1CQVA

Crystal structure of staphylococcal enterotoxin c2 at 100k crystallized at ph 5.0
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
239
structure length
232
Chain Sequence
ESQPDPTPDELHKSSEFTGTMGNMKYLYDDHYVSATKVMSVDKFLAHDLIYNISDKKLKNYDKVKTELLNEDLAKKYKDEVVDVYGSNYYVNCYFSSKGGKTCMYGGITKHEGNHFDNGNLQNVLIRVYENKRNTISFEVQTDKKSVTAQELDIKARNFLINKKNLYEFNSSPYETGYIKFIENNGNTFWYDMMPAPGDKFDQSKYLMMYNDNKTVDSKSVKIEVHLTTKNG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN (STAPHYLOCOCCAL ENTEROTOXIN C2)
publication title Structure of staphylococcal enterotoxin C2 at various pH levels.
pubmed doi rcsb
molecule tags Toxin
total genus 68
structure length 232
sequence length 239
ec nomenclature
pdb deposition date 1999-08-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01123 Stap_Strp_toxin Staphylococcal/Streptococcal toxin, OB-fold domain
A PF02876 Stap_Strp_tox_C Staphylococcal/Streptococcal toxin, beta-grasp domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.110 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1cqvA01
3.10.20.120 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1cqvA02
3R2TA 1MD2D 4DXFA 1JWMD 2NTTA 1LTGD 1M4VA 1PRTB 4TSSA 1PRTC 2QILA 1AW7A 1D6EC 3O13A 1SE4A 1CHPD 4RGOS 3R8BA 1HA5A 1KLGD 3BVZA 1I4QA 1ET9A 1TS4A 1HXYD 4RHSA 1PRTD 1BCPF 1XTCD 1D5ZC 5ELFA 3R2IA 1FNUA 2ICIA 1BXTA 4C56C 1SE3A 1SJED 1AN8A 3MC0B 1DYQA 1XXGA 1BCPB 1EEID 1L0YB 3BZDB 1FD7D 3W2DA 1LTBD 1V1OA 5ELBA 3DWAA 1BCPD 4RCOA 3V05A 1LTID 1DJRD 1TY2A 3GP7A 2AQ2B 2IJ0A 1TS3A 1STEA 5I4DA 1EU3A 1RCVD 1V1PA 3CHBD 1PZKD 4Z9CB 1LTRD 3DWPA 3URYA 1I4GA 1S5DD 1QILA 2R61A 2IPKD 1I4PA 1S5FD 1G8ZD 1CQVA 5FK9C 1ESFA 4RH6A 1PZJD 2Z8LA 4NZLB 1RDPD 3DWQA 5D3DA 1GOZA 3TSSA 1B1ZA 1LT5D 4BWGB 1ENFA 1D5XC 3BYTB 1ET6A 2AQ3B 1JQYD 1PZID 2XNAC 1S5CD 3BVGA 5ELEA 1EEFD 1LO5D 1B44D 1LT6D 1PTOH 5TSSA 4L63B 3SEBA 1FNWA 2XN9C 1FGBD 1JWUD 1SE2A 1I4XA 3EA6A 1CK1A 1S5ED 2WV6D 5FKAC 1LTTD 3BYYB 1JWSD 1JR0D 1SXTA 1KLUD 1CT1D 1YN3A 4ZYSA 1SBBB 1FNVA 1EU4A 1YN5A 1RD9D 2SEBD 2XRQD 2RDHA 4RGTA 1UUPA 1YN4A 2XRSD 1I4RA 1HTLD 4RHRA 1LT3D 4RGNA 4OHJA 5D3IB 1TS2A 4O1NA 1PTOF 1I4HA 1JCKB 4RFBA 1SEBD 3MFGA 1KTKA 1TS5A 1S5BD 2G9HD 3EFXD 1HQRD 1LT4D 1LTSD 2O2LD 1PTOB 1PTOC 1EFID 1CHQD 1D5MC 1F77A 1SJHD 3BVMA 5ELDA 1L0XB 1UNSA 3OWEB 1PTOD 1T5XD 1BCPC 2TSSA 2CHBD 1RF2D 1TY0A 2QEJC 1EWCA 1PRTF 2J4XA 4L6TB 4RGMA 2AQ1B 1LLRD 2NTSA 3KLSX 4K6LA 4UDUC 1PYWD 4DXGA 1LTAD 5ELCA 2RDGA 1V1PB
chains in the Genus database with same CATH superfamily
4B3RQ 4OZBA 2PO4A 4JYAL 3UI3A 4DGZA 4TQ1A 4DNRB 3FKIH 2CKHB 4ALPA 3ZJVA 4FF2A 1L6UA 5C4XG 1QNKA 4OELB 2ZPYA 1A5RA 3DBRB 4M0WB 2AMCB 1NMFA 1CKMA 1D5ZC 2Q8IB 3BDCA 2L83A 2WXFA 1QOAA 1HNZL 4KHPQ 2UU9L 4GOPA 4DKAC 1EWYC 1CSQA 4LF5L 1NYQA 5LNK1 3AEFB 4RKLA 2DYBA 4NKLA 1STAA 3BZDB 4HN7A 4OL7A 1TGZB 1CZWA 1HZBA 4A3EG 1WTRA 2C5LC 3K5OA 1Q5WB 1JJ2A 4DV1Q 3VH4B 3P4SB 1YNJC 4EQOA 5FO8B 4K2KA 3ZNGC 3APCA 3JC66 2LS01 5E1FA 1JRPA 1JE4A 2WU2B 1IYJB 1F2RC 4P6VF 1B8AA 1WM3A 4HJ7A 2JQRB 5AZFA 4A93G 3PZDA 4GLVB 1BDOA 1S5DD 4ZCKA 4HAEA 4MSQB 2D2QA 2JA9A 2BBCA 3ZXVA 3FKIB 2JEBI 3SE0A 4PQXA 4KIKB 3T9LA 2JWUA 1SGHA 1BBWA 1AH9A 3HIZA 3NHEB 4IWQA 2GLSA 4KSKC 4AJWA 2R92H 1N60A 2A6HC 4J3OD 2M56B 3BYTB 3RNBC 1W6KA 4EGVA 4JI0Q 2RDFA 5E7NA 3H3VH 1A8VA 4JC0A 3BVGA 5ELEA 4L5TA 5T8IA 1EEFD 2TMPA 3Q8CA 1LT6D 4JBWA 4PZ6A 3UQAA 1ENAA 1G2TA 1R4MB 3KF6A 1F2MA 4DV4L 2B63G 3GTKH 2EYHA 2Y5CA 5IYBG 4KKIA 4KSLC 2AUKA 1LTTD 1WFQA 5HURA 4W9LA 4FJYA 1YQBA 2EYJA 4K8JA 4JWUC 1E2WA 2KVMA 1EY9A 4PG3A 2K5HA 3QB3A 4KGRA 4HRSA 4M0WA 2PMVA 1YJ9A 4OGQC 3Q8DA 4NY0A 1M8AA 3FKIG 4Q0FA 1Z7TA 1EM7A 4TQUS 1YN4A 2M2LA 5IA7A 1SF0A 5FO7B 2PI2E 4RHRA 3TP8A 2BF8B 4OHJA 1ZYRC 2PW7A 4R9WA 2R92B 1O7LA 1ISNA 1CJEA 2KWDA 5JOBA 3HOUH 1KLVA 3KLSA 3GZNI 3A1QA 3GE8C 4M8NA 3I56A 3BIID 1NTGA 4DK0A 2WIIB 1XLQA 2PVOD 4CJ2C 2FE8A 3UDIA 2B29A 3LXFA 4ZRJA 5AZHA 3NOBA 2V3SA 2QCZA 3GTKB 3NVZA 2JY6A 2E74C 3VA7A 4AQYQ 3NEMA 3NTKA 2K1FA 2RPQA 4HK2A 1CTMA 4YT0B 2QEXA 1G291 2B8GA 3SVMA 4FLHA 3WALA 2BTEA 3C8YA 1GJZA 1FCLA 3NS1A 4IPDA 2L7RA 4CGYB 2DWQA 2AQ1B 2RDBC 3FC4A 2QGQA 3R3MA 4K6LA 3DBRI 2J42A 5C5LA 1E2ZA 2O4XA 2X6LA 4P2CB 1GHKA 2LEKA 3AE2B 5EKIA 4ZKBB 2NTTA 1MVKA 3A7LA 2L52A 1IBLL 2WWZA 4LFBQ 1DOMA 4HKQA 3LGJA 2CCZA 4JI6L 4DR6Q 4DV3L 2PE9A 5J3BA 4BFRA 3QWZB 4W9CA 2V9HA 2ACZB 2R92G 2EVBA 4OONA 3HOUB 3PSIA 2JT4B 4L2YA 2PPBC 1XLOA 1KIXA 4JV5L 3VTUA 2ICIA 1MHWC 4KMUC 1X3QA 3U58A 1TKGA 1HCZA 4A55A 3IAS1 1F2RI 5J22A 2B2YA 2HD3A 3WAPA 2FIFA 5ELOA 1R4PB 2FMCA 4IDIA 3KQ4A 4WJQA 1NR2A 2YU9H 3WCQA 3H1UA 4WJ3M 2WDRB 3SK8A 4USAA 1JRUA 3TIXA 5KYIA 5GAHC 4IQZA 3GB1A 2AWOA 1HE8A 1JICA 2OQ0A 3L10B 4AUQC 5E4XA 2JE6I 2NVYH 3EBEA 1YNJD 3I90A 4H7BA 4R1JA 1TT5B 2CFMA 1EZ8A 1KDAA 2CKZB 3MZ5A 1PUTA 1IYUA 1D2BA 2XBBC 3J7A5 1UWXA 2Z8LA 2ZZPB 3NHHA 4Y52H 1YZ6A 3HOUG 2MQJA 3F2DA 1R4MI 1WGGA 3QIJA 2J0KA 5G3LD 3VR6A 3AE8B 4IOIE 1IL2A 1H8CA 5JEAJ 1EF1A 1ZKHA 2EJGC 4PZ8A 4BY7H 5LXHA 4MN3A 2NBVB 3NG0A 2A6HD 4RNAA 2ZJQA 5C3JB 3KOJA 4F88A 2YU9B 3DVNU 2LUEA 2JX5A 2R3ZA 3S2HH 4KDIC 4R4CA 4RWSC 1X65A 4JI4L 2MBQA 4E71A 2NVYB 2UXDL 2GBNA 4LF9L 3N52A 3RNCC 