2PPHA

Solution structure of human mekk3 pb1 domain
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
93
structure length
93
Chain Sequence
QSDVRIKFEHNGERRIIAFSRPVKYEDVEHKVTTVFGQPLDLHYMNNELSILLKNQDDLDKAIDILDRSSSMKSLRILLLSQDRNLEHHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Mitogen-activated protein kinase kinase kinase 3
publication title Insight into the Binding Properties of MEKK3 PB1 to MEK5 PB1 from Its Solution Structure.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 14
structure length 93
sequence length 93
ec nomenclature ec 2.7.11.25: Mitogen-activated protein kinase kinase kinase.
pdb deposition date 2007-04-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00564 PB1 PB1 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 2pphA01
1KOTA 1WM3A 2KO3A 3KVFB 1HE8A 2XK5A 2KX0A 3S2AA 3RUIB 3U30A 2MP2B 2KDEB 1G6JA 5CHFA 1WX8A 4EZLA 4DXAB 5AEKB 2LWPA 2CS4A 5D7GA 2KWVB 4EZJA 3A4RA 1IP9A 2IYDB 3N32A 1RLFA 2N7DA 4A3PA 2IO0B 2W9NA 4EEWA 1WI0A 4KIKA 1WFYA 1ZW7A 4FJZA 1WXAA 2O2VB 1E8YA 4HDQA 2NBVB 2C60A 5FR6A 5BO4B 3VUWA 3WA0A 3RZFA 1V5OA 3K9OB 2JUOA 4AUQC 5DCNA 1VCBA 1WRDB 1E8XA 2BKFA 2I1JA 2JWZA 2IO3B 2LRWA 2LI5A 2MBBB 2N1VA 3QC8B 1WXSA 4HPMB 3UQAA 1I35A 2ZVOA 3BINA 2WWZA 2MBHA 1T0YA 2L0TA 5AZFA 3VQIA 2J0MA 2K8CA 3AI5A 1TTNA 2AL3A 3NZUA 3H1UA 2NR2A 5LXIB 1WGDA 2IZVB 4JIOU 4EZKA 4WJPA 2EKEC 3K9PB 1OQYA 2KANA 3PGEA 2MWSB 3V6CB 1LQBA 3VDZA 1BT0A 4X57B 2CHZA 2ZNVB 2MA9B 1WXMA 4ANVA 3ZTDA 3ZDMC 2HE7A 4W9GA 3UIPB 2J7QB 3IFWB 4NY0A 3SU8X 4IM3A 5JHBA 3T9LA 3ZLZA 4KZCA 2DAFA 2O6VA 3VUXA 4DHZE 1C3TA 1EO6A 4PS8A 1M94A 1I42A 1UELA 2RPQA 4MJSA 1WGYA 4FJYA 3A33B 4KIKB 1Z2MA 4FHKA 3QARA 1FXTB 1Z5SB 1XT9B 5AZGA 3VXWA 3ZDTA 4DHJB 3AULA 3CMMB 4WAAA 4NAWA 3ZNZB 4OVVA 3MJWA 3DVGX 4I6PA 3SD5A 3ZNGC 3SDLC 2KQSA 3CSFA 4WJNA 4HDOA 3UIOB 4AJWA 2LUEA 5DPWA 3BY4B 4HWIB 3LDZE 2PE6B 2RGFA 4MEMA 3WAOA 2CHXA 1P0RA 3TMPB 4HVBA 4A3OA 5CTRC 3U8ZA 3IVFA 4EKUA 1WZ0A 5EDSA 2KWUB 4NQLB 2FCNA 4AP4C 4NJ6A 4ANWA 3M3JA 4WWNA 4WWOA 4NJ7A 3QA8A 3PREA 4NPNA 3RZWC 2YLMA 4JQWC 1WJ6A 2Z0DB 4K1RB 2QHOA 2R2OA 4GDKA 2FCMA 4P7IA 3PRPB 2M0XA 4E71A 3ALBA 1ISNA 2AEHA 2KJRA 2KN5A 2MSED 4G3XB 4AJYB 2KDFB 4HJKA 1RFAA 4E74A 2DX5B 2NCNA 2KJHB 3OAWA 3PLVA 4BOZB 2C5LC 3KUZA 2RD0A 1YIWA 2A5UA 2MRPA 2IY0B 3ENEA 3ML9A 3V60A 2KVRA 1GJZA 3W1YA 2PJHA 1NBFC 4IG7B 4GIVA 2K39A 4WWPA 5J2RA 1GC7A 4B9KA 2LRUA 1RRBA 4ANUA 4KZ0A 2JZ3B 3ZNID 2Z0EB 5DPRA 5JH5C 2D10A 3A1QA 2K6QA 2XEWA 3UGBB 3PRMB 4BBNF 4JGHB 3UF8A 1GC6A 4TQ0A 1E7UA 4GB9A 1WH3A 1TZ1A 3KYDD 5D94A 3U7DA 5J18A 1GG3A 3EECA 4GXBA 4PS7A 2M4NA 4XC2A 2RSUA 4LCDE 2JY6A 4GN1A 1YX5B 3HM3A 3V61A 3ZW3A 3PS6A 1V6EA 5E6PA 2NS5A 3IHPC 3DQVA 4HK2A 2ZPNA 3APDA 3H7SA 4FJVB 1SGHA 1V5TA 4TUUA 2V4LA 3ZO5B 4AOFA 4GSWA 2L7RA 1IPGA 5C23A 1XQQA 4G50A 2JF5A 4BFRA 2FIDA 3R7QA 4JL9A 2IBIB 4LJPB 3EFUA 2AL6A 2L05A 3TBLD 2M17A 4J6IA 2KFKB 3AU4A 3DDCB 1H8CA 3A9JA 3D32A 3TL5A 1WYWB 3X23A 3KYCD 4MSQB 2NVUI 3ZRCA 2REXA 1UZXB 4GMVA 5CHWA 5GMVA 3VTVA 1WY8A 1YD8U 2KHWB 2R2QA 4A20A 2ASQA 4HCNB 3RD2A 3DBSA 2G4SA 2FIFA 2DZIA 1V81A 2MBQA 3H7PA 4W9FA 2KMCA 2KKCA 3DVGY 4MGYE 2DYMA 2BPSA 1MG8A 2V3SA 3A1QB 2UYZB 4ZRJA 4BKSD 1Q5WB 2D3GA 2L0FA 2DZKA 4LJOB 2MLBA 3ECIA 4G11A 2GOWA 2L3ZA 4KDIC 2D07B 4ZYNA 4B95A 4HPLB 1X1MA 2G4DB 3VHTC 3O65B 3P2BA 1E5WA 2XK5B 5JZEB 2BYEA 2N7EA 3LJ3A 4GU2A 1WJUA 3JVZX 4TKNA 4CO7A 3PTFC 3B0AA 2CR5A 1OEYJ 3WAMA 4GGQA 2ZPYA 2C7NB 1WR1A 2BYVE 4MM3A 3T8MA 4BBNC 4CYEA 3OJ3A 2FCQA 1V2YA 3UQBA 4LDTB 3SHQA 2M8SA 4GDLA 3IBEA 3TCAA 3VUYA 2GBMA 1Q0WB 1ZGUB 2ZZPB 3QK0A 1KLVA 3VVWB 1E8WA 4OVUA 4EOYA 2KTFA 4IM0A 3A9JB 2J0KA 1E7VA 2JRHA 3ZNHB 2BF8B 1YQBA 1S1QB 2KX3A 3CSTA 1WGRA 1TGZB 3JSVA 4BVUC 1EF5A 2LVPA 2ZCCA 2FNJB 2WYQA 4F1SA 1GUAB 1WGGA 2N9XA 4DHZB 4RM9A 4FHJA 4N9F4 3PPAA 4WQOB 5J17A 3KUCB 4TQ1A 4MGKE 4DBGA 2AYOB 2DHZA 3ZKJC 1J0GA 1UH6A 2G45B 2LXAA 3DBLI 4DDGD 4HLEA 2LVQA 2NPTA 5LLIA 1IYFA 2N4FA 4XZ4A 2IO1B 4NQKE 3DPDA 3NS8A 3PHWB 4K7WA 3HM6X 1AARA 3AU5A 2L8JA 3NHEB 4ZRKA 1WX7A 1OEYA 2PEAA 3CF6E 1LFDA 4FLHA 1D3ZA 3ZTCA 2G3QB 2N1WA 3EHVA 3APFA 5E6NA 3PRZA 2O6VB 1WE6A 3DOWA 2KC1A 3VH3B 5D2MB 1WZ3A 4MJSB 4W9CA 5G2NA 4F8CB 1Y8RC 3R7RA 5IA7A 1WM2A 2V1YA 2D11A 3Q3JA 1WGHA 2KWCA 4GDLB 3V6EB 4B6WA 5LXHA 3WANA 4NAWB 2LASA 1A5RA 2DAJA 4XX5A 2NBWB 5DPTA 4RMAA 5E6OA 4ANXA 2GBKA 1NDDA 4F7ZA 1WJNA 3DVNV 2L00B 4DK5A 1WMHA 2Z59B 1E8ZA 3JSVB 3JW0X 1P3QU 2JXXA 2KK8A 2YVCA 1H4RA 2GBNA 1UBQA 2JZZA 3B1LX 1P1AA 3TIXA 2KLCA 4DHJD 2FCSA 4EUTA 3L54A 3L17A 4NNJB 3QQ8B 5JHAA 2L76A 2BGFA 2FAZA 4GDKB 2CKHB 3ONSA 2MCNB 2BWFA 3RULA 1LM8B 1V49A 4K7SA 2KTRA 2HTHA 3HK0A 3ZRFA 4URKA 1L7YA 3A9KA 4IC7B 1ZKHA 2NPTB 1J19A 2DZMA 4W9HA 2RR9A 1LXDA 3QWZB 1SE9A 2XBBC 1P98A 3MHSD 2CU1A 1R4MI 1SIFA 3VTWA 2KLGA 1TBEA 2ZCBA 3PLUA 1WJ4A 2ZNVC 3ML8A 2IO2B 1WX9A 2HJ8A 3VTUA 1UGMA 3UINB 3A4SC 4GOCA 4FADA 1F9JA 4FA6A 1JRUA 2K1FA 3VH4B 3ZVVA 3B08A 2K8BA 2WX1A 3DBHI 3PSEB 4M8MA 1KJTA 3N3KB 3QAQA 5L83A 3WAPA 5KHQA 2VRRB 4AWJA 4IM2A 2I1KA 2WX0A 3KUDB 4IW0A 4MH0E 4DDID 3H6NA 2O6VD 1XD3B 2M1MA 3N30A 1E90A 2FUHB 2KNBA 3L0WB 1WMHB 2GBRA 2DZJA 2K25A 2MW5A 4KSKC 4W9EA 4W9DA 1U4AA 4YL8A 1J8CA 2EMTA 2WDTB 4ZDVA 4PS3A 3M95A 2BYFA 2LJ5A 2PPHA 2KOXA 4RM8A 4BKTA 4MGIE 2LXCA 4IWPA 1S3SG 4BOSC 4EFOA 5L95C 2KC2A 4E3CA 2NBUA 2A4ZA 2OOBB 1KM7A 2N9EB 4ICUA 4M8NA 2KTRB 3X0WA 3NY5A 4ICVA 2EMSA 3A9KB 2KQ7A 2D2QA 4W9KA 2MQJA 1P9DU 4I6NB 3IG3A 3VAWA 4I6LB 5CX3A 5AZHA 3TJPA 1V9JA 4TV3A 1WE7A 4W9IA 2LD9A 4W9LA 2KXJA 2KZRA 2UWQA 4ZRIA 4II2B 1C1YB 2MX2A 3I3TB 4II3B 3QCAA 3APCA 1WR6E 2GBJA 4KSLC 4MDKE 2JVCA 4IWOA 3JYUA 3OJ4B 5TR5A 4BKSA 1V86A 3QX1A 1PQSA 1UD7A 2LVOA 3M63B 5DPSA 2OJRA 4FN2A 3RYTA 1CMXB 2DYOA 3ZIMA 3RCZA 4KV2A 5HKHA 3M62B 2K8HA 3H7PB 1R4NI 3KW5B 2K6DB 3PT2B 2LGXA 3GOEA 3NOBA 1QZEA 1UBIA 3KH0A 2JT4B 2C7MB 3HIZA 1VD2A 4HCPB 2KD0A 2BWES 2LGYA 2J0JA 4WJQA 4KVGB 2KJ6A 2KDIA 4M0WB 2KDBA 1WXVA 4PYZA 1OTRB 4CHKA 3MTNB 4W9JA 3H9DA 3R3MA 2DYBA 3OLMD 1WIAA 3L13A 2LZ6A 3PHXB 1WF9A 2MP2A 3L10B 3C0RB 4FULA 4JLCA 5C1ZA 1EF1A 2MBEA 5CHVC 3DCGA 2IY1B 3PZDA 2CHWA 4IUMB 1GNUA 2DENB 2BKRB 2JRIB 2AWTA 3PVLA 2HD5B 4MGZE 3L16A 2Y5BB 3GZNI 3QHTA 3VFKA 3QJZA 4BKGA 3R66C 4PYUA 2O2VA 5KHOA 2ZEQA 3RT3B 1K8RB 3DVNU 2KMAA 2KFKA 3DBRI 3PV1A 4HXDA 1Q1OA 3WIMA 4KDLB 4ASWC 1YX6B 3NZSA 2LGDA 4G0NB 4WJOA 3V62A 3HHMA 3AXCA 4LDTD 4K81A 3L08A 2B3AA 3QIJA 1NI2A 5G55A 5IAAC 1L2NA 4DWFA 1RAXA 4K7UA 1OGWA 1YJ1A 2KFJA 2PE9A 2ZVNA 2C7HA 2ZJDA 3EC8A 2C9WB 3W1SA 3ZUNA 3W1SC 1EUVB 2N9PC 4IWQA 5D6JB 4MELA 1V80A 2MBOA 3WALA 4FBJB 2GMIC 2JPHA 4MSMB 3Q3FA
chains in the Genus database with same CATH superfamily
