1PGBA

Two crystal structures of the b1 immunoglobulin-binding domain of streptoccocal protein g and comparison with nmr
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
56
structure length
56
Chain Sequence
MTYKLILNGKTLKGETTTEAVDAATAEKVFKQYANDNGVDGEWTYDDATKTFTVTE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immunoglobulin binding protein
molecule keywords PROTEIN G
publication title Two crystal structures of the B1 immunoglobulin-binding domain of streptococcal protein G and comparison with NMR.
pubmed doi rcsb
source organism Streptococcus sp. gx7805
total genus 15
structure length 56
sequence length 56
ec nomenclature
pdb deposition date 1993-11-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01378 IgG_binding_B B domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.10 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1pgbA00
1XCTL 2OEDA 4HJGE 1Q10A 1P7FA 2J52A 1K51A 1PGXA 4WH4A 2NMQA 1GB1A 1FCCC 1MHHE 2JSVX 1UWXA 2IGGA 3UI3A 2KACA 2ZW0A 4OZCA 2RMMA 1C9FA 2KWDA 4IOIE 2JZPA 2KQ4X 2GI9A 1YMHE 2ONQA 2QSDA 1YNTE 1HEZE 1F2RI 2LHDA 2EELA 1IGDA 2N9LA 4KGRA 1IGCA 4GLSC 2IGHA 5BMHA 2PTLA 2JWUA 1FCLA 2LGIA 4KGSA 4OZBA 1GB4A 1MVKA 1XF5L 2PLPA 2IGDA 1HZ6A 1IBXA 2N9KA 1PGBA 4OZAA 2N7JA 5HG2A 1K52A 4MACA 1MI0A 4IKGA 3MP9A 2LUMA 5HFYA 1QKZA 1MHXA 1IBXB 1D4BA 5HI1A 2JU6X 2ON8A 1P7EA 2PW9A 2JXTA 2KDMA 1JMLA 2GB1A 3GB1A 2KN4A 2J53A 2QMTA 3FILA 2I38A 5JXVA 1K53A 2RPVA 5HHDG 2ZW1A 1MPEA 4HKZE 2I2YA 1KH0A 5BMIA 1XCQL 1F2RC 3V3XA 1K50A 5BMGA 1FD6A 4KGTA 1HZ5A 4D2KA 3FILB 1EM7A 2LHEA 1PGAA 2K0PA 1ZXHA
chains in the Genus database with same CATH superfamily
3ONSA 3R7QA 4ARCA 2GMIC 1EUVB 3IAM1 1R4MB 2KD0A 4ZDVA 2M17A 4W9HA 1J7AA 4AJWA 1WF9A 2O2VB 1ZE3D 3X0WA 2K5PA 1E90A 3GOEA 2KWDA 2W54A 1NENB 4DQOC 3ZJVA 3R2IA 2LI5A 1J0GA 2JY6A 4RF1A 1FEHA 4RM8A 2QHOA 1QF6A 4GLSC 3TJPA 2K6DB 5D94A 1KFYB 2WDVB 2N9EB 1PFDA 1J8CA 4M0WA 2BVCA 5C2TB 4FJYA 1N5XA 4EZJA 1HZ6A 4LNOA 2IBIB 4LNFA 4XDCA 3VR8B 3NS8A 4W9IA 3UGBB 2LWPA 4BKSD 3B2GA 1MI0A 2RR9A 2JUOA 4AQ7A 5HFYA 3W1SC 3V6EB 2MRPA 3AB5A 3PLUA 5HI1A 2JU6X 5CTRC 2N0SB 1QILA 3AE7B 1N61A 1T0YA 2R61A 1IUEA 1WMHA 2N9XA 2HJ8A 2ZW1A 1JWUD 2V3NA 2C7HA 3R2TA 3A9JB 3PZDA 3V3XA 1TY0A 3K9OB 4KDIC 5DPWA 1L4DB 3HM3A 1STEA 1C4AA 3DBHI 4QAYA 2BYEA 1TKYA 2DYOA 4LTUA 3DDCB 2M1MA 2ICIA 3DBLB 2KTFA 2B76B 4HJGE 2C60A 1KF6B 1YX6B 3QJZA 2QC8A 1TTNA 1Q0WB 2MA9B 1VZ8A 3KLSX 4K7WA 1EF5A 2AX5A 3QWZB 2KZRA 3I63C 1G6JA 1GAQB 2DAJA 1R4MI 3W9CB 2MP2A 4BFRA 1WGYA 2BBCA 2MBEA 2MLBA 2L83A 2Z0DB 2FCSA 3MHSD 1HEZE 2Y5CA 2DWQA 4ZYNA 3MC8A 2PJHA 2WDTB 4EZLA 4MM3B 3KW5B 2MX2A 3N1ZC 3APCA 1WR1A 1L7YA 1JQ4A 3DVNU 3VR9B 2I1JA 1WGKA 1R4NB 3RPFC 4NQLB 3RNEC 1FPYA 3KQ4A 1WJUA 2BWFA 4WQMA 4GDKB 1NI3A 3GP7A 1R7SA 2LUMA 2OHFA 1FFVA 1CQVA 2D07B 3GS2A 3V62A 1B9RA 2WXLA 1E8ZA 1JW9D 4LNNA 1RFKA 2WXGA 3E9SA 2KDMA 4MDKE 4O1NA 5D3IB 3BK2A 2KAJA 5JHBA 2L3ZA 4FBJB 3SU8X 2WXHA 1E8YA 4NJ7A 3AN1A 1I35A 4E74A 3PREA 4HLEA 3MJ5A 5E6OA 4ZHOA 1TGZB 3H1UA 1WZ0A 3ZXVA 2J52A 3QIJA 2BF8B 4I6LB 2JVCA 1NYQA 1TT5B 5IO9A 2RSUA 1ENFA 3URYA 3DBLI 1FRDA 2CHZA 2KK8A 5AEKB 1LGRA 2R2QA 2FNJB 3EA6A 1LM8B 3L17A 4GXBA 1YN4A 4IWOA 3NRZA 4ARIA 5EDSA 4OHJA 1XLQA 2BS2B 1WXSA 4W9GA 5FR3A 2XNAC 4PT5A 2DHZA 1E7PB 3Q14C 2BB5A 1L5PA 5L95C 2ZPYA 3Q8BA 1I4QA 2CU1A 2ZVOA 1I4HA 1HQRD 4YL8A 5MPOA 1GB4A 2N9PC 1E9MA 3RT3B 1YN5A 3NVWA 2RDBC 4MSQB 3RZWC 3IVFA 3TBLD 4DDID 4ZRJA 3ZNGC 4RGNA 3AU5A 3MC9A 3QAQA 2NS5A 4E71A 1K52A 2D3BA 3ZIMA 1XLNA 2G9HD 3JW0X 4DXAB 3AH7A 1Z2MA 4P1CC 1WGHA 3J9CA 4TUUA 5EE9A 3M95A 3NVZA 2BWES 1FXAA 2JZ3B 3VUXA 2GB1A 4NJCA 2WHIA 2RDGA 4W9CA 3W1YA 2LXCA 1YN3A 5E6NA 3SFEB 5BMGA 4KGTA 5E6JA 4C4VB 3L13A 1RM6C 1AWDA 2NR2A 4CYEA 1SJHD 1KJTA 4M8MA 3AEEB 3R66C 2BS3B 4II3B 1JWAD 1V1PB 4AUQC 3PV1A 2CR5A 1S1QB 3WIMA 2K25A 4OZCA 1P98A 2RMMA 3H7PB 3WAOA 2JZPA 4TKNA 5CHFA 5IAAC 4REZA 3BK1A 4MGKE 4WIPA 4KV2A 2BPSA 4XWWA 3HK0A 1GNUA 2TSSA 1CMXB 4NZLB 1M94A 4G50A 2JZZA 2LRWA 3L16A 4WURA 1Z5SB 2DAFA 3NUHB 4XDDA 1WX9A 3QA8A 4KGSA 3KWVA 1T0QC 1V5TA 2INPE 2WDQB 3APFA 4NJ6A 1P1AA 3VAWA 3PPAA 1QQRA 1WR6E 3W5VB 1WJ6A 2DNFA 2L32A 2HJ1A 3A9KB 2IO1B 2WGSA 1UELA 3UQBA 3A1QB 5TSSA 4PK1A 3Q3JA 4XYCA 4G11A 1V86A 1MHXA 2HD5B 1ZGUB 1TS3A 3PSEB 2QCZA 4Q2JA 1ZDXA 4ASWC 3AE4B 2D3GA 5LXIB 3DVGX 5BYRA 3R8BA 1QZEA 1UZXB 3AE1B 1OEYA 5LNK1 4FULA 2XBBC 1XO3A 3GE8C 3P42A 5BMIA 1XD3B 4N59A 5FKAC 3WALA 1GC7A 3N20C 2Z8LA 2LASA 4G0NB 1SB3C 3AE9B 3ALBA 1ZXHA 4PYUA 4RM9A 2BKRB 1WX7A 5T8IA 3VFKA 1K51A 3JSVA 3PO0A 4LJPB 2LVOA 4YT0B 2HTME 3RNFC 4KIKA 3C19A 2KFJA 4WJNA 3ENEA 1UWXA 3DBSA 1XLPA 2M0AA 2K9XA 4WWNA 3VVWB 2W55A 1VZ6A 2JQRB 3Q3NC 1TKEA 2MJ3A 3WCQA 4ICUA 3NHEB 1TZOA 3P1MA 3NS1A 2KQSA 2N9LA 2KYWA 1HXYD 4X57B 2JYEA 4JL9A 2LGIA 3Q3MC 1YQ4B 3RNBC 3RZFA 1TS4A 3UIPB 1IBXA 2DYBA 2WXKA 1L4ZB 2AQ3B 2NPTB 2WXOA 2N7JA 2OJWA 3Q8AA 5IN7A 1OQYA 2C9WB 2H88B 4MACA 3LDZE 3RI7C 3ZGZA 4BBNC 4IW0A 3HVZA 4M00A 4BOSC 2L1AA 1JMLA 3GB1A 3P4SB 4XWTA 3QC8B 4M02A 3Q3OC 4BAXA 5HHDG 1FNVA 5C23A 2N1VA 2C7NB 2VH2A 1ROEA 1SF0A 4J3OD 3KH0A 1WYWB 2KC1A 3DBRB 4P6VF 1XCQL 1F2RC 5H92C 4FHJA 1BXTA 3NOBA 1WGGA 1D6EC 3BZDB 4IG7B 2BT6A 2YLMA 5AZGA 3BINA 4DBGA 3SD5A 1I7HA 2WXRA 1E0ZA 1WY8A 3KWLA 1XQQA 2CU3A 2CJOA 2K39A 4L23A 1RFAA 3EHVA 1MHHE 1PUTA 3I3TB 4MT5A 