1EU4A

Crystal structure of the superantigen spe-h (zinc bound) from streptococcus pyogenes
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
204
structure length
204
Chain Sequence
NSYNTTNRHNLESLYKHDSNLIEADSIKNSPDIVTSHMLKYSVKDKNLSVFFEKDWISQEFKDKEVDIYALSAQEVCECPGKRYEAFGGITLTNSEKKEIKVPVNVWDKSKQQPPMFITVNKPKVTAQEVDIKVRKLLIKKYDIYNNREQKYSKGTVTLDLNSGKDIVFDLYYFGNGDFNSMLKIYSNNERIDSTQFHVDVSIS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords SUPERANTIGEN SPE-H
publication title Conservation and variation in superantigen structure and activity highlighted by the three-dimensional structures of two new superantigens from Streptococcus pyogenes.
pubmed doi rcsb
source organism Streptococcus pyogenes
total genus 60
structure length 204
sequence length 204
ec nomenclature
pdb deposition date 2000-04-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01123 Stap_Strp_toxin Staphylococcal/Streptococcal toxin, OB-fold domain
A PF02876 Stap_Strp_tox_C Staphylococcal/Streptococcal toxin, beta-grasp domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.110 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1eu4A02
3.10.20.120 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1eu4A01
5TSSA 1XTCD 1LTRD 1JQYD 1S5BD 4RH6A 3R8BA 1QILA 1PZID 5ELCA 1BCPB 4RGNA 1GOZA 1SE2A 1ET6A 3BVGA 4L63B 1LT5D 2WV6D 3URYA 4RGOS 3V05A 5D3IB 1PRTB 2AQ3B 3CHBD 2RDGA 1EEID 3O13A 1S5CD 3KLSX 1AW7A 1I4GA 2IPKD 4K6LA 1D5ZC 1JWUD 1STEA 2AQ2B 2NTSA 1SJHD 4C56C 1ENFA 1LTGD 1TS3A 2QEJC 2G9HD 3BYTB 1LT6D 1SJED 5ELEA 3BYYB 1FNWA 2O2LD 5FK9C 1I4XA 1TS5A 1CHQD 4BWGB 1JCKB 2RDHA 4RHSA 5I4DA 1F77A 1I4PA 1B44D 4ZYSA 2Z8LA 1PZJD 2IJ0A 1SBBB 3EFXD 1EEFD 1D5MC 2R61A 1JWSD 3MC0B 1EWCA 1TY2A 3MFGA 1I4RA 1HQRD 2XNAC 4Z9CB 4O1NA 1UUPA 5FKAC 1UNSA 2J4XA 1G8ZD 1PTOD 4UDUC 1KLGD 4RGTA 1FD7D 1FGBD 1RF2D 1XXGA 2AQ1B 3DWPA 2CHBD 1S5DD 4NZLB 1EU3A 1TS4A 3R2IA 4RFBA 1SE3A 1L0XB 1LTBD 1V1PB 1SE4A 2XRSD 4L6TB 1TY0A 3TSSA 1DJRD 1LTID 1PYWD 1AN8A 1L0YB 4RGMA 3W2DA 1EFID 1S5FD 1BCPC 1KLUD 1D6EC 1LO5D 1RD9D 1S5ED 1LT4D 1MD2D 3GP7A 1PTOC 3BVMA 1BCPD 1I4HA 2NTTA 1CT1D 1CHPD 1PRTC 1PZKD 1B1ZA 1JR0D 1BCPF 1I4QA 1FNUA 3BVZA 3R2TA 1SXTA 1D5XC 2ICIA 4RCOA 1TS2A 1PTOF 1PRTD 1PTOH 4OHJA 1HXYD 4DXFA 1LLRD 1ESFA 1HA5A 2TSSA 2XN9C 1V1PA 1CK1A 1PRTF 3SEBA 1LTTD 1YN5A 1LTSD 1JWMD 1YN4A 1CQVA 1T5XD 2QILA 1PTOB 4RHRA 1SEBD 4TSSA 3DWQA 5ELBA 2SEBD 1RCVD 1DYQA 3EA6A 5ELFA 1YN3A 1M4VA 5D3DA 3OWEB 1KTKA 1FNVA 3DWAA 1EU4A 5ELDA 1RDPD 1V1OA 1LT3D 2XRQD 1BXTA 1LTAD 4DXGA 3BZDB 1HTLD 1ET9A
chains in the Genus database with same CATH superfamily
2F0PA 2KHJA 1BDOA 3IFWB 2B2WA 4L5QA 2VB3X 5M5YH 4II2B 1YBYA 3QOLA 2KVZA 3KF8B 2KWVB 3NP8A 5AZFA 1ET6A 3NENA 4BOZB 1QVFA 2K6DB 5CHFA 1MSHA 3D6WA 1PDQA 2CR5A 1MKHA 3J80E 1QB5D 3UE0A 2NBWB 5BYRA 1FRRA 2EJFC 1JOOA 2N0SB 1IBXB 3CSFA 2MBHA 4R4IA 1EYDA 2CQOA 3T53B 3UDIA 4U673 5C3EB 3OTOQ 2EYMA 1PFDA 3LWEA 2KHWB 3PZDA 3TZUA 2N7JA 2HTME 2DHZA 3J80i 1AE2A 4L5RC 3KJOA 4DN4M 4BKTA 3QO2A 4YCUA 3QARA 3L0OA 1WXVA 3OYYA 5FO9B 4K3BA 3H0GH 4JBMA 2CVRA 2O2LD 4JPBW 1HZCA 1B9NA 2XGTA 4JI5L 4HIOA 4QAYA 2KWUB 3CCEA 2FIFA 3NELA 2LY7A 4X57B 3L4PA 3CCLA 1AWDA 4DK3C 1JMCA 2KAJA 3ZQ4A 1FR3A 2GRIA 3NJTA 4JI1Q 2OEOA 4OO1I 4KY5A 4JI7L 2SAKA 1F2ZA 1I50B 2ACZB 4K7UA 2KK8A 1B7YB 1XYIA 2CU1A 2K39A 4UP7A 4C3HG 3J80c 4UDUC 3IBEA 1E8YA 2XVSA 4II3B 4EUTA 1CQFA 4X3SA 2I5LX 4A3MH 1L6UA 1S4ZA 4MHEA 2EYJA 2EXZA 2WYQA 1IKMA 3T3OA 3L16A 3RNFC 4C3JB 1C79A 1HEZE 1L0XB 2BVCA 3H9DA 3GTQH 2F0LA 3A5UA 2ZTCA 2OEDA 2KANA 1HZ6A 5HFYA 2OQKA 5A2QE 1DJRD 4P73A 2J42A 3DOWA 2K5PA 1ZPSA 4GNXB 1EZ8A 4A3IH 1WFYA 1KAWA 1HE8A 3IXSA 4JWUC 4OXPA 2F0OA 1IBKQ 1GXDC 4QUCA 1YJIA 5IWAL 3PV1A 1UD7A 1TKEA 4JI0L 1WJNA 3SK4A 4AQYL 1CHPD 5LLIA 3NQIA 1Z5SB 3BU2A 2GLSA 4RCOA 1EY8A 4KDIC 1II3A 3CRKC 1HR0Q 1PRTD 5HURA 4KZCA 4L8JA 3I56A 4K6DA 2M9VA 5CV6A 4KGSA 3W3AA 1N34L 3PRMB 3KQ4A 2OCEA 3B2FA 1UWVA 5E6OA 4EKUA 4QF4A 5C3EH 1FD6A 5BYSA 4DR7L 1FVIA 3HUIA 4KKUA 2WDRB 3KFUA 1Q7YC 1EWYC 1YJJA 3CC2A 3S1MB 4WH4A 1V86A 4P2CB 1BNZA 3JYUA 3RNCC 3OAWA 1N9WA 2KJXA 2X6LA 2WNMA 2JA6B 3GOEA 4MGYE 5ELDA 1WJ6A 4S3SA 1WH3A 3Q23A 2AEHA 5AJ3Q 2VQEQ 3R66C 3F2CA 4C4VA 2JXTA 3UINB 5JHAA 1HTLD 1VQ4A 4JV5L 4ZRIA 1XEEA 2JN4A 4ZQ3A 5KYLA 2IZVB 4H2AA 1JQYD 4RH6A 1AH9A 2WXHA 5DEHA 3WALA 4B6WA 2FJ2A 3S1RB 4RMFA 4LAAA 4DR4L 2PZTA 4XDXA 2MW5A 2EZVA 3QJYA 4GLVB 2JA8B 4PT5A 3WAOA 2RPQA 1SYFA 4X62L 4BBSB 4GN1A 2EOTA 2I38A 2M1MA 1XWEA 1WJUA 2ZNVC 1EOTA 2KECA 5IYDH 4PZ7A 4F7ZA 4M0WA 4FO2A 1YX5B 3CQZB 2BB6A 4HDOA 1X56A 1QOHA 4OWWB 4JW0A 1NYRA 1F9RA 4QJFA 2I46A 3EROA 4DK5A 3M4OB 1F9PA 2B8GA 3HKZB 3U4ZA 5K5PA 2BTEA 3A8JE 2GOWA 4CHTB 4ZAIA 4A3DB 1QOFA 1WIAA 4HIMA 4KY7A 4E74A 5GAHC 4MH0E 4X65L 4POGA 3MHBA 3IAM1 4FXCA 1HR0W 3L13A 1XD3B 3K0YA 4DV5L 3VRAB 1D5MC 4I6LB 1EF1A 2KZRA 1WD1A 5CGKA 4GOPC 3BY4B 3ZNID 1NBWA 1PHJA 4RAUC 1HZ5A 1MVKA 1JQ4A 4JC0A 2L9HA 2MSED 2K04A 4HTHA 4ZHPA 3M3JA 2NPTB 4MDKE 2K28A 1UEBA 4USAA 1FD7D 2V3PA 4CKBA 5CHWA 2Q8TA 1XO3A 1HNZL 2VUMG 3KF6A 3S1MH 3CRLC 4DKAC 4H0LC 3F2BA 2PIAA 2UYZB 3PUXA 4P75A 2KXJA 2L0FA 3M4PA 3AQQA 2JA6H 2LFIA 4A3FH 3AEAB 4BZAA 