4WAAA

Crystal structure of nix lir-fused human lc3b_2-119
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
126
structure length
126
Chain Sequence
NEEWVELGSPSEKTFKQRRTFEQRVEDVRLIREQHPTKIPVIIERYKGEKQLPVLDKTKFLVPDHVNMSELIKIIRRRLQLNANQAFFLLVNGHSMVSVSTPISEVYESEKDEDGFLYMVYASQET
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural protein
molecule keywords Microtubule-associated proteins 1A/1B light chain 3B
publication title Phosphorylation of the mitochondrial autophagy receptor Nix enhances its interaction with LC3 proteins.
pubmed doi rcsb
source organism Homo sapiens
total genus 34
structure length 126
sequence length 126
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-08-29
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 4waaA00
3DVNU 3ZTDA 2J0MA 2JRIB 2CU1A 2IZVB 2Z0DB 3ZIMA 4TQ1A 4EKUA 4B6WA 1EUVB 3RD2A 2FAZA 3PVLA 2HE7A 2MP2A 4WJOA 2N7EA 1WJUA 5J18A 4NAWA 4PS8A 3NHEB 3A9KB 3QQ8B 3QJZA 1E7UA 3QC8B 3QWZB 2KWCA 3M62B 2KJRA 4WJQA 3VUXA 3WAMA 3UIPB 2MW5A 2ZPNA 3TJPA 1J19A 1WH3A 1E90A 3DDCB 5L95C 2MBHA 3UF8A 2RR9A 3VTWA 3PRZA 1EF5A 1Q5WB 1NI2A 2C60A 3A9JB 3UIOB 4HPLB 3MJWA 1R4NI 3NOBA 3V62A 3L16A 2CHZA 5J17A 3PZDA 4AJWA 1OEYA 2AEHA 4FJVB 3ZKJC 2G3QB 3T9LA 1OTRB 3PTFC 5DPWA 2DYOA 2K6DB 4NQKE 2K39A 3TL5A 4G3XB 3R7QA 4K7UA 4MEMA 3WAOA 1YQBA 1TZ1A 1WFYA 4AP4C 4E3CA 4XC2A 3VFKA 3VHTC 3JVZX 2NPTB 3A4RA 1V2YA 4HJKA 3VUYA 4DHZB 3DPDA 2N1WA 4W9KA 4MJSA 1LQBA 2EMTA 1WM3A 3R7RA 2L76A 2DZIA 3IG3A 4GB9A 4CYEA 1RRBA 3DVNV 2MBQA 4FLHA 2ZNVB 1WGGA 2KDFB 4MELA 4HWIB 1SE9A 1IP9A 1WX8A 1WZ3A 2FUHB 2FCMA 3QCAA 4EZKA 1LXDA 2FIDA 2K8HA 4IM0A 2KZRA 3DOWA 4BKGA 3UINB 3X0WA 2YLMA 2JUOA 2L0TA 2OOBB 2NS5A 2NCNA 2KOXA 2DAJA 4X57B 1KLVA 2LWPA 2N4FA 3TIXA 3L54A 1UZXB 2NBUA 2CS4A 2LXCA 2ZJDA 2YVCA 3D32A 5D2MB 3SHQA 1V86A 3KYCD 3NS8A 4II2B 1ZGUB 4ZYNA 2M0XA 5L83A 1MG8A 1UD7A 5IAAC 2JPHA 4B95A 2UYZB 4ZRIA 1WGYA 4KIKB 3RT3B 1WJ4A 4BVUC 5G2NA 4HVBA 5BO4B 3ONSA 3M95A 3WIMA 2EMSA 2O6VD 3ZW3A 4BBNC 3BY4B 3ML9A 3ALBA 3QHTA 4II3B 3ZRFA 3DVGX 2CHXA 3WA0A 3CSTA 3PPAA 3A1QB 3C0RB 2G4DB 2L8JA 1KJTA 1P0RA 4PYZA 3ZDTA 1VD2A 3RULA 3VTVA 2GOWA 4GDKA 5J2RA 2IBIB 4GN1A 4GU2A 2BKRB 2Z59B 3HK0A 4KDIC 5CHVC 2BPSA 2XBBC 2KD0A 1ZW7A 3Q3JA 5C23A 4URKA 3VUWA 3DBHI 3KW5B 2RGFA 2JXXA 2LJ5A 3RUIB 3AULA 2D11A 3RYTA 3A9KA 4TV3A 3PRMB 1E8YA 3APCA 1V5OA 4BKSA 1YJ1A 1LM8B 1UELA 2GBNA 3HM6X 4OVUA 4G11A 5FR6A 3OAWA 1WE7A 1WM2A 3B1LX 5DCNA 2JZ3B 2HTHA 3A9JA 4AUQC 1WIAA 1M94A 5LXHA 1JRUA 4IUMB 4FJZA 2C7MB 5DPSA 4KSLC 5D7GA 3WALA 1L2NA 3ZNGC 2KVRA 2MQJA 2FIFA 1ZKHA 3PLUA 3U7DA 3JYUA 1FXTB 2N7DA 2JVCA 3PV1A 4WWNA 2KANA 1R4MI 2NPTA 1KM7A 1GUAB 2ZVOA 2LUEA 4WWPA 5AZFA 2KTRB 4MH0E 4BOSC 5D94A 1WGHA 2PPHA 3KUZA 3QARA 1E7VA 2KKCA 3W1SA 4EFOA 4HCNB 3T8MA 3ECIA 2LVQA 2KO3A 2KFJA 2NBVB 2N9XA 2DZKA 2L3ZA 2K8CA 4J6IA 3U30A 4K81A 3QAQA 2KX0A 2C9WB 2DHZA 3PRPB 4LDTD 1TTNA 3S2AA 1TGZB 4ANVA 4ICUA 3L13A 2ZZPB 2NVUI 2MWSB 4G50A 4GMVA 2N9PC 3ZNHB 4YL8A 2VRRB 2WDTB 2LD9A 2K25A 1NBFC 4TUUA 1YX6B 4KZCA 2O6VB 2M4NA 2KN5A 1WXVA 3A33B 1WE6A 2IO1B 3TBLD 4IC7B 2K6QA 4IM2A 2KDBA 1I42A 1D3ZA 3ZNID 3ZRCA 2HD5B 2KQ7A 4E74A 2M8SA 2WWZA 4NJ7A 2JT4B 2J7QB 4DK5A 2BYVE 2JRHA 3RZWC 4KIKA 2ZCBA 2ZEQA 2BYFA 4GIVA 4W9IA 4GDLA 3V6CB 1UBQA 4WJNA 4HDOA 3IFWB 4KDLB 3KVFB 2ZCCA 2MBOA 3N32A 4A3PA 3A1QA 3LJ3A 1P1AA 2LI5A 3ZNZB 2PEAA 3AXCA 2DYBA 5IA7A 4BOZB 4A3OA 2KTFA 2C7HA 4JIOU 2RD0A 3AI5A 1H8CA 4OVVA 2B3AA 2KLCA 2CR5A 4MSMB 4W9JA 3B08A 4ANXA 3L08A 3QX1A 4XZ4A 3CF6E 2NR2A 1P3QU 4FHJA 1GC6A 4DDGD 2IO3B 3N30A 1WMHB 2KK8A 5CHFA 1V49A 3EECA 4AJYB 4EOYA 2A4ZA 2FCNA 5TR5A 5D6JB 3VQIA 1WGRA 4TQ0A 2BYEA 2BWES 2KMCA 2M1MA 4DDID 1EO6A 2W9NA 1J8CA 2BF8B 2IYDB 2R2QA 3ZLZA 4BKSD 3APDA 2M17A 2J0KA 2KFKB 3PLVA 2KXJA 2WX0A 3P2BA 3RZFA 2KWVB 3ZVVA 5E6NA 2LXAA 3DBRI 2C5LC 5DPRA 1Z5SB 2UWQA 1A5RA 4MJSB 4CHKA 3O65B 3DBLI 2RSUA 2MLBA 1WRDB 4LDTB 5KHQA 3PGEA 4GSWA 4WAAA 2LVPA 3R66C 4WQOB 4W9HA 2JY6A 1SGHA 1XQQA 2KTRA 1AARA 4NQLB 3EC8A 5KHOA 3HHMA 3NY5A 3PT2B 1BT0A 2LGDA 3VAWA 4JLCA 3WAPA 1F9JA 1WJ6A 3W1YA 3KH0A 4RMAA 2MSED 4M8NA 2CKHB 4LJPB 4G0NB 3H1UA 1T0YA 4KSKC 2O2VB 3V60A 4IW0A 3R3MA 5JHAA 1EF1A 1UGMA 4HK2A 3PREA 1RAXA 3NZSA 1ISNA 1L7YA 2IO0B 1H4RA 1IPGA 2KDEB 3OJ3A 4ZDVA 3ML8A 5JHBA 2Y5BB 3K9OB 3AU4A 2KJHB 1Z2MA 1NDDA 1E8ZA 4MGYE 4ZRJA 3ZO5B 4W9CA 4F7ZA 4HDQA 2GBJA 2JZZA 4W9LA 2HJ8A 1WR6E 4DWFA 1Q0WB 3H7PB 3VTUA 3SU8X 4GOCA 3H6NA 4GGQA 2PE9A 4HLEA 3PHXB 1OEYJ 2KLGA 1OQYA 2KQSA 4JQWC 4XX5A 3QIJA 2FCSA 4IWOA 2FNJB 4PS7A 1WXAA 3MHSD 2RPQA 5JH5C 2D07B 1E8XA 4LCDE 4I6LB 4KZ0A 4MM3A 5CX3A 3M3JA 4ZRKA 2MBBB 4W9EA 1WYWB 2OJRA 4AOFA 4GDKB 2KMAA 5AZHA 3IBEA 2K1FA 4MDKE 5E6PA 1U4AA 2L00B 3IHPC 2L05A 5HKHA 2MBEA 2DZJA 2BGFA 3JSVB 4DXAB 2G4SA 1WR1A 1SIFA 4PS3A 5G55A 3DQVA 3CSFA 2KC2A 1WX7A 2V3SA 3DVGY 4DHZE 4MGKE 2AYOB 1CMXB 1J0GA 4NNJB 1YX5B 4A20A 2REXA 2KWUB 3U8ZA 2GBRA 4N9F4 4RM8A 1WMHA 2NBWB 1XT9B 3NZUA 4I6NB 5JZEB 4NPNA 3VDZA 3VH4B 1Q1OA 1VCBA 2IY1B 3I3TB 3X23A 4ICVA 5AZGA 1Y8RC 2LGYA 4GXBA 2A5UA 3RCZA 2GBKA 3WANA 4KVGB 2GMIC 5EDSA 1GJZA 3BINA 2KDIA 1V80A 3OLMD 4P7IA 4MGZE 2XK5B 3EFUA 1G6JA 1XD3B 3KUCB 3N3KB 2CHWA 4FADA 4B9KA 3IVFA 1UH6A 2EKEC 3UGBB 2KFKA 4ANUA 4EUTA 4F8CB 4RM9A 2ZPYA 1P98A 3DBSA 1LFDA 4MGIE 3ZTCA 2JF5A 2LZ6A 2L0FA 2MP2B 4LJOB 4NAWB 2DX5B 4DHJD 2LRUA 2DZMA 2AL6A 2QHOA 4MSQB 2KC1A 1V81A 1PQSA 1TBEA 2D10A 3JW0X 2IO2B 4W9FA 1QZEA 1C1YB 2FCQA 5LLIA 3TMPB 3VVWB 1WZ0A 3V61A 3A4SC 2MA9B 3KYDD 4M0WB 4TKNA 2BWFA 1RFAA 3W1SC 1E5WA 2KHWB 2KX3A 2LVOA 1K8RB 5GMVA 4AWJA 4IG7B 3V6EB 4ANWA 1GG3A 2ZNVC 4IWQA 4K1RB 2D2QA 4EZJA 4HPMB 2WYQA 2C7NB 3HIZA 3KUDB 4HCPB 4HXDA 4PYUA 2O2VA 4I6PA 2R2OA 2BKFA 1OGWA 3DCGA 4WJPA 4FBJB 5C1ZA 2MX2A 1C3TA 4JL9A 1RLFA 3B0AA 1HE8A 3Q3FA 4FA6A 1GC7A 2V1YA 3PSEB 5E6OA 3ZDMC 4M8MA 4E71A 3ENEA 2G45B 3AU5A 2KNBA 4KV2A 1V9JA 2LRWA 3H7PA 3OJ4B 1KOTA 5CTRC 3SDLC 2DENB 2J0JA 2I1JA 3PHWB 1V6EA 1WF9A 3PS6A 4GDLB 2V4LA 4EZLA 2L7RA 4NY0A 2LASA 3LDZE 2Z0EB 2DYMA 4W9DA 3VXWA 4EEWA 2AL3A 3M63B 2JWZA 2PJHA 2IY0B 1WXSA 3L0WB 1GNUA 1WX9A 2KJ6A 4BBNF 4BKTA 3QK0A 1YD8U 4F1SA 4BFRA 1IYFA 3VH3B 2D3GA 1WJNA 3ZUNA 3L17A 2DAFA 2GBMA 1V5TA 1WY8A 5CHWA 1X1MA 2N1VA 3UQBA 4IWPA 5AEKB 4FHKA 3JSVA 1WXMA 3GOEA 5DPTA 4FN2A 1WGDA 1WI0A 3H9DA 4JGHB 4W9GA 3L10B 3APFA 2O6VA 4WWOA 4DBGA 2AWTA 4IM3A 2MRPA 4ASWC 1UBIA 2K8BA 3HM3A 4FJYA 3MTNB 4K7SA 2I1KA 1S3SG 3EHVA 3CMMB 4FULA 1P9DU 1YIWA 4K7WA 2MCNB 4NJ6A 2ZVNA 1S1QB 3SD5A 4DHJB 3TCAA 1E8WA 4CO7A 2LGXA 3H7SA 3QA8A 1I35A 3GZNI 3K9PB 2N9EB 2WX1A 2XEWA 2ASQA 2XK5A 5LXIB 2PE6B 3UQAA
chains in the Genus database with same CATH superfamily
