2NBUA

Solution structure of the rad23 ubiquitin-like (ubl) domain
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
78
structure length
78
Chain Sequence
MVSLTFKNFKKEKVPLDLEPSNTILETKTKLAQSISCEESQIKLIYSGKVLQDSKTVSECGLKDGDQVVFMVSQKKST
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Dna binding protein
molecule keywords UV excision repair protein RAD23
publication title Structures of Rpn1 T1:Rad23 and hRpn13:hPLIC2 Reveal Distinct Binding Mechanisms between Substrate Receptors and Shuttle Factors of the Proteasome.
pubmed doi rcsb
source organism Saccharomyces cerevisiae s288c
total genus 12
structure length 78
sequence length 78
ec nomenclature
pdb deposition date 2016-03-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00240 ubiquitin Ubiquitin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 2nbuA00
3SU8X 3ZLZA 4EKUA 3ZNGC 4K1RB 5G2NA 3DVNU 1S1QB 1XD3B 3UGBB 3D32A 1C1YB 4WWPA 3ZO5B 4NJ6A 1H4RA 1SGHA 4KZCA 3B08A 1WR1A 2IO3B 2KDBA 3EECA 3V62A 5CHVC 2KHWB 4PS8A 2FCQA 2N9PC 2RSUA 5AEKB 4B9KA 1ZW7A 2UWQA 1WXVA 3QIJA 2L05A 3N30A 4PYZA 3LDZE 2M0XA 3VH3B 1L7YA 1WE6A 4GDLA 3VTUA 3HM3A 3QC8B 1C3TA 3ECIA 3M62B 3KW5B 4BKSD 2N4FA 1UBIA 4DDID 1K8RB 4FA6A 3P2BA 1WM3A 1Y8RC 3GZNI 3L16A 1Z5SB 5AZHA 2ZJDA 2C5LC 4KZ0A 5D94A 2J7QB 4G0NB 1EUVB 3AI5A 3DVGX 1T0YA 1OGWA 4GU2A 1UGMA 3V6CB 2Z0EB 4FJZA 3X23A 2KDEB 2J0MA 3T9LA 3DVNV 1GC7A 1XT9B 3A4SC 2RGFA 2HTHA 3U30A 1FXTB 3RUIB 2NBUA 3K9OB 2AEHA 3PRMB 4WAAA 1YJ1A 2UYZB 3PHXB 2AYOB 5KHOA 4DXAB 2PJHA 1SIFA 3VTVA 1I42A 4II2B 3H9DA 4MGKE 1WX7A 3HK0A 3C0RB 1VCBA 3A4RA 3NZSA 2ZNVC 3L54A 4GN1A 4MELA 4WQOB 5CX3A 1R4MI 3UIPB 1IYFA 1S3SG 1V5TA 3OAWA 4LJPB 2ZCCA 4NAWA 2IO0B 4WJNA 4IW0A 3L13A 3A33B 3ZRCA 2GMIC 2LXAA 1WR6E 3IG3A 2L0FA 1F9JA 2LZ6A 3KUZA 3CSTA 4ZYNA 2G3QB 2J0KA 3ML9A 4AOFA 4TUUA 2MRPA 3DOWA 2AWTA 2N9EB 5JHBA 4ZDVA 2G4SA 4GB9A 4LDTD 3RD2A 3W1SC 2MSED 3ZNID 4MGYE 4FHKA 2KTRB 4GDKA 5DCNA 1WGHA 4G11A 4AP4C 3QCAA 5CHWA 2ZPNA 1E7VA 3EHVA 3TCAA 3ZNZB 3DBLI 2ZCBA 5C1ZA 1WM2A 5J2RA 2BF8B 3R66C 4KDIC 3KYDD 2BWFA 3H7PA 2EMSA 2M17A 1WY8A 2K39A 1Q1OA 1WMHA 2BPSA 2XK5B 2O6VA 1WGGA 4HPLB 2WX1A 4I6NB 1KOTA 3JW0X 1LM8B 3UF8A 2MP2B 3PT2B 2IY0B 2BKRB 3SHQA 4DWFA 2DZKA 3V60A 4RMAA 1IP9A 4G50A 3CMMB 1WI0A 2A4ZA 2NPTA 3UIOB 2KWVB 1IPGA 2GBMA 3DBSA 2CHWA 4A3PA 2NBWB 3W1SA 4DHJD 1D3ZA 3AU4A 2XEWA 3DVGY 2D07B 1TGZB 3PRZA 2C7HA 4W9CA 1OTRB 4EUTA 2KQSA 3QK0A 4ZRIA 3UQBA 5DPRA 2LXCA 2IZVB 2K8BA 1E90A 1UZXB 4AJWA 1E8WA 4ICVA 3RCZA 3VVWB 4IWQA 1E5WA 3A1QA 2K25A 4FJVB 3APDA 5IAAC 2V1YA 4FBJB 4OVUA 1J0GA 2MWSB 1LXDA 2PEAA 2KMCA 1NBFC 2L00B 2KJHB 4NJ7A 3SDLC 2PPHA 2V3SA 2L0TA 2BKFA 1GC6A 2CHZA 4HLEA 1GNUA 2G4DB 2BGFA 2GBRA 5D2MB 2KKCA 3R3MA 1WGRA 2HJ8A 4LCDE 3CF6E 2KQ7A 5DPSA 2LGXA 1R4NI 3MTNB 1NI2A 5LXHA 2QHOA 2JPHA 3QQ8B 3VXWA 1V2YA 2LUEA 4N9F4 3ML8A 1ISNA 2O6VD 1WJUA 2IY1B 4EZJA 4FADA 4XC2A 3PZDA 2MBQA 2N9XA 2LGDA 3TIXA 2KK8A 3QWZB 2L7RA 4FULA 1WGYA 2OJRA 4F7ZA 3AU5A 3AXCA 4ICUA 1GJZA 3DPDA 2KWUB 2PE6B 5J17A 3ZNHB 3LJ3A 2JT4B 4M8NA 2BYVE 2MBHA 2ASQA 3U7DA 1X1MA 1Z2MA 3JVZX 3Q3FA 2KX0A 2MBBB 4FLHA 1OEYJ 4GIVA 2C9WB 5CHFA 2IO1B 3BINA 4CHKA 2DENB 2M8SA 4KSKC 3ALBA 2I1KA 2KXJA 4MGIE 4NQLB 5E6PA 4TV3A 1WXSA 4W9KA 5L83A 4NNJB 4KSLC 5KHQA 2CS4A 3VUYA 2WYQA 1ZGUB 2MBEA 1XQQA 1LFDA 1RLFA 3JYUA 4W9JA 2D10A 2ZEQA 3ONSA 1WXMA 1YIWA 1J8CA 1WRDB 2BYFA 3UINB 4EEWA 4MSMB 4WJPA 1H8CA 2MA9B 2M4NA 2FUHB 4FHJA 3WALA 1E8ZA 2DZJA 3V6EB 2MQJA 2DZIA 4JGHB 4HK2A 3O65B 4PS3A 4IM0A 3B1LX 4E3CA 2ZPYA 2O2VA 3H1UA 2DX5B 3V61A 4E74A 4ASWC 4MSQB 4PS7A 4M0WB 2JWZA 1P3QU 4MJSA 1J19A 1RAXA 3DQVA 4TQ1A 4IUMB 5AZFA 2NS5A 3VDZA 2BWES 1EF1A 4F8CB 1V49A 1L2NA 5JHAA 3IHPC 3A9JB 5J18A 2LVOA 2VRRB 4RM9A 3VFKA 3QA8A 3NOBA 2HE7A 3ZDTA 2MW5A 3WANA 5LLIA 3HHMA 4GOCA 1V6EA 4IWPA 3X0WA 2CR5A 2XBBC 3PRPB 3N3KB 3KUCB 1E8XA 3A9KB 3WIMA 3L17A 1YD8U 2WDTB 1EF5A 2D11A 4GSWA 4FN2A 3VAWA 3IFWB 3PPAA 3NS8A 1JRUA 2RPQA 3JSVA 1TBEA 1WE7A 3QHTA 2KC1A 4BBNF 4XX5A 1V81A 3GOEA 2KFKB 3ZUNA 1QZEA 2RD0A 3OLMD 1P98A 1Q0WB 4DHZE 2Z59B 4MDKE 3Q3JA 2N1WA 5HKHA 3QARA 2KDFB 2YLMA 4KIKA 2YVCA 5CTRC 3I3TB 4GDKB 5TR5A 2MP2A 2JZZA 4W9LA 3VH4B 2JF5A 3HIZA 1RRBA 3PHWB 3DDCB 2RR9A 1RFAA 4ANXA 4I6PA 4B6WA 2Z0DB 2DAJA 2GBNA 4WJQA 2V4LA 3L08A 4EOYA 1KJTA 4G3XB 4JL9A 3H7PB 2I1JA 2W9NA 2C7MB 4BKGA 4KDLB 2ZNVB 1WMHB 2KVRA 2KO3A 4RM8A 3SD5A 2KN5A 3APFA 3IVFA 2NVUI 2DZMA 2LRUA 4X57B 1E8YA 2FCSA 1WF9A 4URKA 2L3ZA 2N7EA 2R2QA 3EC8A 5DPWA 3PLUA 4W9FA 2NPTB 2K1FA 2CHXA 2K8HA 2LRWA 5EDSA 4HDQA 4K7WA 2LI5A 2CKHB 2DHZA 4KVGB 2G45B 3AULA 4OVVA 2BYEA 1WXAA 2KLGA 2OOBB 4MEMA 2WWZA 3R7QA 1V5OA 3ZDMC 4ANWA 2FAZA 2L76A 3TJPA 1LQBA 3RZWC 1I35A 2KD0A 2KJ6A 4KV2A 3VTWA 3ZKJC 4AJYB 1UD7A 3A1QB 3KVFB 2R2OA 2LVQA 4P7IA 4HXDA 4W9DA 5DPTA 4AUQC 3VHTC 2NR2A 4AWJA 5FR6A 1KLVA 1P9DU 2DYBA 3ZTDA 3ZW3A 2KDIA 5GMVA 3UQAA 2N1VA 4BBNC 3PVLA 4GGQA 2C60A 4TQ0A 2JXXA 3QAQA 4JLCA 2JRHA 3B0AA 3PTFC 4HCPB 3M63B 3MJWA 4GXBA 3VUXA 2MBOA 1P1AA 2DAFA 2JVCA 3M3JA 4PYUA 3WAPA 2FIDA 4MH0E 5D7GA 1TTNA 4ANUA 1WJ4A 5JH5C 3IBEA 4GMVA 2MLBA 4JQWC 4F1SA 3WA0A 1WX9A 2B3AA 3RT3B 5C23A 3PLVA 1ZKHA 4GDLB 4WWOA 5E6NA 2LGYA 4K81A 4LDTB 1BT0A 2ZZPB 4MM3A 3MHSD 2J0JA 2C7NB 2KX3A 4EZLA 2KANA 2ZVNA 4K7UA 4BFRA 4W9HA 2FNJB 1WGDA 2M1MA 1WX8A 4HVBA 4BOZB 3NHEB 1UH6A 2GOWA 4HWIB 2MCNB 2L8JA 2KOXA 4E71A 3RZFA 1P0RA 4HDOA 1V80A 2KJRA 1PQSA 3NY5A 4ANVA 3HM6X 1KM7A 3OJ4B 4WJOA 3H6NA 3ENEA 2FIFA 2FCMA 3OJ3A 2LWPA 3RULA 2FCNA 4FJYA 4YL8A 3VUWA 1WYWB 2KLCA 1G6JA 3PREA 3KYCD 3NZUA 2GBKA 2K8CA 3A9JA 3ZRFA 5L95C 1WH3A 3QX1A 4A20A 3KH0A 5AZGA 3APCA 4IG7B 4W9IA 2K6DB 3T8MA 4NPNA 5LXIB 1GG3A 4DHJB 2O2VB 1UELA 1VD2A 1OQYA 2NBVB 4M8MA 2KTRA 1M94A 1WIAA 3A9KA 1U4AA 1YX6B 4XZ4A 3K9PB 4IC7B 3ZTCA 3DCGA 4MJSB 2K6QA 3H7SA 3CSFA 2JRIB 1WFYA 4BVUC 4NAWB 2LD9A 1YQBA 2KMAA 1V86A 4DDGD 2IYDB 1SE9A 3WAMA 4DBGA 4W9GA 1NDDA 2KFKA 2MX2A 2LASA 2WX0A 3U8ZA 3EFUA 4ZRJA 4HPMB 4HJKA 4LJOB 4JIOU 2XK5A 1CMXB 4J6IA 4A3OA 1WZ3A 1A5RA 3QJZA 4NY0A 5BO4B 1UBQA 2KFJA 4NQKE 3VQIA 2EKEC 2JZ3B 4ZRKA 4EFOA 4IM2A 3ZIMA 2KWCA 5E6OA 2DYOA 4DK5A 3JSVB 3BY4B 4I6LB 1MG8A 2HD5B 3L10B 2IBIB 4BKTA 2REXA 2CU1A 3TL5A 1GUAB 1Q5WB 3ZVVA 4K7SA 4CYEA 2Y5BB 3TBLD 3DBRI 2IO2B 2O6VB 4WWNA 2NCNA 4BOSC 4KIKB 5G55A 4EZKA 2D2QA 2ZVOA 3N32A 4HCNB 3W1YA 3WAOA 4IWOA 4B95A 3PV1A 2AL3A 2KNBA 1WJNA 2PE9A 1WJ6A 2D3GA 2GBJA 3RYTA 4BKSA 3TMPB 1E7UA 4TKNA 1WZ0A 2DYMA 2KTFA 2EMTA 3KUDB 5JZEB 1YX5B 4CO7A 3L0WB 2JY6A 2LJ5A 2KC2A 4W9EA 3PSEB 1HE8A 2AL6A 1AARA 2A5UA 3S2AA 3PS6A 1TZ1A 2N7DA 4II3B 3R7RA 5D6JB 1EO6A 5IA7A 2LVPA 3DBHI 4DHZB 1OEYA 3M95A 4MGZE 1V9JA 2KZRA 2JUOA 4IM3A 3PGEA
chains in the Genus database with same CATH superfamily
