2PPHA

Solution structure of human mekk3 pb1 domain
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
93
structure length
93
Chain Sequence
QSDVRIKFEHNGERRIIAFSRPVKYEDVEHKVTTVFGQPLDLHYMNNELSILLKNQDDLDKAIDILDRSSSMKSLRILLLSQDRNLEHHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Mitogen-activated protein kinase kinase kinase 3
publication title Insight into the Binding Properties of MEKK3 PB1 to MEK5 PB1 from Its Solution Structure.
pubmed doi rcsb
source organism Homo sapiens
total genus 14
structure length 93
sequence length 93
ec nomenclature ec 2.7.11.25: Mitogen-activated protein kinase kinase kinase.
pdb deposition date 2007-04-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00564 PB1 PB1 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 2pphA01
4FJZA 5DPTA 2ZPNA 2WX1A 3ENEA 4IM3A 3V6CB 3IBEA 5IAAC 3QC8B 2K8CA 3APFA 1BT0A 5AEKB 2J0MA 2C60A 2L7RA 4K1RB 2NCNA 1UH6A 2GBMA 2JY6A 3A4RA 3PLVA 1UZXB 2K6DB 3CF6E 1WH3A 4GSWA 3CMMB 2O2VA 5D7GA 2IYDB 4NAWB 2D10A 3B0AA 1UBQA 2FAZA 3H9DA 4DWFA 3VDZA 3PRZA 2KK8A 3EECA 2IY0B 2LI5A 2KFKA 2IZVB 2OJRA 3HK0A 3AULA 2DHZA 2K25A 3PREA 3UQBA 4FADA 1WR1A 1GG3A 2MBEA 3ZW3A 1I35A 4BOZB 3VHTC 2MP2B 3ZNID 3ZTCA 3V62A 1VCBA 3VTVA 4B9KA 4OVVA 5KHQA 4GOCA 2M17A 4NQLB 4RMAA 4TV3A 2KD0A 5TR5A 3QAQA 1P1AA 4ANVA 1UBIA 2WWZA 1A5RA 3D32A 2FCQA 3IG3A 2EKEC 3DVNU 4DK5A 1J0GA 1OQYA 4M8MA 4M0WB 4ZRIA 2ZVOA 4W9CA 2N9XA 2W9NA 4EZJA 2XEWA 1GNUA 4W9LA 3N32A 4IC7B 3IVFA 3OAWA 3L54A 3NHEB 3V60A 4G3XB 4AJYB 1E8ZA 1VD2A 4YL8A 3U30A 1IYFA 4ZYNA 4DDGD 3T8MA 2J0JA 3VVWB 4EKUA 2XBBC 3A9KA 2L0FA 2AL6A 1E8XA 3OJ3A 4GIVA 1C3TA 3KYDD 4NY0A 4CYEA 3UIPB 1SGHA 1WXAA 2DYOA 3QX1A 2KC1A 3R7RA 3PS6A 1NBFC 2L0TA 1WMHB 1WJ4A 1YJ1A 3DPDA 2KWUB 2LVQA 4E71A 1K8RB 2FIFA 2K1FA 2Z0DB 1WGYA 2I1KA 4K7UA 3SHQA 2N1WA 3H7SA 3VUXA 1WE7A 2JPHA 2MBOA 3RUIB 3VAWA 4FBJB 3MTNB 3HM3A 2IO0B 2N7EA 3KUZA 3L17A 4GU2A 2JT4B 2MW5A 1WYWB 4NAWA 1WRDB 2NPTB 4K81A 1R4MI 1IP9A 3AU4A 3DBLI 3JW0X 1XD3B 4A20A 2XK5B 3VQIA 1KM7A 2DZJA 2IO3B 2MA9B 2LRWA 1SIFA 2YLMA 3K9PB 4ICVA 4LJOB 1S1QB 2ZEQA 3A4SC 3RD2A 2D07B 2DZKA 2MP2A 4HVBA 1E7VA 3TCAA 1Z2MA 1ZW7A 4F8CB 4ANUA 4KSKC 5AZHA 2KN5A 5DPWA 5CHWA 4W9DA 3R3MA 2FNJB 4WAAA 3ML9A 3ZLZA 4RM8A 1IPGA 5E6PA 2GBJA 5HKHA 2MBQA 2BYVE 2KWVB 2C7NB 3JSVB 3KYCD 3DVGY 1WF9A 5C1ZA 1FXTB 1P0RA 1WJUA 2KDFB 4TQ0A 4PYZA 4BBNF 4DXAB 3M62B 1Z5SB 4DHZE 3GZNI 1WGRA 2PEAA 3A33B 5KHOA 4KIKB 5JHBA 4W9IA 2A5UA 4MSMB 3ZTDA 4BKGA 2LGXA 3B1LX 4KSLC 4EEWA 3ZVVA 2AEHA 2ZPYA 3O65B 3NOBA 2O6VB 4BKTA 2QHOA 4FJYA 4MH0E 3WA0A 1NI2A 5DPSA 4I6LB 1EF5A 4F1SA 4NJ6A 2BKRB 2C7MB 4ICUA 5LXHA 2JRHA 3TL5A 3ZNGC 4LDTB 2DENB 4NQKE 4PYUA 3H1UA 1WM3A 3H7PA 2KX3A 2BYFA 4WJOA 4ZDVA 4MGIE 2L8JA 1E8YA 4TKNA 1TBEA 2D2QA 3KH0A 3IHPC 3V6EB 1RRBA 1AARA 1RAXA 1WE6A 3OLMD 4XZ4A 3R7QA 3PRMB 4BVUC 3ALBA 2BF8B 1Q5WB 2M8SA 3JYUA 3EFUA 4JLCA 1JRUA 3A1QA 4LCDE 4GDLA 2KANA 3A9JB 4FLHA 3QCAA 2G3QB 2BWES 3DBSA 4HLEA 2MX2A 3ONSA 3S2AA 1R4NI 3P2BA 4HK2A 3KW5B 2ZNVC 2LGDA 1WZ0A 2CU1A 3OJ4B 1E8WA 3PGEA 4WWNA 3ZO5B 3V61A 4TUUA 2CS4A 2DAFA 4EZLA 2MCNB 4FULA 4RM9A 4HDOA 2BWFA 5E6OA 1WFYA 4AJWA 4ASWC 1TZ1A 4BKSD 1V6EA 2JRIB 1E5WA 3DCGA 2NBVB 4HDQA 1RLFA 3CSTA 1V86A 2DZIA 3K9OB 3TMPB 2DX5B 4EUTA 1EUVB 1UD7A 2G4DB 4ZRKA 2HTHA 2DYBA 4IWOA 2GMIC 3Q3FA 2KNBA 3QQ8B 2RD0A 5CX3A 3U8ZA 1V5OA 3ZUNA 2B3AA 2O6VA 2N7DA 3UIOB 5J18A 3WALA 4EFOA 3QWZB 3EC8A 1TTNA 4EOYA 2FIDA 4B95A 4HWIB 3ZNHB 2CKHB 5CHVC 3NZSA 3Q3JA 1GC6A 4FHJA 1QZEA 2KOXA 3W1YA 2M1MA 1WX7A 4BKSA 4NJ7A 1WIAA 4HCNB 4FA6A 3UQAA 2KX0A 1EO6A 1L2NA 1D3ZA 2ZZPB 2IO1B 1ISNA 4XX5A 1CMXB 2MBBB 3X0WA 1E90A 3WANA 2ZCBA 2BGFA 3W1SA 3KUDB 2NS5A 4E74A 1G6JA 3ZKJC 2J7QB 3ZRCA 4HXDA 5AZGA 4MGKE 4WWPA 2KWCA 4BFRA 3L10B 2CHXA 1X1MA 2KTRB 1UGMA 2LRUA 2BPSA 4MGYE 2K8BA 4WJPA 3NY5A 5C23A 4P7IA 4W9HA 1PQSA 2R2OA 2UYZB 2L00B 4KZCA 4TQ1A 4NPNA 2KXJA 1P98A 2O2VB 4BOSC 3GOEA 5LXIB 1OTRB 2C7HA 2L3ZA 2LGYA 3LJ3A 4MEMA 5IA7A 3N30A 4GB9A 3DBHI 2UWQA 2AYOB 3ZDMC 2JXXA 4KZ0A 2WYQA 3RZWC 3L16A 4IUMB 1YX5B 4BBNC 5LLIA 2EMSA 2LXCA 4W9FA 3UGBB 4ANWA 3NZUA 4GMVA 2WX0A 2LZ6A 1V49A 2KLCA 2V1YA 2LD9A 2ZVNA 1WGDA 2LJ5A 5CHFA 3QK0A 1I42A 1WX9A 3VUYA 1XT9B 4F7ZA 4DBGA 2KJ6A 2L05A 1WX8A 3ECIA 4A3OA 4AOFA 1NDDA 2JWZA 1GC7A 2D3GA 2MRPA 3CSFA 4WJQA 1YQBA 2KQSA 4GN1A 4CO7A 3PVLA 4GDKB 4DHJB 1V81A 4WJNA 3RZFA 1WXMA 4AP4C 4FJVB 3H6NA 1KJTA 4WQOB 2N4FA 2RPQA 3PPAA 1F9JA 1WMHA 1EF1A 2AL3A 4PS8A 5EDSA 3PSEB 2N9EB 4XC2A 4I6NB 1WR6E 3KUCB 2V3SA 1HE8A 4PS3A 2KMAA 3ZIMA 2LXAA 4OVUA 2OOBB 2NR2A 2REXA 4K7SA 1WGHA 3DVGX 3NS8A 2L76A 4MJSB 5CTRC 2BYEA 3ZNZB 2Z0EB 2K8HA 2NPTA 4URKA 2DAJA 3DBRI 2DYMA 3M95A 4EZKA 3I3TB 4I6PA 1WJNA 2KQ7A 3AI5A 2RR9A 2KTRA 3C0RB 4N9F4 2FUHB 2KC2A 2XK5A 1Q1OA 5G55A 2KVRA 3UF8A 1V80A 2M4NA 1Y8RC 2MWSB 4G11A 3VFKA 1H8CA 1OEYJ 1L7YA 2M0XA 4IWQA 2O6VD 1LXDA 4CHKA 3L0WB 2JZ3B 3L13A 4KDIC 5E6NA 1V2YA 2GOWA 1OEYA 3EHVA 4DHJD 2V4LA 3ZDTA 4AWJA 2A4ZA 2R2QA 2Z59B 2KLGA 2LVOA 3N3KB 2KMCA 2ASQA 3QIJA 4FN2A 2K39A 2KDIA 3R66C 4LDTD 3VUWA 3HHMA 1V9JA 2ZJDA 3T9LA 2MQJA 4JIOU 3MHSD 5GMVA 2IO2B 5DCNA 3X23A 4W9GA 3LDZE 3JSVA 2PE6B 4E3CA 2BKFA 1T0YA 2HD5B 4II3B 2KO3A 1YX6B 2RGFA 4B6WA 2HE7A 2CR5A 2J0KA 3APDA 2AWTA 3AXCA 4KIKA 1TGZB 3TIXA 1ZKHA 2FCMA 1S3SG 2KTFA 1Q0WB 1P9DU 2JUOA 4W9EA 4GGQA 3WAPA 4X57B 1WXVA 3PZDA 4IM2A 4DHZB 2G45B 1LM8B 2YVCA 2ZCCA 4IG7B 5J2RA 1UELA 1KOTA 3VH3B 1GUAB 2RSUA 4GDKA 2PJHA 2NVUI 1WXSA 3VXWA 4NNJB 1XQQA 4W9JA 2KFJA 4GXBA 1P3QU 3ZRFA 1WM2A 2IBIB 1WY8A 1ZGUB 1OGWA 3VH4B 2JVCA 2C9WB 2IY1B 3B08A 3WAOA 5JH5C 3JVZX 1WZ3A 2NBUA 4KDLB 5D2MB 1KLVA 2KHWB 2KDEB 1LFDA 2MBHA 4HCPB 4MM3A 2G4SA 2KKCA 3RYTA 4KV2A 2PPHA 4MDKE 3SDLC 5L95C 4MJSA 5L83A 2DZMA 4G50A 4JGHB 2KJRA 3VTWA 3HM6X 2CHZA 3A9JA 5DPRA 4K7WA 2C5LC 3W1SC 1GJZA 3RCZA 4IM0A 3M63B 3H7PB 3IFWB 1J8CA 4LJPB 3PTFC 3PHWB 5D94A 3QARA 3SU8X 4AUQC 2HJ8A 3ML8A 1RFAA 1J19A 2VRRB 2N1VA 1U4AA 2GBRA 4KVGB 3A1QB 3PV1A 4FHKA 4WWOA 2GBKA 3BY4B 5JZEB 3M3JA 4GDLB 4PS7A 2ZNVB 4JL9A 4DDID 2WDTB 1E7UA 2KFKB 3KVFB 3BINA 5D6JB 3PHXB 4IW0A 3PT2B 3TJPA 4ANXA 4HJKA 3VTUA 1SE9A 3QHTA 4M8NA 3PRPB 3QA8A 2GBNA 2CHWA 1YIWA 2LWPA 3PLUA 3MJWA 4IWPA 3UINB 2FCNA 3DDCB 4HPMB 1LQBA 4MGZE 4G0NB 2LUEA 2NBWB 3QJZA 2FCSA 1M94A 5JHAA 4HPLB 1C1YB 2D11A 2Y5BB 3AU5A 4W9KA 3WAMA 2MSED 4ZRJA 2JZZA 2K6QA 5AZFA 3SD5A 1YD8U 4II2B 2EMTA 4JQWC 2LASA 2JF5A 1V5TA 4MELA 3L08A 2LVPA 3APCA 3DOWA 3HIZA 2N9PC 3TBLD 2PE9A 1WI0A 4J6IA 2KJHB 1MG8A 5G2NA 5FR6A 2MLBA 5J17A 4A3PA 3DQVA 1WJ6A 3RULA 3A9KB 2I1JA 2KZRA 3RT3B 4MSQB 1H4RA 5BO4B 3U7DA 1WGGA 3WIMA 3DVNV 2KDBA
chains in the Genus database with same CATH superfamily
