1YN3A

Crystal structures of eap domains from staphylococcus aureus reveal an unexpected homology to bacterial superantigens
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
98
structure length
98
Chain Sequence
GSTVPYTITVNGTSQNILSNLTFNKNQNISYKDLEGKVKSVLESNRGITDVDLRLSKQAKYTVNFKNGTKKVIDLKSGIYTANLINSSDIKSININID
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title The Crystal Structures of EAP Domains from Staphylococcus aureus Reveal an Unexpected Homology to Bacterial Superantigens.
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Toxin, protein binding
molecule keywords truncated cell surface protein map-w
total genus 32
structure length 98
sequence length 98
chains with identical sequence B
ec nomenclature
pdb deposition date 2005-01-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03642 MAP MAP domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.120 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1yn3A00
3O13A 5D3DA 4C56C 5I4DA 1SEBD 3R2IA 1SBBB 1TS2A 1KLGD 1ESFA 1SXTA 2IJ0A 1AW7A 3URYA 2AQ3B 1D5ZC 2ICIA 1L0XB 1STEA 3W2DA 2RDHA 3KLSX 4DXFA 4NZLB 1SE2A 2NTTA 1CQVA 3GP7A 3BVZA 2Z8LA 1YN5A 2SEBD 4RCOA 2XNAC 1SE4A 1HXYD 1XXGA 1YN3A 1D5MC 1TS4A 3R8BA 1TS3A 1T5XD 1TY0A 5TSSA 1AN8A 1HQRD 3BZDB 3MFGA 1F77A 3OWEB 1SJHD 2R61A 1ET6A 3BYYB 1I4QA 4OHJA 4O1NA 1V1PA 4RGTA 1V1PB 1SE3A 1JWMD 1I4XA 3BYTB 1ENFA 1D5XC 2NTSA 1KTKA 3SEBA 1L0YB 4DXGA 1FNVA 1LO5D 1JWSD 1KLUD 1YN4A 4RFBA 4RGNA 4TSSA 2QEJC 4RH6A 1D6EC 2G9HD 1ET9A 1GOZA 3BVGA 3EA6A 3BVMA 1SJED 1FNUA 1TS5A 3V05A 1JCKB 1FNWA 1M4VA 4RGOS 4UDUC 1UUPA 2J4XA 2QILA 5FK9C 2RDGA 1TY2A 1EU4A 2XN9C 3TSSA 2AQ1B 1JWUD 1DYQA 1EWCA 1B1ZA 4ZYSA 3R2TA 1UNSA 3MC0B 2IPKD 5FKAC 1I4GA 4RGMA 1CK1A 1QILA 1I4RA 2AQ2B 1I4PA 1EU3A 1BXTA 5D3IB 1HA5A 1I4HA 2TSSA 1PYWD 1V1OA
chains in the Genus database with same CATH superfamily
2NBWB 3T9LA 3NG0A 1FEHA 1XF5L 1JW9D 2JRIB 5AEKB 4BKGA 3B9JA 2GMIC 3OJ3A 3ZYYX 4LLGM 2RSUA 3B0AA 4BKSD 4KDIC 3AI5A 3ZXRA 3MJ5A 1RFKA 1IGCA 3QIJA 3AB5A 4EUTA 1SE4A 2RGFA 5GMVA 4KZ0A 2NR2A 4KGRA 5BYRA 3EECA 4W9EA 2KQ7A 5D6JB 4WWPA 3RMKC 1V2YA 1ROEA 5GXGB 3TEYA 1RFAA 4HJKA 4ZRKA 4L2YA 2NTSA 2EKEC 4US8A 5BYQA 4URKA 1PGBA 4A6QA 4AUQC 4US9A 1ET9A 5BO4B 1ZE3D 2JSVX 1HEZE 1TS5A 2DAFA 4P7IA 2M56B 2PVGC 2BKRB 3JW0X 1N6ZA 1UD7A 4IM2A 1GNUA 1F1HA 3JSVB 3RFZB 3R2TA 4MEMA 2PVOD 4WIPA 2K0PA 2KO3A 4IM0A 1JMLA 5FKAC 4RGMA 2N1VA 3QK0A 1N62A 4WJPA 3DVGX 4MGZE 1VJKA 4ASWC 1OQYA 4KIKA 1WXQA 4DDGD 2TSSA 2KJ6A 1V1OA 3Q14C 2C9WB 3A9JB 5D3DA 4YTMB 4E71A 2MBQA 2KVRA 2W3RA 2ZCCA 1C4AA 2N9EB 4KV2A 4M0WB 1TBEA 1NI2A 2I2YA 1JRUA 4E3CA 2RDHA 3RNBC 4EKUA 3AU4A 1F2RC 4WAAA 4A9AA 4MH0E 2WDRB 3ZRCA 4ACFA 1R4NB 1FXTB 4KGTA 2MCNB 2N4FA 2MBHA 2IGDA 3UIPB 1ZPSA 2WNMA 1ZP0B 1FFVA 1WXVA 4OZAA 4BKSA 3FKYA 1T6BX 2JXXA 4ZDVA 1YJJA 3IBEA 5TR5A 4JWUC 1VLBA 3VR9B 1CZPA 1PGAA 4P1BC 1TYGB 1MVKA 3AECB 3APDA 3PV1A 1WMHA 5DPTA 2BKFA 1TKGA 1TGZB 3K9PB 4EZLA 2IO1B 4PT5A 3A1QA 2GRIA 1ZOYB 2JX5A 1MHHE 1Y8RC 4OZCA 2LEKA 3RD2A 2V3PA 4EOYA 1GB4A 4YTNB 5G5GA 3ENEA 1FD6A 1EF5A 4CO7A 4OVZA 3AE6B 3AEGB 3ZNZB 2BQQA 4GDKB 4K7SA 3DWMA 4PYZA 2LUMA 3Q8AA 1WSPA 3R66C 2WLBA 1N60A 3QX1A 1N61A 3ZNID 2H88B 4S0RA 2REXA 4EEWA 4XYCA 2KDIA 1U4AA 3V62A 2MHJA 3PLVA 1XLQA 1SEBD 1WR6E 3R2IA 1QOGA 2WDVB 1EWYC 4NAWA 2IJ0A 4TQ1A 1JALA 4NY0A 2CS4A 2L52A 2V1YA 2IYDB 2FCQA 1DOIA 2NTTA 4HPLB 1WWTA 4EZKA 1ZDXA 1ZXIA 3P2BA 2OJWA 2WXGA 2K8HA 4JLCA 1TS3A 2HJ1A 1PDXA 4D2KA 2DNFA 3TL5A 2UYZB 2GBRA 3PO0A 2G3QB 2KJHB 5HHDG 5H92C 3W5UB 3CSTA 2BVCA 2GOWA 2W54A 4RGTA 1WX9A 1YQ4B 1TIFA 3TJPA 3UQBA 1EF1A 1D5XC 2Y5CA 1KTKA 1OEYJ 2J0JA 2VRRB 2DBYA 3BVGA 3V05A 3SD5A 1M4VA 1S1QB 2JYTA 1WH3A 3PZ8A 3UINB 1YIWA 1OGWA 2RR9A 2W9NA 1EWCA 4FBJB 1YQBA 1L6VA 3DVNV 1WXMA 3W5VB 3PGEA 2CHZA 3RT3B 2V4LA 1D4BA 3IAM1 1IPGA 2N0SB 2ZPYA 2IO3B 4W9GA 2L32A 3AE1B 3NS8A 3U52E 1PFDA 1Z5SB 4W9CA 1UGMA 2KDEB 1E6EB 3NVWA 2BT6A 4C56C 1M94A 5J18A 3WA0A 3ZNHB 2LVPA 4MDKE 2K8BA 2L1AA 3AEEB 3ZTCA 1JWAD 3NZ3A 2K8CA 2IZVB 3IXSA 1E0ZA 1T3QA 1GPXA 2IBIB 1L2NA 3RNEC 1P0RA 2UU7A 4LNNA 4GB9A 2SEBD 2KC2A 3MJWA 1NENB 1YJ1A 3DHIC 3ZDTA 3N1ZC 2M4NA 1VRAB 2Z59B 1WR1A 1GB1A 3WALA 3BYYB 2WYQA 3NZSA 4FJZA 3TMPB 4YTPB 3GB1A 3MC8A 2EMTA 4FLHA 3I3TB 1SIJA 2INDC 4NAMA 2D10A 4USAA 4TSSA 4MM3B 3B1LX 3RNFC 3KUCB 3IT6B 4HROA 4G11A 5JHAA 2KT7A 2KQ4X 1FMAD 4RGOS 1UUPA 2G1EA 3RUIB 3MHSD 4NQLB 1TY2A 3A1QB 2MH7A 1K53A 5AUKA 2WU2B 1I42A 4EFOA 2K25A 5JHBA 4NPNA 1JROA 4YSZB 1V49A 3VUYA 2HTHA 2LGIA 3MC0B 2LVOA 3WAMA 4MSMB 1QILA 4IC7B 4W9FA 1I4PA 5EE0A 1Y56A 2WXPA 3BWUD 4RM9A 3WAOA 1F9JA 1EU3A 4DHZB 1F52A 1E8YA 2KX3A 2L83A 1L6UA 4EE2A 4GDKA 1UBIA 1V9JA 3TEWA 3RNCC 2CHXA 4M00A 2M1MA 3DBRB 3N1XC 4MGYE 3TEXA 3W1SC 2WXMA 3IT4B 2HD5B 1NYRA 4DXFA 4KKIA 2GBJA 2KFKB 1TT5B 1WGKA 4MM3A 5FR3A 4IKGA 3CIRB 4ANVA 2KN4A 2FCMA 1WMHB 1FPYA 2PIAA 1AN8A 2PMVA 3VFKA 2H89B 1TZOA 3NVYA 2K22A 1RAXA 2Y3AA 2BS3B 1V1PB 2EMSA 2IO2B 3AV8A 2G4SA 2E6XA 5JZEB 3AEAB 4LJOB 4DXGA 4FXCA 1YJIA 2M0AA 1A70A 4GSWA 3U8ZA 2AYOB 1EM7A 2RPQA 1D6EC 1V97A 2G9HD 3H8HA 3EA6A 2ZW0A 3ABVB 1WIAA 1XCTL 1L7YA 2WX0A 1J19A 2PE6B 5T8IA 1YNTE 2RDGA 5BYSA 3V6CB 3AEFB 4C4VA 1IP9A 3ZIMA 5L83A 5D94A 4YT0B 2FNJB 1NEKB 4EZJA 1TJEA 1CJEA 4II2B 3MTNB 1KJTA 3C0RB 1X1MA 2LWPA 5IOIA 4ARIA 4PK1A 4FN2A 2KXJA 1Q10A 3L0WB 1ACCA 2SAKA 1QLBB 3BIID 2KVZA 