1CQVA

Crystal structure of staphylococcal enterotoxin c2 at 100k crystallized at ph 5.0
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
239
structure length
232
Chain Sequence
ESQPDPTPDELHKSSEFTGTMGNMKYLYDDHYVSATKVMSVDKFLAHDLIYNISDKKLKNYDKVKTELLNEDLAKKYKDEVVDVYGSNYYVNCYFSSKGGKTCMYGGITKHEGNHFDNGNLQNVLIRVYENKRNTISFEVQTDKKSVTAQELDIKARNFLINKKNLYEFNSSPYETGYIKFIENNGNTFWYDMMPAPGDKFDQSKYLMMYNDNKTVDSKSVKIEVHLTTKNG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Toxin
molecule keywords PROTEIN (STAPHYLOCOCCAL ENTEROTOXIN C2)
publication title Structure of staphylococcal enterotoxin C2 at various pH levels.
pubmed doi rcsb
total genus 68
structure length 232
sequence length 239
ec nomenclature
pdb deposition date 1999-08-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01123 Stap_Strp_toxin Staphylococcal/Streptococcal toxin, OB-fold domain
A PF02876 Stap_Strp_tox_C Staphylococcal/Streptococcal toxin, beta-grasp domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.110 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1cqvA01
3.10.20.120 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1cqvA02
3MC0B 1I4PA 1SEBD 1PZJD 1EEFD 2G9HD 1M4VA 1LO5D 1LT5D 1HQRD 1JWMD 2Z8LA 1SE4A 1ET9A 2AQ2B 1BCPF 4RFBA 3MFGA 1B44D 1SJHD 2ICIA 5ELEA 1BCPC 1L0YB 4OHJA 1EWCA 1I4QA 1PYWD 2QEJC 5ELFA 1ET6A 5ELDA 1LTID 1JR0D 4RCOA 2XNAC 1PRTD 1D5ZC 4UDUC 5FK9C 3BYYB 4DXFA 1LTSD 5FKAC 1UNSA 2NTSA 1CT1D 1AN8A 3DWPA 3KLSX 1LT4D 2CHBD 1XXGA 1I4HA 4RGTA 2RDHA 1EU3A 1RDPD 2AQ1B 4RHRA 5D3DA 1S5ED 1PRTB 3EA6A 1CK1A 3V05A 2NTTA 3BVZA 1LT6D 1ESFA 1XTCD 5TSSA 4Z9CB 2WV6D 4RHSA 1V1PB 1AW7A 1B1ZA 4DXGA 2O2LD 1D5MC 1BCPD 1JWUD 1LTBD 1EFID 5I4DA 2AQ3B 1SXTA 2SEBD 1JWSD 1QILA 1SE2A 1PTOF 1TY2A 2QILA 1LTAD 1UUPA 1PTOC 2XRSD 1TY0A 1T5XD 1FNWA 1BCPB 1ENFA 4NZLB 1LLRD 1FNVA 4ZYSA 1RD9D 1L0XB 1G8ZD 1SBBB 1BXTA 1FNUA 3R8BA 2J4XA 1STEA 2RDGA 1MD2D 1FGBD 4RGNA 3TSSA 5ELCA 1HXYD 3OWEB 2IJ0A 1YN4A 1I4XA 1SE3A 4TSSA 1S5DD 1KLGD 1YN3A 3GP7A 1PTOH 1S5FD 1F77A 3EFXD 4L6TB 1LTTD 1CHQD 2XN9C 1I4RA 1KLUD 3CHBD 1JCKB 1LTGD 1DYQA 1PZKD 1S5BD 3URYA 1HTLD 1PTOD 3W2DA 1CQVA 1YN5A 4C56C 4O1NA 1DJRD 1JQYD 2TSSA 1I4GA 3BYTB 1RF2D 2XRQD 1PRTF 4L63B 3BVMA 1TS3A 1V1PA 3DWAA 1PTOB 1PRTC 4RGOS 1D6EC 1LTRD 3O13A 3SEBA 1PZID 1FD7D 1SJED 3BZDB 1V1OA 1S5CD 1CHPD 2IPKD 4BWGB 1TS4A 3DWQA 1TS5A 2R61A 1EEID 4RH6A 3R2IA 1GOZA 1HA5A 1D5XC 4K6LA 5D3IB 5ELBA 1KTKA 1RCVD 1TS2A 1LT3D 3BVGA 3R2TA 4RGMA 1EU4A
chains in the Genus database with same CATH superfamily
3PO3B 3M3JA 4REZA 2I5HA 4DV0L 4JPBW 2JA5G 4JI1L 2IGGA 2O2VA 1GHJA 1LO5D 1N63A 1KRTA 2QGQA 2G4SA 4XDCA 1ZDVA 5IT9L 3EHVA 1EQTA 1HQRD 1PGBA 3J7ZC 5E4XA 4HEDA 3IHPC 3MVVA 3M85A 3PF4A 4W9FA 3SFDB 1A2TA 1QUQA 1PLFA 3H09A 3MFGA 4A3KB 3CIRB 3R3MA 4L23A 3C3LA 3EIVA 1UWVA 3IKJA 5MPOA 5G5HA 5DPSA 2IHFA 4KV2A 1RHPA 3MEHA 4A3FH 4JBMA 4DDID 5E4WC 4L8JA 2LGYA 3WIMA 2KEDA 3K5LA 1IGDA 4RCOA 4UDUC 4A3GH 3WOFA 1UAPA 2LD9A 2WU2B 1YNXA 4ABNA 3AE8B 2N1WA 2B63B 1JE4A 4FP5D 4LTUA 2VXWA 4BZAA 1CT1D 1HEZE 4JI5L 4A3BH 1SE8A 3UDIA 2K5QA 2CCZA 1NMFA 3N52A 3MHZA 4RGTA 1HZCA 2YU9H 2N9XA 2RD0A 2C5CA 4MGIE 4Q2JA 2GN5A 1FGUA 4G0NB 1O80A 2SOBA 4K1RB 1U4AA 4GLVB 2CKHB 1ESFA 2GBRA 4KHPQ 2GI9A 4A3PA 4Y7NB 4IFDI 4JI6L 3PGEA 3FEWX 3A5ZB 2F0QA 3GTJH 3I73A 5BYRA 1A8VA 2Z6KC 2KFKA 2OXPA 2RF4A 3KYDD 2JT4B 1YQ4B 4FJZA 1EZ6A 2M1MA 4XWWA 2QCPX 4FLHA 4DWFA 2BE5C 2HHHL 4TQ0A 2F0LA 2DHZA 2MH7A 5LXIB 4BAXA 1XPUA 4FF2A 4II3B 4KKTA 1ENFA 1VQ8A 1UGJA 3A7LA 2DN8A 1Z7TA 4ZYSA 5BMIA 2EVBA 1QG7A 2K5HA 1KDAA 1VMPA 2VB3X 1SR3A 1ZUD2 3P42A 1SN8A 4MJSB 1HZ9A 4POFA 2JA8G 2O6VD 4HSVA 4DK0A 1CKOA 4C4VB 2Z4IA 2MO0A 4R9WA 3EC8A 2KENA 3GZNI 1IZ6A 4DUYL 4OGQC 4K0KL 3E0EA 1BR9A 1ROEA 4L6TB 5D94A 3LWUA 4KJOA 2NCNA 4HXDA 5IYCG 2QW7A 3GTQB 3DEPA 1AEXA 1KLUD 2NBWB 4IFDH 3E3XA 1DD2A 5M5YH 1J7BA 2HTHA 3K57A 3DBSA 4PT5A 1VQ4A 1MSHA 3I8ZA 3U50C 1EY8A 1HA6A 1E90A 4EQNA 2ZM6L 1F2RI 2D10A 3AE6B 4L5TA 4Q5VA 4HJGE 3STBC 1IYJB 1HUNA 2D5GA 5EKLA 4LF7L 3B1LX 1TKWB 3C19A 1F2MA 4LWCA 5HHDG 3ZLZA 1TS3A 1XMOL 4B3TL 1FJGQ 2R92B 1Q10A 1X3FA 3GD7A 2D07B 5EDSA 2K5NA 1S4ZA 3BZDB 4DK3C 3VA7A 3NVZA 3QA8A 4HJKA 2JQOA 3PUWA 3R7RA 4HCEA 5I2XA 2BWFA 1VQ5A 3NRZA 4XC2A 1JMCA 1SYFA 5H1SE 3HOUH 3I57A 2IY5B 2KBNA 1EU4A 3HOZG 4ZK9B 4YSXB 3BINA 3KF6A 4QJFA 4WJPA 3ZXVA 1EEFD 2G9HD 5M3FH 4A3IG 3X3NA 4CJ1B 4I6NB 3HK0A 2X6GA 3DHGC 1XCQL 3NG0A 3I3TB 3V3XA 1FVIA 4K6DA 2VUMG 2LXAA 2F0HA 4YWKA 3AI5A 4FF4A 2PPHA 1C1YB 2NVQB 3S15B 4QIWB 1WJ6A 2HDEA 1I4QA 2E3TA 1C48A 4RM8A 2KOLA 3T1HQ 3E0JA 4DAYB 5L37A 2XNAC 3C1FA 3MXNB 2KDBA 3VXWA 1B9RA 1WXAA 1QVFA 4B3ML 1ICWA 3GV3A 4CJ2C 2MNAA 2BS4B 3TCAA 1WWTA 2JA9A 4K3BA 5AFWA 1VD2A 4D2KA 1YJ9A 3Q6BA 2MEKA 3NTHA 2WDVB 1E8WA 4DV0Q 2D0PA 1A6XA 4JI1Q 2J42A 5D3DA 5CHVC 2FHTA 1QUQB 1CQFA 4DR3L 3A54A 4AJYB 1PXUA 1IW7D 3U4VA 5IGGA 3AM9A 4M00A 2KXJA 1HTPA 3I4MH 2JWZA 2N9EB 3S2AA 1B1ZA 1P8LA 2FNJB 5IT9E 3S1RH 4F7ZA 1Y1VH 1TT2A 2RR9A 2NVYB 4BY7H 5IYDG 4W9JA 3FKIG 1LTBD 4ZQ3A 2R93H 1LQBA 5DPTA 3I55A 5D65A 4EZJA 3VTVA 2LGXA 4PS7A 5J3BA 3BK2A 1SYBA 1ESRA 1MVKA 4AYBB 3F8TA 3PGZA 3PRMB 4XYCA 1ASYA 1YHQA 1IBKL 1WCMB 