1CQVA

Crystal structure of staphylococcal enterotoxin c2 at 100k crystallized at ph 5.0
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
239
structure length
232
Chain Sequence
ESQPDPTPDELHKSSEFTGTMGNMKYLYDDHYVSATKVMSVDKFLAHDLIYNISDKKLKNYDKVKTELLNEDLAKKYKDEVVDVYGSNYYVNCYFSSKGGKTCMYGGITKHEGNHFDNGNLQNVLIRVYENKRNTISFEVQTDKKSVTAQELDIKARNFLINKKNLYEFNSSPYETGYIKFIENNGNTFWYDMMPAPGDKFDQSKYLMMYNDNKTVDSKSVKIEVHLTTKNG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN (STAPHYLOCOCCAL ENTEROTOXIN C2)
publication title Structure of staphylococcal enterotoxin C2 at various pH levels.
pubmed doi rcsb
molecule tags Toxin
total genus 68
structure length 232
sequence length 239
ec nomenclature
pdb deposition date 1999-08-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01123 Stap_Strp_toxin Staphylococcal/Streptococcal toxin, OB-fold domain
A PF02876 Stap_Strp_tox_C Staphylococcal/Streptococcal toxin, beta-grasp domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.110 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1cqvA01
3.10.20.120 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1cqvA02
1KLUD 1HTLD 1STEA 1FNVA 1QILA 1JQYD 1TS5A 1TS3A 2AQ2B 1UNSA 1T5XD 2ICIA 2SEBD 1S5DD 1PRTF 4RGTA 1EU3A 2IPKD 3R2TA 1LT3D 1JCKB 1S5ED 4RH6A 5TSSA 1YN4A 1MD2D 5ELCA 1LTAD 1I4PA 1TS2A 1FGBD 1JR0D 4K6LA 1ET9A 5ELDA 1CK1A 4DXGA 4Z9CB 1B1ZA 2TSSA 1BCPF 1S5CD 4OHJA 1SJHD 2AQ3B 3BZDB 2O2LD 1HA5A 3BYYB 1L0XB 5FK9C 1JWUD 1V1OA 2RDHA 1M4VA 1YN5A 1CT1D 1FNUA 1I4QA 2XNAC 3TSSA 1PTOC 4TSSA 3MC0B 1FNWA 1JWSD 4C56C 1LTGD 2IJ0A 5ELEA 1D5MC 1RD9D 1L0YB 3V05A 1B44D 1HQRD 1SE2A 1KLGD 1LTBD 1PZID 2NTTA 4ZYSA 2NTSA 1SEBD 1CHPD 1PZJD 1D6EC 1LT6D 1SXTA 4UDUC 1ENFA 1SBBB 1CQVA 3BYTB 4L63B 3KLSX 3CHBD 2R61A 5ELFA 1D5XC 3DWAA 3BVZA 1EU4A 1SE3A 1XXGA 1AN8A 1LLRD 1SE4A 1ET6A 2XN9C 1PTOB 1PTOD 3W2DA 1I4XA 5ELBA 3BVGA 1KTKA 1RF2D 2AQ1B 5I4DA 1LTRD 3DWPA 1I4HA 1S5BD 1YN3A 1PTOF 2QILA 3OWEB 3EFXD 1F77A 3MFGA 5FKAC 4NZLB 2WV6D 1HXYD 4RGNA 1CHQD 1LTSD 2QEJC 2Z8LA 1V1PA 1BCPC 1LT4D 1V1PB 1BXTA 3GP7A 1PRTD 4RGOS 5D3IB 1TY0A 1G8ZD 1PZKD 1PYWD 1FD7D 4RHRA 4O1NA 1S5FD 4L6TB 1I4GA 1EEFD 1LT5D 1PRTC 2RDGA 3URYA 2G9HD 1AW7A 1DYQA 2J4XA 4RFBA 1ESFA 3R2IA 1LO5D 4RGMA 1I4RA 3EA6A 2CHBD 4RCOA 3R8BA 1RCVD 1LTTD 1GOZA 5D3DA 4DXFA 1PTOH 1DJRD 1JWMD 1BCPB 1BCPD 1D5ZC 1UUPA 2XRSD 4BWGB 3SEBA 3DWQA 1XTCD 2XRQD 1RDPD 1SJED 1LTID 1TS4A 4RHSA 1EFID 3BVMA 1EEID 3O13A 1EWCA 1TY2A 1PRTB
chains in the Genus database with same CATH superfamily
4DHJB 4R4TA 3P63A 3MZ5A 1QLBB 3DMUA 1I50H 3L16A 4ZHOA 3NTHA 1DONA 2KDIA 2UUCL 2K0PA 1A6XA 1EY7A 2CWPA 2WINB 2UU7A 4MEMA 3H6NA 5M9OA 1QWYA 1HR0L 1XQQA 2UXDQ 5BYSA 1Q8KA 5ELCA 4DR3Q 5KRUA 2KA7A 4NDXA 1TS2A 4P74A 3L13A 2JA5G 3AE3B 3HOUG 5J17A 2XTIA 2LXJA 2ZXRA 1WJ6A 2KJRA 1X65A 2A8VA 2EJMA 2KTRB 4FNFA 1G291 3TP8A 1IBML 2K04A 4KLKA 1HA5A 3TMEA 2JEBI 5JJZA 4A3FH 2KNBA 2Z0DB 1BT0A 1GJZA 3MXNA 1K3BC 2FAZA 1V1OA 1V80A 4KJOA 2D0PA 4KKSA 1VQHA 5IWAQ 5KYIA 3M3YB 2B63B 1IGCA 2C35B 5IIFA 3CCEA 4IFDI 4ICUA 4WJ3M 1PTOC 2C7HA 1ZE3D 1JE5A 4GDKA 2R7ZG 1FCCC 1MI0A 4JL9A 2HDEA 1WJUA 3FKIG 2B76B 2SDFA 1GUAB 2IO1B 3SU8X 1JRPA 5IT9L 2G4DB 3V05A 1V81A 4K81A 4EZKA 3P1HA 3PLVA 3PO2G 1KLGD 1JROA 2A68D 5JVG3 4DR5L 4LJZC 3OTOL 2NTSA 2A19A 2NBFA 1LV9A 5CV5A 4QCLA 5EGTA 1UH6A 1ENFA 1H9SA 4C3IH 4C3HB 1VQ9A 2AL3A 1C77A 3DLLA 5H92C 2GVBA 2BT6A 4BKSD 4DPGA 1KFYB 4ANWA 4REZA 4B0MA 4DV4L 2WLBA 2MFIA 1TKYA 3GTOH 1I4XA 3E9SA 2KDFB 4NY0A 3C8YA 2CJOA 4FBJB 4IFDH 3PGZA 3AEGB 5LL6S 4G50A 2VB2X 4E3CA 1C48A 1GHKA 2FE8A 1S5BD 3HVDA 4H2AA 3CAMA 4PMWA 1V49A 4ZDVA 1SSOA 2KQ3A 1PFMA 2O4XA 1OTRB 1N5WA 3PZDA 2JA6H 4GGQA 4GU2A 1I50B 3F2DA 1IZ6A 4K2KA 1CUKA 2KFJA 4GLXA 2YU9B 4JI7Q 3BWUD 3RFZB 2KLGA 2Q8IB 2WX1A 3N3KB 3VTUA 2W3SA 3TBLD 1CSPA 4NAWA 3T1HQ 3E0EA 3OOCA 3SR6A 2N4FA 2WAQG 5T1GA 2JN4A 5CV7A 1CTMA 3HOZG 2DZJA 4GLAC 3J9CA 4TV3A 1K28A 2KWDA 4WJ4A 4JI3L 4OWWB 1SGHA 3H7PA 1A70A 2W9NA 1IBXB 1DJRD 4JBMA 1JWMD 1VQEA 1BCPB 2Z0SA 3P7JA 3PT2B 5EE3A 2PZWA 4ARCA 3TIXA 4W9KA 1KAWA 3WIMA 1STAA 4TVAB 1TS4A 2QJLA 4A3FB 4XT1B 4P1CC 1C79A 2INPE 1WXQA 2N9EB 3VRBB 5IP4D 2LRWA 4QF4A 1N5XA 4IZ8A 1UGJA 2VUMG 3E5SA 2OQ0A 3NUCA 1J19A 2BB5A 1TXYA 2RHQB 3ICEA 1A5RA 1Y1WH 2SAKA 1WMHB 4UP9A 3RMKC 2M1MA 1QQRA 4A3MG 3ER0A 4A3IH 3PRZA 1PDXA 1G2SA 5IYDG 3H0GG 3RN5A 3W1SA 2GOWA 2EKEC 2WACA 4IPCA 3GTKB 4LF8L 3NBHA 5CTRC 5A2QE 3WAMA 4NJ6A 4C3IB 4NQLB 1GC6A 2L8JA 3D3RA 2ONQA 3Q3MC 4KKIA 3KBXA 1CKNA 3Q14C 1NR2A 4KZCA 2R92G 5CYUA 3KYDD 1Q0WB 5HHDG 4KKJA 2A68C 1FVIA 3Q6SA 3GTOB 3DWMA 4MH8A 1IBLL 1FXAA 3VDYA 4EEWA 1WM3A 4X64L 2MW5A 1YN5A 1EUJA 4JK1C 2HD3A 5G5GA 3ZNHB 5JEAG 2J7QB 2LI5A 4F7XA 2I0QA 4EKUA 4GNXB 4YWGG 2L55A 4WJWA 1E0BA 4YWLA 2CVRA 5J39A 5C3EB 1HNZL 4N9F4 3SDLC 1JQ4A 2ZM6L 3FAHA 1L0YB 4QUFA 5BN4A 1JWBD 2EVBA 1ROEA 3AE5B 2LVPA 5LLIA 3CC2A 1C78A 3WAOA 1CHPD 1TWCH 5H8YE 4FVMA 1BUIC 2Y3AA 3MC8A 4HDOA 3VAWA 4X65L 2KOLA 1T5EA 4YIJA 3J81E 4Y52H 3DHIC 2A6ED 4PZ7A 1P3QU 3STBC 5C1ZA 2CHWA 4KZ0A 4FJZA 4PT5A 1XCTL 4ZAIA 4R8IA 2UXCQ 1HTOA 3RZFA 1L4ZB 2B2UC 2Y5CA 2L83A 5C4XH 3KWVA 1L2FA 4LFAQ 3P4QB 4ZUJA 3OWEB 4S0RA 1AZQA 