2PPHA

Solution structure of human mekk3 pb1 domain
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
93
structure length
93
Chain Sequence
QSDVRIKFEHNGERRIIAFSRPVKYEDVEHKVTTVFGQPLDLHYMNNELSILLKNQDDLDKAIDILDRSSSMKSLRILLLSQDRNLEHHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Mitogen-activated protein kinase kinase kinase 3
publication title Insight into the Binding Properties of MEKK3 PB1 to MEK5 PB1 from Its Solution Structure.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 14
structure length 93
sequence length 93
ec nomenclature ec 2.7.11.25: Mitogen-activated protein kinase kinase kinase.
pdb deposition date 2007-04-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00564 PB1 PB1 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 2pphA01
2IO3B 2JUOA 2FCNA 2IO0B 4MEMA 1VCBA 3JSVA 3PRPB 2L7RA 5DCNA 1SIFA 5D6JB 3H7PB 4TQ0A 2G4SA 3RYTA 1WY8A 2C7HA 2R2QA 3CSFA 3CMMB 3ZW3A 4EZJA 2KMCA 2IO2B 2KZRA 4HDQA 4DXAB 1RLFA 5E6PA 2N4FA 2V3SA 2MBOA 2KK8A 2CS4A 1BT0A 1UD7A 2KJ6A 1TBEA 4BOSC 4DHZB 2L3ZA 3ECIA 3N30A 2NPTB 2IYDB 4EEWA 4BKSD 2DENB 1V5TA 4HCNB 3IHPC 1V9JA 2DYMA 3OJ3A 3W1SA 4K7WA 2M1MA 3ZNHB 4RMAA 3DQVA 3NHEB 4OVUA 2AL3A 5D7GA 4AOFA 1P1AA 1P3QU 2O6VA 1QZEA 4GGQA 4LDTD 1Z2MA 2FCSA 4P7IA 3N32A 1GG3A 1Y8RC 3ZUNA 4E71A 3UQAA 1J8CA 1R4MI 2KC2A 2K1FA 2D3GA 2WDTB 2ZZPB 1WXAA 2RD0A 3QQ8B 1GJZA 2G45B 4M8MA 2DZKA 3KUZA 4G11A 3MJWA 3M95A 2MSED 3D32A 3SHQA 2KDFB 5LXIB 2DZJA 2K6DB 1LM8B 4JIOU 2EMTA 3PTFC 3TL5A 4AP4C 2W9NA 4GDKA 2KX0A 2LVQA 1E5WA 2I1KA 3L13A 2UYZB 3SU8X 3W1YA 3PV1A 2KFJA 4HLEA 2C7NB 2KWVB 3VUWA 1V6EA 4XC2A 2AYOB 3PHWB 1WXSA 2BKFA 4KZ0A 2ZVNA 5JH5C 3IVFA 1XQQA 2NS5A 2MBEA 3C0RB 2R2OA 2HTHA 2LXAA 2O6VB 4TV3A 2IY0B 4DDGD 4II2B 2WX0A 3R66C 1H8CA 2KD0A 5DPRA 2UWQA 1WRDB 2BYFA 1RRBA 3M62B 4HDOA 2C7MB 1D3ZA 4LJOB 4MGKE 3OJ4B 3K9OB 4B6WA 1KLVA 2BWES 4LCDE 2KQSA 2JRIB 2O2VB 2MP2A 1WGYA 1V86A 3CSTA 3NZUA 2KTFA 3B0AA 2LXCA 2MBHA 4II3B 2LUEA 4JL9A 4WWPA 3X23A 1UBIA 2LASA 3JVZX 3TIXA 3PT2B 1TZ1A 2NBUA 4IW0A 3ZRCA 1J19A 4AWJA 2M8SA 2OOBB 3V62A 2WWZA 3VTVA 2ZPYA 3HHMA 2PE6B 4WWNA 4HJKA 3KYCD 4KDIC 2C60A 5BO4B 4URKA 1HE8A 1IP9A 2KTRA 4NQLB 2MBBB 2K8HA 3M63B 1SGHA 4WJPA 4ZRIA 4DHJD 1GUAB 1LFDA 2LI5A 4HPMB 2DHZA 4CO7A 1ISNA 4MGYE 2KANA 3ZNID 2XK5B 1WR1A 3QA8A 3H7PA 4MSQB 1P0RA 3QAQA 3QJZA 5GMVA 3VXWA 2GBNA 2JZ3B 3UF8A 3PVLA 3WA0A 1T0YA 2HD5B 2JY6A 3JW0X 3AXCA 3PPAA 2CKHB 4A3OA 3N3KB 3WAPA 4IWPA 2IY1B 2LVPA 4DBGA 2GBRA 2EMSA 2NPTA 3R7QA 2KLGA 2MA9B 3ZDMC 4M8NA 3MTNB 3LDZE 4FJZA 1H4RA 5CX3A 3QIJA 2L8JA 2LZ6A 2N7EA 4G0NB 2M4NA 3APFA 3VH4B 4AJYB 4N9F4 2BPSA 1E8XA 2C5LC 1V81A 1I35A 1UELA 3A1QB 3PRZA 3AU5A 2OJRA 2KO3A 2WX1A 3AULA 3TJPA 1SE9A 1TTNA 2LWPA 2PEAA 5LLIA 3KUCB 1WJ6A 2L76A 1EUVB 2YLMA 2CR5A 4AUQC 3HK0A 2Y5BB 2HE7A 4HK2A 2NBVB 2LRWA 3ALBA 4I6PA 1Q0WB 3B1LX 3ONSA 3SDLC 3WALA 1YX5B 2KVRA 3CF6E 2ZNVC 1ZKHA 3KW5B 3QHTA 4K81A 1YJ1A 2KX3A 1UH6A 2L0FA 3VUXA 1S3SG 3KVFB 3RCZA 4OVVA 2I1JA 5J17A 4FJVB 5JHBA 1KOTA 2G3QB 3NS8A 1NBFC 1WM3A 4B95A 4DWFA 3EHVA 3PGEA 4K7UA 4EFOA 3SD5A 2RGFA 5AZGA 1V49A 3MHSD 1P9DU 2DX5B 2FCQA 4F8CB 5KHOA 1OGWA 3ZKJC 2J0JA 1WGHA 4LDTB 1WYWB 5DPSA 5EDSA 1WIAA 2RSUA 2J7QB 2JZZA 2N9XA 1J0GA 3DOWA 3ENEA 5L83A 4BBNF 2O2VA 3WIMA 1E90A 4MGIE 2A4ZA 3R7RA 2MBQA 4IUMB 5J18A 4PS7A 1IPGA 2ASQA 2FAZA 4I6LB 3DVNV 2L00B 4ICUA 1E8YA 4HWIB 3ZDTA 1A5RA 2IZVB 3A4RA 1M94A 2N9PC 2BYEA 4MSMB 3BY4B 2KMAA 1MG8A 3X0WA 4GOCA 4KZCA 2JF5A 4M0WB 4BOZB 2GMIC 4RM9A 3V6EB 1IYFA 3M3JA 4EZKA 2LRUA 3ZTCA 4J6IA 4GSWA 3QCAA 1WX7A 4EUTA 1C3TA 5FR6A 2K8BA 2JWZA 2XK5A 1WX8A 3VTWA 3ZO5B 1C1YB 2GBJA 1Q5WB 4AJWA 3APCA 3PZDA 3B08A 1UZXB 3W1SC 4MGZE 1WJUA 4A3PA 4DHZE 1OEYJ 5IA7A 4B9KA 4GMVA 1GC7A 4G3XB 2ZEQA 1F9JA 2QHOA 1WGRA 2IBIB 4KVGB 3IFWB 3EC8A 2XBBC 3RT3B 4KDLB 3V60A 2O6VD 4FADA 1YIWA 4NAWB 3QX1A 3U8ZA 3LJ3A 3UIPB 4WQOB 2C9WB 5G55A 3KYDD 2L05A 1EO6A 3UIOB 1L2NA 2BKRB 2CHWA 1K8RB 4ANXA 4ANUA 3PREA 4KV2A 4FHKA 4IWQA 1ZGUB 5D94A 2BWFA 3R3MA 3L16A 5C23A 3L08A 3A1QA 3BINA 5L95C 2GBKA 3H6NA 4DHJB 2Z0EB 4KIKB 1XD3B 3VHTC 1ZW7A 3A9JB 5G2NA 4WJOA 5KHQA 3HM3A 4X57B 4HVBA 1WR6E 1EF5A 1WM2A 3A9KB 4W9KA 2GBMA 3AI5A 4IC7B 5DPTA 1WE6A 4CHKA 3HIZA 4WJQA 2AWTA 2BGFA 2LGYA 4W9GA 3IBEA 2NBWB 5J2RA 3VFKA 4IG7B 4IM2A 3TCAA 2A5UA 2JPHA 2Z0DB 4BKSA 3QWZB 2M0XA 2KQ7A 2KXJA 2G4DB 3OLMD 4ANWA 1FXTB 4PS8A 3VTUA 3O65B 2J0MA 3UINB 5HKHA 2REXA 1NI2A 4PYZA 3RULA 2JVCA 4NJ7A 3VUYA 2WYQA 1WZ0A 3H9DA 3L0WB 4FN2A 4LJPB 4BBNC 4TUUA 2KWCA 2PE9A 3HM6X 4DK5A 4W9CA 2K8CA 3L54A 3P2BA 3ZTDA 3ZRFA 5CTRC 3PLUA 3NOBA 1I42A 4MM3A 1TGZB 2CU1A 2IO1B 4E74A 4NPNA 2MQJA 1XT9B 3RUIB 2N1VA 3QARA 3U7DA 4EKUA 1X1MA 2JRHA 4GU2A 2NR2A 2NCNA 1WMHB 5C1ZA 1UGMA 4TQ1A 2L0TA 1WXMA 3KUDB 3V61A 2KDEB 1YX6B 1S1QB 2MWSB 2ZNVB 3ZNZB 3ZNGC 4FA6A 5AZHA 2LGXA 2NVUI 3RZFA 3VAWA 2DYOA 4F1SA 1E8ZA 1NDDA 1Z5SB 3DBHI 5CHWA 2D11A 3DBSA 2V4LA 2JXXA 2D2QA 4W9HA 3TBLD 3PHXB 4PS3A 2KDIA 4WAAA 3RZWC 3VH3B 1WXVA 4KSLC 1OQYA 3A33B 3ML8A 1AARA 3VDZA 2FNJB 4GIVA 4KSKC 2FCMA 1E7UA 1YQBA 4IM0A 2PPHA 2DAJA 4MJSB 3EFUA 2FUHB 2FIDA 1WZ3A 4NAWA 4MH0E 4GDLB 3WANA 3L10B 4PYUA 2HJ8A 4NY0A 1WJ4A 2KFKB 4FBJB 5CHFA 3UQBA 3DVNU 4RM8A 4ZRKA 3VQIA 2BF8B 2LJ5A 1WF9A 3DVGY 3JSVB 2KN5A 4GB9A 4GN1A 2DYBA 3NZSA 2MX2A 1CMXB 2KLCA 4CYEA 2LVOA 1V80A 2RR9A 4W9FA 2D10A 1GNUA 3PSEB 4NQKE 1L7YA 3OAWA 2AEHA 3GOEA 2ZCBA 1KJTA 1WFYA 2N9EB 4KIKA 2AL6A 4JLCA 3A9JA 1U4AA 2KC1A 3UGBB 2MLBA 3EECA 4JQWC 1WGDA 2MRPA 2KOXA 1WH3A 4MDKE 3A9KA 3DBLI 3K9PB 3DCGA 2MCNB 4G50A 4ICVA 4ZYNA 5AEKB 3DBRI 2KHWB 4FJYA 5E6NA 2KKCA 3VVWB 2XEWA 3QC8B 2DAFA 4BKTA 1LXDA 2KJRA 2BYVE 2D07B 2J0KA 4JGHB 1G6JA 4XX5A 5DPWA 2VRRB 4NJ6A 1OTRB 4W9DA 4E3CA 2ZVOA 2CHXA 3ZLZA 2FIFA 1KM7A 2YVCA 3Q3JA 2M17A 2K39A 1Q1OA 3DPDA 4FHJA 4GDKB 4BVUC 2B3AA 2KWUB 4TKNA 3I3TB 2KDBA 4K1RB 1E8WA 4GXBA 4WWOA 3DVGX 4EOYA 4IM3A 3V6CB 2RPQA 2LD9A 4DDID 4ZDVA 2KNBA 4W9EA 2EKEC 5CHVC 1R4NI 2ZPNA 2N7DA 5JZEB 4FLHA 1E7VA 1OEYA 2GOWA 5D2MB 5TR5A 3S2AA 4XZ4A 4ASWC 3NY5A 1WMHA 2K6QA 4EZLA 3KH0A 4BKGA 3ML9A 2KJHB 4HXDA 4YL8A 4ZRJA 1WX9A 1P98A 3DDCB 2DZMA 3WAOA 3GZNI 4W9LA 3H1UA 2ZCCA 3JYUA 3PRMB 3PS6A 4F7ZA 4FULA 1RAXA 3T9LA 3ZVVA 4A20A 3Q3FA 4IWOA 4MELA 3APDA 5AZFA 2Z59B 3PLVA 2PJHA 3T8MA 3U30A 4BFRA 1RFAA 1V5OA 1WGGA 2K25A 4WJNA 5LXHA 3WAMA 2MP2B 3ZIMA 1V2YA 4W9JA 2N1WA 4I6NB 2ZJDA 3A4SC 3L17A 3AU4A 1UBQA 3RD2A 2DZIA 3QK0A 4W9IA 2JT4B 2MW5A 3IG3A 4HPLB 2V1YA 5IAAC 1VD2A 4MJSA 1EF1A 2CHZA 1WI0A 1JRUA 4K7SA 4GDLA 1LQBA 1WE7A 5E6OA 1GC6A 4ANVA 4NNJB 3H7SA 5JHAA 2LGDA 2KFKA 1YD8U 1WJNA 2KTRB 4HCPB 3TMPB 1PQSA
chains in the Genus database with same CATH superfamily
