1EU4A

Crystal structure of the superantigen spe-h (zinc bound) from streptococcus pyogenes
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
204
structure length
204
Chain Sequence
NSYNTTNRHNLESLYKHDSNLIEADSIKNSPDIVTSHMLKYSVKDKNLSVFFEKDWISQEFKDKEVDIYALSAQEVCECPGKRYEAFGGITLTNSEKKEIKVPVNVWDKSKQQPPMFITVNKPKVTAQEVDIKVRKLLIKKYDIYNNREQKYSKGTVTLDLNSGKDIVFDLYYFGNGDFNSMLKIYSNNERIDSTQFHVDVSIS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Conservation and variation in superantigen structure and activity highlighted by the three-dimensional structures of two new superantigens from Streptococcus pyogenes.
pubmed doi rcsb
source organism Streptococcus pyogenes
molecule tags Immune system
molecule keywords SUPERANTIGEN SPE-H
total genus 60
structure length 204
sequence length 204
ec nomenclature
pdb deposition date 2000-04-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01123 Stap_Strp_toxin Staphylococcal/Streptococcal toxin, OB-fold domain
A PF02876 Stap_Strp_tox_C Staphylococcal/Streptococcal toxin, beta-grasp domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.110 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1eu4A02
3.10.20.120 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1eu4A01
1JCKB 1D5ZC 1SXTA 2NTTA 1PRTD 1CHPD 1BXTA 3OWEB 1LLRD 1XTCD 2J4XA 2RDHA 2G9HD 4ZYSA 1LT5D 3TSSA 1S5ED 1FNUA 5TSSA 4Z9CB 1EU4A 3R2IA 4RGNA 1TS4A 4RGOS 4TSSA 1SJHD 3BVZA 1EEID 3EA6A 1M4VA 1B44D 1EWCA 4DXGA 1SE4A 5ELBA 1EU3A 1BCPD 4BWGB 1UUPA 4RGTA 1ESFA 2Z8LA 3URYA 1XXGA 1I4PA 2XRSD 1AN8A 3BVMA 5D3DA 3KLSX 3DWPA 1I4HA 1V1PA 2NTSA 1LO5D 5FK9C 3GP7A 2CHBD 4RFBA 1ET9A 1L0YB 1GOZA 4RCOA 1LT4D 2AQ2B 1HXYD 1F77A 1FD7D 1BCPF 1LT3D 1TS2A 2XRQD 4DXFA 1D5XC 1TS3A 2IJ0A 1UNSA 5I4DA 1PRTB 1V1OA 3R8BA 4L63B 2AQ3B 4RHRA 1LTSD 1PRTC 3R2TA 1I4RA 2WV6D 5ELFA 5ELEA 1FNWA 1BCPC 4OHJA 2RDGA 1EEFD 1DYQA 1RDPD 5ELDA 1ET6A 1YN3A 1L0XB 1LTTD 2QEJC 5FKAC 1CHQD 1HA5A 1PZJD 1I4GA 1PZID 1RF2D 5D3IB 1LTID 5ELCA 2SEBD 4C56C 3BZDB 3MC0B 2IPKD 2O2LD 1CT1D 1S5CD 1EFID 4RGMA 1KLUD 1PRTF 4RHSA 1S5BD 1RD9D 1JWUD 1KLGD 1LTGD 1JR0D 1S5FD 1B1ZA 2QILA 3BVGA 1SE3A 3DWAA 1BCPB 1JQYD 1SE2A 1PTOF 1PZKD 1D5MC 1PTOB 1JWSD 4NZLB 1TY0A 2TSSA 1D6EC 1FGBD 1CQVA 1LTRD 1PTOH 2XNAC 3DWQA 1FNVA 1PTOC 1PTOD 1HTLD 1LT6D 1I4QA 3BYTB 3MFGA 4L6TB 1ENFA 2XN9C 1LTAD 1LTBD 1SJED 1T5XD 1YN5A 3V05A 1I4XA 1TS5A 2AQ1B 1G8ZD 4RH6A 1MD2D 3CHBD 1CK1A 3O13A 2R61A 3BYYB 1JWMD 1RCVD 1S5DD 1TY2A 1YN4A 3W2DA 1QILA 1DJRD 1HQRD 1V1PB 1AW7A 4UDUC 1STEA 1SEBD 4O1NA 1KTKA 2ICIA 4K6LA 3SEBA 3EFXD 1PYWD 1SBBB
chains in the Genus database with same CATH superfamily
1UH6A 4LFAQ 3RMHA 1PVOA 2R7ZH 3EFUA 2LFNA 5C0XH 1VQBA 3RZDB 2N9KA 2J0KA 2EY5A 5CV9A 1LV9A 3ERQA 3KBXA 2M19A 1B7YB 4YCVA 4TMAB 4DR3Q 4J6HA 1K8GA 3IL8A 4ZRKA 4B3RQ 3KDFA 4LUOA 2D10A 3GZNB 3V6CB 2Y0SE 3H91A 2DBYA 2KFKA 1UD7A 1U9RA 3A33B 4HCPB 4KN7C 3PF5A 1YMHE 4HR7B 4NJCA 2V0GA 3OIPA 4YCUA 2D5GA 1E2VA 2UU7A 3PRMB 3Q8BA 3PO3H 4R4CA 4CHKA 2WS3B 4EZLA 1UUPA 1XPUA 4DUZQ 3I4NH 3VHTC 3S1MB 2Z8LA 3HM6X 4XYCA 3VR5A 5D3DA 4TKNA 3RN2A 1I4HA 5DM73 3AECB 2JA9A 1TZOA 1PLFA 4BBNC 2RDFA 4DKAC 4WJ3M 2WLBA 1NBFC 4BVUC 4DK5A 3STBD 2BVCA 4O42A 3WCQA 2NCNA 4ZRJA 2AL3A 2WB1G 3RNEC 4A3MG 1YNXA 2IX0A 1X32A 4NPSA 4ZLTF 3S2DB 1HUNA 2M1MA 1NYQA 4FF3A 2C9OA 1EQTA 4JI2L 1UNSA 2L5TA 5GADC 1T0QC 4ZQ3A 1SNQA 2BWES 1K52A 3F2DA 3VYRA 1CSQA 4L23A 1XLPA 3LX0A 2AL6A 1KXLA 4FVMA 4A3LG 1IXRA 3BZCA 4JI7Q 2F0DA 4LF9L 4HRSA 2LHEA 2OQ0A 1L0XB 1F2RI 3CCLA 5IP9H 4NXMQ 2F0KA 4DUYL 2WKDA 4F1SA 1F9RA 4OONA 2N9PC 4BBRB 4P6VF 4N8X1 3MEFA 5LL6S 1QVGA 1WZ0A 4M00A 2FUHB 4BOZB 5MPOA 5KHOA 4LF7Q 3WIMA 2B3GA 1SAPA 3W1BA 5FO7B 1CKNA 1M1KC 3B2GA 2B2WC 4NNJB 4NPNA 3NS8A 1GUGA 5IKCM 1I3QH 3AE9B 3DBRB 5JOBA 1Z47A 3U50C 2CCZA 2JSOA 4DV2L 2INDC 2O6VB 2NVTH 1VQPA 3DBLI 3VR2A 3T3NA 1JQ4A 2BKRB 2JWUA 2IGHA 1PTOB 1PV4A 1PMRA 1BNZA 1R4NB 4K6DA 3S17B 1A6XA 1HZCA 2NZOA 3R3OA 1EUJA 3CPFA 2R2QA 3HS0C 4FADA 5ISRA 2BDNA 1PTOD 3UINB 4L6TB 1KJTA 1K83H 3X0WA 1YQBA 4YTMB 4DNIA 4AQYL 3ZRCA 1HTPA 3Q3NC 3K59A 1Q46A 3CHBD 1AZQA 2QIEB 2IX1A 2EY1A 3KUZA 3PRZA 1XYIA 1IKMA 3M4YA 1FEHA 2ZEQA 1B53A 1IW7C 3Q3OC 1F2ZA 3ZQ4A 3VRAB 1CM9A 2D5DA 3W2DA 4KX6B 1WI5A 2ZVOA 3SK8A 1B3AA 4JBMA 1EL0A 5EBCA 1F2RC 1AW7A 3D4RA 1STEA 4PV1C 1S4ZA 3H3VH 2HDEA 4AH6A 1LABA 1C0AA 4EE2A 4PMBA 1UBIA 3AEEB 3Q8FA 4GNXA 3LYYA 3U8ZA 1GPXA 4W9FA 5HGTA 1MVKA 4PZ8A 2G9HD 4BKSD 2UUCL 2QKIC 4DV7L 3ZIMA 4XT3B 3NBHA 3FILB 3H15A 2EDGA 3I4MB 5IP7G 1EQVA 3J80c 2XK5A 1SDFA 3K0YA 4WQMA 2JA8G 4IUNA 4IM2A 3KYDD 3PO3B 2KDFB 4RNAA 5I2XA 2B2UA 2E75C 4DR1Q 1S72A 2HTME 2WHIA 3V6EB 4ID6A 5IYDG 1FFVA 1L1OC 2DZIA 4LFBL 4CO7A 3LGJA 1WVLA 3Q0AA 1PXUA 4RGTA 5KEEA 1HZAA 3P1HA 2C7HA 4HKZE 3HOUG 3KLSX 3BJUA 3PIO3 2JPHA 4TQ1A 3I4NB 5CV5A 1SSOA 1D8LA 1ET9A 2KN5A 2PPBC 3HOUB 4A3IH 2MSED 2V1YA 1PFNA 2AYOB 5D65A 2VQEQ 2A6EC 2MO0A 5BN3A 1LACA 3V60A 1RJTA 4GLAC 2K6QA 3GTJB 4QUCA 2F4VL 3SXHA 5CGKA 2KZRA 4LNOA 3U9OA 3DBHB 1F9PA 1T3QA 4M8NA 1BMLC 4K5VA 4IUQA 2M8SA 4ITKA 3TEWA 1LTSD 3I55A 1E7UA 4K8JA 2KN4A 2EY6A 3AEVA 2WX0A 5AUKA 3OG5A 2VQFQ 1H9KA 5ELFA 4OHJA 4N6EB 2L0TA 2DNFA 3HOVB 2IO0B 