1YN3A

Crystal structures of eap domains from staphylococcus aureus reveal an unexpected homology to bacterial superantigens
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
98
structure length
98
Chain Sequence
GSTVPYTITVNGTSQNILSNLTFNKNQNISYKDLEGKVKSVLESNRGITDVDLRLSKQAKYTVNFKNGTKKVIDLKSGIYTANLINSSDIKSININID
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title The Crystal Structures of EAP Domains from Staphylococcus aureus Reveal an Unexpected Homology to Bacterial Superantigens.
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Toxin, protein binding
molecule keywords truncated cell surface protein map-w
total genus 32
structure length 98
sequence length 98
chains with identical sequence B
ec nomenclature
pdb deposition date 2005-01-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03642 MAP MAP domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.120 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1yn3A00
3MFGA 1D5ZC 1D5XC 3O13A 1BXTA 1TY2A 1L0YB 1I4RA 1YN3A 4O1NA 1SE4A 1STEA 1YN4A 1AN8A 1TS3A 3BZDB 1I4HA 3W2DA 2QILA 1TS5A 4RGMA 4RFBA 1V1PB 4UDUC 3URYA 3KLSX 1ENFA 1JWMD 3BYYB 1I4PA 1TY0A 3BVMA 1I4XA 4RH6A 4TSSA 1AW7A 1EU3A 1D6EC 1PYWD 2TSSA 4RGNA 3BVZA 2J4XA 1SBBB 3OWEB 1SEBD 4RCOA 5FKAC 3SEBA 2AQ2B 5D3DA 3EA6A 1SJED 1T5XD 1SXTA 2AQ1B 4DXFA 1V1OA 2RDHA 3R2TA 4NZLB 1EWCA 1HA5A 2AQ3B 3R8BA 1QILA 4RGOS 1KTKA 1JWUD 3R2IA 1FNWA 1DYQA 1L0XB 1SE3A 5D3IB 1UUPA 2XN9C 1KLUD 4DXGA 2NTTA 1D5MC 1SE2A 5I4DA 1LO5D 1FNVA 1TS2A 2NTSA 2RDGA 3MC0B 4OHJA 1V1PA 3V05A 1ESFA 3BYTB 4C56C 1SJHD 1ET6A 2ICIA 3GP7A 5FK9C 2R61A 1YN5A 1XXGA 1FNUA 2IPKD 3TSSA 1JWSD 1GOZA 5TSSA 2XNAC 2G9HD 1CK1A 1B1ZA 2QEJC 1UNSA 1M4VA 1F77A 1JCKB 1I4QA 1KLGD 2IJ0A 1HXYD 1TS4A 2Z8LA 3BVGA 4RGTA 1EU4A 4ZYSA 1HQRD 1ET9A 1I4GA 2SEBD 1CQVA
chains in the Genus database with same CATH superfamily
3NVWA 4WURA 5IAAC 4ARCA 2W9NA 1D5XC 1PGXA 2HDEA 1ZE3D 2KVZA 1QOBA 3ZGZA 1N60A 1WX9A 4WH4A 1TS3A 1LQBA 1I4HA 2IGDA 1E8ZA 4YSYB 2DNFA 3BYYB 2LD9A 2EKEC 1OFFA 1T0RC 3Q8BA 1E9MA 1OQQA 4MSMB 1P7EA 3N1YC 1R4NB 2KT7A 2KTFA 2L00B 4CHKA 3W1SA 2K9XA 2OEDA 4K7SA 1WRDB 4JX1C 3ZJTA 1ACCA 2K3UA 2PE9A 2FIDA 3QHTA 3AE6B 3R8BA 3B1LX 2K1FA 2W3RA 3RNEC 1V2YA 4WJOA 3A9KB 3CSFA 2JUOA 1V8CA 3U8ZA 1FNVA 4ZRQA 3Q2AC 2WU2B 2E6XA 2MRPA 4TKNA 1N63A 3MJ5A 5GXGB 4RM8A 1DGJA 4BZAA 4HPLB 4W9CA 2R61A 2IPKD 2ON8A 2L76A 4L23A 2MP2B 2KC1A 3Q6BA 3DBSA 2M0XA 1WWTA 2WDRB 3FKYA 2BT6A 4MGZE 2BTEA 2MP2A 4ASWC 3SR6A 3OLMD 2WXRA 2O2VB 1ET9A 4P1BC 2KWVB 2O6VD 1C78A 4QAYA 5IKCM 3ALBA 2V9HA 3V61A 1QQRA 1SE9A 2HE7A 5G5HA 4MSQB 1E8WA 2V3SA 3QQ8B 4K7UA 2J0MA 3DDCB 1WX7A 3VFKA 2QHOA 3JVZX 1QT9A 3QWZB 4WAAA 1WXSA 1JWMD 4BVUC 2JT4B 2WXHA 1WM3A 2ONQA 1KJTA 1UWXA 4TSSA 1UGJA 1J7CA 1AW7A 2XK5B 3H9DA 4K1RB 3AU5A 2BS3B 3ZNID 2BYEA 3KWLA 4BOSC 2I1JA 1XCTL 3AE8B 2Z59B 4GSWA 3ONSA 2LXAA 2G4SA 4CO7A 3R2IA 1PFDA 1PQSA 1KLUD 4NJCA 4DXGA 2KYWA 5AUIA 1WFYA 3K9OB 3L13A 3Q14C 1JQ4A 4GGQA 3W1SC 3N3KB 4YL8A 2MSED 4M00A 4R3DA 5BYSA 2G3QB 4IW0A 1M4VA 1P98A 1VD2A 1ROEA 1EWYC 1QOFA 4RGTA 3P1MA 3K9PB 2WXNA 2ZVNA 3ZXRA 3AEAB 4BKTA 2K5PA 2MH7A 3AE1B 3KQ4A 4WWOA 4GLSC 4FXCA 4BOZB 1JWBD 1YOVB 1T0SC 5BO4B 4XYCA 2D5GA 2YVCA 2GI9A 3ABVB 4ZOHC 4WQMA 3H8HA 3B2FA 2KQSA 4A20A 3ZDMC 1GG3A 4ACFA 2REXA 1L4ZB 1H8CA 4XX5A 1J8CA 3RNAC 1E8XA 1F2RI 3RNFC 1PGAA 1C4PA 1EO6A 2PW9A 4E71A 4ZHPA 4ZYNA 1WE7A 1J0GA 1D6EC 1WF9A 2WX0A 4KZ0A 1PYWD 1WZ3A 3MJWA 1JALA 4I6PA 2J4XA 4ZRIA 5LNK1 5JH5C 3DVGY 1GC7A 1LM8B 5D3DA 3RFZB 2K6QA 3AV8A 1F1HA 2J42A 3MP9A 4TQ0A 4JGHB 1L2NA 2KFKA 2PMVA 2DHZA 4M01A 1YX6B 2DWQA 4YTPB 2HJ8A 2WXPA 3CMMB 2JVCA 3RYTA 3UQAA 5BYRA 2NBVB 2KACA 1IPGA 3EFUA 1WGGA 3PLUA 3VTUA 1ET6A 5FK9C 2JXTA 3KH0A 2BGFA 4JWUC 4XGAB 1J7AA 2KO3A 1YIWA 3WANA 3J9CA 4IWOA 2CKHB 1WXMA 4ITKA 4DHZB 3ML9A 1F0ZA 2N4FA 2X38A 1I4GA 4MJSB 4M0WB 4KGRA 2CU1A 1SB3C 3AE2B 5KHOA 1MPEA 3T9LA 3A9KA 2ACZB 2L3ZA 2X8XX 3M62B 2IDYA 1I4RA 3NZ3A 1WZ0A 3GOEA 4URKA 3I3TB 3A1QB 3A33B 3NHEB 1TKYA 3C8YA 1YQ3B 1WMHB 2MW5A 2INPE 3JSVA 3U52E 4NJ7A 1A70A 1V1PB 5EE1A 2MJDA 3NZSA 4USAA 3BIID 4DHZE 4EEWA 1V97A 3HVZA 2D3CA 4RH6A 2JZ3B 4KX6B 4G3XB 1CZPA 3MC8A 1ZP0B 2LVQA 2NPTB 3PS6A 3MTNB 1SF0A 4WJPA 1KRHA 4YXDB 1JRPA 4EZKA 4FA6A 5L83A 2A5UA 2OOBB 2AQ2B 2CHWA 2W55A 2KDBA 1TZ1A 5EE0A 4YTMB 4S0RA 2RDBC 3ZW3A 4GN1A 4L2YA 1J19A 2NTTA 2AL3A 4EKUA 1UBIA 2DZIA 1ZUD2 2NCNA 1XLNA 4W9JA 4WJNA 4KDLB 4JPSA 4K7WA 1FNUA 1OTRB 1GOZA 2H88B 5C23A 3DHHC 4N6EB 1RAXA 3DBLB 4A8XC 1Q10A 1F9JA 1I4QA 2JX5A 2WXKA 3HK0A 1TTNA 2KLGA 4NAWA 2FNJB 1ZKHA 3N1XC 4MDKE 3LDZE 3DVNU 2ZJDA 4IDIA 1E5WA 1DYQA 3QARA 3TEXA 5AUKA 1TT5B 4B95A 3DOWA 2DENB 3ZLZA 3U30A 2C7HA 4C80A 1TY2A 1D4BA 3RT3B 5HG2A 2IYDB 3DHGC 2JYTA 3NY5A 4G11A 2LVOA 4K81A 5D94A 1C79A 1RFKA 1UD7A 2I2YA 3AN1A 4K3CA 2ASQA 2NBUA 4E3CA 1YN4A 3JYUA 2QILA 4RGMA 3AB5A 2D10A 1K52A 3VXWA 4GDKA 1WGRA 3N1ZC 4GOCA 1WSPA 4KKIA 4BKSA 4MT5A 1EU3A 2D3GA 3NJTA 2MBQA 2KAJA 1B9RA 3QX1A 3DCGA 1E6EB 2MQJA 5G2NA 1EM7A 2O2VA 3NVYA 1Z5SB 2D11A 3EA6A 1T5XD 1WGYA 4DXFA 2IBIB 3C0RB 3DBLI 5HHDG 2BB6A 1UZXB 2GLSA 4RGOS 3R7QA 3HHMA 3AULA 3ZKJC 2GMIC 3QAQA 2LMCA 2N1VA 1SE3A 3AEBB 3Q3OC 4XZ4A 1WJUA 3IVFA 2XN9C 1C9FA 5FR3A 1D5MC 1SE2A 1DOYA 5I4DA 1L7YA 2W3SA 1QOAA 3ZTCA 5IOIA 2D3BA 3WAMA 5BMHA 3A4SC 4LNKA 3DBHB 5HI1A 5FR6A 2ICIA 1WMHA 3AH7A 5LXHA 1L0VB 2EMTA 