1I7HA

Crystal sturcuture of fdx
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
109
structure length
109
Chain Sequence
b'PKIVILPHQDLCPDGAVLEANSGETILDAALRNGIEIEHACEKSCACTTCHCIVREGFDSLPESSEQEDDMLDKAWGLEPESRLSCQARVTDEDLVVEIPRYTINHARE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FERREDOXIN
publication title Crystal structure of Escherichia coli Fdx, an adrenodoxin-type ferredoxin involved in the assembly of iron-sulfur clusters.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Electron transport
total genus 27
structure length 109
sequence length 109
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2001-03-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00111 Fer2 2Fe-2S iron-sulfur cluster binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1i7hA00
2PVGC 4ZHPA 1FRDA 1YQ3B 3P4RB 1WXQA 1N63A 3HRDD 4JWUC 1A70A 1E9MA 2N0SB 1FXAA 1CZPA 1KRHA 1N60A 1KF6B 1NI3A 2M19A 3W9CB 1NENB 4C7YA 2FBWB 1SIJA 2WS3B 2H89B 3FAHA 4N6EB 4YT0B 5MPOA 1L6UA 5G5HA 5EE0A 4C7ZA 1QF6A 4FXCA 1ZXIA 1XO3A 1OFFA 1QLBB 1RWSA 3LXFA 1YQ4B 3NVVA 1WWTA 1WGKA 1I7HA 1L6VA 1SB3C 1WRIA 3BIID 1FIQA 1DOIA 1VLBA 2WU5B 3AE2B 3B2GA 2Y5CA 3CWIA 3DWMA 4P6VF 3AEBB 1SF0A 3DWGC 2BT6A 1PFDA 3AE9B 3P63A 2KAJA 2QJLA 2WU2B 4YTNB 2G1EA 3AECB 3P1MA 3AE1B 2PKOA 1JROA 4ZOHC 2DWQA 3AMZA 1N61A 2PIAA 3L4PA 5H8YE 3NS1A 1ZP0B 4USAA 1E0ZA 1RYJA 2W54A 1TKYA 1GPXA 3AE8B 4KX6B 3VRBB 4YXDB 2H88B 2LEKA 3HVZA 1QOGA 2Q5WD 3CIRB 5EE1A 4WQMA 3AM9A 1NYRA 1JWAD 2PVOD 5G5GA 1J7AA 1L0VB 4LTUA 2JX5A 3AEGB 4US9A 1FMAD 1DGJA 2KMMA 3AN1A 2BS3B 2ACZB 3AEAB 3AE4B 1JW9D 3PO0A 2W3RA 1JQ4A 2E3TA 3SR6A 1DOYA 4N59A 1WYGA 4HRSA 1T3QA 1TKEA 2W3SA 1FRRA 1ZOYB 3ABVB 4C80A 1J7CA 3AE5B 3AE6B 3LB8C 1NVID 1N5XA 2AX5A 2K5PA 2OHFA 2WP9B 4JX1C 4YSYB 3AV8A 1JWBD 2BS4B 2EKIA 2HTME 1UWMA 5C2TB 1JRPA 3AE7B 4WWMA 3VR9B 3NRZA 4YTPB 4N58A 3W5UB 1EWYC 1J7BA 1GAQB 1TJEA 1QOAA 2WDRB 1JALA 3B9JA 3W5VB 4A9AA 2WLBA 1IUEA 3NVYA 1E6EB 1E7PB 3VRAB 1V97A 5GXGB 1FFVA 3P4PB 3NVZA 4YTMB 2MJEA 1QT9A 1N5WA 2BS2B 3ZYYX 5AUIA 3P4SB 3P4QB 5H92C 2WQYB 4YSZB 2WDVB 3AEEB 1DOXA 3AEDB 1YJJA 1YJIA 1QOFA 1CJEA 1VJKA 3AE3B 2CU3A 1FO4A 1AYFA 1OQQA 1XLPA 2CJNA 4HROA 4IDIA 2JQRB 4ITKA 1TYGB 1FXIA 3AB5A 3WCQA 1ROEA 1VDVA 2WDQB 5C3JB 3B2FA 1XLNA 1KFYB 4US8A 3ETRA 1FFUA 1B9RA 4JWSC 3EUB2 1PDXA 1NYQA 1R7SA 2B76B 1L5PA 1XLQA 1FM0D 2QIEB 3VR8B 4YSXB 4ZHOA 1OQRA 2K9XA 2MH7A 3AEFB 1XLOA 2K22A 5EE3A 3SFEB 1E10A 3SFDB 2M56B 1V8CA 1RM6C 3KWLA 1F0ZA 2CJOA 3NVWA 1ZUD2 3FC4A 2DBYA 2W55A 1QOBA 2MJDA 3HUIA 1PUTA 1AWDA 1RFKA 1NEKB 3RPFC 1N62A 1TKGA 2MJ3A 2L83A 3AH7A 5AUKA 5EE9A 2L52A
chains in the Genus database with same CATH superfamily
3R7RA 3X0WA 1VRAB 3PRMB 1KTKA 2N0SB 2M19A 3WANA 1NENB 5D6JB 1WZ3A 3NHEB 4FXCA 4F8CB 2RD0A 1WMHB 4MT5A 2QSDA 4XZ4A 2DAFA 3I5JC 1IYFA 4URKA 3MC0B 2W82A 2GOWA 2PKOA 3DBSA 3LYYA 3HVDA 3L4PA 2BYTA 1WGYA 3KUCB 3KUDB 3VRBB 2K39A 4YXDB 3RNEC 2WWZA 3QWZB 5T8IA 1TTNA 1I42A 3ZXVA 3IT4B 3U52E 1R4NI 1P7FA 3QARA 3BY4B 2WXRA 4JX1C 4M8MA 4JL9A 1JWBD 2EKIA 5C2TB 3O13A 2VH1A 1Y56A 4N58A 4ZRKA 3RZWC 4A3OA 3DBRI 4XWTA 2YLMA 5IKCM 3A4SC 3J9CA 3P4PB 3VVWB 2LHEA 3UGBB 4MDKE 1V9JA 4ZDVA 3H6NA 1N5WA 1RAXA 4ZYSA 1QOFA 1I4QA 4MGKE 1TY0A 2C7MB 3RNCC 1KFYB 2BYFA 3ETRA 1FFUA 1WSPA 2FCSA 1B9RA 2KTRB 4NJ7A 3N9YC 3GB1A 4NQLB 1KM7A 1V8CA 3ZO5B 5JHBA 3N1XC 1J8CA 3ZJTA 2KOXA 4HCPB 2WX1A 2JXXA 2R61A 4E3CA 2LUMA 1WIAA 2MJ3A 3SEBA 4AP4C 4XYCA 3ALBA 2BYVE 4A55A 3RNAC 1N63A 3A9KA 4W9LA 1A70A 4H2AA 2DENB 1C1YB 1N60A 1KF6B 1TS5A 2N9KA 4W9CA 4ANUA 1ZDVA 3IT6B 1YMHE 3PS6A 2AWTA 5CHFA 2WU5B 3U7DA 1SF0A 2KFKA 3EA6A 3P63A 1XD3B 2KAJA 3B0AA 2MCNB 2B3AA 3AE1B 3DVGY 4YL8A 2JT4B 3QK0A 2NVUI 2EMSA 3AM9A 4M0WA 2KD0A 1L0VB 1DGJA 4HWIB 4B6WA 1LXDA 3PO0A 3PRPB 4II3B 1FNUA 3RCZA 3IAM1 4HRSA 2HJ8A 2SEBD 1NVID 3WIMA 3AV8A 2KK8A 4WWMA 4X57B 2L3ZA 4BOZB 1EUVB 1J7BA 4LNFA 1M4VA 3ECIA 4A3PA 4BFRA 1SIFA 1J19A 2Z8LA 5D2MB 1R4MI 1MJDA 1ESFA 1NDDA 1F1HA 1C79A 3I57A 4D2KA 1V5TA 3AE3B 5D3DA 5DCNA 2CU3A 3DVNV 4ZRIA 1XEEA 4MSMB 2JRHA 3V3XA 1TYGB 1VDVA 4LJPB 2BBCA 4OZCA 4US8A 2NPTB 1KOTA 4HKZE 1SE3A 1D6EC 5FK9C 3ZJVA 1OQRA 3ZNID 1YN5A 4K3CA 1E10A 2BB6A 2KQ7A 2M56B 1HXYD 4DXGA 3ZTCA 1K53A 3TSSA 2JWZA 1HZ6A 4I6PA 1TZ1A 1QOBA 1G6JA 2DZMA 1D4BA 2IO3B 3MJ5A 1Z2MA 5J17A 3P4RB 1I4XA 2N1VA 1MG8A 3HRDD 2MWSB 4OZAA 3H7PB 2D3BA 1FNWA 4YT0B 4NJCA 3H7SA 2MP2A 4TKNA 2M4NA 1WRIA 3HHMA 3B2GA 4HCNB 1YIWA 1JCKB 2WU2B 2WHIA 1EU3A 5AZFA 3T3NA 4XDCA 1N61A 2R2QA 2KDBA 2MRPA 5JXVA 4AWJA 3PZ7A 1YD8U 3VQIA 3ZNGC 4DDGD 1T0QC 3AEAB 3ML8A 5BMGA 3P2BA 1WYGA 1T3QA 1TKEA 4PS3A 3AE5B 2J0MA 4K7SA 2RGFA 2WXPA 1VR9A 5GMVA 3T8MA 3PLUA 1ISNA 1VD2A 1F77A 1QKZA 2WXGA 1C4CA 3FKYA 3NVZA 3NG0A 1D5ZC 3TEYA 2FIFA 2RMMA 3DBHI 5EDSA 5H92C 3AEDB 5FR6A 2ASQA 3WCQA 4W9KA 2GBRA 4A20A 3VR8B 2KACA 2CR5A 2WYQA 3VH4B 2J52A 4F7ZA 2LGYA 3U2SC 1WGDA 2L83A 4NQKE 3IHPC 4RGMA 1E7VA 2WX0A 3NS8A 4W9JA 4PK1A 3PV1A 2MQJA 5G5HA 2LWPA 3N1YC 3MJWA 4WAFA 1RWSA 3NVVA 2I1JA 3PGEA 3ZJUA 1I7HA 2AL6A 2QMTA 2RDGA 1E90A 4KZ0A 4ACFA 1CK1A 2EKEC 2Z0DB 1EO6A 4MH8A 2L32A 2Z0EB 1GB4A 1E0ZA 3A9JB 4HDQA 1OEYJ 4BZAA 4TV3A 1QOGA 5EE1A 2BPSA 1JWAD 5G5GA 4YWGG 1J7AA 3LDZE 2WXNA 2BS3B 2AQ3B 3DBLI 2NMQA 3BZDB 2DZKA 2AX5A 5LXHA 4K81A 2OHFA 2V3NA 3N30A 2HDEA 4PYZA 2MBQA 5IA7A 4HEA1 3DHHC 3Q8BA 3UIPB 4QAYA 3GS2A 1JRPA 4B0MA 3L54A 4C4VA 2KN5A 4A9AA 1PYWD 5BYRA 3NVYA 2J4XA 2O6VA 3JVZX 1SE9A 3IAS1 1YX5B 2KKCA 1WXAA 4YTMB 1E8XA 4NZLB 3VUYA 3GOEA 2IO1B 3PPAA 2LXCA 3ZNZB 4ITKA 2YEPB 3EUB2 4TUUA 2ZVOA 5FKAC 1ZKHA 2IZVB 1C9FA 2MLBA 2KDMA 2NTSA 1QILA 1XT9B 5IOIA 2ZVNA 5AUKA 2V4LA 4OVUA 1WMHA 4M8NA 2HD5B 1H4RA 