1R4QB 3AB5A 3AB9A 1WX8A 3VR4A 1GG3A 2RHSB 1TYGB 4L1BA 4S0RA 1XNRL 4CJ2C 2CJOA 3NS1A 3OHXC 2MCNB 2SDFA 4A3FG 5G3LD 1W2BA 4FJZA 2R3ZA 1Y1VB 5EPJA 5EE0A 3CSFA 3WAPA 2PCFB 3CQZH 1MG8A 4MTKA 2YEPB 4H0LC 1LTGD 4OL7A 4XT1B 4YCWA 4CDFC 5LMUL 2HHHL 1B1ZA 3I3CA 4JI1L 2NVTB 2WX1A 3PZ7A 3WWVA 2D3CA 1NSNS 3MHZA 2UXDQ 1FXTB 4JPBW 5D2MB 1JMLA 1PZKD 4HDOA 3PLVA 2EMSA 1BVSA 1C4AA 1EO6A 4NAMA 5IOCA 1D6EC 1ASYA 2GVAA 1WFQA 1WH3A 1L1OB 3PUVA 5EQ0A 2K5PA 3ULPA 1WGDA 3NOBA 5C4JH 2I2YA 2LVQA 3APDA 3HVDA 1HTLD 2EZVA 4JG2A 1I35A 2Z59B 1GUNA 3GTLH 1RRBA 2LS01 3VR8B 4KVGB 1PFDA 3A4SC 1B70B 2IT1A 1QF6A 1DCZA 5KNBA 3QOJA 3KJOA 3K7AH 2NUCA 1S1QB 2MJ8A 2JVCA 4DV0Q 3SR1A 1K9MC 2UYZB 3MXGA 1A5RA 3GTOB 3H0GB 4RF1A 4KIKA 3P4PB 1S3OA 3T13A 2YU9B 4R8IA 2XGTA 1YN4A 2UUCQ 4GOPC 5C3JB 1HNZQ 1HHVA 2R92H 5IOIA 3PUYA 4MM3A 1JW9D 2ZNVC 4DK1A 2IGGA 1HQRD 3FC4A 1J8CA 3RZOH 1ISNA 1WIAA 1QB5D 3DHHC 3I7FA 1YX5B 1KQSA 1QKZA 3A54A 3G4SA 1KIXA 2Z6BA 4JI3L 4A3KH 1JJ2A 4BY7G 3HK0A 4I6NB 4YY3L 4L5TA 4XXEA 1Q1OA 5GAGC 1Q86C 4ANUA 1XLQA 5IYDH 1SFOB 3CMMB 3K6OA 2VUMH 3HOVG 2I46A 1SYDA 4QIWB 3E6ZX 2ZNVB 4E3CA 5JEAG 4A3OA 1QQRA 2QW7A 3DEOA 4P71A 4ALPA 5M5WB 1SE9A 2PO4A 2B2TC 3AN1A 3S1QH 3VDYA 2MBQA 2RF4A 1A63A 4DV3L 2A69D 5FJ8H 3E9SA 1NCVA 1B8AA 2BOSA 3I2ZA 3UDXA 1IBKL 4BBSG 3IRBA 2BS2B 2KCNA 4CKBA 1MI0A 3KWVA 4V190 2Z4HA 1DOXA 4K7WA 2OXPA 2LGSA 1VQMA 5JEAH 2DWQA 2KYWA 2Z0DB 1Z7TA 4DK6C 3HOUH 4PYUA 4D2KA 3S9WA 2E5LL 1Y8NB 1CSPA 1WM2A 4JOIA 5I4DA 2FNJB 1TWAH 1PRTB 2AWNA 3NY5A 1MPEA 5CX3A 3NQIA 4POGA 4HJ5A 2HD3A 2BBCA 1HNZL 3D8GA 1ZGUB 1WGKA 4C4VB 4TVAB 4G7OC 2RD0A 4CKEA 4PMCA 4Q5VA 1YN3A 3G6JB 2PI2E 3H8HA 3V3XA 2QEJC 3KF8A 3NWSA 5GROA 4LF9Q 4DHZB 1PZID 2KQ3A 4C3HB 4BA1I 4X62Q 4OO1I 2JQRB 3AEAB 4NMZA 1DGSA 1K3BC 1FGUA 2JA8H 2O2LD 1PQSA 2NVYH 2IO2B 2BYFA 4QB4A 2K6DB 2WINB 1L4ZB 1QOAA 5M3FH 4LF4L 1JALA 2QDFA 4P1BC 3AE5B 1X65A 4JI2Q 2D3GA 2F3VA 3MEHA 1SRUA 4KDLB 1K8MA 5HFYA 1NI3A 2QCZA 3CQZB 2JEBI 1SE3A 5A2QE 5JVG3 1FMAD 1YJ1A 2F0QA 1M8AA 2CW0D 3U9SA 2NPTA 4GDKA 4HEA1 4IKGA 4YSYB 4UY8C 3RPFC 2UUBL 4IFDH 5G3LF 1SGHA 2DLBA 5E4XA 2JF5A 4OZAA 5C4XH 3T9LA 2Q5WD 2RPVA 3AV8A 2K5WA 5KYIA 2FINB 3VFKA 1E90A 5CMDA 2G1EA 1E1OA 1IL8A 4YSXB 1TWGB 5D7GA 1IUEA 1EZ6A 5IT9L 3QAQA 1TIFA 2F0NA 4BY1B 4LF5Q 5JPNC 4HMJA 1UELA 1YNNC 1YIWA 4KGTA 1KRSA 2A8VA 2IY5B 1N62A 3I70A 2E2IB 2LMCA 3V61A 3VUYA 3DCGA 1D3ZA 4KD4A 5FLMG 4ZHPA 1TGZB 2MO1A 5LNK1 5CV6A 2KVZA 2L0CA 1C78A 3MXNA 1S5DD 1ZDXA 3DWGC 1C1YB 4A3BH 1QILA 3NE5B 4LMQD 5IGGA 2WXQA 3ZGZA 3VTWA 2NBFA 2VUMB 4FXCA 5G2NA 4UDUC 4GIVA 1SEBD 1BUVT 4FXGC 1VJKA 2BE5C 3HKSA 3EIVA 2E2HH 2JY6A 4UHVA 2NTTA 1PRTD 3B6YA 4UP7A 1XTCD 1R4PB 3ULJA 1A15A 1EWHA 1OXSC 2YTXA 1J5EL 3TSSA 3J80L 1I94L 1JRPA 2VS1A 1JRUA 5T8IA 4DHJD 1V81A 4C7YA 3HP3A 2BTEA 4EQNA 3SHLA 4C3IH 3GTMB 1QCBD 1X56A 3ZYYX 2K32A 3LWEA 4C3JG 1CMXB 1WR1A 4CGYB 2BGFA 4PK1A 3ZNID 1GO3E 1YNJC 1K0SA 3TUOA 4LJPB 1CUKA 1EWCA 4HJKA 1EYAA 4P75A 3NUCA 5EJWA 2I07B 2WP8J 2ZJRA 3KF8B 1Y69U 2WXJA 4NY0A 4S17A 2OQKA 4C2MH 1I6HB 1TXYA 2K1BA 4JWUC 3Q6SA 2R93B 5DPSA 3RNUA 3M3JA 2JYOA 3HIZA 1R9TB 2O5JC 1L4DB 1U4AA 2C60A 3L16A 2F4IA 4DU9A 2FE8A 1R4NI 1GNUA 2ZJDA 4W9EA 2I38A 3AE3B 2MX2A 2F0UA 3FKIB 4RWSC 4B3TQ 2K8CA 2KC1A 2RDBC 2V3SA 4J3OD 5G55A 1TKWB 1H9RA 4HN7A 4AQYQ 5J17A 1Q8KA 1QWYA 5C2TB 4DA2A 2GBRA 4IWPA 3MWYW 1NDDA 2L12A 1T0YA 5M3FB 3RCZA 2X38A 1QT9A 2BQQA 3VAWA 1KRTA 1FNWA 4RF0A 4DDID 1D2BA 4JIOU 2RDGA 4IUPA 2B76B 3DOWA 4DR4L 4X65L 1K3RA 1WCMB 3ENEA 3TQYA 5KIXA 4ZCKA 1WE7A 1CQFA 4RM8A 1TWFH 5BR8Q 4H13C 3SK5A 3FHWA 2WU2B 1VQ4A 1IGCA 4JI0Q 2K4KA 2ID0A 3TN2A 4B3SQ 3DVNU 2X69A 2E6XA 4DR6L 4B9WA 2WP9B 1V5TA 1MFWA 4V0BA 3GTJH 2KMAA 1TKYA 3C8YA 3BWUD 1OTRB 1G2SA 3EBEA 2EIFA 3A1QA 1D1IA 4LF7L 1ZXIA 2A68D 1SF0A 2XN9C 1LTBD 3RZWC 2BW2A 3PT2B 5IYCH 3V05A 1I4XA 4U68A 1KM7A 5JZEB 3MHSD 4NXML 2KHWB 2CHZA 4JCVE 2WGSA 2B2UC 1O7IA 4L5RC 4ZAIA 4HXDA 4B6WA 5IWAQ 1B50A 3UDFA 3DM3A 1XX8A 2EXDA 2OJRA 1WTRA 1C9OA 1DJRD 1Q5WB 1TJEA 1XT9B 1E10A 2F0IA 4GU2A 1JJCB 4A8XC 2YEPF 3AE7B 2MUYA 3NBHB 1V8QA 5IGBA 3N30A 4EFOA 2KJHB 1XTDA 1SBBB 2Y5BB 2CU1A 3CAMA 3TS2A 3OMGA 1SXTA 1QVCA 1GXDC 2MFIA 1FPYA 1X55A 2HD5B 3Q3MC 1PH6A 1C4PA 3T1HL 1ZE3D 1HFNA 4QGUA 3K0XA 3M4PA 1Z5SB 1KF6B 1ASZA 4LDTB 1C9FA 3ZTCA 2LSSA 3CU7A 2BKFA 3L4PA 3IAM1 2Y0SB 3J80E 1LQBA 4RCNA 1ESRA 3ZJYC 3U58A 4NJ6A 1B44D 3HKZG 4X57B 4USAA 2Y3AA 1RFAA 4YWGG 1Y8OB 2WWZA 1V1QA 2R7FA 2A74C 4ABNA 1TBEA 1H4RA 1XNRQ 2L1AA 2A19A 2OJWA 2JQOA 1AN8A 2L11A 1WTPA 3DWPA 3BDLA 5DAUA 3H6MA 2ON8A 1BO0A 1EZ8A 5BYRA 5HY6A 1F2MA 5C4JB 3D4WA 4RG1A 3T16A 2QSDA 3PIP3 1Y8PB 3IT4B 4WJPA 2Q2TA 3FKIH 2AMCB 5JAVA 4OZCA 3CC7A 1WF9A 1NTGA 4IZ8A 1TS3A 3EC8A 2KANA 2B2WA 1P7FA 4DFAA 1G51A 2MJDA 4QAYA 4JWSC 3GO5A 4AS1A 5KGUA 1N34Q 3MA2B 5BYQA 4QJFA 3T1YQ 1QZGA 1T0SC 1EOVA 1SNPA 2J7QB 1RKNA 2ZPNA 2AKWB 1IBLL 1U5KA 1LYLA 2DGYA 1BR9A 5C44H 1TWFB 3B0AA 1MIUA 1VQAA 3BZDB 2G5DA 1PGBA 4JBKA 3BY4B 4JBWA 2EY2A 1MBYA 2IPKD 4FHJA 3K7UC 1UE6A 1ZYRC 2EYPA 1ILPA 2D11A 3KW5B 5E6NA 4RGMA 2RSNA 2HHHQ 4ODGA 2CS4A 1MSGA 3UQAA 5LMNQ 2J0JA 4GKJL 4LW1A 4TV3A 3MC8A 1IL2A 3CF6E 4CDEC 4AYBE 3H0GH 2IHEA 4EUTA 1UEAB 1YJWA 2K25A 3N1YC 5BYSA 2OT2A 2KDEB 