4FJZA 1L6UA 3ENEA 3V6CB 3ZYYX 3APFA 2J0MA 2PVOD 5EE1A 4RF1A 3PLVA 1HZ5A 2K6DB 3B0AA 2N9LA 1RM6C 4ZHOA 3H9DA 2KDMA 2KK8A 2WDQB 3AEGB 1GG3A 2MBEA 1I35A 3VHTC 3ZNID 4RMAA 4P1CC 2IGDA 3AEEB 2WWZA 2J52A 3D32A 1RFKA 1ZUD2 1PGBA 1SSNA 2ZVOA 4W9CA 2E6XA 2AQ3B 1YQ4B 1GNUA 1N61A 3IVFA 3OAWA 4YL8A 4YT0B 2D3BA 2PW9A 3T8MA 5BMGA 3VVWB 4EKUA 3A9KA 1I7HA 1C3TA 1SGHA 2DYOA 1OFFA 2KC1A 1FXIA 3R7RA 3PS6A 1CZPA 2K0PA 2RPVA 1YJ1A 3LXFA 2WXFA 2W3SA 1VRAB 1EWYC 2LVQA 2Z0DB 2INCC 3H7SA 1QOGA 2JPHA 3ZGZA 4FBJB 3MTNB 3HM3A 3KUZA 4ARCA 2VZKB 1SEBD 5I4DA 1WRDB 1E7PB 1IP9A 3HUIA 3JW0X 3MP9A 2XK5B 3IAS1 2MA9B 2LRWA 1QF6A 3MC0B 1SIFA 1KRHA 1K53A 3K9PB 3RD2A 1E7VA 4F8CB 1Z2MA 1ZW7A 3FKYA 4HJGE 1R4NB 3AE1B 5CHWA 4W9DA 2FNJB 4WAAA 3ML9A 2BYVE 2KWVB 2C7NB 3KYCD 4RGOS 1WJUA 1JWMD 1IGDA 2KDFB 1NYQA 2WQYB 4DHZE 3GZNI 5KHOA 4KIKB 4BKGA 3B1LX 4PK1A 1JWSD 2ZPYA 4BKTA 4MH0E 1NI2A 4NJ6A 1TKGA 5LXHA 1TY0A 3B9JA 2QILA 1NVID 1L0XB 3H7PA 2KX3A 4WJOA 3MHZA 1TYGB 5HFYA 3KH0A 3AE5B 3V6EB 3PRMB 3I5JC 3Q3NC 4WAFA 3EFUA 1JRUA 1C79A 3H8HA 1TJEA 5D3DA 2KANA 4FLHA 3QCAA 3PZ7A 3DHIC 3IAM1 2BWES 1T3QA 1M4VA 1ZXHA 5C2TB 2LGDA 1MJDA 1QT9A 3BYYB 2CU1A 3OJ4B 4WWNA 1EU4A 1K50A 3Q69A 4AJWA 4ASWC 2QC8A 1AYFA 1E5WA 1T6BX 2NBVB 4HDQA 3CSTA 3GE3C 1RWSA 3V3XA 2KNBA 3U8ZA 3UIOB 4EFOA 1A70A 4HWIB 1DOIA 2QEJC 1GC6A 2KOXA 4XWWA 3MC9A 4NJ7A 3AB5A 3ABVB 4WWMA 1D3ZA 1L2NA 4XX5A 5GXGB 3AM9A 2MBBB 4A8XC 1E90A 4EE2A 3W1SA 3HRDD 4WWPA 2CHXA 2KTRB 1UGMA 2WXIA 3BZDB 4MGYE 2UYZB 4KZCA 1IBXA 4BOSC 1HZ6A 1OTRB 2C7HA 2JZPA 4JX1C 4QAYA 3ZDMC 1D4BA 3RZWC 4KKIA 4IUMB 1YX5B 5LLIA 4P1BC 3T3OA 3UGBB 2WXHA 3NZUA 2V1YA 1WGDA 2LJ5A 4HPPA 5HI1A 3TEYA 3VUYA 1TS4A 3R8BA 1WX8A 1GPXA 4A3OA 1D6EC 1V97A 4GDKB 2JX5A 1HEZE 1V1OA 3H6NA 2AQ1B 2RPQA 3PPAA 1F9JA 1HQRD 4I6NB 3OWEB 1GB4A 4BZAA 1D5ZC 3BIID 3W2DA 3DBRI 3P4PB 2N7JA 4I6PA 4YSXB 3UF8A 1Q1OA 2LHEA 3VFKA 1OEYJ 2JZ3B 4Q2JA 5E6NA 2BS3B 3TEXA 3EHVA 3ZDTA 4AWJA 3L4PA 2R2QA 4FN2A 3AE4B 2WXKA 3HHMA 1V9JA 4JIOU 3N1XC 2IO2B 3LDZE 3I57A 3JSVA 1ZPSA 5BYSA 2HE7A 2AWTA 5C3JB 3TIXA 1S3SG 1P9DU 2JUOA 3WAPA 1XO3A 1JMLA 4IG7B 1LM8B 2IJ0A 2YVCA 2ZCCA 2WHIA 3SR6A 2VH2A 4NNJB 4DXGA 3MJ5A 2IBIB 1OGWA 3WAOA 3JVZX 5D2MB 2KHWB 4MM3A 2W54A 2G4SA 1AWDA 3RYTA 4KV2A 2PPHA 3VR8B 2EELA 4MJSA 2DZMA 3AV8A 3A9JA 3RCZA 3KLSX 3H7PB 4IDIA 1J8CA 4RGMA 2FE8A 4AUQC 3QARA 4S0RA 4ZOHC 2JXTA 3E9SA 2N1VA 1VDVA 4C56C 2GBKA 1XLNA 5JZEB 3BK1A 3U7ZA 2KFKB 3CIRB 3PT2B 4XE0A 3TJPA 4HJKA 3QHTA 1ZXIA 4M8NA 1ACCA 4IWPA 3MJWA 4HPMB 4H2AA 2LFIA 2GRIA 2WXJA 1M94A 2XNAC 1C1YB 2D11A 4W9KA 4KX6B 4LLGM 1YD8U 1FPYA 3AEAB 4JQWC 1JCKB 4MELA 3L08A 1UGJA 2LVPA 1T0QC 3HIZA 3TBLD 1WI0A 2PTLA 2KJHB 2AX5A 1MG8A 2MLBA 3GB1A 1I4PA 1NYRA 5FKAC 5J17A 4A3PA 4L1BA 2KZRA 3O13A 3U7DA 2KQ4X 3DVNV 4YWGG 3IBEA 5IP4D 1BT0A 4K1RB 2NCNA 1UH6A 4ARIA 3FILA 3URYA 1FCLA 1UZXB 3CMMB 2BBCA 3SEBA 1LO5D 2IYDB 1IUEA 4NAWB 1UBQA 2KWDA 2M56B 2IY0B 2LI5A 3HK0A 1TKEA 1QILA 2WP9B 3AULA 3PREA 4NZLB 3LB8C 1WR1A 2CJOA 3ZW3A 2RMMA 4BOZB 1IBXB 2MP2B 3BYTB 3VTVA 5KHQA 4GOCA 4TV3A 1TS5A 5TR5A 1ESFA 2KT7A 3Q8BA 3DHGC 1J0GA 3DVNU 1OQYA 4M8MA 2N9XA 2XEWA 4YTPB 3N32A 4IC7B 4AJYB 1E8ZA 2DWQA 1IYFA 4ZYNA 4C4VB 3RI7C 1J7AA 2J0JA 2XBBC 3GZNB 4GIVA 3OJ3A 3KYDD 3UIPB 1WXAA 3QX1A 3Q8FA 1NBFC 2MJEA 1BUIC 3P1MA 1P7FA 2I38A 2KWUB 3AE2B 2FIFA 1L4ZB 3VUXA 3RUIB 2IO0B 2N7EA 1PGAA 2MW5A 1WYWB 4K81A 3EA6A 5FR3A 2TSSA 1DOXA 1KM7A 1T0SC 2IO3B 1N5XA 1HA5A 4LJOB 2DZKA 3Q6BA 3EUB2 1FRRA 5AZHA 1IGCA 2KN5A 3J9CA 2WXMA 3R3MA 3ZLZA 2Y3AA 4RM8A 4IOIE 4M0WA 5HKHA 3JSVB 3DVGY 3AMZA 5C1ZA 4TQ0A 1TS2A 1UF0A 2D3CA 2LGIA 3ZTDA 3RNFC 1MHHE 4JWUC 3O65B 1MPEA 5BMIA 4FJYA 2X8XX 3VR9B 3WA0A 2MJ3A 1SE2A 4F1SA 2BS4B 2PMVA 2BKRB 2C7MB 2JRHA 3TL5A 2SAKA 4LDTB 2DENB 1YMHE 4WQMA 4NQKE 4FXCA 1OQQA 1ZDXA 2ON8A 1KF6B 4LK0M 4MGIE 1ZDVA 4TKNA 3IHPC 1VZ7A 2B76B 1F77A 2DBYA 2L52A 4BVUC 1WRIA 1XLOA 2M8SA 3JYUA 4LCDE 3A9JB 2IGHA 3DBSA 3ONSA 3P2BA 3KW5B 2N9KA 5G5HA 3V61A 4LNFA 4EZLA 5H8YE 1DOYA 4FULA 1V8CA 4HDOA 2BWFA 4ZRPA 4KGTA 4BKSD 4HKQA 4RCOA 3R2TA 2UU7A 3Q2AC 4J3OD 4M02A 2WDVB 1RLFA 1V86A 2DX5B 4ZRKA 1JRPA 2GMIC 3QQ8B 2RD0A 1UWXA 1V5OA 1MI0A 2B3AA 2O6VA 1FMAD 3AE7B 3WALA 2FIDA 3NZSA 4JE3B 1QZEA 1ENFA 1WX7A 1UWMA 4HCNB 3UQAA 1EO6A 2LGSA 2INPE 1CMXB 4OW0A 3X0WA 3GS2A 1FM0D 3PZ8A 2NS5A 3P4QB 5AZGA 4TSSA 2E3TA 2KWCA 1X1MA 2LRUA 2BPSA 1MFWA 2K8BA 1FNUA 1DGJA 4W9HA 3FILB 3DBRB 2R2OA 2L00B 3VRBB 4XGAB 2KXJA 3GOEA 5LNK1 4JPSA 2L3ZA 5T8IA 1ZP0B 2JXXA 3ZXRA 4BBNC 3NRZA 2LXCA 2BVCA 3NVVA 1FRDA 4ANWA 2LZ6A 1V49A 2KLCA 1BMLC 5CHFA 1I42A 3QK0A 1WX9A 2QSDA 1XT9B 2MH7A 4YSYB 3RPFC 2KVZA 3OG5A 3ECIA 4AOFA 1JWUD 2D3GA 3CSFA 3KWLA 2KQSA 4CO7A 4DHJB 1V81A 3RZFA 4AP4C 4FJVB 3W5UB 2N4FA 2L83A 1WMHA 1ZE3D 4PS8A 1PGXA 4XC2A 1WR6E 2KYWA 2V3SA 2MEKA 1N5WA 2KMAA 3ZIMA 2LXAA 5HG2A 2XN9C 2BTEA 1VZ8A 1F2RI 3NS8A 3DVGX 2NPTA 4URKA 3M95A 3Q8EA 3C0RB 2OHFA 2V3NA 4N9F4 2KC2A 5G55A 1I4RA 1TKYA 2MWSB 1H8CA 1L7YA 2O6VD 2QCZA 1F0ZA 2JYEA 1XXGA 2KLGA 2LVOA 3VUWA 3R66C 4USAA 1YOVB 3T9LA 2MQJA 3MHSD 4WH4A 5GMVA 3X23A 4E3CA 4K3CA 4ZRQA 3DBLB 1E0ZA 4RGNA 2CR5A 1E6EB 2V3PA 3AXCA 2FCMA 1XEEA 3FAHA 3PZDA 4DHZB 1GUAB 1FNVA 2NVUI 1WXSA 1V1PB 4W9JA 5IO9A 1MG4A 2KFJA 3ZRFA 3DWGC 3HVDA 2IY1B 3B08A 1VZ6A 1KLVA 4HCPB 1J7BA 5L95C 2G9HD 4JGHB 4KKJA 2CHZA 5DPRA 4K7WA 3W1SC 3M63B 5EE9A 2L1AA 3TUOA 4LJPB 2V9HA 2QJLA 3PTFC 5D94A 1J19A 1SE4A 3RNGC 2JYTA 1U4AA 5H92C 5BYRA 2GBRA 4KVGB 3PV1A 4FHKA 4WWOA 4JL9A 4DDID 2WDTB 1E7UA 1I4QA 3PHXB 4IW0A 4ANXA 3PRPB 2GBNA 3PLUA 2FCNA 3DDCB 1TY2A 4G0NB 2LUEA 1PYWD 2Y5BB 2H89B 3AU5A 1XLQA 5AZFA 3ZXVA 2INNE 2EMTA 1V5TA 4LNOA 3APCA 3DOWA 3BWUD 4J6IA 2LEKA 4RH6A 1WJ6A 3NS1A 3A9KB 3RT3B 3RULA 1FCCC 4A90A 4NJCA 2KDBA 2KMMA 5IAAC 1L5PA 2K22A 2K8CA 3QC8B 3AN1A 2L7RA 2V4IB 2K5PA 1CJEA 1YN4A 4A55A 1YQ3B 3CF6E 1XCQL 2G1EA 4GSWA 2QDFA 2IZVB 2N0SB 2K25A 3UQBA 1CQVA 2DLBA 4TMAB 3W9CB 4FADA 5IKCM 1FFUA 3V62A 2WU2B 4NQLB 2KD0A 3QAQA 1P1AA 4ANVA 3VRAB 1A5RA 3IG3A 2W9NA 2I2YA 4OHJA 4W9LA 3L54A 3NHEB 1VD2A 3U30A 1AW7A 2BB6A 4DDGD 2J4XA 2PLPA 2AL6A 5G5GA 4NY0A 2H88B 2WXOA 4GLSC 3Q8CA 1I4HA 2KACA 2K3UA 2JWUA 1WMHB 4HROA 2JSVX 3DPDA 4N6EB 1SBBB 3SHQA 2N1WA 4M01A 2RDBC 1UUPA 3VAWA 3AE6B 1HXYD 1QOFA 3L17A 2NPTB 1R4MI 1QQRA 2HTME 3AU4A 3DBLI 1YN3A 1J7CA 3CWIA 1I4XA 2FUG1 2DZJA 2RDHA 2YLMA 4ICVA 1S1QB 4HVBA 2LUMA 2D07B 4R3DA 3IXSA 3TCAA 4YTNB 3U52E 2ZW0A 4KSKC 2BS2B 2WXPA 2Z8LA 5E6PA 2GBJA 1WF9A 1FXTB 1P0RA 3BK2A 4PYZA 4BBNF 5E6JA 1JROA 1Z5SB 3I9V1 1WGRA 3A33B 4C80A 5JHBA 1QKZA 4W9IA 2A5UA 3I63C 1K51A 2NMQA 4KSLC 3AEFB 3ZVVA 1MVKA 2BW2A 2BYTA 2QHOA 2X38A 4A9AA 4C7ZA 5DPSA 1EF5A 2KAJA 4ICUA 3ZNGC 3NUHB 5EE0A 1ROEA 3BVMA 2IDYA 3H1UA 1WM3A 2ACZB 4B0MA 2BT6A 4ZDVA 2L8JA 1E8YA 1DYQA 1N60A 1RRBA 4OVZA 1WXQA 1MHXA 2BF8B 3GP7A 4JLCA 1KH0A 2OEDA 1EWCA 3RMKC 2WXNA 3AE8B 4HLEA 2MX2A 3S2AA 4HK2A 2BQQA 1WZ0A 1JQ4A 3DHHC 1N63A 3ZO5B 4TUUA 2CS4A 2DAFA 3N20C 2MCNB 4RM9A 1I4GA 1TZ1A 1V6EA 3E56A 3DCGA 2NTTA 4XYCA 4MT5A 1STEA 2DZIA 3K9OB 1N62A 4B0EA 3P63A 3TMPB 1HTQA 4KGSA 4EUTA 1C4AA 2G4DB 3Q3OC 3NVWA 4IWOA 5CX3A 2WXQA 2N7DA 1Y56A 3QWZB 3EC8A 2PKOA 5CHVC 3Q3JA 4FHJA 4BKSA 4XWTA 3ZJTA 2KX0A 2IO1B 3WANA 2V0GA 2ZCBA 2MHJA 4E74A 1G6JA 3ZRCA 1TZOA 1GB1A 4HXDA 4BFRA 1VJKA 4ZHPA 2Q5WD 4P7IA 1PQSA 4XDCA 4TQ1A 2CJNA 4NPNA 2K9XA 5LXIB 4MEMA 2LGYA 3LJ3A 5IA7A 3N30A 1L0VB 3NVZA 4GB9A 3DBHI 2WYQA 3L16A 3IT4B 2EMSA 2D5GA 4GMVA 3WCQA 2NTSA 2LD9A 1NENB 4F7ZA 2VZKD 3U2SC 2MRPA 3GE8C 1YQBA 3UI3A 4GN1A 4WJNA 1WXMA 2GI9A 4N58A 1KJTA 4WQOB 3RNEC 1UNSA 2L32A 1EF1A 4US9A 3PSEB 1EU3A 4OVUA 2OOBB 2NR2A 2REXA 4MM3B 4K7SA 1WGHA 5CTRC 4MJSB 2L76A 1TIFA 2DAJA 1TT5B 3I3TB 1B9RA 2RR9A 2KTRA 1YJIA 2FUHB 2KVRA 1V80A 2M4NA 2M0XA 2HJ1A 4IWQA 1LXDA 4CHKA 3L0WB 3L13A 1V2YA 2GOWA 1OEYA 1LGRA 4DHJD 2V4LA 2A4ZA 2ASQA 1RYJA 2KN4A 4ITKA 3MFGA 4W9GA 