2PPHA

Solution structure of human mekk3 pb1 domain
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
93
structure length
93
Chain Sequence
b'QSDVRIKFEHNGERRIIAFSRPVKYEDVEHKVTTVFGQPLDLHYMNNELSILLKNQDDLDKAIDILDRSSSMKSLRILLLSQDRNLEHHHHHH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Mitogen-activated protein kinase kinase kinase 3
publication title Insight into the Binding Properties of MEKK3 PB1 to MEK5 PB1 from Its Solution Structure.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 14
structure length 93
sequence length 93
ec nomenclature ec 2.7.11.25: Mitogen-activated protein kinase kinase kinase.
pdb deposition date 2007-04-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00564 PB1 PB1 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 2pphA01
4W9GA 5E6OA 1WGRA 2M1MA 2Z0DB 2BYFA 3I3TB 4XC2A 3RD2A 4GOCA 4IM2A 4EZKA 1UH6A 1V6EA 4OVVA 1LFDA 3AI5A 4I6LB 2ZJDA 2UWQA 4HPMB 3PHXB 4B6WA 3NZSA 5DPTA 4YL8A 3WAMA 4P7IA 2ZVOA 5D7GA 2J0KA 3PRPB 3DDCB 3A1QA 2ZEQA 2CKHB 2DZKA 4W9KA 3UIOB 5BO4B 4FHKA 1IPGA 3QX1A 3A9KA 4ANXA 3OJ3A 2CHXA 5IAAC 2MRPA 2MP2B 3A9JB 3MTNB 4HK2A 1WMHA 3BINA 2MBHA 1WM2A 2JY6A 2KZRA 4NY0A 4BOSC 2K39A 4HLEA 5G2NA 3NY5A 4ZYNA 2CHWA 4ZRJA 4NQKE 1SGHA 3C0RB 2KWVB 4NAWB 4GSWA 4WWPA 3IG3A 4CO7A 1RRBA 2KN5A 1V5TA 3VAWA 4LDTD 2KO3A 2RGFA 1PQSA 1RAXA 1EUVB 4HWIB 4FHJA 4DHJB 4M8NA 4X57B 4KSLC 1WGGA 3DQVA 3ZRFA 2KFJA 4HPLB 1L7YA 3VDZA 4W9CA 3W1SC 2MBEA 1JRUA 4KIKA 3UQBA 2IO0B 3GOEA 4JLCA 4BKSD 1RFAA 2PPHA 2RR9A 2BYEA 2EKEC 3CSFA 2JPHA 2NR2A 3CSTA 4RMAA 2UYZB 1WXMA 2GBRA 2OOBB 3DVGY 4GDLA 2PE6B 3TCAA 5LXIB 2R2OA 2GBNA 3NS8A 1FXTB 2KDFB 3V62A 5AZHA 2KFKA 2C9WB 4BBNF 1V2YA 3A4RA 4WJQA 1H4RA 2BYVE 2KVRA 4GGQA 4TQ1A 1E8YA 4I6NB 3KUCB 4BBNC 2AWTA 1WXVA 4FADA 3EFUA 3APCA 4BKSA 1V86A 3PVLA 4W9FA 3RT3B 2LJ5A 2DZMA 3Q3JA 3A9KB 2I1JA 3HM6X 4A3PA 2C7MB 2IY1B 4KDIC 3QHTA 2K6DB 1C3TA 1J19A 4DHJD 3IFWB 3HM3A 1WMHB 4IM0A 2HD5B 2MP2A 3L10B 1WRDB 2HJ8A 2ZNVB 3ECIA 2L05A 4DK5A 2CS4A 2ZZPB 3AULA 1EO6A 3QCAA 2NS5A 2MSED 5AZGA 4URKA 2OJRA 1P9DU 3ZLZA 1J0GA 3WA0A 4ASWC 2FIFA 4GB9A 2EMTA 2LRWA 3DBLI 1E8WA 3RULA 5L83A 3EECA 4TV3A 2LXCA 1P98A 2GOWA 1E5WA 2AYOB 2XK5A 2V3SA 3X0WA 3PTFC 4F1SA 4GIVA 4RM8A 1KM7A 1YD8U 5AEKB 2O6VD 2LZ6A 4ICUA 4PYZA 4KIKB 1G6JA 1WJ6A 1GUAB 2D10A 1LQBA 3PV1A 5CX3A 1ISNA 4NNJB 3OLMD 5J18A 2ZVNA 4W9EA 2HTHA 3HHMA 5J2RA 2IO1B 4JGHB 2CR5A 3ML8A 3ZTDA 1NBFC 3UGBB 2J0MA 2CHZA 4GDLB 3WAOA 4IWQA 2KD0A 3ALBA 1SIFA 1WXSA 3QC8B 3U7DA 2AL3A 2KFKB 4GU2A 3T8MA 4LDTB 2NVUI 2K8HA 3QIJA 2AEHA 3IBEA 2MX2A 1YJ1A 1WX7A 3DVNU 1AARA 2DZJA 4DHZB 4KZCA 4W9JA 2PEAA 1E7UA 2O6VA 3QWZB 4IC7B 1WFYA 2ZNVC 3PLUA 4A3OA 4IWPA 4NQLB 3R7RA 3DVNV 4JIOU 3TBLD 2DAFA 3B1LX 2JZZA 1MG8A 4HDQA 2BF8B 1OGWA 1IP9A 3U30A 4AWJA 4DHZE 3V6EB 5C23A 3H7PA 2NBUA 1M94A 2KLCA 4DWFA 1KOTA 1ZGUB 4A20A 4HXDA 1WZ0A 2LASA 2JRIB 2KDEB 3KYCD 2KJRA 3N30A 1Q0WB 4EOYA 5J17A 3UQAA 3ONSA 2KKCA 2ZPNA 4LCDE 2JZ3B 4E3CA 2HE7A 5KHQA 2C7NB 2KC2A 1Z5SB 2DHZA 4II3B 2N7DA 2DZIA 3KW5B 4FLHA 2IYDB 4KSKC 2L00B 2LGXA 4G0NB 2XK5B 2O2VB 1WGDA 1WX9A 2KWCA 3JW0X 3LDZE 2LUEA 2NPTA 2D07B 3R3MA 2L8JA 4F7ZA 3MHSD 3WANA 3VHTC 4EZJA 2M0XA 3ZNZB 4HCNB 3AU5A 1UZXB 3RZFA 2MCNB 3KUDB 4DXAB 4NJ7A 1LM8B 1R4NI 2L76A 3N3KB 1R4MI 2WX1A 3DVGX 2V4LA 4RM9A 2K6QA 2J7QB 5DPRA 4ANUA 3DBHI 1C1YB 4II2B 1TTNA 2GBMA 2BWFA 4OVUA 5G55A 2MBBB 1ZW7A 1Z2MA 2VRRB 2KMAA 3H7SA 1UGMA 2LGYA 4MJSB 1WGYA 2N4FA 4AJYB 4ZRKA 5DPSA 1L2NA 2JXXA 3UINB 4CYEA 2IO3B 4FJYA 3H9DA 4W9IA 2O6VB 2FCQA 2DYOA 3VQIA 2LVOA 3KVFB 2CU1A 2KJHB 1NI2A 4TQ0A 4K7WA 3PGEA 1V81A 1WZ3A 4NPNA 4FA6A 4TUUA 3APDA 3H1UA 2KQ7A 5CTRC 4AUQC 2JF5A 3O65B 3KUZA 3ZNGC 3ML9A 2PE9A 1EF1A 3AXCA 3H7PB 4WQOB 2YVCA 2WWZA 4F8CB 3VXWA 3QA8A 3VFKA 2RD0A 2I1KA 2BPSA 2JWZA 4IM3A 3UIPB 2KK8A 4HJKA 4DDGD 4K81A 2GMIC 2A5UA 1YQBA 3ENEA 3DBSA 4FBJB 4J6IA 3ZO5B 2KNBA 4MELA 1WIAA 2RPQA 3B08A 3DOWA 2Y5BB 3ZVVA 1SE9A 5JZEB 2DENB 2NBVB 3KYDD 5IA7A 2KJ6A 3R7QA 4MSQB 2NPTB 3L0WB 2DYBA 3DPDA 2FNJB 1OTRB 2O2VA 3L54A 3TIXA 3RZWC 1WE6A 2LXAA 2D3GA 3OAWA 4WJNA 4XX5A 3WAPA 2MA9B 4E74A 4ANWA 2IO2B 4BVUC 3N32A 4BFRA 2KHWB 3LJ3A 4XZ4A 4BKGA 2JT4B 2MBOA 4IW0A 4WJPA 1X1MA 2FAZA 1OQYA 5DPWA 1P3QU 5DCNA 2G4DB 3RUIB 5AZFA 3VUXA 1TGZB 3ZDTA 2KTFA 3VUYA 1HE8A 3PT2B 4GDKA 1J8CA 1GG3A 2AL6A 3QARA 3D32A 2B3AA 3TMPB 3ZW3A 3PS6A 2D11A 4IUMB 5E6NA 1LXDA 3PREA 5CHFA 2GBJA 4I6PA 1V49A 2ZCBA 3M95A 4MJSA 3SD5A 3ZIMA 1K8RB 2GBKA 5TR5A 2WX0A 4MH0E 4DBGA 2IBIB 1RLFA 1YX5B 2N1VA 3QQ8B 2A4ZA 3SDLC 2KLGA 3ZNID 1EF5A 3V60A 1S1QB 3JSVA 3M3JA 4FULA 4WWNA 3RYTA 4K1RB 3U8ZA 4MDKE 2N7EA 1WF9A 5LXHA 1I42A 2KQSA 2C7HA 4M0WB 3ZTCA 4MSMB 3EC8A 4G50A 3SU8X 1WYWB 2MLBA 4ZRIA 4K7UA 1YX6B 4MEMA 1Q1OA 2FCSA 1S3SG 2YLMA 4W9DA 4AJWA 3VTUA 4HVBA 1E90A 2J0JA 2LI5A 2ZPYA 3ZKJC 2C60A 2LD9A 3IHPC 3WALA 1V80A 3PSEB 1WJNA 1GJZA 2KX0A 1WI0A 3L08A 4PYUA 2L0TA 4GXBA 1WH3A 2N9PC 3H6NA 4AOFA 2D2QA 2M4NA 5L95C 3QK0A 3APFA 1WJ4A 3GZNI 3PLVA 3TJPA 2FIDA 1ZKHA 1F9JA 2REXA 3L16A 4IWOA 4NJ6A 3ZRCA 2NBWB 3VVWB 3QJZA 2DX5B 4BOZB 4E71A 5JH5C 2R2QA 4MGIE 2KXJA 3UF8A 4HDOA 1NDDA 4FJVB 2DAJA 4N9F4 3T9LA 1TBEA 2BGFA 3K9OB 1GC6A 5C1ZA 1OEYJ 2BKRB 5EDSA 2JVCA 2KTRB 4GDKB 3VUWA 3ZNHB 2KWUB 4CHKA 1P1AA 2ASQA 2BKFA 2MWSB 4EEWA 2N1WA 4MGYE 1TZ1A 2NCNA 3M62B 1GNUA 4PS8A 1XQQA 1WM3A 3Q3FA 4WJOA 4ANVA 3V6CB 1V5OA 1QZEA 5KHOA 2KOXA 2V1YA 2QHOA 3JVZX 3ZUNA 3DCGA 4PS3A 4AP4C 1UBIA 4BKTA 4KVGB 2M8SA 3OJ4B 2LWPA 1WXAA 2FUHB 2KDBA 1E8XA 2IZVB 2M17A 3DBRI 3HK0A 4G3XB 4G11A 4K7SA 5GMVA 3VTWA 4DDID 3JSVB 4MGKE 4EKUA 2XBBC 2BWES 1CMXB 4ZDVA 3ZDMC 4LJOB 4W9HA 2K25A 1T0YA 2XEWA 5JHBA 5CHWA 1WE7A 3TL5A 2EMSA 1WY8A 1GC7A 1WX8A 2G45B 2L3ZA 3R66C 3KH0A 3PPAA 1VD2A 3K9PB 3JYUA 1VCBA 1E7VA 4B9KA 3AU4A 3CMMB 3W1SA 4ICVA 4WAAA 1I35A 2L0FA 1UELA 1U4AA 4PS7A 5LLIA 2Z0EB 3MJWA 1UD7A 5E6PA 1WR1A 3A1QB 3QAQA 3NHEB 3SHQA 4HCPB 1KLVA 3P2BA 2LRUA 2JRHA 1V9JA 5HKHA 4EUTA 3IVFA 2PJHA 2N9XA 1UBQA 2Z59B 5CHVC 3M63B 5FR6A 2IY0B 4MGZE 2FCNA 2FCMA 2WDTB 3A9JA 2G3QB 4W9LA 1WGHA 4FN2A 3HIZA 2KC1A 4MM3A 4B95A 1H8CA 1Q5WB 2LGDA 2K8CA 4GMVA 2G4SA 3BY4B 3L13A 2MQJA 4GN1A 3PZDA 2JUOA 4FJZA 3VH4B 4EFOA 1D3ZA 3NZUA 3L17A 2KTRA 3PRMB 2RSUA 4M8MA 1YIWA 3WIMA 1A5RA 4NAWA 3V61A 3VH3B 2MW5A 1Y8RC 4IG7B 1XD3B 5D6JB 1E8ZA 2N9EB 4WWOA 3S2AA 5D94A 1OEYA 2KX3A 2MBQA 3NOBA 4KDLB 1WR6E 2LVQA 2DYMA 2L7RA 2C5LC 3RCZA 1WJUA 2W9NA 2LVPA 2KDIA 1BT0A 3PHWB 2K8BA 2KMCA 3EHVA 3A4SC 5JHAA 2K1FA 4KV2A 4EZLA 1XT9B 4JQWC 1P0RA 3B0AA 3PRZA 4KZ0A 4TKNA 3X23A 2KANA 1IYFA 4JL9A 3A33B 4LJPB 5D2MB 3CF6E 3VTVA 3W1YA 1KJTA 2ZCCA 2WYQA
chains in the Genus database with same CATH superfamily