3A8IE 3CC4A 1I4QA 1UE1A 3DBLB 2N49A 1STYA 4KIKB 4FYDA 2RA4A 4RKLA 1SJED 4S3SA 2KWUB 1YN5A 2PW9A 2LUEA 3K5NA 1TS5A 5BO4B 1ILQA 4KKSA 2BH2A 4IOAA 5FLXE 2Y5CA 5C0XJ 1STHA 2IX3A 1XLOA 2KACA 2RQXA 3IAS1 4C3HH 3M7NA 1XEEA 1VLBA 1YQ4B 4DGZA 2PE9A 1TWHH 2C7MB 3KYCD 3ZRFA 1GD7A 5J22A 4BBRH 1PGXA 4XDXA 1XMOL 1YBYA 1LXDA 2KVRA 2JA5H 3K81C 2BF8B 3R3MA 1V1PB 2XVSA 2DYMA 1W6KA 4ME3A 4MH0E 1SYCA 2I0QA 4RGNA 3AE2B 3N20C 3AFPA 2FMCA 3FP9A 2PZUA 3CC2A 2OCEA 4W9IA 4BBRG 2WXGA 1GB1A 1QUQB 2KCTA 3U4VA 4IOCA 3AU7A 1E9MA 1EIYB 3ZJVA 3QCAA 3RNCC 2VW9A 3H9DA 2CU3A 2DZJA 4XTCS 4HKQA 1O7ZA 4JI7L 3N1ZC 2JK8A 5D94A 1PH2A 1E6EB 2CWPA 5ELBA 1EY0A 4JYAL 3P42A 5IAAC 1GJZA 1OTCA 2YTYA 1BF4A 3K57A 1WE6A 4AJYB 4XQQA 2WAQG 4I65A 1V6EA 1XXGA 4MM3B 4CYEA 1P98A 3RI7C 3D3RA 2WXIA 5FR3A 4MTNA 4MELA 2NTSA 1TWCH 5M5YB 4BKTA 4K5WA 1I50B 2BE5D 3AE6B 3NVWA 4KTAA 4X3SA 4A3BB 1FD7D 1YIJA 1J5EQ 2IW3A 1Q10A 2N0SB 3PVLA 1I94Q 1T6BX 2KTRA 1U4PA 4WWPA 3M4OH 4YSZB 2R6GA 1YOVB 4A3JH 2XRQD 2K8HA 3APCA 4G7HC 2YLMA 2NVXH 1EFWA 2D3AA 3VXWA 3S1NH 1GC7A 2KK8A 3AH7A 4NP5A 1Q82C 4LF8Q 2WDVB 3DWMA 1PRTC 1O80A 2PTLA 2EYFA 3S15H 4BZAA 2UXBQ 4DR2Q 3S14B 2GBJA 4DDGD 2ZXPA 4WRDA 3B9JA 5DPWA 5ELDA 2PW5A 3HOYH 1YX6B 4LUVA 2K0PA 2LUMA 4J1MA 1RF2D 3X3MA 1N36L 3GTOH 2NMQA 4LWCA 3WALA 5E6JA 3RN5A 5CHFA 3GE8C 4DUZL 2DY8A 2HCIA 4HIDA 1WXAA 4KY7A 4FDBA 2AHOB 4DV1L 4HIKA 2L15A 1D7QA 1NVID 1WTQA 4B3TL 2WXOA 2DYBA 1V9JA 5CV8A 3G6EA 1PH3A 2KDIA 2MA9B 4HWIB 1UWVA 2MRPA 3VR6A 3W1SC 1R9TH 3M7GA 4A3CG 4MJSB 3ZNGC 5J3BA 5E3FA 2NBVB 1NJIC 2Q8RE 1JQYD 2QF7A 2KOXA 1Y56A 2RGFA 3ONAB 1J7BA 3ZVVA 2E3TA 4OELB 1HFGA 4A3KB 3H09A 1VMCA 2A69C 4RA8A 4GOCA 1QNUA 5IYBH 4URKA 3BINA 2I5HA 4C4VA 3RD2A 2CQAA 1E3PA 5JPMC 4IWQA 4KZCA 1Y1WB 1K51A 4FBJB 1D4BA 2R93H 2GVBA 3PSEB 1N34L 2M0XA 5LLIA 5IP4D 4IFDI 5I6WA 3AU4A 3HGBA 1FD6A 4IPDA 4XYQA 3JAML 2PMVA 1CA5A 4FF1A 2LY7A 2CJNA 2RSOA 3ULLA 1JMCA 1G291 1IBLQ 3I63C 3Q23A 4XGAB 4AP4C 3QQ8B 4Y7NH 2K39A 4LNFA 5IGCA 2SAKA 4DV6Q 4Y52H 1UEBA 3G7LA 3ALBA 2KENA 3DXJC 3LXFA 1VQLA 1WTWA 4JYAQ 2LASA 4C3IG 4W9GA 2KWCA 5C44G 1Q1EA 1SMXA 1JJGA 4K2LA 3I3TB 3BIID 3W9CB 1VQJA 1HR0L 1UE7A 2F03A 1EY7A 1QOFA 5C5LA 2VZKD 4ZKCB 4FXDA 3DBRI 3JYUA 3TL5A 4A90A 2EYHA 3PO2B 4FLHA 2INPE 2LGXA 5TSSA 4F7XA 5NUCA 3DMUA 4JL9A 3FDTA 2LMCB 4RAUC 1JOQA 3CCSA 1Q81C 2PMZB 2UXCQ 3RD4A 2H1EA 3P4QB 1VZ6A 4PS7A 1JB3A 4TUUA 2WYQA 3L0OA 1CTMA 2N4FA 4OX9Q 2K75A 1WJ6A 3VRBB 1CKOA 5HI1A 5COYA 1V97A 1O7YA 3T53B 5IP9G 3DVGY 3TEXA 4PT5A 4GN3B 3URYA 2XRSD 1I4PA 2L05A 2HUGA 2QEXA 3GTPH 4YL8A 2M2LA 3HVZA 2GBNA 2CHWA 2D0PA 1NR4A 3CP0A 3A7AB 4HIMA 1ZP0B 1JICA 3BK1A 2O4XA 4WWNA 1A2UA 2HJ8A 3I72A 4JI3Q 3RLOA 4YY3Q 3CIRB 4RM9A 1N60A 2XBBC 2DUDA 2BYVE 3RLFA 4EZKA 2AUKA 1TS2A 5CC4A 2K04A 4A3LH 3M4OB 3Q6BA 5FLMH 1QZEA 3FKIG 3Q22A 4A3GH 3UIOB 2WDRB 3WA0A 3TMPB 2A6HD 1P16A 3ECIA 1FM0D 2JZPA 1IYFA 4LCDE 2OTLA 1N5XA 1Y8RC 1PFSA 1X3QA 2V4LA 2ACZB 4NQKE 5IN7A 4IN3A 3E5SA 2JA5G 4GOPB 4PNYA 1DZ1A 1WXMA 1GUTA 3KYHC 1XNQQ 4ZRPA 3KF6B 1QOGA 2OHFA 3A8JE 5ELCA 3RUZA 3S1QB 4EOYA 4GN5A 3GOEA 1ICFB 1AZPA 2L1BA 1D1KA 1VQ9A 4WJOA 1M90C 1UGMA 2PI2A 1PRTF 4A93H 4B3SL 3VQIA 4DR5Q 2PMZE 1LM8B 2WDTB 4GLSC 5EPKA 1TIID 1E8ZA 4AJWA 3MVVA 2ZT9C 1NBWA 4DHZE 1IHZA 4CDDC 4IPGA 2OTJA 2INNE 3J81j 4QMGA 1YNJD 4CQNA 4G50A 3QOLA 3A1QB 2FHTA 3T1YL 4PS3A 2UXDL 1J9OA 4X65Q 2A5HA 3UE0A 2P5ZX 4G57A 4PS8A 2MHJA 3S2AA 3AXCA 4JI1Q 4B0EA 5IT9E 1EF5A 2N7EA 3A55A 5K36G 2Z1CA 3J9CA 3HRDD 2B63H 2F3IA 1Z6HA 5KHQA 1WRDB 4OX9L 4WORA 1G8ZD 1JWAD 1VDVA 1SNMA 1WTOA 2FAZA 4KHVA 4A3PA 1UBQA 3RNBC 4F7ZA 4N9TA 2GA4B 2ASQA 2R61A 5C44B 4HK2A 3R7RA 2E2JB 4JI8Q 2I1KA 3E9HA 5C3WA 4FF2A 1WXVA 1LUZA 4ZRIA 4X64L 1WD0A 3ZDTA 3HG9A 1WYWB 4Y7NB 2HE7A 1E8WA 2YYZA 2VY3A 1GM5A 5E6OA 1UGJA 2JA7B 2ICIA 2M00A 4K7SA 2MEKA 3T51B 1HQMC 2FJ2A 2B39A 2YU9H 2RDHA 2R7ZB 1PDQA 4GNXC 1EY5A 2PJHA 2N9EB 1STGA 5M3FG 2EVBA 1CI3M 2IO1B 5EKKA 2LRUA 3DBHI 3E56A 4APVA 4I7AA 1WX9A 1YHQA 5F2DA 4TKOB 2JA6B 4TSSA 5C4ZA 1EEID 3EA6A 1WYDA 2UWQA 3EHVA 2LKVA 3FKYA 1WCMH 2HQEA 2K5HA 4GB9A 1KL9A 1J7AA 5IYBG 1C77A 5M3MB 4BWGB 3HOZB 1WGYA 1AH9A 4J6IA 3A9JA 3PF4A 3MTNB 1J7CA 3M85A 5I6YA 1Y1VH 2BS4B 1GJXA 3PZDA 2BDOA 2XWBB 1JWBD 1GOZA 4XDDA 4RCOA 3AE1B 2O6VD 5J2RA 3OMCA 2FIFA 3QIJA 5M3MG 2IY0B 3PREA 3TDQA 4MEMA 5J39A 3S1RB 1FRRA 5AZHA 2B63B 1PH5A 4JC0A 3HOWG 2EOTA 2G45B 2WXFA 2N3SA 3A9KB 2WXLA 2LJ5A 3P4SB 2BYTA 1YITA 2JUOA 2KEDA 3R8BA 1GUOA 1E5WA 2EELA 2L00B 4RHRA 3ZXVA 2EYOA 4C1NI 1SLJA 3J81E 2B2TA 1B9NA 1H8CA 1YHBA 1R4MI 1BCPC 3AI5A 3AULA 3I5JC 2PVGC 1XLNA 3UQBA 1HRJA 1EY9A 5C4HA 1K28A 3K5MA 2J0TD 4A93B 4KJOA 3QA8A 1VQGA 1WX7A 2JYTA 4POFA 1A3UA 1BT0A 2YVCA 4PZ7A 1P3QU 1JE4A 1I50H 2F4VQ 1NUCA 4LAAA 1GAQB 1RYJA 4AYBG 3Q8EA 1BCPB 3ZJTA 2QDLA 3TP6A 1OGWA 4WURA 5G5HA 5HKHA 1AFPA 3JVZX 3HOXB 4KKUA 4AIMA 2JJQA 1FRDA 2MWSB 5HHDG 2M17A 4NZLB 4H2AA 4B08A 1XCTL 1HZBA 5IWAL 2F0GA 4C3JB 5BN5A 2NBWB 1EUVB 2XNAC 4DAVA 2GBMA 3FPPA 2W82A 3HZXA 1K83B 4XQNA 5J1ZA 3KVFB 1IKLA 2B2VC 3VYUA 1A0IA 2C35B 1U4MA 1ZPSA 2GMIC 1IPGA 2KJXA 5CBEE 2ZPYA 4R4IA 1LM0A 4IFDG 3M62B 3FVQA 4A6QA 4I7ZC 1X3PA 1XJVA 3M63B 2ZJPA 4TRDA 2F0HA 2CKHB 3VH3B 1RCVD 4A3KG 4JI4Q 3CD6A 