2IY1B

Senp1 (mutant) full length sumo1
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
83
structure length
83
Chain Sequence
EYIKLKVIGQDSSEIHFKVKMTTHLKKLKESYCQRQGVPMNSLRFLFEGQRIADNHTPKELGMEEEDVIEVYQEQTGGHSTVC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/nuclear protein
molecule keywords SENTRIN-SPECIFIC PROTEASE 1
publication title Sumo Protease Senp1 Induces Isomerization of the Scissile Peptide Bond.
pubmed doi rcsb
source organism Homo sapiens
total genus 18
structure length 83
sequence length 83
chains with identical sequence D
ec nomenclature
pdb deposition date 2006-07-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF11976 Rad60-SLD Ubiquitin-2 like Rad60 SUMO-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 2iy1B00
2JY6A 2JPHA 2KN5A 3QJZA 3M63B 2W9NA 2UYZB 3EC8A 3DPDA 1NBFC 2BGFA 5LLIA 3NY5A 2Y5BB 2OJRA 1LM8B 1V6EA 1GC6A 3A4SC 2RSUA 3HK0A 4IM2A 4I6NB 4MEMA 3X0WA 1A5RA 3H7SA 1WMHA 2RR9A 3H6NA 4KDIC 4MGIE 4B9KA 3WANA 3X23A 1WGDA 3D32A 4K7WA 4KIKA 2M4NA 4ZDVA 3O65B 4MDKE 4DBGA 2LD9A 1WRDB 2M17A 2CHWA 1V49A 4NPNA 5LXIB 2K25A 2XBBC 4W9IA 2JZZA 2LGXA 2DYBA 2JRHA 2KK8A 2JF5A 5J17A 2J0MA 3PVLA 2HD5B 1NDDA 2KZRA 2GBJA 3A33B 5C23A 2J0JA 4GB9A 1D3ZA 2LGDA 3VH3B 3W1SA 2JUOA 2KXJA 4WJQA 2DAJA 2PE9A 3PPAA 1E8ZA 1TBEA 2KJ6A 1OQYA 5KHOA 1KM7A 4DDGD 3DVNU 3VXWA 4DHZB 5J2RA 2V4LA 2MBHA 2NVUI 4I6PA 5D2MB 1LXDA 2DX5B 1IP9A 2LVPA 4EZJA 3QARA 3B08A 1VD2A 1Z5SB 3U30A 1WGYA 4FHKA 2FUHB 3QX1A 3VUXA 3SHQA 1ISNA 1V86A 4GU2A 1WX7A 5IAAC 3R7RA 3VH4B 1SE9A 1GNUA 1EF1A 1EUVB 2CHZA 3AI5A 3DBRI 4GN1A 2FCNA 4IM0A 4IWPA 1M94A 1L7YA 4CO7A 3VTUA 3PLUA 3QC8B 4IC7B 2GOWA 2I1JA 1L2NA 3QIJA 4G50A 2BPSA 4GSWA 3UF8A 4PYZA 2K8HA 3ONSA 