4AOFA 1TZOA 2DZKA 2MJEA 4NAWB 4PT5A 4WIPA 2IJ0A 2K0PA 4HRSA 4M8NA 2LHEA 3Q3MC 4MGYE 4AP4C 3MHZA 2JF5A 3MFGA 4NY0A 1J7BA 1D5ZC 1WJ6A 1RLFA 1FCCC 5GMVA 4JLCA 1WXQA 4W9LA 4MH8A 3APFA 4DXAB 4ZRPA 2WWZA 4AQ7A 3R7RA 2FE8A 3GE8C 3N20C 5BMGA 1LXDA 3VH3B 2OHFA 1N62A 3ZVVA 3EUB2 1UELA 1UF0A 3M95A 4ZRJA 3TEWA 4HCPB 3RULA 4ANWA 5DPWA 3PHWB 4OW0A 2IGGA 4TQ1A 3SEBA 5IA7A 2RSUA 3NG0A 3AI5A 1R4NI 1HZ5A 1HZ6A 2C9WB 1V49A 1YX5B 2KK8A 4W9FA 2D2QA 1FFVA 3NVZA 1LO5D 4LCDE 4HKZE 3QIJA 1L6VA 2BWFA 3U4EG 1WX8A 2WP9B 2K8HA 4C00A 1GC6A 3N30A 1V6EA 3V05A 1SIJA 2O6VB 4N59A 3DQVA 1OEYA 2QEJC 2YLMA 4A90A 4GDLA 1WYWB 3PO0A 1SGHA 1EU4A 5IN7A 4OVVA 3HUIA 3I57A 4BAXA 4WWPA 4II2B 1V86A 2D07B 2JWUA 4EUTA 1CQVA 1OQYA 1WE6A 2W54A 2Q5WD 2HTHA 2KNBA 3BY4B 1WY8A 1WJNA 3X23A 3RNGC 3ZRFA 4KDIC 4G50A 3P4RB 2LGDA 3Q8FA 5E6JA 2Z0DB 3PRMB 1I4PA 3RUIB 1TGZB 4C7YA 5EE3A 3RN9C 4IG7B 5DCNA 4PS3A 2FUG1 2LZ6A 2LGSA 2YEPF 1MHXA 2BS2B 2ZCBA 3RCZA 2MBHA 1C77A 2BW2A 4RCOA 1XT9B 2WXOA 2WDVB 2RD0A 3CF6E 3UGBB 2DLBA 3Q8AA 2PPHA 1HA5A 2B76B 4XDCA 1P7FA 3HRDD 1XLOA 3IXSA 4W9EA 2I1KA 5H8YE 2XK5A 2M17A 3AM9A 4FJVB 2RDGA 4A3PA 2J53A 4MH0E 1UBQA 1V1PA 1ZDVA 2WS3B 3I9V1 4M0WA 3B2GA 2FIFA 1MHHE 4LJOB 3GP7A 4HWIB 3QCAA 4LTUA 5TSSA 1YQ4B 2AEHA 4PS8A 3ZTDA 3FC4A 1C4CA 5BMIA 3AECB 1Z2MA 3V6EB 3V62A 1QOGA 1TS4A 2JPHA 2IGHA 4DDGD 4OVZA 1QLBB 2JYEA 2CJNA 2WDTB 3GZNB 3VTWA 2FAZA 3JSVB 1VR9A 2ZW1A 2SEBD 5CTRC 4ANUA 3RNCC 3QA8A 3QJZA 2DZJA 4WQOB 4LNFA 1BMLC 2LFIA 2RPQA 2LRWA 3NUHB 4C7ZA 3Q8EA 4A9AA 1YNTE 3VAWA 4HPPA 3P42A 3L0WB 1STEA 3A9JB 3PVLA 5AZHA 3URYA 3AU4A 1C3TA 2N9PC 2MA9B 3M63B 1L5PA 3OJ4B 3T3NA 3AEEB 2L0FA 2N7JA 2DYMA 5J2RA 3H1UA 2KC2A 1HE8A 1NYQA 1VLBA 3AE3B 3GZNI 4IOIE 3OWEB 5EE9A 2MBOA 2KWUB 4EFOA 2Z0EB 1K50A 3AE5B 3BK2A 4FULA 2DAFA 1U4AA 1QILA 2J0JA 2Y5PA 1XD3B 2E3TA 3BK1A 3O65B 2HD5B 1WGKA 1JW9D 1YJJA 2WXJA 3D32A 2WXLA 3KUZA 4N58A 3WCQA 4CYEA 1E8YA 2NTSA 4C4VA 3ZDTA 4DDID 4GDLB 2LRUA 4WWMA 3BYTB 3KYCD 2KX0A 2L1AA 3EECA 4LNOA 1K8RB 1RRBA 1UH6A 2KJRA 2LVPA 3ZIMA 5G55A 3VR8B 3TEYA 2DAJA 3ZQ4A 1VJKA 4MGIE 1FEHA 2UWQA 5HKHA 2K25A 3OJ3A 2NVUI 5HFYA 5JHAA 3IHPC 2WGSA 4HKQA 2WNMA 4KKJA 3QC8B 5IO9A 2G45B 3IT6B 4NQKE 1WGHA 3PRZA 4F7ZA 4W9IA 1I42A 1E7PB 2R2OA 4RFBA 2WLBA 3KLSX 3RD2A 4DK5A 1QZEA 3QK0A 1Q0WB 3V6CB 3BVMA 2KKCA 1N61A 2FCSA 2MJ3A 2I38A 3TIXA 4KV2A 1NEKB 1NVID 3N32A 5FKAC 1KLVA 3WIMA 1FCLA 3IT4B 3BINA 3ZJUA 3PRPB 3Q3FA 3IAM1 4BBNF 1JWUD 5DPSA 3WAPA 2BQQA 2M8SA 3AEGB 4GXBA 1OEYJ 1K53A 2D3AA 1TJEA 2AYOB 1AARA 3Q69A 3RMKC 1AWDA 2HJ1A 2QIEB 3NS8A 1XCQL 1WR6E 4ZDVA 3H7SA 4LK0M 3BWUD 1SJHD 1XQQA 1T6BX 3M3JA 3TSSA 2KDEB 2LWPA 1GPXA 1V5OA 4HK2A 1B1ZA 3U2SC 1UWMA 1ZDXA 2LUEA 1ZGUB 4A3OA 1DOXA 5IP4D 1FXTB 4P7IA 4LDTD 2ZCCA 2WU5B 2M19A 3KUCB 3JW0X 1GB4A 2M0AA 2IO1B 3IAS1 4IM2A 2QCZA 4YSXB 5D2MB 3VH4B 1IYFA 4GDKB 3FILA 3ZO5B 1YN3A 1FO4A 1GNUA 4O1NA 4P16A 4PS7A 1BT0A 5LLIA 2RMMA 1KH0A 3DWGC 2IO3B 2QMTA 1TKGA 3NS1A 2JWZA 1YQBA 3S2AA 3TL5A 5JHBA 1TBEA 2KN4A 2CHXA 4LDTB 2GBRA 3KWVA 3EHVA 3SD5A 1YJIA 2N9EB 4AWJA 2Y3AA 1X1MA 3SDLC 3A1QA 3NZUA 2PIAA 3L17A 2LGXA 3GE3C 3L08A 1V80A 1ZOYB 5AEKB 4L1BA 2AQ1B 2XBBC 1WXAA 1EWCA 5JXVA 4IC7B 4MACA 4FJYA 1I7HA 1L0XB 3UINB 2OJRA 3W5VB 3WA0A 3NOBA 4B6WA 2DX5B 4IWPA 4N9F4 4LNIA 3PGEA 4HDQA 1FD6A 5EDSA 4RF0A 1IBXA 5KHQA 4FHKA 4A6QA 2KD0A 1JWSD 1ZPSA 3T3OA 2MCNB 1AYFA 1UNSA 2K39A 3FILB 1NENB 2PLPA 4HVBA 2GBNA 4W9HA 1LFDA 4HJGE 2FCMA 1HXYD 2L7RA 2IO0B 1EUVB 2GRIA 2N0SB 3CIRB 3DBRI 4FBJB 1V81A 1TKEA 1VDVA 2KDFB 3KUDB 5J18A 2MX2A 5DPRA 3LB8C 2R2QA 4Q2JA 4A55A 1FRDA 3ZNGC 1VZ6A 2BB5A 4FHJA 4P1CC 2KMAA 1HEZE 2Y5CA 4DBGA 4JIOU 3VQIA 1XEEA 3BZDB 5D7GA 1QF6A 2LEKA 2ZNVB 3W9CB 2N1WA 1KM7A 3TJPA 2INNE 3KYDD 2N9KA 3BVZA 4FADA 3AE4B 1SBBB 2H89B 2WXGA 3APDA 3LYYA 4DQOC 2BS4B 1P1AA 4HDOA 3PZ7A 2JU6X 3TMPB 1ZW7A 1R4MB 4II3B 3R2TA 2KOXA 4MEMA 1VCBA 2N7EA 1F52A 1IGCA 1KF6B 1GJZA 3E9SA 3AE7B 1UUPA 3DVNV 3NVVA 1NI2A 3HM3A 1I35A 2NS5A 4E74A 1MVKA 1FPYA 2J52A 4BFRA 2V4IB 1YMHE 2JSVX 2NBWB 2KWDA 5E6OA 1KOTA 1Y8RC 1MFWA 3I5JC 4X57B 2INCC 4S17A 2JY6A 1GUAB 2G9HD 3HVDA 1P9DU 3VRBB 1XLQA 4PYUA 2ZW0A 2BKFA 2FCQA 2Z8LA 5J17A 1FRRA 1HQRD 4LJPB 2WXFA 1C76A 3MC9A 2EMSA 4P6VF 4TMAB 5CHVC 3EGRA 2VZKB 2QDFA 4M8MA 2K8CA 4NNJB 1BXTA 2LXCA 2KFJA 4W9KA 1WI0A 3LXFA 1L4DB 2KMCA 3L16A 2Y5BB 2JRHA 1FM0D 3RZFA 1RM6C 3TBLD 3IFWB 2KFKB 2DBYA 5D6JB 3T8MA 1YD8U 3VRAB 2LUMA 3RZWC 4KGTA 1I4XA 1WR1A 1PUTA 1ZXIA 2DYOA 2KVRA 1Y56A 3UIOB 4NPNA 2CHZA 3A4RA 4RGNA 3P63A 4KIKA 2IZVB 1E90A 4PK1A 4KGSA 1NDDA 1E0ZA 3PREA 5H92C 1V1OA 4AJWA 3WALA 3RPFC 4AS1A 4HCNB 4J3OD 1KTKA 1VZ7A 1UGMA 2KLCA 2BWES 5D3IB 2ZNVC 2BVCA 4BKGA 2KDMA 3HIZA 2MLBA 1IP9A 2VH1A 2KWCA 4C4VB 3ENEA 4OZBA 3R3MA 4GU2A 3ZXVA 2UU7A 3DPDA 4GIVA 2CU3A 3DBRB 2MEKA 2L8JA 3ZRCA 2BYVE 3W5UB 4AJYB 1MG4A 4ICVA 3UF8A 2ZPNA 2BPSA 1CK1A 1KFYB 2PE6B 2G4DB 2RR9A 3HM6X 4DHJD 1ZXHA 2UYZB 5T8IA 4HPMB 3UQBA 5TR5A 2C5LC 3BVGA 3ETRA 4W9GA 4EE2A 3A9JA 1PGBA 2RGFA 1DOIA 1HTOA 2BYTA 1LGRA 4IWQA 1IBXB 4ARIA 2AL6A 4OZCA 1R7SA 3TEZA 3AMZA 1N5WA 2BYFA 3DWMA 4MELA 4W9DA 3ZYYX 4XWTA 1SE4A 2L83A 2BF8B 2CJOA 1TS5A 1C4AA 2O6VA 3PZDA 4ZHOA 4ANVA 2B3AA 5MPOA 3VR9B 2RPVA 1JROA 4F1SA 4KIKB 2TSSA 4JQWC 2M1MA 5C1ZA 4HLEA 4RM9A 1JWAD 1WXVA 2PJHA 2PTLA 4B9KA 2PVOD 2ZVOA 3EC8A 1SJED 2RDHA 2WXMA 1V9JA 4FN2A 2AQ3B 5DPTA 2KHWB 2K22A 2KMMA 2DYBA 1F2RC 3AEFB 1FXAA 3IG3A 