2PPHA

Solution structure of human mekk3 pb1 domain
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
93
structure length
93
Chain Sequence
QSDVRIKFEHNGERRIIAFSRPVKYEDVEHKVTTVFGQPLDLHYMNNELSILLKNQDDLDKAIDILDRSSSMKSLRILLLSQDRNLEHHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Insight into the Binding Properties of MEKK3 PB1 to MEK5 PB1 from Its Solution Structure.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords Mitogen-activated protein kinase kinase kinase 3
total genus 14
structure length 93
sequence length 93
ec nomenclature ec 2.7.11.25: Mitogen-activated protein kinase kinase kinase.
pdb deposition date 2007-04-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00564 PB1 PB1 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 2pphA01
2KMAA 1KJTA 2L8JA 3TL5A 2OJRA 1R4MI 2FCMA 5HKHA 1WGHA 2K6DB 2C7MB 4W9EA 4GXBA 2NBWB 2XEWA 3VFKA 5J18A 2JUOA 2KNBA 3QWZB 4ASWC 1F9JA 2WX0A 3UIPB 3KW5B 3RULA 2KFJA 3WIMA 1ZKHA 4GU2A 4DK5A 1E5WA 2M8SA 4JL9A 2V3SA 3T8MA 3QC8B 4ICVA 4ZRJA 3U8ZA 1SE9A 2KK8A 4OVVA 5BO4B 4HXDA 4GMVA 4EFOA 4TUUA 4BOZB 4I6LB 2M0XA 1V2YA 2BYVE 3PHXB 1YX6B 2BKFA 1I35A 3ZLZA 2J7QB 3ZIMA 3UF8A 3SU8X 3PVLA 4JGHB 4AOFA 1UBQA 3DCGA 3S2AA 1X1MA 1GG3A 1VCBA 3KYDD 3ALBA 3QQ8B 3R3MA 1IYFA 3JYUA 1WZ0A 2JWZA 5E6OA 1C1YB 2MBBB 3WAPA 3QJZA 2MWSB 1WMHB 2KC2A 2BYFA 2C60A 3QIJA 4W9FA 2GBJA 3GZNI 4W9JA 2Z0DB 1WR1A 1Q1OA 2KFKA 3CMMB 3ZTCA 4BOSC 3ZNZB 1HE8A 1RFAA 2MP2B 3PTFC 3UIOB 2WDTB 3AI5A 1TBEA 4BVUC 4HVBA 1LQBA 2KWUB 1YJ1A 4KV2A 3TCAA 2ZCBA 3NY5A 2IY0B 2I1KA 2RSUA 2A5UA 3APDA 3KH0A 5GMVA 1WX8A 3V61A 3AXCA 3HIZA 4ANVA 3PLVA 2AL3A 2G4SA 2XK5A 2KQ7A 1RAXA 2FUHB 2OOBB 3A9KB 4B6WA 2IY1B 4KZ0A 1TZ1A 1V6EA 1EUVB 3LDZE 2KDIA 2RR9A 3X0WA 1A5RA 3KYCD 3DVNU 4ICUA 3PS6A 2LJ5A 2L0TA 2NS5A 1BT0A 2MBQA 4URKA 1WM3A 4XX5A 4M8NA 1WJ4A 4KIKB 4F1SA 2IZVB 3APCA 2KDFB 3PRZA 2LVOA 4IWOA 2KD0A 3TJPA 1QZEA 2ZJDA 2KVRA 1SIFA 5JHAA 4M0WB 2DZJA 5AEKB 3PGEA 4X57B 3ML8A 2DHZA 3DVNV 4KDIC 4K7WA 4HPLB 2BWES 1V5OA 2KANA 4KZCA 1KLVA 4I6PA 2KFKB 4CO7A 2GBMA 3HK0A 3QK0A 4AJWA 2KJHB 2NPTA 2MBHA 1UH6A 4WQOB 3VTUA 1GUAB 2KN5A 4G3XB 2NVUI 2V1YA 4IM0A 3ZUNA 3WA0A 5C1ZA 4JIOU 2KTFA 2REXA 2LXAA 4K7UA 4AJYB 3DVGY 3L54A 4WWOA 2R2QA 4ZYNA 3VHTC 3PSEB 2G4DB 3WAMA 3HHMA 3N3KB 1UZXB 2AYOB 4W9GA 1D3ZA 5LLIA 1L7YA 1NBFC 2IBIB 1YQBA 3MJWA 2IYDB 4MELA 2JZ3B 4KIKA 4HLEA 1OQYA 2L7RA 4F8CB 2DYBA 2GBNA 4LJPB 2KJRA 1LXDA 1WGGA 2FIFA 2L3ZA 5CHVC 4FLHA 2NR2A 4ANWA 2ZVNA 3NOBA 1OEYJ 2GOWA 2DZMA 2IO3B 2GMIC 3H7SA 4FBJB 5KHQA 1C3TA 2DX5B 3DBHI 2C9WB 2O2VB 3L0WB 4GIVA 4N9F4 2MP2A 3UGBB 4MJSB 1TGZB 4GGQA 2YLMA 2ZPYA 3ONSA 4I6NB 4IWQA 1AARA 1XT9B 2KWCA 1K8RB 2WYQA 2MLBA 1NDDA 1WF9A 4IUMB 4WJNA 3RZWC 1I42A 2LVQA 2BYEA 3W1SA 4II3B 4NJ7A 2KTRB 1WY8A 4DDGD 1LFDA 3R7RA 2XBBC 2LWPA 3A9KA 5TR5A 2KOXA 2L0FA 4ANXA 1Z5SB 2MSED 4MGYE 1R4NI 3IHPC 3WAOA 3A9JB 3B0AA 4PYUA 3ZRCA 1E8YA 3DBRI 4XC2A 2K8CA 4GDKA 2JY6A 1ZW7A 2QHOA 4FHKA 4F7ZA 3N30A 4A20A 5CHWA 2J0MA 3L17A 3DBLI 4MH0E 2A4ZA 4GN1A 4K7SA 3L08A 1WM2A 1E90A 2L00B 2LD9A 4MSMB 4WJQA 1M94A 1V80A 1Q0WB 2K25A 3VUWA 1JRUA 4EUTA 2EMTA 2LZ6A 2N9EB 1RRBA 5D7GA 5JHBA 2V4LA 2DYOA 2LUEA 2UYZB 2FCQA 4GDLA 4FJYA 4PS8A 3VUXA 3HM3A 1Q5WB 5CTRC 2J0JA 4NAWA 3IG3A 1WJUA 1OEYA 3ECIA 5IA7A 1J8CA 5DCNA 2LGYA 3H7PA 4IW0A 4DHJD 2RPQA 5D94A 3SHQA 1OTRB 1V5TA 1J19A 3ZNHB 4EZKA 3EFUA 2J0KA 3VQIA 2CHZA 2LASA 3VVWB 3CSTA 3BINA 2RD0A 2Y5BB 4FJVB 3D32A 4IC7B 5CX3A 4MGIE 5L83A 2D07B 4A3OA 2MX2A 2IO1B 2ZNVC 2KLGA 3EC8A 3H6NA 1EO6A 2JF5A 4BBNC 4G11A 3M63B 3ENEA 1P9DU 4P7IA 4FULA 3EHVA 5L95C 1WXSA 2WX1A 4HCNB 3H9DA 3DPDA 3V6EB 4MGZE 4WAAA 5DPRA 4AUQC 4RMAA 3UQBA 2C7NB 3ZDTA 4CYEA 3L16A 3RZFA 4HWIB 4DHZB 1RLFA 4RM9A 5EDSA 1WIAA 2PE6B 4FJZA 3PRMB 5IAAC 2L05A 4GDLB 4KDLB 4BKTA 5AZGA 2DAFA 2UWQA 4TQ0A 3JVZX 3ZTDA 3QHTA 3ZO5B 3HM6X 4GSWA 2NCNA 5DPSA 4B95A 3M95A 2PEAA 4WWPA 2GBRA 4LJOB 4FA6A 2HD5B 2ZZPB 1WFYA 4HDOA 1WI0A 5AZHA 2DZKA 4PYZA 4OVUA 2LGXA 2N7DA 1ZGUB 2D11A 1YX5B 3AU4A 2FCNA 1H4RA 3VDZA 4EOYA 1E7VA 3UINB 4A3PA 4IM3A 1V86A 2JRHA 3VUYA 1V49A 2LVPA 1P3QU 1KM7A 1WGDA 2KDEB 3M3JA 3QX1A 3A4SC 3RCZA 3RT3B 1WMHA 1KOTA 3PV1A 4HK2A 2EKEC 5JH5C 4NQLB 4E3CA 2RGFA 2K8BA 2PPHA 3K9OB 4BKSA 2KJ6A 4WJOA 2CHXA 4EZJA 2KDBA 1FXTB 2MQJA 1SGHA 4DWFA 3KVFB 3AULA 4E71A 1IP9A 3DBSA 4MDKE 3W1YA 1L2NA 5G55A 4TQ1A 3PHWB 3RUIB 3VTVA 1WXVA 4TV3A 2VRRB 2KMCA 3ZNGC 2KWVB 1Y8RC 4ANUA 2EMSA 5D2MB 2BGFA 4IM2A 3IVFA 4LDTD 2HTHA 1WGYA 1WX9A 5C23A 3H1UA 4PS7A 2AWTA 1S1QB 1WXAA 4ZRKA 3VTWA 2PE9A 4W9LA 2N1VA 3DVGX 1V81A 3MHSD 4FADA 2KXJA 2N9PC 3BY4B 3T9LA 3IBEA 4KSKC 3RD2A 2KX3A 2FAZA 4HJKA 1J0GA 2G3QB 2ZNVB 2O6VA 2BWFA 4W9CA 3ZDMC 2KQSA 4NJ6A 1E8WA 2JZZA 3L13A 4LDTB 5LXIB 4BKSD 1E8XA 2ZEQA 4FHJA 4WWNA 3PPAA 3V6CB 4JLCA 2D10A 2YVCA 4W9IA 1P1AA 2XK5B 1WGRA 3KUZA 5J17A 1VD2A 2CHWA 2ZCCA 3QARA 2K8HA 4HCPB 2DYMA 2ZPNA 3M62B 3JSVB 2GBKA 1PQSA 3OLMD 4HDQA 1EF1A 3JW0X 3ZNID 5JZEB 3R7QA 1Z2MA 1WJ6A 2MCNB 2C7HA 3IFWB 3TBLD 3WANA 5DPTA 3SD5A 1UD7A 4AP4C 2KLCA 5CHFA 2N7EA 4GB9A 3W1SC 1EF5A 4EZLA 3RYTA 2N1WA 3A9JA 3CF6E 2BPSA 2D2QA 4DHZE 1ISNA 4LCDE 3U7DA 4YL8A 2MBOA 1GC7A 2DENB 3WALA 3V62A 3PLUA 2NBVB 2HJ8A 2IO2B 4GOCA 1MG8A 4K81A 4E74A 2KZRA 4JQWC 2MW5A 4IWPA 4MGKE 3I3TB 4XZ4A 5AZFA 1XQQA 4AWJA 2FNJB 4CHKA 3LJ3A 1WE7A 3KUDB 3NHEB 2LI5A 4J6IA 3TMPB 2O2VA 2LXCA 3TIXA 4TKNA 3MTNB 4MJSA 4II2B 2FIDA 1OGWA 2NPTB 3A33B 2FCSA 3DDCB 4M8MA 3ML9A 2C5LC 4EEWA 2ASQA 1WR6E 1V9JA 1T0YA 2DAJA 1GC6A 2KO3A 2KX0A 1E8ZA 1LM8B 1WH3A 3PREA 5KHOA 3NS8A 2L76A 4EKUA 4IG7B 2MA9B 2MRPA 5LXHA 4MEMA 2I1JA 2M1MA 2LGDA 3DOWA 4MSQB 1GJZA 2HE7A 4G50A 1P98A 4HPMB 2NBUA 2R2OA 3QCAA 2Z59B 3R66C 4FN2A 3B1LX 2JVCA 1P0RA 1WXMA 3KUCB 2BKRB 2K6QA 3A1QA 1UELA 3AU5A 1WJNA 3B08A 4GDKB 1TTNA 2JRIB 3OAWA 1WZ3A 3NZSA 3QAQA 3CSFA 2JT4B 2CU1A 3C0RB 2M17A 1UGMA 4BKGA 2K1FA 2ZVOA 2O6VB 3PRPB 4MM3A 4W9DA 3X23A 1S3SG 3ZW3A 2KKCA 4RM8A 2JXXA 2M4NA 2Z0EB 4B9KA 2PJHA 2W9NA 5E6NA 4KSLC 3VH4B 4K1RB 4ZDVA 1NI2A 3PZDA 1CMXB 3UQAA 5DPWA 2AL6A 2KHWB 4KVGB 3DQVA 1YIWA 2KTRA 3Q3FA 2BF8B 4NQKE 3ZRFA 1G6JA 4DHJB 4PS3A 1WX7A 2D3GA 4NAWB 3JSVA 2WWZA 4G0NB 3APFA 3H7PB 3N32A 4DXAB 4W9HA 2CKHB 3NZUA 3Q3JA 4BBNF 1UBIA 2G45B 3ZKJC 1WRDB 4BFRA 1YD8U 2JPHA 3EECA 5E6PA 3L10B 4DDID 4DBGA 2N9XA 3O65B 2MBEA 3OJ3A 3VH3B 2KC1A 3K9PB 3A1QB 2CR5A 2N4FA 2CS4A 2LRUA 2DZIA 4W9KA 3ZVVA 3GOEA 1GNUA 2IO0B 2B3AA 3PT2B 4WJPA 5J2RA 3P2BA 5G2NA 1U4AA 1WYWB 1XD3B 2AEHA 2O6VD 4NNJB 1E7UA 1H8CA 4NPNA 5D6JB 3V60A 3VAWA 3A4RA 1WE6A 5FR6A 3SDLC 3VXWA 3QA8A 4ZRIA 3U30A 2LRWA 3OJ4B 1IPGA 2K39A 4NY0A
chains in the Genus database with same CATH superfamily
