1PGBA

Two crystal structures of the b1 immunoglobulin-binding domain of streptoccocal protein g and comparison with nmr
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
56
structure length
56
Chain Sequence
MTYKLILNGKTLKGETTTEAVDAATAEKVFKQYANDNGVDGEWTYDDATKTFTVTE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN G
publication title Two crystal structures of the B1 immunoglobulin-binding domain of streptococcal protein G and comparison with NMR.
pubmed doi rcsb
source organism Streptococcus sp. gx7805
molecule tags Immunoglobulin binding protein
total genus 15
structure length 56
sequence length 56
ec nomenclature
pdb deposition date 1993-11-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01378 IgG_binding_B B domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.10 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1pgbA00
1YNTE 1YMHE 3FILA 2NMQA 1IBXB 4IKGA 4GLSC 1K51A 2ZW1A 1MHHE 2JU6X 4HJGE 1FD6A 2KACA 1GB4A 3MP9A 4OZCA 5JXVA 2KQ4X 1F2RC 2ZW0A 1XCQL 2J52A 2GI9A 1QKZA 2QSDA 2LUMA 1ZXHA 1K50A 5HG2A 2I2YA 2LHEA 2KWDA 2JWUA 5HHDG 5HI1A 3UI3A 2OEDA 1IBXA 2ONQA 4KGTA 1HZ6A 1IGDA 5BMGA 2PTLA 2PLPA 1IGCA 2ON8A 2IGDA 1FCCC 1D4BA 5BMIA 4HKZE 2K0PA 1HEZE 1HZ5A 4D2KA 1MHXA 2JXTA 2PW9A 1PGXA 2N7JA 1MPEA 4WH4A 1FCLA 1MI0A 1XCTL 1MVKA 3V3XA 4KGSA 5BMHA 3FILB 2N9KA 2LHDA 2N9LA 1PGBA 1XF5L 2KDMA 4IOIE 2GB1A 1UWXA 2LGIA 2EELA 2IGGA 2IGHA 2RMMA 1F2RI 2RPVA 3GB1A 2JSVX 4MACA 5HFYA 4OZBA 1P7EA 1KH0A 1K52A 1EM7A 2JZPA 4KGRA 1Q10A 1C9FA 1K53A 1P7FA 2QMTA 2KN4A 2I38A 1JMLA 1GB1A 1PGAA 2J53A 4OZAA
chains in the Genus database with same CATH superfamily
1WJNA 4G11A 4YSZB 2KHWB 1TKYA 4EZKA 2VH2A 3Q8BA 2ZCBA 5EDSA 3EHVA 4ZRIA 1Y8RC 4NJ6A 4MSQB 4TUUA 4FULA 4HJGE 1T6BX 2PPHA 3PRMB 4EZJA 3ZNZB 4K7UA 4ZHPA 3I57A 4YL8A 4DHZE 4YXDB 5JXVA 3KLSX 1C76A 2Z8LA 5CHFA 3AB5A 1YQBA 3RNCC 2R2QA 2KTFA 1ZXHA 1D3ZA 1YN5A 1QOGA 5HHDG 3H7SA 3X23A 4KGTA 1HTOA 3TMPB 1D6EC 2N0SB 2BVCA 1IGCA 1V97A 5C3JB 4RM9A 2AQ2B 3RFZB 3ZYYX 1NI2A 4S0RA 2G9HD 4OHJA 1ZKHA 1S3SG 3LB8C 3Q3MC 4YTPB 3DHHC 5D3DA 2NPTB 1MPEA 2KN5A 4M01A 1RRBA 3RI7C 3M3JA 5LXIB 2WX1A 2IO1B 2N9KA 1E8YA 2KDIA 5IAAC 1BUIC 2IZVB 1UWXA 3N20C 1TY0A 1FXIA 1T5XD 2RDHA 3GB1A 1GNUA 1BT0A 5D6JB 4DDID 2KNBA 3QWZB 4RGMA 1Z2MA 1E8XA 3HVDA 2CJNA 4TSSA 1I4GA 1FFUA 1P7FA 2QMTA 4HWIB 1XO3A 1WSPA 4YSXB 2CS4A 4F7ZA 3OAWA 3NS8A 2NMQA 1L2NA 2KLCA 2MSED 3ZDTA 2B76B 2E6XA 2D3GA 1N62A 4JWSC 1YIWA 4J6IA 1WY8A 1EWCA 2WLBA 1B1ZA 1L0YB 1A70A 1WFYA 1JWAD 4KSKC 3DHGC 3I3TB 2V1YA 3T8MA 2RPQA 2J52A 1I35A 3WAPA 1R7SA 2M1MA 4XWWA 2C7MB 2DBYA 4L2YA 4ACFA 2QSDA 2J7QB 5C23A 4ZRKA 5G5GA 1KF6B 2WXKA 3DDCB 2KDEB 1P3QU 4W9JA 3AEDB 3MC8A 2W3SA 2MWSB 4I6NB 4MM3A 3NRZA 1VLBA 1FCCC 4F8CB 2Q5WD 1D4BA 2JXXA 4XWTA 5BMIA 3U30A 4NQLB 1HXYD 1TTNA 1LQBA 2L3ZA 3DBLB 1SIFA 2JRIB 2PVOD 4WJNA 1F1HA 2JXTA 4W9DA 3DBLI 2BB5A 1RFAA 4FN2A 4US8A 1P1AA 1MI0A 3NVWA 3V05A 2K5PA 1F77A 3SFDB 2IBIB 4HDOA 5AUIA 3V3XA 4KGSA 2DNFA 2VZKB 3FILB 2PIAA 4AWJA 4US9A 2DLBA 1V80A 2N9LA 2KDMA 5J2RA 4WAFA 4BKSA 2IGHA 3AULA 2EMTA 3FC4A 1BMLC 2Z0EB 4FJZA 2BW2A 3VR9B 2AYOB 3VDZA 2DYOA 1C9FA 4DQOC 1HA5A 4G50A 3VTWA 4I6LB 5H92C 4ZDVA 3QCAA 4ICUA 3TEYA 3VH4B 3VHTC 4AUQC 5C2TB 4FXCA 3L4PA 1FD6A 1I4HA 3BINA 3ENEA 1I4QA 3AV8A 2J0MA 2MW5A 2IYDB 3FKYA 3EECA 3AMZA 4II2B 2LXCA 3RCZA 4WURA 1FRRA 3Q3FA 4JX1C 4O1NA 1WGKA 3WALA 3PTFC 4H2AA 1F9JA 4REZA 1BXTA 1YJJA 2ZZPB 3B9JA 3NZSA 4XC2A 2D11A 1EO6A 1YQ3B 3JYUA 2YVCA 4CHKA 1F0ZA 1L4DB 2WXMA 2BS4B 1YX5B 2BYTA 4FA6A 5MPOA 1CQVA 5FK9C 1UWMA 3DVGY 1ZE3D 1V1OA 1EF1A 1I7HA 2L83A 3NHEB 1OEYJ 4WWMA 3VTUA 4GB9A 2WXNA 3EA6A 1HE8A 4EE2A 2KO3A 4WWOA 2J0KA 4ZOHC 2M0AA 3NZUA 4ASWC 2MEKA 3HVZA 3H9DA 1L7YA 3RYTA 2RMMA 4WJOA 4N59A 2JSVX 3J9CA 2K3UA 3ZXRA 2J42A 3A4RA 4JE3B 3APCA 4W9FA 2KOXA 2D10A 2LRWA 3DWMA 4FHKA 1G6JA 3NUHB 3NZ3A 3GS2A 1LO5D 2W82A 2DHZA 4IKGA 1JWBD 4GU2A 4WQMA 1L4ZB 5E6NA 4XE0A 2N7DA 3U2SC 2KACA 3L08A 1GB4A 3MP9A 1XLNA 2CKHB 1T0RC 1ET9A 4IDIA 2JZ3B 2XK5B 2MQJA 3L10B 4OZCA 2V3PA 1KOTA 5CHVC 3QA8A 1WJ4A 3U4EG 3N30A 4HKQA 4RGOS 4A8XC 2CR5A 4Q2JA 1WR6E 4HCPB 4YTNB 5HKHA 4KSLC 4W9LA 1C1YB 3TSSA 2EKEC 4MDKE 3M62B 4RFBA 3VRAB 1WZ0A 2LGDA 4URKA 1C4AA 1SE3A 1UBIA 3QAQA 4ANWA 4F1SA 1JWMD 1HEZE 3HK0A 3KWVA 3VH3B 3VVWB 1MHXA 3BYYB 3PREA 2AQ3B 4KDIC 3IAS1 5LLIA 4C00A 3AI5A 2BT6A 1J8CA 1WGDA 2WU2B 2MRPA 2WGSA 3QC8B 3IBEA 4B9KA 1KLUD 2RD0A 1QT9A 4IM3A 1KRHA 3GP7A 2E3TA 3Q8FA 3I63C 1XEEA 4A90A 3PRPB 3V6EB 2BGFA 4XX5A 2BWFA 2JRHA 3AH7A 3V62A 4ZYSA 5AUKA 2KTRA 2OJWA 4BVUC 1JMLA 3AU5A 2JYEA 4M02A 1E7PB 3FILA 1H8CA 1WI0A 2RR9A 4NPNA 3PHWB 2INNE 3ZGZA 1T3QA 1TJEA 1E5WA 5E6JA 1V9JA 4LK0M 2EMSA 3MTNB 3EUB2 2WWZA 4XYCA 2H88B 3AE9B 3JSVB 5IN7A 4KKJA 2LUMA 3A4SC 1JCKB 2LEKA 5BO4B 3X0WA 2MCNB 2OOBB 2FBWB 1ISNA 1N61A 2XN9C 4MM3B 2KDFB 3EC8A 2ON8A 3AE4B 2O2VB 1WYGA 1T0QC 2O6VD 1XLPA 1XQQA 3V61A 3P42A 4DBGA 4YT0B 2ZVNA 2W9NA 3C8YA 1MG8A 3PT2B 3W1SA 3ZJVA 4USAA 3AE2B 2Y5PA 1OFFA 3DPDA 3ZNHB 5TR5A 4MGZE 4HJKA 4ARCA 3IG3A 2HTME 3IT4B 4NJ7A 1SEBD 2YLMA 4KKIA 2MJEA 1V5TA 2MA9B 2CHXA 5HFYA 3SD5A 5G2NA 4BKGA 2Y5BB 1UZXB 3UF8A 1DOYA 4BOZB 2K8CA 3TIXA 1Q10A 4ANUA 1I4RA 2KN4A 1VJKA 2KMCA 2QC8A 4AS1A 3APDA 3PSEB 2BBCA 1FPYA 1YOVB 4AP4C 2XNAC 1EWYC 1WXQA 1J7BA 4IM0A 1IBXB 3CWIA 4KZCA 3DQVA 