1N5WA 2M1MA 4TMAB 4EZKA 4OVVA 1V6EA 2D3CA 2MH7A 2ICIA 3PHXB 4A90A 1TS5A 2J0KA 1FXAA 2CKHB 3IXSA 3UIOB 2KT7A 4J3OD 3A9KA 5IOIA 1JRPA 2MP2B 3AE9B 5E6JA 1FCLA 1ZPSA 1NYQA 2CHWA 4ZRJA 2KN5A 1V5TA 3VAWA 2M0AA 2KO3A 1EWYC 3P4RB 4KSLC 3RNCC 1L7YA 2D3BA 4KIKA 2PPHA 1JWUD 2EKEC 2BVCA 2JPHA 2QCZA 3NVZA 2UYZB 1WXMA 2OOBB 1N63A 4S17A 3NS8A 4UDUC 2INPE 2KFKA 2C9WB 2FBWB 4WJQA 2X38A 1T6BX 1J7BA 4IOIE 1V86A 3A9KB 3HM6X 3N1XC 4PK1A 2IY1B 2WXGA 2K6DB 4HKZE 2KYWA 4DHJD 4LNFA 3HM3A 1JMLA 3ABVB 2HD5B 1FM0D 3L10B 2HJ8A 2ZNVB 1EO6A 3QCAA 1DYQA 5FK9C 4L23A 1YN4A 2LMCA 1FMAD 1J0GA 1C76A 1E8WA 5L83A 2LXCA 5BYRA 1VRAB 2V3SA 1FIQA 4F1SA 1KM7A 2O6VD 2LZ6A 4PYZA 4YTNB 4KIKB 1EWCA 1QLBB 1E6EB 1LQBA 1HTOA 2IO1B 2CR5A 2R61A 4LNOA 5C2TB 3WAOA 3ALBA 1ZXIA 1WXSA 2KFKB 2AEHA 1NI3A 5IN7A 1YJ1A 1WWTA 4ZYSA 4KZCA 2PEAA 2O6VA 1WFYA 2ZNVC 2QJLA 2IGGA 4IWPA 5BMIA 4LK0M 2LHDA 2WDQB 1OGWA 1YN3A 5C23A 3H7PA 1ZGUB 3MP9A 1WZ0A 3AN1A 2JRIB 5H8YE 2KKCA 3T3OA 1Z5SB 4II3B 1A70A 2N7DA 3KW5B 2LGXA 2JZPA 2KWCA 2WXNA 1ET9A 1VZ8A 2L8JA 4F7ZA 3WANA 1N6ZA 2BTEA 4XDCA 3BVZA 4NJ7A 1LM8B 1R4NI 1R4MI 2E3TA 1SIJA 1C1YB 2AQ2B 5FR3A 2BWFA 4M00A 5G55A 2KVZA 2VRRB 4LTUA 4AJYB 2N4FA 3P4SB 2JXXA 4CYEA 2O6VB 3VQIA 2V9HA 2WXOA 2J52A 1NI2A 3BVGA 4K7WA 1T3QA 4TUUA 3APDA 2KQ7A 1PGBA 1KRHA 4WQOB 1WRIA 3H7PB 2DNFA 4WAFA 2WWZA 4F8CB 1ZUD2 3EUB2 4B0EA 2RD0A 2BPSA 2JWZA 1GPXA 1VLBA 4DDGD 3AE5B 3ZO5B 2NMQA 1WIAA 3B08A 5AUIA 4QAYA 3KYDD 3GE3C 2HJ1A 1HA5A 1WSPA 2M19A 3L0WB 3URYA 2DYBA 2FNJB 1OTRB 3SR6A 3TIXA 3BWUD 4YSYB 3MFGA 4WJNA 4XX5A 2IO2B 3TEWA 3EFCA 4XZ4A 2JT4B 1X1MA 3RUIB 5BMHA 3PT2B 3QARA 1TS4A 2D11A 3AE4B 1JROA 1HTQA 2BYTA 3SD5A 2WQYB 1TT5B 2GI9A 3C8YA 1YX5B 3SDLC 1EF5A 5LXHA 1NYRA 3ZTCA 4MSMB 2ZW1A 1E10A 1YJIA 2MLBA 1C9FA 4MEMA 2FCSA 2YLMA 3E56A 3VTUA 2LI5A 2OHFA 2LD9A 5LNK1 3PSEB 1GJZA 2WXFA 3AECB 1DOYA 2N9PC 4AOFA 5G5GA 3APFA 2FIDA 1ZKHA 3ZRCA 3QJZA 3UF8A 2KXJA 2MJEA 3AEDB 2NTTA 5C1ZA 2BKRB 1SJHD 1T0SC 4EEWA 2QILA 1WM3A 3GZNB 1QZEA 4PS3A 3OJ4B 4G3XB 2FUHB 2ON8A 3HK0A 3VTWA 4K7SA 1K52A 2SEBD 4EKUA 1TKGA 2XBBC 4TSSA 5JHBA 1WE7A 2EMSA 2G45B 2L3ZA 3TEYA 3R66C 3KH0A 1VD2A 3NZ3A 1XXGA 3GE8C 2XNAC 3AU4A 2PMVA 4WAAA 3NG0A 2Z0EB 1WGKA 3DBRB 2KQ4X 1V9JA 2PJHA 5HFYA 2Z59B 4MGZE 2GRIA 2WDTB 1XLNA 4HROA 5EE1A 4US9A 2G3QB 1WGHA 2WXJA 2WXKA 2K8CA 3BY4B 2AQ3B 3E9SA 2KWDA 3PZDA 4WURA 1FNWA 3DHIC 1A5RA 1E8ZA 3ZJTA 2L32A 1FRDA 1ET6A 1SE2A 1HZ5A 2DLBA 1D4BA 3NVVA 2KANA 2Y5PA 4LJPB 5IP4D 1UF0A 3AE8B 1VDVA 4EE2A 1YN5A 2Z0DB 4MACA 3I3TB 2CU3A 1STEA 4I6LB 3I9V1 2LHEA 3AE3B 4B6WA 5D7GA 2N0SB 2LJIA 3ZJUA 2ZEQA 2DZKA 1VZ6A 4W9KA 5BMGA 2MEKA 5IAAC 2MRPA 4L2YA 1WMHA 2JY6A 2KZRA 4NY0A 1TJEA 3U4EG 3TEZA 4YWGG 2WXIA 4P6VF 2BW2A 3RN9C 5G2NA 4GSWA 4HJGE 4CO7A 2RDHA 4LDTD 2JYEA 1RAXA 1EUVB 4X57B 1XCTL 1QOBA 1I4QA 1V97A 2IO0B 4JE3B 1FD6A 1GB1A 4JLCA 4BKSD 2BB5A 1RFAA 2RR9A 1Q10A 2NR2A 4OZAA 3DVGY 4GDLA 2PE6B 2KDFB 2W54A 4WQMA 4BBNF 3AMZA 1V2YA 4JX1C 3A4RA 1E9MA 4P1BC 2BYVE 2KVRA 3P63A 4I6NB 4BBNC 3N20C 4XE0A 3TSSA 3APCA 1IGCA 4BKSA 4W9FA 1KF6B 2LJ5A 1N61A 2I1JA 3DBHB 1J7CA 2DBYA 1WMHB 2Q5WD 4IM0A 2MP2A 3ECIA 2L05A 4ACFA 4N58A 3SEBA 2N9LA 5AZGA 4URKA 1P9DU 3Q69A 3WA0A 2QSDA 3DBLI 3WCQA 1KLUD 3EECA 4TV3A 4AQ7A 2AYOB 1YJJA 4GIVA 4RM8A 1P7FA 5AEKB 4HRSA 1GUAB 3OLMD 3DWGC 3HHMA 2BS2B 5J2RA 1F52A 3ML8A 3ZTDA 1NBFC 3UGBB 4GDLB 2CHZA 5I4DA 3MC0B 3IT6B 4OHJA 4YXDB 1KFYB 2AL3A 2D5GA 2XN9C 4LDTB 2NVUI 2K8HA 3QIJA 2RPVA 1AARA 2DZJA 1QF6A 3GS2A 3VR9B 4IC7B 3PLUA 4A3OA 2K3UA 4NQLB 3TBLD 1MG8A 4HDQA 3B2GA 1IP9A 3U30A 4AWJA 4DHZE 3P4QB 3V6EB 1M94A 2LASA 2KDEB 3BVMA 4R3DA 1Q0WB 2ZPNA 2JZ3B 5KHQA 2W55A 1OFFA 5JXVA 2DZIA 2D3AA 3W2DA 2WDVB 2INDC 4G0NB 2O2VB 2NPTA 2W3SA 3ZNZB 3KQ4A 1UZXB 3AE2B 3KUDB 4L1BA 5D3IB 1NEKB 1ENFA 2L76A 2WX1A 1TKYA 2WXPA 4ANUA 1YNTE 2PIAA 5HHDG 1TTNA 2MBBB 2K22A 3ZGZA 2LGIA 2LGYA 4ZRKA 4LNKA 4ZOHC 1L0VB 1L2NA 3J9CA 3UINB 2BT6A 1SXTA 4FJYA 2FCQA 1ROEA 4Q2JA 4XWTA 4C00A 1V81A 4NPNA 1XCQL 1ZE3D 4C7ZA 1TZOA 3ZNGC 2PE9A 3AXCA 1D6EC 4M0WA 1RFKA 3RNEC 3VXWA 1YQ4B 4JWUC 4K81A 2GMIC 2A5UA 2INNE 4FBJB 3HVZA 2KNBA 3Q6BA 3FC4A 2Y5BB 2Z8LA 3ZVVA 1FFVA 3P42A 3HRDD 3ZYYX 1ZOYB 5IA7A 2KJ6A 2NPTB 3DPDA 3L54A 1WE6A 3BYYB 2D3GA 5EE9A 2MA9B 4E74A 3N32A 3LXFA 4LNNA 4BKGA 2OJWA 1P3QU 1PUTA 5AZFA 4XYCA 3ZDTA 2KTFA 3AEAB 1HE8A 1J8CA 1GG3A 3HUIA 3NJTA 3PS6A 1LXDA 3AM9A 2GBJA 4I6PA 2ZCBA 5GXGB 4C7YA 3BZDB 4RGMA 2GBKA 2VH1A 3ZJVA 1Y56A 2N1VA 3QQ8B 2A4ZA 3ZNID 3V05A 3Q8FA 3V60A 3M3JA 2L83A 2N7EA 1WF9A 3N1YC 4M0WB 4H2AA 1T0QC 4K7UA 1YX6B 1F2RC 5AUKA 4AJWA 1RM6C 1E90A 2J0JA 2ZPYA 3Q3NC 3IHPC 1KTKA 3AEGB 1V80A 4LNIA 3MC9A 2KX0A 4PYUA 2L0TA 4GXBA 3FAHA 3GZNI 3TJPA 2REXA 3GB1A 5JH5C 4MM3B 4MGIE 2DAJA 1N60A 3T9LA 1TBEA 2BGFA 5T8IA 2JVCA 2KTRB 2KWUB 2BKFA 2MWSB 2ONQA 1VJKA 4PS8A 1GNUA 1WXQA 1XQQA 1TIFA 2GLSA 3V6CB 4HEA1 3EGRA 2QHOA 3ZUNA 3DCGA 3DBRI 3LYYA 4G11A 4DDID 3EA6A 4RGTA 3VRBB 1CMXB 4LJOB 2N9KA 1WY8A 1GC7A 1WX8A 2Y5CA 3K9PB 3JYUA 1VCBA 1VR9A 2IGHA 2LFIA 4ICVA 1UELA 1UD7A 1WR1A 2PW9A 3A1QB 3QAQA 3NHEB 4HCPB 2N9XA 1UBQA 5CHVC 3M63B 1IGDA 2QEJC 4FN2A 1H8CA 2KC1A 4C80A 2LGDA 4GMVA 2MQJA 4GN1A 1NVID 1OQQA 2GB1A 1N62A 2JUOA 3VH4B 3TEXA 4EFOA 3NZUA 3WIMA 2WU2B 4NAWA 2MW5A 1XD3B 5D6JB 1JWMD 2N9EB 1JALA 1OEYA 2BBCA 2V0GA 1VZ7A 3NOBA 1FRRA 2QMTA 2LVQA 2L7RA 1BUIC 4MT5A 2K8BA 4XWWA 3A4SC 1I4HA 5JHAA 4EZLA 4KV2A 1XT9B 4JQWC 1P0RA 3B0AA 1IYFA 4JL9A 3A33B 3TUOA 3VTVA 3W1YA 2ZCCA 1WGRA 3U52E 2V4IB 2BYFA 1B1ZA 4GOCA 4IM2A 1LFDA 2ZJDA 2WNMA 3NZSA 4YL8A 1QKZA 3WAMA 2ZVOA 3PRPB 3DDCB 1SB3C 5BO4B 1IPGA 3QX1A 2CHXA 1NENB 4YTMB 2WXQA 3Q3MC 4HPPA 4HK2A 3BINA 2MBHA 1WM2A 2WGSA 1SE3A 4HLEA 4NAMA 4ZYNA 2IJ0A 1SGHA 3C0RB 2KWVB 4NAWB 4ARIA 3AEFB 1RRBA 4A8XC 1L0XB 1J7AA 4HWIB 3I5JC 4M8NA 1WGGA 3ZRFA 2KFJA 3VDZA 4W9CA 1JRUA 3CSFA 3CSTA 4RMAA 1D5MC 3PZ8A 2R2OA 3PZ7A 3V62A 3BYTB 4KGSA 4TQ1A 3KUCB 2AWTA 3NUHB 1I4XA 4FADA 1R4NB 3EFUA 4RCOA 2DZMA 3Q3JA 1AWDA 4A3PA 4M02A 1ZP0B 1JWBD 5HI1A 1J19A 3IFWB 2OEDA 1CK1A 1WRDB 4DK5A 2CS4A 3AULA 4RF1A 5BYQA 1MJDA 1JW9D 3NVWA 3ZLZA 4ASWC 2FIFA 2EMTA 2LRWA 2KACA 1FO4A 1E5WA 1V1PB 3HVDA 4OW0A 5TSSA 1MPEA 2B76B 5IKCM 1ISNA 5J18A 1UGJA 1QQRA 3AH7A 3W9CB 4YSXB 4JGHB 1XLOA 2WDRB 2YEPB 2QIEB 1SIFA 4BZAA 3QC8B 3T8MA 4YTPB 2PVGC 4IDIA 2MX2A 1WX7A 1UUPA 3QWZB 2WS3B 1C4AA 1XLPA 1T0RC 4JIOU 2JZZA 1DOXA 4M01A 1M4VA 3Q8EA 1YQ3B 2NBUA 4OZBA 1GB4A 1KH0A 4A20A 1XF5L 2SAKA 1OQRA 4HXDA 3KYCD 3N30A 3UQAA 3ONSA 4E3CA 4KX6B 3FILA 2C7NB 2KC2A 2DHZA 2W82A 1K50A 2YEPF 3C19A 2VZKB 2Y3AA 4FLHA 2L00B 3B2FA 3B9JA 1WGDA 3JW0X 2LUEA 3R3MA 3MHSD 3VHTC 1JCKB 2M0XA 4A55A 2PKOA 4HCNB 3VR8B 3RZFA 2MCNB 4A9AA 3N3KB 3DVGX 3Q8CA 4RM9A 3DHHC 2MJ3A 5D3DA 4II2B 1C77A 3BK1A 4RGOS 1ZW7A 2KMAA 2AQ1B 1UGMA 4MJSB 2EELA 2JYTA 5DPSA 4DXFA 2G1EA 3H9DA 4W9IA 3UI3A 2LVOA 3KVFB 1HEZE 2CU1A 2KJHB 3CWIA 1WZ3A 1AW7A 4O1NA 4AUQC 2JF5A 1MHHE 4NJCA 3ML9A 1EF1A 1F2RI 3KWLA 1C78A 3RNBC 2YVCA 2I1KA 4IM3A 3UIPB 3FILB 3ENEA 2E6XA 3NRZA 2WXMA 3FKYA 2DENB 2IPKD 3R7QA 4MSQB 2FE8A 2O2VA 5HG2A 4C4VA 3T3NA 3RNFC 2LXAA 3L4PA 4KKIA 3KLSX 4BVUC 4BFRA 3R2TA 3LJ3A 2MBOA 2CJOA 4WJPA 2FAZA 1OQYA 5DPWA 2G4DB 3VUXA 1QOFA 4REZA 3VUYA 3O13A 4S0RA 1FXIA 2B3AA 3TMPB 2BS4B 3DHGC 3NVYA 1T5XD 4IUMB 5E6NA 3VRAB 3M95A 3AV8A 1E7PB 1K8RB 1FNUA 5TR5A 4MH0E 4USAA 1EU3A 4DBGA 2IBIB 1IBXA 1TKEA 3W5UB 1YMHE 4PT5A 2KLGA 1S1QB 3U8ZA 4K1RB 4MDKE 1I42A 2KQSA 2C7HA 3EC8A 3SU8X 1WYWB 4ZRIA 1BMLC 1S3SG 2JQRB 3ZKJC 2C60A 3WALA 1ACCA 1WI0A 4C56C 1FNVA 1SE4A 3L08A 3H6NA 2D2QA 2M4NA 1DOIA 4C4VB 3ZXRA 3OG5A 3PLVA 3N1ZC 1F9JA 4IWOA 4BOZB 1I4RA 2R2QA 4HDOA 4FJVB 2KN4A 4RH6A 1OEYJ 1K53A 2ACZB 2WXRA 4P1CC 3BK2A 2M56B 2ASQA 1V8CA 5EE3A 2N1WA 4MGYE 2JU6X 2DWQA 2CJNA 2AX5A 4JWSC 3AE7B 5KHOA 3Q2AC 2KOXA 1IBXB 1EU4A 4US8A 4AP4C 1MI0A 4BKTA 4KVGB 2LWPA 2M17A 2IZVB 4LLGM 2JSVX 