2INCC 4M00A 2CU1A 1IGCA 2AQ3B 5J18A 1WJUA 3NHEB 1E7UA 1YJJA 2KWCA 1I4QA 2KJRA 3VUXA 3WAMA 1J19A 1WH3A 4CQNA 2PVGC 2QILA 1FRRA 1BUIC 2C60A 2WP9B 1TJEA 3UIOB 1HQRD 1R4NI 3L16A 4YSZB 4AJWA 4FJVB 2V4IB 3T9LA 3PTFC 5DPWA 2DYOA 4REZA 4K7UA 2JYTA 4MEMA 4D2KA 3WAOA 1WFYA 4E3CA 3OWEB 1V2YA 3Q14C 3RNFC 4MJSA 3TUOA 5IO9A 4GB9A 1RRBA 3RNAC 3SEBA 1V1PA 2ZNVB 1WGGA 4N6EB 2BTEA 4BZAA 4HWIB 4JWUC 2FIDA 4TMAB 1RWSA 2AQ1B 2DLBA 1XLOA 2L0TA 2NCNA 2DAJA 4X57B 2LGSA 2N4FA 5I4DA 2FBWB 1T3QA 2CS4A 2QMTA 1ZGUB 4ZYNA 1AWDA 5IAAC 2G1EA 2UYZB 2WXRA 4KIKB 4BVUC 5BMHA 1EWYC 3DWGC 2H89B 3ALBA 3QHTA 4II3B 3ZRFA 5C2TB 3A1QB 2L8JA 4JE3B 3TSSA 4GDKA 3NUHB 2BKRB 5CHVC 1SEBD 2XBBC 4URKA 3DBHI 3GE8C 2RGFA 2JXXA 2LJ5A 1CK1A 3A9KA 1FNWA 2B76B 1P7FA 4TV3A 3PRMB 2FUG1 2HTME 1V5OA 1WSPA 1ZPSA 1UELA 2GBNA 1WM2A 3B1LX 4AUQC 1WIAA 1T0QC 1ZXHA 3FILB 1M94A 2PW9A 1TKYA 1XCTL 2OJWA 1CQVA 3N9YC 3PV1A 1R4MI 1GUAB 2ZVOA 4AS1A 3R2IA 5AUKA 3HVDA 3GP7A 2ACZB 1B1ZA 5BMIA 3ECIA 2LVQA 4J6IA 3U30A 4ANVA 4LDTD 3S2AA 1Q10A 3L13A 2NVUI 2MWSB 1UWMA 2N0SB 3L4PA 1NBFC 1YX6B 4A8XC 2M4NA 3TEZA 1WE6A 4PK1A 2KDBA 4E74A 2WS3B 3AECB 2LMCA 4GIVA 4GDLA 1UBQA 4HDOA 1F0ZA 2SAKA 3LB8C 1QF6A 3IFWB 2MBOA 4LNKA 2MHJA 4XE0A 2IJ0A 1VJKA 2KLCA 4YT0B 3AE2B 2CR5A 1QOBA 2K9XA 2XN9C 2BB5A 2OEDA 2KK8A 1V49A 4AJYB 5TR5A 5D6JB 1MG4A 1WGRA 4TQ0A 4YSXB 1C4PA 2BWES 1L0XB 1JQ4A 2M1MA 1J8CA 2M17A 2KFKB 2KWVB 5BYRA 1FEHA 2LXAA 3EA6A 4LNOA 1Z5SB 2UWQA 3TEXA 4MJSB 3DBLI 1WRDB 4LDTB 2LVPA 1V1PB 1XQQA 2KTRA 1AARA 1N5WA 3EC8A 3HHMA 1BT0A 2LGIA 2KACA 4RMAA 1HZ5A 3RNGC 5HG2A 3ZYYX 2NTSA 4IW0A 5JHAA 1RAXA 2ZW1A 1ISNA 5JHBA 3OJ3A 2V0GA 1ET6A 1EU4A 3K9OB 5HHDG 2INPE 2KJHB 4ZRJA 4W9CA 2K3UA 4F7ZA 3H7PB 3SU8X 4GOCA 3H6NA 3NVVA 2MJDA 2KLGA 2KQSA 4JQWC 3NVWA 2FNJB 5JH5C 4KZ0A 3T3OA 3BWUD 4W9EA 4C80A 3BVMA 2WXOA 4AOFA 4GDKB 2KMAA 1M4VA 1JWMD 2L05A 2DZJA 2BGFA 3AV8A 1MHHE 2G4SA 2NTTA 3NRZA 1J0GA 1L6VA 2GBRA 2ICIA 1HA5A 2IDYA 3VH4B 1Q1OA 3I3TB 4WAFA 3X23A 2A5UA 2GBKA 4TSSA 3N3KB 4FADA 4B9KA 4C7ZA 3P42A 3U4EG 3ZTCA 2QCZA 1XCQL 4LNFA 2BB6A 2L0FA 2MP2B 1MPEA 1SIJA 4NAWB 4DHJD 1QT9A 4ITKA 2LRUA 2AL6A 3URYA 1V81A 1TBEA 3W9CB 3Q8AA 1YJIA 1QZEA 2CJOA 3V61A 4M0WB 2LVOA 2EKIA 2KX3A 1ZOYB 3HIZA 1P7EA 3KUDB 3NJTA 3FKYA 2R2OA 4N59A 4ACFA 2WXGA 1C3TA 3ETRA 1HE8A 4FA6A 2QEJC 2V1YA 3ZDMC 2D3BA 3SDLC 2I1JA 1ZE3D 4GDLB 4XWTA 3N1ZC 1JW9D 2JWZA 4WQMA 1WXSA 1J7CA 3ZUNA 3L17A 1F2RC 3H8HA 1WY8A 1X1MA 3UQBA 2DNFA 4FN2A 3MC9A 4W9GA 2L52A 3L10B 3APFA 1BMLC 4NJCA 1LGRA 1C78A 3EFCA 4FJYA 1QKZA 1FIQA 1P9DU 2V3PA 2ZVNA 1C77A 3SD5A 4US9A 4DHJB 1R7SA 2BQQA 3Q8BA 3H7SA 1QLBB 3GZNI 3K9PB 2WX1A 3R8BA 2JX5A 1L5PA 3DVNU 1YN4A 1DYQA 2J0MA 2JRIB 3ZTDA 1PFDA 3Q8FA 2WDRB 3ABVB 3ZIMA 4TQ1A 4EKUA 4RH6A 4XDCA 1EUVB 3RD2A 2FAZA 3BK2A 2HE7A 1HXYD 3QQ8B 3QJZA 3QC8B 4ZHPA 2H88B 3M62B 1VZ6A 1SE4A 2MW5A 2ZPNA 3TJPA 3V3XA 1E90A 4B0EA 1VR9A 3PO0A 5L95C 3P4PB 3PRZA 1EF5A 1N5XA 1N62A 3A9JB 1D5ZC 3MJWA 3V62A 3GB1A 1PGAA 3PZDA 1GB1A 5H92C 3R7QA 3T3NA 4OZBA 3RFZB 3A4RA 3DPDA 4WIPA 3Q6BA 3KLSX 2WDQB 1WM3A 2DZIA 4FLHA 1MI0A 4RFBA 2KDFB 2WQYB 4MELA 1FNVA 1MJDA 1QOFA 2FUHB 3AEEB 1L0YB 3DOWA 3UINB 3X0WA 2YLMA 1UUPA 2OOBB 1T0SC 3FC4A 2LWPA 1UZXB 2WXNA 2NBUA 2LXCA 2ZJDA 3KYCD 3NS8A 1PYWD 1F2RI 1EM7A 1WGYA 1CJEA 1WJ4A 2CU3A 4HVBA 5BO4B 4WH4A 3M95A 2EMSA 2L83A 2WXFA 4BBNC 1GPXA 2G4DB 2RDGA 4PYZA 1P0RA 1SBBB 1VD2A 2EELA 2GOWA 1SSNA 5J2RA 2IBIB 4GN1A 4GU2A 1VZ7A 2Z59B 1ZW7A 3Q3JA 2RPVA 1JCKB 3C8YA 2D11A 3APCA 2JZ3B 5EE1A 3NVZA 2KN4A 5LXHA 1N61A 4IUMB 4FJZA 2C7MB 5DPSA 3HVZA 2KVRA 1IBXB 2FIFA 3U7DA 3PLUA 1NI3A 4YTMB 1AYFA 2JSVX 2NPTA 5AZFA 1KM7A 1XO3A 3KWVA 1XF5L 2PPHA 3QARA 1JWBD 1YN3A 3HUIA 5C1ZA 4A20A 4K81A 3QAQA 2KX0A 1GOZA 2DHZA 3PRPB 1TS2A 1NYQA 3ZJUA 1LO5D 1FFUA 4G50A 3ZNHB 2WDTB 4LNNA 4TUUA 3VR9B 4KKJA 3TBLD 1XLPA 4USAA 4IM2A 1I42A 1D3ZA 3ZRCA 2M8SA 2WWZA 2J7QB 4L1BA 3AE9B 2WDVB 1PGBA 3BVZA 1TS3A 3KVFB 2ZCCA 3N32A 1K52A 3AXCA 2DYBA 4BOZB 2C7HA 4JIOU 2LUMA 4OVVA 2BVCA 1JALA 4ANXA 3L08A 4XZ4A 4YWGG 1FCCC 4DDGD 2IO3B 1WMHB 2JWUA 3SR6A 5HI1A 1NVID 1TKEA 1SXTA 4RCOA 2W9NA 4L23A 2IYDB 1UNSA 3APDA 3IXSA 1SE2A 2WXKA 3P2BA 3RZFA 3BVGA 3DBRI 5DPRA 5BYQA 3BZDB 4P1BC 4GSWA 4WAAA 1KTKA 4C00A 4WQOB 4W9HA 1MFWA 1SGHA 1VLBA 3TEYA 2MJ3A 3PT2B 3VAWA 4JLCA 4R3DA 3WAPA 1YOVB 3W1YA 2CKHB 4LJPB 2D5GA 4A55A 3H1UA 1WXQA 2O2VB 3V60A 1L0VB 3R3MA 3PREA 1I7HA 1NYRA 4ZDVA 3ML8A 1NDDA 4HDQA 4W9LA 4O1NA 2WHIA 2Y5PA 1WR6E 2W54A 1Q0WB 1VZ8A 2JXTA 2FCSA 1WXAA 1ZXIA 3MHSD 1E8XA 1E6EB 4MM3A 4ZRKA 2MBBB 4KKIA 2L32A 3IBEA 4NAMA 2L00B 5IKCM 2MBEA 4DXAB 4PT5A 4PS3A 1SIFA 2K22A 1HZ6A 3DQVA 1V1OA 2WLBA 4ZOHC 1WX7A 3R2TA 3DVGY 4NNJB 2TSSA 2PMVA 3U8ZA 2KWUB 1FXIA 4DXGA 4I6NB 3VDZA 1TYGB 2K5PA 2NMQA 4A90A 4GXBA 3WANA 4KVGB 5EDSA 1GJZA 3BINA 4H2AA 1C79A 3EFUA 2WXPA 3AEAB 2CHWA 3ZXVA 3UGBB 4EUTA 4RM9A 2ZPYA 3DBSA 4MGIE 4J3OD 2JF5A 3CIRB 3P4QB 2IO2B 4W9FA 4XYCA 4N58A 3A4SC 4OW0A 2BWFA 1QOAA 2UU7A 1E5WA 2G9HD 1I4GA 5GMVA 4IG7B 5GXGB 2ZNVC 2D2QA 4HPMB 4HXDA 2C7NB 4PYUA 1D6EC 4FBJB 1AW7A 4JL9A 1RLFA 3B0AA 3Q3FA 1KRHA 1KF6B 2DENB 1WF9A 3PS6A 2V4LA 4EZLA 1RYJA 1JRPA 1FO4A 3VXWA 2Z0EB 2DYMA 1YN5A 2PJHA 2IY0B 2QDFA 1WX9A 1WWTA 1WJNA 1KH0A 1V5TA 1DOIA 1ZDXA 2ONQA 5AEKB 4FHKA 1K50A 3I63C 3JSVA 2QC8A 1WI0A 3H9DA 3IAM1 4WWOA 1F1HA 4IM3A 4L2YA 4LK0M 3MTNB 4K7SA 4K7WA 1YIWA 5LNK1 4NJ6A 1HTOA 3TCAA 3ZGZA 4HEA1 1E8WA 2V3NA 2XEWA 1D5MC 2XK5A 5LXIB 4HJGE 3UQAA 2L1AA 1PGXA 1N6ZA 3P1MA 2IZVB 2VH2A 2N7EA 4PS8A 3A9KB 2WXQA 3O13A 3UIPB 1TIFA 2MBHA 3FAHA 4MACA 4K3CA 2PIAA 1K51A 1Q5WB 1NI2A 4HPLB 3MC0B 5J17A 1OEYA 3ZKJC 1TKGA 2G3QB 4NQKE 1QILA 2K39A 2PLPA 3RNCC 4G3XB 1N63A 1EWCA 2WXJA 1V8CA 1R4NB 2BS2B 1TS4A 3JVZX 4JPSA 3VUYA 2EMTA 3V05A 3R7RA 5EE0A 3IG3A 4CYEA 4MT5A 1ZP0B 3DVNV 5FKAC 3LYYA 2N7JA 4GLSC 3P4RB 1YQ3B 1IP9A 1SE9A 3WCQA 1ZDVA 4EZKA 1LXDA 4IM0A 2K8HA 4BKGA 3KWLA 3AMZA 1TZOA 2NS5A 1KLVA 3TIXA 5FR3A 2I2YA 2YVCA 1UGJA 3D32A 3SHQA 2RDBC 2M0XA 5L83A 4B95A 4ZRIA 3IAS1 3RT3B 2WXLA 5G2NA 3GS2A 3ONSA 3WIMA 3LXFA 1N60A 3BY4B 3ML9A 3P4SB 1ENFA 4C4VA 2CHXA 3WA0A 3PPAA 3ZDTA 2X8XX 3VTVA 4A6QA 2IGGA 4KDIC 2BPSA 2KD0A 3VUWA 3KW5B 3AULA 3DBRB 3RYTA 2PKOA 1VRAB 3HM6X 4OVUA 4G11A 4RGOS 3DBHB 4B0MA 2HTHA 1SF0A 3MP9A 3E56A 4KSLC 5D7GA 3WALA 5HFYA 1E10A 1L2NA 5T8IA 2MQJA 5D3IB 1ZKHA 3DHGC 3EUB2 1PDXA 1UF0A 2N7DA 1YQ4B 2KANA 2LUEA 1JWSD 2KTRB 1FXAA 2W3RA 5D94A 1WGHA 3KUZA 2KKCA 4EFOA 3T8MA 1R4MB 2I38A 2KFJA 2N9XA 2DZKA 2L3ZA 2K8CA 1SE3A 1DGJA 2OHFA 1TTNA 3MJ5A 2VZKD 4ICUA 4ZRQA 1ZUD2 1L4ZB 1TY0A 4GMVA 3ZQ4A 2JQRB 2K25A 2CJNA 1QOGA 2IO1B 4IC7B 4OZAA 1C4AA 3J9CA 3ZNID 2JT4B 3HRDD 3VRAB 4DK5A 3Q3NC 2JRHA 4KIKA 1FRDA 2BYFA 4W9IA 3V6CB 5JXVA 3AM9A 3AEDB 3ZXRA 4KDLB 1OQQA 2PTLA 2VH1A 3A1QA 3LJ3A 1P1AA 3ZNZB 4A3OA 2KTFA 2RD0A 1C4CA 3AI5A 4MSMB 4W9JA 3B08A 3QX1A 1VDVA 3CF6E 2NR2A 1P3QU 4FHJA 3N30A 5G5HA 3VQIA 1XLNA 3RN9C 3AE1B 2BYEA 1FCLA 2KMCA 1WYGA 3RPFC 4DDID 4HKQA 1I4RA 1EO6A 3FILA 2R2QA 3PLVA 2WX0A 3ZVVA 5H8YE 2C5LC 3RNEC 1A5RA 2RSUA 2BBCA 3UI3A 5KHQA 2VZKB 4M02A 4JWSC 1D5XC 1I4XA 2JU6X 3W5VB 3P63A 2LGDA 3DBLB 1F9JA 3AE8B 5EE9A 3KH0A 4RF0A 3B9JA 2MH7A 3ZJVA 4G0NB 1T0YA 2X38A 3RMKC 5FK9C 4HK2A 5IN7A 3NZSA 1L7YA 2KDEB 1H4RA 1IPGA 2WU5B 2Y5BB 1Z2MA 3ZO5B 4MGYE 2JZZA 4HROA 2HJ8A 2HDEA 2LHDA 1I4PA 2PE9A 1OEYJ 4HRSA 1OQYA 1XEEA 1STEA 2E6XA 3QIJA 4PS7A 2RPQA 2D07B 5CX3A 4I6LB 3M3JA 1WYWB 2OJRA 2K1FA 1U4AA 1XLQA 3MHZA 2V3SA 3RI7C 4MGKE 2AYOB 1CMXB 2REXA 4N9F4 4RM8A 1TT5B 3NZUA 5JZEB 2E3TA 2IY1B 1I4HA 4ICVA 5AZGA 1Y8RC 3GE3C 3RCZA 2KDIA 4MGZE 3PZ8A 1XD3B 3MFGA 2KFKA 5D3DA 4F8CB 1FFVA 3BYYB 3AE7B 2DX5B 2WXIA 2DZMA 4MSQB 2KC1A 4IOIE 4ARIA 1PQSA 2D10A 1C9FA 1T5XD 3JW0X 5MPOA 3N1XC 2LHEA 3U52E 3VVWB 1WZ0A 4MH8A 4TKNA 3KYDD 1FPYA 1RFAA 3W1SC 2KHWB 4AWJA 4KGRA 3V6EB 4ANWA 4K1RB 1A70A 4YTPB 4HCPB 4I6PA 2BKFA 1OGWA 1GC7A 5E6OA 