3ZRFA 1KLGD 4ITKA 3O13A 2LXAA 3VRBB 1RLFA 4ICUA 2NBUA 4M01A 2OEDA 3H9DA 2D5GA 1J7CA 1WGGA 2GBMA 2M0XA 1STEA 3NVZA 2KK8A 4A3PA 3Q3OC 3ZKJC 1R4MI 3Q8EA 1GG3A 3KVFB 4WAFA 3VDZA 4OVUA 2YEPB 4DHJD 3NVVA 4LJPB 3A9KA 4RNAA 1E8WA 1IUEA 3OLMD 3RZFA 4GU2A 1XCQL 3B08A 3UI3A 2XEWA 4HKZE 3O65B 4ZRJA 4BVUC 3KQ4A 2L00B 3P63A 2LGSA 3WCQA 2X8XX 2MP2B 2JF5A 2MQJA 2IO0B 3P4QB 3ML8A 2BB6A 1JWMD 1FFUA 1WZ0A 2L0FA 2KDMA 3PVLA 2C7NB 4A55A 4ZRIA 4PYUA 5E6PA 1WM3A 1MHXA 3ZXVA 3R7QA 3EFUA 3GOEA 5JXVA 1XT9B 3MP9A 1VZ8A 1C76A 2NMQA 4I6PA 3H7SA 3KYCD 4HDOA 3Q3JA 4YL8A 4FHJA 3V60A 4C4VB 3GE3C 1TKYA 3HVZA 3GS2A 1FIQA 2KHWB 3VH4B 5IP4D 3DVGY 4JGHB 1GC7A 3PRPB 2DZMA 4TV3A 3HK0A 1OQRA 2LD9A 2WS3B 1BXTA 3E9SA 4YSYB 1P7EA 2N1WA 2KQSA 3DQVA 4JX1C 1PGXA 2LJ5A 4KKJA 2MRPA 4W9LA 5LNK1 1RRBA 3T3NA 5I4DA 2V4IB 3TCAA 1K52A 1JWBD 3FILB 2QCZA 2QMTA 3ZQ4A 4XWWA 2N7JA 4IG7B 4G0NB 2PJHA 4E74A 4K7WA 3HIZA 3NZUA 4OVVA 2KOXA 4ZYNA 2JUOA 2LGDA 3ZO5B 4MJSA 2DLBA 1BMLC 1KFYB 3CF6E 3C8YA 4B6WA 4RCOA 2B76B 1NDDA 3KW5B 2MBEA 5IKCM 3RNAC 3DCGA 3MFGA 1GJZA 4A20A 2JRHA 1MI0A 2BTEA 1WYGA 4C7YA 2WHIA 2DYMA 2GBNA 5CHFA 1XQQA 1UWXA 3PREA 1JWSD 5EE9A 4RGNA 1VZ6A 5HKHA 4F1SA 1Q1OA 5LXIB 3KWVA 1WF9A 2ZJDA 4M8NA 5FK9C 2AX5A 2XK5A 3QAQA 2D3AA 2WXOA 4BZAA 1IGDA 3SU8X 4QAYA 4GDLB 3S2AA 4WWOA 1V5OA 4HPMB 3AEBB 2L0TA 2CU1A 4TKNA 4K7UA 3IG3A 4P6VF 1CK1A 1E10A 2HTME 2HJ8A 2BWES 1WJUA 2KMAA 2EKIA 1UF0A 3APFA 3OAWA 2MBOA 1P7FA 2WXKA 3U2SC 4RMAA 4CHKA 3H7PA 2YEPF 1HTOA 3QC8B 3EC8A 1BUIC 4B0MA 1SBBB 3APCA 1TS2A 3V6EB 4CYEA 2V0GA 3URYA 2DHZA 4J3OD 1K8RB 1C4PA 2J0MA 5BMGA 1L5PA 3KLSX 4NQKE 1YN5A 4C80A 2K6DB 2LASA 4FULA 5E6OA 1XLNA 1T0RC 2V3SA 1HQRD 1T0QC 2JZ3B 1N5WA 1SIFA 3AE2B 1UBQA 4HVBA 5G55A 2KN5A 1ZKHA 3MHZA 2C60A 1KH0A 2ZVOA 4FHKA 3WIMA 2W3SA 2PLPA 1HTQA 3SEBA 2PPHA 1FNVA 3CMMB 4BOSC 4Q2JA 3B2GA 4S17A 4A90A 2DZIA 3P4RB 1L4ZB 5G2NA 1FNWA 3QHTA 2O6VB 4UDUC 3VUXA 4G3XB 4ANUA 3VTWA 4FJVB 2ACZB 1OFFA 2AQ1B 2R2QA 4AWJA 2DYBA 1EUVB 1S3SG 2RD0A 3N3KB 1ISNA 1UNSA 4MELA 1KLVA 1CMXB 2INNE 1I4GA 2KACA 1PUTA 1AYFA 3L08A 3U7DA 5D3IB 5IAAC 3X0WA 2DZJA 4JL9A 5BMIA 2PW9A 2KWUB 3AE7B 3VXWA 1F2RI 3SFDB 2PKOA 1AW7A 2MJDA 2DZKA 1WRIA 3HUIA 4KGSA 5CTRC 3QQ8B 3RULA 2VZKB 3DHGC 2LVQA 2OJRA 2LUEA 3GP7A 4KVGB 1HXYD 2BYTA 3KWLA 3EUB2 5C2TB 5FR6A 2NPTA 2RMMA 2MEKA 1E5WA 4NJ7A 1JRPA 1V1PA 3KUDB 2BF8B 2KX0A 5D7GA 2KTRA 4GOCA 1FCLA 2D11A 5DCNA 3PSEB 1MG4A 4AJYB 3AH7A 1J0GA 4IWOA 2MX2A 1YQ3B 4XGAB 4XWTA 4M8MA 1J7BA 2LRWA 2N9PC 4F8CB 3R7RA 1SJED 2AL3A 3QWZB 2KYWA 3RPFC 2V9HA 2M8SA 3LDZE 1UH6A 1EU4A 1QOBA 1C78A 4B95A 3W9CB 2WX1A 2ZEQA 3IFWB 2QHOA 2D2QA 1IBXA 5JH5C 3J9CA 3BY4B 4J6IA 2HE7A 2KWCA 4RF0A 1OQQA 2KMCA 2BYVE 1BT0A 1WJNA 3L13A 2FIDA 4NJ6A 1XLPA 3ZJUA 5G5HA 2ZNVB 1DYQA 5LLIA 1I35A 3VHTC 1E9MA 1ZDVA 4HCPB 3GE8C 4B9KA 2I1KA 1R4NI 2LI5A 1V6EA 2ON8A 4A3OA 4DXAB 1XO3A 5CHVC 4BKTA 4KX6B 3TBLD 2JY6A 2ZVNA 4GN1A 2WXHA 1VZ7A 5DPRA 1DGJA 4IW0A 2DAJA 2LHDA 2DYOA 1ZUD2 1TS4A 4IWQA 4LDTB 4BAXA 1A5RA 3RZWC 2N7EA 3FC4A 1R7SA 1YX6B 2AEHA 2ZPNA 1TZ1A 4AJWA 3DVNU 3RI7C 2BWFA 1SJHD 1I7HA 1N63A 3NHEB 1JQ4A 2M17A 1WFYA 3A9JA 2Z0DB 5AZGA 1TTNA 2QDFA 4JIOU 4MSQB 2MJEA 2CHWA 3NJTA 3BVMA 3NS1A 3DOWA 2N9XA 2W82A 1WGHA 4TQ0A 3IHPC 1ZXHA 2Q5WD 3PTFC 4HEA1 1VD2A 2NS5A 2KDBA 2KLGA 4DBGA 2ONQA 3M3JA 3BK2A 4IOIE 2FUHB 4ZRPA 5EDSA 4WWMA 3HHMA 4HXDA 2PE9A 3HM3A 4HWIB 1L0VB 1J7AA 2FCSA 2BYFA 3LYYA 3W1SA 2J42A 2N7DA 2C7HA 2K3UA 5EE1A 3LXFA 4L1BA 2BBCA 2NPTB 2IDYA 2L76A 3DBSA 3QARA 1WE7A 5C23A 4W9HA 5BMHA 3KUZA 3M62B 1RYJA 5E6NA 2YLMA 2LZ6A 1ESFA 3V3XA 3PLUA 2AQ3B 2PEAA 3B2FA 1L0XB 4HRSA 2JQRB 2JU6X 1IYFA 5EE3A 2UWQA 3IVFA 3N20C 1QOAA 1FM0D 1WJ6A 2CJNA 4MT5A 4HJGE 3N32A 1YD8U 5AUIA 1SF0A 1WYWB 3P4PB 3BZDB 2ZCBA 2Z0EB 1K50A 4BBNC 1WY8A 3BINA 2OHFA 3AN1A 1YMHE 1XEEA 4OHJA 4YXDB 2LGXA 3HRDD 1SE3A 1C3TA 3M95A 4C7ZA 4DWFA 4W9IA 2KANA 2FE8A 3NY5A 3L16A 2R2OA 3N30A 5AZFA 1MFWA 2BB5A 3QJZA 2J4XA 2QILA 4H2AA 2NBVB 1SB3C 1H4RA 2ASQA 2PTLA 2L3ZA 1V8CA 1KOTA 1QF6A 4AS1A 2BPSA 3ALBA 2AWTA 2KNBA 1L4DB 3Q8FA 4NJCA 2YVCA 1UELA 4REZA 4AOFA 1V81A 2KD0A 4X57B 3KYDD 1MJDA 3P4SB 1PYWD 4JQWC 2KTRB 4IM3A 2DX5B 2J7QB 2LMCA 1T0YA 4XZ4A 2WXRA 1E8ZA 3RYTA 2FIFA 1GUAB 1E90A 3ETRA 3LB8C 5CHWA 4JE3B 1D5ZC 1D3ZA 3L4PA 2VH1A 2LGYA 5C3JB 4DDID 4DHZE 3VUWA 4M02A 2LRUA 2BGFA 1V86A 4KZCA 4MH8A 1R4MB 3U7ZA 5MPOA 2RPVA 2KKCA 1ZW7A 3ML9A 2WP9B 4HK2A 2KAJA 2D3GA 5KHQA 4AP4C 3IAS1 4XDDA 5TSSA 4FADA 4K3BA 4DQOC 5J2RA 3ZDMC 2A5UA 2ZNVC 5L95C 2WGSA 2OOBB 3N9YC 3Q3FA 3VVWB 5E6JA 4IWPA 4JWSC 3ZGZA 4GLSC 3PZ7A 3RNGC 4XDCA 1YN4A 2L05A 3V61A 4WQOB 4RH6A 1C9FA 2DWQA 3E56A 3K9OB 1FNUA 2QC8A 5LXHA 4MACA 3UF8A 1HZ5A 1Q5WB 1ZGUB 3TSSA 2A4ZA 2I1JA 3GZNI 4RF1A 4WJQA 2CR5A 2O6VA 1WX8A 3HVDA 2IY0B 2O2VB 2GBKA 4N59A 2K9XA 1I4RA 1HE8A 4GXBA 4IUMB 2VZKD 3H6NA 2XBBC 3MC9A 1QZEA 2O2VA 3SR6A 1WGRA 4LDTD 1IBXB 4WURA 2CU3A 4G50A 2FBWB 3DDCB 3DWGC 4ICVA 3AULA 4KSLC 1YOVB 1F0ZA 1CQVA 2NVUI 1EO6A 3AE4B 1WXAA 3A33B 2GI9A 2JZZA 4GIVA 1D5MC 3R8BA 1J8CA 2QIEB 2MSED 3PRZA 3DBRI 4R3DA 2WXNA 4N9F4 2HDEA 2IGGA 2LHEA 4OZBA 1NI3A 1QKZA 3OWEB 4LTUA 2WDQB 3H7PB 1KM7A 4WQMA 1HZ6A 3AE5B 2BYEA 2L7RA 4HKQA 2WXQA 4WH4A 4LCDE 1C77A 1L0YB 4JPSA 4W9JA 2B3AA 4I6NB 1WZ3A 2L8JA 1KLUD 4KIKB 3L10B 4W9DA 4RFBA 4W9KA 2IY1B 5IN7A 3M63B 1FO4A 4P16A 1QOFA 4II3B 4K1RB 2WDTB 3A4RA 3UGBB 2DENB 1WGDA 1P98A 2JT4B 2XN9C 4GDLA 