1L4ZB 1E8YA 5HHDG 2MBOA 3V61A 4G11A 1XO3A 4KZCA 1TT5B 4JLCA 4P7IA 1FEHA 1LFDA 2DYBA 2JVCA 4K7UA 5HFYA 4YTNB 3VTWA 2YEPF 2L05A 2LGIA 2DWQA 2PIAA 4USAA 1YJ1A 1GPXA 2ZW0A 4BBNC 2MA9B 3HVZA 1FPYA 1PGAA 3GP7A 4LTUA 4US9A 3Q14C 2KMMA 4KSKC 2QILA 4HPPA 2FE8A 3H9DA 3LB8C 3TL5A 1EF5A 2N4FA 1HZ5A 3AE7B 3VR9B 3L13A 4GDKA 2KLCA 2RSUA 3N3KB 4KGRA 4BKSD 2AQ1B 1C78A 3A33B 4LCDE 4J3OD 3GZNI 3Q3OC 1WX8A 4IKGA 4K3BA 3R2IA 3L10B 4C00A 2KTRA 2IO2B 3NUHB 1V1PB 1V80A 2LASA 1WH3A 1XLPA 4HROA 3W1SC 2N7JA 2MX2A 2JY6A 3IXSA 3QAQA 1P0RA 3KWLA 1RM6C 3OWEB 4FA6A 2LHDA 4RNAA 1Q0WB 4IM3A 1FCCC 2BGFA 3Q8EA 1NEKB 3JSVB 1P9DU 3HM6X 1FRDA 1E7UA 1JMLA 3MFGA 1CZPA 3BYYB 4FJYA 3VTUA 4L2YA 1L6UA 2L00B 3LXFA 2C5LC 4RMAA 3ENEA 3IG3A 3P42A 3O65B 1PFDA 4WWOA 3KUZA 2QHOA 5L83A 4GB9A 2N7DA 5I4DA 1R4NB 3HM3A 2WXJA 4K1RB 1WR1A 4TQ0A 4BOSC 1BT0A 3AE8B 2LEKA 1Q5WB 1F2RC 4XGAB 2LUEA 3DBRB 4LNKA 1HTQA 1JW9D 5D7GA 4N59A 3U4EG 1ZOYB 2A4ZA 1LO5D 4LNIA 1BUIC 3DDCB 1ZGUB 3EFCA 4HJKA 1V97A 2JXTA 1FFVA 1KLVA 3AXCA 2LGXA 2V3SA 3WAMA 2BS2B 3MHSD 2JUOA 4AJYB 3B08A 1B1ZA 4EZLA 4B9KA 4IM2A 1V86A 1HQRD 2QIEB 2SAKA 1XLOA 3Q8AA 1K52A 3ZGZA 3W1YA 4CHKA 2ONQA 4IWQA 4DK5A 4MM3B 1IBXB 2I1KA 1NI3A 2V9HA 5TSSA 1PGXA 1V1OA 3FAHA 1FNVA 4C7ZA 2KWCA 1ZXIA 4EKUA 2M0XA 1I4PA 2KMAA 1SB3C 3V60A 3BIID 1VLBA 5HG2A 1YQBA 4IWOA 1WZ0A 3DWGC 1OQYA 1T0RC 2LZ6A 5E6OA 1SEBD 1E8WA 2JU6X 3U30A 2KDIA 2RDHA 2IO0B 3DVGX 2QC8A 4BAXA 3RT3B 4ANWA 3E56A 2MEKA 1D5XC 3NZUA 1JWSD 1CMXB 5D94A 4A6QA 1R4MB 3MP9A 3V6CB 2BS4B 4NJ6A 1S3SG 4DDID 2WGSA 4ZRQA 3CMMB 1NBFC 3BVZA 3RI7C 4CO7A 4DHZE 3VTVA 3UQBA 1C77A 2MBHA 2KJRA 4WJNA 2MJEA 3PRZA 2M0AA 3EC8A 1BMLC 2KC1A 1X1MA 2ZCCA 2ZPNA 3UF8A 1I4HA 4NAWB 1T6BX 1PDXA 2MHJA 2BKFA 3SFDB 4G0NB 2AYOB 4L1BA 2X8XX 4M01A 1OGWA 4EZKA 2BYEA 4XDDA 3TJPA 4A90A 3AH7A 4A8XC 4KGSA 4O1NA 4WH4A 2L52A 1JWMD 1PGBA 2KZRA 2C60A 4HXDA 4IWPA 3NZSA 4OVVA 5E6NA 4C7YA 2N9LA 1QF6A 3URYA 1ACCA 3A9JA 3KVFB 2FCQA 1T0YA 1JWUD 3DWMA 2BT6A 2KQ4X 4WJPA 4GU2A 4JQWC 3R2TA 2CS4A 5BO4B 2H88B 3L16A 1RRBA 2EMTA 1E8ZA 5AZHA 4JIOU 2Y3AA 4G3XB 4HPLB 2CU1A 1UBQA 4JPSA 2BF8B 3RULA 4MJSB 2C9WB 3IBEA 3UQAA 3DBHB 2D10A 5C1ZA 1J7CA 1EF1A 1D3ZA 2HTME 3V6EB 2LVQA 4W9DA 2WLBA 1WXVA 1E6EB 5E6PA 1WYWB 4EEWA 3QX1A 5BYQA 2E6XA 1OEYA 1VZ6A 4IG7B 2D5GA 3AEEB 1TS4A 1V6EA 2CJNA 3MC9A 5BMIA 3MC8A 4M02A 1XLNA 2PTLA 1T0SC 4W9IA 4B0EA 2KWDA 4ZRJA 2KYWA 4REZA 1L5PA 3OLMD 4IUMB 4WJQA 1WFYA 2K9XA 3TEXA 2JF5A 2KVZA 5KHQA 1UD7A 2XK5A 4Q2JA 1PUTA 1N6ZA 1F52A 2FCMA 4XWWA 2PPHA 1WGGA 2XNAC 2NBVB 3VXWA 1MPEA 2MBBB 4OW0A 2LXAA 1D5MC 2KFKB 3S2AA 3ML9A 1IGDA 2INCC 1WR6E 5L95C 4ARCA 1KJTA 4WAAA 3VHTC 3TEZA 4BKSA 3ZKJC 2KTFA 3AE9B 1UZXB 2G4DB 3DBLB 2GI9A 3P1MA 4RM8A 3AU4A 2R2OA 5CHWA 1IPGA 3PTFC 4DQOC 1SXTA 2XN9C 4WQMA 3H8HA 2PVOD 3AN1A 4HK2A 3KW5B 2N1WA 4ANXA 2Z59B 5HI1A 4WURA 4P1CC 2VH2A 2KFJA 2CHWA 2DYOA 1WRDB 2FCNA 1QOAA 2CHXA 1JALA 2LJ5A 3A1QA 4P16A 3W1SA 2N7EA 1E7PB 5GXGB 2ZEQA 2GBKA 2UU7A 2G45B 2Y5BB 3VUWA 3ZQ4A 1MFWA 1EWCA 4LJOB 2WQYB 4YSZB 4K7WA 2QEJC 2QDFA 1AARA 4XE0A 2IGGA 1PQSA 4MACA 3MHZA 4ZYNA 5HKHA 2WXIA 3PLVA 3JSVA 2J53A 4YSXB 3C19A 2JWUA 1YNTE 2KT7A 2V4IB 1F9JA 1TZOA 3FC4A 3QIJA 3ZW3A 1GNUA 2M17A 2I38A 2MP2B 4JWUC 3OJ4B 3MTNB 2K8CA 3K9PB 2KANA 2ZZPB 2IJ0A 1YQ4B 4XX5A 3PHXB 2X38A 4TMAB 2D3AA 2KDFB 1C3TA 3NY5A 4W9FA 1WY8A 2WXMA 1ZP0B 4GLSC 4LNOA 2BWES 2ON8A 4AS1A 4FHJA 3NOBA 2RPQA 2J7QB 1WXSA 2ACZB 3SR6A 1DOYA 4R3DA 2W3SA 3ZIMA 3WAPA 2JYTA 1N5XA 4NY0A 1VCBA 2K5PA 2KC2A 3X23A 4YSYB 3Q3FA 1XF5L 2DZIA 2XEWA 1UBIA 2WDRB 2GLSA 5G55A 4IC7B 4ARIA 1IUEA 3VRAB 4DHZB 4S0RA 2JZPA 1E5WA 2N9EB 4GIVA 2UYZB 4MGZE 4KIKB 3QJZA 1YJJA 2CHZA 4FJVB 1VJKA 2K8BA 2RPVA 4TSSA 1OQQA 3ZNHB 4II2B 1ROEA 2HJ1A 3RFZB 4HPMB 3JYUA 1JRUA 4LLGM 1TBEA 2B76B 1AN8A 4ANVA 3I9V1 3FILB 3RUIB 1WE6A 3WAOA 4RFBA 3HUIA 2IY0B 3NJTA 1WJUA 2D3CA 5AEKB 4BVUC 4MEMA 4AUQC 1E9MA 1FXAA 2K8HA 2DHZA 3DHGC 1SBBB 1YX6B 2DLBA 3IFWB 2MW5A 5EE0A 5JHAA 2J42A 1QLBB 3T3OA 1Q10A 5J2RA 1WI0A 1FIQA 3AE2B 3QQ8B 2OEDA 4P6VF 4C56C 1WM2A 2WDTB 1ZW7A 1L7YA 2NTTA 3TBLD 1Q1OA 3ZUNA 1JROA 4ZOHC 2BQQA 3AMZA 5DPRA 5H8YE 2JYEA 3NZ3A 1RYJA 2W54A 2LFIA 4FLHA 2M1MA 4EFOA 3U7ZA 1NYRA 2TSSA 3B1LX 5LNK1 2DX5B 2PEAA 3AEGB 4KV2A 2JPHA 4C4VB 2W3RA 2E3TA 3N1ZC 3WA0A 3QC8B 1FRRA 3ABVB 4JE3B 4AOFA 2O6VB 5G2NA 3W2DA 1XXGA 3I63C 3DQVA 4GXBA 3R66C 3W5UB 3M62B 3EGRA 2L8JA 2FNJB 4N9F4 2K3UA 3M3JA 1RFAA 3ZVVA 1QT9A 3D32A 4LNNA 2KVRA 1STEA 3BINA 1DOXA 1CJEA 2BB5A 1P3QU 3ZDMC 2O6VD 4KKIA 3DVNU 4AQ7A 1XLQA 4NPNA 3RNGC 2K22A 3Q3NC 2WXOA 4L23A 2NR2A 1WJ6A 1MHXA 4FHKA 1TIFA 3RMKC 2NPTA 1UH6A 4HLEA 3RYTA 2ZJDA 3KYCD 2PVGC 4DWFA 2PE6B 4ZHPA 1YQ3B 3VDZA 1T5XD 2FBWB 4PS7A 4E71A 4NNJB 3VUXA 4RH6A 4KDIC 4MELA 3QCAA 4LDTB 1C76A 2KX3A 1DOIA 2FIDA 3H7PA 3TIXA 4FADA 3OJ3A 3AEBB 4WIPA 1WE7A 1WX7A 4DHJB 1F2RI 3CSTA 1ZE3D 3NS1A 4IOIE 4MJSA 1NI2A 2ZNVB 4W9GA 4TQ1A 5CHVC 2J0KA 1KLUD 4J6IA 2ZNVC 4RM9A 3M63B 1WGHA 2O2VB 4LDTD 4GDKB 1JQ4A 2QCZA 3L17A 4WWPA 4C80A 2KJ6A 1WF9A 2ZCBA 4WWNA 4DHJD 5IN7A 3APCA 1ZPSA 3KWVA 3NRZA 3AI5A 4YTPB 3VH3B 3SHQA 5LXIB 2KJHB 3AULA 4PS8A 1L4DB 1ZXHA 2DYMA 4EZJA 2KQSA 1ENFA 4G50A 2KXJA 4CQNA 5TR5A 1KLGD 2WDVB 1AW7A 3H1UA 2BTEA 1WJNA 2FUHB 2JSVX 1FXIA 3U8ZA 2WDQB 4GDLB 2UWQA 4EUTA 4ZHOA 2MH7A 1V81A 3RNBC 5IO9A 2L1AA 5AZGA 2JRIB 2LMCA 4PYUA 1P7EA 1ZUD2 1UGJA 2W55A 3UINB 3PVLA 1Y8RC 2L0FA 4I6LB 4MGYE 4JGHB 1HEZE 4FULA 2K25A 2L0TA 3PSEB 3EECA 3HIZA 4KDLB 1GUAB 1UUPA 3EHVA 2H89B 2VZKB 2W9NA 2BKRB 4W9EA 5MPOA 2PE9A 4E74A 4GGQA 1WGKA 1L6VA 3KLSX 2LRWA 3CWIA 1L0YB 2LGSA 2JZZA 2HTHA 1FD6A 2KN4A 2J0JA 1LM8B 1C4PA 3N20C 3V05A 3Q2AC 2LD9A 4I6NB 2XBBC 3CIRB 2BVCA 4RCOA 