2IY1B

Senp1 (mutant) full length sumo1
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
83
structure length
83
Chain Sequence
b'EYIKLKVIGQDSSEIHFKVKMTTHLKKLKESYCQRQGVPMNSLRFLFEGQRIADNHTPKELGMEEEDVIEVYQEQTGGHSTVC'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SENTRIN-SPECIFIC PROTEASE 1
publication title Sumo Protease Senp1 Induces Isomerization of the Scissile Peptide Bond.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/nuclear protein
total genus 18
structure length 83
sequence length 83
chains with identical sequence D
ec nomenclature
pdb deposition date 2006-07-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF11976 Rad60-SLD Ubiquitin-2 like Rad60 SUMO-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 2iy1B00
1S1QB 2KMAA 4FHKA 4IWOA 4KV2A 4HVBA 4DXAB 3UINB 3DBLI 1OEYA 2KNBA 2L8JA 3IG3A 1P3QU 2L76A 2ASQA 4FN2A 5JHBA 5KHOA 1WGHA 1WM2A 4MSQB 4ICUA 4TUUA 4BKSD 1KOTA 4IWPA 1WR1A 2FCSA 2LXCA 3ZNZB 2MBHA 3EECA 1VCBA 4GIVA 1ISNA 4TKNA 2WDTB 1YD8U 4AWJA 4XX5A 2G45B 1SIFA 3QK0A 3QHTA 1HE8A 3H7PA 4TV3A 3VDZA 3DQVA 3H7PB 3L13A 2CS4A 3ECIA 2ZCCA 4X57B 2HE7A 2L0TA 3AULA 2KLGA 2WX1A 4K7UA 3PRPB 3PHWB 4W9DA 3ZRCA 2C7HA 3VVWB 3QX1A 2D07B 4GGQA 4G3XB 3X23A 1UD7A 2CHXA 1J8CA 1Q0WB 3ZDMC 3PLVA 1H4RA 3RCZA 3PZDA 3V6EB 3SU8X 4WJQA 3A33B 4MJSA 2GBJA 3TCAA 1V80A 3A4SC 4URKA 4MJSB 3AXCA 2PJHA 4KSLC 1V86A 4ANVA 4N9F4 2KJRA 3W1YA 3SHQA 1WF9A 1SE9A 1YIWA 2KK8A 3W1SC 2G4SA 4IW0A 2FIFA 2RGFA 2AEHA 4MGIE 3M3JA 3NS8A 4DWFA 2FUHB 2L0FA 4A3PA 4KIKB 4WJPA 2I1JA 3DCGA 1I35A 2BYEA 1EF1A 4JL9A 4KSKC 2DZIA 3MJWA 2KQSA 2CKHB 3APCA 1E8ZA 4WJOA 2K39A 5TR5A 1WXVA 5D2MB 2EMSA 3K9OB 4MGYE 1UBQA 2RR9A 3W1SA 4NNJB 3VQIA 1GG3A 4LCDE 2Z59B 3PHXB 2K25A 5JH5C 2KLCA 1JRUA 1Z2MA 4HJKA 1RFAA 4MGKE 4JIOU 3TL5A 4K1RB 4FJYA 4DDID 4PS7A 4ZYNA 2JRIB 4HDQA 5IA7A 3TIXA 2JPHA 1NBFC 2GBMA 4GDKA 1WM3A 1NDDA 1WMHA 4W9CA 1WMHB 1WFYA 3N32A 1GC7A 3S2AA 3RT3B 2K6DB 3ZNID 3M95A 4MM3A 1C3TA 4W9FA 2AWTA 2MA9B 4ZRJA 3OAWA 3ZKJC 4ANWA 4EZKA 2JY6A 3ZDTA 3VAWA 2KHWB 5J18A 2MW5A 3BINA 2G4DB 2BPSA 1TGZB 2KXJA 3X0WA 3MTNB 4ANXA 2LD9A 2Y5BB 4IWQA 4B6WA 2N9EB 4ICVA 3ZNGC 3OLMD 2A5UA 3TBLD 2D11A 2Z0EB 2K8CA 3APDA 3A9KA 2MBQA 1S3SG 3ENEA 1RAXA 2L00B 5J17A 1V9JA 1L7YA 2DAJA 2R2OA 2DX5B 5D6JB 4GOCA 4E71A 1UGMA 2O2VA 1J19A 2UYZB 2MP2A 4RM9A 2JXXA 3VTUA 1KJTA 1MG8A 1WH3A 1KM7A 2J0KA 3L17A 4CO7A 4BOZB 3QARA 3VHTC 4AUQC 5G55A 5GMVA 3WIMA 1ZGUB 2M17A 4MELA 4IM3A 2KWUB 2NVUI 3D32A 3H1UA 2MLBA 2EKEC 2UWQA 3ALBA 2J0MA 2ZZPB 4GSWA 4HXDA 1Z5SB 2C60A 3KYCD 1EO6A 1R4NI 3VXWA 1WJUA 4GDLB 3IHPC 2LZ6A 2NPTA 2FCMA 2BYVE 2AL6A 2IZVB 4KDIC 3SD5A 3A1QA 3L16A 3A1QB 2RD0A 3UQBA 5BO4B 1LFDA 3KVFB 1SGHA 3PTFC 5G2NA 4TQ0A 3PLUA 2JWZA 4G11A 3L0WB 5CHWA 2LGDA 1E90A 3NY5A 4OVUA 1FXTB 2L3ZA 4B9KA 5CHVC 4RMAA 2IY1B 2FIDA 2MWSB 4HPMB 3Q3JA 1WJ4A 2XK5A 3U7DA 3MHSD 2IBIB 2M0XA 1G6JA 2KWVB 5HKHA 4NQLB 3V61A 4F7ZA 4W9EA 3ZUNA 2ZVNA 1H8CA 4CHKA 4ZDVA 1E5WA 4W9KA 4M8NA 3DBSA 2KFJA 2KN5A 2NBWB 2KQ7A 3Q3FA 2CHWA 4PS8A 3WALA 2ZVOA 4EFOA 3IVFA 3HM3A 2FCNA 4NY0A 2WYQA 3HHMA 1LM8B 1XQQA 1VD2A 1WJNA 1XD3B 1P98A 2KC2A 2OOBB 3R66C 4KVGB 5EDSA 4ANUA 1ZKHA 3CMMB 2B3AA 4EUTA 4WAAA 3ZO5B 1K8RB 3OJ4B 1E7VA 3JSVA 3R7RA 3T8MA 1F9JA 1T0YA 3JVZX 3JSVB 2QHOA 5AZGA 4IC7B 2CU1A 3AU5A 3T9LA 2N1WA 2BYFA 3V62A 2JRHA 4AP4C 3PGEA 4AJYB 1WIAA 4BFRA 4EZJA 2N4FA 4GXBA 1YX5B 1R4MI 4FADA 2LGXA 2LUEA 3CSFA 3VTWA 2MBOA 2C5LC 2KKCA 4FHJA 4NJ6A 2DAFA 4II3B 5E6OA 4P7IA 1WGYA 4XC2A 1RRBA 1UH6A 2NBVB 2KTFA 3RYTA 2DHZA 2V3SA 1V2YA 2FAZA 2MRPA 2LI5A 3ZVVA 2BKFA 2GOWA 3KUCB 3PPAA 3UIOB 5IAAC 3ML8A 2MQJA 2MX2A 3HIZA 4TQ1A 2MBBB 4W9GA 3I3TB 1WX7A 4W9HA 4E3CA 2HD5B 2MCNB 4GDKB 3ZW3A 2V1YA 4PS3A 2J0JA 3LDZE 4HWIB 3R7QA 1Q1OA 2RSUA 1TBEA 1Y8RC 2GBKA 3VFKA 4DHJB 2KZRA 4HDOA 5DPSA 2KC1A 3NZUA 2KO3A 4WWOA 3RZWC 4DHZE 3NHEB 4IM2A 2WX0A 2C7NB 2KJHB 4M0WB 2DYOA 1OQYA 2KVRA 2KTRA 3ZNHB 2N9XA 3O65B 2K6QA 2KTRB 5CHFA 4BKGA 1WXMA 1TZ1A 4E74A 2ZPNA 3A9KB 2FCQA 1GUAB 3HK0A 4DHZB 5LXHA 5DPRA 2C9WB 3QWZB 1CMXB 3WAPA 1NI2A 1E8XA 1P0RA 2O2VB 2KOXA 3V6CB 2MSED 2MP2B 2W9NA 3WANA 2DYBA 3A4RA 4FJZA 4BKTA 4YL8A 2GBRA 2ZJDA 1WGRA 4HCNB 4WWNA 5DPTA 1WZ0A 2REXA 3QC8B 4I6LB 1E8WA 4WWPA 4BBNF 4MH0E 3B0AA 1U4AA 4GU2A 4FLHA 1WJ6A 2D3GA 4NJ7A 2ZEQA 2KFKA 2BKRB 2LGYA 2IO0B 3PV1A 3RULA 4F1SA 2GMIC 2NPTB 4IUMB 4NAWA 4NQKE 5L95C 1IYFA 2N7EA 3VTVA 4NAWB 4K81A 3RZFA 3VH4B 3ZRFA 2BF8B 1V5OA 4JLCA 4MEMA 5LXIB 2HJ8A 4K7SA 2YVCA 1WGGA 3ONSA 2LJ5A 4XZ4A 2KMCA 5D7GA 4LDTB 2IO1B 2NS5A 3NZSA 3PT2B 2NCNA 1RLFA 3N3KB 3K9PB 4FBJB 5C23A 1AARA 2LVPA 2I1KA 3L10B 5D94A 5KHQA 1Q5WB 1V6EA 1YX6B 5CX3A 4I6NB 2JZZA 1WY8A 3HM6X 2XK5B 1WGDA 3V60A 4W9JA 2HTHA 3VUYA 4EKUA 2LVOA 2PEAA 2IO3B 2IY0B 3DVGY 2O6VA 2GBNA 1GJZA 1X1MA 2O6VB 3UGBB 3PS6A 3VH3B 3ZIMA 4EOYA 4HLEA 2L05A 1V81A 2L7RA 2DYMA 2JVCA 1WZ3A 1J0GA 1WX9A 1V49A 1E8YA 2DENB 2KDBA 4JGHB 5DPWA 3H9DA 3B1LX 3RD2A 2JT4B 2VRRB 1A5RA 1L2NA 4DDGD 2LRWA 2D2QA 4RM8A 2NR2A 3QIJA 4LJOB 5E6NA 4BKSA 4A3OA 3IFWB 3ZTDA 3DVNU 3M62B 2N9PC 4K7WA 4G50A 3TMPB 5L83A 3AU4A 3P2BA 4BOSC 4IG7B 3WA0A 4GB9A 2LASA 1WR6E 5C1ZA 2OJRA 1IPGA 4HCPB 2JF5A 2JZ3B 3C0RB 4AOFA 2XEWA 3KUDB 3H6NA 2DZMA 4FA6A 5CTRC 1QZEA 2BGFA 2XBBC 1TTNA 2LWPA 4KZCA 4MGZE 3PREA 4WQOB 3OJ3A 4W9LA 2CHZA 2ZPYA 5JZEB 4MSMB 2ZCBA 2EMTA 4KIKA 1E7UA 3DBRI 3EHVA 2IO2B 3KYDD 2KX3A 4OVVA 1GNUA 4DHJD 5AZHA 5AEKB 2LXAA 2R2QA 3BY4B 4PYUA 1LQBA 3LJ3A 3QCAA 1WXSA 3WAMA 3QQ8B 3PRZA 3KUZA 3KW5B 4II2B 2IYDB 1OGWA 3PVLA 1WX8A 1OTRB 2WWZA 2ZNVC 4A20A 2M8SA 2N7DA 3DVGX 4FULA 3WAOA 5J2RA 4BVUC 2LRUA 3NOBA 1WI0A 4HPLB 4KDLB 4KZ0A 2CR5A 1UZXB 2YLMA 3ZLZA 3M63B 2LVQA 2V4LA 1LXDA 5AZFA 2KJ6A 3UIPB 2G3QB 4FJVB 5JHAA 3DVNV 4I6PA 2AL3A 5DCNA 3VUWA 3U8ZA 4PYZA 2MBEA 4HK2A 2ZNVB 1EUVB 3KH0A 3QAQA 2KX0A 2PPHA 4IM0A 3CSTA 1WYWB 4JQWC 4ASWC 1EF5A 1WRDB 3R3MA 4M8MA 4DK5A 3IBEA 1V5TA 1I42A 3JW0X 5E6PA 1BT0A 4WJNA 4B95A 3DPDA 2A4ZA 4F8CB 3ML9A 3QJZA 2K1FA 1D3ZA 3JYUA 2RPQA 3DDCB 3EC8A 3QA8A 3U30A 4ZRIA 2KDIA 2KWCA 2FNJB 1OEYJ 4GMVA 3GOEA 4J6IA 5FR6A 3UQAA 3AI5A 3APFA 3DOWA 3RUIB 3A9JA 4W9IA 2Z0DB 3A9JB 3PSEB 2JUOA 1YQBA 2DZJA 3B08A 2K8BA 4EZLA 1P9DU 2KFKB 1UBIA 1UELA 2M1MA 3EFUA 1PQSA 1C1YB 1WXAA 2PE9A 4LDTD 1KLVA 4LJPB 4AJWA 3CF6E 4G0NB 4ZRKA 3H7SA 2M4NA 5LLIA 1IP9A 1YJ1A 1M94A 2KD0A 1P1AA 2D10A 2DZKA 3DBHI 4GN1A 3SDLC 2N1VA 2BWES 2KANA 2BWFA 4DBGA 4BBNC 2PE6B 3PRMB 4NPNA 1ZW7A 3UF8A 3VUXA 3GZNI 1WE7A 3TJPA 1WE6A 2AYOB 2NBUA 4MDKE 4GDLA 2J7QB 3ZTCA 1XT9B 1GC6A 2K8HA 2KDEB 2O6VD 3L54A 3L08A 3N30A 2C7MB 4CYEA 2KDFB 4EEWA
chains in the Genus database with same CATH superfamily
