1EU4A

Crystal structure of the superantigen spe-h (zinc bound) from streptococcus pyogenes
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
204
structure length
204
Chain Sequence
NSYNTTNRHNLESLYKHDSNLIEADSIKNSPDIVTSHMLKYSVKDKNLSVFFEKDWISQEFKDKEVDIYALSAQEVCECPGKRYEAFGGITLTNSEKKEIKVPVNVWDKSKQQPPMFITVNKPKVTAQEVDIKVRKLLIKKYDIYNNREQKYSKGTVTLDLNSGKDIVFDLYYFGNGDFNSMLKIYSNNERIDSTQFHVDVSIS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SUPERANTIGEN SPE-H
publication title Conservation and variation in superantigen structure and activity highlighted by the three-dimensional structures of two new superantigens from Streptococcus pyogenes.
pubmed doi rcsb
source organism Streptococcus pyogenes
molecule tags Immune system
total genus 60
structure length 204
sequence length 204
ec nomenclature
pdb deposition date 2000-04-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01123 Stap_Strp_toxin Staphylococcal/Streptococcal toxin, OB-fold domain
A PF02876 Stap_Strp_tox_C Staphylococcal/Streptococcal toxin, beta-grasp domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.110 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1eu4A02
3.10.20.120 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1eu4A01
1EFID 3O13A 4RGNA 1SE2A 1CHQD 1LT4D 3GP7A 1LT6D 1S5ED 1XTCD 3V05A 1JWSD 3BVMA 4NZLB 1LTID 1LTTD 1D5ZC 1PRTB 4RFBA 1ET6A 1JR0D 1JCKB 1LTRD 1SXTA 3DWPA 4UDUC 1PRTC 1TS5A 1DYQA 1BCPD 1RDPD 3TSSA 1PTOC 3URYA 1I4QA 1CHPD 1EEID 3W2DA 3BVZA 1EWCA 1LT5D 1I4HA 5ELDA 1HQRD 1TY2A 2Z8LA 2XNAC 1I4RA 1GOZA 1SJED 2CHBD 1AN8A 1CK1A 4L6TB 1JQYD 1BCPB 3BYTB 3DWQA 1D6EC 4L63B 3MFGA 1EEFD 1EU3A 1LT3D 1BCPC 1I4XA 1G8ZD 1QILA 2J4XA 1PZKD 3R2TA 5I4DA 1TS2A 2IJ0A 1LLRD 1ET9A 1DJRD 4TSSA 1LTGD 2G9HD 4RGTA 2AQ2B 3EFXD 1CQVA 3BVGA 4O1NA 2TSSA 3R8BA 2NTSA 1YN5A 2QILA 2XRQD 1T5XD 1SE4A 1LO5D 2RDGA 3KLSX 1TS4A 1UUPA 1S5DD 1FNVA 5TSSA 1PRTF 1PZJD 1F77A 1SJHD 1LTAD 1LTBD 5D3IB 1PTOF 2SEBD 4OHJA 1PTOH 1PYWD 1L0YB 1FNUA 1L0XB 3EA6A 4RCOA 1V1PB 1RD9D 1PZID 1SE3A 5ELEA 1HXYD 1RF2D 1S5CD 1S5BD 2O2LD 3DWAA 4K6LA 5ELCA 3R2IA 4C56C 5ELBA 2AQ3B 1YN3A 1CT1D 4RHRA 4Z9CB 1KTKA 1JWMD 4ZYSA 1HTLD 1I4PA 1RCVD 4RGOS 1ESFA 3OWEB 1KLGD 1JWUD 1V1OA 1PTOD 1EU4A 3BZDB 2XN9C 2IPKD 4DXGA 1YN4A 1HA5A 2NTTA 3BYYB 1MD2D 1FGBD 1SEBD 3MC0B 1AW7A 1TS3A 3SEBA 5FK9C 5FKAC 2XRSD 1D5XC 1B1ZA 4DXFA 1V1PA 1BXTA 1PTOB 5ELFA 1KLUD 1LTSD 3CHBD 4BWGB 1B44D 1TY0A 1UNSA 1FNWA 2AQ1B 2R61A 2QEJC 4RH6A 2RDHA 4RHSA 2ICIA 1I4GA 4RGMA 1S5FD 1STEA 1ENFA 1PRTD 1SBBB 1FD7D 1BCPF 5D3DA 1M4VA 1XXGA 1D5MC 2WV6D
chains in the Genus database with same CATH superfamily
2K75A 1ZKHA 2EJMA 1CHQD 2N3SA 3GP7A 1S5ED 4R8IA 2PMZE 5KEEA 1O7IA 1FFUA 1L6UA 1B3AA 1TWAB 2IY5B 1T0QC 4DBGA 2J0MA 3G48A 4HKZE 2K33A 3SFDB 5IGFA 3KOJA 3U58A 2KOXA 1JR0D 3F8TA 1J9OA 1E9MA 1BUIC 1VQHA 2K52A 5AZGA 5CYUA 1RLFA 3J81i 2WFWA 5C0XJ 1K0RA 2JSVX 3T56B 2NVXH 1Y1VH 1WJNA 2Y5BB 2E74C 1FFVA 1FIQA 3P4PB 1V97A 2KA7A 3D4DA 3MXNB 2F4VQ 2DWQA 3BJUA 4LF5L 1C77A 5J3BA 3BYTB 4L63B 4PT5A 3SFEB 2RSOA 5E3FA 1ICFB 2NYZD 4II3B 4QGUA 1BVSA 4FYDA 3R2TA 1W6JA 2R7FA 4ZAIA 3A33B 5GMVA 3EECA 1HNZQ 1ONLA 3DCGA 5IYDH 4LW1A 4TKNA 1LTGD 4NXMQ 2XSCA 3VYRA 1OO9B 3DPDA 1EYDA 3V2TA 3HEJA 4KD4A 5IYBG 2L0CA 3E9IA 4GIVA 4NJCA 3TL5A 4HIDA 4WJQA 4BOSC 1E5WA 1EY5A 4JBMA 1WTPA 1Z2MA 1HZ6A 4WJ3M 4AJYB 3Q3NC 4BXXH 4EKUA 4XYCA 2ZTDA 1S5DD 5FLXL 1SJHD 4HJ9A 3MC8A 2B2UC 4IC7B 3D4RA 2I5MX 3NSWA 2MX2A 2VRRB 3U9OA 3DBSA 2N9KA 3KVFB 4JI2Q 2A74C 5C44H 2KTRB 1XTDA 1KIXA 5ELEA 1WRIA 4F8CB 2ATWA 2WINB 4J15A 1YNNC 5JHBA 1WTVA 2EMSA 5C1ZA 2K39A 4A20A 1ISNA 2CCZA 1HZ5A 3R66C 1UD7A 5FO8B 5IGDA 1K51A 2L8JA 2BH8A 1QF6A 4A3MB 2MGSA 2WKCA 3UIPB 4DV4Q 4LDTD 1A2UA 4DR6Q 1F9RA 3NBHB 4MSQB 5C0XH 3OTOQ 1JJ2A 1SYFA 4AQYQ 2FCQA 2O4XA 5LMUQ 4NP5A 1H9SB 2QC8A 3EFUA 3LYYA 3NY5A 1YZ6A 1QUQA 2PJHA 5KGUA 3D32A 3RZWC 1EQTA 1WJ6A 2JWZA 2E2IH 2GOWA 4KZCA 1HZAA 4YY3L 3HOXG 4JI4L 1MHXA 3S17H 1N63A 5EBDA 5GAGC 1IBLQ 3E0JA 1PGXA 4LF4L 4GB9A 1MSHA 2NVQB 1KNEA 2OQ0A 3RNEC 3I4OA 1Y8OB 3I57A 3VHTC 2JF5A 4RGMA 2WWZA 2DY8A 1C4CA 2GA4B 2K03A 4YCUA 4ZRKA 5JHAA 1K83B 5HGQA 1XX8A 1I6HB 2UU7A 2D3BA 3NPPA 3H7SA 2BS3B 3CW2C 3O13A 1YJ9A 2F0IA 4KX6B 2MP2A 1SE2A 2O5JC 2KDEB 2EYJA 2NN6I 2KC2A 3V05A 2LKVA 2JE6I 3BG3A 4NAWA 2KACA 1LTTD 2WXMA 2F0LA 1TWCB 2TMPA 4IPCA 4A6QA 3BDLA 1SAPA 3GTQH 4UDUC 3W3AA 2KFKA 2WAQE 1SSNA 1VQ7A 5IP9G 1JT8A 3EBEA 2KYWA 3DBHI 3W2DA 3T8MA 2X38A 4ZKCB 5IYBH 2EZVA 3M7NA 3NOBA 3E9HA 4A3GG 2X6GA 2KHJA 4DHJB 2Z4IA 4EGVA 5C4ZA 5LMNL 4A3DG 3DVNV 2BYVE 5I2YA 1YEZA 2G9DA 1WX8A 1XLQA 1P16A 3AE1B 4JIOU 1Q81C 1EUVB 1PYBA 3K0YA 1TIFA 1VRAB 2QKIC 2KEDA 1FO4A 2H4OA 1XPRA 2B76B 3HOZG 1GD7A 1ML0D 1FYCA 3FKIH 5DEHA 1F2RI 4IWOA 1GUSA 1E1OA 2VH2A 2N1WA 3CSFA 1WTHA 1CMXB 4JI8L 2D11A 1WR1A 5J22A 4QF4A 3J9CA 1Y1WH 1K50A 1EF1A 3HKZB 1DJRD 4K3CA 2VY3A 3PLUA 4DK5A 3P7JA 2J0KA 1IGDA 5LXIB 4FXCA 4MZ9A 3VYSA 3W1YA 3TEYA 4X66L 1J8IA 5JPNC 3OIPA 4N6EB 3A0JA 3ULLA 1SE4A 3MAQA 1HNWL 1KAWA 2HIXA 4L1BA 1P8LA 3H94A 4FDBA 2XK5A 3DHGC 4LF6Q 2HJ1A 1WCMB 3AE4B 4JGHB 1PFMA 2K7VA 2D3GA 2L0TA 3FILB 4IPGA 5C5MA 2HHHQ 1Q1BA 1IKLA 1FNUA 2YTYA 