3SU8X 3ZLZA 5G2NA 1FIQA 3D32A 1RYJA 4XDDA 2JYTA 5CHVC 2N9PC 5AEKB 1WXVA 3N30A 4K3CA 2D3BA 3HM3A 3ECIA 1MJDA 1R4MB 1UBIA 4DDID 3P2BA 1WM3A 5AZHA 4RGMA 2J7QB 4G0NB 1HZ5A 2Z0EB 1P7FA 2G9HD 3DVNV 3A4SC 2BS4B 3K9OB 2WLBA 3UI3A 3EFCA 2WU2B 2AYOB 1SIFA 1AN8A 2BVCA 1WX7A 3HK0A 2PMVA 3L54A 4MELA 1R4MI 4XE0A 3UIPB 1V5TA 3R2IA 1KTKA 2WXLA 5HG2A 1XCTL 1PUTA 3DOWA 5JHBA 2N9EB 2FUG1 2AQ3B 4XDCA 4ZDVA 3Q3OC 2NMQA 1HTQA 3ZNID 1MHXA 1K51A 3QCAA 3EHVA 2K3UA 3TCAA 2HDEA 1V8CA 2WXHA 3R66C 2EMSA 2JZPA 4DXGA 1WMHA 2BPSA 2XK5B 4I6NB 4O1NA 3V60A 1EM7A 2EELA 4G50A 2A4ZA 2INNE 3NVWA 3UIOB 2KWVB 2PVOD 2J53A 2WGSA 1GPXA 2NBWB 3AU4A 2LJIA 1TGZB 3GS2A 3NVVA 5DPRA 2LXCA 4L1BA 4ICVA 1FO4A 4RGOS 4FJVB 3APDA 1VRAB 2GRIA 2V1YA 1LXDA 3AB5A 1SIJA 2L00B 2KJHB 3SDLC 4RNAA 1GC6A 2G4DB 3Q8CA 2KKCA 3R3MA 3BVZA 4AQ7A 3CF6E 2KQ7A 5DPSA 2LGXA 2B76B 3MTNB 1JMLA 2J4XA 3TUOA 4EZJA 2W3SA 1OQRA 3PZDA 4C7YA 2LGDA 3TIXA 1JCKB 1YOVB 2MH7A 4F7ZA 2RMMA 3AU5A 2PVGC 1GJZA 1Q10A 3ZNHB 1TY2A 3AE4B 4XGAB 3JVZX 2MBBB 2C9WB 3BINA 4CHKA 1XLOA 2PW9A 3T3OA 1WXSA 4W9KA 2W54A 4NNJB 3JYUA 1L6VA 4W9JA 2ZEQA 3ONSA 1WRDB 2MA9B 2BS3B 2GB1A 3WALA 2DZJA 3V6EB 2DZIA 4C7ZA 3B1LX 2O2VA 3H1UA 3V61A 1LGRA 4WH4A 3VR8B 4L23A 4MJSA 2MEKA 4IUMB 4F8CB 5JHAA 1GB4A 3LYYA 4KGTA 3ZXRA 2LVOA 3ZDTA 3WANA 1OFFA 1V6EA 3VR9B 3L17A 3AM9A 2D11A 2KDMA 4MT5A 3NS8A 1TBEA 4ZYSA 3QHTA 2KC1A 3TEXA 4PK1A 4OW0A 1QZEA 1Q0WB 4DHZE 1NYQA 4MDKE 3VRBB 2N1WA 1KFYB 2YLMA 1ZPSA 4KIKA 1L5PA 4GDKB 2JZZA 1N5WA 3VH4B 2QIEB 1RRBA 2N0SB 4I6PA 4WJQA 2V4LA 3U4EG 3WCQA 1T5XD 3AH7A 3H7PB 5IP4D 3SD5A 3IVFA 4J3OD 2DZMA 3CWIA 4X57B 4URKA 2L3ZA 3PLUA 2K1FA 2CHXA 2K8HA 2LI5A 2BYEA 1K50A 1YN3A 2WWZA 2OHFA 1I35A 2KD0A 2KJ6A 3VTWA 4AJYB 4HXDA 4YXDB 3VHTC 2AQ2B 1KLVA 1P9DU 3ZW3A 4OHJA 2L1AA 5GMVA 1ACCA 5IO9A 4BBNC 4GGQA 4ZHOA 4JLCA 3MJWA 1P1AA 2JVCA 3M3JA 2FIDA 3Q3NC 4ANUA 2JYEA 3E56A 4JQWC 4F1SA 3RMKC 3WA0A 3O13A 1ZKHA 4WAFA 2LGYA 1BT0A 2J0JA 2C7NB 3BVGA 4EZLA 1JWUD 4K7UA 4BAXA 4W9HA 2M1MA 3NVZA 1T0QC 2L8JA 2KOXA 3AE1B 5T8IA 1PQSA 1HTOA 3HM6X 1AW7A 3OJ4B 1QOBA 3RULA 4FJYA 3VUWA 2KLCA 2OEDA 3PREA 3KYCD 2K8CA 4A6QA 2D3AA 4A20A 2QCZA 4XWWA 1ZDVA 1B9RA 3T8MA 4NPNA 5LXIB 1GG3A 1UELA 3DBRB 1YMHE 1FFUA 2NBVB 4JWSC 3K9PB 2N7JA 3ZTCA 3AE8B 1J7CA 1MHHE 1WFYA 4BVUC 4NAWB 1C78A 3WAMA 5D3IB 4DBGA 3GE8C 1M4VA 3U8ZA 4HPMB 4LJOB 4P1CC 1CMXB 4J6IA 4C00A 3IXSA 1HEZE 1UNSA 2KWCA 5E6OA 4DK5A 1N62A 1Y56A 2REXA 2LGIA 3N1ZC 4CYEA 2INCC 1UWMA 2Y5BB 1IGDA 1D4BA 3DBRI 2LMCA 2IO2B 1PDXA 4BOSC 2QC8A 1VLBA 3WAOA 4IWOA 1WJNA 2PE9A 2D3GA 2GBJA 3RYTA 1QILA 3TMPB 1C4CA 2WDVB 2ICIA 3DHGC 1WZ0A 2DYMA 3CIRB 3BIID 3IT6B 1YX5B 3N9YC 4N59A 4YSXB 4CO7A 3L0WB 1C4AA 1TS3A 1FD6A 1ZE3D 2G1EA 5FR3A 3PSEB 1F1HA 2W55A 5IOIA 1C4PA 3GZNB 3NG0A 2L52A 3R7RA 1D6EC 1OEYA 1ESFA 3EUB2 1V9JA 2KZRA 1VDVA 2JUOA 2K5PA 4K1RB 3ZO5B 2TSSA 4B9KA 1ZW7A 2LEKA 1GOZA 4KKIA 1SE3A 1IBXB 1WE6A 4HROA 3QC8B 1IGCA 1GB1A 2N4FA 3GZNI 3L16A 1Z5SB 2KVZA 2CJOA 5D94A 3AI5A 1OGWA 3X23A 2KDEB 3H8HA 1MVKA 3TEWA 1FXTB 3RUIB 1KRHA 2WXIA 2PJHA 3VTVA 1I42A 4II2B 4N6EB 2MJEA 4MGKE 1XEEA 1QOGA 3NZSA 2ZNVC 5CX3A 1IYFA 2ZCCA 4NAWA 2IO0B 4WJNA 2GMIC 2LXAA 4ZYNA 1F9JA 3KUZA 2BS2B 3ML9A 4H2AA 5BYQA 1VJKA 2BYTA 2KN4A 2QJLA 2GLSA 3AN1A 2G4SA 4LDTD 3RD2A 3W1SC 1LO5D 4A8XC 4FHKA 4M00A 1WGHA 4REZA 5C3JB 2INPE 5CHWA 1E7VA 5C1ZA 1WM2A 2BWFA 4C4VB 2M17A 2K39A 2QSDA 1Q1OA 3T3NA 2WXOA 1KOTA 3JW0X 3UF8A 4ARCA 3SFDB 2IY0B 4IKGA 2NPTA 3OG5A 3W9CB 2GBMA 1R4NB 2CHWA 1YQ3B 4A3PA 4ZRQA 3W1SA 1D3ZA 4EUTA 1NYRA 4ZRIA 3I9V1 4C56C 1UZXB 3AE9B 1RFKA 4AJWA 1E8WA 4BZAA 1E5WA 2CJNA 2K25A 3A1QA 5IAAC 4FBJB 1MI0A 1J0GA 2MWSB 3DWMA 1I4HA 4DQOC 4NJ7A 2V3SA 2L0TA 4US9A 2CHZA 2WP9B 4HLEA 1VZ7A 1FRRA 1GNUA 2GBRA 1MG4A 1R4NI 5LXHA 1DOXA 2J42A 2JPHA 2LUEA 1N61A 4R3DA 1ISNA 3ZXVA 2N9XA 2SAKA 4FULA 1WGYA 1XLQA 3LJ3A 2LUMA 2PLPA 2BYVE 2ASQA 2IPKD 3U7DA 1X1MA 1Z2MA 3Q3FA 2J52A 1KLGD 4GIVA 5CHFA 2M8SA 2IDYA 2I1KA 2KXJA 4MGIE 4KSLC 5KHQA 3P42A 1I4XA 4XWTA 2MBEA 2FE8A 3BZDB 2D10A 2BW2A 3FAHA 2WNMA 2MQJA 2IGDA 2IJ0A 1E0ZA 2ZPYA 2DX5B 3SFEB 4ASWC 2JWZA 1J19A 3VDZA 1EF1A 2AQ1B 2VRRB 4RM9A 3VFKA 3NOBA 2HE7A 5LLIA 4GOCA 3ZQ4A 3PRPB 1DOIA 3N3KB 1FNUA 3RPFC 4IOIE 3VAWA 3N20C 4A90A 3GOEA 3ZUNA 2IGGA 3OLMD 3RNGC 1P98A 3Q3JA 3QARA 2L83A 3FILA 3W5UB 5TR5A 5FK9C 3HIZA 3PHWB 3DDCB 1KH0A 3BVMA 2DNFA 1V1PB 2GBNA 3AEDB 2I1JA 2W9NA 4BKGA 5EE9A 1WF9A 2KACA 2N7EA 2R2QA 3MC8A 2LRWA 3BWUD 4HDQA 4RF0A 4KGRA 3AULA 4OVVA 4US8A 1WXAA 4MEMA 3R7QA 1V5OA 4ANWA 2L76A 1LQBA 1N63A 3ZKJC 5BYSA 3KVFB 2R2OA 2LVQA 2Y5PA 1BXTA 1TZOA 4W9DA 5DPTA 1FMAD 5FR6A 1SF0A 3ZJTA 3UQAA 3BYTB 3Q6BA 2N1VA 4KX6B 3PVLA 2N9KA 4YT0B 3B0AA 3M63B 3VUXA 3RNEC 2LGSA 2WXPA 1F2RI 4KGSA 5BMIA 1L4DB 4GMVA 2YEPB 1WX9A 1DYQA 3W2DA 3PLVA 5E6NA 4GDLB 4LDTB 4YSYB 4HPPA 2JWUA 2FNJB 3ZYYX 2JU6X 2GOWA 3MFGA 2HJ1A 4HWIB 1SBBB 3AEGB 1V80A 1BUIC 2KJRA 1KM7A 3ENEA 4B0EA 2FIFA 3OJ3A 2LWPA 3IT4B 4RH6A 3NZUA 3PZ8A 1FM0D 3AEFB 3KH0A 5AZGA 2QILA 1NI3A 1YJIA 4A55A 2KAJA 1VD2A 1FFVA 5HHDG 1WSPA 3H7SA 2LD9A 4LNIA 4FXCA 2IYDB 3BYYB 1P7EA 1NDDA 1N60A 1SB3C 3EFUA 1BMLC 1CK1A 4JIOU 1C79A 2XK5A 1ET9A 2LHEA 2GI9A 4A3OA 1A5RA 4MH8A 3URYA 3VQIA 2EKEC 2JZ3B 4IM2A 2DYOA 3JSVB 1MG8A 2XN9C 3P4SB 2HD5B 2HTME 1SXTA 2CU1A 5IKCM 1FNVA 1GUAB 1Q5WB 4M02A 2VH1A 3ZVVA 3TBLD 1GAQB 5LNK1 5D3DA 2ZVOA 3N32A 3W1YA 3GB1A 1YQ4B 2NTSA 2W3RA 3EGRA 1XLNA 2EMTA 1ZUD2 3NS1A 5BMGA 2JY6A 2LJ5A 2KC2A 1F77A 1JWSD 5FKAC 4WWMA 1HE8A 3PS6A 1TZ1A 1QOAA 5D6JB 2I2YA 5IA7A 2LVPA 1FNWA 2JSVX 3U52E 1E10A 4ACFA 3LB8C 2KYWA 4EKUA 1WWTA 3AEEB 1S1QB 2VZKD 3NRZA 3UGBB 2BTEA 4NJ6A 2MJDA 4KZCA 3B08A 1WR1A 2IO3B 3EECA 3B2GA 3V62A 4PS8A 2FCQA 2Y3AA 2RDGA 1ZOYB 2UWQA 3QIJA 2L05A 1L7YA 4OZAA 4GDLA 1XCQL 1C3TA 4HKQA 3M62B 3KW5B 4BKSD 1FEHA 4FA6A 4LNKA 1Y8RC 2ZJDA 2C5LC 4KZ0A 2QMTA 1EUVB 1AWDA 4GU2A 1K52A 1TKYA 1GC7A 1FPYA 1XT9B 2RGFA 2QEJC 2RDHA 2NBUA 2AEHA 3PRMB 1KLUD 3NZ3A 4D2KA 1WXQA 4DXAB 3DHHC 5TSSA 4RCOA 3H9DA 3A4RA 3Q3MC 1ZXHA 1IUEA 4LJPB 3A33B 1VZ8A 2LZ6A 2J0KA 4AOFA 4TUUA 2MRPA 2DLBA 3VRAB 3C8YA 1HQRD 2MSED 2WXRA 4MGYE 2KTRB 4GDKA 2WDQB 5DCNA 1ENFA 4G11A 4AP4C 3NJTA 1CQVA 1L4ZB 1FRDA 2ZPNA 2ZCBA 1JROA 3H7PA 3NUHB 1WGKA 1HZ6A 4CQNA 1PGXA 4HPLB 2EKIA 2H88B 4NJCA 3SHQA 4DWFA 1IP9A 4RMAA 1PGBA 2OJWA 1WI0A 1IPGA 3N1YC 2D07B 3P4RB 3PRZA 5GXGB 1OTRB 2I38A 2KQSA 3QK0A 3UQBA 2K8BA 2FBWB 2DBYA 3RCZA 4IWQA 4OVUA 2PEAA 1XF5L 1NBFC 2L32A 3C19A 2BKFA 2K22A 2JXTA 1QF6A 1HXYD 2BGFA 5MPOA 5D2MB 1WGRA 4LCDE 3Q8AA 4USAA 5H92C 3QQ8B 3LXFA 4N9F4 3ML8A 2WXKA 1NEKB 2O6VD 2IY1B 4FADA 2MBQA 2KK8A 4WQMA 2OJRA 4ICUA 3DPDA 1C77A 5J17A 3ABVB 3AECB 4L2YA 3W5VB 4FLHA 2KX0A 2KQ4X 3KWLA 2IO1B 3ALBA 3KLSX 5E6PA 4TV3A 3MC9A 2CS4A 2PTLA 1NVID 1ZGUB 4MM3B 1LFDA 1RLFA 1WXMA 1J8CA 2BYFA 3UINB 4EEWA 4MSMB 1NENB 2M4NA 1HA5A 5BMHA 2FUHB 4FHJA 1E8ZA 1SE2A 4JGHB 3O65B 4E74A 2WHIA 1JRPA 1B1ZA 2CU3A 4MSQB 3RI7C 4M0WB 1WRIA 1RAXA 1T6BX 1YNTE 2NS5A 2BWES 1V49A 1L2NA 3IHPC 3A9JB 5H8YE 5J18A 4TSSA 3AE7B 3QA8A 2MW5A 3HHMA 4IWPA 2CR5A 2XBBC 1UF0A 4RGNA 1E8XA 3A9KB 1D5XC 3WIMA 2WU5B 4GSWA 4FN2A 2W82A 3IFWB 1JRUA 1T3QA 2V3PA 4PT5A 1WE7A 4BBNF 4XX5A 2KFKB 3B2FA 4NZLB 2RD0A 2ZW1A 4B0MA 1YN4A 5HKHA 5EE0A 2KDFB 5CTRC 2ACZB 4AS1A 1FCCC 1L6UA 1RFAA 4HEA1 2VZKB 4ANXA 3RNBC 2V9HA 1YN5A 4EOYA 1KJTA 4G3XB 4JL9A 4QAYA 5G5GA 3J9CA 1EWYC 4KDLB 1WMHB 4RM8A 4YTNB 3ZGZA 2KN5A 3APFA 2NVUI 2LRUA 1TS5A 1E8YA 2FCSA 2WDRB 3EC8A 5EDSA 2V4IB 2UU7A 4K7WA 1ZDXA 2NTTA 2G45B 1T0SC 1TYGB 1A70A 2KLGA 3ZDMC 2FAZA 3TJPA 1UD7A 1R7SA 2NR2A 2DYBA 2KDIA 1TKGA 1L0YB 3P63A 2C60A 2LHDA 1F0ZA 1IBXA 1XO3A 3AMZA 3PTFC 2AX5A 4HCPB 4GXBA 4PYUA 3WAPA 3AE5B 1EU4A 2R61A 2INDC 3FKYA 1WJ4A 3IBEA 2MLBA 3RT3B 4WWOA 3U2SC 2ZZPB 4MM3A 2KX3A 3NVYA 4TMAB 1JALA 2KANA 4BFRA 4XYCA 1UUPA 1WX8A 4BOZB 