1MFWA 1VDVA 2W82A 5DCNA 3IT6B 3RYTA 2C7HA 4EZJA 3HUIA 3N1XC 3ZJTA 4HDQA 4DXAB 5E6PA 2N4FA 4OHJA 1UD7A 2H89B 3N30A 4XYCA 2JWUA 4Q2JA 1V9JA 3W1SA 3URYA 1T0SC 2MJEA 5D7GA 1FD6A 1J8CA 1R4MI 2K1FA 1I7HA 4P6VF 3MJWA 5AUIA 3SHQA 1TIFA 2KDFB 1LM8B 2BS3B 3TL5A 2W9NA 4GDKA 2LVQA 1E5WA 1FPYA 4PT5A 1DOIA 2V3NA 3Q69A 2UYZB 3IAS1 3IAM1 1L5PA 2ZVNA 3IVFA 4N58A 1ZDXA 2O6VB 1D5XC 4TV3A 4DDGD 2KD0A 2IJ0A 1I4XA 1VLBA 2BYFA 1OQQA 1QOAA 2C7MB 4LJOB 4MGKE 3OJ4B 1WGYA 3CSTA 2KTFA 2MBHA 4II3B 2LUEA 1FCCC 4AQ7A 3PT2B 1TZ1A 2NBUA 3P4SB 4C4VA 1NENB 2M8SA 2OOBB 2WWZA 1TS2A 2ACZB 2QSDA 5BMIA 3KLSX 1CK1A 1SGHA 3ZXRA 4P1BC 2KANA 2XK5B 1WR1A 2KVZA 3H7PA 3QA8A 2JZ3B 3PVLA 2CKHB 3VRBB 1BXTA 2XNAC 3HRDD 2IY1B 1SF0A 2EMSA 2NPTA 2KLGA 2MA9B 3ZDMC 3NRZA 3MTNB 1OQRA 2LGSA 4C7YA 2L83A 1TYGB 4AJYB 4XGAB 1IBXA 1PGAA 2QDFA 2C5LC 3SFDB 1V81A 2CJOA 3TJPA 4RGOS 2LWPA 2PEAA 3AE8B 1WJ6A 2CR5A 2NBVB 3ALBA 2ICIA 2KWDA 2KX3A 3LXFA 1S3SG 4HRSA 3RCZA 4OVVA 2HJ1A 4FJVB 1WM3A 4EFOA 2BQQA 4LDTB 1K50A 5EDSA 1WIAA 4PK1A 2J7QB 5L83A 4BBNF 2O2VA 3LB8C 4R3DA 2A4ZA 4MM3B 3R7RA 1P7EA 2MBQA 2M0AA 3W5VB 1IPGA 4B0EA 1E8YA 4HWIB 3ZDTA 3AEAB 3BY4B 4OZAA 2GMIC 4FXCA 3M3JA 4EZKA 2LRUA 3ZTCA 4J6IA 1WX7A 4EUTA 5FR6A 4US8A 1LGRA 4NAMA 1Q5WB 3C8YA 3APCA 1SJHD 3PZDA 1UZXB 4KKIA 4AJWA 4ZYSA 2D3AA 5IA7A 4GMVA 1JMLA 3B2FA 2K9XA 1IGCA 2XBBC 4KDLB 2O6VD 3P63A 4GLSC 4WQOB 2C9WB 3KYDD 4A8XC 3AEGB 3NVYA 1EO6A 1FFVA 4YSZB 4IWQA 5D94A 3R3MA 4L1BA 2YEPF 3L08A 3A1QA 3FC4A 1VJKA 4KIKB 2WXNA 1XD3B 2Y5PA 1ACCA 3IXSA 4M02A 4WJOA 5G2NA 3HM3A 3I9V1 1EF5A 1WM2A 4XDDA 2CU3A 3AI5A 4IC7B 4L23A 1WE6A 4KGSA 1AN8A 3NS1A 4WJQA 1FNUA 2LGYA 4W9GA 1M4VA 3AECB 3VFKA 2Z0DB 4ARIA 3UI3A 2M0XA 1KLUD 4PS8A 2J0MA 1F0ZA 3UINB 2QIEB 1NI2A 4NJ7A 1WZ0A 3L0WB 4FN2A 1E7PB 4BZAA 2PE9A 5D3IB 1QT9A 2WXPA 5IKCM 4DK5A 1FEHA 4W9CA 1I42A 4E74A 1XO3A 2MQJA 1XT9B 3RUIB 2N1VA 4WURA 3AE3B 3BYTB 1WMHB 2WXKA 1YX6B 3ZNGC 4FA6A 4TMAB 3RZFA 3VAWA 1HEZE 1ZPSA 4MH8A 3DBHI 4RF1A 4USAA 3VR8B 2KAJA 1WXVA 2JYTA 1ZDVA 1UNSA 2FNJB 1C4CA 2FCMA 2FUG1 3RFZB 1EWCA 4NAWA 1ET9A 3WANA 4PYUA 2HJ8A 3I5JC 3O13A 2M56B 3UQBA 2LJ5A 2WLBA 2MX2A 1CMXB 1L4ZB 1V80A 2LVOA 4W9FA 3PSEB 1L7YA 3ZGZA 1NYRA 2N9EB 2D5GA 2G9HD 2AL6A 4JLCA 1YN3A 1PUTA 5EE0A 4JQWC 1WH3A 1NI3A 4G50A 2XN9C 4XWTA 3DBRB 1RWSA 1I4QA 2AQ2B 5E6NA 3QC8B 3B9JA 1YN5A 3R2TA 4NJ6A 1JALA 3ZLZA 2BYTA 1KM7A 2YVCA 2M17A 1WGKA 1T0RC 3RNAC 4FHJA 2CJNA 4BVUC 2KWUB 2KDBA 1E8WA 2AQ3B 4DDID 4ZDVA 4P16A 5JZEB 4WH4A 3S2AA 4REZA 3U4EG 4EZLA 3KH0A 4ZRJA 2KJHB 4YL8A 3DDCB 1HZ5A 3AE2B 3DHHC 1L0XB 3H1UA 3PRMB 3ZVVA 4A20A 1FIQA 4MELA 3P1MA 4A9AA 3PLVA 3AEFB 1WGGA 5IN7A 2N1WA 2ZJDA 3IT4B 3AU4A 3MJ5A 3RD2A 4W9IA 2JT4B 2MW5A 4MJSA 2G1EA 1WI0A 1LQBA 3P4RB 1WE7A 1GC6A 4NNJB 2KFKA 1YD8U 1WJNA 2KTRB 1N61A 3NUHB 3TMPB 1JCKB 1PQSA 1RLFA 2IO3B 2FCNA 2TSSA 3JSVA 3BK2A 5D6JB 2I2YA 4KKJA 1WY8A 3CSFA 1TS3A 2KZRA 3W2DA 2V3SA 2MBOA 2CS4A 4HJGE 1BT0A 1HQRD 2ZW1A 4KGTA 2IGGA 4DHZB 2WXFA 3ECIA 3MC8A 4C80A 1JWAD 1V5TA 4HCNB 2SAKA 4K7WA 3ZNHB 3N9YC 2GLSA 3DQVA 4OVUA 2AL3A 2O6VA 1NEKB 4P7IA 3MP9A 2DLBA 2WDTB 2ZZPB 1Q10A 1LO5D 1WXAA 2RD0A 2J52A 3J9CA 3EFCA 2WXLA 2K6DB 4JIOU 2EMTA 3PTFC 2KX0A 5HHDG 2I1KA 3L13A 3PV1A 4J3OD 4RGMA 4QAYA 2KFJA 4HLEA 2C7NB 3VUWA 2BTEA 2W54A 1WXSA 2BKFA 3CIRB 5JH5C 2NS5A 3FKYA 2KN4A 2QMTA 2IY0B 2WXJA 4II2B 3WCQA 1H8CA 2WXHA 3FILB 1CJEA 2UWQA 1WRDB 3M62B 4LCDE 1JWMD 2BS2B 4ARCA 1V86A 1FM0D 5GXGB 2NMQA 3B0AA 2LXCA 2MJ3A 1DOXA 3JVZX 3TIXA 4AWJA 3V62A 1WYGA 4WWNA 2C60A 1IP9A 1PFDA 3FAHA 2MBBB 4DHJD 1GUAB 4HPMB 1L0VB 1ISNA 4MSQB 3BYYB 2QJLA 3QJZA 3VXWA 2GBNA 2GRIA 2JY6A 3JW0X 4L2YA 3AXCA 4YXDB 3N3KB 4IWPA 4DBGA 3R7QA 1FXAA 4M8NA 1JW9D 1H4RA 2LZ6A 1YQ3B 2N7EA 1XLOA 3APFA 3Q3NC 4OZBA 4RF0A 1I35A 2RDHA 3PRZA 3AU5A 2OJRA 2KO3A 2WX1A 5BMHA 1TTNA 2OJWA 2WXIA 3SFEB 2L76A 4HK2A 2LRWA 1GAQB 4I6PA 3Q6BA 1Q0WB 3ONSA 3SDLC 1HZ6A 1C4PA 2KVRA 1ROEA 3KW5B 4K81A 1UH6A 4IOIE 1KOTA 2WDQB 4DWFA 3EHVA 3PGEA 2DX5B 2N9KA 5KHOA 4KGRA 5DPSA 3TEZA 3DOWA 4A55A 1E90A 4MGIE 1CQVA 1SBBB 2HDEA 2ASQA 4I6LB 3MHZA 4JWSC 2IZVB 3Q8CA 2N9PC 3TEXA 2BYEA 4MSMB 2Q5WD 2KMAA 1MG8A 4GOCA 4KZCA 4M0WB 1QOFA 5C2TB 5EE3A 1UF0A 1T0QC 2K8BA 1WX8A 1C1YB 1UWMA 3B08A 3W1SC 4DHZE 1SSNA 4B9KA 1GC7A 1DOYA 1F9JA 2QHOA 1JWUD 1YJIA 1XLQA 3V60A 1TY0A 3U8ZA 3DWGC 3LJ3A 2LHEA 2N0SB 3UIOB 1L2NA 3PREA 4KV2A 3GS2A 3VR9B 1MHHE 3CWIA 3AV8A 1QOGA 1EWYC 2Z0EB 1J7BA 3PZ8A 3MFGA 3P4PB 4X57B 1WR6E 4W9KA 1R4NB 1NYQA 1VR9A 3H8HA 5DPTA 4CHKA 1I4PA 1PGBA 2V4IB 1D6EC 2NBWB 4IG7B 3QWZB 4ANWA 2KXJA 2G4DB 1L0YB 1YQ4B 1TS5A 4YT0B 2LEKA 3RULA 1FFUA 3VUYA 1TKEA 1Y56A 4S0RA 4BBNC 3AM9A 4B0MA 5EE1A 3ZTDA 3BK1A 4S17A 4AS1A 1TGZB 3SEBA 4RNAA 2NTTA 1XCQL 1C78A 2NR2A 2NCNA 5C1ZA 4OW0A 5EE9A 3KUDB 2KDEB 3AEDB 2JSVX 1HTOA 3ZNZB 3RPFC 2B76B 3MC0B 1WWTA 2DYOA 4F1SA 4A90A 1NDDA 2BB5A 2PMVA 3DBHB 2JXXA 3OG5A 3TBLD 4PS3A 3N1YC 4WAAA 1KRHA 2V0GA 1OQYA 3ML8A 1TY2A 1E7UA 1L6UA 3W9CB 1WZ3A 2FIDA 4MH0E 4GDLB 1VZ6A 5CHFA 3DVNU 3AE7B 4RM8A 1TKGA 2J53A 2RR9A 3C19A 1ZE3D 1GNUA 1KLGD 3GOEA 1KJTA 5AUKA 1WFYA 3A9JA 3UGBB 2W3SA 1WGDA 2MHJA 2MRPA 3BIID 4MDKE 3A9KA 3K9PB 1WSPA 5IOIA 2MCNB 1XEEA 2KHWB 4RH6A 2DAFA 3NZ3A 1ZOYB 2D07B 3NVVA 1B1ZA 3DHGC 2ZVOA 2FIFA 3Q3JA 1WRIA 2INNE 1FNWA 3GP7A 2PW9A 3DPDA 2M19A 4GDKB 4TKNA 4K1RB 3L4PA 4EOYA 2LD9A 5CHVC 1R4NI 2VZKB 5H92C 5TSSA 2ZPNA 2N7DA 4FLHA 2GOWA 1OEYA 5D2MB 5TR5A 5C3JB 3NY5A 2LJIA 4RGTA 1E9MA 4HXDA 3ML9A 1N6ZA 2DZMA 3RNFC 2K5PA 1N60A 3EA6A 3PS6A 3T9LA 1TT5B 4IWOA 1N62A 2Z59B 2PJHA 3U30A 4BFRA 1FO4A 2K25A 4WJNA 4NJCA 1YMHE 3WAMA 1ENFA 2RDBC 4I6NB 3BVGA 2DZIA 3IG3A 5IAAC 2FE8A 4C4VB 4LNFA 1EF1A 1JRUA 5E6OA 5JHAA 1JROA 3R8BA 3TUOA 2WDVB 1HTQA 2RDGA 4A6QA 2JUOA 2IO0B 4MEMA 1VCBA 2SEBD 3PRPB 2KT7A 1SIFA 1KFYB 3H7PB 1P7FA 4TQ0A 2G4SA 2R2QA 1K52A 3CMMB 2KMCA 2IO2B 1FMAD 1JQ4A 2KK8A 2BVCA 2KJ6A 2L3ZA 3HVZA 1ZUD2 2NPTB 2IYDB 4EEWA 4BKSD 2DENB 3NVZA 3IHPC 2INPE 3OJ3A 4OVZA 4RFBA 2HTME 4HKQA 2RPVA 4AOFA 4YWGG 5E6JA 2L1AA 1C76A 4LDTD 2FCSA 4E71A 1IBXB 3N32A 3ZUNA 3FILA 3QQ8B 1GJZA 4LK0M 4M8MA 2DZKA 3SR6A 3M95A 1ESFA 3D32A 5LXIB 4CQNA 4AP4C 1NVID 5JXVA 3SU8X 1J7CA 2KWVB 2WS3B 3Q2AC 1V6EA 2AYOB 3PHWB 3P42A 4KZ0A 2WXOA 2MBEA 2EKIA 2K22A 2R2OA 4MACA 2LXAA 2WX0A 3BVZA 3AMZA 4YSYB 5MPOA 2N9LA 4HDOA 2VH1A 4K3BA 3K9OB 4B6WA 4YSXB 2KQSA 2O2VB 4LNOA 2MP2A 3NZUA 1BMLC 3X23A 1UBIA 1WXQA 1MI0A 4IW0A 3ZRCA 3B2GA 1J19A 3VTVA 2ZPYA 1ZXIA 4ZRPA 1GOZA 2X38A 1IUEA 1XF5L 3AEEB 1OFFA 3KYCD 4HJKA 5BO4B 4URKA 1HE8A 4HKZE 3M63B 2K8HA 2N7JA 4WJPA 1HXYD 2JU6X 1SB3C 4MGYE 5G5GA 3ZNID 3QAQA 5GMVA 2HD5B 4A3OA 3WAPA 5IP4D 2PTLA 2GBRA 1UWXA 1QLBB 3AE4B 4G0NB 1STEA 2WXMA 4UDUC 3VH4B 4N9F4 2BPSA 1TS4A 1GB1A 1E8XA 1UELA 3A1QB 2MH7A 1SXTA 5LLIA 3KUCB 2QEJC 2YLMA 3HK0A 2Y5BB 1GB4A 4DQOC 5T8IA 1I4HA 4N59A 3B1LX 3BVMA 3BZDB 1YX5B 2ZNVC 1ZKHA 1D5MC 3VUXA 2I1JA 5J17A 5JHBA 1L6VA 4B95A 5AZGA 3MHSD 1P9DU 4F8CB 1OGWA 1WGHA 2RSUA 3WIMA 5D3DA 1MPEA 4IUMB 5J18A 1V97A 2FAZA 3DVNV 4ICUA 1A5RA 3KQ4A 1B9RA 2KACA 2INDC 3X0WA 2JF5A 1VRAB 2IGDA 2XK5A 3ZO5B 4US9A 2GBJA 1OEYJ 1WGRA 1KF6B 4KVGB 3OWEB 3RT3B 4N6EB 4FADA 4NAWB 3QX1A 1C4AA 2L05A 1K8RB 4ANXA 4ANUA 2BBCA 3ABVB 2ON8A 2GB1A 3RNBC 4FHKA 2BWFA 5C23A 5L95C 2GBKA 3H6NA 4OZCA 1C9FA 2LMCA 2GBMA 2K3UA 1V1PB 3E56A 1E0ZA 3HIZA 2JYEA 2AWTA 2BGFA 5J2RA 3TCAA 2A5UA 2JPHA 4BKSA 2X8XX 5HKHA 2PVOD 2REXA 1K51A 4PYZA 4ZOHC 2WYQA 3H9DA 4LJPB 3BWUD 2DBYA 4TUUA 1ET6A 3EUB2 3HM6X 2K8CA 4WWMA 3NOBA 4MM3A 1MHXA 2WU5B 3QARA 4C7ZA 2JRHA 3Q8EA 4MT5A 4GU2A 4JE3B 2BB6A 4TQ1A 2L0TA 1WXMA 3NVWA 4O1NA 3R2IA 1DYQA 3V61A 5H8YE 2MWSB 2ZNVB 3AB5A 1RFKA 3RNGC 5AZHA 2LGXA 1QKZA 4KX6B 2NVUI 1E8ZA 1Z5SB 5CHWA 3DBSA 1I4GA 4TSSA 1MVKA 3PHXB 4P1CC 2LGIA 4LNNA 2H88B 4HPPA 4GIVA 4KSKC 2WNMA 3GB1A 4IM0A 2PPHA 4MJSB 3EFUA 2FUHB 1RM6C 4YTPB 3L10B 2EELA 4NY0A 1WJ4A 2KFKB 