3KF8B 4RG1A 3X3NA 2LASA 1STNA 4ACFA 4WQMA 1RL2A 3KYDD 1YMHE 2EYFA 1WTWA 1VCIA 2DNFA 2L0FA 1YN3A 3VR8B 1GPXA 1R4PB 3SU8X 1WGYA 3Q23A 2F3IA 4J8QA 1JWUD 3NTHA 1WTOA 3RZOH 5IY0A 2K32A 1CZPA 4MM3B 1OXXK 1N62A 5G3LF 4EQ5A 2CH4W 2IO3B 3HKSA 3MXPA 2D10A 2MEKA 3PUYA 4GDKA 4B9WA 2BS4B 4ME3A 3PHXB 2JA8H 1FCLA 4BBSG 3IL8A 2L12A 3SR1A 3HOVB 2N9LA 2CH4A 1NMFA 3HM6X 3T13A 1PTOB 1U9RA 3GTLH 1LTSD 4OO1G 2QCZA 2W82A 1DGSA 3CHBD 2AQ1B 1FNWA 4A3BG 3DBRB 5C3JB 4A75A 4TQ0A 3E6ZX 2WB1B 3OIQA 4KHVA 2DX5B 3KK7A 5IP9H 3MJWA 2FCMA 4ME5A 4H7BA 4WJ4A 4TV3A 4OX9Q 4MEMA 2DZKA 2ZXOA 1K8MA 3HOYG 4A3GH 4A3OA 4AOFA 2Z1CA 4DV6L 2A69C 2B3GA 2X6LA 4A3DH 4IFDI 2ZCCA 4ICUA 5EE0A 2Y0SE 1WE6A 1AE3A 2NPTA 1G2TA 4A93G 1QVCA 2JA5B 3K58A 3Q0AA 2K22A 1MFWA 3QOJA 4CQNA 2INCC 1E8YA 4KVGB 1LXDA 1E7VA 2JXXA 1EY6A 3HOZH 1VS0A 1LTID 2E2HH 1JRUA 2I5LX 3TS0A 1V1QA 2OCEA 4WURA 4OGQC 3Q6BA 3DWPA 2R7ZB 3MP9A 4GDLA 1TS5A 5HKHA 3IFWB 3PO3G 3J80i 4LF9L 2DNCA 2F0SA 5KYLA 2BWFA 4DR1Q 3SHQA 1LT5D 3MTNB 3CU7A 3AEGB 1KDBA 4MHEA 4NB3A 2PW9A 1I4RA 1VDZA 4BBRG 5CV6A 2A68C 1C4AA 1WJUA 2R7DA 4KKTA 1JQYD 4PZ8A 3ND8A 2IT1A 3W1BA 3WALA 5BO4B 4JI0Q 5D7GA 4J6HA 1JE5A 4EOYA 1NR4A 4KI0A 1LGRA 3TBIB 1U4MA 2F0DA 3D6CA 4A3IH 2FMMA 4QJFA 4RCNA 2FCNA 1O78A 2KHWB 1WRDB 4NW2A 2WACA 1HTOA 3DHIC 2R6GA 2RF4A 1HPCA 5E6PA 3OOCA 3IXSA 5JPMC 5M3FG 4DR7L 3P2BA 1BBWA 4PYUA 2DY7A 4CKBA 3A9KA 3DVGX 2Q2UA 1HH2P 4IO9A 4ZK9B 4AYBG 2F0GA 1V9PA 2F0NA 3ITPA 4ALPA 2UXBL 2DENB 4FJZA 4KIKB 4HSVA 4C1NI 4CDEC 2J0JA 4A3FG 1VQMA 4CBVA 4JPBW 1TWAH 3WIMA 1FNVA 5T1IA 1TT2A 5EQ0A 1W3SA 4DV2Q 3M4OH 1LTBD 2KCTA 2KO3A 3Q3JA 2K5DA 3MEHA 3VRBB 4G3XB 4KSLC 3VA5A 4DV5L 4B0EA 5JAVA 3W1SA 4BBSH 2M2LA 4LWCA 2QSDA 4OO1H 2QIEB 3L10B 3DWAA 1PH1A 2L55A 4K6LA 2KENA 2WNMA 5C4XB 3DDCB 2GLSA 1CT1D 2B2TA 3S15B 4K7SA 3HVZA 3R7RA 3VR9B 3F2BA 1LYLA 3I8ZA 1Q12A 4KJOA 3PIOA 1HNXQ 5L83A 3NWTA 2N0SB 2HD5B 3UQBA 3CCLA 1ZUD2 4NXNQ 2D3AA 2BDOA 2WXGA 5E6OA 3ICEA 2AMCB 2NBUA 3DWMA 5BYRA 1WX7A 2NVTB 3TRZA 2LGXA 2UUAQ 2ZEQA 2B2YC 2LVQA 2Z6BA 3N3KB 1OQQA 3MC0B 2K5NA 2WXJA 1C1YB 3JVZX 2GI9A 3F2CA 4WWMA 1HE8A 3N9YC 1GUTA 4PZ6A 3IFTA 2DUDA 2I46A 2XRSD 5FKAC 5BR8Q 2Y5CA 4KV2A 4OEMB 1NDDA 1MSGA 4GLXA 2Y5PA 3KUCB 1NR2A 5E6NA 1A62A 3GTGH 3I2ZA 2N9PC 4DK1A 4QAYA 1V8QA 3PO3H 5AJ3Q 4XQJA 3S2HB 3V96A 3T51B 2OEOA 4CHKA 2FAZA 3QARA 1V5TA 1II3A 1WFQA 1VR9A 4YCVA 3L13A 3NP8A 5IT9E 2IHFA 5IGGA 4GKJQ 1CZWA 1S3OA 2GN5A 1M4VA 3J7ZC 1TWFB 3H7PB 1HUMA 2KAJA 4RF1A 1L4ZB 2MFIA 4BBRH 4BVUC 1TIID 5FR6A 3VR4A 2K28A 2Q8RE 1UE6A 2F0VA 3CCSA 2B3AA 4UPAA 3DBLB 4DDGD 4UP7A 5EJWA 1WF9A 4ANXA 3ZJTA 2I07B 4ZCKA 4WAAA 1HZ9A 4AH6A 3FKYA 1J8CA 1YQBA 1WGHA 3CCMA 5GQOA 4B08A 3C3LA 4MDKE 3OW7A 2KVRA 5EPKA 3EQLC 2F4IA 2CQAA 3HFZB 3J81c 4FN2A 2KLCA 3DVNU 2K1FA 3L4PA 5CGKA 2CS4A 2EYOA 5G2NA 1WYWB 2E5LQ 2Z6KA 4BY1G 4X62L 2CKHB 3IVFA 2GBKA 3H0GB 4K2LA 2D0PA 3EHVA 1GJXA 3S1NB 4ANWA 5JVG3 4YSXB 4A90A 3AI5A 4LNFA 4A8XC 1EY9A 3GZNI 1PMRA 1SYCA 1XCQL 1KM7A 5DPWA 2DHZA 2B2VA 3ZDTA 3IT4B 1K83H 4LFCQ 1A63A 2N9XA 2PMZB 4Y7NH 4B3TQ 2GRIA 1PH4A 3SGIA 2B8GA 4OVVA 2F0JA 4QMGA 4LFBQ 2XRQD 3UF8A 2BOSA 2X69A 3VUWA 1B7YB 3S2DB 3NVWA 4NAMA 5IYCH 2WU2B 5DNFA 1S72A 3GV6A 4L2YA 2RGFA 5IP4D 2Q8TA 2KN4A 2B8FA 4ODGA 3VQIA 5HGTA 3JAML 4LF7L 2WQYB 1AEXA 4FJYA 4KKIA 1L0XB 3PMFA 3G71A 3NS1A 3MA2B 2UXDL 2UYZB 4EUTA 3R2IA 4CDDC 2I38A 3I4NG 1YBYA 4HSPA 4Z9CB 3VH4B 3ZTCA 5EKKA 1ACCA 2KWVB 2JA6B 1OQRA 1JB3A 3K9OB 4PS3A 1KLGD 1IBKQ 2L05A 1PTOD 2KCNA 1FXIA 2MNAA 2IDYA 1R4MB 1YHQA 1OTCA 5C0XI 1M90C 4HIOA 2NTTA 5TR5A 2V0GA 5IA7A 4PMCA 2JRHA 3NVYA 2KMCA 1J5EL 3ZNID 2KWCA 2L1AA 3B0AA 4LK1C 3H15A 2ZVOA 3AU4A 4BFRA 4F1SA 1QUQB 2F0OA 4KD3A 3S1MB 2DZIA 3BINA 4HDOA 4HWIB 2L7RA 3A8IE 1VQ5A 1TY0A 5HURA 4GNXC 1DOXA 1CQFA 2J53A 3T4AC 3L16A 4UAIA 2BBCA 1EYCA 1MGSA 1NYQA 2BW2A 3LNNA 1MG4A 2BKRB 5GXGB 5GROA 4HCSA 1F0ZA 1RKNA 3SK6A 4DKAC 3D0FA 2XBBC 2J7ZA 1FEHA 5LXHA 4B9KA 2L76A 1WCMH 5C3EB 2NZHA 2VQFQ 4HCPB 3A56A 1L0WA 3RMHA 1FJGL 4X6AH 4IM0A 2I2YA 2F0PA 1K8GA 1EFID 4URKA 4IUQA 5J18A 1YNXA 4NQLB 1E3PA 2VXWA 1C8CA 2ZW0A 1BOSA 1WXQA 3P1HA 2MP2B 3TZDA 1BO0A 1EO6A 5E7NA 2G4SA 2M1MA 3ZO5B 2BGFA 3CWIA 4NAWB 5GADC 1HEZE 4M8NA 2AWNA 2D5GA 1B53A 1N32L 3ZIMA 4UP9A 1JMCA 2JY6A 4EZLA 3A9JA 2RPQA 1RTNA 2PI2A 1HJPA 3N52A 4IURA 3T1HL 2KFKB 2E6XA 2EXDA 4WWPA 3MWYW 2B2UA 3NZSA 4MJSA 3GOEA 3QHTA 4DQOC 1YIJA 2Z8LA 4I7AA 2WXOA 4ULLA 1Q0WB 4C7YA 3N20C 3I3TB 1AN8A 3U50C 4DR4Q 1PFDA 3MC9A 1BCPB 3SK8A 1GUWA 5AUIA 3J81L 4DAYA 1JMLA 2G5DA 1Y8RC 3BU2A 3HS0C 1QNUA 5EE1A 2VUMB 1E8WA 3NWSA 3IFDA 2K8BA 2BKFA 2NVYH 4B3RL 3CD6A 4WJWA 3PSIA 2LFNA 1WMHA 2KUMA 2UUCQ 4GKKQ 5IN7A 3ZYYX 2FBWB 1LACA 3LWUA 5C4JB 1KHIA 2G9HD 3I4NH 4DFAA 3GE3C 1SNMA 1QG7A 4HCEA 1N61A 2JQOA 5DLQE 2FUHB 5K5PA 1TVXA 1EY0A 3HG9A 1PH6A 4A76A 3AE7B 5CHWA 1TYGB 1HR0L 1ZOYB 1SYDA 5F2DA 1T6BX 2R93G 2PKOA 3I56A 4HPLB 4B0MA 2WAQB 1P1AA 5CV9A 2IHEA 1PH5A 3J7AV 4JOIA 3I90A 4C3JB 3ULPA 2MLBA 2XK5B 2HUGA 2F3VA 5J2RA 4YWKA 1PDQA 4A4IA 4LFAL 4BA2I 4TVAB 1UZXB 4BKSD 4W9FA 3VFKA 5IWAQ 3QX1A 2CWAA 4KHZA 1C0AA 5ELBA 1XNRQ 2RKSA 2N8NA 4B3SQ 4AWJA 2R92B 1JWMD 1NBWA 3T16A 1Q10A 4KDLB 3OWEB 3IRBA 1OEYA 4ZUJA 1Y1VG 3KF6A 2WXRA 4KIKA 1CKMA 