2IY1B

Senp1 (mutant) full length sumo1
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
83
structure length
83
Chain Sequence
EYIKLKVIGQDSSEIHFKVKMTTHLKKLKESYCQRQGVPMNSLRFLFEGQRIADNHTPKELGMEEEDVIEVYQEQTGGHSTVC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SENTRIN-SPECIFIC PROTEASE 1
publication title Sumo Protease Senp1 Induces Isomerization of the Scissile Peptide Bond.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/nuclear protein
total genus 18
structure length 83
sequence length 83
chains with identical sequence D
ec nomenclature
pdb deposition date 2006-07-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF11976 Rad60-SLD Ubiquitin-2 like Rad60 SUMO-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 2iy1B00
1WX7A 4BVUC 2G3QB 4BFRA 2KD0A 1E5WA 2KKCA 3JW0X 4GOCA 2BYFA 3QJZA 4ZRKA 2OOBB 4II3B 1V5OA 3DVNV 1WGHA 4FN2A 5CX3A 2RPQA 3A9JA 3ZIMA 1KOTA 4JL9A 2ZNVC 3AI5A 1LFDA 5DPTA 4HLEA 4MSQB 4RM9A 1S3SG 2LD9A 1EUVB 5CHVC 3S2AA 3B1LX 4KV2A 3X0WA 4MM3A 4MGKE 3ZRCA 3PLVA 3QCAA 1E8WA 1E7UA 1P98A 4EZJA 3HK0A 4EFOA 2JZ3B 4BOZB 2DYMA 1KM7A 3ZKJC 4ASWC 3N30A 4WJPA 3VUWA 3JSVA 5LXIB 2KJ6A 3WAOA 1WXAA 3DVGY 4MSMB 1UBQA 2CR5A 4IM2A 4KZ0A 2KNBA 3RZWC 3PLUA 3H7PB 3VAWA 4TV3A 3C0RB 2D3GA 4GDLB 2GBJA 1WXSA 1BT0A 3TJPA 2XBBC 4FHKA 2Z0DB 5AZHA 3APDA 1YQBA 4DDID 4TKNA 4GSWA 3M95A 4HDQA 3UIOB 3HM6X 2MP2B 1KLVA 4CHKA 4HCPB 5FR6A 1ZGUB 4NNJB 2FAZA 1WJNA 4FJYA 4E71A 1J8CA 3T9LA 3CMMB 1ZW7A 4AWJA 2K6DB 1F9JA 2LRUA 4IM0A 3VTUA 1GJZA 1TZ1A 2WYQA 4FULA 3ECIA 2KJRA 4X57B 4DBGA 3SHQA 3UGBB 2L3ZA 2GBKA 2D11A 3ENEA 1WM2A 2KXJA 1Q1OA 2M17A 5J17A 2G4SA 4E74A 4DK5A 2KFKA 3RYTA 2PEAA 4FA6A 4FHJA 2JY6A 2N9EB 3X23A 1RRBA 2IO2B 3U8ZA 3ZUNA 2DZMA 1XQQA 1ISNA 3IBEA 2MLBA 3TBLD 2FIDA 2IZVB 3R3MA 1QZEA 3PT2B 3I3TB 4KIKA 3QX1A 1NDDA 4PYZA 4BKSD 3QK0A 2MBOA 4EKUA 4ANXA 2ZVNA 4W9CA 2NVUI 3RD2A 2HJ8A 3QIJA 3EFUA 1I42A 4JGHB 1A5RA 4NQLB 2NBWB 3PHXB 1V86A 4HXDA 4IC7B 4MDKE 4HK2A 3RULA 3CF6E 1WE7A 2BYEA 2DX5B 2LRWA 2PPHA 1HE8A 3EC8A 2LWPA 2IY0B 2XK5A 3PRZA 4JQWC 4NAWA 1H8CA 4EUTA 4AJYB 3RT3B 1VCBA 1GC6A 1GG3A 1WGGA 2KDFB 4GN1A 3APCA 2MRPA 2K1FA 5CTRC 2K8HA 2I1JA 5IAAC 2N9XA 1WE6A 3OJ3A 2KDBA 2AWTA 3JYUA 1WZ3A 3GZNI 2DZKA 2W9NA 2C5LC 1GC7A 1X1MA 3A1QA 3M62B 4I6LB 2KMAA 3SD5A 2KTRB 3LJ3A 3R66C 1GUAB 1R4MI 2O6VA 1V81A 2L76A 2MSED 3GOEA 3NY5A 2J7QB 4KVGB 4MJSB 2JF5A 2CS4A 2LVPA 4J6IA 1H4RA 2BWFA 3UINB 4K7UA 3WIMA 2AL6A 4F1SA 3PRPB 4PS8A 3A9JB 4I6NB 3V6CB 2C7HA 1V80A 4ZRJA 1V9JA 5LLIA 3PREA 1LXDA 2A4ZA 3KW5B 3QQ8B 3RZFA 1WRDB 2NBUA 5GMVA 1J19A 2DAFA 2CHWA 2IO3B 3KYCD 2MBBB 3EECA 5JZEB 3U7DA 2M1MA 2EKEC 4A3OA 4XX5A 3DPDA 4DHJB 2KLGA 5D6JB 2DENB 4II2B 2BWES 3JSVB 3RCZA 5DPWA 2LI5A 2D10A 2MX2A 4GDKA 4HPMB 1TGZB 4B6WA 4MJSA 4WWNA 4NJ6A 3TCAA 5D7GA 5G55A 1RLFA 3KH0A 1ZKHA 2GBNA 4BKTA 2WDTB 2ZZPB 5JHAA 4KSLC 3CSTA 4DHZB 2NCNA 4DHJD 1P0RA 1YX5B 5JHBA 4GIVA 1Z5SB 3N32A 2Z59B 3TMPB 2DYOA 4W9GA 1JRUA 1PQSA 2KMCA 3OAWA 3PTFC 1WX8A 1U4AA 1GNUA 1EF1A 3ONSA 2XEWA 1WJUA 2OJRA 3W1SA 1P1AA 1RAXA 2R2OA 2HD5B 3V62A 4BBNC 2J0KA 2LXAA 2LASA 2BKFA 4M8MA 2ZPNA 3NHEB 1I35A 2M4NA 5AZGA 5L83A 2DHZA 4AOFA 1WR6E 2KJHB 1NI2A 1OGWA 2KFKB 1WI0A 4IWPA 3NOBA 4F7ZA 3QARA 4LJOB 1WF9A 2O2VA 2MCNB 2NBVB 3AULA 4HVBA 3A4SC 2ZEQA 1YX6B 2FCQA 2UWQA 3VH4B 4B9KA 3B0AA 2KC2A 4KIKB 5TR5A 4IWOA 5E6PA 3PGEA 3PS6A 4MH0E 4P7IA 1WIAA 3HM3A 1CMXB 3PZDA 3TL5A 2K25A 4CO7A 4MGIE 4G0NB 2FCNA 4HDOA 2K8CA 2V1YA 5AEKB 4E3CA 3VUYA 2JVCA 4MGZE 1WZ0A 1E90A 2KWUB 5DCNA 1E8YA 2M0XA 2EMSA 2XK5B 4NAWB 2NPTA 3L08A 2I1KA 4K1RB 2IBIB 3PRMB 2ZVOA 3V6EB 2FUHB 3HIZA 2K6QA 3R7RA 2WX1A 2KVRA 4W9JA 2FCSA 1Q5WB 3ZDMC 1V49A 2KDEB 2N1VA 3QC8B 1RFAA 2GOWA 3A1QB 2AYOB 4NJ7A 4WQOB 5CHWA 2MWSB 2L0FA 1OEYJ 2KHWB 4GU2A 3BY4B 4KDIC 4ANWA 3QHTA 2J0MA 2O6VB 3DBHI 3U30A 1OQYA 3OJ4B 1UGMA 3L16A 3N3KB 4AJWA 4KSKC 3D32A 1YIWA 3KUCB 5L95C 2JRIB 2N7DA 2LXCA 1EF5A 4ANVA 2RSUA 3P2BA 1S1QB 4GXBA 2MW5A 2KFJA 2WX0A 2ASQA 2O6VD 1L7YA 1P9DU 4K81A 4HCNB 4EZLA 4F8CB 2FNJB 3DBLI 1T0YA 1UD7A 2LVOA 4XC2A 3VFKA 2D07B 4IG7B 4A20A 1WFYA 2YVCA 3MHSD 4G3XB 2V4LA 1UELA 1OTRB 1E7VA 2N9PC 4G50A 1D3ZA 1TTNA 2LVQA 5EDSA 2KANA 4BBNF 2KLCA 4GDKB 3ZNHB 4BOSC 4FBJB 3DDCB 3TIXA 1E8XA 2BF8B 3PSEB 3ZLZA 2MBHA 1KJTA 1V2YA 2PE6B 2JZZA 4K7WA 2JWZA 2A5UA 1OEYA 2M8SA 2KX3A 2ZCCA 4FLHA 3KVFB 4IWQA 3UQBA 4LDTD 2C7MB 4BKGA 2AL3A 3Q3FA 5IA7A 3T8MA 1WXVA 3DCGA 3NZUA 1LQBA 3KYDD 3L10B 3ZDTA 1M94A 1LM8B 3VUXA 3EHVA 2KN5A 4GB9A 2EMTA 4JLCA 1SIFA 5D2MB 3DBSA 1UBIA 1WGRA 3ZNGC 4CYEA 4EZKA 1IP9A 4W9EA 2NS5A 2JXXA 1WH3A 3QWZB 5E6NA 4W9FA 4WJQA 5J2RA 2B3AA 2C9WB 2DZJA 3ML9A 5DPSA 4ZYNA 4MELA 1TBEA 2L05A 3VHTC 2QHOA 2O2VB 2ZNVB 4NQKE 1WM3A 1IYFA 2BPSA 1WGDA 2LZ6A 2AEHA 2Y5BB 3PHWB 3UF8A 4RM8A 1WJ6A 4WWPA 3BINA 2ZCBA 4WJNA 5BO4B 2MQJA 4WAAA 3SU8X 2JUOA 1YD8U 1WYWB 2C60A 4ICVA 2CKHB 2LGXA 3AU5A 4ZDVA 2KO3A 3UQAA 1IPGA 1EO6A 2IY1B 3KUZA 3ZTDA 4W9KA 5CHFA 2NPTB 4FJVB 1E8ZA 4TQ1A 2R2QA 1WGYA 3H1UA 3UIPB 3WAPA 2C7NB 3DOWA 2NR2A 4M8NA 3ZNZB 2DYBA 2KZRA 4LJPB 3VVWB 1Q0WB 1UH6A 1UZXB 3WALA 2GBMA 2JT4B 4GMVA 4WWOA 4A3PA 3PVLA 2GBRA 4W9HA 4I6PA 2LGYA 4ICUA 3VQIA 4BKSA 4M0WB 2DAJA 4ZRIA 4DWFA 1AARA 3A9KB 2PE9A 1G6JA 4OVVA 3L13A 4KZCA 3W1YA 3IHPC 3VDZA 3NS8A 2DZIA 2N7EA 4WJOA 5KHOA 3M3JA 2K39A 1NBFC 3PPAA 1J0GA 3IG3A 4FJZA 5E6OA 1C1YB 3K9OB 2L7RA 3WA0A 5KHQA 1P3QU 2REXA 3APFA 2LUEA 3QAQA 3MJWA 3Q3JA 1SE9A 2CHZA 2IO1B 2KWVB 2VRRB 2G45B 3ZRFA 2UYZB 2V3SA 3V60A 4EEWA 1WY8A 2ZJDA 4IW0A 3OLMD 4XZ4A 3LDZE 1WR1A 2LGDA 4GGQA 2BYVE 5LXHA 3A9KA 3A33B 4OVUA 2YLMA 3M63B 2PJHA 3H9DA 3NZSA 3L17A 1Z2MA 2D2QA 2BGFA 3WAMA 3A4RA 3KUDB 1WXMA 5AZFA 2FCMA 3H7PA 3V61A 3AXCA 2JPHA 4W9DA 4GDLA 2KTFA 1YJ1A 2CU1A 3CSFA 3DQVA 4ANUA 3DVGX 1WMHB 2G4DB 4HWIB 2WWZA 4DDGD 4W9LA 2RR9A 3H7SA 4HJKA 2GMIC 3ZTCA 1XD3B 3ZVVA 4NPNA 3VTVA 2MA9B 3VXWA 2KOXA 2MP2A 3MTNB 2K8BA 3HHMA 1R4NI 2RD0A 4TQ0A 5J18A 2FIFA 2JRHA 2J0JA 5D94A 4LDTB 4KDLB 2MBEA 1Y8RC 4MGYE 4K7SA 2HE7A 2L0TA 2BKRB 3K9PB 4G11A 1MG8A 3O65B 1VD2A 4FADA 3L54A 3R7QA 2L8JA 3ZO5B 3DVNU 3H6NA 4MEMA 3IFWB 4JIOU 3ALBA 1WX9A 1WMHA 4DXAB 4EOYA 5C23A 2N1WA 3WANA 4DHZE 1FXTB 2RGFA 1SGHA 3B08A 2HTHA 2IO0B 1XT9B 2IYDB 3AU4A 1L2NA 2LJ5A 2L00B 5JH5C 5DPRA 2KC1A 2ZPYA 2Z0EB 2KQSA 1WJ4A 3DBRI 2KK8A 4NY0A 2KX0A 4HPLB 3IVFA 4N9F4 2CHXA 5G2NA 4W9IA 2KDIA 3JVZX 2KQ7A 2N4FA 3L0WB 1K8RB 4AUQC 3ZW3A 1V6EA 5HKHA 2MBQA 4LCDE 3ZNID 4YL8A 4URKA 3ML8A 4IM3A 4B95A 4IUMB 4PS7A 3SDLC 4PYUA 3PV1A 4RMAA 2KWCA 3VH3B 3QA8A 1V5TA 4TUUA 3W1SC 2KTRA 3VTWA 1C3TA 4AP4C 3RUIB 5C1ZA 4PS3A
chains in the Genus database with same CATH superfamily
