1YN3A

Crystal structures of eap domains from staphylococcus aureus reveal an unexpected homology to bacterial superantigens
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
98
structure length
98
Chain Sequence
b'GSTVPYTITVNGTSQNILSNLTFNKNQNISYKDLEGKVKSVLESNRGITDVDLRLSKQAKYTVNFKNGTKKVIDLKSGIYTANLINSSDIKSININID'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords truncated cell surface protein map-w
publication title The Crystal Structures of EAP Domains from Staphylococcus aureus Reveal an Unexpected Homology to Bacterial Superantigens.
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Toxin, protein binding
total genus 32
structure length 98
sequence length 98
chains with identical sequence B
ec nomenclature
pdb deposition date 2005-01-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03642 MAP MAP domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.120 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1yn3A00
2TSSA 3BVMA 3O13A 1KLGD 4RGOS 1TY0A 1V1PA 1JCKB 1SEBD 1TS4A 1FNUA 1I4RA 1SJHD 1PYWD 4TSSA 2IJ0A 4RFBA 1L0YB 1SE4A 1EU3A 2AQ1B 1SE3A 2R61A 1FNVA 1HXYD 1STEA 1UNSA 1YN3A 1SE2A 4RGMA 2QEJC 2ICIA 1JWSD 1D5XC 4RGTA 1QILA 3BVZA 1AW7A 1KLUD 1I4XA 1TS2A 1TS3A 2NTSA 1V1PB 2AQ3B 5TSSA 3TSSA 3BVGA 2J4XA 2G9HD 4DXFA 1ET9A 1I4GA 2XNAC 1SXTA 1HQRD 1LO5D 3BYYB 5I4DA 1L0XB 2XN9C 1ENFA 4UDUC 3R8BA 1F77A 3BZDB 1V1OA 1YN5A 3EA6A 1UUPA 1D6EC 1AN8A 2SEBD 1SBBB 3W2DA 5FK9C 1D5ZC 4C56C 1TS5A 1EU4A 5D3IB 3MC0B 3V05A 1YN4A 4OHJA 2AQ2B 4RGNA 3R2TA 4RH6A 1JWMD 1XXGA 4ZYSA 4RCOA 3BYTB 1ET6A 3OWEB 3GP7A 1FNWA 1HA5A 1JWUD 4DXGA 5D3DA 1I4QA 1M4VA 1I4HA 1BXTA 1DYQA 3URYA 5FKAC 2RDHA 1KTKA 3R2IA 1D5MC 1SJED 2RDGA 3MFGA 1ESFA 1EWCA 1I4PA 1CQVA 1TY2A 2NTTA 1GOZA 4NZLB 1B1ZA 3KLSX 1T5XD 3SEBA 2Z8LA 2QILA 2IPKD 1CK1A 4O1NA
chains in the Genus database with same CATH superfamily
1C4PA 3MC8A 2TSSA 5AZGA 1GC6A 2BWES 1D4BA 1YX6B 3NVVA 2MJEA 2PVGC 2H89B 3RNEC 5GMVA 2INPE 1GPXA 4N58A 3Q8CA 4A55A 4JGHB 1WYGA 4KZ0A 3AE9B 5KHOA 1VZ8A 3NOBA 4HVBA 2JRIB 1SE4A 1EU3A 2W55A 3WALA 2L3ZA 1KRHA 4GB9A 1WE6A 2KDFB 2FUHB 4RGMA 2QEJC 5FR6A 1YQBA 3Q69A 3JW0X 3GB1A 1AARA 2UU7A 4AJWA 1V81A 3SHQA 2WDVB 1JROA 4M01A 4ANWA 3Q14C 4IM2A 3Q6BA 1SF0A 1A70A 1SSNA 1WGRA 2MP2B 5TSSA 2V3NA 2RDBC 3AE7B 4TQ1A 3UQAA 4L23A 4AOFA 1OQYA 3L10B 1LO5D 2K9XA 2XN9C 2O6VB 2BB5A 3SR6A 3WAPA 1F2RC 1UELA 5HG2A 5CX3A 2Y5BB 2N1VA 1UUPA 1WGYA 4KKIA 4KKJA 1D6EC 3V60A 1IBXA 2LUMA 3Q2AC 4MGYE 1JALA 1Q10A 1TS5A 2ZNVC 1UWMA 1SIFA 2MEKA 2LRWA 4L1BA 4DK5A 3QWZB 5AUKA 1N6ZA 2KVRA 4BAXA 3CIRB 4WWOA 5IOIA 3CSTA 3DHIC 4MH0E 1BXTA 5CHVC 2D07B 4MM3B 4TKNA 4XZ4A 3DPDA 3KUZA 2WNMA 4JL9A 2X8XX 3L4PA 2WXHA 2J52A 1D5MC 3B2GA 2IGDA 1GB4A 1NI2A 1PGBA 3W1SC 2DBYA 3NZ3A 4NNJB 2WDRB 1MG8A 3DBLI 2WGSA 2MBEA 1R7SA 1HZ5A 1RWSA 3WCQA 3QHTA 2L0FA 3PHXB 3QARA 4E3CA 3KYCD 1WX8A 2ON8A 1R4MB 1QOAA 4MT5A 1E7UA 1DOIA 3BINA 1IYFA 1L5PA 2KQ7A 2IO1B 3BVZA 1OFFA 5C1ZA 1JWAD 1TKYA 2ZZPB 1XLNA 1E8ZA 4PS8A 2JZZA 4GDLA 2MBOA 3NS1A 2PE9A 4DXFA 3AMZA 1EF5A 2RR9A 5HFYA 1P7FA 4M8MA 1N5XA 5J17A 2I1JA 1ENFA 1T3QA 1RRBA 2GBKA 5D2MB 1FM0D 2BPSA 3ENEA 1XCTL 3ZDMC 1JRUA 3UI3A 4PYZA 3M63B 1R4MI 1L6UA 2DAFA 4Q2JA 1ZE3D 4TQ0A 1XO3A 5DCNA 2KQ4X 4C7YA 3BYTB 4BOZB 1HA5A 3DWGC 3ZLZA 4DHJD 2LXAA 2KFKB 2YLMA 2DX5B 1T0YA 3IAM1 2NBUA 3PS6A 1C78A 2ZPYA 4BKTA 2JPHA 2JRHA 1I4PA 2NTTA 2KOXA 3SEBA 5H8YE 2QILA 3WIMA 3TEZA 1WI0A 2ZCCA 3IT4B 4HDQA 1L7YA 3RMKC 2BBCA 3MJ5A 1XQQA 2AL6A 2KJHB 1V1PA 2K0PA 3M62B 2CHZA 2QCZA 4J3OD 4S0RA 4HPPA 1N62A 2WXQA 1TTNA 3QK0A 2LMCA 4OVZA 3L08A 1YN3A 1QZEA 2I38A 4M0WA 3K9OB 1OTRB 3HUIA 1D5XC 5EDSA 2AL3A 2PLPA 1NYQA 1AW7A 3QX1A 4XC2A 1EWYC 5J2RA 3MC9A 1LM8B 2D5GA 1WMHB 4IWOA 3NZSA 1WGGA 2G45B 1FCCC 2N9PC 5AEKB 3N30A 1VZ6A 4IOIE 2M56B 3AEDB 1S1QB 5I4DA 1L0XB 4GSWA 1XD3B 4LJOB 4UDUC 5BYSA 2JWUA 2JWZA 3X0WA 2BS2B 2RGFA 4FJZA 2WX1A 3RFZB 1GNUA 2SEBD 2B3AA 3DVNU 2PEAA 2BS3B 3KH0A 2DZMA 3P1MA 3IG3A 1VDVA 4RGNA 1WYWB 1VJKA 2D2QA 3DBRB 1QQRA 4AP4C 5E6NA 4II3B 1UBQA 4DHZE 4F7ZA 3EECA 4K3CA 3NG0A 1HZ6A 3W1SA 3BK2A 1V8CA 3R2IA 1QF6A 2GBJA 1CK1A 2CHXA 4ANXA 3Q3FA 5HHDG 1PQSA 4R3DA 1M94A 1FRRA 4EE2A 4MDKE 4RGOS 4NAMA 1PUTA 2MP2A 2VH1A 4GGQA 1WXVA 2GBMA 3DBRI 2GLSA 4NJ6A 4II2B 4GDKB 1K50A 3PRPB 3PO0A 1T6BX 2C7MB 3PZDA 2KKCA 4LNNA 3PSEB 1P98A 3TCAA 2WWZA 2JYEA 4YT0B 2M1MA 1TS2A 1WR6E 2MJ3A 3ZRFA 2JZ3B 1V49A 2Q5WD 3EFUA 4EZKA 4K7UA 4DDGD 5CHWA 1CZPA 1E9MA 2KTFA 2ZJDA 4GLSC 2E3TA 3GOEA 4XWTA 1LFDA 1XEEA 3T9LA 4MM3A 5FR3A 5LXHA 4RF0A 3N32A 2LFIA 1V1OA 3KUCB 3EA6A 3IFWB 3W5VB 5JH5C 2M0AA 3W2DA 1IP9A 2WXLA 4FULA 1Q0WB 3H9DA 2B76B 1FO4A 1K8RB 2YVCA 3IBEA 1E0ZA 2KXJA 2V0GA 4QAYA 2CHWA 2I1KA 1NVID 3VR8B 2FBWB 2LEKA 3S2AA 1V5OA 5MPOA 2E6XA 2MBBB 2KWCA 1OGWA 2PMVA 1SJED 2RDGA 1WRIA 1VZ7A 2L00B 4GDLB 2GI9A 5BYQA 1FD6A 2DYOA 2G1EA 1Z5SB 2L83A 2WXIA 2BWFA 4O1NA 2NVUI 4JE3B 2LGDA 1WR1A 4FXCA 3WANA 4KGRA 1WXAA 2LHDA 4W9FA 4AUQC 1KJTA 3ZNID 2IY1B 4GN1A 3AH7A 2R61A 2MWSB 3VTUA 1V86A 4ARIA 5IP4D 1FXIA 4FHJA 1WJUA 2ONQA 2NCNA 1JWSD 2INCC 1S3SG 2N7JA 2KJ6A 3QAQA 2G4DB 1WXSA 4WJNA 4XX5A 1V5TA 2FCQA 4RF1A 4XGAB 2JYTA 2WXJA 2BYTA 4FLHA 2PPHA 3VDZA 1I4GA 3PLVA 1MHHE 2IZVB 1KFYB 3U7ZA 2JQRB 3OG5A 1E7PB 2J7QB 4W9LA 2W82A 4P7IA 1F1HA 5G5HA 4LNIA 4ZDVA 3CMMB 4KIKA 4WWMA 2W3SA 2RMMA 3R2TA 2WDTB 3AM9A 2CS4A 3U8ZA 2LGXA 1AYFA 