2NBUA

Solution structure of the rad23 ubiquitin-like (ubl) domain
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
78
structure length
78
Chain Sequence
MVSLTFKNFKKEKVPLDLEPSNTILETKTKLAQSISCEESQIKLIYSGKVLQDSKTVSECGLKDGDQVVFMVSQKKST
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords UV excision repair protein RAD23
publication title Structures of Rpn1 T1:Rad23 and hRpn13:hPLIC2 Reveal Distinct Binding Mechanisms between Substrate Receptors and Shuttle Factors of the Proteasome.
pubmed doi rcsb
source organism Saccharomyces cerevisiae s288c
molecule tags Dna binding protein
total genus 12
structure length 78
sequence length 78
ec nomenclature
pdb deposition date 2016-03-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00240 ubiquitin Ubiquitin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 2nbuA00
3DVNU 1TTNA 1V49A 4ANVA 2KMCA 4GSWA 1WJUA 4ICUA 4TV3A 3TCAA 3JSVA 4HPMB 4WQOB 2GMIC 2GOWA 2KVRA 1BT0A 5LXHA 5E6OA 2J0MA 3ZLZA 4BFRA 3PHWB 4FJVB 2M4NA 2IZVB 4DK5A 4MGYE 1WXMA 2L00B 2HTHA 4HJKA 3OAWA 2IO1B 1RAXA 2XEWA 1KLVA 3W1SA 2J7QB 2KNBA 1HE8A 1Z2MA 5BO4B 3VH3B 3H7PA 2MLBA 2BGFA 2HD5B 4JGHB 4OVUA 4FJZA 4NPNA 3X0WA 4EKUA 4FBJB 5L83A 2V1YA 2LJ5A 2JUOA 2RPQA 4PS7A 2NR2A 4CHKA 3VH4B 1GUAB 2D10A 2IBIB 4GB9A 4HVBA 3A1QB 1IPGA 2MBQA 4JL9A 5D2MB 3DQVA 4WJOA 4XC2A 3UIOB 3PVLA 2GBJA 2AYOB 2L8JA 1EF1A 4HLEA 4B6WA 1WH3A 2IO0B 2KJRA 4TKNA 2KQ7A 2OOBB 4HDQA 1TBEA 4ICVA 1EF5A 1RLFA 1V2YA 3ML8A 2BYVE 3APCA 2L3ZA 4DDID 3DCGA 2MP2B 3IFWB 2NCNA 2CU1A 2KHWB 4KZ0A 3R3MA 1WR1A 3VUXA 1WZ0A 3KYCD 4W9HA 3ZTCA 3TIXA 2YLMA 1V5OA 2DHZA 2JZZA 2LGXA 4LJOB 5AZFA 1U4AA 2FIDA 1H8CA 4W9FA 1K8RB 1WZ3A 4NJ7A 2MCNB 3A33B 2O2VB 2RGFA 3CSFA 4I6LB 4MH0E 4PS8A 4IG7B 1M94A 2KMAA 4GMVA 3ZVVA 3QHTA 1MG8A 4EOYA 1WGGA 2KDIA 2JRIB 3PRMB 3WAMA 3WIMA 4MEMA 2C9WB 1AARA 2MBBB 1A5RA 1LM8B 1RFAA 4BKSA 4G3XB 1TZ1A 1WGYA 1GNUA 2O6VA 2K1FA 4FN2A 4JIOU 2IY0B 4W9LA 2FUHB 3RT3B 1XQQA 2NPTB 1NBFC 4KIKA 2MSED 1LQBA 3ZIMA 4W9JA 3QQ8B 2BPSA 3EFUA 2MQJA 3EC8A 2IY1B 1GC7A 2FAZA 3QA8A 3H6NA 5C1ZA 2A4ZA 2ASQA 3VHTC 1WX8A 4DXAB 2C7HA 2J0KA 2MBEA 2C5LC 3KUDB 3APDA 4HDOA 3IVFA 3M63B 3U30A 2OJRA 2D07B 4N9F4 2NBUA 5IA7A 3L54A 2DAJA 3A9JB 3B08A 3RZWC 3JVZX 3JSVB 4LJPB 2YVCA 1LFDA 2LVOA 3WANA 5JHBA 5CX3A 4HPLB 5JZEB 3M62B 2KFKA 5DPTA 1PQSA 1UBIA 2KOXA 3EHVA 4MSQB 3A4SC 4J6IA 4WJNA 2KTFA 4W9CA 2LRWA 1Q5WB 2MW5A 4YL8A 3GOEA 4F1SA 2KQSA 3CF6E 1YX5B 2KDFB 4EFOA 2LI5A 1KJTA 2CHZA 4B9KA 2DZKA 4WJQA 4GOCA 3WAOA 2LZ6A 2W9NA 3PLVA 4LDTB 2GBNA 4GDKA 4GGQA 2C7NB 3QAQA 4ZRKA 4IWOA 4HCPB 2MWSB 4GU2A 3DBSA 2M0XA 1P9DU 3DVNV 1QZEA 4ZDVA 2D11A 3BY4B 1WJ6A 2DZIA 4A3OA 2JZ3B 3ZO5B 3N32A 2NS5A 3IHPC 3PV1A 3VFKA 3L13A 3M3JA 2KO3A 3NZUA 4NAWB 1WM2A 3NY5A 3V6CB 2KK8A 3LJ3A 2LASA 4FHJA 1V6EA 3VVWB 3VXWA 3WAPA 3KW5B 3L16A 4JQWC 2KJ6A 3IG3A 3P2BA 3DBRI 5TR5A 2BF8B 2KJHB 1OEYA 2BKRB 3U8ZA 4NY0A 2GBRA 2RSUA 3PGEA 1FXTB 4ANWA 2Y5BB 3N30A 2B3AA 3N3KB 1YX6B 3WA0A 1YJ1A 4DDGD 4X57B 1WE7A 4IWQA 4FJYA 4M8NA 3O65B 2KKCA 2IYDB 2LXAA 3PSEB 4MM3A 4MGKE 1OGWA 4AWJA 2RR9A 2ZCCA 5J17A 3PRPB 2K8BA 4BBNF 2FCSA 4IM2A 3KH0A 3SDLC 1J0GA 4A20A 4PYUA 5G2NA 4RM9A 1L7YA 2JVCA 5J18A 4MJSB 2AL3A 2BKFA 2L05A 5E6NA 4AOFA 4FA6A 3HK0A 2KX0A 3B1LX 5LLIA 3AU4A 1J19A 3HIZA 2LWPA 1S1QB 3SD5A 2DX5B 3UQBA 1V81A 3L0WB 2GBKA 1OTRB 4BVUC 1E7UA 4HCNB 4RMAA 1WYWB 2KWUB 3K9PB 2KC2A 2MA9B 4GDLB 1EO6A 3MHSD 4MDKE 3I3TB 2KWCA 3NOBA 4DBGA 3RYTA 2XK5B 3QIJA 4MSMB 5AZGA 3WALA 3X23A 2XBBC 2BYEA 2L7RA 4IC7B 2I1JA 1P3QU 2VRRB 4K7UA 1WJNA 4CO7A 1T0YA 1J8CA 4WJPA 3UF8A 3IBEA 3JW0X 2LRUA 1ZW7A 1VCBA 2HJ8A 3PZDA 1IP9A 1C1YB 2KDEB 1SGHA 1V86A 2EMTA 2N9XA 3ML9A 3OLMD 3H1UA 1WX9A 4K7WA 4M8MA 2LUEA 3TJPA 2K6QA 3QCAA 3HHMA 2ZEQA 2NBVB 5AEKB 1Y8RC 4F8CB 3SHQA 3UGBB 4ZRIA 3HM6X 2KN5A 4NNJB 3M95A 3R7RA 3A1QA 3RZFA 3ZDMC 1E8WA 2PJHA 4NQKE 4B95A 2M1MA 5DPRA 1E8XA 2G3QB 1GJZA 1Q1OA 3ZNGC 2KX3A 2V4LA 3MTNB 2JF5A 4MGZE 2KDBA 3L17A 2BWFA 5D7GA 1YD8U 2DYOA 2WX0A 2REXA 3PHXB 3DPDA 2MX2A 5FR6A 2PPHA 1S3SG 3A9KA 3VAWA 4ASWC 1WMHB 1C3TA 2IO3B 1OQYA 3DDCB 2FCMA 1GG3A 1WM3A 4WWNA 1I35A 4W9DA 3PPAA 4W9KA 2N9PC 3HM3A 3TL5A 1V80A 3CSTA 1L2NA 2V3SA 1WXAA 1WXSA 1UELA 3VTWA 4II3B 2FNJB 2MP2A 2ZNVB 3AI5A 3LDZE 5JH5C 3D32A 3CMMB 5C23A 1Q0WB 3ZNHB 4A3PA 2L0TA 2L0FA 3SU8X 1H4RA 1YQBA 3W1YA 3EECA 3UIPB 3BINA 3VUYA 2JXXA 2QHOA 2UWQA 3GZNI 2DZMA 2KD0A 4NQLB 4M0WB 3DVGX 3R66C 2O2VA 3PT2B 3RCZA 4KSKC 5KHQA 1SE9A 5GMVA 2WYQA 4NJ6A 3H7PB 2KTRA 3DOWA 3T8MA 4GIVA 2G45B 2MBHA 3DBLI 3PREA 4FULA 2KFJA 4K1RB 4PYZA 1WF9A 5DPSA 4HXDA 2NPTA 3V60A 2ZZPB 1XD3B 3QARA 2KLGA 2N7EA 2PE9A 2KANA 5E6PA 4II2B 2A5UA 1OEYJ 4I6NB 3APFA 2LGDA 4LCDE 2FCNA 1XT9B 2N1WA 1E8ZA 3ENEA 4I6PA 4JLCA 4DHZB 1WXVA 1P0RA 4IM3A 3VTVA 2I1KA 4BBNC 3ALBA 2DZJA 4ANUA 1WGHA 2LVQA 3QC8B 4HWIB 2LGYA 1ISNA 1YIWA 3A9JA 4G11A 3RUIB 1TGZB 2KXJA 2WDTB 3NS8A 3UINB 1G6JA 2JWZA 2N1VA 4WWPA 2IO2B 2N4FA 3PTFC 1NDDA 4E74A 2K6DB 2K8CA 3KUCB 3KYDD 1GC6A 1JRUA 2KC1A 3L10B 2G4SA 3ZNID 4KV2A 2ZPNA 2J0JA 3QJZA 2BYFA 2N7DA 2C60A 4ANXA 3QX1A 4MGIE 4WAAA 3H9DA 2NVUI 5CHVC 5DCNA 2JT4B 3V62A 4AUQC 2ZPYA 3Q3JA 3OJ4B 4TQ1A 5D6JB 4E71A 3ECIA 1I42A 1V5TA 4RM8A 3VQIA 2LVPA 2ZCBA 1RRBA 3AU5A 1WX7A 3V61A 3RD2A 2O6VB 2K8HA 3AULA 4XX5A 4EUTA 4K7SA 4KIKB 4TQ0A 2EKEC 1E8YA 2PE6B 4P7IA 1UBQA 3R7QA 4EZKA 1P98A 4NAWA 2JPHA 1WI0A 4BOSC 4DHJB 3A4RA 1SIFA 2CS4A 3PS6A 4W9EA 1UZXB 4URKA 1R4NI 1ZGUB 3NZSA 1F9JA 4GXBA 4KDIC 3A9KB 3DBHI 2L76A 4KDLB 1UH6A 3DVGY 3JYUA 2WWZA 3B0AA 2G4DB 3AXCA 4BKTA 3ZRCA 1NI2A 3ZDTA 5CTRC 4AJWA 4W9IA 3QWZB 5L95C 1E5WA 5LXIB 4LDTD 4MELA 2CHXA 4FHKA 2JRHA 4IM0A 1V9JA 1WE6A 2KLCA 1WFYA 3C0RB 4BOZB 1WY8A 1UGMA 2KFKB 3VDZA 2AWTA 2DYBA 1KOTA 4IW0A 2WX1A 3ZTDA 2M17A 2CR5A 3V6EB 5CHFA 3TBLD 4AJYB 3ZRFA 3L08A 2LXCA 2RD0A 3U7DA 2Z0EB 4KVGB 4MJSA 1EUVB 5DPWA 2KWVB 2JY6A 3OJ3A 2FCQA 1R4MI 2DENB 2ZJDA 1CMXB 1X1MA 2KTRB 2EMSA 3PRZA 4GDKB 4OVVA 4FLHA 3RULA 1Z5SB 4KSLC 4W9GA 5KHOA 5HKHA 4CYEA 2ZVNA 3TMPB 3H7SA 3KVFB 1WRDB 2R2QA 3ZKJC 4EZJA 2LD9A 5D94A 2NBWB 2BWES 2FIFA 2MBOA 1UD7A 1KM7A 4GDLA 3ZW3A 4BKGA 2C7MB 4EEWA 2AL6A 2ZNVC 4IWPA 2XK5A 4E3CA 4PS3A 1ZKHA 2Z0DB 2ZVOA 4F7ZA 1IYFA 4XZ4A 2R2OA 3ZUNA 5JHAA 3VUWA 4G0NB 2DYMA 3UQAA 2CKHB 1WGDA 2HE7A 4KZCA 1E90A 4AP4C 4ZYNA 5CHWA 5EDSA 3MJWA 3VTUA 3QK0A 3W1SC 5AZHA 4GN1A 4IUMB 1VD2A 1LXDA 2Z59B 1D3ZA 3Q3FA 1WR6E 2D2QA 4ZRJA 2N9EB 2D3GA 4EZLA 3PLUA 2AEHA 4BKSD 2K39A 2UYZB 2O6VD 3ZNZB 2KZRA 2CHWA 5IAAC 3ONSA 2M8SA 3S2AA 2K25A 4HK2A 3K9OB 4WWOA 4K81A 1WGRA 3KUZA 1E7VA 4DHJD 3T9LA 2GBMA 4TUUA 1WMHA 4FADA 1P1AA 4DWFA 1WIAA 2MRPA 2PEAA 2DAFA 3NHEB 5G55A 4DHZE 4G50A 5J2RA 1WJ4A
chains in the Genus database with same CATH superfamily