2WXFA 1S1QB 1ZP0B 4HVBA 5BYRA 3AEAB 3DBLI 2LFIA 1OEYA 2L8JA 4FN2A 5KHOA 1WGHA 1PUTA 2IPKD 4XDCA 1D5MC 2WXOA 2MBHA 1ISNA 4TKNA 3B2GA 2WDTB 1YD8U 4AWJA 4XX5A 2G45B 3QK0A 4WWMA 3CWIA 3QHTA 1GAQB 2CS4A 4AQ7A 1FXIA 2HE7A 2KLGA 4K7UA 4W9DA 1QOAA 2C7HA 3R2TA 3Q69A 3AE3B 4MJSA 2GBJA 3TCAA 1V80A 3A4SC 1Q10A 3AXCA 4KSLC 2LHEA 4N9F4 1SE9A 1YIWA 2KK8A 3W1SC 2G4SA 2PW9A 4MGIE 1D5ZC 4DWFA 2L0FA 2MJ3A 1JW9D 2I1JA 4S0RA 4JWUC 3OWEB 1EF1A 4JL9A 5TSSA 2RDGA 5TR5A 3I57A 3K9OB 1UBQA 4NNJB 3Q3OC 4LCDE 1NENB 5JH5C 4HJKA 3TL5A 4YTNB 4FJYA 5IA7A 2BW2A 2JPHA 3Q8AA 2GBMA 1KFYB 1SXTA 1WM3A 3FC4A 4W9CA 1KLUD 1DGJA 1GC7A 1QOFA 3ZNID 1R4MB 4MM3A 1EWYC 3ZJUA 2IDYA 4ANWA 3L4PA 3VAWA 2MW5A 5BYSA 1PGXA 2KXJA 3C19A 2K3UA 1HXYD 4IWQA 1RM6C 2N9EB 3AN1A 3MP9A 3ZNGC 3OLMD 2D11A 2Z0EB 2K8CA 3APDA 3A9KA 1YQ3B 2D5GA 2EELA 2DAJA 4GOCA 1T3QA 1QOGA 1XCQL 2MP2A 2Y5PA 4BOZB 2K5PA 3WIMA 3AEFB 4MELA 1XO3A 3W9CB 3N1ZC 1ESFA 2VZKB 3D32A 2UWQA 3ALBA 4GSWA 4L23A 1OQRA 1EO6A 3VXWA 1WJUA 2LZ6A 2FCMA 5G5GA 2AL6A 3A1QA 1UF0A 2BVCA 3PTFC 5G2NA 4TQ0A 1N5WA 3L0WB 2FUG1 3NY5A 4ZRPA 1BXTA 3IAS1 1FXTB 5FK9C 2L3ZA 2W82A 2IY1B 3TEYA 4HPMB 3Q3JA 2XK5A 3MHSD 2IBIB 1G6JA 5HKHA 3V61A 4F7ZA 2ZVNA 4ZHPA 2L1AA 2BS4B 2H89B 4M8NA 2KFJA 2NBWB 4M00A 4PS8A 2ZVOA 3NG0A 4NY0A 3HHMA 1WJNA 5EDSA 1P98A 4OZBA 1ZUD2 2WXLA 3ZO5B 1E7VA 1T0YA 4J3OD 2CU1A 2N1WA 4AP4C 2LGXA 2WXJA 2WGSA 2MBOA 2DAFA 3T3OA 5E6OA 4P7IA 1IGDA 2KTFA 2NBVB 1T0RC 2ZW1A 2GOWA 3KUCB 4P1BC 3I3TB 1E7PB 2V1YA 4P6VF 2J0JA 2WNMA 5HG2A 1Q1OA 1QKZA 1JWMD 4MM3B 3VFKA 3Q3MC 2KZRA 4HDOA 1TS3A 2K9XA 2KO3A 4BZAA 1I4HA 3NHEB 2WX0A 1QF6A 4C56C 2C7NB 2PLPA 4WIPA 1V8CA 2KVRA 2QEJC 2JZPA 2KTRA 2K6QA 3AM9A 4XDDA 1WXMA 3BWUD 2ZPNA 3A9KB 3HK0A 4DHZB 3ZQ4A 2C9WB 1CMXB 1E8XA 4C7ZA 2MP2B 2W9NA 3KWVA 3HVDA 1VJKA 4RGOS 2WU5B 2ZJDA 1JALA 1YMHE 1V97A 4MH0E 4FXCA 1WWTA 5FKAC 1B9RA 2VH2A 4NJ7A 1SE3A 2ZEQA 1N62A 3RULA 1TS5A 4DQOC 4NAWA 5L95C 1TYGB 3VTVA 4K81A 3ZRFA 2HJ8A 3ZYYX 3PO0A 2KMCA 3NZSA 2NCNA 1RLFA 2WXRA 3N3KB 1L0VB 2K22A 2I1KA 1MHHE 5D94A 5CX3A 4I6NB 1WY8A 2XK5B 4P16A 2PMVA 1WSPA 4KGSA 4W9JA 1AWDA 2O6VA 1GJZA 1WGKA 3VH3B 3ZIMA 2QCZA 1V81A 2YEPF 3DBHB 2H88B 5DPWA 1N61A 1A5RA 3GZNB 4BKSA 2D2QA 1DOIA 4A3OA 3ZTDA 2N9PC 5IP4D 3V3XA 3P2BA 3WA0A 4GB9A 2LASA 3DBLB 1IPGA 2JZ3B 3MJ5A 2XEWA 3KUDB 2DZMA 2CJNA 2XBBC 3OG5A 3BVGA 2ZPYA 4HKZE 4KIKA 2GI9A 3EHVA 5AEKB 2KX3A 4OVVA 4DHJD 1KTKA 2HDEA 3WAMA 3Q8CA 3LB8C 4II2B 2IYDB 1WX8A 4A20A 2N7DA 3AE6B 5J2RA 2M19A 3RI7C 1UNSA 4KZ0A 3M63B 1CJEA 2KJ6A 4FJVB 2V9HA 2W3RA 4I6PA 3AE1B 5DCNA 1V1PA 2G1EA 3NUHB 3VUWA 1TZOA 4PYZA 2ZNVB 3QAQA 4JQWC 4KGTA 1EF5A 3ZXVA 4DK5A 3IBEA 1V5TA 2QDFA 4WJNA 2K1FA 2RPQA 3QA8A 2KDIA 2KWCA 4TSSA 1OEYJ 2VH1A 3AE9B 5FR6A 3DOWA 2JXTA 3IAM1 4PT5A 4PK1A 1YQBA 3AMZA 1KLGD 4AJWA 3CF6E 3NS1A 4GN1A 3NVZA 2N1VA 1NI3A 2KANA 4DBGA 2PE6B 3P4RB 4NPNA 3UF8A 2ZW0A 1ET9A 3TJPA 1P7EA 4MDKE 4GDLA 5EE1A 3L08A 2KDFB 2KMMA 4OHJA 4ZYSA 2N9KA 4DXAB 3EFCA 3B2FA 2L76A 3MFGA 2ASQA 4ICUA 3KQ4A 1WR1A 2FCSA 3ZNZB 1VCBA 4RH6A 5EE9A 2BS3B 4RF1A 4XWWA 1SF0A 4ARCA 1UUPA 3DQVA 3H7PB 3L13A 4X57B 3AULA 2WX1A 3ZRCA 3TEXA 3X23A 1UD7A 1J8CA 4XYCA 1QQRA 3NVYA 1MG4A 3PLVA 1H4RA 3RCZA 1WXQA 3V6EB 4WJQA 4URKA 2QJLA 2PJHA 3AE7B 1WF9A 3VRAB 3M3JA 1Y56A 3P63A 4KIKB 4TMAB 3DCGA 1I35A 2Y3AA 4KSKC 2CKHB 3MC8A 2K39A 4MGYE 2GB1A 1F52A 3VQIA 1GG3A 4LNOA 2Z59B 1TT5B 3PHXB 1L5PA 2K25A 1JRUA 1Z2MA 1RFAA 3U7ZA 1C79A 4PS7A 1F1HA 2QMTA 3TIXA 2WXIA 1XLOA 1V1PB 1NDDA 1WMHB 1WFYA 3N32A 1GB4A 3RT3B 4CQNA 1IUEA 1C3TA 2AWTA 3VR9B 4LNNA 4M0WA 2KHWB 2V3PA 1QT9A 3W2DA 1TGZB 3X0WA 1PFDA 3MC9A 2LD9A 5LNK1 2X8XX 3TBLD 5J17A 1V9JA 1L7YA 2HJ1A 4JWSC 4E71A 1TKGA 1J19A 1KJTA 1NEKB 4CO7A 1KM7A 3L17A 1EU3A 3QARA 5G55A 4IOIE 1UWMA 3R2IA 4HXDA 4B0MA 3LXFA 2C60A 2K0PA 1R4NI 5BYQA 4GDLB 3AEDB 2IZVB 2WXKA 1NYQA 2RD0A 1FXAA 1LFDA 3KVFB 3UI3A 2MEKA 5AUIA 4G11A 1E90A 2PVOD 4DXFA 2FIDA 1J7AA 2KWVB 4NQLB 2BYTA 3ZJTA 4W9EA 3ZUNA 2WS3B 1H8CA 1EWCA 2KN5A 1FMAD 3Q3NC 4GLSC 2RMMA 2N0SB 3HM3A 2FCNA 1PYWD 2BTEA 4Q2JA 5IO9A 1VD2A 3PZ7A 2KC2A 3R66C 1ZKHA 3CMMB 4EUTA 3OJ4B 3R7RA 3JVZX 1ENFA 3JSVB 3VRBB 3NZ3A 3SEBA 2JRHA 4BFRA 4EZJA 1YX5B 2IGHA 1ZDXA 3VTWA 2KKCA 4FHJA 4NJ6A 2UU7A 2LEKA 4XC2A 2DHZA 1T5XD 1JWBD 2V3SA 4L2YA 1V2YA 2MRPA 2LI5A 2BKFA 3PPAA 3UIOB 4QAYA 2BB5A 2MX2A 2WDRB 1L4ZB 5D3IB 4W9GA 3H8HA 4W9HA 1BUIC 2HD5B 2W55A 2MCNB 4E3CA 1E6EB 4PS3A 1RFKA 1WRIA 1C4AA 4OVZA 3LDZE 3U4EG 4HWIB 2GBKA 3CIRB 5DPSA 1FCLA 4IM2A 2KJHB 4M0WB 1SJED 2JX5A 1YOVB 5CHFA 4BKGA 4RCOA 3DHGC 1PGBA 2GLSA 1TZ1A 3RNAC 4E74A 2CU3A 2MJDA 3AEGB 5DPRA 3HRDD 1A70A 3V6CB 1K50A 2MSED 3A4RA 4FJZA 4YSXB 2AQ3B 1TY2A 3N1YC 4HCNB 4WWNA 4BBNF 1JROA 1U4AA 1VLBA 1L0XB 3RN9C 4HKQA 1NYRA 3Q6BA 2BKRB 2LGYA 2IO0B 3TSSA 3VH4B 2DWQA 2BF8B 4MEMA 1FPYA 4K7SA 1WGGA 2LJ5A 4XZ4A 4EE2A 4LDTB 2IO1B 3PT2B 1RWSA 2LVPA 3L10B 2JU6X 2DBYA 2JZZA 2LJIA 1FD6A 2HTHA 2XNAC 1YJIA 1JWAD 3DVGY 4HLEA 4DXGA 1WX9A 1V49A 3I63C 1L2NA 2NR2A 1HTOA 4BAXA 4HRSA 4K7WA 3AU4A 4HCPB 2JF5A 1SJHD 4AOFA 4FA6A 3H6NA 1C9FA 1L0YB 2LWPA 2WDVB 3PREA 3OJ3A 3Q8BA 4YXDB 3FKYA 4ITKA 3O13A 1E7UA 1EM7A 3DBRI 1SSNA 2LXAA 1JWSD 3EA6A 3T3NA 3QCAA 5HFYA 2D3BA 3KUZA 1OGWA 1OTRB 5D3DA 4FULA 3DVGX 2NTTA 2LRUA 3NOBA 1WI0A 3RNFC 2CR5A 1UZXB 4LK0M 2LVQA 3NVWA 5AZFA 4A6QA 3UIPB 4RGTA 2WQYB 2XN9C 2MBEA 4HK2A 4IM0A 1WRDB 3P4PB 4M8MA 2ACZB 3WCQA 2FE8A 4OZCA 5E6PA 3RNGC 4A8XC 1PGAA 4A55A 3DDCB 5G5HA 1ET6A 1MHXA 4J6IA 3GOEA 5IOIA 3A9JB 2DZJA 4YSYB 2KACA 1P9DU 1UELA 2SEBD 2D3AA 4N58A 4ZRKA 5LLIA 2M4NA 2HTME 3MC0B 2KD0A 2D10A 2DZKA 2JQRB 2BWES 4C7YA 1HZ6A 4BBNC 3PRMB 1TS2A 2BS2B 3DHIC 2NBUA 1XT9B 2K8HA 3U2SC 2O6VD 2RPVA 2WXPA 4CYEA 4ARIA 3TEZA 2Z8LA 2KMAA 4IWOA 4JX1C 3UINB 1P3QU 2Q5WD 4MSQB 4BKSD 1KOTA 4C4VB 4ZHOA 2W3SA 4IWPA 2LXCA 4XE0A 3EECA 5BMIA 4GIVA 4NZLB 2V4IB 4XWTA 1TY0A 1SIFA 1HE8A 3H7PA 3VDZA 3P1MA 1R4NB 2ZCCA 2L0TA 2LHDA 3FAHA 3PRPB 1N63A 4S17A 3VVWB 3QX1A 3BZDB 2D07B 4H2AA 4G3XB 2CHXA 3DWGC 4ACFA 1Q0WB 2D3CA 5T8IA 3RMKC 1XF5L 4ANVA 2KYWA 2L32A 5EE0A 3PZ8A 4IW0A 2RGFA 2FUHB 4OZAA 1C4CA 2DZIA 3MJWA 2KQSA 1F2RI 3APCA 1E8ZA 4WJOA 1TKYA 1WXVA 2WU2B 2KLCA 2ONQA 4K3CA 4US9A 4ZYNA 3Q8FA 2JRIB 1NBFC 2IGGA 2Y5CA 1WMHA 2QSDA 1EU4A 3RNCC 2K6DB 1AN8A 2MA9B 4ZRJA 3ZJVA 3AECB 5J18A 2G4DB 1F77A 1TIFA 4HPPA 3MTNB 2Y5BB 4USAA 3B9JA 2A5UA 1YN5A 3ETRA 1S3SG 3ENEA 1VRAB 2L00B 1XLQA 3IXSA 4A9AA 2R2OA 2J42A 5D6JB 1VZ6A 1UGMA 2UYZB 1WH3A 1MG8A 2J0KA 4AUQC 1M4VA 2WDQB 4IM3A 5HHDG 2NVUI 3N20C 4YT0B 2EKEC 2ZZPB 2I2YA 5H92C 3RFZB 2AQ1B 3IHPC 3W5VB 1MJDA 2M56B 2WXMA 2BYVE 1SBBB 5IN7A 1GOZA 3L16A 1V1OA 1SGHA 2JWZA 5CHWA 1ZXHA 4OVUA 1FRDA 3U52E 4UDUC 4NAMA 2M0XA 1YJJA 3EGRA 1DOYA 4CHKA 4ZRQA 4ZDVA 2JSVX 4EFOA 3IVFA 5C2TB 2WYQA 1FFUA 2OOBB 4KVGB 1QILA 1K8RB 3JSVA 3T9LA 3PGEA 4AJYB 1WIAA 2N4FA 4GXBA 2LUEA 3TUOA 4C00A 4II3B 2G9HD 2E3TA 1WGYA 1FNWA 1RRBA 1UH6A 1I4XA 2J53A 3RYTA 1I4PA 2LUMA 3ZVVA 1FO4A 5JXVA 3HUIA 3HIZA 4TQ1A 2MBBB 1K51A 1XEEA 3DWMA 2WP9B 1RYJA 1TBEA 1Y8RC 4DHJB 1N6ZA 4WWOA 3RZWC 4DHZE 3GS2A 1AW7A 4WQMA 2GRIA 1N60A 1ZE3D 5BMHA 3ZNHB 2N9XA 2WHIA 4NJCA 3Q14C 3DBRB 3RNBC 1SEBD 1YNTE 1OFFA 3RPFC 1XLNA 1GUAB 3QWZB 2VZKD 2RDHA 2LMCA 3AE4B 3WANA 2KDMA 4YL8A 2GBRA 2N9LA 1WGRA 2SAKA 1WZ0A 2REXA 3QC8B 2BQQA 4I6LB 4OW0A 4WWPA 1QLBB 3MHZA 3HVZA 4GU2A 3KLSX 2WXNA 1WJ6A 2D3GA 2KFKA 1D5XC 4F1SA 4IUMB 2N7EA 3RZFA 4JLCA 2L83A 5LXIB 2YVCA 3ONSA 3NVVA 3Q2AC 5D7GA 2NS5A 1MPEA 3K9PB 4FBJB 1AARA 2KN4A 3BVZA 4N6EB 1V6EA 1YX6B 1P7FA 3HM6X 1WGDA 1D4BA 3VUYA 2LVOA 2PEAA 2IO3B 2IY0B 2PTLA 1I7HA 1X1MA 2PIAA 4L1BA 4EOYA 2OEDA 1UGJA 1CZPA 3GE8C 4M02A 2DYMA 5FR3A 2JVCA 1J0GA 2DENB 1TS4A 2KDBA 2JYEA 3H9DA 3RD2A 2JT4B 2VRRB 3R8BA 4YTMB 2LRWA 3N9YC 4HROA 1GPXA 3AV8A 3IFWB 2AQ2B 3DVNU 3M62B 2J52A 4G50A 2WXGA 2KAJA 4IG7B 4LNKA 4BOSC 5C1ZA 1C4PA 3C0RB 1SE2A 1C77A 1TJEA 1FFVA 5CTRC 2BGFA 