1EU4A

Crystal structure of the superantigen spe-h (zinc bound) from streptococcus pyogenes
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
204
structure length
204
Chain Sequence
NSYNTTNRHNLESLYKHDSNLIEADSIKNSPDIVTSHMLKYSVKDKNLSVFFEKDWISQEFKDKEVDIYALSAQEVCECPGKRYEAFGGITLTNSEKKEIKVPVNVWDKSKQQPPMFITVNKPKVTAQEVDIKVRKLLIKKYDIYNNREQKYSKGTVTLDLNSGKDIVFDLYYFGNGDFNSMLKIYSNNERIDSTQFHVDVSIS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SUPERANTIGEN SPE-H
publication title Conservation and variation in superantigen structure and activity highlighted by the three-dimensional structures of two new superantigens from Streptococcus pyogenes.
pubmed doi rcsb
source organism Streptococcus pyogenes
molecule tags Immune system
total genus 60
structure length 204
sequence length 204
ec nomenclature
pdb deposition date 2000-04-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01123 Stap_Strp_toxin Staphylococcal/Streptococcal toxin, OB-fold domain
A PF02876 Stap_Strp_tox_C Staphylococcal/Streptococcal toxin, beta-grasp domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.110 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1eu4A02
3.10.20.120 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1eu4A01
1UUPA 1RF2D 3EA6A 2XNAC 2QILA 1D5ZC 1ET6A 4OHJA 2RDHA 1EEID 1BCPF 1LTID 3W2DA 1UNSA 1HXYD 1EEFD 3CHBD 1PTOH 1S5ED 2IPKD 3MFGA 1SEBD 1KTKA 3OWEB 3DWAA 1TS4A 1TS2A 1LTGD 1LLRD 2R61A 1I4PA 1TS3A 1I4RA 1TS5A 5D3IB 2XRQD 1PTOB 1M4VA 1LT5D 1JQYD 2SEBD 1PZKD 1FNVA 1S5BD 3TSSA 3BVGA 1L0YB 2CHBD 1AN8A 1YN5A 1GOZA 1BXTA 1DJRD 1HQRD 2XRSD 1D5XC 5FK9C 3R2IA 1PZJD 1RD9D 1V1PA 1XTCD 1XXGA 4NZLB 1I4XA 5D3DA 1KLGD 3MC0B 1SE4A 1SE3A 4RGOS 1PRTB 1LTSD 1G8ZD 1KLUD 3BVZA 4RHRA 1EWCA 1LO5D 1TY0A 3DWQA 4RH6A 2J4XA 1CHPD 1JWUD 1TY2A 2ICIA 1S5CD 1F77A 1BCPB 2G9HD 1LT4D 5FKAC 4ZYSA 5ELCA 1S5DD 3BZDB 4DXGA 2RDGA 4Z9CB 1V1PB 3SEBA 1ENFA 4L63B 1I4QA 3V05A 4BWGB 1CHQD 3GP7A 1LTAD 3URYA 1PYWD 1EU3A 1SE2A 1FNUA 4C56C 3R8BA 1I4GA 1PRTD 3KLSX 1T5XD 1HA5A 1JCKB 1D6EC 1FGBD 1QILA 1SXTA 4RGNA 5ELDA 3EFXD 1JWMD 1ESFA 1SJED 2Z8LA 1HTLD 1JWSD 1B44D 1DYQA 1ET9A 1LT6D 1V1OA 3BYYB 3BYTB 1YN4A 1LT3D 2AQ1B 1CK1A 1JR0D 4L6TB 4RGMA 5TSSA 1BCPD 1SJHD 3DWPA 1EFID 4K6LA 4O1NA 5ELFA 1PTOD 1B1ZA 1PTOC 3R2TA 4RHSA 1MD2D 1S5FD 1STEA 1LTBD 1RDPD 1AW7A 1PTOF 2AQ2B 1RCVD 2IJ0A 4UDUC 1FNWA 2TSSA 1LTTD 1PZID 1D5MC 2NTSA 3BVMA 5ELEA 3O13A 4RFBA 1LTRD 5I4DA 1PRTC 1CQVA 4TSSA 4DXFA 1FD7D 4RCOA 1I4HA 2WV6D 2QEJC 1SBBB 1PRTF 5ELBA 1EU4A 2AQ3B 1YN3A 1CT1D 1L0XB 2XN9C 1BCPC 2NTTA 4RGTA 2O2LD
chains in the Genus database with same CATH superfamily
1V43A 1V5TA 4GN1A 5T8IA 2VQFL 1TXYA 5J3BA 2EJGC 2KHIA 2RSOA 3BWUD 3PHWB 4IM0A 3IFWB 4UP8A 3U9SA 3QO2A 1G91A 2RD0A 2WXPA 1IBLQ 5M3MH 4DHZB 1F9RA 2BB6A 3CHBD 4K5XA 2Q2UA 1VCBA 1L6UA 1PH1A 3A1QA 1KJTA 2IPKD 2ZJRA 3VYRA 1MFWA 3JYUA 1ZPSA 4HRSA 3V60A 4QIWE 1PFSA 1H8CA 1Y1WG 2Y5PA 3ZVVA 3HG9A 2K01A 2LXJA 1R4MI 2E2JB 4K81A 2F4VQ 3HOYG 4XDCA 4KMUC 3HGBA 4TQUS 1I4RA 2KHJA 2NB0A 3H09A 2WU5B 1BUVT 3AYHB 4JBJA 3AE7B 4ZCKA 1P0RA 3M63B 1RIPA 4HTHA 3L54A 4MGKE 2HUGA 5JHBA 3L0WB 3VRAB 2LGXA 3F1ZA 3I2ZA 1IXRA 1J7CA 1SYCA 4GMVA 3W5UB 2I2YA 1AP0A 4UPAA 4DDID 3SFDB 3I57A 3GD7A 4DDGD 3VFKA 3DM3A 2NVYH 4KD4A 1GUAB 3FILB 2R2OA 1FJGL 4NQKE 1SE9A 4NZLB 1GXDC 4BY1H 2K5NA 3MFYA 1D7QA 4QUFA 2V1YA 5IYCG 1G8ZD 5JPNC 3RZWC 3A56A 3NY5A 4R4OA 1PQSA 3Q23A 4A3OA 3Q3JA 1X3EA 3ZJTA 3CWIA 2A68C 4KGRA 4MTKA 4II3B 1S5CD 3H94A 1IZ6A 2DNFA 1WCMG 3S1MB 1N36Q 3LWEA 1HNZL 1TTNA 2CU3A 2Y5CA 1VQ4A 1SYDA 4LDTB 1UWVA 2IO3B 2KWUB 2L9HA 5BMIA 2UXCQ 3M4YA 4XT3B 2PQEA 2RCFA 4M1UB 2VH1A 3ZRCA 1UEBA 5BN3A 1MG8A 2QDFA 1YHQA 3M4OB 3V05A 4HCNB 3N30A 4M00A 3V3XA 4BKGA 4IOIE 4BKTA 2BTEA 1EQRA 5FLXE 3G6EA 1I4GA 1WTPA 4JI4L 4POFA 2HQLA 2M9VA 2RCNA 4LFCL 3M85A 4CJ2C 4WJ3M 2CS4A 4DV1Q 3T3NA 3I70A 4K6DA 1LT3D 4J8QA 1Y1WB 1HNWL 1IW7C 1C7YA 1N5WA 4XYCA 1K8AC 3ND8A 5BR8L 2EKEC 3HOYB 3S1RB 1K8GA 4EQOA 1PTOC 3SHLA 4LF4Q 3PIOA 5JEAJ 5C0XI 1KXLA 1ZXIA 1I42A 3U4VA 3ONAB 1S5FD 4P72A 1WTXA 1DONA 4FLHA 2KCTA 3TP6A 1B9MA 4X57B 1R4NI 4C7YA 1PTOF 5LMUQ 4HCEA 5IYDG 1WRIA 2Z6KA 1RKNA 4WAAA 1S40A 5IP7G 3GV3A 2N1VA 1EWIA 1BOSA 3VR6A 1KC8C 4AOFA 2MO0A 2UXDL 1SSNA 1O7ZA 1C48A 1F0ZA 2E75C 1QJOA 3CD6A 2QEJC 4GXBA 4ZRIA 4EGVA 5IN7A 2JEBI 5CTRC 1C4AA 1CT1D 4OWXB 1MHHE 2LWPA 1JC7A 2LI5A 2KCCA 1ESRA 4P73A 2G9DA 2WB1G 1OXXK 3QWNA 1M1KC 1IYVA 2N9PC 1CTMA 2L0CA 3OIPA 1TWCH 4QL5A 3GTQB 1WCMB 4CKEA 2WU2B 4JI1L 3KWLA 1HPCA 1EY5A 2RDHA 4GLXA 3MXNB 3DBLI 3Q2AC 3W2DA 3TL5A 3OYYA 1UBIA 3TIXA 2N0SB 5GAGC 3PHXB 4DAVA 2LGDA 3GE3C 4NQLB 1WOCA 4EZJA 3MFGA 2PTLA 4A93H 2WDRB 4EQNA 2VH2A 1F2MA 4B3MQ 3J7YW 2FCQA 4DHJB 1TS2A 5C44G 2PZUA 4LNKA 4IW0A 1EYDA 1VQ7A 2AMCB 2MBOA 3EGRA 4TV3A 1R7SA 3CC4A 4A3BG 1JMCA 1P3QU 1XLQA 2VB2X 1H9SA 3FEWX 2XWJB 1B70B 3I4MG 2KJRA 1PZKD 2RPVA 4K7UA 2XK5B 3K7AB 3NVVA 2RR9A 5KYIA 2ID0A 2JWUA 3HOVH 1FL0A 5BYQA 4HKQA 4AIMA 1J5EQ 3AU4A 4ZRPA 1N34L 3A0JA 4DAMA 2R7ZH 1XXGA 1WGKA 2F0KA 1YJ1A 4N8X1 2KNBA 4OZBA 3HOZG 1QZGA 3DLLA 5FLXc 1Q81C 3WDNA 1RJTA 4NAMA 2CQAA 3CCLA 2KJHB 1PFMA 4WJOA 5AUKA 1BDOA 2IHFA 3Q22A 1EL0A 1GUGA 