1I7HA

Crystal sturcuture of fdx
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
109
structure length
109
Chain Sequence
PKIVILPHQDLCPDGAVLEANSGETILDAALRNGIEIEHACEKSCACTTCHCIVREGFDSLPESSEQEDDMLDKAWGLEPESRLSCQARVTDEDLVVEIPRYTINHARE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FERREDOXIN
publication title Crystal structure of Escherichia coli Fdx, an adrenodoxin-type ferredoxin involved in the assembly of iron-sulfur clusters.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Electron transport
total genus 27
structure length 109
sequence length 109
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2001-03-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00111 Fer2 2Fe-2S iron-sulfur cluster binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1i7hA00
2BS4B 1EWYC 2K9XA 4ITKA 1FFVA 1NENB 3W5VB 2L83A 5G5HA 1YJIA 2BS3B 4ZHPA 1N61A 4C7ZA 3AE6B 5EE1A 1FRRA 1VDVA 1NEKB 3SR6A 1TKEA 1XO3A 5G5GA 2KAJA 2WDVB 3AE8B 1NYQA 4YTMB 3HUIA 4C7YA 1ZP0B 3EUB2 3FAHA 5AUIA 3AN1A 1J7CA 3HRDD 1QOGA 1L0VB 1WWTA 1SF0A 1L6UA 2B76B 1T3QA 5EE3A 1B9RA 4YXDB 1N5XA 3PO0A 3VR9B 3AH7A 5AUKA 1RWSA 4WWMA 1UWMA 1WXQA 2EKIA 1VJKA 2PIAA 4P6VF 3VRBB 1QOAA 1FFUA 1YQ4B 1E6EB 2WDRB 1JWAD 1CZPA 1RFKA 1E9MA 4USAA 3AE3B 1L6VA 4US9A 2MJ3A 1WRIA 3AM9A 2M56B 1YQ3B 4YTPB 3CIRB 3RPFC 2FBWB 1L5PA 1YJJA 2LEKA 1JW9D 4A9AA 2BT6A 3B2FA 3AEEB 5EE9A 3AEGB 4US8A 1FRDA 1KF6B 1PDXA 2ACZB 1I7HA 2Q5WD 2WP9B 4YSXB 4C80A 2MJDA 1A70A 3DWMA 1WGKA 3NRZA 2JX5A 4N6EB 5C3JB 2MH7A 3ETRA 1NVID 1CJEA 3KWLA 3AE9B 3NVWA 3AECB 1J7AA 1JQ4A 3AE2B 4HRSA 2QJLA 4ZHOA 1JROA 3AMZA 1VLBA 1QLBB 3L4PA 1ZXIA 2M19A 2CJNA 3B9JA 1E0ZA 2BS2B 3P4RB 3DWGC 1XLQA 4FXCA 1V8CA 1N63A 1PUTA 1E7PB 3ABVB 1NI3A 1NYRA 5EE0A 3P4SB 1QOFA 1SIJA 2CU3A 1ZOYB 2DWQA 3AB5A 2PVGC 2W3SA 2DBYA 2H89B 3NS1A 5MPOA 3W9CB 1ROEA 2H88B 2K22A 4IDIA 4JWUC 1DGJA 3SFEB 1FIQA 1SB3C 4N58A 3AEAB 1OFFA 1QOBA 2OHFA 3AEBB 3NVVA 1KFYB 1XLNA 1TYGB 3CWIA 3P63A 3P4PB 1FXIA 1V97A 2N0SB 2WQYB 1PFDA 1TJEA 1R7SA 3AEFB 2PVOD 1KRHA 1GAQB 1N62A 1AWDA 2CJOA 4YSYB 4YTNB 3WCQA 3P4QB 4WQMA 3HVZA 5C2TB 3B2GA 1WYGA 1N5WA 2HTME 2K5PA 1AYFA 1IUEA 2L52A 3AE4B 2WS3B 4YT0B 3AE1B 4N59A 3P1MA 2W3RA 1DOIA 1TKYA 3FC4A 3VR8B 1ZUD2 1F0ZA 1JRPA 1RYJA 3BIID 3LXFA 1TKGA 2KMMA 1QT9A 4KX6B 1OQQA 2QIEB 3AV8A 1DOYA 1E10A 4LTUA 1J7BA 1JWBD 1N60A 4JX1C 3AEDB 2WU2B 3LB8C 5H8YE 2PKOA 2G1EA 3NVYA 3VRAB 5H92C 1FXAA 3W5UB 1XLOA 1DOXA 2WLBA 3SFDB 4ZOHC 1FO4A 2E3TA 3AE7B 2W55A 1RM6C 1GPXA 5GXGB 2Y5CA 1FM0D 2JQRB 2MJEA 3AE5B 1OQRA 1QF6A 4JWSC 2W54A 4YSZB 1JALA 2WDQB 3NVZA 4HROA 2WU5B 2AX5A 3ZYYX 1FMAD 1XLPA
chains in the Genus database with same CATH superfamily
4ARCA 2GBRA 4EUTA 4FN2A 3SR6A 2LGDA 2I2YA 2AYOB 2NPTA 4CO7A 5BYRA 2J52A 3FKYA 4IUMB 3L17A 1HZ5A 1HEZE 1QOAA 1WIAA 3JW0X 2MBEA 1WGHA 3VQIA 3RNBC 3Q3OC 1PQSA 4EZKA 3BWUD 4US8A 2N1VA 3KYDD 2WP9B 4C80A 2LGIA 4N6EB 2Z0EB 3ZGZA 1NVID 1WSPA 5BYSA 1Y8RC 4NAWA 4RM9A 1QLBB 2I1KA 2DZKA 3RI7C 1KM7A 4MH0E 2JU6X 3P4RB 5E6OA 1V8CA 3TIXA 3RFZB 1NI3A 2RSUA 5EE0A 3ML9A 4M8NA 4XDDA 4XX5A 3DCGA 2ZJDA 4W9CA 3QQ8B 4S17A 3BYYB 2KQ7A 4E74A 1C77A 3BVGA 2LHDA 1V97A 3AEFB 4WQOB 4W9LA 3IBEA 2KWUB 1U4AA 4YT0B 3RNEC 1I4QA 4N59A 3O13A 1LO5D 5JHBA 1V80A 1N60A 1JWMD 3NVYA 4W9HA 3PHXB 4DBGA 3PTFC 2WXFA 2WXKA 3S2AA 3B1LX 3VUWA 1WGRA 2KTRB 4OVUA 4K7WA 4K3BA 2BQQA 1WXVA 2V9HA 3KWVA 2AX5A 1S3SG 4FHJA 5D7GA 2RR9A 3HHMA 1FRRA 4FA6A 1WM3A 4EKUA 2IGHA 3PS6A 2GBJA 4GXBA 2G4DB 1L0VB 1GOZA 1Q10A 2WXQA 4WWMA 2WNMA 2IBIB 2PE6B 1YQ4B 4OZCA 3VDZA 1RRBA 2UWQA 4DXFA 2M56B 2BTEA 2BT6A 2JVCA 4HK2A 2LWPA 2JWUA 3DWMA 2ON8A 4ZYSA 1I4XA 2KYWA 2IO0B 4JPSA 4HRSA 4NJ6A 2IY1B 4G11A 2JPHA 4PYUA 2CJNA 1SGHA 3DHGC 4LCDE 4WJOA 1BUIC 1P3QU 2DX5B 4DDID 2W3SA 3PZDA 5BMHA 3QCAA 4TMAB 3Q3MC 4LJOB 1FIQA 2JXXA 3AEBB 3NVVA 1FXIA 3X23A 2J4XA 1F2RI 1BXTA 4KDIC 4BBNF 1JWUD 5LLIA 1SEBD 1FD6A 2N9PC 2W3RA 3VR8B 3FILB 3BIID 2JZPA 2L32A 3BINA 2L0FA 3RNFC 1J7BA 3A4SC 3NG0A 2ZCBA 4AOFA 2GMIC 3CSTA 4KGRA 2E3TA 3AE5B 2NBWB 3LYYA 2FCMA 4JWSC 3NVZA 1XLPA 2QSDA 2L76A 2VZKB 4C4VB 4W9DA 1YJIA 2BS3B 3EGRA 4XZ4A 4WWPA 4IKGA 1EUVB 1XO3A 3ZJVA 3EFUA 4GB9A 4P1BC 3DOWA 3KUDB 2KFJA 1L0XB 4HVBA 2IPKD 5TR5A 2ZEQA 4ICUA 4RNAA 2IGDA 2XBBC 4BKGA 3U8ZA 2EKIA 3E56A 5TSSA 5J18A 2KDBA 5AEKB 3VVWB 1L6VA 2KC1A 4DXGA 3RPFC 4HPMB 2MW5A 3B2FA 3UIOB 1L4ZB 2DYOA 1SJHD 3HM3A 4A6QA 4HDOA 2JWZA 2PMVA 3AE9B 2GBKA 4L23A 5DCNA 3EECA 1ZXIA 1VZ8A 1ACCA 2UYZB 3DWGC 3ABVB 2N1WA 1R4NB 2L8JA 1RFAA 1UZXB 1SB3C 2N4FA 2DAJA 2FUG1 1WJ6A 3Q8BA 5G2NA 4GOCA 1F1HA 3EA6A 3Q8FA 2KJRA 3R7RA 3DDCB 5DPWA 4F1SA 2LHEA 1UGMA 3HIZA 4M0WB 3VXWA 5JHAA 2HJ1A 1XLOA 1V5OA 4HDQA 3ZNZB 3I5JC 5L95C 2BYVE 1WY8A 2Y5CA 1XXGA 3NS8A 2RPQA 3DBHB 3V61A 2CHWA 3TJPA 2QDFA 4Q2JA 1NEKB 2L7RA 4ZDVA 2QC8A 4AWJA 3DVGY 3HUIA 3QX1A 3L0WB 3OAWA 4HPLB 5GMVA 2VRRB 1WXSA 1SE2A 1V81A 5EE3A 2AEHA 2LD9A 1WXQA 2PIAA 2KT7A 3KUZA 3QC8B 3V3XA 3RYTA 2LJ5A 5C23A 1E9MA 4US9A 3M95A 3N32A 2QHOA 4P1CC 2GOWA 1IBXB 2BKFA 1V49A 3AEEB 3AEGB 1OEYJ 1EF1A 4O1NA 1C9FA 2JUOA 2L1AA 3ML8A 1V1OA 3VFKA 4ANUA 4BZAA 2ICIA 4FLHA 2IZVB 1SSNA 2HD5B 1JMLA 2SEBD 3DHHC 3ZO5B 5DPTA 5AZHA 4K3CA 2MSED 2NMQA 1NI2A 4KIKB 3I9V1 2KX0A 1TS4A 2R2QA 3IG3A 2GLSA 4GDLB 3SFEB 3DBLB 4EOYA 4RMAA 2I38A 4A20A 2WXGA 3ZQ4A 4W9GA 1MPEA 1MHXA 1WJNA 5C2TB 2INCC 4ZRQA 4BBNC 5IN7A 4B95A 4IW0A 2LASA 3LDZE 2ZW0A 3P1MA 3EC8A 1RYJA 3OWEB 2ASQA 2KTRA 1OQQA 2M0XA 2J0MA 4GU2A 3PGEA 1R4MB 5D94A 1D4BA 4DK5A 3AE7B 2LVQA 4MELA 2IDYA 4IM2A 2JQRB 1HTOA 2WGSA 2WXHA 3BK1A 1V1PB 4EFOA 1PGAA 4TUUA 4GN1A 1LQBA 4KGSA 1N61A 3ZXRA 4OW0A 5HI1A 4ANXA 2KMAA 2YEPB 4JIOU 2IO1B 4I6LB 1TGZB 