2BT6A 2INPE 4BFRA 2KD0A 3ZXVA 4PT5A 3QJZA 2OOBB 4II3B 1V5OA 3DVNV 4FN2A 5CX3A 2RPQA 2Y3AA 1KOTA 4HLEA 2LD9A 1EUVB 4C4VA 5CHVC 4RNAA 3C8YA 1T6BX 2BB5A 4MGKE 2WXOA 3ZRCA 3PLVA 1JWAD 2JZ3B 2DYMA 4JPSA 4ASWC 4WJPA 5BMGA 1ACCA 3VUWA 2KJ6A 4D2KA 1UBQA 4KZ0A 2IJ0A 2KNBA 1TY2A 3C0RB 3TJPA 2SAKA 3APDA 1YQBA 2J4XA 4HDQA 3GP7A 2D3AA 2FAZA 4E71A 1VLBA 1IBXA 2K6DB 1GJZA 2HDEA 4X57B 4DBGA 3N1YC 2D11A 2KXJA 2M17A 3B2GA 4FA6A 2N9EB 3X23A 2IO2B 3U8ZA 4LNOA 4LNNA 2FIDA 4O1NA 4RGMA 4BKSD 3QK0A 2MBOA 2ZVNA 2BVCA 4JGHB 1A5RA 4IC7B 4BKSA 1QT9A 3IAS1 1GC6A 2KDFB 2ZW0A 3APCA 1WRIA 2MRPA 2PVOD 5BYRA 2GI9A 2AWTA 1WZ3A 1ZXIA 1R4MI 3P4PB 3GOEA 4KVGB 2JF5A 4KKIA 1H4RA 4K7UA 4F1SA 3BYTB 4PS8A 4I6NB 3V6CB 1V80A 4ZRJA 1ZDVA 2JYEA 2NBUA 1J19A 2DAFA 2CHWA 3KYCD 2WU5B 1AN8A 2M1MA 2EKEC 1N5XA 4DHJB 2KLGA 3SEBA 4K3BA 3JSVB 5DPWA 2MX2A 2BBCA 1F0ZA 1TGZB 4B6WA 2E6XA 4WWNA 3TCAA 5D7GA 4LLGM 4M02A 5G55A 1ZKHA 2DWQA 2GBNA 2ZZPB 4KSLC 4DHZB 1QILA 2NCNA 1YJJA 3H8HA 4OW0A 2FBWB 1P0RA 1YX5B 5JHBA 4GIVA 2DYOA 2KMCA 1XCTL 1GNUA 4RGTA 3NVZA 2OJRA 1L6UA 1ZXHA 3V62A 2LASA 1I7HA 1SEBD 3TEZA 2DHZA 2WQYB 1OGWA 5MPOA 4F7ZA 1R4NB 2NBVB 2LHEA 3Q14C 1WXQA 4KIKB 2QC8A 3PS6A 2BTEA 3HM3A 2K25A 4DXGA 4CO7A 4A55A 4HEA1 2FCNA 3VUYA 2XNAC 1WZ0A 4NAWB 5BYSA 2NPTA 3L08A 3Q3MC 3GZNB 4KGRA 5JXVA 1QLBB 2WX1A 2ON8A 1Q5WB 2N7JA 5FK9C 3GE3C 2YEPB 3DBRB 1UWXA 4NJ7A 1OEYJ 2WXRA 1XCQL 3BY4B 1DOIA 4A9AA 4B0EA 1UGMA 2W82A 3BWUD 3L16A 4AJWA 5L95C 2JRIB 2N7DA 2LXCA 3ZQ4A 2QCZA 2RSUA 3P2BA 1S1QB 1PUTA 1HTQA 3U4EG 1SE3A 1PGBA 2JU6X 2O6VD 4EZLA 1T0YA 2J52A 3TEWA 4YTNB 1ZDXA 2YVCA 3VRBB 4G50A 2LVQA 5EDSA 2D3BA 2KLCA 4GDKB 4BOSC 5BMHA 3ZLZA 2LEKA 2IGGA 1SF0A 3KVFB 4IWQA 4ZRPA 1Y56A 3W5VB 4BKGA 3FKYA 3KLSX 1MFWA 3L10B 1M94A 3EHVA 1B9RA 1WGRA 4CYEA 4W9EA 2JXXA 3HVZA 5E6NA 1DGJA 2R61A 1XLPA 3RNEC 4MELA 3ZGZA 2N9LA 3NJTA 2O2VB 2ZNVB 4KX6B 1WGDA 4YWGG 2LZ6A 2AEHA 4MT5A 2Y5BB 1PDXA 1E0ZA 1XXGA 1WJ6A 3GS2A 4YTMB 2MQJA 4A90A 1CQVA 4ICVA 1V8CA 1GAQB 4L23A 1IPGA 2N0SB 1EO6A 2IY1B 4W9KA 3TEXA 1YNTE 4TQ1A 1WGYA 3H1UA 2KYWA 1C79A 4M8NA 2NR2A 1NVID 2DYBA 1N62A 2WXJA 2KZRA 4LJPB 1Q0WB 3DBHB 2JT4B 3FILA 3A9KB 2PE9A 3L13A 4KZCA 4XWWA 3NS8A 4L1BA 5E6OA 3AEAB 3V05A 4BAXA 5KHQA 3APFA 3NVYA 2RDHA 4ARCA 1R4MB 3O13A 1FRRA 2ZJDA 4IW0A 3PZ7A 3SFDB 2BYVE 5LXHA 2YLMA 2Q5WD 1RYJA 1QQRA 4MH8A 3A4RA 3DQVA 4JE3B 3DVGX 2G4DB 4HWIB 4B0MA 2BB6A 3VTVA 1RFKA 2V0GA 2K8BA 2PTLA 3HHMA 3MC8A 4UDUC 2MBEA 4K7SA 3DHIC 1FCCC 4G11A 3GE8C 2HTME 3O65B 5D3DA 4FADA 3AE1B 4M01A 3H6NA 4JIOU 3ALBA 4DXAB 4EOYA 5C23A 4DHZE 2AQ3B 3W5UB 2L00B 4P1CC 2KC1A 4HPLB 3IVFA 1C9FA 1WYGA 1A70A 3ZW3A 1CK1A 4YL8A 3ZNID 2WXPA 4IUMB 3SDLC 2KWCA 1WSPA 3W1SC 3N1XC 2MJ3A 1C3TA 1WX7A 1E5WA 4YT0B 1E9MA 2BYFA 1F1HA 2ZNVC 4YSZB 3BIID 4MSQB 3AEFB 1GOZA 2YEPF 3R2IA 3HK0A 1KM7A 3ZKJC 3B9JA 3JSVA 5LXIB 3WAOA 1WXAA 3DWMA 4OVZA 1FNVA 1ZE3D 4LTUA 1BT0A 1HQRD 1J7AA 2Z0DB 4FHKA 5IOIA 4DDID 4TKNA 3UIOB 2WXHA 4CHKA 5FR6A 4NNJB 4FJYA 1KRHA 2IGDA 5AUKA 2NTSA 3Q3NC 4FULA 3ECIA 3I63C 3L4PA 3AM9A 2BS3B 1QKZA 2L3ZA 4E74A 4RCOA 3ZUNA 2DZMA 3IBEA 2IZVB 3R3MA 3I3TB 4KIKA 3OG5A 4RF1A 1NDDA 1V97A 3HRDD 2NVUI 3RD2A 3VRAB 2WU2B 1N61A 4HXDA 4WAFA 4MDKE 3RULA 2DX5B 1HE8A 4NAWA 4JQWC 1MVKA 4AJYB 1TYGB 2L83A 3AE3B 2QIEB 1MPEA 2K1FA 2K8HA 1ZOYB 1WE6A 2N9XA 2XN9C 2IGHA 3GZNI 4I6LB 3M62B 1AYFA 1OQQA 2GB1A 3NG0A 3N20C 2RMMA 3AMZA 2V3NA 4P6VF 2J7QB 3B2FA 1VDVA 4MJSB 4J6IA 3CIRB 3A9JB 2C7HA 1NI3A 2QSDA 4RFBA 4KGSA 5LLIA 2A4ZA 1WRDB 5GMVA 3RMKC 3EECA 3U7DA 4A3OA 4XX5A 2JZPA 4II2B 2Z8LA 2GRIA 1JMLA 2WXQA 3E56A 2LI5A 2D10A 4GDKA 4ZHPA 3P4SB 2FE8A 3AE6B 3Q6BA 3SR6A 4S17A 5JHAA 3CSTA 1E7PB 1XO3A 4A6QA 1Z5SB 3OAWA 1WX8A 2XEWA 3W1SA 1P1AA 1RAXA 2R2OA 2HD5B 5EE0A 2J0KA 1C4AA 2BKFA 4CQNA 2M4NA 4AOFA 1GPXA 4HPPA 2KFKB 3U52E 1UUPA 1WF9A 2O2VA 2M56B 2QILA 3A4SC 2MH7A 4B9KA 2KC2A 3V3XA 1ENFA 4P7IA 4MH0E 4YSXB 1WIAA 3TL5A 2BW2A 2JVCA 4MGZE 4ARIA 1DOXA 2KWUB 2M0XA 2MEKA 2XK5B 1L5PA 4K1RB 2IBIB 3PRMB 2ZVOA 2K6QA 3R7RA 1I4RA 2W55A 4XYCA 4P16A 2KDEB 1D5MC 1HTOA 2GOWA 3A1QB 1UF0A 2QJLA 1VR9A 2KHWB 1N6ZA 2J0MA 5HHDG 3DBHI 1XF5L 1OQYA 1L4ZB 3OJ4B 3KUCB 1FXIA 4ANVA 3RNGC 2VZKB 1SE4A 1ESFA 4XDDA 2KFJA 1TZOA 1L7YA 3MFGA 4F8CB 2RDGA 1KLUD 4G3XB 2V4LA 2NTTA 1LO5D 1E7VA 1OTRB 3PO0A 4KGTA 1T5XD 3ZJUA 1I4HA 3DDCB 2OHFA 1FXAA 2BF8B 3DHHC 2WHIA 2MBHA 4DXFA 4M00A 2JZZA 2JWZA 2A5UA 1OEYA 2W3RA 3ZDTA 3KYDD 5G5HA 1GB4A 4GB9A 1UBIA 1IP9A 2NS5A 4W9FA 4WJQA 2B3AA 3ML9A 1K50A 5FR3A 2JX5A 1TBEA 2L05A 1L4DB 4K3CA 3R2TA 2BPSA 5AUIA 1JWUD 3PHWB 3E9SA 2CJNA 4WJNA 4WAAA 3SU8X 1WYWB 2CKHB 2PMVA 2LGXA 4ZDVA 2AX5A 2KO3A 3ZTDA 5CHFA 2WDVB 4FJVB 1VZ7A 3DOWA 4WIPA 5G5GA 1C77A 5H92C 1UGJA 1UZXB 3WALA 4GMVA 4WWOA 4A3PA 2GBRA 4XDCA 5IKCM 4ICUA 5T8IA 1FEHA 4ZRIA 2DAJA 1MI0A 2B76B 2INNE 1NYQA 2DZIA 3DHGC 3M3JA 2K39A 1J0GA 3IG3A 1C1YB 3WA0A 4OZAA 2REXA 3NZ3A 2VH2A 3MJWA 1SE9A 1QOFA 2WXLA 2G45B 4C7ZA 3ZJVA 3ZRFA 4EEWA 4XZ4A 1WR1A 4OVUA 3A33B 3M63B 2PJHA 3L17A 2D2QA 2BGFA 2ONQA 5BYQA 3W9CB 3WAMA 3KUDB 2FCMA 3HVDA 1YJ1A 2CU1A 2EELA 3CSFA 1WMHB 3AEBB 4NPNA 2MA9B 3VXWA 3EUB2 5J18A 4TQ0A 3I57A 1CJEA 1YQ3B 4LDTB 4MGYE 1KFYB 2QDFA 2L0TA 2BKRB 3K9PB 1VD2A 2IDYA 1WX9A 1SGHA 3B08A 2L32A 5EE1A 1AWDA 2X38A 3N1ZC 2W54A 1B1ZA 1WJ4A 3U7ZA 4H2AA 1M4VA 4LCDE 4URKA 4HRSA 4B95A 4PS7A 1C4PA 4NZLB 1F77A 3PV1A 3VH3B 3QA8A 1OFFA 1HXYD 1C78A 4ZRKA 1BXTA 3IT6B 1RM6C 4WWMA 3A9JA 4JL9A 3RN9C 4RM9A 1S3SG 1XLQA 2PIAA 4KV2A 1EWCA 1E8WA 1E7UA 1I4XA 1IBXB 4J3OD 3N30A 1JROA 2CR5A 3RZWC 4C56C 3H7PB 3BVMA 1WXSA 5FKAC 5AZHA 4GSWA 4OHJA 1MG4A 4HCPB 3Q8AA 1J8CA 3VTUA 1F9JA 4L2YA 2WYQA 2KJRA 3Q8EA 3SHQA 2Y5PA 1FM0D 4WH4A 1Q1OA 4XE0A 4DK5A 2KFKA 2WGSA 1TS2A 1ZUD2 4FHJA 1GB1A 2JY6A 1RRBA 3IXSA 1ISNA 5HI1A 2WXGA 1QZEA 3PT2B 3AEEB 3BZDB 4ANXA 3QIJA 3EFUA 4NQLB 1J7BA 1V86A 5IP4D 1YOVB 2WXNA 4HK2A 3CF6E 1WE7A 2LRWA 3MP9A 1FCLA 3PRZA 2XK5A 3AE8B 1FNUA 1FFVA 3RT3B 4GN1A 2J53A 2PLPA 5CTRC 2I1JA 1TIFA 5IAAC 3EFCA 1FMAD 1FNWA 2K3UA 3JYUA 2DZKA 2C5LC 3A1QA 1UWMA 4N6EB 4IKGA 2G1EA 2KTRB 3LJ3A 3R66C 1GUAB 4HKQA 1KF6B 1V81A 1V1OA 2VZKD 2CS4A 3UINB 3WIMA 3PRPB 1SXTA 1V1PB 1JWMD 1V9JA 3PREA 3KW5B 3QQ8B 4MM3B 5JZEB 4YSYB 4US9A 2QEJC 3LB8C 1TKGA 1VRAB 3ZJTA 3NS1A 1ZP0B 3MHZA 1PFDA 4BKTA 2WDTB 4DHJD 1SJHD 3CWIA 1TKEA 1SBBB 3C19A 3AH7A 2Z59B 4W9GA 2L1AA 1U4AA 4BBNC 4M8MA 1TS5A 5AZGA 2LJIA 3ETRA 4NJCA 3URYA 1FPYA 1WI0A 3NOBA 5LNK1 4LJOB 4YTPB 2JWUA 2MCNB 1YMHE 4ZHOA 3AULA 2D5GA 1BUIC 2WS3B 1SB3C 1YX6B 4P1BC 3B0AA 2I2YA 5TR5A 4IWOA 5E6PA 4YXDB 3PGEA 1C76A 2JSVX 3PZDA 4MGIE 1K53A 2V1YA 1L6VA 4E3CA 1E90A 2J42A 1VZ6A 1E8YA 1JW9D 4R3DA 3AECB 4OZBA 2FUHB 5H8YE 1FD6A 4W9JA 2FCSA 3ZDMC 1V49A 3QC8B 1RFAA 5CHWA 5HFYA 4KDIC 4GU2A 4ANWA 1T0QC 2O6VB 1F52A 4LNKA 3D32A 1EF5A 5E6JA 1PGXA 2MW5A 1IGCA 1ZPSA 2ASQA 4K81A 1I4GA 2FNJB 1F2RI 4ZYSA 1UD7A 2LVOA 3BVGA 3P42A 1FRDA 3VFKA 2D07B 3ZYYX 2N9PC 4BBNF 3TIXA 3PSEB 4HKZE 5C2TB 3UI3A 1I4PA 1KJTA 1V2YA 1HZ5A 1R7SA 4JWSC 2E3TA 4K7WA 4FLHA 4LNIA 1L0VB 2V3PA 3UQBA 4LDTD 2C7MB 3T8MA 3WCQA 3DCGA 3NZUA 3AEDB 2BYTA 1SIFA 5D2MB 3DBSA 2JQRB 3ZNGC 4LK0M 1WH3A 3QWZB 5J2RA 2KMMA 2C9WB 5DPSA 5GXGB 3VHTC 1E6EB 3UF8A 4RM8A 4WWPA 3FILB 3BINA 2ZCBA 5BO4B 1ET9A 5TSSA 2JUOA 1YD8U 2C60A 4IOIE 3UQAA 3AV8A 1WGKA 1PYWD 2JXTA 2BQQA 1P7FA 2C7NB 1EU4A 1QF6A 1UH6A 4I6PA 2LGYA 3VQIA 4M0WB 4DWFA 3FC4A 1AARA 2QMTA 3W1YA 1YJIA 2VH1A 3NUHB 4KKJA 4WJOA 1NYRA 1NBFC 2CU3A 2L7RA 3DBLB 1P3QU 4TSSA 4C7YA 2LUEA 3QAQA 2CHZA 3BVZA 2KWVB 3EA6A 4HJGE 2V3SA 1JALA 1WY8A 5D3IB 3LDZE 4GGQA 2LGDA 3A9KA 3H9DA 2ICIA 2G9HD 1WXMA 3H7PA 3AE5B 1YQ4B 2JPHA 2KTFA 1YN4A 4DDGD 3IAM1 2WWZA 2GMIC 1EWYC 3ZVVA 2KOXA 1L0YB 2PKOA 3MTNB 2WP9B 1MHXA 4FXCA 4AQ7A 1D5XC 1N63A 4KDLB 2DNFA 3GB1A 5HG2A 1WWTA 1MG8A 2H89B 3TSSA 3R7QA 3IT4B 3ZO5B 2X8XX 3IFWB 1HZ6A 1FXTB 2RGFA 3MC0B 1XT9B 2IYDB 3AU4A 1L2NA 2LJ5A 5JH5C 5DPRA 