1PGBA

Two crystal structures of the b1 immunoglobulin-binding domain of streptoccocal protein g and comparison with nmr
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
56
structure length
56
Chain Sequence
b'MTYKLILNGKTLKGETTTEAVDAATAEKVFKQYANDNGVDGEWTYDDATKTFTVTE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN G
publication title Two crystal structures of the B1 immunoglobulin-binding domain of streptococcal protein G and comparison with NMR.
pubmed doi rcsb
source organism Streptococcus sp. gx7805
molecule tags Immunoglobulin binding protein
total genus 15
structure length 56
sequence length 56
ec nomenclature
pdb deposition date 1993-11-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01378 IgG_binding_B B domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.10 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1pgbA00
4HKZE 2LUMA 3FILA 1FCCC 2N7JA 5HI1A 2IGGA 2QSDA 1HZ6A 3UI3A 5HFYA 2J53A 1YMHE 1IGDA 1MPEA 5BMHA 5HG2A 1IBXB 3MP9A 1MVKA 1MHHE 4KGSA 2RMMA 1F2RI 2IGHA 2KACA 2JWUA 1F2RC 2KN4A 2IGDA 2ZW0A 2PTLA 2JU6X 2LHEA 2RPVA 2PLPA 1PGAA 2I38A 1GB1A 3V3XA 2KWDA 1HEZE 1MI0A 1IBXA 4HJGE 2I2YA 2N9LA 1YNTE 4MACA 4IOIE 1XCTL 3GB1A 1K53A 2JXTA 1ZXHA 2J52A 1K52A 2LHDA 1HZ5A 2N9KA 1EM7A 1MHXA 1P7EA 2JSVX 1PGBA 1XCQL 4OZAA 4OZCA 2GB1A 1K50A 2JZPA 2PW9A 1FD6A 2OEDA 1FCLA 1C9FA 1QKZA 1UWXA 5BMIA 2ZW1A 1D4BA 2NMQA 2EELA 5HHDG 1IGCA 2ON8A 1P7FA 4GLSC 4OZBA 4WH4A 4D2KA 2LGIA 3FILB 1PGXA 2GI9A 2K0PA 4IKGA 1Q10A 5BMGA 1GB4A 4KGTA 1K51A 1JMLA 4KGRA 5JXVA 1XF5L 2KQ4X 2QMTA 2ONQA 2KDMA 1KH0A
chains in the Genus database with same CATH superfamily
3E56A 4HKZE 3TJPA 4KSLC 2N4FA 3DBLB 1HTQA 1FMAD 4RM9A 1MG8A 1V1PA 3T9LA 2EKIA 2N7JA 2ZCBA 4ZHOA 3AE3B 3N1YC 2YEPB 2WWZA 3UI3A 2BGFA 3Q8BA 5DPWA 1OQRA 3D32A 2J53A 1IGDA 2L83A 2L0TA 1JROA 2LVPA 4UDUC 4EZLA 2MP2A 4CO7A 4GOCA 4JLCA 1C76A 1UH6A 4MGIE 2PIAA 2LGSA 3H1UA 5FR6A 3I63C 4EZJA 2MWSB 4W9KA 3WA0A 3Q3OC 2PTLA 1V97A 3U2SC 2LHEA 4YL8A 4MJSA 2RDBC 4WWOA 2BQQA 2G3QB 1UNSA 2I2YA 1Q0WB 1I4XA 2KFKB 3L08A 2LASA 3EFUA 2J52A 3PS6A 4FA6A 1EM7A 3QWZB 4WWNA 4ZRIA 2LGYA 1P1AA 1WH3A 4P7IA 3A1QA 2K8BA 3PPAA 1EU4A 4DXGA 4GGQA 3TBLD 1KFYB 3DVNU 2NCNA 1ACCA 1V1PB 2WXRA 2N1WA 1KLVA 3AEGB 3NVYA 3V61A 1NDDA 2W9NA 3R2IA 2C7NB 2OHFA 4ICUA 2MH7A 4ICVA 1I7HA 2W82A 2MCNB 2Z8LA 5DPRA 5DCNA 2MP2B 3V05A 3JVZX 4DBGA 4RGMA 3KW5B 3PT2B 3QHTA 2KMMA 2KTRA 3W1SA 3W1SC 3Q3MC 1JWMD 5HFYA 3I3TB 2D3BA 3KVFB 1GNUA 5E6NA 2JF5A 4MJSB 4XWWA 2ZEQA 5J18A 1E7PB 2IJ0A 1N61A 3BINA 3M3JA 2HDEA 1FNUA 1ZKHA 4W9FA 2W3SA 2D2QA 2W3RA 4JQWC 5H92C 3DPDA 1YJJA 1UBIA 2FNJB 1GB1A 3A9KA 5IAAC 4REZA 3MC8A 4M0WA 2MQJA 4N9F4 4WIPA 1V49A 4FHJA 4LLGM 2H89B 3DWGC 1QZEA 3A1QB 4B9KA 3QK0A 1XD3B 1D5MC 1FXTB 1OEYA 3T3NA 3KLSX 5EE0A 2WP9B 5AZFA 3RNBC 1TIFA 2MBEA 1S1QB 1N6ZA 2BT6A 1FEHA 1PGBA 3A9JB 2KTFA 4AWJA 3Q69A 2WDVB 1K50A 4NQLB 3ALBA 4LNNA 1FCLA 1OFFA 2BPSA 4JE3B 1A5RA 1ESFA 3TEZA 2KWUB 2NMQA 4GU2A 1IPGA 4FADA 3BVGA 3U7DA 2MLBA 2KWCA 2J0KA 3ZO5B 3AE2B 4K3BA 1V86A 2KTRB 4L2YA 3B9JA 1Q5WB 4C80A 2DWQA 4XZ4A 1QF6A 4XX5A 1J19A 2LRWA 1I4GA 4OW0A 4MGKE 3SFEB 2VH1A 1E8WA 1FPYA 4RGOS 4RM8A 4KV2A 4URKA 2BWFA 1JW9D 2LVOA 1TS2A 1NEKB 3GE8C 4XC2A 5BO4B 1DOYA 4WWMA 1Q1OA 3LJ3A 3A9KB 5BMHA 4M0WB 4HPMB 3NRZA 4M8MA 3N1ZC 1F1HA 1ISNA 4ZRKA 4JWSC 2AQ3B 3TMPB 2L00B 3SR6A 2LVQA 1I4QA 1ZDXA 4PYZA 2NPTA 3AEBB 3NJTA 4XE0A 4HJGE 1EO6A 1YNTE 1ZXIA 1R4MB 4IM0A 4K81A 2C9WB 4A3PA 3AN1A 4HDOA 3TEXA 1FFUA 2RSUA 2GB1A 3R8BA 1IYFA 3UQBA 2JZPA 1WM2A 2IYDB 2L3ZA 3AMZA 1GOZA 2PE9A 4O1NA 2K22A 1JWSD 2MSED 3LYYA 4DHJD 2ZW1A 2O2VA 1AYFA 3RZWC 4DDID 4MH8A 5TR5A 1KF6B 4OZBA 2GMIC 2CHZA 4AJWA 3KWLA 3VDZA 4F1SA 4IKGA 5IP4D 2IY0B 3MJ5A 5EE3A 3ZNHB 5JXVA 4MT5A 1XF5L 1WRDB 2WDQB 2SEBD 1L0XB 2WU2B 2NVUI 1ZP0B 1WGKA 3ZTCA 4A8XC 3MJWA 3Q8CA 4JWUC 4E3CA 3ZVVA 2WQYB 1WXMA 3JSVB 2JYTA 3P4PB 2JT4B 2UWQA 2WLBA 1FXIA 4W9IA 5LNK1 3DBRI 1EWCA 4ANXA 3N9YC 4GDLA 4C4VB 2J7QB 1TZOA 4LK0M 3BWUD 1AARA 3M62B 1RWSA 4OVZA 2WXFA 1XLPA 4LJPB 2CKHB 3ZQ4A 4G50A 2A5UA 4E74A 1FXAA 4TMAB 1WXVA 5H8YE 4BKGA 1T5XD 3V60A 3T3OA 4ZRJA 2GBNA 3EHVA 2JY6A 4GSWA 2XK5A 3PLVA 1FRDA 5D2MB 3ONSA 3H7PA 4MGYE 4XYCA 3JYUA 2J0JA 4GDKB 3P4RB 3PZ7A 1L6UA 2LHDA 1WMHA 2O2VB 3Q3FA 4MM3A 3VRAB 1TY2A 3AU4A 2A4ZA 1M4VA 1V81A 3PHWB 4JX1C 3GE3C 3BYYB 5CTRC 4FLHA 5CHFA 1FD6A 1RAXA 4M00A 5G55A 1GC6A 1F77A 2YLMA 5AEKB 2WXIA 2ZZPB 4M01A 2DZJA 3NY5A 3NS1A 3VUWA 2I1JA 3R7RA 2BYFA 5HHDG 2E3TA 3WAPA 3ZW3A 3PRPB 2KT7A 3CSTA 3VTUA 2LGIA 3KQ4A 1T0SC 3HM6X 2VZKB 5D94A 3N1XC 2KLGA 3ZYYX 5G5GA 1GUAB 1V9JA 1TKEA 1VDVA 2J4XA 3RUIB 2LXCA 3N30A 2BF8B 3NHEB 2WXGA 3IT6B 3VR8B 2MHJA 1WGDA 2DX5B 1SJHD 4FJVB 2KWVB 2KJRA 2XK5B 3A4RA 2CJOA 2FBWB 2DNFA 2N7EA 5HG2A 2R61A 3UIPB 3NZ3A 1QOGA 2FE8A 3RNFC 5FR3A 2RMMA 1F2RI 4EEWA 5AZHA 3MHSD 2G4SA 3QIJA 2KVZA 1WMHB 2QHOA 4NJ7A 1L0YB 5I4DA 3Q3JA 4MM3B 1D6EC 4ARCA 1UBQA 4F8CB 3UINB 3DCGA 1DGJA 2BS2B 4IOIE 3GB1A 1LQBA 2WHIA 5IN7A 3SU8X 2LEKA 4DHZE 2N1VA 1UD7A 4OZAA 2BYVE 2G45B 2M1MA 1YX5B 2ZNVC 1I35A 3DBHB 4HCNB 3T8MA 4L23A 4GXBA 2HJ1A 2BB5A 4L1BA 1X1MA 3P63A 3VHTC 3EUB2 3APCA 4IUMB 2PJHA 2WDRB 2DZIA 3PLUA 1R4NB 1JMLA 1BXTA 4KGRA 4P16A 3RMKC 3BY4B 2ONQA 4K1RB 2WS3B 1KOTA 3M95A 5IKCM 2NTTA 2YEPF 4P1CC 1PUTA 5T8IA 5EDSA 1K8RB 3HRDD 3KYDD 