4WAAA

Crystal structure of nix lir-fused human lc3b_2-119
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
126
structure length
126
Chain Sequence
NEEWVELGSPSEKTFKQRRTFEQRVEDVRLIREQHPTKIPVIIERYKGEKQLPVLDKTKFLVPDHVNMSELIKIIRRRLQLNANQAFFLLVNGHSMVSVSTPISEVYESEKDEDGFLYMVYASQET
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Microtubule-associated proteins 1A/1B light chain 3B
publication title Phosphorylation of the mitochondrial autophagy receptor Nix enhances its interaction with LC3 proteins.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Structural protein
total genus 34
structure length 126
sequence length 126
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-08-29
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 4waaA00
4G3XB 3B0AA 4GXBA 2KXJA 4A3PA 2NBVB 3R66C 2BYVE 2O2VB 4FJZA 4IW0A 5G55A 3HHMA 3VTWA 2MBHA 3CSTA 1LFDA 5DPTA 3P2BA 2AL6A 1V5OA 3KYDD 4M8MA 4KDLB 1EUVB 4FJYA 1CMXB 2IY0B 3RZFA 1TBEA 1WMHB 1WMHA 3HM6X 2DHZA 2GBMA 2YLMA 4FULA 3V60A 3VH3B 1WXSA 4URKA 3L0WB 1I42A 1GJZA 1OGWA 4CYEA 4HCPB 4E3CA 3L17A 4HDQA 2CU1A 4NNJB 1E7UA 2FCSA 3MJWA 2ZPYA 4ICUA 4EFOA 4N9F4 2BWFA 3H6NA 2M4NA 3ZIMA 5D6JB 1WJNA 3QJZA 1Q5WB 1WX9A 1E8WA 1NBFC 2KMAA 3LDZE 2JZ3B 1E5WA 2N9PC 4DHJB 2C7HA 3MTNB 4NQKE 4A3OA 2HD5B 2C7MB 4WWOA 4MDKE 2DX5B 4I6PA 4MGIE 5AZFA 3VHTC 2K6DB 3KYCD 1TZ1A 2PEAA 4GSWA 4IWOA 2Y5BB 1J19A 4AOFA 2YVCA 2KD0A 4E71A 4WAAA 4ANXA 1ZW7A 2LVQA 4BFRA 5AZGA 3PGEA 2KTRB 3A9KA 2KFJA 1QZEA 4FADA 3HIZA 1WJ4A 4OVVA 3EC8A 2KOXA 1WF9A 3H7PA 3SDLC 4NJ6A 1XT9B 2KANA 4JIOU 2I1KA 3ZLZA 3ZNID 2LXCA 3IG3A 3OAWA 3QAQA 2DYOA 3R7RA 3IBEA 3R7QA 2MP2B 4ASWC 4BVUC 1P98A 2JWZA 1UBQA 1WJ6A 3QX1A 3SU8X 4DDGD 3QARA 1GNUA 2KFKA 1Z2MA 2IBIB 2WWZA 3L13A 2KX3A 3A33B 4MGYE 2CHWA 4KZCA 2ZPNA 1E90A 4GDLB 4WJPA 3UQBA 2KKCA 3V6EB 1LQBA 3AI5A 3CF6E 1YIWA 3L10B 4GGQA 2N7DA 2ZJDA 4AWJA 2JF5A 4ICVA 2G4SA 3M95A 3VH4B 4I6LB 2L00B 2N7EA 2ZCCA 4RMAA 4TUUA 4B9KA 2BGFA 1E8ZA 4BKSD 3GZNI 4LDTB 4G0NB 3SHQA 4BKTA 2FNJB 2VRRB 3AU5A 4XX5A 1GG3A 2NVUI 1WZ0A 1Z5SB 2HTHA 3K9PB 4GB9A 2WX1A 2K39A 1KJTA 1IYFA 4DBGA 3NY5A 3PS6A 3DVNV 2D11A 4NQLB 3VTUA 4EKUA 1P1AA 5L95C 1P0RA 3I3TB 3ZNHB 3U7DA 4FHJA 2AL3A 4B95A 2XK5B 2C9WB 2CKHB 2RGFA 2EMTA 1IPGA 3A9JA 4K7UA 4KV2A 3ZRFA 3A4SC 2MBEA 4PS7A 1HE8A 2KNBA 4HWIB 4IM3A 3DPDA 4EUTA 3A1QB 3M62B 3IVFA 2ZVOA 3JSVB 4PS3A 1K8RB 1FXTB 1V49A 2DZJA 1RFAA 1T0YA 3UIPB 3ML9A 5DPWA 2LD9A 1SIFA 4A20A 2Z0DB 3ZVVA 4GU2A 5CHWA 3DVGY 2NCNA 1YX5B 1WGHA 4K81A 4PS8A 3M63B 2GBKA 2KJHB 4GDKA 4MSMB 3WIMA 1WY8A 1WE7A 4AUQC 2C60A 2GMIC 4TQ0A 2IO2B 3VXWA 1SGHA 3AULA 3W1SA 1EF1A 2A4ZA 1WI0A 2DYBA 1I35A 2D3GA 2DYMA 3N32A 4AJYB 2MA9B 1L2NA 2MWSB 1U4AA 3QA8A 2V3SA 3U8ZA 2CHXA 2MCNB 2ZNVB 3ML8A 1UZXB 2MQJA 2WDTB 3Q3FA 1KOTA 3ZTCA 2JRIB 1SE9A 1WR1A 1E8XA 5KHOA 2KWVB 1V6EA 3VFKA 3X23A 2KC1A 2IO1B 3RYTA 3PVLA 4HDOA 3UIOB 1D3ZA 4BBNC 3WAOA 2FIDA 2D10A 1VD2A 4K7SA 4P7IA 5LXIB 5DCNA 3JW0X 5J18A 3KH0A 2NPTA 1WRDB 3HM3A 3PHWB 4LCDE 4DWFA 5AEKB 2XEWA 1V2YA 2NBUA 4KIKA 4K1RB 4JGHB 5IA7A 3ZNGC 1Q0WB 2HJ8A 2KO3A 2MX2A 2RPQA 1V5TA 2KDEB 4IM0A 2FCQA 4YL8A 1YD8U 2IO3B 2RD0A 3K9OB 2LGDA 2EMSA 3DBLI 3EFUA 2MRPA 4I6NB 4ANWA 1Y8RC 4RM9A 3DBSA 1UBIA 4KSLC 1M94A 2O6VD 3ZDTA 5JHBA 2PE6B 1WH3A 2DZMA 3NS8A 1OTRB 3WAMA 5JHAA 3WAPA 2C7NB 2K8HA 1YQBA 3C0RB 4TV3A 1MG8A 3DBHI 2K8CA 3O65B 4FBJB 3A9KB 3WANA 2CR5A 3T9LA 4KSKC 5E6PA 1XQQA 3APFA 3H7PB 2ZZPB 4K7WA 2ZNVC 1OQYA 4W9GA 3PLUA 3S2AA 2K1FA 1BT0A 3RZWC 2M17A 2LWPA 3B08A 1E7VA 2Z0EB 4BBNF 3ZUNA 1GC7A 2UYZB 4II2B 2KFKB 2IYDB 5CX3A 2KVRA 2V4LA 3PV1A 4F8CB 2BWES 4HJKA 2L0TA 4GMVA 3NZUA 4NY0A 1UELA 3KUDB 1KM7A 3UINB 2L76A 1EF5A 5C1ZA 3V61A 2OOBB 4JQWC 3U30A 3KVFB 4PYZA 1H8CA 4M0WB 2BYFA 4NAWB 5GMVA 4NAWA 2MBQA 3IFWB 2JRHA 2ASQA 2L7RA 1S1QB 5CTRC 3LJ3A 4DHJD 4HCNB 4RM8A 1V86A 1F9JA 2LGXA 3N30A 3EHVA 4CO7A 4BOZB 3TJPA 1GUAB 2FCMA 4FLHA 5JZEB 1UD7A 3DDCB 4MJSA 2AYOB 2LI5A 3VUXA 2MSED 3ZKJC 2LUEA 5J17A 3VUYA 2LGYA 2V1YA 2GBRA 1JRUA 3APDA 4WJQA 4PYUA 3VDZA 5KHQA 1UGMA 2KTFA 3A9JB 4EEWA 1WXAA 5FR6A 5L83A 1WM3A 3ZO5B 5G2NA 2PPHA 4LJOB 5DPRA 4WJNA 2DAFA 5BO4B 3PSEB 4FHKA 3RT3B 2AEHA 4G11A 5D94A 3KW5B 4KZ0A 2G3QB 1WGYA 3PLVA 5D7GA 5TR5A 3RD2A 4E74A 2L0FA 3MHSD 2JUOA 3WA0A 2GBJA 4WWNA 5EDSA 3OJ4B 3DVGX 2BKRB 2M0XA 2L8JA 1V81A 2G4DB 4ANUA 3R3MA 3VVWB 1WXMA 2DZKA 3L54A 3ZRCA 4DK5A 2K25A 2LASA 3PRPB 4GDKB 2A5UA 4W9KA 4W9FA 1P9DU 4GN1A 4ZRIA 2KJ6A 1LM8B 4EZKA 5LXHA 2ZVNA 3EECA 4F7ZA 4ZRJA 2R2OA 3QCAA 3T8MA 1WX7A 3QK0A 4IC7B 4W9EA 4BOSC 3TMPB 1J0GA 1PQSA 5DPSA 2JT4B 4LDTD 1WX8A 2J7QB 2IY1B 2O6VA 3VUWA 2WYQA 4DHZE 1VCBA 4HPMB 1WGRA 3AXCA 3CSFA 2RR9A 2CS4A 2C5LC 3M3JA 3QQ8B 2PE9A 3H7SA 2CHZA 2HE7A 2KMCA 2WX0A 5E6OA 4HLEA 3V62A 1RLFA 4IUMB 2JZZA 3GOEA 2MW5A 3PRMB 3AU4A 2NPTB 1Q1OA 1V80A 3NZSA 4FN2A 4KIKB 4W9IA 2O2VA 4AJWA 2KX0A 3L16A 4CHKA 4HVBA 2DENB 4DHZB 5J2RA 2M1MA 2ZEQA 3TL5A 2NS5A 2KJRA 3V6CB 3UQAA 2N1WA 2OJRA 2IO0B 2FAZA 1WXVA 2J0MA 3N3KB 4FJVB 2B3AA 2GOWA 3H9DA 4WJOA 5AZHA 2KLGA 1H4RA 2LVPA 2RSUA 3UF8A 3VTVA 3W1SC 4II3B 2KDBA 3UGBB 2FIFA 2KZRA 4LJPB 4BKSA 2KWCA 4W9JA 2LRWA 2N4FA 2UWQA 4J6IA 3ZDMC 2J0KA 2ZCBA 1OEYJ 3VAWA 3B1LX 4IG7B 2MBBB 3W1YA 3QC8B 4NJ7A 5CHFA 5CHVC 1S3SG 4IWQA 3ALBA 2EKEC 3VQIA 2LJ5A 1TTNA 1XD3B 3PZDA 1WFYA 2JPHA 4NPNA 4X57B 2LVOA 2IZVB 2XBBC 3H1UA 2KHWB 2KTRA 3NHEB 3D32A 2K8BA 3ECIA 4HK2A 2FCNA 4TKNA 3PTFC 3RUIB 1WM2A 2KK8A 1G6JA 5IAAC 2KC2A 3NOBA 2W9NA 5HKHA 4KDIC 4BKGA 4IM2A 2MP2A 3X0WA 2N9EB 2MBOA 1WZ3A 2GBNA 1KLVA 3QHTA 4TQ1A 4XC2A 4MH0E 3WALA 4WQOB 2REXA 3A4RA 5JH5C 1WGGA 3L08A 2NR2A 4EZJA 1RRBA 1R4NI 1WJUA 4MELA 4GDLA 3QIJA 1ISNA 1R4MI 4W9LA 4MJSB 1A5RA 2I1JA 3RULA 4ZYNA 3ZNZB 2N9XA 3JVZX 3JYUA 2N1VA 4KVGB 4IWPA 2MLBA 3BY4B 4W9CA 2KLCA 2KDFB 4HPLB 3TCAA 1WGDA 3PT2B 1E8YA 4JL9A 4DDID 3KUZA 2BF8B 1V9JA 3DOWA 1UH6A 3PREA 4MEMA 1ZGUB 1LXDA 2BKFA 2JXXA 4MGZE 3DBRI 1WYWB 5C23A 3PHXB 2R2QA 1EO6A 2KWUB 3ZTDA 3Q3JA 2KQ7A 3DCGA 2DAJA 3TBLD 2BPSA 3CMMB 1GC6A 2KQSA 2AWTA 2K6QA 2JY6A 2LZ6A 4XZ4A 1IP9A 3ENEA 1WR6E 4JLCA 4ZRKA 3ZW3A 1NDDA 1YX6B 2QHOA 4B6WA 1P3QU 4OVUA 3SD5A 4G50A 2XK5A 4WWPA 3OJ3A 2J0JA 4FA6A 1C1YB 2KDIA 3DQVA 4HXDA 4MSQB 4F1SA 4GIVA 3A1QA 2M8SA 2KN5A 3BINA 3TIXA 1C3TA 2Z59B 3QWZB 4W9HA 4W9DA 5LLIA 3JSVA 3RCZA 1L7YA 4DXAB 4ANVA 2JVCA 1NI2A 2FUHB 2LXAA 1YJ1A 3APCA 1TGZB 3PRZA 1WIAA 2G45B 1WE6A 2O6VB 2DZIA 4EZLA 4M8NA 3KUCB 1RAXA 3DVNU 2NBWB 2D2QA 3OLMD 3PPAA 2L3ZA 3ONSA 4MGKE 1X1MA 1J8CA 5E6NA 1ZKHA 2L05A 4ZDVA 3HK0A 4AP4C 2BYEA 4EOYA 2PJHA 2D07B 2LRUA 4MM3A 1OEYA 3IHPC 5D2MB 1AARA 4GOCA
chains in the Genus database with same CATH superfamily