3L4PA 3VDZA 2V3PA 5CHFA 4YSZB 1FIQA 2LI5A 1ISNA 4PYZA 3MC0B 4JWSC 4IUMB 2A4ZA 2PVGC 3VUYA 3APCA 3TCAA 1WYGA 1N5XA 2L0TA 4YWGG 2V3NA 1P3QU 3PPAA 4ZYSA 1EF5A 3PLVA 3WAOA 5AZGA 5E6PA 2VH2A 4MM3B 3H6NA 4JL9A 3PV1A 5G5GA 2EKIA 2V1YA 1MI0A 2NMQA 4TV3A 1MG8A 3KW5B 3W1YA 1IGDA 2J7QB 3U7DA 2PKOA 3B9JA 2K6DB 2SAKA 3NRZA 2FUHB 2KTRB 4NQLB 2KXJA 2GBKA 1OQRA 5AZFA 4YT0B 4OVUA 5C3JB 1EF1A 2IY0B 1E7UA 4ICUA 2JRIB 4IM0A 2C60A 2G1EA 3E56A 1E10A 3LJ3A 4HEA1 3DBHI 4NAMA 5BYQA 3V60A 3P2BA 2LJIA 4OZAA 3Q3NC 4J6IA 4YTNB 3PSEB 2KN5A 4LNNA 4EOYA 1S3SG 3GS2A 2WDQB 4H2AA 3VUXA 2BBCA 3ZUNA 2N9LA 4BBNC 1RWSA 1P0RA 3H7PB 1L6UA 3OG5A 2KJHB 2KTRA 2GOWA 2WQYB 1G6JA 3CSTA 1YN5A 4D2KA 2XNAC 3IBEA 2NR2A 1JRUA 4M02A 1F77A 2LHDA 2LGYA 1WH3A 2JXXA 2L05A 3B08A 5CX3A 4ANXA 1SIFA 4HXDA 3ZNZB 2MWSB 1VRAB 1NBFC 3B0AA 3I63C 4B0MA 4JE3B 4XC2A 3ZJVA 1TIFA 4LLGM 2QC8A 2GBJA 3AEDB 4I6LB 2IO2B 2KJ6A 1T3QA 2LJ5A 3P4PB 1JMLA 1NI3A 3O13A 5E6NA 1L0YB 2HTME 5CHWA 5L95C 1NYRA 4KSKC 3EFCA 2W82A 3ECIA 2WXQA 1IUEA 4FLHA 2PEAA 4IKGA 1E7VA 2LASA 2GBMA 1Q1OA 2MHJA 2VRRB 1AN8A 2J0KA 3R66C 2N9XA 1T0QC 1XO3A 1ENFA 2WHIA 1TY0A 3VUWA 2AWTA 2K8BA 3UI3A 2VZKD 1RYJA 1FFUA 2JQRB 2AX5A 1S1QB 3Q8CA 1XLPA 2ZPYA 3VTVA 4NJ6A 2MBBB 2BKRB 1FMAD 3GB1A 3L54A 4MM3A 4US8A 2L32A 1OGWA 3OAWA 1WRIA 3SFDB 3DHIC 2OJWA 1SXTA 4NZLB 1N6ZA 3PHXB 2KX3A 2DZMA 4KZCA 4XWWA 1M94A 1FNWA 3FAHA 2N7DA 2NPTA 2C7NB 4DHJB 3H7PA 3V3XA 2QSDA 4FJZA 1TS2A 2ZZPB 4XDDA 2V0GA 4RNAA 3VHTC 4OHJA 1TYGB 1Q5WB 1WIAA 1ESFA 2YEPB 2WX1A 3RI7C 2XEWA 1GB1A 4TUUA 3ML8A 3ZNHB 4GB9A 5LXIB 2KDIA 3X0WA 1KLGD 2M56B 4F8CB 3SFEB 1WM2A 1R4MI 1C1YB 2KQ7A 3P4SB 4MJSA 1T0YA 2KZRA 1WJ4A 2QJLA 2ZEQA 4EZLA 5JZEB 3AXCA 2CR5A 4ZRKA 2KQ4X 1CMXB 1A5RA 2MBEA 2C7MB 2EELA 1XF5L 2WYQA 2GB1A 3MHSD 3PTFC 4RMAA 1HTQA 3SU8X 1H4RA 4HJKA 5C2TB 3W2DA 3PZ8A 4XE0A 4UDUC 3VVWB 1YJ1A 4B0EA 2JZZA 2V4LA 2CS4A 4DWFA 1K51A 1FXIA 1CJEA 3CWIA 4CQNA 4AUQC 3SHQA 4BKSD 1VZ8A 1SEBD 4HROA 1BUIC 2JZPA 4K3BA 2IY1B 4IM3A 4WAFA 2INDC 2L52A 2FCNA 3UIPB 3U7ZA 3AE9B 3N9YC 4REZA 3DVGX 4KVGB 4MGKE 4G0NB 3C19A 1QKZA 3KVFB 1WGDA 4EZJA 4KSLC 2FBWB 4C56C 1XXGA 2M4NA 1GAQB 4RF1A 3Q3JA 2WXIA 4US9A 1V5TA 4WWNA 1JCKB 3RNBC 4WJQA 4I6NB 3L10B 2KANA 4GMVA 3P4QB 1D3ZA 1MJDA 1PDXA 1RFAA 3PT2B 3TUOA 1SSNA 2LGIA
chains in the Genus database with same CATH topology
3NVWA 5HFYA 2BYTA 4WURA 3TEXA 5AUKA 4ARIA 1IBXB 4ARCA 4C80A 1D5XC 4OZCA 1R7SA 1PGXA 1TY2A 3TEZA 4HKQA 1D4BA 3AMZA 5HG2A 1N5WA 2WNMA 4KKJA 3DWMA 2JYTA 2HDEA 1ZE3D 3ZYYX 1C79A 1RFKA 1QOBA 4XWTA 2I2YA 1SE4A 1N60A 3AN1A 3IT6B 3ZGZA 4WH4A 2L83A 1YN4A 1TS3A 2CJOA 1I4HA 2QILA 1TS5A 1E7PB 4RGMA 3AB5A 4RFBA 2WLBA 2IGDA 1C4AA 4ZHOA 1K52A 3KLSX 4YSYB 3BYYB 5MPOA 3BVMA 1OFFA 3VR9B 2RPVA 1WSPA 3Q8BA 1JROA 4KKIA 4MT5A 1EU3A 2MJ3A 1N61A 2TSSA 1E9MA 2I38A 1OQQA 2KAJA 1B9RA 1P7EA 1NEKB 1JWAD 1E6EB 1NVID 3W1SA 1EM7A 2PTLA 5FKAC 3NVYA 2PVOD 2K9XA 2OEDA 1FCLA 3EA6A 3IT4B 1SJED 4JX1C 1T5XD 4DXFA 3ZJUA 3ZJTA 2RDHA 1ACCA 2K3UA 2WXMA 2AQ3B 3AE6B 3R8BA 2K22A 3IAM1 5HHDG 2BB6A 4RGOS 2W3RA 2KMMA 1JWUD 1F2RC 2LMCA 3AEFB 1SE3A 1FXAA 3AEBB 3L4PA 3AEGB 2V3PA 2XN9C 1C9FA 1K53A 5FR3A 1TJEA 1V8CA 1D5MC 1SE2A 1DOYA 5I4DA 2W3SA 1FNVA 1QOAA 4ZRQA 2WU2B 2E6XA 3Q69A 1FIQA 4YSZB 1AWDA 2QIEB 1N63A 3MC0B 3MJ5A 1XCQL 4JWSC 5BMHA 5GXGB 1DGJA 4LK0M 3BWUD 5HI1A 1SJHD 2ICIA 2PVGC 1T6BX 2R61A 2IPKD 3AH7A 3TSSA 1GPXA 1WYGA 2ON8A 1L0VB 4L23A 1TZOA 1B1ZA 2MJEA 3U2SC 1N5XA 4NAWB 4PT5A 1UWMA 1WWTA 2WDRB 2BT6A 1ZDXA 4YWGG 2BTEA 2V3NA 4WIPA 2IJ0A 2K0PA 4HRSA 3SR6A 4ZYSA 2LHEA 1DOXA 2WXRA 1ET9A 3MHZA 4MM3B 5G5GA 2EKIA 3MFGA 2WU5B 2M19A 1C78A 1J7BA 1MI0A 2M0AA 2NMQA 3IAS1 1D5ZC 4YSXB 1GB4A 1FCCC 1QQRA 3FILA 4GDKB 1WXQA 5G5HA 4MH8A 1IGDA 1YN3A 1FO4A 4O1NA 4P16A 2PKOA 3B9JA 4ZRPA 4AQ7A 2FE8A 2RMMA 2SAKA 3NRZA 1KH0A 5BMGA 3DWGC 2QMTA 1QT9A 1TKGA 3NS1A 2OHFA 1N62A 1JWMD 1OQRA 2WXHA 2ONQA 3EUB2 1UWXA 2KN4A 4YT0B 5C3JB 4TSSA 1UGJA 1J7CA 1AW7A 3KWVA 3TEWA 1YJIA 2BS3B 2G1EA 3E56A 1E10A 2Y3AA 4HEA1 4OW0A 2IGGA 3KWLA 4TQ1A 4NAMA 3SEBA 1XCTL 2PIAA 5BYQA 3AE8B 1ZOYB 4L1BA 2AQ1B 1HZ5A 2LJIA 1EWCA 1HZ6A 5JXVA 4OZAA 4MACA 4YTNB 1I7HA 3R2IA 1L0XB 3GS2A 2WDQB 4H2AA 3W5VB 1PFDA 1FFVA 1KLUD 4NJCA 4DXGA 3NVZA 2BBCA 2N9LA 5AUIA 1LO5D 4HKZE 1L6VA 1JQ4A 3U4EG 1RWSA 2WP9B 1L6UA 3V05A 1FD6A 1SIJA 2WQYB 4RF0A 4R3DA 1IBXA 1YN5A 4A6QA 5BYSA 1JWSD 1ZPSA 4N59A 4D2KA 3T3OA 2XNAC 2QEJC 1AYFA 1M4VA 1UNSA 1F77A 2LHDA 4A90A 3FILB 1NENB 2PLPA 3PO0A 1VRAB 4HJGE 1ROEA 1EWYC 1QOFA 1HXYD 4RGTA 4B0MA 4JE3B 1EU4A 3P1MA 3ZJVA 2WXNA 3HUIA 3AEAB 2GRIA 2N0SB 3CIRB 3I57A 4LLGM 2K5PA 2MH7A 3AE1B 3KQ4A 2JWUA 4GLSC 4FXCA 3AEDB 1CQVA 1VDVA 1TKEA 1JWBD 1T3QA 3LB8C 2D5GA 2W54A 3P4PB 1JMLA 2Q5WD 4Q2JA 1NI3A 2GI9A 3ABVB 4A55A 4ZOHC 3O13A 1FRDA 3H8HA 4WQMA 1VZ6A 2BB5A 1L0YB 3B2FA 2HTME 1NYRA 2W82A 2WXQA 1IUEA 1HEZE 1L4ZB 2Y5CA 4IKGA 3VQIA 1XEEA 1AN8A 3BZDB 5D7GA 1QF6A 1XO3A 3P4RB 3Q8FA 2LEKA 5E6JA 1F2RI 1ENFA 1PGAA 1C4PA 3W9CB 1I4PA 1TY0A 4C7YA 5EE3A 2PW9A 3UI3A 4ZHPA 2VZKD 2INNE 1RYJA 1FFUA 2N9KA 1D6EC 1PYWD 3BVZA 2JQRB 2FUG1 2AX5A 2YEPF 3Q8CA 1JALA 1MHXA 1XLPA 2BS2B 3AE4B 3GB1A 1FMAD 4US8A 2J4XA 1SBBB 2H89B 2WXGA 1C77A 2BW2A 2L32A 4RCOA 5LNK1 2WXOA 3LYYA 2WDVB 4DQOC 1WRIA 2BS4B 2DLBA 5D3DA 3PZ7A 3RFZB 3SFDB 2JU6X 3Q8AA 1SXTA 3R2TA 4NZLB 1HA5A 2J42A 3AV8A 3MP9A 2B76B 4TQ0A 4XDCA 1P7FA 3HRDD 1XLOA 1IGCA 1KF6B 4XWWA 3IXSA 