3Q3OC 2PW9A 2KQSA 1TT5B 2KK8A 2KX0A 5G2NA 4N9F4 2CHXA 4NAMA 4W9IA 2KDIA 3JVZX 2WXFA 3L0WB 4REZA 4AUQC 1TS4A 5HKHA 1PGAA 2MBQA 1D4BA 3BYYB 2CJOA 3RNBC 4PYUA 3Q2AC 1TJEA 1V5TA 2KTRA 3VTWA 5IN7A 1SIJA 5C1ZA 1LGRA 3MC9A 2G3QB 4BVUC 1HEZE 2KKCA 3JW0X 4GOCA 1L0XB 3LYYA 3DWGC 1WGHA 1TY0A 3ZIMA 1V1PA 2WXKA 3AI5A 1LFDA 3RNAC 5DPTA 3I9V1 5C3JB 4C80A 3T3NA 5BMIA 3S2AA 3B1LX 3ZXRA 3X0WA 1CZPA 4MM3A 3QCAA 1P98A 2Y5CA 4EZJA 2KN4A 4EFOA 2WLBA 4BOZB 3TEYA 4OZCA 4GLSC 3DVGY 4MSMB 4IM2A 2IPKD 3PLUA 3VAWA 4TV3A 3VR8B 2D3GA 4GDLB 2GBJA 2XBBC 1C4CA 2WNMA 5I4DA 3M95A 4AS1A 3P1MA 3HM6X 2MP2B 1KLVA 3RI7C 3RNCC 1ZGUB 2WDRB 1WJNA 3T9LA 3CMMB 1JQ4A 1ZW7A 4IDIA 1TKYA 1KTKA 4AWJA 2LRUA 4IM0A 1TZ1A 3UGBB 2GBKA 3ENEA 1WM2A 5J17A 2G4SA 2BS4B 3RYTA 2PEAA 1QOBA 3MJ5A 4US8A 1XQQA 4JX1C 2MLBA 3TBLD 3QX1A 2EKIA 1NENB 4PYZA 3N9YC 4EKUA 1FIQA 4W9CA 1I42A 2HJ8A 2NBWB 3PHXB 3V6EB 2BYEA 2PPHA 3EC8A 1AW7A 2IY0B 2LWPA 1H8CA 4EUTA 3HUIA 1VCBA 1GG3A 1WGGA 4LNFA 2DBYA 1EU3A 2K5PA 1K52A 1D6EC 2DLBA 1UNSA 1N5WA 1JWSD 1RWSA 3OJ3A 2KDBA 2OEDA 4MACA 4DQOC 1ET6A 2W9NA 3PZ8A 1GC7A 1X1MA 4JWUC 2KMAA 3SD5A 2O6VA 3KWLA 3AE2B 2L76A 2MSED 3NY5A 2LVPA 2K22A 2BWFA 2AL6A 1LXDA 4QAYA 4C4VB 3RZFA 1XEEA 2ZW1A 2IO3B 2MBBB 4WQMA 3P4QB 3DPDA 5D6JB 2DENB 2KDMA 4RH6A 2BWES 2M0AA 3RCZA 3P4RB 4RF0A 2KQ4X 4HPMB 4MJSA 4NJ6A 1BMLC 1RLFA 3KH0A 3ABVB 1JWBD 4PK1A 1T0SC 3N32A 3TMPB 3KQ4A 1JRUA 1PQSA 3PTFC 3LXFA 3Q8BA 1EF1A 3ONSA 2RPVA 1WJUA 1FFUA 3NVWA 2LXAA 2ZPNA 3FAHA 3NHEB 1I35A 5L83A 1OQRA 4RGNA 1WR6E 3Q69A 2KJHB 1NI2A 2WXMA 4IWPA 5IO9A 3QARA 1TS3A 1JCKB 1T3QA 4HVBA 2ZEQA 2FCQA 2UWQA 3VH4B 2KVZA 3TUOA 3NRZA 1CMXB 1DYQA 4G0NB 2WDQB 2K8CA 4HDOA 4Q2JA 5AEKB 5DCNA 3AE7B 2EMSA 2MJDA 1IGDA 2K0PA 4RGOS 1YN5A 2LMCA 3KWVA 2I1KA 1F2RC 3AN1A 3HIZA 3OWEB 2KVRA 3AE4B 1E10A 4USAA 3AEGB 2N1VA 2AYOB 4WQOB 2AQ2B 2MWSB 2L0FA 4M0WA 3QHTA 4WURA 2INCC 3U30A 1EM7A 2PVGC 3N3KB 2KACA 4KSKC 1YIWA 3NVVA 1QOAA 1N60A 4N59A 3U2SC 4GXBA 1FO4A 2WX0A 2NMQA 1P9DU 4HCNB 1T0RC 3P63A 3DBLI 2MHJA 1KLGD 2MJEA 4XC2A 3VR9B 4IG7B 4A20A 3T3OA 1WFYA 2M19A 3MHSD 1IUEA 1UELA 1D3ZA 1TTNA 2KANA 4FBJB 3ZNHB 1E8XA 1I4QA 1VJKA 4ZOHC 2PE6B 2M8SA 2KX3A 2H88B 2ZCCA 2UU7A 2AL3A 3Q3FA 5IA7A 1WXVA 1LQBA 1QOGA 1LM8B 3VUXA 4A8XC 2KN5A 2EMTA 2SEBD 4JLCA 3AB5A 4EZKA 1XLNA 1YN3A 1DOYA 2DZJA 4BZAA 1HA5A 4ZYNA 2K9XA 2QHOA 2I38A 3EGRA 4NQKE 1WM3A 1IYFA 3W2DA 4XGAB 2L52A 4S0RA 2FUG1 2KT7A 1MHHE 3AU5A 4ITKA 4HROA 4EE2A 3AE9B 3KUZA 2NPTB 1E8ZA 3BK1A 2R2QA 2LHDA 3UIPB 3WAPA 3ZNZB 2D3CA 1NEKB 3VVWB 4N58A 2GBMA 2AQ1B 3PVLA 1KH0A 3Q8FA 4W9HA 1G6JA 4OVVA 3I5JC 1Q10A 3IHPC 3VDZA 2KAJA 2N7EA 5KHOA 3PPAA 4FJZA 3K9OB 2JYTA 1P7EA 4ZRQA 3Q3JA 2IO1B 2VRRB 2KWDA 2LGIA 1ROEA 1JRPA 2UYZB 3V60A 3OLMD 1J7CA 1XLOA 3NZSA 1SJED 1Z2MA 2GLSA 5AZFA 3V61A 3AXCA 4W9DA 4GDLA 3R8BA 4ANUA 2OJWA 1K51A 4W9LA 2HJ1A 2RR9A 3H7SA 4HJKA 3ZTCA 3RFZB 1XD3B 1SE2A 2BS2B 1D5ZC 2MP2A 2N9KA 4ACFA 1VZ8A 1R4NI 2RD0A 3RNFC 1MJDA 2FIFA 2INDC 3J9CA 2JRHA 2J0JA 5D94A 1Y8RC 2RDBC 3SFEB 2HE7A 2WXIA 3L54A 2L8JA 3DVNU 4MEMA 2LUMA 1WMHA 4XWTA 2LFIA 3BK2A 3WANA 2N1WA 2HTHA 2IO0B 2ACZB 5EE3A 5EE9A 2ZPYA 2LGSA 2Z0EB 3DBRI 4NY0A 2V4IB 2KQ7A 2N4FA 4C00A 1K8RB 2V9HA 3RPFC 1V6EA 1SSNA 3Q8CA 4TMAB 2W3SA 3ML8A 4IM3A 4RMAA 4TUUA 2TSSA 4AP4C 1STEA 3RUIB 4PS3A
chains in the Genus database with same CATH topology
1WX7A 4BVUC 2G3QB 4BFRA 2KD0A 1E5WA 2KKCA 3JW0X 4GOCA 2BYFA 3QJZA 4ZRKA 2OOBB 4II3B 1V5OA 3DVNV 1WGHA 4FN2A 5CX3A 2RPQA 3A9JA 3ZIMA 1KOTA 4JL9A 2ZNVC 3AI5A 1LFDA 5DPTA 4HLEA 4MSQB 4RM9A 1S3SG 2LD9A 1EUVB 5CHVC 3S2AA 3B1LX 4KV2A 3X0WA 4MM3A 4MGKE 3ZRCA 3PLVA 3QCAA 1E8WA 1E7UA 1P98A 4EZJA 3HK0A 4EFOA 2JZ3B 4BOZB 2DYMA 1KM7A 3ZKJC 4ASWC 3N30A 4WJPA 3VUWA 3JSVA 5LXIB 2KJ6A 3WAOA 1WXAA 3DVGY 4MSMB 1UBQA 2CR5A 4IM2A 4KZ0A 2KNBA 3RZWC 3PLUA 3H7PB 3VAWA 4TV3A 3C0RB 2D3GA 4GDLB 2GBJA 1WXSA 1BT0A 3TJPA 2XBBC 4FHKA 2Z0DB 5AZHA 3APDA 1YQBA 4DDID 4TKNA 4GSWA 3M95A 4HDQA 3UIOB 3HM6X 2MP2B 1KLVA 4CHKA 4HCPB 5FR6A 1ZGUB 4NNJB 2FAZA 1WJNA 4FJYA 4E71A 1J8CA 3T9LA 3CMMB 1ZW7A 4AWJA 2K6DB 1F9JA 2LRUA 4IM0A 3VTUA 1GJZA 1TZ1A 2WYQA 4FULA 3ECIA 2KJRA 4X57B 4DBGA 3SHQA 3UGBB 2L3ZA 2GBKA 2D11A 3ENEA 1WM2A 2KXJA 1Q1OA 2M17A 5J17A 2G4SA 4E74A 4DK5A 2KFKA 3RYTA 2PEAA 4FA6A 4FHJA 2JY6A 2N9EB 3X23A 1RRBA 2IO2B 3U8ZA 3ZUNA 2DZMA 1XQQA 1ISNA 3IBEA 2MLBA 3TBLD 2FIDA 2IZVB 3R3MA 1QZEA 3PT2B 3I3TB 4KIKA 3QX1A 1NDDA 4PYZA 4BKSD 3QK0A 2MBOA 4EKUA 4ANXA 2ZVNA 4W9CA 2NVUI 3RD2A 2HJ8A 3QIJA 3EFUA 1I42A 4JGHB 1A5RA 4NQLB 2NBWB 3PHXB 1V86A 4HXDA 4IC7B 4MDKE 4HK2A 3RULA 3CF6E 1WE7A 2BYEA 2DX5B 2LRWA 2PPHA 1HE8A 3EC8A 2LWPA 2IY0B 2XK5A 3PRZA 4JQWC 4NAWA 1H8CA 4EUTA 4AJYB 3RT3B 1VCBA 1GC6A 1GG3A 1WGGA 2KDFB 4GN1A 3APCA 2MRPA 2K1FA 5CTRC 2K8HA 2I1JA 5IAAC 2N9XA 1WE6A 3OJ3A 2KDBA 2AWTA 3JYUA 1WZ3A 3GZNI 2DZKA 2W9NA 2C5LC 1GC7A 1X1MA 3A1QA 3M62B 4I6LB 2KMAA 3SD5A 2KTRB 3LJ3A 3R66C 1GUAB 1R4MI 2O6VA 1V81A 2L76A 2MSED 3GOEA 3NY5A 2J7QB 4KVGB 4MJSB 2JF5A 2CS4A 2LVPA 4J6IA 1H4RA 2BWFA 3UINB 4K7UA 3WIMA 2AL6A 4F1SA 3PRPB 4PS8A 3A9JB 4I6NB 3V6CB 2C7HA 1V80A 4ZRJA 1V9JA 5LLIA 3PREA 1LXDA 2A4ZA 3KW5B 3QQ8B 3RZFA 1WRDB 2NBUA 5GMVA 1J19A 2DAFA 2CHWA 2IO3B 3KYCD 2MBBB 3EECA 5JZEB 3U7DA 2M1MA 2EKEC 4A3OA 4XX5A 3DPDA 4DHJB 2KLGA 5D6JB 2DENB 4II2B 2BWES 3JSVB 3RCZA 5DPWA 2LI5A 2D10A 2MX2A 4GDKA 4HPMB 1TGZB 4B6WA 4MJSA 4WWNA 4NJ6A 3TCAA 5D7GA 5G55A 1RLFA 3KH0A 1ZKHA 2GBNA 4BKTA 2WDTB 2ZZPB 5JHAA 4KSLC 3CSTA 4DHZB 2NCNA 4DHJD 1P0RA 1YX5B 5JHBA 4GIVA 1Z5SB 3N32A 2Z59B 3TMPB 2DYOA 4W9GA 1JRUA 1PQSA 2KMCA 3OAWA 3PTFC 1WX8A 1U4AA 1GNUA 1EF1A 3ONSA 2XEWA 1WJUA 2OJRA 3W1SA 1P1AA 1RAXA 2R2OA 2HD5B 3V62A 4BBNC 2J0KA 2LXAA 2LASA 2BKFA 4M8MA 2ZPNA 3NHEB 1I35A 2M4NA 5AZGA 5L83A 2DHZA 4AOFA 1WR6E 2KJHB 1NI2A 1OGWA 2KFKB 1WI0A 4IWPA 3NOBA 4F7ZA 3QARA 4LJOB 1WF9A 2O2VA 2MCNB 2NBVB 3AULA 4HVBA 3A4SC 2ZEQA 1YX6B 2FCQA 2UWQA 3VH4B 4B9KA 3B0AA 2KC2A 4KIKB 5TR5A 4IWOA 5E6PA 3PGEA 3PS6A 4MH0E 4P7IA 1WIAA 3HM3A 1CMXB 3PZDA 3TL5A 2K25A 4CO7A 4MGIE 4G0NB 2FCNA 4HDOA 2K8CA 2V1YA 5AEKB 4E3CA 3VUYA 2JVCA 4MGZE 1WZ0A 1E90A 2KWUB 5DCNA 1E8YA 2M0XA 2EMSA 2XK5B 4NAWB 2NPTA 3L08A 2I1KA 4K1RB 2IBIB 3PRMB 2ZVOA 3V6EB 2FUHB 3HIZA 2K6QA 3R7RA 2WX1A 2KVRA 4W9JA 2FCSA 1Q5WB 3ZDMC 1V49A 2KDEB 2N1VA 3QC8B 1RFAA 2GOWA 3A1QB 2AYOB 4NJ7A 4WQOB 5CHWA 2MWSB 2L0FA 1OEYJ 2KHWB 4GU2A 3BY4B 4KDIC 4ANWA 3QHTA 2J0MA 2O6VB 3DBHI 3U30A 1OQYA 3OJ4B 1UGMA 3L16A 3N3KB 4AJWA 4KSKC 3D32A 1YIWA 3KUCB 5L95C 2JRIB 2N7DA 2LXCA 1EF5A 4ANVA 2RSUA 3P2BA 1S1QB 4GXBA 2MW5A 2KFJA 2WX0A 2ASQA 2O6VD 1L7YA 1P9DU 4K81A 4HCNB 4EZLA 4F8CB 2FNJB 3DBLI 1T0YA 1UD7A 2LVOA 4XC2A 3VFKA 2D07B 4IG7B 4A20A 1WFYA 2YVCA 3MHSD 4G3XB 2V4LA 1UELA 1OTRB 1E7VA 2N9PC 4G50A 1D3ZA 1TTNA 2LVQA 5EDSA 2KANA 4BBNF 2KLCA 4GDKB 3ZNHB 4BOSC 4FBJB 3DDCB 3TIXA 1E8XA 2BF8B 3PSEB 3ZLZA 2MBHA 1KJTA 1V2YA 2PE6B 2JZZA 4K7WA 2JWZA 2A5UA 1OEYA 2M8SA 2KX3A 2ZCCA 4FLHA 3KVFB 4IWQA 3UQBA 4LDTD 2C7MB 4BKGA 2AL3A 3Q3FA 5IA7A 3T8MA 1WXVA 3DCGA 3NZUA 1LQBA 3KYDD 3L10B 3ZDTA 1M94A 1LM8B 3VUXA 3EHVA 2KN5A 4GB9A 2EMTA 4JLCA 1SIFA 5D2MB 3DBSA 1UBIA 1WGRA 3ZNGC 4CYEA 4EZKA 1IP9A 4W9EA 2NS5A 2JXXA 1WH3A 3QWZB 5E6NA 4W9FA 4WJQA 5J2RA 2B3AA 2C9WB 2DZJA 3ML9A 5DPSA 4ZYNA 4MELA 1TBEA 