1EU4A

Crystal structure of the superantigen spe-h (zinc bound) from streptococcus pyogenes
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
204
structure length
204
Chain Sequence
b'NSYNTTNRHNLESLYKHDSNLIEADSIKNSPDIVTSHMLKYSVKDKNLSVFFEKDWISQEFKDKEVDIYALSAQEVCECPGKRYEAFGGITLTNSEKKEIKVPVNVWDKSKQQPPMFITVNKPKVTAQEVDIKVRKLLIKKYDIYNNREQKYSKGTVTLDLNSGKDIVFDLYYFGNGDFNSMLKIYSNNERIDSTQFHVDVSIS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SUPERANTIGEN SPE-H
publication title Conservation and variation in superantigen structure and activity highlighted by the three-dimensional structures of two new superantigens from Streptococcus pyogenes.
pubmed doi rcsb
source organism Streptococcus pyogenes
molecule tags Immune system
total genus 60
structure length 204
sequence length 204
ec nomenclature
pdb deposition date 2000-04-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01123 Stap_Strp_toxin Staphylococcal/Streptococcal toxin, OB-fold domain
A PF02876 Stap_Strp_tox_C Staphylococcal/Streptococcal toxin, beta-grasp domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.110 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1eu4A02
3.10.20.120 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1eu4A01
1TS5A 1I4HA 2G9HD 1STEA 5D3DA 1TS4A 1LTBD 1EU3A 2R61A 5FK9C 1LLRD 1PZID 3BYTB 1AW7A 1D5ZC 1BCPC 1RF2D 5D3IB 4RGNA 4RGMA 1TY0A 4ZYSA 1CT1D 1JR0D 1BXTA 1HTLD 1JWUD 1SE3A 1D5MC 2RDGA 1CHQD 1LTRD 3R2TA 3GP7A 1YN5A 1AN8A 1RCVD 2ICIA 1DYQA 1EEFD 1HQRD 1YN4A 2TSSA 2XNAC 1PRTF 2QEJC 1LTTD 1UUPA 2SEBD 1CHPD 2IJ0A 1ESFA 1L0YB 5TSSA 2XRSD 4RHSA 3BVZA 3O13A 5FKAC 1CQVA 1SEBD 2XN9C 1YN3A 1PRTC 1S5ED 1PTOH 4BWGB 1GOZA 1LT6D 1PTOF 1JCKB 1I4QA 2AQ2B 1EWCA 1G8ZD 1B1ZA 1BCPD 1PYWD 1V1PA 2CHBD 1CK1A 3KLSX 3EFXD 1DJRD 3BVGA 1JWMD 2NTTA 1LT5D 1EFID 1SE2A 4O1NA 2J4XA 4RHRA 4DXGA 4DXFA 5ELFA 1BCPB 4L6TB 1PTOC 1PZKD 1V1OA 3URYA 1HA5A 1QILA 1TY2A 3DWQA 4RFBA 3R2IA 4K6LA 5ELCA 2NTSA 1RD9D 1XXGA 2Z8LA 1KLUD 1LTGD 1HXYD 1D6EC 3DWPA 2WV6D 3BZDB 1EEID 1LT3D 1SBBB 1SE4A 1SJHD 2O2LD 2IPKD 4OHJA 5ELDA 1ENFA 1S5CD 3TSSA 1M4VA 1I4XA 4RGOS 3OWEB 1KTKA 1RDPD 3MC0B 4RH6A 3SEBA 1JQYD 1BCPF 4UDUC 1JWSD 4C56C 1KLGD 4RGTA 1T5XD 1ET9A 1XTCD 3BVMA 3W2DA 4NZLB 1MD2D 1D5XC 1ET6A 1LTID 1SJED 5ELEA 3V05A 4Z9CB 4TSSA 1S5FD 1FNVA 1LTSD 1PZJD 1EU4A 1S5DD 4L63B 1B44D 1PTOD 1S5BD 3MFGA 1TS3A 4RCOA 1I4PA 1LTAD 1FNWA 1I4RA 1I4GA 3CHBD 2QILA 1LO5D 1PTOB 2AQ1B 2XRQD 3EA6A 1FGBD 1SXTA 1PRTD 1FD7D 3BYYB 1FNUA 1UNSA 5I4DA 1TS2A 5ELBA 1F77A 1V1PB 3DWAA 1LT4D 1L0XB 2RDHA 1PRTB 2AQ3B 3R8BA
chains in the Genus database with same CATH superfamily
2G9HD 1VJKA 1YMHE 1HZ9A 4TUUA 1NYQA 1OQYA 2ZVNA 4ZK9B 3A4SC 4HAEA 4KV6A 2WXFA 3ERSX 1J0GA 3HK0A 2MH7A 3NQIA 1U4RA 5IY0A 1SYGA 3BZKA 5IGBA 5JEAG 2HHHQ 4KKIA 5J3BA 3MA2B 4A3CH 2MP2B 3A8IE 1N63A 1P7FA 1WGRA 3L0OA 4A3IB 1ZDXA 3BIID 4S17A 3UQBA 3KBXA 1Q5WB 2RVLA 1L2NA 5COYA 2N1VA 5DPRA 4ZLTF 5IO9A 4EFOA 2QCPX 3GZNI 3IT4B 1A6XA 1Q8IA 4A3DB 4M01A 1EYAA 4OWWB 2G4DB 4FJVB 1WTQA 1J8CA 3AULA 2HJ8A 2F0UA 3FRPB 4E6IA 4GSWA 1CSQA 4FO2A 1XNQL 3HOZG 4LNOA 3SDZA 1VQGA 1L6VA 2WXPA 2R7ZH 5EPLA 2MRPA 2F0DA 3AE5B 4IUVA 3NBHB 2NVXB 2F52A 3MXNB 1TKYA 2X69A 1GUAB 4TRDA 4EE2A 4JWSC 1WXAA 4PYUA 4OIKA 4GOPC 3S2DH 1P7EA 1V80A 1K53A 2Y3AA 2KJXA 3H3VC 4R3DA 1F2YA 2GVBA 1WX7A 4H02A 3AEDB 3AE7B 2BYFA 1AE3A 1TXYA 4C2MB 5C3XA 3CCUA 2WWZA 4F87A 2MLBA 1HFGA 5CV7A 1HUMA 4Q2JA 4ICVA 2PO4A 2HDLA 1SNPA 2DNCA 4WWNA 5M5XH 3PGZA 3T1HL 2DYMA 4H13C 2AHOB 2UXDL 2BYEA 2FIDA 2I38A 2MPMA 1UE5A 1WYWB 2F0NA 2IPKD 4PMCA 3TJPA 1UZXB 4P2CB 1WMHB 3TSSA 4A3MG 4DAYA 1K8AC 4JIOU 3OWEB 5IIFA 3UE1A 3OW2A 1C4QA 2YU9B 4KZ0A 2DX5B 3I3CA 3A9JA 1SNOA 2LXJA 2EYJA 2G3QB 2IHEA 1PFSA 3PPAA 3NOBA 1JWSD 1M1KC 4FLHA 2CU1A 4K7UA 1VZ7A 1PMRA 3DEOA 1KNEA 3QO2A 3ALBA 2CJOA 3S15B 3BVMA 2RCFA 4XXEA 4II2B 1RM6C 3W2DA 1ILQA 3H0GB 3NSWA 3RNBC 1TBEA 2W3RA 3S2HH 3PUZA 1DOIA 1X9NA 1S5FD 1VQ5A 1UGMA 1FD6A 1LTSD 2V3SA 4OELB 4L63B 2SNSA 4POGA 3BG3A 1AP0A 2HQEA 5BO4B 5K36H 1LACA 5IODA 2YTXA 2WX1A 1JE5A 4KDIC 1I6HB 1FNWA 3JSVB 1YX6B 1PH4A 3FAHA 2QA4A 4ZHPA 3TCAA 4A3JB 1KABA 2RKSA 3E6ZX 4IURA 1JICA 3PIO3 2F4VL 4GLSC 2GI9A 5AZHA 1A3TA 2PNRC 1ZP0B 1PRTD 1WX8A 3LB8C 2CW0D 2RCNA 2K04A 1SYCA 1L1OB 2KHWB 2OJWA 4NPSA 3F8TA 4KV2A 1L0XB 3S1RH 3TMEA 5GAEC 2CWAA 4WJ4A 2JA7G 4DK1A 3N1ZC 4KSLC 5EDSA 4DR5L 2F1MA 3I9V1 4K3BA 4Y52H 4J6HA 4KDLB 3GTLB 4NAWB 1WM3A 5M3MH 2OTLA 3S16H 3RPFC 2ZT9C 1FR3A 3J81j 1BXTA 4ZRQA 4WJWA 1E5WA 4W9KA 4A3FH 3K6OA 4IUQA 1HZBA 2MP1A 1QG7A 3NS1A 3PIPA 4FXDA 2EYOA 3DOWA 5AEKB 4MGZE 4ICUA 1KDCA 2ICIA 1OXTA 4BXXH 1HTOA 2JRIB 4OZBA 5D65A 1VRAB 4OO1G 3R93A 5FJ8H 2CJNA 3AE4B 4MIUA 2K39A 1VCBA 1RKNA 4IJLA 3UGBB 2BT6A 3FPUB 3I72A 4EVOA 2SEBD 4X65L 1R4MB 4NNJB 1HQMC 4YT0B 4AQ7A 4QIWB 1G6PA 2G5DA 3N20C 1O78A 4JC0A 3PUVA 2GBRA 1XT9B 5C0XJ 5CHWA 3SK6A 1CQVA 1Z7TA 3VHTC 4US9A 3VUWA 3T1YL 4UP9A 3NRZA 3H9DA 4IUNA 2BH2A 1QOGA 1YHAA 1J7BA 4R4IA 3E0EA 4HIKA 4DR2Q 1Y8NB 2BGFA 2KDEB 2KMMA 3RMKC 4KIKA 2IX1A 2L9HA 1WTRA 2CHBD 4NQLB 4OEMB 4JX1C 3EFXD 2K3UA 3AE9B 4UHVA 1UE6A 3ITPA 2XVSA 2VZAA 4CBVA 1XJVA 2PKOA 4JPSA 3KOJA 2LGDA 3PQIA 