1KRSA 3QIJA 2BWES 3UDIA 4ZDVA 5IP7H 1CI3M 1Y56A 1VCBA 5M5YB 1K8OA 3BYYB 4MGIE 1XPUA 1HQMC 2F0MA 1R4NI 4IOAA 4C3IG 4MH0E 1PVOA 1QJOA 4RM9A 4K0KL 1WGRA 4GDKB 1TT5B 5ELFA 3SR6A 3UE0A 4IWPA 3AEAB 1SYEA 3PGZA 5FLXE 4DPGA 1NCVA 5KNDA 2QEJC 5IYDG 1E7UA 4QQBX 2HDMA 2UXCL 1UWXA 3GE8C 2ZM6L 4B9XA 1I94L 5MPOA 1T0SC 2OT2A 4JQWC 4HIMA 2WX0A 3TEHB 2C9OA 2YU9B 1VZ6A 4HMJA 1D4BA 3ZJUA 4XYOA 1SFOB 3H91A 4I7ZC 2NPTB 1YQ4B 3CIRB 1WD0A 5FJ8G 4JWUC 3V62A 3HHMA 5CMDA 2K9XA 1JJCB 4R4OA 5C4XH 1F2LA 4OZBA 1BT0A 5EE9A 3E9SA 1V49A 2LJIA 2WP9B 2JA9A 2YYZA 2OQKA 3RMKC 3URYA 4ZUIA 1N34Q 3FPPA 4RM8A 5M3MB 3K5OA 3ZJYC 2LMCA 2N9EB 4GOCA 2WXHA 2Z4HA 3OHXC 2NVTH 4ZRIA 2E2JH 3J80c 1STHA 1SN8A 1K8AC 3PO0A 2H88B 4FF1A 2WDTB 5BMHA 1SGHA 1C4PA 2EPBA 2CHBD 2ES2A 3Q14C 1BUVT 4QL5A 2R93H 1N9WA 5AFWA 1YITA 2SAKA 1RHPA 4P72A 4JBKA 3SVMA 1VQKA 2QJLA 3NXWA 1LM0A 3OLMD 4C4VA 5C3WA 2LEKA 3KW5B 3D3RA 5M5WH 2AUJD 2Y0SB 5IKCM 2DNEA 1WI5A 3NTKA 3OMGA 4PZ7A 1STAA 1BMLC 3GO5A 1WTQA 2N55A 3BVGA 1TTNA 3NK9A 2AHOB 1TXYA 4X3UA 5CORA 2MW5A 5IOIA 1H8CA 4DK0A 2KJRA 3A9KB 2UU9L 2ZTCA 3RUIB 2WIIB 2LFIA 3KLSX 2JA7B 1TS4A 3K9PB 2KZRA 4MELA 3L0OA 1L5PA 1EYGA 5TSSA 4DV3Q 2CWPA 1HNZL 2EKIA 1I50B 2JT4B 1OGWA 1AARA 3QG1A 5H1SE 2XIWA 1YHBA 4C3IH 5CBAE 1AH9A 1VF7A 1GG3A 3EA6A 2JYEA 5CV7A 3CF5A 4MTNA 4OO1I 3K5NA 3B9JA 3KWVA 1CKNA 4IG7B 4XTCS 1EY8A 2VQEL 3Q24A 3PGEA 3W9CB 2AQ3B 1F9SA 2JJQA 2MJ8A 4RHRA 1ZYRD 4EQOA 1XCTL 4YWLA 5IAAC 1JALA 2KQ7A 1FR3A 1XMQQ 1V2YA 3EIVA 3NVZA 2Z9HA 4QUCA 2D3CA 3QJZA 2RPVA 1VDVA 2ZNVB 5A35A 2C7NB 4W9DA 4XE0A 2K04A 3S2AA 1BNZA 1GUGA 3DXJC 1TU2B 4JI2L 5FLMG 2WXLA 4CHTB 2IO2B 4DXGA 3H0GH 3QWZB 2MJEA 3PO2B 5M5XB 1SEBD 1NENB 1FVIA 1JOKA 1SDFA 1UAPA 5FJ8H 4EQNA 1AW7A 4JV5Q 3DQVA 1UBQA 3AV8A 3ALBA 3FKIG 5LMNW 2BVCA 1G6JA 3NELA 4CJ0B 1QVGA 1FMAD 5C23A 3QO2A 4LF5Q 1GVPA 1WYDA 3DM3A 1TKWB 2B2WC 2AYOB 3WANA 1Y1WG 2ZJPA 4DR6L 3J81j 2SNSA 3E56A 4A3KG 2RDFA 5BN5A 2QCPX 4AQYL 4J1MA 5LMUL 3ETRA 3L17A 4OVUA 4KKUA 5H92C 4HR7B 5CR3A 3S2DH 3GD7A 2SOBA 2A73B 4EZKA 1C78A 3CP0A 2I0QA 4BY7G 3AEEB 3HK0A 1SNQA 2HE7A 1VQCA 5GAHC 1IBLL 2EQSA 2M9VA 1LT6D 2ZT9C 2BH2A 5EKIA 3DHQA 2ZJDA 1KDCA 5JXVA 3TDQA 1VD2A 2IX1A 3L3OC 1XYIA 2HD3A 4JWSC 1V8CA 2L00B 3CMMB 3KDFA 2JA6H 1X3QA 5DAUA 2M19A 3N1XC 4OXPA 3L08A 2MCNB 1BCPD 1G6PA 3PVLA 5T1GA 3BVZA 2PNRC 4A3JB 3B1LX 3APDA 4LF8Q 4IM3A 2MWSB 4QIWE 5CX3A 3GTKB 4FO2A 1XNQL 1UE7A 2PZTA 4G50A 4MGZE 3ERSX 1JB7A 4NDXA 2XEWA 4NQKE 1C48A 4ANUA 2MRPA 3C19A 4Y52H 5KNBA 4KGSA 4M00A 3MFGA 4A3FB 4M1UB 3CPFA 1IL8A 4O42A 1I4XA 1GHJA 2JA8G 1XD3B 2MHJA 1RJTA 5HI1A 3ZW3A 1L1OA 3TP6A 4DGZA 2XGTA 1YOVB 4FBJB 4TSSA 4FHKA 3HUIA 1DGJA 2AX5A 2L9HA 4JI4Q 3GTOH 2I5HA 1FXTB 4OWTB 3AM9A 1CQVA 2KVMA 4IUPA 5I2XA 2EY1A 1EIHA 4MGYE 3DBHB 2NMQA 3P63A 4ITKA 3QWNA 3KJOA 4L5RC 3PPAA 4FJVB 4LF4Q 1EZ6A 3F2UA 4II2B 3U52E 5FLMH 1VQIA 1D2BA 1J19A 3ONAB 4IJHA 1WXAA 3QJYA 1PLFA 2KD0A 4K7WA 1IP9A 4N8FA 4L5SA 1Q90A 1PTOF 1IBML 3MZ5A 1QE6A 5LNK1 4ID6A 1EIFA 2F0EA 1YVCA 4HPMB 4GOPA 3R93A 4OIJA 2D2QA 2PTLA 4RCOA 3I72A 1RD9D 3NEMA 4WJPA 1RF2D 3A1QA 5C3XA 2FUG1 3HOUB 1NI3A 2G3QB 4LF6L 4A3KH 4JL9A 1VMPA 2KXJA 4XX5A 5G5HA 1IL2A 2HHHL 4KMUC 4KHPQ 2AL6A 3PREA 1KL9A 2EYMA 4XC2A 1STGA 4C2MH 1XMOQ 2MA9B 4BY7H 1C4QA 5KIXA 4APVA 2AKWB 4P6VF 4LAAA 1TKEA 1C9FA 5LMNQ 2LRUA 1SSOA 3G7LA 2OJWA 3RUZA 2DJFC 4K7UA 1Q7YC 3QCAA 3PIP3 1IYJB 1L0VB 4NJ6A 5C4JH 3CCUA 3BK1A 3QC8B 4A3IG 4NNJB 4HAEA 2J0TD 2R61A 4BOZB 1UNSA 4DR2Q 2EELA 4KLKA 1Z5SB 4LMQD 4P1CC 3ML8A 2JU6X 5EKLA 4J6IA 2D62A 5DM63 1JRPA 2KDBA 2MBHA 1JOQA 1GAQB 2Q2TA 1QNKA 2BCOA 3RZDH 3LDZE 3CSTA 4YSYB 2GVBA 3DUZA 3K7AB 2B29A 1ILPA 1O7ZA 2BA0A 1SYBA 4XT1B 5EBCA 2KTFA 3PLVA 4KZ0A 3OJ4B 3STBD 1R9TB 4JI5Q 5JZEB 3ZXRA 1UE5A 1WM3A 3AU5A 2LGIA 4P2CB 4OX9L 1HFNA 3HZXA 4US9A 1D5ZC 4JI7L 1EWYC 1GJZA 3CRKC 3MXGA 2KKCA 2N7JA 2A19A 4E6IA 3PZ8A 1EWIA 1CHPD 4IUMB 1UEAB 1QKZA 3NZUA 4E74A 1QOBA 1EWCA 3A9JB 4MNOA 4NKLA 3MHBA 1XO3A 3P75A 4P73A 3PF5A 4QCLA 3S24A 1I3QH 1HQRD 1TY2A 1ZE3D 3V61A 3GTJH 2WHIA 1V5OA 2MJ3A 4MJSB 3R7QA 4BAXA 3L2PA 4MTKA 1FRRA 4XDDA 2EE1A 3J7AF 1V81A 3I3CA 3DWQA 2J52A 1I35A 3E5SA 2NB0A 3UGBB 2XWBB 3KLRA 4G4KA 2BT6A 4JX1C 2KNBA 4I65A 1WXMA 3APFA 3BDCA 3D6WA 4DAYB 3HOWB 3AH7A 3Q8FA 1Q82C 3GQBA 2NBFA 3I73A 1ROEA 2O6VA 4XZ4A 1WYGA 1EY4A 3FEWX 3HRZC 1KH0A 1WMHB 3DVGY 2KWUB 1WVLA 4DUYL 1Y69U 1ZW7A 1DM0B 1MBYA 3DM1A 4O1NA 4FF3A 5J17A 1UF0A 2MO1A 2TSSA 3R8BA 3RN5A 2IO1B 2NS5A 1IW7D 2KDFB 1DOKA 3I91A 3K5MA 1LO5D 1Y8NB 3M7GA 4XWTA 3AE9B 1X55A 1Z9FA 4XDXA 4ZKBB 1QOAA 1TWGH 3KBGA 1YHAA 4A3CG 1RFKA 1GC6A 1VZ7A 1JOOA 3PUWA 5LL6X 2SEBD 1QOGA 4DV1Q 3AXCA 4A3EB 4NPNA 3VVWB 2INNE 1MPEA 3Q69A 3S1RB 2B63B 1XLPA 4H2AA 3ZUNA 3LXFA 3EUB2 2O2VA 5M3MH 3Q8BA 4HROA 5K36G 1S5CD 3D31A 1JICA 3TQYA 5DCNA 5BN4A 4IUTA 3WA0A 4MIUA 5ELNA 4DK6C 3A5UA 4A3MG 3O65B 4DV2L 4WJOA 1VQPA 4K14A 1WGGA 2KANA 4JK1C 2MBBB 1XPOA 2A1AA 1LFDA 1OQYA 4YHHL 3S1QH 2W3SA 3B2FA 3CXCA 3KF6B 4TKOB 4ABNA 1YI2A 1U4AA 2BS2B 5BYSA 1PHJA 2IPKD 2NBVB 4DUZL 4DXAB 5FR3A 1R4QB 5HFYA 2FE8A 3TN2A 1Z47A 3HRDD 4JW0A 1MI0A 3CC4A 1WE7A 2CHZA 4Q2JA 1E24A 1HNXL 5FK9C 1ZYRC 1A3VA 2AWOA 4UP8A 4DXFA 4GLVB 1E1TA 4NXNL 1NE3A 3RR5A 4X64Q 