2R2OA 2WX0A 1JWMD 4F7ZA 4JWUC 1GOZA 2AL3A 1V5OA 1K8RB 4IWPA 1TYGB 1YMHE 1KTKA 2JYTA 2PEAA 4C56C 3U2SC 3N3KB 4XX5A 2LVQA 3BY4B 1VJKA 2GBRA 4N9F4 1HA5A 4P1BC 1I4RA 2ZPNA 3DOWA 3SEBA 2JWUA 4ZRKA 1WJNA 2DYMA 1WM3A 2LUEA 3FAHA 4MGYE 4L1BA 3UINB 1WE6A 4R3DA 2N9KA 2XEWA 3Q8EA 1QOFA 4K3CA 1EU4A 4XGAB 5IKCM 2GBNA 2K22A 3HUIA 2LGSA 1RRBA 1I4XA 3TEWA 2L8JA 1YQ3B 2A4ZA 4OVUA 4S17A 1V9JA 3BYTB 3FKYA 1D4BA 4IDIA 4ZOHC 2PVOD 2PW9A 4US8A 2FUHB 3A9JA 4A6QA 2IY1B 2JXTA 2MJDA 1TZ1A 2LJ5A 2RPVA 4BOZB 1BMLC 2O6VB 2G3QB 2L7RA 1EWYC 2WXFA 1OGWA 4P16A 2DZKA 4OW0A 1FXIA 1HZ5A 2ZNVB 3EGRA 1E8XA 3I9V1 4HVBA 2K0PA 1B1ZA 4GU2A 5C3JB 1N62A 1UGJA 1E10A 2L52A 4NAMA 1P7FA 4C00A 1DGJA 1FRRA 2FCQA 4KSKC 5IA7A 2M19A 2WP9B 5AUKA 1WRDB 1FCCC 2V4LA 1OQRA 2B3AA 2MBHA 2IGGA 2J0JA 4MM3A 4A20A 5AUIA 2KDBA 1FNUA 1JCKB 3VRAB 2BQQA 3PTFC 3ZRCA 3SHQA 3OLMD 3C0RB 3RUIB 4K1RB 1IGDA 3ZNID 2D2QA 3MTNB 3RNAC 3ML9A 2G1EA 3U4EG 1L2NA 2V0GA 4YSYB 3AEAB 4GDKA 3OWEB 1AW7A 4AP4C 1MVKA 3KVFB 4MJSB 2KLGA 1DOXA 3LXFA 1SXTA 2DX5B 3CSFA 5CX3A 2ACZB 4NAWB 4DXFA 1QKZA 3AI5A 3NG0A 1QOAA 2KT7A 4C7YA 2LD9A 1LO5D 1F9JA 3PS6A 4ACFA 3M62B 2J53A 2KVRA 2AQ2B 2QMTA 2I38A 1ZPSA 3NY5A 4JPSA 4RGOS 1F1HA 2W82A 3AM9A 3PHXB 1VRAB 2VRRB 3BWUD 3D32A 2D3AA 3FILB 1WI0A 2J7QB 1FFUA 1PGAA 4WWOA 2WWZA 1J19A 2SEBD 1BUIC 1FM0D 4M8NA 2E3TA 1SSNA 5D3DA 1WM2A 1PDXA 1V80A 4LDTD 4NY0A 3Q8CA 3KYDD 5D7GA 4HCPB 4BKSA 2V9HA 1MG8A 4ITKA 4JQWC 1C3TA 3ZDTA 2KTRB 1OEYJ 4C7ZA 2NTSA 3A33B 3AE8B 1ZP0B 4IOIE 4AS1A 1LQBA 1IP9A 3AE2B 2INCC 2RD0A 2JT4B 1SIJA 4FN2A 1UGMA 5KHOA 4RH6A 4HPMB 1C76A 2M8SA 2V3SA 4HROA 2J0KA 3NZSA 1ACCA 3HM6X 4KVGB 2L00B 2Y5PA 1ISNA 2WXJA 3JVZX 2PE9A 4FADA 1WE7A 4GN1A 3U8ZA 1RWSA 2KFKB 3VUWA 1RAXA 1FMAD 2PMVA 2WXNA 1X1MA 4TMAB 2BS4B 1P3QU 1QOGA 2KXJA 1GC6A 2CS4A 3HVDA 2BGFA 1VCBA 2H89B 3ABVB 3DWMA 3C8YA 4GSWA 1CJEA 1SGHA 2D11A 4C4VA 4GIVA 3TEXA 4FXCA 2LZ6A 2Y5BB 1ZUD2 3ZNHB 4PYZA 3W2DA 3APDA 4KSLC 4NQKE 4ZRQA 2JF5A 5AZHA 1R4NI 1OFFA 4GGQA 3U30A 2LHEA 2D3CA 3TIXA 3P2BA 1V1PA 1V1OA 2AWTA 2NBUA 1Q1OA 1SE4A 1PYWD 3CWIA 4ZYSA 2PPHA 3H7PA 1KLUD 3PRMB 2WU2B 2NMQA 4IM0A 1FIQA 1JRUA 4KX6B 2IO2B 3N30A 2MHJA 5BO4B 2WXPA 2LVPA 5G55A 3GZNB 3T3OA 1IYFA 1H4RA 2KQ4X 2GI9A 2ONQA 1FNWA 4N58A 1YNTE 4RNAA 2JX5A 1NYRA 1BT0A 5L83A 2EELA 4OVZA 2WQYB 3EC8A 1XLOA 3NVYA 1JALA 2HE7A 2M4NA 3A9KA 1V6EA 3A1QA 3U52E 2IGDA 4I6NB 2LMCA 5JH5C 4KKIA 1SBBB 3ZO5B 3L08A 3T8MA 4JWSC 3ZXRA 2J42A 1WGDA 4AWJA 1SE9A 5GMVA 1VLBA 4XC2A 2OJRA 3VHTC 1YOVB 2XK5B 4HCNB 4LDTB 2ASQA 4FHKA 3H8HA 4TQ0A 3EECA 3RMKC 4B0MA 3CF6E 2LGDA 2I2YA 2JRHA 2EKIA 3B2FA 2EMTA 1FD6A 3RYTA 1UH6A 1RYJA 3IXSA 4W9EA 4MH0E 4FLHA 4IUMB 3DVGY 2AEHA 5J17A 2IPKD 4JGHB 4XZ4A 4J6IA 1N5WA 3QCAA 5H8YE 3B0AA 1V97A 4KZ0A 2RGFA 3VDZA 2KKCA 4B0EA 4IC7B 2G45B 2BYTA 2JRIB 3L10B 1I4PA 1L0XB 1T0SC 1WH3A 3CSTA 2G4SA 1U4AA 3RD2A 2KACA 2KDEB 3AE3B 2W9NA 2QJLA 3K9PB 3Q8FA 2W3RA 2KMCA 3KUCB 4TSSA 2PVGC 3QX1A 2MCNB 2KJ6A 2WXQA 3U7DA 1M4VA 1IGCA 2IGHA 1EU3A 2NPTA 1YJJA 2PTLA 4E3CA 1YJIA 2O6VD 4JE3B 3BIID 2NCNA 4YTPB 1ZKHA 2FUG1 4ANWA 1Y56A 4K7SA 4FJVB 4B9KA 1T3QA 2AYOB 4LLGM 4WAFA 3X23A 1V2YA 1LXDA 4MGZE 1P0RA 4GDLB 2N7DA 5D6JB 3FC4A 3TL5A 4GOCA 4BVUC 2AQ1B 5EE0A 2ZZPB 4DWFA 3HRDD 4W9LA 3Q3FA 3N9YC 3ZW3A 2REXA 2ZCCA 1H8CA 2KVZA 1Y8RC 1F77A 4DHZB 1N63A 2BW2A 1SJED 2FE8A 1E7VA 3QQ8B 4KKJA 3TSSA 1C77A 4FA6A 3ZDMC 1I42A 3ZTDA 3ZYYX 2KDIA 1F52A 1A5RA 2WNMA 2LGYA 1WZ3A 1GB1A 3VTWA 4HWIB 2QEJC 1ZW7A 5DCNA 4BBNF 1C78A 2CHXA 2I1KA 3CIRB 2KN5A 5G5HA 1L0YB 4EEWA 4EZKA 1VDVA 3CMMB 3RN9C 1JWBD 4IWQA 4A3OA 2FCMA 3KUDB 3DVNV 3B08A 2NVUI 4LK0M 1N60A 2J4XA 2LFIA 1A70A 3PLVA 2K8HA 3P4PB 1V81A 2KMMA 1FCLA 4YSZB 2OOBB 1KLGD 4OZBA 3BVZA 1DOYA 1J7CA 4ANUA 4DHZE 1KLVA 1C1YB 2NTTA 5JHAA 1UBQA 3DBHB 4GMVA 3S2AA 3RNCC 1QOBA 3V60A 3R3MA 3WANA 4RF0A 1ZXIA 2Q5WD 3SR6A 2KX3A 2DENB 2O6VA 2W3SA 3TEYA 2D10A 5G5GA 3UIOB 2VZKD 3ZNZB 4EE2A 3AMZA 3Q6BA 3VXWA 2IZVB 3R7RA 2CKHB 1TKGA 1FO4A 2WDRB 1K50A 1IPGA 1MFWA 3DWGC 3ZLZA 3IHPC 2LRUA 2OEDA 2V1YA 1UD7A 4OVVA 3W5UB 1PGXA 1WXVA 3I57A 2HDEA 3AEBB 4A9AA 2UWQA 3BVMA 3L4PA 4B6WA 1DOIA 2BYVE 2CJNA 3WAPA 4F1SA 3H6NA 3UI3A 2MSED 2FIDA 1YX5B 1L6UA 3BYYB 3T9LA 3WAMA 3DBRI 1WJ4A 1D5ZC 1ET6A 4WJQA 2GBMA 4MJSA 3M63B 4IM2A 1L6VA 2GLSA 4HPLB 1T5XD 5BMHA 4M01A 4K7UA 1SE2A 2J0MA 2Z59B 3ZQ4A 2MH7A 2WU5B 4NAWA 2L76A 2FBWB 2MBOA 4OZAA 2NBWB 3ECIA 5CHWA 4MGIE 1WYGA 1WRIA 4M0WB 2MQJA 2MBQA 2PE6B 3UF8A 1VZ7A 3N1YC 1RLFA 2KQ7A 1GJZA 4RMAA 1KM7A 2DZMA 2BKFA 2MJEA 4DXGA 1SEBD 5I4DA 3FILA 2KANA 2IJ0A 5DPSA 1K53A 1D5XC 1SIFA 4CQNA 2GOWA 4D2KA 4WWPA 1WMHB 2M56B 1UUPA 2KC2A 2KTRA 1LFDA 1XCTL 1TS2A 1HE8A 1SE3A 4EFOA 5IP4D 4DK5A 1WFYA 5LLIA 2MEKA 5G2NA 3VRBB 2QILA 4KDLB 1E6EB 3EFCA 4MH8A 2JSVX 3ZVVA 3IFWB 3UQAA 2ZVNA 4K81A 4UDUC 4A8XC 2JPHA 4YSXB 2ZW0A 4PS3A 4TV3A 4BZAA 3DCGA 1WIAA 4BKGA 1GUAB 3L0WB 4HXDA 2MWSB 3V05A 1JWSD 3VTUA 2LHDA 2A5UA 3B9JA 2KX0A 2IDYA 4KGRA 3N32A 3SFDB 2KFKA 2WYQA 5CHVC 4MELA 1WXAA 2MP2B 1L0VB 3PGEA 3A4RA 3TUOA 1WSPA 1XT9B 3H7SA 3DHHC 1XF5L 1S3SG 3DQVA 5FR6A 2PLPA 3PZ7A 2VZKB 1KOTA 4W9FA 5J18A 4ZRIA 2IY0B 5C1ZA 3MP9A 1ZDVA 4HDQA 2LJIA 2VH1A 1NBFC 1C4CA 2ZNVC 3RNGC 4LJOB 1WXQA 1F0ZA 2FCNA 3AU4A 1GG3A 1FXTB 1JRPA 1MG4A 3VH3B 2SAKA 2DLBA 5DPRA 2K3UA 2YEPB 3ZKJC 1MJDA 4HEA1 1NVID 3O65B 1T6BX 3NVVA 2Y3AA 1ZOYB 