3W2DA 4BKSA 2N1VA 4XGAB 1WJNA 2AYOB 3BVZA 3EFCA 4ACFA 4I6NB 3W5VB 1TKYA 1AWDA 2KXJA 3U52E 2BKRB 3RNGC 1L6UA 4YTPB 1T6BX 2QHOA 3VTVA 3R8BA 3KUCB 4NAWB 2DWQA 3A4SC 4HDOA 1EO6A 5GMVA 3N1YC 4A20A 4JPSA 4MELA 3ZKJC 1YQ3B 2M0AA 2FCQA 1C4AA 1E9MA 1VCBA 1SEBD 5BO4B 2KACA 2WXRA 4GB9A 1FXAA 4HK2A 1V8CA 2ZW1A 1Q1OA 2XBBC 2C5LC 4W9HA 5LXIB 3N9YC 3ZLZA 1R4NB 5L95C 4N58A 2LJ5A 3WA0A 3KH0A 2WXIA 3OJ3A 3S2AA 4IWOA 2ASQA 2I1KA 4AS1A 2YLMA 5CTRC 1VLBA 2K8HA 3IAM1 1WR1A 1F2RC 2LFIA 4O1NA 3UIPB 3VHTC 3VR9B 2BGFA 1FNWA 3B1LX 3P4SB 4GDKA 3PLVA 3P42A 1J8CA 3UF8A 3A9JB 4M0WA 1QF6A 3KVFB 1KRHA 1MHHE 3UI3A 4P16A 3VVWB 1AYFA 1VD2A 1YX6B 2DZKA 2GBKA 1XCTL 2VH1A 3TCAA 5JXVA 2L32A 4MGKE 4NJ7A 1CK1A 2K1FA 4DHJB 2MBOA 4F8CB 2AEHA 2BYEA 2XNAC 2N1WA 5BMHA 4II3B 1A5RA 4RH6A 2BBCA 4EZKA 2TSSA 3P63A 4WJQA 1JWBD 2IGHA 1JALA 2KJ6A 1IUEA 3BYTB 4CO7A 1F0ZA 5T8IA 2V0GA 1J7BA 1WXQA 1BT0A 3TEXA 5JHAA 1WXAA 4ANVA 4MSQB 1FRRA 1RWSA 1WJ4A 1IPGA 3QARA 5C23A 2IJ0A 4A3PA 3ZQ4A 1N63A 4WQMA 2R2OA 5JHBA 4G50A 3QHTA 3ZNZB 3RNBC 2QCZA 3FKYA 4HPMB 4WQOB 2QSDA 4TMAB 4YXDB 3DCGA 4FN2A 4XZ4A 3L13A 3TMPB 1T0YA 4HXDA 1MVKA 2GB1A 4FBJB 2BYTA 3DDCB 3P4QB 2DAJA 2LXCA 2V3SA 2WXQA 3V62A 2JZZA 4ZYSA 3SU8X 1Q0WB 1N5WA 1RYJA 1VZ6A 5AEKB 1UD7A 2BWFA 3PS6A 2CHXA 3VH3B 3GZNI 4BFRA 1JW9D 1KM7A 4LCDE 5D6JB 4HJGE 2KHWB 1WR6E 4OZAA 1LM8B 3NRZA 1IP9A 1ZXIA 2OJRA 1HE8A 2CU1A 3A1QA 3A4RA 3E9SA 5D3IB 3ZRFA 3DBSA 1I4GA 2Z0EB 3QC8B 3OAWA 2K22A 2FCNA 4EUTA 3QJZA 4FULA 4EZJA 1OQRA 3ZYYX 2WXOA 1XF5L 4QAYA 3RD2A 2J0MA 3L08A 1JROA 2ZCCA 4LNOA 1EF5A 1GPXA 2K9XA 2A4ZA 2DNFA 3JYUA 4J3OD 3PVLA 4B0EA 2D3AA 3I57A 3VQIA 3WIMA 3HHMA 4P1BC 2A5UA 4C4VA 1QOAA 1V6EA 4DQOC 4CYEA 2BS2B 3KW5B 4EEWA 5CX3A 1DYQA 1Y56A 3AE7B 3V6EB 2WWZA 1FNVA 1WI0A 4OVZA 3UINB 4W9LA 4HCPB 3U4EG 5E6NA 1K53A 3RI7C 2KX0A 2OEDA 3NVWA 2NMQA 3DBRB 3RZWC 2BVCA 4XX5A 2NBVB 4MT5A 2J0JA 2CR5A 1FXIA 5EE1A 4ANXA 2FE8A 1C4PA 3AEFB 3Q8FA 5JH5C 1ZGUB 4CQNA 3AE4B 2QIEB 2E3TA 4KKIA 4LNKA 3LYYA 3AECB 1Z5SB 4FJYA 2Y5CA 4TUUA 1WYWB 3E56A 1V1PB 4DBGA 1MG8A 3HUIA 1TJEA 1WRDB 5AZGA 2GI9A 1KLGD 2MBHA 2KWCA 1WSPA 1ET9A 3RNCC 1L0YB 2G45B 1Y8RC 2GBJA 5MPOA 3ENEA 2YVCA 3ZTDA 4JWSC 1KOTA 4GIVA 3VRAB 1RAXA 5TR5A 4I6LB 1UBQA 4FJVB 2WX1A 2NPTB 2KN5A 4C7ZA 3L54A 2R61A 1E10A 2MCNB 1NEKB 3APDA 2G9HD 2L52A 2PVOD 1QOFA 2GMIC 2LUEA 2LGYA 2X38A 1T3QA 1NDDA 1PGXA 3V61A 3ZNID 3B2GA 2BQQA 3P4RB 3RNEC 4YSZB 1F52A 3MC8A 2KX3A 1ROEA 3VTWA 2L7RA 2K0PA 3L16A 3PV1A 1ZPSA 2MP2A 2M17A 1I7HA 2ICIA 3AEAB 2KTFA 5J2RA 3DPDA 4OZCA 3HIZA 1C79A 1JWUD 1YMHE 1ZP0B 2LVOA 3DHGC 4M00A 4LNNA 1ACCA 2KANA 3DVGY 4ICUA 3NZUA 1E7UA 4P1CC 2NTSA 3RN9C 4PYZA 2L8JA 3K9OB 2AL6A 4N59A 4I6PA 4TSSA 4F7ZA 1V9JA 2BB5A 2Y3AA 1AARA 2NS5A 2MX2A 4LLGM 3X0WA 3DWMA 1CZPA 3W1YA 3RFZB 2C7NB 1NBFC 4A55A 3QWZB 1GAQB 1E5WA 4LNFA 4W9JA 2N4FA 1TS2A 3BINA 4A3OA 1AW7A 3H7PA 3NUHB 2IO0B 1WXVA 4FA6A 4RGOS 3TBLD 3Q8BA 3HM6X 3QIJA 2KQ4X 1WJUA 4BBNF 1L4DB 1KF6B 5DPTA 2V1YA 1E7VA 3PLUA 5J18A 2Z8LA 4WH4A 3M3JA 4ZYNA 4JX1C 1FRDA 2MJ3A 2I1JA 3QQ8B 1TZOA 2EKEC 3AV8A 5DPSA 3OG5A 3B0AA 2W9NA 1XXGA 3DVNU 1PDXA 1RRBA 2CS4A 2AQ2B 3PSEB 4C7YA 1SE9A 2ZJDA 4US8A 3QK0A 1ENFA 5HFYA 2RPQA 1R4NI 2O6VA 1XLPA 3ZDMC 2JUOA 4AOFA 1J19A 5TSSA 3V60A 1MHXA 1FFUA 1L0XB 1JWAD 3NVVA 4IM3A 3H7SA 1WF9A 3M62B 5H8YE 4YTMB 1SXTA 3APCA 2MWSB 2WDVB 4PYUA 3M95A 3GE3C 1L4ZB 2J7QB 3R2IA 5DPWA 1E90A 1WZ3A 2NBUA 4MM3B 3BWUD 3MC9A 3B08A 1SJED 5G5HA 3PRZA 1V5OA 2ZVNA 4Q2JA 1UBIA 4K7UA 4OW0A 3EA6A 5EE3A 2VH2A 4RNAA 2WXNA 5I4DA 5IOIA 1TY2A 1IBXB 4FADA 1K52A 2MBBB 2GLSA 1WIAA 2JYEA 3JSVB 3PT2B 2K25A 2N9KA 1JQ4A 1SF0A 1D6EC 1SGHA 3P4PB 1FD6A 3VUXA 2Q5WD 4L2YA 1FEHA 4X57B 1OTRB 4XWTA 4WJNA 2C60A 1RM6C 3NS8A 4KZ0A 4WIPA 4ZDVA 1VZ7A 3ZJTA 3ZIMA 1P3QU 4RGTA 2KTRA 1WGYA 3X23A 3SFEB 4K7WA 1D3ZA 5G2NA 1SJHD 4ZRPA 2QC8A 3VXWA 1SB3C 2RMMA 2RGFA 2KOXA 4AJYB 4K1RB 2M19A 1ZKHA 2REXA 2BS4B 3SFDB 2KMAA 1DOXA 1KTKA 1TIFA 2Z0DB 4NJ6A 1UUPA 4WAAA 4MGIE 2CHWA 3VUYA 2IGGA 4RCOA 2AX5A 4GOCA 2NCNA 1EWYC 5DCNA 3I63C 4K7SA 1XQQA 4NAWA 3T3NA 1D5XC 4FJZA 2MQJA 4RM9A 3M63B 1HZ6A 2Y5PA 1EF1A 3Q8CA 1VZ8A 4RM8A 2WU2B 4MH0E 5HKHA 2KT7A 4K81A 1BMLC 3L17A 2K3UA 4YSYB 4FLHA 2WX0A 4IDIA 3ZXRA 3IT4B 2BF8B 3Q69A 1MG4A 2WXMA 3AU5A 1PYWD 1WGKA 4RF0A 2V4LA 2WXPA 4LTUA 2KD0A 2N9LA 2J53A 1V49A 4KV2A 3PREA 2ZZPB 2KAJA 4DDGD 5BMGA 1F2RI 1RLFA 3IXSA 3V05A 3QX1A 2FBWB 4KKJA 3CIRB 3VAWA 2KJRA 2MW5A 2KMCA 5CHFA 1H8CA 1TBEA 1KLUD 1YJJA 2WDRB 4XC2A 4RF1A 1OEYJ 3BYYB 4GLSC 3A9JA 5LXHA 1ISNA 1GC7A 2L05A 1JRPA 2INDC 2AWTA 4HLEA 1NI3A 2KYWA 2JT4B 3ZJUA 5FR3A 2HDEA 3AE2B 4J6IA 3Q3OC 2E6XA 1SE3A 1I4PA 3AEEB 3DBRI 2PE6B 4A90A 2ONQA 2D3CA 1HTQA 1HA5A 4HVBA 2O2VB 4HCNB 4HPLB 3P2BA 3SDLC 1V2YA 2OJWA 2XK5B 5IO9A 1YIWA 2JRIB 2QMTA 4BOSC 1UGMA 1L5PA 1HXYD 4KSKC 4B0MA 4K3CA 2DBYA 4BZAA 2KFJA 1YD8U 3NHEB 3U7DA 1SE4A 3R3MA 2CU3A 3DOWA 2DYMA 4DWFA 4OVVA 2KK8A 1WXSA 2YEPF 3MJWA 2NTTA 4BVUC 2DHZA 5E6PA 1S1QB 4S0RA 3VFKA 2WXKA 4B6WA 3LJ3A 3WAPA 3ZDTA 4PS3A 3N30A 2INPE 5D7GA 2QILA 2L1AA 