1CQVA

Crystal structure of staphylococcal enterotoxin c2 at 100k crystallized at ph 5.0
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
239
structure length
232
Chain Sequence
b'ESQPDPTPDELHKSSEFTGTMGNMKYLYDDHYVSATKVMSVDKFLAHDLIYNISDKKLKNYDKVKTELLNEDLAKKYKDEVVDVYGSNYYVNCYFSSKGGKTCMYGGITKHEGNHFDNGNLQNVLIRVYENKRNTISFEVQTDKKSVTAQELDIKARNFLINKKNLYEFNSSPYETGYIKFIENNGNTFWYDMMPAPGDKFDQSKYLMMYNDNKTVDSKSVKIEVHLTTKNG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN (STAPHYLOCOCCAL ENTEROTOXIN C2)
publication title Structure of staphylococcal enterotoxin C2 at various pH levels.
pubmed doi rcsb
molecule tags Toxin
total genus 68
structure length 232
sequence length 239
ec nomenclature
pdb deposition date 1999-08-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01123 Stap_Strp_toxin Staphylococcal/Streptococcal toxin, OB-fold domain
A PF02876 Stap_Strp_tox_C Staphylococcal/Streptococcal toxin, beta-grasp domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.110 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1cqvA01
3.10.20.120 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1cqvA02
1JQYD 1LTRD 1PRTF 1EFID 4RGTA 1LTSD 1V1OA 3MFGA 1HQRD 4L63B 1CHQD 1TS5A 4OHJA 1ET6A 2QILA 5ELDA 1PZKD 1S5FD 1B44D 1LTID 1KLUD 4UDUC 1ENFA 3V05A 1JWSD 1UNSA 3DWQA 1S5DD 1T5XD 1FD7D 2TSSA 1PZJD 1YN4A 1PTOB 1I4RA 1LT4D 1FGBD 1BCPC 1JWMD 4TSSA 5FK9C 1I4PA 4DXFA 1MD2D 1V1PA 4O1NA 1LTGD 1KLGD 1LO5D 1EU4A 1TY0A 2XN9C 2J4XA 1GOZA 1SXTA 2O2LD 1KTKA 2XNAC 1PRTC 3BYTB 1FNWA 1SJED 5ELCA 3TSSA 1TY2A 1M4VA 4RHRA 1PYWD 1UUPA 1S5CD 2AQ1B 4RH6A 4BWGB 1S5BD 1EU3A 2AQ2B 1I4GA 1L0YB 1RCVD 1SJHD 1LTTD 1SE3A 1FNVA 3SEBA 1I4XA 1BXTA 2SEBD 1HTLD 1STEA 1BCPB 1TS2A 3GP7A 4RHSA 1S5ED 3CHBD 2IPKD 4RGMA 3DWAA 4DXGA 1CQVA 4ZYSA 1HA5A 3EFXD 3R8BA 3W2DA 1I4HA 4K6LA 1YN5A 1ESFA 4RGOS 1PZID 1PRTB 1BCPD 1FNUA 1V1PB 1TS4A 1EEFD 1QILA 1PTOD 1RD9D 1B1ZA 1XTCD 2ICIA 2XRSD 1RF2D 1CT1D 1LT6D 3URYA 1D5MC 1ET9A 1LLRD 2RDGA 2AQ3B 2RDHA 1SE4A 3R2IA 3BYYB 1YN3A 4C56C 3BZDB 1DYQA 1AW7A 1RDPD 2NTSA 3EA6A 2XRQD 1PTOF 5ELFA 2CHBD 5D3DA 4RCOA 3OWEB 1PTOH 1D6EC 1DJRD 2IJ0A 2WV6D 5ELEA 1L0XB 1TS3A 1SEBD 1JWUD 2R61A 1D5XC 4Z9CB 3BVZA 3DWPA 1F77A 1JCKB 5FKAC 1CK1A 1G8ZD 2QEJC 1SE2A 1CHPD 1XXGA 3O13A 1I4QA 5I4DA 4RFBA 3BVMA 3MC0B 3R2TA 4RGNA 1LT3D 1JR0D 1BCPF 3KLSX 1AN8A 1LTAD 1PRTD 2NTTA 3BVGA 1HXYD 1PTOC 1EEID 2Z8LA 2G9HD 4L6TB 1LTBD 1LT5D 5D3IB 5ELBA 5TSSA 1SBBB 1D5ZC 4NZLB 1EWCA
chains in the Genus database with same CATH superfamily
1A3TA 1X3QA 2PO4A 1IBLQ 1EFID 3BWUD 3RNAC 4AUQC 3H3VC 1STNA 1A6XA 3J7A5 2KFJA 2QILA 5CV4A 4DV7Q 4CKCA 2K1BA 3V3XA 3DBHB 1G2SA 1HUMA 1LFDA 3RYTA 4A3DB 2RSUA 4GS3A 1MJCA 4O0AA 4LLGM 2UUCL 2E2IB 2JQRB 4P6VF 1QZHA 1P7FA 4N59A 3ZW3A 1YEZA 1WXAA 4ANWA 5C3EH 1XLQA 1ZP0B 2O6VD 1XMQL 3MJWA 5G3LD 1NMFA 4TSSA 1V6EA 2L5TA 3A55A 1RJTA 1WJUA 2PNRC 4LUZA 3S24A 1LO5D 2EYPA 2HQEA 2F0MA 2V3SA 4B3TQ 4J6HA 3KF8B 1KRHA 1KF6B 2A19A 4IUTA 4KY5A 3VR6A 1M94A 2L0TA 3A9JB 1VQDA 1GM5A 3ONSA 4ZRIA 4NXNQ 2HJ1A 1IYFA 2K1FA 2ASQA 2XBBC 1OXUA 1QKZA 4NXMQ 3H7PB 1EWIA 4D2KA 2N4FA 1ZOYB 4LK0M 5D94A 1XJVA 2E2JH 4DV4Q 1L0YB 1BVSA 2VUMH 2R7ZG 1UE7A 2DUDA 5IT9c 1HE8A 2BYFA 3KK7A 1Y1WB 2JZ3B 3SEBA 1HNZQ 1EM7A 1BXTA 2DZJA 2MJDA 1E7PB 1VZ6A 2MPMA 2ZCCA 3IFWB 4GMVA 1XMOQ 1NENB 2E6XA 4RHSA 1S5ED 1JJ2A 5FR6A 2GOWA 5FO8B 4JI3Q 4YWGG 2VQEL 1Q3LA 1IGDA 4N6EB 3HFZB 1EFWA 4J8QA 3D0FA 4DNRB 3OLMD 4HAEA 4DK5A 4A3IH 4ZLTF 3H3VH 1C76A 4QF4A 4JIOU 3QJYA 5AFWA 1K50A 5G3LF 4EQPA 3HOZB 3W1YA 3WANA 1VQ9A 3NBIA 3HKSA 2PLPA 4TQ0A 1EOVA 3K80C 3PPAA 1GKHA 2RCNA 2J7ZA 1LLRD 3GB1A 2OOBB 4DBGA 2AUKA 1IW7D 3BYYB 2RDFA 4A4IA 3PLUA 1OXVA 2K5HA 3T16A 2JEAI 3PRMB 2HD3A 3OWEB 4RCOA 2JN4A 5I6YA 2ALYB 3JAMi 2F0UA 5IA7A 3CPFA 1T3QA 3J9CA 2Y0SG 4JI1L 5EE9A 4CJ0B 1PXUA 1WWTA 3I4NB 1UBIA 3OTOQ 3CU7A 4HJ7A 3HG9A 1HZ6A 5I2XA 2FCMA 2GBJA 4LF6L 2JRIB 1TS3A 1PVOA 3JSVA 1WM2A 3AE8B 3KUCB 2O6VB 1JJCB 1Q1BA 1S3SG 4L5RC 3TS0A 1KC8C 5JJLA 3D4RA 1CK1A 2QKIC 1SSOA 3U8ZA 2F0TA 1WVLA 2YTYA 3HOVG 3I3CA 3L7ZC 2V4LA 3F2BA 5AZGA 4A20A 2K75A 5M5YH 3OJ3A 3BVMA 5EBCA 4KKUA 2F0HA 4BY1H 1OQRA 2NZOA 2BDOA 4KIKA 3AEBB 2N9EB 5T8IA 3HEJA 1WOCA 4HJAA 4A9AA 2NVXB 2XGTA 5F2DA 1KD1C 1XNRQ 1F2RC 1LT5D 2K5QA 1VMPA 4MTKA 3RNBC 5J22A 1XPOA 2LHEA 3RNFC 3GTJB 3J7AF 3T4AC 2AYOB 1P1AA 3LNNA 3K57A 1TU2B 2VL6A 4ILWA 3KWLA 1KRTA 4XQJA 2E3TA 3NOBA 2N55A 1AARA 2FUG1 2HDMA 3S1MB 3AV8A 4IWQA 4LF4Q 2LMCA 1I35A 3WOFA 5JZEB 2DY8A 3ERQA 3A74A 5HGTA 2QHOA 1G51A 2R2QA 3X3NA 1PFSA 5BR8L 2NPTA 4G0NB 1KLGD 1A63A 4DA2A 3AE6B 3RUZA 1FO4A 3UE0A 2DN8A 4MH8A 1IW7C 4MGZE 1YJWA 4A90A 2LGIA 3S9WA 2LXKA 3ULJA 2ES2A 4C1NK 3GTMB 4W9EA 2KT7A 1VRAB 3M95A 1V1QA 2OQKA 2MA9B 3MHBA 4OZAA 3T51B 1B9NA 1B7YB 1Z6HA 3Q69A 1UE1A 2L7RA 1F1HA 1B4OA 1RTOA 2R7ZH 1B70B 1ICFB 5LHY1 4CKBA 1WX9A 2C7NB 2Y5PA 2WGSA 1J19A 2CCZA 2A1AA 2L8JA 3DHQA 1P8LA 1M8AA 1VQGA 2IPKD 2JWUA 4A3FG 1PDQA 1HNWL 2EYMA 4TKOB 2JYTA 3DBSA 3BY4B 4WORA 4TVAB 1N36Q 5G5GA 4K6LA 3RMKC 1A5RA 2M8SA 2LRUA 1MI0A 5M3FB 4TMAB 3UDXA 1WIAA 4H2AA 1K28A 3GTJH 3DHHC 3L16A 3SDLC 1XTCD 2JP1A 4DU9A 2NBVB 1X6OA 4DHJD 1VZ8A 2MX2A 3A9KA 