3DWMA 2I38A 1GOZA 4ZDVA 3ZDMC 4W9HA 2K25A 1T0YA 2XEWA 2JWUA 3TL5A 4D2KA 2PVOD 2J4XA 3PPAA 5G5HA 3W1SA 1L6VA 1ZXHA 4PS7A 5LLIA 3CIRB 2JX5A 3SHQA 3P2BA 2JRHA 3BIID 4EUTA 1PFDA 5FR6A 2FCNA 2FCMA 2H88B 3A9JA 4W9LA 3HIZA 1FFUA 4MM3A 4B95A 1Q5WB 4P16A 3R8BA 4KKJA 4FJZA 3L17A 2KTRA 2RSUA 4M8MA 1YIWA 5BYSA 3V61A 1Y8RC 4IG7B 1HXYD 4WWOA 1JWSD 2KX3A 2MBQA 1WR6E 2DYMA 1ESFA 1CQVA 2PTLA 2KDIA 1BT0A 3PHWB 3EHVA 4KZ0A 4TKNA 3X23A 3DBLB 1IUEA 1KJTA 3OAWA 4W9GA 5E6OA 5FKAC 4XC2A 3RD2A 1UH6A 3AI5A 2UWQA 4HPMB 2QC8A 5DPTA 4P7IA 3A1QA 2V3NA 2HDEA 4FHKA 4A6QA 4ANXA 3P1MA 3OJ3A 2FUG1 3A9JB 3MTNB 4FXCA 4BOSC 4KGRA 1ZDVA 2K39A 3NY5A 4NQKE 2UU7A 4WWPA 3IG3A 1P7EA 2RGFA 1PQSA 1SBBB 3AEEB 4FHJA 4DHJB 3DQVA 3I63C 1C4PA 4HPLB 1D5XC 1QOAA 2HTME 2KMMA 3W1SC 2MBEA 1LGRA 3UQBA 3GOEA 4MH8A 1HQRD 2BYEA 4CQNA 1LO5D 2GBRA 3TCAA 5LXIB 2GBNA 2LGSA 1CJEA 1FXTB 5AZHA 2NTSA 2BS3B 1H4RA 1MFWA 2W3RA 4GGQA 1E8YA 1WXVA 2H89B 1B9RA 3PVLA 3RT3B 1XO3A 2C7MB 2BB6A 3NS1A 4KDIC 3QHTA 1C3TA 1AYFA 3P4PB 3AEBB 4WH4A 2ZZPB 4B0MA 2NS5A 4RNAA 2MSED 5MPOA 1L4ZB 2INCC 2OJRA 3MJ5A 1KLGD 1XEEA 4GB9A 3AE1B 1TS3A 3RULA 4GLSC 1P98A 2GOWA 3U7ZA 1C4CA 2XK5A 3X0WA 3PTFC 2WP9B 1SF0A 1I4PA 1YD8U 4ICUA 1G6JA 1WJ6A 2D10A 3PV1A 5CX3A 4NNJB 2ZVNA 4W9EA 2HTHA 3SFDB 1FPYA 2J0MA 2N7JA 4IWQA 2KD0A 3RFZB 3U7DA 4GU2A 1AN8A 1K51A 2V3PA 3IBEA 3DVNU 3V3XA 1RWSA 4DHZB 1PYWD 4W9JA 3MC8A 1E7UA 3R7RA 3DVNV 2DAFA 1V1OA 3B1LX 1QILA 4K3BA 4BAXA 2BF8B 2WHIA 2KLCA 2BQQA 4DWFA 1KOTA 1XLQA 5J17A 2KJRA 4EOYA 1PGXA 4LCDE 2HE7A 1BXTA 2IGDA 4RF0A 3RNGC 2IYDB 4KSKC 2J53A 4RFBA 2XK5B 1WX9A 3LDZE 4N6EB 2TSSA 1V1PA 2D07B 3MHZA 4EZJA 5H92C 3IAS1 3AU5A 1D5ZC 2IDYA 4DXAB 3ZXVA 1CZPA 1TYGB 2VH2A 1QT9A 3GP7A 1R7SA 2V4LA 2WLBA 4WIPA 1PGAA 1L5PA 2EKIA 2J7QB 2K6QA 5DPRA 3DBHI 2GBMA 4YSZB 2QDFA 4OVUA 1L0YB 3H7SA 1Z2MA 2LUMA 1WGYA 3AE6B 2ZW0A 2IO3B 2X8XX 1DGJA 2DYOA 1MG4A 4TQ0A 3PGEA 1R4MB 4FA6A 3H1UA 2VZKD 5CTRC 3O65B 1SSNA 1MVKA 3KUZA 3QA8A 2WXLA 3LB8C 3VFKA 1MHXA 2KK8A 2L52A 4HJKA 1RYJA 3W5VB 1YQBA 3DBSA 4J6IA 1F1HA 3OWEB 4MELA 2RPQA 3DOWA 1SE9A 5JZEB 2L1AA 2NBVB 2I2YA 3RZWC 3WAPA 4ANWA 1WYGA 3AB5A 2KHWB 3U2SC 4IW0A 4OVZA 5DCNA 1TGZB 4KGTA 2MHJA 4GDKA 2AL6A 3D32A 1I4GA 3ZW3A 3I57A 2K0PA 3PREA 5CHFA 1V49A 4MJSA 3ZIMA 3IAM1 4ITKA 2WX0A 1RLFA 1L4DB 1ZDXA 4RGNA 1C79A 4YT0B 3JSVA 4FULA 4WWNA 3RYTA 1F0ZA 3RMKC 3ETRA 3N9YC 4G50A 1UWMA 1Q1OA 3Q8BA 4W9DA 4HVBA 1SEBD 2RMMA 2LEKA 2MJDA 1YOVB 1WJNA 4ZHPA 4DXGA 1WH3A 3R2IA 5L95C 3QK0A 1WJ4A 1FCCC 1E0ZA 3L16A 4NJ6A 2NBWB 3VVWB 3Q3OC 2DX5B 4E71A 1NDDA 4N9F4 2KAJA 4XGAB 3K9OB 1GC6A 5EDSA 3VUWA 4GDKB 3ZNHB 2KDMA 4CHKA 1P1AA 4K3CA 4N59A 1TZ1A 1QOGA 2NCNA 3M62B 3Q3FA 4ZRQA 4WJOA 4OZCA 4ANVA 1V5OA 1PDXA 2V1YA 1JQ4A 3JVZX 4IKGA 1UBIA 2JXTA 2M8SA 1WXAA 2KDBA 1E8XA 5GMVA 1EM7A 3JSVB 4MGKE 4DQOC 1F77A 2BWES 5EE0A 2K5PA 2WU5B 5CHWA 3IT4B 4JPSA 1SJED 1L6UA 5C3JB 1E7VA 4B9KA 3CMMB 3RI7C 2G9HD 2K9XA 1JWAD 1I35A 4ZRPA 2L0FA 1U4AA 3MJWA 5E6PA 4XDDA 1KLVA 3KWVA 2LRUA 3SFEB 1I7HA 5HKHA 4AS1A 3IVFA 2WXHA 3RNAC 2IY0B 3Q14C 3Q8AA 1HZ6A 1TY2A 2G4SA 2RDGA 3L13A 3H8HA 3RPFC 2RDBC 2J42A 1TY0A 1D3ZA 3PRMB 5IO9A 4ARCA 4HKQA 3VH3B 1UNSA 4NZLB 3S2AA 5D94A 4WWMA 1GAQB 3PO0A 4KDLB 1TS2A 1UWXA 2C5LC 3RCZA 1WJUA 1FEHA 1N5XA 2W9NA 2LVPA 3ZQ4A 2KMCA 2PLPA 2K1FA 3PRZA 5D2MB 3CF6E 4ZHOA 2WYQA
chains in the Genus database with same CATH topology
4W9GA 5E6OA 1WGRA 2M1MA 2Z0DB 2BYFA 3I3TB 4XC2A 3RD2A 4GOCA 4IM2A 4EZKA 1UH6A 1V6EA 4OVVA 1LFDA 3AI5A 4I6LB 2ZJDA 2UWQA 4HPMB 3PHXB 4B6WA 3NZSA 5DPTA 4YL8A 3WAMA 4P7IA 2ZVOA 5D7GA 2J0KA 3PRPB 3DDCB 3A1QA 2ZEQA 2CKHB 2DZKA 4W9KA 3UIOB 5BO4B 4FHKA 1IPGA 3QX1A 3A9KA 4ANXA 3OJ3A 2CHXA 5IAAC 2MRPA 2MP2B 3A9JB 3MTNB 4HK2A 1WMHA 3BINA 2MBHA 1WM2A 2JY6A 2KZRA 4NY0A 4BOSC 2K39A 4HLEA 5G2NA 3NY5A 4ZYNA 2CHWA 4ZRJA 4NQKE 1SGHA 3C0RB 2KWVB 4NAWB 4GSWA 4WWPA 3IG3A 4CO7A 1RRBA 2KN5A 1V5TA 3VAWA 4LDTD 2KO3A 2RGFA 1PQSA 1RAXA 1EUVB 4HWIB 4FHJA 4DHJB 4M8NA 4X57B 4KSLC 1WGGA 3DQVA 3ZRFA 2KFJA 4HPLB 1L7YA 3VDZA 4W9CA 3W1SC 2MBEA 1JRUA 4KIKA 3UQBA 2IO0B 3GOEA 4JLCA 4BKSD 1RFAA 2PPHA 2RR9A 2BYEA 2EKEC 3CSFA 2JPHA 2NR2A 3CSTA 4RMAA 2UYZB 1WXMA 2GBRA 2OOBB 3DVGY 4GDLA 2PE6B 3TCAA 5LXIB 2R2OA 2GBNA 3NS8A 1FXTB 2KDFB 3V62A 5AZHA 2KFKA 2C9WB 4BBNF 1V2YA 3A4RA 4WJQA 1H4RA 2BYVE 2KVRA 4GGQA 4TQ1A 1E8YA 4I6NB 3KUCB 4BBNC 2AWTA 1WXVA 4FADA 3EFUA 3APCA 4BKSA 1V86A 3PVLA 4W9FA 3RT3B 2LJ5A 2DZMA 3Q3JA 3A9KB 2I1JA 3HM6X 4A3PA 2C7MB 2IY1B 4KDIC 3QHTA 2K6DB 1C3TA 1J19A 4DHJD 3IFWB 3HM3A 1WMHB 4IM0A 2HD5B 2MP2A 3L10B 1WRDB 2HJ8A 2ZNVB 3ECIA 2L05A 4DK5A 2CS4A 2ZZPB 3AULA 1EO6A 3QCAA 2NS5A 2MSED 5AZGA 4URKA 2OJRA 1P9DU 3ZLZA 1J0GA 3WA0A 4ASWC 2FIFA 4GB9A 2EMTA 2LRWA 3DBLI 1E8WA 3RULA 5L83A 3EECA 4TV3A 2LXCA 1P98A 2GOWA 1E5WA 2AYOB 2XK5A 2V3SA 3X0WA 3PTFC 4F1SA 4GIVA 4RM8A 1KM7A 1YD8U 5AEKB 2O6VD 2LZ6A 4ICUA 4PYZA 4KIKB 1G6JA 1WJ6A 1GUAB 2D10A 1LQBA 3PV1A 5CX3A 1ISNA 4NNJB 3OLMD 5J18A 2ZVNA 4W9EA 2HTHA 3HHMA 5J2RA 2IO1B 4JGHB 2CR5A 3ML8A 3ZTDA 1NBFC 3UGBB 2J0MA 2CHZA 4GDLB 3WAOA 4IWQA 2KD0A 3ALBA 1SIFA 1WXSA 3QC8B 3U7DA 2AL3A 2KFKB 4GU2A 3T8MA 4LDTB 2NVUI 2K8HA 3QIJA 2AEHA 3IBEA 2MX2A 1YJ1A 1WX7A 3DVNU 1AARA 2DZJA 4DHZB 4KZCA 4W9JA 2PEAA 1E7UA 2O6VA 3QWZB 4IC7B 1WFYA 2ZNVC 3PLUA 4A3OA 4IWPA 4NQLB 3R7RA 3DVNV 4JIOU 3TBLD 2DAFA 3B1LX 2JZZA 1MG8A 4HDQA 2BF8B 1OGWA 1IP9A 3U30A 4AWJA 4DHZE 3V6EB 5C23A 3H7PA 2NBUA 1M94A 2KLCA 4DWFA 1KOTA 1ZGUB 4A20A 4HXDA 1WZ0A 2LASA 2JRIB 2KDEB 3KYCD 2KJRA 3N30A 1Q0WB 4EOYA 5J17A 3UQAA 3ONSA 2KKCA 2ZPNA 4LCDE 2JZ3B 4E3CA 2HE7A 5KHQA 2C7NB 2KC2A 1Z5SB 2DHZA 4II3B 2N7DA 2DZIA 3KW5B 4FLHA 2IYDB 4KSKC 2L00B 2LGXA 4G0NB 2XK5B 2O2VB 1WGDA 1WX9A 2KWCA 3JW0X 3LDZE 2LUEA 2NPTA 2D07B 3R3MA 2L8JA 4F7ZA 3MHSD 3WANA 3VHTC 4EZJA 2M0XA 3ZNZB 4HCNB 3AU5A 1UZXB 3RZFA 2MCNB 3KUDB 4DXAB 4NJ7A 1LM8B 1R4NI 2L76A 3N3KB 1R4MI 2WX1A 3DVGX 2V4LA 4RM9A 2K6QA 2J7QB 5DPRA 4ANUA 3DBHI 1C1YB 4II2B 1TTNA 2GBMA 2BWFA 4OVUA 5G55A 2MBBB 1ZW7A 1Z2MA 2VRRB 2KMAA 3H7SA 1UGMA 2LGYA 4MJSB 1WGYA 2N4FA 4AJYB 4ZRKA 5DPSA 1L2NA 2JXXA 3UINB 4CYEA 2IO3B 4FJYA 3H9DA 4W9IA 2O6VB 2FCQA 2DYOA 3VQIA 2LVOA 3KVFB 2CU1A 2KJHB 1NI2A 4TQ0A 4K7WA 3PGEA 1V81A 1WZ3A 4NPNA 4FA6A 4TUUA 3APDA 3H1UA 2KQ7A 5CTRC 4AUQC 2JF5A 3O65B 3KUZA 3ZNGC 3ML9A 2PE9A 1EF1A 3AXCA 3H7PB 4WQOB 2YVCA 2WWZA 4F8CB 3VXWA 3QA8A 3VFKA 2RD0A 2I1KA 2BPSA 2JWZA 4IM3A 3UIPB 2KK8A 4HJKA 4DDGD 4K81A 2GMIC 2A5UA 1YQBA 3ENEA 3DBSA 4FBJB 4J6IA 3ZO5B 2KNBA 4MELA 1WIAA 2RPQA 3B08A 3DOWA 2Y5BB 3ZVVA 1SE9A 5JZEB 2DENB 2NBVB 3KYDD 5IA7A 2KJ6A 3R7QA 4MSQB 2NPTB 3L0WB 2DYBA 3DPDA 2FNJB 1OTRB 2O2VA 3L54A 3TIXA 3RZWC 1WE6A 2LXAA 2D3GA 3OAWA 4WJNA 4XX5A 3WAPA 2MA9B 4E74A 4ANWA 2IO2B 4BVUC 3N32A 4BFRA 2KHWB 3LJ3A 4XZ4A 4BKGA 2JT4B 2MBOA 4IW0A 4WJPA 1X1MA 2FAZA 1OQYA 5DPWA 1P3QU 5DCNA 2G4DB 3RUIB 5AZFA 3VUXA 1TGZB 3ZDTA 2KTFA 3VUYA 1HE8A 3PT2B 4GDKA 1J8CA 1GG3A 2AL6A 3QARA 3D32A 2B3AA 3TMPB 3ZW3A 3PS6A 2D11A 4IUMB 5E6NA 1LXDA 3PREA 5CHFA 2GBJA 4I6PA 1V49A 2ZCBA 3M95A 4MJSA 3SD5A 3ZIMA 1K8RB 2GBKA 5TR5A 2WX0A 4MH0E 4DBGA 2IBIB 1RLFA 1YX5B 2N1VA 3QQ8B 2A4ZA 3SDLC 2KLGA 3ZNID 1EF5A 3V60A 1S1QB 3JSVA 3M3JA 4FULA 4WWNA 3RYTA 4K1RB 3U8ZA 4MDKE 2N7EA 1WF9A 5LXHA 1I42A 2KQSA 2C7HA 4M0WB 3ZTCA 4MSMB 