1I7HA

Crystal sturcuture of fdx
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
109
structure length
109
Chain Sequence
PKIVILPHQDLCPDGAVLEANSGETILDAALRNGIEIEHACEKSCACTTCHCIVREGFDSLPESSEQEDDMLDKAWGLEPESRLSCQARVTDEDLVVEIPRYTINHARE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Electron transport
molecule keywords FERREDOXIN
publication title Crystal structure of Escherichia coli Fdx, an adrenodoxin-type ferredoxin involved in the assembly of iron-sulfur clusters.
pubmed doi rcsb
source organism Escherichia coli
total genus 27
structure length 109
sequence length 109
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2001-03-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00111 Fer2 2Fe-2S iron-sulfur cluster binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1i7hA00
1QOGA 1E10A 1TKGA 3AEEB 1N60A 3AEDB 2H89B 2M56B 1WYGA 3AE4B 5H92C 1DGJA 1JWAD 1QOAA 1RYJA 3LB8C 1EWYC 1A70A 2HTME 2B76B 4WWMA 4ZHPA 4LTUA 1KFYB 1I7HA 1OFFA 2WLBA 2G1EA 1JWBD 1FFVA 3AE1B 5EE9A 1WWTA 1N62A 1XLQA 2WP9B 3NRZA 1T3QA 1SF0A 3AE3B 5AUIA 2BS4B 2WS3B 1JW9D 3CWIA 1NI3A 3FAHA 1J7CA 1SB3C 1ZP0B 2QIEB 3KWLA 4KX6B 5AUKA 1YJIA 2E3TA 3HVZA 4N59A 1KRHA 4YTNB 3NVZA 1TKEA 3ETRA 1N5WA 1VDVA 1E7PB 1UWMA 2N0SB 3ABVB 1FO4A 1DOIA 3P63A 2WU2B 3AB5A 4JWSC 1CZPA 3SFEB 2H88B 1E6EB 2W3RA 5EE0A 4P6VF 3P4RB 2Q5WD 1F0ZA 3AH7A 1E9MA 3AE7B 4ZHOA 3BIID 2WDRB 1NYQA 2DWQA 3HRDD 4JX1C 3AE2B 4US9A 3AE6B 1NEKB 2MJ3A 3L4PA 3P1MA 1GAQB 3CIRB 1OQRA 3DWGC 2AX5A 4YTMB 2W54A 2PVGC 3VRBB 1QOBA 2KMMA 1KF6B 1YJJA 1FRDA 3NVVA 1YQ4B 1RM6C 1JALA 1ROEA 3RPFC 1PUTA 3B9JA 1J7BA 4N58A 4ZOHC 4A9AA 3WCQA 2WU5B 3B2FA 1JQ4A 2PKOA 2LEKA 3AM9A 4ITKA 1FFUA 1L5PA 3B2GA 1VLBA 1FXAA 2BS3B 2FBWB 2JQRB 2MH7A 2JX5A 3W5UB 1RFKA 2W3SA 5G5HA 2MJEA 1FRRA 2QJLA 1FIQA 1L0VB 4YXDB 4HRSA 3P4QB 1IUEA 2CJOA 1NYRA 1J7AA 3PO0A 2CJNA 2DBYA 2OHFA 3DWMA 4YT0B 1B9RA 3SR6A 5C3JB 2WDQB 2L83A 1TYGB 2BS2B 1WGKA 5EE3A 1TJEA 3VR9B 1VJKA 1OQQA 1L6UA 1ZXIA 1AWDA 2MJDA 3AMZA 4YSXB 1RWSA 1V8CA 2WDVB 3EUB2 1XLOA 3P4SB 5G5GA 1GPXA 1PDXA 3SFDB 3VRAB 3P4PB 1DOXA 3AEBB 1QLBB 5MPOA 3VR8B 3W5VB 4FXCA 2K22A 2PVOD 3AE8B 3AECB 4HROA 3NVWA 1WRIA 5GXGB 4US8A 1YQ3B 4JWUC 3W9CB 2WQYB 1NENB 4C7ZA 2ACZB 1FMAD 1JROA 1R7SA 1ZOYB 2M19A 3AEFB 4WQMA 5EE1A 5H8YE 4C7YA 3LXFA 2W55A 1QOFA 1V97A 1NVID 3AEAB 4YTPB 3AE9B 1WXQA 5C2TB 2K9XA 1TKYA 4IDIA 4N6EB 1SIJA 2PIAA 1XO3A 2BT6A 1AYFA 2L52A 1N61A 1N63A 1ZUD2 3NVYA 1L6VA 1XLPA 1CJEA 3HUIA 3AN1A 1FM0D 2Y5CA 3AEGB 1N5XA 1XLNA 2CU3A 3AV8A 4USAA 4C80A 1QF6A 2EKIA 1PFDA 2K5PA 3AE5B 4YSYB 2KAJA 3FC4A 1E0ZA 1FXIA 4YSZB 1JRPA 3ZYYX 1QT9A 3NS1A 1DOYA
chains in the Genus database with same CATH superfamily
5FK9C 1MG8A 2B3AA 3R66C 4HPPA 2MW5A 2K0PA 2AEHA 2ICIA 1LO5D 2MBBB 1CQVA 3NZUA 2AL6A 2C7MB 2QEJC 4DHJB 3VRAB 3ZGZA 2LVOA 1ZP0B 2JZ3B 2KTFA 1TY0A 5E6PA 1WXSA 3T3OA 4XYCA 4JIOU 1Z2MA 4YWGG 2J52A 2KLGA 2L32A 3IBEA 3R3MA 1NYQA 4US9A 5D94A 2GB1A 3I63C 2NVUI 3MTNB 1NI2A 2ZPNA 4DHJD 5CHWA 2LHDA 2A5UA 4A90A 3N1ZC 3IAM1 4ANXA 3WCQA 1JQ4A 3A9KA 3WA0A 2BVCA 4RMAA 2GLSA 1OEYA 2W3SA 2HJ1A 4NQLB 3EHVA 4MSMB 5KHOA 4A6QA 2PPHA 2RMMA 3ZJUA 1FCLA 2FIDA 4MELA 1I42A 2DYMA 2XEWA 4KGRA 1V8CA 4WURA 1GPXA 3SFDB 1GUAB 3VFKA 2WQYB 1NENB 4BOZB 2G45B 5EE1A 4B0MA 4GU2A 2W55A 1IP9A 2AQ1B 3H8HA 5FR3A 4XX5A 1ZGUB 2KJ6A 4KIKB 1TIFA 3PTFC 4WQOB 2BYTA 1SE2A 1T6BX 2D11A 2WXIA 3L10B 2EKIA 3PVLA 4RF1A 1JRPA 2BWFA 2KHWB 2M56B 2MRPA 2RGFA 2DLBA 1TZ1A 2N9KA 4DWFA 1K50A 1UUPA 2N7JA 3WAOA 4EE2A 4WWMA 3Q8BA 2G1EA 3RCZA 5L83A 1S1QB 3QHTA 2CHZA 2WS3B 1VZ6A 2FCNA 4FULA 5HI1A 1XF5L 1C4PA 3NVZA 4AS1A 2TSSA 1GJZA 2GI9A 3H7SA 5G2NA 2JWZA 2LI5A 3Q8EA 1D5ZC 1KJTA 2CU1A 2W9NA 4XWWA 3PLUA 4ZRKA 3WANA 3PZ8A 4I6PA 5E6JA 2BGFA 2J7QB 2KWCA 3A9JA 1TS2A 2JVCA 2KMCA 1F77A 1L4ZB 3PHWB 4ZRQA 3BYTB 5GMVA 2CJOA 2I38A 4W9DA 3Q14C 2LGIA 1TJEA 1J8CA 2KDBA 2KN5A 1ZXIA 1HZ5A 2LGSA 1XLOA 4EZLA 3A1QB 5IA7A 1KOTA 4FXCA 1XCTL 1SE3A 5LXIB 2Y5BB 1EF1A 1WGDA 4ZRPA 3B1LX 3KLSX 1NVID 1G6JA 1XQQA 2D3CA 1XO3A 3QK0A 1ZUD2 2M0AA 2Z59B 1CK1A 2PE9A 4W9HA 4NPNA 3U8ZA 4MGZE 4W9FA 1QOGA 2BTEA 2MCNB 3DBLB 2IY0B 1WE7A 3ZNGC 3DBHI 3NHEB 1P9DU 2KJRA 2HJ8A 2QHOA 1KFYB 1WWTA 1GB1A 3AE3B 1HTOA 1MVKA 3WIMA 2RPQA 1KRHA 1D5XC 1SEBD 2BYEA 2IJ0A 1VDVA 3ZJTA 4GDLB 4IG7B 4AUQC 3AB5A 1WM3A 2FUG1 1L7YA 2W3RA 4Q2JA 2BBCA 3KUZA 3AE7B 3L08A 3MJWA 3L16A 5TR5A 1WH3A 3HIZA 4IWPA 1FNWA 2NMQA 3QIJA 5LNK1 1RAXA 1PUTA 2KWVB 2K8CA 2MH7A 4HXDA 2WXHA 1WJNA 1WYWB 4NAWB 4FJYA 2ASQA 4FN2A 1K51A 4M01A 2N1VA 5L95C 3PO0A 3C19A 2CJNA 1AN8A 3DWMA 1WZ3A 2L7RA 4IW0A 3UQBA 4ZRJA 2BS2B 2KX0A 1WGYA 4WAFA 1V6EA 2M8SA 1V1OA 1OTRB 3NJTA 1XXGA 2KOXA 4ZRIA 1UD7A 3LYYA 4FA6A 4LNNA 3EFCA 4HROA 2L0TA 3L13A 4GB9A 3AEFB 4FJVB 4WQMA 2K1FA 1HQRD 4K1RB 1WXQA 3L17A 1Y8RC 1XT9B 2ZPYA 3M62B 1AW7A 5IO9A 2L52A 4CO7A 4M0WB 2V0GA 1CJEA 5IAAC 2BW2A 2O2VA 4ANUA 3SHQA 1T0QC 3HM6X 5TSSA 3SDLC 3AEEB 2KNBA 4IC7B 3S2AA 2FCSA 3RMKC 4W9LA 1I4RA 1FEHA 1V81A 4N9F4 3RUIB 5BO4B 2CHWA 3BK1A 1PQSA 2EMTA 3EGRA 4MEMA 4DDGD 5JHAA 4KV2A 3NRZA 2BS4B 3ZIMA 1YD8U 2WU2B 3KW5B 3EECA 4K7WA 1SJHD 2V3SA 3NOBA 1EUVB 3J9CA 2D2QA 2ZCBA 1EO6A 2IGGA 2G9HD 2UYZB 3PZ7A 4G3XB 1KF6B 2BYFA 1GC6A 2KZRA 1JALA 4RM9A 2IO0B 1SIFA 4N58A 2FCMA 3FILA 3QQ8B 2BYVE 2JQRB 1DYQA 1E7UA 4YXDB 1IBXA 2D5GA 3W1SA 2L83A 5JH5C 2L8JA 1V1PB 5D3IB 5J18A 4EFOA 2ZVOA 3W1YA 5IOIA 3AXCA 4EEWA 5IP4D 3RNGC 4OW0A 3VR8B 4P7IA 3RFZB 3TEXA 4L2YA 5AEKB 1Q5WB 1L4DB 1OQYA 2K6QA 4C7ZA 4K7UA 3ML9A 3ZTCA 2AL3A 1V97A 2SEBD 4WJOA 4W9GA 4LDTB 3DBRB 4KZ0A 2Y5CA 1ZXHA 2KTRA 1TS3A 4G50A 1SJED 4P1BC 5LXHA 2PW9A 1QT9A 3I3TB 3IXSA 3ZLZA 3GZNI 4XWTA 1WYGA 3R7RA 