4DU9A 1BO0A 1SR3A 1SE8A 4IJHA 4DV5Q 1ZW7A 4GDLB 3VUXA 2F0TA 3S17B 3ETRA 1V1OA 1E8YA 5J17A 1DXMA 1NTGA 2JA5G 1IBKL 2BB5A 4F8CB 1X55A 3NTHA 1N34Q 2LJ5A 5FR6A 4KY7A 3IAM1 3VH3B 5LMUQ 2WV6D 4C00A 1E90A 4NQKE 2XGTA 4K0KL 1JJ2A 4R8NA 4A3BB 3TEWA 4I7AA 3DLLA 3PF5A 5G3LD 3CMEA 4A90A 2KCTA 5ELOA 1X1MA 3OLMD 2RSOA 2KKCA 2C35B 1PFDA 4N59A 2HIVA 1VLBA 1BCPF 4C56C 2D5GA 2WDQB 3N1XC 1Q46A 4QUFA 3Q3NC 2WXJA 4IM2A 3SHQA 5LNK1 1CKNA 5DPWA 1WCMH 3GV6A 4KJNA 1N8RC 2HD3A 3RFZB 1CFMA 1PH6A 1XPUA 1KLVA 1MBYA 2BS3B 3A56A 2EJGC 1KIXA 3P63A 1O7YA 4TQ1A 4AS1A 3QCAA 2L12A 2Q8IB 2GBMA 2H1EA 4A3EH 4DAPA 3I4MH 3P2BA 2KVZA 4YTMB 1K52A 1H95A 3NG0A 3Q8BA 1HTPA 1D1IA 4EGVA 3CF6E 3UDFA 2Z4IA 3RZOB 2N88A 5BMHA 3T1YQ 3D3RA 3BYYB 2MQJA 4KMUC 3N6RA 4NP5A 2IO3B 4HCSA 5AJ3L 2NBWB 1CQFA 1ZKOA 5EAYA 2QHOA 2WB1G 5HI1A 5C3EG 2MJ3A 4LUVA 5CBEE 4KKUA 3APDA 1NDDA 2WHIA 2CQAA 2IDYA 2WAQE 5J1ZA 3CCQA 2R92B 3L2PA 3ONSA 2D07B 2L1AA 2XWBB 2GVAA 4WRDA 5LL6X 3CCSA 3GTKH 3I8ZA 1OXVA 2EKEC 2UU9Q 3ZNZB 5IT9L 1FGUA 2W55A 1YNND 3GOEA 1PYSB 4TVAB 1GG3A 2CHXA 4F7XA 4A3GG 1JWBD 4MN3A 3Q0AA 4FJZA 4IWPA 3DHHC 1K83B 3QJYA 3BY4B 2FCMA 4NXNL 3OHXC 5BR8L 2INPE 4REZA 4XDCA 3WA0A 1DYQA 2M0XA 5M5YH 3HM6X 4E3CA 3T8MA 2JXXA 1K9MC 1BBXC 5JHBA 4Q0FA 3U58A 4P7IA 3DEPA 1TWFB 3SFEB 1WJNA 3HOXG 4IPHA 2I1JA 2LI5A 5GROA 4B3SL 2C5CA 1A3UA 1UUPA 2GN5A 2Q2IA 5FLXL 2IJ0A 2AL3A 3RNGC 3E0JA 1SNCA 1FFUA 1CZPA 3PZDA 3NZ3A 4LF7L 1P16A 1PTOH 1GOZA 2LVOA 4PYZA 1D4BA 2D0PA 3DUZA 1I94Q 1AYFA 3UI3A 4NJ6A 1E1TA 4A3CG 4E71A 1EWCA 4ZDVA 2EYLA 5KHQA 4DNRB 1TTNA 2C7MB 3KLSX 4X3UA 2NVYH 1PH8A 4LF6L 1JWMD 3QWNA 3P1MA 4KKTA 2KMAA 1PA6A 1BCPB 4CKEA 2BCOA 3TQYA 2EKIA 3OG5A 4AJWA 3KBGA 4P1CC 3TUOA 5FO8B 4DV4L 2Q2TA 1ONLA 3H91A 1NYRA 4IPDA 1KRTA 3PUXA 2ZJPA 1WRIA 4JI1L 1NVID 2Z8LA 3PO2H 1IBXB 2FMCA 1UH6A 3KUZA 3IG3A 4RMAA 2R7ZG 4GZYC 2KJHB 5ELDA 2M9VA 3IVFA 3RMHA 3S14B 3BWUD 1CKMA 3DVGX 1PH7A 1WTWA 3T9LA 3MXGA 3P4SB 3I55A 1GUTA 2JQRB 2KAJA 4BKGA 1Q86C 1X3PA 4DDGD 1SE9A 4LNNA 1QE6A 2RPVA 2PZWA 4U68A 4DAVA 3J7AF 5D2MB 2B2YC 2JQOA 1Q8KA 2FFKB 2E75C 4E74A 1PLFA 2E2HB 3BS1A 4NXNQ 3DM3A 1XNRL 2NUCA 5A2QE 4FDBA 4WAAA 3RZFA 1GNUA 1EU4A 1VQFA 5CV8A 4Y7NB 1WJ6A 2EE1A 4QUCA 2UUCQ 2DY8A 1VD2A 2LUEA 4DNTB 3K5LA 4B3SQ 3MJ5A 4GKJL 3DVNV 1VQIA 1S1QB 2N7DA 2M2LA 3R3OA 3A5ZB 1NEKB 3AH7A 3ZW3A 3EFUA 4JOIA 1OEYA 1MFWA 2BWFA 3PS6A 4L2YA 4HJ9A 1WIAA 4G3XB 2HE7A 2LXAA 1XTDA 3JAMi 1T3QA 2KVRA 3BDCA 3UIPB 5FR3A 1YJ9A 1F77A 3W3AA 1HNZQ 1WJ4A 3H6NA 1E7ZA 2DNFA 2VUMH 3HOUG 1N62A 1TWCH 4BBRB 4GN4B 3R8BA 3OPOA 3J81i 1I4HA 4NXMQ 2FCQA 2KQSA 1PZID 3ZNGC 5E7NA 5K36G 1V49A 2J0MA 1K51A 2B2VC 4GOPB 3Q2AC 1DCZA 2J7QB 3RI7C 3OSOA 5C1ZA 3TEZA 3CRLC 4EQOA 4ALPA 2ZCCA 3GTPH 4F88A 3OOCA 1PFBA 3ZIMA 1CHQD 4LUOA 2VH1A 3GP7A 3P4PB 1JRUA 3LNNA 4A3KB 2CH4A 3J80i 5HURA 2OHFA 2TSSA 4URKA 1EQQA 4DAYB 4JI7L 5T1GA 4ODGA 3PUYA 1FIQA 4WWPA 2MBBB 1EOTA 2BF8B 3NBIA 4HDQA 4ZRIA 3V6CB 2Z4HA 3RYTA 1TKGA 3UF8A 3A54A 4RMFA 3I56A 4DUYQ 4BBSG 1X32A 2KVMA 2KWUB 2K01A 5M3MG 3NHEB 5C23A 1XMOL 4LF5L 1PRTC 2DJFC 3MEHA 1WRDB 1WY8A 3B2GA 1C7YA 3PRPB 3O65B 2K03A 3HOYB 1C48A 4A3IH 3X0WA 1XNRQ 5CBAE 2ZXOA 2Q2HA 4YHHL 1VQ9A 1PYWD 5HKHA 1E8WA 1AH9A 2F0KA 4M00A 3BVGA 2JK8A 2Z6BA 3RULA 2K9XA 4A3DH 4LFCL 5ELFA 5C5MA 1Q1BA 2KN4A 1ENAA 2KWVB 2OCEA 2ZTDA 1EY4A 4M8NA 4DV2L 1JQ4A 3Q24A 3GTGB 1G91A 2UXBQ 1JWAD 4CDFC 1KDAA 5CMDA 4EZLA 2NVXH 1EM7A 3BZDB 2B3AA 2Y0SG 4IO9A 3KH0A 3UINB 2KJ6A 5I6WA 1VQKA 4LFBQ 3KK7A 3L13A 3NVYA 2NZOA 1EQVA 3DBLB 2K05A 1RDPD 4R4QA 5NUCA 4LCDE 4XWWA 4DV3Q 3N9YC 4A75A 4C2MH 1IBML 2KD0A 4W9LA 1VMPA 1HTQA 3FMCA 2EELA 3KLWA 4WURA 4KI0A 3WAMA 4IFDJ 4KX6B 2BYTA 4Z9CB 3KDFA 2UXCQ 2NVQB 4WFN3 4JI5L 2EYFA 1HZAA 3NP8A 1IL2A 3T13A 4M0WA 3PO3G 3M4OB 3IFDA 2YU9H 2F0JA 1P1AA 1I4PA 1XLOA 2DLBA 1GB1A 4RKLA 3CHBD 1I4RA 1OQQA 1XF5L 1FPYA 3L10B 3TP5A 4XYQA 1ROEA 4OVVA 1R4MI 2WAQB 4C4VB 3S15H 1C0AA 3JAML 1IKMA 4G11A 3RUIB 4GDKB 1C77A 1L4ZB 2M8SA 3U8ZA 2DY7A 2W9NA 1GUNA 1XX8A 1WCMG 2HT1A 1WTOA 1I50B 1Q3LA 2SNMA 1OXUA 4KD4A 1AW7A 4O0AA 1SMXA 1TY0A 4FA6A 4R4OA 2KDFB 1E2VA 1SYDA 3CCEA 4WQOB 1LTBD 1EU3A 2R61A 2YTYA 3HOWB 2O5JC 3PVLA 1I6HH 2RPQA 2WP9B 4DR4Q 1P3QU 4IM3A 3AMZA 4OL7A 4A3JH 2RHSB 1N32Q 3I4MG 3K58A 1RIPA 1QKZA 3NVWA 2BA1A 2OQKA 1ILPA 4RM9A 3T53B 1STHA 1C4PA 2KTRA 1AN8A 2RSNA 2EYMA 3K5OA 5HGTA 4DR6Q 1GC6A 3SD5A 1D7QA 2VNUD 2VH2A 1V9PA 2KBNA 1V86A 3HKZG 4I6LB 1TVXA 1QZGA 4X3TA 4DV1L 4B9KA 3GTLH 5DNFA 5BN5A 1R9TB 2I5LX 1L2FA 4N9TA 2XRSD 3MC9A 2K5WA 4OVUA 1WI5A 3O13A 1JJCB 1CKNB 1A15A 1SYBA 3SXHA 1MI2A 3TP7A 4G7HC 4JV5Q 3DM1A 1PH5A 4GNXB 1H9KA 2KT7A 3RLFA 2ZCBA 1FL0A 4YCVA 3ULPA 2DAJA 5LMNW 1BF4A 1MI0A 1TIFA 4XYOA 2KFKB 1BVSA 4ME3A 2LHDA 1AZQA 1U4MA 4FF2A 3VFKA 1UWMA 1DZ1A 3EHVA 4L6TB 4AUQC 1SN8A 4MT5A 1F9SA 1EYCA 2ES2A 2FUG1 1EIGA 1SIFA 3KVFB 3RR5A 5ELCA 2XBBC 3A74A 1K3BC 1HXYD 1EOVA 1N5WA 4G7ZC 3CMMB 4WWOA 2VQEL 2HDMA 4DV7L 2IO1B 2EXDA 2DN8A 4LFAL 1CMXB 3PSIA 2C5LC 2L83A 3D4DA 2NR2A 4JLCA 5AZFA 2CKZB 5JVG3 2GOWA 4GN5A 1WFQA 1E2WA 2C7NB 4RH6A 1V2YA 5KYIA 5BN3A 2K8HA 4YTPB 1K0RA 4JG2A 1IUEA 4MM3B 1RJTA 3S17H 4KN4C 3B1LX 1IYFA 1VDVA 1QZEA 2XWJB 4K2KA 4AYBG 1QF6A 1GUOA 3A1QA 4NZLB 1LTID 5E4WC 3V05A 