4E71A 1WRIA 2G45B 4KGTA 2KNBA 4KV2A 2LRWA 2ZW0A 3H7PA 5AUIA 5CTRC 2J0JA 3TEWA 1FMAD 4AQ7A 3U2SC 4WWMA 1AN8A 4NY0A 2LASA 4XGAB 1OQRA 4EEWA 4ARCA 3M63B 2J4XA 3L0WB 4BKTA 1GNUA 2KJ6A 4BBNF 1IYFA 1YD8U 4M01A 2D3GA 5CHWA 2N1VA 2KWDA 4IWPA 1WXMA 1WGDA 4JGHB 2D3CA 2O6VA 2M19A 2MRPA 4ASWC 2J52A 3W5UB 3OG5A 1S3SG 3EHVA 3SFEB 3CMMB 4FULA 1DOYA 2MCNB 2N9EB 2ASQA 2PE6B 2KDMA 2Z0DB 4B6WA 5EE3A 3C19A 3PVLA 2MP2A 3GZNB 4WJOA 3Q69A 4NAWA 1KFYB 3QWZB 4WJQA 1ROEA 4WURA 3DDCB 1DOXA 3UF8A 2RR9A 3I9V1 3AEFB 4OZCA 3VTWA 4M0WA 2RMMA 4ZYSA 3IT4B 2D3AA 3NOBA 2CHZA 2BYTA 1K53A 2Y5CA 2AEHA 1KLUD 2DWQA 4DQOC 1OTRB 2QJLA 4S0RA 2K6DB 3TL5A 1YQBA 1TZ1A 4AP4C 4XC2A 3VFKA 1T0RC 3VHTC 2NPTB 4HJKA 4DHZB 4OVZA 4KX6B 2N1WA 1YNTE 4W9KA 1LQBA 4YXDB 2KVZA 2L76A 3NVYA 2MBQA 1L6UA 4HKZE 1PUTA 2HJ1A 1WX8A 1WZ3A 1C76A 2FCMA 3QCAA 4S17A 2KZRA 3DHIC 2JUOA 3IT6B 2Y3AA 1KLGD 5G5GA 5IOIA 2KOXA 3L54A 2MEKA 2XNAC 5D2MB 4KGSA 1EU3A 5TSSA 1V86A 4II2B 1MG8A 1NENB 1UD7A 2JPHA 3KQ4A 2IPKD 2O6VD 2YEPB 3ZW3A 2M0AA 3DVGX 4P6VF 3Q2AC 3CSTA 3C0RB 3SFDB 1KJTA 4NZLB 4UDUC 3RULA 3Q8EA 3DHHC 3HK0A 5C23A 3ZJTA 3BYTB 3AEGB 3RUIB 2FE8A 2IGDA 1E8YA 2Q5WD 4BKSA 1T6BX 1LM8B 1YJ1A 4XDDA 5FR6A 3OAWA 1WE7A 5DCNA 4RNAA 3A9JA 4LLGM 2N9LA 1JRUA 2GB1A 3BK1A 3Q3OC 2AQ2B 2M56B 3ZNGC 3JYUA 1FXTB 1F77A 2JVCA 5BMGA 4WWNA 4WWPA 1QQRA 4MH0E 4BOSC 2QSDA 1JWUD 4IKGA 1E7VA 5E6JA 2LJIA 3W1SA 1JROA 1CZPA 4HCNB 1FD6A 2KO3A 2NBVB 2C9WB 1TGZB 3AE4B 2ON8A 2ZZPB 3U7ZA 1MHXA 2N9PC 4YL8A 2VRRB 2LD9A 4KZCA 2O6VB 1E9MA 2KN5A 1WXVA 2KAJA 3A33B 2K6QA 2J53A 3NG0A 1RM6C 2HD5B 2KQ7A 1TS5A 4NJ7A 2BYVE 3Q8CA 3RZWC 2ZCBA 2ZEQA 2W3SA 4C7YA 3MC8A 1SJHD 2PVOD 4MM3B 3W2DA 1B9RA 5IP4D 4WJNA 4P1CC 1E7PB 4RGTA 4A3PA 4YSYB 2LI5A 2PEAA 2N9KA 3N20C 5IA7A 4LTUA 1RFKA 4C56C 1H8CA 4DXFA 2B3AA 2DBYA 1HTQA 2J42A 1XXGA 2LEKA 1GC6A 2INDC 5CHFA 3EECA 3AE5B 2W82A 4EOYA 2A4ZA 2FCNA 2WNMA 1HEZE 3VR8B 2KQ4X 1J7AA 1WGKA 2BF8B 3I5JC 4BKSD 3ZLZA 2J0KA 2R61A 1BXTA 2KXJA 1IGDA 2SEBD 5E6NA 1E0ZA 1ACCA 1IBXA 4CHKA 3O65B 2BS3B 1TY2A 3AB5A 2MLBA 2GLSA 3PGEA 3R66C 2JY6A 4NQLB 5KHOA 3NY5A 4FXCA 1WJ6A 1ESFA 2MSED 4M8NA 4K3BA 3CWIA 4KSKC 1EF1A 4A9AA 1UGMA 1FM0D 5C3JB 2IO0B 3AU4A 4RGNA 1E8ZA 1F52A 2GBJA 2K0PA 2WXHA 4DWFA 2V9HA 4LNIA 3VTUA 4GGQA 4HLEA 3EGRA 3PHXB 4XX5A 4IWOA 4LCDE 2INNE 3VRBB 1JWAD 5AZHA 5E6PA 2GI9A 4MDKE 3IHPC 5HKHA 3PZ7A 2KMMA 3N1YC 2W55A 3JSVB 2JYEA 1WR1A 5G55A 3CSFA 2KC2A 3AE3B 4DHZE 1YX5B 1GAQB 1WMHA 2NBWB 4OHJA 1XT9B 1Y56A 4NPNA 3AH7A 4RF1A 1VCBA 1MVKA 2LGYA 2BS4B 2GMIC 4P7IA 1FNUA 1V80A 3OLMD 2XK5B 1G6JA 2KYWA 3KUCB 3IVFA 1UH6A 2EKEC 1GB4A 4ANUA 3I57A 2BW2A 1ET9A 3NS1A 1P98A 1LFDA 1YMHE 2LZ6A 4LJOB 2QHOA 1JMLA 3AN1A 1C1YB 2FCQA 5LLIA 3TMPB 2MA9B 1K8RB 1J7BA 1GG3A 4IWQA 4EZJA 2WYQA 2JZPA 2O2VA 3NZ3A 3DCGA 4WJPA 2MX2A 3B2GA 1V97A 4BAXA 2WXMA 1L4DB 2GRIA 3PSEB 4M8MA 2LFIA 3ENEA 4ZHOA 2WU2B 2IGHA 3AU5A 1SJED 2KT7A 1D4BA 1V9JA 4QAYA 3OJ4B 5BYSA 4IDIA 1KOTA 4Q2JA 4HPPA 2Z8LA 2QIEB 3PHWB 1V6EA 2MJEA 1OFFA 2L7RA 4EE2A 1IUEA 3LDZE 4W9DA 2AL3A 2BT6A 4ZRPA 3E9SA 3QK0A 4F1SA 4BFRA 3VH3B 4YTNB 2DAFA 2GBMA 2YEPF 1SB3C 3GOEA 5DPTA 4JX1C 3DWMA 2AX5A 2WGSA 4DBGA 2AWTA 1UBIA 1UWXA 2K8BA 3HM3A 4US8A 2I1KA 4RGMA 3RNBC 1NEKB 4P16A 2RDHA 3AE6B 3B2FA 1S1QB 3AEBB 3BIID 4C4VB 4CO7A 2LGXA 3QA8A 1I35A 3Q3MC 4XWWA
chains in the Genus database with same CATH topology
3DVNU 3ZTDA 2J0MA 2JRIB 2CU1A 2IZVB 2Z0DB 3ZIMA 4TQ1A 4EKUA 4B6WA 1EUVB 3RD2A 2FAZA 3PVLA 2HE7A 2MP2A 4WJOA 2N7EA 1WJUA 5J18A 4NAWA 4PS8A 3NHEB 3A9KB 3QQ8B 3QJZA 1E7UA 3QC8B 3QWZB 2KWCA 3M62B 2KJRA 4WJQA 3VUXA 3WAMA 3UIPB 2MW5A 2ZPNA 3TJPA 1J19A 1WH3A 1E90A 3DDCB 5L95C 2MBHA 3UF8A 2RR9A 3VTWA 3PRZA 1EF5A 1Q5WB 1NI2A 2C60A 3A9JB 3UIOB 4HPLB 3MJWA 1R4NI 3NOBA 3V62A 3L16A 2CHZA 5J17A 3PZDA 4AJWA 1OEYA 2AEHA 4FJVB 3ZKJC 2G3QB 3T9LA 1OTRB 3PTFC 5DPWA 2DYOA 2K6DB 4NQKE 2K39A 3TL5A 4G3XB 3R7QA 4K7UA 4MEMA 3WAOA 1YQBA 1TZ1A 1WFYA 4AP4C 4E3CA 4XC2A 3VFKA 3VHTC 3JVZX 2NPTB 3A4RA 1V2YA 4HJKA 3VUYA 4DHZB 3DPDA 2N1WA 4W9KA 4MJSA 1LQBA 2EMTA 1WM3A 3R7RA 2L76A 2DZIA 3IG3A 4GB9A 4CYEA 1RRBA 3DVNV 2MBQA 4FLHA 2ZNVB 1WGGA 2KDFB 4MELA 4HWIB 1SE9A 1IP9A 1WX8A 1WZ3A 2FUHB 2FCMA 3QCAA 4EZKA 1LXDA 2FIDA 2K8HA 4IM0A 2KZRA 3DOWA 4BKGA 3UINB 3X0WA 2YLMA 2JUOA 2L0TA 2OOBB 2NS5A 2NCNA 2KOXA 2DAJA 4X57B 1KLVA 2LWPA 2N4FA 3TIXA 3L54A 1UZXB 2NBUA 2CS4A 2LXCA 2ZJDA 2YVCA 3D32A 5D2MB 3SHQA 1V86A 3KYCD 3NS8A 4II2B 1ZGUB 4ZYNA 2M0XA 5L83A 1MG8A 1UD7A 5IAAC 2JPHA 4B95A 2UYZB 4ZRIA 1WGYA 4KIKB 3RT3B 1WJ4A 4BVUC 5G2NA 4HVBA 5BO4B 3ONSA 3M95A 3WIMA 2EMSA 2O6VD 3ZW3A 4BBNC 3BY4B 3ML9A 3ALBA 3QHTA 4II3B 3ZRFA 3DVGX 2CHXA 3WA0A 3CSTA 3PPAA 3A1QB 3C0RB 2G4DB 2L8JA 1KJTA 1P0RA 4PYZA 3ZDTA 1VD2A 3RULA 3VTVA 2GOWA 4GDKA 5J2RA 2IBIB 4GN1A 4GU2A 2BKRB 2Z59B 3HK0A 4KDIC 5CHVC 2BPSA 2XBBC 2KD0A 1ZW7A 3Q3JA 5C23A 4URKA 3VUWA 3DBHI 3KW5B 2RGFA 2JXXA 2LJ5A 3RUIB 3AULA 2D11A 3RYTA 3A9KA 4TV3A 3PRMB 1E8YA 3APCA 1V5OA 4BKSA 1YJ1A 1LM8B 1UELA 2GBNA 3HM6X 4OVUA 4G11A 5FR6A 3OAWA 1WE7A 1WM2A 3B1LX 5DCNA 2JZ3B 2HTHA 3A9JA 4AUQC 1WIAA 1M94A 5LXHA 1JRUA 4IUMB 4FJZA 2C7MB 5DPSA 4KSLC 5D7GA 3WALA 1L2NA 3ZNGC 2KVRA 2MQJA 2FIFA 1ZKHA 3PLUA 3U7DA 3JYUA 1FXTB 2N7DA 2JVCA 3PV1A 4WWNA 2KANA 1R4MI 2NPTA 1KM7A 1GUAB 2ZVOA 2LUEA 4WWPA 5AZFA 2KTRB 4MH0E 4BOSC 5D94A 1WGHA 2PPHA 3KUZA 3QARA 1E7VA 2KKCA 3W1SA 4EFOA 4HCNB 3T8MA 3ECIA 2LVQA 2KO3A 2KFJA 2NBVB 2N9XA 2DZKA 2L3ZA 2K8CA 4J6IA 3U30A 4K81A 3QAQA 2KX0A 2C9WB 2DHZA 3PRPB 4LDTD 1TTNA 3S2AA 1TGZB 4ANVA 4ICUA 3L13A 2ZZPB 2NVUI 2MWSB 4G50A 4GMVA 2N9PC 3ZNHB 4YL8A 2VRRB 2WDTB 2LD9A 2K25A 1NBFC 4TUUA 1YX6B 4KZCA 2O6VB 2M4NA 2KN5A 1WXVA 3A33B 1WE6A 2IO1B 3TBLD 4IC7B 2K6QA 4IM2A 2KDBA 1I42A 1D3ZA 3ZNID 3ZRCA 2HD5B 2KQ7A 4E74A 2M8SA 2WWZA 4NJ7A 2JT4B 2J7QB 4DK5A 2BYVE 2JRHA 3RZWC 4KIKA 2ZCBA 2ZEQA 2BYFA 4GIVA 4W9IA 4GDLA 3V6CB 1UBQA 4WJNA 4HDOA 3IFWB 4KDLB 3KVFB 2ZCCA 2MBOA 3N32A 4A3PA 3A1QA 3LJ3A 1P1AA 2LI5A 3ZNZB 2PEAA 3AXCA 2DYBA 5IA7A 4BOZB 4A3OA 2KTFA 2C7HA 4JIOU 2RD0A 3AI5A 1H8CA 4OVVA 2B3AA 2KLCA 2CR5A 4MSMB 4W9JA 3B08A 4ANXA 3L08A 3QX1A 4XZ4A 3CF6E 2NR2A 1P3QU 4FHJA 1GC6A 4DDGD 2IO3B 3N30A 1WMHB 2KK8A 5CHFA 1V49A 3EECA 4AJYB 4EOYA 2A4ZA 2FCNA 5TR5A 5D6JB 3VQIA 1WGRA 4TQ0A 2BYEA 2BWES 2KMCA 2M1MA 4DDID 1EO6A 2W9NA 1J8CA 2BF8B 2IYDB 2R2QA 3ZLZA 4BKSD 3APDA 2M17A 2J0KA 2KFKB 3PLVA 2KXJA 2WX0A 3P2BA 3RZFA 2KWVB 3ZVVA 5E6NA 2LXAA 3DBRI 2C5LC 5DPRA 1Z5SB 2UWQA 1A5RA 4MJSB 4CHKA 3O65B 3DBLI 2RSUA 2MLBA 1WRDB 4LDTB 5KHQA 3PGEA 4GSWA 4WAAA 2LVPA 3R66C 4WQOB 4W9HA 2JY6A 1SGHA 1XQQA 2KTRA 1AARA 4NQLB 3EC8A 5KHOA 3HHMA 3NY5A 3PT2B 1BT0A 2LGDA 3VAWA 4JLCA 3WAPA 1F9JA 1WJ6A 3W1YA 3KH0A 4RMAA 2MSED 4M8NA 2CKHB 4LJPB 4G0NB 3H1UA 1T0YA 4KSKC 2O2VB 3V60A 4IW0A 3R3MA 5JHAA 1EF1A 1UGMA 4HK2A 3PREA 1RAXA 3NZSA 1ISNA 1L7YA 2IO0B 1H4RA 1IPGA 2KDEB 3OJ3A 4ZDVA 3ML8A 5JHBA 2Y5BB 3K9OB 3AU4A 2KJHB 1Z2MA 1NDDA 1E8ZA 4MGYE 4ZRJA 3ZO5B 4W9CA 4F7ZA 4HDQA 2GBJA 2JZZA 4W9LA 2HJ8A 1WR6E 4DWFA 1Q0WB 3H7PB 3VTUA 3SU8X 4GOCA 3H6NA 4GGQA 2PE9A 4HLEA 3PHXB 1OEYJ 2KLGA 1OQYA 2KQSA 4JQWC 4XX5A 3QIJA 2FCSA 4IWOA 2FNJB 4PS7A 1WXAA 3MHSD 2RPQA 5JH5C 2D07B 1E8XA 4LCDE 4I6LB 4KZ0A 4MM3A 5CX3A 3M3JA 4ZRKA 2MBBB 4W9EA 1WYWB 2OJRA 4AOFA 4GDKB 2KMAA 5AZHA 