2WGSA 2JZ3B 1AWDA 4BBNC 2DENB 2ZCCA 2NTSA 1TYGB 4WURA 3EC8A 4KGSA 2JRIB 1QQRA 4OHJA 4RGNA 1L6VA 1PDXA 1UWMA 3PZDA 1LO5D 1P9DU 4WJPA 4YSZB 4RGTA 2KO3A 4R3DA 4DQOC 4II3B 3GZNB 2CJNA 4RMAA 2WXLA 2GRIA 5D7GA 1VZ8A 4EKUA 4ANWA 4IDIA 3AEFB 3PRMB 3C0RB 1E8XA 1AW7A 2M56B 3NVZA 3ZGZA 2ZNVB 3HUIA 1WE6A 4IW0A 5IO9A 2JXTA 5BYQA 4KKIA 1NYQA 3O65B 4LNIA 1E9MA 5G5HA 1T0QC 2KDFB 4BBNF 2PW9A 4PK1A 1KLUD 2MX2A 2JRHA 2LXAA 2AQ2B 2KN5A 1Y56A 4W9LA 4NJCA 3R66C 4FJYA 2CU1A 1IGCA 4LNFA 2ON8A 3L0WB 1SE3A 2B3AA 1A70A 1P7FA 1UGMA 1ET6A 2FUG1 3PV1A 2SAKA 1E8YA 3IG3A 3NS8A 2KXJA 1Q10A 5LLIA 1K51A 4HXDA 2ZPYA 2LFIA 2JWZA 1LXDA 2PMVA 3RULA 2QMTA 4I6PA 4PS7A 1T6BX 4TQ0A 1E6EB 1TY0A 1XQQA 3AE7B 3A9JA 2LRUA 3PO0A 1HQRD 2WNMA 4A55A 3EECA 3B08A 2IDYA 1STEA 2VH2A 1YX6B 4MSQB 2WXNA 1FIQA 4N6EB 3ECIA 4TV3A 2K39A 4PYUA 1SEBD 3RNAC 1E8ZA 3AU5A 3E9SA 4PS3A 3N20C 4JPSA 2CU3A 4LJOB 2G9HD 1UF0A 4BAXA 4X57B 1GC7A 4P6VF 2GOWA 1D5ZC 3WALA 4IWQA 1SB3C 2WXKA 3O13A 5KHOA 2JYEA 2V0GA 1JALA 1TJEA 1OQYA 3M63B 4HK2A 3C8YA 2WYQA 3LDZE 2WXOA 1S3SG 3SEBA 3U7ZA 3ZDMC 4OZCA 1JWBD 3IAS1 4FXCA 2DAJA 1VZ6A 2PVOD 1ROEA 5AUKA 3PRZA 4LDTD 1WJ6A 2JX5A 2NBUA 3AE6B 1FFVA 1V80A 2PVGC 3PVLA 1XLOA 4WH4A 1Z2MA 3L10B 4LCDE 3PREA 4W9EA 1V5OA 4AUQC 2FIDA 3BZDB 1FNVA 2D10A 2KFJA 3ZNID 1VR9A 5BMGA 2KC2A 3K9OB 2XNAC 1B9RA 1T0YA 2LZ6A 1VLBA 2KDEB 2WXJA 1ZDVA 3ZRCA 2L0FA 2NR2A 2KOXA 2BS4B 1R7SA 2UU7A 3P1MA 3BYTB 1SE9A 3DVNV 3OJ3A 1CZPA 3FAHA 3EA6A 4WAFA 4BOSC 4FBJB 3UIOB 1TS3A 2K5PA 1OQQA 1WXAA 3N3KB 1WSPA 3LB8C 2Y5BB 2IGHA 2E6XA 1EU3A 1YN5A 4NAMA 3NZSA 1PGAA 2X38A 4KSKC 4PT5A 2N9LA 2V9HA 1XCTL 2CHXA 1TGZB 3VXWA 5C1ZA 3JSVA 1GAQB 5EE1A 1WZ3A 4DHZB 2QILA 2Y5PA 2ZVNA 5KHQA 3KH0A 1R4MI 4C4VA 4EOYA 3AE8B 1E10A 2K25A 4IG7B 1DOIA 5JZEB 4NJ6A 3HVZA 2FCSA 4US9A 3B2FA 1YQBA 5IA7A 4E71A 2LUEA 2MJ3A 3CIRB 1NVID 1VJKA 3L13A 4F7ZA 2KHWB 2IPKD 4MSMB 2M4NA 3ZKJC 4FJZA 1WIAA 4N59A 4B0EA 2FCQA 3ZJVA 1LGRA 1HXYD 3P2BA 4GDKA 2C5LC 4H2AA 4HROA 3X0WA 5L95C 5JH5C 4TUUA 3N32A 1EWYC 1QLBB 5D3IB 3PHXB 2MBQA 2QSDA 5J2RA 1HZ6A 1J0GA 3L17A 3ZXRA 1YMHE 1MPEA 4BZAA 2FUHB 2C7MB 1L0VB 4I6NB 1F9JA 1I4PA 2RD0A 4BFRA 1WYGA 2IO1B 2KACA 2V3NA 3BIID 3JW0X 2DLBA 1XLQA 2OJWA 3HK0A 2BTEA 3TL5A 3NVVA 4CQNA 3AE9B 2I38A 3V3XA 2KWDA 1HEZE 2N9XA 2D3CA 2BS3B 4K7SA 5D6JB 1SIJA 4ZRQA 2HJ8A 1Z5SB 2D3AA 2KANA 3ABVB 1ZXHA 4YSYB 3FC4A 3AE1B 4WJNA 2JZZA 2J0MA 2M0AA 2JSVX 1VRAB 4ACFA 1XCQL 3J9CA 1RFKA 3ETRA 4G3XB 1DOXA 3AXCA 1GJZA 1CMXB 2AWTA 2H88B 3I57A 1QOAA 3AULA 2LI5A 1NENB 1N5WA 4KX6B 2BKRB 3APDA 2EELA 4ASWC 4ANUA 4XDDA 3UF8A 4D2KA 1GPXA 4IWOA 2R2OA 3RZFA 1KRHA 1VD2A 2DZMA 4LNOA 3VTVA 3DVGY 4A6QA 4HDQA 1J7AA 4FN2A 1EUVB 2V1YA 3AEAB 3IBEA 1C78A 1JWAD 2AEHA 2KQ4X 4HCPB 2AL3A 2KDMA 2V3SA 2MA9B 3QARA 3R2TA 4W9DA 2Y3AA 3Q2AC 4DWFA 3RN9C 1WGYA 2XBBC 2M8SA 5E6PA 2V3PA 2WX0A 2C7HA 3NOBA 2GBMA 1E7VA 1L4DB 1WFYA 1IUEA 1MHHE 4WWPA 4KKJA 2DYOA 1SXTA 3U8ZA 1WZ0A 2IGDA 1P98A 2KQSA 4RCOA 1I4RA 2JU6X 1RRBA 1T3QA 3IT4B 1L4ZB 3U4EG 3URYA 1MI0A 2LJ5A 2J42A 1IBXA 3RT3B 1TBEA 1PFDA 4DHJB 1SE2A 2BB6A 4EZKA 3SDLC 2N9KA 3DQVA 3GS2A 2DYMA 4G11A 3DOWA 2MBBB 2WXHA 4RFBA 4GN1A 2K9XA 2VRRB 1QT9A 2V4LA 1QKZA 2Z0DB 5BMIA 1MG4A 1RLFA 2CHWA 5C3JB 1QOBA 2L05A 3ZNGC 3MTNB 3APFA 1SGHA 2MBOA 3BVMA 3DBHI 2K0PA 3W5UB 3VH4B 1DYQA 3ZXVA 2PKOA 1T0RC 2MEKA 2WXQA 2XN9C 2BBCA 2JXXA 3TUOA 4N58A 2M0XA 2MJEA 3QAQA 4KZ0A 1TKYA 5DPSA 4EUTA 3B2GA 3BVZA 4MDKE 4ZYSA 1R4NI 1WWTA 4US8A 2KZRA 5D3DA 4AJYB 2L1AA 2Y5CA 4NNJB 2RGFA 2W54A 1UGJA 2K8CA 2OJRA 4YT0B 3ML8A 1KJTA 2M17A 4BKTA 3P4SB 1IBXB 1E90A 1XT9B 3CF6E 1C79A 2QC8A 3K9PB 1CJEA 2NBWB 4W9CA 3UGBB 1M94A 4XDCA 4C00A 1H8CA 3OLMD 3DDCB 5AUIA 4KDIC 3WAOA 3QQ8B 1L2NA 2O6VA 2ASQA 2UYZB 1WR1A 3L54A 3VQIA 1YQ3B 2JVCA 3WAMA 2Z59B 1WM3A 3DBLI 4XWTA 3U30A 2QCZA 1C77A 2INDC 4EE2A 2I1KA 4CHKA 3H9DA 3GZNI 2XEWA 4HLEA 1WGHA 1EF5A 4YWGG 3KYCD 4II2B 4IC7B 2G1EA 4OVVA 3MFGA 2R2QA 5AZGA 1V6EA 5MPOA 4HEA1 1L7YA 4EFOA 2KX0A 3GP7A 4BKSA 4ZYNA 1IP9A 2LD9A 2NS5A 2N9PC 2HE7A 3W2DA 3V6EB 3SD5A 4BOZB 1EF1A 3PTFC 3VUYA 1JQ4A 2KMCA 1B1ZA 4ZOHC 4KGTA 2EMSA 3DWMA 5GXGB 3PSEB 1YOVB 3RI7C 5FKAC 3RNGC 2DZKA 3HM3A 3KWVA 1ZOYB 3MC0B 2RR9A 1D5XC 1FCCC 2INPE 5HI1A 1XLNA 4G0NB 1HE8A 1J7BA 2ICIA 3AECB 1YN4A 4QAYA 3ENEA 3PGEA 1ZGUB 2INNE 5E6JA 4GMVA 3QA8A 2K6QA 1NBFC 2O6VB 1C4AA 1SE4A 3CMMB 1NI2A 4HWIB 4AS1A 2KKCA 3Q8FA 4B0MA 4RF1A 2FIFA 2QJLA 2NBVB 1WXQA 3W1YA 4NY0A 4CYEA 4GB9A 4JL9A 3IAM1 3RFZB 3QCAA 3Q3NC 3IXSA 1SBBB 4MGZE 2MRPA 2GLSA 1C4CA 2MW5A 1SJED 2RDHA 1JWUD 2BYEA 5JHBA 3ZUNA 4IWPA 1WX8A 2L32A 3PZ8A 1HA5A 2K6DB 4MH0E 3NUHB 2RPQA 2OOBB 4RF0A 1MHXA 1P7EA 1WE7A 3NG0A 3QC8B 5FK9C 3WANA 2ZPNA 4ZHPA 3ZLZA 2KK8A 4AQ7A 4A3OA 3A4SC 2MBHA 3SFDB 1C9FA 1U4AA 2FCNA 2IO0B 4ZRPA 1BMLC 1MFWA 4YTPB 3SHQA 4MELA 3TIXA 4YSXB 2GBJA 4S0RA 3TCAA 5CHWA 3ZJTA 4AOFA 2KDIA 2GBKA 3AE4B 4S17A 5DPTA 4MEMA 2IO2B 2D5GA 1NYRA 4ZDVA 5E6OA 2KC1A 1I42A 3HIZA 4ITKA 4IM3A 3AB5A 2INCC 2D07B 3VUXA 1LFDA 2ZJDA 2LUMA 3FILA 3QJZA 2N9EB 1SF0A 4A90A 1TZ1A 2HD5B 2IGGA 1FM0D 2K1FA 2RDGA 3ZJUA 3W9CB 4WQMA 1G6JA 3HVDA 3I5JC 1GG3A 2Q5WD 1WJNA 4TSSA 3DHHC 2YVCA 3MP9A 1WGRA 3VR9B 4K3CA 1E5WA 2KN4A 5LXHA 1ET9A 2IZVB 2MJDA 2REXA 1FNWA 3AM9A 3Q6BA 3B0AA 4HPLB 2BWES 2AQ1B 1YJIA 1K53A 4M8NA 2CR5A 3X23A 5L83A 1VZ7A 1P0RA 4B6WA 4RH6A 4ARIA 2BKFA 3Q8AA 