4RGOS 3AEFB 2Y5CA 2O2VB 4M00A 3HHMA 2AL6A 3KYDD 1EUVB 1ZOYB 3P4PB 1NVID 4OZAA 4YXDB 3Q8FA 3V60A 3VH3B 4URKA 1EU4A 1OGWA 2BS2B 4IDIA 4NNJB 4EE2A 2INDC 2WXJA 1WJNA 1SE2A 1WX9A 5IP4D 3IT4B 3AV8A 3ZQ4A 4MDKE 2ZW0A 5AZFA 1WWTA 4GSWA 2YVCA 2KD0A 1ZW7A 2LVQA 2W3RA 1XLPA 2JYEA 2KOXA 3MP9A 3SDLC 1QKZA 2QIEB 4ACFA 3W2DA 3ZLZA 2LXCA 2QILA 3QAQA 3R7RA 3SFEB 1MHHE 1YJJA 4BVUC 2JWZA 1QT9A 1WJ6A 2WXHA 3QARA 3L13A 2KX3A 3A33B 1D5MC 2X8XX 2KKCA 1UF0A 1FNVA 4GGQA 3N1XC 2VH1A 2JF5A 4M0WA 2G4SA 2ZCCA 1E8ZA 1GB4A 3SHQA 3AB5A 4BKTA 1IBXB 1GG3A 2NVUI 1WZ0A 5C2TB 1Z5SB 1L6VA 2HTHA 3K9PB 5BMGA 4GB9A 1KTKA 4WH4A 4NQLB 1P1AA 5L95C 1P0RA 3U7DA 4FHJA 2AL3A 2RGFA 2MBEA 3DPDA 3NVYA 3I9V1 4LLGM 4XWWA 1FXTB 4KKIA 1T0YA 4YTMB 2LD9A 4ARIA 3U7ZA 3DVGY 2BW2A 2WDQB 3HVZA 4LNIA 1WGHA 2INPE 4MSMB 3AEEB 3WIMA 1WE7A 4AUQC 1MI0A 2GMIC 1WI0A 2DYBA 2DYMA 1A70A 4A6QA 3N32A 5KHOA 3X23A 2GRIA 4HDOA 4BBNC 3DBRB 1HZ5A 1PGBA 2FIDA 3AE6B 3WAOA 4K7SA 1FCLA 5J18A 3JW0X 1D4BA 1WRDB 3HM3A 4LCDE 5AEKB 2NBUA 4K1RB 5IA7A 2NTSA 2K5PA 2SAKA 2AQ1B 3Q8AA 2EMSA 3EFUA 2MRPA 2ICIA 1Y8RC 4RM9A 2W82A 4KSLC 4Q2JA 2O6VD 5JHBA 1WH3A 3WAMA 3WAPA 1HEZE 2C7NB 1YQBA 1ACCA 3O65B 4FBJB 3PZ7A 5EE9A 3WANA 1VR9A 2CR5A 5E6PA 2ZZPB 2ZNVC 1OQYA 2K1FA 3Q69A 2WXLA 1BT0A 4N6EB 1V97A 4YWGG 3FILA 4BBNF 2KVRA 3KUDB 4M0WB 4NAWB 2EELA 2JRHA 1S1QB 3HUIA 1TS3A 2LGXA 2RDBC 2LGYA 2FBWB 4WJQA 5KHQA 2KTFA 1WXAA 5FR6A 2CU3A 3IAM1 1RFKA 4WJNA 4YTNB 2DAFA 3PSEB 4TSSA 2JXTA 4OZCA 4C00A 3RD2A 1I7HA 1JMLA 4E74A 2JUOA 2GBJA 2JWUA 2W55A 5EDSA 1XEEA 2WU5B 2DZKA 3L54A 1TY0A 3RI7C 4DK5A 4ZRIA 1N60A 4EZKA 3EECA 3T8MA 3QCAA 4IC7B 3BYYB 2D3BA 1J0GA 1XLOA 5DPSA 4LDTD 4C7YA 2J7QB 2WXNA 2ON8A 2VZKD 1TS5A 3H7SA 2CHZA 2DNFA 3PRMB 3URYA 1QOAA 3MHZA 4W9IA 2PVGC 1SJED 2M1MA 2OJRA 3SR6A 4P1CC 2M0AA 1WXVA 3N3KB 4KX6B 2B3AA 1I4RA 1JW9D 2KLGA 4RGMA 1I4HA 1E0ZA 4K3CA 4C4VB 3W1SC 2KT7A 1MVKA 2KDBA 2Y3AA 1VDVA 3UGBB 1TIFA 4RF0A 2N4FA 2ONQA 1FNWA 3QC8B 1JWSD 2RMMA 3C19A 1SE4A 2QCZA 3FILB 1EWCA 3OWEB 4X57B 2LVOA 3R8BA 1C78A 2KTRA 5LNK1 3PTFC 1CJEA 2KK8A 5HKHA 1TJEA 2MP2A 2N9EB 4P1BC 3QHTA 5FKAC 2REXA 3L08A 2NR2A 2JSVX 3AE8B 4N58A 3QIJA 1ISNA 4ITKA 2ZW1A 2I1JA 3RULA 3JYUA 2N1VA 4WIPA 4IWPA 2GLSA 3LXFA 2KDFB 3TCAA 1VJKA 2HJ1A 4DDID 4AQ7A 3KUZA 2BF8B 1HTOA 2JQRB 2WS3B 3B2GA 3TEYA 5C23A 3PHXB 1PGXA 1BMLC 2KQ7A 2DAJA 3TBLD 3DBHB 1KLUD 3Q3OC 2YEPB 2K6QA 2JY6A 5IO9A 1IP9A 1C79A 4ZRKA 3ZW3A 1YX6B 4G50A 4WURA 4WWPA 1M4VA 4FA6A 3TSSA 3I57A 3DQVA 4W9HA 4MT5A 1OQRA 3APCA 1C76A 1WIAA 1E6EB 3OLMD 1TT5B 4HEA1 3PPAA 3NRZA 4ZDVA 2PVOD 4JPSA 4MM3B 2V3NA 5D2MB 3PZ8A 4UDUC 1E10A 3RNBC 1JRPA 3VTWA 1VZ6A 1T5XD 2MBHA 2IGGA 3CSTA 5DPTA 4HRSA 3P2BA 2LUMA 1CMXB 2LGSA 3BIID 3RFZB 1B1ZA 3RZFA 1WMHB 4FULA 3HM6X 2GBMA 5EE3A 4E3CA 4BAXA 1E7UA 1FPYA 2FCSA 3MJWA 4ICUA 4A9AA 4N9F4 1AYFA 2BWFA 3H6NA 3QJZA 3LDZE 1E8WA 2BTEA 2JZ3B 1E5WA 2Q5WD 4DHJB 2C7HA 3MTNB 2HD5B 2C7MB 1HTQA 3KYCD 1TZ1A 4E71A 2Y5BB 4AOFA 2JU6X 2KTRB 2PW9A 3A9KA 1QZEA 1WJ4A 4D2KA 4OVVA 1WF9A 2KANA 1SB3C 3OAWA 2DYOA 3IBEA 2MP2B 4YT0B 3SU8X 3V05A 1GNUA 2KFKA 1Z2MA 2WWZA 2W3SA 4MGYE 2CHWA 4KZCA 1JWMD 2ZPNA 4WJPA 3UQBA 3NVZA 1YIWA 2N7DA 1TKYA 4ICVA 3M95A 4I6LB 4RMAA 1C4PA 5FR3A 3GZNI 1RM6C 4G0NB 2FNJB 1FEHA 2VRRB 2CJOA 3BWUD 2PIAA 2K39A 1JWAD 4DBGA 3NS1A 1FD6A 3VTUA 4EKUA 2X38A 2OEDA 1WRIA 2C9WB 2W54A 4PT5A 1HE8A 3IVFA 2ZVOA 1DGJA 3EA6A 2LJIA 4PS3A 1K8RB 1RFAA 2RPVA 2Z0DB 4GU2A 3W5UB 2OHFA 1N63A 3MC9A 3IT6B 2D3CA 4TQ0A 1YN4A 1EF1A 1FMAD 1MJDA 2D3GA 4AJYB 2MA9B 3QA8A 3U8ZA 1FFUA 3ZTCA 2WU2B 1SE9A 4REZA 2KWVB 4KGTA 2IO1B 3GZNB 1SBBB 3PVLA 1QOGA 1RWSA 5LXIB 3KH0A 2NPTA 4DWFA 2XEWA 1V2YA 4KIKA 4JGHB 3L4PA 2MX2A 2KO3A 4OW0A 2IO3B 1DOXA 1JCKB 4WWMA 2MEKA 5D3IB 3GE3C 5MPOA 3ABVB 2FE8A 1DOYA 2J53A 1OTRB 4MACA 2K8CA 1C9FA 3A9KB 1WSPA 1XQQA 5JXVA 3C8YA 3PLUA 2M17A 1SXTA 2KFKB 3PV1A 3N1YC 4B0MA 4NY0A 1KM7A 2L76A 5C1ZA 3V61A 2OOBB 2QDFA 2DBYA 3U30A 1T0QC 1V1PB 5GMVA 4NAWA 3GS2A 2VH2A 1FM0D 3AEAB 1OQQA 5CTRC 1I4QA 1N5WA 1XLQA 3EGRA 1QQRA 2XNAC 1ZE3D 4CO7A 1QILA 3TJPA 1GUAB 3AN1A 1JWBD 5HFYA 1QOFA 2MSED 3VUYA 1PYWD 3FAHA 2GBRA 1JRUA 1ET6A 1UGMA 4EEWA 1WM3A 4N59A 5DPRA 3V3XA 5BO4B 4FHKA 2KWDA 3I5JC 2V0GA 4KZ0A 1LO5D 5HI1A 3PLVA 5TR5A 2XN9C 4HROA 1OFFA 1YJIA 2BKRB 2L8JA 1V81A 2G4DB 5J2RA 3R3MA 3VVWB 2A5UA 1YN3A 4W9KA 4GN1A 5LXHA 2ZVNA 4ZRJA 2R2OA 1TS4A 4W9EA 3TMPB 1VRAB 4GLSC 2V4IB 4S0RA 4US9A 2IY1B 4L1BA 4HJGE 2RR9A 4LTUA 2CS4A 1ZUD2 2PE9A 2HTME 3DHHC 2LHDA 3ZJUA 2WXGA 3GOEA 2MW5A 2NPTB 2QEJC 2N9KA 4FN2A 4KIKB 2KX0A 1Q10A 2V9HA 4K3BA 4DHZB 2ZEQA 3TL5A 2KJRA 3UQAA 4FJVB 1GOZA 3H9DA 2LHEA 2KYWA 1PDXA 5EE0A 1PUTA 4C4VA 3UF8A 3VTVA 1HZ6A 1VLBA 2FIFA 4LJPB 2BBCA 2UWQA 4XE0A 3TEWA 2ZCBA 1OEYJ 1EWYC 4IG7B 2MBBB 2PKOA 1ESFA 3AE2B 4HKQA 3P1MA 3VRBB 1T0SC 2L32A 2EKIA 1IGDA 1S3SG 2EKEC 2BS3B 2LJ5A 3RNAC 2K9XA 3H8HA 2JPHA 1KRHA 3H1UA 2KHWB 2K8BA 2FCNA 4TKNA 4RF1A 3X0WA 3NVWA 4TQ1A 3WALA 3A4RA 5JH5C 2BYTA 4EZJA 1R4NI 1C4AA 4GDLA 1R4MI 1XCTL 1A5RA 4NJCA 2BT6A 1L0VB 3JVZX 1VZ8A 2KLCA 3RPFC 4JL9A 3FKYA 3DHGC 4MGZE 1QF6A 1D6EC 5BYQA 3DCGA 4R3DA 5TSSA 3ZXRA 2M19A 1C77A 2AWTA 3TEXA 2KVZA 3ENEA 4JLCA 3BK1A 2QHOA 4B6WA 1P3QU 4OVUA 2XK5A 3OJ3A 4CQNA 3A1QA 3TIXA 1I4GA 3BINA 3KQ4A 5LLIA 1E9MA 1L7YA 4HPPA 4DXAB 2JVCA 2I38A 2LXAA 1J7AA 2G45B 1WE6A 4EZLA 2WGSA 4WAFA 1J8CA 1X1MA 3AE9B 2INNE 3HK0A 4AP4C 1HXYD 2QMTA 2PJHA 2LRUA 4MM3A 1OEYA 3IHPC 1L4ZB 3ZKJC 4JX1C 3VR9B 1R4NB 4GXBA 4A3PA 3R66C 5C3JB 2IPKD 1AN8A 2WNMA 1LFDA 1HQRD 4M8MA 2WXFA 4FJYA 1P7FA 1B9RA 1WMHA 2DHZA 2YLMA 3LYYA 3L0WB 1ROEA 2H88B 2N0SB 4HDQA 1QOBA 2I2YA 3TEZA 1EM7A 4MH8A 4EFOA 2G9HD 2M4NA 1I4PA 5D6JB 5IN7A 4RCOA 2INCC 4LNKA 4L2YA 4NQKE 4A3OA 3U4EG 4WWOA 3O13A 1TKGA 3HRDD 2PEAA 2BB5A 1J19A 1CK1A 2H89B 4WAAA 4ANXA 1BXTA 2MJ3A 5AZGA 1FIQA 5HHDG 2KFJA 4FADA 3P4QB 3HIZA 1J7BA 4JIOU 3AEGB 4OHJA 1YN5A 2LFIA 4ASWC 4ZYSA 1JWUD 3QX1A 2IBIB 3Q3MC 4GDLB 1SSNA 1LQBA 3L10B 3OG5A 4AWJA 1SE3A 1KLGD 1STEA 1CQVA 2N7EA 1YQ3B 1NYQA 3AU5A 2AQ2B 4XDDA 1UUPA 2WX1A 1IYFA 1UGJA 1L0YB 3DVNV 2D11A 4ZRQA 1EU3A 4FXCA 4B95A 2XK5B 3A9JA 3W5VB 4KV2A 3ZRFA 4IM3A 4EUTA 3A1QB 4P6VF 1V49A 2DZJA 5AUIA 3UIPB 5DPWA 1SIFA 3RNGC 3E56A 4USAA 5CHWA 1T0RC 1YX5B 2IDYA 4K81A 1N62A 1TKEA 2C60A 2PTLA 3W1SA 1FXAA 1I35A 4RGTA 3W9CB 3IXSA 5HG2A 2MWSB 1U4AA 1MHXA 2V3PA 2ZNVB 3ML8A 4QAYA 1UZXB 3P63A 2KAJA 3AMZA 1WR1A 1V6EA 1FFVA 3RYTA 1D3ZA 1N5XA 5DCNA 4BZAA 3PHWB 1N61A 3ZNGC 1Q0WB 2RPQA 1V5TA 2FCQA 4YL8A 1R7SA 2RD0A 3K9OB 3DBLI 4I6NB 4C56C 3NS8A 5JHAA 4JWUC 2WDRB 3B9JA 5BMHA 4LNFA 3C0RB 4TV3A 1ZXIA 2WP9B 3T9LA 4K7WA 2NMQA 4W9GA 3RZWC 3MC0B 2JZPA 1E7VA 2Z0EB 3ZUNA 2UYZB 2IYDB 2V4LA 4WQMA 4F8CB 2BWES 4JQWC 1L5PA 2Y5PA 1V1PA 3DWGC 2BYFA 2MBQA 1N6ZA 2L7RA 1FRRA 3P42A 4DHJD 4HCNB 3RNCC 1F9JA 3N30A 3EHVA 2BB6A 4BOZB 2FCMA 1SIJA 1NENB 1UD7A 3DDCB 4MJSA 5JZEB 2LI5A 3VUXA 2IGHA 5J17A 3APDA 2RDHA 3VDZA 4M01A 4PYUA 3A9JB 4AS1A 5L83A 3ZO5B 3BK2A 5G2NA 2PPHA 4LJOB 1I4XA 4YSXB 3RT3B 2AEHA 5D94A 3EFCA 2G3QB 1WGYA 5D7GA 2KN4A 3N20C 3HVDA 3Q2AC 1WXQA 4WWNA 3OJ4B 1XLNA 3VRAB 1ZPSA 2KQ4X 2WXKA 4A55A 2K25A 4W9FA 1P9DU 2KJ6A 1LM8B 3AM9A 3T3NA 1K53A 1PQSA 1VZ7A 1ENFA 2JT4B 1WX8A 2O6VA 3VUWA 1YOVB 3AE3B 4DHZE 1T3QA 4HPMB 3AXCA 3CSFA 3M3JA 3NVVA 2HE7A 2KMCA 2WX0A 4HLEA 1RLFA 1L6UA 1YMHE 4IUMB 3AU4A 2GB1A 2RDGA 1D5XC 3CWIA 3NZSA 2WHIA 4AJWA 3PO0A 3SEBA 3L16A 4CHKA 4HVBA 2DENB 2NS5A 1UWMA 4YSYB 3AE5B 2GOWA 4WJOA 4XYCA 5AZHA 1YQ4B 4XDCA 4XWTA 1H4RA 3ZJTA 5IOIA 4BKSA 3RNFC 3ZDMC 4J6IA 2J0KA 3VAWA 1GAQB 5CHFA 4YTPB 4NAMA 4IWQA 4IOIE 3ALBA 3Q8EA 3VQIA 2B76B 3NJTA 4A8XC 2WXRA 4NPNA 2N9LA 1QLBB 3NHEB 1ZP0B 3ECIA 4HK2A 2QJLA 2MJDA 3RUIB 2J52A 1G6JA 2JYTA 3NOBA 2W9NA 4ZHPA 1FNUA 4KDIC 1SJHD 4IM2A 2MBOA 1WZ3A 1KLVA 4XC2A 4MH0E 3Q8BA 3BVGA 3NG0A 1WJUA 1K52A 4MELA 1ET9A 4W9LA 3DHIC 4MJSB 3AE7B 3ZNZB 4DXGA 2N9XA 2L1AA 