2KMAA 1PDXA 3TL5A 5HKHA 2XN9C 4XGAB 2K6DB 4W9EA 1UNSA 1YN3A 4ASWC 3QWZB 1V1PA 2WX0A 1YOVB 3UIPB 3KW5B 2KFJA 1EM7A 3WIMA 4DK5A 1SE9A 4OVVA 2KVZA 4EFOA 4I6LB 2M0XA 1V2YA 3W2DA 1YX6B 1XCQL 2W3RA 4LK0M 1JW9D 2KACA 1UBQA 3R3MA 1GG3A 1YNTE 3KYDD 4ZYSA 1WZ0A 2MBBB 3IT6B 3WAPA 1MHHE 1WMHB 2BYFA 4DXFA 2GBJA 3GZNI 1E0ZA 1WR1A 3ZNZB 1RFAA 3UIOB 5HFYA 1TBEA 4KV2A 3NY5A 2I1KA 2RSUA 3KH0A 1WX8A 1LGRA 3V61A 2WNMA 2G4SA 3E56A 4B6WA 1V6EA 1I4PA 5AUKA 1AYFA 2MJDA 2BS4B 3KYCD 3DVNU 1FFVA 1ZE3D 2JU6X 2LJ5A 1L0XB 1D5ZC 4URKA 4M8NA 5C2TB 3APCA 4IWOA 2ZJDA 3P4SB 1Y56A 2SEBD 2WDRB 1YQ4B 3PGEA 4X57B 5TSSA 3DVNV 2BWES 1V5OA 4CO7A 3HK0A 4AJWA 1UH6A 5HG2A 2V1YA 5C1ZA 4JIOU 2QCZA 4PT5A 3VHTC 1M4VA 2L83A 2TSSA 1D3ZA 5LLIA 3AEAB 3MJWA 4XYCA 4HLEA 1I7HA 2DYBA 4LJPB 3BWUD 2FIFA 1SJHD 5BYRA 4FLHA 2AQ3B 2GOWA 3NVZA 1C3TA 5KHQA 3W9CB 2O2VB 3L0WB 2MP2A 3UGBB 2ZPYA 5JXVA 2WLBA 1WY8A 3ZQ4A 2L0FA 4ANXA 2VZKD 4GLSC 3A9JB 4PYUA 1QILA 4XC2A 2WXMA 4M02A 4GDKA 5EE0A 5GXGB 2JY6A 1TZOA 2R61A 3AEBB 3KWVA 4FXCA 4MSMB 4EUTA 2INPE 2WXHA 1BUIC 2DYOA 2UYZB 2FCQA 3EFCA 4PS8A 5IA7A 2LGYA 2V9HA 3H7PA 4IW0A 1VR9A 2RPQA 1TIFA 2BVCA 3U2SC 1J19A 3ZNHB 3H8HA 3EFUA 3VQIA 1TKGA 2CHZA 3B9JA 4OZAA 4IC7B 2CU3A 1XLNA 4A3OA 4K3BA 3EC8A 3H6NA 5FKAC 4G11A 3M63B 3ENEA 1XLQA 3EHVA 2X38A 1WXSA 4WURA 5DPRA 2C7NB 2BT6A 4HWIB 1SIJA 3PRMB 1CJEA 3QHTA 2N9KA 2NTSA 1N62A 2NCNA 1I4HA 3AE8B 4QAYA 5DPSA 4B95A 1HTQA 1NYRA 2BW2A 2KDMA 2ONQA 1WFYA 4HDOA 4PYZA 4OVUA 4XDCA 1ZGUB 1YX5B 3VDZA 1H4RA 3UINB 3ETRA 2L1AA 4XWWA 1V49A 3QX1A 1WGDA 3UI3A 1WGKA 3PV1A 2KN4A 3NG0A 5JH5C 3DBLB 2K8BA 2KT7A 1WSPA 2PPHA 4JPSA 4EZJA 2L52A 3NJTA 2MQJA 3TEXA 1N5WA 4E71A 5G55A 4TQ1A 1N5XA 2IPKD 4XE0A 2BGFA 3IVFA 2WXJA 4LDTD 2HTHA 2VZKB 1WX9A 1FNVA 1ZXHA 3H1UA 2OHFA 4ZRKA 2W82A 3VTWA 1HXYD 1XEEA 2N9PC 3AECB 1VLBA 4ARCA 1J0GA 3BZDB 1L5PA 3ZDMC 4IDIA 4M0WA 4BKSD 2WP9B 2N0SB 1SSNA 2Z8LA 4K3CA 2CHWA 4HCPB 2AX5A 4ZHOA 4TMAB 3M62B 1T5XD 3JSVB 2GBKA 3TUOA 3NZ3A 1F77A 3R7QA 1WJ6A 3ZXRA 4RNAA 3SD5A 3AE3B 1UD7A 1UWMA 5CHFA 2N7EA 3W1SC 3C8YA 1C9FA 1UUPA 3CF6E 3N1XC 4DHZE 4YL8A 2IGHA 4HPPA 5C3JB 2HJ8A 1MG8A 2DWQA 4USAA 4MGKE 4AWJA 2WXOA 2BBCA 2LI5A 2O2VA 1NVID 3TIXA 4TKNA 3AE7B 3MTNB 4II2B 1BMLC 3A33B 2FCSA 3DDCB 4UDUC 4EEWA 3DHHC 1C79A 3RNFC 3R8BA 3BK2A 2PVOD 2WXPA 1T0YA 2DAJA 2KX0A 2K3UA 1LM8B 5EE1A 2L76A 2MA9B 2MRPA 3RPFC 3VR8B 4MEMA 2M1MA 1FRRA 1EWYC 3QCAA 2Z59B 1I4RA 5IO9A 1L6VA 2JVCA 1WXMA 4YTMB 2GLSA 1V8CA 3A1QA 3V05A 3B08A 2BQQA 1WZ3A 3OAWA 3OWEB 1IBXB 1ET9A 2AQ2B 3URYA 2K1FA 4H2AA 3BYYB 3C19A 3ZW3A 2M19A 1NI2A 3PZDA 5DPWA 2AL6A 1OQQA 1HA5A 1YIWA 1G6JA 3Q8BA 1WX7A 2RMMA 4NAWB 3JSVA 5HHDG 1LO5D 1B1ZA 3APFA 1B9RA 4ARIA 1NI3A 4KX6B 3FKYA 3NZUA 2WXRA 1UBIA 2G45B 4JWSC 3ZKJC 3P63A 1V1OA 3EECA 5E6PA 4DDID 2G9HD 2RDBC 3O65B 3OJ3A 2CS4A 2W55A 4W9KA 1DOIA 2LRUA 1TS2A 2PLPA 3P2BA 1U4AA 1XD3B 2INDC 2O6VD 3ZXVA 1JALA 2BTEA 4ZRIA 2NBWB 1IPGA 3VRBB 2K39A 4NY0A 2ZW1A 2OJRA 3KWLA 1RYJA 3MFGA 3VFKA 2QEJC 2KNBA 1FCLA 5BYQA 1ZKHA 1E5WA 3T8MA 2V3SA 2KK8A 4HXDA 4GMVA 1E9MA 4TUUA 4BOZB 2BYVE 2WXIA 3KQ4A 2BKFA 4B0MA 3ZIMA 3DBHB 4R3DA 3LYYA 4JGHB 1R7SA 4AOFA 3S2AA 2K9XA 1VCBA 3HVZA 1Q10A 3JYUA 5E6OA 4YXDB 2KQ4X 3QJZA 1TS4A 1YN4A 1C78A 2L32A 2KC2A 3QIJA 1FO4A 2C60A 3AV8A 4BOSC 2WDTB 3AEEB 4HVBA 1LQBA 5BMGA 1YMHE 2A5UA 3APDA 3AXCA 2XK5A 1RAXA 2FUHB 3A9KB 2IY1B 3AE9B 1ZUD2 4ICUA 2K22A 2NS5A 1BT0A 4HKQA 1WM3A 1WJ4A 4KIKB 3CIRB 3PRZA 1CQVA 2QDFA 2KD0A 4N59A 3TJPA 2BB6A 2KWDA 4AQ7A 2JYEA 2VH1A 5JHAA 2W3SA 4PK1A 3ML8A 3N1ZC 1KLVA 1VZ6A 3Q8FA 3QK0A 1A70A 3Q3MC 1GUAB 2KN5A 4ZOHC 1JWMD 2REXA 2Y5PA 5BYSA 1XLPA 2LXAA 1SBBB 4WWOA 4ZYNA 2AQ1B 3WAMA 1OQRA 2SAKA 2XNAC 3N3KB 3Q3OC 1UZXB 4RGMA 1NBFC 2IYDB 1MI0A 1OQYA 3GZNB 4F8CB 2KJRA 1LXDA 1OEYJ 2DZMA 1XXGA 2DX5B 1D5XC 1FFUA 4MJSB 2YLMA 3ONSA 4I6NB 4IWQA 1AARA 1I42A 1NDDA 2LVQA 2DLBA 4II3B 4NJ7A 2W54A 3FILA 1GPXA 1Z5SB 2GRIA 1JROA 1D5MC 1AW7A 3ZRCA 1E8YA 4FHKA 4A20A 2J0MA 1TT5B 4MH0E 1TYGB 4GN1A 4K7SA 3L08A 1E90A 4WJQA 5IP4D 1M94A 3VUWA 1JRUA 2EMTA 2LZ6A 4GDLA 4FJYA 3VUXA 3HM3A 5CTRC 4NAWA 3IG3A 3U7ZA 1TKYA 1OEYA 3ECIA 5DCNA 4DHJD 4JWUC 1OTRB 4P1CC 4EZKA 3GE3C 3DHGC 1I4GA 1SXTA 3VVWB 2MHJA 3N9YC 3BINA 1MVKA 3E9SA 5CX3A 5L83A 1FD6A 2IO1B 2ZNVC 4BBNC 1TS5A 4RMAA 3P4RB 1T0RC 1CK1A 1XLOA 1GAQB 1JRPA 1RM6C 1QF6A 3PO0A 1WIAA 3DBRB 4BKTA 1ZXIA 4GSWA 1MJDA 1XF5L 3Q3NC 4RFBA 2WXKA 2PEAA 2GBRA 4LJOB 2KMMA 3J9CA 1WRIA 1R4MB 1WI0A 5AZHA 1T0QC 2D11A 3ZJVA 4OW0A 1E7VA 4A3PA 2JXTA 1SF0A 4LNNA 4DXGA 2LVPA 1P3QU 2KDEB 3A4SC 1KOTA 1WMHA 4YTNB 4YTPB 2KJ6A 4WJOA 1FNWA 2GI9A 3AE4B 3TEZA 1N6ZA 2KYWA 1FRDA 2QMTA 2WDVB 3DBSA 1UF0A 4MDKE 3PHWB 1WXVA 1Y8RC 2EMSA 1GB4A 4IM2A 3Q6BA 5C23A 2WGSA 2AWTA 1QKZA 2PE9A 5E6JA 4WAFA 1KLUD 2N1VA 3DVGX 1MPEA 1V81A 4FADA 3T9LA 4HJKA 1WYGA 4NJ6A 1D4BA 1E8WA 3AE5B 2DNFA 2ZEQA 3PPAA 3BIID 1KH0A 2BS3B 2YVCA 4W9IA 1P1AA 2X8XX 2XK5B 4HROA 3KUZA 3QARA 1TS3A 2K8HA 1HTOA 2ZPNA 2WHIA 4YSXB 5I4DA 2MCNB 3WANA 2ON8A 3T3OA 2KLCA 4EZLA 2N1WA 2D2QA 1N61A 2MBOA 1ACCA 2DENB 2PKOA 4GOCA 4E74A 3I3TB 4XZ4A 5AZFA 3LJ3A 1WE7A 3KUDB 3O13A 4J6IA 3W5VB 5AUIA 4JX1C 1HQRD 4M8MA 3MJ5A 4MACA 2ASQA 4A90A 2ACZB 1V9JA 1C4CA 4A8XC 3PREA 2RPVA 1WH3A 3NS8A 2QSDA 3FILB 2PMVA 4OVZA 4OZBA 3DOWA 3AEGB 2R2OA 1QLBB 1FXAA 1TTNA 5BMIA 2CU1A 4BKGA 2ZVOA 3X23A 4US8A 1PYWD 2INCC 3W5UB 2JXXA 4B9KA 2V4IB 3UQAA 1CMXB 3DQVA 2KTRA 4NQKE 2BF8B 4PS3A 1GB1A 1QT9A 1EU4A 1FM0D 3N20C 2WWZA 3N32A 4DXAB 4EE2A 4ACFA 3Q8CA 3Q3JA 5HI1A 3SEBA 2JPHA 4HKZE 5IOIA 3RFZB 3VH3B 3A1QB 2CR5A 3ZVVA 3R2TA 4KKIA 5J2RA 2IO0B 4WJPA 2BB5A 1QOAA 2D3AA 3AM9A 5D6JB 1E10A 1P7FA 3VAWA 1WE6A 5FR6A 3VXWA 3U30A 2LRWA 3DBHI 1KJTA 4US9A 1EU3A 1KF6B 1R4MI 3MC9A 4GXBA 2E6XA 1VZ7A 4RF0A 1K51A 2JUOA 3RULA 4GU2A 4RGTA 5FK9C 2GB1A 1JCKB 2M8SA 3QC8B 4ZRJA 3BVZA 3P4QB 1ZDXA 3PHXB 3RN9C 1I35A 3RNBC 2LGSA 3ZLZA 4ZHPA 2J7QB 2LFIA 2M56B 3PVLA 1L0VB 1X1MA 1WXQA 2JWUA 3QQ8B 1IYFA 1GOZA 2JWZA 1C1YB 2FUG1 3R2IA 2MWSB 4W9FA 3CWIA 4W9JA 2Z0DB 1QOBA 4IOIE 2KFKA 3AH7A 3PTFC 1YN5A 3AI5A 2KWUB 1YJ1A 3GP7A 2IY0B 1JMLA 4ITKA 5GMVA 4KGTA 4ANVA 1SE3A 4OZCA 4KZ0A 1ZP0B 1C4PA 1IGDA 2KDIA 3X0WA 1A5RA 4RGNA 2YEPF 4XX5A 4P6VF 2NTTA 4JE3B 4F1SA 5FR3A 3LXFA 4C00A 1N60A 3VR9B 3DHIC 1JWBD 4M0WB 2RDHA 5AEKB 4HPLB 4KZCA 3L4PA 1J7CA 4OHJA 4WIPA 2MBHA 3VTUA 4IM0A 1VJKA 2KTFA 4K7UA 4AJYB 3DVGY 1JWAD 4ZRPA 1MFWA 3KLSX 2G4DB 3HHMA 5H8YE 3P1MA 1VZ8A 1UGJA 2IBIB 3TEWA 1YQBA 4RH6A 2ZW0A 4MELA 1TY0A 4RF1A 2L7RA 3P42A 2GBNA 5T8IA 1WGGA 2L3ZA 2ZVNA 3NOBA 1KRHA 4FBJB 1L4DB 1SB3C 4GIVA 1FEHA 1XT9B 1K8RB 2WYQA 3RZWC 4WJNA 4P1BC 2CJOA 2LGIA 3W1SA 2KTRB 3R7RA 3A9KA 2KOXA 2FBWB 1QQRA 5IKCM 4MGYE 1R4NI 2E3TA 3WAOA 4J3OD 3B0AA 1K50A 1PGBA 2K8CA 1L6UA 1IUEA 3N30A 5CHWA 3L17A 2A4ZA 4L23A 3RNGC 3AB5A 1V80A 1ZOYB 2K25A 1I4QA 1YQ3B 4HEA1 1KLGD 4MM3B 4S17A 2J52A 5D7GA 4M01A 5JHBA 2V4LA 2LUEA 2LHDA 3NVVA 1Q5WB 2J0JA 3ABVB 1WJUA 2RDGA 4YSYB 2BYTA 2I38A 5D94A 3Q69A 4LNOA 4D2KA 1BXTA 4RCOA 1MHXA 3BK1A 3CSTA 1VDVA 4FJVB 3ZYYX 3OG5A 2D07B 2MX2A 2V3PA 4P7IA 5L95C 4P16A 2WXGA 3V6EB 3BVMA 1KTKA 1ZPSA 2M0AA 4XDDA 3RZFA 2IGDA 4DHZB 1RLFA 4FJZA 4WQMA 5IAAC 2L05A 4GDLB 2IGGA 4TQ0A 3M95A 2JZPA 4LNIA 4WWPA 4L1BA 4FA6A 2HD5B 2ZZPB 4TSSA 2PIAA 3RMKC 2LGXA 3AU4A 5IN7A 3SR6A 4IM3A 1V86A 2JRHA 3VUYA 2WXQA 3RT3B 3RCZA 3RNEC 4HK2A 2RGFA 4BKSA 3K9OB 2CHXA 4WWMA 1FXTB 1SGHA 2INNE 1L2NA 2H88B 3VTVA 4TV3A 2VRRB 2KMCA 3ZNGC 5D2MB 4C4VB 2V3NA 1WGYA 4PS7A 1WXAA 3HUIA 4W9LA 4KGSA 3MHSD 3IBEA 3V3XA 2G3QB 1E7PB 2O6VA 2BWFA 3HRDD 4XWTA 2KQSA 2JZZA 3L13A 5LXIB 4FHJA 4WWNA 3V6CB 5BMHA 5J17A 2D5GA 1VD2A 1ENFA 2DYMA 1PQSA 4HDQA 3RNAC 1EF1A 2DBYA 3ZNID 2C7HA 1HZ6A 4N58A 5DPTA 3TSSA 4AP4C 4NZLB 3WCQA 1EF5A 1F2RI 1YJIA 1ISNA 4NAMA 1GC7A 1RFKA 3WALA 3V62A 2IO2B 2MW5A 1K52A 1XQQA 2FNJB 4O1NA 4YSZB 3DWGC 1SE2A 4MJSA 2EKIA 1ESFA 