2PVGC 3GE3C 4FBJB 3LYYA 3VQIA 2BF8B 3JSVB 3DVGY 4GB9A 4GN1A 4C00A 4CYEA 3RNCC 3ZYYX 2BW2A 4NQKE 2KMMA 3OAWA 2AEHA 2ZCBA 4KIKA 2KC1A 2MLBA 3EECA 1KTKA 1MG4A 1XLPA 1DGJA 1IGDA 3DCGA 4ZYNA 5AEKB 2JX5A 2KKCA 2XEWA 1F77A 4ACFA 1LXDA 3E9SA 2KJRA 1TKYA 1FRDA 1EM7A 2FBWB 1G6JA 5DPWA 3RNEC 3Q3MC 1V1OA 2K39A 1Q1OA 1UUPA 5BMGA 2Y3AA 2B3AA 3I3TB 3DVGX 4IM3A 3V6CB 2RPQA 1I4RA 2KNBA 4W9EA 3MC9A 2BS4B 1SE2A 1GPXA 2W3RA 1WMHA 2K6QA 4BKGA 2WXGA 3Q3OC 3GZNI 4W9LA 2IGHA 3JYUA 4F7ZA 4FULA 1RAXA 1ZP0B 2WP9B 5AZFA 3KWLA 3T8MA 1RFAA 1V5OA 2OEDA 5LXHA 2I38A 3V3XA 1V2YA 3GE8C 4W9JA 3A4SC 4H2AA 2IPKD 3L17A 1UBQA 2D3BA 1N63A 4HPLB 1R7SA 4ZHOA 2V1YA 2CHZA 5BYRA 4K7SA 1L4DB 3H7SA 5HG2A 4HCPB 1EU3A 1F52A 1YNTE 2L7RA 1E6EB 3ZW3A 1QILA 3P4QB 2QILA 1TBEA 4BOSC 3Q8AA 4WAFA 1A70A 2KDMA 2DYMA 2WHIA 4WQMA 1QF6A 2M1MA 1C77A 4RMAA 3NHEB 1P1AA 1P3QU 1QZEA 4GGQA 1Z2MA 1GG3A 1Y8RC 3UQAA 2KC2A 2D3GA 3AE5B 1FCLA 2LUMA 3U2SC 2G45B 2JZPA 3KUZA 4G11A 4NZLB 4EE2A 2MSED 5FR3A 5HFYA 2WGSA 2DZJA 1SE4A 2AQ1B 3W1YA 2Y5CA 4XE0A 5HI1A 4ZRQA 3N1ZC 1PGXA 4RCOA 4XC2A 1XQQA 1K53A 3ZQ4A 2KQ4X 3C0RB 3Q8FA 1C79A 2HTHA 2MJDA 2PLPA 3ZXVA 2VH2A 3R66C 2UU7A 5DPRA 5BYSA 3DHIC 2V3PA 1RRBA 1VZ7A 2WQYB 2DNFA 2D3CA 1D3ZA 1T5XD 1KLVA 1TJEA 2BWES 2JRIB 1SEBD 4HEA1 4JL9A 4WWPA 3V05A 2LASA 3RN9C 3AEBB 1F1HA 3HHMA 2PE6B 1QQRA 1KH0A 4KDIC 1MJDA 2KTRA 4NQLB 3KWVA 4YTMB 1JWSD 4ZRIA 1XCTL 1LFDA 2LI5A 2DHZA 4CO7A 3U52E 1CZPA 1P0RA 2NTSA 3UF8A 3WA0A 1T0YA 3PPAA 2RMMA 1F2RC 2J42A 2LVPA 3LDZE 4ITKA 4FJZA 5FKAC 1JRPA 5CX3A 3QIJA 2L8JA 2M4NA 4IKGA 2IDYA 2JQRB 1HA5A 2WU2B 1QOBA 2K0PA 3AULA 1SE9A 1EUVB 4AUQC 2HE7A 4RGNA 2L52A 3AH7A 2DWQA 1PYWD 3WALA 3CF6E 3QHTA 1YJ1A 2L0FA 3KVFB 2G3QB 3NS8A 1NBFC 4K7UA 3SD5A 2RGFA 2V9HA 1V49A 2FCQA 3ZKJC 2J0JA 1WYWB 2LHDA 3T3OA 2N9XA 2JZZA 1J0GA 5LNK1 1YOVB 3ENEA 2YEPB 5G5HA 2R61A 4PS7A 1N5WA 2L00B 4HROA 3A4RA 1M94A 4IDIA 2WDRB 5BYQA 2JXTA 4LTUA 4BOZB 4RM9A 1IYFA 3V6EB 3W5UB 4GSWA 3QCAA 4LNKA 1C3TA 3TEYA 2JWZA 4BAXA 3VTWA 5IO9A 4MGZE 1VZ8A 1WJUA 4A3PA 4G3XB 2ZEQA 3DBLB 1V1PA 2IBIB 3Q14C 3IFWB 3EC8A 1YIWA 3UIPB 1AWDA 5G55A 4LLGM 1RYJA 2BKRB 2ZW0A 2CHWA 1AW7A 2KYWA 3RMKC 1ZGUB 3L16A 1XLNA 2WXQA 3BINA 2PKOA 4DHJB 3AN1A 3VHTC 1ZW7A 3A9JB 5KHQA 4HVBA 2VZKD 1D5ZC 3A9KB 2OHFA 2WXRA 5I4DA 3IBEA 2QCZA 4IM2A 3T3NA 1UGJA 2KQ7A 3OLMD 1FXTB 3VTUA 3O65B 3NG0A 1XXGA 4JX1C 3I57A 2JVCA 5FK9C 2KWCA 2INCC 1V8CA 3U7ZA 2Z8LA 3L54A 3P2BA 3ZRFA 2MEKA 5CTRC 3PLUA 2CU1A 2IO1B 4NPNA 3RI7C 3N20C 1E10A 3U7DA 4EKUA 1X1MA 1YN4A 4ZHPA 3ETRA 1UGMA 1S1QB 1JWBD 2E6XA 4M0WA 2W55A 4WIPA 4D2KA 1EU4A 2D11A 2V4LA 2D2QA 4W9HA 3VH3B 2KDIA 3RZWC 3TEWA 4KSLC 1FRRA 3A33B 1AARA 3VDZA 1YQBA 2DAJA 1D4BA 3VRAB 2E3TA 2GI9A 4C56C 3ZJUA 4DXGA 3AE6B 1R4MB 4ZRKA 1WF9A 4JWUC 2KN5A 2DYBA 3NZSA 2KLCA 1T3QA 2D10A 1SJED 3PZ7A 3ZJVA 1J7AA 1U4AA 3AE1B 2LFIA 2KOXA 3DBLI 4ICVA 3DBRI 3DWMA 2PIAA 4XDCA 4FJYA 1BUIC 3VVWB 4BKTA 2BYVE 2J0KA 4JGHB 4XX5A 2VRRB 2QC8A 1OTRB 1T6BX 3NJTA 4W9DA 4E3CA 2CHXA 2J4XA 4M00A 3PO0A 3HVDA 1PDXA 4M01A 4GXBA 4WWOA 1SE3A 1FXIA 2ONQA 1TZOA 2EKEC 1E7VA 4XZ4A 3AE9B 4ASWC 1FNVA 1WX9A 1F2RI 1P98A 3WAOA 3GZNB 2ZCCA 4DXFA 3Q3FA 2AX5A 3APDA 3TSSA 1YJJA 3Q8BA 2MP2B 3ZIMA 4K3CA 1AYFA 4LNIA 1SIJA 3EGRA 3QK0A 2BT6A 1VD2A 3I63C 4XWWA 4GDLA 4ANVA 2LGDA 2L32A 4YTNB 1N5XA 1ZXHA 4JPSA
chains in the Genus database with same CATH topology
2IO3B 2JUOA 2FCNA 2IO0B 4MEMA 1VCBA 3JSVA 3PRPB 2L7RA 5DCNA 1SIFA 5D6JB 3H7PB 4TQ0A 2G4SA 3RYTA 1WY8A 2C7HA 2R2QA 3CSFA 3CMMB 3ZW3A 4EZJA 2KMCA 2IO2B 2KZRA 4HDQA 4DXAB 1RLFA 5E6PA 2N4FA 2V3SA 2MBOA 2KK8A 2CS4A 1BT0A 1UD7A 2KJ6A 1TBEA 4BOSC 4DHZB 2L3ZA 3ECIA 3N30A 2NPTB 2IYDB 4EEWA 4BKSD 2DENB 1V5TA 4HCNB 3IHPC 1V9JA 2DYMA 3OJ3A 3W1SA 4K7WA 2M1MA 3ZNHB 4RMAA 3DQVA 3NHEB 4OVUA 2AL3A 5D7GA 4AOFA 1P1AA 1P3QU 2O6VA 1QZEA 4GGQA 4LDTD 1Z2MA 2FCSA 4P7IA 3N32A 1GG3A 1Y8RC 3ZUNA 4E71A 3UQAA 1J8CA 1R4MI 2KC2A 2K1FA 2D3GA 2WDTB 2ZZPB 1WXAA 2RD0A 3QQ8B 1GJZA 2G45B 4M8MA 2DZKA 3KUZA 4G11A 3MJWA 3M95A 2MSED 3D32A 3SHQA 2KDFB 5LXIB 2DZJA 2K6DB 1LM8B 4JIOU 2EMTA 3PTFC 3TL5A 4AP4C 2W9NA 4GDKA 2KX0A 2LVQA 1E5WA 2I1KA 3L13A 2UYZB 3SU8X 3W1YA 3PV1A 2KFJA 4HLEA 2C7NB 2KWVB 3VUWA 1V6EA 4XC2A 2AYOB 3PHWB 1WXSA 2BKFA 4KZ0A 2ZVNA 5JH5C 3IVFA 1XQQA 2NS5A 2MBEA 3C0RB 2R2OA 2HTHA 2LXAA 2O6VB 4TV3A 2IY0B 4DDGD 4II2B 2WX0A 3R66C 1H8CA 2KD0A 5DPRA 2UWQA 1WRDB 2BYFA 1RRBA 3M62B 4HDOA 2C7MB 1D3ZA 4LJOB 4MGKE 3OJ4B 3K9OB 4B6WA 1KLVA 2BWES 4LCDE 2KQSA 2JRIB 2O2VB 2MP2A 1WGYA 1V86A 3CSTA 3NZUA 2KTFA 3B0AA 2LXCA 2MBHA 4II3B 2LUEA 4JL9A 4WWPA 3X23A 1UBIA 2LASA 3JVZX 3TIXA 3PT2B 1TZ1A 2NBUA 4IW0A 3ZRCA 1J19A 4AWJA 2M8SA 2OOBB 3V62A 2WWZA 3VTVA 2ZPYA 3HHMA 2PE6B 4WWNA 4HJKA 3KYCD 4KDIC 2C60A 5BO4B 4URKA 1HE8A 1IP9A 2KTRA 4NQLB 2MBBB 2K8HA 3M63B 1SGHA 4WJPA 4ZRIA 4DHJD 1GUAB 1LFDA 2LI5A 4HPMB 2DHZA 4CO7A 1ISNA 4MGYE 2KANA 3ZNID 2XK5B 1WR1A 3QA8A 3H7PA 4MSQB 1P0RA 3QAQA 3QJZA 5GMVA 3VXWA 2GBNA 2JZ3B 3UF8A 3PVLA 3WA0A 1T0YA 2HD5B 2JY6A 3JW0X 3AXCA 3PPAA 2CKHB 4A3OA 3N3KB 3WAPA 4IWPA 2IY1B 2LVPA 4DBGA 2GBRA 2EMSA 2NPTA 3R7QA 2KLGA 2MA9B 3ZDMC 4M8NA 3MTNB 3LDZE 4FJZA 1H4RA 5CX3A 3QIJA 2L8JA 2LZ6A 2N7EA 4G0NB 2M4NA 3APFA 3VH4B 4AJYB 4N9F4 2BPSA 1E8XA 2C5LC 1V81A 1I35A 1UELA 3A1QB 3PRZA 3AU5A 2OJRA 2KO3A 2WX1A 3AULA 3TJPA 1SE9A 1TTNA 2LWPA 2PEAA 5LLIA 3KUCB 1WJ6A 2L76A 1EUVB 2YLMA 2CR5A 4AUQC 3HK0A 2Y5BB 2HE7A 4HK2A 2NBVB 2LRWA 3ALBA 4I6PA 1Q0WB 3B1LX 3ONSA 3SDLC 3WALA 1YX5B 2KVRA 3CF6E 2ZNVC 1ZKHA 3KW5B 3QHTA 4K81A 1YJ1A 2KX3A 1UH6A 2L0FA 3VUXA 1S3SG 3KVFB 3RCZA 4OVVA 2I1JA 5J17A 4FJVB 5JHBA 1KOTA 2G3QB 3NS8A 1NBFC 1WM3A 4B95A 4DWFA 3EHVA 3PGEA 4K7UA 4EFOA 3SD5A 2RGFA 5AZGA 1V49A 3MHSD 1P9DU 2DX5B 2FCQA 4F8CB 5KHOA 1OGWA 3ZKJC 2J0JA 1WGHA 4LDTB 1WYWB 5DPSA 5EDSA 1WIAA 2RSUA 2J7QB 2JZZA 2N9XA 1J0GA 3DOWA 3ENEA 5L83A 4BBNF 2O2VA 3WIMA 1E90A 4MGIE 2A4ZA 3R7RA 2MBQA 4IUMB 5J18A 4PS7A 1IPGA 2ASQA 2FAZA 4I6LB 3DVNV 2L00B 4ICUA 1E8YA 4HWIB 3ZDTA 1A5RA 2IZVB 3A4RA 1M94A 2N9PC 2BYEA 4MSMB 3BY4B 2KMAA 1MG8A 3X0WA 4GOCA 4KZCA 2JF5A 4M0WB 4BOZB 2GMIC 4RM9A 3V6EB 1IYFA 3M3JA 4EZKA 2LRUA 3ZTCA 4J6IA 4GSWA 3QCAA 1WX7A 4EUTA 1C3TA 5FR6A 2K8BA 2JWZA 2XK5A 1WX8A 3VTWA 3ZO5B 1C1YB 2GBJA 1Q5WB 4AJWA 3APCA 3PZDA 3B08A 1UZXB 3W1SC 4MGZE 1WJUA 4A3PA 4DHZE 1OEYJ 5IA7A 4B9KA 4GMVA 1GC7A 4G3XB 2ZEQA 1F9JA 2QHOA 1WGRA 2IBIB 4KVGB 3IFWB 3EC8A 2XBBC 3RT3B 4KDLB 3V60A 2O6VD 4FADA 1YIWA 4NAWB 3QX1A 3U8ZA 3LJ3A 3UIPB 4WQOB 2C9WB 5G55A 3KYDD 2L05A 1EO6A 3UIOB 1L2NA 2BKRB 2CHWA 1K8RB 4ANXA 4ANUA 3PREA 4KV2A 4FHKA 4IWQA 1ZGUB 5D94A 2BWFA 3R3MA 3L16A 5C23A 3L08A 3A1QA 3BINA 5L95C 2GBKA 3H6NA 4DHJB 2Z0EB 4KIKB 1XD3B 3VHTC 1ZW7A 3A9JB 5G2NA 4WJOA 5KHQA 3HM3A 4X57B 4HVBA 1WR6E 1EF5A 1WM2A 3A9KB 4W9KA 2GBMA 3AI5A 4IC7B 5DPTA 1WE6A 4CHKA 3HIZA 4WJQA 2AWTA 2BGFA 2LGYA 4W9GA 3IBEA 2NBWB 5J2RA 3VFKA 4IG7B 4IM2A 3TCAA 2A5UA 2JPHA 2Z0DB 4BKSA 3QWZB 2M0XA 2KQ7A 2KXJA 2G4DB 3OLMD 4ANWA 1FXTB 4PS8A 3VTUA 3O65B 2J0MA 3UINB 5HKHA 2REXA 1NI2A 4PYZA 3RULA 2JVCA 4NJ7A 3VUYA 2WYQA 1WZ0A 3H9DA 3L0WB 4FN2A 4LJPB 4BBNC 4TUUA 2KWCA 2PE9A 3HM6X 4DK5A 4W9CA 2K8CA 3L54A 3P2BA 3ZTDA 3ZRFA 5CTRC 3PLUA 3NOBA 1I42A 4MM3A 1TGZB 2CU1A 2IO1B 4E74A 4NPNA 2MQJA 1XT9B 3RUIB 2N1VA 3QARA 3U7DA 4EKUA 