4IZ8A 1P3QU 4YHHL 1RD9D 1C9OA 1STGA 3EIVA 3PTFC 1K73C 1SMYC 4K7WA 3D8GA 2I0QA 2AHOB 3CF6E 3DM1A 2Z6BA 2K25A 4V190 3FILA 2Y5BB 4LF6L 3NJTA 1LM0A 3A9JB 2JQOA 1V86A 1L0VB 1OTRB 5HGQA 1TS5A 1ZYRD 3KDFB 4BY7B 3QJYA 3S1NH 2RCNA 4IM2A 5CV7A 1AEXA 1DCZA 1WJ4A 2L32A 1NNXA 1F77A 1X55A 4P74A 1UAPA 3UIPB 2N9XA 3S2HB 3D4DA 2D07B 2YEPF 2MUYA 2QEJC 3E9SA 1VCIA 3RN9C 4QUCA 1HZCA 3ERSX 1CQFA 1LLRD 3L13A 4IWPA 3WANA 3LDZE 3KLSX 1GUAB 4IO9A 2KDEB 2K3UA 4IFDH 3AEDB 2K5PA 4HCNB 2SNMA 1MD2D 2G45B 1YEZA 4DR4Q 1XJVA 1D6EC 2BA0A 2LKVA 2ONQA 1U0LA 5LHY1 1L7YA 1LFDA 1LM8B 3MJWA 4HJKA 2KO3A 3U4VA 4HCPB 3OJ4B 4KX6B 2A5HA 2F3VA 4POFA 3R2IA 1J7AA 4H2AA 1PMRA 3TZUA 4DAMA 1XWEA 3PHWB 4GN5A 4BY7G 3S1NB 1K0RA 1G6ZA 1Z2MA 4IC7B 3ZDMC 2MP2B 1I35A 3FHWA 3M4YA 2F4VQ 1SE8A 2F0NA 4N59A 3OHXC 3AU7A 4YSYB 1L0YB 1A2TA 2KHJA 3Q0AA 2FIDA 4W9DA 1LTBD 1X6OA 5ELBA 4K14A 1PFMA 4AH6A 1ICFB 1I3QH 3C1EA 4IM0A 2BA1A 2L1AA 4CKCA 2AL3A 3DCGA 1DJRD 4WWNA 2N55A 2K33A 4JWSC 3H9DA 4IKGA 2F4IA 1TIID 4Z9CB 5IWAL 3A9JA 1LTRD 1JB3A 2MW5A 4X6AH 4JI7Q 3MEFA 3MXNB 3M4QA 4DPGA 2V3PA 3P4PB 2LD9A 4FBJB 1UE5A 2MNAA 3UI2A 1NCVA 1V8CA 2PPHA 5G5HA 2PZTA 2JA7H 1HNWL 3FVQA 4DR5L 1CZPA 4EVOA 3NUHB 2D0OA 1B1ZA 3FRPB 1XNRQ 3U4ZA 1D5XC 4IOCA 1KAWA 5BMIA 1TKEA 1QKZA 2VRRB 3KUDB 5IGFA 2N3SA 2A4ZA 2BWFA 3VR9B 1HFNA 3TJPA 2A68C 4DNTB 1QQRA 3ZIMA 4WJPA 1ESRA 1RODA 5DEHA 2IHFA 1K53A 1I3QB 3A4SC 4K6DA 4ZUIA 3RZWC 2PNRC 2DNFA 2WX0A 1TQOA 2WV6D 4B0MA 2ENBA 1ZDVA 4YWMA 2OEDA 4X3TA 4IFDG 1BKBA 2Q5WD 1EYAA 2KEDA 1HTPA 1RIPA 4P75A 5H1SE 5JJLA 1NI2A 1FNVA 1RJTA 3CMMB 4DV2L 2M1MA 1YI2A 3IT4B 3JYUA 4BBSH 1S72A 1B3AA 2X69A 4KK7A 2E75C 4GN4B 5NUCA 2ZJPA 3CMEA 1DD2A 1JT8A 1TTNA 1ZXIA 5JJIA 2JA7B 1I4RA 5JVH3 1JWBD 1NBFC 4P1CC 1N33Q 4ZHPA 4P1BC 2NN6H 4W9HA 4JI3Q 1SMYD 3MXUA 5M9OA 1YHAA 1G2SA 4LW1A 4A3KH 1IYVA 2DENB 2X38A 4DBGA 3MEHA 2VQFQ 4JL9A 5KIXA 1TWFH 1KTKA 4HCSA 5AUKA 3RYTA 3R93A 1HQRD 1LTSD 1QCBD 1E0BA 4WFN3 2L00B 2JZ3B 3L17A 1YIJA 2LVPA 1U5KA 1VQEA 1GC6A 2NWGA 2PVGC 3A9KB 4HIKA 2JA5H 2F0DA 2K5NA 2DX5B 3MXNA 1MI0A 4AOFA 2BS4B 1YJJA 1J8CA 3WDNA 3R7QA 1QOGA 1QVFA 1LACA 3J81c 3TMPB 1RTOA 4DK3C 2W54A 1SFOH 2G9DA 2RDGA 5EBCA 2MLBA 4QUFA 4YTNB 1MBYA 4BBSB 1JWMD 3W1GA 4DHZE 1PRTB 1PRTC 5M3FG 1MSGA 5C6AA 3GOEA 1GUNA 2KJHB 2JA7G 4G4KA 1YNNC 2KTFA 3RNGC 1RAXA 2L55A 3BVZA 2LVQA 3M95A 4EFOA 4A3KB 4W9JA 1IUEA 4GS3A 2HHHQ 1TWFB 2MJEA 3BK2A 4EOYA 4NAMA 1FGUA 4DFAA 4MT5A 4FO2A 4EQPA 1SE3A 5J18A 1MJEA 4K7SA 2V1CC 2KN5A 3UIOB 4ME3A 5ISRA 3K7UC 3VR5A 3PUZA 2GA4B 2JUOA 3I4NH 4IFDI 4MH0E 2JA5B 2FINB 3K58A 2DBYA 4XT3B 4W9IA 2F0SA 1B7YB 4R4TA 4DR1Q 2GRIA 2KJXA 1UE1A 3W1BA 3V05A 1I7HA 3R3OA 1VQ5A 3F1ZA 3STBC 1BT0A 2G3QB 2O2VA 2WAQB 2IJ0A 1X3PA 3PVLA 4XYOA 3W9CB 4J6IA 4B95A 1HR0W 5G3LF 1SFOB 4GKJL 5BN3A 1NUCA 2PZUA 2R2OA 3AE7B 5JXVA 2QJLA 4BBSG 1IGCA 1VJKA 4H13C 2ZTEA 3DBSA 3K9PB 5EPLA 3CCEA 2NVUI 2NUCA 3AM9A 3NBHB 4CYEA 3DDCB 1HR0Q 4A8XC 5JAVA 2MFIA 2NN6G 3Q3OC 2Z0EB 3HGBA 3NWTA 2B2WA 3P1HA 3C46A 3I57A 1SYEA 4A3KG 2NVTH 1P1AA 1VQOA 4C2MH 1LV9A 1C1YB 1RFAA 4EQ5A 1L4ZB 1WYDA 4I6NB 1GO3E 2XSCA 1ZW7A 2Z0DB 2RSOA 4PV1C 4FHKA 2QSDA 2ID0A 1YX6B 3I4NB 4LTUA 4NMZA 2I38A 2OHFA 2JA5G 1GC7A 1MIUA 4PZ7A 4B9XA 2DNCA 4IW0A 3NQIA 1T0YA 4AS1A 2A68D 3G7LA 3GTOH 1MG8A 3A8KE 2KFKA 2BYTA 2K6AA 1CUKA 4MTKA 2WAQG 4XT1B 2UUBQ 1WSPA 3Q8BA 1JWSD 4OEMB 1C7YA 4GSWA 2W9NA 1PFSA 4MDKE 3PCOB 4ODGA 1KLUD 1WRIA 2WXNA 3PUXA 1VLBA 4LDTB 4J6HA 3J7AF 3PO0A 2V0GA 1T3QA 5M5XH 3RNUA 1OXTA 2HIVA 4WJWA 2NVTB 4ID6A 1MSHA 1WE6A 3U50C 3SFDB 1L2FA 4C2MB 3DWGC 1CMXB 5BYSA 3AU5A 2NZOA 5DPTA 2CS4A 4K5VA 1JCKB 5KNBA 2PQAA 3NTHA 2WDVB 1S5BD 3N32A 1GM5A 4DHJD 4CO7A 1C8CA 2DAFA 3I4NG 3BK1A 3QQ8B 1Z47A 2O2LD 2W55A 3D4WA 3UDFA 3ONSA 1CHQD 1F9QA 3PGZA 4FVMA 2MBBB 4OVVA 3ZJTA 3P20A 1U4MA 1WXQA 3GTOB 3IFTA 2SOBA 1WH3A 1YX5B 4K3BA 2KANA 1TY0A 1HQMC 1K28A 3NBHA 1H9SB 4JI2Q 3CMAA 2C35B 4QQBX 1E2VA 2NN6I 1FMAD 2ZM6L 1L6VA 1TT2A 1N63A 2UUCL 5C3EH 2BWES 3VHTC 3LJ3A 1E1OA 3MFYA 4I65A 2MPMA 3J80i 2R93B 4YWGG 5EAYA 4PS3A 3LWUA 1S3OA 4FXGC 2Q8TA 1F9RA 4ZRPA 4A6QA 2LMCB 3K57A 5M5XB 3RNFC 4KDLB 4OW0A 4JI8Q 1PHJA 4RGOS 4NXML 3OAWA 2VNUD 2I46A 1VDVA 4LF8L 1PRTD 2GVBA 1EOVA 4R4OA 5I9PA 1CI3M 3ULPA 2EY1A 1XPRA 2GMIC 1YNND 2D5GA 2UUAL 3KJOA 4NQLB 3IKJA 2I5HA 1IP9A 4J15A 4A3BH 5CV9A 1I50H 3LX0A 1HHVA 2M9VA 2WB1E 1XLNA 2ZW0A 1DOYA 2B3GA 5GAEC 3RCZA 3VUYA 3A0JA 3AULA 4UP8A 5KYLA 3L16A 1F0ZA 5GXGB 5CV4A 4K0KL 1EYGA 1ASYA 4PYZA 3B2FA 1WTOA 3SR1A 1ZE3D 3QK0A 2PI2A 1EO6A 2QW7A 2QA4A 5C3EB 1BNZA 3TEHB 1UBQA 3HOXH 1AYFA 2QDLA 3N6RA 3ND9A 3RN2A 2R93G 1WGKA 3STBD 1KD1C 2KTRB 2F0HA 5IT9c 4ZYNA 2Z6KC 4HJ9A 1I4PA 2E6XA 1UZXB 3MAQA 4BAXA 3IVFA 4HJ5A 3B2GA 4BBNC 1D1IA 5I6WA 4DUZQ 3T8MA 3JAME 2WXOA 3PT2B 2IHEA 3MA2B 3NS8A 4A3PA 3E56A 4DR2L 1XTDA 1TJEA 2UYZB 3GTGH 5G5GA 4A3BB 1TZOA 1W6JA 2EY6A 2AQ3B 1I50B 4JI1L 3NVWA 2GBMA 3NY5A 1H9SA 4LF7L 4X64Q 4LNFA 3DVGY 5TR5A 1GHJA 4IM3A 1B44D 5TSSA 1SYGA 3L08A 3R66C 2F0KA 5COYA 4X62Q 3PIPA 2RBMA 2DYMA 5DPWA 1QE6A 4GDLB 1VMPA 2LMCA 1KM7A 3SK4A 1JOKA 1N34L 4UHVA 5C3EG 3HOXB 2EXZA 4W9GA 2PW5A 4G50A 3UDGA 1MJCA 3B9JA 1GUSA 5IE8A 1W3SA 2D11A 4BKGA 3V6EB 3T1HQ 2VS1A 2SEBD 