4JI5Q 2KQ3A 2MGSA 4ZUIA 4IUVA 5A2QE 4UP8A 4WJ4A 1V8CA 4C00A 4NZLB 4DGZA 1WMHA 4RKLA 5IP4D 4X57B 3KUPA 2GOWA 4AUQC 2BYFA 4PMCA 3CMAA 3APCA 1J6QA 1FNUA 1GKHA 1K0RA 3CAMA 4JI6Q 3FDTA 1E22A 4P71A 3TRZA 3FPPA 1R7SA 1YX5B 3AE4B 4MGKE 3VVWB 4TRDA 3EBEA 5CORA 3H3VI 3CD6A 4DNTB 3AE3B 4JV5L 1UF0A 1TYGB 3JC66 2EYMA 1J9OA 4C3HB 1G91A 5GAGC 3VUXA 1KJTA 2AWTA 2HHHQ 3PSIA 2RPQA 5E6NA 3S9WA 1NUCA 4KGSA 5M5XH 1C3TA 2WXRA 1GO3E 3DBLI 3KJOA 1UWMA 4DKAC 4DHJD 2F0FA 3K7AB 2B2YA 4H44C 5J2RA 3K6OA 5IWAQ 5EKIA 3ZXRA 5KNBA 1EY0A 3CRLC 1BUIC 3NHHA 1OFFA 2WB1E 3M63B 2F03A 3HKSA 1F1HA 1K52A 3U4EG 4KMUC 4A3KH 4YTMB 5NUCA 2QMTA 4BBRG 4DUYQ 3N3KB 3H7PA 5C0XH 4ZOHC 3JVZX 4K0KQ 2RHQB 3DUZA 1SB3C 2PMVA 4KD3A 1UE1A 1YIJA 1EWIA 4CGYB 3R66C 4P73A 3S17B 2F0WA 2PMZE 3CCRA 1OEYA 1RWSA 4E3CA 1LT3D 4H0LC 3CRKC 2B63H 1SE9A 2JPHA 3W5VB 2KN4A 3H3VH 2WXJA 2BS3B 2NZHA 2ZM6Q 3GTGB 1LM8B 2B76B 2EKEC 2OTLA 2INNE 4DV7Q 4JI2L 3QAQA 4NAWA 2LRWA 2CR5A 3DVNU 4MEMA 2KTRA 4LF7Q 2WU5B 1P0RA 2UXCL 3FAHA 3WAOA 2UU9L 3J7A5 1SIJA 1XMOQ 4B3TQ 4XZ4A 1C0AA 2AUKA 3Q3MC 1B7YB 4A75A 2QEJC 3AMZA 3WANA 1U0LA 2D3GA 1UD7A 3NXWA 3TL5A 1J7AA 5CHWA 2PE9A 3WAMA 2OHFA 1JE5A 1KQSA 2LHDA 1MG8A 3W1BA 4JWSC 3L08A 1XXGA 1XQQA 1ZOYB 3AE7B 2DGYA 1GC6A 4H2AA 4N58A 3APDA 3JSVA 5EE3A 2IO2B 1W6KA 2JRIB 5IN7A 2JJQA 4ARIA 5CV4A 1Q86C 5IIFA 4HK2A 3G7LA 3A33B 4K5VA 2RPVA 4DXGA 2WX0A 2A6HC 2K5VA 3BDCA 2DZKA 1D5MC 1U4MA 4ZRZA 3IFWB 3IL8A 4A3JG 1JRUA 1V49A 4HMJA 5C44G 4A93H 2MWSB 4DUZQ 2EYLA 1A0IA 3EJIA 4B3MQ 1RODA 2M17A 3DHIC 4BXXG 3VR4A 4A3CH 5JPMC 4DR5L 1XLQA 4ID6A 2Y5PA 1W2BA 2IX1A 5JXVA 4MGYE 3EFCA 2IO1B 4PMWA 1O7IA 5FJ8G 1K8OA 4DR3Q 3A55A 1HQMC 2K5WA 4DAPA 4YTNB 2BOSA 3ZJUA 1G291 5BMHA 2KD0A 2J4XA 1STEA 3MHSD 1N6ZA 3VTWA 4HIMA 3D4RA 5C3EB 2D2QA 3NEMA 1WD0A 1A70A 4CYEA 2WAQB 2L3ZA 2LY7A 3T16A 1S5DD 4B3RL 5FR6A 4BKSA 2PTLA 3GP7A 2EQSA 2RSOA 3UE0A 1MJCA 2R92H 2IX3A 1CHQD 4UP7A 4YHHQ 3F2BA 3HOYB 1HZBA 1JCKB 2IO3B 3CF5A 1IBKQ 3HOWB 4BOSC 1NR2A 3V6CB 2NZOA 3T3OA 3MXGA 2K75A 1OXTA 3N1YC 3V6EB 3ZNZB 5CX3A 3NK9A 5CR3A 1MKHA 3PREA 3AQQA 3UF8A 2IYDB 4FXGC 3VR3A 1VDZA 1GUGA 1BDOA 1EYGA 1M8AA 5F2DA 2JRHA 2VQEL 2KN5A 3OAWA 4A6QA 3VQIA 2KWVB 3CCJA 1GUTA 2JP1A 1EIHA 3D31A 4MM3A 1Q12A 3Q14C 1K83H 4JV5Q 1SMYC 2W3RA 4P74A 3IVFA 1S5CD 1V86A 4OIKA 3T53B 1DOXA 1WFYA 1X3EA 4LLGM 1NI3A 2KHJA 1Q81C 2R61A 1EEID 3H91A 1SYDA 3LWEA 1EYDA 1UZXB 1FM0D 1SIFA 1V5OA 4RGMA 4ZRIA 1PV4A 2RMMA 1DOLA 5IP9H 4MNOA 4QF4A 2A5UA 2JA7H 1EF1A 3S2DH 2ZVOA 4ULLA 4A3MB 1YNTE 1K3BC 2JF5A 3QWNA 4DR4Q 4FF3A 1CMXB 1FEHA 2R7ZG 1R4PB 2D0OA 4GKKL 1C79A 4RNAA 3EVQA 4NXML 1TZ1A 4OHJA 3CPFA 2WXFA 1ACCA 3PZ8A 3APFA 2BF8B 5ELFA 1CI3M 3OMGA 4LW1A 4IJLA 1DCZA 2B2TA 1JR0D 3PO2B 4U673 4EVOA 2QDLA 3Q8CA 3E9IA 1CFMA 5FKAC 5LL6X 1WYWB 2BGFA 3NS1A 4FHKA 5FO8B 2E2IB 3GO5A 1UEBA 5TR5A 2ZTEA 1JW9D 1CTMA 1I4HA 3PMFA 3PZDA 2UWQA 1WCMH 5JEAH 1VCBA 2X8XX 3V61A 1S40A 2KTRB 2GMIC 1YNND 3E5SA 1CK1A 2INPE 3B9JA 2NTTA 3BVZA 3L9AX 4FNFA 2SAKA 2CQAA 5M3MG 2UXCQ 3UINB 2F0SA 3IG3A 1TQOA 2NBFA 3RZDB 1YBYA 1QWYA 1UGMA 4M0WB 4A3LG 4XE0A 3CXCA 2CW0C 1QJOA 2LVOA 5ELOA 3CCLA 2KVZA 4EGVA 2I1KA 2ID0A 2EYJA 1TTNA 2WXNA 3AFQA 4FJVB 2FMCA 4IUTA 1SFOB 1W3SA 3H15A 4TMAB 3VR8B 4LF9L 3O65B 5K5PA 4C3HH 2INCC 2KQ7A 3HFZB 4GOPC 1BCPB 5AUIA 4X64L 2JA6G 1HHVA 1F52A 3A7AB 1FFVA 2H89B 4OX9L 3P1MA 4EZKA 3K7AH 2RDGA 1IBML 3HOUG 1MFWA 2BYEA 3DBHI 3TJPA 2DLBA 1GJZA 4A3FB 1FRDA 5IOCA 3OLMD 4RA8A 1B4OA 2UUBL 2W55A 3NE5B 4A3GB 1C76A 1EWHA 4GNXA 1C9OA 3SDZA 2KX3A 2YTYA 3F2CA 2IZVB 4GXBA 1EZ8A 1I6VC 1LTTD 1QT9A 1R4MB 2F0IA 2XN9C 2VZKB 4A3BB 1PVOA 3ND9A 1FYCA 3HOXH 1LTGD 4NY0A 1XTDA 3VDZA 3HEJA 1K73C 1IYUA 4KIKA 1V1QA 4OEMB 3A8KE 1GUNA 1SNDA 2WFWA 3QG1A 3W2DA 2ZJDA 3I5JC 1BT0A 1OTRB 3M7GA 1ILPA 1OO9B 3Q6SA 2TSSA 3RZOB 3BYTB 3H8HA 4KLKA 1Y1WH 5L95C 4K81A 2BA0A 3TZDA 2XRQD 5G2NA 4ZKCB 3W5UB 2E5LL 4TQUS 3T8MA 2N78A 5HGQA 4IUMB 3FMCA 2DYMA 3K5NA 4B3RQ 2LVPA 2J7ZA 4A3OA 1PZID 4BY1G 1SJED 1SSNA 2IPKD 4HMIA 1DZ1A 5FLXL 2J53A 4GMVA 4C3IH 2K8BA 3BS1A 3TEXA 3H6MA 5D3IB 2WP8J 3R2TA 2UUAL 1DOYA 4DNRB 4HN7A 3HS0C 1SEBD 1Y1VG 2F0DA 2PQAA 4LNKA 2UXBQ 1V2YA 1N5WA 3MA2B 4DV5L 1I5FA 2JSOA 2PI2E 3KDFA 2F4VL 4BKGA 1VF7A 5IGCA 3ZTCA 2D2CC 1KNEA 3U2SC 1YJWA 3A9JB 4PYZA 4E74A 2V4IB 2D5DA 2L1BA 2VQEQ 3SHLA 4HTHA 4R1JA 4K2LA 2JEAI 4G11A 1HNZL 1JJCB 1JALA 2Y0SG 2OWOA 5C4XG 2AYOB 2D9UA 2H4OA 4XYOA 4FBJB 3SR6A 2D62A 5K36H 2NN6I 2DNFA 4MDKE 1QE6A 4I6PA 1Q7YC 2B8FA 1RM6C 2IO0B 2CWAA 3OHXC 2F4IA 2M2LA 2NVTH 4A90A 3RT3B 2E76C 1XTCD 3DOWA 3C1EA 2DY7A 4GN4B 4XQNA 1JMLA 1LXDA 1QQRA 3I9V1 1A5RA 1MBYA 4GKKQ 4EOYA 2DWQA 3OW7A 4NXMQ 2WDTB 2F3VA 4LFCL 3L7ZC 2LSSA 1WIAA 5C3JB 1QOAA 4KV6A 4XYQA 5C3EH 2FIDA 2KMMA 3BIID 2FCSA 4WWMA 1NE3A 3PO3G 1YHBA 3X3MA 2SEBD 5HGTA 3RLOA 4HSPA 1WR1A 2M19A 5AZGA 2MA9B 5LLIA 1PYBA 2K1BA 5I6WA 5EPKA 1OQYA 2OEOA 3VYSA 1KDBA 4C3JB 4JOIC 3W3AA 1FO4A 4ICUA 3HOYH 2FBWB 2I46A 5M3FB 3GZNB 4A3KG 4H7BA 4ODGA 1HTOA 1E9MA 3A9KB 4GKJL 5C0XG 5CTRC 2PW7A 1Y8OB 4IUNA 2MW5A 4TQ1A 4DXAB 4C7YA 4WWPA 3Q8BA 3V62A 3WWVA 2CH4W 3RLFA 1W6JA 2Q2TA 4QUFA 3PS6A 2EYFA 2Z59B 1E5WA 5KYIA 2NN6H 3K59A 1F2YA 3AE1B 3Q8EA 4HEA1 3I4LA 3HGBA 1SRUA 4TSSA 