2NVQB 4TKNA 1GB1A 1VR9A 1C1YB 3N9YC 3RD2A 4YTPB 3AE8B 4HJAA 4Y7NB 5LHY1 4N8X1 4DR1L 1HPCA 4WJ3M 1ONLA 3L7ZC 2KLCA 2JEBI 5C44G 3ZJTA 3W9CB 2KTRB 3K9PB 5DPWA 4A3GB 2K14A 1PFBA 2JA7B 1AP0A 3AU4A 3EN2A 3RLNA 3GTMB 3HRZC 3Q24A 2E2DC 2K05A 2K1FA 1SXTA 3C2PA 5CV5A 2PI2A 1X1MA 1WCMG 4HRSA 3QR8A 3S1RH 3EGRA 3I5JC 3D8GA 3RCZA 2OXPA 2FUG1 2JA8H 2LZ6A 1VQLA 3GTOH 4DXFA 3MEFA 4G0NB 2TSSA 1YN5A 1BBXC 3NVYA 3ZIMA 2K3UA 4TMAB 1BT0A 2KTFA 2WP9B 4GGQA 1KNAA 1CZWA 1JE4A 1TT5B 3J7AV 1OO9B 4RWSC 2R3ZA 1D4BA 4C3HB 5D14A 4HCEA 3ZRFA 2JYTA 5JVG3 1I94L 2HT1A 4UP8A 4XQQA 3M4OH 4BBRG 3MHZA 3WWVA 4YL8A 4KKIA 1Y14B 4REZA 4GKJL 4A3DH 1LTAD 1NNXA 3W1GA 3BZDB 2DYMA 4BFRA 2NB0A 1ILPA 2J7QB 2M00A 3ECIA 2GBMA 1QG7A 3PIPA 1ZDVA 2OHFA 1TWFB 2HDEA 4LNNA 2PQAA 3DHIC 4OX9L 5FO7B 2EY6A 2LASA 5C0XH 1WXAA 2KFKA 4ANXA 4POFA 4H02A 4FNFA 4J8QA 1G291 2NVXB 4XYCA 2ON8A 4X66L 2QCPX 3W5UB 1XCQL 3DHQA 4ZUJA 1CKNA 1NJIC 2VH2A 1SGHA 2K8CA 4JGHB 4P7IA 3V61A 3WAMA 1PFNA 5M3MH 4W9JA 1HTPA 4KK7A 1NUCA 2QEJC 1XMOQ 2Y3AA 2PNHA 4JBKA 4HMJA 4GDLA 2NVQH 3DVNU 4LJZC 1MHXA 4K2LA 4HXDA 2A4ZA 2ZXRA 3J80L 1CZPA 1RLFA 2JA5G 4KTAA 4IPHA 4A3GH 3J9CA 1F77A 2JXXA 2EDGA 1QKZA 2KVMA 1SNPA 2JA7H 1PZJD 3GTMH 1BUVT 1EEFD 1EIGA 2RVLA 4BY7G 1GC6A 3O65B 1JWSD 2J0MA 1R7SA 3HVDA 5DPSA 4JYAQ 3IFDA 4Z9CB 1QZHA 2B63G 1F2LA 4A3JG 5AFWA 1Y1WB 2UUCQ 3IL8A 4DUZL 2QDFA 3AE3B 3FKYA 5FR6A 1T9HA 3OWFA 2JRHA 2KQ4X 5T1IA 1WSPA 3I3TB 1I5FA 3TQYA 4CJ0B 1DCZA 1X32A 5T1GA 1SFOB 2WXRA 1R9TH 4LJPB 1TKWB 4OIJA 2ONQA 4OWTB 3S16H 4MZ9A 4DV2Q 2Y0SE 4JE3B 4MTKA 4OIKA 3W2DA 2XTIA 2L3ZA 3HGBA 1PYSB 1ZGUB 2KA7A 3AYHB 2NYZD 1E9MA 1YJ1A 2KC2A 4MGKE 3DM1A 3RN9C 3I3CA 4A3PA 1LT4D 2EPBA 2R92G 3VR9B 2AUKA 5I6YA 5IE8A 4DR5L 3Q3JA 4LJOB 3VHTC 2UXCQ 3IAS1 4UAIA 1Y8OB 3IAYA 2NWGA 1I42A 4FN2A 3FKIG 2GVAA 1JR0D 1BCPF 1VCIA 2SOBA 4R8NA 3TREA 1WX8A 2N9XA 4LDTB 4C4VB 1UEAB 1VQHA 2JQRB 4HMIA 5A2QL 3CC4A 1PTOH 4OVVA 1QJOA 2Q2IA 2NVXH 1IYVA 2R2OA 4WURA 3NTKA 3WOEA 4D2KA 2KHIA 2L15A 1TT2A 1SN8A 5BN5A 1OQQA 4B0EA 4HJ5A 1JALA 4URKA 2QILA 2HJ8A 4NKLA 1EYGA 3H7SA 3LXFA 3W1SA 1D3ZA 3W1BA 2WU2B 1E7ZA 1RCVD 5LXHA 1E1OA 2LUMA 2IDYA 4HJGE 4WJOA 3JAME 2UWQA 2WAQB 2CWPA 2KWDA 1EU4A 1IUEA 1K83B 2WU5B 2VL6A 1IL2A 3ZDMC 4DDID 2UUAL 1JJCB 2Z6KA 2VUMB 1HNXQ 3KH0A 4NQLB 1ASZA 3CCSA 4JI2Q 2E2JH 4WWNA 3JAMi 2K9XA 3U7ZA 1LV9A 3SDLC 1XTCD 3ZNZB 3QG1A 2JE6I 3V2TA 2J0KA 1KXLA 1WD0A 4AYBG 1LGRA 4A3CH 1U4RA 4WFN3 2Z0EB 4ID6A 2WFWA 2KCNA 1VZ8A 4BKSA 4LF5L 5C44B 2QIEB 5JJKA 1TWGB 1B9RA 1Y1WH 2F0MA 3PPAA 1SE8A 1HZBA 1STGA 3W5OA 2W55A 2PW7A 3QA8A 4HWIB 3BJUA 1DM0B 2Y5BB 2R7ZG 1EY6A 1KF6B 2UUBQ 3ALBA 1SFOH 2QJLA 1WTXA 4GNXC 1ZKOA 2W82A 4X64Q 1TIFA 2BE5D 2DENB 3VYSA 4LUZA 2LVPA 3U50C 2N9KA 5EGTA 4G11A 1R4QB 3OJ3A 3JAMc 3NK9A 2CH4W 3T1HL 2O4XA 5ELEA 4A4IA 1IBML 3SK8A 2VS1A 1NYQA 4NDXA 1FNWA 3KF6B 4OELB 1Q82C 1WX9A 4K1RB 5IGBA 1VQ8A 5C4JB 1STAA 2N78A 5GMVA 3TZDA 1C4AA 2N1VA 2Z8LA 1SMXA 3ZLZA 3L10B 5J18A 4PYUA 4XX5A 1VDZA 1ISNA 5KHQA 2KKCA 3ER0A 1YD8U 2JSOA 2I0QA 1K51A 2D2QA 3CP0A 3FILA 3M95A 1CUKA 2WIIB 2YEPF 1LABA 1N63A 4GDKB 3NS8A 2MJEA 4WJQA 1O78A 3KLSA 4YWKA 2JP1A 3AFPA 2M8SA 1IXRA 2CHBD 3OIQA 2LWPA 4WJNA 5C5MA 1EU3A 2VZKD 4IG7B 3U58A 3TN2A 4DR2L 3HOYG 1X65A 4L6TB 1ACCA 3H7PA 1TY0A 2F0TA 1K83H 4MIUA 4Q2JA 4WWMA 5CORA 3RUZA 3L2PA 1ZXHA 5D6JB 3DHHC 4XIGS 4DHZB 2J7ZA 2MP2A 1CA6A 4PV1C 1KLUD 3G7LA 1JMLA 3H1UA 3MC8A 4GKKQ 1K8OA 1L1OA 2F0QA 2HUGA 1MI0A 4LF6L 1YQBA 2B8FA 1HTOA 2JRIB 4HK2A 3GTKB 4WIPA 2X8XX 2A6EC 1VQPA 3QC8B 4HPLB 1A5RA 5C44H 4IW0A 1A63A 2GMIC 4ARIA 2FCSA 4A75A 4TQ1A 5C4XG 2Q2TA 4AJYB 5BMIA 3X0WA 3DXJC 3SDZA 1VQKA 2VY3A 2XBBC 3GTLH 4IUNA 3SEBA 1EY5A 5AUIA 4A3EG 2VB2X 1WYDA 1TWHH 2PQAB 1TKGA 1UZXB 2Z4IA 1S1QB 3N1YC 4LK0M 1IP9A 4DV4Q 4BY7B 2WKCA 2F0UA 1L0VB 3RYTA 1FMAD 3HOZG 3QIJA 3BIID 2FFKB 1H9SA 2WGSA 3VUWA 3VR2A 4C3IG 3VUXA 1PH9A 1V1QA 3IHPC 2RQXA 3CAMA 4PG3A 4LNIA 3N6RA 1F9QA 1SNDA 3A4RA 2UXBL 4S0RA 1LQBA 4PYZA 1CKNB 2OF1A 2KN4A 4C7ZA 3I4MB 4Q5VA 2XRQD 1ZXTA 3PO2B 2WXGA 3NQTA 4TVAB 4KHPL 1XPOA 2ZJQA 1VQOA 2LD9A 2FCMA 3A9JA 4B3RQ 5C4JH 3RMHA 4IJHA 1KFYB 2N9EB 1IYFA 2LSSA 1P3QU 5JVH3 2O6VD 3TBLD 4FF4A 4FXKC 4GDLB 1Q81C 1L7YA 4FYDA 1PZID 4A3BG 2CH4A 3CC7A 4HKZE 3A0JA 3S2DB 5HG2A 4KLKA 2F0VA 1SAPA 4ULLA 2R92B 2JA9A 2CKHB 2WV6D 4M8NA 3EVQA 4K81A 1SYCA 3DVGX 2RDGA 2K33A 4NAMA 1LTLA 2M19A 4HIDA 2AQ2B 2I1KA 3HOXG 2MQJA 2MWSB 5EE9A 4ALPA 3JSVA 3PT2B 2LJIA 2EXDA 1Y1VB 3NOBA 2BYTA 3PIOA 3DBLB 1HQMC 2I5HA 3P4RB 5G5GA 5C3XA 3VA7A 3PUYA 2MJ3A 3T8MA 1EUVB 4GXBA 2B2WC 4ZYSA 4IO9A 2IHEA 3STBC 2C7NB 3GTKH 3ETRA 1SBBB 4YSXB 4IWQA 1U4PA 1A0IA 3CCUA 3NZUA 1MJCA 3VR3A 1TY2A 4J6IA 1XT9B 1I4RA 2Y5PA 4X3TA 2ID0A 1RFKA 4JPSA 2L52A 5IP7G 3HOVB 1KLGD 1K0SA 1JICA 3Q14C 4KX6B 2PE6B 5DPRA 1K0RA 3KBXA 1TTNA 1ZOYB 1J0GA 3ZW3A 3UE1A 1KJTA 4IQZA 1GC7A 1IW7C 2BGFA 4E3CA 1STHA 4CKEA 1KC8C 3MP9A 1YIWA 2WB1G 1B70B 4QL5A 2HJ1A 1JORA 3RZWC 5FR3A 3TSSA 4YWMA 3I4MH 2N7EA 3PO2H 2PKOA 1HFGA 2MHJA 3RZOB 3NPPA 3AEFB 5T8IA 1IPGA 5EJWA 3ENEA 3NHEB 1FCCC 4LWCA 4UY8C 1LM0A 3R7QA 3HFZB 1C9OA 5JPNC 1PTOC 1U0LA 4ZRKA 5IGGA 2NS5A 3B9JA 3AV8A 4XT3B 3CMEA 5M3FB 4DV1L 1QNKA 3RZDH 3KWLA 4LTUA 2B3GA 3JW0X 1BMLC 1DOYA 