1CQVA

Crystal structure of staphylococcal enterotoxin c2 at 100k crystallized at ph 5.0
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
239
structure length
232
Chain Sequence
ESQPDPTPDELHKSSEFTGTMGNMKYLYDDHYVSATKVMSVDKFLAHDLIYNISDKKLKNYDKVKTELLNEDLAKKYKDEVVDVYGSNYYVNCYFSSKGGKTCMYGGITKHEGNHFDNGNLQNVLIRVYENKRNTISFEVQTDKKSVTAQELDIKARNFLINKKNLYEFNSSPYETGYIKFIENNGNTFWYDMMPAPGDKFDQSKYLMMYNDNKTVDSKSVKIEVHLTTKNG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of staphylococcal enterotoxin C2 at various pH levels.
pubmed doi rcsb
molecule tags Toxin
molecule keywords PROTEIN (STAPHYLOCOCCAL ENTEROTOXIN C2)
total genus 68
structure length 232
sequence length 239
ec nomenclature
pdb deposition date 1999-08-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01123 Stap_Strp_toxin Staphylococcal/Streptococcal toxin, OB-fold domain
A PF02876 Stap_Strp_tox_C Staphylococcal/Streptococcal toxin, beta-grasp domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.110 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1cqvA01
3.10.20.120 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1cqvA02
1HQRD 1YN5A 3R8BA 2CHBD 1EFID 4C56C 1I4PA 1FGBD 3R2IA 1DJRD 1S5CD 2J4XA 5D3IB 2R61A 1T5XD 3SEBA 1L0XB 1V1OA 2RDGA 3BZDB 1STEA 4RGNA 5ELEA 1JR0D 1BCPB 1S5FD 1CT1D 4RGMA 4UDUC 3BYTB 5FKAC 3EFXD 1KLGD 1D6EC 1G8ZD 1XTCD 4Z9CB 1PTOB 1ESFA 1FNUA 1LTRD 2XN9C 5TSSA 2XRQD 1PZJD 1LT5D 1V1PA 1PZKD 1FNVA 1B44D 1PRTD 1CQVA 1JQYD 3MFGA 1TS2A 1PTOC 5I4DA 1PYWD 1SE4A 1LTBD 4DXGA 1MD2D 2XNAC 1BCPD 1EEFD 3V05A 1CK1A 2TSSA 1D5MC 1YN4A 1PTOD 1UNSA 4O1NA 1TY2A 2QILA 3BVZA 1EWCA 1JCKB 2AQ3B 4RHRA 4BWGB 1F77A 2Z8LA 3DWQA 1EEID 1JWUD 2SEBD 3EA6A 5ELCA 1EU3A 1LTAD 1TS5A 1PRTB 2QEJC 1AN8A 3OWEB 1HTLD 3TSSA 3BVGA 4RFBA 1KLUD 1PZID 4DXFA 1I4XA 2NTSA 1ET9A 1RD9D 1AW7A 4OHJA 1PTOF 1SBBB 1LT3D 4ZYSA 1SJHD 3O13A 1LLRD 4RCOA 1JWMD 1CHQD 1V1PB 1FNWA 1UUPA 1SXTA 2AQ2B 1BCPC 2ICIA 1RCVD 1HXYD 1LTGD 1DYQA 1PTOH 2WV6D 1LT4D 1PRTC 2NTTA 1ENFA 1HA5A 1TS3A 4NZLB 1SE2A 1D5ZC 2IPKD 2AQ1B 1SJED 3GP7A 1TY0A 3BYYB 4RGOS 4L63B 4RH6A 5ELBA 4RGTA 4TSSA 1M4VA 2O2LD 4L6TB 1EU4A 3DWAA 1RF2D 1D5XC 5D3DA 4K6LA 1I4QA 5FK9C 2RDHA 1LT6D 1B1ZA 1RDPD 1S5DD 1JWSD 1LTSD 5ELFA 1SEBD 1XXGA 1BXTA 1LO5D 1LTTD 1TS4A 3DWPA 1S5BD 5ELDA 3URYA 1I4GA 3W2DA 1BCPF 1LTID 1L0YB 1CHPD 3KLSX 1QILA 1SE3A 2G9HD 3R2TA 1FD7D 4RHSA 1PRTF 2IJ0A 3CHBD 3BVMA 1I4RA 1GOZA 2XRSD 1ET6A 3MC0B 1I4HA 1YN3A 1S5ED 1KTKA
chains in the Genus database with same CATH superfamily
1K50A 1WX8A 2FCMA 2H4OA 4EQPA 5LXIB 3ZNGC 5D3IB 1HTOA 3ITPA 2LFIA 1A15A 3J80L 3NBHA 1KLVA 3HOZB 1OTRB 2REXA 3STBC 2B63B 3VYUA 4DK1A 3AEEB 1ZGUB 3Q3OC 3ZVVA 4K5XA 3A7LA 1TWGB 1EUJA 1QOBA 3VVWB 4RGMA 3P4QB 2F0OA 3J81j 2LUMA 2KCMA 1MFWA 3SR6A 2JXMB 1IKMA 1W2BA 3HIZA 3CW2C 1Y1VH 2NR2A 2EKIA 4N9PA 4LNIA 4A3IG 3RZDB 2ZTDA 2J0JA 1WYDA 1FMAD 4JX1C 3HFZB 2J0MA 1I7HA 4MH8A 2R3ZA 3VA5A 2WX1A 3F1ZA 2FE8A 2IDYA 4H2AA 1JQYD 2MBEA 1UZXB 1NJIC 3P63A 3AN1A 2EYJA 4NKLA 2V3SA 1IL8A 1XTDA 4FXCA 5E4WC 5KRUA 1BCPD 3PCOB 1JT8A 1YNXA 4MM3B 4DHZB 3TP7A 1WTHA 4QF4A 1KDBA 2EMSA 2JA6G 1CZGA 1HNWL 2Z4IA 2EDGA 3KUZA 1YNNC 1BUVT 5DEHA 5ELOA 3TMEA 1R9TB 4MSMB 3W1YA 3S1MB 2K03A 1RFAA 3RN9C 1TTNA 1TS5A 5AUIA 1B70B 2HCCA 2JEBI 4C3JG 2DAFA 4NQLB 3GB1A 1G291 3J7AF 1J7BA 2FINB 1HZBA 1K83B 2PMZB 3RPFC 3HOWG 1ONLA 2F03A 4UAIA 3HKZB 4KDIC 1C76A 1ZDXA 5C2TB 5LMUQ 2DUDA 1LACA 2B2TA 4RG1A 4B3RL 3FP9A 3WOFA 4FJVB 3CCEA 1Q8KA 3QO2A 4IQZA 3S16H 2BYEA 1ZOYB 2DBYA 3U50C 2YU9H 2UXBQ 3IT6B 4ZKBB 2BVCA 1TIFA 3EGRA 3NVVA 4CQNA 3RLNA 2V3PA 4MGKE 4A75A 3S15B 4ZOHC 4OXPA 2QW7A 4U673 4GNXB 4N58A 1JMLA 2A68D 4FYDA 1I94L 4AJYB 1XNQQ 2JN4A 4FXGC 4RH6A 3OTOL 1BBUA 3BG3A 3OMCA 3AMUA 2RA4A 4HIDA 3GTJH 3KLRA 1F9JA 2KKCA 4HLEA 1D5XC 1B9RA 2LXJA 1GC6A 1GUAB 3VRAB 1H8CA 4WJWA 2L9HA 4WWPA 3UQBA 3RNCC 3T16A 3RULA 3NJTA 3UIOB 5M3FG 1SEBD 4F8MA 1YHAA 2WQYB 3Q8CA 1LO5D 2QC8A 4HRSA 3J7A5 3RZFA 2Q8RE 4AYBE 2GN5A 3URYA 3H7SA 4HIOA 2PVGC 1ZXHA 1Q1OA 1SE3A 2EXDA 2Z6BA 1SYBA 4OWXB 1PYBA 4DV1L 1RLFA 4DBGA 1NCVA 4DAPA 4XYQA 1EQTA 4P16A 1VJKA 4DF7A 3WAMA 1V6EA 3TEYA 3Q3NC 1D8LA 3LGJA 4L5SA 4GB9A 2K1FA 3N3KB 2KQ7A 3VDZA 1VQFA 1LFDA 5CBEE 1I4PA 1Y8OB 1EUVB 1M1KC 1NR2A 2KA7A 2UXCQ 2A69D 3G7LA 1A8VA 5IGFA 4JL9A 3HVDA 5M5XH 5FJ8G 1S3SG 2BKFA 2CKHB 4ZK9B 1STYA 3PUVA 2GI9A 3HOZH 4LW1A 4EQNA 4OZBA 2OJWA 3BYTB 1SF0A 1UGMA 1QNKA 4JC0A 2K9XA 2C5CA 2FMCA 4JIOU 3R7QA 4PS8A 2XN9C 1E8XA 2YYZA 2K52A 5LLIA 5C0XH 2D07B 2WXLA 4B3RQ 3AXCA 4X65L 1R9TH 2JJQA 2A4ZA 2HTHA 2DY7A 2B2TC 1SE4A 1P7EA 1TWAB 1JRUA 5EKIA 1FXAA 2RPVA 4OO1I 4H7BA 2I1KA 4ZRQA 4DR6Q 1BBWA 3GD7A 1JW9D 4HAEA 2E6XA 2PEAA 4A8XC 1L2NA 2D11A 2LVOA 3PSEB 4X62Q 1QVFA 3TCAA 1UEBA 3BVZA 3TN2A 1QJOA 4BWGB 3K7AH 5FLXc 1QVCA 2JK8A 2INDC 4QJFA 3V96A 2ZW1A 1VF5C 3DWQA 1XX8A 4A3DB 4GN3B 5AFWA 1VQEA 2WDVB 2KFKA 3IRBA 1G6ZA 4ID6A 1PH6A 1S4ZA 1HR0L 2VB2X 4ZHOA 2UXBL 2UXDQ 4OZAA 1IW7D 2CS4A 1FEHA 2F0LA 2K75A 2M9VA 3CD6A 1N6ZA 4IM2A 2F0PA 2R6GA 4JOIA 4XT3B 3VHTC 4P7IA 4KKIA 1SJHD 3O13A 1AE3A 5IIFA 5AJ3L 2R7DA 2NVTH 5M3FH 4V0BA 1XPOA 3NK9A 1JJCB 2KDEB 1SNCA 4TQUS 3D4DA 4BBSB 1DONA 5JH5C 