2M17A 3U52E 2N9KA 4RF1A 5LNK1 2BKRB 2J0JA 1D3ZA 1CZPA 2AL6A 1FPYA 2KOXA 3HM6X 3Q3JA 5C1ZA 1WMHB 2FBWB 2OOBB 1FNWA 2WHIA 3KLSX 3GP7A 2LZ6A 3CF6E 1E7UA 3KQ4A 3WA0A 2MQJA 3R3MA 3M3JA 3VTUA 1WGKA 2W9NA 1D5XC 2RDGA 3IVFA 3QJZA 4G0NB 5E6NA 1YD8U 1JWSD 3TCAA 3ZDTA 2V1YA 1EWCA 2CU3A 2ONQA 4RM8A 1P7FA 2KJ6A 2K22A 1DGJA 1C78A 1STEA 3H7PB 1IGCA 1GC6A 1XLNA 2KLGA 4B0MA 3FILA 1VZ6A 1KH0A 1GAQB 2FCQA 2FE8A 2WXNA 1ZGUB 1T0SC 2WS3B 4LJPB 2FAZA 3AE1B 3PT2B 1T0RC 4HEA1 3LXFA 2J42A 5HHDG 1UNSA 4OVZA 4C4VA 2N7EA 3ENEA 1WGYA 5JZEB 1EF5A 3W1YA 1RM6C 2EMTA 3K9OB 3L54A 4IC7B 3TEYA 1L4DB 2MJEA 1C1YB 1WE6A 4II3B 1FMAD 3FAHA 3PVLA 2MWSB 1IYFA 4GDKB 5FKAC 4AS1A 1E0ZA 2KAJA 1K52A 4YTMB 2L3ZA 3SDLC 3RD2A 1UBIA 1SE3A 3N20C 4K7UA 3AN1A 3RUIB 4CYEA 1WH3A 2ZPYA 3PLUA 1LXDA 2CU1A 2PE9A 2X8XX 2BBCA 4K81A 3RNGC 2N9LA 2JZ3B 3A1QB 2INDC 4HWIB 1G6JA 4PS7A 3VTVA 2MJDA 3PRMB 2JX5A 2RMMA 1YN5A 3TSSA 2O2VB 3AE2B 1E8YA 1TS3A 3AMZA 2XEWA 2KJHB 2N7JA 4DHJB 3MHZA 4JQWC 2KQ4X 2PVGC 3V60A 2JYTA 1MG8A 3P4PB 1PFDA 3UF8A 4ACFA 3A9KB 3DBRB 4M0WA 2HTME 3Q3FA 4ZRIA 3OG5A 5BO4B 5AZFA 3QHTA 3N9YC 2YLMA 4TSSA 2C7HA 4EEWA 3NZUA 4LTUA 2JF5A 2TSSA 5H92C 2ZW1A 1H8CA 4OVVA 3SFDB 4ZOHC 1GPXA 2KFKB 4BKSA 3W2DA 1GNUA 3DHIC 2QMTA 1SBBB 4ZRPA 3R2TA 1PYWD 2MBQA 2W54A 5CHVC 1V2YA 3U7ZA 4IWPA 2JT4B 3TBLD 1TZOA 1V6EA 2RPVA 2RDBC 2MBHA 4AUQC 2MBOA 4LNNA 1WWTA 1TZ1A 1IBXA 1ZKHA 4W9EA 1LM8B 4JLCA 1UWMA 4HXDA 4EZLA 3QIJA 3H8HA 2JZZA 5J17A 3AM9A 3WIMA 1JW9D 1HQRD 3GZNI 5EE9A 5E6PA 1PDXA 4K7SA 1A70A 3A4RA 4A3OA 4I6NB 4KIKA 3AECB 2Z8LA 2BYTA 5I4DA 4NJCA 4GDLA 4PT5A 4MSQB 4WJPA 2WXRA 1FNVA 2HJ8A 4RH6A 2DHZA 3UQAA 1KOTA 5AZGA 1CQVA 2PEAA 3W9CB 1SJED 1UBQA 2DYMA 3B0AA 3ZLZA 2YEPF 2N7DA 1ZE3D 2K6QA 5JXVA 3IXSA 2K5PA 2PJHA 1C3TA 1GJZA 2AWTA 4LK0M 1M94A 3W1SC 4KX6B 1DOYA 2QIEB 3DVGX 4HKZE 4ZYNA 2BF8B 1V1PA 4JGHB 4LNOA 1WE7A 3MC9A 3H6NA 1YNTE 1E8XA 3AULA 1J19A 2WYQA 2LGYA 4WJNA 1FO4A 2GBMA 2BPSA 2K39A 2NTTA 2M4NA 1CMXB 3ZJUA 1F9JA 1WR1A 2MX2A 2D07B 2EMSA 4B6WA 4MT5A 1T6BX 3AE6B 3N1YC 3APDA 3UQBA 3TEZA 2KD0A 1UH6A 3Q8EA 3RULA 2K0PA 4TV3A 2ZNVB 1SF0A 1WMHA 4KKJA 2B76B 4A8XC 2J0KA 2FCNA 4PS3A 2AL3A 3QARA 2KDMA 2C9WB 4A90A 2WDRB 1XEEA 1F77A 4IWOA 2MJ3A 3WAOA 3EFCA 4ZRJA 2LEKA 3QWZB 1FCLA 1FRDA 3PHWB 1VZ7A 3AU5A 3U30A 1CJEA 3JSVB 5T8IA 3NVWA 2BYFA 4ASWC 3A33B 3RNCC 2LFIA 2WXPA 1NDDA 3H7PA 2GRIA 2ZVNA 3CMMB 1XLQA 1UGJA 2L00B 4IM3A 1OTRB 4NY0A 5IP4D 1ZOYB 2DBYA 4MJSB 3PZ8A 3NUHB 1N62A 2CJOA 3ALBA 4W9JA 2LGSA 3B2GA 2QCZA 1TBEA 1HZ6A 2VZKD 3BVZA 1HXYD 1K50A 3OJ3A 1MI0A 3ZNGC 2KLCA 3R66C 3ZDMC 4MSMB 4KSKC 4GDKA 3APCA 5D6JB 5IA7A 4AJWA 3V6EB 2WU5B 1WX7A 1VD2A 1L7YA 2K6DB 2K9XA 1GC7A 4HPPA 5G5HA 3Q8AA 3U7DA 3PZ7A 1T0YA 2PTLA 5G5GA 3IAS1 4MGIE 4OZBA 5AUIA 3RZWC 3HRDD 4GMVA 1FCCC 2KWDA 1T3QA 1WGGA 1AW7A 3V62A 5J2RA 2G3QB 4XWTA 1YJJA 2O2VA 4A9AA 4BOZB 4JL9A 1HE8A 3H9DA 4XWWA 4DDGD 5D3IB 1S1QB 1UD7A 4PK1A 1P1AA 3QK0A 4ANVA 4E3CA 3DBSA 4L2YA 2Z0DB 3C8YA 1FEHA 1XQQA 2QEJC 4IWQA 2DENB 1C4PA 2JYEA 3A9KA 3DPDA 4XGAB 3Q69A 1KTKA 2LUMA 1P9DU 5HKHA 4EE2A 4KKIA 1R7SA 2CS4A 1C4CA 1AWDA 2MP2B 3Q6BA 3R7QA 2HE7A 2EELA 4BFRA 2YVCA 2W82A 1JRPA 4BKSD 1L2NA 2KMMA 2KFKA 1MVKA 1IGDA 3AU4A 4NQLB 4MGKE 3UINB 1BT0A 2PKOA 2KK8A 3W5UB 2KHWB 2MLBA 2WLBA 1GG3A 2LMCA 2JRHA 4BAXA 3H1UA 1JALA 3OLMD 3ZYYX 3SEBA 2ZVOA 2KO3A 4HCPB 1TKEA 3ZW3A 2D5GA 3ZTDA 3HK0A 3EUB2 2KX3A 1GB1A 1QOGA 2M0AA 3ZUNA 4LDTB 1WRDB 1RWSA 3VRBB 4P6VF 2QILA 2DZJA 3RN9C 3MHSD 1WXAA 3CIRB 1L5PA 3GE3C 1WX9A 4FADA 4JE3B 1KF6B 1MFWA 2Q5WD 1JCKB 3RMKC 1R4NI 3NOBA 2LVOA 3BY4B 4F7ZA 1JQ4A 1VLBA 3B9JA 2UU7A 1F52A 3I57A 1TY2A 3L13A 2BS2B 1T0QC 1UF0A 4N9F4 4PS8A 1VCBA 3AB5A 2AQ2B 1Z5SB 3KYCD 2AQ3B 3AEAB 3ZTCA 2CKHB 2PVOD 4LDTD 4IG7B 1L0YB 2BWES 4I6PA 3ZXVA 1D5MC 3ZVVA 5BYQA 3IHPC 1RLFA 3DBHI 1TKGA 1E10A 3KW5B 2C5LC 4OZAA 4JX1C 2KWVB 1FNUA 1WF9A 4EZJA 4KGTA 3Q3NC 4GGQA 4AQ7A 3GOEA 1DOXA 1EM7A 2XN9C 2V3PA 3IT4B 2RD0A 1FM0D 5CX3A 1OQRA 3MJ5A 1QF6A 4NPNA 2L83A 4B0EA 4C7ZA 3RT3B 3TMPB 2BB5A 2AQ1B 4C7YA 2KANA 2LUEA 5BMGA 3ZKJC 5CTRC 3MTNB 3VTWA 1FXTB 2NTSA 4XE0A 4TKNA 3Q8CA 4G50A 1GUAB 4KV2A 1E6EB 2KKCA 1B1ZA 2IO2B 1P98A 1WRIA 3JSVA 4WAFA 2O6VB 1WZ3A 2MA9B 3U4EG 1VR9A 3VUYA 3IAM1 4HKQA 3P42A 2LXAA 4OHJA 5C3JB 4FULA 3X0WA 1ISNA 2V3NA 3DBLI 3PPAA 4MJSA 3NZSA 1K51A 1PUTA 2K8HA 2KVZA 4UDUC 1XD3B 4J6IA 2H89B 1ROEA 2D3CA 2H88B 2INPE 2RDHA 4CQNA 3H7SA 4LLGM 1TJEA 2VH2A 4J3OD 3NY5A 4MM3B 1N5WA 2MRPA 4RCOA 2O6VD 3MJWA 1ZDVA 1F0ZA 4GLSC 2FNJB 3AV8A 1JWBD 1LGRA 2BWFA 1MHHE 3P2BA 2IGGA 2NS5A 1TS2A 1XCTL 2KN4A 2DZIA 1K53A 4RGTA 5GXGB 2RGFA 3GS2A 4MGZE 4AJYB 2KVRA 1EO6A 2WDQB 4HROA 2Y3AA 2BS4B 4ZRKA 4ITKA 3C0RB 2V0GA 4ZHPA 2NR2A 1HA5A 4PYZA 2E6XA 1VRAB 1AARA 4HLEA 4M00A 5IAAC 5KHQA 2XK5B 4MDKE 1V9JA 3MFGA 3VR9B 2C7MB 3PLVA 3PRPB 4DHJD 2DNFA 1RFKA 4DHZE 2K8CA 1I42A 5FR6A 2EKEC 4F8CB 2M8SA 3VHTC 1RAXA 2KN5A 3WAPA 4YWGG 4RGMA 5BMIA 2ZPNA 1SIFA 2OJRA 3GE8C 2FUHB 3O65B 4E71A 4ZHOA 3E9SA 3IT6B 2KACA 1N63A 1QOFA 5MPOA 2MP2A 2OJWA 3I3TB 4JWUC 1I4RA 2LRUA 1WR6E 3AI5A 2BVCA 2J7QB 4N58A 3P63A 1KFYB 3VUXA 3UI3A 1H4RA 1KRHA 2ZNVC 3RCZA 2BB6A 2D11A 1I4GA 1PGXA 3PV1A 1AYFA 2MHJA 1C4AA 2KTFA 1YN3A 2L52A 4XDCA 5IKCM 4ARIA 1ZPSA 1DOIA 2ZCCA 3FC4A 4TQ1A 1KLGD 4WWNA 1QT9A 3C19A 1QQRA 2G1EA 1TT5B 5KHOA 2W55A 2DZMA 4FJZA 2D3BA 4II2B 1WI0A 1I4HA 4DQOC 3W5VB 4BOSC 4W9KA 3ZIMA 5EE1A 5CHFA 4KVGB 4L1BA 1Q0WB 1ZP0B 3B08A 1J7CA 1I35A 3ZRCA 3BZDB 5G55A 4YXDB 1N5XA 3AH7A 4MACA 2VH1A 1AN8A 3NJTA 1SXTA 3NZ3A 1JWAD 2G9HD 3N3KB 3SU8X 3D32A 1XF5L 1XCQL 4A55A 2Y5PA 1A5RA 3U2SC 4ICVA 5DPRA 3I63C 1J7AA 3TEXA 5HFYA 3T8MA 4DHZB 3T3NA 2D10A 5E6JA 2N9EB 3DBRI 2D3AA 1E7PB 4G3XB 