2PMVA 1FNWA 3E9SA 2DWQA 4YTPB 3AE7B 3FAHA 5H8YE 1UUPA 2WXPA 3NVVA 3V3XA 3AM9A 2QSDA 1MVKA 1TS2A 2RDGA 2J52A 2J53A 4XDDA 2V0GA 4RNAA 2V4IB 4OHJA 5BYRA 1TYGB 1YMHE 2JSVX 2KACA 1V1PA 2KWDA 1ZDVA 1ESFA 2WS3B 2YEPB 3B2GA 3I9V1 4M0WA 1ET6A 1MHHE 3GP7A 5FK9C 2JXTA 1GB1A 4JWUC 4LTUA 5TSSA 1YQ4B 2G9HD 3HVDA 1J7AA 3FC4A 1C4CA 3VRBB 5BMIA 3AECB 1XLQA 3J9CA 1KLGD 2ZW0A 2M56B 1QOGA 1TS4A 2Z8LA 3SFEB 1FRRA 2IGHA 4OVZA 4ITKA 1QLBB 2JYEA 1HQRD 2CJNA 2WXFA 1F0ZA 2X38A 1I4GA 1C76A 3P4SB 1VR9A 2ZW1A 2SEBD 4KGRA 1SB3C 2QJLA 3AE2B 1MPEA 4P6VF 4TMAB 1BMLC 3EGRA 2VZKB 2ACZB 2KQ4X 2LFIA 3NUHB 1BXTA 2IDYA 4C7ZA 1I4RA 3Q8EA 3NZ3A 4A9AA 2EELA 1XF5L 3LXFA 1YNTE 1L4DB 3P42A 1TKYA 3C8YA 2GB1A 1YQ3B 1STEA 2INPE 3U52E 1FM0D 5C2TB 3W2DA 1RM6C 1A70A 3PZ8A 4XE0A 1V1PB 2DBYA 4UDUC 2MJDA 5EE1A 3URYA 4USAA 3BIID 4B0EA 1L5PA 3VRAB 3T3NA 2LUMA 1V97A 3AEEB 3HVZA 4KGTA 1I4XA 1PUTA 1ZXIA 2N7JA 2DYOA 4RH6A 1Y56A 2DYMA 4KX6B 1K51A 1FXIA 1CZPA 1CJEA 1ZP0B 4RGNA 3P63A 3CWIA 1SF0A 4YXDB 1KRHA 4CQNA 1NYQA 1JRPA 1VLBA 3AE3B 4IOIE 3OWEB 1VZ8A 1SEBD 4HROA 5EE9A 1BUIC 2JZPA 2AQ2B 4KGSA 2W55A 1E0ZA 5H92C 1V1OA 1K50A 3AE5B 3BK2A 3RPFC 4AS1A 1QILA 4J3OD 4WAFA 5EE0A 2Y5PA 1KTKA 2E3TA 4YTMB 1VZ7A 3BK1A 2L52A 3U7ZA 5D3IB 3AE9B 4L2YA 1WGKA 1JW9D 1YJJA 2KDMA 2WXJA 3N9YC 2WXLA 4REZA 4N58A 2NTTA 3WCQA 1ZUD2 2NTSA 4OZBA 4GDLB 1XLNA 1QKZA 4JPSA 4WWMA 2FBWB 3BYTB 4C56C 2CU3A 2MEKA 1XXGA 1FNUA 3W5UB 1GOZA 2H88B 1GAQB 2L1AA 4RF1A 1CK1A 1KFYB 4N6EB 2WXIA 4US9A 4A8XC 1JCKB 1Q10A 1ZXHA 1I4QA 5T8IA 2JX5A 3VR8B 3TEYA 2WXKA 3BVGA 3ETRA 3ZQ4A 1VJKA 3P4QB 1FEHA 1PDXA 4EE2A 3TUOA 1SSNA 1PGBA 2LGIA 4IDIA 1DYQA 1DOIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3MFG A;  1D5Z C;  1D5X C;  3O13 A;  1BXT A;  1TY2 A;  1L0Y B;  1I4R A;  1YN3 A;  4O1N A;  1SE4 A;  1STE A;  1YN4 A;  1AN8 A;  1TS3 A;  3BZD B;  1I4H A;  3W2D A;  2QIL A;  1TS5 A;  4RGM A;  4RFB A;  1V1P B;  4UDU C;  3URY A;  3KLS X;  1ENF A;  1JWM D;  3BYY B;  1I4P A;  1TY0 A;  3BVM A;  1I4X A;  4RH6 A;  4TSS A;  1AW7 A;  1EU3 A;  1D6E C;  1PYW D;  2TSS A;  4RGN A;  3BVZ A;  2J4X A;  1SBB B;  3OWE B;  1SEB D;  4RCO A;  5FKA C;  3SEB A;  2AQ2 B;  5D3D A;  3EA6 A;  1SJE D;  1T5X D;  1SXT A;  2AQ1 B;  4DXF A;  1V1O A;  2RDH A;  3R2T A;  4NZL B;  1EWC A;  1HA5 A;  2AQ3 B;  3R8B A;  1QIL A;  4RGO S;  1KTK A;  1JWU D;  3R2I A;  1FNW A;  1DYQ A;  1L0X B;  1SE3 A;  5D3I B;  1UUP A;  2XN9 C;  1KLU D;  4DXG A;  2NTT A;  1D5M C;  1SE2 A;  5I4D A;  1LO5 D;  1FNV A;  1TS2 A;  2NTS A;  2RDG A;  3MC0 B;  4OHJ A;  1V1P A;  3V05 A;  1ESF A;  3BYT B;  4C56 C;  1SJH D;  1ET6 A;  2ICI A;  3GP7 A;  5FK9 C;  2R61 A;  1YN5 A;  1XXG A;  1FNU A;  2IPK D;  3TSS A;  1JWS D;  1GOZ A;  5TSS A;  2XNA C;  2G9H D;  1CK1 A;  1B1Z A;  2QEJ C;  1UNS A;  1M4V A;  1F77 A;  1JCK B;  1I4Q A;  1KLG D;  2IJ0 A;  1HXY D;  1TS4 A;  2Z8L A;  3BVG A;  4RGT A;  1EU4 A;  4ZYS A;  1HQR D;  1ET9 A;  1I4G A;  2SEB D;  1CQV A; 
#chains in the Genus database with same CATH topology
 3NVW A;  4WUR A;  5IAA C;  4ARC A;  2W9N A;  1D5X C;  1PGX A;  2HDE A;  1ZE3 D;  2KVZ A;  1QOB A;  3ZGZ A;  1N60 A;  1WX9 A;  4WH4 A;  1TS3 A;  1LQB A;  1I4H A;  2IGD A;  1E8Z A;  4YSY B;  2DNF A;  3BYY B;  2LD9 A;  2EKE C;  1OFF A;  1T0R C;  3Q8B A;  1E9M A;  1OQQ A;  4MSM B;  1P7E A;  3N1Y C;  1R4N B;  2KT7 A;  2KTF A;  2L00 B;  4CHK A;  3W1S A;  2K9X A;  2OED A;  4K7S A;  1WRD B;  4JX1 C;  3ZJT A;  1ACC A;  2K3U A;  2PE9 A;  2FID A;  3QHT A;  3AE6 B;  3R8B A;  3B1L X;  2K1F A;  2W3R A;  3RNE C;  1V2Y A;  4WJO A;  3A9K B;  3CSF A;  2JUO A;  1V8C A;  3U8Z A;  1FNV A;  4ZRQ A;  3Q2A C;  2WU2 B;  2E6X A;  2MRP A;  4TKN A;  1N63 A;  3MJ5 A;  5GXG B;  4RM8 A;  1DGJ A;  4BZA A;  4HPL B;  4W9C A;  2R61 A;  2IPK D;  2ON8 A;  2L76 A;  4L23 A;  2MP2 B;  2KC1 A;  3Q6B A;  3DBS A;  2M0X A;  1WWT A;  2WDR B;  3FKY A;  2BT6 A;  4MGZ E;  2BTE A;  2MP2 A;  4ASW C;  3SR6 A;  3OLM D;  2WXR A;  2O2V B;  1ET9 A;  4P1B C;  2KWV B;  2O6V D;  1C78 A;  4QAY A;  5IKC M;  3ALB A;  2V9H A;  3V61 A;  1QQR A;  1SE9 A;  2HE7 A;  5G5H A;  4MSQ B;  1E8W A;  2V3S A;  3QQ8 B;  4K7U A;  2J0M A;  3DDC B;  1WX7 A;  3VFK A;  2QHO A;  3JVZ X;  1QT9 A;  3QWZ B;  4WAA A;  1WXS A;  1JWM D;  4BVU C;  2JT4 B;  2WXH A;  1WM3 A;  2ONQ A;  1KJT A;  1UWX A;  4TSS A;  1UGJ A;  1J7C A;  1AW7 A;  2XK5 B;  3H9D A;  4K1R B;  3AU5 A;  2BS3 B;  3ZNI D;  2BYE A;  3KWL A;  4BOS C;  2I1J A;  1XCT L;  3AE8 B;  2Z59 B;  4GSW A;  3ONS A;  2LXA A;  2G4S A;  4CO7 A;  3R2I A;  1PFD A;  1PQS A;  1KLU D;  4NJC A;  4DXG A;  2KYW A;  5AUI A;  1WFY A;  3K9O B;  3L13 A;  3Q14 C;  1JQ4 A;  4GGQ A;  3W1S C;  3N3K B;  4YL8 A;  2MSE D;  4M00 A;  4R3D A;  5BYS A;  2G3Q B;  4IW0 A;  1M4V A;  1P98 A;  1VD2 A;  1ROE A;  1EWY C;  1QOF A;  4RGT A;  3P1M A;  3K9P B;  2WXN A;  2ZVN A;  3ZXR A;  3AEA B;  4BKT A;  2K5P A;  2MH7 A;  3AE1 B;  3KQ4 A;  4WWO A;  4GLS C;  4FXC A;  4BOZ B;  1JWB D;  1YOV B;  1T0S C;  5BO4 B;  4XYC A;  2D5G A;  2YVC A;  2GI9 A;  3ABV B;  4ZOH C;  4WQM A;  3H8H A;  3B2F A;  2KQS A;  4A20 A;  3ZDM C;  1GG3 A;  4ACF A;  2REX A;  1L4Z B;  1H8C A;  4XX5 A;  1J8C A;  3RNA C;  1E8X A;  1F2R I;  3RNF C;  1PGA A;  1C4P A;  1EO6 A;  2PW9 A;  4E71 A;  4ZHP A;  4ZYN A;  1WE7 A;  1J0G A;  1D6E C;  1WF9 A;  2WX0 A;  4KZ0 A;  1PYW D;  1WZ3 