5IGDA 1MIUA 4K2KA 3V6CB 1DOXA 1T0SC 1D5XC 5I2YA 2KCMA 3LJ3A 2G4SA 1P98A 3UIPB 2DNFA 3V3XA 2HCIA 2BWFA 3ND8A 4PS8A 3MXUA 2HHHQ 4GU2A 3FMCA 3SD5A 3D4WA 5DLQE 3V96A 5EPJA 1WGHA 1XNRL 1L2FA 2AWOA 1EY0A 4NP5A 4C1NK 1RL2A 1Z6HA 4DR6L 3NSWA 3KUZA 5IP9G 3GE3C 1A2TA 5DNFA 1Y1VH 3VA5A 2GBRA 3ZGZA 5JHBA 4BVUC 1VQDA 1X3FA 3HOUG 2LGSA 4MH8A 4DUYQ 3MA2B 3D32A 4ZKBB 3AULA 3E0JA 5KHOA 4B3ML 2M56B 3Q3MC 1JRPA 1Q1OA 2G1EA 4HKQA 2FUHB 2WXFA 5J3BA 3HOYB 4JI3Q 1VQJA 1VZ7A 2B2YC 5C23A 1N36L 4LFCQ 1VQ7A 1E2ZA 2LXCA 3RNEC 1IHZA 3DBHI 1I6VC 3JAML 3X3MA 3VYTA 4HEDA 3AU7A 1PFSA 1F9JA 1EY9A 3U9OA 3AMZA 3HOVH 1TZ1A 2WXJA 3DCGA 4DAYA 1W6KA 4OL7A 1HUNA 1TQOA 1ZDXA 3FILB 3D31A 2DNCA 2TMPA 4IUPA 1VQFA 2HDLA 1D5ZC 4BXXG 1JWUD 1IGDA 2BKFA 2D3CA 2DAJA 2BCOA 3P1HA 2WLBA 2KYWA 5C0XJ 1HH2P 4KV6A 1KM7A 2L05A 3BYYB 3RZOH 1GUAB 1CSQA 2JYEA 3OMCA 1R4MI 3KDFA 3AE7B 3TEHB 3U8ZA 4C3IB 2R93G 3NS1A 3CCRA 1N6ZA 3TP7A 3D6CA 4B3TL 2K52A 5M3FH 2I07B 3HOWH 1YJNA 4ANUA 2BPSA 4K7WA 5E6NA 3TEXA 2MP2B 2K03A 2B2TA 4AP4C 4ZCKA 3SVMA 1HQRD 4WJWA 4OVUA 4N9TA 4YSYB 1L1OB 4K0KL 5IO9A 4IPDA 2KN5A 1MI2A 5LMNL 5FLMG 4C7YA 1ENCA 4A3BB 2FBWB 3ML8A 1E0ZA 4BOSC 3TS2A 2NVYB 1YNJC 2A6HC 2IW3A 4NAWA 4IKGA 3EQLC 4V190 3QWZB 1ICFB 3I73A 1D7QA 1C4CA 2K50A 2WAQE 3OW7A 3T16A 2A74C 1K8AC 3LX0A 2ZJRA 1XMQQ 2JEAI 1QE6A 1LO5D 1H9SB 3TP8A 2B2UA 3HOXB 1RYJA 2VH1A 4ANWA 4C00A 4R4QA 2LMCA 5GAGC 4YT0B 1WTPA 2WXLA 4G7ZC 3HHMA 3R3MA 4ZRQA 2EY1A 4FULA 5JEAG 4NY0A 4L5TA 4HAEA 2MEKA 1PZKD 1YZ6A 2OWOA 3KBGA 4I6NB 1BBWA 2CW0C 1YX6B 3L54A 3OLMD 1N33L 4K5XA 3EC8A 4CQNA 1XLOA 2LXJA 4QY7A 1YJWA 3Q3FA 3U7DA 4QUFA 1Q1EA 1AEXA 1CK1A 4LF5Q 2LGDA 2D11A 3V60A 5EPLA 1YITA 2GN5A 3KOJA 3CSTA 3DBRI 1XPRA 2BOSA 2BA1A 4R4OA 3K58A 3VH4B 4P16A 3S2HB 1Q86C 1SLJA 1M4VA 5IOCA 2ZCBA 2L12A 1UF0A 4DR3Q 3IRBA 2E3TA 3RMKC 3S24A 3UQBA 4OWXB 2V1YA 3V6EB 1TYGB 2L1AA 3U2SC 2F1MA 3TMEA 3U4VA 4FXDA 1I35A 2WB1B 4GIVA 4DV6Q 1PH7A 1VRAB 5C1ZA 3R8BA 3J81E 4P72A 5H1SE 1GG3A 1TJEA 5EQ0A 1Y8PB 3CU7A 1WRDB 5EBDA 3ZKJC 3ZNHB 1TU2B 2Q8IB 1WYWB 4MSMB 3C19A 4IDIA 4NXML 2INNE 3QAQA 3J81i 1PRTB 3UDXA 2BF8B 5GADC 5IP4D 1A15A 2NVYH 1P8LA 2CFMA 3W5VB 2A1AA 1NEKB 1SYGA 2EKEC 1E90A 1WGRA 2KJRA 2PI2E 3FPUB 2MO0A 4R4CA 2VRRB 2K7VA 4KMUC 2F3VA 4AJWA 3VDZA 3HS0C 2KDMA 4M1UB 2IO0B 1K28A 4LUOA 3MVVA 4DHZE 1WJJA 3HOXH 1N32L 2L5TA 4CBVA 3MXGA 2ICEC 2MGSA 3T1YQ 2IX0A 1VZ6A 4LF8Q 3P20A 1B44D 1I50H 2WDVB 1NMFA 3T4AC 2ATWA 1EQTA 5CMDA 3HOUB 3J81c 2R61A 2YLMA 1T5EA 4J6HA 4DPGA 4IOIE 4DK6C 3RZFA 2A5UA 4X3UA 1J5EQ 1E5WA 1XLQA 4RG1A 5E4WC 3ZUNA 5D94A 3B1LX 1JWBD 1C0AA 3HRDD 4C3JH 5J2RA 4JI6L 4JIOU 2CS4A 4M02A 4GLSC 2PMVA 3DWPA 4K8IA 4FP5D 2KMCA 1HCZA 4YHHL 5BMHA 3WOFA 1V5TA 1WGKA 1KDBA 4XE0A 4B3SL 3S2HH 5CTRC 1E10A 4LNFA 2KD0A 2F0KA 1P0RA 2FMCA 1LTID 4YY3L 2YV5A 2I2YA 3NWTA 3MTSA 1V43A 5D7GA 4F8MA 3D0FA 2ZXOA 1WE6A 2JY6A 1L4DB 1GJZA 2QDLA 2PEAA 1M8AA 4FDBA 3ZO5B 4L1BA 4LK1C 4S17A 2QKIC 2M17A 5EE1A 1VQGA 1F9SA 4BBNC 4IUQA 1MGSA 1Q10A 1P7EA 4JI4L 2F4VL 3PF4A 1B8AA 1ESRA 2ICIA 2INCC 4R8IA 2CU3A 2ENBA 4LFBQ 2PZWA 3QK0A 1SROA 1B4OA 3I2ZA 2UU9L 4DF7A 1KIXA 1GNUA 1LLRD 2PVGC 2ZM6L 2RKSA 1X3GA 1RKNA 2A68C 3FP9A 2Q2HA 2XIWA 2VQFL 2AWTA 2KQ3A 2PZUA 1IBLL 3PUWA 1S40A 1U9RA 3P63A 2CQAA 1U4LA 2SEBD 4KD3A 1OFFA 1VQ6A 5ISRA 1YQ3B 3APCA 4DAYB 2L76A 1R4PB 2V4DA 2C35B 2KNBA 2WX0A 2KHSA 5BR8L 3TRZA 2XK5B 5L83A 2L83A 4BY1G 4IFDG 2RPVA 1QOBA 3MXNA 2O5JC 4DNTB 1KQSA 2BH2A 5TSSA 1EIYB 2MCNB 1U5KA 1LTRD 4N8FA 2WS3B 2FAZA 4EFOA 1LACA 4FF2A 4IC7B 2GI9A 2JJQA 3BZCA 3RR5A 1SYBA 1WI5A 1VQ9A 4BBSH 2DAFA 5G5HA 4C80A 3KDFB 2NZHA 2GBKA 1NSNS 2R7FA 4LNOA 1MG8A 1C9FA 1ASYA 4EVOA 3GV6A 2OJWA 3CQZH 1FXAA 4RGOS 3WANA 5LMUQ 3STBD 2CCZA 4DV7L 4WJ4A 5GXGB 2M0XA 4P1BC 1H4RA 4EZKA 3TBIB 3AE1B 3VR6A 1PXUA 1B53A 3A54A 3TEWA 4C2MB 4ZRJA 1V5OA 1LTGD 5ELNA 1O7IA 3VDYA 4BA2I 4UPAA 1YNXA 2IT1A 2L1BA 3MWYW 3FDTA 2A69D 1N8RC 1EY7A 5FK9C 4BXXH 1WMHA 2Q5WD 4GLXA 4LFAL 4NAWB 1TS5A 1CHQD 2Z6KC 4BWGB 4LF4L 3SK6A 1HNWL 3N30A 1IW7D 2I1JA 2L11A 4YCWA 3RN5A 2KX0A 2PW9A 3AEGB 4XC2A 1QVCA 3QHTA 5G55A 4K8JA 4OGQC 4NXNQ 1S3SG 2MJ8A 1DZ1A 2BWES 2MX2A 1E8WA 4DHJB 4DU9A 4OZCA 4JI8Q 1JOQA 1EIFA 1QOAA 1VLBA 5LXIB 1WI0A 2AHOB 4DV0Q 2KENA 3E9IA 3RD4A 2J4XA 4L2YA 1PTOD 1WR6E 1GD7A 3VR5A 1B3AA 2E5LQ 1LM8B 3N1ZC 2F0SA 1GJXA 2D5DA 2PQEA 4IWPA 4EQOA 4TQUS 4CKCA 3PLVA 4GZYC 4Y7NH 5FO8B 1SE3A 5FJ8G 2KLGA 3AECB 1U4MA 2MJDA 4LF9Q 5FLXE 1GUTA 3CKIB 2N9LA 4RGMA 4DV3L 1BOSA 2E76C 1H9MA 4QIWE 4DNRB 2DYBA 2O6VA 4FADA 1L4ZB 4EE2A 3AEBB 3LB8C 5K36G 2LEKA 4ICVA 2K8HA 1BCPD 3GQBA 4K3CA 3WCQA 5CV8A 2F0FA 5GROA 2KEDA 2GA4B 2WXMA 2NN6G 3PQIA 3NRZA 3ULJA 3JC66 1C8CA 3Q8BA 4K5VA 1PTOF 1WFQA 2B76B 1Z47A 5IYBG 3TCAA 1PVOA 3UDFA 1E22A 4GOPA 2BS4B 4RF1A 1P7FA 1LTTD 2DNEA 1Q3LA 3A8KE 1XNQQ 4C3HH 2ZPNA 3GZNB 3NZ3A 3U30A 2AL6A 2PVOD 4EZJA 4RHRA 4W9HA 1YNND 2B2VA 3IG3A 3HG9A 4C2MH 3DWQA 4HCPB 3CIRB 1CSPA 1DYQA 4PMWA 1KRHA 5KNBA 1YN3A 4FLHA 5D3DA 2OTLA 1SMYC 5FLXc 3AFQA 1FRDA 1TWFH 4KD4A 1SNCA 2CHXA 3PGEA 3H3VH 2UXDL 4GN3B 1YOVB 1PGXA 5C0XI 4A3KG 1ET9A 3FC4A 1FJGL 5J39A 1VCBA 4LF7L 5M5WB 2MBOA 1F52A 4LNKA 3CD6A 3U52E 1F2YA 4C1NI 1V9PA 4HCSA 1WY8A 2H88B 4LDTD 3PHXB 2QSDA 