3DVNU 2JZPA 5IOIA 1VZ7A 2E6XA 5LXHA 3ZLZA 3P4PB 3B2GA 3UI3A 2IZVB 4MGYE 2L00B 3TUOA 4M0WA 4RH6A 2L83A 5BO4B 3VH3B 1D5MC 1L4ZB 2QC8A 4NPNA 4EKUA 3NRZA 1V1PA 2JWUA 1F1HA 2WQYB 4HVBA 3A1QB 2MBQA 4ZHPA 2K9XA 1FRRA 4LK0M 3BYYB 1GB4A 2WP9B 2AYOB 2IO0B 2KJRA 4TKNA 3TEYA 5IN7A 5EE3A 5AUIA 1E0ZA 2OJWA 3AMZA 3ML8A 3Q8FA 4MT5A 2BYVE 3FKYA 2L3ZA 1E6EB 4MH8A 3P4QB 4W9HA 2YLMA 3KLSX 2GI9A 2JSVX 4PK1A 5AZFA 3PO0A 4W9FA 2O2VB 2RGFA 4PS8A 3W5VB 4IG7B 1M94A 3QHTA 3WAMA 2KDIA 2JRIB 3WIMA 4A6QA 2RMMA 2C9WB 1FD6A 2BVCA 3RN9C 1FCLA 4M01A 2IY0B 4A55A 1NBFC 3ZIMA 4W9JA 4C56C 1ZUD2 3RNAC 2FAZA 5C3JB 3Q8AA 4LLGM 3ZQ4A 2MBEA 4DXAB 3U30A 3SR6A 2YVCA 3NVYA 3GE3C 2AQ2B 5JZEB 1F0ZA 1UGJA 3A4SC 4W9CA 2MW5A 3GOEA 3CIRB 3CF6E 1L0VB 4L23A 2LI5A 3DHGC 4P6VF 1AYFA 3C19A 2C7NB 4AQ7A 3DHIC 4HCPB 2M0XA 4ZDVA 3BY4B 4TSSA 1EWYC 2QCZA 3W9CB 3PV1A 3VFKA 3M3JA 2KO3A 1V6EA 3WAPA 1VR9A 5E6JA 2M0AA 3IG3A 3P2BA 1MI0A 3DBRI 2K22A 2DLBA 2KJHB 3NS1A 4WQMA 4ANWA 1PFDA 4OVZA 1K53A 4X57B 4DDGD 3RMKC 4M8NA 2IYDB 4MM3A 2RR9A 2ZCCA 5J17A 2K8BA 1I4PA 2FCSA 1WWTA 3E9SA 4PYUA 4JWUC 3HVZA 1FNVA 1QF6A 3ZXVA 2MJEA 2KX0A 3HIZA 1ZOYB 1KLUD 1S1QB 3SD5A 3UQBA 2WLBA 3Q8EA 4BVUC 1I4RA 1WYWB 2I38A 3P4SB 2DWQA 1IGCA 5AZGA 2XBBC 2BYEA 2I1JA 2VH2A 1CQVA 1WJNA 1T0YA 3U7ZA 4ACFA 1VCBA 3PZDA 1IP9A 2EMTA 4K7WA 3OLMD 1JRPA 2K6QA 1Y8RC 3ETRA 4ZRIA 2WXHA 2PMVA 4B95A 1I7HA 2G3QB 3BWUD 1PGXA 3MTNB 2REXA 1PGBA 3DPDA 5FR6A 3A9KA 1WMHB 1OQYA 3DDCB 2FCMA 3R2TA 4CQNA 4US8A 4WWNA 4W9DA 1NYQA 5BYRA 1Q10A 3VTWA 3P4RB 2MP2A 2IPKD 1Q0WB 3OWEB 1BXTA 1H4RA 2N0SB 2V4IB 3EECA 3W1YA 2QHOA 2UWQA 3GZNI 4NQLB 2INPE 3PT2B 2IGDA 3RCZA 1RM6C 2SAKA 1L0XB 3DOWA 2EKIA 2E3TA 3PREA 2KFJA 4PYZA 5DPSA 1WF9A 4HXDA 3B2FA 5EE1A 3V60A 2N7EA 5D3IB 1PUTA 3ENEA 4DHZB 2XNAC 1WXVA 4USAA 2DZJA 1HZ5A 2RDBC 1TYGB 3A9JA 1TGZB 2KXJA 2WDTB 4AS1A 2N1VA 2V0GA 3PTFC 1NDDA 2K8CA 3L10B 1GC6A 1N61A 2KACA 2I2YA 2JX5A 5CHVC 2QJLA 2W54A 5D6JB 3ECIA 1I42A 1V5TA 2ZCBA 4ARIA 3IXSA 1RRBA 2O6VB 3AEGB 1P7EA 3AEEB 2K8HA 4R3DA 2EKEC 1E8YA 4P7IA 1MVKA 2JPHA 4BOSC 4URKA 1R4NI 3NZSA 4GXBA 1XLPA 4KDLB 2L76A 4NZLB 5G5GA 3DVGY 2WWZA 4BKTA 2QILA 4L1BA 4P16A 5CTRC 3QWZB 5L95C 4LDTD 4MELA 4FHKA 2LGSA 1BMLC 3C0RB 2KFKB 4HKQA 2VZKD 1DOIA 2WX1A 3RNFC 3ZTDA 1SE2A 4KGRA 2CR5A 5CHFA 2VH1A 1SF0A 2WHIA 2ACZB 3OJ3A 2ZJDA 3I5JC 2DENB 2KTRB 2EMSA 3VR9B 4FLHA 3RULA 1Z5SB 2J4XA 4EZJA 1JWSD 5D94A 4ARCA 4GDLA 4EEWA 2MH7A 2WXPA 2MHJA 4PS3A 1ZKHA 4XWWA 1JMLA 5JHAA 4G0NB 1KRHA 4KZCA 4AP4C 2KN4A 3CWIA 3GP7A 4HKZE 1EWCA 1F52A 3IAM1 4L2YA 1V8CA 2WXQA 1B9RA 2AEHA 2K39A 2UYZB 4XGAB 1YJJA 1MHXA 2WXIA 2O6VD 4YSXB 3ZJVA 2KZRA 3K9OB 2WXFA 4WWOA 1SJED 2IGHA 2GBMA 1P1AA 4DWFA 1WIAA 2MRPA 2N9LA 2PEAA 4DHZE 1TTNA 4ANVA 3TCAA 4ICUA 3JSVA 4HPMB 4WQOB 2GMIC 1SBBB 1BT0A 5E6OA 2J0MA 3PHWB 2BT6A 2M4NA 4YTNB 3OAWA 2IO1B 4NJCA 1KLVA 3W1SA 2J7QB 1XXGA 1YN4A 3H7PA 2BGFA 4JGHB 4OVUA 1VLBA 1DOXA 3HRDD 4FJZA 3X0WA 4PS7A 3VH4B 2IBIB 1T0QC 4GB9A 1IPGA 1UNSA 4JL9A 3BYTB 4YSYB 4B0MA 3AE5B 5D3DA 5FR3A 1XLNA 3UIOB 2V3NA 1EF1A 2TSSA 3FAHA 4B6WA 1WH3A 1TBEA 4KKJA 3BVGA 3U4EG 4RF1A 1V2YA 3APCA 4DDID 3IFWB 1FMAD 4KZ0A 1ACCA 1WR1A 3VUXA 1WZ0A 1VZ6A 3KYCD 3TIXA 2DHZA 1D6EC 1XCTL 2JZZA 4LJOB 2FIDA 1K8RB 3CSFA 4I6LB 2L52A 1HXYD 3PRMB 4EOYA 1N63A 2MJ3A 4BKSA 1TZ1A 1WGYA 1EU4A 2K1FA 4FN2A 4ZRQA 1NYRA 4KGTA 2K3UA 4KIKA 2MSED 2WXMA 1E10A 3TEWA 3QQ8B 2BPSA 2IY1B 3QA8A 2D3CA 2ASQA 1F2RI 2C7HA 2J0KA 2C5LC 3RFZB 3IVFA 3M63B 2AQ1B 1WYGA 1FCCC 2LVOA 3WANA 5CX3A 2RPVA 2AQ3B 1PQSA 3EHVA 4MSQB 4J3OD 5MPOA 1Q5WB 2QEJC 4F1SA 2KQSA 4EFOA 2CHZA 4WJQA 2LZ6A 1MHHE 3PLVA 4GDKA 4GGQA 4JX1C 2Y5CA 2MWSB 1SB3C 1SEBD 1QZEA 1WJ6A 2DZIA 2NS5A 3L13A 3NZUA 4NAWB 2ICIA 3NY5A 2KK8A 2LASA 1WXQA 3KW5B 2HTME 2KJ6A 4C7ZA 5TR5A 2BF8B 2BB6A 1RFKA 5BMGA 1YJ1A 2BS4B 3ABVB 3MFGA 2ONQA 4FJYA 3O65B 3Q8BA 2LXAA 3PSEB 1CK1A 1WGKA 2RDGA 4IM2A 3KH0A 4A20A 1UUPA 1L7YA 2JVCA 2N7JA 3EFCA 4RM9A 2BKFA 1C78A 2L05A 5E6NA 4AOFA 4FA6A 5BYSA 4DXFA 3AU4A 1J19A 4WAFA 3PZ8A 1V81A 1M4VA 1PGAA 2GB1A 2KC2A 3URYA 4ZRPA 1EO6A 3AECB 4JPSA 2XK5B 5BYQA 3X23A 1TT5B 1IBXB 2WDQB 2X8XX 2W3RA 4WJPA 3BZDB 4KX6B 3UF8A 3IBEA 1JQ4A 1ZW7A 2HJ8A 2KDEB 1SGHA 1V86A 3QCAA 4H2AA 2NBVB 4LNFA 3SHQA 3UGBB 3HM6X 4NNJB 3A1QA 3V05A 1E8WA 1SXTA 1GJZA 2JF5A 2KDBA 3L17A 4IKGA 3PHXB 2MX2A 1I4XA 1FO4A 1S3SG 1C3TA 2IO3B 1WM3A 1HEZE 2WXKA 2LGIA 2SEBD 2N9PC 3AE2B 1V80A 1YQ3B 1IGDA 1UELA 4II3B 3AI5A 3D32A 3CMMB 4A3PA 1FRDA 2L0FA 3BINA 4C4VB 2DZMA 2KD0A 3DVGX 4QAYA 5EE0A 3R66C 2O2VA 4C7YA 4KKIA 3DBLB 1JW9D 3FILB 2G45B 2J52A 4K1RB 3MJ5A 4YTMB 2ZZPB 5E6PA 2A5UA 4I6NB 1XT9B 2WXNA 4I6PA 2YEPB 3VTVA 2I1KA 4BBNC 3ALBA 4RNAA 1TIFA 3O13A 1STEA 1FXIA 1G6JA 1C4PA 3SEBA 1I4GA 4ZOHC 2K6DB 3KYDD 5T8IA 1JRUA 2KC1A 4HRSA 2J0JA 2N7DA 4NAMA 2YEPF 5AUKA 2Q5WD 1OQRA 3SFDB 4AUQC 4TQ1A 2JU6X 2LVPA 4YTPB 3V61A 1TS2A 3RD2A 4TQ0A 1ZXHA 1KFYB 1WI0A 1SIFA 1UZXB 1XLQA 3TEXA 2PW9A 4YXDB 4N58A 1F9JA 1C76A 1AWDA 3A9KB 3DBHI 1UH6A 3I63C 3Q6BA 3R2IA 5IKCM 3AXCA 4B0EA 2BS2B 4AJWA 5LXIB 1E5WA 4IM0A 1UGMA 1VRAB 2AWTA 2M17A 3ZRFA 3I57A 2LXCA 2RD0A 1EUVB 2JY6A 1L6UA 1WRDB 2R2QA 3PZ7A 3Q3MC 4OW0A 2LD9A 3ZYYX 1PDXA 2MBOA 2AX5A 4BKGA 3KWVA 2AL6A 5I4DA 2ZNVC 1XO3A 3N1XC 2CU3A 2Z0DB 2ZVOA 1IYFA 2KDMA 3DWGC 2DYMA 3UQAA 2HE7A 1KF6B 1E90A 1KH0A 3MJWA 3VTUA 4GN1A 3Q69A 1FFVA 5IP4D 2N9EB 4EZLA 3PLUA 2PKOA 1V97A 2FBWB 3MC0B 3ZJUA 3ZNZB 4C00A 2W55A 2LMCA 2OEDA 5C2TB 3DHHC 3S2AA 1N5XA 2PLPA 4K81A 1E9MA 1E7VA 3T9LA 4BZAA 1WMHA 4FADA 5G2NA 5J2RA 2MEKA 2KMCA 4GSWA 4TMAB 4TV3A 2WXGA 1XEEA 4S17A 1MG4A 4HEA1 4FJVB 3KWLA 4HJKA 2HTHA 2KNBA 2MLBA 4K3CA 2HD5B 1QILA 4FBJB 5L83A 1JROA 1SIJA 2JUOA 2L32A 2NR2A 2EELA 2D10A 4WH4A 1ZDVA 3P42A 3NVWA 2X38A 2QMTA 1FIQA 1SSNA 5D2MB 1A70A 4XDCA 4WJOA 4FXCA 2L8JA 4M02A 1I4HA 3RNBC 4XYCA 2INDC 2KQ7A 4HDQA 4D2KA 2BTEA 1PYWD 3EGRA 1EF5A 1RLFA 2NCNA 2CU1A 4RCOA 2BW2A 1V5OA 1J7AA 1H8CA 3N20C 1FNUA 4A8XC 2MCNB 4MH0E 1R4MB 2JQRB 4GMVA 3ZVVA 1MG8A 2MBBB 1AARA 1A5RA 1C77A 1LM8B 2ZW1A 4ZYSA 2O6VA 4IDIA 4JIOU 2FUHB 4KGSA 2NPTB 5H92C 1LQBA 1P7FA 1FNWA 3EFUA 1ESFA 3EC8A 4M00A 5BMIA 3MC9A 2DBYA 5C1ZA 2A4ZA 4LTUA 3VHTC 1LO5D 1WX8A 4HDOA 1TS5A 2D07B 5IA7A 3L54A 2DAJA 3B08A 3JVZX 3JSVB 4LJPB 3AB5A 5JHBA 5HI1A 1QLBB 3M62B 1T5XD 2KFKA 2WNMA 2LEKA 1UBIA 2KTFA 3V3XA 2LRWA 4YL8A 1ET9A 3IT4B 4XE0A 1KJTA 4GOCA 3WAOA 2WXJA 1UWMA 4MACA 4A90A 4WIPA 1P9DU 3DVNV 2G1EA 2V9HA 2Y5PA 2WU5B 3ZO5B 3N32A 1Y56A 3IHPC 4S0RA 2WXLA 2OHFA 1YNTE 1WM2A 3LJ3A 1ZXIA 4A9AA 3L16A 3DBRB 3C8YA 1FFUA 2RDHA 2JYTA 2K5PA 1OEYA 2NTTA 4NY0A 2GBRA 3U8ZA 1NI3A 3PGEA 1FXTB 5LNK1 2J42A 2B3AA 3WA0A 1XF5L 3RNCC 1WE7A 2WGSA 1NVID 1OGWA 4BBNF 4MJSB 4JE3B 4DXGA 3NG0A 5FK9C 3HK0A 3P63A 3NVZA 4US9A 3B1LX 2LWPA 2WXOA 3AM9A 2BYTA 3L0WB 1OQQA 2GBKA 4HCNB 4RMAA 2KWUB 3K9PB 2MA9B 1DOYA 3I3TB 1ZP0B 4RGNA 2KWCA 4K3BA 3AEDB 2CJOA 3MP9A 3JW0X 3DWMA 2LRUA 3KQ4A 4W9LA 2N9XA 4M8MA 3AH7A 3H1UA 1WX9A 2HDEA 2LUEA 3HHMA 2ZEQA 4F8CB 1MFWA 1CZPA 3Q14C 3RZFA 1ZE3D 4NQKE 4XWTA 2M1MA 1VZ8A 1FXAA 1Q1OA 5D7GA 1JWUD 2WDVB 2INCC 1QQRA 1I35A 3PPAA 3TL5A 3CSTA 2V3SA 1DGJA 1FPYA 1SE3A 3AEFB 2FNJB 2ZNVB 5JH5C 3LDZE 5C23A 1YJIA 3GZNB 3UIPB 3VUYA 2JXXA 4M0WB 4KSKC 5KHQA 5GMVA 1GOZA 4NJ6A 1YMHE 3T8MA 1HTOA 2QDFA 4GIVA 1V1PB 2MBHA 3AE3B 1QOAA 1XD3B 2MJDA 3QARA 4II2B 3APFA 2LGDA 4LCDE 2G9HD 1P0RA 3AE7B 3W5UB 1E7PB 2KVZA 1YN5A 2LVQA 4HWIB 2LGYA 1ISNA 1D5XC 1YIWA 2BQQA 1D5ZC 3RUIB 2NTSA 4P1CC 2LHDA 2GRIA 4N59A 4WWPA 2IO2B 2N4FA 4E74A 2JXTA 3KUCB 3ZNID 1N6ZA 4KV2A 4RFBA 3QJZA 2BYFA 1ZDXA 3NJTA 1QOFA 3WCQA 3QX1A 1GB1A 4MGIE 4WAAA 2NVUI 5DCNA 1L6VA 2JT4B 2WU2B 3V62A 2ZPYA 3Q3JA 3OJ4B 2ON8A 4E71A 4RM8A 3VQIA 1FEHA 1K52A 3AU5A 3NZ3A 4RGOS 2KWDA 4XDDA 4XX5A 4EUTA 3VRAB 2PE6B 1UBQA 1P98A 4NAWA 4DHJB 1R4NB 1NEKB 3A4RA 3PS6A 2NMQA 2LFIA 