4DV7Q 3UIPB 1SYBA 1SE8A 1TWGH 3NK9A 1F9SA 1SNOA 4YWMA 5IGFA 4HJ9A 2FCSA 2H88B 2WNMA 1L5PA 1Q8IA 4LLGM 3A5ZB 5IY0A 2CHXA 4II3B 5GQOA 3NENA 4O1NA 5CORA 4ZRZA 1WXQA 1HZ5A 2DZMA 5JH5C 3F2UA 4NB3A 1PYWD 2LGYA 3LB8C 1CZPA 3AEFB 5JEAJ 4JI6Q 3NSWA 5E1FA 1I6VC 3JSVA 4BOSC 2BH8A 4HPLB 5T1IA 4W9JA 4C80A 5BMIA 5JXVA 3OOCA 1WCMG 4P74A 2DAJA 2PEAA 2KWVB 1TS4A 3BVZA 3JAMc 1Q7YC 3H7PB 3EGRA 2RPQA 1M4VA 4B0MA 2EJMA 2WAQE 3TP8A 1WRIA 1KDAA 3AE8B 3TEHB 4DXGA 2GB1A 3TIXA 1NEKB 3Q2AC 4K1RB 1K73C 4W9CA 2PZWA 4OXPA 4FNFA 5JJKA 1EY6A 4JW0A 2KTRB 4KGSA 2ZXRA 3QG1A 5M3MH 1V1PA 3OPOA 3Q3FA 1IYUA 3ZKJC 4RFBA 5EBDA 1BKBA 2LHDA 4WJNA 1E2WA 1UE5A 3RR5A 2GRIA 2PVOD 1DOKA 2ALYB 4B9KA 2VQFL 2MJEA 2KNBA 1F77A 2ZTCA 1STNA 4DV5L 3SE0A 1TT5B 4JV5L 3NZUA 3T1HQ 2UUBQ 5IGDA 3PTFC 1BUIC 2EKEC 4C3HG 4OZBA 1TVXA 3W1SA 1STAA 5FO9B 5LMNL 1SNCA 1TKEA 4KHPL 3CCUA 5ELNA 2ASBA 3C1EA 1OFFA 3PLUA 3NWTA 1N32Q 1KLVA 4LNNA 4IJHA 2DJGC 2KC2A 2J52A 2NS5A 1QE6A 5EKLA 2VQEL 3MP9A 5DCNA 4X66L 5ELEA 2N1VA 5C3XA 2PW7A 5EAYA 1JOOA 5EE9A 1LTTD 5FKAC 5IE8A 3TS0A 3J81L 2B8GA 4YIJA 3V96A 2DY7A 1VQIA 3MXPA 4GLVB 3MC0B 4BKGA 1VDZA 1M94A 2DZKA 2CH4W 1CT1D 1S5CD 4HJ8A 1QVFA 3I4MH 3GQBA 2F0WA 4ME5A 1WTVA 4ZKBB 1RTNA 3M3YH 4RHSA 1SYGA 4PMWA 1VQHA 5CTRC 1VCBA 2JA6G 4JK1C 3BVGA 3H0GG 4XIGS 5E4WC 4FP5D 3HOXH 1HR0W 4IOIE 3ZO5B 2K9XA 4X66Q 1EM7A 2BPSA 4K0KL 3J81c 4OGQC 2EMTA 4KLKA 1L0WA 2KCMA 1VZ8A 3IFWB 1D5MC 1RODA 1HNXQ 3Q14C 4X64Q 4G3XB 2M4NA 3W1YA 3PUZA 2EYLA 1S40A 3TP7A 3H3VI 3LJ3A 2K8BA 2N9LA 3KOJA 1XWEA 4M8AA 2FMMA 4DV1Q 1HZ9A 2BYEA 2H89B 4BY7B 1N61A 2KD0A 1OXUA 1ZUD2 4CDCC 4DV5Q 1PH9A 2N78A 1PUTA 3DQVA 4GDLA 4RH6A 3E0JA 4WJWA 2B3AA 4US8A 5JVH3 2KMCA 4HSVA 4GKKQ 3BYYB 4R3DA 3R7QA 4R4TA 2IBIB 5CBAE 4MDKE 5M5YH 4KI0A 2D3BA 3RNFC 1AYFA 1VMPA 5I2YA 4MJSA 3A7LA 2W3SA 3LWUA 1X1MA 2FCNA 3D0FA 1KFYB 3W5UB 2Q8IB 1B2TA 3VA5A 1XMQL 4GN1A 3EFXD 2LGIA 4XWWA 2UXCL 1A3TA 1F2YA 3K80C 2BS3B 3PMFA 4R8NA 4DAYA 2J4XA 1WOCA 1K53A 3ZLZA 1HA6A 2IYDB 1EYCA 1SFOH 3S1MH 1S5ED 2R92B 3FRPB 2DJFC 5LXHA 3ONSA 4ZOHC 2FCMA 3DHIC 2A68C 2Z4IA 4IO9A 2CFMA 2E8GA 4C7ZA 5HGQA 3IVFA 3IFDA 4YWLA 1BBWA 1MHHE 3U7ZA 2V3NA 5FLXc 1MSHA 4KMUC 1FL0A 3N1XC 4KDIC 1SE4A 1KHIA 3PHXB 2FBWB 1EYDA 2WXNA 4WAFA 4YWKA 4KZ0A 4F88A 3ERSX 3KDFB 4NW2A 1EF1A 3TJPA 3CW2C 2KFKB 3RNGC 3F2BA 4KV6A 1LTLA 4DV4Q 2KFJA 3TCAA 3VYSA 2CHBD 3GB1A 3S17H 3VTVA 4YTNB 4HROA 2E5LQ 2UU9Q 1LT4D 1JROA 2LWPA 5C3EG 5IODA 4GN4B 4A3DH 1V80A 2PIAA 2VH2A 1QZHA 2DX5B 5IA7A 2JA7H 3F2CA 4K3CA 1TWAB 1YVCA 2IGDA 3V62A 2G4DB 4GS3A 2MP2A 1L2NA 3KWLA 2K01A 4DXFA 1A62A 4XZ4A 2IWHA 5E7NA 1PHJA 3I73A 2JZZA 5IP7H 3I4MG 3C0RB 1VR9A 3PRPB 1ZXHA 2NZ1D 2WB1B 2DNCA 3BDCA 3M3YB 5L37A 1E8YA 2EYJA 5CV7A 2JA6H 4HCSA 1P7EA 2LFIA 4GXBA 4U673 4K3BA 2QGQA 4BKSA 3OW7A 2KJRA 5FOBB 2B63G 2K6AA 2ZTDA 2K3UA 2NVYB 3UGBB 1AE3A 2XSCA 4ZUIA 4GDKB 1WI0A 4IUVA 4WH4A 4O0AA 2NPTB 4BBNF 4QQBX 1Z9FA 1X3FA 2E2DC 1CJEA 1GKHA 2VZAA 1P9DU 1SIJA 2WXMA 2HT1A 1GVPA 3UDIA 2PQAB 3TBIB 2AUJD 4X6AH 4JI5L 4LFCQ 2L0FA 3DEPA 4X3KA 2WIIB 3HOZG 4OVUA 1KDCA 2I1JA 1XPOA 2PKOA 1PFBA 3UI3A 3GE3C 2JYEA 3NTIA 4DUYQ 2G9DA 3CRLC 1JB7A 1A2TA 3N6RA 3OIQA 2ZJQA 2INCC 4NJ7A 2E2JH 4LNKA 2CR5A 1C4CA 1A3VA 4M01A 1N9WA 3EECA 2HCCA 1ENAA 3ZW3A 2R92G 2W9NA 2K1FA 4UP8A 3JW0X 2NYZD 3MXNB 2JWZA 4JGHB 5GMVA 2JU6X 3AEGB 2CWAA 4ZYNA 3SD5A 1QLBB 3B2FA 5C4XB 1JE5A 3SU8X 3N52A 1OXVA 2KLGA 1C7YA 3RYTA 3CF5A 5G5GA 4IUMB 4ICUA 2ATWA 4MSMB 1JC7A 3C1FA 1GHKA 3H1UA 2KOLA 2AX5A 1L6VA 1KTKA 3TRZA 4DR1L 1B4OA 1A8VA 1JCKB 1FIQA 3J7AV 4ANVA 4WWMA 4EEWA 2LXJA 2LVPA 4JPSA 4ZUJA 1XMOQ 2B2YA 4W9KA 1ZEQX 2MP2B 1ML0D 1KNEA 1F52A 2E74C 4BXXG 3SK6A 3WAMA 4B95A 2VNUD 4QF4A 4AYBB 3GTQB 4KV2A 1HNWQ 3ZDMC 3PV0A 3QIAA 3NBIA 4RGOS 3IBEA 1FJGL 1DONA 2KECA 1W6JA 2KHSA 1F9JA 2EJGC 3L7ZC 4A3MB 3FILA 2XTIA 1ENCA 1CZGA 2OEDA 3C19A 4LF8L 1UAPA 1HEZE 3CKIB 3P20A 3GS2A 1VQDA 3ML9A 4JX1C 3BVMA 1E22A 3HRZC 2CW0C 3SK4A 3CPWA 1MHXA 1L0YB 4OO1H 3ZXRA 1RAXA 4G4KA 1GUAB 1TQOA 3K5OA 1KH0A 2L83A 2F0MA 2KHJA 2GI9A 2GLSA 3WAOA 1LT3D 2PQAA 4ARCA 4H02A 3NG0A 1ZYRD 1GC6A 2X8XX 4LFAL 2Y5PA 1D5XC 3QK0A 5C23A 4YXDB 1VS0A 1V1OA 2WAQB 4LF4Q 4HSPA 3TEYA 3ZJUA 1LFDA 3W1GA 1RLFA 4LK0M 3R2TA 1FCLA 1DM0B 3MFYA 2NVQH 2B29A 3PO3G 4XDCA 4ARIA 4XE0A 3A9JB 2K7VA 3DVNV 3VYTA 2KX3A 2M0AA 2Z9HA 5IGEA 5D3IB 3I4NG 1CKMA 3FAHA 1HE8A 3WANA 1J8IA 4J8QA 3L13A 2K33A 4C56C 4CKCA 4X3TA 4ZK9B 2NWGA 5CR3A 3S1NB 3E3XA 5EE3A 2LD9A 2R2OA 1KNAA 4PG3A 5CV4A 1JT8A 4WQOB 3RNAC 2SNMA 2CQOA 5DM63 2V3PA 2F0LA 4UAIA 1YZ6A 2D9UA 5LXIB 1AE2A 1V49A 2BB5A 2KVMA 1O7LA 4KKIA 3A9KA 1KC8C 2H4OA 1P8LA 1WXSA 1H9SB 4MSQB 5BMHA 4KK7A 3C2PA 1IBMQ 3PV1A 1JWSD 2R7ZG 4K2KA 2TSSA 3HEJA 4A76A 2J7ZA 5LMNW 3GZNI 4DN4M 4JI8L 3Q8AA 5H8YE 4DNTB 4F8CB 1T5EA 4JI0L 4OWWB 2MP1A 2D2QA 5I9OA 1SMYD 2F0EA 3HHMA 3PSIA 2O5IC 4M0WA 2EXZA 5T1GA 5EDSA 1T5XD 3S2HB 2WB1E 5M5XB 1K8OA 4NQLB 1G6ZA 1CFMA 3GD7A 3RZOB 2WXKA 4NAWA 2M56B 3APFA 4ULLA 3W5OA 1K0RA 5KYLA 1E7VA 2AWTA 1SROA 3RZDH 4KY6A 2WXHA 3DDCB 4GKKL 2TMPA 1N33Q 2HIVA 1VRAB 3PHWB 4XWTA 1TY2A 2KO3A 2KJ6A 1IBML 3KUPA 3QJZA 1WTXA 1WGGA 3NZSA 1OQRA 1I5FA 3EUB2 3HOYB 3JSVB 2MBOA 4MACA 2A1AA 4IALA 4DF7A 1EWIA 4IURA 4K6LA 1V86A 