1FCLA 5H8YE 5D65A 3NE5B 4I7ZC 3RPFC 4F8CB 3I4NG 5COYA 4KJOA 4X6AH 1E8ZA 1B2TA 2IGDA 3MTNB 3CHBD 2QGQA 1ICWA 2ZZPB 4WQMA 1GUGA 3OTOL 5TR5A 4A3LG 2J52A 1CI3M 3E9HA 1GKHA 3J81L 3SR1A 1ZYRC 2RCFA 3N3KB 3P75A 1SIJA 4M0WB 1NR4A 2IY0B 1C48A 1LT6D 3KUPA 2LI5A 2PJHA 5DPTA 2H5XA 3P4SB 4RMAA 1WTWA 3PREA 4JI5Q 2K5DA 3PO3G 2HIVA 3T3NA 3ZJVA 1C4PA 2F3IA 2BS3B 3RLOA 5C4ZA 3I72A 2E2HB 1I4PA 1NENB 3TDQA 1UWXA 2J0TD 1NVID 2K1BA 1FGUA 4OO1G 1RM6C 2WXOA 2Z59B 4EOYA 4HROA 3BINA 1CKOA 2GBNA 4JI7Q 2Y5CA 3SHLA 5JPMC 1WYGA 3R3OA 4JOIA 4R1JA 4JI1L 2R7DA 5AZGA 1UUPA 1PGAA 4PMBA 4ACFA 2D07B 4IM3A 1WCMB 4W9LA 2WXNA 5EAYA 3OPOA 2Z0SA 2QW7A 5NUCA 1KDCA 4NJ7A 1Z7TA 2RMMA 2CW0D 3SFDB 5BO4B 2QDBA 2IL8A 3ZNGC 2AYOB 1X3PA 2LHDA 4MJSA 3VH3B 3PHWB 5DM73 2Q8RE 3AE5B 4A8XC 2H1EA 4A93G 2KQ7A 2L55A 1YVCA 2K25A 3H3VI 4TV3A 4EGVA 2MLBA 5I9OA 2L0CA 4BBRB 5IWAQ 1L5PA 4R4TA 4HSVA 4B95A 3TMPB 3S15B 4H44C 4JI0Q 1IBKL 4AQYQ 3FRPB 5M5WH 2NBUA 2WB1E 1PRTC 1QLBB 3GB1A 1G2SA 1EQQA 1LFDA 1PA6A 2OT2A 4BS9A 4HPPA 2D0PA 1BVSA 1GB4A 1TS2A 3N20C 3S14B 5JJLA 2Z0DB 3U9SA 3MZ5A 5LMNW 5KNCA 1N34Q 1HR0L 4NB3A 5IGFA 1HA5A 2XN9C 3CF6E 1J9OA 3K80C 1JWMD 2SNMA 4HN7A 2EYLA 4DR7Q 1CMXB 1SIFA 2G45B 2KO3A 4LNQA 3H94A 1V80A 1PH8A 2BYVE 3CF5A 1N5WA 2LUEA 2N3SA 3B2GA 4HIKA 1UBIA 5KNDA 3VQIA 2VUMH 3PSIA 1O7ZA 5CYUA 1SE9A 3H0GG 1A6XA 2G3QB 3ZDTA 2VZKB 2AWNA 3S1QB 1A3UA 3K0XA 2KMMA 3AH7A 4XQNA 3GTJB 2JSVX 1PLFA 2EY5A 5AJ3L 4CDEC 5JAVA 2VQEL 3ULPA 4DXGA 2F0WA 4JV5Q 2C5LC 3IFTA 5L95C 3D3RA 4YCVA 1WTVA 2E2HH 3I9V1 1STYA 2L0TA 4M8MA 1TWGH 3KF8A 2JA5B 4PZ6A 1S5BD 1PYBA 1HFNA 3EFCA 1GHJA 1E2WA 4LUVA 4MTNA 4P74A 4CDCC 4DR4Q 1OEYA 1EYCA 5ELOA 2DJGC 2SDFA 5CBEE 4M01A 1IBXA 4A3MG 4ANVA 1WCMH 4X62Q 2MA9B 1SNMA 2KFKB 3DM3A 3EIVA 1FYCA 2RCNA 3I70A 2B63B 2EJGC 4A3JB 1V97A 1H8CA 4K6LA 2NVUI 1I4GA 2JZ3B 2Y0SG 1QCBD 4QCLA 2F0IA 3I4LA 1JROA 4GN5A 1IKLA 2K5WA 3ICEA 3KYCD 1MHWC 3HKZE 1A8VA 5KGUA 4A3IG 1P1AA 3R7RA 3BDOA 1EO6A 1E8XA 4AIMA 3N32A 2DY7A 3I8ZA 1AFPA 3DBSA 3TP6A 3QCAA 3SFEB 1I4XA 4BBRH 4DNIA 4EQ5A 4QGUA 1VMCA 1EF5A 1Y69U 2MRPA 4X65Q 4NJ6A 2QMTA 1Q1BA 4DV5Q 3P4PB 2HTHA 4JVZA 2NCNA 3Q0AA 3B6YA 1MG4A 2C7HA 1VQEA 2O6VB 2IX1A 3K7AB 4W9GA 4RA8A 3S14H 3FKIB 1PH3A 5E4XA 3K5LA 4G7HC 3Q69A 2REXA 2IY5B 1HHVA 4AOFA 1A2UA 1VDVA 2A5HA 1G6JA 1BO0A 1HNZQ 3ZXVA 4KY6A 1EM7A 2K0PA 4W9IA 1O7LA 2V0GA 1E3PA 1WJ4A 1H9JA 5CR3A 4BA1I 1YNTE 1B3QA 1XCTL 2RDBC 3C8YA 2DN8A 3CWIA 1GPXA 1ZW7A 3CCMA 4O0AA 1SE4A 2XRSD 1I6HB 4GNXA 3S1QH 2EKIA 4R9WA 1W3SA 4DR1Q 1XLNA 2KT7A 4WWOA 3GTJH 2FCQA 2LXAA 2EQSA 2O5IC 5DCNA 4IPCA 2WKDA 1KRTA 3A4SC 4TUUA 2BDNA 4DAPA 1YJ9A 3RUIB 1EZ6A 3BDCA 2JA5H 1QF6A 1I4HA 4RKBA 2NTTA 2ALYB 3VR4A 2D5GA 4I6PA 1JOKA 2GBJA 2QA4A 3DEPA 1GHKA 5E1FA 2DZKA 4WWPA 4AYBB 1WXQA 4BY7H 5FLXL 5C2TB 4OHJA 2OJRA 2UU7A 2MHVA 2F0JA 2INPE 2KVRA 5EDSA 1NTGA 1WRIA 2KDFB 4BBNF 3NUCA 2RSOA 4DQOC 2B63H 4YWLA 2JUOA 3MJWA 1VF7A 4H7BA 5IYDG 4A3JH 1YN4A 3HVZA 3I63C 3AMUA 3C1FA 4H13C 1PQSA 1TWAB 1PMRA 4W9DA 2V4IB 5C3JB 2R7ZB 3H3VC 4KKSA 3VTVA 4W9FA 2WINB 3VAWA 1I94Q 3BWUD 4IURA 1WTRA 1FNVA 3NZSA 3WAPA 3HEJA 2PMZB 4GKJQ 2F0GA 1JB7A 2KC1A 3Q8EA 3W1YA 5MPOA 4IZ8A 4MGIE 4DFAA 2EJMA 1YQ4B 3UQAA 3S2DH 3VR8B 1FXIA 2KX3A 2R92H 2YU9B 4OX9Q 4A93B 1QILA 4YXDB 1VQNA 5CHVC 4MM3A 3K7AH 1D1IA 3AU5A 1KABA 3FKIH 4FF1A 1ZXIA 3PRPB 5CV7A 4FBJB 2BS2B 4WRDA 1DGJA 4X66Q 3NWSA 1UE5A 1E6EB 3PGZA 2DWQA 3NHHA 3PSEB 3V05A 5HHDG 4PZ8A 3AEDB 4IUMB 2BYFA 4XDDA 1GUOA 4E6IA 4FHKA 1QVGA 2IPKD 5KRUA 2NTSA 2NZOA 4A3FG 3PS6A 4L23A 4ZOHC 2MO1A 1TS3A 2G9HD 4JX1C 4MT5A 1I6HH 3K9OB 1K3RA 4UP9A 4JQWC 1XMOL 3CPWA 4M00A 1TGZB 3H91A 2DX5B 1C76A 3KLWA 5HGQA 2RDHA 3J7A5 1VQ5A 5I9PA 3FPPA 4MJSB 4CDFC 3PIP3 3NVZA 5CX3A 2D0OA 4NW2A 3H0GB 3N1XC 2HIXA 4KIKA 4CDDC 1E1TA 3C0RB 2JA8G 2IO2B 2L8JA 4G3XB 2NZ1D 4DUZQ 3UDGA 2VW9A 4JYAL 2HQEA 2ZTEA 3GD7A 3GV3A 3L9AX 3M62B 1WGYA 2UUCL 3H09A 5C4XB 2EYOA 3EJIA 1MJDA 4MACA 5IIFA 2AQ1B 3AN1A 3FHWA 4A3EB 2KQSA 2R7ZH 1E7PB 3HKSA 5GQOA 2HCCA 2IWHA 1C7YA 1A70A 2R2QA 3DHGC 2EYPA 4KJNA 5BMGA 3NTIA 3HOZB 2BT6A 5EE0A 2NBVB 1UE1A 1TKYA 4A3DG 3G6EA 4G50A 3RN2A 2KACA 3ZVVA 4DV2L 3VXWA 2JU6X 3H7PB 2D9UA 4F87A 3VRBB 1FIQA 2ASBA 1RTOA 1N5XA 1RD9D 1S5ED 5KEEA 4DR5Q 2BDOA 1VQIA 2YU9H 3CMAA 2M2LA 4B9WA 1J8CA 2UXCL 5C0XG 3Q8AA 3SXHA 1S3OA 1MFWA 2BKRB 4IUUA 2SNSA 3AB5A 3Q3NC 3M9BA 1J6QA 1WXSA 3OG5A 4MN3A 4K7SA 2XWBB 5CBAE 2EMSA 1RTNA 3K7UC 3SU8X 3C3LA 2FMMA 1T0YA 2JVCA 5E7NA 2AUJD 1LTSD 2QC8A 5M3MG 3DBLI 1I3QB 1WWTA 2QCZA 1A62A 4ASWC 1SEBD 5BN4A 2DZJA 4TSSA 2FHTA 3NBHA 1A3VA 1NCVA 1X9NA 2RF4A 1A3TA 3EA6A 2G4DB 2HD5B 2NBFA 3I4OA 5IT9E 4RF0A 3HOYH 1DOIA 2UUAQ 1G2TA 4WQOB 1YHAA 1XPUA 4KKJA 1TZOA 4U68A 2AX5A 2D10A 4A3GG 5JEAJ 2JA7G 3KUDB 3S2AA 1HNXL 2C9OA 3E6ZX 2LHEA 4JI2L 1ZYRD 5LNK1 3A9JB 2MP1A 1M94A 5DAUA 2WXQA 1EFWA 5JZEB 2I5MX 1NAPA 1QOGA 3J7ZC 2KCTA 3T9LA 2Q2UA 3DWMA 2WACA 1PDXA 2K5NA 3M4YA 3RNUA 1LT5D 2LXKA 1PGBA 5C4XH 4MNOA 5D3IB 3L08A 1FO4A 2BE5C 2W54A 2HE7A 2RSNA 4IUVA 4A3EH 1S5CD 5JXVA 2UUBL 1UELA 1GUNA 3SHQA 4PMCA 4DK0A 3TS0A 1XLPA 4C56C 4X64L 2DYOA 5GAEC 1ENFA 3HOZH 3NTHA 3A9KA 3T1HQ 1QUQA 3IKJA 4C3IH 1SSNA 2V3SA 1IBMQ 3AXCA 5CV9A 1K52A 5IT9c 3JSVB 3P42A 2KOLA 