4MGKE 1SSNA 1VQLA 3NG0A 1EQQA 2KBNA 5JOBA 2A6HD 3S1MH 2PQAA 4KKSA 1EUVB 2YVCA 1NSNS 4YY3L 3AEVA 1OXTA 1C0AA 2ZVNA 3PUYA 3NTIA 1D6EC 5D65A 1FJGQ 5JJIA 2N9PC 3SD5A 3T56B 1JJGA 3RNEC 2L0CA 2J0KA 4UP8A 1K73C 5CBAE 3Q6BA 1F9SA 5C6AA 1GUTA 4BBNC 2KJ6A 4I7ZC 4B3RQ 2AUJD 2ZJQA 4MIUA 2K33A 4DF7A 1I94Q 2KQ4X 3DM3A 2L05A 1KXLA 3AEGB 3D3RA 1WTQA 3GTMH 3O13A 1V49A 5COYA 3N30A 1C79A 3KW5B 5AUKA 1WGYA 1NAPA 3HVZA 2LHDA 3HOVH 2BYEA 1EWYC 1G6JA 4E74A 1CSQA 2KHIA 1WE6A 1K83H 2MFIA 3WA0A 4ZCKA 1PRTD 3DBHI 4A3OA 1GXDC 1Z5SB 1WTPA 1ZXIA 2VB3X 3DDCB 1SIFA 1SLJA 1Q1OA 1TWFH 2D2QA 3N32A 2ZNVC 5CC4A 4AQ7A 2IHEA 2BOSA 5ELBA 4PV1C 2NBUA 4LNOA 2MRPA 3IXSA 3J81c 4A3EG 2L12A 3Q8DA 2F0QA 1CKMA 2D3BA 3CQZB 4EZKA 1HQRD 3HKZE 1Q8IA 5EE1A 3TZUA 1Q46A 3TRZA 4CHKA 3EFCA 4DR2L 1L6VA 4GDLB 4UDUC 4C3HG 1G91A 4IFDI 5J39A 3Q8AA 3CMEA 3GTQH 3I73A 2AWTA 1HPCA 5CYUA 4FXDA 2JU6X 5E6PA 3ZJTA 4XQNA 3ZNID 2AWNA 2A6ED 2JJQA 2KVZA 1Y1VG 3IG3A 2WLBA 3LXFA 1MHHE 4WWOA 3UINB 5FK9C 2XSCA 2A5UA 3RN9C 4OELB 2OEDA 3PO2B 4G4KA 3HKZB 2KVRA 3HS0C 2MWSB 2KEDA 4ALPA 2DNEA 2AWOA 1L0WA 3B6YA 4FXGC 1Q0WB 2KCNA 2UU9L 3RULA 4IPCA 3ULLA 2UXDL 2LVOA 1VQNA 2PIAA 4A3CG 4I6LB 1S3OA 3NY5A 1GC6A 3W3AA 5IWAQ 3FPPA 2O2VB 3PCOB 3TP8A 1RCVD 1KIXA 4C00A 5IP4D 5LMUL 4GOPC 4CQNA 4HRSA 5CV8A 4M00A 2BKRB 3GP7A 4P74A 2VB2X 4WJ4A 3UE1A 2ZTEA 4NB3A 3CCRA 2G5DA 1UWXA 3FVQA 2GBNA 3PZ7A 1D1KA 1Z9FA 5CX3A 2Y5BB 3R3MA 5EKLA 4WWMA 3A8KE 4A3FH 4NQLB 2JEBI 3I70A 4JI0L 2KQ3A 1JROA 2RBMA 3UDGA 1I4HA 1ESFA 1X56A 4X3UA 1PRTB 2W82A 5IIFA 2VW9A 1EQVA 4JI6Q 3CWIA 5EPJA 1PTOD 2KXJA 4YHHQ 1AE2A 2XRSD 2CWAA 1L6UA 2G3QB 1E10A 1K53A 1B50A 1TZOA 3K6OA 2OCEA 2JA8G 3P7JA 3QR8A 4K2LA 2F03A 3NS1A 3OMGA 2N7EA 1MJEA 5AEKB 4LF9L 2LFNA 1E0ZA 3S1NH 3SK6A 1L2FA 2Q8TA 2KN5A 1D8LA 2WAQG 3FAHA 3DUZA 3L3OC 3S17B 1GUAB 2KDBA 2BCOA 2N1WA 3NVYA 1EL0A 5HG2A 2CH4W 3PO2H 1CQFA 5DM63 5C44B 3ZDMC 1HR0Q 1KLVA 3BVZA 2BF8B 2PNHA 2L32A 4P1CC 2ENBA 4H0LC 3VYTA 1KABA 3R93A 5AUIA 3QIJA 3GO5A 3VR5A 4BOSC 3RFZB 2QEJC 3FKIG 3M85A 4JI4Q 2A6EC 2K5VA 4CGYB 5JJZA 3M4OB 1GG3A 2KMAA 2IY1B 4IM0A 1O7YA 2XIWA 1YD8U 1YNNC 3C2PA 2I2YA 2BYTA 3ONAB 4L5QA 1GVPA 1JQ4A 1U9RA 3RNUA 1W6JA 5JH5C 4PT5A 2LY7A 5LXHA 1FPYA 2LVPA 4LCDE 1HXYD 2K3UA 1XPUA 3MXGA 1AZQA 1JOKA 3NJTA 1LTBD 2PKOA 3QO2A 3RMHA 5CMDA 1QVFA 2F3VA 1OTRB 4NJCA 3TP7A 3NSWA 5KNCA 3HM3A 3E0EA 1SB3C 4IWPA 4X62L 1CHQD 4DGZA 3A0JA 1EYDA 3GTPH 4H44C 1WGGA 3S1QH 2BBCA 2WNMA 3M62B 1TWHB 2PE9A 2ZXRA 3CCLA 2A74C 4K8IA 4C3HH 3ULPA 1JWSD 2JF5A 2BYVE 2K25A 5M3MG 1L7YA 4DV3Q 3VDZA 4I7AA 2IL8A 4JPBW 1FM0D 2ACZB 3DBRB 2MQJA 1PTOB 2NMQA 5C3XA 2N8NA 1Y1VH 3G48A 4HPLB 1XLOA 2N49A 2EY6A 2BE5D 2IWHA 5E7NA 4DV6Q 1A3UA 1EU4A 2QCZA 4KGTA 1VD2A 3U52E 1STBA 5C4HA 5IT9E 4JI7L 4GOPA 3OYYA 4LF7Q 4QCLA 3MEFA 3BS1A 3I2ZA 1N32Q 1P98A 1SDFA 2BA1A 3E5SA 2G45B 2V3PA 1PFDA 3B2GA 1M4VA 1KL9A 4IURA 4P16A 1K3RA 2NN6G 1N5WA 3SFDB 3AN1A 3CCJA 3M4OH 1EU3A 3W9CB 4AWJA 3TREA 3G7LA 2F0KA 3K7AH 2NVTB 2ZT9C 2OT2A 4RF1A 5G55A 2M0AA 1VQ4A 2KDFB 4XYOA 3B08A 3VA7A 3CCEA 3W5VB 1I3QB 1SYBA 3EHVA 2R93B 2CFMA 2QDBA 3DWAA 3S14H 5BMGA 4HJ9A 5E6JA 3OW2A 1NEKB 1TJEA 3FILA 3SGIA 2J0TD 3K8AA 3I4MG 1STGA 1D1IA 1HZBA 2MH7A 2UUCQ 2MBQA 3GDEA 3B1LX 3CAMA 3V96A 2GMIC 4DNIA 1FCCC 1L4ZB 2WFWA 1XMQQ 3FKYA 1MFWA 2JA8H 3OJ4B 3RZOB 1UGMA 4C56C 5M3MB 1C3TA 3KLWA 1EQTA 2B63G 2XWBB 3S2HB 4DR4L 1IBKL 4W9CA 2ON8A 1PTOH 1PUTA 2B3GA 2VNUD 2JSVX 2QMTA 3EECA 3IT4B 3PVLA 2E74C 3ZNZB 4AJWA 2VQFQ 3IVFA 3PGEA 3BZKA 4MGIE 3NBHB 3DCGA 2ZXPA 5DPRA 4BBRG 5DPTA 4ME3A 1ZYRC 4X64L 5FKAC 4R8NA 4YCUA 3U7DA 3U50C 3QWNA 3GV6A 4GZYC 2PCFB 3FKIH 2UXBL 1XWEA 1HZCA 2FXQA 4UAIA 1IGCA 4WWPA 3PTFC 1LXDA 1VQEA 2R3ZA 2WB1G 2W3SA 4W9HA 3PUXA 2VQEQ 4GN5A 1YQ4B 4BOZB 4KV6A 5C5MA 3KLSX 2LUMA 2H88B 3K59A 1C8CA 4ACFA 3BVGA 1F9JA 3QK0A 1KQSA 4NNJB 4QUFA 1L1OB 4HCPB 5IOCA 2D3AA 1ZXTA 3SK5A 3DEOA 3VYRA 3J81i 4NZLB 2DZKA 2Q5WD 1C4PA 3Q14C 1YJ1A 4ULLA 4RGTA 1E8YA 3GTKB 3TMPB 4LFCQ 2INPE 2KQSA 4FADA 5IYDG 1QG7A 3GZNB 1DGSA 4KJOA 4RM9A 2L15A 4Q5VA 1SYDA 1B3AA 4JI1Q 4AH6A 4X6AH 1QOGA 5M3MH 1T5XD 5CHVC 1QOAA 1E22A 1E7UA 2BVCA 4LF6Q 2GLSA 2G4SA 1QUQA 2Q2HA 3MEHA 2WWZA 3PIPA 1JRPA 4L8JA 4OWWB 1ZW7A 2DYBA 3GS2A 2Q2IA 1PYBA 1WY8A 1C4AA 2CHWA 1TWAB 2WX1A 5D6JB 4XWTA 1O80A 2QJLA 5IP9G 4M0WA 3BYTB 3BZCA 2YV5A 4OIJA 2I1KA 2KMMA 1VQHA 4G11A 1Y69U 2D2CC 2TMPA 4A3KB 5FJ8G 5CR3A 3IFTA 2Q8RE 4PS7A 4FULA 3E9HA 1HTLD 2L00B 1QB5D 2EY1A 5IKCM 4C7YA 4ZHPA 2R92B 2E2HB 4AQYL 3APFA 2LD9A 2R7DA 4DDGD 1SYCA 5C4XB 1E9MA 1PGBA 1NYQA 3GTGH 3GE3C 4A3JB 4HIMA 4OEMB 3H0GB 1YN5A 5C3JB 4BS9A 4MM3A 3I4MH 3C19A 3BG3A 1YIJA 2PZWA 1SFOB 1E6EB 1ZPSA 2M56B 3GTOB 2BB6A 2WU5B 4ITKA 2F0JA 1EY7A 3L0WB 3C1EA 2L83A 3PO0A 4KLKA 4OVZA 3BINA 3P1HA 2ZCBA 4KDLB 3VRAB 2F0FA 1YN3A 4HWIB 1UBQA 3OSOA 4CDEC 4XWWA 3F2DA 2GBMA 1MJDA 2B63H 2IO1B 4US9A 1B53A 4C3IG 2K03A 3OAWA 4HJKA 1LGRA 1Y56A 2W3RA 2OEOA 2MLBA 1FVIA 4ZRPA 5HGQA 1ISNA 4BBRH 2LJ5A 1F77A 3F2UA 3IRBA 4MELA 4R4TA 4DR5L 1VQ7A 3FP9A 2W55A 2JK8A 4MDKE 3UGBB 4HVBA 1U0LA 3HP3A 1E0BA 2IX3A 4P73A 4TRDA 4J3OD 2A8VA 3OW7A 3SVMA 4PYZA 3HOXG 3OWFA 1LT3D 2WXOA 3J81E 1XQQA 2FCNA 5C3EB 1HNWQ 4YIJA 1K8GA 3T3OA 4XE0A 3I8ZA 3DM1A 1WFYA 1ZE3D 3SFEB 3UIOB 2HT1A 2E2HH 2MQHA 1YIWA 4B0EA 2QW7A 4L6TB 2GA4B 3DBRI 4KDIC 2R6GA 3NWSA 4WJ3M 2D0OA 1HZ5A 2WDRB 2REXA 3IL8A 1WTXA 4YTMB 3A33B 4YSYB 2JSOA 1VQKA 3ML8A 5J2RA 1YNTE 2BPSA 1FCLA 2X6LA 1SFOH 2VXWA 2IO3B 4EX5A 3NRZA 4GDKA 1PZKD 1VDZA 5BN4A 4YY3Q 1IBXA 5IYDH 4KTAA 1N5XA 1SYFA 3MXUA 2E2JB 1B44D 1WCMG 2IY0B 3AECB 4MACA 2Q2TA 1VDVA 2ZVOA 4KI0A 1N61A 1FD7D 1LT4D 4KKTA 3BK1A 4MSMB 1CJEA 2K6QA 3I72A 5ELOA 1MD2D 4EQOA 1XX8A 4QJFA 2J53A 3N20C 4K7UA 2F1MA 4IW0A 3ND9A 4FLHA 4KIKB 3CCSA 2HCIA 4A3GB 1C1YB 5IN7A 1ZEQX 5LL6S 4A93B 1WYWB 2INCC 2WXJA 3HRZC 3MA2B 1B9RA 5BYRA 4BBSB 1WH3A 3SE0A 1CSPA 4K6DA 1WGDA 4RNAA 2KVMA 1S5BD 3AU5A 3ZRFA 5JAVA 4N8FA 1SJHD 1RLFA 2EPBA 5FJ8H 2I5LX 2EMTA 2IHFA 5CTRC 4DN4M 1V43A 1IKMA 2M0XA 4O2DA 2D10A 3I5JC 4HK2A 4JC0A 5KNBA 2AX5A 4FN2A 1I5FA 1UWVA 3ML9A 2CJOA 1V80A 1C48A 3VYUA 3EFXD 2N9KA 1PFNA 5C3WA 3R3OA 5M5WH 2OTLA 3C3LA 2G9DA 4DR2Q 4YXDB 2NPTB 2EE1A 1R4QB 3OMCA 4B3SL 3ZXVA 3U4EG 3J80L 3V6EB 4UPAA 4JWSC 4BA1I 3KUDB 3ERSX 3URYA 4IM2A 3NHEB 2BDNA 2RDHA 1OQYA 5M5YB 1CMXB 2KOLA 2RR9A 4BY1B 3ALBA 3KBXA 2WX0A 1I7HA 3ZNGC 3KVFB 4GB9A 2E5LL 3LYYA 4K7SA 2L0FA 5JHAA 2UU9Q 2LXJA 2WDTB 5FLXL 2UXDQ 2I46A 5ELEA 4ZDVA 2KO3A 4A3GH 1HTPA 5IODA 2BH2A 1JMCA 4A93H 3F8TA 1N8RC 4BBSH 5LMUQ 1WXSA 2FNJB 1QVCA 2J7QB 2WS3B 4NKLA 4C3JG 1XXGA 2B2TC 1BUIC 1WMHA 3QC8B 3WAOA 4ANVA 3ZYYX 2ZW0A 3PGZA 4QMGA 2KOXA 3P4RB 3KF6A 2WXNA 1NTGA 1PMRA 2WACA 2OJRA 1TYGB 4MNOA 4K3CA 1WI5A 1E24A 2EVBA 4JX1C 2M1MA 3GZNI 3A9KB 3ECIA 3PT2B 3KLSA 5IGEA 2BQQA 5FLMG 2C35B 3NHHA 2A5HA 2JPHA 2K28A 1WR1A 4BXXG 1S1QB 2QF7A 2SNSA 4PNYA 2RGFA 4E3CA 5C2TB 3RNGC 2PQAB 1IP9A 4B95A 2K6DB 5M5XH 2DAFA 1VR9A 4YT0B 4QL5A 3BDCA 5JJKA 3CW2C 4NAWA 1R7SA 1D3ZA 3PHWB 3UDIA 4M8MA 1A0IA 4LFBL 2G1EA 2MJ3A 1NI3A 4FF4A 4DR7L 3PRZA 2P5ZX 2M00A 1RHPA 3M7NA 5ELDA 3DVGY 3RPFC 4XIGS 4KHPQ 2I1JA 5NUCA 4ZRJA 4A3BG 2KTRA 3KUPA 1EZ8A 5CV6A 4K3BA 3Q8CA 1HFNA 3ZXRA 5KHQA 1ENFA 1WCMH 3H15A 2EOTA 4X65Q 4KD4A 2JA6G 2R7ZB 3C46A 1K52A 3P4SB 2GN5A 2QGQA 2LI5A 1I4RA 2C60A 3X3MA 2KFKA 2UXCL 2PW7A 2WIIB 4MN3A 4JWUC 4X3TA 2I38A 2ZW1A 4XX5A 3KBGA 4H13C 4M8NA 2YYZA 2MBHA 1VQAA 1TT2A 4H7BA 3I55A 5IGGA 4HDQA 3L9AX 2KZRA 3I91A 4ZAIA 3VDYA 4HJ5A 1KTKA 1FNWA 3E3XA 3TSSA 4DV0L 1QT9A 3HZXA 3V2TA 3J7ZC 3N1XC 1FIQA 1F2YA 5D2MB 1SE3A 3TP6A 1NDDA 1H9JA 3P4PB 3T13A 3OIPA 2EYJA 3UQBA 3NTHA 3NXWA 5EE3A 5HI1A 2PW9A 2YTVA 4OWTB 1N62A 4NPSA 4IN3A 3SU8X 2IO0B 2Y0SB 3AFQA 1I42A 4X62Q 1NMGA 5LMNW 3DXJC 4GN3B 3SHQA 1D7QA 3PZ8A 3W2DA 2PZTA 5ELNA 2R2OA 4X66L 5FO9B 4XDCA 5LNK1 2BB5A 3M4YA 2DX5B 4JL9A 1UEBA 1B3QA 3HOVB 2D3CA 1STHA 5IYBG 4DHJB 1CTMA 1K83B 2EY2A 1VQCA 5D3DA 4TUUA 2PVGC 3A56A 1HQMC 5J1ZA 4YWLA 4JI7Q 2CS4A 1TWFB 2ONQA 3MXNA 2B2TA 5IE8A 3H7PA 1EOTA 2NVQB 5HHDG 3VXWA 2K04A 3UI2A 4BBNF 4Z9CB 4NJ6A 3T1HL 3BJUA 1T9HA 2NVYH 1G6PA 3TUOA 2FBWB 2K0PA 3L54A 3EN2A 2F0SA 1FXAA 2KWDA 2M17A 2L55A 2K5DA 1GUSA 3JAME 2HE7A 2K22A 1RTNA 1F2LA 3P2BA 2FJ2A 3GTLB 2GBRA 4HLEA 3GTQB 3DHGC 3A7LA 4R8IA 1TZ1A 3A5UA 1LTAD 4LF8Q 1Z47A 2CKHB 3HIZA 5FLMH 2INDC 1B9MA 2F0OA 4IQZA 1BNZA 4FF1A 4I6PA 1C9FA 2JA5G 3E9IA 2O5JC 5K5PA 3U7ZA 1Z2MA 4KD3A 4B3ML 4W9LA 2F4VL 4IJLA 1KFYB 4LWCA 4UHVA 1RFAA 1TGZB 3Q8EA 2LS01 2JZPA 4L63B 3M3JA 4LNNA 2PMZB 2EYLA 4DR4Q 1IBKQ 5C0XG 3H3VI 2WXQA 2ZZPB 3UI3A 4HCSA 4A3BH 2K39A 1SE9A 4MJSA 3PMFA 1UNSA 2JXMB 2JA6H 4HXDA 4LNKA 4ZRQA 4RAUC 3NQIA 4KJNA 4BY7G 1C77A 1O7LA 5C1ZA 1VQMA 1B2TA 4CYEA 2A73B 5JEAJ 2ZNVB 3KOJA 4RKLA 4WJOA 2EY5A 2WXRA 4A3FB 4X64Q 3G4SA 2KJXA 2JYOA 1XF5L 1CI3M 2XTIA 3HOWG 1NY4A 2NVQH 2UXBQ 1I50B 4JW0A 4A76A 1WXQA 4B0MA 3RZWC 5I9PA 3VH3B 2A69C 2KC1A 3AEEB 3J7YW 1Q90A 3K5OA 3CCQA 1VF5C 2D0PA 4F7XA 2V1YA 2DYMA 4HR7B 3ZQ4A 2JVCA 3ZJUA 1A3VA 4E6IA 5DEHA 4HEA1 4KX6B 3Q0AA 1H95A 2I5MX 2N7DA 3GTLH 1JICA 4EGVA 3S1NB 3JW0X 1WTHA 2FFKB 1TKEA 2Z59B 3QARA 1BOSA 2B8GA 2CWPA 3NTKA 4EOYA 3ZTCA 3GQBA 3A54A 5I6WA 1GUGA 1EIFA 2SNMA 3APDA 2A68D 1RRBA 1YNND 4ICUA 3TIXA 1MKHA 1RODA 2B2WA 3DEPA 2LWPA 5GMVA 4DHZE 2MUYA 1B8AA 3D31A 2C9OA 2KEEA 4EQNA 1IBML 3W1GA 1K8RB 2DHZA 2YEPF 1BCPD 3S1RH 3QHTA 5DM73 5DPSA 4MTNA 1HHVA 2ICIA 3NZSA 1KAWA 3AMZA 2HDEA 5J18A 1EIGA 1KAAA 2NYZD 4GOPB 5DCNA 2FINB 1HNXL 2LKVA 3QB3A 2NBWB 4DV2Q 1E90A 3CF5A 5I2YA 2PEAA 1AW7A 5IYBH 3ZDTA 3AFPA 4DHZB 5IGCA 1XO3A 4PS8A 4JBJA 1A62A 2RSOA 3PREA 4KSKC 1ILQA 2KKCA 4GN1A 1CZPA 1Q82C 1N9WA 1YZ6A 3I7FA 4IUUA 2LVQA 4Q2JA 2F0LA 1BUVT 1IYUA 3RN2A 1YX5B 3Q3FA 4A3EB 1SEBD 1JWUD 3KUZA 1I50H 2GB1A 2LRWA 4BKGA 1Q86C 4JGHB 1JCKB 2D62A 3IHPC 1Q12A 1G8ZD 2Q8IB 3GTPB 1KDCA 2OF1A 4JK1C 3S1QB 3FILB 3Q8FA 4OO1G 3V60A 1JE4A 5A2QE 4AQYQ 4O42A 4C3HB 4KZ0A 3WDNA 1U4MA 4AYBG 2YTXA 3TBLD 4RGNA 1KOTA 4CJ2C 2PZUA 3TDQA 2EJFC 1LM8B 1BCPF 1C4QA 4XQQA 1GUWA 2RPQA 4FJVB 3QOLA 4DV5L 2PE6B 5KHOA 4A6QA 5FR3A 1Y8RC 2V0GA 2JT4B 1Y1VB 4K0KL 2CH4A 5FOBB 1YJNA 5JVH3 3BU2A 4A3LG 2UWQA 1WRIA 5D3IB 4M1UB 4PZ8A 3E56A 1F2RI 1UD7A 4X3KA 3A8IE 3PUZA 1GAQB 3T3NA 3EFUA 4HIOA 2OJWA 3FMCA 4NW2A 3IBEA 1ZKHA 1S5FD 1VQ6A 1EYAA 2HIVA 1LTID 1KLUD 1ML0D 5KGUA 1UWMA 3K7AB 3Q3NC 2A68C 4WJWA 4HROA 4NJ7A 3VRBB 1JOOA 1S5DD 2CKZB 5JPMC 2TSSA 2OWOA 4LW1A 2EXDA 5TR5A 1IYVA 3KLRA 