3EC8A 4G50A 3SU8X 1WYWB 2MLBA 4ZRIA 4K7UA 1YX6B 4MEMA 1Q1OA 2FCSA 1S3SG 2YLMA 4W9DA 4AJWA 3VTUA 4HVBA 1E90A 2J0JA 2LI5A 2ZPYA 3ZKJC 2C60A 2LD9A 3IHPC 3WALA 1V80A 3PSEB 1WJNA 1GJZA 2KX0A 1WI0A 3L08A 4PYUA 2L0TA 4GXBA 1WH3A 2N9PC 3H6NA 4AOFA 2D2QA 2M4NA 5L95C 3QK0A 3APFA 1WJ4A 3GZNI 3PLVA 3TJPA 2FIDA 1ZKHA 1F9JA 2REXA 3L16A 4IWOA 4NJ6A 3ZRCA 2NBWB 3VVWB 3QJZA 2DX5B 4BOZB 4E71A 5JH5C 2R2QA 4MGIE 2KXJA 3UF8A 4HDOA 1NDDA 4FJVB 2DAJA 4N9F4 3T9LA 1TBEA 2BGFA 3K9OB 1GC6A 5C1ZA 1OEYJ 2BKRB 5EDSA 2JVCA 2KTRB 4GDKB 3VUWA 3ZNHB 2KWUB 4CHKA 1P1AA 2ASQA 2BKFA 2MWSB 4EEWA 2N1WA 4MGYE 1TZ1A 2NCNA 3M62B 1GNUA 4PS8A 1XQQA 1WM3A 3Q3FA 4WJOA 4ANVA 3V6CB 1V5OA 1QZEA 5KHOA 2KOXA 2V1YA 2QHOA 3JVZX 3ZUNA 3DCGA 4PS3A 4AP4C 1UBIA 4BKTA 4KVGB 2M8SA 3OJ4B 2LWPA 1WXAA 2FUHB 2KDBA 1E8XA 2IZVB 2M17A 3DBRI 3HK0A 4G3XB 4G11A 4K7SA 5GMVA 3VTWA 4DDID 3JSVB 4MGKE 4EKUA 2XBBC 2BWES 1CMXB 4ZDVA 3ZDMC 4LJOB 4W9HA 2K25A 1T0YA 2XEWA 5JHBA 5CHWA 1WE7A 3TL5A 2EMSA 1WY8A 1GC7A 1WX8A 2G45B 2L3ZA 3R66C 3KH0A 3PPAA 1VD2A 3K9PB 3JYUA 1VCBA 1E7VA 4B9KA 3AU4A 3CMMB 3W1SA 4ICVA 4WAAA 1I35A 2L0FA 1UELA 1U4AA 4PS7A 5LLIA 2Z0EB 3MJWA 1UD7A 5E6PA 1WR1A 3A1QB 3QAQA 3NHEB 3SHQA 4HCPB 1KLVA 3P2BA 2LRUA 2JRHA 1V9JA 5HKHA 4EUTA 3IVFA 2PJHA 2N9XA 1UBQA 2Z59B 5CHVC 3M63B 5FR6A 2IY0B 4MGZE 2FCNA 2FCMA 2WDTB 3A9JA 2G3QB 4W9LA 1WGHA 4FN2A 3HIZA 2KC1A 4MM3A 4B95A 1H8CA 1Q5WB 2LGDA 2K8CA 4GMVA 2G4SA 3BY4B 3L13A 2MQJA 4GN1A 3PZDA 2JUOA 4FJZA 3VH4B 4EFOA 1D3ZA 3NZUA 3L17A 2KTRA 3PRMB 2RSUA 4M8MA 1YIWA 3WIMA 1A5RA 4NAWA 3V61A 3VH3B 2MW5A 1Y8RC 4IG7B 1XD3B 5D6JB 1E8ZA 2N9EB 4WWOA 3S2AA 5D94A 1OEYA 2KX3A 2MBQA 3NOBA 4KDLB 1WR6E 2LVQA 2DYMA 2L7RA 2C5LC 3RCZA 1WJUA 2W9NA 2LVPA 2KDIA 1BT0A 3PHWB 2K8BA 2KMCA 3EHVA 3A4SC 5JHAA 2K1FA 4KV2A 4EZLA 1XT9B 4JQWC 1P0RA 3B0AA 3PRZA 4KZ0A 4TKNA 3X23A 2KANA 1IYFA 4JL9A 3A33B 4LJPB 5D2MB 3CF6E 3VTVA 3W1YA 1KJTA 2ZCCA 2WYQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4W9G A;  5E6O A;  1WGR A;  2M1M A;  2Z0D B;  2BYF A;  3I3T B;  4XC2 A;  3RD2 A;  4GOC A;  4IM2 A;  4EZK A;  1UH6 A;  1V6E A;  4OVV A;  1LFD A;  3AI5 A;  4I6L B;  2ZJD A;  2UWQ A;  4HPM B;  3PHX B;  4B6W A;  3NZS A;  5DPT A;  4YL8 A;  3WAM A;  4P7I A;  2ZVO A;  5D7G A;  2J0K A;  3PRP B;  3DDC B;  3A1Q A;  2ZEQ A;  2CKH B;  2DZK A;  4W9K A;  3UIO B;  5BO4 B;  4FHK A;  1IPG A;  3QX1 A;  3A9K A;  4ANX A;  3OJ3 A;  2CHX A;  5IAA C;  2MRP A;  2MP2 B;  3A9J B;  3MTN B;  4HK2 A;  1WMH A;  3BIN A;  2MBH A;  1WM2 A;  2JY6 A;  2KZR A;  4NY0 A;  4BOS C;  2K39 A;  4HLE A;  5G2N A;  3NY5 A;  4ZYN A;  2CHW A;  4ZRJ A;  4NQK E;  1SGH A;  3C0R B;  2KWV B;  4NAW B;  4GSW A;  4WWP A;  3IG3 A;  4CO7 A;  1RRB A;  2KN5 A;  1V5T A;  3VAW A;  4LDT D;  2KO3 A;  2RGF A;  1PQS A;  1RAX A;  1EUV B;  4HWI B;  4FHJ A;  4DHJ B;  4M8N A;  4X57 B;  4KSL C;  1WGG A;  3DQV A;  3ZRF A;  2KFJ A;  4HPL B;  1L7Y A;  3VDZ A;  4W9C A;  3W1S C;  2MBE A;  1JRU A;  4KIK A;  3UQB A;  2IO0 B;  3GOE A;  4JLC A;  4BKS D;  1RFA A;  2PPH A;  2RR9 A;  2BYE A;  2EKE C;  3CSF A;  2JPH A;  2NR2 A;  3CST A;  4RMA A;  2UYZ B;  1WXM A;  2GBR A;  2OOB B;  3DVG Y;  4GDL A;  2PE6 B;  3TCA A;  5LXI B;  2R2O A;  2GBN A;  3NS8 A;  1FXT B;  2KDF B;  3V62 A;  5AZH A;  2KFK A;  2C9W B;  4BBN F;  1V2Y A;  3A4R A;  4WJQ A;  1H4R A;  2BYV E;  2KVR A;  4GGQ A;  4TQ1 A;  1E8Y A;  4I6N B;  3KUC B;  4BBN C;  2AWT A;  1WXV A;  4FAD A;  3EFU A;  3APC A;  4BKS A;  1V86 A;  3PVL A;  4W9F A;  3RT3 B;  2LJ5 A;  2DZM A;  3Q3J A;  3A9K B;  2I1J A;  3HM6 X;  4A3P A;  2C7M B;  2IY1 B;  4KDI C;  3QHT A;  2K6D B;  1C3T A;  1J19 A;  4DHJ D;  3IFW B;  3HM3 A;  1WMH B;  4IM0 A;  2HD5 B;  2MP2 A;  3L10 B;  1WRD B;  2HJ8 A;  2ZNV B;  3ECI A;  2L05 A;  4DK5 A;  2CS4 A;  2ZZP B;  3AUL A;  1EO6 A;  3QCA A;  2NS5 A;  2MSE D;  5AZG A;  4URK A;  2OJR A;  1P9D U;  3ZLZ A;  1J0G A;  3WA0 A;  4ASW C;  2FIF A;  4GB9 A;  2EMT A;  2LRW A;  3DBL I;  1E8W A;  3RUL A;  5L83 A;  3EEC A;  4TV3 A;  2LXC A;  1P98 A;  2GOW A;  1E5W A;  2AYO B;  2XK5 A;  2V3S A;  3X0W A;  3PTF C;  4F1S A;  4GIV A;  4RM8 A;  1KM7 A;  1YD8 U;  5AEK B;  2O6V D;  2LZ6 A;  4ICU A;  4PYZ A;  4KIK B;  1G6J A;  1WJ6 A;  1GUA B;  2D10 A;  1LQB A;  3PV1 A;  5CX3 A;  1ISN A;  4NNJ B;  3OLM D;  5J18 A;  2ZVN A;  4W9E A;  2HTH A;  3HHM A;  5J2R A;  2IO1 B;  4JGH B;  2CR5 A;  3ML8 A;  3ZTD A;  1NBF C;  3UGB B;  2J0M A;  2CHZ A;  4GDL B;  3WAO A;  4IWQ A;  2KD0 A;  3ALB A;  1SIF A;  1WXS A;  3QC8 B;  3U7D A;  2AL3 A;  2KFK B;  4GU2 A;  3T8M A;  4LDT B;  2NVU I;  2K8H A;  3QIJ A;  2AEH A;  3IBE A;  2MX2 A;  1YJ1 A;  1WX7 A;  3DVN U;  1AAR A;  2DZJ A;  4DHZ B;  4KZC A;  4W9J A;  2PEA A;  1E7U A;  2O6V A;  3QWZ B;  4IC7 B;  1WFY A;  2ZNV C;  3PLU A;  4A3O A;  4IWP A;  4NQL B;  3R7R A;  3DVN V;  4JIO U;  3TBL D;  2DAF A;  3B1L X;  2JZZ A;  1MG8 A;  4HDQ A;  2BF8 B;  1OGW A;  1IP9 A;  3U30 A;  4AWJ A;  4DHZ E;  3V6E B;  5C23 A;  3H7P A;  2NBU A;  1M94 A;  2KLC A;  4DWF A;  1KOT A;  1ZGU B;  4A20 A;  4HXD A;  1WZ0 A;  2LAS A;  2JRI B;  2KDE B;  3KYC D;  2KJR A;  3N30 A;  1Q0W B;  4EOY A;  5J17 A;  3UQA A;  3ONS A;  2KKC A;  2ZPN A;  4LCD E;  2JZ3 B;  4E3C A;  2HE7 A;  5KHQ A;  2C7N B;  2KC2 A;  1Z5S B;  2DHZ A;  4II3 B;  2N7D A;  2DZI A;  3KW5 B;  4FLH A;  2IYD B;  4KSK C;  2L00 B;  2LGX A;  4G0N B;  2XK5 B;  2O2V B;  1WGD A;  1WX9 A;  2KWC A;  3JW0 X;  3LDZ E;  2LUE A;  2NPT A;  2D07 B;  3R3M A;  2L8J A;  4F7Z A;  3MHS D;  3WAN A;  3VHT C;  4EZJ A;  2M0X A;  3ZNZ B;  4HCN B;  3AU5 A;  1UZX B;  3RZF A;  2MCN B;  3KUD B;  4DXA B;  4NJ7 A;  1LM8 B;  1R4N I;  2L76 A;  3N3K B;  1R4M I;  2WX1 A;  3DVG X;  2V4L A;  4RM9 A;  2K6Q A;  2J7Q B;  5DPR A;  4ANU A;  3DBH I;  1C1Y B;  4II2 B;  1TTN A;  2GBM A;  2BWF A;  4OVU A;  5G55 A;  2MBB B;  1ZW7 A;  1Z2M A;  2VRR B;  2KMA A;  3H7S A;  1UGM A;  2LGY A;  4MJS B;  1WGY A;  2N4F A;  4AJY B;  4ZRK A;  5DPS A;  1L2N A;  2JXX A;  3UIN B;  4CYE A;  2IO3 B;  4FJY A;  3H9D A;  4W9I A;  2O6V B;  2FCQ A;  2DYO A;  3VQI A;  2LVO A;  3KVF B;  2CU1 A;  2KJH B;  1NI2 A;  4TQ0 A;  4K7W A;  3PGE A;  1V81 A;  1WZ3 A;  4NPN A;  4FA6 A;  4TUU A;  3APD A;  3H1U A;  2KQ7 A;  5CTR C;  4AUQ C;  2JF5 A;  3O65 B;  3KUZ A;  3ZNG C;  3ML9 A;  2PE9 A;  1EF1 A;  3AXC A;  3H7P B;  4WQO B;  2YVC A;  2WWZ A;  4F8C B;  3VXW A;  3QA8 A;  3VFK A;  2RD0 A;  2I1K A;  2BPS A;  2JWZ A;  4IM3 A;  3UIP B;  2KK8 A;  4HJK A;  4DDG D;  4K81 A;  2GMI C;  2A5U A;  1YQB A;  3ENE A;  3DBS A;  4FBJ B;  4J6I A;  3ZO5 B;  2KNB A;  4MEL A;  1WIA A;  2RPQ A;  3B08 A;  3DOW A;  2Y5B B;  3ZVV A;  1SE9 A;  5JZE B;  2DEN B;  2NBV B;  3KYD D;  5IA7 A;  2KJ6 A;  3R7Q A;  4MSQ B;  2NPT B;  3L0W B;  2DYB A;  3DPD A;  2FNJ B;  1OTR B;  2O2V A;  3L54 A;  3TIX A;  3RZW C;  1WE6 A;  2LXA A;  2D3G A;  3OAW A;  4WJN A;  4XX5 A;  3WAP A;  2MA9 B;  4E74 A;  4ANW A;  2IO2 B;  4BVU C;  3N32 A;  4BFR A;  2KHW B;  3LJ3 A;  4XZ4 A;  4BKG A;  2JT4 B;  2MBO A;  4IW0 A;  4WJP A;  1X1M A;  2FAZ A;  1OQY A;  5DPW A;  1P3Q U;  5DCN A;  2G4D B;  3RUI B;  5AZF A;  3VUX A;  1TGZ B;  3ZDT A;  2KTF A;  3VUY A;  1HE8 A;  3PT2 B;  4GDK A;  1J8C A;  1GG3 A;  2AL6 A;  3QAR