1VMPA 4F88A 3I57A 3H8HA 1W6JA 3S17B 4ZYNA 4RHSA 4HJ9A 2M4NA 2XSCA 2ZXPA 5G3LD 1SDFA 3MFYA 3NBIA 2B3AA 2V4LA 3IT4B 1STNA 5IOIA 3KK7A 4G57A 4A3BH 4IOAA 4JBJA 4JLCA 4XGAB 2B2YA 2G5DA 2VZAA 1NBFC 5EPKA 2KDEB 3PZ8A 4KVGB 1SRUA 3NG0A 3UF8A 1G8ZD 1Q46A 3BK1A 1O80A 4ZHOA 2C7MB 1X55A 4CHKA 1XXGA 1RF2D 5IN7A 4ARCA 1I3QH 3H6NA 3UI2A 4N9F4 2C9WB 1S5DD 1DGSA 3RLFA 2PO4A 3S1NB 5IAAC 3R2IA 3F8TA 4DR2Q 2NUCA 1RHPA 3PRZA 4FF3A 2O2VA 2PLPA 1BKBA 4HCNB 2WWZA 3APDA 3Q2AC 1JC7A 3FVQA 1JJGA 2BH8A 3L0WB 1RJTA 3LWUA 1FL0A 5JOBA 1UBQA 1D6EC 1Q0WB 4PNYA 3BG3A 1LUZA 4KV2A 4KZ0A 1T0QC 4A3FB 3J7AF 5G3LF 1AYFA 1KAAA 1BF4A 4LF6Q 2KDBA 4A3CG 3L17A 1TWCB 4GKKL 4HJKA 4YWGG 2D3AA 2CHZA 3EHVA 2E8GA 4G4KA 3MHSD 2B39A 3P1MA 1EQRA 1QZGA 2LJ5A 3P4QB 2N1WA 5EE3A 4AS1A 1Y1WG 4W9KA 1QNUA 3NUHB 3TJPA 2A6ED 2PCFB 2MNAA 3E3XA 1PV4A 3ZXRA 3CW2C 4KKTA 3EBEA 1CM9A 4NQKE 1PRTF 2DUDA 2JPHA 1J19A 2ZTDA 4MM3B 5IP7H 2CJOA 4ICUA 2F52A 2IGGA 4DV4L 2KOXA 3OMGA 4A9AA 3A7LA 3HP3A 3GTOB 4DWFA 4B08A 1FEHA 1G51A 4ZRZA 3A7AB 5ELBA 2DBYA 4CO7A 1EWIA 3M7NA 4XYOA 2UXBQ 1C4QA 2JYOA 3LYYA 3PVLA 1CJEA 3DWAA 5EKIA 2BQQA 1RDPD 1X3EA 2PW5A 4KHPQ 2DZMA 2CJNA 2F0HA 2IO3B 5I6WA 3S17H 4GS3A 3PCOB 2R6GA 4KN4C 3MC9A 4F1SA 2OQ0A 4B3RL 4IN3A 1FFVA 1YIJA 2DJFC 1F1HA 1NY4A 1K8RB 2R93B 2RD0A 1WGGA 4YSZB 1YHBA 1J7CA 1YHQA 1T0RC 2NMQA 2IO1B 1BR9A 1T3QA 5E6JA 3AE4B 1X54A 4QMGA 1OXTA 3A56A 1ZEQX 3GO5A 3NEMA 5JJIA 4RM9A 4KIKB 4EQPA 2AQ3B 3BZKA 3O13A 2PPBC 1WM2A 1XQQA 3K5MA 3KLSX 2P5ZX 3S1NH 2B2VC 1DD2A 3KYDD 2FE8A 2WAQG 1SNOA 4HPMB 4A20A 2V1CC 3ZJUA 2JWUA 3J81j 5IP9H 1STBA 2HDMA 3A74A 3KVFB 4IFDJ 3RT3B 5M3MB 2A8VA 4JK1C 4HJ7A 3A1QA 3HOUH 1G6ZA 1TXYA 3PV0A 4WAAA 4HDQA 5I4DA 4DAVA 3P2BA 1R4NB 1FFUA 1TWCH 4X3KA 3RFZB 3ULLA 2N88A 4M8AA 2XEWA 5IA7A 1HRJA 4KN7C 3DLLA 2IJ0A 2MPMA 2ZJPA 2KDIA 1KL9A 1KHIA 2EY2A 1RAXA 1O7YA 3GTPB 1AZQA 4IWOA 4O2DA 3MC0B 4W9CA 4JWSC 1EWCA 3MFGA 4GDKA 5D2MB 4AYBE 3U4EG 2FXQA 2LS01 1DONA 4F7XA 3M3YB 3AE2B 3IT6B 4W9EA 3W1SC 3MAQA 1XX8A 3SR6A 2WQYB 3MJ5A 4EEWA 1WF9A 2JT4B 3ND9A 2HQLA 5BYQA 1V81A 1SR3A 4RM8A 3DMUA 1J8IA 1ROEA 4US9A 3AEEB 3CCVA 1BUIC 3NVWA 3F1ZA 4MSQB 4WJPA 1KNEA 2Z4HA 3PIO3 3E56A 3QWNA 1NMGA 5IYCG 4XDCA 1RIPA 3HZXA 1E24A 3LGJA 2PMZE 1R9TB 2AKWB 1SSOA 1RWSA 3NBHB 2W3SA 3S16B 2WDTB 2CWAA 3GP7A 4PK1A 1WX7A 4DV1Q 2ES2A 2LGIA 2R93H 2LMCB 1VD2A 1HA6A 4WORA 3A5ZB 5HY6A 3T51B 5C4HA 3TIXA 3VTUA 1CTMA 4DHJD 4JOIC 1PH2A 4PS7A 1L2NA 1PUTA 4CJ1B 1IZ6A 4ME3A 4XQJA 1JJ2A 4P71A 1ESFA 4TRDA 1TBEA 1V1PA 1UH6A 2OOBB 1V49A 3JVZX 5E6PA 3E0EA 3ML9A 2MQHA 3QIAA 1XNRQ 4DR6Q 4J1MA 2HHHL 1K53A 4FJVB 5FLMH 4LCDE 1PTOB 3I90A 3J7YW 4BAXA 3OSOA 3QOJA 2JF5A 3I55A 1H9RA 5L37A 2H89B 1EQVA 3B08A 3I91A 5JJZA 5LL6X 5ELFA 2FINB 2V3NA 3OWEB 1KTKA 4O42A 4Y52H 2BYEA 2IX3A 1ML0D 2WXPA 4B3MQ 1LT3D 1I7HA 2WDQB 2QF7A 5C6AA 5IGEA 4DUYL 1W2BA 5IODA 4DK1A 4L5SA 2ASQA 2ZW0A 4XXEA 4V0BA 1D8LA 3A9KB 1QUQB 1N36Q 3RI7C 4OEMB 2FCNA 3UGBB 3ZJYC 4A3OA 4JI3L 1UGMA 2F0NA 4ZLTF 3RNAC 1TR5A 3M7GA 3GTPH 5ELCA 3AE9B 2RBMA 4LFCL 3AB9A 1BCPB 4ZK9B 5JEAH 2E2JB 2ZW1A 1KRSA 3TEZA 4RGNA 1GOZA 1T6BX 5IT9L 3M3YH 5CV4A 4IM0A 4NNJB 2QEXA 3K6OA 4OW0A 3T56B 1EWHA 2AMCB 2K4KA 1EYAA 1SNQA 2KFJA 1Y8NB 3S9WA 5AZHA 2L00B 3ZTDA 3M63B 2LGXA 1AW7A 1WGDA 3DDCB 1V9JA 3ZTCA 2RHQB 1EY4A 5JH5C 1WTHA 2PPHA 2DLBA 3C1EA 3I4MG 4KSLC 3PO2G 1AE3A 1OTRB 1SJED 2LFNA 1K9MC 3F2DA 2JWZA 1L1OC 1B9MA 4DA2A 2LKVA 4IJLA 1PH5A 2K6QA 3PUVA 2LVOA 2H4OA 4CJ2C 1RRBA 4QQBX 3VYRA 4B3TQ 1FM0D 2L32A 4HEA1 2ZVNA 3BDLA 2O2VB 1WOCA 4DDGD 3L3OC 4KSKC 5AUKA 1GUWA 4Q0FA 2BW2A 1GO3E 1FPYA 1VQBA 3EFXD 4LMQD 1QT9A 1DOMA 3KUCB 1OXSC 4ZDVA 1E7VA 4LW1A 4K0KQ 1CA5A 2XNAC 3KLRA 1PH4A 3TP5A 1D2BA 1N62A 3QQ8B 4A90A 4DAMA 1IYUA 5LMNQ 1JT8A 1IL8A 1EOVA 2D62A 2PNRC 1KH0A 1K8GA 1GM5A 2ZJDA 4GOCA 4RGTA 4J15A 1K73C 1UWMA 2WHIA 5I2XA 3DPDA 3Q3OC 4B0MA 1GUSA 3PO0A 2MUYA 3M4QA 3ITPA 2NVTB 1Y1VG 4B9KA 1DXMA 3LNNA 4ODGA 1LTBD 1YNJD 2A6HD 4CGYB 4IUTA 4N59A 1KD1C 1AN8A 1YI2A 1WE7A 3QJZA 4DBGA 5HGTA 4PQXA 5DM63 1EFID 5KYIA 3G71A 1S5FD 1WXMA 4FVMA 2JK8A 3VUYA 3ZRCA 3F2UA 4J3OD 1R4NI 1XMQL 1E7UA 1Y56A 1VS0A 5J1ZA 1MD2D 3K81C 4GLAC 3ERQA 3WIMA 1F0ZA 3BVMA 4BY1B 3K5OA 3H15A 1Z9FA 1SYEA 4KGTA 3R2TA 2N49A 5AEKB 1I4QA 1FNUA 3BVZA 1N33Q 3AI5A 3KW5B 2MBQA 4MELA 4YTNB 3HOVG 2LVQA 4A6QA 4ME5A 3PF5A 2KBNA 1HXYD 1K3BC 2YEPB 1XJVA 4I7AA 1PH6A 5A35A 1N60A 4FJYA 4KDLB 1ENAA 4IOCA 1EIHA 4PS3A 1CQVA 1T5XD 2EVBA 2LRUA 4E71A 1FXTB 3TUOA 3DUZA 4R3DA 1G91A 1VJKA 1Q8IA 3GTLB 1C78A 2KJ6A 2BA0A 1NE3A 1TWHB 1K50A 3K57A 3R93A 5M5XB 3C46A 3PTFC 1DOLA 4ZRPA 4OVZA 2OTJA 3D4DA 1CFMA 4DR3L 1BXTA 4K14A 3DEOA 5M3FG 5H92C 4US8A 2INDC 3HOWG 1V2YA 2PE9A 4OZBA 1TVXA 1L6VA 2KWCA 2YTXA 3MXNB 4FA6A 3CCJA 1EUJA 2PYKA 4MGZE 1L0WA 4DV6L 1MBYA 5HI1A 1H9KA 3APFA 3A1QB 4LLGM 2F4IA 4XWTA 1F2RI 1SB3C 3BVGA 4NXMQ 2K22A 3BK2A 2ZCCA 2AL3A 2JZZA 1VQMA 1OQYA 3T13A 4ITKA 3PLUA 1WTQA 3H6MA 1EEID 3NXWA 3IVFA 3GTGB 1C3TA 1EL0A 2E6XA 2DZIA 2Z1CA 1WTOA 2NVTH 1N61A 1ZUD2 1STEA 1MSGA 1IYJB 2HD3A 1SJHD 1TIID 3WDNA 2DGYA 1OXVA 1PH1A 3AEVA 1WR1A 4MEMA 2K5HA 2A19A 2F0DA 5F2DA 1LXDA 2WXIA 1MJEA 2K6AA 3AE6B 4FJZA 1N32Q 1WZ3A 3EFUA 1YMHE 1WMHB 2WX1A 3K59A 4BY1H 2A73B 