2WFWA 3NJTA 5BYRA 1OQRA 3N30A 1PZJD 2HHHL 1II3A 1R4PB 3E3XA 3AEVA 5DM73 1HE8A 1U4PA 2H4OA 1BUVT 3PO2G 2R7DA 4A3BH 1PTOD 1WXVA 2CHWA 1EY9A 4LJZC 5IWAQ 2XTIA 2V4IB 4LNIA 1XYIA 1O7LA 1B3AA 1EYGA 3PHXB 3HVZA 3N3KB 2SAKA 1DD2A 1BBWA 2XRQD 2I5MX 4M8AA 2L55A 4TV3A 2FNJB 3W1GA 4LF8Q 3LXFA 1GM5A 1NBFC 4RA8A 1SNQA 4XT3B 1T5EA 1FNUA 5CV9A 1RRBA 4QQBX 5I4DA 2R93B 3W1YA 2WXRA 3L7ZC 4X62Q 4ZRZA 3A8KE 5LHY1 1PH3A 1WGKA 2AQ3B 4PS8A 2V9HA 3N32A 1OGWA 1E2ZA 2NBFA 5JJZA 4HIOA 4JI2Q 1TKEA 1LLRD 2AX5A 5AFWA 2EMTA 4GGQA 1BCPC 1RTOA 1HA6A 4ZYSA 2MBEA 3SGIA 3EUB2 1H8CA 3GO5A 4UP7A 3RZOH 2GBKA 3PLVA 3TL5A 5JJLA 1Z9FA 1P9DU 3KF6A 4A3GH 1QB5D 4DNIA 1G2TA 2F3VA 4FXKC 4QF4A 2A8VA 2K8BA 4HXDA 3V62A 2PQAA 2JA6B 1A8VA 3VA5A 3RNFC 3VR9B 1CI3M 4DV7Q 2HTME 2KXJA 5DCNA 1KOTA 1HQRD 2K6QA 4FJYA 3A9KA 3UI2A 4XX5A 3NE5B 1PRTF 4X57B 3RN9C 2K5HA 1FCLA 2R92H 4HJAA 2VUMG 3SVMA 1K8RB 2MX2A 1LGRA 3ZXVA 2KHSA 1KL9A 2L4NA 4QCLA 4JI8Q 3CC7A 4P6VF 5JVH3 4II3B 3GB1A 1CA6A 1STNA 2LGIA 2L0TA 3MTSA 3AXCA 2BTEA 1WX9A 1SAPA 2QJLA 1K83H 3WAPA 1K8MA 5C6AA 4FADA 2EQSA 2WP8J 4EKUA 2RSUA 2K6AA 1N61A 2WB1E 1B1ZA 4QL5A 4MNOA 3M3YB 5C5LA 4YY3Q 1TWFH 2Y5CA 4EZJA 5LMNQ 4BS9A 4CKCA 4PG3A 2PJHA 3IHPC 2H5XA 5C4XG 4W9JA 3CWIA 2NB0A 3TEXA 2B2TA 3PGEA 2A1AA 4HCNB 4KKSA 2ACZB 3ZVVA 5KHOA 2JSOA 1QLBB 1H9SA 3A8JE 3DWQA 3C8YA 1HNWQ 4OWXB 2K1BA 2NTSA 4IWQA 2WXIA 4JBJA 4I65A 4RCNA 3W1BA 1Z2MA 4R1JA 4OHJA 3BU2A 3OMGA 1VQPA 4FF1A 2A73B 1K50A 2DZKA 5IGGA 4A3IG 1M4VA 1L5PA 2IZVB 3ECIA 2UUAQ 3HIZA 2ZPNA 4DDID 4C3IB 1IPGA 3B0AA 1Y1VB 5IOCA 3ICEA 1UBIA 3IFWB 4A3DG 2GRIA 2JWZA 2KN5A 2O6VA 1T5XD 1Q7YC 5T1IA 5LLIA 3F2DA 2Q2UA 3M63B 2Q5WD 4JWUC 3H3VI 2NWGA 3Q6SA 1YNXA 4RKBA 2YVCA 3EECA 3PTFC 1YJNA 2JE6I 2JYOA 3TRZA 4ZRPA 4LF9Q 4DHZE 3IFTA 3S14H 3MFGA 2DZIA 3TEHB 3K80C 4FF4A 2QDLA 3X3NA 3GTQB 5KYLA 3QG1A 1F9JA 1XMQQ 3T16A 5BYSA 1RL2A 2V4DA 1HZ6A 1WE6A 4LNFA 4LW1A 5JPMC 1UE7A 2LVQA 5G3LF 2MFIA 3ZNHB 3TZDA 2ASBA 3VUYA 2J0JA 3ENEA 2F0QA 2E2HH 4DK3C 4GMVA 1L7YA 1EIYB 2YEPB 1H9MA 3BINA 2Z0EB 5CV4A 4W9CA 5IT9c 5E4XA 4MGIE 1E24A 3GDEA 1PRTB 4K5WA 3J7A5 3PV1A 4Y7NH 2L52A 3HOUH 3U7DA 4DR2L 3SR1A 1K73C 3ML9A 4BAXA 4JI3Q 1WYDA 3LX0A 2FBWB 1YQBA 3V3XA 1EY6A 5DPTA 4EZKA 1FXAA 3P20A 4JI0Q 1HJPA 2X6GA 2N9KA 2DGYA 4DV5L 2BE5C 1GXDC 5E6PA 2JA8B 1D5MC 3NQTA 1CZGA 1LTRD 2JPHA 4X64Q 4W9DA 5FLXc 4EEWA 2ZM6Q 1UAPA 3AEBB 4AJYB 4YCUA 3H0GG 4PV1C 1N34L 1YN4A 4BBRH 3MWYW 1B2TA 2JY6A 5DAUA 5LMUL 3P42A 2QMTA 2GBNA 2KQ7A 1J9OA 4W9GA 4ANVA 5J2RA 1JOKA 2QEJC 2WXKA 5EJWA 5T8IA 5AZGA 3DBLI 2BB6A 1CHPD 3AEFB 1WGGA 5IAAC 3VAWA 1SYEA 4BA2I 2PEAA 4DHJD 3H3VH 3D31A 3RNAC 3AEEB 3RZDB 4XGAB 2ZZPB 4A3JG 4BBSH 1B50A 5M5WB 2K5DA 3AU7A 3G7LA 5L37A 1Y1WB 3DBHB 3KDFB 1GHKA 2ZXRA 2MNAA 4P16A 4A3KH 3A55A 1V6EA 4P1BC 1EWIA 1G8ZD 1QUQA 4A55A 2K5VA 4C3HB 4BY7B 2NCNA 1C4CA 2MJ8A 3I2ZA 4M0WB 1Z5SB 3QOJA 4BY1B 2L1BA 5J39A 1WE7A 1ZKHA 3ZUNA 2KENA 1EFID 1SE2A 4O1NA 2J4XA 4RHRA 2J7ZA 4QJFA 5I9PA 1VQ4A 2EMSA 1EY5A 1F52A 1P0RA 3IBEA 1YIWA 2DYBA 3DXJC 3EROA 3U4VA 3QR8A 3CPWA 5CX3A 2BH8A 4CHKA 1QVCA 3ZO5B 1QQRA 2NZ1D 2ATWA 4L1BA 2E6XA 5E6JA 2I5HA 5JEAJ 1WD1A 4OX9Q 1DOLA 1WGHA 1XO3A 3A5UA 4YSZB 4N8FA 4YWLA 2NPTA 4K2LA 2DAFA 5EKLA 3QA8A 3W1SA 1A5RA 4NJCA 4A8XC 2F3WA 3OMCA 3SDLC 2AL6A 3MC0B 2B8GA 5GAGC 4DF7A 2G9DA 4A3LH 1JQYD 1WF9A 2W82A 2WKDA 2BBCA 2MCNB 4V190 5JPNC 4MTKA 3GTGH 1T0QC 3Q8AA 1PDXA 1SJED 2VZKD 2UU9L 5BMIA 1HNXQ 5D14A 1VQBA 3S1QB 1VQMA 1S5DD 4EQNA 2ON8A 2P5ZX 4Q5VA 2EZVA 2HQLA 3PO3H 1LM0A 5IGDA 4N6EB 3A7LA 4EQPA 1LTAD 2MBHA 1FRDA 2A5HA 2HD5B 1M90C 3PIOA 2XK5B 3PZ8A 1FGBD 3QWZB 1EL0A 4GNXC 2PVGC 4J6IA 2BS4B 4OXPA 1IHZA 2IO0B 2NVQH 4MZ9A 1G6ZA 3DCGA 2VY3A 1SGHA 3D4RA 1Q12A 3BZCA 4W9HA 1I94L 4GS3A 2VQFQ 3MC8A 2KDMA 4XQNA 2INNE 3HOVB 2NS5A 3I4OA 4A3BG 1D5ZC 3NPPA 3ZKJC 3I4LA 4HMJA 1WTHA 3K8AA 2A6ED 4KHVA 2LGYA 4JQWC 3STBD 5BYQA 3AQQA 2CHZA 3W5VB 4FNFA 1M94A 4C3JB 2M00A 1Q81C 4LMQD 4BKSA 1EUVB 4FXCA 4JGHB 4B3MQ 3K81C 1T6BX 3E56A 4HMIA 1NY4A 2PTLA 3KWLA 4ZAIA 3HOWH 3PRMB 1N6ZA 5H92C 2VS1A 5C44B 3D8GA 2IY1B 2D11A 1WJJA 1WXSA 4OVZA 1BKBA 3U4EG 4B6WA 4DN4M 3QB3A 4UPAA 4ZCKA 1VQ6A 4B9WA 4P72A 1KNAA 3ZRFA 4BKTA 2W3SA 1TWHB 3C3LA 2LMCB 2KC1A 5G55A 2JYEA 1SSOA 3I4NB 1X65A 1VQNA 3IAYA 5C3WA 5DLQE 1LQBA 4L8JA 4X6AH 4DXFA 1IYVA 3EGRA 1YIJA 5HGQA 1B9MA 5EGTA 2IY0B 4CJ2C 2R92G 1N60A 2UUCL 1YQ4B 2FCNA 3L4PA 2ZJDA 1O7ZA 1JW9D 4J3OD 4MH0E 3NTKA 1RLFA 4NY0A 1IW7D 3M4QA 1LTGD 2FUHB 4MELA 2XSCA 3MVVA 2X6LA 1LT3D 1X56A 3CSFA 5L95C 2WINB 2RHQB 4UAIA 2M4NA 3S1MB 2O2VB 2K14A 4R9WA 4TKOB 3M3JA 3B6YA 4OONA 1GD7A 2LVPA 3CP0A 4XYCA 1D3ZA 1Q1EA 3HKZE 1KTKA 1O80A 1HNZL 2F0OA 3M95A 4G57A 1PH9A 2KX0A 3L08A 3AN1A 3ZTCA 4NXML 1KHIA 3DWMA 4RGTA 2WXMA 4IOAA 1Y8RC 1D5XC 1XCTL 4S0RA 2D3GA 5ELEA 4RNAA 3ZDTA 1FMAD 2WXGA 2FIFA 1PDQA 4WJOA 3ZRCA 2TMPA 4IZ8A 5G5GA 3W9CB 1SMYD 4ITKA 1MHHE 4B08A 3A9KB 5D94A 3WOEA 3JAMc 2Z59B 1S5BD 1EQRA 3QIJA 4N9PA 1TGZB 4EX5A 1V81A 3FILB 4IPCA 1NI3A 3E9SA 2PQEA 4LAAA 4GU2A 1WR6E 3LDZE 1LO5D 5C4ZA 4MHEA 2F0PA 3J81c 3TREA 1YD8U 5FOBB 3C1EA 3FHWA 4ILWA 4DUYL 4L5RC 1LTLA 2KHIA 2WIIB 5JAVA 3CU7A 1HR0Q 5LXIB 1W2BA 2EXZA 1STAA 3RNUA 3DWGC 1GAQB 3F2UA 2DWQA 1J7AA 4IFDG 