3PRPB 2K8CA 2XEWA 3AN1A 1WGDA 2RDBC 5IP4D 4AUQC 2INCC 4EFOA 3GOEA 3TSSA 1YN4A 2G4SA 1SIFA 2PJHA 1AN8A 2KN4A 3NZ3A 3Q3JA 3WAOA 1C3TA 2MEKA 2HJ1A 3AH7A 3IBEA 5LLIA 4ZRJA 1EUVB 4EZLA 3BK2A 3CMMB 3DVGX 1IGCA 4REZA 3ZXVA 1P0RA 3RT3B 4KDIC 4IG7B 3SEBA 1E0ZA 1QOGA 3WCQA 3LXFA 4JIOU 4W9GA 2GBMA 4IUMB 4WWNA 1B1ZA 1GOZA 4UDUC 3VRBB 3QAQA 1DOIA 1EU3A 2WNMA 4KIKB 5J17A 3N1ZC 3ZO5B 2YEPB 2DZJA 1V1OA 1P7FA 4KX6B 3ZNGC 1P98A 1VR9A 3U2SC 1UF0A 3PZ7A 2FAZA 2KVZA 2RSUA 3CF6E 1M4VA 1DOYA 3UQAA 2LHDA 4GXBA 2BTEA 4MSMB 4USAA 3ALBA 1N5XA 3R2TA 4P7IA 3TEYA 1YJ1A 2FCSA 4W9KA 4JL9A 5EE9A 3A9KB 2KDIA 3MFGA 2ZVOA 2KDBA 2HTHA 1Q10A 1V81A 4FHKA 3DVNV 4ZHPA 2KFKB 2C7MB 4L23A 2JSVX 3MP9A 2J52A 3N3KB 1X1MA 1SE2A 2XN9C 5IA7A 1RFAA 1E6EB 1MFWA 1NI2A 2OHFA 2Y5BB 2H89B 1E8XA 3A9KA 2LI5A 5IAAC 2IGDA 1TKEA 5C2TB 3HRDD 4BOZB 1JCKB 4HKZE 2KJHB 1V1PA 3LDZE 1L6VA 2LVPA 1B9RA 1C76A 1MI0A 1SSNA 2C7HA 2PPHA 4ZOHC 1Q5WB 4XDCA 1JMLA 2RR9A 1EWCA 3BVGA 3CSFA 2WHIA 4BBNC 4LK0M 1CQVA 1VDVA 1T0QC 1UGJA 4OHJA 2EMSA 2NPTA 4JE3B 1GNUA 4D2KA 2DYBA 4KGSA 4WURA 1V97A 1XLOA 3KYDD 3RNAC 3TIXA 4H2AA 2KO3A 3RPFC 3AE3B 3RCZA 4BKSD 4PT5A 1P7EA 1E8YA 2N9XA 3BZDB 4MJSB 3C8YA 3Q6BA 1GB1A 2K39A 2BS3B 3J9CA 2FUHB 5EDSA 2JWZA 3UQBA 2KKCA 3FILB 3CWIA 4L1BA 2L0TA 4TV3A 1YQ4B 1FCLA 1NENB 1WJ6A 3NVZA 2HD5B 1YN3A 3Q8EA 2IDYA 3OWEB 1E8ZA 2WXHA 2BYFA 2MHJA 3AE8B 3QCAA 3IFWB 5E6JA 2GOWA 3O65B 2D3GA 3MTNB 2JX5A 1E8WA 3TJPA 4KGRA 3KWLA 2MRPA 1FXTB 3VR8B 4ASWC 2LMCA 4RFBA 2L00B 3EFUA 2AQ3B 3AMZA 4M8MA 4DXGA 3TEZA 3V3XA 3KUZA 3SHQA 1YOVB 4IWPA 1XT9B 3DHIC 5GXGB 1WMHB 3D32A 2M4NA 2PW9A 2G1EA 1TT5B 4GDLB 1WY8A 2WDTB 2KWUB 3IVFA 1IGDA 2DYOA 1C78A 1LQBA 2KLCA 4ICVA 4ITKA 2PKOA 3H8HA 1YJIA 1OQYA 3BK1A 1WM2A 4AP4C 2WP9B 1SIJA 1UH6A 4IWQA 4F1SA 1LO5D 5H92C 2EKIA 2PEAA 1TY0A 3PZ8A 5HG2A 2UYZB 2MJDA 2VZKD 4PK1A 1FFVA 4ZRIA 2W82A 4C56C 3ML8A 5L83A 3W1SC 3AXCA 2QDFA 1MJDA 4E3CA 3MHZA 1WGHA 1OEYA 1V5TA 5FK9C 4M8NA 2W54A 5FKAC 2WS3B 3ZGZA 1CJEA 3Q14C 1LXDA 1PQSA 4IW0A 3NG0A 2K5PA 2FIFA 4KDLB 1D5ZC 2PVGC 3PZDA 1UWMA 3FAHA 1I4QA 2G3QB 2JRHA 4MM3A 3SR6A 5IN7A 4DHZE 5EE0A 2KNBA 5D2MB 4DHZB 1ZUD2 4MH8A 4BAXA 3K9PB 2UWQA 3T3OA 4DDID 4MDKE 2NBWB 1PGAA 2ZPYA 3ABVB 3NY5A 5AUIA 1FM0D 4HKQA 1IBXA 3C19A 4GMVA 1T5XD 2BB6A 3R7RA 2I38A 3JSVA 3IT6B 2ZNVB 3JW0X 2L76A 1H4RA 3B9JA 2J4XA 1NYRA 1J0GA 1L2NA 4S17A 2WXGA 3GS2A 4HROA 4YTNB 4LJOB 2DZIA 1U4AA 1OQQA 2KZRA 3KLSX 1T0RC 1GB4A 2KC1A 1D4BA 3BIID 4XE0A 2LJIA 1WX9A 4NY0A 5G5GA 3RULA 1SBBB 2INNE 1A70A 4KGTA 4E71A 3U30A 2MA9B 1FIQA 1FNUA 3AEDB 2LVQA 1WZ0A 4LDTD 2L3ZA 4GSWA 4JWUC 1I42A 3Q3FA 1WXMA 1K8RB 3AE5B 5DPRA 2CJNA 1TTNA 4A9AA 3R66C 3DHHC 3Q2AC 1M94A 4IM0A 3AB5A 2JYTA 2WDQB 2RDGA 4GN1A 2JQRB 1VJKA 2NR2A 3PPAA 4HWIB 3Q3NC 4GDKB 4YSXB 1YQBA 4URKA 2L83A 1HTOA 2N7DA 1K51A 2KVRA 4YL8A 3URYA 2LGIA 4OVUA 5D94A 4M0WB 4RGMA 4FXCA 4TQ1A 4ZRKA 2KLGA 2ZPNA 3T9LA 2V3PA 3OJ4B 1UNSA 2R2QA 2AQ1B 1WFYA 2GBNA 2B76B 4HEA1 4R3DA 3DBHB 3MC0B 4YWGG 3RUIB 4MGYE 2JZPA 4LJPB 3R7QA 4A6QA 4ANUA 3EUB2 2IZVB 4GU2A 2VZKB 2LEKA 2JPHA 4KZCA 5D3DA 3W1SA 4ANWA 1ESFA 2DZMA 2WQYB 3DBLB 3NZSA 2MBQA 5AZFA 1I4RA 5BYSA 3ZNHB 3T8MA 1WGGA 2MJEA 1YN5A 1WX7A 2LWPA 1VRAB 2K6DB 2LHEA 3AM9A 4XYCA 2LGSA 1WM3A 1F77A 4RMAA 4WWOA 3AE1B 2PMVA 3PRMB 3TUOA 3PHWB 1CMXB 1K50A 2LUMA 2N7EA 3TEWA 3WANA 2HE7A 3IAS1 1LFDA 2N0SB 1I4XA 2O2VA 2ACZB 3EC8A 4YT0B 2CHZA 2W3RA 3GP7A 3MJ5A 2CJOA 3U7ZA 1F1HA 4EOYA 1P1AA 2XK5A 4WWPA 3ONSA 4NPNA 3H9DA 5CHWA 2L0FA 4TQ0A 2ZCBA 4MGZE 3ETRA 2JU6X 3NJTA 2N9EB 1PFDA 2BKFA 4MEMA 1HQRD 3KUDB 1S3SG 2ZW0A 1IYFA 2HTME 2LASA 5HI1A 1C9FA 3A1QB 2G4DB 2WLBA 3L10B 5G55A 4MACA 2IO2B 3H1UA 2MLBA 1UZXB 4JQWC 2JY6A 1WE7A 4RGNA 2EMTA 3HVDA 2LZ6A 4P6VF 2D07B 4LDTB 4M01A 1GJZA
chains in the Genus database with same CATH topology
3P4SB 1V97A 3P42A 4MM3B 1XLOA 3BWUD 4H2AA 1SJED 5G5HA 3RPFC 3AE3B 4Q2JA 4M0WA 4PT5A 1P7EA 1QF6A 3BZDB 3L4PA 4OW0A 1KRHA 3AEGB 1MHHE 3C8YA 3EA6A 3UI3A 3BVMA 4P16A 4RNAA 5EE3A 1AYFA 1GB1A 1MPEA 2WXNA 1YNTE 5I4DA 1TY2A 4XWWA 1XCTL 2BS3B 3J9CA 4IKGA 4NJCA 1TKGA 1IBXB 2MH7A 1K52A 5JXVA 2L32A 1CK1A 3FILB 2JYEA 3CWIA 4L1BA 2N7JA 1YQ4B 2N9KA 1FCLA 1NENB 1D5MC 3NVZA 4A8XC 1JQ4A 2XNAC 1SF0A 1YN3A 3Q8EA 4NZLB 5BMHA 1FMAD 1D6EC 2IDYA 3P4PB 4RH6A 1FD6A 4DXFA 3OWEB 2BBCA 2TSSA 2M56B 2Q5WD 2WXHA 4L2YA 1FEHA 3P63A 1JWBD 3DWGC 2IGHA 1JALA 3AE8B 4XWTA 1IUEA 1RM6C 3BYTB 1HZ5A 1F0ZA 5T8IA 1WYGA 2V0GA 1J7BA 5E6JA 1WXQA 4WIPA 3ZJTA 1VZ7A 4WAFA 4RGTA 3TEXA 2EELA 1FRRA 1RWSA 3FC4A 3SFEB 2JX5A 4KGRA 3I9V1 2IJ0A 3ZQ4A 1N63A 3KWLA 4WQMA 1SJHD 2BT6A 4ZRPA 3VR8B 1SB3C 2RMMA 1N60A 2M19A 2LMCA 4RFBA 2BS4B 3SFDB 4DXGA 2AQ3B 3AMZA 3TEZA 3V3XA 1ZOYB 2V3NA 1DOXA 2WXFA 2QSDA 4TMAB 4YXDB 1KTKA 3GB1A 2KWDA 5BYRA 1UUPA 1XO3A 1MVKA 2GB1A 1ZDVA 1BUIC 2IPKD 5GXGB 2PW9A 2BYTA 2G1EA 1ZDXA 2IGGA 4GDLB 4RCOA 2AX5A 3P4QB 2W3SA 1FCCC 1EWYC 1IGDA 2DYOA 4WWMA 1C78A 4ITKA 2WXQA 2PKOA 3T3NA 2ON8A 4ZYSA 1D5XC 1XLNA 3H8HA 1YJIA 1N5WA 1RYJA 3BK1A 1VZ6A 1HZ6A 1SIJA 1QKZA 1XCQL 2WP9B 3W9CB 2Y5PA 