2VZKD 3RZFA 1FMAD 1C4AA 3OG5A 4ICVA 2G9HD 5DPTA 4F1SA 5C23A 1UELA 2NS5A 1QQRA 1UF0A 1I35A 2L76A 4RGOS 3UIOB 2IBIB 2G4SA 3QHTA 2OJWA 3DHIC 1EWYC 1GAQB 1TJEA 2JZ3B 3W5VB 1FXTB 2LI5A 3E9SA 5IAAC 2IDYA 3JW0X 4ZRPA 3R8BA 4FJZA 5DPSA 3I3TB 2K0PA 2GRIA 3PT2B 2KNBA 3EFUA 4PT5A 1AYFA 3BVMA 4AJWA 3SU8X 1L2NA 1SGHA 1J0GA 4GN1A 2WXLA 2GB1A 1ET9A 2DAJA 2EELA 3SFEB 3R7QA 4M00A 2L7RA 3NVWA 2DBYA 2D3GA 1RFKA 2GBMA 3RPFC 2KLGA 4ASWC 1L0XB 4OVZA 3PZDA 4RF1A 4OZBA 3RD2A 1KRHA 3W9CB 1WX9A 2WS3B 2ZPYA 2FAZA 5E6JA 5CTRC 3C0RB 3ONSA 1K51A 4DBGA 1A5RA 3A9KB 3RN9C 3AU5A 2LVPA 1IGCA 3AECB 2IY1B 4RGTA 2DZJA 3Q69A 2BWFA 2AQ2B 3IVFA 2WXHA 4W9HA 4KX6B 4P1BC 1XCQL 2RR9A 2M8SA 4GOCA 2HE7A 2INDC 4GSWA 1WGRA 3CF6E 5KHOA 2NBUA 4BKGA 2NCNA 2MSED 4GMVA 3ZLZA 4KSLC 4M0WB 2D2QA 1GG3A 1I4GA 4KIKA 2GMIC 2N9XA 3Q8FA 2PMVA 1P1AA 2IGHA 3TMPB 4HKQA 2GBJA 2Y5PA 2MBEA 2KWVB 1V49A 1SE2A 3ZXRA 3ZYYX 2VRRB 3P4QB 4MSQB 2I2YA 2INNE 5J18A 1YN3A 1FO4A 4IDIA 3FILA 3KQ4A 2V0GA 3AB5A 4FN2A 1K50A 2K6DB 3B2FA 3BYTB 2WNMA 1NYQA 1V1PA 1SSNA 2D07B 1FM0D 3ZRCA 4HVBA 1GJZA 2LGDA 1LGRA 4KKJA 3QA8A 3KH0A 5JH5C 1GOZA 1I4RA 1XCTL 1OTRB 4EE2A 1QZEA 3T9LA 2KHWB 1AWDA 3GE3C 3UI3A 5EE9A 1GC7A 1WXQA 4IM0A 1UGMA 1GB1A 3VFKA 3N32A 4N6EB 1HE8A 1ZDXA 2LRUA 2PJHA 3C8YA 1OFFA 1WWTA 2OJRA 4DXFA 2GBNA 3ZDTA 2ICIA 4LK0M 2G1EA 3OAWA 2KWUB 3DOWA 5BYSA 1LQBA 4S17A 5DPWA 1WXMA 1TKYA 4UDUC 2FUG1 4BKTA 4WQOB 4IW0A 3Q6BA 2IGDA 2C7HA 3AE4B 2G3QB 1YN4A 1EU4A 5BMHA 2LVOA 1MI0A 4WJOA 1MVKA 1P98A 3K9OB 3LJ3A 3TEWA 1UWMA 1IP9A 1HTOA 3L08A 3VAWA 2AEHA 1BXTA 2KMCA 1FCLA 3Q3MC 1YOVB 3A4RA 3RNFC 3BWUD 3GZNB 5AUIA 2V3PA 2IPKD 2WXQA 2C7NB 1KH0A 2IYDB 1YJIA 4MH0E 1SJED 1UWXA 2KO3A 3TUOA 1EM7A 4RGNA 4HJGE 2KX0A 4KVGB 1VZ7A 2XK5B 4RF0A 1WM3A 3PZ8A 3AEFB 5EE3A 5JZEB 1ET6A 2WXKA 3DPDA 5LLIA 1F0ZA 3BK1A 3PHWB 3ZRFA 5FR3A 1U4AA 1N62A 1TKGA 4MGIE 1VZ8A 1SE4A 2DNFA 1K8RB 1SIJA 3DCGA 4OHJA 1XQQA 4NAMA 4XC2A 2D11A 2INPE 5IP4D 1TY2A 2BW2A 4HDOA 3APDA 1TGZB 4MM3A 1TS2A 2Y5CA 1IBXA 4FBJB 5CX3A 2QJLA 1HA5A 1GC6A 3APFA 2REXA 3R3MA 2O2VA 1S1QB 1DYQA 2LJIA 5D3IB 4CYEA 3PREA 1M94A 2A5UA 2Q5WD 2PLPA 3Q3JA 2JX5A 2K1FA 4DXAB 1V2YA 3HK0A 2K6QA 2AL3A 2YVCA 4BBNF 1UNSA 3A1QB 3BK2A 3AE6B 2WP9B 3L0WB 3GE8C 1H8CA 1WJ4A 3KYDD 3B9JA 3BVGA 1Z5SB 2PW9A 4GDLA 2CKHB 1MHHE 1V5OA 3P4SB 1MG4A 4EOYA 3M95A 3WALA 2RDBC 4B95A 2OOBB 4ICUA 2JQRB 2ZW1A 3CSFA 5C3JB 2V1YA 4KGTA 4JWSC 1TS3A 3ZTDA 1R7SA 2NBWB 2WXFA 3SD5A 4NAWA 2CJOA 3TCAA 3Q8CA 2N9PC 2KDEB 3SDLC 1RLFA 1CQVA 2MJDA 3V62A 1SJHD
chains in the Genus database with same CATH topology
1VRAB 1HEZE 1KTKA 1MPEA 1L4ZB 2N0SB 4OW0A 2M19A 5HHDG 1D5MC 1NENB 1UUPA 2H89B 2VZKB 1IGDA 5MPOA 4FXCA 1XO3A 4ARCA 1WGKA 1L6VA 1FEHA 4MT5A 3KLSX 2QSDA 3TEZA 3CWIA 3MC0B 2W82A 5HFYA 1L0YB 3AE9B 4YTNB 2GI9A 2YEPF 3P1MA 2LGIA 1FD6A 2PKOA 2DWQA 2KN4A 3LYYA 1C4PA 2PIAA 3HVDA 3L4PA 2BYTA 3V05A 4USAA 1GPXA 2ZW0A 3VRBB 4DQOC 4YXDB 3HVZA 1SXTA 3CIRB 2XN9C 4WQMA 3H8HA 2PVOD 4RCOA 2VZKD 1PGAA 3GP7A 4LTUA 4US9A 1FMAD 5T8IA 1C4AA 2KMMA 3AN1A 2G9HD 2QILA 3IT4B 1QQRA 3U52E 1P7FA 2FE8A 5HI1A 3LB8C 2WXRA 4JX1C 4RGOS 4WURA 1JWBD 2EKIA 2DYOA 5C2TB 1HZ5A 3AE7B 3VR9B 3O13A 1Y56A 4N58A 1EWYC 1GAQB 1TJEA 1QOAA 3W5VB 1JALA 4P16A 3E9SA 4KGRA 3W1SA 2IDYA 4XWTA 4ZRPA 1E7PB 2AQ1B 1C78A 3R8BA 5GXGB 4J3OD 3J9CA 3P4PB 2LHEA 4IKGA 3ZQ4A 2K0PA 1N5WA 2GRIA 3R2IA 1EWCA 4ZYSA 2WQYB 3NUHB 4YSZB 1V1PB 1QOFA 2QEJC 4PT5A 1AYFA 1I4QA 1XLPA 4HROA 4XE0A 2IGGA 3BVMA 4MACA 1TY0A 1KFYB 2N7JA 3MHZA 3ETRA 1FFUA 1WSPA 1B9RA 2WXIA 2WXLA 3IXSA 2GB1A 2J53A 1ET9A 4YSXB 3N9YC 2EELA 3SFEB 2JWUA 3GB1A 1YNTE 2V4IB 1V8CA 1RM6C 3KWLA 3OWEB 3NVWA 3ZJTA 1TZOA 2LHDA 3FC4A 2DBYA 4RNAA 1FCCC 1RFKA 2R61A 3Q8EA 1NEKB 2LUMA 3RPFC 2MJ3A 3SEBA 4A55A 2I38A 1FRDA 4JWUC 1JMLA 1N63A 1L0XB 3MFGA 1A70A 4OVZA 4H2AA 4RF1A 4OZBA 1CZPA 1KRHA 3BYYB 1N60A 1KF6B 3W9CB 1TS5A 2N9KA 2WS3B 1ZDVA 4L2YA 3IT6B 1L6UA 5E6JA 2IJ0A 3LXFA 1YQ4B 1YMHE 1K51A 2WU5B 2X38A 4TMAB 1SF0A 3P42A 1PFDA 3EA6A 3P63A 1IGCA 2KAJA 3AECB 3AE1B 5I4DA 2WXJA 4RGTA 3Q69A 2WXMA 1ZP0B 2AQ2B 4GLSC 4TQ0A 2WXHA 2ON8A 4AS1A 3AE8B 4KX6B 2LEKA 1XCQL 3AM9A 1F2RC 4M0WA 1L0VB 1DGJA 2ACZB 3PO0A 1JW9D 5D7GA 3SR6A 1DOYA 4N59A 1FNUA 4R3DA 3IAM1 2W3SA 4HRSA 3U4EG 1ZOYB 1LO5D 2JYTA 1NVID 1BUIC 1N5XA 2K5PA 2SEBD 4YSYB 3AV8A 1XF5L 1I4GA 4WWMA 3Q8FA 2PMVA 1J7BA 2IGHA 2WDRB 4HKQA 4ARIA 1IUEA 1M4VA 2Y5PA 3VRAB 1V97A 2JXTA 1FFVA 2JZPA 2Z8LA 1SE2A 2BS2B 3ZYYX 1ESFA 3P4QB 2I2YA 1C79A 3I57A 2INNE 4D2KA 1YJJA 1VJKA 3AE3B 5D3DA 1YN3A 2CU3A 2RPVA 4TSSA 1OQQA 1FO4A 1XEEA 3FILA 4IDIA 1B1ZA 3KQ4A 3V3XA 2V0GA 1TYGB 3AB5A 1K50A 1ROEA 1VDVA 2BBCA 3B2FA 3RFZB 3BYTB 4OZCA 2WNMA 4LLGM 4US8A 4HKZE 1SE3A 1NYQA 1V1PA 2B76B 1AN8A 1D6EC 1HQRD 1SSNA 1FM0D 2QIEB 5FK9C 3ZJVA 2SAKA 1OQRA 1YN5A 1XLOA 1E10A 2BB6A 3Q8AA 4KKJA 1K52A 3I9V1 3FILB 2M56B 3ZGZA 1HXYD 4DXGA 1GOZA 1K53A 1I4RA 3TSSA 1HZ6A 1XCTL 4EE2A 4RFBA 1QOBA 3HUIA 2ONQA 1AWDA 3UI3A 1D4BA 5EE9A 3MJ5A 3P4RB 1WXQA 1I4XA 3HRDD 4OZAA 1E9MA 4MM3B 1FXAA 1IBXB 1GB1A 1NI3A 5TSSA 1PGXA 1V1OA 1FNWA 3FAHA 1FNVA 4N6EB 4NJCA 1ZDXA 1SBBB 4YT0B 2DLBA 5EE0A 4C7ZA 2J42A 1ZXIA 3C8YA 1OFFA 1QLBB 1WWTA 3T3OA 1I4PA 1Q10A 1SB3C 1WRIA 3BIID 1FIQA 1VLBA 3AE2B 2OEDA 3B2GA 4P6VF 5HG2A 4C56C 4DXFA 2ICIA 3DWGC 1JCKB 2WU2B 4LK0M 2NTTA 2G1EA 1EU3A 1SEBD 1JROA 4ZOHC 3T3NA 2JU6X 4XDCA 3AMZA 1N61A 5H8YE 5BYSA 2JYEA 2RDHA 3NZ3A 1RYJA 2W54A 1TKYA 5JXVA 2LFIA 4UDUC 2FUG1 3PZ7A 3VQIA 3U7ZA 1NYRA 2TSSA 5LNK1 2IGDA 3AEGB 3E56A 2MEKA 1D5XC 3AEAB 3AE4B 1JWSD 2W3RA 5BMGA 2E3TA 1YN4A 1EU4A 5BMHA 1WYGA 1MI0A 4A6QA 1T3QA 1TKEA 1FRRA 1MVKA 3ABVB 4JE3B 3MP9A 3AE5B 3TEWA 2WXPA 3W2DA 2BS4B 1XXGA 1UWMA 