1XXGA 2L0FA 1WWTA 1C79A 1P9DU 4HDOA 1EF1A 1VR9A 1PQSA 3T3NA 4HPPA 2ZEQA 2QDFA 4B95A 5FK9C 2C5LC 5TR5A 5LXHA 3NZ3A 2BTEA 3OG5A 4XE0A 2KWUB 2JWZA 1D3ZA 2GBKA 4N6EB 2ZCBA 2NBVB 1HTQA 3L54A 3OJ3A 4RGMA 1KRHA 3MFGA 1DYQA 1QT9A 2LEKA 1ESFA 1N6ZA 2WXMA 3DHGC 4A55A 4II2B 2KHWB 4KZCA 5EE3A 3V61A 1V8CA 5HKHA 3P4QB 4IM3A 1JROA 4DDGD 3IAS1 1AARA 1Q5WB 1J7BA 4HK2A 2E6XA 2KO3A 3EFUA 2ZJDA 3ETRA 4PS8A 3KYCD 4WJPA 3B1LX 1E8WA 1WGRA 3MHZA 4ZRPA 2XK5A 4DHJD 4NNJB 5HG2A 1VD2A 1WXMA 4USAA 1UWMA 2KDFB 3MJWA 3AV8A 2RPQA 3AEFB 5DPTA 2ON8A 3V6CB 4W9JA 4JIOU 4YXDB 2LGXA 1AN8A 1WX8A 2KN4A 2DZIA 3AE5B 2X38A 1YIWA 2INDC 3LB8C 3NJTA 5JXVA 4NPNA 3P4RB 1XEEA 2BYFA 3PRPB 2GBJA 2INNE 4PS7A 5KHQA 3IG3A 2DBYA 2N4FA 2WX1A 2N1WA 1EM7A 2V4IB 4URKA 2D5GA 1UNSA 5E6PA 4HRSA 3ZJTA 1Q10A 4AJYB 3VUYA 4WJOA 4LNIA 3Q69A 2GRIA 3ZJUA 2KLCA 2KWVB 2G4DB 2K8CA 2EKEC 5BYQA 3BVGA 2MW5A 3DHIC 4TQ1A 2MBBB 3PRZA 5IOIA 2KJHB 1T0RC 2RDHA 1TJEA 2YEPF 3HHMA 4LCDE 4AOFA 3QARA 4LNKA 3PHWB 4WAAA 4YTNB 1NI2A 3ZUNA 1D5MC 1V49A 1YD8U 2KNBA 3U7ZA 5J2RA 2WLBA 4MEMA 5AZFA 1QLBB 4GDLA 3IBEA 1GPXA 3AXCA 2UU7A 2AL6A 1E7UA 2K8BA 3H9DA 3GZNI 4CO7A 3JYUA 4WWMA 4W9DA 2KWCA 4FJZA 4US9A 1EO6A 3LYYA 4RFBA 3LJ3A 3TEZA 3W1SA 2IYDB 3OJ4B 5D2MB 4MSMB 3HIZA 5JZEB 1TY2A 2Z0EB 1MPEA 2FIFA 3QK0A 3M3JA 4EKUA 3E56A 4HJKA 4RCOA 1CK1A 3DPDA 3PT2B 2IO0B 5GXGB 1UBIA 4P7IA 3AEDB 4YWGG 1CZPA 1EWCA 3RCZA 3IT4B 2HTHA 4JLCA 2X8XX 4WH4A 4GB9A 2BB6A 2JXXA 2N7EA 4DHJB 2L0TA 1YJ1A 2K6QA 4HKQA 1C9FA 2IO3B 3AEGB 3JSVB 3GE3C 4RGTA 3AECB 4JX1C 2QSDA 2YVCA 1HTOA 4C80A 4EOYA 2UYZB 4F8CB 1F2RI 1TIFA 4KIKB 4K3BA 2C7MB 3VH4B 3VQIA 2L05A 3RFZB 5BYSA 3IT6B 3SDLC 2XN9C 4G3XB 4ICVA 2WS3B 3O13A 4WQOB 4YTMB 1PGBA 1NEKB 3ML8A 4I6PA 2LXAA 4EUTA 4ANXA 2V3PA 4IKGA 2FAZA 2KOXA 3KUZA 4H2AA 4A3PA 2DZJA 1AYFA 2KJRA 1I4GA 1C4PA 3AE6B 1OQQA 3A4SC 1IBXB 3Q2AC 3I5JC 2PKOA 1P7EA 4A90A 3MC0B 4W9KA 1YQBA 1ET9A 4ANVA 1E5WA 1TS5A 2O2VA 3AULA 3NZUA 2WXIA 3PZ8A 3TMPB 2EMSA 5EE1A 4CHKA 2PIAA 1UF0A 3P63A 4S0RA 4L2YA 3ZRFA 3N1XC 3QHTA 1NDDA 4HKZE 3ZTCA 1KH0A 2QIEB 4ZHPA 3OAWA 3EUB2 1OTRB 3PVLA 4BKTA 1TBEA 2KMAA 2M0XA 3VTVA 3WA0A 2CHWA 3RULA 3TCAA 2K1FA
chains in the Genus database with same CATH topology
1XCTL 5T8IA 1SE4A 4ARCA 1PYWD 1TS2A 3CWIA 4ZYSA 1K51A 1SE3A 3PO0A 3IAM1 2MEKA 1KLUD 3VRBB 2WU2B 2NMQA 4YT0B 1FIQA 2HTME 1J7AA 2QILA 4KX6B 1E6EB 4MH8A 2JSVX 1UWXA 1ZE3D 4UDUC 4A8XC 4YSXB 1XLPA 2K5PA 2ZW0A 2WXPA 2M0AA 2K9XA 2KWDA 3T3OA 2W55A 1VZ6A 2JQRB 2KQ4X 2GI9A 2W54A 1TKEA 2MJ3A 2ONQA 1FNWA 4N58A 1NENB 1YNTE 4RNAA 3V05A 2JX5A 3WCQA 1JWSD 1NYRA 4DQOC 3R2IA 2LHDA 1TZOA 3ZJVA 3P1MA 2EELA 3NS1A 4OVZA 2WQYB 2N9LA 3B9JA 4RF1A 1XLOA 2IDYA 1JALA 1FEHA 3NVYA 4KGRA 3SFDB 1HXYD 1QF6A 4GLSC 1L0VB 2JYEA 1KFYB 2WDVB 3TUOA 2LGIA 1PFDA 1WSPA 1YQ4B 4M0WA 3U52E 5C2TB 1XF5L 2PLPA 1N5XA 2IGDA 1TS4A 3PZ7A 1HZ6A 2VZKB 1IBXA 2LMCA 2WXKA 1L4ZB 2AQ3B 4XDCA 2WXOA 4KKIA 1SBBB 2N7JA 3VR8B 3Q8AA 4JWSC 2J42A 2H88B 4MACA 3B2GA 1MI0A 3MP9A 1ZDVA 4AQ7A 5HFYA 2LJIA 1VLBA 1C4CA 3AB5A 3ZGZA 5HI1A 2JU6X 2N0SB 1QILA 3AE7B 1N61A 3HVZA 2L1AA 1WXQA 3H8HA 2R61A 1F0ZA 1IUEA 1JMLA 3GB1A 3P4SB 4TQ0A 4XWTA 1JRPA 2SAKA 2DLBA 2K3UA 5HHDG 2YEPB 1FNVA 4B0MA 2ZW1A 1JWUD 4HEA1 2V3NA 4J3OD 1ROEA 1SF0A 2I2YA 3R2TA 4P6VF 1NVID 2EKIA 1XCQL 1F2RC 3B2FA 3V3XA 1FD6A 1TY0A 1T6BX 1RYJA 5H92C 1L4DB 3IXSA 1STEA 3NVVA 1BXTA 1C4AA 1D6EC 2Y3AA 1TKYA 1XXGA 1ZOYB 2DYOA 3BZDB 4LTUA 2BT6A 2IPKD 1WWTA 2ICIA 1C79A 1I7HA 2WXRA 1N5WA 5H8YE 2B76B 4HJGE 1VR9A 3T3NA 1KF6B 1V97A 1E0ZA 3KWLA 4B0EA 2CU3A 5FK9C 2CJOA 2BYTA 3NZ3A 2BTEA 4L23A 1I4PA 4XE0A 1L0XB 1MHHE 1PUTA 1VZ8A 4MT5A 3KLSX 2KACA 3AE3B 1JWMD 2AX5A 4JWUC 4N6EB 2QJLA 1GAQB 3Q8FA 3W9CB 1GOZA 2BBCA 2W3RA 4TSSA 4RGMA 1KRHA 1TYGB 2L83A 3MFGA 1YMHE 1KTKA 2JYTA 2PVGC 4C56C 3U2SC 1DYQA 1QT9A 1HEZE 2LEKA 2Y5CA 2DWQA 1ESFA 1VJKA 2WXMA 4A55A 4MM3B 1HA5A 2WXQA 1I4RA 1M4VA 1IGCA 5EE3A 2IGHA 1V8CA 1EU3A 1YJJA 3SEBA 2PTLA 2JWUA 3P4QB 2DYMA 1JROA 1JQ4A 3IAS1 3FAHA 1J7BA 3VR9B 1YJIA 2E6XA 4L1BA 3ETRA 4JE3B 3BIID 4R3DA 4YTPB 3MHZA 1WGKA 2FUG1 3RPFC 4ZRPA 1Y56A 2N9KA 3Q8EA 1QOFA 1EU4A 3KQ4A 5HG2A 2K22A 3HUIA 4WQMA 4GDKB 1NI3A 3TEWA 1I4XA 3GP7A 4USAA 1T3QA 1UWMA 1YQ3B 1R7SA 3BYTB 2LUMA 2OHFA 1FFVA 4LLGM 4WAFA 3AV8A 1CQVA 1D4BA 3AEFB 3GS2A 4GDLB 2WXLA 1B9RA 2ON8A 1JW9D 4IDIA 4ZOHC 2PVOD 2PW9A 4US8A 3FC4A 4YXDB 1RFKA 2WXGA 4A6QA 3E9SA 2JXTA 1AN8A 2KDMA 2MJDA 4O1NA 2KN4A 3AE5B 2AQ1B 2X38A 5EE0A 3LB8C 5JXVA 2RPVA 3HRDD 5D3IB 3N9YC 3P4RB 1XEEA 3BK2A 1BMLC 2INNE 2KAJA 1EWYC 2WXFA 4P16A 2WXHA 2DBYA 4OW0A 1FXIA 1F77A 1HZ5A 3AN1A 3EGRA 1N63A 1EM7A 1SJED 2BW2A 3I9V1 2FE8A 3MJ5A 2V4IB 4KKJA 2D5GA 2K0PA 1B1ZA 4ZHOA 5C3JB 1N62A 1UNSA 1UGJA 1C77A 3TSSA 4HRSA 3ZJTA 1E10A 2L52A 1Q10A 4NAMA 1P7FA 2J52A 1DGJA 1FRRA 3ZYYX 2M19A 1NYQA 2WP9B 5AUKA 2WNMA 1GB1A 1FCCC 3Q69A 2GRIA 1ENFA 2QEJC 3ZJUA 3URYA 1FRDA 1C78A 1OQRA 5BYQA 3BVGA 2IGGA 3CIRB 5G5HA 1L0YB 3EA6A 1VDVA 5AUIA 1FNUA 1JWBD 1JCKB 3VRAB 4TQ1A 1YN4A 3NRZA 4ARIA 2RDHA 4OHJA 1XLQA 1IGDA 4LK0M 1TJEA 2BS2B 1N60A 5FR3A 2XNAC 2YEPF 2J4XA 2LFIA 4PT5A 1E7PB 2BB5A 1A70A 1L5PA 4YTNB 3Q8BA 1I4QA 3P4PB 2G1EA 1D5MC 3U4EG 2KMMA 2V0GA 1FCLA 4YSYB 3AEAB 4YSZB 3U7ZA 1KLGD 4OZBA 3BVZA 3OWEB 1I4HA 1HQRD 1J7CA 1DOYA 1AW7A 5MPOA 2WLBA 1GB4A 1E9MA 1MVKA 1YN5A 3NVWA 1QLBB 1DOXA 2NTTA 3LXFA 