2NBUA

Solution structure of the rad23 ubiquitin-like (ubl) domain
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
78
structure length
78
Chain Sequence
MVSLTFKNFKKEKVPLDLEPSNTILETKTKLAQSISCEESQIKLIYSGKVLQDSKTVSECGLKDGDQVVFMVSQKKST
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structures of Rpn1 T1:Rad23 and hRpn13:hPLIC2 Reveal Distinct Binding Mechanisms between Substrate Receptors and Shuttle Factors of the Proteasome.
pubmed doi rcsb
source organism Saccharomyces cerevisiae s288c
molecule tags Dna binding protein
molecule keywords UV excision repair protein RAD23
total genus 12
structure length 78
sequence length 78
ec nomenclature
pdb deposition date 2016-03-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00240 ubiquitin Ubiquitin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 2nbuA00
1V2YA 2KWUB 2KFJA 2NBVB 2IYDB 2KXJA 3ZIMA 3QARA 3UIPB 1Q0WB 2JY6A 1P1AA 2OOBB 1ZW7A 4DDGD 1E5WA 1WYWB 3UGBB 5L95C 3ML9A 3TJPA 3ZNHB 2JF5A 1YD8U 3JSVB 4GB9A 1V86A 1RRBA 2NBUA 4HCPB 4LJPB 4MJSA 4AJWA 2PE9A 2FIFA 1Q5WB 1RAXA 5JHBA 1EUVB 1GNUA 4HLEA 3U8ZA 2O6VB 4IG7B 4WJPA 2KLCA 5JZEB 1YX6B 2L05A 2G4DB 3CSFA 2KN5A 3EFUA 2JPHA 4LDTD 5DPRA 2J0KA 2CR5A 4G11A 2A5UA 4F7ZA 1WM2A 2N9XA 2L3ZA 3APCA 4FN2A 2BPSA 1TGZB 2O2VA 3QA8A 2BKFA 1P3QU 4IWQA 1K8RB 4MGIE 2Y5BB 1IYFA 2R2QA 1L2NA 4JLCA 3RCZA 4ANVA 2KVRA 4WJOA 4A20A 2G45B 4OVVA 1WR1A 2CHXA 2MP2B 5KHQA 2PE6B 3QC8B 4W9IA 2FIDA 1EF5A 2MWSB 4BKSD 1E7VA 5CTRC 3A4RA 3OJ4B 3L08A 3NZUA 1WM3A 4W9JA 3ZRCA 5JHAA 2HJ8A 2ZNVC 2L7RA 5AZFA 2RR9A 4DXAB 2L8JA 2KX3A 2WDTB 3IFWB 3N3KB 3VTWA 1E8ZA 2K39A 4AOFA 1WZ0A 4I6PA 3PVLA 3EC8A 3PRZA 4EUTA 3WAOA 3OAWA 2KO3A 4X57B 4TQ1A 2EKEC 5AEKB 3DVGY 4MGYE 1M94A 4CO7A 2LZ6A 1GJZA 3DBHI 1WX7A 1UBQA 3H1UA 3ALBA 2DENB 3DBSA 1Q1OA 3M3JA 1UELA 2MLBA 5GMVA 1OTRB 1J19A 1WH3A 3APDA 2CU1A 4IWPA 1V5OA 2NPTB 4KIKB 4ICVA 4HK2A 2MX2A 1EO6A 2MP2A 4HDOA 3PV1A 5DPWA 3BY4B 1A5RA 2JVCA 4FJYA 2D10A 4GIVA 2ZPNA 3ZO5B 2D2QA 2KOXA 4N9F4 4EEWA 1VD2A 3IBEA 2WX1A 2C60A 2GBMA 4W9EA 3TBLD 3VFKA 1I35A 2KJRA 4W9DA 1LQBA 3QK0A 3ZNZB 3B0AA 4CYEA 2HD5B 3SU8X 2NCNA 4NPNA 2YLMA 4IUMB 3KYCD 1OEYJ 2O2VB 2Z59B 5LLIA 3SD5A 2QHOA 3SHQA 4GU2A 2ZZPB 5C23A 3MTNB 4BBNC 2CKHB 1RFAA 4MJSB 4W9FA 3DPDA 2K6QA 3ZNID 1QZEA 2V3SA 4DHZE 4HVBA 2IBIB 3VUXA 2O6VA 2K8HA 4IWOA 2LI5A 3M95A 2LXAA 1XT9B 3LDZE 4GSWA 5L83A 1Y8RC 3JSVA 5CHVC 3RD2A 1WJ4A 1WXVA 2FUHB 5AZGA 1TBEA 2NS5A 1WE7A 1IPGA 3PLUA 3JYUA 4W9HA 2KJHB 3ZTDA 4RM8A 1SIFA 2DAJA 4HXDA 5CHWA 3C0RB 3RT3B 5EDSA 5HKHA 2WX0A 3RZWC 3PLVA 4K1RB 1WE6A 4JQWC 4RMAA 3RZFA 3T9LA 3WIMA 4MSQB 4FULA 4KZCA 4FLHA 4MDKE 3U7DA 1UZXB 4WJQA 2ZJDA 4PS7A 4DHZB 3DQVA 2M1MA 2DZIA 2JXXA 3QX1A 4I6LB 3U30A 2DYOA 2DZJA 5D7GA 2C9WB 2PPHA 1J8CA 3DBLI 4BKTA 1I42A 2ZEQA 3R7QA 2JT4B 3NOBA 1E8XA 3PPAA 1F9JA 5CHFA 2AWTA 3T8MA 2KQ7A 4KZ0A 4MGZE 3AULA 2GMIC 5TR5A 1UGMA 4GDKB 2JRIB 3PGEA 1WXAA 1R4NI 2MW5A 3Q3JA 4IM0A 4II3B 2D07B 1UH6A 4PYUA 2K8CA 4K7SA 2IO3B 2UYZB 2ZCCA 2ZPYA 1WJUA 4ZDVA 1UD7A 2NPTA 2KDBA 3A33B 4KIKA 5J17A 3ZRFA 1E8WA 2OJRA 3V6CB 3R3MA 5G55A 3ZUNA 2PEAA 1XD3B 2LGDA 2MBBB 3QWZB 2C7NB 2JZZA 2EMSA 2KTRB 2LUEA 2V4LA 1BT0A 4NJ6A 2D3GA 2REXA 2A4ZA 3UINB 2MBQA 1L7YA 2XK5B 2N1VA 4MM3A 2M17A 3VQIA 2KMAA 2L0TA 4HPLB 3ZTCA 3H7SA 3VAWA 2CHWA 3N32A 1C1YB 1WMHA 3W1YA 4BBNF 3HK0A 1C3TA 3L13A 3PHXB 3V62A 3CF6E 3HHMA 1WGRA 5DCNA 2IZVB 3GOEA 4E3CA 2KLGA 2IY1B 2MBOA 5IAAC 3V6EB 2VRRB 2KK8A 4MGKE 1SGHA 4ANUA 4BFRA 2RPQA 4GMVA 1U4AA 4AWJA 1NBFC 2EMTA 3IHPC 3KH0A 2Z0DB 3CMMB 2MCNB 4DHJD 4TKNA 2MBHA 4LCDE 4BKSA 1WRDB 3A9JB 4EKUA 4F8CB 4CHKA 4P7IA 1P0RA 2XBBC 2W9NA 3PZDA 2MRPA 1EF1A 4F1SA 4KDIC 1YQBA 3APFA 4DK5A 2AYOB 2AL6A 4FHKA 2BWES 1FXTB 4OVUA 2BYFA 3A4SC 3MHSD 3O65B 1LM8B 2B3AA 2FCNA 2K1FA 3DVNV 3JW0X 4NAWB 4W9LA 1KOTA 2DYBA 3UF8A 1WMHB 2XEWA 1WZ3A 3AU5A 4NQKE 2M0XA 5C1ZA 2J0MA 3NZSA 3P2BA 3TCAA 3V60A 4DDID 3AXCA 3ZDMC 3L54A 4ZRIA 2HE7A 2GBNA 3PT2B 2K25A 3H7PA 2LVOA 4EZLA 2KC1A 3H7PB 2KFKB 3VTVA 4NJ7A 1H8CA 1V49A 2M4NA 1TTNA 4AUQC 4BVUC 4RM9A 4ASWC 4NAWA 2DYMA 4GN1A 4II2B 3IG3A 2ZVOA 3L0WB 3EHVA 3ZDTA 3ML8A 3A1QA 5DPSA 3L17A 5CX3A 1WJ6A 2C5LC 4PS3A 2IO1B 4FJVB 3W1SC 2ZCBA 4AP4C 1WFYA 4E74A 2CHZA 2KWVB 3QIJA 4XC2A 4B95A 2KX0A 4ZYNA 2KQSA 5LXHA 4GGQA 1MG8A 3PRPB 3VUYA 3KUCB 2IO0B 3PSEB 2NBWB 1OQYA 4G50A 5J18A 2ZVNA 3HM3A 4JIOU 4ICUA 3VUWA 3A9KA 1TZ1A 2KD0A 1WJNA 3AU4A 4MSMB 3PRMB 3VDZA 3QHTA 2LXCA 3M62B 1AARA 2KKCA 1WX8A 2N4FA 4LDTB 2JRHA 4A3PA 4FJZA 3DVGX 2L00B 3S2AA 1WI0A 2KC2A 4B9KA 2MQJA 4EOYA 3DCGA 4PYZA 2ASQA 2BKRB 4M8MA 1GC7A 3A1QB 2N1WA 3B08A 2KMCA 2KTFA 4YL8A 4MH0E 2CS4A 3D32A 1R4MI 5D2MB 5E6NA 3WA0A 4JGHB 4ANXA 2KFKA 3A9JA 3HIZA 3V61A 4I6NB 1XQQA 2RSUA 2WYQA 4HWIB 4EZJA 2LRUA 4DWFA 3SDLC 1HE8A 4FHJA 4XZ4A 5JH5C 3NS8A 1V81A 1V9JA 2KDFB 4EZKA 2G4SA 1J0GA 4PS8A 2DZMA 4IC7B 2DAFA 1LXDA 1YX5B 1ZGUB 3Q3FA 2I1KA 3PREA 4HCNB 1JRUA 2Z0EB 2DHZA 1V80A 2GOWA 3ZNGC 4GDLA 1G6JA 5AZHA 3VVWB 5D94A 1NDDA 4BKGA 1WF9A 2MSED 4MELA 4NY0A 1E8YA 2DX5B 3PHWB 4WAAA 1PQSA 4ZRKA 4W9KA 2BYVE 2FCSA 3OLMD 1WGHA 3L16A 2KNBA 5D6JB 3X0WA 1KLVA 2N9PC 2IO2B 5LXIB 4NQLB 3QAQA 3RYTA 2KWCA 4GDLB 3LJ3A 4WQOB 1LFDA 4KV2A 1VCBA 4ANWA 2GBRA 2KDIA 4JL9A 1H4RA 2O6VD 5E6PA 1OGWA 4KVGB 2N7DA 2HTHA 2KTRA 1X1MA 3NHEB 1V6EA 4WWPA 4E71A 1RLFA 2D11A 2GBJA 2LVQA 3TL5A 3MJWA 2PJHA 2AEHA 2UWQA 3H9DA 1E7UA 3R7RA 4HPMB 3WAPA 4BOSC 2YVCA 4IM2A 3UQBA 1GG3A 3VH4B 3IVFA 4GDKA 3ECIA 1KJTA 2KDEB 1KM7A 5G2NA 2GBKA 3WAMA 3KYDD 1S1QB 2LJ5A 5KHOA 3HM6X 4KDLB 2BGFA 4GOCA 5DPTA 4FA6A 1GUAB 1IP9A 3RULA 3KVFB 3QQ8B 2JWZA 4J6IA 4EFOA 1UBIA 2KJ6A 2IY0B 2JUOA 2ZNVB 1P98A 2J7QB 3N30A 4HJKA 3A9KB 1WGYA 4DHJB 3GZNI 3VTUA 1WX9A 2BWFA 1Z2MA 4MEMA 3AI5A 2WWZA 1YIWA 4DBGA 3H6NA 4K7UA 1P9DU 1ZKHA 4G0NB 5FR6A 3M63B 3PS6A 3BINA 3EECA 4AJYB 2LD9A 3DBRI 4URKA 2MBEA 3NY5A 4KSLC 4LJOB 2LWPA 3CSTA 4M8NA 1CMXB 2C7MB 4WWOA 2LVPA 2LGXA 3OJ3A 1WXSA 2XK5A 5J2RA 3DVNU 1OEYA 2FAZA 1S3SG 2C7HA 2KHWB 2N9EB 2V1YA 3L10B 4GXBA 4IM3A 2NR2A 3ONSA 1GC6A 2K6DB 3ZLZA 4XX5A 2RGFA 2M8SA 1WR6E 3VXWA 4B6WA 4ZRJA 2LGYA 2FCMA 4TUUA 1WY8A 4K81A 4BOZB 3UQAA 4FADA 4KSKC 2KANA 1V5TA 1Z5SB 2K8BA 3R66C 2N7EA 1SE9A 3W1SA 4A3OA 2J0JA 3PTFC 2LASA 3TIXA 1NI2A 1WIAA 4M0WB 2LRWA 3QCAA 3QJZA 3ZKJC 3K9OB 2JZ3B 3ZW3A 3ENEA 1WGDA 1D3ZA 2L0FA 4FBJB 1WXMA 1T0YA 2BYEA 4IW0A 3K9PB 4WWNA 4HDQA 3UIOB 2FCQA 3DOWA 4TV3A 5IA7A 2RD0A 1YJ1A 4TQ0A 5E6OA 3KW5B 3JVZX 4WJNA 3TMPB 2MA9B 4NNJB 2I1JA 3VHTC 4W9CA 3VH3B 3RUIB 2BF8B 2AL3A 3KUZA 3X23A 4W9GA 2R2OA 5BO4B 3WALA 1WGGA 4K7WA 2NVUI 2L76A 2G3QB 3B1LX 1E90A 3KUDB 2FNJB 4G3XB 3WANA 3I3TB 2KZRA 3DDCB 2DZKA 3ZVVA 1ISNA
chains in the Genus database with same CATH superfamily