3LB8C 3JYUA 3B0AA 2G4DB 2M56B 1JWMD 1OFFA 3ZRCA 1TS3A 4W9IA 1XCQL 2JRHA 2KLCA 1WE6A 3VDZA 1KOTA 4IW0A 2BS3B 3V6EB 3TBLD 1QT9A 2FCQA 1R4MI 2L1AA 5BMHA 1X1MA 4OVVA 2JYEA 4KSLC 4W9GA 1ET6A 4CYEA 3H7SA 3ZKJC 1UWXA 2FIFA 2FE8A 3ZW3A 3RPFC 2XK5A 4E3CA 1IBXA 2KAJA 3ZUNA 1F77A 2CKHB 1WGDA 4OZCA 1AW7A 4ZYNA 1DYQA 3BVMA 5EDSA 3SFEB 3W1SC 1T0RC 1VD2A 1LXDA 1AN8A 2Z59B 1D3ZA 1WR6E 1MJDA 1J7BA 4ZRJA 1YQ4B 4HJGE 1BUIC 1SJHD 4MM3B 2CHWA 5IAAC 3ONSA 2M8SA 1L5PA 2K25A 2D3BA 3BVZA 1WGRA 3KUZA 4DHJD 3Q3NC 4TUUA 3OG5A 1WJ4A 1TS4A 1V49A 1WJUA 1TY2A 3N1ZC 2GOWA 2KVRA 3TSSA 4BFRA 3RNEC 4DK5A 4C4VA 1WXMA 3HUIA 1RAXA 4ZHOA 2XEWA 1HE8A 1JWBD 1QOGA 1Z2MA 4ITKA 1V1OA 3FILA 4BAXA 2PVOD 2V1YA 4N6EB 2LJ5A 2RPQA 4CHKA 1GUAB 3Q2AC 1CJEA 3DQVA 2PIAA 4XC2A 3PVLA 2GBJA 2FUG1 4HLEA 1I4QA 2OOBB 1K51A 4ICVA 3DCGA 2MP2B 2KHWB 3R3MA 3NVVA 3ZTCA 3VR8B 2LGXA 3IAS1 1U4AA 3AE8B 1C9FA 4REZA 1WZ3A 4NJ7A 3A33B 3N9YC 2KMAA 3AE1B 1GAQB 1WGGA 5HHDG 4MEMA 2BB5A 1KTKA 2LJIA 1RFAA 2PTLA 4G3XB 1GNUA 4YWGG 4UDUC 3RT3B 1XQQA 3ZGZA 2MQJA 1GC7A 3AE6B 3H6NA 2LUMA 3BK1A 3KUDB 3APDA 2IGGA 4IOIE 2OJRA 4N9F4 3GB1A 2NBUA 3A9JB 3RZWC 1J7CA 1LFDA 3AN1A 4HPLB 5DPTA 2INNE 1L0YB 2KOXA 1K50A 4J6IA 4WJNA 3AV8A 1TKGA 4LNKA 4OZBA 1YX5B 2KDFB 4B9KA 2DZKA 2CJNA 2W9NA 1KLGD 4LDTB 2GBNA 3QAQA 2DNFA 4ZRKA 4IWOA 1TKYA 4GU2A 3DBSA 4LNOA 2VZKB 3AEAB 2D11A 2W82A 4A3OA 2JZ3B 3LYYA 3V6CB 2BBCA 3ZXRA 4WWMA 4FHJA 3VXWA 3VVWB 4JQWC 1NENB 3J9CA 2BKRB 1XLOA 2RSUA 2Y5BB 3N30A 3N3KB 1YX6B 4IWQA 2KKCA 4MGKE 3E56A 4AWJA 3PRPB 3ZJTA 1C4CA 3SDLC 1SE4A 1J0GA 1WRIA 2H89B 2M19A 1R7SA 4YT0B 5J18A 2AL3A 3L4PA 4HPPA 3I9V1 3AE9B 2UU7A 1TY0A 2WS3B 1VJKA 5LLIA 2DX5B 1HTQA 1T0SC 1OTRB 1E7UA 4HROA 5HG2A 2LHEA 2QSDA 4GDLB 3MHSD 4MDKE 1YOVB 3NOBA 4DBGA 3RYTA 3QIJA 4MSMB 3WALA 2J53A 2L7RA 2W3SA 1HA5A 1P3QU 1ZPSA 2VRRB 4K7UA 4CO7A 1J8CA 2Z8LA 2D3AA 3EA6A 2WXRA 1YN3A 1C1YB 3ML9A 3TJPA 1EU3A 3AEBB 1C79A 4WURA 5AEKB 2KN5A 3M95A 3R7RA 2D5GA 3P1MA 3ZDMC 2PJHA 1B1ZA 4RF0A 3Q3OC 5DPRA 1E8XA 3ZNGC 4C80A 2KX3A 2V4LA 4MGZE 4LNIA 4LNNA 2BWFA 1WSPA 1YD8U 2DYOA 2WX0A 2K0PA 3VAWA 2PPHA 4P1BC 4ASWC 1GG3A 4RGMA 4W9KA 3NUHB 3HM3A 1N62A 1L2NA 3MHZA 1TKEA 1WXAA 1WXSA 1HZ6A 3TEZA 1RWSA 3ZNHB 2L0TA 3Q8CA 3SU8X 1ENFA 1YQBA 3GE8C 2KMMA 1C4AA 5EE9A 5TSSA 3GS2A 2GLSA 1SE9A 1MPEA 2WYQA 3H7PB 2KTRA 4OHJA 4YSZB 3BIID 4DQOC 3HVDA 3H8HA 3DBLI 4GLSC 4FULA 1EM7A 2NPTA 5IO9A 2KLGA 2PE9A 2KANA 3T3NA 1OEYJ 1QOBA 1TZOA 2FCNA 1JWAD 2N1WA 1E8ZA 3N1YC 4JLCA 4IM3A 1QKZA 5H8YE 4OZAA 4ANUA 3LXFA 1WGHA 5GXGB 3QC8B 3FC4A 4G11A 5G5HA 3BK2A 3NS8A 3UINB 2JWZA 2G4SA 2ZPNA 2C60A 4ANXA 2ZW0A 3H9DA 1FM0D 1T3QA 3W2DA 3EUB2 2IDYA 1VDVA 2KT7A 2KYWA 1WX7A 3AULA 1GPXA 4Q2JA 5HFYA 4K7SA 4KIKB 3R7QA 4EZKA 2CS4A 4W9EA 1ZGUB 3DBHB 2WDRB 4KDIC 2Y3AA 5JXVA 1D4BA 2HJ1A 1N60A 1JCKB 1TJEA 4PT5A 3RNGC 1NI2A 3ZDTA 1IUEA 2CHXA 4EE2A 1V9JA 4O1NA 4BOZB 1WFYA 1L4DB 1WY8A 2DYBA 2B76B 4AJYB 2V3PA 3L08A 3U7DA 2Z0EB 4KVGB 4MJSA 5DPWA 2KWVB 3R8BA 3PRZA 1CMXB 4GDKB 1F2RC 1RYJA 5KHOA 5HKHA 4RGTA 2ZVNA 3TMPB 3KVFB 5FKAC 2R61A 3AE4B 1T6BX 1JALA 2KQ4X 2BWES 2NBWB 1UD7A 1KM7A 3RI7C 2C7MB 4IWPA 4F7ZA 4XZ4A 2R2OA 3VUWA 2QIEB 1LGRA 2PVGC 3VRBB 5CHWA 3QK0A 5AZHA 3U2SC 4IUMB 3IT6B 3Q3FA 2D2QA 2D3GA 2IJ0A 1N5WA 4BKSD 2N9KA 3MC8A 2H88B 3U52E 3T3OA 4HK2A 4JWSC 1HQRD 1ROEA 3B9JA 1UF0A 2XN9C 3NHEB 5G55A 2DAFA 4IC7B 4G50A
chains in the Genus database with same CATH topology
3DVNU 1TTNA 1V49A 4ANVA 2KMCA 4GSWA 1WJUA 4ICUA 4TV3A 3TCAA 3JSVA 4HPMB 4WQOB 2GMIC 2GOWA 2KVRA 1BT0A 5LXHA 5E6OA 2J0MA 3ZLZA 4BFRA 3PHWB 4FJVB 2M4NA 2IZVB 4DK5A 4MGYE 1WXMA 2L00B 2HTHA 4HJKA 3OAWA 2IO1B 1RAXA 2XEWA 1KLVA 3W1SA 2J7QB 2KNBA 1HE8A 1Z2MA 5BO4B 3VH3B 3H7PA 2MLBA 2BGFA 2HD5B 4JGHB 4OVUA 4FJZA 4NPNA 3X0WA 4EKUA 4FBJB 5L83A 2V1YA 2LJ5A 2JUOA 2RPQA 4PS7A 2NR2A 4CHKA 3VH4B 1GUAB 2D10A 2IBIB 4GB9A 4HVBA 3A1QB 1IPGA 2MBQA 4JL9A 5D2MB 3DQVA 4WJOA 4XC2A 3UIOB 3PVLA 2GBJA 2AYOB 2L8JA 1EF1A 4HLEA 4B6WA 1WH3A 2IO0B 2KJRA 4TKNA 2KQ7A 2OOBB 4HDQA 1TBEA 4ICVA 1EF5A 1RLFA 1V2YA 3ML8A 2BYVE 3APCA 2L3ZA 4DDID 3DCGA 2MP2B 3IFWB 2NCNA 2CU1A 2KHWB 4KZ0A 3R3MA 1WR1A 3VUXA 1WZ0A 3KYCD 4W9HA 3ZTCA 3TIXA 2YLMA 1V5OA 2DHZA 2JZZA 2LGXA 4LJOB 5AZFA 1U4AA 2FIDA 1H8CA 4W9FA 1K8RB 1WZ3A 4NJ7A 2MCNB 3A33B 2O2VB 2RGFA 3CSFA 4I6LB 4MH0E 4PS8A 4IG7B 1M94A 2KMAA 4GMVA 3ZVVA 3QHTA 1MG8A 4EOYA 1WGGA 2KDIA 2JRIB 3PRMB 3WAMA 3WIMA 4MEMA 2C9WB 1AARA 2MBBB 1A5RA 1LM8B 1RFAA 4BKSA 4G3XB 1TZ1A 1WGYA 1GNUA 2O6VA 2K1FA 4FN2A 4JIOU 2IY0B 4W9LA 2FUHB 3RT3B 1XQQA 2NPTB 1NBFC 4KIKA 2MSED 1LQBA 3ZIMA 4W9JA 3QQ8B 2BPSA 3EFUA 2MQJA 3EC8A 2IY1B 1GC7A 2FAZA 3QA8A 3H6NA 5C1ZA 2A4ZA 2ASQA 3VHTC 1WX8A 4DXAB 2C7HA 2J0KA 2MBEA 2C5LC 3KUDB 3APDA 4HDOA 3IVFA 3M63B 3U30A 2OJRA 2D07B 4N9F4 2NBUA 5IA7A 3L54A 2DAJA 3A9JB 3B08A 3RZWC 3JVZX 3JSVB 4LJPB 2YVCA 1LFDA 2LVOA 3WANA 5JHBA 5CX3A 4HPLB 5JZEB 3M62B 2KFKA 5DPTA 1PQSA 1UBIA 2KOXA 3EHVA 4MSQB 3A4SC 4J6IA 4WJNA 2KTFA 4W9CA 2LRWA 1Q5WB 2MW5A 4YL8A 3GOEA 4F1SA 2KQSA 3CF6E 1YX5B 2KDFB 4EFOA 2LI5A 1KJTA 2CHZA 4B9KA 2DZKA 4WJQA 4GOCA 3WAOA 2LZ6A 2W9NA 3PLVA 4LDTB 2GBNA 4GDKA 4GGQA 2C7NB 3QAQA 4ZRKA 4IWOA 4HCPB 2MWSB 4GU2A 3DBSA 2M0XA 1P9DU 3DVNV 1QZEA 4ZDVA 2D11A 3BY4B 1WJ6A 2DZIA 4A3OA 2JZ3B 3ZO5B 3N32A 2NS5A 3IHPC 3PV1A 3VFKA 3L13A 3M3JA 2KO3A 3NZUA 4NAWB 1WM2A 3NY5A 3V6CB 2KK8A 3LJ3A 2LASA 4FHJA 1V6EA 3VVWB 3VXWA 3WAPA 3KW5B 3L16A 4JQWC 2KJ6A 3IG3A 3P2BA 3DBRI 5TR5A 2BF8B 2KJHB 1OEYA 2BKRB 3U8ZA 4NY0A 2GBRA 2RSUA 3PGEA 1FXTB 4ANWA 2Y5BB 3N30A 2B3AA 3N3KB 1YX6B 3WA0A 1YJ1A 4DDGD 4X57B 1WE7A 4IWQA 4FJYA 4M8NA 3O65B 2KKCA 2IYDB 2LXAA 3PSEB 4MM3A 4MGKE 1OGWA 4AWJA 2RR9A 2ZCCA 5J17A 3PRPB 2K8BA 4BBNF 2FCSA 4IM2A 3KH0A 3SDLC 1J0GA 4A20A 4PYUA 5G2NA 4RM9A 1L7YA 2JVCA 5J18A 4MJSB 2AL3A 2BKFA 2L05A 5E6NA 4AOFA 4FA6A 3HK0A 2KX0A 3B1LX 5LLIA 3AU4A 1J19A 3HIZA 2LWPA 1S1QB 3SD5A 2DX5B 3UQBA 1V81A 3L0WB 2GBKA 1OTRB 4BVUC 1E7UA 4HCNB 4RMAA 1WYWB 2KWUB 3K9PB 2KC2A 2MA9B 4GDLB 1EO6A 3MHSD 4MDKE 3I3TB 2KWCA 3NOBA 4DBGA 3RYTA 2XK5B 3QIJA 4MSMB 5AZGA 3WALA 3X23A 2XBBC 2BYEA 2L7RA 4IC7B 2I1JA 1P3QU 2VRRB 4K7UA 1WJNA 4CO7A 1T0YA 1J8CA 4WJPA 3UF8A 3IBEA 3JW0X 2LRUA 1ZW7A 1VCBA 2HJ8A 3PZDA 1IP9A 1C1YB 2KDEB 1SGHA 1V86A 2EMTA 2N9XA 3ML9A 3OLMD 3H1UA 1WX9A 4K7WA 4M8MA 2LUEA 3TJPA 2K6QA 3QCAA 3HHMA 2ZEQA 2NBVB 5AEKB 1Y8RC 4F8CB 3SHQA 3UGBB 4ZRIA 3HM6X 2KN5A 4NNJB 3M95A 3R7RA 3A1QA 3RZFA 3ZDMC 1E8WA 2PJHA 4NQKE 4B95A 2M1MA 5DPRA 1E8XA 2G3QB 1GJZA 1Q1OA 3ZNGC 2KX3A 2V4LA 3MTNB 2JF5A 4MGZE 2KDBA 3L17A 2BWFA 5D7GA 1YD8U 2DYOA 2WX0A 2REXA 3PHXB 3DPDA 2MX2A 5FR6A 2PPHA 1S3SG 3A9KA 3VAWA 4ASWC 1WMHB 1C3TA 2IO3B 1OQYA 3DDCB 2FCMA 1GG3A 1WM3A 4WWNA 1I35A 4W9DA 3PPAA 4W9KA 2N9PC 3HM3A 3TL5A 1V80A 3CSTA 1L2NA 2V3SA 1WXAA 1WXSA 1UELA 3VTWA 4II3B 2FNJB 2MP2A 2ZNVB 3AI5A 3LDZE 5JH5C 3D32A 3CMMB 5C23A 1Q0WB 3ZNHB 4A3PA 2L0TA 2L0FA 3SU8X 1H4RA 1YQBA 3W1YA 3EECA 3UIPB 3BINA 3VUYA 2JXXA 2QHOA 2UWQA 3GZNI 2DZMA 2KD0A 4NQLB 4M0WB 3DVGX 3R66C 2O2VA 3PT2B 3RCZA 4KSKC 5KHQA 1SE9A 5GMVA 2WYQA 4NJ6A 3H7PB 2KTRA 3DOWA 3T8MA 4GIVA 2G45B 2MBHA 3DBLI 3PREA 4FULA 2KFJA 4K1RB 4PYZA 1WF9A 5DPSA 4HXDA 2NPTA 3V60A 2ZZPB 1XD3B 3QARA 2KLGA 2N7EA 2PE9A 2KANA 5E6PA 4II2B 2A5UA 1OEYJ 4I6NB 3APFA 2LGDA 4LCDE 2FCNA 