4KVGB 4HPLB 2SEBD 1F2RC 1T6BX 1FO4A 4RNAA 2ACZB 3DOWA 3PREA 4MEMA 1ZGUB 4B0EA 2BKFA 3AE1B 3DBRI 1WYWB 2NTTA 2R2QA 4JE3B 4S17A 3KLSX 5H8YE 2KWUB 3ZTDA 2BVCA 3CMMB 1GC6A 1ZXHA 4XZ4A 1WR6E 1NDDA 4OVZA 1C1YB 2KDIA 4HXDA 4DQOC 3NZ3A 3J9CA 4GIVA 2KN5A 2Z59B 3RCZA 3JSVA 3U2SC 3R2TA 1NI2A 4L23A 1JROA 1YJ1A 5AUKA 1TGZB 2O6VB 2DZIA 1K51A 3KUCB 4YSZB 1RAXA 3DVNU 2NBWB 2D2QA 2OJWA 5T8IA 2L3ZA 4MGKE 5E6NA 5EE1A 2BYEA 1PGAA 2D07B 2IGDA 4ZHOA 4GOCA 4G3XB 2J4XA 2R61A 3B0AA 2KXJA 2NBVB 1DYQA 2BYVE 4FJZA 2L83A 3IAS1 4IW0A 5G5GA 5G55A 4IKGA 5I4DA 1LGRA 1WGKA 1V5OA 4KDLB 2IY0B 1TBEA 1WXSA 1I42A 1GJZA 4P16A 4CYEA 4HCPB 3L17A 5FK9C 2K3UA 1MPEA 2CU1A 5GXGB 2ZPYA 3ZIMA 4ARCA 3VR8B 1Q5WB 2KMAA 1NBFC 3P4SB 5BMIA 2N9PC 4KGSA 1FXIA 1MFWA 1F77A 2WXMA 2DX5B 4I6PA 4MGIE 3VHTC 1NI3A 2K6DB 4IWOA 1XF5L 4BFRA 3ZXVA 1SF0A 3PGEA 2YEPF 2WXQA 1GB1A 3ZGZA 3EC8A 3H7PA 4NJ6A 1XT9B 2J42A 3FC4A 2QC8A 2I1KA 3ZNID 3IG3A 1XO3A 3R7QA 1JQ4A 1P98A 1UBQA 4DDGD 2CJNA 3R2IA 1E90A 3V6EB 3AI5A 3CF6E 2ZJDA 3VH4B 2N7JA 2L00B 3N9YC 1TS2A 4TUUA 1C4CA 4B9KA 2BGFA 2WLBA 3GB1A 4BKSD 4LDTB 3TUOA 2BQQA 3MJ5A 4XX5A 2VZKB 1KJTA 3NY5A 3PS6A 3LB8C 3SFDB 3I3TB 3ZNHB 2GI9A 4K7UA 2CKHB 2EMTA 1IPGA 4LNNA 2L52A 3A4SC 2KMMA 4PS7A 2KNBA 4HWIB 3M62B 3JSVB 3ETRA 3Q3NC 3N1ZC 3ML9A 1E7PB 4A20A 3ZVVA 1F2RI 2NCNA 4DXFA 4PS8A 3M63B 2GBKA 2KJHB 4GDKA 4C7ZA 1ZDVA 1WY8A 2LMCA 2IO2B 3VXWA 1SGHA 3AULA 1J7CA 2A4ZA 1R4MB 4HKZE 1L2NA 2V3SA 1F52A 2CHXA 2MCNB 4XGAB 3Q8CA 2MQJA 2WDTB 3Q3FA 1KOTA 2JRIB 1E8XA 3VFKA 2KC1A 3UIOB 2D10A 1VD2A 4P7IA 4M02A 2MH7A 2HJ8A 2KDEB 4IM0A 1YD8U 2LGDA 5BYRA 4ANWA 2M56B 1P7EA 3DBSA 1UBIA 1M94A 3RMKC 3ZDTA 1D5ZC 2PE6B 2DZMA 3AEDB 1AW7A 1IGCA 2K8HA 1MG8A 3DBHI 1CZPA 3CIRB 4RFBA 2AX5A 4KSKC 2WXPA 4LK0M 3APFA 1FCCC 3H7PB 3S2AA 2D5GA 2DWQA 2LWPA 2BS4B 3B08A 1GC7A 4II2B 5CX3A 2WDVB 4HJKA 2L0TA 4GMVA 3NZUA 1AWDA 1UELA 3UINB 3ZYYX 1EF5A 3KVFB 5BYSA 4PYZA 1H8CA 2PMVA 3IFWB 4TMAB 4RGNA 2ASQA 4JWSC 3B2FA 3LJ3A 4RM8A 2LEKA 1V86A 1KFYB 4ZRPA 1L4DB 1F1HA 4FLHA 3P4RB 2AYOB 2MJEA 2K22A 2LUEA 2V1YA 4KKJA 2KACA 2E6XA 3Q6BA 2WQYB 4H2AA 4OZBA 2HDEA 1PFDA 2PLPA 1UNSA 3AECB 1YNTE 4G11A 3EUB2 3KW5B 5G5HA 2FUG1 2L0FA 3MHSD 1DOIA 3WA0A 3GP7A 3DVGX 1KF6B 2M0XA 4ANUA 1WXMA 3RNEC 3ZRCA 2LASA 3PRPB 4GDKB 3KWLA 4F7ZA 4KGRA 1WX7A 3QK0A 4BOSC 2UU7A 1K50A 1V1OA 2WYQA 1VCBA 1WGRA 2C5LC 1ZDXA 3QQ8B 4RH6A 5E6OA 1XXGA 3V62A 3AEBB 2QSDA 2JZZA 1TZOA 1Q1OA 1V80A 2O2VA 3NUHB 3V6CB 2LGIA 2N1WA 3AE4B 2IO0B 3RN9C 2FAZA 2J0MA 1Y56A 2LVPA 2RSUA 4J3OD 4II3B 2KZRA 2KWCA 4W9JA 2LRWA 4O1NA 2K0PA 2JX5A 1BUIC 3B1LX 1FRDA 3W1YA 2WXOA 4NJ7A 3UI3A 3DWMA 5CHVC 1XCQL 2AQ3B 1IUEA 1TTNA 1XD3B 3PZDA 1WFYA 3Q14C 2IZVB 2XBBC 1MG4A 2WXIA 1HA5A 3D32A 4A90A 3BYTB 1NEKB 1WM2A 5IAAC 2KC2A 1NYRA 4BKGA 3ZJVA 1WYGA 2GBNA 3MC8A 4WQOB 1WGGA 3KWVA 1RRBA 1L0XB 2D3AA 1V8CA 4ZYNA 4W9CA 2MLBA 3BY4B 1TYGB 1WGDA 1E8YA 3PT2B 1GPXA 3DBLB 1V9JA 3GE8C 2E3TA 1UH6A 1LXDA 2JXXA 2Z8LA 1EO6A 2IJ0A 3E9SA 1IBXA 3Q3JA 4C80A 1UWXA 3I63C 2BPSA 2KQSA 3AH7A 3BVMA 2LZ6A 5D3DA 3BVZA 5H92C 3MFGA 3BZDB 3U52E 4LNOA 3SD5A 2J0JA 3WCQA 1JALA 4F1SA 4MSQB 1KH0A 1TY2A 1RYJA 2KDMA 1C3TA 2M8SA 4PK1A 2DLBA 3QWZB 4W9DA 1F0ZA 4ANVA 5E6JA 2FUHB 1SEBD 3PRZA 5IKCM 4US8A 2TSSA 4M8NA 4NZLB 2MHJA 2G1EA 3ONSA 1ZKHA 2L05A 4EOYA 4ZOHC 1AARA 3T3OA
chains in the Genus database with same CATH topology
4G3XB 3B0AA 4GXBA 2KXJA 4A3PA 2NBVB 3R66C 2BYVE 2O2VB 4FJZA 4IW0A 5G55A 3HHMA 3VTWA 2MBHA 3CSTA 1LFDA 5DPTA 3P2BA 2AL6A 1V5OA 3KYDD 4M8MA 4KDLB 1EUVB 4FJYA 1CMXB 2IY0B 3RZFA 1TBEA 1WMHB 1WMHA 3HM6X 2DHZA 2GBMA 2YLMA 4FULA 3V60A 3VH3B 1WXSA 4URKA 3L0WB 1I42A 1GJZA 1OGWA 4CYEA 4HCPB 4E3CA 3L17A 4HDQA 2CU1A 4NNJB 1E7UA 2FCSA 3MJWA 2ZPYA 4ICUA 4EFOA 4N9F4 2BWFA 3H6NA 2M4NA 3ZIMA 5D6JB 1WJNA 3QJZA 1Q5WB 1WX9A 1E8WA 1NBFC 2KMAA 3LDZE 2JZ3B 1E5WA 2N9PC 4DHJB 2C7HA 3MTNB 4NQKE 4A3OA 2HD5B 2C7MB 4WWOA 4MDKE 2DX5B 4I6PA 4MGIE 5AZFA 3VHTC 2K6DB 3KYCD 1TZ1A 2PEAA 4GSWA 4IWOA 2Y5BB 1J19A 4AOFA 2YVCA 2KD0A 4E71A 4WAAA 4ANXA 1ZW7A 2LVQA 4BFRA 5AZGA 3PGEA 2KTRB 3A9KA 2KFJA 1QZEA 4FADA 3HIZA 1WJ4A 4OVVA 3EC8A 2KOXA 1WF9A 3H7PA 3SDLC 4NJ6A 1XT9B 2KANA 4JIOU 2I1KA 3ZLZA 3ZNID 2LXCA 3IG3A 3OAWA 3QAQA 2DYOA 3R7RA 3IBEA 3R7QA 2MP2B 4ASWC 4BVUC 1P98A 2JWZA 1UBQA 1WJ6A 3QX1A 3SU8X 4DDGD 3QARA 1GNUA 2KFKA 1Z2MA 2IBIB 2WWZA 3L13A 2KX3A 3A33B 4MGYE 2CHWA 4KZCA 2ZPNA 1E90A 4GDLB 4WJPA 3UQBA 2KKCA 3V6EB 1LQBA 3AI5A 3CF6E 1YIWA 3L10B 4GGQA 2N7DA 2ZJDA 4AWJA 2JF5A 4ICVA 2G4SA 3M95A 3VH4B 4I6LB 2L00B 2N7EA 2ZCCA 4RMAA 4TUUA 4B9KA 2BGFA 1E8ZA 4BKSD 3GZNI 4LDTB 4G0NB 3SHQA 4BKTA 2FNJB 2VRRB 3AU5A 4XX5A 1GG3A 2NVUI 1WZ0A 1Z5SB 2HTHA 3K9PB 4GB9A 2WX1A 2K39A 1KJTA 1IYFA 4DBGA 3NY5A 3PS6A 3DVNV 2D11A 4NQLB 3VTUA 4EKUA 1P1AA 5L95C 1P0RA 3I3TB 3ZNHB 3U7DA 4FHJA 2AL3A 4B95A 2XK5B 2C9WB 2CKHB 2RGFA 2EMTA 1IPGA 3A9JA 4K7UA 4KV2A 3ZRFA 3A4SC 2MBEA 4PS7A 1HE8A 2KNBA 4HWIB 4IM3A 3DPDA 4EUTA 3A1QB 3M62B 3IVFA 2ZVOA 3JSVB 4PS3A 1K8RB 1FXTB 1V49A 2DZJA 1RFAA 1T0YA 3UIPB 3ML9A 5DPWA 2LD9A 1SIFA 4A20A 2Z0DB 3ZVVA 4GU2A 5CHWA 3DVGY 2NCNA 1YX5B 1WGHA 4K81A 4PS8A 3M63B 2GBKA 2KJHB 4GDKA 4MSMB 3WIMA 1WY8A 1WE7A 4AUQC 2C60A 2GMIC 4TQ0A 2IO2B 3VXWA 1SGHA 3AULA 3W1SA 1EF1A 2A4ZA 1WI0A 2DYBA 1I35A 2D3GA 2DYMA 3N32A 4AJYB 2MA9B 1L2NA 2MWSB 1U4AA 3QA8A 2V3SA 3U8ZA 2CHXA 2MCNB 2ZNVB 3ML8A 1UZXB 2MQJA 2WDTB 3Q3FA 1KOTA 3ZTCA 2JRIB 1SE9A 1WR1A 1E8XA 5KHOA 2KWVB 1V6EA 3VFKA 3X23A 2KC1A 2IO1B 3RYTA 3PVLA 4HDOA 3UIOB 1D3ZA 4BBNC 3WAOA 2FIDA 2D10A 1VD2A 4K7SA 4P7IA 5LXIB 5DCNA 3JW0X 5J18A 3KH0A 2NPTA 1WRDB 3HM3A 3PHWB 4LCDE 4DWFA 5AEKB 2XEWA 1V2YA 2NBUA 4KIKA 4K1RB 4JGHB 5IA7A 3ZNGC 1Q0WB 2HJ8A 2KO3A 2MX2A 2RPQA 1V5TA 2KDEB 4IM0A 2FCQA 4YL8A 1YD8U 2IO3B 2RD0A 3K9OB 2LGDA 2EMSA 3DBLI 3EFUA 2MRPA 4I6NB 4ANWA 1Y8RC 4RM9A 3DBSA 1UBIA 4KSLC 1M94A 2O6VD 3ZDTA 5JHBA 2PE6B 1WH3A 2DZMA 3NS8A 1OTRB 3WAMA 5JHAA 3WAPA 2C7NB 2K8HA 1YQBA 3C0RB 4TV3A 1MG8A 3DBHI 2K8CA 3O65B 4FBJB 3A9KB 3WANA 2CR5A 3T9LA 4KSKC 5E6PA 1XQQA 3APFA 3H7PB 2ZZPB 4K7WA 2ZNVC 1OQYA 4W9GA 3PLUA 3S2AA 2K1FA 1BT0A 3RZWC 2M17A 2LWPA 3B08A 1E7VA 2Z0EB 4BBNF 3ZUNA 1GC7A 2UYZB 4II2B 2KFKB 2IYDB 5CX3A 2KVRA 2V4LA 3PV1A 4F8CB 2BWES 4HJKA 2L0TA 4GMVA 3NZUA 4NY0A 1UELA 3KUDB 1KM7A 3UINB 2L76A 1EF5A 5C1ZA 3V61A 2OOBB 4JQWC 3U30A 3KVFB 4PYZA 1H8CA 4M0WB 2BYFA 4NAWB 5GMVA 4NAWA 2MBQA 3IFWB 2JRHA 2ASQA 2L7RA 1S1QB 5CTRC 3LJ3A 4DHJD 4HCNB 4RM8A 1V86A 1F9JA 2LGXA 3N30A 3EHVA 4CO7A 4BOZB 3TJPA 1GUAB 2FCMA 4FLHA 5JZEB 1UD7A 3DDCB 4MJSA 2AYOB 2LI5A 3VUXA 2MSED 3ZKJC 2LUEA 5J17A 3VUYA 2LGYA 2V1YA 2GBRA 1JRUA 3APDA 4WJQA 4PYUA 3VDZA 5KHQA 1UGMA 2KTFA 3A9JB 4EEWA 1WXAA 5FR6A 5L83A 1WM3A 3ZO5B 5G2NA 2PPHA 4LJOB 5DPRA 4WJNA 2DAFA 5BO4B 3PSEB 4FHKA 3RT3B 2AEHA 4G11A 5D94A 3KW5B 4KZ0A 2G3QB 1WGYA 3PLVA 5D7GA 5TR5A 3RD2A 4E74A 2L0FA 3MHSD 2JUOA 3WA0A 2GBJA 4WWNA 5EDSA 3OJ4B 3DVGX 2BKRB 2M0XA 2L8JA 1V81A 2G4DB 4ANUA 3R3MA 3VVWB 1WXMA 2DZKA 3L54A 3ZRCA 4DK5A 2K25A 2LASA 3PRPB 4GDKB 2A5UA 4W9KA 4W9FA 1P9DU 4GN1A 4ZRIA 2KJ6A 1LM8B 4EZKA 5LXHA 2ZVNA 3EECA 4F7ZA 4ZRJA 2R2OA 3QCAA 3T8MA 1WX7A 3QK0A 4IC7B 4W9EA 4BOSC 3TMPB 1J0GA 1PQSA 5DPSA 2JT4B 4LDTD 1WX8A 2J7QB 2IY1B 2O6VA 3VUWA 2WYQA 4DHZE 1VCBA 4HPMB 1WGRA 3AXCA 3CSFA 2RR9A 2CS4A 