4REZA 4L8JA 4LJZC 1AZPA 1JWUD 1TY2A 1C4CA 4EX5A 4JI5Q 3V62A 2JXMB 4IJHA 4BY7H 1H95A 1QLBB 2RBMA 4QCLA 4WWOA 3QQ8B 2PZWA 4ZQ3A 5A35A 2M0XA 5DPWA 1HZ6A 3ZRFA 2WXIA 2WB1B 1D8LA 4U68A 3DBRB 4IUVA 5G3LF 3L16A 4KY6A 1QUQB 1I50H 1V1PB 1FJGQ 2HCCA 3URYA 4NXMQ 1Q82C 1AH9A 2L3ZA 3R8BA 5GXGB 4MNOA 2KHWB 3E3XA 4G11A 1DXMA 4KSLC 4F1SA 4DAYA 3I55A 4C3IG 1NCVA 3RNUA 1PDQA 1TU2B 1HZAA 1Y56A 2VXWA 2QC8A 5C44B 3CSFA 2G3QB 4A3KH 2K0PA 4TKNA 4UY8C 5D94A 4K6LA 4CYEA 1AZQA 3AU7A 3KF6A 3Q8DA 1WD0A 2KECA 2XSCA 4QB4A 2V3NA 1BBWA 3K0XA 4V190 4A3BB 2F0JA 4XDXA 2EE1A 1W2BA 4LW1A 1JW9D 3I4MB 2DNCA 3CU7A 4BFRA 3DHQA 3MXPA 2EJFC 4A3JG 4JI4Q 3GTPB 2K6DB 1RCVD 2WXMA 4BS9A 3HVZA 4MH0E 4TQ1A 3WAPA 5IAAC 4LFCQ 3ETRA 4OZAA 1X54A 4Q0FA 2KFJA 3FKYA 5COYA 4PYZA 4M8MA 2OHFA 5M3FB 3KLWA 3HOZB 2M56B 1D2BA 3W5OA 4WJNA 4WAFA 2L55A 1H4RA 5IT9L 1SMYD 1B2TA 2B2UC 1I6HH 1J8IA 4KV6A 5C4XH 3SDZA 1E0BA 4CKCA 2QCZA 4OVZA 3MC8A 3G7LA 2WYQA 2NTTA 1ENAA 2RDFA 2OT2A 1STHA 1HNXQ 2MJ3A 2PVGC 5I9PA 2WAQE 3ND9A 2BWFA 2EMSA 4GOPA 2INDC 1KRHA 2DZIA 1HXYD 3PPAA 4A3PA 3W1SA 3NZUA 4AYBG 4CHKA 2NBUA 4B95A 2NVXH 5KHOA 3MHBA 2UXBL 1PUTA 3ZNGC 3KLRA 4IDIA 3U7ZA 5M9OA 2BB5A 3UQBA 2D62A 4P16A 5C5MA 4DV7Q 4QF4A 4CGYB 2A19A 2KDEB 2N88A 1D4BA 1QCBD 2W55A 4ANVA 2UUBQ 4LNOA 1IP9A 2B2WC 4C3IB 3PIP3 3FC4A 4H2AA 4MJSB 3VUWA 2JU6X 1SYEA 4JIOU 1EZ8A 2B39A 3EBEA 1OQRA 1M90C 3BVGA 1PH3A 1K8OA 1TIFA 1GOZA 2ON8A 1BXTA 3H8HA 4KJOA 3ZJYC 2Y0SG 1VMCA 4JOIA 2V0GA 3CXCA 4A3JB 1WXQA 2KTRB 4HMIA 4HIDA 2EXDA 2QF7A 1WGYA 1SFOB 3RNCC 2KJXA 4QY7A 1N5XA 4IFDH 2EMTA 1VQ8A 1TBEA 3CMMB 2D10A 2MBBB 2NVQH 3N1ZC 1LT4D 3H0GH 3VYSA 3FP9A 1IBKQ 3KYHC 4JV5Q 2NWGA 3QG1A 4KHPL 1DOIA 3DMUA 3PV0A 1WJ6A 4YL8A 2KQ4X 5H92C 2F1MA 4ZKBB 1HTPA 1QOFA 1CHQD 3D4WA 3N52A 1JE4A 2AWNA 1PYWD 4GB9A 2ZPNA 4BAXA 3KDFA 3W1GA 2VZAA 4F87A 1TWGH 4UP7A 4AYBB 5BN4A 3BK1A 3VQIA 3ZGZA 1BBUA 3E56A 1BQQT 3BYYB 2A6HD 3Q6BA 2WINB 3B9JA 2PMZE 1R9TH 1JICA 3RN2A 3L7ZC 2K14A 3W1YA 3VR8B 4AS1A 4FF2A 1HR0W 1WM3A 3PZ7A 2DLBA 3MTSA 5E4WC 2I1KA 3GTMH 3GZNI 3HOXG 5CV6A 1B1ZA 4X64Q 3EFCA 2PO4A 4K8JA 5LXHA 5I6WA 1MSHA 3NJTA 1G2TA 4KGSA 1UEAB 1E7VA 5IT9E 4A3IH 3OMCA 2H89B 2KFKA 4P1CC 4KX6B 2IJ0A 5J2RA 3HZXA 3SK5A 3M3YB 4HAEA 4O2DA 1WSPA 2Y0SB 4IPCA 2VL6A 1T5EA 2M0AA 5FO8B 1WRDB 2JJQA 1QVFA 1NDDA 4IUMB 3WAOA 4B9XA 2BQQA 4JI6L 2JYTA 3S1NH 3AM9A 1EIYB 4KIKA 2PJHA 1G6JA 3KFUA 2KEEA 1EU4A 2WS3B 1Q1BA 4X3KA 3C1EA 4BBSG 1P8LA 4IOAA 1IKMA 1KFYB 3A7LA 2O6VB 1STGA 1Y8RC 2JX5A 4KTAA 4ANXA 3APDA 5IODA 1LM8B 5CR3A 2MGSA 1FVIA 1SNCA 1W3SA 1YVCA 3G71A 2K5HA 1WXMA 2EXZA 4DK5A 2QILA 1D5ZC 1IYFA 2G5DA 1PV4A 4MZ9A 1KDAA 3K5OA 5KGUA 2KDFB 1CKNB 1ZYRD 1EUVB 2E8GA 4DR7L 4TQ0A 3K9PB 4PMBA 3DVGX 3PLUA 3DEPA 1Y8PB 5DPTA 1K53A 2WDQB 4K3CA 3OWEB 5M5XH 2KX3A 3AE9B 4US9A 4DR3L 4HIMA 1W6KA 3EVQA 2F0HA 3BZCA 4H13C 2QMTA 2R93G 1F52A 2KWCA 3AEGB 2LD9A 4DR1L 4WH4A 5EGTA 3IVFA 2EZVA 2WXLA 2ZZPB 4A3EG 2XRQD 5BN5A 3BS1A 3ENEA 1PXUA 5ELNA 2XBBC 1Q8KA 1ISNA 4A3CH 1S5BD 4E74A 4A3MB 5HKHA 4JI3Q 3HOXB 2JA9A 5CBEE 3GTLB 1CJEA 3BINA 1RWSA 3DWGC 3RZOH 1SMXA 5FK9C 3CAMA 5CMDA 2K04A 1UH6A 4JI2L 2WKDA 3MC0B 3L17A 3SHQA 4RF1A 4HSPA 1Q90A 3JAME 1WM2A 4RHRA 2IX0A 2GBRA 3J80i 4C2MH 2IYDB 4WJ4A 3VR3A 3C46A 1SGHA 4A20A 2MP2A 4QJFA 4QIWB 1C1YB 2ZM6L 2OOBB 3NWSA 3FKIG 2KDMA 3U2SC 2CQOA 2AEHA 2FCNA 1FGUA 1JALA 5GADC 2K5QA 2BE5D 1NR2A 3IFTA 4CBVA 3K57A 1XNQQ 4J6HA 4BBSB 4IJLA 5JPMC 1XNRL 2DJGC 1H9RA 3VR4A 2JK8A 2Z6KC 1QOHA 2NPTA 3TS0A 4IFDI 4I6NB 1A62A 2FMMA 5IT9c 1SE2A 1VJKA 1CI3M 1R4PB 4CDFC 4XQQA 4BXXG 4L1BA 1Q0WB 5C23A 4UHVA 1XTDA 4WWPA 1KDBA 2EPBA 3A55A 3X3MA 2KQ3A 4MGZE 5IA7A 1NAPA 3AXCA 5LMNW 2CHXA 1S72A 1QOGA 4HPPA 4ITKA 1UE6A 3PF4A 1YX5B 4S3SA 1F9SA 5EQ0A 3NTHA 3W1BA 2R93B 4KV2A 3ULPA 4F7XA 3PSIA 2PW9A 2LVQA 4KY7A 3VA5A 3L08A 4HJ8A 5DCNA 1V5OA 2X6GA 2BKRB 1J8CA 4RHSA 3AB5A 4GNXB 4LF7L 4LK1C 1E8YA 1WTHA 2K3UA 2GI9A 2ONQA 3S17B 1HFGA 3ZUNA 4AQYQ 5DAUA 2BF8B 4JC0A 3DQVA 3LNNA 4FF3A 1L1OB 2KLGA 1LTTD 2RF4A 2Q8IB 4GKKQ 3NOBA 1A2TA 1OXSC 1HR0Q 1PH6A 3DBHI 2WQYB 1Q1EA 4DR2L 5DPSA 3TMEA 1TGZB 2BYFA 2BGFA 1K3RA 1SMYC 2LXAA 4JX1C 4C4VB 1YNJD 1FCCC 4GDLA 4ZHPA 3DXJC 1XO3A 2JEAI 4A3LG 2UUAQ 2Z9HA 5AJ3L 3AECB 2K5VA 4J15A 3TREA 2MJ8A 3PIO3 2KKCA 3FKIB 2JA6H 4GOCA 3WALA 4OHJA 1QZHA 1E5WA 3PRMB 2IW3A 1G291 4JCVE 4C3JH 5FJ8G 3HVDA 3DHIC 3ZLZA 2CVRA 1ZE3D 1HUMA 4Q5VA 2L52A 3F2BA 2JA5H 2WX1A 1GUWA 3I73A 3W9CB 2VUMG 1IBLL 4I7ZC 3DWAA 3JVZX 2K8HA 3N6RA 2PQAA 1VQKA 2ENBA 1S3SG 2K6QA 5CHWA 1K9MC 2F0GA 3JAMc 1G6ZA 3IXSA 1VDZA 2DAJA 1F2RI 1LLRD 4B6WA 1KABA 4G57A 3T1YQ 3IRBA 1WX8A 3BY4B 1I3QH 4KKJA 2JA7H 2LGIA 3NE5B 2F4VL 1NTGA 1PTOB 3C1FA 1OTRB 3STBD 5C4HA 2O2VA 5BMGA 4R4CA 2F0TA 1WJ4A 2KZRA 5E6OA 1IYJB 5JJLA 1WI0A 3ZIMA 3ZKJC 1PZJD 2AYOB 3ZXRA 3DVGY 4MHEA 4RGOS 2WXJA 4KZCA 4JI8L 4FF4A 2BW2A 1C0AA 2RPQA 4M0WA 2IL8A 4IQZA 3UE1A 2JUOA 4CKBA 3MTNB 4IUTA 2ZTEA 4OEMB 4C00A 1N61A 1JE5A 3PZ8A 1H9MA 4RM8A 2A74C 4A3FH 5D7GA 3ER0A 4JI0Q 4ZRJA 2Q2TA 4ASWC 2NZHA 2KWDA 2ZT9C 4Z9CB 4MSQB 1V49A 3GTKH 2FUHB 4I65A 1N36L 4EZLA 1XMQQ 1PH9A 1U4RA 3F8TA 3S14B 1XD3B 4L63B 4XYQA 1HA6A 4MIUA 1YNTE 4BOZB 1L2FA 3EECA 2UXCL 4LF9Q 5EE0A 4XGAB 5IYBH 3KOJA 1FFUA 2KMAA 