3HHMA 5HI1A 4FBJB 4MACA 4KVGB 2IO2B 4G50A 3RULA 2QDFA 1FFUA 2HD5B 1TGZB 4M0WB 4P16A 2M8SA 4KZCA 2N9LA 3ML8A 3QIJA 4HCNB 1QOBA 1WX7A 2G3QB 1Q5WB 2BYEA 2R2OA 2KWUB 4BBNC 4YTPB 5CTRC 4HJGE 5JHBA 1VCBA 4J6IA 3O13A 3QA8A 3UQBA 2ZNVB 2WXPA 3VH3B 1EO6A 1I4RA 2KAJA 1SB3C 3CSFA 2WXNA 4DWFA 3NHEB 4GXBA 1MFWA 4HRSA 4YWGG 1T0RC 1H8CA 3W9CB 1STEA 1UNSA 4WAAA 3RI7C 3DWMA 3HIZA 3R7RA 3R66C 3PT2B 2EKEC 3FAHA 1JRPA 2GBRA 4ZRPA 4FADA 4LNOA 2FAZA 4G11A 2WU2B 3I63C 3TJPA 3N9YC 4AWJA 3AB5A 5CHFA 2IDYA 2JSVX 2NS5A 1HQRD 1FFVA 1NDDA 1OQRA 3J9CA 4HROA 4BKGA 2DENB 3ABVB 5GXGB 4K81A 2EMTA 2O6VD 3BZDB 5BYRA 1L0VB 1KLVA 5IN7A 2KDMA 3D32A 3OJ4B 4W9IA 1EU4A 1V9JA 3JVZX 1FCLA 5AUIA 4URKA 4NQLB 3AN1A 3NJTA 1RLFA 1YX5B 3ZJVA 1JQ4A 3URYA 1F52A 3ZTDA 2ZW0A 3P4RB 3AEAB 3L17A 2JXTA 2LVOA 4C80A 4NZLB 2R2QA 4GDKA 1FRDA 5J18A 2RSUA 4I6NB 3B1LX 4HJKA 2KMCA 2D3BA 2PJHA 3GE3C 4IG7B 4K7SA 2D3GA 2N7DA 2M4NA 1R4NB 3B9JA 1SEBD 3LYYA 2KN4A 5TR5A 1BMLC 4C00A 2WYQA 1SE3A 1MI0A 3SFEB 2N9KA 1T0QC 1NEKB 5L83A 2K8BA 2NMQA 3U4EG 3N1XC 4B95A 4HLEA 1PGAA 1E90A 2LGIA 3A4SC 2KLCA 3RNGC 1QILA 5LNK1 2MQJA 1V97A 2CJNA 2DWQA 2KHWB 5E6JA 5G55A 2M19A 3AU4A 3FKYA 2AQ3B 1E10A 2C9WB 2JX5A 3QCAA 3TL5A 1P9DU 3I9V1 3BVGA 2J4XA 2W3RA 3RNBC 4HK2A 2WXMA 2XNAC 2VH2A 3E56A 1R4NI 1L4DB 4JPSA 2Z0EB 1YNTE 1WE7A 5AZFA 4WJOA 4EUTA 1NENB 1FPYA 3VRAB 1G6JA 4B0EA 1TIFA 2WQYB 4C56C 3ZTCA 2FIFA 2MCNB 1MHXA 2GB1A 2LXCA 1FIQA 4OZAA 1J7BA 3B2FA 2K6QA 3HK0A 1JWUD 2AYOB 3DOWA 3FILA 2BKFA 1I4QA 2HTME 1M4VA 4L2YA 1WIAA 5LLIA 1P1AA 3AE1B 2W9NA 1RYJA 1PGXA 3KWVA 2OJRA 2Z0DB 1X1MA 1ESFA 3HVDA 1CQVA 1B1ZA 3H7PA 1WJ4A 5KHQA 3Q8BA 1C3TA 3QJZA 2KX0A 1L2NA 3EC8A 2EMSA 1D3ZA 1MVKA 2BW2A 4XE0A 4ANUA 4WWNA 2LGYA 4KIKB 3T3OA 2MA9B 1TZ1A 2JXXA 4NQKE 4IC7B 1WX9A 3AE3B 2L05A 3EHVA 4AQ7A 1J7CA 2JY6A 4HDOA 3AECB 4MSMB 1SE9A 4MELA 3U7DA 1QOFA 2IYDB 4P6VF 3UINB 4HKQA 1C77A 1VLBA 2CR5A 1KF6B 1ET9A 4K7WA 2IBIB 3H1UA 4BKSA 3BYYB 1I7HA 2Y3AA 2LRUA 2C7HA 1YMHE 2K6DB 3ZUNA 1XLOA 2Z59B 3CWIA 2DHZA 3VUXA 1CJEA 2BVCA 2L0TA 1YOVB 2I2YA 2WS3B 3V05A 5DPWA 4WURA 2KC2A 2L1AA 4USAA 3VHTC 4JQWC 1BT0A 1MPEA 4NJCA 3V6EB 3DBHB 4ARCA 1AWDA 2RDHA 4AJYB 4NPNA 2V9HA 1EM7A 1UZXB 3Q3OC 1E7VA 4D2KA 3ETRA 2KVZA 1L4ZB 2KT7A 4GU2A 1L6VA 1GAQB 2WXRA 3ZNHB 1C4CA 3ZO5B 2K39A 4IM0A 2MLBA 1GC7A 4W9GA 3PV1A 3M95A 3VH4B 4OVUA 2N4FA 1C1YB 2YEPB 2DNFA 3KWLA 4K1RB 4LDTB 2LWPA 2DZIA 1FNVA 5BO4B 4B9KA 1K53A 1K52A 2K8HA 4RGTA 3LXFA 2O2VA 1P0RA 4MEMA 3TMPB 1UH6A 3A9KA 2NBVB 3BK1A 2KDEB 2V4IB 1OEYJ 2CU3A 1BUIC 1DOYA 3AV8A 3AE8B 2KYWA 4OVVA 1RFKA 2KK8A 3DHGC 2KN5A 1UGMA 1F77A 2OJWA 1N61A 1YN5A 3EFCA 4IKGA 4WWPA 4B6WA 5C2TB 4MGIE 5D3IB 3MC0B 1YN4A 3X23A 4PYUA 2AQ2B 4MGZE 2MH7A 1JWMD 2MRPA 4RNAA 4ZYSA 1WZ0A 4LLGM 4RCOA 5IAAC 2NPTB 1FNWA 1VRAB 2N9EB 4N59A 1T0SC 2LJIA 3I5JC 3ZNGC 1JMLA 2LI5A 3KQ4A 4A9AA 3P2BA 2KWVB 1UGJA 1EWCA 1N63A 3B0AA 4YTMB 4CO7A 2AEHA 2KMAA 1KH0A 1Y8RC 1XCQL 2G4SA 4GOCA 2AX5A 3W1YA 4TUUA 3A4RA 1ZDVA 4OW0A 5IO9A 5L95C 4HKZE 3HRDD 5EE3A 4C7ZA 4A90A 1YQ3B 3ZIMA 4MJSA 5E6PA 5JZEB 1E6EB 4N6EB 1KOTA 4KSLC 3AU5A 1TYGB 3RD2A 2K3UA 3RZFA 4NJ7A 2XK5A 1DGJA 3HM3A 3AI5A 3FILB 1N5WA 1WY8A 1TS3A 3R7QA 1U4AA 3IT6B 4KDLB 1P7EA 4CHKA 3P4SB 2OEDA 2NBWB 4BVUC 2BKRB 1NI3A 3VTWA 4FHKA 2BTEA 2PIAA 3H7PB 2IO0B 5G2NA 4GMVA 3R8BA 4YL8A 1YJ1A 4HPLB 2K25A 4ZRJA 2JU6X 4W9CA 1AN8A 1JWBD 4BOSC 1QLBB 5D7GA 4YTNB 2LHEA 1J19A 1J0GA 4ITKA 4LNFA 1WWTA 2VZKB 4GIVA 2GOWA 3NZUA 3SD5A 3L54A 1UBIA 2J0JA 3PLUA 2FE8A 2KFJA 4WIPA 3ZYYX 4BKSD 1NBFC 3C8YA 2EELA 3QQ8B 1C9FA 1ZDXA 3RNAC 2QC8A 3KVFB 3ZJUA 4I6LB 2KDBA 3AEFB 3T8MA 3ML9A 5IKCM 3KLSX 5JHAA 3VXWA 4JLCA 2C5LC 3SFDB 2IGGA 4KDIC 1WGKA 3U52E 1QKZA 1ZPSA 4RM8A 3BVMA 1PDXA 2J53A 3A9JA 3VAWA 1TY0A 2ZVOA 1TS4A 2HDEA 3IAS1 1B9RA 1SJHD 3RNCC 1GJZA 3WAMA 2AWTA 1L0YB 3ONSA 2AQ1B 3NUHB 2C7NB 3SU8X 2KD0A 1Q1OA 3N1YC 4LJPB 4FA6A 2PVOD 4K3BA 4A8XC 2WXOA 3PRZA 3ZQ4A 1I4XA 2LVPA 3K9PB 4M00A 3DQVA 3PRMB 4YSZB 3ZKJC 4I6PA 2BB6A 4YSXB 4ZRQA 4LCDE 2ZPNA 1ROEA 1IPGA 1ZP0B 3EGRA 4FN2A 4PS3A 2FCSA 2L76A 4A3PA 4ANVA 2KLGA 5D94A 1MJDA 3ECIA 2KC1A 2CJOA 4ACFA 4BFRA 1WXQA 2M17A 4DDID 1RM6C 1F2RI 4W9JA 4PT5A 5D6JB 3Q8EA 4ZRKA 4IUMB 2ZEQA 4TMAB 1WH3A 1XT9B 2REXA 5T8IA 3UIPB 4KV2A 2O2VB 2D10A 4W9HA 4OZCA 4EZLA 4WQOB 2KTRB 3A9KB 3C0RB 3KUDB 4P1CC 5EE1A 2IPKD 1C79A 3H6NA 3NVYA 2INNE 4NY0A 3N20C 1DOXA 2N7EA 2JVCA 1V6EA 1WFYA 2YEPF 4C4VA 3P63A 4JWUC 3U30A 2GMIC 3UIOB 1P3QU 5BMHA 4A20A 2LVQA 4ASWC 2ICIA 1WGHA 3DVGX 4W9EA 2LUEA 3TBLD 1V2YA 3DBLB 4CQNA 3LDZE 1F9JA 2HJ8A 1FXAA 3LB8C 4E71A 3M3JA 3BIID 2FUG1 1GG3A 4G0NB 2G9HD 2NPTA 5H92C 2KJRA 1SXTA 1OQQA 1TJEA 4YXDB 1UWXA 3AULA 3QC8B 4MSQB 4MH8A 2UYZB 1SBBB 4LNKA 1V80A 1ZOYB 3LJ3A 2BGFA 4ZOHC 4IW0A 4DHZB 1J7AA 4HPMB 2H88B 4RH6A 3ZNZB 2D3AA 1XXGA 4ICUA 3VTVA 1ET6A 2DYBA 3GP7A 3B08A 4MJSB 2DAJA 3ALBA 3W5UB 2JZPA 3JYUA 3JSVA 5FKAC 4EKUA 2XK5B 1KTKA 2KDIA 2K8CA 2KMMA 3MFGA 4JIOU 1CMXB 1WM3A 2D11A 4JX1C 1RAXA 1WZ3A 4EEWA 2MSED 1XF5L 2XBBC 3L16A 3PHWB 1Y56A 3ZXRA 4TSSA 2IJ0A 2LZ6A 2L32A 3MHZA 4IWPA 3V6CB 4JWSC 2HTHA 4WJPA 1ZUD2 2KNBA 4TV3A 4ZRIA 3VUWA 3PTFC 4DQOC 4X57B 3P4QB 1ZW7A 3ZJTA 3RT3B 2FCMA 3BY4B 2MX2A 3AE4B 3UGBB 3IHPC 2GBNA 4B0MA 2JF5A 3SDLC 5IA7A 2V3SA 4BBNF 4S17A 2IGHA 2K1FA 5HKHA 4HXDA 1ZKHA 2KANA 2X38A 2BYFA 1QOGA 2N1WA 2FNJB 4LTUA 3A9JB 1WF9A 3AEBB 1VR9A 5FK9C 3V62A 1E8YA 5G5GA 4PS7A 3RZWC 