2WXMA 3A4RA 1A70A 2B76B 1OFFA 4LDTD 4M02A 1V9JA 3VTUA 3AI5A 1GB4A 2FCQA 2QCZA 1YJIA 3HVZA 4OVUA 4LCDE 2JXXA 3TCAA 1DOIA 1P1AA 4MACA 2LMCA 4WJPA 2IYDB 2OJRA 3HRDD 2LASA 4EOYA 3KWVA 3DWGC 4A55A 3KH0A 5DPWA 1E8XA 2SAKA 2KX3A 1TGZB 2L00B 5D6JB 1WZ0A 3OJ4B 3T9LA 4BKSA 5AZGA 5BMHA 1WR1A 1FFUA 2BS3B 1RFKA 2MJEA 1TS4A 1RRBA 3NZSA 3VHTC 1RLFA 3O65B 2IO2B 4MDKE 2WDQB 2JRIB 2GOWA 2WDTB 3VR9B 3UGBB 2AYOB 1HXYD 3GB1A 3MFGA 2XK5A 3AEBB 2NBVB 5BYRA 2M0XA 2LHEA 1WIAA 2INCC 3C0RB 2ZNVC 1WJ4A 2LZ6A 1FMAD 1L0YB 4IUMB 2MX2A 3AEAB 3Q8CA 1Z5SB 3JVZX 2K9XA 2G4SA 3H1UA 1N61A 1C1YB 1UGJA 2K6DB 1C78A 3N20C 1UNSA 1RFAA 1XLNA 4F1SA 4YSYB 2QMTA 1OEYJ 2KAJA 2ON8A 4WWNA 3ZYYX 1YOVB 1E10A 3A33B 4DDID 1DGJA 3APFA 4LTUA 1I7HA 4KKJA 1YN5A 4DXAB 1SF0A 3CWIA 4B9KA 2Y5PA 3LJ3A 3QAQA 3ETRA 3QCAA 3CMMB 1ESFA 4DXGA 2WX0A 1WGHA 2KFJA 2R2OA 1PGBA 2N9PC 2GMIC 1WF9A 1UZXB 1YMHE 2DYBA 1P98A 1MJDA 2MJ3A 3BYYB 2KN4A 1WX9A 2WXKA 4C4VA 4I6LB 3P42A 3L0WB 1YQ4B 3HM3A 3T8MA 4AP4C 3V6CB 1YNTE 2KK8A 4KVGB 2V3PA 4M8NA 5KHQA 1VLBA 4GXBA 1WGRA 1FIQA 5HKHA 1TY2A 3MC9A 2OOBB 4W9IA 3ZO5B 4NJ6A 2BKRB 1CMXB 2INNE 3DVGX 5G5GA 4TUUA 4BOSC 2K22A 2K8HA 3AECB 3BZDB 5GXGB 3KYCD 4PT5A 1C4AA 3IVFA 3TJPA 4FHKA 1QOFA 1XCQL 4YTPB 3TSSA 2V1YA 3ZVVA 4N6EB 4EZJA 3VVWB 4HK2A 1ET9A 1GC7A 4IWOA 3EFUA 3BVMA 1N5XA 1WXVA 3U7ZA 4CQNA 2DHZA 3PGEA 4HWIB 1L6UA 1R4MB 1C79A 1TBEA 2WYQA 2RPVA 1QOAA 1EWYC 3R2IA 2VZKB 2L76A 1N62A 2V3NA 3Q8FA 1TKEA 2KWUB 3UIPB 1OGWA 1P0RA 1N5WA 1WY8A 1E7PB 5HHDG 1PGXA 1FO4A 3P63A 2WXRA 1CZPA 2O2VB 5EE0A 1A5RA 4YL8A 3P4RB 4IM0A 1E9MA 2WDRB 2CHXA 4HJKA 3PHXB 4AQ7A 2VZKD 3AE6B 2HTHA 3DBSA 1BMLC 4RCOA 2W54A 3VRBB 4XDCA 4PK1A 2KQ4X 2DYOA 3H7PB 1ZDVA 1I4HA 1XEEA 3QX1A 2JX5A 3DHIC 1U4AA 1YJ1A 4OVVA 3SEBA 1J7AA 4DXFA 1Q1OA 1E8YA 1I4PA 4MJSA 1YQBA 3KQ4A 4HKQA 3IT4B 2FE8A 1IGDA 1WRIA 1P7EA 3NG0A 3FILB 4BKGA 3AE9B 2KDFB 3CSFA 1N63A 3JSVB 2JYTA 4DBGA 2AQ3B 2ZVNA 1SXTA 3ZJVA 4AWJA 4HCPB 4TSSA 2LXAA 3AE5B 4JE3B 2WXOA 2L05A 4B95A 2C9WB 2KQSA 3ML8A 5LLIA 4EZKA 2WXGA 3QC8B 4URKA 1FFVA 1EM7A 4MH0E 4X57B 3ZKJC 2BWES 3ALBA 2KWDA 2LFIA 2KDMA 3V6EB 2KTRB 4P6VF 1SE9A 3AH7A 3VUXA 2J4XA 4PS8A 4FJZA 2BKFA 3HHMA 1GAQB 2KVRA 3DVNV 2KMMA 1NDDA 3NVVA 1JWUD 2LRUA 4ZOHC 2D3GA 2MBHA 4ITKA 2FBWB 3PRZA 3DVGY 1L0VB 4HRSA 2A4ZA 2OJWA 4PYUA 3TL5A 1WGGA 2OHFA 4RGNA 2UWQA 2GBRA 4RFBA 3RNAC 4LNKA 2KANA 3IHPC 4OHJA 4RGMA 2M17A 3WAPA 1EF5A 1LFDA 5J2RA 2RDBC 3IAS1 1LGRA 3P4PB 2W82A 1H4RA 3UQAA 4RM8A 4WH4A 3NS8A 4KDLB 1YQ3B 3TBLD 2ZJDA 1ISNA 3RNBC 1GNUA 1MHHE 2JZZA 4NJ7A 2PIAA 1ZKHA 1Q0WB 1VZ7A 4E3CA 3VH4B 4ZYSA 1QILA 4ARIA 1WMHA 1V86A 1JWSD 2G3QB 5D3DA 3Q3OC 4AJYB 5FR6A 2ONQA 3JYUA 4FHJA 4NY0A 2PMVA 4BKSD 2RDHA 2XK5B 1DOYA 1BXTA 2NR2A 4KGTA 1MPEA 3AE4B 2Z8LA 1RYJA 3HK0A 3QWZB 3Q6BA 4II3B 2KACA 4TMAB 3KWLA 4BAXA 2E3TA 4N59A 4TKNA 1WE6A 4UDUC 4TV3A 1D4BA 1WFYA 1MG4A 2KT7A 1WM2A 2V9HA 2LD9A 2NPTA 1MFWA 1L0XB 1B1ZA 1BUIC 4XC2A 1ET6A 1F9JA 2BB5A 3U2SC 2WWZA 4DK5A 2C7HA 2MLBA 3BWUD 3RPFC 3M3JA 3B2FA 5DPSA 2CS4A 4BBNF 2MSED 3AM9A 4F7ZA 2J0JA 3ZNID 1TT5B 2LJIA 1VRAB 3A4SC 3P4QB 4JGHB 2JPHA 5BYSA 1ZPSA 4YT0B 2C60A 4MSQB 5EE3A 3P2BA 1VJKA 3WALA 1WXAA 3MC0B 4HCNB 1PDXA 1F2RC 4RGTA 4LNOA 3ECIA 4WIPA 2LXCA 3RULA 1JROA 2M19A 4H2AA 2WNMA 4G0NB 3NVYA 2YEPB 4PS7A 1L6VA 3PRMB 3U4EG 1Y56A 2K25A 1P3QU 1XD3B 3U30A 2JT4B 3AV8A 3DPDA 4LJOB 3DBHB 3FC4A 2IPKD 2MBEA 3QA8A 1ACCA 1SBBB 3M95A 2IGDA 2WGSA 1J0GA 3A9KB 2KVZA 2PTLA 5EE9A 1S3SG 3B0AA 2WP9B 1HEZE 3IFWB 1NI3A 2ZW1A 1KTKA 1SB3C 3MP9A 4KX6B 4IWQA 3ZRCA 4NQKE 4NJCA 2KYWA 2RSUA 4R3DA 3PREA 2D3BA 2JF5A 4JWSC 3MHZA 3UI3A 3ZXVA 2MHJA 4IKGA 1J19A 2MQJA 3JW0X 3ENEA 5EDSA 2JWUA 2N1WA 5E6NA 5CHFA 2IGHA 3L4PA 2JZPA 3RT3B 2WHIA 4KKIA 1C77A 3AU4A 2PVGC 4OZBA 3APDA 3RYTA 4G11A 1AARA 1J7BA 2WXNA 1E90A 3Q3JA 3PS6A 2LUMA 3VXWA 3U52E 3ZNZB 4RNAA 3N3KB 5D2MB 2MJDA 4A8XC 3W5VB 3VTVA 1GG3A 3NVWA 4US8A 4JWUC 5E6OA 4J3OD 4MGYE 2ACZB 4BFRA 2EMSA 3C8YA 4KSKC 3N1YC 1XLPA 3AN1A 1M94A 1WX8A 3DQVA 2DAFA 4HDQA 2OEDA 1UBIA 3DOWA 3IT6B 2GRIA 3GP7A 1TKGA 4FBJB 3AEDB 4A20A 4KSLC 2AWTA 3A9JB 2KFKA 3LB8C 3RNCC 3EC8A 1FD6A 3PV1A 4ARCA 1T3QA 2EELA 4GDKA 2MP2A 4LNFA 3VAWA 4AOFA 4K81A 3ZQ4A 2K8BA 1WI0A 2REXA 1K53A 2H88B 1YX6B 1E6EB 4E74A 2DENB 2Q5WD 4NNJB 4M0WA 2M1MA 2O6VA 1NEKB 4HKZE 3P1MA 1OQRA 2ZCCA 1E8WA 2N7DA 3SU8X 1YIWA 1WX7A 3NUHB 2LEKA 1FNUA 3B2GA 4HJGE 4MGKE 4ANWA 2WXLA 2NS5A 1IUEA 1QZEA 1D3ZA 5IN7A 2L3ZA 1WGKA 4DHZE 2G4DB 1KM7A 3KUCB 1OQQA 2M4NA 2VH1A 4HEA1 3EUB2 3DHGC 2YEPF 1QLBB 3N32A 2N9LA 3L54A 4XE0A 1TS5A 1K8RB 3MJ5A 1DOXA 2GBJA 4PS3A 4E71A 2UU7A 4IDIA 2DZKA 4P16A 1SIJA 3Q3FA 2R61A 5C1ZA 1ENFA 3PZDA 4CHKA 3GZNB 4S0RA 1T0YA 1HTQA 4HLEA 1T0SC 5JZEB 5J17A 4S17A 1V1PA 3OJ3A 2X38A 4K3BA 1VZ8A 3TMPB 4LLGM 4GSWA 2KD0A 3DBLI 2LRWA 1J7CA 4I6NB 3SR6A 2EKEC 5BMGA 2BPSA 1C76A 3R2TA 3PSEB 3VQIA 1QQRA 1IYFA 2N0SB 2KMAA 2PLPA 1WMHB 2WXPA 3VUWA 4IM2A 1HZ6A 2MBOA 2LGXA 2QDFA 1YN4A 2IBIB 1V5OA 2DZIA 4ACFA 3QJZA 3V05A 4NZLB 3FKYA 2NTSA 1YN3A 4FADA 5BMIA 2J53A 1UWXA 4JPSA 2BB6A 2WU5B 3O13A 1L5PA 4MH8A 3I5JC 4L23A 2IZVB 2J0MA 2NPTB 2VH2A 1Q10A 1I35A 3TEYA 3QARA 3U7DA 5C3JB 2FIFA 3ZW3A 3E56A 1TYGB 2J0KA 4K3CA 1C4CA 1SGHA 3ZUNA 2WDVB 2QSDA 3SD5A 4ASWC 3RN9C 2IY1B 3V60A 3D32A 2VRRB 2IO1B 3W9CB 4F8CB 4CYEA 1ZOYB 5H8YE 3LXFA 1R4NB 5C23A 1SSNA 2C7NB 1AYFA 2JXTA 5CHVC 2Z0EB 1JMLA 4LK0M 2ZZPB 2KC1A 4USAA 1YX5B 2K5PA 1E8ZA 2JSVX 2KQ7A 4QAYA 1FXIA 4YSZB 2ZNVB 1N60A 4ZYNA 1QKZA 1WJ6A 4WJQA 1JRUA 4PYZA 2WLBA 3DVNU 1JWBD 2KXJA 3E9SA 1IBXB 5AUIA 1TZOA 3FAHA 4DQOC 5AUKA 1IPGA 1LXDA 5T8IA 3SFEB 3ZNHB 4MM3A 4HPLB 1F0ZA 1E7VA 3H9DA 4HDOA 4P1CC 2HE7A 4JX1C 3AE2B 1ZDXA 2I1JA 2JUOA 