2KD0A 2HTME 2LJIA 1UWXA 4HRSA 1WYWB 1VCBA 1YD8U 4YTMB 4WQOB 1QILA 1OTRB 3KUDB 1V5TA 3FILB 3NVWA 4FULA 2EKEC 5CX3A 3R7QA 3R3MA 4HVBA 4DDGD 3RD2A 4FHKA 1SIFA 3OJ4B 4TQ1A 1SSNA 3H8HA 1JRUA 1WJ4A 2IBIB 1YJ1A 4K7UA 2EMTA 1TS4A 3UQAA 2KX3A 3EGRA 3OWEB 2VZKD 1C1YB 1QOFA 2N0SB 3EFCA 3TSSA 1WXSA 1FO4A 4IM2A 4NAWA 1MJDA 2KQ7A 5JHAA 5HKHA 1YQ4B 2M19A 1MVKA 3IHPC 2WU5B 1KM7A 4A9AA 1N5XA 2HTHA 2ZW0A 2IO3B 1PQSA 1V1OA 3VFKA 1ZUD2 2Z0EB 3LXFA 3DHIC 1WF9A 4LDTB 2JUOA 2ACZB 3P4QB 1OEYJ 4I6LB 1HZ5A 3AV8A 5LXIB 1YIWA 4HPPA 1Y8RC 1WX7A 4LTUA 2LGDA 3KUZA 4JGHB 3HHMA 1TTNA 4HJKA 3CSFA 1D4BA 3W5VB 3RPFC 2CS4A 3KUCB 3P42A 3L4PA 3I9V1 4BVUC 2PPHA 2X8XX 4WJOA 1FRRA 2GI9A 1TKGA 3C19A 1GB4A 4DK5A 1JCKB 1YN3A 2AL6A 3S2AA 2G4DB 2NPTB 3DBRB 2KAJA 4NAWB 1J7CA 5BYRA 4P1BC 3TEWA 1N60A 2K8HA 1WY8A 1XXGA 3VTWA 2GBRA 2KNBA 1D3ZA 2WXMA 2V4IB 4AP4C 2TSSA 3VRBB 3QX1A 4KIKA 4KDLB 1XO3A 1L5PA 2JWUA 1WRIA 4PS8A 1F2RC 2BYTA 2KLCA 1ENFA 2RPVA 4NZLB 2JQRB 4XGAB 4C7ZA 5G2NA 3WCQA 1N63A 4GIVA 3L16A 4A20A 4NQKE 1BT0A 1LM8B 2PEAA 1I4HA 3IVFA 1K52A 1OGWA 3RNEC 4RNAA 5C2TB 1N62A 3MHZA 1RM6C 4TKNA 2ZVOA 2B76B 1WI0A 3FKYA 3ZRFA 2JPHA 3V6CB 3NZUA 2D3GA 3DVGX 1WJUA 4GDLB 5CHVC 3DBSA 1JRPA 1F0ZA 4GLSC 4KVGB 4W9JA 4K7WA 2WXPA 2L8JA 4LNKA 2PE6B 1V8CA 2BVCA 2C60A 1PGXA 3BK2A 4M02A 3Q8EA 4ANVA 1E7UA 4C7YA 3VAWA 4W9GA 1UZXB 1ZPSA 2DYBA 3CWIA 2WX1A 5EE9A 2L52A 1RFAA 3AEEB 1F52A 3H7PB 1XEEA 2FAZA 2L76A 4B95A 4KIKB 1AN8A 4J3OD 3BK1A 1P3QU 4DXFA 2IY1B 2D11A 3H6NA 2N7DA 4DXAB 1V2YA 1C3TA 1TT5B 2LWPA 1RYJA 3AI5A 2L7RA 4JIOU 1HTOA 2KVRA 2O6VD 1WGGA 3GOEA 1UELA 4YTNB 1E0ZA 3MC9A 3Q14C 1UUPA 3WIMA 2BW2A 1TS5A 1WX9A 1KLGD 5BYSA 2KYWA 4USAA 1H4RA 2PLPA 3RNCC 4Q2JA 2WDTB 3AEDB 3ZTDA 3RYTA 4WAAA 3AE5B 3B1LX 2KJHB 3RCZA 1KTKA 5C23A 4MACA 4BKSD 3VVWB 2QEJC 3ZNZB 5TSSA 2AX5A 4W9HA 4C56C 3OAWA 2QDFA 1ZE3D 4KZCA 3TEYA 5IOIA 2LGXA 3U52E 2FCMA 3IFWB 1NI3A 4HKQA 2OEDA 5J17A 5GMVA 2AYOB 2KFKA 2KDBA 1C4PA 1WR6E 3A33B 3ML9A 3ZIMA 4WJQA 4J6IA 2K3UA 1PYWD 1CK1A 1J8CA 4OVUA 4YXDB 1CQVA 2W55A 4NPNA 3H7SA 2DBYA 3V62A 3VH3B 2DHZA 1BUIC 2LMCA 2DAFA 1ZW7A 2KJ6A 2QIEB 3OG5A 3AH7A 1KH0A 2KMAA 3DHGC 3ZDTA
chains in the Genus database with same CATH topology
1VDVA 2J4XA 3AB5A 3E56A 4HKZE 2LUMA 3FILA 1EWYC 1FMAD 1SF0A 1V1PA 4ZHOA 2EKIA 2N7JA 4A90A 1QLBB 2WXGA 5D3IB 2IGGA 3AE3B 1FM0D 2QSDA 1HZ6A 2RDGA 3IT6B 2YEPB 3VR8B 3UI3A 3ZJUA 3W9CB 3Q8BA 4HROA 1OQRA 4WQMA 2J53A 1SJHD 1YMHE 1IGDA 2L83A 3HVDA 1MPEA 1JROA 4UDUC 2Q5WD 2CJOA 2FBWB 1C76A 5HG2A 2R61A 4TSSA 1L0VB 3NZ3A 1I4PA 1QOGA 2PIAA 3MP9A 2FE8A 1WYGA 5FR3A 3VR9B 2RMMA 1F2RI 2KACA 2KN4A 2V3NA 3BIID 2PTLA 1V97A 3U2SC 2LHEA 2DLBA 1XLQA 2BTEA 1L0YB 5I4DA 3NVVA 4MM3B 4CQNA 3AE9B 2I38A 1D6EC 1ET9A 3V3XA 4ARCA 2KWDA 2MJDA 1FNWA 3AM9A 1HEZE 1UNSA 2I2YA 2BS3B 1DGJA 2BS2B 1I4XA 2AQ1B 1SIJA 4IOIE 4ZRQA 3GB1A 1YJIA 1K53A 3ABVB 4YSYB 1ZXHA 2J52A 3FC4A 3AE1B 2LEKA 2M0AA 1EM7A 1VZ7A 2JSVX 1VRAB 1XCQL 4OZAA 4RH6A 3J9CA 1RFKA 3ETRA 4ARIA 1DOXA 3Q8AA 2H88B 3I57A 2HTME 1QOAA 2LJIA 1UWXA 4HRSA 4L23A 1EU4A 1NENB 1N5WA 2BB5A 4KX6B 2EELA 4YTMB 1QILA 4XDDA 4L1BA 4DXGA 4D2KA 1GPXA 1KFYB 3P63A 1KRHA 3FILB 3NVWA 4A6QA 1J7AA 3EUB2 1ACCA 1V1PB 2WXRA 2WDRB 3AEAB 3AEGB 3NVYA 1JMLA 1BXTA 3R2IA 1C78A 4KGRA 4P16A 1JWAD 2OHFA 2KQ4X 2MH7A 2ONQA 1I7HA 2KDMA 2W82A 3R2TA 2Z8LA 2WS3B 4TQ1A 1SSNA 3H8HA 3V05A 2Y3AA 4RGMA 2NTTA 1TS4A 2YEPF 1PUTA 5T8IA 2V3PA 3EGRA 2KMMA 3OWEB 2VZKD 3HRDD 2N0SB 1QOFA 3W1SA 1JWMD 5HFYA 1AWDA 3TSSA 1FO4A 4XWWA 2NTSA 1E7PB 2IJ0A 1L4DB 1IUEA 1N61A 1TYGB 1YQ4B 4WURA 2M19A 2HDEA 1MVKA 2WU5B 1MHHE 4KGSA 1N5XA 4A9AA 1QQRA 1FNUA 4KKJA 2DYOA 1SXTA 4OHJA 4RGNA 1L6VA 1PDXA 2W3SA 2IGDA 1UWMA 2W3RA 4RCOA 1LO5D 2ZW0A 1I4RA 2JU6X 4YSZB 5H92C 4RGTA 1V1OA 1YJJA 4R3DA 1T3QA 1ZUD2 3IT4B 1L4ZB 4DQOC 2CJNA 1GB1A 2WXLA 2GRIA 5D7GA 3U4EG 3URYA 1VZ8A 3LXFA 4REZA 1MI0A 4IDIA 3AEFB 2J42A 4M0WA 1IBXA 1AW7A 2M56B 3NVZA 4WIPA 3ZGZA 4LLGM 2H89B 3DWGC 3HUIA 1PFDA 2ACZB 1D5MC 2JXTA 5BYQA 4KKIA 1SE2A 3P4QB 1NYQA 3KLSX 2BB6A 5EE0A 1HZ5A 3T3NA 2WP9B 3AV8A 2N9KA 3GS2A 2DYMA 1E9MA 2BT6A 1FEHA 1PGBA 5G5HA 3Q69A 2WXHA 2WDVB 4RFBA 4LTUA 1K50A 2PW9A 1KLUD 1FCLA 1OFFA 2K9XA 4JE3B 1ESFA 1QT9A 2AQ2B 1QKZA 1Y56A 3TEZA 5BMIA 1D4BA 4NJCA 3W5VB 2NMQA 3RPFC 3BVGA 5C3JB 1IGCA 3P42A 3L4PA 2ON8A 1SE3A 3I9V1 1A70A 1P7FA 1QOBA 1ET6A 3AE2B 2FUG1 2SAKA 1FRRA 3BVMA 2GI9A 2K0PA 1Q10A 1TKGA 1GB4A 3W5UB 1JCKB 1K51A 1YN3A 1DYQA 2LFIA 2PKOA 4L2YA 2MEKA 2WXQA 2XN9C 2BBCA 2PMVA 3B9JA 2QMTA 4C80A 3TUOA 2DWQA 1T6BX 4TQ0A 1E6EB 4N58A 1QF6A 2KAJA 4NAWB 2MJEA 1J7CA 5BYRA 1TY0A 4OW0A 1I4GA 1TKYA 3TEWA 3AE7B 3B2GA 3PO0A 1HQRD 1N60A 3SFEB 3BVZA 2WNMA 4A55A 4ZYSA 1WWTA 4RGOS 1XXGA 2IDYA 1STEA 1JW9D 4US8A 1TS2A 5D3DA 1NEKB 2WXNA 1FIQA 2L1AA 2WXMA 2Y5CA 4N6EB 2V4IB 1DOYA 2TSSA 4WWMA 2W54A 1UGJA 1SEBD 4YT0B 3VRBB 5BMHA 1XO3A 3NRZA 3P4SB 1IBXB 1L5PA 3E9SA 4JPSA 1C79A 2CU3A 2JWUA 1WRIA 1F2RC 2BYTA 1CJEA 2AQ3B 2G9HD 4JWSC 3SR6A 4P6VF 4XDCA 1ENFA 1D5ZC 2RPVA 2JQRB 4NZLB 4C7ZA 3WCQA 1I4QA 1SB3C 1N63A 1ZDXA 3AEBB 5AUIA 2WXKA 3O13A 2JYEA 2V0GA 4XE0A 1JALA 4HJGE 1YQ3B 3VQIA 1YNTE 1ZXIA 1TJEA 4XWTA 1I4HA 3AN1A 1K52A 3C8YA 1C77A 3TEXA 1FFUA 2WXOA 4EE2A 3SEBA 3U7ZA 4RNAA 5C2TB 1N62A 3MHZA 4YWGG 1RM6C 4OZCA 1JWBD 2GB1A 3R8BA 3IAS1 4FXCA 2B76B 1VZ6A 2G1EA 2JZPA 3MFGA 2PVOD 5MPOA 