3VR4A 1CMXB 1HZ9A 1UELA 4FJZA 4M01A 3VH3B 1RODA 4IUVA 2CJNA 4XT1B 5T1IA 1L0WA 1WXMA 4LJPB 1WR1A 1JRPA 3TEXA 1EFWA 2K6QA 2KFKB 1U9RA 3ZDMC 4IUTA 2A68C 4ZRJA 1TKYA 1RIPA 1GJZA 3BDLA 1PYSB 3AB5A 3SU8X 3DWAA 2O5JC 5CORA 2N9PC 1X6OA 1O78A 1B1ZA 3CSFA 4JI4Q 3DWMA 1TWCH 1E8ZA 3VUWA 3A74A 2EPBA 2LHDA 1BXTA 4N8FA 3AE6B 5I2YA 4KLKA 2RKSA 2JRHA 1F9RA 4C80A 2E5LQ 1Q7YC 3M9BA 5G3LF 1SYFA 4C4VA 2JA5H 1WFQA 1IBXB 4DHZE 3VA7A 5IYBG 1D2BA 2IO3B 3NVYA 2XEWA 2F0IA 4NW2A 1HHVA 1I4RA 3PUZA 3ZTCA 5M5WB 2EY5A 1R4NI 4YWGG 1HJPA 2KDIA 3BIID 4KGRA 2F1MA 2ZT9C 1R4PB 1JMCA 4MSQB 1F2YA 2HDMA 1I6VC 4ZHPA 1FGBD 2KANA 3S9WA 1XD3B 2N0SB 1V1OA 3X23A 2M0XA 5LMNQ 2K5NA 3GV6A 4HROA 5FR3A 4GMVA 5EDSA 4UDUC 1Q1BA 1UD7A 3AE1B 1KLGD 3Q69A 2HDEA 4NJ6A 1VZ6A 2Q8IB 4LF8Q 1ESFA 1PTOB 2PQAA 2W55A 3PIO3 1EIFA 2XRQD 3OWFA 2DLBA 3JAME 1NYRA 1EOTA 4A3IH 1CM9A 1WYGA 4KHPL 2LHEA 4HPLB 2KAJA 3SK8A 3IVFA 2WKCA 4Y7NH 2KBNA 2KYWA 1JORA 1TS2A 4P72A 4ANUA 3Q6SA 2L4NA 1PYWD 1VMCA 3ND8A 5IGBA 4E71A 2CH4W 2BH2A 3PLUA 2K05A 2GVBA 4RMAA 4IDIA 1HFNA 1HA6A 2G5DA 1V81A 4ARIA 4FJYA 3WOEA 4KDLB 1KH0A 1VR9A 3PF4A 1NAPA 4GKKL 1WWTA 2RHQB 5HI1A 3KUDB 1E5WA 2Y5CA 4W9KA 1AN8A 2PPBC 1QT9A 2IGDA 3TSSA 4ZRKA 3AEAB 1NI2A 1QQRA 4TKOB 2QF7A 2X38A 1B50A 2LGIA 1ZP0B 3SK4A 5IP9H 4IM0A 1BF4A 3UE1A 4M8AA 1LUZA 2BWES 2O2VB 4JW0A 1FPYA 3J81L 3ZJTA 2ASBA 1QKZA 5C4JH 3DVGY 2ZNVC 3NQIA 3S14B 2K6DB 2INNE 3T3NA 2D9UA 3TJPA 1SR3A 3S2DH 1XPRA 4RF1A 3FKIG 4RWSC 3PO2H 2BA1A 1MPEA 3BK2A 4S0RA 5E6JA 3VH4B 2N49A 3OJ4B 4A3FB 1YJWA 3GTMH 1P1AA 4DDGD 3F2UA 4BBSH 4QGUA 2FCNA 4OL7A 4W9GA 2E75C 3LNNA 5NUCA 3QR8A 4GDLA 4LF7Q 2IPKD 4IWPA 5E3FA 1IYFA 2NZ1D 1NDDA 3ZQ4A 1RHPA 3BYYB 4DFAA 3CCUA 2K5HA 4NP5A 2OQ0A 2CHZA 2IO2B 2CFMA 1KXLA 4K3CA 2Z59B 1M4VA 3A54A 3MEHA 5D94A 1Z2MA 1L0VB 4DKAC 2DYOA 1RF2D 3P1HA 4WJOA 1I4QA 2K25A 1ML0D 2WIIB 2VQEL 2KMMA 4IWOA 1JWSD 2EYMA 2ZJDA 1WMHA 1ZE3D 5BR8Q 4FN2A 4RMFA 3C0RB 2X69A 3H7PB 1L1OC 5JEAJ 5FLXL 1QCBD 2YU9B 4B3SL 2JVCA 2F0JA 3U8ZA 2FMMA 3NBHB 4EGVA 2GRIA 2PW7A 5E7NA 3PF5A 2IJ0A 3I4NH 1EY6A 3U4ZA 2BKRB 4US8A 5IWAL 2LZ6A 3J9CA 4M00A 1K8GA 2GMIC 3CU7A 2W54A 4WJPA 3Q3JA 4N59A 4AH6A 4JI6L 4DV6Q 2K28A 1HQRD 4HTHA 2LFNA 5H92C 2GLSA 2G9DA 1BT0A 4KIKA 2INCC 4P1BC 1GC7A 3L4PA 4OO1G 1VQKA 1A2TA 4C3HB 4DUZQ 2MO1A 2F4IA 4OWTB 2VH1A 4A3LG 2E2IB 1HZ6A 3R3OA 4XQJA 2DJFC 3I73A 2ZXOA 3PSIA 4CJ0B 1FJGL 3A33B 2RCFA 1VQ8A 1VZ7A 3M4YA 3H15A 3WAOA 2K6AA 1OO9B 3PRMB 5I6WA 4JBKA 3H9DA 1PZJD 4HJAA 3EFUA 5I6YA 4IWQA 3PO3B 1DGJA 4XYCA 4D2KA 2LI5A 2KJ6A 1DOIA 3VDYA 4BXXH 3UDIA 3I4LA 3IG3A 2LGSA 5KYIA 1IYVA 1EY4A 4DXGA 3WA0A 5LMUL 1WY8A 4LK1C 4EZJA 2DYBA 3K57A 3S1QB 2K0PA 4QQBX 2MJ8A 1SIJA 4E3CA 4G57A 1SLJA 1WZ3A 3BINA 4B3TL 2DX5B 5KEEA 4HCSA 4CO7A 2MBOA 3AV8A 3PIP3 2B2WC 2AL3A 4LAAA 5G5HA 2F3WA 3ONAB 3R3MA 1EQQA 5IODA 1XCQL 4FLHA 4EFOA 2HJ8A 4ME3A 4A3BG 3W1SC 3CCQA 2F0SA 3NG0A 5BR8L 4ZDVA 1EY8A 1GUWA 3ML9A 4I6NB 4BKTA 1N36Q 2B8FA 4HJ5A 1XNQL 3RUIB 4A3CG 1V9PA 3T8MA 2J7ZA 3W3AA 4OHJA 4KK7A 4CDDC 4WIPA 3D4RA 3APFA 3FKIB 3I2ZA 2ZJRA 1YVCA 3T13A 2EOTA 1QOGA 1PH9A 2JA7H 2KX3A 1MSHA 2PZUA 2ZTCA 4P6VF 1TZOA 5DM73 3GOEA 4IC7B 4NZLB 1GXDC 3K59A 2L0CA 4A3BB 2W82A 4LF9Q 3AU7A 4IUPA 3GP7A 1ASYA 3APDA 1QNUA 2EYLA 3SE0A 4WQMA 1LYLA 4HN7A 4B3SQ 2F0HA 5IP9G 4K2LA 5KYLA 1GJXA 1AYFA 1T3QA 1YITA 3VR3A 2NWGA 3I3CA 5IGGA 5IT9c 1D1KA 3KYHC 1I42A 3GTKB 2SNSA 1F9SA 4BY1H 4BBNF 5CV8A 4OO1H 1P3QU 4BKSD 1MHHE 1R7SA 3N1XC 4LJZC 3HOZG 1EY7A 3UE0A 3F2BA 1QUQA 4RAUC 3W2DA 2K04A 1VS0A 2ONQA 1KFYB 4B0EA 3GTQH 1JB7A 4C3HG 3V60A 1C4PA 1D1IA 1JC7A 3BVMA 3CHBD 3Q2AC 2L0FA 4DR1L 1OEYA 4WAAA 2M00A 4DGZA 3RUZA 1YN3A 4BA2I 4GS3A 3B2GA 4AJWA 4FADA 1E2VA 3VAWA 3ZJUA 1YN5A 4UPAA 1XF5L 3HRDD 1EWIA 3MFYA 1YD8U 5IOIA 4K0KL 3WALA 3SEBA 4LUVA 5A35A 1Y56A 2N78A 2IHFA 4IUUA 1MG4A 1BDOA 3KW5B 5D65A 3TZDA 3BZDB 1EO6A 1J7CA 5HHDG 2EY2A 2RQXA 3ZYYX 2K5QA 1PQSA 3APCA 4ABNA 4LFBL 4IN3A 2KC2A 2N8NA 2BWFA 4K5WA 2WNMA 1HTQA 4X64Q 4J8QA 3BDOA 4HPPA 1UBQA 5KGUA 2MFIA 2FXQA 3RD4A 2VS1A 2CHXA 2L52A 3TP8A 2L8JA 4B9XA 2JPHA 4A55A 1V1PA 3L16A 2FBWB 4NPSA 4G50A 1D4BA 4IFDI 5JHAA 1ICFB 4GN5A 2NBVB 1E1TA 5I4DA 1WTQA 2KWCA 4F8CB 4FF3A 4KD4A 4HR7B 1CKNB 4X3KA 5HGQA 1VLBA 2L3ZA 2MJEA 4HJKA 4A3GH 1PTOD 1WCMH 3QB3A 3VR6A 4W9HA 1CQFA 3SFDB 2BW2A 1WMHB 3ZTDA 1WD1A 4W9EA 1JCKB 4RHRA 2INPE 4L8JA 1YJIA 3H7PA 2PI2A 3A9KB 1IBKL 1LM0A 2CH4A 3U9SA 4YSXB 1SMYC 4A3EH 2NN6I 1H4RA 2Z0DB 2LKVA 3Q3FA 1PUTA 2HUGA 2PCFB 3AYHB 2AMCB 1WTXA 5DPRA 1VQBA 3M62B 4L1BA 4QMGA 3H3VH 3A5ZB 2J52A 2L0TA 4LCDE 4IJLA 1ET9A 4PS3A 1PTOF 2BS3B 4LNNA 4MGZE 4R8IA 3E56A 4ZLTF 5DPSA 2L1AA 4DV7Q 3ND9A 3NZ3A 3OLMD 3C19A 4HMJA 1HXYD 3G6EA 2JA5G 2BF8B 3QC8B 1D7QA 4BOZB 1PRTC 1FM0D 1KF6B 1V8CA 1WE6A 1WGGA 2IX0A 4K1RB 4AP4C 2ID0A 2ZXRA 4POFA 1K3BC 1VQ5A 1HCZA 4ICUA 4UP9A 2WLBA 1HFGA 4PZ6A 2N7DA 1TY0A 2WP8J 3E9HA 1BKBA 3KF6B 4OWWB 4MGYE 4XWTA 3D0FA 1Q82C 3M3YB 3I90A 5G55A 3M85A 3ZRCA 2F0GA 2BGFA 4GOPA 3V62A 5IP7H 4OIJA 3FAHA 3L2PA 3F2DA 2MHJA 2L05A 2HD3A 1MSGA 1HUMA 3AECB 4MEMA 4ASWC 1KL9A 3C3LA 3X0WA 4PV1C 3A1QA 2J42A 4A93G 2Q2UA 3U58A 3TP6A 4YWLA 3RR5A 1H9SA 1WOCA 5M3MH 3TL5A 1XNRQ 1C79A 2DN8A 4LFAQ 2A19A 5J39A 4HXDA 