3GE8C 4OZAA 1EWCA 4REZA 3RNEC 4YTMB 2RD0A 4C00A 2DNFA 5JHBA 3X23A 3B9JA 1FNVA 3VH3B 4BVUC 3EA6A 4GIVA 3W5UB 5G5HA 2QJLA 1FRRA 2D3AA 3NY5A 1NYRA 4O1NA 2KO3A 1UH6A 3GE3C 1B9RA 2JYEA 1IGCA 4ICUA 3ZDTA 1PGAA 3AULA 3OAWA 4YSXB 1RWSA 3KYDD 3BK2A 4OZCA 2BQQA 1WJUA 5HFYA 2L1AA 2LGDA 2RDGA 4WJNA 3GOEA 3R7QA 4C7YA 3LDZE 1PYWD 3TUOA 5C2TB 2L0FA 2WXFA 1T5XD 4RH6A 4RGOS 5FKAC 1WXMA 2BT6A 4TQ1A 5DCNA 4L1BA 1C3TA 4ANVA 4XZ4A 3TIXA 3ZTDA 1VD2A 3W2DA 1FPYA 4GOCA 2WX1A 1BT0A 5DPTA 1PFDA 2HDEA 4ICVA 1V5TA 1TTNA 3DBRI 4LNIA 2I1KA 3RD2A 3M63B 4IM3A 1MHXA 1LM8B 2PJHA 2IO3B 4TQ0A 2HTME 1VCBA 4KDIC 4ZHPA 1WSPA 2GBNA 4GLSC 1V80A 1JCKB 1LQBA 3MHSD 1NBFC 4BKTA 3K9PB 1GOZA 2FAZA 3ABVB 2KDIA 1KH0A 3VUYA 2JY6A 3R8BA 4EUTA 2LVQA 1I4XA 4C56C 2RR9A 2FUHB 2MBQA 1D6EC 3CIRB 3OG5A 3ZDMC 1N6ZA 2AX5A 2KFKB 2LGYA 5DPRA 2N4FA 3BY4B 3T3NA 2LWPA 1FRDA 2D07B 1ROEA 2MEKA 3RZFA 4M00A 3UIOB 4A9AA 1I4GA 4GDKB 3HVDA 2MP2B 5BYQA 4KIKA 1ZW7A 1JWMD 1WR6E 2PE6B 2CR5A 2ZEQA 1HA5A 3BVGA 1I4QA 3Q69A 1AWDA 2O6VB 3N30A 4XGAB 5I4DA 3ZRFA 2N7EA 3NZ3A 4KGSA 2Z0DB 1FXTB 2I2YA 4WWPA 1HE8A 2KKCA 2KLCA 3AU5A 2QILA 2K3UA 3H7PA 2O6VD 4LJPB 1X1MA 2GBMA 3HUIA 3CF6E 2CU3A 1E5WA 3DCGA 2INDC 4C4VB 1T0RC 1E0ZA 3VTWA 3B08A 5JXVA 3BVZA 3RI7C 4WAAA 2Y3AA 1KLUD 3AE1B 3RNFC 1F1HA 2KJHB 3I57A 1XLQA 4IOIE 2WXQA 1JW9D 4YTNB 5D7GA 4JLCA 2XBBC 3GS2A 1UWMA 2IDYA 1UF0A 3URYA 5AZFA 3V3XA 3JSVA 3N1XC 2NCNA 1P7FA 1MI0A 3BIID 3UINB 1F2RI 2AQ2B 2NTTA 2MWSB 3A1QA 4MT5A 1M4VA 1RM6C 3Q8AA 4KZCA 3Q3NC 3I9V1 3Q2AC 3VDZA 2PKOA 1KLGD 1FXAA 3UF8A 3PRPB 3V61A 3WAMA 1FCCC 4FLHA 2C5LC 3V62A 4OVZA 4JQWC 1ZE3D 4JL9A 2ZW0A 3TEZA 3MC8A 3AMZA 3PT2B 4NAMA 5MPOA 2J42A 3AE8B 4GMVA 3DDCB 3K9OB 2K39A 3KUDB 4II2B 1EU3A 3KVFB 3OWEB 3ZXRA 1WRDB 2JRHA 2YVCA 1TKYA 2BF8B 1V49A 3TEWA 1VR9A 4W9CA 2DAJA 1V2YA 4DHZB 4GDLA 2DX5B 2KC2A 2V4IB 2DZJA 2PEAA 1QF6A 5IKCM 2CKHB 4GN1A 5AZHA 1D5MC 2LJ5A 3IG3A 2H89B 4W9EA 5G55A 2GBKA 5H92C 3CSTA 1JWAD 4ZDVA 1R4MI 2R2QA 1H8CA 2QIEB 4MJSB 2JU6X 4NAWA 3PPAA 1SE4A 5CTRC 1K52A 5CX3A 3DHHC 2INPE 2LVPA 2WXJA 2MA9B 4GGQA 4ZHOA 3ONSA 2DWQA 5HG2A 2NBWB 2X8XX 4A3PA 1QOBA 1UBQA 4BBNC 1YJJA 4EKUA 3OLMD 4BZAA 4W9JA 2V4LA 4RF0A 3X0WA 3Q3MC 4A3OA 2KDEB 2DZMA 4K7SA 2YLMA 3RZWC 1C9FA 1UELA 2DBYA 4J6IA 2QC8A 4HPMB 4MM3B 4HVBA 3W1SC 4B0EA 1F52A 1R4NI 1EU4A 4XDDA 1KLVA 3P4SB 4D2KA 2N9EB 2PVOD 2N9XA 1R7SA 3PLVA 1UGMA 2LUEA 2D10A 3N9YC 2XN9C 4MGIE 2NBUA 4AJWA 1L2NA 2FNJB 3APCA 3BINA 1FM0D 4B6WA 4W9KA 2XNAC 4WWOA 4C80A 2E6XA 4M8MA 1STEA 3H6NA 3AEGB 3NS1A 2HD5B
chains in the Genus database with same CATH topology
1BXTA 5FK9C 1N60A 4XWTA 4KGTA 1MPEA 1WYGA 1QKZA 3AE4B 2WXMA 2Z8LA 1RYJA 1A70A 2K0PA 2B76B 2ICIA 1LO5D 1OFFA 2WLBA 1JWBD 2KACA 1CQVA 3E9SA 1IBXB 5AUIA 2QEJC 1GB4A 1TZOA 4TMAB 3VRAB 3FAHA 3KWLA 3ZGZA 1ZP0B 4DQOC 5AUKA 1YJIA 2E3TA 3HVZA 4N59A 4UDUC 5T8IA 1TY0A 1D4BA 1DOIA 3SFEB 3T3OA 4MACA 1L0XB 2LMCA 1B1ZA 4YWGG 1F0ZA 2J52A 2L32A 1BUIC 1NYQA 3HRDD 4US9A 4JX1C 3AE2B 2GB1A 1ET6A 1ZDXA 3KWVA 3DWGC 3U2SC 2BB5A 2LHDA 1EWCA 4OZAA 4REZA 4A90A 4A55A 4YTMB 3IAM1 2SAKA 3BWUD 3RPFC 3B9JA 1FNVA 3WCQA 3B2FA 1JQ4A 3EA6A 5BMHA 3AM9A 1FFUA 2BS3B 3W5UB 1RFKA 2W3SA 5G5HA 2MJEA 1FRRA 2QJLA 2LJIA 1TS4A 1VRAB 3P4QB 1NYRA 4O1NA 5BYSA 1ZPSA 4YT0B 1B9RA 4A6QA 2RMMA 2JYEA 2WDQB 1IGCA 3ZJUA 5EE3A 1FCLA 3VR9B 2DYMA 1VJKA 1PGAA 4YSXB 1RWSA 4KGRA 1V8CA 1HXYD 3BK2A 3MC0B 4WURA 4OZCA 3GB1A 1PDXA 3MFGA 3SFDB 1F2RC 1GPXA 3AEBB 5BYRA 4RGTA 5HFYA 2LHEA 2L1AA 4WIPA 2WQYB 1NENB 2RDGA 1FMAD 1JROA 1L0YB 2M19A 4H2AA 5EE1A 4B0MA 4C7YA 2W55A 1PYWD 2AQ1B 3TUOA 3AEAB 3Q8CA 5C2TB 2K9XA 2WNMA 2WXFA 1T5XD 3H8HA 4RGOS 4RH6A 5FR3A 5FKAC 2BT6A 3NVYA 4TQ1A 1N61A 1UGJA 2YEPB 4L1BA 1C78A 1L6VA 3U4EG 1Y56A 3W2DA 1UNSA 2BYTA 1SE2A 1T6BX 1XLNA 2WXIA 3AV8A 2EKIA 1PFDA 2HDEA 4YSYB 2QMTA 2KAJA 2ON8A 3FC4A 4RF1A 2IPKD 1JRPA 3ZYYX 1E10A 2M56B 1ACCA 1SBBB 2IGDA 1MHXA 2DLBA 2N9KA 1DGJA 1K50A 1UUPA 2N7JA 4TQ0A 2HTME 4EE2A 4WWMA 4ZHPA 1WSPA 4LTUA 1I7HA 3Q8BA 4KKJA 2G1EA 2PTLA 5EE9A 1YN5A 4GLSC 2WP9B 1JCKB 1SF0A 3CWIA 1HEZE 2WS3B 1VZ6A 1NI3A 2Y5PA 2ZW1A 1KTKA 1SB3C 3MP9A 4KX6B 5HI1A 1XF5L 1C4PA 3NVZA 4AS1A 3ETRA 4NJCA 2TSSA 1GOZA 1ESFA 2GI9A 3ABVB 4DXGA 4R3DA 1KH0A 4JWSC 3R8BA 3MHZA 3UI3A 1PGBA 4IKGA 1I4XA 3Q8EA 4C56C 2JWUA 1D5ZC 1YMHE 4XWWA 2IGHA 2MJ3A 3L4PA 1D6EC 2JZPA 3CIRB 3BYYB 2AX5A 2KN4A 3PZ8A 5E6JA 2WXKA 4KKIA 1C77A 2PVGC 4OZBA 3T3NA 3P42A 1FRDA 1YQ4B 1ROEA 2MEKA 1J7BA 2WXNA 4A9AA 1YNTE 1I4GA 1TS2A 4GDKB 3HVDA 2V3PA 1VLBA 1F77A 1L4ZB 4ZRQA 3BYTB 2LUMA 1FIQA 2CJOA 5BYQA 2I38A 1TY2A 3U52E 1JWMD 4RNAA 1HA5A 2LGIA 1I4QA 1TJEA 3BVGA 2INNE 3Q69A 1ZXIA 1AWDA 2MJDA 1HZ5A 4A8XC 1XLOA 5G5GA 5I4DA 3W5VB 4FXCA 2K22A 1XCTL 3AECB 3NZ3A 3NVWA 1SE3A 3BZDB 4KGSA 5GXGB 4US8A 4JWUC 4J3OD 4PT5A 2ACZB 1C4AA 2I2YA 3C8YA 4ZRPA 1QOFA 1XCQL 1NVID 3KLSX 4YTPB 3TSSA 4N6EB 2QILA 2K3UA 1XO3A 1ZUD2 1XLPA 1ET9A 2M0AA 3HUIA 3AN1A 3BVMA 1CK1A 1N5XA 2CU3A 3U7ZA 4CQNA 3NS1A 2OEDA 1E0ZA 3IT6B 1L6UA 2GRIA 3GP7A 1QOGA 2BTEA 1TKGA 1C79A 3AEDB 5JXVA 3BVZA 2RPVA 1QOAA 3LB8C 1EWYC 3R2IA 1KFYB 2VZKB 2Y3AA 1KLUD 3AE1B 3I57A 1WWTA 1FD6A 1GB1A 1N62A 1XLQA 4IOIE 4ARCA 1T3QA 2V3NA 2WXQA 1MVKA 3AE3B 1JW9D 3Q8FA 2EELA 1KRHA 4YTNB 5D7GA 1TKEA 1D5XC 1SEBD 2IJ0A 3ZJTA 1N5WA 1VDVA 3ZQ4A 1E7PB 3GS2A 5HHDG 4GDLB 1PGXA 1UWMA 2IDYA 1FO4A 3P63A 3AB5A 1K53A 2WXRA 1CZPA 2FUG1 2H88B 3URYA 1E6EB 2W3RA 5EE0A 4Q2JA 3P4RB 2Q5WD 3V3XA 2BBCA 1E9MA 1P7FA 3AE7B 4M0WA 1MI0A 3BIID 2WDRB 1F2RI 4AQ7A 2VZKD 2AQ2B 3AE6B 1NEKB 4HKZE 3P1MA 2NTTA 1OQRA 1BMLC 1FNWA 4RCOA 2W54A 4MT5A 3VRBB 2NMQA 5LNK1 1M4VA 4XDCA 1RM6C 2KQ4X 1PUTA 2DYOA 3Q8AA 3I9V1 2PKOA 1KLGD 3NUHB 1ZDVA 2LEKA 1FNUA 