2JUOA 2NR2A 4DHJB 2VRRB 4US8A 3TEYA 1K51A 1LQBA 4DXGA 3CF6E 2V3PA 1IGCA 3ZDTA 3T3NA 3P4PB 3U2SC 4P1BC 1I4HA 1DYQA 1ACCA 4EFOA 4FJVB 3A1QA 4W9KA 1IGDA 2CU1A 2J0MA 1C4AA 3VVWB 3MP9A 2IO3B 4E74A 1TKGA 4M8NA 3APCA 3TIXA 3Q3JA 4XDCA 1XLQA 5BMIA 2J42A 4DBGA 3RNFC 1HE8A 1FNUA 1PYWD 3I57A 3RUIB 2ZVNA 3IXSA 4US9A 2DZKA 4LDTD 2FIDA 4PK1A 4NAWA 3AEEB 2PE6B 4KX6B 1E8XA 2HE7A 1H4RA 1TBEA 2WU5B 3UF8A 3WAOA 4AS1A 4ZYNA 3NVZA 3WA0A 3V61A 2KZRA 1E5WA 2V4LA 2GRIA 2QHOA 3DBSA 4A6QA 2RD0A 3L0WB 2KWDA 5EE0A 2BT6A 2Y5CA 3DBHI 2K5PA 1C76A 2QMTA 1TT5B 3RCZA 3N3KB 1TZOA 2KTRA 1QT9A 3GZNB 2ACZB 2MBQA 2V1YA 4RM9A 2W54A 4C4VB 2RPVA 1VD2A 2LASA 4EZJA 3N1ZC 3TEWA 2MJDA 1MG4A 4G3XB 4XYCA 3RPFC 2FCNA 1ZGUB 1FMAD 1Z2MA 3DVGY 4LK0M 4IM3A 4F8CB 3DVNV 3PREA 3MHSD 2OOBB 3E9SA 3NVWA 3Q8FA 4FJYA 1F0ZA 4OZBA 1IBXB 3ZVVA 1WGDA 4RMAA 2WX0A 3L13A 2O6VA 1ISNA 3KYDD 2L52A 2A5UA 2KACA 2XEWA 3GZNI 4F1SA 5C23A 2CKHB 2BQQA 1JCKB 2Y5PA 4IDIA 2QSDA 3DDCB 4RFBA 2PKOA 1GB1A 3PPAA 3KW5B 3OJ3A 1HXYD 1FEHA 4IWQA 4ZHOA 2BS4B 2OHFA 4HWIB 1J8CA 4HEA1 2KO3A 3DCGA 1JW9D 1KLUD 2PTLA 2NTSA 3C19A 1NYRA 4XDDA 1TKEA 3JSVB 3ZW3A 2K22A 5C3JB 4XWWA 3P42A 2WHIA 4EOYA 1UF0A 3GS2A 2PW9A 3O65B 2SAKA 1LXDA 2UWQA 5AZHA 3VRBB 2DLBA 2BYVE 2C60A 5E6OA 3I3TB 1I42A 3MJWA 2LJ5A 5DPSA 4WAFA 1D5ZC 1GUAB 3A33B 3PZ7A 2M0XA 3Q3NC 2ASQA 1OEYA 2LD9A 4CYEA 4OHJA 2ZW1A 2JT4B 3Q3MC 4M02A 4WH4A 1YJJA 1YD8U 1SIJA 4BZAA 2VZKD 3OWEB 2EKIA 3MTNB 3ZXVA 1UD7A 2DYMA 1WRDB 3APDA 1ZXHA 2D3CA 1PFDA 1HTOA 2MHJA 2WXFA 2HJ1A 3OLMD 3TEXA 1KM7A 3HVZA 1TY2A 5LXIB 3H8HA 2WLBA 4A3OA 4KGSA 3AE6B 3PVLA 4HCPB 1A5RA 1I35A 1YIWA 5EE9A 1LGRA 3APFA 2QJLA 1KLGD 2L7RA 2WDQB 3HM6X 2QIEB 5DPRA 4ZHPA 1HTQA 1WXMA 2J0KA 3VFKA 2LGSA 1SE2A 1RFAA 4N9F4 4REZA 3TUOA 2KFKA 1E8WA 2KQSA 2ZCBA 3NY5A 2N0SB 3DHHC 4W9DA 1YJIA 4MGKE 2MBHA 1FXTB 4ICVA 1SGHA 1V1PB 3A1QB 4H2AA 1WJNA 3BWUD 5DPTA 3H7SA 4WJQA 3PZ8A 3TSSA 3AE5B 1WSPA 3Q8AA 3PGEA 3AEGB 3VUYA 1ZXIA 3NS8A 1EUVB 3R3MA 1WJ6A 4YSYB 1XLPA 1YQ4B 3OAWA 3ZGZA 1EF1A 5JXVA 2BF8B 2WXKA 3EUB2 4DXAB 2IY0B 4KSKC 3RYTA 1IUEA 5BMGA 3IVFA 5D3DA 2A4ZA 3VR9B 2INDC 3RN9C 3V3XA 4KGTA 1HEZE 1WMHA 4NAWB 3AE2B 2L8JA 2DZJA 3NRZA 1N60A 2KX3A 3VQIA 3AXCA 3GE8C 2WP9B 1GOZA 2RPQA 1WM2A 3ZRCA 4WQMA 1T5XD 3FC4A 2N9XA 2Z8LA 2MW5A 2WXGA
chains in the Genus database with same CATH topology
1C4PA 1XF5L 1L6VA 1GAQB 2TSSA 2WXRA 1C4CA 1D4BA 3NVVA 2MJEA 4JE3B 1Y56A 4FXCA 2PVGC 2H89B 4KGRA 2INPE 1GPXA 4N58A 2LHDA 3Q8CA 4A55A 1WYGA 4TSSA 2IJ0A 2YEPB 3AE9B 2L32A 1VZ8A 3MHZA 3KWLA 4JWSC 1SE4A 3AH7A 1EU3A 1ZUD2 2R61A 2W55A 4DQOC 4ARIA 3P4QB 1FNVA 1FXIA 3ZJTA 1KRHA 2ONQA 3AE4B 4RGMA 2QEJC 1K53A 1K52A 3Q69A 1JWSD 4RGTA 3GB1A 2N7JA 3LXFA 4B0MA 2WDVB 1JROA 4RF1A 1SF0A 1A70A 1SSNA 3BK1A 5TSSA 2JYTA 2V3NA 2WXJA 2IGHA 2V4IB 2BYTA 2CU3A 1BUIC 3AE7B 4TQ1A 1DOYA 1I4GA 3AV8A 4L23A 3AE8B 1MHHE 1KFYB 1LO5D 3U7ZA 2JQRB 2K9XA 2XN9C 1RFKA 2BB5A 3SR6A 2X38A 1E7PB 1F2RC 5HG2A 1QOGA 2W82A 1F77A 1N61A 5G5HA 1YN5A 4LTUA 1UUPA 4KKJA 4KKIA 4IKGA 1D6EC 1IBXA 3AEBB 1VR9A 2LUMA 5FK9C 1JALA 1Q10A 5C2TB 1TS5A 5G5GA 4WWMA 5D3IB 1UWMA 3MC0B 2W3SA 1YN4A 2MEKA 2RMMA 2AQ2B 4L1BA 3R2TA 2MH7A 1JWMD 3AM9A 4RNAA 4ZYSA 4LLGM 4RCOA 5AUKA 1AYFA 4US8A 3TEYA 1K51A 1FNWA 4DXGA 5HI1A 3CIRB 2V3PA 4MACA 1IGCA 3T3NA 1VRAB 3P4PB 3U2SC 1FFUA 1I4HA 1BXTA 1DYQA 4N59A 1ACCA 4P16A 2LJIA 4MM3B 1JMLA 2WNMA 1IGDA 2N9LA 2WXHA 2J52A 1D5MC 3B2GA 3KQ4A 2IGDA 3L4PA 1C4AA 4A9AA 1GB4A 1UGJA 1EWCA 1PGBA 1N63A 1QOBA 3MP9A 2DBYA 3NZ3A 4YTMB 2WDRB 4YTPB 1TKGA 4HJGE 1KH0A 4XDCA 1XLQA 1R7SA 3O13A 1XCQL 1HZ5A 5BMIA 1RWSA 2J42A 3WCQA 2AX5A 2WXPA 1FNUA 1ZDVA 1I4RA 4OW0A 2KAJA 1PYWD 4HKZE 3I57A 1SB3C 3HRDD 5EE3A 4C7ZA 2WXNA 3IXSA 4A90A 4US9A 2ON8A 4HRSA 1YQ3B 4YWGG 1QOAA 4MT5A 3W9CB 1STEA 1UNSA 1E6EB 1DOIA 3DWMA 4N6EB 3FAHA 1L5PA 1JRPA 4ZRPA 3AEEB 1TYGB 2K3UA 4KX6B 1DGJA 3BVZA 2WU2B 1OFFA 2WU5B 3FILB 1JWAD 1TKYA 1N5WA 1XLNA 1TS3A 3N9YC 3IT6B 4AS1A 1P7EA 3NS1A 3NVZA 3P4SB 3AB5A 2OEDA 2IDYA 2JSVX 4DXFA 1NI3A 2GRIA 3AMZA 1HQRD 1FFVA 4A6QA 5HFYA 1OQRA 1P7FA 3J9CA 2KWDA 5EE0A 1N5XA 2BTEA 2BT6A 4HROA 2Y5CA 2PIAA 3ABVB 5GXGB 1ENFA 1T3QA 3R8BA 2K5PA 1C76A 2QMTA 1FM0D 3BZDB 5BYRA 1L0VB 2JU6X 1XCTL 2KDMA 1TZOA 1AN8A 3UI3A 1QT9A 1JWBD 1L6UA 4Q2JA 1QLBB 5D7GA 1EU4A 4YTNB 2ACZB 2LHEA 1ZE3D 2W54A 4TQ0A 4ITKA 2RPVA 1FCLA 5AUIA 1XO3A 1WWTA 2VZKB 2KQ4X 4C7YA 3TEWA 3AN1A 3BYTB 2MJDA 3RPFC 1HA5A 2FE8A 1FMAD 3DWGC 4LK0M 3ZJVA 1JQ4A 4WIPA 3ZYYX 3URYA 3C8YA 2EELA 1C9FA 2ZW0A 3IAM1 3AEAB 3P4RB 1ZDXA 3E9SA 3NVWA 3Q8FA 1F0ZA 4OZBA 1IBXB 1C78A 2JXTA 3ZJUA 1I4PA 4NZLB 2NTTA 4C80A 3AEFB 1FRDA 3KLSX 3SEBA 5H8YE 2QILA 3SFDB 3TEZA 2IGGA 2L52A 3IT4B 1WGKA 3U52E 1QKZA 1ZPSA 3BVMA 1PDXA 2J53A 2KACA 2BBCA 3MJ5A 1TY0A 3B9JA 1JCKB 1SEBD 1V1PA 1TS4A 2K0PA 2HDEA 2KN4A 2Y5PA 2QSDA 1BMLC 3IAS1 3LYYA 4IDIA 4J3OD 1B9RA 1SJHD 4RFBA 1N62A 2PKOA 2WXQA 1GB1A 1L0YB 2AQ1B 1SE3A 3NUHB 1MI0A 3SFEB 2N9KA 1NEKB 1HXYD 1FEHA 2LMCA 4OVZA 1YN3A 2NMQA 4ZHOA 3U4EG 2BS4B 2OHFA 2I38A 4M0WA 1PGAA 2LGIA 4HEA1 2PVOD 3HUIA 1D5XC 1QILA 4A8XC 2PLPA 2WXOA 5LNK1 1NYQA 1JW9D 1V97A 2CJNA 1AW7A 2DWQA 1KLUD 1I4XA 1EWYC 2PTLA 3ZQ4A 5E6JA 2NTSA 1NYRA 2M19A 4XDDA 2D5GA 1TKEA 5C3JB 2K22A 2AQ3B 1E10A 4YSZB 4XWWA 1FCCC 2JX5A 3P42A 3I9V1 3BVGA 2J4XA 2W3RA 2BB6A 4IOIE 1VZ6A 2WXMA 4ZRQA 4YSXB 3GS2A 2XNAC 2PW9A 2M56B 3AEDB 3E56A 2SAKA 5I4DA 1L0XB 1ROEA 1ZP0B 