2FIDA 1OGWA 2NPTB 2MJ3A 3ML9A 2C5LC 1V1PB 3SFEB 2KO3A 1GC6A 5KHOA 1AWDA 4A9AA 2I1JA 2LGDA 4MSQB 3PZ8A 4G50A 4FN2A 1P0RA 2PW9A 3KUCB 1UELA 3AU5A 1WJNA 4GDKB 3QAQA 3B2FA 3PRPB 2O6VB 4MM3A 2H89B 2M4NA 2Z0EB 5E6NA 4KSLC 3VH4B 4ZDVA 1T3QA 3ZRFA 4DHJB 4NJCA 5G5HA 2D3GA 1DGJA 4Q2JA 3H7PB 5D3DA 5G5GA 1OFFA 2CKHB 2WXLA 3N1YC 2CJNA 4BFRA 1YD8U 3Q8AA 4DBGA 2MBEA 3P4PB 2DZIA 3GOEA 3AMZA 3PT2B 2B3AA 5G2NA 1WYWB 2AEHA 1IBXA 1TKEA 4BZAA 2NMQA 3V60A 2OEDA 2LASA 3OJ4B 4ZRQA 2L8JA 2WU5B 2Y5CA 2FCMA 2LJIA 1WGHA 2C7MB 1C76A 2XEWA 5J18A 4B0EA 3ZJUA 1F9JA 2PTLA 3AE6B 4JL9A 4ICVA 3U8ZA 5BO4B 3I57A 1ROEA 4KGRA 3UF8A 3AE2B 3SU8X 3DCGA 3ALBA 3AEDB 3GE8C 1C77A 2N9LA 4MT5A 2UU7A 2N7JA 1Q1OA 3CMMB 3ZTCA 1HE8A 3IAS1 2MP2B 4BAXA 4BVUC 3IXSA 2VH2A 3TCAA 2ZCBA 3IT4B 1R4NB 2JYTA 3HIZA 3GS2A 3PLVA 2AL3A 2KAJA 1MG4A 2KQ7A 2OOBB 1TZ1A 2WS3B 1EUVB 2I2YA 4LNFA 3LDZE 2RR9A 1HZ5A 4REZA 2MJEA 3PS6A 2L0TA 4C7YA 2MBQA 1RWSA 2IZVB 2KDFB 2LVOA 1PGXA 1PUTA 1QZEA 2KVRA 1N63A 1SIFA 2HJ1A 4LNKA 2DZJA 2DHZA 4KDIC 4K7WA 2KANA 2ICIA 2JQRB 4I6PA 2KFKB 2GBMA 1TY2A 3Q8EA 3EA6A 2KJHB 2NPTA 1XCTL 1QOGA 3AE1B 4WQOB 4G3XB 3VRAB 4C4VA 2NVUI 3ZUNA 3WA0A 3HVDA 4MH8A 1D6EC 1F0ZA 2LEKA 3L54A 2R2QA 3PSEB 2WU2B 3NUHB 1NEKB 1I4XA 4RGOS 4W9GA 2AYOB 3SFDB 1L7YA 1FCCC 3TEYA 1F1HA 2JZ3B 4KIKA 4YWGG 5CHVC 2JX5A 2NR2A 3PZ7A 4ANWA 2IO3B 2GMIC 3H7SA 1ZDVA 2C9WB 4N9F4 1PGAA 1TGZB 4GGQA 2KWCA 2EELA 4IKGA 4IUMB 2MLBA 4YT0B 1WF9A 2BYEA 2K5PA 4WH4A 2D3BA 4DDGD 1LFDA 2D3CA 2XBBC 2LWPA 4DQOC 5TR5A 2QJLA 2MSED 2FE8A 3FAHA 3IHPC 1STEA 3DBRI 1VRAB 2J42A 3MP9A 4N6EB 1ZW7A 3Q2AC 4F7ZA 1F52A 3DBLI 1AN8A 2YEPB 1WM2A 2L00B 2LD9A 4LTUA 3GB1A 1Q0WB 1IGCA 2J4XA 3MHZA 2N9EB 1RRBA 3I9V1 1J7BA 3Q14C 3FC4A 3RNCC 1J8CA 3NS1A 1L4ZB 3SHQA 1TJEA 3T3NA 1V5TA 2HTME 1L0YB 3NRZA 2J0KA 5LNK1 3AN1A 1F2RC 1JQ4A 2RD0A 2Y5BB 3D32A 1FXIA 4MGIE 2KLGA 3ZJTA 1EO6A 2JF5A 1P9DU 1E6EB 4FULA 1KFYB 2WX1A 4HCNB 3H9DA 3DPDA 1JWSD 4MGZE 4WAAA 4AUQC 2OJWA 3ZGZA 3UQBA 3ZDTA 3I63C 4CYEA 3L16A 2BS2B 2LUMA 4L2YA 4RM9A 5EDSA 2PE6B 4KDLB 5AZGA 2DAFA 2UWQA 1T0SC 3JVZX 4S0RA 3ZTDA 3ZO5B 3HM6X 2QC8A 2QILA 3U52E 1DYQA 4AS1A 3U4EG 3BYTB 2DZKA 2IJ0A 2N7DA 3LB8C 4EOYA 2FCNA 3MC8A 2WXNA 1FNUA 2B76B 1KM7A 3M3JA 4HRSA 2EKEC 4NQLB 4E3CA 2Y3AA 4HJGE 2KDBA 3IAM1 3KVFB 1J7AA 4DWFA 3AULA 1IP9A 3I5JC 3W1YA 3RUIB 4C7ZA 2KWVB 4ANUA 2G1EA 4A55A 1S1QB 1P7EA 2WDQB 5EE3A 2KXJA 3BY4B 4KSKC 3RI7C 3RD2A 2KX3A 2FAZA 2ZNVB 4W9CA 1JWUD 4C80A 1CZPA 4LDTB 1E8XA 2LHEA 4JLCA 2D10A 1WGRA 1FMAD 2ZCCA 5H92C 3OLMD 1QOFA 3JW0X 5JZEB 1Z2MA 2HDEA 3IFWB 3TBLD 3EGRA 1HEZE 5MPOA 4GB9A 3RYTA 4CQNA 3A9JA 2BPSA 3U7DA 4LCDE 4A6QA 1FIQA 1NENB 1C4AA 3PLUA 2NBVB 4K81A 2KZRA 3NVWA 4IWPA 4JQWC 4CHKA 3NHEB 3TMPB 2LXCA 3B2GA 3MC0B 1YJJA 2Q5WD 5EE9A 2IDYA 2QIEB 1WR6E 1SE4A 1E8ZA 3NVYA 4EKUA 4IG7B 2WXFA 2LMCA 5LXHA 2WQYB 1GJZA 2HE7A 4HPMB 1P98A 2NBUA 3R66C 3B1LX 1K53A 2BKRB 2K6QA 1PFDA 2JRIB 3NZSA 2V0GA 3CSFA 2JT4B 3C0RB 2M17A 1UGMA 4W9DA 1S3SG 4M00A 2K0PA 2KKCA 4KKJA 1SJED 1WWTA 2PVGC 4RM8A 2PJHA 2W9NA 5D3IB 4K1RB 2KHWB 1ET6A 4KVGB 3Q3FA 1FPYA 1EWCA 3EUB2 2JSVX 4G0NB 4W9HA 1DOYA 1T6BX 4BBNF 1V97A 1WRDB 1SEBD 1DOXA 1NYQA 3L10B 2N9XA 2MH7A 2KC1A 3K9PB 2J53A 2N4FA 1GNUA 4LLGM 3DWMA 4NNJB 1E7UA 1H8CA 3AEFB 4NPNA 3BVGA 4C56C 2MEKA 3A4RA 3SDLC 1XO3A 3QA8A 1UWXA 2QHOA
chains in the Genus database with same CATH topology
2KMAA 1KJTA 2L8JA 3TL5A 2OJRA 1R4MI 2FCMA 5HKHA 1WGHA 2K6DB 2C7MB 4W9EA 4GXBA 2NBWB 2XEWA 3VFKA 5J18A 2JUOA 2KNBA 3QWZB 4ASWC 1F9JA 2WX0A 3UIPB 3KW5B 3RULA 2KFJA 3WIMA 1ZKHA 4GU2A 4DK5A 1E5WA 2M8SA 4JL9A 2V3SA 3T8MA 3QC8B 4ICVA 4ZRJA 3U8ZA 1SE9A 2KK8A 4OVVA 5BO4B 4HXDA 4GMVA 4EFOA 4TUUA 4BOZB 4I6LB 2M0XA 1V2YA 2BYVE 3PHXB 1YX6B 2BKFA 1I35A 3ZLZA 2J7QB 3ZIMA 3UF8A 3SU8X 3PVLA 4JGHB 4AOFA 1UBQA 3DCGA 3S2AA 1X1MA 1GG3A 1VCBA 3KYDD 3ALBA 3QQ8B 3R3MA 1IYFA 3JYUA 1WZ0A 2JWZA 5E6OA 1C1YB 2MBBB 3WAPA 3QJZA 2MWSB 1WMHB 2KC2A 2BYFA 2C60A 3QIJA 4W9FA 2GBJA 3GZNI 4W9JA 2Z0DB 1WR1A 1Q1OA 2KFKA 3CMMB 3ZTCA 4BOSC 3ZNZB 1HE8A 1RFAA 2MP2B 3PTFC 3UIOB 2WDTB 3AI5A 1TBEA 4BVUC 4HVBA 1LQBA 2KWUB 1YJ1A 4KV2A 3TCAA 2ZCBA 3NY5A 2IY0B 2I1KA 2RSUA 2A5UA 3APDA 3KH0A 5GMVA 1WX8A 3V61A 3AXCA 3HIZA 4ANVA 3PLVA 2AL3A 2G4SA 2XK5A 2KQ7A 1RAXA 2FUHB 2OOBB 3A9KB 4B6WA 2IY1B 4KZ0A 1TZ1A 1V6EA 1EUVB 3LDZE 2KDIA 2RR9A 3X0WA 1A5RA 3KYCD 3DVNU 4ICUA 3PS6A 2LJ5A 2L0TA 2NS5A 1BT0A 2MBQA 4URKA 1WM3A 4XX5A 4M8NA 1WJ4A 4KIKB 4F1SA 2IZVB 3APCA 2KDFB 3PRZA 2LVOA 4IWOA 2KD0A 3TJPA 1QZEA 2ZJDA 2KVRA 1SIFA 5JHAA 4M0WB 2DZJA 5AEKB 3PGEA 4X57B 3ML8A 2DHZA 3DVNV 4KDIC 4K7WA 4HPLB 2BWES 1V5OA 2KANA 4KZCA 1KLVA 4I6PA 2KFKB 4CO7A 2GBMA 3HK0A 3QK0A 4AJWA 2KJHB 2NPTA 2MBHA 1UH6A 4WQOB 3VTUA 1GUAB 2KN5A 4G3XB 2NVUI 2V1YA 4IM0A 3ZUNA 3WA0A 5C1ZA 4JIOU 2KTFA 2REXA 2LXAA 4K7UA 4AJYB 3DVGY 3L54A 4WWOA 2R2QA 4ZYNA 3VHTC 3PSEB 2G4DB 3WAMA 3HHMA 3N3KB 1UZXB 2AYOB 4W9GA 1D3ZA 5LLIA 1L7YA 1NBFC 2IBIB 1YQBA 3MJWA 2IYDB 4MELA 2JZ3B 4KIKA 4HLEA 1OQYA 2L7RA 4F8CB 2DYBA 2GBNA 4LJPB 2KJRA 1LXDA 1WGGA 2FIFA 2L3ZA 5CHVC 4FLHA 2NR2A 4ANWA 2ZVNA 3NOBA 1OEYJ 2GOWA 2DZMA 2IO3B 2GMIC 3H7SA 4FBJB 5KHQA 1C3TA 2DX5B 3DBHI 2C9WB 2O2VB 3L0WB 4GIVA 4N9F4 2MP2A 3UGBB 4MJSB 1TGZB 4GGQA 2YLMA 2ZPYA 3ONSA 4I6NB 4IWQA 1AARA 1XT9B 2KWCA 1K8RB 2WYQA 2MLBA 1NDDA 1WF9A 4IUMB 4WJNA 3RZWC 1I42A 2LVQA 2BYEA 3W1SA 4II3B 4NJ7A 2KTRB 1WY8A 4DDGD 1LFDA 3R7RA 2XBBC 2LWPA 3A9KA 5TR5A 2KOXA 2L0FA 4ANXA 1Z5SB 2MSED 4MGYE 1R4NI 3IHPC 3WAOA 3A9JB 3B0AA 4PYUA 3ZRCA 1E8YA 3DBRI 4XC2A 2K8CA 4GDKA 2JY6A 1ZW7A 2QHOA 4FHKA 4F7ZA 3N30A 4A20A 5CHWA 2J0MA 3L17A 3DBLI 4MH0E 2A4ZA 4GN1A 4K7SA 3L08A 1WM2A 1E90A 2L00B 2LD9A 4MSMB 4WJQA 1M94A 1V80A 1Q0WB 2K25A 3VUWA 1JRUA 4EUTA 2EMTA 2LZ6A 2N9EB 1RRBA 5D7GA 5JHBA 2V4LA 2DYOA 2LUEA 2UYZB 2FCQA 4GDLA 4FJYA 4PS8A 3VUXA 3HM3A 1Q5WB 5CTRC 2J0JA 4NAWA 3IG3A 1WJUA 1OEYA 3ECIA 5IA7A 1J8CA 5DCNA 2LGYA 3H7PA 4IW0A 4DHJD 2RPQA 5D94A 3SHQA 1OTRB 1V5TA 1J19A 3ZNHB 4EZKA 3EFUA 2J0KA 3VQIA 2CHZA 2LASA 3VVWB 3CSTA 3BINA 2RD0A 2Y5BB 4FJVB 3D32A 4IC7B 5CX3A 4MGIE 5L83A 2D07B 4A3OA 2MX2A 2IO1B 2ZNVC 2KLGA 3EC8A 3H6NA 1EO6A 2JF5A 4BBNC 4G11A 3M63B 3ENEA 1P9DU 4P7IA 4FULA 3EHVA 5L95C 1WXSA 2WX1A 4HCNB 3H9DA 3DPDA 3V6EB 4MGZE 4WAAA 5DPRA 4AUQC 4RMAA 3UQBA 2C7NB 3ZDTA 4CYEA 3L16A 3RZFA 4HWIB 4DHZB 1RLFA 4RM9A 5EDSA 1WIAA 2PE6B 4FJZA 3PRMB 5IAAC 2L05A 4GDLB 4KDLB 4BKTA 5AZGA 2DAFA 2UWQA 4TQ0A 3JVZX 3ZTDA 3QHTA 3ZO5B 3HM6X 4GSWA 2NCNA 5DPSA 4B95A 3M95A 2PEAA 4WWPA 2GBRA 4LJOB 4FA6A 2HD5B 2ZZPB 1WFYA 4HDOA 1WI0A 5AZHA 2DZKA 4PYZA 4OVUA 2LGXA 2N7DA 1ZGUB 2D11A 1YX5B 3AU4A 2FCNA 1H4RA 3VDZA 4EOYA 1E7VA 3UINB 4A3PA 4IM3A 1V86A 2JRHA 3VUYA 1V49A 2LVPA 1P3QU 1KM7A 1WGDA 2KDEB 3M3JA 3QX1A 3A4SC 3RCZA 3RT3B 1WMHA 1KOTA 3PV1A 4HK2A 2EKEC 5JH5C 4NQLB 4E3CA 2RGFA 2K8BA 2PPHA 3K9OB 4BKSA 2KJ6A 4WJOA 2CHXA 4EZJA 2KDBA 1FXTB 2MQJA 1SGHA 4DWFA 3KVFB 3AULA 4E71A 1IP9A 3DBSA 4MDKE 3W1YA 1L2NA 5G55A 4TQ1A 3PHWB 3RUIB 3VTVA 1WXVA 4TV3A 2VRRB 2KMCA 3ZNGC 2KWVB 1Y8RC 4ANUA 2EMSA 5D2MB 2BGFA 4IM2A 3IVFA 4LDTD 2HTHA 1WGYA 1WX9A 5C23A 3H1UA 4PS7A 2AWTA 1S1QB 1WXAA 4ZRKA 3VTWA 2PE9A 4W9LA 2N1VA 3DVGX 1V81A 3MHSD 4FADA 2KXJA 2N9PC 3BY4B 3T9LA 3IBEA 4KSKC 3RD2A 2KX3A 2FAZA 4HJKA 1J0GA 2G3QB 2ZNVB 2O6VA 