2WWZA 1NYRA 2LI5A 2DAFA 1SIJA 2DWQA 3CSFA 2JXTA 3NS1A 3A9JB 1YIWA 2KWCA 2KC2A 3TUOA 2IO3B 4GSWA 1YX6B 4NNJB 5L83A 3BYTB 1EU4A 2WQYB 1D5ZC 4CHKA 2LVPA 4A3PA 2K8BA 3PREA 2B3AA 4FBJB 1N6ZA 1TS5A 1SE4A 5CHWA 1XT9B 4P7IA 3LJ3A 4IM0A 4GIVA 1ZUD2 2BGFA 4HJGE 3AEDB 2FCSA 3VRAB 4TQ0A 4REZA 2LGXA 1UELA 4MGYE 1K8RB 3VAWA 4FJYA 2V4LA 2BYEA 1WFYA 4YSZB 1WM2A 3URYA 3QAQA 2MBBB 3EHVA 2IY0B 1DYQA 4WAAA 2REXA 1VDVA 2R2OA 2CHXA 3AE8B 1NYQA 4IOIE 1Q1OA 5FR3A 4KZCA 3ZJTA 2PPHA 2HTHA 2O6VA 1C79A 3VH4B 4KDLB 4MH8A 1B9RA 4RGOS 3PO0A 2FIFA 4BKTA 3GB1A 1NBFC 1J0GA 2HDEA 3R2IA 1FFUA 2NPTB 4KSLC 3BVMA 5IO9A 4YTPB 3JYUA 3HVDA 4W9IA 2ACZB 1I7HA 2I1JA 4YSXB 2MH7A 3ETRA 4WIPA 1P7EA 2K25A 4R3DA 3M62B 1WJUA 2QJLA 3A1QA 4XYCA 3L4PA 4YL8A 2M19A 3PRZA 4WJQA 2KDIA 3SD5A 4RGNA 3V6CB 3Q14C 2L0TA 2KZRA 4MM3A 2PLPA 3PSEB 5EDSA 3UGBB 4NAWB 1SE9A 1WJ4A 1YOVB 2SAKA 2INNE 3UIPB 1CK1A 2NBVB 2K3UA 1OFFA 4S0RA 4C56C 3CWIA 1TYGB 2WDTB 4D2KA 5LXHA 4YTNB 5FK9C 1MG4A 4URKA 2D3GA 3N1XC 1ET9A 2KDEB 5DPSA 1TKYA 1YMHE 4B9KA 1WGDA 1YX5B 3AXCA 4WURA 5H8YE 2CHZA 2Y5BB 1FXAA 5JH5C 2L05A 4NZLB 4M02A 1V5TA 3ZNID 1T5XD 3TL5A 2A5UA 2WXOA 2WXJA 3ECIA 2KDFB 2WX1A 2XK5A 1FFVA 1NENB 4NQKE 2A4ZA 3RZFA 1TY0A 2WXMA 1KJTA 2WX0A 3TEWA 1ZW7A 2V3SA 1Z2MA 1YQBA 2X38A 2LRWA 3L08A 2NVUI 3DQVA 1E5WA 1JRUA 4M01A 5AUKA 1EU3A 5HG2A 1HTQA 1VJKA 1WZ0A 4USAA 3WAMA 1ESFA 1YQ3B 2JY6A 1V86A 2KXJA 5D3DA 2KQSA 3MC8A 3J9CA 1M4VA 4NAMA 2WXIA 2Z59B 3WALA 2ZZPB 3KWLA 4FJVB 3M63B 3T9LA 3V05A 2V4IB 1E7VA 4QAYA 4W9FA 3P4SB 2CR5A 1KLUD 1Y56A 2J53A 4RFBA 4C00A 2MEKA 2R61A 3BK2A 3RNAC 3JVZX 3L16A 3R8BA 1BMLC 1QZEA 2OHFA 2GBNA 3QA8A 2MCNB 4YSYB 1IP9A 1LFDA 1KLVA 1X1MA 3HVZA 1QILA 1TIFA 1WYGA 1UUPA 3KVFB 4WWOA 1MJDA 3ZRFA 1IUEA 3K9PB 5D2MB 2DLBA 1YJ1A 3AE4B 3MC0B 1C76A 3Q2AC 1P0RA 2K1FA 2KNBA 4M8MA 3NHEB 2LXCA 2G45B 2OEDA 2M1MA 1WYWB 1OEYA 2IYDB 5IOIA 4MEMA 4DWFA 2JRIB 4NJ7A 1ZXHA 3L10B 1WXMA 4HJKA 2FIDA 1WX8A 1EWYC 4LNIA 3N30A 2WDVB 2IJ0A 4KZ0A 2GB1A 4WH4A 2C7NB 2WXLA 1TTNA 1L6UA 4HCNB 4XC2A 2D2QA 1ET6A 4BVUC 2NBUA 4FHKA 3AE3B 4ANWA 3KUCB 4RF0A 4X57B 1E8WA 1E90A 1IPGA 1F2RC 3NRZA 2LJIA 3A9JA 1JROA 2JSVX 4K1RB 4FXCA 3DVNU 3GZNB 1YN4A 1D6EC 1I4PA 3SHQA 1E8ZA 4DXAB 4IDIA 2PW9A 2NCNA 2G4SA 1ZDXA 1QOBA 2KMCA 5LXIB 2N0SB 4LNFA 1QKZA 3WCQA 2DYBA 3T3OA 1UWXA 3P4QB 4WQMA 3KH0A 4AP4C 3ONSA 1Q5WB 2N9XA 1OQYA 3MP9A 3N1ZC 2C60A 2GI9A 3WANA 3OJ4B 3IFWB 4P16A 2WU2B 3LB8C 1GB4A 1OGWA 3W1SA 3DVNV 4H2AA 1J8CA 1PGBA 3ZNHB 2XNAC 4LNKA 3APFA 1R4MI 2BW2A 1ENFA 3VH3B
chains in the Genus database with same CATH topology
4ARCA 2K9XA 4DQOC 3W5VB 4KGSA 5G5HA 1N61A 3Q8AA 4OW0A 5EE1A 5HI1A 3SR6A 3PZ7A 2PTLA 5G5GA 3IAS1 4L1BA 2I2YA 4OZBA 1ZP0B 2YEPB 5AUIA 1J7CA 3HRDD 5BYRA 3BZDB 2J52A 1FCCC 2KWDA 1T3QA 4YXDB 3U52E 1N5XA 3AH7A 4MACA 1AN8A 2N9KA 1AW7A 4RF1A 1HZ5A 1HEZE 1QOAA 1SXTA 5LNK1 3NZ3A 1JWAD 1CZPA 3VQIA 2G9HD 4XWTA 2FBWB 1YJJA 1FNWA 3KLSX 4A9AA 3GP7A 1XF5L 3BWUD 3KQ4A 4US8A 2WP9B 4XWWA 4C80A 5D3IB 1WGKA 1XCQL 2LGIA 4N6EB 3ZGZA 4A55A 2Y5PA 1NVID 1D5XC 1WSPA 2RDGA 3U2SC 1ENFA 1J7AA 4L2YA 3C8YA 3TEXA 5BYSA 1FEHA 1QLBB 5HFYA 3T3NA 1JWSD 2JU6X 2QEJC 3P4RB 5E6JA 1C4PA 1V8CA 3RFZB 1E7PB 1NI3A 1NYRA 2JYEA 5EE0A 1EWCA 1SIJA 2CU3A 2DWQA 2ONQA 2JXTA 3NS1A 1P7FA 3Q69A 4XDDA 2K22A 1DGJA 1KTKA 1C78A 1STEA 2LUMA 3TUOA 1IGCA 3BYYB 1C77A 1XLNA 3BVGA 2LHDA 1EU4A 3BYTB 1V97A 4B0MA 2WQYB 3FILA 1VZ6A 1KH0A 1R7SA 3AEFB 1D5ZC 1GAQB 1C4CA 1AWDA 4KKIA 2FE8A 2WXNA 2EELA 1SE4A 1TS5A 2WS3B 4YT0B 2W82A 1I4QA 3AE1B 4N59A 1ZUD2 4HEA1 1JRPA 3LXFA 3O13A 2J42A 1LO5D 2KMMA 5HHDG 1MVKA 1IGDA 4HJGE 1N60A 1JWMD 3AEDB 2PKOA 1UNSA 3NVYA 3VRAB 4OVZA 4TQ0A 4REZA 3W5UB 2WXFA 2WLBA 2WXKA 2LMCA 1RM6C 3TEYA 1L4DB 2MJEA 4YSZB 1JALA 3ZYYX 3KWVA 2AX5A 3URYA 1FMAD 3FAHA 3SEBA 5D7GA 1DYQA 4GDKB 5FKAC 4AS1A 1FRRA 1VDVA 1E0ZA 1TKEA 2KAJA 1K52A 3AE8B 1NYQA 4YTMB 4IOIE 2D5GA 1SE3A 5FR3A 3EUB2 2IGHA 1GB1A 3AN1A 3ZJTA 1QOGA 1L0VB 1GOZA 1Q10A 1C79A 2WXQA 2M0AA 4MH8A 1B9RA 4RGOS 3PO0A 1RWSA 3GB1A 4WWMA 4P6VF 2HDEA 3VRBB 2WNMA 2QILA 3R2IA 1FFUA 1YQ4B 4OZCA 2BBCA 3BVMA 4DXFA 4YTPB 2M56B 3CIRB 1L5PA 2N9LA 2BTEA 2BT6A 3HVDA 4JE3B 1KF6B 2ACZB 1I7HA 2Q5WD 4YSXB 1JCKB 2MJDA 2JWUA 3DWMA 2JX5A 2MH7A 2ON8A 3ETRA 2RMMA 1P7EA 4WIPA 4ZYSA 1YN5A 1I4XA 4R3DA 3TSSA 4JPSA 1JQ4A 3AE2B 4HRSA 1TS3A 2QJLA 3AMZA 1VLBA 3L4PA 2M19A 2CJNA 3B9JA 3I57A 1TY2A 2BS2B 4RGNA 2N7JA 3MHZA 1BUIC 2KQ4X 3AB5A 2AQ2B 2PLPA 2PVGC 2W3SA 5BMHA 4TMAB 4NAWB 2JYTA 1FIQA 2SAKA 2INNE 1CK1A 2K3UA 2AQ3B 3AEAB 1OFFA 3AEBB 3NVVA 3P4PB 3CWIA 4C56C 1TYGB 1FXIA 1PFDA 4D2KA 2PVOD 4YTNB 2J4XA 5FK9C 1F2RI 1L0YB 4M0WA 1BXTA 2HTME 1D5MC 1ET9A 1JWUD 1SEBD 5BYQA 1FD6A 3N9YC 2W3RA 1TKYA 3VR8B 1YMHE 3FILB 4TSSA 3BIID 2JZPA 2L32A 1TKGA 1E10A 4LTUA 4OZAA 1J7BA 4JX1C 4WURA 2TSSA 5H8YE 1FNUA 5H92C 2ZW1A 4KGTA 1FXAA 4AQ7A 1DOXA 1EM7A 4NZLB 4KGRA 3SFDB 2XN9C 2V3PA 1T5XD 2E3TA 4ZOHC 3IT4B 2WXOA 1GPXA 3W2DA 1FM0D 2QMTA 3AE5B 3LYYA 1OQRA 1SBBB 3MJ5A 3R2TA 4ZRPA 4JWSC 1PYWD 1QF6A 2W54A 2WXJA 3NVZA 1XLPA 2QSDA 2VZKB 1FFVA 1NENB 3U7ZA 2L83A 4B0EA 1YJIA 2BS3B 3EGRA 4C7ZA 1TY0A 2WXMA 4IKGA 1XO3A 3ZJVA 3TEWA 2BB5A 1TZOA 2AQ1B 4C7YA 2RPVA 1L0XB 2X38A 2IPKD 5BMGA 1WWTA 1IBXA 4RNAA 2IGDA 2NTSA 5AUKA 1EU3A 5HG2A 4XE0A 1UWMA 2EKIA 3E56A 1VJKA 3Q8CA 5TSSA 1E6EB 3H8HA 4USAA 1B1ZA 1L6VA 4DXGA 1WRIA 3AM9A 4WAFA 1ESFA 1YQ3B 3RPFC 3U4EG 1JW9D 1HQRD 1VR9A 3B2FA 5D3DA 5EE9A 1L4ZB 3IAM1 1PDXA 4HKQA 3P42A 2DYOA 3J9CA 1M4VA 1A70A 1SJHD 4NAMA 2WXIA 4OHJA 5C3JB 4A6QA 3KWLA 2V3NA 2PMVA 3AE9B 3AECB 2Z8LA 2BYTA 5I4DA 4L23A 4NJCA 1K51A 1ZXIA 1VZ8A 1ACCA 4PT5A 3DWGC 3V05A 2V4IB 3ABVB 1PUTA 2WXRA 1FNVA 4RH6A 3P4SB 1KLUD 4UDUC 