1WM3A 2WHIA 1HE8A 2MP2B 2B76B 4EZLA 1SF0A 2LWPA 1NI3A 5D7GA 1IP9A 2M56B 3N32A 1RLFA 1WI0A 4JE3B 4OZCA 5BO4B 3ETRA 1V5OA 1N6ZA 3OG5A 3RNGC 5DCNA 1VCBA 1WRDB 1C4PA 2JWZA 2LI5A 2BS3B 1QOFA 2MJDA 3AH7A 2K8CA 1TTNA 1E0ZA 2ZW0A 4EZKA 2MWSB 2INPE 3SEBA 2KAJA 4JWSC 4LNFA 2V3PA 4PT5A 3Q69A 3ZTDA 4ZYSA 2J7QB 1PGXA 4K3BA 1GB4A 3ZLZA 1ZXHA 4KZCA 2N9KA 1M94A 1EU3A 4MJSA 1WGYA 4FJYA 5AZGA 3ZDTA 4DHJB 3AULA 4OVVA 3SD5A 3DVGX 1UGJA 4YWGG 2LUEA 3BY4B 4HWIB 3LDZE 4MEMA 2FE8A 2CHXA 3TMPB 4XWWA 1QLBB 4A3OA 3IVFA 4EKUA 5EDSA 4NQLB 4AP4C 3M3JA 4WWOA 1SEBD 3PREA 4ZHOA 2R2OA 3PRPB 5AUIA 1ISNA 1QF6A 1EM7A 2AEHA 3URYA 2PIAA 4AJYB 3ZJUA 4QAYA 3RNEC 2NCNA 2KJHB 4BOZB 4HKZE 1YIWA 4AS1A 1L0XB 5BYRA 3MC9A 2L1AA 3W1YA 1EU4A 1NBFC 2MJ3A 4IG7B 2LRUA 1DYQA 4N59A 3ZNID 5JH5C 3NG0A 1J7AA 4A6QA 4TQ0A 1XO3A 4WAFA 1WH3A 3KYDD 3NZ3A 2CJNA 1MI0A 4XC2A 1FRRA 1YX5B 2I38A 3PS6A 1V6EA 5E6PA 3U52E 4GSWA 2HTME 1WRIA 2JF5A 1L4ZB 4K3CA 3AEGB 2WXQA 1Q10A 2VH2A 3TBLD 2M17A 1HEZE 2W54A 4C56C 3DHHC 1WYWB 1ESFA 4MSQB 2REXA 1XF5L 1YD8U 1ZPSA 2R2QA 4A20A 2Y3AA 1JALA 3DBSA 2MBQA 2DZIA 1V81A 4OZBA 2DYMA 1MG8A 3A1QB 3KLSX 2UYZB 3ECIA 3BYTB 3TEWA 4D2KA 3DWMA 1HXYD 1E5WA 2XK5B 1ZP0B 5JZEB 4CO7A 3B0AA 2WXJA 2C7NB 3SFEB 4BAXA 2FCQA 4YSZB 3SHQA 2M8SA 1Q0WB 1ZGUB 4OVUA 3A9JB 2J0KA 2WDQB 4YTPB 3CSTA 1JMLA 1QOBA 3BYYB 1EF5A 3AEEB 1EWCA 3W2DA 4WQOB 4LNNA 1PFDA 2AYOB 3ZKJC 4HPPA 4HLEA 1BUIC 1IYFA 4HKQA 2N4FA 2IO1B 1UF0A 1AARA 2WXLA 1FFUA 1OEYA 2PEAA 3B9JA 2QMTA 2N1WA 2O6VB 2KC1A 1SE4A 4W9CA 3R7RA 2INCC 1YQ4B 3Q3JA 1HA5A 4GDLB 2KWCA 1STEA 2LASA 4XX5A 4OZAA 4F7ZA 1NDDA 1VLBA 4P1CC 1WMHA 1E8ZA 1P3QU 2KK8A 2GBNA 1UBQA 2OJWA 4DHJD 5JHAA 2FUG1 4YTMB 1RFKA 2FAZA 1ZOYB 1XLQA 2BWFA 3TUOA 1LM8B 1ZDXA 4URKA 4MH8A 3A9KA 4IC7B 3AN1A 2NPTB 4M00A 2CU1A 1TBEA 1V1OA 3PLUA 2DBYA 2ZNVC 1FIQA 1UGMA 5HHDG 2INNE 3A4SC 4GOCA 4FA6A 3ABVB 1JRPA 3VR9B 3AECB 2BB5A 1NYQA 1KJTA 1I7HA 2M19A 2VRRB 4IM2A 2K22A 3H6NA 2FUHB 1F0ZA 1TY2A 1WSPA 4ZDVA 3M95A 4M0WA 2D3CA 4MGIE 4EFOA 1FNVA 1KTKA 2V4IB 2JYEA 3X0WA 3NY5A 3FC4A 1ET6A 4W9KA 4ARIA 3RPFC 4I6LB 1YN4A 3TJPA 2PW9A 4TV3A 3ZGZA 2UWQA 2MX2A 3AE1B 2JVCA 4IWOA 3OJ4B 1GOZA 1UD7A 3M63B 3RYTA 3EFCA 3ZIMA 3RCZA 4KV2A 1XCQL 3R2TA 2K8HA 1R4NI 2K6DB 2LGXA 2JT4B 3HIZA 1DOXA 2L32A 4REZA 5H8YE 4WJQA 4C7ZA 2KJ6A 1TKGA 4PYZA 4L23A 1CZPA 3L10B 2IGDA 3C0RB 1D5XC 2MBEA 2IY1B 3Q3OC 3PZDA 3AE7B 3AE6B 3R8BA 2HD5B 3L16A 3GZNI 1I4RA 1JWUD 1E7PB 2O2VA 1PGAA 2K5PA 2QCZA 4KDLB 1JROA 1V1PB 4WQMA 2JSVX 1XLOA 2J52A 5G55A 4XYCA 3Q8EA 5GXGB 2C9WB 1SSNA 3W1SA 2N9PC 2MHJA 4IWQA 5D6JB 2WGSA 1V80A 3RN9C 3WALA 4FBJB 2JPHA 3HVZA 4MSMB 3Q3FA 3KVFB 2SEBD 2XK5A 2KX0A 2CU3A 3RUIB 3TSSA 3U30A 1G6JA 3B2FA 1WX8A 1DGJA 5AEKB 1SIJA 2WQYB 4EZJA 2IYDB 1JWSD 4N58A 1BMLC 3HRDD 1ZW7A 1WXAA 1UWMA 4HDQA 5FR6A 3RZFA 2LMCA 4RFBA 1FMAD 1FXIA 4AUQC 1E8XA 3QC8B 2I1JA 2N1VA 2IO3B 4HPMB 3BINA 1F52A 2J0MA 3NZUA 2NR2A 5LXIB 4JIOU 1VR9A 3K9PB 2GB1A 3DWGC 1AYFA 3V6CB 4X57B 2CHZA 5T8IA 2MA9B 1T0QC 2D3AA 1WXMA 4ANVA 3ZDMC 2SAKA 3IFWB 3SU8X 4IM3A 5BMHA 3VUXA 1C3TA 2O6VA 1IBXA 2WS3B 4KIKB 1Z2MA 3QARA 1MVKA 1IGDA 2KQSA 4WJNA 1TIFA 4HDOA 3UIOB 2GI9A 2PE6B 2RGFA 2D3BA 3U8ZA 2QDFA 1L4DB 1NEKB 3AM9A 1ZUD2 3Q3MC 5EE9A 3VR8B 2KWUB 4NJ6A 3QA8A 3RZWC 4JQWC 2XN9C 4K1RB 1MPEA 2FCMA 1R4MB 2M0XA 3RNCC 3ALBA 4G3XB 1YQ3B 2MSED 4NAMA 3RNFC 1TS4A 2MRPA 3ML9A 3ENEA 2KVRA 3MHZA 2PJHA 3DHIC 2W55A 2KYWA 2K39A 4WWPA 1GC7A 2BT6A 1RRBA 2FBWB 5DPRA 1N61A 2K6QA 3UGBB 4TMAB 3BVMA 3UF8A 3ZJVA 4GB9A 3W5UB 1VRAB 2WXHA 4PS7A 3FILA 4LCDE 2JY6A 3GB1A 3DQVA 2ZPNA 3APDA 3H7SA 3P1MA 2V4LA 3ZO5B 4AOFA 4LNKA 1IPGA 5C23A 2IBIB 4LJPB 1LO5D 1H8CA 3DDCB 2NTSA 3GE3C 2LGIA 3X23A 3KYCD 2NVUI 2ICIA 2AQ3B 3PO0A 2ASQA 3DBLB 3RD2A 3BVZA 1JWBD 2V3SA 1TYGB 4BKSD 1Q5WB 2MLBA 4G11A 4KDIC 4ZYNA 4B95A 2K0PA 2G4DB 1GAQB 3LJ3A 4GU2A 3BVGA 3JVZX 1GPXA 2IGHA 2CR5A 1OEYJ 1VZ7A 2ZPYA 4CQNA 1YOVB 3LXFA 4ARCA 2N7JA 1WR1A 2BYVE 2W3SA 3T8MA 4A8XC 4DXGA 3OJ3A 1V2YA 4LDTB 1F2RI 3IBEA 3TCAA 2GBMA 3VUYA 3QK0A 3GE8C 1E7VA 2JRHA 1YQBA 4R3DA 4BVUC 2V9HA 2ZCCA 3PZ8A 1MHXA 4B0EA 4RM9A 3PPAA 3KUCB 4MGKE 4DBGA 2JZPA 2Y5PA 1J0GA 4WH4A 1UH6A 2LXAA 5FKAC 3ZXRA 5TSSA 2ON8A 3HM6X 4ZRKA 1LFDA 4FLHA 3ZTCA 5E6NA 1T0RC 1CJEA 1WE6A 2LFIA 2N9LA 3VH3B 5HFYA 4F8CB 1Y8RC 1WM2A 2V1YA 4J3OD 1L0YB 2MH7A 4JPSA 5LXHA 3WANA 2LJIA 4NAWB 1SE3A 2NBWB 5DPTA 2GBKA 3Q2AC 2Z59B 3C8YA 3JSVB 1DOYA 2JXXA 1JQ4A 5EE3A 3TIXA 1M4VA 2KLCA 3ZQ4A 2CKHB 1TT5B 2MCNB 2KTRA 3HK0A 3LYYA 1ZKHA 1J19A 2RR9A 2XBBC 2RPVA 1P98A 2KWDA 2ZCBA 3BWUD 1WJ4A 1PUTA 4XDCA 1RYJA 3MC0B 4KGRA 2NMQA 3VTUA 3NUHB 1F9JA 1JRUA 1ROEA 4USAA 3B08A 4OHJA 5HI1A 2WX1A 4M8MA 3N3KB 3N9YC 1FEHA 5L83A 5KHQA 3ZJTA 1CK1A 3IT6B 2QSDA 1FNWA 2WX0A 4MH0E 3N1YC 1XD3B 4KSKC 2KNBA 4JX1C 1NVID 4MT5A 4PS3A 2LJ5A 2PPHA 4KGSA 2LXCA 2YEPB 1S3SG 4BOSC 1F1HA 1B9RA 1I4GA 2EMSA 2OEDA 2D2QA 3Q6BA 3RNBC 3VRBB 4I6NB 3VAWA 4B0MA 4ITKA 2KXJA 2JWUA 2KZRA 5BMIA 1C1YB 3APCA 4KSLC 2GBJA 1MJDA 2Z8LA 3JYUA 1V86A 1PQSA 2OJRA 1TY0A 2Q5WD 1CMXB 3Q14C 3H7PB 1JCKB 2KACA 1QZEA 1VD2A 2XNAC 1MG4A 4KVGB 2W82A 3NVWA 2VH1A 1WIAA 4IKGA 2MP2A 4KKIA 4JLCA 5IOIA 3W5VB 5CHVC 4MM3B 4RCOA 2WXRA 1F2RC 3AEBB 4WURA 2BKRB 2AWTA 4MGZE 2Y5BB 3AE4B 3QHTA 3TEXA 4BKGA 3U4EG 2WDVB 1K52A 1T5XD 3DVNU 2KMAA 5EE1A 4HXDA 4LK0M 4ASWC 4AQ7A 1C78A 2D5GA 3HHMA 1XXGA 4LDTD 3VRAB 3L08A 2B3AA 1KRHA 4DWFA 3WCQA 2WXKA 2WNMA 2C7HA 3W1SC 3EGRA 1WGKA 1C77A 1C9FA 4MELA 2GMIC 1JW9D 3RFZB 1KOTA 2KO3A 1L6VA 3S2AA 1SE2A 3BZDB 3UI3A 3J9CA 4DXAB 2KWVB 2X38A 4RH6A 4LNOA 1TKYA 2IO0B 2INDC 1UNSA 1WFYA 4FJZA 2NBVB 1YJJA 3K9OB 2TSSA 2JUOA 4C4VB 2BKFA 2LRWA 3UQAA 1WXSA 5IP4D 3CIRB 2MBHA 1T0YA 1Y56A 2L0TA 5AZFA 3VQIA 3AI5A 2AL3A 5C3JB 1WGDA 3SR6A 1N63A 4WJPA 1OQYA 3PGEA 1BT0A 1TS3A 1TKEA 4WIPA 2KMMA 2HE7A 1SBBB 4W9GA 3UIPB 1TS5A 4NY0A 2AQ2B 5JHBA 1I42A 3RMKC 1NENB 2RPQA 4A55A 1A70A 2H89B 1Z5SB 2RDBC 2RDHA 3CMMB 4WAAA 4NAWA 1J7CA 4MACA 3MJWA 2R61A 4AJWA 5DPWA 1K51A 3O13A 1P0RA 3E56A 4RGOS 4HVBA 3TEYA 2BVCA 1WZ0A 2FCNA 2LEKA 1VZ6A 4WWNA 2YLMA 1WJ6A 4P7IA 5JXVA 3AE8B 2KJRA 2KN5A 1WYGA 2I2YA 2KDFB 1YJIA 2BTEA 4HJKA 4C7YA 4E74A 3FKYA 2DX5B 3EUB2 3OAWA 3PLVA 3KUZA 4LTUA 1FNUA 1I4XA 2RD0A 2L83A 2A5UA 5C2TB 4GIVA 1P7FA 5J2RA 4B9KA 2L52A 2IJ0A 1ZDVA 4ANUA 2JZ3B 2Z0EB 4M01A 3A1QA 5IO9A 2XEWA 3AE3B 2JXTA 2QC8A 5BYQA 1E10A 1E7UA 1TZ1A 5D94A 1GG3A 3EECA 4GXBA 4GN1A 3HM3A 1KH0A 1CQVA 3IHPC 4HK2A 3AEAB 4FJVB 3MC8A 1V5TA 4TUUA 4TSSA 2L7RA 3NVYA 1XQQA 4G50A 4BFRA 3R7QA 3Q8CA 2AL6A 5EE0A 3AMZA 1I4HA 3A9JA 4P6VF 3AE9B 1YMHE 3ZRCA 1UZXB 4GMVA 5CHWA 1T0SC 4BZAA 2G4SA 3H7PA 4W9FA 2KMCA 3DVGY 3P42A 4ZRJA 2DZKA 1HZ6A 1FRDA 5D3IB 2L3ZA 2D07B 2JX5A 5IN7A 4HPLB 1X1MA 3BIID 3VHTC 1ACCA 2LHDA 3O65B 3P2BA 2N7EA 3T3OA 1L6UA 3PTFC 1I4PA 1ZXIA 3I57A 3W9CB 4MM3A 4US8A 3EA6A 3UQBA 4GDLA 2W3RA 2GRIA 1KLVA 4YSYB 3VVWB 4EOYA 2KTFA 4IM0A 1J7BA 4A9AA 2BF8B 2KX3A 1WGRA 1TGZB 2FNJB 4F1SA 1GUAB 1WGGA 4FHJA 3MFGA 1OQRA 1V8CA 2DHZA 1C76A 4HROA 1N62A 2G45B 4RF0A 3DBLI 2NPTA 5LLIA 4RGTA 4RGNA 4DXFA 1F77A 3DPDA 3NS8A 2L8JA 2H88B 1WX7A 5LNK1 3CF6E 1MFWA 3DBHB 1N5WA 1QILA 2EKIA 4S0RA 1R7SA 1QOAA 2UU7A 3DOWA 4ZHPA 1OFFA 2D11A 1WGHA 3V6EB 4B6WA 1GB1A 1A5RA 4NJCA 4YT0B 1WJNA 3IXSA 1T6BX 1RWSA 3B1LX 4KKJA 2FCSA 3L54A 3L17A 4NNJB 3QQ8B 2BGFA 2HDEA 4GDKB 4HEA1 2PVGC 1V49A 4K7SA 2HTHA 3P4RB 2BS2B 2DZMA 4W9HA 1LXDA 3QWZB 1SIFA 3VTWA 3KWVA 3ML8A 2HJ8A 4FADA 2HJ1A 2K8BA 3MP9A 1D5ZC 3PSEB 3QAQA 3ZXVA 4AWJA 4IW0A 3KUDB 1K53A 2GLSA 3N30A 3L0WB 4W9DA 1WMHB 2GBRA 2DZJA 2K25A 2MW5A 4YL8A 4ZOHC 1J8CA 1U4AA 2NTTA 1QQRA 1UWXA 2EMTA 2BYFA 1EWYC 2KOXA 3FAHA 4IWPA 4OVZA 2KC2A 3NVVA 2NBUA 1KM7A 4P1BC 2V0GA 4M8NA 4ICVA 3A9KB 4XE0A 1N5XA 2KQ7A 1P9DU 3L4PA 3DBRB 1TS2A 5CX3A 1V9JA 4W9LA 1WE7A 2JYTA 4ZRIA 1FXAA 2AX5A 4II3B 3QCAA 5I4DA 4ZRPA 4MDKE 1VDVA 5G5GA 4BKSA 1V1PA 2LVOA 