1KRSA 3MP9A 4HMIA 1SMXA 4BXXH 4X3SA 4B9KA 4XGAB 1PXUA 1YJ1A 3CAMA 4LDTD 3ZKJC 3GV6A 4ICUA 1PH3A 4KZCA 2I1JA 4HJGE 5EPKA 2JVCA 3ZW3A 3GTGB 3IG3A 2JP1A 4A3BG 5DPRA 4F7ZA 3GTPH 1OO9B 2EYLA 4N6EB 1XLPA 4GOPB 1IW7C 1DOKA 3J80E 4X3UA 4GOPC 1TXYA 1AP0A 4I7ZC 1RWSA 2KQ7A 3AEBB 3D6CA 4FF4A 1WX7A 2J7QB 2X8XX 5F2DA 1J5EQ 2Z6KA 1JWAD 1EIFA 2H4OA 3QO2A 4P72A 1HUNA 1XCQL 2LI5A 3AI5A 1CKNA 3CQZH 1ICWA 2BT6A 3HOXG 4F8MA 2JRIB 3CD6A 4A75A 1GUTA 2CWAA 4WQMA 3S1QH 4S0RA 3I3TB 4DF7A 2L76A 1GB1A 3G6JB 1HZ5A 4JIOU 4OWTB 2K75A 3E5SA 2LGSA 2NS5A 3O13A 3P42A 1SYFA 2LGYA 1IGDA 5EGTA 4L5QA 1ONLA 4IUTA 2C5CA 2F0UA 4RHSA 4IUMB 5ELFA 1RHPA 3PV0A 3Q8FA 2WU5B 1C3TA 3H09A 3GTPB 4NDXA 4HPLB 1XMOL 3IT6B 1AN8A 1AE2A 3GDEA 4XDXA 1EYCA 3PIO3 3KYDD 2EYMA 3GTMH 5FR3A 1R7SA 1LUZA 3IRBA 2A74C 4FXKC 2B63H 3U9OA 2WLBA 3PGEA 4WWMA 2XK5B 1EWHA 1VQKA 3ZVVA 4DV5L 2PCFB 3PMFA 2KMCA 1WTPA 2KDFB 2K03A 3CQZB 1Y8RC 1IXRA 2LJ5A 3KYCD 2FAZA 4DV0L 1STEA 4MZ9A 4HJ8A 4BA2I 2BGFA 5JJZA 1IYFA 3CHBD 5CORA 2VL6A 1HZ6A 1TU2B 4H02A 3S1QB 2EDGA 2NVQH 3J81L 4KHZA 3IFWB 2J53A 3EGRA 4XQNA 1S5FD 3K59A 1VQHA 3EJIA 4BXXG 1J6QA 5M5YH 4OZAA 3AE3B 3Q69A 3M7NA 4IJLA 3EECA 3NZUA 4XWWA 1YIWA 3HVDA 3VR3A 5KEEA 1KOTA 1Y8NB 2VB2X 3V6CB 2FJ2A 1YHQA 5DM73 1XNQL 1P16A 3EN2A 1SSOA 2RHQB 1EL0A 3GTMB 1P8LA 3A1QB 4CJ1B 2B63B 4URKA 2CVRA 1NSNS 5GQOA 4C4VA 3D3RA 4IUNA 4FF1A 2MEKA 5LMNW 1U9RA 4B3MQ 4KZ0A 3S2AA 1I4XA 4B9WA 2K52A 5AFWA 2IO2B 1VZ7A 2IX0A 4YY3L 4HEA1 4LLGM 2FUG1 2MJ8A 5LMNQ 1V9PA 4X66L 1X9NA 2NVQB 5EE0A 1YN3A 2OWOA 1OEYA 5FLMH 2WXKA 3HUIA 3TS2A 3SK6A 1N62A 5M5YB 4BKSA 2JYEA 4MIUA 4II3B 1SROA 4FADA 1E24A 1YNXA 1F2ZA 5HY6A 2R2QA 3K81C 2AKWB 5AJ3L 1UBIA 2CHZA 4O1NA 2RGFA 1WTWA 2XK5A 4GGQA 1Q1OA 5D6JB 1UE7A 1FL0A 3I72A 3S16H 4JYAQ 4PK1A 2ES2A 3WAMA 1KRHA 4ANVA 4II2B 3CWIA 2N7DA 1D5MC 4HPPA 2JU6X 1WD0A 3GQBA 4OX9L 3BINA 5EE9A 1L0XB 2QKIC 3PZ8A 3ZRFA 2B2YC 2NMQA 1IW7D 4GNXA 5CGKA 1BCPC 2BCOA 4KV2A 2UU9Q 2DZJA 2LY7A 4HIOA 3AXCA 1K9MC 3K0YA 1F2YA 3SGIA 1PRTF 3EC8A 2ZEQA 3H6MA 4YTMB 1SIFA 2BS3B 3ZQ4A 1P7EA 1OXUA 3RMHA 5IY0A 3MC0B 1AE3A 4N9F4 2N9PC 1JROA 3RNEC 3CP0A 1JJCB 3AEAB 4DDID 4AYBE 1PQSA 4G3XB 2DZKA 2DAJA 3HZXA 4O42A 1ILPA 1STNA 3S16B 4OO1H 3U2SC 1NVID 5E6PA 2HDEA 3FEWX 4IUVA 2K6DB 2EMTA 1VQBA 1C4QA 5FR6A 1VQ7A 3L54A 3K7AH 5LMUL 3VR4A 1FPYA 2IO1B 3UQBA 4DR3L 1D1KA 3H7SA 4KGTA 2H1EA 2F0VA 5E6JA 4EKUA 4BA1I 3M3JA 1Y8OB 3BU2A 5MPOA 3Q3JA 5K5PA 2B2TC 2PMZB 1JB7A 1I6HH 2IY5B 4JI5L 4WURA 1PH9A 5I4DA 2MRPA 5FLMG 1K8OA 2Z1CA 1MHHE 3SR6A 2C60A 5I2YA 4LNQA 4PS7A 1N5XA 2O5JC 4ZRKA 4UPAA 3RUIB 2K8HA 3ZDTA 4DV4Q 1WYGA 2A69C 2IY1B 3Q6BA 1KC8C 4C3HH 2DHZA 1SNMA 2NCNA 3KH0A 1R4NB 3F2CA 3FILB 3TMEA 1BOSA 1I5FA 3HG9A 1RRBA 2LUMA 2KCCA 4B3TL 2CH4W 4GDKB 3PO3H 3ZUNA 5D14A 4DUYL 1Q46A 3K7AB 4QL5A 1WR1A 2QF7A 1A3VA 3VUXA 4OZCA 4OVZA 4ANWA 2BYEA 1Y14B 1LXDA 4DAVA 3TCAA 4DV6L 1K8GA 2G4DB 1RYJA 5E4WC 2PNHA 1M94A 5EBDA 3SXHA 1BUVT 2F1MA 2E2DC 1I6HB 4ASWC 4TV3A 4K1RB 3JW0X 2NB0A 5FLXE 5IYCH 1OTCA 1MI2A 1XD3B 2DJGC 1CA5A 4GN1A 4MM3A 2N0SB 2V3NA 5HG2A 1EIHA 2L05A 3D0FA 3CC4A 1H4RA 2ZXRA 4MTNA 4TQ0A 4ZAIA 4XDCA 1WFYA 3CF5A 1UWMA 3M63B 1V8QA 3BS1A 1PH7A 4C3HB 4A3LH 3V60A 1GUGA 2EYOA 4LWCA 5IT9L 1VQ9A 2XRSD 3S2DH 2ZXPA 3N1ZC 3N30A 2RCFA 5J2RA 4HIDA 3FAHA 3VTVA 3DHGC 4OO1G 2GBJA 4KV6A 1XMQL 1FEHA 2H89B 3PO3B 4BS9A 4C3IH 2EMSA 2B2TA 4CDCC 5CYUA 1IBLQ 2L0TA 2ZT9C 1II3A 3DWMA 3CXCA 4DV3Q 3OOCA 3ITPA 1VRAB 1FJGL 1EUJA 4A3CH 2WS3B 3OWEB 1EFWA 4JV5Q 3H7PA 1EIYB 3DVNV 3U4EG 3TEYA 1NEKB 1T0QC 1KABA 3K6OA 3KF8A 4NXNL 4JVZA 2MCNB 1H9KA 2MO0A 4JCVE 4HTHA 1KH0A 3AEEB 2HT1A 2WXLA 4Q2JA 1ENCA 4EZLA 3T4AC 2OTLA 1EOTA 1SRUA 4C3HG 4LFAL 3OG5A 3S2DB 4GDKA 1NMGA 1UWVA 2NBFA 2QILA 3WA0A 1YD8U 4Q5VA 5CX3A 3ETRA 2A8VA 2LRUA 4KHVA 2RHSB 3TRZA 2EKEC 1WXSA 2CQOA 2ICEC 1QJOA 1FNUA 4C3IB 5C4ZA 3PO3G 2N9EB 4YCVA 3EROA 2EE1A 2WB1B 3KYHC 4NB3A 2EZVA 3VR8B 3ZTDA 3M85A 1WGRA 1SB3C 2KWUB 4B0EA 4ZRIA 4YIJA 3AN1A 2JRHA 5CC4A 1ZKOA 1GB4A 1V1OA 1N32Q 4JE3B 2IT1A 4ARCA 2RMMA 3ZJYC 4OWXB 1B9RA 3KUPA 1Q10A 5IYCG 2A1AA 1SNDA 4WJOA 4EUTA 4JGHB 1V1PA 1ZP0B 1Y69U 4BBNF 2IL8A 3ZGZA 4RG1A 4OO1I 1Q82C 1R4NI 1NAPA 1UGMA 1L0WA 1VQNA 1BUIC 4A3LG 3P63A 1O7ZA 3EFCA 4FN2A 4IALA 3W1YA 3E9HA 1SDFA 1TWGH 3U30A 3CSTA 3AV8A 1CQVA 3HKZB 3HOWH 1NJIC 1N6ZA 3D32A 4NJ6A 1XT9B 4RH6A 4JI4Q 3L2PA 4IWOA 4US9A 3A8IE 1K8RB 4GMVA 1Q7YC 3PUWA 1M90C 2A69D 2UXDQ 3GTJH 4LF9Q 1LT5D 4C3IG 1AFPA 4W9KA 4ACFA 5I2XA 1WI0A 4YHHQ 3WAOA 1J7BA 2SNSA 1WIAA 2WB1G 5EQ0A 5A2QL 4CDDC 3AE1B 4XYQA 1MKHA 4IPHA 1Q81C 2K05A 3E3XA 4F8CB 3CC7A 1SYDA 4MGKE 1FR3A 4A3CG 1V49A 3TL5A 4LF6Q 2RR9A 1FGBD 3BWUD 1EY7A 1WTHA 4X65L 2N1WA 1J8IA 1N36L 1Q12A 1IBMQ 3G48A 1NYRA 2DGYA 1YJWA 2KZRA 1E3PA 1YNTE 3W5OA 1WM2A 2KCMA 1F1HA 3AH7A 5IP9H 1SNQA 1O7YA 2MP1A 2FCMA 3APDA 5M3FH 1E8WA 2FHTA 1AARA 3CIRB 2PYKA 2WP8J 1EU4A 1YN5A 4TKNA 5CMDA 1TWGB 1D7QA 2DJFC 4B3SL 3HOWB 5T1IA 4ABNA 1WI5A 2LXCA 3HKZG 5IO9A 5BMGA 3HM6X 4J1MA 4O2DA 2CU3A 4HMJA 4HIMA 4M01A 2ZCBA 5JHBA 1DM0B 3GTJB 2PJHA 3Q8AA 3PS6A 1UGJA 1QOBA 2J0TD 2DZIA 2LVOA 3MFGA 1U4PA 5IP4D 5C0XH 1OQYA 2KMAA 4MGZE 3VR2A 2JZZA 2PW9A 3OPOA 3QARA 4A3GH 3T56B 2A19A 5IGBA 2L0CA 3L7ZC 