3ZVVA 1TS2A 2KYWA 3KVFB 2YEPF 3NG0A 2GBMA 3WANA 1ZW7A 1WXVA 3AEGB 2X8XX 1R4MB 4K3BA 2IO3B 1R4MI 3C19A 5HG2A 3OJ3A 3TEXA 2C5LC 4TMAB 2LHEA 4DHZB 3ZW3A 2JWUA 2L1AA 2NBVB 1VZ7A 4HXDA 2LVPA 2MJDA 3K9PB 4W9HA 3KYDD 2MBHA 3A1QA 3MC0B 1KLGD 5AZHA 1WJUA 4PT5A 2DZJA 3ALBA 4DXAB 4EUTA 3RT3B 2XK5A 2SEBD 3PHXB 3WIMA 1N5WA 4P1BC 3TEZA 5FKAC 4GOCA 4PK1A 1WRIA 3Q3OC 2WXQA 2ZJDA 3DCGA 5BMHA 2G4DB 1QOBA 4JQWC 4IOIE 2GB1A 2KX3A 3AE7B 2G4SA 2IGGA 3U7ZA 2DZKA 5T8IA 1F2RI 4UDUC 1PUTA 1UGJA 4EZLA 2LJIA 2NS5A 3ONSA 4OZBA 2C60A 3N1YC 2KZRA 3RNAC 4E3CA 4EFOA 1QLBB 3QIJA 2DYMA 4HVBA 2NCNA 2XBBC 1NEKB 4EEWA 2KJ6A 5L95C 3AEAB 2L7RA 2A5UA 5LNK1 2MBBB 2ZPNA 1CMXB 2MP2B 3A9JB 3AECB 1WMHB 3Q8AA 1WR1A 1L6UA 4M0WB 4MT5A 2PJHA 1J19A 1I42A 4MSMB 4DDGD 2FCSA 2LASA 3APFA 5CHWA 5AZFA 1K50A 3AE6B 2KFJA 2I2YA 2K6QA 4W9CA 4NQKE 2ONQA 4ICVA 2V3SA 3Q3JA 5LXHA 5IA7A 3VXWA 3V60A 2V0GA 3SEBA 4NNJB 3NS1A 4B0EA 2KLGA 3JSVA 1VDVA 4P16A 3BVMA 4X57B 4D2KA 2KMMA 1V1PB 2NVUI 4PS8A 3P63A 1RFKA 4HROA 1OQQA 4A20A 3CSFA 1SE9A 1V49A 1XLQA 4GMVA 4NZLB 3UIOB 3ZTCA 2DENB 3CMMB 5G55A 3CSTA 1TBEA 2KC1A 2FNJB 1WX7A 2LFIA 3L16A 1FXAA 2L32A 2O2VA 4NAMA 2MX2A 1DGJA 1WH3A 3NOBA 1KH0A 4A9AA 1IUEA 2KTRB 3DVNU 3WCQA 4ZRPA 3NJTA 2I38A 5D7GA 2N9EB 2Y5CA 1E0ZA 2PKOA 1UUPA 3PZDA 3KWLA 4A55A 2WYQA 1STEA 3QARA 1AYFA 5IKCM 1FM0D 2MBEA 3NVYA 1UELA 2GBKA 4K7WA 2KJHB 3O13A 3E9SA 4JLCA 4HPMB 1F2RC 4CO7A 2GI9A 1C79A 1QKZA 2K39A 1OQRA 3RNGC 1QQRA 1IBXA 2D3CA 1YJ1A 4P1CC 2FIFA 2BF8B 3ZTDA 5KHQA 2O6VB 1C78A 4RM8A 1JQ4A 1J0GA 1NENB 1VZ6A 1N63A 2SAKA 2AX5A 2K9XA 1GAQB 2AQ1B 1GOZA 3R3MA 2KWCA 1VRAB 3ZO5B 3T3OA 3QJZA 2JPHA 2LUEA 2WXGA 4P7IA 3DBRB 1OTRB 4XDDA 4HPLB 1Y56A 4HDQA 1N60A 3DBRI 3HM3A 4C7YA 3W9CB 3BWUD 2K8HA 1YN4A 1WXMA 2GBRA 3AE8B 3M63B 1FRDA 2QILA 3EFUA 4RCOA 5E6OA 1SF0A 1K52A 2NBWB 1YN3A 3AEFB 3Q8CA 3P4SB 2PMVA 2WNMA 2LXAA 4OVZA 4RGTA 1J7CA 3ETRA 4HEA1 4FJYA 3E56A 2EKIA 1SXTA 4KIKB 2LVQA 3PZ7A 4ZRQA 3ZDMC 3Q69A 1LGRA 2VH1A 4HRSA 1P0RA 1UD7A 5J18A 1GPXA 2INDC 4IC7B 3D32A 2JU6X 2VRRB 2KAJA 1V5OA 2V4IB 1ZPSA 4GSWA 2CJOA 3A9KB 2MBOA 4DWFA 2RDBC 4K7SA 2BWES 4XZ4A 3IXSA 2ZW0A 1XCQL 1P98A 5EE9A 2M4NA 5L83A 4GIVA 2JWZA 3Q3NC 2IY1B 4HK2A 4L23A 3UINB 4AJWA 2D3BA 2FAZA 2G1EA 3TEWA 3A1QB 1GG3A 1IGDA 4YSYB 2MP2A 1EF5A 3A9JA 1WMHA 2HD5B 3JVZX 5JZEB 4JGHB 1CK1A 2KQ7A 2H89B 4M0WA 2LMCA 3N3KB 1NI3A 3W2DA 1Q1OA 4ITKA 4ARIA 4B95A 4EOYA 2HJ8A 5BYQA 1FMAD 3ZJTA 1XLOA 1ZUD2 1SSNA 2JZZA 2FUG1 3QQ8B 1SJHD 4FBJB 2UYZB 3BK2A 2YEPB 5AEKB 1SIJA 2JUOA 2INCC 5D94A 1D5MC 4KZ0A 3TL5A 4DK5A 1T0SC 2MBQA 1K8RB 1T0YA 5H8YE 2JZPA 4PS7A 1AARA 4RH6A 3MJWA 3ZXVA 1EU3A 1V1PA 4TV3A 2J4XA 2AWTA 5J17A 3LYYA 4W9GA 5EE0A 5IOIA 4DHJD 2WXRA 1C77A 4W9EA 2FUHB 3KQ4A 5DPSA 4RGNA 4B6WA 2WDVB 2N1WA 2N9XA 4ZYNA 1JWUD 3N32A 4MELA 3W1SC 1WZ3A 1UF0A 3AE3B 1A5RA 2BS2B 4N9F4 2AL6A 1WIAA 1YD8U 1FO4A 4WWPA 3KUCB 2WDRB 3PO0A 4J3OD 2GBNA 3P2BA 4NAWB 1IPGA 2I1KA 3L13A 3ABVB 4C56C 4YTMB 2I1JA 3KH0A 4JPSA 4WJPA 3RZFA 1WF9A 4CQNA 2HJ1A 2Y3AA 3QK0A 3FAHA 2BYEA 1VD2A 5DPTA 2KANA 1NYRA 3HRDD 5EE3A 3W5UB 1TZ1A 3PLVA 1FEHA 3N1XC 2ZNVB 1D5XC 1WX9A 1QOAA 1WGYA 2PW9A 4LJPB 3PV1A 4IWOA 5JH5C 4MGIE 1MVKA 4BOSC 1AN8A 2BYVE 4XDCA 1YJIA 3VR8B 3PLUA 1WYWB 3I5JC 1ZOYB 2IJ0A 2LWPA 2EELA 1V86A 2O6VA 1F52A 1WE7A 1WX8A 3SU8X 5CTRC 2K1FA 3ZJUA 3R2IA 3WA0A 1E9MA 1QOFA 4LNOA 3Q8EA 2N7EA 1L0XB 2WXFA 4LNKA 2D07B 3ZKJC 3NVZA 1S1QB 2ZVOA 2BS3B 3AEEB 2NR2A 3LXFA 3DWGC 3P1MA 4PYZA 5GXGB 4A6QA 1VZ8A 5AZGA 2WDTB 4GLSC 4BBNF 2INPE 2MLBA 4FADA 5D3IB 3Q6BA 3RD2A 2ACZB 4LLGM 3EGRA 3PRZA 1Q5WB 4HPPA 3R2TA 1XD3B 4LNIA 2L05A 1TKGA 2QJLA 3OJ4B 4DXGA 3T3NA 4KIKA 3P4QB 1XXGA 3PPAA 3VFKA 2KK8A 4MJSB 3HHMA 3UI3A 1I4XA 2JX5A 3VUXA 4LNFA 2LGSA 3V6CB 2PLPA 2R2OA 1HQRD 4PYUA 4MEMA 4C7ZA 5BYRA 3A9KA 4E74A 2K8BA 3UQBA 2HDEA 1MG4A 3ZLZA 4IM2A 1FXTB 3RNEC 1KFYB 3QHTA 2C9WB 4BFRA 1E8WA 4GDLB 2M17A 3R7RA 1ENFA 3BVGA 5GMVA 2LGIA 2N1VA 2W54A 2K25A 1FNUA 3ML8A 2W3RA 4A3PA 3DHIC 2KWUB 3CIRB 4QAYA 1P7EA 2LGXA 1N5XA 3GE3C 3LDZE 2WXIA 2ZEQA 4KV2A 1N6ZA 5FR3A 1JW9D 1IP9A 2WS3B 4G3XB 3LJ3A 1QZEA 3GOEA 1JALA 3B2GA 4C4VB 2IPKD 3L17A 3PS6A 4OVVA 3IT6B 2IO2B 1DOXA 2ZNVC 1YX6B 1VR9A 5BYSA 4N58A 2DX5B 2QIEB 1HTQA 1JWSD 1NDDA 1MJDA 1H4RA 4KDLB 4BZAA 3BY4B 1EUVB 2KFKA 4ZRJA 2LI5A 2ASQA 4LDTD 2DWQA 3H6NA 3HUIA 4GGQA 1KJTA 1JRUA 2GBJA 1KTKA 2FCNA 2RGFA 3OWEB 1GJZA 1ET6A 4KVGB 1OEYA 2KWDA 1RM6C 2BQQA 5HI1A 2CHWA 1FIQA 3KYCD 3IFWB 2LGYA 3R8BA 1E90A 4GDKB 2WXJA 1V81A 2NTSA 1RWSA 3SR6A 3TBLD 1UGMA 1HZ5A 2WU5B 2KJRA 3ZNID 2LZ6A 2KT7A 4NAWA 3IVFA 1FCLA 4K3CA 4IW0A 3MHZA 3ZUNA 2KX0A 1WJ6A 3H7PB 4ZHOA 3OG5A 1LM8B 2L8JA 2BB6A 3WAMA 2RSUA 3SFEB 3N1ZC 4WIPA 4W9IA 2BYFA 3MHSD 1WGGA 3ZQ4A 4FLHA 2C7HA 3H1UA 4NJCA 4DHJB 2L52A 5E6PA 2GRIA 1YNTE 2CU1A 3W1YA 3O65B 3A33B 1XT9B 3AXCA 1Z5SB 2XEWA 2FCQA 1ACCA 4GN1A 1K51A 1PQSA 3U7DA 2D5GA 4RF1A 3SDLC 4ANVA 5TSSA 5DPRA 3RNBC 2KC2A 2L00B 1TS4A 1M94A 5DPWA 1D5ZC 2WX0A 1C3TA 4P6VF 1WWTA 3PVLA 1U4AA 3CF6E 1L6VA 2TSSA 2KQ4X 1V8CA 2C7NB 2K6DB 1E7VA 4IG7B 3U52E 2KVZA 3KUZA 2UWQA 2FIDA 2V9HA 4CYEA 5C1ZA 1TZOA 4R3DA 3QX1A 2PE6B 4A3OA 2DAFA 3B08A 2BPSA 1HZ6A 4K1RB 2D3AA 2WXOA 1V2YA 3GZNB 3KUDB 3SHQA 2IGDA 4MH8A 1FNVA 5FR6A 2LJ5A 4BKSD 2M56B 3GZNI 1M4VA 2NTTA 1OQYA 4N6EB 4MH0E 2K0PA 1SE2A 1NYQA 1CJEA 2N9PC 2V3NA 2N7JA 5I4DA 3BK1A 