4GLVB 5G5GA 4G3XB 2K14A 3L9AX 3M63B 2YEPF 2LRUA 4M8NA 1K83H 3BK1A 4JBWA 1IP9A 4NY0A 3K80C 2L12A 5I9OA 2M1MA 5JVH3 4O0AA 1C48A 2MHVA 1YIJA 4I6LB 2R7ZG 1YQBA 4JI7L 2ICEC 1Z6HA 4A3KH 2KC1A 5E1FA 2VZKD 5L95C 2G4SA 2E2JB 1L1OB 2N7EA 4L2YA 4LF5Q 3E9IA 1UGJA 4BZAA 4XTCS 3B2FA 1X32A 3TZUA 1DJRD 3ZO5B 2F0TA 2VXWA 5FO9B 2WS3B 3H6NA 2RDGA 2D3AA 3ERSX 5ELEA 3PRPB 3WIMA 4J3OD 2DJGC 1GM5A 2EYHA 4GGQA 4DV0L 4KMUC 5H1SE 1H9SB 5FKAC 1HZ5A 3I63C 5IOCA 2Z6KC 3R7RA 1D6EC 2K3UA 1P9DU 4A3MH 2JQRB 2R2OA 3GTJB 3UI3A 3MXNA 4JI8L 5CGKA 1QG7A 4Q0FA 5IAAC 5CV5A 4HEA1 4EZLA 1TU2B 2L11A 5EKKA 2G3QB 2E2DC 1UWMA 1FNVA 2WACA 4KKSA 2PMVA 3JAML 1PRTD 2OWOA 1IBKQ 1TWGH 1KDAA 4JWUC 5ISRA 3EFCA 4KTAA 1IBMQ 3TUOA 1VQDA 1MD2D 1K0SA 1EY9A 4P2CB 3Q14C 1EEFD 1H9JA 1MJEA 1CA6A 4IO9A 3TP5A 4DV2Q 4AIMA 1RFKA 4O1NA 4IURA 4LDTD 3PZ7A 3RZWC 3DPDA 2W3SA 4WORA 4DV1Q 4IUNA 2WAQG 1X54A 1STAA 2EYOA 4DR3L 4BBSG 4K7SA 5JJZA 2M19A 3MXPA 4MH0E 4R4CA 4C3JB 2IYDB 3DOWA 1IHZA 2CHWA 1SN8A 3W9CB 2I5LX 5JZEB 1A62A 3BVGA 1KLUD 2JXTA 2QDLA 3ZDTA 5JOBA 4GDLB 2NTSA 2KMCA 1C1YB 4NJCA 2WP9B 2AL6A 3U2SC 4ZYSA 1E90A 4CHKA 2RF4A 3MC8A 2HQLA 1JWMD 1TWHB 4UY8C 4FVMA 1V49A 2CW0D 4CDFC 1KABA 2AQ2B 2XVSA 1BCPC 1K28A 3AEFB 1NMFA 4G11A 1GB4A 2EJGC 1TWAH 3L7ZC 2MW5A 1KRTA 2XWBB 1J7AA 4ANXA 4YWKA 3JAMc 3S1QH 1IBLL 4C3JH 1OFFA 2DYMA 1MI2A 1MVKA 2MNAA 1L4DB 3U9OA 3CC4A 4HK2A 4BKGA 3W1SA 2PO4A 1WFYA 1NY4A 3E5SA 1Q8IA 3I70A 2HCIA 4KKUA 4JI6Q 4KJOA 1T6BX 3Q6BA 1STBA 1GUGA 2E74C 1F2RI 2YTYA 2BB6A 2XK5B 5K36G 2KK8A 2M56B 2DZKA 2GVAA 4C00A 1ZKOA 4IPCA 1WXVA 2D3GA 2KTRA 2V4LA 1WE7A 4LJOB 3HOYB 3H09A 4EQ5A 5M9OA 3DWPA 5ELDA 5C5MA 1QVGA 2O2VA 4KHZA 4A90A 3KBGA 3M7GA 3G4SA 1PV4A 3KLSX 3BY4B 2LSSA 1WX9A 1LABA 2EMTA 3HOUG 5LL6S 2IBIB 2NVTB 2BDNA 2NBWB 3N30A 4C3HH 1VZ8A 3C2PA 2X6GA 2NVXB 5BMIA 1B9NA 2Z4HA 2NBFA 2JYOA 3S1NB 4IW0A 2CHBD 2NVQH 4A3CH 3EUB2 1C9FA 2VB3X 2BB5A 5ELNA 3DWGC 2FUG1 1MGSA 4DUZL 1PFSA 3JAMi 4A3JH 1L0XB 1OTCA 5C3XA 1FIQA 2G1EA 3IAS1 3K58A 1DOLA 3RNEC 3NQTA 5A2QE 5IYCH 1V80A 4ZRIA 3NUCA 3K9PB 4PZ7A 2ZJQA 3DBHB 1CT1D 4K8JA 2C7NB 4C7ZA 1E9MA 1KHIA 4DR5L 3S1MH 2WXRA 3U30A 1PFNA 1EIYB 4LF4L 3TBLD 3AE3B 1SB3C 2C60A 2R7ZH 1W6KA 5C3EB 4A3MB 1ZYRD 5FO8B 2KZRA 1JJGA 2AKWB 4L5TA 1EOVA 5EPKA 1F2RC 1WTVA 3H1UA 3JW0X 1STGA 4L5QA 4KN7C 2PIAA 1TIID 5C3WA 1XYIA 4QB4A 1N36L 1Q10A 3U4VA 5G3LD 4BS9A 4BY7H 1D3ZA 2LGYA 2F3VA 1D5MC 2KQSA 2O6VA 1YN4A 3B08A 1OEYJ 1R4NB 1P0RA 3I7FA 4F1SA 4YT0B 2QILA 4P73A 2JA7G 2C9OA 3RN5A 1OXVA 5IE8A 5LMNL 3PGEA 4A3DG 3NWTA 1TKWB 2I07B 1I3QH 4DV6L 4U68A 4X6AH 4YCWA 4A3GB 1WX7A 3Q3MC 3N32A 2SEBD 4IOAA 1RYJA 5DNFA 4DR2Q 4P71A 4A3EG 1ROEA 2UUAL 2OF1A 5CV4A 2WDRB 3VFKA 3J81i 4I65A 1X3GA 3TEWA 4JI0Q 1XMQL 1AP0A 4DNIA 4JK1C 1EYGA 2RSOA 2EIFA 2BS4B 3K9OB 4H13C 1VQCA 4KN4C 1KC8C 2KQ4X 4C4VB 3KJOA 1VQOA 3D6CA 2KLCA 1K3RA 1LLRD 4HJ7A 2KDMA 1P8LA 5EGTA 2UXCL 1CHQD 2PVOD 2ZW0A 1TVXA 2J7QB 5GXGB 3PLVA 5IGCA 2A5UA 1LM8B 4ALPA 1N5WA 2OOBB 4DV3Q 1HA5A 4GN4B 1GHJA 3CQZB 3HOXH 4NAWB 3TIXA 4M02A 3BZKA 4RCNA 2KT7A 4G7HC 3CCRA 4TSSA 1SMYD 1ZPSA 3KF8B 2H5XA 1J5EQ 2RDHA 3PUXA 2ON8A 1U4AA 1RDPD 3VR5A 3RCZA 3CC7A 4L5RC 2F0KA 1LTTD 3QWZB 3WAPA 2UUCL 5IYCG 1SFOH 1WRIA 1BNZA 1E6EB 2IHEA 1LTID 1GUNA 3Q8BA 3C1FA 1C4QA 5D6JB 1PGBA 3A0JA 2G9HD 3MXGA 5IY0A 1HH2P 4USAA 2KWDA 1PRTF 1RTNA 1RTOA 3GE8C 2NN6G 2WXFA 4N9F4 1Y8PB 1I4HA 2WB1G 3D32A 3QJZA 2B29A 4IJHA 3L13A 4F7ZA 3UDXA 3ICEA 1L7YA 4KZCA 4UHVA 2JSVX 2UXDL 5CTRC 2WXIA 1VQHA 1DXMA 4C56C 4LK0M 4NJ7A 4DUYQ 2GBMA 3TEZA 4FP5D 1S5CD 3VR2A 4W9JA 3VTUA 4PG3A 1VQJA 3OOCA 5J18A 2BT6A 4OX9Q 1ASZA 1G6JA 2XTIA 3UF8A 3QK0A 3MXUA 5I2XA 3QARA 1A3VA 2ES2A 1A70A 4WWNA 3MP9A 3MEFA 5A2QL 1AH9A 3UIPB 1LV9A 2ALYB 1B9MA 4ZUIA 5KIXA 1Z9FA 3TBIB 1WXAA 1SE8A 1Q0WB 3J81c 1NEKB 1PDXA 3DEOA 4US9A 2LMCB 4BXXG 4A93B 2LJ5A 2EYPA 5GAHC 2WXNA 2I1JA 3PUWA 4A3EB 1WTRA 2W9NA 3CCJA 4LDTB 4DR1Q 2BA0A 3V61A 4JPBW 4A3IB 2KTRB 3SDLC 2AQ3B 2EKEC 4LTUA 2MUYA 3CRLC 2IY0B 1B8AA 4ZYNA 3AU5A 1JICA 4WJNA 4DK3C 2D3BA 4BBRH 2WU2B 2WGSA 2N9KA 4DV5Q 1Y1WG 3RI7C 1VD2A 2KD0A 3MC9A 4HWIB 1RL2A 1VQ9A 2WWZA 4PMCA 2R2QA 1SMXA 4LF8L 4M0WB 3W1GA 3QOJA 3AEVA 2VUMB 1LT3D 4KJNA 3DHGC 1XQQA 1BO0A 3AMZA 3B6YA 3M95A 3H6MA 3NEMA 4DAYA 2JEAI 1CFMA 4LWCA 3X3MA 5KNCA 1N33L 2ENBA 1F52A 1E7UA 1X56A 4JI2L 1SNMA 2K4KA 2KMAA 3HGBA 4XWWA 3PZ8A 1J8IA 3NOBA 1UF0A 2KXJA 1G2SA 2FHTA 3HG9A 1XNRL 4NXNQ 3CF6E 2DHZA 1TZ1A 2KVRA 2KCTA 1WTOA 1P98A 3ER0A 4URKA 4C2MH 4WURA 3C8YA 1SYGA 1S72A 2CR5A 4A6QA 5EAYA 4R4OA 2YVCA 4JLCA 3PGZA 1XPUA 1TKEA 5HY6A 1UE6A 1E8YA 1CA5A 1X1MA 2JRIB 3HM6X 3VTWA 4EKUA 3DBSA 3RMKC 1HE8A 1C0AA 3KH0A 1E2WA 1R4QB 1NNXA 3LWUA 3SK5A 1PHJA 1BQQT 1UE5A 3GTQB 1RRBA 1E1OA 3D8GA 5C3JB 1EZ6A 2K8BA 3WANA 3P2BA 5DLQE 1GVPA 2HJ1A 5DAUA 4KSKC 1BCPF 2N9XA 3Q8DA 2LXCA 4EEWA 2V0GA 3ZJVA 4F87A 2QCPX 3CCVA 3VXWA 2JE6I 2R93H 1F1HA 3NS1A 4HJ8A 4NQKE 2QSDA 4OX9L 3B9JA 1F2MA 5CC4A 5IYBH 1GOZA 4Q5VA 3X3NA 2NVYB 2KOLA 3WDNA 1TXYA 2KECA 3OMGA 3N52A 5L37A 4OIKA 1ISNA 1TWHH 1X3EA 1VRAB 3LB8C 2EJFC 3W5OA 1PH5A 3H0GB 1X3FA 1QOHA 1WF9A 2BTEA 3DBLI 2N55A 2WKDA 4HSVA 4YY3L 1T0SC 4PK1A 3DXJC 3NBIA 5J22A 3GTPB 5BN4A 1GAQB 4MACA 4B9KA 4A3FH 