3NHEB 1UH6A 2MCNB 1K53A 4C80A 4HDOA 3V3XA 2IGHA 3NY5A 4IDIA 4M0WA 1L0VB 2LFIA 5HFYA 2FCNA 2GBKA 1QQRA 3A9JA 5L95C 3ZRFA 1JQ4A 1WH3A 5C2TB 2K6DB 3DWGC 2O2VB 4S0RA 4P1BC 1M94A 1WIAA 2QDFA 1U4AA 3A9KA 4XZ4A 4IC7B 3DCGA 4MJSB 2K6QA 4LLGM 2JRIB 2KMMA 1YQBA 4K3BA 4RFBA 2WXFA 4W9GA 2KFKA 2LASA 2WX0A 4OZCA 4C4VA 1WYGA 4ZRJA 3KQ4A 2JX5A 1WZ3A 2KT7A 2BT6A 4NY0A 5BO4B 5BYRA 1UBQA 2KFJA 4NQKE 2SEBD 4ZRKA 3ZJUA 3BY4B 1KF6B 2IBIB 3HVDA 3TL5A 3P4QB 4ITKA 4K7SA 1FXAA 2O6VB 4KIKB 4EZKA 2WXGA 3I57A 2WXMA 3PV1A 2AL3A 4BKSA 2KWDA 1E7UA 2BQQA 4WIPA 4TKNA 3KUDB 2ONQA 3SEBA 4HKZE 1VR9A 1DGJA 2D3CA 4W9EA 4YWGG 3E9SA 2A5UA 2N7DA 4II3B 1SE4A 2WS3B 1EO6A 3RNAC 1T0RC 1F52A 5EE1A 3ZNGC 3DVNU 1XD3B 1C1YB 4WWPA 1H4RA 3IAM1 1TS4A 1SGHA 2PIAA 2KDBA 3L4PA 2KHWB 2RSUA 5JXVA 3OWEB 5EE3A 4PYZA 3LDZE 2M0XA 3VH3B 3VTUA 2N9LA 1XXGA 2BB5A 1K8RB 2JQRB 3R8BA 1N6ZA 3DVGX 1T0YA 2DWQA 1UGMA 3V6CB 1SJHD 4FJZA 2J0MA 3T9LA 2HTHA 3U30A 1D5MC 1TT5B 1QOFA 4WAAA 1YJ1A 1ZP0B 2UYZB 3I5JC 1J7BA 1PGAA 2V0GA 3PHXB 5KHOA 3DBLB 4P16A 1J7AA 1TKEA 2K0PA 4MACA 3C0RB 4OVZA 1VCBA 4YSZB 4GN1A 4WQOB 1S3SG 3OAWA 4IW0A 3L13A 3ZRCA 1WR6E 3IG3A 2L0FA 2PKOA 3CSTA 5E6JA 2G3QB 2AWTA 3Q14C 4GB9A 1F2RC 2WXNA 1TJEA 3ZJVA 3PZ7A 3ZNZB 3DBLI 3TSSA 5J2RA 4YTMB 2BF8B 1V1PA 4KDIC 2X8XX 3N1XC 3KYDD 1I4RA 1WY8A 3RNCC 3GE3C 4ZRPA 2O6VA 1WGGA 2WX1A 1LM8B 3RNFC 2MP2B 3PT2B 4HRSA 2BKRB 1QT9A 3RFZB 2DZKA 3V05A 3CMMB 1CZPA 3DBSA 1MFWA 2M19A 4DHJD 3DVGY 2XEWA 4W9CA 2BB6A 2C7HA 2ZW0A 4LNOA 2IZVB 3B9JA 1E90A 1STEA 3VVWB 1DOYA 4OZBA 2KMCA 2PPHA 2RDBC 5HI1A 1SEBD 2D5GA 2HJ8A 4LNFA 2M0AA 2E6XA 3RN9C 1NI2A 2QHOA 3VXWA 1V2YA 3Q8FA 1WJUA 4XC2A 1TS2A 4LTUA 3QWZB 2L7RA 3AXCA 2KWUB 2PE6B 4DXFA 2JT4B 4M8NA 4ZOHC 2MBHA 1OEYJ 3HRDD 1E6EB 2MJ3A 2DENB 1ZXIA 4KSKC 1UGJA 1XLPA 4NQLB 3R2TA 3MP9A 4HJGE 5L83A 1OQQA 3VUYA 5IN7A 2WYQA 1XQQA 3MJ5A 1YIWA 1H8CA 4WJPA 3SR6A 3MC0B 5G5HA 4NAMA 2M56B 4UDUC 4HK2A 3EA6A 4PS3A 4IM0A 4E3CA 1TY0A 2Q5WD 4PS7A 5I4DA 1P3QU 3DQVA 4TQ1A 3Q8EA 5AZFA 1PFDA 1V97A 4LNNA 1RM6C 3BK2A 1RWSA 2MHJA 3X0WA 4S17A 3KUCB 1C9FA 2BBCA 1YD8U 2WDTB 1EF5A 3PPAA 3AEBB 2RPQA 3JSVA 1V81A 4EE2A 3I63C 1EWCA 1FXIA 2WXQA 1SJED 2Z59B 1QLBB 3TEZA 2YVCA 3I3TB 2MP2A 4W9LA 2JF5A 2RR9A 1ROEA 1CJEA 4B6WA 2Z0DB 2DAJA 1QKZA 3L08A 3Q8BA 1JWBD 2C7MB 4JX1C 2ZNVB 2KVRA 2KO3A 5AUIA 5DPWA 3AE3B 4W9FA 2NPTB 4KVGB 2CKHB 2DHZA 3BK1A 1PYWD 2OOBB 1JW9D 3AE6B 1D5ZC 3Q2AC 3RZWC 1UWXA 4KV2A 3IAS1 3A1QB 4P7IA 4AUQC 3GP7A 4AWJA 3AE2B 1C76A 2WQYB 3ZTDA 1E7PB 4TQ0A 2JXXA 3QAQA 2JRHA 2MBOA 2DAFA 4WURA 4MH0E 5D7GA 1TTNA 5JH5C 4ARIA 3ETRA 2B3AA 1EU3A 5C23A 4KKJA 4ZHPA 1V1OA 4K81A 1ET6A 3MHZA 3MHSD 2Y5CA 2ZVNA 1WGDA 1E9MA 4HVBA 4E71A 3FC4A 3RZFA 1P0RA 1JWMD 3HVZA 4Q2JA 4P6VF 1L0XB 4ANVA 4WJOA 5AUKA 3H6NA 3U7ZA 2FCMA 4YL8A 1WYWB 1SSNA 3P4PB 1G6JA 4JPSA 3QX1A 2K9XA 2YEPF 3APCA 1YJJA 4IG7B 4W9IA 4DHJB 4N58A 4A9AA 4M8MA 1OQYA 2KTRA 1YX6B 1I4QA 1AYFA 1N5XA 3CSFA 2KMAA 2WXJA 1V86A 2H89B 3AV8A 2RPVA 4DDGD 1SE9A 4RF1A 1JWAD 2MX2A 4HJKA 2XNAC 2X38A 3QJZA 4JE3B 4EFOA 1I4PA 2E3TA 3ZIMA 1FCLA 2Z8LA 3HUIA 4I6LB 3P1MA 3L10B 4BKTA 3DBHB 1TIFA 4WWNA 2NCNA 2ON8A 3AEAB 3FILB 5G55A 4RGTA 2D2QA 4HCNB 1I4GA 4B95A 2V3NA 3KWVA 2KNBA 4LK0M 1WJ6A 4JWUC 4M01A 2KTFA 4GLSC 5JZEB 3TEYA 2VH2A 1VZ6A 2AL6A 1AARA 3S2AA 3DHIC 1MPEA 1I7HA 3PO0A 3DBHI 4DHZB 3M95A 4MGZE 4YTPB 3Q69A 4IM3A 3PGEA
chains in the Genus database with same CATH topology
3SU8X 3ZLZA 4EKUA 3ZNGC 4K1RB 5G2NA 3DVNU 1S1QB 1XD3B 3UGBB 3D32A 1C1YB 4WWPA 3ZO5B 4NJ6A 1H4RA 1SGHA 4KZCA 3B08A 1WR1A 2IO3B 2KDBA 3EECA 3V62A 5CHVC 2KHWB 4PS8A 2FCQA 2N9PC 2RSUA 5AEKB 4B9KA 1ZW7A 2UWQA 1WXVA 3QIJA 2L05A 3N30A 4PYZA 3LDZE 2M0XA 3VH3B 1L7YA 1WE6A 4GDLA 3VTUA 3HM3A 3QC8B 1C3TA 3ECIA 3M62B 3KW5B 4BKSD 2N4FA 1UBIA 4DDID 1K8RB 4FA6A 3P2BA 1WM3A 1Y8RC 3GZNI 3L16A 1Z5SB 5AZHA 2ZJDA 2C5LC 4KZ0A 5D94A 2J7QB 4G0NB 1EUVB 3AI5A 3DVGX 1T0YA 1OGWA 4GU2A 1UGMA 3V6CB 2Z0EB 4FJZA 3X23A 2KDEB 2J0MA 3T9LA 3DVNV 1GC7A 1XT9B 3A4SC 2RGFA 2HTHA 3U30A 1FXTB 3RUIB 2NBUA 3K9OB 2AEHA 3PRMB 4WAAA 1YJ1A 2UYZB 3PHXB 2AYOB 5KHOA 4DXAB 2PJHA 1SIFA 3VTVA 1I42A 4II2B 3H9DA 4MGKE 1WX7A 3HK0A 3C0RB 1VCBA 3A4RA 3NZSA 2ZNVC 3L54A 4GN1A 4MELA 4WQOB 5CX3A 1R4MI 3UIPB 1IYFA 1S3SG 1V5TA 3OAWA 4LJPB 2ZCCA 4NAWA 2IO0B 4WJNA 4IW0A 3L13A 3A33B 3ZRCA 2GMIC 2LXAA 1WR6E 3IG3A 2L0FA 1F9JA 2LZ6A 3KUZA 3CSTA 4ZYNA 2G3QB 2J0KA 3ML9A 4AOFA 4TUUA 2MRPA 3DOWA 2AWTA 2N9EB 5JHBA 4ZDVA 2G4SA 4GB9A 4LDTD 3RD2A 3W1SC 2MSED 3ZNID 4MGYE 4FHKA 2KTRB 4GDKA 5DCNA 1WGHA 4G11A 4AP4C 3QCAA 5CHWA 2ZPNA 1E7VA 3EHVA 3TCAA 3ZNZB 3DBLI 2ZCBA 5C1ZA 1WM2A 5J2RA 2BF8B 3R66C 4KDIC 3KYDD 2BWFA 3H7PA 2EMSA 2M17A 1WY8A 2K39A 1Q1OA 1WMHA 2BPSA 2XK5B 2O6VA 1WGGA 4HPLB 2WX1A 4I6NB 1KOTA 3JW0X 1LM8B 3UF8A 2MP2B 3PT2B 2IY0B 2BKRB 3SHQA 4DWFA 2DZKA 3V60A 4RMAA 1IP9A 4G50A 3CMMB 1WI0A 2A4ZA 2NPTA 3UIOB 2KWVB 1IPGA 2GBMA 3DBSA 2CHWA 4A3PA 2NBWB 3W1SA 4DHJD 1D3ZA 3AU4A 2XEWA 3DVGY 2D07B 1TGZB 3PRZA 2C7HA 4W9CA 1OTRB 4EUTA 2KQSA 3QK0A 4ZRIA 3UQBA 5DPRA 2LXCA 2IZVB 2K8BA 1E90A 1UZXB 4AJWA 1E8WA 4ICVA 3RCZA 3VVWB 4IWQA 1E5WA 3A1QA 2K25A 4FJVB 3APDA 5IAAC 2V1YA 4FBJB 4OVUA 1J0GA 2MWSB 1LXDA 2PEAA 2KMCA 1NBFC 2L00B 2KJHB 4NJ7A 3SDLC 2PPHA 2V3SA 2L0TA 2BKFA 1GC6A 2CHZA 4HLEA 1GNUA 2G4DB 2BGFA 2GBRA 5D2MB 2KKCA 3R3MA 1WGRA 2HJ8A 4LCDE 3CF6E 2KQ7A 5DPSA 2LGXA 1R4NI 3MTNB 1NI2A 5LXHA 2QHOA 2JPHA 3QQ8B 3VXWA 1V2YA 2LUEA 4N9F4 3ML8A 1ISNA 2O6VD 1WJUA 2IY1B 4EZJA 4FADA 4XC2A 3PZDA 2MBQA 2N9XA 2LGDA 3TIXA 2KK8A 3QWZB 2L7RA 4FULA 1WGYA 2OJRA 4F7ZA 3AU5A 3AXCA 4ICUA 1GJZA 3DPDA 2KWUB 2PE6B 5J17A 3ZNHB 3LJ3A 2JT4B 4M8NA 2BYVE 2MBHA 2ASQA 3U7DA 1X1MA 1Z2MA 3JVZX 3Q3FA 2KX0A 2MBBB 4FLHA 1OEYJ 4GIVA 2C9WB 5CHFA 2IO1B 3BINA 4CHKA 2DENB 2M8SA 4KSKC 3ALBA 2I1KA 2KXJA 4MGIE 4NQLB 5E6PA 4TV3A 1WXSA 4W9KA 5L83A 4NNJB 4KSLC 5KHQA 2CS4A 3VUYA 2WYQA 1ZGUB 2MBEA 1XQQA 1LFDA 1RLFA 3JYUA 4W9JA 2D10A 2ZEQA 3ONSA 1WXMA 1YIWA 1J8CA 1WRDB 2BYFA 3UINB 4EEWA 4MSMB 4WJPA 1H8CA 2MA9B 2M4NA 2FUHB 4FHJA 3WALA 1E8ZA 2DZJA 3V6EB 2MQJA 2DZIA 4JGHB 4HK2A 3O65B 4PS3A 4IM0A 3B1LX 4E3CA 2ZPYA 2O2VA 3H1UA 2DX5B 3V61A 4E74A 4ASWC 4MSQB 4PS7A 4M0WB 2JWZA 1P3QU 4MJSA 1J19A 1RAXA 3DQVA 4TQ1A 4IUMB 5AZFA 2NS5A 3VDZA 2BWES 1EF1A 4F8CB 1V49A 1L2NA 5JHAA 3IHPC 3A9JB 5J18A 2LVOA 2VRRB 4RM9A 3VFKA 3QA8A 3NOBA 2HE7A 3ZDTA 2MW5A 3WANA 5LLIA 3HHMA 4GOCA 1V6EA 4IWPA 3X0WA 2CR5A 2XBBC 3PRPB 3N3KB 3KUCB 1E8XA 3A9KB 3WIMA 3L17A 1YD8U 2WDTB 1EF5A 2D11A 4GSWA 4FN2A 3VAWA 3IFWB 3PPAA 3NS8A 1JRUA 2RPQA 3JSVA 1TBEA 1WE7A 3QHTA 2KC1A 4BBNF 4XX5A 1V81A 3GOEA 2KFKB 3ZUNA 1QZEA 2RD0A 3OLMD 1P98A 1Q0WB 4DHZE 2Z59B 4MDKE 3Q3JA 2N1WA 5HKHA 3QARA 2KDFB 2YLMA 4KIKA 2YVCA 5CTRC 3I3TB 4GDKB 5TR5A 2MP2A 2JZZA 4W9LA 3VH4B 2JF5A 3HIZA 1RRBA 3PHWB 3DDCB 2RR9A 1RFAA 4ANXA 4I6PA 4B6WA 2Z0DB 2DAJA 2GBNA 4WJQA 2V4LA 3L08A 4EOYA 1KJTA 4G3XB 4JL9A 3H7PB 2I1JA 2W9NA 2C7MB 4BKGA 4KDLB 2ZNVB 1WMHB 2KVRA 2KO3A 4RM8A 3SD5A 2KN5A 3APFA 3IVFA 2NVUI 2DZMA 2LRUA 4X57B 1E8YA 2FCSA 1WF9A 4URKA 2L3ZA 2N7EA 2R2QA 3EC8A 5DPWA 3PLUA 4W9FA 2NPTB 2K1FA 2CHXA 2K8HA 2LRWA 5EDSA 4HDQA 4K7WA 2LI5A 2CKHB 2DHZA 4KVGB 2G45B 3AULA 4OVVA 2BYEA 1WXAA 2KLGA 2OOBB 4MEMA 2WWZA 3R7QA 1V5OA 3ZDMC 4ANWA 2FAZA 2L76A 3TJPA 1LQBA 3RZWC 1I35A 