1XT9B 2N1WA 1E8ZA 3ENEA 4I6PA 4JLCA 4DHZB 1WXVA 1P0RA 4IM3A 3VTVA 2I1KA 4BBNC 3ALBA 2DZJA 4ANUA 1WGHA 2LVQA 3QC8B 4HWIB 2LGYA 1ISNA 1YIWA 3A9JA 4G11A 3RUIB 1TGZB 2KXJA 2WDTB 3NS8A 3UINB 1G6JA 2JWZA 2N1VA 4WWPA 2IO2B 2N4FA 3PTFC 1NDDA 4E74A 2K6DB 2K8CA 3KUCB 3KYDD 1GC6A 1JRUA 2KC1A 3L10B 2G4SA 3ZNID 4KV2A 2ZPNA 2J0JA 3QJZA 2BYFA 2N7DA 2C60A 4ANXA 3QX1A 4MGIE 4WAAA 3H9DA 2NVUI 5CHVC 5DCNA 2JT4B 3V62A 4AUQC 2ZPYA 3Q3JA 3OJ4B 4TQ1A 5D6JB 4E71A 3ECIA 1I42A 1V5TA 4RM8A 3VQIA 2LVPA 2ZCBA 1RRBA 3AU5A 1WX7A 3V61A 3RD2A 2O6VB 2K8HA 3AULA 4XX5A 4EUTA 4K7SA 4KIKB 4TQ0A 2EKEC 1E8YA 2PE6B 4P7IA 1UBQA 3R7QA 4EZKA 1P98A 4NAWA 2JPHA 1WI0A 4BOSC 4DHJB 3A4RA 1SIFA 2CS4A 3PS6A 4W9EA 1UZXB 4URKA 1R4NI 1ZGUB 3NZSA 1F9JA 4GXBA 4KDIC 3A9KB 3DBHI 2L76A 4KDLB 1UH6A 3DVGY 3JYUA 2WWZA 3B0AA 2G4DB 3AXCA 4BKTA 3ZRCA 1NI2A 3ZDTA 5CTRC 4AJWA 4W9IA 3QWZB 5L95C 1E5WA 5LXIB 4LDTD 4MELA 2CHXA 4FHKA 2JRHA 4IM0A 1V9JA 1WE6A 2KLCA 1WFYA 3C0RB 4BOZB 1WY8A 1UGMA 2KFKB 3VDZA 2AWTA 2DYBA 1KOTA 4IW0A 2WX1A 3ZTDA 2M17A 2CR5A 3V6EB 5CHFA 3TBLD 4AJYB 3ZRFA 3L08A 2LXCA 2RD0A 3U7DA 2Z0EB 4KVGB 4MJSA 1EUVB 5DPWA 2KWVB 2JY6A 3OJ3A 2FCQA 1R4MI 2DENB 2ZJDA 1CMXB 1X1MA 2KTRB 2EMSA 3PRZA 4GDKB 4OVVA 4FLHA 3RULA 1Z5SB 4KSLC 4W9GA 5KHOA 5HKHA 4CYEA 2ZVNA 3TMPB 3H7SA 3KVFB 1WRDB 2R2QA 3ZKJC 4EZJA 2LD9A 5D94A 2NBWB 2BWES 2FIFA 2MBOA 1UD7A 1KM7A 4GDLA 3ZW3A 4BKGA 2C7MB 4EEWA 2AL6A 2ZNVC 4IWPA 2XK5A 4E3CA 4PS3A 1ZKHA 2Z0DB 2ZVOA 4F7ZA 1IYFA 4XZ4A 2R2OA 3ZUNA 5JHAA 3VUWA 4G0NB 2DYMA 3UQAA 2CKHB 1WGDA 2HE7A 4KZCA 1E90A 4AP4C 4ZYNA 5CHWA 5EDSA 3MJWA 3VTUA 3QK0A 3W1SC 5AZHA 4GN1A 4IUMB 1VD2A 1LXDA 2Z59B 1D3ZA 3Q3FA 1WR6E 2D2QA 4ZRJA 2N9EB 2D3GA 4EZLA 3PLUA 2AEHA 4BKSD 2K39A 2UYZB 2O6VD 3ZNZB 2KZRA 2CHWA 5IAAC 3ONSA 2M8SA 3S2AA 2K25A 4HK2A 3K9OB 4WWOA 4K81A 1WGRA 3KUZA 1E7VA 4DHJD 3T9LA 2GBMA 4TUUA 1WMHA 4FADA 1P1AA 4DWFA 1WIAA 2MRPA 2PEAA 2DAFA 3NHEB 5G55A 4DHZE 4G50A 5J2RA 1WJ4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3DVN U;  1TTN A;  1V49 A;  4ANV A;  2KMC A;  4GSW A;  1WJU A;  4ICU A;  4TV3 A;  3TCA A;  3JSV A;  4HPM B;  4WQO B;  2GMI C;  2GOW A;  2KVR A;  1BT0 A;  5LXH A;  5E6O A;  2J0M A;  3ZLZ A;  4BFR A;  3PHW B;  4FJV B;  2M4N A;  2IZV B;  4DK5 A;  4MGY E;  1WXM A;  2L00 B;  2HTH A;  4HJK A;  3OAW A;  2IO1 B;  1RAX A;  2XEW A;  1KLV A;  3W1S A;  2J7Q B;  2KNB A;  1HE8 A;  1Z2M A;  5BO4 B;  3VH3 B;  3H7P A;  2MLB A;  2BGF A;  2HD5 B;  4JGH B;  4OVU A;  4FJZ A;  4NPN A;  3X0W A;  4EKU A;  4FBJ B;  5L83 A;  2V1Y A;  2LJ5 A;  2JUO A;  2RPQ A;  4PS7 A;  2NR2 A;  4CHK A;  3VH4 B;  1GUA B;  2D10 A;  2IBI B;  4GB9 A;  4HVB A;  3A1Q B;  1IPG A;  2MBQ A;  4JL9 A;  5D2M B;  3DQV A;  4WJO A;  4XC2 A;  3UIO B;  3PVL A;  2GBJ A;  2AYO B;  2L8J A;  1EF1 A;  4HLE A;  4B6W A;  1WH3 A;  2IO0 B;  2KJR A;  4TKN A;  2KQ7 A;  2OOB B;  4HDQ A;  1TBE A;  4ICV A;  1EF5 A;  1RLF A;  1V2Y A;  3ML8 A;  2BYV E;  3APC A;  2L3Z A;  4DDI D;  3DCG A;  2MP2 B;  3IFW B;  2NCN A;  2CU1 A;  2KHW B;  4KZ0 A;  3R3M A;  1WR1 A;  3VUX A;  1WZ0 A;  3KYC D;  4W9H A;  3ZTC A;  3TIX A;  2YLM A;  1V5O A;  2DHZ A;  2JZZ A;  2LGX A;  4LJO B;  5AZF A;  1U4A A;  2FID A;  1H8C A;  4W9F A;  1K8R B;  1WZ3 A;  4NJ7 A;  2MCN B;  3A33 B;  2O2V B;  2RGF A;  3CSF A;  4I6L B;  4MH0 E;  4PS8 A;  4IG7 B;  1M94 A;  2KMA A;  4GMV A;  3ZVV A;  3QHT A;  1MG8 A;  4EOY A;  1WGG A;  2KDI A;  2JRI B;  3PRM B;  3WAM A;  3WIM A;  4MEM A;  2C9W B;  1AAR A;  2MBB B;  1A5R A;  1LM8 B;  1RFA A;  4BKS A;  4G3X B;  1TZ1 A;  1WGY A;  1GNU A;  2O6V A;  2K1F A;  4FN2 A;  4JIO U;  2IY0 B;  4W9L A;  2FUH B;  3RT3 B;  1XQQ A;  2NPT B;  1NBF C;  4KIK A;  2MSE D;  1LQB A;  3ZIM A;  4W9J A;  3QQ8 B;  2BPS A;  3EFU A;  2MQJ A;  3EC8 A;  2IY1 B;  1GC7 A;  2FAZ A;  3QA8 A;  3H6N A;  5C1Z A;  2A4Z A;  2ASQ A;  3VHT C;  1WX8 A;  4DXA B;  2C7H A;  2J0K A;  2MBE A;  2C5L C;  3KUD B;  3APD A;  4HDO A;  3IVF A;  3M63 B;  3U30 A;  2OJR A;  2D07 B;  4N9F 4;  2NBU A;  5IA7 A;  3L54 A;  2DAJ A;  3A9J B;  3B08 A;  3RZW C;  3JVZ X;  3JSV B;  4LJP B;  2YVC A;  1LFD A;  2LVO A;  3WAN A;  5JHB A;  5CX3 A;  4HPL B;  5JZE B;  3M62 B;  2KFK A;  5DPT A;  1PQS A;  1UBI A;  2KOX A;  3EHV A;  4MSQ B;  3A4S C;  4J6I A;  4WJN A;  2KTF A;  4W9C A;  2LRW A;  1Q5W B;  2MW5 A;  4YL8 A;  3GOE A;  4F1S A;  2KQS A;  3CF6 E;  1YX5 B;  2KDF B;  4EFO A;  2LI5 A;  1KJT A;  2CHZ A;  4B9K A;  2DZK A;  4WJQ A;  4GOC A;  3WAO A;  2LZ6 A;  2W9N A;  3PLV A;  4LDT B;  2GBN A;  4GDK A;  4GGQ A;  2C7N B;  3QAQ A;  4ZRK A;  4IWO A;  4HCP B;  2MWS B;  4GU2 A;  3DBS A;  2M0X A;  1P9D U;  3DVN V;  1QZE A;  4ZDV A;  2D11 A;  3BY4 B;  1WJ6 A;  2DZI A;  4A3O A;  2JZ3 B;  3ZO5 B;  3N32 A;  2NS5 A;  3IHP C;  3PV1 A;  3VFK A;  3L13 A;  3M3J A;  2KO3 A;  3NZU A;  4NAW B;  1WM2 A;  3NY5 A;  3V6C B;  2KK8 A;  3LJ3 A;  2LAS A;  4FHJ A;  1V6E A;  3VVW B;  3VXW A;  3WAP A;  3KW5 B;  3L16 A;  4JQW C;  2KJ6 A;  3IG3 A;  3P2B A;  3DBR I;  5TR5 A;  2BF8 B;  2KJH B;  1OEY A;  2BKR B;  3U8Z A;  4NY0 A;  2GBR A;  2RSU A;  3PGE A;  1FXT B;  4ANW A;  2Y5B B;  3N30 A;  2B3A A;  3N3K B;  1YX6 B;  3WA0 A;  1YJ1 A;  4DDG D;  4X57 B;  1WE7 A;  4IWQ A;  4FJY A;  4M8N A;  3O65 B;  2KKC A;  2IYD B;  2LXA A;  3PSE B;  4MM3 A;  4MGK E;  1OGW A;  4AWJ A;  2RR9 A;  2ZCC A;  5J17 A;  3PRP B;  2K8B A;  4BBN F;  2FCS A;  4IM2 A;  3KH0 A;  3SDL C;  1J0G A;  4A20 A;  4PYU A;  5G2N A;  4RM9 A;  1L7Y A;  2JVC A;  5J18 A;  4MJS B;  2AL3 A;  2BKF A;  2L05 A;  5E6N A;  4AOF A;  4FA6 A;  3HK0 A;  2KX0 A;  3B1L X;  5LLI A;  3AU4 A;  1J19 A;  3HIZ A;  2LWP A;  1S1Q B;  3SD5 A;  2DX5 B;  3UQB A;  1V81 A;  3L0W B;  2GBK A;  1OTR B;  4BVU C;  1E7U A;  4HCN B;  4RMA A;  1WYW B;  2KWU B;  3K9P B;  2KC2 A;  2MA9 B;  4GDL B;  1EO6 A;  3MHS D;  4MDK E;  3I3T B;  2KWC A;  3NOB A;  4DBG A;  3RYT A;  2XK5 B;  3QIJ A;  4MSM B;  5AZG A;  3WAL A;  3X23 A;  2XBB C;  2BYE A;  2L7R A;  4IC7 B;  2I1J A;  1P3Q U;  2VRR B;  4K7U A;  1WJN A;  4CO7 A;  1T0Y A;  1J8C A;  4WJP A;  3UF8 A;  3IBE A;  3JW0 X;  2LRU A;  1ZW7 A;  1VCB A;  2HJ8 A;  3PZD A;  1IP9 A;  1C1Y B;  2KDE B;  1SGH A;  1V86 A;  2EMT A;  2N9X A;  3ML9 A;  3OLM D;  3H1U A;  1WX9 A;  4K7W A;  4M8M A;  2LUE A;  3TJP A;  2K6Q A;  3QCA A;  3HHM A;  2ZEQ A;  2NBV B;  5AEK B;  1Y8R C;  4F8C B;  3SHQ A;  3UGB B;  4ZRI A;  3HM6 X;  2KN5 A;  4NNJ B;  3M95 A;  3R7R A;  3A1Q A;  3RZF A;  3ZDM C;  1E8W A;  2PJH A;  4NQK E;  4B95 A;  2M1M A;  5DPR A;  1E8X A;  2G3Q B;  1GJZ A;  1Q1O A;  3ZNG C;  2KX3 A;  2V4L A;  3MTN B;  2JF5 A;  4MGZ E;  2KDB A;  3L17 A;  2BWF A;  5D7G A;  1YD8 U;  2DYO A;  2WX0 A;  2REX A;  3PHX B;  3DPD A;  2MX2 A;  5FR6 A;  2PPH A;  1S3S G;  3A9K A;  3VAW A;  4ASW C;  1WMH B;  1C3T A;  2IO3 B;  1OQY A;  3DDC B;  2FCM A;  1GG3 A;  1WM3 A;  4WWN A;  1I35 A;  4W9D A;  3PPA A;  4W9K A;  2N9P C;  3HM3 A;  3TL5 A;  1V80 A;  3CST A;  1L2N A;  2V3S A;  1WXA A;  1WXS A;  1UEL A;  3VTW A;  4II3 B;  2FNJ B;  2MP2 A;  2ZNV B;  3AI5 A;  3LDZ E;  5JH5 C;  3D32 A;  3CMM B;  5C23 A;  1Q0W B;  3ZNH B;  4A3P A;  2L0T A;  2L0F A;  3SU8 X;  1H4R A;  1YQB A;  3W1Y A;  3EEC A;  3UIP B;  3BIN A;  3VUY A;  2JXX