5CX3A 1P9DU 1JWUD 4LNOA 3TEZA 2JXTA 4MGIE 3X23A 1NBFC 2K1FA 3ZVVA 2XK5B 1KRHA 3DHHC 4LK0M 2Y5BB 2K6QA 5HFYA 1UGJA 2INCC 2MBBB 3SFEB 1LM8B 4BFRA 5IO9A 1TKEA 5AZHA 3PT2B 3ZUNA 4ANXA 3PHXB 3P1MA 4BBNF 4F7ZA 1AARA 1DOYA 1YX5B 1V80A 3U4EG 3PPAA 2WQYB 1RWSA 3DBLB 2MWSB 3L17A 3QA8A 4GGQA 2WU5B 3PS6A 3VTVA 2QJLA 2Y5PA 1NYQA 1LGRA 4NZLB 3N1YC 3AM9A 1C1YB 2J53A 2I38A 3T8MA 4MJSB 4NAWB 3A4SC 4K81A 4LNKA 1DOXA 3RN9C 5C1ZA 3AXCA 3P42A 2FCNA 1N5XA 3OG5A 5HG2A 3FILA 3CWIA 4HPPA 1I4QA 4XX5A 3DBHI 1FCCC 2MA9B 2AL6A 2RDBC 3EFCA 1WE6A 1LFDA 4XC2A 1LQBA 1WM2A 3PRMB 1UZXB 4PS8A 1V5TA 1FXAA 2C7MB 3OJ4B 3W1YA 3HM6X 4TUUA 3PZDA 4MGKE 1VCBA 1SGHA 2EELA 3AEDB 4A8XC 3ONSA 2NCNA 4ZYSA 3AE9B 5HI1A 2C5LC 3UIOB 3NRZA 1QT9A 1T0SC 2JYEA 3ZLZA 3Q2AC 1H8CA 1Z2MA 3EGRA 1FXIA 2KC1A 2AQ2B 2MW5A 2QSDA 4PS7A 1K51A 2G4DB 1LXDA 1XD3B 1HA5A 2N9LA 3AU5A 4XE0A 2W55A 3R3MA 2WXFA 4YSXB 2CJOA 1SE9A 1XLOA 4PS3A 1P3QU 3ECIA 2LFIA 2INPE 2MP2A 3PHWB 2JPHA 4N58A 4CQNA 2KFKA 2BW2A 1RM6C 2JZPA 3Q69A 4ZHOA 3W2DA 3NOBA 3AE3B 4AQ7A 4RM8A 3A9KB 2J52A 1SE2A 2FUG1 4HDQA 4OW0A 4B0EA 1B9RA 3ZJTA 1YN3A 1E7VA 1TY0A 1T5XD 3TIXA 2D3CA 3Q6BA 4WWNA 3I57A 4FA6A 2LXCA 4LNIA 2CKHB 2BS2B 1F77A 1AWDA 2WXLA 1WXSA 2FAZA 3TUOA 4O1NA 2K39A 1WJ4A 1Q0WB 1I4XA 5H8YE 2JWUA 3T3OA 1WX7A 4ZRQA 1ENFA 3AMZA 3Q8BA 3I63C 3KH0A 2KJRA 2KFJA 2KTFA 5KHOA 1GOZA 4TMAB 1C79A 3Q3MC 3ZTDA 3I5JC 1MG8A 3QCAA 3GZNB 1GC6A 4YWGG 1VR9A 2N9KA 2O6VD 4ZHPA 3H1UA 2MLBA 2WWZA 4FJYA 2V3NA 1PQSA 2IPKD 4KDLB 4IDIA 4WJOA 2BS4B 1P1AA 1C4CA 3D32A 2E3TA 2M19A 3DPDA 1OEYA 4C00A 4I6LB 1KF6B 2ZW1A 3VH3B 3VR8B 3C19A 3ZJVA 1QQRA 2J0KA 2K5PA 3FAHA 3VRAB 1SXTA 2KZRA 2X38A 3ZNGC 5DPSA 2D07B 2ICIA 1SSNA 1G6JA 3JSVA 1WGYA 3WANA 2IGHA 2VH2A 4N6EB 5J17A 3BVZA 1E7UA 2Z8LA 3VQIA 1UWMA 2XNAC 1NVID 1XXGA 2JWZA 2KWDA 2ZZPB 4DHJB 4HCNB 1WI0A 2G45B 2WXIA 4NNJB 3VAWA 2LJIA 3CSFA 4M0WA 2WXJA 2KLCA 4L23A 2KWVB 3JVZX 3VTUA 2R61A 1E7PB 1ET6A 4ZOHC 1MPEA 4WJNA 1FRRA 2GLSA 3BYTB 3Q8CA 4K3CA 3UQAA 1LO5D 4KSKC 5IA7A 3ZW3A 4P1CC 2QEJC 1GAQB 2KDFB 2KMMA 1JCKB 3NUHB 3U30A 4BOZB 3BK1A 1FRDA 4DK5A 3DBLI 3LJ3A 3L54A 3I9V1 1VDVA 4HLEA 1B1ZA 1WRDB 3JYUA 3DBHB 3SHQA 5DPWA 4ANWA 3AE8B 3EHVA 2JVCA 4LNFA 3Q3NC 2MJ3A 5D2MB 3SDLC 3WAPA 4ARCA 1E8XA 1OTRB 2D3BA 1I4HA 3RCZA 2GB1A 4GMVA
chains in the Genus database with same CATH topology
1FEHA 3SR6A 2L83A 1XF5L 1L6UA 2PW9A 4EE2A 1JW9D 3TEWA 3AE7B 1IBXB 1F2RI 4WURA 3SFDB 2CU3A 2FBWB 3B9JA 2PKOA 1AW7A 2MJDA 3TEXA 1WRIA 3ZYYX 4LLGM 2WXMA 3IT4B 3DWGC 3HUIA 1NYRA 4KGSA 4DXFA 4KKIA 2VZKB 1F0ZA 3MJ5A 1RFKA 1IGCA 1CQVA 1WGKA 3GP7A 3AB5A 3AE4B 5FR3A 4IKGA 3CIRB 1SE4A 2GI9A 1HXYD 2KN4A 1D5MC 3R8BA 2QIEB 2PIAA 1AN8A 4R3DA 2BYTA 2PMVA 3KWLA 4KGRA 5BYRA 3EUB2 2WXNA 5C2TB 2HDEA 2IGGA 2LHEA 4OZBA 1NI3A 1QKZA 3OWEB 4LTUA 2WDQB 2RMMA 2H89B 2MEKA 4WQMA 1ROEA 1TZOA 5GXGB 3TEYA 3NVYA 1JRPA 1HZ6A 2K22A 3AE5B 1V1PA 2Y3AA 2BS3B 4HKQA 1V1PB 2WXQA 5D7GA 1FCLA 4WH4A 3AV8A 4L2YA 2NTSA 2E6XA 1C77A 1L0YB 3AEAB 4JPSA 5BYQA 4FXCA 4DXGA 4US8A 1KLUD 3AH7A 1YJIA 2M0AA 1A70A 4RFBA 1EM7A 1PGBA 1YQ3B 4XWTA 4A6QA 1D6EC 1J7BA 1V97A 4US9A 2G9HD 1ET9A 3H8HA 3EA6A 2ZW0A 1ZE3D 2JSVX 3ABVB 4P16A 1HEZE 1SJED 1FO4A 1QOFA 1TS5A 1XCTL 3RPFC 2M56B 2PVGC 5T8IA 1YNTE 2RDGA 5BYSA 3AEFB 1EU4A 1QOBA 2XN9C 1C78A 3W9CB 1JWUD 4YT0B 3TEZA 2JXTA 1NEKB 1IBXA 1TJEA 3J9CA 3RFZB 1CJEA 1KRHA 4LK0M 3R2TA 2PVOD 4WIPA 4RF0A 2K0PA 5HFYA 1OQQA 1UGJA 1JMLA 5FKAC 4ARIA 4RGMA 3SFEB 1N62A 1Q10A 1TKEA 1VJKA 1ACCA 3ZJUA 1XLPA 2SAKA 1WXQA 1QLBB 5G5HA 2TSSA 3BIID 1KLGD 1V1OA 1DYQA 4ITKA 3O13A 3P1MA 5D3DA 4YTMB 1E9MA 1ZDVA 3VRBB 2W3RA 1DOYA 1C4AA 2OEDA 2D5GA 3U4EG 1J7CA 2ON8A 2WQYB 1RWSA 1XO3A 2I2YA 1STEA 2WU5B 3NVZA 4KX6B 2RDHA 3Q8EA 2QJLA 2Y5PA 4WAFA 1NYQA 2WXHA 1F2RC 4NZLB 1VZ7A 2YEPB 3AM9A 3NVVA 1DGJA 2I38A 2J53A 2LHDA 4RNAA 4NAWB 4A9AA 2DYOA 1DOXA 1IUEA 1ZUD2 1TS4A 1XCQL 2WDRB 3UI3A 3P42A 4HKZE 3KQ4A 3FC4A 1R7SA 3P63A 4KGTA 1N5XA 3WCQA 2IGDA 5HG2A 1SJHD 3FILA 1I7HA 1N63A 1ZPSA 2WNMA 3CWIA 1ZP0B 3P4QB 1I4QA 1FFVA 1FCCC 2BB6A 1JQ4A 4OZAA 1JWMD 1FFUA 1T6BX 1YJJA 2KDMA 4A55A 4JWUC 1VLBA 3VR9B 1CZPA 1PGAA 2MJEA 1TYGB 1MVKA 3AECB 1MHXA 3BVMA 1FXAA 3NS1A 1TKGA 2W82A 5JXVA 4TQ0A 4PT5A 3MP9A 1VZ8A 1C76A 2NMQA 1ZXHA 2Q5WD 2GRIA 4HEA1 1ZOYB 2JX5A 3AEDB 2EELA 1MHHE 4A8XC 4OZCA 2ONQA 3BK2A 4ZYSA 4IOIE 3AE9B 3HVZA 1TKYA 2LEKA 5HI1A 2V3PA 3NRZA 4ZRPA 3GS2A 4WWMA 1FIQA 1QT9A 2JYEA 4YTNB 1GB4A 5G5GA 1FD6A 1L0VB 4OVZA 1J7AA 3AE6B 3EGRA 3AEGB 1FXIA 3LYYA 4GDKB 2AQ2B 2QSDA 3W1SA 3DWMA 2J42A 2LUMA 1K51A 1OQRA 1WSPA 3Q8AA 2WLBA 2WS3B 2K3UA 1BXTA 5EE1A 3LXFA 1HA5A 3E9SA 4YSYB 1N60A 1P7EA 2N9LA 4XE0A 1N61A 2H88B 2W55A 4JX1C 1PGXA 4L1BA 2WXFA 2BBCA 4YSXB 2IDYA 4KKJA 2CJOA 5LNK1 5BMHA 1XLOA 3T3NA 5I4DA 2V4IB 1XLQA 1K52A 1RYJA 1SEBD 1QOGA 3R2IA 1JWBD 2LFIA 3FILB 2INPE 2QMTA 3ZQ4A 4XWWA 2WDVB 4N58A 1EWYC 2N7JA 4CQNA 1ESFA 3V3XA 2IJ0A 2AQ3B 2BW2A 4TQ1A 1JALA 1RM6C 3B2FA 2JZPA 3Q69A 1L0XB 4ZHOA 2L52A 4HRSA 3W2DA 2JQRB 2JU6X 5EE3A 3AE3B 4AQ7A 2DLBA 1QOAA 2J52A 2FUG1 1FM0D 1BMLC 1SE2A 2NTTA 1DOIA 2CJNA 4MT5A 4HJGE 1KFYB 4OW0A 4B0EA 1B9RA 3C8YA 1WWTA 3ZJTA 4RCOA 5AUIA 1ZDXA 1ZXIA 1YN3A 2WXGA 2B76B 1SF0A 1TS3A 1T5XD 1TY0A 1PDXA 4D2KA 3I57A 3P4PB 3BZDB 2BS2B 1K50A 3MFGA 1F77A 1AWDA 3PO0A 2WXLA 5HHDG 3TUOA 5H92C 3W5UB 2OHFA 3AN1A 1YMHE 1XEEA 4OHJA 1MI0A 4O1NA 4YXDB 2BTEA 1WYGA 3HRDD 2W54A 4C7YA 4RGTA 