1P16A 3H7PA 3D4RA 3P4RB 1FPYA 4G3XB 2KUMA 3RZFA 1JB7A 2VUMB 2Z8LA 2MJDA 3L10B 4LF8Q 1X3PA 2A6HC 2PI2E 2V9HA 2WGSA 3WIMA 1CA6A 4RNAA 1NBFC 1KRSA 5E3FA 3ULLA 1Z2MA 2LVPA 1EFID 2SDFA 4O1NA 1TIID 2EYPA 3MZ5A 4DGZA 3GTGH 3Q24A 1UE1A 2L05A 3AU5A 1MD2D 1K0RA 2MPMA 1EY4A 5JAVA 4GOPC 4KK7A 3U58A 1OQQA 3W1SC 1E3PA 4E71A 2E2IH 2XTIA 1QB5D 5LMNQ 4LF4L 1KH0A 3AE8B 3Q14C 2GBNA 4NJCA 2WAQG 2Z0EB 4YTMB 1EOVA 1EWHA 2GB1A 5LMUL 1JT8A 1MBYA 3KYCD 5IGEA 4US8A 5C0XH 4ZDVA 1FD7D 2M00A 5C4JB 2LGYA 2WV6D 4NMZA 1SRUA 2QA4A 3U4EG 4U673 4F88A 2AWTA 3RT3B 2OF1A 1R4QB 2NUCA 4OONA 2R92G 4Y52H 5EE1A 2D0PA 2MP1A 1PFBA 1GC7A 3NWTA 4P1BC 4DN4M 4GU2A 1A5RA 2OEOA 3VYTA 1FXTB 2MBEA 1TJEA 2GMIC 4G50A 4DV5Q 1P98A 1VRAB 2QJLA 4HROA 3C19A 4PNYA 1WTQA 2KVZA 1ZYRC 4JOIC 4G0NB 2W3SA 5CBAE 3I63C 2DHZA 3T13A 4YSZB 2JYOA 2E2HB 3RFZB 3L4PA 4DR2Q 4IZ8A 1Q8IA 1TWAH 3EQLC 4LWCA 4KHVA 3M4OH 2RSUA 2F0UA 4DUYQ 4PS3A 3U52E 1H9KA 4DUZQ 1ZP0B 2PEAA 5A2QL 3K5MA 3MJWA 4B3ML 1PLFA 3RLOA 1C4PA 3U30A 1Y69U 3HOWG 1TS5A 1YHAA 1E7UA 5GAHC 5D2MB 3P4QB 2F52A 1WTOA 5H1SE 1RLFA 5IP9G 2SEBD 5HY6A 2JSVX 1Y1WH 4YSYB 1AN8A 3CCMA 4W9HA 2A4ZA 3K8AA 4DK1A 3T3OA 1FRRA 1B9NA 1D5XC 3S1RH 2J52A 2PPHA 4K1RB 1VR9A 4DR6Q 3J81E 4J6IA 3M7NA 5D3DA 5AZHA 2BPSA 5HI1A 1SE4A 2WAQB 3AE2B 2KEDA 1J5EL 3E6ZX 3I4NG 2MO1A 3Q8CA 4P7IA 4WIPA 2ATWA 4RKLA 3W3AA 4DV3Q 2K05A 2AWOA 2LUMA 4IWOA 2F0PA 2XVSA 1EF1A 3Q3OC 1IBMQ 2WFWA 3AEAB 3HK0A 3KYDD 1LABA 5IYCH 5FR3A 1ZOYB 1WTWA 2BE5C 4JI5L 2R92B 2MFIA 2L8JA 3TUOA 4IUNA 4GDKA 4R1JA 4LK0M 4DQOC 4BWGB 1B3AA 3BDLA 4LFBL 3APCA 2LSSA 1C4QA 1Y1VG 4JI8Q 2PYKA 1EU3A 3S9WA 1PHJA 2SAKA 4EFOA 1SYGA 4M8NA 3SR6A 1AYFA 4X3UA 1LGRA 3VUYA 4XQNA 1SXTA 1QZEA 4NXML 3T1HQ 1E8WA 1SJED 1YIWA 2F0WA 2IDYA 3HRDD 1DYQA 2WXQA 1LT6D 4J3OD 5M3MG 5C5LA 5C3WA 2F0SA 4W9CA 2K7VA 1WI5A 4L6TB 3C0RB 3KVFB 4FO2A 2JA8G 1F9PA 4CDCC 4L5TA 1F2RC 1UELA 2M17A 2MBQA 4YY3Q 3H15A 4Y7NB 2LJIA 3HOWB 4LDTD 2CR5A 4EUTA 1WGHA 1C8CA 4JPSA 3CRKC 4H44C 3I9V1 2K39A 3NXWA 2QDBA 5L95C 2K03A 4ME3A 3CCSA 3LDZE 1ZEQX 2ZTDA 1ZDXA 3DM1A 2NTSA 2LY7A 3K7AH 4RFBA 2LEKA 1N33Q 2L1AA 1ML0D 4LNNA 4OVUA 2WP8J 3RUIB 5G55A 3VH4B 5JVH3 4MELA 4RCOA 3WCQA 1STNA 4IUPA 1Z9FA 4DV4Q 3I4NB 3RCZA 3A5UA 1RRBA 2K1FA 5CV4A 4OIKA 2FBWB 3TBLD 2MHVA 1GUSA 5GQOA 1F2LA 4BY1G 5IP7H 2F4IA 2IBIB 4OX9L 3S16B 2F3WA 1UWXA 3I5JC 2PKOA 3L0OA 2PMZB 3OOCA 2L83A 3L13A 1OXUA 4A3GH 3QA8A 5EKLA 1ZGUB 1QUQA 3KBGA 1HNXL 2DYMA 2WXNA 4YWKA 2YV5A 2BOSA 3NELA 2IX3A 5JEAG 3DDCB 2EYLA 1K51A 3J81c 1V6EA 1XLPA 3AE3B 4PK1A 1Y1VB 2QGQA 2BWES 3VR5A 2JRIB 2HDLA 3J7A5 4XC2A 1I94Q 3QOLA 4KHZA 3WWVA 1DGJA 5KNDA 2DZMA 4DV7L 4GLSC 5M3MB 3MEFA 1XLNA 2F0LA 4ZLTF 3LGJA 2AUJD 3CSTA 1M4VA 1LT5D 3STBC 2JA8B 3A74A 2UUBL 2QW7A 1Z5SB 1Z6HA 1KIXA 3PS6A 5C44H 2C7NB 3MA2B 2G4SA 3H7SA 1HQRD 3NTIA 3IAYA 1L7YA 3E9IA 4BKSA 5L83A 3TEZA 3SFEB 1BNZA 5JJIA 1TT2A 1MVKA 2JZZA 1ICFB 4A3BH 4L23A 1UZXB 1UBQA 4MGIE 5JJZA 2A73B 4DHJD 1LFDA 3GTPH 1OGWA 4S0RA 2IHEA 3APFA 4GN4B 3GO5A 5C6AA 3NHHA 1CHPD 4R4IA 1SNMA 5IOCA 2M8SA 4HCPB 4B0EA 4C1NK 5M3FH 2NVYB 2G9HD 3ZTDA 1EF5A 4W9GA 3E9HA 5HFYA 4BY1B 1C78A 1T0RC 1WYGA 1Q46A 3OSOA 4TUUA 1I5FA 1STBA 1GG3A 4PZ6A 1IBKL 3AEVA 4JV5L 1WE6A 1WYWB 4KKUA 3N1YC 3KLSX 2J0TD 2O5IC 1X55A 4CHTB 1TQOA 1HTLD 2W54A 3DVNV 4LUZA 4NXNQ 2JF5A 3FPPA 1MI0A 1QKZA 1VDVA 3RMHA 3S15B 5DNFA 2ZNVC 2EYOA 3AV8A 2KA7A 4ZYNA 3TZUA 4LAAA 1UF0A 3IHPC 2NZ1D 3NQIA 4JLCA 5FO9B 1V8CA 1WF9A 4MH8A 3EHVA 3NP8A 4LFBQ 3KK7A 1STAA 3OHXC 2O4XA 3HP3A 3TCAA 2KCMA 4C3IH 1B4OA 1N32Q 2BS2B 4X64L 1OEYA 5IE8A 5LL6S 2GLSA 2NBWB 1N8RC 2ZJQA 2X8XX 2FAZA 2KC1A 4CDDC 1C76A 2B63G 3K9OB 2LVOA 3QX1A 1PRTC 4OELB 4ODGA 1V81A 2KN5A 1A3TA 1E9MA 2IT1A 1LM0A 3PREA 4W9FA 5AFWA 3I4LA 3TZDA 4A3JH 1PRTF 4X3SA 3B0AA 4IG7B 4IM3A 3ZDMC 4ULLA 2R7ZG 2NMQA 1JOQA 3A54A 2FNJB 4DNTB 3RZDB 3A8IE 1VQAA 2HD3A 2H1EA 4XTCS 3KUZA 1BCPC 4KDLB 1EY6A 1SFOH 4BBRH 1YD8U 4FXGC 3KJPA 2GRIA 4JGHB 3X0WA 1WXVA 3CC2A 3S1QH 3S2DB 4BKSD 1BCPF 2NN6G 1F2YA 1Z47A 5LNK1 1WTRA 1L0WA 4ZRKA 3EN2A 4DU9A 2M4NA 4YWMA 3ERSX 3ICEA 1SEBD 2YEPF 1HZBA 3RMKC 2RKSA 2J0JA 1M8AA 1XWEA 5CX3A 1NI2A 1TKEA 2KLCA 2LGSA 3FAHA 2HD5B 5G5HA 3GS2A 1FD6A 1TWCB 4XX5A 1MGSA 1K28A 3NTKA 4BBNC 2GVAA 2BDOA 3N3KB 4OX9Q 2OQ0A 3GTJB 2D07B 1J7AA 1EYAA 3P63A 3DBRI 3Q8BA 2PE9A 3KBXA 3CMEA 2LXKA 4XWWA 5CV7A 3NBHA 1VCIA 2F0NA 1WTVA 2MNAA 1FXAA 1GB4A 1N60A 2XRSD 3NSWA 2ZW1A 3ONSA 4FADA 3ULJA 4JI3L 5EBCA 4A3KG 1VQLA 3TMPB 1X3FA 2I38A 2F0QA 3IBEA 1RFAA 3OAWA 5J17A 2PNHA 3AFQA 4WRDA 1BUIC 1BT0A 2CU1A 3H3VI 3VDYA 2B63B 3B1LX 1HTQA 3DWQA 1J7BA 2REXA 4NP5A 3DHHC 1FXIA 1U4MA 3DWMA 1LQBA 3RULA 4KGTA 3D6CA 1F2ZA 1H9SB 2FXQA 3G6JB 4DKAC 2BT6A 1B7YB 1IL8A 2R7ZB 5FKAC 4ZYSA 2HE7A 2QIEB 3ZXVA 3BZDB 4EQPA 4UP9A 3SK8A 2LASA 1I7HA 2O6VA 2AX5A 3CPWA 3C8YA 1E90A 3HM6X 2KBNA 5D65A 2CCZA 4W9LA 2CWPA 4FXCA 3AMZA 3K5NA 1PFDA 3G4SA 5C4XG 1XNQL 3GP7A 4R9WA 1A63A 2Y3AA 4W9JA 3UDFA 3TEWA 3LYYA 2JVCA 5CORA 1XCTL 4HKZE 2FINB 3TJPA 1ICWA 2GN5A 1YJ9A 3ABVB 1YITA 1EY7A 2UU9Q 1JWMD 2CJNA 5G2NA 5JVG3 1B44D 3H6NA 4KY5A 3RNEC 2ALYB 2CHZA 3BYTB 3MXUA 4JI7L 1KF6B 1YN4A 2J53A 2D2QA 3PO2G 2WXGA 4NPNA 4WWMA 1E7PB 5I6YA 4A3DG 4G7HC 3AN1A 2N9EB 4JG2A 