2SDFA 5H8YE 1GG3A 3ZRCA 1A2UA 5LL6S 2KOLA 5M3FB 1JALA 2D3BA 2O2VB 4XWTA 1NY4A 4XDDA 1TWHH 2LXAA 2WXHA 4C00A 3T53B 2JN4A 3MJ5A 3HOWG 2KLCA 3U52E 2HCIA 2N4FA 3WWVA 1WJUA 4ZLTF 1LABA 3QIAA 2L12A 5CTRC 2WXQA 2VB3X 1DXMA 2G4SA 1OQRA 2AL6A 1XYIA 2F0PA 2L3ZA 3AQQA 1NE3A 5IWAQ 1BBUA 3I4MH 2QC8A 2EXDA 1BQQT 2B2WC 1IL8A 5L83A 1ML0D 1XCTL 1PLFA 1F9JA 4LF4L 2UXBL 1P0RA 3JSVB 3QX1A 4LK0M 2I1KA 3VYTA 5I6YA 3MHZA 1K3BC 3CCMA 2D9UA 1AZQA 2EYFA 1EEID 4P7IA 3RNAC 3WIMA 5AEKB 1HNWQ 4DR5Q 4CHKA 1RKNA 4QIWB 4CQNA 1QT9A 5EJWA 2FFKB 4WORA 4A3GB 5K36H 2J0JA 2QMTA 5D2MB 2N1VA 2LXKA 2LHEA 1Q1EA 4KKUA 1ZOYB 2EPBA 2KVRA 4K5XA 5C44H 5DLQE 4UY8C 4UP7A 1WJ6A 1MHXA 5IP9G 2KFKB 2RA4A 3MTSA 2K0PA 2L9HA 1TWHB 5BR8L 2QHOA 4HEDA 3KLRA 1Q0WB 4WAAA 3VUWA 5ELNA 3C19A 3RD4A 4XTCS 1KNEA 2KX0A 1VD2A 5IN7A 2UXCQ 1GD7A 2KHSA 1N8RC 4M1UB 4E3CA 2JXMB 3HOZH 1E8XA 2IBIB 1HUMA 3FP9A 4OWWB 3AB9A 2FXQA 1SAPA 3I4MB 5JZEB 3PRZA 3CW2C 2C7HA 2A6EC 2XWJB 3UF8A 4DV2Q 4I7AA 2IGGA 4A76A 5C0XG 2INPE 4ZHOA 2FNJB 2I5MX 2PQAB 1EZ6A 1S5CD 2KVZA 2BE5C 3H0GH 4GB9A 4K3CA 2OQKA 1E7VA 2CU1A 4A3GG 1E9MA 2UUBL 1JWUD 3DVGX 4GXBA 3VYRA 2DY8A 2XEWA 4XQJA 2NBWB 4DA2A 5C44B 3VQIA 1BMLC 5C5MA 1EY6A 4KY5A 3CCLA 3MC9A 4ZUJA 1Y1WH 1JR0D 4F87A 1GVPA 1PH1A 1V2YA 2M0AA 3Q14C 4NNJB 3ZNZB 3S15H 1UD7A 1ZXTA 1Q3LA 1ILQA 1TWCH 4TVAB 2NYZD 2XRQD 2K04A 3JSVA 4XZ4A 4GKKL 3ND8A 3HOZB 1PFBA 4WWOA 4DNIA 3I4MG 4AQ7A 4IN3A 1WJNA 3OLMD 3VYSA 1U4LA 1UEBA 2JK8A 2Q2HA 1V9JA 2G9HD 4NW2A 1VQPA 2IWHA 1WXVA 2D3CA 2D5DA 4IOAA 3H0GB 2EELA 4NAWB 2K5VA 3TREA 1RTNA 4QMGA 2FMMA 5K36G 2O6VA 1P9DU 4MJSB 4LNOA 2YTYA 3IBEA 1GUOA 3R7RA 2E2JH 5C44G 4LNKA 1B70B 5J1ZA 1JE5A 1I6VC 2F0WA 2OF1A 5GAGC 1Y1WB 2R93H 3EUB2 3KWVA 5DM63 3BZCA 4RGMA 3ZXRA 4LMQD 5IOIA 3L0WB 3S15B 4FJVB 1WTVA 1XPUA 4UDUC 1TWCB 1B9NA 5ELCA 2NZHA 4KY7A 2EOTA 2INCC 4L23A 5D94A 2K14A 4L5SA 1VQGA 5DCNA 1GPXA 3CRKC 5IP7G 3HOZG 5IODA 5IGEA 5C0XI 1FFVA 3BG3A 4QJFA 4FJZA 4S3SA 2R7ZH 1XQQA 2HE7A 2LGXA 3HVZA 4GKJQ 3W1SC 2I2YA 4NP5A 2KHWB 4ANXA 1QG7A 3PQIA 1S1QB 3N3KB 2CW0C 3H0GG 1XXGA 4DAYA 4B6WA 1FD7D 3W2DA 1X1MA 2VUMH 2E2JB 1QZHA 2F0OA 2RQXA 3G6EA 1Y56A 2MJDA 2IDYA 1Y1WG 4C7YA 1WXMA 1QWYA 2M17A 4KN4C 1DGJA 3ZYYX 4D2KA 1PYSB 1S3SG 4XIGS 1A6XA 2OXPA 3EFUA 5G55A 3OWFA 1WXAA 2VH1A 3ZTCA 3URYA 1I4GA 2J0MA 4R4QA 4GU2A 4BKTA 1F2LA 2NVXH 3OIQA 1A15A 4GLAC 1SIJA 2AX5A 2REXA 3OW2A 3DEPA 2A5UA 1E8ZA 2R7ZB 2UWQA 4NAWA 3RMKC 2F0MA 4KJOA 1KFYB 5HKHA 1QF6A 3TSSA 3P1MA 4ULLA 4MJSA 2V4IB 4L5RC 1ENFA 2KBNA 2AEHA 1VF7A 1ROEA 2IGHA 4CJ0B 2AYOB 2WYQA 4L1BA 1I94L 1L4DB 4W9FA 3VVWB 2BDOA 5I9OA 2A6ED 3T1YL 2XIWA 2VUMB 5IYDH 3K9OB 2RSUA 2L1BA 1F9PA 3IFDA 1KRTA 3SEBA 1KDBA 1WTXA 1XO3A 3CCRA 4IPGA 2ON8A 3I5JC 4MSMB 2HJ8A 2IY0B 3K5MA 2BE5D 3EA6A 2VQEL 2NBUA 4ARIA 3GS2A 1CSPA 3T1HL 3VYUA 1LYLA 1H95A 1CKNB 3W1SA 3ONAB 1X32A 2KCNA 1E7ZA 1OXXK 4APVA 2NVXB 4XE0A 3I4LA 2VZAA 4AWJA 1VZ8A 1V43A 1P7FA 4RF1A 1UUPA 3DOWA 2D2CC 2JYOA 3J81j 2R7ZG 1EQQA 4HDOA 4EZJA 4V0BA 1NI3A 4JG2A 2UUCQ 3N1YC 4IUQA 4YCUA 2B76B 2LXJA 2ZVOA 3Q2AC 4PMBA 1HH2P 4MHEA 4LFCL 1IPGA 1ZXHA 3CKIB 1V6EA 3EFXD 2KQSA 2IO3B 3HK0A 4XQQA 2VUMG 2HTHA 3JAMc 5IKCM 2JSVX 4YL8A 4LF8Q 4IFDJ 4A9AA 3D4RA 1IBKL 2ZJDA 2MH7A 3OIPA 2NZ1D 2UUAQ 3NK9A 1B4OA 3QOLA 4RMFA 3AMUA 2MJ3A 5BN4A 4DWFA 3MC8A 2CWPA 2RKSA 2K8CA 4DR7L 4GLXA 5DPSA 3QCAA 1LTAD 1WE7A 4POGA 4UP9A 2GOWA 4FDBA 3OTOL 1EY0A 5L37A 2E5LL 3DQVA 3MHBA 4JOIC 1HNXL 1IHZA 1CKOA 4E6IA 5CHVC 2B39A 2QDBA 3S24A 3KUCB 2N88A 2Q8RE 1TS4A 2JA8H 3V96A 4OIKA 2DY7A 3PPAA 1FXIA 1TBEA 1K83H 3GE3C 1SYCA 2EY5A 1NR4A 3C3LA 4J8QA 3I4OA 4NPNA 2R6GA 2K6QA 5IYDG 1SNOA 5IOCA 1QZGA 4DV7L 2KOXA 4HXDA 2EYPA 3VDZA 3W5UB 3ZJUA 1WGDA 4FYDA 2D62A 4B3RL 4I6LB 1EQVA 3ZO5B 5JEAG 2YLMA 3AFPA 2YYZA 1WRDB 4C4VB 2KQ4X 4DR2Q 1KAAA 3HS0C 1WZ0A 4K81A 3NRZA 2N7JA 3J80c 3A5UA 3G71A 4LF7Q 2N9LA 2OCEA 4BZAA 1VQCA 2JF5A 2KQ3A 1IKLA 1F9SA 2R61A 4KHPL 1BVSA 1C9FA 1G8ZD 2K5DA 4R8NA 3RT3B 2BQQA 2JA8B 1N34Q 1WX8A 1B53A 5CBEE 2BH2A 1GOZA 2JJQA 1K83B 4IUPA 4DAPA 2G1EA 2KX3A 3T3NA 1VQMA 1WF9A 4DV1L 2K01A 3AECB 4WQOB 3H15A 4PNYA 2CHXA 2DNEA 3RPFC 1G51A 1PZID 1J7CA 5GMVA 1E6EB 3I7FA 2K8BA 1TYGB 2K28A 3N20C 5LLIA 5IGDA 3UINB 4K2LA 3M62B 3HEJA 1GAQB 2LGDA 3L4PA 3AFQA 2K1BA 3UE0A 1CK1A 2C9OA 1A0IA 4JOIA 5EE1A 1E10A 3BYYB 4GNXB 2IX1A 4GNXC 4I6PA 2KJRA 2KDIA 5BN5A 2KDBA 1X3FA 1SR3A 4P71A 3CC2A 1JOQA 1R9TH 4M00A 3KJPA 4BOSC 4JI0L 3TS0A 2KCTA 5JVG3 1G91A 2BYVE 2JA8G 3BDOA 5BYRA 2ZVNA 2IX3A 2L4NA 5D3IB 5KHOA 3LNNA 2MBOA 1E8YA 2KHIA 2K7VA 2K4KA 4YWLA 2QCPX 1JMLA 4WAFA 3VFKA 3NXWA 4RFBA 1KQSA 2F0JA 1PDQA 3I3CA 1YBYA 2HCCA 1KXLA 2LWPA 2UU7A 4RF0A 1YJIA 1LT4D 4XX5A 3SHLA 5IIFA 2F0IA 2VW9A 3DBHB 3ML8A 2NPTA 3BVMA 1EQTA 2B2UC 3X3NA 2SAKA 3QC8B 1XMOQ 3RFZB 1VQJA 2BOSA 4N8FA 1K0SA 4L6TB 1O80A 1PDXA 4S17A 1LQBA 2C9WB 3BJUA 2NTSA 4DXGA 3AEGB 3M4OH 3TP6A 1R9TB 3WOFA 1IBXB 3TN2A 4NJ7A 1FXAA 4DV5Q 3AE6B 1LTGD 1M4VA 3NBIA 5KNCA 3ICEA 2VY3A 2WAQE 1HRJA 1T6BX 4LCDE 4B3TQ 1EIGA 2WFWA 4QGUA 1JMCA 5J17A 1CHPD 3P2BA 2HQEA 4JBJA 1PYBA 1U4RA 4DV0Q 4FXDA 2V4LA 3QA8A 3VH3B 1ET9A 1K50A 2EJFC 1E5WA 4KLKA 1H9MA 4PMCA 2RD0A 4KVGB 4AQYL 3EVQA 5GROA 1WVLA 1QNUA 1L1OA 4TUUA 2F03A 