3SK8A 1A70A 3BDLA 1E22A 3J7ZC 2MHJA 5JH5C 4L5TA 5C0XI 1V43A 2ZXPA 3J80c 2JVCA 4KD3A 3KFUA 4KKJA 2EJFC 4JOIC 1EWHA 4CDCC 4K8IA 2EY6A 3OTOL 3B9JA 5J22A 1ENCA 3C46A 1JWUD 3MTNB 1MG8A 1FYCA 3J7AV 1E8XA 4XQQA 1QJOA 3AI5A 1ZDVA 2JA9A 1AWDA 2R93H 1QT9A 2D3AA 4PNYA 4ASWC 2UXBL 3CCMA 4IPGA 2N9XA 4ZYNA 2AYOB 2XNAC 3HVDA 4AIMA 2D2QA 4C7ZA 2IWHA 2KQ4X 4LF4Q 4IG7B 4RF1A 1I3QB 1LTTD 4NMZA 4LFBL 2V3NA 4KZCA 4HN7A 4KJOA 1V5TA 4XZ4A 3WOFA 5AUIA 2PE9A 1Y8PB 2MP2A 2CH4W 2J0TD 2ENBA 1QWYA 3VR3A 1T0SC 3ZJTA 3A4RA 4DV3L 3KUPA 1AFPA 1WGYA 3DBRB 3W5OA 2JA6H 4XT1B 1PFMA 1JE4A 1YEZA 4G50A 4X3SA 2Z0SA 3S2AA 2AMCB 1SLJA 4ULLA 2CWPA 3K9OB 2UXCL 1LT5D 2I0QA 4BBRG 3AE6B 2E3TA 4C7YA 5C4XH 4KHPQ 3KW5B 2HCIA 5CC4A 1PZKD 2O6VD 4IWOA 5EE3A 1A0IA 3V61A 2D10A 3MXNA 2NYZD 3A9JB 1A2TA 4RFBA 2V0GA 5GXGB 3FDTA 4JPBW 3X3MA 2C60A 3VTWA 3P1HA 4XDXA 4DQOC 4EQ5A 1HH2P 2OF1A 2ONQA 1P8LA 4DV6Q 3M3YH 3GD7A 5C0XH 2CW0C 1I4XA 4A3KG 4JI6Q 1PVOA 1E0BA 1GO3E 2OJRA 2N78A 2IY5B 1ZOYB 4PZ6A 2LUMA 3ULJA 4A3FB 2V4LA 2MHVA 1X3EA 1T0YA 4FN2A 1RFKA 1TZ1A 2MBQA 3OTOQ 4DUZQ 5JXVA 1ET9A 4K6DA 1NI2A 4DR4L 3FKIB 1N32L 2ZPYA 1ET6A 3AB9A 1WMHA 2WGSA 4A76A 3OAWA 3ZTDA 5D7GA 3VRBB 3HOYG 3MJWA 2PMVA 1ZE3D 4C3IH 4DR6L 1U4AA 3WANA 3AYHB 2RQXA 1DOXA 3KUDB 1Y1VH 3JVZX 1V8CA 1VR9A 1K8GA 3QAQA 4A3LG 1LUZA 1Q82C 3PUWA 1HCZA 2A74C 5EKIA 5M3FB 3OIPA 1DM0B 2KZRA 1IL8A 3AU5A 4HPLB 2O5IC 2WXNA 2B39A 1X3QA 1L0WA 3VDYA 4JV5L 4LUZA 3PREA 3DBHI 1YX5B 3JSVA 2F3IA 5IP7G 3KJPA 3E9HA 3QJZA 3S24A 3CCVA 2UWQA 3GTQH 1QOBA 5IYCG 2IBIB 2O4XA 3HG9A 3Q8EA 3P4RB 5IE8A 1UEAB 1BR9A 1HTLD 4IALA 4CDEC 1WD0A 2F03A 1L1OA 2IYDB 3MFYA 4IM0A 5J18A 1C1YB 3RNCC 3ML8A 2N9EB 4P75A 2PYKA 3S1NB 4GKKQ 3MAQA 1YI2A 4IKGA 4C1NK 3AV8A 1AE2A 1AEXA 1IKLA 3H0GH 2GB1A 4NJ7A 2KUMA 1KXLA 2RBMA 4KIKB 1YJIA 1S3OA 1U0LA 2DENB 3AE1B 4QMGA 2NVUI 2AKWB 2F0EA 2E5LQ 2E8GA 4YSXB 4ZHOA 1HFNA 2E2JB 5FKAC 4HKZE 4B3TQ 1CM9A 1K28A 2CFMA 2B2WC 2EY2A 3TBLD 3SE0A 1DOMA 2LXKA 3K9PB 5FO9B 2WAQG 3TDQA 4NAMA 1HZ5A 2SOBA 4BOSC 4A3EB 2F0LA 1MSGA 3EJIA 4HJGE 1H9JA 2OT2A 1C8CA 3VTUA 5I2YA 1PV4A 4A93B 2KDBA 4LDTD 4K7WA 1OO9B 2Z6KA 3A0JA 2KEDA 3KYHC 4A4IA 4AQYQ 2MSED 1KAWA 3HOWG 2A6EC 3STBC 2WU5B 4HVBA 2L32A 2DUDA 5IWAL 3RZDH 3WAOA 2PI2A 5DPSA 1PGBA 5M5WH 3CCJA 1RD9D 2F0WA 3BDOA 4XTCS 4CHTB 1Y1WH 2F0MA 2JZ3B 1YJ1A 4I6PA 4LF8L 2LJIA 4HCEA 4L5QA 1Y69U 4C3HH 4BY7H 4BFRA 1PGXA 2DBYA 4GDLA 4BY1H 3BK2A 2QKIC 3TP6A 2N1WA 2B63B 3L54A 3TN2A 2N9LA 4X62L 4W9FA 2EVBA 4YWGG 2D9UA 1U4LA 4YTNB 1V1QA 2B29A 1OXXK 3Q22A 4JI2L 1ZYRD 4L5SA 1I5FA 4MGKE 2DHZA 1R4NB 1DOKA 4CGYB 4PQXA 2LFIA 2QDFA 3DHQA 4DV0Q 2KCNA 1KRHA 1YNNC 2AWOA 2LGSA 2WXQA 4S3SA 4ABNA 1IGCA 3JAME 4LK1C 4D2KA 2OOBB 1YNJD 1V8QA 3TIXA 2CVRA 2ZEQA 3GTMB 1JMLA 3J81E 3PSEB 1PTOB 4ZUJA 2AQ1B 1VMCA 1FM0D 1BQQT 3RN5A 4WH4A 4TQ0A 2AUJD 4JCVE 3Q3FA 4XDDA 1EZ6A 1PYBA 4JBKA 5C3JB 1VQ7A 2G45B 5KNBA 4JI8L 4BKSD 1IW7C 2K75A 2NVYB 2RF4A 5HHDG 1GUGA 3D6WA 2WXOA 1BOSA 4DPGA 4A6QA 1T9HA 2N7JA 4FF3A 4PK1A 1MGSA 4K3CA 2B2UA 4HIMA 1TS5A 2YV5A 3QC8B 1QVFA 3RT3B 3NHHA 3J80E 1FJGQ 3EQLC 5EPKA 1X54A 3DDCB 2LXCA 4YY3L 3H94A 4HR7B 3CRKC 4IUUA 5LMNL 3PO2B 1CT1D 2A5UA 2R3ZA 2JUOA 5G2NA 4UP8A 3U52E 4KGSA 4YSYB 2J42A 3CC2A 1BMLC 3L3OC 2BDNA 1J5EQ 2EYHA 5EQ0A 5ELNA 3TBIB 3GTJB 1JB3A 3DMUA 4BVUC 2DZJA 1HNWL 5IP4D 3IAS1 2HIXA 2JEBI 3KF8A 3PMFA 3GTOB 2PI2E 4FULA 3HOVH 4AP4C 3K5NA 3K7UC 1YHQA 3T3NA 1ESFA 1NNXA 4B3RQ 2UUAL 5IGCA 1SDFA 2RR9A 4CYEA 5IYBG 4KTAA 3VYSA 3NXWA 3K7AB 1PH1A 3KYCD 4C3JH 1YN3A 2BOSA 2F0SA 4BWGB 4MTNA 2Q8TA 3NVVA 2L0CA 4GN1A 2WX0A 4ACFA 4EOYA 1KH0A 1B7YB 1VCIA 2MO1A 2OTJA 3JW0X 4IOCA 1RWSA 3I3TB 1ASZA 2R93G 2RD0A 2RDBC 1TZOA 5H1SE 4DR7Q 5C44H 2I2YA 2YEPF 3EVQA 3GQBA 1ICFB 4LF9L 1XQQA 5CR3A 4APVA 4IFDI 1Y56A 2LS01 4HJ5A 2IO2B 4KGRA 4USAA 1SFOB 1VQHA 3CQZB 2NVTB 1EWYC 3DPDA 3GE3C 1VQEA 4GN3B 1YHBA 1WTPA 1XMQL 4DR1Q 1TWCB 4CJ1B 1SIJA 4NPNA 5GADC 1TWHH 2A68D 1EEID 2L05A 4A3PA 1FO4A 1EYDA 1FXTB 3EN2A 1CA5A 3I4NH 3CKIB 2JA6G 4B9XA 1IBLQ 1BNZA 5C2TB 2QF7A 3ZYYX 1XWEA 5CORA 1XLQA 3AEAB 1VQJA 1NUCA 2IX3A 1NJIC 1F2ZA 2B2TC 2ZJRA 5E1FA 1C9OA 1Q1OA 2LRWA 2PIAA 2WQYB 4HEA1 2JEAI 1B3QA 4P73A 4MJSA 4K8JA 3EC8A 1H9RA 1IBXA 4JI3L 3QQ8B 3SHLA 1SYFA 3MHBA 1A62A 2E74C 2R7FA 3K59A 1HEZE 2JU6X 2PW9A 4QAYA 4JI0L 1SROA 4FXGC 5CGKA 1H4RA 2JF5A 4WWMA 1TWGB 3S1MH 2FE8A 1JC7A 4MGYE 4X64L 1N33Q 2ZM6L 2WYQA 4W9EA 1SNMA 3HGBA 2MJEA 5C0XG 3HOZB 5KEEA 3VXWA 3U4ZA 3QARA 4JI4Q 1IZ6A 2CKHB 2K8CA 1WOCA 3VA7A 3KYDD 2UUBQ 1TT5B 1TQOA 1HHVA 1EUJA 1V97A 3MEFA 2KA7A 2IGHA 4GLAC 3NZSA 3JYUA 3I70A 3H09A 2WDRB 4KSKC 3DBRI 5KNCA 1EF5A 2R6GA 2H88B 1QOFA 1SF0A 2KEEA 5D3DA 4WJPA 1DGSA 4M1UB 5FK9C 2KO3A 3H7PA 4IFDH 3AFPA 4DR3Q 4HRSA 1UE1A 3PF4A 2HTHA 4C3IG 3Q8DA 2PPHA 1JR0D 5E6NA 1Y1VG 2BDOA 1ZXTA 2MEKA 3PO0A 1N36Q 4JE3B 3PIP3 1PFNA 3F1ZA 4A3MB 4P71A 2PMZE 4I7ZC 1UGJA 2KWCA 3N1YC 3VR4A 3ZQ4A 2IX0A 3ZNID 1GUSA 3U9SA 5CTRC 2L7RA 4GOPA 1XLPA 2DZMA 4OX9L 2X8XX 4XC2A 2K5PA 1IYUA 2R2OA 3QOLA 4YWMA 3ND9A 4GB9A 4DFAA 2WXLA 5IOIA 2B8FA 4X66Q 3CIRB 2LGXA 3D32A 4DAMA 3KUCB 4TKNA 3C2PA 3ZJUA 3GS2A 2L00B 1I7HA 4WIPA 1IYJB 2WKCA 4ME5A 3ABVB 2EPBA 3V2TA 1FCCC 5A35A 1MJEA 2EY5A 1S4ZA 4QY7A 4OIJA 3R7RA 