4WAAA

Crystal structure of nix lir-fused human lc3b_2-119
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
126
structure length
126
Chain Sequence
NEEWVELGSPSEKTFKQRRTFEQRVEDVRLIREQHPTKIPVIIERYKGEKQLPVLDKTKFLVPDHVNMSELIKIIRRRLQLNANQAFFLLVNGHSMVSVSTPISEVYESEKDEDGFLYMVYASQET
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Phosphorylation of the mitochondrial autophagy receptor Nix enhances its interaction with LC3 proteins.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Structural protein
molecule keywords Microtubule-associated proteins 1A/1B light chain 3B
total genus 34
structure length 126
sequence length 126
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-08-29
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 4waaA00
2JWZA 2KJRA 4AJYB 1UBQA 3H7PA 2MBHA 1E8WA 2KFKA 2G3QB 2O2VA 2C5LC 2G4DB 4G11A 2LJ5A 5E6NA 1Y8RC 3GOEA 3TL5A 5JHAA 1JRUA 2REXA 4AWJA 3KUZA 2AEHA 1UGMA 3A1QA 2C7MB 2PPHA 2KK8A 1LFDA 2C7NB 3APDA 2HD5B 3SU8X 4BOZB 1GJZA 2MCNB 1EUVB 4EKUA 1E7UA 2JUOA 3ZLZA 4IM3A 1KJTA 1WX7A 2DZKA 2KTRA 2J0JA 2M0XA 2N1VA 4G0NB 4HPLB 4I6PA 1XD3B 3CSFA 5AZGA 3DBSA 1YX5B 2B3AA 1RRBA 3L54A 3T9LA 2KZRA 1RFAA 2XK5A 3L08A 4K7SA 4ASWC 3A9JA 4IG7B 3UIOB 1I35A 2NCNA 2M8SA 3PLUA 1WJ4A 2FNJB 2J7QB 4LDTD 5L95C 1GG3A 3ZVVA 3H7SA 3ZRCA 3L10B 4PS3A 3DVNU 2IY1B 1R4MI 1G6JA 2DZIA 2NBVB 3RT3B 1F9JA 3W1SA 2YVCA 4NJ6A 3DVGY 3R3MA 3KVFB 4IWQA 2J0KA 2MA9B 4BKGA 4JGHB 3DDCB 2MP2A 1WE6A 2IBIB 2JZ3B 2IO1B 1WJUA 4WWPA 4I6NB 3JW0X 2FCMA 3VH3B 5CTRC 3AU4A 2MRPA 4MELA 4GDLA 4TQ0A 2K8BA 3AULA 3R66C 2ZZPB 4HPMB 4HK2A 4EZJA 2Z59B 4PYZA 5LLIA 1RAXA 2IO2B 3PLVA 3DBRI 3APFA 3B0AA 3PT2B 3VHTC 4I6LB 4IW0A 1GNUA 3VAWA 2N7DA 3IG3A 5J18A 1J8CA 1V86A 5C1ZA 2FIFA 1GC6A 2QHOA 1SIFA 2LXCA 3EC8A 3IHPC 4HDQA 4ZYNA 2CHXA 3PREA 2KLCA 1E8ZA 1Q1OA 2PJHA 4W9HA 4FJZA 3T8MA 3V60A 2LRUA 3NS8A 3LJ3A 2K8HA 4F1SA 2MBEA 3PPAA 3HHMA 1ISNA 3PS6A 1E8XA 3ZNGC 1NDDA 2JY6A 2ZJDA 4JLCA 3QAQA 2BYEA 2KC2A 3KUDB 2V1YA 1WF9A 4A20A 2D2QA 4J6IA 4OVVA 3VTVA 4W9DA 1WXVA 2D11A 2JZZA 3UIPB 2Z0EB 1OEYJ 2KWUB 2MLBA 3Q3FA 2R2QA 4BFRA 3UQBA 1WZ0A 4BKSD 2FCQA 3N3KB 3B08A 5TR5A 4HWIB 4G50A 5D6JB 3NOBA 2KN5A 3ZDTA 2XEWA 1S1QB 5GMVA 2LGXA 2N9XA 4M8MA 2ZVNA 3L17A 1CMXB 1Q5WB 3QHTA 4GDKA 3QJZA 1QZEA 2MWSB 3DQVA 3U8ZA 2N1WA 2DAFA 4B6WA 4TUUA 4W9IA 4M0WB 2ZPNA 3A1QB 2L0TA 3ZNHB 5D2MB 2EMSA 1A5RA 1I42A 2LVOA 2G4SA 2LRWA 3VUXA 1P98A 2V4LA 4HVBA 2RPQA 3AU5A 1EO6A 4B95A 2GMIC 2XBBC 3ZDMC 4AP4C 1WXAA 3QIJA 3GZNI 4KVGB 1P3QU 4LCDE 2C9WB 1OGWA 3X23A 2G45B 3TCAA 2MBOA 2MSED 3PTFC 4FJVB 4RMAA 5G2NA 3TIXA 1ZGUB 2MQJA 2V3SA 1WE7A 1RLFA 2RD0A 2JXXA 1LQBA 3L0WB 3A9JB 3VFKA 1FXTB 5E6OA 4A3OA 2BGFA 3N32A 1V2YA 1WMHA 3DPDA 3PRPB 1MG8A 2KQSA 2L0FA 4X57B 4BBNC 4N9F4 2PE9A 3ECIA 1EF5A 2IY0B 4WQOB 4DHJB 1KOTA 2LWPA 3VTWA 2KMCA 4PS7A 3AXCA 4W9EA 4AOFA 3AI5A 3UINB 3PHXB 4DHZE 2ZNVC 4ZRJA 2DYBA 1WM3A 3OAWA 2FIDA 1WMHB 1XQQA 1UZXB 1U4AA 2WWZA 3JSVA 3B1LX 1S3SG 5BO4B 3RZWC 4DDGD 2Z0DB 4MM3A 3DVNV 1V81A 4W9GA 1D3ZA 1UH6A 5AEKB 2KDFB 4ZRIA 3PGEA 3TMPB 5KHOA 4NPNA 3VVWB 1WX9A 2KC1A 1UD7A 4AUQC 2IYDB 2DENB 2KJ6A 2KTRB 4WWNA 2BKFA 4KZCA 3EHVA 3VQIA 3PRMB 3W1YA 2KOXA 2PE6B 2KKCA 5DPTA 1OTRB 2ZCCA 3ML8A 4KV2A 4AJWA 2ZCBA 3JYUA 2O6VD 3NZSA 4GGQA 4KDLB 4NQKE 2AL6A 2UWQA 4KSKC 4BOSC 2KXJA 3ZRFA 4TQ1A 2DHZA 5EDSA 2D10A 2L8JA 1V5TA 2KFKB 3BY4B 2Y5BB 3CF6E 3APCA 1R4NI 4YL8A 1C1YB 3Q3JA 5E6PA 4K7WA 5KHQA 3KH0A 2UYZB 4WAAA 4NJ7A 4NNJB 2FCNA 1C3TA 5DPWA 3ALBA 3HM6X 2OOBB 1V9JA 3H6NA 3C0RB 2KQ7A 3L13A 3OJ4B 3UF8A 4ANUA 5L83A 1WFYA 2BYVE 2LGYA 1HE8A 1VCBA 4IUMB 2LXAA 3HIZA 3R7RA 3A33B 5D94A 4CO7A 3JVZX 4FA6A 4XC2A 2CR5A 4IM2A 4KSLC 1YIWA 1WY8A 4GXBA 2EMTA 1KLVA 2A4ZA 4FN2A 2FUHB 1T0YA 3QARA 1TGZB 3DBHI 2KMAA 4IWPA 3VH4B 4URKA 4KZ0A 3ML9A 4WJNA 4GDKB 3X0WA 1WIAA 2M4NA 4DDID 4E74A 3V61A 1LM8B 3ZIMA 2RGFA 3M63B 3M62B 3OLMD 4JL9A 4B9KA 1YJ1A 4GOCA 1BT0A 1WGHA 3S2AA 1P0RA 3PVLA 2KFJA 1WJ6A 4DHZB 2DX5B 3ZO5B 3RCZA 3A9KA 2BPSA 1VD2A 4MGKE 4IWOA 1SE9A 3ZTDA 2AWTA 4WJOA 2JF5A 3RYTA 2LVPA 1H4RA 1E7VA 2N4FA 4FJYA 4PS8A 3QA8A 2VRRB 2KWCA 2C60A 3KYCD 4GMVA 5D7GA 2I1KA 1ZKHA 2L76A 3ZW3A 3PRZA 2KWVB 2L7RA 1E5WA 1OQYA 2NBUA 4MJSA 1P9DU 2JVCA 2R2OA 2K6DB 2RR9A 1KM7A 4TKNA 4EUTA 2FAZA 2LD9A 4ANVA 4F8CB 3DBLI 4MGYE 4LJOB 4W9LA 3PV1A 5CHFA 4KIKA 1IPGA 1AARA 3H1UA 4K7UA 3RD2A 4W9JA 4WWOA 2DAJA 2MBQA 3ENEA 4ANXA 2NBWB 3QK0A 4HDOA 4DBGA 3QC8B 2BF8B 2DZMA 2I1JA 2GBKA 3ZNID 2HJ8A 5J2RA 2KANA 4FBJB 4MH0E 1TZ1A 2GBMA 2IZVB 2IO0B 4BVUC 2MP2B 1OEYA 4DWFA 1K8RB 2MW5A 4FHKA 5J17A 2DZJA 3QWZB 2BKRB 4JQWC 4W9KA 2NVUI 4NQLB 2O6VB 1X1MA 4W9CA 5JZEB 2KTFA 2ZVOA 4NAWB 1YX6B 1PQSA 2ZPYA 1XT9B 4K81A 4LJPB 4F7ZA 2ASQA 2KHWB 2K25A 1P1AA 1GC7A 4GU2A 1WZ3A 5C23A 1TTNA 5DPRA 4EZKA 1Q0WB 4DK5A 2CHWA 3V6EB 2GOWA 2W9NA 1WGGA 4MSMB 3VUYA 4A3PA 2GBRA 4JIOU 1YD8U 2DYOA 2KVRA 3ZUNA 3K9OB 2C7HA 3BINA 2CKHB 1V6EA 5JH5C 4TV3A 2KDIA 3IFWB 3IVFA 3KUCB 3NHEB 2JRHA 2L05A 1EF1A 3A9KB 4ICVA 1V5OA 3HK0A 5DCNA 1WRDB 3ZKJC 1YQBA 2K6QA 4WJQA 1L7YA 2IO3B 2K1FA 3HM3A 3WIMA 1WGYA 2KX0A 1WGDA 2WDTB 3H7PB 4HCNB 2AL3A 3SD5A 3WANA 2M1MA 3NZUA 3MJWA 1LXDA 3K9PB 4E3CA 2CHZA 1UBIA 3NY5A 3O65B 4GN1A 4NAWA 4GIVA 5AZFA 2NPTB 4MSQB 4ANWA 3QX1A 4MJSB 3ZNZB 3JSVB 4DHJD 1UELA 3IBEA 1WJNA 2LGDA 1V80A 4HJKA 3ONSA 1E90A 3A4SC 1TBEA 4MGZE 5JHBA 5FR6A 4XX5A 3PSEB 3SHQA 2FCSA 2LVQA 3EECA 4DXAB 2WX1A 1WI0A 2NPTA 5IA7A 2CU1A 3WAOA 3QQ8B 2KDBA 2LI5A 4II2B 3RUIB 3WA0A 4E71A 2KLGA 2JRIB 2N9EB 3DOWA 3WAPA 3D32A 2D3GA 3MTNB 4MDKE 3VXWA 1WR6E 2NR2A 3DCGA 4FULA 2PEAA 1WXSA 3DVGX 4WJPA 4RM9A 2L3ZA 2D07B 1Z2MA 4PYUA 4FADA 2HTHA 5IAAC 1J0GA 1NI2A 4RM8A 3ZTCA 4BBNF 2GBJA 2CS4A 3UGBB 4EFOA 4GDLB 2K8CA 2RSUA 3VDZA 1NBFC 3M3JA 2JPHA 3OJ3A 4II3B 2L00B 2LUEA 5CHVC 3RULA 4P7IA 3PZDA 4GSWA 3QCAA 3N30A 3VUWA 4G3XB 5HKHA 1WM2A 3VTUA 2LZ6A 4IM0A 4BKTA 3L16A 1M94A 4OVUA 2HE7A 2A5UA 2KJHB 4EEWA 2AYOB 3U30A 3RZFA 1WR1A 1L2NA 2KO3A 2KNBA 3A4RA 3WALA 4ICUA 1GUAB 2NS5A 1V49A 3KW5B 2DYMA 2OJRA 4MEMA 1H8CA 4HXDA 5G55A 1SGHA 3M95A 4KDIC 2KD0A 3CMMB 1IP9A 2YLMA 3PHWB 3MHSD 4FHJA 3TBLD 4CHKA 2ZEQA 4NY0A 5LXIB 1E8YA 3P2BA 2LASA 2GBNA 1ZW7A 2MX2A 3EFUA 4M8NA 2WYQA 2KX3A 1WGRA 3KYDD 3LDZE 3R7QA 4BKSA 1IYFA 2N7EA 2BWES 4HCPB 1Z5SB 4IC7B 5CX3A 5DPSA 3SDLC 4K1RB 2BWFA 4EZLA 4XZ4A 3W1SC 3V6CB 3CSTA 2M17A 4KIKB 5AZHA 4MGIE 3WAMA 3TJPA 2EKEC 3U7DA 3V62A 4W9FA 2ZNVB 4ZRKA 3UQAA 2WX0A 2O2VB 2J0MA 2KDEB 3H9DA 5CHWA 2K39A 1WH3A 1J19A 4CYEA 2N9PC 4EOYA 4ZDVA 1WX8A 3I3TB 1WXMA 2BYFA 4LDTB 2JT4B 2O6VA 5LXHA 2MBBB 4GB9A 4HLEA 2XK5B 1WYWB 4FLHA
chains in the Genus database with same CATH superfamily