A;  3D32 A;  2B3A A;  3TMP B;  3ZW3 A;  3PS6 A;  2D11 A;  4IUM B;  5E6N A;  1LXD A;  3PRE A;  5CHF A;  2GBJ A;  4I6P A;  1V49 A;  2ZCB A;  3M95 A;  4MJS A;  3SD5 A;  3ZIM A;  1K8R B;  2GBK A;  5TR5 A;  2WX0 A;  4MH0 E;  4DBG A;  2IBI B;  1RLF A;  1YX5 B;  2N1V A;  3QQ8 B;  2A4Z A;  3SDL C;  2KLG A;  3ZNI D;  1EF5 A;  3V60 A;  1S1Q B;  3JSV A;  3M3J A;  4FUL A;  4WWN A;  3RYT A;  4K1R B;  3U8Z A;  4MDK E;  2N7E A;  1WF9 A;  5LXH A;  1I42 A;  2KQS A;  2C7H A;  4M0W B;  3ZTC A;  4MSM B;  3EC8 A;  4G50 A;  3SU8 X;  1WYW B;  2MLB A;  4ZRI A;  4K7U A;  1YX6 B;  4MEM A;  1Q1O A;  2FCS A;  1S3S G;  2YLM A;  4W9D A;  4AJW A;  3VTU A;  4HVB A;  1E90 A;  2J0J A;  2LI5 A;  2ZPY A;  3ZKJ C;  2C60 A;  2LD9 A;  3IHP C;  3WAL A;  1V80 A;  3PSE B;  1WJN A;  1GJZ A;  2KX0 A;  1WI0 A;  3L08 A;  4PYU A;  2L0T A;  4GXB A;  1WH3 A;  2N9P C;  3H6N A;  4AOF A;  2D2Q A;  2M4N A;  5L95 C;  3QK0 A;  3APF A;  1WJ4 A;  3GZN I;  3PLV A;  3TJP A;  2FID A;  1ZKH A;  1F9J A;  2REX A;  3L16 A;  4IWO A;  4NJ6 A;  3ZRC A;  2NBW B;  3VVW B;  3QJZ A;  2DX5 B;  4BOZ B;  4E71 A;  5JH5 C;  2R2Q A;  4MGI E;  2KXJ A;  3UF8 A;  4HDO A;  1NDD A;  4FJV B;  2DAJ A;  4N9F 4;  3T9L A;  1TBE A;  2BGF A;  3K9O B;  1GC6 A;  5C1Z A;  1OEY J;  2BKR B;  5EDS A;  2JVC A;  2KTR B;  4GDK B;  3VUW A;  3ZNH B;  2KWU B;  4CHK A;  1P1A A;  2ASQ A;  2BKF A;  2MWS B;  4EEW A;  2N1W A;  4MGY E;  1TZ1 A;  2NCN A;  3M62 B;  1GNU A;  4PS8 A;  1XQQ A;  1WM3 A;  3Q3F A;  4WJO A;  4ANV A;  3V6C B;  1V5O A;  1QZE A;  5KHO A;  2KOX A;  2V1Y A;  2QHO A;  3JVZ X;  3ZUN A;  3DCG A;  4PS3 A;  4AP4 C;  1UBI A;  4BKT A;  4KVG B;  2M8S A;  3OJ4 B;  2LWP A;  1WXA A;  2FUH B;  2KDB A;  1E8X A;  2IZV B;  2M17 A;  3DBR I;  3HK0 A;  4G3X B;  4G11 A;  4K7S A;  5GMV A;  3VTW A;  4DDI D;  3JSV B;  4MGK E;  4EKU A;  2XBB C;  2BWE S;  1CMX B;  4ZDV A;  3ZDM C;  4LJO B;  4W9H A;  2K25 A;  1T0Y A;  2XEW A;  5JHB A;  5CHW A;  1WE7 A;  3TL5 A;  2EMS A;  1WY8 A;  1GC7 A;  1WX8 A;  2G45 B;  2L3Z A;  3R66 C;  3KH0 A;  3PPA A;  1VD2 A;  3K9P B;  3JYU A;  1VCB A;  1E7V A;  4B9K A;  3AU4 A;  3CMM B;  3W1S A;  4ICV A;  4WAA A;  1I35 A;  2L0F A;  1UEL A;  1U4A A;  4PS7 A;  5LLI A;  2Z0E B;  3MJW A;  1UD7 A;  5E6P A;  1WR1 A;  3A1Q B;  3QAQ A;  3NHE B;  3SHQ A;  4HCP B;  1KLV A;  3P2B A;  2LRU A;  2JRH A;  1V9J A;  5HKH A;  4EUT A;  3IVF A;  2PJH A;  2N9X A;  1UBQ A;  2Z59 B;  5CHV C;  3M63 B;  5FR6 A;  2IY0 B;  4MGZ E;  2FCN A;  2FCM A;  2WDT B;  3A9J A;  2G3Q B;  4W9L A;  1WGH A;  4FN2 A;  3HIZ A;  2KC1 A;  4MM3 A;  4B95 A;  1H8C A;  1Q5W B;  2LGD A;  2K8C A;  4GMV A;  2G4S A;  3BY4 B;  3L13 A;  2MQJ A;  4GN1 A;  3PZD A;  2JUO A;  4FJZ A;  3VH4 B;  4EFO A;  1D3Z A;  3NZU A;  3L17 A;  2KTR A;  3PRM B;  2RSU A;  4M8M A;  1YIW A;  3WIM A;  1A5R A;  4NAW A;  3V61 A;  3VH3 B;  2MW5 A;  1Y8R C;  4IG7 B;  1XD3 B;  5D6J B;  1E8Z A;  2N9E B;  4WWO A;  3S2A A;  5D94 A;  1OEY A;  2KX3 A;  2MBQ A;  3NOB A;  4KDL B;  1WR6 E;  2LVQ A;  2DYM A;  2L7R A;  2C5L C;  3RCZ A;  1WJU A;  2W9N A;  2LVP A;  2KDI A;  1BT0 A;  3PHW B;  2K8B A;  2KMC A;  3EHV A;  3A4S C;  5JHA A;  2K1F A;  4KV2 A;  4EZL A;  1XT9 B;  4JQW C;  1P0R A;  3B0A A;  3PRZ A;  4KZ0 A;  4TKN A;  3X23 A;  2KAN A;  1IYF A;  4JL9 A;  3A33 B;  4LJP B;  5D2M B;  3CF6 E;  3VTV A;  3W1Y A;  1KJT A;  2ZCC A;  2WYQ A; 
#chains in the Genus database with same CATH topology
 1N5W A;  2M1M A;  4TMA B;  4EZK A;  4OVV A;  1V6E A;  2D3C A;  2MH7 A;  2ICI A;  3PHX B;  4A90 A;  1TS5 A;  2J0K A;  1FXA A;  2CKH B;  3IXS A;  3UIO B;  2KT7 A;  4J3O D;  3A9K A;  5IOI A;  1JRP A;  2MP2 B;  3AE9 B;  5E6J A;  1FCL A;  1ZPS A;  1NYQ A;  2CHW A;  4ZRJ A;  2KN5 A;  1V5T A;  3VAW A;  2M0A A;  2KO3 A;  1EWY C;  3P4R B;  4KSL C;  3RNC C;  1L7Y A;  2D3B A;  4KIK A;  2PPH A;  1JWU D;  2EKE C;  2BVC A;  2JPH A;  2QCZ A;  3NVZ A;  2UYZ B;  1WXM A;  2OOB B;  1N63 A;  4S17 A;  3NS8 A;  4UDU C;  2INP E;  2KFK A;  2C9W B;  2FBW B;  4WJQ A;  2X38 A;  1T6B X;  1J7B A;  4IOI E;  1V86 A;  3A9K B;  3HM6 X;  3N1X C;  4PK1 A;  2IY1 B;  2WXG A;  2K6D B;  4HKZ E;  2KYW A;  4DHJ D;  4LNF A;  3HM3 A;  1JML A;  3ABV B;  2HD5 B;  1FM0 D;  3L10 B;  2HJ8 A;  2ZNV B;  1EO6 A;  3QCA A;  1DYQ A;  5FK9 C;  4L23 A;  1YN4 A;  2LMC A;  1FMA D;  1J0G A;  1C76 A;  1E8W A;  5L83 A;  2LXC A;  5BYR A;  1VRA B;  2V3S A;  1FIQ A;  4F1S A;  1KM7 A;  2O6V D;  2LZ6 A;  4PYZ A;  4YTN B;  4KIK B;  1EWC A;  1QLB B;  1E6E B;  1LQB A;  1HTO A;  2IO1 B;  2CR5 A;  2R61 A;  4LNO A;  5C2T B;  3WAO A;  3ALB A;  1ZXI A;  1WXS A;  2KFK B;  2AEH A;  1NI3 A;  5IN7 A;  1YJ1 A;  1WWT A;  4ZYS A;  4KZC A;  2PEA A;  2O6V A;  1WFY A;  2ZNV C;  2QJL A;  2IGG A;  4IWP A;  5BMI A;  4LK0 M;  2LHD A;  2WDQ B;  1OGW A;  1YN3 A;  5C23 A;  3H7P A;  1ZGU B;  3MP9 A;  1WZ0 A;  3AN1 A;  2JRI B;  5H8Y E;  2KKC A;  3T3O A;  1Z5S B;  4II3 B;  1A70 A;  2N7D A;  3KW5 B;  2LGX A;  2JZP A;  2KWC A;  2WXN A;  1ET9 A;  1VZ8 A;  2L8J A;  4F7Z A;  3WAN A;  1N6Z A;  2BTE A;  4XDC A;  3BVZ A;  4NJ7 A;  1LM8 B;  1R4N I;  1R4M I;  2E3T A;  1SIJ A;  1C1Y B;  2AQ2 B;  5FR3 A;  2BWF A;  4M00 A;  5G55 A;  2KVZ A;  2VRR B;  4LTU A;  4AJY B;  2N4F A;  3P4S B;  2JXX A;  4CYE A;  2O6V B;  3VQI A;  2V9H A;  2WXO A;  2J52 A;  1NI2 A;  3BVG A;  4K7W A;  1T3Q A;  4TUU A;  3APD A;  2KQ7 A;  1PGB A;  1KRH A;  4WQO B;  1WRI A;  3H7P B;  2DNF A;  4WAF A;  2WWZ A;  4F8C B;  1ZUD 2;  3EUB 2;  4B0E A;  2RD0 A;  2BPS A;  2JWZ A;  1GPX A;  1VLB A;  4DDG D;  3AE5 B;  3ZO5 B;  2NMQ A;  1WIA A;  3B08 A;  5AUI A;  4QAY A;  3KYD D;  3GE3 C;  2HJ1 A;  1HA5 A;  1WSP A;  2M19 A;  3L0W B;  3URY A;  2DYB A;  2FNJ B;  1OTR B;  3SR6 A;  3TIX A;  3BWU D;  4YSY B;  3MFG A;  4WJN A;  4XX5 A;  2IO2 B;  3TEW A;  3EFC A;  4XZ4 A;  2JT4 B;  1X1M A;  3RUI B;  5BMH A;  3PT2 B;  3QAR A;  1TS4 A;  2D11 A;  3AE4 B;  1JRO A;  1HTQ A;  2BYT A;  3SD5 A;  2WQY B;  1TT5 B;  2GI9 A;  3C8Y A;  1YX5 B;  3SDL C;  1EF5 A;  5LXH A;  1NYR A;  3ZTC A;  4MSM B;  2ZW1 A;  1E10 A;  1YJI A;  2MLB A;  1C9F A;  4MEM A;  2FCS A;  2YLM A;  3E56 A;  3VTU A;  2LI5 A;  2OHF A;  2LD9 A;  5LNK 1;  3PSE B;  1GJZ A;  2WXF A;  3AEC B;  1DOY A;  2N9P C;  4AOF A;  5G5G A;  3APF A;  2FID A;  1ZKH A;  3ZRC A;  3QJZ A;  3UF8 A;  2KXJ A;  2MJE A;  3AED B;  2NTT A;  5C1Z A;  2BKR B;  1SJH D;  1T0S C;  4EEW A;  2QIL A;  1WM3 A;  3GZN B;  1QZE A;  4PS3 A;  3OJ4 B;  4G3X B;  2FUH B;  2ON8 A;  3HK0 A;  3VTW A;  4K7S A;  1K52 A;  2SEB D;  4EKU A;  1TKG A;  2XBB C;  4TSS A;  5JHB A;  1WE7 A;  2EMS A;  2G45 B;  2L3Z A;  3TEY A;  3R66 C;  3KH0 A;  1VD2 A;  3NZ3 A;  1XXG A;  3GE8 C;  2XNA C;  3AU4 A;  2PMV A;  4WAA A;  3NG0 A;  2Z0E B;  1WGK A;  3DBR B;  2KQ4 X;  1V9J A;  2PJH A;  5HFY A;  2Z59 B;  4MGZ E;  2GRI A;  2WDT B;  1XLN A;  4HRO A;  5EE1 A;  4US9 A;  2G3Q B;  1WGH A;  2WXJ A;  2WXK A;  2K8C A;  3BY4 B;  2AQ3 B;  3E9S A;  2KWD A;  3PZD A;  4WUR A;  1FNW A;  3DHI C;  1A5R A;  1E8Z A;  3ZJT A;  2L32 A;  1FRD A;  1ET6 A;  1SE2 A;  1HZ5 A;  2DLB A;  1D4B A;  3NVV A;  2KAN A;  2Y5P A;  4LJP B;  5IP4 D;  1UF0 A;  3AE8 B;  1VDV A;  4EE2 A;  1YN5 A;  2Z0D B;  