1KAWA 3OTOL 3KLSA 2OOBB 1K8RB 4WAFA 1JQ4A 3SK8A 5I6YA 3PIP3 4DHZB 2YEPF 5CMDA 2WINB 1JJGA 1J7CA 2DENB 3W1SC 4LF9Q 3KH0A 2Q2HA 2ACZB 3K58A 4NQKE 2IBIB 3VUYA 4F8CB 2L52A 1PYSB 1EOVA 2FFKB 4A4IA 3CCMA 4X64Q 4A20A 3AE5B 2JZ3B 2HDMA 4POGA 3I4MB 1V8QA 1I4GA 4GN3B 3FVQA 5GQOA 4BBSB 3ZRFA 1BBWA 3H9DA 4GDLB 3S1RB 1HZAA 1IBMQ 2KWDA 2WACA 5D14A 3F2UA 4BY7B 2DZJA 2K9XA 2R93B 4B0MA 2M56B 2UUBQ 1PTOB 2WQYB 3KW5B 2L83A 4KSLC 3AEVA 3M3YH 2LVQA 3SEBA 2QDBA 1XPOA 1HUMA 1XYIA 4IPHA 3AEFB 5D6JB 2W54A 4GLXA 4KSKC 2QJLA 1TS4A 3DWQA 3SXHA 5JVG3 1E7ZA 4LJOB 3N1XC 1XWEA 2F0NA 1GB4A 1LM0A 1L6VA 3AU4A 1E24A 3MC0B 1I4PA 3VDYA 2QEXA 1WGKA 1XF5L 2E2IH 3AECB 1L1OA 2V3NA 1II3A 1ET9A 1RFKA 2JX5A 3BG3A 3PV0A 2HE7A 1SDFA 4QL5A 4A3CG 2REXA 4X3KA 1B44D 2ICIA 1HH2P 1L0YB 2RBMA 5G3LF 4BFRA 1VQHA 1WJJA 4BKTA 4JL9A 4YWGG 1JICA 1X3QA 4XT3B 1BMLC 1O78A 4PS3A 4WJOA 5C5LA 1VRAB 4N9TA 2MBQA 2B2UA 4UHVA 2MJ8A 5M5XB 2ZVNA 2ZXOA 4XT1B 3VYTA 2UUAQ 3RPFC 1I42A 4URKA 1AN8A 1TWAH 3ZJYC 1J8CA 3MEFA 4WJNA 5FLXE 4NW2A 3ZDTA 1K9MC 1S1QB 4RHRA 1G6JA 4US8A 2DZIA 1HCZA 1HRJA 4L1BA 1TWHB 4DV5Q 2F4VQ 2R92G 2KLCA 3A8IE 5TSSA 1WTXA 5JJKA 4H13C 3I63C 4GOCA 2QA4A 2JYEA 5C4ZA 1WXVA 4LCDE 1CZWA 5AUKA 4A9AA 4Q0FA 1MHWC 4OVVA 1T0SC 3EN2A 4IOAA 3NTIA 5C6AA 1LUZA 1XD3B 1HNZQ 2J0MA 1BCPD 3UDGA 1RAXA 3BZKA 4JOIA 4F7XA 3KWLA 1QILA 3RMHA 1N34L 1GHKA 2MP2B 2F0OA 3TMEA 5DPWA 2K7VA 1L4ZB 5C0XJ 4IW0A 1KM7A 3RCZA 1UUPA 2L5TA 3R93A 2OEDA 2XRSD 1RTNA 3HIZA 4EQOA 3NWSA 3KBGA 3J81E 3C0RB 3DWGC 4IALA 4C2MH 2MLBA 1RLFA 2FMMA 1VQKA 2KO3A 3VR9B 2AX5A 2KANA 3BY4B 3J80L 2L15A 3M4PA 1B50A 4NDXA 4KKSA 3PIPA 2WNMA 2VZKD 3ICEA 4GDKB 2XGTA 4B9KA 3RZOH 4LFCQ 1AARA 1CZPA 3MJ5A 2RSNA 3DBLB 1QZEA 2Z0SA 4LK1C 1ZW7A 5HFYA 2Q8RE 4IM2A 5FR3A 1I50B 4KX6B 4XIGS 4DNIA 1O7LA 4QUCA 2Z0EB 4LFAL 1P16A 2LGDA 4NMZA 4DA2A 1G2TA 3NZ3A 4BOZB 4WIPA 1VQGA 2R2OA 3MC9A 4CHKA 1SYEA 2ZPNA 1Y56A 4I7AA 2A8VA 4JWUC 2E74C 2R7FA 3ZRCA 3F1ZA 4GKJQ 1L5PA 4LNOA 1DJRD 4J6HA 3D8GA 2EY6A 3F2DA 2GB1A 2AWNA 3AEEB 3RMKC 1EYAA 3W1GA 3VHTC 4PZ8A 3VR6A 5IY0A 4A3DH 3BVMA 3CCVA 2WIIB 4AYBG 3B08A 1SNCA 2PZWA 4EQ5A 2CWPA 2I5LX 3DWAA 1VQ7A 1JWBD 1WXQA 1V97A 5GAEC 4A93B 3CKIB 1R4QB 1WCMG 3OTOQ 1FD7D 4AP4C 1ZDXA 3S1MH 1Z2MA 3K9OB 4DK5A 4B6WA 3L4PA 1PDXA 1D8LA 1F9RA 4ZHPA 3R2IA 3NPPA 1D5XC 4K6LA 3NELA 5KRUA 3HHMA 1XX8A 3H0GB 5JVH3 2CKZB 2WP9B 1I6HH 2WKCA 2LJ5A 1M90C 4X66L 5JPNC 3NVYA 3GTOH 4GN5A 1PFMA 2EYPA 3ERSX 2BB6A 1FCLA 4AJWA 4JCVE 2Z8LA 1SE4A 5J22A 2VL6A 3SFEB 2FUHB 5IA7A 2LASA 5EE1A 2XSCA 2Y0SE 4FO2A 4C3HG 3MAQA 2XEWA 2JQRB 5E6JA 2F3IA 3R7QA 2BBCA 2G4DB 3W9CB 4LUZA 4EZLA 4KZCA 2DNCA 5IYBH 1NAPA 4DR7L 2NS5A 1Y8PB 4DXFA 2JEBI 4GLSC 4MT5A 1BQQT 1LTSD 2PW5A 3MFYA 1KIXA 3ECIA 4XWTA 1X3PA 1YOVB 1XLOA 3TEZA 1E2WA 1LT4D 1HNWL 1X1MA 1E8YA 2ENBA 1FPYA 4C3JH 2H88B 2PYKA 1CZGA 2AQ1B 4BA1I 3L10B 1PRTB 3RZWC 1ZEQX 4K14A 3RYTA 4GSWA 2CU3A 1YVCA 3RN5A 1AWDA 5GROA 4JX1C 1V1PB 3ZQ4A 4K7SA 1MIUA 3TBLD 3GV6A 3AU7A 3TP7A 4DV1L 2I1JA 3EUB2 2PCFB 1K83B 1J19A 1V81A 2LMCB 1VQMA 5H92C 1UEAB 4FF1A 1C4QA 4DPGA 3LXFA 1NR4A 4J8QA 2CHWA 3Q8AA 4WAAA 3ZGZA 2RSUA 5EBCA 3QCAA 3KUDB 4WQOB 4DU9A 3AMUA 3D4WA 4KI0A 4ICVA 2PLPA 4HAEA 1NI2A 5C1ZA 2GBMA 3R3OA 2ES2A 3CWIA 2XWJB 4BBNC 4N8FA 4MIUA 1T6BX 4DQOC 1EQVA 2JA7B 2KDEB 3S2DB 4WORA 1N36L 3DM1A 4QQBX 2O2VB 3ML8A 3D4DA 4R8NA 5EPJA 1IBXA 2ICEC 1ASZA 2Q2UA 2A6ED 3NBHA 2JY6A 1AZQA 3HUIA 1EFWA 1MHHE 4OO1G 3OMCA 5D2MB 1BXTA 4OVUA 1STBA 1M94A 2Z6KA 4IN3A 2MO1A 3T13A 5I2YA 5JAVA 3GTMH 4BBSH 1T3QA 2LGSA 1QVGA 2HJ8A 3E9HA 2CS4A 4IOIE 3WA0A 4IWOA 2I5MX 3I2ZA 3PV1A 1K0SA 1PTOH 4KN4C 4I6LB 1N34Q 3I4NB 2KJRA 1WOCA 4DF7A 4A76A 4O2DA 4LFBL 1I35A 2L11A 2N7JA 5J1ZA 5JHAA 2X6LA 3TEWA 4NQLB 1XLPA 1YX6B 4MH0E 4HPMB 1PTOD 2EMTA 2JN4A 2KWCA 1H95A 3RNFC 3BJUA 4QGUA 1TR5A 1X9NA 1T9HA 3ONAB 4JVZA 3T1YL 4L63B 5C23A 1IBLL 4A3EH 3U30A 2KFKB 2Q8IB 1VQJA 2EIFA 3J80E 2KJHB 2BPSA 1LTRD 2IL8A 5CGKA 2BT6A 3DDCB 3P20A 2K03A 3J7AV 2LFNA 3DLLA 4PV1C 2EY2A 4LFAQ 1E1TA 1VCIA 4KHZA 4HIOA 5KHOA 2QSDA 1DONA 2BWES 2CJNA 3BVGA 4IKGA 4YY3L 1GUSA 1AP0A 1WRDB 2KC2A 2L0TA 2K05A 4JI8L 5IP7H 1WTOA 4JG2A 1CA6A 5EAYA 5C3EG 2ATWA 2WAQG 5DNFA 5T1GA 4CKCA 1RJTA 1QB5D 2DJGC 2ONQA 3UGBB 2N9PC 3VAWA 1TWHH 2HJ1A 2F0PA 1S3OA 3GTLH 1F9QA 1GC7A 2MRPA 5ELEA 2P5ZX 2KYWA 2L05A 4B95A 2F0KA 3HOYG 1QKZA 4HCSA 3HOWG 2KHIA 1PYWD 1Y14B 1VQDA 1ET6A 4X62L 5AZHA 5ELDA 5CBEE 5LXHA 2LEKA 1ZKHA 1E6EB 1FRRA 5C4JH 2MJDA 1B53A 3HOXB 3A1QA 1R9TH 1JJ2A 3Q3FA 2DY8A 2OJWA 2NTSA 2PI2A 3CCSA 4XDDA 4W9IA 1U4PA 4OELB 4FN2A 3IXSA 5CV7A 2B2WC 2PW9A 3N32A 4X66Q 1OQQA 2BYVE 1Y1WB 1DOKA 1B9NA 2CQOA 4NKLA 3L17A 2OJRA 3SD5A 3ULPA 1WI5A 4HJ5A 4F88A 2K33A 1D2BA 2FCQA 2IY1B 2A68D 1EFID 4C3IB 1WJ4A 3KYCD 4BBNF 3L3OC 2L9HA 1SE2A 2DX5B 4A3MG 1I50H 2B3AA 3PHWB 3DBHB 1IXRA 1IL2A 3KF6B 1VZ8A 5LMNL 2LUMA 1HNWQ 1P7EA 1UBQA 1H9SA 2KWUB 3S1NH 3ZW3A 4QIWE 5IGBA 4KKIA 3OPOA 2MJEA 4FADA 2CH4A 2LXJA 1C4PA 1TVXA 1E8ZA 4IG7B 3HOVH 2NYZD 2QF7A 1E2ZA 4ZKBB 2R3ZA 4XQJA 2I0QA 3S16H 3GTPH 2VH1A 3PO2G 3K5MA 4X6AH 4DV1Q 4NPNA 4GGQA 2Y5BB 1CKNA 1HXYD 3OWEB 3TBIB 2K5PA 2EXZA 4QB4A 2IGHA 3HZXA 3I3CA 1WFQA 1KNAA 4E6IA 3TQYA 3KLWA 3CSTA 5BYSA 5EBDA 4IC7B 