3IAYA 3KUZA 1IKMA 3T3OA 2KWCA 1DYQA 4G7OC 1BCPB 1HNZQ 4W9EA 3SD5A 3FMCA 4CKBA 3VRBB 2LZ6A 4MACA 2PKOA 4N58A 1PFDA 4LF5Q 2W3RA 5HHDG 3DXJC 2Z59B 1XNQQ 3RI7C 1PVOA 4KGSA 4LFBL 2IGDA 3AE5B 4DHZB 2ZPNA 1TY2A 3GP7A 4DR6L 4KKJA 4TKOB 3TBIB 3M4OB 2KLGA 3DLLA 1PZKD 3U9SA 3BY4B 2DUDA 4BOZB 3RZOH 2YTXA 3RZDH 4PS8A 4DXAB 4MM3B 2JYTA 4U673 2WKDA 4NPSA 3Q24A 3IXSA 3J9CA 4K8IA 4LAAA 1VQLA 3NTIA 2KWVB 1E1TA 4YY3Q 3P4QB 2O5IC 1E90A 5JJKA 4X66Q 3M7GA 2Q2TA 1Y1VH 2L0FA 3TQYA 1KHIA 1MGSA 1RL2A 2B2UA 1N61A 1VR9A 1FVIA 1U4AA 3VAWA 4BKSD 1WGYA 1TZ1A 2GI9A 4A3JH 1KNAA 3FPUB 2E76C 4FP5D 2MHVA 3TUOA 4K5WA 5BMHA 2Y3AA 1C77A 1V81A 2XN9C 4KKTA 5AJ3Q 2QDFA 3H3VC 2F0EA 3T51B 3PRPB 1IBXA 3TP7A 2MBEA 5C1ZA 4DN4M 2KKCA 3TZDA 2Y0SE 5M3MH 3NSWA 3H7PB 3K5LA 3I91A 2KUMA 3NZSA 3V62A 1TKWB 1KL9A 3RZDB 3RZOB 4WJ4A 4XXEA 5IGGA 2M4NA 3KF8B 2NR2A 3ZLZA 1ZGUB 3NUCA 4OX9Q 3B0AA 4KIKA 4OVUA 2JA6H 3HOYH 4N9TA 2KT7A 3ABVB 1D4BA 1C4PA 5DAUA 4DU9A 2WXIA 4RGTA 3OMGA 1C4AA 4M02A 3H94A 2J7ZA 3KVFB 3OMCA 3C2PA 4BVUC 1Y1VB 1KF6B 3Q3FA 3DBHI 4NQKE 2MO1A 3A74A 4ZK9B 4H0LC 3H91A 4A3JB 3PLVA 1VQ8A 1PGAA 5DNFA 3M9BA 1DOXA 2JXTA 1S40A 1G6JA 4BY1H 4FF3A 1PFNA 2P5ZX 3H8HA 3O65B 2KC1A 1T5XD 4RAUC 4UAIA 5M3MB 2KJ6A 4IUUA 2INNE 4C7ZA 2XTIA 1A62A 5LMUQ 4N9PA 5JPNC 4DR3Q 1V1PB 3R2TA 2JA6B 1WTQA 3HOYB 1K8MA 3FKYA 3PHXB 3PIOA 5KRUA 3NQTA 3DHIC 5H92C 2BW2A 1PA6A 1AW7A 2BKRB 4HWIB 3DMUA 5EPJA 5FLXc 4JBKA 2CR5A 1KLGD 4HJAA 4JI5Q 1Y1VG 2OOBB 4G57A 1ASZA 4YWKA 3K8AA 1SYBA 4KY6A 4JI6Q 1EQRA 5D7GA 2KACA 2EIFA 2LJIA 2WKCA 3GD7A 4A3JG 3I55A 4WWPA 2KFJA 5G2NA 2YVCA 1N32L 2KEEA 1I42A 1C0AA 2HDLA 2BH8A 2BKFA 4BY1B 3MVVA 1ZPSA 1L5PA 1RM6C 1IZ6A 3TDQA 2R7DA 2JWZA 4LNIA 2ATWA 3DWAA 3JAML 4DR4L 4RM9A 1BCPD 3SDLC 1FM0D 4X57B 5M3MG 1T0RC 2LHDA 3T13A 3NVYA 3NP8A 4DUYQ 5BO4B 3K5NA 2I07B 2L5TA 5IGCA 4JQWC 2JA6G 3HOYG 4DV6Q 1QILA 1OQQA 4C3JH 2VH2A 5FOBB 2F4VL 4ZRQA 3DHQA 4EQNA 1PZJD 2MWSB 3VXWA 1AZPA 3L3OC 3I63C 3CCUA 3P7JA 5CV6A 1FRRA 2W3SA 4ZDVA 5FJ8H 1N9WA 3H3VI 3NE5B 2FUHB 2F52A 2F0QA 1A3TA 2CQAA 4JBMA 1N5WA 2CH4A 3W3AA 3UGBB 2L15A 1X56A 4BY1G 1IBML 1PTOH 1EF5A 2L8JA 4XC2A 5KNDA 1PGXA 4JI7L 1XMQQ 1SE2A 3I2ZA 2JZPA 2ASBA 4RA8A 1BO0A 2CJNA 1D3ZA 2AUJD 5IAAC 5CBAE 4PT5A 4MGYE 1WX9A 2KENA 4BBRH 3Q22A 3X3MA 4QCLA 1CA6A 4LUVA 1WCMH 1K3RA 1HJPA 1XNRL 1WY8A 3J80L 3J81i 1SBBB 4C3JB 1FJGQ 1GUWA 1MFWA 1OEYJ 3BZKA 2WNMA 4RM8A 1VQDA 3N9YC 3C0RB 2RDHA 1TVXA 5HGTA 1LT3D 4C80A 3MHSD 2AWNA 4ME5A 4NXNQ 3L9AX 1DGSA 1EUVB 1GJXA 1CFMA 3DEOA 1JW9D 2Z4IA 3G4SA 4HSVA 4FULA 4LFAQ 2RF4A 1XPOA 3E0EA 1Q86C 1PTOB 1PTOC 3F2UA 5LL6X 3NENA 1CM9A 1SJHD 5ELDA 4A3IH 3GTLH 4PYUA 3KBGA 3U7DA 4A3OA 1X54A 1WGHA 3QWNA 5BYQA 4BBRB 2TSSA 3MTNB 1N33L 3HRDD 2R7FA 1WCMB 3A4RA 1TR5A 3D31A 1CZGA 2Z9HA 2F0GA 4JI3L 4C3JG 3PRMB 2CJOA 2VQFL 1QLBB 2K50A 1XEEA 4LJZC 1LTLA 1JQ4A 2DZMA 4A90A 5CHFA 1OXSC 4XYCA 1QB5D 1FRDA 1XF5L 4JW0A 3AB5A 3ULJA 2INDC 5FJ8G 2PLPA 3Q3MC 2A73B 2F3IA 1V5OA 2CHWA 5GADC 3A5ZB 1R4QB 1VQAA 3KDFA 4DK6C 1Q1BA 1KJTA 1J0GA 3S9WA 1SJED 2BDNA 2YV5A 2HIXA 2N9KA 2Z4HA 3IL8A 3F2BA 2WXMA 2BYFA 4FA6A 2ZTDA 4KKSA 3S1RH 3CPFA 4R4IA 4A3IB 3GTLB 3RUZA 3K80C 1DOIA 4B08A 2E2IH 3I9V1 3LB8C 3E6ZX 4AJYB 5JH5C 1YVCA 4BBRG 2EQSA 3HP3A 3HFZB 1FO4A 3TP5A 1FCCC 1HA6A 3HHMA 1WCMG 4GN3B 3OSOA 2ASQA 2N78A 1V80A 2WP9B 2UXCL 1STYA 4KI0A 1QUQB 4ZQ3A 5C4HA 2HHHL 2M0XA 2LFIA 2PTLA 5CR3A 4X65Q 2YTVA 2WHIA 4L8JA 2ZCCA 1N36Q 3Q6SA 4NJCA 4OXPA 1ESFA 1D8LA 3OYYA 1WR6E 1NBWA 3VDYA 3PO2H 2IYDB 3HM3A 3HOVH 1QOFA 5D3DA 2V1YA 1Y8PB 3KLWA 3PV1A 4ANUA 4DR1L 1WOCA 1Q8KA 4GOCA 1TKYA 4BWGB 2MP2A 4GZYC 1FD6A 3F8TA 1PGBA 5D65A 1NDDA 3QAQA 2E8GA 3I73A 4YTPB 2PZWA 1HZ9A 4B3SQ 2OJWA 4MGIE 4DDGD 1JQYD 2XNAC 3J81E 3S1RB 3NPPA 1LO5D 4A3IG 2E2IB 3A7AB 1FNWA 1VF5C 4Y7NH 2F0LA 2I5LX 2HUGA 4RKBA 5JPMC 2O6VB 3RLNA 1YMHE 2WXGA 1VQFA 3AE4B 1JC7A 1S5ED 1A3UA 3C1FA 3W5VB 4KJNA 3B6YA 5FKAC 1HR0L 2K5WA 2WQYB 1WJJA 4ITKA 3TEXA 1SXTA 2F3WA 1YHBA 2EY2A 1UH6A 3A8JE 2KECA 4CKEA 5IP7H 3IAM1 1ZDXA 3KK7A 4AIMA 3LYYA 3PIP3 4JPBW 3VA5A 4QF4A 1YITA 5A35A 4YCWA 3HOVB 3PO2B 1F52A 2K9XA 3ZNHB 2X6GA 2H5XA 4RGNA 1VZ6A 1PV4A 1I4HA 1C48A 4LNNA 4OIJA 2OEOA 3SHQA 3DM3A 1FYCA 3RN5A 4A3DH 3PUYA 2J52A 3BDLA 4EX5A 1QVCA 1HPCA 3CPWA 3S17H 4Y7NB 1UELA 2E3TA 2IZVB 2JEAI 3KBXA 1QUQA 2ZNVB 2ZNVC 3MWYW 4DAYB 2HD5B 3UDXA 1HTQA 5AZGA 2GVAA 1PTOD 3ECIA 2WACA 4WIPA 4JK1C 2HJ1A 4LF4Q 3E0JA 1EWCA 3S1MH 2UXBQ 2Y5PA 3H6NA 2J4XA 3X0WA 3M4PA 5EKLA 5JHAA 4WRDA 2ZW1A 1PYWD 3RR5A 3DWQA 4HR7B 1SLJA 3MXPA 4F7XA 3ML9A 4HPMB 5EDSA 3I8ZA 2PMZE 4TSSA 3PO2G 2M00A 3X23A 2XGTA 1SE4A 4LK1C 3HOVG 1FXTB 2MGSA 3KFUA 1HA5A 4QB4A 1I4QA 3NVVA 2DYOA 2MQHA 1BCPF 2Q2IA 1XTCD 4KTAA 5BR8Q 3CCQA 4HCEA 3PF4A 4A3DB 5E3FA 2BB5A 4MEMA 4EZKA 3WOEA 1Q90A 4JI2L 1FFUA 5L95C 2MBHA 4FXCA 3S17B 4GIVA 1ZUD2 3ERQA 2Q2UA 1DONA 3A9KA 4KN7C 4RCNA 4KD3A 2GN5A 2WDQB 2WXPA 3ENEA 4P16A 1BBXC 2G5DA 4F1SA 4A3FH 2LSSA 3RULA 4YSXB 3AU4A 1V5TA 4RCOA 1B9MA 3S1MB 4JI8L 1LTID 1PH8A 5EE3A 4DQOC 1GKHA 2ALYB 2AQ2B 2GBKA 2BVCA 1TS3A 1SNPA 1V1QA 1B2TA 2GB1A 1RCVD 4GLSC 4AYBB 4JX1C 1STHA 3JAMi 2KA7A 3Q3NC 3GV3A 1H9JA 4R8IA 5HFYA 1SN8A 2JSOA 5EKKA 4DK1A 3ER0A 1LGRA 5E6NA 2IPKD 