2NBUA

Solution structure of the rad23 ubiquitin-like (ubl) domain
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
78
structure length
78
Chain Sequence
MVSLTFKNFKKEKVPLDLEPSNTILETKTKLAQSISCEESQIKLIYSGKVLQDSKTVSECGLKDGDQVVFMVSQKKST
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords UV excision repair protein RAD23
publication title Structures of Rpn1 T1:Rad23 and hRpn13:hPLIC2 Reveal Distinct Binding Mechanisms between Substrate Receptors and Shuttle Factors of the Proteasome.
pubmed doi rcsb
source organism Saccharomyces cerevisiae s288c
molecule tags Dna binding protein
total genus 12
structure length 78
sequence length 78
ec nomenclature
pdb deposition date 2016-03-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00240 ubiquitin Ubiquitin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 2nbuA00
2N4FA 3PREA 2ZCBA 2L05A 1WM2A 4EFOA 2JPHA 4BKSD 3KW5B 4X57B 3DPDA 3L08A 3U7DA 2FUHB 3DCGA 4KSLC 2MW5A 4HJKA 5E6NA 3VH4B 3W1SA 3W1SC 4II3B 2NBUA 1TTNA 2NPTA 2RGFA 3B0AA 2DENB 3B1LX 3NS8A 1LQBA 2K39A 3PGEA 4JIOU 2NBWB 3A9JB 3LDZE 4FULA 1LM8B 4KIKA 1WJ4A 2KLCA 2G4SA 5J18A 3L0WB 2KTRB 2MCNB 3QARA 2AEHA 3HK0A 4J6IA 1WX8A 4HXDA 2DAFA 4MEMA 4ZRJA 4K81A 4AP4C 4NJ6A 4M8NA 4NQKE 4B6WA 3JYUA 3MJWA 2D11A 2L3ZA 4PS3A 3UINB 3BY4B 4PYZA 3RCZA 4IC7B 2ZVOA 2LGYA 2MLBA 1XQQA 2V4LA 2KFKA 2MWSB 2CHXA 1XT9B 4GGQA 4IM3A 3VTUA 4AUQC 4BVUC 1I42A 5AZFA 4A3PA 3DBRI 3VVWB 4AJYB 1UZXB 2EMTA 2YVCA 3PV1A 4RM8A 2JUOA 1WGYA 2HTHA 3IHPC 4LCDE 1ZW7A 4HDOA 3A9JA 3ECIA 2KANA 1UBQA 2ZNVC 2GMIC 3APCA 5J2RA 3R7QA 3H7SA 4BBNC 5DPWA 4WJQA 1YIWA 1NDDA 1YX6B 3QWZB 3QJZA 2KDEB 3V61A 2KHWB 3QHTA 1V9JA 3A9KB 4WQOB 1E7VA 1Q0WB 4KSKC 1UH6A 2FCNA 4WJPA 3APFA 4FN2A 3ZNID 1LFDA 2C60A 3NZSA 1WGGA 2WWZA 4DHJD 1L7YA 3ENEA 4FLHA 1GC7A 2LUEA 3HM3A 1M94A 1T0YA 2CHWA 4W9HA 3APDA 4W9CA 4XX5A 3IFWB 2OOBB 4EEWA 3UQAA 5D2MB 3W1YA 4PS8A 4HVBA 2PE9A 2PJHA 3M3JA 3JW0X 4DHJB 1WIAA 2FIFA 4FJZA 5L83A 2JY6A 4HWIB 4MELA 4YL8A 3ZRCA 4BKTA 1TZ1A 4W9DA 3ALBA 2G3QB 3OJ4B 4URKA 3KH0A 2N7EA 2NCNA 4HDQA 4GDLB 3A9KA 1A5RA 2KQSA 2I1KA 4GDKB 3ZVVA 1WYWB 1SGHA 2J0JA 1U4AA 2ZJDA 2N9PC 3CSFA 1E8YA 4II2B 5TR5A 1WM3A 2LI5A 2KMCA 4MJSB 3WIMA 4IW0A 4TV3A 2AL6A 5HKHA 1V2YA 1D3ZA 5E6PA 4KDLB 3SU8X 3H7PB 4FJYA 1KLVA 2DAJA 3TBLD 4F7ZA 2LGXA 3ZTDA 3T8MA 1TGZB 3VQIA 1V6EA 2JZ3B 1WR1A 1S3SG 2AWTA 1H4RA 1E8ZA 3UGBB 1P98A 3PPAA 5FR6A 2GBRA 1L2NA 3KUZA 2BWFA 4FJVB 4XC2A 2LJ5A 4GXBA 1RLFA 3VDZA 1WJNA 4GDKA 4IUMB 5IAAC 2KDBA 5J17A 3HIZA 2KWUB 2HD5B 3LJ3A 4NPNA 4ANXA 1PQSA 2KZRA 2D07B 4CHKA 3QAQA 4EZKA 4LJOB 2LVOA 3QK0A 2XK5B 3Q3JA 2FCQA 3QX1A 2AL3A 4DDGD 3ZO5B 4G0NB 3C0RB 4NAWB 1XD3B 3DVNU 3V6CB 4CO7A 4B95A 3ML9A 1P3QU 1OTRB 2G4DB 4FHJA 2BF8B 2Z59B 3TCAA 4BFRA 5CHFA 2KJHB 2KKCA 2A5UA 3HM6X 3PTFC 2C5LC 2NR2A 2M8SA 3EFUA 4TQ1A 3T9LA 2VRRB 2WDTB 1E7UA 2BYFA 2KJRA 3A1QA 3PHWB 4ZDVA 2K25A 2NBVB 2CR5A 2LRUA 1WXAA 4B9KA 3ZRFA 2M1MA 1IPGA 2IO3B 3ML8A 2K8CA 5JZEB 1BT0A 3L13A 3PVLA 5DCNA 2XK5A 4MM3A 4HLEA 1WH3A 3ONSA 1WY8A 2N1WA 5CTRC 1WJUA 2CKHB 2KN5A 1WXSA 4ZYNA 2M17A 3SD5A 4GU2A 2K6DB 3DBLI 1ZKHA 3CF6E 3X23A 5LXIB 2DZMA 4HCPB 4AOFA 3QQ8B 1WR6E 3PRZA 2HJ8A 4W9EA 3PZDA 4EZJA 4GSWA 3VHTC 4JGHB 2MSED 4TUUA 4MGKE 3OJ3A 2KDFB 3NZUA 3DVNV 4BKSA 3DOWA 2PE6B 3ZNHB 3QIJA 4DBGA 2JVCA 2JF5A 2KTRA 2CU1A 1GC6A 1R4MI 3KYCD 2K8HA 3HHMA 4JQWC 3PHXB 3VH3B 2BYEA 2ZVNA 1GG3A 3U8ZA 3ZNZB 2HE7A 3PLVA 5D6JB 3R66C 2KFJA 3BINA 3L54A 2JRHA 3ZIMA 2JZZA 3VTVA 2O6VD 3RT3B 3X0WA 1WMHB 1J8CA 3UIOB 1UGMA 3KVFB 1RAXA 2LGDA 3U30A 1WE6A 1H8CA 4IM0A 4W9JA 1GUAB 2BKRB 2RD0A 4KV2A 4DHZE 3NY5A 2IO1B 1ISNA 2O6VB 2EMSA 1V5OA 4ICVA 3RZWC 3DBHI 1LXDA 4EOYA 1P1AA 2N9XA 3ZW3A 1Z5SB 2A4ZA 4HPLB 1KM7A 2XEWA 3Q3FA 1WXVA 4EUTA 4MGIE 4BBNF 4ZRIA 4XZ4A 3CMMB 3PLUA 2M0XA 2PEAA 2OJRA 4BOZB 2KVRA 4WJNA 2UYZB 1WF9A 1WGHA 2RSUA 2KWCA 1GNUA 3VFKA 1QZEA 4F8CB 2CHZA 2DYBA 2NS5A 4W9KA 1WGRA 4E3CA 3N30A 5JHBA 2MP2B 2MBEA 1OEYJ 2FAZA 2N9EB 2ASQA 3K9OB 1SE9A 2Z0DB 3TL5A 1J0GA 1WI0A 2FCMA 2KNBA 4EZLA 2FNJB 4IWPA 2J0KA 1RFAA 2JXXA 3WAOA 3DBSA 2DYOA 5JH5C 4GDLA 2L8JA 5L95C 3WAMA 1NI2A 2IYDB 3EHVA 1E90A 4LDTD 2CS4A 2KWVB 4MGZE 4RMAA 1OQYA 3JSVB 4EKUA 1IP9A 2L0FA 4MJSA 2BPSA 3EC8A 2GBMA 1P9DU 1E5WA 2MBHA 4CYEA 4PS7A 2BKFA 2K8BA 3QA8A 5D94A 4LDTB 3H7PA 1E8WA 3M95A 2LASA 3AU5A 1Q5WB 1WX9A 3PRPB 1G6JA 3UQBA 3N3KB 2K6QA 1KJTA 1R4NI 2Y5BB 2J0MA 2L76A 4JL9A 5DPSA 2WX1A 2NVUI 2NPTB 3OAWA 2RPQA 1K8RB 2IZVB 2BGFA 4A3OA 3DVGY 3NOBA 3ZNGC 1GJZA 1P0RA 4KIKB 2AYOB 4E74A 5AZHA 3MTNB 3PSEB 2KC2A 1YJ1A 3AU4A 1V81A 5AZGA 3R3MA 3JSVA 4MGYE 4W9LA 1UELA 2DZIA 5DPTA 1S1QB 2LRWA 4K1RB 4P7IA 3V62A 4DK5A 4IG7B 2GBJA 4NAWA 2QHOA 3VXWA 5CX3A 2R2QA 1AARA 2O2VB 3DDCB 2KFKB 3V6EB 1X1MA 1Z2MA 3QC8B 2IO2B 1NBFC 3AI5A 2LVPA 1ZGUB 1Y8RC 4MSQB 1WX7A 2IBIB 3KUDB 4GB9A 4W9FA 3I3TB 2L00B 3JVZX 4PYUA 4FHKA 1E8XA 3VAWA 1IYFA 1KOTA 2IY0B 1C3TA 4AWJA 2KTFA 2ZNVB 4IWOA 3ZKJC 4WAAA 4ANVA 4ANWA 1VD2A 2B3AA 4DHZB 3TIXA 2L7RA 3VTWA 2FIDA 2KC1A 3GOEA 2UWQA 2WX0A 4MDKE 4W9GA 4FADA 5CHWA 2KX0A 5IA7A 2D10A 5DPRA 1VCBA 3TJPA 2D3GA 2WYQA 4MSMB 2BWES 2MX2A 1WZ0A 1YX5B 1OGWA 1WRDB 4HPMB 2MQJA 2O2VA 2ZPNA 3NHEB 4GN1A 4ZRKA 5LLIA 3R7RA 2XBBC 2G45B 2C7HA 4E71A 2MBQA 2L0TA 2LXAA 2YLMA 3IBEA 4WWPA 3TMPB 5C1ZA 4KZCA 2N1VA 2ZCCA 2GBKA 2IY1B 4HK2A 2R2OA 4WWNA 1V80A 3WALA 1MG8A 2D2QA 4GOCA 4OVVA 3PS6A 4LJPB 2W9NA 3AULA 4TQ0A 3ZUNA 2C7NB 3H6NA 4HCNB 2K1FA 2KK8A 5EDSA 4G11A 2LXCA 1UD7A 1V5TA 3VUYA 3ZDTA 4DDID 3SDLC 1V86A 4NY0A 3V60A 3L17A 4FA6A 3D32A 2JT4B 5AEKB 3B08A 2DX5B 3PRMB 4FBJB 1I35A 1WZ3A 3EECA 2LD9A 3M63B 2ZEQA 3DVGX 4N9F4 4BOSC 4RM9A 3AXCA 4KVGB 4I6LB 2EKEC 2LZ6A 4GMVA 5GMVA 3RYTA 3ZLZA 1WMHA 2LVQA 5D7GA 5G2NA 3IVFA 1SIFA 3OLMD 4I6NB 1EO6A 3RZFA 4A20A 3GZNI 4NNJB 3K9PB 2MA9B 4DXAB 4BKGA 2V1YA 2MRPA 1TBEA 3H9DA 4WWOA 2ZPYA 2O6VA 2J7QB 2GOWA 2KX3A 3H1UA 4GIVA 1C1YB 3MHSD 4K7WA 3DQVA 5LXHA 1WE7A 3RULA 2KQ7A 2KXJA 2KD0A 3A4SC 4I6PA 3WA0A 1J19A 3A33B 2FCSA 5G55A 3M62B 2DZKA 4F1SA 2LWPA 3L10B 1WGDA 3N32A 5E6OA 1YQBA 2REXA 4IWQA 3UIPB 4NJ7A 4M0WB 3VUWA 2C7MB 2BYVE 4MH0E 2ZZPB 3IG3A 4JLCA 4W9IA 3WAPA 2RR9A 4DWFA 3ZTCA 2DZJA 4G3XB 1EF5A 3UF8A 4K7UA 2MP2A 4OVUA 2KLGA 3A4RA 2C9WB 3O65B 3PT2B 2KDIA 4IM2A 3KUCB 4G50A 4KZ0A 4WJOA 1WFYA 1OEYA 2DYMA 2I1JA 3P2BA 5CHVC 1HE8A 2GBNA 2M4NA 5C23A 4ASWC 1EUVB 2Z0EB 3A1QB 4ANUA 3L16A 2N7DA 2PPHA 1WXMA 3QCAA 5KHOA 2JRIB 2DHZA 2MBBB 2V3SA 1FXTB 4NQLB 1UBIA 4M8MA 2KO3A 3WANA 2JWZA 1Q1OA 3S2AA 1EF1A 1WJ6A 2IO0B 4TKNA 5JHAA 1JRUA 4AJWA 2KJ6A 2MBOA 3SHQA 1RRBA 3RUIB 5KHQA 2KMAA 1YD8U 2KOXA 4K7SA 1V49A 3KYDD 5BO4B 1CMXB 1F9JA 4KDIC 3CSTA 3ZDMC 3RD2A 3VUXA 4ICUA
chains in the Genus database with same CATH superfamily