3IBEA 2K1FA 4MDKE 5E6PA 1U4AA 2L00B 3IHPC 2L05A 5HKHA 2MBEA 2DZJA 2BGFA 3JSVB 4DXAB 2G4SA 1WR1A 1SIFA 4PS3A 5G55A 3DQVA 3CSFA 2KC2A 1WX7A 2V3SA 3DVGY 4DHZE 4MGKE 2AYOB 1CMXB 1J0GA 4NNJB 1YX5B 4A20A 2REXA 2KWUB 3U8ZA 2GBRA 4N9F4 4RM8A 1WMHA 2NBWB 1XT9B 3NZUA 4I6NB 5JZEB 4NPNA 3VDZA 3VH4B 1Q1OA 1VCBA 2IY1B 3I3TB 3X23A 4ICVA 5AZGA 1Y8RC 2LGYA 4GXBA 2A5UA 3RCZA 2GBKA 3WANA 4KVGB 2GMIC 5EDSA 1GJZA 3BINA 2KDIA 1V80A 3OLMD 4P7IA 4MGZE 2XK5B 3EFUA 1G6JA 1XD3B 3KUCB 3N3KB 2CHWA 4FADA 4B9KA 3IVFA 1UH6A 2EKEC 3UGBB 2KFKA 4ANUA 4EUTA 4F8CB 4RM9A 2ZPYA 1P98A 3DBSA 1LFDA 4MGIE 3ZTCA 2JF5A 2LZ6A 2L0FA 2MP2B 4LJOB 4NAWB 2DX5B 4DHJD 2LRUA 2DZMA 2AL6A 2QHOA 4MSQB 2KC1A 1V81A 1PQSA 1TBEA 2D10A 3JW0X 2IO2B 4W9FA 1QZEA 1C1YB 2FCQA 5LLIA 3TMPB 3VVWB 1WZ0A 3V61A 3A4SC 2MA9B 3KYDD 4M0WB 4TKNA 2BWFA 1RFAA 3W1SC 1E5WA 2KHWB 2KX3A 2LVOA 1K8RB 5GMVA 4AWJA 4IG7B 3V6EB 4ANWA 1GG3A 2ZNVC 4IWQA 4K1RB 2D2QA 4EZJA 4HPMB 2WYQA 2C7NB 3HIZA 3KUDB 4HCPB 4HXDA 4PYUA 2O2VA 4I6PA 2R2OA 2BKFA 1OGWA 3DCGA 4WJPA 4FBJB 5C1ZA 2MX2A 1C3TA 4JL9A 1RLFA 3B0AA 1HE8A 3Q3FA 4FA6A 1GC7A 2V1YA 3PSEB 5E6OA 3ZDMC 4M8MA 4E71A 3ENEA 2G45B 3AU5A 2KNBA 4KV2A 1V9JA 2LRWA 3H7PA 3OJ4B 1KOTA 5CTRC 3SDLC 2DENB 2J0JA 2I1JA 3PHWB 1V6EA 1WF9A 3PS6A 4GDLB 2V4LA 4EZLA 2L7RA 4NY0A 2LASA 3LDZE 2Z0EB 2DYMA 4W9DA 3VXWA 4EEWA 2AL3A 3M63B 2JWZA 2PJHA 2IY0B 1WXSA 3L0WB 1GNUA 1WX9A 2KJ6A 4BBNF 4BKTA 3QK0A 1YD8U 4F1SA 4BFRA 1IYFA 3VH3B 2D3GA 1WJNA 3ZUNA 3L17A 2DAFA 2GBMA 1V5TA 1WY8A 5CHWA 1X1MA 2N1VA 3UQBA 4IWPA 5AEKB 4FHKA 3JSVA 1WXMA 3GOEA 5DPTA 4FN2A 1WGDA 1WI0A 3H9DA 4JGHB 4W9GA 3L10B 3APFA 2O6VA 4WWOA 4DBGA 2AWTA 4IM3A 2MRPA 4ASWC 1UBIA 2K8BA 3HM3A 4FJYA 3MTNB 4K7SA 2I1KA 1S3SG 3EHVA 3CMMB 4FULA 1P9DU 1YIWA 4K7WA 2MCNB 4NJ6A 2ZVNA 1S1QB 3SD5A 4DHJB 3TCAA 1E8WA 4CO7A 2LGXA 3H7SA 3QA8A 1I35A 3GZNI 3K9PB 2N9EB 2WX1A 2XEWA 2ASQA 2XK5A 5LXIB 2PE6B 3UQAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3DVN U;  3ZTD A;  2J0M A;  2JRI B;  2CU1 A;  2IZV B;  2Z0D B;  3ZIM A;  4TQ1 A;  4EKU A;  4B6W A;  1EUV B;  3RD2 A;  2FAZ A;  3PVL A;  2HE7 A;  2MP2 A;  4WJO A;  2N7E A;  1WJU A;  5J18 A;  4NAW A;  4PS8 A;  3NHE B;  3A9K B;  3QQ8 B;  3QJZ A;  1E7U A;  3QC8 B;  3QWZ B;  2KWC A;  3M62 B;  2KJR A;  4WJQ A;  3VUX A;  3WAM A;  3UIP B;  2MW5 A;  2ZPN A;  3TJP A;  1J19 A;  1WH3 A;  1E90 A;  3DDC B;  5L95 C;  2MBH A;  3UF8 A;  2RR9 A;  3VTW A;  3PRZ A;  1EF5 A;  1Q5W B;  1NI2 A;  2C60 A;  3A9J B;  3UIO B;  4HPL B;  3MJW A;  1R4N I;  3NOB A;  3V62 A;  3L16 A;  2CHZ A;  5J17 A;  3PZD A;  4AJW A;  1OEY A;  2AEH A;  4FJV B;  3ZKJ C;  2G3Q B;  3T9L A;  1OTR B;  3PTF C;  5DPW A;  2DYO A;  2K6D B;  4NQK E;  2K39 A;  3TL5 A;  4G3X B;  3R7Q A;  4K7U A;  4MEM A;  3WAO A;  1YQB A;  1TZ1 A;  1WFY A;  4AP4 C;  4E3C A;  4XC2 A;  3VFK A;  3VHT C;  3JVZ X;  2NPT B;  3A4R A;  1V2Y A;  4HJK A;  3VUY A;  4DHZ B;  3DPD A;  2N1W A;  4W9K A;  4MJS A;  1LQB A;  2EMT A;  1WM3 A;  3R7R A;  2L76 A;  2DZI A;  3IG3 A;  4GB9 A;  4CYE A;  1RRB A;  3DVN V;  2MBQ A;  4FLH A;  2ZNV B;  1WGG A;  2KDF B;  4MEL A;  4HWI B;  1SE9 A;  1IP9 A;  1WX8 A;  1WZ3 A;  2FUH B;  2FCM A;  3QCA A;  4EZK A;  1LXD A;  2FID A;  2K8H A;  4IM0 A;  2KZR A;  3DOW A;  4BKG A;  3UIN B;  3X0W A;  2YLM A;  2JUO A;  2L0T A;  2OOB B;  2NS5 A;  2NCN A;  2KOX A;  2DAJ A;  4X57 B;  1KLV A;  2LWP A;  2N4F A;  3TIX A;  3L54 A;  1UZX B;  2NBU A;  2CS4 A;  2LXC A;  2ZJD A;  2YVC A;  3D32 A;  5D2M B;  3SHQ A;  1V86 A;  3KYC D;  3NS8 A;  4II2 B;  1ZGU B;  4ZYN A;  2M0X A;  5L83 A;  1MG8 A;  1UD7 A;  5IAA C;  2JPH A;  4B95 A;  2UYZ B;  4ZRI A;  1WGY A;  4KIK B;  3RT3 B;  1WJ4 A;  4BVU C;  5G2N A;  4HVB A;  5BO4 B;  3ONS A;  3M95 A;  3WIM A;  2EMS A;  2O6V D;  3ZW3 A;  4BBN C;  3BY4 B;  3ML9 A;  3ALB A;  3QHT A;  4II3 B;  3ZRF A;  3DVG X;  2CHX A;  3WA0 A;  3CST A;  3PPA A;  3A1Q B;  3C0R B;  2G4D B;  2L8J A;  1KJT A;  1P0R A;  4PYZ A;  3ZDT A;  1VD2 A;  3RUL A;  3VTV A;  2GOW A;  4GDK A;  5J2R A;  2IBI B;  4GN1 A;  4GU2 A;  2BKR B;  2Z59 B;  3HK0 A;  4KDI C;  5CHV C;  2BPS A;  2XBB C;  2KD0 A;  1ZW7 A;  3Q3J A;  5C23 A;  4URK A;  3VUW A;  3DBH I;  3KW5 B;  2RGF A;  2JXX A;  2LJ5 A;  3RUI B;  3AUL A;  2D11 A;  3RYT A;  3A9K A;  4TV3 A;  3PRM B;  1E8Y A;  3APC A;  1V5O A;  4BKS A;  1YJ1 A;  1LM8 B;  1UEL A;  2GBN A;  3HM6 X;  4OVU A;  4G11 A;  5FR6 A;  3OAW A;  1WE7 A;  1WM2 A;  3B1L X;  5DCN A;  2JZ3 B;  2HTH A;  3A9J A;  4AUQ C;  1WIA A;  1M94 A;  5LXH A;  1JRU A;  4IUM B;  4FJZ A;  2C7M B;  5DPS A;  4KSL C;  5D7G A;  3WAL A;  1L2N A;  3ZNG C;  2KVR A;  2MQJ A;  2FIF A;  1ZKH A;  3PLU A;  3U7D A;  3JYU A;  1FXT B;  2N7D A;  2JVC A;  3PV1 A;  4WWN A;  2KAN A;  1R4M I;  2NPT A;  1KM7 A;  1GUA B;  2ZVO A;  2LUE A;  4WWP A;  5AZF A;  2KTR B;  4MH0 E;  4BOS C;  5D94 A;  1WGH A;  2PPH A;  3KUZ A;  3QAR A;  1E7V A;  2KKC A;  3W1S A;  4EFO A;  4HCN B;  3T8M A;  3ECI A;  2LVQ A;  2KO3 A;  2KFJ A;  2NBV B;  2N9X A;  2DZK A;  2L3Z A;  2K8C A;  4J6I A;  3U30 A;  4K81 A;  3QAQ A;  2KX0 A;  2C9W B;  2DHZ A;  3PRP B;  4LDT D;  1TTN A;  3S2A A;  1TGZ B;  4ANV A;  4ICU A;  3L13 A;  2ZZP B;  2NVU I;  2MWS B;  4G50 A;  4GMV A;  2N9P C;  3ZNH B;  4YL8 A;  2VRR B;  2WDT B;  2LD9 A;  2K25 A;  1NBF C;  4TUU A;  1YX6 B;  4KZC A;  2O6V B;  2M4N A;  2KN5 A;  1WXV A;  3A33 B;  1WE6 A;  2IO1 B;  3TBL D;  4IC7 B;  2K6Q A;  4IM2 A;  2KDB A;  1I42 A;  1D3Z A;  3ZNI D;  3ZRC A;  2HD5 B;  2KQ7 A;  4E74 A;  2M8S A;  2WWZ A;  4NJ7 A;  2JT4 B;  2J7Q B;  4DK5 A;  2BYV E;  2JRH A;  3RZW C;  4KIK A;  2ZCB A;  2ZEQ A;  2BYF A;  4GIV A;  4W9I A;  4GDL A;  3V6C B;  1UBQ A;  4WJN A;  4HDO A;  3IFW B;  4KDL B;  3KVF B;  2ZCC A;  2MBO A;  3N32 A;  4A3P A;  3A1Q A;  3LJ3 A;  1P1A A;  2LI5 A;  3ZNZ B;  2PEA A;  3AXC A;  2DYB A;  5IA7 A;  4BOZ B;  4A3O A;  2KTF A;  2C7H A;  4JIO U;  2RD0 A;  3AI5 A;  1H8C A;  4OVV A;  2B3A A;  2KLC A;  2CR5 A;  4MSM B;  4W9J A;  3B08 A;  4ANX A;  3L08 A;  3QX1 A;  4XZ4 A;  3CF6 E;  2NR2 A;  1P3Q U;  4FHJ A;  1GC6 A;  4DDG D;  2IO3 B;  3N30 A;  1WMH B;  2KK8 A;  5CHF A;  1V49 A;  3EEC A;  4AJY B;  4EOY A;  2A4Z A;  2FCN A;  5TR5 A;  5D6J B;  3VQI A;  1WGR A;  4TQ0 A;  2BYE A;  2BWE S;  2KMC A;  2M1M A;  4DDI D;  1EO6 A;  2W9N A;  1J8C A;  2BF8 B;  2IYD B;  2R2Q A;  3ZLZ A;  4BKS D;  3APD A;  2M17 A;  2J0K A;  2KFK B;  3PLV A;  2KXJ A;  2WX0 A;  3P2B A;  3RZF A;  2KWV B;  3ZVV A;  5E6N A;  2LXA A;  3DBR I;  2C5L C;  5DPR A;  1Z5S B;  2UWQ A;  1A5R A;  4MJS B;  4CHK A;  3O65 B;  3DBL I;  2RSU A;  2MLB A;  1WRD B;  4LDT B;  5KHQ A;  3PGE A;  4GSW A;  4WAA A;  2LVP A;  3R66 C;  4WQO B;  4W9H A;  2JY6 A;  1SGH A;  1XQQ A;  2KTR A;  1AAR A;  4NQL B;  3EC8 A;  5KHO A;  3HHM A;  3NY5 A;  3PT2 B;  1BT0 A;  2LGD A;  3VAW A;  4JLC A;  3WAP A;  1F9J A;  1WJ6 A;  3W1Y A;  3KH0 A;  4RMA A;  2MSE D;  4M8N A;  2CKH B;  4LJP B;  4G0N B;  3H1U A;  1T0Y A;  4KSK C;  2O2V B;  3V60 A;  4IW0 A;  3R3M A;  5JHA A;  1EF1 A;  1UGM A;  4HK2 A;  3PRE A;  1RAX A;  3NZS A;  1ISN A;  1L7Y A;  2IO0 B;  1H4R A;  1IPG A;  2KDE B;  3OJ3 A;  4ZDV A;  3ML8 A;  5JHB A;  2Y5B B;  3K9O B;  3AU4 A;  2KJH B;  1Z2M A;  1NDD