A;  2QHO A;  2UWQ A;  3GZN I;  2DZM A;  2KD0 A;  4NQL B;  4M0W B;  3DVG X;  3R66 C;  2O2V A;  3PT2 B;  3RCZ A;  4KSK C;  5KHQ A;  1SE9 A;  5GMV A;  2WYQ A;  4NJ6 A;  3H7P B;  2KTR A;  3DOW A;  3T8M A;  4GIV A;  2G45 B;  2MBH A;  3DBL I;  3PRE A;  4FUL A;  2KFJ A;  4K1R B;  4PYZ A;  1WF9 A;  5DPS A;  4HXD A;  2NPT A;  3V60 A;  2ZZP B;  1XD3 B;  3QAR A;  2KLG A;  2N7E A;  2PE9 A;  2KAN A;  5E6P A;  4II2 B;  2A5U A;  1OEY J;  4I6N B;  3APF A;  2LGD A;  4LCD E;  2FCN A;  1XT9 B;  2N1W A;  1E8Z A;  3ENE A;  4I6P A;  4JLC A;  4DHZ B;  1WXV A;  1P0R A;  4IM3 A;  3VTV A;  2I1K A;  4BBN C;  3ALB A;  2DZJ A;  4ANU A;  1WGH A;  2LVQ A;  3QC8 B;  4HWI B;  2LGY A;  1ISN A;  1YIW A;  3A9J A;  4G11 A;  3RUI B;  1TGZ B;  2KXJ A;  2WDT B;  3NS8 A;  3UIN B;  1G6J A;  2JWZ A;  2N1V A;  4WWP A;  2IO2 B;  2N4F A;  3PTF C;  1NDD A;  4E74 A;  2K6D B;  2K8C A;  3KUC B;  3KYD D;  1GC6 A;  1JRU A;  2KC1 A;  3L10 B;  2G4S A;  3ZNI D;  4KV2 A;  2ZPN A;  2J0J A;  3QJZ A;  2BYF A;  2N7D A;  2C60 A;  4ANX A;  3QX1 A;  4MGI E;  4WAA A;  3H9D A;  2NVU I;  5CHV C;  5DCN A;  2JT4 B;  3V62 A;  4AUQ C;  2ZPY A;  3Q3J A;  3OJ4 B;  4TQ1 A;  5D6J B;  4E71 A;  3ECI A;  1I42 A;  1V5T A;  4RM8 A;  3VQI A;  2LVP A;  2ZCB A;  1RRB A;  3AU5 A;  1WX7 A;  3V61 A;  3RD2 A;  2O6V B;  2K8H A;  3AUL A;  4XX5 A;  4EUT A;  4K7S A;  4KIK B;  4TQ0 A;  2EKE C;  1E8Y A;  2PE6 B;  4P7I A;  1UBQ A;  3R7Q A;  4EZK A;  1P98 A;  4NAW A;  2JPH A;  1WI0 A;  4BOS C;  4DHJ B;  3A4R A;  1SIF A;  2CS4 A;  3PS6 A;  4W9E A;  1UZX B;  4URK A;  1R4N I;  1ZGU B;  3NZS A;  1F9J A;  4GXB A;  4KDI C;  3A9K B;  3DBH I;  2L76 A;  4KDL B;  1UH6 A;  3DVG Y;  3JYU A;  2WWZ A;  3B0A A;  2G4D B;  3AXC A;  4BKT A;  3ZRC A;  1NI2 A;  3ZDT A;  5CTR C;  4AJW A;  4W9I A;  3QWZ B;  5L95 C;  1E5W A;  5LXI B;  4LDT D;  4MEL A;  2CHX A;  4FHK A;  2JRH A;  4IM0 A;  1V9J A;  1WE6 A;  2KLC A;  1WFY A;  3C0R B;  4BOZ B;  1WY8 A;  1UGM A;  2KFK B;  3VDZ A;  2AWT A;  2DYB A;  1KOT A;  4IW0 A;  2WX1 A;  3ZTD A;  2M17 A;  2CR5 A;  3V6E B;  5CHF A;  3TBL D;  4AJY B;  3ZRF A;  3L08 A;  2LXC A;  2RD0 A;  3U7D A;  2Z0E B;  4KVG B;  4MJS A;  1EUV B;  5DPW A;  2KWV B;  2JY6 A;  3OJ3 A;  2FCQ A;  1R4M I;  2DEN B;  2ZJD A;  1CMX B;  1X1M A;  2KTR B;  2EMS A;  3PRZ A;  4GDK B;  4OVV A;  4FLH A;  3RUL A;  1Z5S B;  4KSL C;  4W9G A;  5KHO A;  5HKH A;  4CYE A;  2ZVN A;  3TMP B;  3H7S A;  3KVF B;  1WRD B;  2R2Q A;  3ZKJ C;  4EZJ A;  2LD9 A;  5D94 A;  2NBW B;  2BWE S;  2FIF A;  2MBO A;  1UD7 A;  1KM7 A;  4GDL A;  3ZW3 A;  4BKG A;  2C7M B;  4EEW A;  2AL6 A;  2ZNV C;  4IWP A;  2XK5 A;  4E3C A;  4PS3 A;  1ZKH A;  2Z0D B;  2ZVO A;  4F7Z A;  1IYF A;  4XZ4 A;  2R2O A;  3ZUN A;  5JHA A;  3VUW A;  4G0N B;  2DYM A;  3UQA A;  2CKH B;  1WGD A;  2HE7 A;  4KZC A;  1E90 A;  4AP4 C;  4ZYN A;  5CHW A;  5EDS A;  3MJW A;  3VTU A;  3QK0 A;  3W1S C;  5AZH A;  4GN1 A;  4IUM B;  1VD2 A;  1LXD A;  2Z59 B;  1D3Z A;  3Q3F A;  1WR6 E;  2D2Q A;  4ZRJ A;  2N9E B;  2D3G A;  4EZL A;  3PLU A;  2AEH A;  4BKS D;  2K39 A;  2UYZ B;  2O6V D;  3ZNZ B;  2KZR A;  2CHW A;  5IAA C;  3ONS A;  2M8S A;  3S2A A;  2K25 A;  4HK2 A;  3K9O B;  4WWO A;  4K81 A;  1WGR A;  3KUZ A;  1E7V A;  4DHJ D;  3T9L A;  2GBM A;  4TUU A;  1WMH A;  4FAD A;  1P1A A;  4DWF A;  1WIA A;  2MRP A;  2PEA A;  2DAF A;  3NHE B;  5G55 A;  4DHZ E;  4G50 A;  5J2R A;  1WJ4 A; 
#chains in the Genus database with same CATH topology
 3DVN U;  2JZP A;  5IOI A;  1VZ7 A;  2E6X A;  5LXH A;  3ZLZ A;  3P4P B;  3B2G A;  3UI3 A;  2IZV B;  4MGY E;  2L00 B;  3TUO A;  4M0W A;  4RH6 A;  2L83 A;  5BO4 B;  3VH3 B;  1D5M C;  1L4Z B;  2QC8 A;  4NPN A;  4EKU A;  3NRZ A;  1V1P A;  2JWU A;  1F1H A;  2WQY B;  4HVB A;  3A1Q B;  2MBQ A;  4ZHP A;  2K9X A;  1FRR A;  4LK0 M;  3BYY B;  1GB4 A;  2WP9 B;  2AYO B;  2IO0 B;  2KJR A;  4TKN A;  3TEY A;  5IN7 A;  5EE3 A;  5AUI A;  1E0Z A;  2OJW A;  3AMZ A;  3ML8 A;  3Q8F A;  4MT5 A;  2BYV E;  3FKY A;  2L3Z A;  1E6E B;  4MH8 A;  3P4Q B;  4W9H A;  2YLM A;  3KLS X;  2GI9 A;  2JSV X;  4PK1 A;  5AZF A;  3PO0 A;  4W9F A;  2O2V B;  2RGF A;  4PS8 A;  3W5V B;  4IG7 B;  1M94 A;  3QHT A;  3WAM A;  2KDI A;  2JRI B;  3WIM A;  4A6Q A;  2RMM A;  2C9W B;  1FD6 A;  2BVC A;  3RN9 C;  1FCL A;  4M01 A;  2IY0 B;  4A55 A;  1NBF C;  3ZIM A;  4W9J A;  4C56 C;  1ZUD 2;  3RNA C;  2FAZ A;  5C3J B;  3Q8A A;  4LLG M;  3ZQ4 A;  2MBE A;  4DXA B;  3U30 A;  3SR6 A;  2YVC A;  3NVY A;  3GE3 C;  2AQ2 B;  5JZE B;  1F0Z A;  1UGJ A;  3A4S C;  4W9C A;  2MW5 A;  3GOE A;  3CIR B;  3CF6 E;  1L0V B;  4L23 A;  2LI5 A;  3DHG C;  4P6V F;  1AYF A;  3C19 A;  2C7N B;  4AQ7 A;  3DHI C;  4HCP B;  2M0X A;  4ZDV A;  3BY4 B;  4TSS A;  1EWY C;  2QCZ A;  3W9C B;  3PV1 A;  3VFK A;  3M3J A;  2KO3 A;  1V6E A;  3WAP A;  1VR9 A;  5E6J A;  2M0A A;  3IG3 A;  3P2B A;  1MI0 A;  3DBR I;  2K22 A;  2DLB A;  2KJH B;  3NS1 A;  4WQM A;  4ANW A;  1PFD A;  4OVZ A;  1K53 A;  4X57 B;  4DDG D;  3RMK C;  4M8N A;  2IYD B;  4MM3 A;  2RR9 A;  2ZCC A;  5J17 A;  2K8B A;  1I4P A;  2FCS A;  1WWT A;  3E9S A;  4PYU A;  4JWU C;  3HVZ A;  1FNV A;  1QF6 A;  3ZXV A;  2MJE A;  2KX0 A;  3HIZ A;  1ZOY B;  1KLU D;  1S1Q B;  3SD5 A;  3UQB A;  2WLB A;  3Q8E A;  4BVU C;  1I4R A;  1WYW B;  2I38 A;  3P4S B;  2DWQ A;  1IGC A;  5AZG A;  2XBB C;  2BYE A;  2I1J A;  2VH2 A;  1CQV A;  1WJN A;  1T0Y A;  3U7Z A;  4ACF A;  1VCB A;  3PZD A;  1IP9 A;  2EMT A;  4K7W A;  3OLM D;  1JRP A;  2K6Q A;  1Y8R C;  3ETR A;  4ZRI A;  2WXH A;  2PMV A;  4B95 A;  1I7H A;  2G3Q B;  3BWU D;  1PGX A;  3MTN B;  2REX A;  1PGB A;  3DPD A;  5FR6 A;  3A9K A;  1WMH B;  1OQY A;  3DDC B;  2FCM A;  3R2T A;  4CQN A;  4US8 A;  4WWN A;  4W9D A;  1NYQ A;  5BYR A;  1Q10 A;  3VTW A;  3P4R B;  2MP2 A;  2IPK D;  1Q0W B;  3OWE B;  1BXT A;  1H4R A;  2N0S B;  2V4I B;  3EEC A;  3W1Y A;  2QHO A;  2UWQ A;  3GZN I;  4NQL B;  2INP E;  3PT2 B;  2IGD A;  3RCZ A;  1RM6 C;  2SAK A;  1L0X B;  3DOW A;  2EKI A;  2E3T A;  3PRE A;  2KFJ A;  4PYZ A;  5DPS A;  1WF9 A;  4HXD A;  3B2F A;  5EE1 A;  3V60 A;  2N7E A;  5D3I B;  1PUT A;  3ENE A;  4DHZ B;  2XNA C;  1WXV A;  4USA A;  2DZJ A;  1HZ5 A;  2RDB C;  1TYG B;  3A9J A;  1TGZ B;  2KXJ A;  2WDT B;  4AS1 A;  2N1V A;  2V0G A;  3PTF C;  1NDD A;  2K8C A;  3L10 B;  1GC6 A;  1N61 A;  2KAC A;  2I2Y A;  2JX5 A;  5CHV C;  2QJL A;  2W54 A;  5D6J B;  3ECI A;  1I42 A;  1V5T A;  2ZCB A;  4ARI A;  3IXS A;  1RRB A;  2O6V B;  3AEG B;  1P7E A;  3AEE B;  2K8H A;  4R3D A;  2EKE C;  1E8Y A;  4P7I A;  1MVK A;  2JPH A;  4BOS C;  4URK A;  1R4N I;  3NZS A;  4GXB A;  1XLP A;  4KDL B;  2L76 A;  4NZL B;  5G5G A;  3DVG Y;  2WWZ A;  4BKT A;  2QIL A;  4L1B A;  4P16 A;  5CTR C;  3QWZ B;  5L95 C;  4LDT D;  4MEL A;  4FHK A;  2LGS A;  1BML C;  3C0R B;  2KFK B;  4HKQ A;  2VZK D;  1DOI A;  2WX1 A;  3RNF C;  3ZTD A;  1SE2 A;  4KGR A;  2CR5 A;  5CHF A;  2VH1 A;  1SF0 A;  2WHI A;  2ACZ B;  3OJ3 A;  2ZJD A;  3I5J C;  2DEN B;  2KTR B;  2EMS A;  3VR9 B;  4FLH A;  3RUL A;  1Z5S B;  2J4X A;  4EZJ A;  1JWS D;  5D94 A;  4ARC A;  4GDL A;  4EEW A;  2MH7 A;  2WXP A;  2MHJ A;  4PS3 A;  1ZKH A;  4XWW A;  1JML A;  5JHA A;  4G0N B;  1KRH A;  4KZC A;  4AP4 C;  