2KD0A 2KJ6A 4KV2A 3VTWA 3ZKJC 4AJYB 1UD7A 3A1QB 3KVFB 2R2OA 2LVQA 4P7IA 4HXDA 4W9DA 5DPTA 4AUQC 3VHTC 2NR2A 4AWJA 5FR6A 1KLVA 1P9DU 2DYBA 3ZTDA 3ZW3A 2KDIA 5GMVA 3UQAA 2N1VA 4BBNC 3PVLA 4GGQA 2C60A 4TQ0A 2JXXA 3QAQA 4JLCA 2JRHA 3B0AA 3PTFC 4HCPB 3M63B 3MJWA 4GXBA 3VUXA 2MBOA 1P1AA 2DAFA 2JVCA 3M3JA 4PYUA 3WAPA 2FIDA 4MH0E 5D7GA 1TTNA 4ANUA 1WJ4A 5JH5C 3IBEA 4GMVA 2MLBA 4JQWC 4F1SA 3WA0A 1WX9A 2B3AA 3RT3B 5C23A 3PLVA 1ZKHA 4GDLB 4WWOA 5E6NA 2LGYA 4K81A 4LDTB 1BT0A 2ZZPB 4MM3A 3MHSD 2J0JA 2C7NB 2KX3A 4EZLA 2KANA 2ZVNA 4K7UA 4BFRA 4W9HA 2FNJB 1WGDA 2M1MA 1WX8A 4HVBA 4BOZB 3NHEB 1UH6A 2GOWA 4HWIB 2MCNB 2L8JA 2KOXA 4E71A 3RZFA 1P0RA 4HDOA 1V80A 2KJRA 1PQSA 3NY5A 4ANVA 3HM6X 1KM7A 3OJ4B 4WJOA 3H6NA 3ENEA 2FIFA 2FCMA 3OJ3A 2LWPA 3RULA 2FCNA 4FJYA 4YL8A 3VUWA 1WYWB 2KLCA 1G6JA 3PREA 3KYCD 3NZUA 2GBKA 2K8CA 3A9JA 3ZRFA 5L95C 1WH3A 3QX1A 4A20A 3KH0A 5AZGA 3APCA 4IG7B 4W9IA 2K6DB 3T8MA 4NPNA 5LXIB 1GG3A 4DHJB 2O2VB 1UELA 1VD2A 1OQYA 2NBVB 4M8MA 2KTRA 1M94A 1WIAA 3A9KA 1U4AA 1YX6B 4XZ4A 3K9PB 4IC7B 3ZTCA 3DCGA 4MJSB 2K6QA 3H7SA 3CSFA 2JRIB 1WFYA 4BVUC 4NAWB 2LD9A 1YQBA 2KMAA 1V86A 4DDGD 2IYDB 1SE9A 3WAMA 4DBGA 4W9GA 1NDDA 2KFKA 2MX2A 2LASA 2WX0A 3U8ZA 3EFUA 4ZRJA 4HPMB 4HJKA 4LJOB 4JIOU 2XK5A 1CMXB 4J6IA 4A3OA 1WZ3A 1A5RA 3QJZA 4NY0A 5BO4B 1UBQA 2KFJA 4NQKE 3VQIA 2EKEC 2JZ3B 4ZRKA 4EFOA 4IM2A 3ZIMA 2KWCA 5E6OA 2DYOA 4DK5A 3JSVB 3BY4B 4I6LB 1MG8A 2HD5B 3L10B 2IBIB 4BKTA 2REXA 2CU1A 3TL5A 1GUAB 1Q5WB 3ZVVA 4K7SA 4CYEA 2Y5BB 3TBLD 3DBRI 2IO2B 2O6VB 4WWNA 2NCNA 4BOSC 4KIKB 5G55A 4EZKA 2D2QA 2ZVOA 3N32A 4HCNB 3W1YA 3WAOA 4IWOA 4B95A 3PV1A 2AL3A 2KNBA 1WJNA 2PE9A 1WJ6A 2D3GA 2GBJA 3RYTA 4BKSA 3TMPB 1E7UA 4TKNA 1WZ0A 2DYMA 2KTFA 2EMTA 3KUDB 5JZEB 1YX5B 4CO7A 3L0WB 2JY6A 2LJ5A 2KC2A 4W9EA 3PSEB 1HE8A 2AL6A 1AARA 2A5UA 3S2AA 3PS6A 1TZ1A 2N7DA 4II3B 3R7RA 5D6JB 1EO6A 5IA7A 2LVPA 3DBHI 4DHZB 1OEYA 3M95A 4MGZE 1V9JA 2KZRA 2JUOA 4IM3A 3PGEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3SU8 X;  3ZLZ A;  4EKU A;  3ZNG C;  4K1R B;  5G2N A;  3DVN U;  1S1Q B;  1XD3 B;  3UGB B;  3D32 A;  1C1Y B;  4WWP A;  3ZO5 B;  4NJ6 A;  1H4R A;  1SGH A;  4KZC A;  3B08 A;  1WR1 A;  2IO3 B;  2KDB A;  3EEC A;  3V62 A;  5CHV C;  2KHW B;  4PS8 A;  2FCQ A;  2N9P C;  2RSU A;  5AEK B;  4B9K A;  1ZW7 A;  2UWQ A;  1WXV A;  3QIJ A;  2L05 A;  3N30 A;  4PYZ A;  3LDZ E;  2M0X A;  3VH3 B;  1L7Y A;  1WE6 A;  4GDL A;  3VTU A;  3HM3 A;  3QC8 B;  1C3T A;  3ECI A;  3M62 B;  3KW5 B;  4BKS D;  2N4F A;  1UBI A;  4DDI D;  1K8R B;  4FA6 A;  3P2B A;  1WM3 A;  1Y8R C;  3GZN I;  3L16 A;  1Z5S B;  5AZH A;  2ZJD A;  2C5L C;  4KZ0 A;  5D94 A;  2J7Q B;  4G0N B;  1EUV B;  3AI5 A;  3DVG X;  1T0Y A;  1OGW A;  4GU2 A;  1UGM A;  3V6C B;  2Z0E B;  4FJZ A;  3X23 A;  2KDE B;  2J0M A;  3T9L A;  3DVN V;  1GC7 A;  1XT9 B;  3A4S C;  2RGF A;  2HTH A;  3U30 A;  1FXT B;  3RUI B;  2NBU A;  3K9O B;  2AEH A;  3PRM B;  4WAA A;  1YJ1 A;  2UYZ B;  3PHX B;  2AYO B;  5KHO A;  4DXA B;  2PJH A;  1SIF A;  3VTV A;  1I42 A;  4II2 B;  3H9D A;  4MGK E;  1WX7 A;  3HK0 A;  3C0R B;  1VCB A;  3A4R A;  3NZS A;  2ZNV C;  3L54 A;  4GN1 A;  4MEL A;  4WQO B;  5CX3 A;  1R4M I;  3UIP B;  1IYF A;  1S3S G;  1V5T A;  3OAW A;  4LJP B;  2ZCC A;  4NAW A;  2IO0 B;  4WJN A;  4IW0 A;  3L13 A;  3A33 B;  3ZRC A;  2GMI C;  2LXA A;  1WR6 E;  3IG3 A;  2L0F A;  1F9J A;  2LZ6 A;  3KUZ A;  3CST A;  4ZYN A;  2G3Q B;  2J0K A;  3ML9 A;  4AOF A;  4TUU A;  2MRP A;  3DOW A;  2AWT A;  2N9E B;  5JHB A;  4ZDV A;  2G4S A;  4GB9 A;  4LDT D;  3RD2 A;  3W1S C;  2MSE D;  3ZNI D;  4MGY E;  4FHK A;  2KTR B;  4GDK A;  5DCN A;  1WGH A;  4G11 A;  4AP4 C;  3QCA A;  5CHW A;  2ZPN A;  1E7V A;  3EHV A;  3TCA A;  3ZNZ B;  3DBL I;  2ZCB A;  5C1Z A;  1WM2 A;  5J2R A;  2BF8 B;  3R66 C;  4KDI C;  3KYD D;  2BWF A;  3H7P A;  2EMS A;  2M17 A;  1WY8 A;  2K39 A;  1Q1O A;  1WMH A;  2BPS A;  2XK5 B;  2O6V A;  1WGG A;  4HPL B;  2WX1 A;  4I6N B;  1KOT A;  3JW0 X;  1LM8 B;  3UF8 A;  2MP2 B;  3PT2 B;  2IY0 B;  2BKR B;  3SHQ A;  4DWF A;  2DZK A;  3V60 A;  4RMA A;  1IP9 A;  4G50 A;  3CMM B;  1WI0 A;  2A4Z A;  2NPT A;  3UIO B;  2KWV B;  1IPG A;  2GBM A;  3DBS A;  2CHW A;  4A3P A;  2NBW B;  3W1S A;  4DHJ D;  1D3Z A;  3AU4 A;  2XEW A;  3DVG Y;  2D07 B;  1TGZ B;  3PRZ A;  2C7H A;  4W9C A;  1OTR B;  4EUT A;  2KQS A;  3QK0 A;  4ZRI A;  3UQB A;  5DPR A;  2LXC A;  2IZV B;  2K8B A;  1E90 A;  1UZX B;  4AJW A;  1E8W A;  4ICV A;  3RCZ A;  3VVW B;  4IWQ A;  1E5W A;  3A1Q A;  2K25 A;  4FJV B;  3APD A;  5IAA C;  2V1Y A;  4FBJ B;  4OVU A;  1J0G A;  2MWS B;  1LXD A;  2PEA A;  2KMC A;  1NBF C;  2L00 B;  2KJH B;  4NJ7 A;  3SDL C;  2PPH A;  2V3S A;  2L0T A;  2BKF A;  1GC6 A;  2CHZ A;  4HLE A;  1GNU A;  2G4D B;  2BGF A;  2GBR A;  5D2M B;  2KKC A;  3R3M A;  1WGR A;  2HJ8 A;  4LCD E;  3CF6 E;  2KQ7 A;  5DPS A;  2LGX A;  1R4N I;  3MTN B;  1NI2 A;  5LXH A;  2QHO A;  2JPH A;  3QQ8 B;  3VXW A;  1V2Y A;  2LUE A;  4N9F 4;  3ML8 A;  1ISN A;  2O6V D;  1WJU A;  2IY1 B;  4EZJ A;  4FAD A;  4XC2 A;  3PZD A;  2MBQ A;  2N9X A;  2LGD A;  3TIX A;  2KK8 A;  3QWZ B;  2L7R A;  4FUL A;  1WGY A;  2OJR A;  4F7Z A;  3AU5 A;  3AXC A;  4ICU A;  1GJZ A;  3DPD A;  2KWU B;  2PE6 B;  5J17 A;  3ZNH B;  3LJ3 A;  2JT4 B;  4M8N A;  2BYV E;  2MBH A;  2ASQ A;  3U7D A;  1X1M A;  1Z2M A;  3JVZ X;  3Q3F A;  2KX0 A;  2MBB B;  4FLH A;  1OEY J;  4GIV A;  2C9W B;  5CHF A;  2IO1 B;  3BIN A;  4CHK A;  2DEN B;  2M8S A;  4KSK C;  3ALB A;  2I1K A;  2KXJ A;  4MGI E;  4NQL B;  5E6P A;  4TV3 A;  1WXS A;  4W9K A;  5L83 A;  4NNJ B;  4KSL C;  5KHQ A;  2CS4 A;  3VUY A;  2WYQ A;  1ZGU B;  2MBE A;  1XQQ A;  1LFD A;  1RLF A;  3JYU A;  4W9J A;  2D10 A;  2ZEQ A;  3ONS A;  1WXM A;  1YIW A;  1J8C A;  1WRD B;  2BYF A;  3UIN B;  4EEW A;  4MSM B;  4WJP A;  1H8C A;  2MA9 B;  2M4N A;  2FUH B;  4FHJ A;  3WAL A;  1E8Z A;  2DZJ A;  3V6E B;  2MQJ A;  2DZI A;  4JGH B;  4HK2 A;  3O65 B;  4PS3 A;  4IM0 A;  3B1L X;  4E3C A;  2ZPY A;  2O2V A;  3H1U A;  2DX5 B;  3V61 A;  4E74 A;  4ASW C;  4MSQ B;  4PS7 A;  4M0W B;  2JWZ A;  1P3Q U;  4MJS A;  1J19 A;  1RAX A;  3DQV A;  4TQ1 A;  4IUM B;  5AZF A;  2NS5 A;  3VDZ A;  2BWE S;  1EF1 A;  4F8C B;  1V49 A;  1L2N A;  5JHA A;  3IHP C;  3A9J B;  5J18 A;  2LVO A;  2VRR B;  4RM9 A;  3VFK A;  3QA8 A;  3NOB A;  2HE7 A;  3ZDT A;  2MW5 A;  3WAN A;  5LLI A;  3HHM A;  4GOC A;  1V6E A;  4IWP A;  3X0W A;  2CR5 A;  2XBB C;  3PRP B;  3N3K B;  3KUC B;  1E8X A;  3A9K B;  3WIM A;  3L17 A;  1YD8 U;  2WDT B;  1EF5 A;  2D11 A;  4GSW A;  4FN2 A;  3VAW A;  3IFW B;  3PPA A;  3NS8 A;  1JRU A;  2RPQ A;  3JSV A;  1TBE A;  1WE7 A;  3QHT A;  2KC1 A;  4BBN F;  4XX5 A;  1V81 A;  3GOE A;  2KFK B;  3ZUN A;  1QZE A;  2RD0 A;  3OLM D;  1P98 A;  1Q0W B;  4DHZ E;  2Z59 B;  4MDK E;  3Q3J A;  2N1W A;  5HKH A;  3QAR A;  2KDF B;  2YLM A;  4KIK A;  2YVC A;  5CTR C;  3I3T B;  4GDK B;  5TR5 A;  2MP2 A;  2JZZ A;  4W9L A;  3VH4 B;  2JF5 A;  3HIZ A;  1RRB A;  3PHW B;  3DDC B;  2RR9 A;  1RFA A;  4ANX A;  4I6P A;  4B6W A;  2Z0D B;  2DAJ A;  2GBN A;  4WJQ A;  2V4L A;  3L08 A;  4EOY A;  1KJT A;  4G3X B;  4JL9 A;  3H7P B;  2I1J A;  2W9N A;  2C7M B;  4BKG A;  4KDL B;  2ZNV B;  1WMH B;  2KVR