3EGRA 1L4DB 4UDUC 5BYSA 4JPSA 2JWUA 3VRBB 1YNTE 2DLBA 1NENB 2BS2B 3RFZB 3VRAB 2SEBD 4B0EA 2CJOA 2WQYB 1D5ZC 1WXQA 3PZ7A 4WAFA 4C56C 2BS3B 1RM6C 1F2RI 3P1MA 4PT5A 1VDVA 4OHJA 2ZW1A 4RGNA 1MHXA 1VJKA 4WH4A 1YJJA 3Q8EA 2GB1A 1FIQA 1SIJA 1J7BA 4OZAA 1QQRA 2VZKD 3B2FA 3OWEB 2EKIA 1JWUD 2DYMA 3FILA 1I4QA 2HTME 1M4VA 4L2YA 4TMAB 1ZXHA 1HZ6A 1PFDA 3AE1B 3W1SA 1RYJA 5T8IA 1PGXA 3BK2A 3KWVA 1V8CA 2WXFA 3R2IA 1QF6A 4OZCA 3TEXA 1ESFA 3HVZA 3HVDA 1TY2A 1CQVA 1B1ZA 3H8HA 2WLBA 5EE1A 2IPKD 4KGSA 1C79A 1CK1A 3Q8BA 3AE6B 5HHDG 3NVYA 2INNE 4R3DA 5EE9A 1FRRA 4EE2A 2QJLA 1KLGD 4RGOS 4NAMA 1DOXA 1MVKA 1PUTA 2BW2A 2WDQB 2YEPF 2QIEB 3P63A 4JWUC 4XE0A 4ZHPA 3T3OA 1SE2A 4GDKB 1K50A 4REZA 3TUOA 5BMHA 3PO0A 1T6BX 2N0SB 3AE3B 2ICIA 4AQ7A 1J7CA 1YJIA 3AECB 2JYEA 4YT0B 1TS2A 2MJ3A 2Q5WD 4CQNA 1QOFA 1V1PB 4P6VF 4H2AA 3BWUD 1FXAA 1C77A 3LB8C 1VLBA 4HKQA 3PZ8A 3TSSA 3AE5B 3BIID 1CZPA 1E9MA 1KF6B 2FUG1 4GLSC 2G9HD 1WSPA 3Q8AA 5H92C 1ET9A 1SXTA 1OQQA 2E3TA 3BYYB 1I7HA 2Y3AA 1TJEA 4YXDB 1UWXA 1YMHE 4XWTA 1XEEA 5FR3A 1XLOA 4RF0A 3AEGB 2LFIA 1ZXIA 1V1OA 4MH8A 3CWIA 3EA6A 3W5VB 1SBBB 2M0AA 1CJEA 1XLPA 1YQ4B 4YSYB 3W2DA 3ZGZA 1ZOYB 2WXLA 1FO4A 2B76B 5JXVA 4ZOHC 2I2YA 2WS3B 3V05A 1E0ZA 1J7AA 2WXKA 3EUB2 2H88B 4WURA 4RH6A 2V0GA 1XXGA 2L1AA 1ET6A 1IUEA 3GP7A 4USAA 1NVID 3VR8B 5BMGA 2FBWB 2LEKA 5D3DA 1MPEA 4NJCA 3VR9B 3W5UB 3V3XA 4KGTA 1HEZE 2JZPA 5MPOA 2E6XA 4NAWB 5FKAC 3AE2B 4ARCA 3NRZA 1AWDA 2RDHA 1KTKA 1N60A 2PMVA 1SJED 2KMMA 2RDGA 3VQIA 1WRIA 1EM7A 3MFGA 1VZ7A 4GDLB 2GI9A 2WP9B 1GOZA 4D2KA 3ETRA 1L4ZB 1T5XD 3FC4A 4WQMA 5BYQA 1FD6A 2DYOA 2Z8LA 2G1EA 4JX1C 2L83A 2WXIA 2WXGA 4O1NA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2TSS A;  3BVM A;  3O13 A;  1KLG D;  4RGO S;  1TY0 A;  1V1P A;  1JCK B;  1SEB D;  1TS4 A;  1FNU A;  1I4R A;  1SJH D;  1PYW D;  4TSS A;  2IJ0 A;  4RFB A;  1L0Y B;  1SE4 A;  1EU3 A;  2AQ1 B;  1SE3 A;  2R61 A;  1FNV A;  1HXY D;  1STE A;  1UNS A;  1YN3 A;  1SE2 A;  4RGM A;  2QEJ C;  2ICI A;  1JWS D;  1D5X C;  4RGT A;  1QIL A;  3BVZ A;  1AW7 A;  1KLU D;  1I4X A;  1TS2 A;  1TS3 A;  2NTS A;  1V1P B;  2AQ3 B;  5TSS A;  3TSS A;  3BVG A;  2J4X A;  2G9H D;  4DXF A;  1ET9 A;  1I4G A;  2XNA C;  1SXT A;  1HQR D;  1LO5 D;  3BYY B;  5I4D A;  1L0X B;  2XN9 C;  1ENF A;  4UDU C;  3R8B A;  1F77 A;  3BZD B;  1V1O A;  1YN5 A;  3EA6 A;  1UUP A;  1D6E C;  1AN8 A;  2SEB D;  1SBB B;  3W2D A;  5FK9 C;  1D5Z C;  4C56 C;  1TS5 A;  1EU4 A;  5D3I B;  3MC0 B;  3V05 A;  1YN4 A;  4OHJ A;  2AQ2 B;  4RGN A;  3R2T A;  4RH6 A;  1JWM D;  1XXG A;  4ZYS A;  4RCO A;  3BYT B;  1ET6 A;  3OWE B;  3GP7 A;  1FNW A;  1HA5 A;  1JWU D;  4DXG A;  5D3D A;  1I4Q A;  1M4V A;  1I4H A;  1BXT A;  1DYQ A;  3URY A;  5FKA C;  2RDH A;  1KTK A;  3R2I A;  1D5M C;  1SJE D;  2RDG A;  3MFG A;  1ESF A;  1EWC A;  1I4P A;  1CQV A;  1TY2 A;  2NTT A;  1GOZ A;  4NZL B;  1B1Z A;  3KLS X;  1T5X D;  3SEB A;  2Z8L A;  2QIL A;  2IPK D;  1CK1 A;  4O1N A; 
#chains in the Genus database with same CATH topology
 1C4P A;  3MC8 A;  2TSS A;  5AZG A;  1GC6 A;  2BWE S;  1D4B A;  1YX6 B;  3NVV A;  2MJE A;  2PVG C;  2H89 B;  3RNE C;  5GMV A;  2INP E;  1GPX A;  4N58 A;  3Q8C A;  4A55 A;  4JGH B;  1WYG A;  4KZ0 A;  3AE9 B;  5KHO A;  1VZ8 A;  3NOB A;  4HVB A;  2JRI B;  1SE4 A;  1EU3 A;  2W55 A;  3WAL A;  2L3Z A;  1KRH A;  4GB9 A;  1WE6 A;  2KDF B;  2FUH B;  4RGM A;  2QEJ C;  5FR6 A;  1YQB A;  3Q69 A;  3JW0 X;  3GB1 A;  1AAR A;  2UU7 A;  4AJW A;  1V81 A;  3SHQ A;  2WDV B;  1JRO A;  4M01 A;  4ANW A;  3Q14 C;  4IM2 A;  3Q6B A;  1SF0 A;  1A70 A;  1SSN A;  1WGR A;  2MP2 B;  5TSS A;  2V3N A;  2RDB C;  3AE7 B;  4TQ1 A;  3UQA A;  4L23 A;  4AOF A;  1OQY A;  3L10 B;  1LO5 D;  2K9X A;  2XN9 C;  2O6V B;  2BB5 A;  3SR6 A;  3WAP A;  1F2R C;  1UEL A;  5HG2 A;  5CX3 A;  2Y5B B;  2N1V A;  1UUP A;  1WGY A;  4KKI A;  4KKJ A;  1D6E C;  3V60 A;  1IBX A;  2LUM A;  3Q2A C;  4MGY E;  1JAL A;  1Q10 A;  1TS5 A;  2ZNV C;  1UWM A;  1SIF A;  2MEK A;  2LRW A;  4L1B A;  4DK5 A;  3QWZ B;  5AUK A;  1N6Z A;  2KVR A;  4BAX A;  3CIR B;  4WWO A;  5IOI A;  3CST A;  3DHI C;  4MH0 E;  1BXT A;  5CHV C;  2D07 B;  4MM3 B;  4TKN A;  4XZ4 A;  3DPD A;  3KUZ A;  2WNM A;  4JL9 A;  2X8X X;  3L4P A;  2WXH A;  2J52 A;  1D5M C;  3B2G A;  2IGD A;  1GB4 A;  1NI2 A;  1PGB A;  3W1S C;  2DBY A;  3NZ3 A;  4NNJ B;  2WDR B;  1MG8 A;  3DBL I;  2WGS A;  2MBE A;  1R7S A;  1HZ5 A;  1RWS A;  3WCQ A;  3QHT A;  2L0F A;  3PHX B;  3QAR A;  4E3C A;  3KYC D;  1WX8 A;  2ON8 A;  1R4M B;  1QOA A;  4MT5 A;  1E7U A;  1DOI A;  3BIN A;  1IYF A;  1L5P A;  2KQ7 A;  2IO1 B;  3BVZ A;  1OFF A;  5C1Z A;  1JWA D;  1TKY A;  2ZZP B;  1XLN A;  1E8Z A;  4PS8 A;  2JZZ A;  4GDL A;  2MBO A;  3NS1 A;  2PE9 A;  4DXF A;  3AMZ A;  1EF5 A;  2RR9 A;  5HFY A;  1P7F A;  4M8M A;  1N5X A;  5J17 A;  2I1J A;  1ENF A;  1T3Q A;  1RRB A;  2GBK A;  5D2M B;  1FM0 D;  2BPS A;  3ENE A;  1XCT L;  3ZDM C;  1JRU A;  3UI3 A;  4PYZ A;  3M63 B;  1R4M I;  1L6U A;  2DAF A;  4Q2J A;  1ZE3 D;  4TQ0 A;  1XO3 A;  5DCN A;  2KQ4 X;  4C7Y A;  3BYT B;  4BOZ B;  1HA5 A;  3DWG C;  3ZLZ A;  4DHJ D;  2LXA A;  2KFK B;  2YLM A;  2DX5 B;  1T0Y A;  3IAM 1;  2NBU A;  3PS6 A;  1C78 A;  2ZPY A;  4BKT A;  2JPH A;  2JRH A;  1I4P A;  2NTT A;  2KOX A;  3SEB A;  5H8Y E;  2QIL A;  3WIM A;  3TEZ A;  1WI0 A;  2ZCC A;  3IT4 B;  4HDQ A;  1L7Y A;  3RMK C;  2BBC A;  3MJ5 A;  1XQQ A;  2AL6 A;  2KJH B;  1V1P A;  2K0P A;  3M62 B;  2CHZ A;  2QCZ A;  4J3O D;  4S0R A;  4HPP A;  1N62 A;  2WXQ A;  1TTN A;  3QK0 A;  2LMC A;  4OVZ A;  3L08 A;  1YN3 A;  1QZE A;  2I38 A;  4M0W A;  3K9O B;  1OTR B;  3HUI A;  1D5X C;  5EDS A;  2AL3 A;  2PLP A;  1NYQ A;  1AW7 A;  3QX1 A;  4XC2 A;  1EWY C;  5J2R A;  3MC9 A;  1LM8 B;  2D5G A;  1WMH B;  4IWO A;  3NZS A;  1WGG A;  2G45 B;  1FCC C;  2N9P C;  5AEK B;  3N30 A;  1VZ6 A;  4IOI E;  2M56 B;  3AED B;  1S1Q B;  5I4D A;  1L0X B;  4GSW A;  1XD3 B;  4LJO B;  4UDU C;  5BYS A;  2JWU A;  2JWZ A;  3X0W A;  2BS2 B;  2RGF A;  4FJZ A;  2WX1 A;  3RFZ B;  1GNU A;  2SEB D;  2B3A A;  3DVN U;  2PEA A;  2BS3 B;  3KH0 A;  2DZM A;  3P1M A;  3IG3 A;  1VDV A;  4RGN A;  1WYW B;  1VJK A;  2D2Q A;  3DBR B;  1QQR A;  4AP4 C;  5E6N A;  4II3 B;  1UBQ A;  4DHZ E;  4F7Z A;  3EEC A;  4K3C A;  3NG0 A;  1HZ6 A;  3W1S A;  3BK2 A;  1V8C A;  3R2I A;  1QF6 A;  2GBJ A;  1CK1 A;  2CHX A;  4ANX A;  3Q3F A;  5HHD G;  1PQS A;  4R3D A;  1M94 A;  1FRR A;  4EE2 A;  4MDK E;  4RGO S;  4NAM A;  1PUT A;  2MP2 A;  2VH1 A;  4GGQ A;  1WXV A;  2GBM A;  3DBR I;  2GLS A;  4NJ6 A;  4II2 B;  4GDK B;  1K50 A;  3PRP B;  3PO0 A;  1T6B X;  2C7M B;  3PZD A;  2KKC A;  4LNN A;  3PSE B;  1P98 A;  3TCA A;  2WWZ A;  2JYE A;  4YT0 B;  2M1M A;  1TS2 A;  1WR6 E;  2MJ3 A;  3ZRF A;  2JZ3 B;  1V49 A;  2Q5W D;  3EFU A;  4EZK A;  4K7U A;  4DDG D;  5CHW A;  1CZP A;  1E9M A;  2KTF A;  2ZJD A;  4GLS C;  2E3T A;  3GOE A;  4XWT A;  1LFD A;  1XEE A;  3T9L A;  4MM3 A;  5FR3 A;  5LXH A;  4RF0 A;  3N32 A;  2LFI A;  1V1O A;  3KUC B;  3EA6 A;  3IFW B;  3W5V B;  5JH5 C;  2M0A A;  3W2D A;  1IP9 A;  2WXL A;  4FUL A;  1Q0W B;  3H9D A;  2B76 B;  1FO4 A;  1K8R B;  2YVC A;  3IBE A;  1E0Z A;  2KXJ A;  2V0G A;  4QAY A;  2CHW A;  2I1K A;  1NVI D;  3VR8 B;  2FBW B;  2LEK A;  3S2A A;  1V5O A;  5MPO A;  2E6X A;  2MBB B;  2KWC A;  1OGW A;  2PMV A;  1SJE D;  2RDG A;  1WRI A;  1VZ7 A;  2L00 B;  4GDL B;  2GI9 A;  5BYQ A;  1FD6 A;  2DYO A;  2G1E A;  1Z5S B;  2L83 A;  2WXI A;  2BWF A;  4O1N A;  2NVU I;  4JE3 B;  2LGD A;  1WR1 A;  4FXC A;  3WAN A;  4KGR A;  1WXA A;  2LHD A;  4W9F A;  4AUQ C;  1KJT A;  3ZNI D;  2IY1 B;  4GN1 A;  3AH7 A;  2R61 A;  2MWS B;  3VTU A;  1V86 A;  4ARI A;  5IP4 D;  1FXI A;  4FHJ A;  1WJU A;  2ONQ A;  2NCN A;  1JWS D;  2INC C;  1S3S G;  2N7J A;  2KJ6 A;  3QAQ A;  2G4D B;  1WXS A;  4WJN A;  4XX5 A;  1V5T A;  2FCQ A;  4RF1 A;  4XGA B;  2JYT A;  2WXJ A;  2BYT A;  4FLH A;  2PPH A;  3VDZ A;  1I4G A;  3PLV A;  1MHH E;  2IZV B;  1KFY B;  3U7Z A;  2JQR B;  3OG5 A;  1E7P B;  2J7Q B;  4W9L A;  2W82 A;  4P7I A;  1F1H A;  5G5H A;  4LNI A;  4ZDV A;  3CMM B;  4KIK A;  4WWM A;  2W3S A;  2RMM A;  3R2T A;  2WDT B;  3AM9 A;  2CS4 A;  3U8Z A;  2LGX A;  1AYF A;  3HHM A;  5HI1 A;  4FBJ B;  4MAC A;  4KVG B;  2IO2 B;  4G50 A;  3RUL A;  2QDF A;  1FFU A;  2HD5 B;  1TGZ B;  4M0W B;  4P16 A;  2M8S A;  4KZC A;  2N9L A;  3ML8 A;  3QIJ A;  4HCN B;  1QOB A;  1WX7 A;  2G3Q B;  1Q5W B;  2BYE A;  2R2O A;  2KWU B;  4BBN C;  4YTP B;  5CTR C;  4HJG E;  5JHB A;  1VCB A;  4J6I A;  3O13 A;  3QA8 A;  3UQB A;  2ZNV B;  2WXP A;  3VH3 B;  1EO6 A;  1I4R A;  2KAJ A;  1SB3 C;  3CSF A;  2WXN A;  4DWF A;  3NHE B;  4GXB A;  1MFW A;  4HRS A;  4YWG G;  1T0R C;  1H8C A;  3W9C B;  1STE A;  1UNS A;  4WAA A;  3RI7 C;  3DWM A;  3HIZ A;  3R7R A;  3R66 C;  3PT2 B;  2EKE C;  3FAH A;  1JRP A;  2GBR A;  4ZRP A;  4FAD A;  4LNO A;  2FAZ A;  4G11 A;  2WU2 B;  3I63 C;  3TJP A;  3N9Y C;  4AWJ A;  3AB5 A;  5CHF A;  2IDY A;  2JSV X;  2NS5 A;  1HQR D;  1FFV A;  1NDD A;  1OQR A;  3J9C A;  4HRO A;  4BKG A;  2DEN B;  3ABV B;  5GXG B;  4K81 A;  2EMT A;  2O6V D;  3BZD B;  5BYR A;  1L0V B;  1KLV A;  5IN7 A;  2KDM A;  3D32 A;  3OJ4 B;  4W9I A;  1EU4 A;  1V9J A;  3JVZ X;  1FCL A;  5AUI A;  4URK A;  4NQL B;  3AN1 A;  3NJT A;  1RLF A;  1YX5 B;  3ZJV A;  1JQ4 A;  3URY A;  1F52 A;  3ZTD A;  2ZW0 A;  3P4R B;  3AEA B;  3L17 A;  2JXT A;  2LVO A;  4C80 A;  4NZL B;  2R2Q A;  4GDK A;  1FRD A;  5J18 A;  2RSU A;  4I6N B;  3B1L X;  4HJK A;  2KMC A;  2D3B A;  2PJH A;  3GE3 C;  4IG7 B;  4K7S A;  2D3G A;  2N7D A;  2M4N A;  1R4N B;  3B9J A;  1SEB D;  3LYY A;  2KN4 A;  5TR5 A;  1BML C;  4C00 A;  2WYQ A;  1SE3 A;  1MI0 A;  3SFE B;  2N9K A;  1T0Q C;  1NEK B;  5L83 A;  2K8B A;  2NMQ A;  3U4E G;  3N1X C;  4B95 A;  4HLE A;  1PGA A;  1E90 A;  2LGI A;  3A4S C;  2KLC A;  3RNG C;  1QIL A;  5LNK 1;  2MQJ A;  1V97 A;  2CJN A;  2DWQ A;  2KHW B;  5E6J A;  5G55 A;  2M19 A;  3AU4 A;  3FKY A;  2AQ3 B;  1E10 A;  2C9W B;  2JX5 A;  3QCA A;  3TL5 A;  1P9D U;  3I9V 1;  3BVG A;  2J4X A;  2W3R A;  3RNB C;  4HK2 A;  2WXM A;  2XNA C;  2VH2 A;  3E56 A;  1R4N I;  1L4D B;  4JPS A;  2Z0E B;  1YNT E;  1WE7 A;  5AZF A;  4WJO A;  4EUT A;  1NEN B;  1FPY A;  3VRA B;  1G6J A;  4B0E A;  1TIF A;  2WQY B;  4C56 C;  3ZTC A;  2FIF A;  2MCN B;  1MHX A;  2GB1 A;  2LXC A;  1FIQ A;  4OZA A;  1J7B A;  3B2F A;  2K6Q A;  3HK0 A;  1JWU D;  2AYO B;  3DOW A;  3FIL A;  2BKF A;  1I4Q A;  2HTM E;  1M4V A;  4L2Y A;  1WIA A;  5LLI A;  1P1A A;  3AE1 B;  2W9N A;  1RYJ A;  1PGX A;  3KWV A;  2OJR A;  2Z0D B;  1X1M A;  1ESF A;  3HVD A;  1CQV A;  1B1Z A;  3H7P A;  1WJ4 A;  5KHQ A;  3Q8B A;  1C3T A;  3QJZ A;  2KX0 A;  1L2N A;  3EC8 