2C5LC 3M3JA 3QQ8B 2PE9A 3H7SA 2CHZA 2HE7A 2KMCA 2WX0A 5E6OA 4HLEA 3V62A 1RLFA 4IUMB 2JZZA 3GOEA 2MW5A 3PRMB 3AU4A 2NPTB 1Q1OA 1V80A 3NZSA 4FN2A 4KIKB 4W9IA 2O2VA 4AJWA 2KX0A 3L16A 4CHKA 4HVBA 2DENB 4DHZB 5J2RA 2M1MA 2ZEQA 3TL5A 2NS5A 2KJRA 3V6CB 3UQAA 2N1WA 2OJRA 2IO0B 2FAZA 1WXVA 2J0MA 3N3KB 4FJVB 2B3AA 2GOWA 3H9DA 4WJOA 5AZHA 2KLGA 1H4RA 2LVPA 2RSUA 3UF8A 3VTVA 3W1SC 4II3B 2KDBA 3UGBB 2FIFA 2KZRA 4LJPB 4BKSA 2KWCA 4W9JA 2LRWA 2N4FA 2UWQA 4J6IA 3ZDMC 2J0KA 2ZCBA 1OEYJ 3VAWA 3B1LX 4IG7B 2MBBB 3W1YA 3QC8B 4NJ7A 5CHFA 5CHVC 1S3SG 4IWQA 3ALBA 2EKEC 3VQIA 2LJ5A 1TTNA 1XD3B 3PZDA 1WFYA 2JPHA 4NPNA 4X57B 2LVOA 2IZVB 2XBBC 3H1UA 2KHWB 2KTRA 3NHEB 3D32A 2K8BA 3ECIA 4HK2A 2FCNA 4TKNA 3PTFC 3RUIB 1WM2A 2KK8A 1G6JA 5IAAC 2KC2A 3NOBA 2W9NA 5HKHA 4KDIC 4BKGA 4IM2A 2MP2A 3X0WA 2N9EB 2MBOA 1WZ3A 2GBNA 1KLVA 3QHTA 4TQ1A 4XC2A 4MH0E 3WALA 4WQOB 2REXA 3A4RA 5JH5C 1WGGA 3L08A 2NR2A 4EZJA 1RRBA 1R4NI 1WJUA 4MELA 4GDLA 3QIJA 1ISNA 1R4MI 4W9LA 4MJSB 1A5RA 2I1JA 3RULA 4ZYNA 3ZNZB 2N9XA 3JVZX 3JYUA 2N1VA 4KVGB 4IWPA 2MLBA 3BY4B 4W9CA 2KLCA 2KDFB 4HPLB 3TCAA 1WGDA 3PT2B 1E8YA 4JL9A 4DDID 3KUZA 2BF8B 1V9JA 3DOWA 1UH6A 3PREA 4MEMA 1ZGUB 1LXDA 2BKFA 2JXXA 4MGZE 3DBRI 1WYWB 5C23A 3PHXB 2R2QA 1EO6A 2KWUB 3ZTDA 3Q3JA 2KQ7A 3DCGA 2DAJA 3TBLD 2BPSA 3CMMB 1GC6A 2KQSA 2AWTA 2K6QA 2JY6A 2LZ6A 4XZ4A 1IP9A 3ENEA 1WR6E 4JLCA 4ZRKA 3ZW3A 1NDDA 1YX6B 2QHOA 4B6WA 1P3QU 4OVUA 3SD5A 4G50A 2XK5A 4WWPA 3OJ3A 2J0JA 4FA6A 1C1YB 2KDIA 3DQVA 4HXDA 4MSQB 4F1SA 4GIVA 3A1QA 2M8SA 2KN5A 3BINA 3TIXA 1C3TA 2Z59B 3QWZB 4W9HA 4W9DA 5LLIA 3JSVA 3RCZA 1L7YA 4DXAB 4ANVA 2JVCA 1NI2A 2FUHB 2LXAA 1YJ1A 3APCA 1TGZB 3PRZA 1WIAA 2G45B 1WE6A 2O6VB 2DZIA 4EZLA 4M8NA 3KUCB 1RAXA 3DVNU 2NBWB 2D2QA 3OLMD 3PPAA 2L3ZA 3ONSA 4MGKE 1X1MA 1J8CA 5E6NA 1ZKHA 2L05A 4ZDVA 3HK0A 4AP4C 2BYEA 4EOYA 2PJHA 2D07B 2LRUA 4MM3A 1OEYA 3IHPC 5D2MB 1AARA 4GOCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4G3X B;  3B0A A;  4GXB A;  2KXJ A;  4A3P A;  2NBV B;  3R66 C;  2BYV E;  2O2V B;  4FJZ A;  4IW0 A;  5G55 A;  3HHM A;  3VTW A;  2MBH A;  3CST A;  1LFD A;  5DPT A;  3P2B A;  2AL6 A;  1V5O A;  3KYD D;  4M8M A;  4KDL B;  1EUV B;  4FJY A;  1CMX B;  2IY0 B;  3RZF A;  1TBE A;  1WMH B;  1WMH A;  3HM6 X;  2DHZ A;  2GBM A;  2YLM A;  4FUL A;  3V60 A;  3VH3 B;  1WXS A;  4URK A;  3L0W B;  1I42 A;  1GJZ A;  1OGW A;  4CYE A;  4HCP B;  4E3C A;  3L17 A;  4HDQ A;  2CU1 A;  4NNJ B;  1E7U A;  2FCS A;  3MJW A;  2ZPY A;  4ICU A;  4EFO A;  4N9F 4;  2BWF A;  3H6N A;  2M4N A;  3ZIM A;  5D6J B;  1WJN A;  3QJZ A;  1Q5W B;  1WX9 A;  1E8W A;  1NBF C;  2KMA A;  3LDZ E;  2JZ3 B;  1E5W A;  2N9P C;  4DHJ B;  2C7H A;  3MTN B;  4NQK E;  4A3O A;  2HD5 B;  2C7M B;  4WWO A;  4MDK E;  2DX5 B;  4I6P A;  4MGI E;  5AZF A;  3VHT C;  2K6D B;  3KYC D;  1TZ1 A;  2PEA A;  4GSW A;  4IWO A;  2Y5B B;  1J19 A;  4AOF A;  2YVC A;  2KD0 A;  4E71 A;  4WAA A;  4ANX A;  1ZW7 A;  2LVQ A;  4BFR A;  5AZG A;  3PGE A;  2KTR B;  3A9K A;  2KFJ A;  1QZE A;  4FAD A;  3HIZ A;  1WJ4 A;  4OVV A;  3EC8 A;  2KOX A;  1WF9 A;  3H7P A;  3SDL C;  4NJ6 A;  1XT9 B;  2KAN A;  4JIO U;  2I1K A;  3ZLZ A;  3ZNI D;  2LXC A;  3IG3 A;  3OAW A;  3QAQ A;  2DYO A;  3R7R A;  3IBE A;  3R7Q A;  2MP2 B;  4ASW C;  4BVU C;  1P98 A;  2JWZ A;  1UBQ A;  1WJ6 A;  3QX1 A;  3SU8 X;  4DDG D;  3QAR A;  1GNU A;  2KFK A;  1Z2M A;  2IBI B;  2WWZ A;  3L13 A;  2KX3 A;  3A33 B;  4MGY E;  2CHW A;  4KZC A;  2ZPN A;  1E90 A;  4GDL B;  4WJP A;  3UQB A;  2KKC A;  3V6E B;  1LQB A;  3AI5 A;  3CF6 E;  1YIW A;  3L10 B;  4GGQ A;  2N7D A;  2ZJD A;  4AWJ A;  2JF5 A;  4ICV A;  2G4S A;  3M95 A;  3VH4 B;  4I6L B;  2L00 B;  2N7E A;  2ZCC A;  4RMA A;  4TUU A;  4B9K A;  2BGF A;  1E8Z A;  4BKS D;  3GZN I;  4LDT B;  4G0N B;  3SHQ A;  4BKT A;  2FNJ B;  2VRR B;  3AU5 A;  4XX5 A;  1GG3 A;  2NVU I;  1WZ0 A;  1Z5S B;  2HTH A;  3K9P B;  4GB9 A;  2WX1 A;  2K39 A;  1KJT A;  1IYF A;  4DBG A;  3NY5 A;  3PS6 A;  3DVN V;  2D11 A;  4NQL B;  3VTU A;  4EKU A;  1P1A A;  5L95 C;  1P0R A;  3I3T B;  3ZNH B;  3U7D A;  4FHJ A;  2AL3 A;  4B95 A;  2XK5 B;  2C9W B;  2CKH B;  2RGF A;  2EMT A;  1IPG A;  3A9J A;  4K7U A;  4KV2 A;  3ZRF A;  3A4S C;  2MBE A;  4PS7 A;  1HE8 A;  2KNB A;  4HWI B;  4IM3 A;  3DPD A;  4EUT A;  3A1Q B;  3M62 B;  3IVF A;  2ZVO A;  3JSV B;  4PS3 A;  1K8R B;  1FXT B;  1V49 A;  2DZJ A;  1RFA A;  1T0Y A;  3UIP B;  3ML9 A;  5DPW A;  2LD9 A;  1SIF A;  4A20 A;  2Z0D B;  3ZVV A;  4GU2 A;  5CHW A;  3DVG Y;  2NCN A;  1YX5 B;  1WGH A;  4K81 A;  4PS8 A;  3M63 B;  2GBK A;  2KJH B;  4GDK A;  4MSM B;  3WIM A;  1WY8 A;  1WE7 A;  4AUQ C;  2C60 A;  2GMI C;  4TQ0 A;  2IO2 B;  3VXW A;  1SGH A;  3AUL A;  3W1S A;  1EF1 A;  2A4Z A;  1WI0 A;  2DYB A;  1I35 A;  2D3G A;  2DYM A;  3N32 A;  4AJY B;  2MA9 B;  1L2N A;  2MWS B;  1U4A A;  3QA8 A;  2V3S A;  3U8Z A;  2CHX A;  2MCN B;  2ZNV B;  3ML8 A;  1UZX B;  2MQJ A;  2WDT B;  3Q3F A;  1KOT A;  3ZTC A;  2JRI B;  1SE9 A;  1WR1 A;  1E8X A;  5KHO A;  2KWV B;  1V6E A;  3VFK A;  3X23 A;  2KC1 A;  2IO1 B;  3RYT A;  3PVL A;  4HDO A;  3UIO B;  1D3Z A;  4BBN C;  3WAO A;  2FID A;  2D10 A;  1VD2 A;  4K7S A;  4P7I A;  5LXI B;  5DCN A;  3JW0 X;  5J18 A;  3KH0 A;  2NPT A;  1WRD B;  3HM3 A;  3PHW B;  4LCD E;  4DWF A;  5AEK B;  2XEW A;  1V2Y A;  2NBU A;  4KIK A;  4K1R B;  4JGH B;  5IA7 A;  3ZNG C;  1Q0W B;  2HJ8 A;  2KO3 A;  2MX2 A;  2RPQ A;  1V5T A;  2KDE B;  4IM0 A;  2FCQ A;  4YL8 A;  1YD8 U;  2IO3 B;  2RD0 A;  3K9O B;  2LGD A;  2EMS A;  3DBL I;  3EFU A;  2MRP A;  4I6N B;  4ANW A;  1Y8R C;  4RM9 A;  3DBS A;  1UBI A;  4KSL C;  1M94 A;  2O6V D;  3ZDT A;  5JHB A;  2PE6 B;  1WH3 A;  2DZM A;  3NS8 A;  1OTR B;  3WAM A;  5JHA A;  3WAP A;  2C7N B;  2K8H A;  1YQB A;  3C0R B;  4TV3 A;  1MG8 A;  3DBH I;  2K8C A;  3O65 B;  4FBJ B;  3A9K B;  3WAN A;  2CR5 A;  3T9L A;  4KSK C;  5E6P A;  1XQQ A;  3APF A;  3H7P B;  2ZZP B;  4K7W A;  2ZNV C;  1OQY A;  4W9G A;  3PLU A;  3S2A A;  2K1F A;  1BT0 A;  3RZW C;  2M17 A;  2LWP A;  3B08 A;  1E7V A;  2Z0E B;  4BBN F;  3ZUN A;  1GC7 A;  2UYZ B;  4II2 B;  2KFK B;  2IYD B;  5CX3 A;  2KVR A;  2V4L A;  3PV1 A;  4F8C B;  2BWE S;  4HJK A;  2L0T A;  4GMV A;  3NZU A;  4NY0 A;  1UEL A;  3KUD B;  1KM7 A;  3UIN B;  2L76 A;  1EF5 A;  5C1Z A;  3V61 A;  2OOB B;  4JQW C;  3U30 A;  3KVF B;  4PYZ A;  1H8C A;  4M0W B;  2BYF A;  4NAW B;  5GMV A;  4NAW A;  2MBQ A;  3IFW B;  2JRH A;  2ASQ A;  2L7R A;  1S1Q B;  5CTR C;  3LJ3 A;  4DHJ D;  4HCN B;  4RM8 A;  1V86 A;  1F9J A;  2LGX A;  3N30 A;  3EHV A;  4CO7 A;  4BOZ B;  3TJP A;  1GUA B;  2FCM A;  4FLH A;  5JZE B;  1UD7 A;  3DDC B;  4MJS A;  2AYO B;  2LI5 A;  3VUX A;  2MSE D;  3ZKJ C;  2LUE A;  5J17 A;  3VUY A;  2LGY A;  2V1Y A;  2GBR A;  1JRU A;  3APD A;  4WJQ A;  4PYU A;  3VDZ A;  5KHQ A;  1UGM A;  2KTF A;  3A9J B;  4EEW A;  1WXA A;  5FR6 A;  5L83 A;  1WM3 A;  3ZO5 B;  5G2N A;  2PPH A;  4LJO B;  5DPR A;  4WJN A;  2DAF A;  5BO4 B;  3PSE B;  4FHK A;  3RT3 B;  2AEH A;  4G11 A;  5D94 A;  3KW5 B;  4KZ0 A;  2G3Q B;  1WGY A;  3PLV A;  5D7G A;  5TR5 A;  3RD2 A;  4E74 A;  2L0F A;  3MHS D;  2JUO A;  3WA0 A;  2GBJ A;  4WWN A;  5EDS A;  3OJ4 B;  3DVG X;  2BKR B;  2M0X A;  2L8J