4HLEA 5L83A 1E2ZA 3E0EA 3SHQA 3RLNA 1EY4A 3DHGC 2NBUA 4QY7A 1XPRA 5EKIA 3NQTA 3PQIA 2ES2A 4OEMB 2MQHA 2RCFA 1HNXL 4R9WA 5JJZA 4HJ7A 1WTHA 1V8CA 1VD2A 3OLMD 2I5MX 1F1HA 2VB3X 2UU9L 2IZVB 3D4DA 3HUIA 4FULA 1QG7A 1HR0Q 4DV0L 2VXWA 4LJOB 4R1JA 2BA1A 1NI2A 4MGYE 3RMKC 1BBXC 2CKZB 3MTSA 1VQ5A 3K9OB 3TZDA 3IXSA 3D6CA 1RL2A 4N9F4 4REZA 2KA7A 1OEYJ 2A6ED 5I9PA 1F9QA 1KAAA 2MBHA 1X54A 1NE3A 2OF1A 1XD3B 2RR9A 2Q2UA 4GMVA 4F8MA 3CRKC 4WJ4A 1KRHA 4BFRA 4KY5A 1SN8A 4LK1C 1E0ZA 5AJ3L 3L17A 1YHAA 1Z2MA 1EOTA 2GOWA 4A93G 1HXYD 3P1MA 2MQJA 4P72A 1W3SA 3K9PB 3J7YW 2NVQB 3GV6A 2AEHA 4B3MQ 1GB4A 3Q69A 1HTQA 2EQSA 5AUIA 4IUTA 1VQ8A 1VQ7A 1PGAA 4E74A 3JC66 4KKTA 1DD2A 3OJ3A 1H9SA 2Z6KC 4IFDJ 4XX5A 2VL6A 4JE3B 2SNSA 1X6OA 4K7UA 1IBXA 5A35A 4IM0A 2X6LA 3OW2A 2FIDA 1MJEA 3B08A 3H7PA 1YEZA 5GAHC 2WV6D 4EGVA 4HPPA 4W9LA 4ZRQA 4LUZA 2CH4A 4K14A 1ET6A 1N36Q 3CMAA 3IKJA 5AZFA 1HNWL 4BAXA 1IP9A 1YI2A 1I4GA 3E9IA 4EQPA 3ND9A 5KNCA 2N7JA 3PO2H 4NAWB 1TT2A 3M95A 4BXXH 3L54A 2NN6H 1NMGA 3G71A 3G48A 3U4ZA 3Q8CA 1F0ZA 1L7YA 3SGIA 2KDMA 3NRZA 3UE1A 1IYJB 1TR5A 4L2YA 2QILA 3SFEB 4DR7Q 3FEWX 1JORA 3D6WA 5IYCG 3W5VB 3RZFA 3IAYA 1E1TA 2JRHA 1PTOF 4LF6Q 3GTPB 1IYVA 1V2YA 5H92C 3SR6A 1TY0A 2N1WA 4BBSH 3ND8A 1FGBD 1CQVA 3AMUA 1WJUA 3IG3A 4II2B 3IT6B 4LJZC 4AUQC 3CCVA 1PTOC 1BDOA 4KGRA 3S2HH 1A70A 2RSUA 1GUSA 1EIHA 2ZM6Q 4M8MA 3RFZB 5A2QL 2YV5A 5J18A 3L08A 3SFDB 3CCEA 5HG2A 3P2BA 4KN4C 1SYFA 2KHIA 1UWMA 2A5UA 2D0OA 3J81i 1DGJA 1AWDA 1IZ6A 3T4AC 2G3QB 4C00A 3GTGB 5K5PA 4N59A 3VVWB 1N8RC 1J19A 4HCEA 1MKHA 4DAYB 2EJFC 2K50A 3IHPC 2GN5A 2J0MA 4FF4A 1QUQA 3M4QA 3AM9A 1RM6C 2JZ3B 4LFCL 4IM3A 2B2VA 1FCCC 1BBUA 2RVLA 3V2TA 4MN3A 4P2CB 1VF7A 2B2YC 3TREA 4HVBA 4C1NK 2V4IB 4FHKA 1GHJA 2L32A 3I90A 2D2CC 5CHVC 1XQQA 1VF5C 4C2MB 4Z9CB 1I6HH 3NELA 1SR3A 3M9BA 3I8ZA 1VQEA 2N8NA 3R2IA 1UZXB 2PE6B 4DR2L 4F87A 4FXKC 4A3CH 2DYOA 2I5LX 4FO2A 1EU3A 2M9VA 4WFN3 4A3EG 1C79A 1TWCB 1J6QA 1MJDA 4HTHA 1C48A 1RIPA 1TZ1A 3KH0A 5DEHA 2B8FA 2NZHA 1TKGA 1I3QB 4BS9A 4ANXA 1STBA 3I57A 3MC9A 5E6PA 2NVXB 5GAEC 2UUAQ 4L5SA 1II3A 2K52A 5FJ8G 1OQYA 2C5LC 4DR5L 1EQQA 1CA6A 1H9JA 3ER0A 3PIPA 2K5QA 2DNEA 1WSPA 2QHOA 4WIPA 3RN9C 2F0VA 2RKSA 1JOKA 2LJIA 4RKBA 2NN6G 1PH1A 1MGSA 1HUMA 4OO1G 2LZ6A 3KLWA 2GBKA 4B9XA 4A3BG 1XNQL 2ZW0A 3QWZB 1DYQA 3CWIA 2EE1A 4PQXA 4IW0A 2HTHA 1PA6A 1CHQD 3A4RA 1PZJD 5M5WH 3U4EG 4FJYA 1PH8A 2CVRA 2QDBA 2AWOA 4OVZA 2L3ZA 4DQOC 2JE6I 5M9OA 3PPAA 4KKJA 3PO0A 3ICEA 5AEKB 4Q2JA 5IT9c 3S15B 2KT7A 1S5BD 4JI5Q 2L7RA 3SDZA 3DPDA 3VH4B 1JR0D 5AFWA 3P4RB 2QMTA 1MHWC 3GV3A 2N7DA 1QOBA 3VA7A 4A75A 2QA4A 2JSVX 4K81A 2LXAA 4JLCA 1SE2A 1P0RA 2F0PA 1SNDA 1NENB 3NP8A 4M02A 2VB2X 3PUWA 1YNND 4HIOA 4NKLA 3CCRA 5JJIA 3RUIB 2IO3B 2ZXOA 3CCQA 4DV3Q 2Z0SA 2HIXA 4L5QA 4DAMA 2JA7G 4P16A 5EGTA 2WU5B 1SIFA 1VCIA 2MPMA 2K5NA 4FJVB 3C46A 3A0JA 1E0BA 2KQSA 3DVGX 1N6ZA 2A73B 3O13A 1N63A 4NXNQ 1YJNA 3CMEA 3MJWA 1V9PA 2V9HA 1JWMD 2JA8B 4ANWA 1QNKA 4B3RL 1RTOA 4DXAB 2VRRB 3NHEB 2K5DA 3S16B 3BS1A 1Y1VG 3MAQA 2K5VA 2KLCA 3P63A 4A3FB 2LXCA 1EIFA 3VDZA 2ZCBA 2ZCCA 2ICEC 3PGEA 4DK0A 4DV4L 1RHPA 2KKCA 2OEOA 5C4XG 1E7ZA 1BOSA 4HAEA 1HH2P 1RWSA 3A5UA 3OWEB 3NTHA 1CHPD 1KDBA 2F0TA 4R4QA 4A3MH 3AMZA 1B9RA 3NPPA 1VQOA 1YJIA 3NTKA 1SSNA 2ZZPB 4DPGA 5AJ3Q 1Y1WG 1EU4A 1YQ3B 2BCOA 2MGSA 4PYZA 1ZKOA 2JP1A 1G2TA 4EVOA 4A9AA 1KD1C 3H7SA 5C0XI 3HM3A 3MXUA 4XQJA 3HOXG 2C9WB 3KLSA 1ICWA 2K28A 2ZM6L 4RMFA 1BCPD 5D14A 4C3JH 4G0NB 1XF5L 2D62A 1SYEA 5JHBA 1O78A 1OO9B 3I4OA 4OIJA 4JI4L 2WXPA 1XMQQ 5DPRA 2F52A 1QJOA 3QR8A 4EQOA 2L4NA 4G11A 4DWFA 1UF0A 3AE4B 2JEAI 2FUG1 1VQCA 4MH8A 3AFQA 1PH7A 4K5XA 3EN2A 3HKZE 1VQNA 4ILWA 3NVYA 2FXQA 4O2DA 1CKNB 4BY1H 4DR7L 5LHY1 4CJ1B 4DR6Q 1FYCA 4W9HA 4OVVA 4NDXA 1BQQT 2HJ1A 4GOPA 2MJ3A 1V43A 2W55A 3J7ZC 4DNRB 2EKIA 1FO4A 2AQ3B 2UUAL 4IDIA 1EY8A 1I42A 1ZOYB 3UDGA 1PYBA 4JV5Q 1R7SA 1WZ3A 2KX0A 1I4RA 2L76A 3N9YC 2PLPA 4AWJA 5FLXL 4OW0A 3NVZA 1IGDA 1UWXA 3ZTDA 1TU2B 4EKUA 1RDPD 5C6AA 1I7HA 1ZDVA 3GDEA 1HA5A 1L2FA 4NXNL 2KUMA 2X6GA 4DR4Q 4WJQA 2MH7A 2JXMB 1NY4A 4HEDA 3OAWA 1OXXK 1DOLA 5DLQE 4TQ0A 2RBMA 1EFID 5BR8L 1VZ7A 2JT4B 2NB0A 3WDNA 3OTOQ 4HPMB 1JWUD 1U0LA 2KCCA 3ZUNA 1AEXA 1WMHB 3WOEA 5CYUA 1PFMA 4YT0B 3DUZA 4HDQA 2ENBA 4C3IB 3I56A 2V4DA 4N8FA 3H94A 3TMEA 1YJ9A 4B3ML 3GTMH 2K22A 2ZW1A 4GGQA 1WY8A 3VR9B 1MI2A 3EVQA 2BA0A 2O2VA 4IUUA 3PO2G 3I9V1 3VUXA 3CSTA 2K14A 4K0KQ 2IDYA 2LRWA 3U52E 1LTRD 3KK7A 2A6HC 1LGRA 2KDBA 3QC8B 3DWQA 1P1AA 2W54A 2PNHA 2J53A 2O6VA 5TR5A 3QARA 1HJPA 2LEKA 3BYTB 1ZKHA 2JN4A 2KMMA 2LXKA 3FMCA 2LGDA 3C3LA 4P7IA 4WAAA 3B1LX 1ENFA 2JXXA 4MGKE 1NAPA 3NHHA 2QJLA 1ZW7A 1AARA 1C76A 4N58A 3EFCA 5IIFA 3K5LA 5FR6A 3U2SC 1E8XA 3NJTA 1ZXTA 2WKCA 2IL8A 3HOWH 2QCPX 3AU5A 2WDQB 3LDZE 3QJYA 4GZYC 2FCQA 4ZDVA 2N88A 4KJNA 1K50A 4L8JA 3Q3JA 4EX5A 3N32A 3PZ8A 3SDLC 1K8RB 3A74A 3L3OC 1ONLA 4HJAA 1E7PB 5D6JB 4LFBQ 4LNQA 2WXRA 3DLLA 2EPBA 3GTKH 2E76C 3L2PA 3WOFA 1PYSB 3BG3A 2QC8A 1D5ZC 4KHPQ 2L9HA 1BXTA 1HPCA 1LLRD 4M0WB 4ZYSA 3K8AA 2YTVA 3ABVB 1H9MA 1FNUA 1N33L 1C8CA 1VQ6A 3S24A 5HURA 3J7AF 2BT6A 4GNXB 4MIUA 3OJ4B 3GTLB 1SJHD 2IY1B 3N3KB 3EJIA 3RULA 5LL6X 5KRUA 2OWOA 3IFTA 4IQZA 1FFUA 1DOMA 2L8JA 2ZVNA 