A;  2KO3 A;  4RM8 A;  3SD5 A;  2KN5 A;  3APF A;  3IVF A;  2NVU I;  2DZM A;  2LRU A;  4X57 B;  1E8Y A;  2FCS A;  1WF9 A;  4URK A;  2L3Z A;  2N7E A;  2R2Q A;  3EC8 A;  5DPW A;  3PLU A;  4W9F A;  2NPT B;  2K1F A;  2CHX A;  2K8H A;  2LRW A;  5EDS A;  4HDQ A;  4K7W A;  2LI5 A;  2CKH B;  2DHZ A;  4KVG B;  2G45 B;  3AUL A;  4OVV A;  2BYE A;  1WXA A;  2KLG A;  2OOB B;  4MEM A;  2WWZ A;  3R7Q A;  1V5O A;  3ZDM C;  4ANW A;  2FAZ A;  2L76 A;  3TJP A;  1LQB A;  3RZW C;  1I35 A;  2KD0 A;  2KJ6 A;  4KV2 A;  3VTW A;  3ZKJ C;  4AJY B;  1UD7 A;  3A1Q B;  3KVF B;  2R2O A;  2LVQ A;  4P7I A;  4HXD A;  4W9D A;  5DPT A;  4AUQ C;  3VHT C;  2NR2 A;  4AWJ A;  5FR6 A;  1KLV A;  1P9D U;  2DYB A;  3ZTD A;  3ZW3 A;  2KDI A;  5GMV A;  3UQA A;  2N1V A;  4BBN C;  3PVL A;  4GGQ A;  2C60 A;  4TQ0 A;  2JXX A;  3QAQ A;  4JLC A;  2JRH A;  3B0A A;  3PTF C;  4HCP B;  3M63 B;  3MJW A;  4GXB A;  3VUX A;  2MBO A;  1P1A A;  2DAF A;  2JVC A;  3M3J A;  4PYU A;  3WAP A;  2FID A;  4MH0 E;  5D7G A;  1TTN A;  4ANU A;  1WJ4 A;  5JH5 C;  3IBE A;  4GMV A;  2MLB A;  4JQW C;  4F1S A;  3WA0 A;  1WX9 A;  2B3A A;  3RT3 B;  5C23 A;  3PLV A;  1ZKH A;  4GDL B;  4WWO A;  5E6N A;  2LGY A;  4K81 A;  4LDT B;  1BT0 A;  2ZZP B;  4MM3 A;  3MHS D;  2J0J A;  2C7N B;  2KX3 A;  4EZL A;  2KAN A;  2ZVN A;  4K7U A;  4BFR A;  4W9H A;  2FNJ B;  1WGD A;  2M1M A;  1WX8 A;  4HVB A;  4BOZ B;  3NHE B;  1UH6 A;  2GOW A;  4HWI B;  2MCN B;  2L8J A;  2KOX A;  4E71 A;  3RZF A;  1P0R A;  4HDO A;  1V80 A;  2KJR A;  1PQS A;  3NY5 A;  4ANV A;  3HM6 X;  1KM7 A;  3OJ4 B;  4WJO A;  3H6N A;  3ENE A;  2FIF A;  2FCM A;  3OJ3 A;  2LWP A;  3RUL A;  2FCN A;  4FJY A;  4YL8 A;  3VUW A;  1WYW B;  2KLC A;  1G6J A;  3PRE A;  3KYC D;  3NZU A;  2GBK A;  2K8C A;  3A9J A;  3ZRF A;  5L95 C;  1WH3 A;  3QX1 A;  4A20 A;  3KH0 A;  5AZG A;  3APC A;  4IG7 B;  4W9I A;  2K6D B;  3T8M A;  4NPN A;  5LXI B;  1GG3 A;  4DHJ B;  2O2V B;  1UEL A;  1VD2 A;  1OQY A;  2NBV B;  4M8M A;  2KTR A;  1M94 A;  1WIA A;  3A9K A;  1U4A A;  1YX6 B;  4XZ4 A;  3K9P B;  4IC7 B;  3ZTC A;  3DCG A;  4MJS B;  2K6Q A;  3H7S A;  3CSF A;  2JRI B;  1WFY A;  4BVU C;  4NAW B;  2LD9 A;  1YQB A;  2KMA A;  1V86 A;  4DDG D;  2IYD B;  1SE9 A;  3WAM A;  4DBG A;  4W9G A;  1NDD A;  2KFK A;  2MX2 A;  2LAS A;  2WX0 A;  3U8Z A;  3EFU A;  4ZRJ A;  4HPM B;  4HJK A;  4LJO B;  4JIO U;  2XK5 A;  1CMX B;  4J6I A;  4A3O A;  1WZ3 A;  1A5R A;  3QJZ A;  4NY0 A;  5BO4 B;  1UBQ A;  2KFJ A;  4NQK E;  3VQI A;  2EKE C;  2JZ3 B;  4ZRK A;  4EFO A;  4IM2 A;  3ZIM A;  2KWC A;  5E6O A;  2DYO A;  4DK5 A;  3JSV B;  3BY4 B;  4I6L B;  1MG8 A;  2HD5 B;  3L10 B;  2IBI B;  4BKT A;  2REX A;  2CU1 A;  3TL5 A;  1GUA B;  1Q5W B;  3ZVV A;  4K7S A;  4CYE A;  2Y5B B;  3TBL D;  3DBR I;  2IO2 B;  2O6V B;  4WWN A;  2NCN A;  4BOS C;  4KIK B;  5G55 A;  4EZK A;  2D2Q A;  2ZVO A;  3N32 A;  4HCN B;  3W1Y A;  3WAO A;  4IWO A;  4B95 A;  3PV1 A;  2AL3 A;  2KNB A;  1WJN A;  2PE9 A;  1WJ6 A;  2D3G A;  2GBJ A;  3RYT A;  4BKS A;  3TMP B;  1E7U A;  4TKN A;  1WZ0 A;  2DYM A;  2KTF A;  2EMT A;  3KUD B;  5JZE B;  1YX5 B;  4CO7 A;  3L0W B;  2JY6 A;  2LJ5 A;  2KC2 A;  4W9E A;  3PSE B;  1HE8 A;  2AL6 A;  1AAR A;  2A5U A;  3S2A A;  3PS6 A;  1TZ1 A;  2N7D A;  4II3 B;  3R7R A;  5D6J B;  1EO6 A;  5IA7 A;  2LVP A;  3DBH I;  4DHZ B;  1OEY A;  3M95 A;  4MGZ E;  1V9J A;  2KZR A;  2JUO A;  4IM3 A;  3PGE A; 
#chains in the Genus database with same CATH topology
 3SU8 X;  3ZLZ A;  5G2N A;  1FIQ A;  3D32 A;  1RYJ A;  4XDD A;  2JYT A;  5CHV C;  2N9P C;  5AEK B;  1WXV A;  3N30 A;  4K3C A;  2D3B A;  3HM3 A;  3ECI A;  1MJD A;  1R4M B;  1UBI A;  4DDI D;  3P2B A;  1WM3 A;  5AZH A;  4RGM A;  2J7Q B;  4G0N B;  1HZ5 A;  2Z0E B;  1P7F A;  2G9H D;  3DVN V;  3A4S C;  2BS4 B;  3K9O B;  2WLB A;  3UI3 A;  3EFC A;  2WU2 B;  2AYO B;  1SIF A;  1AN8 A;  2BVC A;  1WX7 A;  3HK0 A;  2PMV A;  3L54 A;  4MEL A;  1R4M I;  4XE0 A;  3UIP B;  1V5T A;  3R2I A;  1KTK A;  2WXL A;  5HG2 A;  1XCT L;  1PUT A;  3DOW A;  5JHB A;  2N9E B;  2FUG 1;  2AQ3 B;  4XDC A;  4ZDV A;  3Q3O C;  2NMQ A;  1HTQ A;  3ZNI D;  1MHX A;  1K51 A;  3QCA A;  3EHV A;  2K3U A;  3TCA A;  2HDE A;  1V8C A;  2WXH A;  3R66 C;  2EMS A;  2JZP A;  4DXG A;  1WMH A;  2BPS A;  2XK5 B;  4I6N B;  4O1N A;  3V60 A;  1EM7 A;  2EEL A;  4G50 A;  2A4Z A;  2INN E;  3NVW A;  3UIO B;  2KWV B;  2PVO D;  2J53 A;  2WGS A;  1GPX A;  2NBW B;  3AU4 A;  2LJI A;  1TGZ B;  3GS2 A;  3NVV A;  5DPR A;  2LXC A;  4L1B A;  4ICV A;  1FO4 A;  4RGO S;  4FJV B;  3APD A;  1VRA B;  2GRI A;  2V1Y A;  1LXD A;  3AB5 A;  1SIJ A;  2L00 B;  2KJH B;  3SDL C;  4RNA A;  1GC6 A;  2G4D B;  3Q8C A;  2KKC A;  3R3M A;  3BVZ A;  4AQ7 A;  3CF6 E;  2KQ7 A;  5DPS A;  2LGX A;  2B76 B;  3MTN B;  1JML A;  2J4X A;  3TUO A;  4EZJ A;  2W3S A;  1OQR A;  3PZD A;  4C7Y A;  2LGD A;  3TIX A;  1JCK B;  1YOV B;  2MH7 A;  4F7Z A;  2RMM A;  3AU5 A;  2PVG C;  1GJZ A;  1Q10 A;  3ZNH B;  1TY2 A;  3AE4 B;  4XGA B;  3JVZ X;  2MBB B;  2C9W B;  3BIN A;  4CHK A;  1XLO A;  2PW9 A;  3T3O A;  1WXS A;  4W9K A;  2W54 A;  4NNJ B;  3JYU A;  1L6V A;  4W9J A;  2ZEQ A;  3ONS A;  1WRD B;  2MA9 B;  2BS3 B;  2GB1 A;  3WAL A;  2DZJ A;  3V6E B;  2DZI A;  4C7Z A;  3B1L X;  2O2V A;  3H1U A;  3V61 A;  1LGR A;  4WH4 A;  3VR8 B;  4L23 A;  4MJS A;  2MEK A;  4IUM B;  4F8C B;  5JHA A;  1GB4 A;  3LYY A;  4KGT A;  3ZXR A;  2LVO A;  3ZDT A;  3WAN A;  1OFF A;  1V6E A;  3VR9 B;  3L17 A;  3AM9 A;  2D11 A;  2KDM A;  4MT5 A;  3NS8 A;  1TBE A;  4ZYS A;  3QHT A;  2KC1 A;  3TEX A;  4PK1 A;  4OW0 A;  1QZE A;  1Q0W B;  4DHZ E;  1NYQ A;  4MDK E;  3VRB B;  2N1W A;  1KFY B;  2YLM A;  1ZPS A;  4KIK A;  1L5P A;  4GDK B;  2JZZ A;  1N5W A;  3VH4 B;  2QIE B;  1RRB A;  2N0S B;  4I6P A;  4WJQ A;  2V4L A;  3U4E G;  3WCQ A;  1T5X D;  3AH7 A;  3H7P B;  5IP4 D;  3SD5 A;  3IVF A;  4J3O D;  2DZM A;  3CWI A;  4X57 B;  4URK A;  2L3Z A;  3PLU A;  2K1F A;  2CHX A;  2K8H A;  2LI5 A;  2BYE A;  1K50 A;  1YN3 A;  2WWZ A;  2OHF A;  1I35 A;  2KD0 A;  2KJ6 A;  3VTW A;  4AJY B;  4HXD A;  4YXD B;  3VHT C;  2AQ2 B;  1KLV A;  1P9D U;  3ZW3 A;  4OHJ A;  2L1A A;  5GMV A;  1ACC A;  5IO9 A;  4BBN C;  4GGQ A;  4ZHO A;  4JLC A;  3MJW A;  1P1A A;  2JVC A;  3M3J A;  2FID A;  3Q3N C;  4ANU A;  2JYE A;  3E56 A;  4JQW C;  4F1S A;  3RMK C;  3WA0 A;  3O13 A;  1ZKH A;  4WAF A;  2LGY A;  1BT0 A;  2J0J A;  2C7N B;  3BVG A;  4EZL A;  1JWU D;  4K7U A;  4BAX A;  4W9H A;  2M1M A;  3NVZ A;  1T0Q C;  2L8J A;  2KOX A;  3AE1 B;  5T8I A;  1PQS A;  1HTO A;  3HM6 X;  1AW7 A;  3OJ4 B;  1QOB A;  3RUL A;  4FJY A;  3VUW A;  2KLC A;  2OED A;  3PRE A;  3KYC D;  2K8C A;  4A6Q A;  2D3A A;  4A20 A;  2QCZ A;  4XWW A;  1ZDV A;  1B9R A;  3T8M A;  4NPN A;  5LXI B;  1GG3 A;  1UEL A;  3DBR B;  1YMH E;  1FFU A;  2NBV B;  4JWS C;  3K9P B;  2N7J A;  3ZTC A;  3AE8 B;  1J7C A;  1MHH E;  1WFY A;  4BVU C;  4NAW B;  1C78 A;  3WAM A;  5D3I B;  4DBG A;  3GE8 C;  1M4V A;  3U8Z A;  4HPM B;  4LJO B;  4P1C C;  1CMX B;  4J6I A;  4C00 A;  3IXS A;  1HEZ E;  1UNS A;  2KWC A;  5E6O A;  4DK5 A;  1N62 A;  1Y56 A;  2REX A;  2LGI A;  3N1Z C;  4CYE A;  2INC C;  1UWM A;  2Y5B B;  1IGD A;  1D4B A;  3DBR I;  2LMC A;  