4ZKCB 2BPSA 5CV8A 2ZXOA 2M8SA 2M19A 1RFKA 5FK9C 1OXVA 1E7PB 4A3MH 3J7YW 1JORA 1MPEA 4ZOHC 1C79A 1Z6HA 2PIAA 1STBA 5FLXL 2V4DA 4AP4C 3P4RB 2KMMA 4A3DG 3GTQH 2ZJRA 4M8AA 3ZNID 2N7EA 1ET6A 3CCVA 4IPCA 4QY7A 1WMHB 1QOHA 4GKKQ 3RD2A 2B3AA 3DUZA 2VXWA 2H88B 4A3FB 2K22A 3KW5B 2OT2A 2BS2B 1JOOA 4L63B 3PZ7A 1Z9FA 2K32A 3B1LX 3SU8X 2EJMA 4CDEC 2HQLA 2Y0SB 1Z5SB 2K39A 2KK8A 1YQ3B 3DBLB 2GBRA 5KHQA 3K0XA 1E0ZA 3T16A 1C4CA 4DUZL 4AYBG 1RLFA 1T5EA 3NELA 3AYHB 2O6VD 5AUIA 1CT1D 1TIFA 1G6PA 4ZYSA 2MA9B 1VMCA 3L0OA 4JPSA 1JJGA 3A56A 4CHTB 3D6WA 4X64L 4A3MB 4A20A 1OGWA 1HTLD 4IURA 3M3YH 2LRWA 3U8ZA 2B8FA 4US8A 2RPVA 1E22A 1TS2A 2L11A 2C7MB 3FDTA 4X62L 4DK5A 2EKIA 3GTQB 1K52A 1PH6A 1SEBD 4YXDB 1HEZE 1FIQA 2N8NA 3UE1A 1XX8A 1K51A 1W2BA 1NENB 1VDZA 3RLFA 4IG7B 4U68A 3KWLA 5JEAH 4A3FG 1EFID 3OJ3A 1O78A 2VZKB 2KDMA 1K8AC 2PQEA 5KGUA 4YSZB 4LUOA 1UNSA 5IT9E 2Y0SG 1KDCA 1A63A 1T0SC 2D3AA 4JLCA 4P73A 1SNCA 2WGSA 2CHBD 1VQ4A 4HROA 4FHJA 2KXJA 2IO0B 2D10A 4REZA 2FCQA 2WINB 1TWAH 4N8X1 5HI1A 2KD0A 1YQ4B 3J7ZC 2D0PA 4FNFA 3AEVA 3U7ZA 1DZ1A 4RMAA 2YEPB 5E6OA 4DXFA 3NZ3A 2N49A 4HKZE 3FPPA 2ZM6Q 1YJNA 1T9HA 4A3MG 3M3YB 1WMHA 2HTME 3R8BA 4HLEA 4KD4A 1X3GA 4LUZA 2WX1A 3IHPC 1UEAB 3QR8A 4X3KA 1HXYD 3SK5A 1WZ3A 4M8MA 3TBLD 1X3EA 1J5EL 1V97A 1BR9A 1BF4A 2KAJA 5M5WH 4ILWA 4NXMQ 1GNUA 1BXTA 3HKZE 4C56C 3TEZA 1UE6A 3I70A 3PREA 3A55A 3J7AV 4EE2A 1QZEA 1OFFA 3E9IA 1O7IA 3S14H 1WD1A 1VQ6A 5C23A 1J9OA 3B08A 2Z0SA 2E2HH 1HTOA 3V2TA 1UF0A 4A4IA 4G0NB 2WDTB 4G11A 1P98A 2PE6B 1WYWB 2XWBB 1C78A 3N1XC 2FCSA 2B2VC 1PH5A 2KN4A 4H44C 1I94Q 1TWAB 3CCSA 2WXRA 1EU3A 1EY4A 4K0KQ 3QHTA 1GXDC 3T1YQ 3MXGA 4G7HC 1C76A 3DWPA 3Q8EA 3VTWA 4E74A 4CDFC 2KNBA 2KC2A 4C1NK 1MJDA 3OW7A 5C4JH 3VRAB 5CV5A 4G7ZC 4LJOB 2VQEQ 3QG1A 2DLBA 3NWSA 3APFA 4HSPA 1Q8IA 1EY5A 1RDPD 4DHJB 4NZLB 2MHJA 4MELA 5C4XH 1M1KC 1YOVB 2LGIA 2D3GA 5M5WB 4MH8A 2WXJA 2JPHA 3DBLI 2CW0D 2XVSA 4O0AA 1AWDA 3TEWA 3PF5A 3S14B 2E2HB 4PMWA 4JI1Q 3CU7A 3PSEB 4WH4A 2LASA 4A3EH 2LFNA 1QVGA 5T1GA 1VCBA 2NPTB 3Q23A 4IJHA 4LFCQ 1EYDA 4TRDA 2W82A 3A33B 1HFGA 2KTRA 3LWEA 2MSED 1PH2A 3QOJA 2F0FA 1EY8A 2QIEB 2DN8A 5C2TB 1H9RA 1MG4A 4TMAB 2FCNA 3SFEB 2ZTCA 5A2QE 4A93H 2RSNA 4QAYA 3SDZA 5J39A 5C4JB 4CBVA 3A54A 3HKSA 1S4ZA 3RLOA 1IBKQ 2F0TA 2FBWB 3JVZX 5CHWA 1E7UA 3AMZA 1VQIA 1L2NA 1VS0A 3AE9B 5C0XJ 4WJNA 2K5QA 5C4XB 3P75A 1SE9A 3EQLC 4DR7Q 2HDMA 4B3ML 1WWTA 1PTOF 5C3XA 3DPDA 4ICVA 4LJPB 3PUVA 1DOLA 2IW3A 1ZEQX 2RVLA 3CCJA 3OTOQ 4HDQA 2B2VA 3CRLC 4R3DA 3PLUA 2E5LQ 1J19A 2JXXA 3V3XA 1HNXQ 1L1OB 1EWIA 1L1OC 5LMNL 2OTJA 1B50A 2C7NB 3HRZC 3ULLA 5FO9B 3ALBA 4GDLA 4EEWA 3EHVA 3V61A 4A3EB 4HVBA 3GZNB 1PH4A 1SSNA 3DHHC 1ACCA 1HZAA 1A70A 2AWTA 3QJZA 2VZKD 1RF2D 2MX2A 1B3QA 3CSFA 5IYBH 3GO5A 3RZFA 4C1NI 2KYWA 4DV7Q 2BB6A 4K7UA 4QIWE 5C3WA 5LXIB 2OJRA 3KF6B 4A93B 4MNOA 4ZRZA 2PEAA
chains in the Genus database with same CATH topology
4OZBA 2PO4A 3UI3A 4DGZA 4TQ1A 4DNRB 3ZJVA 4FF2A 1L6UA 1QNKA 1D5ZC 2Q8IB 3BDCA 2L83A 2WXFA 1QOAA 1EWYC 1NYQA 5LNK1 3AEFB 4RKLA 4NKLA 1STAA 3BZDB 4HN7A 4OL7A 1CZWA 1WTRA 3K5OA 3P4SB 1YNJC 4EQOA 5FO8B 4K2KA 2LS01 5E1FA 1JRPA 1JE4A 2WU2B 4P6VF 1F2RC 2JQRB 1BDOA 1S5DD 4HAEA 2BBCA 3FKIB 2JEBI 3SE0A 4PQXA 2JWUA 1N60A 2A6HC 4J3OD 2M56B 3BYTB 1W6KA 4EGVA 2RDFA 3BVGA 5ELEA 5T8IA 1EEFD 2TMPA 3Q8CA 1LT6D 4JBWA 1ENAA 1G2TA 1F2MA 2EYHA 2Y5CA 4KKIA 2AUKA 1LTTD 5HURA 2EYJA 4K8JA 4JWUC 1E2WA 2KVMA 1EY9A 3QB3A 4KGRA 4HRSA 4M0WA 2PMVA 4OGQC 1M8AA 4Q0FA 1Z7TA 1EM7A 4TQUS 1YN4A 2M2LA 1SF0A 5FO7B 4RHRA 3TP8A 4OHJA 1ZYRC 2PW7A 4R9WA 2R92B 1O7LA 1CJEA 2KWDA 5JOBA 3KLSA 3BIID 4DK0A 2WIIB 1XLQA 2PVOD 4CJ2C 2FE8A 3LXFA 3GTKB 3NVZA 2E74C 3VA7A 3NTKA 1CTMA 4YT0B 2BTEA 1G291 2B8GA 3SVMA 3C8YA 1FCLA 3NS1A 4CGYB 2DWQA 2AQ1B 3FC4A 4K6LA 2J42A 5C5LA 1E2ZA 2O4XA 2X6LA 4P2CB 1GHKA 2LEKA 3AE2B 5EKIA 4ZKBB 2NTTA 1MVKA 3A7LA 2L52A 4HKQA 1DOMA 2ACZB 2EVBA 3HOUB 4L2YA 2PPBC 1XLOA 2ICIA 4KMUC 1X3QA 1TKGA 1HCZA 4A55A 3IAS1 1F2RI 5J22A 2B2YA 4IDIA 1R4PB 2FMCA 3KQ4A 1NR2A 3WCQA 2WDRB 3SK8A 4USAA 5KYIA 3GB1A 4IQZA 2AWOA 1JICA 5E4XA 2JE6I 3I90A 1YNJD 4H7BA 1EZ8A 1KDAA 3MZ5A 1PUTA 1IYUA 1D2BA 1UWXA 2Z8LA 3NHHA 5G3LD 3VR6A 3AE8B 4IOIE 5JEAJ 2EJGC 4MN3A 2A6HD 4RNAA 5C3JB 4F88A 2YU9B 2JX5A 2R3ZA 4RWSC 2NVYB 3N52A 4IZ8A 1RD9D 1STGA 1SMYC 3D8GA 3DM1A 4V190 3FILA 1L0VB 1TS5A 1ZYRD 4BY7B 3QJYA 5CV7A 1AEXA 1DCZA 2L32A 1F77A 1UAPA 3S2HB 3D4DA 2YEPF 2MUYA 2QEJC 3E9SA 1VCIA 4QUCA 1CQFA 1LLRD 3KLSX 2K3UA 4IFDH 3AEDB 2K5PA 2SNMA 1MD2D 1D6EC 2BA0A 2LKVA 2ONQA 5LHY1 4KX6B 2A5HA 2F3VA 1J7AA 3R2IA 4H2AA 1PMRA 3TZUA 1XWEA 1G6ZA 3S1NB 3M4YA 2F0NA 4N59A 3OHXC 3AU7A 4YSYB 1L0YB 1A2TA 3Q0AA 1LTBD 5ELBA 4K14A 1PFMA 3C1EA 2BA1A 2L1AA 4CKCA 1DJRD 2N55A 2K33A 4JWSC 4IKGA 2F4IA 1TIID 4Z9CB 1LTRD 1JB3A 2V3PA 3P4PB 3UI2A 1NCVA 1V8CA 5G5HA 2PZTA 1CZPA 3FVQA 4EVOA 3NUHB 1B1ZA 3FRPB 1D5XC 5BMIA 1TKEA 1QKZA 5IGFA 3VR9B 1HFNA 2A68C 4DNTB 1QQRA 1ESRA 1RODA 5DEHA 1K53A 1I3QB 4K6DA 4ZUIA 2PNRC 1TQOA 2WV6D 4B0MA 2ENBA 1ZDVA 2OEDA 4X3TA 4IFDG 2Q5WD 1EYAA 2KEDA 1HTPA 1FNVA 1RJTA 3IT4B 1B3AA 2X69A 4KK7A 2E75C 5NUCA 1DD2A 1ZXIA 4B0EA 2JA7B 1I4RA 5JVH3 1JWBD 4ZHPA 2NN6H 1SMYD 3MXUA 5M9OA 2X38A 