A;  2EMS A;  1D3Z A;  1MVK A;  2BW2 A;  4XE0 A;  4ANU A;  4WWN A;  2LGY A;  4KIK B;  3T3O A;  2MA9 B;  1TZ1 A;  2JXX A;  4NQK E;  4IC7 B;  1WX9 A;  3AE3 B;  2L05 A;  3EHV A;  4AQ7 A;  1J7C A;  2JY6 A;  4HDO A;  3AEC B;  4MSM B;  1SE9 A;  4MEL A;  3U7D A;  1QOF A;  2IYD B;  4P6V F;  3UIN B;  4HKQ A;  1C77 A;  1VLB A;  2CR5 A;  1KF6 B;  1ET9 A;  4K7W A;  2IBI B;  3H1U A;  4BKS A;  3BYY B;  1I7H A;  2Y3A A;  2LRU A;  2C7H A;  1YMH E;  2K6D B;  3ZUN A;  1XLO A;  2Z59 B;  3CWI A;  2DHZ A;  3VUX A;  1CJE A;  2BVC A;  2L0T A;  1YOV B;  2I2Y A;  2WS3 B;  3V05 A;  5DPW A;  4WUR A;  2KC2 A;  2L1A A;  4USA A;  3VHT C;  4JQW C;  1BT0 A;  1MPE A;  4NJC A;  3V6E B;  3DBH B;  4ARC A;  1AWD A;  2RDH A;  4AJY B;  4NPN A;  2V9H A;  1EM7 A;  1UZX B;  3Q3O C;  1E7V A;  4D2K A;  3ETR A;  2KVZ A;  1L4Z B;  2KT7 A;  4GU2 A;  1L6V A;  1GAQ B;  2WXR A;  3ZNH B;  1C4C A;  3ZO5 B;  2K39 A;  4IM0 A;  2MLB A;  1GC7 A;  4W9G A;  3PV1 A;  3M95 A;  3VH4 B;  4OVU A;  2N4F A;  1C1Y B;  2YEP B;  2DNF A;  3KWL A;  4K1R B;  4LDT B;  2LWP A;  2DZI A;  1FNV A;  5BO4 B;  4B9K A;  1K53 A;  1K52 A;  2K8H A;  4RGT A;  3LXF A;  2O2V A;  1P0R A;  4MEM A;  3TMP B;  1UH6 A;  3A9K A;  2NBV B;  3BK1 A;  2KDE B;  2V4I B;  1OEY J;  2CU3 A;  1BUI C;  1DOY A;  3AV8 A;  3AE8 B;  2KYW A;  4OVV A;  1RFK A;  2KK8 A;  3DHG C;  2KN5 A;  1UGM A;  1F77 A;  2OJW A;  1N61 A;  1YN5 A;  3EFC A;  4IKG A;  4WWP A;  4B6W A;  5C2T B;  4MGI E;  5D3I B;  3MC0 B;  1YN4 A;  3X23 A;  4PYU A;  2AQ2 B;  4MGZ E;  2MH7 A;  1JWM D;  2MRP A;  4RNA A;  4ZYS A;  1WZ0 A;  4LLG M;  4RCO A;  5IAA C;  2NPT B;  1FNW A;  1VRA B;  2N9E B;  4N59 A;  1T0S C;  2LJI A;  3I5J C;  3ZNG C;  1JML A;  2LI5 A;  3KQ4 A;  4A9A A;  3P2B A;  2KWV B;  1UGJ A;  1EWC A;  1N63 A;  3B0A A;  4YTM B;  4CO7 A;  2AEH A;  2KMA A;  1KH0 A;  1Y8R C;  1XCQ L;  2G4S A;  4GOC A;  2AX5 A;  3W1Y A;  4TUU A;  3A4R A;  1ZDV A;  4OW0 A;  5IO9 A;  5L95 C;  4HKZ E;  3HRD D;  5EE3 A;  4C7Z A;  4A90 A;  1YQ3 B;  3ZIM A;  4MJS A;  5E6P A;  5JZE B;  1E6E B;  4N6E B;  1KOT A;  4KSL C;  3AU5 A;  1TYG B;  3RD2 A;  2K3U A;  3RZF A;  4NJ7 A;  2XK5 A;  1DGJ A;  3HM3 A;  3AI5 A;  3FIL B;  1N5W A;  1WY8 A;  1TS3 A;  3R7Q A;  1U4A A;  3IT6 B;  4KDL B;  1P7E A;  4CHK A;  3P4S B;  2OED A;  2NBW B;  4BVU C;  2BKR B;  1NI3 A;  3VTW A;  4FHK A;  2BTE A;  2PIA A;  3H7P B;  2IO0 B;  5G2N A;  4GMV A;  3R8B A;  4YL8 A;  1YJ1 A;  4HPL B;  2K25 A;  4ZRJ A;  2JU6 X;  4W9C A;  1AN8 A;  1JWB D;  4BOS C;  1QLB B;  5D7G A;  4YTN B;  2LHE A;  1J19 A;  1J0G A;  4ITK A;  4LNF A;  1WWT A;  2VZK B;  4GIV A;  2GOW A;  3NZU A;  3SD5 A;  3L54 A;  1UBI A;  2J0J A;  3PLU A;  2FE8 A;  2KFJ A;  4WIP A;  3ZYY X;  4BKS D;  1NBF C;  3C8Y A;  2EEL A;  3QQ8 B;  1C9F A;  1ZDX A;  3RNA C;  2QC8 A;  3KVF B;  3ZJU A;  4I6L B;  2KDB A;  3AEF B;  3T8M A;  3ML9 A;  5IKC M;  3KLS X;  5JHA A;  3VXW A;  4JLC A;  2C5L C;  3SFD B;  2IGG A;  4KDI C;  1WGK A;  3U52 E;  1QKZ A;  1ZPS A;  4RM8 A;  3BVM A;  1PDX A;  2J53 A;  3A9J A;  3VAW A;  1TY0 A;  2ZVO A;  1TS4 A;  2HDE A;  3IAS 1;  1B9R A;  1SJH D;  3RNC C;  1GJZ A;  3WAM A;  2AWT A;  1L0Y B;  3ONS A;  2AQ1 B;  3NUH B;  2C7N B;  3SU8 X;  2KD0 A;  1Q1O A;  3N1Y C;  4LJP B;  4FA6 A;  2PVO D;  4K3B A;  4A8X C;  2WXO A;  3PRZ A;  3ZQ4 A;  1I4X A;  2LVP A;  3K9P B;  4M00 A;  3DQV A;  3PRM B;  4YSZ B;  3ZKJ C;  4I6P A;  2BB6 A;  4YSX B;  4ZRQ A;  4LCD E;  2ZPN A;  1ROE A;  1IPG A;  1ZP0 B;  3EGR A;  4FN2 A;  4PS3 A;  2FCS A;  2L76 A;  4A3P A;  4ANV A;  2KLG A;  5D94 A;  1MJD A;  3ECI A;  2KC1 A;  2CJO A;  4ACF A;  4BFR A;  1WXQ A;  2M17 A;  4DDI D;  1RM6 C;  1F2R I;  4W9J A;  4PT5 A;  5D6J B;  3Q8E A;  4ZRK A;  4IUM B;  2ZEQ A;  4TMA B;  1WH3 A;  1XT9 B;  2REX A;  5T8I A;  3UIP B;  4KV2 A;  2O2V B;  2D10 A;  4W9H A;  4OZC A;  4EZL A;  4WQO B;  2KTR B;  3A9K B;  3C0R B;  3KUD B;  4P1C C;  5EE1 A;  2IPK D;  1C79 A;  3H6N A;  3NVY A;  2INN E;  4NY0 A;  3N20 C;  1DOX A;  2N7E A;  2JVC A;  1V6E A;  1WFY A;  2YEP F;  4C4V A;  3P63 A;  4JWU C;  3U30 A;  2GMI C;  3UIO B;  1P3Q U;  5BMH A;  4A20 A;  2LVQ A;  4ASW C;  2ICI A;  1WGH A;  3DVG X;  4W9E A;  2LUE A;  3TBL D;  1V2Y A;  3DBL B;  4CQN A;  3LDZ E;  1F9J A;  2HJ8 A;  1FXA A;  3LB8 C;  4E71 A;  3M3J A;  3BII D;  2FUG 1;  1GG3 A;  4G0N B;  2G9H D;  2NPT A;  5H92 C;  2KJR A;  1SXT A;  1OQQ A;  1TJE A;  4YXD B;  1UWX A;  3AUL A;  3QC8 B;  4MSQ B;  4MH8 A;  2UYZ B;  1SBB B;  4LNK A;  1V80 A;  1ZOY B;  3LJ3 A;  2BGF A;  4ZOH C;  4IW0 A;  4DHZ B;  1J7A A;  4HPM B;  2H88 B;  4RH6 A;  3ZNZ B;  2D3A A;  1XXG A;  4ICU A;  3VTV A;  1ET6 A;  2DYB A;  3GP7 A;  3B08 A;  4MJS B;  2DAJ A;  3ALB A;  3W5U B;  2JZP A;  3JYU A;  3JSV A;  5FKA C;  4EKU A;  2XK5 B;  1KTK A;  2KDI A;  2K8C A;  2KMM A;  3MFG A;  4JIO U;  1CMX B;  1WM3 A;  2D11 A;  4JX1 C;  1RAX A;  1WZ3 A;  4EEW A;  2MSE D;  1XF5 L;  2XBB C;  3L16 A;  3PHW B;  1Y56 A;  3ZXR A;  4TSS A;  2IJ0 A;  2LZ6 A;  2L32 A;  3MHZ A;  4IWP A;  3V6C B;  4JWS C;  2HTH A;  4WJP A;  1ZUD 2;  2KNB A;  4TV3 A;  4ZRI A;  3VUW A;  3PTF C;  4DQO C;  4X57 B;  3P4Q B;  1ZW7 A;  3ZJT A;  3RT3 B;  2FCM A;  3BY4 B;  2MX2 A;  3AE4 B;  3UGB B;  3IHP C;  2GBN A;  4B0M A;  2JF5 A;  3SDL C;  5IA7 A;  2V3S A;  4BBN F;  4S17 A;  2IGH A;  2K1F A;  5HKH A;  4HXD A;  