2WXLA 2BKFA 1T0YA 2HD5B 1P7EA 4II3B 2KO3A 1YX6B 3APDA 1TGZB 2KTFA 4W9EA 4GGQA 4A6QA 4X57B 2ZW1A 1SE3A 2Y5PA 1KOTA 5J2RA 1FFVA 1WWTA 2CU3A 4GDKA 2PJHA 3P4SB 3BVGA 1NEKB 1SJED 3RN9C 1T5XD 1WM2A 2WGSA 2WXGA 2JVCA 2C9WB 1KTKA 1WZ3A 2KDEB 2MBHA 3SDLC 2KKCA 5BYQA 4MDKE 1KLUD 5L83A 2IPKD 4G50A 3BVZA 1QOBA 2KJRA 3VTWA 2DNFA 2C5LC 1GJZA 1YN5A 2SEBD 3IFWB 3PHWB 1C4PA 4OZBA 2HJ8A 3ML8A 3RNBC 4K3BA 1E10A 4HEA1 3BY4B 3M3JA 1C4CA 4PS7A 1K52A 5AUKA 3ETRA 3KVFB 5D6JB 5TSSA 4O1NA 1SE9A 2PVGC 3QA8A 1YIWA 2Y5CA 1LQBA 2M19A 4RGTA 5JHAA 4HPLB 2MSED 3Q8AA 4ZRJA 4D2KA 3SD5A 1QOAA 4II2B 2LASA 2PE9A 2W3RA 3TSSA 4IKGA 3NZ3A 1KLGD 2QIEB 2I1JA 4MSQB 1H4RA 2VH1A 2GLSA 3WIMA 2D3AA 5DPTA 2ZPNA 2WX1A 1C9FA 4IM3A 1F1HA 4YTMB 5AEKB 1SF0A 2C60A 2GBMA 2JY6A 5MPOA 3A4RA 1JALA 1WH3A 2O2VA 4OZAA 5D7GA 3N1YC 2D10A 2FAZA 4DWFA 3VDZA 3PRZA 5BMHA 3EECA 2KFKA 2OJRA 1KFYB 2DHZA 4PT5A 1R4MB 1OQRA 3ZTCA 1VCBA 4ACFA 4B9KA 4OVVA 2M17A 1UBIA 2FCQA 2EKEC 4DK5A 4M0WB 3AEBB 4ZRIA 4EZJA 3V60A 4G3XB 2LJIA 4OZCA 3V05A 1XLPA 2L0FA 3AECB 1E8XA 1VLBA 1FXAA 3Q14C 4RFBA 4CYEA 2M0AA 3MC8A 1C77A 4P6VF 2L0TA 5EE3A 1WJ4A 1QLBB 4E71A 1K8RB 2K1FA 5JXVA 1WGYA 2I1KA 4K7UA 1WE7A 2MBOA 2BB5A 1WGKA 1NI3A 4GU2A 2JT4B 4NAWA 3C19A 4RNAA 1XD3B 3KWVA 4YXDB 4A20A 3Q3MC 3VQIA 2R61A 2ZEQA 3A4SC 3TEWA 2MP2A 2MJDA 4ANUA 4YSZB 1SIJA 5DPWA 4L23A 1IPGA 3N1ZC 2MBQA 3RNAC 2LHDA 4ZYSA 1PUTA 4DXAB 3M62B 3R2IA 2PEAA 4MSMB 2LGXA 4C4VA 3FC4A 2ONQA 4EEWA 2AEHA 2JU6X 3NOBA 2O6VB 2YEPB 3NG0A 4I6LB 4XDDA 3TEZA 1FO4A 4PYUA 1JW9D 1WSPA 2BYFA 1F2RC 2RDGA 1TBEA 2D2QA 1AARA 1RAXA 1WE6A 3OLMD 4LNIA 4XZ4A 3R7QA 3ALBA 1ZOYB 1Q5WB 2WLBA 3A1QA 2WS3B 1EM7A 4GDLA 2FBWB 5D3IB 3LYYA 1BXTA 2G3QB 2PIAA 2WXRA 4JWSC 1R4NI 1B1ZA 2ZNVC 1E8WA 3PGEA 1XCTL 1XF5L 3HVZA 5E6OA 4US8A 1WFYA 2JRIB 3C8YA 3DBHB 2J42A 1EUVB 1UD7A 2HTHA 2DYBA 3Q3FA 1FNWA 1R7SA 3ZUNA 5J18A 2OJWA 1TTNA 4EOYA 4UDUC 1SXTA 3SFEB 4B95A 3ZNHB 2CKHB 3AEDB 1L4DB 3W1YA 2M1MA 1WIAA 4FA6A 2GB1A 2YEPF 2ZZPB 2J53A 3N9YC 1ISNA 1Q10A 2BGFA 3ZJVA 1TS3A 3KUDB 3ZKJC 2J7QB 4MACA 4LTUA 4MGKE 3L10B 4WJPA 5IN7A 3NY5A 5C23A 3RFZB 1JWBD 4DXFA 1P98A 2O2VB 1SJHD 1WYGA 3ZJUA 3U4EG 2UWQA 2AYOB 3AH7A 4KZ0A 4AS1A 5FK9C 3P4RB 4W9FA 2WX0A 4L2YA 2ZVNA 4N59A 1F52A 4DBGA 2KJ6A 2L05A 4REZA 3T3NA 1NDDA 2JWZA 1GC7A 4WJQA 1SB3C 3PVLA 1D5MC 2WDRB 3B2GA 4WIPA 3W5VB 1GOZA 3KQ4A 2AL3A 3SFDB 5EDSA 2N9EB 3KUCB 1GAQB 5IOIA 2ICIA 1HE8A 2JQRB 4PS3A 2LMCA 3NVYA 2EKIA 4HRSA 3ZNZB 2BYEA 2Z0EB 2K8HA 4DQOC 2DYMA 4EZKA 1WJNA 2KQ7A 2WU5B 3AI5A 2XK5A 1Y8RC 4G11A 4KDIC 5AUIA 1YJJA 1E9MA 3N3KB 3QIJA 2Z59B 3IT6B 2KMCA 2AQ2B 2K39A 2KDIA 4LDTD 4CQNA 2ZJDA 4P16A 4S17A 2HDEA 5DCNA 1AN8A 2PE6B 4AQ7A 2RGFA 4B6WA 2J0KA 4KIKA 1ZKHA 2INDC 1Q0WB 1WXVA 4IM2A 2G45B 4KGRA 1PFDA 1UELA 3VH3B 2RSUA 1JWAD 2W55A 3VXWA 1FD6A 1XQQA 4GXBA 1P3QU 4LNNA 1WY8A 1ZGUB 3VH4B 5JH5C 4RF0A 2NBUA 4KDLB 1LFDA 3AE9B 4LNKA 4C00A 1C76A 1ET6A 3HM6X 2W82A 4IM0A 4C7YA 1YNTE 1ET9A 3RNCC 3P42A 3SU8X 5HHDG 1RFAA 2VRRB 3PO0A 1PDXA 1D5XC 3A1QB 3EFCA 1T0RC 4GDLB 2ZNVB 1L0YB 1N6ZA 3AE3B 3BINA 1L6VA 3VTUA 1CK1A 3ZQ4A 2WNMA 2CHWA 4NAMA 2LWPA 4MH8A 1FEHA 3UINB 4BAXA 1FIQA 1HTOA 4MGZE 4HKZE 2NBWB 3QJZA 4WURA 2FCSA 3EGRA 3NJTA 3WAMA 4M00A 2JZZA 2K6QA 2JF5A 1V1PA 2N9PC 3B2FA 5G2NA 5FR6A 2IGGA 1VR9A 3DQVA 3DWMA 5BO4B 1C78A 2QMTA 1WGGA
chains in the Genus database with same CATH topology
4FJZA 5DPTA 2ZPNA 2WX1A 3ENEA 4IM3A 3V6CB 3IBEA 5IAAC 3QC8B 2K8CA 3APFA 1BT0A 5AEKB 2J0MA 2C60A 2L7RA 4K1RB 2NCNA 1UH6A 2GBMA 2JY6A 3A4RA 3PLVA 1UZXB 2K6DB 3CF6E 1WH3A 4GSWA 3CMMB 2O2VA 5D7GA 2IYDB 4NAWB 2D10A 3B0AA 1UBQA 2FAZA 3H9DA 4DWFA 3VDZA 3PRZA 2KK8A 3EECA 2IY0B 2LI5A 2KFKA 2IZVB 2OJRA 3HK0A 3AULA 2DHZA 2K25A 3PREA 3UQBA 4FADA 1WR1A 1GG3A 2MBEA 3ZW3A 1I35A 4BOZB 3VHTC 2MP2B 3ZNID 3ZTCA 3V62A 1VCBA 3VTVA 4B9KA 4OVVA 5KHQA 4GOCA 2M17A 4NQLB 4RMAA 4TV3A 2KD0A 5TR5A 3QAQA 1P1AA 4ANVA 1UBIA 2WWZA 1A5RA 3D32A 2FCQA 3IG3A 2EKEC 3DVNU 4DK5A 1J0GA 1OQYA 4M8MA 4M0WB 4ZRIA 2ZVOA 4W9CA 2N9XA 2W9NA 4EZJA 2XEWA 1GNUA 4W9LA 3N32A 4IC7B 3IVFA 3OAWA 3L54A 3NHEB 3V60A 4G3XB 4AJYB 1E8ZA 1VD2A 4YL8A 3U30A 1IYFA 4ZYNA 4DDGD 3T8MA 2J0JA 3VVWB 4EKUA 2XBBC 3A9KA 2L0FA 2AL6A 1E8XA 3OJ3A 4GIVA 1C3TA 3KYDD 4NY0A 4CYEA 3UIPB 1SGHA 1WXAA 2DYOA 3QX1A 2KC1A 3R7RA 3PS6A 1NBFC 2L0TA 1WMHB 1WJ4A 1YJ1A 3DPDA 2KWUB 2LVQA 4E71A 1K8RB 2FIFA 2K1FA 2Z0DB 1WGYA 2I1KA 4K7UA 3SHQA 2N1WA 3H7SA 3VUXA 1WE7A 2JPHA 2MBOA 3RUIB 3VAWA 4FBJB 3MTNB 3HM3A 2IO0B 2N7EA 3KUZA 3L17A 4GU2A 2JT4B 2MW5A 1WYWB 4NAWA 1WRDB 2NPTB 4K81A 1R4MI 1IP9A 3AU4A 3DBLI 3JW0X 1XD3B 4A20A 2XK5B 3VQIA 1KM7A 2DZJA 2IO3B 2MA9B 2LRWA 1SIFA 2YLMA 3K9PB 4ICVA 4LJOB 1S1QB 2ZEQA 3A4SC 3RD2A 2D07B 2DZKA 2MP2A 4HVBA 1E7VA 3TCAA 1Z2MA 1ZW7A 4F8CB 4ANUA 4KSKC 5AZHA 2KN5A 5DPWA 5CHWA 4W9DA 3R3MA 2FNJB 4WAAA 3ML9A 3ZLZA 4RM8A 1IPGA 5E6PA 2GBJA 5HKHA 2MBQA 2BYVE 2KWVB 2C7NB 3JSVB 3KYCD 3DVGY 1WF9A 5C1ZA 1FXTB 1P0RA 1WJUA 2KDFB 4TQ0A 4PYZA 4BBNF 4DXAB 3M62B 1Z5SB 4DHZE 3GZNI 1WGRA 2PEAA 3A33B 5KHOA 4KIKB 5JHBA 4W9IA 2A5UA 4MSMB 3ZTDA 4BKGA 2LGXA 3B1LX 4KSLC 4EEWA 3ZVVA 2AEHA 2ZPYA 3O65B 3NOBA 2O6VB 4BKTA 2QHOA 4FJYA 4MH0E 3WA0A 1NI2A 5DPSA 4I6LB 1EF5A 4F1SA 4NJ6A 2BKRB 2C7MB 4ICUA 5LXHA 2JRHA 3TL5A 3ZNGC 4LDTB 2DENB 4NQKE 4PYUA 3H1UA 1WM3A 3H7PA 2KX3A 2BYFA 4WJOA 4ZDVA 4MGIE 2L8JA 1E8YA 4TKNA 1TBEA 2D2QA 3KH0A 3IHPC 3V6EB 1RRBA 1AARA 1RAXA 1WE6A 3OLMD 4XZ4A 3R7QA 3PRMB 4BVUC 3ALBA 2BF8B 1Q5WB 2M8SA 3JYUA 3EFUA 4JLCA 1JRUA 3A1QA 4LCDE 4GDLA 2KANA 3A9JB 4FLHA 3QCAA 2G3QB 2BWES 3DBSA 4HLEA 2MX2A 3ONSA 3S2AA 1R4NI 3P2BA 4HK2A 3KW5B 2ZNVC 2LGDA 1WZ0A 2CU1A 3OJ4B 1E8WA 3PGEA 4WWNA 3ZO5B 3V61A 4TUUA 2CS4A 2DAFA 4EZLA 2MCNB 4FULA 4RM9A 4HDOA 2BWFA 5E6OA 1WFYA 4AJWA 4ASWC 1TZ1A 4BKSD 1V6EA 2JRIB 1E5WA 3DCGA 2NBVB 4HDQA 1RLFA 3CSTA 1V86A 2DZIA 3K9OB 3TMPB 2DX5B 4EUTA 1EUVB 1UD7A 2G4DB 4ZRKA 2HTHA 2DYBA 4IWOA 2GMIC 3Q3FA 2KNBA 3QQ8B 2RD0A 5CX3A 3U8ZA 1V5OA 3ZUNA 2B3AA 2O6VA 2N7DA 3UIOB 5J18A 3WALA 4EFOA 3QWZB 3EC8A 1TTNA 4EOYA 2FIDA 4B95A 4HWIB 3ZNHB 2CKHB 5CHVC 3NZSA 3Q3JA 1GC6A 4FHJA 1QZEA 2KOXA 3W1YA 2M1MA 1WX7A 4BKSA 4NJ7A 1WIAA 4HCNB 4FA6A 3UQAA 2KX0A 1EO6A 1L2NA 1D3ZA 2ZZPB 2IO1B 1ISNA 4XX5A 1CMXB 2MBBB 3X0WA 1E90A 3WANA 2ZCBA 2BGFA 3W1SA 3KUDB 2NS5A 4E74A 1G6JA 3ZKJC 2J7QB 3ZRCA 4HXDA 5AZGA 4MGKE 4WWPA 2KWCA 4BFRA 3L10B 2CHXA 1X1MA 2KTRB 1UGMA 2LRUA 2BPSA 4MGYE 2K8BA 4WJPA 3NY5A 5C23A 4P7IA 4W9HA 1PQSA 2R2OA 2UYZB 2L00B 4KZCA 4TQ1A 4NPNA 2KXJA 1P98A 2O2VB 4BOSC 3GOEA 5LXIB 1OTRB 2C7HA 2L3ZA 2LGYA 3LJ3A 4MEMA 5IA7A 3N30A 4GB9A 3DBHI 2UWQA 2AYOB 3ZDMC 2JXXA 4KZ0A 2WYQA 3RZWC 3L16A 4IUMB 1YX5B 4BBNC 5LLIA 2EMSA 2LXCA 4W9FA 3UGBB 4ANWA 3NZUA 4GMVA 2WX0A 2LZ6A 1V49A 2KLCA 2V1YA 2LD9A 2ZVNA 1WGDA 2LJ5A 5CHFA 3QK0A 1I42A 1WX9A 3VUYA 1XT9B 4F7ZA 4DBGA 2KJ6A 2L05A 1WX8A 3ECIA 4A3OA 4AOFA 1NDDA 2JWZA 1GC7A 2D3GA 2MRPA 3CSFA 4WJQA 1YQBA 2KQSA 4GN1A 4CO7A 3PVLA 4GDKB 4DHJB 1V81A 4WJNA 3RZFA 1WXMA 4AP4C 4FJVB 3H6NA 1KJTA 4WQOB 2N4FA 2RPQA 3PPAA 1F9JA 1WMHA 1EF1A 2AL3A 4PS8A 5EDSA 3PSEB 2N9EB 4XC2A 4I6NB 1WR6E 3KUCB 2V3SA 1HE8A 4PS3A 2KMAA 3ZIMA 2LXAA 4OVUA 2OOBB 2NR2A 2REXA 4K7SA 1WGHA 3DVGX 3NS8A 2L76A 4MJSB 5CTRC 2BYEA 3ZNZB 2Z0EB 2K8HA 2NPTA 4URKA 2DAJA 3DBRI 2DYMA 3M95A 4EZKA 