2JYTA 3VQIA 1Q0WB 4WH4A 3ZRFA 1XCTL 4BAXA 2PVGC 1SJED 4MJSA 2LHDA 3H8HA 2GMIC 1VCBA 4AJYB 1ESFA 2ICIA 1YQ4B 1E6EB 1C4PA 3W5VB 2OHFA 1KLVA 4TQ0A 1RLFA 4RNAA 2QDFA 1WM3A 1SE4A 2PEAA 5CX3A 3VAWA 1NBFC 3DVGX 1JROA 3VUYA 2JQRB 4B0MA 4GDLA 1KM7A 2N4FA 2MJ3A 1B9RA 4M8MA 5EE1A 1SBBB 3UIPB 4II3B 1MFWA 2WQYB 3C0RB 3PGEA 2QEJC 2BKRB 5JHAA 2M8SA 4KX6B 3PZ8A 2BKFA 3AE1B 1TIFA 1PFDA 1SB3C 2L0TA 2Z0DB 3IAM1 4YWGG 4C4VA 3B0AA 3RULA 4TKNA 1FNWA 2X38A 4FJVB 2KXJA 1ZDVA 2MH7A 2M19A 2D2QA 3DBHB 1JRPA 2PTLA 2MHJA 4LCDE 1GUAB 4OVUA 3VUWA 3DBHI 1L5PA 2A4ZA 4HCNB 4HKZE 3MJ5A 4W9KA 2B3AA 2ZCCA 3RPFC 2LVOA 2HE7A 3TCAA 1J7AA 2LD9A 4MGYE 4M00A 4DXFA 2NPTA 2JVCA 4IWQA 3Q2AC 3P4RB 3B1LX 1XF5L 3BIID 2Z59B 3BVZA 2WXPA 2UU7A 1R4NB 4GDKA 1PDXA 1L0VB 3T9LA 1R4NI 1E10A 4MACA 1QILA 2AL3A 1ZXIA 1WXAA 2HTHA 4GXBA 1GB1A 2JF5A 1LFDA 4L1BA 1C4CA 1FFVA 3H7PA 1I4PA 4RMAA 3AN1A 3HIZA 4FHJA 4EKUA 2ZW1A 1TYGB 3TJPA 2V4LA 2KFKB 2DZIA 4I6PA 1ZP0B 1CZPA 1NVID 3EFCA 3M95A 1OGWA 3URYA 4LDTB 1WGRA 2QCZA 1UH6A 1DYQA 2IY0B 3RN9C 4ANXA 4BKTA 1ZDXA 3DBSA 1WXSA 1X1MA 3ZNGC 5KHOA 1GC7A 5IO9A 1UBQA 3RNFC 4AQ7A 2OEDA 3K9OB 3AE5B 2NBUA 4WQOB 1P9DU 3RMKC 3NY5A 3L0WB 3OLMD 2G45B 4AOFA 2CHZA 2R61A 3ECIA 3VTVA 2GLSA 1WE6A 3BZDB 2L0FA 5JHBA 2WP9B 5IP4D 3NVVA 3ML9A 2KQSA 3GE8C 4XGAB 3ZIMA 4G0NB 2BTEA 1E7UA 2DAJA 3AEBB 3TUOA 1AW7A 2KD0A 1ZGUB 1TS5A 3DOWA 2VZKD 2REXA 1TT5B 2WHIA 3UGBB 1SGHA 3HM6X 2DYBA 4JWUC 2IO0B 1UNSA 2IDYA 1EM7A 4KGRA 1EU4A 1V6EA 1QF6A 1K53A 3I9V1 3WAOA 2JY6A 2LRUA 2G3QB 4WJQA 4C80A 1PGAA 1PYWD 4OZAA 3B2FA 2FCMA 3R66C 4JIOU 3L54A 1YMHE 3ZRCA 3R7QA 2AEHA 4LJOB 4S17A 1GC6A 1WRDB 3AM9A 4WWNA 3VRBB 3DVNV 1WM2A 1MHHE 3IHPC 3KW5B 1IYFA 2CU3A 3U8ZA 4HLEA 4OW0A 2OJRA 3Q14C 3MFGA 3AU4A 2KVRA 4RF0A 3RUIB 3BYTB 2J0JA 2RDGA 2KKCA 4BBNC 4LNNA 1WGHA 2JT4B 1ROEA 3RZWC 2M0XA 4LTUA 3S2AA 2ZPYA 2WXHA 2WDQB 4JL9A 2PE9A 2QHOA 5G5HA 5BMGA 1RYJA 4WAAA 1TS3A 2W55A 1AWDA 1DOIA 4M8NA 2WXLA 1TKEA 4IUMB 4PS3A 4MGKE 2FE8A 4NY0A 4E71A 2KWVB 1PGXA 2K22A 4K81A 3P4PB 2KMAA 2DZMA 1E8ZA 1PGBA 5D2MB 1TGZB 2KDBA 2RPVA 1RAXA 2L76A 3N9YC 4IWPA 1TY2A 3JW0X 1LXDA 3MC9A 3UQAA 5DCNA 2J53A 4TQ1A 2GOWA
chains in the Genus database with same CATH topology
2GRIA 2JYEA 1YNTE 4YSZB 1E7PB 3FILA 4ZRQA 3PZ7A 1TKYA 3Q69A 4HRSA 3Q8BA 1ACCA 1GPXA 2INNE 1K51A 2D5GA 3ZGZA 4RF1A 1T3QA 1TJEA 5TSSA 2JU6X 4HJGE 1T6BX 5E6JA 2KAJA 1TS4A 2V4IB 4LK0M 1D5ZC 1ZPSA 2CJOA 4P6VF 1WWTA 4ZHPA 3I57A 3EUB2 2H88B 4YXDB 3AE9B 5JXVA 1L6VA 2TSSA 2KQ4X 3IXSA 2ZW0A 3KLSX 1V8CA 1XCQL 1C76A 2Z8LA 3AB5A 4KKJA 3U52E 5EE9A 2LUMA 1ZXHA 1JCKB 2LEKA 1TZOA 4R3DA 1YN5A 4L23A 2FBWB 1QOGA 2G1EA 5HHDG 3TEWA 1N61A 2XN9C 4KGTA 1HZ6A 4MM3B 1IGDA 1D6EC 2N0SB 2WXOA 4YSYB 1IGCA 1V97A 5C3JB 2ON8A 2IGDA 4MH8A 3AE4B 2AQ2B 1CK1A 1FNVA 1WYGA 1XLPA 3RFZB 2M56B 2H89B 3ZYYX 1M4VA 2NTTA 4M0WA 2LMCA 2G9HD 4OHJA 4N6EB 1NI3A 2K0PA 3LB8C 3P42A 3W2DA 4ITKA 4ARIA 1SE2A 4YT0B 4YTPB 1NYQA 5BYQA 1CJEA 5D3DA 1FMAD 2N7JA 2V3NA 5I4DA 3C8YA 3BK1A 1MPEA 2JYTA 3VQIA 4WH4A 3ZJTA 3W1SA 3ZJVA 1XCTL 4USAA 2PVGC 3AE2B 1SJED 1XLOA 1ZUD2 2Y5PA 1OFFA 1SSNA 2N9KA 2FUG1 2LHDA 3H8HA 1BUIC 1UWXA 1TY0A 1SJHD 3BK2A 4ARCA 2YEPB 1ESFA 1FXIA 2ICIA 1T5XD 1YQ4B 2HTME 2RDHA 3IT4B 1E6EB 1SEBD 1SIJA 3GB1A 4KKIA 2MJEA 1C4PA 3W5VB 1D5MC 2OHFA 4RGMA 5HFYA 4TQ0A 4RNAA 1SE4A 1DOYA 5H8YE 3HVDA 2JZPA 4RH6A 2CJNA 4TSSA 1Q10A 1EU3A 1V1PA 1I4GA 1FFUA 1I4RA 1P7FA 2J4XA 2QMTA 2KN4A 1VJKA 1JROA 1XO3A 1WSPA 3LYYA 4AS1A 4YSXB 5EE0A 2JQRB 2WXRA 2BBCA 4B0MA 1C77A 2MJ3A 2XNAC 1EWYC 1B9RA 1WXQA 2NMQA 1J7BA 3KQ4A 4RGNA 1IBXB 5EE1A 3CWIA 1SBBB 2WDVB 2WQYB 1JWUD 2B76B 2E6XA 2QEJC 1TS2A 1N62A 4JWSC 2YEPF 3AE3B 2BS2B 1EWCA 2WLBA 1B1ZA 1L0YB 3AEGB 4KX6B 3PZ8A 3AE1B 1A70A 1FO4A 1JWAD 1PFDA 1SB3C 2WDRB 3PO0A 4J3OD 2J52A 1R7SA 4XWWA 2DBYA 4L2YA 2QSDA 3IAM1 4NAWB 5HG2A 4YWGG 3TEXA 3ABVB 4TMAB 2LHEA 5G5GA 4C56C 1FNWA 4YTMB 2JWUA 2X38A 1KF6B 4JPSA 2L1AA 2WXKA 1ZDVA 1VZ7A 2MH7A 2MJDA 2M19A 4CQNA 1JRPA 2PTLA 3AEDB 2Y3AA 2W3SA 3MC0B 3FAHA 1KLGD 3NRZA 1VLBA 4PT5A 1FCCC 1NYRA 2Q5WD 1L5PA 3HRDD 5EE3A 3W5UB 1D4BA 4XWTA 5BMIA 1HXYD 1FEHA 4HKZE 3MJ5A 2SEBD 1D5XC 1N5WA 1QOAA 3RPFC 2PVOD 3TEZA 5FKAC 2JXTA 2PW9A 2BB5A 1WRIA 1J7AA 2WXQA 4US8A 3V05A 1MI0A 3NVWA 2K5PA 1F77A 3SFDB 4DXFA 5AUIA 1MVKA 3V3XA 4KGSA 5BMHA 1AN8A 2VZKB 3FILB 2PIAA 4US9A 4XDCA 1YJIA 2DLBA 3P4RB 1QOBA 2N9LA 3VR8B 1XF5L 3BIID 1ZOYB 2KDMA 4IOIE 3BVZA 2GB1A 2WXPA 2IJ0A 4WAFA 3AE7B 2EELA 2IGGA 3U7ZA 2IGHA 5T8IA 1F2RI 4UDUC 1PUTA 1PDXA 1BMLC 3FC4A 1UGJA 2LJIA 1L0VB 1E10A 4MACA 2BW2A 3R2IA 3VR9B 3ZJUA 4OZBA 2DYOA 1E9MA 1QILA 1QOFA 1ZXIA 3Q8EA 1C9FA 1L0XB 2WXFA 4DQOC 1QLBB 1HA5A 2DYMA 1GB1A 4L1BA 1C4CA 1FFVA 5H92C 1NEKB 3NVZA 3LXFA 2BS3B 3AEEB 3AEAB 1I4PA 3DWGC 3P1MA 3AN1A 5GXGB 4A6QA 1VZ8A 5LNK1 3TEYA 4GLSC 2ZW1A 1TYGB 2INPE 5C2TB 3AECB 4FXCA 3L4PA 5D3IB 1ZP0B 1CZPA 1NVID 1FD6A 1I4HA 3URYA 3Q8AA 1I4QA 2ACZB 3AV8A 1L6UA 4LLGM 3EGRA 4MT5A 1DYQA 3AMZA 3R2TA 1ZDXA 1TKGA 2QJLA 4WURA 4DXGA 1FRRA 3T3NA 1K50A 3AE6B 4JX1C 4O1NA 1WGKA 3P4QB 1XXGA 2I2YA 4AQ7A 4H2AA 3UI3A 2OEDA 1I4XA 2JX5A 3AE5B 2ONQA 4REZA 1BXTA 1YJJA 2PLPA 1HQRD 3B9JA 2R61A 4C7ZA 1YQ3B 3BZDB 1F0ZA 2V0GA 5BYRA 3SEBA 1L4DB 2WP9B 3NVVA 2WXMA 2BS4B 2BYTA 5MPOA 2HDEA 1CQVA 3NS1A 4B0EA 1VDVA 4P16A 1KFYB 3BVMA 4D2KA 2KMMA 5FK9C 1UWMA 1V1PB 1V1OA 1ZE3D 