1YQ4B 1SE3A 2DYMA 1I4XA 5H8YE 2JWUA 3T3OA 4ZRQA 1ENFA 1UWXA 1D5XC 2Y5CA 1KTKA 3AMZA 3Q8BA 1JWSD 5EE9A 4RGNA 4C7ZA 1VZ6A 2DBYA 1GOZA 4TMAB 3BVGA 1C79A 2FE8A 3KWVA 3V05A 1M4VA 2JYTA 2BB5A 2J4XA 2QILA 2AX5A 4H2AA 5FK9C 3PZ8A 1SB3C 2WXOA 4YWGG 1IGDA 1VR9A 2PTLA 2N9KA 1EWCA 4GDLB 1L6VA 1V8CA 4ZHPA 3W5VB 1QF6A 4AS1A 3AEBB 2V3NA 1D4BA 1L4DB 2IPKD 3IAM1 3Q8FA 4NJCA 4P6VF 4IDIA 1CK1A 1E10A 2BS4B 2HTME 4REZA 2N0SB 2L32A 3AE1B 3U52E 1PFDA 2EKIA 1C4CA 1P7FA 2E3TA 2M19A 3P4SB 1PYWD 2WXKA 2LMCA 1E6EB 3NVWA 3U2SC 2WXRA 2BT6A 4C56C 1KF6B 2ZW1A 2YEPF 3VR8B 1BUIC 4B0MA 3ZJVA 1QQRA 1SBBB 2K5PA 3FAHA 1TS2A 3VRAB 3ETRA 1SXTA 3LB8C 2L1AA 2X38A 2V0GA 3URYA 3AEEB 4JE3B 4J3OD 1D5ZC 2ICIA 1SSNA 1JWAD 3L4PA 1C4PA 5BMGA 1L5PA 3NZ3A 2IGHA 5C3JB 3KLSX 4N6EB 3IXSA 1E0ZA 1T3QA 1GPXA 3BVZA 4MH8A 2Z8LA 3U7ZA 5MPOA 2RPVA 3VQIA 1YN5A 1UWMA 2SEBD 2XNAC 4C80A 1NVID 1XXGA 2WP9B 2KAJA 1NENB 2KWDA 1XLNA 3IAS1 4XDDA 5TSSA 2WXIA 4DQOC 2LJIA 1HQRD 4M0WA 2WXJA 4L23A 1N5WA 1VRAB 3AE2B 2R61A 1GB1A 1E7PB 1ET6A 3BYYB 1MPEA 4ZOHC 3MHZA 1FRRA 3N9YC 1KH0A 3BYTB 2W3SA 5E6JA 2PLPA 3Q8CA 4JWSC 4YTPB 3GB1A 4GLSC 3PZ7A 3SEBA 3ZGZA 1FNVA 1LO5D 4XDCA 1SIJA 1YN4A 4Q2JA 4NAMA 4USAA 4TSSA 3B2GA 2QEJC 4MM3B 4RH6A 4A90A 1GAQB 1C9FA 2DWQA 3E56A 2KMMA 3IT6B 3P4RB 1L4ZB 1FNUA 4HROA 1JCKB 1FNWA 4MACA 2KQ4X 1FMAD 4RGOS 1UUPA 4UDUC 2G1EA 3NUHB 1HZ5A 1TY2A 3BK1A 2ACZB 1FRDA 2MH7A 1K53A 3TSSA 1OFFA 2AQ1B 2WU2B 5AUKA 3I9V1 1VDVA 1B1ZA 1JROA 4YSZB 1UNSA 3AE8B 4RF1A 3HVDA 2LGIA 3MC0B 2INNE 4N59A 1I4GA 2MJ3A 2KACA 2K9XA 1QILA 1I4RA 1I4PA 1PUTA 5EE0A 1AYFA 1Y56A 2WXPA 3BWUD 4ARCA 1EU3A 5D3IB 2VZKD 1I4HA 5BMIA 2GB1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3O13 A;  5D3D A;  4C56 C;  5I4D A;  1SEB D;  3R2I A;  1SBB B;  1TS2 A;  1KLG D;  1ESF A;  1SXT A;  2IJ0 A;  1AW7 A;  3URY A;  2AQ3 B;  1D5Z C;  2ICI A;  1L0X B;  1STE A;  3W2D A;  2RDH A;  3KLS X;  4DXF A;  4NZL B;  1SE2 A;  2NTT A;  1CQV A;  3GP7 A;  3BVZ A;  2Z8L A;  1YN5 A;  2SEB D;  4RCO A;  2XNA C;  1SE4 A;  1HXY D;  1XXG A;  1YN3 A;  1D5M C;  1TS4 A;  3R8B A;  1TS3 A;  1T5X D;  1TY0 A;  5TSS A;  1AN8 A;  1HQR D;  3BZD B;  3MFG A;  1F77 A;  3OWE B;  1SJH D;  2R61 A;  1ET6 A;  3BYY B;  1I4Q A;  4OHJ A;  4O1N A;  1V1P A;  4RGT A;  1V1P B;  1SE3 A;  1JWM D;  1I4X A;  3BYT B;  1ENF A;  1D5X C;  2NTS A;  1KTK A;  3SEB A;  1L0Y B;  4DXG A;  1FNV A;  1LO5 D;  1JWS D;  1KLU D;  1YN4 A;  4RFB A;  4RGN A;  4TSS A;  2QEJ C;  4RH6 A;  1D6E C;  2G9H D;  1ET9 A;  1GOZ A;  3BVG A;  3EA6 A;  3BVM A;  1SJE D;  1FNU A;  1TS5 A;  3V05 A;  1JCK B;  1FNW A;  1M4V A;  4RGO S;  4UDU C;  1UUP A;  2J4X A;  2QIL A;  5FK9 C;  2RDG A;  1TY2 A;  1EU4 A;  2XN9 C;  3TSS A;  2AQ1 B;  1JWU D;  1DYQ A;  1EWC A;  1B1Z A;  4ZYS A;  3R2T A;  1UNS A;  3MC0 B;  2IPK D;  5FKA C;  1I4G A;  4RGM A;  1CK1 A;  1QIL A;  1I4R A;  2AQ2 B;  1I4P A;  1EU3 A;  1BXT A;  5D3I B;  1HA5 A;  1I4H A;  2TSS A;  1PYW D;  1V1O A; 
#chains in the Genus database with same CATH topology
 2NBW B;  3T9L A;  3NG0 A;  1FEH A;  1XF5 L;  1JW9 D;  2JRI B;  5AEK B;  4BKG A;  3B9J A;  2GMI C;  3OJ3 A;  3ZYY X;  4LLG M;  2RSU A;  3B0A A;  4BKS D;  4KDI C;  3AI5 A;  3ZXR A;  3MJ5 A;  1RFK A;  1IGC A;  3QIJ A;  3AB5 A;  4EUT A;  1SE4 A;  2RGF A;  5GMV A;  4KZ0 A;  2NR2 A;  4KGR A;  5BYR A;  3EEC A;  4W9E A;  2KQ7 A;  5D6J B;  4WWP A;  3RMK C;  1V2Y A;  1ROE A;  5GXG B;  3TEY A;  1RFA A;  4HJK A;  4ZRK A;  4L2Y A;  2NTS A;  2EKE C;  4US8 A;  5BYQ A;  4URK A;  1PGB A;  4A6Q A;  4AUQ C;  4US9 A;  1ET9 A;  5BO4 B;  1ZE3 D;  2JSV X;  1HEZ E;  1TS5 A;  2DAF A;  4P7I A;  2M56 B;  2PVG C;  2BKR B;  3JW0 X;  1N6Z A;  1UD7 A;  4IM2 A;  1GNU A;  1F1H A;  3JSV B;  3RFZ B;  3R2T A;  4MEM A;  2PVO D;  4WIP A;  2K0P A;  2KO3 A;  4IM0 A;  1JML A;  5FKA C;  4RGM A;  2N1V A;  3QK0 A;  1N62 A;  4WJP A;  3DVG X;  4MGZ E;  1VJK A;  4ASW C;  1OQY A;  4KIK A;  1WXQ A;  4DDG D;  2TSS A;  2KJ6 A;  1V1O A;  3Q14 C;  2C9W B;  3A9J B;  5D3D A;  4YTM B;  4E71 A;  2MBQ A;  2KVR A;  2W3R A;  2ZCC A;  1C4A A;  2N9E B;  4KV2 A;  4M0W B;  1TBE A;  1NI2 A;  2I2Y A;  1JRU A;  4E3C A;  2RDH A;  3RNB C;  4EKU A;  3AU4 A;  1F2R C;  4WAA A;  4A9A A;  4MH0 E;  2WDR B;  3ZRC A;  4ACF A;  1R4N B;  1FXT B;  4KGT A;  2MCN B;  2N4F A;  2MBH A;  2IGD A;  3UIP B;  1ZPS A;  2WNM A;  1ZP0 B;  1FFV A;  1WXV A;  4OZA A;  4BKS A;  3FKY A;  1T6B X;  2JXX A;  4ZDV A;  1YJJ A;  3IBE A;  5TR5 A;  4JWU C;  1VLB A;  3VR9 B;  1CZP A;  1PGA A;  4P1B C;  1TYG B;  1MVK A;  3AEC B;  3APD A;  3PV1 A;  1WMH A;  5DPT A;  2BKF A;  1TKG A;  1TGZ B;  3K9P B;  4EZL A;  2IO1 B;  4PT5 A;  3A1Q A;  2GRI A;  1ZOY B;  2JX5 A;  1MHH E;  1Y8R C;  4OZC A;  2LEK A;  3RD2 A;  2V3P A;  4EOY A;  1GB4 A;  4YTN B;  5G5G A;  3ENE A;  1FD6 A;  1EF5 A;  4CO7 A;  4OVZ A;  3AE6 B;  3AEG B;  3ZNZ B;  2BQQ A;  4GDK B;  4K7S A;  3DWM A;  4PYZ A;  2LUM A;  3Q8A A;  1WSP A;  3R66 C;  2WLB A;  1N60 A;  3QX1 A;  1N61 A;  3ZNI D;  2H88 B;  4S0R A;  2REX A;  4EEW A;  4XYC A;  2KDI A;  1U4A A;  3V62 A;  2MHJ A;  3PLV A;  1XLQ A;  1SEB D;  1WR6 E;  3R2I A;  1QOG A;  2WDV B;  1EWY C;  4NAW A;  2IJ0 A;  4TQ1 A;  1JAL A;  4NY0 A;  2CS4 A;  2L52 A;  2V1Y A;  2IYD B;  2FCQ A;  1DOI A;  2NTT A;  4HPL B;  1WWT A;  4EZK A;  1ZDX A;  1ZXI A;  3P2B A;  2OJW A;  2WXG A;  2K8H A;  4JLC A;  1TS3 A;  2HJ1 A;  1PDX A;  4D2K A;  2DNF A;  3TL5 A;  2UYZ B;  2GBR A;  3PO0 A;  2G3Q B;  2KJH B;  5HHD G;  5H92 C;  3W5U B;  3CST A;  2BVC A;  2GOW A;  2W54 A;  4RGT A;  1WX9 A;  1YQ4 B;  1TIF A;  3TJP A;  3UQB A;  1EF1 A;  1D5X C;  2Y5C A;  1KTK A;  1OEY J;  2J0J A;  2VRR B;  2DBY A;  3BVG A;  3V05 A;  3SD5 A;  1M4V A;  1S1Q B;  2JYT A;  1WH3 A;  3PZ8 A;  3UIN B;  1YIW A;  1OGW A;  2RR9 A;  2W9N A;  1EWC A;  4FBJ B;  1YQB A;  1L6V A;  3DVN V;  1WXM A;  3W5V B;  3PGE A;  2CHZ A;  3RT3 B;  2V4L A;  1D4B A;  3IAM 1;  1IPG A;  2N0S B;  2ZPY A;  2IO3 B;  4W9G A;  2L32 A;  3AE1 B;  3NS8 A;  3U52 E;  1PFD A;  1Z5S B;  4W9C A;  1UGM A;  2KDE B;  1E6E B;  3NVW A;  2BT6 A;  4C56 C;  1M94 A;  5J18 A;  3WA0 A;  3ZNH B;  2LVP A;  4MDK E;  2K8B A;  2L1A A;  3AEE B;  3ZTC A;  1JWA D;  3NZ3 A;  2K8C A;  2IZV B;  3IXS A;  1E0Z A;  1T3Q A;  1GPX A;  2IBI B;  1L2N A;  3RNE C;  1P0R A;  2UU7 A;  4LNN A;  4GB9 A;  2SEB D;  2KC2 A;  3MJW A;  1NEN B;  1YJ1 A;  3DHI C;  3ZDT A;  3N1Z C;  2M4N A;  1VRA B;  2Z59 B;  1WR1 A;  1GB1 A;  3WAL A;  3BYY B;  2WYQ A;  3NZS A;  4FJZ A;  3TMP B;  4YTP B;  3GB1 A;  3MC8 A;  2EMT A;  4FLH A;  3I3T B;  1SIJ A;  2IND C;  4NAM A;  2D10 A;  4USA A;  4TSS A;  4MM3 B;  3B1L X;  3RNF C;  3KUC B;  3IT6 B;  4HRO A;  4G11 A;  5JHA A;  2KT7 A;  2KQ4 X;  1FMA D;  4RGO S;  1UUP A;  2G1E A;  3RUI B;  3MHS D;  4NQL B;  1TY2 A;  3A1Q B;  2MH7 A;  1K53 A;  5AUK A;  2WU2 B;  1I42 A;  4EFO A;  2K25 A;  5JHB A;  4NPN A;  1JRO A;  4YSZ B;  1V49 A;  3VUY A;  2HTH A;  2LGI A;  3MC0 B;  2LVO A;  3WAM A;  4MSM B;  1QIL A;  4IC7 B;  4W9F A;  1I4P A;  5EE0 A;  1Y56 A;  2WXP A;  3BWU D;  4RM9 A;  3WAO A;  1F9J A;  1EU3 A;  4DHZ B;  1F52 A;  1E8Y A;  2KX3 A;  2L83 A;  1L6U A;  4EE2 A;  4GDK A;  1UBI A;  1V9J A;  3TEW A;  3RNC C;  2CHX A;  4M00 A;  2M1M A;  3DBR B;  3N1X C;  4MGY E;  3TEX A;  3W1S C;  2WXM A;  3IT4 B;  2HD5 B;  1NYR A;  4DXF A;  4KKI A;  2GBJ A;  2KFK B;  1TT5 B;  1WGK A;  4MM3 A;  5FR3 A;  4IKG A;  3CIR B;  4ANV A;  2KN4 A;  2FCM A;  1WMH B;  1FPY A;  2PIA A;  1AN8 A;  2PMV A;  3VFK A;  2H89 B;  1TZO A;  3NVY A;  2K22 A;  1RAX A;  2Y3A A;  2BS3 B;  1V1P B;  2EMS A;  2IO2 B;  3AV8 A;  2G4S A;  2E6X A;  5JZE B;  3AEA B;  4LJO B;  4DXG A;  4FXC A;  1YJI A;  2M0A A;  1A70 A;  4GSW A;  3U8Z A;  2AYO B;  1EM7 A;  2RPQ A;  1D6E C;  1V97 A;  2G9H D;  3H8H A;  3EA6 A;  2ZW0 A;  3ABV B;  1WIA A;  1XCT L;  1L7Y A;  2WX0 A;  1J19 A;  2PE6 B;  5T8I A;  1YNT E;  2RDG A;  5BYS A;  3V6C B;  3AEF B;  4C4V A;  1IP9 A;  3ZIM A;  5L83 A;  5D94 A;  4YT0 B;  2FNJ B;  1NEK B;  4EZJ A;  1TJE A;  1CJE A;  4II2 B;  3MTN B;  1KJT A;  3C0R B;  1X1M A;  2LWP A;  5IOI A;  4ARI A;  4PK1 A;  4FN2 A;  2KXJ A;  1Q10 A;  3L0W B;  1ACC A;  2SAK A;  1QLB B;  3BII D;  2KVZ A;  3ZRF A;  1KLG D;  4ITK A;  3O13 A;  2LXA A;  3VRB B;  1RLF A;  4ICU A;  2NBU A;  4M01 A;  2OED A;  3H9D A;  2D5G A;  1J7C A;  1WGG A;  2GBM A;  2M0X A;  1STE A;  3NVZ A;  2KK8 A;  4A3P A;  3Q3O C;  3ZKJ C;  1R4M I;  3Q8E A;  1GG3 A;  3KVF B;  4WAF A;  3VDZ A;  4OVU A;  2YEP B;  4DHJ D;  3NVV A;  4LJP B;  3A9K A;  4RNA A;  1E8W A;  1IUE A;  3OLM D;  3RZF A;  4GU2 A;  1XCQ L;  3B08 A;  3UI3 A;  2XEW A;  4HKZ E;  3O65 B;  4ZRJ A;  4BVU C;  3KQ4 A;  2L00 B;  3P63 A;  2LGS A;  3WCQ A;  2X8X X;  2MP2 B;  2JF5 A;  2MQJ A;  2IO0 B;  3P4Q B;  3ML8 A;  2BB6 A;  1JWM D;  1FFU A;  1WZ0 A;  2L0F A;  2KDM A;  3PVL A;  2C7N B;  4A55 A;  4ZRI A;  4PYU A;  5E6P A;  1WM3 A;  1MHX A;  3ZXV A;  3R7Q A;  3EFU A;  3GOE A;  5JXV A;  1XT9 B;  3MP9 A;  1VZ8 A;  1C76 A;  2NMQ A;  4I6P A;  3H7S A;  3KYC D;  4HDO A;  3Q3J A;  4YL8 A;  4FHJ A;  3V60 A;  4C4V B;  3GE3 C;  1TKY A;  3HVZ A;  3GS2 A;  1FIQ A;  2KHW B;  3VH4 B;  5IP4 D;  3DVG Y;  4JGH B;  1GC7 A;  3PRP B;  2DZM A;  4TV3 A;  3HK0 A;  1OQR A;  2LD9 A;  2WS3 B;  1BXT A;  3E9S A;  4YSY B;  1P7E A;  2N1W A;  2KQS A;  3DQV A;  4JX1 C;  1PGX A;  2LJ5 A;  4KKJ A;  2MRP A;  4W9L A;  5LNK 1;  1RRB A;  3T3N A;  5I4D A;  2V4I B;  3TCA A;  1K52 A;  1JWB D;  3FIL B;  2QCZ A;  2QMT A;  3ZQ4 A;  4XWW A;  2N7J A;  4IG7 B;  4G0N B;  2PJH A;  4E74 A;  4K7W A;  3HIZ A;  3NZU A;  4OVV A;  2KOX A;  4ZYN A;  2JUO A;  2LGD A;  3ZO5 B;  4MJS A;  2DLB A;  1BML C;  1KFY B;  3CF6 E;  3C8Y A;  4B6W A;  4RCO A;  2B76 B;  1NDD A;  3KW5 B;  2MBE A;  5IKC M;  3RNA C;  3DCG A;  3MFG A;  1GJZ A;  4A20 A;  2JRH A;  1MI0 A;  2BTE A;  1WYG A;  4C7Y A;  2WHI A;  2DYM A;  2GBN A;  5CHF A;  1XQQ A;  1UWX A;  3PRE A;  1JWS D;  5EE9 A;  4RGN A;  1VZ6 A;  5HKH A;  4F1S A;  1Q1O A;  5LXI B;  3KWV A;  1WF9 A;  2ZJD A;  4M8N A;  5FK9 C;  2AX5 A;  2XK5 A;  3QAQ A;  2D3A A;  2WXO A;  4BZA A;  1IGD A;  3SU8 X;  4QAY A;  4GDL B;  3S2A A;  4WWO A;  1V5O A;  4HPM B;  3AEB B;  2L0T A;  2CU1 A;  4TKN A;  4K7U A;  3IG3 A;  4P6V F;  1CK1 A;  1E10 A;  2HTM E;  2HJ8 A;  2BWE S;  1WJU A;  2KMA A;  2EKI A;  1UF0 A;  3APF A;  3OAW A;  2MBO A;  1P7F A;  2WXK A;  3U2S C;  4RMA A;  4CHK A;  3H7P A;  2YEP F;  1HTO A;  3QC8 B;  3EC8 A;  1BUI C;  4B0M A;  1SBB B;  3APC A;  1TS2 A;  3V6E B;  4CYE A;  2V0G A;  3URY A;  2DHZ A;  4J3O D;  1K8R B;  1C4P A;  2J0M A;  5BMG A;  1L5P A;  3KLS X;  4NQK E;  1YN5 A;  4C80 A;  2K6D B;  2LAS A;  4FUL A;  5E6O A;  1XLN A;  1T0R C;  