2IO2 B;  1PDX A;  4BOS C;  2QC8 A;  1VLB A;  3WAO A;  4IWO A;  1WJN A;  2PE9 A;  2D3G A;  2GBJ A;  3RYT A;  1QIL A;  3TMP B;  1C4C A;  2WDV B;  2ICI A;  3DHG C;  1WZ0 A;  2DYM A;  3CIR B;  3BII D;  3IT6 B;  1YX5 B;  3N9Y C;  4N59 A;  4YSX B;  4CO7 A;  3L0W B;  1C4A A;  1TS3 A;  1FD6 A;  1ZE3 D;  2G1E A;  5FR3 A;  3PSE B;  1F1H A;  2W55 A;  5IOI A;  1C4P A;  3GZN B;  3NG0 A;  2L52 A;  3R7R A;  1D6E C;  1OEY A;  1ESF A;  3EUB 2;  1V9J A;  2KZR A;  1VDV A;  2JUO A;  2K5P A;  4K1R B;  3ZO5 B;  2TSS A;  4B9K A;  1ZW7 A;  2LEK A;  1GOZ A;  4KKI A;  1SE3 A;  1IBX B;  1WE6 A;  4HRO A;  3QC8 B;  1IGC A;  1GB1 A;  2N4F A;  3GZN I;  3L16 A;  1Z5S B;  2KVZ A;  2CJO A;  5D94 A;  3AI5 A;  1OGW A;  3X23 A;  2KDE B;  3H8H A;  1MVK A;  3TEW A;  1FXT B;  3RUI B;  1KRH A;  2WXI A;  2PJH A;  3VTV A;  1I42 A;  4II2 B;  4N6E B;  2MJE A;  4MGK E;  1XEE A;  1QOG A;  3NZS A;  2ZNV C;  5CX3 A;  1IYF A;  2ZCC A;  4NAW A;  2IO0 B;  4WJN A;  2GMI C;  2LXA A;  4ZYN A;  1F9J A;  3KUZ A;  2BS2 B;  3ML9 A;  4H2A A;  5BYQ A;  1VJK A;  2BYT A;  2KN4 A;  2QJL A;  2GLS A;  3AN1 A;  2G4S A;  4LDT D;  3RD2 A;  3W1S C;  1LO5 D;  4A8X C;  4FHK A;  4M00 A;  1WGH A;  4REZ A;  5C3J B;  2INP E;  5CHW A;  1E7V A;  5C1Z A;  1WM2 A;  2BWF A;  4C4V B;  2M17 A;  2K39 A;  2QSD A;  1Q1O A;  3T3N A;  2WXO A;  1KOT A;  3JW0 X;  3UF8 A;  4ARC A;  3SFD B;  2IY0 B;  4IKG A;  2NPT A;  3OG5 A;  3W9C B;  2GBM A;  1R4N B;  2CHW A;  1YQ3 B;  4A3P A;  4ZRQ A;  3W1S A;  1D3Z A;  4EUT A;  1NYR A;  4ZRI A;  3I9V 1;  4C56 C;  1UZX B;  3AE9 B;  1RFK A;  4AJW A;  1E8W A;  4BZA A;  1E5W A;  2CJN A;  2K25 A;  3A1Q A;  5IAA C;  4FBJ B;  1MI0 A;  1J0G A;  2MWS B;  3DWM A;  1I4H A;  4DQO C;  4NJ7 A;  2V3S A;  2L0T A;  4US9 A;  2CHZ A;  2WP9 B;  4HLE A;  1VZ7 A;  1FRR A;  1GNU A;  2GBR A;  1MG4 A;  1R4N I;  5LXH A;  1DOX A;  2J42 A;  2JPH A;  2LUE A;  1N61 A;  4R3D A;  1ISN A;  3ZXV A;  2N9X A;  2SAK A;  4FUL A;  1WGY A;  1XLQ A;  3LJ3 A;  2LUM A;  2PLP A;  2BYV E;  2ASQ A;  2IPK D;  3U7D A;  1X1M A;  1Z2M A;  3Q3F A;  2J52 A;  1KLG D;  4GIV A;  5CHF A;  2M8S A;  2IDY A;  2I1K A;  2KXJ A;  4MGI E;  4KSL C;  5KHQ A;  3P42 A;  1I4X A;  4XWT A;  2MBE A;  2FE8 A;  3BZD B;  2D10 A;  2BW2 A;  3FAH A;  2WNM A;  2MQJ A;  2IGD A;  2IJ0 A;  1E0Z A;  2ZPY A;  2DX5 B;  3SFE B;  4ASW C;  2JWZ A;  1J19 A;  3VDZ A;  1EF1 A;  2AQ1 B;  2VRR B;  4RM9 A;  3VFK A;  3NOB A;  2HE7 A;  5LLI A;  4GOC A;  3ZQ4 A;  3PRP B;  1DOI A;  3N3K B;  1FNU A;  3RPF C;  4IOI E;  3VAW A;  3N20 C;  4A90 A;  3GOE A;  3ZUN A;  2IGG A;  3OLM D;  3RNG C;  1P98 A;  3Q3J A;  3QAR A;  2L83 A;  3FIL A;  3W5U B;  5TR5 A;  5FK9 C;  3HIZ A;  3PHW B;  3DDC B;  1KH0 A;  3BVM A;  2DNF A;  1V1P B;  2GBN A;  3AED B;  2I1J A;  2W9N A;  4BKG A;  5EE9 A;  1WF9 A;  2KAC A;  2N7E A;  2R2Q A;  3MC8 A;  2LRW A;  3BWU D;  4HDQ A;  4RF0 A;  4KGR A;  3AUL A;  4OVV A;  4US8 A;  1WXA A;  4MEM A;  3R7Q A;  1V5O A;  4ANW A;  2L76 A;  1LQB A;  1N63 A;  3ZKJ C;  5BYS A;  3KVF B;  2R2O A;  2LVQ A;  2Y5P A;  1BXT A;  1TZO A;  4W9D A;  5DPT A;  1FMA D;  5FR6 A;  1SF0 A;  3ZJT A;  3UQA A;  3BYT B;  3Q6B A;  2N1V A;  4KX6 B;  3PVL A;  2N9K A;  4YT0 B;  3B0A A;  3M63 B;  3VUX A;  3RNE C;  2LGS A;  2WXP A;  1F2R I;  4KGS A;  5BMI A;  1L4D B;  4GMV A;  2YEP B;  1WX9 A;  1DYQ A;  3W2D A;  3PLV A;  5E6N A;  4GDL B;  4LDT B;  4YSY B;  4HPP A;  2JWU A;  2FNJ B;  3ZYY X;  2JU6 X;  2GOW A;  3MFG A;  2HJ1 A;  4HWI B;  1SBB B;  3AEG B;  1V80 A;  1BUI C;  2KJR A;  1KM7 A;  3ENE A;  4B0E A;  2FIF A;  3OJ3 A;  2LWP A;  3IT4 B;  4RH6 A;  3NZU A;  3PZ8 A;  1FM0 D;  3AEF B;  3KH0 A;  5AZG A;  2QIL A;  1NI3 A;  1YJI A;  4A55 A;  2KAJ A;  1VD2 A;  1FFV A;  5HHD G;  1WSP A;  3H7S A;  2LD9 A;  4LNI A;  4FXC A;  2IYD B;  3BYY B;  1P7E A;  1NDD A;  1N60 A;  1SB3 C;  3EFU A;  1BML C;  1CK1 A;  4JIO U;  1C79 A;  2XK5 A;  1ET9 A;  2LHE A;  2GI9 A;  4A3O A;  1A5R A;  4MH8 A;  3URY A;  3VQI A;  2EKE C;  2JZ3 B;  4IM2 A;  2DYO A;  3JSV B;  1MG8 A;  2XN9 C;  3P4S B;  2HD5 B;  2HTM E;  1SXT A;  2CU1 A;  5IKC M;  1FNV A;  1GUA B;  1Q5W B;  4M02 A;  2VH1 A;  3ZVV A;  3TBL D;  1GAQ B;  5LNK 1;  5D3D A;  2ZVO A;  3N32 A;  3W1Y A;  3GB1 A;  1YQ4 B;  2NTS A;  2W3R A;  3EGR A;  1XLN A;  2EMT A;  1ZUD 2;  3NS1 A;  5BMG A;  2JY6 A;  2LJ5 A;  2KC2 A;  1F77 A;  1JWS D;  5FKA C;  4WWM A;  1HE8 A;  3PS6 A;  1TZ1 A;  1QOA A;  5D6J B;  2I2Y A;  5IA7 A;  2LVP A;  1FNW A;  2JSV X;  3U52 E;  1E10 A;  4ACF A;  3LB8 C;  2KYW A;  4EKU A;  1WWT A;  3AEE B;  1S1Q B;  2VZK D;  3NRZ A;  3UGB B;  2BTE A;  4NJ6 A;  2MJD A;  4KZC A;  3B08 A;  1WR1 A;  2IO3 B;  3EEC A;  3B2G A;  3V62 A;  4PS8 A;  2FCQ A;  2Y3A A;  2RDG A;  1ZOY B;  2UWQ A;  3QIJ A;  2L05 A;  1L7Y A;  4OZA A;  4GDL A;  1XCQ L;  1C3T A;  4HKQ A;  3M62 B;  3KW5 B;  4BKS D;  1FEH A;  4FA6 A;  4LNK A;  1Y8R C;  2ZJD A;  2C5L C;  4KZ0 A;  2QMT A;  1EUV B;  1AWD A;  4GU2 A;  1K52 A;  1TKY A;  1GC7 A;  1FPY A;  1XT9 B;  2RGF A;  2QEJ C;  2RDH A;  2NBU A;  2AEH A;  3PRM B;  1KLU D;  3NZ3 A;  4D2K A;  1WXQ A;  4DXA B;  3DHH C;  5TSS A;  4RCO A;  3H9D A;  3A4R A;  3Q3M C;  1ZXH A;  1IUE A;  4LJP B;  3A33 B;  1VZ8 A;  2LZ6 A;  2J0K A;  4AOF A;  4TUU A;  2MRP A;  2DLB A;  3VRA B;  3C8Y A;  1HQR D;  2MSE D;  2WXR A;  4MGY E;  2KTR B;  4GDK A;  2WDQ B;  5DCN A;  1ENF A;  4G11 A;  4AP4 C;  3NJT A;  1CQV A;  1L4Z B;  1FRD A;  2ZPN A;  2ZCB A;  1JRO A;  3H7P A;  3NUH B;  1WGK A;  1HZ6 A;  4CQN A;  1PGX A;  4HPL B;  2EKI A;  2H88 B;  4NJC A;  3SHQ A;  4DWF A;  1IP9 A;  4RMA A;  1PGB A;  2OJW A;  1WI0 A;  1IPG A;  3N1Y C;  2D07 B;  3P4R B;  3PRZ A;  5GXG B;  1OTR B;  2I38 A;  2KQS A;  3QK0 A;  3UQB A;  2K8B A;  2FBW B;  2DBY A;  3RCZ A;  4IWQ A;  4OVU A;  2PEA A;  1XF5 L;  1NBF C;  2L32 A;  3C19 A;  2BKF A;  2K22 A;  2JXT A;  1QF6 A;  1HXY D;  2BGF A;  5MPO A;  5D2M B;  1WGR A;  4LCD E;  3Q8A A;  4USA A;  5H92 C;  3QQ8 B;  3LXF A;  4N9F 4;  3ML8 A;  2WXK A;  1NEK B;  2O6V D;  2IY1 B;  4FAD A;  2MBQ A;  2KK8 A;  4WQM A;  2OJR A;  4ICU A;  3DPD A;  1C77 A;  5J17 A;  3ABV B;  3AEC B;  4L2Y A;  3W5V B;  4FLH A;  2KX0 A;  2KQ4 X;  3KWL A;  2IO1 B;  3ALB A;  3KLS X;  5E6P A;  4TV3 A;  3MC9 A;  2CS4 A;  2PTL A;  1NVI D;  1ZGU B;  4MM3 B;  1LFD A;  1RLF A;  1WXM A;  1J8C A;  2BYF A;  3UIN B;  4EEW A;  4MSM B;  1NEN B;  2M4N A;  1HA5 A;  5BMH A;  2FUH B;  4FHJ A;  1E8Z A;  1SE2 A;  4JGH B;  3O65 B;  4E74 A;  2WHI A;  1JRP A;  1B1Z A;  2CU3 A;  4MSQ B;  3RI7 C;  4M0W B;  1WRI A;  1RAX A;  1T6B X;  1YNT E;  2NS5 A;  2BWE S;  1V49 A;  1L2N A;  3IHP C;  3A9J B;  5H8Y E;  5J18 A;  4TSS A;  3AE7 B;  3QA8 A;  2MW5 A;  3HHM A;  4IWP A;  2CR5 A;  2XBB C;  1UF0 A;  4RGN A;  1E8X A;  3A9K B;  1D5X C;  3WIM A;  2WU5 B;  4GSW A;  4FN2 A;  2W82 A;  3IFW B;  1JRU A;  1T3Q A;  2V3P A;  4PT5 A;  1WE7 A;  4BBN F;  4XX5 A;  2KFK B;  3B2F A;  4NZL B;  2RD0 A;  2ZW1 A;  4B0M A;  1YN4 A;  5HKH A;  5EE0 A;  2KDF B;  5CTR C;  2ACZ B;  4AS1 A;  1FCC C;  1L6U A;  1RFA A;  4HEA 1;  2VZK B;  4ANX A;  3RNB C;  2V9H A;  1YN5 A;  4EOY A;  1KJT A;  4G3X B;  4JL9 A;  4QAY A;  5G5G A;  3J9C A;  1EWY C;  4KDL B;  1WMH