A;  1V81 A;  2G4D B;  4ANU A;  3R3M A;  3VVW B;  1WXM A;  2DZK A;  3L54 A;  3ZRC A;  4DK5 A;  2K25 A;  2LAS A;  3PRP B;  4GDK B;  2A5U A;  4W9K A;  4W9F A;  1P9D U;  4GN1 A;  4ZRI A;  2KJ6 A;  1LM8 B;  4EZK A;  5LXH A;  2ZVN A;  3EEC A;  4F7Z A;  4ZRJ A;  2R2O A;  3QCA A;  3T8M A;  1WX7 A;  3QK0 A;  4IC7 B;  4W9E A;  4BOS C;  3TMP B;  1J0G A;  1PQS A;  5DPS A;  2JT4 B;  4LDT D;  1WX8 A;  2J7Q B;  2IY1 B;  2O6V A;  3VUW A;  2WYQ A;  4DHZ E;  1VCB A;  4HPM B;  1WGR A;  3AXC A;  3CSF A;  2RR9 A;  2CS4 A;  2C5L C;  3M3J A;  3QQ8 B;  2PE9 A;  3H7S A;  2CHZ A;  2HE7 A;  2KMC A;  2WX0 A;  5E6O A;  4HLE A;  3V62 A;  1RLF A;  4IUM B;  2JZZ A;  3GOE A;  2MW5 A;  3PRM B;  3AU4 A;  2NPT B;  1Q1O A;  1V80 A;  3NZS A;  4FN2 A;  4KIK B;  4W9I A;  2O2V A;  4AJW A;  2KX0 A;  3L16 A;  4CHK A;  4HVB A;  2DEN B;  4DHZ B;  5J2R A;  2M1M A;  2ZEQ A;  3TL5 A;  2NS5 A;  2KJR A;  3V6C B;  3UQA A;  2N1W A;  2OJR A;  2IO0 B;  2FAZ A;  1WXV A;  2J0M A;  3N3K B;  4FJV B;  2B3A A;  2GOW A;  3H9D A;  4WJO A;  5AZH A;  2KLG A;  1H4R A;  2LVP A;  2RSU A;  3UF8 A;  3VTV A;  3W1S C;  4II3 B;  2KDB A;  3UGB B;  2FIF A;  2KZR A;  4LJP B;  4BKS A;  2KWC A;  4W9J A;  2LRW A;  2N4F A;  2UWQ A;  4J6I A;  3ZDM C;  2J0K A;  2ZCB A;  1OEY J;  3VAW A;  3B1L X;  4IG7 B;  2MBB B;  3W1Y A;  3QC8 B;  4NJ7 A;  5CHF A;  5CHV C;  1S3S G;  4IWQ A;  3ALB A;  2EKE C;  3VQI A;  2LJ5 A;  1TTN A;  1XD3 B;  3PZD A;  1WFY A;  2JPH A;  4NPN A;  4X57 B;  2LVO A;  2IZV B;  2XBB C;  3H1U A;  2KHW B;  2KTR A;  3NHE B;  3D32 A;  2K8B A;  3ECI A;  4HK2 A;  2FCN A;  4TKN A;  3PTF C;  3RUI B;  1WM2 A;  2KK8 A;  1G6J A;  5IAA C;  2KC2 A;  3NOB A;  2W9N A;  5HKH A;  4KDI C;  4BKG A;  4IM2 A;  2MP2 A;  3X0W A;  2N9E B;  2MBO A;  1WZ3 A;  2GBN A;  1KLV A;  3QHT A;  4TQ1 A;  4XC2 A;  4MH0 E;  3WAL A;  4WQO B;  2REX A;  3A4R A;  5JH5 C;  1WGG A;  3L08 A;  2NR2 A;  4EZJ A;  1RRB A;  1R4N I;  1WJU A;  4MEL A;  4GDL A;  3QIJ A;  1ISN A;  1R4M I;  4W9L A;  4MJS B;  1A5R A;  2I1J A;  3RUL A;  4ZYN A;  3ZNZ B;  2N9X A;  3JVZ X;  3JYU A;  2N1V A;  4KVG B;  4IWP A;  2MLB A;  3BY4 B;  4W9C A;  2KLC A;  2KDF B;  4HPL B;  3TCA A;  1WGD A;  3PT2 B;  1E8Y A;  4JL9 A;  4DDI D;  3KUZ A;  2BF8 B;  1V9J A;  3DOW A;  1UH6 A;  3PRE A;  4MEM A;  1ZGU B;  1LXD A;  2BKF A;  2JXX A;  4MGZ E;  3DBR I;  1WYW B;  5C23 A;  3PHX B;  2R2Q A;  1EO6 A;  2KWU B;  3ZTD A;  3Q3J A;  2KQ7 A;  3DCG A;  2DAJ A;  3TBL D;  2BPS A;  3CMM B;  1GC6 A;  2KQS A;  2AWT A;  2K6Q A;  2JY6 A;  2LZ6 A;  4XZ4 A;  1IP9 A;  3ENE A;  1WR6 E;  4JLC A;  4ZRK A;  3ZW3 A;  1NDD A;  1YX6 B;  2QHO A;  4B6W A;  1P3Q U;  4OVU A;  3SD5 A;  4G50 A;  2XK5 A;  4WWP A;  3OJ3 A;  2J0J A;  4FA6 A;  1C1Y B;  2KDI A;  3DQV A;  4HXD A;  4MSQ B;  4F1S A;  4GIV A;  3A1Q A;  2M8S A;  2KN5 A;  3BIN A;  3TIX A;  1C3T A;  2Z59 B;  3QWZ B;  4W9H A;  4W9D A;  5LLI A;  3JSV A;  3RCZ A;  1L7Y A;  4DXA B;  4ANV A;  2JVC A;  1NI2 A;  2FUH B;  2LXA A;  1YJ1 A;  3APC A;  1TGZ B;  3PRZ A;  1WIA A;  2G45 B;  1WE6 A;  2O6V B;  2DZI A;  4EZL A;  4M8N A;  3KUC B;  1RAX A;  3DVN U;  2NBW B;  2D2Q A;  3OLM D;  3PPA A;  2L3Z A;  3ONS A;  4MGK E;  1X1M A;  1J8C A;  5E6N A;  1ZKH A;  2L05 A;  4ZDV A;  3HK0 A;  4AP4 C;  2BYE A;  4EOY A;  2PJH A;  2D07 B;  2LRU A;  4MM3 A;  1OEY A;  3IHP C;  5D2M B;  1AAR A;  4GOC A; 
#chains in the Genus database with same CATH topology
 4RGO S;  3AEF B;  2Y5C A;  2O2V B;  4M00 A;  3HHM A;  2AL6 A;  3KYD D;  1EUV B;  1ZOY B;  3P4P B;  1NVI D;  4OZA A;  4YXD B;  3Q8F A;  3V60 A;  3VH3 B;  4URK A;  1EU4 A;  1OGW A;  2BS2 B;  4IDI A;  4NNJ B;  4EE2 A;  2IND C;  2WXJ A;  1WJN A;  1SE2 A;  1WX9 A;  5IP4 D;  3IT4 B;  3AV8 A;  3ZQ4 A;  4MDK E;  2ZW0 A;  5AZF A;  1WWT A;  4GSW A;  2YVC A;  2KD0 A;  1ZW7 A;  2LVQ A;  2W3R A;  1XLP A;  2JYE A;  2KOX A;  3MP9 A;  3SDL C;  1QKZ A;  2QIE B;  4ACF A;  3W2D A;  3ZLZ A;  2LXC A;  2QIL A;  3QAQ A;  3R7R A;  3SFE B;  1MHH E;  1YJJ A;  4BVU C;  2JWZ A;  1QT9 A;  1WJ6 A;  2WXH A;  3QAR A;  3L13 A;  2KX3 A;  3A33 B;  1D5M C;  2X8X X;  2KKC A;  1UF0 A;  1FNV A;  4GGQ A;  3N1X C;  2VH1 A;  2JF5 A;  4M0W A;  2G4S A;  2ZCC A;  1E8Z A;  1GB4 A;  3SHQ A;  3AB5 A;  4BKT A;  1IBX B;  1GG3 A;  2NVU I;  1WZ0 A;  5C2T B;  1Z5S B;  1L6V A;  2HTH A;  3K9P B;  5BMG A;  4GB9 A;  1KTK A;  4WH4 A;  4NQL B;  1P1A A;  5L95 C;  1P0R A;  3U7D A;  4FHJ A;  2AL3 A;  2RGF A;  2MBE A;  3DPD A;  3NVY A;  3I9V 1;  4LLG M;  4XWW A;  1FXT B;  4KKI A;  1T0Y A;  4YTM B;  2LD9 A;  4ARI A;  3U7Z A;  3DVG Y;  2BW2 A;  2WDQ B;  3HVZ A;  4LNI A;  1WGH A;  2INP E;  4MSM B;  3AEE B;  3WIM A;  1WE7 A;  4AUQ C;  1MI0 A;  2GMI C;  1WI0 A;  2DYB A;  2DYM A;  1A70 A;  4A6Q A;  3N32 A;  5KHO A;  3X23 A;  2GRI A;  4HDO A;  4BBN C;  3DBR B;  1HZ5 A;  1PGB A;  2FID A;  3AE6 B;  3WAO A;  4K7S A;  1FCL A;  5J18 A;  3JW0 X;  1D4B A;  1WRD B;  3HM3 A;  4LCD E;  5AEK B;  2NBU A;  4K1R B;  5IA7 A;  2NTS A;  2K5P A;  2SAK A;  2AQ1 B;  3Q8A A;  2EMS A;  3EFU A;  2MRP A;  2ICI A;  1Y8R C;  4RM9 A;  2W82 A;  4KSL C;  4Q2J A;  2O6V D;  5JHB A;  1WH3 A;  3WAM A;  3WAP A;  1HEZ E;  2C7N B;  1YQB A;  1ACC A;  3O65 B;  4FBJ B;  3PZ7 A;  5EE9 A;  3WAN A;  1VR9 A;  2CR5 A;  5E6P A;  2ZZP B;  2ZNV C;  1OQY A;  2K1F A;  3Q69 A;  2WXL A;  1BT0 A;  4N6E B;  1V97 A;  4YWG G;  3FIL A;  4BBN F;  2KVR A;  3KUD B;  4M0W B;  4NAW B;  2EEL A;  2JRH A;  1S1Q B;  3HUI A;  1TS3 A;  2LGX A;  2RDB C;  2LGY A;  2FBW B;  4WJQ A;  5KHQ A;  2KTF A;  1WXA A;  5FR6 A;  2CU3 A;  3IAM 1;  1RFK A;  4WJN A;  4YTN B;  2DAF A;  3PSE B;  4TSS A;  2JXT A;  4OZC A;  4C00 A;  3RD2 A;  1I7H A;  1JML A;  4E74 A;  2JUO A;  2GBJ A;  2JWU A;  2W55 A;  5EDS A;  1XEE A;  2WU5 B;  2DZK A;  3L54 A;  1TY0 A;  3RI7 C;  4DK5 A;  4ZRI A;  1N60 A;  4EZK A;  3EEC A;  3T8M A;  3QCA A;  4IC7 B;  3BYY B;  2D3B A;  1J0G A;  1XLO A;  5DPS A;  4LDT D;  4C7Y A;  2J7Q B;  2WXN A;  2ON8 A;  2VZK D;  1TS5 A;  3H7S A;  2CHZ A;  2DNF A;  3PRM B;  3URY A;  1QOA A;  3MHZ A;  4W9I A;  2PVG C;  1SJE D;  2M1M A;  2OJR A;  3SR6 A;  4P1C C;  2M0A A;  1WXV A;  3N3K B;  4KX6 B;  2B3A A;  1I4R A;  1JW9 D;  2KLG A;  4RGM A;  1I4H A;  1E0Z A;  4K3C A;  4C4V B;  3W1S C;  2KT7 A;  1MVK A;  2KDB A;  2Y3A A;  1VDV A;  3UGB B;  1TIF A;  4RF0 A;  2N4F A;  2ONQ A;  1FNW A;  3QC8 B;  1JWS D;  2RMM A;  3C19 A;  1SE4 A;  2QCZ A;  3FIL B;  1EWC A;  3OWE B;  4X57 B;  2LVO A;  3R8B A;  1C78 A;  2KTR A;  5LNK 1;  3PTF C;  1CJE A;  2KK8 A;  5HKH A;  1TJE A;  2MP2 A;  2N9E B;  4P1B C;  3QHT A;  5FKA C;  2REX A;  3L08 A;  2NR2 A;  2JSV X;  3AE8 B;  4N58 A;  3QIJ A;  1ISN A;  4ITK A;  2ZW1 A;  2I1J A;  3RUL A;  3JYU A;  2N1V A;  4WIP A;  4IWP A;  2GLS A;  3LXF A;  2KDF B;  3TCA A;  1VJK A;  2HJ1 A;  4DDI D;  4AQ7 A;  3KUZ A;  2BF8 B;  1HTO A;  2JQR B;  2WS3 B;  3B2G A;  3TEY A;  5C23 A;  3PHX B;  1PGX A;  1BML C;  2KQ7 A;  2DAJ A;  3TBL D;  3DBH B;  1KLU D;  3Q3O C;  2YEP B;  2K6Q A;  2JY6 A;  5IO9 A;  1IP9 A;  1C79 A;  4ZRK A;  3ZW3 A;  1YX6 B;  4G50 A;  4WUR A;  4WWP A;  1M4V A;  4FA6 A;  3TSS A;  3I57 A;  3DQV A;  4W9H A;  4MT5 A;  1OQR A;  3APC A;  1C76 A;  