1X1MA 2JRHA 4GU2A 2NR2A 2NCNA 1WMHB 5C1ZA 1UGMA 4TQ1A 2L0TA 1WXMA 3KUDB 3V61A 2KDEB 1YX6B 1S1QB 2MWSB 2ZNVB 3ZNZB 3ZNGC 4FA6A 5AZHA 2LGXA 2NVUI 3RZFA 3VAWA 2DYOA 4F1SA 1E8ZA 1NDDA 1Z5SB 3DBHI 5CHWA 2D11A 3DBSA 2V4LA 2JXXA 2D2QA 4W9HA 3TBLD 3PHXB 4PS3A 2KDIA 4WAAA 3RZWC 3VH3B 1WXVA 4KSLC 1OQYA 3A33B 3ML8A 1AARA 3VDZA 2FNJB 4GIVA 4KSKC 2FCMA 1E7UA 1YQBA 4IM0A 2PPHA 2DAJA 4MJSB 3EFUA 2FUHB 2FIDA 1WZ3A 4NAWA 4MH0E 4GDLB 3WANA 3L10B 4PYUA 2HJ8A 4NY0A 1WJ4A 2KFKB 4FBJB 5CHFA 3UQBA 3DVNU 4RM8A 4ZRKA 3VQIA 2BF8B 2LJ5A 1WF9A 3DVGY 3JSVB 2KN5A 4GB9A 4GN1A 2DYBA 3NZSA 2MX2A 1CMXB 2KLCA 4CYEA 2LVOA 1V80A 2RR9A 4W9FA 2D10A 1GNUA 3PSEB 4NQKE 1L7YA 3OAWA 2AEHA 3GOEA 2ZCBA 1KJTA 1WFYA 2N9EB 4KIKA 2AL6A 4JLCA 3A9JA 1U4AA 2KC1A 3UGBB 2MLBA 3EECA 4JQWC 1WGDA 2MRPA 2KOXA 1WH3A 4MDKE 3A9KA 3DBLI 3K9PB 3DCGA 2MCNB 4G50A 4ICVA 4ZYNA 5AEKB 3DBRI 2KHWB 4FJYA 5E6NA 2KKCA 3VVWB 2XEWA 3QC8B 2DAFA 4BKTA 1LXDA 2KJRA 2BYVE 2D07B 2J0KA 4JGHB 1G6JA 4XX5A 5DPWA 2VRRB 4NJ6A 1OTRB 4W9DA 4E3CA 2ZVOA 2CHXA 3ZLZA 2FIFA 1KM7A 2YVCA 3Q3JA 2M17A 2K39A 1Q1OA 3DPDA 4FHJA 4GDKB 4BVUC 2B3AA 2KWUB 4TKNA 3I3TB 2KDBA 4K1RB 1E8WA 4GXBA 4WWOA 3DVGX 4EOYA 4IM3A 3V6CB 2RPQA 2LD9A 4DDID 4ZDVA 2KNBA 4W9EA 2EKEC 5CHVC 1R4NI 2ZPNA 2N7DA 5JZEB 4FLHA 1E7VA 1OEYA 2GOWA 5D2MB 5TR5A 3S2AA 4XZ4A 4ASWC 3NY5A 1WMHA 2K6QA 4EZLA 3KH0A 4BKGA 3ML9A 2KJHB 4HXDA 4YL8A 4ZRJA 1WX9A 1P98A 3DDCB 2DZMA 3WAOA 3GZNI 4W9LA 3H1UA 2ZCCA 3JYUA 3PRMB 3PS6A 4F7ZA 4FULA 1RAXA 3T9LA 3ZVVA 4A20A 3Q3FA 4IWOA 4MELA 3APDA 5AZFA 2Z59B 3PLVA 2PJHA 3T8MA 3U30A 4BFRA 1RFAA 1V5OA 1WGGA 2K25A 4WJNA 5LXHA 3WAMA 2MP2B 3ZIMA 1V2YA 4W9JA 2N1WA 4I6NB 2ZJDA 3A4SC 3L17A 3AU4A 1UBQA 3RD2A 2DZIA 3QK0A 4W9IA 2JT4B 2MW5A 3IG3A 4HPLB 2V1YA 5IAAC 1VD2A 4MJSA 1EF1A 2CHZA 1WI0A 1JRUA 4K7SA 4GDLA 1LQBA 1WE7A 5E6OA 1GC6A 4ANVA 4NNJB 3H7SA 5JHAA 2LGDA 2KFKA 1YD8U 1WJNA 2KTRB 4HCPB 3TMPB 1PQSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2IO3 B;  2JUO A;  2FCN A;  2IO0 B;  4MEM A;  1VCB A;  3JSV A;  3PRP B;  2L7R A;  5DCN A;  1SIF A;  5D6J B;  3H7P B;  4TQ0 A;  2G4S A;  3RYT A;  1WY8 A;  2C7H A;  2R2Q A;  3CSF A;  3CMM B;  3ZW3 A;  4EZJ A;  2KMC A;  2IO2 B;  2KZR A;  4HDQ A;  4DXA B;  1RLF A;  5E6P A;  2N4F A;  2V3S A;  2MBO A;  2KK8 A;  2CS4 A;  1BT0 A;  1UD7 A;  2KJ6 A;  1TBE A;  4BOS C;  4DHZ B;  2L3Z A;  3ECI A;  3N30 A;  2NPT B;  2IYD B;  4EEW A;  4BKS D;  2DEN B;  1V5T A;  4HCN B;  3IHP C;  1V9J A;  2DYM A;  3OJ3 A;  3W1S A;  4K7W A;  2M1M A;  3ZNH B;  4RMA A;  3DQV A;  3NHE B;  4OVU A;  2AL3 A;  5D7G A;  4AOF A;  1P1A A;  1P3Q U;  2O6V A;  1QZE A;  4GGQ A;  4LDT D;  1Z2M A;  2FCS A;  4P7I A;  3N32 A;  1GG3 A;  1Y8R C;  3ZUN A;  4E71 A;  3UQA A;  1J8C A;  1R4M I;  2KC2 A;  2K1F A;  2D3G A;  2WDT B;  2ZZP B;  1WXA A;  2RD0 A;  3QQ8 B;  1GJZ A;  2G45 B;  4M8M A;  2DZK A;  3KUZ A;  4G11 A;  3MJW A;  3M95 A;  2MSE D;  3D32 A;  3SHQ A;  2KDF B;  5LXI B;  2DZJ A;  2K6D B;  1LM8 B;  4JIO U;  2EMT A;  3PTF C;  3TL5 A;  4AP4 C;  2W9N A;  4GDK A;  2KX0 A;  2LVQ A;  1E5W A;  2I1K A;  3L13 A;  2UYZ B;  3SU8 X;  3W1Y A;  3PV1 A;  2KFJ A;  4HLE A;  2C7N B;  2KWV B;  3VUW A;  1V6E A;  4XC2 A;  2AYO B;  3PHW B;  1WXS A;  2BKF A;  4KZ0 A;  2ZVN A;  5JH5 C;  3IVF A;  1XQQ A;  2NS5 A;  2MBE A;  3C0R B;  2R2O A;  2HTH A;  2LXA A;  2O6V B;  4TV3 A;  2IY0 B;  4DDG D;  4II2 B;  2WX0 A;  3R66 C;  1H8C A;  2KD0 A;  5DPR A;  2UWQ A;  1WRD B;  2BYF A;  1RRB A;  3M62 B;  4HDO A;  2C7M B;  1D3Z A;  4LJO B;  4MGK E;  3OJ4 B;  3K9O B;  4B6W A;  1KLV A;  2BWE S;  4LCD E;  2KQS A;  2JRI B;  2O2V B;  2MP2 A;  1WGY A;  1V86 A;  3CST A;  3NZU A;  2KTF A;  3B0A A;  2LXC A;  2MBH A;  4II3 B;  2LUE A;  4JL9 A;  4WWP A;  3X23 A;  1UBI A;  2LAS A;  3JVZ X;  3TIX A;  3PT2 B;  1TZ1 A;  2NBU A;  4IW0 A;  3ZRC A;  1J19 A;  4AWJ A;  2M8S A;  2OOB B;  3V62 A;  2WWZ A;  3VTV A;  2ZPY A;  3HHM A;  2PE6 B;  4WWN A;  4HJK A;  3KYC D;  4KDI C;  2C60 A;  5BO4 B;  4URK A;  1HE8 A;  1IP9 A;  2KTR A;  4NQL B;  2MBB B;  2K8H A;  3M63 B;  1SGH A;  4WJP A;  4ZRI A;  4DHJ D;  1GUA B;  1LFD A;  2LI5 A;  4HPM B;  2DHZ A;  4CO7 A;  1ISN A;  4MGY E;  2KAN A;  3ZNI D;  2XK5 B;  1WR1 A;  3QA8 A;  3H7P A;  4MSQ B;  1P0R A;  3QAQ A;  3QJZ A;  5GMV A;  3VXW A;  2GBN A;  2JZ3 B;  3UF8 A;  3PVL A;  3WA0 A;  1T0Y A;  2HD5 B;  2JY6 A;  3JW0 X;  3AXC A;  3PPA A;  2CKH B;  4A3O A;  3N3K B;  3WAP A;  4IWP A;  2IY1 B;  2LVP A;  4DBG A;  2GBR A;  2EMS A;  2NPT A;  3R7Q A;  2KLG A;  2MA9 B;  3ZDM C;  4M8N A;  3MTN B;  3LDZ E;  4FJZ A;  1H4R A;  5CX3 A;  3QIJ A;  2L8J A;  2LZ6 A;  2N7E A;  4G0N B;  2M4N A;  3APF A;  3VH4 B;  4AJY B;  4N9F 4;  2BPS A;  1E8X A;  2C5L C;  1V81 A;  1I35 A;  1UEL A;  3A1Q B;  3PRZ A;  3AU5 A;  2OJR A;  2KO3 A;  2WX1 A;  3AUL A;  3TJP A;  1SE9 A;  1TTN A;  2LWP A;  2PEA A;  5LLI A;  3KUC B;  1WJ6 A;  2L76 A;  1EUV B;  2YLM A;  2CR5 A;  4AUQ C;  3HK0 A;  2Y5B B;  2HE7 A;  4HK2 A;  2NBV B;  2LRW A;  3ALB A;  4I6P A;  1Q0W B;  3B1L X;  3ONS A;  3SDL C;  3WAL A;  1YX5 B;  2KVR A;  3CF6 E;  2ZNV C;  1ZKH A;  3KW5 B;  3QHT A;  4K81 A;  1YJ1 A;  2KX3 A;  1UH6 A;  2L0F A;  3VUX A;  1S3S G;  3KVF B;  3RCZ A;  4OVV A;  2I1J A;  5J17 A;  4FJV B;  5JHB A;  1KOT A;  2G3Q B;  3NS8 A;  1NBF C;  1WM3 A;  4B95 A;  4DWF A;  3EHV A;  3PGE A;  4K7U A;  4EFO A;  3SD5 A;  2RGF A;  5AZG A;  1V49 A;  3MHS D;  1P9D U;  2DX5 B;  2FCQ A;  4F8C B;  5KHO A;  1OGW A;  3ZKJ C;  2J0J A;  1WGH A;  4LDT B;  1WYW B;  5DPS A;  5EDS A;  1WIA A;  2RSU A;  2J7Q B;  2JZZ A;  2N9X A;  1J0G A;  3DOW A;  3ENE A;  5L83 A;  4BBN F;  2O2V A;  3WIM A;  1E90 A;  4MGI E;  2A4Z A;  3R7R A;  2MBQ A;  4IUM B;  5J18 A;  4PS7 A;  1IPG A;  2ASQ A;  2FAZ A;  4I6L B;  3DVN V;  2L00 B;  4ICU A;  1E8Y A;  4HWI B;  3ZDT A;  1A5R A;  2IZV B;  3A4R A;  1M94 A;  2N9P C;  2BYE A;  4MSM B;  3BY4 B;  2KMA A;  1MG8 A;  3X0W A;  4GOC A;  4KZC A;  2JF5 A;  4M0W B;  4BOZ B;  2GMI C;  4RM9 A;  3V6E B;  1IYF A;  3M3J A;  4EZK A;  2LRU A;  3ZTC A;  4J6I A;  4GSW A;  3QCA A;  1WX7 A;  4EUT A;  1C3T A;  5FR6 A;  2K8B A;  2JWZ A;  2XK5 A;  1WX8 A;  3VTW A;  3ZO5 B;  1C1Y B;  2GBJ A;  1Q5W B;  4AJW A;  3APC A;  3PZD A;  3B08 A;  1UZX B;  3W1S C;  4MGZ E;  1WJU A;  4A3P A;  4DHZ E;  1OEY J;  5IA7 A;  4B9K A;  4GMV A;  1GC7 A;  4G3X B;  2ZEQ A;  1F9J A;  2QHO A;  1WGR A;  2IBI B;  4KVG B;  3IFW B;  3EC8 A;  2XBB C;  3RT3 B;  4KDL B;  3V60 A;  2O6V D;  4FAD A;  1YIW A;  4NAW B;  3QX1 A;  3U8Z A;  3LJ3 A;  3UIP B;  4WQO B;  2C9W B;  5G55 A;  3KYD D;  2L05 A;  1EO6 A;  3UIO B;  1L2N A;  2BKR B;  2CHW A;  1K8R B;  4ANX A;  4ANU A;  3PRE A;  4KV2 A;  4FHK A;  4IWQ A;  1ZGU B;  5D94 A;  2BWF A;  3R3M A;  3L16 A;  5C23 A;  3L08 A;  3A1Q A;  3BIN A;  5L95 C;  2GBK A;  3H6N A;  4DHJ B;  2Z0E B;  4KIK B;  1XD3 B;  3VHT C;  1ZW7 A;  3A9J B;  5G2N A;  4WJO A;  5KHQ A;  3HM3 A;  4X57 B;  4HVB A;  1WR6 E;  1EF5 A;  1WM2 A;  3A9K B;  4W9K A;  2GBM A;  3AI5 A;  4IC7 B;  5DPT A;  1WE6 A;  4CHK A;  3HIZ A;  4WJQ A;  2AWT A;  2BGF A;  2LGY A;  4W9G A;  3IBE A;  2NBW B;  5J2R A;  3VFK A;  4IG7 B;  4IM2 A;  3TCA A;  2A5U A;  2JPH A;  2Z0D B;  4BKS A;  3QWZ B;  2M0X A;  2KQ7 A;  2KXJ A;  2G4D B;  3OLM D;  4ANW A;  1FXT B;  4PS8 A;  3VTU A;  3O65 B;  2J0M A;  3UIN B;  5HKH A;  2REX A;  1NI2 A;  4PYZ A;  3RUL A;  2JVC A;  4NJ7 A;  3VUY A;  2WYQ A;  1WZ0 A;  3H9D A;  3L0W B;  4FN2 A;  4LJP B;  4BBN C;  4TUU A;  2KWC A;  2PE9 A;  3HM6 X;  4DK5 A;  4W9C A;  2K8C A;  3L54 A;  3P2B A;  3ZTD A;  3ZRF A;  5CTR C;  3PLU A;  3NOB A;  1I42 A;  4MM3 A;  1TGZ B;  2CU1 A;  2IO1 B;  4E74 A;  4NPN A;  2MQJ A;  1XT9 B;  3RUI B;  2N1V A;  3QAR A;  3U7D A;  4EKU A;  1X1M A;  2JRH A;  4GU2 A;  2NR2 A;  2NCN A;  1WMH B;  5C1Z A;  1UGM A;  4TQ1 A;  2L0T A;  1WXM A;  3KUD B;  3V61 A;  2KDE B;  1YX6 B;  1S1Q B;  2MWS B;  2ZNV B;  3ZNZ B;  3ZNG C;  4FA6 A;  5AZH A;  2LGX A;  2NVU I;  3RZF A;  3VAW A;  2DYO A;  4F1S A;  1E8Z A;  1NDD A;  1Z5S B;  3DBH I;  5CHW A;  2D11 A;  3DBS A;  2V4L A;  2JXX A;  2D2Q A;  4W9H A;  3TBL D;  3PHX B;  4PS3 A;  2KDI A;  4WAA A;  3RZW C;  3VH3 B;  1WXV A;  4KSL C;  1OQY A;  3A33 B;  3ML8 A;  1AAR A;  3VDZ A;  2FNJ B;  4GIV A;  4KSK C;  2FCM A;  1E7U A;  1YQB A;  4IM0 A;  2PPH A;  2DAJ A;  4MJS B;  3EFU A;  2FUH B;  2FID A;  1WZ3 A;  4NAW A;  4MH0 E;  4GDL B;  3WAN A;  3L10 B;  4PYU A;  2HJ8 A;  4NY0 A;  1WJ4 A;  2KFK B;  4FBJ B;  5CHF A;  3UQB A;  3DVN U;  4RM8 A;  4ZRK A;  3VQI A;  2BF8 B;  2LJ5 A;  1WF9 A;  3DVG Y;  3JSV B;  2KN5 A;  4GB9 A;  4GN1 A;  2DYB A;  3NZS A;  2MX2 A;  1CMX B;  2KLC A;  4CYE A;  2LVO A;  1V80 A;  2RR9 A;  4W9F A;  2D10 A;  1GNU A;  3PSE B;  4NQK E;  1L7Y A;  3OAW A;  2AEH A;  3GOE A;  2ZCB A;  1KJT A;  1WFY A;  2N9E B;  4KIK A;  2AL6 A;  4JLC A;  3A9J A;  1U4A A;  2KC1 A;  3UGB B;  2MLB A;  3EEC A;  4JQW C;  1WGD A;  2MRP A;  2KOX A;  1WH3 A;  4MDK E;  3A9K A;  3DBL I;  3K9P B;  3DCG A;  2MCN B;  4G50 A;  4ICV A;  4ZYN A;  5AEK B;  3DBR I;  2KHW B;  4FJY A;  5E6N A;  2KKC A;  3VVW B;  2XEW A;  3QC8 B;  2DAF A;  4BKT A;  1LXD A;  2KJR A;  2BYV E;  2D07 B;  2J0K A;  4JGH B;  1G6J A;  4XX5 A;  5DPW A;  2VRR B;  4NJ6 A;  1OTR B;  4W9D A;  4E3C A;  2ZVO A;  2CHX A;  3ZLZ A;  2FIF A;  1KM7 A;  2YVC A;  3Q3J A;  2M17 A;  2K39 A;  1Q1O A;  3DPD A;  4FHJ A;  4GDK B;  4BVU C;  2B3A A;  2KWU B;  4TKN A;  3I3T B;  2KDB A;  4K1R B;  1E8W A;  4GXB A;  4WWO A;  3DVG X;  4EOY A;  4IM3 A;  3V6C B;  2RPQ A;  2LD9 A;  4DDI D;  4ZDV A;  2KNB A;  4W9E A;  2EKE C;  5CHV C;  1R4N I;  2ZPN A;  2N7D A;  5JZE B;  4FLH A;  1E7V A;  1OEY A;  2GOW A;  5D2M B;  5TR5 A;  3S2A A;  4XZ4 A;  4ASW C;  3NY5 A;  1WMH A;  2K6Q A;  4EZL A;  3KH0 A;  4BKG A;  3ML9 A;  2KJH B;  4HXD A;  4YL8 A;  4ZRJ A;  1WX9 A;  1P98 A;  3DDC B;  2DZM A;  3WAO A;  3GZN I;  4W9L A;  3H1U A;  2ZCC A;  3JYU A;  3PRM B;  3PS6 A;  4F7Z A;  4FUL A;  1RAX A;  3T9L A;  3ZVV A;  4A20 A;  3Q3F A;  4IWO A;  4MEL A;  3APD A;  5AZF A;  2Z59 B;  3PLV A;  2PJH A;  3T8M A;  3U30 A;  4BFR A;  1RFA A;  1V5O A;  1WGG A;  2K25 A;  4WJN A;  5LXH A;  3WAM A;  2MP2 B;  3ZIM A;  1V2Y A;  4W9J A;  2N1W A;  4I6N B;  2ZJD A;  3A4S C;  3L17 A;  3AU4 A;  1UBQ A;  3RD2 A;  2DZI A;  3QK0 A;  4W9I A;  2JT4 B;  2MW5 A;  3IG3 A;  4HPL B;  2V1Y A;  5IAA C;  1VD2 A;  4MJS A;  1EF1 A;  2CHZ A;  1WI0 A;  1JRU A;  4K7S A;  4GDL A;  1LQB A;  1WE7 A;  5E6O A;  1GC6 A;  4ANV A;  4NNJ B;  3H7S A;  5JHA A;  2LGD A;  2KFK A;  1YD8 U;  1WJN A;  2KTR B;  4HCP B;  3TMP B;  1PQS A; 
#chains in the Genus database with same CATH topology
 1MFW A;  1VDV A;  2W82 A;  5DCN A;  3IT6 B;  3RYT A;  2C7H A;  4EZJ A;  3HUI A;  3N1X C;  3ZJT A;  4HDQ A;  4DXA B;  5E6P A;  2N4F A;  4OHJ A;  1UD7 A;  2H89 B;  3N30 A;  4XYC A;  2JWU A;  4Q2J A;  1V9J A;  3W1S A;  3URY A;  1T0S C;  2MJE A;  5D7G A;  1FD6 A;  1J8C A;  1R4M I;  2K1F A;  1I7H A;  4P6V F;  3MJW A;  5AUI A;  3SHQ A;  1TIF A;  2KDF B;  1LM8 B;  2BS3 B;  3TL5 A;  2W9N A;  4GDK A;  2LVQ A;  1E5W A;  1FPY A;  4PT5 A;  1DOI A;  2V3N A;  3Q69 A;  2UYZ B;  3IAS 1;  3IAM 1;  1L5P A;  2ZVN A;  3IVF A;  4N58 A;  1ZDX A;  2O6V B;  1D5X C;  4TV3 A;  4DDG D;  2KD0 A;  2IJ0 A;  1I4X A;  1VLB A;  2BYF A;  1OQQ A;  1QOA A;  2C7M B;  4LJO B;  4MGK E;  3OJ4 B;  1WGY A;  3CST A;  2KTF A;  2MBH A;  4II3 B;  2LUE A;  1FCC C;  4AQ7 A;  3PT2 B;  1TZ1 A;  2NBU A;  3P4S B;  4C4V A;  1NEN B;  2M8S A;  2OOB B;  2WWZ A;  1TS2 A;  2ACZ B;  2QSD A;  5BMI A;  3KLS X;  1CK1 A;  1SGH A;  3ZXR A;  4P1B C;  2KAN A;  2XK5 B;  1WR1 A;  2KVZ A;  3H7P A;  3QA8 A;  2JZ3 B;  3PVL A;  2CKH B;  3VRB B;  1BXT A;  2XNA C;  3HRD D;  2IY1 B;  1SF0 A;  2EMS A;  2NPT A;  2KLG A;  2MA9 B;  3ZDM C;  3NRZ A;  3MTN B;  1OQR A;  2LGS A;  4C7Y A;  2L83 A;  1TYG B;  4AJY B;  4XGA B;  1IBX A;  1PGA A;  2QDF A;  2C5L C;  3SFD B;  1V81 A;  2CJO A;  3TJP A;  4RGO S;  2LWP A;  2PEA A;  3AE8 B;  1WJ6 A;  2CR5 A;  2NBV B;  3ALB A;  2ICI A;  2KWD A;  2KX3 A;  3LXF A;  1S3S G;  4HRS A;  3RCZ A;  4OVV A;  2HJ1 A;  4FJV B;  1WM3 A;  4EFO A;  2BQQ A;  4LDT B;  1K50 A;  5EDS A;  1WIA A;  4PK1 A;  2J7Q B;  5L83 A;  4BBN F;  2O2V A;  3LB8 C;  4R3D A;  2A4Z A;  4MM3 B;  3R7R A;  1P7E A;  2MBQ A;  2M0A A;  3W5V B;  1IPG A;  4B0E A;  1E8Y A;  4HWI B;  3ZDT A;  3AEA B;  3BY4 B;  4OZA A;  2GMI C;  4FXC A;  3M3J A;  4EZK A;  2LRU A;  3ZTC A;  4J6I A;  1WX7 A;  4EUT A;  5FR6 A;  4US8 A;  1LGR A;  4NAM A;  1Q5W B;  3C8Y A;  3APC A;  1SJH D;  3PZD A;  1UZX B;  4KKI A;  4AJW A;  4ZYS A;  2D3A A;  5IA7 A;  4GMV A;  1JML A;  3B2F A;  2K9X A;  1IGC A;  2XBB C;  4KDL B;  2O6V D;  3P63 A;  4GLS C;  4WQO B;  2C9W B;  3KYD D;  4A8X C;  3AEG B;  3NVY A;  1EO6 A;  1FFV A;  4YSZ B;  4IWQ A;  5D94 A;  3R3M A;  4L1B A;  2YEP F;  3L08 A;  3A1Q A;  3FC4 A;  1VJK A;  4KIK B;  2WXN A;  1XD3 B;  2Y5P A;  1ACC A;  3IXS A;  4M02 A;  4WJO A;  5G2N A;  3HM3 A;  3I9V 1;  1EF5 A;  1WM2 A;  4XDD A;  2CU3 A;  3AI5 A;  4IC7 B;  4L23 A;  1WE6 A;  4KGS A;  1AN8 A;  3NS1 A;  4WJQ A;  1FNU A;  2LGY A;  4W9G A;  1M4V A;  3AEC B;  3VFK A;  2Z0D B;  4ARI A;  3UI3 A;  2M0X A;  1KLU D;  4PS8 A;  2J0M A;  1F0Z A;  3UIN B;  2QIE B;  1NI2 A;  4NJ7 A;  1WZ0 A;  3L0W B;  4FN2 A;  1E7P B;  4BZA A;  2PE9 A;  5D3I B;  1QT9 A;  2WXP A;  5IKC M;  4DK5 A;  1FEH A;  4W9C A;  1I42 A;  4E74 A;  1XO3 A;  2MQJ A;  1XT9 B;  3RUI B;  2N1V A;  4WUR A;  3AE3 B;  3BYT B;  1WMH B;  2WXK A;  1YX6 B;  3ZNG C;  4FA6 A;  4TMA B;  3RZF A;  3VAW A;  1HEZ E;  1ZPS A;  4MH8 A;  3DBH I;  4RF1 A;  4USA A;  3VR8 B;  2KAJ A;  1WXV A;  2JYT A;  1ZDV A;  1UNS A;  2FNJ B;  1C4C A;  2FCM A;  2FUG 1;  3RFZ B;  1EWC A;  4NAW A;  1ET9 A;  3WAN A;  4PYU A;  2HJ8 A;  3I5J C;  3O13 A;  2M56 B;  3UQB A;  2LJ5 A;  2WLB A;  2MX2 A;  1CMX B;  1L4Z B;  1V80 A;  2LVO A;  4W9F A;  3PSE B;  1L7Y A;  3ZGZ A;  1NYR A;  2N9E B;  2D5G A;  2G9H D;  2AL6 A;  4JLC A;  1YN3 A;  1PUT A;  5EE0 A;  4JQW C;  1WH3 A;  1NI3 A;  4G50 A;  2XN9 C;  4XWT A;  3DBR B;  1RWS A;  1I4Q A;  2AQ2 B;  5E6N A;  3QC8 B;  3B9J A;  1YN5 A;  3R2T A;  4NJ6 A;  1JAL A;  3ZLZ A;  2BYT A;  1KM7 A;  2YVC A;  2M17 A;  1WGK A;  1T0R C;  3RNA C;  4FHJ A;  2CJN A;  4BVU C;  2KWU B;  2KDB A;  1E8W A;  2AQ3 B;  4DDI D;  4ZDV A;  4P16 A;  5JZE B;  4WH4 A;  3S2A A;  4REZ A;  3U4E G;  4EZL A;  3KH0 