4AJYB 4G11A 1JRUA 4S0RA 4AWJA 3C8YA 2RMMA 1UGMA 3A1QA 2KK8A 2HD5B 3SU8X 1GJZA 1EUVB 1QOAA 1KJTA 2J0JA 3BYYB 3NRZA 1K51A 1JRPA 1E7PB 1ET9A 3NVVA 3UIOB 2NCNA 2WXIA 3PLUA 1WJ4A 4LDTD 1C76A 2XN9C 2YVCA 3KVFB 1C77A 1MVKA 4JGHB 1HXYD 2Y5CA 2IO1B 3AEAB 4WWPA 3JW0X 5CTRC 2BS3B 3DHIC 3KLSX 4TQ0A 3R66C 4HK2A 1TZOA 1PGAA 2Z59B 2JYTA 2KYWA 2IO2B 4PK1A 3PLVA 4KGSA 3VHTC 4IOIE 1GNUA 5C1ZA 1QQRA 2QHOA 5FKAC 3IHPC 1E8ZA 3DBHB 1Q1OA 4W9HA 2LRUA 3RMKC 3HHMA 5MPOA 2QEJC 1YQ4B 3PS6A 3ABVB 2JQRB 3KUDB 1VR9A 4A20A 4C00A 4OVVA 4W9DA 1FXIA 1WXVA 2MLBA 2R2QA 4BFRA 3TSSA 2FCQA 3CIRB 4HWIB 5D6JB 3NOBA 2LGXA 3DQVA 5HFYA 3Q8EA 4XYCA 2I2YA 3ZJTA 2L0TA 3P4RB 2YEPB 2EMSA 1I42A 1JWAD 5IP4D 1FM0D 3VUXA 4HVBA 1F52A 4B95A 4LLGM 2GMIC 2XBBC 3ZDMC 1IBXB 1TS2A 3GZNI 2V0GA 3KQ4A 4LCDE 2J53A 3AEBB 2I38A 3TIXA 2KWDA 3VFKA 1I7HA 4X57B 4BBNC 3ECIA 4DHJB 3VTWA 2J52A 1CJEA 4DHZE 1JCKB 1YN5A 2FIDA 1UZXB 1U4AA 3JSVA 1SIJA 4MM3A 1QT9A 2L83A 5HI1A 3DVNV 1IGDA 4W9GA 1UH6A 4HJGE 1N61A 1R7SA 2MJ3A 4ZRIA 3PGEA 5KHOA 4NPNA 1FNVA 1WX9A 2KC1A 2WU5B 2IGGA 1XF5L 2DENB 1PGXA 4WWNA 2BKFA 4KZCA 3PRMB 2MEKA 2KOXA 2KKCA 5DPTA 4KV2A 4AJWA 2O6VD 4YXDB 4KSKC 4BOSC 2DHZA 3HVZA 2L8JA 3Q3JA 2KAJA 5KHQA 4NJ7A 1C3TA 2OOBB 2VZKB 2ACZB 1N63A 2CR5A 4IM2A 4GXBA 2EMTA 4FN2A 2FUHB 2G9HD 4JWUC 2KMAA 1T5XD 3ML9A 4DDID 1ENFA 3V61A 4CQNA 1LM8B 3AEEB 3M62B 1EM7A 2WS3B 3MP9A 1YJ1A 4GOCA 3B2GA 1KFYB 5T8IA 4RNAA 4WIPA 4OHJA 2KFJA 2V4IB 1VD2A 3TEWA 2AWTA 1SJED 2LVPA 1H4RA 1E7VA 4FJYA 4PS8A 1ZXIA 3T3OA 3B9JA 2VZKD 3IT4B 1PDXA 2D5GA 3C19A 1KM7A 4TKNA 4MT5A 2LD9A 2BYTA 5IOIA 4W9LA 4LJOB 2W54A 4UDUC 3H1UA 1YN4A 2DAJA 2MBQA 3NUHB 3SEBA 2GBKA 3ZNID 2HJ8A 2GBMA 1KH0A 2IZVB 4NAMA 2GRIA 5J17A 2BKRB 2QJLA 4K3BA 3VR9B 4W9CA 1YX6B 4XGAB 1FXAA 4OVZA 1PQSA 2ZPYA 1HZ6A 2WHIA 5DPRA 4DK5A 2E6XA 3DHGC 3ZUNA 1V6EA 4TV3A 2KDIA 4JX1C 3A9KB 5DCNA 1WRDB 4ZHPA 2IO3B 1TJEA 2AL3A 1N5WA 1XLQA 3NS1A 5BYSA 2J42A 2M19A 3DWMA 1LXDA 3N9YC 1ET6A 4AQ7A 1VZ6A 4ANWA 3E56A 3JSVB 4C4VA 1UELA 2MJDA 2WDVB 1WJNA 4B0MA 2LGDA 2V3NA 1E90A 4M00A 1TBEA 4MGZE 4OZAA 2FE8A 2LVQA 4OW0A 3P63A 2CU1A 5LNK1 3RUIB 1FRRA 2JRIB 3WAPA 1HTOA 3DCGA 4WJPA 2WLBA 3SR6A 1UUPA 5FK9C 4FADA 1VZ8A 2KACA 1CK1A 2JZPA 5HG2A 5CHVC 4P7IA 3PZDA 3QCAA 1K53A 1KLGD 4IM0A 1F1HA 2KJHB 4EEWA 2Z8LA 4RGOS 2KNBA 3URYA 1PYWD 1JW9D 2OJRA 1SGHA 5I4DA 2WXJA 2WP9B 1FIQA 2INCC 3EFUA 1ZW7A 4M8NA 2WYQA 3KYDD 1E0ZA 2VH2A 5CX3A 2DLBA 4DXFA 4XZ4A 1EWYC 3W1SC 3LB8C 2M17A 5AZHA 4XE0A 3P1MA 4MGIE 5IO9A 3TJPA 3V62A 4W9FA 3UQAA 1N5XA 2J0MA 2KDEB 2K39A 4ZDVA 3I3TB 1D4BA 1OFFA 1LGRA 1P7EA 3PO0A 2XK5B 4ICUA 2JWZA 2KJRA 1UBQA 2KFKA 2C5LC 4A90A 5E6NA 2LJ5A 3GOEA 2E3TA 2REXA 2AEHA 1LFDA 4BOZB 3APDA 1UGJA 4NJCA 1WX7A 2N1VA 2DZKA 1XD3B 3DBSA 4C80A 5BYQA 3Q8BA 2B3AA 3L54A 3Q3OC 2K0PA 1RFAA 1FNWA 1I35A 2J7QB 1J7CA 5L95C 3H7SA 3ZRCA 1STEA 3RT3B 4WAFA 1TYGB 2MA9B 4BKGA 2PMVA 3DDCB 1WE6A 2W82A 2WXMA 2FCMA 5EE3A 3R2IA 2MRPA 2ICIA 2K8BA 3AULA 2ZZPB 3CWIA 1ROEA 4EZJA 2V9HA 3DBRI 4RGNA 4I6LB 4IW0A 3VAWA 2BVCA 2LFIA 3GB1A 2Q5WD 4WWMA 1FO4A 1GC6A 3EGRA 1SIFA 1TIFA 4ZYNA 2KLCA 5HHDG 2ONQA 3T8MA 3V60A 3NS8A 3AB5A 3AV8A 1ISNA 3ZNGC 2JY6A 2ZJDA 3L4PA 4JLCA 2KC2A 2D11A 3UIPB 2Z0EB 2KWUB 3BVZA 1WZ0A 4BKSD 4QAYA 2XEWA 2ZVNA 3MC8A 1Q5WB 3U8ZA 1QZEA 2MWSB 4B6WA 4W9IA 1I4HA 2KN4A 4M0WB 3AE5B 5D2MB 1GOZA 1PUTA 2LVOA 2G4SA 3AU5A 1EO6A 2BBCA 2RPVA 1JMLA 1YJIA 3RNAC 3BWUD 3X23A 4C7ZA 2MSED 3PTFC 4RMAA 5G2NA 2V3SA 1WE7A 1RLFA 1HEZE 3A9JB 3GE8C 2BGFA 2W3SA 2MH7A 3DPDA 3N32A 1MG8A 4WQOB 2LWPA 1KRHA 2BTEA 3Q8FA 3AI5A 1DYQA 3TEZA 3NVYA 1WM3A 3OAWA 3TEXA 1E10A 2WWZA 2INPE 3B1LX 1S3SG 5BO4B 3RZWC 2Z0DB 1RM6C 1FCCC 5AEKB 5GXGB 2BQQA 3J9CA 3VVWB 2D3CA 1UD7A 2PVOD 4J3OD 1JROA 1XXGA 2ZCBA 3JYUA 1CQVA 4GGQA 4NQKE 2KXJA 5EDSA 4ARCA 3OWEB 3KH0A 4WAAA 4NNJB 3ALBA 1V9JA 3H6NA 2KQ7A 3MJ5A 4RH6A 1HE8A 1GAQB 2LXAA 3R7RA 4R3DA 1L0VB 5JXVA 5C3JB 2IPKD 2DWQA 4KSLC 1KLVA 1YOVB 1TGZB 3DBHI 4IWPA 3VH4B 4URKA 4GDKB 2M4NA 2N9KA 2K9XA 3M63B 2BS4B 2JWUA 1SE4A 1BT0A 1WGHA 3S2AA 3PVLA 1WJ6A 1XLPA 2LMCA 4TMAB 4MGKE 2WXQA 3ZTDA 4WJOA 3RYTA 1MG4A 4M02A 4HROA 2C60A 1WWTA 4GMVA 1ZKHA 2L76A 3I9V1 3ZW3A 3HUIA 1MI0A 1L6VA 1OQYA 1P9DU 4FXCA 2K6DB 2RR9A 1R4MB 1ESFA 2PTLA 1L6UA 4YTPB 4ANVA 4F8CB 3DBLI 1C4AA 1IPGA 1AARA 3Q3MC 4WWOA 3BYTB 4ANXA 3QK0A 3QC8B 2BF8B 4LNFA 2QDFA 3V3XA 2I1JA 5J2RA 1OQQA 2KANA 3PZ7A 3SFEB 4BVUC 4LK0M 1F0ZA 2MW5A 4FHKA 3RN9C 3ZQ4A 4JQWC 1NENB 2O6VB 4MH8A 1TY0A 2KTFA 2ZVOA 4NAWB 5G5HA 3IT6B 5JZEB 3GP7A 4P16A 1EWCA 4K81A 4LJPB 2WXOA 4F7ZA 2KHWB 4GU2A 4H2AA 5C23A 1TTNA 2X38A 3V6EB 2GOWA 2W9NA 2AQ3B 2AQ2B 1VLBA 1YD8U 3K9OB 2FUG1 3IVFA 2VH1A 1V5OA 3HK0A 1YQBA 5C2TB 2K6QA 1L7YA 1WGYA 2KX0A 2WDTB 3WANA 3DBRB 2PKOA 4E3CA 2CHZA 1UBIA 3NY5A 3O65B 2WDRB 4GIVA 1AYFA 2NPTB 3MFGA 4MJSB 1XO3A 4YTNB 4DHJD 1FMAD 1N60A 1AN8A 1V80A 4XWWA 1L4DB 5JHBA 4XX5A 4DXAB 3WCQA 1WI0A 2NPTA 5IA7A 3WAOA 4E71A 2KDBA 2LI5A 3H8HA 3WA0A 3DOWA 1SJHD 1D5ZC 2PEAA 1WXSA 4RM9A 1IUEA 2D07B 5IAAC 1J0GA 1V97A 4RM8A 3ZTCA 3U4EG 3NG0A 3RNBC 1NVID 4EFOA 4GDLB 2K8CA 2RSUA 3VDZA 1FD6A 3OJ3A 4II3B 2LUEA 2V3PA 4G3XB 1AWDA 3NVZA 3VTUA 4BKTA 3L16A 1LO5D 4C4VB 1T3QA 2LJIA 1WR1A 3A4RA 4RF0A 1Y56A 3Q8CA 3WALA 1GUAB 2NS5A 4KKJA 3KW5B 5AUIA 2DYMA 4MEMA 1H8CA 3FC4A 3M95A 2KD0A 2WXHA 3TBLD 2ZEQA 4NY0A 5LXIB 1I4PA 1E8YA 3DHHC 3Q14C 2LASA 2GBNA 2MX2A 1JWBD 4USAA 1I4GA 2KX3A 3LDZE 1PFDA 3R7QA 1UWXA 2BWES 2INDC 4IC7B 3SDLC 1CZPA 4K1RB 1WGKA 4RFBA 4NZLB 2X8XX 3IAM1 3U7DA 1QKZA 2O2VB 3W9CB 1F2RI 1N6ZA 1WH3A 1WX8A 1HZ5A 4MACA 1RYJA 2MBBB 4YSZB 1WYWB 4FLHA 3RCZA 1ZDVA 2SEBD 3FILB 3H7PA 1E8WA 2M56B 2G3QB 2G4DB 3BIID 3KUZA 1VZ7A 3MHZA 2C7NB 2WGSA 2JUOA 3ZLZA 4IM3A 4HPLB 2KTRA 2M0XA 4I6PA 4G0NB 2UU7A 1YQ3B 5EE1A 2BB5A 1RRBA 1L0XB 3UI3A 3W5VB 4IG7B 3E9SA 2M8SA 1GG3A 4HKZE 1ZP0B 3VRAB 3RNFC 3Q3NC 1C79A 1R4MI 3W1SA 4B0EA 1F9JA 4NJ6A 1BUIC 3DVGY 2G1EA 1IBXA 2MP2A 2IBIB 2JZ3B 1ZUD2 1WJUA 1C9FA 4I6NB 1R4NB 2DNFA 3BK2A 3AU4A 4MELA 1NI3A 2GB1A 4P6VF 4HPMB 2WNMA 4GLSC 1MFWA 5LLIA 4EE2A 3B0AA 3Q8AA 5J18A 1V86A 2FIFA 1T0RC 2LXCA 3EC8A 3AN1A 4HDQA 3MC0B 3PREA 4C7YA 2PJHA 1MHHE 2PW9A 3PPAA 2NTTA 3I57A 1E8XA 5D3IB 1NDDA 2BYEA 3VTVA 1QOFA 1OEYJ 4YT0B 3UQBA 2HJ1A 1FRDA 3N3KB 3OG5A 3B08A 5TR5A 1J7BA 2XNAC 1RWSA 3ZDTA 5GMVA 3RNGC 4M8MA 3QHTA 1CMXB 4GDKA 1V1OA 3QJZA 2DAFA 4TSSA 3ZNHB 1SE2A 3ETRA 2LRWA 1TT5B 2KT7A 2V4LA 2RPQA 1ZXHA 4HPPA 4KVGB 1P3QU 1GB1A 2C9WB 2G45B 4FJVB 3ZJVA 5BMGA 3RI7C 3AEFB 2RD0A 4RGMA 2JXXA 1LQBA 3ZGZA 3L0WB 4A3OA 2L0FA 2WXRA 2PE9A 2MJEA 1EF5A 2IY0B 1V1PB 4JE3B 3AM9A 2QCZA 3P4PB 4AOFA 3UINB 2FBWB 2ZNVC 4ZRJA 2LUMA 1XQQA 4DDGD 4N58A 3AECB 1C4PA 3P4SB 2DBYA 2YEPF 1D3ZA 2KDFB 4C56C 1WXQA 1IGCA 4ZHOA 1BXTA 3EHVA 4PT5A 4S17A 1MHXA 4RGTA 1NYQA 3ML8A 1XLNA 2RDGA 4KDLB 2AL6A 2UWQA 2EKIA 4TQ1A 2KFKB 2W55A 2Y5BB 1WRIA 1C1YB 5E6PA 3RFZB 4K7WA 2UYZB 2FCNA 3BZDB 5DPWA 3TEYA 3OJ4B 1SBBB 3L13A 3UF8A 4ANUA 5L83A 1WFYA 1VCBA 4IUMB 3BK1A 2LGIA 3HIZA 4WQMA 5D94A 3JVZX 4XC2A 4BZAA 1E6EB 3BVMA 1N62A 1QF6A 3QARA 2BT6A 4KZ0A 3X0WA 4E74A 2J4XA 5IKCM 3ZIMA 2WXGA 3LYYA 3OLMD 4B9KA 1P0RA 4DHZB 1YN3A 2DX5B 3ZO5B 3A9KA 2BPSA 4IWOA 1SE9A 2KVZA 2N4FA 4ARIA 2H88B 2VRRB 2LHEA 4XDCA 2JU6X 2NMQA 3KYCD 5D7GA 2IGHA 2H89B 3PRZA 2KWVB 2CJNA 2IJ0A 2L7RA 1E5WA 4O1NA 2NBUA 4MJSA 2JVCA 4MM3B 3GZNB 4EUTA 1K50A 1L0YB 4ZOHC 5CHFA 4KIKA 4L1BA 3RD2A 4W9JA 2QMTA 2NBWB 4HDOA 4DBGA 1C4CA 1WYGA 1L5PA 1J7AA 3NVWA 4FBJB 1MPEA 4MH0E 1SF0A 2IO0B 4DWFA 1OEYA 1K8RB 2D3BA 1GB4A 2DZJA 3QWZB 5H8YE 4W9KA 2GI9A 1ZE3D 1X1MA 1NYRA 1XT9B 3EUB2 4L23A 1P1AA 3R8BA 4WH4A 4EZKA 1TKEA 4A3PA 1WGGA 2KVRA 5IN7A 4RCOA 2CKHB 1UWMA 1DOXA 4A6QA 2L05A 1EF1A 4ICVA 4YSYB 3KWVA 4WJQA 3HM3A 2QILA 4HCNB 1XLOA 2ZW0A 3AE6B 2AQ1B 3NZUA 3MJWA 3K9PB 4HRSA 2L52A 5AZFA 1F77A 4MSQB 3ZNZB 1VJKA 4HJKA 3ONSA 5FR6A 2QC8A 5G5GA 3SHQA 2FCSA 2WX1A 4L2YA 