2RGFA 3ZW3A 2KO3A 5CX3A 3DVGY 1P0RA 2MA9B 4K7UA 2EMTA 3VTWA 4FJYA 1OTRB 1X1MA 2KWCA 5AZHA 2KWVB 3PRPB 1LQBA 3KH0A 1F9JA 2PEAA 2HTHA 2LXCA 4HXDA 4ZRIA 1WZ3A 5G2NA 2LRWA 2JT4B 1YX5B 3RT3B 1J19A 2R2QA 4HPLB 1KOTA 2KTRB 2HJ8A 4BOSC 4HLEA 2O2VA 4X57B 4JIOU 2FIDA 4LJPB 2ZNVC 3UGBB 2KLGA 1OEYA 3DBSA 3RD2A 3TCAA 2IZVB 1EF5A 2KQSA 4ZRJA 3TBLD 4ZRKA 4B95A 2JZ3B 1WXVA 5D7GA 3DBLI 4WAAA 3ZKJC 1MG8A 4JL9A 2NBWB 4BBNF 2LUEA 1WXSA 4ICVA 1P3QU 3PHXB 1FXTB 2D2QA 5E6PA 4IWOA 2AL6A 4ANXA 3C0RB 3N32A 4GDKB 1GC7A 2FCMA 4WWPA 3N30A 4GMVA 4BOZB 4BKSD 3QK0A 3ZNHB 3QQ8B 2VRRB 3B1LX 2IYDB 4K81A 4ZYNA 4DXAB 2K8BA 2N7EA 3SU8X 4RM8A 4OVVA 4W9KA 3APCA 2YVCA 2FCQA 2WX1A 3VUYA 4IW0A 3QWZB 1R4MI 2CS4A 4LDTD 2C5LC 2LI5A 3ZTDA 3W1YA 1WE6A 3GOEA 1JRUA 3ZDTA 3ZIMA 2KDEB 4IUMB 3JVZX 4ANUA 3DDCB 1CMXB 4GOCA 1UBIA 4II2B 2BYFA 2RD0A 2BKFA 2ZCBA 5J18A 2GBKA 4BVUC 2IY0B 1GJZA 3AU4A 4NJ6A 2KDIA 3NOBA 4J6IA 4FLHA 4YL8A 3L17A 3VVWB 4GDKA 1HE8A 2MRPA 2LVQA 2ZPNA 3WIMA 5KHQA 2B3AA 3KUZA 2PPHA 4CHKA 3H7PB 2CHXA 2L05A 4RMAA 3EFUA 1EO6A 2DYOA 3PS6A 2FCSA 4JLCA 3PGEA 2MW5A 4KVGB 4A3OA 4EKUA 3V60A 3EHVA 2KX0A 1WYWB 1WX8A 2KTFA 3PV1A 2DZIA 4PS7A 1V80A 4FULA 1WH3A 2UWQA 5E6NA 4KDLB 2N7DA 3APDA 3I3TB 2BWFA 3JSVA 4FJVB 5C1ZA 2QHOA 4AWJA 3PRZA 2NBVB 1WJNA 3KW5B 4AUQC 3H7PA 1UH6A 4AOFA 1KJTA 2L8JA 4MGKE 2N1VA 2KQ7A 3LJ3A 2K6DB 1E5WA 1P9DU 1OEYJ 3IHPC 1QZEA 3VFKA 3V62A 1WJ6A 2V3SA 4RM9A 3PZDA 3TMPB 2LVOA 4I6LB 2KMAA 2J0KA 1E7VA 2BF8B 3DCGA 2DYMA 4KV2A 4EUTA 3L10B 3QCAA 3KYCD 5CHFA 4JQWC 5CTRC 2LZ6A 4GGQA 2IO2B 2AEHA 2DAFA 4K7SA 1P1AA 2G3QB 2KFJA 3PSEB 2V1YA 2AYOB 3PRMB 4FHJA 2L0FA 2KHWB 3A4RA 4NJ7A 4W9EA 5AZGA 5GMVA 2PJHA 4K1RB 3L08A 1TZ1A 2BYVE 2D11A 3L13A 1KLVA 2LJ5A 2WX0A 2GBRA 2NS5A 