1UAPA 4IFDH 4HVBA 3T1YL 1SF0A 1Y8RC 4LF8L 3I7FA 4DXAB 1NR2A 3BS1A 3GZNI 1NI3A 1CZGA 2VXWA 4HSPA 2Z6BA 3OHXC 4XWWA 5FKAC 3G48A 4O1NA 4B9XA 2V9HA 2F3WA 1UNSA 5J22A 4JI6Q 3VTWA 1J5EL 4NMZA 1M1KC 3V62A 4HR7B 1WM3A 1QWYA 1FGBD 1XTDA 3DBHB 4YHHQ 4HLEA 4B3SQ 5CC4A 2KJHB 2W9NA 2WXKA 4NZLB 2MFIA 5G2NA 1HTQA 4RFBA 1JE5A 3M85A 4EQNA 5M5XH 5HKHA 3X23A 2MH7A 4AWJA 1V1PB 2X69A 2FIDA 4YY3Q 3S15H 3K5NA 2G9DA 2KEEA 1NDDA 2LGYA 3Q8DA 3EECA 1PYWD 3MEHA 2XWJB 2ZNVB 2GVBA 2E2IB 3Q8CA 1P9DU 2YYZA 5EBCA 2IBIB 3DVGY 1AARA 1OXUA 3UI3A 4K5WA 2QHOA 4BKGA 2RGFA 3VVWB 1OEYJ 5IYCH 4JI4Q 4N9PA 4XT1B 1CT1D 4A3KB 1M90C 2F4VQ 1B1ZA 3Q6BA 5C3EG 1R4MB 3EUB2 1H95A 5EKKA 2K5QA 2UU9Q 2E75C 1BQQT 3E9SA 4GB9A 4N6EB 3RZDB 3MXPA 2ZM6Q 2RDFA 1MHHE 4LFBL 2EYHA 3ONAB 4ZKCB 1P16A 4KHVA 3ZYYX 4ABNA 4GSWA 4FXGC 2FNJB 3GTGH 2VQFQ 1RODA 2ZT9C 4GOPB 3PUZA 4TKOB 3SGIA 1IBLQ 3I4NB 2VNUD 2J0JA 2N4FA 3CMMB 1V8CA 1CKMA 4JL9A 1MPEA 4XZ4A 2A68D 4UHVA 2E74C 4ZUIA 3B0AA 2IHFA 5BR8Q 5FJ8H 1UE7A 3OIPA 1KLVA 2JX5A 3VFKA 4RCNA 3E5SA 4NPSA 2BBCA 2GB1A 3KYHC 2K32A 3Q22A 2RR9A 1UGJA 2B2TC 4IFDI 2X38A 3PO3B 2KMAA 5K36H 4OONA 4AH6A 1WVLA 3UIOB 1JW9D 3RULA 1RFAA 3HIZA 1HZ9A 2KUMA 1AZPA 3VYUA 1GVPA 2J53A 2B29A 2NN6H 1X3QA 3OOCA 1SE2A 1V6EA 4C3JG 2IY1B 3AM9A 1HJPA 5C5LA 2N7DA 3GS2A 4L63B 4WAFA 2ZEQA 5IY0A 2KCCA 2K75A 2NR2A 3URYA 1VQCA 4DV7Q 5IYBH 1X6OA 3LDZE 1ZE3D 2RA4A 2WP8J 4OZAA 2MBBB 1KDAA 3FEWX 1F2MA 1Q90A 5LMUL 4IALA 2EMTA 2ZVOA 3DVNV 4NPNA 1J7AA 4TQ0A 1IGCA 2JQOA 5FOBB 4KHZA 2LRWA 3FAHA 4YIJA 3ERSX 3BYTB 2A69C 2EIFA 3A55A 4I65A 3HM6X 3DQVA 2B2UC 3QB3A 4JCVE 4G7OC 3DBRB 4LFAQ 1WZ0A 2E2IH 4LF4Q 1HNWQ 2M0AA 3KWVA 4JBWA 1OXXK 2N8NA 4A55A 3A8IE 1E2VA 1JCKB 4AUQC 5J17A 1Q12A 3Q6SA 2YTYA 1F2RC 2JXMB 1VQAA 2EE1A 4A3KH 5M5YB 4DGZA 2EELA 2RSUA 3A33B 3RNGC 2YVCA 5E3FA 2L4NA 2K8BA 1HUMA 4NXNL 2ZPYA 3P7JA 3SE0A 4AQ7A 4YTMB 3TL5A 4P6VF 4JI8L 3X3NA 3HOWB 2DY8A 1JRUA 5LL6S 4BKSD 4DV0L 2JA6G 3WA0A 3CCQA 3GDEA 1JWAD 4GMVA 3I4NH 4NJCA 1J7BA 2E5LL 1Q5WB 1OTCA 1JB3A 1TS4A 2IYDB 4JG2A 1S72A 1V8QA 3G6JB 4A3LH 4KGRA 5KIXA 1D1KA 1QZEA 1ZP0B 4DV3Q 1LYLA 3NVVA 4FHJA 3GE8C 4LF9L 1G6PA 1L0YB 4P1CC 2D3GA 4XYQA 1BCPC 4IM2A 5IGCA 2IGHA 1Z2MA 2PTLA 3PO3H 1E0BA 4QIWB 5BN3A 3ONSA 3HM3A 5IKCM 4ILWA 2NPTA 2CHWA 2W3RA 5EKLA 4XTCS 3OW2A 2F03A 4BBSG 4EZLA 1VF5C 2N9PC 3KJPA 2JZPA 3HK0A 4N58A 1BBUA 4OO1H 2NN6I 2D3BA 3D4RA 2CKZB 4EX5A 4A76A 1DOKA 2RHSB 3NY5A 1KOTA 1PFMA 1OQRA 1TWAH 3CXCA 3SK5A 1QQRA 3G4SA 1ZKHA 3PMFA 2MBEA 3PZ7A 1K8MA 1YEZA 1YNNC 3Q8FA 4QB4A 4APVA 4IPGA 3ABVB 3DWGC 4A3MB 5M9OA 1NI2A 3N52A 1C77A 2N55A 1UE6A 1XNQL 1U4AA 3HKZG 4GN4B 2K01A 2C5CA 1XF5L 2C60A 3OJ4B 4CYEA 3TEYA 1HZAA 5C3WA 4HJ8A 2YTVA 3RNBC 2L7RA 2F0EA 1SYDA 2X6GA 1B50A 2KTRA 2D2CC 2Y0SB 3GTQB 2EYFA 3K8AA 2XK5A 3QX1A 1Q8KA 2K5VA 1V1OA 1OGWA 1GAQB 4RNAA 2UXDQ 2BB5A 4A93H 4RKLA 4KI0A 1SMYD 4A3IB 1FJGQ 2Z9HA 3CPFA 1ILQA 4LF7Q
chains in the Genus database with same CATH topology
2F0PA 1BDOA 2B2WA 2VB3X 3QOLA 3NP8A 1ET6A 1MSHA 3D6WA 1PDQA 3J80E 1QB5D 5BYRA 1FRRA 2EJFC 1JOOA 2N0SB 1IBXB 1EYDA 1PFDA 3T53B 4U673 5C3EB 2EYMA 3LWEA 3TZUA 2N7JA 2HTME 4DN4M 3QO2A 5FO9B 2CVRA 2O2LD 1B9NA 2LY7A 3L4PA 1AWDA 2KAJA 3ZQ4A 1FR3A 2GRIA 2OEOA 4OO1I 4KY5A 2SAKA 1F2ZA 1I50B 2ACZB 1XYIA 4C3HG 4UDUC 2XVSA 1CQFA 4X3SA 1L6UA 1S4ZA 4MHEA 2EYJA 2EXZA 1IKMA 3T3OA 4C3JB 1C79A 1HEZE 1L0XB 2F0LA 2OEDA 1HZ6A 5HFYA 5A2QE 2J42A 1DJRD 2K5PA 1ZPSA 1EZ8A 3IXSA 4JWUC 2F0OA 1GXDC 4QUCA 1YJIA 1TKEA 3SK4A 1CHPD 3NQIA 4RCOA 1EY8A 1II3A 3CRKC 1PRTD 5HURA 4L8JA 4K6DA 5CV6A 2M9VA 4KGSA 3W3AA 3KQ4A 3B2FA 4QF4A 1FD6A 5BYSA 3HUIA 4KKUA 2WDRB 1EWYC 1YJJA 3S1MB 4WH4A 4P2CB 1BNZA 2KJXA 2X6LA 2WNMA 2JA6B 5ELDA 4S3SA 3Q23A 2JXTA 1HTLD 1XEEA 5KYLA 4ZQ3A 4H2AA 1JQYD 4RH6A 2WXHA 5DEHA 2FJ2A 3S1RB 4LAAA 2PZTA 4XDXA 2EZVA 3QJYA 2JA8B 4PT5A 1SYFA 4BBSB 2EOTA 2I38A 1XWEA 1EOTA 2KECA 4M0WA 4FO2A 3CQZB 2BB6A 1QOHA 1NYRA 1F9RA 2I46A 3EROA 3M4OB 1F9PA 2B8GA 3HKZB 5K5PA 2BTEA 3A8JE 4CHTB 4ZAIA 4A3DB 1QOFA 4KY7A 3IAM1 4FXCA 3MHBA 3K0YA 3VRAB 1D5MC 1WD1A 5CGKA 4RAUC 1HZ5A 1MVKA 1JQ4A 2L9HA 2K04A 4HTHA 4ZHPA 2K28A 1FD7D 2V3PA 4CKBA 2Q8TA 1XO3A 3CRLC 4H0LC 2PIAA 3PUXA 2LFIA 3AEAB 2NVQB 1GB1A 1VR9A 3N9YC 4YTPB 3AE8B 4Y7NB 5LHY1 4EE2A 1HPCA 1ONLA 3L7ZC 3ZJTA 2JEBI 3W9CB 4A3GB 1PFBA 2JA7B 1AP0A 3GTMB 3HRZC 3Q24A 2E2DC 2K05A 1SXTA 3C2PA 5CV5A 4HRSA 3EGRA 3D8GA 2OXPA 2FUG1 4DXFA 2TSSA 1YN5A 1BBXC 3NVYA 2K3UA 4TMAB 2WP9B 1KNAA 1CZWA 1JE4A 3J7AV 1OO9B 4RWSC 2R3ZA 1D4BA 4C3HB 5D14A 4HCEA 2JYTA 5JVG3 4XQQA 3MHZA 4KKIA 4REZA 1LTAD 3BZDB 2DYMA 2NB0A 1ILPA 2M00A 1QG7A 1ZDVA 2OHFA 1TWFB 2HDEA 5FO7B 2EY6A 5C0XH 4FNFA 4J8QA 1G291 2NVXB 2ON8A 2QCPX 3W5UB 1XCQL 3DHQA 4ZUJA 1PFNA 1HTPA 4KK7A 1NUCA 2QEJC 2Y3AA 4HMJA 4LJZC 1MHXA 4K2LA 2ZXRA 3J80L 1CZPA 4KTAA 3J9CA 1F77A 2EDGA 1QKZA 2KVMA 1SNPA 1PZJD 1BUVT 1EEFD 1EIGA 2RVLA 1JWSD 1R7SA 3HVDA 3IFDA 4Z9CB 1F2LA 5AFWA 1Y1WB 3IL8A 3AE3B 3OWFA 2KQ4X 5T1IA 1WSPA 4CJ0B 1DCZA 1X32A 5T1GA 1SFOB 2WXRA 1TKWB 4OIJA 2ONQA 4JE3B 3W2DA 4OIKA 3HGBA 2KA7A 2NYZD 1E9MA 3DM1A 3I3CA 1LT4D 2EPBA 3VR9B 2AUKA 5I6YA 3IAS1 4UAIA 1Y8OB 3IAYA 2NWGA 1JR0D 1BCPF 1VCIA 2SOBA 4R8NA 1UEAB 2JQRB 4HMIA 5A2QL 1PTOH 