2MX2A 2IY0B 2KT7A 1MG4A 4IUPA 1DYQA 1BBUA 3IFTA 1N36Q 2QHOA 4JI3L 1RKNA 2NVTB 1VQPA 1Q5WB 1FFUA 3H0GH 4YT0B 1A62A 4CJ0B 1XEEA 4AYBE 2PQEA 4WFN3 5FO7B 3NZSA 1TKGA 1TWGH 1B8AA 1STGA 1AE3A 5GMVA 4FHJA 3ENEA 1BKBA 2CHXA 4ME3A 3TS0A 4RCNA 4HJAA 1YQ3B 2M4NA 2UYZB 3V2TA 2LJIA 4CBVA 4X65L 2WXHA 1VQAA 5KHQA 4HJ7A 3PTFC 4WJ3M 2A5HA 2J7QB 3OWFA 3TDQA 1EWYC 2KKCA 2N8NA 4M01A 1TS5A 4QAYA 3QJZA 2DBYA 1JOOA 4LFBQ 3IAM1 4AOFA 3U9OA 4G7ZC 5GXGB 2EPBA 4ZRJA 4HPPA 1WMHB 1CUKA 2UUCL 4OZAA 3K7UC 1GXDC 2DUDA 3P7JA 1IW7C 1M4VA 4A3FG 2B2VC 1V5TA 4P1CC 4A3GG 2MFIA 1JROA 3LDZE 5EQ0A 2XK5A 1EIFA 3T1YQ 1IBLQ 3GOEA 1O7YA 5KEEA 3AEGB 4IM3A 4NXNL 2JA5H 3V96A 4A3BG 2ZJQA 4APVA 4HWIB 1IL8A 1NTGA 1T0YA 4OZCA 4OWXB 3TEHB 1PRTD 1XJVA 2KTFA 2MBEA 2B2WA 5FK9C 4XTCS 2DYBA 4RF1A 3U52E 1WGYA 2BYTA 2Q2IA 4O0AA 1C7YA 5M5WB 4YY3Q 5CV9A 1WTVA 2B8GA 1BUVT 3M4OB 1I3QH 4BS9A 4JI8Q 4OIJA 4CO7A 1EU3A 1LV9A 1RDPD 3Q69A 2I38A 4NAMA 1Q82C 1HE8A 4MSMB 2E2JB 1NBWA 4LNFA 3SGIA 4IQZA 3AV8A 4TKNA 1AYFA 2VQFL 4W9EA 1Q3LA 3M3YB 3H7PB 2EY5A 3RNCC 2FCMA 2VY3A 2G9DA 2BQQA 3A1QB 4X62Q 3EROA 2L00B 4HLEA 2YTVA 1PDQA 2EE1A 1RRBA 3ER0A 2L32A 4KKJA 1FR3A 4F1SA 3ZTDA 5EKKA 2KACA 3I4NH 4P1BC 4HROA 4LUOA 1VQBA 2A1AA 1Q1OA 2JUOA 4MHEA 4NAWB 1RD9D 4J15A 4DV6L 1L0XB 4JI2Q 4ZRKA 4LDTB 1TJEA 2K14A 2LXKA 2W9NA 4P75A 2O4XA 2NMQA 1SLJA 2OF1A 4K2KA 4MN3A 4RGNA 2UU9Q 4IFDG 2GA4B 3PRZA 1Z9FA 2ALYB 2HD3A 1PH7A 1LTLA 2L4NA 4B0EA 4ACFA 1XCTL 5DM73 2V1CC 4B9XA 4L2YA 5BYQA 1WI0A 1F77A 3UIOB 3T9LA 1XPRA 3HVZA 1YNJD 1TWAB 1VQEA 4DK1A 3Q22A 3M4YA 4P6VF 4K5XA 1E1OA 4ZUJA 3UDFA 5LMNQ 2K8HA 3PT2B 3I72A 4DAMA 4KVGB 4IPDA 4JI7L 1GM5A 4J3OD 1S5BD 2K0PA 1UBIA 4P7IA 2AHOB 3K0YA 2N1VA 5FLMH 2FAZA 2WXGA 2NVXH 3JSVB 3QK0A 5C2TB 1YN5A 2AUJD 4OL7A 4N59A 3L0WB 4R4CA 5IYBG 3PUVA 2WXIA 4JLCA 3H3VC 1NVID 1QLBB 2KX0A 3EQLC 1HR0L 1U9RA 2VNUD 3K80C 1PGXA 1ZYRD 2K5DA 4B9WA 4K7WA 3RULA 4KJNA 4RGOS 4C3JG 1FXIA 3BK1A 3RNBC 5L83A 4LMQD 2A69D 1BVSA 1BF4A 2ZT9C 3S14H 1KD1C 1V1OA 4JBWA 3KK7A 5M3FG 2J52A 2FIFA 3QIJA 5BN4A 4RH6A 1PHJA 3WAPA 2VB2X 5HURA 4GIVA 2B2VA 2BS2B 4DR5Q 1WX9A 4WWOA 4C2MB 3Q8FA 4C1NI 2WAQE 1X3GA 4IZ8A 2KJ6A 1QNKA 4X3UA 5LMNW 2XIWA 2D3CA 3OJ3A 1V6EA 3U9SA 1KHIA 3DXJC 1KXLA 4FXCA 4KY6A 1MI0A 2KJXA 1WX8A 1EM7A 3QOLA 4WH4A 3PQIA 3HOZH 1JT8A 4RMFA 1VJKA 4US9A 1GAQB 1E7PB 5H8YE 4ANWA 4X65Q 1UWXA 5CYUA 1QF6A 1V9JA 3P75A 1MGSA 3HP3A 1S72A 5J17A 2W3SA 1ONLA 3FC4A 2FE8A 3PPAA 1WTQA 1WF9A 3Q2AC 1L2NA 2F0JA 5JJIA 2SDFA 2VS1A 3I4MG 1FXTB 4ALPA 2V3SA 3KUZA 3MZ5A 2UUCQ 5E3FA 4B3SL 4BA2I 2C7MB 5HG2A 3RZFA 1J0GA 1PFBA 4FDBA 4BY7G 1IP9A 3LX0A 3RD2A 2R93G 1RFAA 1VQOA 2M0XA 3A8JE 3N9YC 2UXDL 3IFDA 3A5UA 4A3DB 2B39A 2WV6D 1PH2A 3AEDB 3NY5A 4MM3B 1VQNA 2BVCA 3M9BA 1BBXC 4NXNQ 1DGSA 1VS0A 1P9DU 1WJUA 4M02A 3ML9A 4DV3L 5HY6A 3VYRA 3S1MB 3NOBA 5IGFA 1AH9A 3ZYYX 2M00A 2L0FA 2PZUA 1QNUA 2DZMA 1I6HB 2AMCB 3T56B 3ZNID 3RD4A 1TY0A 3GTOB 5IYDH 1T5XD 2EMSA 3VH4B 2BCOA 2JYOA 3FKIH 2WDQB 3BU2A 5IT9c 4IFDJ 3B2FA 2KFJA 2FINB 3NENA 1G8ZD 4R4TA 1WTRA 5E6OA 3R8BA 4ANVA 1PMRA 1A3TA 1CM9A 1QVCA 2RHSB 4KGRA 2VQFQ 3SK5A 3TSSA 2YVCA 4RF0A 4NJCA 4JBJA 4RKBA 1YN4A 3CPWA 2K28A 3NZUA 1SNOA 3RNAC 1YN3A 1A15A 1KAAA 2WKDA 1S3SG 2ZW1A 3CCUA 4GOPA 1TT5B 2JYTA 1E7UA 3KF8A 4R3DA 2TMPA 1SYGA 2Q5WD 1HFGA 3AEAB 2NB0A 1KLVA 2KQSA 2Y5CA 3B6YA 2KAJA 2L12A 2IDYA 5C4HA 4L5QA 3URYA 1KF6B 1KC8C 2MSED 3EFUA 2V0GA 4EFOA 3CP0A 3PO0A 4DV6Q 4DDGD 3ZIMA 4KHPL 1F9PA 1GD7A 2RCNA 4CDEC 2PJHA 1IHZA 2OTJA 3SR1A 3B2GA 3SVMA 4OW0A 5IAAC 3X23A 2B63G 4R8IA 1JOQA 3ABVB 4HDOA 1SF0A 1VQ9A 3WALA 1WYDA 4AQ7A 3HM6X 1D7QA 4YSYB 1YJ1A 4KY7A 3AXCA 2A74C 5BR8L 1AZPA 3PZ7A 1WD1A 2EY1A 3I90A 5IKCM 4JI7Q 2LGIA 4BBRH 3TUOA 1YNNC 3RN9C 3RFZB 5M5WH 3PUZA 3M4OH 2PVGC 1EL0A 1C78A 1WJNA 3EECA 1XLNA 4H02A 4RFBA 2AQ2B 3U4ZA 1UH6A 4YWLA 2R2QA 1A3UA 4OX9Q 3STBD 1HR0Q 3GTMB 1SJHD 1G2SA 2E2JH 2JZPA 1YIWA 3P1HA 5IO9A 4GNXB 3Q3NC 4MJSA 1YNJC 3SDLC 3HKZB 4C4VA 2HCIA 2KZRA 1DOMA 2KDMA 3TZUA 4YXDB 1HJPA 1XO3A 4JIOU 2EDGA 5EPLA 5A35A 2WXKA 5ELNA 4IJHA 1JORA 5KYLA 2GVBA 4R4IA 4KIKB 1D1KA 4DAVA 2CHBD 3ZUNA 4KK7A 3MJWA 2CHZA 2PE6B 4MH8A 4DR2L 2HIVA 1GUWA 4J1MA 1EUVB 3EA6A 3ERQA 2PIAA 1VQ6A 1LT6D 4A93G 1TWFH 1ZYRC 4MTKA 4A3EB 4CDDC 2KOXA 4LF5L 4TVAB 4ANUA 5ISRA 1STYA 2E5LQ 2KMCA 1Z47A 1HR0W 1KRHA 5DLQE 2KLGA 3H0GG 3KVFB 1SXTA 1E0ZA 3PLVA 1WTPA 2OCEA 5CV8A 4CDFC 2K50A 3ULJA 3ONSA 4LF8L 2A19A 3NTKA 4FA6A 4LDTD 3D6WA 2PVOD 1L0VB 2HIXA 2PQAB 1MI2A 3V60A 1GUOA 4LF4L 2HUGA 3DBRI 1LLRD 3KDFB 1E10A 2BA1A 5C44H 3ND8A 3PRPB 2UXDQ 5IOIA 1E0BA 1SBBB 1XMQL 3GTLB 4BXXH 2V4DA 4UPAA 2IT1A 3EGRA 1MD2D 4PZ6A 3H7SA 4YSZB 3A56A 2KVMA 4S3SA 1U4RA 4MZ9A 1TKEA 3GDEA 4DV3Q 4GU2A 5FJ8H 1F9JA 5C4JB 5FO9B 1F9SA 1JWAD 3GE3C 1R9TB 1G6PA 2GBKA 4OONA 4WRDA 1P3QU 2L76A 3N1ZC 1WE7A 3OYYA 2G1EA 4DAYA 3FHWA 3MXNA 3NJTA 4DN4M 3M95A 1GUAB 3J7AF 1IPGA 1ZGUB 3CC4A 2X69A 2KCNA 2QDFA 1PZKD 1VR9A 2K52A 1HTLD 3FPUB 3MHBA 2B29A 3ETRA 2LKVA 4IURA 3AE2B 2MBHA 4XDXA 4XQQA 3U58A 1OXVA 4ZRPA 2V9HA 1UE6A 4K8IA 5I9OA 2MBOA 2F52A 4HIDA 1LFDA 3NWTA 3AB9A 1LYLA 4ASWC 5IP9G 1D6EC 3IRBA 3W1SA 4GOPB 2Z4HA 2JA7G 1HTQA 1NSNS 3KF8B 5A2QL 3NVVA 1OXXK 1Z6HA 2EOTA 4J6IA 4DR1L 