A;  4ZRJ A;  2KJH B;  4YL8 A;  3DDC B;  1HZ5 A;  3AE2 B;  3DHH C;  1L0X B;  3H1U A;  3PRM B;  3ZVV A;  4A20 A;  1FIQ A;  4MEL A;  3P1M A;  4A9A A;  3PLV A;  3AEF B;  1WGG A;  5IN7 A;  2N1W A;  2ZJD A;  3IT4 B;  3AU4 A;  3MJ5 A;  3RD2 A;  4W9I A;  2JT4 B;  2MW5 A;  4MJS A;  2G1E A;  1WI0 A;  1LQB A;  3P4R B;  1WE7 A;  1GC6 A;  4NNJ B;  2KFK A;  1YD8 U;  1WJN A;  2KTR B;  1N61 A;  3NUH B;  3TMP B;  1JCK B;  1PQS A;  1RLF A;  2IO3 B;  2FCN A;  2TSS A;  3JSV A;  3BK2 A;  5D6J B;  2I2Y A;  4KKJ A;  1WY8 A;  3CSF A;  1TS3 A;  2KZR A;  3W2D A;  2V3S A;  2MBO A;  2CS4 A;  4HJG E;  1BT0 A;  1HQR D;  2ZW1 A;  4KGT A;  2IGG A;  4DHZ B;  2WXF A;  3ECI A;  3MC8 A;  4C80 A;  1JWA D;  1V5T A;  4HCN B;  2SAK A;  4K7W A;  3ZNH B;  3N9Y C;  2GLS A;  3DQV A;  4OVU A;  2AL3 A;  2O6V A;  1NEK B;  4P7I A;  3MP9 A;  2DLB A;  2WDT B;  2ZZP B;  1Q10 A;  1LO5 D;  1WXA A;  2RD0 A;  2J52 A;  3J9C A;  3EFC A;  2WXL A;  2K6D B;  4JIO U;  2EMT A;  3PTF C;  2KX0 A;  5HHD G;  2I1K A;  3L13 A;  3PV1 A;  4J3O D;  4RGM A;  4QAY A;  2KFJ A;  4HLE A;  2C7N B;  3VUW A;  2BTE A;  2W54 A;  1WXS A;  2BKF A;  3CIR B;  5JH5 C;  2NS5 A;  3FKY A;  2KN4 A;  2QMT A;  2IY0 B;  2WXJ A;  4II2 B;  3WCQ A;  1H8C A;  2WXH A;  3FIL B;  1CJE A;  2UWQ A;  1WRD B;  3M62 B;  4LCD E;  1JWM D;  2BS2 B;  4ARC A;  1V86 A;  1FM0 D;  5GXG B;  2NMQ A;  3B0A A;  2LXC A;  2MJ3 A;  1DOX A;  3JVZ X;  3TIX A;  4AWJ A;  3V62 A;  1WYG A;  4WWN A;  2C60 A;  1IP9 A;  1PFD A;  3FAH A;  2MBB B;  4DHJ D;  1GUA B;  4HPM B;  1L0V B;  1ISN A;  4MSQ B;  3BYY B;  2QJL A;  3QJZ A;  3VXW A;  2GBN A;  2GRI A;  2JY6 A;  3JW0 X;  4L2Y A;  3AXC A;  4YXD B;  3N3K B;  4IWP A;  4DBG A;  3R7Q A;  1FXA A;  4M8N A;  1JW9 D;  1H4R A;  2LZ6 A;  1YQ3 B;  2N7E A;  1XLO A;  3APF A;  3Q3N C;  4OZB A;  4RF0 A;  1I35 A;  2RDH A;  3PRZ A;  3AU5 A;  2OJR A;  2KO3 A;  2WX1 A;  5BMH A;  1TTN A;  2OJW A;  2WXI A;  3SFE B;  2L76 A;  4HK2 A;  2LRW A;  1GAQ B;  4I6P A;  3Q6B A;  1Q0W B;  3ONS A;  3SDL C;  1HZ6 A;  1C4P A;  2KVR A;  1ROE A;  3KW5 B;  4K81 A;  1UH6 A;  4IOI E;  1KOT A;  2WDQ B;  4DWF A;  3EHV A;  3PGE A;  2DX5 B;  2N9K A;  5KHO A;  4KGR A;  5DPS A;  3TEZ A;  3DOW A;  4A55 A;  1E90 A;  4MGI E;  1CQV A;  1SBB B;  2HDE A;  2ASQ A;  4I6L B;  3MHZ A;  4JWS C;  2IZV B;  3Q8C A;  2N9P C;  3TEX A;  2BYE A;  4MSM B;  2Q5W D;  2KMA A;  1MG8 A;  4GOC A;  4KZC A;  4M0W B;  1QOF A;  5C2T B;  5EE3 A;  1UF0 A;  1T0Q C;  2K8B A;  1WX8 A;  1C1Y B;  1UWM A;  3B08 A;  3W1S C;  4DHZ E;  1SSN A;  4B9K A;  1GC7 A;  1DOY A;  1F9J A;  2QHO A;  1JWU D;  1YJI A;  1XLQ A;  3V60 A;  1TY0 A;  3U8Z A;  3DWG C;  3LJ3 A;  2LHE A;  2N0S B;  3UIO B;  1L2N A;  3PRE A;  4KV2 A;  3GS2 A;  3VR9 B;  1MHH E;  3CWI A;  3AV8 A;  1QOG A;  1EWY C;  2Z0E B;  1J7B A;  3PZ8 A;  3MFG A;  3P4P B;  4X57 B;  1WR6 E;  4W9K A;  1R4N B;  1NYQ A;  1VR9 A;  3H8H A;  5DPT A;  4CHK A;  1I4P A;  1PGB A;  2V4I B;  1D6E C;  2NBW B;  4IG7 B;  3QWZ B;  4ANW A;  2KXJ A;  2G4D B;  1L0Y B;  1YQ4 B;  1TS5 A;  4YT0 B;  2LEK A;  3RUL A;  1FFU A;  3VUY A;  1TKE A;  1Y56 A;  4S0R A;  4BBN C;  3AM9 A;  4B0M A;  5EE1 A;  3ZTD A;  3BK1 A;  4S17 A;  4AS1 A;  1TGZ B;  3SEB A;  4RNA A;  2NTT A;  1XCQ L;  1C78 A;  2NR2 A;  2NCN A;  5C1Z A;  4OW0 A;  5EE9 A;  3KUD B;  2KDE B;  3AED B;  2JSV X;  1HTO A;  3ZNZ B;  3RPF C;  2B76 B;  3MC0 B;  1WWT A;  2DYO A;  4F1S A;  4A90 A;  1NDD A;  2BB5 A;  2PMV A;  3DBH B;  2JXX A;  3OG5 A;  3TBL D;  4PS3 A;  3N1Y C;  4WAA A;  1KRH A;  2V0G A;  1OQY A;  3ML8 A;  1TY2 A;  1E7U A;  1L6U A;  3W9C B;  1WZ3 A;  2FID A;  4MH0 E;  4GDL B;  1VZ6 A;  5CHF A;  3DVN U;  3AE7 B;  4RM8 A;  1TKG A;  2J53 A;  2RR9 A;  3C19 A;  1ZE3 D;  1GNU A;  1KLG D;  3GOE A;  1KJT A;  5AUK A;  1WFY A;  3A9J A;  3UGB B;  2W3S A;  1WGD A;  2MHJ A;  2MRP A;  3BII D;  4MDK E;  3A9K A;  3K9P B;  1WSP A;  5IOI A;  2MCN B;  1XEE A;  2KHW B;  4RH6 A;  2DAF A;  3NZ3 A;  1ZOY B;  2D07 B;  3NVV A;  1B1Z A;  3DHG C;  2ZVO A;  2FIF A;  3Q3J A;  1WRI A;  2INN E;  1FNW A;  3GP7 A;  2PW9 A;  3DPD A;  2M19 A;  4GDK B;  4TKN A;  4K1R B;  3L4P A;  4EOY A;  2LD9 A;  5CHV C;  1R4N I;  2VZK B;  5H92 C;  5TSS A;  2ZPN A;  2N7D A;  4FLH A;  2GOW A;  1OEY A;  5D2M B;  5TR5 A;  5C3J B;  3NY5 A;  2LJI A;  4RGT A;  1E9M A;  4HXD A;  3ML9 A;  1N6Z A;  2DZM A;  3RNF C;  2K5P A;  1N60 A;  3EA6 A;  3PS6 A;  3T9L A;  1TT5 B;  4IWO A;  1N62 A;  2Z59 B;  2PJH A;  3U30 A;  4BFR A;  1FO4 A;  2K25 A;  4WJN A;  4NJC A;  1YMH E;  3WAM A;  1ENF A;  2RDB C;  4I6N B;  3BVG A;  2DZI A;  3IG3 A;  5IAA C;  2FE8 A;  4C4V B;  4LNF A;  1EF1 A;  1JRU A;  5E6O A;  5JHA A;  1JRO A;  3R8B A;  3TUO A;  2WDV B;  1HTQ A;  2RDG A;  4A6Q A;  2JUO A;  2IO0 B;  4MEM A;  1VCB A;  2SEB D;  3PRP B;  2KT7 A;  1SIF A;  1KFY B;  3H7P B;  1P7F A;  4TQ0 A;  2G4S A;  2R2Q A;  1K52 A;  3CMM B;  2KMC A;  2IO2 B;  1FMA D;  1JQ4 A;  2KK8 A;  2BVC A;  2KJ6 A;  2L3Z A;  3HVZ A;  1ZUD 2;  2NPT B;  2IYD B;  4EEW A;  4BKS D;  2DEN B;  3NVZ A;  3IHP C;  2INP E;  3OJ3 A;  4OVZ A;  4RFB A;  2HTM E;  4HKQ A;  2RPV A;  4AOF A;  4YWG G;  5E6J A;  2L1A A;  1C76 A;  4LDT D;  2FCS A;  4E71 A;  1IBX B;  3N32 A;  3ZUN A;  3FIL A;  3QQ8 B;  1GJZ A;  4LK0 M;  4M8M A;  2DZK A;  3SR6 A;  3M95 A;  1ESF A;  3D32 A;  5LXI B;  4CQN A;  4AP4 C;  1NVI D;  5JXV A;  3SU8 X;  1J7C A;  2KWV B;  2WS3 B;  3Q2A C;  1V6E A;  2AYO B;  3PHW B;  3P42 A;  4KZ0 A;  2WXO A;  2MBE A;  2EKI A;  2K22 A;  2R2O A;  4MAC A;  2LXA A;  2WX0 A;  3BVZ A;  3AMZ A;  4YSY B;  5MPO A;  2N9L A;  4HDO A;  2VH1 A;  4K3B A;  3K9O B;  4B6W A;  4YSX B;  2KQS A;  2O2V B;  4LNO A;  2MP2 A;  3NZU A;  1BML C;  3X23 A;  1UBI A;  1WXQ A;  1MI0 A;  4IW0 A;  3ZRC A;  3B2G A;  1J19 A;  3VTV A;  2ZPY A;  1ZXI A;  4ZRP A;  1GOZ A;  2X38 A;  1IUE A;  1XF5 L;  3AEE B;  1OFF A;  3KYC D;  4HJK A;  5BO4 B;  4URK A;  1HE8 A;  4HKZ E;  3M63 B;  2K8H A;  2N7J A;  4WJP A;  1HXY D;  2JU6 X;  1SB3 C;  4MGY E;  5G5G A;  3ZNI D;  3QAQ A;  5GMV A;  2HD5 B;  4A3O A;  3WAP A;  5IP4 D;  2PTL A;  2GBR A;  1UWX A;  1QLB B;  3AE4 B;  4G0N B;  1STE A;  2WXM A;  4UDU C;  3VH4 B;  4N9F 4;  2BPS A;  1TS4 A;  1GB1 A;  1E8X A;  1UEL A;  3A1Q B;  2MH7 A;  1SXT A;  5LLI A;  3KUC B;  2QEJ C;  2YLM A;  3HK0 A;  2Y5B B;  1GB4 A;  4DQO C;  5T8I A;  1I4H A;  4N59 A;  3B1L X;  3BVM A;  3BZD B;  1YX5 B;  2ZNV C;  1ZKH A;  1D5M C;  3VUX A;  2I1J A;  5J17 A;  5JHB A;  1L6V A;  4B95 A;  5AZG A;  3MHS D;  1P9D U;  4F8C B;  1OGW A;  1WGH A;  2RSU A;  3WIM A;  5D3D A;  1MPE A;  4IUM B;  5J18 A;  1V97 A;  2FAZ A;  3DVN V;  4ICU A;  1A5R A;  3KQ4 A;  1B9R A;  2KAC A;  2IND C;  3X0W A;  2JF5 A;  1VRA B;  2IGD A;  2XK5 A;  3ZO5 B;  4US9 A;  2GBJ A;  1OEY J;  1WGR A;  1KF6 B;  4KVG B;  3OWE B;  3RT3 B;  4N6E B;  4FAD A;  4NAW B;  3QX1 A;  1C4A A;  2L05 A;  1K8R B;  4ANX A;  4ANU A;  2BBC A;  3ABV B;  2ON8 A;  2GB1 A;  3RNB C;  4FHK A;  2BWF A;  5C23 A;  5L95 C;  2GBK A;  3H6N A;  4OZC A;  1C9F A;  2LMC A;  2GBM A;  2K3U A;  1V1P B;  3E56 A;  1E0Z A;  3HIZ A;  2JYE A;  2AWT A;  2BGF A;  5J2R A;  3TCA A;  2A5U A;  2JPH A;  4BKS A;  2X8X X;  5HKH A;  2PVO D;  