3HKZE 4ARCA 1S5FD 4A93H 4GOPB 3HUIA 1I6HH 3KLSA 3GTKH 2A74C 3DDCB 5BO4B 3BDCA 1A2UA 2DENB 2HTME 3NSWA 4Z9CB 1M94A 4TVAB 1C3TA 2LRWA 4R3DA 4PMBA 5E6NA 4YIJA 1NENB 4KY5A 3ZLZA 3AE9B 3RMHA 1AZQA 1YNND 1PZKD 2IGHA 2KDFB 3QX1A 2P5ZX 2E2IH 4NAWA 1I50H 3FILB 1FR3A 1WXSA 3KVFB 4X3UA 2F4VL 2I38A 4KV6A 4JG2A 4LFAL 4PNYA 1GUOA 4B95A 2KVMA 3S16B 4DV0Q 1P7FA 4DWFA 4I6PA 2NVQB 4DR3Q 3OIQA 3HOYH 1WVLA 1VQPA 2DZIA 3ECIA 3QCAA 5M3MG 4JI1L 3DBRB 3S24A 3NP8A 3M4QA 2EELA 2LWPA 2RMMA 4KV2A 4JVZA 3ENEA 2B2YA 1IPGA 2KHSA 2BQQA 5ELCA 3AE5B 2LY7A 2ZNVB 5LL6X 4DK5A 4AYBB 4MHEA 3J7AV 1XO3A 3AE7B 2QCZA 3PS6A 5EE1A 1PH1A 2MQHA 3L0WB 2KFJA 4DK6C 2LS01 3HOWH 1RKNA 4NXNL 5IP4D 4K0KQ 4DXFA 2VUMG 2N1VA 2WXPA 3ULLA 4HKZE 5C23A 3V3XA 4LF6Q 1XMOQ 1ICWA 3T9LA 2RPQA 4A20A 4O2DA 3HOVH 4TQ0A 1WCMB 3G6JB 2DZJA 1UUPA 1KM7A 1K8OA 3FPPA 2X8XX 2XK5A 4YXDB 1NR4A 3KDFA 1V86A 4DR7L 2NZHA 3CP0A 1HR0W 1C4CA 1LT4D 3NWSA 4ZKCB 3Q0AA 4CBVA 1L2FA 2GB1A 3RLFA 3JSVA 4AS1A 3A7AB 1HRJA 3AFPA 2LEKA 4GLAC 1E0BA 2F0FA 2RDFA 4OGQC 3ZRFA 1U4MA 4DV2L 2ZPNA 2H1EA 1OQYA 2RSNA 1G6PA 2MJ3A 1A63A 5MPOA 1YHQA 2WINB 5HKHA 5BN3A 1S5DD 1LTSD 3K5LA 2MBQA 4BOSC 4EUTA 2LUEA 5LXHA 1IL2A 2RVLA 1NSNS 2N88A 2NUCA 3ERQA 2I2YA 2NPTB 1DOYA 2K01A 2KJRA 3KDFB 2JSOA 2WXKA 2D0PA 1CHPD 1X65A 4EE2A 2ZVOA 2ZCBA 3FKYA 1EQVA 1WJ4A 1WTWA 1DCZA 1QLBB 2Y0SG 3SDZA 3BWUD 2OEDA 3D3RA 2IO0B 2Y5PA 2DY8A 1FCLA 1F9QA 2O2LD 3H0GG 2K1BA 2OCEA 2SOBA 3R8BA 1N34Q 3NVZA 4OEMB 3P20A 3JVZX 1K0RA 1EYDA 1H9MA 2IX1A 2E2JH 1PGAA 2ATWA 4LUZA 1S1QB 3L10B 3CCSA 5FJ8H 1JR0D 3K5NA 1PH3A 4II3B 1YNTE 3CMEA 3KQ4A 4UP7A 2UUBQ 4YTNB 1KD1C 4C1NI 1KDCA 1Q86C 5CYUA 4XC2A 3HVZA 2KHJA 2K5DA 5LHY1 2WX0A 2UU7A 5LNK1 2HHHL 1LT5D 2Q5WD 3I4MH 2IW3A 4X3TA 4AUQC 3P1MA 3G48A 3E6ZX 2VZAA 3T53B 4DV4L 1WIAA 1MKHA 1TWCB 1VQLA 3AU4A 4ANWA 3I4OA 5BMHA 1IUEA 3GTGH 1HNWQ 4MJSB 3HOWB 4EX5A 2R7FA 1B53A 2FCQA 2MLBA 1JWAD 1SE9A 2FFKB 4DR4L 4FXKC 1EWCA 5C4XH 2JA8G 4BAXA 1F77A 2Z8LA 3EIVA 1EF5A 3NVWA 4GKJL 2GBNA 5J3BA 5BMGA 2KWUB 3MA2B 2QA4A 5AJ3Q 2PE9A 2W3RA 1HTLD 1SSOA 2RDBC 4YHHQ 2QIEB 3CAMA 1N33Q 3FRPB 2KN5A 3PPAA 5TR5A 5KHQA 2D3CA 2ZZPB 2WB1E 1GNUA 1RD9D 3MZ5A 2NCNA 1SBBB 5EE0A 4BBNC 2ZVNA 4O42A 2PZTA 2PI2E 1WJNA 3CQZH 3HOXB 1WR6E 3I5JC 3NZUA 4A3GG 3BU2A 1EQRA 2RHSB 3FVQA 3LWEA 2WFWA 4MIUA 2MQJA 3OW2A 4ICVA 3ZXRA 1SXTA 1GHKA 3H91A 2L7RA 3U7ZA 3HOYG 2CW0C 4DDID 2N9EB 4OVVA 2K5WA 3ALBA 3CWIA 1L1OA 2FIDA 4XZ4A 4NNJB 2QMTA 1JWBD 3S1NH 4GU2A 1ESRA 2C5LC 1E10A 2ASQA 2K22A 4A4IA 2WXQA 5KNDA 4JWSC 2ZEQA 2D0OA 4H44C 5C0XG 3L17A 1MJDA 3MVVA 4ZRPA 4RGOS 4JI4L 2MBHA 3AFQA 3K0YA 1B3QA 5EBCA 3K0XA 1PFBA 2C9WB 2NBUA 1T0RC 4WJQA 1UEAB 3VYTA 2IZVB 1E24A 2Y0SE 3V6CB 4HCPB 1F2LA 2V1CC 4PMWA 1OXXK 4K8IA 2L5TA 1DOXA 5FK9C 2RGFA 1YI2A 5JAVA 4BY1G 5HURA 4DUYL 3BS1A 2MO0A 1DOKA 3SVMA 3ZNHB 1XXGA 4DK0A 4A3LH 4NAMA 4XX5A 2JU6X 3NHEB 4AOFA 2B2UA 4W9LA 3KF6A 1HNXL 1PDQA 2PYKA 4BBRG 2M0AA 2CQOA 4RHSA 5C6AA 1Q3LA 2K8CA 2BDOA 1CKMA 2WAQE 3TREA 1Q5WB 5JEAG 3IXSA 1EIGA 2QHOA 1Z7TA 4MZ9A 1K51A 2Y3AA 3P4SB 4POGA 1EFID 5IP7G 4MN3A 2YEPB 3N20C 3RFZB 2M2LA 3BZCA 2UU9Q 4BY1B 1ZXIA 3ZJYC 5M5XB 1Y8RC 1FD6A 1IGCA 2D2CC 1TR5A 2QJLA 2BOSA 2AHOB 4JI3Q 4DV3L 3E9SA 1Q46A 5CV7A 4TKNA 5AZHA 3M7NA 3AEGB 1ZDVA 4YHHL 1RWSA 3OJ3A 1JOOA 2CVRA 3TDQA 1VCBA 1EY0A 3FMCA 1STHA 1DM0B 4KKTA 1AFPA 2KLGA 2Q8TA 3CRKC 4RKBA 3Q23A 1Q1EA 2XWJB 4JV5Q 2B3AA 4G7OC 1QZEA 3QG1A 1TWFB 1A3TA 1HEZE 2V4IB 3EECA 4APVA 4C3IH 4LUOA 3MFGA 1PH2A 1C9OA 2XGTA 1PTOC 4ZCKA 2PW9A 1LTBD 3RNBC 3J80c 3A4RA 3AE2B 1G51A 2BH8A 3V05A 4WJ3M 3WWVA 1SDFA 2TSSA 1Z47A 1YQ3B 3PREA 1YQ4B 3GTGB 1QZHA 1UNSA 1YNJD 3K7AB 4MELA 3MXNB 2KOXA 1XWEA 2FNJB 3I9V1 1JOKA 4FNFA 3GTMB 4QAYA 3P42A 3KWVA 4M8MA 4PQXA 2M17A 3HM3A 3MTNB 4FF2A 3W1BA 2R92H 2AUJD 3S15H 2QEJC 5IGEA 1VCIA 4GZYC 2ZPYA 2KHIA 3OWEB 2NB0A 2IX3A 1EM7A 4W9CA 3CCLA 4QIWE 2JP1A 1SGHA 2K33A 2LXKA 1VQ4A 2MRPA 4MTKA 3K7UC 4FF4A 1I4XA 3CCMA 1YJJA 1AW7A 2ACZB 3KOJA 2K8HA 2WDQB 3RZOB 5JHBA 2RR9A 4LNQA 3HHMA 1CTMA 3LYYA 3NUHB 1SIFA 2XBBC 2JA7B 1ZUD2 1FNWA 3A8IE 2E8GA 2HT1A 5C0XJ 1O7LA 1SRUA 5M5YB 2JXXA 2LMCA 2LD9A 4X3SA 1LTGD 1DYQA 1I3QB 2NVUI 2F3IA 4KKJA 4G0NB 4KGSA 1JQ4A 4ME5A 4X65Q 3K5OA 2LJIA 3E3XA 1TS3A 3PV1A 3S2AA 4C7YA 3J81E 4K3BA 4ZQ3A 5D2MB 5COYA 2KDBA 4DR2L 4B9WA 5JXVA 2PLPA 4RGTA 2UYZB 4GDKB 1U4RA 2SDFA 3PMFA 5T1GA 5CV6A 4OVUA 2K50A 1LT6D 2JZ3B 2KVZA 4A3JG 2F0WA 2F0MA 3MWYW 5IWAQ 3IHPC 2HIXA 2MWSB 4KZ0A 1I4GA 4JV5L 2H89B 2C35B 3NPPA 1SNQA 3ZGZA 1O7ZA 5AZGA 1V8QA 1J19A 3W5VB 1S3OA 1NBFC 3AM9A 4LNKA 3ULPA 3PIOA 3HOVB 3HK0A 3NS8A 1FFVA 2HHHQ 2NN6H 2UUAQ 3KLWA 1XCTL 1NE3A 3QJYA 1Y1WH 4K7UA 3PO3H 2R92B 2D62A 4RM8A 4K7WA 4JBMA 5CHFA 1N5XA 2K7VA 1OGWA 4C3IG 1DOMA 1QOAA 1ENAA 4FA6A 1PVOA 2FIFA 1DD2A 1QF6A 1DGSA 3PHWB 1YNJC 2A5HA 3ULJA 4IKGA 4CHTB 1YJ9A 1WJJA 2KNBA 2WXJA 1NBWA 1L6VA 2OTJA 2LGXA 1Q12A 3TS0A 3FILA 3SHQA 1N8RC 1CKOA 4JYAL 1WGKA 2JA6H 3UGBB 1SYDA 2PQEA 3FEWX 5EPJA 4K6DA 4WRDA 5CX3A 4GKJQ 3MTSA 2K5VA 3FDTA 2WU5B 2DWQA 2JZZA 2CJOA 4KD3A 5IKCM 4A3MG 1Q81C 3I56A 2OTLA 2DNCA 4S3SA 5HGTA 2E2HB 1U4LA 1BMLC 3A9JB 3RYTA 4IOCA 3ABVB 4X57B 2RBMA 4CKBA 1WSPA 1SYEA 2B63G 2F4VQ 1IXRA 2YTXA 1CZWA 3GV3A 