2BWFA 4W9CA 3ZDMC 2KQSA 4NJ6A 1E8WA 2JZZA 3L13A 4LDTB 5LXIB 4BKSD 1E8XA 2ZEQA 4FHJA 4WWNA 3PPAA 3V6CB 4JLCA 2D10A 2YVCA 4W9IA 1P1AA 2XK5B 1WGRA 3KUZA 5J17A 1VD2A 2CHWA 2ZCCA 3QARA 2K8HA 4HCPB 2DYMA 2ZPNA 3M62B 3JSVB 2GBKA 1PQSA 3OLMD 4HDQA 1EF1A 3JW0X 3ZNID 5JZEB 3R7QA 1Z2MA 1WJ6A 2MCNB 2C7HA 3IFWB 3TBLD 3WANA 5DPTA 3SD5A 1UD7A 4AP4C 2KLCA 5CHFA 2N7EA 4GB9A 3W1SC 1EF5A 4EZLA 3RYTA 2N1WA 3A9JA 3CF6E 2BPSA 2D2QA 4DHZE 1ISNA 4LCDE 3U7DA 4YL8A 2MBOA 1GC7A 2DENB 3WALA 3V62A 3PLUA 2NBVB 2HJ8A 2IO2B 4GOCA 1MG8A 4K81A 4E74A 2KZRA 4JQWC 2MW5A 4IWPA 4MGKE 3I3TB 4XZ4A 5AZFA 1XQQA 4AWJA 2FNJB 4CHKA 3LJ3A 1WE7A 3KUDB 3NHEB 2LI5A 4J6IA 3TMPB 2O2VA 2LXCA 3TIXA 4TKNA 3MTNB 4MJSA 4II2B 2FIDA 1OGWA 2NPTB 3A33B 2FCSA 3DDCB 4M8MA 3ML9A 2C5LC 4EEWA 2ASQA 1WR6E 1V9JA 1T0YA 2DAJA 1GC6A 2KO3A 2KX0A 1E8ZA 1LM8B 1WH3A 3PREA 5KHOA 3NS8A 2L76A 4EKUA 4IG7B 2MA9B 2MRPA 5LXHA 4MEMA 2I1JA 2M1MA 2LGDA 3DOWA 4MSQB 1GJZA 2HE7A 4G50A 1P98A 4HPMB 2NBUA 2R2OA 3QCAA 2Z59B 3R66C 4FN2A 3B1LX 2JVCA 1P0RA 1WXMA 3KUCB 2BKRB 2K6QA 3A1QA 1UELA 3AU5A 1WJNA 3B08A 4GDKB 1TTNA 2JRIB 3OAWA 1WZ3A 3NZSA 3QAQA 3CSFA 2JT4B 2CU1A 3C0RB 2M17A 1UGMA 4BKGA 2K1FA 2ZVOA 2O6VB 3PRPB 4MM3A 4W9DA 3X23A 1S3SG 3ZW3A 2KKCA 4RM8A 2JXXA 2M4NA 2Z0EB 4B9KA 2PJHA 2W9NA 5E6NA 4KSLC 3VH4B 4K1RB 4ZDVA 1NI2A 3PZDA 1CMXB 3UQAA 5DPWA 2AL6A 2KHWB 4KVGB 3DQVA 1YIWA 2KTRA 3Q3FA 2BF8B 4NQKE 3ZRFA 1G6JA 4DHJB 4PS3A 1WX7A 2D3GA 4NAWB 3JSVA 2WWZA 4G0NB 3APFA 3H7PB 3N32A 4DXAB 4W9HA 2CKHB 3NZUA 3Q3JA 4BBNF 1UBIA 2G45B 3ZKJC 1WRDB 4BFRA 1YD8U 2JPHA 3EECA 5E6PA 3L10B 4DDID 4DBGA 2N9XA 3O65B 2MBEA 3OJ3A 3VH3B 2KC1A 3K9PB 3A1QB 2CR5A 2N4FA 2CS4A 2LRUA 2DZIA 4W9KA 3ZVVA 3GOEA 1GNUA 2IO0B 2B3AA 3PT2B 4WJPA 5J2RA 3P2BA 5G2NA 1U4AA 1WYWB 1XD3B 2AEHA 2O6VD 4NNJB 1E7UA 1H8CA 4NPNA 5D6JB 3V60A 3VAWA 3A4RA 1WE6A 5FR6A 3SDLC 3VXWA 3QA8A 4ZRIA 3U30A 2LRWA 3OJ4B 1IPGA 2K39A 4NY0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KMA A;  1KJT A;  2L8J A;  3TL5 A;  2OJR A;  1R4M I;  2FCM A;  5HKH A;  1WGH A;  2K6D B;  2C7M B;  4W9E A;  4GXB A;  2NBW B;  2XEW A;  3VFK A;  5J18 A;  2JUO A;  2KNB A;  3QWZ B;  4ASW C;  1F9J A;  2WX0 A;  3UIP B;  3KW5 B;  3RUL A;  2KFJ A;  3WIM A;  1ZKH A;  4GU2 A;  4DK5 A;  1E5W A;  2M8S A;  4JL9 A;  2V3S A;  3T8M A;  3QC8 B;  4ICV A;  4ZRJ A;  3U8Z A;  1SE9 A;  2KK8 A;  4OVV A;  5BO4 B;  4HXD A;  4GMV A;  4EFO A;  4TUU A;  4BOZ B;  4I6L B;  2M0X A;  1V2Y A;  2BYV E;  3PHX B;  1YX6 B;  2BKF A;  1I35 A;  3ZLZ A;  2J7Q B;  3ZIM A;  3UF8 A;  3SU8 X;  3PVL A;  4JGH B;  4AOF A;  1UBQ A;  3DCG A;  3S2A A;  1X1M A;  1GG3 A;  1VCB A;  3KYD D;  3ALB A;  3QQ8 B;  3R3M A;  1IYF A;  3JYU A;  1WZ0 A;  2JWZ A;  5E6O A;  1C1Y B;  2MBB B;  3WAP A;  3QJZ A;  2MWS B;  1WMH B;  2KC2 A;  2BYF A;  2C60 A;  3QIJ A;  4W9F A;  2GBJ A;  3GZN I;  4W9J A;  2Z0D B;  1WR1 A;  1Q1O A;  2KFK A;  3CMM B;  3ZTC A;  4BOS C;  3ZNZ B;  1HE8 A;  1RFA A;  2MP2 B;  3PTF C;  3UIO B;  2WDT B;  3AI5 A;  1TBE A;  4BVU C;  4HVB A;  1LQB A;  2KWU B;  1YJ1 A;  4KV2 A;  3TCA A;  2ZCB A;  3NY5 A;  2IY0 B;  2I1K A;  2RSU A;  2A5U A;  3APD A;  3KH0 A;  5GMV A;  1WX8 A;  3V61 A;  3AXC A;  3HIZ A;  4ANV A;  3PLV A;  2AL3 A;  2G4S A;  2XK5 A;  2KQ7 A;  1RAX A;  2FUH B;  2OOB B;  3A9K B;  4B6W A;  2IY1 B;  4KZ0 A;  1TZ1 A;  1V6E A;  1EUV B;  3LDZ E;  2KDI A;  2RR9 A;  3X0W A;  1A5R A;  3KYC D;  3DVN U;  4ICU A;  3PS6 A;  2LJ5 A;  2L0T A;  2NS5 A;  1BT0 A;  2MBQ A;  4URK A;  1WM3 A;  4XX5 A;  4M8N A;  1WJ4 A;  4KIK B;  4F1S A;  2IZV B;  3APC A;  2KDF B;  3PRZ A;  2LVO A;  4IWO A;  2KD0 A;  3TJP A;  1QZE A;  2ZJD A;  2KVR A;  1SIF A;  5JHA A;  4M0W B;  2DZJ A;  5AEK B;  3PGE A;  4X57 B;  3ML8 A;  2DHZ A;  3DVN V;  4KDI C;  4K7W A;  4HPL B;  2BWE S;  1V5O A;  2KAN A;  4KZC A;  1KLV A;  4I6P A;  2KFK B;  4CO7 A;  2GBM A;  3HK0 A;  3QK0 A;  4AJW A;  2KJH B;  2NPT A;  2MBH A;  1UH6 A;  4WQO B;  3VTU A;  1GUA B;  2KN5 A;  4G3X B;  2NVU I;  2V1Y A;  4IM0 A;  3ZUN A;  3WA0 A;  5C1Z A;  4JIO U;  2KTF A;  2REX A;  2LXA A;  4K7U A;  4AJY B;  3DVG Y;  3L54 A;  4WWO A;  2R2Q A;  4ZYN A;  3VHT C;  3PSE B;  2G4D B;  3WAM A;  3HHM A;  3N3K B;  1UZX B;  2AYO B;  4W9G A;  1D3Z A;  5LLI A;  1L7Y A;  1NBF C;  2IBI B;  1YQB A;  3MJW A;  2IYD B;  4MEL A;  2JZ3 B;  4KIK A;  4HLE A;  1OQY A;  2L7R A;  4F8C B;  2DYB A;  2GBN A;  4LJP B;  2KJR A;  1LXD A;  1WGG A;  2FIF A;  2L3Z A;  5CHV C;  4FLH A;  2NR2 A;  4ANW A;  2ZVN A;  3NOB A;  1OEY J;  2GOW A;  2DZM A;  2IO3 B;  2GMI C;  3H7S A;  4FBJ B;  5KHQ A;  1C3T A;  2DX5 B;  3DBH I;  2C9W B;  2O2V B;  3L0W B;  4GIV A;  4N9F 4;  2MP2 A;  3UGB B;  4MJS B;  1TGZ B;  4GGQ A;  2YLM A;  2ZPY A;  3ONS A;  4I6N B;  4IWQ A;  1AAR A;  1XT9 B;  2KWC A;  1K8R B;  2WYQ A;  2MLB A;  1NDD A;  1WF9 A;  4IUM B;  4WJN A;  3RZW C;  1I42 A;  2LVQ A;  2BYE A;  3W1S A;  4II3 B;  4NJ7 A;  2KTR B;  1WY8 A;  4DDG D;  1LFD A;  3R7R A;  2XBB C;  2LWP A;  3A9K A;  5TR5 A;  2KOX A;  2L0F A;  4ANX A;  1Z5S B;  2MSE D;  4MGY E;  1R4N I;  3IHP C;  3WAO A;  3A9J B;  3B0A A;  4PYU A;  3ZRC A;  1E8Y A;  3DBR I;  4XC2 A;  2K8C A;  4GDK A;  2JY6 A;  1ZW7 A;  2QHO A;  4FHK A;  4F7Z A;  3N30 A;  4A20 A;  5CHW A;  2J0M A;  3L17 A;  3DBL I;  4MH0 E;  2A4Z A;  4GN1 A;  4K7S A;  3L08 A;  1WM2 A;  1E90 A;  2L00 B;  2LD9 A;  4MSM B;  4WJQ A;  1M94 A;  1V80 A;  1Q0W B;  2K25 A;  3VUW A;  1JRU A;  4EUT A;  2EMT A;  2LZ6 A;  2N9E B;  1RRB A;  5D7G A;  5JHB A;  2V4L A;  2DYO A;  2LUE A;  2UYZ B;  2FCQ A;  4GDL A;  4FJY A;  4PS8 A;  3VUX A;  3HM3 A;  1Q5W B;  5CTR C;  2J0J A;  4NAW A;  3IG3 A;  1WJU A;  1OEY A;  3ECI A;  5IA7 A;  1J8C A;  5DCN A;  2LGY A;  3H7P A;  4IW0 A;  4DHJ D;  2RPQ A;  5D94 A;  3SHQ A;  1OTR B;  1V5T A;  1J19 A;  3ZNH B;  4EZK A;  3EFU A;  2J0K A;  3VQI A;  2CHZ A;  2LAS A;  3VVW B;  3CST A;  3BIN A;  2RD0 A;  2Y5B B;  4FJV B;  3D32 A;  4IC7 B;  5CX3 A;  4MGI E;  5L83 A;  2D07 B;  4A3O A;  2MX2 A;  2IO1 B;  2ZNV C;  2KLG A;  3EC8 A;  3H6N A;  1EO6 A;  2JF5 A;  4BBN C;  4G11 A;  3M63 B;  3ENE A;  1P9D U;  4P7I A;  4FUL A;  3EHV A;  5L95 C;  1WXS A;  2WX1 A;  4HCN B;  3H9D A;  3DPD A;  3V6E B;  4MGZ E;  4WAA A;  5DPR A;  4AUQ C;  4RMA A;  3UQB A;  2C7N B;  3ZDT A;  4CYE A;  3L16 A;  3RZF A;  4HWI B;  4DHZ B;  1RLF A;  4RM9 A;  5EDS A;  1WIA A;  2PE6 B;  4FJZ A;  3PRM B;  5IAA C;  2L05 A;  4GDL B;  4KDL B;  4BKT A;  5AZG A;  2DAF A;  2UWQ A;  4TQ0 A;  3JVZ X;  3ZTD A;  3QHT A;  3ZO5 B;  3HM6 X;  4GSW A;  2NCN A;  5DPS A;  4B95 A;  3M95 A;  2PEA A;  4WWP A;  2GBR A;  4LJO B;  4FA6 A;  2HD5 B;  2ZZP B;  1WFY A;  4HDO A;  1WI0 A;  5AZH A;  2DZK A;  4PYZ A;  4OVU A;  2LGX A;  2N7D A;  1ZGU B;  2D11 A;  1YX5 B;  3AU4 A;  2FCN A;  1H4R A;  3VDZ A;  4EOY A;  1E7V A;  3UIN B;  4A3P A;  4IM3 A;  1V86 A;  2JRH A;  3VUY A;  1V49 A;  2LVP A;  1P3Q U;  1KM7 A;  1WGD A;  2KDE B;  3M3J A;  3QX1 A;  3A4S C;  3RCZ A;  3RT3 B;  1WMH A;  1KOT A;  3PV1 A;  4HK2 A;  2EKE C;  5JH5 C;  4NQL B;  4E3C A;  2RGF A;  2K8B A;  2PPH A;  3K9O B;  4BKS A;  2KJ6 A;  4WJO A;  2CHX A;  4EZJ A;  2KDB A;  1FXT B;  2MQJ A;  1SGH A;  4DWF A;  3KVF B;  3AUL A;  4E71 A;  1IP9 A;  