3Q8CA 1LO5D 1VZ8A 2WU2B 5H92C 1JW9D 2EKIA 1TY0A 3PZ8A 5HG2A 4ZHOA 4HJGE 4ZRQA 5HHDG 2SAKA 2MJDA 2VZKD 1BMLC 1FFVA 4EE2A 2K3UA 1KH0A 2W82A 4OZAA 4YSYB 4C56C 3NRZA 1ZXIA 4IDIA 4ARIA 1OFFA 3IT4B 3Q69A 2SEBD 2WXMA 3E9SA 5D3IB 3MHZA 1PYWD 1WGKA 4RF0A 1XEEA 2WXPA 4LTUA 5FK9C 1I4GA 2W54A 5FKAC 2K22A 2N9LA 2WS3B 2J53A 4WURA 3ZGZA 2KAJA 1OQRA 2PIAA 3ZYYX 1CJEA 5BMGA 1F2RI 2WXOA 3IXSA 3V05A 1J7AA 1ZE3D 2FBWB 5C3JB 1XF5L 4KKJA 3CIRB 1JROA 2K5PA 1D5ZC 2BW2A 2PVGC 3AE9B 1UWMA 2WXLA 3FAHA 1I4QA 3NVYA 1KLUD 1YJJA 1GPXA 2K9XA 2WDRB 3SR6A 3PO0A 4J3OD 5EE0A 1ZUD2 4MH8A 4RF1A 4B0EA 3BYYB 3I57A 4GLSC 3VQIA 4IOIE 1FO4A 3W5UB 3T3OA 1QOBA 1QOAA 4DQOC 2W55A 2BS2B 1JRPA 3AE6B 1BXTA 1PGAA 3ABVB 5AUIA 1FM0D 1DYQA 1NI3A 1QT9A 1Y56A 3AE7B 1FNVA 2PLPA 3KQ4A 3ZJUA 1RFKA 4HKQA 1STEA 2HDEA 5FR3A 1IBXA 4OVZA 3AE2B 3O13A 1T5XD 2BB6A 2JWUA 1C4CA 3FILA 2E6XA 1SE3A 4N6EB 2I38A 3U4EG 1I4PA 1K53A 3AEEB 3IT6B 5BYQA 2OEDA 3NVWA 4A90A 2NMQA 2ONQA 1N61A 3B9JA 1HA5A 3LB8C 4MT5A 2J4XA 1NYRA 2WXGA 5LNK1 3GS2A 4HROA 1FXIA 4YTNB 5EE1A 2FE8A 1C4PA 1JWSD 3AEFB 4OZBA 1OQQA 1KFYB 3KLSX 1EM7A 3Q8FA 1E7PB 1GB4A 1C77A 3ZJVA 3P1MA 1D4BA 3BIID 4XE0A 4CQNA 1PGBA 3AE4B 2QMTA 2LJIA 4ARCA 1DGJA 1L5PA 1TS3A 2QIEB 1HXYD 2E3TA 4HRSA 1HEZE 4KKIA 4B0MA 5G5GA 2DBYA 1NVID 1SBBB 2INNE 3AECB 3LYYA 4US9A 2Y5CA 1A70A 3E56A 4KGTA 1V1PB 1FIQA 1FNUA 3HUIA 3AEDB 1TJEA 3KWVA 4JWUC 1SE4A 2DLBA 2GI9A 2CU3A 1KLGD 3AE5B 2DYMA 2CJNA 1WSPA 1ET9A 4A9AA 1XLQA 3NS1A 1L0YB 1QQRA 2FUG1 1N62A 5MPOA 2YEPF 2NTTA 3AB5A 2JYTA 1EU4A 2WDQB 2KMMA 2RDGA 4JWSC 3VRAB 2JQRB 1VJKA 2WXKA 4C7ZA 2R61A 1I4HA 1WRIA 1E10A 3B2FA 1PUTA 4GDKB 2INPE 5D7GA 4YSXB 1NEKB 1JWMD 2L83A 2QILA 2G9HD 2L1AA 1K51A 2L52A 2PVOD 1QOFA 3URYA 5BMIA 3AN1A 1QLBB 2D5GA 2H88B 2LGIA 2V4IB 4C80A 2X38A 4RGMA 1T3QA 1PGXA 4FXCA 3B2GA 4TQ1A 3P4RB 3TSSA 1YN4A 1AN8A 2KN4A 3NZ3A 4YSZB 2V3PA 1WWTA 2WXJA 1UNSA 4AQ7A 2J42A 1ROEA 2AQ1B 2MEKA 4XDDA 2K0PA 3AH7A 2B76B 4HEA1 4R3DA 1ZXHA 1ZPSA 3MC0B 4YWGG 2PTLA 3BK2A 2JZPA 2KDMA 1L0VB 1I7HA 2ICIA 3AEAB 4A6QA 3EUB2 1IGCA 1J7CA 4REZA 4NAMA 4OZCA 1C79A 1JWUD 1YMHE 1ZP0B 2VZKB 3SEBA 2LEKA 1ACCA 5D3DA 3W1SA 1E0ZA 1QOGA 1ESFA 2WQYB 3WCQA 3LXFA 2I2YA 2NTSA 1I4RA 5BYSA 2GRIA 4N59A 3HVZA 1UWXA 1QILA 4TSSA 3AEBB 1B1ZA 2MJEA 1GOZA 1YN5A 2BB5A 2Y3AA 4UDUC 1TS5A 3VRBB 2RPVA 1NYQA 1DOIA 1EU3A 2WNMA 1TYGB 1VRAB 4LLGM 3DWMA 2LHEA 1CZPA 3AM9A 2YEPB 1F77A 2JXTA 1V1OA 5AUKA 1P7FA 4KX6B 3RFZB 2RDHA 1VR9A 2QEJC 2WU5B 3AE1B 1ET6A 2PMVA 3U2SC 4A55A 1GAQB 1TS4A 2QJLA 3PZ7A 3TUOA 1TS2A 1AW7A 3NUHB 1K50A 2LUMA 1M4VA 3TEWA 1R7SA 3Q8AA 1DOYA 2BTEA 2LHDA 4RGOS 4USAA 3Q8BA 1N5XA 3EGRA 3W2DA 3IAS1 3R2TA 2KQ4X 3TEYA 3BVZA 2N0SB 5EE9A 1L4DB 1KF6B 3MFGA 1I4XA 3W5VB 1Q10A 1TKYA 2ACZB 1AWDA 4YT0B 2Z8LA 3U52E 2W3RA 1L6UA 3GP7A 4WH4A 3MJ5A 2CJOA 4JX1C 4YTPB 3U7ZA 1FRDA 1T6BX 2MJ3A 4ZHPA 4L23A 3R8BA 2JSVX 3MP9A 1TZOA 4NAWB 2DWQA 2J52A 3AV8A 1SE2A 2XN9C 1E6EB 4TQ0A 1XXGA 2OHFA 4JPSA 1PDXA 2H89B 3ETRA 2JU6X 1YQ3B 2IGDA 2M0AA 1TKEA 5C2TB 3HRDD 1JCKB 1PFDA 4HKZE 2AQ2B 1C4AA 1E9MA 1HQRD 1V1PA 1SEBD 2KACA 2WXRA 2ZW0A 1FXAA 2HTME 4C7YA 1V8CA 1L6VA 5HI1A 4US8A 1B9RA 2ZW1A 1C9FA 1C76A 1ENFA 5HFYA 1MI0A 1SSNA 1XLPA 3N9YC 2WLBA 4N58A 4ZOHC 4MACA 5TSSA 4XDCA 1JMLA 2WXIA 1MHXA 1FFUA 1L0XB 1EWCA 1JWAD 3BVGA 3NVVA 4RGNA 5H8YE 4YTMB 4AS1A 1SXTA 1VLBA 4LK0M 3IAM1 2WDVB 1CQVA 1VDVA 3HVDA 1UGJA 4P6VF 4OHJA 1F2RC 1L4ZB 2LFIA 4JE3B 4O1NA 4D2KA 3VR9B 4KGSA 3R2IA 1FNWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3HVZ A;  2PKO A;  1E7P B;  1V97 A;  3P4S B;  1XLO A;  3AEB B;  3P1M A;  2MJE A;  1XLN A;  1YJI A;  1N5W A;  3BII D;  1RYJ A;  3AE4 B;  5G5H A;  3VRB B;  1NYQ A;  1DOI A;  3RPF C;  2WP9 B;  1DGJ A;  1TYG B;  1SIJ A;  3DWM A;  3W9C B;  1L5P A;  3AE3 B;  1CZP A;  2QIE B;  2E3T A;  3AM9 A;  4HRS A;  1QF6 A;  5G5G A;  2DBY A;  2WU2 B;  5H92 C;  1JW9 D;  2EKI A;  3L4P A;  4KX6 B;  5AUK A;  1KRH A;  3AEG B;  1NVI D;  3AEC B;  4US9 A;  4ZHO A;  5EE3 A;  2Y5C A;  1A70 A;  1AYF A;  2WU5 B;  3AE1 B;  2MJD A;  1FFV A;  1GAQ B;  1FIQ A;  3HUI A;  3AED B;  1TJE A;  4YSY B;  2BS3 B;  2QJL A;  1ZXI A;  3NRZ A;  4N59 A;  1TKG A;  4JWU C;  4IDI A;  2MH7 A;  1OFF A;  2CU3 A;  3AE5 B;  1R7S A;  1DOY A;  2CJN A;  3CWI A;  4A9A A;  1WGK A;  4USA A;  1XLQ A;  3NS1 A;  4LTU A;  1N5X A;  1YQ4 B;  1NEN B;  2W54 A;  1N62 A;  2K22 A;  3NVZ A;  5MPO A;  1JQ4 A;  1SF0 A;  3AB5 A;  2WS3 B;  2N0S B;  5EE9 A;  1KF6 B;  1FMA D;  1OQR A;  2KAJ A;  2PIA A;  1CJE A;  2WDQ B;  2KMM A;  3P4P B;  4JWS C;  3ZYY X;  3W5V B;  1J7A A;  3VRA B;  2JQR B;  2FBW B;  1TKY A;  2ACZ B;  1AWD A;  4YT0 B;  5C3J B;  1VJK A;  2M56 B;  2Q5W D;  2W3R A;  3CIR B;  1L6U A;  1JRO A;  2K5P A;  3P63 A;  2CJO A;  2PVG C;  4JX1 C;  1JWB D;  1FRD A;  4YTP B;  3DWG C;  2MJ3 A;  1JAL A;  3AE9 B;  1UWM A;  3AE8 B;  3FAH A;  4C7Z A;  4ZHP A;  1WRI A;  1E10 A;  1IUE A;  1RM6 C;  3B2F A;  3NVY A;  1PUT A;  1YJJ A;  1F0Z A;  2DWQ A;  2K9X A;  1WYG A;  2WDR B;  3AV8 A;  3PO0 