2L05A 3VHTC 2QHOA 2O2VB 2ZNVB 4NQKE 1WM3A 1IYFA 2BPSA 1WGDA 2LZ6A 2AEHA 2Y5BB 3PHWB 3UF8A 4RM8A 1WJ6A 4WWPA 3BINA 2ZCBA 4WJNA 5BO4B 2MQJA 4WAAA 3SU8X 2JUOA 1YD8U 1WYWB 2C60A 4ICVA 2CKHB 2LGXA 3AU5A 4ZDVA 2KO3A 3UQAA 1IPGA 1EO6A 2IY1B 3KUZA 3ZTDA 4W9KA 5CHFA 2NPTB 4FJVB 1E8ZA 4TQ1A 2R2QA 1WGYA 3H1UA 3UIPB 3WAPA 2C7NB 3DOWA 2NR2A 4M8NA 3ZNZB 2DYBA 2KZRA 4LJPB 3VVWB 1Q0WB 1UH6A 1UZXB 3WALA 2GBMA 2JT4B 4GMVA 4WWOA 4A3PA 3PVLA 2GBRA 4W9HA 4I6PA 2LGYA 4ICUA 3VQIA 4BKSA 4M0WB 2DAJA 4ZRIA 4DWFA 1AARA 3A9KB 2PE9A 1G6JA 4OVVA 3L13A 4KZCA 3W1YA 3IHPC 3VDZA 3NS8A 2DZIA 2N7EA 4WJOA 5KHOA 3M3JA 2K39A 1NBFC 3PPAA 1J0GA 3IG3A 4FJZA 5E6OA 1C1YB 3K9OB 2L7RA 3WA0A 5KHQA 1P3QU 2REXA 3APFA 2LUEA 3QAQA 3MJWA 3Q3JA 1SE9A 2CHZA 2IO1B 2KWVB 2VRRB 2G45B 3ZRFA 2UYZB 2V3SA 3V60A 4EEWA 1WY8A 2ZJDA 4IW0A 3OLMD 4XZ4A 3LDZE 1WR1A 2LGDA 4GGQA 2BYVE 5LXHA 3A9KA 3A33B 4OVUA 2YLMA 3M63B 2PJHA 3H9DA 3NZSA 3L17A 1Z2MA 2D2QA 2BGFA 3WAMA 3A4RA 3KUDB 1WXMA 5AZFA 2FCMA 3H7PA 3V61A 3AXCA 2JPHA 4W9DA 4GDLA 2KTFA 1YJ1A 2CU1A 3CSFA 3DQVA 4ANUA 3DVGX 1WMHB 2G4DB 4HWIB 2WWZA 4DDGD 4W9LA 2RR9A 3H7SA 4HJKA 2GMIC 3ZTCA 1XD3B 3ZVVA 4NPNA 3VTVA 2MA9B 3VXWA 2KOXA 2MP2A 3MTNB 2K8BA 3HHMA 1R4NI 2RD0A 4TQ0A 5J18A 2FIFA 2JRHA 2J0JA 5D94A 4LDTB 4KDLB 2MBEA 1Y8RC 4MGYE 4K7SA 2HE7A 2L0TA 2BKRB 3K9PB 4G11A 1MG8A 3O65B 1VD2A 4FADA 3L54A 3R7QA 2L8JA 3ZO5B 3DVNU 3H6NA 4MEMA 3IFWB 4JIOU 3ALBA 1WX9A 1WMHA 4DXAB 4EOYA 5C23A 2N1WA 3WANA 4DHZE 1FXTB 2RGFA 1SGHA 3B08A 2HTHA 2IO0B 1XT9B 2IYDB 3AU4A 1L2NA 2LJ5A 2L00B 5JH5C 5DPRA 2KC1A 2ZPYA 2Z0EB 2KQSA 1WJ4A 3DBRI 2KK8A 4NY0A 2KX0A 4HPLB 3IVFA 4N9F4 2CHXA 5G2NA 4W9IA 2KDIA 3JVZX 2KQ7A 2N4FA 3L0WB 1K8RB 4AUQC 3ZW3A 1V6EA 5HKHA 2MBQA 4LCDE 3ZNID 4YL8A 4URKA 3ML8A 4IM3A 4B95A 4IUMB 4PS7A 3SDLC 4PYUA 3PV1A 4RMAA 2KWCA 3VH3B 3QA8A 1V5TA 4TUUA 3W1SC 2KTRA 3VTWA 1C3TA 4AP4C 3RUIB 5C1ZA 4PS3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1WX7 A;  4BVU C;  2G3Q B;  4BFR A;  2KD0 A;  1E5W A;  2KKC A;  3JW0 X;  4GOC A;  2BYF A;  3QJZ A;  4ZRK A;  2OOB B;  4II3 B;  1V5O A;  3DVN V;  1WGH A;  4FN2 A;  5CX3 A;  2RPQ A;  3A9J A;  3ZIM A;  1KOT A;  4JL9 A;  2ZNV C;  3AI5 A;  1LFD A;  5DPT A;  4HLE A;  4MSQ B;  4RM9 A;  1S3S G;  2LD9 A;  1EUV B;  5CHV C;  3S2A A;  3B1L X;  4KV2 A;  3X0W A;  4MM3 A;  4MGK E;  3ZRC A;  3PLV A;  3QCA A;  1E8W A;  1E7U A;  1P98 A;  4EZJ A;  3HK0 A;  4EFO A;  2JZ3 B;  4BOZ B;  2DYM A;  1KM7 A;  3ZKJ C;  4ASW C;  3N30 A;  4WJP A;  3VUW A;  3JSV A;  5LXI B;  2KJ6 A;  3WAO A;  1WXA A;  3DVG Y;  4MSM B;  1UBQ A;  2CR5 A;  4IM2 A;  4KZ0 A;  2KNB A;  3RZW C;  3PLU A;  3H7P B;  3VAW A;  4TV3 A;  3C0R B;  2D3G A;  4GDL B;  2GBJ A;  1WXS A;  1BT0 A;  3TJP A;  2XBB C;  4FHK A;  2Z0D B;  5AZH A;  3APD A;  1YQB A;  4DDI D;  4TKN A;  4GSW A;  3M95 A;  4HDQ A;  3UIO B;  3HM6 X;  2MP2 B;  1KLV A;  4CHK A;  4HCP B;  5FR6 A;  1ZGU B;  4NNJ B;  2FAZ A;  1WJN A;  4FJY A;  4E71 A;  1J8C A;  3T9L A;  3CMM B;  1ZW7 A;  4AWJ A;  2K6D B;  1F9J A;  2LRU A;  4IM0 A;  3VTU A;  1GJZ A;  1TZ1 A;  2WYQ A;  4FUL A;  3ECI A;  2KJR A;  4X57 B;  4DBG A;  3SHQ A;  3UGB B;  2L3Z A;  2GBK A;  2D11 A;  3ENE A;  1WM2 A;  2KXJ A;  1Q1O A;  2M17 A;  5J17 A;  2G4S A;  4E74 A;  4DK5 A;  2KFK A;  3RYT A;  2PEA A;  4FA6 A;  4FHJ A;  2JY6 A;  2N9E B;  3X23 A;  1RRB A;  2IO2 B;  3U8Z A;  3ZUN A;  2DZM A;  1XQQ A;  1ISN A;  3IBE A;  2MLB A;  3TBL D;  2FID A;  2IZV B;  3R3M A;  1QZE A;  3PT2 B;  3I3T B;  4KIK A;  3QX1 A;  1NDD A;  4PYZ A;  4BKS D;  3QK0 A;  2MBO A;  4EKU A;  4ANX A;  2ZVN A;  4W9C A;  2NVU I;  3RD2 A;  2HJ8 A;  3QIJ A;  3EFU A;  1I42 A;  4JGH B;  1A5R A;  4NQL B;  2NBW B;  3PHX B;  1V86 A;  4HXD A;  4IC7 B;  4MDK E;  4HK2 A;  3RUL A;  3CF6 E;  1WE7 A;  2BYE A;  2DX5 B;  2LRW A;  2PPH A;  1HE8 A;  3EC8 A;  2LWP A;  2IY0 B;  2XK5 A;  3PRZ A;  4JQW C;  4NAW A;  1H8C A;  4EUT A;  4AJY B;  3RT3 B;  1VCB A;  1GC6 A;  1GG3 A;  1WGG A;  2KDF B;  4GN1 A;  3APC A;  2MRP A;  2K1F A;  5CTR C;  2K8H A;  2I1J A;  5IAA C;  2N9X A;  1WE6 A;  3OJ3 A;  2KDB A;  2AWT A;  3JYU A;  1WZ3 A;  3GZN I;  2DZK A;  2W9N A;  2C5L C;  1GC7 A;  1X1M A;  3A1Q A;  3M62 B;  4I6L B;  2KMA A;  3SD5 A;  2KTR B;  3LJ3 A;  3R66 C;  1GUA B;  1R4M I;  2O6V A;  1V81 A;  2L76 A;  2MSE D;  3GOE A;  3NY5 A;  2J7Q B;  4KVG B;  4MJS B;  2JF5 A;  2CS4 A;  2LVP A;  4J6I A;  1H4R A;  2BWF A;  3UIN B;  4K7U A;  3WIM A;  2AL6 A;  4F1S A;  3PRP B;  4PS8 A;  3A9J B;  4I6N B;  3V6C B;  2C7H A;  1V80 A;  4ZRJ A;  1V9J A;  5LLI A;  3PRE A;  1LXD A;  2A4Z A;  3KW5 B;  3QQ8 B;  3RZF A;  1WRD B;  2NBU A;  5GMV A;  1J19 A;  2DAF A;  2CHW A;  2IO3 B;  3KYC D;  2MBB B;  3EEC A;  5JZE B;  3U7D A;  2M1M A;  2EKE C;  4A3O A;  4XX5 A;  3DPD A;  4DHJ B;  2KLG A;  5D6J B;  2DEN B;  4II2 B;  2BWE S;  3JSV B;  3RCZ A;  5DPW A;  2LI5 A;  2D10 A;  2MX2 A;  4GDK A;  4HPM B;  1TGZ B;  4B6W A;  4MJS A;  4WWN A;  4NJ6 A;  3TCA A;  5D7G A;  5G55 A;  1RLF A;  3KH0 A;  1ZKH A;  2GBN A;  4BKT A;  2WDT B;  2ZZP B;  5JHA A;  4KSL C;  3CST A;  4DHZ B;  2NCN A;  4DHJ D;  1P0R A;  1YX5 B;  5JHB A;  4GIV A;  1Z5S B;  3N32 A;  2Z59 B;  3TMP B;  2DYO A;  4W9G A;  1JRU A;  1PQS A;  2KMC A;  3OAW A;  3PTF C;  1WX8 A;  1U4A A;  1GNU A;  1EF1 A;  3ONS A;  2XEW A;  1WJU A;  2OJR A;  3W1S A;  1P1A A;  1RAX A;  2R2O A;  2HD5 B;  3V62 A;  4BBN C;  2J0K A;  2LXA A;  2LAS A;  2BKF A;  4M8M A;  2ZPN A;  3NHE B;  1I35 A;  2M4N A;  5AZG A;  5L83 A;  2DHZ A;  4AOF A;  1WR6 E;  2KJH B;  1NI2 A;  1OGW A;  2KFK B;  1WI0 A;  4IWP A;  3NOB A;  4F7Z A;  3QAR A;  4LJO B;  1WF9 A;  2O2V A;  2MCN B;  2NBV B;  3AUL A;  4HVB A;  3A4S C;  2ZEQ A;  1YX6 B;  2FCQ A;  2UWQ A;  3VH4 B;  4B9K A;  3B0A A;  2KC2 A;  4KIK B;  5TR5 A;  4IWO A;  5E6P A;  3PGE A;  3PS6 A;  4MH0 E;  4P7I A;  1WIA A;  3HM3 A;  1CMX B;  3PZD A;  3TL5 A;  2K25 A;  4CO7 A;  4MGI E;  4G0N B;  2FCN A;  4HDO A;  2K8C A;  2V1Y A;  5AEK B;  4E3C A;  3VUY A;  2JVC A;  4MGZ E;  1WZ0 A;  1E90 A;  2KWU B;  5DCN A;  1E8Y A;  2M0X A;  2EMS A;  2XK5 B;  4NAW B;  2NPT A;  3L08 A;  2I1K A;  4K1R B;  2IBI B;  3PRM B;  2ZVO A;  3V6E B;  2FUH B;  3HIZ A;  2K6Q A;  3R7R A;  2WX1 A;  2KVR A;  4W9J A;  2FCS A;  1Q5W B;  3ZDM C;  1V49 A;  2KDE B;  2N1V A;  3QC8 B;  1RFA A;  2GOW A;  3A1Q B;  2AYO B;  4NJ7 A;  4WQO B;  5CHW A;  2MWS B;  2L0F A;  1OEY J;  2KHW B;  4GU2 A;  3BY4 B;  4KDI C;  4ANW A;  3QHT A;  2J0M A;  2O6V B;  3DBH I;  3U30 A;  1OQY A;  3OJ4 B;  1UGM A;  3L16 A;  3N3K B;  4AJW A;  4KSK C;  3D32 A;  1YIW A;  3KUC B;  5L95 C;  2JRI B;  2N7D A;  2LXC A;  1EF5 A;  4ANV A;  2RSU A;  3P2B A;  1S1Q B;  4GXB A;  2MW5 A;  2KFJ A;  2WX0 A;  2ASQ A;  2O6V D;  1L7Y A;  1P9D U;  4K81 A;  4HCN B;  4EZL A;  4F8C B;  2FNJ B;  3DBL I;  1T0Y A;  1UD7 A;  2LVO A;  4XC2 A;  3VFK A;  2D07 B;  4IG7 B;  4A20 A;  1WFY A;  2YVC A;  3MHS D;  4G3X B;  2V4L A;  1UEL A;  1OTR B;  1E7V A;  2N9P C;  4G50 A;  1D3Z A;  1TTN A;  2LVQ A;  5EDS A;  2KAN A;  4BBN F;  2KLC A;  4GDK B;  3ZNH B;  4BOS C;  4FBJ B;  3DDC B;  3TIX A;  1E8X A;  2BF8 B;  3PSE B;  3ZLZ A;  2MBH A;  1KJT A;  1V2Y A;  2PE6 B;  2JZZ A;  4K7W A;  2JWZ A;  