3P63A 1RFKA 1I7HA 4HROA 2BTEA 2L83A 1OQQA 4WWMA 3AEBB 3TUOA 1AW7A 2WXNA 3EA6A 4EE2A 1XLQA 4NZLB 4GDLB 1TS5A 4ZOHC 2M0AA 2MEKA 3HVZA 1ENFA 2VZKD 3BVGA 2LGIA 2LFIA 2W54A 1FXAA 2RMMA 1FNUA 2L32A 2W3RA 4N59A 4NAMA 2JSVX 3J9CA 2K3UA 1DGJA 2J42A 3CIRB 1P7EA 1KH0A 4JWUC 4A9AA 1IUEA 1UNSA 4JE3B 2IDYA 1EM7A 1N5XA 4KGRA 3WCQA 1EU4A 2WXIA 1QF6A 1K53A 4ZRPA 3I9V1 5FR3A 1JW9D 2WS3B 2I38A 4C80A 5D7GA 1PGAA 1PYWD 4OZAA 3B2FA 1JALA 3DWMA 2Y5CA 1E0ZA 1YMHE 3B2GA 2PKOA 2IPKD 3NUHB 1UUPA 3NZ3A 3IT6B 3GS2A 1LO5D 3AM9A 3KWLA 1DOXA 2W82A 4A55A 4IKGA 3VRBB 1JWBD 1VR9A 5BYSA 4N58A 4WQMA 1STEA 1MHHE 2QIEB 1L4ZB 1JWSD 1AYFA 4XE0A 1FM0D 2CU3A 3NVYA 4OW0A 3U2SC 2KACA 3MFGA 1GB4A 3MP9A 1XLNA 3O13A 4RF0A 3E9SA 1ET9A 2DWQA 3BYTB 2RDGA 4IDIA 4OZCA 1F2RC 2V3PA 3HUIA 1ROEA 2GI9A 1C79A 1QKZA 1KTKA 3U4EG 4HKQA 3OWEB 4LTUA 1ET6A 4RGOS 4A8XC 1OQRA 2KWDA 2WXHA 4Q2JA 2WDQB 1RM6C 4YTNB 5HI1A 1QQRA 1IBXA 1FIQA 3TSSA 5G5HA 5BMGA 3R8BA 4GDKB 1C78A 4RFBA 3VRAB 1RYJA 1C4AA 1SE3A 1JQ4A 2WXJA 1TS3A 2NTSA 2W55A 1AWDA 1DOIA 1RWSA 3SR6A 2WXLA 1NENB 1TKEA 1VZ6A 1JWMD 1HEZE 1N63A 1HZ5A 2SAKA 2WU5B 3KWVA 2AX5A 2FE8A 2K9XA 1GAQB 2AQ1B 1GOZA 1MHXA 1PGXA 2K22A 3BYYB 3P4PB 2AQ3B 3IAS1 1FCLA 1VRAB 3T3OA 3MHZA 2BT6A 2WU2B 2WXGA 4ZHOA 1PGBA 4XDDA 1Y56A 1KLUD 2BB6A 1N60A 4C7YA 3SFEB 3W9CB 3BWUD 1QT9A 2RPVA 1KRHA 3GP7A 4WIPA 2E3TA 1YN4A 3Q8FA 1XEEA 4A90A 3AE8B 3N9YC 1FRDA 2QILA 4RCOA 1SF0A 1TY2A 1K52A 3AH7A 3ZQ4A 1YN3A 3AEFB 3Q8CA 3P4SB 2PMVA 2WNMA 4RGTA 4OVZA 5AUKA 1J7CA 3ETRA 4HEA1 4ZYSA 4NJCA 3E56A 1JMLA 2EKIA 1SXTA 2J53A 4TQ1A 2L52A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1YNT E;  1YMH E;  3FIL A;  2NMQ A;  1IBX B;  4IKG A;  4GLS C;  1K51 A;  2ZW1 A;  1MHH E;  2JU6 X;  4HJG E;  1FD6 A;  2KAC A;  1GB4 A;  3MP9 A;  4OZC A;  5JXV A;  2KQ4 X;  1F2R C;  2ZW0 A;  1XCQ L;  2J52 A;  2GI9 A;  1QKZ A;  2QSD A;  2LUM A;  1ZXH A;  1K50 A;  5HG2 A;  2I2Y A;  2LHE A;  2KWD A;  2JWU A;  5HHD G;  5HI1 A;  3UI3 A;  2OED A;  1IBX A;  2ONQ A;  4KGT A;  1HZ6 A;  1IGD A;  5BMG A;  2PTL A;  2PLP A;  1IGC A;  2ON8 A;  2IGD A;  1FCC C;  1D4B A;  5BMI A;  4HKZ E;  2K0P A;  1HEZ E;  1HZ5 A;  4D2K A;  1MHX A;  2JXT A;  2PW9 A;  1PGX A;  2N7J A;  1MPE A;  4WH4 A;  1FCL A;  1MI0 A;  1XCT L;  1MVK A;  3V3X A;  4KGS A;  5BMH A;  3FIL B;  2N9K A;  2LHD A;  2N9L A;  1PGB A;  1XF5 L;  2KDM A;  4IOI E;  2GB1 A;  1UWX A;  2LGI A;  2EEL A;  2IGG A;  2IGH A;  2RMM A;  1F2R I;  2RPV A;  3GB1 A;  2JSV X;  4MAC A;  5HFY A;  4OZB A;  1P7E A;  1KH0 A;  1K52 A;  1EM7 A;  2JZP A;  4KGR A;  1Q10 A;  1C9F A;  1K53 A;  1P7F A;  2QMT A;  2KN4 A;  2I38 A;  1JML A;  1GB1 A;  1PGA A;  2J53 A;  4OZA A; 
#chains in the Genus database with same CATH topology
 1WJN A;  4G11 A;  4YSZ B;  2KHW B;  1TKY A;  4EZK A;  2VH2 A;  3Q8B A;  2ZCB A;  5EDS A;  3EHV A;  4ZRI A;  1Y8R C;  4NJ6 A;  4MSQ B;  4TUU A;  4FUL A;  4HJG E;  1T6B X;  2PPH A;  3PRM B;  4EZJ A;  3ZNZ B;  4K7U A;  4ZHP A;  3I57 A;  4YL8 A;  4DHZ E;  4YXD B;  5JXV A;  3KLS X;  1C76 A;  2Z8L A;  5CHF A;  3AB5 A;  1YQB A;  3RNC C;  2R2Q A;  2KTF A;  1ZXH A;  1D3Z A;  1YN5 A;  1QOG A;  5HHD G;  3H7S A;  3X23 A;  4KGT A;  1HTO A;  3TMP B;  1D6E C;  2N0S B;  2BVC A;  1IGC A;  1V97 A;  5C3J B;  4RM9 A;  2AQ2 B;  3RFZ B;  3ZYY X;  1NI2 A;  4S0R A;  2G9H D;  4OHJ A;  1ZKH A;  1S3S G;  3LB8 C;  3Q3M C;  4YTP B;  3DHH C;  5D3D A;  2NPT B;  1MPE A;  2KN5 A;  4M01 A;  1RRB A;  3RI7 C;  3M3J A;  5LXI B;  2WX1 A;  2IO1 B;  2N9K A;  1E8Y A;  2KDI A;  5IAA C;  1BUI C;  2IZV B;  1UWX A;  3N20 C;  1TY0 A;  1FXI A;  1T5X D;  2RDH A;  3GB1 A;  1GNU A;  1BT0 A;  5D6J B;  4DDI D;  2KNB A;  3QWZ B;  4RGM A;  1Z2M A;  1E8X A;  3HVD A;  2CJN A;  4TSS A;  1I4G A;  1FFU A;  1P7F A;  2QMT A;  4HWI B;  1XO3 A;  1WSP A;  4YSX B;  2CS4 A;  4F7Z A;  3OAW A;  3NS8 A;  2NMQ A;  1L2N A;  2KLC A;  2MSE D;  3ZDT A;  2B76 B;  2E6X A;  2D3G A;  1N62 A;  4JWS C;  1YIW A;  4J6I A;  1WY8 A;  1EWC A;  2WLB A;  1B1Z A;  1L0Y B;  1A70 A;  1WFY A;  1JWA D;  4KSK C;  3DHG C;  3I3T B;  2V1Y A;  3T8M A;  2RPQ A;  2J52 A;  1I35 A;  3WAP A;  1R7S A;  2M1M A;  4XWW A;  2C7M B;  2DBY A;  4L2Y A;  4ACF A;  2QSD A;  2J7Q B;  5C23 A;  4ZRK A;  5G5G A;  1KF6 B;  2WXK A;  3DDC B;  2KDE B;  1P3Q U;  4W9J A;  3AED B;  3MC8 A;  2W3S A;  2MWS B;  4I6N B;  4MM3 A;  3NRZ A;  1VLB A;  1FCC C;  4F8C B;  2Q5W D;  1D4B A;  2JXX A;  4XWT A;  5BMI A;  3U30 A;  4NQL B;  1HXY D;  1TTN A;  1LQB A;  2L3Z A;  3DBL B;  1SIF A;  2JRI B;  2PVO D;  4WJN A;  1F1H A;  2JXT A;  4W9D A;  3DBL I;  2BB5 A;  1RFA A;  4FN2 A;  4US8 A;  1P1A A;  1MI0 A;  3NVW A;  3V05 A;  2K5P A;  1F77 A;  3SFD B;  2IBI B;  4HDO A;  5AUI A;  3V3X A;  4KGS A;  2DNF A;  2VZK B;  3FIL B;  2PIA A;  4AWJ A;  4US9 A;  2DLB A;  1V80 A;  2N9L A;  2KDM A;  5J2R A;  4WAF A;  4BKS A;  2IGH A;  3AUL A;  2EMT A;  3FC4 A;  1BML C;  2Z0E B;  4FJZ A;  2BW2 A;  3VR9 B;  2AYO B;  3VDZ A;  2DYO A;  1C9F A;  4DQO C;  1HA5 A;  4G50 A;  3VTW A;  4I6L B;  5H92 C;  4ZDV A;  3QCA A;  4ICU A;  3TEY A;  3VH4 B;  3VHT C;  4AUQ C;  5C2T B;  4FXC A;  3L4P A;  1FD6 A;  1I4H A;  3BIN A;  3ENE A;  1I4Q A;  3AV8 A;  2J0M A;  2MW5 A;  2IYD B;  3FKY A;  3EEC A;  3AMZ A;  4II2 B;  2LXC A;  3RCZ A;  4WUR A;  1FRR A;  