1VR9A 3W5UB 1BXTA 4ZRQA 3BVZA 3EGRA 1F77A 1FCLA 1QKZA 2WXGA 1C4CA 2K3UA 1C77A 3NVZA 3TEYA 1D5ZC 2MJEA 1QT9A 3BWUD 2RMMA 5AUIA 2V3PA 1STEA 2M0AA 2IPKD 5H92C 2WXQA 1DOXA 1KH0A 3AEDB 1BMLC 1YJIA 1CJEA 2BB5A 1SJED 1UWXA 3TUOA 1I4HA 4KKIA 1EM7A 3WCQA 4NAWB 4RGNA 4HJGE 1T6BX 1VZ7A 1PDXA 4AQ7A 1XLQA 4RF0A 3VR8B 3PZ8A 3AEFB 5EE3A 2K22A 2KACA 2WXOA 3SFDB 1ET6A 2WXKA 4L23A 1MHXA 4L1BA 2J52A 1F0ZA 3BK1A 5FR3A 4XDDA 1N62A 1TKGA 3AH7A 2L83A 3U2SC 4A90A 4A8XC 4KGSA 4O1NA 4RGMA 4WH4A 2L52A 1JWMD 1PGBA 1VZ8A 2PVGC 4ZHPA 1YQ3B 1SE4A 1T5XD 4C7YA 2FBWB 1SIJA 4OHJA 4NAMA 4RH6A 2N9LA 5G5HA 2INPE 4WAFA 1QF6A 3URYA 1RWSA 3NVVA 1TY2A 2BW2A 3ZJUA 1ACCA 1I7HA 1C76A 1DOIA 2QMTA 1TS2A 2RDGA 2Y5CA 1JWUD 3DWMA 1IBXA 3AEBB 1CK1A 2BT6A 4WIPA 2QJLA 2KQ4X 1HA5A 1F2RI 1DYQA 4MH8A 1ZE3D 2L32A 3NS1A 2LJIA 4IOIE 5D3IB 1GB4A 1E0ZA 3R2TA 4TQ1A 2H88B 1KLUD 1QOGA 2Q5WD 5EE1A 1JWAD 5G5GA 2PLPA 4YWGG 1J7AA 2Y3AA 2JX5A 2WXNA 4JPSA 2BS3B 2AQ3B 4GDKB 2NMQA 1JQ4A 1UNSA 3BK2A 3BZDB 4C80A 1J7CA 3AE6B 2AX5A 2WP9B 2OHFA 2V3NA 2HDEA 4HEA1 2HTME 3Q8BA 1ZPSA 3GS2A 1JRPA 3KWVA 4B0MA 3NRZA 4YTPB 3B9JA 4A9AA 1PYWD 2WLBA 5BYRA 3NVYA 1E6EB 3BVGA 2J4XA 1L4DB 1ZXHA 3IAS1 2PW9A 2DYMA 4YTMB 1MHHE 5BYQA 2E6XA 1ENFA 1VZ6A 4NZLB 3P4SB 4CQNA 2D5GA 1KLGD 2WDVB 3AEEB 1AW7A 1TS4A 2BTEA 2CJNA 2JSVX 4ITKA 2JQRB 5BMIA 1FXIA 2ZW1A 2WDQB 4GDLB 5C3JB 1XLNA 2PTLA 2YEPB 4KGTA 4B0EA 2KWDA 4JWSC 1TS3A 3EUB2 5FKAC 1R7SA 4REZA 1L5PA 1C9FA 4ZHOA 2K9XA 2MH7A 3TEXA 2WXFA 2KDMA 2L1AA 2CJOA 2LMCA 2NTSA 1QILA 3Q8CA 1P7EA 1ZUD2 1UGJA 2W55A 1CQVA 2MJDA 1PUTA 4Q2JA 4XWWA 1SJHD 5AUKA 2XNAC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2PVG C;  4ZHP A;  1FRD A;  1YQ3 B;  3P4R B;  1WXQ A;  1N63 A;  3HRD D;  4JWU C;  1A70 A;  1E9M A;  2N0S B;  1FXA A;  1CZP A;  1KRH A;  1N60 A;  1KF6 B;  1NI3 A;  2M19 A;  3W9C B;  1NEN B;  4C7Y A;  2FBW B;  1SIJ A;  2WS3 B;  2H89 B;  3FAH A;  4N6E B;  4YT0 B;  5MPO A;  1L6U A;  5G5H A;  5EE0 A;  4C7Z A;  1QF6 A;  4FXC A;  1ZXI A;  1XO3 A;  1OFF A;  1QLB B;  1RWS A;  3LXF A;  1YQ4 B;  3NVV A;  1WWT A;  1WGK A;  1I7H A;  1L6V A;  1SB3 C;  1WRI A;  3BII D;  1FIQ A;  1DOI A;  1VLB A;  2WU5 B;  3AE2 B;  3B2G A;  2Y5C A;  3CWI A;  3DWM A;  4P6V F;  3AEB B;  1SF0 A;  3DWG C;  2BT6 A;  1PFD A;  3AE9 B;  3P63 A;  2KAJ A;  2QJL A;  2WU2 B;  4YTN B;  2G1E A;  3AEC B;  3P1M A;  3AE1 B;  2PKO A;  1JRO A;  4ZOH C;  2DWQ A;  3AMZ A;  1N61 A;  2PIA A;  3L4P A;  5H8Y E;  3NS1 A;  1ZP0 B;  4USA A;  1E0Z A;  1RYJ A;  2W54 A;  1TKY A;  1GPX A;  3AE8 B;  4KX6 B;  3VRB B;  4YXD B;  2H88 B;  2LEK A;  3HVZ A;  1QOG A;  2Q5W D;  3CIR B;  5EE1 A;  4WQM A;  3AM9 A;  1NYR A;  1JWA D;  2PVO D;  5G5G A;  1J7A A;  1L0V B;  4LTU A;  2JX5 A;  3AEG B;  4US9 A;  1FMA D;  1DGJ A;  2KMM A;  3AN1 A;  2BS3 B;  2ACZ B;  3AEA B;  3AE4 B;  1JW9 D;  3PO0 A;  2W3R A;  1JQ4 A;  2E3T A;  3SR6 A;  1DOY A;  4N59 A;  1WYG A;  4HRS A;  1T3Q A;  1TKE A;  2W3S A;  1FRR A;  1ZOY B;  3ABV B;  4C80 A;  1J7C A;  3AE5 B;  3AE6 B;  3LB8 C;  1NVI D;  1N5X A;  2AX5 A;  2K5P A;  2OHF A;  2WP9 B;  4JX1 C;  4YSY B;  3AV8 A;  1JWB D;  2BS4 B;  2EKI A;  2HTM E;  1UWM A;  5C2T B;  1JRP A;  3AE7 B;  4WWM A;  3VR9 B;  3NRZ A;  4YTP B;  4N58 A;  3W5U B;  1EWY C;  1J7B A;  1GAQ B;  1TJE A;  1QOA A;  2WDR B;  1JAL A;  3B9J A;  3W5V B;  4A9A A;  2WLB A;  1IUE A;  3NVY A;  1E6E B;  1E7P B;  3VRA B;  1V97 A;  5GXG B;  1FFV A;  3P4P B;  3NVZ A;  4YTM B;  2MJE A;  1QT9 A;  1N5W A;  2BS2 B;  3ZYY X;  5AUI A;  3P4S B;  3P4Q B;  5H92 C;  2WQY B;  4YSZ B;  2WDV B;  3AEE B;  1DOX A;  3AED B;  1YJJ A;  1YJI A;  1QOF A;  1CJE A;  1VJK A;  3AE3 B;  2CU3 A;  1FO4 A;  1AYF A;  1OQQ A;  1XLP A;  2CJN A;  4HRO A;  4IDI A;  2JQR B;  4ITK A;  1TYG B;  1FXI A;  3AB5 A;  3WCQ A;  1ROE A;  1VDV A;  2WDQ B;  5C3J B;  3B2F A;  1XLN A;  1KFY B;  4US8 A;  3ETR A;  1FFU A;  1B9R A;  4JWS C;  3EUB 2;  1PDX A;  1NYQ A;  1R7S A;  2B76 B;  1L5P A;  1XLQ A;  1FM0 D;  2QIE B;  3VR8 B;  4YSX B;  4ZHO A;  1OQR A;  2K9X A;  2MH7 A;  3AEF B;  1XLO A;  2K22 A;  5EE3 A;  3SFE B;  1E10 A;  3SFD B;  2M56 B;  1V8C A;  1RM6 C;  3KWL A;  1F0Z A;  2CJO A;  3NVW A;  1ZUD 2;  3FC4 A;  2DBY A;  2W55 A;  1QOB A;  2MJD A;  3HUI A;  1PUT A;  1AWD A;  1RFK A;  1NEK B;  3RPF C;  1N62 A;  1TKG A;  2MJ3 A;  2L83 A;  3AH7 A;  5AUK A;  5EE9 A;  2L52 A; 
#chains in the Genus database with same CATH topology
 3R7R A;  3X0W A;  1VRA B;  3PRM B;  1KTK A;  2N0S B;  2M19 A;  3WAN A;  1NEN B;  5D6J B;  1WZ3 A;  3NHE B;  4FXC A;  4F8C B;  2RD0 A;  1WMH B;  4MT5 A;  2QSD A;  4XZ4 A;  2DAF A;  3I5J C;  1IYF A;  4URK A;  3MC0 B;  2W82 A;  2GOW A;  2PKO A;  3DBS A;  3LYY A;  3HVD A;  3L4P A;  2BYT A;  1WGY A;  3KUC B;  3KUD B;  3VRB B;  2K39 A;  4YXD B;  3RNE C;  2WWZ A;  3QWZ B;  5T8I A;  1TTN A;  1I42 A;  3ZXV A;  3IT4 B;  3U52 E;  1R4N I;  1P7F A;  3QAR A;  3BY4 B;  2WXR A;  4JX1 C;  4M8M A;  4JL9 A;  1JWB D;  2EKI A;  5C2T B;  3O13 A;  2VH1 A;  1Y56 A;  4N58 A;  4ZRK A;  3RZW C;  4A3O A;  3DBR I;  4XWT A;  2YLM A;  5IKC M;  3A4S C;  3J9C A;  3P4P B;  3VVW B;  2LHE A;  3UGB B;  4MDK E;  1V9J A;  4ZDV A;  3H6N A;  1N5W A;  1RAX A;  4ZYS A;  1QOF A;  1I4Q A;  4MGK E;  1TY0 A;  2C7M B;  3RNC C;  1KFY B;  2BYF A;  3ETR A;  1FFU A;  1WSP A;  2FCS A;  1B9R A;  2KTR B;  4NJ7 A;  3N9Y C;  3GB1 A;  4NQL B;  1KM7 A;  1V8C A;  3ZO5 B;  5JHB A;  3N1X C;  1J8C A;  3ZJT A;  2KOX A;  4HCP B;  2WX1 A;  2JXX A;  2R61 A;  4E3C A;  2LUM A;  1WIA A;  2MJ3 A;  3SEB A;  4AP4 C;  4XYC A;  3ALB A;  2BYV E;  4A55 A;  3RNA C;  1N63 A;  3A9K A;  4W9L A;  1A70 A;  