4MAC A;  3I3T B;  2CU3 A;  1STE A;  4I6L B;  3I9V 1;  2LHE A;  3AE3 B;  4B6W A;  5D7G A;  2N0S B;  2LJI A;  3ZJU A;  2ZEQ A;  2DZK A;  1VZ6 A;  4W9K A;  5BMG A;  2MEK A;  5IAA C;  2MRP A;  4L2Y A;  1WMH A;  2JY6 A;  2KZR A;  4NY0 A;  1TJE A;  3U4E G;  3TEZ A;  4YWG G;  2WXI A;  4P6V F;  2BW2 A;  3RN9 C;  5G2N A;  4GSW A;  4HJG E;  4CO7 A;  2RDH A;  4LDT D;  2JYE A;  1RAX A;  1EUV B;  4X57 B;  1XCT L;  1QOB A;  1I4Q A;  1V97 A;  2IO0 B;  4JE3 B;  1FD6 A;  1GB1 A;  4JLC A;  4BKS D;  2BB5 A;  1RFA A;  2RR9 A;  1Q10 A;  2NR2 A;  4OZA A;  3DVG Y;  4GDL A;  2PE6 B;  2KDF B;  2W54 A;  4WQM A;  4BBN F;  3AMZ A;  1V2Y A;  4JX1 C;  3A4R A;  1E9M A;  4P1B C;  2BYV E;  2KVR A;  3P63 A;  4I6N B;  4BBN C;  3N20 C;  4XE0 A;  3TSS A;  3APC A;  1IGC A;  4BKS A;  4W9F A;  1KF6 B;  2LJ5 A;  1N61 A;  2I1J A;  3DBH B;  1J7C A;  2DBY A;  1WMH B;  2Q5W D;  4IM0 A;  2MP2 A;  3ECI A;  2L05 A;  4ACF A;  4N58 A;  3SEB A;  2N9L A;  5AZG A;  4URK A;  1P9D U;  3Q69 A;  3WA0 A;  2QSD A;  3DBL I;  3WCQ A;  1KLU D;  3EEC A;  4TV3 A;  4AQ7 A;  2AYO B;  1YJJ A;  4GIV A;  4RM8 A;  1P7F A;  5AEK B;  4HRS A;  1GUA B;  3OLM D;  3DWG C;  3HHM A;  2BS2 B;  5J2R A;  1F52 A;  3ML8 A;  3ZTD A;  1NBF C;  3UGB B;  4GDL B;  2CHZ A;  5I4D A;  3MC0 B;  3IT6 B;  4OHJ A;  4YXD B;  1KFY B;  2AL3 A;  2D5G A;  2XN9 C;  4LDT B;  2NVU I;  2K8H A;  3QIJ A;  2RPV A;  1AAR A;  2DZJ A;  1QF6 A;  3GS2 A;  3VR9 B;  4IC7 B;  3PLU A;  4A3O A;  2K3U A;  4NQL B;  3TBL D;  1MG8 A;  4HDQ A;  3B2G A;  1IP9 A;  3U30 A;  4AWJ A;  4DHZ E;  3P4Q B;  3V6E B;  1M94 A;  2LAS A;  2KDE B;  3BVM A;  4R3D A;  1Q0W B;  2ZPN A;  2JZ3 B;  5KHQ A;  2W55 A;  1OFF A;  5JXV A;  2DZI A;  2D3A A;  3W2D A;  2WDV B;  2IND C;  4G0N B;  2O2V B;  2NPT A;  2W3S A;  3ZNZ B;  3KQ4 A;  1UZX B;  3AE2 B;  3KUD B;  4L1B A;  5D3I B;  1NEK B;  1ENF A;  2L76 A;  2WX1 A;  1TKY A;  2WXP A;  4ANU A;  1YNT E;  2PIA A;  5HHD G;  1TTN A;  2MBB B;  2K22 A;  3ZGZ A;  2LGI A;  2LGY A;  4ZRK A;  4LNK A;  4ZOH C;  1L0V B;  1L2N A;  3J9C A;  3UIN B;  2BT6 A;  1SXT A;  4FJY A;  2FCQ A;  1ROE A;  4Q2J A;  4XWT A;  4C00 A;  1V81 A;  4NPN A;  1XCQ L;  1ZE3 D;  4C7Z A;  1TZO A;  3ZNG C;  2PE9 A;  3AXC A;  1D6E C;  4M0W A;  1RFK A;  3RNE C;  3VXW A;  1YQ4 B;  4JWU C;  4K81 A;  2GMI C;  2A5U A;  2INN E;  4FBJ B;  3HVZ A;  2KNB A;  3Q6B A;  3FC4 A;  2Y5B B;  2Z8L A;  3ZVV A;  1FFV A;  3P42 A;  3HRD D;  3ZYY X;  1ZOY B;  5IA7 A;  2KJ6 A;  2NPT B;  3DPD A;  3L54 A;  1WE6 A;  3BYY B;  2D3G A;  5EE9 A;  2MA9 B;  4E74 A;  3N32 A;  3LXF A;  4LNN A;  4BKG A;  2OJW A;  1P3Q U;  1PUT A;  5AZF A;  4XYC A;  3ZDT A;  2KTF A;  3AEA B;  1HE8 A;  1J8C A;  1GG3 A;  3HUI A;  3NJT A;  3PS6 A;  1LXD A;  3AM9 A;  2GBJ A;  4I6P A;  2ZCB A;  5GXG B;  4C7Y A;  3BZD B;  4RGM A;  2GBK A;  2VH1 A;  3ZJV A;  1Y56 A;  2N1V A;  3QQ8 B;  2A4Z A;  3ZNI D;  3V05 A;  3Q8F A;  3V60 A;  3M3J A;  2L83 A;  2N7E A;  1WF9 A;  3N1Y C;  4M0W B;  4H2A A;  1T0Q C;  4K7U A;  1YX6 B;  1F2R C;  5AUK A;  4AJW A;  1RM6 C;  1E90 A;  2J0J A;  2ZPY A;  3Q3N C;  3IHP C;  1KTK A;  3AEG B;  1V80 A;  4LNI A;  3MC9 A;  2KX0 A;  4PYU A;  2L0T A;  4GXB A;  3FAH A;  3GZN I;  3TJP A;  2REX A;  3GB1 A;  5JH5 C;  4MM3 B;  4MGI E;  2DAJ A;  1N60 A;  3T9L A;  1TBE A;  2BGF A;  5T8I A;  2JVC A;  2KTR B;  2KWU B;  2BKF A;  2MWS B;  2ONQ A;  1VJK A;  4PS8 A;  1GNU A;  1WXQ A;  1XQQ A;  1TIF A;  2GLS A;  3V6C B;  4HEA 1;  3EGR A;  2QHO A;  3ZUN A;  3DCG A;  3DBR I;  3LYY A;  4G11 A;  4DDI D;  3EA6 A;  4RGT A;  3VRB B;  1CMX B;  4LJO B;  2N9K A;  1WY8 A;  1GC7 A;  1WX8 A;  2Y5C A;  3K9P B;  3JYU A;  1VCB A;  1VR9 A;  2IGH A;  2LFI A;  4ICV A;  1UEL A;  1UD7 A;  1WR1 A;  2PW9 A;  3A1Q B;  3QAQ A;  3NHE B;  4HCP B;  2N9X A;  1UBQ A;  5CHV C;  3M63 B;  1IGD A;  2QEJ C;  4FN2 A;  1H8C A;  2KC1 A;  4C80 A;  2LGD A;  4GMV A;  2MQJ A;  4GN1 A;  1NVI D;  1OQQ A;  2GB1 A;  1N62 A;  2JUO A;  3VH4 B;  3TEX A;  4EFO A;  3NZU A;  3WIM A;  2WU2 B;  4NAW A;  2MW5 A;  1XD3 B;  5D6J B;  1JWM D;  2N9E B;  1JAL A;  1OEY A;  2BBC A;  2V0G A;  1VZ7 A;  3NOB A;  1FRR A;  2QMT A;  2LVQ A;  2L7R A;  1BUI C;  4MT5 A;  2K8B A;  4XWW A;  3A4S C;  1I4H A;  5JHA A;  4EZL A;  4KV2 A;  1XT9 B;  4JQW C;  1P0R A;  3B0A A;  1IYF A;  4JL9 A;  3A33 B;  3TUO A;  3VTV A;  3W1Y A;  2ZCC A;  1WGR A;  3U52 E;  2V4I B;  2BYF A;  1B1Z A;  4GOC A;  4IM2 A;  1LFD A;  2ZJD A;  2WNM A;  3NZS A;  4YL8 A;  1QKZ A;  3WAM A;  2ZVO A;  3PRP B;  3DDC B;  1SB3 C;  5BO4 B;  1IPG A;  3QX1 A;  2CHX A;  1NEN B;  4YTM B;  2WXQ A;  3Q3M C;  4HPP A;  4HK2 A;  3BIN A;  2MBH A;  1WM2 A;  2WGS A;  1SE3 A;  4HLE A;  4NAM A;  4ZYN A;  2IJ0 A;  1SGH A;  3C0R B;  2KWV B;  4NAW B;  4ARI A;  3AEF B;  1RRB A;  4A8X C;  1L0X B;  1J7A A;  4HWI B;  3I5J C;  4M8N A;  1WGG A;  3ZRF A;  2KFJ A;  3VDZ A;  4W9C A;  1JRU A;  3CSF A;  3CST A;  4RMA A;  1D5M C;  3PZ8 A;  2R2O A;  3PZ7 A;  3V62 A;  3BYT B;  4KGS A;  4TQ1 A;  3KUC B;  2AWT A;  3NUH B;  1I4X A;  4FAD A;  1R4N B;  3EFU A;  4RCO A;  2DZM A;  3Q3J A;  1AWD A;  4A3P A;  4M02 A;  1ZP0 B;  1JWB D;  5HI1 A;  1J19 A;  3IFW B;  2OED A;  1CK1 A;  1WRD B;  4DK5 A;  2CS4 A;  3AUL A;  4RF1 A;  5BYQ A;  1MJD A;  1JW9 D;  3NVW A;  3ZLZ A;  4ASW C;  2FIF A;  2EMT A;  2LRW A;  2KAC A;  1FO4 A;  1E5W A;  1V1P B;  3HVD A;  4OW0 A;  5TSS A;  1MPE A;  2B76 B;  5IKC M;  1ISN A;  5J18 A;  1UGJ A;  1QQR A;  3AH7 A;  3W9C B;  4YSX B;  4JGH B;  1XLO A;  2WDR B;  2YEP B;  2QIE B;  1SIF A;  4BZA A;  3QC8 B;  3T8M A;  4YTP B;  2PVG C;  4IDI A;  2MX2 A;  1WX7 A;  1UUP A;  3QWZ B;  2WS3 B;  1C4A A;  1XLP A;  1T0R C;  4JIO U;  2JZZ A;  1DOX A;  4M01 A;  1M4V A;  3Q8E A;  1YQ3 B;  2NBU A;  4OZB A;  1GB4 A;  1KH0 A;  4A20 A;  1XF5 L;  2SAK A;  1OQR A;  4HXD A;  3KYC D;  3N30 A;  3UQA A;  3ONS A;  4E3C A;  4KX6 B;  3FIL A;  2C7N B;  2KC2 A;  2DHZ A;  2W82 A;  1K50 A;  2YEP F;  3C19 A;  2VZK B;  2Y3A A;  4FLH A;  2L00 B;  3B2F A;  3B9J A;  1WGD A;  3JW0 X;  2LUE A;  3R3M A;  3MHS D;  3VHT C;  1JCK B;  2M0X A;  4A55 A;  2PKO A;  4HCN B;  3VR8 B;  3RZF A;  2MCN B;  4A9A A;  3N3K B;  3DVG X;  3Q8C A;  4RM9 A;  3DHH C;  2MJ3 A;  5D3D A;  4II2 B;  1C77 A;  3BK1 A;  4RGO S;  1ZW7 A;  2KMA A;  2AQ1 B;  1UGM A;  4MJS B;  2EEL A;  2JYT A;  5DPS A;  4DXF A;  2G1E A;  3H9D A;  4W9I A;  3UI3 A;  2LVO A;  3KVF B;  1HEZ E;  2CU1 A;  2KJH B;  3CWI A;  1WZ3 A;  1AW7 A;  4O1N A;  4AUQ C;  2JF5 A;  1MHH E;  4NJC A;  3ML9 A;  1EF1 A;  1F2R I;  3KWL A;  1C78 A;  3RNB C;  2YVC A;  2I1K A;  4IM3 A;  3UIP B;  3FIL B;  3ENE A;  2E6X A;  3NRZ A;  2WXM A;  3FKY A;  2DEN B;  2IPK D;  3R7Q A;  4MSQ B;  2FE8 A;  2O2V A;  5HG2 A;  4C4V A;  3T3N A;  3RNF C;  2LXA A;  3L4P A;  4KKI A;  3KLS X;  4BVU C;  4BFR A;  3R2T A;  3LJ3 A;  2MBO A;  2CJO A;  4WJP A;  2FAZ A;  1OQY A;  5DPW A;  2G4D B;  3VUX A;  1QOF A;  4REZ A;  3VUY A;  3O13 A;  4S0R A;  1FXI A;  2B3A A;  3TMP B;  2BS4 B;  3DHG C;  3NVY A;  1T5X D;  4IUM B;  5E6N A;  3VRA B;  3M95 A;  3AV8 A;  1E7P B;  1K8R B;  1FNU A;  5TR5 A;  4MH0 E;  4USA A;  1EU3 A;  4DBG A;  2IBI B;  1IBX A;  1TKE A;  3W5U B;  1YMH E;  4PT5 A;  2KLG A;  