1PUTA 2L12A 1MHXA 3ZRFA 4MSMB 3ZJYC 3AI5A 1KAAA 2EYFA 1NUCA 3R3OA 4C3JH 5I9OA 3EROA 1WTPA 2A4ZA 3QWNA 1Y1WB 3MC9A 2HTME 2E8GA 3AQQA 4DV1Q 2EPBA 3AEDB 3B6YA 3QARA 3PUZA 4A3IB 2KCCA 2D5DA 5IP9H 4P71A 3DM3A 2X38A 4W9HA 5EE1A 2BA1A 5L95C 5BR8Q 4C1NI 4IM3A 4IPGA 1M8AA 2OJWA 1AE2A 1QNUA 4LF6Q 5ELOA 2AX5A 2KO3A 2O5JC 4RA8A 2D3CA 2L00B 1OTCA 1LM0A 2UYZB 3KQ4A 3AH7A 1LTTD 2JA8B 1ZXIA 4L5QA 5FOBB 4LF4Q 1PTOH 2D07B 3D31A 5E7NA 3RR5A 3Q6BA 4DGZA 5AJ3Q 3ZRCA 2CQAA 3S1RH 2CU1A 5IGDA 4HPMB 3CMAA 5EKIA 1EWYC 2LXCA 2AUJD 1XX8A 2FMMA 2KENA 1N33Q 3FRPB 3N6RA 4A76A 2KFKA 5COYA 3J81c 1YEZA 1BKBA 1KLUD 2VZAA 1QUQB 4DDGD 3E0JA 1VMCA 2IO0B 3IT4B 4QIWB 3R66C 5IYCH 1UNSA 2LXAA 1XJVA 3OJ4B 1W3SA 2N1WA 3KF6B 3VUYA 2EJFC 2Z6KC 2RD0A 3W5UB 3BK2A 5J2RA 1H8CA 3PUYA 4RH6A 4JI6Q 2D3BA 4BY1H 2WXFA 3RULA 2BYEA 4EZLA 1YNXA 4RNAA 2ZCBA 3TBIB 3S1MH 4NQKE 1XWEA 3T1YL 1TWCB 3RD4A 4R4OA 4DR6Q 4LDTD 1B8AA 3HKZB 2M8SA 1EWIA 4N8FA 5A35A 4GDLB 1HH2P 4XX5A 4RM9A 3ZXRA 3KYHC 5EJWA 5C3XA 5GAEC 1SJHD 5LMNL 4OX9Q 1MG8A 3WCQA 2Y0SE 1IPGA 3ZXVA 3QJYA 1YIWA 3E9IA 3H09A 5C4XB 4E71A 3PMFA 4KK7A 5F2DA 4A3KG 3N30A 2PPBC 2A6EC 3L7ZC 3WALA 4KKUA 1C1YB 1L1OC 1QG7A 1I7HA 3CSTA 3AMZA 3OIPA 3I4MH 4P6VF 5KHQA 4U673 4LFCL 1RJTA 1VQNA 1C3TA 1P0RA 3OHXC 3A56A 1ISNA 2RHSB 3IFTA 4ICVA 3NHHA 3A9KB 3HRZC 3ND8A 4YCVA 3N9YC 5JJIA 2LMCB 2CKHB 3TL5A 3SFDB 3D6CA 2DNCA 2UUBL 3ZJVA 4GKJL 5JHBA 2BYTA 3FILA 1I3QB 3S2HH 1PH5A 1L0VB 2OOBB 2EY2A 4CKBA 2F4VL 2K39A 5JJKA 3KDFA 1Q10A 1PTOB 5FJ8H 5M3FH 3Q2AC 4LW1A 4N6EB 5ELBA 1NI3A 4B0EA 2VL6A 3S1RB 3I4NB 4KHPL 1K53A 4BZAA 4OXPA 3ALBA 3NZ3A 1O80A 1PFDA 3TP5A 1SB3C 2I5LX 2B2VA 2QDLA 2QILA 2UWQA 3UE0A 2WYQA 4FULA 4KX6B 4LNFA 2CFMA 4M0WA 1UD7A 2KC1A 4RGNA 4WORA 5TR5A 2RA4A 2NS5A 5DPRA 1A15A 2JA9A 3EJIA 3A33B 3TEZA 3X3NA 2ZXOA 4XDXA 1S3OA 5DM73 1WGKA 2WDVB 1PYWD 4O1NA 2LEKA 1W6KA 4L6TB 1XT9B 4DR2L 1PRTC 1X56A 2RPVA 3D4DA 1YJ1A 5AZGA 4BY1B 1EYAA 1WTQA 3HOVG 2J53A 5E4XA 2GBNA 1V86A 2V4DA 3S1MB 1NTGA 3MEHA 3Q24A 4J15A 1SYGA 4URKA 4O42A 4DXFA 2KCMA 3ML9A 2V3PA 1PGAA 4DK6C 1PH1A 2XRSD 1VQ5A 3AN1A 2PIAA 5E6NA 2EMTA 3ZIMA 4HKQA 3GTMH 3BZCA 1EFID 1HCZA 3BVMA 1FRDA 4H02A 1EWCA 4A3OA 3NJTA 1PA6A 4JBJA 4IUNA 2ZVOA 3PIP3 2DAFA 4K7UA 5GMVA 3FDTA 5JPMC 1CJEA 2MO0A 2ICIA 4YSXB 2V1CC 1X3FA 1HNWQ 4CHTB 4I7ZC 3MAQA 3B08A 4DV0Q 3KYCD 3S14H 5C23A 2IPKD 4B95A 4BBRG 2NVYH 4ILWA 3ZNZB 3DHHC 4MGKE 5EQ0A 4A3LG 1KJTA 2KT7A 1Z9FA 2ZT9C 5KNBA 4R3DA 1HZBA 2LGIA 4J6HA 1YQ3B 1KOTA 2Q2UA 1PFNA 2K75A 4DUYL 3KUCB 1SMXA 3L3OC 5M5XH 4B9KA 4B9WA 3S2HB 1FJGL 5EKLA 1WRIA 3PIO3 4JI0L 5IGFA 3U8ZA 1H4RA 2AQ3B 3BZDB 2RF4A 5M3FB 3B0AA 4LJPB 4XWTA 3G4SA 5LMUL 1Q46A 3EN2A 3BDCA 4H7BA 3HUIA 4NJCA 2PI2A 3SVMA 1HE8A 1GUGA 2CWAA 5M3MB 2XNAC 4WQMA 2KQ4X 1HFGA 3F2BA 2W54A 1RTOA 1WR6E 1K50A 3ABVB 2D2CC 1WJJA 3CMMB 2L76A 2GA4B 2WXMA 2BH2A 4R4QA 1K51A 1JMCA 2YEPF 4ABNA 3GO5A 3MHBA 2DJFC 3CKIB 3ULJA 1IBKQ 2WQYB 2OEOA 4HCEA 3SE0A 4BXXG 4IWOA 1PZID 3UDIA 3PO3H 2G3QB 2V1YA 3MEFA 1EIFA 3BYTB 4QMGA 3PF5A 2DLBA 1XNRL 1TVXA 4X66Q 4OO1G 2IX3A 3AYHB 4L5TA 4NKLA 3J80E 1AN8A 2Q2HA 2OT2A 2IL8A 5G2NA 4B3SL 3H6MA 2BKRB 2MNAA 3BDLA 3K81C 2JX5A 2FFKB 1RF2D 4MH0E 4XQNA 2PI2E 5I4DA 3GTMB 2EOTA 4A3GG 5IODA 2B8GA 4UP7A 3K9OB 4GMVA 4XC2A 1LT4D 4DNRB 3CSFA 3GP7A 1P9DU 3Q69A 2B2YA 3VR2A 1PYBA 3A1QA 4JYAL 2WAQE 4WJPA 1PFBA 3S14B 4OVVA 4ID6A 3URYA 3SHQA 4IQZA 2NVYB 1HTPA 2J4XA 2Z1CA 3OSOA 1B53A 3A5ZB 3DWGC 2WB1B 1U0LA 4KI0A 3OW2A 4RGMA 4I7AA 1NNXA 1J7AA 4RCOA 3BINA 5T1IA 2XWJB 3U50C 1GC7A 1RODA 1SYEA 2L4NA 3OW7A 5M5XB 4S17A 2JK8A 3JYUA 4JOIA 1X32A 2HQEA 3SEBA 1Y1VH 1QVFA 2A1AA 2B8FA 3M4PA 3UDXA 2O6VB 2DZKA 2WXQA 2XK5A 3V61A 4ZRQA 1WCMH 3CXCA 2HHHL 3AEBB 3NVZA 4N58A 2I2YA 2PQAA 5DPSA 1JICA 3JAML 2J0MA 4GN1A 3J80c 1QT9A 2WP8J 4HJAA 1E90A 2FJ2A 2IT1A 1SR3A 4B08A 1OQYA 2BF8B 1GB4A 3C46A 3NBIA 1TZOA 1VZ6A 2LVOA 4DAPA 2QCPX 4RGTA 1C7YA 5K36H 2NUCA 1Q1BA 2HTHA 4BA1I 1QVGA 1XMQL 2MA9B 2TMPA 1SNCA 1D3ZA 1ZYRD 3QIAA 4A3EB 2AKWB 4LF5L 1LTAD 2LSSA 5HY6A 5C5MA 3Q23A 2OEDA 1KRSA 3PO3B 4PYUA 4KSKC 4AQYL 4MJSA 1UEBA 4ASWC 1C8CA 2B2VC 4K5XA 5LXIB 1STGA 1Z2MA 1CK1A 3HOXG 4I6PA 3LYYA 2JA7H 2TSSA 1BUVT 4YY3Q 2KVZA 2HUGA 4X3UA 3KUDB 4K1RB 3RNUA 1Z47A 3U4ZA 2IO3B 3C1EA 5ELNA 2JPHA 4K7SA 1STBA 1EUVB 2LASA 1YX6B 1SNMA 4XQQA 4C4VA 1VJKA 1MIUA 2NVXH 3X23A 2N49A 4G7OC 1YJ9A 4F7ZA 2EYOA 2KX3A 3QIJA 2DZMA 4M00A 3BDOA 2HIXA 2EZVA 4TSSA 3L10B 1QF6A 4IUTA 3DVGY 3P4RB 4EGVA 4JG2A 4RF1A 4IDIA 1V9PA 3ZTDA 3ONSA 3KBGA 2D2QA 1RD9D 2MBHA 4X57B 1TTNA 1XD3B 3FHWA 4P72A 4OVZA 3OMGA 4ZYSA 2MO1A 5J22A 3GTQB 3B1LX 2B2TA 1SAPA 1PXUA 1YHBA 4RG1A 4IUUA 1FYCA 4X6AH 4L23A 4FN2A 1A8VA 1C9FA 1D5XC 4QY7A 5FLXE 2X69A 2QIEB 1FXIA 3DWAA 3EFCA 4JI1Q 4JI2Q 2BPSA 2BB6A 1L1OB 1NDDA 2NPTB 4CDEC 3P4PB 4IUMB 1YX5B 1Y1VB 1C0AA 2F0HA 4JW0A 1C4CA 3DWPA 4PG3A 1E22A 1I4HA 3Q3OC 1GUOA 1B2TA 1ZW7A 3BZKA 2KCNA 4GOPA 4DV3Q 1WCMB 4NXMQ 2B63G 3I63C 4MZ9A 3QA8A 1F2LA 1MSHA 4H44C 4LF7Q 4HXDA 1A2TA 1S3SG 1A3UA 2QSDA 3DDCB 1EIYB 1G8ZD 3NTKA 1J5EL 4UHVA 2UUCQ 1VQOA 2N7DA 2XBBC 5C0XI 4MELA 1IW7D 2OTLA 5GXGB 3AE4B 4DV2L 4V190 2KAJA 2Z0EB 1ESFA 2R3ZA 4IPHA 3I72A 4A3DH 1V43A 1HR0Q 1E9MA 1NVID 3TMPB 