4DHJB 4K5VA 4RG1A 1MKHA 4BZAA 4J8QA 4ZQ3A 3RUZA 1CK1A 5I9OA 2FXQA 1HNXL 2XIWA 3I91A 3HRDD 4GOCA 1G51A 3M7GA 2JZZA 4RAUC 4J15A 3SR6A 4K14A 4R4TA 1I3QH 2A6HD 2PW5A 3P75A 3KJOA 2WS3B 4LTUA 3X23A 3NWSA 2MWSB 3NS8A 2ICEC 2VB3X 4MSQB 3LJ3A 1QILA 2PE6B 3TS0A 5MPOA 2SDFA 1FXIA 1F0ZA 4OGQC 3DVNU 1VQAA 3EIVA 1WM2A 3H7SA 2ZW1A 5IP9H 1D6EC 1E1OA 1MSHA 3CCLA 2JA7B 4N9F4 2JA8G 4R8IA 1ENFA 1WJUA 3Q3MC 1CJEA 3AEGB 2W54A 1NMGA 1XNQQ 1E7PB 4HSPA 3QK0A 1VQCA 3SEBA 2ZJQA 2LHEA 2JZPA 2GBJA 2JRHA 2VQFL 3KQ4A 1KLGD 5FO7B 1YVCA 1ESRA 1GKHA 2YLMA 1IGDA 3MXPA 4XIGS 2FAZA 1FVIA 1YJJA 1GB4A 2QW7A 2JN4A 2LSSA 4PMWA 4C1NI 2F0IA 3VYUA 3PRZA 3AU4A 2N49A 1Y1WG 2NMQA 3Q8CA 4WJQA 2EY1A 2RGFA 2VZKB 5EE9A 2KLGA 3W1SC 2D62A 2LFNA 3HOYH 1WZ0A 1A63A 5LXHA 4LJOB 4B3ML 4MEMA 4RCOA 4C3HG 4BY7G 4FYDA 4GLXA 2QILA 4BY1G 3SK5A 1BBUA 1ZGUB 5FLMH 1PUTA 4HJKA 3T1HQ 4LNQA 4YXDB 3I73A 2UXDQ 1OEYJ 1G291 3FKIH 3VH4B 2N0SB 2F0GA 2D3BA 4P74A 1E9MA 1UD7A 4A20A 1JMCA 3APFA 2BA0A 2K28A 4K81A 2I1KA 3CF5A 1STBA 2PPBC 2GMIC 4CKBA 2CU3A 1G2SA 1JJGA 2KTRB 3G6JB 5IP7H 2D2CC 3UIOB 2F4IA 2LWPA 1J6QA 1RF2D 4YCWA 1XEEA 2D0OA 2JA5B 4H2AA 4LK0M 4C4VA 4MDKE 4GDKA 3H6MA 5IYCH 3BJUA 1ZYRC 4WAFA 4UY8C 4J1MA 2PCFB 3M62B 3HHMA 2RA4A 1ML0D 1L0VB 5M3FH 4KY6A 5I6YA 4WORA 4AH6A 1YN5A 2E76C 3UE0A 4BOZB 2LRUA 2KANA 3AE2B 1U9RA 4QGUA 4RF0A 3IXSA 3WIMA 4IUTA 1HR0W 1VQOA 1YNJC 3NWTA 1WTVA 2INDC 1VF5C 1TWAB 2FHTA 2F4VQ 1E7UA 1UWXA 3NUHB 2Y0SE 2ALYB 1N5XA 2HJ1A 2OQ0A 3MP9A 2CCZA 3HRZC 1ZEQX 4H7BA 2MUYA 3M4OH 4TMAB 5KGUA 2IL8A 1VDZA 1PXUA 4PMBA 3KLRA 1OTRB 2A69D 1B4OA 1MVKA 3NENA 4N8X1 2F0HA 3CXCA 2H89B 1Y14B 3FEWX 3VRAB 4B95A 3S1NH 1QOAA 1GJZA 4DR5Q 2LKVA 1KQSA 1R4NI 3Q14C 1LM8B 3F2CA 4FHKA 2E2IB 1V1PA 3T56B 4EUTA 3CW2C 2EIFA 3UDXA 1I50H 4DXGA 2Z9HA 1T0RC 3FPPA 5LL6S 4XQJA 1PTOC 4GNXA 3MHZA 3HOVG 1KD1C 3URYA 2E2JH 2FJ2A 1NE3A 2MBOA 3T51B 1SRUA 1CKOA 4CJ0B 5IGFA 2RDFA 4X3KA 1XXGA 2WB1B 5C3EB 3ZLZA 3I57A 2KFKA 1F2MA 3LYYA 2A4ZA 4C3JG 2BWES 1JOQA 2NBVB 1V5OA 2YYZA 1Y8OB 3A1QB 4M02A 3A33B 4HROA 2WACA 4X65Q 1KFYB 1S5CD 4BBNF 4A93H 1C4AA 4IDIA 3CCRA 2DNEA 3KWVA 5C4JB 4F8MA 4NKLA 2BKFA 1VZ6A 4KY5A 1HR0L 3OWFA 1WVLA 4A3GB 1NCVA 2VL6A 5C44G 1CZWA 1F2RC 2BYVE 4LWCA 2MW5A 3U50C 1XTCD 1R9TH 1BDOA 1JT8A 1S3SG 1XCQL 1C76A 3QIAA 1ZPSA 2MO0A 1F2RI 1F1HA 3C0RB 4TSSA 1YITA 3DHGC 1FNVA 3AB5A 2BVCA 2PZTA 3HOXB 4MSMB 1B44D 2PZUA 2DYOA 3KF8B 1E10A 5L83A 4MM3A 2B63H 2WLBA 3I4NG 3R66C 2KWDA 4R4CA 1IBKQ 1YBYA 4JVZA 4POFA 3G48A 2ZVOA 4U673 2G1EA 1QZHA 5A2QL 4LF4L 1HRJA 2KC2A 1JRPA 4FP5D 3OJ4B 4K0KQ 2JX5A 3E9IA 2NN6G 3OIQA 2N9PC 5C4HA 1KM7A 4DHZB 2A68C 3KF6B 1LT4D 2N8NA 1MIUA 3L16A 1C78A 2PQAB 3DHIC 3A7AB 3GTMH 5IYDH 4K1RB 3BYTB 1DOYA 1YOVB 2ASQA 2PMZB 1NAPA 1X3GA 4PZ8A 5GMVA 4RGNA 2AUKA 3Q3JA 5BMGA 3CAMA 1E6EB 5EPJA 3C1FA 2L5TA 3DQVA 4KHPL 2R7ZB 1ZXHA 2BPSA 2IGDA 1SE3A 2ZNVB 3CSTA 3Q3OC 3R2TA 4K7SA 2PW7A 4F1SA 5E6OA 1CUKA 3IL8A 1D2BA 4CQNA 1RCVD 1HZCA 2QSDA 2OWOA 1Z47A 4IUPA 1KRSA 1EEFD 2NZHA 5F2DA 4ZUIA 2J52A 4HPMB 3S2DB 2J53A 5IT9E 1K3RA 2KDIA 4RWSC 1SSNA 1RTNA 3RZWC 4HJ7A 3LGJA 1LFDA 2B76B 4DV6L 2X38A 1R4QB 2MGSA 3VR2A 5KRUA 4JBMA 4JYAL 4MJSB 2FMMA 3ERQA 3D0FA 1KAAA 4JI6L 2WNMA 5IA7A 1TT2A 1X6OA 2ID0A 3NK9A 5AJ3Q 1EF1A 5IYBH 1ASYA 1KF6B 1MG4A 1SEBD 2XN9C 1VQ8A 1WYGA 2INCC 3G71A 1E8ZA 5HFYA 5M5XB 4DUZL 1IP9A 1W3SA 1LT6D 1H9SB 3GTJH 2LASA 2EDGA 4ZKCB 1I6VC 1BCPD 2VRRB 4AYBE 5FLXE 2HDEA 4FHJA 3GTOH 3FKYA 4PS7A 5GAHC 1EZ8A 2KACA 1HPCA 3FP9A 1B70B 4O2DA 5JOBA 2KNBA 1PGAA 2WXHA 3TEYA 3EBEA 4JW0A 4XE0A 1P98A 1WTXA 2K7VA 2IT1A 2K1FA 3SFDB 1HA5A 3K7AH 1TY2A 3ONAB 5BR8Q 1XLNA 3FC4A 4OW0A 3R2IA 4K6LA 2WDTB 4G4KA 4HJ8A 4ANUA 2B2YA 1AZPA 1VQLA 3ER0A 1KLUD 3DWPA 1EFWA 4IC7B 3HOUB 3S2HB 3E5SA 2O6VB 1EY7A 1SJHD 2O2LD 3I63C 1CSPA 1BUIC 2JP1A 3GZNB 3PT2B 3VTVA 3H8HA 4ANXA 1XPOA 1A3VA 3NZUA 2KECA 4IN3A 2CS4A 2LEKA 1MJCA 5AUKA 5DM63 3H7PB 2ZW0A 4OZAA 1GVPA 5M9OA 1UEBA 4LF7Q 4KK7A 1PH2A 4F7ZA 3HZXA 2ZTEA 2KTFA 4DK5A 2ZTCA 1SFOH 1RYJA 3CQZH 2NVTH 5IGEA 1ZUD2 4KLKA 1XD3B 4NDXA 3RCZA 1L4DB 3K57A 1W6JA 4LF6Q 1Q10A 1NBWA 3NBHA 2K0PA 1ICWA 1EIFA 5HY6A 4RM8A 1RFAA 5CYUA 2M17A 5IP9G 5E3FA 3APCA 3S1RB 4ZRJA 3CMAA 4N58A 1I35A 2K33A 4GKKL 1VZ8A 2L76A 4NB3A 4DV4Q 2L3ZA 4V0BA 4C80A 5H8YE 4BBSB 2A6HC 5M3MB 5JEAH 4JI1Q 4JYAQ 2MA9B 2B2VA 1C3TA 2KJRA 3S16B 1KJTA 5EBDA 4HTHA 1TIID 2I46A 2BW2A 2JXMB 1YZ6A 3N52A 3VR6A 2E5LL 3AECB 3L0WB 1QVGA 4G0NB 3S9WA 1TKWB 3CPFA 1J8IA 4B3TL 1B9RA 3NVZA 5CV6A 1A2UA 1TWGH 1EIHA 3QHTA 3L9AX 2PVOD 1STEA 5JJIA 3V96A 4YWKA 4CO7A 1QCBD 3FVQA 3HOZH 2QIEB 4PT5A 3RN2A 1FEHA 5D3IB 2C7HA 3B2FA 4JK1C 4GIVA 4HKQA 1F9PA 1PQSA 3WWVA 2KFJA 1F9RA 4A3FG 5KIXA 2Y0SB 2VW9A 2EOTA 1EQTA 5FLMG 3Q23A 4AQYL 1YJWA 4DGZA 2KK8A 1Q0WB 2JWUA 4GXBA 1JORA 1WXMA 4BXXG 3VDZA 3FKIG 4A9AA 3OYYA 1D1KA 5JHAA 1VS0A 5FJ8G 1Z6HA 3D6CA 2N3SA 4GKJQ 2CR5A 3ZJVA 2R2QA 4CDDC 2E2DC 4HIDA 2AWNA 1S72A 2C9OA 2M19A 2LD9A 1QUQB 5D6JB 4DXAB 1STGA 3IT6B 2LY7A 4YIJA 3PZ7A 2EYPA 3Q6BA 5TSSA 1QOHA 1WFYA 5EKKA 1ZXIA 2V3PA 1WWTA 4RHSA 2L15A 3BVZA 4H0LC 3SU8X 3R3MA 1L1OC 3UDIA 2DJGC 1S5ED 3LWEA 3I90A 4NW2A 3G6EA 3AMUA 2JXTA 3NY5A 3PO3B 1PTOF 4A3MH 2WDVB 1NR2A 1JCKB 1MHXA 2AQ2B 5M3FG 3SK4A 