2CJOA 3N1ZC 4II2B 1SE3A 1GPXA 1FNUA 2D3GA 1JQ4A 3VXWA 1WR6E 2NR2A 4FULA 1B1ZA 1A70A 3R2TA 1QOBA 1Z2MA 2BS2B 3IAS1 1QLBB 1NI2A 2GBJA 2B76B 3UGBB 2Y3AA 4IKGA 4KGTA 3RULA 5HKHA 2ON8A 4US8A 1WM2A 5E6JA 2LZ6A 1JWSD 2AYOB 3U30A 3RZFA 1L2NA 1QILA 2KO3A 3N1XC 1V49A 1TY2A 3U7ZA 2IGDA 2OJWA 4ZYSA 3CMMB 1IP9A 2YLMA 3PHWB 4CHKA 2PIAA 1UNSA 3P2BA 1BMLC 4RF1A 2WXLA 4BKSA 1IYFA 2N7EA 5DPSA 4EZLA 2BWFA 3ZXVA 1UF0A 3V6CB 5TSSA 4AS1A 4OZCA 3Q2AC 5EE9A 4KIKB 1DOYA 2EELA 2ZNVB 1I4XA 2SAKA 2WX0A 4XWTA 1DGJA 4D2KA 1J19A 2GLSA 4EOYA 2N9PC 3EFCA 1WXMA 2BYFA 2JT4B 2O6VA 4GB9A 1TS5A 2WXKA 2OHFA 3P42A 2MBHA 2O2VA 1TS4A 1Y8RC 3TL5A 1HQRD 5JHAA 1HTQA 4LNNA 5D3DA 2C7MB 2PPHA 4P1CC 2KMMA 2MCNB 4EKUA 3I63C 1E7UA 1ZOYB 2N0SB 3DWGC 3CSFA 5AZGA 1YX5B 3T9LA 4LTUA 2KZRA 3W5UB 2XK5A 3L08A 1WSPA 4K7SA 4ASWC 3A9JA 3VR8B 2HDEA 2BB6A 2FNJB 3Q69A 3AE9B 1RFKA 3L10B 4PS3A 1XCTL 3DVNU 2IY1B 1F2RC 1G6JA 2DZIA 2NBVB 3AEDB 3R3MA 4IWQA 2J0KA 2K22A 3RNCC 4HEA1 3VH3B 1YJJA 4M0WA 4GDLA 4ZRQA 3O13A 3TUOA 3V05A 2L32A 4PYZA 1RAXA 2N7JA 3APFA 3PT2B 3FILA 2N7DA 3IG3A 1J8CA 4ITKA 1FFVA 2N9LA 1K52A 2ZW1A 2CHXA 4FJZA 3LJ3A 1XCQL 1B9RA 2K8HA 4F1SA 2MBEA 3NZ3A 2OEDA 3QAQA 2JYEA 2V1YA 1WF9A 2D2QA 4J6IA 1OQRA 2JZZA 2WXFA 3Q3FA 1EU3A 4G50A 2KN5A 4YWGG 1S1QB 4LNOA 2N9XA 3L17A 3KWLA 1C78A 3ZVVA 4YTMB 2N1WA 4TUUA 4KKIA 2ZPNA 3A1QB 1I4QA 4OZBA 1QOGA 1A5RA 2WU2B 1P98A 3DBLB 5BMHA 1D5MC 2WXNA 3AMZA 2PVGC 4AP4C 1WXAA 3QIJA 1SEBD 2PLPA 1OGWA 3TCAA 2MBOA 1ZGUB 2MQJA 4JPSA 4REZA 1FXTB 5E6OA 4N59A 1V2YA 1WMHA 3PRPB 2KQSA 4N9F4 4A8XC 1KOTA 1MJDA 1TS3A 2KMCA 4PS7A 3AXCA 4W9EA 4DQOC 4P1BC 2JSVX 3PHXB 2DYBA 1WMHB 3N20C 2KQ4X 1YNTE 2IDYA 3U2SC 1KF6B 1V81A 4A9AA 3RNEC 1P7FA 3TMPB 3AE8B 3ZYYX 4US9A 4AUQC 1V8CA 2IYDB 3I5JC 2KJ6A 2KTRB 3PZ8A 3VQIA 1E9MA 1JWMD 3W1YA 2WQYB 2PE6B 1OTRB 2LHDA 2ZCCA 1FPYA 1NEKB 1FCLA 3NZSA 3IXSA 1SSNA 3ZRFA 2D10A 3HRDD 1V5TA 3BY4B 3CF6E 4YL8A 3APCA 1R4NI 5EE0A 4LNIA 3RPFC 1Q10A 2R61A 3HM6X 4KGRA 3HVDA 3BVGA 3C0RB 5BMIA 2BYVE 2LGYA 1D5XC 3ZJUA 4CO7A 3A33B 4FA6A 2D3AA 1AW7A 1YIWA 1WY8A 2A4ZA 3P4QB 4HKQA 1T6BX 4KX6B 1T0YA 4A55A 3AEGB 1VRAB 3AE2B 4WJNA 1WIAA 1YMHE 3GS2A 2RGFA 3U52E 4LNKA 4JL9A 1JWUD 2BW2A 4Q2JA 5H92C 2K5PA 2AX5A 2JF5A 1KLUD 1ZPSA 3VRBB 3QA8A 2KWCA 4BAXA 2RDBC 2I1KA 2R2OA 1FEHA 1FFUA 4ZRPA 4WURA 3AE3B 4ACFA 2FAZA 3NJTA 4MGYE 3PV1A 1M4VA 3AE4B 4K7UA 2Y5PA 3EA6A 2KDMA 3ENEA 2DZMA 2M0AA 3FKYA 4DXGA 3LXFA 1TZ1A 2WXPA 3FAHA 2MP2B 2MHJA 3ZXRA 5AUKA 2NVUI 4NQLB 1SXTA 1T0SC 2ASQA 2K25A 1GC7A 1WZ3A 1Q0WB 2CHWA 2JXTA 4MSMB 3VUYA 2GBRA 4JIOU 2DYOA 4YSXB 2C7HA 2CU3A 4JWSC 3AE7B 3BINA 1V1PA 2JX5A 5JH5C 3IFWB 3KUCB 1SB3C 3NHEB 2JRHA 3ZKJC 2K1FA 3WIMA 3T3NA 1WGDA 3H7PB 3SD5A 2M1MA 3AH7A 3B2FA 3W2DA 4GN1A 4NAWA 2LGSA 2TSSA 3QX1A 3IBEA 4N6EB 3SFDB 3A4SC 3PSEB 1EU4A 3EECA 5BYRA 3QQ8B 2W3RA 2KLGA 2N9EB 3D32A 3MTNB 4MDKE 2INNE 3DVGX 2L3ZA 3MC9A 4PYUA 1JALA 2HTHA 2NTSA 2HTME 4BBNF 1L4ZB 2QSDA 2CS4A 1NBFC 3M3JA 2JPHA 2L00B 3AE1B 1DOIA 4GSWA 3VUWA 1D6EC 3N30A 4M01A 4OVUA 1M94A 2HE7A 2A5UA 1TKYA 3Q6BA 1ACCA 2K3UA 1VDVA 1I4RA 4K3CA 4HXDA 5G55A 2QIEB 4KDIC 5FR3A 3MHSD 4FHJA 1PGBA 3N1YC 1WGRA 1KTKA 4IDIA 4HCPB 1Z5SB 1HA5A 2LEKA 3CSTA 3WAMA 2EKEC 4ZRKA 3H9DA 5CHWA 2WDQB 2L1AA 4CYEA 4LDTB 5LXHA 1T0QC 1TKGA 1XEEA 4XDDA 4HLEA 1ZDXA 2RDHA 3GE3C
chains in the Genus database with same CATH topology
2JWZA 2KJRA 4AJYB 1UBQA 3H7PA 2MBHA 1E8WA 2KFKA 2G3QB 2O2VA 2C5LC 2G4DB 4G11A 2LJ5A 5E6NA 1Y8RC 3GOEA 3TL5A 5JHAA 1JRUA 2REXA 4AWJA 3KUZA 2AEHA 1UGMA 3A1QA 2C7MB 2PPHA 2KK8A 1LFDA 2C7NB 3APDA 2HD5B 3SU8X 4BOZB 1GJZA 2MCNB 1EUVB 4EKUA 1E7UA 2JUOA 3ZLZA 4IM3A 1KJTA 1WX7A 2DZKA 2KTRA 2J0JA 2M0XA 2N1VA 4G0NB 4HPLB 4I6PA 1XD3B 3CSFA 5AZGA 3DBSA 1YX5B 2B3AA 1RRBA 3L54A 3T9LA 2KZRA 1RFAA 2XK5A 3L08A 4K7SA 4ASWC 3A9JA 4IG7B 3UIOB 1I35A 2NCNA 2M8SA 3PLUA 1WJ4A 2FNJB 2J7QB 4LDTD 5L95C 1GG3A 3ZVVA 3H7SA 3ZRCA 3L10B 4PS3A 3DVNU 2IY1B 1R4MI 1G6JA 2DZIA 2NBVB 3RT3B 1F9JA 3W1SA 2YVCA 4NJ6A 3DVGY 3R3MA 3KVFB 4IWQA 2J0KA 2MA9B 4BKGA 4JGHB 3DDCB 2MP2A 1WE6A 2IBIB 2JZ3B 2IO1B 1WJUA 4WWPA 4I6NB 3JW0X 2FCMA 3VH3B 5CTRC 3AU4A 2MRPA 4MELA 4GDLA 4TQ0A 2K8BA 3AULA 3R66C 2ZZPB 4HPMB 4HK2A 4EZJA 2Z59B 4PYZA 5LLIA 1RAXA 2IO2B 3PLVA 3DBRI 3APFA 3B0AA 3PT2B 3VHTC 4I6LB 4IW0A 1GNUA 3VAWA 2N7DA 3IG3A 5J18A 1J8CA 1V86A 5C1ZA 2FIFA 1GC6A 2QHOA 1SIFA 2LXCA 3EC8A 3IHPC 4HDQA 4ZYNA 2CHXA 3PREA 2KLCA 1E8ZA 1Q1OA 2PJHA 4W9HA 4FJZA 3T8MA 3V60A 2LRUA 3NS8A 3LJ3A 2K8HA 4F1SA 2MBEA 3PPAA 3HHMA 1ISNA 3PS6A 1E8XA 3ZNGC 1NDDA 2JY6A 2ZJDA 4JLCA 3QAQA 2BYEA 2KC2A 3KUDB 2V1YA 1WF9A 4A20A 2D2QA 4J6IA 4OVVA 3VTVA 4W9DA 1WXVA 2D11A 2JZZA 3UIPB 2Z0EB 1OEYJ 2KWUB 2MLBA 3Q3FA 2R2QA 4BFRA 3UQBA 1WZ0A 4BKSD 2FCQA 3N3KB 3B08A 5TR5A 4HWIB 4G50A 5D6JB 3NOBA 2KN5A 3ZDTA 2XEWA 1S1QB 5GMVA 2LGXA 2N9XA 4M8MA 2ZVNA 3L17A 1CMXB 1Q5WB 3QHTA 4GDKA 3QJZA 1QZEA 2MWSB 3DQVA 3U8ZA 2N1WA 2DAFA 4B6WA 4TUUA 4W9IA 4M0WB 2ZPNA 3A1QB 2L0TA 3ZNHB 5D2MB 2EMSA 1A5RA 1I42A 2LVOA 2G4SA 2LRWA 3VUXA 1P98A 2V4LA 4HVBA 2RPQA 3AU5A 1EO6A 4B95A 2GMIC 2XBBC 3ZDMC 4AP4C 1WXAA 3QIJA 3GZNI 4KVGB 1P3QU 4LCDE 2C9WB 1OGWA 3X23A 2G45B 3TCAA 2MBOA 2MSED 3PTFC 4FJVB 4RMAA 5G2NA 3TIXA 1ZGUB 2MQJA 2V3SA 1WE7A 1RLFA 2RD0A 2JXXA 1LQBA 3L0WB 3A9JB 3VFKA 1FXTB 5E6OA 4A3OA 2BGFA 3N32A 1V2YA 1WMHA 3DPDA 3PRPB 1MG8A 2KQSA 2L0FA 4X57B 4BBNC 4N9F4 2PE9A 3ECIA 1EF5A 2IY0B 4WQOB 4DHJB 1KOTA 2LWPA 3VTWA 2KMCA 4PS7A 3AXCA 4W9EA 4AOFA 3AI5A 3UINB 3PHXB 4DHZE 2ZNVC 4ZRJA 2DYBA 1WM3A 3OAWA 2FIDA 1WMHB 1XQQA 1UZXB 1U4AA 2WWZA 3JSVA 3B1LX 1S3SG 5BO4B 3RZWC 4DDGD 2Z0DB 4MM3A 3DVNV 1V81A 4W9GA 1D3ZA 1UH6A 5AEKB 2KDFB 4ZRIA 3PGEA 3TMPB 5KHOA 4NPNA 3VVWB 1WX9A 2KC1A 1UD7A 4AUQC 2IYDB 2DENB 2KJ6A 2KTRB 4WWNA 2BKFA 4KZCA 3EHVA 3VQIA 3PRMB 3W1YA 2KOXA 2PE6B 2KKCA 5DPTA 1OTRB 2ZCCA 3ML8A 4KV2A 4AJWA 2ZCBA 3JYUA 2O6VD 3NZSA 4GGQA 4KDLB 4NQKE 2AL6A 2UWQA 4KSKC 4BOSC 2KXJA 3ZRFA 4TQ1A 2DHZA 5EDSA 2D10A 2L8JA 1V5TA 2KFKB 3BY4B 2Y5BB 3CF6E 3APCA 1R4NI 4YL8A 1C1YB 3Q3JA 5E6PA 4K7WA 5KHQA 3KH0A 2UYZB 4WAAA 4NJ7A 4NNJB 2FCNA 1C3TA 5DPWA 3ALBA 3HM6X 2OOBB 1V9JA 3H6NA 3C0RB 2KQ7A 3L13A 3OJ4B 3UF8A 4ANUA 5L83A 1WFYA 2BYVE 2LGYA 1HE8A 1VCBA 4IUMB 2LXAA 3HIZA 3R7RA 3A33B 5D94A 4CO7A 3JVZX 4FA6A 4XC2A 2CR5A 4IM2A 4KSLC 1YIWA 1WY8A 4GXBA 2EMTA 1KLVA 2A4ZA 4FN2A 2FUHB 1T0YA 3QARA 1TGZB 3DBHI 2KMAA 4IWPA 3VH4B 4URKA 4KZ0A 3ML9A 4WJNA 4GDKB 3X0WA 1WIAA 2M4NA 4DDID 4E74A 3V61A 1LM8B 3ZIMA 2RGFA 3M63B 3M62B 3OLMD 4JL9A 4B9KA 1YJ1A 4GOCA 1BT0A 1WGHA 3S2AA 1P0RA 3PVLA 2KFJA 1WJ6A 4DHZB 2DX5B 3ZO5B 3RCZA 3A9KA 2BPSA 1VD2A 4MGKE 4IWOA 1SE9A 3ZTDA 2AWTA 4WJOA 2JF5A 3RYTA 2LVPA 1H4RA 1E7VA 2N4FA 4FJYA 4PS8A 3QA8A 2VRRB 2KWCA 2C60A 3KYCD 4GMVA 5D7GA 2I1KA 1ZKHA 2L76A 3ZW3A 3PRZA 2KWVB 2L7RA 1E5WA 1OQYA 2NBUA 4MJSA 1P9DU 2JVCA 2R2OA 2K6DB 2RR9A 1KM7A 4TKNA 4EUTA 2FAZA 2LD9A 4ANVA 4F8CB 3DBLI 4MGYE 4LJOB 4W9LA 3PV1A 5CHFA 4KIKA 1IPGA 1AARA 3H1UA 4K7UA 3RD2A 4W9JA 4WWOA 2DAJA 2MBQA 3ENEA 4ANXA 2NBWB 3QK0A 4HDOA 4DBGA 3QC8B 2BF8B 2DZMA 2I1JA 2GBKA 3ZNID 2HJ8A 5J2RA 2KANA 4FBJB 4MH0E 1TZ1A 2GBMA 2IZVB 2IO0B 4BVUC 2MP2B 1OEYA 4DWFA 1K8RB 2MW5A 4FHKA 5J17A 2DZJA 3QWZB 2BKRB 4JQWC 4W9KA 2NVUI 4NQLB 2O6VB 1X1MA 4W9CA 5JZEB 2KTFA 2ZVOA 4NAWB 1YX6B 1PQSA 