5DPSA 1DOIA 2ACZB 2G9HD 1C4CA 3M62B 3KW5B 2QEJC 4L1BA 1BXTA 1UBIA 3KH0A 3RNAC 2C7MB 2J42A 3AE2B 5MPOA 2BWES 1YN3A 2LGYA 2J0JA 1E9MA 1XLNA 4M0WB 2KDBA 1WXVA 1OTRB 3I9V1 3MTNB 4CHKA 4W9JA 2WDRB 3H9DA 3R3MA 2DYBA 1TZOA 2LZ6A 3PHXB 4FULA 3P63A 5C1ZA 1GNUA 4ZRQA 2DENB 3U2SC 3NVZA 3QJZA 3R66C 5KHOA 2ZEQA 1K8RB 4HJGE 3PV1A 2IPKD 1E6EB 4M02A 3V3XA 1YX6B 4YSXB 4G0NB 1P7EA 4WJOA 3V62A 3SFDB 4K81A 2MJEA 3HVDA 5IAAC 1L2NA 1RAXA 4OW0A 1OGWA 2PE9A 2ZVNA 2ZJDA 1EUVB 4KX6B 4RF1A 2MBOA 1WWTA 1KF6B 3I5JC 2WU2B 3H8HA 2WXIA 1KFYB 3NJTA 2KDEB 5CHFA 2CS4A 1IUEA 3A4RA 2WU5B 2N7DA 4A3PA 2W9NA 4P16A 4EEWA 4KIKA 2BQQA 2O2VB 1E8YA 2C60A 2VZKB 3VUWA 3WA0A 2LUMA 2ONQA 4LNIA 1FM0D 3R2IA 2MBBB 1YNTE 2BYTA 1I35A 4IOIE 2ZVOA 2WWZA 1N60A 3H1UA 4C00A 2IZVB 2WXFA 2EKEC 2KANA 2RMMA 2OHFA 3AEFB 1LQBA 1FO4A 4WWMA 3VDZA 2K9XA 1KLGD 2ZNVB 3T9LA 2X8XX 4DHZE 2DAFA 2BW2A 1VZ8A 1EO6A 1HTOA 4PS8A 1UELA 3T3NA 2YEPF 3A33B 4XGAB 4FHKA 1FXTB 3I63C 1XT9B 1ENFA 5HG2A 3VXWA 4YTNB 1SJED 3ZNZB 3ZNGC 4I6PA 3SDLC 3CSFA 3WAOA 1QT9A 5CTRC 5AUKA 3OWEB 1XLPA 3KQ4A 4ANWA 4NJ7A 4NPNA 2Z0DB 2QHOA 4GDKA 3GP7A 4E71A 1FFVA 2Y5CA 1C4AA 1RFAA 3Q3NC 3U7ZA 3IAM1 1PGBA 2WXPA 4PK1A 1KLUD 2C5LC 4C80A 4LLGM 4O1NA 2IY0B 3V60A 3AEDB 1IBXB 1GJZA 1V97A 3N1ZC 2DLBA 2PKOA 3DHGC 3LB8C 1VJKA 5G5HA 4KZ0A 2D10A 2RDGA 3N20C 3PRMB 4BBNF 4JGHB 1GC6A 2IDYA 3U7DA 5J18A 1JWAD 2M4NA 2RSUA 2ZW1A 3ZW3A 3V61A 1PDXA 2NS5A 2PVOD 1SGHA 3C19A 1UUPA 1QKZA 2J4XA 2DNFA 2FIDA 4JL9A 2JQRB 3EFUA 2PMVA 2L05A 1MHHE 3AB5A 4J6IA 4HRSA 2K3UA 2KFKB 3AU4A 3D32A 4JWUC 3TL5A 1ET9A 3MJ5A 5GMVA 3VTVA 1WY8A 2KHWB 4HCNB 2FIFA 2KKCA 4MGYE 2BPSA 3Q8FA 2D3GA 3IAS1 3BK2A 2L0FA 3NRZA 4LJOB 2GOWA 1YN5A 3FILB 1TJEA 4US9A 4YXDB 2BYEA 1WJUA 3BK1A 1SJHD 4TKNA 1SB3C 4NZLB 3WAMA 4GGQA 1FCLA 2WP9B 3P4SB 4N6EB 4BBNC 4CYEA 2PTLA 1QOGA 2QJLA 2DWQA 4EE2A 2ZZPB 2WXOA 1E8WA 3ZNHB 1S1QB 3JSVA 1FD6A 4RNAA 2KQ4X 2LVPA 1HTQA 2WYQA 4DHZB 2N9XA 4N9F4 2KDMA 4XWTA 3B2GA 2VZKD 5J17A 1L5PA 4TQ1A 4IDIA 4DDGD 2LVQA 4XZ4A 1T3QA 4NQKE 3PHWB 4K7WA 3AU5A 4L2YA 1D4BA 3NHEB 2QILA 3HUIA 1D3ZA 2G3QB 2WXGA 2AQ1B 3EHVA 3Q8BA 5FR3A 3APFA 3PRZA 1RM6C 3Q8AA 5D2MB 1WZ3A 4MJSB 5G2NA 5IA7A 3CWIA 2BS4B 2DAJA 2WXNA 1B1ZA 4RMAA 2KN4A 5E6OA 4ANXA 5BYSA 3DVNV 2L00B 4DK5A 3JW0X 2YVCA 5IKCM 1H4RA 2JZZA 1P1AA 1NYRA 4EUTA 1I4QA 3KWLA 2L76A 1SXTA 4S17A 3ONSA 3RULA 4RGMA 3ZRFA 2MEKA 1L7YA 1FCCC 4ACFA 1SE9A 3MHSD 1R4MI 1IGCA 2KLGA 1AN8A 2IO2B 1WX9A 1ZE3D 4Q2JA 3UINB 2LHEA 2K1FA 3VH4B 1R4NB 3PZ7A 3ZVVA 2KT7A 3P4QB 5H92C 3N1XC 3IT4B 3DBHI 1LGRA 2KVZA 3WAPA 2E3TA 2LGSA 2I1KA 4DDID 2O6VD 2M1MA 1E90A 4W9EA 1HZ5A 2PLPA 2G1EA 2WDTB 2JU6X 4RM8A 4BKTA 5L95C 1D5MC 1D6EC 1WXQA 4E3CA 2OOBB 2A4ZA 1AW7A 1OQQA 4FXCA 2N9EB 4DQOC 4ICUA 2KTRB 3GZNB 2EELA 1JWMD 4A90A 1C79A 4KGTA 2MQJA 3E9SA 3IG3A 2V3NA 5AZHA 3TEZA 5FK9C 4W9IA 2LD9A 4II2B 3GS2A 3I3TB 1WR6E 5TR5A 3V05A 3QX1A 1FPYA 4FN2A 3RI7C 4UDUC 2DYOA 1XEEA 5HKHA 3PT2B 3GOEA 3NOBA 1XCTL 5E6JA 4HCPB 2KD0A 1K50A 2KDIA 3AV8A 3P4PB 3OLMD 3L13A 2J53A 1WF9A 1EF1A 3DCGA 4XDDA 2CHWA 4IUMB 2JRIB 3PVLA 2M0AA 2QIEB 5BMGA 1HQRD 2N0SB 3VFKA 1PYWD 4H2AA 4PYUA 3RT3B 1L0VB 2BBCA 2KFKA 3DBRI 3ZYYX 1AWDA 1Q1OA 3WIMA 3NZSA 2LGDA 3AXCA 4C4VA 2WLBA 3QIJA 1NI2A 4K7UA 2WXMA 1YJ1A 2KFJA 3EC8A 2E6XA 2BB6A 5D3DA 3AE5B 3ZUNA 4GLSC 3NS1A 2IGGA 2CJOA
chains in the Genus database with same CATH topology
1KOTA 1WM3A 2KO3A 3KVFB 1HE8A 2XK5A 2KX0A 3S2AA 3RUIB 3U30A 2MP2B 2KDEB 1G6JA 5CHFA 1WX8A 4EZLA 4DXAB 5AEKB 2LWPA 2CS4A 5D7GA 2KWVB 4EZJA 3A4RA 1IP9A 2IYDB 3N32A 1RLFA 2N7DA 4A3PA 2IO0B 2W9NA 4EEWA 1WI0A 4KIKA 1WFYA 1ZW7A 4FJZA 1WXAA 2O2VB 1E8YA 4HDQA 2NBVB 2C60A 5FR6A 5BO4B 3VUWA 3WA0A 3RZFA 1V5OA 3K9OB 2JUOA 4AUQC 5DCNA 1VCBA 1WRDB 1E8XA 2BKFA 2I1JA 2JWZA 2IO3B 2LRWA 2LI5A 2MBBB 2N1VA 3QC8B 1WXSA 4HPMB 3UQAA 1I35A 2ZVOA 3BINA 2WWZA 2MBHA 1T0YA 2L0TA 5AZFA 3VQIA 2J0MA 2K8CA 3AI5A 1TTNA 2AL3A 3NZUA 3H1UA 2NR2A 5LXIB 1WGDA 2IZVB 4JIOU 4EZKA 4WJPA 2EKEC 3K9PB 1OQYA 2KANA 3PGEA 2MWSB 3V6CB 1LQBA 3VDZA 1BT0A 4X57B 2CHZA 2ZNVB 2MA9B 1WXMA 4ANVA 3ZTDA 3ZDMC 2HE7A 4W9GA 3UIPB 2J7QB 3IFWB 4NY0A 3SU8X 4IM3A 5JHBA 3T9LA 3ZLZA 4KZCA 2DAFA 2O6VA 3VUXA 4DHZE 1C3TA 1EO6A 4PS8A 1M94A 1I42A 1UELA 2RPQA 4MJSA 1WGYA 4FJYA 3A33B 4KIKB 1Z2MA 4FHKA 3QARA 1FXTB 1Z5SB 1XT9B 5AZGA 3VXWA 3ZDTA 4DHJB 3AULA 3CMMB 4WAAA 4NAWA 3ZNZB 4OVVA 3MJWA 3DVGX 4I6PA 3SD5A 3ZNGC 3SDLC 2KQSA 3CSFA 4WJNA 4HDOA 3UIOB 4AJWA 2LUEA 5DPWA 3BY4B 4HWIB 3LDZE 2PE6B 2RGFA 4MEMA 3WAOA 2CHXA 1P0RA 3TMPB 4HVBA 4A3OA 5CTRC 3U8ZA 3IVFA 4EKUA 1WZ0A 5EDSA 2KWUB 4NQLB 2FCNA 4AP4C 4NJ6A 4ANWA 3M3JA 4WWNA 4WWOA 4NJ7A 3QA8A 3PREA 4NPNA 3RZWC 2YLMA 4JQWC 1WJ6A 2Z0DB 4K1RB 2QHOA 2R2OA 4GDKA 2FCMA 4P7IA 3PRPB 2M0XA 4E71A 3ALBA 1ISNA 2AEHA 2KJRA 2KN5A 2MSED 4G3XB 4AJYB 2KDFB 4HJKA 1RFAA 4E74A 2DX5B 2NCNA 2KJHB 3OAWA 3PLVA 4BOZB 2C5LC 3KUZA 2RD0A 1YIWA 2A5UA 2MRPA 2IY0B 3ENEA 3ML9A 3V60A 2KVRA 1GJZA 3W1YA 2PJHA 1NBFC 4IG7B 4GIVA 2K39A 4WWPA 5J2RA 1GC7A 4B9KA 2LRUA 1RRBA 4ANUA 4KZ0A 2JZ3B 3ZNID 2Z0EB 5DPRA 5JH5C 2D10A 3A1QA 2K6QA 2XEWA 3UGBB 3PRMB 4BBNF 4JGHB 3UF8A 1GC6A 4TQ0A 1E7UA 4GB9A 1WH3A 1TZ1A 3KYDD 5D94A 3U7DA 5J18A 1GG3A 3EECA 4GXBA 4PS7A 2M4NA 4XC2A 2RSUA 4LCDE 2JY6A 4GN1A 1YX5B 3HM3A 3V61A 3ZW3A 3PS6A 1V6EA 5E6PA 2NS5A 3IHPC 3DQVA 4HK2A 2ZPNA 3APDA 3H7SA 4FJVB 1SGHA 1V5TA 4TUUA 2V4LA 3ZO5B 4AOFA 4GSWA 2L7RA 1IPGA 5C23A 1XQQA 4G50A 2JF5A 4BFRA 2FIDA 3R7QA 4JL9A 2IBIB 4LJPB 3EFUA 2AL6A 2L05A 3TBLD 2M17A 4J6IA 2KFKB 3AU4A 3DDCB 1H8CA 3A9JA 3D32A 3TL5A 1WYWB 3X23A 3KYCD 4MSQB 2NVUI 3ZRCA 2REXA 1UZXB 4GMVA 5CHWA 5GMVA 3VTVA 1WY8A 1YD8U 2KHWB 2R2QA 4A20A 2ASQA 4HCNB 3RD2A 3DBSA 2G4SA 2FIFA 2DZIA 1V81A 2MBQA 3H7PA 4W9FA 2KMCA 2KKCA 3DVGY 4MGYE 2DYMA 2BPSA 1MG8A 2V3SA 3A1QB 2UYZB 4ZRJA 4BKSD 1Q5WB 2D3GA 2L0FA 2DZKA 4LJOB 2MLBA 3ECIA 4G11A 2GOWA 2L3ZA 4KDIC 2D07B 4ZYNA 4B95A 4HPLB 1X1MA 2G4DB 3VHTC 3O65B 3P2BA 1E5WA 2XK5B 5JZEB 2BYEA 2N7EA 3LJ3A 4GU2A 1WJUA 3JVZX 4TKNA 4CO7A 3PTFC 3B0AA 2CR5A 1OEYJ 3WAMA 4GGQA 2ZPYA 2C7NB 1WR1A 2BYVE 4MM3A 3T8MA 4BBNC 4CYEA 3OJ3A 2FCQA 1V2YA 3UQBA 4LDTB 3SHQA 2M8SA 4GDLA 3IBEA 3TCAA 3VUYA 2GBMA 1Q0WB 1ZGUB 2ZZPB 3QK0A 1KLVA 3VVWB 1E8WA 4OVUA 4EOYA 2KTFA 4IM0A 3A9JB 2J0KA 1E7VA 2JRHA 3ZNHB 2BF8B 1YQBA 1S1QB 2KX3A 3CSTA 1WGRA 1TGZB 3JSVA 4BVUC 1EF5A 2LVPA 2ZCCA 2FNJB 2WYQA 4F1SA 1GUAB 1WGGA 2N9XA 4DHZB 4RM9A 4FHJA 4N9F4 3PPAA 4WQOB 5J17A 3KUCB 4TQ1A 4MGKE 4DBGA 2AYOB 2DHZA 3ZKJC 1J0GA 1UH6A 2G45B 2LXAA 3DBLI 4DDGD 4HLEA 2LVQA 2NPTA 5LLIA 1IYFA 2N4FA 4XZ4A 2IO1B 4NQKE 3DPDA 3NS8A 3PHWB 4K7WA 3HM6X 1AARA 3AU5A 2L8JA 3NHEB 4ZRKA 1WX7A 1OEYA 2PEAA 3CF6E 1LFDA 4FLHA 1D3ZA 3ZTCA 2G3QB 2N1WA 3EHVA 3APFA 5E6NA 3PRZA 2O6VB 1WE6A 3DOWA 2KC1A 3VH3B 5D2MB 1WZ3A 4MJSB 4W9CA 5G2NA 4F8CB 1Y8RC 3R7RA 5IA7A 1WM2A 2V1YA 2D11A 3Q3JA 1WGHA 2KWCA 4GDLB 3V6EB 4B6WA 5LXHA 3WANA 4NAWB 2LASA 1A5RA 2DAJA 4XX5A 2NBWB 5DPTA 4RMAA 5E6OA 4ANXA 2GBKA 1NDDA 4F7ZA 1WJNA 3DVNV 2L00B 4DK5A 1WMHA 2Z59B 1E8ZA 3JSVB 3JW0X 1P3QU 2JXXA 2KK8A 2YVCA 1H4RA 2GBNA 1UBQA 2JZZA 3B1LX 1P1AA 3TIXA 2KLCA 4DHJD 2FCSA 4EUTA 3L54A 3L17A 4NNJB 3QQ8B 5JHAA 2L76A 2BGFA 2FAZA 4GDKB 2CKHB 3ONSA 2MCNB 2BWFA 3RULA 1LM8B 1V49A 4K7SA 2KTRA 2HTHA 3HK0A 3ZRFA 4URKA 1L7YA 3A9KA 