2BS4B 1V2YA 2NBVB 2KXJA 1Q0WB 1KF6B 1N62A 1P1AA 3KWVA 1V1PB 1ZW7A 1SJHD 4DDGD 2MJDA 3UGBB 3ML9A 3TJPA 4LLGM 3JSVB 4HCPB 1AN8A 4MJSA 4AJWA 5JHBA 1JROA 3DHGC 3U8ZA 2O6VB 2L05A 4HROA 2WNMA 4LNIA 1L6VA 2KN5A 3EFUA 2JPHA 4LDTD 5DPRA 1XXGA 4G11A 2A5UA 1UUPA 2BPSA 1TGZB 2O2VA 1K8RB 4MGIE 3DHIC 1L2NA 3RCZA 2KVRA 2G45B 2MP2B 1TKGA 2JQRB 2MWSB 4BKSD 5CTRC 3OJ4B 5EE1A 3P4SB 1VR9A 3NZUA 5JHAA 2HJ8A 2RR9A 3BWUD 2L8JA 1DYQA 1E8ZA 1WZ0A 1E6EB 5FK9C 4K3BA 4TQ1A 2EKEC 2LZ6A 3KLSX 3H1UA 3V3XA 1Q1OA 1OTRB 1VRAB 1WH3A 2CU1A 4YTNB 2NPTB 4HK2A 3U7ZA 1YN5A 4P1BC 2JVCA 1ET9A 2D2QA 2C60A 2GBMA 4W9EA 3VFKA 1I35A 4W9DA 4CYEA 3SU8X 2VZKD 3IXSA 3KYCD 2O2VB 2Z59B 4GU2A 1C4AA 3J9CA 4W9FA 3DPDA 1L0VB 2INPE 2YEPB 1XT9B 3RD2A 2CJNA 4HKZE 3W5UB 3JYUA 2KJHB 2QEJC 3T3NA 1CJEA 2DAJA 5EDSA 4K1RB 4JQWC 4MSQB 4MDKE 1OQRA 2WU5B 2M1MA 2C9WB 1KLUD 3AE1B 5AUIA 3SFEB 1J8CA 2G1EA 4KGSA 4BKTA 3NOBA 4P16A 3T8MA 2GMIC 4A9AA 3ZJTA 2JRIB 1WXAA 2D07B 2K8CA 2UYZB 2ZPYA 4KIKA 4JX1C 3V6CB 3R3MA 3QWZB 2KTRB 3RI7C 2LMCA 2NTTA 4LNFA 1ROEA 2A4ZA 5TSSA 3UINB 2MBQA 1GB4A 2M17A 1C76A 2BVCA 1SE2A 3Q69A 3H7SA 1SE3A 3BVGA 2HJ1A 3HK0A 3PHXB 5HFYA 2J52A 1DOXA 2K22A 4E3CA 3V6EB 3I63C 4MGKE 4ANUA 4BFRA 3DWMA 1NI3A 4BKSA 5BMHA 3RNAC 2GLSA 2GRIA 4P7IA 2RPVA 4F1SA 2AL6A 2BWES 3A4SC 1BMLC 2L32A 3DVNV 3BK2A 3NZSA 2WLBA 2HE7A 3PT2B 1MHXA 4TMAB 1TTNA 1E0ZA 2N9KA 4II2B 3IG3A 2WP9B 2PIAA 3ML8A 5DPSA 3L17A 2IO1B 3W1SC 4ZHPA 1YOVB 2CHZA 4ZYNA 1IBXA 3HRDD 4GGQA 3PRPB 1IGCA 2IO0B 2KVZA 1WGKA 3RN9C 4G50A 1K53A 2BW2A 5J18A 3HM3A 5MPOA 1QILA 4JIOU 1KTKA 3AEEB 3AU4A 1SE4A 3M62B 2KKCA 2N4FA 1IGDA 2JRHA 3DVGX 1CQVA 2L00B 2B76B 3Q8FA 4B9KA 2BKRB 4M8MA 4LK0M 1T0RC 2WXPA 2CS4A 1R4MI 1V1PA 3WA0A 2KFKA 4J3OD 3AEDB 3A9JA 3HIZA 1MFWA 1XF5L 1XQQA 2RSUA 3B9JA 4EZJA 4JWUC 3CIRB 1HE8A 4FHJA 2W54A 4XZ4A 1SEBD 4EZKA 1J0GA 1E9MA 4RNAA 1JMLA 1XLOA 3ZNGC 2JWUA 1TS3A 4BKGA 1PDXA 2J4XA 4WH4A 1LO5D 4MELA 1E8YA 3PHWB 2WXRA 1PQSA 2FCSA 4Q2JA 1QQRA 3QAQA 4WQOB 1LFDA 1JRPA 4ANWA 1RYJA 1JCKB 4KVGB 2HTHA 2LJIA 4WWPA 1RLFA 2GBJA 1D5MC 4YTMB 2AEHA 2UWQA 2INNE 1E7UA 3WAPA 2BS2B 2YVCA 4IM2A 3UQBA 3VH4B 3IVFA 3ECIA 4XDDA 5H92C 4ARCA 5G2NA 2GBKA 1N60A 1ACCA 1S1QB 4KDLB 2BGFA 4GOCA 2V0GA 4A8XC 1GUAB 1IP9A 3RULA 3KVFB 3E56A 3MJ5A 1MJDA 2IJ0A 2ZNVB 1P98A 3N30A 3A9KB 1E7PB 1FIQA 3VTUA 4L23A 4K7UA 1P9DU 4P6VF 3PS6A 3BINA 3PZ8A 4AJYB 4URKA 3NY5A 4M8NA 4WWOA 1XCTL 3T3OA 2XK5A 3TEZA 1BXTA 2AQ2B 1S3SG 1OFFA 2C7HA 4GXBA 4O1NA 4AQ7A 1FRDA 4XX5A 4L2YA 1V1OA 1WR6E 4M02A 2WU2B 1MVKA 4BOZB 2K8BA 2N7EA 2LASA 3FKYA 3TIXA 1L0YB 1NI2A 3AN1A 1TT5B 4FBJB 4IW0A 2BYEA 1C78A 1IBXB 2FCQA 3KQ4A 3KW5B 3DWGC 2MA9B 4IOIE 3VH3B 1V8CA 2WXJA 2M0AA 2R2OA 1WGGA 2XN9C 2D3BA 2H89B 5EE9A 1E90A 2AX5A 4ACFA 3DDCB 3RPFC 2OHFA 4GLSC 3UIPB 3AB5A 2OOBB 2DNFA 1TKEA 3ZNHB 2JF5A 2NBUA 1HZ6A 2PE9A 1PGBA 1Q5WB 1RAXA 2KYWA 1FXIA 2BQQA 4IG7B 4YXDB 4WJPA 1XEEA 2JZPA 3QA8A 1UWMA 3FILA 2R2QA 4WJOA 3VRBB 2AQ1B 4A20A 2CHXA 4YSYB 2PE6B 4W9JA 1QOBA 4H2AA 3N3KB 3VTWA 2K39A 2KWDA 3PVLA 4WWMA 2MH7A 3EC8A 3PRZA 3WAOA 1QF6A 2EELA 2KO3A 4X57B 1M94A 3ALBA 2DENB 3DBSA 3KWLA 1XO3A 1SIJA 3NUHB 1J19A 2DLBA 3APDA 2E3TA 1YQ4B 5T8IA 1EO6A 4XDCA 1ZP0B 1A5RA 2D10A 4GIVA 2ZPNA 2Z8LA 3MFGA 2KOXA 4MACA 1VD2A 1I7HA 3IBEA 4RGMA 3QK0A 4RGNA 4IUMB 1OEYJ 5LLIA 3SD5A 2WXMA 3SHQA 2QHOA 2ZZPB 4BBNC 2WQYB 2CKHB 1RFAA 1HQRD 1QZEA 4DHZE 4HVBA 2WXNA 3Q2AC 1J7CA 4L1BA 2LXAA 1RWSA 1Y8RC 2LUMA 1F2RC 5AZGA 1TBEA 1IPGA 1I4RA 4UDUC 4RM8A 4HXDA 3C0RB 3PLVA 4OW0A 1PGAA 4KZCA 1FCLA 2PW9A 4WJQA 4DHZB 2DZIA 3U30A 2DZJA 2N7JA 2PPHA 5CHFA 1NENB 1HTQA 3PGEA 4PYUA 3VR9B 4K7SA 2IO3B 1EU4A 1FNWA 2K0PA 1E8WA 3ZUNA 3ZYYX 2V3NA 2LGDA 1K50A 3R2IA 2JZZA 2LUEA 2V4LA 4NJ6A 4LNNA 2REXA 4REZA 4KGTA 1L7YA 3NVZA 3MC8A 3ZTCA 3VAWA 1N61A 1VZ8A 3P1MA 3W1YA 4BBNF 2RDBC 2NMQA 3CF6E 1WGRA 5DCNA 2IZVB 3GOEA 5E6JA 1SGHA 1FPYA 2RPQA 2QDFA 1C79A 5HHDG 4AWJA 3KH0A 1N5XA 3CMMB 5BYQA 2INCC 2LHEA 3A9JB 4F8CB 2W9NA 3PZDA 1DGJA 1YQBA 4FHKA 2HDEA 2G9HD 4OVUA 2D5GA 3MC0B 3MHSD 4W9LA 2FCNA 3C8YA 1WZ3A 3AU5A 4RFBA 2GB1A 1QKZA 2WHIA 4LNKA 3AXCA 4K3CA 2K25A 2LVOA 2XNAC 3IAM1 3SEBA 2V4IB 2M4NA 4GN1A 3NZ3A 2BBCA 2ZVOA 2AQ3B 1P7EA 1I4HA 1E10A 3B2FA 4PS3A 1WFYA 4E74A 4WIPA 4B95A 1RFKA 5IOIA 2FE8A 3FAHA 3VUYA 1I4GA 3PSEB 3U4EG 4RCOA 3HVZA 1OQYA 2ZVNA 5H8YE 1FFUA 2KD0A 3V05A 3PRMB 1PUTA 3VDZA 3Q3NC 2LXCA 2CJOA 1D4BA 4HEA1 3RNCC 4PYZA 3I9V1 3A1QB 3B08A 2KMCA 2KTFA 3D32A 4XWTA 5D2MB 3P4PB 4JGHB 4ANXA 4ZYSA 3V61A 3BVMA 2YEPF 3NS8A 2ZW1A 2DAFA 1YX5B 3Q3FA 4HCNB 4YWGG 4HKQA 2Z0EB 2DHZA 1V80A 4GDLA 5AZHA 5D94A 1NDDA 1WF9A 2W3SA 5C2TB 4ZRKA 4W9KA 3W2DA 5IN7A 3L16A 3X0WA 1KLVA 2K5PA 3EGRA 2IO2B 4GDLB 4XYCA 3BZDB 4KV2A 1VCBA 2KDIA 1H4RA 1OGWA 3BK1A 2N7DA 2KTRA 1X1MA 1MHHE 4E71A 2LVQA 2WXQA 3MJWA 2INDC 2PJHA 3TEXA 2UU7A 3RNFC 4HPMB 4GDKA 4HJGE 3E9SA 3WAMA 5KHOA 3NVYA 5D3IB 4J6IA 2N0SB 1ZXIA 1JWUD 2JUOA 2J7QB 4M01A 4HJKA 4DHJB 4MEMA 2WWZA 4DBGA 4C00A 1JWSD 4IDIA 1F77A 2MBEA 4C4VB 1TYGB 3GS2A 4PK1A 2LWPA 1TKYA 1UGJA 3ZGZA 4NZLB 2HTME 3DVNU 2KHWB 3ZLZA 1GC6A 2K6DB 2KT7A 3ETRA 1YN3A 5IP4D 4ZRJA 1WY8A 3UQAA 4FADA 4KSKC 1ZPSA 1P7FA 3R66C 2J0JA 4M0WB 1WIAA 4C7YA 2WXLA 3ZJVA 3ZW3A 1ZDXA 3RNGC 1WGDA 2L0FA 2ONQA 2PLPA 3EFCA 4US8A 3K9PB 3UIOB 2JSVX 3GZNB 4TQ0A 4WJNA 3TMPB 3BYTB 5BMIA 3UI3A 4ZRPA 2QILA 3LYYA 2AL3A 3X23A 3PO0A 3WALA 3IAS1 3IT6B 3DBRB 1WRIA 2FNJB 1DOIA 2DZKA 2WGSA 2WXIA 1ISNA 2KWUB 2KFJA 2IYDB 3ZIMA 3QARA 1EU3A 4S17A 2WXFA 1R7SA 3HVDA 1I4XA 1YD8U 2PVGC 4GB9A 1V86A 3P42A 4RGOS 3URYA 3Q3MC 4LJPB 1YMHE 1EUVB 2KLCA 1YX6B 1WSPA 2G4DB 2I2YA 4NAMA 5LNK1 2LHDA 3APCA 2L3ZA 4FN2A 4ZRQA 5AUKA 4XWWA 4IWQA 1P3QU 1IYFA 4JLCA 5BMGA 4ANVA 4OVVA 5KHQA 1ZXHA 3VRAB 3AE6B 4OZBA 1ENFA 1WM3A 1ET6A 1N5WA 4XGAB 4DXFA 3Q8EA 1HTOA 4I6PA 1F2RI 2WXGA 1FXAA 2Y5CA 4MGYE 4CO7A 1GJZA 3DBHI 1WX7A 3R8BA 1QOFA 1L0XB 1UBQA 4WURA 1QOGA 3M3JA 1UELA 5JXVA 5GMVA 1PGXA 1V5OA 4KIKB 2MP2A 3PV1A 5DPWA 1JQ4A 4XE0A 4FJYA 3ZO5B 3MHZA 3NRZA 2ICIA 2RDGA 3TBLD 3ZQ4A 3ZNZB 4D2KA 2WS3B 2HD5B 3AH7A 4NPNA 2YLMA 2J53A 3TEYA 2M56B 3WCQA 1ZUD2 5C23A 3NS1A 2QMTA 4ZHOA 2RMMA 1MI0A 1VZ7A 2K6QA 3ZNID 4OZCA 2V3SA 3VUXA 2K8HA 2LI5A 3M95A 3LDZE 5L83A 3JSVA 2FUHB 1WE7A 3H8HA 1KRHA 5CHWA 1M4VA 3RT3B 5HKHA 3RZFA 1WE6A 3T9LA 4RMAA 1R4MB 2TSSA 2ZJDA 4PS7A 1T0SC 2JXXA 3AE8B 3QX1A 4I6LB 2DYOA 5D7GA 3DBLI 2ZEQA 3R7QA 1E8XA 3AE5B 3PPAA 4AS1A 2AWTA 2D3AA 2KQ7A 4KZ0A 4MGZE 2IGHA 3RMKC 1UGMA 1ZE3D 4IM0A 4C7ZA 3Q3JA 1UH6A 4ZDVA 1WYGA 1UD7A 2NPTA 3A33B 1SBBB 2OJRA 3R2TA 5G5GA 5G55A 2LFIA 2PEAA 1TS2A 1XD3B 2EMSA 1QOAA 3PZ7A 1BT0A 1J7BA 3ZJUA 1I4PA 4C80A 4A55A 2WDRB 1A70A 2MJEA 2XK5B 2N1VA 4MM3A 1GAQB 2KMAA 2L0TA 4HPLB 2CHWA 1WMHA 3V62A 3W9CB 1T6BX 3AE7B 2QIEB 4YTPB 2MBOA 2VRRB 4GMVA 1XLQA 1YJJA 5HG2A 4BAXA 1NBFC 2EMTA 3IHPC 1CK1A 2MCNB 1R4NB 4DHJD 2MBHA 4LCDE 1WRDB 4EKUA 3AE3B 5D3DA 4CHKA 3P63A 1P0RA 2XBBC 2GI9A 3DBHB 1EF1A 4DK5A 4MM3B 5EE0A 2BYFA 2VH2A 1C4PA 1WMHB 2XEWA 4BZAA 4NQKE 5C1ZA 3P2BA 3TCAA 3V60A 3L54A 1JWMD 1KH0A 4ZRIA 2WDVB 1YQ3B 3H7PA 4EZLA 2X8XX 2KC1A 3H7PB 3NJTA 1V49A 4ASWC 3P4RB 3A1QA 2PKOA 4FJVB 4AP4C 2KWVB 3QIJA 4XC2A 2WXKA 1SSNA 2KQSA 5LXHA 1MG8A 2N9LA 3W5VB 1GB1A 2VH1A 2JYEA 3BYYB 3A9KA 1HXYD 2IDYA 1TZ1A 3N20C 1ESFA 1WJNA 4YSZB 4KKIA 4IKGA 1FD6A 1WX8A 1HA5A 4A3PA 1WI0A 4LTUA 2KC2A 2X38A 2KACA 2MQJA 2ASQA 1GC7A 3BVZA 4YL8A 5E6NA 1NEKB 4RF0A 3N1XC 1SXTA 4HWIB 2LRUA 4DWFA 3EUB2 2Q5WD 5JH5C 1V81A 2KDFB 2PTLA 3RNEC 3LXFA 1ZGUB 1D5XC 4USAA 2SEBD 3I57A 3AE4B 1JRUA 1IUEA 3VVWB 4S0RA 2WXOA 3AEBB 3RNBC 3VR8B 4NY0A 1PYWD 2J42A 1T3QA 2ON8A 2BYVE 2DBYA 3OLMD 1WGHA 2PMVA 4PT5A 2D3CA 2N9PC 4NQLB 4ITKA 1FO4A 2KWCA 3LJ3A 1WXQA 2GBRA 4JL9A 3U52E 2V9HA 2L52A 3U2SC 2D11A 3TL5A 1EWCA 3DHHC 3Q3OC 3H9DA 4BOSC 1KM7A 1C4CA 3KYDD 2LJ5A 3NVVA 1K52A 4FA6A 3QQ8B 