3PREA 2L05A 1WM2A 4BKSD 4X57B 3W1SA 4II3B 2WXKA 1WYGA 4LNNA 1C4AA 1R4NB 2MEKA 3RNAC 4FULA 3A9JB 3LDZE 5GXGB 4KIKA 2VH1A 2G4SA 3W5UB 2MCNB 2KTRB 2AEHA 1STEA 3HK0A 4DXGA 4ZRQA 1QQRA 1VZ6A 4MEMA 1EWCA 4RGTA 3VR9B 2LMCA 4NQKE 4B6WA 3JYUA 1L0VB 1QILA 1AYFA 4ZHPA 2ZVOA 3R2IA 1DGJA 1XQQA 4S0RA 3LYYA 3VTUA 5HI1A 4A3PA 1T6BX 2EMTA 2YVCA 1F1HA 1MHHE 1WGYA 2HTHA 4LCDE 4HDOA 3A9JA 1NENB 1JWBD 1UBQA 3U52E 4C56C 2L1AA 1PGXA 3APCA 5DPWA 4WJQA 1YIWA 2KDEB 3V61A 1FIQA 1E7VA 1Q0WB 3RNFC 1ZDVA 1FO4A 1QOFA 3NZSA 3AH7A 2WWZA 3ENEA 2LUEA 1M94A 1FNVA 4EEWA 2OOBB 4PS8A 4JX1C 3URYA 2FIFA 2JY6A 4HWIB 1L6VA 1TZ1A 1ACCA 3AEDB 3ALBA 2G3QB 4URKA 3KH0A 2J4XA 1JW9D 2KQSA 4GDKB 1WYWB 1SGHA 3U7DA 3RNCC 4II2B 2D5GA 1HZ6A 3AEAB 1AW7A 2AL6A 4TV3A 5E6PA 4OZAA 4WH4A 1KLVA 1WRIA 2LGXA 2IGGA 1TGZB 1V6EA 1H4RA 3UGBB 1JMLA 5FR6A 2GBRA 3HVZA 1V1PB 1WJNA 4GDKA 5IAAC 2KDBA 2B76B 3AE4B 3NS1A 3HIZA 4ANXA 2N7JA 3BVMA 4LJOB 3Q8EA 4M0WA 2FCQA 4G0NB 3C0RB 4NAWB 4RF1A 3DVNU 3RFZB 2WXPA 4HKZE 1T0RC 2BF8B 2Z59B 3HM6X 2A5UA 3PTFC 2C5LC 2WDTB 1E7UA 3NZ3A 3FAHA 2CR5A 2LRUA 3ML8A 1IPGA 1IBXA 1CJEA 2VZKD 4HLEA 1SBBB 1WY8A 2EELA 5CTRC 4ZYNA 3TEZA 2M17A 1L4ZB 2RPVA 2DBYA 3AEGB 2K6DB 1ZKHA 2NTTA 5LXIB 4XE0A 4AOFA 3QQ8B 1WR6E 2YEPF 2HJ8A 3PZDA 1WSPA 3Q8BA 1FPYA 3I63C 2WQYB 1T0QC 3Q3OC 2BB5A 3NZUA 4C80A 3DVNV 3ZNHB 3QIJA 3ZJTA 5EE0A 2IDYA 1KLUD 3ZJVA 3KYCD 2JU6X 3ZNZB 2WU2B 3TEYA 3L54A 3VTVA 2O6VD 3RT3B 3ETRA 1WMHB 1J8CA 5E6JA 1RAXA 2LGDA 1WE6A 1D5XC 1H8CA 1C79A 1KH0A 1V5OA 3DBHI 1QF6A 1TY0A 4BBNF 4XZ4A 3PLUA 2PEAA 3GE8C 2OJRA 1EWYC 1WGHA 4TMAB 1GNUA 1B9RA 5HHDG 2DYBA 4OHJA 4OVZA 5JHBA 2MP2B 2K9XA 2FAZA 2N9EB 4OZCA 3CIRB 1SE9A 1FNUA 2BS2B 2N0SB 3HRDD 3VRBB 4IWPA 2E6XA 3NVWA 1ZUD2 1NI2A 3AV8A 5FK9C 2KWVB 3TUOA 3JSVB 4EKUA 1IP9A 2ZW1A 2BPSA 4MJSA 2GBMA 3BVZA 4M02A 1SSNA 2MBHA 4KKJA 1PGBA 3H7PA 3M95A 3AU5A 2W55A 1QLBB 1JRPA 2Y5BB 1E10A 3TSSA 2RPQA 1K8RB 2PVOD 2BGFA 1TJEA 1NYRA 1GJZA 4Q2JA 2TSSA 3PSEB 5G5HA 3RPFC 1MJDA 1V81A 3JSVA 4MGYE 1UELA 4P7IA 3V62A 4DK5A 4IG7B 5H92C 2QCZA 3DDCB 1X1MA 2IPKD 4YXDB 3QC8B 2IGDA 3KUDB 4GB9A 1VR9A 2L00B 4PYUA 3P1MA 1KOTA 4AWJA 2ZNVB 4ANWA 4AS1A 1JALA 2FIDA 3DHIC 4W9GA 2WX0A 4MDKE 2QIEB 2WXQA 5DPRA 2WYQA 2JYEA 2OJWA 2X8XX 2KMMA 1R7SA 2MQJA 2J53A 2XNAC 3EFCA 2GLSA 5C1ZA 4KZCA 3DBLB 2BTEA 3WALA 2R2OA 4WWNA 3PZ7A 2N9KA 3NUHB 1Q10A 2C7NB 4RF0A 4G11A 2I38A 3VUYA 4DDID 1V86A 4NY0A 3V60A 3L17A 5AEKB 3B08A 1I35A 2LD9A 3DVGX 1V97A 4BOSC 4KX6B 3GS2A 2L52A 5GMVA 3C8YA 4GMVA 3IVFA 4A20A 4WWOA 3IXSA 1C1YB 2KXJA 1J19A 2KWDA 2FCSA 5G55A 3M62B 3L10B 4B0EA 2PIAA 5E6OA 5C2TB 4C00A 1FEHA 5LNK1 2BYVE 3V3XA 4DWFA 1N61A 2RR9A 3NRZA 2DZJA 1EF5A 2V0GA 2D3CA 1XO3A 2WNMA 4G50A 1P7EA 2DYMA 1XF5L 2I1JA 3P2BA 3Q14C 4HEA1 1KFYB 1HE8A 2Z0EB 2KYWA 2JZPA 2MBBB 4QAYA 4M8MA 3WANA 2EKIA 1UUPA 4AJWA 2MBOA 1TS5A 2WXMA 5C3JB 4M01A 1M4VA 3KYDD 1MG4A 4ICUA 2ZCBA 2FE8A 4L2YA 3L08A 3N1YC 3B2FA 3VH4B 3Q6BA 2NBUA 1K52A 3B0AA 2DENB 2DLBA 3NS8A 2KAJA 3B1LX 1DOXA 3PGEA 4YTNB 4LTUA 1SEBD 3U4EG 2BVCA 4NJ6A 1VZ7A 4M8NA 4AP4C 3ZYYX 2D11A 2L3ZA 3BY4B 2KFKA 2MWSB 4IM3A 4GGQA 2UU7A 1SXTA 3DBRI 3Q8FA 2GRIA 1SIJA 1UZXB 1FXIA 2R61A 3PV1A 4RM8A 2KANA 2ZNVC 3ZJUA 5J2RA 3H7SA 1NDDA 2IJ0A 3EA6A 3QJZA 3LB8C 2QDFA 4UDUC 1XLOA 1UH6A 2K5PA 4FN2A 1LFDA 1WGGA 1V1OA 5D3DA 3APDA 4W9CA 1I4RA 2PJHA 5IO9A 3M3JA 4HRSA 3FC4A 4FJZA 4YL8A 3N20C 1OQQA 1WGKA 4LNKA 1P7FA 2G9HD 2N7EA 4HDQA 4GDLB 4OZBA 1A5RA 2ZJDA 2J0JA 2N9PC 2Y5PA 4YTMB 1F2RC 5TSSA 2WXLA 5FKAC 4XDDA 4FJYA 2DAJA 4F7ZA 3VQIA 3C19A 1CZPA 4LNIA 1WR1A 2AWTA 2K3UA 3KUZA 2BT6A 4GXBA 4ZRPA 3NJTA 2BQQA 1E6EB 1TZOA 5I4DA 2FUG1 3LJ3A 2HD5B 1A70A 3QK0A 2XK5B 3U7ZA 4DDGD 2AL3A 3ZO5B 3V6CB 2G4DB 1OTRB 3TCAA 3E56A 3BK2A 4ZYSA 2NR2A 3B2GA 2M8SA 3EFUA 2VRRB 2KJRA 4ZDVA 1ESFA 2LJIA 4YWGG 3Q8CA 2IO3B 1YN4A 3CWIA 1BT0A 3SFDB 3PVLA 3DWMA 1WWTA 5DCNA 2XK5A 1YQ4B 1WJUA 4P1BC 4LNFA 3U2SC 2VZKB 3X23A 2DZMA 4HCPB 4EZJA 4TUUA 2WXIA 2XN9C 2INNE 1V8CA 4JPSA 1I4HA 1TKYA 3DOWA 3W2DA 1FM0D 2KTRA 1PUTA 2CU1A 1XCQL 1GC6A 3IT6B 2KACA 3HHMA 3PHXB 4RGNA 2ZVNA 2HE7A 1AN8A 2JRHA 3AE2B 3ZIMA 2JZZA 1L6UA 3I9V1 4ZOHC 4RGOS 3KVFB 3U30A 4DHZE 2IO1B 1ISNA 2O6VB 3RZWC 1Z5SB 4HPLB 1WXVA 3V05A 3PO0A 4PK1A 1E7PB 3CMMB 4BOZB 4N59A 4WJNA 1UF0A 1TT5B 4A55A 3VFKA 1GB4A 2CHZA 2NS5A 3TEWA 2KN4A 3N30A 2WDQB 4A90A 5H8YE 1HXYD 1FFVA 3TL5A 4B0MA 1J0GA 2FCMA 2KNBA 1TS4A 2J0KA 1RFAA 3TEXA 2DYOA 1ZPSA 2L8JA 2IYDB 2SEBD 1E90A 2M19A 2MJDA 2CS4A 1FCLA 4RMAA 1OQYA 1D5MC 3Q2AC 1F77A 3DHHC 2K8BA 3T3OA 1JCKB 1E8WA 1FRDA 1WX9A 3UQBA 1R4NI 2WX1A 3OAWA 2NPTB 1V1PA 3NOBA 5BYRA 2AYOB 4E74A 1YN5A 5AZHA 2KC2A 3R3MA 4W9LA 4JWUC 1EU3A 2Y3AA 4MH8A 1S1QB 5DPTA 3BWUD 4NAWA 1VZ8A 2QHOA 2L83A 4KGSA 3V6EB 4HROA 3AI5A 1ZGUB 1Y8RC 1WX7A 4C4VB 4W9FA 3I3TB 4NAMA 4FHKA 3VAWA 1IYFA 2IY0B 3SR6A 4ANVA 1VD2A 4DHZB 3TIXA 3VTWA 4US9A 3W9CB 2KX0A 5IA7A 3RNBC 3TJPA 4MSMB 2BWES 1ET6A 1ZP0B 3R7RA 2MBQA 3IBEA 4O1NA 4C4VA 1RYJA 3I57A 2H88B 5AUIA 3PS6A 2W3RA 2W9NA 3H6NA 3P4QB 2K1FA 1C76A 2KK8A 4K3CA 1UD7A 3R2TA 4A9AA 4FA6A 2JT4B 1T5XD 3EECA 3M63B 4RM9A 1R4MB 3AXCA 4KVGB 4I6LB 2EKEC 4L1BA 3RYTA 1WMHA 5D7GA 1JWAD 1RM6C 2V1YA 3H9DA 2ZPYA 2J7QB 1J7CA 3DQVA 1UWXA 1Y56A 4H2AA 2ACZB 1SB3C 2N9LA 3N32A 1SE2A 2REXA 5BYSA 2C7MB 3IG3A 4JLCA 2WGSA 4G3XB 4K7UA 2MP2A 3PT2B 3O65B 4WJOA 3KUCB 1DOYA 2JQRB 3IAM1 1TS2A 1YQ3B 3A1QB 4C7ZA 3IAS1 3L16A 5KHOA 1FXTB 4RH6A 2PVGC 1Q1OA 1WXQA 1WJ6A 2IO0B 1BXTA 3AEBB 4TKNA 1JRUA 2JYTA 3AECB 1RRBA 3RUIB 5KHQA 1YD8U 2KOXA 2V3NA 5BO4B 3O13A 4KDIC 4XDCA 3ZDMC 1GOZA 3RD2A 1XEEA 1ZXHA 2M56B 2FUHB 4KSLC 1IGCA 2J52A 2K39A 1L0XB 2NBWB 1LM8B 1WJ4A 2KLCA 1UGJA 3L0WB 3QARA 4J6IA 1WX8A 3AB5A 2DAFA 4HPPA 3UINB 4PYZA 2W54A 3RCZA 2LGYA 2V4LA 1UNSA 2CHXA 1XT9B 4AUQC 1I42A 5AZFA 3VVWB 1C4CA 2Y5CA 2JUOA 3IHPC 1N5WA 2BS3B 1I4XA 1ZW7A 3ECIA 4D2KA 2GMIC 2WXFA 1TIFA 3R7QA 2X38A 1YX6B 3QWZB 5JXVA 3A9KB 4WQOB 1MVKA 3AE5B 2FCNA 1KRHA 3APFA 2BS4B 4DHJD 1L7YA 4FLHA 3HM3A 3IFWB 5D2MB 2PE9A 1D5ZC 3JW0X 1HTQA 5L83A 4MELA 4LNOA 3ZRCA 3BVGA 3SEBA 1ET9A 2KVZA 3A9KA 3ZVVA 4A6QA 1PFDA 4ITKA 1U4AA 4YSYB 5FR3A 2KMCA 1OQRA 2I2YA 3WIMA 4IW0A 5HKHA 1D3ZA 4KDLB 3SU8X 2W3SA 5IN7A 3T8MA 2JZ3B 2RDHA 5BYQA 3SFEB 3PPAA 1L2NA 2BWFA 4FJVB 4XC2A 3RN9C 1RLFA 1QOGA 3AM9A 3VDZA 3I5JC 2KWUB 1PQSA 2KZRA 2D07B 4CHKA 4YT0B 4C7YA 2LVOA 4MM3B 3QX1A 2MHJA 2LGSA 4CO7A 2INPE 3E9SA 1P3QU 3ML9A 5CHFA 2MJEA 3ZGZA 2QILA 1IUEA 3J9CA 4RGMA 5IOIA 2AQ3B 4TQ1A 3T9LA 1I7HA 2BW2A 3PHWB 2HJ1A 1K50A 1MHXA 4WIPA 1FXAA 3Q3MC 4B9KA 1SE4A 2M1MA 4ZHOA 2K8CA 5JZEB 3L13A 4MM3A 1WH3A 2N1WA 5EE3A 2WU5B 2KN5A 1WXSA 3AE1B 3SD5A 2GI9A 4GU2A 2JXTA 3DBLI 1J7AA 3NVZA 4W9EA 2NMQA 1GB1A 2MH7A 3VHTC 2LEKA 4JGHB 2MSED 1TKGA 2KDFB 4IKGA 2PW9A 1LGRA 4BKSA 2PE6B 4R3DA 4DBGA 2JF5A 2W82A 2K8HA 4JQWC 3VH3B 2BYEA 1GG3A 3U8ZA 3R66C 3DHGC 3BINA 1XCTL 2V3PA 4OW0A 3X0WA 1I4GA 1UGMA 3WCQA 1ENFA 4IOIE 2DNFA 4IM0A 2RD0A 4JWSC 3NY5A 1NEKB 2EMSA 1LXDA 2L32A 1P1AA 2INCC 3ZW3A 4EOYA 3R8BA 2A4ZA 4XYCA 5HFYA 4EUTA 2RSUA 4YSXB 4F8CB 1I4PA 1C4PA 3T3NA 2PKOA 4W9KA 1WGRA 4E3CA 5EE9A 2MBEA 1C9FA 2ASQA 2Z0DB 3KLSX 3Q3NC 3NG0A 3FKYA 3WAOA 3DBSA 2WS3B 2PTLA 4GDLA 1PGAA 1YN3A 4JE3B 4LDTD 2AQ2B 3KQ4A 2NTSA 2ZW0A 2L0FA 5IP4D 3EC8A 1E5WA 4PS7A 1XXGA 2BKFA 2JSVX 2YEPB 2QEJC 3ABVB 1G6JA 3PRPB 3N3KB 3Q8AA 4WQMA 3P4SB 4M00A 1D6EC 2BB6A 1CK1A 2NVUI 1KLGD 2IZVB 3DVGY 3ZNGC 1P0RA 4KIKB 4S17A 2HDEA 3MTNB 2WDRB 2V4IB 4K1RB 1VRAB 2Q5WD 4P6VF 3VXWA 5CX3A 2O2VB 4TSSA 1JWSD 3Q69A 2IO2B 2LVPA 4MACA 1FFUA 1KF6B 2KTFA 3LXFA 2B3AA 2L7RA 1AWDA 2KC1A 2CJOA 4FADA 2D10A 2D3GA 2MX2A 1WZ0A 1YX5B 1WRDB 4HPMB 2O2VA 2ZPNA 1N62A 1L4DB 4GN1A 4CQNA 1LO5D 2G45B 4E71A 4WWPA 5D3IB 3TMPB 4LLGM 1TY2A 2N1VA 2ZCCA 2GBKA 1BMLC 2D2QA 3P4PB 4GOCA 4OVVA 4LJPB 2QJLA 4TQ0A 3OWEB 4GLSC 4HCNB 1V5TA 