2ZPYA 1XT9B 4K81A 4LJPB 4F7ZA 2ASQA 2KHWB 2K25A 1P1AA 1GC7A 4GU2A 1WZ3A 5C23A 1TTNA 5DPRA 4EZKA 1Q0WB 4DK5A 2CHWA 3V6EB 2GOWA 2W9NA 1WGGA 4MSMB 3VUYA 4A3PA 2GBRA 4JIOU 1YD8U 2DYOA 2KVRA 3ZUNA 3K9OB 2C7HA 3BINA 2CKHB 1V6EA 5JH5C 4TV3A 2KDIA 3IFWB 3IVFA 3KUCB 3NHEB 2JRHA 2L05A 1EF1A 3A9KB 4ICVA 1V5OA 3HK0A 5DCNA 1WRDB 3ZKJC 1YQBA 2K6QA 4WJQA 1L7YA 2IO3B 2K1FA 3HM3A 3WIMA 1WGYA 2KX0A 1WGDA 2WDTB 3H7PB 4HCNB 2AL3A 3SD5A 3WANA 2M1MA 3NZUA 3MJWA 1LXDA 3K9PB 4E3CA 2CHZA 1UBIA 3NY5A 3O65B 4GN1A 4NAWA 4GIVA 5AZFA 2NPTB 4MSQB 4ANWA 3QX1A 4MJSB 3ZNZB 3JSVB 4DHJD 1UELA 3IBEA 1WJNA 2LGDA 1V80A 4HJKA 3ONSA 1E90A 3A4SC 1TBEA 4MGZE 5JHBA 5FR6A 4XX5A 3PSEB 3SHQA 2FCSA 2LVQA 3EECA 4DXAB 2WX1A 1WI0A 2NPTA 5IA7A 2CU1A 3WAOA 3QQ8B 2KDBA 2LI5A 4II2B 3RUIB 3WA0A 4E71A 2KLGA 2JRIB 2N9EB 3DOWA 3WAPA 3D32A 2D3GA 3MTNB 4MDKE 3VXWA 1WR6E 2NR2A 3DCGA 4FULA 2PEAA 1WXSA 3DVGX 4WJPA 4RM9A 2L3ZA 2D07B 1Z2MA 4PYUA 4FADA 2HTHA 5IAAC 1J0GA 1NI2A 4RM8A 3ZTCA 4BBNF 2GBJA 2CS4A 3UGBB 4EFOA 4GDLB 2K8CA 2RSUA 3VDZA 1NBFC 3M3JA 2JPHA 3OJ3A 4II3B 2L00B 2LUEA 5CHVC 3RULA 4P7IA 3PZDA 4GSWA 3QCAA 3N30A 3VUWA 4G3XB 5HKHA 1WM2A 3VTUA 2LZ6A 4IM0A 4BKTA 3L16A 1M94A 4OVUA 2HE7A 2A5UA 2KJHB 4EEWA 2AYOB 3U30A 3RZFA 1WR1A 1L2NA 2KO3A 2KNBA 3A4RA 3WALA 4ICUA 1GUAB 2NS5A 1V49A 3KW5B 2DYMA 2OJRA 4MEMA 1H8CA 4HXDA 5G55A 1SGHA 3M95A 4KDIC 2KD0A 3CMMB 1IP9A 2YLMA 3PHWB 3MHSD 4FHJA 3TBLD 4CHKA 2ZEQA 4NY0A 5LXIB 1E8YA 3P2BA 2LASA 2GBNA 1ZW7A 2MX2A 3EFUA 4M8NA 2WYQA 2KX3A 1WGRA 3KYDD 3LDZE 3R7QA 4BKSA 1IYFA 2N7EA 2BWES 4HCPB 1Z5SB 4IC7B 5CX3A 5DPSA 3SDLC 4K1RB 2BWFA 4EZLA 4XZ4A 3W1SC 3V6CB 3CSTA 2M17A 4KIKB 5AZHA 4MGIE 3WAMA 3TJPA 2EKEC 3U7DA 3V62A 4W9FA 2ZNVB 4ZRKA 3UQAA 2WX0A 2O2VB 2J0MA 2KDEB 3H9DA 5CHWA 2K39A 1WH3A 1J19A 4CYEA 2N9PC 4EOYA 4ZDVA 1WX8A 3I3TB 1WXMA 2BYFA 4LDTB 2JT4B 2O6VA 5LXHA 2MBBB 4GB9A 4HLEA 2XK5B 1WYWB 4FLHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2JWZ A;  2KJR A;  4AJY B;  1UBQ A;  3H7P A;  2MBH A;  1E8W A;  2KFK A;  2G3Q B;  2O2V A;  2C5L C;  2G4D B;  4G11 A;  2LJ5 A;  5E6N A;  1Y8R C;  3GOE A;  3TL5 A;  5JHA A;  1JRU A;  2REX A;  4AWJ A;  3KUZ A;  2AEH A;  1UGM A;  3A1Q A;  2C7M B;  2PPH A;  2KK8 A;  1LFD A;  2C7N B;  3APD A;  2HD5 B;  3SU8 X;  4BOZ B;  1GJZ A;  2MCN B;  1EUV B;  4EKU A;  1E7U A;  2JUO A;  3ZLZ A;  4IM3 A;  1KJT A;  1WX7 A;  2DZK A;  2KTR A;  2J0J A;  2M0X A;  2N1V A;  4G0N B;  4HPL B;  4I6P A;  1XD3 B;  3CSF A;  5AZG A;  3DBS A;  1YX5 B;  2B3A A;  1RRB A;  3L54 A;  3T9L A;  2KZR A;  1RFA A;  2XK5 A;  3L08 A;  4K7S A;  4ASW C;  3A9J A;  4IG7 B;  3UIO B;  1I35 A;  2NCN A;  2M8S A;  3PLU A;  1WJ4 A;  2FNJ B;  2J7Q B;  4LDT D;  5L95 C;  1GG3 A;  3ZVV A;  3H7S A;  3ZRC A;  3L10 B;  4PS3 A;  3DVN U;  2IY1 B;  1R4M I;  1G6J A;  2DZI A;  2NBV B;  3RT3 B;  1F9J A;  3W1S A;  2YVC A;  4NJ6 A;  3DVG Y;  3R3M A;  3KVF B;  4IWQ A;  2J0K A;  2MA9 B;  4BKG A;  4JGH B;  3DDC B;  2MP2 A;  1WE6 A;  2IBI B;  2JZ3 B;  2IO1 B;  1WJU A;  4WWP A;  4I6N B;  3JW0 X;  2FCM A;  3VH3 B;  5CTR C;  3AU4 A;  2MRP A;  4MEL A;  4GDL A;  4TQ0 A;  2K8B A;  3AUL A;  3R66 C;  2ZZP B;  4HPM B;  4HK2 A;  4EZJ A;  2Z59 B;  4PYZ A;  5LLI A;  1RAX A;  2IO2 B;  3PLV A;  3DBR I;  3APF A;  3B0A A;  3PT2 B;  3VHT C;  4I6L B;  4IW0 A;  1GNU A;  3VAW A;  2N7D A;  3IG3 A;  5J18 A;  1J8C A;  1V86 A;  5C1Z A;  2FIF A;  1GC6 A;  2QHO A;  1SIF A;  2LXC A;  3EC8 A;  3IHP C;  4HDQ A;  4ZYN A;  2CHX A;  3PRE A;  2KLC A;  1E8Z A;  1Q1O A;  2PJH A;  4W9H A;  4FJZ A;  3T8M A;  3V60 A;  2LRU A;  3NS8 A;  3LJ3 A;  2K8H A;  4F1S A;  2MBE A;  3PPA A;  3HHM A;  1ISN A;  3PS6 A;  1E8X A;  3ZNG C;  1NDD A;  2JY6 A;  2ZJD A;  4JLC A;  3QAQ A;  2BYE A;  2KC2 A;  3KUD B;  2V1Y A;  1WF9 A;  4A20 A;  2D2Q A;  4J6I A;  4OVV A;  3VTV A;  4W9D A;  1WXV A;  2D11 A;  2JZZ A;  3UIP B;  2Z0E B;  1OEY J;  2KWU B;  2MLB A;  3Q3F A;  2R2Q A;  4BFR A;  3UQB A;  1WZ0 A;  4BKS D;  2FCQ A;  3N3K B;  3B08 A;  5TR5 A;  4HWI B;  4G50 A;  5D6J B;  3NOB A;  2KN5 A;  3ZDT A;  2XEW A;  1S1Q B;  5GMV A;  2LGX A;  2N9X A;  4M8M A;  2ZVN A;  3L17 A;  1CMX B;  1Q5W B;  3QHT A;  4GDK A;  3QJZ A;  1QZE A;  2MWS B;  3DQV A;  3U8Z A;  2N1W A;  2DAF A;  4B6W A;  4TUU A;  4W9I A;  4M0W B;  2ZPN A;  3A1Q B;  2L0T A;  3ZNH B;  5D2M B;  2EMS A;  1A5R A;  1I42 A;  2LVO A;  2G4S A;  2LRW A;  3VUX A;  1P98 A;  2V4L A;  4HVB A;  2RPQ A;  3AU5 A;  1EO6 A;  4B95 A;  2GMI C;  2XBB C;  3ZDM C;  4AP4 C;  1WXA A;  3QIJ A;  3GZN I;  4KVG B;  1P3Q U;  4LCD E;  2C9W B;  1OGW A;  3X23 A;  2G45 B;  3TCA A;  2MBO A;  2MSE D;  3PTF C;  4FJV B;  4RMA A;  5G2N A;  3TIX A;  1ZGU B;  2MQJ A;  2V3S A;  1WE7 A;  1RLF A;  2RD0 A;  2JXX A;  1LQB A;  3L0W B;  3A9J B;  3VFK A;  1FXT B;  5E6O A;  4A3O A;  2BGF A;  3N32 A;  1V2Y A;  1WMH A;  3DPD A;  3PRP B;  1MG8 A;  2KQS A;  2L0F A;  4X57 B;  4BBN C;  4N9F 4;  2PE9 A;  3ECI A;  1EF5 A;  2IY0 B;  4WQO B;  4DHJ B;  1KOT A;  2LWP A;  3VTW A;  2KMC A;  4PS7 A;  3AXC A;  4W9E A;  4AOF A;  3AI5 A;  3UIN B;  3PHX B;  4DHZ E;  2ZNV C;  4ZRJ A;  2DYB A;  1WM3 A;  3OAW A;  2FID A;  1WMH B;  1XQQ A;  1UZX B;  1U4A A;  2WWZ A;  3JSV A;  3B1L X;  1S3S G;  5BO4 B;  3RZW C;  4DDG D;  2Z0D B;  4MM3 A;  3DVN V;  1V81 A;  4W9G A;  1D3Z A;  1UH6 A;  5AEK B;  2KDF B;  4ZRI A;  3PGE A;  3TMP B;  5KHO A;  4NPN A;  3VVW B;  1WX9 A;  2KC1 A;  1UD7 A;  4AUQ C;  2IYD B;  2DEN B;  2KJ6 A;  2KTR B;  4WWN A;  2BKF A;  4KZC A;  3EHV A;  3VQI A;  3PRM B;  3W1Y A;  2KOX A;  2PE6 B;  2KKC A;  5DPT A;  1OTR B;  2ZCC A;  3ML8 A;  4KV2 A;  4AJW A;  2ZCB A;  3JYU A;  2O6V D;  3NZS A;  4GGQ A;  4KDL B;  4NQK E;  2AL6 A;  2UWQ A;  4KSK C;  4BOS C;  2KXJ A;  3ZRF A;  4TQ1 A;  2DHZ A;  5EDS A;  2D10 A;  2L8J A;  1V5T A;  2KFK B;  3BY4 B;  2Y5B B;  3CF6 E;  3APC A;  1R4N I;  4YL8 A;  1C1Y B;  3Q3J A;  5E6P A;  4K7W A;  5KHQ A;  3KH0 A;  2UYZ B;  4WAA A;  4NJ7 A;  4NNJ B;  2FCN A;  1C3T A;  5DPW A;  3ALB A;  3HM6 X;  2OOB B;  1V9J A;  3H6N A;  3C0R B;  2KQ7 A;  3L13 A;  3OJ4 B;  3UF8 A;  4ANU A;  5L83 A;  1WFY A;  2BYV E;  2LGY A;  1HE8 A;  1VCB A;  4IUM B;  2LXA A;  3HIZ A;  3R7R A;  3A33 B;  5D94 A;  4CO7 A;  3JVZ X;  4FA6 A;  4XC2 A;  2CR5 A;  4IM2 A;  4KSL C;  1YIW A;  1WY8 A;  4GXB A;  2EMT A;  1KLV A;  2A4Z A;  4FN2 A;  2FUH B;  1T0Y A;  3QAR A;  1TGZ B;  3DBH I;  2KMA A;  4IWP A;  3VH4 B;  4URK A;  4KZ0 A;  3ML9 A;  4WJN A;  4GDK B;  3X0W A;  1WIA A;  2M4N A;  4DDI D;  4E74 A;  3V61 A;  1LM8 B;  3ZIM A;  2RGF A;  3M63 B;  3M62 B;  3OLM D;  4JL9 A;  4B9K A;  1YJ1 A;  4GOC A;  1BT0 A;  1WGH A;  3S2A A;  1P0R A;  3PVL A;  2KFJ A;  1WJ6 A;  4DHZ B;  2DX5 B;  3ZO5 B;  3RCZ A;  3A9K A;  2BPS A;  1VD2 A;  4MGK E;  4IWO A;  1SE9 A;  3ZTD A;  2AWT A;  4WJO A;  2JF5 A;  3RYT A;  2LVP A;  1H4R A;  1E7V A;  2N4F A;  4FJY A;  4PS8 A;  3QA8 A;  2VRR B;  2KWC A;  2C60 A;  3KYC D;  4GMV A;  5D7G A;  2I1K A;  1ZKH A;  2L76 A;  3ZW3 A;  3PRZ A;  2KWV B;  2L7R A;  1E5W A;  1OQY A;  2NBU A;  4MJS A;  1P9D U;  2JVC A;  2R2O A;  2K6D B;  2RR9 A;  1KM7 A;  4TKN A;  4EUT A;  2FAZ A;  2LD9 A;  4ANV A;  4F8C B;  3DBL I;  4MGY E;  4LJO B;  4W9L A;  3PV1 