3B2GA 4HJGE 1I4HA 1XEEA 1FXAA 2MH7A 2WXHA 2JX5A 4NAWB 2WXLA 1K51A 1FCCC 1IUEA 3PO0A 3SEBA 1J7AA 4DXFA 2CJNA 1AN8A 3DWMA 4OVZA 1I4PA 1ZE3D 2ZW0A 2BS2B 1WGKA 3TEZA 3KQ4A 4WAFA 4HKQA 1V1OA 1OQQA 4HEA1 3IT4B 3AMZA 1XXGA 3EUB2 4NAMA 2YEPF 3LYYA 1QLBB 5MPOA 2FE8A 1IGDA 2J42A 3AE8B 4HROA 1WRIA 2N9LA 1P7EA 4XE0A 1TS5A 3MJ5A 3AEFB 3FILB 1DOXA 1EU3A 4WQMA 1HQRD 3OWEB 3AE9B 1WXQA 1TKYA 4IDIA 4P16A 1AW7A 1SIJA 2L52A 2R61A 1N63A 3TEWA 1VR9A 2JYTA 2V0GA 1CJEA 2AQ3B 1ENFA 1SXTA 2BW2A 2V4IB 3ZJVA 3AEGB 4TSSA 1QF6A 3AE5B 4JE3B 5TSSA 2WXOA 1D5MC 3AEEB 2H89B 1V1PA 1I4RA 5H92C 1FEHA 1JWAD 2X38A 2WXGA 1VZ8A 4LLGM 3BK1A 1FFVA 3EGRA 3NRZA 1EM7A 2BS4B 1J7CA 3SR6A 2QIEB 5BMGA 1C76A 3R2TA 2JU6X 2KWDA 3VQIA 1QQRA 2N0SB 1SE4A 2LFIA 2PLPA 1K52A 2WU2B 2WXPA 2KDMA 2INPE 2WXJA 1HZ6A 4P6VF 3AH7A 1SJHD 4ZHOA 2J4XA 1YN4A 3J9CA 2DWQA 1GAQB 4NZLB 3V05A 5HG2A 2IGGA 2NTSA 1YN3A 2G9HD 1QOBA 3PZ7A 2KMMA 1KF6B 1YJJA 3NVVA 1JWUD 5BMIA 2J53A 1JALA 1UWXA 4RF0A 4N58A 4JPSA 2BB6A 4ZOHC 3FILA 2WU5B 4ITKA 3O13A 1L5PA 2JQRB 2FBWB 4MH8A 4L23A 1DYQA 1L0VB 4YXDB 4HRSA 1C9FA 1IBXA 2D5GA 2OHFA 2DBYA 1Q10A 4RGNA 3W1SA 3TEYA 4RFBA 4MM3B 5C3JB 3E56A 2L83A 1TYGB 4OHJA 4RGMA 1V1PB 5D3IB 4B0EA 1C4CA 1EU4A 4XDDA 2WDVB 2QSDA 3P4SB 4D2KA 3IAS1 3P4PB 2W82A 3VR8B 4OW0A 3RFZB 2PVOD 4WH4A 3TEXA 1YQ3B 4L2YA 3W9CB 1L4DB 4C7ZA 1R7SA 1ZOYB 5H8YE 3LXFA 1V97A 2SEBD 3N9YC 2XN9C 1MHHE 1SSNA 2PIAA 1VZ7A 1AYFA 2JXTA 1JMLA 4ZYSA 1QILA 4ARIA 1FM0D 2Y5CA 4LK0M 1JWSD 4USAA 2XNAC 5D3DA 1ZXHA 4C80A 2E6XA 1TS3A 2K5PA 1SJED 2JSVX 2ONQA 1STEA 1FXIA 2PMVA 4YSZB 2PW9A 1QT9A 2RDHA 3IXSA 1DOYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1QOG A;  1E10 A;  1TKG A;  3AEE B;  1N60 A;  3AED B;  2H89 B;  2M56 B;  1WYG A;  3AE4 B;  5H92 C;  1DGJ A;  1JWA D;  1QOA A;  1RYJ A;  3LB8 C;  1EWY C;  1A70 A;  2HTM E;  2B76 B;  4WWM A;  4ZHP A;  4LTU A;  1KFY B;  1I7H A;  1OFF A;  2WLB A;  2G1E A;  1JWB D;  1FFV A;  3AE1 B;  5EE9 A;  1WWT A;  1N62 A;  1XLQ A;  2WP9 B;  3NRZ A;  1T3Q A;  1SF0 A;  3AE3 B;  5AUI A;  2BS4 B;  2WS3 B;  1JW9 D;  3CWI A;  1NI3 A;  3FAH A;  1J7C A;  1SB3 C;  1ZP0 B;  2QIE B;  3KWL A;  4KX6 B;  5AUK A;  1YJI A;  2E3T A;  3HVZ A;  4N59 A;  1KRH A;  4YTN B;  3NVZ A;  1TKE A;  3ETR A;  1N5W A;  1VDV A;  1E7P B;  1UWM A;  2N0S B;  3ABV B;  1FO4 A;  1DOI A;  3P63 A;  2WU2 B;  3AB5 A;  4JWS C;  1CZP A;  3SFE B;  2H88 B;  1E6E B;  2W3R A;  5EE0 A;  4P6V F;  3P4R B;  2Q5W D;  1F0Z A;  3AH7 A;  1E9M A;  3AE7 B;  4ZHO A;  3BII D;  2WDR B;  1NYQ A;  2DWQ A;  3HRD D;  4JX1 C;  3AE2 B;  4US9 A;  3AE6 B;  1NEK B;  2MJ3 A;  3L4P A;  3P1M A;  1GAQ B;  3CIR B;  1OQR A;  3DWG C;  2AX5 A;  4YTM B;  2W54 A;  2PVG C;  3VRB B;  1QOB A;  2KMM A;  1KF6 B;  1YJJ A;  1FRD A;  3NVV A;  1YQ4 B;  1RM6 C;  1JAL A;  1ROE A;  3RPF C;  1PUT A;  3B9J A;  1J7B A;  4N58 A;  4ZOH C;  4A9A A;  3WCQ A;  2WU5 B;  3B2F A;  1JQ4 A;  2PKO A;  2LEK A;  3AM9 A;  4ITK A;  1FFU A;  1L5P A;  3B2G A;  1VLB A;  1FXA A;  2BS3 B;  2FBW B;  2JQR B;  2MH7 A;  2JX5 A;  3W5U B;  1RFK A;  2W3S A;  5G5H A;  2MJE A;  1FRR A;  2QJL A;  1FIQ A;  1L0V B;  4YXD B;  4HRS A;  3P4Q B;  1IUE A;  2CJO A;  1NYR A;  1J7A A;  3PO0 A;  2CJN A;  2DBY A;  2OHF A;  3DWM A;  4YT0 B;  1B9R A;  3SR6 A;  5C3J B;  2WDQ B;  2L83 A;  1TYG B;  2BS2 B;  1WGK A;  5EE3 A;  1TJE A;  3VR9 B;  1VJK A;  1OQQ A;  1L6U A;  1ZXI A;  1AWD A;  2MJD A;  3AMZ A;  4YSX B;  1RWS A;  1V8C A;  2WDV B;  3EUB 2;  1XLO A;  3P4S B;  5G5G A;  1GPX A;  1PDX A;  3SFD B;  3VRA B;  3P4P B;  1DOX A;  3AEB B;  1QLB B;  5MPO A;  3VR8 B;  3W5V B;  4FXC A;  2K22 A;  2PVO D;  3AE8 B;  3AEC B;  4HRO A;  3NVW A;  1WRI A;  5GXG B;  4US8 A;  1YQ3 B;  4JWU C;  3W9C B;  2WQY B;  1NEN B;  4C7Z A;  2ACZ B;  1FMA D;  1JRO A;  1R7S A;  1ZOY B;  2M19 A;  3AEF B;  4WQM A;  5EE1 A;  5H8Y E;  4C7Y A;  3LXF A;  2W55 A;  1QOF A;  1V97 A;  1NVI D;  3AEA B;  4YTP B;  3AE9 B;  1WXQ A;  5C2T B;  2K9X A;  1TKY A;  4IDI A;  4N6E B;  1SIJ A;  2PIA A;  1XO3 A;  2BT6 A;  1AYF A;  2L52 A;  1N61 A;  1N63 A;  1ZUD 2;  3NVY A;  1L6V A;  1XLP A;  1CJE A;  3HUI A;  3AN1 A;  1FM0 D;  2Y5C A;  3AEG B;  1N5X A;  1XLN A;  2CU3 A;  3AV8 A;  4USA A;  4C80 A;  1QF6 A;  2EKI A;  1PFD A;  2K5P A;  3AE5 B;  4YSY B;  2KAJ A;  3FC4 A;  1E0Z A;  1FXI A;  4YSZ B;  1JRP A;  3ZYY X;  1QT9 A;  3NS1 A;  1DOY A; 
#chains in the Genus database with same CATH topology
 5FK9 C;  1MG8 A;  2B3A A;  3R66 C;  4HPP A;  2MW5 A;  2K0P A;  2AEH A;  2ICI A;  1LO5 D;  2MBB B;  1CQV A;  3NZU A;  2AL6 A;  2C7M B;  2QEJ C;  4DHJ B;  3VRA B;  3ZGZ A;  2LVO A;  1ZP0 B;  2JZ3 B;  2KTF A;  1TY0 A;  5E6P A;  1WXS A;  3T3O A;  4XYC A;  4JIO U;  1Z2M A;  4YWG G;  2J52 A;  2KLG A;  2L32 A;  3IBE A;  3R3M A;  1NYQ A;  4US9 A;  5D94 A;  2GB1 A;  3I63 C;  2NVU I;  3MTN B;  1NI2 A;  2ZPN A;  4DHJ D;  5CHW A;  2LHD A;  2A5U A;  4A90 A;  3N1Z C;  3IAM 1;  4ANX A;  3WCQ A;  1JQ4 A;  3A9K A;  3WA0 A;  2BVC A;  4RMA A;  2GLS A;  1OEY A;  2W3S A;  2HJ1 A;  4NQL B;  3EHV A;  4MSM B;  5KHO A;  4A6Q A;  2PPH A;  2RMM A;  3ZJU A;  1FCL A;  2FID A;  4MEL A;  1I42 A;  2DYM A;  2XEW A;  4KGR A;  1V8C A;  4WUR A;  1GPX A;  3SFD B;  1GUA B;  3VFK A;  2WQY B;  1NEN B;  4BOZ B;  2G45 B;  5EE1 A;  4B0M A;  4GU2 A;  2W55 A;  1IP9 A;  2AQ1 B;  3H8H A;  5FR3 A;  4XX5 A;  1ZGU B;  2KJ6 A;  4KIK B;  1TIF A;  3PTF C;  4WQO B;  2BYT A;  1SE2 A;  1T6B X;  2D11 A;  2WXI A;  3L10 B;  2EKI A;  3PVL A;  4RF1 A;  1JRP A;  2BWF A;  2KHW B;  2M56 B;  2MRP A;  2RGF A;  2DLB A;  1TZ1 A;  2N9K A;  4DWF A;  1K50 A;  1UUP A;  2N7J A;  3WAO A;  4EE2 