2A5U A;  1OEY A;  2M8S A;  2KX3 A;  2ZCC A;  4FLH A;  3KVF B;  4IWQ A;  3UQB A;  4LDT D;  2C7M B;  4BKG A;  2AL3 A;  3Q3F A;  5IA7 A;  3T8M A;  1WXV A;  3DCG A;  3NZU A;  1LQB A;  3KYD D;  3L10 B;  3ZDT A;  1M94 A;  1LM8 B;  3VUX A;  3EHV A;  2KN5 A;  4GB9 A;  2EMT A;  4JLC A;  1SIF A;  5D2M B;  3DBS A;  1UBI A;  1WGR A;  3ZNG C;  4CYE A;  4EZK A;  1IP9 A;  4W9E A;  2NS5 A;  2JXX A;  1WH3 A;  3QWZ B;  5E6N A;  4W9F A;  4WJQ A;  5J2R A;  2B3A A;  2C9W B;  2DZJ A;  3ML9 A;  5DPS A;  4ZYN A;  4MEL A;  1TBE A;  2L05 A;  3VHT C;  2QHO A;  2O2V B;  2ZNV B;  4NQK E;  1WM3 A;  1IYF A;  2BPS A;  1WGD A;  2LZ6 A;  2AEH A;  2Y5B B;  3PHW B;  3UF8 A;  4RM8 A;  1WJ6 A;  4WWP A;  3BIN A;  2ZCB A;  4WJN A;  5BO4 B;  2MQJ A;  4WAA A;  3SU8 X;  2JUO A;  1YD8 U;  1WYW B;  2C60 A;  4ICV A;  2CKH B;  2LGX A;  3AU5 A;  4ZDV A;  2KO3 A;  3UQA A;  1IPG A;  1EO6 A;  2IY1 B;  3KUZ A;  3ZTD A;  4W9K A;  5CHF A;  2NPT B;  4FJV B;  1E8Z A;  4TQ1 A;  2R2Q A;  1WGY A;  3H1U A;  3UIP B;  3WAP A;  2C7N B;  3DOW A;  2NR2 A;  4M8N A;  3ZNZ B;  2DYB A;  2KZR A;  4LJP B;  3VVW B;  1Q0W B;  1UH6 A;  1UZX B;  3WAL A;  2GBM A;  2JT4 B;  4GMV A;  4WWO A;  4A3P A;  3PVL A;  2GBR A;  4W9H A;  4I6P A;  2LGY A;  4ICU A;  3VQI A;  4BKS A;  4M0W B;  2DAJ A;  4ZRI A;  4DWF A;  1AAR A;  3A9K B;  2PE9 A;  1G6J A;  4OVV A;  3L13 A;  4KZC A;  3W1Y A;  3IHP C;  3VDZ A;  3NS8 A;  2DZI A;  2N7E A;  4WJO A;  5KHO A;  3M3J A;  2K39 A;  1NBF C;  3PPA A;  1J0G A;  3IG3 A;  4FJZ A;  5E6O A;  1C1Y B;  3K9O B;  2L7R A;  3WA0 A;  5KHQ A;  1P3Q U;  2REX A;  3APF A;  2LUE A;  3QAQ A;  3MJW A;  3Q3J A;  1SE9 A;  2CHZ A;  2IO1 B;  2KWV B;  2VRR B;  2G45 B;  3ZRF A;  2UYZ B;  2V3S A;  3V60 A;  4EEW A;  1WY8 A;  2ZJD A;  4IW0 A;  3OLM D;  4XZ4 A;  3LDZ E;  1WR1 A;  2LGD A;  4GGQ A;  2BYV E;  5LXH A;  3A9K A;  3A33 B;  4OVU A;  2YLM A;  3M63 B;  2PJH A;  3H9D A;  3NZS A;  3L17 A;  1Z2M A;  2D2Q A;  2BGF A;  3WAM A;  3A4R A;  3KUD B;  1WXM A;  5AZF A;  2FCM A;  3H7P A;  3V61 A;  3AXC A;  2JPH A;  4W9D A;  4GDL A;  2KTF A;  1YJ1 A;  2CU1 A;  3CSF A;  3DQV A;  4ANU A;  3DVG X;  1WMH B;  2G4D B;  4HWI B;  2WWZ A;  4DDG D;  4W9L A;  2RR9 A;  3H7S A;  4HJK A;  2GMI C;  3ZTC A;  1XD3 B;  3ZVV A;  4NPN A;  3VTV A;  2MA9 B;  3VXW A;  2KOX A;  2MP2 A;  3MTN B;  2K8B A;  3HHM A;  1R4N I;  2RD0 A;  4TQ0 A;  5J18 A;  2FIF A;  2JRH A;  2J0J A;  5D94 A;  4LDT B;  4KDL B;  2MBE A;  1Y8R C;  4MGY E;  4K7S A;  2HE7 A;  2L0T A;  2BKR B;  3K9P B;  4G11 A;  1MG8 A;  3O65 B;  1VD2 A;  4FAD A;  3L54 A;  3R7Q A;  2L8J A;  3ZO5 B;  3DVN U;  3H6N A;  4MEM A;  3IFW B;  4JIO U;  3ALB A;  1WX9 A;  1WMH A;  4DXA B;  4EOY A;  5C23 A;  2N1W A;  3WAN A;  4DHZ E;  1FXT B;  2RGF A;  1SGH A;  3B08 A;  2HTH A;  2IO0 B;  1XT9 B;  2IYD B;  3AU4 A;  1L2N A;  2LJ5 A;  2L00 B;  5JH5 C;  5DPR A;  2KC1 A;  2ZPY A;  2Z0E B;  2KQS A;  1WJ4 A;  3DBR I;  2KK8 A;  4NY0 A;  2KX0 A;  4HPL B;  3IVF A;  4N9F 4;  2CHX A;  5G2N A;  4W9I A;  2KDI A;  3JVZ X;  2KQ7 A;  2N4F A;  3L0W B;  1K8R B;  4AUQ C;  3ZW3 A;  1V6E A;  5HKH A;  2MBQ A;  4LCD E;  3ZNI D;  4YL8 A;  4URK A;  3ML8 A;  4IM3 A;  4B95 A;  4IUM B;  4PS7 A;  3SDL C;  4PYU A;  3PV1 A;  4RMA A;  2KWC A;  3VH3 B;  3QA8 A;  1V5T A;  4TUU A;  3W1S C;  2KTR A;  3VTW A;  1C3T A;  4AP4 C;  3RUI B;  5C1Z A;  4PS3 A; 
#chains in the Genus database with same CATH topology
 2BT6 A;  2INP E;  4BFR A;  2KD0 A;  3ZXV A;  4PT5 A;  3QJZ A;  2OOB B;  4II3 B;  1V5O A;  3DVN V;  4FN2 A;  5CX3 A;  2RPQ A;  2Y3A A;  1KOT A;  4HLE A;  2LD9 A;  1EUV B;  4C4V A;  5CHV C;  4RNA A;  3C8Y A;  1T6B X;  2BB5 A;  4MGK E;  2WXO A;  3ZRC A;  3PLV A;  1JWA D;  2JZ3 B;  2DYM A;  4JPS A;  4ASW C;  4WJP A;  5BMG A;  1ACC A;  3VUW A;  2KJ6 A;  4D2K A;  1UBQ A;  4KZ0 A;  2IJ0 A;  2KNB A;  1TY2 A;  3C0R B;  3TJP A;  2SAK A;  3APD A;  1YQB A;  2J4X A;  4HDQ A;  3GP7 A;  2D3A A;  2FAZ A;  4E71 A;  1VLB A;  1IBX A;  2K6D B;  1GJZ A;  2HDE A;  4X57 B;  4DBG A;  3N1Y C;  2D11 A;  2KXJ A;  2M17 A;  3B2G A;  4FA6 A;  2N9E B;  3X23 A;  2IO2 B;  3U8Z A;  4LNO A;  4LNN A;  2FID A;  4O1N A;  4RGM A;  4BKS D;  3QK0 A;  2MBO A;  2ZVN A;  2BVC A;  4JGH B;  1A5R A;  4IC7 B;  4BKS A;  1QT9 A;  3IAS 1;  1GC6 A;  2KDF B;  2ZW0 A;  3APC A;  1WRI A;  2MRP A;  2PVO D;  5BYR A;  2GI9 A;  2AWT A;  1WZ3 A;  1ZXI A;  1R4M I;  3P4P B;  3GOE A;  4KVG B;  2JF5 A;  4KKI A;  1H4R A;  4K7U A;  4F1S A;  3BYT B;  4PS8 A;  4I6N B;  3V6C B;  1V80 A;  4ZRJ A;  1ZDV A;  2JYE A;  2NBU A;  1J19 A;  2DAF A;  2CHW A;  3KYC D;  2WU5 B;  1AN8 A;  2M1M A;  2EKE C;  1N5X A;  4DHJ B;  2KLG A;  3SEB A;  4K3B A;  3JSV B;  5DPW A;  2MX2 A;  2BBC A;  1F0Z A;  1TGZ B;  4B6W A;  2E6X A;  4WWN A;  3TCA A;  5D7G A;  4LLG M;  4M02 A;  5G55 A;  1ZKH A;  2DWQ A;  2GBN A;  2ZZP B;  4KSL C;  4DHZ B;  1QIL A;  2NCN A;  1YJJ A;  3H8H A;  4OW0 A;  2FBW B;  1P0R A;  1YX5 B;  5JHB A;  4GIV A;  2DYO A;  2KMC A;  1XCT L;  1GNU A;  4RGT A;  3NVZ A;  2OJR A;  1L6U A;  1ZXH A;  3V62 A;  2LAS A;  1I7H A;  1SEB D;  3TEZ A;  2DHZ A;  2WQY B;  1OGW A;  5MPO A;  4F7Z A;  1R4N B;  2NBV B;  2LHE A;  3Q14 C;  1WXQ A;  4KIK B;  2QC8 A;  3PS6 A;  2BTE A;  3HM3 A;  2K25 A;  4DXG A;  4CO7 A;  4A55 A;  4HEA 1;  2FCN A;  3VUY A;  2XNA C;  1WZ0 A;  4NAW B;  5BYS A;  2NPT A;  3L08 A;  3Q3M C;  3GZN B;  4KGR A;  5JXV A;  1QLB B;  2WX1 A;  2ON8 A;  1Q5W B;  2N7J A;  5FK9 C;  3GE3 C;  2YEP B;  3DBR B;  1UWX A;  4NJ7 A;  1OEY J;  2WXR A;  1XCQ L;  3BY4 B;  1DOI A;  4A9A A;  4B0E A;  1UGM A;  2W82 A;  3BWU D;  3L16 A;  4AJW A;  5L95 C;  2JRI B;  2N7D A;  2LXC A;  3ZQ4 A;  2QCZ A;  2RSU A;  3P2B A;  1S1Q B;  1PUT A;  1HTQ A;  3U4E G;  1SE3 A;  1PGB A;  2JU6 X;  2O6V D;  4EZL A;  1T0Y A;  2J52 A;  3TEW A;  4YTN B;  1ZDX A;  2YVC A;  3VRB B;  4G50 A;  2LVQ A;  5EDS A;  2D3B A;  2KLC A;  4GDK B;  4BOS C;  5BMH A;  3ZLZ A;  2LEK A;  2IGG A;  1SF0 A;  3KVF B;  4IWQ A;  4ZRP A;  1Y56 A;  3W5V B;  4BKG A;  3FKY A;  3KLS X;  1MFW A;  3L10 B;  1M94 A;  3EHV A;  1B9R A;  1WGR A;  4CYE A;  4W9E A;  2JXX A;  3HVZ A;  5E6N A;  1DGJ A;  2R61 A;  1XLP A;  3RNE C;  4MEL A;  3ZGZ A;  2N9L A;  3NJT A;  2O2V B;  2ZNV B;  4KX6 B;  1WGD A;  4YWG G;  2LZ6 A;  2AEH A;  4MT5 A;  2Y5B B;  1PDX A;  1E0Z A;  1XXG A;  1WJ6 A;  3GS2 A;  4YTM B;  2MQJ A;  4A90 A;  1CQV A;  4ICV A;  1V8C A;  1GAQ B;  4L23 A;  1IPG A;  2N0S B;  1EO6 A;  2IY1 B;  4W9K A;  3TEX A;  1YNT E;  4TQ1 A;  1WGY A;  3H1U A;  2KYW A;  1C79 A;  4M8N A;  2NR2 A;  1NVI D;  2DYB A;  1N62 A;  2WXJ A;  2KZR A;  4LJP B;  1Q0W B;  3DBH B;  2JT4 B;  3FIL A;  3A9K B;  2PE9 A;  3L13 A;  4KZC A;  4XWW A;  3NS8 A;  4L1B A;  5E6O A;  3AEA B;  3V05 A;  4BAX A;  5KHQ A;  3APF A;  3NVY A;  2RDH A;  4ARC A;  1R4M B;  3O13 A;  1FRR A;  2ZJD A;  4IW0 A;  3PZ7 A;  3SFD B;  2BYV E;  5LXH A;  2YLM A;  2Q5W D;  1RYJ A;  1QQR A;  4MH8 A;  3A4R A;  3DQV A;  4JE3 B;  3DVG X;  2G4D B;  4HWI B;  4B0M A;  2BB6 A;  3VTV A;  1RFK A;  2V0G A;  2K8B A;  2PTL A;  3HHM A;  3MC8 A;  4UDU C;  2MBE A;  4K7S A;  3DHI C;  1FCC C;  4G11 A;  3GE8 C;  2HTM E;  3O65 B;  5D3D A;  4FAD A;  3AE1 B;  4M01 