1ROEA 5AUKA 3AMZA 1GOZA 4HEA1 4O1NA 2K22A 1JWSD 3LYYA 2ZW1A 3GP7A 2JX5A 4GDLB 1AYFA 3AE6B 1FFVA 2PVGC 1JRPA 1XLOA 4MH8A 1F0ZA 1KF6B 4GLSC 4OZBA 4WH4A 3W2DA 2WXPA 3BZDB 1JQ4A 1FNVA 1V8CA 3KWLA 1VR9A 1PGXA 3BK2A 4IKGA 1B1ZA 4ZOHC 5BMGA 3Q8EA 4C7YA 4KGTA 3MJ5A 2XNAC 3DWMA 5EE3A 1B9RA 5JXVA 4MT5A 1XF5L 5GXGB 2WDQB 2SEBD 1L0XB 1ZPSA 1VLBA 2WXJA 3CWIA 1ZDVA 2WU2B 1ZP0B 5EE9A 1WGKA 2L52A 5FKAC 3AEEB 1XEEA 3KWVA 4A8XC 1ZOYB 3Q8CA 4JWUC 3MC0B 1AN8A 4J3OD 2BS4B 3BK1A 4DXFA 1D5XC 2WQYB 1FCCC 1R7SA 3P1MA 3BYTB 2INPE 5HI1A 2JYTA 3P4PB 1XLNA 2WLBA 1CZPA 1FXIA 1J7BA 3FAHA 2ICIA 3EA6A 4WAFA 5LNK1 3AECB 1RYJA 1EWCA 1YN4A 3N9YC 2INNE 5E6JA 1TZOA 4LK0M 1C4AA 1SE4A 3BWUD 2K5PA 1TS3A 1OQQA 1RWSA 3LB8C 1WSPA 2WXFA 4OVZA 1XLPA 4YTNB 4AS1A 3Q8FA 1E0ZA 3ZQ4A 4B0MA 4RF1A 1UUPA 2IGHA 2BW2A 2QJLA 2E6XA 1FXAA 1TS5A 1WXQA 4TMAB 5H8YE 1EU3A 1YN5A 1KLGD 3IAM1 1T5XD 4NAMA 5BYSA 3RFZB 4USAA 2PLPA 1PGAA 3IXSA 3T3OA 4Q2JA 3AEDB 1SBBB 1FRDA 2X38A 1C4CA 1SJED 3AE5B 4PT5A 2RDHA 2N9LA 1KTKA 1JWUD 4MACA 1XCTL 4GDKB 2QEJC 3P4RB 3PZ7A 5TSSA 1L6UA 2AX5A 2L32A 3PZ8A 1HA5A 2LHDA 1GAQB 3NUHB 4C56C 4RF0A 5EE1A 1MHXA 1ZE3D 1P7EA 3TEYA 3VRAB 5FK9C 1TY2A 2QILA 1M4VA 4JX1C 4ZHPA 2Y5PA 3U52E 3BYYB 1NI3A 4HKQA 1FD6A 4AQ7A 2OEDA 3SFDB 1C9FA 1F77A 3AE8B 1E10A 2WXIA 1DOIA 1C4PA 3HVZA 3NS1A 4ZRPA 1BMLC 4US9A 4YTPB 3B2FA 2K3UA 1PYWD 5HHDG 2E3TA 4YSXB 1CK1A 2MJ3A 3CIRB 4YXDB 1NVID 1CQVA 2LGIA 3ZJTA 2W55A 1VJKA 2IPKD 3KQ4A 2DBYA 3AE4B 4N59A 2VZKB 1BUIC 4B0EA 2LMCA 2D5GA 2QIEB 1NYRA 3ZJVA 3ZYYX 1HXYD 3AH7A 5G5GA 4ITKA 4H2AA 1KH0A 1TKEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4HKZ E;  2LUM A;  3FIL A;  1FCC C;  2N7J A;  5HI1 A;  2IGG A;  2QSD A;  1HZ6 A;  3UI3 A;  5HFY A;  2J53 A;  1YMH E;  1IGD A;  1MPE A;  5BMH A;  5HG2 A;  1IBX B;  3MP9 A;  1MVK A;  1MHH E;  4KGS A;  2RMM A;  1F2R I;  2IGH A;  2KAC A;  2JWU A;  1F2R C;  2KN4 A;  2IGD A;  2ZW0 A;  2PTL A;  2JU6 X;  2LHE A;  2RPV A;  2PLP A;  1PGA A;  2I38 A;  1GB1 A;  3V3X A;  2KWD A;  1HEZ E;  1MI0 A;  1IBX A;  4HJG E;  2I2Y A;  2N9L A;  1YNT E;  4MAC A;  4IOI E;  1XCT L;  3GB1 A;  1K53 A;  2JXT A;  1ZXH A;  2J52 A;  1K52 A;  2LHD A;  1HZ5 A;  2N9K A;  1EM7 A;  1MHX A;  1P7E A;  2JSV X;  1PGB A;  1XCQ L;  4OZA A;  4OZC A;  2GB1 A;  1K50 A;  2JZP A;  2PW9 A;  1FD6 A;  2OED A;  1FCL A;  1C9F A;  1QKZ A;  1UWX A;  5BMI A;  2ZW1 A;  1D4B A;  2NMQ A;  2EEL A;  5HHD G;  1IGC A;  2ON8 A;  1P7F A;  4GLS C;  4OZB A;  4WH4 A;  4D2K A;  2LGI A;  3FIL B;  1PGX A;  2GI9 A;  2K0P A;  4IKG A;  1Q10 A;  5BMG A;  1GB4 A;  4KGT A;  1K51 A;  1JML A;  4KGR A;  5JXV A;  1XF5 L;  2KQ4 X;  2QMT A;  2ONQ A;  2KDM A;  1KH0 A; 
#chains in the Genus database with same CATH topology
 3E56 A;  4HKZ E;  3TJP A;  4KSL C;  2N4F A;  3DBL B;  1HTQ A;  1FMA D;  4RM9 A;  1MG8 A;  1V1P A;  3T9L A;  2EKI A;  2N7J A;  2ZCB A;  4ZHO A;  3AE3 B;  3N1Y C;  2YEP B;  2WWZ A;  3UI3 A;  2BGF A;  3Q8B A;  5DPW A;  1OQR A;  3D32 A;  2J53 A;  1IGD A;  2L83 A;  2L0T A;  1JRO A;  2LVP A;  4UDU C;  4EZL A;  2MP2 A;  4CO7 A;  4GOC A;  4JLC A;  1C76 A;  1UH6 A;  4MGI E;  2PIA A;  2LGS A;  3H1U A;  5FR6 A;  3I63 C;  4EZJ A;  2MWS B;  4W9K A;  3WA0 A;  3Q3O C;  2PTL A;  1V97 A;  3U2S C;  2LHE A;  4YL8 A;  4MJS A;  2RDB C;  4WWO A;  2BQQ A;  2G3Q B;  1UNS A;  2I2Y A;  1Q0W B;  1I4X A;  2KFK B;  3L08 A;  2LAS A;  3EFU A;  2J52 A;  3PS6 A;  4FA6 A;  1EM7 A;  3QWZ B;  4WWN A;  4ZRI A;  2LGY A;  1P1A A;  1WH3 A;  4P7I A;  3A1Q A;  2K8B A;  3PPA A;  1EU4 A;  4DXG A;  4GGQ A;  3TBL D;  1KFY B;  3DVN U;  2NCN A;  1ACC A;  1V1P B;  2WXR A;  2N1W A;  1KLV A;  3AEG B;  3NVY A;  3V61 A;  1NDD A;  2W9N A;  3R2I A;  2C7N B;  2OHF A;  4ICU A;  2MH7 A;  4ICV A;  1I7H A;  2W82 A;  2MCN B;  2Z8L A;  5DPR A;  5DCN A;  2MP2 B;  3V05 A;  3JVZ X;  4DBG A;  4RGM A;  3KW5 B;  3PT2 B;  3QHT A;  2KMM A;  2KTR A;  3W1S A;  3W1S C;  3Q3M C;  1JWM D;  5HFY A;  3I3T B;  2D3B A;  3KVF B;  1GNU A;  5E6N A;  2JF5 A;  4MJS B;  4XWW A;  2ZEQ A;  5J18 A;  1E7P B;  2IJ0 A;  1N61 A;  3BIN A;  3M3J A;  2HDE A;  1FNU A;  1ZKH A;  4W9F A;  2W3S A;  2D2Q A;  2W3R A;  4JQW C;  5H92 C;  3DPD A;  1YJJ A;  1UBI A;  2FNJ B;  1GB1 A;  3A9K A;  5IAA C;  4REZ A;  3MC8 A;  4M0W A;  2MQJ A;  4N9F 4;  4WIP A;  1V49 A;  4FHJ A;  4LLG M;  2H89 B;  3DWG C;  1QZE A;  3A1Q B;  4B9K A;  3QK0 A;  1XD3 B;  1D5M C;  1FXT B;  1OEY A;  3T3N A;  3KLS X;  5EE0 A;  2WP9 B;  5AZF A;  3RNB C;  1TIF A;  2MBE A;  1S1Q B;  1N6Z A;  2BT6 A;  1FEH A;  1PGB A;  3A9J B;  2KTF A;  4AWJ A;  3Q69 A;  2WDV B;  1K50 A;  4NQL B;  3ALB A;  4LNN A;  1FCL A;  1OFF A;  2BPS A;  4JE3 B;  1A5R A;  1ESF A;  3TEZ A;  2KWU B;  2NMQ A;  4GU2 A;  1IPG A;  4FAD A;  3BVG A;  3U7D A;  2MLB A;  2KWC A;  2J0K A;  3ZO5 B;  3AE2 B;  4K3B A;  1V86 A;  2KTR B;  4L2Y A;  3B9J A;  1Q5W B;  4C80 A;  2DWQ A;  4XZ4 A;  1QF6 A;  4XX5 A;  1J19 A;  2LRW A;  1I4G A;  4OW0 A;  4MGK E;  3SFE B;  2VH1 A;  1E8W A;  1FPY A;  4RGO S;  4RM8 A;  4KV2 A;  4URK A;  2BWF A;  1JW9 D;  2LVO A;  1TS2 A;  1NEK B;  3GE8 C;  4XC2 A;  5BO4 B;  1DOY A;  4WWM A;  1Q1O A;  3LJ3 A;  3A9K B;  5BMH A;  4M0W B;  4HPM B;  3NRZ A;  4M8M A;  3N1Z C;  1F1H A;  1ISN A;  4ZRK A;  4JWS C;  2AQ3 B;  3TMP B;  2L00 B;  3SR6 A;  