2K8BA 2KX0A 2UUAL 1BCPC 1P16A 4XYQA 3S14B 4DXFA 3P20A 1MGSA 4DR5Q 2HTME 3N9YC 1VF7A 1VQ8A 4KKJA 4IOCA 3ZRCA 3MC8A 2FIDA 1F9PA 3P42A 3JYUA 2D9UA 2WAQE 4W9FA 4A3EH 1FEHA 3TMEA 2LEKA 4K81A 2EELA 3PO3G 4G7ZC 4GKKL 2KX3A 2JA8B 2KYWA 4PG3A 1YMHE 4LDTD 1QE6A 2CHXA 1ZYRD 2OHFA 2WXGA 2F0GA 1E3PA 4H02A 5BYSA 1I4XA 1OXSC 4ID6A 3SXHA 2WAQB 4RGMA 4REZA 3L10B 3J7AV 2WXFA 3NS8A 4HTHA 1X55A 1YNXA 5EKKA 1KJTA 2J42A 4QUCA 1A8VA 4EKUA 2J0JA 2MCNB 3N1YC 4WQOB 2V4DA 3C0RB 1QUQB 2EJMA 3RI7C 4IUNA 1VCBA 1VZ7A 3CRKC 2AL6A 4N58A 2IT1A 4Y7NB 1CT1D 3FKIB 2M19A 3NUHB 1YX6B 4A3CH 3AE7B 1CM9A 4LTUA 3WIMA 1SNPA 4UP7A 5GAEC 3GD7A 4LNIA 4M0WB 2WP9B 2NWGA 2RPVA 1AYFA 4IOIE 1E7ZA 1TIFA 1R4NI 2Z0DB 1HZ9A 4A3MG 4GIVA 4F7ZA 1DJRD 1ENCA 1H9MA 1PYSB 1UF0A 4IM3A 2B76B 1T6BX 3EROA 2X6GA 1V8CA 2K01A 2BWFA 2K7VA 2KA7A 2O2VA 2Z6BA 1AEXA 1N63A 4C7ZA 3PS6A 3L4PA 1D5XC 2HIXA 5KEEA 4XT1B 4OWXB 1Q5WB 4IDIA 3QAQA 3L2PA 2RQXA 2F0EA 5C0XJ 4YSXB 3TS2A 1F2MA 1V81A 2KDIA 2N78A 1TKWB 1GPXA 4AJYB 2WHIA 2X38A 3M4PA 1TVXA 4NMZA 4GLVB 3AE5B 4LJPB 4C2MB 2ZM6L 1G2TA 1FRDA 1EEID 5GAGC 2DNFA 3V6CB 3DMUA 1SBBB 2SOBA 1FXIA 1XCTL 1N6ZA 4L1BA 1LTRD 1G6ZA 1GUOA 1ROEA 1OXXK 3Q3MC 1LACA 1LTSD 3X0WA 4WWNA 5M9OA 2HHHL 1J7BA 4KMUC 2GRIA 3CPWA 4YL8A 3H91A 3VQIA 1R4MB 4NDXA 3NZUA 3HOYG 4F87A 3QG1A 4Y7NH 4JI2L 4FF2A 1FRRA 2E5LQ 3VUWA 1KNEA 4CO7A 2CU3A 3K9PB 2PI2E 1ENAA 3LGJA 4II2B 4WJPA 3DVGX 3K0YA 3WOEA 1BBXC 3GOEA 4E71A 2DZIA 4B9KA 3DWGC 2HD5B 4N9F4 2J52A 1V1PA 4FHKA 1ZDVA 4HCNB 2ZJPA 4QIWE 2KDEB 3Q22A 4JOIC 4ANXA 3GTGB 4K5WA 3ZGZA 2K8HA 3NQTA 3MTNB 1T5EA 2K5NA 1ZGUB 4YCVA 2XN9C 3I4MB 1RAXA 4KN4C 3AM9A 1J7AA 1BR9A 3CRLC 2ATWA 1OQQA 3KJOA 1L0VB 4AOFA 2K50A 2E76C 2XVSA 4GNXC 2INNE 2HDLA 3PO3H 1NYRA 1X1MA 1C7YA 1SYGA 1SRUA 1S40A 5DPWA 5IOIA 1EZ6A 4ZKBB 4MSQB 4RMFA 3RNCC 4HPMB 1FNVA 2KCCA 4QIWB 1HJPA 4DNTB 2B63B 4FVMA 4HIDA 4DR1L 3WAPA 4EEWA 4S3SA 1IBXB 2JWZA 2N9XA 3Q23A 1I6HB 1AH9A 3L13A 1E8WA 4ZRKA 2HQLA 4C2MH 1VQ5A 3FDTA 2Z0EB 4RWSC 1H4RA 4L5TA 3RLFA 3TEZA 2QDLA 2AEHA 3CC4A 1C78A 3NE5B 2BGFA 2CHZA 3AB5A 5H92C 2BKFA 3P63A 1H9RA 1SNQA 4K5XA 1O7ZA 2YLMA 4RGOS 4BBRB 5IT9L 4GLSC 2UUBL 1EF5A 4HIKA 2E2DC 3QIAA 3F1ZA 1EEFD 2ASBA 4YSZB 2XWJB 1WR6E 1RF2D 2H5XA 1YHAA 1SYEA 5E3FA 1UE5A 1PH4A 3HOUG 5K36G 1KM7A 3AI5A 3R7QA 1QOBA 2RDGA 2QA4A 2UXCQ 2C9WB 2AHOB 2NN6H 1VQPA 3H09A 1WGHA 2WB1B 3PUWA 5KYLA 1RDPD 2W9NA 2ZJRA 2LGSA 3H6MA 4N9TA 2XRQD 1I6VC 5ELFA 2PJHA 4GLAC 3PF5A 3FEWX 3A1QA 4A55A 2RHQB 2KQ7A 2ICEC 4PZ7A 3AXCA 3I3TB 5H8YE 2K14A 2F3IA 1VQOA 2OTJA 3LWEA 2LUEA 4DV0Q 1JW9D 4BAXA 4NAMA 1QOFA 2IDYA 4G7OC 1KHIA 1X54A 4X3SA 5EAYA 4TV3A 5EPKA 3MHZA 4XYCA 2VZKD 4HCEA 3BDOA 2N0SB 3SDZA 3RT3B 4PQXA 3OPOA 4J1MA 3ZKJC 4JI6L 1E7VA 1NBWA 3VTVA 4B9WA 4JQWC 3F2CA 2DY7A 1IKLA 5BR8Q 1K51A 4GN4B 1P9DU 4FA6A 3PF4A 3W5UB 4WURA 3KH0A 4Y52H 2PPBC 1I6HH 1YHBA 2JUOA 2G9HD 3PQIA 3I63C 1WJNA 2PTLA 1SNOA 4IWOA 4XC2A 3T8MA 4YWMA 2F4IA 2VZAA 1YITA 1JOQA 1TTNA 2K8CA 3H6NA 1CKNA 3T1YL 2N88A 4DFAA 3QX1A 4K8JA 1HRJA 4HEDA 3SHLA 3HVDA 1QNUA 1N33L 3U9SA 2KCTA 2L9HA 4AIMA 2VUMG 4JBKA 2RF4A 5JPNC 3HOYH 2IY5B 3BK2A 2WXIA 4ARIA 4JOIA 1XLPA 5BMIA 1UAPA 3V05A 5AZFA 1TR5A 4APVA 2MEKA 4ICVA 3VTUA 1VMCA 1LUZA 4MHEA 3IAYA 2B2YC 3TZDA 1WMHB 4FXKC 4MZ9A 1A70A 4IALA 4CDFC 4IOAA 4GNXA 4DAYA 3KF6B 1NE3A 1EUJA 2PPHA 4YTNB 1VQJA 3PIP3 5BO4B 2C7HA 4LFAL 3WWVA 2IBIB 3S2AA 2MGSA 3PZDA 4IG7B 4A3IG 5M5WB 2MBBB 3NP8A 3TN2A 4GOCA 3IT6B 1XNQL 2KECA 1K8OA 2YU9B 2EKIA 4R4OA 4ABNA 3QA8A 1TIID 2MP2A 2XNAC 2LGXA 1ZDXA 4RHRA 1PYWD 2BW2A 2MJ8A 3PIO3 4NAWB 1E2VA 1II3A 4JVZA 4A3DG 3JSVB 1PH7A 3MWYW 4OZBA 2CQOA 1JORA 2L11A 4CBVA 3MHSD 4YTPB 3HM6X 1EWHA 4IUMB 2XK5A 3S2DH 1HA6A 3VFKA 4JG2A 1NR4A 4B3MQ 2M4NA 2Z1CA 1V2YA 4C3IB 2F4VQ 2KTRB 2QIEB 1GHJA 4PYUA 1HR0W 4U68A 1UEAB 1WSPA 4LJOB 3RZDH 2PQEA 1U5KA 4ODGA 2KHWB 3DQVA 4HKZE 1E8ZA 1GJXA 2MHJA 4FHJA 2F0DA 2KFKB 1X65A 1EYCA 2MHVA 2CQAA 3NUCA 4BA2I 1TXYA 4M01A 4US8A 1HUNA 4UY8C 1DXMA 4OGQC 4IFDG 4DV6L 1JRUA 5GAHC 5IP9H 1XYIA 4F88A 1PQSA 4FJZA 1ONLA 3HOUH 2H89B 4GU2A 3K81C 3I90A 3CP0A 4JI8L 1E8XA 1MVKA 3SK4A 2MNAA 1P7EA 1XD3B 3APCA 2JA7G 3RUIB 4P75A 3BZDB 2KAJA 2WXLA 1J6QA 1Y1WG 3HOXB 1F2ZA 4II3B 1FGUA 1GD7A 4ZYNA 1PGXA 4LNQA 5L83A 2B8FA 1HTQA 2M9VA 2K52A 3AE1B 4GSWA 1WTWA 3V62A 2IO2B 4DWFA 2NUCA 3QJZA 1T0QC 3H94A 3R7RA 5JEAG 4C80A 5M5XB 2QDFA 2LMCB 2K6AA 4S17A 3PSEB 4AS1A 4DKAC 3U4ZA 2X69A 1DZ1A 1ESRA 3UDFA 1C4CA 2BS2B 5IP7G 4FF3A 1RIPA 3G6JB 4LK1C 3UQAA 3HOZG 3CKIB 3EVQA 2YU9H 3DOWA 2IGDA 1H8CA 5H1SE 1WX7A 2KLCA 4WAFA 4LAAA 1IHZA 2OQ0A 3AEAB 4OVUA 1A2TA 3T9LA 1WCMB 1GO3E 3MC0B 5HFYA 4IZ8A 3AMUA 2B3AA 1Q7YC 1R4MI 3E0JA 1N60A 5CV5A 3W1BA 4JPSA 4JBWA 4KHVA 2NN6I 4ZUJA 4NQKE 1IBMQ 3QCAA 4EFOA 2FMMA 1XPRA 3EUB2 4K1RB 4KSLC 1QCBD 4C1NI 4C3IH 4BZAA 3ENEA 3Q3JA 1WGRA 2BWES 1K0RA 3QWZB 3I4NG 4IO9A 4KN7C 4OVVA 1OO9B 3DHIC 4L23A 1QNKA 1GC7A 2KC2A 1JQYD 2VQFL 1HEZE 3NK9A 3MXNB 2BA0A 1HNXQ 2B39A 3M7GA 1V1OA 3MTSA 4B08A 1YJIA 2B2YA 2KMCA 1H9SA 4R4IA 4DR6L 5BMHA 4P1BC 2AMCB 1AWDA 2WDQB 2JA7B 1J8CA 4R3DA 4DUYL 2EIFA 3J81L 2JX5A 4OXPA 3A8JE 3OHXC 4N8X1 2DGYA 3HOXH 1HH2P 4JI0Q 3NZ3A 3K5NA 3QQ8B 3PRPB 3M63B 3ND8A 2LJIA 4BKSD 4DQOC 