4H2A A;  2DEN B;  1C1Y B;  1N60 A;  1KF6 B;  1TS5 A;  2N9K A;  4W9C A;  4ANU A;  1ZDV A;  3IT6 B;  1YMH E;  3PS6 A;  2AWT A;  5CHF A;  2WU5 B;  3U7D A;  1SF0 A;  2KFK A;  3EA6 A;  3P63 A;  1XD3 B;  2KAJ A;  3B0A A;  2MCN B;  2B3A A;  3AE1 B;  3DVG Y;  4YL8 A;  2JT4 B;  3QK0 A;  2NVU I;  2EMS A;  3AM9 A;  4M0W A;  2KD0 A;  1L0V B;  1DGJ A;  4HWI B;  4B6W A;  1LXD A;  3PO0 A;  3PRP B;  4II3 B;  1FNU A;  3RCZ A;  3IAM 1;  4HRS A;  2HJ8 A;  2SEB D;  1NVI D;  3WIM A;  3AV8 A;  2KK8 A;  4WWM A;  4X57 B;  2L3Z A;  4BOZ B;  1EUV B;  1J7B A;  4LNF A;  1M4V A;  3ECI A;  4A3P A;  4BFR A;  1SIF A;  1J19 A;  2Z8L A;  5D2M B;  1R4M I;  1MJD A;  1ESF A;  1NDD A;  1F1H A;  1C79 A;  3I57 A;  4D2K A;  1V5T A;  3AE3 B;  5D3D A;  5DCN A;  2CU3 A;  3DVN V;  4ZRI A;  1XEE A;  4MSM B;  2JRH A;  3V3X A;  1TYG B;  1VDV A;  4LJP B;  2BBC A;  4OZC A;  4US8 A;  2NPT B;  1KOT A;  4HKZ E;  1SE3 A;  1D6E C;  5FK9 C;  3ZJV A;  1OQR A;  3ZNI D;  1YN5 A;  4K3C A;  1E10 A;  2BB6 A;  2KQ7 A;  2M56 B;  1HXY D;  4DXG A;  3ZTC A;  1K53 A;  3TSS A;  2JWZ A;  1HZ6 A;  4I6P A;  1TZ1 A;  1QOB A;  1G6J A;  2DZM A;  1D4B A;  2IO3 B;  3MJ5 A;  1Z2M A;  5J17 A;  3P4R B;  1I4X A;  2N1V A;  1MG8 A;  3HRD D;  2MWS B;  4OZA A;  3H7P B;  2D3B A;  1FNW A;  4YT0 B;  4NJC A;  3H7S A;  2MP2 A;  4TKN A;  2M4N A;  1WRI A;  3HHM A;  3B2G A;  4HCN B;  1YIW A;  1JCK B;  2WU2 B;  2WHI A;  1EU3 A;  5AZF A;  3T3N A;  4XDC A;  1N61 A;  2R2Q A;  2KDB A;  2MRP A;  5JXV A;  4AWJ A;  3PZ7 A;  1YD8 U;  3VQI A;  3ZNG C;  4DDG D;  1T0Q C;  3AEA B;  3ML8 A;  5BMG A;  3P2B A;  1WYG A;  1T3Q A;  1TKE A;  4PS3 A;  3AE5 B;  2J0M A;  4K7S A;  2RGF A;  2WXP A;  1VR9 A;  5GMV A;  3T8M A;  3PLU A;  1ISN A;  1VD2 A;  1F77 A;  1QKZ A;  2WXG A;  1C4C A;  3FKY A;  3NVZ A;  3NG0 A;  1D5Z C;  3TEY A;  2FIF A;  2RMM A;  3DBH I;  5EDS A;  5H92 C;  3AED B;  5FR6 A;  2ASQ A;  3WCQ A;  4W9K A;  2GBR A;  4A20 A;  3VR8 B;  2KAC A;  2CR5 A;  2WYQ A;  3VH4 B;  2J52 A;  4F7Z A;  2LGY A;  3U2S C;  1WGD A;  2L83 A;  4NQK E;  3IHP C;  4RGM A;  1E7V A;  2WX0 A;  3NS8 A;  4W9J A;  4PK1 A;  3PV1 A;  2MQJ A;  5G5H A;  2LWP A;  3N1Y C;  3MJW A;  4WAF A;  1RWS A;  3NVV A;  2I1J A;  3PGE A;  3ZJU A;  1I7H A;  2AL6 A;  2QMT A;  2RDG A;  1E90 A;  4KZ0 A;  4ACF A;  1CK1 A;  2EKE C;  2Z0D B;  1EO6 A;  4MH8 A;  2L32 A;  2Z0E B;  1GB4 A;  1E0Z A;  3A9J B;  4HDQ A;  1OEY J;  4BZA A;  4TV3 A;  1QOG A;  5EE1 A;  2BPS A;  1JWA D;  5G5G A;  4YWG G;  1J7A A;  3LDZ E;  2WXN A;  2BS3 B;  2AQ3 B;  3DBL I;  2NMQ A;  3BZD B;  2DZK A;  2AX5 A;  5LXH A;  4K81 A;  2OHF A;  2V3N A;  3N30 A;  2HDE A;  4PYZ A;  2MBQ A;  5IA7 A;  4HEA 1;  3DHH C;  3Q8B A;  3UIP B;  4QAY A;  3GS2 A;  1JRP A;  4B0M A;  3L54 A;  4C4V A;  2KN5 A;  4A9A A;  1PYW D;  5BYR A;  3NVY A;  2J4X A;  2O6V A;  3JVZ X;  1SE9 A;  3IAS 1;  1YX5 B;  2KKC A;  1WXA A;  4YTM B;  1E8X A;  4NZL B;  3VUY A;  3GOE A;  2IO1 B;  3PPA A;  2LXC A;  3ZNZ B;  4ITK A;  2YEP B;  3EUB 2;  4TUU A;  2ZVO A;  5FKA C;  1ZKH A;  2IZV B;  1C9F A;  2MLB A;  2KDM A;  2NTS A;  1QIL A;  1XT9 B;  5IOI A;  2ZVN A;  5AUK A;  2V4L A;  4OVU A;  1WMH A;  4M8N A;  2HD5 B;  1H4R A;  1L4Z B;  1E8Y A;  5HHD G;  2MBO A;  3V61 A;  4G11 A;  1XO3 A;  4KZC A;  1TT5 B;  4JLC A;  4P7I A;  1FEH A;  1LFD A;  2DYB A;  2JVC A;  4K7U A;  5HFY A;  4YTN B;  3VTW A;  2YEP F;  2L05 A;  2LGI A;  2DWQ A;  2PIA A;  4USA A;  1YJ1 A;  1GPX A;  2ZW0 A;  4BBN C;  2MA9 B;  3HVZ A;  1FPY A;  1PGA A;  3GP7 A;  4LTU A;  4US9 A;  3Q14 C;  2KMM A;  4KSK C;  2QIL A;  4HPP A;  2FE8 A;  3H9D A;  3LB8 C;  3TL5 A;  1EF5 A;  2N4F A;  1HZ5 A;  3AE7 B;  3VR9 B;  3L13 A;  4GDK A;  2KLC A;  2RSU A;  3N3K B;  4KGR A;  4BKS D;  2AQ1 B;  1C78 A;  3A33 B;  4LCD E;  4J3O D;  3GZN I;  3Q3O C;  1WX8 A;  4IKG A;  4K3B A;  3R2I A;  3L10 B;  4C00 A;  2KTR A;  2IO2 B;  3NUH B;  1V1P B;  1V80 A;  2LAS A;  1WH3 A;  1XLP A;  4HRO A;  3W1S C;  2N7J A;  2MX2 A;  2JY6 A;  3IXS A;  3QAQ A;  1P0R A;  3KWL A;  1RM6 C;  3OWE B;  4FA6 A;  2LHD A;  4RNA A;  1Q0W B;  4IM3 A;  1FCC C;  2BGF A;  3Q8E A;  1NEK B;  3JSV B;  1P9D U;  3HM6 X;  1FRD A;  1E7U A;  1JML A;  3MFG A;  1CZP A;  3BYY B;  4FJY A;  3VTU A;  4L2Y A;  1L6U A;  2L00 B;  3LXF A;  2C5L C;  4RMA A;  3ENE A;  3IG3 A;  3P42 A;  3O65 B;  1PFD A;  4WWO A;  3KUZ A;  2QHO A;  5L83 A;  4GB9 A;  2N7D A;  5I4D A;  1R4N B;  3HM3 A;  2WXJ A;  4K1R B;  1WR1 A;  4TQ0 A;  4BOS C;  1BT0 A;  3AE8 B;  2LEK A;  1Q5W B;  1F2R C;  4XGA B;  2LUE A;  3DBR B;  4LNK A;  1HTQ A;  1JW9 D;  5D7G A;  4N59 A;  3U4E G;  1ZOY B;  2A4Z A;  1LO5 D;  4LNI A;  1BUI C;  3DDC B;  1ZGU B;  3EFC A;  4HJK A;  1V97 A;  2JXT A;  1FFV A;  1KLV A;  3AXC A;  2LGX A;  2V3S A;  3WAM A;  2BS2 B;  3MHS D;  2JUO A;  4AJY B;  3B08 A;  1B1Z A;  4EZL A;  4B9K A;  4IM2 A;  1V86 A;  1HQR D;  2QIE B;  2SAK A;  1XLO A;  3Q8A A;  1K52 A;  3ZGZ A;  3W1Y A;  4CHK A;  2ONQ A;  4IWQ A;  4DK5 A;  4MM3 B;  1IBX B;  2I1K A;  1NI3 A;  2V9H A;  5TSS A;  1PGX A;  1V1O A;  3FAH A;  1FNV A;  4C7Z A;  2KWC A;  1ZXI A;  4EKU A;  2M0X A;  1I4P A;  2KMA A;  1SB3 C;  3V60 A;  3BII D;  1VLB A;  5HG2 A;  1YQB A;  4IWO A;  1WZ0 A;  3DWG C;  1OQY A;  1T0R C;  2LZ6 A;  5E6O A;  1SEB D;  1E8W A;  2JU6 X;  3U30 A;  2KDI A;  2RDH A;  2IO0 B;  3DVG X;  2QC8 A;  4BAX A;  3RT3 B;  4ANW A;  3E56 A;  2MEK A;  1D5X C;  3NZU A;  1JWS D;  1CMX B;  5D94 A;  4A6Q A;  1R4M B;  3MP9 A;  3V6C B;  2BS4 B;  4NJ6 A;  1S3S G;  4DDI D;  2WGS A;  4ZRQ A;  3CMM B;  1NBF C;  3BVZ A;  3RI7 C;  4CO7 A;  4DHZ E;  3VTV A;  3UQB A;  1C77 A;  2MBH A;  2KJR