2K39A 2L00B 3MJWA 1V9JA 2IBIB 2O2VB 3U8ZA 2KJRA 2ZZPB 4PS8A 2MBQA 5AEKB 4W9CA 4F8CB 3JYUA 2G4DB 2K1FA 2KANA 5D94A 3W1SC 2ZPYA 3EECA 1UBQA 4HCNB 4LDTB 4M0WB 5JZEB 4ANVA 3A9KA 3ZLZA 4E74A 4MM3A 2ZCCA 3ZDMC 3T9LA 4DHJD 1ZGUB 2WWZA 1T0YA 1S3SG 3KVFB 2FAZA 4F7ZA 5L83A 3CF6E 2D10A 3PTFC 2NPTB 1WR1A 4W9JA 3JW0X 4WJPA 1E7UA 1BT0A 3HM6X 2BKRB 4BKSA 2JVCA 3VAWA 3A1QB 3SDLC 3CSTA 1WM3A 2KDBA 2REXA 2ZVOA 3ALBA 4CYEA 4TQ1A 2ZJDA 5E6OA 2Z0DB 1WY8A 4DDID 1R4NI 2JRIB 1SGHA 2KOXA 3WAMA 3BY4B 3QA8A 2NCNA 2C7MB 3A9JB 3R66C 4TUUA 1P98A 2AWTA 2GMIC 1V5TA 4BKTA 4ICUA 3ECIA 4AJWA 5G55A 4HCPB 3HHMA 3AXCA 3KYDD 3ZUNA 2DENB 2MBBB 4NY0A 3NHEB 4KSKC 4P7IA 2LWPA 3PREA 4MJSA 2G4SA 2NPTA 1WGGA 3IVFA 5JH5C 2KJHB 1WM2A 4XX5A 5AZFA 3A1QA 3UQAA 3ZTCA 3P2BA 3VQIA 4TV3A 3BINA 2EKEC 2M1MA 3ZRCA 3DQVA 3WAPA 2DZJA 3WA0A 4HDOA 3IFWB 3ZNGC 1PQSA 1E8WA 1WE7A 2WYQA 3A9JA 2MSED 1RAXA 3JSVB 3L54A 1ZKHA 3T8MA 3K9OB 3H9DA 2C7NB 4W9HA 2KD0A 2ZEQA 1IPGA 1RRBA 2IO3B 2YLMA 1VCBA 2GBNA 3U7DA 3CMMB 3MTNB 4N9F4 1E8YA 2BWES 4HDQA 4A20A 5IA7A 2NBUA 3TJPA 3QAQA 2N1WA 4ASWC 3QHTA 4AJYB 4AP4C 1V81A 2L0TA 1H4RA 3RUIB 5JHAA 1WGHA 1TTNA 3DOWA 4NNJB 4EEWA 4EZKA 1WJ4A 4XZ4A 2O6VD 3HIZA 4WWNA 4A3PA 5DCNA 2MLBA 4B6WA 1K8RB 3ZVVA 2KDFB 3K9PB 1GG3A 2C7HA 3PLVA 1UELA 3WAOA 2KC2A 3OAWA 4W9GA 4DHJB 3WALA 4II3B 1UGMA 2JWZA 5JHBA 1WF9A 2L7RA 4NQLB 4G11A 3VUWA 4XC2A 3M95A 4W9DA 3OJ4B 1NI2A 4BBNC 4EFOA 5HKHA 2A4ZA 2K8CA 2N9XA 3NZUA 4GDLB 5D6JB 1S1QB 2KMCA 2Z0EB 4PS3A 4DWFA 4HPMB 3GZNI 3NS8A 1E8XA 2LXAA 3A9KB 4IM3A 4FN2A 2KC1A 2L3ZA 1U4AA 2BYEA 2DHZA 2KKCA 3AULA 1AARA 4WJNA 3ZNID 1WFYA 3Q3FA 1I42A 1ZW7A 3V61A 2ASQA 3VDZA 2CKHB 1J8CA 2ZNVB 3H1UA 3RCZA 3R3MA 4JGHB 1RLFA 1XD3B 4MELA 5EDSA 2CR5A 4FADA 