3I3TB 4I6PA 1WJNA 2KQ7A 3AI5A 2RR9A 2KTRA 3C0RB 4N9F4 2FUHB 2KC2A 2XK5A 1Q1OA 5G55A 2KVRA 3UF8A 1V80A 2M4NA 1Y8RC 2MWSB 4G11A 3VFKA 1H8CA 1OEYJ 1L7YA 2M0XA 4IWQA 2O6VD 1LXDA 4CHKA 3L0WB 2JZ3B 3L13A 4KDIC 5E6NA 1V2YA 2GOWA 1OEYA 3EHVA 4DHJD 2V4LA 3ZDTA 4AWJA 2A4ZA 2R2QA 2Z59B 2KLGA 2LVOA 3N3KB 2KMCA 2ASQA 3QIJA 4FN2A 2K39A 2KDIA 3R66C 4LDTD 3VUWA 3HHMA 1V9JA 2ZJDA 3T9LA 2MQJA 4JIOU 3MHSD 5GMVA 2IO2B 5DCNA 3X23A 4W9GA 3LDZE 3JSVA 2PE6B 4E3CA 2BKFA 1T0YA 2HD5B 4II3B 2KO3A 1YX6B 2RGFA 4B6WA 2HE7A 2CR5A 2J0KA 3APDA 2AWTA 3AXCA 4KIKA 1TGZB 3TIXA 1ZKHA 2FCMA 1S3SG 2KTFA 1Q0WB 1P9DU 2JUOA 4W9EA 4GGQA 3WAPA 4X57B 1WXVA 3PZDA 4IM2A 4DHZB 2G45B 1LM8B 2YVCA 2ZCCA 4IG7B 5J2RA 1UELA 1KOTA 3VH3B 1GUAB 2RSUA 4GDKA 2PJHA 2NVUI 1WXSA 3VXWA 4NNJB 1XQQA 4W9JA 2KFJA 4GXBA 1P3QU 3ZRFA 1WM2A 2IBIB 1WY8A 1ZGUB 1OGWA 3VH4B 2JVCA 2C9WB 2IY1B 3B08A 3WAOA 5JH5C 3JVZX 1WZ3A 2NBUA 4KDLB 5D2MB 1KLVA 2KHWB 2KDEB 1LFDA 2MBHA 4HCPB 4MM3A 2G4SA 2KKCA 3RYTA 4KV2A 2PPHA 4MDKE 3SDLC 5L95C 4MJSA 5L83A 2DZMA 4G50A 4JGHB 2KJRA 3VTWA 3HM6X 2CHZA 3A9JA 5DPRA 4K7WA 2C5LC 3W1SC 1GJZA 3RCZA 4IM0A 3M63B 3H7PB 3IFWB 1J8CA 4LJPB 3PTFC 3PHWB 5D94A 3QARA 3SU8X 4AUQC 2HJ8A 3ML8A 1RFAA 1J19A 2VRRB 2N1VA 1U4AA 2GBRA 4KVGB 3A1QB 3PV1A 4FHKA 4WWOA 2GBKA 3BY4B 5JZEB 3M3JA 4GDLB 4PS7A 2ZNVB 4JL9A 4DDID 2WDTB 1E7UA 2KFKB 3KVFB 3BINA 5D6JB 3PHXB 4IW0A 3PT2B 3TJPA 4ANXA 4HJKA 3VTUA 1SE9A 3QHTA 4M8NA 3PRPB 3QA8A 2GBNA 2CHWA 1YIWA 2LWPA 3PLUA 3MJWA 4IWPA 3UINB 2FCNA 3DDCB 4HPMB 1LQBA 4MGZE 4G0NB 2LUEA 2NBWB 3QJZA 2FCSA 1M94A 5JHAA 4HPLB 1C1YB 2D11A 2Y5BB 3AU5A 4W9KA 3WAMA 2MSED 4ZRJA 2JZZA 2K6QA 5AZFA 3SD5A 1YD8U 4II2B 2EMTA 4JQWC 2LASA 2JF5A 1V5TA 4MELA 3L08A 2LVPA 3APCA 3DOWA 3HIZA 2N9PC 3TBLD 2PE9A 1WI0A 4J6IA 2KJHB 1MG8A 5G2NA 5FR6A 2MLBA 5J17A 4A3PA 3DQVA 1WJ6A 3RULA 3A9KB 2I1JA 2KZRA 3RT3B 4MSQB 1H4RA 5BO4B 3U7DA 1WGGA 3WIMA 3DVNV 2KDBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4FJZ A;  5DPT A;  2ZPN A;  2WX1 A;  3ENE A;  4IM3 A;  3V6C B;  3IBE A;  5IAA C;  3QC8 B;  2K8C A;  3APF A;  1BT0 A;  5AEK B;  2J0M A;  2C60 A;  2L7R A;  4K1R B;  2NCN A;  1UH6 A;  2GBM A;  2JY6 A;  3A4R A;  3PLV A;  1UZX B;  2K6D B;  3CF6 E;  1WH3 A;  4GSW A;  3CMM B;  2O2V A;  5D7G A;  2IYD B;  4NAW B;  2D10 A;  3B0A A;  1UBQ A;  2FAZ A;  3H9D A;  4DWF A;  3VDZ A;  3PRZ A;  2KK8 A;  3EEC A;  2IY0 B;  2LI5 A;  2KFK A;  2IZV B;  2OJR A;  3HK0 A;  3AUL A;  2DHZ A;  2K25 A;  3PRE A;  3UQB A;  4FAD A;  1WR1 A;  1GG3 A;  2MBE A;  3ZW3 A;  1I35 A;  4BOZ B;  3VHT C;  2MP2 B;  3ZNI D;  3ZTC A;  3V62 A;  1VCB A;  3VTV A;  4B9K A;  4OVV A;  5KHQ A;  4GOC A;  2M17 A;  4NQL B;  4RMA A;  4TV3 A;  2KD0 A;  5TR5 A;  3QAQ A;  1P1A A;  4ANV A;  1UBI A;  2WWZ A;  1A5R A;  3D32 A;  2FCQ A;  3IG3 A;  2EKE C;  3DVN U;  4DK5 A;  1J0G A;  1OQY A;  4M8M A;  4M0W B;  4ZRI A;  2ZVO A;  4W9C A;  2N9X A;  2W9N A;  4EZJ A;  2XEW A;  1GNU A;  4W9L A;  3N32 A;  4IC7 B;  3IVF A;  3OAW A;  3L54 A;  3NHE B;  3V60 A;  4G3X B;  4AJY B;  1E8Z A;  1VD2 A;  4YL8 A;  3U30 A;  1IYF A;  4ZYN A;  4DDG D;  3T8M A;  2J0J A;  3VVW B;  4EKU A;  2XBB C;  3A9K A;  2L0F A;  2AL6 A;  1E8X A;  3OJ3 A;  4GIV A;  1C3T A;  3KYD D;  4NY0 A;  4CYE A;  3UIP B;  1SGH A;  1WXA A;  2DYO A;  3QX1 A;  2KC1 A;  3R7R A;  3PS6 A;  1NBF C;  2L0T A;  1WMH B;  1WJ4 A;  1YJ1 A;  3DPD A;  2KWU B;  2LVQ A;  4E71 A;  1K8R B;  2FIF A;  2K1F A;  2Z0D B;  1WGY A;  2I1K A;  4K7U A;  3SHQ A;  2N1W A;  3H7S A;  3VUX A;  1WE7 A;  2JPH A;  2MBO A;  3RUI B;  3VAW A;  4FBJ B;  3MTN B;  3HM3 A;  2IO0 B;  2N7E A;  3KUZ A;  3L17 A;  4GU2 A;  2JT4 B;  2MW5 A;  1WYW B;  4NAW A;  1WRD B;  2NPT B;  4K81 A;  1R4M I;  1IP9 A;  3AU4 A;  3DBL I;  3JW0 X;  1XD3 B;  4A20 A;  2XK5 B;  3VQI A;  1KM7 A;  2DZJ A;  2IO3 B;  2MA9 B;  2LRW A;  1SIF A;  2YLM A;  3K9P B;  4ICV A;  4LJO B;  1S1Q B;  2ZEQ A;  3A4S C;  3RD2 A;  2D07 B;  2DZK A;  2MP2 A;  4HVB A;  1E7V A;  3TCA A;  1Z2M A;  1ZW7 A;  4F8C B;  4ANU A;  4KSK C;  5AZH A;  2KN5 A;  5DPW A;  5CHW A;  4W9D A;  3R3M A;  2FNJ B;  4WAA A;  3ML9 A;  3ZLZ A;  4RM8 A;  1IPG A;  5E6P A;  2GBJ A;  5HKH A;  2MBQ A;  2BYV E;  2KWV B;  2C7N B;  3JSV B;  3KYC D;  3DVG Y;  1WF9 A;  5C1Z A;  1FXT B;  1P0R A;  1WJU A;  2KDF B;  4TQ0 A;  4PYZ A;  4BBN F;  4DXA B;  3M62 B;  1Z5S B;  4DHZ E;  3GZN I;  1WGR A;  2PEA A;  3A33 B;  5KHO A;  4KIK B;  5JHB A;  4W9I A;  2A5U A;  4MSM B;  3ZTD A;  4BKG A;  2LGX A;  3B1L X;  4KSL C;  4EEW A;  3ZVV A;  2AEH A;  2ZPY A;  3O65 B;  3NOB A;  2O6V B;  4BKT A;  2QHO A;  4FJY A;  4MH0 E;  3WA0 A;  1NI2 A;  5DPS A;  4I6L B;  1EF5 A;  4F1S A;  4NJ6 A;  2BKR B;  2C7M B;  4ICU A;  5LXH A;  2JRH A;  3TL5 A;  3ZNG C;  4LDT B;  2DEN B;  4NQK E;  4PYU A;  3H1U A;  1WM3 A;  3H7P A;  2KX3 A;  2BYF A;  4WJO A;  4ZDV A;  4MGI E;  2L8J A;  1E8Y A;  4TKN A;  1TBE A;  2D2Q A;  3KH0 A;  3IHP C;  3V6E B;  1RRB A;  1AAR A;  1RAX A;  1WE6 A;  3OLM D;  4XZ4 A;  3R7Q A;  3PRM B;  4BVU C;  3ALB A;  2BF8 B;  1Q5W B;  2M8S A;  3JYU A;  3EFU A;  4JLC A;  1JRU A;  3A1Q A;  4LCD E;  4GDL A;  2KAN A;  3A9J B;  4FLH A;  3QCA A;  2G3Q B;  2BWE S;  3DBS A;  4HLE A;  2MX2 A;  3ONS A;  3S2A A;  1R4N I;  3P2B A;  4HK2 A;  3KW5 B;  2ZNV C;  2LGD A;  1WZ0 A;  2CU1 A;  3OJ4 B;  1E8W A;  3PGE A;  4WWN A;  3ZO5 B;  3V61 A;  4TUU A;  2CS4 A;  2DAF A;  4EZL A;  2MCN B;  4FUL A;  4RM9 A;  4HDO A;  2BWF A;  5E6O A;  1WFY A;  4AJW A;  4ASW C;  1TZ1 A;  4BKS D;  1V6E A;  2JRI B;  1E5W A;  3DCG A;  2NBV B;  4HDQ A;  1RLF A;  3CST A;  1V86 A;  2DZI A;  3K9O B;  3TMP B;  2DX5 B;  4EUT A;  1EUV B;  1UD7 A;  2G4D B;  4ZRK A;  2HTH A;  2DYB A;  4IWO A;  2GMI C;  3Q3F A;  2KNB A;  3QQ8 B;  2RD0 A;  5CX3 A;  3U8Z A;  1V5O A;  3ZUN A;  2B3A A;  2O6V A;  2N7D A;  3UIO B;  5J18 A;  3WAL A;  4EFO A;  3QWZ B;  3EC8 A;  1TTN A;  4EOY A;  2FID A;  4B95 A;  4HWI B;  3ZNH B;  2CKH B;  5CHV C;  3NZS A;  3Q3J A;  1GC6 A;  4FHJ A;  1QZE A;  2KOX A;  3W1Y A;  2M1M A;  1WX7 A;  4BKS A;  4NJ7 A;  1WIA A;  4HCN B;  4FA6 A;  3UQA A;  2KX0 A;  1EO6 A;  1L2N A;  1D3Z A;  2ZZP B;  2IO1 B;  1ISN A;  4XX5 A;  1CMX B;  2MBB B;  3X0W A;  1E90 A;  3WAN A;  2ZCB A;  2BGF A;  3W1S A;  3KUD B;  2NS5 A;  4E74 A;  1G6J A;  3ZKJ C;  2J7Q B;  3ZRC A;  4HXD A;  5AZG A;  4MGK E;  4WWP A;  2KWC A;  4BFR A;  3L10 B;  2CHX A;  1X1M A;  2KTR B;  1UGM A;  2LRU A;  2BPS A;  4MGY E;  2K8B A;  4WJP A;  3NY5 A;  5C23 A;  4P7I A;  4W9H A;  1PQS A;  2R2O A;  2UYZ B;  2L00 B;  4KZC A;  4TQ1 A;  4NPN A;  2KXJ A;  1P98 A;  2O2V B;  4BOS C;  3GOE A;  5LXI B;  1OTR B;  2C7H A;  2L3Z A;  2LGY A;  3LJ3 A;  4MEM A;  5IA7 A;  3N30 A;  4GB9 A;  3DBH I;  2UWQ A;  2AYO B;  3ZDM C;  2JXX A;  4KZ0 A;  2WYQ A;  3RZW C;  3L16 A;  4IUM B;  1YX5 B;  4BBN C;  5LLI A;  2EMS A;  2LXC A;  4W9F A;  3UGB B;  4ANW A;  3NZU A;  4GMV A;  2WX0 A;  2LZ6 A;  1V49 A;  2KLC A;  2V1Y A;  2LD9 A;  2ZVN A;  1WGD A;  2LJ5 A;  5CHF A;  3QK0 A;  1I42 A;  1WX9 A;  3VUY A;  1XT9 B;  4F7Z A;  4DBG A;  2KJ6 A;  2L05 A;  1WX8 A;  3ECI A;  4A3O A;  4AOF A;  1NDD A;  2JWZ A;  1GC7 A;  2D3G A;  2MRP A;  3CSF A;  4WJQ A;  1YQB A;  2KQS A;  4GN1 A;  4CO7 