3KWLA 1CQVA 4KZCA 2BB6A 3SR6A 4MSMB 2EMTA 4R3DA 1JMLA 1GNUA 4MH8A 4PYUA 3LJ3A 1WXSA 3KW5B 3PVLA 2ZNVC 1MVKA 4BVUC 4HPLB 1B1ZA 2YLMA 2X38A 3FILB 2V4LA 1T0SC 2G3QB 5JHAA 2AL3A 3ZXRA 1UWXA 5GXGB 3KH0A 3CSTA 4ASWC 1TKEA 3BYTB 5C3JB 4A90A 3EUB2 1XLPA 4D2KA 2LGSA 1I42A 4B95A 4LLGM 3ML9A 1C78A 3J9CA 4ZRIA 1BMLC 4GMVA 3UQAA 3AI5A 2TSSA 1L6UA 3RUIB 3A9JA 1LO5D 2Z0DB 3E9SA 4EZLA 3AH7A 2KFKB 1UBIA 1HZ5A 3BVMA 1C1YB 1WXAA 1HQRD 1KLVA 3P42A 1YJ1A 3SDLC 2BWFA 3P4SB 1ZW7A 3VUXA 3AE8B 1WE7A 3BK1A 1SIJA 2ICIA 2J7QB 1GC6A 3N30A 3L54A 1WYGA 3PS6A 4EEWA 1K52A 4FHKA 4KV2A 3GB1A 2KNBA 3IG3A 3N1XC 1KF6B 3SFDB 5E6JA 5JHBA 4M01A 4C4VA 1WM2A 4TUUA 3NJTA 1SE4A 2KQ4X 4ZOHC 4RF0A 1ACCA 4K3BA 5I4DA 4TV3A 3ECIA 3BK2A 1FM0D 1DYQA 4XGAB 3PHWB 1FIQA 4LNIA 1FCCC 4GGQA 1ZPSA 3ZDMC 1R7SA 3PZDA 3SU8X 3A33B 4MJSB 1V86A 2KJRA 3W1YA 3SHQA 2FBWB 2FIFA 3AB5A 2YEPB 2AEHA 1YN4A 3NS8A 4A3PA 2WXHA 4WJPA 5H8YE 2BYEA 2PVGC 1KRHA 1KH0A 5D2MB 2EMSA 2E6XA 2RR9A 3W1SA 5MPOA 4US8A 3BYYB 2B76B 4MGKE 4JIOU 2N7JA 4K1RB 4DDID 2DNFA 4HDQA 2EKIA 2QILA 4GDKA 1ROEA 3S2AA 3M95A 4W9FA 4IDIA 3ZKJC 3OAWA 4EZKA 2JY6A 4KGRA 3ZDTA 3LYYA 2BBCA 2BT6A 3BINA 5HI1A 1T0QC 2BPSA 1LGRA 1N5XA 4P1CC 4ANXA 4C80A 4B6WA 2PKOA 4ICVA 3AEEB 2MBQA 2V3NA 1RAXA 3GE3C 2DX5B 2O2VA 4YWGG 4RM9A 2JXXA 3VTUA 2IJ0A 3VHTC 3GP7A 5GMVA 1ZGUB 2M17A 2KWUB 3H1UA 2MLBA 2J0MA 2I38A 4AS1A 1Z5SB 3KYCD 2NPTA 4KDIC 3SD5A 1ZXIA 3W5UB 1PDXA 3A1QB 4RGNA 1JQ4A 3UQBA 5BO4B 1NVID 1CK1A 1VZ7A 2M0AA 3PLUA 2DLBA 3NRZA 2LGDA 3I9V1 1I4QA 3IT6B 1I4RA 4B9KA 5CHVC 4RMAA 1ZDVA 2MWSB 1WJ4A 3U7DA 1FRRA 1E5WA 4W9KA 3DBSA 2KQ7A 2QIEB 3Q3FA 2CHWA 3WALA 3C8YA 1K53A 2OHFA 1LM8B 1XQQA 1XD3B 3Q8EA 4YTPB 1IBXA 4ANUA 2B3AA 4WAAA 3T8MA 2NTSA 1F9JA 2QHOA 5AZGA 2KWDA 4IC7B 4MACA 3AU5A 2BYFA 3V62A 1R4MI 4FADA 3CSFA 3ABVB 2C5LC 4MT5A 2KVZA 2JWUA 1HA5A 1L6VA 2FAZA 2J4XA 1T6BX 5IAAC 3ML8A 2MQJA 4O1NA 1WX7A 4JE3B 1XCTL 4GDKB 3ZW3A 4KKJA 2OJWA 2INPE 3BIID 2MJEA 5EE3A 3R7QA 1XXGA 4N59A 2RSUA 1FNVA 4RFBA 2KC1A 1J7BA 3NZUA 1F2RC 2DYOA 1OQYA 2KT7A 1GB1A 3O65B 2KTRB 2FCQA 5LXHA 3IT4B 4WURA 3WAPA 1NI2A 1P0RA 2O2VB 2KOXA 2JYTA 4JPSA 2DYBA 3DHHC 4BKTA 2IGDA 1YN3A 5DPTA 1E8WA 3AE2B 2MH7A 3B0AA 4FLHA 4YSZB 1SB3C 3PV1A 2GMIC 2NPTB 4NQKE 1IYFA 4NAWB 3P4QB 1YQ4B 1MFWA 1V5OA 2MHJA 3VR8B 1JCKB 1D6EC 2INNE 5C23A 5KHQA 1STEA 1Q5WB 1FEHA 1HTQA 3V60A 2RDBC 4EKUA 2GBNA 1L4DB 2O6VB 1VDVA 3I5JC 3UGBB 2L05A 2LGIA 2L7RA 1WZ3A 1VR9A 1E8YA 4JGHB 2L52A 3B1LX 4WH4A 4DDGD 4RM8A 1IBXB 5E6NA 3QIJA 4LJOB 4RGMA 1JWUD 4KX6B 4REZA 3TMPB 5L83A 1E0ZA 2AX5A 1WR6E 2OJRA 3ZGZA 2INCC 4IKGA 1I4GA 1QZEA 3URYA 2QC8A 1DOXA 1TTNA 4MGZE 3RNEC 4WQOB 2WLBA 4W9LA 2CHZA 4WAFA 5JZEB 2ZCBA 1MI0A 2INDC 2IO2B 3KYDD 5AZHA 2R2QA 3BY4B 1IGCA 1LQBA 3QQ8B 3PRZA 3AE5B 3SFEB 2WWZA 4LNFA 2R61A 2M8SA 3WAOA 3AEBB 4KDLB 1E10A 3ZLZA 4HJGE 3FILA 1FNUA 4RNAA 1LXDA 2NMQA 1ZOYB 2ON8A 4HEA1 3DVNV 5AUKA 1F0ZA 2WXQA 4KKIA 1J7CA 3U8ZA 5BMGA 1EUVB 2KX0A 2PPHA 1WYWB 3TEWA 1HEZE 3R3MA 2W54A 1JRPA 2CJOA 1AYFA 3JW0X 1BT0A 3DPDA 2A4ZA 4F8CB 3QJZA 1D3ZA 3JYUA 3EC8A 1VZ8A 1OQQA 1QOBA 3U30A 1C76A 2FNJB 4B0EA 3APFA 4W9IA 3PSEB 2JUOA 3V05A 3B08A 2K8BA 2M1MA 3EFUA 1PQSA 2PE9A 3E56A 4LDTD 4LJPB 2V0GA 4G0NB 3H7SA 1IP9A 1M94A 1P1AA 3DBHI 1E9MA 3GZNI 4LTUA 1WE6A 2AYOB 3ZTCA 5IKCM 2KDEB 2C7MB
chains in the Genus database with same CATH topology
1S1QB 2KMAA 4FHKA 4IWOA 4KV2A 4HVBA 4DXAB 3UINB 3DBLI 1OEYA 2KNBA 2L8JA 3IG3A 1P3QU 2L76A 2ASQA 4FN2A 5JHBA 5KHOA 1WGHA 1WM2A 4MSQB 4ICUA 4TUUA 4BKSD 1KOTA 4IWPA 1WR1A 2FCSA 2LXCA 3ZNZB 2MBHA 3EECA 1VCBA 4GIVA 1ISNA 4TKNA 2WDTB 1YD8U 4AWJA 4XX5A 2G45B 1SIFA 3QK0A 3QHTA 1HE8A 3H7PA 4TV3A 3VDZA 3DQVA 3H7PB 3L13A 2CS4A 3ECIA 2ZCCA 4X57B 2HE7A 2L0TA 3AULA 2KLGA 2WX1A 4K7UA 3PRPB 3PHWB 4W9DA 3ZRCA 2C7HA 3VVWB 3QX1A 2D07B 4GGQA 4G3XB 3X23A 1UD7A 2CHXA 1J8CA 1Q0WB 3ZDMC 3PLVA 1H4RA 3RCZA 3PZDA 3V6EB 3SU8X 4WJQA 3A33B 4MJSA 2GBJA 3TCAA 1V80A 3A4SC 4URKA 4MJSB 3AXCA 2PJHA 4KSLC 1V86A 4ANVA 4N9F4 2KJRA 3W1YA 3SHQA 1WF9A 1SE9A 1YIWA 2KK8A 3W1SC 2G4SA 4IW0A 2FIFA 2RGFA 2AEHA 4MGIE 3M3JA 3NS8A 4DWFA 2FUHB 2L0FA 4A3PA 4KIKB 4WJPA 2I1JA 3DCGA 1I35A 2BYEA 1EF1A 4JL9A 4KSKC 2DZIA 3MJWA 2KQSA 2CKHB 3APCA 1E8ZA 4WJOA 2K39A 5TR5A 1WXVA 5D2MB 2EMSA 3K9OB 4MGYE 1UBQA 2RR9A 3W1SA 4NNJB 3VQIA 1GG3A 4LCDE 2Z59B 3PHXB 2K25A 5JH5C 2KLCA 1JRUA 1Z2MA 4HJKA 1RFAA 4MGKE 4JIOU 3TL5A 4K1RB 4FJYA 4DDID 4PS7A 4ZYNA 2JRIB 4HDQA 5IA7A 3TIXA 2JPHA 1NBFC 2GBMA 4GDKA 1WM3A 1NDDA 1WMHA 4W9CA 1WMHB 1WFYA 3N32A 1GC7A 3S2AA 3RT3B 2K6DB 3ZNID 3M95A 4MM3A 1C3TA 4W9FA 2AWTA 2MA9B 4ZRJA 3OAWA 3ZKJC 4ANWA 4EZKA 2JY6A 3ZDTA 3VAWA 2KHWB 5J18A 2MW5A 3BINA 2G4DB 2BPSA 1TGZB 2KXJA 3X0WA 3MTNB 4ANXA 2LD9A 2Y5BB 4IWQA 4B6WA 2N9EB 4ICVA 3ZNGC 3OLMD 2A5UA 3TBLD 2D11A 2Z0EB 2K8CA 3APDA 3A9KA 2MBQA 1S3SG 3ENEA 1RAXA 2L00B 5J17A 1V9JA 1L7YA 2DAJA 2R2OA 2DX5B 5D6JB 4GOCA 4E71A 1UGMA 2O2VA 1J19A 2UYZB 2MP2A 4RM9A 2JXXA 3VTUA 1KJTA 1MG8A 1WH3A 1KM7A 2J0KA 3L17A 4CO7A 4BOZB 3QARA 3VHTC 4AUQC 5G55A 5GMVA 3WIMA 1ZGUB 2M17A 4MELA 4IM3A 2KWUB 2NVUI 3D32A 3H1UA 2MLBA 2EKEC 2UWQA 3ALBA 2J0MA 2ZZPB 4GSWA 4HXDA 1Z5SB 2C60A 3KYCD 1EO6A 1R4NI 3VXWA 1WJUA 4GDLB 3IHPC 2LZ6A 2NPTA 2FCMA 2BYVE 2AL6A 2IZVB 4KDIC 3SD5A 3A1QA 3L16A 3A1QB 2RD0A 3UQBA 5BO4B 1LFDA 3KVFB 1SGHA 3PTFC 5G2NA 4TQ0A 3PLUA 2JWZA 4G11A 3L0WB 5CHWA 2LGDA 1E90A 3NY5A 4OVUA 1FXTB 2L3ZA 4B9KA 5CHVC 4RMAA 2IY1B 2FIDA 2MWSB 4HPMB 3Q3JA 1WJ4A 2XK5A 3U7DA 3MHSD 2IBIB 2M0XA 1G6JA 2KWVB 5HKHA 4NQLB 3V61A 4F7ZA 4W9EA 3ZUNA 2ZVNA 1H8CA 4CHKA 4ZDVA 1E5WA 4W9KA 4M8NA 3DBSA 2KFJA 2KN5A 2NBWB 2KQ7A 3Q3FA 2CHWA 4PS8A 3WALA 2ZVOA 4EFOA 3IVFA 3HM3A 2FCNA 4NY0A 2WYQA 3HHMA 1LM8B 1XQQA 1VD2A 1WJNA 1XD3B 1P98A 2KC2A 2OOBB 3R66C 4KVGB 5EDSA 4ANUA 1ZKHA 3CMMB 2B3AA 4EUTA 4WAAA 3ZO5B 1K8RB 3OJ4B 1E7VA 3JSVA 3R7RA 3T8MA 1F9JA 1T0YA 3JVZX 3JSVB 2QHOA 5AZGA 4IC7B 2CU1A 3AU5A 3T9LA 2N1WA 2BYFA 3V62A 2JRHA 4AP4C 3PGEA 4AJYB 1WIAA 4BFRA 4EZJA 2N4FA 4GXBA 1YX5B 1R4MI 4FADA 2LGXA 2LUEA 3CSFA 3VTWA 2MBOA 2C5LC 2KKCA 4FHJA 4NJ6A 2DAFA 4II3B 5E6OA 4P7IA 1WGYA 4XC2A 1RRBA 1UH6A 2NBVB 2KTFA 3RYTA 2DHZA 2V3SA 1V2YA 2FAZA 2MRPA 2LI5A 3ZVVA 2BKFA 2GOWA 3KUCB 3PPAA 3UIOB 5IAAC 3ML8A 2MQJA 2MX2A 3HIZA 4TQ1A 2MBBB 4W9GA 3I3TB 1WX7A 4W9HA 4E3CA 2HD5B 2MCNB 4GDKB 3ZW3A 2V1YA 4PS3A 2J0JA 3LDZE 4HWIB 3R7QA 1Q1OA 2RSUA 1TBEA 1Y8RC 2GBKA 3VFKA 4DHJB 2KZRA 4HDOA 5DPSA 2KC1A 3NZUA 2KO3A 4WWOA 3RZWC 4DHZE 3NHEB 4IM2A 2WX0A 2C7NB 2KJHB 4M0WB 2DYOA 1OQYA 2KVRA 2KTRA 3ZNHB 2N9XA 3O65B 2K6QA 2KTRB 5CHFA 4BKGA 1WXMA 1TZ1A 4E74A 2ZPNA 3A9KB 2FCQA 1GUAB 3HK0A 4DHZB 5LXHA 5DPRA 2C9WB 3QWZB 1CMXB 3WAPA 1NI2A 1E8XA 1P0RA 2O2VB 2KOXA 3V6CB 2MSED 2MP2B 2W9NA 3WANA 2DYBA 3A4RA 4FJZA 4BKTA 4YL8A 2GBRA 2ZJDA 1WGRA 4HCNB 4WWNA 5DPTA 1WZ0A 2REXA 3QC8B 4I6LB 1E8WA 4WWPA 4BBNF 4MH0E 3B0AA 1U4AA 4GU2A 4FLHA 1WJ6A 2D3GA 4NJ7A 2ZEQA 2KFKA 2BKRB 2LGYA 2IO0B 3PV1A 3RULA 4F1SA 2GMIC 2NPTB 4IUMB 4NAWA 4NQKE 5L95C 1IYFA 2N7EA 3VTVA 4NAWB 4K81A 3RZFA 3VH4B 3ZRFA 2BF8B 1V5OA 4JLCA 4MEMA 5LXIB 2HJ8A 4K7SA 2YVCA 1WGGA 3ONSA 2LJ5A 4XZ4A 2KMCA 5D7GA 4LDTB 2IO1B 2NS5A 3NZSA 3PT2B 2NCNA 1RLFA 3N3KB 3K9PB 4FBJB 5C23A 1AARA 2LVPA 2I1KA 3L10B 5D94A 5KHQA 1Q5WB 1V6EA 1YX6B 5CX3A 4I6NB 2JZZA 