A;  4WJN A;  2MJE A;  3PRZ A;  2M0A A;  3EC8 A;  1BML C;  2KC1 A;  1X1M A;  2ZCC A;  2ZPN A;  3UF8 A;  1I4H A;  4NAW B;  1T6B X;  1PDX A;  2MHJ A;  2BKF A;  3SFD B;  4G0N B;  2AYO B;  4L1B A;  2X8X X;  4M01 A;  1OGW A;  4EZK A;  2BYE A;  4XDD A;  3TJP A;  4A90 A;  3AH7 A;  4A8X C;  4KGS A;  4O1N A;  4WH4 A;  2L52 A;  1JWM D;  1PGB A;  2KZR A;  2C60 A;  4HXD A;  4IWP A;  3NZS A;  4OVV A;  5E6N A;  4C7Y A;  2N9L A;  1QF6 A;  3URY A;  1ACC A;  3A9J A;  3KVF B;  2FCQ A;  1T0Y A;  1JWU D;  3DWM A;  2BT6 A;  2KQ4 X;  4WJP A;  4GU2 A;  4JQW C;  3R2T A;  2CS4 A;  5BO4 B;  2H88 B;  3L16 A;  1RRB A;  2EMT A;  1E8Z A;  5AZH A;  4JIO U;  2Y3A A;  4G3X B;  4HPL B;  2CU1 A;  1UBQ A;  4JPS A;  2BF8 B;  3RUL A;  4MJS B;  2C9W B;  3IBE A;  3UQA A;  3DBH B;  2D10 A;  5C1Z A;  1J7C A;  1EF1 A;  1D3Z A;  2HTM E;  3V6E B;  2LVQ A;  4W9D A;  2WLB A;  1WXV A;  1E6E B;  5E6P A;  1WYW B;  4EEW A;  3QX1 A;  5BYQ A;  2E6X A;  1OEY A;  1VZ6 A;  4IG7 B;  2D5G A;  3AEE B;  1TS4 A;  1V6E A;  2CJN A;  3MC9 A;  5BMI A;  3MC8 A;  4M02 A;  1XLN A;  2PTL A;  1T0S C;  4W9I A;  4B0E A;  2KWD A;  4ZRJ A;  2KYW A;  4REZ A;  1L5P A;  3OLM D;  4IUM B;  4WJQ A;  1WFY A;  2K9X A;  3TEX A;  2JF5 A;  2KVZ A;  5KHQ A;  1UD7 A;  2XK5 A;  4Q2J A;  1PUT A;  1N6Z A;  1F52 A;  2FCM A;  4XWW A;  2PPH A;  1WGG A;  2XNA C;  2NBV B;  3VXW A;  1MPE A;  2MBB B;  4OW0 A;  2LXA A;  1D5M C;  2KFK B;  3S2A A;  3ML9 A;  1IGD A;  2INC C;  1WR6 E;  5L95 C;  4ARC A;  1KJT A;  4WAA A;  3VHT C;  3TEZ A;  4BKS A;  3ZKJ C;  2KTF A;  3AE9 B;  1UZX B;  2G4D B;  3DBL B;  2GI9 A;  3P1M A;  4RM8 A;  3AU4 A;  2R2O A;  5CHW A;  1IPG A;  3PTF C;  4DQO C;  1SXT A;  2XN9 C;  4WQM A;  3H8H A;  2PVO D;  3AN1 A;  4HK2 A;  3KW5 B;  2N1W A;  4ANX A;  2Z59 B;  5HI1 A;  4WUR A;  4P1C C;  2VH2 A;  2KFJ A;  2CHW A;  2DYO A;  1WRD B;  2FCN A;  1QOA A;  2CHX A;  1JAL A;  2LJ5 A;  3A1Q A;  4P16 A;  3W1S A;  2N7E A;  1E7P B;  5GXG B;  2ZEQ A;  2GBK A;  2UU7 A;  2G45 B;  2Y5B B;  3VUW A;  3ZQ4 A;  1MFW A;  1EWC A;  4LJO B;  2WQY B;  4YSZ B;  4K7W A;  2QEJ C;  2QDF A;  1AAR A;  4XE0 A;  2IGG A;  1PQS A;  4MAC A;  3MHZ A;  4ZYN A;  5HKH A;  2WXI A;  3PLV A;  3JSV A;  2J53 A;  4YSX B;  3C19 A;  2JWU A;  1YNT E;  2KT7 A;  2V4I B;  1F9J A;  1TZO A;  3FC4 A;  3QIJ A;  3ZW3 A;  1GNU A;  2M17 A;  2I38 A;  2MP2 B;  4JWU C;  3OJ4 B;  3MTN B;  2K8C A;  3K9P B;  2KAN A;  2ZZP B;  2IJ0 A;  1YQ4 B;  4XX5 A;  3PHX B;  2X38 A;  4TMA B;  2D3A A;  2KDF B;  1C3T A;  3NY5 A;  4W9F A;  1WY8 A;  2WXM A;  1ZP0 B;  4GLS C;  4LNO A;  2BWE S;  2ON8 A;  4AS1 A;  4FHJ A;  3NOB A;  2RPQ A;  2J7Q B;  1WXS A;  2ACZ B;  3SR6 A;  1DOY A;  4R3D A;  2W3S A;  3ZIM A;  3WAP A;  2JYT A;  1N5X A;  4NY0 A;  1VCB A;  2K5P A;  2KC2 A;  3X23 A;  4YSY B;  3Q3F A;  1XF5 L;  2DZI A;  2XEW A;  1UBI A;  2WDR B;  2GLS A;  5G55 A;  4IC7 B;  4ARI A;  1IUE A;  3VRA B;  4DHZ B;  4S0R A;  2JZP A;  1E5W A;  2N9E B;  4GIV A;  2UYZ B;  4MGZ E;  4KIK B;  3QJZ A;  1YJJ A;  2CHZ A;  4FJV B;  1VJK A;  2K8B A;  2RPV A;  4TSS A;  1OQQ A;  3ZNH B;  4II2 B;  1ROE A;  2HJ1 A;  3RFZ B;  4HPM B;  3JYU A;  1JRU A;  4LLG M;  1TBE A;  2B76 B;  1AN8 A;  4ANV A;  3I9V 1;  3FIL B;  3RUI B;  1WE6 A;  3WAO A;  4RFB A;  3HUI A;  2IY0 B;  3NJT A;  1WJU A;  2D3C A;  5AEK B;  4BVU C;  4MEM A;  4AUQ C;  1E9M A;  1FXA A;  2K8H A;  2DHZ A;  3DHG C;  1SBB B;  1YX6 B;  2DLB A;  3IFW B;  2MW5 A;  5EE0 A;  5JHA A;  2J42 A;  1QLB B;  3T3O A;  1Q10 A;  5J2R A;  1WI0 A;  1FIQ A;  3AE2 B;  3QQ8 B;  2OED A;  4P6V F;  4C56 C;  1WM2 A;  2WDT B;  1ZW7 A;  1L7Y A;  2NTT A;  3TBL D;  1Q1O A;  3ZUN A;  1JRO A;  4ZOH C;  2BQQ A;  3AMZ A;  5DPR A;  5H8Y E;  2JYE A;  3NZ3 A;  1RYJ A;  2W54 A;  2LFI A;  4FLH A;  2M1M A;  4EFO A;  3U7Z A;  1NYR A;  2TSS A;  3B1L X;  5LNK 1;  2DX5 B;  2PEA A;  3AEG B;  4KV2 A;  2JPH A;  4C4V B;  2W3R A;  2E3T A;  3N1Z C;  3WA0 A;  3QC8 B;  1FRR A;  3ABV B;  4JE3 B;  4AOF A;  2O6V B;  5G2N A;  3W2D A;  1XXG A;  3I63 C;  3DQV A;  4GXB A;  3R66 C;  3W5U B;  3M62 B;  3EGR A;  2L8J A;  2FNJ B;  4N9F 4;  2K3U A;  3M3J A;  1RFA A;  3ZVV A;  1QT9 A;  3D32 A;  4LNN A;  2KVR A;  1STE A;  3BIN A;  1DOX A;  1CJE A;  2BB5 A;  1P3Q U;  3ZDM C;  2O6V D;  4KKI A;  3DVN U;  4AQ7 A;  1XLQ A;  4NPN A;  3RNG C;  2K22 A;  3Q3N C;  2WXO A;  4L23 A;  2NR2 A;  1WJ6 A;  1MHX A;  4FHK A;  1TIF A;  3RMK C;  2NPT A;  1UH6 A;  4HLE A;  3RYT A;  2ZJD A;  3KYC D;  2PVG C;  4DWF A;  2PE6 B;  4ZHP A;  1YQ3 B;  3VDZ A;  1T5X D;  2FBW B;  4PS7 A;  4E71 A;  4NNJ B;  3VUX A;  4RH6 A;  4KDI C;  4MEL A;  3QCA A;  4LDT B;  1C76 A;  2KX3 A;  1DOI A;  2FID A;  3H7P A;  3TIX A;  4FAD A;  3OJ3 A;  3AEB B;  4WIP A;  1WE7 A;  1WX7 A;  4DHJ B;  1F2R I;  3CST A;  1ZE3 D;  3NS1 A;  4IOI E;  4MJS A;  1NI2 A;  2ZNV B;  4W9G A;  4TQ1 A;  5CHV C;  2J0K A;  1KLU D;  4J6I A;  2ZNV C;  4RM9 A;  3M63 B;  1WGH A;  2O2V B;  4LDT D;  4GDK B;  1JQ4 A;  2QCZ A;  3L17 A;  4WWP A;  4C80 A;  2KJ6 A;  1WF9 A;  2ZCB A;  4WWN A;  4DHJ D;  5IN7 A;  3APC A;  1ZPS A;  3KWV A;  3NRZ A;  3AI5 A;  4YTP B;  3VH3 B;  3SHQ A;  5LXI B;  2KJH B;  3AUL A;  4PS8 A;  1L4D B;  1ZXH A;  2DYM A;  4EZJ A;  2KQS A;  1ENF A;  4G50 A;  2KXJ A;  4CQN A;  5TR5 A;  1KLG D;  2WDV B;  1AW7 A;  3H1U A;  2BTE A;  1WJN A;  2FUH B;  2JSV X;  1FXI A;  3U8Z A;  2WDQ B;  4GDL B;  2UWQ A;  4EUT A;  4ZHO A;  2MH7 A;  1V81 A;  3RNB C;  5IO9 A;  2L1A A;  5AZG A;  2JRI B;  2LMC A;  4PYU A;  1P7E A;  1ZUD 2;  1UGJ A;  2W55 A;  3UIN B;  3PVL A;  1Y8R C;  2L0F A;  4I6L B;  4MGY E;  4JGH B;  1HEZ E;  4FUL A;  2K25 