4V0BA 2B2VC 1MSGA 2A4ZA 3AE3B 2DENB 3NWTA 3VR3A 1Y14B 1CFMA 4IPDA 1IYJB 1BT0A 1GUNA 4TQUS 4DDID 1OEYA 1TWCB 4LF9Q 1JWAD 2AQ1B 4DV5Q 4I65A 4JCVE 3ZIMA 4A3DH 1X32A 2AQ2B 4K0KQ 1SNDA 4LFCL 4JBMA 1WYGA 5LMNL 2RSNA 2E2IH 3OIQA 1RKNA 3PV1A 4POGA 2PW5A 2SEBD 2EJGC 1TBEA 1DD2A 2EMSA 4K5VA 2WXKA 2RKSA 1MHXA 4MGYE 2ZTCA 3CHBD 3KYDD 2NVUI 1CA6A 4MJSB 1L4DB 4XDXA 1CQVA 4A75A 4ZYSA 1D2BA 3KQ4A 2DWQA 1H9KA 4GXBA 3UIPB 1UELA 3OOCA 1VQFA 1NR2A 2EDGA 2H1EA 4DAVA 4P72A 3ABVB 2NVYB 2I5HA 4DK6C 1TS4A 3I57A 1Z7TA 4IFDH 2Y0SE 3IFDA 5E1FA 4BFRA 2B2UC 4C3JB 1BQQT 5E4XA 1QVGA 3AE9B 3Q8BA 3DPDA 3FC4A 3M4QA 2UUAQ 1NCVA 3KDFA 1PH3A 1K8MA 1OEYJ 3K7UC 2JA7H 2LXAA 5LLIA 4FNFA 2NTSA 1Y1WH 1BBUA 1TQOA 4CKEA 4DAMA 4GKJL 1Q8KA 4WAAA 1X3FA 3LDZE 4C4VA 1CZGA 4KGRA 1JWBD 3TEYA 4XTCS 2Z6KC 1KNAA 1VLBA 4FO2A 5T1IA 5E6OA 5EDSA 2F0PA 5BN5A 5JEAH 4XGAB 2F52A 4FDBA 1NI2A 4TQ1A 1M1KC 3DVNU 4GKKQ 3V61A 5GADC 3DWPA 5M3FG 1SN8A 1X3PA 1M90C 5IP7H 4J6IA 1K3BC 3HOZH 1YQ3B 4UP9A 5C4JB 4OONA 1K0SA 1GJZA 3W5OA 1TWCH 3DWMA 4PK1A 4JV5L 2IX0A 4XZ4A 4A3BB 1ILPA 2B2WC 3Q3OC 1SE8A 2V3NA 2JA6B 1UH6A 1FYCA 3NEMA 1S4ZA 2A69D 1BKBA 3L17A 1JR0D 5D14A 1WZ0A 2GI9A 3GE8C 3HRDD 1AN8A 2KHJA 1R9TB 5L95C 2NTTA 3KF8A 1J5EL 3MC9A 4WJQA 3A9JA 1V86A 1EY0A 3MVVA 2Q2UA 4DV1L 1GHKA 1EY8A 1OGWA 2HJ8A 3D8GA 3I4NH 5JVG3 3P75A 4JI5L 1DONA 4G50A 4S0RA 3TEXA 3EJIA 1SROA 2RMMA 2MSED 2QC8A 1T0RC 3MAQA 4HKQA 1ET6A 1NNXA 3H7SA 2IZVB 1X3GA 3CC2A 4C3JH 5GQOA 1VS0A 2FIFA 3K58A 1R4NB 1TKYA 3CMMB 3A4RA 5AJ3L 4L2YA 2Y3AA 3DWQA 1ASYA 4OX9L 3U2SC 3TL5A 2B2VA 2OXPA 2KD0A 2XEWA 5J3BA 5I9OA 1YN4A 3A5ZB 2PMZE 1TT5B 2AKWB 1XEEA 2NVXH 5KYIA 4PZ6A 5G5HA 1N34L 2Z4HA 4DR3L 1WFQA 3PHXB 1D4BA 1E1OA 3E6ZX 3K5MA 4BXXH 2VS1A 1AP0A 2GVBA 3VA5A 4DPGA 1YBYA 1TY0A 2SDFA 4FJYA 1WF9A 2RDBC 4IFDJ 4HSVA 3S1RB 4ZKCB 2WP8J 1J8IA 4WFN3 4DUZL 1SJED 2KENA 3AE2B 2VH1A 4HDOA 2GVAA 3D6CA 5C4JH 3H1UA 2ZM6Q 1HZAA 1SF0A 1JALA 3H9DA 3Q6SA 1PFBA 4QGUA 2KHSA 3IAS1 4JYAL 1F9RA 2DZMA 4RM8A 5C4ZA 3N3KB 1JE5A 1A2UA 3J80c 5IAAC 1XLNA 1MBYA 1R9TH 1BMLC 2O6VA 1GB1A 2B2UA 1WRDB 1MIUA 2ZXOA 3FHWA 1IZ6A 3HKZG 3CCUA 2HHHQ 3PO2G 2X8XX 3D32A 3CSTA 3U30A 4XXEA 4LF5L 3TP5A 4IUQA 3VAWA 3VUXA 4JI2Q 1FNUA 3T53B 3U58A 5D7GA 1QILA 1LYLA 3CF6E 1U4AA 2K4KA 3LJ3A 5FLXc 5CORA 1MG8A 1ET9A 2Z6KA 3MFYA 2ZEQA 3ZNHB 5EJWA 1IBLL 1SE4A 5CBEE 5IYCG 2NB0A 3L08A 1A15A 4DV7L 3STBD 2KACA 3TCAA 2LGYA 1PDXA 4IPGA 2IJ0A 2EYHA 2F0VA 4G57A 1O7IA 2JA5B 1EQRA 1EY9A 4QQBX 2VRRB 2WYQA 2JZZA 4BKSA 2CVRA 5C5LA 1IPGA 2BH8A 4LUOA 5M3FH 2F0NA 1EO6A 3IAM1 1ASZA 1SMYD 2UU7A 5EKIA 1TWGB 1GNUA 1MSHA 1ACCA 1F0ZA 2QCPX 1GB4A 1WD1A 2MP1A 1E5WA 4DR1Q 4B3TL 1AE3A 5KNDA 3SR1A 1ZXHA 2Z4IA 4IUPA 2ZJDA 1I4QA 4RFBA 1YQBA 4WRDA 4NXNL 1FFVA 4HSPA 2BT6A 4BY7B 1PHJA 4NXML 1NJIC 1UZXB 1WGKA 4XT3B 2MO1A 5DLQE 2IX1A 2SAKA 1QF6A 4WIPA 3CD6A 4DV4L 2UUBQ 1L2NA 2Z8LA 4RKBA 1HNZL 1MHWC 1LTLA 1R4PB 1IL2A 1L5PA 5BN3A 4I6NB 3HOWB 5C44G 2O4XA 1XMOL 1PFMA 2KWVB 1PRTF 4CJ1B 2A6HC 4OL7A 5KRUA 2WXPA 2IGGA 4JI3L 2YEPB 4N9PA 1MG4A 2MJEA 1TS5A 1P3QU 2JY6A 3EBEA 3EGRA 3NVZA 2KLGA 3VTWA 5MPOA 1QLBB 3JAML 4KHZA 1PH2A 4CHTB 2ID0A 1JB7A 5JHBA 2D07B 1RWSA 1WE7A 4B6WA 2R7FA 5LL6X 1Q10A 4EUTA 2KK8A 1WI0A 2MBEA 3TJPA 3S16B 2HCCA 1I4PA 4O1NA 2WKCA 1F9QA 2CU1A 1LTGD 4PMBA 1LABA 2JA5H 3UF8A 2C7MB 3D4DA 3TEHB 3H8HA 2J4XA 3IKJA 2DJFC 3K9OB 1AZPA 3CQZH 2O2LD 1PGAA 1PRTC 3N52A 2QEXA 1TWGH 5ELCA 3STBC 1TY2A 5HY6A 3OTOL 2N9LA 3VVWB 1UUPA 1U4PA 2L52A 3AEDB 3BIID 4BWGB 2K9XA 5C0XH 4WJNA 2DNCA 1QZEA 1VCIA 2B29A 2EXZA 2KWUB 1FFUA 3M9BA 4KHPL 3P1MA 1BCPB 3RLOA 3HUIA 4BY7H 4XDDA 2DJGC 3VYSA 4X65L 1SMYC 3KFUA 2C5LC 4DXGA 2D11A 3T1YQ 4AYBE 5CHFA 2CW0D 3JC66 3DBLB 1KH0A 2N3SA 3B0AA 2O5IC 1N33Q 4PS3A 1QWYA 1E2ZA 1STYA 3PUVA 1MPEA 3HOWH 2WXHA 1KRSA 3RD2A 1PZID 3LX0A 4DK1A 1TKGA 3DLLA 4LUVA 1VQIA 1LM0A 1V1PB 1XNRL 4MH0E 4PMWA 3RCZA 1B1ZA 5IO9A 3ITPA 4P71A 1LT6D 4ME5A 1WM3A 1UE6A 2ZPYA 4L5SA 4R4CA 1E2WA 3R2IA 4G7HC 3CIRB 1YNJD 4CDCC 1SIJA 4RF0A 5IYCH 4AYBB 4B9XA 2K5WA 3VR4A 2RA4A 3EA6A 4LFAQ 4HMIA 4TKNA 1PTOF 1EYGA 1PH5A 2R93G 1ICWA 1XNQQ 1E1TA 4BVUC 3S16H 2ZTDA 1VQBA 3MXPA 4LF4L 1SR3A 2LZ6A 4KV2A 1BF4A 2WDVB 5IGFA 2JE6I 1Q1EA 2R61A 4EZLA 3I9V1 3ZJYC 1U4RA 4J15A 4FYDA 3KYCD 4GDLA 1PH6A 4ZK9B 1IUEA 4GGQA 5DNFA 4FXCA 3DVNV 1EF1A 1JB3A 1ZKOA 3WALA 3RZFA 3Q24A 3L0OA 4QAYA 4ARCA 4P2CB 2C5CA 1FD6A 3SK8A 1V5OA 4URKA 5EQ0A 1DM0B 4W9IA 1PTOC 3S17H 3AE4B 1DOYA 1EY4A 2FHTA 1YOVB 2L3ZA 4ZRZA 3AH7A 5TSSA 5C23A 5IY0A 4YCWA 1IL8A 2MO0A 1DOLA 5C44H 1J9OA 2EKEC 1WXMA 1EWCA 4JI8Q 4P7IA 2KN4A 4ZUIA 3ICEA 3P4QB 3FPUB 4M02A 1WD0A 1WX8A 1YI2A 3AYHB 3PO3B 2H4OA 1HCZA 1N36L 2KCMA 5A2QL 1WJJA 1PV4A 4KZCA 3VR8B 2NBFA 4OO1H 4MM3B 2CW0C 5KIXA 1FMAD 3CXCA 4IUVA 5HKHA 1MI2A 3G71A 3N1ZC 2WKDA 1PZJD 2LSSA 2RCFA 1LQBA 2BS3B 5AZHA 3ER0A 1XCQL 3CSFA 1JWMD 1W6KA 2K05A 3NELA 4M8AA 1DGJA 5CHWA 4A8XC 1C9OA 2HTHA 3NPPA 1PH9A 4B3SQ 4LF8L 1G291 4A3LH 1J0GA 4LDTB 2L4NA 3S15B 4WQMA 4G3XB 1VJKA 1FJGL 3ETRA 1YNJC 3CCMA 4RA8A 1RM6C 3VUYA 1GOZA 5EPLA 4NP5A 2F3WA 1RFKA 4JLCA 1YHQA 2JRHA 1CKOA 5CV7A 2CR5A 1S5CD 1F52A 4IPHA 2DYOA 4CDDC 1TWHH 3KYHC 1QQRA 2KNBA 2IYDB 1I4GA 4B3RL 1CKNB 3KJPA 1I94L 