A;  3MJW A;  1JAL A;  4I6P A;  2J4X A;  4ZRI A;  5LNK 1;  5JH5 C;  3DVG Y;  1GC7 A;  1LM8 B;  5D3D A;  3RFZ B;  2K6Q A;  3AV8 A;  1F1H A;  2J42 A;  3MP9 A;  4TQ0 A;  4JGH B;  1L2N A;  2KFK A;  2PMV A;  2DHZ A;  4M01 A;  1YX6 B;  2DWQ A;  4YTP B;  2HJ8 A;  2WXP A;  3CMM B;  2JVC A;  3RYT A;  3UQA A;  5BYR A;  2NBV B;  2KAC A;  1IPG A;  3EFU A;  1WGG A;  3PLU A;  3VTU A;  1ET6 A;  5FK9 C;  2JXT A;  3KH0 A;  2BGF A;  4JWU C;  4XGA B;  1J7A A;  2KO3 A;  1YIW A;  3WAN A;  3J9C A;  4IWO A;  2CKH B;  1WXM A;  4ITK A;  4DHZ B;  3ML9 A;  1F0Z A;  2N4F A;  2X38 A;  1I4G A;  4MJS B;  4M0W B;  4KGR A;  2CU1 A;  1SB3 C;  3AE2 B;  5KHO A;  1MPE A;  3T9L A;  3A9K A;  2ACZ B;  2L3Z A;  2X8X X;  3M62 B;  2IDY A;  1I4R A;  3NZ3 A;  1WZ0 A;  3GOE A;  4URK A;  3I3T B;  3A1Q B;  3A33 B;  3NHE B;  1TKY A;  3C8Y A;  1YQ3 B;  1WMH B;  2MW5 A;  2INP E;  3JSV A;  3U52 E;  4NJ7 A;  1A70 A;  1V1P B;  5EE1 A;  2MJD A;  3NZS A;  4USA A;  3BII D;  4DHZ E;  4EEW A;  1V97 A;  3HVZ A;  2D3C A;  4RH6 A;  2JZ3 B;  4KX6 B;  4G3X B;  1CZP A;  3MC8 A;  1ZP0 B;  2LVQ A;  2NPT B;  3PS6 A;  3MTN B;  1SF0 A;  4WJP A;  1KRH A;  4YXD B;  1JRP A;  4EZK A;  4FA6 A;  5L83 A;  2A5U A;  2OOB B;  2AQ2 B;  2CHW A;  2W55 A;  2KDB A;  1TZ1 A;  5EE0 A;  4YTM B;  4S0R A;  2RDB C;  3ZW3 A;  4GN1 A;  4L2Y A;  1J19 A;  2NTT A;  2AL3 A;  4EKU A;  1UBI A;  2DZI A;  1ZUD 2;  2NCN A;  1XLN A;  4W9J A;  4WJN A;  4KDL B;  4JPS A;  4K7W A;  1FNU A;  1OTR B;  1GOZ A;  2H88 B;  5C23 A;  3DHH C;  4N6E B;  1RAX A;  3DBL B;  4A8X C;  1Q10 A;  1F9J A;  1I4Q A;  2JX5 A;  2WXK A;  3HK0 A;  1TTN A;  2KLG A;  4NAW A;  2FNJ B;  1ZKH A;  3N1X C;  4MDK E;  3LDZ E;  3DVN U;  2ZJD A;  4IDI A;  1E5W A;  1DYQ A;  3QAR A;  3TEX A;  5AUK A;  1TT5 B;  4B95 A;  3DOW A;  2DEN B;  3ZLZ A;  3U30 A;  2C7H A;  4C80 A;  1TY2 A;  1D4B A;  3RT3 B;  5HG2 A;  2IYD B;  3DHG C;  2JYT A;  3NY5 A;  4G11 A;  2LVO A;  4K81 A;  5D94 A;  1C79 A;  1RFK A;  1UD7 A;  2I2Y A;  3AN1 A;  4K3C A;  2ASQ A;  2NBU A;  4E3C A;  1YN4 A;  3JYU A;  2QIL A;  4RGM A;  3AB5 A;  2D10 A;  1K52 A;  3VXW A;  4GDK A;  1WGR A;  3N1Z C;  4GOC A;  1WSP A;  4KKI A;  4BKS A;  4MT5 A;  1EU3 A;  2D3G A;  3NJT A;  2MBQ A;  2KAJ A;  1B9R A;  3QX1 A;  3DCG A;  1E6E B;  2MQJ A;  5G2N A;  1EM7 A;  2O2V A;  3NVY A;  1Z5S B;  2D11 A;  3EA6 A;  1T5X D;  1WGY A;  4DXF A;  2IBI B;  3C0R B;  3DBL I;  5HHD G;  2BB6 A;  1UZX B;  2GLS A;  4RGO S;  3R7Q A;  3HHM A;  3AUL A;  3ZKJ C;  2GMI C;  3QAQ A;  2LMC A;  2N1V A;  1SE3 A;  3AEB B;  3Q3O C;  4XZ4 A;  1WJU A;  3IVF A;  2XN9 C;  1C9F A;  5FR3 A;  1D5M C;  1SE2 A;  1DOY A;  5I4D A;  1L7Y A;  2W3S A;  1QOA A;  3ZTC A;  5IOI A;  2D3B A;  3WAM A;  5BMH A;  3A4S C;  4LNK A;  3DBH B;  5HI1 A;  5FR6 A;  2ICI A;  1WMH A;  3AH7 A;  5LXH A;  1L0V B;  2EMT A;  4AOF A;  1TZO A;  2DZK A;  2MJE A;  4NAW B;  4PT5 A;  4WIP A;  2IJ0 A;  2K0P A;  4HRS A;  4M8N A;  2LHE A;  3Q3M C;  4MGY E;  4AP4 C;  3MHZ A;  2JF5 A;  3MFG A;  4NY0 A;  1J7B A;  1D5Z C;  1WJ6 A;  1RLF A;  1FCC C;  5GMV A;  4JLC A;  1WXQ A;  4W9L A;  4MH8 A;  3APF A;  4DXA B;  4ZRP A;  2WWZ A;  4AQ7 A;  3R7R A;  2FE8 A;  3GE8 C;  3N20 C;  5BMG A;  1LXD A;  3VH3 B;  2OHF A;  1N62 A;  3ZVV A;  3EUB 2;  1UEL A;  1UF0 A;  3M95 A;  4ZRJ A;  3TEW A;  4HCP B;  3RUL A;  4ANW A;  5DPW A;  3PHW B;  4OW0 A;  2IGG A;  4TQ1 A;  3SEB A;  5IA7 A;  2RSU A;  3NG0 A;  3AI5 A;  1R4N I;  1HZ5 A;  1HZ6 A;  2C9W B;  1V49 A;  1YX5 B;  2KK8 A;  4W9F A;  2D2Q A;  1FFV A;  3NVZ A;  1LO5 D;  4LCD E;  4HKZ E;  3QIJ A;  1L6V A;  2BWF A;  3U4E G;  1WX8 A;  2WP9 B;  2K8H A;  4C00 A;  1GC6 A;  3N30 A;  1V6E A;  3V05 A;  1SIJ A;  2O6V B;  4N59 A;  3DQV A;  1OEY A;  2QEJ C;  2YLM A;  4A90 A;  4GDL A;  1WYW B;  3PO0 A;  1SGH A;  1EU4 A;  5IN7 A;  4OVV A;  3HUI A;  3I57 A;  4BAX A;  4WWP A;  4II2 B;  1V86 A;  2D07 B;  2JWU A;  4EUT A;  1CQV A;  1OQY A;  1WE6 A;  2W54 A;  2Q5W D;  2HTH A;  2KNB A;  3BY4 B;  1WY8 A;  1WJN A;  3X23 A;  3RNG C;  3ZRF A;  4KDI C;  4G50 A;  3P4R B;  2LGD A;  3Q8F A;  5E6J A;  2Z0D B;  3PRM B;  1I4P A;  3RUI B;  1TGZ B;  4C7Y A;  5EE3 A;  3RN9 C;  4IG7 B;  5DCN A;  4PS3 A;  2FUG 1;  2LZ6 A;  2LGS A;  2YEP F;  1MHX A;  2BS2 B;  2ZCB A;  3RCZ A;  2MBH A;  1C77 A;  2BW2 A;  4RCO A;  1XT9 B;  2WXO A;  2WDV B;  2RD0 A;  3CF6 E;  3UGB B;  2DLB A;  3Q8A A;  2PPH A;  1HA5 A;  2B76 B;  4XDC A;  1P7F A;  3HRD D;  1XLO A;  3IXS A;  4W9E A;  2I1K A;  5H8Y E;  2XK5 A;  2M17 A;  3AM9 A;  4FJV B;  2RDG A;  4A3P A;  2J53 A;  4MH0 E;  1UBQ A;  1V1P A;  1ZDV A;  2WS3 B;  3I9V 1;  4M0W A;  3B2G A;  2FIF A;  1MHH E;  4LJO B;  3GP7 A;  4HWI B;  3QCA A;  4LTU A;  5TSS A;  1YQ4 B;  2AEH A;  4PS8 A;  3ZTD A;  3FC4 A;  1C4C A;  5BMI A;  3AEC B;  1Z2M A;  3V6E B;  3V62 A;  1QOG A;  1TS4 A;  2JPH A;  2IGH A;  4DDG D;  4OVZ A;  1QLB B;  2JYE A;  2CJN A;  2WDT B;  3GZN B;  3VTW A;  2FAZ A;  3JSV B;  1VR9 A;  2ZW1 A;  2SEB D;  5CTR C;  4ANU A;  3RNC C;  3QA8 A;  3QJZ A;  2DZJ A;  4WQO B;  4LNF A;  1BML C;  2LFI A;  2RPQ A;  2LRW A;  3NUH B;  4C7Z A;  3Q8E A;  4A9A A;  1YNT E;  3VAW A;  4HPP A;  3P42 A;  3L0W B;  1STE A;  3A9J B;  3PVL A;  5AZH A;  3URY A;  3AU4 A;  1C3T A;  2N9P C;  2MA9 B;  3M63 B;  1L5P A;  3OJ4 B;  3T3N A;  3AEE B;  2L0F A;  2N7J A;  2DYM A;  5J2R A;  