1I4RA 4TKOB 1OO9B 1WYWB 1SYBA 1SNOA 3SHLA 3R8BA 1DOIA 4X62L 4HJ5A 4QGUA 1Q3LA 1UE7A 1Z7TA 4L5SA 2BCOA 3NQTA 1E8YA 2KEDA 2K8CA 3PLUA 4I6NB 4NAMA 3NBHB 2A73B 2MEKA 1FRRA 1GKHA 1Z6HA 2ALYB 5IP7H 1E0ZA 3K5MA 4FJVB 1G2TA 3NWSA 5FR3A 3R7QA 1IBMQ 1GG3A 3DVNV 1EEID 4CYEA 4K5VA 1XPRA 1PRTB 5I6WA 5FLXc 1HTLD 4U68A 2EIFA 1EY0A 1NBWA 4DR4Q 1N62A 4EOYA 4KHZA 1MBYA 5C0XH 2E2IH 1OXTA 5CBEE 2FCNA 1PH4A 4ME5A 1X3EA 4OZAA 3ZJTA 1WD0A 1LFDA 5EBCA 3F2UA 3KH0A 1O7ZA 3R2TA 1VQLA 2NYZD 3GV6A 5G3LD 5J1ZA 2CCZA 3PVLA 4JV5L 2AUKA 3JSVA 4C00A 3IAS1 1TT2A 4DR5Q 4L5RC 5I2YA 3OTOQ 4KD4A 4W9DA 2O5IC 1DOYA 2LGDA 4MIUA 2NN6G 1ILQA 4PS3A 1VQBA 3A7AB 1FR3A 1WTRA 4POGA 3TS2A 1WIAA 4PMCA 5AFWA 3HM6X 5C4JB 2MJ3A 4TQUS 2K6DB 3W5VB 2MQHA 2MUYA 4DV4Q 4B3RL 3DCGA 2B2YC 4R9WA 3U7ZA 4J1MA 4RKBA 5IT9E 1IXRA 2PPHA 2ZZPB 2GVAA 4DV6L 3Q22A 4ALPA 2X6GA 4QQBX 3AB5A 1XPUA 1R4NI 4I6LB 1MFWA 3DVNU 1HHVA 4BBNC 3Q8DA 4CGYB 3MC0B 2R2OA 3OPOA 1GAQB 2JYOA 1KH0A 1J8IA 2VH1A 3EHVA 1Q5WB 4DKAC 5HI1A 1KQSA 1UELA 1D5MC 3NSWA 3U7DA 3IFDA 4HSPA 1HQRD 5G3LF 3HOYG 3S2DH 4A93H 3VYTA 1IL2A 2WNMA 2F0LA 3N52A 3QC8B 1VQCA 3PZ7A 1VQ7A 1X3QA 4MN3A 1E7VA 2R6GA 1R9TH 2ON8A 2WXLA 2WGSA 4M8AA 2WXPA 4A75A 1PV4A 3VTWA 2F0TA 4OIKA 3HOWG 4ZRKA 2RDBC 2C9WB 3SK8A 1UF0A 1G51A 4JI3Q 1IW7C 4IJHA 2LJ5A 4BS9A 3TDQA 2KZRA 3WDNA 2VNUD 3BVGA 2PVGC 4H0LC 2F0KA 4HIOA 2DAJA 5KIXA 2N9LA 4P1BC 5CHWA 5DCNA 1XMOL 3VYSA 4KIKB 2AEHA 2I5HA 3VH4B 1EY8A 2W55A 5FKAC 5KHOA 1B3QA 4AYBB 1BBWA 1W2BA 1V1PA 1VD2A 3MWYW 1V1QA 2B29A 4YWMA 1MJDA 4OEMB 1V97A 5C3EG 2K9XA 3KWLA 4JX1C 1HPCA 2E2IB 1F0ZA 2EXDA 3KF8A 1TY0A 3W9CB 1MGSA 4RHRA 5IT9c 4LFBL 3KLWA 5M5YH 1N32Q 1IYFA 1SYFA 1WTHA 1EEFD 1SMYD 1HZCA 5GROA 4BY7H 4P2CB 1P98A 1HZ9A 3HS0C 1ZDXA 2IGHA 3VHTC 1LTLA 4YHHQ 2L7RA 4LUVA 1NY4A 1HJPA 2VB3X 3N20C 1LO5D 3HIZA 5IOCA 4A3JB 3BK1A 2ATWA 4RMAA 1TGZB 1RCVD 1QVCA 2K14A 1Z5SB 3NOBA 3TUOA 2WXOA 2V4IB 4YTPB 2JA5H 4PZ6A 3HOUH 1Q8IA 2BE5D 2O2VB 4LK0M 3ZGZA 2IHFA 3FVQA 4M8MA 3UDGA 1G91A 3RCZA 1WWTA 3AECB 4WH4A 1IBLQ 1EL0A 1T6BX 3PHWB 4FA6A 2HQLA 5FO7B 1KXLA 4X64Q 1WH3A 3ULLA 3PF4A 4KN4C 4DAYA 1RM6C 1TZ1A 2B2TC 4C1NK 4CJ2C 1XLOA 2MWSB 3A8JE 3RNGC 3NPPA 2HDMA 2JE6I 3V6EB 2NVTH 1K0RA 4A3IG 1HNZQ 2IY0B 2IGGA 1LT3D 1NAPA 1S5ED 2VY3A 3PQIA 2R7ZH 1JWAD 2JZPA 4K6DA 1U9RA 3C19A 5G5HA 1SE8A 3FKIH 4K0KQ 4K14A 4B3MQ 3GQBA 2F0MA 1E24A 2ZM6Q 2INNE 2K22A 3DBRI 3M9BA 3S2DB 4A93B 3P1MA 4X3KA 2R2QA 2UXDL 1L4DB 3RLFA 1EYDA 3C2PA 3PO2H 2WX0A 2JA8G 3ZO5B 2ZTCA 2DENB 1R9TB 1NCVA 4RKLA 5IY0A 4X65Q 1I6VC 1VRAB 1FCLA 4QUCA 1E5WA 2NBUA 2QEXA 3MHSD 2PLPA 1E2VA 2PEAA 2K01A 3BYYB 1R4NB 1N61A 5FK9C 3L4PA 3VR4A 3F2CA 4IUQA 2FHTA 4XWWA 1M4VA 4M8NA 4EX5A 1I4QA 5H1SE 2N0SB 3DVGX 1N36L 3MTSA 2SNSA 2KHWB 3ONAB 3Q8EA 3FPUB 4AWJA 4EUTA 2PE9A 5HURA 1Q1EA 2RDFA 2SOBA 2G5DA 1S72A 2K6QA 2PTLA 4PYZA 3U58A 1UBIA 4PK1A 2WS3B 1QZHA 2E2JH 2R7DA 1S4ZA 4BY7B 4BAXA 4RCNA 1IGDA 1D6EC 2Q8TA 4EE2A 2BGFA 3KLSX 4AJYB 3VA7A 5JZEB 4FADA 5HGTA 3SGIA 2VZKD 3HOZH 4W9IA 1P8LA 1SNPA 1SMYC 5FO9B 2JT4B 3B2FA 4L8JA 3HOUB 2IZVB 2NZHA 1N34L 2ZTEA 5C4XG 1T0SC 4HPPA 2JA6B 2DUDA 2KYWA 2D5GA 4NZLB 5EPKA 3TCAA 2WXRA 2XSCA 4JC0A 4NP5A 3WOFA 2VUMH 3NXWA 4W9EA 2PE6B 2ZNVC 1QCBD 4H13C 5M5WH 4G7ZC 2K03A 4JI7L 2N9KA 2NVTB 4C7YA 1HNXQ 4JGHB 1N6ZA 1FFUA 5C3WA 5E4WC 3FKIB 2CQOA 2OCEA 4KDLB 5IYDH 1IL8A 3H0GH 1FM0D 2VQEL 2D3GA 3EA6A 1KC8C 2WXNA 1EYCA 2CHBD 2J7ZA 3PREA 4AH6A 4MGIE 3H91A 4OIJA 3F8TA 3DM1A 3PO2B 4PZ8A 2IHEA 5D3DA 5EPLA 4ZCKA 4TKNA 4DN4M 3BS1A 2F52A 3WANA 3ND9A 2X6LA 2NBVB 3PZ8A 1E8XA 3QJZA 1CQFA 5CMDA 3I4NG 3IHPC 4P7IA 5HGQA 1XTCD 4XYCA 4MDKE 4B6WA 2V0GA 1Y56A 3VUXA 2R92H 5LMNQ 3KVFB 1D8LA 3IT6B 3UI3A 4GN3B 3V96A 1CZPA 5T8IA 2F3WA 2OJRA 2FUHB 3X0WA 2YTVA 2J0TD 1DM0B 1FNVA 1TQOA 3KK7A 2RSUA 3X3MA 2JUOA 1WJNA 5A2QL 4XGAB 5JEAH 4XQJA 1B9RA 3DBRB 2KVMA 3CRLC 2G1EA 3F1ZA 4L1BA 3RUZA 4LFCQ 3VR6A 2N88A 5J18A 3B2GA 1K73C 3RZOH 1ACCA 1WTVA 2E2JB 1VQKA 1N8RC 1JR0D 1TJEA 1ET9A 2BWFA 4DHZE 1EQVA 1EWHA 4O2DA 1SN8A 3I57A 4A55A 3PIOA 2HIVA 2LXKA 2UUBQ 4GKJQ 1XEEA 1T9HA 2PCFB 1WY8A 3TEYA 5CV4A 2F4VQ 1QOHA 1FEHA 3L0OA 1C76A 1NMFA 3FPPA 4PV1C 3NVWA 3CMEA 3TS0A 1UWXA 2WHIA 3K9PB 4XZ4A 2MBBB 5HKHA 1OEYJ 3CU7A 2KLCA 2CHXA 4JI8Q 3T53B 1IYJB 1SRUA 4LUZA 1J9OA 2RKSA 2EE1A 2C7MB 5LXHA 1TWFH 5KEEA 2OTJA 5IYBG 4XE0A 2HDLA 2KWCA 3L08A 2BVCA 5M5WB 4F87A 3A4SC 2MPMA 2JEAI 1KRHA 2E5LL 3HG9A 4DR2Q 2ACZB 1AFPA 1LT6D 5ISRA 2KMAA 4GN4B 3L17A 1VQIA 5L83A 4FYDA 2LJIA 3H0GB 2ASQA 3I4OA 3HP3A 4JPBW 1ET6A 2HD5B 1X9NA 2RBMA 5FJ8G 5M3FG 2CU3A 3QWZB 5CR3A 3S1QH 3I3CA 1NR4A 2NBWB 1LGRA 1HZ5A 2J0KA 4YT0B 2CH4A 4K3CA 2EY6A 2R92B 1YN3A 2DBYA 2MGSA 3EFXD 4C3JB 3QQ8B 3U30A 5M3MG 4A6QA 3BU2A 4OWTB 2LHEA 3RI7C 4AIMA 5CV8A 2L11A 4DV5Q 3WAPA 2GBMA 5BN5A 3DEOA 3GDEA 2E76C 3AEFB 3QAQA 4APVA 3KLRA 1M94A 2B2WA 4DHJD 2F4IA 2PQAB 3CCSA 1JW9D 4CBVA 1X54A 1S5FD 2D9UA 4HSVA 3G6JB 2M9VA 4GKKL 4DV1L 1K83H 2UXBQ 1P7EA 1VS0A 1YJWA 2EMSA 1EIGA 2VXWA 3L9AX 1JALA 2M56B 5K5PA 3AEAB 3P4SB 3VR9B 3ZKJC 2UU9L 4US8A 1F9PA 4DNIA 3L54A 5BR8L 3RZOB 3MJWA 4NNJB 2DJGC 1EY6A 4MTKA 4P75A 3GZNI 4GXBA 1KABA 1R4PB 3VR8B 3WWVA 1A3TA 1TYGB 4DK1A 5DEHA 1IBXA 2C60A 3RLOA 1VF5C 3AFPA 