2V3S A;  1HQR D;  1T0Q C;  2JZ3 B;  1N5W A;  1SIF A;  3AE2 B;  1UBQ A;  4HVB A;  5G55 A;  2KN5 A;  1ZKH A;  3MHZ A;  2C60 A;  1KH0 A;  2ZVO A;  4FHK A;  3WIM A;  2W3S A;  2PLP A;  1HTQ A;  3SEB A;  2PPH A;  1FNV A;  3CMM B;  4BOS C;  4Q2J A;  3B2G A;  4S17 A;  4A90 A;  2DZI A;  3P4R B;  1L4Z B;  5G2N A;  1FNW A;  3QHT A;  2O6V B;  4UDU C;  3VUX A;  4G3X B;  4ANU A;  3VTW A;  4FJV B;  2ACZ B;  1OFF A;  2AQ1 B;  2R2Q A;  4AWJ A;  2DYB A;  1EUV B;  1S3S G;  2RD0 A;  3N3K B;  1ISN A;  1UNS A;  4MEL A;  1KLV A;  1CMX B;  2INN E;  1I4G A;  2KAC A;  1PUT A;  1AYF A;  3L08 A;  3U7D A;  5D3I B;  5IAA C;  3X0W A;  2DZJ A;  4JL9 A;  5BMI A;  2PW9 A;  2KWU B;  3AE7 B;  3VXW A;  1F2R I;  3SFD B;  2PKO A;  1AW7 A;  2MJD A;  2DZK A;  1WRI A;  3HUI A;  4KGS A;  5CTR C;  3QQ8 B;  3RUL A;  2VZK B;  3DHG C;  2LVQ A;  2OJR A;  2LUE A;  3GP7 A;  4KVG B;  1HXY D;  2BYT A;  3KWL A;  3EUB 2;  5C2T B;  5FR6 A;  2NPT A;  2RMM A;  2MEK A;  1E5W A;  4NJ7 A;  1JRP A;  1V1P A;  3KUD B;  2BF8 B;  2KX0 A;  5D7G A;  2KTR A;  4GOC A;  1FCL A;  2D11 A;  5DCN A;  3PSE B;  1MG4 A;  4AJY B;  3AH7 A;  1J0G A;  4IWO A;  2MX2 A;  1YQ3 B;  4XGA B;  4XWT A;  4M8M A;  1J7B A;  2LRW A;  2N9P C;  4F8C B;  3R7R A;  1SJE D;  2AL3 A;  3QWZ B;  2KYW A;  3RPF C;  2V9H A;  2M8S A;  3LDZ E;  1UH6 A;  1EU4 A;  1QOB A;  1C78 A;  4B95 A;  3W9C B;  2WX1 A;  2ZEQ A;  3IFW B;  2QHO A;  2D2Q A;  1IBX A;  5JH5 C;  3J9C A;  3BY4 B;  4J6I A;  2HE7 A;  2KWC A;  4RF0 A;  1OQQ A;  2KMC A;  2BYV E;  1BT0 A;  1WJN A;  3L13 A;  2FID A;  4NJ6 A;  1XLP A;  3ZJU A;  5G5H A;  2ZNV B;  1DYQ A;  5LLI A;  1I35 A;  3VHT C;  1E9M A;  1ZDV A;  4HCP B;  3GE8 C;  4B9K A;  2I1K A;  1R4N I;  2LI5 A;  1V6E A;  2ON8 A;  4A3O A;  4DXA B;  1XO3 A;  5CHV C;  4BKT A;  4KX6 B;  3TBL D;  2JY6 A;  2ZVN A;  4GN1 A;  2WXH A;  1VZ7 A;  5DPR A;  1DGJ A;  4IW0 A;  2DAJ A;  2LHD A;  2DYO A;  1ZUD 2;  1TS4 A;  4IWQ A;  4LDT B;  4BAX A;  1A5R A;  3RZW C;  2N7E A;  3FC4 A;  1R7S A;  1YX6 B;  2AEH A;  2ZPN A;  1TZ1 A;  4AJW A;  3DVN U;  3RI7 C;  2BWF A;  1SJH D;  1I7H A;  1N63 A;  3NHE B;  1JQ4 A;  2M17 A;  1WFY A;  3A9J A;  2Z0D B;  5AZG A;  1TTN A;  2QDF A;  4JIO U;  4MSQ B;  2MJE A;  2CHW A;  3NJT A;  3BVM A;  3NS1 A;  3DOW A;  2N9X A;  2W82 A;  1WGH A;  4TQ0 A;  3IHP C;  1ZXH A;  2Q5W D;  3PTF C;  4HEA 1;  1VD2 A;  2NS5 A;  2KDB A;  2KLG A;  4DBG A;  2ONQ A;  3M3J A;  3BK2 A;  4IOI E;  2FUH B;  4ZRP A;  5EDS A;  4WWM A;  3HHM A;  4HXD A;  2PE9 A;  3HM3 A;  4HWI B;  1L0V B;  1J7A A;  2FCS A;  2BYF A;  3LYY A;  3W1S A;  2J42 A;  2N7D A;  2C7H A;  2K3U A;  5EE1 A;  3LXF A;  4L1B A;  2BBC A;  2NPT B;  2IDY A;  2L76 A;  3DBS A;  3QAR A;  1WE7 A;  5C23 A;  4W9H A;  5BMH A;  3KUZ A;  3M62 B;  1RYJ A;  5E6N A;  2YLM A;  2LZ6 A;  1ESF A;  3V3X A;  3PLU A;  2AQ3 B;  2PEA A;  3B2F A;  1L0X B;  4HRS A;  2JQR B;  2JU6 X;  1IYF A;  5EE3 A;  2UWQ A;  3IVF A;  3N20 C;  1QOA A;  1FM0 D;  1WJ6 A;  2CJN A;  4MT5 A;  4HJG E;  3N32 A;  1YD8 U;  5AUI A;  1SF0 A;  1WYW B;  3P4P B;  3BZD B;  2ZCB A;  2Z0E B;  1K50 A;  4BBN C;  1WY8 A;  3BIN A;  2OHF A;  3AN1 A;  1YMH E;  1XEE A;  4OHJ A;  4YXD B;  2LGX A;  3HRD D;  1SE3 A;  1C3T A;  3M95 A;  4C7Z A;  4DWF A;  4W9I A;  2KAN A;  2FE8 A;  3NY5 A;  3L16 A;  2R2O A;  3N30 A;  5AZF A;  1MFW A;  2BB5 A;  3QJZ A;  2J4X A;  2QIL A;  4H2A A;  2NBV B;  1SB3 C;  1H4R A;  2ASQ A;  2PTL A;  2L3Z A;  1V8C A;  1KOT A;  1QF6 A;  4AS1 A;  2BPS A;  3ALB A;  2AWT A;  2KNB A;  1L4D B;  3Q8F A;  4NJC A;  2YVC A;  1UEL A;  4REZ A;  4AOF A;  1V81 A;  2KD0 A;  4X57 B;  3KYD D;  1MJD A;  3P4S B;  1PYW D;  4JQW C;  2KTR B;  4IM3 A;  2DX5 B;  2J7Q B;  2LMC A;  1T0Y A;  4XZ4 A;  2WXR A;  1E8Z A;  3RYT A;  2FIF A;  1GUA B;  1E90 A;  3ETR A;  3LB8 C;  5CHW A;  4JE3 B;  1D5Z C;  1D3Z A;  3L4P A;  2VH1 A;  2LGY A;  5C3J B;  4DDI D;  4DHZ E;  3VUW A;  4M02 A;  2LRU A;  2BGF A;  1V86 A;  4KZC A;  4MH8 A;  1R4M B;  3U7Z A;  5MPO A;  2RPV A;  2KKC A;  1ZW7 A;  3ML9 A;  2WP9 B;  4HK2 A;  2KAJ A;  2D3G A;  5KHQ A;  4AP4 C;  3IAS 1;  4XDD A;  5TSS A;  4FAD A;  4K3B A;  4DQO C;  5J2R A;  3ZDM C;  2A5U A;  2ZNV C;  5L95 C;  2WGS A;  2OOB B;  3N9Y C;  3Q3F A;  3VVW B;  5E6J A;  4IWP A;  4JWS C;  3ZGZ A;  4GLS C;  3PZ7 A;  3RNG C;  4XDC A;  1YN4 A;  2L05 A;  3V61 A;  4WQO B;  4RH6 A;  1C9F A;  2DWQ A;  3E56 A;  3K9O B;  1FNU A;  2QC8 A;  5LXH A;  4MAC A;  3UF8 A;  1HZ5 A;  1Q5W B;  1ZGU B;  3TSS A;  2A4Z A;  2I1J A;  3GZN I;  4RF1 A;  4WJQ A;  2CR5 A;  2O6V A;  1WX8 A;  3HVD A;  2IY0 B;  2O2V B;  2GBK A;  4N59 A;  2K9X A;  1I4R A;  1HE8 A;  4GXB A;  4IUM B;  2VZK D;  3H6N A;  2XBB C;  3MC9 A;  1QZE A;  2O2V A;  3SR6 A;  1WGR A;  4LDT D;  1IBX B;  4WUR A;  2CU3 A;  4G50 A;  2FBW B;  3DDC B;  3DWG C;  4ICV A;  3AUL A;  4KSL C;  1YOV B;  1F0Z A;  1CQV A;  2NVU I;  1EO6 A;  3AE4 B;  1WXA A;  3A33 B;  2GI9 A;  2JZZ A;  4GIV A;  1D5M C;  3R8B A;  1J8C A;  2QIE B;  2MSE D;  3PRZ A;  3DBR I;  4R3D A;  2WXN A;  4N9F 4;  2HDE A;  2IGG A;  2LHE A;  4OZB A;  1NI3 A;  1QKZ A;  3OWE B;  4LTU A;  2WDQ B;  3H7P B;  1KM7 A;  4WQM A;  1HZ6 A;  3AE5 B;  2BYE A;  2L7R A;  4HKQ A;  2WXQ A;  4WH4 A;  4LCD E;  1C77 A;  1L0Y B;  4JPS A;  4W9J A;  2B3A A;  4I6N B;  1WZ3 A;  2L8J A;  1KLU D;  4KIK B;  3L10 B;  4W9D A;  4RFB