B;  4RM8 A;  4YTN B;  3ZGZ A;  2KN5 A;  3APF A;  2NVU I;  2LRU A;  1TS5 A;  1E8Y A;  2FCS A;  2WDR B;  3EC8 A;  5EDS A;  2V4I B;  2UU7 A;  4K7W A;  1ZDX A;  2NTT A;  2G45 B;  1T0S C;  1TYG B;  1A70 A;  2KLG A;  3ZDM C;  2FAZ A;  3TJP A;  1UD7 A;  1R7S A;  2NR2 A;  2DYB A;  2KDI A;  1TKG A;  1L0Y B;  3P63 A;  2C60 A;  2LHD A;  1F0Z A;  1IBX A;  1XO3 A;  3AMZ A;  3PTF C;  2AX5 A;  4HCP B;  4GXB A;  4PYU A;  3WAP A;  3AE5 B;  1EU4 A;  2R61 A;  2IND C;  3FKY A;  1WJ4 A;  3IBE A;  2MLB A;  3RT3 B;  4WWO A;  3U2S C;  2ZZP B;  4MM3 A;  2KX3 A;  3NVY A;  4TMA B;  1JAL A;  2KAN A;  4BFR A;  4XYC A;  1UUP A;  1WX8 A;  4BOZ B;  3NHE B;  1UH6 A;  2MCN B;  1K53 A;  4C80 A;  4HDO A;  3V3X A;  2IGH A;  3NY5 A;  4IDI A;  4M0W A;  1L0V B;  2LFI A;  5HFY A;  2FCN A;  2GBK A;  1QQR A;  3A9J A;  5L95 C;  3ZRF A;  1JQ4 A;  1WH3 A;  5C2T B;  2K6D B;  3DWG C;  2O2V B;  4S0R A;  4P1B C;  1M94 A;  1WIA A;  2QDF A;  1U4A A;  3A9K A;  4XZ4 A;  4IC7 B;  3DCG A;  4MJS B;  2K6Q A;  4LLG M;  2JRI B;  2KMM A;  1YQB A;  4K3B A;  4RFB A;  2WXF A;  4W9G A;  2KFK A;  2LAS A;  2WX0 A;  4OZC A;  4C4V A;  1WYG A;  4ZRJ A;  3KQ4 A;  2JX5 A;  1WZ3 A;  2KT7 A;  2BT6 A;  4NY0 A;  5BO4 B;  5BYR A;  1UBQ A;  2KFJ A;  4NQK E;  2SEB D;  4ZRK A;  3ZJU A;  3BY4 B;  1KF6 B;  2IBI B;  3HVD A;  3TL5 A;  3P4Q B;  4ITK A;  4K7S A;  1FXA A;  2O6V B;  4KIK B;  4EZK A;  2WXG A;  3I57 A;  2WXM A;  3PV1 A;  2AL3 A;  4BKS A;  2KWD A;  1E7U A;  2BQQ A;  4WIP A;  4TKN A;  3KUD B;  2ONQ A;  3SEB A;  4HKZ E;  1VR9 A;  1DGJ A;  2D3C A;  4W9E A;  4YWG G;  3E9S A;  2A5U A;  2N7D A;  4II3 B;  1SE4 A;  2WS3 B;  1EO6 A;  3RNA C;  1T0R C;  1F52 A;  5EE1 A;  3ZNG C;  3DVN U;  1XD3 B;  1C1Y B;  4WWP A;  1H4R A;  3IAM 1;  1TS4 A;  1SGH A;  2PIA A;  2KDB A;  3L4P A;  2KHW B;  2RSU A;  5JXV A;  3OWE B;  5EE3 A;  4PYZ A;  3LDZ E;  2M0X A;  3VH3 B;  3VTU A;  2N9L A;  1XXG A;  2BB5 A;  1K8R B;  2JQR B;  3R8B A;  1N6Z A;  3DVG X;  1T0Y A;  2DWQ A;  1UGM A;  3V6C B;  1SJH D;  4FJZ A;  2J0M A;  3T9L A;  2HTH A;  3U30 A;  1D5M C;  1TT5 B;  1QOF A;  4WAA A;  1YJ1 A;  1ZP0 B;  2UYZ B;  3I5J C;  1J7B A;  1PGA A;  2V0G A;  3PHX B;  5KHO A;  3DBL B;  4P16 A;  1J7A A;  1TKE A;  2K0P A;  4MAC A;  3C0R B;  4OVZ A;  1VCB A;  4YSZ B;  4GN1 A;  4WQO B;  1S3S G;  3OAW A;  4IW0 A;  3L13 A;  3ZRC A;  1WR6 E;  3IG3 A;  2L0F A;  2PKO A;  3CST A;  5E6J A;  2G3Q B;  2AWT A;  3Q14 C;  4GB9 A;  1F2R C;  2WXN A;  1TJE A;  3ZJV A;  3PZ7 A;  3ZNZ B;  3DBL I;  3TSS A;  5J2R A;  4YTM B;  2BF8 B;  1V1P A;  4KDI C;  2X8X X;  3N1X C;  3KYD D;  1I4R A;  1WY8 A;  3RNC C;  3GE3 C;  4ZRP A;  2O6V A;  1WGG A;  2WX1 A;  1LM8 B;  3RNF C;  2MP2 B;  3PT2 B;  4HRS A;  2BKR B;  1QT9 A;  3RFZ B;  2DZK A;  3V05 A;  3CMM B;  1CZP A;  3DBS A;  1MFW A;  2M19 A;  4DHJ D;  3DVG Y;  2XEW A;  4W9C A;  2BB6 A;  2C7H A;  2ZW0 A;  4LNO A;  2IZV B;  3B9J A;  1E90 A;  1STE A;  3VVW B;  1DOY A;  4OZB A;  2KMC A;  2PPH A;  2RDB C;  5HI1 A;  1SEB D;  2D5G A;  2HJ8 A;  4LNF A;  2M0A A;  2E6X A;  3RN9 C;  1NI2 A;  2QHO A;  3VXW A;  1V2Y A;  3Q8F A;  1WJU A;  4XC2 A;  1TS2 A;  4LTU A;  3QWZ B;  2L7R A;  3AXC A;  2KWU B;  2PE6 B;  4DXF A;  2JT4 B;  4M8N A;  4ZOH C;  2MBH A;  1OEY J;  3HRD D;  1E6E B;  2MJ3 A;  2DEN B;  1ZXI A;  4KSK C;  1UGJ A;  1XLP A;  4NQL B;  3R2T A;  3MP9 A;  4HJG E;  5L83 A;  1OQQ A;  3VUY A;  5IN7 A;  2WYQ A;  1XQQ A;  3MJ5 A;  1YIW A;  1H8C A;  4WJP A;  3SR6 A;  3MC0 B;  5G5H A;  4NAM A;  2M56 B;  4UDU C;  4HK2 A;  3EA6 A;  4PS3 A;  4IM0 A;  4E3C A;  1TY0 A;  2Q5W D;  4PS7 A;  5I4D A;  1P3Q U;  3DQV A;  4TQ1 A;  3Q8E A;  5AZF A;  1PFD A;  1V97 A;  4LNN A;  1RM6 C;  3BK2 A;  1RWS A;  2MHJ A;  3X0W A;  4S17 A;  3KUC B;  1C9F A;  2BBC A;  1YD8 U;  2WDT B;  1EF5 A;  3PPA A;  3AEB B;  2RPQ A;  3JSV A;  1V81 A;  4EE2 A;  3I63 C;  1EWC A;  1FXI A;  2WXQ A;  1SJE D;  2Z59 B;  1QLB B;  3TEZ A;  2YVC A;  3I3T B;  2MP2 A;  4W9L A;  2JF5 A;  2RR9 A;  1ROE A;  1CJE A;  4B6W A;  2Z0D B;  2DAJ A;  1QKZ A;  3L08 A;  3Q8B A;  1JWB D;  2C7M B;  4JX1 C;  2ZNV B;  2KVR A;  2KO3 A;  5AUI A;  5DPW A;  3AE3 B;  4W9F A;  2NPT B;  4KVG B;  2CKH B;  2DHZ A;  3BK1 A;  1PYW D;  2OOB B;  1JW9 D;  3AE6 B;  1D5Z C;  3Q2A C;  3RZW C;  1UWX A;  4KV2 A;  3IAS 1;  3A1Q B;  4P7I A;  4AUQ C;  3GP7 A;  4AWJ A;  3AE2 B;  1C76 A;  2WQY B;  3ZTD A;  1E7P B;  4TQ0 A;  2JXX A;  3QAQ A;  2JRH A;  2MBO A;  2DAF A;  4WUR A;  4MH0 E;  5D7G A;  1TTN A;  5JH5 C;  4ARI A;  3ETR A;  2B3A A;  1EU3 A;  5C23 A;  4KKJ A;  4ZHP A;  1V1O A;  4K81 A;  1ET6 A;  3MHZ A;  3MHS D;  2Y5C A;  2ZVN A;  1WGD A;  1E9M A;  4HVB A;  4E71 A;  3FC4 A;  3RZF A;  1P0R A;  1JWM D;  3HVZ A;  4Q2J A;  4P6V F;  1L0X B;  4ANV A;  4WJO A;  5AUK A;  3H6N A;  3U7Z A;  2FCM A;  4YL8 A;  1WYW B;  1SSN A;  3P4P B;  1G6J A;  4JPS A;  3QX1 A;  2K9X A;  2YEP F;  3APC A;  1YJJ A;  4IG7 B;  4W9I A;  4DHJ B;  4N58 A;  4A9A A;  4M8M A;  1OQY A;  2KTR A;  1YX6 B;  1I4Q A;  1AYF A;  1N5X A;  3CSF A;  2KMA A;  2WXJ A;  1V86 A;  2H89 B;  3AV8 A;  2RPV A;  4DDG D;  1SE9 A;  4RF1 A;  1JWA D;  2MX2 A;  4HJK A;  2XNA C;  2X38 A;  3QJZ A;  4JE3 B;  4EFO A;  1I4P A;  2E3T A;  3ZIM A;  1FCL A;  2Z8L A;  3HUI A;  4I6L B;  3P1M A;  3L10 B;  4BKT A;  3DBH B;  1TIF A;  4WWN A;  2NCN A;  2ON8 A;  3AEA B;  3FIL B;  5G55 A;  4RGT A;  2D2Q A;  4HCN B;  1I4G A;  4B95 A;  2V3N A;  3KWV A;  2KNB A;  4LK0 M;  1WJ6 A;  4JWU C;  4M01 A;  2KTF A;  4GLS C;  5JZE B;  3TEY A;  2VH2 A;  1VZ6 A;  2AL6 A;  1AAR A;  3S2A A;  3DHI C;  1MPE A;  1I7H A;  3PO0 A;  3DBH I;  4DHZ B;  3M95 A;  4MGZ E;  4YTP B;  3Q69 A;  4IM3 A;  3PGE A; 
#chains in the Genus database with same CATH homology
 3SU8 X;  3ZLZ A;  4EKU A;  3ZNG C;  4K1R B;  5G2N A;  3DVN U;  1S1Q B;  1XD3 B;  3UGB B;  3D32 A;  1C1Y B;  4WWP A;  3ZO5 B;  4NJ6 A;  1H4R A;  1SGH A;  4KZC A;  3B08 A;  1WR1 A;  2IO3 B;  2KDB A;  3EEC A;  3V62 A;  5CHV C;  2KHW B;  4PS8 A;  2FCQ A;  2N9P C;  2RSU A;  5AEK B;  4B9K A;  1ZW7 A;  2UWQ A;  1WXV A;  3QIJ A;  2L05 A;  3N30 A;  4PYZ A;  3LDZ E;  2M0X A;  3VH3 B;  1L7Y A;  1WE6 A;  4GDL A;  3VTU A;  3HM3 A;  3QC8 B;  1C3T A;  3ECI A;  3M62 B;  3KW5 B;  4BKS D;  2N4F A;  1UBI A;  4DDI D;  1K8R B;  4FA6 A;  3P2B A;  1WM3 A;  1Y8R C;  3GZN I;  3L16 A;  1Z5S B;  5AZH A;  2ZJD A;  2C5L C;  4KZ0 A;  5D94 A;  2J7Q B;  4G0N B;  1EUV B;  3AI5 A;  3DVG X;  1T0Y A;  1OGW A;  4GU2 A;  1UGM A;  3V6C B;  2Z0E B;  4FJZ A;  3X23 A;  2KDE B;  2J0M A;  3T9L A;  3DVN V;  1GC7 A;  1XT9 B;  3A4S C;  2RGF A;  2HTH A;  3U30 A;  1FXT B;  3RUI B;  2NBU A;  3K9O B;  2AEH A;  3PRM B;  4WAA A;  1YJ1 A;  2UYZ B;  3PHX B;  2AYO B;  5KHO A;  4DXA B;  2PJH A;  1SIF A;  3VTV A;  1I42 A;  4II2 B;  3H9D A;  4MGK E;  1WX7 A;  3HK0 A;  3C0R B;  1VCB A;  3A4R A;  3NZS A;  2ZNV C;  3L54 A;  4GN1 A;  4MEL A;  4WQO B;  5CX3 A;  1R4M I;  3UIP B;  1IYF A;  1S3S G;  1V5T A;  3OAW A;  4LJP B;  2ZCC A;  4NAW A;  2IO0 B;  4WJN A;  4IW0 A;  3L13 A;  3A33 B;  3ZRC A;  2GMI C;  2LXA A;  1WR6 E;  3IG3 A;  2L0F A;  1F9J A;  2LZ6 A;  3KUZ A;  3CST A;  4ZYN A;  2G3Q B;  2J0K A;  3ML9 A;  4AOF A;  4TUU A;  2MRP A;  