1WY8A 3HM6X 2XK5B 1WGDA 3V60A 4W9JA 2HTHA 3VUYA 4EKUA 2LVOA 2PEAA 2IO3B 2IY0B 3DVGY 2O6VA 2GBNA 1GJZA 1X1MA 2O6VB 3UGBB 3PS6A 3VH3B 3ZIMA 4EOYA 4HLEA 2L05A 1V81A 2L7RA 2DYMA 2JVCA 1WZ3A 1J0GA 1WX9A 1V49A 1E8YA 2DENB 2KDBA 4JGHB 5DPWA 3H9DA 3B1LX 3RD2A 2JT4B 2VRRB 1A5RA 1L2NA 4DDGD 2LRWA 2D2QA 4RM8A 2NR2A 3QIJA 4LJOB 5E6NA 4BKSA 4A3OA 3IFWB 3ZTDA 3DVNU 3M62B 2N9PC 4K7WA 4G50A 3TMPB 5L83A 3AU4A 3P2BA 4BOSC 4IG7B 3WA0A 4GB9A 2LASA 1WR6E 5C1ZA 2OJRA 1IPGA 4HCPB 2JF5A 2JZ3B 3C0RB 4AOFA 2XEWA 3KUDB 3H6NA 2DZMA 4FA6A 5CTRC 1QZEA 2BGFA 2XBBC 1TTNA 2LWPA 4KZCA 4MGZE 3PREA 4WQOB 3OJ3A 4W9LA 2CHZA 2ZPYA 5JZEB 4MSMB 2ZCBA 2EMTA 4KIKA 1E7UA 3DBRI 3EHVA 2IO2B 3KYDD 2KX3A 4OVVA 1GNUA 4DHJD 5AZHA 5AEKB 2LXAA 2R2QA 3BY4B 4PYUA 1LQBA 3LJ3A 3QCAA 1WXSA 3WAMA 3QQ8B 3PRZA 3KUZA 3KW5B 4II2B 2IYDB 1OGWA 3PVLA 1WX8A 1OTRB 2WWZA 2ZNVC 4A20A 2M8SA 2N7DA 3DVGX 4FULA 3WAOA 5J2RA 4BVUC 2LRUA 3NOBA 1WI0A 4HPLB 4KDLB 4KZ0A 2CR5A 1UZXB 2YLMA 3ZLZA 3M63B 2LVQA 2V4LA 1LXDA 5AZFA 2KJ6A 3UIPB 2G3QB 4FJVB 5JHAA 3DVNV 4I6PA 2AL3A 5DCNA 3VUWA 3U8ZA 4PYZA 2MBEA 4HK2A 2ZNVB 1EUVB 3KH0A 3QAQA 2KX0A 2PPHA 4IM0A 3CSTA 1WYWB 4JQWC 4ASWC 1EF5A 1WRDB 3R3MA 4M8MA 4DK5A 3IBEA 1V5TA 1I42A 3JW0X 5E6PA 1BT0A 4WJNA 4B95A 3DPDA 2A4ZA 4F8CB 3ML9A 3QJZA 2K1FA 1D3ZA 3JYUA 2RPQA 3DDCB 3EC8A 3QA8A 3U30A 4ZRIA 2KDIA 2KWCA 2FNJB 1OEYJ 4GMVA 3GOEA 4J6IA 5FR6A 3UQAA 3AI5A 3APFA 3DOWA 3RUIB 3A9JA 4W9IA 2Z0DB 3A9JB 3PSEB 2JUOA 1YQBA 2DZJA 3B08A 2K8BA 4EZLA 1P9DU 2KFKB 1UBIA 1UELA 2M1MA 3EFUA 1PQSA 1C1YB 1WXAA 2PE9A 4LDTD 1KLVA 4LJPB 4AJWA 3CF6E 4G0NB 4ZRKA 3H7SA 2M4NA 5LLIA 1IP9A 1YJ1A 1M94A 2KD0A 1P1AA 2D10A 2DZKA 3DBHI 4GN1A 3SDLC 2N1VA 2BWES 2KANA 2BWFA 4DBGA 4BBNC 2PE6B 3PRMB 4NPNA 1ZW7A 3UF8A 3VUXA 3GZNI 1WE7A 3TJPA 1WE6A 2AYOB 2NBUA 4MDKE 4GDLA 2J7QB 3ZTCA 1XT9B 1GC6A 2K8HA 2KDEB 2O6VD 3L54A 3L08A 3N30A 2C7MB 4CYEA 2KDFB 4EEWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1S1Q B;  2KMA A;  4FHK A;  4IWO A;  4KV2 A;  4HVB A;  4DXA B;  3UIN B;  3DBL I;  1OEY A;  2KNB A;  2L8J A;  3IG3 A;  1P3Q U;  2L76 A;  2ASQ A;  4FN2 A;  5JHB A;  5KHO A;  1WGH A;  1WM2 A;  4MSQ B;  4ICU A;  4TUU A;  4BKS D;  1KOT A;  4IWP A;  1WR1 A;  2FCS A;  2LXC A;  3ZNZ B;  2MBH A;  3EEC A;  1VCB A;  4GIV A;  1ISN A;  4TKN A;  2WDT B;  1YD8 U;  4AWJ A;  4XX5 A;  2G45 B;  1SIF A;  3QK0 A;  3QHT A;  1HE8 A;  3H7P A;  4TV3 A;  3VDZ A;  3DQV A;  3H7P B;  3L13 A;  2CS4 A;  3ECI A;  2ZCC A;  4X57 B;  2HE7 A;  2L0T A;  3AUL A;  2KLG A;  2WX1 A;  4K7U A;  3PRP B;  3PHW B;  4W9D A;  3ZRC A;  2C7H A;  3VVW B;  3QX1 A;  2D07 B;  4GGQ A;  4G3X B;  3X23 A;  1UD7 A;  2CHX A;  1J8C A;  1Q0W B;  3ZDM C;  3PLV A;  1H4R A;  3RCZ A;  3PZD A;  3V6E B;  3SU8 X;  4WJQ A;  3A33 B;  4MJS A;  2GBJ A;  3TCA A;  1V80 A;  3A4S C;  4URK A;  4MJS B;  3AXC A;  2PJH A;  4KSL C;  1V86 A;  4ANV A;  4N9F 4;  2KJR A;  3W1Y A;  3SHQ A;  1WF9 A;  1SE9 A;  1YIW A;  2KK8 A;  3W1S C;  2G4S A;  4IW0 A;  2FIF A;  2RGF A;  2AEH A;  4MGI E;  3M3J A;  3NS8 A;  4DWF A;  2FUH B;  2L0F A;  4A3P A;  4KIK B;  4WJP A;  2I1J A;  3DCG A;  1I35 A;  2BYE A;  1EF1 A;  4JL9 A;  4KSK C;  2DZI A;  3MJW A;  2KQS A;  2CKH B;  3APC A;  1E8Z A;  4WJO A;  2K39 A;  5TR5 A;  1WXV A;  5D2M B;  2EMS A;  3K9O B;  4MGY E;  1UBQ A;  2RR9 A;  3W1S A;  4NNJ B;  3VQI A;  1GG3 A;  4LCD E;  2Z59 B;  3PHX B;  2K25 A;  5JH5 C;  2KLC A;  1JRU A;  1Z2M A;  4HJK A;  1RFA A;  4MGK E;  4JIO U;  3TL5 A;  4K1R B;  4FJY A;  4DDI D;  4PS7 A;  4ZYN A;  2JRI B;  4HDQ A;  5IA7 A;  3TIX A;  2JPH A;  1NBF C;  2GBM A;  4GDK A;  1WM3 A;  1NDD A;  1WMH A;  4W9C A;  1WMH B;  1WFY A;  3N32 A;  1GC7 A;  3S2A A;  3RT3 B;  2K6D B;  3ZNI D;  3M95 A;  4MM3 A;  1C3T A;  4W9F A;  2AWT A;  2MA9 B;  4ZRJ A;  3OAW A;  3ZKJ C;  4ANW A;  4EZK A;  2JY6 A;  3ZDT A;  3VAW A;  2KHW B;  5J18 A;  2MW5 A;  3BIN A;  2G4D B;  2BPS A;  1TGZ B;  2KXJ A;  3X0W A;  3MTN B;  4ANX A;  2LD9 A;  2Y5B B;  4IWQ A;  4B6W A;  2N9E B;  4ICV A;  3ZNG C;  3OLM D;  2A5U A;  3TBL D;  2D11 A;  2Z0E B;  2K8C A;  3APD A;  3A9K A;  2MBQ A;  1S3S G;  3ENE A;  1RAX A;  2L00 B;  5J17 A;  1V9J A;  1L7Y A;  2DAJ A;  2R2O A;  2DX5 B;  5D6J B;  4GOC A;  4E71 A;  1UGM A;  2O2V A;  1J19 A;  2UYZ B;  2MP2 A;  4RM9 A;  2JXX A;  3VTU A;  1KJT A;  1MG8 A;  1WH3 A;  1KM7 A;  2J0K A;  3L17 A;  4CO7 A;  4BOZ B;  3QAR A;  3VHT C;  4AUQ C;  5G55 A;  5GMV A;  3WIM A;  1ZGU B;  2M17 A;  4MEL A;  4IM3 A;  2KWU B;  2NVU I;  3D32 A;  3H1U A;  2MLB A;  2EKE C;  2UWQ A;  3ALB A;  2J0M A;  2ZZP B;  4GSW A;  4HXD A;  1Z5S B;  2C60 A;  3KYC D;  1EO6 A;  1R4N I;  3VXW A;  1WJU A;  4GDL B;  3IHP C;  2LZ6 A;  2NPT A;  2FCM A;  2BYV E;  2AL6 A;  2IZV B;  4KDI C;  3SD5 A;  3A1Q A;  3L16 A;  3A1Q B;  2RD0 A;  3UQB A;  5BO4 B;  1LFD A;  3KVF B;  1SGH A;  3PTF C;  5G2N A;  4TQ0 A;  3PLU A;  2JWZ A;  4G11 A;  3L0W B;  5CHW A;  2LGD A;  1E90 A;  3NY5 A;  4OVU A;  1FXT B;  2L3Z A;  4B9K A;  5CHV C;  4RMA A;  2IY1 B;  2FID A;  2MWS B;  4HPM B;  3Q3J A;  1WJ4 A;  2XK5 A;  3U7D A;  3MHS D;  2IBI B;  2M0X A;  1G6J A;  2KWV B;  5HKH A;  4NQL B;  3V61 A;  4F7Z A;  4W9E A;  3ZUN A;  2ZVN A;  1H8C A;  4CHK A;  4ZDV A;  1E5W A;  4W9K A;  4M8N A;  3DBS A;  2KFJ A;  2KN5 A;  2NBW B;  2KQ7 A;  3Q3F A;  2CHW A;  4PS8 A;  3WAL A;  2ZVO A;  4EFO A;  3IVF A;  3HM3 A;  2FCN A;  4NY0 A;  2WYQ A;  3HHM A;  1LM8 B;  1XQQ A;  1VD2 A;  1WJN A;  1XD3 B;  1P98 A;  2KC2 A;  2OOB B;  3R66 C;  4KVG B;  5EDS A;  4ANU A;  1ZKH A;  3CMM B;  2B3A A;  4EUT A;  4WAA A;  3ZO5 B;  1K8R B;  3OJ4 B;  1E7V A;  3JSV A;  3R7R A;  3T8M A;  1F9J A;  1T0Y A;  3JVZ X;  3JSV B;  2QHO A;  5AZG A;  4IC7 B;  2CU1 A;  3AU5 A;  3T9L A;  2N1W A;  2BYF A;  3V62 A;  2JRH A;  4AP4 C;  3PGE A;  4AJY B;  1WIA A;  4BFR A;  4EZJ A;  2N4F A;  4GXB A;  1YX5 B;  1R4M I;  4FAD A;  2LGX A;  2LUE A;  3CSF A;  3VTW A;  2MBO A;  2C5L C;  2KKC A;  4FHJ A;  4NJ6 A;  2DAF A;  4II3 B;  5E6O A;  4P7I A;  1WGY A;  4XC2 A;  1RRB A;  1UH6 A;  2NBV B;  2KTF A;  3RYT A;  2DHZ A;  2V3S A;  1V2Y A;  2FAZ A;  2MRP A;  2LI5 A;  3ZVV A;  2BKF A;  2GOW A;  3KUC B;  3PPA A;  3UIO B;  5IAA C;  3ML8 A;  2MQJ A;  2MX2 A;  3HIZ A;  4TQ1 A;  2MBB B;  4W9G A;  3I3T B;  1WX7 A;  4W9H A;  4E3C A;  2HD5 B;  2MCN B;  4GDK B;  3ZW3 A;  2V1Y A;  4PS3 A;  2J0J A;  3LDZ E;  4HWI B;  3R7Q A;  1Q1O A;  2RSU A;  1TBE A;  1Y8R C;  2GBK A;  3VFK A;  4DHJ B;  2KZR A;  4HDO A;  5DPS A;  2KC1 A;  3NZU A;  2KO3 A;  4WWO A;  3RZW C;  4DHZ E;  3NHE B;  4IM2 A;  2WX0 A;  2C7N B;  2KJH B;  4M0W B;  2DYO A;  1OQY A;  2KVR A;  2KTR A;  3ZNH B;  2N9X A;  3O65 B;  2K6Q A;  2KTR B;  5CHF A;  4BKG A;  1WXM A;  1TZ1 A;  4E74 A;  2ZPN A;  3A9K B;  2FCQ A;  1GUA B;  3HK0 A;  4DHZ B;  5LXH A;  5DPR A;  2C9W B;  3QWZ B;  1CMX B;  3WAP A;  1NI2 A;  1E8X A;  1P0R A;  2O2V B;  2KOX A;  3V6C B;  2MSE D;  2MP2 B;  2W9N A;  3WAN A;  2DYB A;  3A4R A;  4FJZ A;  4BKT A;  4YL8 A;  2GBR A;  2ZJD A;  1WGR A;  4HCN B;  4WWN A;  5DPT A;  1WZ0 A;  2REX A;  3QC8 B;  4I6L B;  1E8W A;  4WWP A;  4BBN F;  4MH0 E;  3B0A A;  1U4A A;  4GU2 A;  4FLH A;  1WJ6 A;  2D3G A;  4NJ7 A;  2ZEQ A;  2KFK A;  2BKR B;  