3DBS A;  4MDK E;  3W1Y A;  1L2N A;  5G55 A;  4TQ1 A;  3PHW B;  3RUI B;  3VTV A;  1WXV A;  4TV3 A;  2VRR B;  2KMC A;  3ZNG C;  2KWV B;  1Y8R C;  4ANU A;  2EMS A;  5D2M B;  2BGF A;  4IM2 A;  3IVF A;  4LDT D;  2HTH A;  1WGY A;  1WX9 A;  5C23 A;  3H1U A;  4PS7 A;  2AWT A;  1S1Q B;  1WXA A;  4ZRK A;  3VTW A;  2PE9 A;  4W9L A;  2N1V A;  3DVG X;  1V81 A;  3MHS D;  4FAD A;  2KXJ A;  2N9P C;  3BY4 B;  3T9L A;  3IBE A;  4KSK C;  3RD2 A;  2KX3 A;  2FAZ A;  4HJK A;  1J0G A;  2G3Q B;  2ZNV B;  2O6V A;  2BWF A;  4W9C A;  3ZDM C;  2KQS A;  4NJ6 A;  1E8W A;  2JZZ A;  3L13 A;  4LDT B;  5LXI B;  4BKS D;  1E8X A;  2ZEQ A;  4FHJ A;  4WWN A;  3PPA A;  3V6C B;  4JLC A;  2D10 A;  2YVC A;  4W9I A;  1P1A A;  2XK5 B;  1WGR A;  3KUZ A;  5J17 A;  1VD2 A;  2CHW A;  2ZCC A;  3QAR A;  2K8H A;  4HCP B;  2DYM A;  2ZPN A;  3M62 B;  3JSV B;  2GBK A;  1PQS A;  3OLM D;  4HDQ A;  1EF1 A;  3JW0 X;  3ZNI D;  5JZE B;  3R7Q A;  1Z2M A;  1WJ6 A;  2MCN B;  2C7H A;  3IFW B;  3TBL D;  3WAN A;  5DPT A;  3SD5 A;  1UD7 A;  4AP4 C;  2KLC A;  5CHF A;  2N7E A;  4GB9 A;  3W1S C;  1EF5 A;  4EZL A;  3RYT A;  2N1W A;  3A9J A;  3CF6 E;  2BPS A;  2D2Q A;  4DHZ E;  1ISN A;  4LCD E;  3U7D A;  4YL8 A;  2MBO A;  1GC7 A;  2DEN B;  3WAL A;  3V62 A;  3PLU A;  2NBV B;  2HJ8 A;  2IO2 B;  4GOC A;  1MG8 A;  4K81 A;  4E74 A;  2KZR A;  4JQW C;  2MW5 A;  4IWP A;  4MGK E;  3I3T B;  4XZ4 A;  5AZF A;  1XQQ A;  4AWJ A;  2FNJ B;  4CHK A;  3LJ3 A;  1WE7 A;  3KUD B;  3NHE B;  2LI5 A;  4J6I A;  3TMP B;  2O2V A;  2LXC A;  3TIX A;  4TKN A;  3MTN B;  4MJS A;  4II2 B;  2FID A;  1OGW A;  2NPT B;  3A33 B;  2FCS A;  3DDC B;  4M8M A;  3ML9 A;  2C5L C;  4EEW A;  2ASQ A;  1WR6 E;  1V9J A;  1T0Y A;  2DAJ A;  1GC6 A;  2KO3 A;  2KX0 A;  1E8Z A;  1LM8 B;  1WH3 A;  3PRE A;  5KHO A;  3NS8 A;  2L76 A;  4EKU A;  4IG7 B;  2MA9 B;  2MRP A;  5LXH A;  4MEM A;  2I1J A;  2M1M A;  2LGD A;  3DOW A;  4MSQ B;  1GJZ A;  2HE7 A;  4G50 A;  1P98 A;  4HPM B;  2NBU A;  2R2O A;  3QCA A;  2Z59 B;  3R66 C;  4FN2 A;  3B1L X;  2JVC A;  1P0R A;  1WXM A;  3KUC B;  2BKR B;  2K6Q A;  3A1Q A;  1UEL A;  3AU5 A;  1WJN A;  3B08 A;  4GDK B;  1TTN A;  2JRI B;  3OAW A;  1WZ3 A;  3NZS A;  3QAQ A;  3CSF A;  2JT4 B;  2CU1 A;  3C0R B;  2M17 A;  1UGM A;  4BKG A;  2K1F A;  2ZVO A;  2O6V B;  3PRP B;  4MM3 A;  4W9D A;  3X23 A;  1S3S G;  3ZW3 A;  2KKC A;  4RM8 A;  2JXX A;  2M4N A;  2Z0E B;  4B9K A;  2PJH A;  2W9N A;  5E6N A;  4KSL C;  3VH4 B;  4K1R B;  4ZDV A;  1NI2 A;  3PZD A;  1CMX B;  3UQA A;  5DPW A;  2AL6 A;  2KHW B;  4KVG B;  3DQV A;  1YIW A;  2KTR A;  3Q3F A;  2BF8 B;  4NQK E;  3ZRF A;  1G6J A;  4DHJ B;  4PS3 A;  1WX7 A;  2D3G A;  4NAW B;  3JSV A;  2WWZ A;  4G0N B;  3APF A;  3H7P B;  3N32 A;  4DXA B;  4W9H A;  2CKH B;  3NZU A;  3Q3J A;  4BBN F;  1UBI A;  2G45 B;  3ZKJ C;  1WRD B;  4BFR A;  1YD8 U;  2JPH A;  3EEC A;  5E6P A;  3L10 B;  4DDI D;  4DBG A;  2N9X A;  3O65 B;  2MBE A;  3OJ3 A;  3VH3 B;  2KC1 A;  3K9P B;  3A1Q B;  2CR5 A;  2N4F A;  2CS4 A;  2LRU A;  2DZI A;  4W9K A;  3ZVV A;  3GOE A;  1GNU A;  2IO0 B;  2B3A A;  3PT2 B;  4WJP A;  5J2R A;  3P2B A;  5G2N A;  1U4A A;  1WYW B;  1XD3 B;  2AEH A;  2O6V D;  4NNJ B;  1E7U A;  1H8C A;  4NPN A;  5D6J B;  3V60 A;  3VAW A;  3A4R A;  1WE6 A;  5FR6 A;  3SDL C;  3VXW A;  3QA8 A;  4ZRI A;  3U30 A;  2LRW A;  3OJ4 B;  1IPG A;  2K39 A;  4NY0 A; 
#chains in the Genus database with same CATH topology
 2KMA A;  1PDX A;  3TL5 A;  5HKH A;  2XN9 C;  4XGA B;  2K6D B;  4W9E A;  1UNS A;  1YN3 A;  4ASW C;  3QWZ B;  1V1P A;  2WX0 A;  1YOV B;  3UIP B;  3KW5 B;  2KFJ A;  1EM7 A;  3WIM A;  4DK5 A;  1SE9 A;  4OVV A;  2KVZ A;  4EFO A;  4I6L B;  2M0X A;  1V2Y A;  3W2D A;  1YX6 B;  1XCQ L;  2W3R A;  4LK0 M;  1JW9 D;  2KAC A;  1UBQ A;  3R3M A;  1GG3 A;  1YNT E;  3KYD D;  4ZYS A;  1WZ0 A;  2MBB B;  3IT6 B;  3WAP A;  1MHH E;  1WMH B;  2BYF A;  4DXF A;  2GBJ A;  3GZN I;  1E0Z A;  1WR1 A;  3ZNZ B;  1RFA A;  3UIO B;  5HFY A;  1TBE A;  4KV2 A;  3NY5 A;  2I1K A;  2RSU A;  3KH0 A;  1WX8 A;  1LGR A;  3V61 A;  2WNM A;  2G4S A;  3E56 A;  4B6W A;  1V6E A;  1I4P A;  5AUK A;  1AYF A;  2MJD A;  2BS4 B;  3KYC D;  3DVN U;  1FFV A;  1ZE3 D;  2JU6 X;  2LJ5 A;  1L0X B;  1D5Z C;  4URK A;  4M8N A;  5C2T B;  3APC A;  4IWO A;  2ZJD A;  3P4S B;  1Y56 A;  2SEB D;  2WDR B;  1YQ4 B;  3PGE A;  4X57 B;  5TSS A;  3DVN V;  2BWE S;  1V5O A;  4CO7 A;  3HK0 A;  4AJW A;  1UH6 A;  5HG2 A;  2V1Y A;  5C1Z A;  4JIO U;  2QCZ A;  4PT5 A;  3VHT C;  1M4V A;  2L83 A;  2TSS A;  1D3Z A;  5LLI A;  3AEA B;  3MJW A;  4XYC A;  4HLE A;  1I7H A;  2DYB A;  4LJP B;  3BWU D;  2FIF A;  1SJH D;  5BYR A;  4FLH A;  2AQ3 B;  2GOW A;  3NVZ A;  1C3T A;  5KHQ A;  3W9C B;  2O2V B;  3L0W B;  2MP2 A;  3UGB B;  2ZPY A;  5JXV A;  2WLB A;  1WY8 A;  3ZQ4 A;  2L0F A;  4ANX A;  2VZK D;  4GLS C;  3A9J B;  4PYU A;  1QIL A;  4XC2 A;  2WXM A;  4M02 A;  4GDK A;  5EE0 A;  5GXG B;  2JY6 A;  1TZO A;  2R61 A;  3AEB B;  3KWV A;  4FXC A;  4MSM B;  4EUT A;  2INP E;  2WXH A;  1BUI C;  2DYO A;  2UYZ B;  2FCQ A;  3EFC A;  4PS8 A;  5IA7 A;  2LGY A;  2V9H A;  3H7P A;  4IW0 A;  1VR9 A;  2RPQ A;  1TIF A;  2BVC A;  3U2S C;  1J19 A;  3ZNH B;  3H8H A;  3EFU A;  3VQI A;  1TKG A;  2CHZ A;  3B9J A;  4OZA A;  4IC7 B;  2CU3 A;  1XLN A;  4A3O A;  4K3B A;  3EC8 A;  3H6N A;  5FKA C;  4G11 A;  3M63 B;  3ENE A;  1XLQ A;  3EHV A;  2X38 A;  1WXS A;  4WUR A;  5DPR A;  2C7N B;  2BT6 A;  4HWI B;  1SIJ A;  3PRM B;  1CJE A;  3QHT A;  2N9K A;  2NTS A;  1N62 A;  2NCN A;  1I4H A;  3AE8 B;  4QAY A;  5DPS A;  4B95 A;  1HTQ A;  1NYR A;  2BW2 A;  2KDM A;  2ONQ A;  1WFY A;  4HDO A;  4PYZ A;  4OVU A;  4XDC A;  1ZGU B;  1YX5 B;  3VDZ A;  1H4R A;  3UIN B;  3ETR A;  2L1A A;  4XWW A;  1V49 A;  3QX1 A;  1WGD A;  3UI3 A;  1WGK A;  3PV1 A;  2KN4 A;  3NG0 A;  5JH5 C;  3DBL B;  2K8B A;  2KT7 A;  1WSP A;  2PPH A;  4JPS A;  4EZJ A;  2L52 A;  3NJT A;  2MQJ A;  3TEX A;  1N5W A;  4E71 A;  5G55 A;  4TQ1 A;  1N5X A;  2IPK D;  4XE0 A;  2BGF A;  3IVF A;  2WXJ A;  4LDT D;  2HTH A;  2VZK B;  1WX9 A;  1FNV A;  1ZXH A;  3H1U A;  2OHF A;  4ZRK A;  2W82 A;  3VTW A;  1HXY D;  1XEE A;  2N9P C;  3AEC B;  1VLB A;  4ARC A;  1J0G A;  3BZD B;  1L5P A;  3ZDM C;  4IDI A;  4M0W A;  4BKS D;  2WP9 B;  2N0S B;  1SSN A;  2Z8L A;  4K3C A;  2CHW A;  4HCP B;  2AX5 A;  4ZHO A;  4TMA B;  3M62 B;  1T5X D;  3JSV B;  2GBK A;  3TUO A;  3NZ3 A;  1F77 A;  3R7Q A;  1WJ6 A;  3ZXR A;  4RNA A;  3SD5 A;  3AE3 B;  1UD7 A;  1UWM A;  5CHF A;  2N7E A;  3W1S C;  3C8Y A;  1C9F A;  1UUP A;  3CF6 E;  3N1X C;  4DHZ E;  4YL8 A;  2IGH A;  4HPP A;  5C3J B;  2HJ8 A;  1MG8 A;  2DWQ A;  4USA A;  4MGK E;  4AWJ A;  2WXO A;  2BBC A;  2LI5 A;  2O2V A;  1NVI D;  3TIX A;  4TKN A;  3AE7 B;  3MTN B;  4II2 B;  1BML C;  3A33 B;  2FCS A;  3DDC B;  4UDU C;  4EEW A;  3DHH C;  1C79 A;  3RNF C;  3R8B A;  3BK2 A;  2PVO D;  2WXP A;  1T0Y A;  2DAJ A;  2KX0 A;  2K3U A;  1LM8 B;  5EE1 A;  2L76 A;  2MA9 B;  2MRP A;  3RPF C;  3VR8 B;  4MEM A;  2M1M A;  1FRR A;  1EWY C;  3QCA A;  2Z59 B;  1I4R A;  5IO9 A;  1L6V A;  2JVC A;  1WXM A;  4YTM B;  2GLS A;  1V8C A;  3A1Q A;  3V05 A;  3B08 A;  2BQQ A;  1WZ3 A;  3OAW A;  3OWE B;  1IBX