2LVQ A;  1I4Q A;  1ZDX A;  4PYZ A;  2NPT A;  3AEB B;  3NJT A;  4XE0 A;  4HJG E;  1EO6 A;  1YNT E;  1ZXI A;  1R4M B;  4IM0 A;  4K81 A;  2C9W B;  4A3P A;  3AN1 A;  4HDO A;  3TEX A;  1FFU A;  2RSU A;  2GB1 A;  3R8B A;  1IYF A;  3UQB A;  2JZP A;  1WM2 A;  2IYD B;  2L3Z A;  3AMZ A;  1GOZ A;  2PE9 A;  4O1N A;  2K22 A;  1JWS D;  2MSE D;  3LYY A;  4DHJ D;  2ZW1 A;  2O2V A;  1AYF A;  3RZW C;  4DDI D;  4MH8 A;  5TR5 A;  1KF6 B;  4OZB A;  2GMI C;  2CHZ A;  4AJW A;  3KWL A;  3VDZ A;  4F1S A;  4IKG A;  5IP4 D;  2IY0 B;  3MJ5 A;  5EE3 A;  3ZNH B;  5JXV A;  4MT5 A;  1XF5 L;  1WRD B;  2WDQ B;  2SEB D;  1L0X B;  2WU2 B;  2NVU I;  1ZP0 B;  1WGK A;  3ZTC A;  4A8X C;  3MJW A;  3Q8C A;  4JWU C;  4E3C A;  3ZVV A;  2WQY B;  1WXM A;  3JSV B;  2JYT A;  3P4P B;  2JT4 B;  2UWQ A;  2WLB A;  1FXI A;  4W9I A;  5LNK 1;  3DBR I;  1EWC A;  4ANX A;  3N9Y C;  4GDL A;  4C4V B;  2J7Q B;  1TZO A;  4LK0 M;  3BWU D;  1AAR A;  3M62 B;  1RWS A;  4OVZ A;  2WXF A;  1XLP A;  4LJP B;  2CKH B;  3ZQ4 A;  4G50 A;  2A5U A;  4E74 A;  1FXA A;  4TMA B;  1WXV A;  5H8Y E;  4BKG A;  1T5X D;  3V60 A;  3T3O A;  4ZRJ A;  2GBN A;  3EHV A;  2JY6 A;  4GSW A;  2XK5 A;  3PLV A;  1FRD A;  5D2M B;  3ONS A;  3H7P A;  4MGY E;  4XYC A;  3JYU A;  2J0J A;  4GDK B;  3P4R B;  3PZ7 A;  1L6U A;  2LHD A;  1WMH A;  2O2V B;  3Q3F A;  4MM3 A;  3VRA B;  1TY2 A;  3AU4 A;  2A4Z A;  1M4V A;  1V81 A;  3PHW B;  4JX1 C;  3GE3 C;  3BYY B;  5CTR C;  4FLH A;  5CHF A;  1FD6 A;  1RAX A;  4M00 A;  5G55 A;  1GC6 A;  1F77 A;  2YLM A;  5AEK B;  2WXI A;  2ZZP B;  4M01 A;  2DZJ A;  3NY5 A;  3NS1 A;  3VUW A;  2I1J A;  3R7R A;  2BYF A;  5HHD G;  2E3T A;  3WAP A;  3ZW3 A;  3PRP B;  2KT7 A;  3CST A;  3VTU A;  2LGI A;  3KQ4 A;  1T0S C;  3HM6 X;  2VZK B;  5D94 A;  3N1X C;  2KLG A;  3ZYY X;  5G5G A;  1GUA B;  1V9J A;  1TKE A;  1VDV A;  2J4X A;  3RUI B;  2LXC A;  3N30 A;  2BF8 B;  3NHE B;  2WXG A;  3IT6 B;  3VR8 B;  2MHJ A;  1WGD A;  2DX5 B;  1SJH D;  4FJV B;  2KWV B;  2KJR A;  2XK5 B;  3A4R A;  2CJO A;  2FBW B;  2DNF A;  2N7E A;  5HG2 A;  2R61 A;  3UIP B;  3NZ3 A;  1QOG A;  2FE8 A;  3RNF C;  5FR3 A;  2RMM A;  1F2R I;  4EEW A;  5AZH A;  3MHS D;  2G4S A;  3QIJ A;  2KVZ A;  1WMH B;  2QHO A;  4NJ7 A;  1L0Y B;  5I4D A;  3Q3J A;  4MM3 B;  1D6E C;  4ARC A;  1UBQ A;  4F8C B;  3UIN B;  3DCG A;  1DGJ A;  2BS2 B;  4IOI E;  3GB1 A;  1LQB A;  2WHI A;  5IN7 A;  3SU8 X;  2LEK A;  4DHZ E;  2N1V A;  1UD7 A;  4OZA A;  2BYV E;  2G45 B;  2M1M A;  1YX5 B;  2ZNV C;  1I35 A;  3DBH B;  4HCN B;  3T8M A;  4L23 A;  4GXB A;  2HJ1 A;  2BB5 A;  4L1B A;  1X1M A;  3P63 A;  3VHT C;  3EUB 2;  3APC A;  4IUM B;  2PJH A;  2WDR B;  2DZI A;  3PLU A;  1R4N B;  1JML A;  1BXT A;  4KGR A;  4P16 A;  3RMK C;  3BY4 B;  2ONQ A;  4K1R B;  2WS3 B;  1KOT A;  3M95 A;  5IKC M;  2NTT A;  2YEP F;  4P1C C;  1PUT A;  5T8I A;  5EDS A;  1K8R B;  3HRD D;  3KYD D;  2WGS A;  2JZ3 B;  1AWD A;  4BBN C;  2DEN B;  2ZCC A;  2NTS A;  1TYG B;  4WUR A;  3EC8 A;  4KGS A;  2JRI B;  1QQR A;  4OHJ A;  4RGN A;  1L6V A;  1PDX A;  1UWM A;  3PZD A;  1LO5 D;  1P9D U;  4WJP A;  4YSZ B;  4RGT A;  2KO3 A;  4R3D A;  4DQO C;  4II3 B;  3GZN B;  2CJN A;  4RMA A;  2WXL A;  2GRI A;  5D7G A;  1VZ8 A;  4EKU A;  4ANW A;  4IDI A;  3AEF B;  3PRM B;  3C0R B;  1E8X A;  1AW7 A;  2M56 B;  3NVZ A;  3ZGZ A;  2ZNV B;  3HUI A;  1WE6 A;  4IW0 A;  5IO9 A;  2JXT A;  5BYQ A;  4KKI A;  1NYQ A;  3O65 B;  4LNI A;  1E9M A;  5G5H A;  1T0Q C;  2KDF B;  4BBN F;  2PW9 A;  4PK1 A;  1KLU D;  2MX2 A;  2JRH A;  2LXA A;  2AQ2 B;  2KN5 A;  1Y56 A;  4W9L A;  4NJC A;  3R66 C;  4FJY A;  2CU1 A;  1IGC A;  4LNF A;  2ON8 A;  3L0W B;  1SE3 A;  2B3A A;  1A70 A;  1P7F A;  1UGM A;  1ET6 A;  2FUG 1;  3PV1 A;  2SAK A;  1E8Y A;  3IG3 A;  3NS8 A;  2KXJ A;  1Q10 A;  5LLI A;  1K51 A;  4HXD A;  2ZPY A;  2LFI A;  2JWZ A;  1LXD A;  2PMV A;  3RUL A;  2QMT A;  4I6P A;  4PS7 A;  1T6B X;  4TQ0 A;  1E6E B;  1TY0 A;  1XQQ A;  3AE7 B;  3A9J A;  2LRU A;  3PO0 A;  1HQR D;  2WNM A;  4A55 A;  3EEC A;  3B08 A;  2IDY A;  1STE A;  2VH2 A;  1YX6 B;  4MSQ B;  2WXN A;  1FIQ A;  4N6E B;  3ECI A;  4TV3 A;  2K39 A;  4PYU A;  1SEB D;  3RNA C;  1E8Z A;  3AU5 A;  3E9S A;  4PS3 A;  3N20 C;  4JPS A;  2CU3 A;  4LJO B;  2G9H D;  1UF0 A;  4BAX A;  4X57 B;  1GC7 A;  4P6V F;  2GOW A;  1D5Z C;  3WAL A;  4IWQ A;  1SB3 C;  2WXK A;  3O13 A;  5KHO A;  2JYE A;  2V0G A;  1JAL A;  1TJE A;  1OQY A;  3M63 B;  4HK2 A;  3C8Y A;  2WYQ A;  3LDZ E;  2WXO A;  1S3S G;  3SEB A;  3U7Z A;  3ZDM C;  4OZC A;  1JWB D;  3IAS 1;  4FXC A;  2DAJ A;  1VZ6 A;  2PVO D;  1ROE A;  5AUK A;  3PRZ A;  4LDT D;  1WJ6 A;  2JX5 A;  2NBU A;  3AE6 B;  1FFV A;  1V80 A;  2PVG C;  3PVL A;  1XLO A;  4WH4 A;  1Z2M A;  3L10 B;  4LCD E;  3PRE A;  4W9E A;  1V5O A;  4AUQ C;  2FID A;  3BZD B;  1FNV A;  2D10 A;  2KFJ A;  3ZNI D;  1VR9 A;  5BMG A;  2KC2 A;  3K9O B;  2XNA C;  1B9R A;  1T0Y A;  2LZ6 A;  1VLB A;  2KDE B;  2WXJ A;  1ZDV A;  3ZRC A;  2L0F A;  2NR2 A;  2KOX A;  2BS4 B;  1R7S A;  2UU7 A;  3P1M A;  3BYT B;  1SE9 A;  3DVN V;  3OJ3 A;  1CZP A;  3FAH A;  3EA6 A;  4WAF A;  4BOS C;  4FBJ B;  3UIO B;  1TS3 A;  2K5P A;  1OQQ A;  1WXA A;  3N3K B;  1WSP A;  3LB8 C;  2Y5B B;  2IGH A;  2E6X A;  1EU3 A;  1YN5 A;  4NAM A;  3NZS A;  1PGA A;  2X38 A;  4KSK C;  