2WYQA 5ELBA 1T0RC 3S1NB 3ZJVA 2JVCA 3P4PB 4RWSC 4DFAA 1K51A 1N5XA 4HCNB 4S0RA 5C3WA 1EOTA 1X56A 2JWUA 4U68A 2D3AA 3HOVB 4IOCA 4BKSD 4AH6A 1KRSA 2EJGC 2A73B 4ZAIA 1EY9A 5I9PA 3GTPB 4L5SA 3S16B 1NYRA 1K50A 2NBUA 5EE0A 4DHZE 1X55A 2WGSA 5JOBA 3M4QA 2DNEA 1FMAD 1WM2A 3AU5A 4W9HA 4YIJA 2K32A 4IWQA 3I4NG 2ASQA 3H1UA 3T3NA 2DAFA 2N55A 3LYYA 1EWCA 1MSGA 2PO4A 3ZDMC 2YEPB 1JRPA 1LTID 2N49A 5JEAG 1T0QC 2W82A 4G50A 4G4KA 1WZ3A 5EGTA 3JAMi 2R7ZH 4RM9A 3AB5A 4W9DA 4XX5A 3IT4B 1WXMA 5AEKB 1L0WA 1SMXA 5BR8Q 1CA5A 3L54A 4LAAA 3A0JA 2K6AA 2NWGA 1WSPA 4M1UB 3BDOA 2E6XA 2LUEA 1NNXA 3HKZE 4YL8A 4ZDVA 1EUJA 2RDHA 3MTSA 3Q3OC 4IO9A 3K9PB 1U4LA 3K5OA 3QARA 1SNMA 3UE1A 5IWAL 3V05A 3U7DA 4EEWA 2L0CA 2XWBB 1B70B 1ZXIA 1TWGB 2LRUA 4P72A 5T8IA 5IODA 1H4RA 4LF6L 1K8AC 4OWWB 2M9VA 3RUZA 1K8GA 1YD8U 2L7RA 2LWPA 3AN1A 3MWYW 2GRIA 4OVZA 1BO0A 3L16A 2JXMB 5FLMG 3DVGX 3OG5A 1B9MA 2Z6BA 3NS8A 4PK1A 2LXCA 2VZAA 2GBNA 1I94L 2EJFC 1V9PA 1YEZA 2WS3B 2N88A 2XTIA 5M3MH 1KDCA 2OQKA 1XNQL 2WB1B 4R4QA 2NUCA 4X3TA 4A3LH 4JI4L 1HPCA 1PH3A 3S2HH 3L2PA 2V4LA 3PUXA 2WXLA 1L1OB 3AE9B 1D1IA 3N20C 5HKHA 4DR2Q 1V80A 3D6CA 1NEKB 1A3VA 3G4SA 4DV7L 5DM63 1VQLA 1R4NB 2AEHA 4JYAL 1PH5A 4LF5Q 2PMZB 1TXYA 1WE6A 2JA5B 2B2YC 2BDOA 5G5GA 3HOXG 4LNNA 5AZFA 2E2HH 2IJ0A 2WLBA 1I4XA 4HJ9A 2JA6H 3UDXA 1HZ6A 2AWOA 2A6HD 1OXSC 2YV5A 4YWMA 1QOFA 1LACA 1VF5C 2INDC 1TBEA 4LF8Q 4KZ0A 3A4RA 3CC2A 1I3QB 1Y1WG 3KLRA 2KC1A 4USAA 2K8CA 2ZNVB 5COYA 1PA6A 4LF4Q 4YCUA 1Q90A 2ZTDA 1E7VA 1TGZB 5JH5C 4O1NA 4EX5A 1NENB 1NJIC 2JU6X 3NUCA 2X38A 1XMQQ 3JW0X 4C3IG 4OZBA 3TIXA 1JC7A 3KWVA 4M8AA 3E9SA 1GG3A 4V190 3T4AC 1EYCA 3NQIA 4OXPA 1CHPD 4DUZL 1V43A 3GTKB 5LMUL 2WHIA 1WX7A 2F0TA 3QIAA 1IYFA 3QO2A 4DV4L 1Q0WB 2WXQA 1RCVD 1H9RA 2R7DA 3VA5A 4HIKA 2LZ6A 1HFNA 2ZEQA 3DHHC 1FD6A 4HR7B 1EQQA 3S1QH 4BY1H 5IE8A 2D3BA 2HTME 4LK0M 3JAMc 3PUYA 2VW9A 1SROA 1ML0D 1WY8A 2ZCCA 3K81C 3G71A 4ME5A 1STNA 5JEAJ 3DMUA 2ZW0A 2EKIA 1EY6A 1BCPC 1HZ5A 5K36G 3C8YA 2E2DC 2PNRC 5E6PA 3OIQA 3IAYA 2N0SB 1GJXA 4YHHL 2JA8B 1SMYD 3BYYB 3QB3A 4DR1Q 1PH1A 1DGJA 2NZ1D 4ZRQA 1UNSA 3M62B 3UQAA 3UI2A 4N8X1 1L4DB 3PIO3 1L6UA 3TP5A 4XGAB 1X65A 5C0XI 4V0BA 1PH9A 2NVXB 2K39A 2KDFB 3DHQA 5C4XH 1HNXL 2EXDA 1EO6A 4KY5A 2QKIC 4PNYA 5M9OA 3S24A 2K25A 2QIEB 4W9CA 1P7FA 5DAUA 1E3PA 3PLUA 3GQBA 1NBFC 1AW7A 4RMAA 4IUQA 2O5IC 4AQYL 2RCFA 3RUIB 3QR8A 3S14B 2FUG1 2NBVB 1RTOA 3CSFA 1I7HA 5IGDA 3IAS1 1YJJA 5I4DA 4KKUA 5J39A 2KK8A 4JPSA 5BO4B 3CQZB 5J18A 4FVMA 4JW0A 1SGHA 2FJ2A 2KCCA 1A63A 3A4SC 4M8NA 3Q0AA 3P2BA 4HJ8A 4CDCC 1NMGA 2H5XA 4NPSA 3CMEA 1FNWA 2NN6G 3K0XA 4DR6L 3BWUD 1TWCH 3PO3H 3D0FA 1XNRL 1Y8NB 4DR4L 3P4SB 1MHXA 1GB1A 1EY7A 2YTXA 2DAJA 1QCBD 1VQCA 4EQPA 3HOZB 4LF6Q 1C4CA 4S17A 4LJZC 1STHA 5CHFA 4MTNA 4A3IB 4W9KA 5BN5A 1BNZA 3X0WA 2D11A 1SE3A 4L5RC 3CW2C 3QC8B 2CW0D 4QCLA 3EFXD 1I94Q 2VUMB 2DJFC 1ICFB 4DR7Q 1I4RA 2KUMA 1XNQQ 1U5KA 3LGJA 4JI4Q 2GBJA 3WDNA 4W9LA 4EUTA 1VZ6A 3NUHB 2K01A 3TN2A 4K8JA 4O42A 1WGDA 4MSQB 2KHSA 1YJIA 4II2B 1L7YA 4G3XB 2B3GA 4JYAQ 1NY4A 3E6ZX 3SK6A 4NJ7A 3J81i 1VMCA 3Q24A 1DM0B 1K28A 4Y7NH 2BDNA 3PSEB 3VR2A 2Z9HA 2NR2A 3N6RA 2MPMA 4M0WA 1ISNA 2HD5B 4BWGB 1GNUA 2C7NB 3VTUA 3KFUA 2F3WA 1K53A 3QOJA 1N32L 2UU7A 2WWZA 3MTNB 3AH7A 1R4NI 2B2TC 3UQBA 5E1FA 2EYOA 1J5EL 4ITKA 2IHEA 3FKIB 4DBGA 1IBXB 4KN7C 2XVSA 3NBHB 2ZJPA 5C5MA 3TEYA 3QQ8B 1WVLA 2F0VA 2F1MA 2RA4A 3M7NA 2C9WB 2ZCBA 1JB7A 3SE0A 1OXUA 1BCPF 1TIID 1ZKOA 1OTCA 1PUTA 1VLBA 3HRDD 3ZKJC 1SSOA 1SAPA 2SNMA 1OGWA 1EF5A 2XBBC 1JB3A 2E75C 5CV5A 2WDRB 2PKOA 4PS8A 4WURA 3RI7C 1L2FA 3DVNV 3PIOA 1X54A 5EJWA 1MJDA 2QCZA 4PG3A 2E8GA 4RG1A 2NPTA 1EY5A 5LMUQ 3I56A 2G3QB 2HT1A 4DV2L 1WGRA 3CMMB 4HDQA 1B3QA 4DV4Q 3T51B 1N33L 3GTQH 2KHWB 3DWPA 1KFYB 3KQ4A 3GB1A 1RL2A 2A6EC 1F2RC 4CQNA 3NHEB 2MQHA 1ENCA 3JAML 1QOBA 2K6QA 4QMGA 3I7FA 4ZCKA 3DPDA 2AKWB 3NQTA 1H8CA 3OSOA 4RHSA 3D32A 1AFPA 1H9KA 3RNUA 1E2VA 2O2LD 3SK4A 3Q23A 3RNEC 3D3RA 3KBXA 3CCEA 1IYVA 3DQVA 2BKFA 2C5LC 2IX0A 4K5WA 2AQ3B 1F2LA 5FLXc 1D3ZA 1VDVA 5DCNA 2QC8A 1TIFA 2MJ3A 5G3LD 1TY2A 2IW3A 3LJ3A 2K3UA 3RNGC 4GNXC 3I4OA 4BBRB 1T5EA 4JBKA 2RGFA 2VRRB 4C80A 4N9F4 1PTOC 2MHVA 4AWJA 4E71A 2BTEA 2O6VA 2UXBL 2C9OA 1FNVA 3H94A 2KCMA 1YITA 1HNXQ 3JYUA 3H6NA 4EKUA 3C46A 5EE9A 1Q8IA 2EJMA 2JSVX 3ZJTA 4P16A 3FILA 4FXDA 3A9JA 4AQYQ 3KOJA 1SYCA 2J0KA 3DVGY 4JGHB 1FIQA 1MPEA 1WTHA 4FJYA 1ZXTA 1Q46A 2WXMA 2NVQH 3S15H 1WZ0A 1P1AA 4ANXA 3J81c 1S5FD 1IKMA 2ON8A 3TMPB 4XXEA 4BVUC 4I65A 2PEAA 3GTKH 1VZ7A 5BN3A 4I7ZC 4A3DG 3C2PA 4KHVA 1KH0A 2OT2A 1KOTA 1N60A 2JZZA 4DR6Q 1LABA 1ZE3D 4IWPA 1OEYJ 4IPCA 1TWFB 4AS1A 5DPRA 1XNRQ 2LI5A 4JE3B 1DXMA 3K8AA 2Y3AA 3BDLA 3KJPA 5JZEB 2K6DB 2K4KA 4NP5A 4KD4A 2N7DA 2WXPA 4A55A 3NP8A 2WX1A 3MP9A 3RR5A 1UELA 2OQ0A 4HRSA 4B08A 3MXPA 2EYHA 2IWHA 4HKQA 1YQBA 2NVYH 1LGRA 4HCPB 2MBBB 5C3XA 2L1AA 4LUVA 4EE2A 1AE2A 2K22A 3TS2A 4K3CA 4X3SA 1H9SB 1KTKA 1G51A 2G45B 2SNSA 2JA8H 5CBAE 3OOCA 3P63A 3UIPB 2KA7A 4A3JB 4TUUA 5C44B 2FXQA 4IUUA 5IGEA 4P2CB 3B0AA 2V1YA 1PFNA 4GN1A 2MQJA 2PNHA 3PF5A 1EIYB 3VRAB 1ZP0B 3A9KA 3HVDA 4IPGA 3NBIA 5IYCH 3KUCB 3Q3JA 1E8XA 5D7GA 1Q1BA 1QOGA 2GVAA 2CJOA 5JJLA 5JJZA 1CKNB 3HRZC 4LNIA 2I2YA 