1ZKH A;  2KAN A;  2X38 A;  2BYF A;  1QOG A;  2N1W A;  2FNJ B;  4LTU A;  3A9J B;  1WF9 A;  3AEB B;  1VR9 A;  5FK9 C;  3V62 A;  1E8Y A;  5G5G A;  4PS7 A;  3RZW C;  2JUO A;  2NR2 A;  4DHJ B;  2VRR B;  4US8 A;  3TEY A;  1K51 A;  1LQB A;  4DXG A;  3CF6 E;  2V3P A;  1IGC A;  3ZDT A;  3T3N A;  3P4P B;  3U2S C;  4P1B C;  1I4H A;  1DYQ A;  1ACC A;  4EFO A;  4FJV B;  3A1Q A;  4W9K A;  1IGD A;  2CU1 A;  2J0M A;  1C4A A;  3VVW B;  3MP9 A;  2IO3 B;  4E74 A;  1TKG A;  4M8N A;  3APC A;  3TIX A;  3Q3J A;  4XDC A;  1XLQ A;  5BMI A;  2J42 A;  4DBG A;  3RNF C;  1HE8 A;  1FNU A;  1PYW D;  3I57 A;  3RUI B;  2ZVN A;  3IXS A;  4US9 A;  2DZK A;  4LDT D;  2FID A;  4PK1 A;  4NAW A;  3AEE B;  2PE6 B;  4KX6 B;  1E8X A;  2HE7 A;  1H4R A;  1TBE A;  2WU5 B;  3UF8 A;  3WAO A;  4AS1 A;  4ZYN A;  3NVZ A;  3WA0 A;  3V61 A;  2KZR A;  1E5W A;  2V4L A;  2GRI A;  2QHO A;  3DBS A;  4A6Q A;  2RD0 A;  3L0W B;  2KWD A;  5EE0 A;  2BT6 A;  2Y5C A;  3DBH I;  2K5P A;  1C76 A;  2QMT A;  1TT5 B;  3RCZ A;  3N3K B;  1TZO A;  2KTR A;  1QT9 A;  3GZN B;  2ACZ B;  2MBQ A;  2V1Y A;  4RM9 A;  2W54 A;  4C4V B;  2RPV A;  1VD2 A;  2LAS A;  4EZJ A;  3N1Z C;  3TEW A;  2MJD A;  1MG4 A;  4G3X B;  4XYC A;  3RPF C;  2FCN A;  1ZGU B;  1FMA D;  1Z2M A;  3DVG Y;  4LK0 M;  4IM3 A;  4F8C B;  3DVN V;  3PRE A;  3MHS D;  2OOB B;  3E9S A;  3NVW A;  3Q8F A;  4FJY A;  1F0Z A;  4OZB A;  1IBX B;  3ZVV A;  1WGD A;  4RMA A;  2WX0 A;  3L13 A;  2O6V A;  1ISN A;  3KYD D;  2L52 A;  2A5U A;  2KAC A;  2XEW A;  3GZN I;  4F1S A;  5C23 A;  2CKH B;  2BQQ A;  1JCK B;  2Y5P A;  4IDI A;  2QSD A;  3DDC B;  4RFB A;  2PKO A;  1GB1 A;  3PPA A;  3KW5 B;  3OJ3 A;  1HXY D;  1FEH A;  4IWQ A;  4ZHO A;  2BS4 B;  2OHF A;  4HWI B;  1J8C A;  4HEA 1;  2KO3 A;  3DCG A;  1JW9 D;  1KLU D;  2PTL A;  2NTS A;  3C19 A;  1NYR A;  4XDD A;  1TKE A;  3JSV B;  3ZW3 A;  2K22 A;  5C3J B;  4XWW A;  3P42 A;  2WHI A;  4EOY A;  1UF0 A;  3GS2 A;  2PW9 A;  3O65 B;  2SAK A;  1LXD A;  2UWQ A;  5AZH A;  3VRB B;  2DLB A;  2BYV E;  2C60 A;  5E6O A;  3I3T B;  1I42 A;  3MJW A;  2LJ5 A;  5DPS A;  4WAF A;  1D5Z C;  1GUA B;  3A33 B;  3PZ7 A;  2M0X A;  3Q3N C;  2ASQ A;  1OEY A;  2LD9 A;  4CYE A;  4OHJ A;  2ZW1 A;  2JT4 B;  3Q3M C;  4M02 A;  4WH4 A;  1YJJ A;  1YD8 U;  1SIJ A;  4BZA A;  2VZK D;  3OWE B;  2EKI A;  3MTN B;  3ZXV A;  1UD7 A;  2DYM A;  1WRD B;  3APD A;  1ZXH A;  2D3C A;  1PFD A;  1HTO A;  2MHJ A;  2WXF A;  2HJ1 A;  3OLM D;  3TEX A;  1KM7 A;  3HVZ A;  1TY2 A;  5LXI B;  3H8H A;  2WLB A;  4A3O A;  4KGS A;  3AE6 B;  3PVL A;  4HCP B;  1A5R A;  1I35 A;  1YIW A;  5EE9 A;  1LGR A;  3APF A;  2QJL A;  1KLG D;  2L7R A;  2WDQ B;  3HM6 X;  2QIE B;  5DPR A;  4ZHP A;  1HTQ A;  1WXM A;  2J0K A;  3VFK A;  2LGS A;  1SE2 A;  1RFA A;  4N9F 4;  4REZ A;  3TUO A;  2KFK A;  1E8W A;  2KQS A;  2ZCB A;  3NY5 A;  2N0S B;  3DHH C;  4W9D A;  1YJI A;  4MGK E;  2MBH A;  1FXT B;  4ICV A;  1SGH A;  1V1P B;  3A1Q B;  4H2A A;  1WJN A;  3BWU D;  5DPT A;  3H7S A;  4WJQ A;  3PZ8 A;  3TSS A;  3AE5 B;  1WSP A;  3Q8A A;  3PGE A;  3AEG B;  3VUY A;  1ZXI A;  3NS8 A;  1EUV B;  3R3M A;  1WJ6 A;  4YSY B;  1XLP A;  1YQ4 B;  3OAW A;  3ZGZ A;  1EF1 A;  5JXV A;  2BF8 B;  2WXK A;  3EUB 2;  4DXA B;  2IY0 B;  4KSK C;  3RYT A;  1IUE A;  5BMG A;  3IVF A;  5D3D A;  2A4Z A;  3VR9 B;  2IND C;  3RN9 C;  3V3X A;  4KGT A;  1HEZ E;  1WMH A;  4NAW B;  3AE2 B;  2L8J A;  2DZJ A;  3NRZ A;  1N60 A;  2KX3 A;  3VQI A;  3AXC A;  3GE8 C;  2WP9 B;  1GOZ A;  2RPQ A;  1WM2 A;  3ZRC A;  4WQM A;  1T5X D;  3FC4 A;  2N9X A;  2Z8L A;  2MW5 A;  2WXG A; 
#chains in the Genus database with same CATH homology
 1C4P A;  1XF5 L;  1L6V A;  1GAQ B;  2TSS A;  2WXR A;  1C4C A;  1D4B A;  3NVV A;  2MJE A;  4JE3 B;  1Y56 A;  4FXC A;  2PVG C;  2H89 B;  4KGR A;  2INP E;  1GPX A;  4N58 A;  2LHD A;  3Q8C A;  4A55 A;  1WYG A;  4TSS A;  2IJ0 A;  2YEP B;  3AE9 B;  2L32 A;  1VZ8 A;  3MHZ A;  3KWL A;  4JWS C;  1SE4 A;  3AH7 A;  1EU3 A;  1ZUD 2;  2R61 A;  2W55 A;  4DQO C;  4ARI A;  3P4Q B;  1FNV A;  1FXI A;  3ZJT A;  1KRH A;  2ONQ A;  3AE4 B;  4RGM A;  2QEJ C;  1K53 A;  1K52 A;  3Q69 A;  1JWS D;  4RGT A;  3GB1 A;  2N7J A;  3LXF A;  4B0M A;  2WDV B;  1JRO A;  4RF1 A;  1SF0 A;  1A70 A;  1SSN A;  3BK1 A;  5TSS A;  2JYT A;  2V3N A;  2WXJ A;  2IGH A;  2V4I B;  2BYT A;  2CU3 A;  1BUI C;  3AE7 B;  4TQ1 A;  1DOY A;  1I4G A;  3AV8 A;  4L23 A;  3AE8 B;  1MHH E;  1KFY B;  1LO5 D;  3U7Z A;  2JQR B;  2K9X A;  2XN9 C;  1RFK A;  2BB5 A;  3SR6 A;  2X38 A;  1E7P B;  1F2R C;  5HG2 A;  1QOG A;  2W82 A;  1F77 A;  1N61 A;  5G5H A;  1YN5 A;  4LTU A;  1UUP A;  4KKJ A;  4KKI A;  4IKG A;  1D6E C;  1IBX A;  3AEB B;  1VR9 A;  2LUM A;  5FK9 C;  1JAL A;  1Q10 A;  5C2T B;  1TS5 A;  5G5G A;  4WWM A;  5D3I B;  1UWM A;  3MC0 B;  2W3S A;  1YN4 A;  2MEK A;  2RMM A;  2AQ2 B;  4L1B A;  3R2T A;  2MH7 A;  1JWM D;  3AM9 A;  4RNA A;  4ZYS A;  4LLG M;  4RCO A;  5AUK A;  1AYF A;  4US8 A;  3TEY A;  1K51 A;  1FNW A;  4DXG A;  5HI1 A;  3CIR B;  2V3P A;  4MAC A;  1IGC A;  3T3N A;  1VRA B;  3P4P B;  3U2S C;  1FFU A;  1I4H A;  1BXT A;  1DYQ A;  4N59 A;  1ACC A;  4P16 A;  2LJI A;  4MM3 B;  1JML A;  2WNM A;  1IGD A;  2N9L A;  2WXH A;  2J52 A;  1D5M C;  3B2G A;  3KQ4 A;  2IGD A;  3L4P A;  1C4A A;  4A9A A;  1GB4 A;  1UGJ A;  1EWC A;  1PGB A;  1N63 A;  1QOB A;  3MP9 