B;  1ET9 A;  2AQ2 B;  3URY A;  2K1F A;  4H2A A;  3BYY B;  3C19 A;  3ZW3 A;  2M19 A;  1NI2 A;  3PZD A;  5DPW A;  2AL6 A;  1OQQ A;  1HA5 A;  1YIW A;  1G6J A;  3Q8B A;  1WX7 A;  2RMM A;  4NAW B;  3JSV A;  5HHD G;  1LO5 D;  1B1Z A;  3APF A;  1B9R A;  4ARI A;  1NI3 A;  4KX6 B;  3FKY A;  3NZU A;  2WXR A;  1UBI A;  2G45 B;  4JWS C;  3ZKJ C;  3P63 A;  1V1O A;  3EEC A;  5E6P A;  4DDI D;  2G9H D;  2RDB C;  3O65 B;  3OJ3 A;  2CS4 A;  2W55 A;  4W9K A;  1DOI A;  2LRU A;  1TS2 A;  2PLP A;  3P2B A;  1U4A A;  1XD3 B;  2IND C;  2O6V D;  3ZXV A;  1JAL A;  2BTE A;  4ZRI A;  2NBW B;  1IPG A;  3VRB B;  2K39 A;  4NY0 A;  2ZW1 A;  2OJR A;  3KWL A;  1RYJ A;  3MFG A;  3VFK A;  2QEJ C;  2KNB A;  1FCL A;  5BYQ A;  1ZKH A;  1E5W A;  3T8M A;  2V3S A;  2KK8 A;  4HXD A;  4GMV A;  1E9M A;  4TUU A;  4BOZ B;  2BYV E;  2WXI A;  3KQ4 A;  2BKF A;  4B0M A;  3ZIM A;  3DBH B;  4R3D A;  3LYY A;  4JGH B;  1R7S A;  4AOF A;  3S2A A;  2K9X A;  1VCB A;  3HVZ A;  1Q10 A;  3JYU A;  5E6O A;  4YXD B;  2KQ4 X;  3QJZ A;  1TS4 A;  1YN4 A;  1C78 A;  2L32 A;  2KC2 A;  3QIJ A;  1FO4 A;  2C60 A;  3AV8 A;  4BOS C;  2WDT B;  3AEE B;  4HVB A;  1LQB A;  5BMG A;  1YMH E;  2A5U A;  3APD A;  3AXC A;  2XK5 A;  1RAX A;  2FUH B;  3A9K B;  2IY1 B;  3AE9 B;  1ZUD 2;  4ICU A;  2K22 A;  2NS5 A;  1BT0 A;  4HKQ A;  1WM3 A;  1WJ4 A;  4KIK B;  3CIR B;  3PRZ A;  1CQV A;  2QDF A;  2KD0 A;  4N59 A;  3TJP A;  2BB6 A;  2KWD A;  4AQ7 A;  2JYE A;  2VH1 A;  5JHA A;  2W3S A;  4PK1 A;  3ML8 A;  3N1Z C;  1KLV A;  1VZ6 A;  3Q8F A;  3QK0 A;  1A70 A;  3Q3M C;  1GUA B;  2KN5 A;  4ZOH C;  1JWM D;  2REX A;  2Y5P A;  5BYS A;  1XLP A;  2LXA A;  1SBB B;  4WWO A;  4ZYN A;  2AQ1 B;  3WAM A;  1OQR A;  2SAK A;  2XNA C;  3N3K B;  3Q3O C;  1UZX B;  4RGM A;  1NBF C;  2IYD B;  1MI0 A;  1OQY A;  3GZN B;  4F8C B;  2KJR A;  1LXD A;  1OEY J;  2DZM A;  1XXG A;  2DX5 B;  1D5X C;  1FFU A;  4MJS B;  2YLM A;  3ONS A;  4I6N B;  4IWQ A;  1AAR A;  1I42 A;  1NDD A;  2LVQ A;  2DLB A;  4II3 B;  4NJ7 A;  2W54 A;  3FIL A;  1GPX A;  1Z5S B;  2GRI A;  1JRO A;  1D5M C;  1AW7 A;  3ZRC A;  1E8Y A;  4FHK A;  4A20 A;  2J0M A;  1TT5 B;  4MH0 E;  1TYG B;  4GN1 A;  4K7S A;  3L08 A;  1E90 A;  4WJQ A;  5IP4 D;  1M94 A;  3VUW A;  1JRU A;  2EMT A;  2LZ6 A;  4GDL A;  4FJY A;  3VUX A;  3HM3 A;  5CTR C;  4NAW A;  3IG3 A;  3U7Z A;  1TKY A;  1OEY A;  3ECI A;  5DCN A;  4DHJ D;  4JWU C;  1OTR B;  4P1C C;  4EZK A;  3GE3 C;  3DHG C;  1I4G A;  1SXT A;  3VVW B;  2MHJ A;  3N9Y C;  3BIN A;  1MVK A;  3E9S A;  5CX3 A;  5L83 A;  1FD6 A;  2IO1 B;  2ZNV C;  4BBN C;  1TS5 A;  4RMA A;  3P4R B;  1T0R C;  1CK1 A;  1XLO A;  1GAQ B;  1JRP A;  1RM6 C;  1QF6 A;  3PO0 A;  1WIA A;  3DBR B;  4BKT A;  1ZXI A;  4GSW A;  1MJD A;  1XF5 L;  3Q3N C;  4RFB A;  2WXK A;  2PEA A;  2GBR A;  4LJO B;  2KMM A;  3J9C A;  1WRI A;  1R4M B;  1WI0 A;  5AZH A;  1T0Q C;  2D11 A;  3ZJV A;  4OW0 A;  1E7V A;  4A3P A;  2JXT A;  1SF0 A;  4LNN A;  4DXG A;  2LVP A;  1P3Q U;  2KDE B;  3A4S C;  1KOT A;  1WMH A;  4YTN B;  4YTP B;  2KJ6 A;  4WJO A;  1FNW A;  2GI9 A;  3AE4 B;  3TEZ A;  1N6Z A;  2KYW A;  1FRD A;  2QMT A;  2WDV B;  3DBS A;  1UF0 A;  4MDK E;  3PHW B;  1WXV A;  1Y8R C;  2EMS A;  1GB4 A;  4IM2 A;  3Q6B A;  5C23 A;  2WGS A;  2AWT A;  1QKZ A;  2PE9 A;  5E6J A;  4WAF A;  1KLU D;  2N1V A;  3DVG X;  1MPE A;  1V81 A;  4FAD A;  3T9L A;  4HJK A;  1WYG A;  4NJ6 A;  1D4B A;  1E8W A;  3AE5 B;  2DNF A;  2ZEQ A;  3PPA A;  3BII D;  1KH0 A;  2BS3 B;  2YVC A;  4W9I A;  1P1A A;  2X8X X;  2XK5 B;  4HRO A;  3KUZ A;  3QAR A;  1TS3 A;  2K8H A;  1HTO A;  2ZPN A;  2WHI A;  4YSX B;  5I4D A;  2MCN B;  3WAN A;  2ON8 A;  3T3O A;  2KLC A;  4EZL A;  2N1W A;  2D2Q A;  1N61 A;  2MBO A;  1ACC A;  2DEN B;  2PKO A;  4GOC A;  4E74 A;  3I3T B;  4XZ4 A;  5AZF A;  3LJ3 A;  1WE7 A;  3KUD B;  3O13 A;  4J6I A;  3W5V B;  5AUI A;  4JX1 C;  1HQR D;  4M8M A;  3MJ5 A;  4MAC A;  2ASQ A;  4A90 A;  2ACZ B;  1V9J A;  1C4C A;  4A8X C;  3PRE A;  2RPV A;  1WH3 A;  3NS8 A;  2QSD A;  3FIL B;  2PMV A;  4OVZ A;  4OZB A;  3DOW A;  3AEG B;  2R2O A;  1QLB B;  1FXA A;  1TTN A;  5BMI A;  2CU1 A;  4BKG A;  2ZVO A;  3X23 A;  4US8 A;  1PYW D;  2INC C;  3W5U B;  2JXX A;  4B9K A;  2V4I B;  3UQA A;  1CMX B;  3DQV A;  2KTR A;  4NQK E;  2BF8 B;  4PS3 A;  1GB1 A;  1QT9 A;  1EU4 A;  1FM0 D;  3N20 C;  2WWZ A;  3N32 A;  4DXA B;  4EE2 A;  4ACF A;  3Q8C A;  3Q3J A;  5HI1 A;  3SEB A;  2JPH A;  4HKZ E;  5IOI A;  3RFZ B;  3VH3 B;  3A1Q B;  2CR5 A;  3ZVV A;  3R2T A;  4KKI A;  5J2R A;  2IO0 B;  4WJP A;  2BB5 A;  1QOA A;  2D3A A;  3AM9 A;  5D6J B;  1E10 A;  1P7F A;  3VAW A;  1WE6 A;  5FR6 A;  3VXW A;  3U30 A;  2LRW A;  3DBH I;  1KJT A;  4US9 A;  1EU3 A;  1KF6 B;  1R4M I;  3MC9 A;  4GXB A;  2E6X A;  1VZ7 A;  4RF0 A;  1K51 A;  2JUO A;  3RUL A;  4GU2 A;  4RGT A;  5FK9 C;  2GB1 A;  1JCK B;  2M8S A;  3QC8 B;  4ZRJ A;  3BVZ A;  3P4Q B;  1ZDX A;  3PHX B;  3RN9 C;  1I35 A;  3RNB C;  2LGS A;  3ZLZ A;  4ZHP A;  2J7Q B;  2LFI A;  2M56 B;  3PVL A;  1L0V B;  1X1M A;  1WXQ A;  2JWU A;  3QQ8 B;  1IYF A;  1GOZ A;  2JWZ A;  1C1Y B;  2FUG 1;  3R2I A;  2MWS B;  4W9F A;  3CWI A;  4W9J A;  2Z0D B;  1QOB A;  4IOI E;  2KFK A;  3AH7 A;  3PTF C;  1YN5 A;  3AI5 A;  2KWU B;  1YJ1 A;  3GP7 A;  2IY0 B;  1JML A;  4ITK A;  5GMV A;  4KGT A;  4ANV A;  1SE3 A;  4OZC A;  4KZ0 A;  1ZP0 B;  1C4P A;  1IGD A;  2KDI A;  3X0W A;  1A5R A;  4RGN A;  2YEP F;  4XX5 A;  4P6V F;  2NTT A;  4JE3 B;  4F1S A;  5FR3 A;  3LXF A;  4C00 A;  1N60 A;  3VR9 B;  3DHI C;  1JWB D;  4M0W B;  2RDH A;  5AEK B;  4HPL B;  4KZC A;  3L4P A;  1J7C A;  4OHJ A;  4WIP A;  2MBH A;  3VTU A;  4IM0 A;  1VJK A;  2KTF A;  4K7U A;  4AJY B;  3DVG Y;  1JWA D;  4ZRP A;  1MFW A;  3KLS X;  2G4D B;  3HHM A;  5H8Y E;  3P1M A;  1VZ8 A;  1UGJ A;  2IBI B;  3TEW A;  1YQB A;  4RH6 A;  2ZW0 A;  4MEL A;  1TY0 A;  4RF1 A;  2L7R A;  3P42 A;  2GBN A;  5T8I A;  1WGG A;  2L3Z A;  2ZVN A;  3NOB A;  1KRH A;  4FBJ B;  1L4D B;  1SB3 C;  4GIV A;  1FEH A;  1XT9 B;  1K8R B;  2WYQ A;  3RZW C;  4WJN A;  4P1B C;  2CJO A;  2LGI A;  3W1S A;  2KTR B;  3R7R A;  3A9K A;  2KOX A;  2FBW B;  1QQR A;  5IKC M;  4MGY E;  1R4N I;  2E3T A;  3WAO A;  4J3O D;  3B0A A;  1K50 A;  1PGB A;  2K8C A;  1L6U A;  1IUE A;  3N30 A;  5CHW A;  3L17 A;  2A4Z A;  4L23 A;  3RNG C;  3AB5 A;  1V80 A;  1ZOY B;  2K25 A;  1I4Q A;  1YQ3 B;  4HEA 1;  1KLG D;  4MM3 B;  4S17 A;  2J52 A;  5D7G A;  4M01 A;  5JHB A;  2V4L A;  2LUE A;  2LHD A;  3NVV A;  1Q5W B;  2J0J A;  3ABV B;  1WJU A;  2RDG A;  4YSY B;  2BYT A;  2I38 A;  5D94 A;  3Q69 A;  4LNO A;  4D2K A;  1BXT A;  4RCO A;  1MHX A;  3BK1 A;  3CST A;  1VDV A;  4FJV B;  3ZYY X;  3OG5 A;  2D07 B;  2MX2 A;  2V3P A;  4P7I A;  5L95 C;  4P16 A;  2WXG A;  3V6E B;  3BVM A;  1KTK A;  1ZPS A;  2M0A A;  4XDD A;  3RZF A;  2IGD A;  4DHZ B;  1RLF A;  4FJZ A;  4WQM A;  5IAA C;  2L05 A;  4GDL B;  2IGG A;  4TQ0 A;  3M95 A;  2JZP A;  4LNI A;  4WWP A;  4L1B A;  4FA6 A;  2HD5 B;  2ZZP B;  4TSS A;  2PIA A;  3RMK C;  2LGX A;  3AU4 A;  5IN7 A;  3SR6 A;  4IM3 A;  1V86 A;  2JRH A;  3VUY A;  2WXQ A;  3RT3 B;  3RCZ A;  3RNE C;  4HK2 A;  2RGF A;  4BKS A;  3K9O B;  2CHX A;  4WWM A;  1FXT B;  1SGH