A;  5CHF A;  4KIK A;  1IPG A;  1AAR A;  3H1U A;  4K7U A;  3RD2 A;  4W9J A;  4WWO A;  2DAJ A;  2MBQ A;  3ENE A;  4ANX A;  2NBW B;  3QK0 A;  4HDO A;  4DBG A;  3QC8 B;  2BF8 B;  2DZM A;  2I1J A;  2GBK A;  3ZNI D;  2HJ8 A;  5J2R A;  2KAN A;  4FBJ B;  4MH0 E;  1TZ1 A;  2GBM A;  2IZV B;  2IO0 B;  4BVU C;  2MP2 B;  1OEY A;  4DWF A;  1K8R B;  2MW5 A;  4FHK A;  5J17 A;  2DZJ A;  3QWZ B;  2BKR B;  4JQW C;  4W9K A;  2NVU I;  4NQL B;  2O6V B;  1X1M A;  4W9C A;  5JZE B;  2KTF A;  2ZVO A;  4NAW B;  1YX6 B;  1PQS A;  2ZPY A;  1XT9 B;  4K81 A;  4LJP B;  4F7Z A;  2ASQ A;  2KHW B;  2K25 A;  1P1A A;  1GC7 A;  4GU2 A;  1WZ3 A;  5C23 A;  1TTN A;  5DPR A;  4EZK A;  1Q0W B;  4DK5 A;  2CHW A;  3V6E B;  2GOW A;  2W9N A;  1WGG A;  4MSM B;  3VUY A;  4A3P A;  2GBR A;  4JIO U;  1YD8 U;  2DYO A;  2KVR A;  3ZUN A;  3K9O B;  2C7H A;  3BIN A;  2CKH B;  1V6E A;  5JH5 C;  4TV3 A;  2KDI A;  3IFW B;  3IVF A;  3KUC B;  3NHE B;  2JRH A;  2L05 A;  1EF1 A;  3A9K B;  4ICV A;  1V5O A;  3HK0 A;  5DCN A;  1WRD B;  3ZKJ C;  1YQB A;  2K6Q A;  4WJQ A;  1L7Y A;  2IO3 B;  2K1F A;  3HM3 A;  3WIM A;  1WGY A;  2KX0 A;  1WGD A;  2WDT B;  3H7P B;  4HCN B;  2AL3 A;  3SD5 A;  3WAN A;  2M1M A;  3NZU A;  3MJW A;  1LXD A;  3K9P B;  4E3C A;  2CHZ A;  1UBI A;  3NY5 A;  3O65 B;  4GN1 A;  4NAW A;  4GIV A;  5AZF A;  2NPT B;  4MSQ B;  4ANW A;  3QX1 A;  4MJS B;  3ZNZ B;  3JSV B;  4DHJ D;  1UEL A;  3IBE A;  1WJN A;  2LGD A;  1V80 A;  4HJK A;  3ONS A;  1E90 A;  3A4S C;  1TBE A;  4MGZ E;  5JHB A;  5FR6 A;  4XX5 A;  3PSE B;  3SHQ A;  2FCS A;  2LVQ A;  3EEC A;  4DXA B;  2WX1 A;  1WI0 A;  2NPT A;  5IA7 A;  2CU1 A;  3WAO A;  3QQ8 B;  2KDB A;  2LI5 A;  4II2 B;  3RUI B;  3WA0 A;  4E71 A;  2KLG A;  2JRI B;  2N9E B;  3DOW A;  3WAP A;  3D32 A;  2D3G A;  3MTN B;  4MDK E;  3VXW A;  1WR6 E;  2NR2 A;  3DCG A;  4FUL A;  2PEA A;  1WXS A;  3DVG X;  4WJP A;  4RM9 A;  2L3Z A;  2D07 B;  1Z2M A;  4PYU A;  4FAD A;  2HTH A;  5IAA C;  1J0G A;  1NI2 A;  4RM8 A;  3ZTC A;  4BBN F;  2GBJ A;  2CS4 A;  3UGB B;  4EFO A;  4GDL B;  2K8C A;  2RSU A;  3VDZ A;  1NBF C;  3M3J A;  2JPH A;  3OJ3 A;  4II3 B;  2L00 B;  2LUE A;  5CHV C;  3RUL A;  4P7I A;  3PZD A;  4GSW A;  3QCA A;  3N30 A;  3VUW A;  4G3X B;  5HKH A;  1WM2 A;  3VTU A;  2LZ6 A;  4IM0 A;  4BKT A;  3L16 A;  1M94 A;  4OVU A;  2HE7 A;  2A5U A;  2KJH B;  4EEW A;  2AYO B;  3U30 A;  3RZF A;  1WR1 A;  1L2N A;  2KO3 A;  2KNB A;  3A4R A;  3WAL A;  4ICU A;  1GUA B;  2NS5 A;  1V49 A;  3KW5 B;  2DYM A;  2OJR A;  4MEM A;  1H8C A;  4HXD A;  5G55 A;  1SGH A;  3M95 A;  4KDI C;  2KD0 A;  3CMM B;  1IP9 A;  2YLM A;  3PHW B;  3MHS D;  4FHJ A;  3TBL D;  4CHK A;  2ZEQ A;  4NY0 A;  5LXI B;  1E8Y A;  3P2B A;  2LAS A;  2GBN A;  1ZW7 A;  2MX2 A;  3EFU A;  4M8N A;  2WYQ A;  2KX3 A;  1WGR A;  3KYD D;  3LDZ E;  3R7Q A;  4BKS A;  1IYF A;  2N7E A;  2BWE S;  4HCP B;  1Z5S B;  4IC7 B;  5CX3 A;  5DPS A;  3SDL C;  4K1R B;  2BWF A;  4EZL A;  4XZ4 A;  3W1S C;  3V6C B;  3CST A;  2M17 A;  4KIK B;  5AZH A;  4MGI E;  3WAM A;  3TJP A;  2EKE C;  3U7D A;  3V62 A;  4W9F A;  2ZNV B;  4ZRK A;  3UQA A;  2WX0 A;  2O2V B;  2J0M A;  2KDE B;  3H9D A;  5CHW A;  2K39 A;  1WH3 A;  1J19 A;  4CYE A;  2N9P C;  4EOY A;  4ZDV A;  1WX8 A;  3I3T B;  1WXM A;  2BYF A;  4LDT B;  2JT4 B;  2O6V A;  5LXH A;  2MBB B;  4GB9 A;  4HLE A;  2XK5 B;  1WYW B;  4FLH A; 
#chains in the Genus database with same CATH topology
 4AJY B;  4G11 A;  1JRU A;  4S0R A;  4AWJ A;  3C8Y A;  2RMM A;  1UGM A;  3A1Q A;  2KK8 A;  2HD5 B;  3SU8 X;  1GJZ A;  1EUV B;  1QOA A;  1KJT A;  2J0J A;  3BYY B;  3NRZ A;  1K51 A;  1JRP A;  1E7P B;  1ET9 A;  3NVV A;  3UIO B;  2NCN A;  2WXI A;  3PLU A;  1WJ4 A;  4LDT D;  1C76 A;  2XN9 C;  2YVC A;  3KVF B;  1C77 A;  1MVK A;  4JGH B;  1HXY D;  2Y5C A;  2IO1 B;  3AEA B;  4WWP A;  3JW0 X;  5CTR C;  2BS3 B;  3DHI C;  3KLS X;  4TQ0 A;  3R66 C;  4HK2 A;  1TZO A;  1PGA A;  2Z59 B;  2JYT A;  2KYW A;  2IO2 B;  4PK1 A;  3PLV A;  4KGS A;  3VHT C;  4IOI E;  1GNU A;  5C1Z A;  1QQR A;  2QHO A;  5FKA C;  3IHP C;  1E8Z A;  3DBH B;  1Q1O A;  4W9H A;  2LRU A;  3RMK C;  3HHM A;  5MPO A;  2QEJ C;  1YQ4 B;  3PS6 A;  3ABV B;  2JQR B;  3KUD B;  1VR9 A;  4A20 A;  4C00 A;  4OVV A;  4W9D A;  1FXI A;  1WXV A;  2MLB A;  2R2Q A;  4BFR A;  3TSS A;  2FCQ A;  3CIR B;  4HWI B;  5D6J B;  3NOB A;  2LGX A;  3DQV A;  5HFY A;  3Q8E A;  4XYC A;  2I2Y A;  3ZJT A;  2L0T A;  3P4R B;  2YEP B;  2EMS A;  1I42 A;  1JWA D;  5IP4 D;  1FM0 D;  3VUX A;  4HVB A;  1F52 A;  4B95 A;  4LLG M;  2GMI C;  2XBB C;  3ZDM C;  1IBX B;  1TS2 A;  3GZN I;  2V0G A;  3KQ4 A;  4LCD E;  2J53 A;  3AEB B;  2I38 A;  3TIX A;  2KWD A;  3VFK A;  1I7H A;  4X57 B;  4BBN C;  3ECI A;  4DHJ B;  3VTW A;  2J52 A;  1CJE A;  4DHZ E;  1JCK B;  1YN5 A;  2FID A;  1UZX B;  1U4A A;  3JSV A;  1SIJ A;  4MM3 A;  1QT9 A;  2L83 A;  5HI1 A;  3DVN V;  1IGD A;  4W9G A;  1UH6 A;  4HJG E;  1N61 A;  1R7S A;  2MJ3 A;  4ZRI A;  3PGE A;  5KHO A;  4NPN A;  1FNV A;  1WX9 A;  2KC1 A;  2WU5 B;  2IGG A;  1XF5 L;  2DEN B;  1PGX A;  4WWN A;  2BKF A;  4KZC A;  3PRM B;  2MEK A;  2KOX A;  2KKC A;  5DPT A;  4KV2 A;  4AJW A;  2O6V D;  4YXD B;  4KSK C;  4BOS C;  2DHZ A;  3HVZ A;  2L8J A;  3Q3J A;  2KAJ A;  5KHQ A;  4NJ7 A;  1C3T A;  2OOB B;  2VZK B;  2ACZ B;  1N63 A;  2CR5 A;  4IM2 A;  4GXB A;  2EMT A;  4FN2 A;  2FUH B;  2G9H D;  4JWU C;  2KMA A;  1T5X D;  3ML9 A;  4DDI D;  1ENF A;  3V61 A;  4CQN A;  1LM8 B;  3AEE B;  3M62 B;  1EM7 A;  2WS3 B;  3MP9 A;  1YJ1 A;  4GOC A;  3B2G A;  1KFY B;  5T8I A;  4RNA A;  4WIP A;  4OHJ A;  2KFJ A;  2V4I B;  1VD2 A;  3TEW A;  2AWT A;  1SJE D;  2LVP A;  1H4R A;  1E7V A;  4FJY A;  4PS8 A;  1ZXI A;  3T3O A;  3B9J A;  2VZK D;  3IT4 B;  1PDX A;  2D5G A;  3C19 A;  1KM7 A;  4TKN A;  4MT5 A;  2LD9 A;  2BYT A;  5IOI A;  4W9L A;  4LJO B;  2W54 A;  4UDU C;  3H1U A;  1YN4 A;  2DAJ A;  2MBQ A;  3NUH B;  3SEB A;  2GBK A;  3ZNI D;  2HJ8 A;  2GBM A;  1KH0 A;  2IZV B;  4NAM A;  2GRI A;  5J17 A;  2BKR B;  2QJL A;  4K3B A;  3VR9 B;  4W9C A;  1YX6 B;  4XGA B;  1FXA A;  4OVZ A;  1PQS A;  2ZPY A;  1HZ6 A;  2WHI A;  5DPR A;  4DK5 A;  2E6X A;  3DHG C;  3ZUN A;  1V6E A;  4TV3 A;  2KDI A;  4JX1 C;  3A9K B;  5DCN A;  1WRD B;  4ZHP A;  2IO3 B;  1TJE A;  2AL3 A;  1N5W A;  1XLQ A;  3NS1 A;  5BYS A;  2J42 A;  2M19 A;  3DWM A;  1LXD A;  3N9Y C;  1ET6 A;  4AQ7 A;  1VZ6 A;  4ANW A;  3E56 A;  3JSV B;  4C4V A;  1UEL A;  2MJD A;  2WDV B;  1WJN A;  4B0M A;  2LGD A;  2V3N A;  1E90 A;  4M00 A;  1TBE A;  4MGZ E;  4OZA A;  2FE8 A;  2LVQ A;  4OW0 A;  3P63 A;  2CU1 A;  5LNK 1;  3RUI B;  1FRR A;  2JRI B;  3WAP A;  1HTO A;  3DCG A;  4WJP A;  2WLB A;  3SR6 A;  1UUP A;  5FK9 C;  4FAD A;  1VZ8 A;  2KAC A;  1CK1 A;  2JZP A;  5HG2 A;  5CHV C;  4P7I A;  3PZD A;  3QCA A;  1K53 A;  1KLG D;  4IM0 A;  1F1H A;  2KJH B;  4EEW A;  2Z8L A;  4RGO S;  2KNB A;  3URY A;  1PYW D;  1JW9 D;  2OJR A;  1SGH A;  5I4D A;  2WXJ A;  2WP9 B;  1FIQ A;  2INC C;  3EFU A;  1ZW7 A;  4M8N A;  2WYQ A;  3KYD D;  1E0Z A;  2VH2 A;  5CX3 A;  2DLB A;  4DXF A;  4XZ4 A;  1EWY C;  3W1S C;  3LB8 C;  2M17 A;  5AZH A;  4XE0 A;  3P1M A;  4MGI E;  5IO9 A;  3TJP A;  3V62 A;  4W9F A;  