4KGRA 3ZDTA 4ACFA 3D32A 2RDBC 2DX5B 3PRMB 4FBJB 1BUIC 4P1CC 2CU3A 3AEEB 2LZ6A 1JWMD 5G2NA 4BZAA 1SIFA 3OLMD 4I6NB 1EO6A 3GZNI 4NNJB 4WAFA 2MA9B 4DXAB 4BKGA 2MRPA 1TBEA 2O6VA 2KX3A 3RNEC 2ICIA 3EGRA 3H1UA 4GIVA 4PT5A 4K7WA 2G1EA 4HJGE 3RULA 2KQ7A 2KD0A 3A4SC 4I6PA 3WA0A 1YOVB 2ONQA 3DBHB 3BIID 2LWPA 1YQBA 3MFGA 4IWQA 3UIPB 4NJ7A 4M0WB 3VUWA 4FXCA 1T0SC 4USAA 2ZZPB 3WAPA 1YJJA 3UF8A 2WHIA 4OVUA 2C9WB 4IM2A 2WXNA 1ZDXA 1WFYA 3MC0B 2WXOA 5CHVC 1QKZA 2GBNA 1EUVB 2N7DA 2PPHA 1WXMA 2DHZA 2V3SA 4NQLB 2WXGA 1IBXB 3S2AA 1EF1A 5JHAA 1XLNA 5AUKA 2KJ6A 5MPOA 2KMAA 4WWMA 1V49A 1CMXB 2PLPA 1F9JA 3WAMA 2MJ3A 2N4FA 4EFOA 1K51A 2JPHA 3KW5B 3UI3A 3DPDA 3DCGA 4WURA 3W1SC 2MW5A 4HJKA 5E6NA 1TTNA 2NPTA 2RGFA 2V9HA 1PDXA 3AE9B 1LQBA 3NVVA 4JIOU 2AX5A 3MP9A 4AQ7A 5J18A 2Z8LA 4RCOA 4HXDA 4ZRJA 4K81A 1NVID 3MJWA 4PS3A 4IC7B 1FRRA 2MLBA 4P16A 1SF0A 4BVUC 5G5GA 3N1XC 4AJYB 3P42A 1DOIA 4KGTA 1EU4A 2FBWB 4BAXA 4BBNC 5BMHA 1F0ZA 1FD6A 2KHWB 3QHTA 1V9JA 4KSKC 4WJPA 3ZNID 1QT9A 2C60A 1JWUD 1GC7A 1T0YA 2CHWA 4W9HA 3HVDA 3MC8A 4XX5A 3UQAA 2RMMA 3GE3C 3W1YA 4YSZB 4HVBA 1NI3A 4DHJB 1WIAA 2VH2A 1D4BA 1VJKA 3RNGC 4BKTA 4W9DA 1TKEA 2E3TA 3OJ4B 1RWSA 1SJHD 2NCNA 2I1KA 2LFIA 3GB1A 3CSFA 5TR5A 1E8YA 4US8A 1UWMA 1WM3A 2LI5A 3MHZA 4MJSB 1V2YA 3N9YC 1FMAD 3H7PB 1QOBA 3TBLD 3ZTDA 3IT4B 1MI0A 3AE3B 1OFFA 1S3SG 1E8ZA 1ROEA 1P98A 1HA5A 3AE7B 2LJ5A 4J3OD 4IUMB 5J17A 1YNTE 4NPNA 1VDVA 4XWWA 3QAQA 1HZ5A 4EZKA 1E0ZA 2WP9B 3Q3JA 1XD3B 2RDGA 2KDMA 4B95A 4FHJA 1L5PA 1FNWA 3RMKC 4BFRA 1I4QA 2KJHB 2KKCA 3AMZA 4HKQA 1J7BA 1YJIA 2BYFA 3A1QA 4IDIA 3N1ZC 1VLBA 2K25A 2NBVB 2CJNA 1WXAA 3ZRFA 1GAQB 4RFBA 3ONSA 4RNAA 2CKHB 3AEFB 2KT7A 3CF6E 1HTOA 1DYQA 3PRZA 3KWVA 2WLBA 2H89B 5T8IA 4GSWA 2DWQA 4MGKE 3OJ3A 3BYYB 2BYTA 3PZ8A 1ZXIA 1N5XA 2GB1A 2WXJA 1SE3A 2JVCA 1QOAA 1FCCC 1R4MI 4EE2A 3PLVA 5D6JB 2KFJA 3DWGC 1ZOYB 1GPXA 3UIOB 1HQRD 1TS3A 1N60A 4W9JA 1N63A 1GUAB 2BKRB 4KV2A 3W5VB 2WXHA 4ICVA 2WXRA 2LHDA 2M0AA 3DBRB 2N9XA 2PMVA 1KM7A 2XEWA 3Q3FA 5BMGA 1ZE3D 4NZLB 4MGIE 3B9JA 4ZRIA 4REZA 2M0XA 5HG2A 2KVRA 2UYZB 1CQVA 1WF9A 2KWCA 4ARCA 1QZEA 2LGIA 3ZQ4A 4K3BA 2HTME 2LHEA 1OEYJ 3K9OB 2D3AA 2J42A 1WI0A 3EUB2 4EZLA 2FNJB 2K22A 2JXXA 2SAKA 1JROA 5JH5C 2QMTA 1MPEA 5L95C 3EHVA 2WDVB 4MGZE 1B1ZA 1P9DU 4CYEA 1C77A 2ON8A 1E9MA 3QA8A 5D94A 3HUIA 4XWTA 1RFKA 1KTKA 4LDTB 2INDC 5EE1A 2LASA 1Q5WB 3FILB 2K6QA 1KJTA 2LUMA 3KWLA 1T3QA 4DQOC 4LK0M 4JL9A 2J0MA 2L76A 5DPSA 3P63A 2OEDA 4N6EB 4A3OA 1JQ4A 1SJED 1K53A 2IGHA 1YJ1A 3AU4A 5AZGA 3NVYA 4KKIA 4ARIA 2DZIA 2K0PA 2LRWA 4DXFA 2GBJA 3OG5A 2AQ1B 3BZDB 2R2QA 3FILA 1AARA 2QSDA 2KFKB 1Z2MA 1NBFC 4MSQB 2QC8A 4XGAB 2IBIB 3L4PA 3JVZX 1E8XA 1C3TA 4IWOA 3ZKJC 4WAAA 3ZXVA 3VRAB 3GOEA 2UWQA 2KQ4X 5CHWA 3BK1A 1F2RI 1MFWA 1VCBA 4N58A 1OGWA 3NHEB 4ZRKA 5LLIA 2XBBC 3AN1A 2C7HA 2L0TA 2LXAA 2YLMA 1HEZE 1TYGB 3H8HA 3AE8B 2IY1B 4HK2A 1V80A 1MG8A 3AULA 1NYQA 3ZUNA 3ZXRA 5BMIA 5EDSA 5IKCM 2LXCA 3SDLC 1WZ3A 2ZEQA 4N9F4 3MC9A 2JWUA 3ZLZA 2LVQA 3RZFA 1C78A 1XLQA 3K9PB 1L0YB 2GOWA 3MHSD 5LXHA 1WE7A 1YMHE 3A33B 2DZKA 3AE6B 3VR8B 4F1SA 4L23A 3MJ5A 1WGDA 4A8XC 2JX5A 1PYWD 4MH0E 4W9IA 4NJCA 3ZTCA 3P4RB 2KLGA 1IGDA 1N6ZA 3A4RA 2KDIA 4KZ0A 1OEYA 3GP7A 3RI7C 3GZNB 1F52A 2M4NA 5C23A 4ASWC 1XLPA 4ANUA 1EM7A 4YTPB 3QCAA 2JRIB 1UBIA 2KO3A 2JWZA 2D3BA 3SHQA 4K7SA 2OHFA 3CSTA 3BYTB 3VUXA 4MT5A 2BBCA
chains in the Genus database with same CATH topology
2N4FA 3PREA 2ZCBA 2L05A 1WM2A 4EFOA 2JPHA 4BKSD 3KW5B 4X57B 3DPDA 3L08A 3U7DA 2FUHB 3DCGA 4KSLC 2MW5A 4HJKA 5E6NA 3VH4B 3W1SA 3W1SC 4II3B 2NBUA 1TTNA 2NPTA 2RGFA 3B0AA 2DENB 3B1LX 3NS8A 1LQBA 2K39A 3PGEA 4JIOU 2NBWB 3A9JB 3LDZE 4FULA 1LM8B 4KIKA 1WJ4A 2KLCA 2G4SA 5J18A 3L0WB 2KTRB 2MCNB 3QARA 2AEHA 3HK0A 4J6IA 1WX8A 4HXDA 2DAFA 4MEMA 4ZRJA 4K81A 4AP4C 4NJ6A 4M8NA 4NQKE 4B6WA 3JYUA 3MJWA 2D11A 2L3ZA 4PS3A 3UINB 3BY4B 4PYZA 3RCZA 4IC7B 2ZVOA 2LGYA 2MLBA 1XQQA 2V4LA 2KFKA 2MWSB 2CHXA 1XT9B 4GGQA 4IM3A 3VTUA 4AUQC 4BVUC 1I42A 5AZFA 4A3PA 3DBRI 3VVWB 4AJYB 1UZXB 2EMTA 2YVCA 3PV1A 4RM8A 2JUOA 1WGYA 2HTHA 3IHPC 4LCDE 1ZW7A 4HDOA 3A9JA 3ECIA 2KANA 1UBQA 2ZNVC 2GMIC 3APCA 5J2RA 3R7QA 3H7SA 4BBNC 5DPWA 4WJQA 1YIWA 1NDDA 1YX6B 3QWZB 3QJZA 2KDEB 3V61A 2KHWB 3QHTA 1V9JA 3A9KB 4WQOB 1E7VA 1Q0WB 4KSKC 1UH6A 2FCNA 4WJPA 3APFA 4FN2A 3ZNID 1LFDA 2C60A 3NZSA 1WGGA 2WWZA 4DHJD 1L7YA 3ENEA 4FLHA 1GC7A 2LUEA 3HM3A 1M94A 1T0YA 2CHWA 4W9HA 3APDA 4W9CA 4XX5A 3IFWB 2OOBB 4EEWA 3UQAA 5D2MB 3W1YA 4PS8A 4HVBA 2PE9A 2PJHA 3M3JA 3JW0X 4DHJB 1WIAA 2FIFA 4FJZA 5L83A 2JY6A 4HWIB 4MELA 4YL8A 3ZRCA 4BKTA 1TZ1A 4W9DA 3ALBA 2G3QB 3OJ4B 4URKA 3KH0A 2N7EA 2NCNA 4HDQA 4GDLB 3A9KA 1A5RA 2KQSA 2I1KA 4GDKB 3ZVVA 1WYWB 1SGHA 2J0JA 1U4AA 2ZJDA 2N9PC 3CSFA 1E8YA 4II2B 5TR5A 1WM3A 2LI5A 2KMCA 4MJSB 3WIMA 4IW0A 4TV3A 2AL6A 5HKHA 1V2YA 1D3ZA 5E6PA 4KDLB 3SU8X 3H7PB 4FJYA 1KLVA 2DAJA 3TBLD 4F7ZA 2LGXA 3ZTDA 3T8MA 1TGZB 3VQIA 1V6EA 2JZ3B 1WR1A 1S3SG 2AWTA 1H4RA 1E8ZA 3UGBB 1P98A 3PPAA 5FR6A 2GBRA 1L2NA 3KUZA 2BWFA 4FJVB 4XC2A 2LJ5A 4GXBA 1RLFA 3VDZA 1WJNA 4GDKA 4IUMB 5IAAC 2KDBA 5J17A 3HIZA 2KWUB 2HD5B 3LJ3A 4NPNA 4ANXA 1PQSA 2KZRA 2D07B 4CHKA 3QAQA 4EZKA 4LJOB 2LVOA 3QK0A 2XK5B 3Q3JA 2FCQA 3QX1A 2AL3A 4DDGD 3ZO5B 4G0NB 3C0RB 4NAWB 1XD3B 3DVNU 3V6CB 4CO7A 4B95A 3ML9A 1P3QU 1OTRB 2G4DB 4FHJA 2BF8B 2Z59B 3TCAA 4BFRA 5CHFA 2KJHB 2KKCA 2A5UA 3HM6X 3PTFC 2C5LC 2NR2A 2M8SA 3EFUA 4TQ1A 3T9LA 2VRRB 2WDTB 1E7UA 2BYFA 2KJRA 3A1QA 3PHWB 4ZDVA 2K25A 2NBVB 2CR5A 2LRUA 1WXAA 4B9KA 3ZRFA 2M1MA 1IPGA 2IO3B 3ML8A 2K8CA 5JZEB 1BT0A 3L13A 3PVLA 5DCNA 2XK5A 4MM3A 4HLEA 1WH3A 3ONSA 1WY8A 2N1WA 5CTRC 1WJUA 2CKHB 2KN5A 1WXSA 4ZYNA 2M17A 3SD5A 4GU2A 2K6DB 3DBLI 1ZKHA 3CF6E 3X23A 5LXIB 2DZMA 4HCPB 4AOFA 3QQ8B 1WR6E 3PRZA 2HJ8A 4W9EA 3PZDA 4EZJA 4GSWA 3VHTC 4JGHB 2MSED 4TUUA 4MGKE 3OJ3A 2KDFB 3NZUA 3DVNV 4BKSA 3DOWA 2PE6B 3ZNHB 3QIJA 4DBGA 2JVCA 2JF5A 2KTRA 2CU1A 1GC6A 1R4MI 3KYCD 2K8HA 3HHMA 4JQWC 3PHXB 3VH3B 2BYEA 2ZVNA 1GG3A 3U8ZA 3ZNZB 2HE7A 3PLVA 5D6JB 3R66C 2KFJA 3BINA 3L54A 2JRHA 3ZIMA 2JZZA 3VTVA 2O6VD 3RT3B 3X0WA 1WMHB 1J8CA 3UIOB 1UGMA 3KVFB 1RAXA 2LGDA 3U30A 1WE6A 1H8CA 4IM0A 4W9JA 1GUAB 2BKRB 2RD0A 4KV2A 4DHZE 3NY5A 2IO1B 1ISNA 2O6VB 2EMSA 1V5OA 4ICVA 3RZWC 3DBHI 1LXDA 4EOYA 1P1AA 2N9XA 3ZW3A 1Z5SB 2A4ZA 4HPLB 1KM7A 2XEWA 3Q3FA 1WXVA 4EUTA 4MGIE 4BBNF 4ZRIA 4XZ4A 3CMMB 3PLUA 2M0XA 2PEAA 2OJRA 4BOZB 2KVRA 4WJNA 2UYZB 1WF9A 1WGHA 2RSUA 2KWCA 1GNUA 3VFKA 1QZEA 4F8CB 2CHZA 2DYBA 2NS5A 4W9KA 1WGRA 4E3CA 3N30A 5JHBA 2MP2B 2MBEA 1OEYJ 2FAZA 2N9EB 2ASQA 3K9OB 1SE9A 2Z0DB 3TL5A 1J0GA 1WI0A 2FCMA 2KNBA 4EZLA 2FNJB 4IWPA 2J0KA 1RFAA 2JXXA 3WAOA 3DBSA 2DYOA 5JH5C 4GDLA 2L8JA 5L95C 3WAMA 1NI2A 2IYDB 3EHVA 1E90A 4LDTD 2CS4A 2KWVB 4MGZE 4RMAA 1OQYA 3JSVB 4EKUA 1IP9A 2L0FA 4MJSA 2BPSA 3EC8A 2GBMA 1P9DU 1E5WA 2MBHA 4CYEA 4PS7A 2BKFA 2K8BA 3QA8A 5D94A 4LDTB 3H7PA 1E8WA 3M95A 2LASA 3AU5A 1Q5WB 1WX9A 3PRPB 1G6JA 3UQBA 3N3KB 2K6QA 1KJTA 1R4NI 2Y5BB 2J0MA 2L76A 4JL9A 5DPSA 2WX1A 2NVUI 2NPTB 3OAWA 2RPQA 1K8RB 2IZVB 2BGFA 4A3OA 3DVGY 3NOBA 3ZNGC 1GJZA 1P0RA 4KIKB 2AYOB 4E74A 5AZHA 3MTNB 3PSEB 2KC2A 1YJ1A 3AU4A 1V81A 5AZGA 3R3MA 3JSVA 4MGYE 4W9LA 1UELA 2DZIA 5DPTA 1S1QB 2LRWA 4K1RB 4P7IA 3V62A 4DK5A 4IG7B 2GBJA 4NAWA 2QHOA 3VXWA 5CX3A 