3D4WA 3NEMA 4JBWA 4PZ7A 3M7NA 1HUNA 2C9WB 3AFQA 4OO1I 4DV0L 1KC8C 1DJRD 4HWIB 3H15A 2NTTA 1JALA 1G6JA 5K5PA 2M0AA 4LLGM 3V60A 4ID6A 1SB3C 1E7VA 2LZ6A 1GHJA 2NPTB 1MHWC 2BE5D 2HCCA 1OXSC 4NAWA 4FBJB 4HDOA 2KX3A 2AWTA 1TYGB 3U7ZA 4GLVB 2Z0DB 4LDTB 1V9JA 3U30A 5I2XA 3M85A 4KN7C 5DEHA 2N55A 4IQZA 2FCSA 1WCMB 3VYTA 3WALA 3M4PA 3ZJYC 3HP3A 4JI7Q 3AE3B 3QX1A 3HEJA 4FVMA 1SE4A 1K8OA 2KQ3A 4G7OC 1EY8A 2JJQA 4DA2A 2JT4B 3ZGZA 3G4SA 2JA8H 3IRBA 2K25A 4RGOS 2L8JA 3RNEC 2Z6KC 2QEXA 3I4MB 4M8MA 4WQMA 1LV9A 1XMOQ 4MH8A 1STYA 2IHFA 4LF5Q 1LABA 3M4YA 4UDUC 4DKAC 4US8A 3T3OA 3ULLA 2IW3A 3J7YW 2YTVA 3KLSA 1FJGL 1MJDA 4MACA 3DBSA 4ARCA 3HKSA 2A69C 1NMFA 4YHHQ 3PHWB 3J81L 1MD2D 3B08A 1PHJA 1ISNA 3U2SC 1GC7A 2QDBA 2JA7H 2K5QA 3HKZB 1X3FA 2Y5PA 3EFCA 4LNKA 4LFCQ 1WH3A 4YL8A 1VF7A 3VYRA 2QGQA 1K0SA 4A3EG 1J5EL 4DV2Q 1YQ3B 4AWJA 1WGDA 1TJEA 4HCPB 1QNKA 3CD6A 1VQDA 2K50A 4H44C 2F0FA 2XEWA 4ZKBB 4A93G 2B2WA 3GTKB 3DVGY 2VXWA 2PLPA 3L17A 1CTMA 4O42A 3AM9A 1BT0A 3PLUA 3J80L 3RLNA 1OTCA 4HEDA 1WI0A 1SXTA 3VVWB 3TS2A 1XPRA 2GLSA 3HM3A 4B3RL 1FD7D 5CV5A 5JZEB 2KCCA 4OO1H 3VR8B 1LYLA 1UNSA 2MQHA 3CC4A 2IGGA 4LJPB 3TMPB 1TS2A 5ELBA 5JJKA 1V1PB 2CQOA 3DWAA 5M5YB 3I5JC 1RODA 1IBMQ 4QB4A 3RD2A 4ARIA 2K4KA 1TS4A 1NR4A 1DGJA 4OWTB 2FINB 2B3GA 1N9WA 1FRRA 2XK5A 1O7IA 2OXPA 2B63G 4WJ3M 1F2LA 4RGMA 4B0EA 2J0KA 1B8AA 4KHZA 2Q8RE 4L23A 1EY0A 2VB2X 4DR7L 1B9NA 3MZ5A 3WCQA 1Q90A 1AARA 4JI5Q 1FFVA 5IKCM 4WJNA 2HUGA 3RD4A 3HFZB 2PNHA 2RDGA 3NUCA 3H1UA 2OEDA 4HK2A 4JL9A 2K5NA 3K0XA 2KHJA 3HS0C 2MJDA 3GE8C 3ZXRA 2B2UC 3LWUA 2Z1CA 4DR1L 3Q69A 4ZRKA 3NELA 3P7JA 2KOXA 1NSNS 3S1QH 1GJXA 4BA1I 5EE1A 2KOLA 4ANWA 1GUWA 3PV0A 3ND8A 2JA5H 2N4FA 1I42A 1U5KA 2QC8A 1TR5A 1L0YB 1M8AA 4AYBB 1IBLL 2G4SA 5IYDG 1W6KA 2M56B 3M9BA 2F0VA 1WZ3A 3MHSD 3V6EB 4AOFA 4HSVA 2UU7A 4K5XA 3I7FA 1IXRA 2RMMA 5EE0A 1RAXA 3TP8A 4HLEA 5CHFA 1I4QA 2WU2B 4QIWE 1J19A 1WXQA 2BS2B 2JSVX 3UQAA 1KDBA 2N7EA 2K32A 2EJMA 1TWAH 2NN6I 4TQUS 3C19A 2GA4B 3GV3A 1EO6A 1R7SA 2KYWA 4I6NB 1L6UA 5BN4A 4PS3A 5HG2A 2NBUA 1JB7A 1SMYC 1E3PA 1SNDA 4DBGA 1N33L 2D3CA 2K52A 1UELA 3K5MA 2KMCA 3T4AC 4OZCA 3W5UB 2JYTA 1NENB 2L0FA 3OW7A 2LMCA 4XWTA 1GPXA 1B53A 4JI4L 3WDNA 2K6DB 2REXA 2V1CC 1JOOA 1SBBB 1JROA 1UBQA 3P4QB 3UDGA 4HPPA 4DV1Q 2E2IH 2UUBL 2K22A 5TR5A 3PCOB 4DWFA 5IN7A 1OFFA 4DK6C 3BK1A 1YNTE 2KLCA 3ZDMC 4IUMB 5GQOA 3VR5A 1F9QA 5ISRA 3Q8FA 5CHVC 4W9IA 3U9OA 1QNUA 2V1YA 3J9CA 3MXUA 3NTIA 2QCZA 4IOIE 3AE8B 1DONA 5G5HA 2I07B 4DR3L 5EBCA 1C9FA 1E0ZA 2ZNVC 2BQQA 3R7QA 4B0MA 5C3EH 2A19A 2O2VA 4ZOHC 1RHPA 4KVGB 1J7CA 1MPEA 2VUMB 4A3OA 1N36L 1WR1A 2UYZB 1TS3A 2M1MA 5C4JH 3TZUA 1ACCA 1WSPA 1C79A 3F2BA 1UF0A 3HUIA 1I4GA 3RLOA 2AEHA 1TU2B 1D8LA 1UWVA 2OEOA 3K0YA 2KCMA 4IW0A 3EA6A 3VQIA 2VQEQ 2L11A 2BKRB 4LFAQ 4X66L 4DK0A 2D5DA 3GTPB 3IKJA 4KGTA 2NN6H 3OJ3A 3JC66 5KNDA 3FILA 1LXDA 3HOXH 4BBNC 1S40A 2Y5BB 2RDHA 5C4XB
chains in the Genus database with same CATH topology
2G9HD 1VJKA 1YMHE 1NYQA 4ZK9B 4HAEA 4KV6A 2WXFA 2MH7A 3NQIA 1U4RA 1SYGA 5IGBA 5JEAG 4KKIA 3MA2B 3BIID 3A8IE 1N63A 1P7FA 4A3IB 1ZDXA 3KBXA 2RVLA 5COYA 4ZLTF 2QCPX 3IT4B 1A6XA 1Q8IA 4A3DB 1EYAA 1WTQA 2F0UA 3FRPB 4E6IA 4FO2A 3SDZA 1L6VA 2WXPA 5EPLA 2F0DA 3AE5B 4IUVA 2NVXB 1TKYA 2X69A 4EE2A 4TRDA 4JWSC 4OIKA 1P7EA 1K53A 2Y3AA 2KJXA 3H3VC 4R3DA 1F2YA 3AEDB 3AE7B 4C2MB 5C3XA 4F87A 1HFGA 5CV7A 1HUMA 4Q2JA 2PO4A 2HDLA 1SNPA 2DNCA 2DYMA 4H13C 2I38A 2MPMA 2F0NA 2IPKD 4PMCA 4P2CB 3TSSA 4DAYA 3OWEB 5IIFA 1C4QA 2YU9B 3I3CA 1SNOA 2EYJA 1JWSD 1VZ7A 1PMRA 3DEOA 1KNEA 3QO2A 2CJOA 3S15B 3BVMA 4XXEA 1RM6C 3W2DA 1ILQA 3H0GB 3NSWA 2W3RA 3PUZA 1DOIA 1S5FD 1FD6A 1LTSD 4L63B 2SNSA 3BG3A 1AP0A 2HQEA 5K36H 1LACA 5IODA 1I6HB 1FNWA 3FAHA 4ZHPA 4A3JB 1KABA 2RKSA 3E6ZX 4IURA 1JICA 3PIO3 4GLSC 2GI9A 1A3TA 2PNRC 1ZP0B 1PRTD 3LB8C 2CW0D 2K04A 1SYCA 1L0XB 3TMEA 4DK1A 2F1MA 3I9V1 4J6HA 3GTLB 4NAWB 3RPFC 2ZT9C 1FR3A 1BXTA 4ZRQA 4WJWA 3K6OA 4IUQA 2MP1A 1QG7A 3NS1A 4FXDA 2EYOA 1KDCA 2ICIA 1OXTA 4OZBA 5D65A 1VRAB 4OO1G 3R93A 3AE4B 2CJNA 4MIUA 1RKNA 2BT6A 3FPUB 3I72A 4EVOA 2SEBD 1HQMC 4YT0B 4AQ7A 4QIWB 1O78A 3PUVA 5C0XJ 3SK6A 1CQVA 1Z7TA 4US9A 3NRZA 4IUNA 1QOGA 1J7BA 1Y8NB 2KMMA 2IX1A 2L9HA 1WTRA 2CHBD 4JX1C 3EFXD 2K3UA 3AE9B 3ITPA 2XVSA 2PKOA 4CBVA 4JPSA 4DU9A 1BO0A 4GDLB 2F0TA 3S17B 3ETRA 1V1OA 1DXMA 2BB5A 3NTHA 4KY7A 3IAM1 2WV6D 4R8NA 4A3BB 3TEWA 5G3LD 4A90A 2RSOA 1PFDA 4N59A 1VLBA 1BCPF 4C56C 2D5GA 2WDQB 4QUFA 5LNK1 2WXJA 3GV6A 4KJNA 3RFZB 1CFMA 1MBYA 2BS3B 3A56A 2EJGC 3P63A 1O7YA 4TQ1A 4AS1A 2L12A 2Q8IB 2H1EA 4DAPA 4YTMB 1K52A 3Q8BA 1HTPA 1D1IA 4EGVA 2Z4IA 3RZOB 2N88A 5BMHA 3D3RA 3BYYB 4KMUC 3N6RA 4NP5A 4HCSA 1CQFA 1ZKOA 5HI1A 2MJ3A 5CBEE 4KKUA 2CQAA 2IDYA 5J1ZA 2R92B 2L1AA 2XWBB 4WRDA 5LL6X 3I8ZA 1OXVA 5IT9L 2W55A 1YNND 4F7XA 1JWBD 4MN3A 3Q0AA 1K83B 3QJYA 3OHXC 2INPE 4REZA 4XDCA 1DYQA 1BBXC 4Q0FA 3DEPA 1TWFB 3SFEB 2C5CA 1A3UA 1UUPA 5FLXL 2IJ0A 3E0JA 1SNCA 1FFUA 1CZPA 3NZ3A 1PTOH 1GOZA 1D4BA 3DUZA 1AYFA 3UI3A 1EWCA 2EYLA 4DNRB 3KLSX 4X3UA 1JWMD 3QWNA 3P1MA 4KKTA 1BCPB 4CKEA 2BCOA 2EKIA 3KBGA 3TUOA 5FO8B 1ONLA 3H91A 1NYRA 3PUXA 1WRIA 1NVID 2Z8LA 1IBXB 2FMCA 4GZYC 5ELDA 2M9VA 3RMHA 3S14B 3BWUD 1WTWA 