1WIA A;  1E6E B;  3OLM D;  1TT5 B;  4HEA 1;  3PPA A;  3NRZ A;  4ZDV A;  2PVO D;  4JPS A;  4MM3 B;  2V3N A;  5D2M B;  3PZ8 A;  4UDU C;  1E10 A;  3RNB C;  1JRP A;  3VTW A;  1VZ6 A;  1T5X D;  2MBH A;  2IGG A;  3CST A;  5DPT A;  4HRS A;  3P2B A;  2LUM A;  1CMX B;  2LGS A;  3BII D;  3RFZ B;  1B1Z A;  3RZF A;  1WMH B;  4FUL A;  3HM6 X;  2GBM A;  5EE3 A;  4E3C A;  4BAX A;  1E7U A;  1FPY A;  2FCS A;  3MJW A;  4ICU A;  4A9A A;  4N9F 4;  1AYF A;  2BWF A;  3H6N A;  3QJZ A;  3LDZ E;  1E8W A;  2BTE A;  2JZ3 B;  1E5W A;  2Q5W D;  4DHJ B;  2C7H A;  3MTN B;  2HD5 B;  2C7M B;  1HTQ A;  3KYC D;  1TZ1 A;  4E71 A;  2Y5B B;  4AOF A;  2JU6 X;  2KTR B;  2PW9 A;  3A9K A;  1QZE A;  1WJ4 A;  4D2K A;  4OVV A;  1WF9 A;  2KAN A;  1SB3 C;  3OAW A;  2DYO A;  3IBE A;  2MP2 B;  4YT0 B;  3SU8 X;  3V05 A;  1GNU A;  2KFK A;  1Z2M A;  2WWZ A;  2W3S A;  4MGY E;  2CHW A;  4KZC A;  1JWM D;  2ZPN A;  4WJP A;  3UQB A;  3NVZ A;  1YIW A;  2N7D A;  1TKY A;  4ICV A;  3M95 A;  4I6L B;  4RMA A;  1C4P A;  5FR3 A;  3GZN I;  1RM6 C;  4G0N B;  2FNJ B;  1FEH A;  2VRR B;  2CJO A;  3BWU D;  2PIA A;  2K39 A;  1JWA D;  4DBG A;  3NS1 A;  1FD6 A;  3VTU A;  4EKU A;  2X38 A;  2OED A;  1WRI A;  2C9W B;  2W54 A;  4PT5 A;  1HE8 A;  3IVF A;  2ZVO A;  1DGJ A;  3EA6 A;  2LJI A;  4PS3 A;  1K8R B;  1RFA A;  2RPV A;  2Z0D B;  4GU2 A;  3W5U B;  2OHF A;  1N63 A;  3MC9 A;  3IT6 B;  2D3C A;  4TQ0 A;  1YN4 A;  1EF1 A;  1FMA D;  1MJD A;  2D3G A;  4AJY B;  2MA9 B;  3QA8 A;  3U8Z A;  1FFU A;  3ZTC A;  2WU2 B;  1SE9 A;  4REZ A;  2KWV B;  4KGT A;  2IO1 B;  3GZN B;  1SBB B;  3PVL A;  1QOG A;  1RWS A;  5LXI B;  3KH0 A;  2NPT A;  4DWF A;  2XEW A;  1V2Y A;  4KIK A;  4JGH B;  3L4P A;  2MX2 A;  2KO3 A;  4OW0 A;  2IO3 B;  1DOX A;  1JCK B;  4WWM A;  2MEK A;  5D3I B;  3GE3 C;  5MPO A;  3ABV B;  2FE8 A;  1DOY A;  2J53 A;  1OTR B;  4MAC A;  2K8C A;  1C9F A;  3A9K B;  1WSP A;  1XQQ A;  5JXV A;  3C8Y A;  3PLU A;  2M17 A;  1SXT A;  2KFK B;  3PV1 A;  3N1Y C;  4B0M A;  4NY0 A;  1KM7 A;  2L76 A;  5C1Z A;  3V61 A;  2OOB B;  2QDF A;  2DBY A;  3U30 A;  1T0Q C;  1V1P B;  5GMV A;  4NAW A;  3GS2 A;  2VH2 A;  1FM0 D;  3AEA B;  1OQQ A;  5CTR C;  1I4Q A;  1N5W A;  1XLQ A;  3EGR A;  1QQR A;  2XNA C;  1ZE3 D;  4CO7 A;  1QIL A;  3TJP A;  1GUA B;  3AN1 A;  1JWB D;  5HFY A;  1QOF A;  2MSE D;  3VUY A;  1PYW D;  3FAH A;  2GBR A;  1JRU A;  1ET6 A;  1UGM A;  4EEW A;  1WM3 A;  4N59 A;  5DPR A;  3V3X A;  5BO4 B;  4FHK A;  2KWD A;  3I5J C;  2V0G A;  4KZ0 A;  1LO5 D;  5HI1 A;  3PLV A;  5TR5 A;  2XN9 C;  4HRO A;  1OFF A;  1YJI A;  2BKR B;  2L8J A;  1V81 A;  2G4D B;  5J2R A;  3R3M A;  3VVW B;  2A5U A;  1YN3 A;  4W9K A;  4GN1 A;  5LXH A;  2ZVN A;  4ZRJ A;  2R2O A;  1TS4 A;  4W9E A;  3TMP B;  1VRA B;  4GLS C;  2V4I B;  4S0R A;  4US9 A;  2IY1 B;  4L1B A;  4HJG E;  2RR9 A;  4LTU A;  2CS4 A;  1ZUD 2;  2PE9 A;  2HTM E;  3DHH C;  2LHD A;  3ZJU A;  2WXG A;  3GOE A;  2MW5 A;  2NPT B;  2QEJ C;  2N9K A;  4FN2 A;  4KIK B;  2KX0 A;  1Q10 A;  2V9H A;  4K3B A;  4DHZ B;  2ZEQ A;  3TL5 A;  2KJR A;  3UQA A;  4FJV B;  1GOZ A;  3H9D A;  2LHE A;  2KYW A;  1PDX A;  5EE0 A;  1PUT A;  4C4V A;  3UF8 A;  3VTV A;  1HZ6 A;  1VLB A;  2FIF A;  4LJP B;  2BBC A;  2UWQ A;  4XE0 A;  3TEW A;  2ZCB A;  1OEY J;  1EWY C;  4IG7 B;  2MBB B;  2PKO A;  1ESF A;  3AE2 B;  4HKQ A;  3P1M A;  3VRB B;  1T0S C;  2L32 A;  2EKI A;  1IGD A;  1S3S G;  2EKE C;  2BS3 B;  2LJ5 A;  3RNA C;  2K9X A;  3H8H A;  2JPH A;  1KRH A;  3H1U A;  2KHW B;  2K8B A;  2FCN A;  4TKN A;  4RF1 A;  3X0W A;  3NVW A;  4TQ1 A;  3WAL A;  3A4R A;  5JH5 C;  2BYT A;  4EZJ A;  1R4N I;  1C4A A;  4GDL A;  1R4M I;  1XCT L;  1A5R A;  4NJC A;  2BT6 A;  1L0V B;  3JVZ X;  1VZ8 A;  2KLC A;  3RPF C;  4JL9 A;  3FKY A;  3DHG C;  4MGZ E;  1QF6 A;  1D6E C;  5BYQ A;  3DCG A;  4R3D A;  5TSS A;  3ZXR A;  2M19 A;  1C77 A;  2AWT A;  3TEX A;  2KVZ A;  3ENE A;  4JLC A;  3BK1 A;  2QHO A;  4B6W A;  1P3Q U;  4OVU A;  2XK5 A;  3OJ3 A;  4CQN A;  3A1Q A;  3TIX A;  1I4G A;  3BIN A;  3KQ4 A;  5LLI A;  1E9M A;  1L7Y A;  4HPP A;  4DXA B;  2JVC A;  2I38 A;  2LXA A;  1J7A A;  2G45 B;  1WE6 A;  4EZL A;  2WGS A;  4WAF A;  1J8C A;  1X1M A;  3AE9 B;  2INN E;  3HK0 A;  4AP4 C;  1HXY D;  2QMT A;  2PJH A;  2LRU A;  4MM3 A;  1OEY A;  3IHP C;  1L4Z B;  3ZKJ C;  4JX1 C;  3VR9 B;  1R4N B;  4GXB A;  4A3P A;  3R66 C;  5C3J B;  2IPK D;  1AN8 A;  2WNM A;  1LFD A;  1HQR D;  4M8M A;  2WXF A;  4FJY A;  1P7F A;  1B9R A;  1WMH A;  2DHZ A;  2YLM A;  3LYY A;  3L0W B;  1ROE A;  2H88 B;  2N0S B;  4HDQ A;  1QOB A;  2I2Y A;  3TEZ A;  1EM7 A;  4MH8 A;  4EFO A;  2G9H D;  2M4N A;  1I4P A;  5D6J B;  5IN7 A;  4RCO A;  2INC C;  4LNK A;  4L2Y A;  4NQK E;  4A3O A;  3U4E G;  4WWO A;  3O13 A;  1TKG A;  3HRD D;  2PEA A;  2BB5 A;  1J19 A;  1CK1 A;  2H89 B;  4WAA A;  4ANX A;  1BXT A;  2MJ3 A;  5AZG A;  1FIQ A;  5HHD G;  2KFJ A;  4FAD A;  3P4Q B;  3HIZ A;  1J7B A;  4JIO U;  3AEG B;  4OHJ A;  1YN5 A;  2LFI A;  4ASW C;  4ZYS A;  1JWU D;  3QX1 A;  2IBI B;  3Q3M C;  4GDL B;  1SSN A;  1LQB A;  3L10 B;  3OG5 A;  4AWJ A;  1SE3 A;  1KLG D;  1STE A;  1CQV A;  2N7E A;  1YQ3 B;  1NYQ A;  3AU5 A;  2AQ2 B;  4XDD A;  1UUP A;  2WX1 A;  1IYF A;  1UGJ A;  1L0Y B;  3DVN V;  2D11 A;  4ZRQ A;  1EU3 A;  4FXC A;  4B95 A;  2XK5 B;  3A9J A;  3W5V B;  4KV2 A;  3ZRF A;  4IM3 A;  4EUT A;  3A1Q B;  4P6V F;  1V49 A;  2DZJ A;  5AUI A;  3UIP B;  5DPW A;  1SIF A;  3RNG C;  3E56 A;  4USA A;  5CHW A;  1T0R C;  1YX5 B;  2IDY A;  4K81 A;  1N62 A;  1TKE A;  2C60 A;  2PTL A;  3W1S A;  1FXA A;  1I35 A;  4RGT A;  3W9C B;  3IXS A;  5HG2 A;  2MWS B;  1U4A A;  1MHX A;  2V3P A;  2ZNV B;  3ML8 A;  4QAY A;  1UZX B;  3P63 A;  2KAJ A;  3AMZ A;  1WR1 A;  1V6E A;  1FFV A;  3RYT A;  1D3Z A;  1N5X A;  5DCN A;  4BZA A;  3PHW B;  1N61 A;  3ZNG C;  1Q0W B;  2RPQ A;  1V5T A;  2FCQ A;  4YL8 A;  1R7S A;  2RD0 A;  3K9O B;  3DBL I;  4I6N B;  4C56 C;  3NS8 A;  5JHA A;  4JWU C;  2WDR B;  3B9J A;  5BMH A;  4LNF A;  3C0R B;  4TV3 A;  1ZXI A;  2WP9 B;  3T9L A;  4K7W A;  2NMQ A;  4W9G A;  3RZW C;  3MC0 B;  2JZP A;  1E7V A;  2Z0E B;  3ZUN A;  2UYZ B;  2IYD B;  2V4L A;  4WQM A;  4F8C B;  2BWE S;  4JQW C;  1L5P A;  2Y5P A;  1V1P A;  3DWG C;  2BYF A;  2MBQ A;  1N6Z A;  2L7R A;  1FRR A;  3P42 A;  4DHJ D;  4HCN B;  3RNC C;  1F9J A;  3N30 A;  3EHV A;  2BB6 A;  4BOZ B;  2FCM A;  1SIJ A;  1NEN B;  1UD7 A;  3DDC B;  4MJS A;  5JZE B;  2LI5 A;  3VUX A;  2IGH A;  5J17 A;  3APD A;  2RDH A;  3VDZ A;  4M01 A;  4PYU A;  3A9J B;  4AS1 A;  5L83 A;  3ZO5 B;  3BK2 A;  5G2N A;  2PPH A;  4LJO B;  1I4X A;  4YSX B;  3RT3 B;  2AEH A;  5D94 A;  3EFC A;  2G3Q B;  1WGY A;  5D7G A;  2KN4 A;  3N20 C;  3HVD A;  3Q2A C;  1WXQ A;  4WWN A;  3OJ4 B;  1XLN A;  3VRA B;  1ZPS A;  2KQ4 X;  2WXK A;  4A55 A;  2K25 A;  4W9F A;  1P9D U;  2KJ6 A;  1LM8 B;  3AM9 A;  3T3N A;  1K53 A;  1PQS A;  1VZ7 A;  1ENF A;  2JT4 B;  1WX8 A;  2O6V A;  3VUW A;  1YOV B;  3AE3 B;  4DHZ E;  1T3Q A;  4HPM B;  3AXC A;  3CSF A;  3M3J A;  3NVV A;  2HE7 A;  2KMC A;  2WX0 A;  4HLE A;  1RLF A;  1L6U A;  1YMH E;  4IUM B;  3AU4 A;  2GB1 A;  2RDG A;  1D5X C;  3CWI A;  3NZS A;  2WHI A;  4AJW A;  3PO0 A;  3SEB A;  3L16 