A;  3SR6 A;  1J7B A;  4YSX B;  1NEK B;  2L83 A;  1WXQ A;  5EE0 A;  1ZUD 2;  1E6E B;  2L52 A;  1QOF A;  2PVO D;  2OHF A;  3AN1 A;  1PDX A;  1QLB B;  2H88 B;  2H89 B;  1FRR A;  1FO4 A;  1RWS A;  3ETR A;  3W5U B;  4C80 A;  1T3Q A;  1QOB A;  3FC4 A;  3SFE B;  1QOA A;  1YQ3 B;  2JX5 A;  1TKE A;  2W55 A;  2BS2 B;  4FXC A;  1JRP A;  3AE6 B;  3B2G A;  3HRD D;  5C2T B;  1PFD A;  1N63 A;  3P4R B;  3KWL A;  4WQM A;  1E9M A;  3ABV B;  2BT6 A;  5AUI A;  1FM0 D;  1NI3 A;  1FXA A;  1QT9 A;  2HTM E;  3VR8 B;  4C7Y A;  3AE7 B;  1V8C A;  1L6V A;  1SB3 C;  4YSZ B;  1RFK A;  4US8 A;  1N60 A;  1B9R A;  1GPX A;  1WWT A;  2M19 A;  3AE2 B;  1ROE A;  2BS4 B;  3SFD B;  3AH7 A;  3AMZ A;  2B76 B;  1XLP A;  4N6E B;  1ZOY B;  1DOX A;  2WLB A;  3AEE B;  4YXD B;  4N58 A;  4ZOH C;  3NVW A;  1L0V B;  1I7H A;  3AEA B;  1XO3 A;  3EUB 2;  1FFU A;  1J7C A;  1N61 A;  1JWA D;  3B9J A;  5GXG B;  3LB8 C;  3NVV A;  1NYR A;  2G1E A;  5H8Y E;  4YTM B;  1ZP0 B;  1VLB A;  2AX5 A;  2LEK A;  2WDV B;  1VDV A;  3P4Q B;  1E0Z A;  2W3S A;  1QOG A;  4HRO A;  2WQY B;  4P6V F;  1FXI A;  3LXF A;  4YTN B;  5EE1 A;  3WCQ A;  1EWY C;  4WWM A;  3AEF B;  4ITK A;  3VR9 B;  1OQQ A;  1KFY B; 
#chains in the Genus database with same CATH topology
 4DXA B;  3I3T B;  3CST A;  2C9W B;  1QZE A;  4C4V B;  1F9J A;  2LRW A;  3L4P A;  3AEG B;  2BYV E;  3BVM A;  1MPE A;  2KDF B;  1YNT E;  2GBR A;  3GE8 C;  4XWW A;  4IKG A;  4NJC A;  1TKG A;  3MHS D;  2MH7 A;  2DAF A;  4G3X B;  3VTU A;  3RMK C;  4BKT A;  1WH3 A;  2N7J A;  1LGR A;  4B9K A;  4JLC A;  1D5M C;  4A8X C;  2UU7 A;  4NZL B;  1R4M I;  1FMA D;  4DXF A;  4C00 A;  5E6O A;  2M56 B;  4TKN A;  3DWG C;  3UGB B;  2D2Q A;  2M1M A;  1HZ5 A;  5KHQ A;  1WYG A;  2O6V D;  2M0X A;  2LRU A;  3VUW A;  4AJW A;  2IO3 B;  3AUL A;  4WAF A;  4KIK A;  2EEL A;  2VRR B;  4EKU A;  3FC4 A;  1KJT A;  1N6Z A;  4FHJ A;  3I9V 1;  4GGQ A;  4HJK A;  2BT6 A;  3UIO B;  3PGE A;  1N60 A;  3V6C B;  2IY0 B;  1T0S C;  4HPP A;  3C0R B;  1ZOY B;  2V3N A;  3BY4 B;  2WXF A;  3N1X C;  4AWJ A;  3GB1 A;  2DEN B;  2KWD A;  5BYR A;  1XO3 A;  1Z2M A;  4M02 A;  1ZDV A;  1BUI C;  2FCM A;  2IPK D;  1ZDX A;  2D10 A;  4II2 B;  2W3S A;  5JZE B;  1FCC C;  1KLV A;  4WWM A;  2NVU I;  2KFK A;  1GUA B;  2B3A A;  2IBI B;  2ON8 A;  2LD9 A;  1XLN A;  1QKZ A;  1XCQ L;  3W9C B;  5FR6 A;  4PS7 A;  4W9E A;  3GZN B;  4ZHO A;  4IM2 A;  4E74 A;  4ZRQ A;  4K3B A;  1TZ1 A;  5HHD G;  2SAK A;  2RD0 A;  1XD3 B;  3PTF C;  4EE2 A;  1KH0 A;  1FPY A;  1JRU A;  4ARI A;  1OFF A;  2MBE A;  2DX5 B;  2N9P C;  2SEB D;  3U8Z A;  4W9C A;  1XEE A;  2MP2 B;  3H6N A;  4JGH B;  2D11 A;  4BKG A;  2PIA A;  1V80 A;  2K8B A;  1J7A A;  1ZE3 D;  5C3J B;  1I35 A;  4N9F 4;  2BW2 A;  3NOB A;  2K6Q A;  3AE9 B;  2WXL A;  3ZVV A;  3NVY A;  3DQV A;  3PO0 A;  5CHV C;  4NQK E;  4IOI E;  1FO4 A;  2JF5 A;  3W5U B;  2BWE S;  1QOB A;  2ZNV C;  2W55 A;  3AE6 B;  4MJS A;  1BXT A;  1R4M B;  3VDZ A;  1QT9 A;  3L0W B;  2PLP A;  5IKC M;  3KQ4 A;  1RFK A;  1STE A;  3H7P B;  2AL3 A;  1L7Y A;  3EEC A;  3O13 A;  2JWU A;  1C4C A;  2X8X X;  3FIL A;  4N6E B;  2Z59 B;  5BYQ A;  3KYC D;  1N61 A;  2JXX A;  3ECI A;  3LB8 C;  3PHX B;  3ZRC A;  3IG3 A;  5LNK 1;  5KHO A;  4PS8 A;  3AI5 A;  1JWS D;  5AZH A;  3QA8 A;  4OZB A;  4W9D A;  1KFY B;  1EM7 A;  4WJP A;  1E7P B;  2BPS A;  3N32 A;  1C77 A;  3ZJV A;  3P1M A;  4CHK A;  2JVC A;  1PGB A;  4ARC A;  1DGJ A;  1TS3 A;  4HRS A;  2FNJ B;  3Q3M C;  1HEZ E;  3IHP C;  1GC6 A;  3EHV A;  1NVI D;  2KDE B;  4US9 A;  4HDQ A;  5C1Z A;  3HM3 A;  3VH4 B;  3ZTC A;  3KWV A;  2HJ8 A;  2DLB A;  4W9I A;  1P9D U;  2O6V B;  1TGZ B;  1XLQ A;  3NS1 A;  1QQR A;  3I5J C;  2FUG 1;  1N62 A;  1V86 A;  1EU4 A;  4NNJ B;  3ZW3 A;  2LGX A;  1WMH A;  1WX8 A;  2KMM A;  4GDL A;  1C1Y B;  2OOB B;  1G6J A;  4KSL C;  2PE9 A;  1I4H A;  1WRI A;  4WJO A;  3B2F A;  4B95 A;  1PUT A;  2IYD B;  4DHJ D;  1JWM D;  2M8S A;  5BMI A;  1QLB B;  2D5G A;  2H88 B;  3ML9 A;  2V4I B;  4C80 A;  3SD5 A;  2LGD A;  1UEL A;  4NQL B;  2JZ3 B;  1GG3 A;  2MSE D;  1WWT A;  2WXJ A;  4AQ7 A;  4DK5 A;  2J42 A;  3DBH I;  4XDD A;  1ZW7 A;  1ZXH A;  2V9H A;  2PTL A;  3A33 B;  3AU4 A;  3RYT A;  2KDM A;  1L0V B;  2IY1 B;  2WYQ A;  3ZUN A;  1J7C A;  2IO1 B;  4NAM A;  3DBL I;  2I2Y A;  4G0N B;  2CKH B;  3TL5 A;  2D3B A;  2J0K A;  2KQS A;  2GRI A;  3N20 C;  3HVZ A;  1UWX A;  1QIL A;  3RNF C;  3AEB B;  2KC2 A;  3JVZ X;  2WGS A;  1WE6 A;  1TS5 A;  2ZEQ A;  2RPV A;  1NYQ A;  2LXA A;  1TYG B;  2KTR B;  4LNI A;  4W9F A;  1YX5 B;  2JXT A;  4G11 A;  5AUK A;  3WAL A;  3WAM A;  2KWV B;  2RDH A;  2QEJ C;  2WU5 B;  1ET6 A;  1TS4 A;  1WGR A;  2FID A;  4KVG B;  2QJL A;  1OGW A;  4IC7 B;  3OLM D;  3RZF A;  1R7S A;  3Q8A A;  2KQ7 A;  3APF A;  3HK0 A;  3EGR A;  3W2D A;  4BKS A;  2N1V A;  4XGA B;  1WJN A;  2AYO B;  3BVZ A;  3EFC A;  4ACF A;  4I6N B;  3W5V B;  1TKY A;  1AWD A;  2KXJ A;  3U52 E;  2BKR B;  3RNG C;  1L6U A;  4YTP B;  1T6B X;  2QHO