A;  2INN E;  1L2N A;  2H88 B;  3VTV A;  4TV3 A;  2VRR B;  2KMC A;  3ZNG C;  5D2M B;  4C4V B;  2V3N A;  1WGY A;  4PS7 A;  1WXA A;  3HUI A;  4W9L A;  4KGS A;  3MHS D;  3IBE A;  3V3X A;  2G3Q B;  1E7P B;  2O6V A;  2BWF A;  3HRD D;  4XWT A;  2KQS A;  2JZZ A;  3L13 A;  5LXI B;  4FHJ A;  4WWN A;  3V6C B;  5BMH A;  5J17 A;  2D5G A;  1VD2 A;  1ENF A;  2DYM A;  1PQS A;  4HDQ A;  3RNA C;  1EF1 A;  2DBY A;  3ZNI D;  2C7H A;  1HZ6 A;  4N58 A;  5DPT A;  3TSS A;  4AP4 C;  4NZL B;  3WCQ A;  1EF5 A;  1F2R I;  1YJI A;  1ISN A;  4NAM A;  1GC7 A;  1RFK A;  3WAL A;  3V62 A;  2IO2 B;  2MW5 A;  1K52 A;  1XQQ A;  2FNJ B;  4O1N A;  4YSZ B;  3DWG C;  1SE2 A;  4MJS A;  2EKI A;  1ESF A;  2FID A;  1OGW A;  2NPT B;  2MJ3 A;  3ML9 A;  2C5L C;  1V1P B;  3SFE B;  2KO3 A;  1GC6 A;  5KHO A;  1AWD A;  4A9A A;  2I1J A;  2LGD A;  4MSQ B;  3PZ8 A;  4G50 A;  4FN2 A;  1P0R A;  2PW9 A;  3KUC B;  1UEL A;  3AU5 A;  1WJN A;  4GDK B;  3QAQ A;  3B2F A;  3PRP B;  2O6V B;  4MM3 A;  2H89 B;  2M4N A;  2Z0E B;  5E6N A;  4KSL C;  3VH4 B;  4ZDV A;  1T3Q A;  3ZRF A;  4DHJ B;  4NJC A;  5G5H A;  2D3G A;  1DGJ A;  4Q2J A;  3H7P B;  5D3D A;  5G5G A;  1OFF A;  2CKH B;  2WXL A;  3N1Y C;  2CJN A;  4BFR A;  1YD8 U;  3Q8A A;  4DBG A;  2MBE A;  3P4P B;  2DZI A;  3GOE A;  3AMZ A;  3PT2 B;  2B3A A;  5G2N A;  1WYW B;  2AEH A;  1IBX A;  1TKE A;  4BZA A;  2NMQ A;  3V60 A;  2OED A;  2LAS A;  3OJ4 B;  4ZRQ A;  2L8J A;  2WU5 B;  2Y5C A;  2FCM A;  2LJI A;  1WGH A;  2C7M B;  1C76 A;  2XEW A;  5J18 A;  4B0E A;  3ZJU A;  1F9J A;  2PTL A;  3AE6 B;  4JL9 A;  4ICV A;  3U8Z A;  5BO4 B;  3I57 A;  1ROE A;  4KGR A;  3UF8 A;  3AE2 B;  3SU8 X;  3DCG A;  3ALB A;  3AED B;  3GE8 C;  1C77 A;  2N9L A;  4MT5 A;  2UU7 A;  2N7J A;  1Q1O A;  3CMM B;  3ZTC A;  1HE8 A;  3IAS 1;  2MP2 B;  4BAX A;  4BVU C;  3IXS A;  2VH2 A;  3TCA A;  2ZCB A;  3IT4 B;  1R4N B;  2JYT A;  3HIZ A;  3GS2 A;  3PLV A;  2AL3 A;  2KAJ A;  1MG4 A;  2KQ7 A;  2OOB B;  1TZ1 A;  2WS3 B;  1EUV B;  2I2Y A;  4LNF A;  3LDZ E;  2RR9 A;  1HZ5 A;  4REZ A;  2MJE A;  3PS6 A;  2L0T A;  4C7Y A;  2MBQ A;  1RWS A;  2IZV B;  2KDF B;  2LVO A;  1PGX A;  1PUT A;  1QZE A;  2KVR A;  1N63 A;  1SIF A;  2HJ1 A;  4LNK A;  2DZJ A;  2DHZ A;  4KDI C;  4K7W A;  2KAN A;  2ICI A;  2JQR B;  4I6P A;  2KFK B;  2GBM A;  1TY2 A;  3Q8E A;  3EA6 A;  2KJH B;  2NPT A;  1XCT L;  1QOG A;  3AE1 B;  4WQO B;  4G3X B;  3VRA B;  4C4V A;  2NVU I;  3ZUN A;  3WA0 A;  3HVD A;  4MH8 A;  1D6E C;  1F0Z A;  2LEK A;  3L54 A;  2R2Q A;  3PSE B;  2WU2 B;  3NUH B;  1NEK B;  1I4X A;  4RGO S;  4W9G A;  2AYO B;  3SFD B;  1L7Y A;  1FCC C;  3TEY A;  1F1H A;  2JZ3 B;  4KIK A;  4YWG G;  5CHV C;  2JX5 A;  2NR2 A;  3PZ7 A;  4ANW A;  2IO3 B;  2GMI C;  3H7S A;  1ZDV A;  2C9W B;  4N9F 4;  1PGA A;  1TGZ B;  4GGQ A;  2KWC A;  2EEL A;  4IKG A;  4IUM B;  2MLB A;  4YT0 B;  1WF9 A;  2BYE A;  2K5P A;  4WH4 A;  2D3B A;  4DDG D;  1LFD A;  2D3C A;  2XBB C;  2LWP A;  4DQO C;  5TR5 A;  2QJL A;  2MSE D;  2FE8 A;  3FAH A;  3IHP C;  1STE A;  3DBR I;  1VRA B;  2J42 A;  3MP9 A;  4N6E B;  1ZW7 A;  3Q2A C;  4F7Z A;  1F52 A;  3DBL I;  1AN8 A;  2YEP B;  1WM2 A;  2L00 B;  2LD9 A;  4LTU A;  3GB1 A;  1Q0W B;  1IGC A;  2J4X A;  3MHZ A;  2N9E B;  1RRB A;  3I9V 1;  1J7B A;  3Q14 C;  3FC4 A;  3RNC C;  1J8C A;  3NS1 A;  1L4Z B;  3SHQ A;  1TJE A;  3T3N A;  1V5T A;  2HTM E;  1L0Y B;  3NRZ A;  2J0K A;  5LNK 1;  3AN1 A;  1F2R C;  1JQ4 A;  2RD0 A;  2Y5B B;  3D32 A;  1FXI A;  4MGI E;  2KLG A;  3ZJT A;  1EO6 A;  2JF5 A;  1P9D U;  1E6E B;  4FUL A;  1KFY B;  2WX1 A;  4HCN B;  3H9D A;  3DPD A;  1JWS D;  4MGZ E;  4WAA A;  4AUQ C;  2OJW A;  3ZGZ A;  3UQB A;  3ZDT A;  3I63 C;  4CYE A;  3L16 A;  2BS2 B;  2LUM A;  4L2Y A;  4RM9 A;  5EDS A;  2PE6 B;  4KDL B;  5AZG A;  2DAF A;  2UWQ A;  1T0S C;  3JVZ X;  4S0R A;  3ZTD A;  3ZO5 B;  3HM6 X;  2QC8 A;  2QIL A;  3U52 E;  1DYQ A;  4AS1 A;  3U4E G;  3BYT B;  2DZK A;  2IJ0 A;  2N7D A;  3LB8 C;  4EOY A;  2FCN A;  3MC8 A;  2WXN A;  1FNU A;  2B76 B;  1KM7 A;  3M3J A;  4HRS A;  2EKE C;  4NQL B;  4E3C A;  2Y3A A;  4HJG E;  2KDB A;  3IAM 1;  3KVF B;  1J7A A;  4DWF A;  3AUL A;  1IP9 A;  3I5J C;  3W1Y A;  3RUI B;  4C7Z A;  2KWV B;  4ANU A;  2G1E A;  4A55 A;  1S1Q B;  1P7E A;  2WDQ B;  5EE3 A;  2KXJ A;  3BY4 B;  4KSK C;  3RI7 C;  3RD2 A;  2KX3 A;  2FAZ A;  2ZNV B;  4W9C A;  1JWU D;  4C80 A;  1CZP A;  4LDT B;  1E8X A;  2LHE A;  4JLC A;  2D10 A;  1WGR A;  1FMA D;  2ZCC A;  5H92 C;  3OLM D;  1QOF A;  3JW0 X;  5JZE B;  1Z2M A;  2HDE A;  3IFW B;  3TBL D;  3EGR A;  1HEZ E;  5MPO A;  4GB9 A;  3RYT A;  4CQN A;  3A9J A;  2BPS A;  3U7D A;  4LCD E;  4A6Q A;  1FIQ A;  1NEN B;  1C4A A;  3PLU A;  2NBV B;  4K81 A;  2KZR A;  3NVW A;  4IWP A;  4JQW C;  4CHK A;  3NHE B;  3TMP B;  2LXC A;  3B2G A;  3MC0 B;  1YJJ A;  2Q5W D;  5EE9 A;  2IDY A;  2QIE B;  1WR6 E;  1SE4 A;  1E8Z A;  3NVY A;  4EKU A;  4IG7 B;  2WXF A;  2LMC A;  5LXH A;  2WQY B;  1GJZ A;  2HE7 A;  4HPM B;  1P98 A;  2NBU A;  3R66 C;  3B1L X;  1K53 A;  2BKR B;  2K6Q A;  1PFD A;  2JRI B;  3NZS A;  2V0G A;  3CSF A;  2JT4 B;  3C0R B;  2M17 A;  1UGM A;  4W9D A;  1S3S G;  4M00 A;  2K0P A;  2KKC A;  4KKJ A;  1SJE D;  1WWT A;  2PVG C;  4RM8 A;  2PJH A;  2W9N A;  5D3I B;  4K1R B;  2KHW B;  1ET6 A;  4KVG B;  3Q3F A;  1FPY A;  1EWC A;  3EUB 2;  2JSV X;  4G0N B;  4W9H A;  1DOY A;  1T6B X;  4BBN F;  1V97 A;  1WRD B;  1SEB D;  1DOX A;  1NYQ A;  3L10 B;  2N9X A;  2MH7 A;  2KC1 A;  3K9P B;  2J53 A;  2N4F A;  1GNU A;  4LLG M;  3DWM A;  4NNJ B;  1E7U A;  1H8C A;  3AEF B;  4NPN A;  3BVG A;  4C56 C;  2MEK A;  3A4R A;  3SDL C;  1XO3 A;  3QA8 A;  1UWX A;  2QHO A; 
#chains in the Genus database with same CATH homology
 2KMA A;  1KJT A;  2L8J A;  3TL5 A;  2OJR A;  1R4M I;  2FCM A;  5HKH A;  1WGH A;  2K6D B;  2C7M B;  4W9E A;  4GXB A;  2NBW B;  2XEW A;  3VFK A;  5J18 A;  2JUO A;  2KNB A;  3QWZ B;  4ASW C;  1F9J A;  2WX0 A;  3UIP B;  3KW5 B;  3RUL A;  2KFJ A;  3WIM A;  1ZKH A;  4GU2 A;  4DK5 A;  1E5W A;  2M8S A;  4JL9 A;  2V3S A;  3T8M A;  3QC8 B;  4ICV A;  4ZRJ A;  3U8Z A;  1SE9 A;  2KK8 A;  4OVV A;  5BO4 B;  4HXD A;  4GMV A;  4EFO A;  4TUU A;  4BOZ B;  4I6L B;  2M0X A;  1V2Y A;  2BYV E;  3PHX B;  1YX6 B;  2BKF A;  1I35 A;  3ZLZ A;  2J7Q B;  3ZIM A;  3UF8 A;  3SU8 X;  3PVL A;  4JGH B;  4AOF A;  1UBQ A;  3DCG A;  3S2A A;  1X1M A;  1GG3 A;  1VCB A;  3KYD D;  3ALB A;  3QQ8 B;  3R3M A;  1IYF A;  3JYU A;  1WZ0 A;  2JWZ A;  5E6O A;  1C1Y B;  2MBB B;  3WAP A;  3QJZ A;  2MWS B;  1WMH B;  2KC2 A;  2BYF A;  2C60 A;  3QIJ A;  4W9F A;  2GBJ A;  3GZN I;  4W9J A;  2Z0D B;  1WR1 A;  1Q1O A;  2KFK A;  3CMM B;  3ZTC A;  4BOS C;  3ZNZ B;  1HE8 A;  1RFA A;  2MP2 B;  3PTF C;  3UIO B;  2WDT B;  3AI5 A;  1TBE A;  4BVU C;  4HVB A;  1LQB A;  2KWU B;  1YJ1 A;  4KV2 A;  3TCA A;  2ZCB A;  3NY5 A;  2IY0 B;  2I1K A;  2RSU A;  2A5U A;  3APD A;  3KH0 A;  5GMV A;  1WX8 A;  3V61 A;  3AXC A;  3HIZ A;  4ANV A;  3PLV A;  2AL3 A;  2G4S A;  2XK5 A;  2KQ7 A;  1RAX A;  2FUH B;  2OOB B;  3A9K B;  4B6W A;  2IY1 B;  4KZ0 A;  1TZ1 A;  1V6E A;  1EUV B;  3LDZ E;  2KDI A;  2RR9 A;  3X0W A;  1A5R A;  3KYC D;  3DVN U;  4ICU A;  3PS6 A;  2LJ5 A;  