1G291 2FIDA 4BZAA 1E90A 2WXNA 1ZDVA 4WH4A 1YNJD 1MIUA 3JAME 1RODA 2Q2IA 1CJEA 2OJRA 2VW9A 3DLLA 2K50A 2JA7H 2PW7A 4C7ZA 1STEA 3M3YB 4C3HB 2W55A 2FXQA 3PRZA 4TQUS 3A5ZB 2WDVB 2LUMA 4FP5D 1SMYD 4A3LH 4DR7Q 2PPHA 3SK5A 5IYCG 1F2YA 1QWYA 4L5QA 4DK3C 1XTCD 4DR5L 2UXBQ 2PQAA 3D4WA 1CA5A 4DR3L 5CV4A 1PQSA 2V4IB 1WZ3A 2X8XX 3BIID 4F7ZA 1PFNA 3EC8A 2BB5A 4HLEA 1NSNS 4W9IA 4GKJL 4AYBE 1TWHB 4P71A 4FF4A 4X3KA 4DV5Q 3S9WA 1KRHA 2JZ3B 2A6HD 1X54A 1XQQA 1LABA 1L6VA 1L7YA 5COYA 3OG5A 2LMCB 1OXSC 2ZXRA 3SHLA 3SDLC 5M5XH 3ZRFA 3C1EA 4L6TB 1UEBA 2ENBA 2MJDA 2IY0B 2KN5A 4JYAL 1D6EC 4A3CH 2ZVNA 1UGJA 3EGRA 4MACA 4FLHA 5JJIA 4GXBA 1BCPC 2KLGA 3R3MA 1CZGA 1SNPA 2JUOA 2LVOA 3I4MB 1PZKD 4POGA 3VR6A 1SMXA 2EKEC 4C4VB 1IBXA 2HCIA 5K36H 2KMMA 5A2QL 5E4WC 3UINB 4N8X1 4A3MH 4CJ1B 1DXMA 4DA2A 2E5LL 3C0RB 3ML9A 3N6RA 4WJNA 2G45B 2V4DA 4IOIE 2FMCA 1PXUA 3KLWA 1T5XD 1PUTA 1WCMG 3QA8A 2RDGA 1X1MA 3QAQA 4W9LA 1UUPA 3T1YL 1SNOA 2PZWA 3E3XA 1VQOA 2C60A 3DEPA 4KSKC 5KHOA 3ERQA 4M8AA 1KJTA 5BYQA 1L0YB 3Q8EA 1XF5L 1KF6B 4LFCL 3U4ZA 4JPSA 2HCCA 2F3WA 1SE3A 1NTGA 5FO7B 2NVQH 1S5BD 3NENA 1W2BA 4A3JH 1VMCA 2K5PA 3J81E 2NVUI 3AB5A 1CKNB 5LHY1 3GTKH 4GMVA 3TJPA 3GZNB 3H1UA 1WX9A 3M63B 3RN2A 3N1ZC 3PS6A 3ZVVA 1I6HH 4I6PA 4QB4A 1Q1OA 4BA1I 3U30A 3ZNZB 4ARCA 5G55A 4K6DA 5KHQA 1L4DB 1ZKOA 2MBEA 4LUZA 1Y8PB 5ISRA 4KGRA 3DHHC 3AE6B 5KRUA 1TS3A 5IE8A 1TWCH 2IGGA 3NRZA 3JC66 1D5XC 2L5TA 3M4YA 2H5XA 2J7QB 4R3DA 2WB1G 2HT1A 1B44D 4C80A 3SE0A 2RA4A 2MPMA 4BKGA 4JI1Q 2Q8IB 5C44B 4WIPA 3QOLA 4PMWA 2EIFA 5GAEC 5G5GA 3CAMA 4G57A 1OTRB 1A5RA 4LJZC 3PCOB 5CV5A 2F52A 3BWUD 1Q8KA 3U4EG 1E22A 5DPTA 2N49A 4WORA 3UDFA 1FD7D 1BCPF 2NWGA 2JA5G 1P9DU 2JEAI 3VTVA 3A7LA 5I9OA 4CKCA 1EOTA 1NYRA 3KYHC 1VQ6A 1VQNA 1XEEA 2EDGA 3PF4A 2DZMA 4OELB 3I9V1 2C35B 2IL8A 1HCZA 1K53A 2MQHA 1PH8A 2PIAA 4LK0M 1HUNA 4PYZA 5IO9A 1T5EA 3Q3OC 3S16B 3GB1A 2W3RA 3BVMA 1P7FA 2R7ZG 3S14B 5KNCA 1MI2A 2KQSA 3K57A 2WXKA 1ET6A 2ZW1A 3RLOA 1SXTA 3KYCD 2LGSA 3GDEA 1DYQA 4LF7Q 1FL0A 2JX5A 1GHKA 3FAHA 1QB5D 1I4QA 3KDFB 3C2PA 3JSVA 1U0LA 4G0NB 3A7AB 2ZXPA 1WGDA 3U7DA 3WAPA 1YNND 3STBC 2IYDB 4K81A 1VQ8A 2C5LC 2OEDA 4G7OC 1N60A 3GTMB 2Z0EB 4USAA 4BBNF 1GOZA 3NUCA 5IP7G 2VZAA 1QT9A 1X6OA 2WB1E 3ZNHB 3OYYA 1N33L 3OMCA 5JJLA 2KJHB 1PFBA 1WTXA 1QLBB 4US8A 5JH5C 3CCJA 2BYEA 1T0YA 1MG8A 1S40A 4C00A 1VQEA 4HJAA 4OZCA 4XT3B 4LTUA 4ZHOA 3HGBA 1FCCC 1KAAA 1MHHE 4RA8A 1L1OB 4U673 5EGTA 2EYHA 4ANVA 4TQ1A 3K7AH 3GTQB 4DR4L 2H1EA 1VQ9A 1PGAA 3L9AX 1EQQA 2MBOA 1F2ZA 1KABA 1XLNA 4DV7Q 1YJJA 4DF7A 2GB1A 2BF8B 1H9KA 1YJNA 5CV8A 3NHHA 3NQTA 4JI6L 3MHSD 1VZ8A 1E10A 3RLFA 1R9TH 1XJVA 1ZEQX 4QUFA 4KN7C 4DU9A 2UUCL 3KBXA 4Q0FA 3HOVH 2K14A 4S3SA 1YX6B 1PTOH 2P5ZX 5EPJA 4JVZA 2F0QA 1VLBA 3T53B 1FJGQ 3NVVA 5C4XG 4QIWB 2BPSA 2E3TA 2LXJA 1V1PB 1BF4A 2RMMA 4GOPB 3QQ8B 1N36Q 3NTIA 2O2LD 3RI7C 3VTWA 2OWOA 4IQZA 4AIMA 1JC7A 1KTKA 1TKYA 4IUVA 2UUBQ 3EFCA 3A1QB 1PV4A 1ENCA 1I4PA 3LB8C 1NNXA 2BYTA 4A55A 4RGOS 2A5UA 2LXKA 1NUCA 2K5VA 1MJCA 2JA5H 3N1YC 4IOCA 1RYJA 1IXRA 1AZPA 2EYPA 3PHWB 4PV1C 4TUUA 2ZNVC 3MXUA 4DAPA 3Q8AA 3HOWH 5IWAL 3NBIA 4FXGC 1WJJA 1X3EA 4JI3L 1XNRL 2O5IC 1T3QA 3BDOA 1EIYB 2LUEA 4DWFA 1B4OA 3ZLZA 4B3SL 4IPDA 2HIVA 3M4PA 4DAVA 1BXTA 2R7ZH 1WR6E 2CHXA 3CPWA 3TEZA 4U68A 2L83A 1L2NA 4OVZA 4BWGB 3UI3A 3HOXB 1JE4A 3F2DA 4X65L 2ASBA 1EFWA 4DDID 1WY8A 2VB3X 4EZJA 1NVID 5AZHA 4B3RQ 3RNGC 2ICIA 4IPHA 2GVAA 1WZ0A 3VH3B 4A9AA 1ASZA 2D0OA 2MH7A 3NZ3A 3FHWA 4KKJA 2VB2X 4LNQA 3FDTA 4DN4M 1EL0A 4HVBA 2WDQB 3WWVA 2LY7A 1ESRA 2B63H 4ILWA 2KC1A 2KJ6A 4B3MQ 3TP8A 2RR9A 4P75A 1KD1C 3KQ4A 1VF5C 4KDIC 2K5QA 2RHSB 3R3OA 1F1HA 3RD2A 1JWSD 1YNJC 2LHDA 1R4NB 4ICVA 3LGJA 1Q5WB 3ONSA 3J7A5 5JJKA 1ZXHA 3TEXA 3PSEB 1KQSA 3MFYA 4DNIA 3TS2A 2K05A 3GTLB 4YTNB 3TSSA 3IHPC 3VUXA 4K5XA 2CU1A 2W54A 1SMYC 3JAMi 1EF5A 4LFAQ 4FNFA 5FLXc 3C1FA 3VDYA 2YTXA 3H3VH 4M01A 1I4HA 1W6KA 3ENEA 2WYQA 2WU5B 4LUVA 5DM73 4A3GB 1SJED 2EMTA 4F7XA 4M8MA 2EY6A 2DGYA 2EJFC 4A3DB 2R2OA 3PRPB 3H0GG 5BMIA 1WM2A 4F8MA 2YV5A 2WXIA 4YIJA 5M9OA 1TGZB 3VAWA 4F87A 1EU3A 3ND9A 2KK8A 2YLMA 3AQQA 3TREA 1PGBA 3OJ3A 1QZEA 2EOTA 2J4XA 5CHVC 2A6HC 1K28A 4KN4C 2FFKB 2PQEA 1ICWA 3HOZB 1G51A 3S15H 2IJ0A 2E2HB 2Z6KC 1PH9A 3I63C 3PZDA 1E7PB 1CSPA 1LLRD 3SK4A 1G6ZA 2M8SA 4HEA1 1X56A 4X3SA 3AEFB 3M62B 2O6VB 3EFXD 2PO4A 3KLSA 3U4VA 1EQVA 1AWDA 2IW3A 4DV0Q 1WXSA 1B9NA 4MGKE 5DPRA 2NUCA 1YN5A 4DHZE 2QILA 5CTRC 1PDXA 1E0BA 4RF0A 4GGQA 2B2VC 4HJ7A 1TR5A 4YXDB 3M9BA 1PRTF 2L52A 1LTAD 2A69D 1ZXIA 2YVCA 1YJ1A 1I94Q 4LNIA 4OHJA 5H8YE 2Y3AA 5I6WA 3A8JE 1TWHH 3NQIA 4AQ7A 1C76A 1TKGA 5IODA 4G7HC 1LTLA 2MBQA 3LJ3A 1BBUA 2QA4A 1J7BA 2CQOA 2NCNA 1H9RA 3S2HH 2K5HA 2VZKB 2Q2HA 1PH2A 2JA6G 5BN3A 3WDNA 1LUZA 2O2VB 3QIAA 2NR2A 3X0WA 2F4VL 1WTRA 4DV3L 2PMVA 3PV1A 5E6JA 4LJPB 2VNUD 4GLSC 2ZCBA 1TWFH 3NG0A 1DONA 1I42A 2WS3B 3M85A 2C7MB 2JWUA 3BZDB 2JYTA 3PV0A 3M4QA 2JVCA 1VQDA 4G7ZC 2QEXA 1YN4A 4C1NK 1U4PA 5LL6S 5JEAJ 4RWSC 1FGBD 1VJKA 4NJ7A 4JC0A 5JVH3 2KCCA 2JZZA 1KFYB 3I4MH 2KCMA 3B6YA 3ER0A 3VR5A 3M4OB 2A68D 3SEBA 1A2TA 2F0WA 4NXML 2AL3A 3P42A 4M0WA 1B1ZA 4CDCC 2K0PA 1XMQL 2DAFA 5AZFA 1F9QA 2ZJQA 1M1KC 4BBSB 3Q3MC 1CM9A 2E76C 1QVFA 2JP1A 