4F8CB 3TEWA 2RD0A 2J0MA 3C8YA 1PH1A 1NUCA 1QZGA 1IXRA 1TS2A 3J80i 2L76A 4LNFA 4OIKA 4A3MB 3I4LA 5T1GA 2ZPNA 5L37A 1BDOA 1OFFA 1JC7A 3U9OA 4W9DA 1HA5A 4RG1A 3MJ5A 4DR6Q 5GROA 3R8BA 2L1AA 2DAJA 3NVVA 5FO7B 4U673 2RVLA 2JQOA 3BDLA 3EIVA 3EQLC 2IW3A 4GNXB 1JT8A 4DAYB 3HHMA 1NVID 2I0QA 4HJGE 1DOXA 4DUYQ 1DOKA 3B2FA 5LXIB 4USAA 3TBIB 1D5MC 3M3YB 2NS5A 1Q81C 2EYFA 1DOMA 3PV0A 4EVOA 4A3KG 1T0YA 2V4IB 1FR3A 2BE5C 2NVTH 2MP2B 3A4SC 3C1FA 2LGDA 3ZUNA 1V8QA 2D5DA 1Y8OB 4ZQ3A 2CHBD 5C0XI 1I3QH 2R92G 2FUHB 4HJ8A 4GDKB 2D5GA 3A7AB 3JAMc 4BKTA 4LJZC 2R93H 1CUKA 1QJOA 5C4XG 1X9NA 3U4VA 4LFBQ 1WJ4A 2WV6D 2WB1E 4KY7A 1EIHA 3KWVA 2XK5B 4DR7Q 4A3JG 1L1OC 1L0XB 1PH8A 1JMLA 3ZLZA 1BBWA 1U4LA 2HUGA 3H0GG 2KJHB 3S15H 3PSIA 1V5TA 3OG5A 3X23A 5LMNQ 1PA6A 3I56A 3ZVVA 3G6EA 3LWUA 2MBOA 1SE2A 1CHPD 2GBKA 2KDMA 4IKGA 3HOYB 1V9PA 5E4WC 4W9GA 4GLXA 2FCQA 3RZOH 5G2NA 2NZHA 1CZWA 1UGJA 3ZTDA 3S2HH 4DXAB 5IWAL 3NENA 3B9JA 4KK7A 4POFA 3TQYA 4DV2L 3NVWA 4W9JA 3WCQA 4A3MH 1X3EA 3RD4A 4MEMA 4FBJB 1RYJA 3QOJA 4OZCA 1FL0A 4JE3B 2E75C 5ISRA 1V97A 5E6NA 3W1SC 1K8AC 4R9WA 2G4DB 1SGHA 2K32A 3MFGA 2UYZB 1WJ6A 4OHJA 3PIOA 2PMVA 5GXGB 4GKJQ 2PVOD 2WXMA 2RHSB 3CMAA 2NR2A 1ZUD2 3M3YH 2K5PA 2BTEA 3D4WA 4AP4C 3MZ5A 4QB4A 2KUMA 4YHHL 1T0SC 5C3EG 2LFIA 5EBDA 4RMAA 4EQ5A 3S2DB 1DCZA 1V9JA 2QSDA 3D6WA 1WXVA 1HTOA 3CC7A 3AU4A 1RL2A 1FGBD 4HN7A 1WYDA 1YVCA 4X66Q 3AB9A 4K7WA 3RZDB 3PLVA 1OTCA 2WU2B 5JXVA 2M2LA 2FE8A 3LB8C 3ZO5B 4ASWC 5J17A 4JV5Q 3VR9B 2Y5CA 1STAA 2V1CC 2D3GA 1LV9A 2Z9HA 1W2BA 2FCSA 3GTKH 4NY0A 1SXTA 4FP5D 1EIYB 3DBLI 1SNMA 3HGBA 3J80E 4KY6A 4DK3C 3HOUB 3RN5A 4RH6A 3E9SA 3VH4B 4EZJA 1HR0L 3FRPB 1J5EQ 4K2KA 4MT5A 1LTTD 5IGDA 3J81j 1DOIA 1NBFC 2KANA 4DV1Q 1CA5A 2WQYB 1K9MC 1H9SB 4PMCA 3RR5A 4JI4L 1STEA 3NBHA 1S72A 4OO1I 4JI5Q 5CV9A 4HMJA 4Q0FA 5DAUA 5EE0A 3N6RA 4NPNA 3T1HQ 5FLXE 2L1BA 3ZJVA 3AU7A 5A35A 2DLBA 4A3GG 2LXCA 4A93G 4OW0A 1KDAA 3MP9A 1TWAH 4RCNA 4KGSA 3K0XA 1Y8NB 4BBSG 1PLFA 5AJ3Q 4HPPA 2N7JA 2CJNA 4OX9Q 1RD9D 2FMCA 3HK0A 1XT9B 1SMXA 3JVZX 3I4OA 2I07B 1YJJA 3WAMA 5BYQA 1WTVA 2AQ3B 2EYOA 1Y8PB 4A3KH 1N34Q 4DR3Q 3VHTC 1DYQA 1L1OA 2VY3A 1J7CA 4EE2A 2V9HA 3AQQA 2KJRA 4KKIA 1W3SA 1WTRA 4ANUA 4KVGB 1EY5A 2PYKA 5HURA 3RLNA 2R92H 2VZKB 4F8MA 2W54A 3R66C 2PI2A 1BO0A 3GV3A 2IGHA 4W9KA 5C4XH 4DV3L 2LASA 3CCVA 4DUZQ 1YJ9A 1O78A 1HFGA 1SAPA 4A3JH 2BS4B 4V190 1QOHA 2KTFA 2FAZA 3H0GH 1WTOA 1SNCA 2EZVA 1FXTB 2DBYA 2JXXA 4WH4A 1XTDA 4LMQD 5CGKA 2N1VA 2F0WA 3VR2A 5IGBA 3GTOH 4JYAQ 4YWKA 2JXTA 2F0IA 4X57B 3SR6A 2AL3A 2WINB 4ZHOA 4A3PA 2VUMB 4LF7L 5K36H 4DAPA 3A1QB 1N32L 5I4DA 2Z0SA 4K14A 4BY1G 4IC7B 3R2TA 1AFPA 2EQSA 3EC8A 2JYEA 1EY6A 4LF5Q 4DK0A 2MW5A 3W1SA 1WZ3A 4IJHA 2E8GA 3O65B 4QY7A 1P0RA 3KDFB 3AULA 2NCNA 2JA9A 2KWCA 3Q2AC 2NZ1D 4F1SA 4R4QA 4A3IB 1D5ZC 2VH2A 4ZOHC 3AEFB 1KDBA 4C4VB 3K5LA 4R1JA 5EGTA
chains in the Genus database with same CATH topology
1A3TA 1X3QA 2PO4A 1EFID 3BWUD 3H3VC 1STNA 1A6XA 2QILA 5CV4A 4CKCA 2K1BA 3V3XA 1G2SA 1HUMA 4A3DB 4LLGM 2E2IB 2JQRB 4P6VF 1P7FA 4N59A 1XLQA 1ZP0B 5G3LD 4TSSA 2L5TA 3A55A 1RJTA 2PNRC 1LO5D 2EYPA 2HQEA 2F0MA 4J6HA 1KRHA 1KF6B 4IUTA 3VR6A 4KY5A 1OXUA 1QKZA 4D2KA 1ZOYB 4LK0M 1L0YB 3KK7A 1Y1WB 3SEBA 1EM7A 1BXTA 2MJDA 1E7PB 1VZ6A 2MPMA 1NENB 2E6XA 4RHSA 1S5ED 5FO8B 4YWGG 1Q3LA 1IGDA 4N6EB 4J8QA 4DNRB 4HAEA 4ZLTF 1C76A 4QF4A 3QJYA 5AFWA 1K50A 5G3LF 4EQPA 3HOZB 3NBIA 2PLPA 4TQ0A 2J7ZA 1LLRD 3GB1A 2AUKA 1IW7D 3BYYB 2RDFA 1OXVA 3T16A 2JEAI 4RCOA 3OWEB 5I6YA 2F0UA 1T3QA 3J9CA 5EE9A 4CJ0B 1PXUA 1WWTA 3I4NB 3CU7A 1HZ6A 3HG9A 5I2XA 1TS3A 3AE8B 1Q1BA 3D4RA 1CK1A 2QKIC 1SSOA 2F0TA 1WVLA 3I3CA 3L7ZC 3BVMA 5EBCA 4KKUA 2F0HA 1OQRA 2BDOA 3AEBB 5T8IA 3HEJA 4A9AA 2NVXB 5F2DA 1F2RC 1LT5D 2K5QA 1VMPA 5J22A 2LHEA 3GTJB 3J7AF 3T4AC 3LNNA 3K57A 1TU2B 4ILWA 3KWLA 4XQJA 2E3TA 2N55A 2FUG1 2HDMA 3S1MB 3AV8A 2LMCA 3WOFA 2DY8A 3ERQA 5HGTA 3X3NA 1KLGD 4DA2A 3AE6B 3RUZA 1FO4A 2DN8A 4MH8A 1IW7C 4A90A 2LGIA 3S9WA 4C1NK 3GTMB 1VRAB 4OZAA 3MHBA 3T51B 1B9NA 1Z6HA 3Q69A 1B4OA 1RTOA 5LHY1 4CKBA 2Y5PA 3DHQA 1M8AA 2IPKD 2JWUA 1PDQA 2EYMA 4TKOB 2JYTA 4WORA 5G5GA 4K6LA 1MI0A 5M3FB 4TMAB 4H2AA 1XTCD 2JP1A 4DU9A 1VZ8A 1SSNA 5JOBA 2A6HD 4KKSA 1NSNS 1OXTA 3PUYA 3NTIA 1D6EC 5D65A 3T56B 2L0CA 5CBAE 1F9SA 5C6AA 1GUTA 4I7ZC 2AUJD 3AEGB 4MIUA 2K33A 4DF7A 2KQ4X 3D3RA 1WTQA 3O13A 5COYA 1C79A 5AUKA 1NAPA 3HVZA 2LHDA 1EWYC 1PRTD 1GXDC 1WTPA 1ZXIA 2VB3X 5CC4A 4AQ7A 2BOSA 5ELBA 4PV1C 3IXSA 2L12A 2F0QA 3CQZB 1HQRD 1Q8IA 5EE1A 3TZUA 1L6VA 4GDLB 4UDUC 4C3HG 1G91A 4IFDI 5J39A 3Q8AA 3I73A 1HPCA 5CYUA 4FXDA 2JU6X 3ZJTA 4XQNA 2AWNA 2A6ED 2WLBA 3LXFA 1MHHE 5FK9C 2XSCA 2OEDA 3PO2B 4G4KA 3HKZB 3HS0C 2KEDA 2DNEA 2AWOA 4FXGC 2KCNA 2PIAA 3W3AA 3FPPA 3TP8A 1RCVD 4CQNA 4HRSA 5CV8A 3GP7A 2VB2X 1UWXA 3PZ7A 3FVQA 1D1KA 5EKLA 4WWMA 3A8KE 2JEBI 3I70A 2KQ3A 1JROA 2RBMA 1I4HA 1ESFA 4X3UA 1PRTB 2W82A 5IIFA 1EQVA 3CWIA 5EPJA 1PTOD 2XRSD 1L6UA 1E10A 1K53A 1B50A 1TZOA 3K6OA 3P7JA 2F03A 4K2LA 3NS1A 3OMGA 2LFNA 1E0ZA 3SK6A 2Q8TA 3FAHA 3DUZA 3L3OC 3S17B 2BCOA 3NVYA 1EL0A 5HG2A 1CQFA 5DM63 5C44B 3BVZA 2L32A 2ENBA 4H0LC 3VYTA 1KABA 3R93A 5AUIA 3GO5A 3VR5A 3RFZB 2QEJC 3M85A 2A6EC 4CGYB 5JJZA 3M4OB 