A;  3VTV A;  3R8B A;  3KUC B;  4NAW B;  2DWQ A;  3A4S C;  4HDO A;  1EO6 A;  5GMV A;  3N1Y C;  4A20 A;  4JPS A;  4MEL A;  3ZKJ C;  1YQ3 B;  2M0A A;  2FCQ A;  1C4A A;  1E9M A;  1VCB A;  1SEB D;  5BO4 B;  2KAC A;  2WXR A;  4GB9 A;  1FXA A;  4HK2 A;  1V8C A;  2ZW1 A;  1Q1O A;  2XBB C;  2C5L C;  4W9H A;  5LXI B;  3N9Y C;  3ZLZ A;  1R4N B;  5L95 C;  4N58 A;  2LJ5 A;  3WA0 A;  3KH0 A;  2WXI A;  3OJ3 A;  3S2A A;  4IWO A;  2ASQ A;  2I1K A;  4AS1 A;  2YLM A;  5CTR C;  1VLB A;  2K8H A;  3IAM 1;  1WR1 A;  1F2R C;  2LFI A;  4O1N A;  3UIP B;  3VHT C;  3VR9 B;  2BGF A;  1FNW A;  3B1L X;  3P4S B;  4GDK A;  3PLV A;  3P42 A;  1J8C A;  3UF8 A;  3A9J B;  4M0W A;  1QF6 A;  3KVF B;  1KRH A;  1MHH E;  3UI3 A;  4P16 A;  3VVW B;  1AYF A;  1VD2 A;  1YX6 B;  2DZK A;  2GBK A;  1XCT L;  2VH1 A;  3TCA A;  5JXV A;  2L32 A;  4MGK E;  4NJ7 A;  1CK1 A;  2K1F A;  4DHJ B;  2MBO A;  4F8C B;  2AEH A;  2BYE A;  2XNA C;  2N1W A;  5BMH A;  4II3 B;  1A5R A;  4RH6 A;  2BBC A;  4EZK A;  2TSS A;  3P63 A;  4WJQ A;  1JWB D;  2IGH A;  1JAL A;  2KJ6 A;  1IUE A;  3BYT B;  4CO7 A;  1F0Z A;  5T8I A;  2V0G A;  1J7B A;  1WXQ A;  1BT0 A;  3TEX A;  5JHA A;  1WXA A;  4ANV A;  4MSQ B;  1FRR A;  1RWS A;  1WJ4 A;  1IPG A;  3QAR A;  5C23 A;  2IJ0 A;  4A3P A;  3ZQ4 A;  1N63 A;  4WQM A;  2R2O A;  5JHB A;  4G50 A;  3QHT A;  3ZNZ B;  3RNB C;  2QCZ A;  3FKY A;  4HPM B;  4WQO B;  2QSD A;  4TMA B;  4YXD B;  3DCG A;  4FN2 A;  4XZ4 A;  3L13 A;  3TMP B;  1T0Y A;  4HXD A;  1MVK A;  2GB1 A;  4FBJ B;  2BYT A;  3DDC B;  3P4Q B;  2DAJ A;  2LXC A;  2V3S A;  2WXQ A;  3V62 A;  2JZZ A;  4ZYS A;  3SU8 X;  1Q0W B;  1N5W A;  1RYJ A;  1VZ6 A;  5AEK B;  1UD7 A;  2BWF A;  3PS6 A;  2CHX A;  3VH3 B;  3GZN I;  4BFR A;  1JW9 D;  1KM7 A;  4LCD E;  5D6J B;  4HJG E;  2KHW B;  1WR6 E;  4OZA A;  1LM8 B;  3NRZ A;  1IP9 A;  1ZXI A;  2OJR A;  1HE8 A;  2CU1 A;  3A1Q A;  3A4R A;  3E9S A;  5D3I B;  3ZRF A;  3DBS A;  1I4G A;  2Z0E B;  3QC8 B;  3OAW A;  2K22 A;  2FCN A;  4EUT A;  3QJZ A;  4FUL A;  4EZJ A;  1OQR A;  3ZYY X;  2WXO A;  1XF5 L;  4QAY A;  3RD2 A;  2J0M A;  3L08 A;  1JRO A;  2ZCC A;  4LNO A;  1EF5 A;  1GPX A;  2K9X A;  2A4Z A;  2DNF A;  3JYU A;  4J3O D;  3PVL A;  4B0E A;  2D3A A;  3I57 A;  3VQI A;  3WIM A;  3HHM A;  4P1B C;  2A5U A;  4C4V A;  1QOA A;  1V6E A;  4DQO C;  4CYE A;  2BS2 B;  3KW5 B;  4EEW A;  5CX3 A;  1DYQ A;  1Y56 A;  3AE7 B;  3V6E B;  2WWZ A;  1FNV A;  1WI0 A;  4OVZ A;  3UIN B;  4W9L A;  4HCP B;  3U4E G;  5E6N A;  1K53 A;  3RI7 C;  2KX0 A;  2OED A;  3NVW A;  2NMQ A;  3DBR B;  3RZW C;  2BVC A;  4XX5 A;  2NBV B;  4MT5 A;  2J0J A;  2CR5 A;  1FXI A;  5EE1 A;  4ANX A;  2FE8 A;  1C4P A;  3AEF B;  3Q8F A;  5JH5 C;  1ZGU B;  4CQN A;  3AE4 B;  2QIE B;  2E3T A;  4KKI A;  4LNK A;  3LYY A;  3AEC B;  1Z5S B;  4FJY A;  2Y5C A;  4TUU A;  1WYW B;  3E56 A;  1V1P B;  4DBG A;  1MG8 A;  3HUI A;  1TJE A;  1WRD B;  5AZG A;  2GI9 A;  1KLG D;  2MBH A;  2KWC A;  1WSP A;  1ET9 A;  3RNC C;  1L0Y B;  2G45 B;  1Y8R C;  2GBJ A;  5MPO A;  3ENE A;  2YVC A;  3ZTD A;  4JWS C;  1KOT A;  4GIV A;  3VRA B;  1RAX A;  5TR5 A;  4I6L B;  1UBQ A;  4FJV B;  2WX1 A;  2NPT B;  2KN5 A;  4C7Z A;  3L54 A;  2R61 A;  1E10 A;  2MCN B;  1NEK B;  3APD A;  2G9H D;  2L52 A;  2PVO D;  1QOF A;  2GMI C;  2LUE A;  2LGY A;  2X38 A;  1T3Q A;  1NDD A;  1PGX A;  3V61 A;  3ZNI D;  3B2G A;  2BQQ A;  3P4R B;  3RNE C;  4YSZ B;  1F52 A;  3MC8 A;  2KX3 A;  1ROE A;  3VTW A;  2L7R A;  2K0P A;  3L16 A;  3PV1 A;  1ZPS A;  2MP2 A;  2M17 A;  1I7H A;  2ICI A;  3AEA B;  2KTF A;  5J2R A;  3DPD A;  4OZC A;  3HIZ A;  1C79 A;  1JWU D;  1YMH E;  1ZP0 B;  2LVO A;  3DHG C;  4M00 A;  4LNN A;  1ACC A;  2KAN A;  3DVG Y;  4ICU A;  3NZU A;  1E7U A;  4P1C C;  2NTS A;  3RN9 C;  4PYZ A;  2L8J A;  3K9O B;  2AL6 A;  4N59 A;  4I6P A;  4TSS A;  4F7Z A;  1V9J A;  2BB5 A;  2Y3A A;  1AAR A;  2NS5 A;  2MX2 A;  4LLG M;  3X0W A;  3DWM A;  1CZP A;  3W1Y A;  3RFZ B;  2C7N B;  1NBF C;  4A55 A;  3QWZ B;  1GAQ B;  1E5W A;  4LNF A;  4W9J A;  2N4F A;  1TS2 A;  3BIN A;  4A3O A;  1AW7 A;  3H7P A;  3NUH B;  2IO0 B;  1WXV A;  4FA6 A;  4RGO S;  3TBL D;  3Q8B A;  3HM6 X;  3QIJ A;  2KQ4 X;  1WJU A;  4BBN F;  1L4D B;  1KF6 B;  5DPT A;  2V1Y A;  1E7V A;  3PLU A;  5J18 A;  2Z8L A;  4WH4 A;  3M3J A;  4ZYN A;  4JX1 C;  1FRD A;  2MJ3 A;  2I1J A;  3QQ8 B;  1TZO A;  2EKE C;  3AV8 A;  5DPS A;  3OG5 A;  3B0A A;  2W9N A;  1XXG A;  3DVN U;  1PDX A;  1RRB A;  2CS4 A;  2AQ2 B;  3PSE B;  4C7Y A;  1SE9 A;  2ZJD A;  4US8 A;  3QK0 A;  1ENF A;  5HFY A;  2RPQ A;  1R4N I;  2O6V A;  1XLP A;  3ZDM C;  2JUO A;  4AOF A;  1J19 A;  5TSS A;  3V60 A;  1MHX A;  1FFU A;  1L0X B;  1JWA D;  3NVV A;  4IM3 A;  3H7S A;  1WF9 A;  3M62 B;  5H8Y E;  4YTM B;  1SXT A;  3APC A;  2MWS B;  2WDV B;  4PYU A;  3M95 A;  3GE3 C;  1L4Z B;  2J7Q B;  3R2I A;  5DPW A;  1E90 A;  1WZ3 A;  2NBU A;  4MM3 B;  3BWU D;  3MC9 A;  3B08 A;  1SJE D;  5G5H A;  3PRZ A;  1V5O A;  2ZVN A;  4Q2J A;  1UBI A;  4K7U A;  