1SXTA 4RGNA 1GPXA 1K52A 1XLNA 2ACZB 2G9HD 4NAWB 3AH7A 1QOBA 4DXFA 1QKZA 4WWMA 4RF0A 1QOAA 3J9CA 1ZXIA 2Q5WD 3SR6A 4C7YA 5EE9A 4US9A 1LO5D 3NVZA 3LYYA 4RFBA 1FXAA 3TEZA 3W1SA 2W3SA 3TEYA 2GB1A 4NJCA 5G5GA 2J53A 2QMTA 2AQ2B 2RDGA 2I38A 1ZPSA 2VZKD 4EE2A 3AMZA 4JPSA 4RGOS 1TY2A 2W82A 1MPEA 3AM9A 1TKGA 1YN3A 1VRAB 1FO4A 3BWUD 3SFEB 2WDRB 1K50A 5BMGA 4KGTA 3DWGC 3FILB 5E6JA 3E56A 1FFUA 1PGAA 4RCOA 1RM6C 2SEBD 1CK1A 1AWDA 1BUIC 1FM0D 2E3TA 5GXGB 1SSNA 3AEDB 4YWGG 5D3DA 2OEDA 1CZPA 1EWCA 1SJHD 1PDXA 3IT4B 3W5UB 3Q8CA 1PGXA 5D7GA 3AEEB 2HDEA 3AEBB 3I57A 4A9AA 4WH4A 2BS3B 3BVMA 3L4PA 1DOIA 4ITKA 1JWAD 2BB6A 1V1PB 2CJNA 3UI3A 4C7ZA 2NTSA 4OZCA 4HKQA 3AE8B 2RMMA 1ZP0B 1C9FA 3AEGB 4IOIE 2JZPA 4RGTA 4REZA 3BK1A 3AECB 4JX1C 2QSDA 4WIPA 1L6UA 4C80A 3BYYB 4AS1A 1D5ZC 1F2RI 1ET6A 3AE2B 4XWWA 2TSSA 1SIJA 4NZLB 3VQIA 1L6VA 4RH6A 3RFZB 1C76A 1T5XD 4WURA 4HROA 5BMHA 1ACCA 5BYSA 3IT6B 3NUHB 4XDDA 1SE2A 4KGSA 2Y5PA 3KWVA 2INPE 2WDQB 2XN9C 3ZQ4A 2WXJA 2MH7A 2WU5B 2WS3B 1QQRA 2FBWB 1RWSA 3O13A 3W5VB 4YTMB 1PGBA 4OZAA 2L32A 1FMAD 1NEKB 2PMVA 2WXNA 1WYGA 1WRIA 5TSSA 2V3PA 4IKGA 4TMAB 4H2AA 1AYFA 1I4GA 1C4PA 1VZ7A 1MHXA 2BS4B 3AE6B 1OQQA 1QOGA 1IBXB 1TS3A 3HVDA 2PKOA 1P7EA 4A90A 3MC0B 2H89B 3ABVB 3DWMA 1ET9A 3C8YA 2MJEA 4Q2JA 4DXGA 1SEBD 1TS5A 1ZDXA 3AE4B 2WXIA 5BYRA 3R8BA 3PZ8A 1CJEA 3FILA 5I4DA 2IJ0A 3TEXA 3AE1B 4FXCA 5EE1A 5LNK1 2PIAA 1K53A 3P63A 4L2YA 1ZUD2 1D5XC 1XO3A 3W2DA 4HKZE 3P42A 1KH0A 5BMIA 2QIEB 4ZRQA 4ZHPA 4N59A 4CQNA 3EUB2 5FKAC 1OFFA 4D2KA 2Z8LA 2LHEA 1V1PA 2M56B 1SB3C 1V1OA 1UUPA 3AE9B 1ZXHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1XCT L;  2OED A;  4HJG E;  1Q10 A;  1P7F A;  2J52 A;  1K51 A;  1PGX A;  4WH4 A;  2NMQ A;  1GB1 A;  1FCC C;  1MHH E;  2JSV X;  1UWX A;  2IGG A;  3UI3 A;  2KAC A;  2ZW0 A;  4OZC A;  2RMM A;  1C9F A;  2KWD A;  4IOI E;  2JZP A;  2KQ4 X;  2GI9 A;  1YMH E;  2ONQ A;  2QSD A;  1YNT E;  1HEZ E;  1F2R I;  2LHD A;  2EEL A;  1IGD A;  2N9L A;  4KGR A;  1IGC A;  4GLS C;  2IGH A;  5BMH A;  2PTL A;  2JWU A;  1FCL A;  2LGI A;  4KGS A;  4OZB A;  1GB4 A;  1MVK A;  1XF5 L;  2PLP A;  2IGD A;  1HZ6 A;  1IBX A;  2N9K A;  1PGB A;  4OZA A;  2N7J A;  5HG2 A;  1K52 A;  4MAC A;  1MI0 A;  4IKG A;  3MP9 A;  2LUM A;  5HFY A;  1QKZ A;  1MHX A;  1IBX B;  1D4B A;  5HI1 A;  2JU6 X;  2ON8 A;  1P7E A;  2PW9 A;  2JXT A;  2KDM A;  1JML A;  2GB1 A;  3GB1 A;  2KN4 A;  2J53 A;  2QMT A;  3FIL A;  2I38 A;  5JXV A;  1K53 A;  2RPV A;  5HHD G;  2ZW1 A;  1MPE A;  4HKZ E;  2I2Y A;  1KH0 A;  5BMI A;  1XCQ L;  1F2R C;  3V3X A;  1K50 A;  5BMG A;  1FD6 A;  4KGT A;  1HZ5 A;  4D2K A;  3FIL B;  1EM7 A;  2LHE A;  1PGA A;  2K0P A;  1ZXH A; 
#chains in the Genus database with same CATH topology
 3ONS A;  3R7Q A;  4ARC A;  2GMI C;  1EUV B;  3IAM 1;  1R4M B;  2KD0 A;  4ZDV A;  2M17 A;  4W9H A;  1J7A A;  4AJW A;  1WF9 A;  2O2V B;  1ZE3 D;  3X0W A;  2K5P A;  1E90 A;  3GOE A;  2KWD A;  2W54 A;  1NEN B;  4DQO C;  3ZJV A;  3R2I A;  2LI5 A;  1J0G A;  2JY6 A;  4RF1 A;  1FEH A;  4RM8 A;  2QHO A;  1QF6 A;  4GLS C;  3TJP A;  2K6D B;  5D94 A;  1KFY B;  2WDV B;  2N9E B;  1PFD A;  1J8C A;  4M0W A;  2BVC A;  5C2T B;  4FJY A;  1N5X A;  4EZJ A;  1HZ6 A;  4LNO A;  2IBI B;  4LNF A;  4XDC A;  3VR8 B;  3NS8 A;  4W9I A;  3UGB B;  2LWP A;  4BKS D;  3B2G A;  1MI0 A;  2RR9 A;  2JUO A;  4AQ7 A;  5HFY A;  3W1S C;  3V6E B;  2MRP A;  3AB5 A;  3PLU A;  5HI1 A;  2JU6 X;  5CTR C;  2N0S B;  1QIL A;  3AE7 B;  1N61 A;  1T0Y A;  2R61 A;  1IUE A;  1WMH A;  2N9X A;  2HJ8 A;  2ZW1 A;  1JWU D;  2V3N A;  2C7H A;  3R2T A;  3A9J B;  3PZD A;  3V3X A;  1TY0 A;  3K9O B;  4KDI C;  5DPW A;  1L4D B;  3HM3 A;  1STE A;  1C4A A;  3DBH I;  4QAY A;  2BYE A;  1TKY A;  2DYO A;  4LTU A;  3DDC B;  2M1M A;  2ICI A;  3DBL B;  2KTF A;  2B76 B;  4HJG E;  2C60 A;  1KF6 B;  1YX6 B;  3QJZ A;  2QC8 A;  1TTN A;  1Q0W B;  2MA9 B;  1VZ8 A;  3KLS X;  4K7W A;  1EF5 A;  2AX5 A;  3QWZ B;  2KZR A;  3I63 C;  1G6J A;  1GAQ B;  2DAJ A;  1R4M I;  3W9C B;  2MP2 A;  4BFR A;  1WGY A;  2BBC A;  2MBE A;  2MLB A;  2L83 A;  2Z0D B;  2FCS A;  3MHS D;  1HEZ E;  2Y5C A;  2DWQ A;  4ZYN A;  3MC8 A;  2PJH A;  2WDT B;  4EZL A;  4MM3 B;  3KW5 B;  2MX2 A;  3N1Z C;  3APC A;  1WR1 A;  1L7Y A;  1JQ4 A;  3DVN U;  3VR9 B;  2I1J A;  1WGK A;  1R4N B;  3RPF C;  4NQL B;  3RNE C;  1FPY A;  3KQ4 A;  1WJU A;  2BWF A;  4WQM A;  4GDK B;  1NI3 A;  3GP7 A;  1R7S A;  2LUM A;  2OHF A;  1FFV A;  1CQV A;  2D07 B;  3GS2 A;  3V62 A;  1B9R A;  2WXL A;  1E8Z A;  1JW9 D;  4LNN A;  1RFK A;  2WXG A;  3E9S A;  2KDM A;  4MDK E;  4O1N A;  5D3I B;  3BK2 A;  2KAJ A;  5JHB A;  2L3Z A;  4FBJ B;  3SU8 X;  2WXH A;  1E8Y A;  4NJ7 A;  3AN1 A;  1I35 A;  4E74 A;  3PRE A;  4HLE A;  3MJ5 A;  5E6O A;  4ZHO A;  1TGZ B;  3H1U A;  1WZ0 A;  3ZXV A;  2J52 A;  3QIJ A;  2BF8 B;  4I6L B;  2JVC A;  1NYQ A;  1TT5 B;  5IO9 A;  2RSU A;  1ENF A;  3URY A;  3DBL I;  1FRD A;  2CHZ A;  2KK8 A;  5AEK B;  1LGR A;  2R2Q A;  2FNJ B;  3EA6 A;  1LM8 B;  3L17 A;  4GXB A;  1YN4 A;  4IWO A;  3NRZ A;  4ARI A;  5EDS A;  4OHJ A;  1XLQ A;  2BS2 B;  1WXS A;  4W9G A;  5FR3 A;  2XNA C;  4PT5 A;  2DHZ A;  1E7P B;  3Q14 C;  2BB5 A;  1L5P A;  5L95 C;  2ZPY A;  3Q8B A;  1I4Q A;  2CU1 A;  2ZVO A;  1I4H A;  1HQR D;  4YL8 A;  5MPO A;  1GB4 