1U4LA 2OXPA 5IGCA 1MVKA 2WLBA 3U8ZA 5KYIA 1T9HA 4CDFC 4S17A 4CGYB 4R4QA 4A3BB 2JYOA 3Q22A 1FGUA 2FJ2A 5C3EG 2F03A 4JV5L 2REXA 3DEOA 2V3SA 1HZCA 4GN3B 3RN9C 4W9KA 2PNHA 2NZOA 4PQXA 1SB3C 3Q3FA 3HOYB 1CFMA 2RQXA 5J1ZA 3ZXVA 4A3PA 4RGNA 1D1IA 2MQJA 1IZ6A 1DOMA 4H0LC 2B39A 2RSUA 2UU9Q 3K59A 4A93B 2E8GA 1E6EB 2RD0A 4GSWA 3S1NH 1GB4A 4NZLB 3TMEA 5CHFA 3FC4A 2QF7A 2PQAB 2NBWB 1PRTB 2HDLA 3TIXA 2EVBA 3KJPA 4AP4C 3TP7A 1MHWC 2JK8A 4DV4L 2WXPA 1RDPD 3VA7A 4BS9A 1PTOC 2IGDA 2ON8A 3VYTA 3GTGB 3M95A 3OTOL 1MJEA 1EM7A 3RCZA 3VXWA 3PO3B 1WJ4A 5ELDA 3U7ZA 2VQEQ 3UIOB 1TQOA 3OSOA 3EROA 5CBEE 2A6ED 4X57B 1Q46A 2CKZB 3A74A 4EQPA 2VUMG 3KH0A 4QY7A 4DNTB 4BBRB 1EEFD 3JW0X 4PS8A 1P3QU 1STBA 4LF8L 1PYSB 2DAJA 5JEAH 3C8YA 3DWGC 4GN5A 1QZGA 2GBMA 1S1QB 1ZGUB 4CJ2C 1FPYA 3CQZB 1WXVA 3LWEA 4EX5A 2OTJA 2ACZB 3IBEA 3KWLA 3N32A 4J3OD 1IBXB 4YSZB 1C7YA 2HQEA 1ZXTA 3PUXA 5JJZA 4MH8A 3VRAB 2JEBI 1IUEA 2L15A 5M3FB 2J42A 2LRWA 4BKTA 2KHIA 3CCQA 2WAQG 1HHVA 4IALA 4KJNA 3MJ5A 4C3JG 2MHVA 4AYBB 5E4XA 3S16H 3W5UB 1FRDA 3S14H 3J80L 2LSSA 1XT9B 1Z6HA 3PT2B 3S1MH 1HTPA 2BE5D 4K8IA 4P16A 4YT0B 2N1VA 4MT5A 1WSPA 2JPHA 1QQRA 1VQJA 1I5FA 1FM0D 2R92G 4JOIC 1H4RA 2CFMA 4FXKC 4KGTA 4WRDA 2N88A 4H44C 4ZYSA 3GTMH 1HTLD 4OWXB 2B2YA 3FPUB 1A3TA 1RCVD 4YY3Q 1X9NA 1DZ1A 5C3EH 1MJDA 4I6LB 4FADA 1B9MA 1ZP0B 3RFZB 2BYFA 1F52A 1Q1EA 4Y7NB 1HZBA 2PZUA 2ONQA 1RTOA 2M4NA 2RVLA 3RT3B 3Q8CA 4NMZA 5EPLA 3H3VC 1K8RB 2KQ4X 4B95A 1KLVA 5E1FA 1XNQQ 3AULA 1IYFA 1B9RA 5T8IA 1V1PA 4F88A 2XTIA 1A3UA 2PE9A 2KJXA 1NI2A 4IZ8A 1VQFA 3VR3A 4M02A 5EDSA 3RYTA 4KHPL 3P1MA 3QK0A 1SNCA 1XMOL 2PEAA 3J7YW 4HXDA 2V3PA 2RDHA 2GBNA 3N30A 3H8HA 3HVDA 1IPGA 4IKGA 4L23A 4LNOA 1JROA 3K7UC 4P1BC 5D3DA 3RLNA 2DLBA 1VQLA 1WOCA 1RFAA 1B70B 4CKEA 2CJOA 3UE1A 3VDZA 4DR2L 2VUMH 4YWGG 1G91A 3I5JC 3EVQA 2A8VA 3SDZA 2AWTA 1SIFA 2LI5A 1E0ZA 2V1YA 1STYA 4ZRZA 1TJEA 1SF0A 3A4RA 4O0AA 5M3MG 1JCKB 1OFFA 4R1JA 1IBMQ 1GNUA 3IAYA 1E8XA 1EEID 3DMUA 4R4IA 1EWHA 1KOTA 2INPE 3KUZA 2CJNA 2D5DA 1KRTA 4OWWB 4JI5L 3JSVB 1X3PA 1ASYA 4KKSA 4JI8Q 3RULA 4W9CA 4V0BA 3TMPB 2XNAC 1GXDC 2LXCA 4IW0A 5ELOA 1SR3A 1I7HA 5LLIA 2K6AA 4RMAA 4C3JH 4ZRPA 1V43A 3UQAA 4HJ5A 4PNYA 2O6VD 3A54A 1DCZA 3MTSA 4X66Q 2QDLA 1BQQT 1SRUA 3CF6E 1YIWA 4N9TA 3HOXH 1SE9A 1C9OA 2Y0SG 4D2KA 3CMEA 1HNWQ 2MP1A 4EE2A 2F0HA 4BY1B 2EYLA 2DZJA 1A70A 2C9WB 1D7QA 4FHJA 2R92H 1UELA 4JLCA 2K5WA 4HN7A 2PLPA 4K5WA 4N9PA 4RGTA 2RCNA 2K3UA 2N4FA 3U2SC 2JN4A 2H89B 4FF2A 1EUJA 3AE8B 3PIPA 2V3NA 4RKLA 2JA7G 4YCWA 3Q2AC 3AE5B 4TMAB 5IOCA 4AS1A 2PVOD 1E2VA 1I6VC 5M5YH 2VZKD 4GN4B 4HIKA 2K8CA 3P4SB 5J39A 4HDQA 1PZJD 1F77A 2SNMA 4GN1A 5D3IB 2WP8J 1IGCA 3EJIA 5IGEA 1TZOA 3H6NA 4JBJA 3NJTA 3PTFC 3CCVA 4DR1L 3DBRI 2WDRB 4K1RB 4UHVA 3QB3A 2NVYB 2WX1A 4Q5VA 3A4SC 4LNNA 4WAFA 2OOBB 2G1EA 1C79A 4E3CA 2IX0A 1GKHA 1GC7A 4YTMB 3WOEA 1ESFA 4JI7Q 4PG3A 3I4NB 2YU9H 4DV1L 1EIGA 2K4KA 3G4SA 4JI0L 5C2TB 3PO2G 1H9MA 4XXEA 3BY4B 1ENAA 1SFOH 1HA6A 1WI0A 5A2QE 3E0EA 3AE3B 3BK2A 4GZYC 3PZ7A 1IYVA 1HA5A 2ICEC 2INDC 3CCEA 3AYHB 1MD2D 4RMFA 1WIAA 3RNFC 1EQRA 1D8LA 1Q8IA 4GNXA 2WGSA 2WXQA 1V6EA 1EY7A 4DV6Q 2OF1A 1RAXA 4R4TA 3IT6B 1D3ZA 5L95C 1J7CA 2KBNA 1ZDXA 2HTHA 3L0WB 1A15A 4YWMA 1N5XA 1WGKA 2V1CC 2KMAA 1K52A 3K8AA 3V6EB 2YTVA 3I7FA 2GBRA 5HHDG 1CA6A 2FCSA 1S3SG 4LLGM 3NE5B 1E2ZA 4IUUA 1YX5B 1O7YA 4AJWA 3T3NA 4OZAA 4R9WA 1CUKA 3T9LA 1S5FD 4HEDA 1ENFA 1PRTD 1X3FA 5I9PA 1DD2A 3LX0A 4LCDE 1HFGA 4X64L 2F0KA 4DAMA 4LF9Q 1K3RA 4DUYQ 1T0RC 2WV6D 1S4ZA 3ZNGC 5BMGA 2N78A 3FP9A 1N8RC 2PVGC 4WWOA 1L2FA 1E8ZA 1GM5A 1KDAA 2Z0SA 3ZKJC 3TZUA 1YJIA 3PIO3 1BKBA 2Q5WD 3ZRCA 1H9JA 4ARIA 3PUZA 4A3JG 5AUKA 2F0UA 2LD9A 4XGAB 2IO0B 4IN3A 1NEKB 3H9DA 2UUAL 3IAS1 3VUYA 2ALYB 4RAUC 3A55A 2FINB 3CMAA 3H3VI 3B08A 3ZTDA 2FHTA 2K6DB 2BA1A 3UI2A 3AMZA 3MXNA 2LWPA 3JAMc 5DPSA 1FXAA 1H95A 5NUCA 1I50H 4S0RA 5BR8L 1UE1A 4EVOA 4HK2A 1CK1A 3HIZA 2M17A 1PFSA 4ZOHC 2I1KA 3GS2A 1NAPA 2K6QA 1WD1A 5C4HA 4YHHQ 2NN6G 1B3QA 3SXHA 1YD8U 5AJ3L 2GMIC 1C3TA 1G8ZD 4DUZQ 1ZPSA 1SLJA 1EOVA 3RZFA 2D9UA 4OONA 1NJIC 4A3BH 2C7HA 2LXAA 3CC7A 1WWTA 4HJ8A 5JOBA 1V9JA 1JORA 2AQ2B 4JG2A 1L1OC 3MHZA 2A6EC 3HOYH 3APCA 2DYOA 2M0XA 2NTSA 4KTAA 1X65A 3GTPB 3OPOA 2XWJB 4KV6A 1DOLA 3VTUA 3PO2H 2E2JB 2M0AA 3AFQA 2JXMB 3KUDB 4A93H 2FIFA 1IKMA 4LNKA 2QGQA 5IT9c 5C6AA 5L37A 2BQQA 2DBYA 2F0FA 2R93B 2KTRA 3NUHB 4XWWA 4RNAA 3CC2A 2OTLA 2KX3A 3HOUG 4L5TA 3HKZG 2ZTEA 1HXYD 3AEBB 2C5CA 4HJKA 4DR5Q 5M5WB 3W1GA 4DR3Q 1TZ1A 4XYQA 4GOPC 2RBMA 4O2DA 2K25A 3WCQA 1HTQA 1B8AA 4JBWA 2CW0D 3NBHA 1GUNA 1O7LA 4OL7A 2D07B 5D94A 2BE5C 4CYEA 4PK1A 4LUOA 1H9SA 2NVXB 1Y1VB 2M00A 3UDGA 3TP5A 3AECB 2A5HA 1F9PA 3DBLI 1YNTE 3BZCA 5IIFA 2D2CC 2DJGC 1J7AA 4DHJD 3W5OA 2RSNA 4HMIA 1AE2A 3MVVA 3OWFA 2IZVB 1X3GA 1TBEA 2EXZA 3K81C 1QCBD 2WXFA 3CQZH 4BBNC 4DHZB 4C3IB 3FVQA 4B3TL 4M0WB 3I70A 2KECA 4JYAQ 3F1ZA 4H02A 1J6QA 2LS01 2L1BA 4LFBL 2HTME 1Z7TA 4K5VA 5M3FH 3X3MA 5I6YA 1N5WA 1A6XA 1PH3A 3G6EA 3KFUA 1SNDA 4DNRB 1LM8B 3G6JB 1I4GA 3PRMB 2DYMA 2RCFA 2V9HA 2NZ1D 2KT7A 3AEVA 3GV3A 4ASWC 1SIJA 2N7EA 2JRIB 2L11A 2K01A 1FD6A 2ZZPB 4A3FH 3HKZE 1D1KA 4OIKA 4W9EA 1VQ4A 2L32A 4YTPB 3D8GA 3K0XA 4JI1L 2FNJB 3HOVG 3DOWA 2NN6H 