1Y56A 2J53A 4RFBA 1CQVA 2MEKA 2H89B 2R61A 3BK2A 3W9CB 1ROEA 1SJED 2H88B 2INPE 3R8BA 2RDHA 1BMLC 2DYMA 1SB3C 4CQNA 2FUG1 2OHFA 2YEPF 3Q8BA 4LLGM 1TJEA 1ZE3D 4YSYB 4J3OD 4MM3B 3HVZA 5JXVA 1QILA 1WYGA 1N5WA 1UUPA 2K5PA 3IXSA 1IUEA 2DLBA 3EA6A 3AE4B 3Q8FA 3MC0B 4RCOA 4LK0M 1ZDVA 1C76A 1F0ZA 4GLSC 2LHEA 4KX6B 1DOYA 2QIEB 3AV8A 4HKZE 1JWBD 1V1PA 2OEDA 1MHHE 1YNTE 1XLOA 2IGGA 1TS2A 1FO4A 1XCTL 2KN4A 1K53A 4RGTA 1ZXHA 5GXGB 2Y5CA 2NTTA 1XXGA 3GS2A 2WDQB 3ZJUA 4HROA 2Y3AA 2BS4B 1EWYC 4ITKA 2V0GA 4ZHPA 4Q2JA 4MT5A 1T6BX 3AE6B 1HA5A 1NEKB 2WDVB 2IJ0A 2E6XA 3HUIA 1VRAB 2GB1A 4WH4A 3TEZA 3Q8EA 2K0PA 2WXLA 1SE2A 1SF0A 3MFGA 4KKJA 1L6UA 2B76B 5EE3A 4A8XC 3VR9B 1ET6A 2KDMA 1WXQA 2PIAA 4A90A 2WDRB 3V3XA 1XEEA 1F77A 1RFKA 1E9MA 3AE3B 4US9A 4RF0A 2MJ3A 2LEKA 1IBXB 3AEEB 1FCLA 3AEGB 1FRDA 1VZ7A 4O1NA 1C9FA 2L1AA 1F2RC 3NRZA 4YWGG 1V1OA 4RGMA 5BMIA 1CJEA 2LJIA 5T8IA 3NVWA 2ICIA 4ZHOA 2LFIA 1JROA 3E9SA 2WXPA 2JSVX 1SSNA 2GRIA 3IT6B 1JMLA 1XLQA 2SEBD 4FXCA 2KACA 1N63A 1UGJA 1YN4A 1D6EC 1I4PA 1QOFA 2NMQA 1ZOYB 5MPOA 2DBYA 3I9V1 1TS4A 4IDIA 1I4RA 2PW9A 3PZ8A 4JWUC 4GDLB 3SFEB 1ZDXA 4N58A 2I38A 1QOBA 3NUHB 3P63A 2WXGA 1KFYB 3ZQ4A 2N0SB 3UI3A 1QKZA 1KRHA 1N62A 2CJOA 3WCQA 1MPEA 1MHXA 3T3OA 1UWXA 2BB6A 3P4QB 4WQMA 1I4GA 1PGXA 5C2TB 4ZRQA 3B2GA 1AYFA 1HZ6A 1C4AA 3MP9A 1YN3A 2L52A 2VZKD 4XDCA 3BVZA 2ZW0A 1HXYD 1K50A 1ZPSA 3P1MA 4ARIA 1DOIA 3FC4A 4TQ1A 1MI0A 1KLGD 1RYJA 3OWEB 2GI9A 1QT9A 1OQQA 4P16A 1QQRA 2WU2B 3LB8C 2G1EA 1GB4A 3W1SA 1D4BA 4EE2A 4H2AA 3AE7B 2W55A 1PGBA 2XNAC 2IDYA 2JQRB 2WXHA 3BK1A 2BW2A 1V1PB 1I4HA 2WU5B 1PGAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2BS4 B;  1EWY C;  2K9X A;  4ITK A;  1FFV A;  1NEN B;  3W5V B;  2L83 A;  5G5H A;  1YJI A;  2BS3 B;  4ZHP A;  1N61 A;  4C7Z A;  3AE6 B;  5EE1 A;  1FRR A;  1VDV A;  1NEK B;  3SR6 A;  1TKE A;  1XO3 A;  5G5G A;  2KAJ A;  2WDV B;  3AE8 B;  1NYQ A;  4YTM B;  3HUI A;  4C7Y A;  1ZP0 B;  3EUB 2;  3FAH A;  5AUI A;  3AN1 A;  1J7C A;  3HRD D;  1QOG A;  1L0V B;  1WWT A;  1SF0 A;  1L6U A;  2B76 B;  1T3Q A;  5EE3 A;  1B9R A;  4YXD B;  1N5X A;  3PO0 A;  3VR9 B;  3AH7 A;  5AUK A;  1RWS A;  4WWM A;  1UWM A;  1WXQ A;  2EKI A;  1VJK A;  2PIA A;  4P6V F;  3VRB B;  1QOA A;  1FFU A;  1YQ4 B;  1E6E B;  2WDR B;  1JWA D;  1CZP A;  1RFK A;  1E9M A;  4USA A;  3AE3 B;  1L6V A;  4US9 A;  2MJ3 A;  1WRI A;  3AM9 A;  2M56 B;  1YQ3 B;  4YTP B;  3CIR B;  3RPF C;  2FBW B;  1L5P A;  1YJJ A;  2LEK A;  1JW9 D;  4A9A A;  2BT6 A;  3B2F A;  3AEE B;  5EE9 A;  3AEG B;  4US8 A;  1FRD A;  1KF6 B;  1PDX A;  2ACZ B;  1I7H A;  2Q5W D;  2WP9 B;  4YSX B;  4C80 A;  2MJD A;  1A70 A;  3DWM A;  1WGK A;  3NRZ A;  2JX5 A;  4N6E B;  5C3J B;  2MH7 A;  3ETR A;  1NVI D;  1CJE A;  3KWL A;  3AE9 B;  3NVW A;  3AEC B;  1J7A A;  1JQ4 A;  3AE2 B;  4HRS A;  2QJL A;  4ZHO A;  1JRO A;  3AMZ A;  1VLB A;  1QLB B;  3L4P A;  1ZXI A;  2M19 A;  2CJN A;  3B9J A;  1E0Z A;  2BS2 B;  3P4R B;  3DWG C;  1XLQ A;  4FXC A;  1V8C A;  1N63 A;  1PUT A;  1E7P B;  3ABV B;  1NI3 A;  1NYR A;  5EE0 A;  3P4S B;  1QOF A;  1SIJ A;  2CU3 A;  1ZOY B;  2DWQ A;  3AB5 A;  2PVG C;  2W3S A;  2DBY A;  2H89 B;  3NS1 A;  5MPO A;  3W9C B;  1ROE A;  2H88 B;  2K22 A;  4IDI A;  4JWU C;  1DGJ A;  3SFE B;  1FIQ A;  1SB3 C;  4N58 A;  3AEA B;  1OFF A;  1QOB A;  2OHF A;  3AEB B;  3NVV A;  1KFY B;  1XLN A;  1TYG B;  3CWI A;  3P63 A;  3P4P B;  1FXI A;  1V97 A;  2N0S B;  2WQY B;  1PFD A;  1TJE A;  1R7S A;  3AEF B;  2PVO D;  1KRH A;  1GAQ B;  1N62 A;  1AWD A;  2CJO A;  4YSY B;  4YTN B;  3WCQ A;  3P4Q B;  4WQM A;  3HVZ A;  5C2T B;  3B2G A;  1WYG A;  1N5W A;  2HTM E;  2K5P A;  1AYF A;  1IUE A;  2L52 A;  3AE4 B;  2WS3 B;  4YT0 B;  3AE1 B;  4N59 A;  3P1M A;  2W3R A;  1DOI A;  1TKY A;  3FC4 A;  3VR8 B;  1ZUD 2;  1F0Z A;  1JRP A;  1RYJ A;  3BII D;  3LXF A;  1TKG A;  2KMM A;  1QT9 A;  4KX6 B;  1OQQ A;  2QIE B;  3AV8 A;  1DOY A;  1E10 A;  4LTU A;  1J7B A;  1JWB D;  1N60 A;  4JX1 C;  3AED B;  2WU2 B;  3LB8 C;  5H8Y E;  2PKO A;  2G1E A;  3NVY A;  3VRA B;  5H92 C;  1FXA A;  3W5U B;  1XLO A;  1DOX A;  2WLB A;  3SFD B;  4ZOH C;  1FO4 A;  2E3T A;  3AE7 B;  2W55 A;  1RM6 C;  1GPX A;  5GXG B;  2Y5C A;  1FM0 D;  2JQR B;  2MJE A;  3AE5 B;  1OQR A;  1QF6 A;  4JWS C;  2W54 A;  4YSZ B;  1JAL A;  2WDQ B;  3NVZ A;  4HRO A;  2WU5 B;  2AX5 A;  3ZYY X;  1FMA D;  1XLP A; 
#chains in the Genus database with same CATH topology
 4ARC A;  2GBR A;  4EUT A;  4FN2 A;  3SR6 A;  2LGD A;  2I2Y A;  2AYO B;  2NPT A;  4CO7 A;  5BYR A;  2J52 A;  3FKY A;  4IUM B;  3L17 A;  1HZ5 A;  1HEZ E;  1QOA A;  1WIA A;  3JW0 X;  2MBE A;  1WGH A;  3VQI A;  3RNB C;  3Q3O C;  1PQS A;  4EZK A;  3BWU D;  4US8 A;  2N1V A;  3KYD D;  2WP9 B;  4C80 A;  2LGI A;  4N6E B;  2Z0E B;  3ZGZ A;  1NVI D;  1WSP A;  5BYS A;  1Y8R C;  4NAW A;  4RM9 A;  1QLB B;  2I1K A;  2DZK A;  3RI7 C;  1KM7 A;  4MH0 E;  2JU6 X;  3P4R B;  5E6O A;  1V8C A;  3TIX A;  3RFZ B;  1NI3 A;  2RSU A;  5EE0 A;  3ML9 A;  4M8N A;  4XDD A;  4XX5 A;  3DCG A;  2ZJD A;  4W9C A;  3QQ8 B;  4S17 A;  3BYY B;  2KQ7 A;  4E74 A;  1C77 A;  3BVG A;  2LHD A;  1V97 A;  3AEF B;  4WQO B;  4W9L A;  3IBE A;  2KWU B;  1U4A A;  4YT0 B;  3RNE C;  1I4Q A;  4N59 A;  3O13 A;  1LO5 D;  5JHB A;  1V80 A;  1N60 A;  1JWM D;  3NVY A;  4W9H A;  3PHX B;  4DBG A;  3PTF C;  2WXF A;  2WXK A;  3S2A A;  3B1L X;  3VUW A;  1WGR A;  2KTR B;  4OVU A;  4K7W A;  4K3B A;  2BQQ A;  1WXV A;  2V9H A;  3KWV A;  2AX5 A;  1S3S G;  4FHJ A;  5D7G A;  2RR9 A;  3HHM A;  1FRR A;  4FA6 A;  1WM3 A;  4EKU A;  2IGH A;  3PS6 A;  2GBJ A;  4GXB A;  2G4D B;  1L0V B;  1GOZ A;  1Q10 A;  2WXQ A;  4WWM A;  2WNM A;  2IBI B;  2PE6 B;  1YQ4 B;  4OZC A;  3VDZ A;  1RRB A;  2UWQ A;  4DXF A;  2M56 B;  2BTE A;  2BT6 A;  2JVC A;  4HK2 A;  2LWP A;  2JWU A;  3DWM A;  2ON8 A;  4ZYS A;  1I4X A;  2KYW A;  2IO0 B;  4JPS A;  4HRS A;  4NJ6 A;  2IY1 B;  4G11 A;  2JPH A;  4PYU A;  2CJN A;  1SGH A;  3DHG C;  4LCD E;  4WJO A;  1BUI C;  1P3Q U;  2DX5 B;  4DDI D;  2W3S A;  3PZD A;  5BMH A;  3QCA A;  4TMA B;  3Q3M C;  4LJO B;  1FIQ A;  2JXX A;  3AEB B;  3NVV A;  1FXI A;  3X23 A;  2J4X A;  1F2R I;  1BXT A;  4KDI C;  4BBN F;  1JWU D;  5LLI A;  1SEB D;  1FD6 A;  2N9P C;  2W3R A;  3VR8 B;  3FIL B;  3BII D;  2JZP A;  2L32 A;  3BIN A;  2L0F A;  3RNF C;  1J7B A;  3A4S C;  3NG0 A;  2ZCB A;  4AOF A;  2GMI C;  3CST A;  4KGR A;  2E3T A;  3AE5 B;  2NBW B;  3LYY A;  2FCM A;  4JWS C;  3NVZ A;  1XLP A;  2QSD A;  2L76 A;  2VZK B;  4C4V B;  4W9D A;  1YJI A;  2BS3 B;  3EGR A;  4XZ4 A;  4WWP A;  4IKG A;  1EUV B;  1XO3 A;  3ZJV A;  3EFU A;  4GB9 A;  4P1B C;  3DOW A;  3KUD B;  2KFJ A;  1L0X B;  4HVB A;  2IPK D;  5TR5 A;  2ZEQ A;  4ICU A;  4RNA A;  2IGD A;  2XBB C;  4BKG A;  3U8Z A;  2EKI A;  3E56 A;  5TSS A;  5J18 A;  2KDB A;  5AEK B;  3VVW B;  1L6V A;  2KC1 A;  4DXG A;  3RPF C;  4HPM B;  2MW5 A;  3B2F A;  3UIO B;  1L4Z B;  2DYO A;  1SJH D;  3HM3 A;  4A6Q A;  4HDO A;  2JWZ A;  2PMV A;  3AE9 B;  2GBK A;  4L23 A;  5DCN A;  3EEC A;  1ZXI A;  1VZ8 A;  1ACC A;  2UYZ B;  3DWG C;  3ABV B;  2N1W A;  1R4N B;  2L8J A;  1RFA A;  1UZX B;  1SB3 C;  2N4F A;  2DAJ A;  2FUG 1;  1WJ6 A;  3Q8B A;  5G2N A;  4GOC A;  1F1H A;  3EA6 A;  3Q8F A;  2KJR A;  3R7R A;  3DDC B;  5DPW A;  4F1S A;  2LHE A;  1UGM A;  3HIZ A;  4M0W B;  3VXW A;  5JHA A;  2HJ1 A;  1XLO A;  1V5O A;  4HDQ A;  3ZNZ B;  3I5J C;  5L95 C;  2BYV E;  1WY8 A;  2Y5C A;  1XXG A;  3NS8 A;  2RPQ A;  3DBH B;  3V61 A;  2CHW A;  3TJP A;  2QDF A;  4Q2J A;  1NEK B;  2L7R A;  4ZDV A;  2QC8 A;  4AWJ A;  3DVG Y;  3HUI A;  3QX1 A;  3L0W B;  3OAW A;  4HPL B;  5GMV A;  2VRR B;  1WXS A;  1SE2 A;  1V81 A;  5EE3 A;  2AEH A;  2LD9 A;  1WXQ A;  2PIA A;  2KT7 A;  3KUZ A;  3QC8 B;  3V3X A;  3RYT A;  2LJ5 A;  5C23 A;  1E9M A;  4US9 A;  3M95 A;  3N32 A;  2QHO A;  4P1C C;  2GOW A;  1IBX B;  2BKF A;  1V49 A;  3AEE B;  3AEG B;  1OEY J;  1EF1 A;  4O1N A;  1C9F A;  2JUO A;  2L1A A;  3ML8 A;  1V1O A;  3VFK A;  4ANU A;  4BZA A;  2ICI A;  4FLH A;  2IZV B;  1SSN A;  2HD5 B;  1JML A;  2SEB D;  3DHH C;  3ZO5 B;  5DPT A;  5AZH A;  4K3C A;  2MSE D;  2NMQ A;  1NI2 A;  4KIK B;  3I9V 1;  2KX0 A;  1TS4 A;  2R2Q A;  3IG3 A;  2GLS A;  4GDL B;  3SFE B;  3DBL B;  4EOY A;  4RMA A;  2I38 A;  4A20 A;  2WXG A;  3ZQ4 A;  4W9G A;  1MPE A;  1MHX A;  1WJN A;  5C2T B;  2INC C;  4ZRQ A;  4BBN C;  5IN7 A;  4B95 A;  4IW0 A;  2LAS A;  3LDZ E;  2ZW0 A;  3P1M A;  3EC8 A;  1RYJ A;  3OWE B;  2ASQ A;  2KTR A;  1OQQ A;  2M0X A;  2J0M A;  4GU2 A;  3PGE A;  1R4M B;  5D94 A;  1D4B A;  4DK5 A;  3AE7 B;  2LVQ A;  4MEL A;  2IDY A;  4IM2 A;  2JQR B;  1HTO A;  2WGS A;  2WXH A;  3BK1 A;  1V1P B;  4EFO A;  1PGA A;  4TUU A;  4GN1 A;  1LQB A;  4KGS A;  1N61 A;  3ZXR A;  4OW0 A;  5HI1 A;  4ANX A;  2KMA A;  2YEP B;  4JIO U;  2IO1 B;  4I6L B;  1TGZ B;  2M17 A;  3U52 E;  2N9K A;  4RF1 A;  5LNK 1;  2BKR B;  2J0J A;  1D3Z A;  1CZP A;  2AL6 A;  1FPY A;  2KOX A;  3HM6 X;  3Q3J A;  5C1Z A;  1WMH B;  2FBW B;  2OOB B;  1FNW A;  2WHI A;  3KLS X;  3GP7 A;  2LZ6 A;  3CF6 E;  1E7U A;  3KQ4 A;  3WA0 A;  2MQJ A;  3R3M A;  3M3J A;  3VTU A;  1WGK A;  2W9N A;  1D5X C;  2RDG A;  3IVF A;  3QJZ A;  4G0N B;  5E6N A;  1YD8 U;  1JWS D;  3TCA A;  3ZDT A;  2V1Y A;  1EWC A;  2CU3 A;  2ONQ A;  4RM8 A;  1P7F A;  2KJ6 A;  2K22 A;  1DGJ A;  1C78 A;  1STE A;  3H7P B;  1IGC A;  1GC6 A;  1XLN A;  2KLG A;  4B0M A;  3FIL A;  1VZ6 A;  1KH0 A;  1GAQ B;  2FCQ A;  2FE8 A;  2WXN A;  1ZGU B;  1T0S C;  2WS3 B;  4LJP B;  2FAZ A;  3AE1 B;  3PT2 B;  1T0R C;  4HEA 1;  3LXF A;  2J42 A;  5HHD G;  1UNS A;  4OVZ A;  4C4V A;  2N7E A;  3ENE A;  1WGY A;  5JZE B;  1EF5 A;  3W1Y A;  1RM6 C;  2EMT A;  3K9O B;  3L54 A;  4IC7 B;  3TEY A;  1L4D B;  2MJE A;  1C1Y B;  1WE6 A;  4II3 B;  1FMA D;  3FAH A;  3PVL A;  2MWS B;  1IYF A;  4GDK B;  5FKA C;  4AS1 A;  1E0Z A;  2KAJ A;  1K52 A;  4YTM B;  2L3Z A;  3SDL C;  3RD2 A;  1UBI A;  1SE3 A;  3N20 C;  4K7U A;  3AN1 A;  3RUI B;  4CYE A;  1WH3 A;  2ZPY A;  3PLU A;  1LXD A;  2CU1 A;  2PE9 A;  2X8X X;  2BBC A;  4K81 A;  3RNG C;  2N9L A;  2JZ3 B;  3A1Q B;  2IND C;  4HWI B;  1G6J A;  4PS7 A;  3VTV A;  2MJD A;  3PRM B;  2JX5 A;  2RMM A;  1YN5 A;  3TSS A;  2O2V B;  3AE2 B;  1E8Y A;  1TS3 A;  3AMZ A;  2XEW A;  2KJH B;  2N7J A;  4DHJ B;  3MHZ A;  4JQW C;  2KQ4 X;  2PVG C;  3V60 A;  2JYT A;  1MG8 A;  3P4P B;  1PFD A;  3UF8 A;  4ACF A;  3A9K B;  3DBR B;  4M0W A;  2HTM E;  3Q3F A;  4ZRI A;  3OG5 A;  5BO4 B;  5AZF A;  3QHT A;  3N9Y C;  2YLM A;  4TSS A;  2C7H A;  4EEW A;  3NZU A;  4LTU A;  2JF5 A;  2TSS A;  5H92 C;  2ZW1 A;  1H8C A;  4OVV A;  3SFD B;  4ZOH C;  1GPX A;  2KFK B;  4BKS A;  3W2D A;  1GNU A;  3DHI C;  2QMT A;  1SBB B;  4ZRP A;  3R2T A;  1PYW D;  2MBQ A;  2W54 A;  5CHV C;  1V2Y A;  3U7Z A;  4IWP A;  2JT4 B;  3TBL D;  1TZO A;  1V6E A;  2RPV A;  2RDB C;  2MBH A;  4AUQ C;  2MBO A;  4LNN A;  1WWT A;  1TZ1 A;  1IBX A;  1ZKH A;  4W9E A;  1LM8 B;  4JLC A;  1UWM A;  4HXD A;  4EZL A;  3QIJ A;  3H8H A;  2JZZ A;  5J17 A;  3AM9 A;  3WIM A;  1JW9 D;  1HQR D;  3GZN I;  5EE9 A;  5E6P A;  1PDX A;  4K7S A;  1A70 A;  3A4R A;  4A3O A;  4I6N B;  4KIK A;  3AEC B;  2Z8L A;  2BYT A;  5I4D A;  4NJC A;  4GDL A;  4PT5 A;  4MSQ B;  4WJP A;  2WXR A;  1FNV A;  2HJ8 