A;  2N9P C;  1E9M A;  3RT3 B;  1YN5 A;  3NVW A;  2RDB C;  4MSQ B;  3RZW C;  3IVF A;  3TBL D;  4DDI D;  4ZRJ A;  3ZNG C;  4RGN A;  3AU5 A;  3MC9 A;  3QAQ A;  2NS5 A;  4E71 A;  1K52 A;  2D3B A;  3ZIM A;  1XLN A;  2G9H D;  3JW0 X;  4DXA B;  3AH7 A;  1Z2M A;  4P1C C;  1WGH A;  3J9C A;  4TUU A;  5EE9 A;  3M95 A;  3NVZ A;  2BWE S;  1FXA A;  2JZ3 B;  3VUX A;  2GB1 A;  4NJC A;  2WHI A;  2RDG A;  4W9C A;  3W1Y A;  2LXC A;  1YN3 A;  5E6N A;  3SFE B;  5BMG A;  4KGT A;  5E6J A;  4C4V B;  3L13 A;  1RM6 C;  1AWD A;  2NR2 A;  4CYE A;  1SJH D;  1KJT A;  4M8M A;  3AEE B;  3R66 C;  2BS3 B;  4II3 B;  1JWA D;  1V1P B;  4AUQ C;  3PV1 A;  2CR5 A;  1S1Q B;  3WIM A;  2K25 A;  4OZC A;  1P98 A;  2RMM A;  3H7P B;  3WAO A;  2JZP A;  4TKN A;  5CHF A;  5IAA C;  4REZ A;  3BK1 A;  4MGK E;  4WIP A;  4KV2 A;  2BPS A;  4XWW A;  3HK0 A;  1GNU A;  2TSS A;  1CMX B;  4NZL B;  1M94 A;  4G50 A;  2JZZ A;  2LRW A;  3L16 A;  4WUR A;  1Z5S B;  2DAF A;  3NUH B;  4XDD A;  1WX9 A;  3QA8 A;  4KGS A;  3KWV A;  1T0Q C;  1V5T A;  2INP E;  2WDQ B;  3APF A;  4NJ6 A;  1P1A A;  3VAW A;  3PPA A;  1QQR A;  1WR6 E;  3W5V B;  1WJ6 A;  2DNF A;  2L32 A;  2HJ1 A;  3A9K B;  2IO1 B;  2WGS A;  1UEL A;  3UQB A;  3A1Q B;  5TSS A;  4PK1 A;  3Q3J A;  4XYC A;  4G11 A;  1V86 A;  1MHX A;  2HD5 B;  1ZGU B;  1TS3 A;  3PSE B;  2QCZ A;  4Q2J A;  1ZDX A;  4ASW C;  3AE4 B;  2D3G A;  5LXI B;  3DVG X;  5BYR A;  3R8B A;  1QZE A;  1UZX B;  3AE1 B;  1OEY A;  5LNK 1;  4FUL A;  2XBB C;  1XO3 A;  3GE8 C;  3P42 A;  5BMI A;  1XD3 B;  4N59 A;  5FKA C;  3WAL A;  1GC7 A;  3N20 C;  2Z8L A;  2LAS A;  4G0N B;  1SB3 C;  3AE9 B;  3ALB A;  1ZXH A;  4PYU A;  4RM9 A;  2BKR B;  1WX7 A;  5T8I A;  3VFK A;  1K51 A;  3JSV A;  3PO0 A;  4LJP B;  2LVO A;  4YT0 B;  2HTM E;  3RNF C;  4KIK A;  3C19 A;  2KFJ A;  4WJN A;  3ENE A;  1UWX A;  3DBS A;  1XLP A;  2M0A A;  2K9X A;  4WWN A;  3VVW B;  2W55 A;  1VZ6 A;  2JQR B;  3Q3N C;  1TKE A;  2MJ3 A;  3WCQ A;  4ICU A;  3NHE B;  1TZO A;  3P1M A;  3NS1 A;  2KQS A;  2N9L A;  2KYW A;  1HXY D;  4X57 B;  2JYE A;  4JL9 A;  2LGI A;  3Q3M C;  1YQ4 B;  3RNB C;  3RZF A;  1TS4 A;  3UIP B;  1IBX A;  2DYB A;  2WXK A;  1L4Z B;  2AQ3 B;  2NPT B;  2WXO A;  2N7J A;  2OJW A;  3Q8A A;  5IN7 A;  1OQY A;  2C9W B;  2H88 B;  4MAC A;  3LDZ E;  3RI7 C;  3ZGZ A;  4BBN C;  4IW0 A;  3HVZ A;  4M00 A;  4BOS C;  2L1A A;  1JML A;  3GB1 A;  3P4S B;  4XWT A;  3QC8 B;  4M02 A;  3Q3O C;  4BAX A;  5HHD G;  1FNV A;  5C23 A;  2N1V A;  2C7N B;  2VH2 A;  1ROE A;  1SF0 A;  4J3O D;  3KH0 A;  1WYW B;  2KC1 A;  3DBR B;  4P6V F;  1XCQ L;  1F2R C;  5H92 C;  4FHJ A;  1BXT A;  3NOB A;  1WGG A;  1D6E C;  3BZD B;  4IG7 B;  2BT6 A;  2YLM A;  5AZG A;  3BIN A;  4DBG A;  3SD5 A;  1I7H A;  2WXR A;  1E0Z A;  1WY8 A;  3KWL A;  1XQQ A;  2CU3 A;  2CJO A;  2K39 A;  4L23 A;  1RFA A;  3EHV A;  1MHH E;  1PUT A;  3I3T B;  4MT5 A;  2R2O A;  2WX0 A;  1JWM D;  4F7Z A;  4JWU C;  1GOZ A;  2AL3 A;  1V5O A;  1K8R B;  4IWP A;  1TYG B;  1YMH E;  1KTK A;  2JYT A;  2PEA A;  4C56 C;  3U2S C;  3N3K B;  4XX5 A;  2LVQ A;  3BY4 B;  1VJK A;  2GBR A;  4N9F 4;  1HA5 A;  4P1B C;  1I4R A;  2ZPN A;  3DOW A;  3SEB A;  2JWU A;  4ZRK A;  1WJN A;  2DYM A;  1WM3 A;  2LUE A;  3FAH A;  4MGY E;  4L1B A;  3UIN B;  1WE6 A;  4R3D A;  2N9K A;  2XEW A;  3Q8E A;  1QOF A;  4K3C A;  1EU4 A;  4XGA B;  5IKC M;  2GBN A;  2K22 A;  3HUI A;  2LGS A;  1RRB A;  1I4X A;  3TEW A;  2L8J A;  1YQ3 B;  2A4Z A;  4OVU A;  4S17 A;  1V9J A;  3BYT B;  3FKY A;  1D4B A;  4IDI A;  4ZOH C;  2PVO D;  2PW9 A;  4US8 A;  2FUH B;  3A9J A;  4A6Q A;  2IY1 B;  2JXT A;  2MJD A;  1TZ1 A;  2LJ5 A;  2RPV A;  4BOZ B;  1BML C;  2O6V B;  2G3Q B;  2L7R A;  1EWY C;  2WXF A;  1OGW A;  4P16 A;  2DZK A;  4OW0 A;  1FXI A;  1HZ5 A;  2ZNV B;  3EGR A;  1E8X A;  3I9V 1;  4HVB A;  2K0P A;  1B1Z A;  4GU2 A;  5C3J B;  1N62 A;  1UGJ A;  1E10 A;  2L52 A;  4NAM A;  1P7F A;  4C00 A;  1DGJ A;  1FRR A;  2FCQ A;  4KSK C;  5IA7 A;  2M19 A;  2WP9 B;  5AUK A;  1WRD B;  1FCC C;  2V4L A;  1OQR A;  2B3A A;  2MBH A;  2IGG A;  2J0J A;  4MM3 A;  4A20 A;  5AUI A;  2KDB A;  1FNU A;  1JCK B;  3VRA B;  2BQQ A;  3PTF C;  3ZRC A;  3SHQ A;  3OLM D;  3C0R B;  3RUI B;  4K1R B;  1IGD A;  3ZNI D;  2D2Q A;  3MTN B;  3RNA C;  3ML9 A;  2G1E A;  3U4E G;  1L2N A;  2V0G A;  4YSY B;  3AEA B;  4GDK A;  3OWE B;  1AW7 A;  4AP4 C;  1MVK A;  3KVF B;  4MJS B;  2KLG A;  1DOX A;  3LXF A;  1SXT A;  2DX5 B;  3CSF A;  5CX3 A;  2ACZ B;  4NAW B;  4DXF A;  1QKZ A;  3AI5 A;  3NG0 A;  1QOA A;  2KT7 A;  4C7Y A;  2LD9 A;  1LO5 D;  1F9J A;  3PS6 A;  4ACF A;  3M62 B;  2J53 A;  2KVR A;  2AQ2 B;  2QMT A;  2I38 A;  1ZPS A;  3NY5 A;  4JPS A;  4RGO S;  1F1H A;  2W82 A;  3AM9 A;  3PHX B;  1VRA B;  2VRR B;  3BWU D;  3D32 A;  2D3A A;  3FIL B;  1WI0 A;  2J7Q B;  1FFU A;  1PGA A;  4WWO A;  2WWZ A;  1J19 A;  2SEB D;  1BUI C;  1FM0 D;  4M8N A;  2E3T A;  1SSN A;  5D3D A;  1WM2 A;  1PDX A;  1V80 A;  4LDT D;  4NY0 A;  3Q8C A;  3KYD D;  5D7G A;  4HCP B;  4BKS A;  2V9H A;  1MG8 A;  4ITK A;  4JQW C;  1C3T A;  3ZDT A;  2KTR B;  1OEY J;  4C7Z A;  2NTS A;  3A33 B;  3AE8 B;  1ZP0 B;  4IOI E;  4AS1 A;  1LQB A;  1IP9 A;  3AE2 B;  2INC C;  2RD0 A;  2JT4 B;  1SIJ A;  4FN2 A;  1UGM A;  5KHO A;  4RH6 A;  4HPM B;  1C76 A;  2M8S A;  2V3S