2QSDA 2JWZA 1TZOA 4EFOA 1UBIA 2IY0B 2E6XA 1XLNA 1WX9A 5G5HA 3AI5A 1YIWA 3H6NA 1ZKHA 4G0NB 5FR6A 3M63B 4LNOA 3GB1A 2JU6X 3DBRI 4KSLC 3CSTA 2LGXA 3O13A 1FMAD 3OJ3A 1WXSA 2V1YA 3L10B 1JW9D 3SFDB 3ONSA 2RGFA 2M8SA 3VXWA 1FNUA 2LGYA 4TUUA 2V3PA 3N1YC 4WQMA 1V5TA 2BTEA 1SE9A 1NYRA 2LRWA 3QJZA 3K9OB 3ENEA 3AV8A 1D3ZA 1WXMA 1GOZA 3DOWA 4TV3A 5IA7A 2RD0A 1YJ1A 2W82A 1TY0A 4NNJB 1UF0A 1V97A 4B0MA 3RUIB 2BF8B 2SAKA 4W9GA 4OVZA 1KLGD 2L76A 2G3QB 3B1LX 4G3XB 3KUDB 3I3TB 3AM9A 4N9F4 2VZKB 4JPSA 4B0EA 2JY6A 4CQNA 2K9XA 2MEKA 2BB6A 1E5WA 1WYWB 4ZOHC 5L95C 1CZPA 1MG4A 1RRBA 1TJEA 1JWBD 2FIFA 4C4VA 1GNUA 4HLEA 5JZEB 2BYTA 2OEDA 2KN4A 2EKIA 3CSFA 2J0KA 4OZAA 2CR5A 4F7ZA 1WM2A 2N9XA 2BKFA 3AE9B 3B2GA 4ARIA 2JYTA 2Y5BB 1XLPA 2MHJA 1WR1A 3QC8B 4W9IA 2FIDA 4KGRA 1EF5A 4RF1A 1E7VA 3A4RA 3L08A 3ZRCA 2ZNVC 2L7RA 3AE2B 5AZFA 3L4PA 4DXAB 2KX3A 2WDTB 3IFWB 4AOFA 1HEZE 4YT0B 4EUTA 3TSSA 4KKJA 3OAWA 3MP9A 2QCZA 5AEKB 3DVGY 2I38A 1RM6C 2FBWB 2MLBA 1OQQA 4N58A 4IWPA 3Q8AA 4ICVA 2MX2A 4HDOA 3BY4B 3P4QB 3I5JC 4EEWA 3LB8C 2WX1A 2KJRA 4M0WA 1LQBA 3B0AA 2NCNA 5IKCM 4NJCA 5FR3A 3IT4B 3MTNB 4MJSB 5C3JB 2IPKD 1Q10A 5I4DA 2IBIB 2O6VA 4IWOA 4GSWA 2QC8A 5CHVC 1WJ4A 1WXVA 2NS5A 3PLUA 5HI1A 4RGTA 4W9HA 4OHJA 4C56C 3ZTDA 1SIFA 2CU3A 3TUOA 2WX0A 3RZWC 3BIID 3WIMA 1FEHA 1VDVA 1ZDVA 4FULA 3AMZA 4FLHA 1D6EC 3U7DA 1UZXB 3DQVA 1LGRA 4DQOC 1VZ6A 4YSXB 4US9A 3GE3C 1I42A 2JT4B 2Y5PA 1F9JA 3AULA 5TR5A 1ZOYB 4QAYA 4GDKB 1SJED 2MW5A 1R4NI 1J7AA 1XCQL 4II3B 2ZCCA 1WJUA 2R61A 4N6EB 5J17A 2KDBA 3ZRFA 1L6UA 2MBBB 1UWXA 2C7NB 3FILB 2D3GA 2LEKA 5FKAC 1B9RA 3VQIA 3RFZB 3MC9A 3N32A 1C1YB 1C3TA 3L13A 1SF0A 2BB5A 3HHMA 2IGDA 3Q6BA 3ZXRA 2KLGA 4DXGA 2IY1B 5IAAC 1F1HA 2KK8A 3AEFB 1FRRA 1YJIA 2KMMA 1U4AA 2OJWA 4MH8A 2Z0DB 4TKNA 4WAFA 1TIFA 1TS5A 3C19A 3TEWA 1N63A 3AEGB 2NTSA 2MRPA 3ZVVA 4KDIC 3APFA 2AYOB 3Q8CA 1FXTB 1UNSA 3O65B 1LM8B 2B3AA 2K1FA 4NAWB 3JW0X 1KOTA 2DYBA 3UF8A 3GP7A 3NVWA 3GE8C 2M0XA 2J0MA 4DDID 1EWYC 2W3RA 3ZDMC 2GBNA 1YN4A 2KFKB 3VTVA 4NJ7A 1H8CA 2K3UA 1MPEA 4AUQC 4BVUC 1F0ZA 4RM9A 4NAWA 2DYMA 4R3DA 1TY2A 3L0WB 1T5XD 3EHVA 1K51A 3ZDTA 5CX3A 1WJ6A 2C5LC 2ZCBA 2KX0A 3KUCB 5BYSA 1AW7A 2NBWB 3OG5A 5EE3A 1FCCC 4ICUA 3VUWA 2L83A 4MSMB 1TS4A 3QHTA 1AARA 4LDTB 1B1ZA 4FJZA 3S2AA 4EOYA 3DCGA 4N59A 3N1ZC 2N1WA 1NYQA 1HZ5A 4MH0E 3AEAB 1KFYB 4EE2A 2DWQA 4I6NB 2WYQA 2L1AA 3SDLC 2FUG1 5GXGB 1V9JA 2G4SA 4PS8A 2DZMA 4IC7B 1L4ZB 1LXDA 3EA6A 2I1KA 3PREA 3ZXVA 1SB3C 2GOWA 1JWAD 1N6ZA 2M19A 1G6JA 1QT9A 4A90A 4JE3B 2MSED 2DX5B 4WAAA 1T0QC 2KNBA 5D6JB 5LXIB 3AECB 3RYTA 3Q8BA 2MJ3A 4A6QA 2O6VD 5E6PA 4RH6A 5IO9A 2KQ4X 1VJKA 3NHEB 1V6EA 2JXTA 3ABVB 2H88B 2BT6A 1DOYA 1PFDA 1VLBA 3R7RA 3NG0A 2Y3AA 1GG3A 1KJTA 2KDEB 3HM6X 3Q14C 2JX5A 5DPTA 1L4DB 2LGIA 1WWTA 1C77A 1GPXA 2KJ6A 4JWSC 4FXCA 2W55A 1BUIC 1WGYA 2QJLA 3GZNI 2BWFA 1Z2MA 1FM0D 2ZW0A 3HUIA 1FNVA 3EECA 2LD9A 1Y56A 4LJOB 1CMXB 2C7MB 2LVPA 3DBLB 1AYFA 2LGSA 5J2RA 1STEA 1EM7A 1OEYA 2FAZA 1F52A 4IM3A 2N9EB 3CWIA 2NR2A 2WDQB 2RDHA 4B6WA 2FCMA 1AWDA 4K81A 2BS3B 2KANA 3OWEB 4M00A 1Z5SB 4MT5A 1C9FA 4P1CC 1D5ZC 3PTFC 4TSSA 3W1SA 4A3OA 3QCAA 1QLBB 3ZKJC 2JZ3B 2ACZB 2IGGA 1L5PA 1T0YA 1FFVA 4WWNA 4HDQA 3SR6A 5E6OA 3JVZX 4HPPA 2WXHA 4HRSA 2KDMA 2I1JA 3VHTC 4W9CA 3FC4A 3KUZA 5BO4B 1JALA 1YNTE 1I4QA 2KAJA 4K7WA 2NVUI 4KX6B 3WANA 3N9YC 2PVOD 1NVID 2KZRA 5BYRA
chains in the Genus database with same CATH topology
1V2YA 2KWUB 2KFJA 2NBVB 2IYDB 2KXJA 3ZIMA 3QARA 3UIPB 1Q0WB 2JY6A 1P1AA 2OOBB 1ZW7A 4DDGD 1E5WA 1WYWB 3UGBB 5L95C 3ML9A 3TJPA 3ZNHB 2JF5A 1YD8U 3JSVB 4GB9A 1V86A 1RRBA 2NBUA 4HCPB 4LJPB 4MJSA 4AJWA 2PE9A 2FIFA 1Q5WB 1RAXA 5JHBA 1EUVB 1GNUA 4HLEA 3U8ZA 2O6VB 4IG7B 4WJPA 2KLCA 5JZEB 1YX6B 2L05A 2G4DB 3CSFA 2KN5A 3EFUA 2JPHA 4LDTD 5DPRA 2J0KA 2CR5A 4G11A 2A5UA 4F7ZA 1WM2A 2N9XA 2L3ZA 3APCA 4FN2A 2BPSA 1TGZB 2O2VA 3QA8A 2BKFA 1P3QU 4IWQA 1K8RB 4MGIE 2Y5BB 1IYFA 2R2QA 1L2NA 4JLCA 3RCZA 4ANVA 2KVRA 4WJOA 4A20A 2G45B 4OVVA 1WR1A 2CHXA 2MP2B 5KHQA 2PE6B 3QC8B 4W9IA 2FIDA 1EF5A 2MWSB 4BKSD 1E7VA 5CTRC 3A4RA 3OJ4B 3L08A 3NZUA 1WM3A 4W9JA 3ZRCA 5JHAA 2HJ8A 2ZNVC 2L7RA 5AZFA 2RR9A 4DXAB 2L8JA 2KX3A 2WDTB 3IFWB 3N3KB 3VTWA 1E8ZA 2K39A 4AOFA 1WZ0A 4I6PA 3PVLA 3EC8A 3PRZA 4EUTA 3WAOA 3OAWA 2KO3A 4X57B 4TQ1A 2EKEC 5AEKB 3DVGY 4MGYE 1M94A 4CO7A 2LZ6A 1GJZA 3DBHI 1WX7A 1UBQA 3H1UA 3ALBA 2DENB 3DBSA 1Q1OA 3M3JA 1UELA 2MLBA 5GMVA 1OTRB 1J19A 1WH3A 3APDA 2CU1A 4IWPA 1V5OA 2NPTB 4KIKB 4ICVA 4HK2A 2MX2A 1EO6A 2MP2A 4HDOA 3PV1A 5DPWA 3BY4B 1A5RA 2JVCA 4FJYA 2D10A 4GIVA 2ZPNA 3ZO5B 2D2QA 2KOXA 4N9F4 4EEWA 1VD2A 3IBEA 2WX1A 2C60A 2GBMA 4W9EA 3TBLD 3VFKA 1I35A 2KJRA 4W9DA 1LQBA 3QK0A 3ZNZB 3B0AA 4CYEA 2HD5B 3SU8X 2NCNA 4NPNA 2YLMA 4IUMB 3KYCD 1OEYJ 2O2VB 2Z59B 5LLIA 3SD5A 2QHOA 3SHQA 4GU2A 2ZZPB 5C23A 3MTNB 4BBNC 2CKHB 1RFAA 4MJSB 4W9FA 3DPDA 2K6QA 3ZNID 1QZEA 2V3SA 4DHZE 4HVBA 2IBIB 3VUXA 2O6VA 2K8HA 4IWOA 2LI5A 3M95A 2LXAA 1XT9B 3LDZE 4GSWA 5L83A 1Y8RC 3JSVA 5CHVC 3RD2A 1WJ4A 1WXVA 2FUHB 5AZGA 1TBEA 2NS5A 1WE7A 1IPGA 3PLUA 3JYUA 4W9HA 2KJHB 3ZTDA 4RM8A 1SIFA 2DAJA 4HXDA 5CHWA 3C0RB 3RT3B 5EDSA 5HKHA 2WX0A 3RZWC 3PLVA 4K1RB 1WE6A 4JQWC 4RMAA 3RZFA 3T9LA 3WIMA 4MSQB 4FULA 4KZCA 4FLHA 4MDKE 3U7DA 1UZXB 4WJQA 2ZJDA 4PS7A 4DHZB 3DQVA 2M1MA 2DZIA 2JXXA 3QX1A 4I6LB 3U30A 2DYOA 2DZJA 5D7GA 2C9WB 2PPHA 1J8CA 3DBLI 4BKTA 1I42A 2ZEQA 3R7QA 2JT4B 3NOBA 1E8XA 3PPAA 1F9JA 5CHFA 2AWTA 3T8MA 2KQ7A 4KZ0A 4MGZE 3AULA 2GMIC 5TR5A 1UGMA 4GDKB 2JRIB 3PGEA 1WXAA 1R4NI 2MW5A 3Q3JA 4IM0A 4II3B 2D07B 1UH6A 4PYUA 2K8CA 4K7SA 2IO3B 2UYZB 2ZCCA 2ZPYA 1WJUA 4ZDVA 1UD7A 2NPTA 2KDBA 3A33B 4KIKA 5J17A 3ZRFA 1E8WA 2OJRA 3V6CB 3R3MA 5G55A 3ZUNA 2PEAA 1XD3B 2LGDA 2MBBB 3QWZB 2C7NB 2JZZA 2EMSA 2KTRB 2LUEA 2V4LA 1BT0A 4NJ6A 2D3GA 2REXA 2A4ZA 3UINB 2MBQA 1L7YA 2XK5B 2N1VA 4MM3A 2M17A 3VQIA 2KMAA 2L0TA 4HPLB 3ZTCA 3H7SA 3VAWA 2CHWA 3N32A 1C1YB 1WMHA 3W1YA 4BBNF 3HK0A 1C3TA 3L13A 3PHXB 3V62A 3CF6E 3HHMA 1WGRA 5DCNA 2IZVB 3GOEA 4E3CA 2KLGA 2IY1B 2MBOA 5IAAC 3V6EB 2VRRB 2KK8A 4MGKE 1SGHA 4ANUA 4BFRA 2RPQA 4GMVA 1U4AA 4AWJA 1NBFC 2EMTA 3IHPC 3KH0A 2Z0DB 3CMMB 2MCNB 4DHJD 4TKNA 2MBHA 4LCDE 4BKSA 1WRDB 3A9JB 4EKUA 4F8CB 4CHKA 4P7IA 1P0RA 2XBBC 2W9NA 3PZDA 2MRPA 1EF1A 4F1SA 4KDIC 1YQBA 3APFA 4DK5A 2AYOB 2AL6A 4FHKA 2BWES 1FXTB 4OVUA 2BYFA 3A4SC 3MHSD 3O65B 1LM8B 2B3AA 2FCNA 2K1FA 3DVNV 3JW0X 4NAWB 4W9LA 1KOTA 2DYBA 3UF8A 1WMHB 2XEWA 1WZ3A 3AU5A 4NQKE 2M0XA 5C1ZA 2J0MA 3NZSA 3P2BA 3TCAA 3V60A 4DDID 3AXCA 3ZDMC 3L54A 4ZRIA 2HE7A 2GBNA 3PT2B 2K25A 3H7PA 2LVOA 4EZLA 2KC1A 3H7PB 2KFKB 3VTVA 4NJ7A 1H8CA 1V49A 2M4NA 1TTNA 4AUQC 4BVUC 4RM9A 4ASWC 4NAWA 2DYMA 4GN1A 4II2B 3IG3A 2ZVOA 3L0WB 3EHVA 3ZDTA 3ML8A 3A1QA 5DPSA 3L17A 5CX3A 1WJ6A 2C5LC 4PS3A 2IO1B 4FJVB 3W1SC 2ZCBA 4AP4C 1WFYA 4E74A 2CHZA 2KWVB 3QIJA 4XC2A 4B95A 2KX0A 4ZYNA 2KQSA 5LXHA 4GGQA 1MG8A 3PRPB 3VUYA 3KUCB 2IO0B 3PSEB 2NBWB 1OQYA 4G50A 5J18A 2ZVNA 3HM3A 4JIOU 4ICUA 3VUWA 3A9KA 1TZ1A 2KD0A 1WJNA 3AU4A 4MSMB 3PRMB 3VDZA 3QHTA 2LXCA 3M62B 1AARA 2KKCA 1WX8A 2N4FA 4LDTB 2JRHA 4A3PA 4FJZA 3DVGX 2L00B 3S2AA 1WI0A 2KC2A 4B9KA 2MQJA 4EOYA 3DCGA 4PYZA 2ASQA 2BKRB 4M8MA 1GC7A 3A1QB 2N1WA 3B08A 2KMCA 2KTFA 4YL8A 4MH0E 2CS4A 3D32A 1R4MI 5D2MB 5E6NA 3WA0A 4JGHB 4ANXA 2KFKA 3A9JA 