3MEFA 4KY7A 1RM6C 3T1YQ 2SDFA 3BZKA 1IBKL 1LTRD 2BB6A 3ABVB 4REZA 3Q6SA 4X62Q 3L54A 4ZRJA 4POFA 3WOFA 1BDOA 1A0IA 2EJGC 2AEHA 1KNAA 3RNCC 4HCNB 2HQLA 4IDIA 4IFDG 2ZJRA 3IG3A 3TBLD 4IUNA 4KY6A 2ASQA 2IBIB 1O80A 2PCFB 4AUQC 3CKIB 3KUPA 3HOWG 4LJOB 1J0GA 1F2MA 1SE8A 2G4DB 4ZRQA 1LT3D 2CR5A 2KDMA 1KC8C 1QZHA 3AB9A 3HOUH 2KFJA 5I4DA 1UWMA 2Z59B 4XQQA 1K73C 1HR0W 2E2IB 4W9HA 1MKHA 1ET9A 2EY5A 4HJGE 4NY0A 4W9GA 3S17B 2VQFL 2R2QA 4IFDJ 5EAYA 3VYUA 4K3BA 4P74A 3B2GA 5D14A 5IGBA 4E71A 2MUYA 1R4MI 5HY6A 2LGDA 2UXDQ 3ECIA 2LGYA 1V86A 1UH6A 4EFOA 4FVMA 1JWBD 3WAMA 2QMTA 2W9NA 3RD4A 2A4ZA 3FILA 1M94A 4A3EG 1LV9A 1CKOA 3U9SA 2B63G 4P7IA 3P4RB 3L7ZC 2PI2E 3KF8A 5EE3A 3AN1A 1JWAD 1B50A 3M3JA 5IT9L 4DV7L 2JZPA 2Z0DB 3AE2B 4RKBA 4HKQA 1AZQA 2KHSA 4X3TA 4WFN3 1OXTA 5ELCA 4KK7A 1J5EQ 1DOYA 2VS1A 2LVPA 4HRSA 1XLOA 2YEPF 4FA6A 2XVSA 2CVRA 3RNUA 1E7ZA 4MM3A 3GTOB 1V1OA 1M8AA 2L4NA 1JQ4A 4H13C 1QOHA 1EU4A 4XQNA 3ZJVA 2XN9C 2PYKA 4GLAC 1N36L 1NY4A 4BY1H 4GKKL 2QDFA 2B2WA 3HP3A 4I6NB 3P20A 3AU7A 2UUBL 1RRBA 4HPPA 1PH7A 3JYUA 3PQIA 2KWDA 1N33Q 1KLUD 4LDTB 2KEEA 1OEYJ 4TRDA 3FKIB 1LQBA 4V190 3K5LA 4W9JA 1IW7C 1UGMA 4IM2A 3IKJA 3QR8A 4RHSA 5G3LD 4C3HG 3V6CB 3W1SC 1K0SA 2E75C 1Y1WB 4YL8A 3V3XA 4ZQ3A 3RPFC 4A3KB 3H09A 3EN2A 1KXLA 1SBBB 2CU3A 1N32Q 4IFDH 2B2TC 1CTMA 4GU2A 1D5MC 4L8JA 3H6MA 4R4CA 1OXVA 4C2MB 3T1HQ 4IJLA 1K3BC 2KQ3A 4BY7B 3K80C 1LT4D 4JCVE 1WFYA 1GB1A 2KX0A 4JI6Q 2LJ5A 3OW2A 4HTHA 1XWEA 4PMBA 4RFBA 5CC4A 2IGHA 2VH1A 1ILQA 2RDBC 4NPSA 3OAWA 3I55A 1PRTC 1JJGA 2I1JA 2BTEA 2IWHA 1Y14B 4XIGS 3AEDB 1A8VA 1GUAB 1QOFA 2F0TA 4FULA 4N9F4 4B3ML 3CCRA 2QHOA 3AMUA 2CHWA 2V4LA 2DYBA 2VL6A 3SD5A 3I4LA 2K8HA 2KVZA 3TCAA 1R7SA 3ZGZA 1VQGA 1Q86C 2ZPYA 3RZDB 2YEPB 5C5LA 3NHEB 5D2MB 4A3LG 3RNBC 3RZOB 1K9MC 4A3EH 2KDIA 4B6WA 3S1RH 1N6ZA 3X23A 1VQBA 3NS8A 1UBIA 3I4MG 1P98A 1QILA 1AYFA 2IY1B 1AFPA 4JE3B 2F1MA 2JSOA 4ZLTF 1HR0Q 3ZQ4A 1TS2A 4K2KA 1E2WA 2BDNA 2JA8B 4JI3Q 1WH3A 2GBJA 4CO7A 2R3ZA 2JXTA 4N58A 1NMGA 3T3OA 3P4QB 3ZDMC 3V60A 4R8NA 2PE6B 1GO3E 4X65Q 4FXDA 2E2DC 1DOIA 3RNAC 2MO0A 5FO9B 1RWSA 4PS7A 1CSQA 1BBXC 2L3ZA 1I3QB 2DN8A 3AFPA 1UWVA 4N59A 1U4RA 3GTJB 4ZHPA 4KY5A 1NBFC 1SYGA 1F9JA 3FRPB 1IYUA 1N34L 1EZ8A 1PYWD 3W5VB 2EY2A 4K8JA 3PUVA 4DV0L 2ID0A 2LHEA 2MSED 2N7DA 2ZPNA 3UDXA 1PZID 2RHQB 4EEWA 2KOLA 2K1BA 4C56C 2IX3A 1AP0A 3TUOA 1RIPA 1GUOA 4C3HH 3M3YH 2JQRB 4K0KQ 1B2TA 2PPBC 1P0RA 3VR2A 4BKSA 1JW9D 4OW0A 5D65A 3HM3A 4XDCA 4BXXG 1BR9A 3BS1A 5D6JB 4WWNA 2HDEA 2UXCQ 2WKDA 4WQOB 3WAOA 1EYAA 1SROA 1VQAA 2ZM6Q 2UWQA 2M56B 4G11A 1TWGB 3C46A 2QDBA 1X32A 3IAM1 1OXUA 3Q8DA 1IHZA 2QW7A 3CRLC 5FOBB 5C44G 4GNXB 5JEAG 1P7EA 4MSMB 3K6OA 1YQ3B 1U5KA 2CW0C 4GS3A 3J80E 1HRJA 2LZ6A 4UY8C 4RH6A 2AUKA 4GDLB 4A3IB 1Q3LA 3GTPH 5AEKB 3TEWA 3FMCA 1F2RC 4ZYNA 1PA6A 3ULJA 2PW5A 2HJ8A 3H7PA 5HG2A 4IWQA 1YJWA 2OHFA 1V80A 1XXGA 1G2SA 5C0XG 3A8KE 4MN3A 3S1QB
chains in the Genus database with same CATH topology
2EJMA 1CHQD 3GP7A 1S5ED 4R8IA 5KEEA 1FFUA 1L6UA 1B3AA 1TWAB 4HKZE 2K33A 3SFDB 5IGFA 1JR0D 1J9OA 1E9MA 1BUIC 5CYUA 5C0XJ 2JSVX 3T56B 2E74C 1FFVA 1FIQA 3P4PB 1V97A 2KA7A 3D4DA 2DWQA 1C77A 3BYTB 4L63B 4PT5A 3SFEB 2RSOA 5E3FA 2NYZD 4FYDA 3R2TA 1W6JA 4ZAIA 1ONLA 1LTGD 2XSCA 3VYRA 1OO9B 1EYDA 3V2TA 3HEJA 4KD4A 2L0CA 4NJCA 1EY5A 1WTPA 1HZ6A 1S5DD 5FLXL 1SJHD 2B2UC 3D4RA 3NSWA 3U9OA 2N9KA 2A74C 5ELEA 1WRIA 2WINB 1YNNC 1WTVA 1HZ5A 5FO8B 5IGDA 1K51A 1QF6A 4A3MB 2MGSA 2WKCA 1A2UA 1F9RA 5C0XH 1SYFA 2O4XA 4NP5A 1H9SB 3LYYA 5KGUA 1EQTA 1MHXA 1N63A 5EBDA 3E0JA 1PGXA 1MSHA 2NVQB 1KNEA 1Y8OB 3I57A 4RGMA 2DY8A 1C4CA 2GA4B 2K03A 1K83B 1XX8A 1I6HB 3NPPA 2BS3B 3O13A 2F0IA 4KX6B 1SE2A 2O5JC 2EYJA 2NN6I 3V05A 2LKVA 2JE6I 3BG3A 2KACA 1LTTD 2WXMA 2F0LA 1TWCB 2TMPA 4A6QA 3BDLA 1SAPA 4UDUC 3W3AA 1SSNA 3W2DA 2X38A 4ZKCB 2EZVA 3M7NA 2X6GA 2Z4IA 4EGVA 5C4ZA 5I2YA 2G9DA 1XLQA 3AE1B 3K0YA 1VRAB 2QKIC 2KEDA 1FO4A 2H4OA 2B76B 1ML0D 1FYCA 5DEHA 1F2RI 1GUSA 5J22A 4QF4A 3J9CA 1K50A 3HKZB 1DJRD 3P7JA 1IGDA 4FXCA 3VYSA 3TEYA 1J8IA 5JPNC 3OIPA 4N6EB 1SE4A 3MAQA 4L1BA 3H94A 3AE4B 1WCMB 1PFMA 2K7VA 3FILB 5C5MA 1Q1BA 1IKLA 1FNUA 3X3NA 1STNA 4WQMA 1YMHE 2EYFA 1WTWA 1VCIA 1YN3A 3VR8B 1GPXA 1R4PB 3Q23A 4J8QA 1JWUD 3NTHA 1WTOA 2K32A 1CZPA 4MM3B 1OXXK 1N62A 5G3LF 3MXPA 2MEKA 3PUYA 4B9WA 2BS4B 1FCLA 3IL8A 2L12A 3SR1A 3HOVB 2N9LA 3T13A 1PTOB 1U9RA 4OO1G 1LTSD 2W82A 3CHBD 2AQ1B 1FNWA 5C3JB 4TQ0A 3E6ZX 2WB1B 3OIQA 4KHVA 3KK7A 4ME5A 4H7BA 2ZXOA 1K8MA 2Z1CA 2A69C 2X6LA 4IFDI 5EE0A 1G2TA 2JA5B 2K22A 3K58A 3Q0AA 3QOJA 4CQNA 1EY6A 1LTID 4WURA 4OGQC 3DWPA 2R7ZB 3MP9A 1TS5A 2DNCA 2F0SA 5KYLA 1LT5D 3CU7A 3AEGB 1KDBA 4MHEA 2PW9A 1I4RA 1VDZA 1C4AA 5CV6A 2A68C 4KKTA 1JQYD 3ND8A 2IT1A 5D7GA 4J6HA 1NR4A 4KI0A 3TBIB 1U4MA 2F0DA 3D6CA 2FMMA 4RCNA 1O78A 4NW2A 2WACA 2R6GA 1HPCA 3OOCA 3IXSA 5JPMC 2DY7A 4CKBA 4ZK9B 2F0GA 3ITPA 2F0NA 4HSVA 4C1NI 4CBVA 5T1IA 1FNVA 1TT2A 5EQ0A 1LTBD 2K5DA 3MEHA 3VRBB 3VA5A 4B0EA 5JAVA 3W1SA 2M2LA 2QSDA 4OO1H 2QIEB 3DWAA 2L55A 4K6LA 2WNMA 5C4XB 1CT1D 2B2TA 3S15B 3VR9B 3HVZA 3I8ZA 1Q12A 4KJOA 3NWTA 2N0SB 1ZUD2 2BDOA 2WXGA 3DWMA 5BYRA 2NVTB 2B2YC 1OQQA 3MC0B 2WXJA 2GI9A 4WWMA 3N9YC 1GUTA 3IFTA 2I46A 2XRSD 5FKAC 