4R1JA 2JYTA 1O7YA 2KEEA 2I5HA 3UQAA 3IT4B 4FULA 4M1UB 1U0LA 2AYOB 1HQMC 3M4OH 2OHFA 2EXZA 5EBDA 1TY2A 2Y0SB 1PMRA 3K81C 1E0ZA 1HPCA 3QAQA 1PH4A 4GKKQ 3SD5A 1M90C 3RZOH 3RLOA 5D7GA 1JWUD 1XT9B 1RJTA 4HIKA 4HIMA 2MPMA 1EU3A 5EKLA 3S17B 3AULA 1STNA 2MP2A 2A6ED 5AUKA 1C77A 4RA8A 1PA6A 4RF0A 1J6QA 3SK6A 2A73B 1WJUA 4A3OA 2CCZA 1CSPA 3EVQA 4WQOB 3MJ5A 1PH8A 2KJXA 2O6VB 2TMPA 1GG3A 4W9DA 2YV5A 3KK7A 2NS5A 3PTFC 1B4OA 2KACA 4BVUC 2CWPA 4EVOA 3K5MA 4RCOA 1E2ZA 3M3JA 4PT5A 3PO2B 1P16A 2VY3A 1PLFA 1FL0A 4CJ1B 1SAPA 4P75A 5K5PA 3UDGA 4LF9L 3GTLH 1L5PA 3TQYA 4AQYQ 2NYZD 3S14H 1QE6A 4HVBA 3A55A 1KNAA 2L55A 5C4XB 1N61A 2CU3A 5GROA 2EJMA 1VQAA 3DBRI 2M4NA 1ENCA 1M8AA 4P74A 1TT5B 4DXAB 1SYCA 4GOPC 3I4MG 3VTVA 1Y69U 2IO1B 2D5DA 3SR1A 4N8X1 2I0QA 1QB5D 1V2YA 1WYWB 3I72A 4L23A 3RNAC 4JI1Q 3QWNA 4F88A 1HNXQ 4JI7Q 5FLMH 1NMGA 3ONSA 3NTKA 4NDXA 2JWZA 4JPSA 3A4SC 2H88B 2GA4B 2PJHA 1Y1VB 4DR7Q 4LF5L 3HEJA 2B76B 1K73C 1S5BD 3Q22A 3I57A 2JA8H 5C4XG 1IBML 2R93G 3QIAA 2OQKA 2VQFL 3P4PB 2PNRC 3H3VI 4HDQA 2K39A 2O4XA 2L15A 3NENA 4FO2A 3ZXVA 3R2TA 4PS7A 2WB1B 4XDXA 2O5IC 2K5PA 1UE1A 2YLMA 1X3QA 4A3BH 2V3NA 2KWVB 3DCGA 1IKLA 1E22A 1Y8NB 3SGIA 1W6JA 4II2B 2FJ2A 5M3FB 3Q8EA 1YMHE 1T0QC 4X62L 2DNEA 4CGYB 3C46A 3GZNI 2JF5A 4CDCC 1CKNA 2D5GA 2J4XA 4GNXA 1UAPA 3NRZA 3A5UA 5JJIA 3CIRB 5L83A 2PMZE 2QDBA 3K8AA 4JI5L 3NE5B 3I91A 1FRDA 2FUHB 1XLOA 1WGDA 2GBKA 3DVNV 4I7AA 3NZSA 2HQEA 1J5EL 4GOCA 5CHVC 3EFXD 3PVLA 5JJKA 2F0UA 2F0VA 3VR8B 1XTCD 4ULLA 5CBAE 1ACCA 2B2YC 1E7VA 1MI0A 3DMUA 3S1RB 5EE3A 2ZM6L 4DHJB 4LFCL 3PO3G 4ILWA 3KUCB 1CSQA 2L32A 3ZKJC 4B6WA 1E7PB 2CWAA 3GO5A 2NPTA 3DBLB 4HKQA 2F0QA 4CKEA 4WFN3 2LVQA 4GSWA 3H0GH 1EWYC 2MJDA 2EE1A 2PPHA 3NXWA 1YBYA 2AWOA 4YCVA 1B3AA 2BCOA 4NMZA 3EN2A 5BYRA 1TWFH 4DR4Q 1XLQA 1WGHA 1N32Q 2UUBL 3O65B 1Y14B 1WCMG 3Q24A 3L0OA 3N6RA 1I6HB 2XIWA 1MHXA 1SNPA 1GD7A 2L76A 1U5KA 4GLSC 1MJCA 2LXAA 5LMNW 4JCVE 5KNBA 2JA8B 3MHZA 4R4TA 3GTPH 3HP3A 2KHWB 2KJHB 3EJIA 4GIVA 3E0JA 3AE4B 5AZFA 3M3YH 3VUXA 3A8KE 3MHBA 4DV7L 3SFEB 4E74A 1PXUA 5AEKB 3CMAA 4N9TA 1WM2A 1WI0A 3RT3B 2OT2A 3VYRA 1O80A 1OXSC 1C7YA 3DHIC 1JALA 4B3TQ 1QZGA 5FLMG 2IT1A 2HIVA 3FHWA 1LXDA 3KYDD 1EL0A 2RD0A 2G45B 4OZCA 2JWUA 3RD2A 3KYCD 4FDBA 5JJLA 3DVNU 3STBD 1V97A 2PTLA 4B3ML 3QIJA 1RM6C 1V1QA 3OHXC 4OVZA 2B2WA 2N3SA 4YTPB 4MT5A 2A6HC 3QA8A 3QQ8B 2NTTA 3J7ZC 1Y1VG 2F0NA 4V190 2BBCA 3IBEA 4KHPQ 5FOBB 1Z5SB 3HZXA 3I8ZA 4L63B 3HOXG 3S1RH 2AWTA 4LNFA 4RKLA 4F7XA 5KHOA 3UINB 4FXDA 1TBEA 2IGGA 2VRRB 4DV5L 2PW5A 3T56B 2I46A 1K9MC 4YL8A 4BFRA 1KRSA 1MIUA 2MH7A 1WI5A 3LJ3A 4JYAQ 3VR9B 1X3PA 2BPSA 1J0GA 1EZ8A 2Y5BB 4FHKA 2KCCA 3CPWA 1BUIC 1NYQA 2RCNA 4ZAIA 4W9FA 3U4EG 1LQBA 3D31A 3SHLA 2Z0EB 3L54A 4Y52H 1WRDB 2E2HH 2AEHA 4MM3A 2XRSD 1IW7C 1O7IA 2I5MX 4JI2Q 1OQQA 1YX5B 4FHJA 4HDOA 1MHWC 4DA2A 2EQSA 1DZ1A 1V43A 3J7YW 2VNUD 1E8WA 3OAWA 1KTKA 2MP2B 2NVXH 1V5OA 5C5LA 5C4HA 3MJWA 5J2RA 2KENA 5JPMC 1FGUA 4J1MA 4G4KA 1PFMA 3TEHB 1T5XD 4DR6L 2D2QA 1MG8A 1G2TA 1A0IA 4BBRB 1XEEA 1J8CA 4HEDA 3V6EB 4IFDJ 4K81A 2JUOA 2JZPA 1K52A 2NMQA 3CMMB 1TYGB 1FO4A 3A1QB 3QHTA 5EE9A 3RNUA 3AEBB 3OPOA 2IY1B 4FBJB 3I55A 4WJ4A 2LGDA 1G8ZD 4LF7L 1YHBA 3D6WA 3DM3A 2FCSA 2KTFA 3N1ZC 4OW0A 1FNUA 2JA6B 4K2KA 1VQ7A 1N63A 3UI2A 4UP8A 1ZKHA 3LXFA 5C3EG 1F2ZA 1II3A 3NTHA 1H95A 2MSED 3QOLA 5IT9E 1WM3A 3CXCA 5GADC 1XLPA 5FO7B 4DN4M 2JX5A 1CQVA 3EHVA 3ETRA 1J9OA 3ZUNA 2VUMH 2ZXPA 1N62A 4R9WA 4K14A 3HKSA 1WH3A 1I94Q 2BE5D 4EOYA 4X64L 3JSVB 2GBJA 3NY5A 3T3OA 4LNOA 3HOVG 3W5UB 4BY7B 2MGSA 4OELB 3I4NB 1JB3A 3IKJA 2A69C 2VW9A 3HRZC 2DZMA 1FVIA 5EQ0A 5C44H 4XDCA 2BYFA 2Q2IA 1F9PA 1FCCC 4B0MA 2B2VC 1FXIA 4AYBG 3EA6A 3HOUH 2M8SA 3U7DA 1WTPA 2V4DA 2ZJPA 2SNMA 1AWDA 1C8CA 2QEXA 3T1HQ 4RFBA 2JA5B 1JE5A 2JA9A 4XQNA 3DQVA 1H9KA 1GKHA 3DHQA 1A3UA 1PZID 5GQOA 4KVGB 3MHSD 4QUCA 3MAQA 4ZRZA 4AQYL 2QKIC 4JQWC 4W9IA 4DNRB 4MTNA 1UH6A 2MP1A 3J80i 2CQAA 2V1YA 4J15A 2N1WA 4LLGM 4A76A 2XSCA 1L6UA 5D14A 2CU1A 3M4OB 1KOTA 1K8RB 3A8JE 1HTPA 2ICIA 3N1YC 5T8IA 3VQIA 2GBRA 4NXML 3D4WA 2DGYA 4KI0A 4LMQD 5CV9A 1SNDA 2N4FA 2WV6D 4IOIE 1BR9A 2YTVA 4R8NA 1EYAA 2E76C 4WAFA 3GTLB 1TKGA 1SE2A 1D5ZC 3HOUB 2AQ1B 1K8AC 2UUCQ 3E0EA 1VQMA 1EF1A 4IUQA 3TMPB 1F0ZA 2B63H 5ELBA 4HJGE 1EU4A 1GUSA 3GQBA 2J53A 1KIXA 1V5TA 3J80E 4JOIC 2WHIA 1VDZA 5IYDG 2VQFQ 2Z9HA 2AWNA 4FF1A 5BYSA 4YSZB 4RM9A 4KGTA 5ELFA 1IYJB 3AQQA 4MDKE 4KIKB 4XQQA 4H0LC 3H3VC 2SAKA 4IZ8A 3OG5A 3S2HB 1ILQA 4TUUA 4KSLC 5JPNC 5IT9L 2JT4B 4HPMB 5G2NA 1QILA 2MBBB 4PYZA 4TMAB 1FD7D 2R7ZB 3H94A 3IAM1 4HCNB 3DBHI 3T1YL 1X55A 5CHWA 1ET6A 3P7JA 4C2MB 3OTOQ 1RAXA 1NI3A 3EROA 3A9KA 3S17H 4X66Q 1UWVA 4M0WA 4E6IA 1BBXC 5GAEC 4JI5Q 4IFDG 4EZKA 1UBIA 1HNZQ 1SSNA 5HG2A 4C3IB 3NTIA 4DAYB 2IY5B 4PYUA 1YJ1A 3H8HA 4NPNA 3HS0C 3DM1A 1N32L 1XMOL 4DAVA 3ML8A 1STEA 2BE5C 4RGNA 1B2TA 1YX6B 4HJ9A 4XXEA 1N60A 2ZM6Q 4XYOA 2MA9B 1FFUA 1R4MI 3Q8FA 3AH7A 1TJEA 2JQOA 2PKOA 1VQIA 3R66C 3IFTA 3AB9A 5TSSA 1WD0A 3LDZE 3T4AC 1ZEQX 1ZXTA 1S40A 2PNHA 2N7JA 4CJ2C 4J6IA 4ZUJA 3L08A 1E7ZA 3OIPA 2MEKA 3B1LX 3EBEA 1N9WA 3DVGX 1YEZA 3OSOA 3IAYA 1CJEA 1V9JA 5K36H 1JE4A 1VF7A 4NXMQ 1YIWA 2X6LA 4ITKA 4XE0A 1CUKA 2XNAC 4DNTB 4JBJA 