3Q3F A;  4JX1 C;  4O1N A;  1WGK A;  3WAL A;  3PTF C;  4H2A A;  1F9J A;  4REZ A;  1BXT A;  1YJJ A;  2ZZP B;  3B9J A;  3NZS A;  4XC2 A;  2D11 A;  1EO6 A;  1YQ3 B;  3JYU A;  2YVC A;  4CHK A;  1F0Z A;  1L4D B;  2WXM A;  2BS4 B;  1YX5 B;  2BYT A;  4FA6 A;  5MPO A;  1CQV A;  5FK9 C;  1UWM A;  3DVG Y;  1ZE3 D;  1V1O A;  1EF1 A;  1I7H A;  2L83 A;  3NHE B;  1OEY J;  4WWM A;  3VTU A;  4GB9 A;  2WXN A;  3EA6 A;  1HE8 A;  4EE2 A;  2KO3 A;  4WWO A;  2J0K A;  4ZOH C;  2M0A A;  3NZU A;  4ASW C;  2MEK A;  3HVZ A;  3H9D A;  1L7Y A;  3RYT A;  2RMM A;  4WJO A;  4N59 A;  2JSV X;  3J9C A;  2K3U A;  3ZXR A;  2J42 A;  3A4R A;  4JE3 B;  3APC A;  4W9F A;  2KOX A;  2D10 A;  2LRW A;  3DWM A;  4FHK A;  1G6J A;  3NUH B;  3NZ3 A;  3GS2 A;  1LO5 D;  2W82 A;  2DHZ A;  4IKG A;  1JWB D;  4GU2 A;  4WQM A;  1L4Z B;  5E6N A;  4XE0 A;  2N7D A;  3U2S C;  2KAC A;  3L08 A;  1GB4 A;  3MP9 A;  1XLN A;  2CKH B;  1T0R C;  1ET9 A;  4IDI A;  2JZ3 B;  2XK5 B;  2MQJ A;  3L10 B;  4OZC A;  2V3P A;  1KOT A;  5CHV C;  3QA8 A;  1WJ4 A;  3U4E G;  3N30 A;  4HKQ A;  4RGO S;  4A8X C;  2CR5 A;  4Q2J A;  1WR6 E;  4HCP B;  4YTN B;  5HKH A;  4KSL C;  4W9L A;  1C1Y B;  3TSS A;  2EKE C;  4MDK E;  3M62 B;  4RFB A;  3VRA B;  1WZ0 A;  2LGD A;  4URK A;  1C4A A;  1SE3 A;  1UBI A;  3QAQ A;  4ANW A;  4F1S A;  1JWM D;  1HEZ E;  3HK0 A;  3KWV A;  3VH3 B;  3VVW B;  1MHX A;  3BYY B;  3PRE A;  2AQ3 B;  4KDI C;  3IAS 1;  5LLI A;  4C00 A;  3AI5 A;  2BT6 A;  1J8C A;  1WGD A;  2WU2 B;  2MRP A;  2WGS A;  3QC8 B;  3IBE A;  4B9K A;  1KLU D;  2RD0 A;  1QT9 A;  4IM3 A;  1KRH A;  3GP7 A;  2E3T A;  3Q8F A;  3I63 C;  1XEE A;  4A90 A;  3PRP B;  3V6E B;  2BGF A;  4XX5 A;  2BWF A;  2JRH A;  3AH7 A;  3V62 A;  4ZYS A;  5AUK A;  2KTR A;  2OJW A;  4BVU C;  1JML A;  3AU5 A;  2JYE A;  4M02 A;  1E7P B;  3FIL A;  1H8C A;  1WI0 A;  2RR9 A;  4NPN A;  3PHW B;  2INN E;  3ZGZ A;  1T3Q A;  1TJE A;  1E5W A;  5E6J A;  1V9J A;  4LK0 M;  2EMS A;  3MTN B;  3EUB 2;  2WWZ A;  4XYC A;  2H88 B;  3AE9 B;  3JSV B;  5IN7 A;  4KKJ A;  2LUM A;  3A4S C;  1JCK B;  2LEK A;  5BO4 B;  3X0W A;  2MCN B;  2OOB B;  2FBW B;  1ISN A;  1N61 A;  2XN9 C;  4MM3 B;  2KDF B;  3EC8 A;  2ON8 A;  3AE4 B;  2O2V B;  1WYG A;  1T0Q C;  2O6V D;  1XLP A;  1XQQ A;  3V61 A;  3P42 A;  4DBG A;  4YT0 B;  2ZVN A;  2W9N A;  3C8Y A;  1MG8 A;  3PT2 B;  3W1S A;  3ZJV A;  4USA A;  3AE2 B;  2Y5P A;  1OFF A;  3DPD A;  3ZNH B;  5TR5 A;  4MGZ E;  4HJK A;  4ARC A;  3IG3 A;  2HTM E;  3IT4 B;  4NJ7 A;  1SEB D;  2YLM A;  4KKI A;  2MJE A;  1V5T A;  2MA9 B;  2CHX A;  5HFY A;  3SD5 A;  5G2N A;  4BKG A;  2Y5B B;  1UZX B;  3UF8 A;  1DOY A;  4BOZ B;  2K8C A;  3TIX A;  1Q10 A;  4ANU A;  1I4R A;  2KN4 A;  1VJK A;  2KMC A;  2QC8 A;  4AS1 A;  3APD A;  3PSE B;  2BBC A;  1FPY A;  1YOV B;  4AP4 C;  2XNA C;  1EWY C;  1WXQ A;  1J7B A;  4IM0 A;  1IBX B;  3CWI A;  4KZC A;  3DQV A;  3ZVV A;  1TS2 A;  2KYW A;  3KVF B;  2YEP F;  3NG0 A;  2GBM A;  3WAN A;  1ZW7 A;  1WXV A;  3AEG B;  2X8X X;  1R4M B;  4K3B A;  2IO3 B;  1R4M I;  3C19 A;  5HG2 A;  3OJ3 A;  3TEX A;  2C5L C;  4TMA B;  2LHE A;  4DHZ B;  3ZW3 A;  2JWU A;  2L1A A;  2NBV B;  1VZ7 A;  4HXD A;  2LVP A;  2MJD A;  3K9P B;  4W9H A;  3KYD D;  2MBH A;  3A1Q A;  3MC0 B;  1KLG D;  5AZH A;  1WJU A;  4PT5 A;  2DZJ A;  3ALB A;  4DXA B;  4EUT A;  3RT3 B;  2XK5 A;  2SEB D;  3PHX B;  3WIM A;  1N5W A;  4P1B C;  3TEZ A;  5FKA C;  4GOC A;  4PK1 A;  1WRI A;  3Q3O C;  2WXQ A;  2ZJD A;  3DCG A;  5BMH A;  2G4D B;  1QOB A;  4JQW C;  4IOI E;  2GB1 A;  2KX3 A;  3AE7 B;  2G4S A;  2IGG A;  3U7Z A;  2DZK A;  5T8I A;  1F2R I;  4UDU C;  1PUT A;  1UGJ A;  4EZL A;  2LJI A;  2NS5 A;  3ONS A;  4OZB A;  2C60 A;  3N1Y C;  2KZR A;  3RNA C;  4E3C A;  4EFO A;  1QLB B;  3QIJ A;  2DYM A;  4HVB A;  2NCN A;  2XBB C;  1NEK B;  4EEW A;  2KJ6 A;  5L95 C;  3AEA B;  2L7R A;  2A5U A;  5LNK 1;  2MBB B;  2ZPN A;  1CMX B;  2MP2 B;  3A9J B;  3AEC B;  1WMH B;  3Q8A A;  1WR1 A;  1L6U A;  4M0W B;  4MT5 A;  2PJH A;  1J19 A;  1I42 A;  4MSM B;  4DDG D;  2FCS A;  2LAS A;  3APF A;  5CHW A;  5AZF A;  1K50 A;  3AE6 B;  2KFJ A;  2I2Y A;  2K6Q A;  4W9C A;  4NQK E;  2ONQ A;  4ICV A;  2V3S A;  3Q3J A;  5LXH A;  5IA7 A;  3VXW A;  3V60 A;  2V0G A;  3SEB A;  4NNJ B;  3NS1 A;  4B0E A;  2KLG A;  3JSV A;  1VDV A;  4P16 A;  3BVM A;  4X57 B;  4D2K A;  2KMM A;  1V1P B;  2NVU I;  4PS8 A;  3P63 A;  1RFK A;  4HRO A;  1OQQ A;  4A20 A;  3CSF A;  1SE9 A;  1V49 A;  1XLQ A;  4GMV A;  4NZL B;  3UIO B;  3ZTC A;  2DEN B;  3CMM B;  5G55 A;  3CST A;  1TBE A;  2KC1 A;  2FNJ B;  1WX7 A;  2LFI A;  3L16 A;  1FXA A;  2L32 A;  2O2V A;  4NAM A;  2MX2 A;  1DGJ A;  1WH3 A;  3NOB A;  1KH0 A;  4A9A A;  1IUE A;  2KTR B;  3DVN U;  3WCQ A;  4ZRP A;  3NJT A;  2I38 A;  5D7G A;  2N9E B;  2Y5C A;  1E0Z A;  2PKO A;  1UUP A;  3PZD A;  3KWL A;  4A55 A;  2WYQ A;  1STE A;  3QAR A;  1AYF A;  5IKC M;  1FM0 D;  2MBE A;  3NVY A;  1UEL A;  2GBK A;  4K7W A;  2KJH B;  3O13 A;  3E9S A;  4JLC A;  4HPM B;  1F2R C;  4CO7 A;  2GI9 A;  1C79 A;  1QKZ A;  2K39 A;  1OQR A;  3RNG C;  1QQR A;  1IBX A;  2D3C A;  1YJ1 A;  4P1C C;  2FIF A;  2BF8 B;  3ZTD A;  5KHQ A;  2O6V B;  1C78 A;  4RM8 A;  1JQ4 A;  1J0G A;  1NEN B;  1VZ6 A;  1N63 A;  2SAK A;  2AX5 A;  2K9X A;  1GAQ B;  2AQ1 B;  1GOZ A;  