A;  4W9K A;  2IY1 B;  5IN7 A;  3M63 B;  1FO4 A;  4P16 A;  1QOF A;  4II3 B;  4K1R B;  2WDT B;  3A4R A;  3UGB B;  2DEN B;  1WGD A;  1P98 A;  2JT4 B;  2XN9 C;  4GDL A;  5CX3 A;  1P9D U;  1JWU D;  4LNO A;  3TEZ A;  2JXT A;  4MGI E;  3X23 A;  1NBF C;  2K1F A;  3ZVV A;  2XK5 B;  1KRH A;  3DHH C;  4LK0 M;  2Y5B B;  2K6Q A;  5HFY A;  1UGJ A;  2INC C;  2MBB B;  3SFE B;  1LM8 B;  4BFR A;  5IO9 A;  1TKE A;  5AZH A;  3PT2 B;  3ZUN A;  4ANX A;  3PHX B;  3P1M A;  4BBN F;  4F7Z A;  1AAR A;  1DOY A;  1YX5 B;  1V80 A;  3U4E G;  3PPA A;  2WQY B;  1RWS A;  3DBL B;  2MWS B;  3L17 A;  3QA8 A;  4GGQ A;  2WU5 B;  3PS6 A;  3VTV A;  2QJL A;  2Y5P A;  1NYQ A;  1LGR A;  4NZL B;  3N1Y C;  3AM9 A;  1C1Y B;  2J53 A;  2I38 A;  3T8M A;  4MJS B;  4NAW B;  3A4S C;  4K81 A;  4LNK A;  1DOX A;  3RN9 C;  5C1Z A;  3AXC A;  3P42 A;  2FCN A;  1N5X A;  3OG5 A;  5HG2 A;  3FIL A;  3CWI A;  4HPP A;  1I4Q A;  4XX5 A;  3DBH I;  1FCC C;  2MA9 B;  2AL6 A;  2RDB C;  3EFC A;  1WE6 A;  1LFD A;  4XC2 A;  1LQB A;  1WM2 A;  3PRM B;  1UZX B;  4PS8 A;  1V5T A;  1FXA A;  2C7M B;  3OJ4 B;  3W1Y A;  3HM6 X;  4TUU A;  3PZD A;  4MGK E;  1VCB A;  1SGH A;  2EEL A;  3AED B;  4A8X C;  3ONS A;  2NCN A;  4ZYS A;  3AE9 B;  5HI1 A;  2C5L C;  3UIO B;  3NRZ A;  1QT9 A;  1T0S C;  2JYE A;  3ZLZ A;  3Q2A C;  1H8C A;  1Z2M A;  3EGR A;  1FXI A;  2KC1 A;  2AQ2 B;  2MW5 A;  2QSD A;  4PS7 A;  1K51 A;  2G4D B;  1LXD A;  1XD3 B;  1HA5 A;  2N9L A;  3AU5 A;  4XE0 A;  2W55 A;  3R3M A;  2WXF A;  4YSX B;  2CJO A;  1SE9 A;  1XLO A;  4PS3 A;  1P3Q U;  3ECI A;  2LFI A;  2INP E;  2MP2 A;  3PHW B;  2JPH A;  4N58 A;  4CQN A;  2KFK A;  2BW2 A;  1RM6 C;  2JZP A;  3Q69 A;  4ZHO A;  3W2D A;  3NOB A;  3AE3 B;  4AQ7 A;  4RM8 A;  3A9K B;  2J52 A;  1SE2 A;  2FUG 1;  4HDQ A;  4OW0 A;  4B0E A;  1B9R A;  3ZJT A;  1YN3 A;  1E7V A;  1TY0 A;  1T5X D;  3TIX A;  2D3C A;  3Q6B A;  4WWN A;  3I57 A;  4FA6 A;  2LXC A;  4LNI A;  2CKH B;  2BS2 B;  1F77 A;  1AWD A;  2WXL A;  1WXS A;  2FAZ A;  3TUO A;  4O1N A;  2K39 A;  1WJ4 A;  1Q0W B;  1I4X A;  5H8Y E;  2JWU A;  3T3O A;  1WX7 A;  4ZRQ A;  1ENF A;  3AMZ A;  3Q8B A;  3I63 C;  3KH0 A;  2KJR A;  2KFJ A;  2KTF A;  5KHO A;  1GOZ A;  4TMA B;  1C79 A;  3Q3M C;  3ZTD A;  3I5J C;  1MG8 A;  3QCA A;  3GZN B;  1GC6 A;  4YWG G;  1VR9 A;  2N9K A;  2O6V D;  4ZHP A;  3H1U A;  2MLB A;  2WWZ A;  4FJY A;  2V3N A;  1PQS A;  2IPK D;  4KDL B;  4IDI A;  4WJO A;  2BS4 B;  1P1A A;  1C4C A;  3D32 A;  2E3T A;  2M19 A;  3DPD A;  1OEY A;  4C00 A;  4I6L B;  1KF6 B;  2ZW1 A;  3VH3 B;  3VR8 B;  3C19 A;  3ZJV A;  1QQR A;  2J0K A;  2K5P A;  3FAH A;  3VRA B;  1SXT A;  2KZR A;  2X38 A;  3ZNG C;  5DPS A;  2D07 B;  2ICI A;  1SSN A;  1G6J A;  3JSV A;  1WGY A;  3WAN A;  2IGH A;  2VH2 A;  4N6E B;  5J17 A;  3BVZ A;  1E7U A;  2Z8L A;  3VQI A;  1UWM A;  2XNA C;  1NVI D;  1XXG A;  2JWZ A;  2KWD A;  2ZZP B;  4DHJ B;  4HCN B;  1WI0 A;  2G45 B;  2WXI A;  4NNJ B;  3VAW A;  2LJI A;  3CSF A;  4M0W A;  2WXJ A;  2KLC A;  4L23 A;  2KWV B;  3JVZ X;  3VTU A;  2R61 A;  1E7P B;  1ET6 A;  4ZOH C;  1MPE A;  4WJN A;  1FRR A;  2GLS A;  3BYT B;  3Q8C A;  4K3C A;  3UQA A;  1LO5 D;  4KSK C;  5IA7 A;  3ZW3 A;  4P1C C;  2QEJ C;  1GAQ B;  2KDF B;  2KMM A;  1JCK B;  3NUH B;  3U30 A;  4BOZ B;  3BK1 A;  1FRD A;  4DK5 A;  3DBL I;  3LJ3 A;  3L54 A;  3I9V 1;  1VDV A;  4HLE A;  1B1Z A;  1WRD B;  3JYU A;  3DBH B;  3SHQ A;  5DPW A;  4ANW A;  3AE8 B;  3EHV A;  2JVC A;  4LNF A;  3Q3N C;  2MJ3 A;  5D2M B;  3SDL C;  3WAP A;  4ARC A;  1E8X A;  1OTR B;  2D3B A;  1I4H A;  3RCZ A;  2GB1 A;  4GMV A; 
#chains in the Genus database with same CATH homology
 1FEH A;  3SR6 A;  2L83 A;  1XF5 L;  1L6U A;  2PW9 A;  4EE2 A;  1JW9 D;  3TEW A;  3AE7 B;  1IBX B;  1F2R I;  4WUR A;  3SFD B;  2CU3 A;  2FBW B;  3B9J A;  2PKO A;  1AW7 A;  2MJD A;  3TEX A;  1WRI A;  3ZYY X;  4LLG M;  2WXM A;  3IT4 B;  3DWG C;  3HUI A;  1NYR A;  4KGS A;  4DXF A;  4KKI A;  2VZK B;  1F0Z A;  3MJ5 A;  1RFK A;  1IGC A;  1CQV A;  1WGK A;  3GP7 A;  3AB5 A;  3AE4 B;  5FR3 A;  4IKG A;  3CIR B;  1SE4 A;  2GI9 A;  1HXY D;  2KN4 A;  1D5M C;  3R8B A;  2QIE B;  2PIA A;  1AN8 A;  4R3D A;  2BYT A;  2PMV A;  3KWL A;  4KGR A;  5BYR A;  3EUB 2;  2WXN A;  5C2T B;  2HDE A;  2IGG A;  2LHE A;  4OZB A;  1NI3 A;  1QKZ A;  3OWE B;  4LTU A;  2WDQ B;  2RMM A;  2H89 B;  2MEK A;  4WQM A;  1ROE A;  1TZO A;  5GXG B;  3TEY A;  3NVY A;  1JRP A;  1HZ6 A;  2K22 A;  3AE5 B;  1V1P A;  2Y3A A;  2BS3 B;  4HKQ A;  1V1P B;  2WXQ A;  5D7G A;  1FCL A;  4WH4 A;  3AV8 A;  4L2Y A;  2NTS A;  2E6X A;  1C77 A;  1L0Y B;  3AEA B;  4JPS A;  5BYQ A;  4FXC A;  4DXG A;  4US8 A;  1KLU D;  3AH7 A;  1YJI A;  2M0A A;  1A70 A;  4RFB A;  1EM7 A;  1PGB A;  1YQ3 B;  4XWT A;  4A6Q A;  1D6E C;  1J7B A;  1V97 A;  4US9 A;  2G9H D;  1ET9 A;  3H8H A;  3EA6 A;  2ZW0 A;  1ZE3 D;  2JSV X;  3ABV B;  4P16 A;  1HEZ E;  1SJE D;  1FO4 A;  1QOF A;  1TS5 A;  1XCT L;  3RPF C;  2M56 B;  2PVG C;  5T8I A;  1YNT E;  2RDG A;  5BYS A;  3AEF B;  1EU4 A;  1QOB A;  2XN9 C;  1C78 A;  3W9C B;  1JWU D;  4YT0 B;  3TEZ A;  2JXT A;  1NEK B;  1IBX A;  1TJE A;  3J9C A;  3RFZ B;  1CJE A;  1KRH A;  4LK0 M;  3R2T A;  2PVO D;  4WIP A;  4RF0 A;  2K0P A;  5HFY A;  1OQQ A;  1UGJ A;  1JML A;  5FKA C;  4ARI A;  4RGM A;  3SFE B;  1N62 A;  1Q10 A;  1TKE A;  1VJK A;  1ACC A;  