2R2QA 1AARA 2O2VB 3DDCB 2KFKB 3V6EB 1X1MA 1Z2MA 3QC8B 2IO2B 1NBFC 3AI5A 2LVPA 1ZGUB 1Y8RC 4MSQB 1WX7A 2IBIB 3KUDB 4GB9A 4W9FA 3I3TB 2L00B 3JVZX 4PYUA 4FHKA 1E8XA 3VAWA 1IYFA 1KOTA 2IY0B 1C3TA 4AWJA 2KTFA 2ZNVB 4IWOA 3ZKJC 4WAAA 4ANVA 4ANWA 1VD2A 2B3AA 4DHZB 3TIXA 2L7RA 3VTWA 2FIDA 2KC1A 3GOEA 2UWQA 2WX0A 4MDKE 4W9GA 4FADA 5CHWA 2KX0A 5IA7A 2D10A 5DPRA 1VCBA 3TJPA 2D3GA 2WYQA 4MSMB 2BWES 2MX2A 1WZ0A 1YX5B 1OGWA 1WRDB 4HPMB 2MQJA 2O2VA 2ZPNA 3NHEB 4GN1A 4ZRKA 5LLIA 3R7RA 2XBBC 2G45B 2C7HA 4E71A 2MBQA 2L0TA 2LXAA 2YLMA 3IBEA 4WWPA 3TMPB 5C1ZA 4KZCA 2N1VA 2ZCCA 2GBKA 2IY1B 4HK2A 2R2OA 4WWNA 1V80A 3WALA 1MG8A 2D2QA 4GOCA 4OVVA 3PS6A 4LJPB 2W9NA 3AULA 4TQ0A 3ZUNA 2C7NB 3H6NA 4HCNB 2K1FA 2KK8A 5EDSA 4G11A 2LXCA 1UD7A 1V5TA 3VUYA 3ZDTA 4DDID 3SDLC 1V86A 4NY0A 3V60A 3L17A 4FA6A 3D32A 2JT4B 5AEKB 3B08A 2DX5B 3PRMB 4FBJB 1I35A 1WZ3A 3EECA 2LD9A 3M63B 2ZEQA 3DVGX 4N9F4 4BOSC 4RM9A 3AXCA 4KVGB 4I6LB 2EKEC 2LZ6A 4GMVA 5GMVA 3RYTA 3ZLZA 1WMHA 2LVQA 5D7GA 5G2NA 3IVFA 1SIFA 3OLMD 4I6NB 1EO6A 3RZFA 4A20A 3GZNI 4NNJB 3K9PB 2MA9B 4DXAB 4BKGA 2V1YA 2MRPA 1TBEA 3H9DA 4WWOA 2ZPYA 2O6VA 2J7QB 2GOWA 2KX3A 3H1UA 4GIVA 1C1YB 3MHSD 4K7WA 3DQVA 5LXHA 1WE7A 3RULA 2KQ7A 2KXJA 2KD0A 3A4SC 4I6PA 3WA0A 1J19A 3A33B 2FCSA 5G55A 3M62B 2DZKA 4F1SA 2LWPA 3L10B 1WGDA 3N32A 5E6OA 1YQBA 2REXA 4IWQA 3UIPB 4NJ7A 4M0WB 3VUWA 2C7MB 2BYVE 4MH0E 2ZZPB 3IG3A 4JLCA 4W9IA 3WAPA 2RR9A 4DWFA 3ZTCA 2DZJA 4G3XB 1EF5A 3UF8A 4K7UA 2MP2A 4OVUA 2KLGA 3A4RA 2C9WB 3O65B 3PT2B 2KDIA 4IM2A 3KUCB 4G50A 4KZ0A 4WJOA 1WFYA 1OEYA 2DYMA 2I1JA 3P2BA 5CHVC 1HE8A 2GBNA 2M4NA 5C23A 4ASWC 1EUVB 2Z0EB 3A1QB 4ANUA 3L16A 2N7DA 2PPHA 1WXMA 3QCAA 5KHOA 2JRIB 2DHZA 2MBBB 2V3SA 1FXTB 4NQLB 1UBIA 4M8MA 2KO3A 3WANA 2JWZA 1Q1OA 3S2AA 1EF1A 1WJ6A 2IO0B 4TKNA 5JHAA 1JRUA 4AJWA 2KJ6A 2MBOA 3SHQA 1RRBA 3RUIB 5KHQA 2KMAA 1YD8U 2KOXA 4K7SA 1V49A 3KYDD 5BO4B 1CMXB 1F9JA 4KDIC 3CSTA 3ZDMC 3RD2A 3VUXA 4ICUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2N4F A;  3PRE A;  2ZCB A;  2L05 A;  1WM2 A;  4EFO A;  2JPH A;  4BKS D;  3KW5 B;  4X57 B;  3DPD A;  3L08 A;  3U7D A;  2FUH B;  3DCG A;  4KSL C;  2MW5 A;  4HJK A;  5E6N A;  3VH4 B;  3W1S A;  3W1S C;  4II3 B;  2NBU A;  1TTN A;  2NPT A;  2RGF A;  3B0A A;  2DEN B;  3B1L X;  3NS8 A;  1LQB A;  2K39 A;  3PGE A;  4JIO U;  2NBW B;  3A9J B;  3LDZ E;  4FUL A;  1LM8 B;  4KIK A;  1WJ4 A;  2KLC A;  2G4S A;  5J18 A;  3L0W B;  2KTR B;  2MCN B;  3QAR A;  2AEH A;  3HK0 A;  4J6I A;  1WX8 A;  4HXD A;  2DAF A;  4MEM A;  4ZRJ A;  4K81 A;  4AP4 C;  4NJ6 A;  4M8N A;  4NQK E;  4B6W A;  3JYU A;  3MJW A;  2D11 A;  2L3Z A;  4PS3 A;  3UIN B;  3BY4 B;  4PYZ A;  3RCZ A;  4IC7 B;  2ZVO A;  2LGY A;  2MLB A;  1XQQ A;  2V4L A;  2KFK A;  2MWS B;  2CHX A;  1XT9 B;  4GGQ A;  4IM3 A;  3VTU A;  4AUQ C;  4BVU C;  1I42 A;  5AZF A;  4A3P A;  3DBR I;  3VVW B;  4AJY B;  1UZX B;  2EMT A;  2YVC A;  3PV1 A;  4RM8 A;  2JUO A;  1WGY A;  2HTH A;  3IHP C;  4LCD E;  1ZW7 A;  4HDO A;  3A9J A;  3ECI A;  2KAN A;  1UBQ A;  2ZNV C;  2GMI C;  3APC A;  5J2R A;  3R7Q A;  3H7S A;  4BBN C;  5DPW A;  4WJQ A;  1YIW A;  1NDD A;  1YX6 B;  3QWZ B;  3QJZ A;  2KDE B;  3V61 A;  2KHW B;  3QHT A;  1V9J A;  3A9K B;  4WQO B;  1E7V A;  1Q0W B;  4KSK C;  1UH6 A;  2FCN A;  4WJP A;  3APF A;  4FN2 A;  3ZNI D;  1LFD A;  2C60 A;  3NZS A;  1WGG A;  2WWZ A;  4DHJ D;  1L7Y A;  3ENE A;  4FLH A;  1GC7 A;  2LUE A;  3HM3 A;  1M94 A;  1T0Y A;  2CHW A;  4W9H A;  3APD A;  4W9C A;  4XX5 A;  3IFW B;  2OOB B;  4EEW A;  3UQA A;  5D2M B;  3W1Y A;  4PS8 A;  4HVB A;  2PE9 A;  2PJH A;  3M3J A;  3JW0 X;  4DHJ B;  1WIA A;  2FIF A;  4FJZ A;  5L83 A;  2JY6 A;  4HWI B;  4MEL A;  4YL8 A;  3ZRC A;  4BKT A;  1TZ1 A;  4W9D A;  3ALB A;  2G3Q B;  3OJ4 B;  4URK A;  3KH0 A;  2N7E A;  2NCN A;  4HDQ A;  4GDL B;  3A9K A;  1A5R A;  2KQS A;  2I1K A;  4GDK B;  3ZVV A;  1WYW B;  1SGH A;  2J0J A;  1U4A A;  2ZJD A;  2N9P C;  3CSF A;  1E8Y A;  4II2 B;  5TR5 A;  1WM3 A;  2LI5 A;  2KMC A;  4MJS B;  3WIM A;  4IW0 A;  4TV3 A;  2AL6 A;  5HKH A;  1V2Y A;  1D3Z A;  5E6P A;  4KDL B;  3SU8 X;  3H7P B;  4FJY A;  1KLV A;  2DAJ A;  3TBL D;  4F7Z A;  2LGX A;  3ZTD A;  3T8M A;  1TGZ B;  3VQI A;  1V6E A;  2JZ3 B;  1WR1 A;  1S3S G;  2AWT A;  1H4R A;  1E8Z A;  3UGB B;  1P98 A;  3PPA A;  5FR6 A;  2GBR A;  1L2N A;  3KUZ A;  2BWF A;  4FJV B;  4XC2 A;  2LJ5 A;  4GXB A;  1RLF A;  3VDZ A;  1WJN A;  4GDK A;  4IUM B;  5IAA C;  2KDB A;  5J17 A;  3HIZ A;  2KWU B;  2HD5 B;  3LJ3 A;  4NPN A;  4ANX A;  1PQS A;  2KZR A;  2D07 B;  4CHK A;  3QAQ A;  4EZK A;  4LJO B;  2LVO A;  3QK0 A;  2XK5 B;  3Q3J A;  2FCQ A;  3QX1 A;  2AL3 A;  4DDG D;  3ZO5 B;  4G0N B;  3C0R B;  4NAW B;  1XD3 B;  3DVN U;  3V6C B;  4CO7 A;  4B95 A;  3ML9 A;  1P3Q U;  1OTR B;  2G4D B;  4FHJ A;  2BF8 B;  2Z59 B;  3TCA A;  4BFR A;  5CHF A;  2KJH B;  2KKC A;  2A5U A;  3HM6 X;  3PTF C;  2C5L C;  2NR2 A;  2M8S A;  3EFU A;  4TQ1 A;  3T9L A;  2VRR B;  2WDT B;  1E7U A;  2BYF A;  2KJR A;  3A1Q A;  3PHW B;  4ZDV A;  2K25 A;  2NBV B;  2CR5 A;  2LRU A;  1WXA A;  4B9K A;  3ZRF A;  2M1M A;  1IPG A;  2IO3 B;  3ML8 A;  2K8C A;  5JZE B;  1BT0 A;  3L13 A;  3PVL A;  5DCN A;  2XK5 A;  4MM3 A;  4HLE A;  1WH3 A;  3ONS A;  1WY8 A;  2N1W A;  5CTR C;  1WJU A;  2CKH B;  2KN5 A;  1WXS A;  4ZYN A;  2M17 A;  3SD5 A;  4GU2 A;  2K6D B;  3DBL I;  1ZKH A;  3CF6 E;  3X23 A;  5LXI B;  2DZM A;  4HCP B;  4AOF A;  3QQ8 B;  1WR6 E;  3PRZ A;  2HJ8 A;  4W9E A;  3PZD A;  4EZJ A;  4GSW A;  3VHT C;  4JGH B;  2MSE D;  4TUU A;  4MGK E;  3OJ3 A;  2KDF B;  3NZU A;  3DVN V;  4BKS A;  3DOW A;  2PE6 B;  3ZNH B;  3QIJ A;  4DBG A;  2JVC A;  2JF5 A;  2KTR A;  2CU1 A;  1GC6 A;  1R4M I;  3KYC D;  2K8H A;  3HHM A;  4JQW C;  3PHX B;  3VH3 B;  2BYE A;  2ZVN A;  1GG3 A;  3U8Z A;  3ZNZ B;  2HE7 A;  3PLV A;  5D6J B;  3R66 C;  2KFJ A;  3BIN A;  3L54 A;  2JRH A;  3ZIM A;  2JZZ A;  3VTV A;  2O6V D;  3RT3 B;  3X0W A;  1WMH B;  1J8C A;  3UIO B;  1UGM A;  3KVF B;  1RAX A;  2LGD A;  3U30 A;  1WE6 A;  1H8C A;  4IM0 A;  4W9J A;  1GUA B;  2BKR B;  2RD0 A;  4KV2 A;  4DHZ E;  3NY5 A;  2IO1 B;  1ISN A;  2O6V B;  2EMS A;  1V5O A;  4ICV A;  3RZW C;  3DBH I;  1LXD A;  4EOY A;  1P1A A;  2N9X A;  3ZW3 A;  1Z5S B;  2A4Z A;  4HPL B;  1KM7 A;  2XEW A;  3Q3F A;  1WXV A;  4EUT A;  4MGI E;  4BBN F;  4ZRI A;  4XZ4 A;  3CMM B;  3PLU A;  2M0X A;  2PEA A;  2OJR A;  4BOZ B;  2KVR A;  4WJN A;  2UYZ B;  1WF9 A;  1WGH A;  2RSU A;  2KWC A;  1GNU A;  3VFK A;  1QZE A;  4F8C B;  2CHZ A;  2DYB A;  2NS5 A;  4W9K A;  1WGR A;  4E3C A;  3N30 A;  5JHB A;  2MP2 B;  2MBE A;  1OEY J;  2FAZ A;  2N9E B;  2ASQ A;  3K9O B;  1SE9 A;  2Z0D B;  3TL5 A;  1J0G A;  1WI0 A;  2FCM A;  2KNB A;  4EZL A;  2FNJ B;  4IWP A;  2J0K A;  1RFA A;  2JXX A;  3WAO A;  3DBS A;  2DYO A;  5JH5 C;  4GDL A;  2L8J A;  5L95 C;  3WAM A;  1NI2 A;  2IYD B;  3EHV A;  1E90 A;  4LDT D;  2CS4 A;  2KWV B;  4MGZ E;  4RMA A;  1OQY A;  3JSV B;  4EKU A;  1IP9 A;  2L0F A;  4MJS A;  2BPS A;  3EC8 A;  2GBM A;  1P9D U;  1E5W A;  2MBH A;  4CYE A;  4PS7 A;  2BKF A;  2K8B A;  3QA8 A;  5D94 A;  4LDT B;  3H7P A;  1E8W A;  3M95 A;  2LAS A;  3AU5 A;  1Q5W B;  1WX9 A;  3PRP B;  1G6J A;  3UQB A;  3N3K