4HIOA 2IO0B 3A9KA 2JSOA 2KYWA 2KK8A 3KH0A 2DBYA 1J6QA 2KC2A 4LJOB 2DY8A 4GN5A 1EIFA 1FR3A 1ASZA 2D5GA 1WE7A 3GOEA 5CHFA 4URKA 1M94A 4LF5Q 4A3MH 1D3ZA 3BVMA 2OXPA 3HOXH 4AQYL 1WWTA 1LACA 4A3KB 1OTCA 1PGXA 4FN2A 4GIVA 4FXDA 2H5XA 4ICVA 4DXFA 4N9PA 3QIJA 1X6OA 4GKKL 4ANUA 2M19A 3TBIB 1HR0L 1WR6E 3U4ZA 2WDTB 4DK0A 1HEZE 2LZ6A 5FLMG 2JYEA 2L4NA 4HR7B 4AP4C 3KF6B 2Q2IA 1KRTA 1IUEA 2DAFA 5FO7B 2OTJA 5K36H 4DR5Q 2F0VA 1MKHA 3QIAA 3ZW3A 3QB3A 1CZGA 3NEMA 3EFUA 4K7WA 2EJMA 1K0SA 1RTOA 2UUAL 1BBXC 3EC8A 3RUZA 1EEID 4X66Q 1EY0A 3RN5A 3TQYA 1BVSA 4IUQA 4NAWA 1E1TA 1KTKA 5C4XB 3H0GG 3GDEA 5T1GA 4HJAA 4I6LB 5M5YB 1QOAA 2DWQA 4WURA 1EYGA 4MM3A 1E7ZA 4DFAA 2ZEQA 3JAMi 2UU7A 1FEHA 2F0EA 2IY5B 2CKZB 3CQZB 2EYJA 4MTNA 1OXTA 2A5HA 3ZNID 1VD2A 2NBFA 2O6VD 2ZXRA 1NY4A 5ISRA 3PO2B 4H02A 5AZGA 5EDSA 3ZO5B 2WXOA 2K33A 2EYMA 5EPKA 4G7ZC 4A3DB 2NVXB 3T1YL 2K25A 4EE2A 1S3OA 4GNXA 2MQJA 3KWVA 3VHTC 3ZYYX 1MJCA 1FIQA 3N32A 4M01A 3PUYA 1XTCD 3MXGA 2RA4A 3ZDTA 1V97A 1L1OA 1KOTA 1V1QA 4P6VF 1DOYA 5CYUA 1HQMC 1VQHA 3RLNA 4OW0A 3CCVA 1U9RA 3QC8B 1WMHB 4IC7B 1YQ4B 3NRZA 2J0KA 1CFMA 2MUYA 1VQPA 2N7JA 4A3IG 1TWFB 3A4SC 4HMJA 3ZNZB 1SNPA 5HG2A 2E2DC 3SK4A 4HN7A 2KJ6A 4C4VA 1TT5B 2UUCQ 5C3EG 2YYZA 1ACCA 4P71A 4ACFA 4NDXA 2INCC 5ELCA 3UDGA 4OO1G 3J80L 4DXGA 1SB3C 4X62Q 2FE8A 2JPHA 4FJVB 4GSWA 3AQQA 1WY8A 1JOKA 2K22A 3AE6B 4YWLA 4JI0L 1GHKA 1KAAA 3PUWA 4W9IA 5BMHA 4JW0A 2KN4A 4RAUC 3Q8EA 4GS3A 3NVYA 4O0AA 3T4AC 1XMQL 1PH5A 3JSVB 4FULA 2D3AA 1NVID 1LYLA 3BK2A 3PRZA 1QILA 3V2TA 2NVQB 1T0QC 4LF9L 3VR9B 2KVRA 3H0GB 2N9XA 1NJIC 3V61A 1EUJA 4YXDB 1JJCB 1ASYA 4KD3A 3FVQA 1YJJA 1YJIA 2QSDA 4RM9A 4FBJB 3ZTCA 3H6MA 1PH7A 1SJHD 1DD2A 4N59A 1QVGA 4LF8L 1EY8A 4M02A 2EIFA 2EY1A 3RR5A 1QE6A 2JT4B 4HLEA 1SN8A 1II3A 5KEEA 3OIQA 4K14A 1TWGB 4A55A 2ZXPA 2BH8A 4C3HH 3IAM1 3MWYW 1GNUA 4F8CB 2EKIA 1D1IA 2TSSA 3J9CA 1R9TB 3P1HA 5LMNL 1JORA 1OFFA 3E9SA 3VUXA 4L5QA 2E76C 3CCQA 1E10A 3F2UA 4JI7Q 5M5WB 3MHZA 1WXSA 3K58A 4FP5D 3TEXA 1H9JA 2JXTA 4EVOA 3OW7A 1O80A 1CKMA 5IGBA 2J7ZA 1NMGA 3QR8A 1GJXA 4IWQA 1IBXA 2XN9C 1QNKA 2N49A 1MI2A 3OTOL 1HCZA 4A3IB 4XIGS 1EO6A 2JN4A 3PQIA 2XNAC 3R93A 5C3EB 2WXFA 3GQBA 3HOUH 3QAQA 1E2WA 2B8FA 4A3EB 2B76B 2KFKB 1GO3E 4B3TL 1FM0D 2BKFA 3CKIB 1A0IA 4IO9A 3S24A 3NQTA 2E3TA 4R8NA 4DV5L 1AWDA 1JRUA 2KENA 5DEHA 2EELA 2NVTB 3R7RA 4AH6A 3S14H 2K9XA 4B0MA 1NYRA 1VQMA 4LNIA 5GAEC 1PDXA 1O7LA 4PT5A 5KNBA 1XPOA 2PE6B 5BYRA 1X3QA 2MH7A 4EZKA 4K0KQ 2EYFA 5E6JA 3A9JA 1I4PA 4DUYL 4HEDA 2LXCA 3EIVA 4DUZL 4DBGA 2HIXA 1QWYA 2F3IA 3V6CB 1K50A 2C9OA 3HIZA 3MJ5A 2F0MA 5IY0A 3A33B 1SR3A 1EQTA 1AEXA 1PH8A 4HWIB 1KL9A 3VAWA 2F0DA 4PS8A 5L37A 1TWHB 1HHVA 3SR1A 5CV8A 4R8IA 1I4XA 1DZ1A 1KAWA 4L5SA 1ENCA 4IN3A 4OGQC 5DLQE 4DR6L 1YJWA 2ICEC 2B3GA 4HJ9A 3PO3G 2ACZB 5F2DA 4HVBA 2J4XA 4NJ7A 1E1OA 1U4LA 2LS01 1P1AA 2ZTCA 2LKVA 4DV3L 1GUNA 1SNOA 3NENA 2DZKA 4XWTA 2IGHA 5JOBA 3HS0C 4WQMA 2EY6A 2YU9B 1YNXA 1IBML 3BU2A 4X3TA 3SEBA 4K5VA 5EPLA 2E5LQ 5IO9A 1HZ5A 1P7FA 1XMOQ 2Q8RE 2L1BA 2QHOA 1UAPA 2B2YA 2D3CA 3VYUA 3CW2C 3HEJA 3QARA 3UINB 1IPGA 1UE5A 3KW5B 1HA5A 3F2CA 1GB1A 1T6BX 1UD7A 1KM7A 5AEKB 3T51B 2E2HH 2MP2B 4LTUA 3TDQA 1LXDA 3J7AV 3T1HL 1K8MA 1KNAA 2FIFA 4I7AA 2JA5G 2MRPA 3EUB2 3Q8FA 2NBVB 4NNJB 2K50A 3KF8B 1B9RA 4L5RC 3HFZB 3K81C 1B3QA 1NI3A 2KD0A 2L7RA 2NPTB 1STEA 3HM3A 4YY3L 3WA0A 3Q69A 2Z0SA 2N9KA 3L3OC 2KVMA 3IL8A 2AQ2B 1E2VA 1YQBA 5CV9A 5EKKA 2J0MA 2PLPA 4PS7A 3DEOA 4WWNA 1GUOA 3PUVA 4WJPA 4JE3B 4MACA 1IHZA 4APVA 1N33L 4ZUIA 4LFAL 4B3RL 3PO3B 1YN3A 2WNMA 1G6PA 4A4IA 1OQYA 1EZ6A 4DV4L 3M3JA 3VH3B 5HURA 2H88B 4FHJA 1RF2D 3CCUA 1CMXB 1WD1A 4FXKC 2K32A 1XYIA 1KQSA 2E2JH 2IGGA 4KDIC 5KHQA 1L4ZB 1FRDA 5JH5C 5KIXA 4TMAB 1LTID 5D14A 3GB1A 3K7UC 4QMGA 3UQAA 2DUDA 2RSNA 4DF7A 1RL2A 2HQEA 1YI2A 2R92H 2MSED 1A2UA 5J22A 2A5UA 3FILA 3P4SB 3CRLC 2VQEQ 3CF5A 2PMVA 3TP5A 1NUCA 3B08A 5CC4A 2K8CA 2LFIA 2PIAA 1FMAD 1V80A 2ZCBA 3OTOQ 3GTOB 5GROA 4JQWC 5G3LD 3T8MA 1K83B 1PH2A 5IYBG 1I94L 3IT6B 1Q5WB 2Z59B 5D3IB 2HTHA 3PV1A 2L11A 3UIOB 2EDGA 2JA5B 3A7AB 4B3TQ 2ZXOA 1FNVA 2VB3X 4C1NI 5KYLA 1V86A 1YN5A 2KHSA 2V4LA 2K28A 1RYJA 2V3SA 3M62B 2RQXA 3HOWH 3S1MH 3QWZB 5C3XA 4ZRZA 2C5CA 2E74C 2R7FA 3GE8C 2LRUA 3ML8A 3W5VB 1DOLA 1PRTB 2YTYA 5IP9H 1XF5L 1KLUD 1NEKB 1T0SC 1I3QB 3BVZA 1NBWA 2KX0A 2VZKB 4R3DA 4KN7C 2AKWB 2BYEA 4A8XC 3UIPB 5IGCA 1WXAA 3PTFC 3B2GA 2LRWA 5C0XJ 5FLXL 1R4MB 4AQ7A 2CFMA 3H91A 4IUUA 2JE6I 1BCPB 5E4XA 1A70A 4DK6C 2ZCCA 5C0XG 1SSOA 2LMCB 3OPOA 4MSMB 4DXAB 2YEPB 2K52A 1ENFA 2L12A 3HOYH 2QEXA 1Y8NB 1U4PA 1LTAD 4LMQD 3S16H 1N6ZA 1UGJA 4M0WB 1YX6B 1B8AA 4DNRB 1V9PA 1SIJA 2OTLA 4CJ0B 5IGDA 3I3TB 2C7HA 3RPFC 2HDEA 1Y1VH 1YMHE 2JQOA 1YIJA 4YIJA 5LHY1 3AEBB 4NXNL 2BS3B 5EBDA 1CSPA 2D3GA 2WX0A 1MJEA 4ARIA 1CM9A 2DYOA 3R2TA 3F2DA 2HDMA 5JHAA 4PV1C 4NY0A 1WJJA 1VZ8A 2NCNA 1IGCA 1LTBD 1DCZA 1V8QA 2OJWA 4KN4C 2Z0DB 3CF6E 4II2B 3MXNA 1N62A 1FNWA 2JA8H 1SROA 3H7PB 1X32A 2FCSA 1E24A 4BA1I 2I46A 3GTQH 1O78A 1WCMH 4IPHA 2YTVA 1N32L 3A5ZB 4IALA 2V4DA 2IZVB 1CQVA 3ALBA 1KDCA 1VQ5A 1K3BC 3J7ZC 4KVGB 3GTGB 2ZPYA 4ME5A 1ZKHA 2HHHQ 4ANWA 4DAPA 3DOWA 2L00B 4KKIA 5I2YA 4CJ1B 2YTXA 2E2IB 1C9FA 1DOKA 4KI0A 3C2PA 3ECIA 