5BO4B 4DHZE 2JXXA 5LXHA 3OJ3A 2FNJB 4GDLA 4IWQA 4NAWB 1E90A 4E71A 2K6QA 2KLCA 3RZFA 2MBOA 3V6EB 3APFA 1C1YB 3VHTC 2RPQA 3ZRFA 4OVUA 2MQJA 2XK5B 2KX3A 2FIFA 4ANWA 2NR2A 3L0WB 1YIWA 3VTVA 3ZNZB 1V2YA 2DZKA 3DBHI 3UQBA 2EMSA 1RFAA 4MH0E 2GBMA 4KSLC 2C9WB 4F1SA 1WIAA 2KFKB 4MSMB 3IBEA 1Y8RC 2IY1B 2LRUA 4MJSB 2MP2B 2J7QB 1TGZB 1GUAB 3HM3A 2WDTB 1C3TA 2R2OA 4DK5A 3UIPB 2M0XA 3IG3A 2Z59B 2D07B 1YX6B 4WWOA 1WGRA 4KZ0A 1YQBA 4TQ0A 4LJOB 1WXAA 4NAWA 2L76A 2PE6B 3M3JA 4BFRA 1Q5WB 1YD8U 2MWSB 3V6CB 1Z2MA 2KNBA 2A5UA 2XK5A 2O6VB 5DPWA 3UINB 5CHVC 3B0AA 1SIFA 1V5OA 4FA6A 4W9FA 3NZSA 4GIVA 2C60A 5FR6A 4HWIB 4WQOB 2OOBB 3RZWC 3CSFA 3Q3JA 4M8MA 1H8CA 2HE7A 2KFKA 4HVBA 1WZ0A 3PT2B 3ML8A 3R7QA 3M62B 1LFDA 1Q0WB 2MP2A 3RYTA 4W9LA 3S2AA 2D3GA 1WXMA 4PYUA 3UIOB 3AU5A 3KUDB 4G0NB 1WJUA 1WX9A 1G6JA 3N3KB 3MHSD 4E3CA 1I35A 4MGZE 2XEWA 3OLMD 5TR5A 5L95C 2CU1A 4FJZA 1Q1OA 4TKNA 3RULA 3ENEA 2N9PC 3ML9A 5DPRA 4NQKE 2MCNB 1UD7A 2LGYA 2G45B 2O6VA 1OGWA 2DZMA 2M8SA 3TIXA 1WR6E 2N4FA 3KUCB 2KWUB 2I1KA 1XQQA 2KVRA 3ZO5B 2IO1B 3L16A 4EZLA 4BKGA 1J0GA 1WMHB 4IG7B 2KTRA 4G3XB 4HJKA 2ZVNA 4WJOA 4GXBA 2IO0B 3DVGX 3TL5A 4FBJB 4MGYE 5DPSA 1IYFA 4URKA 4M8NA 3LDZE 4KIKB 3PHWB 1YJ1A 2LASA 4EOYA 5DPTA 4KZCA 3SD5A 4HK2A 4MSQB 1WI0A 1XT9B 2MBEA 3DVNV 4LCDE 2N9EB 2MX2A 2AL3A 1UZXB 5CHWA
chains in the Genus database with same CATH superfamily
2JY6A 2KN5A 3QJZA 1CQVA 2BGFA 1FPYA 3GE8C 2M56B 1GC6A 2RSUA 2DNFA 2WXQA 3X0WA 1D5MC 3H7SA 2CJOA 1JWSD 3P4SB 2M4NA 2GRIA 4DQOC 1T0SC 1QILA 4ZDVA 4HEA1 5LXIB 2QMTA 2K25A 4W9IA 2LGXA 2PKOA 2DYBA 3AV8A 2J0MA 3PVLA 1E6EB 2KZRA 3ZQ4A 2J0JA 2WXOA 1D3ZA 2LEKA 3PPAA 4PT5A 1ENFA 1CZPA 2BS4B 1KFYB 4RF1A 3DVNU 1GB4A 5GXGB 3VXWA 4DHZB 4OHJA 2MBHA 