A;  4WWM A;  3Q8B A;  2G1E A;  3RCZ A;  5L83 A;  1S1Q B;  3QHT A;  2CHZ A;  2WS3 B;  1VZ6 A;  2FCN A;  4FUL A;  5HI1 A;  1XF5 L;  1C4P A;  3NVZ A;  4AS1 A;  2TSS A;  1GJZ A;  2GI9 A;  3H7S A;  5G2N A;  2JWZ A;  2LI5 A;  3Q8E A;  1D5Z C;  1KJT A;  2CU1 A;  2W9N A;  4XWW A;  3PLU A;  4ZRK A;  3WAN A;  3PZ8 A;  4I6P A;  5E6J A;  2BGF A;  2J7Q B;  2KWC A;  3A9J A;  1TS2 A;  2JVC A;  2KMC A;  1F77 A;  1L4Z B;  3PHW B;  4ZRQ A;  3BYT B;  5GMV A;  2CJO A;  2I38 A;  4W9D A;  3Q14 C;  2LGI A;  1TJE A;  1J8C A;  2KDB A;  2KN5 A;  1ZXI A;  1HZ5 A;  2LGS A;  1XLO A;  4EZL A;  3A1Q B;  5IA7 A;  1KOT A;  4FXC A;  1XCT L;  1SE3 A;  5LXI B;  2Y5B B;  1EF1 A;  1WGD A;  4ZRP A;  3B1L X;  3KLS X;  1NVI D;  1G6J A;  1XQQ A;  2D3C A;  1XO3 A;  3QK0 A;  1ZUD 2;  2M0A A;  2Z59 B;  1CK1 A;  2PE9 A;  4W9H A;  4NPN A;  3U8Z A;  4MGZ E;  4W9F A;  1QOG A;  2BTE A;  2MCN B;  3DBL B;  2IY0 B;  1WE7 A;  3ZNG C;  3DBH I;  3NHE B;  1P9D U;  2KJR A;  2HJ8 A;  2QHO A;  1KFY B;  1WWT A;  1GB1 A;  3AE3 B;  1HTO A;  1MVK A;  3WIM A;  2RPQ A;  1KRH A;  1D5X C;  1SEB D;  2BYE A;  2IJ0 A;  1VDV A;  3ZJT A;  4GDL B;  4IG7 B;  4AUQ C;  3AB5 A;  1WM3 A;  2FUG 1;  1L7Y A;  2W3R A;  4Q2J A;  2BBC A;  3KUZ A;  3AE7 B;  3L08 A;  3MJW A;  3L16 A;  5TR5 A;  1WH3 A;  3HIZ A;  4IWP A;  1FNW A;  2NMQ A;  3QIJ A;  5LNK 1;  1RAX A;  1PUT A;  2KWV B;  2K8C A;  2MH7 A;  4HXD A;  2WXH A;  1WJN A;  1WYW B;  4NAW B;  4FJY A;  2ASQ A;  4FN2 A;  1K51 A;  4M01 A;  2N1V A;  5L95 C;  3PO0 A;  3C19 A;  2CJN A;  1AN8 A;  3DWM A;  1WZ3 A;  2L7R A;  4IW0 A;  3UQB A;  4ZRJ A;  2BS2 B;  2KX0 A;  1WGY A;  4WAF A;  1V6E A;  2M8S A;  1V1O A;  1OTR B;  3NJT A;  1XXG A;  2KOX A;  4ZRI A;  1UD7 A;  3LYY A;  4FA6 A;  4LNN A;  3EFC A;  4HRO A;  2L0T A;  3L13 A;  4GB9 A;  3AEF B;  4FJV B;  4WQM A;  2K1F A;  1HQR D;  4K1R B;  1WXQ A;  3L17 A;  1Y8R C;  1XT9 B;  2ZPY A;  3M62 B;  1AW7 A;  5IO9 A;  2L52 A;  4CO7 A;  4M0W B;  2V0G A;  1CJE A;  5IAA C;  2BW2 A;  2O2V A;  4ANU A;  3SHQ A;  1T0Q C;  3HM6 X;  5TSS A;  3SDL C;  3AEE B;  2KNB A;  4IC7 B;  3S2A A;  2FCS A;  3RMK C;  4W9L A;  1I4R A;  1FEH A;  1V81 A;  4N9F 4;  3RUI B;  5BO4 B;  2CHW A;  3BK1 A;  1PQS A;  2EMT A;  3EGR A;  4MEM A;  4DDG D;  5JHA A;  4KV2 A;  3NRZ A;  2BS4 B;  3ZIM A;  1YD8 U;  2WU2 B;  3KW5 B;  3EEC A;  4K7W A;  1SJH D;  2V3S A;  3NOB A;  1EUV B;  3J9C A;  2D2Q A;  2ZCB A;  1EO6 A;  2IGG A;  2G9H D;  2UYZ B;  3PZ7 A;  4G3X B;  1KF6 B;  2BYF A;  1GC6 A;  2KZR A;  1JAL A;  4RM9 A;  2IO0 B;  1SIF A;  4N58 A;  2FCM A;  3FIL A;  3QQ8 B;  2BYV E;  2JQR B;  1DYQ A;  1E7U A;  4YXD B;  1IBX A;  2D5G A;  3W1S A;  2L83 A;  5JH5 C;  2L8J A;  1V1P B;  5D3I B;  5J18 A;  4EFO A;  2ZVO A;  3W1Y A;  5IOI A;  3AXC A;  4EEW A;  5IP4 D;  3RNG C;  4OW0 A;  3VR8 B;  4P7I A;  3RFZ B;  3TEX A;  4L2Y A;  5AEK B;  1Q5W B;  1L4D B;  1OQY A;  2K6Q A;  4C7Z A;  4K7U A;  3ML9 A;  3ZTC A;  2AL3 A;  1V97 A;  2SEB D;  4WJO A;  4W9G A;  4LDT B;  3DBR B;  4KZ0 A;  2Y5C A;  1ZXH A;  2KTR A;  1TS3 A;  4G50 A;  1SJE D;  4P1B C;  5LXH A;  2PW9 A;  1QT9 A;  3I3T B;  3IXS A;  3ZLZ A;  3GZN I;  4XWT A;  1WYG A;  3R7R A;  2WXM A;  3A4R A;  1A70 A;  2B76 B;  1OFF A;  4LDT D;  4M02 A;  1V9J A;  3VTU A;  3AI5 A;  1GB4 A;  2FCQ A;  2QCZ A;  1YJI A;  3HVZ A;  4OVU A;  4LCD E;  2JXX A;  3TCA A;  1DOI A;  1P1A A;  4MAC A;  2LMC A;  4WJP A;  2IYD B;  2OJR A;  3HRD D;  2LAS A;  4EOY A;  3KWV A;  3DWG C;  4A55 A;  3KH0 A;  5DPW A;  1E8X A;  2SAK A;  2KX3 A;  1TGZ B;  2L00 B;  5D6J B;  1WZ0 A;  3OJ4 B;  3T9L A;  4BKS A;  5AZG A;  5BMH A;  1WR1 A;  1FFU A;  2BS3 B;  1RFK A;  2MJE A;  1TS4 A;  1RRB A;  3NZS A;  3VHT C;  1RLF A;  3O65 B;  2IO2 B;  4MDK E;  2WDQ B;  2JRI B;  2GOW A;  2WDT B;  3VR9 B;  3UGB B;  2AYO B;  1HXY D;  3GB1 A;  3MFG A;  2XK5 A;  3AEB B;  2NBV B;  5BYR A;  2M0X A;  2LHE A;  1WIA A;  2INC C;  3C0R B;  2ZNV C;  1WJ4 A;  2LZ6 A;  1FMA D;  1L0Y B;  4IUM B;  2MX2 A;  3AEA B;  3Q8C A;  1Z5S B;  3JVZ X;  2K9X A;  2G4S A;  3H1U A;  1N61 A;  1C1Y B;  1UGJ A;  2K6D B;  1C78 A;  3N20 C;  1UNS A;  1RFA A;  1XLN A;  4F1S A;  4YSY B;  2QMT A;  1OEY J;  2KAJ A;  2ON8 A;  4WWN A;  3ZYY X;  1YOV B;  1E10 A;  3A33 B;  4DDI D;  1DGJ A;  3APF A;  4LTU A;  1I7H A;  4KKJ A;  1YN5 A;  4DXA B;  1SF0 A;  3CWI A;  4B9K A;  2Y5P A;  3LJ3 A;  3QAQ A;  3ETR A;  3QCA A;  3CMM B;  1ESF A;  4DXG A;  2WX0 A;  1WGH A;  2KFJ A;  2R2O A;  1PGB A;  2N9P C;  2GMI C;  1WF9 A;  1UZX B;  1YMH E;  2DYB A;  1P98 A;  1MJD A;  2MJ3 A;  3BYY B;  2KN4 A;  1WX9 A;  2WXK A;  4C4V A;  4I6L B;  3P42 A;  3L0W B;  1YQ4 B;  3HM3 A;  3T8M A;  4AP4 C;  3V6C B;  1YNT E;  2KK8 A;  4KVG B;  2V3P A;  4M8N A;  5KHQ A;  1VLB A;  4GXB A;  1WGR A;  1FIQ A;  5HKH A;  1TY2 A;  3MC9 A;  2OOB B;  4W9I A;  3ZO5 B;  4NJ6 A;  2BKR B;  1CMX B;  2INN E;  3DVG X;  5G5G A;  4TUU A;  4BOS C;  2K22 A;  2K8H A;  3AEC B;  3BZD B;  5GXG B;  3KYC D;  4PT5 A;  1C4A A;  3IVF A;  3TJP A;  4FHK A;  1QOF A;  1XCQ L;  4YTP B;  3TSS A;  2V1Y A;  3ZVV A;  4N6E B;  4EZJ A;  3VVW B;  4HK2 A;  1ET9 A;  1GC7 A;  4IWO A;  3EFU A;  3BVM A;  1N5X A;  1WXV A;  3U7Z A;  4CQN A;  2DHZ A;  3PGE A;  4HWI B;  1L6U A;  1R4M B;  1C79 A;  1TBE A;  2WYQ A;  2RPV A;  1QOA A;  1EWY C;  3R2I A;  2VZK B;  2L76 A;  1N62 A;  2V3N A;  3Q8F A;  1TKE A;  2KWU B;  3UIP B;  1OGW A;  1P0R A;  1N5W A;  1WY8 A;  1E7P B;  5HHD G;  1PGX A;  1FO4 A;  3P63 A;  2WXR A;  1CZP A;  2O2V B;  5EE0 A;  1A5R A;  4YL8 A;  3P4R B;  4IM0 A;  1E9M A;  2WDR B;  2CHX A;  4HJK A;  3PHX B;  4AQ7 A;  2VZK D;  3AE6 B;  2HTH A;  