A;  4HRO A;  2J0K A;  3NZS A;  1ACC A;  3HM6 X;  4KVG B;  2L00 B;  2Y5P A;  1ISN A;  2WXJ A;  3JVZ X;  2PE9 A;  4FAD A;  1WE7 A;  4GN1 A;  3U8Z A;  1RWS A;  2KFK B;  3VUW A;  1RAX A;  1FMA D;  2PMV A;  2WXN A;  1X1M A;  4TMA B;  2BS4 B;  1P3Q U;  1QOG A;  2KXJ A;  1GC6 A;  2CS4 A;  3HVD A;  2BGF A;  1VCB A;  2H89 B;  3ABV B;  3DWM A;  3C8Y A;  4GSW A;  1CJE A;  1SGH A;  2D11 A;  4C4V A;  4GIV A;  3TEX A;  4FXC A;  2LZ6 A;  2Y5B B;  1ZUD 2;  3ZNH B;  4PYZ A;  3W2D A;  3APD A;  4KSL C;  4NQK E;  4ZRQ A;  2JF5 A;  5AZH A;  1R4N I;  1OFF A;  4GGQ A;  3U30 A;  2LHE A;  2D3C A;  3TIX A;  3P2B A;  1V1P A;  1V1O A;  2AWT A;  2NBU A;  1Q1O A;  1SE4 A;  1PYW D;  3CWI A;  4ZYS A;  2PPH A;  3H7P A;  1KLU D;  3PRM B;  2WU2 B;  2NMQ A;  4IM0 A;  1FIQ A;  1JRU A;  4KX6 B;  2IO2 B;  3N30 A;  2MHJ A;  5BO4 B;  2WXP A;  2LVP A;  5G55 A;  3GZN B;  3T3O A;  1IYF A;  1H4R A;  2KQ4 X;  2GI9 A;  2ONQ A;  1FNW A;  4N58 A;  1YNT E;  4RNA A;  2JX5 A;  1NYR A;  1BT0 A;  5L83 A;  2EEL A;  4OVZ A;  2WQY B;  3EC8 A;  1XLO A;  3NVY A;  1JAL A;  2HE7 A;  2M4N A;  3A9K A;  1V6E A;  3A1Q A;  3U52 E;  2IGD A;  4I6N B;  2LMC A;  5JH5 C;  4KKI A;  1SBB B;  3ZO5 B;  3L08 A;  3T8M A;  4JWS C;  3ZXR A;  2J42 A;  1WGD A;  4AWJ A;  1SE9 A;  5GMV A;  1VLB A;  4XC2 A;  2OJR A;  3VHT C;  1YOV B;  2XK5 B;  4HCN B;  4LDT B;  2ASQ A;  4FHK A;  3H8H A;  4TQ0 A;  3EEC A;  3RMK C;  4B0M A;  3CF6 E;  2LGD A;  2I2Y A;  2JRH A;  2EKI A;  3B2F A;  2EMT A;  1FD6 A;  3RYT A;  1UH6 A;  1RYJ A;  3IXS A;  4W9E A;  4MH0 E;  4FLH A;  4IUM B;  3DVG Y;  2AEH A;  5J17 A;  2IPK D;  4JGH B;  4XZ4 A;  4J6I A;  1N5W A;  3QCA A;  5H8Y E;  3B0A A;  1V97 A;  4KZ0 A;  2RGF A;  3VDZ A;  2KKC A;  4B0E A;  4IC7 B;  2G45 B;  2BYT A;  2JRI B;  3L10 B;  1I4P A;  1L0X B;  1T0S C;  1WH3 A;  3CST A;  2G4S A;  1U4A A;  3RD2 A;  2KAC A;  2KDE B;  3AE3 B;  2W9N A;  2QJL A;  3K9P B;  3Q8F A;  2W3R A;  2KMC A;  3KUC B;  4TSS A;  2PVG C;  3QX1 A;  2MCN B;  2KJ6 A;  2WXQ A;  3U7D A;  1M4V A;  1IGC A;  2IGH A;  1EU3 A;  2NPT A;  1YJJ A;  2PTL A;  4E3C A;  1YJI A;  2O6V D;  4JE3 B;  3BII D;  2NCN A;  4YTP B;  1ZKH A;  2FUG 1;  4ANW A;  1Y56 A;  4K7S A;  4FJV B;  4B9K A;  1T3Q A;  2AYO B;  4LLG M;  4WAF A;  3X23 A;  1V2Y A;  1LXD A;  4MGZ E;  1P0R A;  4GDL B;  2N7D A;  5D6J B;  3FC4 A;  3TL5 A;  4GOC A;  4BVU C;  2AQ1 B;  5EE0 A;  2ZZP B;  4DWF A;  3HRD D;  4W9L A;  3Q3F A;  3N9Y C;  3ZW3 A;  2REX A;  2ZCC A;  1H8C A;  2KVZ A;  1Y8R C;  1F77 A;  4DHZ B;  1N63 A;  2BW2 A;  1SJE D;  2FE8 A;  1E7V A;  3QQ8 B;  4KKJ A;  3TSS A;  1C77 A;  4FA6 A;  3ZDM C;  1I42 A;  3ZTD A;  3ZYY X;  2KDI A;  1F52 A;  1A5R A;  2WNM A;  2LGY A;  1WZ3 A;  1GB1 A;  3VTW A;  4HWI B;  2QEJ C;  1ZW7 A;  5DCN A;  4BBN F;  1C78 A;  2CHX A;  2I1K A;  3CIR B;  2KN5 A;  5G5H A;  1L0Y B;  4EEW A;  4EZK A;  1VDV A;  3CMM B;  3RN9 C;  1JWB D;  4IWQ A;  4A3O A;  2FCM A;  3KUD B;  3DVN V;  3B08 A;  2NVU I;  4LK0 M;  1N60 A;  2J4X A;  2LFI A;  1A70 A;  3PLV A;  2K8H A;  3P4P B;  1V81 A;  2KMM A;  1FCL A;  4YSZ B;  2OOB B;  1KLG D;  4OZB A;  3BVZ A;  1DOY A;  1J7C A;  4ANU A;  4DHZ E;  1KLV A;  1C1Y B;  2NTT A;  5JHA A;  1UBQ A;  3DBH B;  4GMV A;  3S2A A;  3RNC C;  1QOB A;  3V60 A;  3R3M A;  3WAN A;  4RF0 A;  1ZXI A;  2Q5W D;  3SR6 A;  2KX3 A;  2DEN B;  2O6V A;  2W3S A;  3TEY A;  2D10 A;  5G5G A;  3UIO B;  2VZK D;  3ZNZ B;  4EE2 A;  3AMZ A;  3Q6B A;  3VXW A;  2IZV B;  3R7R A;  2CKH B;  1TKG A;  1FO4 A;  2WDR B;  1K50 A;  1IPG A;  1MFW A;  3DWG C;  3ZLZ A;  3IHP C;  2LRU A;  2OED A;  2V1Y A;  1UD7 A;  4OVV A;  3W5U B;  1PGX A;  1WXV A;  3I57 A;  2HDE A;  3AEB B;  4A9A A;  2UWQ A;  3BVM A;  3L4P A;  4B6W A;  1DOI A;  2BYV E;  2CJN A;  3WAP A;  4F1S A;  3H6N A;  3UI3 A;  2MSE D;  2FID A;  1YX5 B;  1L6U A;  3BYY B;  3T9L A;  3WAM A;  3DBR I;  1WJ4 A;  1D5Z C;  1ET6 A;  4WJQ A;  2GBM A;  4MJS A;  3M63 B;  4IM2 A;  1L6V A;  2GLS A;  4HPL B;  1T5X D;  5BMH A;  4M01 A;  4K7U A;  1SE2 A;  2J0M A;  2Z59 B;  3ZQ4 A;  2MH7 A;  2WU5 B;  4NAW A;  2L76 A;  2FBW B;  2MBO A;  4OZA A;  2NBW B;  3ECI A;  5CHW A;  4MGI E;  1WYG A;  1WRI A;  4M0W B;  2MQJ A;  2MBQ A;  2PE6 B;  3UF8 A;  1VZ7 A;  3N1Y C;  1RLF A;  2KQ7 A;  1GJZ A;  4RMA A;  1KM7 A;  2DZM A;  2BKF A;  2MJE A;  4DXG A;  1SEB D;  5I4D A;  3FIL A;  2KAN A;  2IJ0 A;  5DPS A;  1K53 A;  1D5X C;  1SIF A;  4CQN A;  2GOW A;  4D2K A;  4WWP A;  1WMH B;  2M56 B;  1UUP A;  2KC2 A;  2KTR A;  1LFD A;  1XCT L;  1TS2 A;  1HE8 A;  1SE3 A;  4EFO A;  5IP4 D;  4DK5 A;  1WFY A;  5LLI A;  2MEK A;  5G2N A;  3VRB B;  2QIL A;  4KDL B;  1E6E B;  3EFC A;  4MH8 A;  2JSV X;  3ZVV A;  3IFW B;  3UQA A;  2ZVN A;  4K81 A;  4UDU C;  4A8X C;  2JPH A;  4YSX B;  2ZW0 A;  4PS3 A;  4TV3 A;  4BZA A;  3DCG A;  1WIA A;  4BKG A;  1GUA B;  3L0W B;  4HXD A;  2MWS B;  3V05 A;  1JWS D;  3VTU A;  2LHD A;  2A5U A;  3B9J A;  2KX0 A;  2IDY A;  4KGR A;  3N32 A;  3SFD B;  2KFK A;  2WYQ A;  5CHV C;  4MEL A;  1WXA A;  2MP2 B;  1L0V B;  3PGE A;  3A4R A;  3TUO A;  1WSP A;  1XT9 B;  3H7S A;  3DHH C;  1XF5 L;  1S3S G;  3DQV A;  5FR6 A;  2PLP A;  3PZ7 A;  2VZK B;  1KOT A;  4W9F A;  5J18 A;  4ZRI A;  2IY0 B;  5C1Z A;  3MP9 A;  1ZDV A;  4HDQ A;  2LJI A;  2VH1 A;  1NBF C;  1C4C A;  