3HIZA 3V61A 4I6NB 1XQQA 2RSUA 2WYQA 4HWIB 4EZJA 2LRUA 4DWFA 3SDLC 1HE8A 4FHJA 4XZ4A 5JH5C 3NS8A 1V81A 1V9JA 2KDFB 4EZKA 2G4SA 1J0GA 4PS8A 2DZMA 4IC7B 2DAFA 1LXDA 1YX5B 1ZGUB 3Q3FA 2I1KA 3PREA 4HCNB 1JRUA 2Z0EB 2DHZA 1V80A 2GOWA 3ZNGC 4GDLA 1G6JA 5AZHA 3VVWB 5D94A 1NDDA 4BKGA 1WF9A 2MSED 4MELA 4NY0A 1E8YA 2DX5B 3PHWB 4WAAA 1PQSA 4ZRKA 4W9KA 2BYVE 2FCSA 3OLMD 1WGHA 3L16A 2KNBA 5D6JB 3X0WA 1KLVA 2N9PC 2IO2B 5LXIB 4NQLB 3QAQA 3RYTA 2KWCA 4GDLB 3LJ3A 4WQOB 1LFDA 4KV2A 1VCBA 4ANWA 2GBRA 2KDIA 4JL9A 1H4RA 2O6VD 5E6PA 1OGWA 4KVGB 2N7DA 2HTHA 2KTRA 1X1MA 3NHEB 1V6EA 4WWPA 4E71A 1RLFA 2D11A 2GBJA 2LVQA 3TL5A 3MJWA 2PJHA 2AEHA 2UWQA 3H9DA 1E7UA 3R7RA 4HPMB 3WAPA 4BOSC 2YVCA 4IM2A 3UQBA 1GG3A 3VH4B 3IVFA 4GDKA 3ECIA 1KJTA 2KDEB 1KM7A 5G2NA 2GBKA 3WAMA 3KYDD 1S1QB 2LJ5A 5KHOA 3HM6X 4KDLB 2BGFA 4GOCA 5DPTA 4FA6A 1GUAB 1IP9A 3RULA 3KVFB 3QQ8B 2JWZA 4J6IA 4EFOA 1UBIA 2KJ6A 2IY0B 2JUOA 2ZNVB 1P98A 2J7QB 3N30A 4HJKA 3A9KB 1WGYA 4DHJB 3GZNI 3VTUA 1WX9A 2BWFA 1Z2MA 4MEMA 3AI5A 2WWZA 1YIWA 4DBGA 3H6NA 4K7UA 1P9DU 1ZKHA 4G0NB 5FR6A 3M63B 3PS6A 3BINA 3EECA 4AJYB 2LD9A 3DBRI 4URKA 2MBEA 3NY5A 4KSLC 4LJOB 2LWPA 3CSTA 4M8NA 1CMXB 2C7MB 4WWOA 2LVPA 2LGXA 3OJ3A 1WXSA 2XK5A 5J2RA 3DVNU 1OEYA 2FAZA 1S3SG 2C7HA 2KHWB 2N9EB 2V1YA 3L10B 4GXBA 4IM3A 2NR2A 3ONSA 1GC6A 2K6DB 3ZLZA 4XX5A 2RGFA 2M8SA 1WR6E 3VXWA 4B6WA 4ZRJA 2LGYA 2FCMA 4TUUA 1WY8A 4K81A 4BOZB 3UQAA 4FADA 4KSKC 2KANA 1V5TA 1Z5SB 2K8BA 3R66C 2N7EA 1SE9A 3W1SA 4A3OA 2J0JA 3PTFC 2LASA 3TIXA 1NI2A 1WIAA 4M0WB 2LRWA 3QCAA 3QJZA 3ZKJC 3K9OB 2JZ3B 3ZW3A 3ENEA 1WGDA 1D3ZA 2L0FA 4FBJB 1WXMA 1T0YA 2BYEA 4IW0A 3K9PB 4WWNA 4HDQA 3UIOB 2FCQA 3DOWA 4TV3A 5IA7A 2RD0A 1YJ1A 4TQ0A 5E6OA 3KW5B 3JVZX 4WJNA 3TMPB 2MA9B 4NNJB 2I1JA 3VHTC 4W9CA 3VH3B 3RUIB 2BF8B 2AL3A 3KUZA 3X23A 4W9GA 2R2OA 5BO4B 3WALA 1WGGA 4K7WA 2NVUI 2L76A 2G3QB 3B1LX 1E90A 3KUDB 2FNJB 4G3XB 3WANA 3I3TB 2KZRA 3DDCB 2DZKA 3ZVVA 1ISNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1V2Y A;  2KWU B;  2KFJ A;  2NBV B;  2IYD B;  2KXJ A;  3ZIM A;  3QAR A;  3UIP B;  1Q0W B;  2JY6 A;  1P1A A;  2OOB B;  1ZW7 A;  4DDG D;  1E5W A;  1WYW B;  3UGB B;  5L95 C;  3ML9 A;  3TJP A;  3ZNH B;  2JF5 A;  1YD8 U;  3JSV B;  4GB9 A;  1V86 A;  1RRB A;  2NBU A;  4HCP B;  4LJP B;  4MJS A;  4AJW A;  2PE9 A;  2FIF A;  1Q5W B;  1RAX A;  5JHB A;  1EUV B;  1GNU A;  4HLE A;  3U8Z A;  2O6V B;  4IG7 B;  4WJP A;  2KLC A;  5JZE B;  1YX6 B;  2L05 A;  2G4D B;  3CSF A;  2KN5 A;  3EFU A;  2JPH A;  4LDT D;  5DPR A;  2J0K A;  2CR5 A;  4G11 A;  2A5U A;  4F7Z A;  1WM2 A;  2N9X A;  2L3Z A;  3APC A;  4FN2 A;  2BPS A;  1TGZ B;  2O2V A;  3QA8 A;  2BKF A;  1P3Q U;  4IWQ A;  1K8R B;  4MGI E;  2Y5B B;  1IYF A;  2R2Q A;  1L2N A;  4JLC A;  3RCZ A;  4ANV A;  2KVR A;  4WJO A;  4A20 A;  2G45 B;  4OVV A;  1WR1 A;  2CHX A;  2MP2 B;  5KHQ A;  2PE6 B;  3QC8 B;  4W9I A;  2FID A;  1EF5 A;  2MWS B;  4BKS D;  1E7V A;  5CTR C;  3A4R A;  3OJ4 B;  3L08 A;  3NZU A;  1WM3 A;  4W9J A;  3ZRC A;  5JHA A;  2HJ8 A;  2ZNV C;  2L7R A;  5AZF A;  2RR9 A;  4DXA B;  2L8J A;  2KX3 A;  2WDT B;  3IFW B;  3N3K B;  3VTW A;  1E8Z A;  2K39 A;  4AOF A;  1WZ0 A;  4I6P A;  3PVL A;  3EC8 A;  3PRZ A;  4EUT A;  3WAO A;  3OAW A;  2KO3 A;  4X57 B;  4TQ1 A;  2EKE C;  5AEK B;  3DVG Y;  4MGY E;  1M94 A;  4CO7 A;  2LZ6 A;  1GJZ A;  3DBH I;  1WX7 A;  1UBQ A;  3H1U A;  3ALB A;  2DEN B;  3DBS A;  1Q1O A;  3M3J A;  1UEL A;  2MLB A;  5GMV A;  1OTR B;  1J19 A;  1WH3 A;  3APD A;  2CU1 A;  4IWP A;  1V5O A;  2NPT B;  4KIK B;  4ICV A;  4HK2 A;  2MX2 A;  1EO6 A;  2MP2 A;  4HDO A;  3PV1 A;  5DPW A;  3BY4 B;  1A5R A;  2JVC A;  4FJY A;  2D10 A;  4GIV A;  2ZPN A;  3ZO5 B;  2D2Q A;  2KOX A;  4N9F 4;  4EEW A;  1VD2 A;  3IBE A;  2WX1 A;  2C60 A;  2GBM A;  4W9E A;  3TBL D;  3VFK A;  1I35 A;  2KJR A;  4W9D A;  1LQB A;  3QK0 A;  3ZNZ B;  3B0A A;  4CYE A;  2HD5 B;  3SU8 X;  2NCN A;  4NPN A;  2YLM A;  4IUM B;  3KYC D;  1OEY J;  2O2V B;  2Z59 B;  5LLI A;  3SD5 A;  2QHO A;  3SHQ A;  4GU2 A;  2ZZP B;  5C23 A;  3MTN B;  4BBN C;  2CKH B;  1RFA A;  4MJS B;  4W9F A;  3DPD A;  2K6Q A;  3ZNI D;  1QZE A;  2V3S A;  4DHZ E;  4HVB A;  2IBI B;  3VUX A;  2O6V A;  2K8H A;  4IWO A;  2LI5 A;  3M95 A;  2LXA A;  1XT9 B;  3LDZ E;  4GSW A;  5L83 A;  1Y8R C;  3JSV A;  5CHV C;  3RD2 A;  1WJ4 A;  1WXV A;  2FUH B;  5AZG A;  1TBE A;  2NS5 A;  1WE7 A;  1IPG A;  3PLU A;  3JYU A;  4W9H A;  2KJH B;  3ZTD A;  4RM8 A;  1SIF A;  2DAJ A;  4HXD A;  5CHW A;  3C0R B;  3RT3 B;  5EDS A;  5HKH A;  2WX0 A;  3RZW C;  3PLV A;  4K1R B;  1WE6 A;  4JQW C;  4RMA A;  3RZF A;  3T9L A;  3WIM A;  4MSQ B;  4FUL A;  4KZC A;  4FLH A;  4MDK E;  3U7D A;  1UZX B;  4WJQ A;  2ZJD A;  4PS7 A;  4DHZ B;  3DQV A;  2M1M A;  2DZI A;  2JXX A;  3QX1 A;  4I6L B;  3U30 A;  2DYO A;  2DZJ A;  5D7G A;  2C9W B;  2PPH A;  1J8C A;  3DBL I;  4BKT A;  1I42 A;  2ZEQ A;  3R7Q A;  2JT4 B;  3NOB A;  1E8X A;  3PPA A;  1F9J A;  5CHF A;  2AWT A;  3T8M A;  2KQ7 A;  4KZ0 A;  4MGZ E;  3AUL A;  2GMI C;  5TR5 A;  1UGM A;  4GDK B;  2JRI B;  3PGE A;  1WXA A;  1R4N I;  2MW5 A;  3Q3J A;  4IM0 A;  4II3 B;  2D07 B;  1UH6 A;  4PYU A;  2K8C A;  4K7S A;  2IO3 B;  2UYZ B;  2ZCC A;  2ZPY A;  1WJU A;  4ZDV A;  1UD7 A;  2NPT A;  2KDB A;  3A33 B;  4KIK A;  5J17 A;  3ZRF A;  1E8W A;  2OJR A;  3V6C B;  3R3M A;  5G55 A;  3ZUN A;  2PEA A;  1XD3 B;  2LGD A;  2MBB B;  3QWZ B;  2C7N B;  2JZZ A;  2EMS A;  2KTR B;  2LUE A;  2V4L A;  1BT0 A;  4NJ6 A;  2D3G A;  2REX A;  2A4Z A;  3UIN B;  2MBQ A;  1L7Y A;  2XK5 B;  2N1V A;  4MM3 A;  2M17 A;  3VQI A;  2KMA A;  2L0T A;  4HPL B;  3ZTC A;  3H7S A;  3VAW A;  2CHW A;  3N32 A;  1C1Y B;  1WMH A;  3W1Y A;  4BBN F;  3HK0 A;  1C3T A;  3L13 A;  3PHX B;  3V62 A;  3CF6 E;  3HHM A;  1WGR A;  5DCN A;  2IZV B;  3GOE A;  4E3C A;  2KLG A;  2IY1 B;  2MBO A;  5IAA C;  3V6E B;  2VRR B;  2KK8 A;  4MGK E;  1SGH A;  4ANU A;  4BFR A;  2RPQ A;  4GMV A;  1U4A A;  4AWJ A;  1NBF C;  2EMT A;  3IHP C;  3KH0 A;  2Z0D B;  3CMM B;  2MCN B;  4DHJ D;  4TKN A;  2MBH A;  4LCD E;  4BKS A;  1WRD B;  3A9J B;  4EKU A;  4F8C B;  4CHK A;  4P7I A;  1P0R A;  2XBB C;  2W9N A;  3PZD A;  2MRP A;  1EF1 A;  4F1S A;  4KDI C;  1YQB A;  3APF A;  4DK5 A;  2AYO B;  2AL6 A;  4FHK A;  2BWE S;  1FXT B;  4OVU A;  2BYF A;  3A4S C;  3MHS D;  3O65 B;  1LM8 B;  2B3A A;  2FCN A;  2K1F A;  3DVN V;  3JW0 X;  4NAW B;  4W9L A;  1KOT A;  2DYB A;  3UF8 A;  1WMH B;  2XEW A;  1WZ3 A;  3AU5 A;  4NQK E;  2M0X A;  5C1Z A;  2J0M A;  3NZS A;  3P2B A;  3TCA A;  3V60 A;  4DDI D;  3AXC A;  3ZDM C;  3L54 A;  4ZRI A;  2HE7 A;  2GBN A;  3PT2 B;  2K25 A;  3H7P A;  2LVO A;  4EZL A;  2KC1 A;  3H7P B;  2KFK B;  3VTV A;  4NJ7 A;  1H8C A;  1V49 A;  2M4N A;  1TTN A;  4AUQ C;  4BVU C;  4RM9 A;  4ASW C;  4NAW A;  2DYM A;  4GN1 A;  4II2 B;  3IG3 A;  2ZVO A;  3L0W B;  3EHV A;  3ZDT A;  3ML8 A;  3A1Q A;  5DPS A;  3L17 A;  5CX3 A;  1WJ6 A;  2C5L C;  4PS3 A;  2IO1 B;  4FJV B;  3W1S C;  2ZCB A;  4AP4 C;  1WFY A;  4E74 A;  2CHZ A;  2KWV B;  3QIJ A;  4XC2 A;  4B95 A;  2KX0 A;  4ZYN A;  2KQS A;  5LXH A;  4GGQ A;  1MG8 A;  3PRP B;  3VUY A;  3KUC B;  2IO0 B;  3PSE B;  2NBW B;  1OQY A;  4G50 A;  5J18 A;  2ZVN A;  3HM3 A;  4JIO U;  4ICU A;  3VUW A;  3A9K A;  1TZ1 A;  2KD0 A;  1WJN A;  3AU4 A;  4MSM B;  3PRM B;  3VDZ A;  3QHT A;  2LXC A;  3M62 B;  1AAR A;  2KKC A;  1WX8 A;  2N4F A;  4LDT B;  2JRH A;  4A3P A;  4FJZ A;  3DVG X;  2L00 B;  3S2A A;  1WI0 A;  2KC2 A;  4B9K A;  2MQJ A;  4EOY A;  3DCG A;  4PYZ A;  2ASQ A;  2BKR B;  4M8M A;  1GC7 A;  3A1Q B;  2N1W A;  3B08 A;  2KMC A;  2KTF A;  4YL8 A;  4MH0 E;  2CS4 A;  3D32 A;  1R4M I;  5D2M B;  5E6N A;  3WA0 A;  4JGH B;  4ANX A;  2KFK A;  3A9J A;  3HIZ A;  3V61 A;  4I6N B;  1XQQ A;  2RSU A;  2WYQ A;  4HWI B;  4EZJ A;  2LRU A;  4DWF A;  3SDL C;  1HE8 A;  4FHJ A;  4XZ4 A;  5JH5 C;  3NS8 A;  1V81 A;  1V9J A;  2KDF B;  4EZK A;  2G4S A;  1J0G A;  4PS8 A;  2DZM A;  4IC7 B;  2DAF A;  1LXD A;  1YX5 B;  1ZGU B;  3Q3F A;  2I1K A;  3PRE A;  4HCN B;  1JRU A;  2Z0E B;  2DHZ A;  1V80 A;  2GOW A;  3ZNG C;  4GDL A;  1G6J A;  5AZH A;  3VVW B;  5D94 A;  1NDD A;  4BKG A;  1WF9 A;  2MSE D;  4MEL A;  4NY0 A;  1E8Y A;  2DX5 B;  3PHW B;  4WAA A;  1PQS A;  4ZRK A;  4W9K A;  2BYV E;  2FCS A;  3OLM D;  1WGH A;  3L16 A;  2KNB A;  5D6J B;  3X0W A;  1KLV A;  2N9P C;  2IO2 B;  5LXI B;  4NQL B;  3QAQ A;  3RYT A;  2KWC A;  4GDL B;  3LJ3 A;  4WQO B;  1LFD A;  4KV2 A;  1VCB A;  4ANW A;  2GBR A;  2KDI A;  4JL9 A;  1H4R A;  2O6V D;  5E6P A;  1OGW A;  4KVG B;  2N7D A;  2HTH A;  2KTR A;  1X1M A;  3NHE B;  1V6E A;  4WWP A;  4E71 A;  1RLF A;  2D11 A;  2GBJ A;  2LVQ A;  3TL5 A;  3MJW A;  2PJH A;  2AEH A;  2UWQ A;  3H9D A;  1E7U A;  3R7R A;  4HPM B;  3WAP A;  4BOS C;  2YVC A;  4IM2 A;  3UQB A;  1GG3 A;  3VH4 B;  3IVF A;  4GDK A;  3ECI A;  1KJT A;  2KDE B;  1KM7 A;  5G2N A;  2GBK A;  3WAM A;  3KYD D;  1S1Q B;  2LJ5 A;  5KHO A;  3HM6 X;  4KDL B;  2BGF A;  4GOC A;  5DPT A;  4FA6 A;  1GUA B;  1IP9 A;  3RUL A;  3KVF B;  3QQ8 B;  2JWZ A;  4J6I A;  4EFO A;  1UBI A;  2KJ6 A;  2IY0 B;  2JUO A;  2ZNV B;  1P98 A;  2J7Q B;  3N30 A;  4HJK A;  3A9K B;  1WGY A;  4DHJ B;  3GZN I;  3VTU A;  1WX9 A;  2BWF A;  1Z2M A;  4MEM A;  3AI5 A;  2WWZ A;  1YIW A;  4DBG A;  3H6N A;  4K7U A;  1P9D U;  1ZKH A;  4G0N B;  5FR6 A;  3M63 B;  3PS6 A;  3BIN A;  3EEC A;  4AJY B;  2LD9 A;  3DBR I;  4URK A;  2MBE A;  3NY5 A;  4KSL C;  4LJO B;  2LWP A;  3CST A;  4M8N A;  1CMX B;  2C7M B;  4WWO A;  2LVP A;  2LGX A;  3OJ3 A;  1WXS A;  2XK5 A;  5J2R A;  3DVN U;  1OEY A;  2FAZ A;  1S3S G;  2C7H A;  2KHW B;  2N9E B;  2V1Y A;  3L10 B;  4GXB A;  4IM3 A;  2NR2 A;  3ONS A;  1GC6 A;  2K6D B;  3ZLZ A;  4XX5 A;  2RGF A;  2M8S A;  1WR6 E;  3VXW A;  4B6W A;  4ZRJ A;  2LGY A;  2FCM A;  4TUU A;  1WY8 A;  4K81 A;  4BOZ B;  3UQA A;  4FAD A;  4KSK C;  2KAN A;  1V5T A;  1Z5S B;  2K8B A;  3R66 C;  2N7E A;  1SE9 A;  3W1S A;  4A3O A;  2J0J A;  3PTF C;  2LAS A;  3TIX A;  1NI2 A;  1WIA A;  4M0W B;  2LRW A;  3QCA A;  3QJZ A;  3ZKJ C;  3K9O B;  2JZ3 B;  3ZW3 A;  3ENE A;  1WGD A;  1D3Z A;  2L0F A;  4FBJ B;  1WXM A;  1T0Y A;  2BYE A;  4IW0 A;  3K9P B;  4WWN A;  4HDQ A;  3UIO B;  2FCQ A;  3DOW A;  4TV3 A;  5IA7 A;  2RD0 A;  1YJ1 A;  4TQ0 A;  5E6O A;  3KW5 B;  3JVZ X;  4WJN A;  3TMP B;  2MA9 B;  4NNJ B;  2I1J A;  3VHT C;  4W9C A;  3VH3 B;  3RUI B;  2BF8 B;  2AL3 A;  3KUZ A;  3X23 A;  4W9G A;  2R2O A;  5BO4 B;  3WAL A;  1WGG A;  4K7W A;  2NVU I;  2L76 A;  2G3Q B;  3B1L X;  1E90 A;  3KUD B;  2FNJ B;  4G3X B;  3WAN A;  3I3T B;  2KZR A;  3DDC B;  2DZK A;  3ZVV A;  1ISN A; 
#chains in the Genus database with same CATH topology
 2BS4 B;  1V2Y A;  2NBV B;  2KXJ A;  1Q0W B;  1KF6 B;  1N62 A;  1P1A A;  3KWV A;  1V1P B;  1ZW7 A;  1SJH D;  4DDG D;  2MJD A;  3UGB B;  3ML9 A;  3TJP A;  4LLG M;  3JSV B;  4HCP B;  1AN8 A;  4MJS A;  4AJW A;  5JHB A;  1JRO A;  3DHG C;  3U8Z A;  2O6V B;  2L05 A;  4HRO A;  2WNM A;  4LNI A;  1L6V A;  2KN5 A;  3EFU A;  2JPH A;  4LDT D;  5DPR A;  1XXG A;  4G11 A;  2A5U A;  1UUP A;  2BPS A;  1TGZ B;  2O2V A;  1K8R B;  4MGI E;  3DHI C;  1L2N A;  3RCZ A;  2KVR A;  2G45 B;  2MP2 B;  1TKG A;  2JQR B;  2MWS B;  4BKS D;  5CTR C;  3OJ4 B;  5EE1 A;  3P4S B;  1VR9 A;  3NZU A;  5JHA A;  2HJ8 A;  2RR9 A;  3BWU D;  2L8J A;  1DYQ A;  1E8Z A;  1WZ0 A;  1E6E B;  5FK9 C;  4K3B A;  4TQ1 A;  2EKE C;  2LZ6 A;  3KLS X;  3H1U A;  3V3X A;  1Q1O A;  1OTR B;  1VRA B;  1WH3 A;  2CU1 A;  4YTN B;  2NPT B;  4HK2 A;  3U7Z A;  1YN5 A;  4P1B C;  2JVC A;  1ET9 A;  2D2Q A;  2C60 A;  2GBM A;  4W9E A;  3VFK A;  1I35 A;  4W9D A;  4CYE A;  3SU8 X;  2VZK D;  3IXS A;  3KYC D;  2O2V B;  2Z59 B;  4GU2 A;  1C4A A;  3J9C A;  4W9F A;  3DPD A;  1L0V B;  2INP E;  2YEP B;  1XT9 B;  3RD2 A;  2CJN A;  4HKZ E;  3W5U B;  3JYU A;  2KJH B;  2QEJ C;  3T3N A;  1CJE A;  2DAJ A;  5EDS A;  4K1R B;  4JQW C;  4MSQ B;  4MDK E;  1OQR A;  2WU5 B;  2M1M A;  2C9W B;  1KLU D;  3AE1 B;  5AUI A;  3SFE B;  1J8C A;  2G1E A;  4KGS A;  4BKT A;  3NOB A;  4P16 A;  3T8M A;  2GMI C;  4A9A A;  3ZJT A;  2JRI B;  1WXA A;  2D07 B;  2K8C A;  2UYZ B;  2ZPY A;  4KIK A;  4JX1 C;  3V6C B;  3R3M A;  3QWZ B;  2KTR B;  3RI7 C;  2LMC A;  2NTT A;  4LNF A;  1ROE A;  2A4Z A;  5TSS A;  3UIN B;  2MBQ A;  1GB4 A;  2M17 A;  1C76 A;  2BVC A;  1SE2 A;  3Q69 A;  3H7S A;  1SE3 A;  3BVG A;  2HJ1 A;  3HK0 A;  3PHX B;  5HFY A;  2J52 A;  1DOX A;  2K22 A;  4E3C A;  3V6E B;  3I63 C;  4MGK E;  4ANU A;  4BFR A;  3DWM A;  1NI3 A;  4BKS A;  5BMH A;  3RNA C;  2GLS A;  2GRI A;  4P7I A;  2RPV A;  4F1S A;  2AL6 A;  2BWE S;  3A4S C;  1BML C;  2L32 A;  3DVN V;  3BK2 A;  3NZS A;  2WLB A;  2HE7 A;  3PT2 B;  1MHX A;  4TMA B;  1TTN A;  1E0Z A;  2N9K A;  4II2 B;  3IG3 A;  2WP9 B;  2PIA A;  3ML8 A;  5DPS A;  3L17 A;  2IO1 B;  3W1S C;  4ZHP A;  1YOV B;  2CHZ A;  4ZYN A;  1IBX A;  3HRD D;  4GGQ A;  3PRP B;  1IGC A;  2IO0 B;  2KVZ A;  1WGK A;  3RN9 C;  4G50 A;  1K53 A;  2BW2 A;  5J18 A;  3HM3 A;  5MPO A;  1QIL A;  4JIO U;  1KTK A;  3AEE B;  3AU4 A;  1SE4 A;  3M62 B;  2KKC A;  2N4F A;  1IGD A;  2JRH A;  3DVG X;  1CQV A;  2L00 B;  2B76 B;  3Q8F A;  4B9K A;  2BKR B;  4M8M A;  4LK0 M;  1T0R C;  2WXP A;  2CS4 A;  1R4M I;  1V1P A;  3WA0 A;  2KFK A;  4J3O D;  3AED B;  3A9J A;  3HIZ A;  1MFW A;  1XF5 L;  1XQQ A;  2RSU A;  3B9J A;  4EZJ A;  4JWU C;  3CIR B;  1HE8 A;  4FHJ A;  2W54 A;  4XZ4 A;  1SEB D;  4EZK A;  1J0G A;  1E9M A;  4RNA A;  1JML A;  1XLO A;  3ZNG C;  2JWU A;  1TS3 A;  4BKG A;  1PDX A;  2J4X A;  4WH4 A;  1LO5 D;  4MEL A;  1E8Y A;  3PHW B;  2WXR A;  1PQS A;  2FCS A;  4Q2J A;  1QQR A;  3QAQ A;  4WQO B;  1LFD A;  1JRP A;  4ANW A;  1RYJ A;  1JCK B;  4KVG B;  2HTH A;  2LJI A;  4WWP A;  1RLF A;  2GBJ A;  1D5M C;  4YTM B;  2AEH A;  2UWQ A;  2INN E;  1E7U A;  3WAP A;  2BS2 B;  2YVC A;  4IM2 A;  3UQB A;  3VH4 B;  3IVF A;  3ECI A;  4XDD A;  5H92 C;  4ARC A;  5G2N A;  2GBK A;  1N60 A;  1ACC A;  1S1Q B;  4KDL B;  2BGF A;  4GOC A;  2V0G A;  4A8X C;  1GUA B;  1IP9 A;  3RUL A;  3KVF B;  3E56 A;  3MJ5 A;  1MJD A;  2IJ0 A;  2ZNV B;  1P98 A;  3N30 A;  3A9K B;  1E7P B;  1FIQ A;  3VTU A;  4L23 A;  4K7U A;  1P9D U;  4P6V F;  3PS6 A;  3BIN A;  3PZ8 A;  4AJY B;  4URK A;  3NY5 A;  4M8N A;  4WWO A;  1XCT L;  3T3O A;  2XK5 A;  3TEZ A;  1BXT A;  2AQ2 B;  1S3S G;  1OFF A;  2C7H A;  4GXB A;  4O1N A;  4AQ7 A;  1FRD A;  4XX5 A;  4L2Y A;  