4FHJA 2PNRC 4ZKBB 1BO0A 4DUYQ 4HJGE 3A54A 1L2NA 1G6ZA 3W1SC 4DAMA 4QL5A 4NJ7A 1FJGQ 1WOCA 1ZP0B 5AUKA 3H15A 4AP4C 4JI0Q 4W9LA 5FLMH 1YIJA 3U4VA 1ZOYB 2REXA 5LMUQ 1DOKA 2IX1A 3C1FA 4BBSG 3JW0X 1XTDA 1N33L 3EC8A 2ENBA 2N55A 2AWNA 4WWOA 1WM2A 1WMHA 2JYEA 2NVQH 4A3KH 1M1KC 2HJ8A 1K3RA 5GADC 3S17H 2K1FA 4FP5D 2DX5B 4MGYE 5IGGA 3A4RA 2WFWA 4NW2A 4FHKA 3M3JA 3HGBA 1MD2D 3CD6A 2N9PC 1NBFC 2R93H 2MBEA 2SNMA 2LD9A 1ICFB 2WB1G 2V3NA 2WWZA 3VQIA 4ZK9B 4NB3A 3HK0A 1Q90A 2BS4B 1T3QA 3NVVA 1ZXTA 4MACA 1NYRA 4WAFA 1DGSA 1TIFA 4A8XC 4HMJA 5CV9A 2F0JA 1BR9A 2EYHA 3CWIA 1DXMA 4Z9CB 1QZGA 1XNRQ 3D4WA 1VR9A 3A8KE 3AM9A 5IAAC 2QF7A 2MJDA 3AU5A 3APDA 1V5OA 2XVSA 4F8CB 4LNOA 3A0JA 3S1QB 2IDYA 4A3CH 2VRRB 1C9OA 2NZOA 5DM63 3A9JA 2ICEC 1WI0A 1KNAA 3I4MB 3OJ3A 4GNXA 2INDC 1WFQA 3OAWA 3RNFC 2L52A 4NXNQ 3ECIA 2H89B 3Q8FA 5I6YA 4BFRA 1ESRA 3AE6B 1TWGH 5EKKA 4V0BA 4GZYC 4IFDJ 4LAAA 2L1AA 2ZJDA 2BS2B 2BOSA 1VQ4A 2KDEB 5BO4B 2KMCA 1B44D 2NTTA 2FXQA 4A3EG 3GS2A 4JYAQ 2L15A 1KLVA 1K83B 4KGRA 3I8ZA 1SXTA 3S15H 1HQMC 1SBBB 4CKCA 3MXPA 5BN3A 4PMBA 1LXDA 2R61A 2XWBB 2GBRA 3QX1A 3AE8B 4K3BA 2E75C 3RT3B 3BVZA 2E6XA 1WF9A 3O65B 4WJOA 3UGBB 5C44H 4WFN3 1E7PB 3PSEB 1E2WA 1J8CA 3K7AH 1F1HA 2X8XX 2G45B 1AZPA 2LHDA 4ODGA 5D2MB 2PMZB 4M02A 3VXWA 4LNNA 1SYCA 1MKHA 1WXSA 2J52A 3L2PA 2QEJC 2HHHQ 3ETRA 4IURA 4JBKA 1EFWA 4FDBA 2H1EA 4R8NA 4A3KB 5DPWA 1PQSA 3I7FA 2BS3B 3GTPH 3C3LA 2WDTB 1RKNA 3SR1A 1OGWA 3QR8A 1TKEA 1I4GA 3RUIB 3GZNB 1SF0A 2IX0A 1I35A 2G9HD 3UI2A 1Q86C 4RFBA 2DYBA 2WXIA 2R93B 2LS01 3EBEA 3EGRA 4BBRH 3U9OA 4PQXA 4LMQD 2JXXA 4CDCC 3JAME 3ITPA 1CZWA 1QNKA 4B9XA 2QDBA 1IUEA 1SNQA 2CHZA 2DNEA 4KGSA 1R7SA 3N1YC 3T51B 4TRDA 4Q5VA 1FPYA 2M0XA 1SJED 1EZ8A 4XT3B 4EQ5A 1Q7YC 1F52A 2ZNVB 2MP2B 4MT5A 2JU6X 1QJOA 3O13A 1TY2A 4FF1A 4G11A 2BH8A 1QUQA 1ENCA 2E2HH 3TZDA 5AUIA 2DYMA 2BDOA 3MHZA 1JQYD 3VR3A 4N9PA 3D8GA 2C7NB 2NVUI 1I94Q 1HZ6A 3TJPA 3LNNA 2E74C 4LUOA 3M62B 1TWGB 3E3XA 4G7HC 2VS1A 1XPOA 1HNWL 5K36G 5TSSA 1YN4A 1W6JA 1F2RC 2CS4A 5BMIA 2KHJA 1IYVA 1H95A 4I65A 2KJ6A 2MSED 4W9FA 2OWOA 1QOAA 4ZRZA 2L5TA 2KK8A 3LXFA 3S15B 2K25A 3M95A 1A62A 4MHEA 1K52A 4GDLA 4PS7A 1Y8OB 3S16H 1V2YA 2VH2A 3R93A 1ILPA 3NZSA 1KL9A 5E1FA 1SFOH 4DF7A 3DHQA 1F9JA 2QCZA 2EQSA 3N32A 1RIPA 2ID0A 5CORA 2RCNA 5C44B 1CKOA 1XYIA 2GLSA 3ZW3A 4BOZB 2K05A 3K7AB 4XTCS 5BMHA 1F9RA 3MXNB 3AFQA 2KECA 4QIWE 2F0IA 1ASZA 2IY1B 3MA2B 3JAMc 3H3VC 4A3GH 2FCQA 4GS3A 4OVUA 3VFKA 2A5HA 1WFYA 5CC4A 1X55A 5AEKB 4C56C 1XLPA 4LJOB 2QHOA 3LWUA 3RPFC 4J6IA 2M19A 2IJ0A 5AZHA 5ELEA 4HMIA 5J3BA 2F0QA 4EVOA 3J80L 2QW7A 4UY8C 4KY6A 2F0SA 3A9KA 3I70A 1LTBD 1J5EQ 1IBKL 1WXMA 2FBWB 2LMCA 3UINB 4ANUA 2EXZA 4UDUC 3J80i 4DV2Q 3PUWA 2Y5BB 3LB8C 1WTOA 1H9SB 5ELFA 3C0RB 4OWXB 4WWMA 4WJNA 2Z9HA 2VZKB 3I3TB 1KDAA 1XXGA 1N60A 4KV2A 1SE4A 4JI4L 4AUQC 3NK9A 4X62Q 4N8X1 4QB4A 2UUAL 1PH3A 1GNUA 1KTKA 1WVLA 4S3SA 3DBLI 3U52E 1BBUA 3G48A 4M01A 3PRMB 1E1OA 2PW7A 4F88A 3RZDH 3H9DA 3DHGC 3CCJA 1VQ6A 2LFIA 1SROA 2E2HB 4JCVE 1JC7A 2KBNA 2D3AA 2G4SA 2DY7A 1U4LA 1FD7D 3J7ZC 4AOFA 1QB5D 2JWUA 3KUPA 2KWVB 4RAUC 4CDFC 4NAWB 1YJIA 2EY1A 5C4ZA 1GUNA 4DV7L 1MG4A 1HZAA 1XNQQ 1RWSA 5LL6X 2WKDA 1G6JA 3PCOB 1SSNA 1QOGA 1OXUA 4XYOA 1TT5B 2BYVE 2N9XA 2HE7A 1N63A 3AMUA 1GJXA 4DR7Q 3H7PB 2A74C 2BDNA 2JQOA 4EZJA 2N7JA 3SK4A 3S16B 2MHVA 3VYRA 3OLMD 1KF6B 1K8GA 5IP7G 3HOXH 4KHVA 2L32A 3E56A 1PFSA 2KWUB 2IBIB 4HN7A 3MXUA 1Q82C 4Q0FA 2LWPA 2YTXA 2ZTDA 4MM3A 3NVYA 1F2ZA 4AYBG 4NPSA 4DV6Q 1ZXHA 4C2MH 3ZLZA 3M4QA 4A3GB 3T8MA 3SK5A 4UPAA 1ZUD2 4DK5A 1Y8PB 4WURA 1ZKOA 1E7UA 2JF5A 2K33A 1JB7A 3ERSX 4C3HG 1JE4A 3J7YW 3A74A 5JJLA 1VZ7A 4OL7A 2V3SA 4HIMA 1VQ8A 1A2UA 1L6UA 2EYJA 3J7AF 1YHQA 1VQDA 1WGGA 1CFMA 2LVQA 1KD1C 4A3JG 1FGBD 2MP1A 2JA7B 4XDDA 4OW0A 5HFYA 1ZYRC 3PV0A 2MBOA 3U4EG 4WIPA 1D1KA 2F3VA 3IVFA 1Y14B 2FCSA 1J6QA 1B3AA 1HR0W 3K0XA 1CKNB 2KANA 2KMMA 4ZYNA 2FIDA 4GOCA 4OHJA 2NVXB 2BW2A 3D4RA 2LKVA 1L0XB 3ZVVA 4OGQC 5C6AA 4TMAB 1ZPSA 4GSWA 3DPDA 2R7FA 1C4QA 1XMOQ 1CT1D 3RZDB 2W82A 2KOXA 3JVZX 2IW3A 2IO2B 3TSSA 2L05A 3T9LA 4FF3A 2I5MX 3OWFA 4HRSA 3M3YH 1JWSD 4JI5L 4HR7B 2B63H 1F2RI 2ZW0A 4POFA 1AWDA 4CJ1B 3NELA 3NP8A 4A3PA 2C9OA 3G71A 4LDTB 4DAVA 5IOIA 4LFBQ 1GHJA 4A93G 4KTAA 1EY9A 2EJGC 2WXKA 3H1UA 3NG0A 1I42A 3IBEA 3RNBC 3TREA 2MJ8A 1Y8RC 2KHIA 1EQQA 2K5HA 4A3FG 3DBLB 3QK0A 2K5QA 2N8NA 4DUZL 2W3RA 4JI1L 2FCMA 4JI2L 4C7ZA 2YVCA 4AJWA 1MHWC 3H3VI 2JWZA 2KC2A 2KDMA 4RWSC 4A3BH 2N3SA 3HOXB 1WXVA 4P16A 3NRZA 3Q8AA 2OQKA 1CZGA 1PTOF 1U4RA 3MFGA 4F8MA 4K8IA 4JWSC 1CM9A 1PH6A 5DNFA 4HWIB 1WZ0A 5LNK1 1Q1OA 2NN6I 3V6CB 1FFVA 4NXML 4DV3L 4K8JA 4C2MB 2CR5A 1VQGA 4WJQA 5G55A 4ZRJA 2PW5A 4JOIC 5FR6A 5D3IB 3TN2A 1NE3A 2ZXPA 4WRDA 4LF7L 3GV3A 4DR1L 2FUG1 3H8HA 2J42A 4Q2JA 4A3DB 2KACA 3OIQA 4C3IG 4ZLTF 2YU9H 3BY4B 4BY7G 1DYQA 2B2UA 2VQFL 1V8CA 4KGTA 3R2IA 2WU2B 3CF6E 1PMRA 1O7YA 2AHOB 5BMGA 2F0PA 3CC4A 1ASYA 3H94A 3H3VH 4D2KA 3TEWA 1UE5A 4FO2A 1GOZA 4UP8A 3HRDD 4HJ7A 4IFDG 3CPFA 1KM7A 4B3TL 4II3B 1BDOA 3NEMA 4K5WA 5KNCA 2INCC 2O6VA 2NN6H 3DWQA 2JY6A 4P73A 1RDPD 1LYLA 2K32A 1RAXA 4HJ9A 2ES2A 2JA6G 2D62A 2Y0SB 1UZXB 3W3AA 2KFKB 3AV8A 5KNDA 4DR4L 2I1JA 1T5XD 3CPWA 2MQJA 