3MXGA 3P4SB 1GUTA 2JQRB 2KAJA 1X3PA 1QE6A 2RPVA 2PZWA 4U68A 4DAVA 3J7AF 2B2YC 2FFKB 2E75C 1PLFA 2E2HB 3BS1A 2NUCA 5A2QE 1EU4A 5CV8A 4Y7NB 2EE1A 4QUCA 2DY8A 4DNTB 3K5LA 3MJ5A 2M2LA 3R3OA 1NEKB 3AH7A 4L2YA 1T3QA 3BDCA 5FR3A 1F77A 3W3AA 1N62A 4BBRB 3R8BA 3OPOA 1I4HA 1PZID 5K36G 1K51A 2B2VC 1DCZA 3OSOA 3TEZA 3CRLC 4EQOA 4F88A 3OOCA 1PFBA 1CHQD 3GP7A 3P4PB 3LNNA 4A3KB 5HURA 2OHFA 2TSSA 5T1GA 4ODGA 3PUYA 1FIQA 1EOTA 3NBIA 2Z4HA 1TKGA 3A54A 1X32A 2KVMA 2K01A 1PRTC 3MEHA 3B2GA 2K03A 3HOYB 1C48A 5CBAE 2ZXOA 1PYWD 2F0KA 3BVGA 2K9XA 5C5MA 5ELFA 1Q1BA 2KN4A 1ENAA 1EY4A 1JQ4A 3Q24A 3GTGB 1G91A 1JWAD 1KDAA 5CMDA 1EM7A 3BZDB 5I6WA 3KK7A 3NVYA 1EQVA 2K05A 1RDPD 5NUCA 4XWWA 3N9YC 1VMPA 3FMCA 2EELA 4WURA 4KI0A 4IFDJ 4KX6B 2BYTA 4Z9CB 2NVQB 4WFN3 2EYFA 3NP8A 3T13A 4M0WA 3M4OB 3IFDA 2F0JA 2DLBA 1I4PA 1XLOA 1GB1A 4RKLA 3CHBD 1I4RA 1OQQA 1XF5L 3TP5A 4XYQA 1ROEA 2WAQB 3JAML 1IKMA 4GDKB 1C77A 1L4ZB 2DY7A 1GUNA 1XX8A 1WTOA 1I50B 1Q3LA 2SNMA 1OXUA 4KD4A 1AW7A 1TY0A 1E2VA 1SYDA 1LTBD 1EU3A 2R61A 3HOWB 2O5JC 2WP9B 3AMZA 4OL7A 3K58A 1QKZA 3NVWA 2BA1A 1ILPA 3T53B 1STHA 1C4PA 1AN8A 2RSNA 2EYMA 3K5OA 5HGTA 2VNUD 1TVXA 4X3TA 5DNFA 5BN5A 1R9TB 4N9TA 2XRSD 2K5WA 3O13A 1A15A 3SXHA 1SYBA 1MI2A 3TP7A 4G7HC 3DM1A 1H9KA 3RLFA 1BF4A 1MI0A 4XYOA 2LHDA 1AZQA 1U4MA 4FF2A 1UWMA 1DZ1A 4L6TB 4MT5A 1F9SA 1EYCA 2FUG1 1EIGA 5ELCA 1HXYD 1N5WA 4G7ZC 2HDMA 2DN8A 2L83A 3D4DA 5JVG3 1E2WA 4RH6A 5KYIA 5BN3A 4YTPB 1IUEA 4MM3B 1RJTA 4KN4C 1VDVA 2XWJB 4K2KA 1QF6A 1GUOA 4NZLB 1LTID 5E4WC 3V05A 5BYRA 1OQRA 1PZJD 1II3A 1R4PB 5DM73 1U4PA 2H4OA 1BUVT 1PTOD 1EY9A 4LJZC 2V4IB 1XYIA 1O7LA 1B3AA 3HVZA 2SAKA 1DD2A 2XRQD 4M8AA 2L55A 3LXFA 4RA8A 1SNQA 4XT3B 1T5EA 1FNUA 5CV9A 5I4DA 2R93B 2WXRA 3L7ZC 4ZRZA 3A8KE 5LHY1 1WGKA 2AQ3B 1E2ZA 2NBFA 5JJZA 1TKEA 2AX5A 1LLRD 5AFWA 1BCPC 1RTOA 1HA6A 4ZYSA 3EUB2 3GO5A 1QB5D 1G2TA 2F3VA 4FXKC 4QF4A 2JA6B 3VA5A 3VR9B 1CI3M 2HTME 1HQRD 1FCLA 3UI2A 3NE5B 1PRTF 3SVMA 2KHSA 2L4NA 4QCLA 4P6VF 5JVH3 3GB1A 1CA6A 1STNA 2LGIA 3MTSA 2BTEA 1SAPA 2QJLA 1K8MA 5C6AA 2WP8J 2K6AA 1N61A 1B1ZA 3M3YB 5C5LA 2Y5CA 4BS9A 4CKCA 3CWIA 2NB0A 3TEXA 2B2TA 4KKSA 2ACZB 2JSOA 1QLBB 1H9SA 3A8JE 3DWQA 3C8YA 2K1BA 2NTSA 4I65A 4RCNA 4OHJA 3OMGA 4FF1A 2A73B 1K50A 5IGGA 1L5PA 1M4VA 4C3IB 1Y1VB 5IOCA 2GRIA 1T5XD 5T1IA 2Q5WD 4JWUC 2NWGA 3Q6SA 4RKBA 2JE6I 2JYOA 4ZRPA 3IFTA 3MFGA 4FF4A 3GTQB 3X3NA 5KYLA 3QG1A 3T16A 5BYSA 2V4DA 1HZ6A 5JPMC 5G3LF 3TZDA 2F0QA 2YEPB 1H9MA 5CV4A 5E4XA 4K5WA 1PRTB 2L52A 3SR1A 3LX0A 2FBWB 3V3XA 1EY6A 1FXAA 3P20A 2X6GA 2N9KA 2BE5C 1GXDC 2JA8B 1D5MC 3NQTA 1CZGA 1LTRD 1UAPA 3AEBB 4PV1C 1YN4A 3MWYW 1B2TA 3P42A 5DAUA 2QMTA 1J9OA 1JOKA 2QEJC 2WXKA 5EJWA 5T8IA 2BB6A 1CHPD 3AEFB 1SYEA 4BA2I 3D31A 3AEEB 3RZDB 1B50A 5M5WB 2K5DA 3AU7A 3G7LA 1Y1WB 1GHKA 2ZXRA 4P16A 3A55A 1G8ZD 4A55A 4C3HB 4BY7B 1C4CA 2MJ8A 3QOJA 4BY1B 2L1BA 5J39A 1EFID 1SE2A 4O1NA 2J4XA 4RHRA 2J7ZA 5I9PA 1EY5A 3DXJC 3EROA 1QQRA 2NZ1D 4L1BA 2E6XA 5E6JA 5JEAJ 1WD1A 1DOLA 1XO3A 4YSZB 4K2LA 5EKLA 3W1SA 4NJCA 4A8XC 2F3WA 3OMCA 3MC0B 2B8GA 4DF7A 2G9DA 1JQYD 2W82A 2WKDA 2BBCA 4V190 5JPNC 3Q8AA 1PDXA 1SJED 2VZKD 5BMIA 5D14A 3S1QB 1S5DD 4EQNA 2ON8A 4Q5VA 2EZVA 5IGDA 4N6EB 3A7LA 4EQPA 1LTAD 1FRDA 2A5HA 3PZ8A 1FGBD 1EL0A 2PVGC 2BS4B 1IHZA 1G6ZA 3D4RA 1Q12A 2KDMA 4XQNA 2INNE 3HOVB 1D5ZC 3NPPA 3I4LA 4HMJA 4KHVA 2A6ED 5BYQA 3W5VB 4FNFA 4C3JB 2M00A 4LMQD 4FXCA 1T6BX 3E56A 4HMIA 2PTLA 3KWLA 4ZAIA 5H92C 5C44B 3D8GA 4OVZA 3U4EG 4DN4M 3QB3A 4B9WA 1KNAA 2W3SA 1TWHB 3C3LA 2LMCB 2JYEA 1SSOA 3I4NB 3IAYA 5C3WA 4L8JA 4DXFA 1IYVA 3EGRA 1B9MA 5EGTA 4CJ2C 1N60A 1YQ4B 3L4PA 1O7ZA 1JW9D 4J3OD 3NTKA 1IW7D 1LTGD 2XSCA 3MVVA 2X6LA 1LT3D 2WINB 4UAIA 3S1MB 4R9WA 4TKOB 1Q1EA 1KTKA 1O80A 2F0OA 4G57A 3AN1A 3DWMA 4RGTA 2WXMA 1D5XC 1XCTL 5ELEA 4RNAA 1FMAD 2WXGA 1PDQA 2TMPA 4IZ8A 5G5GA 3W9CB 1SMYD 4ITKA 1MHHE 4B08A 3WOEA 1S5BD 4N9PA 3FILB 1NI3A 3E9SA 2PQEA 4LAAA 1LO5D 5C4ZA 4MHEA 2F0PA 5FOBB 3C1EA 4ILWA 2WIIB 5JAVA 3CU7A 2EXZA 1STAA 3DWGC 1GAQB 3F2UA 2DWQA 1J7AA 4IFDG 3SK8A 1A70A 3BDLA 5C0XI 1V43A 2ZXPA 4KKJA 4KD3A 2EJFC 1EWHA 4K8IA 2EY6A 3B9JA 5J22A 1ENCA 3C46A 1JWUD 1FYCA 3J7AV 4XQQA 1QJOA 1ZDVA 1AWDA 1QT9A 4PNYA 2XNAC 3HVDA 4C7ZA 2IWHA 2KQ4X 4RF1A 1I3QB 1LTTD 4NMZA 2V3NA 4HN7A 4KJOA 5AUIA 3WOFA 1Y8PB 2ENBA 2J0TD 3VR3A 1QWYA 3ZJTA 3KUPA 1AFPA 4XT1B 1PFMA 1JE4A 4X3SA 4ULLA 1LT5D 3AE6B 2E3TA 4C7YA 2HCIA 5CC4A 1PZKD 5EE3A 3MXNA 2NYZD 1A2TA 4RFBA 2V0GA 5GXGB 3FDTA 3X3MA 3P1HA 4XDXA 4DQOC 2OF1A 2ONQA 3GD7A 5C0XH 2CW0C 1I4XA 1E0BA 1ZOYB 2LUMA 4A3FB 2MHVA 1RFKA 5JXVA 1ET9A 4K6DA 3FKIB 1ET6A 3AB9A 5D7GA 3VRBB 2PMVA 1ZE3D 1DOXA 2RQXA 1V8CA 1VR9A 3PUWA 1HCZA 2A74C 5EKIA 5M3FB 3OIPA 1DM0B 1IL8A 2O5IC 2WXNA 2B39A 1X3QA 1QOBA 2O4XA 3HG9A 3Q8EA 3P4RB 1UEAB 1BR9A 1HTLD 4IALA 1WD0A 2F03A 3MFYA 2PYKA 3S1NB 3MAQA 4IKGA 4C1NK 3AV8A 1AEXA 1IKLA 2GB1A 2KUMA 2RBMA 1YJIA 3AE1B 4QMGA 2F0EA 4YSXB 4ZHOA 1HFNA 2E2JB 5FKAC 4HKZE 1CM9A 2EY2A 2B2WC 3SE0A 1DOMA 5FO9B 3TDQA 4NAMA 1HZ5A 2SOBA 4A3EB 2F0LA 1MSGA 3EJIA 4HJGE 1H9JA 2OT2A 1C8CA 5I2YA 4A93B 1OO9B 2KEDA 2A6EC 2WU5B 2L32A 1PGBA 1RD9D 2F0WA 3BDOA 4XTCS 4CHTB 2F0MA 2LJIA 4HCEA 1Y69U 1PGXA 2DBYA 3BK2A 2QKIC 3TP6A 2B63B 3TN2A 