2L0T A;  2NS5 A;  1BT0 A;  2MBQ A;  4URK A;  1WM3 A;  4XX5 A;  4M8N A;  1WJ4 A;  4KIK B;  4F1S A;  2IZV B;  3APC A;  2KDF B;  3PRZ A;  2LVO A;  4IWO A;  2KD0 A;  3TJP A;  1QZE A;  2ZJD A;  2KVR A;  1SIF A;  5JHA A;  4M0W B;  2DZJ A;  5AEK B;  3PGE A;  4X57 B;  3ML8 A;  2DHZ A;  3DVN V;  4KDI C;  4K7W A;  4HPL B;  2BWE S;  1V5O A;  2KAN A;  4KZC A;  1KLV A;  4I6P A;  2KFK B;  4CO7 A;  2GBM A;  3HK0 A;  3QK0 A;  4AJW A;  2KJH B;  2NPT A;  2MBH A;  1UH6 A;  4WQO B;  3VTU A;  1GUA B;  2KN5 A;  4G3X B;  2NVU I;  2V1Y A;  4IM0 A;  3ZUN A;  3WA0 A;  5C1Z A;  4JIO U;  2KTF A;  2REX A;  2LXA A;  4K7U A;  4AJY B;  3DVG Y;  3L54 A;  4WWO A;  2R2Q A;  4ZYN A;  3VHT C;  3PSE B;  2G4D B;  3WAM A;  3HHM A;  3N3K B;  1UZX B;  2AYO B;  4W9G A;  1D3Z A;  5LLI A;  1L7Y A;  1NBF C;  2IBI B;  1YQB A;  3MJW A;  2IYD B;  4MEL A;  2JZ3 B;  4KIK A;  4HLE A;  1OQY A;  2L7R A;  4F8C B;  2DYB A;  2GBN A;  4LJP B;  2KJR A;  1LXD A;  1WGG A;  2FIF A;  2L3Z A;  5CHV C;  4FLH A;  2NR2 A;  4ANW A;  2ZVN A;  3NOB A;  1OEY J;  2GOW A;  2DZM A;  2IO3 B;  2GMI C;  3H7S A;  4FBJ B;  5KHQ A;  1C3T A;  2DX5 B;  3DBH I;  2C9W B;  2O2V B;  3L0W B;  4GIV A;  4N9F 4;  2MP2 A;  3UGB B;  4MJS B;  1TGZ B;  4GGQ A;  2YLM A;  2ZPY A;  3ONS A;  4I6N B;  4IWQ A;  1AAR A;  1XT9 B;  2KWC A;  1K8R B;  2WYQ A;  2MLB A;  1NDD A;  1WF9 A;  4IUM B;  4WJN A;  3RZW C;  1I42 A;  2LVQ A;  2BYE A;  3W1S A;  4II3 B;  4NJ7 A;  2KTR B;  1WY8 A;  4DDG D;  1LFD A;  3R7R A;  2XBB C;  2LWP A;  3A9K A;  5TR5 A;  2KOX A;  2L0F A;  4ANX A;  1Z5S B;  2MSE D;  4MGY E;  1R4N I;  3IHP C;  3WAO A;  3A9J B;  3B0A A;  4PYU A;  3ZRC A;  1E8Y A;  3DBR I;  4XC2 A;  2K8C A;  4GDK A;  2JY6 A;  1ZW7 A;  2QHO A;  4FHK A;  4F7Z A;  3N30 A;  4A20 A;  5CHW A;  2J0M A;  3L17 A;  3DBL I;  4MH0 E;  2A4Z A;  4GN1 A;  4K7S A;  3L08 A;  1WM2 A;  1E90 A;  2L00 B;  2LD9 A;  4MSM B;  4WJQ A;  1M94 A;  1V80 A;  1Q0W B;  2K25 A;  3VUW A;  1JRU A;  4EUT A;  2EMT A;  2LZ6 A;  2N9E B;  1RRB A;  5D7G A;  5JHB A;  2V4L A;  2DYO A;  2LUE A;  2UYZ B;  2FCQ A;  4GDL A;  4FJY A;  4PS8 A;  3VUX A;  3HM3 A;  1Q5W B;  5CTR C;  2J0J A;  4NAW A;  3IG3 A;  1WJU A;  1OEY A;  3ECI A;  5IA7 A;  1J8C A;  5DCN A;  2LGY A;  3H7P A;  4IW0 A;  4DHJ D;  2RPQ A;  5D94 A;  3SHQ A;  1OTR B;  1V5T A;  1J19 A;  3ZNH B;  4EZK A;  3EFU A;  2J0K A;  3VQI A;  2CHZ A;  2LAS A;  3VVW B;  3CST A;  3BIN A;  2RD0 A;  2Y5B B;  4FJV B;  3D32 A;  4IC7 B;  5CX3 A;  4MGI E;  5L83 A;  2D07 B;  4A3O A;  2MX2 A;  2IO1 B;  2ZNV C;  2KLG A;  3EC8 A;  3H6N A;  1EO6 A;  2JF5 A;  4BBN C;  4G11 A;  3M63 B;  3ENE A;  1P9D U;  4P7I A;  4FUL A;  3EHV A;  5L95 C;  1WXS A;  2WX1 A;  4HCN B;  3H9D A;  3DPD A;  3V6E B;  4MGZ E;  4WAA A;  5DPR A;  4AUQ C;  4RMA A;  3UQB A;  2C7N B;  3ZDT A;  4CYE A;  3L16 A;  3RZF A;  4HWI B;  4DHZ B;  1RLF A;  4RM9 A;  5EDS A;  1WIA A;  2PE6 B;  4FJZ A;  3PRM B;  5IAA C;  2L05 A;  4GDL B;  4KDL B;  4BKT A;  5AZG A;  2DAF A;  2UWQ A;  4TQ0 A;  3JVZ X;  3ZTD A;  3QHT A;  3ZO5 B;  3HM6 X;  4GSW A;  2NCN A;  5DPS A;  4B95 A;  3M95 A;  2PEA A;  4WWP A;  2GBR A;  4LJO B;  4FA6 A;  2HD5 B;  2ZZP B;  1WFY A;  4HDO A;  1WI0 A;  5AZH A;  2DZK A;  4PYZ A;  4OVU A;  2LGX A;  2N7D A;  1ZGU B;  2D11 A;  1YX5 B;  3AU4 A;  2FCN A;  1H4R A;  3VDZ A;  4EOY A;  1E7V A;  3UIN B;  4A3P A;  4IM3 A;  1V86 A;  2JRH A;  3VUY A;  1V49 A;  2LVP A;  1P3Q U;  1KM7 A;  1WGD A;  2KDE B;  3M3J A;  3QX1 A;  3A4S C;  3RCZ A;  3RT3 B;  1WMH A;  1KOT A;  3PV1 A;  4HK2 A;  2EKE C;  5JH5 C;  4NQL B;  4E3C A;  2RGF A;  2K8B A;  2PPH A;  3K9O B;  4BKS A;  2KJ6 A;  4WJO A;  2CHX A;  4EZJ A;  2KDB A;  1FXT B;  2MQJ A;  1SGH A;  4DWF A;  3KVF B;  3AUL A;  4E71 A;  1IP9 A;  3DBS A;  4MDK E;  3W1Y A;  1L2N A;  5G55 A;  4TQ1 A;  3PHW B;  3RUI B;  3VTV A;  1WXV A;  4TV3 A;  2VRR B;  2KMC A;  3ZNG C;  2KWV B;  1Y8R C;  4ANU A;  2EMS A;  5D2M B;  2BGF A;  4IM2 A;  3IVF A;  4LDT D;  2HTH A;  1WGY A;  1WX9 A;  5C23 A;  3H1U A;  4PS7 A;  2AWT A;  1S1Q B;  1WXA A;  4ZRK A;  3VTW A;  2PE9 A;  4W9L A;  2N1V A;  3DVG X;  1V81 A;  3MHS D;  4FAD A;  2KXJ A;  2N9P C;  3BY4 B;  3T9L A;  3IBE A;  4KSK C;  3RD2 A;  2KX3 A;  2FAZ A;  4HJK A;  1J0G A;  2G3Q B;  2ZNV B;  2O6V A;  2BWF A;  4W9C A;  3ZDM C;  2KQS A;  4NJ6 A;  1E8W A;  2JZZ A;  3L13 A;  4LDT B;  5LXI B;  4BKS D;  1E8X A;  2ZEQ A;  4FHJ A;  4WWN A;  3PPA A;  3V6C B;  4JLC A;  2D10 A;  2YVC A;  4W9I A;  1P1A A;  2XK5 B;  1WGR A;  3KUZ A;  5J17 A;  1VD2 A;  2CHW A;  2ZCC A;  3QAR A;  2K8H A;  4HCP B;  2DYM A;  2ZPN A;  3M62 B;  3JSV B;  2GBK A;  1PQS A;  3OLM D;  4HDQ A;  1EF1 A;  3JW0 X;  3ZNI D;  5JZE B;  3R7Q A;  1Z2M A;  1WJ6 A;  2MCN B;  2C7H A;  3IFW B;  3TBL D;  3WAN A;  5DPT A;  3SD5 A;  1UD7 A;  4AP4 C;  2KLC A;  5CHF A;  2N7E A;  4GB9 A;  3W1S C;  1EF5 A;  4EZL A;  3RYT A;  2N1W A;  3A9J A;  3CF6 E;  2BPS A;  2D2Q A;  4DHZ E;  1ISN A;  4LCD E;  3U7D A;  4YL8 A;  2MBO A;  1GC7 A;  2DEN B;  3WAL A;  3V62 A;  3PLU A;  2NBV B;  2HJ8 A;  2IO2 B;  4GOC A;  1MG8 A;  4K81 A;  4E74 A;  2KZR A;  4JQW C;  2MW5 A;  4IWP A;  4MGK E;  3I3T B;  4XZ4 A;  5AZF A;  1XQQ A;  4AWJ A;  2FNJ B;  4CHK A;  3LJ3 A;  1WE7 A;  3KUD B;  3NHE B;  2LI5 A;  4J6I A;  3TMP B;  2O2V A;  2LXC A;  3TIX A;  4TKN A;  3MTN B;  4MJS A;  4II2 B;  2FID A;  1OGW A;  2NPT B;  3A33 B;  2FCS A;  3DDC B;  4M8M A;  3ML9 A;  2C5L C;  4EEW A;  2ASQ A;  1WR6 E;  1V9J A;  1T0Y A;  2DAJ A;  1GC6 A;  2KO3 A;  2KX0 A;  1E8Z A;  1LM8 B;  1WH3 A;  3PRE A;  5KHO A;  3NS8 A;  2L76 A;  4EKU A;  4IG7 B;  2MA9 B;  2MRP A;  5LXH A;  4MEM A;  2I1J A;  2M1M A;  2LGD A;  3DOW A;  4MSQ B;  1GJZ A;  2HE7 A;  4G50 A;  1P98 A;  4HPM B;  2NBU A;  2R2O A;  3QCA A;  2Z59 B;  3R66 C;  4FN2 A;  3B1L X;  2JVC A;  1P0R A;  1WXM A;  3KUC B;  2BKR B;  2K6Q A;  3A1Q A;  1UEL A;  3AU5 A;  1WJN A;  3B08 A;  4GDK B;  1TTN A;  2JRI B;  3OAW A;  1WZ3 A;  3NZS A;  3QAQ A;  3CSF A;  2JT4 B;  2CU1 A;  3C0R B;  2M17 A;  1UGM A;  4BKG A;  2K1F A;  2ZVO A;  2O6V B;  3PRP B;  4MM3 A;  4W9D A;  3X23 A;  1S3S G;  3ZW3 A;  2KKC A;  4RM8 A;  2JXX A;  2M4N A;  2Z0E B;  4B9K A;  2PJH A;  2W9N A;  5E6N A;  4KSL C;  3VH4 B;  4K1R B;  4ZDV A;  1NI2 A;  3PZD A;  1CMX B;  3UQA A;  5DPW A;  2AL6 A;  2KHW B;  4KVG B;  3DQV A;  1YIW A;  2KTR A;  3Q3F A;  2BF8 B;  4NQK E;  3ZRF A;  1G6J A;  4DHJ B;  4PS3 A;  1WX7 A;  2D3G A;  4NAW B;  3JSV A;  2WWZ A;  4G0N B;  3APF A;  3H7P B;  3N32 A;  4DXA B;  4W9H A;  2CKH B;  3NZU A;  3Q3J A;  4BBN F;  1UBI A;  2G45 B;  3ZKJ C;  1WRD B;  4BFR A;  1YD8 U;  2JPH A;  3EEC A;  5E6P A;  3L10 B;  4DDI D;  4DBG A;  2N9X A;  3O65 B;  2MBE A;  3OJ3 A;  3VH3 B;  2KC1 A;  3K9P B;  3A1Q B;  2CR5 A;  2N4F A;  2CS4 A;  2LRU A;  2DZI A;  4W9K A;  3ZVV A;  3GOE A;  1GNU A;  2IO0 B;  2B3A A;  3PT2 B;  4WJP A;  5J2R A;  3P2B A;  5G2N A;  1U4A A;  1WYW B;  1XD3 B;  2AEH A;  2O6V D;  4NNJ B;  1E7U A;  1H8C A;  4NPN A;  5D6J B;  3V60 A;  3VAW A;  3A4R A;  1WE6 A;  5FR6 A;  3SDL C;  3VXW A;  3QA8 A;  4ZRI A;  3U30 A;  2LRW A;  3OJ4 B;  1IPG A;  2K39 A;  4NY0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...