4PT5 A;  2N9L A;  2V9H A;  1XCT L;  2CHX A;  1TGZ B;  3VXW A;  5C1Z A;  3JSV A;  1GAQ B;  5EE1 A;  1WZ3 A;  4DHZ B;  2QIL A;  2Y5P A;  2ZVN A;  5KHQ A;  3KH0 A;  1R4M I;  4C4V A;  4EOY A;  3AE8 B;  1E10 A;  2K25 A;  4IG7 B;  1DOI A;  5JZE B;  4NJ6 A;  3HVZ A;  2FCS A;  4US9 A;  3B2F A;  1YQB A;  5IA7 A;  4E71 A;  2LUE A;  2MJ3 A;  3CIR B;  1NVI D;  1VJK A;  3L13 A;  4F7Z A;  2KHW B;  2IPK D;  4MSM B;  2M4N A;  3ZKJ C;  4FJZ A;  1WIA A;  4N59 A;  4B0E A;  2FCQ A;  3ZJV A;  1LGR A;  1HXY D;  3P2B A;  4GDK A;  2C5L C;  4H2A A;  4HRO A;  3X0W A;  5L95 C;  5JH5 C;  4TUU A;  3N32 A;  1EWY C;  1QLB B;  5D3I B;  3PHX B;  2MBQ A;  2QSD A;  5J2R A;  1HZ6 A;  1J0G A;  3L17 A;  3ZXR A;  1YMH E;  1MPE A;  4BZA A;  2FUH B;  2C7M B;  1L0V B;  4I6N B;  1F9J A;  1I4P A;  2RD0 A;  4BFR A;  1WYG A;  2IO1 B;  2KAC A;  2V3N A;  3BII D;  3JW0 X;  2DLB A;  1XLQ A;  2OJW A;  3HK0 A;  2BTE A;  3TL5 A;  3NVV A;  4CQN A;  3AE9 B;  2I38 A;  3V3X A;  2KWD A;  1HEZ E;  2N9X A;  2D3C A;  2BS3 B;  4K7S A;  5D6J B;  1SIJ A;  4ZRQ A;  2HJ8 A;  1Z5S B;  2D3A A;  2KAN A;  3ABV B;  1ZXH A;  4YSY B;  3FC4 A;  3AE1 B;  4WJN A;  2JZZ A;  2J0M A;  2M0A A;  2JSV X;  1VRA B;  4ACF A;  1XCQ L;  3J9C A;  1RFK A;  3ETR A;  4G3X B;  1DOX A;  3AXC A;  1GJZ A;  1CMX B;  2AWT A;  2H88 B;  3I57 A;  1QOA A;  3AUL A;  2LI5 A;  1NEN B;  1N5W A;  4KX6 B;  2BKR B;  3APD A;  2EEL A;  4ASW C;  4ANU A;  4XDD A;  3UF8 A;  4D2K A;  1GPX A;  4IWO A;  2R2O A;  3RZF A;  1KRH A;  1VD2 A;  2DZM A;  4LNO A;  3VTV A;  3DVG Y;  4A6Q A;  4HDQ A;  1J7A A;  4FN2 A;  1EUV B;  2V1Y A;  3AEA B;  3IBE A;  1C78 A;  1JWA D;  2AEH A;  2KQ4 X;  4HCP B;  2AL3 A;  2KDM A;  2V3S A;  2MA9 B;  3QAR A;  3R2T A;  4W9D A;  2Y3A A;  3Q2A C;  4DWF A;  3RN9 C;  1WGY A;  2XBB C;  2M8S A;  5E6P A;  2V3P A;  2WX0 A;  2C7H A;  3NOB A;  2GBM A;  1E7V A;  1L4D B;  1WFY A;  1IUE A;  1MHH E;  4WWP A;  4KKJ A;  2DYO A;  1SXT A;  3U8Z A;  1WZ0 A;  2IGD A;  1P98 A;  2KQS A;  4RCO A;  1I4R A;  2JU6 X;  1RRB A;  1T3Q A;  3IT4 B;  1L4Z B;  3U4E G;  3URY A;  1MI0 A;  2LJ5 A;  2J42 A;  1IBX A;  3RT3 B;  1TBE A;  1PFD A;  4DHJ B;  1SE2 A;  2BB6 A;  4EZK A;  3SDL C;  2N9K A;  3DQV A;  3GS2 A;  2DYM A;  4G11 A;  3DOW A;  2MBB B;  2WXH A;  4RFB A;  4GN1 A;  2K9X A;  2VRR B;  1QT9 A;  2V4L A;  1QKZ A;  2Z0D B;  5BMI A;  1MG4 A;  1RLF A;  2CHW A;  5C3J B;  1QOB A;  2L05 A;  3ZNG C;  3MTN B;  3APF A;  1SGH A;  2MBO A;  3BVM A;  3DBH I;  2K0P A;  3W5U B;  3VH4 B;  1DYQ A;  3ZXV A;  2PKO A;  1T0R C;  2MEK A;  2WXQ A;  2XN9 C;  2BBC A;  2JXX A;  3TUO A;  4N58 A;  2M0X A;  2MJE A;  3QAQ A;  4KZ0 A;  1TKY A;  5DPS A;  4EUT A;  3B2G A;  3BVZ A;  4MDK E;  4ZYS A;  1R4N I;  1WWT A;  4US8 A;  2KZR A;  5D3D A;  4AJY B;  2L1A A;  2Y5C A;  4NNJ B;  2RGF A;  2W54 A;  1UGJ A;  2K8C A;  2OJR A;  4YT0 B;  3ML8 A;  1KJT A;  2M17 A;  4BKT A;  3P4S B;  1IBX B;  1E90 A;  1XT9 B;  3CF6 E;  1C79 A;  2QC8 A;  3K9P B;  1CJE A;  2NBW B;  4W9C A;  3UGB B;  1M94 A;  4XDC A;  4C00 A;  1H8C A;  3OLM D;  3DDC B;  5AUI A;  4KDI C;  3WAO A;  3QQ8 B;  1L2N A;  2O6V A;  2ASQ A;  2UYZ B;  1WR1 A;  3L54 A;  3VQI A;  1YQ3 B;  2JVC A;  3WAM A;  2Z59 B;  1WM3 A;  3DBL I;  4XWT A;  3U30 A;  2QCZ A;  1C77 A;  2IND C;  4EE2 A;  2I1K A;  4CHK A;  3H9D A;  3GZN I;  2XEW A;  4HLE A;  1WGH A;  1EF5 A;  4YWG G;  3KYC D;  4II2 B;  4IC7 B;  2G1E A;  4OVV A;  3MFG A;  2R2Q A;  5AZG A;  1V6E A;  5MPO A;  4HEA 1;  1L7Y A;  4EFO A;  2KX0 A;  3GP7 A;  4BKS A;  4ZYN A;  1IP9 A;  2LD9 A;  2NS5 A;  2N9P C;  2HE7 A;  3W2D A;  3V6E B;  3SD5 A;  4BOZ B;  1EF1 A;  3PTF C;  3VUY A;  1JQ4 A;  2KMC A;  1B1Z A;  4ZOH C;  4KGT A;  2EMS A;  3DWM A;  5GXG B;  3PSE B;  1YOV B;  3RI7 C;  5FKA C;  3RNG C;  2DZK A;  3HM3 A;  3KWV A;  1ZOY B;  3MC0 B;  2RR9 A;  1D5X C;  1FCC C;  2INP E;  5HI1 A;  1XLN A;  4G0N B;  1HE8 A;  1J7B A;  2ICI A;  3AEC B;  1YN4 A;  4QAY A;  3ENE A;  3PGE A;  1ZGU B;  2INN E;  5E6J A;  4GMV A;  3QA8 A;  2K6Q A;  1NBF C;  2O6V B;  1C4A A;  1SE4 A;  3CMM B;  1NI2 A;  4HWI B;  4AS1 A;  2KKC A;  3Q8F A;  4B0M A;  4RF1 A;  2FIF A;  2QJL A;  2NBV B;  1WXQ A;  3W1Y A;  4NY0 A;  4CYE A;  4GB9 A;  4JL9 A;  3IAM 1;  3RFZ B;  3QCA A;  3Q3N C;  3IXS A;  1SBB B;  4MGZ E;  2MRP A;  2GLS A;  1C4C A;  2MW5 A;  1SJE D;  2RDH A;  1JWU D;  2BYE A;  5JHB A;  3ZUN A;  4IWP A;  1WX8 A;  2L32 A;  3PZ8 A;  1HA5 A;  2K6D B;  4MH0 E;  3NUH B;  2RPQ A;  2OOB B;  4RF0 A;  1MHX A;  1P7E A;  1WE7 A;  3NG0 A;  3QC8 B;  5FK9 C;  3WAN A;  2ZPN A;  4ZHP A;  3ZLZ A;  2KK8 A;  4AQ7 A;  4A3O A;  3A4S C;  2MBH A;  3SFD B;  1C9F A;  1U4A A;  2FCN A;  2IO0 B;  4ZRP A;  1BML C;  1MFW A;  4YTP B;  3SHQ A;  4MEL A;  3TIX A;  4YSX B;  2GBJ A;  4S0R A;  3TCA A;  5CHW A;  3ZJT A;  4AOF A;  2KDI A;  2GBK A;  3AE4 B;  4S17 A;  5DPT A;  4MEM A;  2IO2 B;  2D5G A;  1NYR A;  4ZDV A;  5E6O A;  2KC1 A;  1I42 A;  3HIZ A;  4ITK A;  4IM3 A;  3AB5 A;  2INC C;  2D07 B;  3VUX A;  1LFD A;  2ZJD A;  2LUM A;  3FIL A;  3QJZ A;  2N9E B;  1SF0 A;  4A90 A;  1TZ1 A;  2HD5 B;  2IGG A;  1FM0 D;  2K1F A;  2RDG A;  3ZJU A;  3W9C B;  4WQM A;  1G6J A;  3HVD A;  3I5J C;  1GG3 A;  2Q5W D;  1WJN A;  4TSS A;  3DHH C;  2YVC A;  3MP9 A;  1WGR A;  3VR9 B;  4K3C A;  1E5W