4UP9A 3ITPA 3OWFA 3H6NA 4HJGE 4P1CC 2XK5B 2N55A 4JI6L 4YTPB 1WFYA 5EE1A 1MG4A 1DOYA 3RT3B 2FFKB 4BBSB 2KXJA 4X3UA 4DR3L 1YJJA 3P7JA 4YHHL 2W3RA 2AQ2B 3MJ5A 2MNAA 3S14H 3W3AA 2Z0EB 4I6PA 1BCPF 4DV2Q 4KD3A 4ICVA 4JQWC 1WGRA 5EPLA 4GKJQ 1HZ6A 1WMHA 4RMAA 2REXA 3HOZH 3UF8A 4HMIA 4N9PA 4XC2A 4IC7B 2SOBA 4KSKC 2JRIB 3I91A 1WR6E 1QOHA 3SVMA 2O2VB 4EZJA 3HOWB 2MW5A 1VQKA 1OQQA 4A3IB 4A3IG 2LVOA 1X3GA 4EQ5A 1VQFA 3PCOB 4BA2I 1FXAA 1L1OA 2RCNA 4A3DB 5C3EB 4QUFA 2C5CA 2VH1A 3L10B 2E2IH 1EEFD 4ASWC 2NR2A 3NZ3A 3VTUA 3PS6A 3NXWA 2SEBD 4LNIA 5AZGA 4IG7B 1KABA 5FO8B 1DXMA 3TP5A 5C0XG 1V5OA 5C1ZA 4HCNB 1HCZA 3TBLD 2KEEA 1G91A 1GUWA 4W9DA 3BU2A 1KLUD 4IPCA 1RD9D 1KLGD 2MHVA 3TZUA 1Y1WH 1WWTA 1S5FD 2Q8TA 1S3SG 4M1UB 2VUMG 3DWAA 3P75A 2H5XA 3QB3A 1K8AC 4A3EB 3HOVH 3KFUA 1SB3C 4ACFA 2E2HB 4R4OA 1R4MB 4MGIE 1IBXB 3HKZB 3PUXA 1SMYC 2F3WA 3PGZA 4A55A 4YHHQ 1PH4A 4IJLA 2NN6I 3KBGA 3KLRA 1AP0A 4MT5A 4OWXB 4CBVA 1FVIA 3OYYA 1WJNA 3MZ5A 1LT6D 3GTGH 1WJJA 3MFGA 1NYRA 2WQYB 3Q8DA 2ZTEA 1WM3A 4J15A 1XO3A 2Q2IA 2V1CC 1N5WA 1E24A 4BY1G 2PPHA 1Q3LA 2F1MA 4A3JG 2AQ1B 2VZKB 3GTKB 4FN2A 4ZHOA 1FJGQ 1X9NA 1WD1A 4GLXA 1CK1A 1CZWA 3KUDB 3X3NA 2JXTA 2F0SA 2KTFA 1Y14B 2JX5A 2ONQA 5L95C 3CCMA 4AOFA 2C7NB 3QX1A 2KQ7A 4E71A 1B9MA 1Q0WB 3BDOA 1G6JA 1FXIA 1L6UA 5CHWA 3MHBA 5IO9A 1FR3A 2WACA 3VUWA 3VR3A 2EYMA 2F0JA 1H95A 2OOBB 5BMGA 4XYOA 3SEBA 1IW7D 5C3EH 4A4IA 3UI2A 4LTUA 2DAFA 2L52A 2HQLA 3HFZB 2PZTA 4US9A 3DHQA 4WWOA 1WYGA 3ETRA 4QCLA 1ROEA 2MBEA 3ZNHB 1LT5D 5ELOA 1WJ4A 4GSWA 3T3OA 1NMFA 4AQ7A 3CCJA 3ML8A 2XWJB 3L9AX 4CJ0B 3K58A 2J42A 2HDLA 4IWOA 4MZ9A 2DENB 3QHTA 4KHZA 4A3DG 2Z6KA 2D07B 3ZNZB 5M5XH 3AQQA 3AEBB 2KBNA 4MGZE 5GXGB 1EQRA 4FA6A 1ESFA 3KQ4A 1B3QA 3QWNA 3KUCB 1L0VB 1TTNA 5FK9C 2DHZA 1HTOA 1LO5D 4QIWE 3GP7A 3GTQH 3L0WB 4KSLC 2R93G 4LDTD 1J0GA 2MBBB 1U4LA 3CXCA 2JA5B 4P73A 2RMMA 3K7AB 3NVVA 4IPHA 1G6PA 4A20A 2NVUI 2L55A 3X23A 2HDMA 2IHFA 2IJ0A 3F8TA 1IBKQ 4MHEA 3S2DH 3A56A 3QO2A 4JBJA 5LMUQ 4A3GB 3H3VC 5JHAA 2RHQB 3KJPA 5JJLA 2DN8A 4L63B 3OTOL 2PYKA 3JAMi 4K8IA 1T0RC 3NEMA 3R93A 2K03A 3PIOA 4LF6L 2G4SA 1EIGA 2KQ4X 3D32A 3BK2A 4A3GG 4A3FH 2KAJA 4E6IA 1EYGA 4JVZA 4A3EH 1F2LA 3AEDB 1DOIA 1LTID 3AYHB 2PNRC 4H44C 3U7DA 3TEZA 2A4ZA 3HOYG 1PDXA 4LF5L 3J7A5 3D31A 3KF6A 3STBC 1Q1BA 4UPAA 1WGHA 2Y0SG 1RFKA 3F1ZA 4JOIC 4TQUS 4PZ6A 4DK3C 2F0OA 1NR2A 2PQEA 2KWDA 1X3EA 2BWFA 3T56B 2UXBL 4Q0FA 2F0FA 3J80i 5KNDA 4A3JB 2N9XA 3DM1A 3U30A 4OIKA 1U4RA 2R7DA 5K36H 1C3TA 4H7BA 1TWHB 2K05A 2XIWA 1PTOH 1ACCA 3I4LA 2BB6A 4GDLB 1YD8U 4OWTB 3Q24A 1Q90A 4BY7H 1FNVA 2WFWA 1KOTA 4I6LB 3EQLC 3BZKA 3S16H 1OEYA 3LNNA 1LTAD 1MJCA 1KAWA 1NNXA 2LI5A 5BN4A 3EROA 5C5MA 4DV6L 1MD2D 4X62L 3JAME 4QL5A 3S1RH 2MLBA 2XEWA 4DHJB 3R66C 4DAPA 3T8MA 5H1SE 5DPTA 4MNOA 1T9HA 1C4QA 3FPUB 4CHTB 4DBGA 1YNTE 3NUHB 3OSOA 1N32L 3O65B 1Q12A 4G7ZC 1XCQL 3A8KE 1OXTA 1EWYC 2Q2HA 3DBSA 5DNFA
chains in the Genus database with same CATH topology
3RMHA 2LFNA 5C0XH 3RZDB 2N9KA 2EY5A 5CV9A 1LV9A 3ERQA 3KBXA 2M19A 4TMAB 4J6HA 3IL8A 3H91A 2DBYA 1U9RA 4KN7C 1YMHE 4HR7B 4NJCA 2V0GA 3OIPA 2D5GA 3Q8BA 1E2VA 2WS3B 1UUPA 3S1MB 2Z8LA 3VR5A 5D3DA 1I4HA 5DM73 3AECB 1TZOA 1PLFA 2RDFA 2WLBA 4O42A 3WCQA 2IX0A 3S2DB 1X32A 3EGRA 4ZLTF 1HUNA 1NYQA 4FF3A 2C9OA 1EQTA 1UNSA 2L5TA 4ZQ3A 1SNQA 1K52A 3VYRA 4L23A 1XLPA 3LX0A 4FVMA 2F0DA 4HRSA 2LHEA 1L0XB 1F2RI 2F0KA 2WKDA 1F9RA 4BBRB 4P6VF 5LL6S 5MPOA 1SAPA 3B2GA 5FO7B 2B2WC 1GUGA 3AE9B 5JOBA 1Z47A 4MH8A 2JSOA 3VR2A 3T3NA 1JQ4A 2JWUA 2IGHA 1PTOB 1PMRA 1BNZA 4K6DA 3S17B 1A6XA 3R3OA 3HS0C 5ISRA 2BDNA 1PTOD 4L6TB 4YTMB 1HTPA 3K59A 3CHBD 1AZQA 2QIEB 2IX1A 2EY1A 1XYIA 1IKMA 3M4YA 1FEHA 1B53A 1IW7C 3ZQ4A 1F2ZA 3VRAB 1CM9A 2D5DA 3W2DA 4KX6B 3SK8A 1B3AA 1EL0A 5EBCA 1F2RC 1AW7A 3D4RA 1STEA 4PV1C 1S4ZA 2HDEA 1LABA 4EE2A 4PMBA 3AEEB 3Q8FA 3LYYA 1GPXA 5HGTA 1MVKA 2G9HD 2QKIC 4XT3B 3NBHA 3FILB 2EDGA 3I4MB 1EQVA 1SDFA 3K0YA 4WQMA 4IUNA 3PO3B 4RNAA 5I2XA 2B2UA 2E75C 2HTME 4ID6A 1FFVA 1WVLA 3Q0AA 1PXUA 4RGTA 5KEEA 3P1HA 4HKZE 3KLSX 3PIO3 4TQ1A 3I4NB 5CV5A 1SSOA 1ET9A 2PPBC 3HOUB 1PFNA 5D65A 2A6EC 5BN3A 1LACA 1RJTA 3GTJB 4QUCA 3SXHA 5CGKA 3U9OA 1F9PA 1T3QA 1BMLC 4K5VA 4IUQA 4ITKA 3TEWA 1LTSD 2KN4A 4K8JA 2EY6A 5AUKA 1H9KA 5ELFA 4OHJA 4N6EB 3HOVB 1R4QB 3AB5A 3AB9A 3VR4A 1TYGB 4L1BA 4CJ2C 2CJOA 3NS1A 3OHXC 2SDFA 5G3LD 2R3ZA 1Y1VB 5EPJA 5EE0A 2PCFB 2YEPB 4H0LC 1LTGD 4OL7A 4XT1B 1B1ZA 3I3CA 2NVTB 3PZ7A 1NSNS 3MHZA 1JMLA 1PZKD 1C4AA 4NAMA 5IOCA 1D6EC 3PUVA 5EQ0A 2K5PA 2I2YA 3HVDA 1HTLD 2EZVA 1GUNA 2LS01 3VR8B 1PFDA 2IT1A 1QF6A 1DCZA 5KNBA 3QOJA 2NUCA 2MJ8A 3SR1A 3MXGA 3GTOB 3H0GB 4RF1A 3P4PB 3T13A 2YU9B 4R8IA 1YN4A 5C3JB 1HHVA 3PUYA 1JW9D 4DK1A 2IGGA 1HQRD 3FC4A 1QB5D 1QKZA 3A54A 4XXEA 1XLQA 1SFOB 3K6OA 2I46A 1SYDA 4QIWB 3E6ZX 5JEAG 1QQRA 3DEOA 5M5WB 2PO4A 2B2TC 3AN1A 2A69D 3E9SA 1NCVA 2BOSA 2BS2B 2KCNA 4CKBA 1MI0A 3KWVA 4V190 2Z4HA 1DOXA 2OXPA 2DWQA 5JEAH 4D2KA 1Z7TA 3S9WA 1Y8NB 5I4DA 1PRTB 2AWNA 1MPEA 3NQIA 2BBCA 3D8GA 1WGKA 4G7OC 4CKEA 4PMCA 4Q5VA 1YN3A 3G6JB 3V3XA 3H8HA 2QEJC 3KF8A 3NWSA 1PZID 4C3HB 2KQ3A 4BA1I 4OO1I 2JQRB 3AEAB 4NMZA 2O2LD 4QB4A 2WINB 1L4ZB 1QOAA 1JALA 3AE5B 5HFYA 2F3VA 3MEHA 1K8MA 1NI3A 