2Y5CA 1MSGA 2Y5PA 1NR2A 4DK1A 1V8QA 3S2HB 4XQJA 3V96A 3T51B 2OEOA 1II3A 1VR9A 3NP8A 5IT9E 5IGGA 1CZWA 1M4VA 1TWFB 1HUMA 2KAJA 4RF1A 1L4ZB 1TIID 3VR4A 2K28A 2Q8RE 2F0VA 3ZJTA 5EJWA 2I07B 4B08A 3C3LA 3OW7A 5EPKA 3EQLC 2F4IA 2CQAA 3L4PA 5CGKA 2EYOA 3H0GB 4K2LA 1GJXA 3S1NB 5JVG3 4YSXB 4A90A 4A8XC 1EY9A 1PMRA 1SYCA 1XCQL 2B2VA 3IT4B 2PMZB 2GRIA 2B8GA 2F0JA 4QMGA 2XRQD 2BOSA 2X69A 3S2DB 3NVWA 4NAMA 2WU2B 5DNFA 3GV6A 4L2YA 2Q8TA 2KN4A 2B8FA 4ODGA 3VQIA 5HGTA 3JAML 2WQYB 1AEXA 4KKIA 1L0XB 3PMFA 3NS1A 3MA2B 3R2IA 2I38A 4HSPA 4Z9CB 5EKKA 1ACCA 2JA6B 1OQRA 1JB3A 1KLGD 1PTOD 2KCNA 1FXIA 2IDYA 5C0XI 2NTTA 2V0GA 4PMCA 3NVYA 2L1AA 4LK1C 2F0OA 4KD3A 3S1MB 3A8IE 1TY0A 5HURA 1DOXA 1CQFA 2J53A 3T4AC 4UAIA 2BBCA 1EYCA 1MGSA 1NYQA 2BW2A 3LNNA 1F0ZA 5GXGB 4HCSA 1RKNA 3SK6A 2J7ZA 1FEHA 5C3EB 3A56A 3RMHA 2I2YA 2F0PA 1EFID 4IUQA 2VXWA 1C8CA 2ZW0A 1BOSA 1WXQA 3P1HA 3TZDA 1BO0A 4NAWB 3CWIA 1HEZE 2AWNA 2D5GA 1B53A 1RTNA 3N52A 4IURA 2E6XA 3MWYW 2B2UA 4DQOC 2Z8LA 2WXOA 4ULLA 4C7YA 1AN8A 1PFDA 1BCPB 3SK8A 1GUWA 5AUIA 3J81L 4DAYA 1JMLA 3HS0C 1QNUA 5EE1A 2VUMB 3NWSA 3IFDA 4WJWA 2LFNA 2KUMA 3ZYYX 2FBWB 1LACA 3LWUA 5C4JB 2G9HD 4DFAA 1SNMA 1QG7A 4HCEA 1N61A 3AE7B 5K5PA 1TVXA 1EY0A 3HG9A 1TYGB 1ZOYB 1SYDA 5F2DA 1T6BX 2PKOA 4B0MA 2WAQB 5BMIA 5CV9A 3J7AV 3I90A 4C3JB 2HUGA 2F3VA 1PDQA 4BA2I 4KHZA 5ELBA 2RKSA 2R92B 1JWMD 1Q10A 3T16A 3OWEB 2WXRA 4ZUJA 1CI3M 1Y56A 5M5YB 1K8OA 3BYYB 1HQMC 2F0MA 4C3IG 1QJOA 4GDKB 5ELFA 3SR6A 3AEAB 1SYEA 5FLXE 5KNDA 1NCVA 2QEJC 2HDMA 1UWXA 4B9XA 5MPOA 2OT2A 2C9OA 2YU9B 1VZ6A 4HMJA 1D4BA 3ZJUA 4XYOA 1SFOB 3H91A 4I7ZC 1YQ4B 3CIRB 1WD0A 4JWUC 5CMDA 2K9XA 1F2LA 4OZBA 5EE9A 3E9SA 2LJIA 2WP9B 2YYZA 3URYA 4ZUIA 3FPPA 5M3MB 3K5OA 2LMCA 2WXHA 2Z4HA 3OHXC 1STHA 3PO0A 2H88B 4FF1A 5BMHA 1C4PA 2EPBA 2CHBD 1BUVT 5AFWA 2SAKA 1RHPA 3SVMA 2QJLA 3NXWA 5C3WA 2LEKA 3D3RA 2AUJD 2Y0SB 2DNEA 3NTKA 3OMGA 1STAA 1BMLC 3GO5A 1WTQA 2N55A 3BVGA 3NK9A 4X3UA 5CORA 4DK0A 2WIIB 2LFIA 3KLSX 2JA7B 1TS4A 1L5PA 5TSSA 2EKIA 1I50B 3QG1A 2XIWA 5CBAE 1VF7A 3EA6A 2JYEA 5CV7A 4OO1I 3K5NA 3B9JA 3KWVA 4XTCS 1EY8A 3Q24A 3W9CB 2AQ3B 1F9SA 2MJ8A 4RHRA 1XCTL 1ZYRD 4EQOA 1JALA 1FR3A 3NVZA 4QUCA 2RPVA 1VDVA 5A35A 4XE0A 2K04A 1BNZA 1GUGA 3DXJC 1TU2B 2WXLA 4CHTB 4DXGA 2MJEA 3PO2B 5M5XB 1SEBD 1NENB 1JOKA 1SDFA 1UAPA 4EQNA 1AW7A 3AV8A 4CJ0B 1FMAD 3QO2A 1TKWB 2B2WC 2SNSA 3E56A 2RDFA 5BN5A 2QCPX 4J1MA 3ETRA 4KKUA 5H92C 4HR7B 5CR3A 3GD7A 2SOBA 2A73B 1C78A 3AEEB 1SNQA 2M9VA 1LT6D 2ZT9C 5EKIA 3DHQA 1KDCA 5JXVA 3TDQA 2IX1A 3L3OC 1XYIA 4JWSC 1V8CA 1X3QA 5DAUA 2M19A 1BCPD 5T1GA 3BVZA 2PNRC 4A3JB 3GTKB 4FO2A 2PZTA 4NDXA 1C48A 5KNBA 4KGSA 3MFGA 4A3FB 4M1UB 1IL8A 4O42A 1I4XA 1GHJA 1RJTA 5HI1A 3TP6A 4DGZA 4TSSA 3HUIA 1DGJA 2AX5A 2L9HA 3AM9A 1CQVA 2KVMA 4IUPA 5I2XA 2EY1A 1EIHA 4ITKA 2NMQA 3P63A 3QWNA 1EZ6A 3F2UA 3U52E 1D2BA 3ONAB 3QJYA 1PLFA 1Q90A 1PTOF 3MZ5A 1QE6A 5LNK1 4ID6A 2F0EA 3R93A 4OIJA 2PTLA 4RCOA 3I72A 1RD9D 1RF2D 5C3XA 2FUG1 3HOUB 1NI3A 1VMPA 5G5HA 4KMUC 2EYMA 1STGA 1C4QA 5KIXA 4P6VF 4LAAA 1TKEA 1C9FA 1SSOA 3G7LA 3RUZA 3PIP3 1L0VB 3BK1A 4HAEA 2J0TD 2R61A 1UNSA 2EELA 4LMQD 2JU6X 5EKLA 2D62A 5DM63 1JRPA 1JOQA 1GAQB 1QNKA 2BCOA 4YSYB 3DUZA 3K7AB 1ILPA 1O7ZA 2BA0A 1SYBA 4XT1B 5EBCA 1R9TB 2LGIA 4P2CB 1HFNA 3HZXA 4US9A 1D5ZC 1EWYC 3CRKC 3MXGA 2N7JA 4E6IA 3PZ8A 1CHPD 1UEAB 1QKZA 1QOBA 1EWCA 4NKLA 3MHBA 1XO3A 3P75A 4QCLA 1ZE3D 1HQRD 1TY2A 2MJ3A 1FRRA 4XDDA 2EE1A 3J7AF 3I3CA 3DWQA 2J52A 3E5SA 2NB0A 2XWBB 3KLRA 4G4KA 2BT6A 4JX1C 4I65A 3BDCA 3D6WA 3HOWB 3AH7A 3Q8FA 3GQBA 2NBFA 3I73A 1ROEA 1WYGA 1EY4A 3FEWX 3HRZC 1KH0A 1WVLA 1Y69U 1DM0B 1MBYA 3DM1A 4O1NA 4FF3A 2TSSA 3R8BA 1IW7D 1DOKA 3I91A 3K5MA 1LO5D 1Y8NB 3M7GA 4XWTA 3AE9B 1QOAA 4XDXA 4ZKBB 1RFKA 3KBGA 1VZ7A 1JOOA 3PUWA 5LL6X 2SEBD 1QOGA 4A3EB 2INNE 1MPEA 3Q69A 3S1RB 2B63B 1XLPA 4H2AA 3LXFA 3EUB2 3Q8BA 4HROA 5K36G 1S5CD 3D31A 1JICA 5BN4A 4IUTA 4MIUA 4K14A 4JK1C 2W3SA 3B2FA 4ABNA 4TKOB 2BS2B 5BYSA 5FR3A 2IPKD 1R4QB 5HFYA 2FE8A 3TN2A 1Z47A 3HRDD 1MI0A 4Q2JA 5FK9C 4DXFA 1A3VA 1ZYRC 2AWOA 1G291 2WXNA 1ZDVA 4WH4A 1YNJD 3JAME 1RODA 1CJEA 2PW7A 4C7ZA 1STEA 3M3YB 4C3HB 2W55A 4TQUS 2WDVB 2LUMA 4FP5D 1SMYD 3SK5A 1F2YA 1QWYA 1XTCD 3D4WA 1CA5A 5CV4A 2V4IB 3BIID 1PFNA 2BB5A 1NSNS 1TWHB 4FF4A 4X3KA 3S9WA 1KRHA 2A6HD 1LABA 1L6VA 5COYA 2LMCB 1OXSC 2ZXRA 3SHLA 3C1EA 4L6TB 2ENBA 2MJDA 1D6EC 1UGJA 3EGRA 4MACA 1BCPC 1CZGA 1SNPA 3I4MB 1PZKD 3VR6A 1IBXA 2HCIA 5K36H 2KMMA 5A2QL 5E4WC 4CJ1B 1DXMA 4DA2A 3N6RA 2V4DA 4IOIE 2FMCA 1PXUA 1T5XD 1PUTA 2RDGA 1UUPA 1SNOA 2PZWA 3DEPA 3ERQA 4M8AA 5BYQA 1L0YB 3Q8EA 1XF5L 1KF6B 4JPSA 2HCCA 2F3WA 1SE3A 5FO7B 1S5BD 1VMCA 2K5PA 3J81E 3AB5A 5LHY1 4QB4A 4BA1I 4ARCA 4K6DA 1L4DB 1ZKOA 1Y8PB 5ISRA 4KGRA 3AE6B 5KRUA 1TS3A 2IGGA 3NRZA 1D5XC 2L5TA 3M4YA 4R3DA 1B44D 4C80A 3SE0A 2RA4A 2MPMA 2Q8IB 5C44B 4WIPA 3QOLA 4PMWA 5G5GA 4G57A 4LJZC 3BWUD 5CV5A 3U4EG 4WORA 1FD7D 1BCPF 2NWGA 2JEAI 3A7LA 5I9OA 4CKCA 1EOTA 1NYRA 1XEEA 3I9V1 2EDGA 2IL8A 1HCZA 1K53A 4LK0M 2PIAA 1HUNA 1T5EA 3S16B 3GB1A 2W3RA 3BVMA 1P7FA 3S14B 5KNCA 1MI2A 3K57A 2WXKA 1ET6A 2ZW1A 1SXTA 1DYQA 3FAHA 2JX5A 1GHKA 1QB5D 1I4QA 3C2PA 3A7AB 2ZXPA 1YNND 2OEDA 4USAA 4G7OC 1N60A 3GTMB 