2REX A;  1K51 A;  4PYZ A;  4ZOH C;  2WYQ A;  3H9D A;  4LJP B;  3BWU D;  2DBY A;  4TUU A;  1ET6 A;  3EUB 2;  3HM6 X;  2K8C A;  4WWM A;  3NOB A;  4MM3 A;  1MHX A;  2WU5 B;  3QAR A;  4C7Z A;  2JRH A;  3Q8E A;  4MT5 A;  4GU2 A;  4JE3 B;  2BB6 A;  4TQ1 A;  2L0T A;  1WXM A;  3NVW A;  4O1N A;  3R2I A;  1DYQ A;  3V61 A;  5H8Y E;  2MWS B;  2ZNV B;  3AB5 A;  1RFK A;  3RNG C;  5AZH A;  2LGX A;  1QKZ A;  4KX6 B;  2NVU I;  1E8Z A;  1Z5S B;  5CHW A;  3DBS A;  1I4G A;  4TSS A;  1MVK A;  3PHX B;  4P1C C;  2LGI A;  4LNN A;  2H88 B;  4HPP A;  4GIV A;  4KSK C;  2WNM A;  3GB1 A;  4IM0 A;  2PPH A;  4MJS B;  3EFU A;  2FUH B;  1RM6 C;  4YTP B;  3L10 B;  2EEL A;  4NY0 A;  1WJ4 A;  2KFK B;  2PVG C;  3GE3 C;  4FBJ B;  3LYY A;  3VQI A;  2BF8 B;  3JSV B;  3DVG Y;  4GB9 A;  4GN1 A;  4C00 A;  4CYE A;  3RNC C;  3ZYY X;  2BW2 A;  4NQK E;  2KMM A;  3OAW A;  2AEH A;  2ZCB A;  4KIK A;  2KC1 A;  2MLB A;  3EEC A;  1KTK A;  1MG4 A;  1XLP A;  1DGJ A;  1IGD A;  3DCG A;  4ZYN A;  5AEK B;  2JX5 A;  2KKC A;  2XEW A;  1F77 A;  4ACF A;  1LXD A;  3E9S A;  2KJR A;  1TKY A;  1FRD A;  1EM7 A;  2FBW B;  1G6J A;  5DPW A;  3RNE C;  3Q3M C;  1V1O A;  2K39 A;  1Q1O A;  1UUP A;  5BMG A;  2Y3A A;  2B3A A;  3I3T B;  3DVG X;  4IM3 A;  3V6C B;  2RPQ A;  1I4R A;  2KNB A;  4W9E A;  3MC9 A;  2BS4 B;  1SE2 A;  1GPX A;  2W3R A;  1WMH A;  2K6Q A;  4BKG A;  2WXG A;  3Q3O C;  3GZN I;  4W9L A;  2IGH A;  3JYU A;  4F7Z A;  4FUL A;  1RAX A;  1ZP0 B;  2WP9 B;  5AZF A;  3KWL A;  3T8M A;  1RFA A;  1V5O A;  2OED A;  5LXH A;  2I38 A;  3V3X A;  1V2Y A;  3GE8 C;  4W9J A;  3A4S C;  4H2A A;  2IPK D;  3L17 A;  1UBQ A;  2D3B A;  1N63 A;  4HPL B;  1R7S A;  4ZHO A;  2V1Y A;  2CHZ A;  5BYR A;  4K7S A;  1L4D B;  3H7S A;  5HG2 A;  4HCP B;  1EU3 A;  1F52 A;  1YNT E;  2L7R A;  1E6E B;  3ZW3 A;  1QIL A;  3P4Q B;  2QIL A;  1TBE A;  4BOS C;  3Q8A A;  4WAF A;  1A70 A;  2KDM A;  2DYM A;  2WHI A;  4WQM A;  1QF6 A;  2M1M A;  1C77 A;  4RMA A;  3NHE B;  1P1A A;  1P3Q U;  1QZE A;  4GGQ A;  1Z2M A;  1GG3 A;  1Y8R C;  3UQA A;  2KC2 A;  2D3G A;  3AE5 B;  1FCL A;  2LUM A;  3U2S C;  2G45 B;  2JZP A;  3KUZ A;  4G11 A;  4NZL B;  4EE2 A;  2MSE D;  5FR3 A;  5HFY A;  2WGS A;  2DZJ A;  1SE4 A;  2AQ1 B;  3W1Y A;  2Y5C A;  4XE0 A;  5HI1 A;  4ZRQ A;  3N1Z C;  1PGX A;  4RCO A;  4XC2 A;  1XQQ A;  1K53 A;  3ZQ4 A;  2KQ4 X;  3C0R B;  3Q8F A;  1C79 A;  2HTH A;  2MJD A;  2PLP A;  3ZXV A;  2VH2 A;  3R66 C;  2UU7 A;  5DPR A;  5BYS A;  3DHI C;  2V3P A;  1RRB A;  1VZ7 A;  2WQY B;  2DNF A;  2D3C A;  1D3Z A;  1T5X D;  1KLV A;  1TJE A;  2BWE S;  2JRI B;  1SEB D;  4HEA 1;  4JL9 A;  4WWP A;  3V05 A;  2LAS A;  3RN9 C;  3AEB B;  1F1H A;  3HHM A;  2PE6 B;  1QQR A;  1KH0 A;  4KDI C;  1MJD A;  2KTR A;  4NQL B;  3KWV A;  4YTM B;  1JWS D;  4ZRI A;  1XCT L;  1LFD A;  2LI5 A;  2DHZ A;  4CO7 A;  3U52 E;  1CZP A;  1P0R A;  2NTS A;  3UF8 A;  3WA0 A;  1T0Y A;  3PPA A;  2RMM A;  1F2R C;  2J42 A;  2LVP A;  3LDZ E;  4ITK A;  4FJZ A;  5FKA C;  1JRP A;  5CX3 A;  3QIJ A;  2L8J A;  2M4N A;  4IKG A;  2IDY A;  2JQR B;  1HA5 A;  2WU2 B;  1QOB A;  2K0P A;  3AUL A;  1SE9 A;  1EUV B;  4AUQ C;  2HE7 A;  4RGN A;  2L52 A;  3AH7 A;  2DWQ A;  1PYW D;  3WAL A;  3CF6 E;  3QHT A;  1YJ1 A;  2L0F A;  3KVF B;  2G3Q B;  3NS8 A;  1NBF C;  4K7U A;  3SD5 A;  2RGF A;  2V9H A;  1V49 A;  2FCQ A;  3ZKJ C;  2J0J A;  1WYW B;  2LHD A;  3T3O A;  2N9X A;  2JZZ A;  1J0G A;  5LNK 1;  1YOV B;  3ENE A;  2YEP B;  5G5H A;  2R61 A;  4PS7 A;  1N5W A;  2L00 B;  4HRO A;  3A4R A;  1M94 A;  4IDI A;  2WDR B;  5BYQ A;  2JXT A;  4LTU A;  4BOZ B;  4RM9 A;  1IYF A;  3V6E B;  3W5U B;  4GSW A;  3QCA A;  4LNK A;  1C3T A;  3TEY A;  2JWZ A;  4BAX A;  3VTW A;  5IO9 A;  4MGZ E;  1VZ8 A;  1WJU A;  4A3P A;  4G3X B;  2ZEQ A;  3DBL B;  1V1P A;  2IBI B;  3Q14 C;  3IFW B;  3EC8 A;  1YIW A;  3UIP B;  1AWD A;  5G55 A;  4LLG M;  1RYJ A;  2BKR B;  2ZW0 A;  2CHW A;  1AW7 A;  2KYW A;  3RMK C;  1ZGU B;  3L16 A;  1XLN A;  2WXQ A;  3BIN A;  2PKO A;  4DHJ B;  3AN1 A;  3VHT C;  1ZW7 A;  3A9J B;  5KHQ A;  4HVB A;  2VZK D;  1D5Z C;  3A9K B;  2OHF A;  2WXR A;  5I4D A;  3IBE A;  2QCZ A;  4IM2 A;  3T3N A;  1UGJ A;  2KQ7 A;  3OLM D;  1FXT B;  3VTU A;  3O65 B;  3NG0 A;  1XXG A;  4JX1 C;  3I57 A;  2JVC A;  5FK9 C;  2KWC A;  2INC C;  1V8C A;  3U7Z A;  2Z8L A;  3L54 A;  3P2B A;  3ZRF A;  2MEK A;  5CTR C;  3PLU A;  2CU1 A;  2IO1 B;  4NPN A;  3RI7 C;  3N20 C;  1E10 A;  3U7D A;  4EKU A;  1X1M A;  1YN4 A;  4ZHP A;  3ETR A;  1UGM A;  1S1Q B;  1JWB D;  2E6X A;  4M0W A;  2W55 A;  4WIP A;  4D2K A;  1EU4 A;  2D11 A;  2V4L A;  2D2Q A;  4W9H A;  3VH3 B;  2KDI A;  3RZW C;  3TEW A;  4KSL C;  1FRR A;  3A33 B;  1AAR A;  3VDZ A;  1YQB A;  2DAJ A;  1D4B A;  3VRA B;  2E3T A;  2GI9 A;  4C56 C;  3ZJU A;  4DXG A;  3AE6 B;  1R4M B;  4ZRK A;  1WF9 A;  4JWU C;  2KN5 A;  2DYB A;  3NZS A;  2KLC A;  1T3Q A;  2D10 A;  1SJE D;  3PZ7 A;  3ZJV A;  1J7A A;  1U4A A;  3AE1 B;  2LFI A;  2KOX A;  3DBL I;  4ICV A;  3DBR I;  3DWM A;  2PIA A;  4XDC A;  4FJY A;  1BUI C;  3VVW B;  4BKT A;  2BYV E;  2J0K A;  4JGH B;  4XX5 A;  2VRR B;  2QC8 A;  1OTR B;  1T6B X;  3NJT A;  4W9D A;  4E3C A;  2CHX A;  2J4X A;  4M00 A;  3PO0 A;  3HVD A;  1PDX A;  4M01 A;  4GXB A;  4WWO A;  1SE3 A;  1FXI A;  2ONQ A;  1TZO A;  2EKE C;  1E7V A;  4XZ4 A;  3AE9 B;  4ASW C;  1FNV A;  1WX9 A;  1F2R I;  1P98 A;  3WAO A;  3GZN B;  2ZCC A;  4DXF A;  3Q3F A;  2AX5 A;  3APD A;  3TSS A;  1YJJ A;  3Q8B A;  2MP2 B;  3ZIM A;  4K3C A;  1AYF A;  4LNI A;  1SIJ A;  3EGR A;  3QK0 A;  2BT6 A;  1VD2 A;  3I63 C;  4XWW A;  4GDL A;  4ANV A;  2LGD A;  2L32 A;  4YTN B;  1N5X A;  1ZXH A;  4JPS A; 
#chains in the Genus database with same CATH homology
 2IO3 B;  2JUO A;  2FCN A;  2IO0 B;  4MEM A;  1VCB A;  3JSV A;  3PRP B;  2L7R A;  5DCN A;  1SIF A;  5D6J B;  3H7P B;  4TQ0 A;  2G4S A;  3RYT A;  1WY8 A;  2C7H A;  2R2Q A;  3CSF A;  3CMM B;  3ZW3 A;  4EZJ A;  2KMC A;  2IO2 B;  2KZR A;  4HDQ A;  4DXA B;  1RLF A;  5E6P A;  2N4F A;  2V3S A;  2MBO A;  2KK8 A;  2CS4 A;  1BT0 A;  1UD7 A;  2KJ6 A;  1TBE A;  4BOS C;  4DHZ B;  2L3Z A;  3ECI A;  3N30 A;  2NPT B;  2IYD B;  4EEW A;  4BKS D;  2DEN B;  1V5T A;  4HCN B;  3IHP C;  1V9J A;  2DYM A;  3OJ3 A;  3W1S A;  4K7W A;  2M1M A;  3ZNH B;  4RMA A;  3DQV A;  3NHE B;  4OVU A;  2AL3 A;  5D7G A;  4AOF A;  1P1A A;  1P3Q U;  2O6V A;  1QZE A;  4GGQ A;  4LDT D;  1Z2M A;  2FCS A;  4P7I A;  3N32 A;  1GG3 A;  1Y8R C;  3ZUN A;  4E71 A;  3UQA A;  1J8C A;  1R4M I;  2KC2 A;  2K1F A;  2D3G A;  2WDT B;  2ZZP B;  1WXA A;  2RD0 A;  3QQ8 B;  1GJZ A;  2G45 B;  4M8M A;  2DZK A;  3KUZ A;  4G11 A;  3MJW A;  3M95 A;  2MSE D;  3D32 A;  3SHQ A;  2KDF B;  5LXI B;  2DZJ A;  2K6D B;  1LM8 B;  4JIO U;  2EMT A;  3PTF C;  3TL5 A;  4AP4 C;  2W9N A;  4GDK A;  2KX0 A;  2LVQ A;  1E5W A;  2I1K A;  3L13 A;  2UYZ B;  3SU8 X;  3W1Y A;  3PV1 A;  2KFJ A;  4HLE A;  2C7N B;  2KWV B;  3VUW A;  1V6E A;  4XC2 A;  2AYO B;  3PHW B;  1WXS A;  2BKF A;  4KZ0 A;  2ZVN A;  5JH5 C;  3IVF A;  1XQQ A;  2NS5 A;  2MBE A;  3C0R B;  2R2O A;  2HTH A;  2LXA A;  2O6V B;  4TV3 A;  2IY0 B;  4DDG D;  4II2 B;  2WX0 A;  3R66 C;  1H8C A;  2KD0 A;  5DPR A;  2UWQ A;  