3CSTA 1IZ6A 3PZDA 4BY7G 4GNXC 2B8GA 3ZNZB 2FAZA 2KX0A 4BKSA 4JI8Q 5C4ZA 2WAQB 2E3TA 2VZKB 5BYQA 5E6PA 3AE8B 2C7HA 3VRBB 5IGDA 3RNGC 5GAGC 2N9LA 2RSUA 3C1EA 3S2HH 3L3OC 1ILPA 2WDTB 2B2UC 2L1BA 4K5VA 3VYSA 3DEPA 1WZ0A 1LTAD 4TRDA 1I35A 1WJ6A 4A9AA 1LTLA 3PT2B 5C3EH 2HD5B 1EY5A 1GUTA 4A3KG 1HR0Q 1AARA 5C4JB 1ZW7A 5IO9A 2MCNB 5DPWA 2JYEA 4G7ZC 2BYTA 4MJSA 1WXQA 1VMPA 4MNOA 2HE7A 3GZNB 3ZW3A 3KFUA 2OEOA 2A1AA 5CR3A 4BA1I 1XJVA 4B08A 3GTOB 3GDEA 5IYDH 5FR6A 1OXUA 4R4IA 3A9JA 1IBXA 4N6EB 2KQ3A 2KEDA 4JI0L 2K32A 3T1YQ 1IGDA 3IFWB 4A3JB 1Y1WB 4KY6A 2C7MB 5F2DA 4DQOC 1FXTB 5BN5A 4H02A 4YY3Q 1TT2A 3CPFA 2OJRA 1FJGQ 4ODGA 4IALA 1E3PA 5I9PA 4TQ1A 1ENFA 5FLXE 2GOWA 5M5YH 1VQGA 1GPXA 1QUQB 2F52A 1BOSA 3CKIB 1C78A 3TS2A 3P75A 5JVG3 5J17A 2A6HD 4QUFA 5JEAH 5C0XI 4IFDH 5C1ZA 2WYQA 4GLXA 1VQ6A 1YOVB 2AX5A 3CF5A 5D3DA 1L4ZB 2L83A 4K6LA 4GXBA 1XLNA 4ANVA 3BJUA 4LFBQ 2BYVE 2QGQA 4X66L 3P4RB 1JJ2A 2PQAB 4QL5A 3EC8A 4REZA 1K8MA 1HNZL 3GS2A 1AE2A 4YSYB 1YJNA 4XIGS 4A3DH 3UDFA 2KN4A 2EZVA 2UWQA 1R4MB 3DHHC 4A3PA 3I4MB 4AWJA 2Q2HA 4S17A 3RNFC 1G91A 2OXPA 3FPUB 2E5LL 4WWOA 3B0AA 2ZTEA 2A8VA 3HKZG 1AEXA 3I4NG 4IM3A 2CKZB 1X9NA 3NELA 3G71A 2AUKA 1WGRA 1VQNA 2F0DA 2DNFA 4CYEA 3EQLC 3PHXB 4RNAA 1KAAA 3ZNID 1ZYRC 2NVYH 4YTMB 3VUYA 3I3TB 3Q8AA 3JYUA 3KF8A 3R2IA 1KQSA 2R93B 1FRRA 2R61A 2WXOA 1UE7A 2KCNA 4ACFA 2F0EA 1H9RA 4QIWB 3RN2A 4WH4A 4I7ZC 2IL8A 1EIHA 1IBLQ 1BCPB 2EY1A 1U4PA 1EYCA 1NUCA 2J0KA 4DHJD 4DAMA 2LVPA 3PUYA 4JGHB 1C4AA 2J0TD 2Z0SA 3RZDH 2JY6A 5HFYA 1LTRD 3KWLA 4C1NK 2R92G 1T9HA 2EVBA 4IPGA 1KAWA 4CDEC 1I50B 4R4QA 2V9HA 3IFDA 5E4XA 1B44D 1A5RA 3SXHA 2EY6A 1HZCA 4P1CC 3KUPA 4DPGA 1SNOA 2ZCCA 2PZWA 2MX2A 3DLLA 3U52E 4DR5Q 3OW7A 4A3KB 1KRHA 2DAJA 1CK1A 3F2CA 3PO0A 4OONA 2LASA 2VL6A 4KHVA 3FKIH 3PO2G 4MGIE 2UU9L 1OQRA 3GE3C 3AEDB 4QY7A 3T1HL 4LF6L 3FC4A 4GDKA 4TV3A 3KBXA 1B7YB 3OYYA 1W3SA 1PH7A 1HZAA 5M3MB 4Y7NB 3JC66 4KY7A 3A56A 1EEID 4LFCQ 1PFDA 3IL8A 4GN1A 4WWMA 5GMVA 1KNEA 5H8YE 1PRTB 3R93A 4KX6B 4XGAB 3LX0A 1GB1A 3V2TA 1MBYA 4CKCA 1HUNA 2WXGA 2L00B 3GTOH 5DCNA 2IWHA 5EJWA 3KJPA 1BVSA 1YZ6A 5CMDA 3AI5A 5EPLA 2G4DB 2D10A 3DUZA 4HMIA 1LGRA 1UWXA 2NZOA 4LF4Q 1V1PB 4Q2JA 2QDFA 2EYFA 1AZPA 4JI3L 5E6OA 1T5EA 4NB3A 1RCVD 4A3FG 3PRZA 2WXMA 2BS2B 1K53A 1PTOH 3NHHA 2HDLA 5C44B 1JROA 1JOQA 2PE6B 3T51B 1EWHA 2B2VA 1QWYA 1NTGA 3N9YC 2Q2TA 1SJED 1SFOB 3ZIMA 3CC2A 5IN7A 1SROA 1I5FA 4DU9A 2WXHA 4L6TB 2A6EC 4XDDA 3S2DB 1FYCA 3K6OA 4YCUA 1CZPA 4IPHA 4IPDA 2KO3A 4J6HA 4HSPA 3TRZA 1TQOA 2O6VD 1Q90A 2VQEQ 4B3MQ 1T0YA 1N34L 1TS4A 1GO3E 2KUMA 1PGXA 3PQIA 4AQ7A 5DPTA 5C44G 4DV4Q 2Z6KA 5M5WH 1WGYA 3PIPA 1A6XA 4IG7B 1KJTA 1VDVA 1NVID 2B3GA 1L0YB 4YWMA 4JE3B 2B39A 1XMQQ 1QOFA 5DM63 3WCQA 1TGZB 4QCLA 3M4PA 2Z1CA 1IYUA 3PV0A 2VH2A 5J1ZA 3MC0B 5IA7A 4EQOA 4HCEA 4IUMB 3F8TA 4PZ8A 1CI3M 1S5ED 1OXTA
chains in the Genus database with same CATH topology
1K50A 2H4OA 4EQPA 5D3IB 3ITPA 2LFIA 1A15A 3J80L 3NBHA 3HOZB 2B63B 3VYUA 4DK1A 3AEEB 4K5XA 3A7LA 1TWGB 1QOBA 4RGMA 3P4QB 2F0OA 2LUMA 3SR6A 2JXMB 1IKMA 2EKIA 4N9PA 3RZDB 1FMAD 4JX1C 1I7HA 4MH8A 2R3ZA 3VA5A 4H2AA 2FE8A 2IDYA 1JQYD 3P63A 3AN1A 2EYJA 4NKLA 1IL8A 4FXCA 4MM3B 5E4WC 5KRUA 1BCPD 3TP7A 4QF4A 1KDBA 1CZGA 2Z4IA 2EDGA 1YNNC 1BUVT 5DEHA 3TMEA 1R9TB 3S1MB 2K03A 1TS5A 5AUIA 2JEBI 2HCCA 4C3JG 3GB1A 1G291 3J7AF 1J7BA 2FINB 1K83B 2PMZB 3RPFC 1ONLA 2F03A 4UAIA 3HKZB 1C76A 1ZDXA 5C2TB 1LACA 2B2TA 3WOFA 3QO2A 4IQZA 1ZOYB 2DBYA 3IT6B 4ZKBB 3EGRA 3NVVA 4CQNA 2V3PA 3S15B 4ZOHC 4U673 4N58A 1JMLA 2A68D 4FYDA 4FXGC 4RH6A 3BG3A 3OMCA 3AMUA 2RA4A 1B9RA 3KLRA 1D5XC 3VRAB 4WJWA 2L9HA 3T16A 2WQYB 1SEBD 4F8MA 3Q8CA 4HRSA 1LO5D 2Q8RE 3URYA 2PVGC 1ZXHA 1SE3A 1SYBA 1NCVA 4DAPA 4XYQA 1EQTA 4P16A 1VJKA 4DF7A 3TEYA 5CBEE 1I4PA 1Y8OB 1NR2A 2KA7A 2A69D 3G7LA 5IGFA 3HVDA 4ZK9B 1STYA 3PUVA 2GI9A 4EQNA 4OZBA 3BYTB 1SF0A 1QNKA 2K9XA 2C5CA 2FMCA 2XN9C 2YYZA 5C0XH 2WXLA 2DY7A 2B2TC 1SE4A 1P7EA 1TWAB 5EKIA 1FXAA 2RPVA 4OO1I 4H7BA 4ZRQA 1JW9D 3GD7A 4A8XC 4HAEA 2E6XA 3BVZA 4BWGB 1QJOA 3TN2A 2ZW1A 3V96A 1VF5C 3DWQA 1XX8A 4A3DB 2WDVB 5AFWA 1G6ZA 4ID6A 1S4ZA 2VB2X 4ZHOA 4OZAA 1IW7D 1FEHA 2F0LA 2M9VA 2F0PA 2R6GA 4XT3B 4KKIA 1SJHD 3O13A 5IIFA 4V0BA 3NK9A 4TQUS 1SNCA 3D4DA 4BBSB 1DONA 3VR4A 1RODA 4IUVA 2CJNA 4XT1B 5T1IA 3TEXA 1JRPA 1U9RA 4IUTA 2A68C 1TKYA 3BDLA 3AB5A 3DWAA 2O5JC 5CORA 1O78A 1B1ZA 3DWMA 2EPBA 2LHDA 1BXTA 3AE6B 5I2YA 2RKSA 1F9RA 4C80A 5G3LF 1SYFA 1IBXB 3VA7A 1D2BA 3NVYA 2F0IA 4NW2A 1HHVA 1I4RA 3PUZA 5M5WB 2EY5A 4YWGG 3BIID 4KGRA 2F1MA 2ZT9C 1R4PB 1F2YA 2HDMA 1I6VC 4ZHPA 1FGBD 3S9WA 2N0SB 1V1OA 3GV6A 4HROA 5FR3A 4UDUC 1Q1BA 3AE1B 1KLGD 3Q69A 2HDEA 1VZ6A 2Q8IB 1ESFA 1PTOB 2W55A 3PIO3 2XRQD 3OWFA 2DLBA 3JAME 1NYRA 1EOTA 1CM9A 1WYGA 2LHEA 2KAJA 3SK8A 2WKCA 1JORA 1TS2A 3Q6SA 2L4NA 1PYWD 5IGBA 1VMCA 3ND8A 2K05A 4IDIA 1HFNA 1HA6A 4ARIA 3WOEA 1KH0A 1VR9A 1NAPA 1WWTA 5HI1A 2Y5CA 1AN8A 2PPBC 1QT9A 2IGDA 3TSSA 3AEAB 1QQRA 2X38A 4TKOB 2QF7A 1B50A 2LGIA 1ZP0B 3SK4A 1BF4A 4M8AA 3J81L 3ZJTA 1QKZA 3NQIA 3S14B 2INNE 3T3NA 2D9UA 4RF1A 5E6JA 4RWSC 3BK2A 2BA1A 1MPEA 4A3FB 3F2UA 4OL7A 2E75C 3LNNA 5NUCA 2IPKD 5E3FA 2NZ1D 3ZQ4A 1RHPA 3BYYB 4DFAA 4NP5A 1M4VA 3A54A 3MEHA 1L0VB 2DYOA 1RF2D 3P1HA 1I4QA 1ML0D 2WIIB 2KMMA 1JWSD 2EYMA 1ZE3D 2X69A 5JEAJ 5FLXL 1QCBD 2YU9B 2F0JA 2FMMA 4EGVA 2GRIA 2PW7A 4US8A 2IJ0A 1EY6A 3J9CA 3CU7A 2W54A 4N59A 2K28A 1HQRD 4HTHA 2LFNA 5H92C 2G9DA 3L4PA 4OO1G 1A2TA 4C3HB 2F4IA 2E2IB 1HZ6A 3R3OA 4XQJA 3I73A 2ZXOA 4CJ0B 1VZ7A 3M4YA 2K6AA 1OO9B 5I6WA 1PZJD 5I6YA 3PO3B 1DGJA 4D2KA 1DOIA 3I4LA 5KYIA 1IYVA 1EY4A 4DXGA 4LK1C 3K57A 3S1QB 2K0PA 2MJ8A 1SIJA 4G57A 5KEEA 4HCSA 3AV8A 3PIP3 2B2WC 4LAAA 5G5HA 2F3WA 3ONAB 5IODA 1XCQL 2F0SA 1EY8A 1GUWA 2B8FA 2J7ZA 3W3AA 4OHJA 4KK7A 4WIPA 3D4RA 3FKIB 3T13A 2EOTA 1QOGA 1MSHA 2PZUA 4P6VF 1TZOA 5DM73 4NZLB 1GXDC 3K59A 2L0CA 4A3BB 2W82A 3AU7A 4IUPA 3GP7A 4WQMA 1QNUA 2EYLA 3SE0A 4HN7A 1GJXA 2F0HA 1AYFA 4K2LA 5KYLA 1T3QA 3VR3A 2NWGA 3I3CA 5IGGA 1D1KA 3GTKB 2SNSA 1F9SA 5CV8A 4OO1H 1MHHE 1R7SA 4LJZC 1EY7A 4RAUC 3W2DA 2K04A 2ONQA 1KFYB 4B0EA 4C3HG 1C4PA 1D1IA 1JC7A 3BVMA 3CHBD 2M00A 4DGZA 3RUZA 1YN3A 4BA2I 3B2GA 1E2VA 3ZJUA 1YN5A 1XF5L 3HRDD 3MFYA 3SEBA 5A35A 1Y56A 4IUUA 1BDOA 5D65A 3TZDA 3BZDB 1J7CA 5HHDG 2EY2A 2RQXA 3ZYYX 2K5QA 4ABNA 4IN3A 2WNMA 4K5WA 4J8QA 3BDOA 5KGUA 3RD4A 2L52A 3TP8A 4B9XA 4A55A 1V1PA 1D4BA 2FBWB 4IFDI 5I4DA 1WTQA 4FF3A 4KD4A 4HR7B 1VLBA 4X3KA 2MJEA 1PTOD 3VR6A 3QB3A 1CQFA 3SFDB 2BW2A 1WD1A 1JCKB 4RHRA 2INPE 4L8JA 1YJIA 3U9SA 4YSXB 1SMYC 2NN6I 2LKVA 1PUTA 2HUGA 2PCFB 1WTXA 4L1BA 4QMGA 2J52A 1ET9A 1PTOF 2BS3B 4R8IA 3E56A 4ZLTF 2L1AA 3ND9A 3NZ3A 4HMJA 1HXYD 1PRTC 1FM0D 1KF6B 1V8CA 2IX0A 2ID0A 2ZXRA 1HCZA 2WLBA 1HFGA 1TY0A 2WP8J 4XWTA 3M3YB 3I90A 3M85A 2F0GA 4OIJA 3FAHA 3AECB 1MSGA 1HUMA 3C3LA 4PV1C 2J42A 3TP6A 1H9SA 1C79A 2DN8A 5G5GA 5J39A 3L9AX 2YEPF 3BK1A 4JBWA 5I9OA 2L12A 5JVH3 1C48A 2MHVA 2ICEC 1Z6HA 2VZKD 5E1FA 2E2JB 4L2YA 1UGJA 4XTCS 3B2FA 1X32A 3TZUA 1DJRD 2F0TA 2VXWA 5FO9B 2WS3B 2RDGA 5ELEA 4J3OD 2EYHA 4KMUC 1H9SB 5FKAC 1HZ5A 5IOCA 1D6EC 2K3UA 2JQRB 3GTJB 3UI3A 3MXNA 5CGKA 1QG7A 4Q0FA 5CV5A 4HEA1 1TU2B 2L11A 5EKKA 2E2DC 1UWMA 1FNVA 2WACA 4KKSA 2PMVA 3JAML 1PRTD 1KDAA 4JWUC 5ISRA 3TUOA 4KTAA 1MD2D 1EY9A 4P2CB 1EEFD 1H9JA 1CA6A 3TP5A 1RFKA 4O1NA 4IURA 3PZ7A 2W3SA 4WORA 4IUNA 1STAA 2EYOA 5JJZA 2M19A 3MXPA 4C3JB 1IHZA 3W9CB 3BVGA 1KLUD 2JXTA 5JOBA 4GDLB 2NTSA 4NJCA 2WP9B 3U2SC 4ZYSA 1JWMD 1TWHB 4FVMA 2CW0D 1KABA 2AQ2B 2XVSA 1BCPC 3AEFB 1GB4A 2EJGC 3L7ZC 2XWBB 1J7AA 1OFFA 2DYMA 1MI2A 1MVKA 1L4DB 3U9OA 3W1SA 2PO4A 3E5SA 1Q8IA 3I70A 2HCIA 4KKUA 1T6BX 4KJOA 1STBA 1GUGA 2E74C 1F2RI 2BB6A 5K36G 2M56B 1ZKOA 3HOYB 3H09A 5M9OA 3DWPA 5ELDA 5C5MA 4KHZA 4A90A 3KBGA 3M7GA 3KLSX 1LABA 5LL6S 2NVTB 2BDNA 1VZ8A 3C2PA 2X6GA 2NVXB 5BMIA 1B9NA 2Z4HA 2NBFA 2JYOA 3S1NB 2CHBD 3EUB2 1C9FA 2VB3X 2BB5A 3DWGC 2FUG1 1MGSA 1L0XB 5C3XA 1FIQA 2G1EA 3IAS1 3K58A 1DOLA 3NQTA 5A2QE 3NUCA 1CT1D 4K8JA 4C7ZA 1E9MA 2WXRA 1PFNA 3AE3B 1SB3C 1W6KA 5C3EB 4A3MB 1ZYRD 5FO8B 5EPKA 1F2RC 1WTVA 1STGA 4KN7C 2PIAA 5C3WA 1TIID 1XYIA 4QB4A 1Q10A 5G3LD 4BS9A 2F3VA 1D5MC 1YN4A 4YT0B 2QILA 2C9OA 1OXVA 3NWTA 1TKWB 2I07B 4U68A 4A3GB 2SEBD 1RYJA 5DNFA 1ROEA 2OF1A 5CV4A 2WDRB 4I65A 3TEWA 1AP0A 4JK1C 2RSOA 2BS4B 4H13C 4KN4C 2KQ4X 3D6CA 1LLRD 2KDMA 5EGTA 1CHQD 2PVOD 2ZW0A 1TVXA 5GXGB 5IGCA 1N5WA 1HA5A 1GHJA 3CQZB 4NAWB 4RCNA 4G7HC 4TSSA 1SMYD 1ZPSA 2RDHA 3PUXA 2ON8A 1RDPD 3VR5A 2F0KA 1LTTD 1WRIA 1BNZA 1E6EB 1LTID 1GUNA 3Q8BA 3C1FA 1C4QA 1PGBA 3MXGA 2G9HD 4USAA 2KWDA 1PRTF 1RTNA 1RTOA 2NN6G 2WXFA 1Y8PB 1I4HA 2JSVX 2WXIA 4C56C 1DXMA 4LK0M 3TEZA 4FP5D 1S5CD 3VR2A 3OOCA 2BT6A 3MXUA 5I2XA 1A3VA 1A70A 3MP9A 5A2QL 1LV9A 1B9MA 4ZUIA 5KIXA 3TBIB 1NEKB 1PDXA 3DEOA 4US9A 2LMCB 4A93B 2EYPA 2WXNA 3PUWA 4A3EB 1WTRA 2BA0A 4A3IB 2AQ3B 4LTUA 2MUYA 3CRLC 1JICA 2WU2B 2N9KA 4PMCA 3QOJA 2VUMB 1LT3D 4KJNA 1BO0A 3AMZA 3H6MA 4DAYA 2JEAI 1CFMA 3X3MA 5KNCA 2ENBA 1SNMA 3HGBA 4XWWA 3PZ8A 1J8IA 1G2SA 2FHTA 3HG9A 1WTOA 4WURA 3C8YA 1SYGA 4A6QA 1TKEA 1CA5A 1E2WA 1R4QB 3LWUA 3SK5A 3GTQB 1BQQT 3D8GA 5C3JB 1EZ6A 4YXDB 5DAUA 1BCPF 2V0GA 3ZJVA 4F87A 2QCPX 2JE6I 3NS1A 2QSDA 3B9JA 1F2MA 5CC4A 4Q5VA 1GOZA 3X3NA 2NVYB 2KOLA 3WDNA 2KECA 3OMGA 3N52A 4OIKA 1VRAB 3LB8C 2EJFC 3H0GB 1QOHA 2BTEA 2N55A 2WKDA 4HSVA 3DXJC 3NBIA 5J22A 3GTPB 5BN4A 1GAQB 4MACA 4ARCA 1S5FD 3HUIA 3KLSA 2A74C 3BDCA 1A2UA 2HTME 3NSWA 4Z9CB 4R3DA 4PMBA 4YIJA 1NENB 4KY5A 3AE9B 3RMHA 1AZQA 1YNND 1PZKD 2IGHA 3FILB 1FR3A 4X3UA 2I38A 4KV6A 4PNYA 1GUOA 2KVMA 3S16B 1P7FA 2NVQB 3OIQA 1WVLA 3NP8A 2EELA 2RMMA 2B2YA 2KHSA 5ELCA 3AE5B 2LY7A 5LL6X 4AYBB 4MHEA 3J7AV 1XO3A 3AE7B 5EE1A 2LS01 1RKNA 2WXPA 4DXFA 4HKZE 3V3XA 1ICWA 4TQ0A 1WCMB 3G6JB 1UUPA 1K8OA 3FPPA 1NR4A 1C4CA 1LT4D 3NWSA 4ZKCB 3Q0AA 4CBVA 2GB1A 3RLFA 4AS1A 3A7AB 1HRJA 2LEKA 1E0BA 2F0FA 2RDFA 4OGQC 1U4MA 2H1EA 2RSNA 2MJ3A 5MPOA 2WINB 5BN3A 1S5DD 1LTSD 3K5LA 2RVLA 1NSNS 2N88A 2NUCA 3ERQA 2I2YA 1DOYA 2K01A 2JSOA 2WXKA 1CHPD 4EE2A 1EQVA 1WTWA 1DCZA 1QLBB 3SDZA 3BWUD 2OEDA 3D3RA 2Y5PA 2DY8A 1FCLA 1F9QA 2O2LD 2K1BA 2SOBA 3R8BA 3NVZA 3P20A 1EYDA 1H9MA 2IX1A 1PGAA 1JR0D 3K5NA 1YNTE 3KQ4A 4YTNB 4C1NI 1KDCA 5CYUA 3HVZA 5LHY1 2K5DA 1LT5D 2Q5WD 2IW3A 4X3TA 3P1MA 3E6ZX 3T53B 1TWCB 5BMHA 1IUEA 3HOWB 1B53A 1JWAD 2FFKB 4FXKC 1EWCA 1F77A 2Z8LA 3NVWA 5BMGA 3MA2B 2W3RA 1HTLD 1SSOA 2QIEB 