2KN4 A;  3CWI A;  3GP7 A;  4HKZ E;  1EWC A;  1F52 A;  3IAM 1;  4L2Y A;  1V8C A;  2WXQ A;  1B9R A;  2AEH A;  2K39 A;  2UYZ B;  4XGA B;  1YJJ A;  1MHX A;  2WXI A;  2O6V D;  4YSX B;  3ZJV A;  2KZR A;  3K9O B;  2WXF A;  4WWO A;  1SJE D;  2IGH A;  2GBM A;  1P1A A;  4DWF A;  1WIA A;  2MRP A;  2N9L A;  2PEA A;  4DHZ E;  1TTN A;  4ANV A;  3TCA A;  4ICU A;  3JSV A;  4HPM B;  4WQO B;  2GMI C;  1SBB B;  1BT0 A;  5E6O A;  2J0M A;  3PHW B;  2BT6 A;  2M4N A;  4YTN B;  3OAW A;  2IO1 B;  4NJC A;  1KLV A;  3W1S A;  2J7Q B;  1XXG A;  1YN4 A;  3H7P A;  2BGF A;  4JGH B;  4OVU A;  1VLB A;  1DOX A;  3HRD D;  4FJZ A;  3X0W A;  4PS7 A;  3VH4 B;  2IBI B;  1T0Q C;  4GB9 A;  1IPG A;  1UNS A;  4JL9 A;  3BYT B;  4YSY B;  4B0M A;  3AE5 B;  5D3D A;  5FR3 A;  1XLN A;  3UIO B;  2V3N A;  1EF1 A;  2TSS A;  3FAH A;  4B6W A;  1WH3 A;  1TBE A;  4KKJ A;  3BVG A;  3U4E G;  4RF1 A;  1V2Y A;  3APC A;  4DDI D;  3IFW B;  1FMA D;  4KZ0 A;  1ACC A;  1WR1 A;  3VUX A;  1WZ0 A;  1VZ6 A;  3KYC D;  3TIX A;  2DHZ A;  1D6E C;  1XCT L;  2JZZ A;  4LJO B;  2FID A;  1K8R B;  3CSF A;  4I6L B;  2L52 A;  1HXY D;  3PRM B;  4EOY A;  1N63 A;  2MJ3 A;  4BKS A;  1TZ1 A;  1WGY A;  1EU4 A;  2K1F A;  4FN2 A;  4ZRQ A;  1NYR A;  4KGT A;  2K3U A;  4KIK A;  2MSE D;  2WXM A;  1E10 A;  3TEW A;  3QQ8 B;  2BPS A;  2IY1 B;  3QA8 A;  2D3C A;  2ASQ A;  1F2R I;  2C7H A;  2J0K A;  2C5L C;  3RFZ B;  3IVF A;  3M63 B;  2AQ1 B;  1WYG A;  1FCC C;  2LVO A;  3WAN A;  5CX3 A;  2RPV A;  2AQ3 B;  1PQS A;  3EHV A;  4MSQ B;  4J3O D;  5MPO A;  1Q5W B;  2QEJ C;  4F1S A;  2KQS A;  4EFO A;  2CHZ A;  4WJQ A;  2LZ6 A;  1MHH E;  3PLV A;  4GDK A;  4GGQ A;  4JX1 C;  2Y5C A;  2MWS B;  1SB3 C;  1SEB D;  1QZE A;  1WJ6 A;  2DZI A;  2NS5 A;  3L13 A;  3NZU A;  4NAW B;  2ICI A;  3NY5 A;  2KK8 A;  2LAS A;  1WXQ A;  3KW5 B;  2HTM E;  2KJ6 A;  4C7Z A;  5TR5 A;  2BF8 B;  2BB6 A;  1RFK A;  5BMG A;  1YJ1 A;  2BS4 B;  3ABV B;  3MFG A;  2ONQ A;  4FJY A;  3O65 B;  3Q8B A;  2LXA A;  3PSE B;  1CK1 A;  1WGK A;  2RDG A;  4IM2 A;  3KH0 A;  4A20 A;  1UUP A;  1L7Y A;  2JVC A;  2N7J A;  3EFC A;  4RM9 A;  2BKF A;  1C78 A;  2L05 A;  5E6N A;  4AOF A;  4FA6 A;  5BYS A;  4DXF A;  3AU4 A;  1J19 A;  4WAF A;  3PZ8 A;  1V81 A;  1M4V A;  1PGA A;  2GB1 A;  2KC2 A;  3URY A;  4ZRP A;  1EO6 A;  3AEC B;  4JPS A;  2XK5 B;  5BYQ A;  3X23 A;  1TT5 B;  1IBX B;  2WDQ B;  2X8X X;  2W3R A;  4WJP A;  3BZD B;  4KX6 B;  3UF8 A;  3IBE A;  1JQ4 A;  1ZW7 A;  2HJ8 A;  2KDE B;  1SGH A;  1V86 A;  3QCA A;  4H2A A;  2NBV B;  4LNF A;  3SHQ A;  3UGB B;  3HM6 X;  4NNJ B;  3A1Q A;  3V05 A;  1E8W A;  1SXT A;  1GJZ A;  2JF5 A;  2KDB A;  3L17 A;  4IKG A;  3PHX B;  2MX2 A;  1I4X A;  1FO4 A;  1S3S G;  1C3T A;  2IO3 B;  1WM3 A;  1HEZ E;  2WXK A;  2LGI A;  2SEB D;  2N9P C;  3AE2 B;  1V80 A;  1YQ3 B;  1IGD A;  1UEL A;  4II3 B;  3AI5 A;  3D32 A;  3CMM B;  4A3P A;  1FRD A;  2L0F A;  3BIN A;  4C4V B;  2DZM A;  2KD0 A;  3DVG X;  4QAY A;  5EE0 A;  3R66 C;  2O2V A;  4C7Y A;  4KKI A;  3DBL B;  1JW9 D;  3FIL B;  2G45 B;  2J52 A;  4K1R B;  3MJ5 A;  4YTM B;  2ZZP B;  5E6P A;  2A5U A;  4I6N B;  1XT9 B;  2WXN A;  4I6P A;  2YEP B;  3VTV A;  2I1K A;  4BBN C;  3ALB A;  4RNA A;  1TIF A;  3O13 A;  1STE A;  1FXI A;  1G6J A;  1C4P A;  3SEB A;  1I4G A;  4ZOH C;  2K6D B;  3KYD D;  5T8I A;  1JRU A;  2KC1 A;  4HRS A;  2J0J A;  2N7D A;  4NAM A;  2YEP F;  5AUK A;  2Q5W D;  1OQR A;  3SFD B;  4AUQ C;  4TQ1 A;  2JU6 X;  2LVP A;  4YTP B;  3V61 A;  1TS2 A;  3RD2 A;  4TQ0 A;  1ZXH A;  1KFY B;  1WI0 A;  1SIF A;  1UZX B;  1XLQ A;  3TEX A;  2PW9 A;  4YXD B;  4N58 A;  1F9J A;  1C76 A;  1AWD A;  3A9K B;  3DBH I;  1UH6 A;  3I63 C;  3Q6B A;  3R2I A;  5IKC M;  3AXC A;  4B0E A;  2BS2 B;  4AJW A;  5LXI B;  1E5W A;  4IM0 A;  1UGM A;  1VRA B;  2AWT A;  2M17 A;  3ZRF A;  3I57 A;  2LXC A;  2RD0 A;  1EUV B;  2JY6 A;  1L6U A;  1WRD B;  2R2Q A;  3PZ7 A;  3Q3M C;  4OW0 A;  2LD9 A;  3ZYY X;  1PDX A;  2MBO A;  2AX5 A;  4BKG A;  3KWV A;  2AL6 A;  5I4D A;  2ZNV C;  1XO3 A;  3N1X C;  2CU3 A;  2Z0D B;  2ZVO A;  1IYF A;  2KDM A;  3DWG C;  2DYM A;  3UQA A;  2HE7 A;  1KF6 B;  1E90 A;  1KH0 A;  3MJW A;  3VTU A;  4GN1 A;  3Q69 A;  1FFV A;  5IP4 D;  2N9E B;  4EZL A;  3PLU A;  2PKO A;  1V97 A;  2FBW B;  3MC0 B;  3ZJU A;  3ZNZ B;  4C00 A;  2W55 A;  2LMC A;  2OED A;  5C2T B;  3DHH C;  3S2A A;  1N5X A;  2PLP A;  4K81 A;  1E9M A;  1E7V A;  3T9L A;  4BZA A;  1WMH A;  4FAD A;  5G2N A;  5J2R A;  2MEK A;  2KMC A;  4GSW A;  4TMA B;  4TV3 A;  2WXG A;  1XEE A;  4S17 A;  1MG4 A;  4HEA 1;  4FJV B;  3KWL A;  4HJK A;  2HTH A;  2KNB A;  2MLB A;  4K3C A;  2HD5 B;  1QIL A;  4FBJ B;  5L83 A;  1JRO A;  1SIJ A;  2JUO A;  2L32 A;  2NR2 A;  2EEL A;  2D10 A;  4WH4 A;  1ZDV A;  3P42 A;  3NVW A;  2X38 A;  2QMT A;  1FIQ A;  1SSN A;  5D2M B;  1A70 A;  4XDC A;  4WJO A;  4FXC A;  2L8J A;  4M02 A;  1I4H A;  3RNB C;  4XYC A;  2IND C;  2KQ7 A;  4HDQ A;  4D2K A;  2BTE A;  1PYW D;  3EGR A;  1EF5 A;  1RLF A;  2NCN A;  2CU1 A;  4RCO A;  2BW2 A;  1V5O A;  1J7A A;  1H8C A;  3N20 C;  1FNU A;  4A8X C;  2MCN B;  4MH0 E;  1R4M B;  2JQR B;  4GMV A;  3ZVV A;  1MG8 A;  2MBB B;  1AAR A;  1A5R A;  1C77 A;  1LM8 B;  2ZW1 A;  4ZYS A;  2O6V A;  4IDI A;  4JIO U;  2FUH B;  4KGS A;  2NPT B;  5H92 C;  1LQB A;  1P7F A;  1FNW A;  3EFU A;  1ESF A;  3EC8 A;  4M00 A;  5BMI A;  3MC9 A;  2DBY A;  5C1Z A;  2A4Z A;  4LTU A;  3VHT C;  1LO5 D;  1WX8 A;  4HDO A;  1TS5 A;  2D07 B;  5IA7 A;  3L54 A;  2DAJ A;  3B08 A;  3JVZ X;  3JSV B;  4LJP B;  3AB5 A;  5JHB A;  5HI1 A;  1QLB B;  3M62 B;  1T5X D;  2KFK A;  2WNM A;  2LEK A;  1UBI A;  2KTF A;  3V3X A;  2LRW A;  4YL8 A;  1ET9 A;  3IT4 B;  4XE0 A;  1KJT A;  4GOC A;  3WAO A;  2WXJ A;  1UWM A;  4MAC A;  4A90 A;  4WIP A;  1P9D U;  3DVN V;  2G1E A;  2V9H A;  2Y5P A;  2WU5 B;  3ZO5 B;  3N32 A;  1Y56 A;  3IHP C;  4S0R A;  2WXL A;  2OHF A;  1YNT E;  1WM2 A;  3LJ3 A;  1ZXI A;  4A9A A;  3L16 A;  3DBR B;  3C8Y A;  1FFU A;  2RDH A;  2JYT A;  2K5P A;  1OEY A;  2NTT A;  4NY0 A;  2GBR A;  3U8Z A;  1NI3 A;  3PGE A;  1FXT B;  5LNK 1;  2J42 A;  2B3A A;  3WA0 A;  1XF5 L;  3RNC C;  1WE7 A;  2WGS A;  1NVI D;  1OGW A;  4BBN F;  4MJS B;  4JE3 B;  4DXG A;  3NG0 A;  5FK9 C;  3HK0 A;  3P63 A;  3NVZ A;  4US9 A;  3B1L X;  2LWP A;  2WXO A;  3AM9 A;  2BYT A;  3L0W B;  1OQQ A;  2GBK A;  4HCN B;  4RMA A;  2KWU B;  3K9P B;  2MA9 B;  1DOY A;  3I3T B;  1ZP0 B;  4RGN A;  2KWC A;  4K3B A;  3AED B;  2CJO A;  3MP9 A;  3JW0 X;  3DWM A;  2LRU A;  3KQ4 A;  4W9L A;  2N9X A;  4M8M A;  3AH7 A;  3H1U A;  1WX9 A;  2HDE A;  2LUE A;  3HHM A;  2ZEQ A;  4F8C B;  1MFW A;  1CZP A;  3Q14 C;  3RZF A;  1ZE3 D;  4NQK E;  4XWT A;  2M1M A;  1VZ8 A;  1FXA A;  1Q1O A;  5D7G A;  1JWU D;  2WDV B;  2INC C;  1QQR A;  1I35 A;  3PPA A;  3TL5 A;  3CST A;  2V3S A;  1DGJ A;  1FPY A;  1SE3 A;  3AEF B;  2FNJ B;  2ZNV B;  5JH5 C;  3LDZ E;  5C23 A;  1YJI A;  3GZN B;  3UIP B;  3VUY A;  2JXX A;  4M0W B;  4KSK C;  5KHQ A;  5GMV A;  1GOZ A;  4NJ6 A;  1YMH E;  3T8M A;  1HTO A;  2QDF A;  4GIV A;  1V1P B;  2MBH A;  3AE3 B;  1QOA A;  1XD3 B;  2MJD A;  3QAR A;  4II2 B;  3APF A;  2LGD A;  4LCD E;  2G9H D;  1P0R A;  3AE7 B;  3W5U B;  1E7P B;  2KVZ A;  1YN5 A;  2LVQ A;  4HWI B;  2LGY A;  1ISN A;  1D5X C;  1YIW A;  2BQQ A;  1D5Z C;  3RUI B;  2NTS A;  4P1C C;  2LHD A;  2GRI A;  4N59 A;  4WWP A;  2IO2 B;  2N4F A;  4E74 A;  2JXT A;  3KUC B;  3ZNI D;  1N6Z A;  4KV2 A;  4RFB A;  3QJZ A;  2BYF A;  1ZDX A;  3NJT A;  1QOF A;  3WCQ A;  3QX1 A;  1GB1 A;  4MGI E;  4WAA A;  2NVU I;  5DCN A;  1L6V A;  2JT4 B;  2WU2 B;  3V62 A;  2ZPY A;  3Q3J A;  3OJ4 B;  2ON8 A;  4E71 A;  4RM8 A;  3VQI A;  1FEH A;  1K52 A;  3AU5 A;  3NZ3 A;  4RGO S;  2KWD A;  4XDD A;  4XX5 A;  4EUT A;  3VRA B;  2PE6 B;  1UBQ A;  1P98 A;  4NAW A;  4DHJ B;  1R4N B;  1NEK B;  3A4R A;  3PS6 A;  2NMQ A;  2LFI A;  3LB8 C;  3JYU A;  3B0A A;  2G4D B;  2M56 B;  1JWM D;  1OFF A;  3ZRC A;  1TS3 A;  4W9I A;  1XCQ L;  2JRH A;  2KLC A;  1WE6 A;  3VDZ A;  1KOT A;  4IW0 A;  2BS3 B;  3V6E B;  3TBL D;  1QT9 A;  2FCQ A;  1R4M I;  2L1A A;  5BMH A;  1X1M A;  4OVV A;  2JYE A;  4KSL C;  4W9G A;  1ET6 A;  4CYE A;  3H7S A;  3ZKJ C;  1UWX A;  2FIF A;  2FE8 A;  3ZW3 A;  3RPF C;  2XK5 A;  4E3C A;  1IBX A;  2KAJ A;  3ZUN A;  1F77 A;  2CKH B;  1WGD A;  4OZC A;  1AW7 A;  4ZYN A;  1DYQ A;  3BVM A;  5EDS A;  3SFE B;  3W1S C;  1T0R C;  1VD2 A;  1LXD A;  1AN8 A;  2Z59 B;  1D3Z A;  1WR6 E;  1MJD A;  1J7B A;  4ZRJ A;  1YQ4 B;  4HJG E;  1BUI C;  1SJH D;  4MM3 B;  2CHW A;  5IAA C;  3ONS A;  2M8S A;  1L5P A;  2K25 A;  2D3B A;  3BVZ A;  1WGR A;  3KUZ A;  4DHJ D;  3Q3N C;  4TUU A;  3OG5 A;  1WJ4 A;  1TS4 A;  1V49 A;  1WJU A;  1TY2 A;  3N1Z C;  2GOW A;  2KVR A;  3TSS A;  4BFR A;  3RNE C;  4DK5 A;  4C4V A;  1WXM A;  3HUI A;  1RAX A;  4ZHO A;  2XEW A;  1HE8 A;  1JWB D;  1QOG A;  1Z2M A;  4ITK A;  1V1O A;  3FIL A;  4BAX A;  2PVO D;  2V1Y A;  4N6E B;  2LJ5 A;  2RPQ A;  4CHK A;  1GUA B;  3Q2A C;  1CJE A;  3DQV A;  2PIA A;  4XC2 A;  3PVL A;  2GBJ A;  2FUG 1;  4HLE A;  1I4Q A;  2OOB B;  1K51 A;  4ICV A;  3DCG A;  2MP2 B;  2KHW B;  3R3M A;  3NVV A;  3ZTC A;  3VR8 B;  2LGX A;  3IAS 1;  1U4A A;  3AE8 B;  1C9F A;  4REZ A;  1WZ3 A;  4NJ7 A;  3A33 B;  3N9Y C;  2KMA A;  3AE1 B;  1GAQ B;  1WGG A;  5HHD G;  4MEM A;  2BB5 A;  1KTK A;  2LJI A;  1RFA A;  2PTL A;  4G3X B;  1GNU A;  4YWG G;  4UDU C;  3RT3 B;  1XQQ A;  3ZGZ A;  2MQJ A;  1GC7 A;  3AE6 B;  3H6N A;  2LUM A;  3BK1 A;  3KUD B;  3APD A;  2IGG A;  4IOI E;  2OJR A;  4N9F 4;  3GB1 A;  2NBU A;  3A9J B;  3RZW C;  1J7C A;  1LFD A;  3AN1 A;  4HPL B;  5DPT A;  2INN E;  1L0Y B;  2KOX A;  1K50 A;  4J6I A;  4WJN A;  3AV8 A;  1TKG A;  4LNK A;  4OZB A;  1YX5 B;  2KDF B;  4B9K A;  2DZK A;  2CJN A;  2W9N A;  1KLG D;  4LDT B;  2GBN A;  3QAQ A;  2DNF A;  4ZRK A;  4IWO A;  1TKY A;  4GU2 A;  3DBS A;  4LNO A;  2VZK B;  3AEA B;  2D11 A;  2W82 A;  4A3O A;  2JZ3 B;  3LYY A;  3V6C B;  2BBC A;  3ZXR A;  4WWM A;  4FHJ A;  3VXW A;  3VVW B;  4JQW C;  1NEN B;  3J9C A;  2BKR B;  1XLO A;  2RSU A;  2Y5B B;  3N30 A;  3N3K B;  1YX6 B;  4IWQ A;  2KKC A;  4MGK E;  3E56 A;  4AWJ A;  3PRP B;  3ZJT A;  1C4C A;  3SDL C;  1SE4 A;  1J0G A;  1WRI A;  2H89 B;  2M19 A;  1R7S A;  4YT0 B;  5J18 A;  2AL3 A;  3L4P A;  4HPP A;  3I9V 1;  3AE9 B;  2UU7 A;  1TY0 A;  2WS3 B;  1VJK A;  5LLI A;  2DX5 B;  1HTQ A;  1T0S C;  1OTR B;  1E7U A;  4HRO A;  5HG2 A;  2LHE A;  2QSD A;  4GDL B;  3MHS D;  4MDK E;  1YOV B;  3NOB A;  4DBG A;  3RYT A;  3QIJ A;  4MSM B;  3WAL A;  2J53 A;  2L7R A;  2W3S A;  1HA5 A;  1P3Q U;  1ZPS A;  2VRR B;  4K7U A;  4CO7 A;  1J8C A;  2Z8L A;  2D3A A;  3EA6 A;  2WXR A;  1YN3 A;  1C1Y B;  3ML9 A;  3TJP A;  1EU3 A;  3AEB B;  1C79 A;  4WUR A;  5AEK B;  2KN5 A;  3M95 A;  3R7R A;  2D5G A;  3P1M A;  3ZDM C;  2PJH A;  1B1Z A;  4RF0 A;  3Q3O C;  5DPR A;  1E8X A;  3ZNG C;  4C80 A;  2KX3 A;  2V4L A;  4MGZ E;  4LNI A;  4LNN A;  2BWF A;  1WSP A;  1YD8 U;  2DYO A;  2WX0 A;  2K0P A;  3VAW A;  2PPH A;  4P1B C;  4ASW C;  1GG3 A;  4RGM A;  4W9K A;  3NUH B;  3HM3 A;  1N62 A;  1L2N A;  3MHZ A;  1TKE A;  1WXA A;  1WXS A;  1HZ6 A;  3TEZ A;  1RWS A;  3ZNH B;  2L0T A;  3Q8C A;  3SU8 X;  1ENF A;  1YQB A;  3GE8 C;  2KMM A;  1C4A A;  5EE9 A;  5TSS A;  3GS2 A;  2GLS A;  1SE9 A;  1MPE A;  2WYQ A;  3H7P B;  2KTR A;  4OHJ A;  4YSZ B;  3BII D;  4DQO C;  3HVD A;  3H8H A;  3DBL I;  4GLS C;  4FUL A;  1EM7 A;  2NPT A;  5IO9 A;  2KLG A;  2PE9 A;  2KAN A;  3T3N A;  1OEY J;  1QOB A;  1TZO A;  2FCN A;  1JWA D;  2N1W A;  1E8Z A;  3N1Y C;  4JLC A;  4IM3 A;  1QKZ A;  5H8Y E;  4OZA A;  4ANU A;  3LXF A;  1WGH A;  5GXG B;  3QC8 B;  3FC4 A;  4G11 A;  5G5H A;  3BK2 A;  3NS8 A;  3UIN B;  2JWZ A;  2G4S A;  2ZPN A;  2C60 A;  4ANX A;  2ZW0 A;  3H9D A;  1FM0 D;  1T3Q A;  3W2D A;  3EUB 2;  2IDY A;  1VDV A;  2KT7 A;  2KYW A;  1WX7 A;  3AUL A;  1GPX A;  4Q2J A;  5HFY A;  4K7S A;  4KIK B;  3R7Q A;  4EZK A;  2CS4 A;  4W9E A;  1ZGU B;  3DBH B;  2WDR B;  4KDI C;  2Y3A A;  5JXV A;  1D4B A;  2HJ1 A;  1N60 A;  1JCK B;  1TJE A;  4PT5 A;  3RNG C;  1NI2 A;  3ZDT A;  1IUE A;  2CHX A;  4EE2 A;  1V9J A;  4O1N A;  4BOZ B;  1WFY A;  1L4D B;  1WY8 A;  2DYB A;  2B76 B;  4AJY B;  2V3P A;  3L08 A;  3U7D A;  2Z0E B;  4KVG B;  4MJS A;  5DPW A;  2KWV B;  3R8B A;  3PRZ A;  1CMX B;  4GDK B;  1F2R C;  1RYJ A;  5KHO A;  5HKH A;  4RGT A;  2ZVN A;  3TMP B;  3KVF B;  5FKA C;  2R61 A;  3AE4 B;  1T6B X;  1JAL A;  2KQ4 X;  2BWE S;  2NBW B;  1UD7 A;  1KM7 A;  3RI7 C;  2C7M B;  4IWP A;  4F7Z A;  4XZ4 A;  2R2O A;  3VUW A;  2QIE B;  1LGR A;  2PVG C;  3VRB B;  5CHW A;  3QK0 A;  5AZH A;  3U2S C;  4IUM B;  3IT6 B;  3Q3F A;  2D2Q A;  2D3G A;  2IJ0 A;  1N5W A;  4BKS D;  2N9K A;  3MC8 A;  2H88 B;  3U52 E;  3T3O A;  4HK2 A;  4JWS C;  1HQR D;  1ROE A;  3B9J A;  1UF0 A;  2XN9 C;  3NHE B;  5G55 A;  2DAF A;  4IC7 B;  4G50 A; 
#chains in the Genus database with same CATH homology
 3DVN U;  1TTN A;  1V49 A;  4ANV A;  2KMC A;  4GSW A;  1WJU A;  4ICU A;  4TV3 A;  3TCA A;  3JSV A;  4HPM B;  4WQO B;  2GMI C;  2GOW A;  2KVR A;  1BT0 A;  5LXH A;  5E6O A;  2J0M A;  3ZLZ A;  4BFR A;  3PHW B;  4FJV B;  2M4N A;  2IZV B;  4DK5 A;  4MGY E;  1WXM A;  2L00 B;  2HTH A;  4HJK A;  3OAW A;  2IO1 B;  1RAX A;  2XEW A;  1KLV A;  3W1S A;  2J7Q B;  2KNB A;  1HE8 A;  1Z2M A;  5BO4 B;  3VH3 B;  3H7P A;  2MLB A;  2BGF A;  2HD5 B;  4JGH B;  4OVU A;  4FJZ A;  4NPN A;  3X0W A;  4EKU A;  4FBJ B;  5L83 A;  2V1Y A;  2LJ5 A;  2JUO A;  2RPQ A;  4PS7 A;  2NR2 A;  4CHK A;  3VH4 B;  1GUA B;  2D10 A;  2IBI B;  4GB9 A;  4HVB A;  3A1Q B;  1IPG A;  2MBQ A;  4JL9 A;  5D2M B;  3DQV A;  4WJO A;  4XC2 A;  3UIO B;  3PVL A;  2GBJ A;  2AYO B;  2L8J A;  1EF1 A;  4HLE A;  4B6W A;  1WH3 A;  2IO0 B;  2KJR A;  4TKN A;  2KQ7 A;  2OOB B;  4HDQ A;  1TBE A;  4ICV A;  1EF5 A;  1RLF A;  1V2Y A;  3ML8 A;  2BYV E;  3APC A;  2L3Z A;  4DDI D;  3DCG A;  2MP2 B;  3IFW B;  2NCN A;  2CU1 A;  2KHW B;  4KZ0 A;  3R3M A;  1WR1 A;  3VUX A;  1WZ0 A;  3KYC D;  4W9H A;  3ZTC A;  3TIX A;  2YLM A;  1V5O A;  2DHZ A;  2JZZ A;  2LGX A;  4LJO B;  5AZF A;  1U4A A;  2FID A;  1H8C A;  4W9F A;  1K8R B;  1WZ3 A;  4NJ7 A;  2MCN B;  3A33 B;  2O2V B;  2RGF A;  3CSF A;  4I6L B;  4MH0 E;  4PS8 A;  4IG7 B;  1M94 A;  2KMA A;  4GMV A;  3ZVV A;  3QHT A;  1MG8 A;  4EOY A;  1WGG A;  2KDI A;  2JRI B;  3PRM B;  3WAM A;  3WIM A;  4MEM A;  2C9W B;  