3UQA A;  1N5X A;  2J0M A;  2KDE B;  2K39 A;  4ZDV A;  3I3T B;  1D4B A;  1OFF A;  1LGR A;  1P7E A;  3PO0 A;  2XK5 B;  4ICU A;  2JWZ A;  2KJR A;  1UBQ A;  2KFK A;  2C5L C;  4A90 A;  5E6N A;  2LJ5 A;  3GOE A;  2E3T A;  2REX A;  2AEH A;  1LFD A;  4BOZ B;  3APD A;  1UGJ A;  4NJC A;  1WX7 A;  2N1V A;  2DZK A;  1XD3 B;  3DBS A;  4C80 A;  5BYQ A;  3Q8B A;  2B3A A;  3L54 A;  3Q3O C;  2K0P A;  1RFA A;  1FNW A;  1I35 A;  2J7Q B;  1J7C A;  5L95 C;  3H7S A;  3ZRC A;  1STE A;  3RT3 B;  4WAF A;  1TYG B;  2MA9 B;  4BKG A;  2PMV A;  3DDC B;  1WE6 A;  2W82 A;  2WXM A;  2FCM A;  5EE3 A;  3R2I A;  2MRP A;  2ICI A;  2K8B A;  3AUL A;  2ZZP B;  3CWI A;  1ROE A;  4EZJ A;  2V9H A;  3DBR I;  4RGN A;  4I6L B;  4IW0 A;  3VAW A;  2BVC A;  2LFI A;  3GB1 A;  2Q5W D;  4WWM A;  1FO4 A;  1GC6 A;  3EGR A;  1SIF A;  1TIF A;  4ZYN A;  2KLC A;  5HHD G;  2ONQ A;  3T8M A;  3V60 A;  3NS8 A;  3AB5 A;  3AV8 A;  1ISN A;  3ZNG C;  2JY6 A;  2ZJD A;  3L4P A;  4JLC A;  2KC2 A;  2D11 A;  3UIP B;  2Z0E B;  2KWU B;  3BVZ A;  1WZ0 A;  4BKS D;  4QAY A;  2XEW A;  2ZVN A;  3MC8 A;  1Q5W B;  3U8Z A;  1QZE A;  2MWS B;  4B6W A;  4W9I A;  1I4H A;  2KN4 A;  4M0W B;  3AE5 B;  5D2M B;  1GOZ A;  1PUT A;  2LVO A;  2G4S A;  3AU5 A;  1EO6 A;  2BBC A;  2RPV A;  1JML A;  1YJI A;  3RNA C;  3BWU D;  3X23 A;  4C7Z A;  2MSE D;  3PTF C;  4RMA A;  5G2N A;  2V3S A;  1WE7 A;  1RLF A;  1HEZ E;  3A9J B;  3GE8 C;  2BGF A;  2W3S A;  2MH7 A;  3DPD A;  3N32 A;  1MG8 A;  4WQO B;  2LWP A;  1KRH A;  2BTE A;  3Q8F A;  3AI5 A;  1DYQ A;  3TEZ A;  3NVY A;  1WM3 A;  3OAW A;  3TEX A;  1E10 A;  2WWZ A;  2INP E;  3B1L X;  1S3S G;  5BO4 B;  3RZW C;  2Z0D B;  1RM6 C;  1FCC C;  5AEK B;  5GXG B;  2BQQ A;  3J9C A;  3VVW B;  2D3C A;  1UD7 A;  2PVO D;  4J3O D;  1JRO A;  1XXG A;  2ZCB A;  3JYU A;  1CQV A;  4GGQ A;  4NQK E;  2KXJ A;  5EDS A;  4ARC A;  3OWE B;  3KH0 A;  4WAA A;  4NNJ B;  3ALB A;  1V9J A;  3H6N A;  2KQ7 A;  3MJ5 A;  4RH6 A;  1HE8 A;  1GAQ B;  2LXA A;  3R7R A;  4R3D A;  1L0V B;  5JXV A;  5C3J B;  2IPK D;  2DWQ A;  4KSL C;  1KLV A;  1YOV B;  1TGZ B;  3DBH I;  4IWP A;  3VH4 B;  4URK A;  4GDK B;  2M4N A;  2N9K A;  2K9X A;  3M63 B;  2BS4 B;  2JWU A;  1SE4 A;  1BT0 A;  1WGH A;  3S2A A;  3PVL A;  1WJ6 A;  1XLP A;  2LMC A;  4TMA B;  4MGK E;  2WXQ A;  3ZTD A;  4WJO A;  3RYT A;  1MG4 A;  4M02 A;  4HRO A;  2C60 A;  1WWT A;  4GMV A;  1ZKH A;  2L76 A;  3I9V 1;  3ZW3 A;  3HUI A;  1MI0 A;  1L6V A;  1OQY A;  1P9D U;  4FXC A;  2K6D B;  2RR9 A;  1R4M B;  1ESF A;  2PTL A;  1L6U A;  4YTP B;  4ANV A;  4F8C B;  3DBL I;  1C4A A;  1IPG A;  1AAR A;  3Q3M C;  4WWO A;  3BYT B;  4ANX A;  3QK0 A;  3QC8 B;  2BF8 B;  4LNF A;  2QDF A;  3V3X A;  2I1J A;  5J2R A;  1OQQ A;  2KAN A;  3PZ7 A;  3SFE B;  4BVU C;  4LK0 M;  1F0Z A;  2MW5 A;  4FHK A;  3RN9 C;  3ZQ4 A;  4JQW C;  1NEN B;  2O6V B;  4MH8 A;  1TY0 A;  2KTF A;  2ZVO A;  4NAW B;  5G5H A;  3IT6 B;  5JZE B;  3GP7 A;  4P16 A;  1EWC A;  4K81 A;  4LJP B;  2WXO A;  4F7Z A;  2KHW B;  4GU2 A;  4H2A A;  5C23 A;  1TTN A;  2X38 A;  3V6E B;  2GOW A;  2W9N A;  2AQ3 B;  2AQ2 B;  1VLB A;  1YD8 U;  3K9O B;  2FUG 1;  3IVF A;  2VH1 A;  1V5O A;  3HK0 A;  1YQB A;  5C2T B;  2K6Q A;  1L7Y A;  1WGY A;  2KX0 A;  2WDT B;  3WAN A;  3DBR B;  2PKO A;  4E3C A;  2CHZ A;  1UBI A;  3NY5 A;  3O65 B;  2WDR B;  4GIV A;  1AYF A;  2NPT B;  3MFG A;  4MJS B;  1XO3 A;  4YTN B;  4DHJ D;  1FMA D;  1N60 A;  1AN8 A;  1V80 A;  4XWW A;  1L4D B;  5JHB A;  4XX5 A;  4DXA B;  3WCQ A;  1WI0 A;  2NPT A;  5IA7 A;  3WAO A;  4E71 A;  2KDB A;  2LI5 A;  3H8H A;  3WA0 A;  3DOW A;  1SJH D;  1D5Z C;  2PEA A;  1WXS A;  4RM9 A;  1IUE A;  2D07 B;  5IAA C;  1J0G A;  1V97 A;  4RM8 A;  3ZTC A;  3U4E G;  3NG0 A;  3RNB C;  1NVI D;  4EFO A;  4GDL B;  2K8C A;  2RSU A;  3VDZ A;  1FD6 A;  3OJ3 A;  4II3 B;  2LUE A;  2V3P A;  4G3X B;  1AWD A;  3NVZ A;  3VTU A;  4BKT A;  3L16 A;  1LO5 D;  4C4V B;  1T3Q A;  2LJI A;  1WR1 A;  3A4R A;  4RF0 A;  1Y56 A;  3Q8C A;  3WAL A;  1GUA B;  2NS5 A;  4KKJ A;  3KW5 B;  5AUI A;  2DYM A;  4MEM A;  1H8C A;  3FC4 A;  3M95 A;  2KD0 A;  2WXH A;  3TBL D;  2ZEQ A;  4NY0 A;  5LXI B;  1I4P A;  1E8Y A;  3DHH C;  3Q14 C;  2LAS A;  2GBN A;  2MX2 A;  1JWB D;  4USA A;  1I4G A;  2KX3 A;  3LDZ E;  1PFD A;  3R7Q A;  1UWX A;  2BWE S;  2IND C;  4IC7 B;  3SDL C;  1CZP A;  4K1R B;  1WGK A;  4RFB A;  4NZL B;  2X8X X;  3IAM 1;  3U7D A;  1QKZ A;  2O2V B;  3W9C B;  1F2R I;  1N6Z A;  1WH3 A;  1WX8 A;  1HZ5 A;  4MAC A;  1RYJ A;  2MBB B;  4YSZ B;  1WYW B;  4FLH A;  3RCZ A;  1ZDV A;  2SEB D;  3FIL B;  3H7P A;  1E8W A;  2M56 B;  2G3Q B;  2G4D B;  3BII D;  3KUZ A;  1VZ7 A;  3MHZ A;  2C7N B;  2WGS A;  2JUO A;  3ZLZ A;  4IM3 A;  4HPL B;  2KTR A;  2M0X A;  4I6P A;  4G0N B;  2UU7 A;  1YQ3 B;  5EE1 A;  2BB5 A;  1RRB A;  1L0X B;  3UI3 A;  3W5V B;  4IG7 B;  3E9S A;  2M8S A;  1GG3 A;  4HKZ E;  1ZP0 B;  3VRA B;  3RNF C;  3Q3N C;  1C79 A;  1R4M I;  3W1S A;  4B0E A;  1F9J A;  4NJ6 A;  1BUI C;  3DVG Y;  2G1E A;  1IBX A;  2MP2 A;  2IBI B;  2JZ3 B;  1ZUD 2;  1WJU A;  1C9F A;  4I6N B;  1R4N B;  2DNF A;  3BK2 A;  3AU4 A;  4MEL A;  1NI3 A;  2GB1 A;  4P6V F;  4HPM B;  2WNM A;  4GLS C;  1MFW A;  5LLI A;  4EE2 A;  3B0A A;  3Q8A A;  5J18 A;  1V86 A;  2FIF A;  1T0R C;  2LXC A;  3EC8 A;  3AN1 A;  4HDQ A;  3MC0 B;  3PRE A;  4C7Y A;  2PJH A;  1MHH E;  2PW9 A;  3PPA A;  2NTT A;  3I57 A;  1E8X A;  5D3I B;  1NDD A;  2BYE A;  3VTV A;  1QOF A;  1OEY J;  4YT0 B;  3UQB A;  2HJ1 A;  1FRD A;  3N3K B;  3OG5 A;  3B08 A;  5TR5 A;  1J7B A;  2XNA C;  1RWS A;  3ZDT A;  5GMV A;  3RNG C;  4M8M A;  3QHT A;  1CMX B;  4GDK A;  1V1O A;  3QJZ A;  2DAF A;  4TSS A;  3ZNH B;  1SE2 A;  3ETR A;  2LRW A;  1TT5 B;  2KT7 A;  2V4L A;  2RPQ A;  1ZXH A;  4HPP A;  4KVG B;  1P3Q U;  1GB1 A;  2C9W B;  2G45 B;  4FJV B;  3ZJV A;  5BMG A;  3RI7 C;  3AEF B;  2RD0 A;  4RGM A;  2JXX A;  1LQB A;  3ZGZ A;  3L0W B;  4A3O A;  2L0F A;  2WXR A;  2PE9 A;  2MJE A;  1EF5 A;  2IY0 B;  1V1P B;  4JE3 B;  3AM9 A;  2QCZ A;  3P4P B;  4AOF A;  3UIN B;  2FBW B;  2ZNV C;  4ZRJ A;  2LUM A;  1XQQ A;  4DDG D;  4N58 A;  3AEC B;  1C4P A;  3P4S B;  2DBY A;  2YEP F;  1D3Z A;  2KDF B;  4C56 C;  1WXQ A;  1IGC A;  4ZHO A;  1BXT A;  3EHV A;  4PT5 A;  4S17 A;  1MHX A;  4RGT A;  1NYQ A;  3ML8 A;  1XLN A;  2RDG A;  4KDL B;  2AL6 A;  2UWQ A;  2EKI A;  4TQ1 A;  2KFK B;  2W55 A;  2Y5B B;  1WRI A;  1C1Y B;  5E6P A;  3RFZ B;  4K7W A;  2UYZ B;  2FCN A;  3BZD B;  5DPW A;  3TEY A;  3OJ4 B;  1SBB B;  3L13 A;  3UF8 A;  4ANU A;  5L83 A;  1WFY A;  1VCB A;  4IUM B;  3BK1 A;  2LGI A;  3HIZ A;  4WQM A;  5D94 A;  3JVZ X;  4XC2 A;  4BZA A;  1E6E B;  3BVM A;  1N62 A;  1QF6 A;  3QAR A;  2BT6 A;  4KZ0 A;  3X0W A;  4E74 A;  2J4X A;  5IKC M;  3ZIM A;  2WXG A;  3LYY A;  3OLM D;  4B9K A;  1P0R A;  4DHZ B;  1YN3 A;  2DX5 B;  3ZO5 B;  3A9K A;  2BPS A;  4IWO A;  1SE9 A;  2KVZ A;  2N4F A;  4ARI A;  2H88 B;  2VRR B;  2LHE A;  4XDC A;  2JU6 X;  2NMQ A;  3KYC D;  5D7G A;  2IGH A;  2H89 B;  3PRZ A;  2KWV B;  2CJN A;  2IJ0 A;  2L7R A;  1E5W A;  4O1N A;  2NBU A;  4MJS A;  2JVC A;  4MM3 B;  3GZN B;  4EUT A;  1K50 A;  1L0Y B;  4ZOH C;  5CHF A;  4KIK A;  4L1B A;  3RD2 A;  4W9J