1V1O A;  1WR6 E;  4M02 A;  2WU2 B;  1MVK A;  4BOZ B;  2K8B A;  2N7E A;  2LAS A;  3FKY A;  3TIX A;  1L0Y B;  1NI2 A;  3AN1 A;  1TT5 B;  4FBJ B;  4IW0 A;  2BYE A;  1C78 A;  1IBX B;  2FCQ A;  3KQ4 A;  3KW5 B;  3DWG C;  2MA9 B;  4IOI E;  3VH3 B;  1V8C A;  2WXJ A;  2M0A A;  2R2O A;  1WGG A;  2XN9 C;  2D3B A;  2H89 B;  5EE9 A;  1E90 A;  2AX5 A;  4ACF A;  3DDC B;  3RPF C;  2OHF A;  4GLS C;  3UIP B;  3AB5 A;  2OOB B;  2DNF A;  1TKE A;  3ZNH B;  2JF5 A;  2NBU A;  1HZ6 A;  2PE9 A;  1PGB A;  1Q5W B;  1RAX A;  2KYW A;  1FXI A;  2BQQ A;  4IG7 B;  4YXD B;  4WJP A;  1XEE A;  2JZP A;  3QA8 A;  1UWM A;  3FIL A;  2R2Q A;  4WJO A;  3VRB B;  2AQ1 B;  4A20 A;  2CHX A;  4YSY B;  2PE6 B;  4W9J A;  1QOB A;  4H2A A;  3N3K B;  3VTW A;  2K39 A;  2KWD A;  3PVL A;  4WWM A;  2MH7 A;  3EC8 A;  3PRZ A;  3WAO A;  1QF6 A;  2EEL A;  2KO3 A;  4X57 B;  1M94 A;  3ALB A;  2DEN B;  3DBS A;  3KWL A;  1XO3 A;  1SIJ A;  3NUH B;  1J19 A;  2DLB A;  3APD A;  2E3T A;  1YQ4 B;  5T8I A;  1EO6 A;  4XDC A;  1ZP0 B;  1A5R A;  2D10 A;  4GIV A;  2ZPN A;  2Z8L A;  3MFG A;  2KOX A;  4MAC A;  1VD2 A;  1I7H A;  3IBE A;  4RGM A;  3QK0 A;  4RGN A;  4IUM B;  1OEY J;  5LLI A;  3SD5 A;  2WXM A;  3SHQ A;  2QHO A;  2ZZP B;  4BBN C;  2WQY B;  2CKH B;  1RFA A;  1HQR D;  1QZE A;  4DHZ E;  4HVB A;  2WXN A;  3Q2A C;  1J7C A;  4L1B A;  2LXA A;  1RWS A;  1Y8R C;  2LUM A;  1F2R C;  5AZG A;  1TBE A;  1IPG A;  1I4R A;  4UDU C;  4RM8 A;  4HXD A;  3C0R B;  3PLV A;  4OW0 A;  1PGA A;  4KZC A;  1FCL A;  2PW9 A;  4WJQ A;  4DHZ B;  2DZI A;  3U30 A;  2DZJ A;  2N7J A;  2PPH A;  5CHF A;  1NEN B;  1HTQ A;  3PGE A;  4PYU A;  3VR9 B;  4K7S A;  2IO3 B;  1EU4 A;  1FNW A;  2K0P A;  1E8W A;  3ZUN A;  3ZYY X;  2V3N A;  2LGD A;  1K50 A;  3R2I A;  2JZZ A;  2LUE A;  2V4L A;  4NJ6 A;  4LNN A;  2REX A;  4REZ A;  4KGT A;  1L7Y A;  3NVZ A;  3MC8 A;  3ZTC A;  3VAW A;  1N61 A;  1VZ8 A;  3P1M A;  3W1Y A;  4BBN F;  2RDB C;  2NMQ A;  3CF6 E;  1WGR A;  5DCN A;  2IZV B;  3GOE A;  5E6J A;  1SGH A;  1FPY A;  2RPQ A;  2QDF A;  1C79 A;  5HHD G;  4AWJ A;  3KH0 A;  1N5X A;  3CMM B;  5BYQ A;  2INC C;  2LHE A;  3A9J B;  4F8C B;  2W9N A;  3PZD A;  1DGJ A;  1YQB A;  4FHK A;  2HDE A;  2G9H D;  4OVU A;  2D5G A;  3MC0 B;  3MHS D;  4W9L A;  2FCN A;  3C8Y A;  1WZ3 A;  3AU5 A;  4RFB A;  2GB1 A;  1QKZ A;  2WHI A;  4LNK A;  3AXC A;  4K3C A;  2K25 A;  2LVO A;  2XNA C;  3IAM 1;  3SEB A;  2V4I B;  2M4N A;  4GN1 A;  3NZ3 A;  2BBC A;  2ZVO A;  2AQ3 B;  1P7E A;  1I4H A;  1E10 A;  3B2F A;  4PS3 A;  1WFY A;  4E74 A;  4WIP A;  4B95 A;  1RFK A;  5IOI A;  2FE8 A;  3FAH A;  3VUY A;  1I4G A;  3PSE B;  3U4E G;  4RCO A;  3HVZ A;  1OQY A;  2ZVN A;  5H8Y E;  1FFU A;  2KD0 A;  3V05 A;  3PRM B;  1PUT A;  3VDZ A;  3Q3N C;  2LXC A;  2CJO A;  1D4B A;  4HEA 1;  3RNC C;  4PYZ A;  3I9V 1;  3A1Q B;  3B08 A;  2KMC A;  2KTF A;  3D32 A;  4XWT A;  5D2M B;  3P4P B;  4JGH B;  4ANX A;  4ZYS A;  3V61 A;  3BVM A;  2YEP F;  3NS8 A;  2ZW1 A;  2DAF A;  1YX5 B;  3Q3F A;  4HCN B;  4YWG G;  4HKQ A;  2Z0E B;  2DHZ A;  1V80 A;  4GDL A;  5AZH A;  5D94 A;  1NDD A;  1WF9 A;  2W3S A;  5C2T B;  4ZRK A;  4W9K A;  3W2D A;  5IN7 A;  3L16 A;  3X0W A;  1KLV A;  2K5P A;  3EGR A;  2IO2 B;  4GDL B;  4XYC A;  3BZD B;  4KV2 A;  1VCB A;  2KDI A;  1H4R A;  1OGW A;  3BK1 A;  2N7D A;  2KTR A;  1X1M A;  1MHH E;  4E71 A;  2LVQ A;  2WXQ A;  3MJW A;  2IND C;  2PJH A;  3TEX A;  2UU7 A;  3RNF C;  4HPM B;  4GDK A;  4HJG E;  3E9S A;  3WAM A;  5KHO A;  3NVY A;  5D3I B;  4J6I A;  2N0S B;  1ZXI A;  1JWU D;  2JUO A;  2J7Q B;  4M01 A;  4HJK A;  4DHJ B;  4MEM A;  2WWZ A;  4DBG A;  4C00 A;  1JWS D;  4IDI A;  1F77 A;  2MBE A;  4C4V B;  1TYG B;  3GS2 A;  4PK1 A;  2LWP A;  1TKY A;  1UGJ A;  3ZGZ A;  4NZL B;  2HTM E;  3DVN U;  2KHW B;  3ZLZ A;  1GC6 A;  2K6D B;  2KT7 A;  3ETR A;  1YN3 A;  5IP4 D;  4ZRJ A;  1WY8 A;  3UQA A;  4FAD A;  4KSK C;  1ZPS A;  1P7F A;  3R66 C;  2J0J A;  4M0W B;  1WIA A;  4C7Y A;  2WXL A;  3ZJV A;  3ZW3 A;  1ZDX A;  3RNG C;  1WGD A;  2L0F A;  2ONQ A;  2PLP A;  3EFC A;  4US8 A;  3K9P B;  3UIO B;  2JSV X;  3GZN B;  4TQ0 A;  4WJN A;  3TMP B;  3BYT B;  5BMI A;  3UI3 A;  4ZRP A;  2QIL A;  3LYY A;  2AL3 A;  3X23 A;  3PO0 A;  3WAL A;  3IAS 1;  3IT6 B;  3DBR B;  1WRI A;  2FNJ B;  1DOI A;  2DZK A;  2WGS A;  2WXI A;  1ISN A;  2KWU B;  2KFJ A;  2IYD B;  3ZIM A;  3QAR A;  1EU3 A;  4S17 A;  2WXF A;  1R7S A;  3HVD A;  1I4X A;  1YD8 U;  2PVG C;  4GB9 A;  1V86 A;  3P42 A;  4RGO S;  3URY A;  3Q3M C;  4LJP B;  1YMH E;  1EUV B;  2KLC A;  1YX6 B;  1WSP A;  2G4D B;  2I2Y A;  4NAM A;  5LNK 1;  2LHD A;  3APC A;  2L3Z A;  4FN2 A;  4ZRQ A;  5AUK A;  4XWW A;  4IWQ A;  1P3Q U;  1IYF A;  4JLC A;  5BMG A;  4ANV A;  4OVV A;  5KHQ A;  1ZXH A;  3VRA B;  3AE6 B;  4OZB A;  1ENF A;  1WM3 A;  1ET6 A;  1N5W A;  4XGA B;  4DXF A;  3Q8E A;  1HTO A;  4I6P A;  1F2R I;  2WXG A;  1FXA A;  2Y5C A;  4MGY E;  4CO7 A;  1GJZ A;  3DBH I;  1WX7 A;  3R8B A;  1QOF A;  1L0X B;  1UBQ A;  4WUR A;  1QOG A;  3M3J A;  1UEL A;  5JXV A;  5GMV A;  1PGX A;  1V5O A;  4KIK B;  2MP2 A;  3PV1 A;  5DPW A;  1JQ4 A;  4XE0 A;  4FJY A;  3ZO5 B;  3MHZ A;  3NRZ A;  2ICI A;  2RDG A;  3TBL D;  3ZQ4 A;  3ZNZ B;  4D2K A;  2WS3 B;  2HD5 B;  3AH7 A;  4NPN A;  2YLM A;  2J53 A;  3TEY A;  2M56 B;  3WCQ A;  1ZUD 2;  5C23 A;  3NS1 A;  2QMT A;  4ZHO A;  2RMM A;  1MI0 A;  1VZ7 A;  2K6Q A;  3ZNI D;  4OZC A;  2V3S A;  3VUX A;  2K8H A;  2LI5 A;  3M95 A;  3LDZ E;  5L83 A;  3JSV A;  2FUH B;  1WE7 A;  3H8H A;  1KRH A;  5CHW A;  1M4V A;  3RT3 B;  5HKH A;  3RZF A;  1WE6 A;  3T9L A;  4RMA A;  1R4M B;  2TSS A;  2ZJD A;  4PS7 A;  1T0S C;  2JXX A;  3AE8 B;  3QX1 A;  4I6L B;  2DYO A;  5D7G A;  3DBL I;  2ZEQ A;  3R7Q A;  1E8X A;  3AE5 B;  3PPA A;  4AS1 A;  2AWT A;  2D3A A;  2KQ7 A;  4KZ0 A;  4MGZ E;  2IGH A;  3RMK C;  1UGM A;  1ZE3 D;  4IM0 A;  4C7Z A;  3Q3J A;  1UH6 A;  4ZDV A;  1WYG A;  1UD7 A;  2NPT A;  3A33 B;  1SBB B;  2OJR A;  3R2T A;  5G5G A;  5G55 A;  2LFI A;  2PEA A;  1TS2 A;  1XD3 B;  2EMS A;  1QOA A;  3PZ7 A;  1BT0 A;  1J7B A;  3ZJU A;  1I4P A;  4C80 A;  4A55 A;  2WDR B;  1A70 A;  2MJE A;  2XK5 B;  2N1V A;  4MM3 A;  1GAQ B;  2KMA A;  2L0T A;  4HPL B;  2CHW A;  1WMH A;  3V62 A;  3W9C B;  1T6B X;  3AE7 B;  2QIE B;  4YTP B;  2MBO A;  2VRR B;  4GMV A;  1XLQ A;  1YJJ A;  5HG2 A;  4BAX A;  1NBF C;  2EMT A;  3IHP C;  1CK1 A;  2MCN B;  1R4N B;  4DHJ D;  2MBH A;  4LCD E;  1WRD B;  4EKU A;  3AE3 B;  5D3D A;  4CHK A;  3P63 A;  1P0R A;  2XBB C;  2GI9 A;  3DBH B;  1EF1 A;  4DK5 A;  4MM3 B;  5EE0 A;  2BYF A;  2VH2 A;  1C4P A;  1WMH B;  2XEW A;  4BZA A;  4NQK E;  5C1Z A;  3P2B A;  3TCA A;  3V60 A;  3L54 A;  1JWM D;  1KH0 A;  4ZRI A;  2WDV B;  1YQ3 B;  3H7P A;  4EZL A;  2X8X X;  2KC1 A;  3H7P B;  3NJT A;  1V49 A;  4ASW C;  3P4R B;  3A1Q A;  2PKO A;  4FJV B;  4AP4 C;  2KWV B;  3QIJ A;  4XC2 A;  2WXK A;  1SSN A;  2KQS A;  5LXH A;  1MG8 A;  2N9L A;  3W5V B;  1GB1 A;  2VH1 A;  2JYE A;  3BYY B;  3A9K A;  1HXY D;  2IDY A;  1TZ1 A;  3N20 C;  1ESF A;  1WJN A;  4YSZ B;  4KKI A;  4IKG A;  1FD6 A;  1WX8 A;  1HA5 A;  4A3P A;  1WI0 A;  4LTU A;  2KC2 A;  2X38 A;  2KAC A;  2MQJ A;  2ASQ A;  1GC7 A;  3BVZ A;  4YL8 