A;  3PVL A;  4GDK B;  4DHJ B;  1V81 A;  4WJN A;  3RZF A;  1WXM A;  4AP4 C;  4FJV B;  3H6N A;  1KJT A;  4WQO B;  2N4F A;  2RPQ A;  3PPA A;  1F9J A;  1WMH A;  1EF1 A;  2AL3 A;  4PS8 A;  5EDS A;  3PSE B;  2N9E B;  4XC2 A;  4I6N B;  1WR6 E;  3KUC B;  2V3S A;  1HE8 A;  4PS3 A;  2KMA A;  3ZIM A;  2LXA A;  4OVU A;  2OOB B;  2NR2 A;  2REX A;  4K7S A;  1WGH A;  3DVG X;  3NS8 A;  2L76 A;  4MJS B;  5CTR C;  2BYE A;  3ZNZ B;  2Z0E B;  2K8H A;  2NPT A;  4URK A;  2DAJ A;  3DBR I;  2DYM A;  3M95 A;  4EZK A;  3I3T B;  4I6P A;  1WJN A;  2KQ7 A;  3AI5 A;  2RR9 A;  2KTR A;  3C0R B;  4N9F 4;  2FUH B;  2KC2 A;  2XK5 A;  1Q1O A;  5G55 A;  2KVR A;  3UF8 A;  1V80 A;  2M4N A;  1Y8R C;  2MWS B;  4G11 A;  3VFK A;  1H8C A;  1OEY J;  1L7Y A;  2M0X A;  4IWQ A;  2O6V D;  1LXD A;  4CHK A;  3L0W B;  2JZ3 B;  3L13 A;  4KDI C;  5E6N A;  1V2Y A;  2GOW A;  1OEY A;  3EHV A;  4DHJ D;  2V4L A;  3ZDT A;  4AWJ A;  2A4Z A;  2R2Q A;  2Z59 B;  2KLG A;  2LVO A;  3N3K B;  2KMC A;  2ASQ A;  3QIJ A;  4FN2 A;  2K39 A;  2KDI A;  3R66 C;  4LDT D;  3VUW A;  3HHM A;  1V9J A;  2ZJD A;  3T9L A;  2MQJ A;  4JIO U;  3MHS D;  5GMV A;  2IO2 B;  5DCN A;  3X23 A;  4W9G A;  3LDZ E;  3JSV A;  2PE6 B;  4E3C A;  2BKF A;  1T0Y A;  2HD5 B;  4II3 B;  2KO3 A;  1YX6 B;  2RGF A;  4B6W A;  2HE7 A;  2CR5 A;  2J0K A;  3APD A;  2AWT A;  3AXC A;  4KIK A;  1TGZ B;  3TIX A;  1ZKH A;  2FCM A;  1S3S G;  2KTF A;  1Q0W B;  1P9D U;  2JUO A;  4W9E A;  4GGQ A;  3WAP A;  4X57 B;  1WXV A;  3PZD A;  4IM2 A;  4DHZ B;  2G45 B;  1LM8 B;  2YVC A;  2ZCC A;  4IG7 B;  5J2R A;  1UEL A;  1KOT A;  3VH3 B;  1GUA B;  2RSU A;  4GDK A;  2PJH A;  2NVU I;  1WXS A;  3VXW A;  4NNJ B;  1XQQ A;  4W9J A;  2KFJ A;  4GXB A;  1P3Q U;  3ZRF A;  1WM2 A;  2IBI B;  1WY8 A;  1ZGU B;  1OGW A;  3VH4 B;  2JVC A;  2C9W B;  2IY1 B;  3B08 A;  3WAO A;  5JH5 C;  3JVZ X;  1WZ3 A;  2NBU A;  4KDL B;  5D2M B;  1KLV A;  2KHW B;  2KDE B;  1LFD A;  2MBH A;  4HCP B;  4MM3 A;  2G4S A;  2KKC A;  3RYT A;  4KV2 A;  2PPH A;  4MDK E;  3SDL C;  5L95 C;  4MJS A;  5L83 A;  2DZM A;  4G50 A;  4JGH B;  2KJR A;  3VTW A;  3HM6 X;  2CHZ A;  3A9J A;  5DPR A;  4K7W A;  2C5L C;  3W1S C;  1GJZ A;  3RCZ A;  4IM0 A;  3M63 B;  3H7P B;  3IFW B;  1J8C A;  4LJP B;  3PTF C;  3PHW B;  5D94 A;  3QAR A;  3SU8 X;  4AUQ C;  2HJ8 A;  3ML8 A;  1RFA A;  1J19 A;  2VRR B;  2N1V A;  1U4A A;  2GBR A;  4KVG B;  3A1Q B;  3PV1 A;  4FHK A;  4WWO A;  2GBK A;  3BY4 B;  5JZE B;  3M3J A;  4GDL B;  4PS7 A;  2ZNV B;  4JL9 A;  4DDI D;  2WDT B;  1E7U A;  2KFK B;  3KVF B;  3BIN A;  5D6J B;  3PHX B;  4IW0 A;  3PT2 B;  3TJP A;  4ANX A;  4HJK A;  3VTU A;  1SE9 A;  3QHT A;  4M8N A;  3PRP B;  3QA8 A;  2GBN A;  2CHW A;  1YIW A;  2LWP A;  3PLU A;  3MJW A;  4IWP A;  3UIN B;  2FCN A;  3DDC B;  4HPM B;  1LQB A;  4MGZ E;  4G0N B;  2LUE A;  2NBW B;  3QJZ A;  2FCS A;  1M94 A;  5JHA A;  4HPL B;  1C1Y B;  2D11 A;  2Y5B B;  3AU5 A;  4W9K A;  3WAM A;  2MSE D;  4ZRJ A;  2JZZ A;  2K6Q A;  5AZF A;  3SD5 A;  1YD8 U;  4II2 B;  2EMT A;  4JQW C;  2LAS A;  2JF5 A;  1V5T A;  4MEL A;  3L08 A;  2LVP A;  3APC A;  3DOW A;  3HIZ A;  2N9P C;  3TBL D;  2PE9 A;  1WI0 A;  4J6I A;  2KJH B;  1MG8 A;  5G2N A;  5FR6 A;  2MLB A;  5J17 A;  4A3P A;  3DQV A;  1WJ6 A;  3RUL A;  3A9K B;  2I1J A;  2KZR A;  3RT3 B;  4MSQ B;  1H4R A;  5BO4 B;  3U7D A;  1WGG A;  3WIM A;  3DVN V;  2KDB A; 
#chains in the Genus database with same CATH topology
 4FJZ A;  1L6U A;  3ENE A;  3V6C B;  3ZYY X;  3APF A;  2J0M A;  2PVO D;  5EE1 A;  4RF1 A;  3PLV A;  1HZ5 A;  2K6D B;  3B0A A;  2N9L A;  1RM6 C;  4ZHO A;  3H9D A;  2KDM A;  2KK8 A;  2WDQ B;  3AEG B;  1GG3 A;  2MBE A;  1I35 A;  3VHT C;  3ZNI D;  4RMA A;  4P1C C;  2IGD A;  3AEE B;  2WWZ A;  2J52 A;  3D32 A;  1RFK A;  1ZUD 2;  1PGB A;  1SSN A;  2ZVO A;  4W9C A;  2E6X A;  2AQ3 B;  1YQ4 B;  1GNU A;  1N61 A;  3IVF A;  3OAW A;  4YL8 A;  4YT0 B;  2D3B A;  2PW9 A;  3T8M A;  5BMG A;  3VVW B;  4EKU A;  3A9K A;  1I7H A;  1C3T A;  1SGH A;  2DYO A;  1OFF A;  2KC1 A;  1FXI A;  3R7R A;  3PS6 A;  1CZP A;  2K0P A;  2RPV A;  1YJ1 A;  3LXF A;  2WXF A;  2W3S A;  1VRA B;  1EWY C;  2LVQ A;  2Z0D B;  2INC C;  3H7S A;  1QOG A;  2JPH A;  3ZGZ A;  4FBJ B;  3MTN B;  3HM3 A;  3KUZ A;  4ARC A;  2VZK B;  1SEB D;  5I4D A;  1WRD B;  1E7P B;  1IP9 A;  3HUI A;  3JW0 X;  3MP9 A;  2XK5 B;  3IAS 1;  2MA9 B;  2LRW A;  1QF6 A;  3MC0 B;  1SIF A;  1KRH A;  1K53 A;  3K9P B;  3RD2 A;  1E7V A;  4F8C B;  1Z2M A;  1ZW7 A;  3FKY A;  4HJG E;  1R4N B;  3AE1 B;  5CHW A;  4W9D A;  2FNJ B;  4WAA A;  3ML9 A;  2BYV E;  2KWV B;  2C7N B;  3KYC D;  4RGO S;  1WJU A;  1JWM D;  1IGD A;  2KDF B;  1NYQ A;  2WQY B;  4DHZ E;  3GZN I;  5KHO A;  4KIK B;  4BKG A;  3B1L X;  4PK1 A;  1JWS D;  2ZPY A;  4BKT A;  4MH0 E;  1NI2 A;  4NJ6 A;  1TKG A;  5LXH A;  1TY0 A;  3B9J A;  2QIL A;  1NVI D;  1L0X B;  3H7P A;  2KX3 A;  4WJO A;  3MHZ A;  1TYG B;  5HFY A;  3KH0 A;  3AE5 B;  3V6E B;  3PRM B;  3I5J C;  3Q3N C;  4WAF A;  3EFU A;  1JRU A;  1C79 A;  3H8H A;  1TJE A;  5D3D A;  2KAN A;  4FLH A;  3QCA A;  3PZ7 A;  3DHI C;  3IAM 1;  2BWE S;  1T3Q A;  1M4V A;  1ZXH A;  5C2T B;  2LGD A;  1MJD A;  1QT9 A;  3BYY B;  2CU1 A;  3OJ4 B;  4WWN A;  1EU4 A;  1K50 A;  3Q69 A;  4AJW A;  4ASW C;  2QC8 A;  1AYF A;  1E5W A;  1T6B X;  2NBV B;  4HDQ A;  3CST A;  3GE3 C;  1RWS A;  3V3X A;  2KNB A;  3U8Z A;  3UIO B;  4EFO A;  1A70 A;  4HWI B;  1DOI A;  2QEJ C;  1GC6 A;  2KOX A;  4XWW A;  3MC9 A;  4NJ7 A;  3AB5 A;  3ABV B;  4WWM A;  1D3Z A;  1L2N A;  4XX5 A;  5GXG B;  3AM9 A;  2MBB B;  4A8X C;  1E90 A;  4EE2 A;  3W1S A;  3HRD D;  4WWP A;  2CHX A;  2KTR B;  1UGM A;  2WXI A;  3BZD B;  4MGY E;  2UYZ B;  4KZC A;  1IBX A;  4BOS C;  1HZ6 A;  1OTR B;  2C7H A;  2JZP A;  4JX1 C;  4QAY A;  3ZDM C;  1D4B A;  3RZW C;  4KKI A;  4IUM B;  1YX5 B;  5LLI A;  4P1B C;  3T3O A;  3UGB B;  2WXH A;  3NZU A;  2V1Y A;  1WGD A;  2LJ5 A;  4HPP A;  5HI1 A;  3TEY A;  3VUY A;  1TS4 A;  3R8B A;  1WX8 A;  1GPX A;  4A3O A;  1D6E C;  1V97 A;  4GDK B;  2JX5 A;  1HEZ E;  1V1O A;  3H6N A;  2AQ1 B;  2RPQ A;  3PPA A;  1F9J A;  1HQR D;  4I6N B;  3OWE B;  1GB4 A;  4BZA A;  1D5Z C;  3BII D;  3W2D A;  3DBR I;  3P4P B;  2N7J A;  4I6P A;  4YSX B;  3UF8 A;  1Q1O A;  2LHE A;  3VFK A;  1OEY J;  2JZ3 B;  4Q2J A;  5E6N A;  2BS3 B;  3TEX A;  3EHV A;  3ZDT A;  4AWJ A;  3L4P A;  2R2Q A;  4FN2 A;  3AE4 B;  2WXK A;  3HHM A;  1V9J A;  4JIO U;  3N1X C;  2IO2 B;  3LDZ E;  3I57 A;  3JSV A;  1ZPS A;  5BYS A;  2HE7 A;  2AWT A;  5C3J B;  3TIX A;  1S3S G;  1P9D U;  2JUO A;  3WAP A;  1XO3 A;  1JML A;  4IG7 B;  1LM8 B;  2IJ0 A;  2YVC A;  2ZCC A;  2WHI A;  3SR6 A;  2VH2 A;  4NNJ B;  4DXG A;  3MJ5 A;  2IBI B;  1OGW A;  3WAO A;  3JVZ X;  5D2M B;  2KHW B;  4MM3 A;  2W54 A;  2G4S A;  1AWD A;  3RYT A;  4KV2 A;  2PPH A;  3VR8 B;  2EEL A;  4MJS A;  2DZM A;  3AV8 A;  3A9J A;  3RCZ A;  3KLS X;  3H7P B;  4IDI A;  1J8C A;  4RGM A;  2FE8 A;  4AUQ C;  3QAR A;  4S0R A;  4ZOH C;  2JXT A;  3E9S A;  2N1V A;  1VDV A;  4C56 C;  2GBK A;  1XLN A;  5JZE B;  3BK1 A;  3U7Z A;  2KFK B;  3CIR B;  3PT2 B;  4XE0 A;  3TJP A;  4HJK A;  3QHT A;  1ZXI A;  4M8N A;  1ACC A;  4IWP A;  3MJW A;  4HPM B;  