3CQZB 2JEBI 5A2QE 1SE3A 5JVG3 1FMAD 2F0QA 1M8AA 2CW0D 3U9SA 4HEA1 4IKGA 4YSYB 3RPFC 4IFDH 5G3LF 2DLBA 5E4XA 4OZAA 2Q5WD 2RPVA 3AV8A 2K5WA 5KYIA 2FINB 5CMDA 2G1EA 1IL8A 4YSXB 1TWGB 5D7GA 1IUEA 1EZ6A 5IT9L 2F0NA 4BY1B 5JPNC 4HMJA 1YNNC 4KGTA 1N62A 3I70A 2E2IB 2LMCA 4KD4A 4ZHPA 5LNK1 5CV6A 2L0CA 1C78A 3MXNA 1S5DD 1ZDXA 3DWGC 1QILA 3NE5B 4LMQD 5IGGA 2WXQA 3ZGZA 2NBFA 2VUMB 4FXCA 4UDUC 1SEBD 1BUVT 4FXGC 1VJKA 2BE5C 2NTTA 1PRTD 1XTCD 1R4PB 1A15A 1EWHA 1OXSC 3TSSA 3J80L 1JRPA 5T8IA 4C7YA 3HP3A 2BTEA 4EQNA 3SHLA 3GTMB 1QCBD 3ZYYX 2K32A 3LWEA 4C3JG 4CGYB 1YNJC 3TUOA 1EWCA 1EYAA 3NUCA 5EJWA 2I07B 2WP8J 1Y69U 2WXJA 1I6HB 2K1BA 4JWUC 3Q6SA 2R93B 2JYOA 1R9TB 2O5JC 1L4DB 2F4IA 4DU9A 2FE8A 2I38A 3AE3B 2F0UA 3FKIB 4RWSC 4J3OD 1TKWB 1H9RA 4HN7A 1QWYA 5C2TB 4DA2A 3MWYW 2L12A 5M3FB 2X38A 1QT9A 1FNWA 4RF0A 1D2BA 2RDGA 4IUPA 2B76B 1WCMB 5KIXA 1CQFA 4H13C 3SK5A 2WU2B 1IGCA 2ID0A 3TN2A 2X69A 2E6XA 4B9WA 2WP9B 4V0BA 1TKYA 3C8YA 3BWUD 1G2SA 1D1IA 1ZXIA 2A68D 1SF0A 2XN9C 1LTBD 2BW2A 3V05A 1I4XA 4U68A 2B2UC 4ZAIA 1B50A 1XX8A 1WTRA 1DJRD 1E10A 1TJEA 2F0IA 4A8XC 2YEPF 3AE7B 2MUYA 1V8QA 5IGBA 1SBBB 3OMGA 1SXTA 1GXDC 1C4PA 1ZE3D 1HFNA 1KF6B 1C9FA 3CU7A 3L4PA 3IAM1 2Y0SB 3J80E 4RCNA 1ESRA 1B44D 4USAA 2Y3AA 4YWGG 1Y8OB 4ABNA 2A74C 2L1AA 1AN8A 2L11A 1WTPA 3DWPA 3BDLA 5DAUA 3H6MA 2ON8A 1BO0A 1EZ8A 5BYRA 1F2MA 5C4JB 3D4WA 3T16A 2QSDA 3PIP3 1Y8PB 3IT4B 5JAVA 4OZCA 4IZ8A 1TS3A 2B2WA 1P7FA 4DFAA 2MJDA 4AS1A 4JWSC 3GO5A 5KGUA 3MA2B 5BYQA 1SNPA 1RKNA 1BR9A 1TWFB 1PGBA 3BZDB 4JBWA 2EY2A 1MBYA 2IPKD 1ZYRC 2EYPA 1ILPA 4RGMA 2RSNA 4ODGA 1MSGA 1UEAB 5BYSA 2OT2A 3A8IE 1I4QA 1STYA 4FYDA 2RA4A 4RKLA 1SJED 4S3SA 1YN5A 2PW9A 3K5NA 1TS5A 1ILQA 4KKSA 5FLXE 2Y5CA 5C0XJ 1STHA 2IX3A 1XLOA 2KACA 2RQXA 3IAS1 3M7NA 1XEEA 1VLBA 1YQ4B 4DGZA 5J22A 1PGXA 4XDXA 1V1PB 2XVSA 2DYMA 1W6KA 1SYCA 4RGNA 3AE2B 2FMCA 2PZUA 2WXGA 1GB1A 3AU7A 1E9MA 3ZJVA 2CU3A 4XTCS 4HKQA 1O7ZA 1E6EB 5ELBA 1EY0A 3P42A 1BF4A 3K57A 4XQQA 4MM3B 4I65A 5FR3A 1XXGA 3D3RA 2WXIA 2NTSA 5M5YB 4K5WA 1I50B 2BE5D 3AE6B 3NVWA 4KTAA 4X3SA 4A3BB 1FD7D 2N0SB 2IW3A 1Q10A 1T6BX 1U4PA 4YSZB 2R6GA 2XRQD 4G7HC 3AH7A 4NP5A 3DWMA 2WDVB 1PRTC 1O80A 2PTLA 2EYFA 3S14B 2ZXPA 4WRDA 3B9JA 5ELDA 2PW5A 2K0PA 2LUMA 4J1MA 1RF2D 3X3MA 2NMQA 5E6JA 2DY8A 2HCIA 4KY7A 1NVID 1WTQA 2WXOA 5CV8A 3VR6A 3M7GA 5E3FA 2Q8RE 1JQYD 2QF7A 1Y56A 3ONAB 1J7BA 2E3TA 1HFGA 4A3KB 3H09A 1VMCA 2A69C 4RA8A 1QNUA 2CQAA 5JPMC 1D4BA 1Y1WB 1K51A 4IFDI 5I6WA 3HGBA 1FD6A 4XYQA 3JAML 2PMVA 1CA5A 4FF1A 2LY7A 2CJNA 2RSOA 1G291 3Q23A 5IGCA 2SAKA 3G7LA 3DXJC 3LXFA 1WTWA 4C3IG 1Q1EA 4K2LA 3W9CB 3BIID 2F03A 1EY7A 1QOFA 5C5LA 2VZKD 4ZKCB 4FXDA 4A90A 2EYHA 3PO2B 2INPE 5TSSA 4F7XA 5NUCA 3DMUA 3FDTA 2LMCB 4RAUC 1JOQA 2PMZB 3RD4A 2H1EA 3P4QB 1VZ6A 1JB3A 1CTMA 3VRBB 5HI1A 5COYA 1V97A 1O7YA 3T53B 3TEXA 4PT5A 3URYA 2XRSD 1I4PA 2HUGA 2M2LA 3HVZA 1NR4A 3A7AB 1ZP0B 1JICA 3BK1A 2O4XA 1A2UA 3I72A 3CIRB 1N60A 3RLFA 2AUKA 1TS2A 5CC4A 2K04A 3M4OB 3Q22A 2WDRB 2A6HD 1FM0D 2JZPA 1N5XA 1X3QA 2ACZB 4IN3A 3E5SA 4PNYA 1DZ1A 1GUTA 4ZRPA 1QOGA 2OHFA 3A8JE 5ELCA 3RUZA 3S1QB 1AZPA 2L1BA 1D1KA 1PRTF 3VQIA 4GLSC 5EPKA 1TIID 3MVVA 2ZT9C 1IHZA 2INNE 4QMGA 1YNJD 4CQNA 3QOLA 2FHTA 1J9OA 2A5HA 4G57A 4B0EA 5IT9E 3A55A 5K36G 2Z1CA 3J9CA 3HRDD 1Z6HA 1VDVA 4WORA 1G8ZD 1JWAD 1SNMA 1WTOA 4KHVA 4N9TA 2GA4B 2R61A 5C44B 2E2JB 5C3WA 4FF2A 1WD0A 3HG9A 4Y7NB 2YYZA 1UGJA 2JA7B 2ICIA 2M00A 2MEKA 3T51B 1HQMC 2FJ2A 2B39A 2RDHA 2R7ZB 1PDQA 1EY5A 1STGA 2EVBA 1CI3M 3E56A 5EKKA 5F2DA 4TKOB 2JA6B 4TSSA 5C4ZA 1EEID 3EA6A 2LKVA 2HQEA 1J7AA 1C77A 5M3MB 4BWGB 3HOZB 1J7CA 3M85A 5I6YA 2BS4B 1GJXA 2BDOA 2XWBB 1JWBD 1GOZA 4XDDA 4RCOA 3AE1B 3OMCA 3TDQA 5J39A 3S1RB 1FRRA 2B63B 2WXFA 2EOTA 2WXLA 2BYTA 3P4SB 2KEDA 3R8BA 1GUOA 2EELA 4RHRA 2EYOA 4C1NI 3J81E 2B2TA 1B9NA 1BCPC 2PVGC 1XLNA 1HRJA 1EY9A 5C4HA 3K5MA 2J0TD 4A93B 4KJOA 2JYTA 1A3UA 1JE4A 1NUCA 4LAAA 1GAQB 1RYJA 3ZJTA 3Q8EA 1BCPB 3TP6A 4WURA 5G5HA 1AFPA 3HOXB 4KKUA 1FRDA 5HHDG 4NZLB 4H2AA 4B08A 1XCTL 2F0GA 4C3JB 5BN5A 2XNAC 4DAVA 2W82A 3FPPA 3HZXA 1K83B 4XQNA 5J1ZA 1IKLA 2B2VC 3VYUA 1U4MA 1ZPSA 2KJXA 5CBEE 4IFDG 3FVQA 4A6QA 4I7ZC 1X3PA 4TRDA 2F0HA 1RCVD 1SYBA 5IGFA 3NK9A 1F9SA 1SNOA 2H88B 2WNMA 1L5PA 1Q8IA 4LLGM 4O1NA 4ZRZA 5CORA 1WXQA 1HZ5A 3F2UA 1PYWD 3LB8C 1CZPA 3AEFB 5JEAJ 3NSWA 5E1FA 1I6VC 5T1IA 4C80A 5BMIA 5JXVA 3OOCA 1TS4A 3BVZA 4B0MA 1M4VA 2EJMA 3AE8B 3TP8A 1WRIA 1KDAA 4DXGA 2GB1A 1NEKB 2PZWA 4FNFA 1EY6A 4KGSA 2ZXRA 3QG1A 1V1PA 3OPOA 1IYUA 4RFBA 5EBDA 2LHDA 1E2WA 2GRIA 2PVOD 1DOKA 2MJEA 1F77A 1STNA 3SE0A 5IGDA 4OZBA 1BUIC 4C3HG 1TVXA 3W1SA 1STAA 5FO9B 1SNCA 1TKEA 3C1EA 1OFFA 3NWTA 2J52A 1QE6A 5EKLA 3MP9A 5ELEA 5C3XA 2PW7A 1JOOA 5EE9A 1LTTD 5FKAC 3J81L 2B8GA 4YIJA 3V96A 2DY7A 3MXPA 3MC0B 1VDZA 1CT1D 1S5CD 3GQBA 2F0WA 4ME5A 1WTVA 4ZKBB 1RTNA 4RHSA 1SYGA 4PMWA 4JK1C 3BVGA 5E4WC 4XIGS 4IOIE 4FP5D 2K9XA 1EM7A 4OGQC 1VZ8A 1D5MC 1RODA 3PUZA 2EYLA 3TP7A 2N9LA 1XWEA 4M8AA 2FMMA 2H89B 4BY7B 1N61A 1OXUA 1ZUD2 1PUTA 4RH6A 3E0JA 4WJWA 4US8A 5JVH3 4HSVA 3BYYB 4R3DA 5CBAE 4KI0A 1AYFA 1VMPA 5I2YA 3A7LA 2W3SA 3LWUA 1KFYB 3W5UB 2Q8IB 1B2TA 3VA5A 3EFXD 2LGIA 4XWWA 1A3TA 1F2YA 2BS3B 3PMFA 4R8NA 