B;  2K6Q A;  1KJT A;  1R4N I;  2Y5B B;  2J0M A;  2L76 A;  4JL9 A;  5DPS A;  2WX1 A;  2NVU I;  2NPT B;  3OAW A;  2RPQ A;  1K8R B;  2IZV B;  2BGF A;  4A3O A;  3DVG Y;  3NOB A;  3ZNG C;  1GJZ A;  1P0R A;  4KIK B;  2AYO B;  4E74 A;  5AZH A;  3MTN B;  3PSE B;  2KC2 A;  1YJ1 A;  3AU4 A;  1V81 A;  5AZG A;  3R3M A;  3JSV A;  4MGY E;  4W9L A;  1UEL A;  2DZI A;  5DPT A;  1S1Q B;  2LRW A;  4K1R B;  4P7I A;  3V62 A;  4DK5 A;  4IG7 B;  2GBJ A;  4NAW A;  2QHO A;  3VXW A;  5CX3 A;  2R2Q A;  1AAR A;  2O2V B;  3DDC B;  2KFK B;  3V6E B;  1X1M A;  1Z2M A;  3QC8 B;  2IO2 B;  1NBF C;  3AI5 A;  2LVP A;  1ZGU B;  1Y8R C;  4MSQ B;  1WX7 A;  2IBI B;  3KUD B;  4GB9 A;  4W9F A;  3I3T B;  2L00 B;  3JVZ X;  4PYU A;  4FHK A;  1E8X A;  3VAW A;  1IYF A;  1KOT A;  2IY0 B;  1C3T A;  4AWJ A;  2KTF A;  2ZNV B;  4IWO A;  3ZKJ C;  4WAA A;  4ANV A;  4ANW A;  1VD2 A;  2B3A A;  4DHZ B;  3TIX A;  2L7R A;  3VTW A;  2FID A;  2KC1 A;  3GOE A;  2UWQ A;  2WX0 A;  4MDK E;  4W9G A;  4FAD A;  5CHW A;  2KX0 A;  5IA7 A;  2D10 A;  5DPR A;  1VCB A;  3TJP A;  2D3G A;  2WYQ A;  4MSM B;  2BWE S;  2MX2 A;  1WZ0 A;  1YX5 B;  1OGW A;  1WRD B;  4HPM B;  2MQJ A;  2O2V A;  2ZPN A;  3NHE B;  4GN1 A;  4ZRK A;  5LLI A;  3R7R A;  2XBB C;  2G45 B;  2C7H A;  4E71 A;  2MBQ A;  2L0T A;  2LXA A;  2YLM A;  3IBE A;  4WWP A;  3TMP B;  5C1Z A;  4KZC A;  2N1V A;  2ZCC A;  2GBK A;  2IY1 B;  4HK2 A;  2R2O A;  4WWN A;  1V80 A;  3WAL A;  1MG8 A;  2D2Q A;  4GOC A;  4OVV A;  3PS6 A;  4LJP B;  2W9N A;  3AUL A;  4TQ0 A;  3ZUN A;  2C7N B;  3H6N A;  4HCN B;  2K1F A;  2KK8 A;  5EDS A;  4G11 A;  2LXC A;  1UD7 A;  1V5T A;  3VUY A;  3ZDT A;  4DDI D;  3SDL C;  1V86 A;  4NY0 A;  3V60 A;  3L17 A;  4FA6 A;  3D32 A;  2JT4 B;  5AEK B;  3B08 A;  2DX5 B;  3PRM B;  4FBJ B;  1I35 A;  1WZ3 A;  3EEC A;  2LD9 A;  3M63 B;  2ZEQ A;  3DVG X;  4N9F 4;  4BOS C;  4RM9 A;  3AXC A;  4KVG B;  4I6L B;  2EKE C;  2LZ6 A;  4GMV A;  5GMV A;  3RYT A;  3ZLZ A;  1WMH A;  2LVQ A;  5D7G A;  5G2N A;  3IVF A;  1SIF A;  3OLM D;  4I6N B;  1EO6 A;  3RZF A;  4A20 A;  3GZN I;  4NNJ B;  3K9P B;  2MA9 B;  4DXA B;  4BKG A;  2V1Y A;  2MRP A;  1TBE A;  3H9D A;  4WWO A;  2ZPY A;  2O6V A;  2J7Q B;  2GOW A;  2KX3 A;  3H1U A;  4GIV A;  1C1Y B;  3MHS D;  4K7W A;  3DQV A;  5LXH A;  1WE7 A;  3RUL A;  2KQ7 A;  2KXJ A;  2KD0 A;  3A4S C;  4I6P A;  3WA0 A;  1J19 A;  3A33 B;  2FCS A;  5G55 A;  3M62 B;  2DZK A;  4F1S A;  2LWP A;  3L10 B;  1WGD A;  3N32 A;  5E6O A;  1YQB A;  2REX A;  4IWQ A;  3UIP B;  4NJ7 A;  4M0W B;  3VUW A;  2C7M B;  2BYV E;  4MH0 E;  2ZZP B;  3IG3 A;  4JLC A;  4W9I A;  3WAP A;  2RR9 A;  4DWF A;  3ZTC A;  2DZJ A;  4G3X B;  1EF5 A;  3UF8 A;  4K7U A;  2MP2 A;  4OVU A;  2KLG A;  3A4R A;  2C9W B;  3O65 B;  3PT2 B;  2KDI A;  4IM2 A;  3KUC B;  4G50 A;  4KZ0 A;  4WJO A;  1WFY A;  1OEY A;  2DYM A;  2I1J A;  3P2B A;  5CHV C;  1HE8 A;  2GBN A;  2M4N A;  5C23 A;  4ASW C;  1EUV B;  2Z0E B;  3A1Q B;  4ANU A;  3L16 A;  2N7D A;  2PPH A;  1WXM A;  3QCA A;  5KHO A;  2JRI B;  2DHZ A;  2MBB B;  2V3S A;  1FXT B;  4NQL B;  1UBI A;  4M8M A;  2KO3 A;  3WAN A;  2JWZ A;  1Q1O A;  3S2A A;  1EF1 A;  1WJ6 A;  2IO0 B;  4TKN A;  5JHA A;  1JRU A;  4AJW A;  2KJ6 A;  2MBO A;  3SHQ A;  1RRB A;  3RUI B;  5KHQ A;  2KMA A;  1YD8 U;  2KOX A;  4K7S A;  1V49 A;  3KYD D;  5BO4 B;  1CMX B;  1F9J A;  4KDI C;  3CST A;  3ZDM C;  3RD2 A;  3VUX A;  4ICU A; 
#chains in the Genus database with same CATH topology
 3PRE A;  2L05 A;  1WM2 A;  4BKS D;  4X57 B;  3W1S A;  4II3 B;  2WXK A;  1WYG A;  4LNN A;  1C4A A;  1R4N B;  2MEK A;  3RNA C;  4FUL A;  3A9J B;  3LDZ E;  5GXG B;  4KIK A;  2VH1 A;  2G4S A;  3W5U B;  2MCN B;  2KTR B;  2AEH A;  1STE A;  3HK0 A;  4DXG A;  4ZRQ A;  1QQR A;  1VZ6 A;  4MEM A;  1EWC A;  4RGT A;  3VR9 B;  2LMC A;  4NQK E;  4B6W A;  3JYU A;  1L0V B;  1QIL A;  1AYF A;  4ZHP A;  2ZVO A;  3R2I A;  1DGJ A;  1XQQ A;  4S0R A;  3LYY A;  3VTU A;  5HI1 A;  4A3P A;  1T6B X;  2EMT A;  2YVC A;  1F1H A;  1MHH E;  1WGY A;  2HTH A;  4LCD E;  4HDO A;  3A9J A;  1NEN B;  1JWB D;  1UBQ A;  3U52 E;  4C56 C;  2L1A A;  1PGX A;  3APC A;  5DPW A;  4WJQ A;  1YIW A;  2KDE B;  3V61 A;  1FIQ A;  1E7V A;  1Q0W B;  3RNF C;  1ZDV A;  1FO4 A;  1QOF A;  3NZS A;  3AH7 A;  2WWZ A;  3ENE A;  2LUE A;  1M94 A;  1FNV A;  4EEW A;  2OOB B;  4PS8 A;  4JX1 C;  3URY A;  2FIF A;  2JY6 A;  4HWI B;  1L6V A;  1TZ1 A;  1ACC A;  3AED B;  3ALB A;  2G3Q B;  4URK A;  3KH0 A;  2J4X A;  1JW9 D;  2KQS A;  4GDK B;  1WYW B;  1SGH A;  3U7D A;  3RNC C;  4II2 B;  2D5G A;  1HZ6 A;  3AEA B;  1AW7 A;  2AL6 A;  4TV3 A;  5E6P A;  4OZA A;  4WH4 A;  1KLV A;  1WRI A;  2LGX A;  2IGG A;  1TGZ B;  1V6E A;  1H4R A;  3UGB B;  1JML A;  5FR6 A;  2GBR A;  3HVZ A;  1V1P B;  1WJN A;  4GDK A;  5IAA C;  2KDB A;  2B76 B;  3AE4 B;  3NS1 A;  3HIZ A;  4ANX A;  2N7J A;  3BVM A;  4LJO B;  3Q8E A;  4M0W A;  2FCQ A;  4G0N B;  3C0R B;  4NAW B;  4RF1 A;  3DVN U;  3RFZ B;  2WXP A;  4HKZ E;  1T0R C;  2BF8 B;  2Z59 B;  3HM6 X;  2A5U A;  3PTF C;  2C5L C;  2WDT B;  1E7U A;  3NZ3 A;  3FAH A;  2CR5 A;  2LRU A;  3ML8 A;  1IPG A;  1IBX A;  1CJE A;  2VZK D;  4HLE A;  1SBB B;  1WY8 A;  2EEL A;  5CTR C;  4ZYN A;  3TEZ A;  2M17 A;  1L4Z B;  2RPV A;  2DBY A;  3AEG B;  2K6D B;  1ZKH A;  2NTT A;  5LXI B;  4XE0 A;  4AOF A;  3QQ8 B;  1WR6 E;  2YEP F;  2HJ8 A;  3PZD A;  1WSP A;  3Q8B A;  1FPY A;  3I63 C;  2WQY B;  1T0Q C;  3Q3O C;  2BB5 A;  3NZU A;  4C80 A;  3DVN V;  3ZNH B;  3QIJ A;  3ZJT A;  5EE0 A;  2IDY A;  1KLU D;  3ZJV A;  3KYC D;  2JU6 X;  3ZNZ B;  2WU2 B;  3TEY A;  3L54 A;  3VTV A;  2O6V D;  3RT3 B;  3ETR A;  1WMH B;  1J8C A;  5E6J A;  1RAX A;  2LGD A;  1WE6 A;  1D5X C;  1H8C A;  1C79 A;  1KH0 A;  1V5O A;  3DBH I;  1QF6 A;  1TY0 A;  4BBN F;  4XZ4 A;  3PLU A;  2PEA A;  3GE8 C;  2OJR A;  1EWY C;  1WGH A;  4TMA B;  1GNU A;  1B9R A;  5HHD G;  2DYB A;  4OHJ A;  4OVZ A;  5JHB A;  2MP2 B;  2K9X A;  2FAZ A;  2N9E B;  4OZC A;  3CIR B;  1SE9 A;  1FNU A;  2BS2 B;  2N0S B;  3HRD D;  3VRB B;  4IWP A;  2E6X A;  3NVW A;  1ZUD 2;  1NI2 A;  3AV8 A;  5FK9 C;  2KWV B;  3TUO A;  3JSV B;  4EKU A;  1IP9 A;  2ZW1 A;  2BPS A;  4MJS A;  2GBM A;  3BVZ A;  4M02 A;  1SSN A;  2MBH A;  4KKJ A;  1PGB A;  3H7P A;  3M95 A;  3AU5 A;  2W55 A;  1QLB B;  1JRP A;  2Y5B B;  1E10 A;  3TSS A;  2RPQ A;  1K8R B;  2PVO D;  2BGF A;  1TJE A;  1NYR A;  1GJZ A;  4Q2J A;  2TSS A;  3PSE B;  5G5H A;  3RPF C;  1MJD A;  1V81 A;  3JSV A;  4MGY E;  1UEL A;  4P7I A;  3V62 A;  4DK5 A;  4IG7 B;  5H92 C;  2QCZ A;  3DDC B;  1X1M A;  2IPK D;  4YXD B;  3QC8 B;  2IGD A;  3KUD B;  4GB9 A;  1VR9 A;  2L00 B;  4PYU A;  3P1M A;  1KOT A;  4AWJ A;  2ZNV B;  4ANW A;  4AS1 A;  1JAL A;  2FID A;  3DHI C;  4W9G A;  2WX0 A;  4MDK E;  2QIE B;  2WXQ A;  5DPR A;  2WYQ A;  2JYE A;  2OJW A;  2X8X X;  2KMM A;  1R7S A;  2MQJ A;  2J53 A;  2XNA C;  3EFC A;  2GLS A;  5C1Z A;  4KZC A;  3DBL B;  2BTE A;  3WAL A;  2R2O A;  4WWN A;  3PZ7 A;  2N9K A;  3NUH B;  1Q10 A;  2C7N B;  4RF0 A;  4G11 A;  2I38 A;  3VUY A;  4DDI D;  1V86 A;  4NY0 A;  3V60 A;  3L17 A;  5AEK B;  3B08 A;  1I35 A;  2LD9 A;  3DVG X;  1V97 A;  4BOS C;  4KX6 B;  3GS2 A;  2L52 A;  5GMV A;  3C8Y A;  