A;  2KN4 A;  5LXH A;  1ET9 A;  2IZV B;  2MJD A;  2REX A;  1FNW A;  3AM9 A;  3Q6B A;  3B0A A;  4HPL B;  2BWE S;  2AQ1 B;  1YJI A;  1K53 A;  4M8N A;  2CR5 A;  3X23 A;  5L83 A;  1VZ7 A;  1P0R A;  4B6W A;  4RH6 A;  4ARI A;  2BKF A;  3Q8A A;  2KD0 A;  2HTM E;  2LJI A;  1UWX A;  4HRS A;  1WYW B;  1VCB A;  1YD8 U;  4YTM B;  4WQO B;  1QIL A;  1OTR B;  3KUD B;  1V5T A;  3FIL B;  3NVW A;  4FUL A;  2EKE C;  5CX3 A;  3R7Q A;  3R3M A;  4HVB A;  4DDG D;  3RD2 A;  4FHK A;  1SIF A;  3OJ4 B;  4TQ1 A;  1SSN A;  3H8H A;  1JRU A;  1WJ4 A;  2IBI B;  1YJ1 A;  4K7U A;  2EMT A;  1TS4 A;  3UQA A;  2KX3 A;  3EGR A;  3OWE B;  2VZK D;  1C1Y B;  1QOF A;  2N0S B;  3EFC A;  3TSS A;  1WXS A;  1FO4 A;  4IM2 A;  4NAW A;  1MJD A;  2KQ7 A;  5JHA A;  5HKH A;  1YQ4 B;  2M19 A;  1MVK A;  3IHP C;  2WU5 B;  1KM7 A;  4A9A A;  1N5X A;  2HTH A;  2ZW0 A;  2IO3 B;  1PQS A;  1V1O A;  3VFK A;  1ZUD 2;  2Z0E B;  3LXF A;  3DHI C;  1WF9 A;  4LDT B;  2JUO A;  2ACZ B;  3P4Q B;  1OEY J;  4I6L B;  1HZ5 A;  3AV8 A;  5LXI B;  1YIW A;  4HPP A;  1Y8R C;  1WX7 A;  4LTU A;  2LGD A;  3KUZ A;  4JGH B;  3HHM A;  1TTN A;  4HJK A;  3CSF A;  1D4B A;  3W5V B;  3RPF C;  2CS4 A;  3KUC B;  3P42 A;  3L4P A;  3I9V 1;  4BVU C;  2PPH A;  2X8X X;  4WJO A;  1FRR A;  2GI9 A;  1TKG A;  3C19 A;  1GB4 A;  4DK5 A;  1JCK B;  1YN3 A;  2AL6 A;  3S2A A;  2G4D B;  2NPT B;  3DBR B;  2KAJ A;  4NAW B;  1J7C A;  5BYR A;  4P1B C;  3TEW A;  1N60 A;  2K8H A;  1WY8 A;  1XXG A;  3VTW A;  2GBR A;  2KNB A;  1D3Z A;  2WXM A;  2V4I B;  4AP4 C;  2TSS A;  3VRB B;  3QX1 A;  4KIK A;  4KDL B;  1XO3 A;  1L5P A;  2JWU A;  1WRI A;  4PS8 A;  1F2R C;  2BYT A;  2KLC A;  1ENF A;  2RPV A;  4NZL B;  2JQR B;  4XGA B;  4C7Z A;  5G2N A;  3WCQ A;  1N63 A;  4GIV A;  3L16 A;  4A20 A;  4NQK E;  1BT0 A;  1LM8 B;  2PEA A;  1I4H A;  3IVF A;  1K52 A;  1OGW A;  3RNE C;  4RNA A;  5C2T B;  1N62 A;  3MHZ A;  1RM6 C;  4TKN A;  2ZVO A;  2B76 B;  1WI0 A;  3FKY A;  3ZRF A;  2JPH A;  3V6C B;  3NZU A;  2D3G A;  3DVG X;  1WJU A;  4GDL B;  5CHV C;  3DBS A;  1JRP A;  1F0Z A;  4GLS C;  4KVG B;  4W9J A;  4K7W A;  2WXP A;  2L8J A;  4LNK A;  2PE6 B;  1V8C A;  2BVC A;  2C60 A;  1PGX A;  3BK2 A;  4M02 A;  3Q8E A;  4ANV A;  1E7U A;  4C7Y A;  3VAW A;  4W9G A;  1UZX B;  1ZPS A;  2DYB A;  3CWI A;  2WX1 A;  5EE9 A;  2L52 A;  1RFA A;  3AEE B;  1F52 A;  3H7P B;  1XEE A;  2FAZ A;  2L76 A;  4B95 A;  4KIK B;  1AN8 A;  4J3O D;  3BK1 A;  1P3Q U;  4DXF A;  2IY1 B;  2D11 A;  3H6N A;  2N7D A;  4DXA B;  1V2Y A;  1C3T A;  1TT5 B;  2LWP A;  1RYJ A;  3AI5 A;  2L7R A;  4JIO U;  1HTO A;  2KVR A;  2O6V D;  1WGG A;  3GOE A;  1UEL A;  4YTN B;  1E0Z A;  3MC9 A;  3Q14 C;  1UUP A;  3WIM A;  2BW2 A;  1TS5 A;  1WX9 A;  1KLG D;  5BYS A;  2KYW A;  4USA A;  1H4R A;  2PLP A;  3RNC C;  4Q2J A;  2WDT B;  3AED B;  3ZTD A;  3RYT A;  4WAA A;  3AE5 B;  3B1L X;  2KJH B;  3RCZ A;  1KTK A;  5C23 A;  4MAC A;  4BKS D;  3VVW B;  2QEJ C;  3ZNZ B;  5TSS A;  2AX5 A;  4W9H A;  4C56 C;  3OAW A;  2QDF A;  1ZE3 D;  4KZC A;  3TEY A;  5IOI A;  2LGX A;  3U52 E;  2FCM A;  3IFW B;  1NI3 A;  4HKQ A;  2OED A;  5J17 A;  5GMV A;  2AYO B;  2KFK A;  2KDB A;  1C4P A;  1WR6 E;  3A33 B;  3ML9 A;  3ZIM A;  4WJQ A;  4J6I A;  2K3U A;  1PYW D;  1CK1 A;  1J8C A;  4OVU A;  4YXD B;  1CQV A;  2W55 A;  4NPN A;  3H7S A;  2DBY A;  3V62 A;  3VH3 B;  2DHZ A;  1BUI C;  2LMC A;  2DAF A;  1ZW7 A;  2KJ6 A;  2QIE B;  3OG5 A;  3AH7 A;  1KH0 A;  2KMA A;  3DHG C;  3ZDT A; 
#chains in the Genus database with same CATH homology
 1VDV A;  2J4X A;  3AB5 A;  3E56 A;  4HKZ E;  2LUM A;  3FIL A;  1EWY C;  1FMA D;  1SF0 A;  1V1P A;  4ZHO A;  2EKI A;  2N7J A;  4A90 A;  1QLB B;  2WXG A;  5D3I B;  2IGG A;  3AE3 B;  1FM0 D;  2QSD A;  1HZ6 A;  2RDG A;  3IT6 B;  2YEP B;  3VR8 B;  3UI3 A;  3ZJU A;  3W9C B;  3Q8B A;  4HRO A;  1OQR A;  4WQM A;  2J53 A;  1SJH D;  1YMH E;  1IGD A;  2L83 A;  3HVD A;  1MPE A;  1JRO A;  4UDU C;  2Q5W D;  2CJO A;  2FBW B;  1C76 A;  5HG2 A;  2R61 A;  4TSS A;  1L0V B;  3NZ3 A;  1I4P A;  1QOG A;  2PIA A;  3MP9 A;  2FE8 A;  1WYG A;  5FR3 A;  3VR9 B;  2RMM A;  1F2R I;  2KAC A;  2KN4 A;  2V3N A;  3BII D;  2PTL A;  1V97 A;  3U2S C;  2LHE A;  2DLB A;  1XLQ A;  2BTE A;  1L0Y B;  5I4D A;  3NVV A;  4MM3 B;  4CQN A;  3AE9 B;  2I38 A;  1D6E C;  1ET9 A;  3V3X A;  4ARC A;  2KWD A;  2MJD A;  1FNW A;  3AM9 A;  1HEZ E;  1UNS A;  2I2Y A;  2BS3 B;  1DGJ A;  2BS2 B;  1I4X A;  2AQ1 B;  1SIJ A;  4IOI E;  4ZRQ A;  3GB1 A;  1YJI A;  1K53 A;  3ABV B;  4YSY B;  1ZXH A;  2J52 A;  3FC4 A;  3AE1 B;  2LEK A;  2M0A A;  1EM7 A;  1VZ7 A;  2JSV X;  1VRA B;  1XCQ L;  4OZA A;  4RH6 A;  3J9C A;  1RFK A;  3ETR A;  4ARI A;  1DOX A;  3Q8A A;  2H88 B;  3I57 A;  2HTM E;  1QOA A;  2LJI A;  1UWX A;  4HRS A;  4L23 A;  1EU4 A;  1NEN B;  1N5W A;  2BB5 A;  4KX6 B;  2EEL A;  4YTM B;  1QIL A;  4XDD A;  4L1B A;  4DXG A;  4D2K A;  1GPX A;  1KFY B;  3P63 A;  1KRH A;  3FIL B;  3NVW A;  4A6Q A;  1J7A A;  3EUB 2;  1ACC A;  1V1P B;  2WXR A;  2WDR B;  3AEA B;  3AEG B;  3NVY A;  1JML A;  1BXT A;  3R2I A;  1C78 A;  4KGR A;  4P16 A;  1JWA D;  2OHF A;  2KQ4 X;  2MH7 A;  2ONQ A;  1I7H A;  2KDM A;  2W82 A;  3R2T A;  2Z8L A;  2WS3 B;  4TQ1 A;  1SSN A;  3H8H A;  3V05 A;  2Y3A A;  4RGM A;  2NTT A;  1TS4 A;  2YEP F;  