2N9LA 2EVBA 4YWGG 2D9UA 1U4LA 4YTNB 1OXXK 3Q22A 1ZYRD 1DOKA 4CGYB 4PQXA 2LFIA 3DHQA 2KCNA 1KRHA 1YNNC 2AWOA 2WXQA 4S3SA 4ABNA 1IGCA 3JAME 4LK1C 4D2KA 1YNJD 1V8QA 2CVRA 3GTMB 1JMLA 3J81E 1PTOB 4ZUJA 2AQ1B 1VMCA 1FM0D 1BQQT 4WH4A 4TQ0A 2AUJD 4XDDA 1EZ6A 5C3JB 5KNBA 1IW7C 2NVYB 5HHDG 1GUGA 3D6WA 2WXOA 1BOSA 4A6QA 2N7JA 4FF3A 1MGSA 2B2UA 1TS5A 3NHHA 3J80E 3EQLC 5EPKA 3H94A 4HR7B 3CRKC 4IUUA 3PO2B 1CT1D 2R3ZA 3U52E 4KGSA 4YSYB 2J42A 1BMLC 3L3OC 2BDNA 2EYHA 5EQ0A 3TBIB 3GTJB 1JB3A 3DMUA 3IAS1 2JEBI 3GTOB 3KF8A 3PMFA 3K5NA 3T3NA 1ESFA 5IGCA 1SDFA 4KTAA 3VYSA 3NXWA 3K7AB 1YN3A 2BOSA 2F0SA 4BWGB 3NVVA 2Q8TA 2L0CA 1KH0A 1VCIA 1RWSA 1TZOA 2I2YA 2YEPF 3EVQA 3GQBA 5CR3A 1Y56A 4IFDI 2LS01 4USAA 4KGRA 1SFOB 1EWYC 3CQZB 2NVTB 1WTPA 1TWCB 4CJ1B 1SIJA 2A68D 1EEID 1FO4A 1EYDA 1CA5A 3CKIB 4B9XA 1BNZA 5C2TB 2QF7A 3ZYYX 1XWEA 5CORA 1XLQA 3AEAB 1NUCA 2IX3A 2WXIA 1F2ZA 2B2TC 5E1FA 4HEA1 2PIAA 2WQYB 2JEAI 4K8JA 1H9RA 1IBXA 3SHLA 1SYFA 3MHBA 2E74C 3K59A 1HEZE 2JU6X 2PW9A 4FXGC 5CGKA 4WWMA 1TWGB 2FE8A 1JC7A 1SNMA 3HGBA 2MJEA 5C0XG 3HOZB 5KEEA 3VA7A 1TQOA 1HHVA 1V97A 2KA7A 2IGHA 3I70A 3H09A 2WDRB 5KNCA 2H88B 2R6GA 1QOFA 1SF0A 2KEEA 5D3DA 4M1UB 5FK9C 4IFDH 4HRSA 4C3IG 1JR0D 2BDOA 1ZXTA 2MEKA 3PO0A 4JE3B 3PIP3 1PFNA 4A3MB 4I7ZC 1UGJA 3VR4A 3ZQ4A 2IX0A 1GUSA 3U9SA 1XLPA 2K5PA 1IYUA 3QOLA 3ND9A 4DFAA 2WXLA 2B8FA 3CIRB 3C2PA 3ZJUA 3GS2A 1I7HA 4WIPA 2WKCA 4ME5A 3ABVB 2EPBA 3V2TA 1FCCC 5A35A 2EY5A 1S4ZA 4OIJA 4K5VA 4J8QA 4ZQ3A 3RUZA 1CK1A 5I9OA 3HRDD 2XIWA 3I91A 3M7GA 4RAUC 3SR6A 4K14A 2A6HD 2PW5A 3P75A 2WS3B 4LTUA 3NWSA 2ICEC 2VB3X 1QILA 5MPOA 2SDFA 1FXIA 1F0ZA 4OGQC 2ZW1A 1D6EC 1MSHA 2JA7B 4R8IA 1ENFA 1CJEA 3AEGB 2W54A 1E7PB 4HSPA 3SEBA 2LHEA 2JZPA 3KQ4A 1KLGD 5FO7B 1ESRA 1IGDA 3MXPA 4XIGS 1GB4A 1YJJA 4PMWA 4C1NI 2F0IA 3VYUA 2NMQA 3Q8CA 2EY1A 2VZKB 5EE9A 2D62A 2LFNA 4RCOA 4C3HG 4FYDA 2QILA 3SK5A 1PUTA 4YXDB 3I73A 1G291 2N0SB 2F0GA 1E9MA 2BA0A 2K28A 1STBA 2PPBC 4CKBA 2CU3A 1G2SA 3G6JB 2D2CC 2F4IA 1RF2D 1XEEA 2JA5B 4H2AA 4LK0M 3H6MA 1ZYRC 4WAFA 4J1MA 2PCFB 2RA4A 1ML0D 1L0VB 4KY6A 5I6YA 4WORA 1YN5A 2E76C 3AE2B 1U9RA 4RF0A 3IXSA 4IUTA 1YNJC 3NWTA 1WTVA 1VF5C 1TWAB 2FHTA 1UWXA 3NUHB 1N5XA 3MP9A 3HRZC 1ZEQX 4H7BA 2MUYA 4TMAB 5KGUA 2IL8A 1VDZA 1PXUA 4PMBA 3KLRA 2A69D 1B4OA 1MVKA 2F0HA 2H89B 3FEWX 3VRAB 1QOAA 2LKVA 2E2IB 1V1PA 3T56B 4DXGA 3FPPA 5LL6S 4XQJA 1PTOC 3MHZA 3URYA 2FJ2A 3T51B 4CJ0B 5IGFA 2RDFA 4X3KA 1XXGA 2WB1B 5C3EB 3I57A 1F2MA 3LYYA 4C3JG 1JOQA 2YYZA 1Y8OB 4HROA 2WACA 1KFYB 1S5CD 4IDIA 1C4AA 2DNEA 3KWVA 5C4JB 4F8MA 4NKLA 1VZ6A 4KY5A 3OWFA 1WVLA 4A3GB 1NCVA 1CZWA 1F2RC 1XTCD 1BDOA 1XCQL 1C76A 3QIAA 1ZPSA 1F2RI 4TSSA 1FNVA 3AB5A 2PZTA 3HOXB 1B44D 2PZUA 2DYOA 1E10A 2WLBA 2KWDA 4U673 2G1EA 1HRJA 5A2QL 1JRPA 4FP5D 2JX5A 2NN6G 3OIQA 5C4HA 2A68C 1LT4D 1C78A 3A7AB 3BYTB 1DOYA 2PMZB 1NAPA 4RGNA 2AUKA 5BMGA 1E6EB 5EPJA 3C1FA 2L5TA 2R7ZB 1ZXHA 2IGDA 1SE3A 3R2TA 2PW7A 3IL8A 1D2BA 4CQNA 1RCVD 2QSDA 1Z47A 4IUPA 4ZUIA 1EEFD 5F2DA 2J52A 3S2DB 2J53A 5IT9E 4RWSC 1SSNA 1RTNA 2B76B 2X38A 1R4QB 2MGSA 3VR2A 5KRUA 2FMMA 3ERQA 1KAAA 2WNMA 1TT2A 2ID0A 3NK9A 1KF6B 1WYGA 1SEBD 2XN9C 5HFYA 5M5XB 1LT6D 1H9SB 2EDGA 4ZKCB 1I6VC 1BCPD 5FLXE 2HDEA 2KACA 1EZ8A 1HPCA 5JOBA 1PGAA 2WXHA 3TEYA 4XE0A 1WTXA 2K7VA 2IT1A 3SFDB 1HA5A 1TY2A 3ONAB 1XLNA 3FC4A 4OW0A 3R2IA 4K6LA 4G4KA 2B2YA 1AZPA 1KLUD 3DWPA 3HOUB 3S2HB 3E5SA 1EY7A 1SJHD 2O2LD 1BUIC 2JP1A 3H8HA 1A3VA 2KECA 4IN3A 2LEKA 5AUKA 5DM63 2ZW0A 4OZAA 5M9OA 4KK7A 3HZXA 1RYJA 1ZUD2 5IGEA 4NDXA 1L4DB 3K57A 1W6JA 1Q10A 3NBHA 2K0PA 1ICWA 5CYUA 5E3FA 3S1RB 4N58A 2K33A 1VZ8A 4C80A 4V0BA 5H8YE 4BBSB 2A6HC 5M3MB 5JEAH 2B2VA 3S16B 5EBDA 4HTHA 1TIID 2I46A 2BW2A 2JXMB 3VR6A 3N52A 3AECB 3S9WA 1TKWB 1J8IA 1B9RA 3NVZA 5CV6A 1A2UA 1EIHA 3L9AX 2PVOD 1STEA 3V96A 1QCBD 3FVQA 2QIEB 4PT5A 1FEHA 5D3IB 3B2FA 4JK1C 4HKQA 1F9PA 1F9RA 5KIXA 2Y0SB 2EOTA 1EQTA 3Q23A 4DGZA 2JWUA 1JORA 4A9AA 1D1KA 1Z6HA 3D6CA 3ZJVA 2E2DC 2AWNA 2M19A 2C9OA 1STGA 3IT6B 2LY7A 4YIJA 3PZ7A 2EYPA 5TSSA 1QOHA 5EKKA 1ZXIA 2V3PA 1WWTA 4RHSA 3BVZA 4H0LC 1S5ED 3LWEA 3I90A 4NW2A 3AMUA 2JXTA 3PO3B 1PTOF 2WDVB 1NR2A 1JCKB 1MHXA 2AQ2B 3SK4A 3D4WA 4JBWA 3M7NA 1HUNA 4OO1I 1DJRD 2NTTA 1JALA 5K5PA 2M0AA 4LLGM 4ID6A 1SB3C 1GHJA 2BE5D 2HCCA 1OXSC 1TYGB 3U7ZA 5I2XA 3M85A 4KN7C 5DEHA 2N55A 4IQZA 1WCMB 3VYTA 3HP3A 3AE3B 3HEJA 4FVMA 1SE4A 1K8OA 2KQ3A 4G7OC 1EY8A 4DA2A 3ZGZA 4RGOS 3I4MB 4WQMA 1LV9A 4MH8A 1STYA 1LABA 3M4YA 4UDUC 4US8A 3T3OA 2IW3A 3J7YW 4MACA 3KLSA 4ARCA 2A69C 3J81L 1MD2D 3U2SC 2QDBA 2K5QA 3HKZB 2Y5PA 1VF7A 3VYRA 1YQ3B 1TJEA 1QNKA 4H44C 2F0FA 4ZKBB 2B2WA 3GTKB 2VXWA 2PLPA 1CTMA 4O42A 3AM9A 3J80L 4HEDA 1SXTA 1FD7D 5CV5A 2KCCA 4OO1H 3VR8B 2IGGA 1UNSA 1TS2A 5ELBA 1V1PB 3DWAA 5M5YB 1RODA 4QB4A 4ARIA 1TS4A 1NR4A 1DGJA 1FRRA 2FINB 2OXPA 1F2LA 4RGMA 4B0EA 4KHZA 2Q8RE 4L23A 1EY0A 2VB2X 3WCQA 1B9NA 3MZ5A 1Q90A 1FFVA 2HUGA 3RD4A 2RDGA 3NUCA 2OEDA 2MJDA 3HS0C 2B2UC 3LWUA 2Z1CA 3Q69A 3P7JA 1NSNS 1GJXA 5EE1A 4BA1I 2KOLA 1GUWA 3PV0A 3ND8A 1TR5A 1L0YB 1M8AA 4AYBB 1W6KA 2M56B 2F0VA 4HSVA 4K5XA 2RMMA 5EE0A 3TP8A 1I4QA 2WU2B 1WXQA 2BS2B 2JSVX 1KDBA 2K32A 2EJMA 2NN6I 4TQUS 2GA4B 3GV3A 1R7SA 5HG2A 1L6UA 5BN4A