4MGZE 1N36Q 1NSNS 3ULPA 3QCAA 4IM2A 1NEKB 2WU5B 2IYDB 4HAEA 3UDFA 1MJCA 2WB1E 1RYJA 2F0NA 3MVVA 4LF8Q 3FEWX 4ITKA 1RFKA 3AU4A 3ZJUA 3K59A 2KN4A 2KN5A 2BBCA 2WDQB 3K57A 4IOCA 4K6LA 4LF9L 3HOYH 2JVCA 4W9JA 3GTKH 3V2TA 2DY8A 3DBHI 5JXVA 2EYPA 4XDCA 2IWHA 3KUZA 3NZUA 1GB1A 4A90A 2O2LD 4MSQB 2QA4A 4KMUC 1EO6A 2Z6KA 3K80C 3HOWH 3VA5A 1MSGA 2ZEQA 4A3BB 3SK6A 5KYLA 3MXGA 5CBAE 1Y1WG 2EYLA 4YCUA 1S1QB 3CQZH 1FNUA 1N34Q 2PW9A 3CRKC 2ZW1A 1STYA 3TEHB 3QOJA 2YEPB 1WRDB 3MTNB 3Q3NC 3CW2C 3QHTA 4USAA 1FNWA 4QJFA 1MJEA 1J7CA 3S24A 4MTNA 4NMZA 1J7BA 1LTGD 2DGYA 1H9KA 5DLQE 2Z6BA 2PO4A 1WI5A 2KX0A 1STNA 2K3UA 4DR3L 5C3EH 2PKOA 1KNEA 4GOPC 2L9HA 5CX3A 2D11A 4DK3C 2GB1A 3STBD 4O0AA 1R4MI 4TQ1A 3CHBD 1VQMA 3CCRA 3S9WA 3RLNA 1T0QC 3FILB 1SLJA 5GQOA 2VQEQ 3LDZE 1L1OA 2NPTA 4ZOHC 2F0WA 3WA0A 3RZWC 3PO0A 3KDFB 3NE5B 1EM7A 5IWAL 1BVSA 5BYRA 2LFNA 5MPOA 1EF1A 4GLSC 2F0FA 4QAYA 4WQOB 2YLMA 4BOSC 2OF1A 4M0WB 3V60A 2Z8LA 2O6VD 3FC4A 3M4YA 1FD6A 4G4KA 5EAYA 5M5YB 3I91A 1UEAB 5DAUA 3APFA 2WXGA 3JC66 2JYTA 4BKGA 2F0UA 2BKFA 2KJHB 3Q3FA 1KHIA 2GMIC 1LT5D 4KD3A 3HKZG 3T13A 3K5NA 1N32L 3KW5B 1HUMA 4YTNB 5E3FA 2M2LA 3KJPA 3VDZA 4KSLC 1IYUA 4YHHL 2JA5B 3LGJA 3HOYB 3ZQ4A 3AE1B 1WJ4A 3A7LA 1UGMA 1ZGUB 2LY7A 2YTYA 4HIKA 1FIQA 1UUPA 2EYMA 3Q8BA 2JA8H 3ZDTA 1EIHA 5JH5C 2KHSA 4ACFA 5JAVA 3GTJH 3DEPA 2XRQD 2DYOA 3VRAB 1CA6A 2D10A 3HOWB 1I6HH 1NMGA 2BE5C 4C3JG 3NUHB 4ZRPA 1HA6A 2RVLA 1PGBA 2HCCA 1NYQA 3ZDMC 2AWOA 3GD7A 4IG7B 4KVGB 1X6OA 3CQZB 4HDQA 5C2TB 1TS5A 2AQ2B 1YJNA 2PZUA 3SXHA 1CMXB 4J3OD 5IP9G 5JHAA 2F3IA 3ZYYX 1S5DD 3HFZB 2R7ZB 3A9JB 4A3MH 4II2B 3KFUA 3T1HL 5CGKA 1IKMA 1OXVA 2QMTA 4HLEA 4HROA 1U4PA 4LNQA 3N1XC 4IW0A 2KQSA 3T1YQ 1IHZA 1I4PA 2JZ3B 2XIWA 4K0KL 3Q0AA 4B3ML 1L7YA 3DBHB 1BF4A 2E5LQ 1EY4A 3MJ5A 5ELDA 1U5KA 4XIGS 4DXGA 1RHPA 3SD5A 2EKIA 4RMFA 1D7QA 3MFYA 3R7RA 3PIPA 1XLQA 1DOMA 3UE1A 2RGFA 1S40A 5L37A 1E6EB 3Q8CA 4EQPA 2GBJA 3CCUA 1ENAA 1F2MA 2RDHA 2L3ZA 5IYCG 1JORA 4HKZE 4HTHA 3I73A 4IM0A 1YNJD 1JJCB 2MJEA 2A69D 5LMNW 2E2DC 1KRTA 4BY1G 3MP9A 3WOEA 2XGTA 1QZEA 3ENEA 3DQVA 3G6EA 1CI3M 1O7IA 5C4HA 3TP7A 3AU7A 2LUEA 3I55A 3G7LA 1PH9A 1YZ6A 4JBWA 1CKMA 2JZZA 1GUSA 1R4MB 1TBEA 1E1TA 1SE2A 1LM8B 4JLCA 1DOLA 3I90A 2WAQB 4GKKQ 1GUWA 1SEBD 2KTRA 3RNEC 1GO3E 3T16A 1OEYA 4DK0A 1CQVA 1E3PA 3HOZB 2KQ7A 5D6JB 5CV6A 2UU9Q 2GN5A 3DUZA 3EECA 5IA7A 4PS8A 1YD8U 2AYOB 3RNAC 2HCIA 1KIXA 2WDRB 1LLRD 2XN9C 4KHPQ 1I5FA 1I3QH 1EQTA 2RCFA 4J8QA 5NUCA 2LGSA 5LHY1 1YNND 3DXJC 3OMCA 2E3TA 3GTJB 1LTRD 2Z4IA 2PMVA 3CIRB 3HHMA 5KGUA 4KIKA 1JB3A 2M0AA 3NS8A 2KCTA 1I6HB 3I4NH 3PUVA 4IJLA 3I4MG 3J81L 1UWMA 1K8AC 1HXYD 2VUMB 4ANVA 2Z4HA 1ZDVA 3QO2A 3P42A 3M7GA 1AH9A 3TRZA 2B3GA 1Q81C 5EE9A 4TQ0A 1PRTD 1ICWA 1OXSC 3J81i 1E8ZA 3PV1A 4YSZB 1WYDA 4IC7B 4A3MB 2ZCCA 1DGJA 4G57A 1JT8A 3A1QB 1NI2A 3ML8A 2KEEA 1V8QA 2NWGA 1VQAA 2IY5B 1Y69U 1LABA 5JOBA 1HNXL 3TZUA 3EFUA 4YSYB 2MRPA 3PTFC 5C0XJ 1TKWB 4KKTA 1C4AA 2C5LC 3B9JA 3CC7A 3W1GA 3N1ZC 3GE3C 4IPDA 1F9QA 1WZ3A 3TP6A 1AP0A 2UXCL 1LUZA 2O2VA 2I46A 1RFAA 2FNJB 2BTEA 4LFAL 3E9HA 1KDBA 3D32A 2JSOA 4YCWA 1HFNA 1LTID 4AQ7A 2LRUA 4EQNA 5FLMG 5GAHC 1GVPA 4AYBE 2XK5B 1YNTE 1GM5A 3IFWB 2K4KA 3K0YA 5C5LA 1WGRA 2FMCA 2GRIA 3I2ZA 5E6PA 1VCIA 4IKGA 3EUB2 1WTWA 3T3OA 2NR2A 2JXMB 4DWFA 2Q5WD 4HCNB 2RQXA 1MVKA 5IE8A 1VQFA 2K5WA 1PRTF 3OG5A 3Q3JA 1HRJA 4RF0A 1E10A 4XXEA 4OONA 1A0IA 3EQLC 4KY5A 3GTLH 1T0RC 3DBSA 4LF6L 1TWAH 4IALA 1U4AA 2F0DA 1YNJC 1FGUA 2K28A 2A69C 5IYBH 2R93G 1PGXA 2AL6A 3BJUA 4XYQA 2FINB 4GIVA 1STHA 2H5XA 4LF4L 2N78A 5HG2A 2CH4W 4EFOA 4MJSB 3PPAA 5AJ3L 2MX2A 3PGEA 4FLHA 3J7AV 1B1ZA 2LUMA 1WE6A 1S5CD 3AEVA 3D6WA 3HZXA 3I56A 2PNHA 3SDZA 5IO9A 2WP9B 4IO9A 4A3CG 4E6IA 1RLFA 3AULA 3AE9B 4C4VB 3UQAA 1TIID 2QKIC 2K5NA 2VW9A 1TWFB 1BQQT 1R4QB 3NQIA 3IRBA 1DZ1A 3P2BA 4ME3A 5M3MH 1PDQA 4ZQ3A 1YNNC 4JI8L 4JI6L 1K8OA 4W9GA 1VF7A 1PVOA 1WR1A 1XLNA 1TKGA 1OXXK 4HIDA 3IG3A 2KTFA 1WTXA 5JVH3 2BWES 5IGBA 5IKCM 4DR6L 2BA0A 3NTIA 1YQ4B 2V9HA 2H4OA 1PLFA 3P20A 4ULLA 3FMCA 3K5OA 3AE2B 3BIID 1SE3A 1EY5A 2RSNA 3NWTA 3QG1A 4B3SQ 3P75A 3PSIA 4OX9L 2ASBA 2F0GA 2YYZA 4R1JA 1C4PA 1PH8A 2NCNA 4L2YA 1QKZA 3FP9A 4EQOA 5C44G 1X1MA 2AQ1B 4LTUA 1EOVA 3W5OA 2K1BA 3FKYA 4IWPA 5JPNC 5DPTA 3UIOB 2JRIB 1ZKHA 3DOWA 4JPSA 4WAAA 4KY7A 1K0SA 1B4OA 2AMCB 4GOPB 4TUUA 3M85A 2BQQA 1JJ2A 2MH7A 1LTSD 2I07B 1B7YB 3TQYA 1YOVB 2M4NA 2MCNB 1WSPA 4BBSH 4DV5L 3AEEB 1ZEQX 4RGOS 2L0CA 4GN5A 4HVBA 4Y7NH 4MM3B 3KOJA 3VUWA 3PRPB 3VTVA 3PO3G 3D0FA 5AZFA 3ZNGC 2QDFA 3GTLB 3RMHA 1UBQA 4OZCA 3HOVH 2UXBL 1TWAB 2Q8RE 3OYYA 5I2XA 4HJKA 4OELB 1AEXA 1M90C 4FXCA 1RRBA 5IN7A 5EBDA 1EF5A 1Q12A 1GPXA 1EQRA 1KDCA 1A63A 4JQWC 2H88B 1AYFA 1BCPD 2ZJRA 1PH2A 2FIFA 4JWUC 4CJ0B 3A5UA 2B39A 4LCDE 2K5DA 5D65A 5CHFA 2KXJA 4AS1A 3M7NA 5BYQA 1QOBA 3NS1A 2NVQB 2MBQA 1JOKA 4A4IA 2ZJPA 3S17B 4YTMB 3U2SC 1TS3A 1V5TA 4JIOU 4GLVB 1UE6A 5GAGC 2LGYA 1X3PA 3EIVA 2NZ1D 5D14A 2G9DA 2RR9A 1XMQQ 1EU3A 2KD0A 3J7A5 4LF5Q 1PYSB 4A3LH 4DBGA 4E74A 2F0OA 1DOXA 2JRHA 3TEXA 4AQYQ 1D2BA 1TWHH 1FL0A 5E6OA 1AE3A 3I5JC 3JSVB 3I9V1 3QB3A 2LGXA 3APCA 4A3EH 4HCPB 2KVRA 4OZBA 1Y1VG 1L5PA 2I1KA 4JVZA 4ZUIA 1YBYA 2YV5A 4LNKA 1V9JA 