A;  3H6N A;  4JIO U;  3ALB A;  4DXA B;  4EOY A;  5C23 A;  4DHZ E;  2AQ3 B;  3W5U B;  2L00 B;  4P1C C;  2KC1 A;  4HPL B;  3IVF A;  1C9F A;  1WYG A;  1A70 A;  3ZW3 A;  1CK1 A;  4YL8 A;  3ZNI D;  2WXP A;  4IUM B;  3SDL C;  2KWC A;  1WSP A;  3W1S C;  3N1X C;  2MJ3 A;  1C3T A;  1WX7 A;  1E5W A;  4YT0 B;  1E9M A;  2BYF A;  1F1H A;  2ZNV C;  4YSZ B;  3BII D;  4MSQ B;  3AEF B;  1GOZ A;  2YEP F;  3R2I A;  3HK0 A;  1KM7 A;  3ZKJ C;  3B9J A;  3JSV A;  5LXI B;  3WAO A;  1WXA A;  3DWM A;  4OVZ A;  1FNV A;  1ZE3 D;  4LTU A;  1BT0 A;  1HQR D;  1J7A A;  2Z0D B;  4FHK A;  5IOI A;  4DDI D;  4TKN A;  3UIO B;  2WXH A;  4CHK A;  5FR6 A;  4NNJ B;  4FJY A;  1KRH A;  2IGD A;  5AUK A;  2NTS A;  3Q3N C;  4FUL A;  3ECI A;  3I63 C;  3L4P A;  3AM9 A;  2BS3 B;  1QKZ A;  2L3Z A;  4E74 A;  4RCO A;  3ZUN A;  2DZM A;  3IBE A;  2IZV B;  3R3M A;  3I3T B;  4KIK A;  3OG5 A;  4RF1 A;  1NDD A;  1V97 A;  3HRD D;  2NVU I;  3RD2 A;  3VRA B;  2WU2 B;  1N61 A;  4HXD A;  4WAF A;  4MDK E;  3RUL A;  2DX5 B;  1HE8 A;  4NAW A;  4JQW C;  1MVK A;  4AJY B;  1TYG B;  2L83 A;  3AE3 B;  2QIE B;  1MPE A;  2K1F A;  2K8H A;  1ZOY B;  1WE6 A;  2N9X A;  2XN9 C;  2IGH A;  3GZN I;  4I6L B;  3M62 B;  1AYF A;  1OQQ A;  2GB1 A;  3NG0 A;  3N20 C;  2RMM A;  3AMZ A;  2V3N A;  4P6V F;  2J7Q B;  3B2F A;  1VDV A;  4MJS B;  4J6I A;  3CIR B;  3A9J B;  2C7H A;  1NI3 A;  2QSD A;  4RFB A;  4KGS A;  5LLI A;  2A4Z A;  1WRD B;  5GMV A;  3RMK C;  3EEC A;  3U7D A;  4A3O A;  4XX5 A;  2JZP A;  4II2 B;  2Z8L A;  2GRI A;  1JML A;  2WXQ A;  3E56 A;  2LI5 A;  2D10 A;  4GDK A;  4ZHP A;  3P4S B;  2FE8 A;  3AE6 B;  3Q6B A;  3SR6 A;  4S17 A;  5JHA A;  3CST A;  1E7P B;  1XO3 A;  4A6Q A;  1Z5S B;  3OAW A;  1WX8 A;  2XEW A;  3W1S A;  1P1A A;  1RAX A;  2R2O A;  2HD5 B;  5EE0 A;  2J0K A;  1C4A A;  2BKF A;  4CQN A;  2M4N A;  4AOF A;  1GPX A;  4HPP A;  2KFK B;  3U52 E;  1UUP A;  1WF9 A;  2O2V A;  2M56 B;  2QIL A;  3A4S C;  2MH7 A;  4B9K A;  2KC2 A;  3V3X A;  1ENF A;  4P7I A;  4MH0 E;  4YSX B;  1WIA A;  3TL5 A;  2BW2 A;  2JVC A;  4MGZ E;  4ARI A;  1DOX A;  2KWU B;  2M0X A;  2MEK A;  2XK5 B;  1L5P A;  4K1R B;  2IBI B;  3PRM B;  2ZVO A;  2K6Q A;  3R7R A;  1I4R A;  2W55 A;  4XYC A;  4P16 A;  2KDE B;  1D5M C;  1HTO A;  2GOW A;  3A1Q B;  1UF0 A;  2QJL A;  1VR9 A;  2KHW B;  1N6Z A;  2J0M A;  5HHD G;  3DBH I;  1XF5 L;  1OQY A;  1L4Z B;  3OJ4 B;  3KUC B;  1FXI A;  4ANV A;  3RNG C;  2VZK B;  1SE4 A;  1ESF A;  4XDD A;  2KFJ A;  1TZO A;  1L7Y A;  3MFG A;  4F8C B;  2RDG A;  1KLU D;  4G3X B;  2V4L A;  2NTT A;  1LO5 D;  1E7V A;  1OTR B;  3PO0 A;  4KGT A;  1T5X D;  3ZJU A;  1I4H A;  3DDC B;  2OHF A;  1FXA A;  2BF8 B;  3DHH C;  2WHI A;  2MBH A;  4DXF A;  4M00 A;  2JZZ A;  2JWZ A;  2A5U A;  1OEY A;  2W3R A;  3ZDT A;  3KYD D;  5G5H A;  1GB4 A;  4GB9 A;  1UBI A;  1IP9 A;  2NS5 A;  4W9F A;  4WJQ A;  2B3A A;  3ML9 A;  1K50 A;  5FR3 A;  2JX5 A;  1TBE A;  2L05 A;  1L4D B;  4K3C A;  3R2T A;  2BPS A;  5AUI A;  1JWU D;  3PHW B;  3E9S A;  2CJN A;  4WJN A;  4WAA A;  3SU8 X;  1WYW B;  2CKH B;  2PMV A;  2LGX A;  4ZDV A;  2AX5 A;  2KO3 A;  3ZTD A;  5CHF A;  2WDV B;  4FJV B;  1VZ7 A;  3DOW A;  4WIP A;  5G5G A;  1C77 A;  5H92 C;  1UGJ A;  1UZX B;  3WAL A;  4GMV A;  4WWO A;  4A3P A;  2GBR A;  4XDC A;  5IKC M;  4ICU A;  5T8I A;  1FEH A;  4ZRI A;  2DAJ A;  1MI0 A;  2B76 B;  2INN E;  1NYQ A;  2DZI A;  3DHG C;  3M3J A;  2K39 A;  1J0G A;  3IG3 A;  1C1Y B;  3WA0 A;  4OZA A;  2REX A;  3NZ3 A;  2VH2 A;  3MJW A;  1SE9 A;  1QOF A;  2WXL A;  2G45 B;  4C7Z A;  3ZJV A;  3ZRF A;  4EEW A;  4XZ4 A;  1WR1 A;  4OVU A;  3A33 B;  3M63 B;  2PJH A;  3L17 A;  2D2Q A;  2BGF A;  2ONQ A;  5BYQ A;  3W9C B;  3WAM A;  3KUD B;  2FCM A;  3HVD A;  1YJ1 A;  2CU1 A;  2EEL A;  3CSF A;  1WMH B;  3AEB B;  4NPN A;  2MA9 B;  3VXW A;  3EUB 2;  5J18 A;  4TQ0 A;  3I57 A;  1CJE A;  1YQ3 B;  4LDT B;  4MGY E;  1KFY B;  2QDF A;  2L0T A;  2BKR B;  3K9P B;  1VD2 A;  2IDY A;  1WX9 A;  1SGH A;  3B08 A;  2L32 A;  5EE1 A;  1AWD A;  2X38 A;  3N1Z C;  2W54 A;  1B1Z A;  1WJ4 A;  3U7Z A;  4H2A A;  1M4V A;  4LCD E;  4URK A;  4HRS A;  4B95 A;  4PS7 A;  1C4P A;  4NZL B;  1F77 A;  3PV1 A;  3VH3 B;  3QA8 A;  1OFF A;  1HXY D;  1C78 A;  4ZRK A;  1BXT A;  3IT6 B;  1RM6 C;  4WWM A;  3A9J A;  4JL9 A;  3RN9 C;  4RM9 A;  1S3S G;  1XLQ A;  2PIA A;  4KV2 A;  1EWC A;  1E8W A;  1E7U A;  1I4X A;  1IBX B;  4J3O D;  3N30 A;  1JRO A;  2CR5 A;  3RZW C;  4C56 C;  3H7P B;  3BVM A;  1WXS A;  5FKA C;  5AZH A;  4GSW A;  4OHJ A;  1MG4 A;  4HCP B;  3Q8A A;  1J8C A;  3VTU A;  1F9J A;  4L2Y A;  2WYQ A;  2KJR A;  3Q8E A;  3SHQ A;  2Y5P A;  1FM0 D;  4WH4 A;  1Q1O A;  4XE0 A;  4DK5 A;  2KFK A;  2WGS A;  1TS2 A;  1ZUD 2;  4FHJ A;  1GB1 A;  2JY6 A;  1RRB A;  3IXS A;  1ISN A;  5HI1 A;  2WXG A;  1QZE A;  3PT2 B;  3AEE B;  3BZD B;  4ANX A;  3QIJ A;  3EFU A;  4NQL B;  1J7B A;  1V86 A;  5IP4 D;  1YOV B;  2WXN A;  4HK2 A;  3CF6 E;  1WE7 A;  2LRW A;  3MP9 A;  1FCL A;  3PRZ A;  2XK5 A;  3AE8 B;  1FNU A;  1FFV A;  3RT3 B;  4GN1 A;  2J53 A;  2PLP A;  5CTR C;  2I1J A;  1TIF A;  5IAA C;  3EFC A;  1FMA D;  1FNW A;  2K3U A;  3JYU A;  2DZK A;  2C5L C;  3A1Q A;  1UWM A;  4N6E B;  4IKG A;  2G1E A;  2KTR B;  3LJ3 A;  3R66 C;  1GUA B;  4HKQ A;  1KF6 B;  1V81 A;  1V1O A;  2VZK D;  2CS4 A;  3UIN B;  3WIM A;  3PRP B;  1SXT A;  1V1P B;  1JWM D;  1V9J A;  3PRE A;  3KW5 B;  3QQ8 B;  4MM3 B;  5JZE B;  4YSY B;  4US9 A;  2QEJ C;  3LB8 C;  1TKG A;  1VRA B;  3ZJT A;  3NS1 A;  1ZP0 B;  3MHZ A;  1PFD A;  4BKT A;  2WDT B;  4DHJ D;  1SJH D;  3CWI A;  1TKE A;  1SBB B;  3C19 A;  3AH7 A;  2Z59 B;  4W9G A;  2L1A A;  1U4A A;  4BBN C;  4M8M A;  1TS5 A;  5AZG A;  2LJI A;  3ETR A;  4NJC A;  3URY A;  1FPY A;  1WI0 A;  3NOB A;  5LNK 1;  4LJO B;  4YTP B;  2JWU A;  2MCN B;  1YMH E;  4ZHO A;  3AUL A;  2D5G A;  1BUI C;  2WS3 B;  1SB3 C;  1YX6 B;  4P1B C;  3B0A A;  2I2Y A;  5TR5 A;  4IWO A;  5E6P A;  4YXD B;  3PGE A;  1C76 A;  2JSV X;  3PZD A;  4MGI E;  1K53 A;  2V1Y A;  1L6V A;  4E3C A;  1E90 A;  2J42 A;  1VZ6 A;  1E8Y A;  1JW9 D;  4R3D A;  3AEC B;  4OZB A;  2FUH B;  5H8Y E;  1FD6 A;  4W9J A;  2FCS A;  3ZDM C;  1V49 A;  3QC8 B;  1RFA A;  5CHW A;  5HFY A;  4KDI C;  4GU2 A;  4ANW A;  1T0Q C;  2O6V B;  1F52 A;  4LNK A;  3D32 A;  1EF5 A;  5E6J A;  1PGX A;  2MW5 A;  1IGC A;  1ZPS A;  2ASQ A;  4K81 A;  1I4G A;  2FNJ B;  1F2R I;  4ZYS A;  1UD7 A;  2LVO A;  3BVG A;  3P42 A;  1FRD A;  3VFK A;  2D07 B;  3ZYY X;  2N9P C;  4BBN F;  3TIX A;  3PSE B;  4HKZ E;  5C2T B;  3UI3 A;  1I4P A;  1KJT A;  1V2Y A;  1HZ5 A;  1R7S A;  4JWS C;  2E3T A;  4K7W A;  4FLH A;  4LNI A;  1L0V B;  2V3P A;  3UQB A;  4LDT D;  2C7M B;  3T8M A;  3WCQ A;  3DCG A;  3NZU A;  3AED B;  2BYT A;  1SIF A;  5D2M B;  3DBS A;  2JQR B;  3ZNG C;  4LK0 M;  1WH3 A;  3QWZ B;  5J2R A;  2KMM A;  2C9W B;  5DPS A;  5GXG B;  3VHT C;  1E6E B;  3UF8 A;  4RM8 A;  4WWP A;  3FIL B;  3BIN A;  2ZCB A;  5BO4 B;  1ET9 A;  5TSS A;  2JUO A;  1YD8 U;  2C60 A;  4IOI E;  3UQA A;  3AV8 A;  1WGK A;  1PYW D;  2JXT A;  2BQQ A;  1P7F A;  2C7N B;  1EU4 A;  1QF6 A;  1UH6 A;  4I6P A;  2LGY A;  3VQI A;  4M0W B;  4DWF A;  3FC4 A;  1AAR A;  2QMT A;  3W1Y A;  