4H2A A;  2LFI A;  2GRI A;  2WXJ A;  1M94 A;  2XNA C;  1C1Y B;  2D11 A;  4W9K A;  4KX6 B;  4LLG M;  1YD8 U;  1FPY A;  3AEA B;  4JQW C;  1JCK B;  4MEL A;  3L08 A;  1UGJ A;  2LVP A;  1T0Q C;  3HIZ A;  3TBL D;  1WI0 A;  2PTL A;  2KJH B;  2AX5 A;  1MG8 A;  2MLB A;  3GB1 A;  1I4P A;  1NYR A;  5FKA C;  5J17 A;  4A3P A;  4L1B A;  2KZR A;  3O13 A;  3U7D A;  2KQ4 X;  3DVN V;  4YWG G;  3IBE A;  5IP4 D;  1BT0 A;  4K1R B;  2NCN A;  1UH6 A;  4ARI A;  3FIL A;  3URY A;  1FCL A;  1UZX B;  3CMM B;  2BBC A;  3SEB A;  1LO5 D;  2IYD B;  1IUE A;  4NAW B;  1UBQ A;  2KWD A;  2M56 B;  2IY0 B;  2LI5 A;  3HK0 A;  1TKE A;  1QIL A;  2WP9 B;  3AUL A;  3PRE A;  4NZL B;  3LB8 C;  1WR1 A;  2CJO A;  3ZW3 A;  2RMM A;  4BOZ B;  1IBX B;  2MP2 B;  3BYT B;  3VTV A;  5KHQ A;  4GOC A;  4TV3 A;  1TS5 A;  5TR5 A;  1ESF A;  2KT7 A;  3Q8B A;  3DHG C;  1J0G A;  3DVN U;  1OQY A;  4M8M A;  2N9X A;  2XEW A;  4YTP B;  3N32 A;  4IC7 B;  4AJY B;  1E8Z A;  2DWQ A;  1IYF A;  4ZYN A;  4C4V B;  3RI7 C;  1J7A A;  2J0J A;  2XBB C;  3GZN B;  4GIV A;  3OJ3 A;  3KYD D;  3UIP B;  1WXA A;  3QX1 A;  3Q8F A;  1NBF C;  2MJE A;  1BUI C;  3P1M A;  1P7F A;  2I38 A;  2KWU B;  3AE2 B;  2FIF A;  1L4Z B;  3VUX A;  3RUI B;  2IO0 B;  2N7E A;  1PGA A;  2MW5 A;  1WYW B;  4K81 A;  3EA6 A;  5FR3 A;  2TSS A;  1DOX A;  1KM7 A;  1T0S C;  2IO3 B;  1N5X A;  1HA5 A;  4LJO B;  2DZK A;  3Q6B A;  3EUB 2;  1FRR A;  5AZH A;  1IGC A;  2KN5 A;  3J9C A;  2WXM A;  3R3M A;  3ZLZ A;  2Y3A A;  4RM8 A;  4IOI E;  4M0W A;  5HKH A;  3JSV B;  3DVG Y;  3AMZ A;  5C1Z A;  4TQ0 A;  1TS2 A;  1UF0 A;  2D3C A;  2LGI A;  3ZTD A;  3RNF C;  1MHH E;  4JWU C;  3O65 B;  1MPE A;  5BMI A;  4FJY A;  2X8X X;  3VR9 B;  3WA0 A;  2MJ3 A;  1SE2 A;  4F1S A;  2BS4 B;  2PMV A;  2BKR B;  2C7M B;  2JRH A;  3TL5 A;  2SAK A;  4LDT B;  2DEN B;  1YMH E;  4WQM A;  4NQK E;  4FXC A;  1OQQ A;  1ZDX A;  2ON8 A;  1KF6 B;  4LK0 M;  4MGI E;  1ZDV A;  4TKN A;  3IHP C;  1VZ7 A;  2B76 B;  1F77 A;  2DBY A;  2L52 A;  4BVU C;  1WRI A;  1XLO A;  2M8S A;  3JYU A;  4LCD E;  3A9J B;  2IGH A;  3DBS A;  3ONS A;  3P2B A;  3KW5 B;  2N9K A;  5G5H A;  3V61 A;  4LNF A;  4EZL A;  5H8Y E;  1DOY A;  4FUL A;  1V8C A;  4HDO A;  2BWF A;  4ZRP A;  4KGT A;  4BKS D;  4HKQ A;  4RCO A;  3R2T A;  2UU7 A;  3Q2A C;  4J3O D;  4M02 A;  2WDV B;  1RLF A;  1V86 A;  2DX5 B;  4ZRK A;  1JRP A;  2GMI C;  3QQ8 B;  2RD0 A;  1UWX A;  1V5O A;  1MI0 A;  2B3A A;  2O6V A;  1FMA D;  3AE7 B;  3WAL A;  2FID A;  3NZS A;  4JE3 B;  1QZE A;  1ENF A;  1WX7 A;  1UWM A;  4HCN B;  3UQA A;  1EO6 A;  2LGS A;  2INP E;  1CMX B;  4OW0 A;  3X0W A;  3GS2 A;  1FM0 D;  3PZ8 A;  2NS5 A;  3P4Q B;  5AZG A;  4TSS A;  2E3T A;  2KWC A;  1X1M A;  2LRU A;  2BPS A;  1MFW A;  2K8B A;  1FNU A;  1DGJ A;  4W9H A;  3FIL B;  3DBR B;  2R2O A;  2L00 B;  3VRB B;  4XGA B;  2KXJ A;  3GOE A;  5LNK 1;  4JPS A;  2L3Z A;  5T8I A;  1ZP0 B;  2JXX A;  3ZXR A;  4BBN C;  3NRZ A;  2LXC A;  2BVC A;  3NVV A;  1FRD A;  4ANW A;  2LZ6 A;  1V49 A;  2KLC A;  1BML C;  5CHF A;  1I42 A;  3QK0 A;  1WX9 A;  2QSD A;  1XT9 B;  2MH7 A;  4YSY B;  3RPF C;  2KVZ A;  3OG5 A;  3ECI A;  4AOF A;  1JWU D;  2D3G A;  3CSF A;  3KWL A;  2KQS A;  4CO7 A;  4DHJ B;  1V81 A;  3RZF A;  4AP4 C;  4FJV B;  3W5U B;  2N4F A;  2L83 A;  1WMH A;  1ZE3 D;  4PS8 A;  1PGX A;  4XC2 A;  1WR6 E;  2KYW A;  2V3S A;  2MEK A;  1N5W A;  2KMA A;  3ZIM A;  2LXA A;  5HG2 A;  2XN9 C;  2BTE A;  1VZ8 A;  1F2R I;  3NS8 A;  3DVG X;  2NPT A;  4URK A;  3M95 A;  3Q8E A;  3C0R B;  2OHF A;  2V3N A;  4N9F 4;  2KC2 A;  5G55 A;  1I4R A;  1TKY A;  2MWS B;  1H8C A;  1L7Y A;  2O6V D;  2QCZ A;  1F0Z A;  2JYE A;  1XXG A;  2KLG A;  2LVO A;  3VUW A;  3R66 C;  4USA A;  1YOV B;  3T9L A;  2MQJ A;  3MHS D;  4WH4 A;  5GMV A;  3X23 A;  4E3C A;  4K3C A;  4ZRQ A;  3DBL B;  1E0Z A;  4RGN A;  2CR5 A;  1E6E B;  2V3P A;  3AXC A;  2FCM A;  1XEE A;  3FAH A;  3PZD A;  4DHZ B;  1GUA B;  1FNV A;  2NVU I;  1WXS A;  1V1P B;  4W9J A;  5IO9 A;  1MG4 A;  2KFJ A;  3ZRF A;  3DWG C;  3HVD A;  2IY1 B;  3B08 A;  1VZ6 A;  1KLV A;  4HCP B;  1J7B A;  5L95 C;  2G9H D;  4JGH B;  4KKJ A;  2CHZ A;  5DPR A;  4K7W A;  3W1S C;  3M63 B;  5EE9 A;  2L1A A;  3TUO A;  4LJP B;  2V9H A;  2QJL A;  3PTF C;  5D94 A;  1J19 A;  1SE4 A;  3RNG C;  2JYT A;  1U4A A;  5H92 C;  5BYR A;  2GBR A;  4KVG B;  3PV1 A;  4FHK A;  4WWO A;  4JL9 A;  4DDI D;  2WDT B;  1E7U A;  1I4Q A;  3PHX B;  4IW0 A;  4ANX A;  3PRP B;  2GBN A;  3PLU A;  2FCN A;  3DDC B;  1TY2 A;  4G0N B;  2LUE A;  1PYW D;  2Y5B B;  2H89 B;  3AU5 A;  1XLQ A;  5AZF A;  3ZXV A;  2INN E;  2EMT A;  1V5T A;  4LNO A;  3APC A;  3DOW A;  3BWU D;  4J6I A;  2LEK A;  4RH6 A;  1WJ6 A;  3NS1 A;  3A9K B;  3RT3 B;  3RUL A;  1FCC C;  4A90 A;  4NJC A;  2KDB A;  2KMM A;  5IAA C;  1L5P A;  2K22 A;  2K8C A;  3QC8 B;  3AN1 A;  2L7R A;  2V4I B;  2K5P A;  1CJE A;  1YN4 A;  4A55 A;  1YQ3 B;  3CF6 E;  1XCQ L;  2G1E A;  4GSW A;  2QDF A;  2IZV B;  2N0S B;  2K25 A;  3UQB A;  1CQV A;  2DLB A;  4TMA B;  3W9C B;  4FAD A;  5IKC M;  1FFU A;  3V62 A;  2WU2 B;  4NQL B;  2KD0 A;  3QAQ A;  1P1A A;  4ANV A;  3VRA B;  1A5R A;  3IG3 A;  2W9N A;  2I2Y A;  4OHJ A;  4W9L A;  3L54 A;  3NHE B;  1VD2 A;  3U30 A;  1AW7 A;  2BB6 A;  4DDG D;  2J4X A;  2PLP A;  2AL6 A;  5G5G A;  4NY0 A;  2H88 B;  2WXO A;  4GLS C;  3Q8C A;  1I4H A;  2KAC A;  2K3U A;  2JWU A;  1WMH B;  4HRO A;  2JSV X;  3DPD A;  4N6E B;  1SBB B;  3SHQ A;  2N1W A;  4M01 A;  2RDB C;  1UUP A;  3VAW A;  3AE6 B;  1HXY D;  1QOF A;  3L17 A;  2NPT B;  1R4M I;  1QQR A;  2HTM E;  3AU4 A;  3DBL I;  1YN3 A;  1J7C A;  3CWI A;  1I4X A;  2FUG 1;  2DZJ A;  2RDH A;  2YLM A;  4ICV A;  1S1Q B;  4HVB A;  2LUM A;  2D07 B;  4R3D A;  3IXS A;  3TCA A;  4YTN B;  3U52 E;  2ZW0 A;  4KSK C;  2BS2 B;  2WXP A;  2Z8L A;  5E6P A;  2GBJ A;  1WF9 A;  1FXT B;  1P0R A;  3BK2 A;  4PYZ A;  4BBN F;  5E6J A;  1JRO A;  1Z5S B;  3I9V 1;  1WGR A;  3A33 B;  4C80 A;  5JHB A;  1QKZ A;  4W9I A;  2A5U A;  3I63 C;  1K51 A;  2NMQ A;  4KSL C;  3AEF B;  3ZVV A;  1MVK A;  2BW2 A;  2BYT A;  2QHO A;  2X38 A;  4A9A A;  4C7Z A;  5DPS A;  1EF5 A;  2KAJ A;  4ICU A;  3ZNG C;  3NUH B;  5EE0 A;  1ROE A;  3BVM A;  2IDY A;  3H1U A;  1WM3 A;  2ACZ B;  4B0M A;  2BT6 A;  4ZDV A;  2L8J A;  1E8Y A;  1DYQ A;  1N60 A;  1RRB A;  4OVZ A;  1WXQ A;  1MHX A;  2BF8 B;  3GP7 A;  4JLC A;  1KH0 A;  2OED A;  1EWC A;  3RMK C;  2WXN A;  3AE8 B;  4HLE A;  2MX2 A;  3S2A A;  4HK2 A;  2BQQ A;  1WZ0 A;  1JQ4 A;  3DHH C;  1N63 A;  3ZO5 B;  4TUU A;  2CS4 A;  2DAF A;  3N20 C;  2MCN B;  4RM9 A;  1I4G A;  1TZ1 A;  1V6E A;  3E56 A;  3DCG A;  2NTT A;  4XYC A;  4MT5 A;  1STE A;  2DZI A;  3K9O B;  1N62 A;  4B0E A;  3P63 A;  3TMP B;  1HTQ A;  4KGS A;  4EUT A;  1C4A A;  2G4D B;  3Q3O C;  3NVW A;  4IWO A;  5CX3 A;  2WXQ A;  2N7D A;  1Y56 A;  3QWZ B;  3EC8 A;  2PKO A;  5CHV C;  3Q3J A;  4FHJ A;  4BKS A;  4XWT A;  3ZJT A;  2KX0 A;  2IO1 B;  3WAN A;  2V0G A;  2ZCB A;  2MHJ A;  4E74 A;  1G6J A;  3ZRC A;  1TZO A;  1GB1 A;  4HXD A;  4BFR A;  1VJK A;  4ZHP A;  2Q5W D;  4P7I A;  1PQS A;  4XDC A;  4TQ1 A;  2CJN A;  4NPN A;  2K9X A;  5LXI B;  4MEM A;  2LGY A;  3LJ3 A;  5IA7 A;  3N30 A;  1L0V B;  3NVZ A;  