3DBS A;  1BML C;  4RCO A;  2W54 A;  3VRB B;  4XDC A;  4PK1 A;  2KQ4 X;  2DYO A;  3H7P B;  1ZDV A;  1I4H A;  1XEE A;  3QX1 A;  2JX5 A;  3DHI C;  1U4A A;  1YJ1 A;  4OVV A;  3SEB A;  1J7A A;  4DXF A;  1Q1O A;  1E8Y A;  1I4P A;  4MJS A;  1YQB A;  3KQ4 A;  4HKQ A;  3IT4 B;  2FE8 A;  1IGD A;  1WRI A;  1P7E A;  3NG0 A;  3FIL B;  4BKG A;  3AE9 B;  2KDF B;  3CSF A;  1N63 A;  3JSV B;  2JYT A;  4DBG A;  2AQ3 B;  2ZVN A;  1SXT A;  3ZJV A;  4AWJ A;  4HCP B;  4TSS A;  2LXA A;  3AE5 B;  4JE3 B;  2WXO A;  2L05 A;  4B95 A;  2C9W B;  2KQS A;  3ML8 A;  5LLI A;  4EZK A;  2WXG A;  3QC8 B;  4URK A;  1FFV A;  1EM7 A;  4MH0 E;  4X57 B;  3ZKJ C;  2BWE S;  3ALB A;  2KWD A;  2LFI A;  2KDM A;  3V6E B;  2KTR B;  4P6V F;  1SE9 A;  3AH7 A;  3VUX A;  2J4X A;  4PS8 A;  4FJZ A;  2BKF A;  3HHM A;  1GAQ B;  2KVR A;  3DVN V;  2KMM A;  1NDD A;  3NVV A;  1JWU D;  2LRU A;  4ZOH C;  2D3G A;  2MBH A;  4ITK A;  2FBW B;  3PRZ A;  3DVG Y;  1L0V B;  4HRS A;  2A4Z A;  2OJW A;  4PYU A;  3TL5 A;  1WGG A;  2OHF A;  4RGN A;  2UWQ A;  2GBR A;  4RFB A;  3RNA C;  4LNK A;  2KAN A;  3IHP C;  4OHJ A;  4RGM A;  2M17 A;  3WAP A;  1EF5 A;  1LFD A;  5J2R A;  2RDB C;  3IAS 1;  1LGR A;  3P4P B;  2W82 A;  1H4R A;  3UQA A;  4RM8 A;  4WH4 A;  3NS8 A;  4KDL B;  1YQ3 B;  3TBL D;  2ZJD A;  1ISN A;  3RNB C;  1GNU A;  1MHH E;  2JZZ A;  4NJ7 A;  2PIA A;  1ZKH A;  1Q0W B;  1VZ7 A;  4E3C A;  3VH4 B;  4ZYS A;  1QIL A;  4ARI A;  1WMH A;  1V86 A;  1JWS D;  2G3Q B;  5D3D A;  3Q3O C;  4AJY B;  5FR6 A;  2ONQ A;  3JYU A;  4FHJ A;  4NY0 A;  2PMV A;  4BKS D;  2RDH A;  2XK5 B;  1DOY A;  1BXT A;  2NR2 A;  4KGT A;  1MPE A;  3AE4 B;  2Z8L A;  1RYJ A;  3HK0 A;  3QWZ B;  3Q6B A;  4II3 B;  2KAC A;  4TMA B;  3KWL A;  4BAX A;  2E3T A;  4N59 A;  4TKN A;  1WE6 A;  4UDU C;  4TV3 A;  1D4B A;  1WFY A;  1MG4 A;  2KT7 A;  1WM2 A;  2V9H A;  2LD9 A;  2NPT A;  1MFW A;  1L0X B;  1B1Z A;  1BUI C;  4XC2 A;  1ET6 A;  1F9J A;  2BB5 A;  3U2S C;  2WWZ A;  4DK5 A;  2C7H A;  2MLB A;  3BWU D;  3RPF C;  3M3J A;  3B2F A;  5DPS A;  2CS4 A;  4BBN F;  2MSE D;  3AM9 A;  4F7Z A;  2J0J A;  3ZNI D;  1TT5 B;  2LJI A;  1VRA B;  3A4S C;  3P4Q B;  4JGH B;  2JPH A;  5BYS A;  1ZPS A;  4YT0 B;  2C60 A;  4MSQ B;  5EE3 A;  3P2B A;  1VJK A;  3WAL A;  1WXA A;  3MC0 B;  4HCN B;  1PDX A;  1F2R C;  4RGT A;  4LNO A;  3ECI A;  4WIP A;  2LXC A;  3RUL A;  1JRO A;  2M19 A;  4H2A A;  2WNM A;  4G0N B;  3NVY A;  2YEP B;  4PS7 A;  1L6V A;  3PRM B;  3U4E G;  1Y56 A;  2K25 A;  1P3Q U;  1XD3 B;  3U30 A;  2JT4 B;  3AV8 A;  3DPD A;  4LJO B;  3DBH B;  3FC4 A;  2IPK D;  2MBE A;  3QA8 A;  1ACC A;  1SBB B;  3M95 A;  2IGD A;  2WGS A;  1J0G A;  3A9K B;  2KVZ A;  2PTL A;  5EE9 A;  1S3S G;  3B0A A;  2WP9 B;  1HEZ E;  3IFW B;  1NI3 A;  2ZW1 A;  1KTK A;  1SB3 C;  3MP9 A;  4KX6 B;  4IWQ A;  3ZRC A;  4NQK E;  4NJC A;  2KYW A;  2RSU A;  4R3D A;  3PRE A;  2D3B A;  2JF5 A;  4JWS C;  3MHZ A;  3UI3 A;  3ZXV A;  2MHJ A;  4IKG A;  1J19 A;  2MQJ A;  3JW0 X;  3ENE A;  5EDS A;  2JWU A;  2N1W A;  5E6N A;  5CHF A;  2IGH A;  3L4P A;  2JZP A;  3RT3 B;  2WHI A;  4KKI A;  1C77 A;  3AU4 A;  2PVG C;  4OZB A;  3APD A;  3RYT A;  4G11 A;  1AAR A;  1J7B A;  2WXN A;  1E90 A;  3Q3J A;  3PS6 A;  2LUM A;  3VXW A;  3U52 E;  3ZNZ B;  4RNA A;  3N3K B;  5D2M B;  2MJD A;  4A8X C;  3W5V B;  3VTV A;  1GG3 A;  3NVW A;  4US8 A;  4JWU C;  5E6O A;  4J3O D;  4MGY E;  2ACZ B;  4BFR A;  2EMS A;  3C8Y A;  4KSK C;  3N1Y C;  1XLP A;  3AN1 A;  1M94 A;  1WX8 A;  3DQV A;  2DAF A;  4HDQ A;  2OED A;  1UBI A;  3DOW A;  3IT6 B;  2GRI A;  3GP7 A;  1TKG A;  4FBJ B;  3AED B;  4A20 A;  4KSL C;  2AWT A;  3A9J B;  2KFK A;  3LB8 C;  3RNC C;  3EC8 A;  1FD6 A;  3PV1 A;  4ARC A;  1T3Q A;  2EEL A;  4GDK A;  2MP2 A;  4LNF A;  3VAW A;  4AOF A;  4K81 A;  3ZQ4 A;  2K8B A;  1WI0 A;  2REX A;  1K53 A;  2H88 B;  1YX6 B;  1E6E B;  4E74 A;  2DEN B;  2Q5W D;  4NNJ B;  4M0W A;  2M1M A;  2O6V A;  1NEK B;  4HKZ E;  3P1M A;  1OQR A;  2ZCC A;  1E8W A;  2N7D A;  3SU8 X;  1YIW A;  1WX7 A;  3NUH B;  2LEK A;  1FNU A;  3B2G A;  4HJG E;  4MGK E;  4ANW A;  2WXL A;  2NS5 A;  1IUE A;  1QZE A;  1D3Z A;  5IN7 A;  2L3Z A;  1WGK A;  4DHZ E;  2G4D B;  1KM7 A;  3KUC B;  1OQQ A;  2M4N A;  2VH1 A;  4HEA 1;  3EUB 2;  3DHG C;  2YEP F;  1QLB B;  3N32 A;  2N9L A;  3L54 A;  4XE0 A;  1TS5 A;  1K8R B;  3MJ5 A;  1DOX A;  2GBJ A;  4PS3 A;  4E71 A;  2UU7 A;  4IDI A;  2DZK A;  4P16 A;  1SIJ A;  3Q3F A;  2R61 A;  5C1Z A;  1ENF A;  3PZD A;  4CHK A;  3GZN B;  4S0R A;  1T0Y A;  1HTQ A;  4HLE A;  1T0S C;  5JZE B;  5J17 A;  4S17 A;  1V1P A;  3OJ3 A;  2X38 A;  4K3B A;  1VZ8 A;  3TMP B;  4LLG M;  4GSW A;  2KD0 A;  3DBL I;  2LRW A;  1J7C A;  4I6N B;  3SR6 A;  2EKE C;  5BMG A;  2BPS A;  1C76 A;  3R2T A;  3PSE B;  3VQI A;  1QQR A;  1IYF A;  2N0S B;  2KMA A;  2PLP A;  1WMH B;  2WXP A;  3VUW A;  4IM2 A;  1HZ6 A;  2MBO A;  2LGX A;  2QDF A;  1YN4 A;  2IBI B;  1V5O A;  2DZI A;  4ACF A;  3QJZ A;  3V05 A;  4NZL B;  3FKY A;  2NTS A;  1YN3 A;  4FAD A;  5BMI A;  2J53 A;  1UWX A;  4JPS A;  2BB6 A;  2WU5 B;  3O13 A;  1L5P A;  4MH8 A;  3I5J C;  4L23 A;  2IZV B;  2J0M A;  2NPT B;  2VH2 A;  1Q10 A;  1I35 A;  3TEY A;  3QAR A;  3U7D A;  5C3J B;  2FIF A;  3ZW3 A;  3E56 A;  1TYG B;  2J0K A;  4K3C A;  1C4C A;  1SGH A;  3ZUN A;  2WDV B;  2QSD A;  3SD5 A;  4ASW C;  3RN9 C;  2IY1 B;  3V60 A;  3D32 A;  2VRR B;  2IO1 B;  3W9C B;  4F8C B;  4CYE A;  1ZOY B;  5H8Y E;  3LXF A;  1R4N B;  5C23 A;  1SSN A;  2C7N B;  1AYF A;  2JXT A;  5CHV C;  2Z0E B;  1JML A;  4LK0 M;  2ZZP B;  2KC1 A;  4USA A;  1YX5 B;  2K5P A;  1E8Z A;  2JSV X;  2KQ7 A;  4QAY A;  