A;  4CHK A;  4HVB A;  2DEN B;  2NS5 A;  1UWM A;  4YSY B;  3AE5 B;  2GOW A;  4WJO A;  4XYC A;  5AZH A;  1YQ4 B;  4XDC A;  4XWT A;  1H4R A;  3ZJT A;  5IOI A;  4BKS A;  3RNF C;  3ZDM C;  4J6I A;  2J0K A;  3VAW A;  1GAQ B;  5CHF A;  4YTP B;  4NAM A;  4IWQ A;  4IOI E;  3ALB A;  3Q8E A;  3VQI A;  2B76 B;  3NJT A;  4A8X C;  2WXR A;  4NPN A;  2N9L A;  1QLB B;  3NHE B;  1ZP0 B;  3ECI A;  4HK2 A;  2QJL A;  2MJD A;  3RUI B;  2J52 A;  1G6J A;  2JYT A;  3NOB A;  2W9N A;  4ZHP A;  1FNU A;  4KDI C;  1SJH D;  4IM2 A;  2MBO A;  1WZ3 A;  1KLV A;  4XC2 A;  4MH0 E;  3Q8B A;  3BVG A;  3NG0 A;  1WJU A;  1K52 A;  4MEL A;  1ET9 A;  4W9L A;  3DHI C;  4MJS B;  3AE7 B;  3ZNZ B;  4DXG A;  2N9X A;  2L1A A;  4KVG B;  4HPL B;  2SEB D;  1F2R C;  1T6B X;  1FO4 A;  4RNA A;  2ACZ B;  3DOW A;  3PRE A;  4MEM A;  1ZGU B;  4B0E A;  2BKF A;  3AE1 B;  3DBR I;  1WYW B;  2NTT A;  2R2Q A;  4JE3 B;  4S17 A;  3KLS X;  5H8Y E;  2KWU B;  3ZTD A;  2BVC A;  3CMM B;  1GC6 A;  1ZXH A;  4XZ4 A;  1WR6 E;  1NDD A;  4OVZ A;  1C1Y B;  2KDI A;  4HXD A;  4DQO C;  3NZ3 A;  3J9C A;  4GIV A;  2KN5 A;  2Z59 B;  3RCZ A;  3JSV A;  3U2S C;  3R2T A;  1NI2 A;  4L23 A;  1JRO A;  1YJ1 A;  5AUK A;  1TGZ B;  2O6V B;  2DZI A;  1K51 A;  3KUC B;  4YSZ B;  1RAX A;  3DVN U;  2NBW B;  2D2Q A;  2OJW A;  5T8I A;  2L3Z A;  4MGK E;  5E6N A;  5EE1 A;  2BYE A;  1PGA A;  2D07 B;  2IGD A;  4ZHO A;  4GOC A;  4G3X B;  2J4X A;  2R61 A;  3B0A A;  2KXJ A;  2NBV B;  1DYQ A;  2BYV E;  4FJZ A;  2L83 A;  3IAS 1;  4IW0 A;  5G5G A;  5G55 A;  4IKG A;  5I4D A;  1LGR A;  1WGK A;  1V5O A;  4KDL B;  2IY0 B;  1TBE A;  1WXS A;  1I42 A;  1GJZ A;  4P16 A;  4CYE A;  4HCP B;  3L17 A;  5FK9 C;  2K3U A;  1MPE A;  2CU1 A;  5GXG B;  2ZPY A;  3ZIM A;  4ARC A;  3VR8 B;  1Q5W B;  2KMA A;  1NBF C;  3P4S B;  5BMI A;  2N9P C;  4KGS A;  1FXI A;  1MFW A;  1F77 A;  2WXM A;  2DX5 B;  4I6P A;  4MGI E;  3VHT C;  1NI3 A;  2K6D B;  4IWO A;  1XF5 L;  4BFR A;  3ZXV A;  1SF0 A;  3PGE A;  2YEP F;  2WXQ A;  1GB1 A;  3ZGZ A;  3EC8 A;  3H7P A;  4NJ6 A;  1XT9 B;  2J42 A;  3FC4 A;  2QC8 A;  2I1K A;  3ZNI D;  3IG3 A;  1XO3 A;  3R7Q A;  1JQ4 A;  1P98 A;  1UBQ A;  4DDG D;  2CJN A;  3R2I A;  1E90 A;  3V6E B;  3AI5 A;  3CF6 E;  2ZJD A;  3VH4 B;  2N7J A;  2L00 B;  3N9Y C;  1TS2 A;  4TUU A;  1C4C A;  4B9K A;  2BGF A;  2WLB A;  3GB1 A;  4BKS D;  4LDT B;  3TUO A;  2BQQ A;  3MJ5 A;  4XX5 A;  2VZK B;  1KJT A;  3NY5 A;  3PS6 A;  3LB8 C;  3SFD B;  3I3T B;  3ZNH B;  2GI9 A;  4K7U A;  2CKH B;  2EMT A;  1IPG A;  4LNN A;  2L52 A;  3A4S C;  2KMM A;  4PS7 A;  2KNB A;  4HWI B;  3M62 B;  3JSV B;  3ETR A;  3Q3N C;  3N1Z C;  3ML9 A;  1E7P B;  4A20 A;  3ZVV A;  1F2R I;  2NCN A;  4DXF A;  4PS8 A;  3M63 B;  2GBK A;  2KJH B;  4GDK A;  4C7Z A;  1ZDV A;  1WY8 A;  2LMC A;  2IO2 B;  3VXW A;  1SGH A;  3AUL A;  1J7C A;  2A4Z A;  1R4M B;  4HKZ E;  1L2N A;  2V3S A;  1F52 A;  2CHX A;  2MCN B;  4XGA B;  3Q8C A;  2MQJ A;  2WDT B;  3Q3F A;  1KOT A;  2JRI B;  1E8X A;  3VFK A;  2KC1 A;  3UIO B;  2D10 A;  1VD2 A;  4P7I A;  4M02 A;  2MH7 A;  2HJ8 A;  2KDE B;  4IM0 A;  1YD8 U;  2LGD A;  5BYR A;  4ANW A;  2M56 B;  1P7E A;  3DBS A;  1UBI A;  1M94 A;  3RMK C;  3ZDT A;  1D5Z C;  2PE6 B;  2DZM A;  3AED B;  1AW7 A;  1IGC A;  2K8H A;  1MG8 A;  3DBH I;  1CZP A;  3CIR B;  4RFB A;  2AX5 A;  4KSK C;  2WXP A;  4LK0 M;  3APF A;  1FCC C;  3H7P B;  3S2A A;  2D5G A;  2DWQ A;  2LWP A;  2BS4 B;  3B08 A;  1GC7 A;  4II2 B;  5CX3 A;  2WDV B;  4HJK A;  2L0T A;  4GMV A;  3NZU A;  1AWD A;  1UEL A;  3UIN B;  3ZYY X;  1EF5 A;  3KVF B;  5BYS A;  4PYZ A;  1H8C A;  2PMV A;  3IFW B;  4TMA B;  4RGN A;  2ASQ A;  4JWS C;  3B2F A;  3LJ3 A;  4RM8 A;  2LEK A;  1V86 A;  1KFY B;  4ZRP A;  1L4D B;  1F1H A;  4FLH A;  3P4R B;  2AYO B;  2MJE A;  2K22 A;  2LUE A;  2V1Y A;  4KKJ A;  2KAC A;  2E6X A;  3Q6B A;  2WQY B;  4H2A A;  4OZB A;  2HDE A;  1PFD A;  2PLP A;  1UNS A;  3AEC B;  1YNT E;  4G11 A;  3EUB 2;  3KW5 B;  5G5H A;  2FUG 1;  2L0F A;  3MHS D;  1DOI A;  3WA0 A;  3GP7 A;  3DVG X;  1KF6 B;  2M0X A;  4ANU A;  1WXM A;  3RNE C;  3ZRC A;  2LAS A;  3PRP B;  4GDK B;  3KWL A;  4F7Z A;  4KGR A;  1WX7 A;  3QK0 A;  4BOS C;  2UU7 A;  1K50 A;  1V1O A;  2WYQ A;  1VCB A;  1WGR A;  2C5L C;  1ZDX A;  3QQ8 B;  4RH6 A;  5E6O A;  1XXG A;  3V62 A;  3AEB B;  2QSD A;  2JZZ A;  1TZO A;  1Q1O A;  1V80 A;  2O2V A;  3NUH B;  3V6C B;  2LGI A;  2N1W A;  3AE4 B;  2IO0 B;  3RN9 C;  2FAZ A;  2J0M A;  1Y56 A;  2LVP A;  2RSU A;  4J3O D;  4II3 B;  2KZR A;  2KWC A;  4W9J A;  2LRW A;  4O1N A;  2K0P A;  2JX5 A;  1BUI C;  3B1L X;  1FRD A;  3W1Y A;  2WXO A;  4NJ7 A;  3UI3 A;  3DWM A;  5CHV C;  1XCQ L;  2AQ3 B;  1IUE A;  1TTN A;  1XD3 B;  3PZD A;  1WFY A;  3Q14 C;  2IZV B;  2XBB C;  1MG4 A;  2WXI A;  1HA5 A;  3D32 A;  4A90 A;  3BYT B;  1NEK B;  1WM2 A;  5IAA C;  2KC2 A;  1NYR A;  4BKG A;  3ZJV A;  1WYG A;  2GBN A;  3MC8 A;  4WQO B;  1WGG A;  3KWV A;  1RRB A;  1L0X B;  2D3A A;  1V8C A;  4ZYN A;  4W9C A;  2MLB A;  3BY4 B;  1TYG B;  1WGD A;  1E8Y A;  3PT2 B;  1GPX A;  3DBL B;  1V9J A;  3GE8 C;  2E3T A;  1UH6 A;  1LXD A;  2JXX A;  2Z8L A;  1EO6 A;  2IJ0 A;  3E9S A;  1IBX A;  3Q3J A;  4C80 A;  1UWX A;  3I63 C;  2BPS A;  2KQS A;  3AH7 A;  3BVM A;  2LZ6 A;  5D3D A;  3BVZ A;  5H92 C;  3MFG A;  3BZD B;  3U52 E;  4LNO A;  3SD5 A;  2J0J A;  3WCQ A;  1JAL A;  4F1S A;  4MSQ B;  1KH0 A;  1TY2 A;  1RYJ A;  2KDM A;  1C3T A;  2M8S A;  4PK1 A;  2DLB A;  3QWZ B;  4W9D A;  1F0Z A;  4ANV A;  5E6J A;  2FUH B;  1SEB D;  3PRZ A;  5IKC M;  4US8 A;  2TSS A;  4M8N A;  4NZL B;  2MHJ A;  2G1E A;  3ONS A;  1ZKH A;  2L05 A;  4EOY A;  4ZOH C;  1AAR A;  3T3O A; 
#chains in the Genus database with same CATH homology
 4G3X B;  3B0A A;  4GXB A;  2KXJ A;  4A3P A;  2NBV B;  3R66 C;  2BYV E;  2O2V B;  4FJZ A;  4IW0 A;  5G55 A;  3HHM A;  3VTW A;  2MBH A;  3CST A;  1LFD A;  5DPT A;  3P2B A;  2AL6 A;  1V5O A;  3KYD D;  4M8M A;  4KDL B;  1EUV B;  4FJY A;  1CMX B;  2IY0 B;  3RZF A;  1TBE A;  1WMH B;  1WMH A;  3HM6 X;  2DHZ A;  2GBM A;  2YLM A;  4FUL A;  3V60 A;  3VH3 B;  1WXS A;  4URK A;  3L0W B;  1I42 A;  1GJZ A;  1OGW A;  4CYE A;  4HCP B;  4E3C A;  3L17 A;  4HDQ A;  2CU1 A;  4NNJ B;  1E7U A;  2FCS A;  3MJW A;  2ZPY A;  4ICU A;  4EFO A;  4N9F 4;  2BWF A;  3H6N A;  2M4N A;  3ZIM A;  5D6J B;  1WJN A;  3QJZ A;  1Q5W B;  1WX9 A;  1E8W A;  1NBF C;  2KMA A;  3LDZ E;  2JZ3 B;  1E5W A;  2N9P C;  4DHJ B;  2C7H A;  3MTN B;  4NQK E;  4A3O A;  2HD5 B;  2C7M B;  4WWO A;  4MDK E;  2DX5 B;  4I6P A;  4MGI E;  5AZF A;  3VHT C;  2K6D B;  3KYC D;  1TZ1 A;  2PEA A;  4GSW A;  4IWO A;  2Y5B B;  1J19 A;  4AOF A;  2YVC A;  2KD0 A;  4E71 A;  4WAA A;  4ANX A;  1ZW7 A;  2LVQ A;  4BFR A;  5AZG A;  3PGE A;  2KTR B;  3A9K A;  2KFJ A;  1QZE A;  4FAD A;  3HIZ A;  1WJ4 A;  4OVV A;  3EC8 A;  2KOX A;  1WF9 A;  3H7P A;  3SDL C;  4NJ6 A;  1XT9 B;  2KAN A;  4JIO U;  2I1K A;  3ZLZ A;  3ZNI D;  2LXC A;  3IG3 A;  3OAW A;  3QAQ A;  2DYO A;  3R7R A;  3IBE A;  3R7Q A;  2MP2 B;  4ASW C;  4BVU C;  1P98 A;  2JWZ A;  1UBQ A;  1WJ6 A;  3QX1 A;  3SU8 X;  4DDG D;  3QAR A;  1GNU A;  2KFK A;  1Z2M A;  2IBI B;  2WWZ A;  3L13 A;  2KX3 A;  3A33 B;  4MGY E;  