4JYAQ 1L5PA 2ZVOA 4RGTA 4A9AA 2DZJA 1V2YA 2E6XA 2Q8TA 1AE3A 4GNXC 1E2ZA 3S2HB 4HJGE 2Y5BB 3RNBC 4B3SQ 2MLBA 1WZ3A 3B2FA 3Q3FA 1G51A 3SU8X 2IY1B 4JBKA 1K8RB 2XK5A 5JXVA 1L1OC 1S4ZA 3MHSD 1R4NB 4L2YA 5EAYA 2NR2A 4MT5A 3IKJA 1QT9A 5EKIA 1VQFA 4B3RQ 4LFAQ 1ZXTA 3PRPB 3NBIA 1HJPA 5C2TB 2PNRC 3IFDA 2R61A 5IYDH 5JEAH 4IURA 1YNJC 1CZPA 4RF0A 3HUIA 3I8ZA 2HT1A 1ILPA 4A90A 2CH4W 1HH2P 1JQYD 3M4PA 4NJ6A 1TWAB 2KCNA 3S15H 1IL2A 2SNMA 4P74A 4DV0Q 3HKZE 5A2QE 2D5DA 3RNAC 3D6WA 3DBLB 1V1PA 2DJFC 4JBWA 1WJUA 3QHTA 4LF6L 3K0YA 1LTSD 2VS1A 4O42A 1EWCA 4DV6L 5T1IA 2QCPX 2R7DA 1EIGA 3PMFA 1ZUD2 2B8GA 4DV2L 3MP9A 2CW0D 2R3ZA 3S2AA 4W9KA 1U5KA 2WXRA 1J0GA 3A4RA 3H1UA 1JB3A 3NHEB 3PGZA 5IWAQ 1C77A 4NKLA 1GHJA 2EOTA 4DR4Q 4B9KA 1ROEA 1PYBA 3H3VH 3LX0A 3RZDH 3PGEA 1ONLA 1WVLA 2OCEA 4GZYC 3A1QB 1I35A 3K59A 2AL6A 3TN2A 1BKBA 2ZW0A 4I6PA 5IGGA 1PMRA 2K5WA 3S2DH 1X56A 2NS5A 4X65Q 2INPE 3NVZA 1FO4A 1D6EC 2WP9B 1TR5A 4RGNA 3NZ3A 1SLJA 4H0LC 3I4MH 4A3GG 4F7ZA 2I5MX 4YCUA 4A76A 5E1FA 4ALPA 1JWSD 5HGTA 4TVAB 4LUVA 1E0ZA 2AQ1B 1Q3LA 2BYVE 2UU9L 3CCRA 3M7GA 1EQVA 3TP7A 1UWMA 1PGBA 3BDCA 4ID6A 3FPUB 1HRJA 3DUZA 2KOLA 4CQNA 1BO0A 3P7JA 3HOZH 2PVOD 4GDKB 1JWAD 4BVUC 5AUIA 5BYSA 3MEHA 1DGSA 1DM0B 1RAXA 2X6LA 5EE3A 4AJWA 3GTJH 5CHVC 3U7DA 1XEEA 4GLVB 2GBMA 3PSEB 3KUPA 3MC9A 2K1BA 1D5MC 2WIIB 1TZOA 3NZSA 1QQRA 4AWJA 2Z1CA 3O13A 3T9LA 4GLAC 2LHDA 2BS4B 3P42A 3VA7A 3O65B 4OVVA 4CDEC 4LF5L 4HJ7A 4HXDA 3CCEA 2QDLA 4MEMA 3Q3MC 3PCOB 4OWWB 5HHDG 1B53A 3AI5A 1GC6A 2VQFQ 2VNUD 1TVXA 4FNFA 2B63H 4A93G 1UE7A 5GMVA 2OJRA 2OQKA 3UI3A 4K2KA 1EOTA 1A6XA 4MJSA 4B9WA 5DM63 4DR5L 1F9QA 2A1AA 3X3NA 1WGGA 2KWVB 1W6JA 1MG4A 5K5PA 5M3FG 2IO1B 1PFNA 3PUZA 2GA4B 4X66L 4JPBW 4G4KA 5C4ZA 1X65A 4YT0B 4LNFA 2KTRA 2ES2A 4GDLB 2NN6H 1L4DB 5AZFA 4A3GB 2RMMA 1VQCA 3HOVG 2BH2A 1UGMA 2N1WA 3OMGA 4IWPA 3VDZA 4EQ5A 3E0EA 3PF5A 3RN9C 1L0VB 1STYA 2B2TC 2P5ZX 1WX7A 2G4DB 4N9F4 2SNSA 2DYBA 3BJUA 1DJRD 3JC66 4JVZA 4AJYB 2B2YC 2R2QA 3LB8C 1LUZA 3DCGA 2H4OA 4XYOA 1OO9B 2F3VA 3GV6A 4BY7G 1J19A 1SE3A 1WFYA 3I7FA 2RHSB 5FOBB 1SE8A 1VQ6A 2B3AA 3PVLA 3VVWB 1TY0A 5I2XA 1CKOA 1OEYJ 1MJDA 1HNZQ 4D2KA 2OWOA 2FIDA 3Q6SA 4DK3C 1ZKOA 2WHIA 1VQJA 4HJKA 4YWGG 2MHJA 1RTNA 4BBNF 2KAJA 3OLMD 2HTME 2UUCL 2I07B 4A93B 4YHHL 2PI2A 3PT2B 5HGQA 4M8AA 2N3SA 1NE3A 3D8GA 5NUCA 3N20C 4X62L 5DPRA 2A6ED 4LF6Q 1I6VC 4IPDA 3RNFC 2V3PA 4ABNA 4C56C 1Q1OA 1X9NA 4DV6Q 2N55A 4BBRG 2C7MB 1FGBD 5LL6X 1U0LA 2N78A 1HNWQ 4DV2Q 2EYHA 1GUTA 5BR8Q 1XT9B 5CGKA 2Z6BA 4FHKA 1Z7TA 1BMLC 1TKYA 2WXHA 3M3YH 3RD2A 1NNXA 5M5YH 4AUQC 2JWZA 2MBHA 4N6EB 4DHZE 3UDXA 3HOVB 3CQZH 1LTLA 3RD4A 2F0OA 2FMCA 3LXFA 1O7YA 2LFNA 1N63A 2JQRB 2I5LX 3PO2H 2HJ8A 3VXWA 1YOVB 3VTVA 1RFKA 2W82A 4FVMA 1CKNA 2UXDQ 1X1MA 2ASQA 4A3DH 3QOJA 3I3CA 4S17A 2FFKB 5I4DA 1YHBA 3JW0X 3QJYA 4TSSA 3I91A 4BY7B 4P75A 1AFPA 2VRRB 1X3GA 1QG7A 2A8VA 4USAA 2MCNB 1WMHA 5C1ZA 3M9BA 3ZJVA 1SYFA 4RWSC 3SK6A 1SAPA 4QQBX 2BBCA 3H9DA 1Q12A 1L0XB 2B2VA 4R4QA 4WJQA 1L2NA 4N58A 1GVPA 1I50B 4JI1Q 1WFQA 2TMPA 2WACA 1Q7YC 4QGUA 3OG5A 3K6OA 4WJWA 1KHIA 3EA6A 2I0QA 2YVCA 1YBYA 1TWFH 3AMUA 3GZNB 2MWSB 1ET6A 4PQXA 4YCWA 5TR5A 2SOBA 3NK9A 5FLMH 1C9OA 1UNSA 5E6PA 5FR6A 1CZWA 4GKJL 1VS0A 1S5ED 2BA0A 2VY3A 2K75A 1OXVA 4OZCA 4A75A 1E22A 3JSVA 1EYCA 1G2SA 1YNND 2OEDA 3UE0A 5KRUA 2CWAA 3GTLH 4YTNB 1TS4A 2I5HA 1VQGA 2BA1A 4RKBA 4DAYB 1B50A 3ZNHB 4BBRB 3SGIA 4ZKCB 4H7BA 3CMAA 3S1QB 4IM2A 3X23A 1TS3A 1WH3A 4FJZA 3TRZA 3C3LA 1IGDA 3KJOA 3AEDB 3CP0A 2PW5A 4K0KL 4HPMB 5J39A 3JAML 4RMFA 4IFDJ 3RYTA 4YSXB 2MJEA 1N34Q 2CHBD 5J1ZA 3J7AF 2UWQA 4LNQA 3WANA 3BZKA 2NN6I 4OL7A 2M1MA 3R2IA 4IFDG 3DBSA 5J18A 3SVMA 2Q2HA 1HZCA 4BBSH 1KLGD 5MPOA 4JBMA 2R6GA 1I6HB 1MSGA 4DPGA 1VQEA 4LCDE 3OJ4B 4PG3A 5IIFA 3Q3NC 3ERQA 2JY6A 1BR9A 3WOFA 1XQQA 3QCAA 2XWBB 1VMPA 4RMAA 2CW0C 4A3MG 2JRHA 2AL3A 1VF5C 1MIUA 5M5WH 2L0FA 1V9JA 1RODA 3NBHB 4ZAIA 1GJZA 2WWZA 3PLVA 4FYDA 1EWYC 5C3JB 2BVCA 1E8XA 3D0FA 4FDBA 1EQQA 4PZ7A 1F1HA 1HZ9A 3HRZC 4GOPB 2ASBA 3BG3A 4MN3A 2R93H 1A3UA 1PH4A 2Z4HA 4NW2A 4KSKC 1VF7A 2NZOA 3NUCA 5C3EH 1FNUA 1EY9A 2NVUI 5K36G 4PMCA 1KD1C 3TS2A 2D9UA 3B6YA 4K8IA 4A3EH 1T5XD 2E5LL 3S17H 1XMOL 5ELDA 4OO1H 2A69D 3E5SA 2JZ3B 4QAYA 3I90A 4XZ4A 4CO7A 2JZPA 1ESFA 4POGA 1FFVA 4X6AH 3NS8A 1VQNA 3AFPA 3RI7C 1T3QA 2F0IA 1O7IA 2NVTH 1JRPA 3UI2A 3EROA 2PPBC 2C60A 1CA5A 2FCMA 1XX8A 1C79A 2L15A 3OW2A 1NYQA 4YHHQ 2DENB 1AARA 1SF0A 1GD7A 2D2CC 1JMLA 1GAQB 2KANA 2D11A 3AEEB 3T53B 3UDIA 4XDDA 4HPLB 5IP4D 1AW7A 2C35B 4P2CB 2CHWA 3T16A 2ZJDA 4LJPB 3BIID 1SNQA 3D4DA 3V96A 4JWUC 3FKIH 1LTRD 1Y14B 4K2LA 1PVOA 2FUG1 4HJ5A 3DPDA 1TWHH 1PYSB 2PW7A 1I4HA 4XXEA 4XE0A 3RNGC 1SBBB 2DX5B 4K5WA 3KUCB 4YTPB 2AQ3B 4JWSC 3VTWA 2I1JA 1K73C 3I72A 1P9DU 2G45B 3A9KB 1PGAA 2LHEA 1SIFA 3I4OA 4KJNA 4BXXH 1UUPA 3FRPB 2L76A 4N8FA 4LLGM 2LUEA 3Q8AA 5E6NA 4KKTA 2UXBQ 2KDBA 4QUCA 1EEFD 4ILWA 1PTOH 3KDFB 4E3CA 2AUKA 3HKZG 2YU9H 4MGYE 1FCLA 3AH7A 2KO3A 3QJZA 3P75A 4HIKA 3SD5A 2DY7A 2FHTA 1U4AA 1ILQA 4A3CG 3IAS1 3CCJA 3GTMB 3AEFB 5H8YE 3DBHB 2VQEL 2WB1E 1LTGD 2DGYA 4TKOB 3J81j 1YZ6A 1GM5A 3H3VC 4RG1A 4GGQA 2KMMA 4OIJA 3U8ZA 2KT7A 2L0TA 3KF8A 2BYTA 3SDLC 3WAMA 4GKJQ 4HDQA 1EFWA 4UAIA 