4GB9 A;  3DBH I;  2WYQ A;  3L16 A;  3IT4 B;  2EMS A;  2D5G A;  4GMV A;  3WCQ A;  2NTS A;  2LD9 A;  1NEN B;  4F7Z A;  2VZK D;  3U2S C;  2MRP A;  3GE8 C;  1YQB A;  3UI3 A;  4GN1 A;  4WJN A;  1WXM A;  2GI9 A;  4N58 A;  1KJT A;  4WQO B;  3RNE C;  1UNS A;  2L32 A;  1EF1 A;  4US9 A;  3PSE B;  1EU3 A;  4OVU A;  2OOB B;  2NR2 A;  2REX A;  4MM3 B;  4K7S A;  1WGH A;  5CTR C;  4MJS B;  2L76 A;  1TIF A;  2DAJ A;  1TT5 B;  3I3T B;  1B9R A;  2RR9 A;  2KTR A;  1YJI A;  2FUH B;  2KVR A;  1V80 A;  2M4N A;  2M0X A;  2HJ1 A;  4IWQ A;  1LXD A;  4CHK A;  3L0W B;  3L13 A;  1V2Y A;  2GOW A;  1OEY A;  1LGR A;  4DHJ D;  2V4L A;  2A4Z A;  2ASQ A;  1RYJ A;  2KN4 A;  4ITK A;  3MFG A;  4W9G A;  2WXL A;  2BKF A;  1T0Y A;  2HD5 B;  1P7E A;  4II3 B;  2KO3 A;  1YX6 B;  3APD A;  1TGZ B;  2KTF A;  4W9E A;  4GGQ A;  4A6Q A;  4X57 B;  2ZW1 A;  1SE3 A;  2Y5P A;  1KOT A;  5J2R A;  1FFV A;  1WWT A;  2CU3 A;  4GDK A;  2PJH A;  3P4S B;  3BVG A;  1NEK B;  1SJE D;  3RN9 C;  1T5X D;  1WM2 A;  2WGS A;  2WXG A;  2JVC A;  2C9W B;  1KTK A;  1WZ3 A;  2KDE B;  2MBH A;  3SDL C;  2KKC A;  5BYQ A;  4MDK E;  1KLU D;  5L83 A;  2IPK D;  4G50 A;  3BVZ A;  1QOB A;  2KJR A;  3VTW A;  2DNF A;  2C5L C;  1GJZ A;  1YN5 A;  2SEB D;  3IFW B;  3PHW B;  1C4P A;  4OZB A;  2HJ8 A;  3ML8 A;  3RNB C;  4K3B A;  1E10 A;  4HEA 1;  3BY4 B;  3M3J A;  1C4C A;  4PS7 A;  1K52 A;  5AUK A;  3ETR A;  3KVF B;  5D6J B;  5TSS A;  4O1N A;  1SE9 A;  2PVG C;  3QA8 A;  1YIW A;  2Y5C A;  1LQB A;  2M19 A;  4RGT A;  5JHA A;  4HPL B;  2MSE D;  3Q8A A;  4ZRJ A;  4D2K A;  3SD5 A;  1QOA A;  4II2 B;  2LAS A;  2PE9 A;  2W3R A;  3TSS A;  4IKG A;  3NZ3 A;  1KLG D;  2QIE B;  2I1J A;  4MSQ B;  1H4R A;  2VH1 A;  2GLS A;  3WIM A;  2D3A A;  5DPT A;  2ZPN A;  2WX1 A;  1C9F A;  4IM3 A;  1F1H A;  4YTM B;  5AEK B;  1SF0 A;  2C60 A;  2GBM A;  2JY6 A;  5MPO A;  3A4R A;  1JAL A;  1WH3 A;  2O2V A;  4OZA A;  5D7G A;  3N1Y C;  2D10 A;  2FAZ A;  4DWF A;  3VDZ A;  3PRZ A;  5BMH A;  3EEC A;  2KFK A;  2OJR A;  1KFY B;  2DHZ A;  4PT5 A;  1R4M B;  1OQR A;  3ZTC A;  1VCB A;  4ACF A;  4B9K A;  4OVV A;  2M17 A;  1UBI A;  2FCQ A;  2EKE C;  4DK5 A;  4M0W B;  3AEB B;  4ZRI A;  4EZJ A;  3V60 A;  4G3X B;  2LJI A;  4OZC A;  3V05 A;  1XLP A;  2L0F A;  3AEC B;  1E8X A;  1VLB A;  1FXA A;  3Q14 C;  4RFB A;  4CYE A;  2M0A A;  3MC8 A;  1C77 A;  4P6V F;  2L0T A;  5EE3 A;  1WJ4 A;  1QLB B;  4E71 A;  1K8R B;  2K1F A;  5JXV A;  1WGY A;  2I1K A;  4K7U A;  1WE7 A;  2MBO A;  2BB5 A;  1WGK A;  1NI3 A;  4GU2 A;  2JT4 B;  4NAW A;  3C19 A;  4RNA A;  1XD3 B;  3KWV A;  4YXD B;  4A20 A;  3Q3M C;  3VQI A;  2R61 A;  2ZEQ A;  3A4S C;  3TEW A;  2MP2 A;  2MJD A;  4ANU A;  4YSZ B;  1SIJ A;  5DPW A;  4L23 A;  1IPG A;  3N1Z C;  2MBQ A;  3RNA C;  2LHD A;  4ZYS A;  1PUT A;  4DXA B;  3M62 B;  3R2I A;  2PEA A;  4MSM B;  2LGX A;  4C4V A;  3FC4 A;  2ONQ A;  4EEW A;  2AEH A;  2JU6 X;  3NOB A;  2O6V B;  2YEP B;  3NG0 A;  4I6L B;  4XDD A;  3TEZ A;  1FO4 A;  4PYU A;  1JW9 D;  1WSP A;  2BYF A;  1F2R C;  2RDG A;  1TBE A;  2D2Q A;  1AAR A;  1RAX A;  1WE6 A;  3OLM D;  4LNI A;  4XZ4 A;  3R7Q A;  3ALB A;  1ZOY B;  1Q5W B;  2WLB A;  3A1Q A;  2WS3 B;  1EM7 A;  4GDL A;  2FBW B;  5D3I B;  3LYY A;  1BXT A;  2G3Q B;  2PIA A;  2WXR A;  4JWS C;  1R4N I;  1B1Z A;  2ZNV C;  1E8W A;  3PGE A;  1XCT L;  1XF5 L;  3HVZ A;  5E6O A;  4US8 A;  1WFY A;  2JRI B;  3C8Y A;  3DBH B;  2J42 A;  1EUV B;  1UD7 A;  2HTH A;  2DYB A;  3Q3F A;  1FNW A;  1R7S A;  3ZUN A;  5J18 A;  2OJW A;  1TTN A;  4EOY A;  4UDU C;  1SXT A;  3SFE B;  4B95 A;  3ZNH B;  2CKH B;  3AED B;  1L4D B;  3W1Y A;  2M1M A;  1WIA A;  4FA6 A;  2GB1 A;  2YEP F;  2ZZP B;  2J53 A;  3N9Y C;  1ISN A;  1Q10 A;  2BGF A;  3ZJV A;  1TS3 A;  3KUD B;  3ZKJ C;  2J7Q B;  4MAC A;  4LTU A;  4MGK E;  3L10 B;  4WJP A;  5IN7 A;  3NY5 A;  5C23 A;  3RFZ B;  1JWB D;  4DXF A;  1P98 A;  2O2V B;  1SJH D;  1WYG A;  3ZJU A;  3U4E G;  2UWQ A;  2AYO B;  3AH7 A;  4KZ0 A;  4AS1 A;  5FK9 C;  3P4R B;  4W9F A;  2WX0 A;  4L2Y A;  2ZVN A;  4N59 A;  1F52 A;  4DBG A;  2KJ6 A;  2L05 A;  4REZ A;  3T3N A;  1NDD A;  2JWZ A;  1GC7 A;  4WJQ A;  1SB3 C;  3PVL A;  1D5M C;  2WDR B;  3B2G A;  4WIP A;  3W5V B;  1GOZ A;  3KQ4 A;  2AL3 A;  3SFD B;  5EDS A;  2N9E B;  3KUC B;  1GAQ B;  5IOI A;  2ICI A;  1HE8 A;  2JQR B;  4PS3 A;  2LMC A;  3NVY A;  2EKI A;  4HRS A;  3ZNZ B;  2BYE A;  2Z0E B;  2K8H A;  4DQO C;  2DYM A;  4EZK A;  1WJN A;  2KQ7 A;  2WU5 B;  3AI5 A;  2XK5 A;  1Y8R C;  4G11 A;  4KDI C;  5AUI A;  1YJJ A;  1E9M A;  3N3K B;  3QIJ A;  2Z59 B;  3IT6 B;  2KMC A;  2AQ2 B;  2K39 A;  2KDI A;  4LDT D;  4CQN A;  2ZJD A;  4P16 A;  4S17 A;  2HDE A;  5DCN A;  1AN8 A;  2PE6 B;  4AQ7 A;  2RGF A;  4B6W A;  2J0K A;  4KIK A;  1ZKH A;  2IND C;  1Q0W B;  1WXV A;  4IM2 A;  2G45 B;  4KGR A;  1PFD A;  1UEL A;  3VH3 B;  2RSU A;  1JWA D;  2W55 A;  3VXW A;  1FD6 A;  1XQQ A;  4GXB A;  1P3Q U;  4LNN A;  1WY8 A;  1ZGU B;  3VH4 B;  5JH5 C;  4RF0 A;  2NBU A;  4KDL B;  1LFD A;  3AE9 B;  4LNK A;  4C00 A;  1C76 A;  1ET6 A;  3HM6 X;  2W82 A;  4IM0 A;  4C7Y A;  1YNT E;  1ET9 A;  3RNC C;  3P42 A;  3SU8 X;  5HHD G;  1RFA A;  2VRR B;  3PO0 A;  1PDX A;  1D5X C;  3A1Q B;  3EFC A;  1T0R C;  4GDL B;  2ZNV B;  1L0Y B;  1N6Z A;  3AE3 B;  3BIN A;  1L6V A;  3VTU A;  1CK1 A;  3ZQ4 A;  2WNM A;  2CHW A;  4NAM A;  2LWP A;  4MH8 A;  1FEH A;  3UIN B;  4BAX A;  1FIQ A;  1HTO A;  4MGZ E;  4HKZ E;  2NBW B;  3QJZ A;  4WUR A;  2FCS A;  3EGR A;  3NJT A;  3WAM A;  4M00 A;  2JZZ A;  2K6Q A;  2JF5 A;  1V1P A;  2N9P C;  3B2F A;  5G2N A;  5FR6 A;  2IGG A;  1VR9 A;  3DQV A;  3DWM A;  5BO4 B;  1C78 A;  2QMT A;  1WGG A; 
#chains in the Genus database with same CATH homology
 4FJZ A;  5DPT A;  2ZPN A;  2WX1 A;  3ENE A;  4IM3 A;  3V6C B;  3IBE A;  5IAA C;  3QC8 B;  2K8C A;  3APF A;  1BT0 A;  5AEK B;  2J0M A;  2C60 A;  2L7R A;  4K1R B;  2NCN A;  1UH6 A;  2GBM A;  2JY6 A;  3A4R A;  3PLV A;  1UZX B;  2K6D B;  3CF6 E;  1WH3 A;  4GSW A;  3CMM B;  2O2V A;  5D7G A;  2IYD B;  4NAW B;  2D10 A;  3B0A A;  1UBQ A;  2FAZ A;  3H9D A;  4DWF A;  3VDZ A;  3PRZ A;  2KK8 A;  3EEC A;  2IY0 B;  2LI5 A;  2KFK A;  2IZV B;  2OJR A;  3HK0 A;  3AUL A;  2DHZ A;  2K25 A;  3PRE A;  3UQB A;  4FAD A;  1WR1 A;  1GG3 A;  2MBE A;  3ZW3 A;  1I35 A;  4BOZ B;  3VHT C;  2MP2 B;  3ZNI D;  3ZTC A;  3V62 A;  1VCB A;  3VTV A;  4B9K A;  4OVV A;  5KHQ A;  4GOC A;  2M17 A;  4NQL B;  4RMA A;  4TV3 A;  2KD0 A;  5TR5 A;  3QAQ A;  1P1A A;  4ANV A;  1UBI A;  2WWZ A;  1A5R A;  3D32 A;  2FCQ A;  3IG3 A;  2EKE C;  3DVN U;  4DK5 A;  1J0G A;  1OQY A;  4M8M A;  4M0W B;  4ZRI A;  2ZVO A;  4W9C A;  2N9X A;  2W9N A;  4EZJ A;  2XEW A;  1GNU A;  4W9L A;  3N32 A;  4IC7 B;  3IVF A;  3OAW A;  3L54 A;  3NHE B;  3V60 A;  4G3X B;  4AJY B;  1E8Z A;  1VD2 A;  4YL8 A;  3U30 A;  1IYF A;  4ZYN A;  4DDG D;  3T8M A;  2J0J A;  3VVW B;  4EKU A;  2XBB C;  3A9K A;  2L0F A;  2AL6 A;  1E8X A;  3OJ3 A;  4GIV A;  1C3T A;  3KYD D;  4NY0 A;  4CYE A;  3UIP B;  1SGH A;  1WXA A;  2DYO A;  3QX1 A;  2KC1 A;  3R7R A;  3PS6 A;  1NBF C;  2L0T A;  1WMH B;  1WJ4 A;  1YJ1 A;  3DPD A;  2KWU B;  2LVQ A;  4E71 A;  1K8R B;  2FIF A;  2K1F A;  2Z0D B;  