4IC7B 1ZKHA 2NPTB 1J19A 2DZMA 4W9HA 2RR9A 1LXDA 3QWZB 1SE9A 2XBBC 1P98A 3MHSD 2CU1A 1R4MI 1SIFA 3VTWA 2KLGA 1TBEA 2ZCBA 3PLUA 1WJ4A 2ZNVC 3ML8A 2IO2B 1WX9A 2HJ8A 3VTUA 1UGMA 3UINB 3A4SC 4GOCA 4FADA 1F9JA 4FA6A 1JRUA 2K1FA 3VH4B 3ZVVA 3B08A 2K8BA 2WX1A 3DBHI 3PSEB 4M8MA 1KJTA 3N3KB 3QAQA 5L83A 3WAPA 5KHQA 2VRRB 4AWJA 4IM2A 2I1KA 2WX0A 3KUDB 4IW0A 4MH0E 4DDID 3H6NA 2O6VD 1XD3B 2M1MA 3N30A 1E90A 2FUHB 2KNBA 3L0WB 1WMHB 2GBRA 2DZJA 2K25A 2MW5A 4KSKC 4W9EA 4W9DA 1U4AA 4YL8A 1J8CA 2EMTA 2WDTB 4ZDVA 4PS3A 3M95A 2BYFA 2LJ5A 2PPHA 2KOXA 4RM8A 4BKTA 4MGIE 2LXCA 4IWPA 1S3SG 4BOSC 4EFOA 5L95C 2KC2A 4E3CA 2NBUA 2A4ZA 2OOBB 1KM7A 2N9EB 4ICUA 4M8NA 2KTRB 3X0WA 3NY5A 4ICVA 2EMSA 3A9KB 2KQ7A 2D2QA 4W9KA 2MQJA 1P9DU 4I6NB 3IG3A 3VAWA 4I6LB 5CX3A 5AZHA 3TJPA 1V9JA 4TV3A 1WE7A 4W9IA 2LD9A 4W9LA 2KXJA 2KZRA 2UWQA 4ZRIA 4II2B 1C1YB 2MX2A 3I3TB 4II3B 3QCAA 3APCA 1WR6E 2GBJA 4KSLC 4MDKE 2JVCA 4IWOA 3JYUA 3OJ4B 5TR5A 4BKSA 1V86A 3QX1A 1PQSA 1UD7A 2LVOA 3M63B 5DPSA 2OJRA 4FN2A 3RYTA 1CMXB 2DYOA 3ZIMA 3RCZA 4KV2A 5HKHA 3M62B 2K8HA 3H7PB 1R4NI 3KW5B 2K6DB 3PT2B 2LGXA 3GOEA 3NOBA 1QZEA 1UBIA 3KH0A 2JT4B 2C7MB 3HIZA 1VD2A 4HCPB 2KD0A 2BWES 2LGYA 2J0JA 4WJQA 4KVGB 2KJ6A 2KDIA 4M0WB 2KDBA 1WXVA 4PYZA 1OTRB 4CHKA 3MTNB 4W9JA 3H9DA 3R3MA 2DYBA 3OLMD 1WIAA 3L13A 2LZ6A 3PHXB 1WF9A 2MP2A 3L10B 3C0RB 4FULA 4JLCA 5C1ZA 1EF1A 2MBEA 5CHVC 3DCGA 2IY1B 3PZDA 2CHWA 4IUMB 1GNUA 2DENB 2BKRB 2JRIB 2AWTA 3PVLA 2HD5B 4MGZE 3L16A 2Y5BB 3GZNI 3QHTA 3VFKA 3QJZA 4BKGA 3R66C 4PYUA 2O2VA 5KHOA 2ZEQA 3RT3B 1K8RB 3DVNU 2KMAA 2KFKA 3DBRI 3PV1A 4HXDA 1Q1OA 3WIMA 4KDLB 4ASWC 1YX6B 3NZSA 2LGDA 4G0NB 4WJOA 3V62A 3HHMA 3AXCA 4LDTD 4K81A 3L08A 2B3AA 3QIJA 1NI2A 5G55A 5IAAC 1L2NA 4DWFA 1RAXA 4K7UA 1OGWA 1YJ1A 2KFJA 2PE9A 2ZVNA 2C7HA 2ZJDA 3EC8A 2C9WB 3W1SA 3ZUNA 3W1SC 1EUVB 2N9PC 4IWQA 5D6JB 4MELA 1V80A 2MBOA 3WALA 4FBJB 2GMIC 2JPHA 4MSMB 3Q3FA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1KOT A;  1WM3 A;  2KO3 A;  3KVF B;  1HE8 A;  2XK5 A;  2KX0 A;  3S2A A;  3RUI B;  3U30 A;  2MP2 B;  2KDE B;  1G6J A;  5CHF A;  1WX8 A;  4EZL A;  4DXA B;  5AEK B;  2LWP A;  2CS4 A;  5D7G A;  2KWV B;  4EZJ A;  3A4R A;  1IP9 A;  2IYD B;  3N32 A;  1RLF A;  2N7D A;  4A3P A;  2IO0 B;  2W9N A;  4EEW A;  1WI0 A;  4KIK A;  1WFY A;  1ZW7 A;  4FJZ A;  1WXA A;  2O2V B;  1E8Y A;  4HDQ A;  2NBV B;  2C60 A;  5FR6 A;  5BO4 B;  3VUW A;  3WA0 A;  3RZF A;  1V5O A;  3K9O B;  2JUO A;  4AUQ C;  5DCN A;  1VCB A;  1WRD B;  1E8X A;  2BKF A;  2I1J A;  2JWZ A;  2IO3 B;  2LRW A;  2LI5 A;  2MBB B;  2N1V A;  3QC8 B;  1WXS A;  4HPM B;  3UQA A;  1I35 A;  2ZVO A;  3BIN A;  2WWZ A;  2MBH A;  1T0Y A;  2L0T A;  5AZF A;  3VQI A;  2J0M A;  2K8C A;  3AI5 A;  1TTN A;  2AL3 A;  3NZU A;  3H1U A;  2NR2 A;  5LXI B;  1WGD A;  2IZV B;  4JIO U;  4EZK A;  4WJP A;  2EKE C;  3K9P B;  1OQY A;  2KAN A;  3PGE A;  2MWS B;  3V6C B;  1LQB A;  3VDZ A;  1BT0 A;  4X57 B;  2CHZ A;  2ZNV B;  2MA9 B;  1WXM A;  4ANV A;  3ZTD A;  3ZDM C;  2HE7 A;  4W9G A;  3UIP B;  2J7Q B;  3IFW B;  4NY0 A;  3SU8 X;  4IM3 A;  5JHB A;  3T9L A;  3ZLZ A;  4KZC A;  2DAF A;  2O6V A;  3VUX A;  4DHZ E;  1C3T A;  1EO6 A;  4PS8 A;  1M94 A;  1I42 A;  1UEL A;  2RPQ A;  4MJS A;  1WGY A;  4FJY A;  3A33 B;  4KIK B;  1Z2M A;  4FHK A;  3QAR A;  1FXT B;  1Z5S B;  1XT9 B;  5AZG A;  3VXW A;  3ZDT A;  4DHJ B;  3AUL A;  3CMM B;  4WAA A;  4NAW A;  3ZNZ B;  4OVV A;  3MJW A;  3DVG X;  4I6P A;  3SD5 A;  3ZNG C;  3SDL C;  2KQS A;  3CSF A;  4WJN A;  4HDO A;  3UIO B;  4AJW A;  2LUE A;  5DPW A;  3BY4 B;  4HWI B;  3LDZ E;  2PE6 B;  2RGF A;  4MEM A;  3WAO A;  2CHX A;  1P0R A;  3TMP B;  4HVB A;  4A3O A;  5CTR C;  3U8Z A;  3IVF A;  4EKU A;  1WZ0 A;  5EDS A;  2KWU B;  4NQL B;  2FCN A;  4AP4 C;  4NJ6 A;  4ANW A;  3M3J A;  4WWN A;  4WWO A;  4NJ7 A;  3QA8 A;  3PRE A;  4NPN A;  3RZW C;  2YLM A;  4JQW C;  1WJ6 A;  2Z0D B;  4K1R B;  2QHO A;  2R2O A;  4GDK A;  2FCM A;  4P7I A;  3PRP B;  2M0X A;  4E71 A;  3ALB A;  1ISN A;  2AEH A;  2KJR A;  2KN5 A;  2MSE D;  4G3X B;  4AJY B;  2KDF B;  4HJK A;  1RFA A;  4E74 A;  2DX5 B;  2NCN A;  2KJH B;  3OAW A;  3PLV A;  4BOZ B;  2C5L C;  3KUZ A;  2RD0 A;  1YIW A;  2A5U A;  2MRP A;  2IY0 B;  3ENE A;  3ML9 A;  3V60 A;  2KVR A;  1GJZ A;  3W1Y A;  2PJH A;  1NBF C;  4IG7 B;  4GIV A;  2K39 A;  4WWP A;  5J2R A;  1GC7 A;  4B9K A;  2LRU A;  1RRB A;  4ANU A;  4KZ0 A;  2JZ3 B;  3ZNI D;  2Z0E B;  5DPR A;  5JH5 C;  2D10 A;  3A1Q A;  2K6Q A;  2XEW A;  3UGB B;  3PRM B;  4BBN F;  4JGH B;  3UF8 A;  1GC6 A;  4TQ0 A;  1E7U A;  4GB9 A;  1WH3 A;  1TZ1 A;  3KYD D;  5D94 A;  3U7D A;  5J18 A;  1GG3 A;  3EEC A;  4GXB A;  4PS7 A;  2M4N A;  4XC2 A;  2RSU A;  4LCD E;  2JY6 A;  4GN1 A;  1YX5 B;  3HM3 A;  3V61 A;  3ZW3 A;  3PS6 A;  1V6E A;  5E6P A;  2NS5 A;  3IHP C;  3DQV A;  4HK2 A;  2ZPN A;  3APD A;  3H7S A;  4FJV B;  1SGH A;  1V5T A;  4TUU A;  2V4L A;  3ZO5 B;  4AOF A;  4GSW A;  2L7R A;  1IPG A;  5C23 A;  1XQQ A;  4G50 A;  2JF5 A;  4BFR A;  2FID A;  3R7Q A;  4JL9 A;  2IBI B;  4LJP B;  3EFU A;  2AL6 A;  2L05 A;  3TBL D;  2M17 A;  4J6I A;  2KFK B;  3AU4 A;  3DDC B;  1H8C A;  3A9J A;  3D32 A;  3TL5 A;  1WYW B;  3X23 A;  3KYC D;  4MSQ B;  2NVU I;  3ZRC A;  2REX A;  1UZX B;  4GMV A;  5CHW A;  5GMV A;  3VTV A;  1WY8 A;  1YD8 U;  2KHW B;  2R2Q A;  4A20 A;  2ASQ A;  4HCN B;  3RD2 A;  3DBS A;  2G4S A;  2FIF A;  2DZI A;  1V81 A;  2MBQ A;  3H7P A;  4W9F A;  2KMC A;  2KKC A;  3DVG Y;  4MGY E;  2DYM A;  2BPS A;  1MG8 A;  2V3S A;  3A1Q B;  2UYZ B;  4ZRJ A;  4BKS D;  1Q5W B;  2D3G A;  2L0F A;  2DZK A;  4LJO B;  2MLB A;  3ECI A;  4G11 A;  2GOW A;  2L3Z A;  4KDI C;  2D07 B;  4ZYN A;  4B95 A;  4HPL B;  1X1M A;  2G4D B;  3VHT C;  3O65 B;  3P2B A;  1E5W A;  2XK5 B;  5JZE B;  2BYE A;  2N7E A;  3LJ3 A;  4GU2 A;  1WJU A;  3JVZ X;  4TKN A;  4CO7 A;  3PTF C;  3B0A A;  2CR5 A;  1OEY J;  3WAM A;  4GGQ A;  2ZPY A;  2C7N B;  1WR1 A;  2BYV E;  4MM3 A;  3T8M A;  4BBN C;  4CYE A;  3OJ3 A;  2FCQ A;  1V2Y A;  3UQB A;  4LDT B;  3SHQ A;  2M8S A;  4GDL A;  3IBE A;  3TCA A;  3VUY A;  2GBM A;  1Q0W B;  1ZGU B;  2ZZP B;  3QK0 A;  1KLV A;  3VVW B;  1E8W A;  4OVU A;  4EOY A;  2KTF A;  4IM0 A;  3A9J B;  2J0K A;  1E7V A;  2JRH A;  3ZNH B;  2BF8 B;  1YQB A;  1S1Q B;  2KX3 A;  3CST A;  1WGR A;  1TGZ B;  3JSV A;  4BVU C;  1EF5 A;  2LVP A;  2ZCC A;  2FNJ B;  2WYQ A;  4F1S A;  1GUA B;  1WGG A;  2N9X A;  4DHZ B;  4RM9 A;  4FHJ A;  4N9F 4;  3PPA A;  4WQO B;  5J17 A;  3KUC B;  4TQ1 A;  4MGK E;  4DBG A;  2AYO B;  2DHZ A;  3ZKJ C;  1J0G A;  1UH6 A;  2G45 B;  2LXA A;  3DBL I;  4DDG D;  4HLE A;  2LVQ A;  2NPT A;  5LLI A;  1IYF A;  2N4F A;  4XZ4 A;  2IO1 B;  4NQK E;  3DPD A;  3NS8 A;  3PHW B;  4K7W A;  3HM6 X;  1AAR A;  3AU5 A;  2L8J A;  3NHE B;  4ZRK A;  1WX7 A;  1OEY A;  2PEA A;  3CF6 E;  1LFD A;  4FLH A;  1D3Z A;  3ZTC A;  2G3Q B;  2N1W A;  3EHV A;  3APF A;  5E6N A;  3PRZ A;  2O6V B;  1WE6 A;  3DOW A;  2KC1 A;  3VH3 B;  5D2M B;  1WZ3 A;  4MJS B;  4W9C A;  5G2N A;  4F8C B;  1Y8R C;  3R7R A;  5IA7 A;  1WM2 A;  2V1Y A;  2D11 A;  3Q3J A;  1WGH A;  2KWC A;  4GDL B;  3V6E B;  4B6W A;  5LXH A;  3WAN A;  4NAW B;  2LAS A;  1A5R A;  2DAJ A;  4XX5 A;  2NBW B;  