A;  1E8Z A;  4MGY E;  4ZRJ A;  3ZO5 B;  4W9C A;  4F7Z A;  4HDQ A;  2GBJ A;  2JZZ A;  4W9L A;  2HJ8 A;  1WR6 E;  4DWF A;  1Q0W B;  3H7P B;  3VTU A;  3SU8 X;  4GOC A;  3H6N A;  4GGQ A;  2PE9 A;  4HLE A;  3PHX B;  1OEY J;  2KLG A;  1OQY A;  2KQS A;  4JQW C;  4XX5 A;  3QIJ A;  2FCS A;  4IWO A;  2FNJ B;  4PS7 A;  1WXA A;  3MHS D;  2RPQ A;  5JH5 C;  2D07 B;  1E8X A;  4LCD E;  4I6L B;  4KZ0 A;  4MM3 A;  5CX3 A;  3M3J A;  4ZRK A;  2MBB B;  4W9E A;  1WYW B;  2OJR A;  4AOF A;  4GDK B;  2KMA A;  5AZH A;  3IBE A;  2K1F A;  4MDK E;  5E6P A;  1U4A A;  2L00 B;  3IHP C;  2L05 A;  5HKH A;  2MBE A;  2DZJ A;  2BGF A;  3JSV B;  4DXA B;  2G4S A;  1WR1 A;  1SIF A;  4PS3 A;  5G55 A;  3DQV A;  3CSF A;  2KC2 A;  1WX7 A;  2V3S A;  3DVG Y;  4DHZ E;  4MGK E;  2AYO B;  1CMX B;  1J0G A;  4NNJ B;  1YX5 B;  4A20 A;  2REX A;  2KWU B;  3U8Z A;  2GBR A;  4N9F 4;  4RM8 A;  1WMH A;  2NBW B;  1XT9 B;  3NZU A;  4I6N B;  5JZE B;  4NPN A;  3VDZ A;  3VH4 B;  1Q1O A;  1VCB A;  2IY1 B;  3I3T B;  3X23 A;  4ICV A;  5AZG A;  1Y8R C;  2LGY A;  4GXB A;  2A5U A;  3RCZ A;  2GBK A;  3WAN A;  4KVG B;  2GMI C;  5EDS A;  1GJZ A;  3BIN A;  2KDI A;  1V80 A;  3OLM D;  4P7I A;  4MGZ E;  2XK5 B;  3EFU A;  1G6J A;  1XD3 B;  3KUC B;  3N3K B;  2CHW A;  4FAD A;  4B9K A;  3IVF A;  1UH6 A;  2EKE C;  3UGB B;  2KFK A;  4ANU A;  4EUT A;  4F8C B;  4RM9 A;  2ZPY A;  1P98 A;  3DBS A;  1LFD A;  4MGI E;  3ZTC A;  2JF5 A;  2LZ6 A;  2L0F A;  2MP2 B;  4LJO B;  4NAW B;  2DX5 B;  4DHJ D;  2LRU A;  2DZM A;  2AL6 A;  2QHO A;  4MSQ B;  2KC1 A;  1V81 A;  1PQS A;  1TBE A;  2D10 A;  3JW0 X;  2IO2 B;  4W9F A;  1QZE A;  1C1Y B;  2FCQ A;  5LLI A;  3TMP B;  3VVW B;  1WZ0 A;  3V61 A;  3A4S C;  2MA9 B;  3KYD D;  4M0W B;  4TKN A;  2BWF A;  1RFA A;  3W1S C;  1E5W A;  2KHW B;  2KX3 A;  2LVO A;  1K8R B;  5GMV A;  4AWJ A;  4IG7 B;  3V6E B;  4ANW A;  1GG3 A;  2ZNV C;  4IWQ A;  4K1R B;  2D2Q A;  4EZJ A;  4HPM B;  2WYQ A;  2C7N B;  3HIZ A;  3KUD B;  4HCP B;  4HXD A;  4PYU A;  2O2V A;  4I6P A;  2R2O A;  2BKF A;  1OGW A;  3DCG A;  4WJP A;  4FBJ B;  5C1Z A;  2MX2 A;  1C3T A;  4JL9 A;  1RLF A;  3B0A A;  1HE8 A;  3Q3F A;  4FA6 A;  1GC7 A;  2V1Y A;  3PSE B;  5E6O A;  3ZDM C;  4M8M A;  4E71 A;  3ENE A;  2G45 B;  3AU5 A;  2KNB A;  4KV2 A;  1V9J A;  2LRW A;  3H7P A;  3OJ4 B;  1KOT A;  5CTR C;  3SDL C;  2DEN B;  2J0J A;  2I1J A;  3PHW B;  1V6E A;  1WF9 A;  3PS6 A;  4GDL B;  2V4L A;  4EZL A;  2L7R A;  4NY0 A;  2LAS A;  3LDZ E;  2Z0E B;  2DYM A;  4W9D A;  3VXW A;  4EEW A;  2AL3 A;  3M63 B;  2JWZ A;  2PJH A;  2IY0 B;  1WXS A;  3L0W B;  1GNU A;  1WX9 A;  2KJ6 A;  4BBN F;  4BKT A;  3QK0 A;  1YD8 U;  4F1S A;  4BFR A;  1IYF A;  3VH3 B;  2D3G A;  1WJN A;  3ZUN A;  3L17 A;  2DAF A;  2GBM A;  1V5T A;  1WY8 A;  5CHW A;  1X1M A;  2N1V A;  3UQB A;  4IWP A;  5AEK B;  4FHK A;  3JSV A;  1WXM A;  3GOE A;  5DPT A;  4FN2 A;  1WGD A;  1WI0 A;  3H9D A;  4JGH B;  4W9G A;  3L10 B;  3APF A;  2O6V A;  4WWO A;  4DBG A;  2AWT A;  4IM3 A;  2MRP A;  4ASW C;  1UBI A;  2K8B A;  3HM3 A;  4FJY A;  3MTN B;  4K7S A;  2I1K A;  1S3S G;  3EHV A;  3CMM B;  4FUL A;  1P9D U;  1YIW A;  4K7W A;  2MCN B;  4NJ6 A;  2ZVN A;  1S1Q B;  3SD5 A;  4DHJ B;  3TCA A;  1E8W A;  4CO7 A;  2LGX A;  3H7S A;  3QA8 A;  1I35 A;  3GZN I;  3K9P B;  2N9E B;  2WX1 A;  2XEW A;  2ASQ A;  2XK5 A;  5LXI B;  2PE6 B;  3UQA A; 
#chains in the Genus database with same CATH topology
 2INC C;  4M00 A;  2CU1 A;  1IGC A;  2AQ3 B;  5J18 A;  1WJU A;  3NHE B;  1E7U A;  1YJJ A;  2KWC A;  1I4Q A;  2KJR A;  3VUX A;  3WAM A;  1J19 A;  1WH3 A;  4CQN A;  2PVG C;  2QIL A;  1FRR A;  1BUI C;  2C60 A;  2WP9 B;  1TJE A;  3UIO B;  1HQR D;  1R4N I;  3L16 A;  4YSZ B;  4AJW A;  4FJV B;  2V4I B;  3T9L A;  3PTF C;  5DPW A;  2DYO A;  4REZ A;  4K7U A;  2JYT A;  4MEM A;  4D2K A;  3WAO A;  1WFY A;  4E3C A;  3OWE B;  1V2Y A;  3Q14 C;  3RNF C;  4MJS A;  3TUO A;  5IO9 A;  4GB9 A;  1RRB A;  3RNA C;  3SEB A;  1V1P A;  2ZNV B;  1WGG A;  4N6E B;  2BTE A;  4BZA A;  4HWI B;  4JWU C;  2FID A;  4TMA B;  1RWS A;  2AQ1 B;  2DLB A;  1XLO A;  2L0T A;  2NCN A;  2DAJ A;  4X57 B;  2LGS A;  2N4F A;  5I4D A;  2FBW B;  1T3Q A;  2CS4 A;  2QMT A;  1ZGU B;  4ZYN A;  1AWD A;  5IAA C;  2G1E A;  2UYZ B;  2WXR A;  4KIK B;  4BVU C;  5BMH A;  1EWY C;  3DWG C;  2H89 B;  3ALB A;  3QHT A;  4II3 B;  3ZRF A;  5C2T B;  3A1Q B;  2L8J A;  4JE3 B;  3TSS A;  4GDK A;  3NUH B;  2BKR B;  5CHV C;  1SEB D;  2XBB C;  4URK A;  3DBH I;  3GE8 C;  2RGF A;  2JXX A;  2LJ5 A;  1CK1 A;  3A9K A;  1FNW A;  2B76 B;  1P7F A;  4TV3 A;  3PRM B;  2FUG 1;  2HTM E;  1V5O A;  1WSP A;  1ZPS A;  1UEL A;  2GBN A;  1WM2 A;  3B1L X;  4AUQ C;  1WIA A;  1T0Q C;  1ZXH A;  3FIL B;  1M94 A;  2PW9 A;  1TKY A;  1XCT L;  2OJW A;  1CQV A;  3N9Y C;  3PV1 A;  1R4M I;  1GUA B;  2ZVO A;  4AS1 A;  3R2I A;  5AUK A;  3HVD A;  3GP7 A;  2ACZ B;  1B1Z A;  5BMI A;  3ECI A;  2LVQ A;  4J6I A;  3U30 A;  4ANV A;  4LDT D;  3S2A A;  1Q10 A;  3L13 A;  2NVU I;  2MWS B;  1UWM A;  2N0S B;  3L4P A;  1NBF C;  1YX6 B;  4A8X C;  2M4N A;  3TEZ A;  1WE6 A;  4PK1 A;  2KDB A;  4E74 A;  2WS3 B;  3AEC B;  2LMC A;  4GIV A;  4GDL A;  1UBQ A;  4HDO A;  1F0Z A;  2SAK A;  3LB8 C;  1QF6 A;  3IFW B;  2MBO A;  4LNK A;  2MHJ A;  4XE0 A;  2IJ0 A;  1VJK A;  2KLC A;  4YT0 B;  3AE2 B;  2CR5 A;  1QOB A;  2K9X A;  2XN9 C;  2BB5 A;  2OED A;  2KK8 A;  1V49 A;  4AJY B;  5TR5 A;  5D6J B;  1MG4 A;  1WGR A;  4TQ0 A;  4YSX B;  1C4P A;  2BWE S;  1L0X B;  1JQ4 A;  2M1M A;  1J8C A;  2M17 A;  2KFK B;  2KWV B;  5BYR A;  1FEH A;  2LXA A;  3EA6 A;  4LNO A;  1Z5S B;  2UWQ A;  3TEX A;  4MJS B;  3DBL I;  1WRD B;  4LDT B;  2LVP A;  1V1P B;  1XQQ A;  2KTR A;  1AAR A;  1N5W A;  3EC8 A;  3HHM A;  1BT0 A;  2LGI A;  2KAC A;  4RMA A;  1HZ5 A;  3RNG C;  5HG2 A;  3ZYY X;  2NTS A;  4IW0 A;  5JHA A;  1RAX A;  2ZW1 A;  1ISN A;  5JHB A;  3OJ3 A;  2V0G A;  1ET6 A;  1EU4 A;  3K9O B;  5HHD G;  2INP E;  2KJH B;  4ZRJ A;  4W9C A;  2K3U A;  4F7Z A;  3H7P B;  3SU8 X;  4GOC A;  3H6N A;  3NVV A;  2MJD A;  2KLG A;  2KQS A;  4JQW C;  3NVW A;  2FNJ B;  5JH5 C;  4KZ0 A;  3T3O A;  3BWU D;  4W9E A;  4C80 A;  3BVM A;  2WXO A;  4AOF A;  4GDK B;  2KMA A;  1M4V A;  1JWM D;  2L05 A;  2DZJ A;  2BGF A;  3AV8 A;  1MHH E;  2G4S A;  2NTT A;  3NRZ A;  1J0G A;  1L6V A;  2GBR A;  2ICI A;  1HA5 A;  2IDY A;  3VH4 B;  1Q1O A;  3I3T B;  4WAF A;  3X23 A;  2A5U A;  2GBK A;  4TSS A;  3N3K B;  4FAD A;  4B9K A;  4C7Z A;  3P42 A;  3U4E G;  3ZTC A;  2QCZ A;  1XCQ L;  4LNF A;  2BB6 A;  2L0F A;  2MP2 B;  1MPE A;  1SIJ A;  4NAW B;  4DHJ D;  1QT9 A;  4ITK A;  2LRU A;  2AL6 A;  3URY A;  1V81 A;  1TBE A;  3W9C B;  3Q8A A;  1YJI A;  1QZE A;  2CJO A;  3V61 A;  4M0W B;  2LVO A;  2EKI A;  2KX3 A;  1ZOY B;  3HIZ A;  1P7E A;  3KUD B;  3NJT A;  3FKY A;  2R2O A;  4N59 A;  4ACF A;  2WXG A;  1C3T A;  3ETR A;  1HE8 A;  4FA6 A;  2QEJ C;  2V1Y A;  3ZDM C;  2D3B A;  3SDL C;  2I1J A;  1ZE3 D;  4GDL B;  4XWT A;  3N1Z C;  1JW9 D;  2JWZ A;  4WQM A;  1WXS A;  1J7C A;  3ZUN A;  3L17 A;  1F2R C;  3H8H A;  1WY8 A;  1X1M A;  3UQB A;  2DNF A;  4FN2 A;  3MC9 A;  4W9G A;  2L52 A;  3L10 B;  3APF A;  1BML C;  4NJC A;  1LGR A;  1C78 A;  