1WGY A;  2I1K A;  4K7U A;  3SHQ A;  2N1W A;  3H7S A;  3VUX A;  1WE7 A;  2JPH A;  2MBO A;  3RUI B;  3VAW A;  4FBJ B;  3MTN B;  3HM3 A;  2IO0 B;  2N7E A;  3KUZ A;  3L17 A;  4GU2 A;  2JT4 B;  2MW5 A;  1WYW B;  4NAW A;  1WRD B;  2NPT B;  4K81 A;  1R4M I;  1IP9 A;  3AU4 A;  3DBL I;  3JW0 X;  1XD3 B;  4A20 A;  2XK5 B;  3VQI A;  1KM7 A;  2DZJ A;  2IO3 B;  2MA9 B;  2LRW A;  1SIF A;  2YLM A;  3K9P B;  4ICV A;  4LJO B;  1S1Q B;  2ZEQ A;  3A4S C;  3RD2 A;  2D07 B;  2DZK A;  2MP2 A;  4HVB A;  1E7V A;  3TCA A;  1Z2M A;  1ZW7 A;  4F8C B;  4ANU A;  4KSK C;  5AZH A;  2KN5 A;  5DPW A;  5CHW A;  4W9D A;  3R3M A;  2FNJ B;  4WAA A;  3ML9 A;  3ZLZ A;  4RM8 A;  1IPG A;  5E6P A;  2GBJ A;  5HKH A;  2MBQ A;  2BYV E;  2KWV B;  2C7N B;  3JSV B;  3KYC D;  3DVG Y;  1WF9 A;  5C1Z A;  1FXT B;  1P0R A;  1WJU A;  2KDF B;  4TQ0 A;  4PYZ A;  4BBN F;  4DXA B;  3M62 B;  1Z5S B;  4DHZ E;  3GZN I;  1WGR A;  2PEA A;  3A33 B;  5KHO A;  4KIK B;  5JHB A;  4W9I A;  2A5U A;  4MSM B;  3ZTD A;  4BKG A;  2LGX A;  3B1L X;  4KSL C;  4EEW A;  3ZVV A;  2AEH A;  2ZPY A;  3O65 B;  3NOB A;  2O6V B;  4BKT A;  2QHO A;  4FJY A;  4MH0 E;  3WA0 A;  1NI2 A;  5DPS A;  4I6L B;  1EF5 A;  4F1S A;  4NJ6 A;  2BKR B;  2C7M B;  4ICU A;  5LXH A;  2JRH A;  3TL5 A;  3ZNG C;  4LDT B;  2DEN B;  4NQK E;  4PYU A;  3H1U A;  1WM3 A;  3H7P A;  2KX3 A;  2BYF A;  4WJO A;  4ZDV A;  4MGI E;  2L8J A;  1E8Y A;  4TKN A;  1TBE A;  2D2Q A;  3KH0 A;  3IHP C;  3V6E B;  1RRB A;  1AAR A;  1RAX A;  1WE6 A;  3OLM D;  4XZ4 A;  3R7Q A;  3PRM B;  4BVU C;  3ALB A;  2BF8 B;  1Q5W B;  2M8S A;  3JYU A;  3EFU A;  4JLC A;  1JRU A;  3A1Q A;  4LCD E;  4GDL A;  2KAN A;  3A9J B;  4FLH A;  3QCA A;  2G3Q B;  2BWE S;  3DBS A;  4HLE A;  2MX2 A;  3ONS A;  3S2A A;  1R4N I;  3P2B A;  4HK2 A;  3KW5 B;  2ZNV C;  2LGD A;  1WZ0 A;  2CU1 A;  3OJ4 B;  1E8W A;  3PGE A;  4WWN A;  3ZO5 B;  3V61 A;  4TUU A;  2CS4 A;  2DAF A;  4EZL A;  2MCN B;  4FUL A;  4RM9 A;  4HDO A;  2BWF A;  5E6O A;  1WFY A;  4AJW A;  4ASW C;  1TZ1 A;  4BKS D;  1V6E A;  2JRI B;  1E5W A;  3DCG A;  2NBV B;  4HDQ A;  1RLF A;  3CST A;  1V86 A;  2DZI A;  3K9O B;  3TMP B;  2DX5 B;  4EUT A;  1EUV B;  1UD7 A;  2G4D B;  4ZRK A;  2HTH A;  2DYB A;  4IWO A;  2GMI C;  3Q3F A;  2KNB A;  3QQ8 B;  2RD0 A;  5CX3 A;  3U8Z A;  1V5O A;  3ZUN A;  2B3A A;  2O6V A;  2N7D A;  3UIO B;  5J18 A;  3WAL A;  4EFO A;  3QWZ B;  3EC8 A;  1TTN A;  4EOY A;  2FID A;  4B95 A;  4HWI B;  3ZNH B;  2CKH B;  5CHV C;  3NZS A;  3Q3J A;  1GC6 A;  4FHJ A;  1QZE A;  2KOX A;  3W1Y A;  2M1M A;  1WX7 A;  4BKS A;  4NJ7 A;  1WIA A;  4HCN B;  4FA6 A;  3UQA A;  2KX0 A;  1EO6 A;  1L2N A;  1D3Z A;  2ZZP B;  2IO1 B;  1ISN A;  4XX5 A;  1CMX B;  2MBB B;  3X0W A;  1E90 A;  3WAN A;  2ZCB A;  2BGF A;  3W1S A;  3KUD B;  2NS5 A;  4E74 A;  1G6J A;  3ZKJ C;  2J7Q B;  3ZRC A;  4HXD A;  5AZG A;  4MGK E;  4WWP A;  2KWC A;  4BFR A;  3L10 B;  2CHX A;  1X1M A;  2KTR B;  1UGM A;  2LRU A;  2BPS A;  4MGY E;  2K8B A;  4WJP A;  3NY5 A;  5C23 A;  4P7I A;  4W9H A;  1PQS A;  2R2O A;  2UYZ B;  2L00 B;  4KZC A;  4TQ1 A;  4NPN A;  2KXJ A;  1P98 A;  2O2V B;  4BOS C;  3GOE A;  5LXI B;  1OTR B;  2C7H A;  2L3Z A;  2LGY A;  3LJ3 A;  4MEM A;  5IA7 A;  3N30 A;  4GB9 A;  3DBH I;  2UWQ A;  2AYO B;  3ZDM C;  2JXX A;  4KZ0 A;  2WYQ A;  3RZW C;  3L16 A;  4IUM B;  1YX5 B;  4BBN C;  5LLI A;  2EMS A;  2LXC A;  4W9F A;  3UGB B;  4ANW A;  3NZU A;  4GMV A;  2WX0 A;  2LZ6 A;  1V49 A;  2KLC A;  2V1Y A;  2LD9 A;  2ZVN A;  1WGD A;  2LJ5 A;  5CHF A;  3QK0 A;  1I42 A;  1WX9 A;  3VUY A;  1XT9 B;  4F7Z A;  4DBG A;  2KJ6 A;  2L05 A;  1WX8 A;  3ECI A;  4A3O A;  4AOF A;  1NDD A;  2JWZ A;  1GC7 A;  2D3G A;  2MRP A;  3CSF A;  4WJQ A;  1YQB A;  2KQS A;  4GN1 A;  4CO7 A;  3PVL A;  4GDK B;  4DHJ B;  1V81 A;  4WJN A;  3RZF A;  1WXM A;  4AP4 C;  4FJV B;  3H6N A;  1KJT A;  4WQO B;  2N4F A;  2RPQ A;  3PPA A;  1F9J A;  1WMH A;  1EF1 A;  2AL3 A;  4PS8 A;  5EDS A;  3PSE B;  2N9E B;  4XC2 A;  4I6N B;  1WR6 E;  3KUC B;  2V3S A;  1HE8 A;  4PS3 A;  2KMA A;  3ZIM A;  2LXA A;  4OVU A;  2OOB B;  2NR2 A;  2REX A;  4K7S A;  1WGH A;  3DVG X;  3NS8 A;  2L76 A;  4MJS B;  5CTR C;  2BYE A;  3ZNZ B;  2Z0E B;  2K8H A;  2NPT A;  4URK A;  2DAJ A;  3DBR I;  2DYM A;  3M95 A;  4EZK A;  3I3T B;  4I6P A;  1WJN A;  2KQ7 A;  3AI5 A;  2RR9 A;  2KTR A;  3C0R B;  4N9F 4;  2FUH B;  2KC2 A;  2XK5 A;  1Q1O A;  5G55 A;  2KVR A;  3UF8 A;  1V80 A;  2M4N A;  1Y8R C;  2MWS B;  4G11 A;  3VFK A;  1H8C A;  1OEY J;  1L7Y A;  2M0X A;  4IWQ A;  2O6V D;  1LXD A;  4CHK A;  3L0W B;  2JZ3 B;  3L13 A;  4KDI C;  5E6N A;  1V2Y A;  2GOW A;  1OEY A;  3EHV A;  4DHJ D;  2V4L A;  3ZDT A;  4AWJ A;  2A4Z A;  2R2Q A;  2Z59 B;  2KLG A;  2LVO A;  3N3K B;  2KMC A;  2ASQ A;  3QIJ A;  4FN2 A;  2K39 A;  2KDI A;  3R66 C;  4LDT D;  3VUW A;  3HHM A;  1V9J A;  2ZJD A;  3T9L A;  2MQJ A;  4JIO U;  3MHS D;  5GMV A;  2IO2 B;  5DCN A;  3X23 A;  4W9G A;  3LDZ E;  3JSV A;  2PE6 B;  4E3C A;  2BKF A;  1T0Y A;  2HD5 B;  4II3 B;  2KO3 A;  1YX6 B;  2RGF A;  4B6W A;  2HE7 A;  2CR5 A;  2J0K A;  3APD A;  2AWT A;  3AXC A;  4KIK A;  1TGZ B;  3TIX A;  1ZKH A;  2FCM A;  1S3S G;  2KTF A;  1Q0W B;  1P9D U;  2JUO A;  4W9E A;  4GGQ A;  3WAP A;  4X57 B;  1WXV A;  3PZD A;  4IM2 A;  4DHZ B;  2G45 B;  1LM8 B;  2YVC A;  2ZCC A;  4IG7 B;  5J2R A;  1UEL A;  1KOT A;  3VH3 B;  1GUA B;  2RSU A;  4GDK A;  2PJH A;  2NVU I;  1WXS A;  3VXW A;  4NNJ B;  1XQQ A;  4W9J A;  2KFJ A;  4GXB A;  1P3Q U;  3ZRF A;  1WM2 A;  2IBI B;  1WY8 A;  1ZGU B;  1OGW A;  3VH4 B;  2JVC A;  2C9W B;  2IY1 B;  3B08 A;  3WAO A;  5JH5 C;  3JVZ X;  1WZ3 A;  2NBU A;  4KDL B;  5D2M B;  1KLV A;  2KHW B;  2KDE B;  1LFD A;  2MBH A;  4HCP B;  4MM3 A;  2G4S A;  2KKC A;  3RYT A;  4KV2 A;  2PPH A;  4MDK E;  3SDL C;  5L95 C;  4MJS A;  5L83 A;  2DZM A;  4G50 A;  4JGH B;  2KJR A;  3VTW A;  3HM6 X;  2CHZ A;  3A9J A;  5DPR A;  4K7W A;  2C5L C;  3W1S C;  1GJZ A;  3RCZ A;  4IM0 A;  3M63 B;  3H7P B;  3IFW B;  1J8C A;  4LJP B;  3PTF C;  3PHW B;  5D94 A;  3QAR A;  3SU8 X;  4AUQ C;  2HJ8 A;  3ML8 A;  1RFA A;  1J19 A;  2VRR B;  2N1V A;  1U4A A;  2GBR A;  4KVG B;  3A1Q B;  3PV1 A;  4FHK A;  4WWO A;  2GBK A;  3BY4 B;  5JZE B;  3M3J A;  4GDL B;  4PS7 A;  2ZNV B;  4JL9 A;  4DDI D;  2WDT B;  1E7U A;  2KFK B;  3KVF B;  3BIN A;  5D6J B;  3PHX B;  4IW0 A;  3PT2 B;  3TJP A;  4ANX A;  4HJK A;  3VTU A;  1SE9 A;  3QHT A;  4M8N A;  3PRP B;  3QA8 A;  2GBN A;  2CHW A;  1YIW A;  2LWP A;  3PLU A;  3MJW A;  4IWP A;  3UIN B;  2FCN A;  3DDC B;  4HPM B;  1LQB A;  4MGZ E;  4G0N B;  2LUE A;  2NBW B;  3QJZ A;  2FCS A;  1M94 A;  5JHA A;  4HPL B;  1C1Y B;  2D11 A;  2Y5B B;  3AU5 A;  4W9K A;  3WAM A;  2MSE D;  4ZRJ A;  2JZZ A;  2K6Q A;  5AZF A;  3SD5 A;  1YD8 U;  4II2 B;  2EMT A;  4JQW C;  2LAS A;  2JF5 A;  1V5T A;  4MEL A;  3L08 A;  2LVP A;  3APC A;  3DOW A;  3HIZ A;  2N9P C;  3TBL D;  2PE9 A;  1WI0 A;  4J6I A;  2KJH B;  1MG8 A;  5G2N A;  5FR6 A;  2MLB A;  5J17 A;  4A3P A;  3DQV A;  1WJ6 A;  3RUL A;  3A9K B;  2I1J A;  2KZR A;  3RT3 B;  4MSQ B;  1H4R A;  5BO4 B;  3U7D A;  1WGG A;  3WIM A;  3DVN V;  2KDB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...