3R3M A;  2KWC A;  1VRA B;  3ZO5 B;  3T3O A;  3QJZ A;  2JPH A;  2LUE A;  2WXG A;  4P7I A;  3DBR B;  1OTR B;  4XDD A;  4HPL B;  1Y56 A;  4HDQ A;  1N60 A;  3DBR I;  3HM3 A;  4C7Y A;  3W9C B;  3BWU D;  2K8H A;  1YN4 A;  1WXM A;  2GBR A;  3AE8 B;  3M63 B;  1FRD A;  2QIL A;  3EFU A;  4RCO A;  5E6O A;  1SF0 A;  1K52 A;  2NBW B;  1YN3 A;  3AEF B;  3Q8C A;  3P4S B;  2PMV A;  2WNM A;  2LXA A;  4OVZ A;  4RGT A;  1J7C A;  3ETR A;  4HEA 1;  4FJY A;  3E56 A;  2EKI A;  1SXT A;  4KIK B;  2LVQ A;  3PZ7 A;  4ZRQ A;  3ZDM C;  3Q69 A;  1LGR A;  2VH1 A;  4HRS A;  1P0R A;  1UD7 A;  5J18 A;  1GPX A;  2IND C;  4IC7 B;  3D32 A;  2JU6 X;  2VRR B;  2KAJ A;  1V5O A;  2V4I B;  1ZPS A;  4GSW A;  2CJO A;  3A9K B;  2MBO A;  4DWF A;  2RDB C;  4K7S A;  2BWE S;  4XZ4 A;  3IXS A;  2ZW0 A;  1XCQ L;  1P98 A;  5EE9 A;  2M4N A;  5L83 A;  4GIV A;  2JWZ A;  3Q3N C;  2IY1 B;  4HK2 A;  4L23 A;  3UIN B;  4AJW A;  2D3B A;  2FAZ A;  2G1E A;  3TEW A;  3A1Q B;  1GG3 A;  1IGD A;  4YSY B;  2MP2 A;  1EF5 A;  3A9J A;  1WMH A;  2HD5 B;  3JVZ X;  5JZE B;  4JGH B;  1CK1 A;  2KQ7 A;  2H89 B;  4M0W A;  2LMC A;  3N3K B;  1NI3 A;  3W2D A;  1Q1O A;  4ITK A;  4ARI A;  4B95 A;  4EOY A;  2HJ8 A;  5BYQ A;  1FMA D;  3ZJT A;  1XLO A;  1ZUD 2;  1SSN A;  2JZZ A;  2FUG 1;  3QQ8 B;  1SJH D;  4FBJ B;  2UYZ B;  3BK2 A;  2YEP B;  5AEK B;  1SIJ A;  2JUO A;  2INC C;  5D94 A;  1D5M C;  4KZ0 A;  3TL5 A;  4DK5 A;  1T0S C;  2MBQ A;  1K8R B;  1T0Y A;  5H8Y E;  2JZP A;  4PS7 A;  1AAR A;  4RH6 A;  3MJW A;  3ZXV A;  1EU3 A;  1V1P A;  4TV3 A;  2J4X A;  2AWT A;  5J17 A;  3LYY A;  4W9G A;  5EE0 A;  5IOI A;  4DHJ D;  2WXR A;  1C77 A;  4W9E A;  2FUH B;  3KQ4 A;  5DPS A;  4RGN A;  4B6W A;  2WDV B;  2N1W A;  2N9X A;  4ZYN A;  1JWU D;  3N32 A;  4MEL A;  3W1S C;  1WZ3 A;  1UF0 A;  3AE3 B;  1A5R A;  2BS2 B;  4N9F 4;  2AL6 A;  1WIA A;  1YD8 U;  1FO4 A;  4WWP A;  3KUC B;  2WDR B;  3PO0 A;  4J3O D;  2GBN A;  3P2B A;  4NAW B;  1IPG A;  2I1K A;  3L13 A;  3ABV B;  4C56 C;  4YTM B;  2I1J A;  3KH0 A;  4JPS A;  4WJP A;  3RZF A;  1WF9 A;  4CQN A;  2HJ1 A;  2Y3A A;  3QK0 A;  3FAH A;  2BYE A;  1VD2 A;  5DPT A;  2KAN A;  1NYR A;  3HRD D;  5EE3 A;  3W5U B;  1TZ1 A;  3PLV A;  1FEH A;  3N1X C;  2ZNV B;  1D5X C;  1WX9 A;  1QOA A;  1WGY A;  2PW9 A;  4LJP B;  3PV1 A;  4IWO A;  5JH5 C;  4MGI E;  1MVK A;  4BOS C;  1AN8 A;  2BYV E;  4XDC A;  1YJI A;  3VR8 B;  3PLU A;  1WYW B;  3I5J C;  1ZOY B;  2IJ0 A;  2LWP A;  2EEL A;  1V86 A;  2O6V A;  1F52 A;  1WE7 A;  1WX8 A;  3SU8 X;  5CTR C;  2K1F A;  3ZJU A;  3R2I A;  3WA0 A;  1E9M A;  1QOF A;  4LNO A;  3Q8E A;  2N7E A;  1L0X B;  2WXF A;  4LNK A;  2D07 B;  3ZKJ C;  3NVZ A;  1S1Q B;  2ZVO A;  2BS3 B;  3AEE B;  2NR2 A;  3LXF A;  3DWG C;  3P1M A;  4PYZ A;  5GXG B;  4A6Q A;  1VZ8 A;  5AZG A;  2WDT B;  4GLS C;  4BBN F;  2INP E;  2MLB A;  4FAD A;  5D3I B;  3Q6B A;  3RD2 A;  2ACZ B;  4LLG M;  3EGR A;  3PRZ A;  1Q5W B;  4HPP A;  3R2T A;  1XD3 B;  4LNI A;  2L05 A;  1TKG A;  2QJL A;  3OJ4 B;  4DXG A;  3T3N A;  4KIK A;  3P4Q B;  1XXG A;  3PPA A;  3VFK A;  2KK8 A;  4MJS B;  3HHM A;  3UI3 A;  1I4X A;  2JX5 A;  3VUX A;  4LNF A;  2LGS A;  3V6C B;  2PLP A;  2R2O A;  1HQR D;  4PYU A;  4MEM A;  4C7Z A;  5BYR A;  3A9K A;  4E74 A;  2K8B A;  3UQB A;  2HDE A;  1MG4 A;  3ZLZ A;  4IM2 A;  1FXT B;  3RNE C;  1KFY B;  3QHT A;  2C9W B;  4BFR A;  1E8W A;  4GDL B;  2M17 A;  3R7R A;  1ENF A;  3BVG A;  5GMV A;  2LGI A;  2N1V A;  2W54 A;  2K25 A;  1FNU A;  3ML8 A;  2W3R A;  4A3P A;  3DHI C;  2KWU B;  3CIR B;  4QAY A;  1P7E A;  2LGX A;  1N5X A;  3GE3 C;  3LDZ E;  2WXI A;  2ZEQ A;  4KV2 A;  1N6Z A;  5FR3 A;  1JW9 D;  1IP9 A;  2WS3 B;  4G3X B;  3LJ3 A;  1QZE A;  3GOE A;  1JAL A;  3B2G A;  4C4V B;  2IPK D;  3L17 A;  3PS6 A;  4OVV A;  3IT6 B;  2IO2 B;  1DOX A;  2ZNV C;  1YX6 B;  1VR9 A;  5BYS A;  4N58 A;  2DX5 B;  2QIE B;  1HTQ A;  1JWS D;  1NDD A;  1MJD A;  1H4R A;  4KDL B;  4BZA A;  3BY4 B;  1EUV B;  2KFK A;  4ZRJ A;  2LI5 A;  2ASQ A;  4LDT D;  2DWQ A;  3H6N A;  3HUI A;  4GGQ A;  1KJT A;  1JRU A;  2GBJ A;  1KTK A;  2FCN A;  2RGF A;  3OWE B;  1GJZ A;  1ET6 A;  4KVG B;  1OEY A;  2KWD A;  1RM6 C;  2BQQ A;  5HI1 A;  2CHW A;  1FIQ A;  3KYC D;  3IFW B;  2LGY A;  3R8B A;  1E90 A;  4GDK B;  2WXJ A;  1V81 A;  2NTS A;  1RWS A;  3SR6 A;  3TBL D;  1UGM A;  1HZ5 A;  2WU5 B;  2KJR A;  3ZNI D;  2LZ6 A;  2KT7 A;  4NAW A;  3IVF A;  1FCL A;  4K3C A;  4IW0 A;  3MHZ A;  3ZUN A;  2KX0 A;  1WJ6 A;  3H7P B;  4ZHO A;  3OG5 A;  1LM8 B;  2L8J A;  2BB6 A;  3WAM A;  2RSU A;  3SFE B;  3N1Z C;  4WIP A;  4W9I A;  2BYF A;  3MHS D;  1WGG A;  3ZQ4 A;  4FLH A;  2C7H A;  3H1U A;  4NJC A;  4DHJ B;  2L52 A;  5E6P A;  2GRI A;  1YNT E;  2CU1 A;  3W1Y A;  3O65 B;  3A33 B;  1XT9 B;  3AXC A;  1Z5S B;  2XEW A;  2FCQ A;  1ACC A;  4GN1 A;  1K51 A;  1PQS A;  3U7D A;  2D5G A;  4RF1 A;  3SDL C;  4ANV A;  5TSS A;  5DPR A;  3RNB C;  2KC2 A;  2L00 B;  1TS4 A;  1M94 A;  5DPW A;  1D5Z C;  2WX0 A;  1C3T A;  4P6V F;  1WWT A;  3PVL A;  1U4A A;  3CF6 E;  1L6V A;  2TSS A;  2KQ4 X;  1V8C A;  2C7N B;  2K6D B;  1E7V A;  4IG7 B;  3U52 E;  2KVZ A;  3KUZ A;  2UWQ A;  2FID A;  2V9H A;  4CYE A;  5C1Z A;  1TZO A;  4R3D A;  3QX1 A;  2PE6 B;  4A3O A;  2DAF A;  3B08 A;  2BPS A;  1HZ6 A;  4K1R B;  2D3A A;  2WXO