1MJEA 3WOEA 2A68C 3I91A 1DOIA 2MUYA 3L13A 3G6EA 1NDDA 4G57A 3QHTA 2YLMA 1X32A 2RQXA 1ILQA 4UAIA 3DEOA 1FCCC 3WCQA 1N32Q 3P4RB 5DEHA 3OW2A 2ZZPB 3J80i 4W9GA 3AFPA 3CQZH 2GLSA 1A2UA 1EIGA 3GE8C 4JI0L 1J5EQ 3W1YA 3MXUA 3KLSX 2MCNB 1M1KC 4KDLB 4HKZE 4OO1I 1RIPA 4JI3Q 5CV6A 1C4AA 1H9JA 1S5ED 4UY8C 3PHXB 4Z9CB 3AULA 3RLNA 4M8MA 5FOBB 1QOHA 1TU2B 1Z5SB 2NPTB 3P4QB 3KYHC 3DBRB 4GDLA 4IM0A 1O7ZA 2KDIA 1JWUD 4A3IH 2C7HA 3DCGA 1UE7A 4PQXA 3A74A 1XT9B 1JWSD 1TZOA 2ZJRA 4DV2Q 1PTOF 4QY7A 2QILA 3L0OA 1EY4A 1N33Q 2YU9B 5KIXA 2VUMH 4GS3A 3J9CA 3S17H 5AJ3L 3OIPA 3RN2A 2DYOA 1D4BA 2N9LA 4BBSG 2HQEA 1PFSA 1KL9A 4KTAA 2XK5B 4GB9A 3BZCA 1JOKA 1ZPSA 3W5OA 3GTGH 4GZYC 2Z0DB 3SHQA 3HKZG 3PCOB 3GTJB 5LNK1 1WGGA 1WXSA 3J81j 3VRBB 2F0MA 1FGBD 1K8MA 2LS01 3JAME 3LB8C 2Q8TA 2BB5A 2BW2A 4TV3A 3I70A 1BOSA 3E56A 4OO1H 2R7ZB 4YTPB 1GVPA 3CHBD 1ENAA 2O6VB 4IDIA 2BH8A 4MELA 1Q1EA 3U8ZA 4A3EG 1PH8A 1VQIA 3OJ4B 2MHJA 3UI3A 2K04A 2C60A 4Y52H 2KNBA 2JE6I 4CKEA 1JQYD 3FILB 1B2TA 3DWMA 2ZXRA 4HPLB 1RF2D 4A8XC 3ULLA 2F0EA 5JHBA 1L1OC 3QJYA 2RDBC 3NVWA 1YI2A 5KGUA 5KNCA 3DM3A 4MACA 2CFMA 2LFIA 1PRTC 1N9WA 5IP7G 2FCNA 1Y8RC 1OQRA 5E7NA 2RDFA 1N8RC 5KNDA 3TP8A 5M3MB 1K3RA 1UE5A 2H1EA 3TREA 3J81L 2IGDA 5M5YB 4NNJB 3U7ZA 4YCWA 3VFKA 3G6JB 1GOZA 3N30A 3S2HB 2MP2A 1TS2A 1IKLA 1CSPA 2AL3A 1H9MA 1PH4A 2B2UC 1PZJD 4ZYNA 2BE5D 4MGZE 2CU1A 2HQLA 2PPBC 1LT5D 3J80c 1JWMD 4C1NK 2RVLA 4F8MA 3CF6E 2J0JA 2M0AA 5BMGA 2E2HB 2ZNVC 1CKMA 2G5DA 4ILWA 3ZNGC 2AL6A 3AEBB 2WXOA 2JA6B 4GDKA 2JK8A 2K1FA 1TKYA 4ARCA 3FP9A 1X6OA 1F2ZA 1SNPA 3NSWA 2N7EA 1D5ZC 3HOUB 2JXTA 2ASBA 1Y69U 3ZNHB 2I07B 4LNQA 4WWNA 2KMAA 3CCQA 4FULA 2CVRA 2KEEA 3FRPB 3CU7A 3HOWH 1QZHA 3Q8DA 4ZHOA 2O5JC 4KGTA 4JK1C 2ZTCA 4FYDA 1NCVA 5T1IA 2KCTA 5GAHC 3PVLA 2EZVA 1WRIA 2N3SA 3AYHB 3LNNA 1CJEA 1N62A 2KECA 1P98A 3IT6B 4WJQA 1KABA 1J8IA 1PH6A 4UP9A 1YJNA 3ZVVA 1F0ZA 4PMBA 2KVRA 1GPXA 2VH2A 1VQFA 3TP6A 4R4OA 2M8SA 4DK6C 3HOVG 2C35B 4GLAC 1C77A 3GS2A 2HCCA 3IBEA 4KDIC 3G48A 2ZPYA 4CKBA 4JI0Q 4JC0A 1LTAD 3S1QB 1RYJA 4BY1B 3J7YW 1EQRA 4YCVA 2N9KA 4FXKC 3HM3A 3VUWA 3VYUA 1YZ6A 5CC4A 4NJ6A 1SNQA 1WTWA 5LL6S 4ZLTF 2HDLA 1WGHA 2N4FA 2NVUI 4K7UA 4A3MH 3QX1A 4NB3A 4CHTB 5LHY1 1PGAA 1WH3A 1Y1VB 1IUEA 2A4ZA 2Z1CA 3VH3B 2A69C 2ZXPA 4WJWA 5ELCA 1FJGL 2PZTA 1NYQA 2EELA 4LJPB 3ALBA 2L55A 1KLGD 2YYZA 1N61A 2J0TD 1STAA 2RKSA 3VR5A 1G6ZA 2KQ4X 2V3PA 4AIMA 3PO2H 4PZ7A 1CSQA 1ZXHA 1FXAA 2F0GA 2BKRB 1C8CA 2LHEA 2MP1A 5AJ3Q 2Y0SB 5C4XB 3FKYA 3SU8X 3ITPA 1PFDA 4TKOB 4OWTB 1IGCA 4B3SQ 3MC8A 1CQVA 1YHAA 3QWZB 4C56C 4PYUA 4A3JH 1QZGA 3CC7A 1C9FA 4N9PA 5GADC 1R4MI 4F87A 1PQSA 2JXXA 1PRTF 1Q8KA 1WM3A 1V1PA 2F0UA 2L8JA 1B3AA 1WYGA 4C7ZA 2WB1G 3RZDH 3O13A 4DHJB 3T1HL 2LMCA 1YMHE 4WQMA 5HI1A 4G7HC 4HVBA 4JQWC 4G7OC 1WR6E 4RAUC 2BH2A 3HG9A 1HA5A 3ZO5B 1SFOH 1FL0A 2R6GA 5G55A 4N6EB 1TWCB
chains in the Genus database with same CATH topology
3PO3B 4REZA 2IGGA 1GHJA 1LO5D 1N63A 4XDCA 1ZDVA 5IT9L 1EQTA 1HQRD 1PGBA 5E4XA 4HEDA 3SFDB 3MVVA 3M85A 1A2TA 3H09A 1PLFA 3MFGA 4A3KB 3CIRB 4L23A 3C3LA 3IKJA 5MPOA 5G5HA 1RHPA 3MEHA 5E4WC 4L8JA 2KEDA 3K5LA 1IGDA 4RCOA 4UDUC 2WU2B 3WOFA 1UAPA 4ABNA 3AE8B 2B63B 1JE4A 4FP5D 4LTUA 2VXWA 1CT1D 1HEZE 2K5QA 3N52A 3MHZA 4RGTA 4Q2JA 2C5CA 1O80A 2SOBA 1ESFA 2GI9A 4Y7NB 4IFDI 3FEWX 2F0QA 3I73A 5BYRA 2OXPA 1YQ4B 1EZ6A 4XWWA 2QCPX 2BE5C 4TQ0A 2F0LA 2MH7A 4FF2A 4KKTA 1ENFA 1UGJA 3A7LA 2DN8A 1Z7TA 4ZYSA 5BMIA 2EVBA 1QG7A 1KDAA 1VMPA 2VB3X 1ZUD2 3P42A 4HSVA 4DK0A 2Z4IA 4R9WA 4OGQC 1BR9A 1ROEA 4L6TB 3LWUA 4KJOA 3GTQB 3DEPA 1AEXA 1KLUD 4IFDH 1DD2A 1J7BA 3K57A 4PT5A 1MSHA 3I8ZA 1EY8A 1HA6A 3AE6B 4EQNA 1F2RI 4Q5VA 4HJGE 1HUNA 2D5GA 5EKLA 1TKWB 1F2MA 5HHDG 1TS3A 2R92B 1Q10A 3GD7A 1S4ZA 3BZDB 3VA7A 3NVZA 3PUWA 4HCEA 5I2XA 3NRZA 1SYFA 3I57A 1EU4A 4ZK9B 4YSXB 1EEFD 2G9HD 3X3NA 4CJ1B 2X6GA 1XCQL 3V3XA 4K6DA 2F0HA 4FF4A 2NVQB 3S15B 4QIWB 2HDEA 1I4QA 2E3TA 1C48A 2KOLA 3E0JA 2XNAC 3C1FA 1B9RA 1ICWA 3GV3A 4CJ2C 2BS4B 1WWTA 5AFWA 4D2KA 2MEKA 3NTHA 2WDVB 1A6XA 2J42A 5D3DA 2FHTA 1CQFA 3A54A 1PXUA 1IW7D 3AM9A 5IGGA 1HTPA 1B1ZA 5IT9E 1TT2A 2NVYB 1LTBD 4ZQ3A 5D65A 3BK2A 1SYBA 1ESRA 1MVKA 4AYBB 1WCMB 2KQ3A 2MGSA 4ZUIA 4IUVA 5A2QE 1V8CA 4NZLB 4DGZA 4RKLA 3KUPA 4PMCA 1FNUA 1R7SA 3FDTA 3FPPA 3AE4B 4TRDA 5CORA 4DNTB 3AE3B 1TYGB 2EYMA 1J9OA 4C3HB 1G91A 3S9WA 1NUCA 4KGSA 2WXRA 1UWMA 2F0FA 3K7AB 2B2YA 4H44C 3K6OA 5EKIA 5KNBA 1EY0A 3CRLC 1BUIC 3NHHA 1OFFA 2F03A 1K52A 3U4EG 4KMUC 4YTMB 5NUCA 2QMTA 5C0XH 4ZOHC 1SB3C 3DUZA 2PMVA 4KD3A 4CGYB 3S17B 2F0WA 1RWSA 1LT3D 4H0LC 3CRKC 3W5VB 2KN4A 2WXJA 2BS3B 3GTGB 2B76B 2INNE 2WU5B 3FAHA 1SIJA 2AUKA 2QEJC 3AMZA 3NXWA 1J7AA 2OHFA 2LHDA 4JWSC 1XXGA 1ZOYB 3AE7B 4H2AA 4N58A 5EE3A 1W6KA 4ARIA 5CV4A 5IIFA 3G7LA 4K5VA 2RPVA 4DXGA 2A6HC 3BDCA 1D5MC 1U4MA 4ZRZA 3IL8A 4HMJA 2EYLA 3EJIA 1RODA 3VR4A 5JPMC 1XLQA 2Y5PA 4ID6A 2IX1A 5JXVA 4PMWA 1K8OA 3A55A 1HQMC 2K5WA 4DAPA 4YTNB 2BOSA 3ZJUA 1G291 5BMHA 2J4XA 1STEA 3D4RA 5C3EB 1WD0A 1A70A 2WAQB 2LY7A 3T16A 1S5DD 2PTLA 3GP7A 2RSOA 2IX3A 1CHQD 3HOYB 1JCKB 3HOWB 1NR2A 3T3OA 3MXGA 1OXTA 3NK9A 5CR3A 4FXGC 3VR3A 1VDZA 1GUGA 1BDOA 1M8AA 5F2DA 4A6QA 3VQIA 1GUTA 2JP1A 1EIHA 3D31A 1Q12A 