2ZW0A 2DX5B 2LVPA 5HHDG 4L1BA 3B08A 1V1PB 1WGYA 3QX1A 3BZDB 1GOZA 5T8IA 3SHQA 5IN7A 4ACFA 1WX7A 3VH4B 3AI5A 1GNUA 1EF1A 3DBRI 1M94A 3AE5B 3VTUA 3PLUA 2GOWA 1RFKA 3AE3B 3Q8FA 3DVGY 1OTRB 3IAM1 2BB6A 1L6UA 3KH0A 1F9JA 3Q8AA 2PEAA 2LXCA 3DBLB 3RNEC 1PYWD 2LRWA 5HG2A 4RGMA 3RT3B 1J19A 2R2QA 1KOTA 2ZNVC 3DWGC 3UGBB 1OEYA 3RD2A 2IZVB 4B95A 1AN8A 1L0XB 5BMIA 3ABVB 4ICVA 2D2QA 4IWOA 2WXHA 4ANXA 2FCMA 3O13A 3BVMA 4ZHOA 2VRRB 2IYDB 4ZYNA 2K8BA 3SU8X 4RM8A 4OVVA 4W9KA 3APCA 2YVCA 1N62A 2WX1A 2WS3B 4IW0A 2UU7A 1XF5L 4O1NA 3AMZA 4M02A 1WE6A 1NI3A 1F2RC 3ZDTA 5G5GA 4ANUA 4II2B 4GOCA 1UBIA 1E10A 5J18A 2GBKA 4BVUC 3BVZA 3AU4A 1PUTA 2KDIA 4FLHA 3UI3A 3L17A 2LVQA 4CHKA 3PS6A 3PGEA 2MW5A 4EKUA 3EHVA 2KX0A 1WX8A 4PS7A 4HRSA 1I4PA 2MH7A 3APDA 3JSVA 1BUIC 3KW5B 3H7PA 1UH6A 4AOFA 5EE1A 1KJTA 2L8JA 4KKIA 2K6DB 1E5WA 1AW7A 1WJ6A 2IGHA 4YXDB 1QOBA 2V3SA 2X38A 4HJGE 3NVVA 1L5PA 2CU3A 1E7VA 4LNIA 3KYCD 2M19A 3NRZA 5CTRC 2LZ6A 4GGQA 2AEHA 1I4XA 2V1YA 4FHJA 4W9EA 2PJHA 3L08A 4N59A 2WX0A 5H8YE 1I4GA 2IBIB 2KJRA 3W1SC 3EECA 2WXPA 1DGJA 4MM3A 1SIJA 4DXGA 5L83A 3CF6E 2D10A 1BT0A 2QJLA 4BKSA 2JX5A 3A1QB 1MHXA 2KDBA 2REXA 3ALBA 1MFWA 4TQ1A 3PO0A 1WY8A 3BY4B 3R66C 1P98A 4A9AA 5G55A 1CK1A 3KYDD 2DENB 4NY0A 1SSNA 4MJSA 2G4SA 5JH5C 2PVOD 4ITKA 4XX5A 2W55A 3ZTCA 3RI7C 4C7YA 1JQ4A 1K51A 3HUIA 1NENB 1L4DB 1WE7A 2WYQA 1TZOA 4N6EB 3JSVB 4RGTA 4XWTA 1WXQA 4MH8A 2KD0A 1VCBA 3PZ8A 2D3AA 3IT4B 4YSZB 3L4PA 3TJPA 4ASWC 4AJYB 4AP4C 3E9SA 5JHAA 4NNJB 1TS3A 5DCNA 2MLBA 1N60A 2KDFB 3K9PB 4C7ZA 4W9GA 4A6QA 4II3B 5AUIA 1UGMA 1EM7A 4YWGG 5JHBA 2L7RA 4NQLB 1ZXHA 4G11A 2AX5A 3M95A 3C8YA 1TKEA 3NVWA 3NZUA 5D6JB 2KMCA 4DWFA 3GZNI 1TT5B 3E56A 3NS8A 1XO3A 4FN2A 1AYFA 1U4AA 4MM3B 2KN4A 4WJNA 