2LGY A;  2IO0 B;  3PV1 A;  3RUL A;  4F1S A;  2GMI C;  2NPT B;  4IUM B;  4NAW A;  4NQK E;  5L95 C;  1IYF A;  2N7E A;  3VTV A;  4NAW B;  4K81 A;  3RZF A;  3VH4 B;  3ZRF A;  2BF8 B;  1V5O A;  4JLC A;  4MEM A;  5LXI B;  2HJ8 A;  4K7S A;  2YVC A;  1WGG A;  3ONS A;  2LJ5 A;  4XZ4 A;  2KMC A;  5D7G A;  4LDT B;  2IO1 B;  2NS5 A;  3NZS A;  3PT2 B;  2NCN A;  1RLF A;  3N3K B;  3K9P B;  4FBJ B;  5C23 A;  1AAR A;  2LVP A;  2I1K A;  3L10 B;  5D94 A;  5KHQ A;  1Q5W B;  1V6E A;  1YX6 B;  5CX3 A;  4I6N B;  2JZZ A;  1WY8 A;  3HM6 X;  2XK5 B;  1WGD A;  3V60 A;  4W9J A;  2HTH A;  3VUY A;  4EKU A;  2LVO A;  2PEA A;  2IO3 B;  2IY0 B;  3DVG Y;  2O6V A;  2GBN A;  1GJZ A;  1X1M A;  2O6V B;  3UGB B;  3PS6 A;  3VH3 B;  3ZIM A;  4EOY A;  4HLE A;  2L05 A;  1V81 A;  2L7R A;  2DYM A;  2JVC A;  1WZ3 A;  1J0G A;  1WX9 A;  1V49 A;  1E8Y A;  2DEN B;  2KDB A;  4JGH B;  5DPW A;  3H9D A;  3B1L X;  3RD2 A;  2JT4 B;  2VRR B;  1A5R A;  1L2N A;  4DDG D;  2LRW A;  2D2Q A;  4RM8 A;  2NR2 A;  3QIJ A;  4LJO B;  5E6N A;  4BKS A;  4A3O A;  3IFW B;  3ZTD A;  3DVN U;  3M62 B;  2N9P C;  4K7W A;  4G50 A;  3TMP B;  5L83 A;  3AU4 A;  3P2B A;  4BOS C;  4IG7 B;  3WA0 A;  4GB9 A;  2LAS A;  1WR6 E;  5C1Z A;  2OJR A;  1IPG A;  4HCP B;  2JF5 A;  2JZ3 B;  3C0R B;  4AOF A;  2XEW A;  3KUD B;  3H6N A;  2DZM A;  4FA6 A;  5CTR C;  1QZE A;  2BGF A;  2XBB C;  1TTN A;  2LWP A;  4KZC A;  4MGZ E;  3PRE A;  4WQO B;  3OJ3 A;  4W9L A;  2CHZ A;  2ZPY A;  5JZE B;  4MSM B;  2ZCB A;  2EMT A;  4KIK A;  1E7U A;  3DBR I;  3EHV A;  2IO2 B;  3KYD D;  2KX3 A;  4OVV A;  1GNU A;  4DHJ D;  5AZH A;  5AEK B;  2LXA A;  2R2Q A;  3BY4 B;  4PYU A;  1LQB A;  3LJ3 A;  3QCA A;  1WXS A;  3WAM A;  3QQ8 B;  3PRZ A;  3KUZ A;  3KW5 B;  4II2 B;  2IYD B;  1OGW A;  3PVL A;  1WX8 A;  1OTR B;  2WWZ A;  2ZNV C;  4A20 A;  2M8S A;  2N7D A;  3DVG X;  4FUL A;  3WAO A;  5J2R A;  4BVU C;  2LRU A;  3NOB A;  1WI0 A;  4HPL B;  4KDL B;  4KZ0 A;  2CR5 A;  1UZX B;  2YLM A;  3ZLZ A;  3M63 B;  2LVQ A;  2V4L A;  1LXD A;  5AZF A;  2KJ6 A;  3UIP B;  2G3Q B;  4FJV B;  5JHA A;  3DVN V;  4I6P A;  2AL3 A;  5DCN A;  3VUW A;  3U8Z A;  4PYZ A;  2MBE A;  4HK2 A;  2ZNV B;  1EUV B;  3KH0 A;  3QAQ A;  2KX0 A;  2PPH A;  4IM0 A;  3CST A;  1WYW B;  4JQW C;  4ASW C;  1EF5 A;  1WRD B;  3R3M A;  4M8M A;  4DK5 A;  3IBE A;  1V5T A;  1I42 A;  3JW0 X;  5E6P A;  1BT0 A;  4WJN A;  4B95 A;  3DPD A;  2A4Z A;  4F8C B;  3ML9 A;  3QJZ A;  2K1F A;  1D3Z A;  3JYU A;  2RPQ A;  3DDC B;  3EC8 A;  3QA8 A;  3U30 A;  4ZRI A;  2KDI A;  2KWC A;  2FNJ B;  1OEY J;  4GMV A;  3GOE A;  4J6I A;  5FR6 A;  3UQA A;  3AI5 A;  3APF A;  3DOW A;  3RUI B;  3A9J A;  4W9I A;  2Z0D B;  3A9J B;  3PSE B;  2JUO A;  1YQB A;  2DZJ A;  3B08 A;  2K8B A;  4EZL A;  1P9D U;  2KFK B;  1UBI A;  1UEL A;  2M1M A;  3EFU A;  1PQS A;  1C1Y B;  1WXA A;  2PE9 A;  4LDT D;  1KLV A;  4LJP B;  4AJW A;  3CF6 E;  4G0N B;  4ZRK A;  3H7S A;  2M4N A;  5LLI A;  1IP9 A;  1YJ1 A;  1M94 A;  2KD0 A;  1P1A A;  2D10 A;  2DZK A;  3DBH I;  4GN1 A;  3SDL C;  2N1V A;  2BWE S;  2KAN A;  2BWF A;  4DBG A;  4BBN C;  2PE6 B;  3PRM B;  4NPN A;  1ZW7 A;  3UF8 A;  3VUX A;  3GZN I;  1WE7 A;  3TJP A;  1WE6 A;  2AYO B;  2NBU A;  4MDK E;  4GDL A;  2J7Q B;  3ZTC A;  1XT9 B;  1GC6 A;  2K8H A;  2KDE B;  2O6V D;  3L54 A;  3L08 A;  3N30 A;  2C7M B;  4CYE A;  2KDF B;  4EEW A; 
#chains in the Genus database with same CATH topology
 2WXF A;  1S1Q B;  1ZP0 B;  4HVB A;  5BYR A;  3AEA B;  3DBL I;  2LFI A;  1OEY A;  2L8J A;  4FN2 A;  5KHO A;  1WGH A;  1PUT A;  2IPK D;  4XDC A;  1D5M C;  2WXO A;  2MBH A;  1ISN A;  4TKN A;  3B2G A;  2WDT B;  1YD8 U;  4AWJ A;  4XX5 A;  2G45 B;  3QK0 A;  4WWM A;  3CWI A;  3QHT A;  1GAQ B;  2CS4 A;  4AQ7 A;  1FXI A;  2HE7 A;  2KLG A;  4K7U A;  4W9D A;  1QOA A;  2C7H A;  3R2T A;  3Q69 A;  3AE3 B;  4MJS A;  2GBJ A;  3TCA A;  1V80 A;  3A4S C;  1Q10 A;  3AXC A;  4KSL C;  2LHE A;  4N9F 4;  1SE9 A;  1YIW A;  2KK8 A;  3W1S C;  2G4S A;  2PW9 A;  4MGI E;  1D5Z C;  4DWF A;  2L0F A;  2MJ3 A;  1JW9 D;  2I1J A;  4S0R A;  4JWU C;  3OWE B;  1EF1 A;  4JL9 A;  5TSS A;  2RDG A;  5TR5 A;  3I57 A;  3K9O B;  1UBQ A;  4NNJ B;  3Q3O C;  4LCD E;  1NEN B;  5JH5 C;  4HJK A;  3TL5 A;  4YTN B;  4FJY A;  5IA7 A;  2BW2 A;  2JPH A;  3Q8A A;  2GBM A;  1KFY B;  1SXT A;  1WM3 A;  3FC4 A;  4W9C A;  1KLU D;  1DGJ A;  1GC7 A;  1QOF A;  3ZNI D;  1R4M B;  4MM3 A;  1EWY C;  3ZJU A;  2IDY A;  4ANW A;  3L4P A;  3VAW A;  2MW5 A;  5BYS A;  1PGX A;  2KXJ A;  3C19 A;  2K3U A;  1HXY D;  4IWQ A;  1RM6 C;  2N9E B;  3AN1 A;  3MP9 A;  3ZNG C;  3OLM D;  2D11 A;  2Z0E B;  2K8C A;  3APD A;  3A9K A;  1YQ3 B;  2D5G A;  2EEL A;  2DAJ A;  4GOC A;  1T3Q A;  1QOG A;  1XCQ L;  2MP2 A;  2Y5P A;  4BOZ B;  2K5P A;  3WIM A;  3AEF B;  4MEL A;  1XO3 A;  3W9C B;  3N1Z C;  1ESF A;  2VZK B;  3D32 A;  2UWQ A;  3ALB A;  4GSW A;  4L23 A;  1OQR A;  1EO6 A;  3VXW A;  1WJU A;  2LZ6 A;  2FCM A;  5G5G A;  2AL6 A;  3A1Q A;  1UF0 A;  2BVC A;  3PTF C;  5G2N A;  4TQ0 A;  1N5W A;  3L0W B;  2FUG 1;  3NY5 A;  4ZRP A;  1BXT A;  3IAS 1;  1FXT B;  5FK9 C;  2L3Z A;  2W82 A;  2IY1 B;  3TEY A;  4HPM B;  3Q3J A;  2XK5 A;  3MHS D;  2IBI B;  1G6J A;  5HKH A;  3V61 A;  4F7Z A;  2ZVN A;  4ZHP A;  2L1A A;  2BS4 B;  2H89 B;  4M8N A;  2KFJ A;  2NBW B;  4M00 A;  4PS8 A;  2ZVO A;  3NG0 A;  4NY0 A;  3HHM A;  1WJN A;  5EDS A;  1P98 A;  4OZB A;  1ZUD 2;  2WXL A;  3ZO5 B;  1E7V A;  1T0Y A;  4J3O D;  2CU1 A;  2N1W A;  4AP4 C;  2LGX A;  2WXJ A;  2WGS A;  2MBO A;  2DAF A;  3T3O A;  5E6O A;  4P7I A;  1IGD A;  2KTF A;  2NBV B;  1T0R C;  2ZW1 A;  2GOW A;  3KUC B;  4P1B C;  3I3T B;  1E7P B;  2V1Y A;  4P6V F;  2J0J A;  2WNM A;  5HG2 A;  1Q1O A;  1QKZ A;  1JWM D;  4MM3 B;  3VFK A;  3Q3M C;  2KZR A;  4HDO A;  1TS3 A;  2K9X A;  2KO3 A;  4BZA A;  1I4H A;  3NHE B;  2WX0 A;  1QF6 A;  4C56 C;  2C7N B;  2PLP A;  4WIP A;  1V8C A;  2KVR A;  2QEJ C;  2JZP A;  2KTR A;  2K6Q A;  3AM9 A;  4XDD A;  1WXM A;  3BWU D;  2ZPN A;  3A9K B;  3HK0 A;  4DHZ B;  3ZQ4 A;  2C9W B;  1CMX B;  1E8X A;  4C7Z A;  2MP2 B;  2W9N A;  3KWV A;  3HVD A;  1VJK A;  4RGO S;  2WU5 B;  2ZJD A;  1JAL A;  1YMH E;  1V97 A;  4MH0 E;  4FXC A;  1WWT A;  5FKA C;  1B9R A;  2VH2 A;  4NJ7 A;  1SE3 A;  2ZEQ A;  1N62 A;  3RUL A;  1TS5 A;  4DQO C;  4NAW A;  5L95 C;  1TYG B;  3VTV A;  4K81 A;  3ZRF A;  2HJ8 A;  3ZYY X;  3PO0 A;  2KMC A;  3NZS A;  2NCN A;  1RLF A;  2WXR A;  3N3K B;  1L0V B;  2K22 A;  2I1K A;  1MHH E;  5D94 A;  5CX3 A;  4I6N B;  1WY8 A;  2XK5 B;  4P16 A;  2PMV A;  1WSP A;  4KGS A;  4W9J A;  1AWD A;  2O6V A;  1GJZ A;  1WGK A;  3VH3 B;  3ZIM A;  2QCZ A;  1V81 A;  2YEP F;  3DBH B;  2H88 B;  5DPW A;  1N61 A;  1A5R A;  3GZN B;  4BKS A;  2D2Q A;  1DOI A;  4A3O A;  3ZTD A;  2N9P C;  5IP4 D;  3V3X A;  3P2B A;  3WA0 A;  4GB9 A;  2LAS A;  3DBL B;  1IPG A;  2JZ3 B;  3MJ5 A;  2XEW A;  3KUD B;  2DZM A;  2CJN A;  2XBB C;  3OG5 A;  3BVG A;  2ZPY A;  4HKZ E;  4KIK A;  2GI9 A;  3EHV A;  5AEK B;  2KX3 A;  4OVV A;  4DHJ D;  1KTK A;  2HDE A;  3WAM A;  3Q8C A;  3LB8 C;  4II2 B;  2IYD B;  1WX8 A;  4A20 A;  2N7D A;  3AE6 B;  5J2R A;  2M19 A;  3RI7 C;  1UNS A;  4KZ0 A;  3M63 B;  1CJE A;  2KJ6 