4OW0 A;  3EA6 A;  5EE3 A;  2VH2 A;  4RNA A;  2WXN A;  5I4D A;  5IOI A;  1TY2 A;  1IBX B;  4FAD A;  1K52 A;  2MBB B;  2GLS A;  1WIA A;  2JYE A;  3JSV B;  3PT2 B;  2K25 A;  2N9K A;  1JQ4 A;  1SF0 A;  1D6E C;  1SGH A;  3P4P B;  1FD6 A;  3VUX A;  2Q5W D;  4L2Y A;  1FEH A;  4X57 B;  1OTR B;  4XWT A;  4WJN A;  2C60 A;  1RM6 C;  3NS8 A;  4KZ0 A;  4WIP A;  4ZDV A;  1VZ7 A;  3ZJT A;  3ZIM A;  1P3Q U;  4RGT A;  2KTR A;  1WGY A;  3X23 A;  3SFE B;  4K7W A;  1D3Z A;  5G2N A;  1SJH D;  4ZRP A;  2QC8 A;  3VXW A;  1SB3 C;  2RMM A;  2RGF A;  2KOX A;  4AJY B;  4K1R B;  2M19 A;  1ZKH A;  2REX A;  2BS4 B;  3SFD B;  2KMA A;  1DOX A;  1KTK A;  1TIF A;  2Z0D B;  4NJ6 A;  1UUP A;  4WAA A;  4MGI E;  2CHW A;  3VUY A;  2IGG A;  4RCO A;  2AX5 A;  4GOC A;  2NCN A;  1EWY C;  5DCN A;  3I63 C;  4K7S A;  1XQQ A;  4NAW A;  3T3N A;  1D5X C;  4FJZ A;  2MQJ A;  4RM9 A;  3M63 B;  1HZ6 A;  2Y5P A;  1EF1 A;  3Q8C A;  1VZ8 A;  4RM8 A;  2WU2 B;  4MH0 E;  5HKH A;  2KT7 A;  4K81 A;  1BML C;  3L17 A;  2K3U A;  4YSY B;  4FLH A;  2WX0 A;  4IDI A;  3ZXR A;  3IT4 B;  2BF8 B;  3Q69 A;  1MG4 A;  2WXM A;  3AU5 A;  1PYW D;  1WGK A;  4RF0 A;  2V4L A;  2WXP A;  4LTU A;  2KD0 A;  2N9L A;  2J53 A;  1V49 A;  4KV2 A;  3PRE A;  2ZZP B;  2KAJ A;  4DDG D;  5BMG A;  1F2R I;  1RLF A;  3IXS A;  3V05 A;  3QX1 A;  2FBW B;  4KKJ A;  3CIR B;  3VAW A;  2KJR A;  2MW5 A;  2KMC A;  5CHF A;  1H8C A;  1TBE A;  1KLU D;  1YJJ A;  2WDR B;  4XC2 A;  4RF1 A;  1OEY J;  3BYY B;  4GLS C;  3A9J A;  5LXH A;  1ISN A;  1GC7 A;  2L05 A;  1JRP A;  2IND C;  2AWT A;  4HLE A;  1NI3 A;  2KYW A;  2JT4 B;  3ZJU A;  5FR3 A;  2HDE A;  3AE2 B;  4J6I A;  3Q3O C;  2E6X A;  1SE3 A;  1I4P A;  3AEE B;  3DBR I;  2PE6 B;  4A90 A;  2ONQ A;  2D3C A;  1HTQ A;  1HA5 A;  4HVB A;  2O2V B;  4HCN B;  4HPL B;  3P2B A;  3SDL C;  1V2Y A;  2OJW A;  2XK5 B;  5IO9 A;  1YIW A;  2JRI B;  2QMT A;  4BOS C;  1UGM A;  1L5P A;  1HXY D;  4KSK C;  4B0M A;  4K3C A;  2DBY A;  4BZA A;  2KFJ A;  1YD8 U;  3NHE B;  3U7D A;  1SE4 A;  3R3M A;  2CU3 A;  3DOW A;  2DYM A;  4DWF A;  4OVV A;  2KK8 A;  1WXS A;  2YEP F;  3MJW A;  2NTT A;  4BVU C;  2DHZ A;  5E6P A;  1S1Q B;  4S0R A;  3VFK A;  2WXK A;  4B6W A;  3LJ3 A;  3WAP A;  3ZDT A;  4PS3 A;  3N30 A;  2INP E;  5D7G A;  2QIL A;  2L1A A;  3PRP B;  2K8C A;  2XEW A;  3AN1 A;  1WGD A;  2RDB C;  5IP4 D;  4AUQ C;  2INC C;  4EFO A;  3GOE A;  3TSS A;  1YN4 A;  2G4S A;  1SIF A;  2PJH A;  1AN8 A;  2KN4 A;  3NZ3 A;  3Q3J A;  3WAO A;  1C3T A;  2MEK A;  2HJ1 A;  3AH7 A;  3IBE A;  5LLI A;  4ZRJ A;  1EUV B;  4EZL A;  3BK2 A;  3CMM B;  3DVG X;  1IGC A;  4REZ A;  3ZXV A;  1P0R A;  3RT3 B;  4KDI C;  4IG7 B;  3SEB A;  1E0Z A;  1QOG A;  3WCQ A;  3LXF A;  4JIO U;  4W9G A;  2GBM A;  4IUM B;  4WWN A;  1B1Z A;  1GOZ A;  4UDU C;  3VRB B;  3QAQ A;  1DOI A;  1EU3 A;  2WNM A;  4KIK B;  5J17 A;  3N1Z C;  3ZO5 B;  2YEP B;  2DZJ A;  1V1O A;  1P7F A;  4KX6 B;  3ZNG C;  1P98 A;  1VR9 A;  3U2S C;  1UF0 A;  3PZ7 A;  2FAZ A;  2KVZ A;  2RSU A;  3CF6 E;  1M4V A;  1DOY A;  3UQA A;  2LHD A;  4GXB A;  2BTE A;  4MSM B;  4USA A;  3ALB A;  1N5X A;  3R2T A;  4P7I A;  3TEY A;  1YJ1 A;  2FCS A;  4W9K A;  4JL9 A;  5EE9 A;  3A9K B;  2KDI A;  3MFG A;  2ZVO A;  2KDB A;  2HTH A;  1Q10 A;  1V81 A;  4FHK A;  3DVN V;  4ZHP A;  2KFK B;  2C7M B;  4L23 A;  2JSV X;  3MP9 A;  2J52 A;  3N3K B;  1X1M A;  1SE2 A;  2XN9 C;  5IA7 A;  1RFA A;  1E6E B;  1MFW A;  1NI2 A;  2OHF A;  2Y5B B;  2H89 B;  1E8X A;  3A9K A;  2LI5 A;  5IAA C;  2IGD A;  1TKE A;  5C2T B;  3HRD D;  4BOZ B;  1JCK B;  4HKZ E;  2KJH B;  1V1P A;  3LDZ E;  1L6V A;  2LVP A;  1B9R A;  1C76 A;  1MI0 A;  1SSN A;  2C7H A;  2PPH A;  4ZOH C;  1Q5W B;  4XDC A;  1JML A;  2RR9 A;  1EWC A;  3BVG A;  3CSF A;  2WHI A;  4BBN C;  4LK0 M;  1CQV A;  1VDV A;  1T0Q C;  1UGJ A;  4OHJ A;  2EMS A;  2NPT A;  4JE3 B;  1GNU A;  4D2K A;  2DYB A;  4KGS A;  4WUR A;  1V97 A;  1XLO A;  3KYD D;  3RNA C;  3TIX A;  4H2A A;  2KO3 A;  3RPF C;  3AE3 B;  3RCZ A;  4BKS D;  4PT5 A;  1P7E A;  1E8Y A;  2N9X A;  3BZD B;  4MJS B;  3C8Y A;  3Q6B A;  1GB1 A;  2K39 A;  2BS3 B;  3J9C A;  2FUH B;  5EDS A;  2JWZ A;  3UQB A;  2KKC A;  3FIL B;  3CWI A;  4L1B A;  2L0T A;  4TV3 A;  1YQ4 B;  1FCL A;  1NEN B;  1WJ6 A;  3NVZ A;  2HD5 B;  1YN3 A;  3Q8E A;  2IDY A;  3OWE B;  1E8Z A;  2WXH A;  2BYF A;  2MHJ A;  3AE8 B;  3QCA A;  3IFW B;  5E6J A;  2GOW A;  3O65 B;  2D3G A;  3MTN B;  2JX5 A;  1E8W A;  3TJP A;  4KGR A;  3KWL A;  2MRP A;  1FXT B;  3VR8 B;  4ASW C;  2LMC A;  4RFB A;  2L00 B;  3EFU A;  2AQ3 B;  3AMZ A;  4M8M A;  4DXG A;  3TEZ A;  3V3X A;  3KUZ A;  3SHQ A;  1YOV B;  4IWP A;  1XT9 B;  3DHI C;  5GXG B;  1WMH B;  3D32 A;  2M4N A;  2PW9 A;  2G1E A;  1TT5 B;  4GDL B;  1WY8 A;  2WDT B;  2KWU B;  3IVF A;  1IGD A;  2DYO A;  1C78 A;  1LQB A;  2KLC A;  4ICV A;  4ITK A;  2PKO A;  3H8H A;  1YJI A;  1OQY A;  3BK1 A;  1WM2 A;  4AP4 C;  2WP9 B;  1SIJ A;  1UH6 A;  4IWQ A;  4F1S A;  1LO5 D;  5H92 C;  2EKI A;  2PEA