4JL9A 4NAWB 1D1KA 1NR4A 4FF1A 3S1NB 2RHQB 4A3LH 1AE2A 4MM3B 4RCNA 2MA9B 3IT4B 1ZDVA 4DWFA 4PYUA 1Q86C 1HTOA 1JWBD 3PUXA 1YQ3B 3U50C 1BF4A 2RDBC 4KIKB 1GPXA 3R3MA 1LO5D 1T0YA 2RVLA 2L32A 1WX9A 4C3HG 2A68D 5FJ8H 2ICIA 2CH4A 1HE8A 3CPFA 3UGBB 2XIWA 4WFN3 4KHPQ 4BZAA 1F77A 2GBKA 3AE5B 2YLMA 2KTFA 4W9DA 2VUMH 1S5DD 1SNDA 1RHPA 2DN8A 1LV9A 1EIHA 1XLOA 3PO3H 1F9JA 2N7DA 2KACA 3I56A 3DHGC 1SYBA 2RGFA 5M5XB 3M95A 4C7ZA 2ZVNA 2A6EC 1P7EA 2G1EA 3TEHB 5E7NA 1WIAA 4V0BA 5EJWA 1JCKB 2JP1A 3D31A 3HKZB 3EFXD 3R7QA 3J80E 3HOUG 1TYGB 1ET9A 3K5LA 4ZUJA 3CIRB 4IKGA 3M4QA 4MDKE 4NPSA 3D32A 1IW7D 4K3BA 4J1MA 1HFNA 1CK1A 4RGMA 4KLKA 3T56B 1CQFA 3DWPA 2WDVB 3PZDA 3G48A 3RZOB 4ARCA 4WORA 2C5LC 1PTOD 5C4JH 3N9YC 1WYDA 3LWUA 4OO1I 2M2LA 4TRDA 1XJVA 2MX2A 3K80C 3GTOH 4ZOHC 5JJKA 1PA6A 4WQOB 1K83H 3AULA 1QNUA 1RDPD 2B2TA 4GN3B 4N9TA 4F8MA 2GBJA 2X69A 3SE0A 3TEYA 4UDUC 1XPRA 4C2MB 3NVWA 1VQ9A 1Y8OB 1A15A 2D0OA 2EVBA 2V1CC 4JI6Q 4G7OC 5BO4B 3WOEA 3CC7A 1WGDA 1JJ2A 4IOCA 4ZRQA 4HCSA 2JA6G 3NS1A 3P4PB 3A8JE 2L5TA 3R66C 1E6EB 1EM7A 4C3JG 3VR2A 2C9WB 3A8KE 3R3OA 3MVVA 4XQJA 5D6JB 2K5DA 4C3HB 2HHHL 3PIPA 3EJIA 2O2LD 3MAQA 1KLVA 4DR7Q 1WGRA 3KQ4A 2FJ2A 5LXIB 4JYAL 2LMCA 3PO0A 2INNE 4E6IA 4C80A 1VQOA 1CUKA 2BCOA 4DR3Q 4B3SL 2HJ1A 4NB3A 4HDOA 4DA2A 2UYZB 2AHOB 2D3BA 1MHWC 2W3RA 2K5PA 2JA7G 4DR1Q 2B29A 1YNNC 2XGTA 3P20A 1WJNA 1IKLA 2QKIC 4DNIA 2VW9A 2KXJA 1IBXB 3HOUB 1A8VA 3J81L 3NPPA 3Q0AA 2V4IB 2ZJPA 1C3TA 3AE1B 5G5GA 5JZEB 4ICUA 2B2UA 4LUOA 3HKSA 2HIVA 2W9NA 1TKWB 2MQHA 1E8ZA 3VRBB 4BOSC 3TSSA 3DVNU 2JXXA 1L0YB 4JI2Q 4W9EA 1DOMA 5IGFA 5EPJA 4AYBE 3N1XC 4FJYA 2Z4IA 2EY5A 4R4TA 1RD9D 1A3VA 4B08A 4A6QA 5IOIA 1S1QB 3QK0A 3ML9A 3KLSA 5ELOA 4DV0L 3KUDB 3J81i 4A3FG 1QVCA 1CSQA 1VZ6A 2IY0B 3AE4B 4KKSA 3P2BA 2PZTA 1VQDA 2X38A 2ZM6Q 2WKCA 3A9JB 3UF8A 4ZK9B 4RH6A 3ITPA 3J80c 1K52A 1T9HA 3FHWA 2KDIA 5CV5A 2JA6B 2K4KA 2GOWA 2KQSA 4IPGA 3HHMA 4DV1L 1Q10A 1VQBA 3P1MA 2ZNVB 1XNRQ 2IO2B 4C3JB 3U9OA 5LLIA 4EKUA 4FA6A 2K8BA 3IG3A 2B2WA 3L2PA 1JROA 1YEZA 2NYZD 2J42A 3RLFA 1NSNS 2BDNA 2RDGA 2N4FA 1ZW7A 1MPEA 1GKHA 2Y0SE 2CKHB 2KOXA 1XCQL 5IWAL 1DOXA 2HCIA 3OJ3A 1J9OA 1I4QA 2EQSA 3FMCA 4PMWA 4DR4L 4Y7NH 2WLBA 1TZ1A 2GVBA 3S2HH 5EE9A 2IWHA 1TKGA 2KQ7A 1PRTD 2K6AA 2PQAB 1ZXHA 3E0JA 2J7QB 3VTUA 3L9AX 1JQ4A 2MW5A 4KZ0A 2A69C 5KNCA 1QOBA 2VZKD 5DM73 4XT1B 1HUNA 2JA7B 3BDOA 4OXPA 1JJGA 2F0FA 4Q2JA 2B2VC 1V1OA 2DNEA 3D3RA 4PZ8A 4X65L 1JOOA 2WXKA 4HSVA 2XEWA 3NUHB 4EOYA 1VZ7A 1WZ0A 2IGDA 1JR0D 5TSSA 4LF7Q 1BCPD 4JK1C 1WR1A 5I9OA 1MHXA 5IKCM 1IYUA 2O2VB 5ELFA 4YCVA 2O5JC 1L6VA 3NG0A 1VQIA 2N8NA 4EEWA 3I4NH 1NMFA 1SDFA 1XPUA 4BA2I 3OWFA 2CJOA 4HEA1 3V6EB 1KNEA 4RA8A 2Q5WD 2MEKA 3AB9A 2F03A 4K7SA 4ZHOA 1VLBA 1PZID 2PCFB 2LJ5A 3ZQ4A 5ELEA 1RM6C 1FYCA 1YJNA 2KMCA 2N7EA 1NENB 4OWTB 4HK2A 4A3FB 2N9LA 5AJ3Q 5ELBA 2IX1A 3GTKB 3FDTA 3LJ3A 3ZJUA 1QF6A 3SXHA 3TP8A 2EY2A 1N9WA
chains in the Genus database with same CATH topology
1V43A 5T8IA 2EJGC 3BWUD 2RSOA 3U9SA 3QO2A 1G91A 2WXPA 1F9RA 2BB6A 3CHBD 4K5XA 1L6UA 2IPKD 3VYRA 1ZPSA 4HRSA 2Y5PA 3HG9A 2K01A 2E2JB 4XDCA 4KMUC 3HGBA 4TQUS 1I4RA 3H09A 2NB0A 2WU5B 1BUVT 3AE7B 4HTHA 2HUGA 3W5UB 1J7CA 1SYCA 2I2YA 1AP0A 3SFDB 3I57A 3GD7A 4KD4A 3FILB 4NZLB 1GXDC 3MFYA 4QUFA 1G8ZD 5JPNC 3A56A 3Q23A 3ZJTA 3CWIA 2A68C 4KGRA 1S5CD 3H94A 3S1MB 3LWEA 2CU3A 2Y5CA 1SYDA 5BMIA 2L9HA 3M4YA 4XT3B 2PQEA 4M1UB 5BN3A 3V3XA 3M4OB 3V05A 4IOIE 2BTEA 5FLXE 1I4GA 1WTPA 2M9VA 3M85A 4CJ2C 3T3NA 3I70A 4K6DA 1LT3D 4J8QA 1Y1WB 1N5WA 1IW7C 3ND8A 3HOYB 3S1RB 4EQOA 1PTOC 3SHLA 1ZXIA 5JEAJ 5C0XI 3ONAB 1S5FD 1WTXA 1DONA 3TP6A 1B9MA 4C7YA 1PTOF 4HCEA 1WRIA 1RKNA 3GV3A 1BOSA 3VR6A 1SSNA 1O7ZA 1C48A 1F0ZA 2E75C 1QJOA 2QEJC 4EGVA 2JEBI 1C4AA 1CT1D 1MHHE 1JC7A 2KCCA 1ESRA 2G9DA 1OXXK 3QWNA 1IYVA 1CTMA 2L0CA 3OIPA 3GTQB 1WCMB 4CKEA 2WU2B 3KWLA 1HPCA 1EY5A 2RDHA 3W2DA 2N0SB 4DAVA 3MFGA 2PTLA 2WDRB 4EQNA 1F2MA 3J7YW 1TS2A 2PZUA 1EYDA 3EGRA 1R7SA 1XLQA 2VB2X 1H9SA 3FEWX 2XWJB 1PZKD 2RPVA 3K7AB 3NVVA 5KYIA 2ID0A 2JWUA 5BYQA 4HKQA 4ZRPA 3VRAB 1XXGA 1WGKA 2F0KA 4OZBA 3WDNA 1RJTA 4NAMA 2CQAA 1PFMA 5AUKA 1BDOA 3Q22A 4REZA 1EL0A 1GUGA 3U7ZA 4L8JA 4LJZC 1AZPA 1JWUD 1TY2A 1C4CA 2JXMB 1QLBB 2RBMA 4QCLA 2PZWA 4ZQ3A 5A35A 1HZ6A 2WXIA 2WB1B 4U68A 4IUVA 5G3LF 4KY6A 1V1PB 2HCCA 3URYA 5GXGB 3R8BA 1DXMA 4DAYA 4C3IG 1NCVA 1PDQA 1TU2B 1Y56A 2VXWA 5C44B 2K0PA 4K6LA 1AZQA 3AU7A 1WD0A 2KECA 2XSCA 4QB4A 2V3NA 4V190 4A3BB 2F0JA 4XDXA 2EE1A 1JW9D 3I4MB 2DNCA 3CU7A 3DHQA 3MXPA 2EJFC 3GTPB 2WXMA 1RCVD 3HVZA 4BS9A 4TQ1A 3ETRA 4OZAA 4Q0FA 5COYA 2OHFA 5M3FB 3HOZB 2M56B 1D2BA 4WAFA 2L55A 5IT9L 1SMYD 1B2TA 2B2UC 1J8IA 4KV6A 3SDZA 1E0BA 4CKCA 4OVZA 3G7LA 2NTTA 1ENAA 2RDFA 2OT2A 1STHA 2MJ3A 2PVGC 5I9PA 3ND9A 1KRHA 1HXYD 3W1SA 3MHBA 1PUTA 3KLRA 4IDIA 5M9OA 2BB5A 2D62A 4P16A 5C5MA 4QF4A 4CGYB 2N88A 1D4BA 1QCBD 2W55A 2B2WC 4C3IB 3PIP3 3FC4A 4H2AA 2JU6X 1SYEA 1EZ8A 2B39A 1OQRA 3BVGA 1K8OA 1GOZA 2ON8A 1BXTA 3H8HA 4KJOA 1VMCA 2V0GA 4A3JB 1WXQA 4HMIA 2QF7A 1SFOB 2KJXA 1N5XA 4IFDH 1LT4D 3VYSA 2NWGA 3QG1A 1DOIA 3DMUA 3PV0A 2KQ4X 5H92C 2F1MA 4ZKBB 1HTPA 1QOFA 1CHQD 3D4WA 3N52A 1JE4A 2AWNA 1PYWD 4F87A 4AYBB 5BN4A 3BK1A 3VQIA 3ZGZA 3E56A 