1FXI A;  4YSZ B;  2ZNV B;  1N60 A;  4ZYN A;  1QKZ A;  1WJ6 A;  4WJQ A;  1JRU A;  4PYZ A;  2WLB A;  3DVN U;  1JWB D;  2KXJ A;  3E9S A;  1IBX B;  5AUI A;  1TZO A;  3FAH A;  4DQO C;  5AUK A;  1IPG A;  1LXD A;  5T8I A;  3SFE B;  3ZNH B;  4MM3 A;  4HPL B;  1F0Z A;  1E7V A;  3H9D A;  4HDO A;  4P1C C;  2HE7 A;  4JX1 C;  3AE2 B;  1ZDX A;  2I1J A;  2JUO A;  3GE8 C;  4OZA A;  1EWC A;  4REZ A;  3RNE C;  4YTM B;  2RD0 A;  4C00 A;  2DNF A;  5JHB A;  3X23 A;  3B9J A;  1FNV A;  3VH3 B;  4BVU C;  3EA6 A;  4GIV A;  3W5U B;  5G5H A;  2QJL A;  1FRR A;  2D3A A;  3NY5 A;  1NYR A;  4O1N A;  2KO3 A;  1UH6 A;  3GE3 C;  1B9R A;  2JYE A;  1IGC A;  4ICU A;  3ZDT A;  1PGA A;  3AUL A;  3OAW A;  4YSX B;  1RWS A;  3KYD D;  3BK2 A;  4OZC A;  2BQQ A;  1WJU A;  5HFY A;  2L1A A;  2LGD A;  2RDG A;  4WJN A;  3GOE A;  3R7Q A;  4C7Y A;  3LDZ E;  1PYW D;  3TUO A;  5C2T B;  2L0F A;  2WXF A;  1T5X D;  4RH6 A;  4RGO S;  5FKA C;  1WXM A;  2BT6 A;  4TQ1 A;  5DCN A;  4L1B A;  1C3T A;  4ANV A;  4XZ4 A;  3TIX A;  3ZTD A;  1VD2 A;  3W2D A;  1FPY A;  4GOC A;  2WX1 A;  1BT0 A;  5DPT A;  1PFD A;  2HDE A;  4ICV A;  1V5T A;  1TTN A;  3DBR I;  4LNI A;  2I1K A;  3RD2 A;  3M63 B;  4IM3 A;  1MHX A;  1LM8 B;  2PJH A;  2IO3 B;  4TQ0 A;  2HTM E;  1VCB A;  4KDI C;  4ZHP A;  1WSP A;  2GBN A;  4GLS C;  1V80 A;  1JCK B;  1LQB A;  3MHS D;  1NBF C;  4BKT A;  3K9P B;  1GOZ A;  2FAZ A;  3ABV B;  2KDI A;  1KH0 A;  3VUY A;  2JY6 A;  3R8B A;  4EUT A;  2LVQ A;  1I4X A;  4C56 C;  2RR9 A;  2FUH B;  2MBQ A;  1D6E C;  3CIR B;  3OG5 A;  3ZDM C;  1N6Z A;  2AX5 A;  2KFK B;  2LGY A;  5DPR A;  2N4F A;  3BY4 B;  3T3N A;  2LWP A;  1FRD A;  2D07 B;  1ROE A;  2MEK A;  3RZF A;  4M00 A;  3UIO B;  4A9A A;  1I4G A;  4GDK B;  3HVD A;  2MP2 B;  5BYQ A;  4KIK A;  1ZW7 A;  1JWM D;  1WR6 E;  2PE6 B;  2CR5 A;  2ZEQ A;  1HA5 A;  3BVG A;  1I4Q A;  3Q69 A;  1AWD A;  2O6V B;  3N30 A;  4XGA B;  5I4D A;  3ZRF A;  2N7E A;  3NZ3 A;  4KGS A;  2Z0D B;  1FXT B;  2I2Y A;  4WWP A;  1HE8 A;  2KKC A;  2KLC A;  3AU5 A;  2QIL A;  2K3U A;  3H7P A;  2O6V D;  4LJP B;  1X1M A;  2GBM A;  3HUI A;  3CF6 E;  2CU3 A;  1E5W A;  3DCG A;  2IND C;  4C4V B;  1T0R C;  1E0Z A;  3VTW A;  3B08 A;  5JXV A;  3BVZ A;  3RI7 C;  4WAA A;  2Y3A A;  1KLU D;  3AE1 B;  3RNF C;  1F1H A;  2KJH B;  3I57 A;  1XLQ A;  4IOI E;  2WXQ A;  1JW9 D;  4YTN B;  5D7G A;  4JLC A;  2XBB C;  3GS2 A;  1UWM A;  2IDY A;  1UF0 A;  3URY A;  5AZF A;  3V3X A;  3JSV A;  3N1X C;  2NCN A;  1P7F A;  1MI0 A;  3BII D;  3UIN B;  1F2R I;  2AQ2 B;  2NTT A;  2MWS B;  3A1Q A;  4MT5 A;  1M4V A;  1RM6 C;  3Q8A A;  4KZC A;  3Q3N C;  3I9V 1;  3Q2A C;  3VDZ A;  2PKO A;  1KLG D;  1FXA A;  3UF8 A;  3PRP B;  3V61 A;  3WAM A;  1FCC C;  4FLH A;  2C5L C;  3V62 A;  4OVZ A;  4JQW C;  1ZE3 D;  4JL9 A;  2ZW0 A;  3TEZ A;  3MC8 A;  3AMZ A;  3PT2 B;  4NAM A;  5MPO A;  2J42 A;  3AE8 B;  4GMV A;  3DDC B;  3K9O B;  2K39 A;  3KUD B;  4II2 B;  1EU3 A;  3KVF B;  3OWE B;  3ZXR A;  1WRD B;  2JRH A;  2YVC A;  1TKY A;  2BF8 B;  1V49 A;  3TEW A;  1VR9 A;  4W9C A;  2DAJ A;  1V2Y A;  4DHZ B;  4GDL A;  2DX5 B;  2KC2 A;  2V4I B;  2DZJ A;  2PEA A;  1QF6 A;  5IKC M;  2CKH B;  4GN1 A;  5AZH A;  1D5M C;  2LJ5 A;  3IG3 A;  2H89 B;  4W9E A;  5G55 A;  2GBK A;  5H92 C;  3CST A;  1JWA D;  4ZDV A;  1R4M I;  2R2Q A;  1H8C A;  2QIE B;  4MJS B;  2JU6 X;  4NAW A;  3PPA A;  1SE4 A;  5CTR C;  1K52 A;  5CX3 A;  3DHH C;  2INP E;  2LVP A;  2WXJ A;  2MA9 B;  4GGQ A;  4ZHO A;  3ONS A;  2DWQ A;  5HG2 A;  2NBW B;  2X8X X;  4A3P A;  1QOB A;  1UBQ A;  4BBN C;  1YJJ A;  4EKU A;  3OLM D;  4BZA A;  4W9J A;  2V4L A;  4RF0 A;  3X0W A;  3Q3M C;  4A3O A;  2KDE B;  2DZM A;  4K7S A;  2YLM A;  3RZW C;  1C9F A;  1UEL A;  2DBY A;  4J6I A;  2QC8 A;  4HPM B;  4MM3 B;  4HVB A;  3W1S C;  4B0E A;  1F52 A;  1R4N I;  1EU4 A;  4XDD A;  1KLV A;  3P4S B;  4D2K A;  2N9E B;  2PVO D;  2N9X A;  1R7S A;  3PLV A;  1UGM A;  2LUE A;  2D10 A;  3N9Y C;  2XN9 C;  4MGI E;  2NBU A;  4AJW A;  1L2N A;  2FNJ B;  3APC A;  3BIN A;  1FM0 D;  4B6W A;  4W9K A;  2XNA C;  4WWO A;  4C80 A;  2E6X A;  4M8M A;  1STE A;  3H6N A;  3AEG B;  3NS1 A;  2HD5 B; 
#chains in the Genus database with same CATH homology
 1BXT A;  5FK9 C;  1N60 A;  4XWT A;  4KGT A;  1MPE A;  1WYG A;  1QKZ A;  3AE4 B;  2WXM A;  2Z8L A;  1RYJ A;  1A70 A;  2K0P A;  2B76 B;  2ICI A;  1LO5 D;  1OFF A;  2WLB A;  1JWB D;  2KAC A;  1CQV A;  3E9S A;  1IBX B;  5AUI A;  2QEJ C;  1GB4 A;  1TZO A;  4TMA B;  3VRA B;  3FAH A;  3KWL A;  3ZGZ A;  1ZP0 B;  4DQO C;  5AUK A;  1YJI A;  2E3T A;  3HVZ A;  4N59 A;  4UDU C;  5T8I A;  1TY0 A;  1D4B A;  1DOI A;  3SFE B;  3T3O A;  4MAC A;  1L0X B;  2LMC A;  1B1Z A;  4YWG G;  1F0Z A;  2J52 A;  2L32 A;  1BUI C;  1NYQ A;  3HRD D;  4US9 A;  4JX1 C;  3AE2 B;  2GB1 A;  1ET6 A;  1ZDX A;  3KWV A;  3DWG C;  3U2S C;  2BB5 A;  2LHD A;  1EWC A;  4OZA A;  4REZ A;  4A90 A;  4A55 A;  4YTM B;  3IAM 1;  2SAK A;  3BWU D;  3RPF C;  3B9J A;  1FNV A;  3WCQ A;  3B2F A;  1JQ4 A;  3EA6 A;  5BMH A;  3AM9 A;  1FFU A;  2BS3 B;  3W5U B;  1RFK A;  2W3S A;  5G5H A;  2MJE A;  1FRR A;  2QJL A;  2LJI A;  1TS4 A;  1VRA B;  3P4Q B;  1NYR A;  4O1N A;  5BYS A;  1ZPS A;  4YT0 B;  1B9R A;  4A6Q A;  2RMM A;  2JYE A;  2WDQ B;  1IGC A;  3ZJU A;  5EE3 A;  1FCL A;  3VR9 B;  2DYM A;  1VJK A;  1PGA A;  4YSX B;  1RWS A;  4KGR A;  1V8C A;  1HXY D;  3BK2 A;  3MC0 B;  4WUR A;  4OZC A;  3GB1 A;  1PDX A;  3MFG A;  3SFD B;  1F2R C;  1GPX A;  3AEB B;  5BYR A;  4RGT A;  5HFY A;  2LHE A;  2L1A A;  4WIP A;  2WQY B;  1NEN B;  2RDG A;  1FMA D;  1JRO A;  1L0Y B;  2M19 A;  4H2A A;  5EE1 A;  4B0M