1YMHE 3LX0A 4YL8A 4BKTA 2HT1A 2N7EA 2PZTA 3VVWB 1BCPF 1RTNA 3QOLA 1B50A 2K5VA 1WCMG 3K5LA 4OO1I 1EZ6A 4JI4Q 4HEA1 1JWUD 4WWNA 2UUAQ 3BG3A 1BOSA 1L0WA 3LJ3A 4CHKA 5C3JB 3KF6A 2K7VA 4HJ8A 2KUMA 4KDIC 1D4BA 2CW0D 1WGHA 1P7FA 3HM3A 4DV0L 4ARIA 2L0FA 4G0NB 4NXNL 4BBSB 2OXPA 1NENB 4Y7NB 4YWKA 3CCLA 4GB9A 2RPQA 1N9WA 3S1NH 4BXXH 1SDFA 2JP1A 4DXAB 4LWCA 2KJXA 1P16A 2J0JA 3HOVB 4JE3B 2JA7G 2PJHA 3GOEA 1XO3A 2M17A 1H9RA 3HEJA 1O7LA 4DV7Q 4OO1H 1WGDA 1MPEA 3GTQH 1GXDC 5D7GA 2DWQA 3AB9A 2B2WC 1JJGA 1V6EA 4A9AA 4IWQA 2K50A 3GB1A 3W2DA 4KJNA 4LK1C 4CDDC 4ZHPA 2JQRB 1SNDA 1II3A 3RN2A 3T56B 2ZJQA 3RYTA 2ZPNA 2Z59B 1MI2A 4IUVA 1B9NA 1T0YA 1HTQA 2DHZA 1VCBA 1F77A 4KN7C 1F2YA 3ZUNA 1E7ZA 5FO8B 2WV6D 1SIJA 1EOTA 1BCPC 1WE7A 3GTPB 1UWVA 1V1PB 3HVZA 1UE1A 1D1IA 2P5ZX 2AWTA 3ZTCA 4BVUC 1TR5A 3W1YA 3HKZE 3VR5A 3KF8B 4DA2A 1WD1A 1FMAD 2Q2IA 3K58A 1YITA 2DN8A 1SE9A 4BBRB 3R3MA 1ONLA 1AW7A 1TU2B 3JAMi 4FJYA 4X66L 3UF8A 3A55A 1SYDA 1TWHB 2WXHA 4G3XB 2F03A 3IL8A 5JEAJ 5D94A 1F9SA 1ML0D 1YVCA 2GBKA 5EDSA 3M4OH 2JXTA 4N59A 4ZRIA 4CKEA 4HPLB 4BWGB 1YI2A 4YXDB 3V62A 4HEDA 5EPJA 3RD2A 1VDVA 4FF2A 1BBXC 4DU9A 3IKJA 1WYGA 3T3NA 1PHJA 3E6ZX 3M63B 1D5ZC 3PUXA 2F0VA 4M1UB 2C5CA 2JSVX 2KKCA 3PHXB 2EELA 1STEA 1YHAA 4HCSA 1QILA 2MHJA 5EE0A 1LACA 4ANXA 4DAYB 2M00A 2SEBD 4K7WA 1Y8NB 4LLGM 1I94L 3ERQA 1GUTA 4JI5Q 5IGCA 5CHVC 4A3DG 4FXDA 1JCKB 2A6HD 2LZ6A 4JV5Q 2B3AA 1K9MC 2WXJA 2CW0C 3GTGH 3S1NB 2CJNA 1A3VA 1IKLA 4KV6A 4GDKB 3CF5A 2RMMA 4FXGC 4GNXC 3T4AC 1QE6A 1BNZA 4RM8A 2IGDA 1K8MA 1WGYA 2NMQA 1P1AA 2K52A 3IAM1 4IOIE 3NENA 3LWEA 2F1MA 3IXSA 3PS6A 3VYUA 1SFOB 4WWPA 3U9SA 3HKSA 1YQBA 1PH7A 1JOOA 3KJOA 4B3RQ 1AARA 2CKZB 1IP9A 3UIPB 4DUZQ 2EY5A 1OQQA 4US9A 4IOAA 1JMLA 4IN3A 5C0XG 5C4JH 4DDID 3CP0A 2Y0SG 1EYGA 2PQEA 3IAYA 3NHEB 5IGEA 2QC8A 3W1BA 1UAPA 3ZNID 3UQBA 4FF4A 3A8IE 2I38A 1RL2A 2EDGA 3RN9C 4A20A 1GD7A 1BMLC 2ZVNA 2XEWA 1E2ZA 2L1BA 1U4MA 1YJJA 3AE7B 1VDZA 4C80A 1QOFA 2K8BA 4LNIA 4CQNA 4DFAA 4IUPA 2F0EA 2PYKA 1DCZA 4DR1Q 1VQPA 2DNFA 4MNOA 2N1VA 1PZJD 1CA5A 1K8RB 3SFEB 4L63B 3K6OA 2VQFQ 1HUNA 3I4LA 4YY3L 2QGQA 4NPNA 1VZ8A 1EU4A 1OFFA 3V3XA 3CCQA 3NY5A 2RSOA 2WIIB 1E8WA 5E6JA 1WX9A 1PTOD 4R4IA 2JJQA 3M4OB 4W9CA 3AXCA 4ZKCB 1B9MA 1X3GA 2HJ1A 2K5PA 4HK2A 4B3TQ 1DD2A 3KLSA 4A3BG 2WKCA 1VLBA 4BBNF 1WX7A 4FXKC 4UAIA 2OHFA 1JOQA 3S2AA 2GI9A 1VMPA 5FLXL 1CHQD 2BYFA 1VQJA 1H9MA 2DZIA 1G6PA 1BXTA 4DQOC 4N9TA 2PVOD 1MHHE 4CO7A 1H9JA 1SIFA 1XCQL 1PZKD 1NJIC 2D0OA 1WXAA 3RNCC 1L6VA 1LQBA 2RDGA 4X3TA 4R4CA 2K6AA 4BKSA 1FO4A 4DNTB 2MLBA 4BA2I 2K8HA 3GTGB 3VH3B 1B70B 3K7UC 4K2LA 4C3HH 1CSQA 3EVQA 1JRUA 1WX8A 3H7SA 3K8AA 3CCMA 1XNQL 1HEZE 1OQRA 5I9PA 2Q2TA 4X3SA 2L0TA 4A3JH 4LF9Q 4DHZB 1J0GA 2A6HC 2A5UA 3CCVA 4DR7L 1XF5L 2V4LA 2PMZE 2MP2A 2Y5PA 1O78A 3J81j 2ZPYA 4RHSA 4F1SA 2KDBA 3GE8C 2NB0A 1FXTB 3L0WB 4PNYA
chains in the Genus database with same CATH topology
3P63A 3MZ5A 1QLBB 3DMUA 4ZHOA 3NTHA 1DONA 2K0PA 1A6XA 1EY7A 2WINB 5M9OA 1QWYA 5BYSA 5ELCA 5KRUA 2KA7A 4NDXA 1TS2A 3AE3B 2ZXRA 2EJMA 4FNFA 1G291 3TP8A 2K04A 1HA5A 3TMEA 2JEBI 5JJZA 3MXNA 1V1OA 4KJOA 4KKSA 3M3YB 1IGCA 5KYIA 2B63B 5IIFA 4IFDI 1PTOC 1ZE3D 1FCCC 1MI0A 2HDEA 2B76B 2SDFA 1JRPA 5IT9L 3V05A 3P1HA 1KLGD 1JROA 2A68D 5JVG3 4LJZC 2NTSA 2NBFA 1LV9A 5CV5A 4QCLA 5EGTA 1ENFA 1H9SA 4C3HB 1C77A 5H92C 2BT6A 1KFYB 4REZA 4B0MA 2WLBA 1TKYA 1I4XA 3E9SA 3C8YA 2CJOA 4IFDH 3AEGB 5LL6S 2VB2X 1C48A 1GHKA 2FE8A 1S5BD 3HVDA 4H2AA 4PMWA 1SSOA 2KQ3A 1PFMA 2O4XA 1N5WA 1I50B 4K2KA 3RFZB 2YU9B 3BWUD 2Q8IB 2W3SA 3OOCA 3SR6A 5T1GA 5CV7A 1CTMA 3J9CA 2KWDA 1A70A 1IBXB 1DJRD 5EE3A 1JWMD 4ARCA 1BCPB 3P7JA 2PZWA 1STAA 1TS4A 2QJLA 4A3FB 4XT1B 1C79A 2INPE 1WXQA 3VRBB 4QF4A 1N5XA 4IZ8A 1UGJA 3E5SA 3NUCA 2BB5A 2SAKA 1QQRA 1PDXA 1G2SA 3W1SA 2WACA 3GTKB 3NBHA 5A2QE 4C3IB 2ONQA 3D3RA 4KKIA 3KBXA 1NR2A 5CYUA 5HHDG 4KKJA 2A68C 3Q6SA 3GTOB 3DWMA 4MH8A 1FXAA 1YN5A 4JK1C 5G5GA 5JEAG 4F7XA 4YWGG 2L55A 4WJWA 1E0BA 5C3EB 2CVRA 5J39A 1JQ4A 3FAHA 1L0YB 4QUFA 5BN4A 1JWBD 2EVBA 1ROEA 3AE5B 1C78A 1CHPD 5H8YE 4FVMA 1BUIC 2Y3AA 2KOLA 1T5EA 4YIJA 3J81E 2A6ED 4PT5A 1XCTL 4ZAIA 4R8IA 1L4ZB 2B2UC 2Y5CA 2L83A 3KWVA 3P4QB 4ZUJA 3OWEB 1AZQA 1PUTA 2L12A 1MHXA 1KAAA 2EYFA 1NUCA 3R3OA 5I9OA 3EROA 1WTPA 3QWNA 1Y1WB 2HTME 2EPBA 3AEDB 3PUZA 4A3IB 2KCCA 2D5DA 5EE1A 2X38A 2BA1A 4C1NI 1M8AA 2AX5A 1QNUA 2O5JC 4RA8A 3KQ4A 3AH7A 1LTTD 2JA8B 1ZXIA 5FOBB 1PTOH 3D31A 4DGZA 2CQAA 5IGDA 5EKIA 1EWYC 2AUJD 1XX8A 2FMMA 3FRPB 3N6RA 5COYA 1KLUD 3E0JA 1VMCA 3IT4B 4QIWB 1UNSA 2EJFC 3W5UB 3BK2A 3PUYA 4RH6A 2WXFA 4RNAA 3TBIB 1XWEA 1TWCB 3RD4A 3HKZB 5A35A 4GDLB 5EJWA 5C3XA 1SJHD 3WCQA 3QJYA 3H09A 5C4XB 3PMFA 4KK7A 5F2DA 2PPBC 2A6EC 3L7ZC 4KKUA 1QG7A 1I7HA 3AMZA 3OIPA 4P6VF 4U673 1RJTA 3OHXC 3A56A 3IFTA 3NHHA 3HRZC 3ND8A 3N9YC 2LMCB 3SFDB 3D6CA 2DNCA 3ZJVA 2BYTA 3FILA 1I3QB 1L0VB 2EY2A 4CKBA 1Q10A 1PTOB 4N6EB 5ELBA 1NI3A 4B0EA 3S1RB 3I4NB 1K53A 3NZ3A 1O80A 1PFDA 3TP5A 1SB3C 2B2VA 4KX6B 2QILA 4M0WA 4RGNA 4WORA 2RA4A 1A15A 3EJIA 3TEZA 3X3NA 2ZXOA 4XDXA 5DM73 1WGKA 2WDVB 1PYWD 4O1NA 2LEKA 1W6KA 4L6TB 1PRTC 2RPVA 3D4DA 4BY1B 1EYAA 1WTQA 2J53A 5E4XA 2V4DA 3S1MB 3MEHA 3Q24A 1SYGA 4O42A 4DXFA 