1AAR A;  2MBB B;  1A5R A;  1LM8 B;  1RFA A;  4BKS A;  4G3X B;  1TZ1 A;  1WGY A;  1GNU A;  2O6V A;  2K1F A;  4FN2 A;  4JIO U;  2IY0 B;  4W9L A;  2FUH B;  3RT3 B;  1XQQ A;  2NPT B;  1NBF C;  4KIK A;  2MSE D;  1LQB A;  3ZIM A;  4W9J A;  3QQ8 B;  2BPS A;  3EFU A;  2MQJ A;  3EC8 A;  2IY1 B;  1GC7 A;  2FAZ A;  3QA8 A;  3H6N A;  5C1Z A;  2A4Z A;  2ASQ A;  3VHT C;  1WX8 A;  4DXA B;  2C7H A;  2J0K A;  2MBE A;  2C5L C;  3KUD B;  3APD A;  4HDO A;  3IVF A;  3M63 B;  3U30 A;  2OJR A;  2D07 B;  4N9F 4;  2NBU A;  5IA7 A;  3L54 A;  2DAJ A;  3A9J B;  3B08 A;  3RZW C;  3JVZ X;  3JSV B;  4LJP B;  2YVC A;  1LFD A;  2LVO A;  3WAN A;  5JHB A;  5CX3 A;  4HPL B;  5JZE B;  3M62 B;  2KFK A;  5DPT A;  1PQS A;  1UBI A;  2KOX A;  3EHV A;  4MSQ B;  3A4S C;  4J6I A;  4WJN A;  2KTF A;  4W9C A;  2LRW A;  1Q5W B;  2MW5 A;  4YL8 A;  3GOE A;  4F1S A;  2KQS A;  3CF6 E;  1YX5 B;  2KDF B;  4EFO A;  2LI5 A;  1KJT A;  2CHZ A;  4B9K A;  2DZK A;  4WJQ A;  4GOC A;  3WAO A;  2LZ6 A;  2W9N A;  3PLV A;  4LDT B;  2GBN A;  4GDK A;  4GGQ A;  2C7N B;  3QAQ A;  4ZRK A;  4IWO A;  4HCP B;  2MWS B;  4GU2 A;  3DBS A;  2M0X A;  1P9D U;  3DVN V;  1QZE A;  4ZDV A;  2D11 A;  3BY4 B;  1WJ6 A;  2DZI A;  4A3O A;  2JZ3 B;  3ZO5 B;  3N32 A;  2NS5 A;  3IHP C;  3PV1 A;  3VFK A;  3L13 A;  3M3J A;  2KO3 A;  3NZU A;  4NAW B;  1WM2 A;  3NY5 A;  3V6C B;  2KK8 A;  3LJ3 A;  2LAS A;  4FHJ A;  1V6E A;  3VVW B;  3VXW A;  3WAP A;  3KW5 B;  3L16 A;  4JQW C;  2KJ6 A;  3IG3 A;  3P2B A;  3DBR I;  5TR5 A;  2BF8 B;  2KJH B;  1OEY A;  2BKR B;  3U8Z A;  4NY0 A;  2GBR A;  2RSU A;  3PGE A;  1FXT B;  4ANW A;  2Y5B B;  3N30 A;  2B3A A;  3N3K B;  1YX6 B;  3WA0 A;  1YJ1 A;  4DDG D;  4X57 B;  1WE7 A;  4IWQ A;  4FJY A;  4M8N A;  3O65 B;  2KKC A;  2IYD B;  2LXA A;  3PSE B;  4MM3 A;  4MGK E;  1OGW A;  4AWJ A;  2RR9 A;  2ZCC A;  5J17 A;  3PRP B;  2K8B A;  4BBN F;  2FCS A;  4IM2 A;  3KH0 A;  3SDL C;  1J0G A;  4A20 A;  4PYU A;  5G2N A;  4RM9 A;  1L7Y A;  2JVC A;  5J18 A;  4MJS B;  2AL3 A;  2BKF A;  2L05 A;  5E6N A;  4AOF A;  4FA6 A;  3HK0 A;  2KX0 A;  3B1L X;  5LLI A;  3AU4 A;  1J19 A;  3HIZ A;  2LWP A;  1S1Q B;  3SD5 A;  2DX5 B;  3UQB A;  1V81 A;  3L0W B;  2GBK A;  1OTR B;  4BVU C;  1E7U A;  4HCN B;  4RMA A;  1WYW B;  2KWU B;  3K9P B;  2KC2 A;  2MA9 B;  4GDL B;  1EO6 A;  3MHS D;  4MDK E;  3I3T B;  2KWC A;  3NOB A;  4DBG A;  3RYT A;  2XK5 B;  3QIJ A;  4MSM B;  5AZG A;  3WAL A;  3X23 A;  2XBB C;  2BYE A;  2L7R A;  4IC7 B;  2I1J A;  1P3Q U;  2VRR B;  4K7U A;  1WJN A;  4CO7 A;  1T0Y A;  1J8C A;  4WJP A;  3UF8 A;  3IBE A;  3JW0 X;  2LRU A;  1ZW7 A;  1VCB A;  2HJ8 A;  3PZD A;  1IP9 A;  1C1Y B;  2KDE B;  1SGH A;  1V86 A;  2EMT A;  2N9X A;  3ML9 A;  3OLM D;  3H1U A;  1WX9 A;  4K7W A;  4M8M A;  2LUE A;  3TJP A;  2K6Q A;  3QCA A;  3HHM A;  2ZEQ A;  2NBV B;  5AEK B;  1Y8R C;  4F8C B;  3SHQ A;  3UGB B;  4ZRI A;  3HM6 X;  2KN5 A;  4NNJ B;  3M95 A;  3R7R A;  3A1Q A;  3RZF A;  3ZDM C;  1E8W A;  2PJH A;  4NQK E;  4B95 A;  2M1M A;  5DPR A;  1E8X A;  2G3Q B;  1GJZ A;  1Q1O A;  3ZNG C;  2KX3 A;  2V4L A;  3MTN B;  2JF5 A;  4MGZ E;  2KDB A;  3L17 A;  2BWF A;  5D7G A;  1YD8 U;  2DYO A;  2WX0 A;  2REX A;  3PHX B;  3DPD A;  2MX2 A;  5FR6 A;  2PPH A;  1S3S G;  3A9K A;  3VAW A;  4ASW C;  1WMH B;  1C3T A;  2IO3 B;  1OQY A;  3DDC B;  2FCM A;  1GG3 A;  1WM3 A;  4WWN A;  1I35 A;  4W9D A;  3PPA A;  4W9K A;  2N9P C;  3HM3 A;  3TL5 A;  1V80 A;  3CST A;  1L2N A;  2V3S A;  1WXA A;  1WXS A;  1UEL A;  3VTW A;  4II3 B;  2FNJ B;  2MP2 A;  2ZNV B;  3AI5 A;  3LDZ E;  5JH5 C;  3D32 A;  3CMM B;  5C23 A;  1Q0W B;  3ZNH B;  4A3P A;  2L0T A;  2L0F A;  3SU8 X;  1H4R A;  1YQB A;  3W1Y A;  3EEC A;  3UIP B;  3BIN A;  3VUY A;  2JXX A;  2QHO A;  2UWQ A;  3GZN I;  2DZM A;  2KD0 A;  4NQL B;  4M0W B;  3DVG X;  3R66 C;  2O2V A;  3PT2 B;  3RCZ A;  4KSK C;  5KHQ A;  1SE9 A;  5GMV A;  2WYQ A;  4NJ6 A;  3H7P B;  2KTR A;  3DOW A;  3T8M A;  4GIV A;  2G45 B;  2MBH A;  3DBL I;  3PRE A;  4FUL A;  2KFJ A;  4K1R B;  4PYZ A;  1WF9 A;  5DPS A;  4HXD A;  2NPT A;  3V60 A;  2ZZP B;  1XD3 B;  3QAR A;  2KLG A;  2N7E A;  2PE9 A;  2KAN A;  5E6P A;  4II2 B;  2A5U A;  1OEY J;  4I6N B;  3APF A;  2LGD A;  4LCD E;  2FCN A;  1XT9 B;  2N1W A;  1E8Z A;  3ENE A;  4I6P A;  4JLC A;  4DHZ B;  1WXV A;  1P0R A;  4IM3 A;  3VTV A;  2I1K A;  4BBN C;  3ALB A;  2DZJ A;  4ANU A;  1WGH A;  2LVQ A;  3QC8 B;  4HWI B;  2LGY A;  1ISN A;  1YIW A;  3A9J A;  4G11 A;  3RUI B;  1TGZ B;  2KXJ A;  2WDT B;  3NS8 A;  3UIN B;  1G6J A;  2JWZ A;  2N1V A;  4WWP A;  2IO2 B;  2N4F A;  3PTF C;  1NDD A;  4E74 A;  2K6D B;  2K8C A;  3KUC B;  3KYD D;  1GC6 A;  1JRU A;  2KC1 A;  3L10 B;  2G4S A;  3ZNI D;  4KV2 A;  2ZPN A;  2J0J A;  3QJZ A;  2BYF A;  2N7D A;  2C60 A;  4ANX A;  3QX1 A;  4MGI E;  4WAA A;  3H9D A;  2NVU I;  5CHV C;  5DCN A;  2JT4 B;  3V62 A;  4AUQ C;  2ZPY A;  3Q3J A;  3OJ4 B;  4TQ1 A;  5D6J B;  4E71 A;  3ECI A;  1I42 A;  1V5T A;  4RM8 A;  3VQI A;  2LVP A;  2ZCB A;  1RRB A;  3AU5 A;  1WX7 A;  3V61 A;  3RD2 A;  2O6V B;  2K8H A;  3AUL A;  4XX5 A;  4EUT A;  4K7S A;  4KIK B;  4TQ0 A;  2EKE C;  1E8Y A;  2PE6 B;  4P7I A;  1UBQ A;  3R7Q A;  4EZK A;  1P98 A;  4NAW A;  2JPH A;  1WI0 A;  4BOS C;  4DHJ B;  3A4R A;  1SIF A;  2CS4 A;  3PS6 A;  4W9E A;  1UZX B;  4URK A;  1R4N I;  1ZGU B;  3NZS A;  1F9J A;  4GXB A;  4KDI C;  3A9K B;  3DBH I;  2L76 A;  4KDL B;  1UH6 A;  3DVG Y;  3JYU A;  2WWZ A;  3B0A A;  2G4D B;  3AXC A;  4BKT A;  3ZRC A;  1NI2 A;  3ZDT A;  5CTR C;  4AJW A;  4W9I A;  3QWZ B;  5L95 C;  1E5W A;  5LXI B;  4LDT D;  4MEL A;  2CHX A;  4FHK A;  2JRH A;  4IM0 A;  1V9J A;  1WE6 A;  2KLC A;  1WFY A;  3C0R B;  4BOZ B;  1WY8 A;  1UGM A;  2KFK B;  3VDZ A;  2AWT A;  2DYB A;  1KOT A;  4IW0 A;  2WX1 A;  3ZTD A;  2M17 A;  2CR5 A;  3V6E B;  5CHF A;  3TBL D;  4AJY B;  3ZRF A;  3L08 A;  2LXC A;  2RD0 A;  3U7D A;  2Z0E B;  4KVG B;  4MJS A;  1EUV B;  5DPW A;  2KWV B;  2JY6 A;  3OJ3 A;  2FCQ A;  1R4M I;  2DEN B;  2ZJD A;  1CMX B;  1X1M A;  2KTR B;  2EMS A;  3PRZ A;  4GDK B;  4OVV A;  4FLH A;  3RUL A;  1Z5S B;  4KSL C;  4W9G A;  5KHO A;  5HKH A;  4CYE A;  2ZVN A;  3TMP B;  3H7S A;  3KVF B;  1WRD B;  2R2Q A;  3ZKJ C;  4EZJ A;  2LD9 A;  5D94 A;  2NBW B;  2BWE S;  2FIF A;  2MBO A;  1UD7 A;  1KM7 A;  4GDL A;  3ZW3 A;  4BKG A;  2C7M B;  4EEW A;  2AL6 A;  2ZNV C;  4IWP A;  2XK5 A;  4E3C A;  4PS3 A;  1ZKH A;  2Z0D B;  2ZVO A;  4F7Z A;  1IYF A;  4XZ4 A;  2R2O A;  3ZUN A;  5JHA A;  3VUW A;  4G0N B;  2DYM A;  3UQA A;  2CKH B;  1WGD A;  2HE7 A;  4KZC A;  1E90 A;  4AP4 C;  4ZYN A;  5CHW A;  5EDS A;  3MJW A;  3VTU A;  3QK0 A;  3W1S C;  5AZH A;  4GN1 A;  4IUM B;  1VD2 A;  1LXD A;  2Z59 B;  1D3Z A;  3Q3F A;  1WR6 E;  2D2Q A;  4ZRJ A;  2N9E B;  2D3G A;  4EZL A;  3PLU A;  2AEH A;  4BKS D;  2K39 A;  2UYZ B;  2O6V D;  3ZNZ B;  2KZR A;  2CHW A;  5IAA C;  3ONS A;  2M8S A;  3S2A A;  2K25 A;  4HK2 A;  3K9O B;  4WWO A;  4K81 A;  1WGR A;  3KUZ A;  1E7V A;  4DHJ D;  3T9L A;  2GBM A;  4TUU A;  1WMH A;  4FAD A;  1P1A A;  4DWF A;  1WIA A;  2MRP A;  2PEA A;  2DAF A;  3NHE B;  5G55 A;  4DHZ E;  4G50 A;  5J2R A;  1WJ4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...