1GOZA 3NUCA 1QT9A 3OMCA 1PFBA 1WTXA 1QLBB 4US8A 4OZCA 4XT3B 4LTUA 4ZHOA 3HGBA 1FCCC 1KAAA 1MHHE 4RA8A 4U673 5EGTA 2EYHA 4TQ1A 3GTQB 2H1EA 1PGAA 3L9AX 1F2ZA 1KABA 1XLNA 1YJJA 2GB1A 4DF7A 1H9KA 5CV8A 3NHHA 3NQTA 1E10A 1VZ8A 3RLFA 1ZEQX 4QUFA 4KN7C 4DU9A 3KBXA 4Q0FA 4S3SA 1PTOH 5EPJA 2F0QA 1VLBA 3T53B 3NVVA 4QIWB 2E3TA 1V1PB 1BF4A 2RMMA 3NTIA 2O2LD 4IQZA 1JC7A 1KTKA 1TKYA 4IUVA 1ENCA 1I4PA 3LB8C 2BYTA 4A55A 4RGOS 1NUCA 1RYJA 1AZPA 2EYPA 4PV1C 3MXUA 4DAPA 3Q8AA 3NBIA 4FXGC 1T3QA 2O5IC 3BDOA 1B4OA 4DAVA 1BXTA 3TEZA 4U68A 2L83A 4OVZA 4BWGB 3UI3A 3HOXB 1JE4A 2VB3X 1NVID 2ICIA 4A9AA 2MH7A 3NZ3A 4KKJA 2VB2X 3FDTA 4DN4M 1EL0A 2WDQB 2LY7A 1ESRA 4ILWA 3TP8A 3KQ4A 1VF5C 2K5QA 3R3OA 1JWSD 1YNJC 2LHDA 1ZXHA 3TEXA 3MFYA 4YTNB 2K05A 3GTLB 3TSSA 4K5XA 2W54A 1SMYC 4FNFA 3C1FA 1I4HA 1W6KA 2WU5B 5DM73 4A3GB 1SJED 4F7XA 2EY6A 2EJFC 4A3DB 4F8MA 2WXIA 4YIJA 5M9OA 4F87A 1EU3A 3ND9A 1PGBA 2EOTA 2J4XA 2A6HC 4KN4C 2FFKB 2PQEA 1ICWA 3HOZB 2IJ0A 2E2HB 1E7PB 1LLRD 3SK4A 1G6ZA 4HEA1 4X3SA 3AEFB 3EFXD 2PO4A 3KLSA 1EQVA 1AWDA 2IW3A 1B9NA 2NUCA 1YN5A 2QILA 1PDXA 1E0BA 4RF0A 2B2VC 1TR5A 4YXDB 1PRTF 2L52A 1LTAD 2A69D 1ZXIA 4OHJA 5H8YE 2Y3AA 5I6WA 3A8JE 3NQIA 4AQ7A 1C76A 1TKGA 5IODA 4G7HC 1J7BA 1H9RA 2VZKB 5BN3A 3WDNA 3QIAA 1WTRA 2PMVA 5E6JA 2VNUD 4GLSC 1DONA 2WS3B 3M85A 2JWUA 3BZDB 2JYTA 3PV0A 4G7ZC 1YN4A 4C1NK 1U4PA 5LL6S 5JEAJ 4RWSC 1FGBD 1VJKA 5JVH3 2KCCA 1KFYB 3VR5A 3M4OB 2A68D 3SEBA 1A2TA 2F0WA 3P42A 4M0WA 1B1ZA 2K0PA 1F9QA 4BBSB 1CM9A 2E76C 2JP1A 1U4LA 2OXPA 5IGCA 1MVKA 2WLBA 5KYIA 4CGYB 4A3BB 2JYOA 3Q22A 2FJ2A 2F03A 3DEOA 4PQXA 1SB3C 3HOYB 1CFMA 2RQXA 5J1ZA 4RGNA 1D1IA 1DOMA 4H0LC 2B39A 3K59A 4A93B 1E6EB 1GB4A 4NZLB 3TMEA 3FC4A 2QF7A 1PRTB 2HDLA 2EVBA 3TP7A 2WXPA 1RDPD 3VA7A 4BS9A 1PTOC 2IGDA 2ON8A 3VYTA 3GTGB 1EM7A 3PO3B 5ELDA 3U7ZA 1TQOA 3OSOA 3EROA 5CBEE 2A6ED 4EQPA 4DNTB 4BBRB 1EEFD 1STBA 3C8YA 5JEAH 3DWGC 4CJ2C 3CQZB 3LWEA 2ACZB 3KWLA 4J3OD 1IBXB 4YSZB 2HQEA 1ZXTA 3PUXA 5JJZA 4MH8A 3VRAB 2JEBI 1IUEA 5M3FB 2J42A 1HHVA 4IALA 4KJNA 3MJ5A 4C3JG 2MHVA 4AYBB 5E4XA 3W5UB 1FRDA 3J80L 1Z6HA 1HTPA 2BE5D 4K8IA 4P16A 4YT0B 4MT5A 1WSPA 1QQRA 1FM0D 4FXKC 4KGTA 4WRDA 2N88A 4H44C 4ZYSA 1HTLD 2B2YA 3FPUB 1A3TA 1RCVD 1DZ1A 1B9MA 1ZP0B 3RFZB 1Q1EA 4Y7NB 2PZUA 2ONQA 1RTOA 2RVLA 3Q8CA 4NMZA 5EPLA 3H3VC 2KQ4X 5E1FA 1B9RA 5T8IA 4F88A 1V1PA 1A3UA 2KJXA 4IZ8A 3VR3A 3P1MA 1SNCA 3J7YW 2V3PA 2RDHA 3H8HA 3HVDA 4L23A 4IKGA 1JROA 5D3DA 2DLBA 4CKEA 2CJOA 4YWGG 1G91A 3EVQA 3SDZA 1E0ZA 1STYA 4ZRZA 1TJEA 1SF0A 1JCKB 1OFFA 3IAYA 1EEID 3DMUA 1EWHA 2INPE 2CJNA 2D5DA 1X3PA 4KKSA 4V0BA 2XNAC 1GXDC 1I7HA 2K6AA 4ZRPA 1V43A 4PNYA 3A54A 1DCZA 3MTSA 1BQQT 4N9TA 4D2KA 2MP1A 4EE2A 2F0HA 4BY1B 2EYLA 1A70A 2K5WA 4HN7A 2PLPA 4K5WA 4N9PA 4RGTA 2K3UA 3U2SC 2H89B 4FF2A 3AE8B 2V3NA 4RKLA 4TMAB 3AE5B 4AS1A 5IOCA 2PVOD 1E2VA 1I6VC 2VZKD 3P4SB 5J39A 1PZJD 1F77A 2SNMA 5D3IB 2WP8J 1IGCA 3EJIA 5IGEA 1TZOA 2WDRB 3QB3A 2NVYB 4Q5VA 4WAFA 2G1EA 1C79A 2IX0A 4YTMB 3WOEA 1ESFA 3I4NB 1EIGA 5C2TB 1H9MA 4XXEA 1ENAA 1HA6A 5A2QE 3BK2A 3AE3B 4GZYC 3PZ7A 1IYVA 1HA5A 2ICEC 1MD2D 1Q8IA 2WXQA 1EY7A 2OF1A 3IT6B 1J7CA 1ZDXA 1A15A 1N5XA 1WGKA 1K52A 5HHDG 1CA6A 4LLGM 3NE5B 1E2ZA 4IUUA 1O7YA 3T3NA 4OZAA 4R9WA 1S5FD 4HEDA 1ENFA 1PRTD 5I9PA 1DD2A 3LX0A 1HFGA 2F0KA 2WV6D 1S4ZA 5BMGA 2PVGC 1KDAA 3TZUA 1YJIA 3PIO3 2Q5WD 1H9JA 4ARIA 3PUZA 5AUKA 2F0UA 4IN3A 1NEKB 3IAS1 4RAUC 3A55A 2FINB 2FHTA 2BA1A 3UI2A 3AMZA 3MXNA 1FXAA 5NUCA 4EVOA 1CK1A 4ZOHC 3GS2A 1NAPA 1WD1A 5C4HA 2NN6G 3SXHA 1G8ZD 1ZPSA 2D9UA 1WWTA 5JOBA 1JORA 2AQ2B 3MHZA 2A6EC 2DYOA 2NTSA 4KTAA 3GTPB 3OPOA 2XWJB 4KV6A 1DOLA 2E2JB 2M0AA 2JXMB 1IKMA 5C6AA 2DBYA 2F0FA 2R93B 3NUHB 4XWWA 4RNAA 1HXYD 3AEBB 2C5CA 5M5WB 4XYQA 2RBMA 3WCQA 4JBWA 2CW0D 3NBHA 1GUNA 1O7LA 4OL7A 2BE5C 1H9SA 2NVXB 1Y1VB 2M00A 3TP5A 3AECB 2A5HA 1F9PA 1YNTE 5IIFA 2D2CC 1J7AA 2RSNA 4HMIA 3MVVA 3OWFA 2WXFA 2EXZA 1QCBD 4C3IB 3FVQA 3I70A 2KECA 2LS01 2L1BA 2HTME 1Z7TA 4K5VA 3X3MA 5I6YA 1N5WA 1A6XA 4DNRB 1SNDA 3G6JB 1I4GA 2DYMA 2NZ1D 3GV3A 1SIJA 2L11A 2K01A 1FD6A 1D1KA 4OIKA 2L32A 4YTPB 3D8GA 2NN6H 4KY7A 1RM6C 2SDFA 2BB6A 1LTRD 3ABVB 4REZA 3Q6SA 3WOFA 1BDOA 2EJGC 1KNAA 4IDIA 4IFDG 4IUNA 4KY6A 1O80A 2PCFB 3CKIB 3KUPA 1F2MA 4ZRQA 1LT3D 2KDMA 3AB9A 5I4DA 1UWMA 4XQQA 2E2IB 2EY5A 1ET9A 4HJGE 3S17B 4IFDJ 3VYUA 3B2GA 5D14A 5IGBA 2MUYA 4FVMA 1JWBD 2QMTA 3RD4A 3FILA 1LV9A 3U9SA 3P4RB 3L7ZC 3KF8A 5EE3A 3AN1A 1JWAD 1B50A 5IT9L 2JZPA 3AE2B 4HKQA 4RKBA 1AZQA 2KHSA 4X3TA 4WFN3 1OXTA 5ELCA 4KK7A 1DOYA 4HRSA 1XLOA 2YEPF 2XVSA 2CVRA 3GTOB 1V1OA 1M8AA 2L4NA 1JQ4A 4H13C 1QOHA 1EU4A 4XQNA 3ZJVA 2XN9C 2PYKA 2B2WA 3HP3A 3P20A 3AU7A 2KWDA 1KLUD 2KEEA 4TRDA 3FKIB 4V190 3K5LA 1IW7C 3IKJA 4RHSA 5G3LD 4C3HG 2E75C 1Y1WB 3V3XA 4ZQ3A 3RPFC 4A3KB 3H09A 1SBBB 2CU3A 4IFDH 2B2TC 1CTMA 1D5MC 4L8JA 3H6MA 1OXVA 4C2MB 2KQ3A 4BY7B 1LT4D 1GB1A 4HTHA 1XWEA 4PMBA 4RFBA 5CC4A 2IGHA 4N59A 1ILQA 1PRTC 2BTEA 2IWHA 3AEDB 4XIGS 1QOFA 2F0TA 3AMUA 3I4LA 1R7SA 3ZGZA 3RZDB 2YEPB 5C5LA 3RZOB 1QILA 1AYFA 1AFPA 4JE3B 2F1MA 2JSOA 4ZLTF 3ZQ4A 1TS2A 4K2KA 1E2WA 2BDNA 2JA8B 2R3ZA 2JXTA 4N58A 3T3OA 3P4QB 4R8NA 1DOIA 4FXDA 2E2DC 5FO9B 1RWSA 1BBXC 1I3QB 2DN8A 1U4RA 3GTJB