A;  1V2Y A;  3GZN B;  3KUD B;  3SHQ A;  2IGD A;  4MH8 A;  1FNV A;  5FR6 A;  2LJ5 A;  4BKS D;  2M56 B;  3GZN I;  1M4V A;  2NTT A;  1OQY A;  4N6E B;  4MH0 E;  2K0P A;  1SE2 A;  1NYQ A;  1CJE A;  2N9P C;  2V3N A;  2N7J A;  5I4D A;  3BK1 A;  2JYT A;  3VQI A;  1Q0W B;  4WH4 A;  3ZRF A;  1XCT L;  4BAX A;  2PVG C;  1SJE D;  4MJS A;  2LHD A;  3H8H A;  2GMI C;  1VCB A;  4AJY B;  1ESF A;  2ICI A;  1YQ4 B;  1E6E B;  1C4P A;  3W5V B;  2OHF A;  1KLV A;  4TQ0 A;  1RLF A;  4RNA A;  2QDF A;  1WM3 A;  1SE4 A;  2PEA A;  5CX3 A;  3VAW A;  1NBF C;  3DVG X;  1JRO A;  3VUY A;  2JQR B;  4B0M A;  4GDL A;  1KM7 A;  2N4F A;  2MJ3 A;  1B9R A;  4M8M A;  5EE1 A;  1SBB B;  3UIP B;  4II3 B;  1MFW A;  2WQY B;  3C0R B;  3PGE A;  2QEJ C;  2BKR B;  5JHA A;  2M8S A;  4KX6 B;  3PZ8 A;  2BKF A;  3AE1 B;  1TIF A;  1PFD A;  1SB3 C;  2L0T A;  2Z0D B;  3IAM 1;  4YWG G;  4C4V A;  3B0A A;  3RUL A;  4TKN A;  1FNW A;  2X38 A;  4FJV B;  2KXJ A;  1ZDV A;  2MH7 A;  2M19 A;  2D2Q A;  3DBH B;  1JRP A;  2PTL A;  2MHJ A;  4LCD E;  1GUA B;  4OVU A;  3VUW A;  3DBH I;  1L5P A;  2A4Z A;  4HCN B;  4HKZ E;  3MJ5 A;  4W9K A;  2B3A A;  2ZCC A;  3RPF C;  2LVO A;  2HE7 A;  3TCA A;  1J7A A;  2LD9 A;  4MGY E;  4M00 A;  4DXF A;  2NPT A;  2JVC A;  4IWQ A;  3Q2A C;  3P4R B;  3B1L X;  1XF5 L;  3BII D;  2Z59 B;  3BVZ A;  2WXP A;  2UU7 A;  1R4N B;  4GDK A;  1PDX A;  1L0V B;  3T9L A;  1R4N I;  1E10 A;  4MAC A;  1QIL A;  2AL3 A;  1ZXI A;  1WXA A;  2HTH A;  4GXB A;  1GB1 A;  2JF5 A;  1LFD A;  4L1B A;  1C4C A;  1FFV A;  3H7P A;  1I4P A;  4RMA A;  3AN1 A;  3HIZ A;  4FHJ A;  4EKU A;  2ZW1 A;  1TYG B;  3TJP A;  2V4L A;  2KFK B;  2DZI A;  4I6P A;  1ZP0 B;  1CZP A;  1NVI D;  3EFC A;  3M95 A;  1OGW A;  3URY A;  4LDT B;  1WGR A;  2QCZ A;  1UH6 A;  1DYQ A;  2IY0 B;  3RN9 C;  4ANX A;  4BKT A;  1ZDX A;  3DBS A;  1WXS A;  1X1M A;  3ZNG C;  5KHO A;  1GC7 A;  5IO9 A;  1UBQ A;  3RNF C;  4AQ7 A;  2OED A;  3K9O B;  3AE5 B;  2NBU A;  4WQO B;  1P9D U;  3RMK C;  3NY5 A;  3L0W B;  3OLM D;  2G45 B;  4AOF A;  2CHZ A;  2R61 A;  3ECI A;  3VTV A;  2GLS A;  1WE6 A;  3BZD B;  2L0F A;  5JHB A;  2WP9 B;  5IP4 D;  3NVV A;  3ML9 A;  2KQS A;  3GE8 C;  4XGA B;  3ZIM A;  4G0N B;  2BTE A;  1E7U A;  2DAJ A;  3AEB B;  3TUO A;  1AW7 A;  2KD0 A;  1ZGU B;  1TS5 A;  3DOW A;  2VZK D;  2REX A;  1TT5 B;  2WHI A;  3UGB B;  1SGH A;  3HM6 X;  2DYB A;  4JWU C;  2IO0 B;  1UNS A;  2IDY A;  1EM7 A;  4KGR A;  1EU4 A;  1V6E A;  1QF6 A;  1K53 A;  3I9V 1;  3WAO A;  2JY6 A;  2LRU A;  2G3Q B;  4WJQ A;  4C80 A;  1PGA A;  1PYW D;  4OZA A;  3B2F A;  2FCM A;  3R66 C;  4JIO U;  3L54 A;  1YMH E;  3ZRC A;  3R7Q A;  2AEH A;  4LJO B;  4S17 A;  1GC6 A;  1WRD B;  3AM9 A;  4WWN A;  3VRB B;  3DVN V;  1WM2 A;  1MHH E;  3IHP C;  3KW5 B;  1IYF A;  2CU3 A;  3U8Z A;  4HLE A;  4OW0 A;  2OJR A;  3Q14 C;  3MFG A;  3AU4 A;  2KVR A;  4RF0 A;  3RUI B;  3BYT B;  2J0J A;  2RDG A;  2KKC A;  4BBN C;  4LNN A;  1WGH A;  2JT4 B;  1ROE A;  3RZW C;  2M0X A;  4LTU A;  3S2A A;  2ZPY A;  2WXH A;  2WDQ B;  4JL9 A;  2PE9 A;  2QHO A;  5G5H A;  5BMG A;  1RYJ A;  4WAA A;  1TS3 A;  2W55 A;  1AWD A;  1DOI A;  4M8N A;  2WXL A;  1TKE A;  4IUM B;  4PS3 A;  4MGK E;  2FE8 A;  4NY0 A;  4E71 A;  2KWV B;  1PGX A;  2K22 A;  4K81 A;  3P4P B;  2KMA A;  2DZM A;  1E8Z A;  1PGB A;  5D2M B;  1TGZ B;  2KDB A;  2RPV A;  1RAX A;  2L76 A;  3N9Y C;  4IWP A;  1TY2 A;  3JW0 X;  1LXD A;  3MC9 A;  3UQA A;  5DCN A;  2J53 A;  4TQ1 A;  2GOW A; 
#chains in the Genus database with same CATH homology
 2GRI A;  2JYE A;  1YNT E;  4YSZ B;  1E7P B;  3FIL A;  4ZRQ A;  3PZ7 A;  1TKY A;  3Q69 A;  4HRS A;  3Q8B A;  1ACC A;  1GPX A;  2INN E;  1K51 A;  2D5G A;  3ZGZ A;  4RF1 A;  1T3Q A;  1TJE A;  5TSS A;  2JU6 X;  4HJG E;  1T6B X;  5E6J A;  2KAJ A;  1TS4 A;  2V4I B;  4LK0 M;  1D5Z C;  1ZPS A;  2CJO A;  4P6V F;  1WWT A;  4ZHP A;  3I57 A;  3EUB 2;  2H88 B;  4YXD B;  3AE9 B;  5JXV A;  1L6V A;  2TSS A;  2KQ4 X;  3IXS A;  2ZW0 A;  3KLS X;  1V8C A;  1XCQ L;  1C76 A;  2Z8L A;  3AB5 A;  4KKJ A;  3U52 E;  5EE9 A;  2LUM A;  1ZXH A;  1JCK B;  2LEK A;  1TZO A;  4R3D A;  1YN5 A;  4L23 A;  2FBW B;  1QOG A;  2G1E A;  5HHD G;  3TEW A;  1N61 A;  2XN9 C;  4KGT A;  1HZ6 A;  4MM3 B;  1IGD A;  1D6E C;  2N0S B;  2WXO A;  4YSY B;  1IGC A;  1V97 A;  5C3J B;  2ON8 A;  2IGD A;  4MH8 A;  3AE4 B;  2AQ2 B;  1CK1 A;  1FNV A;  1WYG A;  1XLP A;  3RFZ B;  2M56 B;  2H89 B;  3ZYY X;  1M4V A;  2NTT A;  4M0W A;  2LMC A;  2G9H D;  4OHJ A;  4N6E B;  1NI3 A;  2K0P A;  3LB8 C;  3P42 A;  3W2D A;  4ITK A;  4ARI A;  1SE2 A;  4YT0 B;  4YTP B;  1NYQ A;  5BYQ A;  1CJE A;  5D3D A;  1FMA D;  2N7J A;  2V3N A;  5I4D A;  3C8Y A;  3BK1 A;  1MPE A;  2JYT A;  3VQI A;  4WH4 A;  3ZJT A;  3W1S A;  3ZJV A;  1XCT L;  4USA A;  2PVG C;  3AE2 B;  1SJE D;  1XLO A;  1ZUD 2;  2Y5P A;  1OFF A;  1SSN A;  2N9K A;  2FUG 1;  2LHD A;  3H8H A;  1BUI C;  1UWX A;  1TY0 A;  1SJH D;  3BK2 A;  4ARC A;  2YEP B;  1ESF A;  1FXI A;  2ICI A;  1T5X D;  1YQ4 B;  2HTM E;  2RDH A;  3IT4 B;  1E6E B;  1SEB D;  1SIJ A;  3GB1 A;  4KKI A;  2MJE A;  1C4P A;  3W5V B;  1D5M C;  2OHF A;  4RGM A;  5HFY A;  4TQ0 A;  4RNA A;  1SE4 A;  1DOY A;  5H8Y E;  3HVD A;  2JZP A;  4RH6 A;  2CJN A;  4TSS A;  1Q10 A;  1EU3 A;  1V1P A;  1I4G A;  1FFU A;  