1QJOA 1IYVA 4WURA 3NTKA 3WOEA 4D2KA 1TT2A 5BN5A 1OQQA 1JALA 2QILA 4NKLA 3W1SA 3LXFA 2WU2B 1RCVD 2LUMA 2IDYA 4HJGE 3JAME 2WAQB 2KWDA 1EU4A 1IUEA 1K83B 2WU5B 2VUMB 3U7ZA 2K9XA 1LV9A 1XTCD 3QG1A 2JE6I 3V2TA 1WD0A 1U4RA 4WFN3 4ID6A 2KCNA 1VZ8A 5C44B 2QIEB 1TWGB 1B9RA 2F0MA 1STGA 2W55A 2PW7A 1DM0B 1EY6A 1KF6B 2QJLA 1WTXA 1ZKOA 2W82A 2BE5D 3VYSA 2N9KA 5EGTA 1R4QB 3NK9A 2O4XA 5ELEA 3SK8A 1NYQA 4NDXA 1FNWA 5IGBA 5C4JB 1STAA 3TZDA 1C4AA 2Z8LA 1VDZA 2JSOA 1K51A 3FILA 2WIIB 2YEPF 1LABA 1N63A 4GDKB 2MJEA 1O78A 3KLSA 2JP1A 2CHBD 3OIQA 5C5MA 1EU3A 2VZKD 3TN2A 4L6TB 1ACCA 4Q2JA 1TY0A 2F0TA 4WWMA 4MIUA 5CORA 3RUZA 1ZXHA 4XIGS 2J7ZA 1CA6A 4PV1C 1KLUD 3G7LA 1JMLA 1K8OA 2F0QA 2HUGA 1MI0A 2B8FA 3GTKB 4WIPA 2A6EC 4ARIA 4TQ1A 5BMIA 3DXJC 3SDZA 3SEBA 4IUNA 1EY5A 5AUIA 2VB2X 4LK0M 1TKGA 2Z4IA 4BY7B 2WKCA 2F0UA 1L0VB 1FMAD 3BIID 2FFKB 1H9SA 3VR2A 4C3IG 2RQXA 3N6RA 1F9QA 1SNDA 2OF1A 2KN4A 4C7ZA 3I4MB 4Q5VA 2XRQD 1ZXTA 3PO2B 2WXGA 3NQTA 3RMHA 1KFYB 5JVH3 4FF4A 4FXKC 4GDLB 4FYDA 1PZID 4HKZE 3S2DB 5HG2A 2F0VA 1SAPA 4ULLA 2R92B 2WV6D 3EVQA 1SYCA 2RDGA 2K33A 4NAMA 2M19A 2AQ2B 5EE9A 2LJIA 1Y1VB 2BYTA 1HQMC 3P4RB 5G5GA 5C3XA 3VA7A 3PUYA 2MJ3A 2B2WC 4ZYSA 3ETRA 1SBBB 4YSXB 1U4PA 3VR3A 1TY2A 1I4RA 2Y5PA 4X3TA 2ID0A 1RFKA 4JPSA 2L52A 3HOVB 1KLGD 1JICA 4KX6B 3KBXA 1ZOYB 4IQZA 1IW7C 1STHA 4CKEA 3MP9A 1JORA 3TSSA 2PKOA 1HFGA 3RZOB 3NPPA 3AEFB 5T8IA 5EJWA 1FCCC 5JPNC 1PTOC 5IGGA 3B9JA 3KWLA 3AV8A 4XT3B 5M3FB 4LTUA 1QNKA 1DOYA 1BMLC 5IGDA 4K2KA 1DOXA 1D5XC 5I2YA 3V3XA 2HCIA 3ND8A 3MXUA 3FMCA 3D4WA 3V96A 5EPJA 2AWOA 1EY0A 4NP5A 4C1NK 1Z6HA 3NSWA 1A2TA 5DNFA 3ZGZA 3VA5A 4MH8A 3MA2B 4ZKBB 3E0JA 2M56B 1JRPA 2G1EA 4HKQA 2WXFA 3HOYB 1VZ7A 2B2YC 1E2ZA 1IHZA 1I6VC 3JAML 3X3MA 3VYTA 4HEDA 3AU7A 1EY9A 3U9OA 3AMZA 2WXJA 4DAYA 1W6KA 4OL7A 1HUNA 1TQOA 1ZDXA 3FILB 3D31A 2DNCA 2TMPA 4IUPA 2HDLA 1IGDA 1D5ZC 1JWUD 2BCOA 3P1HA 2WLBA 5C0XJ 4KV6A 3BYYB 2JYEA 3OMCA 3AE7B 4C3IB 3NS1A 3TP7A 3D6CA 2I07B 3TEXA 2K03A 2B2TA 3SVMA 1HQRD 4WJWA 4N9TA 4YSYB 1MI2A 4C7YA 1ENCA 4A3BB 2FBWB 1E0ZA 2NVYB 1YNJC 2A6HC 2IW3A 4IKGA 3EQLC 4V190 3I73A 1C4CA 3OW7A 3T16A 2A74C 3LX0A 2JEAI 1QE6A 1LO5D 1H9SB 3TP8A 2B2UA 3HOXB 1RYJA 2LMCA 4YT0B 1WTPA 2WXLA 4G7ZC 4ZRQA 2EY1A 5JEAG 4HAEA 2MEKA 1PZKD 3KBGA 2CW0C 4K5XA 4CQNA 1XLOA 4QUFA 1Q1EA 1AEXA 1CK1A 5EPLA 2BOSA 2BA1A 3K58A 4P16A 3S2HB 1M4VA 5IOCA 2L12A 2E3TA 1TYGB 2L1AA 3U2SC 2F1MA 3TMEA 4FXDA 2WB1B 1VRAB 3R8BA 3J81E 1TJEA 5EQ0A 1Y8PB 3CU7A 5EBDA 1TU2B 2Q8IB 4IDIA 2INNE 1PRTB 1A15A 3W5VB 1NEKB 1SYGA 3FPUB 2K7VA 4KMUC 2F3VA 3HS0C 2KDMA 4M1UB 3MVVA 2L5TA 4CBVA 3MXGA 2ICEC 2MGSA 2IX0A 1VZ6A 3P20A 1B44D 2WDVB 3T4AC 1EQTA 5CMDA 3HOUB 2R61A 1T5EA 4J6HA 4IOIE 4X3UA 1XLQA 5E4WC 1JWBD 3HRDD 4GLSC 2PMVA 3DWPA 4K8IA 4FP5D 1HCZA 5BMHA 3WOFA 1WGKA 1KDBA 4XE0A 1E10A 2F0KA 2FMCA 1LTID 2I2YA 3NWTA 3MTSA 1V43A 4F8MA 2ZXOA 1L4DB 1M8AA 4L1BA 4LK1C 5EE1A 2QKIC 1F9SA 4IUQA 1MGSA 1Q10A 1P7EA 1ESRA 2ICIA 4R8IA 2CU3A 2ENBA 2PZWA 1B4OA 4DF7A 1LLRD 2PVGC 2RKSA 1RKNA 2A68C 2XIWA 2KQ3A 2PZUA 3PUWA 1U9RA 3P63A 2CQAA 1U4LA 2SEBD 4KD3A 1OFFA 5ISRA 1YQ3B 1R4PB 2V4DA 2KHSA 2L83A 4IFDG 2RPVA 1QOBA 3MXNA 2O5JC 4DNTB 5TSSA 1LTRD 2WS3B 1LACA 4FF2A 2GI9A 1SYBA 4C80A 5G5HA 1NSNS 1C9FA 4EVOA 3GV6A 1FXAA 4RGOS 5GXGB 3TBIB 3AE1B 3VR6A 1PXUA 1B53A 3A54A 3TEWA 4C2MB 1LTGD 4BA2I 2L1BA 2IT1A 3MWYW 3FDTA 2A69D 1EY7A 5FK9C 5D7GA 2Q5WD 4NAWB 1TS5A 1CHQD 4BWGB 3SK6A 1IW7D 2L11A 2PW9A 3AEGB 4K8JA 4OGQC 2MJ8A 1DZ1A 4DU9A 4OZCA 1JOQA 1QOAA 1VLBA 3RD4A 2J4XA 4L2YA 1PTOD 3VR5A 1B3AA 2F0SA 1GJXA 2D5DA 2PQEA 4EQOA 4TQUS 4CKCA 4GZYC 5FO8B 1SE3A 3AECB 1U4MA 2MJDA 5FLXE 1GUTA 3CKIB 2N9LA 4RGMA 1BOSA 2E76C 1H9MA 4DNRB 1L4ZB 3AEBB 3LB8C 5K36G 2LEKA 1BCPD 3GQBA 3WCQA 5CV8A 2F0FA 2KEDA 2GA4B 2WXMA 2NN6G 3NRZA 1C8CA 3Q8BA 4K5VA 1PTOF 2B76B 1Z47A 2BS4B 4RF1A 1P7FA 1LTTD 2DNEA 1Q3LA 3A8KE 3NZ3A 2PVOD 4RHRA 1YNND 2B2VA 3HG9A 3DWQA 3CIRB 1DYQA 4PMWA 1KRHA 5KNBA 1YN3A 5D3DA 1SMYC 1FRDA 4KD4A 1SNCA 1PGXA 5C0XI 3FC4A 1ET9A 5J39A 5M5WB 3U52E 1F2YA 4C1NI 4HCSA 2H88B 2QSDA 1FCLA 5H8YE 5D65A 3NE5B 4I7ZC 3RPFC 5COYA 4KJOA 2IGDA 1B2TA 3CHBD 1ICWA 4WQMA 1GUGA 2J52A 1CI3M 3J81L 3SR1A 1ZYRC 3P75A 1SIJA 1NR4A 1C48A 1LT6D 3KUPA 3P4SB 1WTWA 2K5DA 3ZJVA 3T3NA 1C4PA 2BS3B 5C4ZA 3I72A 2E2HB 1I4PA 1NENB 3TDQA 1UWXA 2J0TD 1NVID 2K1BA 1RM6C 4OO1G 2WXOA 4HROA 2Y5CA 3SHLA 5JPMC 1WYGA 3R3OA 1UUPA 1PGAA 4PMBA 1WCMB 2WXNA 3OPOA 5NUCA 1KDCA 1Z7TA 2RMMA 2CW0D 3SFDB 2QDBA 2IL8A 1X3PA 2LHDA 5DM73 2Q8RE 3AE5B 4A8XC 2H1EA 2L55A 4EGVA 5I9OA 2L0CA 4BBRB 1L5PA 4HSVA 3S15B 4H44C 3FRPB 1PRTC 1QLBB 3GB1A 1G2SA 2OT2A 4BS9A 1GB4A 1TS2A 3S14B 3U9SA 3MZ5A 5KNCA 5IGFA 1HA5A 2XN9C 1J9OA 1JWMD 2SNMA 4HN7A 2EYLA 3H94A 1N5WA 3B2GA 5KNDA 3VQIA 1O7ZA 5CYUA 1A6XA 2VZKB 2AWNA 3S1QB 1A3UA 3AH7A 2KMMA 4XQNA 3GTJB 2JSVX 1PLFA 2EY5A 5JAVA 4DXGA 2F0WA 3IFTA 3D3RA 1WTVA 3I9V1 1STYA 3KF8A 2JA5B 1S5BD 1HFNA 1GHJA 1E2WA 1EYCA 2SDFA 5CBEE 1IBXA 1SNMA 1FYCA 3I70A 2B63B 2EJGC 4A3JB 1V97A 4K6LA 1I4GA 1QCBD 4QCLA 2F0IA 3I4LA 1JROA 1IKLA 2K5WA 5KGUA 3BDOA 2DY7A 3I8ZA 1AFPA 3TP6A 3SFEB 1I4XA 1VMCA 1Y69U 2QMTA 1Q1BA 3P4PB 3Q0AA 2IX1A 3K7AB 4RA8A 3FKIB 5E4XA 3K5LA 4G7HC 3Q69A 1HHVA 1A2UA 