1SMYC 2W3RA 1S5CD 1DOXA 4OIKA 3T53B 4LLGM 1NI3A 2R61A 1EEID 3H91A 1SYDA 3LWEA 1EYDA 1FM0D 4RGMA 2RMMA 1DOLA 4QF4A 4ULLA 4A3MB 1YNTE 3QWNA 4FF3A 1FEHA 1R4PB 1C79A 4RNAA 3EVQA 4OHJA 2WXFA 3PZ8A 1ACCA 5ELFA 1CI3M 3OMGA 1DCZA 2B2TA 1JR0D 3PO2B 4U673 4EVOA 3Q8CA 1CFMA 5FKAC 5LL6X 3NS1A 5FO8B 2E2IB 3GO5A 1JW9D 1CTMA 1I4HA 3PMFA 5JEAH 1YNND 3E5SA 1CK1A 2INPE 3B9JA 2NTTA 3BVZA 3L9AX 4FNFA 2SAKA 2CQAA 2F0SA 1TQOA 2NBFA 3RZDB 4XE0A 1QWYA 2CW0C 1QJOA 4EGVA 2ID0A 2EYJA 2WXNA 2FMCA 4IUTA 1SFOB 4TMAB 3VR8B 5K5PA 1BCPB 5AUIA 1HHVA 3A7AB 1FFVA 2H89B 3P1MA 2RDGA 2DLBA 4A3FB 1FRDA 5IOCA 4RA8A 1B4OA 2W55A 3NE5B 4A3GB 1C76A 1EWHA 3SDZA 1EZ8A 1I6VC 1LTTD 1QT9A 2VZKB 2F0IA 2XN9C 4A3BB 3ND9A 1FYCA 1LTGD 3HEJA 1IYUA 3A8KE 1GUNA 1SNDA 3QG1A 3W2DA 3M7GA 1ILPA 1OO9B 3Q6SA 2TSSA 3RZOB 3BYTB 3H8HA 2BA0A 3TZDA 2XRQD 4ZKCB 3W5UB 4TQUS 3FMCA 2DYMA 3K5NA 2J7ZA 1PZID 1SJED 1SSNA 2IPKD 4HMIA 1DZ1A 5FLXL 2J53A 3BS1A 3TEXA 3H6MA 5D3IB 2WP8J 3R2TA 1DOYA 4DNRB 4HN7A 3HS0C 1SEBD 2F0DA 1N5WA 3MA2B 2JSOA 1VF7A 5IGCA 2D2CC 1KNEA 3U2SC 2V4IB 2D5DA 2L1BA 3SHLA 4HTHA 4K2LA 2JEAI 1JALA 2D9UA 2H4OA 4XYOA 3SR6A 2D62A 5K36H 2NN6I 1QE6A 2B8FA 1RM6C 3OHXC 4A90A 2F4IA 2M2LA 2E76C 1XTCD 3C1EA 2DY7A 4XQNA 1QQRA 1JMLA 3I9V1 1MBYA 2DWQA 3OW7A 2F3VA 3L7ZC 5C3JB 1QOAA 4KV6A 4XYQA 3BIID 2KMMA 4WWMA 2M19A 3X3MA 5HGTA 2SEBD 4HSPA 2K1BA 5I6WA 5EPKA 2OEOA 3VYSA 1KDBA 4C3JB 3W3AA 1FO4A 2FBWB 2I46A 5M3FB 4H7BA 4ODGA 1E9MA 5C0XG 2PW7A 1Y8OB 4IUNA 4C7YA 4TQ1A 3Q8BA 3RLFA 1W6JA 4QUFA 2EYFA 4HEA1 3AE1B 5KYIA 2NN6H 3K59A 1F2YA 3Q8EA 3I4LA 3HGBA 4TSSA 3KLSA 1JQ4A 4WAFA 3SK8A 5I6YA 3PIP3 2YEPF 5CMDA 2WINB 1J7CA 2ACZB 3K58A 2L52A 2FFKB 3AE5B 2HDMA 3I4MB 1V8QA 1I4GA 3FVQA 4BBSB 4GDLB 3S1RB 2KWDA 2WACA 5D14A 3F2UA 4BY7B 2K9XA 2R93B 4B0MA 2M56B 1PTOB 2WQYB 2L83A 3SEBA 2QDBA 1HUMA 1XYIA 3AEFB 2W54A 2QJLA 1TS4A 3DWQA 3SXHA 5JVG3 1XWEA 2F0NA 1GB4A 1L6VA 3MC0B 1I4PA 1WGKA 1XF5L 3AECB 2V3NA 1II3A 1ET9A 1RFKA 2JX5A 3BG3A 3PV0A 1SDFA 4X3KA 1B44D 2ICIA 1L0YB 2RBMA 5G3LF 4YWGG 1JICA 1X3QA 4XT3B 1BMLC 1O78A 5C5LA 1VRAB 4N9TA 2B2UA 3RPFC 2MJ8A 5M5XB 2ZXOA 4XT1B 3VYTA 1AN8A 5FLXE 4NW2A 4RHRA 4US8A 1HCZA 1HRJA 4L1BA 1TWHB 3A8IE 5TSSA 1WTXA 4H13C 2JYEA 5AUKA 5C4ZA 4A9AA 1CZWA 4Q0FA 3NTIA 5C6AA 1BCPD 4F7XA 3KWLA 1QILA 3RMHA 1GHKA 2F0OA 3TMEA 2K7VA 1L4ZB 5C0XJ 1UUPA 2L5TA 3R93A 2OEDA 2XRSD 1RTNA 4EQOA 3NWSA 3KBGA 3J81E 3DWGC 4IALA 2FMMA 3VR9B 2AX5A 3J80L 1B50A 4NDXA 4KKSA 2WNMA 2VZKD 4GDKB 3MJ5A 1CZPA 2RSNA 4LK1C 5HFYA 2Q8RE 5FR3A 1I50B 4KX6B 4XIGS 1O7LA 4QUCA 4NMZA 4DA2A 1G2TA 3NZ3A 4WIPA 1SYEA 1Y56A 4JWUC 2E74C 1L5PA 1DJRD 4J6HA 3D8GA 2EY6A 3AEEB 2AWNA 1EYAA 3VR6A 3BVMA 2WIIB 1SNCA 2PZWA 1WXQA 1V97A 3DWAA 1JWBD 4A93B 3CKIB 1R4QB 1FD7D 1ZDXA 3L4PA 1PDXA 1F9RA 4ZHPA 3R2IA 3NPPA 1D5XC 4K6LA 5KRUA 1XX8A 3H0GB 5JVH3 2WP9B 2WKCA 5JPNC 3NVYA 1PFMA 2EYPA 2BB6A 1FCLA 2Z8LA 1SE4A 5J22A 3SFEB 5EE1A 2XSCA 4FO2A 4C3HG 3MAQA 2JQRB 5E6JA 2BBCA 3W9CB 2DNCA 1NAPA 1Y8PB 4DXFA 2JEBI 4GLSC 4MT5A 1BQQT 1LTSD 2PW5A 3MFYA 4XWTA 1X3PA 1XLOA 3TEZA 1E2WA 1LT4D 2ENBA 2H88B 2PYKA 1CZGA 2AQ1B 4BA1I 1PRTB 1ZEQX 4K14A 2CU3A 1AWDA 4JX1C 1V1PB 3ZQ4A 3GV6A 3AU7A 3TP7A 3EUB2 2PCFB 1K83B 2LMCB 5H92C 1UEAB 4FF1A 1C4QA 3LXFA 1NR4A 4J8QA 3Q8AA 3ZGZA 5EBCA 4DU9A 3AMUA 3D4WA 4KI0A 2PLPA 4HAEA 3R3OA 3CWIA 2XWJB 1T6BX 4MIUA 4DQOC 1EQVA 2JA7B 3S2DB 4WORA 3DM1A 3D4DA 4R8NA 5EPJA 1IBXA 2ICEC 2A6ED 3NBHA 1AZQA 3HUIA 1MHHE 4OO1G 3OMCA 1BXTA 1STBA 4IN3A 3T13A 5I2YA 5JAVA 1T3QA 4IOIE 1PTOH 4KN4C 3I4NB 4DF7A 2L11A 2N7JA 5J1ZA 2X6LA 3TEWA 1XLPA 1PTOD 1TR5A 3ONAB 4L63B 2Q8IB 3J80E 1LTRD 2IL8A 5CGKA 2BT6A 2K03A 3P20A 3J7AV 2LFNA 4PV1C 2EY2A 1VCIA 4KHZA 2QSDA 1DONA 2CJNA 3BVGA 4IKGA 1GUSA 1AP0A 2K05A 1WTOA 1CA6A 5DNFA 5T1GA 4CKCA 1RJTA 1QB5D 2ONQA 2F0PA 1F9QA 5ELEA 2F0KA 1QKZA 4HCSA 1PYWD 1ET6A 5ELDA 5CBEE 2LEKA 2MJDA 1E6EB 1FRRA 1B53A 3HOXB 2DY8A 2NTSA 4XDDA 1U4PA 3IXSA 5CV7A 2B2WC 2PW9A 1OQQA 1Y1WB 1DOKA 1B9NA 4NKLA 4F88A 2K33A 1D2BA 2A68D 1EFID 4C3IB 3L3OC 2L9HA 1SE2A 1VZ8A 2LUMA 1P7EA 1H9SA 5IGBA 4KKIA 3OPOA 2MJEA 1C4PA 1TVXA 2NYZD 2QF7A 1E2ZA 4ZKBB 2R3ZA 4XQJA 3K5MA 1HXYD 3OWEB 3TBIB 2K5PA 2EXZA 4QB4A 2IGHA 3HZXA 3I3CA 4E6IA 1KNAA 5BYSA 5EBDA 4IUPA 1DYQA 3IFTA 1RKNA 2NVTB 1FFUA 4YT0B 4CJ0B 1XEEA 2PQEA 4WFN3 5FO7B 1TKGA 1STGA 4RCNA 1YQ3B 3V2TA 2LJIA 4CBVA 2WXHA 2A5HA 3OWFA 3TDQA 1EWYC 1TS5A 2DBYA 1JOOA 3IAM1 3U9OA 4G7ZC 5GXGB 2EPBA 4OZAA 1GXDC 3P7JA 1IW7C 1M4VA 2B2VC 1JROA 5EQ0A 1O7YA 5KEEA 3AEGB 3V96A 1IL8A 4OZCA 1PRTD 2B2WA 5FK9C 4XTCS 4RF1A 3U52E 2BYTA 5M5WB 5CV9A 1WTVA 2B8GA 1BUVT 3M4OB 4BS9A 4OIJA 1EU3A 1LV9A 1RDPD 3Q69A 2I38A 4NAMA 2E2JB 4IQZA 3AV8A 1AYFA 1Q3LA 3M3YB 2EY5A 2G9DA 3EROA 1PDQA 2EE1A 2L32A 4KKJA 1FR3A 5EKKA 2KACA 4HROA 4NAWB 4MHEA 1RD9D 1L0XB 1TJEA 2NMQA 2O4XA 2OF1A 4K2KA 4MN3A 4RGNA 4IFDG 2GA4B 4B0EA 2L4NA 1XCTL 5DM73 4B9XA 4L2YA 5BYQA 1F77A 3HVZA 1YNJD 1TWAB 4DK1A 3Q22A 3M4YA 4P6VF 4K5XA 4ZUJA 3I72A 4J3OD 1S5BD 2K0PA 3K0YA 2WXGA 5C2TB 1YN5A 2AUJD 4OL7A 4N59A 3PUVA 2WXIA 3H3VC 1NVID 1QLBB 3EQLC 1U9RA 2VNUD 1PGXA 1ZYRD 2K5DA 4B9WA 4KJNA 4RGOS 4C3JG 1FXIA 3BK1A 4LMQD 2A69D 1BF4A 2ZT9C 2J52A 1V1OA 4JBWA 3KK7A 5BN4A 4RH6A 2VB2X 