A;  1TY0 A;  3PZ8 A;  5HG2 A;  2UYZ B;  2MJD A;  2VZK D;  4PK1 A;  1FFV A;  4ZRI A;  2W82 A;  4C56 C;  3ML8 A;  5L83 A;  3W1S C;  3AXC A;  2QDF A;  1MJD A;  4E3C A;  3MHZ A;  1WGH A;  1OEY A;  1V5T A;  5FK9 C;  4M8N A;  2W54 A;  5FKA C;  2WS3 B;  3ZGZ A;  1CJE A;  3Q14 C;  1LXD A;  1PQS A;  4IW0 A;  3NG0 A;  2K5P A;  2FIF A;  4KDL B;  1D5Z C;  2PVG C;  3PZD A;  1UWM A;  3FAH A;  1I4Q A;  2G3Q B;  2JRH A;  4MM3 A;  3SR6 A;  5IN7 A;  4DHZ E;  5EE0 A;  2KNB A;  5D2M B;  4DHZ B;  1ZUD 2;  4MH8 A;  4BAX A;  3K9P B;  2UWQ A;  3T3O A;  4DDI D;  4MDK E;  2NBW B;  1PGA A;  2ZPY A;  3ABV B;  3NY5 A;  5AUI A;  1FM0 D;  4HKQ A;  1IBX A;  3C19 A;  4GMV A;  1T5X D;  2BB6 A;  3R7R A;  2I38 A;  3JSV A;  3IT6 B;  2ZNV B;  3JW0 X;  2L76 A;  1H4R A;  3B9J A;  2J4X A;  1NYR A;  1J0G A;  1L2N A;  4S17 A;  2WXG A;  3GS2 A;  4HRO A;  4YTN B;  4LJO B;  2DZI A;  1U4A A;  1OQQ A;  2KZR A;  3KLS X;  1T0R C;  1GB4 A;  2KC1 A;  1D4B A;  3BII D;  4XE0 A;  2LJI A;  1WX9 A;  4NY0 A;  5G5G A;  3RUL A;  1SBB B;  2INN E;  1A70 A;  4KGT A;  4E71 A;  3U30 A;  2MA9 B;  1FIQ A;  1FNU A;  3AED B;  2LVQ A;  1WZ0 A;  4LDT D;  2L3Z A;  4GSW A;  4JWU C;  1I42 A;  3Q3F A;  1WXM A;  1K8R B;  3AE5 B;  5DPR A;  2CJN A;  1TTN A;  4A9A A;  3R66 C;  3DHH C;  3Q2A C;  1M94 A;  4IM0 A;  3AB5 A;  2JYT A;  2WDQ B;  2RDG A;  4GN1 A;  2JQR B;  1VJK A;  2NR2 A;  3PPA A;  4HWI B;  3Q3N C;  4GDK B;  4YSX B;  1YQB A;  4URK A;  2L83 A;  1HTO A;  2N7D A;  1K51 A;  2KVR A;  4YL8 A;  3URY A;  2LGI A;  4OVU A;  5D94 A;  4M0W B;  4RGM A;  4FXC A;  4TQ1 A;  4ZRK A;  2KLG A;  2ZPN A;  3T9L A;  2V3P A;  3OJ4 B;  1UNS A;  2R2Q A;  2AQ1 B;  1WFY A;  2GBN A;  2B76 B;  4HEA 1;  4R3D A;  3DBH B;  3MC0 B;  4YWG G;  3RUI B;  4MGY E;  2JZP A;  4LJP B;  3R7Q A;  4A6Q A;  4ANU A;  3EUB 2;  2IZV B;  4GU2 A;  2VZK B;  2LEK A;  2JPH A;  4KZC A;  5D3D A;  3W1S A;  4ANW A;  1ESF A;  2DZM A;  2WQY B;  3DBL B;  3NZS A;  2MBQ A;  5AZF A;  1I4R A;  5BYS A;  3ZNH B;  3T8M A;  1WGG A;  2MJE A;  1YN5 A;  1WX7 A;  2LWP A;  1VRA B;  2K6D B;  2LHE A;  3AM9 A;  4XYC A;  2LGS A;  1WM3 A;  1F77 A;  4RMA A;  4WWO A;  3AE1 B;  2PMV A;  3PRM B;  3TUO A;  3PHW B;  1CMX B;  1K50 A;  2LUM A;  2N7E A;  3TEW A;  3WAN A;  2HE7 A;  3IAS 1;  1LFD A;  2N0S B;  1I4X A;  2O2V A;  2ACZ B;  3EC8 A;  4YT0 B;  2CHZ A;  2W3R A;  3GP7 A;  3MJ5 A;  2CJO A;  3U7Z A;  1F1H A;  4EOY A;  1P1A A;  2XK5 A;  4WWP A;  3ONS A;  4NPN A;  3H9D A;  5CHW A;  2L0F A;  4TQ0 A;  2ZCB A;  4MGZ E;  3ETR A;  2JU6 X;  3NJT A;  2N9E B;  1PFD A;  2BKF A;  4MEM A;  1HQR D;  3KUD B;  1S3S G;  2ZW0 A;  1IYF A;  2HTM E;  2LAS A;  5HI1 A;  1C9F A;  3A1Q B;  2G4D B;  2WLB A;  3L10 B;  5G55 A;  4MAC A;  2IO2 B;  3H1U A;  2MLB A;  1UZX B;  4JQW C;  2JY6 A;  1WE7 A;  4RGN A;  2EMT A;  3HVD A;  2LZ6 A;  4P6V F;  2D07 B;  4LDT B;  4M01 A;  1GJZ A; 
#chains in the Genus database with same CATH homology
 3P4S B;  1V97 A;  3P42 A;  4MM3 B;  1XLO A;  3BWU D;  4H2A A;  1SJE D;  5G5H A;  3RPF C;  3AE3 B;  4Q2J A;  4M0W A;  4PT5 A;  1P7E A;  1QF6 A;  3BZD B;  3L4P A;  4OW0 A;  1KRH A;  3AEG B;  1MHH E;  3C8Y A;  3EA6 A;  3UI3 A;  3BVM A;  4P16 A;  4RNA A;  5EE3 A;  1AYF A;  1GB1 A;  1MPE A;  2WXN A;  1YNT E;  5I4D A;  1TY2 A;  4XWW A;  1XCT L;  2BS3 B;  3J9C A;  4IKG A;  4NJC A;  1TKG A;  1IBX B;  2MH7 A;  1K52 A;  5JXV A;  2L32 A;  1CK1 A;  3FIL B;  2JYE A;  3CWI A;  4L1B A;  2N7J A;  1YQ4 B;  2N9K A;  1FCL A;  1NEN B;  1D5M C;  3NVZ A;  4A8X C;  1JQ4 A;  2XNA C;  1SF0 A;  1YN3 A;  3Q8E A;  4NZL B;  5BMH A;  1FMA D;  1D6E C;  2IDY A;  3P4P B;  4RH6 A;  1FD6 A;  4DXF A;  3OWE B;  2BBC A;  2TSS A;  2M56 B;  2Q5W D;  2WXH A;  4L2Y A;  1FEH A;  3P63 A;  1JWB D;  3DWG C;  2IGH A;  1JAL A;  3AE8 B;  4XWT A;  1IUE A;  1RM6 C;  3BYT B;  1HZ5 A;  1F0Z A;  5T8I A;  1WYG A;  2V0G A;  1J7B A;  5E6J A;  1WXQ A;  4WIP A;  3ZJT A;  1VZ7 A;  4WAF A;  4RGT A;  3TEX A;  2EEL A;  1FRR A;  1RWS A;  3FC4 A;  3SFE B;  2JX5 A;  4KGR A;  3I9V 1;  2IJ0 A;  3ZQ4 A;  1N63 A;  3KWL A;  4WQM A;  1SJH D;  2BT6 A;  4ZRP A;  3VR8 B;  1SB3 C;  2RMM A;  1N60 A;  2M19 A;  2LMC A;  4RFB A;  2BS4 B;  3SFD B;  4DXG A;  2AQ3 B;  3AMZ A;  3TEZ A;  3V3X A;  1ZOY B;  2V3N A;  1DOX A;  2WXF A;  2QSD A;  4TMA B;  4YXD B;  1KTK A;  3GB1 A;  2KWD A;  5BYR A;  1UUP A;  1XO3 A;  1MVK A;  2GB1 A;  1ZDV A;  1BUI C;  2IPK D;  5GXG B;  2PW9 A;  2BYT A;  2G1E A;  1ZDX A;  2IGG A;  4GDL B;  4RCO A;  2AX5 A;  3P4Q B;  2W3S A;  1FCC C;  1EWY C;  1IGD A;  2DYO A;  4WWM A;  1C78 A;  4ITK A;  2WXQ A;  2PKO A;  3T3N A;  2ON8 A;  4ZYS A;  1D5X C;  1XLN A;  3H8H A;  1YJI A;  1N5W A;  1RYJ A;  3BK1 A;  1VZ6 A;  1HZ6 A;  1SIJ A;  1QKZ A;  1XCQ L;  2WP9 B;  3W9C B;  2Y5P A;  3Q8C A;  1LO5 D;  1VZ8 A;  2WU2 B;  5H92 C;  1JW9 D;  2EKI A;  1TY0 A;  3PZ8 A;  5HG2 A;  4ZHO A;  4HJG E;  4ZRQ A;  5HHD G;  2SAK A;  2MJD A;  2VZK D;  1BML C;  1FFV A;  4EE2 A;  2K3U A;  1KH0 A;  2W82 A;  