1S1Q B;  3U8Z A;  4K1R B;  4MDK E;  1I42 A;  2KQS A;  2C7H A;  3EC8 A;  3SU8 X;  1WYW B;  4ZRI A;  1BML C;  1S3S G;  2JQR B;  3ZKJ C;  2C60 A;  3WAL A;  1ACC A;  1WI0 A;  4C56 C;  1FNV A;  1SE4 A;  3L08 A;  3H6N A;  2D2Q A;  2M4N A;  1DOI A;  4C4V B;  3ZXR A;  3OG5 A;  3PLV A;  3N1Z C;  1F9J A;  4IWO A;  4BOZ B;  1I4R A;  2R2Q A;  4HDO A;  4FJV B;  2KN4 A;  4RH6 A;  1OEY J;  1K53 A;  2ACZ B;  2WXR A;  4P1C C;  3BK2 A;  2M56 B;  2ASQ A;  1V8C A;  5EE3 A;  2N1W A;  4MGY E;  2JU6 X;  2DWQ A;  2CJN A;  2AX5 A;  4JWS C;  3AE7 B;  5KHO A;  3Q2A C;  2KOX A;  1IBX B;  1EU4 A;  4US8 A;  4AP4 C;  1MI0 A;  4BKT A;  4KVG B;  2LWP A;  2M17 A;  2IZV B;  4LLG M;  2JSV X;  3DWM A;  2I38 A;  1GOZ A;  4ZDV A;  3ZDM C;  4W9H A;  2K25 A;  1T0Y A;  2XEW A;  2JWU A;  3TL5 A;  4D2K A;  2PVO D;  2J4X A;  3PPA A;  5G5H A;  3W1S A;  1L6V A;  1ZXH A;  4PS7 A;  5LLI A;  3CIR B;  2JX5 A;  3SHQ A;  3P2B A;  2JRH A;  3BII D;  4EUT A;  1PFD A;  5FR6 A;  2FCN A;  2FCM A;  2H88 B;  3A9J A;  4W9L A;  3HIZ A;  1FFU A;  4MM3 A;  4B95 A;  1Q5W B;  4P16 A;  3R8B A;  4KKJ A;  4FJZ A;  3L17 A;  2KTR A;  2RSU A;  4M8M A;  1YIW A;  5BYS A;  3V61 A;  1Y8R C;  4IG7 B;  1HXY D;  4WWO A;  1JWS D;  2KX3 A;  2MBQ A;  1WR6 E;  2DYM A;  1ESF A;  1CQV A;  2PTL A;  2KDI A;  1BT0 A;  3PHW B;  3EHV A;  4KZ0 A;  4TKN A;  3X23 A;  3DBL B;  1IUE A;  1KJT A;  3OAW A;  4W9G A;  5E6O A;  5FKA C;  4XC2 A;  3RD2 A;  1UH6 A;  3AI5 A;  2UWQ A;  4HPM B;  2QC8 A;  5DPT A;  4P7I A;  3A1Q A;  2V3N A;  2HDE A;  4FHK A;  4A6Q A;  4ANX A;  3P1M A;  3OJ3 A;  2FUG 1;  3A9J B;  3MTN B;  4FXC A;  4BOS C;  4KGR A;  1ZDV A;  2K39 A;  3NY5 A;  4NQK E;  2UU7 A;  4WWP A;  3IG3 A;  1P7E A;  2RGF A;  1PQS A;  1SBB B;  3AEE B;  4FHJ A;  4DHJ B;  3DQV A;  3I63 C;  1C4P A;  4HPL B;  1D5X C;  1QOA A;  2HTM E;  2KMM A;  3W1S C;  2MBE A;  1LGR A;  3UQB A;  3GOE A;  4MH8 A;  1HQR D;  2BYE A;  4CQN A;  1LO5 D;  2GBR A;  3TCA A;  5LXI B;  2GBN A;  2LGS A;  1CJE A;  1FXT B;  5AZH A;  2NTS A;  2BS3 B;  1H4R A;  1MFW A;  2W3R A;  4GGQ A;  1E8Y A;  1WXV A;  2H89 B;  1B9R A;  3PVL A;  3RT3 B;  1XO3 A;  2C7M B;  2BB6 A;  3NS1 A;  4KDI C;  3QHT A;  1C3T A;  1AYF A;  3P4P B;  3AEB B;  4WH4 A;  2ZZP B;  4B0M A;  2NS5 A;  4RNA A;  2MSE D;  5MPO A;  1L4Z B;  2INC C;  2OJR A;  3MJ5 A;  1KLG D;  1XEE A;  4GB9 A;  3AE1 B;  1TS3 A;  3RUL A;  4GLS C;  1P98 A;  2GOW A;  3U7Z A;  1C4C A;  2XK5 A;  3X0W A;  3PTF C;  2WP9 B;  1SF0 A;  1I4P A;  1YD8 U;  4ICU A;  1G6J A;  1WJ6 A;  2D10 A;  3PV1 A;  5CX3 A;  4NNJ B;  2ZVN A;  4W9E A;  2HTH A;  3SFD B;  1FPY A;  2J0M A;  2N7J A;  4IWQ A;  2KD0 A;  3RFZ B;  3U7D A;  4GU2 A;  1AN8 A;  1K51 A;  2V3P A;  3IBE A;  3DVN U;  3V3X A;  1RWS A;  4DHZ B;  1PYW D;  4W9J A;  3MC8 A;  1E7U A;  3R7R A;  3DVN V;  2DAF A;  1V1O A;  3B1L X;  1QIL A;  4K3B A;  4BAX A;  2BF8 B;  2WHI A;  2KLC A;  2BQQ A;  4DWF A;  1KOT A;  1XLQ A;  5J17 A;  2KJR A;  4EOY A;  1PGX A;  4LCD E;  2HE7 A;  1BXT A;  2IGD A;  4RF0 A;  3RNG C;  2IYD B;  4KSK C;  2J53 A;  4RFB A;  2XK5 B;  1WX9 A;  3LDZ E;  4N6E B;  2TSS A;  1V1P A;  2D07 B;  3MHZ A;  4EZJ A;  5H92 C;  3IAS 1;  3AU5 A;  1D5Z C;  2IDY A;  4DXA B;  3ZXV A;  1CZP A;  1TYG B;  2VH2 A;  1QT9 A;  3GP7 A;  1R7S A;  2V4L A;  2WLB A;  4WIP A;  1PGA A;  1L5P A;  2EKI A;  2J7Q B;  2K6Q A;  5DPR A;  3DBH I;  2GBM A;  4YSZ B;  2QDF A;  4OVU A;  1L0Y B;  3H7S A;  1Z2M A;  2LUM A;  1WGY A;  3AE6 B;  2ZW0 A;  2IO3 B;  2X8X X;  1DGJ A;  2DYO A;  1MG4 A;  4TQ0 A;  3PGE A;  1R4M B;  4FA6 A;  3H1U A;  2VZK D;  5CTR C;  3O65 B;  1SSN A;  1MVK A;  3KUZ A;  3QA8 A;  2WXL A;  3LB8 C;  3VFK A;  1MHX A;  2KK8 A;  2L52 A;  4HJK A;  1RYJ A;  3W5V B;  1YQB A;  3DBS A;  4J6I A;  1F1H A;  3OWE B;  4MEL A;  2RPQ A;  3DOW A;  1SE9 A;  5JZE B;  2L1A A;  2NBV B;  2I2Y A;  3RZW C;  3WAP A;  4ANW A;  1WYG A;  3AB5 A;  2KHW B;  3U2S C;  4IW0 A;  4OVZ A;  5DCN A;  1TGZ B;  4KGT A;  2MHJ A;  4GDK A;  2AL6 A;  3D32 A;  1I4G A;  3ZW3 A;  3I57 A;  2K0P A;  3PRE A;  5CHF A;  1V49 A;  4MJS A;  3ZIM A;  3IAM 1;  4ITK A;  2WX0 A;  1RLF A;  1L4D B;  1ZDX A;  4RGN A;  1C79 A;  4YT0 B;  3JSV A;  4FUL A;  4WWN A;  3RYT A;  1F0Z A;  3RMK C;  3ETR A;  3N9Y C;  4G50 A;  1UWM A;  1Q1O A;  3Q8B A;  4W9D A;  4HVB A;  1SEB D;  2RMM A;  2LEK A;  2MJD A;  1YOV B;  1WJN A;  4ZHP A;  4DXG A;  1WH3 A;  3R2I A;  5L95 C;  3QK0 A;  1WJ4 A;  1FCC C;  1E0Z A;  3L16 A;  4NJ6 A;  2NBW B;  3VVW B;  3Q3O C;  2DX5 B;  4E71 A;  1NDD A;  4N9F 4;  2KAJ A;  4XGA B;  3K9O B;  1GC6 A;  5EDS A;  3VUW A;  4GDK B;  3ZNH B;  2KDM A;  4CHK A;  1P1A A;  4K3C A;  4N59 A;  1TZ1 A;  1QOG A;  2NCN A;  3M62 B;  3Q3F A;  4ZRQ A;  4WJO A;  4OZC A;  4ANV A;  1V5O A;  1PDX A;  2V1Y A;  1JQ4 A;  3JVZ X;  4IKG A;  1UBI A;  2JXT A;  2M8S A;  1WXA A;  2KDB A;  1E8X A;  5GMV A;  1EM7 A;  3JSV B;  4MGK E;  4DQO C;  1F77 A;  2BWE S;  5EE0 A;  2K5P A;  2WU5 B;  5CHW A;  3IT4 B;  4JPS A;  1SJE D;  1L6U A;  5C3J B;  1E7V A;  4B9K A;  3CMM B;  3RI7 C;  2G9H D;  2K9X A;  1JWA D;  1I35 A;  4ZRP A;  2L0F A;  1U4A A;  3MJW A;  5E6P A;  4XDD A;  1KLV A;  3KWV A;  2LRU A;  3SFE B;  1I7H A;  5HKH A;  4AS1 A;  3IVF A;  2WXH A;  3RNA C;  2IY0 B;  3Q14 C;  3Q8A A;  1HZ6 A;  1TY2 A;  2G4S A;  2RDG A;  3L13 A;  3H8H A;  3RPF C;  2RDB C;  2J42 A;  1TY0 A;  1D3Z A;  3PRM B;  5IO9 A;  4ARC A;  4HKQ A;  3VH3 B;  1UNS A;  4NZL B;  3S2A A;  5D94 A;  4WWM A;  1GAQ B;  3PO0 A;  4KDL B;  1TS2 A;  1UWX A;  2C5L C;  3RCZ A;  1WJU A;  1FEH A;  1N5X A;  2W9N A;  2LVP A;  3ZQ4 A;  2KMC A;  2PLP A;  2K1F A;  3PRZ A;  5D2M B;  3CF6 E;  4ZHO A;  2WYQ A; 
#chains in the Genus database with same CATH homology
 4W9G A;  5E6O A;  1WGR A;  2M1M A;  2Z0D B;  2BYF A;  3I3T B;  4XC2 A;  3RD2 A;  4GOC A;  4IM2 A;  4EZK A;  1UH6 A;  1V6E A;  4OVV A;  1LFD A;  3AI5 A;  4I6L B;  2ZJD A;  2UWQ A;  4HPM B;  3PHX B;  4B6W A;  3NZS A;  5DPT A;  4YL8 A;  3WAM A;  4P7I A;  2ZVO A;  5D7G A;  2J0K A;  3PRP B;  3DDC B;  3A1Q A;  2ZEQ A;  2CKH B;  2DZK A;  4W9K A;  3UIO B;  5BO4 B;  4FHK A;  1IPG A;  3QX1 A;  3A9K A;  4ANX A;  3OJ3 A;  2CHX A;  5IAA C;  2MRP A;  2MP2 B;  3A9J B;  3MTN B;  4HK2 A;  1WMH A;  3BIN A;  2MBH A;  1WM2 A;  2JY6 A;  2KZR A;  4NY0 A;  4BOS C;  2K39 A;  4HLE A;  5G2N A;  3NY5 A;  4ZYN A;  2CHW A;  4ZRJ A;  4NQK E;  1SGH A;  3C0R B;  2KWV B;  4NAW B;  4GSW A;  4WWP A;  3IG3 A;  4CO7 A;  1RRB A;  2KN5 A;  1V5T A;  3VAW A;  4LDT D;  2KO3 A;  2RGF A;  1PQS A;  1RAX A;  1EUV B;  4HWI B;  4FHJ A;  4DHJ B;  4M8N A;  4X57 B;  4KSL C;  1WGG A;  3DQV A;  3ZRF A;  2KFJ A;  4HPL B;  1L7Y A;  3VDZ A;  4W9C A;  3W1S C;  2MBE A;  1JRU A;  4KIK A;  3UQB A;  2IO0 B;  3GOE A;  4JLC A;  4BKS D;  1RFA A;  2PPH A;  2RR9 A;  2BYE A;  2EKE C;  3CSF A;  2JPH A;  2NR2 A;  3CST A;  4RMA A;  2UYZ B;  1WXM A;  2GBR A;  2OOB B;  3DVG Y;  4GDL A;  2PE6 B;  3TCA A;  5LXI B;  2R2O A;  2GBN A;  3NS8 A;  1FXT B;  2KDF B;  3V62 A;  5AZH A;  2KFK A;  2C9W B;  4BBN F;  1V2Y A;  3A4R A;  4WJQ A;  1H4R A;  2BYV E;  2KVR A;  4GGQ A;  4TQ1 A;  1E8Y A;  4I6N B;  3KUC B;  4BBN C;  2AWT A;  1WXV A;  4FAD A;  3EFU A;  3APC A;  