3FRPB 1RD9D 3MZ5A 5EE0A 1SBBB 2PZTA 4O42A 3HOXB 3LWEA 3FVQA 4MIUA 1SXTA 1GHKA 3H91A 3U7ZA 2CW0C 2K5WA 3CWIA 2QMTA 1JWBD 1ESRA 1E10A 2K22A 2WXQA 5KNDA 4JWSC 4H44C 5C0XG 3MVVA 4ZRPA 4RGOS 3K0YA 5EBCA 1PFBA 1UEAB 3VYTA 1F2LA 4PMWA 1OXXK 4K8IA 2L5TA 1DOXA 5FK9C 5JAVA 5HURA 3BS1A 1DOKA 3SVMA 1XXGA 4DK0A 4NAMA 2JU6X 2B2UA 1PDQA 2PYKA 2M0AA 4RHSA 5C6AA 1Q3LA 2BDOA 5JEAG 3IXSA 1EIGA 1Z7TA 1K51A 2Y3AA 3P4SB 1EFID 2YEPB 4MN3A 3RFZB 2M2LA 4BY1B 1ZXIA 5M5XB 1FD6A 1IGCA 2D2CC 1TR5A 2QJLA 2BOSA 3E9SA 5CV7A 3M7NA 3AEGB 1ZDVA 1RWSA 1JOOA 2CVRA 3TDQA 1EY0A 3FMCA 1STHA 1DM0B 4KKTA 1AFPA 2Q8TA 3CRKC 4RKBA 3Q23A 1Q1EA 2XWJB 4G7OC 3QG1A 1TWFB 1A3TA 1HEZE 2V4IB 3MFGA 1PTOC 2PW9A 1LTBD 3AE2B 3V05A 1SDFA 2TSSA 1Z47A 1YQ3B 1YQ4B 3GTGB 1UNSA 1YNJD 3K7AB 1XWEA 3I9V1 1JOKA 4FNFA 3GTMB 3P42A 3KWVA 4PQXA 4FF2A 2AUJD 2QEJC 5IGEA 1VCIA 4GZYC 3OWEB 1EM7A 2NB0A 2IX3A 2JP1A 2K33A 4FF4A 1I4XA 1YJJA 1AW7A 2ACZB 2WDQB 3RZOB 3LYYA 1CTMA 3NUHB 2JA7B 1ZUD2 1FNWA 3A8IE 5C0XJ 1O7LA 5M5YB 2LMCA 4X3SA 1LTGD 1DYQA 1I3QB 4KKJA 4KGSA 4ME5A 3K5OA 2LJIA 1TS3A 4C7YA 3J81E 4ZQ3A 5COYA 4B9WA 5JXVA 2PLPA 4RGTA 4GDKB 1U4RA 2SDFA 3PMFA 5T1GA 5CV6A 1LT6D 2F0WA 2F0MA 3MWYW 1I4GA 2H89B 3NPPA 1SNQA 3ZGZA 1O7ZA 1V8QA 3W5VB 3AM9A 3HOVB 1FFVA 2NN6H 1XCTL 3QJYA 2R92B 2D62A 1N5XA 2K7VA 4C3IG 1DOMA 1QOAA 1ENAA 1QF6A 1DD2A 1YNJC 2A5HA 4IKGA 4CHTB 2WXJA 1L6VA 1Q12A 3FILA 1WGKA 5EPJA 1SYDA 2PQEA 3FEWX 4K6DA 4WRDA 3MTSA 3FDTA 2WU5B 2DWQA 2CJOA 4KD3A 2E2HB 1BMLC 2DNCA 4S3SA 5HGTA 1U4LA 3ABVB 2RBMA 4CKBA 1WSPA 1SYEA 3GV3A 1CZWA 2JYTA 1O7YA 2KEEA 3IT4B 4M1UB 1HQMC 2OHFA 2EXZA 5EBDA 1TY2A 2Y0SB 1PMRA 1E0ZA 1HPCA 5D7GA 1JWUD 1RJTA 2MPMA 1EU3A 5EKLA 3S17B 1STNA 5AUKA 2A6ED 1C77A 4RA8A 4RF0A 3SK6A 2A73B 3EVQA 3MJ5A 2KJXA 2TMPA 3KK7A 1B4OA 2KACA 4EVOA 4PT5A 3K5MA 4RCOA 1E2ZA 3PO2B 5K5PA 4CJ1B 1PLFA 1SAPA 1L5PA 2NYZD 1QE6A 3A55A 1KNAA 2L55A 5C4XB 1N61A 2CU3A 2EJMA 1ENCA 1M8AA 1SYCA 1Y69U 2D5DA 3SR1A 1QB5D 3I72A 4L23A 3QWNA 4F88A 4JPSA 3NTKA 4NDXA 2H88B 2GA4B 1Y1VB 3HEJA 2B76B 1S5BD 3Q22A 3I57A 3QIAA 3P4PB 2PNRC 2O4XA 4FO2A 3R2TA 2WB1B 4XDXA 2O5IC 2K5PA 1X3QA 2V3NA 1IKLA 1Y8NB 1W6JA 2FJ2A 5M3FB 3Q8EA 1YMHE 2DNEA 4CGYB 3C46A 2D5GA 2J4XA 1UAPA 3NRZA 3CIRB 2QDBA 3NE5B 3I91A 1FRDA 1XLOA 2HQEA 3EFXD 2F0UA 2F0VA 3VR8B 1XTCD 4ULLA 5CBAE 1ACCA 2B2YC 1MI0A 3DMUA 3S1RB 5EE3A 4ILWA 2L32A 1E7PB 4HKQA 3GO5A 2F0QA 4CKEA 4WFN3 1EWYC 2MJDA 2EE1A 3NXWA 2AWOA 1B3AA 2BCOA 4NMZA 5BYRA 1XLQA 3Q24A 3N6RA 1I6HB 2XIWA 1MHXA 1SNPA 4GLSC 5KNBA 2JA8B 3MHZA 3HP3A 3EJIA 3E0JA 3AE4B 3A8KE 3MHBA 3SFEB 1PXUA 4N9TA 2OT2A 3VYRA 1O80A 1OXSC 1JALA 2IT1A 1EL0A 4OZCA 2JWUA 1V97A 2PTLA 1RM6C 3OHXC 4OVZA 2B2WA 4YTPB 4MT5A 2A6HC 2NTTA 2F0NA 4V190 2BBCA 5FOBB 3HZXA 3I8ZA 4L63B 4RKLA 4F7XA 4FXDA 2IGGA 2PW5A 3T56B 2I46A 2MH7A 3VR9B 1X3PA 1EZ8A 2KCCA 1BUIC 1NYQA 4ZAIA 3U4EG 3D31A 3SHLA 1JQ4A 2XRSD 1IW7C 1OQQA 4DA2A 1DZ1A 1V43A 3J7YW 2VNUD 1KTKA 5C5LA 5C4HA 5JPMC 4J1MA 4G4KA 1PFMA 1T5XD 1G2TA 4BBRB 1XEEA 4HEDA 4IFDJ 2JZPA 1K52A 2NMQA 1FO4A 1TYGB 5EE9A 3AEBB 3OPOA 1G8ZD 4OW0A 3D6WA 1FNUA 2JA6B 4K2KA 1N63A 3UI2A 3LXFA 1F2ZA 1II3A 3NTHA 3QOLA 5IT9E 2JX5A 5LNK1 1XLPA 5FO7B 4DN4M 3ETRA 1CQVA 1J9OA 2ZXPA 1N62A 4R9WA 4K14A 2BE5D 3T3OA 3W5UB 4BY7B 2MGSA 3I4NB 1JB3A 3IKJA 2A69C 3HRZC 5EQ0A 4XDCA 1FCCC 1F9PA 4B0MA 2B2VC 1FXIA 3EA6A 1WTPA 2V4DA 2SNMA 1AWDA 1C8CA 2JA5B 4RFBA 4XQNA 1H9KA 3DHQA 1A3UA 1PZID 4QUCA 3MAQA 4ZRZA 2QKIC 4DNRB 2MP1A 2CQAA 4LLGM 2XSCA 1L6UA 5D14A 3M4OB 3A8JE 1HTPA 2ICIA 3VQIA 5T8IA 3D4WA 4KI0A 4LMQD 4IOIE 5CV9A 1SNDA 2WV6D 1BR9A 4R8NA 1EYAA 2E76C 4WAFA 3GTLB 1TKGA 1SE2A 1D5ZC 3HOUB 2AQ1B 4IUQA 1F0ZA 5ELBA 4HJGE 1EU4A 1GUSA 3GQBA 2J53A 3J80E 1VDZA 2AWNA 4FF1A 5BYSA 4YSZB 4KGTA 5ELFA 4XQQA 4H0LC 3H3VC 2SAKA 4IZ8A 3S2HB 1ILQA 5JPNC 5IT9L 1QILA 4TMAB 1FD7D 2R7ZB 3H94A 3IAM1 1ET6A 3P7JA 4C2MB 1NI3A 3EROA 4M0WA 4E6IA 1BBXC 4IFDG 1SSNA 5HG2A 4C3IB 3NTIA 3H8HA 3HS0C 3DM1A 4DAVA 1STEA 2BE5C 4RGNA 1B2TA 4XXEA 1N60A 4XYOA 1FFUA 3Q8FA 3AH7A 1TJEA 2PKOA 3IFTA 3AB9A 5TSSA 1WD0A 3T4AC 1ZEQX 1ZXTA 2N7JA 4CJ2C 4ZUJA 3OIPA 2MEKA 3OSOA 3IAYA 1CJEA 5K36H 1JE4A 1VF7A 4ITKA 2X6LA 4XE0A 2XNAC 4DNTB 2B8GA 5C4ZA 2WAQB 2E3TA 2VZKB 5BYQA 3AE8B 3VRBB 5IGDA 2N9LA 3C1EA 3L3OC 1ILPA 2B2UC 2L1BA 4K5VA 3VYSA 3DEPA 1LTAD 4TRDA 4A9AA 1EY5A 1GUTA 5C4JB 2JYEA 4G7ZC 2BYTA 1WXQA 1VMPA 2OEOA 5CR3A 4BA1I 4B08A 3GTOB 1OXUA 1IBXA 4N6EB 2KQ3A 2KEDA 2K32A 1IGDA 4A3JB 1Y1WB 4KY6A 5F2DA 4DQOC 5BN5A 1TT2A 4ODGA 4IALA 5I9PA 4TQ1A 1ENFA 5FLXE 1GPXA 1BOSA 3CKIB 1C78A 5JVG3 3P75A 2A6HD 4QUFA 5JEAH 5C0XI 4IFDH 2AX5A 5D3DA 1L4ZB 2L83A 4K6LA 1XLNA 3P4RB 4REZA 1K8MA 3GS2A 4YSYB 4XIGS 2KN4A 2EZVA 3I4MB 1G91A 2OXPA 3FPUB 1AEXA 2AUKA 2F0DA 3EQLC 4RNAA 1KAAA 1ZYRC 4YTMB 3Q8AA 3KF8A 3R2IA 2R93B 1FRRA 2R61A 2WXOA 2KCNA 2F0EA 1H9RA 4QIWB 4WH4A 4I7ZC 2IL8A 1EIHA 1BCPB 2EY1A 1U4PA 1EYCA 1NUCA 3PUYA 1C4AA 2J0TD 5HFYA 1LTRD 3KWLA 4C1NK 2EVBA 1I50B 3IFDA 5E4XA 1B44D 3SXHA 2EY6A 3KUPA 1SNOA 2PZWA 3U52E 3OW7A 4A3KB 1KRHA 3PO0A 1CK1A 4KHVA 1OQRA 3AEDB 3FC4A 3KBXA 5M3MB 4Y7NB 4KY7A 3A56A 1EEID 1PFDA 4WWMA 3IL8A 5H8YE 1KNEA 1PRTB 3R93A 4KX6B 3LX0A 1GB1A 3V2TA 1MBYA 4CKCA 1HUNA 2WXGA 2IWHA