4OZA A;  4YSY B;  4C56 C;  3NRZ A;  1ZXI A;  4IDI A;  4ARI A;  1OFF A;  3IT4 B;  3Q69 A;  2SEB D;  2WXM A;  3E9S A;  5D3I B;  3MHZ A;  1PYW D;  1WGK A;  4RF0 A;  1XEE A;  2WXP A;  4LTU A;  5FK9 C;  1I4G A;  2W54 A;  5FKA C;  2K22 A;  2N9L A;  2WS3 B;  2J53 A;  4WUR A;  3ZGZ A;  2KAJ A;  1OQR A;  2PIA A;  3ZYY X;  1CJE A;  5BMG A;  1F2R I;  2WXO A;  3IXS A;  3V05 A;  1J7A A;  1ZE3 D;  2FBW B;  5C3J B;  1XF5 L;  4KKJ A;  3CIR B;  1JRO A;  2K5P A;  1D5Z C;  2BW2 A;  2PVG C;  3AE9 B;  1UWM A;  2WXL A;  3FAH A;  1I4Q A;  3NVY A;  1KLU D;  1YJJ A;  1GPX A;  2K9X A;  2WDR B;  3SR6 A;  3PO0 A;  4J3O D;  5EE0 A;  1ZUD 2;  4MH8 A;  4RF1 A;  4B0E A;  3BYY B;  3I57 A;  4GLS C;  3VQI A;  4IOI E;  1FO4 A;  3W5U B;  3T3O A;  1QOB A;  1QOA A;  4DQO C;  2W55 A;  2BS2 B;  1JRP A;  3AE6 B;  1BXT A;  1PGA A;  3ABV B;  5AUI A;  1FM0 D;  1DYQ A;  1NI3 A;  1QT9 A;  1Y56 A;  3AE7 B;  1FNV A;  2PLP A;  3KQ4 A;  3ZJU A;  1RFK A;  4HKQ A;  1STE A;  2HDE A;  5FR3 A;  1IBX A;  4OVZ A;  3AE2 B;  3O13 A;  1T5X D;  2BB6 A;  2JWU A;  1C4C A;  3FIL A;  2E6X A;  1SE3 A;  4N6E B;  2I38 A;  3U4E G;  1I4P A;  1K53 A;  3AEE B;  3IT6 B;  5BYQ A;  2OED A;  3NVW A;  4A90 A;  2NMQ A;  2ONQ A;  1N61 A;  3B9J A;  1HA5 A;  3LB8 C;  4MT5 A;  2J4X A;  1NYR A;  2WXG A;  5LNK 1;  3GS2 A;  4HRO A;  1FXI A;  4YTN B;  5EE1 A;  2FE8 A;  1C4P A;  1JWS D;  3AEF B;  4OZB A;  1OQQ A;  1KFY B;  3KLS X;  1EM7 A;  3Q8F A;  1E7P B;  1GB4 A;  1C77 A;  3ZJV A;  3P1M A;  1D4B A;  3BII D;  4XE0 A;  4CQN A;  1PGB A;  3AE4 B;  2QMT A;  2LJI A;  4ARC A;  1DGJ A;  1L5P A;  1TS3 A;  2QIE B;  1HXY D;  2E3T A;  4HRS A;  1HEZ E;  4KKI A;  4B0M A;  5G5G A;  2DBY A;  1NVI D;  1SBB B;  2INN E;  3AEC B;  3LYY A;  4US9 A;  2Y5C A;  1A70 A;  3E56 A;  4KGT A;  1V1P B;  1FIQ A;  1FNU A;  3HUI A;  3AED B;  1TJE A;  3KWV A;  4JWU C;  1SE4 A;  2DLB A;  2GI9 A;  2CU3 A;  1KLG D;  3AE5 B;  2DYM A;  2CJN A;  1WSP A;  1ET9 A;  4A9A A;  1XLQ A;  3NS1 A;  1L0Y B;  1QQR A;  2FUG 1;  1N62 A;  5MPO A;  2YEP F;  2NTT A;  3AB5 A;  2JYT A;  1EU4 A;  2WDQ B;  2KMM A;  2RDG A;  4JWS C;  3VRA B;  2JQR B;  1VJK A;  2WXK A;  4C7Z A;  2R61 A;  1I4H A;  1WRI A;  1E10 A;  3B2F A;  1PUT A;  4GDK B;  2INP E;  5D7G A;  4YSX B;  1NEK B;  1JWM D;  2L83 A;  2QIL A;  2G9H D;  2L1A A;  1K51 A;  2L52 A;  2PVO D;  1QOF A;  3URY A;  5BMI A;  3AN1 A;  1QLB B;  2D5G A;  2H88 B;  2LGI A;  2V4I B;  4C80 A;  2X38 A;  4RGM A;  1T3Q A;  1PGX A;  4FXC A;  3B2G A;  4TQ1 A;  3P4R B;  3TSS A;  1YN4 A;  1AN8 A;  2KN4 A;  3NZ3 A;  4YSZ B;  2V3P A;  1WWT A;  2WXJ A;  1UNS A;  4AQ7 A;  2J42 A;  1ROE A;  2AQ1 B;  2MEK A;  4XDD A;  2K0P A;  3AH7 A;  2B76 B;  4HEA 1;  4R3D A;  1ZXH A;  1ZPS A;  3MC0 B;  4YWG G;  2PTL A;  3BK2 A;  2JZP A;  2KDM A;  1L0V B;  1I7H A;  2ICI A;  3AEA B;  4A6Q A;  3EUB 2;  1IGC A;  1J7C A;  4REZ A;  4NAM A;  4OZC A;  1C79 A;  1JWU D;  1YMH E;  1ZP0 B;  2VZK B;  3SEB A;  2LEK A;  1ACC A;  5D3D A;  3W1S A;  1E0Z A;  1QOG A;  1ESF A;  2WQY B;  3WCQ A;  3LXF A;  2I2Y A;  2NTS A;  1I4R A;  5BYS A;  2GRI A;  4N59 A;  3HVZ A;  1UWX A;  1QIL A;  4TSS A;  3AEB B;  1B1Z A;  2MJE A;  1GOZ A;  1YN5 A;  2BB5 A;  2Y3A A;  4UDU C;  1TS5 A;  3VRB B;  2RPV A;  1NYQ A;  1DOI A;  1EU3 A;  2WNM A;  1TYG B;  1VRA B;  4LLG M;  3DWM A;  2LHE A;  1CZP A;  3AM9 A;  2YEP B;  1F77 A;  2JXT A;  1V1O A;  5AUK A;  1P7F A;  4KX6 B;  3RFZ B;  2RDH A;  1VR9 A;  2QEJ C;  2WU5 B;  3AE1 B;  1ET6 A;  2PMV A;  3U2S C;  4A55 A;  1GAQ B;  1TS4 A;  2QJL A;  3PZ7 A;  3TUO A;  1TS2 A;  1AW7 A;  3NUH B;  1K50 A;  2LUM A;  1M4V A;  3TEW A;  1R7S A;  3Q8A A;  1DOY A;  2BTE A;  2LHD A;  4RGO S;  4USA A;  3Q8B A;  1N5X A;  3EGR A;  3W2D A;  3IAS 1;  3R2T A;  2KQ4 X;  3TEY A;  3BVZ A;  2N0S B;  5EE9 A;  1L4D B;  1KF6 B;  3MFG A;  1I4X A;  3W5V B;  1Q10 A;  1TKY A;  2ACZ B;  1AWD A;  4YT0 B;  2Z8L A;  3U52 E;  2W3R A;  1L6U A;  3GP7 A;  4WH4 A;  3MJ5 A;  2CJO A;  4JX1 C;  4YTP B;  3U7Z A;  1FRD A;  1T6B X;  2MJ3 A;  4ZHP A;  4L23 A;  3R8B A;  2JSV X;  3MP9 A;  1TZO A;  4NAW B;  2DWQ A;  2J52 A;  3AV8 A;  1SE2 A;  2XN9 C;  1E6E B;  4TQ0 A;  1XXG A;  2OHF A;  4JPS A;  1PDX A;  2H89 B;  3ETR A;  2JU6 X;  1YQ3 B;  2IGD A;  2M0A A;  1TKE A;  5C2T B;  3HRD D;  1JCK B;  1PFD A;  4HKZ E;  2AQ2 B;  1C4A A;  1E9M A;  1HQR D;  1V1P A;  1SEB D;  2KAC A;  2WXR A;  2ZW0 A;  1FXA A;  2HTM E;  4C7Y A;  1V8C A;  1L6V A;  5HI1 A;  4US8 A;  1B9R A;  2ZW1 A;  1C9F A;  1C76 A;  1ENF A;  5HFY A;  1MI0 A;  1SSN A;  1XLP A;  3N9Y C;  2WLB A;  4N58 A;  4ZOH C;  4MAC A;  5TSS A;  4XDC A;  1JML A;  2WXI A;  1MHX A;  1FFU A;  1L0X B;  1EWC A;  1JWA D;  3BVG A;  3NVV A;  4RGN A;  5H8Y E;  4YTM B;  4AS1 A;  1SXT A;  1VLB A;  4LK0 M;  3IAM 1;  2WDV B;  1CQV A;  1VDV A;  3HVD A;  1UGJ A;  4P6V F;  4OHJ A;  1F2R C;  1L4Z B;  2LFI A;  4JE3 B;  4O1N A;  4D2K A;  3VR9 B;  4KGS A;  3R2I A;  1FNW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...