4BKS A;  1V86 A;  3PVL A;  4W9F A;  3RT3 B;  2LJ5 A;  2DZM A;  3Q3J A;  3A9K B;  2I1J A;  3HM6 X;  4A3P A;  2C7M B;  2IY1 B;  4KDI C;  3QHT A;  2K6D B;  1C3T A;  1J19 A;  4DHJ D;  3IFW B;  3HM3 A;  1WMH B;  4IM0 A;  2HD5 B;  2MP2 A;  3L10 B;  1WRD B;  2HJ8 A;  2ZNV B;  3ECI A;  2L05 A;  4DK5 A;  2CS4 A;  2ZZP B;  3AUL A;  1EO6 A;  3QCA A;  2NS5 A;  2MSE D;  5AZG A;  4URK A;  2OJR A;  1P9D U;  3ZLZ A;  1J0G A;  3WA0 A;  4ASW C;  2FIF A;  4GB9 A;  2EMT A;  2LRW A;  3DBL I;  1E8W A;  3RUL A;  5L83 A;  3EEC A;  4TV3 A;  2LXC A;  1P98 A;  2GOW A;  1E5W A;  2AYO B;  2XK5 A;  2V3S A;  3X0W A;  3PTF C;  4F1S A;  4GIV A;  4RM8 A;  1KM7 A;  1YD8 U;  5AEK B;  2O6V D;  2LZ6 A;  4ICU A;  4PYZ A;  4KIK B;  1G6J A;  1WJ6 A;  1GUA B;  2D10 A;  1LQB A;  3PV1 A;  5CX3 A;  1ISN A;  4NNJ B;  3OLM D;  5J18 A;  2ZVN A;  4W9E A;  2HTH A;  3HHM A;  5J2R A;  2IO1 B;  4JGH B;  2CR5 A;  3ML8 A;  3ZTD A;  1NBF C;  3UGB B;  2J0M A;  2CHZ A;  4GDL B;  3WAO A;  4IWQ A;  2KD0 A;  3ALB A;  1SIF A;  1WXS A;  3QC8 B;  3U7D A;  2AL3 A;  2KFK B;  4GU2 A;  3T8M A;  4LDT B;  2NVU I;  2K8H A;  3QIJ A;  2AEH A;  3IBE A;  2MX2 A;  1YJ1 A;  1WX7 A;  3DVN U;  1AAR A;  2DZJ A;  4DHZ B;  4KZC A;  4W9J A;  2PEA A;  1E7U A;  2O6V A;  3QWZ B;  4IC7 B;  1WFY A;  2ZNV C;  3PLU A;  4A3O A;  4IWP A;  4NQL B;  3R7R A;  3DVN V;  4JIO U;  3TBL D;  2DAF A;  3B1L X;  2JZZ A;  1MG8 A;  4HDQ A;  2BF8 B;  1OGW A;  1IP9 A;  3U30 A;  4AWJ A;  4DHZ E;  3V6E B;  5C23 A;  3H7P A;  2NBU A;  1M94 A;  2KLC A;  4DWF A;  1KOT A;  1ZGU B;  4A20 A;  4HXD A;  1WZ0 A;  2LAS A;  2JRI B;  2KDE B;  3KYC D;  2KJR A;  3N30 A;  1Q0W B;  4EOY A;  5J17 A;  3UQA A;  3ONS A;  2KKC A;  2ZPN A;  4LCD E;  2JZ3 B;  4E3C A;  2HE7 A;  5KHQ A;  2C7N B;  2KC2 A;  1Z5S B;  2DHZ A;  4II3 B;  2N7D A;  2DZI A;  3KW5 B;  4FLH A;  2IYD B;  4KSK C;  2L00 B;  2LGX A;  4G0N B;  2XK5 B;  2O2V B;  1WGD A;  1WX9 A;  2KWC A;  3JW0 X;  3LDZ E;  2LUE A;  2NPT A;  2D07 B;  3R3M A;  2L8J A;  4F7Z A;  3MHS D;  3WAN A;  3VHT C;  4EZJ A;  2M0X A;  3ZNZ B;  4HCN B;  3AU5 A;  1UZX B;  3RZF A;  2MCN B;  3KUD B;  4DXA B;  4NJ7 A;  1LM8 B;  1R4N I;  2L76 A;  3N3K B;  1R4M I;  2WX1 A;  3DVG X;  2V4L A;  4RM9 A;  2K6Q A;  2J7Q B;  5DPR A;  4ANU A;  3DBH I;  1C1Y B;  4II2 B;  1TTN A;  2GBM A;  2BWF A;  4OVU A;  5G55 A;  2MBB B;  1ZW7 A;  1Z2M A;  2VRR B;  2KMA A;  3H7S A;  1UGM A;  2LGY A;  4MJS B;  1WGY A;  2N4F A;  4AJY B;  4ZRK A;  5DPS A;  1L2N A;  2JXX A;  3UIN B;  4CYE A;  2IO3 B;  4FJY A;  3H9D A;  4W9I A;  2O6V B;  2FCQ A;  2DYO A;  3VQI A;  2LVO A;  3KVF B;  2CU1 A;  2KJH B;  1NI2 A;  4TQ0 A;  4K7W A;  3PGE A;  1V81 A;  1WZ3 A;  4NPN A;  4FA6 A;  4TUU A;  3APD A;  3H1U A;  2KQ7 A;  5CTR C;  4AUQ C;  2JF5 A;  3O65 B;  3KUZ A;  3ZNG C;  3ML9 A;  2PE9 A;  1EF1 A;  3AXC A;  3H7P B;  4WQO B;  2YVC A;  2WWZ A;  4F8C B;  3VXW A;  3QA8 A;  3VFK A;  2RD0 A;  2I1K A;  2BPS A;  2JWZ A;  4IM3 A;  3UIP B;  2KK8 A;  4HJK A;  4DDG D;  4K81 A;  2GMI C;  2A5U A;  1YQB A;  3ENE A;  3DBS A;  4FBJ B;  4J6I A;  3ZO5 B;  2KNB A;  4MEL A;  1WIA A;  2RPQ A;  3B08 A;  3DOW A;  2Y5B B;  3ZVV A;  1SE9 A;  5JZE B;  2DEN B;  2NBV B;  3KYD D;  5IA7 A;  2KJ6 A;  3R7Q A;  4MSQ B;  2NPT B;  3L0W B;  2DYB A;  3DPD A;  2FNJ B;  1OTR B;  2O2V A;  3L54 A;  3TIX A;  3RZW C;  1WE6 A;  2LXA A;  2D3G A;  3OAW A;  4WJN A;  4XX5 A;  3WAP A;  2MA9 B;  4E74 A;  4ANW A;  2IO2 B;  4BVU C;  3N32 A;  4BFR A;  2KHW B;  3LJ3 A;  4XZ4 A;  4BKG A;  2JT4 B;  2MBO A;  4IW0 A;  4WJP A;  1X1M A;  2FAZ A;  1OQY A;  5DPW A;  1P3Q U;  5DCN A;  2G4D B;  3RUI B;  5AZF A;  3VUX A;  1TGZ B;  3ZDT A;  2KTF A;  3VUY A;  1HE8 A;  3PT2 B;  4GDK A;  1J8C A;  1GG3 A;  2AL6 A;  3QAR A;  3D32 A;  2B3A A;  3TMP B;  3ZW3 A;  3PS6 A;  2D11 A;  4IUM B;  5E6N A;  1LXD A;  3PRE A;  5CHF A;  2GBJ A;  4I6P A;  1V49 A;  2ZCB A;  3M95 A;  4MJS A;  3SD5 A;  3ZIM A;  1K8R B;  2GBK A;  5TR5 A;  2WX0 A;  4MH0 E;  4DBG A;  2IBI B;  1RLF A;  1YX5 B;  2N1V A;  3QQ8 B;  2A4Z A;  3SDL C;  2KLG A;  3ZNI D;  1EF5 A;  3V60 A;  1S1Q B;  3JSV A;  3M3J A;  4FUL A;  4WWN A;  3RYT A;  4K1R B;  3U8Z A;  4MDK E;  2N7E A;  1WF9 A;  5LXH A;  1I42 A;  2KQS A;  2C7H A;  4M0W B;  3ZTC A;  4MSM B;  3EC8 A;  4G50 A;  3SU8 X;  1WYW B;  2MLB A;  4ZRI A;  4K7U A;  1YX6 B;  4MEM A;  1Q1O A;  2FCS A;  1S3S G;  2YLM A;  4W9D A;  4AJW A;  3VTU A;  4HVB A;  1E90 A;  2J0J A;  2LI5 A;  2ZPY A;  3ZKJ C;  2C60 A;  2LD9 A;  3IHP C;  3WAL A;  1V80 A;  3PSE B;  1WJN A;  1GJZ A;  2KX0 A;  1WI0 A;  3L08 A;  4PYU A;  2L0T A;  4GXB A;  1WH3 A;  2N9P C;  3H6N A;  4AOF A;  2D2Q A;  2M4N A;  5L95 C;  3QK0 A;  3APF A;  1WJ4 A;  3GZN I;  3PLV A;  3TJP A;  2FID A;  1ZKH A;  1F9J A;  2REX A;  3L16 A;  4IWO A;  4NJ6 A;  3ZRC A;  2NBW B;  3VVW B;  3QJZ A;  2DX5 B;  4BOZ B;  4E71 A;  5JH5 C;  2R2Q A;  4MGI E;  2KXJ A;  3UF8 A;  4HDO A;  1NDD A;  4FJV B;  2DAJ A;  4N9F 4;  3T9L A;  1TBE A;  2BGF A;  3K9O B;  1GC6 A;  5C1Z A;  1OEY J;  2BKR B;  5EDS A;  2JVC A;  2KTR B;  4GDK B;  3VUW A;  3ZNH B;  2KWU B;  4CHK A;  1P1A A;  2ASQ A;  2BKF A;  2MWS B;  4EEW A;  2N1W A;  4MGY E;  1TZ1 A;  2NCN A;  3M62 B;  1GNU A;  4PS8 A;  1XQQ A;  1WM3 A;  3Q3F A;  4WJO A;  4ANV A;  3V6C B;  1V5O A;  1QZE A;  5KHO A;  2KOX A;  2V1Y A;  2QHO A;  3JVZ X;  3ZUN A;  3DCG A;  4PS3 A;  4AP4 C;  1UBI A;  4BKT A;  4KVG B;  2M8S A;  3OJ4 B;  2LWP A;  1WXA A;  2FUH B;  2KDB A;  1E8X A;  2IZV B;  2M17 A;  3DBR I;  3HK0 A;  4G3X B;  4G11 A;  4K7S A;  5GMV A;  3VTW A;  4DDI D;  3JSV B;  4MGK E;  4EKU A;  2XBB C;  2BWE S;  1CMX B;  4ZDV A;  3ZDM C;  4LJO B;  4W9H A;  2K25 A;  1T0Y A;  2XEW A;  5JHB A;  5CHW A;  1WE7 A;  3TL5 A;  2EMS A;  1WY8 A;  1GC7 A;  1WX8 A;  2G45 B;  2L3Z A;  3R66 C;  3KH0 A;  3PPA A;  1VD2 A;  3K9P B;  3JYU A;  1VCB A;  1E7V A;  4B9K A;  3AU4 A;  3CMM B;  3W1S A;  4ICV A;  4WAA A;  1I35 A;  2L0F A;  1UEL A;  1U4A A;  4PS7 A;  5LLI A;  2Z0E B;  3MJW A;  1UD7 A;  5E6P A;  1WR1 A;  3A1Q B;  3QAQ A;  3NHE B;  3SHQ A;  4HCP B;  1KLV A;  3P2B A;  2LRU A;  2JRH A;  1V9J A;  5HKH A;  4EUT A;  3IVF A;  2PJH A;  2N9X A;  1UBQ A;  2Z59 B;  5CHV C;  3M63 B;  5FR6 A;  2IY0 B;  4MGZ E;  2FCN A;  2FCM A;  2WDT B;  3A9J A;  2G3Q B;  4W9L A;  1WGH A;  4FN2 A;  3HIZ A;  2KC1 A;  4MM3 A;  4B95 A;  1H8C A;  1Q5W B;  2LGD A;  2K8C A;  4GMV A;  2G4S A;  3BY4 B;  3L13 A;  2MQJ A;  4GN1 A;  3PZD A;  2JUO A;  4FJZ A;  3VH4 B;  4EFO A;  1D3Z A;  3NZU A;  3L17 A;  2KTR A;  3PRM B;  2RSU A;  4M8M A;  1YIW A;  3WIM A;  1A5R A;  4NAW A;  3V61 A;  3VH3 B;  2MW5 A;  1Y8R C;  4IG7 B;  1XD3 B;  5D6J B;  1E8Z A;  2N9E B;  4WWO A;  3S2A A;  5D94 A;  1OEY A;  2KX3 A;  2MBQ A;  3NOB A;  4KDL B;  1WR6 E;  2LVQ A;  2DYM A;  2L7R A;  2C5L C;  3RCZ A;  1WJU A;  2W9N A;  2LVP A;  2KDI A;  1BT0 A;  3PHW B;  2K8B A;  2KMC A;  3EHV A;  3A4S C;  5JHA A;  2K1F A;  4KV2 A;  4EZL A;  1XT9 B;  4JQW C;  1P0R A;  3B0A A;  3PRZ A;  4KZ0 A;  4TKN A;  3X23 A;  2KAN A;  1IYF A;  4JL9 A;  3A33 B;  4LJP B;  5D2M B;  3CF6 E;  3VTV A;  3W1Y A;  1KJT A;  2ZCC A;  2WYQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...