1G2SA 1IYVA 3MEHA 5KIXA 1KTKA 4HCSA 5AUKA 3R93A 1HQRD 1QCBD 1LTSD 1E0BA 4WFN3 2NWGA 2PVGC 2F0DA 3MXNA 1MI0A 2BS4B 1YJJA 3WDNA 1QOGA 1LACA 1RTOA 2W54A 2G9DA 2RDGA 5EBCA 4YTNB 4QUFA 1MBYA 4BBSB 1JWMD 1PRTB 1PRTC 1MSGA 5C6AA 1GUNA 4G4KA 1YNNC 2L55A 3BVZA 4A3KB 1IUEA 1TWFB 2MJEA 3BK2A 4NAMA 4DFAA 4MT5A 4FO2A 4EQPA 1SE3A 5ISRA 3VR5A 3PUZA 2GA4B 4IFDI 2JA5B 2FINB 3K58A 2DBYA 4XT3B 2F0SA 2GRIA 2KJXA 1I7HA 3V05A 3R3OA 2WAQB 2IJ0A 1X3PA 3W9CB 4XYOA 5G3LF 1SFOB 5BN3A 1NUCA 2PZUA 3AE7B 5JXVA 2QJLA 1IGCA 1VJKA 4H13C 5EPLA 2NUCA 3AM9A 4A8XC 5JAVA 2NN6G 3HGBA 3NWTA 2B2WA 3P1HA 3C46A 3I57A 1SYEA 1LV9A 1L4ZB 2XSCA 2RSOA 4PV1C 2QSDA 2ID0A 3I4NB 4LTUA 4NMZA 2I38A 2OHFA 4B9XA 2DNCA 3NQIA 4AS1A 2A68D 3G7LA 3A8KE 2BYTA 2K6AA 4XT1B 1WSPA 3Q8BA 1JWSD 4ODGA 1KLUD 1WRIA 2WXNA 3PUXA 1VLBA 4J6HA 3J7AF 3PO0A 2V0GA 1T3QA 1OXTA 4WJWA 2NVTB 4ID6A 1MSHA 3SFDB 3DWGC 4C2MB 5BYSA 4K5VA 1JCKB 5KNBA 3NTHA 2WDVB 1S5BD 1C8CA 3BK1A 1Z47A 2O2LD 2W55A 3D4WA 1CHQD 1F9QA 4FVMA 3ZJTA 3P20A 1U4MA 1WXQA 3GTOB 3IFTA 2SOBA 1TY0A 1HQMC 3NBHA 1H9SB 1E2VA 2NN6I 1FMAD 1L6VA 1TT2A 1N63A 4I65A 3MFYA 2R93B 2MPMA 4YWGG 3LWUA 4FXGC 2Q8TA 4ZRPA 1F9RA 4A6QA 2LMCB 3K57A 5M5XB 4OW0A 4RGOS 2VNUD 2I46A 1VDVA 1PRTD 5I9PA 1CI3M 2EY1A 1YNND 2D5GA 3IKJA 5CV9A 3LX0A 1XLNA 1HHVA 2M9VA 2ZW0A 1DOYA 5KYLA 1F0ZA 5GXGB 5CV4A 3B2FA 1WTOA 3SR1A 1ZE3D 5C3EB 1BNZA 1AYFA 1WGKA 3N6RA 3ND9A 2F0HA 2E6XA 1I4PA 3MAQA 3B2GA 1D1IA 5I6WA 3JAME 2WXOA 3MA2B 3E56A 1TJEA 5G5GA 4A3BB 1TZOA 1W6JA 2EY6A 2AQ3B 1I50B 3NVWA 1H9SA 1GHJA 1B44D 5TSSA 1SYGA 2F0KA 5COYA 2DYMA 2RBMA 1QE6A 4GDLB 1VMPA 2LMCA 3SK4A 1JOKA 3HOXB 2EXZA 2PW5A 3B9JA 1GUSA 2SEBD 3MP9A 4HMIA 4X3SA 1PXUA 3GV6A 4HJGE 5EPKA 3GTGB 2JP1A 1OO9B 2EYLA 4N6EB 1XLPA 1IW7C 1DOKA 3J80E 4X3UA 1RWSA 1AP0A 4I7ZC 3AEBB 3D6CA 4FF4A 5F2DA 1JWAD 2H4OA 3QO2A 1HUNA 1XCQL 2BT6A 1ICWA 4F8MA 1GUTA 4WQMA 4DF7A 1GB1A 3G6JB 1HZ5A 3E5SA 3O13A 3P42A 1SYFA 1IGDA 5EGTA 1ONLA 4IUTA 2C5CA 2F0UA 4RHSA 5ELFA 1RHPA 3PV0A 3Q8FA 2WU5B 3H09A 3GTPB 4NDXA 3IT6B 1AN8A 4XDXA 1EYCA 3PIO3 2EYMA 5FR3A 1R7SA 4FXKC 2WLBA 2A74C 4WWMA 3U9OA 1EWHA 2PCFB 3PMFA 1WTPA 2K03A 3CQZB 1STEA 4BA2I 5JJZA 3CHBD 5CORA 1HZ6A 1TU2B 3S1QB 2EDGA 3J81L 4KHZA 2J53A 3EGRA 4XQNA 1S5FD 3K59A 3EJIA 4OZAA 3AE3B 3Q69A 3M7NA 4XWWA 3HVDA 3VR3A 5KEEA 1Y8NB 2VB2X 2FJ2A 5DM73 1SSOA 1EL0A 3GTMB 4CJ1B 2B63B 2CVRA 1NSNS 3D3RA 4IUNA 4FF1A 2MEKA 1U9RA 1I4XA 4B9WA 5AFWA 1VZ7A 2IX0A 4HEA1 4LLGM 2FUG1 2MJ8A 5EE0A 2NVQB 1YN3A 2WXKA 3HUIA 3SK6A 1N62A 5M5YB 2JYEA 4MIUA 1F2ZA 4O1NA 1WTWA 3I72A 1KRHA 3CWIA 1D5MC 2JU6X 1WD0A 3GQBA 5EE9A 1L0XB 2QKIC 3PZ8A 2B2YC 2NMQA 1IW7D 5CGKA 1BCPC 2BCOA 2LY7A 3K0YA 1F2YA 1PRTF 3H6MA 4YTMB 3ZQ4A 2BS3B 1P7EA 1OXUA 3RMHA 3MC0B 1JROA 3AEAB 3HZXA 4O42A 1ILPA 1STNA 3S16B 4OO1H 3U2SC 1NVID 2HDEA 3FEWX 4IUVA 1C4QA 3VR4A 1D1KA 4KGTA 2H1EA 2F0VA 5E6JA 4BA1I 1Y8OB 5MPOA 5K5PA 2B2TC 2PMZB 4WURA 5I4DA 1K8OA 2Z1CA 1MHHE 3SR6A 5I2YA 1N5XA 2O5JC 1WYGA 2A69C 1SNMA 3FILB 3TMEA 1BOSA 3HG9A 2LUMA 2KCCA 4GDKB 5D14A 3K7AB 2QF7A 1A3VA 4OZCA 4OVZA 4DAVA 1RYJA 5E4WC 5EBDA 3SXHA 1BUVT 2F1MA 2E2DC 1I6HB 2NB0A 5FLXE 1MI2A 1CA5A 5HG2A 2N0SB 2V3NA 1EIHA 2ZXRA 4TQ0A 4ZAIA 4XDCA 1UWMA 1V8QA 3BS1A 4C3HB 1GUGA 2EYOA 5IT9L 2XRSD 2ZXPA 3FAHA 4OO1G 4KV6A 1FEHA 2H89B 3PO3B 4BS9A 2B2TA 5CYUA 2ZT9C 1II3A 3DWMA 3OOCA 3ITPA 1VRAB 2WS3B 3OWEB 3U4EG 3TEYA 1NEKB 1KABA 3K6OA 3KF8A 1H9KA 1KH0A 4HTHA 3AEEB 2WXLA 4Q2JA 1ENCA 3T4AC 1EOTA 4C3HG 3S2DB 2NBFA 2QILA 4Q5VA 3ETRA 4KHVA 2ICEC 1QJOA 1FNUA 4C3IB 5C4ZA 3EROA 2EE1A 2WB1B 3VR8B 2EZVA 3M85A 1SB3C 4YIJA 3AN1A 5CC4A 1ZKOA 1GB4A 1V1OA 4JE3B 4ARCA 2IT1A 2RMMA 1B9RA 3KUPA 1Q10A 1SNDA 1V1PA 1ZP0B 1Y69U 2IL8A 3ZGZA 4OO1I 1NAPA 1BUIC 3P63A 1O7ZA 4IALA 1SDFA 3AV8A 1CQVA 3HKZB 4RH6A 4US9A 3A8IE 3PUWA 2A69D 1LT5D 4C3IG 1AFPA 5I2XA 1J7BA 2SNSA 5EQ0A 5A2QL 3AE1B 4XYQA 2K05A 1SYDA 1FR3A 1FGBD 3BWUD 1EY7A 1J8IA 1Q12A 1NYRA 1YNTE 3AH7A 1SNQA 1O7YA 2MP1A 3CIRB 2FHTA 2PYKA 2WP8J 1EU4A 1YN5A 5CMDA 1TWGB 5BMGA 3HOWB 5T1IA 4ABNA 4J1MA 2CU3A 4HMJA 1DM0B 3GTJB 3Q8AA 1UGJA 1QOBA 2J0TD 3MFGA 1U4PA 5C0XH 3VR2A 2PW9A 3OPOA 3T56B 5IGBA 2L0CA 3L7ZC 2SDFA 5H8YE 1A2UA 5LL6S 2KOLA 5M3FB 1JALA 4XWTA 4XDDA 2WXHA 3T53B 3MJ5A 3U52E 2HCIA 4ZLTF 1LABA 3QIAA 2L12A 2WXQA 2VB3X 1DXMA 1OQRA 1XYIA 2F0PA 1BQQT 2B2WC 1IL8A 1ML0D 1XCTL 1PLFA 4LK0M 3VYTA 5I6YA 3MHZA 2D9UA 1AZQA 2EYFA 1EEID 1RKNA 4QIWB 4CQNA 1QT9A 5EJWA 2FFKB 4WORA 4A3GB 5K36H 2QMTA 2LHEA 1Q1EA 4KKUA 1ZOYB 2EPBA 4K5XA 1MHXA 2RA4A 3MTSA 2K0PA 2L9HA 1TWHB 4HEDA 3KLRA 3RD4A 4XTCS 1KNEA 2KHSA 4M1UB 2JXMB 1HUMA 3AB9A 3I4MB 1SAPA 2A6EC 2XWJB 5C0XG 2INPE 4ZHOA 1EZ6A 1S5CD 2BE5C 1E9MA 1JWUD 3VYRA 2DY8A 4XQJA 4DA2A 5C44B 3VQIA 1BMLC 5C5MA 1EY6A 4KY5A 4ZUJA 1JR0D 4F87A 2M0AA 1ZXTA 1Q3LA 1ILQA 2NYZD 2XRQD 2K04A 3ND8A 3HOZB 1PFBA 4AQ7A 4IN3A 3VYSA 1U4LA 2G9HD 4NW2A 2IWHA 2D5DA 3H0GB 2EELA 4NAWB 1RTNA 4QMGA 2FMMA 5K36G 1GUOA 5J1ZA 1I6VC 2F0WA 2OF1A 1Y1WB 3KWVA 3EUB2 4MH8A 5DM63 4RGMA 4LMQD 3S15B 1WTVA 4UDUC 1TWCB 1B9NA 5ELCA 4KY7A 4L23A 2EOTA 1GPXA 3CRKC 5IODA 5IGEA 5C0XI 1FFVA 3BG3A 4S3SA 2I2YA 3HVZA 4NP5A 1QG7A 2CW0C 1XXGA 4DAYA 1FD7D 3W2DA 2E2JB 2F0OA 2RQXA 1Y56A 2MJDA 2IDYA 