3H1U A;  2KC2 A;  1HE8 A;  1NYQ A;  1VLB A;  3AE3 B;  3GZN I;  4IOI E;  3OWE B;  5EE9 A;  2MBO A;  2KWU B;  4EFO A;  2Z0E B;  1K50 A;  3AE5 B;  3BK2 A;  4FUL A;  2DAF A;  1U4A A;  1QIL A;  2J0J A;  2Y5P A;  1XD3 B;  2E3T A;  3BK1 A;  3O65 B;  2HD5 B;  1WGK A;  1JW9 D;  1YJJ A;  2WXJ A;  3D32 A;  2WXL A;  3KUZ A;  4N58 A;  3WCQ A;  4CYE A;  1E8Y A;  2NTS A;  4C4V A;  3ZDT A;  4DDI D;  4GDL B;  2LRU A;  4WWM A;  3BYT B;  3KYC D;  2KX0 A;  2L1A A;  3EEC A;  4LNO A;  1K8R B;  1RRB A;  1UH6 A;  2KJR A;  2LVP A;  3ZIM A;  5G55 A;  3VR8 B;  3TEY A;  2DAJ A;  3ZQ4 A;  1VJK A;  4MGI E;  1FEH A;  2UWQ A;  5HKH A;  2K25 A;  3OJ3 A;  2NVU I;  5HFY A;  5JHA A;  3IHP C;  2WGS A;  4HKQ A;  2WNM A;  4KKJ A;  3QC8 B;  5IO9 A;  2G45 B;  3IT6 B;  4NQK E;  1WGH A;  3PRZ A;  4F7Z A;  4W9I A;  1I42 A;  1E7P B;  2R2O A;  4RFB A;  2WLB A;  3KLS X;  3RD2 A;  4DK5 A;  1QZE A;  3QK0 A;  1Q0W B;  3V6C B;  3BVM A;  2KKC A;  1N61 A;  2FCS A;  2MJ3 A;  2I38 A;  3TIX A;  4KV2 A;  1NEK B;  1NVI D;  3N32 A;  5FKA C;  1KLV A;  3WIM A;  1FCL A;  3IT4 B;  3BIN A;  3ZJU A;  3PRP B;  3Q3F A;  3IAM 1;  4BBN F;  1JWU D;  5DPS A;  3WAP A;  2BQQ A;  2M8S A;  3AEG B;  4GXB A;  1OEY J;  1K53 A;  2D3A A;  1TJE A;  2AYO B;  1AAR A;  3Q69 A;  3RMK C;  1AWD A;  2HJ1 A;  2QIE B;  3NS8 A;  1XCQ L;  1WR6 E;  4ZDV A;  3H7S A;  4LK0 M;  3BWU D;  1SJH D;  1XQQ A;  1T6B X;  3M3J A;  3TSS A;  2KDE B;  2LWP A;  1GPX A;  1V5O A;  4HK2 A;  1B1Z A;  3U2S C;  1UWM A;  1ZDX A;  2LUE A;  1ZGU B;  4A3O A;  1DOX A;  5IP4 D;  1FXT B;  4P7I A;  4LDT D;  2ZCC A;  2WU5 B;  2M19 A;  3KUC B;  3JW0 X;  1GB4 A;  2M0A A;  2IO1 B;  3IAS 1;  4IM2 A;  2QCZ A;  4YSX B;  5D2M B;  3VH4 B;  1IYF A;  4GDK B;  3FIL A;  3ZO5 B;  1YN3 A;  1FO4 A;  1GNU A;  4O1N A;  4P16 A;  4PS7 A;  1BT0 A;  5LLI A;  2RMM A;  1KH0 A;  3DWG C;  2IO3 B;  2QMT A;  1TKG A;  3NS1 A;  2JWZ A;  1YQB A;  3S2A A;  3TL5 A;  5JHB A;  1TBE A;  2KN4 A;  2CHX A;  4LDT B;  2GBR A;  3KWV A;  3EHV A;  3SD5 A;  1YJI A;  2N9E B;  4AWJ A;  2Y3A A;  1X1M A;  3SDL C;  3A1Q A;  3NZU A;  2PIA A;  3L17 A;  2LGX A;  3GE3 C;  3L08 A;  1V80 A;  1ZOY B;  5AEK B;  4L1B A;  2AQ1 B;  2XBB C;  1WXA A;  1EWC A;  5JXV A;  4IC7 B;  4MAC A;  4FJY A;  1I7H A;  1L0X B;  3UIN B;  2OJR A;  3W5V B;  3WA0 A;  3NOB A;  4B6W A;  2DX5 B;  4IWP A;  4N9F 4;  4LNI A;  3PGE A;  4HDQ A;  1FD6 A;  5EDS A;  4RF0 A;  1IBX A;  5KHQ A;  4FHK A;  4A6Q A;  2KD0 A;  1JWS D;  1ZPS A;  3T3O A;  2MCN B;  1AYF A;  1UNS A;  2K39 A;  3FIL B;  1NEN B;  2PLP A;  4HVB A;  2GBN A;  4W9H A;  1LFD A;  4HJG E;  2FCM A;  1HXY D;  2L7R A;  2IO0 B;  1EUV B;  2GRI A;  2N0S B;  3CIR B;  3DBR I;  4FBJ B;  1V81 A;  1TKE A;  1VDV A;  2KDF B;  3KUD B;  5J18 A;  2MX2 A;  5DPR A;  3LB8 C;  2R2Q A;  4Q2J A;  4A55 A;  1FRD A;  3ZNG C;  1VZ6 A;  2BB5 A;  4FHJ A;  4P1C C;  2KMA A;  1HEZ E;  2Y5C A;  4DBG A;  4JIO U;  3VQI A;  1XEE A;  3BZD B;  5D7G A;  1QF6 A;  2LEK A;  2ZNV B;  3W9C B;  2N1W A;  1KM7 A;  3TJP A;  2INN E;  3KYD D;  2N9K A;  3BVZ A;  4FAD A;  3AE4 B;  1SBB B;  2H89 B;  2WXG A;  3APD A;  3LYY A;  4DQO C;  2BS4 B;  1P1A A;  4HDO A;  3PZ7 A;  2JU6 X;  3TMP B;  1ZW7 A;  1R4M B;  4II3 B;  3R2T A;  2KOX A;  4MEM A;  1VCB A;  2N7E A;  1F52 A;  1IGC A;  1KF6 B;  1GJZ A;  3E9S A;  3AE7 B;  1UUP A;  3DVN V;  3NVV A;  1NI2 A;  3HM3 A;  1I35 A;  2NS5 A;  4E74 A;  1MVK A;  1FPY A;  2J52 A;  4BFR A;  2V4I B;  1YMH E;  2JSV X;  2NBW B;  2KWD A;  5E6O A;  1KOT A;  1Y8R C;  1MFW A;  3I5J C;  4X57 B;  2INC C;  4S17 A;  2JY6 A;  1GUA B;  2G9H D;  3HVD A;  1P9D U;  3VRB B;  1XLQ A;  4PYU A;  2ZW0 A;  2BKF A;  2FCQ A;  2Z8L A;  5J17 A;  1FRR A;  1HQR D;  4LJP B;  2WXF A;  1C76 A;  3MC9 A;  2EMS A;  4P6V F;  4TMA B;  5CHV C;  3EGR A;  2VZK B;  2QDF A;  4M8M A;  2K8C A;  4NNJ B;  1BXT A;  2LXC A;  2KFJ A;  4W9K A;  1WI0 A;  3LXF A;  1L4D B;  2KMC A;  3L16 A;  2Y5B B;  2JRH A;  1FM0 D;  3RZF A;  1RM6 C;  3TBL D;  3IFW B;  2KFK B;  2DBY A;  5D6J B;  3T8M A;  1YD8 U;  3VRA B;  2LUM A;  3RZW C;  4KGT A;  1I4X A;  1WR1 A;  1PUT A;  1ZXI A;  2DYO A;  2KVR A;  1Y56 A;  3UIO B;  4NPN A;  2CHZ A;  3A4R A;  4RGN A;  3P63 A;  4KIK A;  2IZV B;  1E90 A;  4PK1 A;  4KGS A;  1NDD A;  1E0Z A;  3PRE A;  5H92 C;  1V1O A;  4AJW A;  3WAL A;  3RPF C;  4AS1 A;  4HCN B;  4J3O D;  1KTK A;  1VZ7 A;  1UGM A;  2KLC A;  2BWE S;  5D3I B;  2ZNV C;  2BVC A;  4BKG A;  2KDM A;  3HIZ A;  2MLB A;  1IP9 A;  2VH1 A;  2KWC A;  4C4V B;  3ENE A;  4OZB A;  3R3M A;  4GU2 A;  3ZXV A;  2UU7 A;  3DPD A;  4GIV A;  2CU3 A;  3DBR B;  2MEK A;  2L8J A;  3ZRC A;  2BYV E;  3W5U B;  4AJY B;  1MG4 A;  4ICV A;  3UF8 A;  2ZPN A;  2BPS A;  1CK1 A;  1KFY B;  2PE6 B;  2G4D B;  2RR9 A;  3HM6 X;  4DHJ D;  1ZXH A;  2UYZ B;  5T8I A;  4HPM B;  3UQB A;  5TR5 A;  2C5L C;  3BVG A;  3ETR A;  4W9G A;  4EE2 A;  3A9J A;  1PGB A;  2RGF A;  1DOI A;  1HTO A;  2BYT A;  1LGR A;  4IWQ A;  1IBX B;  4ARI A;  2AL6 A;  4OZC A;  1R7S A;  3TEZ A;  3AMZ A;  1N5W A;  2BYF A;  3DWM A;  4MEL A;  4W9D A;  3ZYY X;  4XWT A;  1SE4 A;  2L83 A;  2BF8 B;  2CJO A;  1TS5 A;  1C4A A;  2O6V A;  3PZD A;  4ZHO A;  4ANV A;  2B3A A;  5MPO A;  3VR9 B;  2RPV A;  1JRO A;  4F1S A;  4KIK B;  2TSS A;  4JQW C;  2M1M A;  5C1Z A;  4HLE A;  4RM9 A;  1JWA D;  1WXV A;  2PJH A;  2PTL A;  4B9K