1PUT A;  5T8I A;  2V3P A;  3EGR A;  2KMM A;  3OWE B;  2VZK D;  3HRD D;  2N0S B;  1QOF A;  3W1S A;  1JWM D;  5HFY A;  1AWD A;  3TSS A;  1FO4 A;  4XWW A;  2NTS A;  1E7P B;  2IJ0 A;  1L4D B;  1IUE A;  1N61 A;  1TYG B;  1YQ4 B;  4WUR A;  2M19 A;  2HDE A;  1MVK A;  2WU5 B;  1MHH E;  4KGS A;  1N5X A;  4A9A A;  1QQR A;  1FNU A;  4KKJ A;  2DYO A;  1SXT A;  4OHJ A;  4RGN A;  1L6V A;  1PDX A;  2W3S A;  2IGD A;  1UWM A;  2W3R A;  4RCO A;  1LO5 D;  2ZW0 A;  1I4R A;  2JU6 X;  4YSZ B;  5H92 C;  4RGT A;  1V1O A;  1YJJ A;  4R3D A;  1T3Q A;  1ZUD 2;  3IT4 B;  1L4Z B;  4DQO C;  2CJN A;  1GB1 A;  2WXL A;  2GRI A;  5D7G A;  3U4E G;  3URY A;  1VZ8 A;  3LXF A;  4REZ A;  1MI0 A;  4IDI A;  3AEF B;  2J42 A;  4M0W A;  1IBX A;  1AW7 A;  2M56 B;  3NVZ A;  4WIP A;  3ZGZ A;  4LLG M;  2H89 B;  3DWG C;  3HUI A;  1PFD A;  2ACZ B;  1D5M C;  2JXT A;  5BYQ A;  4KKI A;  1SE2 A;  3P4Q B;  1NYQ A;  3KLS X;  2BB6 A;  5EE0 A;  1HZ5 A;  3T3N A;  2WP9 B;  3AV8 A;  2N9K A;  3GS2 A;  2DYM A;  1E9M A;  2BT6 A;  1FEH A;  1PGB A;  5G5H A;  3Q69 A;  2WXH A;  2WDV B;  4RFB A;  4LTU A;  1K50 A;  2PW9 A;  1KLU D;  1FCL A;  1OFF A;  2K9X A;  4JE3 B;  1ESF A;  1QT9 A;  2AQ2 B;  1QKZ A;  1Y56 A;  3TEZ A;  5BMI A;  1D4B A;  4NJC A;  3W5V B;  2NMQ A;  3RPF C;  3BVG A;  5C3J B;  1IGC A;  3P42 A;  3L4P A;  2ON8 A;  1SE3 A;  3I9V 1;  1A70 A;  1P7F A;  1QOB A;  1ET6 A;  3AE2 B;  2FUG 1;  2SAK A;  1FRR A;  3BVM A;  2GI9 A;  2K0P A;  1Q10 A;  1TKG A;  1GB4 A;  3W5U B;  1JCK B;  1K51 A;  1YN3 A;  1DYQ A;  2LFI A;  2PKO A;  4L2Y A;  2MEK A;  2WXQ A;  2XN9 C;  2BBC A;  2PMV A;  3B9J A;  2QMT A;  4C80 A;  3TUO A;  2DWQ A;  1T6B X;  4TQ0 A;  1E6E B;  4N58 A;  1QF6 A;  2KAJ A;  4NAW B;  2MJE A;  1J7C A;  5BYR A;  1TY0 A;  4OW0 A;  1I4G A;  1TKY A;  3TEW A;  3AE7 B;  3B2G A;  3PO0 A;  1HQR D;  1N60 A;  3SFE B;  3BVZ A;  2WNM A;  4A55 A;  4ZYS A;  1WWT A;  4RGO S;  1XXG A;  2IDY A;  1STE A;  1JW9 D;  4US8 A;  1TS2 A;  5D3D A;  1NEK B;  2WXN A;  1FIQ A;  2L1A A;  2WXM A;  2Y5C A;  4N6E B;  2V4I B;  1DOY A;  2TSS A;  4WWM A;  2W54 A;  1UGJ A;  1SEB D;  4YT0 B;  3VRB B;  5BMH A;  1XO3 A;  3NRZ A;  3P4S B;  1IBX B;  1L5P A;  3E9S A;  4JPS A;  1C79 A;  2CU3 A;  2JWU A;  1WRI A;  1F2R C;  2BYT A;  1CJE A;  2AQ3 B;  2G9H D;  4JWS C;  3SR6 A;  4P6V F;  4XDC A;  1ENF A;  1D5Z C;  2RPV A;  2JQR B;  4NZL B;  4C7Z A;  3WCQ A;  1I4Q A;  1SB3 C;  1N63 A;  1ZDX A;  3AEB B;  5AUI A;  2WXK A;  3O13 A;  2JYE A;  2V0G A;  4XE0 A;  1JAL A;  4HJG E;  1YQ3 B;  3VQI A;  1YNT E;  1ZXI A;  1TJE A;  4XWT A;  1I4H A;  3AN1 A;  1K52 A;  3C8Y A;  1C77 A;  3TEX A;  1FFU A;  2WXO A;  4EE2 A;  3SEB A;  3U7Z A;  4RNA A;  5C2T B;  1N62 A;  3MHZ A;  4YWG G;  1RM6 C;  4OZC A;  1JWB D;  2GB1 A;  3R8B A;  3IAS 1;  4FXC A;  2B76 B;  1VZ6 A;  2G1E A;  2JZP A;  3MFG A;  2PVO D;  5MPO A;  1ROE A;  5AUK A;  3AMZ A;  1GOZ A;  4HEA 1;  4O1N A;  2K22 A;  1JWS D;  3LYY A;  2ZW1 A;  3GP7 A;  2JX5 A;  4GDL B;  1AYF A;  3AE6 B;  1FFV A;  2PVG C;  1JRP A;  1XLO A;  4MH8 A;  1F0Z A;  1KF6 B;  4GLS C;  4OZB A;  4WH4 A;  3W2D A;  2WXP A;  3BZD B;  1JQ4 A;  1FNV A;  1V8C A;  3KWL A;  1VR9 A;  1PGX A;  3BK2 A;  4IKG A;  1B1Z A;  4ZOH C;  5BMG A;  3Q8E A;  4C7Y A;  4KGT A;  3MJ5 A;  2XNA C;  3DWM A;  5EE3 A;  1B9R A;  5JXV A;  4MT5 A;  1XF5 L;  5GXG B;  2WDQ B;  2SEB D;  1L0X B;  1ZPS A;  1VLB A;  2WXJ A;  3CWI A;  1ZDV A;  2WU2 B;  1ZP0 B;  5EE9 A;  1WGK A;  2L52 A;  5FKA C;  3AEE B;  1XEE A;  3KWV A;  4A8X C;  1ZOY B;  3Q8C A;  4JWU C;  3MC0 B;  1AN8 A;  4J3O D;  2BS4 B;  3BK1 A;  4DXF A;  1D5X C;  2WQY B;  1FCC C;  1R7S A;  3P1M A;  3BYT B;  2INP E;  5HI1 A;  2JYT A;  3P4P B;  1XLN A;  2WLB A;  1CZP A;  1FXI A;  1J7B A;  3FAH A;  2ICI A;  3EA6 A;  4WAF A;  5LNK 1;  3AEC B;  1RYJ A;  1EWC A;  1YN4 A;  3N9Y C;  2INN E;  5E6J A;  1TZO A;  4LK0 M;  1C4A A;  1SE4 A;  3BWU D;  2K5P A;  1TS3 A;  1OQQ A;  1RWS A;  3LB8 C;  1WSP A;  2WXF A;  4OVZ A;  1XLP A;  4YTN B;  4AS1 A;  3Q8F A;  1E0Z A;  3ZQ4 A;  4B0M A;  4RF1 A;  1UUP A;  2IGH A;  2BW2 A;  2QJL A;  2E6X A;  1FXA A;  1TS5 A;  1WXQ A;  4TMA B;  5H8Y E;  1EU3 A;  1YN5 A;  1KLG D;  3IAM 1;  1T5X D;  4NAM A;  5BYS A;  3RFZ B;  4USA A;  2PLP A;  1PGA A;  3IXS A;  3T3O A;  4Q2J A;  3AED B;  1SBB B;  1FRD A;  2X38 A;  1C4C A;  1SJE D;  3AE5 B;  4PT5 A;  2RDH A;  2N9L A;  1KTK A;  1JWU D;  4MAC A;  1XCT L;  4GDK B;  2QEJ C;  3P4R B;  3PZ7 A;  5TSS A;  1L6U A;  2AX5 A;  2L32 A;  3PZ8 A;  1HA5 A;  2LHD A;  1GAQ B;  3NUH B;  4C56 C;  4RF0 A;  5EE1 A;  1MHX A;  1ZE3 D;  1P7E A;  3TEY A;  3VRA B;  5FK9 C;  1TY2 A;  2QIL A;  1M4V A;  4JX1 C;  4ZHP A;  2Y5P A;  3U52 E;  3BYY B;  1NI3 A;  4HKQ A;  1FD6 A;  4AQ7 A;  2OED A;  3SFD B;  1C9F A;  1F77 A;  3AE8 B;  1E10 A;  2WXI A;  1DOI A;  1C4P A;  3HVZ A;  3NS1 A;  4ZRP A;  1BML C;  4US9 A;  4YTP B;  3B2F A;  2K3U A;  1PYW D;  5HHD G;  2E3T A;  4YSX B;  1CK1 A;  2MJ3 A;  3CIR B;  4YXD B;  1NVI D;  1CQV A;  2LGI A;  3ZJT A;  2W55 A;  1VJK A;  2IPK D;  3KQ4 A;  2DBY A;  3AE4 B;  4N59 A;  2VZK B;  1BUI C;  4B0E A;  2LMC A;  2D5G A;  2QIE B;  1NYR A;  3ZJV A;  3ZYY X;  1HXY D;  3AH7 A;  5G5G A;  4ITK A;  4H2A A;  1KH0 A;  1TKE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...