5DPT A;  4RMA A;  5E6O A;  4ANX A;  2GBK A;  1NDD A;  4F7Z A;  1WJN A;  3DVN V;  2L00 B;  4DK5 A;  1WMH A;  2Z59 B;  1E8Z A;  3JSV B;  3JW0 X;  1P3Q U;  2JXX A;  2KK8 A;  2YVC A;  1H4R A;  2GBN A;  1UBQ A;  2JZZ A;  3B1L X;  1P1A A;  3TIX A;  2KLC A;  4DHJ D;  2FCS A;  4EUT A;  3L54 A;  3L17 A;  4NNJ B;  3QQ8 B;  5JHA A;  2L76 A;  2BGF A;  2FAZ A;  4GDK B;  2CKH B;  3ONS A;  2MCN B;  2BWF A;  3RUL A;  1LM8 B;  1V49 A;  4K7S A;  2KTR A;  2HTH A;  3HK0 A;  3ZRF A;  4URK A;  1L7Y A;  3A9K A;  4IC7 B;  1ZKH A;  2NPT B;  1J19 A;  2DZM A;  4W9H A;  2RR9 A;  1LXD A;  3QWZ B;  1SE9 A;  2XBB C;  1P98 A;  3MHS D;  2CU1 A;  1R4M I;  1SIF A;  3VTW A;  2KLG A;  1TBE A;  2ZCB A;  3PLU A;  1WJ4 A;  2ZNV C;  3ML8 A;  2IO2 B;  1WX9 A;  2HJ8 A;  3VTU A;  1UGM A;  3UIN B;  3A4S C;  4GOC A;  4FAD A;  1F9J A;  4FA6 A;  1JRU A;  2K1F A;  3VH4 B;  3ZVV A;  3B08 A;  2K8B A;  2WX1 A;  3DBH I;  3PSE B;  4M8M A;  1KJT A;  3N3K B;  3QAQ A;  5L83 A;  3WAP A;  5KHQ A;  2VRR B;  4AWJ A;  4IM2 A;  2I1K A;  2WX0 A;  3KUD B;  4IW0 A;  4MH0 E;  4DDI D;  3H6N A;  2O6V D;  1XD3 B;  2M1M A;  3N30 A;  1E90 A;  2FUH B;  2KNB A;  3L0W B;  1WMH B;  2GBR A;  2DZJ A;  2K25 A;  2MW5 A;  4KSK C;  4W9E A;  4W9D A;  1U4A A;  4YL8 A;  1J8C A;  2EMT A;  2WDT B;  4ZDV A;  4PS3 A;  3M95 A;  2BYF A;  2LJ5 A;  2PPH A;  2KOX A;  4RM8 A;  4BKT A;  4MGI E;  2LXC A;  4IWP A;  1S3S G;  4BOS C;  4EFO A;  5L95 C;  2KC2 A;  4E3C A;  2NBU A;  2A4Z A;  2OOB B;  1KM7 A;  2N9E B;  4ICU A;  4M8N A;  2KTR B;  3X0W A;  3NY5 A;  4ICV A;  2EMS A;  3A9K B;  2KQ7 A;  2D2Q A;  4W9K A;  2MQJ A;  1P9D U;  4I6N B;  3IG3 A;  3VAW A;  4I6L B;  5CX3 A;  5AZH A;  3TJP A;  1V9J A;  4TV3 A;  1WE7 A;  4W9I A;  2LD9 A;  4W9L A;  2KXJ A;  2KZR A;  2UWQ A;  4ZRI A;  4II2 B;  1C1Y B;  2MX2 A;  3I3T B;  4II3 B;  3QCA A;  3APC A;  1WR6 E;  2GBJ A;  4KSL C;  4MDK E;  2JVC A;  4IWO A;  3JYU A;  3OJ4 B;  5TR5 A;  4BKS A;  1V86 A;  3QX1 A;  1PQS A;  1UD7 A;  2LVO A;  3M63 B;  5DPS A;  2OJR A;  4FN2 A;  3RYT A;  1CMX B;  2DYO A;  3ZIM A;  3RCZ A;  4KV2 A;  5HKH A;  3M62 B;  2K8H A;  3H7P B;  1R4N I;  3KW5 B;  2K6D B;  3PT2 B;  2LGX A;  3GOE A;  3NOB A;  1QZE A;  1UBI A;  3KH0 A;  2JT4 B;  2C7M B;  3HIZ A;  1VD2 A;  4HCP B;  2KD0 A;  2BWE S;  2LGY A;  2J0J A;  4WJQ A;  4KVG B;  2KJ6 A;  2KDI A;  4M0W B;  2KDB A;  1WXV A;  4PYZ A;  1OTR B;  4CHK A;  3MTN B;  4W9J A;  3H9D A;  3R3M A;  2DYB A;  3OLM D;  1WIA A;  3L13 A;  2LZ6 A;  3PHX B;  1WF9 A;  2MP2 A;  3L10 B;  3C0R B;  4FUL A;  4JLC A;  5C1Z A;  1EF1 A;  2MBE A;  5CHV C;  3DCG A;  2IY1 B;  3PZD A;  2CHW A;  4IUM B;  1GNU A;  2DEN B;  2BKR B;  2JRI B;  2AWT A;  3PVL A;  2HD5 B;  4MGZ E;  3L16 A;  2Y5B B;  3GZN I;  3QHT A;  3VFK A;  3QJZ A;  4BKG A;  3R66 C;  4PYU A;  2O2V A;  5KHO A;  2ZEQ A;  3RT3 B;  1K8R B;  3DVN U;  2KMA A;  2KFK A;  3DBR I;  3PV1 A;  4HXD A;  1Q1O A;  3WIM A;  4KDL B;  4ASW C;  1YX6 B;  3NZS A;  2LGD A;  4G0N B;  4WJO A;  3V62 A;  3HHM A;  3AXC A;  4LDT D;  4K81 A;  3L08 A;  2B3A A;  3QIJ A;  1NI2 A;  5G55 A;  5IAA C;  1L2N A;  4DWF A;  1RAX A;  4K7U A;  1OGW A;  1YJ1 A;  2KFJ A;  2PE9 A;  2ZVN A;  2C7H A;  2ZJD A;  3EC8 A;  2C9W B;  3W1S A;  3ZUN A;  3W1S C;  1EUV B;  2N9P C;  4IWQ A;  5D6J B;  4MEL A;  1V80 A;  2MBO A;  3WAL A;  4FBJ B;  2GMI C;  2JPH A;  4MSM B;  3Q3F A; 
#chains in the Genus database with same CATH topology
 1WM3 A;  2WHI A;  1HE8 A;  2MP2 B;  2B76 B;  4EZL A;  1SF0 A;  2LWP A;  1NI3 A;  5D7G A;  1IP9 A;  2M56 B;  3N32 A;  1RLF A;  1WI0 A;  4JE3 B;  4OZC A;  5BO4 B;  3ETR A;  1V5O A;  1N6Z A;  3OG5 A;  3RNG C;  5DCN A;  1VCB A;  1WRD B;  1C4P A;  2JWZ A;  2LI5 A;  2BS3 B;  1QOF A;  2MJD A;  3AH7 A;  2K8C A;  1TTN A;  1E0Z A;  2ZW0 A;  4EZK A;  2MWS B;  2INP E;  3SEB A;  2KAJ A;  4JWS C;  4LNF A;  2V3P A;  4PT5 A;  3Q69 A;  3ZTD A;  4ZYS A;  2J7Q B;  1PGX A;  4K3B A;  1GB4 A;  3ZLZ A;  1ZXH A;  4KZC A;  2N9K A;  1M94 A;  1EU3 A;  4MJS A;  1WGY A;  4FJY A;  5AZG A;  3ZDT A;  4DHJ B;  3AUL A;  4OVV A;  3SD5 A;  3DVG X;  1UGJ A;  4YWG G;  2LUE A;  3BY4 B;  4HWI B;  3LDZ E;  4MEM A;  2FE8 A;  2CHX A;  3TMP B;  4XWW A;  1QLB B;  4A3O A;  3IVF A;  4EKU A;  5EDS A;  4NQL B;  4AP4 C;  3M3J A;  4WWO A;  1SEB D;  3PRE A;  4ZHO A;  2R2O A;  3PRP B;  5AUI A;  1ISN A;  1QF6 A;  1EM7 A;  2AEH A;  3URY A;  2PIA A;  4AJY B;  3ZJU A;  4QAY A;  3RNE C;  2NCN A;  2KJH B;  4BOZ B;  4HKZ E;  1YIW A;  4AS1 A;  1L0X B;  5BYR A;  3MC9 A;  2L1A A;  3W1Y A;  1EU4 A;  1NBF C;  2MJ3 A;  4IG7 B;  2LRU A;  1DYQ A;  4N59 A;  3ZNI D;  5JH5 C;  3NG0 A;  1J7A A;  4A6Q A;  4TQ0 A;  1XO3 A;  4WAF A;  1WH3 A;  3KYD D;  3NZ3 A;  2CJN A;  1MI0 A;  4XC2 A;  1FRR A;  1YX5 B;  2I38 A;  3PS6 A;  1V6E A;  5E6P A;  3U52 E;  4GSW A;  2HTM E;  1WRI A;  2JF5 A;  1L4Z B;  4K3C A;  3AEG B;  2WXQ A;  1Q10 A;  2VH2 A;  3TBL D;  2M17 A;  1HEZ E;  2W54 A;  4C56 C;  3DHH C;  1WYW B;  1ESF A;  4MSQ B;  2REX A;  1XF5 L;  1YD8 U;  1ZPS A;  2R2Q A;  4A20 A;  2Y3A A;  1JAL A;  3DBS A;  2MBQ A;  2DZI A;  1V81 A;  4OZB A;  2DYM A;  1MG8 A;  3A1Q B;  3KLS X;  2UYZ B;  3ECI A;  3BYT B;  3TEW A;  4D2K A;  3DWM A;  1HXY D;  1E5W A;  2XK5 B;  1ZP0 B;  5JZE B;  4CO7 A;  3B0A A;  2WXJ A;  2C7N B;  3SFE B;  4BAX A;  2FCQ A;  4YSZ B;  3SHQ A;  2M8S A;  1Q0W B;  1ZGU B;  4OVU A;  3A9J B;  2J0K A;  2WDQ B;  4YTP B;  3CST A;  1JML A;  1QOB A;  3BYY B;  1EF5 A;  3AEE B;  1EWC A;  3W2D A;  4WQO B;  4LNN A;  1PFD A;  2AYO B;  3ZKJ C;  4HPP A;  4HLE A;  1BUI C;  1IYF A;  4HKQ A;  2N4F A;  2IO1 B;  1UF0 A;  1AAR A;  2WXL A;  1FFU A;  1OEY A;  2PEA A;  3B9J A;  2QMT A;  2N1W A;  2O6V B;  2KC1 A;  1SE4 A;  4W9C A;  3R7R A;  2INC C;  1YQ4 B;  3Q3J A;  1HA5 A;  4GDL B;  2KWC A;  1STE A;  2LAS A;  4XX5 A;  4OZA A;  4F7Z A;  1NDD A;  1VLB A;  4P1C C;  1WMH A;  1E8Z A;  1P3Q U;  2KK8 A;  2GBN A;  1UBQ A;  2OJW A;  4DHJ D;  5JHA A;  2FUG 1;  4YTM B;  1RFK A;  2FAZ A;  1ZOY B;  1XLQ A;  2BWF A;  3TUO A;  1LM8 B;  1ZDX A;  4URK A;  4MH8 A;  3A9K A;  4IC7 B;  3AN1 A;  2NPT B;  4M00 A;  2CU1 A;  1TBE A;  1V1O A;  3PLU A;  2DBY A;  2ZNV C;  1FIQ A;  1UGM A;  5HHD G;  2INN E;  3A4S C;  4GOC A;  4FA6 A;  3ABV B;  1JRP A;  3VR9 B;  3AEC B;  2BB5 A;  1NYQ A;  1KJT A;  1I7H A;  2M19 A;  2VRR B;  4IM2 A;  2K22 A;  3H6N A;  2FUH B;  1F0Z A;  1TY2 A;  1WSP A;  4ZDV A;  3M95 A;  4M0W A;  2D3C A;  4MGI E;  4EFO A;  1FNV A;  1KTK A;  2V4I B;  2JYE A;  3X0W A;  3NY5 A;  3FC4 A;  1ET6 A;  4W9K A;  4ARI A;  3RPF C;  4I6L B;  1YN4 A;  3TJP A;  2PW9 A;  4TV3 A;  3ZGZ A;  2UWQ A;  2MX2 A;  3AE1 B;  2JVC A;  4IWO A;  3OJ4 B;  1GOZ A;  1UD7 A;  3M63 B;  3RYT A;  3EFC A;  3ZIM A;  3RCZ A;  4KV2 A;  1XCQ L;  3R2T A;  2K8H A;  1R4N I;  2K6D B;  2LGX A;  2JT4 B;  3HIZ A;  1DOX A;  2L32 A;  4REZ A;  5H8Y E;  4WJQ A;  4C7Z A;  2KJ6 A;  1TKG A;  4PYZ A;  4L23 A;  1CZP A;  3L10 B;  2IGD A;  3C0R B;  1D5X C;  2MBE A;  2IY1 B;  3Q3O C;  3PZD A;  3AE7 B;  3AE6 B;  3R8B A;  2HD5 B;  3L16 A;  3GZN I;  1I4R A;  1JWU D;  1E7P B;  2O2V A;  1PGA A;  2K5P A;  2QCZ A;  4KDL B;  1JRO A;  1V1P B;  4WQM A;  2JSV X;  1XLO A;  2J52 A;  5G55 