2V3PA 1PGAA 2XRSD 3AN1A 2PIAA 4HKQA 1EFID 1HCZA 3BVMA 1FRDA 1EWCA 4IUNA 3PIP3 3FDTA 5JPMC 1CJEA 2ICIA 4YSXB 4CHTB 4I7ZC 3MAQA 2IPKD 4ILWA 5EQ0A 2ZT9C 5KNBA 4R3DA 2LGIA 4J6HA 1YQ3B 1PFNA 3L3OC 4B9WA 3S2HB 5EKLA 1WRIA 3PIO3 5IGFA 2AQ3B 3BZDB 5M3FB 4XWTA 3BDCA 4H7BA 3HUIA 4NJCA 3SVMA 1GUGA 5M3MB 2XNAC 4WQMA 2KQ4X 1HFGA 2W54A 1RTOA 1K50A 3ABVB 2D2CC 2GA4B 2WXMA 1K51A 2YEPF 4ABNA 3GO5A 3MHBA 3CKIB 2WQYB 2OEOA 4HCEA 3SE0A 1PZID 3BYTB 4QMGA 2DLBA 1TVXA 4OO1G 2IX3A 4NKLA 3J80E 1AN8A 2OT2A 2IL8A 3H6MA 3BDLA 2JX5A 2FFKB 1RF2D 4XQNA 5I4DA 3GTMB 2EOTA 5IODA 2B8GA 1LT4D 4DNRB 3GP7A 3Q69A 2B2YA 3VR2A 1PFBA 3S14B 4ID6A 3URYA 4IQZA 2NVYB 1HTPA 2J4XA 2Z1CA 3OSOA 1B53A 3DWGC 2WB1B 4KI0A 4RGMA 1J7AA 4RCOA 5T1IA 2XWJB 1RODA 1SYEA 2L4NA 3OW7A 5M5XB 1X32A 2HQEA 3SEBA 2B8FA 2WXQA 4ZRQA 3AEBB 3NVZA 4N58A 2I2YA 1JICA 3JAML 1QT9A 2WP8J 2FJ2A 2IT1A 4B08A 1GB4A 3C46A 3NBIA 1TZOA 1VZ6A 4DAPA 2QCPX 4RGTA 5K36H 2NUCA 1Q1BA 4BA1I 2TMPA 1SNCA 1ZYRD 3QIAA 4A3EB 1LTAD 3Q23A 5C5MA 2OEDA 3PO3B 1C8CA 2B2VC 4K5XA 1STGA 1CK1A 3LYYA 2TSSA 1BUVT 2HUGA 4X3UA 1Z47A 3C1EA 1STBA 1SNMA 4XQQA 1VJKA 4G7OC 2EYOA 3BDOA 2EZVA 4TSSA 1QF6A 4IUTA 3P4RB 4EGVA 4RF1A 4IDIA 3KBGA 1RD9D 4OVZA 3OMGA 4ZYSA 5J22A 3GTQB 2B2TA 1SAPA 1PXUA 4IUUA 1FYCA 4L23A 1C9FA 1D5XC 5FLXE 2X69A 2QIEB 1FXIA 3DWAA 2BB6A 3P4PB 1Y1VB 2F0HA 1C4CA 3DWPA 1I4HA 1GUOA 1B2TA 2KCNA 1WCMB 1F2LA 1MSHA 4H44C 1A2TA 2QSDA 1A3UA 1G8ZD 3NTKA 5C0XI 1IW7D 5GXGB 3AE4B 4V190 2KAJA 1ESFA 2R3ZA 3I72A 1NVID 1V43A 1E9MA 1I4RA 4TKOB 1OO9B 1SYBA 1SNOA 3SHLA 3R8BA 1DOIA 1Q3LA 1Z7TA 2BCOA 3NQTA 3U4EG 2KEDA 4NAMA 5HFYA 2A73B 2MEKA 1FRRA 1E0ZA 1Z6HA 3K5MA 1G2TA 3NWSA 5FR3A 1EEID 4K5VA 1PRTB 5I6WA 1HTLD 4U68A 1EY0A 1N62A 4KHZA 1MBYA 5C0XH 4OZAA 1OXTA 5CBEE 4ME5A 3ZJTA 1WD0A 5EBCA 3F2UA 1O7ZA 3R2TA 2NYZD 3GV6A 5G3LD 5J1ZA 2AUKA 3IAS1 1TT2A 5I2YA 4KD4A 2O5IC 1DOYA 4MIUA 2NN6G 1ILQA 3A7AB 1FR3A 1WTRA 4PMCA 5AFWA 5C4JB 2MJ3A 4TQUS 3W5VB 2MUYA 2B2YC 4R9WA 3U7ZA 4J1MA 4RKBA 5IT9E 3Q22A 2X6GA 3AB5A 1HHVA 4CGYB 3MC0B 3OPOA 1GAQB 2JYOA 1KH0A 1J8IA 5HI1A 1D5MC 3NSWA 3IFDA 4HSPA 1HQRD 5G3LF 2WNMA 3VYTA 2F0LA 3N52A 3PZ7A 1X3QA 4MN3A 2R6GA 2ON8A 2WXLA 4M8AA 2WXPA 2F0TA 4OIKA 3SK8A 1IW7C 4BS9A 3TDQA 3WDNA 2VNUD 3BVGA 2PVGC 4H0LC 2F0KA 5KIXA 2N9LA 3VYSA 1EY8A 2W55A 5FKAC 4AYBB 1V1PA 3MWYW 1V97A 2K9XA 4JX1C 3KWLA 1HPCA 2E2IB 1F0ZA 3KF8A 1TY0A 3W9CB 1MGSA 4RHRA 1SYFA 3U52E 1EEFD 1SMYD 1ZDXA 4P2CB 2IGHA 3HS0C 2VB3X 1LO5D 5IOCA 4A3JB 3BK1A 1RCVD 3TUOA 2WXOA 2V4IB 4YTPB 1Q8IA 2BE5D 4LK0M 3ZGZA 3FVQA 1G91A 1WWTA 3AECB 4WH4A 1EL0A 1T6BX 5FO7B 4KN4C 4DAYA 1RM6C 2B2TC 4C1NK 4CJ2C 1XLOA 3A8JE 3NPPA 2HDMA 2JE6I 2IGGA 1LT3D 1NAPA 1S5ED 2JZPA 1JWAD 4K6DA 1U9RA 5G5HA 4KGSA 3ZQ4A 4K14A 2INNE 3GQBA 2F0MA 2K22A 3S2DB 4A93B 3P1MA 4X3KA 1L4DB 3RLFA 1EYDA 3C2PA 1R9TB 1NCVA 4RKLA 1VRAB 1I6VC 1FCLA 4QUCA 2PLPA 1E2VA 2K01A 3BYYB 1N61A 5FK9C 3L4PA 3VR4A 4IUQA 2FHTA 4XWWA 1M4VA 1I4QA 2N0SB 3MTSA 2SNSA 3ONAB 3Q8EA 3FPUB 5HURA 1Q1EA 2RDFA 2SOBA 2PTLA 2WS3B 4BY7B 1S4ZA 4RCNA 1IGDA 1D6EC 2Q8TA 4EE2A 3KLSX 3VA7A 5HGTA 2VZKD 1SNPA 1SMYC 5FO9B 3B2FA 4L8JA 3HOUB 2JA6B 2D5GA 4NZLB 5EPKA 2WXRA 2XSCA 4NP5A 3WOFA 3NXWA 1QCBD 4H13C 4G7ZC 2K03A 2N9KA 4C7YA 2NVTB 1FFUA 5C3WA 5E4WC 3FKIB 1IL8A 1FM0D 2WXNA 3EA6A 1EYCA 2CHBD 2J7ZA 3H91A 4OIJA 3DM1A 3PO2B 5D3DA 5EPLA 4DN4M 3BS1A 3ND9A 2X6LA 3PZ8A 1CQFA 5CMDA 1XTCD 2V0GA 1Y56A 3IT6B 3UI3A 3V96A 1CZPA 5T8IA 2F3WA 2J0TD 1DM0B 1FNVA 1TQOA 3KK7A 3X3MA 5A2QL 5JEAH 4XQJA 1B9RA 2KVMA 3CRLC 2G1EA 4L1BA 3RUZA 3VR6A 2N88A 3B2GA 1ACCA 1WTVA 2E2JB 1JR0D 1TJEA 1ET9A 1EQVA 1EWHA 3I57A 4A55A 1XEEA 2PCFB 3TEYA 5CV4A 1QOHA 1FEHA 1C76A 3FPPA 4PV1C 3NVWA 1UWXA 3CU7A 3T53B 1J9OA 2RKSA 2EE1A 5KEEA 4XE0A 2HDLA 5M5WB 4F87A 2MPMA 2JEAI 1KRHA 3HG9A 2ACZB 1AFPA 1LT6D 5ISRA 4FYDA 2LJIA 3H0GB 3HP3A 1ET6A 2RBMA 2CU3A 5CR3A 3I3CA 1NR4A 4YT0B 1HZ5A 2EY6A 2R92B 1YN3A 2DBYA 2MGSA 3EFXD 4C3JB 4A6QA 2LHEA 5CV8A 2L11A 5BN5A 3DEOA 3AEFB 2E76C 3KLRA 2B2WA 2F4IA 1JW9D 4CBVA 2PMVA 1S5FD 2D9UA 4HSVA 3G6JB 2M9VA 1P7EA 2M56B 3AEAB 3P4SB 1EIGA 2VXWA 3L9AX 1JALA 5K5PA 4US8A 3VR9B 1F9PA 3RZOB 1EY6A 1KABA 1R4PB 3VR8B 1A3TA 1TYGB 4DK1A 5DEHA 1IBXA 1VF5C 2PNRC 4ZKBB 1BO0A 4HJGE 3A54A 1G6ZA 1ZP0B 5AUKA 1ZOYB 1DOKA 2IX1A 3C1FA 2ENBA 2N55A 2AWNA 2JYEA 4FP5D 5IGGA 4NW2A 3HGBA 1MD2D 3VQIA 2SNMA 2V3NA 4ZK9B 1Q90A 2BS4B 1T3QA 3NVVA 1ZXTA 4MACA 1NYRA 4WAFA 4A8XC 4HMJA 5CV9A 2F0JA 1BR9A 2EYHA 3CWIA 1DXMA 4Z9CB 1VR9A 3D4WA 3A8KE 3AM9A 2QF7A 2MJDA 2XVSA 3S1QB 2IDYA 5DM63 2ICEC 1KNAA 3I4MB 2L52A 2H89B 3Q8FA 5I6YA 1ESRA 3AE6B 5EKKA 4V0BA 4GZYC 4IFDJ 4LAAA 2L1AA 2BS2B 2BOSA 1B44D 2NTTA 3GS2A 1K83B 4KGRA 3I8ZA 1SXTA 1HQMC 1SBBB 4CKCA 3MXPA 5BN3A 4PMBA 2R61A 2XWBB 3AE8B 2E75C 3BVZA 2E6XA 4WFN3 1E7PB 1E2WA 1AZPA 2LHDA 4ODGA 2PMZB 1SYCA 2J52A 2QEJC 3ETRA 4IURA 2H1EA 4R8NA 4A3KB 2BS3B 3C3LA 1RKNA 3SR1A 1TKEA 1I4GA 1SF0A 2IX0A 2G9HD 3UI2A 4RFBA 2WXIA 2R93B 2LS01 3EGRA 3U9OA 4PQXA 4LMQD 3JAME 3ITPA 1CZWA 1QNKA 4B9XA 2QDBA 1IUEA 1SNQA 2DNEA 1R7SA 3T51B 4TRDA 4Q5VA 1SJED 1EZ8A 4XT3B 4MT5A 2JU6X 1QJOA 3O13A 1TY2A 4FF1A 1ENCA 3TZDA 5AUIA 2DYMA 2BDOA 3MHZA 1JQYD 3VR3A 4N9PA 3D8GA 1HZ6A 3LNNA 2E74C 