1BQQT 3BYYB 2A6HD 2WINB 3B9JA 1JICA 3L7ZC 3VR8B 4AS1A 4FF2A 3PZ7A 2DLBA 3MTSA 5E4WC 5CV6A 1B1ZA 2PO4A 4K8JA 5I6WA 1MSHA 1G2TA 4KGSA 1UEAB 5IT9E 2H89B 3OMCA 4KX6B 2IJ0A 3HZXA 3SK5A 3M3YB 4HAEA 1WSPA 2Y0SB 1T5EA 2M0AA 5FO8B 4B9XA 3AM9A 2JYTA 2WS3B 2KEEA 1EU4A 1Q1BA 4X3KA 3C1EA 1KFYB 1IKMA 3A7LA 1STGA 2JX5A 4KTAA 5IODA 5CR3A 2MGSA 1SNCA 2EXZA 2QILA 1D5ZC 5KGUA 1KDAA 3K5OA 1ZYRD 4TQ0A 4PMBA 3DEPA 1Y8PB 1K53A 2WDQB 3OWEB 3AE9B 4US9A 1W6KA 3EVQA 2F0HA 4H13C 2QMTA 3AEGB 4WH4A 5EGTA 2EZVA 2WXLA 2XRQD 5BN5A 3BS1A 1PXUA 1S5BD 4A3MB 3HOXB 5CBEE 3GTLB 1CJEA 1RWSA 3DWGC 5FK9C 5CMDA 2K04A 2WKDA 3MC0B 4RF1A 4HSPA 1Q90A 3JAME 4RHRA 2IX0A 3VR3A 3C46A 4QIWB 3NWSA 2KDMA 3U2SC 1JALA 2K5QA 4CBVA 2BE5D 1NR2A 3IFTA 3K57A 4BBSB 4J6HA 5JPMC 1H9RA 3VR4A 1QOHA 4IFDI 2FMMA 1SE2A 1VJKA 1CI3M 1R4PB 4XQQA 4L1BA 1KDBA 2EPBA 3X3MA 3A55A 2KQ3A 1NAPA 1QOGA 4ITKA 4S3SA 1F9SA 5EQ0A 3NTHA 2R93B 4F7XA 2PW9A 4KY7A 3VA5A 2X6GA 4RHSA 3AB5A 4LK1C 2K3UA 2GI9A 2ONQA 3S17B 1HFGA 5DAUA 3LNNA 4FF3A 1LTTD 2Q8IB 1A2TA 1OXSC 2WQYB 1Q1EA 3TMEA 1SMYC 4JX1C 1YNJD 1FCCC 4ZHPA 3DXJC 1XO3A 2JEAI 3AECB 2MJ8A 3PIO3 3FKIB 4OHJA 2IW3A 1G291 3HVDA 2CVRA 1ZE3D 1HUMA 4Q5VA 2L52A 1GUWA 3I73A 3W9CB 4I7ZC 3DWAA 3N6RA 2ENBA 2F0GA 1G6ZA 3IXSA 1VDZA 1F2RI 1LLRD 1KABA 4G57A 4KKJA 2LGIA 3NE5B 3C1FA 1PTOB 5C4HA 5BMGA 2F0TA 1PZJD 4MHEA 4RGOS 2WXJA 4FF4A 2BW2A 4M0WA 2IL8A 4IQZA 4CKBA 4IUTA 1N61A 3PZ8A 1H9MA 2A74C 5D7GA 2KWDA 2ZT9C 4Z9CB 4I65A 3S14B 1U4RA 4L63B 4XYQA 1HA6A 4MIUA 1YNTE 5EE0A 1FFUA 3D4RA 3P4RB 2KUMA 2VUMB 2Z8LA 2MJDA 1X3PA 2A6HC 1CA6A 4RNAA 5E3FA 1EFID 2SDFA 4O1NA 1TIID 2EYPA 3MZ5A 4DGZA 3Q24A 1MD2D 2MPMA 1EY4A 5JAVA 4KK7A 1OQQA 3AE8B 4NJCA 1QB5D 1KH0A 4YTMB 1EWHA 2GB1A 1MBYA 5IGEA 4US8A 5C0XH 1FD7D 2M00A 5C4JB 2WV6D 4NMZA 3U4EG 4U673 4F88A 2OF1A 1R4QB 2NUCA 5EE1A 2MP1A 1PFBA 3NWTA 4DN4M 2OEOA 3VYTA 1TJEA 1VRAB 2QJLA 4HROA 4PNYA 1WTQA 1ZYRC 2W3SA 5CBAE 4YSZB 3T13A 3RFZB 2JYOA 2E2HB 3L4PA 4IZ8A 1Q8IA 3EQLC 4KHVA 2F0UA 3U52E 1H9KA 1ZP0B 5A2QL 3K5MA 1PLFA 1C4PA 1Y69U 1TS5A 3P4QB 1WTOA 4YSYB 2SEBD 2JSVX 1AN8A 4DK1A 3T3OA 1FRRA 1B9NA 1D5XC 2J52A 1VR9A 3J81E 3M7NA 5D3DA 5HI1A 1SE4A 2WAQB 3AE2B 2KEDA 3E6ZX 3Q8CA 4WIPA 4RKLA 3W3AA 2K05A 2AWOA 2LUMA 2F0PA 2XVSA 5FR3A 3AEAB 1LABA 1ZOYB 1WTWA 2BE5C 2R92B 3TUOA 4IUNA 4LK0M 4DQOC 4BWGB 1B3AA 3BDLA 1C4QA 2PYKA 1EU3A 3S9WA 2SAKA 1SYGA 3SR6A 1AYFA 4X3UA 4XQNA 1SXTA 1SJED 2IDYA 2F0WA 4J3OD 3HRDD 1DYQA 2WXQA 1LT6D 5C5LA 5C3WA 2F0SA 2K7VA 4L6TB 4FO2A 1F9PA 1F2RC 4Y7NB 2LJIA 3HOWB 1C8CA 4JPSA 3CRKC 4H44C 3I9V1 3NXWA 2QDBA 2K03A 1ZEQX 1ZDXA 3DM1A 2NTSA 2LY7A 4RFBA 2LEKA 2L1AA 1ML0D 2WP8J 5JVH3 4RCOA 3WCQA 1STNA 4IUPA 3I4NB 5CV4A 4OIKA 2FBWB 2MHVA 1GUSA 1F2LA 2F4IA 3S16B 2F3WA 1UWXA 2PKOA 3OOCA 2PMZB 2L83A 1OXUA 5EKLA 3KBGA 2DYMA 2WXNA 2BOSA 5JEAG 2IX3A 2EYLA 1K51A 1XLPA 3AE3B 1Y1VB 3VR5A 2HDLA 3QOLA 4KHZA 1DGJA 5KNDA 4GLSC 5M3MB 1XLNA 2F0LA 4ZLTF 2AUJD 1M4VA 1LT5D 2JA8B 1Z6HA 3MA2B 1HQRD 3NTIA 3IAYA 3TEZA 3SFEB 1BNZA 1MVKA 1TT2A 4L23A 5JJZA 2A73B 3GO5A 5C6AA 3NHHA 1CHPD 1SNMA 5IOCA 4B0EA 4C1NK 2NVYB 2G9HD 5HFYA 4BY1B 1C78A 1WYGA 3OSOA 1STBA 4KKUA 3KLSX 2J0TD 2O5IC 4CHTB 1TQOA 1HTLD 2W54A 3FPPA 1MI0A 1QKZA 1VDVA 3RMHA 3S15B 5DNFA 2EYOA 3AV8A 2KA7A 3TZUA 4LAAA 2NZ1D 3NQIA 5FO9B 1V8CA 4MH8A 3NP8A 3KK7A 1STAA 3OHXC 2O4XA 3HP3A 1B4OA 2BS2B 5LL6S 1C76A 1PRTC 4ODGA 1A3TA 1E9MA 2IT1A 5AFWA 3I4LA 3TZDA 1PRTF 4X3SA 4ULLA 2NMQA 1JOQA 3A54A 4DNTB 3RZDB 3A8IE 2H1EA 4XTCS 1BCPC 1EY6A 4FXGC 2GRIA 3S2DB 1BCPF 2NN6G 1F2YA 1Z47A 5LNK1 1WTRA 4DU9A 1SEBD 2YEPF 2RKSA 1M8AA 1XWEA 1TKEA 3FAHA 5G5HA 1FD6A 3GS2A 1TWCB 1MGSA 3NTKA 2BDOA 3GTJB 1J7AA 1EYAA 3P63A 3Q8BA 3KBXA 5CV7A 3NBHA 1VCIA 2F0NA 1WTVA 1FXAA 1GB4A 1N60A 2XRSD 3NSWA 2ZW1A 5EBCA 2I38A 2F0QA 4WRDA 1BUIC 2B63B 3DWQA 1J7BA 4NP5A 1FXIA 1U4MA 3DWMA 4KGTA 3D6CA 1F2ZA 1H9SB 3G6JB 2BT6A 1IL8A 2R7ZB 5FKAC 4ZYSA 2QIEB 4EQPA 3BZDB 3SK8A 1I7HA 2AX5A 3C8YA 5D65A 4FXCA 3AMZA 3K5NA 1PFDA 3GP7A 4R9WA 2Y3AA 3TEWA 3LYYA 5CORA 1XCTL 4HKZE 2FINB 1ICWA 3ABVB 1EY7A 2CJNA 1JWMD 5JVG3 1B44D 4KY5A 2J53A 2WXGA 3BYTB 3MXUA 1KF6B 1YN4A 4WWMA 1E7PB 5I6YA 4G7HC 3AN1A 2JSOA 2DBYA 2DY8A 1FR3A 2D5GA 3BVMA 2OXPA 1WWTA 1LACA 4A3KB 1PGXA 4FXDA 4DXFA 4N9PA 2M19A 3TBIB 4DK0A 1HEZE 2JYEA 2L4NA 4HR7B 1IUEA 5FO7B 5K36H 2F0VA 3QIAA 3QB3A 1CZGA 2EJMA 1RTOA 1BBXC 3RUZA 1EEID 1EY0A 4IUQA 1KTKA 5C4XB 5T1GA 5M5YB 1QOAA 2DWQA 4WURA 4DFAA 1FEHA 2F0EA 3CQZB 2EYJA 1OXTA 2A5HA 2NBFA 2ZXRA 5ISRA 3PO2B 2WXOA 2K33A 2EYMA 5EPKA 4G7ZC 4A3DB 2NVXB 4EE2A 3KWVA 3ZYYX 1FIQA 3PUYA 1XTCD 3MXGA 2RA4A 1V97A 4P6VF 1DOYA 5CYUA 1HQMC 4OW0A 1U9RA 1YQ4B 3NRZA 1CFMA 2MUYA 2N7JA 1TWFB 4HMJA 1SNPA 5HG2A 2E2DC 3SK4A 4HN7A 2YYZA 4NDXA 5ELCA 4OO1G 3J80L 4DXGA 1SB3C 2FE8A 1JOKA 2K22A 3AE6B 1GHKA 1KAAA 3PUWA 5BMHA 2KN4A 4RAUC 3Q8EA 3NVYA 3T4AC 1NVID 3BK2A 1QILA 3V2TA 2NVQB 3VR9B 3H0GB 4YXDB 4KD3A 3FVQA 1YJJA 1YJIA 2QSDA 3H6MA 1SJHD 1DD2A 4N59A 1EY8A 2EY1A 1QE6A 5KEEA 1II3A 3OIQA 4K14A 1TWGB 4A55A 2ZXPA 3IAM1 3MWYW 2EKIA 1D1IA 2TSSA 3J9CA 1R9TB 3P1HA 1JORA 1OFFA 3E9SA 2E76C 1E10A 3F2UA 5M5WB 3MHZA 3K58A 4FP5D 3TEXA 1H9JA 2JXTA 4EVOA 3OW7A 1O80A 1GJXA 5IGBA 2J7ZA 1IBXA 2XN9C 1QNKA 