A;  4FJV B;  2V9H A;  2W3R A;  4I6P A;  3AE1 B;  5DCN A;  1V1P A;  2G1E A;  3NUH B;  3VUW A;  1TZO A;  4PYZ A;  2ZNV B;  3QAQ A;  4JQW C;  4KGT A;  1EF5 A;  3ZXV A;  4DK5 A;  3IBE A;  1V5T A;  2QDF A;  4WJN A;  2K1F A;  2RPQ A;  3QA8 A;  2KDI A;  2KWC A;  4TSS A;  1OEY J;  2VH1 A;  3AE9 B;  5FR6 A;  3DOW A;  2JXT A;  3IAM 1;  4PT5 A;  4PK1 A;  1YQB A;  3AMZ A;  1KLG D;  4AJW A;  3CF6 E;  3NS1 A;  4GN1 A;  3NVZ A;  2N1V A;  1NI3 A;  2KAN A;  4DBG A;  2PE6 B;  3P4R B;  4NPN A;  3UF8 A;  2ZW0 A;  1ET9 A;  3TJP A;  1P7E A;  4MDK E;  4GDL A;  5EE1 A;  3L08 A;  2KDF B;  2KMM A;  4OHJ A;  4ZYS A;  2N9K A;  4DXA B;  3EFC A;  3B2F A;  2L76 A;  3MFG A;  2ASQ A;  4ICU A;  3KQ4 A;  1WR1 A;  2FCS A;  3ZNZ B;  1VCB A;  4RH6 A;  5EE9 A;  2BS3 B;  4RF1 A;  4XWW A;  1SF0 A;  4ARC A;  1UUP A;  3DQV A;  3H7P B;  3L13 A;  4X57 B;  3AUL A;  2WX1 A;  3ZRC A;  3TEX A;  3X23 A;  1UD7 A;  1J8C A;  4XYC A;  1QQR A;  3NVY A;  1MG4 A;  3PLV A;  1H4R A;  3RCZ A;  1WXQ A;  3V6E B;  4WJQ A;  4URK A;  2QJL A;  2PJH A;  3AE7 B;  1WF9 A;  3VRA B;  3M3J A;  1Y56 A;  3P63 A;  4KIK B;  4TMA B;  3DCG A;  1I35 A;  2Y3A A;  4KSK C;  2CKH B;  3MC8 A;  2K39 A;  4MGY E;  2GB1 A;  1F52 A;  3VQI A;  1GG3 A;  4LNO A;  2Z59 B;  1TT5 B;  3PHX B;  1L5P A;  2K25 A;  1JRU A;  1Z2M A;  1RFA A;  3U7Z A;  1C79 A;  4PS7 A;  1F1H A;  2QMT A;  3TIX A;  2WXI A;  1XLO A;  1V1P B;  1NDD A;  1WMH B;  1WFY A;  3N32 A;  1GB4 A;  3RT3 B;  4CQN A;  1IUE A;  1C3T A;  2AWT A;  3VR9 B;  4LNN A;  4M0W A;  2KHW B;  2V3P A;  1QT9 A;  3W2D A;  1TGZ B;  3X0W A;  1PFD A;  3MC9 A;  2LD9 A;  5LNK 1;  2X8X X;  3TBL D;  5J17 A;  1V9J A;  1L7Y A;  2HJ1 A;  4JWS C;  4E71 A;  1TKG A;  1J19 A;  1KJT A;  1NEK B;  4CO7 A;  1KM7 A;  3L17 A;  1EU3 A;  3QAR A;  5G55 A;  4IOI E;  1UWM A;  3R2I A;  4HXD A;  4B0M A;  3LXF A;  2C60 A;  2K0P A;  1R4N I;  5BYQ A;  4GDL B;  3AED B;  2IZV B;  2WXK A;  1NYQ A;  2RD0 A;  1FXA A;  1LFD A;  3KVF B;  3UI3 A;  2MEK A;  5AUI A;  4G11 A;  1E90 A;  2PVO D;  4DXF A;  2FID A;  1J7A A;  2KWV B;  4NQL B;  2BYT A;  3ZJT A;  4W9E A;  3ZUN A;  2WS3 B;  1H8C A;  1EWC A;  2KN5 A;  1FMA D;  3Q3N C;  4GLS C;  2RMM A;  2N0S B;  3HM3 A;  2FCN A;  1PYW D;  2BTE A;  4Q2J A;  5IO9 A;  1VD2 A;  3PZ7 A;  2KC2 A;  3R66 C;  1ZKH A;  3CMM B;  4EUT A;  3OJ4 B;  3R7R A;  3JVZ X;  1ENF A;  3JSV B;  3VRB B;  3NZ3 A;  3SEB A;  2JRH A;  4BFR A;  4EZJ A;  1YX5 B;  2IGH A;  1ZDX A;  3VTW A;  2KKC A;  4FHJ A;  4NJ6 A;  2UU7 A;  2LEK A;  4XC2 A;  2DHZ A;  1T5X D;  1JWB D;  2V3S A;  4L2Y A;  1V2Y A;  2MRP A;  2LI5 A;  2BKF A;  3PPA A;  3UIO B;  4QAY A;  2BB5 A;  2MX2 A;  2WDR B;  1L4Z B;  5D3I B;  4W9G A;  3H8H A;  4W9H A;  1BUI C;  2HD5 B;  2W55 A;  2MCN B;  4E3C A;  1E6E B;  4PS3 A;  1RFK A;  1WRI A;  1C4A A;  4OVZ A;  3LDZ E;  3U4E G;  4HWI B;  2GBK A;  3CIR B;  5DPS A;  1FCL A;  4IM2 A;  2KJH B;  4M0W B;  1SJE D;  2JX5 A;  1YOV B;  5CHF A;  4BKG A;  4RCO A;  3DHG C;  1PGB A;  2GLS A;  1TZ1 A;  3RNA C;  4E74 A;  2CU3 A;  2MJD A;  3AEG B;  5DPR A;  3HRD D;  1A70 A;  3V6C B;  1K50 A;  2MSE D;  3A4R A;  4FJZ A;  4YSX B;  2AQ3 B;  1TY2 A;  3N1Y C;  4HCN B;  4WWN A;  4BBN F;  1JRO A;  1U4A A;  1VLB A;  1L0X B;  3RN9 C;  4HKQ A;  1NYR A;  3Q6B A;  2BKR B;  2LGY A;  2IO0 B;  3TSS A;  3VH4 B;  2DWQ A;  2BF8 B;  4MEM A;  1FPY A;  4K7S A;  1WGG A;  2LJ5 A;  4XZ4 A;  4EE2 A;  4LDT B;  2IO1 B;  3PT2 B;  1RWS A;  2LVP A;  3L10 B;  2JU6 X;  2DBY A;  2JZZ A;  2LJI A;  1FD6 A;  2HTH A;  2XNA C;  1YJI A;  1JWA D;  3DVG Y;  4HLE A;  4DXG A;  1WX9 A;  1V49 A;  3I63 C;  1L2N A;  2NR2 A;  1HTO A;  4BAX A;  4HRS A;  4K7W A;  3AU4 A;  4HCP B;  2JF5 A;  1SJH D;  4AOF A;  4FA6 A;  3H6N A;  1C9F A;  1L0Y B;  2LWP A;  2WDV B;  3PRE A;  3OJ3 A;  3Q8B A;  4YXD B;  3FKY A;  4ITK A;  3O13 A;  1E7U A;  1EM7 A;  3DBR I;  1SSN A;  2LXA A;  1JWS D;  3EA6 A;  3T3N A;  3QCA A;  5HFY A;  2D3B A;  3KUZ A;  1OGW A;  1OTR B;  5D3D A;  4FUL A;  3DVG X;  2NTT A;  2LRU A;  3NOB A;  1WI0 A;  3RNF C;  2CR5 A;  1UZX B;  4LK0 M;  2LVQ A;  3NVW A;  5AZF A;  4A6Q A;  3UIP B;  4RGT A;  2WQY B;  2XN9 C;  2MBE A;  4HK2 A;  4IM0 A;  1WRD B;  3P4P B;  4M8M A;  2ACZ B;  3WCQ A;  2FE8 A;  4OZC A;  5E6P A;  3RNG C;  4A8X C;  1PGA A;  4A55 A;  3DDC B;  5G5H A;  1ET6 A;  1MHX A;  4J6I A;  3GOE A;  5IOI A;  3A9J B;  2DZJ A;  4YSY B;  2KAC A;  1P9D U;  1UEL A;  2SEB D;  2D3A A;  4N58 A;  4ZRK A;  5LLI A;  2M4N A;  2HTM E;  3MC0 B;  2KD0 A;  2D10 A;  2DZK A;  2JQR B;  2BWE S;  4C7Y A;  1HZ6 A;  4BBN C;  3PRM B;  1TS2 A;  2BS2 B;  3DHI C;  2NBU A;  1XT9 B;  2K8H A;  3U2S C;  2O6V D;  2RPV A;  2WXP A;  4CYE A;  4ARI A;  3TEZ A;  2Z8L A;  2KMA A;  4IWO A;  4JX1 C;  3UIN B;  1P3Q U;  2Q5W D;  4MSQ B;  4BKS D;  1KOT A;  4C4V B;  4ZHO A;  2W3S A;  4IWP A;  2LXC A;  4XE0 A;  3EEC A;  5BMI A;  4GIV A;  4NZL B;  2V4I B;  4XWT A;  1TY0 A;  1SIF A;  1HE8 A;  3H7P A;  3VDZ A;  3P1M A;  1R4N B;  2ZCC A;  2L0T A;  2LHD A;  3FAH A;  3PRP B;  1N63 A;  4S17 A;  3VVW B;  3QX1 A;  3BZD B;  2D07 B;  4H2A A;  4G3X B;  2CHX A;  3DWG C;  4ACF A;  1Q0W B;  2D3C A;  5T8I A;  3RMK C;  1XF5 L;  4ANV A;  2KYW A;  2L32 A;  5EE0 A;  3PZ8 A;  4IW0 A;  2RGF A;  2FUH B;  4OZA A;  1C4C A;  2DZI A;  3MJW A;  2KQS A;  1F2R I;  3APC A;  1E8Z A;  4WJO A;  1TKY A;  1WXV A;  2WU2 B;  2KLC A;  2ONQ A;  4K3C A;  4US9 A;  4ZYN A;  3Q8F A;  2JRI B;  1NBF C;  2IGG A;  2Y5C A;  1WMH A;  2QSD A;  1EU4 A;  3RNC C;  2K6D B;  1AN8 A;  2MA9 B;  4ZRJ A;  3ZJV A;  3AEC B;  5J18 A;  2G4D B;  1F77 A;  1TIF A;  4HPP A;  3MTN B;  2Y5B B;  4USA A;  3B9J A;  2A5U A;  1YN5 A;  3ETR A;  1S3S G;  3ENE A;  1VRA B;  2L00 B;  1XLQ A;  3IXS A;  4A9A A;  2R2O A;  2J42 A;  5D6J B;  1VZ6 A;  1UGM A;  2UYZ B;  1WH3 A;  1MG8 A;  2J0K A;  4AUQ C;  1M4V A;  2WDQ B;  4IM3 A;  5HHD G;  2NVU I;  3N20 C;  4YT0 B;  2EKE C;  2ZZP B;  2I2Y A;  5H92 C;  3RFZ B;  2AQ1 B;  3IHP C;  3W5V B;  1MJD A;  2M56 B;  2WXM A;  2BYV E;  1SBB B;  5IN7 A;  1GOZ A;  3L16 A;  1V1O A;  1SGH A;  2JWZ A;  5CHW A;  1ZXH A;  4OVU A;  1FRD A;  3U52 E;  4UDU C;  4NAM A;  2M0X A;  1YJJ A;  3EGR A;  1DOY A;  4CHK A;  4ZRQ A;  4ZDV A;  2JSV X;  4EFO A;  3IVF A;  5C2T B;  2WYQ A;  1FFU A;  2OOB B;  4KVG B;  1QIL A;  1K8R B;  3JSV A;  3T9L A;  3PGE A;  4AJY B;  1WIA A;  2N4F A;  4GXB A;  2LUE A;  3TUO A;  4C00 A;  4II3 B;  2G9H D;  2E3T A;  1WGY A;  1FNW A;  1RRB A;  1UH6 A;  1I4X A;  2J53 A;  3RYT A;  1I4P A;  2LUM A;  3ZVV A;  1FO4 A;  5JXV A;  3HUI A;  3HIZ A;  4TQ1 A;  2MBB B;  1K51 A;  1XEE A;  3DWM A;  2WP9 B;  1RYJ A;  1TBE A;  1Y8R C;  4DHJ B;  1N6Z A;  4WWO A;  3RZW C;  4DHZ E;  3GS2 A;  1AW7 A;  4WQM A;  2GRI A;  1N60 A;  1ZE3 D;  5BMH A;  3ZNH B;  2N9X A;  2WHI A;  4NJC A;  3Q14 C;  3DBR B;  3RNB C;  1SEB D;  1YNT E;  1OFF A;  3RPF C;  1XLN A;  1GUA B;  3QWZ B;  2VZK D;  2RDH A;  2LMC A;  3AE4 B;  3WAN A;  2KDM A;  4YL8 A;  2GBR A;  2N9L A;  1WGR A;  2SAK A;  1WZ0 A;  2REX A;  3QC8 B;  2BQQ A;  4I6L B;  4OW0 A;  4WWP A;  1QLB B;  3MHZ A;  3HVZ A;  4GU2 A;  3KLS X;  2WXN A;  1WJ6 A;  2D3G A;  2KFK A;  1D5X C;  4F1S A;  4IUM B;  2N7E A;  3RZF A;  