A;  4C7Y A;  2W55 A;  1PYW D;  2AQ1 B;  3TUO A;  3AEA B;  3Q8C A;  5C2T B;  2K9X A;  2WNM A;  2WXF A;  1T5X D;  3H8H A;  4RGO S;  4RH6 A;  5FR3 A;  5FKA C;  2BT6 A;  3NVY A;  4TQ1 A;  1N61 A;  1UGJ A;  2YEP B;  4L1B A;  1C78 A;  1L6V A;  3U4E G;  1Y56 A;  3W2D A;  1UNS A;  2BYT A;  1SE2 A;  1T6B X;  1XLN A;  2WXI A;  3AV8 A;  2EKI A;  1PFD A;  2HDE A;  4YSY B;  2QMT A;  2KAJ A;  2ON8 A;  3FC4 A;  4RF1 A;  2IPK D;  1JRP A;  3ZYY X;  1E10 A;  2M56 B;  1ACC A;  1SBB B;  2IGD A;  1MHX A;  2DLB A;  2N9K A;  1DGJ A;  1K50 A;  1UUP A;  2N7J A;  4TQ0 A;  2HTM E;  4EE2 A;  4WWM A;  4ZHP A;  1WSP A;  4LTU A;  1I7H A;  3Q8B A;  4KKJ A;  2G1E A;  2PTL A;  5EE9 A;  1YN5 A;  4GLS C;  2WP9 B;  1JCK B;  1SF0 A;  3CWI A;  1HEZ E;  2WS3 B;  1VZ6 A;  1NI3 A;  2Y5P A;  2ZW1 A;  1KTK A;  1SB3 C;  3MP9 A;  4KX6 B;  5HI1 A;  1XF5 L;  1C4P A;  3NVZ A;  4AS1 A;  3ETR A;  4NJC A;  2TSS A;  1GOZ A;  1ESF A;  2GI9 A;  3ABV B;  4DXG A;  4R3D A;  1KH0 A;  4JWS C;  3R8B A;  3MHZ A;  3UI3 A;  1PGB A;  4IKG A;  1I4X A;  3Q8E A;  4C56 C;  2JWU A;  1D5Z C;  1YMH E;  4XWW A;  2IGH A;  2MJ3 A;  3L4P A;  1D6E C;  2JZP A;  3CIR B;  3BYY B;  2AX5 A;  2KN4 A;  3PZ8 A;  5E6J A;  2WXK A;  4KKI A;  1C77 A;  2PVG C;  4OZB A;  3T3N A;  3P42 A;  1FRD A;  1YQ4 B;  1ROE A;  2MEK A;  1J7B A;  2WXN A;  4A9A A;  1YNT E;  1I4G A;  1TS2 A;  4GDK B;  3HVD A;  2V3P A;  1VLB A;  1F77 A;  1L4Z B;  4ZRQ A;  3BYT B;  2LUM A;  1FIQ A;  2CJO A;  5BYQ A;  2I38 A;  1TY2 A;  3U52 E;  1JWM D;  4RNA A;  1HA5 A;  2LGI A;  1I4Q A;  1TJE A;  3BVG A;  2INN E;  3Q69 A;  1ZXI A;  1AWD A;  2MJD A;  1HZ5 A;  4A8X C;  1XLO A;  5G5G A;  5I4D A;  3W5V B;  4FXC A;  2K22 A;  1XCT L;  3AEC B;  3NZ3 A;  3NVW A;  1SE3 A;  3BZD B;  4KGS A;  5GXG B;  4US8 A;  4JWU C;  4J3O D;  4PT5 A;  2ACZ B;  1C4A A;  2I2Y A;  3C8Y A;  4ZRP A;  1QOF A;  1XCQ L;  1NVI D;  3KLS X;  4YTP B;  3TSS A;  4N6E B;  2QIL A;  2K3U A;  1XO3 A;  1ZUD 2;  1XLP A;  1ET9 A;  2M0A A;  3HUI A;  3AN1 A;  3BVM A;  1CK1 A;  1N5X A;  2CU3 A;  3U7Z A;  4CQN A;  3NS1 A;  2OED A;  1E0Z A;  3IT6 B;  1L6U A;  2GRI A;  3GP7 A;  1QOG A;  2BTE A;  1TKG A;  1C79 A;  3AED B;  5JXV A;  3BVZ A;  2RPV A;  1QOA A;  3LB8 C;  1EWY C;  3R2I A;  1KFY B;  2VZK B;  2Y3A A;  1KLU D;  3AE1 B;  3I57 A;  1WWT A;  1FD6 A;  1GB1 A;  1N62 A;  1XLQ A;  4IOI E;  4ARC A;  1T3Q A;  2V3N A;  2WXQ A;  1MVK A;  3AE3 B;  1JW9 D;  3Q8F A;  2EEL A;  1KRH A;  4YTN B;  5D7G A;  1TKE A;  1D5X C;  1SEB D;  2IJ0 A;  3ZJT A;  1N5W A;  1VDV A;  3ZQ4 A;  1E7P B;  3GS2 A;  5HHD G;  4GDL B;  1PGX A;  1UWM A;  2IDY A;  1FO4 A;  3P63 A;  3AB5 A;  1K53 A;  2WXR A;  1CZP A;  2FUG 1;  2H88 B;  3URY A;  1E6E B;  2W3R A;  5EE0 A;  4Q2J A;  3P4R B;  2Q5W D;  3V3X A;  2BBC A;  1E9M A;  1P7F A;  3AE7 B;  4M0W A;  1MI0 A;  3BII D;  2WDR B;  1F2R I;  4AQ7 A;  2VZK D;  2AQ2 B;  3AE6 B;  1NEK B;  4HKZ E;  3P1M A;  2NTT A;  1OQR A;  1BML C;  1FNW A;  4RCO A;  2W54 A;  4MT5 A;  3VRB B;  2NMQ A;  5LNK 1;  1M4V A;  4XDC A;  1RM6 C;  2KQ4 X;  1PUT A;  2DYO A;  3Q8A A;  3I9V 1;  2PKO A;  1KLG D;  3NUH B;  1ZDV A;  2LEK A;  1FNU A;  3B2G A;  4HJG E;  1I4H A;  1XEE A;  1FXA A;  2MH7 A;  2WXH A;  2JX5 A;  4NAW B;  2WXL A;  1K51 A;  1FCC C;  1IUE A;  3PO0 A;  3SEB A;  1J7A A;  4DXF A;  2CJN A;  1AN8 A;  3DWM A;  4OVZ A;  1I4P A;  1ZE3 D;  2ZW0 A;  2BS2 B;  1WGK A;  3TEZ A;  3KQ4 A;  4WAF A;  4HKQ A;  1V1O A;  1OQQ A;  4HEA 1;  3IT4 B;  3AMZ A;  1XXG A;  3EUB 2;  4NAM A;  2YEP F;  3LYY A;  1QLB B;  5MPO A;  2FE8 A;  1IGD A;  2J42 A;  3AE8 B;  4HRO A;  1WRI A;  2N9L A;  1P7E A;  4XE0 A;  1TS5 A;  3MJ5 A;  3AEF B;  3FIL B;  1DOX A;  1EU3 A;  4WQM A;  1HQR D;  3OWE B;  3AE9 B;  1WXQ A;  1TKY A;  4IDI A;  4P16 A;  1AW7 A;  1SIJ A;  2L52 A;  2R61 A;  1N63 A;  3TEW A;  1VR9 A;  2JYT A;  2V0G A;  1CJE A;  2AQ3 B;  1ENF A;  1SXT A;  2BW2 A;  2V4I B;  3ZJV A;  3AEG B;  4TSS A;  1QF6 A;  3AE5 B;  4JE3 B;  5TSS A;  2WXO A;  1D5M C;  3AEE B;  2H89 B;  1V1P A;  1I4R A;  5H92 C;  1FEH A;  1JWA D;  2X38 A;  2WXG A;  1VZ8 A;  4LLG M;  3BK1 A;  1FFV A;  3EGR A;  3NRZ A;  1EM7 A;  2BS4 B;  1J7C A;  3SR6 A;  2QIE B;  5BMG A;  1C76 A;  3R2T A;  2JU6 X;  2KWD A;  3VQI A;  1QQR A;  2N0S B;  1SE4 A;  2LFI A;  2PLP A;  1K52 A;  2WU2 B;  2WXP A;  2KDM A;  2INP E;  2WXJ A;  1HZ6 A;  4P6V F;  3AH7 A;  1SJH D;  4ZHO A;  2J4X A;  1YN4 A;  3J9C A;  2DWQ A;  1GAQ B;  4NZL B;  3V05 A;  5HG2 A;  2IGG A;  2NTS A;  1YN3 A;  2G9H D;  1QOB A;  3PZ7 A;  2KMM A;  1KF6 B;  1YJJ A;  3NVV A;  1JWU D;  5BMI A;  2J53 A;  1JAL A;  1UWX A;  4RF0 A;  4N58 A;  4JPS A;  2BB6 A;  4ZOH C;  3FIL A;  2WU5 B;  4ITK A;  3O13 A;  1L5P A;  2JQR B;  2FBW B;  4MH8 A;  4L23 A;  1DYQ A;  1L0V B;  4YXD B;  4HRS A;  1C9F A;  1IBX A;  2D5G A;  2OHF A;  2DBY A;  1Q10 A;  4RGN A;  3W1S A;  3TEY A;  4RFB A;  4MM3 B;  5C3J B;  3E56 A;  2L83 A;  1TYG B;  4OHJ A;  4RGM A;  1V1P B;  5D3I B;  4B0E A;  1C4C A;  1EU4 A;  4XDD A;  2WDV B;  2QSD A;  3P4S B;  4D2K A;  3IAS 1;  3P4P B;  2W82 A;  3VR8 B;  4OW0 A;  3RFZ B;  2PVO D;  4WH4 A;  3TEX A;  1YQ3 B;  4L2Y A;  3W9C B;  1L4D B;  4C7Z A;  1R7S A;  1ZOY B;  5H8Y E;  3LXF A;  1V97 A;  2SEB D;  3N9Y C;  2XN9 C;  1MHH E;  1SSN A;  2PIA A;  1VZ7 A;  1AYF A;  2JXT A;  1JML A;  4ZYS A;  1QIL A;  4ARI A;  1FM0 D;  2Y5C A;  4LK0 M;  1JWS D;  4USA A;  2XNA C;  5D3D A;  1ZXH A;  4C80 A;  2E6X A;  1TS3 A;  2K5P A;  1SJE D;  2JSV X;  2ONQ A;  1STE A;  1FXI A;  2PMV A;  4YSZ B;  2PW9 A;  1QT9 A;  2RDH A;  3IXS A;  1DOY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...