2CHW A;  4KZC A;  2ZPN A;  1E90 A;  4GDL B;  4WJP A;  3UQB A;  2KKC A;  3V6E B;  1LQB A;  3AI5 A;  3CF6 E;  1YIW A;  3L10 B;  4GGQ A;  2N7D A;  2ZJD A;  4AWJ A;  2JF5 A;  4ICV A;  2G4S A;  3M95 A;  3VH4 B;  4I6L B;  2L00 B;  2N7E A;  2ZCC A;  4RMA A;  4TUU A;  4B9K A;  2BGF A;  1E8Z A;  4BKS D;  3GZN I;  4LDT B;  4G0N B;  3SHQ A;  4BKT A;  2FNJ B;  2VRR B;  3AU5 A;  4XX5 A;  1GG3 A;  2NVU I;  1WZ0 A;  1Z5S B;  2HTH A;  3K9P B;  4GB9 A;  2WX1 A;  2K39 A;  1KJT A;  1IYF A;  4DBG A;  3NY5 A;  3PS6 A;  3DVN V;  2D11 A;  4NQL B;  3VTU A;  4EKU A;  1P1A A;  5L95 C;  1P0R A;  3I3T B;  3ZNH B;  3U7D A;  4FHJ A;  2AL3 A;  4B95 A;  2XK5 B;  2C9W B;  2CKH B;  2RGF A;  2EMT A;  1IPG A;  3A9J A;  4K7U A;  4KV2 A;  3ZRF A;  3A4S C;  2MBE A;  4PS7 A;  1HE8 A;  2KNB A;  4HWI B;  4IM3 A;  3DPD A;  4EUT A;  3A1Q B;  3M62 B;  3IVF A;  2ZVO A;  3JSV B;  4PS3 A;  1K8R B;  1FXT B;  1V49 A;  2DZJ A;  1RFA A;  1T0Y A;  3UIP B;  3ML9 A;  5DPW A;  2LD9 A;  1SIF A;  4A20 A;  2Z0D B;  3ZVV A;  4GU2 A;  5CHW A;  3DVG Y;  2NCN A;  1YX5 B;  1WGH A;  4K81 A;  4PS8 A;  3M63 B;  2GBK A;  2KJH B;  4GDK A;  4MSM B;  3WIM A;  1WY8 A;  1WE7 A;  4AUQ C;  2C60 A;  2GMI C;  4TQ0 A;  2IO2 B;  3VXW A;  1SGH A;  3AUL A;  3W1S A;  1EF1 A;  2A4Z A;  1WI0 A;  2DYB A;  1I35 A;  2D3G A;  2DYM A;  3N32 A;  4AJY B;  2MA9 B;  1L2N A;  2MWS B;  1U4A A;  3QA8 A;  2V3S A;  3U8Z A;  2CHX A;  2MCN B;  2ZNV B;  3ML8 A;  1UZX B;  2MQJ A;  2WDT B;  3Q3F A;  1KOT A;  3ZTC A;  2JRI B;  1SE9 A;  1WR1 A;  1E8X A;  5KHO A;  2KWV B;  1V6E A;  3VFK A;  3X23 A;  2KC1 A;  2IO1 B;  3RYT A;  3PVL A;  4HDO A;  3UIO B;  1D3Z A;  4BBN C;  3WAO A;  2FID A;  2D10 A;  1VD2 A;  4K7S A;  4P7I A;  5LXI B;  5DCN A;  3JW0 X;  5J18 A;  3KH0 A;  2NPT A;  1WRD B;  3HM3 A;  3PHW B;  4LCD E;  4DWF A;  5AEK B;  2XEW A;  1V2Y A;  2NBU A;  4KIK A;  4K1R B;  4JGH B;  5IA7 A;  3ZNG C;  1Q0W B;  2HJ8 A;  2KO3 A;  2MX2 A;  2RPQ A;  1V5T A;  2KDE B;  4IM0 A;  2FCQ A;  4YL8 A;  1YD8 U;  2IO3 B;  2RD0 A;  3K9O B;  2LGD A;  2EMS A;  3DBL I;  3EFU A;  2MRP A;  4I6N B;  4ANW A;  1Y8R C;  4RM9 A;  3DBS A;  1UBI A;  4KSL C;  1M94 A;  2O6V D;  3ZDT A;  5JHB A;  2PE6 B;  1WH3 A;  2DZM A;  3NS8 A;  1OTR B;  3WAM A;  5JHA A;  3WAP A;  2C7N B;  2K8H A;  1YQB A;  3C0R B;  4TV3 A;  1MG8 A;  3DBH I;  2K8C A;  3O65 B;  4FBJ B;  3A9K B;  3WAN A;  2CR5 A;  3T9L A;  4KSK C;  5E6P A;  1XQQ A;  3APF A;  3H7P B;  2ZZP B;  4K7W A;  2ZNV C;  1OQY A;  4W9G A;  3PLU A;  3S2A A;  2K1F A;  1BT0 A;  3RZW C;  2M17 A;  2LWP A;  3B08 A;  1E7V A;  2Z0E B;  4BBN F;  3ZUN A;  1GC7 A;  2UYZ B;  4II2 B;  2KFK B;  2IYD B;  5CX3 A;  2KVR A;  2V4L A;  3PV1 A;  4F8C B;  2BWE S;  4HJK A;  2L0T A;  4GMV A;  3NZU A;  4NY0 A;  1UEL A;  3KUD B;  1KM7 A;  3UIN B;  2L76 A;  1EF5 A;  5C1Z A;  3V61 A;  2OOB B;  4JQW C;  3U30 A;  3KVF B;  4PYZ A;  1H8C A;  4M0W B;  2BYF A;  4NAW B;  5GMV A;  4NAW A;  2MBQ A;  3IFW B;  2JRH A;  2ASQ A;  2L7R A;  1S1Q B;  5CTR C;  3LJ3 A;  4DHJ D;  4HCN B;  4RM8 A;  1V86 A;  1F9J A;  2LGX A;  3N30 A;  3EHV A;  4CO7 A;  4BOZ B;  3TJP A;  1GUA B;  2FCM A;  4FLH A;  5JZE B;  1UD7 A;  3DDC B;  4MJS A;  2AYO B;  2LI5 A;  3VUX A;  2MSE D;  3ZKJ C;  2LUE A;  5J17 A;  3VUY A;  2LGY A;  2V1Y A;  2GBR A;  1JRU A;  3APD A;  4WJQ A;  4PYU A;  3VDZ A;  5KHQ A;  1UGM A;  2KTF A;  3A9J B;  4EEW A;  1WXA A;  5FR6 A;  5L83 A;  1WM3 A;  3ZO5 B;  5G2N A;  2PPH A;  4LJO B;  5DPR A;  4WJN A;  2DAF A;  5BO4 B;  3PSE B;  4FHK A;  3RT3 B;  2AEH A;  4G11 A;  5D94 A;  3KW5 B;  4KZ0 A;  2G3Q B;  1WGY A;  3PLV A;  5D7G A;  5TR5 A;  3RD2 A;  4E74 A;  2L0F A;  3MHS D;  2JUO A;  3WA0 A;  2GBJ A;  4WWN A;  5EDS A;  3OJ4 B;  3DVG X;  2BKR B;  2M0X A;  2L8J A;  1V81 A;  2G4D B;  4ANU A;  3R3M A;  3VVW B;  1WXM A;  2DZK A;  3L54 A;  3ZRC A;  4DK5 A;  2K25 A;  2LAS A;  3PRP B;  4GDK B;  2A5U A;  4W9K A;  4W9F A;  1P9D U;  4GN1 A;  4ZRI A;  2KJ6 A;  1LM8 B;  4EZK A;  5LXH A;  2ZVN A;  3EEC A;  4F7Z A;  4ZRJ A;  2R2O A;  3QCA A;  3T8M A;  1WX7 A;  3QK0 A;  4IC7 B;  4W9E A;  4BOS C;  3TMP B;  1J0G A;  1PQS A;  5DPS A;  2JT4 B;  4LDT D;  1WX8 A;  2J7Q B;  2IY1 B;  2O6V A;  3VUW A;  2WYQ A;  4DHZ E;  1VCB A;  4HPM B;  1WGR A;  3AXC A;  3CSF A;  2RR9 A;  2CS4 A;  2C5L C;  3M3J A;  3QQ8 B;  2PE9 A;  3H7S A;  2CHZ A;  2HE7 A;  2KMC A;  2WX0 A;  5E6O A;  4HLE A;  3V62 A;  1RLF A;  4IUM B;  2JZZ A;  3GOE A;  2MW5 A;  3PRM B;  3AU4 A;  2NPT B;  1Q1O A;  1V80 A;  3NZS A;  4FN2 A;  4KIK B;  4W9I A;  2O2V A;  4AJW A;  2KX0 A;  3L16 A;  4CHK A;  4HVB A;  2DEN B;  4DHZ B;  5J2R A;  2M1M A;  2ZEQ A;  3TL5 A;  2NS5 A;  2KJR A;  3V6C B;  3UQA A;  2N1W A;  2OJR A;  2IO0 B;  2FAZ A;  1WXV A;  2J0M A;  3N3K B;  4FJV B;  2B3A A;  2GOW A;  3H9D A;  4WJO A;  5AZH A;  2KLG A;  1H4R A;  2LVP A;  2RSU A;  3UF8 A;  3VTV A;  3W1S C;  4II3 B;  2KDB A;  3UGB B;  2FIF A;  2KZR A;  4LJP B;  4BKS A;  2KWC A;  4W9J A;  2LRW A;  2N4F A;  2UWQ A;  4J6I A;  3ZDM C;  2J0K A;  2ZCB A;  1OEY J;  3VAW A;  3B1L X;  4IG7 B;  2MBB B;  3W1Y A;  3QC8 B;  4NJ7 A;  5CHF A;  5CHV C;  1S3S G;  4IWQ A;  3ALB A;  2EKE C;  3VQI A;  2LJ5 A;  1TTN A;  1XD3 B;  3PZD A;  1WFY A;  2JPH A;  4NPN A;  4X57 B;  2LVO A;  2IZV B;  2XBB C;  3H1U A;  2KHW B;  2KTR A;  3NHE B;  3D32 A;  2K8B A;  3ECI A;  4HK2 A;  2FCN A;  4TKN A;  3PTF C;  3RUI B;  1WM2 A;  2KK8 A;  1G6J A;  5IAA C;  2KC2 A;  3NOB A;  2W9N A;  5HKH A;  4KDI C;  4BKG A;  4IM2 A;  2MP2 A;  3X0W A;  2N9E B;  2MBO A;  1WZ3 A;  2GBN A;  1KLV A;  3QHT A;  4TQ1 A;  4XC2 A;  4MH0 E;  3WAL A;  4WQO B;  2REX A;  3A4R A;  5JH5 C;  1WGG A;  3L08 A;  2NR2 A;  4EZJ A;  1RRB A;  1R4N I;  1WJU A;  4MEL A;  4GDL A;  3QIJ A;  1ISN A;  1R4M I;  4W9L A;  4MJS B;  1A5R A;  2I1J A;  3RUL A;  4ZYN A;  3ZNZ B;  2N9X A;  3JVZ X;  3JYU A;  2N1V A;  4KVG B;  4IWP A;  2MLB A;  3BY4 B;  4W9C A;  2KLC A;  2KDF B;  4HPL B;  3TCA A;  1WGD A;  3PT2 B;  1E8Y A;  4JL9 A;  4DDI D;  3KUZ A;  2BF8 B;  1V9J A;  3DOW A;  1UH6 A;  3PRE A;  4MEM A;  1ZGU B;  1LXD A;  2BKF A;  2JXX A;  4MGZ E;  3DBR I;  1WYW B;  5C23 A;  3PHX B;  2R2Q A;  1EO6 A;  2KWU B;  3ZTD A;  3Q3J A;  2KQ7 A;  3DCG A;  2DAJ A;  3TBL D;  2BPS A;  3CMM B;  1GC6 A;  2KQS A;  2AWT A;  2K6Q A;  2JY6 A;  2LZ6 A;  4XZ4 A;  1IP9 A;  3ENE A;  1WR6 E;  4JLC A;  4ZRK A;  3ZW3 A;  1NDD A;  1YX6 B;  2QHO A;  4B6W A;  1P3Q U;  4OVU A;  3SD5 A;  4G50 A;  2XK5 A;  4WWP A;  3OJ3 A;  2J0J A;  4FA6 A;  1C1Y B;  2KDI A;  3DQV A;  4HXD A;  4MSQ B;  4F1S A;  4GIV A;  3A1Q A;  2M8S A;  2KN5 A;  3BIN A;  3TIX A;  1C3T A;  2Z59 B;  3QWZ B;  4W9H A;  4W9D A;  5LLI A;  3JSV A;  3RCZ A;  1L7Y A;  4DXA B;  4ANV A;  2JVC A;  1NI2 A;  2FUH B;  2LXA A;  1YJ1 A;  3APC A;  1TGZ B;  3PRZ A;  1WIA A;  2G45 B;  1WE6 A;  2O6V B;  2DZI A;  4EZL A;  4M8N A;  3KUC B;  1RAX A;  3DVN U;  2NBW B;  2D2Q A;  3OLM D;  3PPA A;  2L3Z A;  3ONS A;  4MGK E;  1X1M A;  1J8C A;  5E6N A;  1ZKH A;  2L05 A;  4ZDV A;  3HK0 A;  4AP4 C;  2BYE A;  4EOY A;  2PJH A;  2D07 B;  2LRU A;  4MM3 A;  1OEY A;  3IHP C;  5D2M B;  1AAR A;  4GOC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...