3U4EG 3ZNID 3TEYA 3ZJVA 1ZW7A 2ASQA 2CKHB 3N20C 3H1UA 1I4RA 3R3MA 1RLFA 4MELA 4FADA 5BO4B 4KGTA 2INDC 2QIEB 4MACA 4GDLA 3BYYB 4NAWB 2WGSA 3V6EB 2KMMA 2FIFA 1T0QC 3ETRA 3ZNZB 3DBHI 3AE6B 2GBMA 1FNUA 2C9WB 1E0ZA 2KFKB 4MSMB 3IBEA 4MJSB 1QOFA 1PDXA 3DHIC 2J7QB 3UIPB 1B1ZA 3I57A 3VR8B 4AS1A 1EWCA 4RH6A 1HTOA 4LJOB 2LGSA 2MWSB 2KNBA 5DPWA 3UINB 3B0AA 1SIFA 1F2RI 2MJEA 2G9HD 1VLBA 2J53A 4GIVA 2IPKD 5FR6A 3N1XC 2OOBB 4TSSA 1ZXIA 3P4RB 5EE0A 1Q10A 4HVBA 3ML8A 3S2AA 1OFFA 1LO5D 3AU5A 3CWIA 3KLSX 3MHSD 1ZUD2 5TR5A 2INCC 4FJZA 1Q1OA 5DPRA 2N9KA 3AECB 3FILA 1FNVA 4LNKA 1GAQB 1WR6E 2KVRA 1XQQA 3ZO5B 2IO1B 1D5XC 2D3BA 1WMHB 1WGKA 3DWMA 1C4AA 2ZVNA 4GXBA 2IJ0A 2IO0B 3N1YC 4LNNA 4FBJB 4MGYE 5DPSA 3AEBB 3TEXA 4JX1C 4MSQB 1QOGA 1WI0A 1IGCA 2N9EB 1NVID 2W9NA 1NBFC 3HK0A 2X8XX 4OZBA 4MEMA 1P7FA 3H6NA 2RR9A 3I63C 4KDIC 3SFEB 2BTEA 1YN5A 1NYRA 4NJCA 4K7WA 4KIKA 4MDKE 4DBGA 1C78A 1F0ZA 1F1HA 2M17A 2CHWA 2JRHA 2KK8A 2JF5A 2JU6X 2GBJA 1FFVA 5C23A 1Y56A 3ZXVA 3VH3B 2JUOA 2KXJA 4WJQA 1FM0D 2W82A 1E8ZA 4M00A 3DBRB 2V4LA 1L4ZB 1SE4A 4I6PA 1LXDA 1IP9A 1UGJA 3QARA 1P7EA 1AWDA 1A70A 2IGDA 1ISNA 3NG0A 2KVZA 4IWPA 1UWXA 1ZP0B 2KAJA 2I1JA 1L2NA 4G50A 2BPSA 4GSWA 3AEGB 2KO3A 5CX3A 1RYJA 2EMTA 3R2IA 3FILB 4FJYA 2KWCA 3MHZA 2KWVB 1LQBA 2KACA 4S0RA 1WZ3A 4RGOS 4CQNA 1YX5B 3LB8C 1IUEA 2LHEA 2FIDA 1D5ZC 3FKYA 1SJED 3TCAA 2KDMA 2W3RA 2E3TA 2WXIA 1WXVA 2LUEA 3PHXB 3LYYA 3N32A 4C4VB 4TMAB 3QK0A 3B1LX 4K81A 2FCQA 4ARIA 2PLPA 1VR9A 3RPFC 2KDEB 3JVZX 3DDCB 2BYFA 2RD0A 2IY0B 4YL8A 3AE4B 1HE8A 2MRPA 2ZPNA 4RFBA 2DLBA 2PPHA 1C9FA 4RMAA 3EFUA 2G1EA 1EO6A 4KVGB 4A3OA 1DOYA 1E9MA 3PV1A 3TSSA 4FULA 2UWQA 4FJVB 5C1ZA 2XNAC 2H88B 1FCCC 4ARCA 1TKYA 3KWLA 2I38A 2KQ7A 3IHPC 3OG5A 