2ZNV C;  3RNG C;  4LJO B;  1WXQ A;  1F0Z A;  2FCN A;  3AU4 A;  1GG3 A;  1FXT B;  1JRP A;  1MG4 A;  3VH3 B;  2SAK A;  2DLB A;  5DPR A;  2K3U A;  2YEP B;  3ZKJ C;  1MJD A;  4HEA 1;  1NVI D;  3O65 B;  1T6B X;  3NVV A;  2Y3A A;  1ZOY B;  1XXG A;  2L0F A;  1WWT A;  1C79 A;  1P9D U;  4HDO A;  1EF1 A;  1VR9 A;  1PQS A;  3T3N A;  4HPP A;  2ZEQ A;  2QDF A;  4B95 A;  5FK9 C;  2C5L C;  5TR5 A;  5LXH A;  3NZ3 A;  2BTE A;  3OG5 A;  4XE0 A;  2KWU B;  2JWZ A;  1D3Z A;  2GBK A;  4N6E B;  2ZCB A;  2NBV B;  1HTQ A;  3L54 A;  3OJ3 A;  4RGM A;  1KRH A;  3MFG A;  1DYQ A;  1QT9 A;  2LEK A;  1ESF A;  1N6Z A;  2WXM A;  3DHG C;  4A55 A;  4II2 B;  2KHW B;  4KZC A;  5EE3 A;  3V61 A;  1V8C A;  5HKH A;  3P4Q B;  4IM3 A;  1JRO A;  4DDG D;  3IAS 1;  1AAR A;  1Q5W B;  1J7B A;  4HK2 A;  2E6X A;  2KO3 A;  3EFU A;  2ZJD A;  3ETR A;  4PS8 A;  3KYC D;  4WJP A;  3B1L X;  1E8W A;  1WGR A;  3MHZ A;  4ZRP A;  2XK5 A;  4DHJ D;  4NNJ B;  5HG2 A;  1VD2 A;  1WXM A;  4USA A;  1UWM A;  2KDF B;  3MJW A;  3AV8 A;  2RPQ A;  3AEF B;  5DPT A;  2ON8 A;  3V6C B;  4W9J A;  4JIO U;  4YXD B;  2LGX A;  1AN8 A;  1WX8 A;  2KN4 A;  2DZI A;  3AE5 B;  2X38 A;  1YIW A;  2IND C;  3LB8 C;  3NJT A;  5JXV A;  4NPN A;  3P4R B;  1XEE A;  2BYF A;  3PRP B;  2GBJ A;  2INN E;  4PS7 A;  5KHQ A;  3IG3 A;  2DBY A;  2N4F A;  2WX1 A;  2N1W A;  1EM7 A;  2V4I B;  4URK A;  2D5G A;  1UNS A;  5E6P A;  4HRS A;  3ZJT A;  1Q10 A;  4AJY B;  3VUY A;  4WJO A;  4LNI A;  3Q69 A;  2GRI A;  3ZJU A;  2KLC A;  2KWV B;  2G4D B;  2K8C A;  2EKE C;  5BYQ A;  3BVG A;  2MW5 A;  3DHI C;  4TQ1 A;  2MBB B;  3PRZ A;  5IOI A;  2KJH B;  1T0R C;  2RDH A;  1TJE A;  2YEP F;  3HHM A;  4LCD E;  4AOF A;  3QAR A;  4LNK A;  3PHW B;  4WAA A;  4YTN B;  1NI2 A;  3ZUN A;  1D5M C;  1V49 A;  1YD8 U;  2KNB A;  3U7Z A;  5J2R A;  2WLB A;  4MEM A;  5AZF A;  1QLB B;  4GDL A;  3IBE A;  1GPX A;  3AXC A;  2UU7 A;  2AL6 A;  1E7U A;  2K8B A;  3H9D A;  3GZN I;  4CO7 A;  3JYU A;  4WWM A;  4W9D A;  2KWC A;  4FJZ A;  4US9 A;  1EO6 A;  3LYY A;  4RFB A;  3LJ3 A;  3TEZ A;  3W1S A;  2IYD B;  3OJ4 B;  5D2M B;  4MSM B;  3HIZ A;  5JZE B;  1TY2 A;  2Z0E B;  1MPE A;  2FIF A;  3QK0 A;  3M3J A;  4EKU A;  3E56 A;  4HJK A;  4RCO A;  1CK1 A;  3DPD A;  3PT2 B;  2IO0 B;  5GXG B;  1UBI A;  4P7I A;  3AED B;  4YWG G;  1CZP A;  1EWC A;  3RCZ A;  3IT4 B;  2HTH A;  4JLC A;  2X8X X;  4WH4 A;  4GB9 A;  2BB6 A;  2JXX A;  2N7E A;  4DHJ B;  2L0T A;  1YJ1 A;  2K6Q A;  4HKQ A;  1C9F A;  2IO3 B;  3AEG B;  3JSV B;  3GE3 C;  4RGT A;  3AEC B;  4JX1 C;  2QSD A;  2YVC A;  1HTO A;  4C80 A;  4EOY A;  2UYZ B;  4F8C B;  1F2R I;  1TIF A;  4KIK B;  4K3B A;  2C7M B;  3VH4 B;  3VQI A;  2L05 A;  3RFZ B;  5BYS A;  3IT6 B;  3SDL C;  2XN9 C;  4G3X B;  4ICV A;  2WS3 B;  3O13 A;  4WQO B;  4YTM B;  1PGB A;  1NEK B;  3ML8 A;  4I6P A;  2LXA A;  4EUT A;  4ANX A;  2V3P A;  4IKG A;  2FAZ A;  2KOX A;  3KUZ A;  4H2A A;  4A3P A;  2DZJ A;  1AYF A;  2KJR A;  1I4G A;  1C4P A;  3AE6 B;  1OQQ A;  3A4S C;  1IBX B;  3Q2A C;  3I5J C;  2PKO A;  1P7E A;  4A90 A;  3MC0 B;  4W9K A;  1YQB A;  1ET9 A;  4ANV A;  1E5W A;  1TS5 A;  2O2V A;  3AUL A;  3NZU A;  2WXI A;  3PZ8 A;  3TMP B;  2EMS A;  5EE1 A;  4CHK A;  2PIA A;  1UF0 A;  3P63 A;  4S0R A;  4L2Y A;  3ZRF A;  3N1X C;  3QHT A;  1NDD A;  4HKZ E;  3ZTC A;  1KH0 A;  2QIE B;  4ZHP A;  3OAW A;  3EUB 2;  1OTR B;  3PVL A;  4BKT A;  1TBE A;  2KMA A;  2M0X A;  3VTV A;  3WA0 A;  2CHW A;  3RUL A;  3TCA A;  2K1F A; 
#chains in the Genus database with same CATH homology
 1XCT L;  5T8I A;  1SE4 A;  4ARC A;  1PYW D;  1TS2 A;  3CWI A;  4ZYS A;  1K51 A;  1SE3 A;  3PO0 A;  3IAM 1;  2MEK A;  1KLU D;  3VRB B;  2WU2 B;  2NMQ A;  4YT0 B;  1FIQ A;  2HTM E;  1J7A A;  2QIL A;  4KX6 B;  1E6E B;  4MH8 A;  2JSV X;  1UWX A;  1ZE3 D;  4UDU C;  4A8X C;  4YSX B;  1XLP A;  2K5P A;  2ZW0 A;  2WXP A;  2M0A A;  2K9X A;  2KWD A;  3T3O A;  2W55 A;  1VZ6 A;  2JQR B;  2KQ4 X;  2GI9 A;  2W54 A;  1TKE A;  2MJ3 A;  2ONQ A;  1FNW A;  4N58 A;  1NEN B;  1YNT E;  4RNA A;  3V05 A;  2JX5 A;  3WCQ A;  1JWS D;  1NYR A;  4DQO C;  3R2I A;  2LHD A;  1TZO A;  3ZJV A;  3P1M A;  2EEL A;  3NS1 A;  4OVZ A;  2WQY B;  2N9L A;  3B9J A;  4RF1 A;  1XLO A;  2IDY A;  1JAL A;  1FEH A;  3NVY A;  4KGR A;  3SFD B;  1HXY D;  1QF6 A;  4GLS C;  1L0V B;  2JYE A;  1KFY B;  2WDV B;  3TUO A;  2LGI A;  1PFD A;  1WSP A;  1YQ4 B;  4M0W A;  3U52 E;  5C2T B;  1XF5 L;  2PLP A;  1N5X A;  2IGD A;  1TS4 A;  3PZ7 A;  1HZ6 A;  2VZK B;  1IBX A;  2LMC A;  2WXK A;  1L4Z B;  2AQ3 B;  4XDC A;  2WXO A;  4KKI A;  1SBB B;  2N7J A;  3VR8 B;  3Q8A A;  4JWS C;  2J42 A;  2H88 B;  4MAC A;  3B2G A;  1MI0 A;  3MP9 A;  1ZDV A;  4AQ7 A;  5HFY A;  2LJI A;  1VLB A;  1C4C A;  3AB5 A;  3ZGZ A;  5HI1 A;  2JU6 X;  2N0S B;  1QIL A;  3AE7 B;  1N61 A;  3HVZ A;  2L1A A;  1WXQ A;  3H8H A;  2R61 A;  1F0Z A;  1IUE A;  1JML A;  3GB1 A;  3P4S B;  4TQ0 A;  4XWT A;  1JRP A;  2SAK A;  2DLB A;  2K3U A;  5HHD G;  2YEP B;  1FNV A;  4B0M A;  2ZW1 A;  1JWU D;  4HEA 1;  2V3N A;  4J3O D;  1ROE A;  1SF0 A;  2I2Y A;  3R2T A;  4P6V F;  1NVI D;  2EKI A;  1XCQ L;  1F2R C;  3B2F A;  3V3X A;  1FD6 A;  1TY0 A;  1T6B X;  1RYJ A;  5H92 C;  1L4D B;  3IXS A;  1STE A;  3NVV A;  1BXT A;  1C4A A;  1D6E C;  2Y3A A;  1TKY A;  1XXG A;  