1YJI A;  2VH1 A;  3NUH B;  4KKJ A;  4WJO A;  1NYR A;  1NBF C;  2CU3 A;  2L7R A;  3DBL B;  1P3Q U;  4TSS A;  4C7Y A;  2LUE A;  3QAQ A;  2CHZ A;  3BVZ A;  2KWV B;  3EA6 A;  4HJG E;  2V3S A;  1JAL A;  1WY8 A;  5D3I B;  3LDZ E;  4GGQ A;  2LGD A;  3A9K A;  3H9D A;  2ICI A;  2G9H D;  1WXM A;  3H7P A;  3AE5 B;  1YQ4 B;  2JPH A;  2KTF A;  1YN4 A;  4DDG D;  3IAM 1;  2WWZ A;  2GMI C;  1EWY C;  3ZVV A;  2KOX A;  1L0Y B;  2PKO A;  3MTN B;  2WP9 B;  1MHX A;  4FXC A;  4AQ7 A;  1D5X C;  1N63 A;  4KDL B;  2DNF A;  3GB1 A;  5HG2 A;  1WWT A;  1MG8 A;  2H89 B;  3TSS A;  3R7Q A;  3IT4 B;  3ZO5 B;  2X8X X;  3IFW B;  1HZ6 A;  1FXT B;  2RGF A;  3MC0 B;  1XT9 B;  2IYD B;  3AU4 A;  1L2N A;  2LJ5 A;  5JH5 C;  5DPR A;  3Q3O C;  2PW9 A;  2KQS A;  1TT5 B;  2KK8 A;  2KX0 A;  5G2N A;  4N9F 4;  2CHX A;  4NAM A;  4W9I A;  2KDI A;  3JVZ X;  2WXF A;  3L0W B;  4REZ A;  4AUQ C;  1TS4 A;  5HKH A;  1PGA A;  2MBQ A;  1D4B A;  3BYY B;  2CJO A;  3RNB C;  4PYU A;  3Q2A C;  1TJE A;  1V5T A;  2KTR A;  3VTW A;  5IN7 A;  1SIJ A;  5C1Z A;  1LGR A;  3MC9 A;  2G3Q B;  4BVU C;  1HEZ E;  2KKC A;  3JW0 X;  4GOC A;  1L0X B;  3LYY A;  3DWG C;  1WGH A;  1TY0 A;  3ZIM A;  1V1P A;  2WXK A;  3AI5 A;  1LFD A;  3RNA C;  5DPT A;  3I9V 1;  5C3J B;  4C80 A;  3T3N A;  5BMI A;  3S2A A;  3B1L X;  3ZXR A;  3X0W A;  1CZP A;  4MM3 A;  3QCA A;  1P98 A;  2Y5C A;  4EZJ A;  2KN4 A;  4EFO A;  2WLB A;  4BOZ B;  3TEY A;  4OZC A;  4GLS C;  3DVG Y;  4MSM B;  4IM2 A;  2IPK D;  3PLU A;  3VAW A;  4TV3 A;  3VR8 B;  2D3G A;  4GDL B;  2GBJ A;  2XBB C;  1C4C A;  2WNM A;  5I4D A;  3M95 A;  4AS1 A;  3P1M A;  3HM6 X;  2MP2 B;  1KLV A;  3RI7 C;  3RNC C;  1ZGU B;  2WDR B;  1WJN A;  3T9L A;  3CMM B;  1JQ4 A;  1ZW7 A;  4IDI A;  1TKY A;  1KTK A;  4AWJ A;  2LRU A;  4IM0 A;  1TZ1 A;  3UGB B;  2GBK A;  3ENE A;  1WM2 A;  5J17 A;  2G4S A;  2BS4 B;  3RYT A;  2PEA A;  1QOB A;  3MJ5 A;  4US8 A;  1XQQ A;  4JX1 C;  2MLB A;  3TBL D;  3QX1 A;  2EKI A;  1NEN B;  4PYZ A;  3N9Y C;  4EKU A;  1FIQ A;  4W9C A;  1I42 A;  2HJ8 A;  2NBW B;  3PHX B;  3V6E B;  2BYE A;  2PPH A;  3EC8 A;  1AW7 A;  2IY0 B;  2LWP A;  1H8C A;  4EUT A;  3HUI A;  1VCB A;  1GG3 A;  1WGG A;  4LNF A;  2DBY A;  1EU3 A;  2K5P A;  1K52 A;  1D6E C;  2DLB A;  1UNS A;  1N5W A;  1JWS D;  1RWS A;  3OJ3 A;  2KDB A;  2OED A;  4MAC A;  4DQO C;  1ET6 A;  2W9N A;  3PZ8 A;  1GC7 A;  1X1M A;  4JWU C;  2KMA A;  3SD5 A;  2O6V A;  3KWL A;  3AE2 B;  2L76 A;  2MSE D;  3NY5 A;  2LVP A;  2K22 A;  2BWF A;  2AL6 A;  1LXD A;  4QAY A;  4C4V B;  3RZF A;  1XEE A;  2ZW1 A;  2IO3 B;  2MBB B;  4WQM A;  3P4Q B;  3DPD A;  5D6J B;  2DEN B;  2KDM A;  4RH6 A;  2BWE S;  2M0A A;  3RCZ A;  3P4R B;  4RF0 A;  2KQ4 X;  4HPM B;  4MJS A;  4NJ6 A;  1BML C;  1RLF A;  3KH0 A;  3ABV B;  1JWB D;  4PK1 A;  1T0S C;  3N32 A;  3TMP B;  3KQ4 A;  1JRU A;  1PQS A;  3PTF C;  3LXF A;  3Q8B A;  1EF1 A;  3ONS A;  2RPV A;  1WJU A;  1FFU A;  3NVW A;  2LXA A;  2ZPN A;  3FAH A;  3NHE B;  1I35 A;  5L83 A;  1OQR A;  4RGN A;  1WR6 E;  3Q69 A;  2KJH B;  1NI2 A;  2WXM A;  4IWP A;  5IO9 A;  3QAR A;  1TS3 A;  1JCK B;  1T3Q A;  4HVB A;  2ZEQ A;  2FCQ A;  2UWQ A;  3VH4 B;  2KVZ A;  3TUO A;  3NRZ A;  1CMX B;  1DYQ A;  4G0N B;  2WDQ B;  2K8C A;  4HDO A;  4Q2J A;  5AEK B;  5DCN A;  3AE7 B;  2EMS A;  2MJD A;  1IGD A;  2K0P A;  4RGO S;  1YN5 A;  2LMC A;  3KWV A;  2I1K A;  1F2R C;  3AN1 A;  3HIZ A;  3OWE B;  2KVR A;  3AE4 B;  1E10 A;  4USA A;  3AEG B;  2N1V A;  2AYO B;  4WQO B;  2AQ2 B;  2MWS B;  2L0F A;  4M0W A;  3QHT A;  4WUR A;  2INC C;  3U30 A;  1EM7 A;  2PVG C;  3N3K B;  2KAC A;  4KSK C;  1YIW A;  3NVV A;  1QOA A;  1N60 A;  4N59 A;  3U2S C;  4GXB A;  1FO4 A;  2WX0 A;  2NMQ A;  1P9D U;  4HCN B;  1T0R C;  3P63 A;  3DBL I;  2MHJ A;  1KLG D;  2MJE A;  4XC2 A;  3VR9 B;  4IG7 B;  4A20 A;  3T3O A;  1WFY A;  2M19 A;  3MHS D;  1IUE A;  1UEL A;  1D3Z A;  1TTN A;  2KAN A;  4FBJ B;  3ZNH B;  1E8X A;  1I4Q A;  1VJK A;  4ZOH C;  2PE6 B;  2M8S A;  2KX3 A;  2H88 B;  2ZCC A;  2UU7 A;  2AL3 A;  3Q3F A;  5IA7 A;  1WXV A;  1LQB A;  1QOG A;  1LM8 B;  3VUX A;  4A8X C;  2KN5 A;  2EMT A;  2SEB D;  4JLC A;  3AB5 A;  4EZK A;  1XLN A;  1YN3 A;  1DOY A;  2DZJ A;  4BZA A;  1HA5 A;  4ZYN A;  2K9X A;  2QHO A;  2I38 A;  3EGR A;  4NQK E;  1WM3 A;  1IYF A;  3W2D A;  4XGA B;  2L52 A;  4S0R A;  2FUG 1;  2KT7 A;  1MHH E;  3AU5 A;  4ITK A;  4HRO A;  4EE2 A;  3AE9 B;  3KUZ A;  2NPT B;  1E8Z A;  3BK1 A;  2R2Q A;  2LHD A;  3UIP B;  3WAP A;  3ZNZ B;  2D3C A;  1NEK B;  3VVW B;  4N58 A;  2GBM A;  2AQ1 B;  3PVL A;  1KH0 A;  3Q8F A;  4W9H A;  1G6J A;  4OVV A;  3I5J C;  1Q10 A;  3IHP C;  3VDZ A;  2KAJ A;  2N7E A;  5KHO A;  3PPA A;  4FJZ A;  3K9O B;  2JYT A;  1P7E A;  4ZRQ A;  3Q3J A;  2IO1 B;  2VRR B;  2KWD A;  2LGI A;  1ROE A;  1JRP A;  2UYZ B;  3V60 A;  3OLM D;  1J7C A;  1XLO A;  3NZS A;  1SJE D;  1Z2M A;  2GLS A;  5AZF A;  3V61 A;  3AXC A;  4W9D A;  4GDL A;  3R8B A;  4ANU A;  2OJW A;  1K51 A;  4W9L A;  2HJ1 A;  2RR9 A;  3H7S A;  4HJK A;  3ZTC A;  3RFZ B;  1XD3 B;  1SE2 A;  2BS2 B;  1D5Z C;  2MP2 A;  2N9K A;  4ACF A;  1VZ8 A;  1R4N I;  2RD0 A;  3RNF C;  1MJD A;  2FIF A;  2IND C;  3J9C A;  2JRH A;  2J0J A;  5D94 A;  1Y8R C;  2RDB C;  3SFE B;  2HE7 A;  2WXI A;  3L54 A;  2L8J A;  3DVN U;  4MEM A;  2LUM A;  1WMH A;  4XWT A;  2LFI A;  3BK2 A;  3WAN A;  2N1W A;  2HTH A;  2IO0 B;  2ACZ B;  5EE3 A;  5EE9 A;  2ZPY A;  2LGS A;  2Z0E B;  3DBR I;  4NY0 A;  2V4I B;  2KQ7 A;  2N4F A;  4C00 A;  1K8R B;  2V9H A;  3RPF C;  1V6E A;  1SSN A;  3Q8C A;  4TMA B;  2W3S A;  3ML8 A;  4IM3 A;  4RMA A;  4TUU A;  2TSS A;  4AP4 C;  1STE A;  3RUI B;  4PS3 A; 
#chains in the Genus database with same CATH homology
 1WX7 A;  4BVU C;  2G3Q B;  4BFR A;  2KD0 A;  1E5W A;  2KKC A;  3JW0 X;  4GOC A;  2BYF A;  3QJZ A;  4ZRK A;  2OOB B;  4II3 B;  1V5O A;  3DVN V;  1WGH A;  4FN2 A;  5CX3 A;  2RPQ A;  3A9J A;  3ZIM A;  1KOT A;  4JL9 A;  2ZNV C;  3AI5 A;  1LFD A;  5DPT A;  4HLE A;  4MSQ B;  4RM9 A;  1S3S G;  2LD9 A;  1EUV B;  5CHV C;  3S2A A;  3B1L X;  4KV2 A;  3X0W A;  4MM3 A;  4MGK E;  3ZRC A;  3PLV A;  3QCA A;  1E8W A;  1E7U A;  1P98 A;  4EZJ A;  3HK0 A;  4EFO A;  2JZ3 B;  4BOZ B;  2DYM A;  1KM7 A;  3ZKJ C;  4ASW C;  3N30 A;  4WJP A;  3VUW A;  3JSV A;  5LXI B;  2KJ6 A;  3WAO A;  1WXA A;  3DVG Y;  4MSM B;  1UBQ A;  2CR5 A;  4IM2 A;  4KZ0 A;  2KNB A;  3RZW C;  3PLU A;  3H7P B;  3VAW A;  4TV3 A;  3C0R B;  2D3G A;  4GDL B;  2GBJ A;  1WXS A;  1BT0 A;  3TJP A;  2XBB C;  4FHK A;  2Z0D B;  5AZH A;  3APD A;  1YQB A;  4DDI D;  4TKN A;  4GSW A;  3M95 A;  4HDQ A;  3UIO B;  3HM6 X;  2MP2 B;  1KLV A;  4CHK A;  4HCP B;  5FR6 A;  1ZGU B;  4NNJ B;  2FAZ A;  1WJN A;  4FJY A;  4E71 A;  1J8C A;  3T9L A;  3CMM B;  1ZW7 A;  4AWJ A;  2K6D B;  1F9J A;  2LRU A;  4IM0 A;  3VTU A;  1GJZ A;  1TZ1 A;  2WYQ A;  4FUL A;  3ECI A;  2KJR A;  4X57 B;  4DBG A;  3SHQ A;  3UGB B;  2L3Z A;  2GBK A;  2D11 A;  3ENE A;  1WM2 A;  2KXJ A;  1Q1O A;  2M17 A;  5J17 A;  2G4S A;  4E74 A;  4DK5 A;  2KFK A;  3RYT A;  2PEA A;  4FA6 A;  4FHJ A;  2JY6 A;  2N9E B;  3X23 A;  1RRB A;  2IO2 B;  3U8Z A;  3ZUN A;  2DZM A;  1XQQ A;  1ISN A;  3IBE A;  2MLB A;  