A;  4RH6 A;  2DHZ A;  3UQA A;  1KOT A;  5AZG A;  1CQV A;  2PEA A;  3W9C B;  1SJE D;  1UBQ A;  2DYM A;  3B0A A;  3ZLZ A;  2YEP F;  2N7D A;  1ZE3 D;  2K6Q A;  5JXV A;  3IXS A;  2K5P A;  2PJH A;  1C3T A;  1GJZ A;  2AWT A;  4LK0 M;  1M94 A;  3W1S C;  4KX6 B;  1DOY A;  2QIE B;  3DVG X;  4HKZ E;  4ZYN A;  2BF8 B;  1V1P A;  4JGH B;  4LNO A;  1WE7 A;  3MC9 A;  3H6N A;  1YNT E;  1E8X A;  3AUL A;  1J19 A;  2WYQ A;  2LGY A;  4WJN A;  1FO4 A;  2GBM A;  2BPS A;  2K39 A;  2NTT A;  2M4N A;  1CMX B;  3ZJU A;  1F9J A;  1WR1 A;  2MX2 A;  2D07 B;  2EMS A;  4B6W A;  4MT5 A;  1T6B X;  3AE6 B;  3N1Y C;  3APD A;  3UQB A;  3TEZ A;  2KD0 A;  1UH6 A;  3Q8E A;  3RUL A;  2K0P A;  4TV3 A;  2ZNV B;  1SF0 A;  1WMH A;  4KKJ A;  2B76 B;  4A8X C;  2J0K A;  2FCN A;  4PS3 A;  2AL3 A;  3QAR A;  2KDM A;  2C9W B;  4A90 A;  2WDR B;  1XEE A;  1F77 A;  4IWO A;  2MJ3 A;  3WAO A;  3EFC A;  4ZRJ A;  2LEK A;  3QWZ B;  1FCL A;  1FRD A;  3PHW B;  1VZ7 A;  3AU5 A;  3U30 A;  1CJE A;  3JSV B;  5T8I A;  3NVW A;  2BYF A;  4ASW C;  3A33 B;  3RNC C;  2LFI A;  2WXP A;  1NDD A;  3H7P A;  2GRI A;  2ZVN A;  3CMM B;  1XLQ A;  1UGJ A;  2L00 B;  4IM3 A;  1OTR B;  4NY0 A;  5IP4 D;  1ZOY B;  2DBY A;  4MJS B;  3PZ8 A;  3NUH B;  1N62 A;  2CJO A;  3ALB A;  4W9J A;  2LGS A;  3B2G A;  2QCZ A;  1TBE A;  1HZ6 A;  2VZK D;  3BVZ A;  1HXY D;  1K50 A;  3OJ3 A;  1MI0 A;  3ZNG C;  2KLC A;  3R66 C;  3ZDM C;  4MSM B;  4KSK C;  4GDK A;  3APC A;  5D6J B;  5IA7 A;  4AJW A;  3V6E B;  2WU5 B;  1WX7 A;  1VD2 A;  1L7Y A;  2K6D B;  2K9X A;  1GC7 A;  4HPP A;  5G5H A;  3Q8A A;  3U7D A;  3PZ7 A;  1T0Y A;  2PTL A;  5G5G A;  3IAS 1;  4MGI E;  4OZB A;  5AUI A;  3RZW C;  3HRD D;  4GMV A;  1FCC C;  2KWD A;  1T3Q A;  1WGG A;  1AW7 A;  3V62 A;  5J2R A;  2G3Q B;  4XWT A;  1YJJ A;  2O2V A;  4A9A A;  4BOZ B;  4JL9 A;  1HE8 A;  3H9D A;  4XWW A;  4DDG D;  5D3I B;  1S1Q B;  1UD7 A;  4PK1 A;  1P1A A;  3QK0 A;  4ANV A;  4E3C A;  3DBS A;  4L2Y A;  2Z0D B;  3C8Y A;  1FEH A;  1XQQ A;  2QEJ C;  4IWQ A;  2DEN B;  1C4P A;  2JYE A;  3A9K A;  3DPD A;  4XGA B;  3Q69 A;  1KTK A;  2LUM A;  1P9D U;  5HKH A;  4EE2 A;  4KKI A;  1R7S A;  2CS4 A;  1C4C A;  1AWD A;  2MP2 B;  3Q6B A;  3R7Q A;  2HE7 A;  2EEL A;  4BFR A;  2YVC A;  2W82 A;  1JRP A;  4BKS D;  1L2N A;  2KMM A;  2KFK A;  1MVK A;  1IGD A;  3AU4 A;  4NQL B;  4MGK E;  3UIN B;  1BT0 A;  2PKO A;  2KK8 A;  3W5U B;  2KHW B;  2MLB A;  2WLB A;  1GG3 A;  2LMC A;  2JRH A;  4BAX A;  3H1U A;  1JAL A;  3OLM D;  3ZYY X;  3SEB A;  2ZVO A;  2KO3 A;  4HCP B;  1TKE A;  3ZW3 A;  2D5G A;  3ZTD A;  3HK0 A;  3EUB 2;  2KX3 A;  1GB1 A;  1QOG A;  2M0A A;  3ZUN A;  4LDT B;  1WRD B;  1RWS A;  3VRB B;  4P6V F;  2QIL A;  2DZJ A;  3RN9 C;  3MHS D;  1WXA A;  3CIR B;  1L5P A;  3GE3 C;  1WX9 A;  4FAD A;  4JE3 B;  1KF6 B;  1MFW A;  2Q5W D;  1JCK B;  3RMK C;  1R4N I;  3NOB A;  2LVO A;  3BY4 B;  4F7Z A;  1JQ4 A;  1VLB A;  3B9J A;  2UU7 A;  1F52 A;  3I57 A;  1TY2 A;  3L13 A;  2BS2 B;  1T0Q C;  1UF0 A;  4N9F 4;  4PS8 A;  1VCB A;  3AB5 A;  2AQ2 B;  1Z5S B;  3KYC D;  2AQ3 B;  3AEA B;  3ZTC A;  2CKH B;  2PVO D;  4LDT D;  4IG7 B;  1L0Y B;  2BWE S;  4I6P A;  3ZXV A;  1D5M C;  3ZVV A;  5BYQ A;  3IHP C;  1RLF A;  3DBH I;  1TKG A;  1E10 A;  3KW5 B;  2C5L C;  4OZA A;  4JX1 C;  2KWV B;  1FNU A;  1WF9 A;  4EZJ A;  4KGT A;  3Q3N C;  4GGQ A;  4AQ7 A;  3GOE A;  1DOX A;  1EM7 A;  2XN9 C;  2V3P A;  3IT4 B;  2RD0 A;  1FM0 D;  5CX3 A;  1OQR A;  3MJ5 A;  1QF6 A;  4NPN A;  2L83 A;  4B0E A;  4C7Z A;  3RT3 B;  3TMP B;  2BB5 A;  2AQ1 B;  4C7Y A;  2KAN A;  2LUE A;  5BMG A;  3ZKJ C;  5CTR C;  3MTN B;  3VTW A;  1FXT B;  2NTS A;  4XE0 A;  4TKN A;  3Q8C A;  4G50 A;  1GUA B;  4KV2 A;  1E6E B;  2KKC A;  1B1Z A;  2IO2 B;  1P98 A;  1WRI A;  3JSV A;  4WAF A;  2O6V B;  1WZ3 A;  2MA9 B;  3U4E G;  1VR9 A;  3VUY A;  3IAM 1;  4HKQ A;  3P42 A;  2LXA A;  4OHJ A;  5C3J B;  4FUL A;  3X0W A;  1ISN A;  2V3N A;  3DBL I;  3PPA A;  4MJS A;  3NZS A;  1K51 A;  1PUT A;  2K8H A;  2KVZ A;  4UDU C;  1XD3 B;  4J6I A;  2H89 B;  1ROE A;  2D3C A;  2H88 B;  2INP E;  2RDH A;  4CQN A;  3H7S A;  4LLG M;  1TJE A;  2VH2 A;  4J3O D;  3NY5 A;  4MM3 B;  1N5W A;  2MRP A;  4RCO A;  2O6V D;  3MJW A;  1ZDV A;  1F0Z A;  4GLS C;  2FNJ B;  3AV8 A;  1JWB D;  1LGR A;  2BWF A;  1MHH E;  3P2B A;  2IGG A;  2NS5 A;  1TS2 A;  1XCT L;  2KN4 A;  2DZI A;  1K53 A;  4RGT A;  5GXG B;  2RGF A;  3GS2 A;  4MGZ E;  4AJY B;  2KVR A;  1EO6 A;  2WDQ B;  4HRO A;  2Y3A A;  2BS4 B;  4ZRK A;  4ITK A;  3C0R B;  2V0G A;  4ZHP A;  2NR2 A;  1HA5 A;  4PYZ A;  2E6X A;  1VRA B;  1AAR A;  4HLE A;  4M00 A;  5IAA C;  5KHQ A;  2XK5 B;  4MDK E;  1V9J A;  3MFG A;  3VR9 B;  2C7M B;  3PLV A;  3PRP B;  4DHJ D;  2DNF A;  1RFK A;  4DHZ E;  2K8C A;  1I42 A;  5FR6 A;  2EKE C;  4F8C B;  2M8S A;  3VHT C;  1RAX A;  2KN5 A;  3WAP A;  4YWG G;  4RGM A;  5BMI A;  2ZPN A;  1SIF A;  2OJR A;  3GE8 C;  2FUH B;  3O65 B;  4E71 A;  4ZHO A;  3E9S A;  3IT6 B;  2KAC A;  1N63 A;  1QOF A;  5MPO A;  2MP2 A;  2OJW A;  3I3T B;  4JWU C;  1I4R A;  2LRU A;  1WR6 E;  3AI5 A;  2BVC A;  2J7Q B;  4N58 A;  3P63 A;  1KFY B;  3VUX A;  3UI3 A;  1H4R A;  1KRH A;  2ZNV C;  3RCZ A;  2BB6 A;  2D11 A;  1I4G A;  1PGX A;  3PV1 A;  1AYF A;  2MHJ A;  1C4A A;  2KTF A;  1YN3 A;  2L52 A;  4XDC A;  5IKC M;  4ARI A;  1ZPS A;  1DOI A;  2ZCC A;  3FC4 A;  4TQ1 A;  1KLG D;  4WWN A;  1QT9 A;  3C19 A;  1QQR A;  2G1E A;  1TT5 B;  5KHO A;  2W55 A;  2DZM A;  4FJZ A;  2D3B A;  4II2 B;  1WI0 A;  1I4H A;  4DQO C;  3W5V B;  4BOS C;  4W9K A;  3ZIM A;  5EE1 A;  5CHF A;  4KVG B;  4L1B A;  1Q0W B;  1ZP0 B;  3B08 A;  1J7C