1I4R A;  1P7F A;  2J4X A;  2QMT A;  2KN4 A;  1VJK A;  1JRO A;  1XO3 A;  1WSP A;  3LYY A;  4AS1 A;  4YSX B;  5EE0 A;  2JQR B;  2WXR A;  2BBC A;  4B0M A;  1C77 A;  2MJ3 A;  2XNA C;  1EWY C;  1B9R A;  1WXQ A;  2NMQ A;  1J7B A;  3KQ4 A;  4RGN A;  1IBX B;  5EE1 A;  3CWI A;  1SBB B;  2WDV B;  2WQY B;  1JWU D;  2B76 B;  2E6X A;  2QEJ C;  1TS2 A;  1N62 A;  4JWS C;  2YEP F;  3AE3 B;  2BS2 B;  1EWC A;  2WLB A;  1B1Z A;  1L0Y B;  3AEG B;  4KX6 B;  3PZ8 A;  3AE1 B;  1A70 A;  1FO4 A;  1JWA D;  1PFD A;  1SB3 C;  2WDR B;  3PO0 A;  4J3O D;  2J52 A;  1R7S A;  4XWW A;  2DBY A;  4L2Y A;  2QSD A;  3IAM 1;  4NAW B;  5HG2 A;  4YWG G;  3TEX A;  3ABV B;  4TMA B;  2LHE A;  5G5G A;  4C56 C;  1FNW A;  4YTM B;  2JWU A;  2X38 A;  1KF6 B;  4JPS A;  2L1A A;  2WXK A;  1ZDV A;  1VZ7 A;  2MH7 A;  2MJD A;  2M19 A;  4CQN A;  1JRP A;  2PTL A;  3AED B;  2Y3A A;  2W3S A;  3MC0 B;  3FAH A;  1KLG D;  3NRZ A;  1VLB A;  4PT5 A;  1FCC C;  1NYR A;  2Q5W D;  1L5P A;  3HRD D;  5EE3 A;  3W5U B;  1D4B A;  4XWT A;  5BMI A;  1HXY D;  1FEH A;  4HKZ E;  3MJ5 A;  2SEB D;  1D5X C;  1N5W A;  1QOA A;  3RPF C;  2PVO D;  3TEZ A;  5FKA C;  2JXT A;  2PW9 A;  2BB5 A;  1WRI A;  1J7A A;  2WXQ A;  4US8 A;  3V05 A;  1MI0 A;  3NVW A;  2K5P A;  1F77 A;  3SFD B;  4DXF A;  5AUI A;  1MVK A;  3V3X A;  4KGS A;  5BMH A;  1AN8 A;  2VZK B;  3FIL B;  2PIA A;  4US9 A;  4XDC A;  1YJI A;  2DLB A;  3P4R B;  1QOB A;  2N9L A;  3VR8 B;  1XF5 L;  3BII D;  1ZOY B;  2KDM A;  4IOI E;  3BVZ A;  2GB1 A;  2WXP A;  2IJ0 A;  4WAF A;  3AE7 B;  2EEL A;  2IGG A;  3U7Z A;  2IGH A;  5T8I A;  1F2R I;  4UDU C;  1PUT A;  1PDX A;  1BML C;  3FC4 A;  1UGJ A;  2LJI A;  1L0V B;  1E10 A;  4MAC A;  2BW2 A;  3R2I A;  3VR9 B;  3ZJU A;  4OZB A;  2DYO A;  1E9M A;  1QIL A;  1QOF A;  1ZXI A;  3Q8E A;  1C9F A;  1L0X B;  2WXF A;  4DQO C;  1QLB B;  1HA5 A;  2DYM A;  1GB1 A;  4L1B A;  1C4C A;  1FFV A;  5H92 C;  1NEK B;  3NVZ A;  3LXF A;  2BS3 B;  3AEE B;  3AEA B;  1I4P A;  3DWG C;  3P1M A;  3AN1 A;  5GXG B;  4A6Q A;  1VZ8 A;  5LNK 1;  3TEY A;  4GLS C;  2ZW1 A;  1TYG B;  2INP E;  5C2T B;  3AEC B;  4FXC A;  3L4P A;  5D3I B;  1ZP0 B;  1CZP A;  1NVI D;  1FD6 A;  1I4H A;  3URY A;  3Q8A A;  1I4Q A;  2ACZ B;  3AV8 A;  1L6U A;  4LLG M;  3EGR A;  4MT5 A;  1DYQ A;  3AMZ A;  3R2T A;  1ZDX A;  1TKG A;  2QJL A;  4WUR A;  4DXG A;  1FRR A;  3T3N A;  1K50 A;  3AE6 B;  4JX1 C;  4O1N A;  1WGK A;  3P4Q B;  1XXG A;  2I2Y A;  4AQ7 A;  4H2A A;  3UI3 A;  2OED A;  1I4X A;  2JX5 A;  3AE5 B;  2ONQ A;  4REZ A;  1BXT A;  1YJJ A;  2PLP A;  1HQR D;  3B9J A;  2R61 A;  4C7Z A;  1YQ3 B;  3BZD B;  1F0Z A;  2V0G A;  5BYR A;  3SEB A;  1L4D B;  2WP9 B;  3NVV A;  2WXM A;  2BS4 B;  2BYT A;  5MPO A;  2HDE A;  1CQV A;  3NS1 A;  4B0E A;  1VDV A;  4P16 A;  1KFY B;  3BVM A;  4D2K A;  2KMM A;  5FK9 C;  1UWM A;  1V1P B;  1V1O A;  1ZE3 D;  3P63 A;  1RFK A;  1I7H A;  4HRO A;  2BTE A;  2L83 A;  1OQQ A;  4WWM A;  3AEB B;  3TUO A;  1AW7 A;  2WXN A;  3EA6 A;  4EE2 A;  1XLQ A;  4NZL B;  4GDL B;  1TS5 A;  4ZOH C;  2M0A A;  2MEK A;  3HVZ A;  1ENF A;  2VZK D;  3BVG A;  2LGI A;  2LFI A;  2W54 A;  1FXA A;  2RMM A;  1FNU A;  2L32 A;  2W3R A;  4N59 A;  4NAM A;  2JSV X;  3J9C A;  2K3U A;  1DGJ A;  2J42 A;  3CIR B;  1P7E A;  1KH0 A;  4JWU C;  4A9A A;  1IUE A;  1UNS A;  4JE3 B;  2IDY A;  1EM7 A;  1N5X A;  4KGR A;  3WCQ A;  1EU4 A;  2WXI A;  1QF6 A;  1K53 A;  4ZRP A;  3I9V 1;  5FR3 A;  1JW9 D;  2WS3 B;  2I38 A;  4C80 A;  5D7G A;  1PGA A;  1PYW D;  4OZA A;  3B2F A;  1JAL A;  3DWM A;  2Y5C A;  1E0Z A;  1YMH E;  3B2G A;  2PKO A;  2IPK D;  3NUH B;  1UUP A;  3NZ3 A;  3IT6 B;  3GS2 A;  1LO5 D;  3AM9 A;  3KWL A;  1DOX A;  2W82 A;  4A55 A;  4IKG A;  3VRB B;  1JWB D;  1VR9 A;  5BYS A;  4N58 A;  4WQM A;  1STE A;  1MHH E;  2QIE B;  1L4Z B;  1JWS D;  1AYF A;  4XE0 A;  1FM0 D;  2CU3 A;  3NVY A;  4OW0 A;  3U2S C;  2KAC A;  3MFG A;  1GB4 A;  3MP9 A;  1XLN A;  3O13 A;  4RF0 A;  3E9S A;  1ET9 A;  2DWQ A;  3BYT B;  2RDG A;  4IDI A;  4OZC A;  1F2R C;  2V3P A;  3HUI A;  1ROE A;  2GI9 A;  1C79 A;  1QKZ A;  1KTK A;  3U4E G;  4HKQ A;  3OWE B;  4LTU A;  1ET6 A;  4RGO S;  4A8X C;  1OQR A;  2KWD A;  2WXH A;  4Q2J A;  2WDQ B;  1RM6 C;  4YTN B;  5HI1 A;  1QQR A;  1IBX A;  1FIQ A;  3TSS A;  5G5H A;  5BMG A;  3R8B A;  4GDK B;  1C78 A;  4RFB A;  3VRA B;  1RYJ A;  1C4A A;  1SE3 A;  1JQ4 A;  2WXJ A;  1TS3 A;  2NTS A;  2W55 A;  1AWD A;  1DOI A;  1RWS A;  3SR6 A;  2WXL A;  1NEN B;  1TKE A;  1VZ6 A;  1JWM D;  1HEZ E;  1N63 A;  1HZ5 A;  2SAK A;  2WU5 B;  3KWV A;  2AX5 A;  2FE8 A;  2K9X A;  1GAQ B;  2AQ1 B;  1GOZ A;  1MHX A;  1PGX A;  2K22 A;  3BYY B;  3P4P B;  2AQ3 B;  3IAS 1;  1FCL A;  1VRA B;  3T3O A;  3MHZ A;  2BT6 A;  2WU2 B;  2WXG A;  4ZHO A;  1PGB A;  4XDD A;  1Y56 A;  1KLU D;  2BB6 A;  1N60 A;  4C7Y A;  3SFE B;  3W9C B;  3BWU D;  1QT9 A;  2RPV A;  1KRH A;  3GP7 A;  4WIP A;  2E3T A;  1YN4 A;  3Q8F A;  1XEE A;  4A90 A;  3AE8 B;  3N9Y C;  1FRD A;  2QIL A;  4RCO A;  1SF0 A;  1TY2 A;  1K52 A;  3AH7 A;  3ZQ4 A;  1YN3 A;  3AEF B;  3Q8C A;  3P4S B;  2PMV A;  2WNM A;  4RGT A;  4OVZ A;  5AUK A;  1J7C A;  3ETR A;  4HEA 1;  4ZYS A;  4NJC A;  3E56 A;  1JML A;  2EKI A;  1SXT A;  2J53 A;  4TQ1 A;  2L52 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...