1TWGB 4G7HC 5K36G 5TSSA 1YN4A 1W6JA 1F2RC 5BMIA 1IYVA 4I65A 1QOAA 4ZRZA 2L5TA 3LXFA 3S15B 4MHEA 1K52A 1Y8OB 3R93A 1ILPA 5E1FA 4DF7A 3DHQA 2ID0A 5CORA 5C44B 1XYIA 2K05A 3K7AB 4XTCS 5BMHA 1F9RA 2KECA 2F0IA 3MA2B 3H3VC 2A5HA 5CC4A 4C56C 1XLPA 3LWUA 3RPFC 2M19A 2IJ0A 5ELEA 4HMIA 2F0QA 4EVOA 3J80L 4KY6A 2F0SA 3I70A 1LTBD 2FBWB 2LMCA 2EXZA 4UDUC 3PUWA 3LB8C 1WTOA 1H9SB 5ELFA 4WWMA 2VZKB 1KDAA 1XXGA 1N60A 1SE4A 3NK9A 4QB4A 1KTKA 1WVLA 4S3SA 2PW7A 4F88A 2LFIA 2E2HB 1JC7A 2DY7A 1U4LA 1FD7D 1QB5D 2JWUA 3KUPA 4RAUC 4NAWB 1YJIA 2EY1A 5C4ZA 1GUNA 1RWSA 5LL6X 2WKDA 1SSNA 1QOGA 1OXUA 4XYOA 1N63A 3AMUA 1GJXA 2A74C 2BDNA 2N7JA 3SK4A 3S16B 2MHVA 3VYRA 1KF6B 4KHVA 2L32A 3E56A 4HN7A 3MXUA 4Q0FA 3NVYA 1F2ZA 1ZXHA 4A3GB 3SK5A 1ZUD2 1Y8PB 4WURA 1ZKOA 2K33A 4C3HG 3J7YW 1JE4A 1VZ7A 4OL7A 1L6UA 1A2UA 2EYJA 3J7AF 1CFMA 1FGBD 2MP1A 2JA7B 4XDDA 4OW0A 1ZYRC 3PV0A 4WIPA 1D1KA 2F3VA 5BYQA 1B3AA 2KMMA 4OHJA 2NVXB 2BW2A 3D4RA 2LKVA 1L0XB 4OGQC 5C6AA 4TMAB 1ZPSA 1C4QA 1CT1D 3RZDB 2W82A 2IW3A 3TSSA 4FF3A 3OWFA 4HRSA 1JWSD 2ZW0A 4HR7B 1F2RI 1AWDA 4CJ1B 3NP8A 2C9OA 4DAVA 1GHJA 4KTAA 1EY9A 2EJGC 2WXKA 2MJ8A 2K5QA 2W3RA 4C7ZA 2KDMA 4RWSC 4P16A 3HOXB 3NRZA 3Q8AA 1CZGA 1PTOF 1U4RA 3MFGA 4F8MA 4K8IA 4JWSC 1CM9A 5DNFA 5LNK1 2NN6I 1FFVA 4K8JA 4C2MB 2PW5A 5D3IB 3TN2A 2ZXPA 4WRDA 3GV3A 2FUG1 3H8HA 2J42A 4Q2JA 4A3DB 2KACA 3OIQA 4C3IG 4ZLTF 1DYQA 2B2UA 1V8CA 4KGTA 3R2IA 2WU2B 1PMRA 1O7YA 5BMGA 2F0PA 3H94A 3TEWA 4D2KA 4FO2A 1GOZA 3HRDD 4IFDG 1BDOA 4K5WA 5KNCA 2NN6H 3DWQA 1RDPD 2K32A 2D62A 2Y0SB 3W3AA 3AV8A 5KNDA 1T5XD 1NSNS 1NEKB 2WU5B 4HAEA 1RYJA 2F0NA 3MVVA 3FEWX 4ITKA 1RFKA 3ZJUA 3K59A 2KN4A 2BBCA 2WDQB 3K57A 4K6LA 3V2TA 2DY8A 5JXVA 2EYPA 4XDCA 2IWHA 1GB1A 4A90A 2O2LD 4KMUC 3VA5A 1MSGA 4A3BB 3SK6A 5KYLA 3MXGA 5CBAE 2EYLA 1FNUA 2PW9A 3CRKC 2ZW1A 1STYA 3QOJA 2YEPB 4USAA 1FNWA 1J7CA 4NMZA 1J7BA 1LTGD 1H9KA 2PO4A 1STNA 2K3UA 2PKOA 1KNEA 2L9HA 2GB1A 4TQ1A 3CHBD 3S9WA 3FILB 4ZOHC 2F0WA 3PO0A 3NE5B 1EM7A 5BYRA 2LFNA 5MPOA 4GLSC 2F0FA 2OF1A 2Z8LA 3FC4A 3M4YA 1FD6A 4G4KA 5M5YB 3I91A 1UEAB 5DAUA 2WXGA 2JYTA 2F0UA 1LT5D 4KD3A 3T13A 3K5NA 1HUMA 4YTNB 5E3FA 2M2LA 1IYUA 2JA5B 3HOYB 3AE1B 3A7LA 2LY7A 1FIQA 1UUPA 2EYMA 3Q8BA 1EIHA 2KHSA 5JAVA 3DEPA 2XRQD 2DYOA 3VRAB 1CA6A 3HOWB 2BE5C 4C3JG 3NUHB 4ZRPA 1HA6A 2RVLA 1PGBA 2HCCA 1NYQA 2AWOA 3GD7A 3CQZB 5C2TB 1TS5A 2AQ2B 2PZUA 3SXHA 4J3OD 3ZYYX 1S5DD 2R7ZB 5CGKA 1IKMA 1OXVA 2QMTA 4HROA 1U4PA 1IHZA 1I4PA 2XIWA 3Q0AA 1BF4A 1EY4A 3MJ5A 5ELDA 4XIGS 4DXGA 1RHPA 2EKIA 3MFYA 1XLQA 1DOMA 1E6EB 3Q8CA 4EQPA 1ENAA 1F2MA 2RDHA 1JORA 4HKZE 4HTHA 3I73A 1YNJD 2MJEA 2A69D 2E2DC 3MP9A 3WOEA 1CI3M 5C4HA 3TP7A 3AU7A 3G7LA 4JBWA 1GUSA 1SE2A 1DOLA 3I90A 2WAQB 1GUWA 1SEBD 3T16A 4DK0A 1CQVA 3HOZB 5CV6A 3DUZA 2HCIA 2WDRB 1LLRD 2XN9C 1EQTA 4J8QA 5NUCA 5LHY1 1YNND 3DXJC 3OMCA 2E3TA 3GTJB 1LTRD 2Z4IA 3CIRB 5KGUA 1JB3A 2M0AA 1I6HB 3PUVA 3J81L 1UWMA 1HXYD 2VUMB 2Z4HA 1ZDVA 3QO2A 3P42A 3M7GA 5EE9A 4TQ0A 1PRTD 1ICWA 1OXSC 4YSZB 4A3MB 1DGJA 4G57A 2KEEA 1V8QA 2NWGA 1Y69U 1LABA 5JOBA 4YSYB 3TZUA 5C0XJ 1TKWB 4KKTA 1C4AA 3B9JA 1F9QA 3TP6A 1AP0A 2I46A 2BTEA 1KDBA 2JSOA 1HFNA 1LTID 4AQ7A 4EQNA 1YNTE 3K0YA 5C5LA 2FMCA 2GRIA 1VCIA 4IKGA 3EUB2 1WTWA 3T3OA 2JXMB 2Q5WD 2RQXA 1MVKA 2K5WA 1PRTF 1HRJA 4RF0A 1E10A 4XXEA 3EQLC 4KY5A 4IALA 2F0DA 1YNJC 2K28A 2A69C 1PGXA 4XYQA 2FINB 1STHA 5HG2A 3J7AV 1B1ZA 2LUMA 1S5CD 3D6WA 3HZXA 3SDZA 2WP9B 4E6IA 3AE9B 1TIID 2QKIC 1TWFB 1BQQT 1R4QB 3NQIA 1DZ1A 1PDQA 4ZQ3A 1YNNC 1K8OA 1VF7A 1XLNA 1TKGA 1OXXK 1WTXA 5JVH3 5IGBA 2BA0A 3NTIA 1YQ4B 2H4OA 1PLFA 3P20A 4ULLA 3FMCA 3K5OA 3AE2B 3BIID 1SE3A 1EY5A 2RSNA 3NWTA 3QG1A 1C4PA 3P75A 1L5PA 2F0GA 2YYZA 4L2YA 1QKZA 4EQOA 4LTUA 2AQ1B 2K1BA 5JPNC 4JPSA 4KY7A 1B4OA 3M85A 2MH7A 1LTSD 2I07B 1WSPA 3AEEB 1ZEQX 4RGOS 2L0CA 4MM3B 3GTLB 3RMHA 4OZCA 1TWAB 2Q8RE 5I2XA 1AEXA 4FXCA 5EBDA 1Q12A 1GPXA 1KDCA 2H88B 1AYFA 1BCPD 4JWUC 4CJ0B 2B39A 2K5DA 5D65A 4AS1A 3M7NA 1QOBA 3NS1A 2NVQB 1JOKA 3S17B 4YTMB 3U2SC 1TS3A 1X3PA 2NZ1D 5D14A 2G9DA 1EU3A 2F0OA 1DOXA 3TEXA 1D2BA 3I9V1 3QB3A 4OZBA 4ZUIA 1YMHE 3LX0A 2PZTA 1BCPF 1RTNA 3QOLA 1B50A 3K5LA 4OO1I 1EZ6A 4HEA1 1JWUD 3BG3A 1BOSA 5C3JB 2K7VA 2KUMA 1D4BA 2CW0D 1P7FA 4ARIA 4BBSB 2OXPA 1NENB 4Y7NB 1SDFA 2JP1A 2KJXA 3HOVB 4JE3B 1XO3A 1H9RA 3HEJA 1O7LA 4OO1H 5D7GA 1MPEA 1GXDC 2DWQA 3AB9A 2B2WC 4A9AA 3GB1A 3W2DA 4KJNA 4LK1C 4ZHPA 2JQRB 1SNDA 1II3A 3T56B 1MI2A 4IUVA 1B9NA 1F77A 4KN7C 1F2YA 5FO8B 2WV6D 1SIJA 1EOTA 1BCPC 3GTPB 1V1PB 3HVZA 1D1IA 1TR5A 3VR5A 4DA2A 1WD1A 1FMAD 3K58A 2DN8A 4BBRB 1ONLA 1AW7A 1TU2B 3A55A 1SYDA 1TWHB 2WXHA 2F03A 3IL8A 5JEAJ 1F9SA 1ML0D 2JXTA 4N59A 4CKEA 4BWGB 4YXDB 4HEDA 5EPJA 1VDVA 4FF2A 1BBXC 4DU9A 3IKJA 1WYGA 3T3NA 3E6ZX 1D5ZC 3PUXA 2F0VA 4M1UB 2C5CA 2JSVX 2EELA 1STEA 4HCSA 1QILA 5EE0A 1LACA 2M00A 2SEBD 1Y8NB 4LLGM 3ERQA 1GUTA 5IGCA 4FXDA 1JCKB 2A6HD 2WXJA 2CW0C 2CJNA 3S1NB 1A3VA 1IKLA 4KV6A 4GDKB 2RMMA 4FXGC 1BNZA 3T4AC 1QE6A 2IGDA 1K8MA 2NMQA 4IOIE 3IAM1 3LWEA 2F1MA 3IXSA 3VYUA 1SFOB 3U9SA 1JOOA 2EY5A 1OQQA 4US9A 1JMLA 4IN3A 5C0XG 2PQEA 3IAYA 5IGEA 1UAPA 4FF4A 3A8IE 2I38A 2EDGA 1BMLC 1E2ZA 2L1BA 1U4MA 1YJJA 3AE7B 1VDZA 4C80A 1QOFA 4CQNA 4DFAA