A;  2QMT A;  2NBW B;  4HDO A;  4DBG A;  1C4C A;  1WYG A;  1L5P A;  1J7A A;  3NVW A;  4FBJ B;  1MPE A;  4MH0 E;  1SF0 A;  2IO0 B;  4DWF A;  1OEY A;  1K8R B;  2D3B A;  1GB4 A;  2DZJ A;  3QWZ B;  5H8Y E;  4W9K A;  2GI9 A;  1ZE3 D;  1X1M A;  1NYR A;  1XT9 B;  3EUB 2;  4L23 A;  1P1A A;  3R8B A;  4WH4 A;  4EZK A;  1TKE A;  4A3P A;  1WGG A;  2KVR A;  5IN7 A;  4RCO A;  2CKH B;  1UWM A;  1DOX A;  4A6Q A;  2L05 A;  1EF1 A;  4ICV A;  4YSY B;  3KWV A;  4WJQ A;  3HM3 A;  2QIL A;  4HCN B;  1XLO A;  2ZW0 A;  3AE6 B;  2AQ1 B;  3NZU A;  3MJW A;  3K9P B;  4HRS A;  2L52 A;  5AZF A;  1F77 A;  4MSQ B;  3ZNZ B;  1VJK A;  4HJK A;  3ONS A;  5FR6 A;  2QC8 A;  5G5G A;  3SHQ A;  2FCS A;  2WX1 A;  4L2Y A;  2CJO A;  3N1Z C;  4II2 B;  1SE3 A;  1GPX A;  1FNU A;  2D3G A;  1JQ4 A;  3VXW A;  1WR6 E;  2NR2 A;  4FUL A;  1B1Z A;  1A70 A;  3R2T A;  1QOB A;  1Z2M A;  2BS2 B;  3IAS 1;  1QLB B;  1NI2 A;  2GBJ A;  2B76 B;  3UGB B;  2Y3A A;  4IKG A;  4KGT A;  3RUL A;  5HKH A;  2ON8 A;  4US8 A;  1WM2 A;  5E6J A;  2LZ6 A;  1JWS D;  2AYO B;  3U30 A;  3RZF A;  1L2N A;  1QIL A;  2KO3 A;  3N1X C;  1V49 A;  1TY2 A;  3U7Z A;  2IGD A;  2OJW A;  4ZYS A;  3CMM B;  1IP9 A;  2YLM A;  3PHW B;  4CHK A;  2PIA A;  1UNS A;  3P2B A;  1BML C;  4RF1 A;  2WXL A;  4BKS A;  1IYF A;  2N7E A;  5DPS A;  4EZL A;  2BWF A;  3ZXV A;  1UF0 A;  3V6C B;  5TSS A;  4AS1 A;  4OZC A;  3Q2A C;  5EE9 A;  4KIK B;  1DOY A;  2EEL A;  2ZNV B;  1I4X A;  2SAK A;  2WX0 A;  4XWT A;  1DGJ A;  4D2K A;  1J19 A;  2GLS A;  4EOY A;  2N9P C;  3EFC A;  1WXM A;  2BYF A;  2JT4 B;  2O6V A;  4GB9 A;  1TS5 A;  2WXK A;  2OHF A;  3P42 A;  2MBH A;  2O2V A;  1TS4 A;  1Y8R C;  3TL5 A;  1HQR D;  5JHA A;  1HTQ A;  4LNN A;  5D3D A;  2C7M B;  2PPH A;  4P1C C;  2KMM A;  2MCN B;  4EKU A;  3I63 C;  1E7U A;  1ZOY B;  2N0S B;  3DWG C;  3CSF A;  5AZG A;  1YX5 B;  3T9L A;  4LTU A;  2KZR A;  3W5U B;  2XK5 A;  3L08 A;  1WSP A;  4K7S A;  4ASW C;  3A9J A;  3VR8 B;  2HDE A;  2BB6 A;  2FNJ B;  3Q69 A;  3AE9 B;  1RFK A;  3L10 B;  4PS3 A;  1XCT L;  3DVN U;  2IY1 B;  1F2R C;  1G6J A;  2DZI A;  2NBV B;  3AED B;  3R3M A;  4IWQ A;  2J0K A;  2K22 A;  3RNC C;  4HEA 1;  3VH3 B;  1YJJ A;  4M0W A;  4GDL A;  4ZRQ A;  3O13 A;  3TUO A;  3V05 A;  2L32 A;  4PYZ A;  1RAX A;  2N7J A;  3APF A;  3PT2 B;  3FIL A;  2N7D A;  3IG3 A;  1J8C A;  4ITK A;  1FFV A;  2N9L A;  1K52 A;  2ZW1 A;  2CHX A;  4FJZ A;  3LJ3 A;  1XCQ L;  1B9R A;  2K8H A;  4F1S A;  2MBE A;  3NZ3 A;  2OED A;  3QAQ A;  2JYE A;  2V1Y A;  1WF9 A;  2D2Q A;  4J6I A;  1OQR A;  2JZZ A;  2WXF A;  3Q3F A;  1EU3 A;  4G50 A;  2KN5 A;  4YWG G;  1S1Q B;  4LNO A;  2N9X A;  3L17 A;  3KWL A;  1C78 A;  3ZVV A;  4YTM B;  2N1W A;  4TUU A;  4KKI A;  2ZPN A;  3A1Q B;  1I4Q A;  4OZB A;  1QOG A;  1A5R A;  2WU2 B;  1P98 A;  3DBL B;  5BMH A;  1D5M C;  2WXN A;  3AMZ A;  2PVG C;  4AP4 C;  1WXA A;  3QIJ A;  1SEB D;  2PLP A;  1OGW A;  3TCA A;  2MBO A;  1ZGU B;  2MQJ A;  4JPS A;  4REZ A;  1FXT B;  5E6O A;  4N59 A;  1V2Y A;  1WMH A;  3PRP B;  2KQS A;  4N9F 4;  4A8X C;  1KOT A;  1MJD A;  1TS3 A;  2KMC A;  4PS7 A;  3AXC A;  4W9E A;  4DQO C;  4P1B C;  2JSV X;  3PHX B;  2DYB A;  1WMH B;  3N20 C;  2KQ4 X;  1YNT E;  2IDY A;  3U2S C;  1KF6 B;  1V81 A;  4A9A A;  3RNE C;  1P7F A;  3TMP B;  3AE8 B;  3ZYY X;  4US9 A;  4AUQ C;  1V8C A;  2IYD B;  3I5J C;  2KJ6 A;  2KTR B;  3PZ8 A;  3VQI A;  1E9M A;  1JWM D;  3W1Y A;  2WQY B;  2PE6 B;  1OTR B;  2LHD A;  2ZCC A;  1FPY A;  1NEK B;  1FCL A;  3NZS A;  3IXS A;  1SSN A;  3ZRF A;  2D10 A;  3HRD D;  1V5T A;  3BY4 B;  3CF6 E;  4YL8 A;  3APC A;  1R4N I;  5EE0 A;  4LNI A;  3RPF C;  1Q10 A;  2R61 A;  3HM6 X;  4KGR A;  3HVD A;  3BVG A;  3C0R B;  5BMI A;  2BYV E;  2LGY A;  1D5X C;  3ZJU A;  4CO7 A;  3A33 B;  4FA6 A;  2D3A A;  1AW7 A;  1YIW A;  1WY8 A;  2A4Z A;  3P4Q B;  4HKQ A;  1T6B X;  4KX6 B;  1T0Y A;  4A55 A;  3AEG B;  1VRA B;  3AE2 B;  4WJN A;  1WIA A;  1YMH E;  3GS2 A;  2RGF A;  3U52 E;  4LNK A;  4JL9 A;  1JWU D;  2BW2 A;  4Q2J A;  5H92 C;  2K5P A;  2AX5 A;  2JF5 A;  1KLU D;  1ZPS A;  3VRB B;  3QA8 A;  2KWC A;  4BAX A;  2RDB C;  2I1K A;  2R2O A;  1FEH A;  1FFU A;  4ZRP A;  4WUR A;  3AE3 B;  4ACF A;  2FAZ A;  3NJT A;  4MGY E;  3PV1 A;  1M4V A;  3AE4 B;  4K7U A;  2Y5P A;  3EA6 A;  2KDM A;  3ENE A;  2DZM A;  2M0A A;  3FKY A;  4DXG A;  3LXF A;  1TZ1 A;  2WXP A;  3FAH A;  2MP2 B;  2MHJ A;  3ZXR A;  5AUK A;  2NVU I;  4NQL B;  1SXT A;  1T0S C;  2ASQ A;  2K25 A;  1GC7 A;  1WZ3 A;  1Q0W B;  2CHW A;  2JXT A;  4MSM B;  3VUY A;  2GBR A;  4JIO U;  2DYO A;  4YSX B;  2C7H A;  2CU3 A;  4JWS C;  3AE7 B;  3BIN A;  1V1P A;  2JX5 A;  5JH5 C;  3IFW B;  3KUC B;  1SB3 C;  3NHE B;  2JRH A;  3ZKJ C;  2K1F A;  3WIM A;  3T3N A;  1WGD A;  3H7P B;  3SD5 A;  2M1M A;  3AH7 A;  3B2F A;  3W2D A;  4GN1 A;  4NAW A;  2LGS A;  2TSS A;  3QX1 A;  3IBE A;  4N6E B;  3SFD B;  3A4S C;  3PSE B;  1EU4 A;  3EEC A;  5BYR A;  3QQ8 B;  2W3R A;  2KLG A;  2N9E B;  3D32 A;  3MTN B;  4MDK E;  2INN E;  3DVG X;  2L3Z A;  3MC9 A;  4PYU A;  1JAL A;  2HTH A;  2NTS A;  2HTM E;  4BBN F;  1L4Z B;  2QSD A;  2CS4 A;  1NBF C;  3M3J A;  2JPH A;  2L00 B;  3AE1 B;  1DOI A;  4GSW A;  3VUW A;  1D6E C;  3N30 A;  4M01 A;  4OVU A;  1M94 A;  2HE7 A;  2A5U A;  1TKY A;  3Q6B A;  1ACC A;  2K3U A;  1VDV A;  1I4R A;  4K3C A;  4HXD A;  5G55 A;  2QIE B;  4KDI C;  5FR3 A;  3MHS D;  4FHJ A;  1PGB A;  3N1Y C;  1WGR A;  1KTK A;  4IDI A;  4HCP B;  1Z5S B;  1HA5 A;  2LEK A;  3CST A;  3WAM A;  2EKE C;  4ZRK A;  3H9D A;  5CHW A;  2WDQ B;  2L1A A;  4CYE A;  4LDT B;  5LXH A;  1T0Q C;  1TKG A;  1XEE A;  4XDD A;  4HLE A;  1ZDX A;  2RDH A;  3GE3 C; 
#chains in the Genus database with same CATH homology
 2JWZ A;  2KJR A;  4AJY B;  1UBQ A;  3H7P A;  2MBH A;  1E8W A;  2KFK A;  2G3Q B;  2O2V A;  2C5L C;  2G4D B;  4G11 A;  2LJ5 A;  5E6N A;  1Y8R C;  3GOE A;  3TL5 A;  5JHA A;  1JRU A;  2REX A;  4AWJ A;  3KUZ A;  2AEH A;  1UGM A;  3A1Q A;  2C7M B;  2PPH A;  2KK8 A;  1LFD A;  2C7N B;  3APD A;  2HD5 B;  3SU8 X;  4BOZ B;  1GJZ A;  2MCN B;  1EUV B;  4EKU A;  1E7U A;  2JUO A;  3ZLZ A;  4IM3 A;  1KJT A;  1WX7 A;  2DZK A;  2KTR A;  2J0J A;  2M0X A;  2N1V A;  4G0N B;  4HPL B;  4I6P A;  1XD3 B;  3CSF A;  5AZG A;  3DBS A;  1YX5 B;  2B3A A;  1RRB A;  3L54 A;  3T9L A;  2KZR A;  1RFA A;  2XK5 A;  3L08 A;  4K7S A;  4ASW C;  3A9J A;  4IG7 B;  3UIO B;  1I35 A;  2NCN A;  2M8S A;  3PLU A;  1WJ4 A;  2FNJ B;  2J7Q B;  4LDT D;  5L95 C;  1GG3 A;  3ZVV A;  3H7S A;  3ZRC A;  3L10 B;  4PS3 A;  3DVN U;  2IY1 B;  1R4M I;  1G6J A;  2DZI A;  2NBV B;  3RT3 B;  1F9J A;  3W1S A;  2YVC A;  4NJ6 A;  3DVG Y;  3R3M A;  3KVF B;  4IWQ A;  2J0K A;  2MA9 B;  4BKG A;  4JGH B;  3DDC B;  2MP2 A;  1WE6 A;  2IBI B;  2JZ3 B;  2IO1 B;  1WJU A;  4WWP A;  4I6N B;  3JW0 X;  2FCM A;  3VH3 B;  5CTR C;  3AU4 A;  2MRP A;  4MEL A;  4GDL A;  4TQ0 A;  2K8B A;  3AUL A;  3R66 C;  2ZZP B;  4HPM B;  4HK2 A;  4EZJ A;  2Z59 B;  4PYZ A;  5LLI A;  1RAX A;  2IO2 B;  3PLV A;  3DBR I;  3APF A;  3B0A A;  3PT2 B;  3VHT C;  4I6L B;  4IW0 A;  1GNU A;  3VAW A;  2N7D A;  3IG3 A;  5J18 A;  1J8C A;  1V86 A;  5C1Z A;  2FIF A;  1GC6 A;  2QHO A;  1SIF A;  2LXC A;  