3TBL D;  2FID A;  2IZV B;  3R3M A;  1QZE A;  3PT2 B;  3I3T B;  4KIK A;  3QX1 A;  1NDD A;  4PYZ A;  4BKS D;  3QK0 A;  2MBO A;  4EKU A;  4ANX A;  2ZVN A;  4W9C A;  2NVU I;  3RD2 A;  2HJ8 A;  3QIJ A;  3EFU A;  1I42 A;  4JGH B;  1A5R A;  4NQL B;  2NBW B;  3PHX B;  1V86 A;  4HXD A;  4IC7 B;  4MDK E;  4HK2 A;  3RUL A;  3CF6 E;  1WE7 A;  2BYE A;  2DX5 B;  2LRW A;  2PPH A;  1HE8 A;  3EC8 A;  2LWP A;  2IY0 B;  2XK5 A;  3PRZ A;  4JQW C;  4NAW A;  1H8C A;  4EUT A;  4AJY B;  3RT3 B;  1VCB A;  1GC6 A;  1GG3 A;  1WGG A;  2KDF B;  4GN1 A;  3APC A;  2MRP A;  2K1F A;  5CTR C;  2K8H A;  2I1J A;  5IAA C;  2N9X A;  1WE6 A;  3OJ3 A;  2KDB A;  2AWT A;  3JYU A;  1WZ3 A;  3GZN I;  2DZK A;  2W9N A;  2C5L C;  1GC7 A;  1X1M A;  3A1Q A;  3M62 B;  4I6L B;  2KMA A;  3SD5 A;  2KTR B;  3LJ3 A;  3R66 C;  1GUA B;  1R4M I;  2O6V A;  1V81 A;  2L76 A;  2MSE D;  3GOE A;  3NY5 A;  2J7Q B;  4KVG B;  4MJS B;  2JF5 A;  2CS4 A;  2LVP A;  4J6I A;  1H4R A;  2BWF A;  3UIN B;  4K7U A;  3WIM A;  2AL6 A;  4F1S A;  3PRP B;  4PS8 A;  3A9J B;  4I6N B;  3V6C B;  2C7H A;  1V80 A;  4ZRJ A;  1V9J A;  5LLI A;  3PRE A;  1LXD A;  2A4Z A;  3KW5 B;  3QQ8 B;  3RZF A;  1WRD B;  2NBU A;  5GMV A;  1J19 A;  2DAF A;  2CHW A;  2IO3 B;  3KYC D;  2MBB B;  3EEC A;  5JZE B;  3U7D A;  2M1M A;  2EKE C;  4A3O A;  4XX5 A;  3DPD A;  4DHJ B;  2KLG A;  5D6J B;  2DEN B;  4II2 B;  2BWE S;  3JSV B;  3RCZ A;  5DPW A;  2LI5 A;  2D10 A;  2MX2 A;  4GDK A;  4HPM B;  1TGZ B;  4B6W A;  4MJS A;  4WWN A;  4NJ6 A;  3TCA A;  5D7G A;  5G55 A;  1RLF A;  3KH0 A;  1ZKH A;  2GBN A;  4BKT A;  2WDT B;  2ZZP B;  5JHA A;  4KSL C;  3CST A;  4DHZ B;  2NCN A;  4DHJ D;  1P0R A;  1YX5 B;  5JHB A;  4GIV A;  1Z5S B;  3N32 A;  2Z59 B;  3TMP B;  2DYO A;  4W9G A;  1JRU A;  1PQS A;  2KMC A;  3OAW A;  3PTF C;  1WX8 A;  1U4A A;  1GNU A;  1EF1 A;  3ONS A;  2XEW A;  1WJU A;  2OJR A;  3W1S A;  1P1A A;  1RAX A;  2R2O A;  2HD5 B;  3V62 A;  4BBN C;  2J0K A;  2LXA A;  2LAS A;  2BKF A;  4M8M A;  2ZPN A;  3NHE B;  1I35 A;  2M4N A;  5AZG A;  5L83 A;  2DHZ A;  4AOF A;  1WR6 E;  2KJH B;  1NI2 A;  1OGW A;  2KFK B;  1WI0 A;  4IWP A;  3NOB A;  4F7Z A;  3QAR A;  4LJO B;  1WF9 A;  2O2V A;  2MCN B;  2NBV B;  3AUL A;  4HVB A;  3A4S C;  2ZEQ A;  1YX6 B;  2FCQ A;  2UWQ A;  3VH4 B;  4B9K A;  3B0A A;  2KC2 A;  4KIK B;  5TR5 A;  4IWO A;  5E6P A;  3PGE A;  3PS6 A;  4MH0 E;  4P7I A;  1WIA A;  3HM3 A;  1CMX B;  3PZD A;  3TL5 A;  2K25 A;  4CO7 A;  4MGI E;  4G0N B;  2FCN A;  4HDO A;  2K8C A;  2V1Y A;  5AEK B;  4E3C A;  3VUY A;  2JVC A;  4MGZ E;  1WZ0 A;  1E90 A;  2KWU B;  5DCN A;  1E8Y A;  2M0X A;  2EMS A;  2XK5 B;  4NAW B;  2NPT A;  3L08 A;  2I1K A;  4K1R B;  2IBI B;  3PRM B;  2ZVO A;  3V6E B;  2FUH B;  3HIZ A;  2K6Q A;  3R7R A;  2WX1 A;  2KVR A;  4W9J A;  2FCS A;  1Q5W B;  3ZDM C;  1V49 A;  2KDE B;  2N1V A;  3QC8 B;  1RFA A;  2GOW A;  3A1Q B;  2AYO B;  4NJ7 A;  4WQO B;  5CHW A;  2MWS B;  2L0F A;  1OEY J;  2KHW B;  4GU2 A;  3BY4 B;  4KDI C;  4ANW A;  3QHT A;  2J0M A;  2O6V B;  3DBH I;  3U30 A;  1OQY A;  3OJ4 B;  1UGM A;  3L16 A;  3N3K B;  4AJW A;  4KSK C;  3D32 A;  1YIW A;  3KUC B;  5L95 C;  2JRI B;  2N7D A;  2LXC A;  1EF5 A;  4ANV A;  2RSU A;  3P2B A;  1S1Q B;  4GXB A;  2MW5 A;  2KFJ A;  2WX0 A;  2ASQ A;  2O6V D;  1L7Y A;  1P9D U;  4K81 A;  4HCN B;  4EZL A;  4F8C B;  2FNJ B;  3DBL I;  1T0Y A;  1UD7 A;  2LVO A;  4XC2 A;  3VFK A;  2D07 B;  4IG7 B;  4A20 A;  1WFY A;  2YVC A;  3MHS D;  4G3X B;  2V4L A;  1UEL A;  1OTR B;  1E7V A;  2N9P C;  4G50 A;  1D3Z A;  1TTN A;  2LVQ A;  5EDS A;  2KAN A;  4BBN F;  2KLC A;  4GDK B;  3ZNH B;  4BOS C;  4FBJ B;  3DDC B;  3TIX A;  1E8X A;  2BF8 B;  3PSE B;  3ZLZ A;  2MBH A;  1KJT A;  1V2Y A;  2PE6 B;  2JZZ A;  4K7W A;  2JWZ A;  2A5U A;  1OEY A;  2M8S A;  2KX3 A;  2ZCC A;  4FLH A;  3KVF B;  4IWQ A;  3UQB A;  4LDT D;  2C7M B;  4BKG A;  2AL3 A;  3Q3F A;  5IA7 A;  3T8M A;  1WXV A;  3DCG A;  3NZU A;  1LQB A;  3KYD D;  3L10 B;  3ZDT A;  1M94 A;  1LM8 B;  3VUX A;  3EHV A;  2KN5 A;  4GB9 A;  2EMT A;  4JLC A;  1SIF A;  5D2M B;  3DBS A;  1UBI A;  1WGR A;  3ZNG C;  4CYE A;  4EZK A;  1IP9 A;  4W9E A;  2NS5 A;  2JXX A;  1WH3 A;  3QWZ B;  5E6N A;  4W9F A;  4WJQ A;  5J2R A;  2B3A A;  2C9W B;  2DZJ A;  3ML9 A;  5DPS A;  4ZYN A;  4MEL A;  1TBE A;  2L05 A;  3VHT C;  2QHO A;  2O2V B;  2ZNV B;  4NQK E;  1WM3 A;  1IYF A;  2BPS A;  1WGD A;  2LZ6 A;  2AEH A;  2Y5B B;  3PHW B;  3UF8 A;  4RM8 A;  1WJ6 A;  4WWP A;  3BIN A;  2ZCB A;  4WJN A;  5BO4 B;  2MQJ A;  4WAA A;  3SU8 X;  2JUO A;  1YD8 U;  1WYW B;  2C60 A;  4ICV A;  2CKH B;  2LGX A;  3AU5 A;  4ZDV A;  2KO3 A;  3UQA A;  1IPG A;  1EO6 A;  2IY1 B;  3KUZ A;  3ZTD A;  4W9K A;  5CHF A;  2NPT B;  4FJV B;  1E8Z A;  4TQ1 A;  2R2Q A;  1WGY A;  3H1U A;  3UIP B;  3WAP A;  2C7N B;  3DOW A;  2NR2 A;  4M8N A;  3ZNZ B;  2DYB A;  2KZR A;  4LJP B;  3VVW B;  1Q0W B;  1UH6 A;  1UZX B;  3WAL A;  2GBM A;  2JT4 B;  4GMV A;  4WWO A;  4A3P A;  3PVL A;  2GBR A;  4W9H A;  4I6P A;  2LGY A;  4ICU A;  3VQI A;  4BKS A;  4M0W B;  2DAJ A;  4ZRI A;  4DWF A;  1AAR A;  3A9K B;  2PE9 A;  1G6J A;  4OVV A;  3L13 A;  4KZC A;  3W1Y A;  3IHP C;  3VDZ A;  3NS8 A;  2DZI A;  2N7E A;  4WJO A;  5KHO A;  3M3J A;  2K39 A;  1NBF C;  3PPA A;  1J0G A;  3IG3 A;  4FJZ A;  5E6O A;  1C1Y B;  3K9O B;  2L7R A;  3WA0 A;  5KHQ A;  1P3Q U;  2REX A;  3APF A;  2LUE A;  3QAQ A;  3MJW A;  3Q3J A;  1SE9 A;  2CHZ A;  2IO1 B;  2KWV B;  2VRR B;  2G45 B;  3ZRF A;  2UYZ B;  2V3S A;  3V60 A;  4EEW A;  1WY8 A;  2ZJD A;  4IW0 A;  3OLM D;  4XZ4 A;  3LDZ E;  1WR1 A;  2LGD A;  4GGQ A;  2BYV E;  5LXH A;  3A9K A;  3A33 B;  4OVU A;  2YLM A;  3M63 B;  2PJH A;  3H9D A;  3NZS A;  3L17 A;  1Z2M A;  2D2Q A;  2BGF A;  3WAM A;  3A4R A;  3KUD B;  1WXM A;  5AZF A;  2FCM A;  3H7P A;  3V61 A;  3AXC A;  2JPH A;  4W9D A;  4GDL A;  2KTF A;  1YJ1 A;  2CU1 A;  3CSF A;  3DQV A;  4ANU A;  3DVG X;  1WMH B;  2G4D B;  4HWI B;  2WWZ A;  4DDG D;  4W9L A;  2RR9 A;  3H7S A;  4HJK A;  2GMI C;  3ZTC A;  1XD3 B;  3ZVV A;  4NPN A;  3VTV A;  2MA9 B;  3VXW A;  2KOX A;  2MP2 A;  3MTN B;  2K8B A;  3HHM A;  1R4N I;  2RD0 A;  4TQ0 A;  5J18 A;  2FIF A;  2JRH A;  2J0J A;  5D94 A;  4LDT B;  4KDL B;  2MBE A;  1Y8R C;  4MGY E;  4K7S A;  2HE7 A;  2L0T A;  2BKR B;  3K9P B;  4G11 A;  1MG8 A;  3O65 B;  1VD2 A;  4FAD A;  3L54 A;  3R7Q A;  2L8J A;  3ZO5 B;  3DVN U;  3H6N A;  4MEM A;  3IFW B;  4JIO U;  3ALB A;  1WX9 A;  1WMH A;  4DXA B;  4EOY A;  5C23 A;  2N1W A;  3WAN A;  4DHZ E;  1FXT B;  2RGF A;  1SGH A;  3B08 A;  2HTH A;  2IO0 B;  1XT9 B;  2IYD B;  3AU4 A;  1L2N A;  2LJ5 A;  2L00 B;  5JH5 C;  5DPR A;  2KC1 A;  2ZPY A;  2Z0E B;  2KQS A;  1WJ4 A;  3DBR I;  2KK8 A;  4NY0 A;  2KX0 A;  4HPL B;  3IVF A;  4N9F 4;  2CHX A;  5G2N A;  4W9I A;  2KDI A;  3JVZ X;  2KQ7 A;  2N4F A;  3L0W B;  1K8R B;  4AUQ C;  3ZW3 A;  1V6E A;  5HKH A;  2MBQ A;  4LCD E;  3ZNI D;  4YL8 A;  4URK A;  3ML8 A;  4IM3 A;  4B95 A;  4IUM B;  4PS7 A;  3SDL C;  4PYU A;  3PV1 A;  4RMA A;  2KWC A;  3VH3 B;  3QA8 A;  1V5T A;  4TUU A;  3W1S C;  2KTR A;  3VTW A;  1C3T A;  4AP4 C;  3RUI B;  5C1Z A;  4PS3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...