1ZOY B;  2DYO A;  3BZD B;  4LTU A;  2BT6 A;  2IPK D;  1WWT A;  2ICI A;  1C79 A;  1I7H A;  2WXR A;  1N5W A;  5H8Y E;  2B76 B;  4HJG E;  1VR9 A;  3T3N A;  1KF6 B;  1V97 A;  1E0Z A;  3KWL A;  4B0E A;  2CU3 A;  5FK9 C;  2CJO A;  2BYT A;  3NZ3 A;  2BTE A;  4L23 A;  1I4P A;  4XE0 A;  1L0X B;  1MHH E;  1PUT A;  1VZ8 A;  4MT5 A;  3KLS X;  2KAC A;  3AE3 B;  1JWM D;  2AX5 A;  4JWU C;  4N6E B;  2QJL A;  1GAQ B;  3Q8F A;  3W9C B;  1GOZ A;  2BBC A;  2W3R A;  4TSS A;  4RGM A;  1KRH A;  1TYG B;  2L83 A;  3MFG A;  1YMH E;  1KTK A;  2JYT A;  2PVG C;  4C56 C;  3U2S C;  1DYQ A;  1QT9 A;  1HEZ E;  2LEK A;  2Y5C A;  2DWQ A;  1ESF A;  1VJK A;  2WXM A;  4A55 A;  4MM3 B;  1HA5 A;  2WXQ A;  1I4R A;  1M4V A;  1IGC A;  5EE3 A;  2IGH A;  1V8C A;  1EU3 A;  1YJJ A;  3SEB A;  2PTL A;  2JWU A;  3P4Q B;  2DYM A;  1JRO A;  1JQ4 A;  3IAS 1;  3FAH A;  1J7B A;  3VR9 B;  1YJI A;  2E6X A;  4L1B A;  3ETR A;  4JE3 B;  3BII D;  4R3D A;  4YTP B;  3MHZ A;  1WGK A;  2FUG 1;  3RPF C;  4ZRP A;  1Y56 A;  2N9K A;  3Q8E A;  1QOF A;  1EU4 A;  3KQ4 A;  5HG2 A;  2K22 A;  3HUI A;  4WQM A;  4GDK B;  1NI3 A;  3TEW A;  1I4X A;  3GP7 A;  4USA A;  1T3Q A;  1UWM A;  1YQ3 B;  1R7S A;  3BYT B;  2LUM A;  2OHF A;  1FFV A;  4LLG M;  4WAF A;  3AV8 A;  1CQV A;  1D4B A;  3AEF B;  3GS2 A;  4GDL B;  2WXL A;  1B9R A;  2ON8 A;  1JW9 D;  4IDI A;  4ZOH C;  2PVO D;  2PW9 A;  4US8 A;  3FC4 A;  4YXD B;  1RFK A;  2WXG A;  4A6Q A;  3E9S A;  2JXT A;  1AN8 A;  2KDM A;  2MJD A;  4O1N A;  2KN4 A;  3AE5 B;  2AQ1 B;  2X38 A;  5EE0 A;  3LB8 C;  5JXV A;  2RPV A;  3HRD D;  5D3I B;  3N9Y C;  3P4R B;  1XEE A;  3BK2 A;  1BML C;  2INN E;  2KAJ A;  1EWY C;  2WXF A;  4P16 A;  2WXH A;  2DBY A;  4OW0 A;  1FXI A;  1F77 A;  1HZ5 A;  3AN1 A;  3EGR A;  1N63 A;  1EM7 A;  1SJE D;  2BW2 A;  3I9V 1;  2FE8 A;  3MJ5 A;  2V4I B;  4KKJ A;  2D5G A;  2K0P A;  1B1Z A;  4ZHO A;  5C3J B;  1N62 A;  1UNS A;  1UGJ A;  1C77 A;  3TSS A;  4HRS A;  3ZJT A;  1E10 A;  2L52 A;  1Q10 A;  4NAM A;  1P7F A;  2J52 A;  1DGJ A;  1FRR A;  3ZYY X;  2M19 A;  1NYQ A;  2WP9 B;  5AUK A;  2WNM A;  1GB1 A;  1FCC C;  3Q69 A;  2GRI A;  1ENF A;  2QEJ C;  3ZJU A;  3URY A;  1FRD A;  1C78 A;  1OQR A;  5BYQ A;  3BVG A;  2IGG A;  3CIR B;  5G5H A;  1L0Y B;  3EA6 A;  1VDV A;  5AUI A;  1FNU A;  1JWB D;  1JCK B;  3VRA B;  4TQ1 A;  1YN4 A;  3NRZ A;  4ARI A;  2RDH A;  4OHJ A;  1XLQ A;  1IGD A;  4LK0 M;  1TJE A;  2BS2 B;  1N60 A;  5FR3 A;  2XNA C;  2YEP F;  2J4X A;  2LFI A;  4PT5 A;  1E7P B;  2BB5 A;  1A70 A;  1L5P A;  4YTN B;  3Q8B A;  1I4Q A;  3P4P B;  2G1E A;  1D5M C;  3U4E G;  2KMM A;  2V0G A;  1FCL A;  4YSY B;  3AEA B;  4YSZ B;  3U7Z A;  1KLG D;  4OZB A;  3BVZ A;  3OWE B;  1I4H A;  1HQR D;  1J7C A;  1DOY A;  1AW7 A;  5MPO A;  2WLB A;  1GB4 A;  1E9M A;  1MVK A;  1YN5 A;  3NVW A;  1QLB B;  1DOX A;  2NTT A;  3LXF A;  1SXT A;  4RGN A;  1GPX A;  1K52 A;  1XLN A;  2ACZ B;  2G9H D;  4NAW B;  3AH7 A;  1QOB A;  4DXF A;  1QKZ A;  4WWM A;  4RF0 A;  1QOA A;  3J9C A;  1ZXI A;  2Q5W D;  3SR6 A;  4C7Y A;  5EE9 A;  4US9 A;  1LO5 D;  3NVZ A;  3LYY A;  4RFB A;  1FXA A;  3TEZ A;  3W1S A;  2W3S A;  3TEY A;  2GB1 A;  4NJC A;  5G5G A;  2J53 A;  2QMT A;  2AQ2 B;  2RDG A;  2I38 A;  1ZPS A;  2VZK D;  4EE2 A;  3AMZ A;  4JPS A;  4RGO S;  1TY2 A;  2W82 A;  1MPE A;  3AM9 A;  1TKG A;  1YN3 A;  1VRA B;  1FO4 A;  3BWU D;  3SFE B;  2WDR B;  1K50 A;  5BMG A;  4KGT A;  3DWG C;  3FIL B;  5E6J A;  3E56 A;  1FFU A;  1PGA A;  4RCO A;  1RM6 C;  2SEB D;  1CK1 A;  1AWD A;  1BUI C;  1FM0 D;  2E3T A;  5GXG B;  1SSN A;  3AED B;  4YWG G;  5D3D A;  2OED A;  1CZP A;  1EWC A;  1SJH D;  1PDX A;  3IT4 B;  3W5U B;  3Q8C A;  1PGX A;  5D7G A;  3AEE B;  2HDE A;  3AEB B;  3I57 A;  4A9A A;  4WH4 A;  2BS3 B;  3BVM A;  3L4P A;  1DOI A;  4ITK A;  1JWA D;  2BB6 A;  1V1P B;  2CJN A;  3UI3 A;  4C7Z A;  2NTS A;  4OZC A;  4HKQ A;  3AE8 B;  2RMM A;  1ZP0 B;  1C9F A;  3AEG B;  4IOI E;  2JZP A;  4RGT A;  4REZ A;  3BK1 A;  3AEC B;  4JX1 C;  2QSD A;  4WIP A;  1L6U A;  4C80 A;  3BYY B;  4AS1 A;  1D5Z C;  1F2R I;  1ET6 A;  3AE2 B;  4XWW A;  2TSS A;  1SIJ A;  4NZL B;  3VQI A;  1L6V A;  4RH6 A;  3RFZ B;  1C76 A;  1T5X D;  4WUR A;  4HRO A;  5BMH A;  1ACC A;  5BYS A;  3IT6 B;  3NUH B;  4XDD A;  1SE2 A;  4KGS A;  2Y5P A;  3KWV A;  2INP E;  2WDQ B;  2XN9 C;  3ZQ4 A;  2WXJ A;  2MH7 A;  2WU5 B;  2WS3 B;  1QQR A;  2FBW B;  1RWS A;  3O13 A;  3W5V B;  4YTM B;  1PGB A;  4OZA A;  2L32 A;  1FMA D;  1NEK B;  2PMV A;  2WXN A;  1WYG A;  1WRI A;  5TSS A;  2V3P A;  4IKG A;  4TMA B;  4H2A A;  1AYF A;  1I4G A;  1C4P A;  1VZ7 A;  1MHX A;  2BS4 B;  3AE6 B;  1OQQ A;  1QOG A;  1IBX B;  1TS3 A;  3HVD A;  2PKO A;  1P7E A;  4A90 A;  3MC0 B;  2H89 B;  3ABV B;  3DWM A;  1ET9 A;  3C8Y A;  2MJE A;  4Q2J A;  4DXG A;  1SEB D;  1TS5 A;  1ZDX A;  3AE4 B;  2WXI A;  5BYR A;  3R8B A;  3PZ8 A;  1CJE A;  3FIL A;  5I4D A;  2IJ0 A;  3TEX A;  3AE1 B;  4FXC A;  5EE1 A;  5LNK 1;  2PIA A;  1K53 A;  3P63 A;  4L2Y A;  1ZUD 2;  1D5X C;  1XO3 A;  3W2D A;  4HKZ E;  3P42 A;  1KH0 A;  5BMI A;  2QIE B;  4ZRQ A;  4ZHP A;  4N59 A;  4CQN A;  3EUB 2;  5FKA C;  1OFF A;  4D2K A;  2Z8L A;  2LHE A;  1V1P A;  2M56 B;  1SB3 C;  1V1O A;  1UUP A;  3AE9 B;  1ZXH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...