4C7YA 1QWYA 4KN4C 1DGJA 3ZYYX 4D2KA 4XIGS 1A6XA 2OXPA 3OWFA 3URYA 1I4GA 1F2LA 3OIQA 1A15A 1SIJA 2AX5A 3DEPA 2R7ZB 2F0MA 4KJOA 1KFYB 1QF6A 3TSSA 3P1MA 4ULLA 2V4IB 1ENFA 1VF7A 1ROEA 2IGHA 4CJ0B 4L1BA 1L4DB 2BDOA 5I9OA 2A6ED 2XIWA 2VUMB 2L1BA 1F9PA 3IFDA 3SEBA 1XO3A 1KDBA 1WTXA 2IGGA 2ON8A 3K5MA 2BE5D 3EA6A 4ARIA 3GS2A 3VYUA 3W1SA 3ONAB 1X32A 2KCNA 1OXXK 2NVXB 4XE0A 3I4LA 1VZ8A 1V43A 1P7FA 4RF1A 1UUPA 2D2CC 2JYOA 4V0BA 1NI3A 4IUQA 2B76B 4PMBA 4MHEA 1ZXHA 3CKIB 3EFXD 4XQQA 2JSVX 4A9AA 4IFDJ 3D4RA 2MH7A 3OIPA 2NZ1D 3NK9A 1B4OA 3QOLA 3AMUA 2MJ3A 5BN4A 2RKSA 1LTAD 1EY0A 3MHBA 1IHZA 4E6IA 2B39A 2QDBA 2N88A 2Q8RE 1TS4A 3V96A 4OIKA 2DY7A 1FXIA 1SYCA 2EY5A 1NR4A 3C3LA 4J8QA 2R6GA 1SNOA 5IOCA 2EYPA 3W5UB 3ZJUA 4FYDA 2D62A 1EQVA 5JEAG 2YYZA 2KQ4X 1KAAA 3HS0C 3NRZA 2N7JA 2N9LA 2KQ3A 1IKLA 1F9SA 2R61A 1C9FA 1G8ZD 2K5DA 4R8NA 2JA8B 1B53A 5CBEE 2G1EA 1GOZA 4IUPA 1K83B 3T3NA 4DAPA 2K01A 3AECB 4PNYA 2DNEA 3RPFC 1J7CA 1PZID 1E6EB 1TYGB 2K28A 5IGDA 4K2LA 3HEJA 1GAQB 3L4PA 2K1BA 1CK1A 2C9OA 5EE1A 1E10A 3BYYB 2IX1A 5BN5A 1JOQA 5JVG3 1G91A 3BDOA 5BYRA 2IX3A 2L4NA 5D3IB 3LNNA 2K7VA 2QCPX 1JMLA 4WAFA 3NXWA 4RFBA 2F0JA 1PDQA 3I3CA 2HCCA 4RF0A 1YJIA 1LT4D 3SHLA 5IIFA 2F0IA 3BVMA 1EQTA 2B2UC 3X3NA 2SAKA 3RFZB 2BOSA 4L6TB 1O80A 1PDXA 2NTSA 4DXGA 3AEGB 3TP6A 1R9TB 3WOFA 1IBXB 3TN2A 1FXAA 3AE6B 1LTGD 1M4VA 3NBIA 5KNCA 1T6BX 1HRJA 1EIGA 1CHPD 2HQEA 1U4RA 4FXDA 1ET9A 1K50A 2EJFC 1H9MA 4PMCA 3EVQA 1WVLA 1QNUA 2F03A 3IAYA 1IKMA 3T3OA 1DYQA 4G7OC 1BCPB 3FMCA 4CKBA 3VRBB 4MACA 2PKOA 4N58A 1PFDA 2W3RA 5HHDG 3DXJC 4KGSA 2IGDA 3AE5B 4KKJA 1TY2A 3GP7A 4TKOB 3TBIB 3M4OB 1PZKD 3U9SA 4MM3B 2JYTA 4U673 2WKDA 3Q24A 3IXSA 3J9CA 4K8IA 4LAAA 3NTIA 3P4QB 2O5IC 3M7GA 1MGSA 2B2UA 1N61A 1VR9A 2GI9A 1KNAA 3FPUB 2E76C 4FP5D 2MHVA 3TUOA 4K5WA 5BMHA 2Y3AA 1C77A 2XN9C 4KKTA 3H3VC 2F0EA 3T51B 1IBXA 3TP7A 4DN4M 3TZDA 3NSWA 3K5LA 3I91A 2KUMA 1TKWB 3RZDB 3RZOB 4XXEA 5IGGA 3NUCA 4N9TA 3ABVB 1D4BA 1C4PA 5DAUA 4DU9A 2WXIA 4RGTA 3OMGA 1C4AA 3H94A 2J7ZA 3OMCA 3C2PA 1Y1VB 1KF6B 4ZK9B 4H0LC 3H91A 4A3JB 1PGAA 5DNFA 1DOXA 2JXTA 4FF3A 1PFNA 3H8HA 1T5XD 4RAUC 4UAIA 5M3MB 4IUUA 2INNE 4C7ZA 4N9PA 5JPNC 1V1PB 3R2TA 2JA6B 1WTQA 3HOYB 1K8MA 5KRUA 3NQTA 5H92C 2BW2A 1AW7A 3DMUA 5EPJA 1KLGD 4G57A 1SYBA 4KY6A 5D7GA 2KACA 2LJIA 2WKCA 3GD7A 2KEEA 2HDLA 4BY1B 3MVVA 1ZPSA 1L5PA 1RM6C 3TDQA 3DWAA 3JAML 1BCPD 1FM0D 2LHDA 3T13A 3NVYA 3NP8A 3K5NA 2I07B 2L5TA 5IGCA 1QILA 1OQQA 5FOBB 4ZRQA 3DHQA 4EQNA 1PZJD 1AZPA 3L3OC 3P7JA 5CV6A 1FRRA 2W3SA 3NE5B 2F0QA 1A3TA 2CQAA 1N5WA 3W3AA 1PTOH 5KNDA 1PGXA 1SE2A 2JZPA 4RA8A 1BO0A 2CJNA 2AUJD 5CBAE 4PT5A 3Q22A 3X3MA 4QCLA 1CA6A 3J80L 1SBBB 4C3JB 1GUWA 2WNMA 3N9YC 2RDHA 1TVXA 5HGTA 1LT3D 4C80A 2AWNA 4ME5A 3L9AX 1GJXA 1CFMA 3DEOA 1JW9D 2Z4IA 4HSVA 1PTOB 1PTOC 3F2UA 5LL6X 1CM9A 1SJHD 5ELDA 3KBGA 3QWNA 5BYQA 4BBRB 2TSSA 3HRDD 1WCMB 1TR5A 3D31A 1CZGA 2F0GA 4C3JG 2CJOA 1QLBB 1XEEA 4LJZC 1JQ4A 4A90A 1OXSC 1QB5D 1FRDA 1XF5L 3AB5A 2PLPA 2A73B 1R4QB 1Q1BA 3S9WA 1SJED 2BDNA 2N9KA 2Z4HA 3IL8A 2WXMA 4KKSA 1DOIA 4A3IB 3GTLB 3RUZA 3LB8C 4B08A 3I9V1 3E6ZX 3HP3A 1FO4A 3TP5A 1FCCC 1HA6A 3OSOA 2WP9B 1STYA 4KI0A 4ZQ3A 5C4HA 2LFIA 2PTLA 5CR3A 4L8JA 3Q6SA 4NJCA 1ESFA 4NZLB 1QOFA 5D3DA 1Y8PB 1TKYA 4BWGB 4GZYC 1FD6A 1PGBA 5D65A 3I73A 4YTPB 2PZWA 1JQYD 2XNAC 3J81E 3S1RB 3NPPA 1LO5D 2E2IB 3A7AB 1FNWA 1VF5C 2F0LA 2HUGA 4RKBA 5JPMC 1YMHE 2WXGA 3AE4B 1JC7A 1S5ED 1A3UA 3C1FA 3W5VB 4KJNA 5FKAC 2K5WA 2WQYB 4ITKA 3TEXA 1SXTA 2F3WA 2EY2A 3A8JE 2KECA 4CKEA 3IAM1 1ZDXA 3KK7A 3LYYA 3PIP3 3VA5A 4QF4A 3PO2B 5A35A 3HOVB 2K9XA 2X6GA 4RGNA 1VZ6A 1I4HA 1C48A 4OIJA 2OEOA 1FYCA 3PUYA 2J52A 3BDLA 1HPCA 4Y7NB 2E3TA 2JEAI 3KBXA 3MWYW 1PTOD 2WACA 4WIPA 4JK1C 2Y5PA 3E0JA 1EWCA 2J4XA 5EKLA 4WRDA 2ZW1A 1PYWD 3DWQA 4HR7B 3MXPA 4F7XA 3I8ZA 4TSSA 2M00A 1SE4A 4LK1C 2MGSA 1HA5A 4QB4A 1I4QA 3NVVA 2DYOA 4KTAA 1BCPF 1XTCD 4HCEA 4A3DB 5E3FA 2BB5A 3WOEA 1Q90A 1FFUA 4FXCA 3S17B 1ZUD2 3ERQA 1DONA 4KN7C 4RCNA 4KD3A 2WXPA 2WDQB 4P16A 1BBXC 4YSXB 4RCOA 1B9MA 3S1MB 1LTID 5EE3A 4DQOC 2AQ2B 1TS3A 1SNPA 1B2TA 2GB1A 1RCVD 4GLSC 4AYBB 4JX1C 1STHA 2KA7A 3GV3A 1H9JA 4R8IA 5HFYA 2JSOA 5EKKA 4DK1A 2IPKD 4ZKCB 5CV8A 2ZXOA 2M19A 1RFKA 5FK9C 1OXVA 1E7PB 3J7YW 1JORA 1MPEA 4ZOHC 1C79A 1Z6HA 2PIAA 1STBA 5FLXL 2V4DA 3P4RB 2KMMA 4M8AA 1ET6A 1QOHA 3DUZA 2VXWA 2H88B 4A3FB 2K22A 2OT2A 2BS2B 1JOOA 4L63B 3PZ7A 2K32A 2EJMA 2Y0SB 1YQ3B 1E0ZA 3T16A 1C4CA 1T5EA 5AUIA 1CT1D 4ZYSA 1VMCA 4JPSA 3A56A 4CHTB 3D6WA 4A3MB 1HTLD 4IURA 2B8FA 4US8A 2RPVA 1TS2A 2L11A 3FDTA 2EKIA 3GTQB 1K52A 1SEBD 4YXDB 1HEZE 1FIQA 1XX8A 1K51A 1NENB 1VDZA 3RLFA 4U68A 3KWLA 5JEAH 1EFID 1O78A 2VZKB 2KDMA 2PQEA 5KGUA 4YSZB 1UNSA 5IT9E 1KDCA 1SNCA 2CHBD 4HROA 4REZA 2WINB 5HI1A 1YQ4B 4FNFA 3U7ZA 1DZ1A 2YEPB 4DXFA 3NZ3A 4HKZE 3FPPA 3M3YB 2HTME 3R8BA 4KD4A 1UEAB 4X3KA 3SK5A 1HXYD 1V97A 1BR9A 1BF4A 2KAJA 4ILWA 1BXTA 4C56C 3TEZA 3I70A 3A55A 3J7AV 4EE2A 1OFFA 1WD1A 1J9OA 3V2TA 2XWBB 1C78A 2B2VC 2KN4A 4H44C 1TWAB 2WXRA 1EU3A 1EY4A 1GXDC 3MXGA 4G7HC 1C76A 3DWPA 3Q8EA 4C1NK 3OW7A 3VRAB 5CV5A 4G7ZC 3QG1A 2DLBA 3NWSA 4HSPA 1Q8IA 1EY5A 1RDPD 2LGIA 5M5WB 2WXJA 2CW0D 2XVSA 1AWDA 3TEWA 3S14B 2E2HB