1O7YA 2XIWA 1YNNC 3C2PA 2I2YA 2BYTA 3ONAB 1JQ4A 1U9RA 1W6JA 4PT5A 2LY7A 1HXYD 2K3UA 3MXGA 1AZQA 1JOKA 1LTBD 2PKOA 3QO2A 3RMHA 5CMDA 2F3VA 4NJCA 3TP7A 3NSWA 5KNCA 1SB3C 1CHQD 4DGZA 2BBCA 1EYDA 2WNMA 4H44C 1TWHB 2ZXRA 2A74C 4K8IA 1JWSD 1FM0D 2IL8A 2ACZB 2NMQA 1PTOB 5C3XA 1XLOA 2EY6A 2BE5D 2IWHA 1A3UA 1EU4A 4KGTA 3U52E 1STBA 5C4HA 5IT9E 4QCLA 3BS1A 1SDFA 2BA1A 3E5SA 2V3PA 1PFDA 3B2GA 1M4VA 4IURA 4P16A 2NN6G 1N5WA 3SFDB 3AN1A 3W9CB 1EU3A 3G7LA 2F0KA 2NVTB 2ZT9C 2OT2A 4RF1A 2M0AA 4XYOA 3W5VB 3VA7A 1I3QB 1SYBA 2R93B 2QDBA 3DWAA 5BMGA 5E6JA 1NEKB 1TJEA 3FILA 2J0TD 1STGA 1D1IA 2MH7A 3V96A 1FCCC 1L4ZB 3RZOB 4C56C 5M3MB 3S2HB 1EQTA 2XWBB 2ON8A 1PTOH 1PUTA 2JSVX 2VNUD 2QMTA 3IT4B 2E74C 2ZXPA 1ZYRC 5FKAC 4R8NA 3QWNA 3GV6A 4GZYC 2PCFB 1XWEA 4UAIA 1IGCA 2R3ZA 2W3SA 3PUXA 1YQ4B 4KV6A 5C5MA 3KLSX 2LUMA 2H88B 3K59A 1C8CA 3BVGA 4QUFA 5IOCA 1ZXTA 3SK5A 3DEOA 3VYRA 4NZLB 2Q5WD 1C4PA 4ULLA 4RGTA 3GTKB 2INPE 1QG7A 4KJOA 4Q5VA 1SYDA 1B3AA 1QOGA 1T5XD 1QOAA 3MEHA 1JRPA 4L8JA 3GS2A 1C4AA 1TWAB 4XWTA 1O80A 2QJLA 4M0WA 3BYTB 4OIJA 2KMMA 1Y69U 2D2CC 2TMPA 4A3KB 5CR3A 3IFTA 2Q8RE 1HTLD 1QB5D 2EY1A 4C7YA 4ZHPA 2R92B 2E2HB 1SYCA 5C4XB 1E9MA 1PGBA 1NYQA 4A3JB 3H0GB 1YN5A 5C3JB 4BS9A 3BG3A 1E6EB 2PZWA 1SFOB 2M56B 1ZPSA 3GTOB 2BB6A 2WU5B 4ITKA 2F0JA 1EY7A 3C1EA 2L83A 3PO0A 4OVZA 3P1HA 3VRAB 2F0FA 1YN3A 3OSOA 4XWWA 4US9A 1B53A 4C3IG 2K03A 1Y56A 2W3RA 2OEOA 4ZRPA 1F77A 3F2UA 2W55A 3HP3A 1E0BA 2IX3A 4J3OD 4TRDA 3OW7A 3SVMA 3OWFA 1LT3D 2WXOA 3J81E 5C3EB 4YIJA 3T3OA 4XE0A 3I8ZA 3DM1A 1ZE3D 3SFEB 4B0EA 4L6TB 2GA4B 2R6GA 3NWSA 1HZ5A 2WDRB 3IL8A 1WTXA 4YTMB 4YSYB 2JSOA 1YNTE 1FCLA 2X6LA 2VXWA 3NRZA 1IBXA 1PZKD 1VDZA 5BN4A 4KTAA 1N5XA 1SYFA 3MXUA 2E2JB 1B44D 3AECB 4MACA 1VDVA 4KI0A 1N61A 1FD7D 1LT4D 4KKTA 3BK1A 1CJEA 3I72A 1MD2D 4EQOA 1XX8A 2J53A 2F1MA 3ND9A 2HCIA 4A3GB 1ZEQX 5LL6S 4A93B 2WXJA 3HRZC 3MA2B 1B9RA 5BYRA 4BBSB 3SE0A 4K6DA 4RNAA 2KVMA 1S5BD 5JAVA 1SJHD 2EPBA 4DN4M 1V43A 1IKMA 5KNBA 2AX5A 2CJOA 1C48A 3VYUA 3EFXD 2N9KA 1PFNA 5C3WA 3R3OA 3C3LA 2G9DA 4YXDB 2EE1A 1R4QB 3OMCA 3U4EG 3J80L 4JWSC 4BA1I 3URYA 2BDNA 2RDHA 5M5YB 2KOLA 4BY1B 3KBXA 1I7HA 3LYYA 5FLXL 2I46A 5ELEA 1HTPA 5IODA 2WS3B 4C3JG 4NKLA 1XXGA 2B2TC 1BUIC 3ZYYX 2ZW0A 4QMGA 3P4RB 2WXNA 1PMRA 2WACA 1TYGB 2EVBA 4JX1C 3KLSA 5IGEA 3NHHA 2A5HA 2K28A 2QF7A 2SNSA 4PNYA 5C2TB 1VR9A 4YT0B 3BDCA 1R7SA 2G1EA 2MJ3A 1NI3A 4FF4A 3M7NA 2M00A 1RHPA 3RPFC 5ELDA 4XIGS 5NUCA 3KUPA 1EZ8A 5CV6A 3Q8CA 1HFNA 1ENFA 2R7ZB 2EOTA 4KD4A 3C46A 1K52A 3P4SB 1I4RA 3X3MA 2PW7A 2WIIB 4MN3A 4JWUC 4X3TA 2I38A 2ZW1A 3KBGA 4H13C 2YYZA 1TT2A 4H7BA 5IGGA 3L9AX 3I91A 4ZAIA 1KTKA 1FNWA 3TSSA 1QT9A 3HZXA 3V2TA 1FIQA 1F2YA 1SE3A 3TP6A 1H9JA 3P4PB 3T13A 2EYJA 3OIPA 3NTHA 3NXWA 5EE3A 5HI1A 2PW9A 1N62A 4IN3A 2Y0SB 3DXJC 3PZ8A 3W2DA 2PZTA 5FO9B 4XDCA 5LNK1 2BB5A 3M4YA 3HOVB 1STHA 1CTMA 1K83B 2EY2A 5D3DA 2PVGC 3A56A 1HQMC 5J1ZA 2ONQA 1TWFB 3MXNA 2B2TA 1EOTA 2NVQB 5HHDG 2K04A 3UI2A 4Z9CB 3TUOA 2FBWB 2K0PA 2F0SA 1FXAA 2KWDA 2L55A 2K5DA 1GUSA 3JAME 2K22A 1RTNA 1F2LA 2FJ2A 3GTLB 3GTQB 3A7LA 4R8IA 1LTAD 1Z47A 1C9FA 1B9MA 2F0OA 4IQZA 1BNZA 4FF1A 2O5JC 5K5PA 3U7ZA 4KD3A 1KFYB 3Q8EA 2LS01 2JZPA 4L63B 2PMZB 2EYLA 5C0XG 2WXQA 3UI3A 4HCSA 3PMFA 1UNSA 2JXMB 4ZRQA 4RAUC 3NQIA 4KJNA 1C77A 1O7LA 1B2TA 2A73B 5JEAJ 4RKLA 2EY5A 2WXRA 4A3FB 2KJXA 2JYOA 1XF5L 1CI3M 1I50B 1WXQA 4B0MA 5I9PA 2A69C 3AEEB 3J7YW 1Q90A 3K5OA 1VF5C 4F7XA 3ZQ4A 2DYMA 4HR7B 3ZJUA 1A3VA 4E6IA 5DEHA 4HEA1 4KX6B 3Q0AA 1JICA 4EGVA 3S1NB 2FFKB 1TKEA 1BOSA 2B8GA 3NTKA 3GQBA 3A54A 5I6WA 1GUGA 2SNMA 2A68D 1YNND 1RODA 2B2WA 3DEPA 2C9OA 2MUYA 3D31A 2KEEA 4EQNA 2YEPF 1BCPD 5DM73 1HHVA 2ICIA 3AMZA 2HDEA 1EIGA 1KAAA 2NYZD 2FINB 2LKVA 3QB3A 5I2YA 1AW7A 5IGCA 1XO3A 2RSOA 1ILQA 1CZPA 4IUUA 4Q2JA 2F0LA 1BUVT 1IYUA 4A3EB 1SEBD 1JWUD 2GB1A 1JCKB 2D62A 1Q12A 1G8ZD 2Q8IB 3GTPB 1KDCA 2OF1A 4JK1C 3S1QB 3FILB 3Q8FA 4OO1G 1JE4A 5A2QE 4O42A 4C3HB 3WDNA 1U4MA 4RGNA 4CJ2C 3TDQA 2PZUA 2EJFC 1BCPF 1C4QA 4XQQA 1GUWA 4A6QA 3QOLA 2V0GA 5FR3A 1Y1VB 5FOBB 5JVH3 1WRIA 5D3IB 4M1UB 3E56A 1F2RI 4X3KA 3A8IE 3PUZA 1GAQB 3T3NA 3FMCA 4NW2A 1S5FD 1EYAA 1LTID 1KLUD 1ML0D 5KGUA 1UWMA 3K7AB 3VRBB 2A68C 4WJWA 4HROA 1JOOA 1S5DD 5JPMC 2TSSA 1IYVA 3KLRA 1BCPC 4XYQA 3S14B 4DXFA 3P20A 1MGSA 2HTME 3N9YC 1VF7A 4KKJA 1F9PA 3P42A 2D9UA 1FEHA 3TMEA 2LEKA 2EELA 4G7ZC 2JA8B 1YMHE 1QE6A 1ZYRD 2OHFA 2WXGA 2F0GA 5BYSA 1I4XA 1OXSC 4ID6A 3SXHA 2WAQB 4RGMA 4REZA 3J7AV 2WXFA 4HTHA 5EKKA 2J42A 4QUCA 2V4DA 2EJMA 4IUNA 1VZ7A 3CRKC 4N58A 2IT1A 4Y7NB 1CT1D 3FKIB 2M19A 3NUHB 3AE7B 1CM9A 4LTUA 1SNPA 3GD7A 2WP9B 2NWGA 2RPVA 1AYFA 4IOIE 1DJRD 1ENCA 1H9MA 2B76B 1T6BX 3EROA 2X6GA 1V8CA 2K01A 2K7VA 2KA7A 1AEXA 1N63A 4C7ZA 3L4PA 1D5XC 5KEEA 4XT1B 4IDIA 2RQXA 2F0EA 5C0XJ 4YSXB 1F2MA 1TKWB 1GPXA 2X38A 1TVXA 4NMZA 3AE5B 4C2MB 1G2TA 1FRDA 1EEID 3DMUA 1SBBB 2SOBA 1FXIA 1XCTL 4L1BA 1LTRD 1G6ZA 1GUOA 1ROEA 1OXXK 1LACA 1LTSD 5M9OA 1J7BA 2GRIA 4KMUC 3VQIA 3H91A 4NDXA 4F87A 3QG1A 4FF2A 1FRRA 1KNEA 2CU3A 1ENAA 3K0YA 3WOEA 1BBXC 3DWGC 2J52A 1V1PA 1ZDVA 3Q22A 3GTGB 4K5WA 3ZGZA 3NQTA 1T5EA 2XN9C 3I4MB 4KN4C 3AM9A 1J7AA 1BR9A 3CRLC 1OQQA 1L0VB 2E76C 2XVSA 2INNE 2HDLA 