3EFC A;  4FJY A;  1QKZ A;  1FIQ A;  1P9D U;  2V3P A;  2ZVN A;  1C77 A;  3SD5 A;  4US9 A;  4DHJ B;  1R7S A;  2BQQ A;  3Q8B A;  3H7S A;  1QLB B;  3GZN I;  3K9P B;  2WX1 A;  3R8B A;  2JX5 A;  1L5P A;  3DVN U;  1YN4 A;  1DYQ A;  2J0M A;  2JRI B;  3ZTD A;  1PFD A;  3Q8F A;  2WDR B;  3ABV B;  3ZIM A;  4TQ1 A;  4EKU A;  4RH6 A;  4XDC A;  1EUV B;  3RD2 A;  2FAZ A;  3BK2 A;  2HE7 A;  1HXY D;  3QQ8 B;  3QJZ A;  3QC8 B;  4ZHP A;  2H88 B;  3M62 B;  1VZ6 A;  1SE4 A;  2MW5 A;  2ZPN A;  3TJP A;  3V3X A;  1E90 A;  4B0E A;  1VR9 A;  3PO0 A;  5L95 C;  3P4P B;  3PRZ A;  1EF5 A;  1N5X A;  1N62 A;  3A9J B;  1D5Z C;  3MJW A;  3V62 A;  3GB1 A;  1PGA A;  3PZD A;  1GB1 A;  5H92 C;  3R7Q A;  3T3N A;  4OZB A;  3RFZ B;  3A4R A;  3DPD A;  4WIP A;  3Q6B A;  3KLS X;  2WDQ B;  1WM3 A;  2DZI A;  4FLH A;  1MI0 A;  4RFB A;  2KDF B;  2WQY B;  4MEL A;  1FNV A;  1MJD A;  1QOF A;  2FUH B;  3AEE B;  1L0Y B;  3DOW A;  3UIN B;  3X0W A;  2YLM A;  1UUP A;  2OOB B;  1T0S C;  3FC4 A;  2LWP A;  1UZX B;  2WXN A;  2NBU A;  2LXC A;  2ZJD A;  3KYC D;  3NS8 A;  1PYW D;  1F2R I;  1EM7 A;  1WGY A;  1CJE A;  1WJ4 A;  2CU3 A;  4HVB A;  5BO4 B;  4WH4 A;  3M95 A;  2EMS A;  2L83 A;  2WXF A;  4BBN C;  1GPX A;  2G4D B;  2RDG A;  4PYZ A;  1P0R A;  1SBB B;  1VD2 A;  2EEL A;  2GOW A;  1SSN A;  5J2R A;  2IBI B;  4GN1 A;  4GU2 A;  1VZ7 A;  2Z59 B;  1ZW7 A;  3Q3J A;  2RPV A;  1JCK B;  3C8Y A;  2D11 A;  3APC A;  2JZ3 B;  5EE1 A;  3NVZ A;  2KN4 A;  5LXH A;  1N61 A;  4IUM B;  4FJZ A;  2C7M B;  5DPS A;  3HVZ A;  2KVR A;  1IBX B;  2FIF A;  3U7D A;  3PLU A;  1NI3 A;  4YTM B;  1AYF A;  2JSV X;  2NPT A;  5AZF A;  1KM7 A;  1XO3 A;  3KWV A;  1XF5 L;  2PPH A;  3QAR A;  1JWB D;  1YN3 A;  3HUI A;  5C1Z A;  4A20 A;  4K81 A;  3QAQ A;  2KX0 A;  1GOZ A;  2DHZ A;  3PRP B;  1TS2 A;  1NYQ A;  3ZJU A;  1LO5 D;  1FFU A;  4G50 A;  3ZNH B;  2WDT B;  4LNN A;  4TUU A;  3VR9 B;  4KKJ A;  3TBL D;  1XLP A;  4USA A;  4IM2 A;  1I42 A;  1D3Z A;  3ZRC A;  2M8S A;  2WWZ A;  2J7Q B;  4L1B A;  3AE9 B;  2WDV B;  1PGB A;  3BVZ A;  1TS3 A;  3KVF B;  2ZCC A;  3N32 A;  1K52 A;  3AXC A;  2DYB A;  4BOZ B;  2C7H A;  4JIO U;  2LUM A;  4OVV A;  2BVC A;  1JAL A;  4ANX A;  3L08 A;  4XZ4 A;  4YWG G;  1FCC C;  4DDG D;  2IO3 B;  1WMH B;  2JWU A;  3SR6 A;  5HI1 A;  1NVI D;  1TKE A;  1SXT A;  4RCO A;  2W9N A;  4L23 A;  2IYD B;  1UNS A;  3APD A;  3IXS A;  1SE2 A;  2WXK A;  3P2B A;  3RZF A;  3BVG A;  3DBR I;  5DPR A;  5BYQ A;  3BZD B;  4P1B C;  4GSW A;  4WAA A;  1KTK A;  4C00 A;  4WQO B;  4W9H A;  1MFW A;  1SGH A;  1VLB A;  3TEY A;  2MJ3 A;  3PT2 B;  3VAW A;  4JLC A;  4R3D A;  3WAP A;  1YOV B;  3W1Y A;  2CKH B;  4LJP B;  2D5G A;  4A55 A;  3H1U A;  1WXQ A;  2O2V B;  3V60 A;  1L0V B;  3R3M A;  3PRE A;  1I7H A;  1NYR A;  4ZDV A;  3ML8 A;  1NDD A;  4HDQ A;  4W9L A;  4O1N A;  2WHI A;  2Y5P A;  1WR6 E;  2W54 A;  1Q0W B;  1VZ8 A;  2JXT A;  2FCS A;  1WXA A;  1ZXI A;  3MHS D;  1E8X A;  1E6E B;  4MM3 A;  4ZRK A;  2MBB B;  4KKI A;  2L32 A;  3IBE A;  4NAM A;  2L00 B;  5IKC M;  2MBE A;  4DXA B;  4PT5 A;  4PS3 A;  1SIF A;  2K22 A;  1HZ6 A;  3DQV A;  1V1O A;  2WLB A;  4ZOH C;  1WX7 A;  3R2T A;  3DVG Y;  4NNJ B;  2TSS A;  2PMV A;  3U8Z A;  2KWU B;  1FXI A;  4DXG A;  4I6N B;  3VDZ A;  1TYG B;  2K5P A;  2NMQ A;  4A90 A;  4GXB A;  3WAN A;  4KVG B;  5EDS A;  1GJZ A;  3BIN A;  4H2A A;  1C79 A;  3EFU A;  2WXP A;  3AEA B;  2CHW A;  3ZXV A;  3UGB B;  4EUT A;  4RM9 A;  2ZPY A;  3DBS A;  4MGI E;  4J3O D;  2JF5 A;  3CIR B;  3P4Q B;  2IO2 B;  4W9F A;  4XYC A;  4N58 A;  3A4S C;  4OW0 A;  2BWF A;  1QOA A;  2UU7 A;  1E5W A;  2G9H D;  1I4G A;  5GMV A;  4IG7 B;  5GXG B;  2ZNV C;  2D2Q A;  4HPM B;  4HXD A;  2C7N B;  4PYU A;  1D6E C;  4FBJ B;  1AW7 A;  4JL9 A;  1RLF A;  3B0A A;  3Q3F A;  1KRH A;  1KF6 B;  2DEN B;  1WF9 A;  3PS6 A;  2V4L A;  4EZL A;  1RYJ A;  1JRP A;  1FO4 A;  3VXW A;  2Z0E B;  2DYM A;  1YN5 A;  2PJH A;  2IY0 B;  2QDF A;  1WX9 A;  1WWT A;  1WJN A;  1KH0 A;  1V5T A;  1DOI A;  1ZDX A;  2ONQ A;  5AEK B;  4FHK A;  1K50 A;  3I63 C;  3JSV A;  2QC8 A;  1WI0 A;  3H9D A;  3IAM 1;  4WWO A;  1F1H A;  4IM3 A;  4L2Y A;  4LK0 M;  3MTN B;  4K7S A;  4K7W A;  1YIW A;  5LNK 1;  4NJ6 A;  1HTO A;  3TCA A;  3ZGZ A;  4HEA 1;  1E8W A;  2V3N A;  2XEW A;  1D5M C;  2XK5 A;  5LXI B;  4HJG E;  3UQA A;  2L1A A;  1PGX A;  1N6Z A;  3P1M A;  2IZV B;  2VH2 A;  2N7E A;  4PS8 A;  3A9K B;  2WXQ A;  3O13 A;  3UIP B;  1TIF A;  2MBH A;  3FAH A;  4MAC A;  4K3C A;  2PIA A;  1K51 A;  1Q5W B;  1NI2 A;  4HPL B;  3MC0 B;  5J17 A;  1OEY A;  3ZKJ C;  1TKG A;  2G3Q B;  4NQK E;  1QIL A;  2K39 A;  2PLP A;  3RNC C;  4G3X B;  1N63 A;  1EWC A;  2WXJ A;  1V8C A;  1R4N B;  2BS2 B;  1TS4 A;  3JVZ X;  4JPS A;  3VUY A;  2EMT A;  3V05 A;  3R7R A;  5EE0 A;  3IG3 A;  4CYE A;  4MT5 A;  1ZP0 B;  3DVN V;  5FKA C;  3LYY A;  2N7J A;  4GLS C;  3P4R B;  1YQ3 B;  1IP9 A;  1SE9 A;  3WCQ A;  1ZDV A;  4EZK A;  1LXD A;  4IM0 A;  2K8H A;  4BKG A;  3KWL A;  3AMZ A;  1TZO A;  2NS5 A;  1KLV A;  3TIX A;  5FR3 A;  2I2Y A;  2YVC A;  1UGJ A;  3D32 A;  3SHQ A;  2RDB C;  2M0X A;  5L83 A;  4B95 A;  4ZRI A;  3IAS 1;  3RT3 B;  2WXL A;  5G2N A;  3GS2 A;  3ONS A;  3WIM A;  3LXF A;  1N60 A;  3BY4 B;  3ML9 A;  3P4S B;  1ENF A;  4C4V A;  2CHX A;  3WA0 A;  3PPA A;  3ZDT A;  2X8X X;  3VTV A;  4A6Q A;  2IGG A;  4KDI C;  2BPS A;  2KD0 A;  3VUW A;  3KW5 B;  3AUL A;  3DBR B;  3RYT A;  2PKO A;  1VRA B;  3HM6 X;  4OVU A;  4G11 A;  4RGO S;  3DBH B;  4B0M A;  2HTH A;  1SF0 A;  3MP9 A;  3E56 A;  4KSL C;  5D7G A;  3WAL A;  5HFY A;  1E10 A;  1L2N A;  5T8I A;  2MQJ A;  5D3I B;  1ZKH A;  3DHG C;  3EUB 2;  1PDX A;  1UF0 A;  2N7D A;  1YQ4 B;  2KAN A;  2LUE A;  1JWS D;  2KTR B;  1FXA A;  2W3R A;  5D94 A;  1WGH A;  3KUZ A;  2KKC A;  4EFO A;  3T8M A;  1R4M B;  2I38 A;  2KFJ A;  2N9X A;  2DZK A;  2L3Z A;  2K8C A;  1SE3 A;  1DGJ A;  2OHF A;  1TTN A;  3MJ5 A;  2VZK D;  4ICU A;  4ZRQ A;  1ZUD 2;  1L4Z B;  1TY0 A;  4GMV A;  3ZQ4 A;  2JQR B;  2K25 A;  2CJN A;  1QOG A;  2IO1 B;  4IC7 B;  4OZA A;  1C4A A;  3J9C A;  3ZNI D;  2JT4 B;  3HRD D;  3VRA B;  4DK5 A;  3Q3N C;  2JRH A;  4KIK A;  1FRD A;  2BYF A;  4W9I A;  3V6C B;  5JXV A;  3AM9 A;  3AED B;  3ZXR A;  4KDL B;  1OQQ A;  2PTL A;  2VH1 A;  3A1Q A;  3LJ3 A;  1P1A A;  3ZNZ B;  4A3O A;  2KTF A;  2RD0 A;  1C4C A;  3AI5 A;  4MSM B;  4W9J A;  3B08 A;  3QX1 A;  1VDV A;  3CF6 E;  2NR2 A;  1P3Q U;  4FHJ A;  3N30 A;  5G5H A;  3VQI A;  1XLN A;  3RN9 C;  3AE1 B;  2BYE A;  1FCL A;  2KMC A;  1WYG A;  3RPF C;  4DDI D;  4HKQ A;  1I4R A;  1EO6 A;  3FIL A;  2R2Q A;  3PLV A;  2WX0 A;  3ZVV A;  5H8Y E;  2C5L C;  3RNE C;  1A5R A;  2RSU A;  2BBC A;  3UI3 A;  5KHQ A;  2VZK B;  4M02 A;  4JWS C;  1D5X C;  1I4X A;  2JU6 X;  3W5V B;  3P63 A;  2LGD A;  3DBL B;  1F9J A;  3AE8 B;  5EE9 A;  3KH0 A;  4RF0 A;  3B9J A;  2MH7 A;  3ZJV A;  4G0N B;  1T0Y A;  2X38 A;  3RMK C;  5FK9 C;  4HK2 A;  5IN7 A;  3NZS A;  1L7Y A;  2KDE B;  1H4R A;  1IPG A;  2WU5 B;  2Y5B B;  1Z2M A;  3ZO5 B;  4MGY E;  2JZZ A;  4HRO A;  2HJ8 A;  2HDE A;  2LHD A;  1I4P A;  2PE9 A;  1OEY J;  4HRS A;  1OQY A;  1XEE A;  1STE A;  2E6X A;  3QIJ A;  4PS7 A;  2RPQ A;  2D07 B;  5CX3 