4GMV A;  3IVF A;  4A20 A;  4WWO A;  3IXS A;  1C1Y B;  2KXJ A;  1J19 A;  2KWD A;  2FCS A;  5G55 A;  3M62 B;  3L10 B;  4B0E A;  2PIA A;  5E6O A;  5C2T B;  4C00 A;  1FEH A;  5LNK 1;  2BYV E;  3V3X A;  4DWF A;  1N61 A;  2RR9 A;  3NRZ A;  2DZJ A;  1EF5 A;  2V0G A;  2D3C A;  1XO3 A;  2WNM A;  4G50 A;  1P7E A;  2DYM A;  1XF5 L;  2I1J A;  3P2B A;  3Q14 C;  4HEA 1;  1KFY B;  1HE8 A;  2Z0E B;  2KYW A;  2JZP A;  2MBB B;  4QAY A;  4M8M A;  3WAN A;  2EKI A;  1UUP A;  4AJW A;  2MBO A;  1TS5 A;  2WXM A;  5C3J B;  4M01 A;  1M4V A;  3KYD D;  1MG4 A;  4ICU A;  2ZCB A;  2FE8 A;  4L2Y A;  3L08 A;  3N1Y C;  3B2F A;  3VH4 B;  3Q6B A;  2NBU A;  1K52 A;  3B0A A;  2DEN B;  2DLB A;  3NS8 A;  2KAJ A;  3B1L X;  1DOX A;  3PGE A;  4YTN B;  4LTU A;  1SEB D;  3U4E G;  2BVC A;  4NJ6 A;  1VZ7 A;  4M8N A;  4AP4 C;  3ZYY X;  2D11 A;  2L3Z A;  3BY4 B;  2KFK A;  2MWS B;  4IM3 A;  4GGQ A;  2UU7 A;  1SXT A;  3DBR I;  3Q8F A;  2GRI A;  1SIJ A;  1UZX B;  1FXI A;  2R61 A;  3PV1 A;  4RM8 A;  2KAN A;  2ZNV C;  3ZJU A;  5J2R A;  3H7S A;  1NDD A;  2IJ0 A;  3EA6 A;  3QJZ A;  3LB8 C;  2QDF A;  4UDU C;  1XLO A;  1UH6 A;  2K5P A;  4FN2 A;  1LFD A;  1WGG A;  1V1O A;  5D3D A;  3APD A;  4W9C A;  1I4R A;  2PJH A;  5IO9 A;  3M3J A;  4HRS A;  3FC4 A;  4FJZ A;  4YL8 A;  3N20 C;  1OQQ A;  1WGK A;  4LNK A;  1P7F A;  2G9H D;  2N7E A;  4HDQ A;  4GDL B;  4OZB A;  1A5R A;  2ZJD A;  2J0J A;  2N9P C;  2Y5P A;  4YTM B;  1F2R C;  5TSS A;  2WXL A;  5FKA C;  4XDD A;  4FJY A;  2DAJ A;  4F7Z A;  3VQI A;  3C19 A;  1CZP A;  4LNI A;  1WR1 A;  2AWT A;  2K3U A;  3KUZ A;  2BT6 A;  4GXB A;  4ZRP A;  3NJT A;  2BQQ A;  1E6E B;  1TZO A;  5I4D A;  2FUG 1;  3LJ3 A;  2HD5 B;  1A70 A;  3QK0 A;  2XK5 B;  3U7Z A;  4DDG D;  2AL3 A;  3ZO5 B;  3V6C B;  2G4D B;  1OTR B;  3TCA A;  3E56 A;  3BK2 A;  4ZYS A;  2NR2 A;  3B2G A;  2M8S A;  3EFU A;  2VRR B;  2KJR A;  4ZDV A;  1ESF A;  2LJI A;  4YWG G;  3Q8C A;  2IO3 B;  1YN4 A;  3CWI A;  1BT0 A;  3SFD B;  3PVL A;  3DWM A;  1WWT A;  5DCN A;  2XK5 A;  1YQ4 B;  1WJU A;  4P1B C;  4LNF A;  3U2S C;  2VZK B;  3X23 A;  2DZM A;  4HCP B;  4EZJ A;  4TUU A;  2WXI A;  2XN9 C;  2INN E;  1V8C A;  4JPS A;  1I4H A;  1TKY A;  3DOW A;  3W2D A;  1FM0 D;  2KTR A;  1PUT A;  2CU1 A;  1XCQ L;  1GC6 A;  3IT6 B;  2KAC A;  3HHM A;  3PHX B;  4RGN A;  2ZVN A;  2HE7 A;  1AN8 A;  2JRH A;  3AE2 B;  3ZIM A;  2JZZ A;  1L6U A;  3I9V 1;  4ZOH C;  4RGO S;  3KVF B;  3U30 A;  4DHZ E;  2IO1 B;  1ISN A;  2O6V B;  3RZW C;  1Z5S B;  4HPL B;  1WXV A;  3V05 A;  3PO0 A;  4PK1 A;  1E7P B;  3CMM B;  4BOZ B;  4N59 A;  4WJN A;  1UF0 A;  1TT5 B;  4A55 A;  3VFK A;  1GB4 A;  2CHZ A;  2NS5 A;  3TEW A;  2KN4 A;  3N30 A;  2WDQ B;  4A90 A;  5H8Y E;  1HXY D;  1FFV A;  3TL5 A;  4B0M A;  1J0G A;  2FCM A;  2KNB A;  1TS4 A;  2J0K A;  1RFA A;  3TEX A;  2DYO A;  1ZPS A;  2L8J A;  2IYD B;  2SEB D;  1E90 A;  2M19 A;  2MJD A;  2CS4 A;  1FCL A;  4RMA A;  1OQY A;  1D5M C;  3Q2A C;  1F77 A;  3DHH C;  2K8B A;  3T3O A;  1JCK B;  1E8W A;  1FRD A;  1WX9 A;  3UQB A;  1R4N I;  2WX1 A;  3OAW A;  2NPT B;  1V1P A;  3NOB A;  5BYR A;  2AYO B;  4E74 A;  1YN5 A;  5AZH A;  2KC2 A;  3R3M A;  4W9L A;  4JWU C;  1EU3 A;  2Y3A A;  4MH8 A;  1S1Q B;  5DPT A;  3BWU D;  4NAW A;  1VZ8 A;  2QHO A;  2L83 A;  4KGS A;  3V6E B;  4HRO A;  3AI5 A;  1ZGU B;  1Y8R C;  1WX7 A;  4C4V B;  4W9F A;  3I3T B;  4NAM A;  4FHK A;  3VAW A;  1IYF A;  2IY0 B;  3SR6 A;  4ANV A;  1VD2 A;  4DHZ B;  3TIX A;  3VTW A;  4US9 A;  3W9C B;  2KX0 A;  5IA7 A;  3RNB C;  3TJP A;  4MSM B;  2BWE S;  1ET6 A;  1ZP0 B;  3R7R A;  2MBQ A;  3IBE A;  4O1N A;  4C4V A;  1RYJ A;  3I57 A;  2H88 B;  5AUI A;  3PS6 A;  2W3R A;  2W9N A;  3H6N A;  3P4Q B;  2K1F A;  1C76 A;  2KK8 A;  4K3C A;  1UD7 A;  3R2T A;  4A9A A;  4FA6 A;  2JT4 B;  1T5X D;  3EEC A;  3M63 B;  4RM9 A;  1R4M B;  3AXC A;  4KVG B;  4I6L B;  2EKE C;  4L1B A;  3RYT A;  1WMH A;  5D7G A;  1JWA D;  1RM6 C;  2V1Y A;  3H9D A;  2ZPY A;  2J7Q B;  1J7C A;  3DQV A;  1UWX A;  1Y56 A;  4H2A A;  2ACZ B;  1SB3 C;  2N9L A;  3N32 A;  1SE2 A;  2REX A;  5BYS A;  2C7M B;  3IG3 A;  4JLC A;  2WGS A;  4G3X B;  4K7U A;  2MP2 A;  3PT2 B;  3O65 B;  4WJO A;  3KUC B;  1DOY A;  2JQR B;  3IAM 1;  1TS2 A;  1YQ3 B;  3A1Q B;  4C7Z A;  3IAS 1;  3L16 A;  5KHO A;  1FXT B;  4RH6 A;  2PVG C;  1Q1O A;  1WXQ A;  1WJ6 A;  2IO0 B;  1BXT A;  3AEB B;  4TKN A;  1JRU A;  2JYT A;  3AEC B;  1RRB A;  3RUI B;  5KHQ A;  1YD8 U;  2KOX A;  2V3N A;  5BO4 B;  3O13 A;  4KDI C;  4XDC A;  3ZDM C;  1GOZ A;  3RD2 A;  1XEE A;  1ZXH A;  2M56 B;  2FUH B;  4KSL C;  1IGC A;  2J52 A;  2K39 A;  1L0X B;  2NBW B;  1LM8 B;  1WJ4 A;  2KLC A;  1UGJ A;  3L0W B;  3QAR A;  4J6I A;  1WX8 A;  3AB5 A;  2DAF A;  4HPP A;  3UIN B;  4PYZ A;  2W54 A;  3RCZ A;  2LGY A;  2V4L A;  1UNS A;  2CHX A;  1XT9 B;  4AUQ C;  1I42 A;  5AZF A;  3VVW B;  1C4C A;  2Y5C A;  2JUO A;  3IHP C;  1N5W A;  2BS3 B;  1I4X A;  1ZW7 A;  3ECI A;  4D2K A;  2GMI C;  2WXF A;  1TIF A;  3R7Q A;  2X38 A;  1YX6 B;  3QWZ B;  5JXV A;  3A9K B;  4WQO B;  1MVK A;  3AE5 B;  2FCN A;  1KRH A;  3APF A;  2BS4 B;  4DHJ D;  1L7Y A;  4FLH A;  3HM3 A;  3IFW B;  5D2M B;  2PE9 A;  1D5Z C;  3JW0 X;  1HTQ A;  5L83 A;  4MEL A;  4LNO A;  3ZRC A;  3BVG A;  3SEB A;  1ET9 A;  2KVZ A;  3A9K A;  3ZVV A;  4A6Q A;  1PFD A;  4ITK A;  1U4A A;  4YSY B;  5FR3 A;  2KMC A;  1OQR A;  2I2Y A;  3WIM A;  4IW0 A;  5HKH A;  1D3Z A;  4KDL B;  3SU8 X;  2W3S A;  5IN7 A;  3T8M A;  2JZ3 B;  2RDH A;  5BYQ A;  3SFE B;  3PPA A;  1L2N A;  2BWF A;  4FJV B;  4XC2 A;  3RN9 C;  1RLF A;  1QOG A;  3AM9 A;  3VDZ A;  3I5J C;  2KWU B;  1PQS A;  2KZR A;  2D07 B;  4CHK A;  4YT0 B;  4C7Y A;  2LVO A;  4MM3 B;  3QX1 A;  2MHJ A;  2LGS A;  4CO7 A;  2INP E;  3E9S A;  1P3Q U;  3ML9 A;  5CHF A;  2MJE A;  3ZGZ A;  2QIL A;  1IUE A;  3J9C A;  4RGM A;  5IOI A;  2AQ3 B;  4TQ1 A;  3T9L A;  1I7H A;  2BW2 A;  3PHW B;  2HJ1 A;  1K50 A;  1MHX A;  4WIP A;  1FXA A;  3Q3M C;  4B9K A;  1SE4 A;  2M1M A;  4ZHO A;  2K8C A;  5JZE B;  3L13 A;  4MM3 A;  1WH3 A;  2N1W A;  5EE3 A;  2WU5 B;  2KN5 A;  1WXS A;  3AE1 B;  3SD5 A;  2GI9 A;  4GU2 A;  2JXT A;  3DBL I;  1J7A A;  3NVZ A;  4W9E A;  2NMQ A;  1GB1 A;  2MH7 A;  3VHT C;  2LEK A;  4JGH B;  2MSE D;  1TKG A;  2KDF B;  4IKG A;  2PW9 A;  1LGR A;  4BKS A;  2PE6 B;  4R3D A;  4DBG A;  2JF5 A;  2W82 A;  2K8H A;  4JQW C;  3VH3 B;  2BYE A;  1GG3 A;  3U8Z A;  3R66 C;  3DHG C;  3BIN A;  1XCT L;  2V3P A;  4OW0 A;  3X0W A;  1I4G A;  1UGM A;  3WCQ A;  1ENF A;  4IOI E;  2DNF A;  4IM0 A;  2RD0 A;  4JWS C;  3NY5 A;  1NEK B;  2EMS A;  1LXD A;  2L32 A;  1P1A A;  2INC C;  3ZW3 A;  4EOY A;  3R8B A;  2A4Z A;  4XYC A;  5HFY A;  4EUT A;  2RSU A;  4YSX B;  4F8C B;  1I4P A;  1C4P A;  3T3N A;  2PKO A;  4W9K A;  1WGR A;  4E3C A;  5EE9 A;  2MBE A;  1C9F A;  2ASQ A;  2Z0D B;  3KLS X;  3Q3N C;  3NG0 A;  3FKY A;  3WAO A;  3DBS A;  2WS3 B;  2PTL A;  4GDL A;  1PGA A;  1YN3 A;  4JE3 B;  4LDT D;  2AQ2 B;  3KQ4 A;  2NTS A;  2ZW0 A;  2L0F A;  5IP4 D;  3EC8 A;  1E5W A;  4PS7 A;  1XXG A;  2BKF A;  2JSV X;  2YEP B;  2QEJ C;  3ABV B;  1G6J A;  3PRP B;  3N3K B;  3Q8A A;  4WQM A;  3P4S B;  4M00 A;  1D6E C;  2BB6 A;  1CK1 A;  2NVU I;  1KLG