3ZJU A;  1XLP A;  2SAK A;  1WXQ A;  1QLB B;  5G5H A;  2TSS A;  3BII D;  1KLG D;  1V1O A;  1DYQ A;  4ITK A;  3O13 A;  3P1M A;  5D3D A;  4YTM B;  1E9M A;  1ZDV A;  3VRB B;  2W3R A;  1DOY A;  1C4A A;  2OED A;  2D5G A;  3U4E G;  1J7C A;  2ON8 A;  2WQY B;  1RWS A;  1XO3 A;  2I2Y A;  1STE A;  2WU5 B;  3NVZ A;  4KX6 B;  2RDH A;  3Q8E A;  2QJL A;  2Y5P A;  4WAF A;  1NYQ A;  2WXH A;  1F2R C;  4NZL B;  1VZ7 A;  2YEP B;  3AM9 A;  3NVV A;  1DGJ A;  2I38 A;  2J53 A;  2LHD A;  4RNA A;  4NAW B;  4A9A A;  2DYO A;  1DOX A;  1IUE A;  1ZUD 2;  1TS4 A;  1XCQ L;  2WDR B;  3UI3 A;  3P42 A;  4HKZ E;  3KQ4 A;  3FC4 A;  1R7S A;  3P63 A;  4KGT A;  1N5X A;  3WCQ A;  2IGD A;  5HG2 A;  1SJH D;  3FIL A;  1I7H A;  1N63 A;  1ZPS A;  2WNM A;  3CWI A;  1ZP0 B;  3P4Q B;  1I4Q A;  1FFV A;  1FCC C;  2BB6 A;  1JQ4 A;  4OZA A;  1JWM D;  1FFU A;  1T6B X;  1YJJ A;  2KDM A;  4A55 A;  4JWU C;  1VLB A;  3VR9 B;  1CZP A;  1PGA A;  2MJE A;  1TYG B;  1MVK A;  3AEC B;  1MHX A;  3BVM A;  1FXA A;  3NS1 A;  1TKG A;  2W82 A;  5JXV A;  4TQ0 A;  4PT5 A;  3MP9 A;  1VZ8 A;  1C76 A;  2NMQ A;  1ZXH A;  2Q5W D;  2GRI A;  4HEA 1;  1ZOY B;  2JX5 A;  3AED B;  2EEL A;  1MHH E;  4A8X C;  4OZC A;  2ONQ A;  3BK2 A;  4ZYS A;  4IOI E;  3AE9 B;  3HVZ A;  1TKY A;  2LEK A;  5HI1 A;  2V3P A;  3NRZ A;  4ZRP A;  3GS2 A;  4WWM A;  1FIQ A;  1QT9 A;  2JYE A;  4YTN B;  1GB4 A;  5G5G A;  1FD6 A;  1L0V B;  4OVZ A;  1J7A A;  3AE6 B;  3EGR A;  3AEG B;  1FXI A;  3LYY A;  4GDK B;  2AQ2 B;  2QSD A;  3W1S A;  3DWM A;  2J42 A;  2LUM A;  1K51 A;  1OQR A;  1WSP A;  3Q8A A;  2WLB A;  2WS3 B;  2K3U A;  1BXT A;  5EE1 A;  3LXF A;  1HA5 A;  3E9S A;  4YSY B;  1N60 A;  1P7E A;  2N9L A;  4XE0 A;  1N61 A;  2H88 B;  2W55 A;  4JX1 C;  1PGX A;  4L1B A;  2WXF A;  2BBC A;  4YSX B;  2IDY A;  4KKJ A;  2CJO A;  5LNK 1;  5BMH A;  1XLO A;  3T3N A;  5I4D A;  2V4I B;  1XLQ A;  1K52 A;  1RYJ A;  1SEB D;  1QOG A;  3R2I A;  1JWB D;  2LFI A;  3FIL B;  2INP E;  2QMT A;  3ZQ4 A;  4XWW A;  2WDV B;  4N58 A;  1EWY C;  2N7J A;  4CQN A;  1ESF A;  3V3X A;  2IJ0 A;  2AQ3 B;  2BW2 A;  4TQ1 A;  1JAL A;  1RM6 C;  3B2F A;  2JZP A;  3Q69 A;  1L0X B;  4ZHO A;  2L52 A;  4HRS A;  3W2D A;  2JQR B;  2JU6 X;  5EE3 A;  3AE3 B;  4AQ7 A;  2DLB A;  1QOA A;  2J52 A;  2FUG 1;  1FM0 D;  1BML C;  1SE2 A;  2NTT A;  1DOI A;  2CJN A;  4MT5 A;  4HJG E;  1KFY B;  4OW0 A;  4B0E A;  1B9R A;  3C8Y A;  1WWT A;  3ZJT A;  4RCO A;  5AUI A;  1ZDX A;  1ZXI A;  1YN3 A;  2WXG A;  2B76 B;  1SF0 A;  1TS3 A;  1T5X D;  1TY0 A;  1PDX A;  4D2K A;  3I57 A;  3P4P B;  3BZD B;  2BS2 B;  1K50 A;  3MFG A;  1F77 A;  1AWD A;  3PO0 A;  2WXL A;  5HHD G;  3TUO A;  5H92 C;  3W5U B;  2OHF A;  3AN1 A;  1YMH E;  1XEE A;  4OHJ A;  1MI0 A;  4O1N A;  4YXD B;  2BTE A;  1WYG A;  3HRD D;  2W54 A;  4C7Y A;  4RGT A;  1YQ4 B;  1SE3 A;  2DYM A;  1I4X A;  5H8Y E;  2JWU A;  3T3O A;  4ZRQ A;  1ENF A;  1UWX A;  1D5X C;  2Y5C A;  1KTK A;  3AMZ A;  3Q8B A;  1JWS D;  5EE9 A;  4RGN A;  4C7Z A;  1VZ6 A;  2DBY A;  1GOZ A;  4TMA B;  3BVG A;  1C79 A;  2FE8 A;  3KWV A;  3V05 A;  1M4V A;  2JYT A;  2BB5 A;  2J4X A;  2QIL A;  2AX5 A;  4H2A A;  5FK9 C;  3PZ8 A;  1SB3 C;  2WXO A;  4YWG G;  1IGD A;  1VR9 A;  2PTL A;  2N9K A;  1EWC A;  4GDL B;  1L6V A;  1V8C A;  4ZHP A;  3W5V B;  1QF6 A;  4AS1 A;  3AEB B;  2V3N A;  1D4B A;  1L4D B;  2IPK D;  3IAM 1;  3Q8F A;  4NJC A;  4P6V F;  4IDI A;  1CK1 A;  1E10 A;  2BS4 B;  2HTM E;  4REZ A;  2N0S B;  2L32 A;  3AE1 B;  3U52 E;  1PFD A;  2EKI A;  1C4C A;  1P7F A;  2E3T A;  2M19 A;  3P4S B;  1PYW D;  2WXK A;  2LMC A;  1E6E B;  3NVW A;  3U2S C;  2WXR A;  2BT6 A;  4C56 C;  1KF6 B;  2ZW1 A;  2YEP F;  3VR8 B;  1BUI C;  4B0M A;  3ZJV A;  1QQR A;  1SBB B;  2K5P A;  3FAH A;  1TS2 A;  3VRA B;  3ETR A;  1SXT A;  3LB8 C;  2L1A A;  2X38 A;  2V0G A;  3URY A;  3AEE B;  4JE3 B;  4J3O D;  1D5Z C;  2ICI A;  1SSN A;  1JWA D;  3L4P A;  1C4P A;  5BMG A;  1L5P A;  3NZ3 A;  2IGH A;  5C3J B;  3KLS X;  4N6E B;  3IXS A;  1E0Z A;  1T3Q A;  1GPX A;  3BVZ A;  4MH8 A;  2Z8L A;  3U7Z A;  5MPO A;  2RPV A;  3VQI A;  1YN5 A;  1UWM A;  2SEB D;  2XNA C;  4C80 A;  1NVI D;  1XXG A;  2WP9 B;  2KAJ A;  1NEN B;  2KWD A;  1XLN A;  3IAS 1;  4XDD A;  5TSS A;  2WXI A;  4DQO C;  2LJI A;  1HQR D;  4M0W A;  2WXJ A;  4L23 A;  1N5W A;  1VRA B;  3AE2 B;  2R61 A;  1GB1 A;  1E7P B;  1ET6 A;  3BYY B;  1MPE A;  4ZOH C;  3MHZ A;  1FRR A;  3N9Y C;  1KH0 A;  3BYT B;  2W3S A;  5E6J A;  2PLP A;  3Q8C A;  4JWS C;  4YTP B;  3GB1 A;  4GLS C;  3PZ7 A;  3SEB A;  3ZGZ A;  1FNV A;  1LO5 D;  4XDC A;  1SIJ A;  1YN4 A;  4Q2J A;  4NAM A;  4USA A;  4TSS A;  3B2G A;  2QEJ C;  4MM3 B;  4RH6 A;  4A90 A;  1GAQ B;  1C9F A;  2DWQ A;  3E56 A;  2KMM A;  3IT6 B;  3P4R B;  1L4Z B;  1FNU A;  4HRO A;  1JCK B;  1FNW A;  4MAC A;  2KQ4 X;  1FMA D;  4RGO S;  1UUP A;  4UDU C;  2G1E A;  3NUH B;  1HZ5 A;  1TY2 A;  3BK1 A;  2ACZ B;  1FRD A;  2MH7 A;  1K53 A;  3TSS A;  1OFF A;  2AQ1 B;  2WU2 B;  5AUK A;  3I9V 1;  1VDV A;  1B1Z A;  1JRO A;  4YSZ B;  1UNS A;  3AE8 B;  4RF1 A;  3HVD A;  2LGI A;  3MC0 B;  2INN E;  4N59 A;  1I4G A;  2MJ3 A;  2KAC A;  2K9X A;  1QIL A;  1I4R A;  1I4P A;  1PUT A;  5EE0 A;  1AYF A;  1Y56 A;  2WXP A;  3BWU D;  4ARC A;  1EU3 A;  5D3I B;  2VZK D;  1I4H A;  5BMI A;  2GB1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...