A;  5E6N A;  1NEK B;  4RF0 A;  3N1X C;  1SXT A;  4HWI B;  2LRU A;  4DWF A;  3EUB 2;  2Q5W D;  5JH5 C;  1V81 A;  2KDF B;  2PTL A;  3RNE C;  3LXF A;  1ZGU B;  1D5X C;  4USA A;  2SEB D;  3I57 A;  3AE4 B;  1JRU A;  1IUE A;  3VVW B;  4S0R A;  2WXO A;  3AEB B;  3RNB C;  3VR8 B;  4NY0 A;  1PYW D;  2J42 A;  1T3Q A;  2ON8 A;  2BYV E;  2DBY A;  3OLM D;  1WGH A;  2PMV A;  4PT5 A;  2D3C A;  2N9P C;  4NQL B;  4ITK A;  1FO4 A;  2KWC A;  3LJ3 A;  1WXQ A;  2GBR A;  4JL9 A;  3U52 E;  2V9H A;  2L52 A;  3U2S C;  2D11 A;  3TL5 A;  1EWC A;  3DHH C;  3Q3O C;  3H9D A;  4BOS C;  1KM7 A;  1C4C A;  3KYD D;  2LJ5 A;  3NVV A;  1K52 A;  4FA6 A;  3QQ8 B;  2QSD A;  2JWZ A;  1TZO A;  4EFO A;  1UBI A;  2IY0 B;  2E6X A;  1XLN A;  1WX9 A;  5G5H A;  3AI5 A;  1YIW A;  3H6N A;  1ZKH A;  4G0N B;  5FR6 A;  3M63 B;  4LNO A;  3GB1 A;  2JU6 X;  3DBR I;  4KSL C;  3CST A;  2LGX A;  3O13 A;  1FMA D;  3OJ3 A;  1WXS A;  2V1Y A;  3L10 B;  1JW9 D;  3SFD B;  3ONS A;  2RGF A;  2M8S A;  3VXW A;  1FNU A;  2LGY A;  4TUU A;  2V3P A;  3N1Y C;  4WQM A;  1V5T A;  2BTE A;  1SE9 A;  1NYR A;  2LRW A;  3QJZ A;  3K9O B;  3ENE A;  3AV8 A;  1D3Z A;  1WXM A;  1GOZ A;  3DOW A;  4TV3 A;  5IA7 A;  2RD0 A;  1YJ1 A;  2W82 A;  1TY0 A;  4NNJ B;  1UF0 A;  1V97 A;  4B0M A;  3RUI B;  2BF8 B;  2SAK A;  4W9G A;  4OVZ A;  1KLG D;  2L76 A;  2G3Q B;  3B1L X;  4G3X B;  3KUD B;  3I3T B;  3AM9 A;  4N9F 4;  2VZK B;  4JPS A;  4B0E A;  2JY6 A;  4CQN A;  2K9X A;  2MEK A;  2BB6 A;  1E5W A;  1WYW B;  4ZOH C;  5L95 C;  1CZP A;  1MG4 A;  1RRB A;  1TJE A;  1JWB D;  2FIF A;  4C4V A;  1GNU A;  4HLE A;  5JZE B;  2BYT A;  2OED A;  2KN4 A;  2EKI A;  3CSF A;  2J0K A;  4OZA A;  2CR5 A;  4F7Z A;  1WM2 A;  2N9X A;  2BKF A;  3AE9 B;  3B2G A;  4ARI A;  2JYT A;  2Y5B B;  1XLP A;  2MHJ A;  1WR1 A;  3QC8 B;  4W9I A;  2FID A;  4KGR A;  1EF5 A;  4RF1 A;  1E7V A;  3A4R A;  3L08 A;  3ZRC A;  2ZNV C;  2L7R A;  3AE2 B;  5AZF A;  3L4P A;  4DXA B;  2KX3 A;  2WDT B;  3IFW B;  4AOF A;  1HEZ E;  4YT0 B;  4EUT A;  3TSS A;  4KKJ A;  3OAW A;  3MP9 A;  2QCZ A;  5AEK B;  3DVG Y;  2I38 A;  1RM6 C;  2FBW B;  2MLB A;  1OQQ A;  4N58 A;  4IWP A;  3Q8A A;  4ICV A;  2MX2 A;  4HDO A;  3BY4 B;  3P4Q B;  3I5J C;  4EEW A;  3LB8 C;  2WX1 A;  2KJR A;  4M0W A;  1LQB A;  3B0A A;  2NCN A;  5IKC M;  4NJC A;  5FR3 A;  3IT4 B;  3MTN B;  4MJS B;  5C3J B;  2IPK D;  1Q10 A;  5I4D A;  2IBI B;  2O6V A;  4IWO A;  4GSW A;  2QC8 A;  5CHV C;  1WJ4 A;  1WXV A;  2NS5 A;  3PLU A;  5HI1 A;  4RGT A;  4W9H A;  4OHJ A;  4C56 C;  3ZTD A;  1SIF A;  2CU3 A;  3TUO A;  2WX0 A;  3RZW C;  3BII D;  3WIM A;  1FEH A;  1VDV A;  1ZDV A;  4FUL A;  3AMZ A;  4FLH A;  1D6E C;  3U7D A;  1UZX B;  3DQV A;  1LGR A;  4DQO C;  1VZ6 A;  4YSX B;  4US9 A;  3GE3 C;  1I42 A;  2JT4 B;  2Y5P A;  1F9J A;  3AUL A;  5TR5 A;  1ZOY B;  4QAY A;  4GDK B;  1SJE D;  2MW5 A;  1R4N I;  1J7A A;  1XCQ L;  4II3 B;  2ZCC A;  1WJU A;  2R61 A;  4N6E B;  5J17 A;  2KDB A;  3ZRF A;  1L6U A;  2MBB B;  1UWX A;  2C7N B;  3FIL B;  2D3G A;  2LEK A;  5FKA C;  1B9R A;  3VQI A;  3RFZ B;  3MC9 A;  3N32 A;  1C1Y B;  1C3T A;  3L13 A;  1SF0 A;  2BB5 A;  3HHM A;  2IGD A;  3Q6B A;  3ZXR A;  2KLG A;  4DXG A;  2IY1 B;  5IAA C;  1F1H A;  2KK8 A;  3AEF B;  1FRR A;  1YJI A;  2KMM A;  1U4A A;  2OJW A;  4MH8 A;  2Z0D B;  4TKN A;  4WAF A;  1TIF A;  1TS5 A;  3C19 A;  3TEW A;  1N63 A;  3AEG B;  2NTS A;  2MRP A;  3ZVV A;  4KDI C;  3APF A;  2AYO B;  3Q8C A;  1FXT B;  1UNS A;  3O65 B;  1LM8 B;  2B3A A;  2K1F A;  4NAW B;  3JW0 X;  1KOT A;  2DYB A;  3UF8 A;  3GP7 A;  3NVW A;  3GE8 C;  2M0X A;  2J0M A;  4DDI D;  1EWY C;  2W3R A;  3ZDM C;  2GBN A;  1YN4 A;  2KFK B;  3VTV A;  4NJ7 A;  1H8C A;  2K3U A;  1MPE A;  4AUQ C;  4BVU C;  1F0Z A;  4RM9 A;  4NAW A;  2DYM A;  4R3D A;  1TY2 A;  3L0W B;  1T5X D;  3EHV A;  1K51 A;  3ZDT A;  5CX3 A;  1WJ6 A;  2C5L C;  2ZCB A;  2KX0 A;  3KUC B;  5BYS A;  1AW7 A;  2NBW B;  3OG5 A;  5EE3 A;  1FCC C;  4ICU A;  3VUW A;  2L83 A;  4MSM B;  1TS4 A;  3QHT A;  1AAR A;  4LDT B;  1B1Z A;  4FJZ A;  3S2A A;  4EOY A;  3DCG A;  4N59 A;  3N1Z C;  2N1W A;  1NYQ A;  1HZ5 A;  4MH0 E;  3AEA B;  1KFY B;  4EE2 A;  2DWQ A;  4I6N B;  2WYQ A;  2L1A A;  3SDL C;  2FUG 1;  5GXG B;  1V9J A;  2G4S A;  4PS8 A;  2DZM A;  4IC7 B;  1L4Z B;  1LXD A;  3EA6 A;  2I1K A;  3PRE A;  3ZXV A;  1SB3 C;  2GOW A;  1JWA D;  1N6Z A;  2M19 A;  1G6J A;  1QT9 A;  4A90 A;  4JE3 B;  2MSE D;  2DX5 B;  4WAA A;  1T0Q C;  2KNB A;  5D6J B;  5LXI B;  3AEC B;  3RYT A;  3Q8B A;  2MJ3 A;  4A6Q A;  2O6V D;  5E6P A;  4RH6 A;  5IO9 A;  2KQ4 X;  1VJK A;  3NHE B;  1V6E A;  2JXT A;  3ABV B;  2H88 B;  2BT6 A;  1DOY A;  1PFD A;  1VLB A;  3R7R A;  3NG0 A;  2Y3A A;  1GG3 A;  1KJT A;  2KDE B;  3HM6 X;  3Q14 C;  2JX5 A;  5DPT A;  1L4D B;  2LGI A;  1WWT A;  1C77 A;  1GPX A;  2KJ6 A;  4JWS C;  4FXC A;  2W55 A;  1BUI C;  1WGY A;  2QJL A;  3GZN I;  2BWF A;  1Z2M A;  1FM0 D;  2ZW0 A;  3HUI A;  1FNV A;  3EEC A;  2LD9 A;  1Y56 A;  4LJO B;  1CMX B;  2C7M B;  2LVP A;  3DBL B;  1AYF A;  2LGS A;  5J2R A;  1STE A;  1EM7 A;  1OEY A;  2FAZ A;  1F52 A;  4IM3 A;  2N9E B;  3CWI A;  2NR2 A;  2WDQ B;  2RDH A;  4B6W A;  2FCM A;  1AWD A;  4K81 A;  2BS3 B;  2KAN A;  3OWE B;  4M00 A;  1Z5S B;  4MT5 A;  1C9F A;  4P1C C;  1D5Z C;  3PTF C;  4TSS A;  3W1S A;  4A3O A;  3QCA A;  1QLB B;  3ZKJ C;  2JZ3 B;  2ACZ B;  2IGG A;  1L5P A;  1T0Y A;  1FFV A;  4WWN A;  4HDQ A;  3SR6 A;  5E6O A;  3JVZ X;  4HPP A;  2WXH A;  4HRS A;  2KDM A;  2I1J A;  3VHT C;  4W9C A;  3FC4 A;  3KUZ A;  5BO4 B;  1JAL A;  1YNT E;  1I4Q A;  2KAJ A;  4K7W A;  2NVU I;  4KX6 B;  3WAN A;  3N9Y C;  2PVO D;  1NVI D;  2KZR A;  5BYR A; 
#chains in the Genus database with same CATH homology
 1V2Y A;  2KWU B;  2KFJ A;  2NBV B;  2IYD B;  2KXJ A;  3ZIM A;  3QAR A;  3UIP B;  1Q0W B;  2JY6 A;  1P1A A;  2OOB B;  1ZW7 A;  4DDG D;  1E5W A;  1WYW B;  3UGB B;  5L95 C;  3ML9 A;  3TJP A;  3ZNH B;  2JF5 A;  1YD8 U;  3JSV B;  4GB9 A;  1V86 A;  1RRB A;  2NBU A;  4HCP B;  4LJP B;  4MJS A;  4AJW A;  2PE9 A;  2FIF A;  1Q5W B;  1RAX A;  5JHB A;  1EUV B;  1GNU A;  4HLE A;  3U8Z A;  2O6V B;  4IG7 B;  4WJP A;  2KLC A;  5JZE B;  1YX6 B;  2L05 A;  2G4D B;  3CSF A;  2KN5 A;  3EFU A;  2JPH A;  4LDT D;  5DPR A;  2J0K A;  2CR5 A;  4G11 A;  2A5U A;  4F7Z A;  1WM2 A;  2N9X A;  2L3Z A;  3APC A;  4FN2 A;  2BPS A;  1TGZ B;  2O2V A;  3QA8 A;  2BKF A;  1P3Q U;  4IWQ A;  1K8R B;  4MGI E;  2Y5B B;  1IYF A;  2R2Q A;  1L2N A;  4JLC A;  3RCZ A;  4ANV A;  2KVR A;  4WJO A;  4A20 A;  2G45 B;  4OVV A;  1WR1 A;  2CHX A;  2MP2 B;  5KHQ A;  2PE6 B;  3QC8 B;  4W9I A;  2FID A;  1EF5 A;  2MWS B;  4BKS D;  1E7V A;  5CTR C;  3A4R A;  3OJ4 B;  3L08 A;  3NZU A;  1WM3 A;  4W9J A;  3ZRC A;  5JHA A;  2HJ8 A;  2ZNV C;  2L7R A;  5AZF A;  2RR9 A;  4DXA B;  2L8J A;  2KX3 A;  2WDT B;  3IFW B;  3N3K B;  3VTW A;  1E8Z A;  2K39 A;  4AOF A;  1WZ0 A;  4I6P A;  3PVL A;  3EC8 A;  3PRZ A;  4EUT A;  3WAO A;  3OAW A;  2KO3 A;  4X57 B;  4TQ1 A;  2EKE C;  5AEK B;  3DVG Y;  4MGY E;  1M94 A;  4CO7 A;  2LZ6 A;  1GJZ A;  3DBH I;  1WX7 A;  1UBQ A;  3H1U A;  3ALB A;  2DEN B;  3DBS A;  1Q1O A;  3M3J A;  1UEL A;  2MLB A;  5GMV A;  1OTR B;  