A;  2DBY A;  3NZ3 A;  4YTM B;  2WDR B;  4YTP B;  1TKG A;  4HJG E;  1KH0 A;  4XDC A;  1XLQ A;  1R7S A;  3O13 A;  1XCQ L;  1HZ5 A;  5BMI A;  1RWS A;  2J42 A;  3WCQ A;  2AX5 A;  2WXP A;  1FNU A;  1ZDV A;  1I4R A;  4OW0 A;  2KAJ A;  1PYW D;  4HKZ E;  3I57 A;  1SB3 C;  3HRD D;  5EE3 A;  4C7Z A;  2WXN A;  3IXS A;  4A90 A;  4US9 A;  2ON8 A;  4HRS A;  1YQ3 B;  4YWG G;  1QOA A;  4MT5 A;  3W9C B;  1STE A;  1UNS A;  1E6E B;  1DOI A;  3DWM A;  4N6E B;  3FAH A;  1L5P A;  1JRP A;  4ZRP A;  3AEE B;  1TYG B;  2K3U A;  4KX6 B;  1DGJ A;  3BVZ A;  2WU2 B;  1OFF A;  2WU5 B;  3FIL B;  1JWA D;  1TKY A;  1N5W A;  1XLN A;  1TS3 A;  3N9Y C;  3IT6 B;  4AS1 A;  1P7E A;  3NS1 A;  3NVZ A;  3P4S B;  3AB5 A;  2OED A;  2IDY A;  2JSV X;  4DXF A;  1NI3 A;  2GRI A;  3AMZ A;  1HQR D;  1FFV A;  4A6Q A;  5HFY A;  1OQR A;  1P7F A;  3J9C A;  2KWD A;  5EE0 A;  1N5X A;  2BTE A;  2BT6 A;  4HRO A;  2Y5C A;  2PIA A;  3ABV B;  5GXG B;  1ENF A;  1T3Q A;  3R8B A;  2K5P A;  1C76 A;  2QMT A;  1FM0 D;  3BZD B;  5BYR A;  1L0V B;  2JU6 X;  1XCT L;  2KDM A;  1TZO A;  1AN8 A;  3UI3 A;  1QT9 A;  1JWB D;  1L6U A;  4Q2J A;  1QLB B;  5D7G A;  1EU4 A;  4YTN B;  2ACZ B;  2LHE A;  1ZE3 D;  2W54 A;  4TQ0 A;  4ITK A;  2RPV A;  1FCL A;  5AUI A;  1XO3 A;  1WWT A;  2VZK B;  2KQ4 X;  4C7Y A;  3TEW A;  3AN1 A;  3BYT B;  2MJD A;  3RPF C;  1HA5 A;  2FE8 A;  1FMA D;  3DWG C;  4LK0 M;  3ZJV A;  1JQ4 A;  4WIP A;  3ZYY X;  3URY A;  3C8Y A;  2EEL A;  1C9F A;  2ZW0 A;  3IAM 1;  3AEA B;  3P4R B;  1ZDX A;  3E9S A;  3NVW A;  3Q8F A;  1F0Z A;  4OZB A;  1IBX B;  1C78 A;  2JXT A;  3ZJU A;  1I4P A;  4NZL B;  2NTT A;  4C80 A;  3AEF B;  1FRD A;  3KLS X;  3SEB A;  5H8Y E;  2QIL A;  3SFD B;  3TEZ A;  2IGG A;  2L52 A;  3IT4 B;  1WGK A;  3U52 E;  1QKZ A;  1ZPS A;  3BVM A;  1PDX A;  2J53 A;  2KAC A;  2BBC A;  3MJ5 A;  1TY0 A;  3B9J A;  1JCK B;  1SEB D;  1V1P A;  1TS4 A;  2K0P A;  2HDE A;  2KN4 A;  2Y5P A;  2QSD A;  1BML C;  3IAS 1;  3LYY A;  4IDI A;  4J3O D;  1B9R A;  1SJH D;  4RFB A;  1N62 A;  2PKO A;  2WXQ A;  1GB1 A;  1L0Y B;  2AQ1 B;  1SE3 A;  3NUH B;  1MI0 A;  3SFE B;  2N9K A;  1NEK B;  1HXY D;  1FEH A;  2LMC A;  4OVZ A;  1YN3 A;  2NMQ A;  4ZHO A;  3U4E G;  2BS4 B;  2OHF A;  2I38 A;  4M0W A;  1PGA A;  2LGI A;  4HEA 1;  2PVO D;  3HUI A;  1D5X C;  1QIL A;  4A8X C;  2PLP A;  2WXO A;  5LNK 1;  1NYQ A;  1JW9 D;  1V97 A;  2CJN A;  1AW7 A;  2DWQ A;  1KLU D;  1I4X A;  1EWY C;  2PTL A;  3ZQ4 A;  5E6J A;  2NTS A;  1NYR A;  2M19 A;  4XDD A;  2D5G A;  1TKE A;  5C3J B;  2K22 A;  2AQ3 B;  1E10 A;  4YSZ B;  4XWW A;  1FCC C;  2JX5 A;  3P42 A;  3I9V 1;  3BVG A;  2J4X A;  2W3R A;  2BB6 A;  4IOI E;  1VZ6 A;  2WXM A;  4ZRQ A;  4YSX B;  3GS2 A;  2XNA C;  2PW9 A;  2M56 B;  3AED B;  3E56 A;  2SAK A;  5I4D A;  1L0X B;  1ROE A;  1ZP0 B;  3EGR A;  1L4D B;  4UDU C;  5BYS A;  4JPS A;  2JWU A;  3VRB B;  1YNT E;  2DLB A;  1NEN B;  2BS2 B;  3RFZ B;  3VRA B;  2SEB D;  4B0E A;  2CJO A;  2WQY B;  1D5Z C;  1WXQ A;  3PZ7 A;  4WAF A;  4C56 C;  2BS3 B;  1RM6 C;  1F2R I;  3P1M A;  4PT5 A;  1VDV A;  4OHJ A;  2ZW1 A;  4RGN A;  1MHX A;  1VJK A;  4WH4 A;  1YJJ A;  3Q8E A;  2GB1 A;  1FIQ A;  1SIJ A;  1J7B A;  4OZA A;  1QQR A;  2VZK D;  3B2F A;  3OWE B;  2EKI A;  1JWU D;  2DYM A;  3FIL A;  1I4Q A;  2HTM E;  1M4V A;  4L2Y A;  4TMA B;  1ZXH A;  1HZ6 A;  1PFD A;  3AE1 B;  3W1S A;  1RYJ A;  5T8I A;  1PGX A;  3BK2 A;  3KWV A;  1V8C A;  2WXF A;  3R2I A;  1QF6 A;  4OZC A;  3TEX A;  1ESF A;  3HVZ A;  3HVD A;  1TY2 A;  1CQV A;  1B1Z A;  3H8H A;  2WLB A;  5EE1 A;  2IPK D;  4KGS A;  1C79 A;  1CK1 A;  3Q8B A;  3AE6 B;  5HHD G;  3NVY A;  2INN E;  4R3D A;  5EE9 A;  1FRR A;  4EE2 A;  2QJL A;  1KLG D;  4RGO S;  4NAM A;  1DOX A;  1MVK A;  1PUT A;  2BW2 A;  2WDQ B;  2YEP F;  2QIE B;  3P63 A;  4JWU C;  4XE0 A;  4ZHP A;  3T3O A;  1SE2 A;  4GDK B;  1K50 A;  4REZ A;  3TUO A;  5BMH A;  3PO0 A;  1T6B X;  2N0S B;  3AE3 B;  2ICI A;  4AQ7 A;  1J7C A;  1YJI A;  3AEC B;  2JYE A;  4YT0 B;  1TS2 A;  2MJ3 A;  2Q5W D;  4CQN A;  1QOF A;  1V1P B;  4P6V F;  4H2A A;  3BWU D;  1FXA A;  1C77 A;  3LB8 C;  1VLB A;  4HKQ A;  3PZ8 A;  3TSS A;  3AE5 B;  3BII D;  1CZP A;  1E9M A;  1KF6 B;  2FUG 1;  4GLS C;  2G9H D;  1WSP A;  3Q8A A;  5H92 C;  1ET9 A;  1SXT A;  1OQQ A;  2E3T A;  3BYY B;  1I7H A;  2Y3A A;  1TJE A;  4YXD B;  1UWX A;  1YMH E;  4XWT A;  1XEE A;  5FR3 A;  1XLO A;  4RF0 A;  3AEG B;  2LFI A;  1ZXI A;  1V1O A;  4MH8 A;  3CWI A;  3EA6 A;  3W5V B;  1SBB B;  2M0A A;  1CJE A;  1XLP A;  1YQ4 B;  4YSY B;  3W2D A;  3ZGZ A;  1ZOY B;  2WXL A;  1FO4 A;  2B76 B;  5JXV A;  4ZOH C;  2I2Y A;  2WS3 B;  3V05 A;  1E0Z A;  1J7A A;  2WXK A;  3EUB 2;  2H88 B;  4WUR A;  4RH6 A;  2V0G A;  1XXG A;  2L1A A;  1ET6 A;  1IUE A;  3GP7 A;  4USA A;  1NVI D;  3VR8 B;  5BMG A;  2FBW B;  2LEK A;  5D3D A;  1MPE A;  4NJC A;  3VR9 B;  3W5U B;  3V3X A;  4KGT A;  1HEZ E;  2JZP A;  5MPO A;  2E6X A;  4NAW B;  5FKA C;  3AE2 B;  4ARC A;  3NRZ A;  1AWD A;  2RDH A;  1KTK A;  1N60 A;  2PMV A;  1SJE D;  2KMM A;  2RDG A;  3VQI A;  1WRI A;  1EM7 A;  3MFG A;  1VZ7 A;  4GDL B;  2GI9 A;  2WP9 B;  1GOZ A;  4D2K A;  3ETR A;  1L4Z B;  1T5X D;  3FC4 A;  4WQM A;  5BYQ A;  1FD6 A;  2DYO A;  2Z8L A;  2G1E A;  4JX1 C;  2L83 A;  2WXI A;  2WXG A;  4O1N A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...