A;  4XYC A;  3Q8E A;  5GXG B;  2C9W B;  1SSN A;  3W1S A;  2N9P C;  2MHJ A;  4IWQ A;  5D6J B;  2WGS A;  1V80 A;  3RN9 C;  3WAL A;  4FBJ B;  2JPH A;  3HVZ A;  4MSM B;  3Q3F A;  3KVF B;  2SEB D;  2XK5 A;  2KX0 A;  2CU3 A;  3RUI B;  3TSS A;  3U30 A;  1G6J A;  3B2F A;  1WX8 A;  1DGJ A;  5AEK B;  1SIJ A;  2WQY B;  4EZJ A;  2IYD B;  1JWS D;  4N58 A;  1BML C;  3HRD D;  1ZW7 A;  1WXA A;  1UWM A;  4HDQ A;  5FR6 A;  3RZF A;  2LMC A;  4RFB A;  1FMA D;  1FXI A;  4AUQ C;  1E8X A;  3QC8 B;  2I1J A;  2N1V A;  2IO3 B;  4HPM B;  3BIN A;  1F52 A;  2J0M A;  3NZU A;  2NR2 A;  5LXI B;  4JIO U;  1VR9 A;  3K9P B;  2GB1 A;  3DWG C;  1AYF A;  3V6C B;  4X57 B;  2CHZ A;  5T8I A;  2MA9 B;  1T0Q C;  2D3A A;  1WXM A;  4ANV A;  3ZDM C;  2SAK A;  3IFW B;  3SU8 X;  4IM3 A;  5BMH A;  3VUX A;  1C3T A;  2O6V A;  1IBX A;  2WS3 B;  4KIK B;  1Z2M A;  3QAR A;  1MVK A;  1IGD A;  2KQS A;  4WJN A;  1TIF A;  4HDO A;  3UIO B;  2GI9 A;  2PE6 B;  2RGF A;  2D3B A;  3U8Z A;  2QDF A;  1L4D B;  1NEK B;  3AM9 A;  1ZUD 2;  3Q3M C;  5EE9 A;  3VR8 B;  2KWU B;  4NJ6 A;  3QA8 A;  3RZW C;  4JQW C;  2XN9 C;  4K1R B;  1MPE A;  2FCM A;  1R4M B;  2M0X A;  3RNC C;  3ALB A;  4G3X B;  1YQ3 B;  2MSE D;  4NAM A;  3RNF C;  1TS4 A;  2MRP A;  3ML9 A;  3ENE A;  2KVR A;  3MHZ A;  2PJH A;  3DHI C;  2W55 A;  2KYW A;  2K39 A;  4WWP A;  1GC7 A;  2BT6 A;  1RRB A;  2FBW B;  5DPR A;  1N61 A;  2K6Q A;  3UGB B;  4TMA B;  3BVM A;  3UF8 A;  3ZJV A;  4GB9 A;  3W5U B;  1VRA B;  2WXH A;  4PS7 A;  3FIL A;  4LCD E;  2JY6 A;  3GB1 A;  3DQV A;  2ZPN A;  3APD A;  3H7S A;  3P1M A;  2V4L A;  3ZO5 B;  4AOF A;  4LNK A;  1IPG A;  5C23 A;  2IBI B;  4LJP B;  1LO5 D;  1H8C A;  3DDC B;  2NTS A;  3GE3 C;  2LGI A;  3X23 A;  3KYC D;  2NVU I;  2ICI A;  2AQ3 B;  3PO0 A;  2ASQ A;  3DBL B;  3RD2 A;  3BVZ A;  1JWB D;  2V3S A;  1TYG B;  4BKS D;  1Q5W B;  2MLB A;  4G11 A;  4KDI C;  4ZYN A;  4B95 A;  2K0P A;  2G4D B;  1GAQ B;  3LJ3 A;  4GU2 A;  3BVG A;  3JVZ X;  1GPX A;  2IGH A;  2CR5 A;  1OEY J;  1VZ7 A;  2ZPY A;  4CQN A;  1YOV B;  3LXF A;  4ARC A;  2N7J A;  1WR1 A;  2BYV E;  2W3S A;  3T8M A;  4A8X C;  4DXG A;  3OJ3 A;  1V2Y A;  4LDT B;  1F2R I;  3IBE A;  3TCA A;  2GBM A;  3VUY A;  3QK0 A;  3GE8 C;  1E7V A;  2JRH A;  1YQB A;  4R3D A;  4BVU C;  2V9H A;  2ZCC A;  3PZ8 A;  1MHX A;  4B0E A;  4RM9 A;  3PPA A;  3KUC B;  4MGK E;  4DBG A;  2JZP A;  2Y5P A;  1J0G A;  4WH4 A;  1UH6 A;  2LXA A;  5FKA C;  3ZXR A;  5TSS A;  2ON8 A;  3HM6 X;  4ZRK A;  1LFD A;  4FLH A;  3ZTC A;  5E6N A;  1T0R C;  1CJE A;  1WE6 A;  2LFI A;  2N9L A;  3VH3 B;  5HFY A;  4F8C B;  1Y8R C;  1WM2 A;  2V1Y A;  4J3O D;  1L0Y B;  2MH7 A;  4JPS A;  5LXH A;  3WAN A;  2LJI A;  4NAW B;  1SE3 A;  2NBW B;  5DPT A;  2GBK A;  3Q2A C;  2Z59 B;  3C8Y A;  3JSV B;  1DOY A;  2JXX A;  1JQ4 A;  5EE3 A;  3TIX A;  1M4V A;  2KLC A;  3ZQ4 A;  2CKH B;  1TT5 B;  2MCN B;  2KTR A;  3HK0 A;  3LYY A;  1ZKH A;  1J19 A;  2RR9 A;  2XBB C;  2RPV A;  1P98 A;  2KWD A;  2ZCB A;  3BWU D;  1WJ4 A;  1PUT A;  4XDC A;  1RYJ A;  3MC0 B;  4KGR A;  2NMQ A;  3VTU A;  3NUH B;  1F9J A;  1JRU A;  1ROE A;  4USA A;  3B08 A;  4OHJ A;  5HI1 A;  2WX1 A;  4M8M A;  3N3K B;  3N9Y C;  1FEH A;  5L83 A;  5KHQ A;  3ZJT A;  1CK1 A;  3IT6 B;  2QSD A;  1FNW A;  2WX0 A;  4MH0 E;  3N1Y C;  1XD3 B;  4KSK C;  2KNB A;  4JX1 C;  1NVI D;  4MT5 A;  4PS3 A;  2LJ5 A;  2PPH A;  4KGS A;  2LXC A;  2YEP B;  1S3S G;  4BOS C;  1F1H A;  1B9R A;  1I4G A;  2EMS A;  2OED A;  2D2Q A;  3Q6B A;  3RNB C;  3VRB B;  4I6N B;  3VAW A;  4B0M A;  4ITK A;  2KXJ A;  2JWU A;  2KZR A;  5BMI A;  1C1Y B;  3APC A;  4KSL C;  2GBJ A;  1MJD A;  2Z8L A;  3JYU A;  1V86 A;  1PQS A;  2OJR A;  1TY0 A;  2Q5W D;  1CMX B;  3Q14 C;  3H7P B;  1JCK B;  2KAC A;  1QZE A;  1VD2 A;  2XNA C;  1MG4 A;  4KVG B;  2W82 A;  3NVW A;  2VH1 A;  1WIA A;  4IKG A;  2MP2 A;  4KKI A;  4JLC A;  5IOI A;  3W5V B;  5CHV C;  4MM3 B;  4RCO A;  2WXR A;  1F2R C;  3AEB B;  4WUR A;  2BKR B;  2AWT A;  4MGZ E;  2Y5B B;  3AE4 B;  3QHT A;  3TEX A;  4BKG A;  3U4E G;  2WDV B;  1K52 A;  1T5X D;  3DVN U;  2KMA A;  5EE1 A;  4HXD A;  4LK0 M;  4ASW C;  4AQ7 A;  1C78 A;  2D5G A;  3HHM A;  1XXG A;  4LDT D;  3VRA B;  3L08 A;  2B3A A;  1KRH A;  4DWF A;  3WCQ A;  2WXK A;  2WNM A;  2C7H A;  3W1S C;  3EGR A;  1WGK A;  1C77 A;  1C9F A;  4MEL A;  2GMI C;  1JW9 D;  3RFZ B;  1KOT A;  2KO3 A;  1L6V A;  3S2A A;  1SE2 A;  3BZD B;  3UI3 A;  3J9C A;  4DXA B;  2KWV B;  2X38 A;  4RH6 A;  4LNO A;  1TKY A;  2IO0 B;  2IND C;  1UNS A;  1WFY A;  4FJZ A;  2NBV B;  1YJJ A;  3K9O B;  2TSS A;  2JUO A;  4C4V B;  2BKF A;  2LRW A;  3UQA A;  1WXS A;  5IP4 D;  3CIR B;  2MBH A;  1T0Y A;  1Y56 A;  2L0T A;  5AZF A;  3VQI A;  3AI5 A;  2AL3 A;  5C3J B;  1WGD A;  3SR6 A;  1N63 A;  4WJP A;  1OQY A;  3PGE A;  1BT0 A;  1TS3 A;  1TKE A;  4WIP A;  2KMM A;  2HE7 A;  1SBB B;  4W9G A;  3UIP B;  1TS5 A;  4NY0 A;  2AQ2 B;  5JHB A;  1I42 A;  3RMK C;  1NEN B;  2RPQ A;  4A55 A;  1A70 A;  2H89 B;  1Z5S B;  2RDB C;  2RDH A;  3CMM B;  4WAA A;  4NAW A;  1J7C A;  4MAC A;  3MJW A;  2R61 A;  4AJW A;  5DPW A;  1K51 A;  3O13 A;  1P0R A;  3E56 A;  4RGO S;  4HVB A;  3TEY A;  2BVC A;  1WZ0 A;  2FCN A;  2LEK A;  1VZ6 A;  4WWN A;  2YLM A;  1WJ6 A;  4P7I A;  5JXV A;  3AE8 B;  2KJR A;  2KN5 A;  1WYG A;  2I2Y A;  2KDF B;  1YJI A;  2BTE A;  4HJK A;  4C7Y A;  4E74 A;  3FKY A;  2DX5 B;  3EUB 2;  3OAW A;  3PLV A;  3KUZ A;  4LTU A;  1FNU A;  1I4X A;  2RD0 A;  2L83 A;  2A5U A;  5C2T B;  4GIV A;  1P7F A;  5J2R A;  4B9K A;  2L52 A;  2IJ0 A;  1ZDV A;  4ANU A;  2JZ3 B;  2Z0E B;  4M01 A;  3A1Q A;  5IO9 A;  2XEW A;  3AE3 B;  2JXT A;  2QC8 A;  5BYQ A;  1E10 A;  1E7U A;  1TZ1 A;  5D94 A;  1GG3 A;  3EEC A;  4GXB A;  4GN1 A;  3HM3 A;  1KH0 A;  1CQV A;  3IHP C;  4HK2 A;  3AEA B;  4FJV B;  3MC8 A;  1V5T A;  4TUU A;  4TSS A;  2L7R A;  3NVY A;  1XQQ A;  4G50 A;  4BFR A;  3R7Q A;  3Q8C A;  2AL6 A;  5EE0 A;  3AMZ A;  1I4H A;  3A9J A;  4P6V F;  3AE9 B;  1YMH E;  3ZRC A;  1UZX B;  4GMV A;  5CHW A;  1T0S C;  4BZA A;  2G4S A;  3H7P A;  4W9F A;  2KMC A;  3DVG Y;  3P42 A;  4ZRJ A;  2DZK A;  1HZ6 A;  1FRD A;  5D3I B;  2L3Z A;  2D07 B;  2JX5 A;  5IN7 A;  4HPL B;  1X1M A;  3BII D;  3VHT C;  1ACC A;  2LHD A;  3O65 B;  3P2B A;  2N7E A;  3T3O A;  1L6U A;  3PTF C;  1I4P A;  1ZXI A;  3I57 A;  3W9C B;  4MM3 A;  4US8 A;  3EA6 A;  3UQB A;  4GDL A;  2W3R A;  2GRI A;  1KLV A;  4YSY B;  3VVW B;  4EOY A;  2KTF A;  4IM0 A;  1J7B A;  4A9A A;  2BF8 B;  2KX3 A;  1WGR A;  1TGZ B;  2FNJ B;  4F1S A;  1GUA B;  1WGG A;  4FHJ A;  3MFG A;  1OQR A;  1V8C A;  2DHZ A;  1C76 A;  4HRO A;  1N62 A;  2G45 B;  4RF0 A;  3DBL I;  2NPT A;  5LLI A;  4RGT A;  4RGN A;  4DXF A;  1F77 A;  3DPD A;  3NS8 A;  2L8J A;  2H88 B;  1WX7 A;  5LNK 1;  3CF6 E;  1MFW A;  3DBH B;  1N5W A;  1QIL A;  2EKI A;  4S0R A;  1R7S A;  1QOA A;  2UU7 A;  3DOW A;  4ZHP A;  1OFF A;  2D11 A;  1WGH A;  3V6E B;  4B6W A;  1GB1 A;  1A5R A;  4NJC A;  4YT0 B;  1WJN A;  3IXS A;  1T6B X;  1RWS A;  3B1L X;  4KKJ A;  2FCS A;  3L54 A;  3L17 A;  4NNJ B;  3QQ8 B;  2BGF A;  2HDE A;  4GDK B;  4HEA 1;  2PVG C;  1V49 A;  4K7S A;  2HTH A;  3P4R B;  2BS2 B;  2DZM A;  4W9H A;  1LXD A;  3QWZ B;  1SIF A;  3VTW A;  3KWV A;  3ML8 A;  2HJ8 A;  4FAD A;  2HJ1 A;  2K8B A;  3MP9 A;  1D5Z C;  3PSE B;  3QAQ A;  3ZXV A;  4AWJ A;  4IW0 A;  3KUD B;  1K53 A;  2GLS A;  3N30 A;  3L0W B;  4W9D A;  1WMH B;  2GBR A;  2DZJ A;  2K25 A;  2MW5 A;  4YL8 A;  4ZOH C;  1J8C A;  1U4A A;  2NTT A;  1QQR A;  1UWX A;  2EMT A;  2BYF A;  1EWY C;  2KOX A;  3FAH A;  4IWP A;  4OVZ A;  2KC2 A;  3NVV A;  2NBU A;  1KM7 A;  4P1B C;  2V0G A;  4M8N A;  4ICV A;  3A9K B;  4XE0 A;  1N5X A;  2KQ7 A;  1P9D U;  3L4P A;  3DBR B;  1TS2 A;  5CX3 A;  1V9J A;  4W9L A;  1WE7 A;  2JYT A;  4ZRI A;  1FXA A;  2AX5 A;  4II3 B;  3QCA A;  5I4D A;  4ZRP A;  4MDK E;  1VDV A;  5G5G A;  4BKS A;  1V1P A;  2LVO A;  5DPS A;  1DOI A;  2ACZ B;  2G9H D;  1C4C A;  3M62 B;  3KW5 B;  2QEJ C;  4L1B A;  1BXT A;  1UBI A;  3KH0 A;  3RNA C;  2C7M B;  2J42 A;  3AE2 B;  5MPO A;  2BWE S;  1YN3 A;  2LGY A;  2J0J A;  1E9M A;  1XLN A;  4M0W B;  2KDB A;  1WXV A;  1OTR B;  3I9V 1;  3MTN B;  4CHK A;  4W9J A;  2WDR B;  3H9D A;  3R3M A;  2DYB A;  1TZO A;  2LZ6 A;  3PHX B;  4FUL A;  3P63 A;  5C1Z A;  1GNU A;  4ZRQ A;  2DEN B;  3U2S C;  3NVZ A;  3QJZ A;  3R66 C;  5KHO A;  2ZEQ A;  1K8R B;  4HJG E;  3PV1 A;  2IPK D;  1E6E B;  4M02 A;  3V3X A;  1YX6 B;  4YSX B;  4G0N B;  1P7E A;  4WJO A;  3V62 A;  3SFD B;  4K81 A;  2MJE A;  3HVD A;  5IAA C;  1L2N A;  1RAX A;  4OW0 A;  1OGW A;  2PE9 A;  2ZVN A;  2ZJD A;  1EUV B;  4KX6 B;  4RF1 A;  2MBO A;  1WWT A;  1KF6 B;  3I5J C;  2WU2 B;  3H8H A;  2WXI A;  1KFY B;  3NJT A;  2KDE B;  5CHF A;  2CS4 A;  1IUE A;  3A4R A;  2WU5 B;  2N7D A;  4A3P A;  2W9N A;  4P16 A;  4EEW A;  4KIK A;  2BQQ A;  2O2V B;  1E8Y A;  2C60 A;  2VZK B;  3VUW A;  3WA0 A;  2LUM A;  2ONQ A;  4LNI A;  1FM0 D;  3R2I A;  2MBB B;  1YNT E;  2BYT A;  1I35 A;  4IOI E;  2ZVO A;  2WWZ A;  1N60 A;  3H1U A;  4C00 A;  2IZV B;  2WXF A;  2EKE C;  2KAN A;  2RMM A;  2OHF A;  3AEF B;  1LQB A;  1FO4 A;  4WWM A;  3VDZ A;  2K9X A;  1KLG D;  2ZNV B;  3T9L A;  2X8X X;  4DHZ E;  2DAF A;  2BW2 A;  1VZ8 A;  1EO6 A;  1HTO A;  4PS8 A;  1UEL A;  3T3N A;  2YEP F;  3A33 B;  4XGA B;  4FHK A;  1FXT B;  3I63 C;  1XT9 B;  1ENF A;  5HG2 A;  3VXW A;  4YTN B;  1SJE D;  3ZNZ B;  3ZNG C;  4I6P A;  3SDL C;  3CSF A;  3WAO A;  1QT9 A;  5CTR C;  5AUK A;  3OWE B;  1XLP A;  3KQ4 A;  4ANW A;  4NJ7 A;  4NPN A;  2Z0D B;  2QHO A;  4GDK A;  3GP7 A;  4E71 A;  1FFV A;  2Y5C A;  1C4A A;  1RFA A;  3Q3N C;  3U7Z A;  3IAM 1;  1PGB A;  2WXP A;  4PK1 A;  1KLU D;  2C5L C;  4C80 A;  4LLG M;  4O1N A;  2IY0 B;  3V60 A;  3AED B;  1IBX B;  1GJZ A;  1V97 A;  3N1Z C;  2DLB A;  2PKO A;  3DHG C;  3LB8 C;  1VJK A;  5G5H A;  4KZ0 A;  2D10 A;  2RDG A;  3N20 C;  3PRM B;  4BBN F;  4JGH B;  1GC6 A;  2IDY A;  3U7D A;  5J18 A;  1JWA D;  2M4N A;  2RSU A;  2ZW1 A;  3ZW3 A;  3V61 A;  1PDX A;  2NS5 A;  2PVO D;  1SGH A;  3C19 A;  1UUP A;  1QKZ A;  2J4X A;  2DNF A;  2FID A;  4JL9 A;  2JQR B;  3EFU A;  2PMV A;  2L05 A;  1MHH E;  3AB5 A;  4J6I A;  4HRS A;  2K3U A;  2KFK B;  3AU4 A;  3D32 A;  4JWU C;  3TL5 A;  1ET9 A;  3MJ5 A;  5GMV A;  3VTV A;  1WY8 A;  2KHW B;  4HCN B;  2FIF A;  2KKC A;  4MGY E;  2BPS A;  3Q8F A;  2D3G A;  3IAS 1;  3BK2 A;  2L0F A;  3NRZ A;  4LJO B;  2GOW A;  1YN5 A;  3FIL B;  1TJE A;  4US9 A;  4YXD B;  2BYE A;  1WJU A;  3BK1 A;  1SJH D;  4TKN A;  1SB3 C;  4NZL B;  3WAM A;  4GGQ A;  1FCL A;  2WP9 B;  3P4S B;  4N6E B;  4BBN C;  4CYE A;  2PTL A;  1QOG A;  2QJL A;  2DWQ A;  4EE2 A;  2ZZP B;  2WXO A;  1E8W A;  3ZNH B;  1S1Q B;  3JSV A;  1FD6 A;  4RNA A;  2KQ4 X;  2LVP A;  1HTQ A;  2WYQ A;  4DHZ B;  2N9X A;  4N9F 4;  2KDM A;  4XWT A;  3B2G A;  2VZK D;  5J17 A;  1L5P A;  4TQ1 A;  4IDI A;  4DDG D;  2LVQ A;  4XZ4 A;  1T3Q A;  4NQK E;  3PHW B;  4K7W A;  3AU5 A;  4L2Y A;  1D4B A;  3NHE B;  2QIL A;  3HUI A;  1D3Z A;  2G3Q B;  2WXG A;  2AQ1 B;  3EHV A;  3Q8B A;  5FR3 A;  3APF A;  3PRZ A;  1RM6 C;  3Q8A A;  5D2M B;  1WZ3 A;  4MJS B;  5G2N A;  5IA7 A;  3CWI A;  2BS4 B;  2DAJ A;  2WXN A;  1B1Z A;  4RMA A;  2KN4 A;  5E6O A;  4ANX A;  5BYS A;  3DVN V;  2L00 B;  4DK5 A;  3JW0 X;  2YVC A;  5IKC M;  1H4R A;  2JZZ A;  1P1A A;  1NYR A;  4EUT A;  1I4Q A;  3KWL A;  2L76 A;  1SXT A;  4S17 A;  3ONS A;  3RUL A;  4RGM A;  3ZRF A;  2MEK A;  1L7Y A;  1FCC C;  4ACF A;  1SE9 A;  3MHS D;  1R4M I;  1IGC A;  2KLG A;  1AN8 A;  2IO2 B;  1WX9 A;  1ZE3 D;  4Q2J A;  3UIN B;  2LHE A;  2K1F A;  3VH4 B;  1R4N B;  3PZ7 A;  3ZVV A;  2KT7 A;  3P4Q B;  5H92 C;  3N1X C;  3IT4 B;  3DBH I;  1LGR A;  2KVZ A;  3WAP A;  2E3T A;  2LGS A;  2I1K A;  4DDI D;  2O6V D;  2M1M A;  1E90 A;  4W9E A;  1HZ5 A;  2PLP A;  2G1E A;  2WDT B;  2JU6 X;  4RM8 A;  4BKT A;  5L95 C;  1D5M C;  1D6E C;  1WXQ A;  4E3C A;  2OOB B;  2A4Z A;  1AW7 A;  1OQQ A;  4FXC A;  2N9E B;  4DQO C;  4ICU A;  2KTR B;  3GZN B;  2EEL A;  1JWM D;  4A90 A;  1C79 A;  4KGT A;  2MQJ A;  3E9S A;  3IG3 A;  2V3N A;  5AZH A;  3TEZ A;  5FK9 C;  4W9I A;  2LD9 A;  4II2 B;  3GS2 A;  3I3T B;  1WR6 E;  5TR5 A;  3V05 A;  3QX1 A;  1FPY A;  4FN2 A;  3RI7 C;  4UDU C;  2DYO A;  1XEE A;  5HKH A;  3PT2 B;  3GOE A;  3NOB A;  1XCT L;  5E6J A;  4HCP B;  2KD0 A;  1K50 A;  2KDI A;  3AV8 A;  3P4P B;  3OLM D;  3L13 A;  2J53 A;  1WF9 A;  1EF1 A;  3DCG A;  4XDD A;  2CHW A;  4IUM B;  2JRI B;  3PVL A;  2M0A A;  2QIE B;  5BMG A;  1HQR D;  2N0S B;  3VFK A;  1PYW D;  4H2A A;  4PYU A;  3RT3 B;  1L0V B;  2BBC A;  2KFK A;  3DBR I;  3ZYY X;  1AWD A;  1Q1O A;  3WIM A;  3NZS A;  2LGD A;  3AXC A;  4C4V A;  2WLB A;  3QIJ A;  1NI2 A;  4K7U A;  2WXM A;  1YJ1 A;  2KFJ A;  3EC8 A;  2E6X A;  2BB6 A;  5D3D A;  3AE5 B;  3ZUN A;  4GLS C;  3NS1 A;  2IGG A;  2CJO A; 
#chains in the Genus database with same CATH homology
 1KOT A;  1WM3 A;  2KO3 A;  3KVF B;  1HE8 A;  2XK5 A;  2KX0 A;  3S2A A;  3RUI B;  3U30 A;  2MP2 B;  2KDE B;  1G6J A;  5CHF A;  1WX8 A;  4EZL A;  4DXA B;  5AEK B;  2LWP A;  2CS4 A;  5D7G A;  2KWV B;  4EZJ A;  3A4R A;  1IP9 A;  2IYD B;  3N32 A;  1RLF A;  2N7D A;  4A3P A;  2IO0 B;  2W9N A;  4EEW A;  1WI0 A;  4KIK A;  1WFY A;  1ZW7 A;  4FJZ A;  1WXA A;  2O2V B;  1E8Y A;  4HDQ A;  2NBV B;  2C60 A;  5FR6 A;  5BO4 B;  3VUW A;  3WA0 A;  3RZF A;  1V5O A;  3K9O B;  2JUO A;  4AUQ C;  5DCN A;  1VCB A;  1WRD B;  1E8X A;  2BKF A;  2I1J A;  2JWZ A;  2IO3 B;  2LRW A;  2LI5 A;  2MBB B;  2N1V A;  3QC8 B;  1WXS A;  4HPM B;  3UQA A;  1I35 A;  2ZVO A;  3BIN A;  2WWZ A;  2MBH A;  1T0Y A;  2L0T A;  5AZF A;  3VQI A;  2J0M A;  2K8C A;  3AI5 A;  1TTN A;  2AL3 A;  3NZU A;  3H1U A;  2NR2 A;  5LXI B;  1WGD A;  2IZV B;  4JIO U;  4EZK A;  4WJP A;  2EKE C;  3K9P B;  1OQY A;  2KAN A;  3PGE A;  2MWS B;  3V6C B;  1LQB A;  3VDZ A;  1BT0 A;  4X57 B;  2CHZ A;  2ZNV B;  2MA9 B;  1WXM A;  4ANV A;  3ZTD A;  3ZDM C;  2HE7 A;  4W9G A;  3UIP B;  2J7Q B;  3IFW B;  4NY0 A;  3SU8 X;  4IM3 A;  5JHB A;  3T9L A;  3ZLZ A;  4KZC A;  2DAF A;  2O6V A;  3VUX A;  4DHZ E;  1C3T A;  1EO6 A;  4PS8 A;  1M94 A;  1I42 A;  1UEL A;  2RPQ A;  4MJS A;  1WGY A;  4FJY A;  3A33 B;  4KIK B;  1Z2M A;  4FHK A;  3QAR A;  1FXT B;  1Z5S B;  1XT9 B;  5AZG A;  3VXW A;  3ZDT A;  4DHJ B;  3AUL A;  3CMM B;  4WAA A;  4NAW A;  3ZNZ B;  4OVV A;  3MJW A;  3DVG X;  