D;  2IZV B;  3DVG Y;  3ZNG C;  1P0R A;  4KIK B;  4S17 A;  2HDE A;  3MTN B;  2WDR B;  2V4I B;  4K1R B;  1VRA B;  2Q5W D;  4P6V F;  3VXW A;  5CX3 A;  2O2V B;  4TSS A;  1JWS D;  3Q69 A;  2IO2 B;  2LVP A;  4MAC A;  1FFU A;  1KF6 B;  2KTF A;  3LXF A;  2B3A A;  2L7R A;  1AWD A;  2KC1 A;  2CJO A;  4FAD A;  2D10 A;  2D3G A;  2MX2 A;  1WZ0 A;  1YX5 B;  1WRD B;  4HPM B;  2O2V A;  2ZPN A;  1N62 A;  1L4D B;  4GN1 A;  4CQN A;  1LO5 D;  2G45 B;  4E71 A;  4WWP A;  5D3I B;  3TMP B;  4LLG M;  1TY2 A;  2N1V A;  2ZCC A;  2GBK A;  1BML C;  2D2Q A;  3P4P B;  4GOC A;  4OVV A;  4LJP B;  2QJL A;  4TQ0 A;  3OWE B;  4GLS C;  4HCN B;  1V5T A;  4KGR A;  3ZDT A;  4ACF A;  3D32 A;  2RDB C;  2DX5 B;  3PRM B;  4FBJ B;  1BUI C;  4P1C C;  2CU3 A;  3AEE B;  2LZ6 A;  1JWM D;  5G2N A;  4BZA A;  1SIF A;  3OLM D;  4I6N B;  1EO6 A;  3GZN I;  4NNJ B;  4WAF A;  2MA9 B;  4DXA B;  4BKG A;  2MRP A;  1TBE A;  2O6V A;  2KX3 A;  3RNE C;  2ICI A;  3EGR A;  3H1U A;  4GIV A;  4PT5 A;  4K7W A;  2G1E A;  4HJG E;  3RUL A;  2KQ7 A;  2KD0 A;  3A4S C;  4I6P A;  3WA0 A;  1YOV B;  2ONQ A;  3DBH B;  3BII D;  2LWP A;  1YQB A;  3MFG A;  4IWQ A;  3UIP B;  4NJ7 A;  4M0W B;  3VUW A;  4FXC A;  1T0S C;  4USA A;  2ZZP B;  3WAP A;  1YJJ A;  3UF8 A;  2WHI A;  4OVU A;  2C9W B;  4IM2 A;  2WXN A;  1ZDX A;  1WFY A;  3MC0 B;  2WXO A;  5CHV C;  1QKZ A;  2GBN A;  1EUV B;  2N7D A;  2PPH A;  1WXM A;  2DHZ A;  2V3S A;  4NQL B;  2WXG A;  1IBX B;  3S2A A;  1EF1 A;  5JHA A;  1XLN A;  5AUK A;  2KJ6 A;  5MPO A;  2KMA A;  4WWM A;  1V49 A;  1CMX B;  2PLP A;  1F9J A;  3WAM A;  2MJ3 A;  2N4F A;  4EFO A;  1K51 A;  2JPH A;  3KW5 B;  3UI3 A;  3DPD A;  3DCG A;  4WUR A;  3W1S C;  2MW5 A;  4HJK A;  5E6N A;  1TTN A;  2NPT A;  2RGF A;  2V9H A;  1PDX A;  3AE9 B;  1LQB A;  3NVV A;  4JIO U;  2AX5 A;  3MP9 A;  4AQ7 A;  5J18 A;  2Z8L A;  4RCO A;  4HXD A;  4ZRJ A;  4K81 A;  1NVI D;  3MJW A;  4PS3 A;  4IC7 B;  1FRR A;  2MLB A;  4P16 A;  1SF0 A;  4BVU C;  5G5G A;  3N1X C;  4AJY B;  3P42 A;  1DOI A;  4KGT A;  1EU4 A;  2FBW B;  4BAX A;  4BBN C;  5BMH A;  1F0Z A;  1FD6 A;  2KHW B;  3QHT A;  1V9J A;  4KSK C;  4WJP A;  3ZNI D;  1QT9 A;  2C60 A;  1JWU D;  1GC7 A;  1T0Y A;  2CHW A;  4W9H A;  3HVD A;  3MC8 A;  4XX5 A;  3UQA A;  2RMM A;  3GE3 C;  3W1Y A;  4YSZ B;  4HVB A;  1NI3 A;  4DHJ B;  1WIA A;  2VH2 A;  1D4B A;  1VJK A;  3RNG C;  4BKT A;  4W9D A;  1TKE A;  2E3T A;  3OJ4 B;  1RWS A;  1SJH D;  2NCN A;  2I1K A;  2LFI A;  3GB1 A;  3CSF A;  5TR5 A;  1E8Y A;  4US8 A;  1UWM A;  1WM3 A;  2LI5 A;  3MHZ A;  4MJS B;  1V2Y A;  3N9Y C;  1FMA D;  3H7P B;  1QOB A;  3TBL D;  3ZTD A;  3IT4 B;  1MI0 A;  3AE3 B;  1OFF A;  1S3S G;  1E8Z A;  1ROE A;  1P98 A;  1HA5 A;  3AE7 B;  2LJ5 A;  4J3O D;  4IUM B;  5J17 A;  1YNT E;  4NPN A;  1VDV A;  4XWW A;  3QAQ A;  1HZ5 A;  4EZK A;  1E0Z A;  2WP9 B;  3Q3J A;  1XD3 B;  2RDG A;  2KDM A;  4B95 A;  4FHJ A;  1L5P A;  1FNW A;  3RMK C;  4BFR A;  1I4Q A;  2KJH B;  2KKC A;  3AMZ A;  4HKQ A;  1J7B A;  1YJI A;  2BYF A;  3A1Q A;  4IDI A;  3N1Z C;  1VLB A;  2K25 A;  2NBV B;  2CJN A;  1WXA A;  3ZRF A;  1GAQ B;  4RFB A;  3ONS A;  4RNA A;  2CKH B;  3AEF B;  2KT7 A;  3CF6 E;  1HTO A;  1DYQ A;  3PRZ A;  3KWV A;  2WLB A;  2H89 B;  5T8I A;  4GSW A;  2DWQ A;  4MGK E;  3OJ3 A;  3BYY B;  2BYT A;  3PZ8 A;  1ZXI A;  1N5X A;  2GB1 A;  2WXJ A;  1SE3 A;  2JVC A;  1QOA A;  1FCC C;  1R4M I;  4EE2 A;  3PLV A;  5D6J B;  2KFJ A;  3DWG C;  1ZOY B;  1GPX A;  3UIO B;  1HQR D;  1TS3 A;  1N60 A;  4W9J A;  1N63 A;  1GUA B;  2BKR B;  4KV2 A;  3W5V B;  2WXH A;  4ICV A;  2WXR A;  2LHD A;  2M0A A;  3DBR B;  2N9X A;  2PMV A;  1KM7 A;  2XEW A;  3Q3F A;  5BMG A;  1ZE3 D;  4NZL B;  4MGI E;  3B9J A;  4ZRI A;  4REZ A;  2M0X A;  5HG2 A;  2KVR A;  2UYZ B;  1CQV A;  1WF9 A;  2KWC A;  4ARC A;  1QZE A;  2LGI A;  3ZQ4 A;  4K3B A;  2HTM E;  2LHE A;  1OEY J;  3K9O B;  2D3A A;  2J42 A;  1WI0 A;  3EUB 2;  4EZL A;  2FNJ B;  2K22 A;  2JXX A;  2SAK A;  1JRO A;  5JH5 C;  2QMT A;  1MPE A;  5L95 C;  3EHV A;  2WDV B;  4MGZ E;  1B1Z A;  1P9D U;  4CYE A;  1C77 A;  2ON8 A;  1E9M A;  3QA8 A;  5D94 A;  3HUI A;  4XWT A;  1RFK A;  1KTK A;  4LDT B;  2IND C;  5EE1 A;  2LAS A;  1Q5W B;  3FIL B;  2K6Q A;  1KJT A;  2LUM A;  3KWL A;  1T3Q A;  4DQO C;  4LK0 M;  4JL9 A;  2J0M A;  2L76 A;  5DPS A;  3P63 A;  2OED A;  4N6E B;  4A3O A;  1JQ4 A;  1SJE D;  1K53 A;  2IGH A;  1YJ1 A;  3AU4 A;  5AZG A;  3NVY A;  4KKI A;  4ARI A;  2DZI A;  2K0P A;  2LRW A;  4DXF A;  2GBJ A;  3OG5 A;  2AQ1 B;  3BZD B;  2R2Q A;  3FIL A;  1AAR A;  2QSD A;  2KFK B;  1Z2M A;  1NBF C;  4MSQ B;  2QC8 A;  4XGA B;  2IBI B;  3L4P A;  3JVZ X;  1E8X A;  1C3T A;  4IWO A;  3ZKJ C;  4WAA A;  3ZXV A;  3VRA B;  3GOE A;  2UWQ A;  2KQ4 X;  5CHW A;  3BK1 A;  1F2R I;  1MFW A;  1VCB A;  4N58 A;  1OGW A;  3NHE B;  4ZRK A;  5LLI A;  2XBB C;  3AN1 A;  2C7H A;  2L0T A;  2LXA A;  2YLM A;  1HEZ E;  1TYG B;  3H8H A;  3AE8 B;  2IY1 B;  4HK2 A;  1V80 A;  1MG8 A;  3AUL A;  1NYQ A;  3ZUN A;  3ZXR A;  5BMI A;  5EDS A;  5IKC M;  2LXC A;  3SDL C;  1WZ3 A;  2ZEQ A;  4N9F 4;  3MC9 A;  2JWU A;  3ZLZ A;  2LVQ A;  3RZF A;  1C78 A;  1XLQ A;  3K9P B;  1L0Y B;  2GOW A;  3MHS D;  5LXH A;  1WE7 A;  1YMH E;  3A33 B;  2DZK A;  3AE6 B;  3VR8 B;  4F1S A;  4L23 A;  3MJ5 A;  1WGD A;  4A8X C;  2JX5 A;  1PYW D;  4MH0 E;  4W9I A;  4NJC A;  3ZTC A;  3P4R B;  2KLG A;  1IGD A;  1N6Z A;  3A4R A;  2KDI A;  4KZ0 A;  1OEY A;  3GP7 A;  3RI7 C;  3GZN B;  1F52 A;  2M4N A;  5C23 A;  4ASW C;  1XLP A;  4ANU A;  1EM7 A;  4YTP B;  3QCA A;  2JRI B;  1UBI A;  2KO3 A;  2JWZ A;  2D3B A;  3SHQ A;  4K7S A;  2OHF A;  3CST A;  3BYT B;  3VUX A;  4MT5 A;  2BBC A; 
#chains in the Genus database with same CATH homology
 2N4F A;  3PRE A;  2ZCB A;  2L05 A;  1WM2 A;  4EFO A;  2JPH A;  4BKS D;  3KW5 B;  4X57 B;  3DPD A;  3L08 A;  3U7D A;  2FUH B;  3DCG A;  4KSL C;  2MW5 A;  4HJK A;  5E6N A;  3VH4 B;  3W1S A;  3W1S C;  4II3 B;  2NBU A;  1TTN A;  2NPT A;  2RGF A;  3B0A A;  2DEN B;  3B1L X;  3NS8 A;  1LQB A;  2K39 A;  3PGE A;  4JIO U;  2NBW B;  3A9J B;  3LDZ E;  4FUL A;  1LM8 B;  4KIK A;  1WJ4 A;  2KLC A;  2G4S A;  5J18 A;  3L0W B;  2KTR B;  2MCN B;  3QAR A;  2AEH A;  3HK0 A;  4J6I A;  1WX8 A;  4HXD A;  2DAF A;  4MEM A;  4ZRJ A;  4K81 A;  4AP4 C;  4NJ6 A;  4M8N A;  4NQK E;  4B6W A;  3JYU A;  3MJW A;  2D11 A;  2L3Z A;  4PS3 A;  3UIN B;  3BY4 B;  4PYZ A;  3RCZ A;  4IC7 B;  2ZVO A;  2LGY A;  2MLB A;  1XQQ A;  2V4L A;  2KFK A;  2MWS B;  2CHX A;  1XT9 B;  4GGQ A;  4IM3 A;  3VTU A;  4AUQ C;  4BVU C;  1I42 A;  5AZF A;  4A3P A;  3DBR I;  3VVW B;  4AJY B;  1UZX B;  2EMT A;  2YVC A;  3PV1 A;  4RM8 A;  2JUO A;  1WGY A;  2HTH A;  3IHP C;  4LCD E;  1ZW7 A;  4HDO A;  3A9J A;  3ECI A;  2KAN A;  1UBQ A;  2ZNV C;  2GMI C;  3APC A;  5J2R A;  3R7Q A;  3H7S A;  4BBN C;  5DPW A;  4WJQ A;  1YIW A;  1NDD A;  1YX6 B;  3QWZ B;  3QJZ A;  2KDE B;  3V61 A;  2KHW B;  3QHT A;  1V9J A;  3A9K B;  4WQO B;  1E7V A;  1Q0W B;  4KSK C;  1UH6 A;  2FCN A;  4WJP A;  3APF A;  4FN2 A;  3ZNI D;  1LFD A;  2C60 A;  3NZS A;  1WGG A;  2WWZ A;  4DHJ D;  1L7Y A;  3ENE A;  4FLH A;  1GC7 A;  2LUE A;  3HM3 A;  1M94 A;  1T0Y A;  2CHW A;  4W9H A;  