3DOW A;  2AWT A;  2N9E B;  5JHB A;  4ZDV A;  2G4S A;  4GB9 A;  4LDT D;  3RD2 A;  3W1S C;  2MSE D;  3ZNI D;  4MGY E;  4FHK A;  2KTR B;  4GDK A;  5DCN A;  1WGH A;  4G11 A;  4AP4 C;  3QCA A;  5CHW A;  2ZPN A;  1E7V A;  3EHV A;  3TCA A;  3ZNZ B;  3DBL I;  2ZCB A;  5C1Z A;  1WM2 A;  5J2R A;  2BF8 B;  3R66 C;  4KDI C;  3KYD D;  2BWF A;  3H7P A;  2EMS A;  2M17 A;  1WY8 A;  2K39 A;  1Q1O A;  1WMH A;  2BPS A;  2XK5 B;  2O6V A;  1WGG A;  4HPL B;  2WX1 A;  4I6N B;  1KOT A;  3JW0 X;  1LM8 B;  3UF8 A;  2MP2 B;  3PT2 B;  2IY0 B;  2BKR B;  3SHQ A;  4DWF A;  2DZK A;  3V60 A;  4RMA A;  1IP9 A;  4G50 A;  3CMM B;  1WI0 A;  2A4Z A;  2NPT A;  3UIO B;  2KWV B;  1IPG A;  2GBM A;  3DBS A;  2CHW A;  4A3P A;  2NBW B;  3W1S A;  4DHJ D;  1D3Z A;  3AU4 A;  2XEW A;  3DVG Y;  2D07 B;  1TGZ B;  3PRZ A;  2C7H A;  4W9C A;  1OTR B;  4EUT A;  2KQS A;  3QK0 A;  4ZRI A;  3UQB A;  5DPR A;  2LXC A;  2IZV B;  2K8B A;  1E90 A;  1UZX B;  4AJW A;  1E8W A;  4ICV A;  3RCZ A;  3VVW B;  4IWQ A;  1E5W A;  3A1Q A;  2K25 A;  4FJV B;  3APD A;  5IAA C;  2V1Y A;  4FBJ B;  4OVU A;  1J0G A;  2MWS B;  1LXD A;  2PEA A;  2KMC A;  1NBF C;  2L00 B;  2KJH B;  4NJ7 A;  3SDL C;  2PPH A;  2V3S A;  2L0T A;  2BKF A;  1GC6 A;  2CHZ A;  4HLE A;  1GNU A;  2G4D B;  2BGF A;  2GBR A;  5D2M B;  2KKC A;  3R3M A;  1WGR A;  2HJ8 A;  4LCD E;  3CF6 E;  2KQ7 A;  5DPS A;  2LGX A;  1R4N I;  3MTN B;  1NI2 A;  5LXH A;  2QHO A;  2JPH A;  3QQ8 B;  3VXW A;  1V2Y A;  2LUE A;  4N9F 4;  3ML8 A;  1ISN A;  2O6V D;  1WJU A;  2IY1 B;  4EZJ A;  4FAD A;  4XC2 A;  3PZD A;  2MBQ A;  2N9X A;  2LGD A;  3TIX A;  2KK8 A;  3QWZ B;  2L7R A;  4FUL A;  1WGY A;  2OJR A;  4F7Z A;  3AU5 A;  3AXC A;  4ICU A;  1GJZ A;  3DPD A;  2KWU B;  2PE6 B;  5J17 A;  3ZNH B;  3LJ3 A;  2JT4 B;  4M8N A;  2BYV E;  2MBH A;  2ASQ A;  3U7D A;  1X1M A;  1Z2M A;  3JVZ X;  3Q3F A;  2KX0 A;  2MBB B;  4FLH A;  1OEY J;  4GIV A;  2C9W B;  5CHF A;  2IO1 B;  3BIN A;  4CHK A;  2DEN B;  2M8S A;  4KSK C;  3ALB A;  2I1K A;  2KXJ A;  4MGI E;  4NQL B;  5E6P A;  4TV3 A;  1WXS A;  4W9K A;  5L83 A;  4NNJ B;  4KSL C;  5KHQ A;  2CS4 A;  3VUY A;  2WYQ A;  1ZGU B;  2MBE A;  1XQQ A;  1LFD A;  1RLF A;  3JYU A;  4W9J A;  2D10 A;  2ZEQ A;  3ONS A;  1WXM A;  1YIW A;  1J8C A;  1WRD B;  2BYF A;  3UIN B;  4EEW A;  4MSM B;  4WJP A;  1H8C A;  2MA9 B;  2M4N A;  2FUH B;  4FHJ A;  3WAL A;  1E8Z A;  2DZJ A;  3V6E B;  2MQJ A;  2DZI A;  4JGH B;  4HK2 A;  3O65 B;  4PS3 A;  4IM0 A;  3B1L X;  4E3C A;  2ZPY A;  2O2V A;  3H1U A;  2DX5 B;  3V61 A;  4E74 A;  4ASW C;  4MSQ B;  4PS7 A;  4M0W B;  2JWZ A;  1P3Q U;  4MJS A;  1J19 A;  1RAX A;  3DQV A;  4TQ1 A;  4IUM B;  5AZF A;  2NS5 A;  3VDZ A;  2BWE S;  1EF1 A;  4F8C B;  1V49 A;  1L2N A;  5JHA A;  3IHP C;  3A9J B;  5J18 A;  2LVO A;  2VRR B;  4RM9 A;  3VFK A;  3QA8 A;  3NOB A;  2HE7 A;  3ZDT A;  2MW5 A;  3WAN A;  5LLI A;  3HHM A;  4GOC A;  1V6E A;  4IWP A;  3X0W A;  2CR5 A;  2XBB C;  3PRP B;  3N3K B;  3KUC B;  1E8X A;  3A9K B;  3WIM A;  3L17 A;  1YD8 U;  2WDT B;  1EF5 A;  2D11 A;  4GSW A;  4FN2 A;  3VAW A;  3IFW B;  3PPA A;  3NS8 A;  1JRU A;  2RPQ A;  3JSV A;  1TBE A;  1WE7 A;  3QHT A;  2KC1 A;  4BBN F;  4XX5 A;  1V81 A;  3GOE A;  2KFK B;  3ZUN A;  1QZE A;  2RD0 A;  3OLM D;  1P98 A;  1Q0W B;  4DHZ E;  2Z59 B;  4MDK E;  3Q3J A;  2N1W A;  5HKH A;  3QAR A;  2KDF B;  2YLM A;  4KIK A;  2YVC A;  5CTR C;  3I3T B;  4GDK B;  5TR5 A;  2MP2 A;  2JZZ A;  4W9L A;  3VH4 B;  2JF5 A;  3HIZ A;  1RRB A;  3PHW B;  3DDC B;  2RR9 A;  1RFA A;  4ANX A;  4I6P A;  4B6W A;  2Z0D B;  2DAJ A;  2GBN A;  4WJQ A;  2V4L A;  3L08 A;  4EOY A;  1KJT A;  4G3X B;  4JL9 A;  3H7P B;  2I1J A;  2W9N A;  2C7M B;  4BKG A;  4KDL B;  2ZNV B;  1WMH B;  2KVR A;  2KO3 A;  4RM8 A;  3SD5 A;  2KN5 A;  3APF A;  3IVF A;  2NVU I;  2DZM A;  2LRU A;  4X57 B;  1E8Y A;  2FCS A;  1WF9 A;  4URK A;  2L3Z A;  2N7E A;  2R2Q A;  3EC8 A;  5DPW A;  3PLU A;  4W9F A;  2NPT B;  2K1F A;  2CHX A;  2K8H A;  2LRW A;  5EDS A;  4HDQ A;  4K7W A;  2LI5 A;  2CKH B;  2DHZ A;  4KVG B;  2G45 B;  3AUL A;  4OVV A;  2BYE A;  1WXA A;  2KLG A;  2OOB B;  4MEM A;  2WWZ A;  3R7Q A;  1V5O A;  3ZDM C;  4ANW A;  2FAZ A;  2L76 A;  3TJP A;  1LQB A;  3RZW C;  1I35 A;  2KD0 A;  2KJ6 A;  4KV2 A;  3VTW A;  3ZKJ C;  4AJY B;  1UD7 A;  3A1Q B;  3KVF B;  2R2O A;  2LVQ A;  4P7I A;  4HXD A;  4W9D A;  5DPT A;  4AUQ C;  3VHT C;  2NR2 A;  4AWJ A;  5FR6 A;  1KLV A;  1P9D U;  2DYB A;  3ZTD A;  3ZW3 A;  2KDI A;  5GMV A;  3UQA A;  2N1V A;  4BBN C;  3PVL A;  4GGQ A;  2C60 A;  4TQ0 A;  2JXX A;  3QAQ A;  4JLC A;  2JRH A;  3B0A A;  3PTF C;  4HCP B;  3M63 B;  3MJW A;  4GXB A;  3VUX A;  2MBO A;  1P1A A;  2DAF A;  2JVC A;  3M3J A;  4PYU A;  3WAP A;  2FID A;  4MH0 E;  5D7G A;  1TTN A;  4ANU A;  1WJ4 A;  5JH5 C;  3IBE A;  4GMV A;  2MLB A;  4JQW C;  4F1S A;  3WA0 A;  1WX9 A;  2B3A A;  3RT3 B;  5C23 A;  3PLV A;  1ZKH A;  4GDL B;  4WWO A;  5E6N A;  2LGY A;  4K81 A;  4LDT B;  1BT0 A;  2ZZP B;  4MM3 A;  3MHS D;  2J0J A;  2C7N B;  2KX3 A;  4EZL A;  2KAN A;  2ZVN A;  4K7U A;  4BFR A;  4W9H A;  2FNJ B;  1WGD A;  2M1M A;  1WX8 A;  4HVB A;  4BOZ B;  3NHE B;  1UH6 A;  2GOW A;  4HWI B;  2MCN B;  2L8J A;  2KOX A;  4E71 A;  3RZF A;  1P0R A;  4HDO A;  1V80 A;  2KJR A;  1PQS A;  3NY5 A;  4ANV A;  3HM6 X;  1KM7 A;  3OJ4 B;  4WJO A;  3H6N A;  3ENE A;  2FIF A;  2FCM A;  3OJ3 A;  2LWP A;  3RUL A;  2FCN A;  4FJY A;  4YL8 A;  3VUW A;  1WYW B;  2KLC A;  1G6J A;  3PRE A;  3KYC D;  3NZU A;  2GBK A;  2K8C A;  3A9J A;  3ZRF A;  5L95 C;  1WH3 A;  3QX1 A;  4A20 A;  3KH0 A;  5AZG A;  3APC A;  4IG7 B;  4W9I A;  2K6D B;  3T8M A;  4NPN A;  5LXI B;  1GG3 A;  4DHJ B;  2O2V B;  1UEL A;  1VD2 A;  1OQY A;  2NBV B;  4M8M A;  2KTR A;  1M94 A;  1WIA A;  3A9K A;  1U4A A;  1YX6 B;  4XZ4 A;  3K9P B;  4IC7 B;  3ZTC A;  3DCG A;  4MJS B;  2K6Q A;  3H7S A;  3CSF A;  2JRI B;  1WFY A;  4BVU C;  4NAW B;  2LD9 A;  1YQB A;  2KMA A;  1V86 A;  4DDG D;  2IYD B;  1SE9 A;  3WAM A;  4DBG A;  4W9G A;  1NDD A;  2KFK A;  2MX2 A;  2LAS A;  2WX0 A;  3U8Z A;  3EFU A;  4ZRJ A;  4HPM B;  4HJK A;  4LJO B;  4JIO U;  2XK5 A;  1CMX B;  4J6I A;  4A3O A;  1WZ3 A;  1A5R A;  3QJZ A;  4NY0 A;  5BO4 B;  1UBQ A;  2KFJ A;  4NQK E;  3VQI A;  2EKE C;  2JZ3 B;  4ZRK A;  4EFO A;  4IM2 A;  3ZIM A;  2KWC A;  5E6O A;  2DYO A;  4DK5 A;  3JSV B;  3BY4 B;  4I6L B;  1MG8 A;  2HD5 B;  3L10 B;  2IBI B;  4BKT A;  2REX A;  2CU1 A;  3TL5 A;  1GUA B;  1Q5W B;  3ZVV A;  4K7S A;  4CYE A;  2Y5B B;  3TBL D;  3DBR I;  2IO2 B;  2O6V B;  4WWN A;  2NCN A;  4BOS C;  4KIK B;  5G55 A;  4EZK A;  2D2Q A;  2ZVO A;  3N32 A;  4HCN B;  3W1Y A;  3WAO A;  4IWO A;  4B95 A;  3PV1 A;  2AL3 A;  2KNB A;  1WJN A;  2PE9 A;  1WJ6 A;  2D3G A;  2GBJ A;  3RYT A;  4BKS A;  3TMP B;  1E7U A;  4TKN A;  1WZ0 A;  2DYM A;  2KTF A;  2EMT A;  3KUD B;  5JZE B;  1YX5 B;  4CO7 A;  3L0W B;  2JY6 A;  2LJ5 A;  2KC2 A;  4W9E A;  3PSE B;  1HE8 A;  2AL6 A;  1AAR A;  2A5U A;  3S2A A;  3PS6 A;  1TZ1 A;  2N7D A;  4II3 B;  3R7R A;  5D6J B;  1EO6 A;  5IA7 A;  2LVP A;  3DBH I;  4DHZ B;  1OEY A;  3M95 A;  4MGZ E;  1V9J A;  2KZR A;  2JUO A;  4IM3 A;  3PGE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...