1VDVA 2A5HA 1BO0A 4KY6A 1EM7A 2K0PA 1O7LA 2V0GA 1H9JA 5CR3A 4BA1I 1YNTE 3CWIA 1XCTL 3C8YA 1GPXA 2DN8A 1SE4A 2XRSD 1I6HB 2EKIA 4R9WA 1XLNA 2O5IC 2WKDA 2BDNA 4DAPA 1QF6A 1EZ6A 3BDCA 1I4HA 4RKBA 2NTTA 3VR4A 2D5GA 1JOKA 3DEPA 1GHKA 5E1FA 4AYBB 1WXQA 5FLXL 5C2TB 4OHJA 2MHVA 2F0JA 2INPE 1WRIA 3NUCA 2RSOA 4DQOC 1VF7A 4H7BA 1YN4A 3HVZA 3AMUA 3C1FA 4H13C 1TWAB 1PMRA 2V4IB 5C3JB 2R7ZB 3H3VC 4KKSA 2WINB 3BWUD 4IURA 1WTRA 1FNVA 3HEJA 2PMZB 2F0GA 3Q8EA 5MPOA 4IZ8A 4DFAA 2EJMA 1YQ4B 3VR8B 1FXIA 2YU9B 4A93B 1QILA 4YXDB 1D1IA 1KABA 4FF1A 1ZXIA 5CV7A 2BS2B 4WRDA 1DGJA 2DWQA 3NWSA 1E6EB 3NHHA 3V05A 5HHDG 3AEDB 4XDDA 1GUOA 4E6IA 2IPKD 5KRUA 2NTSA 4L23A 4ZOHC 1TS3A 2G9HD 4JX1C 4MT5A 3H91A 1C76A 2RDHA 5I9PA 3FPPA 3PIP3 3NVZA 4NW2A 3H0GB 2NZ1D 2HQEA 3GD7A 3GV3A 3L9AX 3H09A 5C4XB 2EYOA 3EJIA 4MACA 5IIFA 2AQ1B 3AN1A 4A3EB 1E7PB 2HCCA 2IWHA 1A70A 2EYPA 4KJNA 5BMGA 3NTIA 3HOZB 2BT6A 5EE0A 1TKYA 2KACA 2JU6X 2D9UA 4F87A 3VRBB 1FIQA 1RTOA 1N5XA 1RD9D 1S5ED 5KEEA 2BDOA 2M2LA 4B9WA 3Q8AA 5C0XG 3SXHA 3AB5A 4IUUA 2SNSA 4MN3A 2XWBB 5CBAE 1RTNA 3C3LA 2FMMA 2AUJD 1LTSD 1I3QB 1WWTA 1SEBD 5BN4A 4TSSA 2FHTA 3NBHA 1A3VA 1NCVA 3EA6A 1A3TA 2NBFA 5IT9E 4RF0A 1DOIA 1G2TA 4KKJA 1TZOA 4U68A 2AX5A 5JEAJ 2C9OA 3E6ZX 2LHEA 1ZYRD 5LNK1 2MP1A 5DAUA 2WXQA 1NAPA 1QOGA 3DWMA 2WACA 1PDXA 3M4YA 1LT5D 1PGBA 5D3IB 1FO4A 2BE5C 2W54A 2RSNA 4IUVA 1S5CD 5JXVA 1GUNA 4PMCA 4DK0A 1XLPA 4C56C 2DYOA 1ENFA 3NTHA 3IKJA 1SSNA 3P42A 5CV9A 1K52A 2KOLA 4F88A 1VMPA 3I57A 3H8HA 1W6JA 3S17B 4RHSA 2XSCA 2ZXPA 5G3LD 1SDFA 3MFYA 3NBIA 3IT4B 1STNA 3KK7A 4G57A 2B2YA 5EPKA 3PZ8A 4ZHOA 1G8ZD 3BK1A 1O80A 1XXGA 1RF2D 4ARCA 3UI2A 1S5DD 3RLFA 2PO4A 3S1NB 3R2IA 2NUCA 1RHPA 4FF3A 2PLPA 1JC7A 3FVQA 4USAA 1RJTA 3LWUA 5JOBA 1D6EC 4PNYA 3BG3A 4A3FB 3J7AF 5G3LF 1AYFA 1KAAA 1BF4A 1TWCB 4YWGG 4G4KA 2B39A 3P1MA 3P4QB 5EE3A 4AS1A 1QNUA 3NUHB 2A6ED 2PCFB 4KKTA 1CM9A 1PRTF 4MM3B 2CJOA 2IGGA 4A9AA 3OMGA 3A7LA 3HP3A 3GTOB 4B08A 1FEHA 5ELBA 4ZRZA 3A7AB 2DBYA 3M7NA 4XYOA 1C4QA 2JYOA 3LYYA 1CJEA 3DWAA 5EKIA 1RDPD 2PW5A 2CJNA 2F0HA 5I6WA 2R6GA 4KN4C 4IN3A 1FFVA 2R93B 4YSZB 1J7CA 2NMQA 1BR9A 1T3QA 5E6JA 3AE4B 4QMGA 1OXTA 3A56A 1ZEQX 3GO5A 4EQPA 2AQ3B 3O13A 2PPBC 3K5MA 3KLSX 2B2VC 1DD2A 2FE8A 1SNOA 3ZJUA 2JWUA 1STBA 2HDMA 4IFDJ 5M3MB 4JK1C 1G6ZA 3PV0A 5I4DA 4DAVA 1FFUA 4X3KA 3RFZB 2N88A 4M8AA 1HRJA 4KN7C 2IJ0A 2MPMA 2EY2A 1O7YA 3GTPB 1AZQA 3MC0B 4JWSC 1EWCA 3MFGA 3U4EG 2LS01 1DONA 3AE2B 4F7XA 3M3YB 3IT6B 3MAQA 1XX8A 3SR6A 2WQYB 3MJ5A 3ND9A 5BYQA 3DMUA 1J8IA 1ROEA 4US9A 3AEEB 1BUIC 3NVWA 1KNEA 2Z4HA 3PIO3 3E56A 3QWNA 4XDCA 3HZXA 1R9TB 1SSOA 1RWSA 2W3SA 3S16B 3GP7A 2LGIA 2LMCB 1HA6A 4WORA 3T51B 5C4HA 1CTMA 1PUTA 4CJ1B 4XQJA 1ESFA 4TRDA 1V1PA 1K53A 3QIAA 4J1MA 1PTOB 3I90A 3J7YW 3OSOA 3QOJA 1H9RA 2H89B 1EQVA 3I91A 5JJZA 5LL6X 5ELFA 2FINB 2V3NA 3OWEB 1KTKA 4O42A 2IX3A 1ML0D 2WXPA 1LT3D 1I7HA 2WDQB 2QF7A 5C6AA 5IGEA 5IODA 4DK1A 2ZW0A 4XXEA 4V0BA 2F0NA 4ZLTF 1TR5A 3M7GA 5ELCA 3AE9B 2RBMA 5JEAH 3AB9A 1BCPB 4ZK9B 2E2JB 2ZW1A 3TEZA 4RGNA 1GOZA 1T6BX 5IT9L 5CV4A 3K6OA 4OW0A 3T56B 1EWHA 1EYAA 1SNQA 1Y8NB 3S9WA 1AW7A 1EY4A 2DLBA 3C1EA 1SJED 2LFNA 1B9MA 4DA2A 2LKVA 3PUVA 2H4OA 4CJ2C 1FM0D 3VYRA 2L32A 4HEA1 3BDLA 3L3OC 5AUKA 1GUWA 4Q0FA 2BW2A 3EFXD 4LMQD 1QT9A 1DOMA 1OXSC 1CA5A 2XNAC 3KLRA 4A90A 3TP5A 1D2BA 1N62A 1IYUA 1IL8A 2D62A 2PNRC 1KH0A 4RGTA 1UWMA 4B0MA 5I2XA 1GUSA 3PO0A 2MUYA 3ITPA 2NVTB 1DXMA 3LNNA 4ODGA 1LTBD 1YNJD 2A6HD 4CGYB 4IUTA 4N59A 1AN8A 5HGTA 4PQXA 5DM63 1EFID 5KYIA 1S5FD 4FVMA 3F2UA 4J3OD 1Y56A 5J1ZA 1MD2D 1F0ZA 3ERQA 3BVMA 4BY1B 3K5OA 1SYEA 4KGTA 3R2TA 1I4QA 1FNUA 3BVZA 4YTNB 4A6QA 4ME5A 1HXYD 2YEPB 5A35A 1N60A 1ENAA 1EIHA 1CQVA 1T5XD 2EVBA 3TUOA 3DUZA 4R3DA 1G91A 1VJKA 1Q8IA 3GTLB 1C78A 2BA0A 1TWHB 1K50A 3K57A 3R93A 5M5XB 3C46A 1DOLA 4ZRPA 4OVZA 3D4DA 1CFMA 1BXTA 4K14A 3DEOA 5H92C 4US8A 4OZBA 1TVXA 1L6VA 2PYKA 1MBYA 5HI1A 1H9KA 4LLGM 2F4IA 4XWTA 1F2RI 1SB3C 3BVGA 2K22A 3BK2A 3T13A 4ITKA 1WTQA 3H6MA 1EEID 3NXWA 3GTGB 1EL0A 2E6XA 2Z1CA 1WTOA 1N61A 1ZUD2 1STEA 1MSGA 1SJHD 1TIID 3WDNA 1OXVA 2F0DA 5F2DA 2WXIA 2K6AA 3AE6B 1YMHE 3K59A 2A73B 1UAPA 4IFDH 1SF0A 1NR2A 3BS1A 1NI3A 1CZGA 2VXWA 4HSPA 3OHXC 4XWWA 5FKAC 4O1NA 4B9XA 2F3WA 1UNSA 5J22A 4NMZA 4HR7B 1QWYA 1FGBD 5CC4A 2WXKA 4NZLB 4RFBA 3M85A 4EQNA 2MH7A 1V1PB 2X69A 4B0EA 3K5NA 2G9DA 2KEEA 1PYWD 3MEHA 2XWJB 2E2IB 3Q8CA 2YYZA 5EBCA 1OXUA 3UI3A 4K5WA 4N9PA 4XT1B 1CT1D 4A3KB 1B1ZA 3EUB2 5EKKA 2K5QA 2E75C 1BQQT 3E9SA 4N6EB 3RZDB 3MXPA 2RDFA 1MHHE 2EYHA 3ONAB 4ZKCB 4KHVA 3ZYYX 4ABNA 4FXGC 5FR3A 1RODA 2ZT9C 3I4NB 3PUZA 4TKOB 2VNUD 1V8CA 1MPEA 2A68D 2E74C 4ZUIA 3OIPA 2JX5A 4RCNA 3E5SA 2BBCA 2GB1A 2K32A 3Q22A 1UGJA 2B2TC 4IFDI 2X38A 3PO3B 5K36H 1WVLA 1JW9D 2KUMA 1AZPA 3VYUA 2J53A 3OOCA 2NN6H 1X3QA 1SE2A 3GS2A 4C3JG 3AM9A 5C5LA 4L63B 4WAFA 2KCCA 3URYA 1ZE3D 2RA4A 2WP8J 4OZAA 1KDAA 3FEWX 1F2MA 1Q90A 4TQ0A 4IALA 1J7AA 1IGCA 5FOBB 4KHZA 3FAHA 4YIJA 3BYTB 2A69C 3A55A 4I65A 2B2UC 3QB3A 4G7OC 2M0AA 3KWVA 4JBWA 1OXXK 4A55A 3A8IE 1E2VA 1JCKB 1Q12A 3Q6SA 1F2RC 2JXMB 2EE1A 5M5YB 4DGZA 2EELA 5E3FA 2L4NA 1HUMA 3P7JA 3SE0A 4AQ7A 4YTMB 4P6VF 3HOWB 3X3NA 2DY8A 5LL6S 1JWAD 4NJCA 1J7BA 1JB3A