A;  2PVO D;  2ZVO A;  3EC8 A;  1SJE D;  2RDH A;  2WXM A;  1V9J A;  4FN2 A;  2AQ3 B;  5DPT A;  2KHW B;  2K22 A;  2KMM A;  2DYB A;  1F2R C;  3AEF B;  1FXA A;  3IG3 A;  3L4P A;  3VDZ A;  2V3P A;  5CHF A;  4YSZ B;  1FIQ A;  2LI5 A;  1ISN A;  4PYZ A;  3MC0 B;  4JWS C;  4IUM B;  2A4Z A;  2PVG C;  3VUY A;  3APC A;  3TCA A;  1WYG A;  1N5X A;  2L0T A;  4YWG G;  2V3N A;  1P3Q U;  3PPA A;  4ZYS A;  1EF5 A;  3PLV A;  3WAO A;  5AZG A;  5E6P A;  2VH2 A;  4MM3 B;  3H6N A;  4JL9 A;  3PV1 A;  5G5G A;  2EKI A;  2V1Y A;  1MI0 A;  2NMQ A;  4TV3 A;  1MG8 A;  3KW5 B;  3W1Y A;  1IGD A;  2J7Q B;  3U7D A;  2PKO A;  3B9J A;  2K6D B;  2SAK A;  3NRZ A;  2FUH B;  2KTR B;  4NQL B;  2KXJ A;  2GBK A;  1OQR A;  5AZF A;  4YT0 B;  4OVU A;  5C3J B;  1EF1 A;  2IY0 B;  1E7U A;  4ICU A;  2JRI B;  4IM0 A;  2C60 A;  2G1E A;  3E56 A;  1E10 A;  3LJ3 A;  4HEA 1;  3DBH I;  4NAM A;  5BYQ A;  3V60 A;  3P2B A;  2LJI A;  4OZA A;  3Q3N C;  4J6I A;  4YTN B;  3PSE B;  2KN5 A;  4LNN A;  4EOY A;  1S3S G;  3GS2 A;  2WDQ B;  4H2A A;  3VUX A;  2BBC A;  3ZUN A;  2N9L A;  4BBN C;  1RWS A;  1P0R A;  3H7P B;  1L6U A;  3OG5 A;  2KJH B;  2KTR A;  2GOW A;  2WQY B;  1G6J A;  3CST A;  1YN5 A;  4D2K A;  2XNA C;  3IBE A;  2NR2 A;  1JRU A;  4M02 A;  1F77 A;  2LHD A;  2LGY A;  1WH3 A;  2JXX A;  2L05 A;  3B08 A;  5CX3 A;  4ANX A;  1SIF A;  4HXD A;  3ZNZ B;  2MWS B;  1VRA B;  1NBF C;  3B0A A;  3I63 C;  4B0M A;  4JE3 B;  4XC2 A;  3ZJV A;  1TIF A;  4LLG M;  2QC8 A;  2GBJ A;  3AED B;  4I6L B;  2IO2 B;  2KJ6 A;  1T3Q A;  2LJ5 A;  3P4P B;  1JML A;  1NI3 A;  3O13 A;  5E6N A;  1L0Y B;  2HTM E;  5CHW A;  5L95 C;  1NYR A;  4KSK C;  3EFC A;  2W82 A;  3ECI A;  2WXQ A;  1IUE A;  4FLH A;  2PEA A;  4IKG A;  1E7V A;  2LAS A;  2GBM A;  1Q1O A;  2MHJ A;  2VRR B;  1AN8 A;  2J0K A;  3R66 C;  2N9X A;  1T0Q C;  1XO3 A;  1ENF A;  2WHI A;  1TY0 A;  3VUW A;  2AWT A;  2K8B A;  3UI3 A;  2VZK D;  1RYJ A;  1FFU A;  2JQR B;  2AX5 A;  1S1Q B;  3Q8C A;  1XLP A;  2ZPY A;  3VTV A;  4NJ6 A;  2MBB B;  2BKR B;  1FMA D;  3GB1 A;  3L54 A;  4MM3 A;  4US8 A;  2L32 A;  1OGW A;  3OAW A;  1WRI A;  3SFD B;  3DHI C;  2OJW A;  1SXT A;  4NZL B;  1N6Z A;  3PHX B;  2KX3 A;  2DZM A;  4KZC A;  4XWW A;  1M94 A;  1FNW A;  3FAH A;  2N7D A;  2NPT A;  2C7N B;  4DHJ B;  3H7P A;  3V3X A;  2QSD A;  4FJZ A;  1TS2 A;  2ZZP B;  4XDD A;  2V0G A;  4RNA A;  3VHT C;  4OHJ A;  1TYG B;  1Q5W B;  1WIA A;  1ESF A;  2YEP B;  2WX1 A;  3RI7 C;  2XEW A;  1GB1 A;  4TUU A;  3ML8 A;  3ZNH B;  4GB9 A;  5LXI B;  2KDI A;  3X0W A;  1KLG D;  2M56 B;  4F8C B;  3SFE B;  1WM2 A;  1R4M I;  1C1Y B;  2KQ7 A;  3P4S B;  4MJS A;  1T0Y A;  2KZR A;  1WJ4 A;  2QJL A;  2ZEQ A;  4EZL A;  5JZE B;  3AXC A;  2CR5 A;  4ZRK A;  2KQ4 X;  1CMX B;  1A5R A;  2MBE A;  2C7M B;  2EEL A;  1XF5 L;  2WYQ A;  2GB1 A;  3MHS D;  3PTF C;  4RMA A;  1HTQ A;  3SU8 X;  1H4R A;  4HJK A;  5C2T B;  3W2D A;  3PZ8 A;  4XE0 A;  4UDU C;  3VVW B;  1YJ1 A;  4B0E A;  2JZZ A;  2V4L A;  2CS4 A;  4DWF A;  1K51 A;  1FXI A;  1CJE A;  3CWI A;  4CQN A;  4AUQ C;  3SHQ A;  4BKS D;  1VZ8 A;  1SEB D;  4HRO A;  1BUI C;  2JZP A;  4K3B A;  2IY1 B;  4IM3 A;  4WAF A;  2IND C;  2L52 A;  2FCN A;  3UIP B;  3U7Z A;  3AE9 B;  3N9Y C;  4REZ A;  3DVG X;  4KVG B;  4MGK E;  4G0N B;  3C19 A;  1QKZ A;  3KVF B;  1WGD A;  4EZJ A;  4KSL C;  2FBW B;  4C56 C;  1XXG A;  2M4N A;  1GAQ B;  4RF1 A;  3Q3J A;  2WXI A;  4US9 A;  1V5T A;  4WWN A;  1JCK B;  3RNB C;  4WJQ A;  4I6N B;  3L10 B;  2KAN A;  4GMV A;  3P4Q B;  1D3Z A;  1MJD A;  1PDX A;  1RFA A;  3PT2 B;  3TUO A;  1SSN A;  2LGI A; 
#chains in the Genus database with same CATH homology
 3NVW A;  5HFY A;  2BYT A;  4WUR A;  3TEX A;  5AUK A;  4ARI A;  1IBX B;  4ARC A;  4C80 A;  1D5X C;  4OZC A;  1R7S A;  1PGX A;  1TY2 A;  3TEZ A;  4HKQ A;  1D4B A;  3AMZ A;  5HG2 A;  1N5W A;  2WNM A;  4KKJ A;  3DWM A;  2JYT A;  2HDE A;  1ZE3 D;  3ZYY X;  1C79 A;  1RFK A;  1QOB A;  4XWT A;  2I2Y A;  1SE4 A;  1N60 A;  3AN1 A;  3IT6 B;  3ZGZ A;  4WH4 A;  2L83 A;  1YN4 A;  1TS3 A;  2CJO A;  1I4H A;  2QIL A;  1TS5 A;  1E7P B;  4RGM A;  3AB5 A;  4RFB A;  2WLB A;  2IGD A;  1C4A A;  4ZHO A;  1K52 A;  3KLS X;  4YSY B;  3BYY B;  5MPO A;  3BVM A;  1OFF A;  3VR9 B;  2RPV A;  1WSP A;  3Q8B A;  1JRO A;  4KKI A;  4MT5 A;  1EU3 A;  2MJ3 A;  1N61 A;  2TSS A;  1E9M A;  2I38 A;  1OQQ A;  2KAJ A;  1B9R A;  1P7E A;  1NEK B;  1JWA D;  1E6E B;  1NVI D;  3W1S A;  1EM7 A;  2PTL A;  5FKA C;  3NVY A;  2PVO D;  2K9X A;  2OED A;  1FCL A;  3EA6 A;  3IT4 B;  1SJE D;  4JX1 C;  1T5X D;  4DXF A;  3ZJU A;  3ZJT A;  2RDH A;  1ACC A;  2K3U A;  2WXM A;  2AQ3 B;  3AE6 B;  3R8B A;  2K22 A;  3IAM 1;  5HHD G;  2BB6 A;  4RGO S;  2W3R A;  2KMM A;  1JWU D;  1F2R C;  2LMC A;  3AEF B;  1SE3 A;  1FXA A;  3AEB B;  3L4P A;  3AEG B;  2V3P A;  2XN9 C;  1C9F A;  1K53 A;  5FR3 A;  1TJE A;  1V8C A;  1D5M C;  1SE2 A;  1DOY A;  5I4D A;  2W3S A;  1FNV A;  1QOA A;  4ZRQ A;  2WU2 B;  2E6X A;  3Q69 A;  1FIQ A;  4YSZ B;  1AWD A;  2QIE B;  1N63 A;  3MC0 B;  3MJ5 A;  1XCQ L;  4JWS C;  5BMH A;  5GXG B;  1DGJ A;  4LK0 M;  3BWU D;  5HI1 A;  1SJH D;  2ICI A;  2PVG C;  1T6B X;  2R61 A;  2IPK D;  3AH7 A;  3TSS A;  1GPX A;  1WYG A;  2ON8 A;  1L0V B;  4L23 A;  1TZO A;  1B1Z A;  2MJE A;  3U2S C;  1N5X A;  4NAW B;  4PT5 A;  1UWM A;  1WWT A;  2WDR B;  2BT6 A;  1ZDX A;  4YWG G;  2BTE A;  2V3N A;  4WIP A;  2IJ0 A;  2K0P A;  4HRS A;  3SR6 A;  4ZYS A;  2LHE A;  1DOX A;  2WXR A;  1ET9 A;  3MHZ A;  4MM3 B;  5G5G A;  2EKI A;  3MFG A;  2WU5 B;  2M19 A;  1C78 A;  1J7B A;  1MI0 A;  2M0A A;  2NMQ A;  3IAS 1;  1D5Z C;  4YSX B;  1GB4 A;  1FCC C;  1QQR A;  3FIL A;  4GDK B;  1WXQ A;  5G5H A;  4MH8 A;  1IGD A;  1YN3 A;  1FO4 A;  4O1N A;  4P16 A;  2PKO A;  3B9J A;  4ZRP A;  4AQ7 A;  2FE8 A;  2RMM A;  2SAK A;  3NRZ A;  1KH0 A;  5BMG A;  3DWG C;  2QMT A;  1QT9 A;  1TKG A;  3NS1 A;  2OHF A;  1N62 A;  1JWM D;  1OQR A;  2WXH A;  2ONQ A;  3EUB 2;  1UWX A;  2KN4 A;  4YT0 B;  5C3J B;  4TSS A;  1UGJ A;  1J7C A;  1AW7 A;  3KWV A;  3TEW A;  1YJI A;  2BS3 B;  2G1E A;  3E56 A;  1E10 A;  2Y3A A;  4HEA 1;  4OW0 A;  2IGG A;  3KWL A;  4TQ1 A;  4NAM A;  3SEB A;  1XCT L;  2PIA A;  5BYQ A;  3AE8 B;  1ZOY B;  4L1B A;  2AQ1 B;  1HZ5 A;  2LJI A;  1EWC A;  1HZ6 A;  5JXV A;  4OZA A;  4MAC A;  4YTN B;  1I7H A;  3R2I A;  1L0X B;  3GS2 A;  2WDQ B;  4H2A A;  3W5V B;  1PFD A;  1FFV A;  1KLU D;  4NJC A;  4DXG A;  3NVZ A;  2BBC A;  2N9L A;  5AUI A;  1LO5 D;  4HKZ E;  1L6V A;  1JQ4 A;  3U4E G;  1RWS A;  2WP9 B;  1L6U A;  3V05 A;  1FD6 A;  1SIJ A;  2WQY B;  4RF0 A;  4R3D A;  1IBX A;  1YN5 A;  4A6Q A;  5BYS A;  1JWS D;  1ZPS A;  4N59 A;  4D2K A;  3T3O A;  2XNA C;  2QEJ C;  1AYF A;  1M4V A;  1UNS A;  1F77 A;  2LHD A;  4A90 A;  3FIL B;  1NEN B;  2PLP A;  3PO0 A;  1VRA B;  4HJG E;  1ROE A;  1EWY C;  1QOF A;  1HXY D;  4RGT A;  4B0M A;  4JE3 B;  1EU4 A;  3P1M A;  3ZJV A;  2WXN A;  3HUI A;  3AEA B;  2GRI A;  2N0S B;  3CIR B;  3I57 A;  4LLG M;  2K5P A;  2MH7 A;  3AE1 B;  3KQ4 A;  2JWU A;  4GLS C;  4FXC A;  3AED B;  1CQV A;  1VDV A;  1TKE A;  1JWB D;  1T3Q A;  3LB8 C;  2D5G A;  2W54 A;  3P4P B;  1JML A;  2Q5W D;  4Q2J A;  1NI3 A;  2GI9 A;  3ABV B;  4A55 A;  4ZOH C;  3O13 A;  1FRD A;  3H8H A;  4WQM A;  1VZ6 A;  2BB5 A;  1L0Y B;  3B2F A;  2HTM E;  1NYR A;  2W82 A;  2WXQ A;  1IUE A;  1HEZ E;  1L4Z B;  2Y5C A;  4IKG A;  3VQI A;  1XEE A;  1AN8 A;  3BZD B;  5D7G A;  1QF6 A;  1XO3 A;  3P4R B;  3Q8F A;  2LEK A;  5E6J A;  1F2R I;  1ENF A;  1PGA A;  1C4P A;  3W9C B;  1I4P A;  1TY0 A;  4C7Y A;  5EE3 A;  2PW9 A;  3UI3 A;  4ZHP A;  2VZK D;  2INN E;  1RYJ A;  1FFU A;  2N9K A;  1D6E C;  1PYW D;  3BVZ A;  2JQR B;  2FUG 1;  2AX5 A;  2YEP F;  3Q8C A;  1JAL A;  1MHX A;  1XLP A;  2BS2 B;  3AE4 B;  3GB1 A;  1FMA D;  4US8 A;  2J4X A;  1SBB B;  2H89 B;  2WXG A;  1C77 A;  2BW2 A;  2L32 A;  4RCO A;  5LNK 1;  2WXO A;  3LYY A;  2WDV B;  4DQO C;  1WRI A;  2BS4 B;  2DLB A;  5D3D A;  3PZ7 A;  3RFZ B;  3SFD B;  2JU6 X;  3Q8A A;  1SXT A;  3R2T A;  4NZL B;  1HA5 A;  2J42 A;  3AV8 A;  3MP9 A;  2B76 B;  4TQ0 A;  4XDC A;  1P7F A;  3HRD D;  1XLO A;  1IGC A;  1KF6 B;  4XWW A;  3IXS A;  2PMV A;  1FNW A;  3E9S A;  2DWQ A;  4YTP B;  3AE7 B;  3FAH A;  5H8Y E;  1UUP A;  2WXP A;  3NVV A;  3V3X A;  3AM9 A;  2QSD A;  1MVK A;  1TS2 A;  2RDG A;  2J52 A;  2J53 A;  4XDD A;  2V0G A;  4RNA A;  2V4I B;  4OHJ A;  5BYR A;  1TYG B;  1YMH E;  2JSV X;  2KAC A;  1V1P A;  2KWD A;  1ZDV A;  1ESF A;  2WS3 B;  2YEP B;  3B2G A;  3I9V 1;  4M0W A;  1ET6 A;  1MHH E;  3GP7 A;  5FK9 C;  2JXT A;  1GB1 A;  4JWU C;  4LTU A;  5TSS A;  1YQ4 B;  2G9H D;  3HVD A;  1J7A A;  3FC4 A;  1C4C A;  3VRB B;  5BMI A;  3AEC B;  1XLQ A;  3J9C A;  1KLG D;  2ZW0 A;  2M56 B;  1QOG A;  1TS4 A;  2Z8L A;  3SFE B;  1FRR A;  2IGH A;  4OVZ A;  4ITK A;  1QLB B;  2JYE A;  1HQR D;  2CJN A;  2WXF A;  1F0Z A;  2X38 A;  1I4G A;  1C76 A;  3P4S B;  1VR9 A;  2ZW1 A;  2SEB D;  4KGR A;  1SB3 C;  2QJL A;  3AE2 B;  1MPE A;  4P6V F;  4TMA B;  1BML C;  3EGR A;  2VZK B;  2ACZ B;  2KQ4 X;  2LFI A;  3NUH B;  1BXT A;  2IDY A;  4C7Z A;  1I4R A;  3Q8E A;  3NZ3 A;  4A9A A;  2EEL A;  1XF5 L;  3LXF A;  1YNT E;  1L4D B;  3P42 A;  1TKY A;  3C8Y A;  2GB1 A;  1YQ3 B;  1STE A;  2INP E;  3U52 E;  1FM0 D;  5C2T B;  3W2D A;  1RM6 C;  1A70 A;  3PZ8 A;  4XE0 A;  1V1P B;  2DBY A;  4UDU C;  2MJD A;  5EE1 A;  3URY A;  4USA A;  3BII D;  4B0E A;  1L5P A;  3VRA B;  3T3N A;  2LUM A;  1V97 A;  3AEE B;  3HVZ A;  4KGT A;  1I4X A;  1PUT A;  1ZXI A;  2N7J A;  2DYO A;  4RH6 A;  1Y56 A;  2DYM A;  4KX6 B;  1K51 A;  1FXI A;  1CZP A;  1CJE A;  1ZP0 B;  4RGN A;  3P63 A;  3CWI A;  1SF0 A;  4YXD B;  1KRH A;  4CQN A;  1NYQ A;  1JRP A;  1VLB A;  3AE3 B;  4IOI E;  3OWE B;  1VZ8 A;  1SEB D;  4HRO A;  5EE9 A;  1BUI C;  2JZP A;  2AQ2 B;  4KGS A;  2W55 A;  1E0Z A;  5H92 C;  1V1O A;  1K50 A;  3AE5 B;  3BK2 A;  3RPF C;  4AS1 A;  1QIL A;  4J3O D;  4WAF A;  5EE0 A;  2Y5P A;  1KTK A;  2E3T A;  4YTM B;  1VZ7 A;  3BK1 A;  2L52 A;  3U7Z A;  5D3I B;  3AE9 B;  4L2Y A;  1WGK A;  1JW9 D;  1YJJ A;  2KDM A;  2WXJ A;  3N9Y C;  2WXL A;  4REZ A;  4N58 A;  2NTT A;  3WCQ A;  1ZUD 2;  2NTS A;  4OZB A;  4GDL B;  1XLN A;  1QKZ A;  4JPS A;  4WWM A;  2FBW B;  3BYT B;  4C56 C;  2CU3 A;  2MEK A;  1XXG A;  1FNU A;  3W5U B;  1GOZ A;  2H88 B;  1GAQ B;  2L1A A;  4RF1 A;  1CK1 A;  1KFY B;  4N6E B;  2WXI A;  4US9 A;  4A8X C;  1JCK B;  1Q10 A;  1ZXH A;  1I4Q A;  5T8I A;  2JX5 A;  3VR8 B;  3TEY A;  2WXK A;  3BVG A;  3ETR A;  3ZQ4 A;  1VJK A;  3P4Q B;  1FEH A;  1PDX A;  4EE2 A;  3TUO A;  1SSN A;  1PGB A;  2LGI A;  4IDI A;  1DYQ A;  1DOI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...