1J19 A;  1WH3 A;  3APD A;  2CU1 A;  4IWP A;  1V5O A;  2NPT B;  4KIK B;  4ICV A;  4HK2 A;  2MX2 A;  1EO6 A;  2MP2 A;  4HDO A;  3PV1 A;  5DPW A;  3BY4 B;  1A5R A;  2JVC A;  4FJY A;  2D10 A;  4GIV A;  2ZPN A;  3ZO5 B;  2D2Q A;  2KOX A;  4N9F 4;  4EEW A;  1VD2 A;  3IBE A;  2WX1 A;  2C60 A;  2GBM A;  4W9E A;  3TBL D;  3VFK A;  1I35 A;  2KJR A;  4W9D A;  1LQB A;  3QK0 A;  3ZNZ B;  3B0A A;  4CYE A;  2HD5 B;  3SU8 X;  2NCN A;  4NPN A;  2YLM A;  4IUM B;  3KYC D;  1OEY J;  2O2V B;  2Z59 B;  5LLI A;  3SD5 A;  2QHO A;  3SHQ A;  4GU2 A;  2ZZP B;  5C23 A;  3MTN B;  4BBN C;  2CKH B;  1RFA A;  4MJS B;  4W9F A;  3DPD A;  2K6Q A;  3ZNI D;  1QZE A;  2V3S A;  4DHZ E;  4HVB A;  2IBI B;  3VUX A;  2O6V A;  2K8H A;  4IWO A;  2LI5 A;  3M95 A;  2LXA A;  1XT9 B;  3LDZ E;  4GSW A;  5L83 A;  1Y8R C;  3JSV A;  5CHV C;  3RD2 A;  1WJ4 A;  1WXV A;  2FUH B;  5AZG A;  1TBE A;  2NS5 A;  1WE7 A;  1IPG A;  3PLU A;  3JYU A;  4W9H A;  2KJH B;  3ZTD A;  4RM8 A;  1SIF A;  2DAJ A;  4HXD A;  5CHW A;  3C0R B;  3RT3 B;  5EDS A;  5HKH A;  2WX0 A;  3RZW C;  3PLV A;  4K1R B;  1WE6 A;  4JQW C;  4RMA A;  3RZF A;  3T9L A;  3WIM A;  4MSQ B;  4FUL A;  4KZC A;  4FLH A;  4MDK E;  3U7D A;  1UZX B;  4WJQ A;  2ZJD A;  4PS7 A;  4DHZ B;  3DQV A;  2M1M A;  2DZI A;  2JXX A;  3QX1 A;  4I6L B;  3U30 A;  2DYO A;  2DZJ A;  5D7G A;  2C9W B;  2PPH A;  1J8C A;  3DBL I;  4BKT A;  1I42 A;  2ZEQ A;  3R7Q A;  2JT4 B;  3NOB A;  1E8X A;  3PPA A;  1F9J A;  5CHF A;  2AWT A;  3T8M A;  2KQ7 A;  4KZ0 A;  4MGZ E;  3AUL A;  2GMI C;  5TR5 A;  1UGM A;  4GDK B;  2JRI B;  3PGE A;  1WXA A;  1R4N I;  2MW5 A;  3Q3J A;  4IM0 A;  4II3 B;  2D07 B;  1UH6 A;  4PYU A;  2K8C A;  4K7S A;  2IO3 B;  2UYZ B;  2ZCC A;  2ZPY A;  1WJU A;  4ZDV A;  1UD7 A;  2NPT A;  2KDB A;  3A33 B;  4KIK A;  5J17 A;  3ZRF A;  1E8W A;  2OJR A;  3V6C B;  3R3M A;  5G55 A;  3ZUN A;  2PEA A;  1XD3 B;  2LGD A;  2MBB B;  3QWZ B;  2C7N B;  2JZZ A;  2EMS A;  2KTR B;  2LUE A;  2V4L A;  1BT0 A;  4NJ6 A;  2D3G A;  2REX A;  2A4Z A;  3UIN B;  2MBQ A;  1L7Y A;  2XK5 B;  2N1V A;  4MM3 A;  2M17 A;  3VQI A;  2KMA A;  2L0T A;  4HPL B;  3ZTC A;  3H7S A;  3VAW A;  2CHW A;  3N32 A;  1C1Y B;  1WMH A;  3W1Y A;  4BBN F;  3HK0 A;  1C3T A;  3L13 A;  3PHX B;  3V62 A;  3CF6 E;  3HHM A;  1WGR A;  5DCN A;  2IZV B;  3GOE A;  4E3C A;  2KLG A;  2IY1 B;  2MBO A;  5IAA C;  3V6E B;  2VRR B;  2KK8 A;  4MGK E;  1SGH A;  4ANU A;  4BFR A;  2RPQ A;  4GMV A;  1U4A A;  4AWJ A;  1NBF C;  2EMT A;  3IHP C;  3KH0 A;  2Z0D B;  3CMM B;  2MCN B;  4DHJ D;  4TKN A;  2MBH A;  4LCD E;  4BKS A;  1WRD B;  3A9J B;  4EKU A;  4F8C B;  4CHK A;  4P7I A;  1P0R A;  2XBB C;  2W9N A;  3PZD A;  2MRP A;  1EF1 A;  4F1S A;  4KDI C;  1YQB A;  3APF A;  4DK5 A;  2AYO B;  2AL6 A;  4FHK A;  2BWE S;  1FXT B;  4OVU A;  2BYF A;  3A4S C;  3MHS D;  3O65 B;  1LM8 B;  2B3A A;  2FCN A;  2K1F A;  3DVN V;  3JW0 X;  4NAW B;  4W9L A;  1KOT A;  2DYB A;  3UF8 A;  1WMH B;  2XEW A;  1WZ3 A;  3AU5 A;  4NQK E;  2M0X A;  5C1Z A;  2J0M A;  3NZS A;  3P2B A;  3TCA A;  3V60 A;  4DDI D;  3AXC A;  3ZDM C;  3L54 A;  4ZRI A;  2HE7 A;  2GBN A;  3PT2 B;  2K25 A;  3H7P A;  2LVO A;  4EZL A;  2KC1 A;  3H7P B;  2KFK B;  3VTV A;  4NJ7 A;  1H8C A;  1V49 A;  2M4N A;  1TTN A;  4AUQ C;  4BVU C;  4RM9 A;  4ASW C;  4NAW A;  2DYM A;  4GN1 A;  4II2 B;  3IG3 A;  2ZVO A;  3L0W B;  3EHV A;  3ZDT A;  3ML8 A;  3A1Q A;  5DPS A;  3L17 A;  5CX3 A;  1WJ6 A;  2C5L C;  4PS3 A;  2IO1 B;  4FJV B;  3W1S C;  2ZCB A;  4AP4 C;  1WFY A;  4E74 A;  2CHZ A;  2KWV B;  3QIJ A;  4XC2 A;  4B95 A;  2KX0 A;  4ZYN A;  2KQS A;  5LXH A;  4GGQ A;  1MG8 A;  3PRP B;  3VUY A;  3KUC B;  2IO0 B;  3PSE B;  2NBW B;  1OQY A;  4G50 A;  5J18 A;  2ZVN A;  3HM3 A;  4JIO U;  4ICU A;  3VUW A;  3A9K A;  1TZ1 A;  2KD0 A;  1WJN A;  3AU4 A;  4MSM B;  3PRM B;  3VDZ A;  3QHT A;  2LXC A;  3M62 B;  1AAR A;  2KKC A;  1WX8 A;  2N4F A;  4LDT B;  2JRH A;  4A3P A;  4FJZ A;  3DVG X;  2L00 B;  3S2A A;  1WI0 A;  2KC2 A;  4B9K A;  2MQJ A;  4EOY A;  3DCG A;  4PYZ A;  2ASQ A;  2BKR B;  4M8M A;  1GC7 A;  3A1Q B;  2N1W A;  3B08 A;  2KMC A;  2KTF A;  4YL8 A;  4MH0 E;  2CS4 A;  3D32 A;  1R4M I;  5D2M B;  5E6N A;  3WA0 A;  4JGH B;  4ANX A;  2KFK A;  3A9J A;  3HIZ A;  3V61 A;  4I6N B;  1XQQ A;  2RSU A;  2WYQ A;  4HWI B;  4EZJ A;  2LRU A;  4DWF A;  3SDL C;  1HE8 A;  4FHJ A;  4XZ4 A;  5JH5 C;  3NS8 A;  1V81 A;  1V9J A;  2KDF B;  4EZK A;  2G4S A;  1J0G A;  4PS8 A;  2DZM A;  4IC7 B;  2DAF A;  1LXD A;  1YX5 B;  1ZGU B;  3Q3F A;  2I1K A;  3PRE A;  4HCN B;  1JRU A;  2Z0E B;  2DHZ A;  1V80 A;  2GOW A;  3ZNG C;  4GDL A;  1G6J A;  5AZH A;  3VVW B;  5D94 A;  1NDD A;  4BKG A;  1WF9 A;  2MSE D;  4MEL A;  4NY0 A;  1E8Y A;  2DX5 B;  3PHW B;  4WAA A;  1PQS A;  4ZRK A;  4W9K A;  2BYV E;  2FCS A;  3OLM D;  1WGH A;  3L16 A;  2KNB A;  5D6J B;  3X0W A;  1KLV A;  2N9P C;  2IO2 B;  5LXI B;  4NQL B;  3QAQ A;  3RYT A;  2KWC A;  4GDL B;  3LJ3 A;  4WQO B;  1LFD A;  4KV2 A;  1VCB A;  4ANW A;  2GBR A;  2KDI A;  4JL9 A;  1H4R A;  2O6V D;  5E6P A;  1OGW A;  4KVG B;  2N7D A;  2HTH A;  2KTR A;  1X1M A;  3NHE B;  1V6E A;  4WWP A;  4E71 A;  1RLF A;  2D11 A;  2GBJ A;  2LVQ A;  3TL5 A;  3MJW A;  2PJH A;  2AEH A;  2UWQ A;  3H9D A;  1E7U A;  3R7R A;  4HPM B;  3WAP A;  4BOS C;  2YVC A;  4IM2 A;  3UQB A;  1GG3 A;  3VH4 B;  3IVF A;  4GDK A;  3ECI A;  1KJT A;  2KDE B;  1KM7 A;  5G2N A;  2GBK A;  3WAM A;  3KYD D;  1S1Q B;  2LJ5 A;  5KHO A;  3HM6 X;  4KDL B;  2BGF A;  4GOC A;  5DPT A;  4FA6 A;  1GUA B;  1IP9 A;  3RUL A;  3KVF B;  3QQ8 B;  2JWZ A;  4J6I A;  4EFO A;  1UBI A;  2KJ6 A;  2IY0 B;  2JUO A;  2ZNV B;  1P98 A;  2J7Q B;  3N30 A;  4HJK A;  3A9K B;  1WGY A;  4DHJ B;  3GZN I;  3VTU A;  1WX9 A;  2BWF A;  1Z2M A;  4MEM A;  3AI5 A;  2WWZ A;  1YIW A;  4DBG A;  3H6N A;  4K7U A;  1P9D U;  1ZKH A;  4G0N B;  5FR6 A;  3M63 B;  3PS6 A;  3BIN A;  3EEC A;  4AJY B;  2LD9 A;  3DBR I;  4URK A;  2MBE A;  3NY5 A;  4KSL C;  4LJO B;  2LWP A;  3CST A;  4M8N A;  1CMX B;  2C7M B;  4WWO A;  2LVP A;  2LGX A;  3OJ3 A;  1WXS A;  2XK5 A;  5J2R A;  3DVN U;  1OEY A;  2FAZ A;  1S3S G;  2C7H A;  2KHW B;  2N9E B;  2V1Y A;  3L10 B;  4GXB A;  4IM3 A;  2NR2 A;  3ONS A;  1GC6 A;  2K6D B;  3ZLZ A;  4XX5 A;  2RGF A;  2M8S A;  1WR6 E;  3VXW A;  4B6W A;  4ZRJ A;  2LGY A;  2FCM A;  4TUU A;  1WY8 A;  4K81 A;  4BOZ B;  3UQA A;  4FAD A;  4KSK C;  2KAN A;  1V5T A;  1Z5S B;  2K8B A;  3R66 C;  2N7E A;  1SE9 A;  3W1S A;  4A3O A;  2J0J A;  3PTF C;  2LAS A;  3TIX A;  1NI2 A;  1WIA A;  4M0W B;  2LRW A;  3QCA A;  3QJZ A;  3ZKJ C;  3K9O B;  2JZ3 B;  3ZW3 A;  3ENE A;  1WGD A;  1D3Z A;  2L0F A;  4FBJ B;  1WXM A;  1T0Y A;  2BYE A;  4IW0 A;  3K9P B;  4WWN A;  4HDQ A;  3UIO B;  2FCQ A;  3DOW A;  4TV3 A;  5IA7 A;  2RD0 A;  1YJ1 A;  4TQ0 A;  5E6O A;  3KW5 B;  3JVZ X;  4WJN A;  3TMP B;  2MA9 B;  4NNJ B;  2I1J A;  3VHT C;  4W9C A;  3VH3 B;  3RUI B;  2BF8 B;  2AL3 A;  3KUZ A;  3X23 A;  4W9G A;  2R2O A;  5BO4 B;  3WAL A;  1WGG A;  4K7W A;  2NVU I;  2L76 A;  2G3Q B;  3B1L X;  1E90 A;  3KUD B;  2FNJ B;  4G3X B;  3WAN A;  3I3T B;  2KZR A;  3DDC B;  2DZK A;  3ZVV A;  1ISN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...