5HURA 2B2VA 2BS2B 4C2MB 3Q8FA 4C1NI 4IZ8A 1QNKA 4X3UA 2XIWA 3U9SA 3DXJC 4FXCA 4KY6A 1MI0A 2KJXA 1EM7A 3QOLA 4WH4A 1VJKA 4US9A 1GAQB 1E7PB 5H8YE 1UWXA 5CYUA 1QF6A 3P75A 1MGSA 3HP3A 2W3SA 1ONLA 3FC4A 2FE8A 1WTQA 2F0JA 2SDFA 3MZ5A 4BA2I 5E3FA 5HG2A 1PFBA 3LX0A 3A8JE 3N9YC 3IFDA 4A3DB 2B39A 2WV6D 3AEDB 4MM3B 1BBXC 3VYRA 3S1MB 5IGFA 3ZYYX 2M00A 2PZUA 1QNUA 1I6HB 3T56B 3RD4A 1TY0A 3GTOB 1T5XD 2BCOA 2JYOA 2WDQB 4IFDJ 3B2FA 2FINB 1G8ZD 1WTRA 3R8BA 1PMRA 1A3TA 1CM9A 4KGRA 3SK5A 3TSSA 4RF0A 4NJCA 4RKBA 1YN4A 2K28A 1SNOA 1YN3A 1A15A 1KAAA 2WKDA 2ZW1A 2JYTA 3KF8A 4R3DA 2TMPA 1SYGA 2Q5WD 1HFGA 3AEAB 2NB0A 2Y5CA 2KAJA 2L12A 2IDYA 5C4HA 1KF6B 3URYA 2V0GA 3PO0A 1F9PA 1IHZA 3SR1A 3B2GA 3SVMA 4OW0A 4R8IA 1JOQA 3ABVB 1SF0A 4AQ7A 4YSYB 4KY7A 2A74C 1AZPA 3PZ7A 1WD1A 2EY1A 3I90A 2LGIA 3TUOA 1YNNC 3RFZB 3PUZA 2PVGC 1EL0A 1C78A 1XLNA 4RFBA 2AQ2B 1A3UA 3GTMB 1SJHD 1G2SA 2JZPA 3P1HA 1YNJC 3HKZB 2HCIA 1DOMA 2KDMA 3TZUA 4YXDB 1XO3A 2EDGA 5A35A 5EPLA 2WXKA 1JORA 5KYLA 1D1KA 4DAVA 2CHBD 4KK7A 4MH8A 1GUWA 4J1MA 3EA6A 3ERQA 2PIAA 1LT6D 1ZYRC 4A3EB 5ISRA 1STYA 1Z47A 1KRHA 1SXTA 1E0ZA 1WTPA 5CV8A 3NTKA 3D6WA 2PVOD 1L0VB 1MI2A 1GUOA 2HUGA 1E10A 1LLRD 2BA1A 3ND8A 1E0BA 1SBBB 3GTLB 2V4DA 2IT1A 3EGRA 1MD2D 4YSZB 3A56A 2KVMA 4S3SA 1U4RA 1TKEA 5C4JB 5FO9B 1F9SA 1JWAD 1R9TB 4WRDA 2G1EA 4DAYA 3MXNA 4DN4M 3J7AF 2X69A 2KCNA 1PZKD 1VR9A 3MHBA 1HTLD 3FPUB 3ETRA 2LKVA 4IURA 3AE2B 4XDXA 4XQQA 1OXVA 4ZRPA 4K8IA 5I9OA 3AB9A 3NWTA 1D6EC 3W1SA 2Z4HA 1NSNS 5A2QL 3NVVA 1OXXK 1Z6HA 2EOTA 5ELBA 3S1NB 3ZJVA 3P4PB 4RWSC 4DFAA 1K51A 1N5XA 5C3WA 1EOTA 2JWUA 4U68A 3HOVB 2EJGC 5I9PA 2A73B 1EY9A 4ZAIA 3GTPB 3S16B 1NYRA 5EE0A 1K50A 5JOBA 2DNEA 1FMAD 3T3NA 4YIJA 2K32A 2N55A 3LYYA 1EWCA 1MSGA 2PO4A 2YEPB 1JRPA 1LTID 5JEAG 2W82A 4G4KA 5EGTA 3AB5A 3IT4B 1CA5A 4LAAA 1WSPA 2K6AA 2NWGA 2E6XA 4M1UB 3BDOA 2RDHA 3MTSA 1U4LA 3K5OA 1SNMA 3V05A 2L0CA 2XWBB 1ZXIA 1TWGB 5T8IA 5IODA 2M9VA 3RUZA 3AN1A 3MWYW 2GRIA 4OVZA 1BO0A 2JXMB 1B9MA 2EJFC 2WS3B 2N88A 1KDCA 2WB1B 2NUCA 4X3TA 1HPCA 2WXLA 3AE9B 3PUXA 1D1IA 3D6CA 1NEKB 1A3VA 5DM63 2PMZB 2JA5B 2B2YC 2BDOA 5G5GA 2IJ0A 2WLBA 1I4XA 1HZ6A 2AWOA 2A6HD 1OXSC 1QOFA 1LACA 1VF5C 1I3QB 3KLRA 4USAA 5COYA 1Q90A 4O1NA 1NENB 2JU6X 3NUCA 2X38A 4C3IG 4OZBA 1JC7A 3KWVA 4M8AA 3E9SA 4V190 3T4AC 1EYCA 3NQIA 1CHPD 1V43A 3GTKB 2F0TA 3QIAA 3QO2A 2WXQA 1RCVD 1H9RA 3VA5A 1HFNA 1FD6A 4HR7B 4LK0M 2HTME 3PUYA 1ML0D 4ME5A 1STNA 5JEAJ 3DMUA 2ZW0A 2EKIA 1EY6A 1BCPC 1HZ5A 5K36G 3C8YA 2E2DC 2PNRC 3OIQA 3IAYA 2N0SB 1GJXA 2JA8B 1DGJA 1SMYD 3BYYB 3QB3A 2GB1A 4ZRQA 2NZ1D 1UNSA 3UI2A 1L4DB 3PIO3 1L6UA 3TP5A 5C0XI 4V0BA 2NVXB 3DHQA 4KY5A 2QKIC 4PNYA 5M9OA 2QIEB 1P7FA 5DAUA 3GQBA 1AW7A 4IUQA 2O5IC 3S14B 2FUG1 1RTOA 1I7HA 5IGDA 3IAS1 1YJJA 5I4DA 4KKUA 5J39A 4JPSA 3CQZB 4FVMA 2FJ2A 2KCCA 3Q0AA 1FNWA 2NN6G 3BWUD 1Y8NB 3P4SB 1GB1A 1MHXA 1EY7A 1QCBD 4EQPA 3HOZB 1C4CA 4LJZC 1STHA 4A3IB 5BN5A 1BNZA 1SE3A 2CW0D 4QCLA 3EFXD 2VUMB 1I4RA 2KUMA 3WDNA 1VZ6A 3NUHB 2K01A 3TN2A 4K8JA 4O42A 2KHSA 1YJIA 3SK6A 3E6ZX 1VMCA 3Q24A 1DM0B 2BDNA 3VR2A 3N6RA 2MPMA 4M0WA 4BWGB 2F3WA 1K53A 3QOJA 3AH7A 2B2TC 5E1FA 2EYOA 4ITKA 3FKIB 1IBXB 4KN7C 2XVSA 5C5MA 3TEYA 1WVLA 2F0VA 2F1MA 2RA4A 3M7NA 1VLBA 3SE0A 1OXUA 1BCPF 1TIID 1ZKOA 1PUTA 3HRDD 1SSOA 1SAPA 2SNMA 1JB3A 2E75C 5CV5A 2WDRB 2PKOA 4WURA 5EJWA 1EY5A 3T51B 3DWPA 1KFYB 3KQ4A 3GB1A 2A6EC 1F2RC 4CQNA 3JAML 1ENCA 1QOBA 4QMGA 3NQTA 3OSOA 4RHSA 1AFPA 1H9KA 1E2VA 2O2LD 3SK4A 3Q23A 3D3RA 3KBXA 1IYVA 2IX0A 4K5WA 2AQ3B 1F2LA 1VDVA 2MJ3A 5G3LD 1TY2A 2IW3A 2K3UA 4BBRB 1T5EA 4C80A 1PTOC 2MHVA 2BTEA 2C9OA 1FNVA 3H94A 3C46A 5EE9A 1Q8IA 2EJMA 2JSVX 3ZJTA 4P16A 3FILA 4FXDA 1SYCA 1FIQA 1MPEA 1ZXTA 2WXMA 1S5FD 1IKMA 2ON8A 4XXEA 4I65A 1VZ7A 5BN3A 4I7ZC 3C2PA 4KHVA 1KH0A 2OT2A 1N60A 1ZE3D 1LABA 1TWFB 4AS1A 4JE3B 1DXMA 2Y3AA 3BDLA 4NP5A 4KD4A 4A55A 2WXPA 3NP8A 3MP9A 4HRSA 4B08A 3MXPA 2EYHA 2IWHA 4HKQA 5C3XA 2L1AA 4EE2A 2K22A 4X3SA 1H9SB 1KTKA 2SNSA 5CBAE 3OOCA 3P63A 2KA7A 4A3JB 5C44B 4IUUA 5IGEA 4P2CB 1PFNA 3VRAB 1ZP0B 3HVDA 3NBIA 5D7GA 1Q1BA 1QOGA 2CJOA 5JJZA 3HRZC 2I2YA 3WOEA 2A68C 3I91A 1DOIA 2MUYA 4G57A 1X32A 2RQXA 1ILQA 4UAIA 3DEOA 1FCCC 3WCQA 3P4RB 5DEHA 1A2UA 1EIGA 3MXUA 3KLSX 4HKZE 4OO1I 1C4AA 5CV6A 1H9JA 1S5ED 4Z9CB 5FOBB 1QOHA 1TU2B 3P4QB 1O7ZA 1JWUD 4PQXA 1JWSD 1TZOA 1PTOF 2QILA 1EY4A 2YU9B 5KIXA 3J9CA 3OIPA 2DYOA 1D4BA 2N9LA 2HQEA 4KTAA 1JOKA 1ZPSA 4GZYC 3GTJB 5LNK1 3VRBB 2F0MA 1FGBD 1K8MA 2LS01 3JAME 3LB8C 2Q8TA 2BB5A 2BW2A 3I70A 1BOSA 3E56A 4OO1H 2R7ZB 4YTPB 3CHBD 1ENAA 4IDIA 1Q1EA 3UI3A 2K04A 2JE6I 4CKEA 1JQYD 3FILB 1B2TA 3DWMA 2ZXRA 1RF2D 4A8XC 2F0EA 3QJYA 3NVWA 5KGUA 5KNCA 4MACA 2LFIA 1PRTC 1OQRA 2RDFA 5KNDA 3TP8A 5M3MB 2H1EA 3J81L 2IGDA 3U7ZA 5M5YB 3G6JB 1GOZA 3S2HB 1TS2A 1IKLA 1H9MA 2B2UC 1PZJD 2BE5D 2PPBC 1LT5D 1JWMD 4C1NK 2RVLA 4F8MA 2M0AA 5BMGA 2E2HB 4ILWA 3AEBB 2WXOA 2JA6B 1TKYA 4ARCA 1F2ZA 1SNPA 3NSWA 1D5ZC 3HOUB 2JXTA 1Y69U 2I07B 2CVRA 2KEEA 3FRPB 3CU7A 4ZHOA 2O5JC 4KGTA 4JK1C 4FYDA 1NCVA 5T1IA 2EZVA 1WRIA 3LNNA 1CJEA 1N62A 2KECA 3IT6B 1KABA 1J8IA 1F0ZA 4PMBA 1GPXA 3TP6A 1C77A 3GS2A 2HCCA 4CKBA 1LTAD 3S1QB 1RYJA 4BY1B 3J7YW 2N9KA 4FXKC 3VYUA 5CC4A