1WRD B;  2BYF A;  1RRB A;  3M62 B;  4HDO A;  2C7M B;  1D3Z A;  4LJO B;  4MGK E;  3OJ4 B;  3K9O B;  4B6W A;  1KLV A;  2BWE S;  4LCD E;  2KQS A;  2JRI B;  2O2V B;  2MP2 A;  1WGY A;  1V86 A;  3CST A;  3NZU A;  2KTF A;  3B0A A;  2LXC A;  2MBH A;  4II3 B;  2LUE A;  4JL9 A;  4WWP A;  3X23 A;  1UBI A;  2LAS A;  3JVZ X;  3TIX A;  3PT2 B;  1TZ1 A;  2NBU A;  4IW0 A;  3ZRC A;  1J19 A;  4AWJ A;  2M8S A;  2OOB B;  3V62 A;  2WWZ A;  3VTV A;  2ZPY A;  3HHM A;  2PE6 B;  4WWN A;  4HJK A;  3KYC D;  4KDI C;  2C60 A;  5BO4 B;  4URK A;  1HE8 A;  1IP9 A;  2KTR A;  4NQL B;  2MBB B;  2K8H A;  3M63 B;  1SGH A;  4WJP A;  4ZRI A;  4DHJ D;  1GUA B;  1LFD A;  2LI5 A;  4HPM B;  2DHZ A;  4CO7 A;  1ISN A;  4MGY E;  2KAN A;  3ZNI D;  2XK5 B;  1WR1 A;  3QA8 A;  3H7P A;  4MSQ B;  1P0R A;  3QAQ A;  3QJZ A;  5GMV A;  3VXW A;  2GBN A;  2JZ3 B;  3UF8 A;  3PVL A;  3WA0 A;  1T0Y A;  2HD5 B;  2JY6 A;  3JW0 X;  3AXC A;  3PPA A;  2CKH B;  4A3O A;  3N3K B;  3WAP A;  4IWP A;  2IY1 B;  2LVP A;  4DBG A;  2GBR A;  2EMS A;  2NPT A;  3R7Q A;  2KLG A;  2MA9 B;  3ZDM C;  4M8N A;  3MTN B;  3LDZ E;  4FJZ A;  1H4R A;  5CX3 A;  3QIJ A;  2L8J A;  2LZ6 A;  2N7E A;  4G0N B;  2M4N A;  3APF A;  3VH4 B;  4AJY B;  4N9F 4;  2BPS A;  1E8X A;  2C5L C;  1V81 A;  1I35 A;  1UEL A;  3A1Q B;  3PRZ A;  3AU5 A;  2OJR A;  2KO3 A;  2WX1 A;  3AUL A;  3TJP A;  1SE9 A;  1TTN A;  2LWP A;  2PEA A;  5LLI A;  3KUC B;  1WJ6 A;  2L76 A;  1EUV B;  2YLM A;  2CR5 A;  4AUQ C;  3HK0 A;  2Y5B B;  2HE7 A;  4HK2 A;  2NBV B;  2LRW A;  3ALB A;  4I6P A;  1Q0W B;  3B1L X;  3ONS A;  3SDL C;  3WAL A;  1YX5 B;  2KVR A;  3CF6 E;  2ZNV C;  1ZKH A;  3KW5 B;  3QHT A;  4K81 A;  1YJ1 A;  2KX3 A;  1UH6 A;  2L0F A;  3VUX A;  1S3S G;  3KVF B;  3RCZ A;  4OVV A;  2I1J A;  5J17 A;  4FJV B;  5JHB A;  1KOT A;  2G3Q B;  3NS8 A;  1NBF C;  1WM3 A;  4B95 A;  4DWF A;  3EHV A;  3PGE A;  4K7U A;  4EFO A;  3SD5 A;  2RGF A;  5AZG A;  1V49 A;  3MHS D;  1P9D U;  2DX5 B;  2FCQ A;  4F8C B;  5KHO A;  1OGW A;  3ZKJ C;  2J0J A;  1WGH A;  4LDT B;  1WYW B;  5DPS A;  5EDS A;  1WIA A;  2RSU A;  2J7Q B;  2JZZ A;  2N9X A;  1J0G A;  3DOW A;  3ENE A;  5L83 A;  4BBN F;  2O2V A;  3WIM A;  1E90 A;  4MGI E;  2A4Z A;  3R7R A;  2MBQ A;  4IUM B;  5J18 A;  4PS7 A;  1IPG A;  2ASQ A;  2FAZ A;  4I6L B;  3DVN V;  2L00 B;  4ICU A;  1E8Y A;  4HWI B;  3ZDT A;  1A5R A;  2IZV B;  3A4R A;  1M94 A;  2N9P C;  2BYE A;  4MSM B;  3BY4 B;  2KMA A;  1MG8 A;  3X0W A;  4GOC A;  4KZC A;  2JF5 A;  4M0W B;  4BOZ B;  2GMI C;  4RM9 A;  3V6E B;  1IYF A;  3M3J A;  4EZK A;  2LRU A;  3ZTC A;  4J6I A;  4GSW A;  3QCA A;  1WX7 A;  4EUT A;  1C3T A;  5FR6 A;  2K8B A;  2JWZ A;  2XK5 A;  1WX8 A;  3VTW A;  3ZO5 B;  1C1Y B;  2GBJ A;  1Q5W B;  4AJW A;  3APC A;  3PZD A;  3B08 A;  1UZX B;  3W1S C;  4MGZ E;  1WJU A;  4A3P A;  4DHZ E;  1OEY J;  5IA7 A;  4B9K A;  4GMV A;  1GC7 A;  4G3X B;  2ZEQ A;  1F9J A;  2QHO A;  1WGR A;  2IBI B;  4KVG B;  3IFW B;  3EC8 A;  2XBB C;  3RT3 B;  4KDL B;  3V60 A;  2O6V D;  4FAD A;  1YIW A;  4NAW B;  3QX1 A;  3U8Z A;  3LJ3 A;  3UIP B;  4WQO B;  2C9W B;  5G55 A;  3KYD D;  2L05 A;  1EO6 A;  3UIO B;  1L2N A;  2BKR B;  2CHW A;  1K8R B;  4ANX A;  4ANU A;  3PRE A;  4KV2 A;  4FHK A;  4IWQ A;  1ZGU B;  5D94 A;  2BWF A;  3R3M A;  3L16 A;  5C23 A;  3L08 A;  3A1Q A;  3BIN A;  5L95 C;  2GBK A;  3H6N A;  4DHJ B;  2Z0E B;  4KIK B;  1XD3 B;  3VHT C;  1ZW7 A;  3A9J B;  5G2N A;  4WJO A;  5KHQ A;  3HM3 A;  4X57 B;  4HVB A;  1WR6 E;  1EF5 A;  1WM2 A;  3A9K B;  4W9K A;  2GBM A;  3AI5 A;  4IC7 B;  5DPT A;  1WE6 A;  4CHK A;  3HIZ A;  4WJQ A;  2AWT A;  2BGF A;  2LGY A;  4W9G A;  3IBE A;  2NBW B;  5J2R A;  3VFK A;  4IG7 B;  4IM2 A;  3TCA A;  2A5U A;  2JPH A;  2Z0D B;  4BKS A;  3QWZ B;  2M0X A;  2KQ7 A;  2KXJ A;  2G4D B;  3OLM D;  4ANW A;  1FXT B;  4PS8 A;  3VTU A;  3O65 B;  2J0M A;  3UIN B;  5HKH A;  2REX A;  1NI2 A;  4PYZ A;  3RUL A;  2JVC A;  4NJ7 A;  3VUY A;  2WYQ A;  1WZ0 A;  3H9D A;  3L0W B;  4FN2 A;  4LJP B;  4BBN C;  4TUU A;  2KWC A;  2PE9 A;  3HM6 X;  4DK5 A;  4W9C A;  2K8C A;  3L54 A;  3P2B A;  3ZTD A;  3ZRF A;  5CTR C;  3PLU A;  3NOB A;  1I42 A;  4MM3 A;  1TGZ B;  2CU1 A;  2IO1 B;  4E74 A;  4NPN A;  2MQJ A;  1XT9 B;  3RUI B;  2N1V A;  3QAR A;  3U7D A;  4EKU A;  1X1M A;  2JRH A;  4GU2 A;  2NR2 A;  2NCN A;  1WMH B;  5C1Z A;  1UGM A;  4TQ1 A;  2L0T A;  1WXM A;  3KUD B;  3V61 A;  2KDE B;  1YX6 B;  1S1Q B;  2MWS B;  2ZNV B;  3ZNZ B;  3ZNG C;  4FA6 A;  5AZH A;  2LGX A;  2NVU I;  3RZF A;  3VAW A;  2DYO A;  4F1S A;  1E8Z A;  1NDD A;  1Z5S B;  3DBH I;  5CHW A;  2D11 A;  3DBS A;  2V4L A;  2JXX A;  2D2Q A;  4W9H A;  3TBL D;  3PHX B;  4PS3 A;  2KDI A;  4WAA A;  3RZW C;  3VH3 B;  1WXV A;  4KSL C;  1OQY A;  3A33 B;  3ML8 A;  1AAR A;  3VDZ A;  2FNJ B;  4GIV A;  4KSK C;  2FCM A;  1E7U A;  1YQB A;  4IM0 A;  2PPH A;  2DAJ A;  4MJS B;  3EFU A;  2FUH B;  2FID A;  1WZ3 A;  4NAW A;  4MH0 E;  4GDL B;  3WAN A;  3L10 B;  4PYU A;  2HJ8 A;  4NY0 A;  1WJ4 A;  2KFK B;  4FBJ B;  5CHF A;  3UQB A;  3DVN U;  4RM8 A;  4ZRK A;  3VQI A;  2BF8 B;  2LJ5 A;  1WF9 A;  3DVG Y;  3JSV B;  2KN5 A;  4GB9 A;  4GN1 A;  2DYB A;  3NZS A;  2MX2 A;  1CMX B;  2KLC A;  4CYE A;  2LVO A;  1V80 A;  2RR9 A;  4W9F A;  2D10 A;  1GNU A;  3PSE B;  4NQK E;  1L7Y A;  3OAW A;  2AEH A;  3GOE A;  2ZCB A;  1KJT A;  1WFY A;  2N9E B;  4KIK A;  2AL6 A;  4JLC A;  3A9J A;  1U4A A;  2KC1 A;  3UGB B;  2MLB A;  3EEC A;  4JQW C;  1WGD A;  2MRP A;  2KOX A;  1WH3 A;  4MDK E;  3A9K A;  3DBL I;  3K9P B;  3DCG A;  2MCN B;  4G50 A;  4ICV A;  4ZYN A;  5AEK B;  3DBR I;  2KHW B;  4FJY A;  5E6N A;  2KKC A;  3VVW B;  2XEW A;  3QC8 B;  2DAF A;  4BKT A;  1LXD A;  2KJR A;  2BYV E;  2D07 B;  2J0K A;  4JGH B;  1G6J A;  4XX5 A;  5DPW A;  2VRR B;  4NJ6 A;  1OTR B;  4W9D A;  4E3C A;  2ZVO A;  2CHX A;  3ZLZ A;  2FIF A;  1KM7 A;  2YVC A;  3Q3J A;  2M17 A;  2K39 A;  1Q1O A;  3DPD A;  4FHJ A;  4GDK B;  4BVU C;  2B3A A;  2KWU B;  4TKN A;  3I3T B;  2KDB A;  4K1R B;  1E8W A;  4GXB A;  4WWO A;  3DVG X;  4EOY A;  4IM3 A;  3V6C B;  2RPQ A;  2LD9 A;  4DDI D;  4ZDV A;  2KNB A;  4W9E A;  2EKE C;  5CHV C;  1R4N I;  2ZPN A;  2N7D A;  5JZE B;  4FLH A;  1E7V A;  1OEY A;  2GOW A;  5D2M B;  5TR5 A;  3S2A A;  4XZ4 A;  4ASW C;  3NY5 A;  1WMH A;  2K6Q A;  4EZL A;  3KH0 A;  4BKG A;  3ML9 A;  2KJH B;  4HXD A;  4YL8 A;  4ZRJ A;  1WX9 A;  1P98 A;  3DDC B;  2DZM A;  3WAO A;  3GZN I;  4W9L A;  3H1U A;  2ZCC A;  3JYU A;  3PRM B;  3PS6 A;  4F7Z A;  4FUL A;  1RAX A;  3T9L A;  3ZVV A;  4A20 A;  3Q3F A;  4IWO A;  4MEL A;  3APD A;  5AZF A;  2Z59 B;  3PLV A;  2PJH A;  3T8M A;  3U30 A;  4BFR A;  1RFA A;  1V5O A;  1WGG A;  2K25 A;  4WJN A;  5LXH A;  3WAM A;  2MP2 B;  3ZIM A;  1V2Y A;  4W9J A;  2N1W A;  4I6N B;  2ZJD A;  3A4S C;  3L17 A;  3AU4 A;  1UBQ A;  3RD2 A;  2DZI A;  3QK0 A;  4W9I A;  2JT4 B;  2MW5 A;  3IG3 A;  4HPL B;  2V1Y A;  5IAA C;  1VD2 A;  4MJS A;  1EF1 A;  2CHZ A;  1WI0 A;  1JRU A;  4K7S A;  4GDL A;  1LQB A;  1WE7 A;  5E6O A;  1GC6 A;  4ANV A;  4NNJ B;  3H7S A;  5JHA A;  2LGD A;  2KFK A;  1YD8 U;  1WJN A;  2KTR B;  4HCP B;  3TMP B;  1PQS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...