A;  4I6L B;  3M3J A;  1WYW B;  2OJR A;  2K1F A;  1U4A A;  1XLQ A;  3MHZ A;  2V3S A;  3RI7 C;  4MGK E;  2AYO B;  1CMX B;  2REX A;  4N9F 4;  4RM8 A;  1TT5 B;  3NZU A;  5JZE B;  2E3T A;  2IY1 B;  1I4H A;  4ICV A;  5AZG A;  1Y8R C;  3GE3 C;  3RCZ A;  2KDI A;  4MGZ E;  3PZ8 A;  1XD3 B;  3MFG A;  2KFK A;  5D3D A;  4F8C B;  1FFV A;  3BYY B;  3AE7 B;  2DX5 B;  2WXI A;  2DZM A;  4MSQ B;  2KC1 A;  4IOI E;  4ARI A;  1PQS A;  2D10 A;  1C9F A;  1T5X D;  3JW0 X;  5MPO A;  3N1X C;  2LHE A;  3U52 E;  3VVW B;  1WZ0 A;  4MH8 A;  4TKN A;  3KYD D;  1FPY A;  1RFA A;  3W1S C;  2KHW B;  4AWJ A;  4KGR A;  3V6E B;  4ANW A;  4K1R B;  1A70 A;  4YTP B;  4HCP B;  4I6P A;  2BKF A;  1OGW A;  1GC7 A;  5E6O A;  4E71 A;  1WRI A;  2G45 B;  4KGT A;  2KNB A;  4KV2 A;  2LRW A;  2ZW0 A;  3H7P A;  5AUI A;  5CTR C;  2J0J A;  3TEW A;  1FMA D;  4AQ7 A;  3U2S C;  4WWM A;  1AN8 A;  4NY0 A;  2LAS A;  4XGA B;  1OQR A;  4EEW A;  4ARC A;  3M63 B;  2J4X A;  3L0W B;  4BKT A;  1GNU A;  2KJ6 A;  4BBN F;  1IYF A;  1YD8 U;  4M01 A;  2D3G A;  5CHW A;  2N1V A;  2KWD A;  4IWP A;  1WXM A;  1WGD A;  4JGH B;  2D3C A;  2O6V A;  2M19 A;  2MRP A;  4ASW C;  2J52 A;  3W5U B;  3OG5 A;  1S3S G;  3EHV A;  3SFE B;  3CMM B;  4FUL A;  1DOY A;  2MCN B;  2N9E B;  2ASQ A;  2PE6 B;  2KDM A;  2Z0D B;  4B6W A;  5EE3 A;  3C19 A;  3PVL A;  2MP2 A;  3GZN B;  4WJO A;  3Q69 A;  4NAW A;  1KFY B;  3QWZ B;  4WJQ A;  1ROE A;  4WUR A;  3DDC B;  1DOX A;  3UF8 A;  2RR9 A;  3I9V 1;  3AEF B;  4OZC A;  3VTW A;  4M0W A;  2RMM A;  4ZYS A;  3IT4 B;  2D3A A;  3NOB A;  2CHZ A;  2BYT A;  1K53 A;  2Y5C A;  2AEH A;  1KLU D;  2DWQ A;  4DQO C;  1OTR B;  2QJL A;  4S0R A;  2K6D B;  3TL5 A;  1YQB A;  1TZ1 A;  4AP4 C;  4XC2 A;  3VFK A;  1T0R C;  3VHT C;  2NPT B;  4HJK A;  4DHZ B;  4OVZ A;  4KX6 B;  2N1W A;  1YNT E;  4W9K A;  1LQB A;  4YXD B;  2KVZ A;  2L76 A;  3NVY A;  2MBQ A;  1L6U A;  4HKZ E;  1PUT A;  2HJ1 A;  1WX8 A;  1WZ3 A;  1C76 A;  2FCM A;  3QCA A;  4S17 A;  2KZR A;  3DHI C;  2JUO A;  3IT6 B;  2Y3A A;  1KLG D;  5G5G A;  5IOI A;  2KOX A;  3L54 A;  2MEK A;  2XNA C;  5D2M B;  4KGS A;  1EU3 A;  5TSS A;  1V86 A;  4II2 B;  1MG8 A;  1NEN B;  1UD7 A;  2JPH A;  3KQ4 A;  2IPK D;  2O6V D;  2YEP B;  3ZW3 A;  2M0A A;  3DVG X;  4P6V F;  3Q2A C;  3CST A;  3C0R B;  3SFD B;  1KJT A;  4NZL B;  4UDU C;  3RUL A;  3Q8E A;  3DHH C;  3HK0 A;  5C23 A;  3ZJT A;  3BYT B;  3AEG B;  3RUI B;  2FE8 A;  2IGD A;  1E8Y A;  2Q5W D;  4BKS A;  1T6B X;  1LM8 B;  1YJ1 A;  4XDD A;  5FR6 A;  3OAW A;  1WE7 A;  5DCN A;  4RNA A;  3A9J A;  4LLG M;  2N9L A;  1JRU A;  2GB1 A;  3BK1 A;  3Q3O C;  2AQ2 B;  2M56 B;  3ZNG C;  3JYU A;  1FXT B;  1F77 A;  2JVC A;  5BMG A;  4WWN A;  4WWP A;  1QQR A;  4MH0 E;  4BOS C;  2QSD A;  1JWU D;  4IKG A;  1E7V A;  5E6J A;  2LJI A;  3W1S A;  1JRO A;  1CZP A;  4HCN B;  1FD6 A;  2KO3 A;  2NBV B;  2C9W B;  1TGZ B;  3AE4 B;  2ON8 A;  2ZZP B;  3U7Z A;  1MHX A;  2N9P C;  4YL8 A;  2VRR B;  2LD9 A;  4KZC A;  2O6V B;  1E9M A;  2KN5 A;  1WXV A;  2KAJ A;  3A33 B;  2K6Q A;  2J53 A;  3NG0 A;  1RM6 C;  2HD5 B;  2KQ7 A;  1TS5 A;  4NJ7 A;  2BYV E;  3Q8C A;  3RZW C;  2ZCB A;  2ZEQ A;  2W3S A;  4C7Y A;  3MC8 A;  1SJH D;  2PVO D;  4MM3 B;  3W2D A;  1B9R A;  5IP4 D;  4WJN A;  4P1C C;  1E7P B;  4RGT A;  4A3P A;  4YSY B;  2LI5 A;  2PEA A;  2N9K A;  3N20 C;  5IA7 A;  4LTU A;  1RFK A;  4C56 C;  1H8C A;  4DXF A;  2B3A A;  2DBY A;  1HTQ A;  2J42 A;  1XXG A;  2LEK A;  1GC6 A;  2IND C;  5CHF A;  3EEC A;  3AE5 B;  2W82 A;  4EOY A;  2A4Z A;  2FCN A;  2WNM A;  1HEZ E;  3VR8 B;  2KQ4 X;  1J7A A;  1WGK A;  2BF8 B;  3I5J C;  4BKS D;  3ZLZ A;  2J0K A;  2R61 A;  1BXT A;  2KXJ A;  1IGD A;  2SEB D;  5E6N A;  1E0Z A;  1ACC A;  1IBX A;  4CHK A;  3O65 B;  2BS3 B;  1TY2 A;  3AB5 A;  2MLB A;  2GLS A;  3PGE A;  3R66 C;  2JY6 A;  4NQL B;  5KHO A;  3NY5 A;  4FXC A;  1WJ6 A;  1ESF A;  2MSE D;  4M8N A;  4K3B A;  3CWI A;  4KSK C;  1EF1 A;  4A9A A;  1UGM A;  1FM0 D;  5C3J B;  2IO0 B;  3AU4 A;  4RGN A;  1E8Z A;  1F52 A;  2GBJ A;  2K0P A;  2WXH A;  4DWF A;  2V9H A;  4LNI A;  3VTU A;  4GGQ A;  4HLE A;  3EGR A;  3PHX B;  4XX5 A;  4IWO A;  4LCD E;  2INN E;  3VRB B;  1JWA D;  5AZH A;  5E6P A;  2GI9 A;  4MDK E;  3IHP C;  5HKH A;  3PZ7 A;  2KMM A;  3N1Y C;  2W55 A;  3JSV B;  2JYE A;  1WR1 A;  5G55 A;  3CSF A;  2KC2 A;  3AE3 B;  4DHZ E;  1YX5 B;  1GAQ B;  1WMH A;  2NBW B;  4OHJ A;  1XT9 B;  1Y56 A;  4NPN A;  3AH7 A;  4RF1 A;  1VCB A;  1MVK A;  2LGY A;  2BS4 B;  2GMI C;  4P7I A;  1FNU A;  1V80 A;  3OLM D;  2XK5 B;  1G6J A;  2KYW A;  3KUC B;  3IVF A;  1UH6 A;  2EKE C;  1GB4 A;  4ANU A;  3I57 A;  2BW2 A;  1ET9 A;  3NS1 A;  1P98 A;  1LFD A;  1YMH E;  2LZ6 A;  4LJO B;  2QHO A;  1JML A;  3AN1 A;  1C1Y B;  2FCQ A;  5LLI A;  3TMP B;  2MA9 B;  1K8R B;  1J7B A;  1GG3 A;  4IWQ A;  4EZJ A;  2WYQ A;  2JZP A;  2O2V A;  3NZ3 A;  3DCG A;  4WJP A;  2MX2 A;  3B2G A;  1V97 A;  4BAX A;  2WXM A;  1L4D B;  2GRI A;  3PSE B;  4M8M A;  2LFI A;  3ENE A;  4ZHO A;  2WU2 B;  2IGH A;  3AU5 A;  1SJE D;  2KT7 A;  1D4B A;  1V9J A;  4QAY A;  3OJ4 B;  5BYS A;  4IDI A;  1KOT A;  4Q2J A;  4HPP A;  2Z8L A;  2QIE B;  3PHW B;  1V6E A;  2MJE A;  1OFF A;  2L7R A;  4EE2 A;  1IUE A;  3LDZ E;  4W9D A;  2AL3 A;  2BT6 A;  4ZRP A;  3E9S A;  3QK0 A;  4F1S A;  4BFR A;  3VH3 B;  4YTN B;  2DAF A;  2GBM A;  2YEP F;  1SB3 C;  3GOE A;  5DPT A;  4JX1 C;  3DWM A;  2AX5 A;  2WGS A;  4DBG A;  2AWT A;  1UBI A;  1UWX A;  2K8B A;  3HM3 A;  4US8 A;  2I1K A;  4RGM A;  3RNB C;  1NEK B;  4P16 A;  2RDH A;  3AE6 B;  3B2F A;  1S1Q B;  3AEB B;  3BII D;  4C4V B;  4CO7 A;  2LGX A;  3QA8 A;  1I35 A;  3Q3M C;  4XWW A; 
#chains in the Genus database with same CATH homology
 3DVN U;  3ZTD A;  2J0M A;  2JRI B;  2CU1 A;  2IZV B;  2Z0D B;  3ZIM A;  4TQ1 A;  4EKU A;  4B6W A;  1EUV B;  3RD2 A;  2FAZ A;  3PVL A;  2HE7 A;  2MP2 A;  4WJO A;  2N7E A;  1WJU A;  5J18 A;  4NAW A;  4PS8 A;  3NHE B;  3A9K B;  3QQ8 B;  3QJZ A;  1E7U A;  3QC8 B;  3QWZ B;  2KWC A;  3M62 B;  2KJR A;  4WJQ A;  3VUX A;  3WAM A;  3UIP B;  2MW5 A;  2ZPN A;  3TJP A;  1J19 A;  1WH3 A;  1E90 A;  3DDC B;  5L95 C;  2MBH A;  3UF8 A;  2RR9 A;  3VTW A;  3PRZ A;  1EF5 A;  1Q5W B;  1NI2 A;  2C60 A;  3A9J B;  3UIO B;  4HPL B;  3MJW A;  1R4N I;  3NOB A;  3V62 A;  3L16 A;  2CHZ A;  5J17 A;  3PZD A;  4AJW A;  1OEY A;  2AEH A;  4FJV B;  3ZKJ C;  2G3Q B;  3T9L A;  1OTR B;  3PTF C;  5DPW A;  2DYO A;  2K6D B;  4NQK E;  2K39 A;  3TL5 A;  4G3X B;  3R7Q A;  4K7U A;  4MEM A;  3WAO A;  1YQB A;  1TZ1 A;  1WFY A;  4AP4 C;  4E3C A;  4XC2 A;  3VFK A;  3VHT C;  3JVZ X;  2NPT B;  3A4R A;  1V2Y A;  4HJK A;  3VUY A;  4DHZ B;  3DPD A;  2N1W A;  4W9K A;  4MJS A;  1LQB A;  2EMT A;  1WM3 A;  3R7R A;  2L76 A;  2DZI A;  3IG3 A;  4GB9 A;  4CYE A;  1RRB A;  3DVN V;  2MBQ A;  4FLH A;  2ZNV B;  1WGG A;  2KDF B;  4MEL A;  4HWI B;  1SE9 A;  1IP9 A;  1WX8 A;  1WZ3 A;  2FUH B;  2FCM A;  3QCA A;  4EZK A;  1LXD A;  2FID A;  2K8H A;  4IM0 A;  2KZR A;  3DOW A;  4BKG A;  3UIN B;  3X0W A;  2YLM A;  2JUO A;  2L0T A;  2OOB B;  2NS5 A;  2NCN A;  2KOX A;  2DAJ A;  4X57 B;  1KLV A;  2LWP A;  2N4F A;  3TIX A;  3L54 A;  1UZX B;  2NBU A;  2CS4 A;  