1NYRA 1SYGA 1EZ6A 4ZKBB 1FNVA 2KCCA 4QIWB 4DNTB 2B63B 4FVMA 1IBXB 4S3SA 3Q23A 1I6HB 3FDTA 4RWSC 3RLFA 3TEZA 5H92C 1C78A 3NE5B 3AB5A 3P63A 1H9RA 1SNQA 4K5XA 1O7ZA 4RGOS 4BBRB 5IT9L 4GLSC 2E2DC 3QIAA 1EEFD 4YSZB 2XWJB 1RF2D 5E3FA 1SYEA 5K36G 1QOBA 2RDGA 2NN6H 3H09A 2WB1B 3PUWA 5KYLA 1RDPD 3H6MA 4N9TA 2XRQD 1I6VC 5ELFA 3FEWX 4A55A 2ICEC 5H8YE 3LWEA 1JW9D 4NAMA 1QOFA 2IDYA 4G7OC 4X3SA 5EPKA 3MHZA 2VZKD 4HCEA 3BDOA 2N0SB 3SDZA 4PQXA 3OPOA 4J1MA 4B9WA 2DY7A 1IKLA 1K51A 3W5UB 4WURA 2PPBC 2G9HD 2PTLA 1SNOA 2F4IA 1JOQA 2N88A 4DFAA 4K8JA 1HRJA 4HEDA 3SHLA 3HVDA 1QNUA 3U9SA 2L9HA 3BK2A 5JPNC 4ARIA 2WXIA 1XLPA 5BMIA 1UAPA 3V05A 1TR5A 2MEKA 1VMCA 4MHEA 3IAYA 2B2YC 3TZDA 4FXKC 1A70A 4IALA 4DAYA 4YTNB 3PIP3 2MGSA 5M5WB 3NP8A 3TN2A 3IT6B 2KECA 1K8OA 2YU9B 2EKIA 4ABNA 1TIID 2XNAC 1ZDXA 4RHRA 1PYWD 2BW2A 2MJ8A 3PIO3 4NAWB 1E2VA 1II3A 4OZBA 3MWYW 1JORA 2L11A 4CBVA 4YTPB 1EWHA 1HA6A 1NR4A 2Z1CA 4C3IB 2QIEB 1GHJA 4U68A 1UEAB 1WSPA 2PQEA 4ODGA 1GJXA 2F0DA 2MHVA 1EYCA 4US8A 2CQAA 3NUCA 4BA2I 1HUNA 1DXMA 4OGQC 4IFDG 1XYIA 4F88A 1ONLA 2H89B 3I90A 1MVKA 3SK4A 1P7EA 3BZDB 2KAJA 2WXLA 3HOXB 1F2ZA 1PGXA 2B8FA 2M9VA 3AE1B 1WTWA 2NUCA 3H94A 4C80A 5JEAG 5M5XB 2LMCB 2K6AA 4AS1A 1DZ1A 2X69A 2BS2B 1ESRA 1C4CA 4FF3A 3G6JB 4LK1C 3CKIB 3EVQA 2IGDA 4WAFA 4LAAA 1IHZA 3AEAB 1A2TA 1WCMB 3MC0B 5HFYA 4IZ8A 3AMUA 3E0JA 1N60A 5CV5A 4JPSA 4JBWA 4KHVA 2NN6I 4ZUJA 2FMMA 3EUB2 1QCBD 4C1NI 4KN7C 1OO9B 4L23A 1QNKA 1JQYD 1HEZE 3NK9A 2BA0A 2B39A 3M7GA 1V1OA 3MTSA 4B08A 1YJIA 2B2YA 1H9SA 5BMHA 1AWDA 2WDQB 2JA7B 4R3DA 3J81L 2JX5A 3A8JE 3OHXC 3NZ3A 3K5NA 3ND8A 2LJIA 4DQOC 4V0BA 2B2VC 1MSGA 3AE3B 3NWTA 3VR3A 1CFMA 1GUNA 4TQUS 1TWCB 1JWAD 2AQ1B 4I65A 1X32A 2AQ2B 1SNDA 1WYGA 2RSNA 3OIQA 1RKNA 2PW5A 2SEBD 2EJGC 1DD2A 4K5VA 2WXKA 2RKSA 1MHXA 3CHBD 1CA6A 1L4DB 1CQVA 4ZYSA 1D2BA 3KQ4A 2DWQA 1H9KA 3OOCA 1NR2A 2EDGA 2H1EA 4DAVA 3ABVB 2NVYB 1TS4A 3I57A 1Z7TA 4IFDH 3IFDA 5E1FA 2B2UC 4C3JB 1BQQT 5E4XA 3AE9B 3Q8BA 3FC4A 1NCVA 1K8MA 4FNFA 2NTSA 4CKEA 1TQOA 1CZGA 4KGRA 1JWBD 3TEYA 4XTCS 1KNAA 1VLBA 4FO2A 5T1IA 2F0PA 5BN5A 5JEAH 4TQ1A 3DWPA 1X3PA 1YQ3B 5C4JB 3DWMA 2IX0A 4A3BB 1ILPA 2B2WC 2V3NA 2JA6B 1FYCA 1S4ZA 2A69D 1JR0D 5D14A 2GI9A 3HRDD 1AN8A 1R9TB 2NTTA 3KF8A 1EY0A 3MVVA 1GHKA 1EY8A 3D8GA 5JVG3 3P75A 1DONA 3TEXA 3EJIA 2RMMA 3MAQA 4HKQA 1ET6A 3K58A 1TKYA 4L2YA 2Y3AA 3DWQA 3U2SC 2B2VA 2OXPA 5I9OA 1YN4A 1XEEA 5KYIA 5G5HA 2Z4HA 1D4BA 3E6ZX 3K5MA 1AP0A 3VA5A 1TY0A 2SDFA 4IFDJ 4HSVA 3S1RB 4ZKCB 2WP8J 1J8IA 4WFN3 3AE2B 1SJED 3D6CA 1SF0A 1JALA 3Q6SA 1PFBA 3IAS1 2KHSA 1F9RA 5C4ZA 1A2UA 1XLNA 1MBYA 1BMLC 1GB1A 2B2UA 2ZXOA 4XXEA 3TP5A 4IUQA 1FNUA 3T53B 5D7GA 1QILA 5CORA 1ET9A 3MFYA 5EJWA 1SE4A 5CBEE 2NB0A 1A15A 2KACA 1PDXA 2IJ0A 2EYHA 2F0VA 4G57A 2JA5B 1EY9A 2CVRA 5C5LA 3IAM1 2F0NA 1SMYD 5EKIA 1TWGB 1MSHA 1ACCA 1F0ZA 2QCPX 1GB4A 1WD1A 2MP1A 5KNDA 3SR1A 1ZXHA 2Z4IA 4IUPA 1I4QA 4RFBA 4WRDA 1FFVA 4HSPA 2BT6A 4BY7B 1WGKA 4XT3B 2SAKA 2IX1A 1QF6A 4WIPA 2Z8LA 4RKBA 1L5PA 1R4PB 5BN3A 3HOWB 2O4XA 1PFMA 1PRTF 4CJ1B 2A6HC 4OL7A 5KRUA 2WXPA 2IGGA 2YEPB 4N9PA 2MJEA 1TS5A 3EGRA 3NVZA 5MPOA 1QLBB 3JAML 4KHZA 4CHTB 2ID0A 1RWSA 1Q10A 5LL6X 3S16B 2HCCA 1I4PA 4O1NA 2WKCA 1F9QA 1LTGD 4PMBA 1LABA 3D4DA 3H8HA 2J4XA 3IKJA 1AZPA 2O2LD 1PGAA 1PRTC 3N52A 5ELCA 2N9LA 1TY2A 1UUPA 1U4PA 2L52A 3AEDB 3BIID 4BWGB 2K9XA 5C0XH 2DNCA 1VCIA 2EXZA 1FFUA 3P1MA 1BCPB 3HUIA 4XDDA 3VYSA 1SMYC 4DXGA 2CW0D 1KH0A 2O5IC 1QWYA 1E2ZA 1STYA 3PUVA 1MPEA 2WXHA 1PZID 3LX0A 4DK1A 1TKGA 1V1PB 4PMWA 1B1ZA 3ITPA 1LT6D 4ME5A 1E2WA 3R2IA 4G7HC 3CIRB 1YNJD 4RF0A 1SIJA 4AYBB 4B9XA 2K5WA 3VR4A 2RA4A 3EA6A 4HMIA 1PTOF 1ICWA 3MXPA 1BF4A 2WDVB 5IGFA 2JE6I 1Q1EA 2R61A 3I9V1 1U4RA 4FYDA 4ZK9B 1IUEA 5DNFA 4FXCA 1JB3A 1ZKOA 3Q24A 4ARCA 4P2CB 2C5CA 1FD6A 3SK8A 5EQ0A 1DM0B 1PTOC 3AE4B 1DOYA 1EY4A 2FHTA 3AH7A 4ZRZA 5TSSA 1IL8A 1DOLA 1J9OA 1EWCA 2KN4A 4ZUIA 3P4QB 3FPUB 1WD0A 3PO3B 2H4OA 1HCZA 5A2QL 3VR8B 2NBFA 4OO1H 4MM3B 2CW0C 5KIXA 1FMAD 4IUVA 1MI2A 1PZJD 2WKDA 2BS3B 1XCQL 1JWMD 1W6KA 2K05A 4M8AA 1DGJA 4A8XC 3NPPA 1G291 2L4NA 3S15B 4WQMA 1VJKA 3ETRA 1YNJC 4RA8A 1RM6C 1GOZA 5EPLA 4NP5A 2F3WA 1RFKA 5CV7A 1S5CD 2DYOA 1QQRA 1I4GA 3TEWA 3C8YA 1NUCA 1TS2A 4OIKA 4A3MB 3I4LA 5T1GA 1OFFA 1BDOA 1KDBA 1JC7A 3U9OA 1HA5A 3MJ5A 3R8BA 2L1AA 3NVVA 5FO7B 4U673 2RVLA 3BDLA 4HKZE 3EQLC 2IW3A 4HJGE 1NVID 1DOXA 1DOKA 3B2FA 4USAA 3TBIB 1D5MC 3M3YB 2EYFA 1DOMA 3PV0A 4EVOA 2V4IB 1FR3A 2BE5C 3C1FA 1V8QA 2D5DA 1Y8OB 4ZQ3A 2CHBD 5C0XI 4GDKB 2D5GA 3A7AB 4LJZC 1QJOA 2WV6D 4KY7A 1EIHA 3KWVA 1JMLA 1L0XB 1U4LA 2HUGA 3LWUA 1SE2A 1CHPD 2KDMA 4IKGA 3HOYB 5E4WC 1CZWA 1UGJA 3B9JA 4KK7A 3WCQA 3NVWA 3RD4A 1RYJA 3QOJA 4OZCA 4JE3B 2E75C 5ISRA 1V97A 4R9WA 2K32A 3MFGA 4OHJA 2PMVA 5GXGB 2PVOD 2WXMA 1ZUD2 2K5PA 2BTEA 3D4WA 3MZ5A 4QB4A 2KUMA 2LFIA 5EBDA 3S2DB 1DCZA 2QSDA 3D6WA 1FGBD 4HN7A 3AB9A 3RZDB 5JXVA 2WU2B 2M2LA 2FE8A 3LB8C 3VR9B 2Y5CA 1STAA 1LV9A 1SXTA 4FP5D 1SNMA 3HGBA 3J80E 4KY6A 3HOUB 4RH6A 3E9SA 3FRPB 4K2KA 4MT5A 1LTTD 5IGDA 1DOIA 2WQYB 1CA5A 1H9SB 4PMCA 1STEA 3NBHA 4OO1I 5CV9A 4HMJA 4Q0FA 5DAUA 5EE0A 3N6RA 5FLXE 2L1BA 3ZJVA 3AU7A 5A35A 2DLBA 4OW0A 1KDAA 3MP9A 4RCNA 4KGSA 1Y8NB 1PLFA