4I6P A;  3SD5 A;  3ZNG C;  3SDL C;  2KQS A;  3CSF A;  4WJN A;  4HDO A;  3UIO B;  4AJW A;  2LUE A;  5DPW A;  3BY4 B;  4HWI B;  3LDZ E;  2PE6 B;  2RGF A;  4MEM A;  3WAO A;  2CHX A;  1P0R A;  3TMP B;  4HVB A;  4A3O A;  5CTR C;  3U8Z A;  3IVF A;  4EKU A;  1WZ0 A;  5EDS A;  2KWU B;  4NQL B;  2FCN A;  4AP4 C;  4NJ6 A;  4ANW A;  3M3J A;  4WWN A;  4WWO A;  4NJ7 A;  3QA8 A;  3PRE A;  4NPN A;  3RZW C;  2YLM A;  4JQW C;  1WJ6 A;  2Z0D B;  4K1R B;  2QHO A;  2R2O A;  4GDK A;  2FCM A;  4P7I A;  3PRP B;  2M0X A;  4E71 A;  3ALB A;  1ISN A;  2AEH A;  2KJR A;  2KN5 A;  2MSE D;  4G3X B;  4AJY B;  2KDF B;  4HJK A;  1RFA A;  4E74 A;  2DX5 B;  2NCN A;  2KJH B;  3OAW A;  3PLV A;  4BOZ B;  2C5L C;  3KUZ A;  2RD0 A;  1YIW A;  2A5U A;  2MRP A;  2IY0 B;  3ENE A;  3ML9 A;  3V60 A;  2KVR A;  1GJZ A;  3W1Y A;  2PJH A;  1NBF C;  4IG7 B;  4GIV A;  2K39 A;  4WWP A;  5J2R A;  1GC7 A;  4B9K A;  2LRU A;  1RRB A;  4ANU A;  4KZ0 A;  2JZ3 B;  3ZNI D;  2Z0E B;  5DPR A;  5JH5 C;  2D10 A;  3A1Q A;  2K6Q A;  2XEW A;  3UGB B;  3PRM B;  4BBN F;  4JGH B;  3UF8 A;  1GC6 A;  4TQ0 A;  1E7U A;  4GB9 A;  1WH3 A;  1TZ1 A;  3KYD D;  5D94 A;  3U7D A;  5J18 A;  1GG3 A;  3EEC A;  4GXB A;  4PS7 A;  2M4N A;  4XC2 A;  2RSU A;  4LCD E;  2JY6 A;  4GN1 A;  1YX5 B;  3HM3 A;  3V61 A;  3ZW3 A;  3PS6 A;  1V6E A;  5E6P A;  2NS5 A;  3IHP C;  3DQV A;  4HK2 A;  2ZPN A;  3APD A;  3H7S A;  4FJV B;  1SGH A;  1V5T A;  4TUU A;  2V4L A;  3ZO5 B;  4AOF A;  4GSW A;  2L7R A;  1IPG A;  5C23 A;  1XQQ A;  4G50 A;  2JF5 A;  4BFR A;  2FID A;  3R7Q A;  4JL9 A;  2IBI B;  4LJP B;  3EFU A;  2AL6 A;  2L05 A;  3TBL D;  2M17 A;  4J6I A;  2KFK B;  3AU4 A;  3DDC B;  1H8C A;  3A9J A;  3D32 A;  3TL5 A;  1WYW B;  3X23 A;  3KYC D;  4MSQ B;  2NVU I;  3ZRC A;  2REX A;  1UZX B;  4GMV A;  5CHW A;  5GMV A;  3VTV A;  1WY8 A;  1YD8 U;  2KHW B;  2R2Q A;  4A20 A;  2ASQ A;  4HCN B;  3RD2 A;  3DBS A;  2G4S A;  2FIF A;  2DZI A;  1V81 A;  2MBQ A;  3H7P A;  4W9F A;  2KMC A;  2KKC A;  3DVG Y;  4MGY E;  2DYM A;  2BPS A;  1MG8 A;  2V3S A;  3A1Q B;  2UYZ B;  4ZRJ A;  4BKS D;  1Q5W B;  2D3G A;  2L0F A;  2DZK A;  4LJO B;  2MLB A;  3ECI A;  4G11 A;  2GOW A;  2L3Z A;  4KDI C;  2D07 B;  4ZYN A;  4B95 A;  4HPL B;  1X1M A;  2G4D B;  3VHT C;  3O65 B;  3P2B A;  1E5W A;  2XK5 B;  5JZE B;  2BYE A;  2N7E A;  3LJ3 A;  4GU2 A;  1WJU A;  3JVZ X;  4TKN A;  4CO7 A;  3PTF C;  3B0A A;  2CR5 A;  1OEY J;  3WAM A;  4GGQ A;  2ZPY A;  2C7N B;  1WR1 A;  2BYV E;  4MM3 A;  3T8M A;  4BBN C;  4CYE A;  3OJ3 A;  2FCQ A;  1V2Y A;  3UQB A;  4LDT B;  3SHQ A;  2M8S A;  4GDL A;  3IBE A;  3TCA A;  3VUY A;  2GBM A;  1Q0W B;  1ZGU B;  2ZZP B;  3QK0 A;  1KLV A;  3VVW B;  1E8W A;  4OVU A;  4EOY A;  2KTF A;  4IM0 A;  3A9J B;  2J0K A;  1E7V A;  2JRH A;  3ZNH B;  2BF8 B;  1YQB A;  1S1Q B;  2KX3 A;  3CST A;  1WGR A;  1TGZ B;  3JSV A;  4BVU C;  1EF5 A;  2LVP A;  2ZCC A;  2FNJ B;  2WYQ A;  4F1S A;  1GUA B;  1WGG A;  2N9X A;  4DHZ B;  4RM9 A;  4FHJ A;  4N9F 4;  3PPA A;  4WQO B;  5J17 A;  3KUC B;  4TQ1 A;  4MGK E;  4DBG A;  2AYO B;  2DHZ A;  3ZKJ C;  1J0G A;  1UH6 A;  2G45 B;  2LXA A;  3DBL I;  4DDG D;  4HLE A;  2LVQ A;  2NPT A;  5LLI A;  1IYF A;  2N4F A;  4XZ4 A;  2IO1 B;  4NQK E;  3DPD A;  3NS8 A;  3PHW B;  4K7W A;  3HM6 X;  1AAR A;  3AU5 A;  2L8J A;  3NHE B;  4ZRK A;  1WX7 A;  1OEY A;  2PEA A;  3CF6 E;  1LFD A;  4FLH A;  1D3Z A;  3ZTC A;  2G3Q B;  2N1W A;  3EHV A;  3APF A;  5E6N A;  3PRZ A;  2O6V B;  1WE6 A;  3DOW A;  2KC1 A;  3VH3 B;  5D2M B;  1WZ3 A;  4MJS B;  4W9C A;  5G2N A;  4F8C B;  1Y8R C;  3R7R A;  5IA7 A;  1WM2 A;  2V1Y A;  2D11 A;  3Q3J A;  1WGH A;  2KWC A;  4GDL B;  3V6E B;  4B6W A;  5LXH A;  3WAN A;  4NAW B;  2LAS A;  1A5R A;  2DAJ A;  4XX5 A;  2NBW B;  5DPT A;  4RMA A;  5E6O A;  4ANX A;  2GBK A;  1NDD A;  4F7Z A;  1WJN A;  3DVN V;  2L00 B;  4DK5 A;  1WMH A;  2Z59 B;  1E8Z A;  3JSV B;  3JW0 X;  1P3Q U;  2JXX A;  2KK8 A;  2YVC A;  1H4R A;  2GBN A;  1UBQ A;  2JZZ A;  3B1L X;  1P1A A;  3TIX A;  2KLC A;  4DHJ D;  2FCS A;  4EUT A;  3L54 A;  3L17 A;  4NNJ B;  3QQ8 B;  5JHA A;  2L76 A;  2BGF A;  2FAZ A;  4GDK B;  2CKH B;  3ONS A;  2MCN B;  2BWF A;  3RUL A;  1LM8 B;  1V49 A;  4K7S A;  2KTR A;  2HTH A;  3HK0 A;  3ZRF A;  4URK A;  1L7Y A;  3A9K A;  4IC7 B;  1ZKH A;  2NPT B;  1J19 A;  2DZM A;  4W9H A;  2RR9 A;  1LXD A;  3QWZ B;  1SE9 A;  2XBB C;  1P98 A;  3MHS D;  2CU1 A;  1R4M I;  1SIF A;  3VTW A;  2KLG A;  1TBE A;  2ZCB A;  3PLU A;  1WJ4 A;  2ZNV C;  3ML8 A;  2IO2 B;  1WX9 A;  2HJ8 A;  3VTU A;  1UGM A;  3UIN B;  3A4S C;  4GOC A;  4FAD A;  1F9J A;  4FA6 A;  1JRU A;  2K1F A;  3VH4 B;  3ZVV A;  3B08 A;  2K8B A;  2WX1 A;  3DBH I;  3PSE B;  4M8M A;  1KJT A;  3N3K B;  3QAQ A;  5L83 A;  3WAP A;  5KHQ A;  2VRR B;  4AWJ A;  4IM2 A;  2I1K A;  2WX0 A;  3KUD B;  4IW0 A;  4MH0 E;  4DDI D;  3H6N A;  2O6V D;  1XD3 B;  2M1M A;  3N30 A;  1E90 A;  2FUH B;  2KNB A;  3L0W B;  1WMH B;  2GBR A;  2DZJ A;  2K25 A;  2MW5 A;  4KSK C;  4W9E A;  4W9D A;  1U4A A;  4YL8 A;  1J8C A;  2EMT A;  2WDT B;  4ZDV A;  4PS3 A;  3M95 A;  2BYF A;  2LJ5 A;  2PPH A;  2KOX A;  4RM8 A;  4BKT A;  4MGI E;  2LXC A;  4IWP A;  1S3S G;  4BOS C;  4EFO A;  5L95 C;  2KC2 A;  4E3C A;  2NBU A;  2A4Z A;  2OOB B;  1KM7 A;  2N9E B;  4ICU A;  4M8N A;  2KTR B;  3X0W A;  3NY5 A;  4ICV A;  2EMS A;  3A9K B;  2KQ7 A;  2D2Q A;  4W9K A;  2MQJ A;  1P9D U;  4I6N B;  3IG3 A;  3VAW A;  4I6L B;  5CX3 A;  5AZH A;  3TJP A;  1V9J A;  4TV3 A;  1WE7 A;  4W9I A;  2LD9 A;  4W9L A;  2KXJ A;  2KZR A;  2UWQ A;  4ZRI A;  4II2 B;  1C1Y B;  2MX2 A;  3I3T B;  4II3 B;  3QCA A;  3APC A;  1WR6 E;  2GBJ A;  4KSL C;  4MDK E;  2JVC A;  4IWO A;  3JYU A;  3OJ4 B;  5TR5 A;  4BKS A;  1V86 A;  3QX1 A;  1PQS A;  1UD7 A;  2LVO A;  3M63 B;  5DPS A;  2OJR A;  4FN2 A;  3RYT A;  1CMX B;  2DYO A;  3ZIM A;  3RCZ A;  4KV2 A;  5HKH A;  3M62 B;  2K8H A;  3H7P B;  1R4N I;  3KW5 B;  2K6D B;  3PT2 B;  2LGX A;  3GOE A;  3NOB A;  1QZE A;  1UBI A;  3KH0 A;  2JT4 B;  2C7M B;  3HIZ A;  1VD2 A;  4HCP B;  2KD0 A;  2BWE S;  2LGY A;  2J0J A;  4WJQ A;  4KVG B;  2KJ6 A;  2KDI A;  4M0W B;  2KDB A;  1WXV A;  4PYZ A;  1OTR B;  4CHK A;  3MTN B;  4W9J A;  3H9D A;  3R3M A;  2DYB A;  3OLM D;  1WIA A;  3L13 A;  2LZ6 A;  3PHX B;  1WF9 A;  2MP2 A;  3L10 B;  3C0R B;  4FUL A;  4JLC A;  5C1Z A;  1EF1 A;  2MBE A;  5CHV C;  3DCG A;  2IY1 B;  3PZD A;  2CHW A;  4IUM B;  1GNU A;  2DEN B;  2BKR B;  2JRI B;  2AWT A;  3PVL A;  2HD5 B;  4MGZ E;  3L16 A;  2Y5B B;  3GZN I;  3QHT A;  3VFK A;  3QJZ A;  4BKG A;  3R66 C;  4PYU A;  2O2V A;  5KHO A;  2ZEQ A;  3RT3 B;  1K8R B;  3DVN U;  2KMA A;  2KFK A;  3DBR I;  3PV1 A;  4HXD A;  1Q1O A;  3WIM A;  4KDL B;  4ASW C;  1YX6 B;  3NZS A;  2LGD A;  4G0N B;  4WJO A;  3V62 A;  3HHM A;  3AXC A;  4LDT D;  4K81 A;  3L08 A;  2B3A A;  3QIJ A;  1NI2 A;  5G55 A;  5IAA C;  1L2N A;  4DWF A;  1RAX A;  4K7U A;  1OGW A;  1YJ1 A;  2KFJ A;  2PE9 A;  2ZVN A;  2C7H A;  2ZJD A;  3EC8 A;  2C9W B;  3W1S A;  3ZUN A;  3W1S C;  1EUV B;  2N9P C;  4IWQ A;  5D6J B;  4MEL A;  1V80 A;  2MBO A;  3WAL A;  4FBJ B;  2GMI C;  2JPH A;  4MSM B;  3Q3F A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...