4JLC A;  2L83 A;  5LXI B;  2YVC A;  3ONS A;  3NVV A;  3Q2A C;  5D7G A;  2NS5 A;  1MPE A;  3K9P B;  4FBJ B;  1AAR A;  2KN4 A;  3BVZ A;  4N6E B;  1V6E A;  1YX6 B;  1P7F A;  3HM6 X;  1WGD A;  1D4B A;  3VUY A;  2LVO A;  2PEA A;  2IO3 B;  2IY0 B;  2PTL A;  1I7H A;  1X1M A;  2PIA A;  4L1B A;  4EOY A;  2OED A;  1UGJ A;  1CZP A;  3GE8 C;  4M02 A;  2DYM A;  5FR3 A;  2JVC A;  1J0G A;  2DEN B;  1TS4 A;  2KDB A;  2JYE A;  3H9D A;  3RD2 A;  2JT4 B;  2VRR B;  3R8B A;  4YTM B;  2LRW A;  3N9Y C;  4HRO A;  1GPX A;  3AV8 A;  3IFW B;  2AQ2 B;  3DVN U;  3M62 B;  2J52 A;  4G50 A;  2WXG A;  2KAJ A;  4IG7 B;  4LNK A;  4BOS C;  5C1Z A;  1C4P A;  3C0R B;  1SE2 A;  1C77 A;  1TJE A;  1FFV A;  5CTR C;  2BGF A;  3KWL A;  1CQV A;  4KZC A;  2BB6 A;  3SR6 A;  4MSM B;  2EMT A;  4R3D A;  1JML A;  1GNU A;  4MH8 A;  4PYU A;  3LJ3 A;  1WXS A;  3KW5 B;  3PVL A;  2ZNV C;  1MVK A;  4BVU C;  4HPL B;  1B1Z A;  2YLM A;  2X38 A;  3FIL B;  2V4L A;  1T0S C;  2G3Q B;  5JHA A;  2AL3 A;  3ZXR A;  1UWX A;  5GXG B;  3KH0 A;  3CST A;  4ASW C;  1TKE A;  3BYT B;  5C3J B;  4A90 A;  3EUB 2;  1XLP A;  4D2K A;  2LGS A;  1I42 A;  4B95 A;  4LLG M;  3ML9 A;  1C78 A;  3J9C A;  4ZRI A;  1BML C;  4GMV A;  3UQA A;  3AI5 A;  2TSS A;  1L6U A;  3RUI B;  3A9J A;  1LO5 D;  2Z0D B;  3E9S A;  4EZL A;  3AH7 A;  2KFK B;  1UBI A;  1HZ5 A;  3BVM A;  1C1Y B;  1WXA A;  1HQR D;  1KLV A;  3P42 A;  1YJ1 A;  3SDL C;  2BWF A;  3P4S B;  1ZW7 A;  3VUX A;  3AE8 B;  1WE7 A;  3BK1 A;  1SIJ A;  2ICI A;  2J7Q B;  1GC6 A;  3N30 A;  3L54 A;  1WYG A;  3PS6 A;  4EEW A;  1K52 A;  4FHK A;  4KV2 A;  3GB1 A;  2KNB A;  3IG3 A;  3N1X C;  1KF6 B;  3SFD B;  5E6J A;  5JHB A;  4M01 A;  4C4V A;  1WM2 A;  4TUU A;  3NJT A;  1SE4 A;  2KQ4 X;  4ZOH C;  4RF0 A;  1ACC A;  4K3B A;  5I4D A;  4TV3 A;  3ECI A;  3BK2 A;  1FM0 D;  1DYQ A;  4XGA B;  3PHW B;  1FIQ A;  4LNI A;  1FCC C;  4GGQ A;  1ZPS A;  3ZDM C;  1R7S A;  3PZD A;  3SU8 X;  3A33 B;  4MJS B;  1V86 A;  2KJR A;  3W1Y A;  3SHQ A;  2FBW B;  2FIF A;  3AB5 A;  2YEP B;  2AEH A;  1YN4 A;  3NS8 A;  4A3P A;  2WXH A;  4WJP A;  5H8Y E;  2BYE A;  2PVG C;  1KRH A;  1KH0 A;  5D2M B;  2EMS A;  2E6X A;  2RR9 A;  3W1S A;  5MPO A;  4US8 A;  3BYY B;  2B76 B;  4MGK E;  4JIO U;  2N7J A;  4K1R B;  4DDI D;  2DNF A;  4HDQ A;  2EKI A;  2QIL A;  4GDK A;  1ROE A;  3S2A A;  3M95 A;  4W9F A;  4IDI A;  3ZKJ C;  3OAW A;  4EZK A;  2JY6 A;  4KGR A;  3ZDT A;  3LYY A;  2BBC A;  2BT6 A;  3BIN A;  5HI1 A;  1T0Q C;  2BPS A;  1LGR A;  1N5X A;  4P1C C;  4ANX A;  4C80 A;  4B6W A;  2PKO A;  4ICV A;  3AEE B;  2MBQ A;  2V3N A;  1RAX A;  3GE3 C;  2DX5 B;  2O2V A;  4YWG G;  4RM9 A;  2JXX A;  3VTU A;  2IJ0 A;  3VHT C;  3GP7 A;  5GMV A;  1ZGU B;  2M17 A;  2KWU B;  3H1U A;  2MLB A;  2J0M A;  2I38 A;  4AS1 A;  1Z5S B;  3KYC D;  2NPT A;  4KDI C;  3SD5 A;  1ZXI A;  3W5U B;  1PDX A;  3A1Q B;  4RGN A;  1JQ4 A;  3UQB A;  5BO4 B;  1NVI D;  1CK1 A;  1VZ7 A;  2M0A A;  3PLU A;  2DLB A;  3NRZ A;  2LGD A;  3I9V 1;  1I4Q A;  3IT6 B;  1I4R A;  4B9K A;  5CHV C;  4RMA A;  1ZDV A;  2MWS B;  1WJ4 A;  3U7D A;  1FRR A;  1E5W A;  4W9K A;  3DBS A;  2KQ7 A;  2QIE B;  3Q3F A;  2CHW A;  3WAL A;  3C8Y A;  1K53 A;  2OHF A;  1LM8 B;  1XQQ A;  1XD3 B;  3Q8E A;  4YTP B;  1IBX A;  4ANU A;  2B3A A;  4WAA A;  3T8M A;  2NTS A;  1F9J A;  2QHO A;  5AZG A;  2KWD A;  4IC7 B;  4MAC A;  3AU5 A;  2BYF A;  3V62 A;  1R4M I;  4FAD A;  3CSF A;  3ABV B;  2C5L C;  4MT5 A;  2KVZ A;  2JWU A;  1HA5 A;  1L6V A;  2FAZ A;  2J4X A;  1T6B X;  5IAA C;  3ML8 A;  2MQJ A;  4O1N A;  1WX7 A;  4JE3 B;  1XCT L;  4GDK B;  3ZW3 A;  4KKJ A;  2OJW A;  2INP E;  3BII D;  2MJE A;  5EE3 A;  3R7Q A;  1XXG A;  4N59 A;  2RSU A;  1FNV A;  4RFB A;  2KC1 A;  1J7B A;  3NZU A;  1F2R C;  2DYO A;  1OQY A;  2KT7 A;  1GB1 A;  3O65 B;  2KTR B;  2FCQ A;  5LXH A;  3IT4 B;  4WUR A;  3WAP A;  1NI2 A;  1P0R A;  2O2V B;  2KOX A;  2JYT A;  4JPS A;  2DYB A;  3DHH C;  4BKT A;  2IGD A;  1YN3 A;  5DPT A;  1E8W A;  3AE2 B;  2MH7 A;  3B0A A;  4FLH A;  4YSZ B;  1SB3 C;  3PV1 A;  2GMI C;  2NPT B;  4NQK E;  1IYF A;  4NAW B;  3P4Q B;  1YQ4 B;  1MFW A;  1V5O A;  2MHJ A;  3VR8 B;  1JCK B;  1D6E C;  2INN E;  5C23 A;  5KHQ A;  1STE A;  1Q5W B;  1FEH A;  1HTQ A;  3V60 A;  2RDB C;  4EKU A;  2GBN A;  1L4D B;  2O6V B;  1VDV A;  3I5J C;  3UGB B;  2L05 A;  2LGI A;  2L7R A;  1WZ3 A;  1VR9 A;  1E8Y A;  4JGH B;  2L52 A;  3B1L X;  4WH4 A;  4DDG D;  4RM8 A;  1IBX B;  5E6N A;  3QIJ A;  4LJO B;  4RGM A;  1JWU D;  4KX6 B;  4REZ A;  3TMP B;  5L83 A;  1E0Z A;  2AX5 A;  1WR6 E;  2OJR A;  3ZGZ A;  2INC C;  4IKG A;  1I4G A;  1QZE A;  3URY A;  2QC8 A;  1DOX A;  1TTN A;  4MGZ E;  3RNE C;  4WQO B;  2WLB A;  4W9L A;  2CHZ A;  4WAF A;  5JZE B;  2ZCB A;  1MI0 A;  2IND C;  2IO2 B;  3KYD D;  5AZH A;  2R2Q A;  3BY4 B;  1IGC A;  1LQB A;  3QQ8 B;  3PRZ A;  3AE5 B;  3SFE B;  2WWZ A;  4LNF A;  2R61 A;  2M8S A;  3WAO A;  3AEB B;  4KDL B;  1E10 A;  3ZLZ A;  4HJG E;  3FIL A;  1FNU A;  4RNA A;  1LXD A;  2NMQ A;  1ZOY B;  2ON8 A;  4HEA 1;  3DVN V;  5AUK A;  1F0Z A;  2WXQ A;  4KKI A;  1J7C A;  3U8Z A;  5BMG A;  1EUV B;  2KX0 A;  2PPH A;  1WYW B;  3TEW A;  1HEZ E;  3R3M A;  2W54 A;  1JRP A;  2CJO A;  1AYF A;  3JW0 X;  1BT0 A;  3DPD A;  2A4Z A;  4F8C B;  3QJZ A;  1D3Z A;  3JYU A;  3EC8 A;  1VZ8 A;  1OQQ A;  1QOB A;  3U30 A;  1C76 A;  2FNJ B;  4B0E A;  3APF A;  4W9I A;  3PSE B;  2JUO A;  3V05 A;  3B08 A;  2K8B A;  2M1M A;  3EFU A;  1PQS A;  2PE9 A;  3E56 A;  4LDT D;  4LJP B;  2V0G A;  4G0N B;  3H7S A;  1IP9 A;  1M94 A;  1P1A A;  3DBH I;  1E9M A;  3GZN I;  4LTU A;  1WE6 A;  2AYO B;  3ZTC A;  5IKC M;  2KDE B;  2C7M B; 
#chains in the Genus database with same CATH homology
 1S1Q B;  2KMA A;  4FHK A;  4IWO A;  4KV2 A;  4HVB A;  4DXA B;  3UIN B;  3DBL I;  1OEY A;  2KNB A;  2L8J A;  3IG3 A;  1P3Q U;  2L76 A;  2ASQ A;  4FN2 A;  5JHB A;  5KHO A;  1WGH A;  1WM2 A;  4MSQ B;  4ICU A;  4TUU A;  4BKS D;  1KOT A;  4IWP A;  1WR1 A;  2FCS A;  2LXC A;  3ZNZ B;  2MBH A;  3EEC A;  1VCB A;  4GIV A;  1ISN A;  4TKN A;  2WDT B;  1YD8 U;  4AWJ A;  4XX5 A;  2G45 B;  1SIF A;  3QK0 A;  3QHT A;  1HE8 A;  3H7P A;  4TV3 A;  3VDZ A;  3DQV A;  3H7P B;  3L13 A;  2CS4 A;  3ECI A;  2ZCC A;  4X57 B;  2HE7 A;  2L0T A;  3AUL A;  2KLG A;  2WX1 A;  4K7U A;  3PRP B;  3PHW B;  4W9D A;  3ZRC A;  2C7H A;  3VVW B;  3QX1 A;  2D07 B;  4GGQ A;  4G3X B;  3X23 A;  1UD7 A;  2CHX A;  1J8C A;  1Q0W B;  3ZDM C;  3PLV A;  1H4R A;  3RCZ A;  3PZD A;  3V6E B;  3SU8 X;  4WJQ A;  3A33 B;  4MJS A;  2GBJ A;  3TCA A;  1V80 A;  3A4S C;  4URK A;  4MJS B;  3AXC A;  2PJH A;  4KSL C;  1V86 A;  4ANV A;  4N9F 4;  2KJR A;  3W1Y A;  3SHQ A;  1WF9 A;  1SE9 A;  1YIW A;  2KK8 A;  3W1S C;  2G4S A;  4IW0 A;  2FIF A;  2RGF A;  2AEH A;  4MGI E;  3M3J A;  3NS8 A;  4DWF A;  2FUH B;  2L0F A;  4A3P A;  4KIK B;  4WJP A;  2I1J A;  3DCG A;  1I35 A;  2BYE A;  1EF1 A;  4JL9 A;  4KSK C;  2DZI A;  3MJW A;  2KQS A;  2CKH B;  3APC A;  1E8Z A;  4WJO A;  2K39 A;  5TR5 A;  1WXV A;  5D2M B;  2EMS A;  3K9O B;  4MGY E;  1UBQ A;  2RR9 A;  3W1S A;  4NNJ B;  3VQI A;  1GG3 A;  4LCD E;  2Z59 B;  3PHX B;  2K25 A;  5JH5 C;  2KLC A;  1JRU A;  1Z2M A;  