3EC8 A;  3IHP C;  4HDQ A;  4ZYN A;  2CHX A;  3PRE A;  2KLC A;  1E8Z A;  1Q1O A;  2PJH A;  4W9H A;  4FJZ A;  3T8M A;  3V60 A;  2LRU A;  3NS8 A;  3LJ3 A;  2K8H A;  4F1S A;  2MBE A;  3PPA A;  3HHM A;  1ISN A;  3PS6 A;  1E8X A;  3ZNG C;  1NDD A;  2JY6 A;  2ZJD A;  4JLC A;  3QAQ A;  2BYE A;  2KC2 A;  3KUD B;  2V1Y A;  1WF9 A;  4A20 A;  2D2Q A;  4J6I A;  4OVV A;  3VTV A;  4W9D A;  1WXV A;  2D11 A;  2JZZ A;  3UIP B;  2Z0E B;  1OEY J;  2KWU B;  2MLB A;  3Q3F A;  2R2Q A;  4BFR A;  3UQB A;  1WZ0 A;  4BKS D;  2FCQ A;  3N3K B;  3B08 A;  5TR5 A;  4HWI B;  4G50 A;  5D6J B;  3NOB A;  2KN5 A;  3ZDT A;  2XEW A;  1S1Q B;  5GMV A;  2LGX A;  2N9X A;  4M8M A;  2ZVN A;  3L17 A;  1CMX B;  1Q5W B;  3QHT A;  4GDK A;  3QJZ A;  1QZE A;  2MWS B;  3DQV A;  3U8Z A;  2N1W A;  2DAF A;  4B6W A;  4TUU A;  4W9I A;  4M0W B;  2ZPN A;  3A1Q B;  2L0T A;  3ZNH B;  5D2M B;  2EMS A;  1A5R A;  1I42 A;  2LVO A;  2G4S A;  2LRW A;  3VUX A;  1P98 A;  2V4L A;  4HVB A;  2RPQ A;  3AU5 A;  1EO6 A;  4B95 A;  2GMI C;  2XBB C;  3ZDM C;  4AP4 C;  1WXA A;  3QIJ A;  3GZN I;  4KVG B;  1P3Q U;  4LCD E;  2C9W B;  1OGW A;  3X23 A;  2G45 B;  3TCA A;  2MBO A;  2MSE D;  3PTF C;  4FJV B;  4RMA A;  5G2N A;  3TIX A;  1ZGU B;  2MQJ A;  2V3S A;  1WE7 A;  1RLF A;  2RD0 A;  2JXX A;  1LQB A;  3L0W B;  3A9J B;  3VFK A;  1FXT B;  5E6O A;  4A3O A;  2BGF A;  3N32 A;  1V2Y A;  1WMH A;  3DPD A;  3PRP B;  1MG8 A;  2KQS A;  2L0F A;  4X57 B;  4BBN C;  4N9F 4;  2PE9 A;  3ECI A;  1EF5 A;  2IY0 B;  4WQO B;  4DHJ B;  1KOT A;  2LWP A;  3VTW A;  2KMC A;  4PS7 A;  3AXC A;  4W9E A;  4AOF A;  3AI5 A;  3UIN B;  3PHX B;  4DHZ E;  2ZNV C;  4ZRJ A;  2DYB A;  1WM3 A;  3OAW A;  2FID A;  1WMH B;  1XQQ A;  1UZX B;  1U4A A;  2WWZ A;  3JSV A;  3B1L X;  1S3S G;  5BO4 B;  3RZW C;  4DDG D;  2Z0D B;  4MM3 A;  3DVN V;  1V81 A;  4W9G A;  1D3Z A;  1UH6 A;  5AEK B;  2KDF B;  4ZRI A;  3PGE A;  3TMP B;  5KHO A;  4NPN A;  3VVW B;  1WX9 A;  2KC1 A;  1UD7 A;  4AUQ C;  2IYD B;  2DEN B;  2KJ6 A;  2KTR B;  4WWN A;  2BKF A;  4KZC A;  3EHV A;  3VQI A;  3PRM B;  3W1Y A;  2KOX A;  2PE6 B;  2KKC A;  5DPT A;  1OTR B;  2ZCC A;  3ML8 A;  4KV2 A;  4AJW A;  2ZCB A;  3JYU A;  2O6V D;  3NZS A;  4GGQ A;  4KDL B;  4NQK E;  2AL6 A;  2UWQ A;  4KSK C;  4BOS C;  2KXJ A;  3ZRF A;  4TQ1 A;  2DHZ A;  5EDS A;  2D10 A;  2L8J A;  1V5T A;  2KFK B;  3BY4 B;  2Y5B B;  3CF6 E;  3APC A;  1R4N I;  4YL8 A;  1C1Y B;  3Q3J A;  5E6P A;  4K7W A;  5KHQ A;  3KH0 A;  2UYZ B;  4WAA A;  4NJ7 A;  4NNJ B;  2FCN A;  1C3T A;  5DPW A;  3ALB A;  3HM6 X;  2OOB B;  1V9J A;  3H6N A;  3C0R B;  2KQ7 A;  3L13 A;  3OJ4 B;  3UF8 A;  4ANU A;  5L83 A;  1WFY A;  2BYV E;  2LGY A;  1HE8 A;  1VCB A;  4IUM B;  2LXA A;  3HIZ A;  3R7R A;  3A33 B;  5D94 A;  4CO7 A;  3JVZ X;  4FA6 A;  4XC2 A;  2CR5 A;  4IM2 A;  4KSL C;  1YIW A;  1WY8 A;  4GXB A;  2EMT A;  1KLV A;  2A4Z A;  4FN2 A;  2FUH B;  1T0Y A;  3QAR A;  1TGZ B;  3DBH I;  2KMA A;  4IWP A;  3VH4 B;  4URK A;  4KZ0 A;  3ML9 A;  4WJN A;  4GDK B;  3X0W A;  1WIA A;  2M4N A;  4DDI D;  4E74 A;  3V61 A;  1LM8 B;  3ZIM A;  2RGF A;  3M63 B;  3M62 B;  3OLM D;  4JL9 A;  4B9K A;  1YJ1 A;  4GOC A;  1BT0 A;  1WGH A;  3S2A A;  1P0R A;  3PVL A;  2KFJ A;  1WJ6 A;  4DHZ B;  2DX5 B;  3ZO5 B;  3RCZ A;  3A9K A;  2BPS A;  1VD2 A;  4MGK E;  4IWO A;  1SE9 A;  3ZTD A;  2AWT A;  4WJO A;  2JF5 A;  3RYT A;  2LVP A;  1H4R A;  1E7V A;  2N4F A;  4FJY A;  4PS8 A;  3QA8 A;  2VRR B;  2KWC A;  2C60 A;  3KYC D;  4GMV A;  5D7G A;  2I1K A;  1ZKH A;  2L76 A;  3ZW3 A;  3PRZ A;  2KWV B;  2L7R A;  1E5W A;  1OQY A;  2NBU A;  4MJS A;  1P9D U;  2JVC A;  2R2O A;  2K6D B;  2RR9 A;  1KM7 A;  4TKN A;  4EUT A;  2FAZ A;  2LD9 A;  4ANV A;  4F8C B;  3DBL I;  4MGY E;  4LJO B;  4W9L A;  3PV1 A;  5CHF A;  4KIK A;  1IPG A;  1AAR A;  3H1U A;  4K7U A;  3RD2 A;  4W9J A;  4WWO A;  2DAJ A;  2MBQ A;  3ENE A;  4ANX A;  2NBW B;  3QK0 A;  4HDO A;  4DBG A;  3QC8 B;  2BF8 B;  2DZM A;  2I1J A;  2GBK A;  3ZNI D;  2HJ8 A;  5J2R A;  2KAN A;  4FBJ B;  4MH0 E;  1TZ1 A;  2GBM A;  2IZV B;  2IO0 B;  4BVU C;  2MP2 B;  1OEY A;  4DWF A;  1K8R B;  2MW5 A;  4FHK A;  5J17 A;  2DZJ A;  3QWZ B;  2BKR B;  4JQW C;  4W9K A;  2NVU I;  4NQL B;  2O6V B;  1X1M A;  4W9C A;  5JZE B;  2KTF A;  2ZVO A;  4NAW B;  1YX6 B;  1PQS A;  2ZPY A;  1XT9 B;  4K81 A;  4LJP B;  4F7Z A;  2ASQ A;  2KHW B;  2K25 A;  1P1A A;  1GC7 A;  4GU2 A;  1WZ3 A;  5C23 A;  1TTN A;  5DPR A;  4EZK A;  1Q0W B;  4DK5 A;  2CHW A;  3V6E B;  2GOW A;  2W9N A;  1WGG A;  4MSM B;  3VUY A;  4A3P A;  2GBR A;  4JIO U;  1YD8 U;  2DYO A;  2KVR A;  3ZUN A;  3K9O B;  2C7H A;  3BIN A;  2CKH B;  1V6E A;  5JH5 C;  4TV3 A;  2KDI A;  3IFW B;  3IVF A;  3KUC B;  3NHE B;  2JRH A;  2L05 A;  1EF1 A;  3A9K B;  4ICV A;  1V5O A;  3HK0 A;  5DCN A;  1WRD B;  3ZKJ C;  1YQB A;  2K6Q A;  4WJQ A;  1L7Y A;  2IO3 B;  2K1F A;  3HM3 A;  3WIM A;  1WGY A;  2KX0 A;  1WGD A;  2WDT B;  3H7P B;  4HCN B;  2AL3 A;  3SD5 A;  3WAN A;  2M1M A;  3NZU A;  3MJW A;  1LXD A;  3K9P B;  4E3C A;  2CHZ A;  1UBI A;  3NY5 A;  3O65 B;  4GN1 A;  4NAW A;  4GIV A;  5AZF A;  2NPT B;  4MSQ B;  4ANW A;  3QX1 A;  4MJS B;  3ZNZ B;  3JSV B;  4DHJ D;  1UEL A;  3IBE A;  1WJN A;  2LGD A;  1V80 A;  4HJK A;  3ONS A;  1E90 A;  3A4S C;  1TBE A;  4MGZ E;  5JHB A;  5FR6 A;  4XX5 A;  3PSE B;  3SHQ A;  2FCS A;  2LVQ A;  3EEC A;  4DXA B;  2WX1 A;  1WI0 A;  2NPT A;  5IA7 A;  2CU1 A;  3WAO A;  3QQ8 B;  2KDB A;  2LI5 A;  4II2 B;  3RUI B;  3WA0 A;  4E71 A;  2KLG A;  2JRI B;  2N9E B;  3DOW A;  3WAP A;  3D32 A;  2D3G A;  3MTN B;  4MDK E;  3VXW A;  1WR6 E;  2NR2 A;  3DCG A;  4FUL A;  2PEA A;  1WXS A;  3DVG X;  4WJP A;  4RM9 A;  2L3Z A;  2D07 B;  1Z2M A;  4PYU A;  4FAD A;  2HTH A;  5IAA C;  1J0G A;  1NI2 A;  4RM8 A;  3ZTC A;  4BBN F;  2GBJ A;  2CS4 A;  3UGB B;  4EFO A;  4GDL B;  2K8C A;  2RSU A;  3VDZ A;  1NBF C;  3M3J A;  2JPH A;  3OJ3 A;  4II3 B;  2L00 B;  2LUE A;  5CHV C;  3RUL A;  4P7I A;  3PZD A;  4GSW A;  3QCA A;  3N30 A;  3VUW A;  4G3X B;  5HKH A;  1WM2 A;  3VTU A;  2LZ6 A;  4IM0 A;  4BKT A;  3L16 A;  1M94 A;  4OVU A;  2HE7 A;  2A5U A;  2KJH B;  4EEW A;  2AYO B;  3U30 A;  3RZF A;  1WR1 A;  1L2N A;  2KO3 A;  2KNB A;  3A4R A;  3WAL A;  4ICU A;  1GUA B;  2NS5 A;  1V49 A;  3KW5 B;  2DYM A;  2OJR A;  4MEM A;  1H8C A;  4HXD A;  5G55 A;  1SGH A;  3M95 A;  4KDI C;  2KD0 A;  3CMM B;  1IP9 A;  2YLM A;  3PHW B;  3MHS D;  4FHJ A;  3TBL D;  4CHK A;  2ZEQ A;  4NY0 A;  5LXI B;  1E8Y A;  3P2B A;  2LAS A;  2GBN A;  1ZW7 A;  2MX2 A;  3EFU A;  4M8N A;  2WYQ A;  2KX3 A;  1WGR A;  3KYD D;  3LDZ E;  3R7Q A;  4BKS A;  1IYF A;  2N7E A;  2BWE S;  4HCP B;  1Z5S B;  4IC7 B;  5CX3 A;  5DPS A;  3SDL C;  4K1R B;  2BWF A;  4EZL A;  4XZ4 A;  3W1S C;  3V6C B;  3CST A;  2M17 A;  4KIK B;  5AZH A;  4MGI E;  3WAM A;  3TJP A;  2EKE C;  3U7D A;  3V62 A;  4W9F A;  2ZNV B;  4ZRK A;  3UQA A;  2WX0 A;  2O2V B;  2J0M A;  2KDE B;  3H9D A;  5CHW A;  2K39 A;  1WH3 A;  1J19 A;  4CYE A;  2N9P C;  4EOY A;  4ZDV A;  1WX8 A;  3I3T B;  1WXM A;  2BYF A;  4LDT B;  2JT4 B;  2O6V A;  5LXH A;  2MBB B;  4GB9 A;  4HLE A;  2XK5 B;  1WYW B;  4FLH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...