A;  2L0T A;  3PSE B;  3EEC A;  3HIZ A;  4KDL B;  1GUA B;  1UUP A;  3EHV A;  2H89 B;  2VZK B;  2W9N A;  2BKR B;  4W9E A;  5MPO A;  2PE9 A;  4E74 A;  4GGQ A;  1WGK A;  1L6V A;  3KLS X;  2LRW A;  3CWI A;  1L0Y B;  2LGS A;  2JZZ A;  2HTH A;  1FD6 A;  2KN4 A;  2J0J A;  1LM8 B;  1C4P A;  3N20 C;  3V05 A;  3Q2A C;  2LD9 A;  4I6N B;  2XBB C;  3CIR B;  2BVC A;  4RCO A;  2VZK D;  3RZF A;  1FMA D;  1C4A A;  3OG5 A;  4ICV A;  2G9H D;  5DPT A;  4F1S A;  5C23 A;  1UEL A;  2NS5 A;  1QQR A;  1UF0 A;  1I35 A;  2L76 A;  4RGO S;  3UIO B;  2IBI B;  2G4S A;  3QHT A;  2OJW A;  3DHI C;  1EWY C;  1GAQ B;  1TJE A;  2JZ3 B;  3W5V B;  1FXT B;  2LI5 A;  3E9S A;  5IAA C;  2IDY A;  3JW0 X;  4ZRP A;  3R8B A;  4FJZ A;  5DPS A;  3I3T B;  2K0P A;  2GRI A;  3PT2 B;  2KNB A;  3EFU A;  4PT5 A;  1AYF A;  3BVM A;  4AJW A;  3SU8 X;  1L2N A;  1SGH A;  1J0G A;  4GN1 A;  2WXL A;  2GB1 A;  1ET9 A;  2DAJ A;  2EEL A;  3SFE B;  3R7Q A;  4M00 A;  2L7R A;  3NVW A;  2DBY A;  2D3G A;  1RFK A;  2GBM A;  3RPF C;  2KLG A;  4ASW C;  1L0X B;  4OVZ A;  3PZD A;  4RF1 A;  4OZB A;  3RD2 A;  1KRH A;  3W9C B;  1WX9 A;  2WS3 B;  2ZPY A;  2FAZ A;  5E6J A;  5CTR C;  3C0R B;  3ONS A;  1K51 A;  4DBG A;  1A5R A;  3A9K B;  3RN9 C;  3AU5 A;  2LVP A;  1IGC A;  3AEC B;  2IY1 B;  4RGT A;  2DZJ A;  3Q69 A;  2BWF A;  2AQ2 B;  3IVF A;  2WXH A;  4W9H A;  4KX6 B;  4P1B C;  1XCQ L;  2RR9 A;  2M8S A;  4GOC A;  2HE7 A;  2IND C;  4GSW A;  1WGR A;  3CF6 E;  5KHO A;  2NBU A;  4BKG A;  2NCN A;  2MSE D;  4GMV A;  3ZLZ A;  4KSL C;  4M0W B;  2D2Q A;  1GG3 A;  1I4G A;  4KIK A;  2GMI C;  2N9X A;  3Q8F A;  2PMV A;  1P1A A;  2IGH A;  3TMP B;  4HKQ A;  2GBJ A;  2Y5P A;  2MBE A;  2KWV B;  1V49 A;  1SE2 A;  3ZXR A;  3ZYY X;  2VRR B;  3P4Q B;  4MSQ B;  2I2Y A;  2INN E;  5J18 A;  1YN3 A;  1FO4 A;  4IDI A;  3FIL A;  3KQ4 A;  2V0G A;  3AB5 A;  4FN2 A;  1K50 A;  2K6D B;  3B2F A;  3BYT B;  2WNM A;  1NYQ A;  1V1P A;  1SSN A;  2D07 B;  1FM0 D;  3ZRC A;  4HVB A;  1GJZ A;  2LGD A;  1LGR A;  4KKJ A;  3QA8 A;  3KH0 A;  5JH5 C;  1GOZ A;  1I4R A;  1XCT L;  1OTR B;  4EE2 A;  1QZE A;  3T9L A;  2KHW B;  1AWD A;  3GE3 C;  3UI3 A;  5EE9 A;  1GC7 A;  1WXQ A;  4IM0 A;  1UGM A;  1GB1 A;  3VFK A;  3N32 A;  4N6E B;  1HE8 A;  1ZDX A;  2LRU A;  2PJH A;  3C8Y A;  1OFF A;  1WWT A;  2OJR A;  4DXF A;  2GBN A;  3ZDT A;  2ICI A;  4LK0 M;  2G1E A;  3OAW A;  2KWU B;  3DOW A;  5BYS A;  1LQB A;  4S17 A;  5DPW A;  1WXM A;  1TKY A;  4UDU C;  2FUG 1;  4BKT A;  4WQO B;  4IW0 A;  3Q6B A;  2IGD A;  2C7H A;  3AE4 B;  2G3Q B;  1YN4 A;  1EU4 A;  5BMH A;  2LVO A;  1MI0 A;  4WJO A;  1MVK A;  1P98 A;  3K9O B;  3LJ3 A;  3TEW A;  1UWM A;  1IP9 A;  1HTO A;  3L08 A;  3VAW A;  2AEH A;  1BXT A;  2KMC A;  1FCL A;  3Q3M C;  1YOV B;  3A4R A;  3RNF C;  3BWU D;  3GZN B;  5AUI A;  2V3P A;  2IPK D;  2WXQ A;  2C7N B;  1KH0 A;  2IYD B;  1YJI A;  4MH0 E;  1SJE D;  1UWX A;  2KO3 A;  3TUO A;  1EM7 A;  4RGN A;  4HJG E;  2KX0 A;  4KVG B;  1VZ7 A;  2XK5 B;  4RF0 A;  1WM3 A;  3PZ8 A;  3AEF B;  5EE3 A;  5JZE B;  1ET6 A;  2WXK A;  3DPD A;  5LLI A;  1F0Z A;  3BK1 A;  3PHW B;  3ZRF A;  5FR3 A;  1U4A A;  1N62 A;  1TKG A;  4MGI E;  1VZ8 A;  1SE4 A;  2DNF A;  1K8R B;  1SIJ A;  3DCG A;  4OHJ A;  1XQQ A;  4NAM A;  4XC2 A;  2D11 A;  2INP E;  5IP4 D;  1TY2 A;  2BW2 A;  4HDO A;  3APD A;  1TGZ B;  4MM3 A;  1TS2 A;  2Y5C A;  1IBX A;  4FBJ B;  5CX3 A;  2QJL A;  1HA5 A;  1GC6 A;  3APF A;  2REX A;  3R3M A;  2O2V A;  1S1Q B;  1DYQ A;  2LJI A;  5D3I B;  4CYE A;  3PRE A;  1M94 A;  2A5U A;  2Q5W D;  2PLP A;  3Q3J A;  2JX5 A;  2K1F A;  4DXA B;  1V2Y A;  3HK0 A;  2K6Q A;  2AL3 A;  2YVC A;  4BBN F;  1UNS A;  3A1Q B;  3BK2 A;  3AE6 B;  2WP9 B;  3L0W B;  3GE8 C;  1H8C A;  1WJ4 A;  3KYD D;  3B9J A;  3BVG A;  1Z5S B;  2PW9 A;  4GDL A;  2CKH B;  1MHH E;  1V5O A;  3P4S B;  1MG4 A;  4EOY A;  3M95 A;  3WAL A;  2RDB C;  4B95 A;  2OOB B;  4ICU A;  2JQR B;  2ZW1 A;  3CSF A;  5C3J B;  2V1Y A;  4KGT A;  4JWS C;  1TS3 A;  3ZTD A;  1R7S A;  2NBW B;  2WXF A;  3SD5 A;  4NAW A;  2CJO A;  3TCA A;  3Q8C A;  2N9P C;  2KDE B;  3SDL C;  1RLF A;  1CQV A;  2MJD A;  3V62 A;  1SJH D; 
#chains in the Genus database with same CATH homology
 1VRA B;  1HEZ E;  1KTK A;  1MPE A;  1L4Z B;  2N0S B;  4OW0 A;  2M19 A;  5HHD G;  1D5M C;  1NEN B;  1UUP A;  2H89 B;  2VZK B;  1IGD A;  5MPO A;  4FXC A;  1XO3 A;  4ARC A;  1WGK A;  1L6V A;  1FEH A;  4MT5 A;  3KLS X;  2QSD A;  3TEZ A;  3CWI A;  3MC0 B;  2W82 A;  5HFY A;  1L0Y B;  3AE9 B;  4YTN B;  2GI9 A;  2YEP F;  3P1M A;  2LGI A;  1FD6 A;  2PKO A;  2DWQ A;  2KN4 A;  3LYY A;  1C4P A;  2PIA A;  3HVD A;  3L4P A;  2BYT A;  3V05 A;  4USA A;  1GPX A;  2ZW0 A;  3VRB B;  4DQO C;  4YXD B;  3HVZ A;  1SXT A;  3CIR B;  2XN9 C;  4WQM A;  3H8H A;  2PVO D;  4RCO A;  2VZK D;  1PGA A;  3GP7 A;  4LTU A;  4US9 A;  1FMA D;  5T8I A;  1C4A A;  2KMM A;  3AN1 A;  2G9H D;  2QIL A;  3IT4 B;  1QQR A;  3U52 E;  1P7F A;  2FE8 A;  5HI1 A;  3LB8 C;  2WXR A;  4JX1 C;  4RGO S;  4WUR A;  1JWB D;  2EKI A;  2DYO A;  5C2T B;  1HZ5 A;  3AE7 B;  3VR9 B;  3O13 A;  1Y56 A;  4N58 A;  1EWY C;  1GAQ B;  1TJE A;  1QOA A;  3W5V B;  1JAL A;  4P16 A;  3E9S A;  4KGR A;  3W1S A;  2IDY A;  4XWT A;  4ZRP A;  1E7P B;  2AQ1 B;  1C78 A;  3R8B A;  5GXG B;  4J3O D;  3J9C A;  3P4P B;  2LHE A;  4IKG A;  3ZQ4 A;  2K0P A;  1N5W A;  2GRI A;  3R2I A;  1EWC A;  4ZYS A;  2WQY B;  3NUH B;  4YSZ B;  1V1P B;  1QOF A;  2QEJ C;  4PT5 A;  1AYF A;  1I4Q A;  1XLP A;  4HRO A;  4XE0 A;  2IGG A;  3BVM A;  4MAC A;  1TY0 A;  1KFY B;  2N7J A;  3MHZ A;  3ETR A;  1FFU A;  1WSP A;  1B9R A;  2WXI A;  2WXL