1MI2A 4A3IB 1HCZA 4XIGS 2XNAC 3R93A 5C3EB 2WXFA 3GQBA 1E2WA 2B8FA 4A3EB 2B76B 1FM0D 3CKIB 3NQTA 2E3TA 4R8NA 1AWDA 5DEHA 2EELA 2NVTB 2K9XA 4B0MA 1NYRA 1PDXA 4PT5A 1O7LA 5KNBA 5BYRA 1X3QA 2MH7A 5E6JA 2EYFA 1I4PA 4HEDA 1QWYA 1K50A 2C9OA 3MJ5A 2F0MA 1EQTA 1AEXA 2F0DA 1TWHB 1HHVA 3SR1A 5CV8A 4R8IA 1I4XA 1DZ1A 1ENCA 4IN3A 4OGQC 2ICEC 2ACZB 5F2DA 2J4XA 1U4LA 2LS01 2LKVA 1GUNA 1SNOA 4XWTA 2IGHA 5JOBA 3HS0C 4WQMA 2EY6A 2YU9B 4X3TA 3SEBA 4K5VA 5EPLA 1HZ5A 1P7FA 2Q8RE 2L1BA 1UAPA 2B2YA 3VYUA 3HEJA 1HA5A 1GB1A 1T6BX 3T51B 4LTUA 3TDQA 3J7AV 1K8MA 1KNAA 3Q8FA 3EUB2 1B9RA 1NI3A 1STEA 3Q69A 2N9KA 3L3OC 2KVMA 3IL8A 2AQ2B 1E2VA 5CV9A 5EKKA 2PLPA 3DEOA 1GUOA 3PUVA 4JE3B 4MACA 1IHZA 4ZUIA 3PO3B 1YN3A 2WNMA 1EZ6A 5HURA 2H88B 1RF2D 1WD1A 4FXKC 2K32A 1XYIA 2IGGA 1L4ZB 1FRDA 5KIXA 4TMAB 1LTID 5D14A 3GB1A 4QMGA 2RSNA 4DF7A 2HQEA 1A2UA 5J22A 3FILA 3P4SB 3CRLC 2PMVA 3TP5A 1NUCA 5CC4A 2LFIA 2PIAA 1FMAD 3GTOB 5G3LD 1K83B 3IT6B 5D3IB 2L11A 2EDGA 2JA5B 3A7AB 2ZXOA 1FNVA 2VB3X 4C1NI 5KYLA 1YN5A 2KHSA 2K28A 1RYJA 2RQXA 5C3XA 4ZRZA 2C5CA 2E74C 3W5VB 1DOLA 1PRTB 1XF5L 1KLUD 1NEKB 1I3QB 3BVZA 2VZKB 4A8XC 4R3DA 4KN7C 5IGCA 3B2GA 5C0XJ 5FLXL 4AQ7A 3H91A 4IUUA 2JE6I 1BCPB 5E4XA 1A70A 5C0XG 1SSOA 2LMCB 3OPOA 2YEPB 1ENFA 2L12A 1Y8NB 1U4PA 1LTAD 4LMQD 1UGJA 4DNRB 1SIJA 4CJ0B 5IGDA 3RPFC 2HDEA 1YMHE 4YIJA 5LHY1 3AEBB 2BS3B 5EBDA 4ARIA 1CM9A 2DYOA 3R2TA 2HDMA 4PV1C 1VZ8A 1IGCA 1LTBD 1DCZA 1V8QA 4KN4C 3MXNA 1N62A 1FNWA 1X32A 4BA1I 2I46A 1O78A 4IALA 2V4DA 1CQVA 1KDCA 3GTGB 4ME5A 4DAPA 4KKIA 5I2YA 4CJ1B 2E2IB 1C9FA 1DOKA 4KI0A 3C2PA 1L5PA 4RGTA 4A9AA 2E6XA 2Q8TA 1E2ZA 3S2HB 4HJGE 3B2FA 5JXVA 1S4ZA 4L2YA 4MT5A 3IKJA 1QT9A 5EKIA 1ZXTA 5C2TB 3NBIA 2PNRC 3IFDA 2R61A 5JEAH 4IURA 1YNJC 1CZPA 4RF0A 3HUIA 3I8ZA 1ILPA 4A90A 1JQYD 1TWAB 2KCNA 2SNMA 5A2QE 2D5DA 3D6WA 1V1PA 4JBWA 3K0YA 1LTSD 4O42A 1EWCA 5T1IA 2QCPX 1EIGA 3PMFA 1ZUD2 2B8GA 3MP9A 2CW0D 2R3ZA 2WXRA 1JB3A 1C77A 4NKLA 1GHJA 2EOTA 1ROEA 3LX0A 1ONLA 1WVLA 4GZYC 3K59A 3TN2A 2ZW0A 5IGGA 1PMRA 2K5WA 3NVZA 1FO4A 2INPE 1D6EC 2WP9B 1TR5A 4RGNA 3NZ3A 4H0LC 5E1FA 1JWSD 5HGTA 1E0ZA 2AQ1B 1Q3LA 3M7GA 1EQVA 3TP7A 1UWMA 1PGBA 3BDCA 4ID6A 3FPUB 1HRJA 3DUZA 2KOLA 4CQNA 1BO0A 3P7JA 2PVOD 4GDKB 1JWAD 5AUIA 5BYSA 3MEHA 1DM0B 2X6LA 5EE3A 1XEEA 3KUPA 2K1BA 1D5MC 2WIIB 1TZOA 1QQRA 2Z1CA 3O13A 2LHDA 3P42A 2BS4B 3VA7A 5HHDG 1B53A 2VNUD 1TVXA 4FNFA 3UI3A 4K2KA 1EOTA 1A6XA 4B9WA 5DM63 1F9QA 3X3NA 1W6JA 5K5PA 1PFNA 3PUZA 2GA4B 4G4KA 5C4ZA 4YT0B 2NN6H 1L4DB 4A3GB 2RMMA 3OMGA 1L0VB 1STYA 2B2TC 2SNSA 1DJRD 2B2YC 3LB8C 2H4OA 4XYOA 1OO9B 2F3VA 3GV6A 1SE3A 5FOBB 1TY0A 5I2XA 4D2KA 3Q6SA 1ZKOA 4YWGG 1RTNA 2KAJA 2HTME 4A93B 2I07B 4M8AA 3D8GA 5NUCA 2A6ED 1I6VC 2V3PA 4ABNA 4C56C 2N55A 1FGBD 5LL6X 2EYHA 1GUTA 5CGKA 1Z7TA 1BMLC 1TKYA 2WXHA 4N6EB 3HOVB 3RD4A 2F0OA 2FMCA 3LXFA 1O7YA 2LFNA 1N63A 2JQRB 1RFKA 2W82A 4FVMA 3QOJA 3I3CA 2FFKB 5I4DA 3QJYA 4TSSA 3I91A 4BY7B 1AFPA 1QG7A 4USAA 3ZJVA 1SYFA 4RWSC 3SK6A 1SAPA 2BBCA 1Q12A 1L0XB 2B2VA 4N58A 1I50B 2TMPA 2WACA 3K6OA 4WJWA 3EA6A 3AMUA 1ET6A 4PQXA 2SOBA 3NK9A 1UNSA 1CZWA 1S5ED 2BA0A 1OXVA 4OZCA 1EYCA 1G2SA 1YNND 2OEDA 5KRUA 4YTNB 1TS4A 2BA1A 4RKBA 1B50A 4BBRB 4ZKCB 4H7BA 3S1QB 1TS3A 3C3LA 1IGDA 3AEDB 2PW5A 5J39A 3JAML 4IFDJ 4YSXB 2MJEA 2CHBD 5J1ZA 3J7AF 2NN6I 4OL7A 3R2IA 4IFDG 3SVMA 1KLGD 5MPOA 2R6GA 1I6HB 1MSGA 5IIFA 3ERQA 1BR9A 3WOFA 2XWBB 1VMPA 2CW0C 1VF5C 1RODA 4ZAIA 4FYDA 1EWYC 5C3JB 3HRZC 3BG3A 4MN3A 1A3UA 2Z4HA 4NW2A 1VF7A 3NUCA 1FNUA 1EY9A 5K36G 4PMCA 1ACCA 2D9UA 4K8IA 1T5XD 4OO1H 5ELDA 2A69D 3E5SA 3I90A 2JZPA 1ESFA 1FFVA 1T3QA 2F0IA 1JRPA 3UI2A 3EROA 2PPBC 1CA5A 1XX8A 1C79A 1NYQA 1SF0A 2D2CC 1JMLA 1GAQB 3AEEB 3T53B 4XDDA 1AW7A 4P2CB 3T16A 3BIID 1SNQA 3D4DA 3V96A 4JWUC 1LTRD 4K2LA 2FUG1 2PW7A 1I4HA 4XXEA 4XE0A 1SBBB 4K5WA 4YTPB 2AQ3B 4JWSC 3I72A 1PGAA 2LHEA 4KJNA 1UUPA 3FRPB 4LLGM 3Q8AA 4KKTA 4QUCA 1EEFD 4ILWA 1PTOH 2AUKA 1FCLA 3AH7A 3P75A 2DY7A 2FHTA 1ILQA 3IAS1 3GTMB 3AEFB 5H8YE 1LTGD 4TKOB 3H3VC 2KMMA 4OIJA 3KF8A 2BYTA 4UAIA 4NAWB 1D1KA 1NR4A 4FF1A 3S1NB 4MM3B 4RCNA 3IT4B 1ZDVA 1JWBD 3PUXA 1YQ3B 1GPXA 1BF4A 1LO5D 2RVLA 2L32A 4C3HG 2A68D 2ICIA 2XIWA 4WFN3 1F77A 3AE5B 1S5DD 1SNDA 1RHPA 2DN8A 1LV9A 1EIHA 1XLOA 2KACA 1SYBA 5M5XB 4C7ZA 2A6EC 1P7EA 2G1EA 4V0BA 5EJWA 1JCKB 2JP1A 3D31A 3HKZB 3EFXD 3J80E 1TYGB 1ET9A 3K5LA 4ZUJA 3CIRB 4IKGA 1IW7D 4J1MA 1HFNA 1CK1A 4RGMA 3T56B 1CQFA 3DWPA 2WDVB 3RZOB 4ARCA 4WORA 1PTOD 3N9YC 4OO1I 3LWUA 4XWWA 2M2LA 4TRDA 4ZOHC 1QNUA 1RDPD 2B2TA 4N9TA 4F8MA 2X69A 3SE0A 3TEYA 4UDUC 4C2MB 3NVWA 1Y8OB 1A15A 2EVBA 4G7OC 3WOEA 4ZRQA 4HCSA 3NS1A 3P4PB 3A8JE 2L5TA 1E6EB 1EM7A 4C3JG 3VR2A 3A8KE 3R3OA 3MVVA 4XQJA 2K5DA 4C3HB 3EJIA 2O2LD 3MAQA 3KQ4A 2FJ2A 2LMCA 3PO0A 2INNE 4E6IA 4C80A 2BCOA 4DA2A 2W3RA 2K5PA 3P20A 1YNNC 1IKLA 2QKIC 1IBXB 3HOUB 3J81L 3NPPA 3Q0AA 2V4IB 3AE1B 5G5GA 2B2UA 1TKWB 3VRBB 3TSSA 1L0YB 1DOMA 5IGFA 5EPJA 2Z4IA 2EY5A 1RD9D 1A3VA 4B08A 4A6QA 3KLSA 1VZ6A 3AE4B 4KKSA 2PZTA 2X38A 2WKCA 4ZK9B 4RH6A 3ITPA 4GDLB 1K52A 5CV5A 2JA6B 1Q10A 3P1MA 4C3JB 3U9OA 2B2WA 1JROA 2NYZD 2J42A 3RLFA 1NSNS 2BDNA 2RDGA 1MPEA 1XCQL 1DOXA 2HCIA 1J9OA 1I4QA 3FMCA 4PMWA 2WLBA 5EE9A 2IWHA 1TKGA