2LXC A;  2ZJD A;  2YVC A;  3D32 A;  5D2M B;  3SHQ A;  1V86 A;  3KYC D;  3NS8 A;  4II2 B;  1ZGU B;  4ZYN A;  2M0X A;  5L83 A;  1MG8 A;  1UD7 A;  5IAA C;  2JPH A;  4B95 A;  2UYZ B;  4ZRI A;  1WGY A;  4KIK B;  3RT3 B;  1WJ4 A;  4BVU C;  5G2N A;  4HVB A;  5BO4 B;  3ONS A;  3M95 A;  3WIM A;  2EMS A;  2O6V D;  3ZW3 A;  4BBN C;  3BY4 B;  3ML9 A;  3ALB A;  3QHT A;  4II3 B;  3ZRF A;  3DVG X;  2CHX A;  3WA0 A;  3CST A;  3PPA A;  3A1Q B;  3C0R B;  2G4D B;  2L8J A;  1KJT A;  1P0R A;  4PYZ A;  3ZDT A;  1VD2 A;  3RUL A;  3VTV A;  2GOW A;  4GDK A;  5J2R A;  2IBI B;  4GN1 A;  4GU2 A;  2BKR B;  2Z59 B;  3HK0 A;  4KDI C;  5CHV C;  2BPS A;  2XBB C;  2KD0 A;  1ZW7 A;  3Q3J A;  5C23 A;  4URK A;  3VUW A;  3DBH I;  3KW5 B;  2RGF A;  2JXX A;  2LJ5 A;  3RUI B;  3AUL A;  2D11 A;  3RYT A;  3A9K A;  4TV3 A;  3PRM B;  1E8Y A;  3APC A;  1V5O A;  4BKS A;  1YJ1 A;  1LM8 B;  1UEL A;  2GBN A;  3HM6 X;  4OVU A;  4G11 A;  5FR6 A;  3OAW A;  1WE7 A;  1WM2 A;  3B1L X;  5DCN A;  2JZ3 B;  2HTH A;  3A9J A;  4AUQ C;  1WIA A;  1M94 A;  5LXH A;  1JRU A;  4IUM B;  4FJZ A;  2C7M B;  5DPS A;  4KSL C;  5D7G A;  3WAL A;  1L2N A;  3ZNG C;  2KVR A;  2MQJ A;  2FIF A;  1ZKH A;  3PLU A;  3U7D A;  3JYU A;  1FXT B;  2N7D A;  2JVC A;  3PV1 A;  4WWN A;  2KAN A;  1R4M I;  2NPT A;  1KM7 A;  1GUA B;  2ZVO A;  2LUE A;  4WWP A;  5AZF A;  2KTR B;  4MH0 E;  4BOS C;  5D94 A;  1WGH A;  2PPH A;  3KUZ A;  3QAR A;  1E7V A;  2KKC A;  3W1S A;  4EFO A;  4HCN B;  3T8M A;  3ECI A;  2LVQ A;  2KO3 A;  2KFJ A;  2NBV B;  2N9X A;  2DZK A;  2L3Z A;  2K8C A;  4J6I A;  3U30 A;  4K81 A;  3QAQ A;  2KX0 A;  2C9W B;  2DHZ A;  3PRP B;  4LDT D;  1TTN A;  3S2A A;  1TGZ B;  4ANV A;  4ICU A;  3L13 A;  2ZZP B;  2NVU I;  2MWS B;  4G50 A;  4GMV A;  2N9P C;  3ZNH B;  4YL8 A;  2VRR B;  2WDT B;  2LD9 A;  2K25 A;  1NBF C;  4TUU A;  1YX6 B;  4KZC A;  2O6V B;  2M4N A;  2KN5 A;  1WXV A;  3A33 B;  1WE6 A;  2IO1 B;  3TBL D;  4IC7 B;  2K6Q A;  4IM2 A;  2KDB A;  1I42 A;  1D3Z A;  3ZNI D;  3ZRC A;  2HD5 B;  2KQ7 A;  4E74 A;  2M8S A;  2WWZ A;  4NJ7 A;  2JT4 B;  2J7Q B;  4DK5 A;  2BYV E;  2JRH A;  3RZW C;  4KIK A;  2ZCB A;  2ZEQ A;  2BYF A;  4GIV A;  4W9I A;  4GDL A;  3V6C B;  1UBQ A;  4WJN A;  4HDO A;  3IFW B;  4KDL B;  3KVF B;  2ZCC A;  2MBO A;  3N32 A;  4A3P A;  3A1Q A;  3LJ3 A;  1P1A A;  2LI5 A;  3ZNZ B;  2PEA A;  3AXC A;  2DYB A;  5IA7 A;  4BOZ B;  4A3O A;  2KTF A;  2C7H A;  4JIO U;  2RD0 A;  3AI5 A;  1H8C A;  4OVV A;  2B3A A;  2KLC A;  2CR5 A;  4MSM B;  4W9J A;  3B08 A;  4ANX A;  3L08 A;  3QX1 A;  4XZ4 A;  3CF6 E;  2NR2 A;  1P3Q U;  4FHJ A;  1GC6 A;  4DDG D;  2IO3 B;  3N30 A;  1WMH B;  2KK8 A;  5CHF A;  1V49 A;  3EEC A;  4AJY B;  4EOY A;  2A4Z A;  2FCN A;  5TR5 A;  5D6J B;  3VQI A;  1WGR A;  4TQ0 A;  2BYE A;  2BWE S;  2KMC A;  2M1M A;  4DDI D;  1EO6 A;  2W9N A;  1J8C A;  2BF8 B;  2IYD B;  2R2Q A;  3ZLZ A;  4BKS D;  3APD A;  2M17 A;  2J0K A;  2KFK B;  3PLV A;  2KXJ A;  2WX0 A;  3P2B A;  3RZF A;  2KWV B;  3ZVV A;  5E6N A;  2LXA A;  3DBR I;  2C5L C;  5DPR A;  1Z5S B;  2UWQ A;  1A5R A;  4MJS B;  4CHK A;  3O65 B;  3DBL I;  2RSU A;  2MLB A;  1WRD B;  4LDT B;  5KHQ A;  3PGE A;  4GSW A;  4WAA A;  2LVP A;  3R66 C;  4WQO B;  4W9H A;  2JY6 A;  1SGH A;  1XQQ A;  2KTR A;  1AAR A;  4NQL B;  3EC8 A;  5KHO A;  3HHM A;  3NY5 A;  3PT2 B;  1BT0 A;  2LGD A;  3VAW A;  4JLC A;  3WAP A;  1F9J A;  1WJ6 A;  3W1Y A;  3KH0 A;  4RMA A;  2MSE D;  4M8N A;  2CKH B;  4LJP B;  4G0N B;  3H1U A;  1T0Y A;  4KSK C;  2O2V B;  3V60 A;  4IW0 A;  3R3M A;  5JHA A;  1EF1 A;  1UGM A;  4HK2 A;  3PRE A;  1RAX A;  3NZS A;  1ISN A;  1L7Y A;  2IO0 B;  1H4R A;  1IPG A;  2KDE B;  3OJ3 A;  4ZDV A;  3ML8 A;  5JHB A;  2Y5B B;  3K9O B;  3AU4 A;  2KJH B;  1Z2M A;  1NDD A;  1E8Z A;  4MGY E;  4ZRJ A;  3ZO5 B;  4W9C A;  4F7Z A;  4HDQ A;  2GBJ A;  2JZZ A;  4W9L A;  2HJ8 A;  1WR6 E;  4DWF A;  1Q0W B;  3H7P B;  3VTU A;  3SU8 X;  4GOC A;  3H6N A;  4GGQ A;  2PE9 A;  4HLE A;  3PHX B;  1OEY J;  2KLG A;  1OQY A;  2KQS A;  4JQW C;  4XX5 A;  3QIJ A;  2FCS A;  4IWO A;  2FNJ B;  4PS7 A;  1WXA A;  3MHS D;  2RPQ A;  5JH5 C;  2D07 B;  1E8X A;  4LCD E;  4I6L B;  4KZ0 A;  4MM3 A;  5CX3 A;  3M3J A;  4ZRK A;  2MBB B;  4W9E A;  1WYW B;  2OJR A;  4AOF A;  4GDK B;  2KMA A;  5AZH A;  3IBE A;  2K1F A;  4MDK E;  5E6P A;  1U4A A;  2L00 B;  3IHP C;  2L05 A;  5HKH A;  2MBE A;  2DZJ A;  2BGF A;  3JSV B;  4DXA B;  2G4S A;  1WR1 A;  1SIF A;  4PS3 A;  5G55 A;  3DQV A;  3CSF A;  2KC2 A;  1WX7 A;  2V3S A;  3DVG Y;  4DHZ E;  4MGK E;  2AYO B;  1CMX B;  1J0G A;  4NNJ B;  1YX5 B;  4A20 A;  2REX A;  2KWU B;  3U8Z A;  2GBR A;  4N9F 4;  4RM8 A;  1WMH A;  2NBW B;  1XT9 B;  3NZU A;  4I6N B;  5JZE B;  4NPN A;  3VDZ A;  3VH4 B;  1Q1O A;  1VCB A;  2IY1 B;  3I3T B;  3X23 A;  4ICV A;  5AZG A;  1Y8R C;  2LGY A;  4GXB A;  2A5U A;  3RCZ A;  2GBK A;  3WAN A;  4KVG B;  2GMI C;  5EDS A;  1GJZ A;  3BIN A;  2KDI A;  1V80 A;  3OLM D;  4P7I A;  4MGZ E;  2XK5 B;  3EFU A;  1G6J A;  1XD3 B;  3KUC B;  3N3K B;  2CHW A;  4FAD A;  4B9K A;  3IVF A;  1UH6 A;  2EKE C;  3UGB B;  2KFK A;  4ANU A;  4EUT A;  4F8C B;  4RM9 A;  2ZPY A;  1P98 A;  3DBS A;  1LFD A;  4MGI E;  3ZTC A;  2JF5 A;  2LZ6 A;  2L0F A;  2MP2 B;  4LJO B;  4NAW B;  2DX5 B;  4DHJ D;  2LRU A;  2DZM A;  2AL6 A;  2QHO A;  4MSQ B;  2KC1 A;  1V81 A;  1PQS A;  1TBE A;  2D10 A;  3JW0 X;  2IO2 B;  4W9F A;  1QZE A;  1C1Y B;  2FCQ A;  5LLI A;  3TMP B;  3VVW B;  1WZ0 A;  3V61 A;  3A4S C;  2MA9 B;  3KYD D;  4M0W B;  4TKN A;  2BWF A;  1RFA A;  3W1S C;  1E5W A;  2KHW B;  2KX3 A;  2LVO A;  1K8R B;  5GMV A;  4AWJ A;  4IG7 B;  3V6E B;  4ANW A;  1GG3 A;  2ZNV C;  4IWQ A;  4K1R B;  2D2Q A;  4EZJ A;  4HPM B;  2WYQ A;  2C7N B;  3HIZ A;  3KUD B;  4HCP B;  4HXD A;  4PYU A;  2O2V A;  4I6P A;  2R2O A;  2BKF A;  1OGW A;  3DCG A;  4WJP A;  4FBJ B;  5C1Z A;  2MX2 A;  1C3T A;  4JL9 A;  1RLF A;  3B0A A;  1HE8 A;  3Q3F A;  4FA6 A;  1GC7 A;  2V1Y A;  3PSE B;  5E6O A;  3ZDM C;  4M8M A;  4E71 A;  3ENE A;  2G45 B;  3AU5 A;  2KNB A;  4KV2 A;  1V9J A;  2LRW A;  3H7P A;  3OJ4 B;  1KOT A;  5CTR C;  3SDL C;  2DEN B;  2J0J A;  2I1J A;  3PHW B;  1V6E A;  1WF9 A;  3PS6 A;  4GDL B;  2V4L A;  4EZL A;  2L7R A;  4NY0 A;  2LAS A;  3LDZ E;  2Z0E B;  2DYM A;  4W9D A;  3VXW A;  4EEW A;  2AL3 A;  3M63 B;  2JWZ A;  2PJH A;  2IY0 B;  1WXS A;  3L0W B;  1GNU A;  1WX9 A;  2KJ6 A;  4BBN F;  4BKT A;  3QK0 A;  1YD8 U;  4F1S A;  4BFR A;  1IYF A;  3VH3 B;  2D3G A;  1WJN A;  3ZUN A;  3L17 A;  2DAF A;  2GBM A;  1V5T A;  1WY8 A;  5CHW A;  1X1M A;  2N1V A;  3UQB A;  4IWP A;  5AEK B;  4FHK A;  3JSV A;  1WXM A;  3GOE A;  5DPT A;  4FN2 A;  1WGD A;  1WI0 A;  3H9D A;  4JGH B;  4W9G A;  3L10 B;  3APF A;  2O6V A;  4WWO A;  4DBG A;  2AWT A;  4IM3 A;  2MRP A;  4ASW C;  1UBI A;  2K8B A;  3HM3 A;  4FJY A;  3MTN B;  4K7S A;  2I1K A;  1S3S G;  3EHV A;  3CMM B;  4FUL A;  1P9D U;  1YIW A;  4K7W A;  2MCN B;  4NJ6 A;  2ZVN A;  1S1Q B;  3SD5 A;  4DHJ B;  3TCA A;  1E8W A;  4CO7 A;  2LGX A;  3H7S A;  3QA8 A;  1I35 A;  3GZN I;  3K9P B;  2N9E B;  2WX1 A;  2XEW A;  2ASQ A;  2XK5 A;  5LXI B;  2PE6 B;  3UQA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...