4HJK A;  1RFA A;  4MGK E;  4JIO U;  3TL5 A;  4K1R B;  4FJY A;  4DDI D;  4PS7 A;  4ZYN A;  2JRI B;  4HDQ A;  5IA7 A;  3TIX A;  2JPH A;  1NBF C;  2GBM A;  4GDK A;  1WM3 A;  1NDD A;  1WMH A;  4W9C A;  1WMH B;  1WFY A;  3N32 A;  1GC7 A;  3S2A A;  3RT3 B;  2K6D B;  3ZNI D;  3M95 A;  4MM3 A;  1C3T A;  4W9F A;  2AWT A;  2MA9 B;  4ZRJ A;  3OAW A;  3ZKJ C;  4ANW A;  4EZK A;  2JY6 A;  3ZDT A;  3VAW A;  2KHW B;  5J18 A;  2MW5 A;  3BIN A;  2G4D B;  2BPS A;  1TGZ B;  2KXJ A;  3X0W A;  3MTN B;  4ANX A;  2LD9 A;  2Y5B B;  4IWQ A;  4B6W A;  2N9E B;  4ICV A;  3ZNG C;  3OLM D;  2A5U A;  3TBL D;  2D11 A;  2Z0E B;  2K8C A;  3APD A;  3A9K A;  2MBQ A;  1S3S G;  3ENE A;  1RAX A;  2L00 B;  5J17 A;  1V9J A;  1L7Y A;  2DAJ A;  2R2O A;  2DX5 B;  5D6J B;  4GOC A;  4E71 A;  1UGM A;  2O2V A;  1J19 A;  2UYZ B;  2MP2 A;  4RM9 A;  2JXX A;  3VTU A;  1KJT A;  1MG8 A;  1WH3 A;  1KM7 A;  2J0K A;  3L17 A;  4CO7 A;  4BOZ B;  3QAR A;  3VHT C;  4AUQ C;  5G55 A;  5GMV A;  3WIM A;  1ZGU B;  2M17 A;  4MEL A;  4IM3 A;  2KWU B;  2NVU I;  3D32 A;  3H1U A;  2MLB A;  2EKE C;  2UWQ A;  3ALB A;  2J0M A;  2ZZP B;  4GSW A;  4HXD A;  1Z5S B;  2C60 A;  3KYC D;  1EO6 A;  1R4N I;  3VXW A;  1WJU A;  4GDL B;  3IHP C;  2LZ6 A;  2NPT A;  2FCM A;  2BYV E;  2AL6 A;  2IZV B;  4KDI C;  3SD5 A;  3A1Q A;  3L16 A;  3A1Q B;  2RD0 A;  3UQB A;  5BO4 B;  1LFD A;  3KVF B;  1SGH A;  3PTF C;  5G2N A;  4TQ0 A;  3PLU A;  2JWZ A;  4G11 A;  3L0W B;  5CHW A;  2LGD A;  1E90 A;  3NY5 A;  4OVU A;  1FXT B;  2L3Z A;  4B9K A;  5CHV C;  4RMA A;  2IY1 B;  2FID A;  2MWS B;  4HPM B;  3Q3J A;  1WJ4 A;  2XK5 A;  3U7D A;  3MHS D;  2IBI B;  2M0X A;  1G6J A;  2KWV B;  5HKH A;  4NQL B;  3V61 A;  4F7Z A;  4W9E A;  3ZUN A;  2ZVN A;  1H8C A;  4CHK A;  4ZDV A;  1E5W A;  4W9K A;  4M8N A;  3DBS A;  2KFJ A;  2KN5 A;  2NBW B;  2KQ7 A;  3Q3F A;  2CHW A;  4PS8 A;  3WAL A;  2ZVO A;  4EFO A;  3IVF A;  3HM3 A;  2FCN A;  4NY0 A;  2WYQ A;  3HHM A;  1LM8 B;  1XQQ A;  1VD2 A;  1WJN A;  1XD3 B;  1P98 A;  2KC2 A;  2OOB B;  3R66 C;  4KVG B;  5EDS A;  4ANU A;  1ZKH A;  3CMM B;  2B3A A;  4EUT A;  4WAA A;  3ZO5 B;  1K8R B;  3OJ4 B;  1E7V A;  3JSV A;  3R7R A;  3T8M A;  1F9J A;  1T0Y A;  3JVZ X;  3JSV B;  2QHO A;  5AZG A;  4IC7 B;  2CU1 A;  3AU5 A;  3T9L A;  2N1W A;  2BYF A;  3V62 A;  2JRH A;  4AP4 C;  3PGE A;  4AJY B;  1WIA A;  4BFR A;  4EZJ A;  2N4F A;  4GXB A;  1YX5 B;  1R4M I;  4FAD A;  2LGX A;  2LUE A;  3CSF A;  3VTW A;  2MBO A;  2C5L C;  2KKC A;  4FHJ A;  4NJ6 A;  2DAF A;  4II3 B;  5E6O A;  4P7I A;  1WGY A;  4XC2 A;  1RRB A;  1UH6 A;  2NBV B;  2KTF A;  3RYT A;  2DHZ A;  2V3S A;  1V2Y A;  2FAZ A;  2MRP A;  2LI5 A;  3ZVV A;  2BKF A;  2GOW A;  3KUC B;  3PPA A;  3UIO B;  5IAA C;  3ML8 A;  2MQJ A;  2MX2 A;  3HIZ A;  4TQ1 A;  2MBB B;  4W9G A;  3I3T B;  1WX7 A;  4W9H A;  4E3C A;  2HD5 B;  2MCN B;  4GDK B;  3ZW3 A;  2V1Y A;  4PS3 A;  2J0J A;  3LDZ E;  4HWI B;  3R7Q A;  1Q1O A;  2RSU A;  1TBE A;  1Y8R C;  2GBK A;  3VFK A;  4DHJ B;  2KZR A;  4HDO A;  5DPS A;  2KC1 A;  3NZU A;  2KO3 A;  4WWO A;  3RZW C;  4DHZ E;  3NHE B;  4IM2 A;  2WX0 A;  2C7N B;  2KJH B;  4M0W B;  2DYO A;  1OQY A;  2KVR A;  2KTR A;  3ZNH B;  2N9X A;  3O65 B;  2K6Q A;  2KTR B;  5CHF A;  4BKG A;  1WXM A;  1TZ1 A;  4E74 A;  2ZPN A;  3A9K B;  2FCQ A;  1GUA B;  3HK0 A;  4DHZ B;  5LXH A;  5DPR A;  2C9W B;  3QWZ B;  1CMX B;  3WAP A;  1NI2 A;  1E8X A;  1P0R A;  2O2V B;  2KOX A;  3V6C B;  2MSE D;  2MP2 B;  2W9N A;  3WAN A;  2DYB A;  3A4R A;  4FJZ A;  4BKT A;  4YL8 A;  2GBR A;  2ZJD A;  1WGR A;  4HCN B;  4WWN A;  5DPT A;  1WZ0 A;  2REX A;  3QC8 B;  4I6L B;  1E8W A;  4WWP A;  4BBN F;  4MH0 E;  3B0A A;  1U4A A;  4GU2 A;  4FLH A;  1WJ6 A;  2D3G A;  4NJ7 A;  2ZEQ A;  2KFK A;  2BKR B;  2LGY A;  2IO0 B;  3PV1 A;  3RUL A;  4F1S A;  2GMI C;  2NPT B;  4IUM B;  4NAW A;  4NQK E;  5L95 C;  1IYF A;  2N7E A;  3VTV A;  4NAW B;  4K81 A;  3RZF A;  3VH4 B;  3ZRF A;  2BF8 B;  1V5O A;  4JLC A;  4MEM A;  5LXI B;  2HJ8 A;  4K7S A;  2YVC A;  1WGG A;  3ONS A;  2LJ5 A;  4XZ4 A;  2KMC A;  5D7G A;  4LDT B;  2IO1 B;  2NS5 A;  3NZS A;  3PT2 B;  2NCN A;  1RLF A;  3N3K B;  3K9P B;  4FBJ B;  5C23 A;  1AAR A;  2LVP A;  2I1K A;  3L10 B;  5D94 A;  5KHQ A;  1Q5W B;  1V6E A;  1YX6 B;  5CX3 A;  4I6N B;  2JZZ A;  1WY8 A;  3HM6 X;  2XK5 B;  1WGD A;  3V60 A;  4W9J A;  2HTH A;  3VUY A;  4EKU A;  2LVO A;  2PEA A;  2IO3 B;  2IY0 B;  3DVG Y;  2O6V A;  2GBN A;  1GJZ A;  1X1M A;  2O6V B;  3UGB B;  3PS6 A;  3VH3 B;  3ZIM A;  4EOY A;  4HLE A;  2L05 A;  1V81 A;  2L7R A;  2DYM A;  2JVC A;  1WZ3 A;  1J0G A;  1WX9 A;  1V49 A;  1E8Y A;  2DEN B;  2KDB A;  4JGH B;  5DPW A;  3H9D A;  3B1L X;  3RD2 A;  2JT4 B;  2VRR B;  1A5R A;  1L2N A;  4DDG D;  2LRW A;  2D2Q A;  4RM8 A;  2NR2 A;  3QIJ A;  4LJO B;  5E6N A;  4BKS A;  4A3O A;  3IFW B;  3ZTD A;  3DVN U;  3M62 B;  2N9P C;  4K7W A;  4G50 A;  3TMP B;  5L83 A;  3AU4 A;  3P2B A;  4BOS C;  4IG7 B;  3WA0 A;  4GB9 A;  2LAS A;  1WR6 E;  5C1Z A;  2OJR A;  1IPG A;  4HCP B;  2JF5 A;  2JZ3 B;  3C0R B;  4AOF A;  2XEW A;  3KUD B;  3H6N A;  2DZM A;  4FA6 A;  5CTR C;  1QZE A;  2BGF A;  2XBB C;  1TTN A;  2LWP A;  4KZC A;  4MGZ E;  3PRE A;  4WQO B;  3OJ3 A;  4W9L A;  2CHZ A;  2ZPY A;  5JZE B;  4MSM B;  2ZCB A;  2EMT A;  4KIK A;  1E7U A;  3DBR I;  3EHV A;  2IO2 B;  3KYD D;  2KX3 A;  4OVV A;  1GNU A;  4DHJ D;  5AZH A;  5AEK B;  2LXA A;  2R2Q A;  3BY4 B;  4PYU A;  1LQB A;  3LJ3 A;  3QCA A;  1WXS A;  3WAM A;  3QQ8 B;  3PRZ A;  3KUZ A;  3KW5 B;  4II2 B;  2IYD B;  1OGW A;  3PVL A;  1WX8 A;  1OTR B;  2WWZ A;  2ZNV C;  4A20 A;  2M8S A;  2N7D A;  3DVG X;  4FUL A;  3WAO A;  5J2R A;  4BVU C;  2LRU A;  3NOB A;  1WI0 A;  4HPL B;  4KDL B;  4KZ0 A;  2CR5 A;  1UZX B;  2YLM A;  3ZLZ A;  3M63 B;  2LVQ A;  2V4L A;  1LXD A;  5AZF A;  2KJ6 A;  3UIP B;  2G3Q B;  4FJV B;  5JHA A;  3DVN V;  4I6P A;  2AL3 A;  5DCN A;  3VUW A;  3U8Z A;  4PYZ A;  2MBE A;  4HK2 A;  2ZNV B;  1EUV B;  3KH0 A;  3QAQ A;  2KX0 A;  2PPH A;  4IM0 A;  3CST A;  1WYW B;  4JQW C;  4ASW C;  1EF5 A;  1WRD B;  3R3M A;  4M8M A;  4DK5 A;  3IBE A;  1V5T A;  1I42 A;  3JW0 X;  5E6P A;  1BT0 A;  4WJN A;  4B95 A;  3DPD A;  2A4Z A;  4F8C B;  3ML9 A;  3QJZ A;  2K1F A;  1D3Z A;  3JYU A;  2RPQ A;  3DDC B;  3EC8 A;  3QA8 A;  3U30 A;  4ZRI A;  2KDI A;  2KWC A;  2FNJ B;  1OEY J;  4GMV A;  3GOE A;  4J6I A;  5FR6 A;  3UQA A;  3AI5 A;  3APF A;  3DOW A;  3RUI B;  3A9J A;  4W9I A;  2Z0D B;  3A9J B;  3PSE B;  2JUO A;  1YQB A;  2DZJ A;  3B08 A;  2K8B A;  4EZL A;  1P9D U;  2KFK B;  1UBI A;  1UEL A;  2M1M A;  3EFU A;  1PQS A;  1C1Y B;  1WXA A;  2PE9 A;  4LDT D;  1KLV A;  4LJP B;  4AJW A;  3CF6 E;  4G0N B;  4ZRK A;  3H7S A;  2M4N A;  5LLI A;  1IP9 A;  1YJ1 A;  1M94 A;  2KD0 A;  1P1A A;  2D10 A;  2DZK A;  3DBH I;  4GN1 A;  3SDL C;  2N1V A;  2BWE S;  2KAN A;  2BWF A;  4DBG A;  4BBN C;  2PE6 B;  3PRM B;  4NPN A;  1ZW7 A;  3UF8 A;  3VUX A;  3GZN I;  1WE7 A;  3TJP A;  1WE6 A;  2AYO B;  2NBU A;  4MDK E;  4GDL A;  2J7Q B;  3ZTC A;  1XT9 B;  1GC6 A;  2K8H A;  2KDE B;  2O6V D;  3L54 A;  3L08 A;  3N30 A;  2C7M B;  4CYE A;  2KDF B;  4EEW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...