A;  1I35 A;  3ZRC A;  3BZD B;  5G55 A;  4YXD B;  1N5X A;  3AH7 A;  4MAC A;  2VH1 A;  1AN8 A;  3NJT A;  1SXT A;  3NZ3 A;  1JWA D;  2G9H D;  3N3K B;  3SU8 X;  3D32 A;  1XF5 L;  1XCQ L;  4A55 A;  2Y5P A;  1A5R A;  3U2S C;  4ICV A;  5DPR A;  3I63 C;  1J7A A;  3TEX A;  5HFY A;  3T8M A;  4DHZ B;  3T3N A;  2D10 A;  5E6J A;  2N9E B;  3DBR I;  2D3A A;  1E7P B;  4G3X B;  2WWZ A;  1NYR A;  2LI5 A;  2DAF A;  1SIJ A;  2DWQ A;  3CSF A;  2JXT A;  3NS1 A;  3A9J B;  1YIW A;  2KWC A;  2KC2 A;  3TUO A;  2IO3 B;  4GSW A;  1YX6 B;  4NNJ B;  5L83 A;  3BYT B;  1EU4 A;  2WQY B;  1D5Z C;  4CHK A;  2LVP A;  4A3P A;  2K8B A;  3PRE A;  2B3A A;  4FBJ B;  1N6Z A;  1TS5 A;  1SE4 A;  5CHW A;  1XT9 B;  4P7I A;  3LJ3 A;  4IM0 A;  4GIV A;  1ZUD 2;  2BGF A;  4HJG E;  3AED B;  2FCS A;  3VRA B;  4TQ0 A;  4REZ A;  2LGX A;  1UEL A;  4MGY E;  1K8R B;  3VAW A;  4FJY A;  2V4L A;  2BYE A;  1WFY A;  4YSZ B;  1WM2 A;  3URY A;  3QAQ A;  2MBB B;  3EHV A;  2IY0 B;  1DYQ A;  4WAA A;  2REX A;  1VDV A;  2R2O A;  2CHX A;  3AE8 B;  1NYQ A;  4IOI E;  1Q1O A;  5FR3 A;  4KZC A;  3ZJT A;  2PPH A;  2HTH A;  2O6V A;  1C79 A;  3VH4 B;  4KDL B;  4MH8 A;  1B9R A;  4RGO S;  3PO0 A;  2FIF A;  4BKT A;  3GB1 A;  1NBF C;  1J0G A;  2HDE A;  3R2I A;  1FFU A;  2NPT B;  4KSL C;  3BVM A;  5IO9 A;  4YTP B;  3JYU A;  3HVD A;  4W9I A;  2ACZ B;  1I7H A;  2I1J A;  4YSX B;  2MH7 A;  3ETR A;  4WIP A;  1P7E A;  2K25 A;  4R3D A;  3M62 B;  1WJU A;  2QJL A;  3A1Q A;  4XYC A;  3L4P A;  4YL8 A;  2M19 A;  3PRZ A;  4WJQ A;  2KDI A;  3SD5 A;  4RGN A;  3V6C B;  3Q14 C;  2L0T A;  2KZR A;  4MM3 A;  2PLP A;  3PSE B;  5EDS A;  3UGB B;  4NAW B;  1SE9 A;  1WJ4 A;  1YOV B;  2SAK A;  2INN E;  3UIP B;  1CK1 A;  2NBV B;  2K3U A;  1OFF A;  4S0R A;  4C56 C;  3CWI A;  1TYG B;  2WDT B;  4D2K A;  5LXH A;  4YTN B;  5FK9 C;  1MG4 A;  4URK A;  2D3G A;  3N1X C;  1ET9 A;  2KDE B;  5DPS A;  1TKY A;  1YMH E;  4B9K A;  1WGD A;  1YX5 B;  3AXC A;  4WUR A;  5H8Y E;  2CHZ A;  2Y5B B;  1FXA A;  5JH5 C;  2L05 A;  4NZL B;  4M02 A;  1V5T A;  3ZNI D;  1T5X D;  3TL5 A;  2A5U A;  2WXO A;  2WXJ A;  3ECI A;  2KDF B;  2WX1 A;  2XK5 A;  1FFV A;  1NEN B;  4NQK E;  2A4Z A;  3RZF A;  1TY0 A;  2WXM A;  1KJT A;  2WX0 A;  3TEW A;  1ZW7 A;  2V3S A;  1Z2M A;  1YQB A;  2X38 A;  2LRW A;  3L08 A;  2NVU I;  3DQV A;  1E5W A;  1JRU A;  4M01 A;  5AUK A;  1EU3 A;  5HG2 A;  1HTQ A;  1VJK A;  1WZ0 A;  4USA A;  3WAM A;  1ESF A;  1YQ3 B;  2JY6 A;  1V86 A;  2KXJ A;  5D3D A;  2KQS A;  3MC8 A;  3J9C A;  1M4V A;  4NAM A;  2WXI A;  2Z59 B;  3WAL A;  2ZZP B;  3KWL A;  4FJV B;  3M63 B;  3T9L A;  3V05 A;  2V4I B;  1E7V A;  4QAY A;  4W9F A;  3P4S B;  2CR5 A;  1KLU D;  1Y56 A;  2J53 A;  4RFB A;  4C00 A;  2MEK A;  2R61 A;  3BK2 A;  3RNA C;  3JVZ X;  3L16 A;  3R8B A;  1BML C;  1QZE A;  2OHF A;  2GBN A;  3QA8 A;  2MCN B;  4YSY B;  1IP9 A;  1LFD A;  1KLV A;  1X1M A;  3HVZ A;  1QIL A;  1TIF A;  1WYG A;  1UUP A;  3KVF B;  4WWO A;  1MJD A;  3ZRF A;  1IUE A;  3K9P B;  5D2M B;  2DLB A;  1YJ1 A;  3AE4 B;  3MC0 B;  1C76 A;  3Q2A C;  1P0R A;  2K1F A;  2KNB A;  4M8M A;  3NHE B;  2LXC A;  2G45 B;  2OED A;  2M1M A;  1WYW B;  1OEY A;  2IYD B;  5IOI A;  4MEM A;  4DWF A;  2JRI B;  4NJ7 A;  1ZXH A;  3L10 B;  1WXM A;  4HJK A;  2FID A;  1WX8 A;  1EWY C;  4LNI A;  3N30 A;  2WDV B;  2IJ0 A;  4KZ0 A;  2GB1 A;  4WH4 A;  2C7N B;  2WXL A;  1TTN A;  1L6U A;  4HCN B;  4XC2 A;  2D2Q A;  1ET6 A;  4BVU C;  2NBU A;  4FHK A;  3AE3 B;  4ANW A;  3KUC B;  4RF0 A;  4X57 B;  1E8W A;  1E90 A;  1IPG A;  1F2R C;  3NRZ A;  2LJI A;  3A9J A;  1JRO A;  2JSV X;  4K1R B;  4FXC A;  3DVN U;  3GZN B;  1YN4 A;  1D6E C;  1I4P A;  3SHQ A;  1E8Z A;  4DXA B;  4IDI A;  2PW9 A;  2NCN A;  2G4S A;  1ZDX A;  1QOB A;  2KMC A;  5LXI B;  2N0S B;  4LNF A;  1QKZ A;  3WCQ A;  2DYB A;  3T3O A;  1UWX A;  3P4Q B;  4WQM A;  3KH0 A;  4AP4 C;  3ONS A;  1Q5W B;  2N9X A;  1OQY A;  3MP9 A;  3N1Z C;  2C60 A;  2GI9 A;  3WAN A;  3OJ4 B;  3IFW B;  4P16 A;  2WU2 B;  3LB8 C;  1GB4 A;  1OGW A;  3W1S A;  3DVN V;  4H2A A;  1J8C A;  1PGB A;  3ZNH B;  2XNA C;  4LNK A;  3APF A;  1R4M I;  2BW2 A;  1ENF A;  3VH3 B; 
#chains in the Genus database with same CATH homology
 4ARC A;  2K9X A;  4DQO C;  3W5V B;  4KGS A;  5G5H A;  1N61 A;  3Q8A A;  4OW0 A;  5EE1 A;  5HI1 A;  3SR6 A;  3PZ7 A;  2PTL A;  5G5G A;  3IAS 1;  4L1B A;  2I2Y A;  4OZB A;  1ZP0 B;  2YEP B;  5AUI A;  1J7C A;  3HRD D;  5BYR A;  3BZD B;  2J52 A;  1FCC C;  2KWD A;  1T3Q A;  4YXD B;  3U52 E;  1N5X A;  3AH7 A;  4MAC A;  1AN8 A;  2N9K A;  1AW7 A;  4RF1 A;  1HZ5 A;  1HEZ E;  1QOA A;  1SXT A;  5LNK 1;  3NZ3 A;  1JWA D;  1CZP A;  3VQI A;  2G9H D;  4XWT A;  2FBW B;  1YJJ A;  1FNW A;  3KLS X;  4A9A A;  3GP7 A;  1XF5 L;  3BWU D;  3KQ4 A;  4US8 A;  2WP9 B;  4XWW A;  4C80 A;  5D3I B;  1WGK A;  1XCQ L;  2LGI A;  4N6E B;  3ZGZ A;  4A55 A;  2Y5P A;  1NVI D;  1D5X C;  1WSP A;  2RDG A;  3U2S C;  1ENF A;  1J7A A;  4L2Y A;  3C8Y A;  3TEX A;  5BYS A;  1FEH A;  1QLB B;  5HFY A;  3T3N A;  1JWS D;  2JU6 X;  2QEJ C;  3P4R B;  5E6J A;  1C4P A;  1V8C A;  3RFZ B;  1E7P B;  1NI3 A;  1NYR A;  2JYE A;  5EE0 A;  1EWC A;  1SIJ A;  2CU3 A;  2DWQ A;  2ONQ A;  2JXT A;  3NS1 A;  1P7F A;  3Q69 A;  4XDD A;  2K22 A;  1DGJ A;  1KTK A;  1C78 A;  1STE A;  2LUM A;  3TUO A;  1IGC A;  3BYY B;  1C77 A;  1XLN A;  3BVG A;  2LHD A;  1EU4 A;  3BYT B;  1V97 A;  4B0M A;  2WQY B;  3FIL A;  1VZ6 A;  1KH0 A;  1R7S A;  3AEF B;  1D5Z C;  1GAQ B;  1C4C A;  1AWD A;  4KKI A;  2FE8 A;  2WXN A;  2EEL A;  1SE4 A;  1TS5 A;  2WS3 B;  4YT0 B;  2W82 A;  1I4Q A;  3AE1 B;  4N59 A;  1ZUD 2;  4HEA 