3APD A;  4W9C A;  4XX5 A;  3IFW B;  2OOB B;  4EEW A;  3UQA A;  5D2M B;  3W1Y A;  4PS8 A;  4HVB A;  2PE9 A;  2PJH A;  3M3J A;  3JW0 X;  4DHJ B;  1WIA A;  2FIF A;  4FJZ A;  5L83 A;  2JY6 A;  4HWI B;  4MEL A;  4YL8 A;  3ZRC A;  4BKT A;  1TZ1 A;  4W9D A;  3ALB A;  2G3Q B;  3OJ4 B;  4URK A;  3KH0 A;  2N7E A;  2NCN A;  4HDQ A;  4GDL B;  3A9K A;  1A5R A;  2KQS A;  2I1K A;  4GDK B;  3ZVV A;  1WYW B;  1SGH A;  2J0J A;  1U4A A;  2ZJD A;  2N9P C;  3CSF A;  1E8Y A;  4II2 B;  5TR5 A;  1WM3 A;  2LI5 A;  2KMC A;  4MJS B;  3WIM A;  4IW0 A;  4TV3 A;  2AL6 A;  5HKH A;  1V2Y A;  1D3Z A;  5E6P A;  4KDL B;  3SU8 X;  3H7P B;  4FJY A;  1KLV A;  2DAJ A;  3TBL D;  4F7Z A;  2LGX A;  3ZTD A;  3T8M A;  1TGZ B;  3VQI A;  1V6E A;  2JZ3 B;  1WR1 A;  1S3S G;  2AWT A;  1H4R A;  1E8Z A;  3UGB B;  1P98 A;  3PPA A;  5FR6 A;  2GBR A;  1L2N A;  3KUZ A;  2BWF A;  4FJV B;  4XC2 A;  2LJ5 A;  4GXB A;  1RLF A;  3VDZ A;  1WJN A;  4GDK A;  4IUM B;  5IAA C;  2KDB A;  5J17 A;  3HIZ A;  2KWU B;  2HD5 B;  3LJ3 A;  4NPN A;  4ANX A;  1PQS A;  2KZR A;  2D07 B;  4CHK A;  3QAQ A;  4EZK A;  4LJO B;  2LVO A;  3QK0 A;  2XK5 B;  3Q3J A;  2FCQ A;  3QX1 A;  2AL3 A;  4DDG D;  3ZO5 B;  4G0N B;  3C0R B;  4NAW B;  1XD3 B;  3DVN U;  3V6C B;  4CO7 A;  4B95 A;  3ML9 A;  1P3Q U;  1OTR B;  2G4D B;  4FHJ A;  2BF8 B;  2Z59 B;  3TCA A;  4BFR A;  5CHF A;  2KJH B;  2KKC A;  2A5U A;  3HM6 X;  3PTF C;  2C5L C;  2NR2 A;  2M8S A;  3EFU A;  4TQ1 A;  3T9L A;  2VRR B;  2WDT B;  1E7U A;  2BYF A;  2KJR A;  3A1Q A;  3PHW B;  4ZDV A;  2K25 A;  2NBV B;  2CR5 A;  2LRU A;  1WXA A;  4B9K A;  3ZRF A;  2M1M A;  1IPG A;  2IO3 B;  3ML8 A;  2K8C A;  5JZE B;  1BT0 A;  3L13 A;  3PVL A;  5DCN A;  2XK5 A;  4MM3 A;  4HLE A;  1WH3 A;  3ONS A;  1WY8 A;  2N1W A;  5CTR C;  1WJU A;  2CKH B;  2KN5 A;  1WXS A;  4ZYN A;  2M17 A;  3SD5 A;  4GU2 A;  2K6D B;  3DBL I;  1ZKH A;  3CF6 E;  3X23 A;  5LXI B;  2DZM A;  4HCP B;  4AOF A;  3QQ8 B;  1WR6 E;  3PRZ A;  2HJ8 A;  4W9E A;  3PZD A;  4EZJ A;  4GSW A;  3VHT C;  4JGH B;  2MSE D;  4TUU A;  4MGK E;  3OJ3 A;  2KDF B;  3NZU A;  3DVN V;  4BKS A;  3DOW A;  2PE6 B;  3ZNH B;  3QIJ A;  4DBG A;  2JVC A;  2JF5 A;  2KTR A;  2CU1 A;  1GC6 A;  1R4M I;  3KYC D;  2K8H A;  3HHM A;  4JQW C;  3PHX B;  3VH3 B;  2BYE A;  2ZVN A;  1GG3 A;  3U8Z A;  3ZNZ B;  2HE7 A;  3PLV A;  5D6J B;  3R66 C;  2KFJ A;  3BIN A;  3L54 A;  2JRH A;  3ZIM A;  2JZZ A;  3VTV A;  2O6V D;  3RT3 B;  3X0W A;  1WMH B;  1J8C A;  3UIO B;  1UGM A;  3KVF B;  1RAX A;  2LGD A;  3U30 A;  1WE6 A;  1H8C A;  4IM0 A;  4W9J A;  1GUA B;  2BKR B;  2RD0 A;  4KV2 A;  4DHZ E;  3NY5 A;  2IO1 B;  1ISN A;  2O6V B;  2EMS A;  1V5O A;  4ICV A;  3RZW C;  3DBH I;  1LXD A;  4EOY A;  1P1A A;  2N9X A;  3ZW3 A;  1Z5S B;  2A4Z A;  4HPL B;  1KM7 A;  2XEW A;  3Q3F A;  1WXV A;  4EUT A;  4MGI E;  4BBN F;  4ZRI A;  4XZ4 A;  3CMM B;  3PLU A;  2M0X A;  2PEA A;  2OJR A;  4BOZ B;  2KVR A;  4WJN A;  2UYZ B;  1WF9 A;  1WGH A;  2RSU A;  2KWC A;  1GNU A;  3VFK A;  1QZE A;  4F8C B;  2CHZ A;  2DYB A;  2NS5 A;  4W9K A;  1WGR A;  4E3C A;  3N30 A;  5JHB A;  2MP2 B;  2MBE A;  1OEY J;  2FAZ A;  2N9E B;  2ASQ A;  3K9O B;  1SE9 A;  2Z0D B;  3TL5 A;  1J0G A;  1WI0 A;  2FCM A;  2KNB A;  4EZL A;  2FNJ B;  4IWP A;  2J0K A;  1RFA A;  2JXX A;  3WAO A;  3DBS A;  2DYO A;  5JH5 C;  4GDL A;  2L8J A;  5L95 C;  3WAM A;  1NI2 A;  2IYD B;  3EHV A;  1E90 A;  4LDT D;  2CS4 A;  2KWV B;  4MGZ E;  4RMA A;  1OQY A;  3JSV B;  4EKU A;  1IP9 A;  2L0F A;  4MJS A;  2BPS A;  3EC8 A;  2GBM A;  1P9D U;  1E5W A;  2MBH A;  4CYE A;  4PS7 A;  2BKF A;  2K8B A;  3QA8 A;  5D94 A;  4LDT B;  3H7P A;  1E8W A;  3M95 A;  2LAS A;  3AU5 A;  1Q5W B;  1WX9 A;  3PRP B;  1G6J A;  3UQB A;  3N3K B;  2K6Q A;  1KJT A;  1R4N I;  2Y5B B;  2J0M A;  2L76 A;  4JL9 A;  5DPS A;  2WX1 A;  2NVU I;  2NPT B;  3OAW A;  2RPQ A;  1K8R B;  2IZV B;  2BGF A;  4A3O A;  3DVG Y;  3NOB A;  3ZNG C;  1GJZ A;  1P0R A;  4KIK B;  2AYO B;  4E74 A;  5AZH A;  3MTN B;  3PSE B;  2KC2 A;  1YJ1 A;  3AU4 A;  1V81 A;  5AZG A;  3R3M A;  3JSV A;  4MGY E;  4W9L A;  1UEL A;  2DZI A;  5DPT A;  1S1Q B;  2LRW A;  4K1R B;  4P7I A;  3V62 A;  4DK5 A;  4IG7 B;  2GBJ A;  4NAW A;  2QHO A;  3VXW A;  5CX3 A;  2R2Q A;  1AAR A;  2O2V B;  3DDC B;  2KFK B;  3V6E B;  1X1M A;  1Z2M A;  3QC8 B;  2IO2 B;  1NBF C;  3AI5 A;  2LVP A;  1ZGU B;  1Y8R C;  4MSQ B;  1WX7 A;  2IBI B;  3KUD B;  4GB9 A;  4W9F A;  3I3T B;  2L00 B;  3JVZ X;  4PYU A;  4FHK A;  1E8X A;  3VAW A;  1IYF A;  1KOT A;  2IY0 B;  1C3T A;  4AWJ A;  2KTF A;  2ZNV B;  4IWO A;  3ZKJ C;  4WAA A;  4ANV A;  4ANW A;  1VD2 A;  2B3A A;  4DHZ B;  3TIX A;  2L7R A;  3VTW A;  2FID A;  2KC1 A;  3GOE A;  2UWQ A;  2WX0 A;  4MDK E;  4W9G A;  4FAD A;  5CHW A;  2KX0 A;  5IA7 A;  2D10 A;  5DPR A;  1VCB A;  3TJP A;  2D3G A;  2WYQ A;  4MSM B;  2BWE S;  2MX2 A;  1WZ0 A;  1YX5 B;  1OGW A;  1WRD B;  4HPM B;  2MQJ A;  2O2V A;  2ZPN A;  3NHE B;  4GN1 A;  4ZRK A;  5LLI A;  3R7R A;  2XBB C;  2G45 B;  2C7H A;  4E71 A;  2MBQ A;  2L0T A;  2LXA A;  2YLM A;  3IBE A;  4WWP A;  3TMP B;  5C1Z A;  4KZC A;  2N1V A;  2ZCC A;  2GBK A;  2IY1 B;  4HK2 A;  2R2O A;  4WWN A;  1V80 A;  3WAL A;  1MG8 A;  2D2Q A;  4GOC A;  4OVV A;  3PS6 A;  4LJP B;  2W9N A;  3AUL A;  4TQ0 A;  3ZUN A;  2C7N B;  3H6N A;  4HCN B;  2K1F A;  2KK8 A;  5EDS A;  4G11 A;  2LXC A;  1UD7 A;  1V5T A;  3VUY A;  3ZDT A;  4DDI D;  3SDL C;  1V86 A;  4NY0 A;  3V60 A;  3L17 A;  4FA6 A;  3D32 A;  2JT4 B;  5AEK B;  3B08 A;  2DX5 B;  3PRM B;  4FBJ B;  1I35 A;  1WZ3 A;  3EEC A;  2LD9 A;  3M63 B;  2ZEQ A;  3DVG X;  4N9F 4;  4BOS C;  4RM9 A;  3AXC A;  4KVG B;  4I6L B;  2EKE C;  2LZ6 A;  4GMV A;  5GMV A;  3RYT A;  3ZLZ A;  1WMH A;  2LVQ A;  5D7G A;  5G2N A;  3IVF A;  1SIF A;  3OLM D;  4I6N B;  1EO6 A;  3RZF A;  4A20 A;  3GZN I;  4NNJ B;  3K9P B;  2MA9 B;  4DXA B;  4BKG A;  2V1Y A;  2MRP A;  1TBE A;  3H9D A;  4WWO A;  2ZPY A;  2O6V A;  2J7Q B;  2GOW A;  2KX3 A;  3H1U A;  4GIV A;  1C1Y B;  3MHS D;  4K7W A;  3DQV A;  5LXH A;  1WE7 A;  3RUL A;  2KQ7 A;  2KXJ A;  2KD0 A;  3A4S C;  4I6P A;  3WA0 A;  1J19 A;  3A33 B;  2FCS A;  5G55 A;  3M62 B;  2DZK A;  4F1S A;  2LWP A;  3L10 B;  1WGD A;  3N32 A;  5E6O A;  1YQB A;  2REX A;  4IWQ A;  3UIP B;  4NJ7 A;  4M0W B;  3VUW A;  2C7M B;  2BYV E;  4MH0 E;  2ZZP B;  3IG3 A;  4JLC A;  4W9I A;  3WAP A;  2RR9 A;  4DWF A;  3ZTC A;  2DZJ A;  4G3X B;  1EF5 A;  3UF8 A;  4K7U A;  2MP2 A;  4OVU A;  2KLG A;  3A4R A;  2C9W B;  3O65 B;  3PT2 B;  2KDI A;  4IM2 A;  3KUC B;  4G50 A;  4KZ0 A;  4WJO A;  1WFY A;  1OEY A;  2DYM A;  2I1J A;  3P2B A;  5CHV C;  1HE8 A;  2GBN A;  2M4N A;  5C23 A;  4ASW C;  1EUV B;  2Z0E B;  3A1Q B;  4ANU A;  3L16 A;  2N7D A;  2PPH A;  1WXM A;  3QCA A;  5KHO A;  2JRI B;  2DHZ A;  2MBB B;  2V3S A;  1FXT B;  4NQL B;  1UBI A;  4M8M A;  2KO3 A;  3WAN A;  2JWZ A;  1Q1O A;  3S2A A;  1EF1 A;  1WJ6 A;  2IO0 B;  4TKN A;  5JHA A;  1JRU A;  4AJW A;  2KJ6 A;  2MBO A;  3SHQ A;  1RRB A;  3RUI B;  5KHQ A;  2KMA A;  1YD8 U;  2KOX A;  4K7S A;  1V49 A;  3KYD D;  5BO4 B;  1CMX B;  1F9J A;  4KDI C;  3CST A;  3ZDM C;  3RD2 A;  3VUX A;  4ICU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...