A;  3IXS A;  2GB1 A;  2J53 A;  1ET9 A;  4YSX B;  3N9Y C;  2EEL A;  3SFE B;  2JWU A;  3GB1 A;  1YNT E;  2V4I B;  1V8C A;  1RM6 C;  3KWL A;  3OWE B;  3NVW A;  3ZJT A;  1TZO A;  2LHD A;  3FC4 A;  2DBY A;  4RNA A;  1FCC C;  1RFK A;  2R61 A;  3Q8E A;  1NEK B;  2LUM A;  3RPF C;  2MJ3 A;  3SEB A;  4A55 A;  2I38 A;  1FRD A;  4JWU C;  1JML A;  1N63 A;  1L0X B;  3MFG A;  1A70 A;  4OVZ A;  4H2A A;  4RF1 A;  4OZB A;  1CZP A;  1KRH A;  3BYY B;  1N60 A;  1KF6 B;  3W9C B;  1TS5 A;  2N9K A;  2WS3 B;  1ZDV A;  4L2Y A;  3IT6 B;  1L6U A;  5E6J A;  2IJ0 A;  3LXF A;  1YQ4 B;  1YMH E;  1K51 A;  2WU5 B;  2X38 A;  4TMA B;  1SF0 A;  3P42 A;  1PFD A;  3EA6 A;  3P63 A;  1IGC A;  2KAJ A;  3AEC B;  3AE1 B;  5I4D A;  2WXJ A;  4RGT A;  3Q69 A;  2WXM A;  1ZP0 B;  2AQ2 B;  4GLS C;  4TQ0 A;  2WXH A;  2ON8 A;  4AS1 A;  3AE8 B;  4KX6 B;  2LEK A;  1XCQ L;  3AM9 A;  1F2R C;  4M0W A;  1L0V B;  1DGJ A;  2ACZ B;  3PO0 A;  1JW9 D;  5D7G A;  3SR6 A;  1DOY A;  4N59 A;  1FNU A;  4R3D A;  3IAM 1;  2W3S A;  4HRS A;  3U4E G;  1ZOY B;  1LO5 D;  2JYT A;  1NVI D;  1BUI C;  1N5X A;  2K5P A;  2SEB D;  4YSY B;  3AV8 A;  1XF5 L;  1I4G A;  4WWM A;  3Q8F A;  2PMV A;  1J7B A;  2IGH A;  2WDR B;  4HKQ A;  4ARI A;  1IUE A;  1M4V A;  2Y5P A;  3VRA B;  1V97 A;  2JXT A;  1FFV A;  2JZP A;  2Z8L A;  1SE2 A;  2BS2 B;  3ZYY X;  1ESF A;  3P4Q B;  2I2Y A;  1C79 A;  3I57 A;  2INN E;  4D2K A;  1YJJ A;  1VJK A;  3AE3 B;  5D3D A;  1YN3 A;  2CU3 A;  2RPV A;  4TSS A;  1OQQ A;  1FO4 A;  1XEE A;  3FIL A;  4IDI A;  1B1Z A;  3KQ4 A;  3V3X A;  2V0G A;  1TYG B;  3AB5 A;  1K50 A;  1ROE A;  1VDV A;  2BBC A;  3B2F A;  3RFZ B;  3BYT B;  4OZC A;  2WNM A;  4LLG M;  4US8 A;  4HKZ E;  1SE3 A;  1NYQ A;  1V1P A;  2B76 B;  1AN8 A;  1D6E C;  1HQR D;  1SSN A;  1FM0 D;  2QIE B;  5FK9 C;  3ZJV A;  2SAK A;  1OQR A;  1YN5 A;  1XLO A;  1E10 A;  2BB6 A;  3Q8A A;  4KKJ A;  1K52 A;  3I9V 1;  3FIL B;  2M56 B;  3ZGZ A;  1HXY D;  4DXG A;  1GOZ A;  1K53 A;  1I4R A;  3TSS A;  1HZ6 A;  1XCT L;  4EE2 A;  4RFB A;  1QOB A;  3HUI A;  2ONQ A;  1AWD A;  3UI3 A;  1D4B A;  5EE9 A;  3MJ5 A;  3P4R B;  1WXQ A;  1I4X A;  3HRD D;  4OZA A;  1E9M A;  4MM3 B;  1FXA A;  1IBX B;  1GB1 A;  1NI3 A;  5TSS A;  1PGX A;  1V1O A;  1FNW A;  3FAH A;  1FNV A;  4N6E B;  4NJC A;  1ZDX A;  1SBB B;  4YT0 B;  2DLB A;  5EE0 A;  4C7Z A;  2J42 A;  1ZXI A;  3C8Y A;  1OFF A;  1QLB B;  1WWT A;  3T3O A;  1I4P A;  1Q10 A;  1SB3 C;  1WRI A;  3BII D;  1FIQ A;  1VLB A;  3AE2 B;  2OED A;  3B2G A;  4P6V F;  5HG2 A;  4C56 C;  4DXF A;  2ICI A;  3DWG C;  1JCK B;  2WU2 B;  4LK0 M;  2NTT A;  2G1E A;  1EU3 A;  1SEB D;  1JRO A;  4ZOH C;  3T3N A;  2JU6 X;  4XDC A;  3AMZ A;  1N61 A;  5H8Y E;  5BYS A;  2JYE A;  2RDH A;  3NZ3 A;  1RYJ A;  2W54 A;  1TKY A;  5JXV A;  2LFI A;  4UDU C;  2FUG 1;  3PZ7 A;  3VQI A;  3U7Z A;  1NYR A;  2TSS A;  5LNK 1;  2IGD A;  3AEG B;  3E56 A;  2MEK A;  1D5X C;  3AEA B;  3AE4 B;  1JWS D;  2W3R A;  5BMG A;  2E3T A;  1YN4 A;  1EU4 A;  5BMH A;  1WYG A;  1MI0 A;  4A6Q A;  1T3Q A;  1TKE A;  1FRR A;  1MVK A;  3ABV B;  4JE3 B;  3MP9 A;  3AE5 B;  3TEW A;  2WXP A;  3W2D A;  2BS4 B;  1XXG A;  1UWM A;  1VR9 A;  3W5U B;  1BXT A;  4ZRQ A;  3BVZ A;  3EGR A;  1F77 A;  1FCL A;  1QKZ A;  2WXG A;  1C4C A;  2K3U A;  1C77 A;  3NVZ A;  3TEY A;  1D5Z C;  2MJE A;  1QT9 A;  3BWU D;  2RMM A;  5AUI A;  2V3P A;  1STE A;  2M0A A;  2IPK D;  5H92 C;  2WXQ A;  1DOX A;  1KH0 A;  3AED B;  1BML C;  1YJI A;  1CJE A;  2BB5 A;  1SJE D;  1UWX A;  3TUO A;  1I4H A;  4KKI A;  1EM7 A;  3WCQ A;  4NAW B;  4RGN A;  4HJG E;  1T6B X;  1VZ7 A;  1PDX A;  4AQ7 A;  1XLQ A;  4RF0 A;  3VR8 B;  3PZ8 A;  3AEF B;  5EE3 A;  2K22 A;  2KAC A;  2WXO A;  3SFD B;  1ET6 A;  2WXK A;  4L23 A;  1MHX A;  4L1B A;  2J52 A;  1F0Z A;  3BK1 A;  5FR3 A;  4XDD A;  1N62 A;  1TKG A;  3AH7 A;  2L83 A;  3U2S C;  4A90 A;  4A8X C;  4KGS A;  4O1N A;  4RGM A;  4WH4 A;  2L52 A;  1JWM D;  1PGB A;  1VZ8 A;  2PVG C;  4ZHP A;  1YQ3 B;  1SE4 A;  1T5X D;  4C7Y A;  2FBW B;  1SIJ A;  4OHJ A;  4NAM A;  4RH6 A;  2N9L A;  5G5H A;  2INP E;  4WAF A;  1QF6 A;  3URY A;  1RWS A;  3NVV A;  1TY2 A;  2BW2 A;  3ZJU A;  1ACC A;  1I7H A;  1C76 A;  1DOI A;  2QMT A;  1TS2 A;  2RDG A;  2Y5C A;  1JWU D;  3DWM A;  1IBX A;  3AEB B;  1CK1 A;  2BT6 A;  4WIP A;  2QJL A;  2KQ4 X;  1HA5 A;  1F2R I;  1DYQ A;  4MH8 A;  1ZE3 D;  2L32 A;  3NS1 A;  2LJI A;  4IOI E;  5D3I B;  1GB4 A;  1E0Z A;  3R2T A;  4TQ1 A;  2H88 B;  1KLU D;  1QOG A;  2Q5W D;  5EE1 A;  1JWA D;  5G5G A;  2PLP A;  4YWG G;  1J7A A;  2Y3A A;  2JX5 A;  2WXN A;  4JPS A;  2BS3 B;  2AQ3 B;  4GDK B;  2NMQ A;  1JQ4 A;  1UNS A;  3BK2 A;  3BZD B;  4C80 A;  1J7C A;  3AE6 B;  2AX5 A;  2WP9 B;  2OHF A;  2V3N A;  2HDE A;  4HEA 1;  2HTM E;  3Q8B A;  1ZPS A;  3GS2 A;  1JRP A;  3KWV A;  4B0M A;  3NRZ A;  4YTP B;  3B9J A;  4A9A A;  1PYW D;  2WLB A;  5BYR A;  3NVY A;  1E6E B;  3BVG A;  2J4X A;  1L4D B;  1ZXH A;  3IAS 1;  2PW9 A;  2DYM A;  4YTM B;  1MHH E;  5BYQ A;  2E6X A;  1ENF A;  1VZ6 A;  4NZL B;  3P4S B;  4CQN A;  2D5G A;  1KLG D;  2WDV B;  3AEE B;  1AW7 A;  1TS4 A;  2BTE A;  2CJN A;  2JSV X;  4ITK A;  2JQR B;  5BMI A;  1FXI A;  2ZW1 A;  2WDQ B;  4GDL B;  5C3J B;  1XLN A;  2PTL A;  2YEP B;  4KGT A;  4B0E A;  2KWD A;  4JWS C;  1TS3 A;  3EUB 2;  5FKA C;  1R7S A;  4REZ A;  1L5P A;  1C9F A;  4ZHO A;  2K9X A;  2MH7 A;  3TEX A;  2WXF A;  2KDM A;  2L1A A;  2CJO A;  2LMC A;  2NTS A;  1QIL A;  3Q8C A;  1P7E A;  1ZUD 2;  1UGJ A;  2W55 A;  1CQV A;  2MJD A;  1PUT A;  4Q2J A;  4XWW A;  1SJH D;  5AUK A;  2XNA C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...