1;  1JRP A;  3LXF A;  3O13 A;  2J42 A;  1LO5 D;  2KMM A;  5HHD G;  1MVK A;  1IGD A;  4HJG E;  1N60 A;  1JWM D;  3AED B;  2PKO A;  1UNS A;  3NVY A;  3VRA B;  4OVZ A;  4TQ0 A;  4REZ A;  3W5U B;  2WXF A;  2WLB A;  2WXK A;  2LMC A;  1RM6 C;  3TEY A;  1L4D B;  2MJE A;  4YSZ B;  1JAL A;  3ZYY X;  3KWV A;  2AX5 A;  3URY A;  1FMA D;  3FAH A;  3SEB A;  5D7G A;  1DYQ A;  4GDK B;  5FKA C;  4AS1 A;  1FRR A;  1VDV A;  1E0Z A;  1TKE A;  2KAJ A;  1K52 A;  3AE8 B;  1NYQ A;  4YTM B;  4IOI E;  2D5G A;  1SE3 A;  5FR3 A;  3EUB 2;  2IGH A;  1GB1 A;  3AN1 A;  3ZJT A;  1QOG A;  1L0V B;  1GOZ A;  1Q10 A;  1C79 A;  2WXQ A;  2M0A A;  4MH8 A;  1B9R A;  4RGO S;  3PO0 A;  1RWS A;  3GB1 A;  4WWM A;  4P6V F;  2HDE A;  3VRB B;  2WNM A;  2QIL A;  3R2I A;  1FFU A;  1YQ4 B;  4OZC A;  2BBC A;  3BVM A;  4DXF A;  4YTP B;  2M56 B;  3CIR B;  1L5P A;  2N9L A;  2BTE A;  2BT6 A;  3HVD A;  4JE3 B;  1KF6 B;  2ACZ B;  1I7H A;  2Q5W D;  4YSX B;  1JCK B;  2MJD A;  2JWU A;  3DWM A;  2JX5 A;  2MH7 A;  2ON8 A;  3ETR A;  2RMM A;  1P7E A;  4WIP A;  4ZYS A;  1YN5 A;  1I4X A;  4R3D A;  3TSS A;  4JPS A;  1JQ4 A;  3AE2 B;  4HRS A;  1TS3 A;  2QJL A;  3AMZ A;  1VLB A;  3L4P A;  2M19 A;  2CJN A;  3B9J A;  3I57 A;  1TY2 A;  2BS2 B;  4RGN A;  2N7J A;  3MHZ A;  1BUI C;  2KQ4 X;  3AB5 A;  2AQ2 B;  2PLP A;  2PVG C;  2W3S A;  5BMH A;  4TMA B;  4NAW B;  2JYT A;  1FIQ A;  2SAK A;  2INN E;  1CK1 A;  2K3U A;  2AQ3 B;  3AEA B;  1OFF A;  3AEB B;  3NVV A;  3P4P B;  3CWI A;  4C56 C;  1TYG B;  1FXI A;  1PFD A;  4D2K A;  2PVO D;  4YTN B;  2J4X A;  5FK9 C;  1F2R I;  1L0Y B;  4M0W A;  1BXT A;  2HTM E;  1D5M C;  1ET9 A;  1JWU D;  1SEB D;  5BYQ A;  1FD6 A;  3N9Y C;  2W3R A;  1TKY A;  3VR8 B;  1YMH E;  3FIL B;  4TSS A;  3BII D;  2JZP A;  2L32 A;  1TKG A;  1E10 A;  4LTU A;  4OZA A;  1J7B A;  4JX1 C;  4WUR A;  2TSS A;  5H8Y E;  1FNU A;  5H92 C;  2ZW1 A;  4KGT A;  1FXA A;  4AQ7 A;  1DOX A;  1EM7 A;  4NZL B;  4KGR A;  3SFD B;  2XN9 C;  2V3P A;  1T5X D;  2E3T A;  4ZOH C;  3IT4 B;  2WXO A;  1GPX A;  3W2D A;  1FM0 D;  2QMT A;  3AE5 B;  3LYY A;  1OQR A;  1SBB B;  3MJ5 A;  3R2T A;  4ZRP A;  4JWS C;  1PYW D;  1QF6 A;  2W54 A;  2WXJ A;  3NVZ A;  1XLP A;  2QSD A;  2VZK B;  1FFV A;  1NEN B;  3U7Z A;  2L83 A;  4B0E A;  1YJI A;  2BS3 B;  3EGR A;  4C7Z A;  1TY0 A;  2WXM A;  4IKG A;  1XO3 A;  3ZJV A;  3TEW A;  2BB5 A;  1TZO A;  2AQ1 B;  4C7Y A;  2RPV A;  1L0X B;  2X38 A;  2IPK D;  5BMG A;  1WWT A;  1IBX A;  4RNA A;  2IGD A;  2NTS A;  5AUK A;  1EU3 A;  5HG2 A;  4XE0 A;  1UWM A;  2EKI A;  3E56 A;  1VJK A;  3Q8C A;  5TSS A;  1E6E B;  3H8H A;  4USA A;  1B1Z A;  1L6V A;  4DXG A;  1WRI A;  3AM9 A;  4WAF A;  1ESF A;  1YQ3 B;  3RPF C;  3U4E G;  1JW9 D;  1HQR D;  1VR9 A;  3B2F A;  5D3D A;  5EE9 A;  1L4Z B;  3IAM 1;  1PDX A;  4HKQ A;  3P42 A;  2DYO A;  3J9C A;  1M4V A;  1A70 A;  1SJH D;  4NAM A;  2WXI A;  4OHJ A;  5C3J B;  4A6Q A;  3KWL A;  2V3N A;  2PMV A;  3AE9 B;  3AEC B;  2Z8L A;  2BYT A;  5I4D A;  4L23 A;  4NJC A;  1K51 A;  1ZXI A;  1VZ8 A;  1ACC A;  4PT5 A;  3DWG C;  3V05 A;  2V4I B;  3ABV B;  1PUT A;  2WXR A;  1FNV A;  4RH6 A;  3P4S B;  1KLU D;  4UDU C;  1Y56 A;  2J53 A;  4RFB A;  1CQV A;  2MEK A;  2H89 B;  2R61 A;  3BK2 A;  3W9C B;  1ROE A;  1SJE D;  2H88 B;  2INP E;  3R8B A;  2RDH A;  1BML C;  2DYM A;  1SB3 C;  4CQN A;  2FUG 1;  2OHF A;  2YEP F;  3Q8B A;  4LLG M;  1TJE A;  1ZE3 D;  4YSY B;  4J3O D;  4MM3 B;  3HVZ A;  5JXV A;  1QIL A;  1WYG A;  1N5W A;  1UUP A;  2K5P A;  3IXS A;  1IUE A;  2DLB A;  3EA6 A;  3AE4 B;  3Q8F A;  3MC0 B;  4RCO A;  4LK0 M;  1ZDV A;  1C76 A;  1F0Z A;  4GLS C;  2LHE A;  4KX6 B;  1DOY A;  2QIE B;  3AV8 A;  4HKZ E;  1JWB D;  1V1P A;  2OED A;  1MHH E;  1YNT E;  1XLO A;  2IGG A;  1TS2 A;  1FO4 A;  1XCT L;  2KN4 A;  1K53 A;  4RGT A;  1ZXH A;  5GXG B;  2Y5C A;  2NTT A;  1XXG A;  3GS2 A;  2WDQ B;  3ZJU A;  4HRO A;  2Y3A A;  2BS4 B;  1EWY C;  4ITK A;  2V0G A;  4ZHP A;  4Q2J A;  4MT5 A;  1T6B X;  3AE6 B;  1HA5 A;  1NEK B;  2WDV B;  2IJ0 A;  2E6X A;  3HUI A;  1VRA B;  2GB1 A;  4WH4 A;  3TEZ A;  3Q8E A;  2K0P A;  2WXL A;  1SE2 A;  1SF0 A;  3MFG A;  4KKJ A;  1L6U A;  2B76 B;  5EE3 A;  4A8X C;  3VR9 B;  1ET6 A;  2KDM A;  1WXQ A;  2PIA A;  4A90 A;  2WDR B;  3V3X A;  1XEE A;  1F77 A;  1RFK A;  1E9M A;  3AE3 B;  4US9 A;  4RF0 A;  2MJ3 A;  2LEK A;  1IBX B;  3AEE B;  1FCL A;  3AEG B;  1FRD A;  1VZ7 A;  4O1N A;  1C9F A;  2L1A A;  1F2R C;  3NRZ A;  4YWG G;  1V1O A;  4RGM A;  5BMI A;  1CJE A;  2LJI A;  5T8I A;  3NVW A;  2ICI A;  4ZHO A;  2LFI A;  1JRO A;  3E9S A;  2WXP A;  2JSV X;  1SSN A;  2GRI A;  3IT6 B;  1JML A;  1XLQ A;  2SEB D;  4FXC A;  2KAC A;  1N63 A;  1UGJ A;  1YN4 A;  1D6E C;  1I4P A;  1QOF A;  2NMQ A;  1ZOY B;  5MPO A;  2DBY A;  3I9V 1;  1TS4 A;  4IDI A;  1I4R A;  2PW9 A;  3PZ8 A;  4JWU C;  4GDL B;  3SFE B;  1ZDX A;  4N58 A;  2I38 A;  1QOB A;  3NUH B;  3P63 A;  2WXG A;  1KFY B;  3ZQ4 A;  2N0S B;  3UI3 A;  1QKZ A;  1KRH A;  1N62 A;  2CJO A;  3WCQ A;  1MPE A;  1MHX A;  3T3O A;  1UWX A;  2BB6 A;  3P4Q B;  4WQM A;  1I4G A;  1PGX A;  5C2T B;  4ZRQ A;  3B2G A;  1AYF A;  1HZ6 A;  1C4A A;  3MP9 A;  1YN3 A;  2L52 A;  2VZK D;  4XDC A;  3BVZ A;  2ZW0 A;  1HXY D;  1K50 A;  1ZPS A;  3P1M A;  4ARI A;  1DOI A;  3FC4 A;  4TQ1 A;  1MI0 A;  1KLG D;  1RYJ A;  3OWE B;  2GI9 A;  1QT9 A;  1OQQ A;  4P16 A;  1QQR A;  2WU2 B;  3LB8 C;  2G1E A;  1GB4 A;  3W1S A;  1D4B A;  4EE2 A;  4H2A A;  3AE7 B;  2W55 A;  1PGB A;  2XNA C;  2IDY A;  2JQR B;  2WXH A;  3BK1 A;  2BW2 A;  1V1P B;  1I4H A;  2WU5 B;  1PGA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...