4DAYA 2J4XA 1K53A 1HA6A 1EYCA 1S5ED 2R92B 3FRPB 4ZOHC 2A68C 2Z4IA 4C7ZA 3IFDA 1MHHE 3U7ZA 2V3NA 1MSHA 4KMUC 1SE4A 2FBWB 1EYDA 2WXNA 4WAFA 4F88A 4NW2A 4KV6A 3VYSA 2CHBD 3GB1A 4YTNB 4HROA 1LT4D 1JROA 2PIAA 5IODA 1TWAB 2IGDA 3KWLA 2K01A 4DXFA 2IWHA 3I73A 1VR9A 1ZXHA 2NZ1D 2WB1B 2DNCA 3BDCA 3M3YB 2EYJA 5CV7A 1P7EA 4HCSA 2LFIA 4U673 3OW7A 5FOBB 2K6AA 2K3UA 2NVYB 2XSCA 4ZUIA 4GDKB 4IUVA 4WH4A 2E2DC 1CJEA 1SIJA 2WXMA 3TBIB 2AUJD 3DEPA 4X3KA 2WIIB 1KDCA 2PKOA 3UI3A 1PFBA 2JYEA 3NTIA 2G9DA 3CRLC 1A2TA 3N6RA 3OIQA 1C4CA 1A3VA 2HCCA 1ENAA 2NYZD 2JU6X 3AEGB 1QLBB 3B2FA 5C4XB 3N52A 1OXVA 5G5GA 1JC7A 3C1FA 1GHKA 2KOLA 2AX5A 1L6VA 1KTKA 1B4OA 1JCKB 1FIQA 3J7AV 4WWMA 4JPSA 4ZUJA 2B2YA 1ZEQX 1ML0D 1KNEA 2E74C 3SK6A 2VNUD 3GTQB 4QF4A 4AYBB 3PV0A 3QIAA 3NBIA 4RGOS 1DONA 2KECA 1W6JA 2KHSA 2EJGC 3L7ZC 4A3MB 3FILA 1ENCA 1CZGA 2OEDA 1UAPA 1HEZE 3CKIB 3P20A 3GS2A 4JX1C 3BVMA 3HRZC 2CW0C 3SK4A 1MHXA 1L0YB 4OO1H 4G4KA 1TQOA 3K5OA 1KH0A 2L83A 2F0MA 2GI9A 1LT3D 4ARCA 1ZYRD 2Y5PA 1D5XC 4YXDB 1V1OA 2WAQB 4HSPA 3TEYA 3ZJUA 4LK0M 3R2TA 1FCLA 1DM0B 3MFYA 4XDCA 4ARIA 4XE0A 2K7VA 3VYTA 2M0AA 5IGEA 5D3IB 3FAHA 1J8IA 4J8QA 4ZK9B 2K33A 4C56C 4X3TA 4CKCA 2NWGA 5CR3A 3S1NB 5EE3A 1KNAA 5CV4A 2SNMA 5DM63 2V3PA 2F0LA 4UAIA 2D9UA 2BB5A 2KVMA 1O7LA 4KKIA 2H4OA 1H9SB 5BMHA 4KK7A 3C2PA 1JWSD 4K2KA 2TSSA 3HEJA 3Q8AA 2J7ZA 5H8YE 4DN4M 4DNTB 1T5EA 2MP1A 5I9OA 1SMYD 2F0EA 4M0WA 2O5IC 2EXZA 5T1GA 1T5XD 3S2HB 5M5XB 1K8OA 1G6ZA 1CFMA 3GD7A 3RZOB 2WXKA 2M56B 4ULLA 5KYLA 2WXHA 4KY6A 2TMPA 1VRAB 4XWTA 1TY2A 3KUPA 1WTXA 1OQRA 3EUB2 3HOYB 4MACA 4IALA 4DF7A 4IURA 4K6LA 1E2ZA 1EY4A 5EKIA 3NQTA 4R9WA 5JJZA 1V8CA 2VB3X 3D4DA 3HUIA 1QG7A 2VXWA 2BA1A 1BBXC 3MTSA 3TZDA 3IXSA 3D6CA 4REZA 2KA7A 2A6ED 5I9PA 1F9QA 1KAAA 2OF1A 4F8MA 3CRKC 1KRHA 4KY5A 4LK1C 1E0ZA 1EOTA 3P1MA 1HXYD 3J7YW 2NVQB 3GV6A 1GB4A 3Q69A 5AUIA 4IUTA 1PGAA 4KKTA 1DD2A 1H9SA 4IFDJ 4JE3B 2SNSA 1IBXA 5A35A 2X6LA 2WV6D 4EGVA 4ZRQA 4K14A 1ET6A 3IKJA 1I4GA 4EQPA 5KNCA 3ND9A 2N7JA 4NAWB 1TT2A 2NN6H 3Q8CA 1F0ZA 3NRZA 2KDMA 1TR5A 4L2YA 2QILA 3SFEB 3FEWX 1JORA 3D6WA 3W5VB 3IAYA 1PTOF 3GTPB 1IYVA 5H92C 3SR6A 1TY0A 3ND8A 1FGBD 1CQVA 3AMUA 3IT6B 4LJZC 1PTOC 1BDOA 4KGRA 1A70A 1GUSA 1EIHA 3RFZB 5A2QL 3SFDB 5HG2A 4KN4C 1SYFA 1UWMA 1DGJA 1AWDA 3T4AC 3GTGB 5K5PA 4N59A 4HCEA 2EJFC 4FF4A 3AM9A 1RM6C 2B2VA 1FCCC 2RVLA 3V2TA 4MN3A 4P2CB 1VF7A 2B2YC 4C1NK 2V4IB 1GHJA 2L32A 3I90A 2D2CC 1VF5C 4C2MB 4Z9CB 3I8ZA 3R2IA 4F87A 4FXKC 2DYOA 4FO2A 1EU3A 2M9VA 4WFN3 1C79A 1TWCB 4HTHA 1C48A 5DEHA 2B8FA 1TKGA 1I3QB 4BS9A 1STBA 3I57A 2NVXB 1II3A 1CA6A 1H9JA 1WSPA 2K5QA 2DNEA 4WIPA 2F0VA 2RKSA 1JOKA 2LJIA 4RKBA 2NN6G 1MGSA 1HUMA 4OO1G 4B9XA 2ZW0A 1DYQA 3CWIA 2EE1A 4PQXA 1CHQD 1PZJD 3U4EG 2CVRA 2QDBA 2AWOA 4OVZA 4DQOC 2JE6I 5M9OA 4KKJA 3PO0A 4Q2JA 3S15B 1S5BD 3SDZA 1JR0D 5AFWA 3P4RB 2QMTA 3GV3A 1QOBA 3VA7A 2JSVX 1SE2A 2F0PA 1SNDA 1NENB 3NP8A 2VB2X 3PUWA 1YNND 4NKLA 2ZXOA 4P16A 5EGTA 2WU5B 1VCIA 2MPMA 3C46A 1E0BA 2A73B 3O13A 1N63A 1JWMD 2JA8B 1QNKA 1RTOA 2K5DA 3S16B 3BS1A 3MAQA 3P63A 4A3FB 2ICEC 4DK0A 1RHPA 2OEOA 1BOSA 4HAEA 1RWSA 3OWEB 3NTHA 1CHPD 1KDBA 2F0TA 3AMZA 1B9RA 3NPPA 1YJIA 3NTKA 1SSNA 1EU4A 1YQ3B 2BCOA 2MGSA 1ZKOA 2JP1A 1G2TA 4EVOA 4A9AA 5C0XI 3MXUA 4XQJA 3KLSA 1ICWA 2K28A 1BCPD 5D14A 1XF5L 2D62A 1SYEA 1O78A 1OO9B 4OIJA 2WXPA 1QJOA 4EQOA 2L4NA 3AE4B 2JEAI 2FUG1 4K5XA 4ILWA 3NVYA 5LHY1 4CJ1B 1FYCA 4NDXA 1BQQT 2MJ3A 1V43A 2W55A 2EKIA 4DNRB 1FO4A 2AQ3B 4IDIA 1EY8A 1ZOYB 1R7SA 3N9YC 1I4RA 2PLPA 5FLXL 4OW0A 3NVZA 1IGDA 1UWXA 1TU2B 1RDPD 5C6AA 1I7HA 1ZDVA 1HA5A 2KUMA 2X6GA 2MH7A 2JXMB 4HEDA 1OXXK 1DOLA 4TQ0A 2RBMA 1EFID 1VZ7A 2NB0A 3WDNA 1JWUD 2KCCA 1AEXA 3WOEA 5CYUA 1PFMA 4YT0B 3DUZA 2ENBA 4C3IB 2V4DA 3TMEA 3H94A 3VR9B 2K22A 2ZW1A 1MI2A 3EVQA 2BA0A 4IUUA 3I9V1 2IDYA 3U52E 1LTRD 3KK7A 2A6HC 3DWQA 2W54A 2J53A 2LEKA 3BYTB 2KMMA 3FMCA 3C3LA 1ENFA 1NAPA 3NHHA 2QJLA 4N58A 1C76A 5IIFA 3K5LA 3U2SC 1ZXTA 2WKCA 2IL8A 2QCPX 2WDQB 3QJYA 4GZYC 2N88A 4KJNA 1K50A 4L8JA 3PZ8A 3L3OC 1ONLA 1E7PB 2WXRA 2EPBA 2E76C 3WOFA 3BG3A 1D5ZC 2L9HA 1BXTA 1HPCA 1LLRD 4ZYSA 3ABVB 1H9MA 1FNUA 1C8CA 5HURA 3J7AF 2BT6A 4MIUA 3GTLB 1SJHD 3EJIA 5LL6X 5KRUA 1FFUA 3IFTA 4IQZA 1DOMA 3ITPA 3OWFA 4HJGE 2N55A 4YTPB 5EE1A 1DOYA 2FFKB 4BBSB 4X3UA 1YJJA 2W3RA 3P7JA 2AQ2B 3MJ5A 3W3AA 1BCPF 4KD3A 5EPLA 1HZ6A 4HMIA 4N9PA 2SOBA 3I91A 1QOHA 3SVMA 3HOWB 1OQQA 4A3IB 1FXAA 4BA2I 4A3DB 5C3EB 4QUFA 2C5CA 1EEFD 3NZ3A 3NXWA 2SEBD 1KABA 5FO8B 1DXMA 3TP5A 5C0XG 1HCZA 2KEEA 1G91A 1GUWA 1KLUD 1RD9D 1KLGD 2MHVA 3TZUA 1WWTA 1S5FD 2Q8TA 4M1UB 3DWAA 3P75A 3QB3A 1SB3C 4A3EB 2E2HB 1IBXB 3HKZB 3PUXA 1SMYC 2F3WA 4A55A 4MT5A 2NN6I 3KBGA 3KLRA 1AP0A 4CBVA 3MZ5A 1LT6D 1NYRA 3MFGA 2WQYB 1XO3A 1N5WA 1Q3LA 2F1MA 2VZKB 2AQ1B 3GTKB 4ZHOA 1WD1A 1CK1A 1CZWA 3X3NA 2JXTA 2F0SA 2JX5A 2ONQA 1B9MA 3BDOA 1FXIA 1L6UA 3MHBA 1FR3A 2WACA 3VR3A 2EYMA 2F0JA 5BMGA 4XYOA 3SEBA 1IW7D 3UI2A 4LTUA 2L52A 2PZTA 4US9A 3DHQA 1WYGA 3ETRA 4QCLA 1ROEA 1LT5D 3T3OA 4AQ7A 2XWJB 4CJ0B 3K58A 3L9AX 2J42A 2HDLA 4KHZA 3AEBB 5GXGB 1ESFA 3KQ4A 3QWNA 1L0VB 5FK9C 1LO5D 3GP7A 1U4LA 2JA5B 2RMMA 3K7AB 3NVVA 2L55A 2HDMA 2IJ0A 4MHEA 4A3GB 3A56A 3QO2A 3H3VC 2DN8A 4L63B