3EA6A 2WHIA 3PZDA 2N7JA 1MG4A 4KV2A 4EUTA 3DCGA 3L10B 3RN9C 1FNWA 2IO2B 4B0EA 2DAFA 4EE2A 3PSEB 1SEBD 3PRMB 2L0FA 2WXFA 1NEKB 1T5XD 2BYVE 5C2TB 1XCQL 2GBRA 3U7ZA 2L00B 3AE1B 4ZOHC 2ZZPB 4PS8A 2MBQA 1FXAA 1QT9A 3HRDD 4W9CA 5AEKB 2WP9B 2G4DB 3RNGC 1KH0A 1UBQA 5EE3A 4HCNB 4LLGM 4ZRQA 3AEAB 3ZLZA 2ZCCA 3T9LA 4ZHPA 1T0YA 1WYGA 3Q14C 1FXIA 4YSYB 1WR1A 3JW0X 3NVZA 3VRBB 2WNMA 2JVCA 4CYEA 5E6OA 1ET9A 4DDID 4XGAB 1R4NI 4MT5A 2JRIB 2JWUA 3WAMA 3QA8A 1FO4A 1R4MB 2AWTA 4AJWA 3AXCA 2M0AA 4P7IA 2LWPA 1TIFA 2KJHB 1WM2A 5HFYA 3A1QA 2VH1A 2PVGC 3BINA 2EKEC 1FFUA 1YOVB 2ZW1A 1YMHE 3GE3C 1C79A 3U2SC 3P4QB 3L54A 2L52A 1ZKHA 1VJKA 2AQ1B 3K9OB 2C7NB 4C80A 4W9HA 3Q8EA 1GPXA 2GBNA 1JMLA 2BWES 3EGRA 2NBUA 4PK1A 1YQ4B 3QAQA 2N1WA 3QHTA 2L0TA 1TTNA 2YEPF 4XZ4A 2O6VD 4WWNA 1BXTA 4HKZE 2BQQA 3ZVVA 1GG3A 3WAOA 3VR9B 4P6VF 3GZNB 1YQ3B 2JWZA 1VZ8A 2Y5CA 3NJTA 1FD6A 1T6BX 3VUWA 3AEFB 4W9DA 3OJ4B 1NI2A 1SB3C 4BBNC 2N9XA 1S1QB 3NUHB 3Q3MC 4PS3A 1XCTL 1E8XA 2LXAA 4IM3A 3U52E 2L3ZA 2BYEA 3AE7B 2KKCA 1WFYA 3V61A 2ZNVB 1K52A 4JPSA 1XD3B 1YN4A 2CR5A 5AUKA 1YJJA 3OJ3A 1SF0A 4E71A 2KLCA 2MBOA 1SE2A 4L23A 1C1YB 4A8XC 4XWWA 1PGXA 2XK5B 4IOIE 5FK9C 1ACCA 1YIWA 2DZKA 1N6ZA 3NS1A 4KSLC 4ZYSA 2LRUA 4XDCA 1VZ6A 3HM3A 3IAS1 2R2OA 2BS3B 1YQBA 3RNCC 1WXAA 3AN1A 1XEEA 4NAWA 3N1ZC 1YD8U 2AQ3B 3VRAB 3HVZA 4OZCA 1YN3A 2A5UA 2O6VB 4JWSC 2IGGA 3FAHA 1ROEA 4FA6A 4W9FA 3NZSA 2C60A 4XDDA 1MHHE 3CSFA 4J3OD 2HE7A 2KFKA 1F77A 1I4QA 3NZ3A 4HKQA 1I7HA 3M62B 1LFDA 4JE3B 2K0PA 4W9LA 3UIOB 1G6JA 1J7CA 1J7AA 1WJUA 1WX9A 5MPOA 3C19A 3OLMD 4YT0B 4TKNA 3ENEA 1CJEA 3ML9A 2LGYA 2V9HA 2G45B 1OGWA 2N4FA 3P1MA 2KWUB 3LXFA 2MEKA 4EZLA 4BKGA 4IG7B 2KTRA 1EU3A 3BIID 4WJOA 3TL5A 5D3DA 4URKA 3LDZE 1JWMD 2R61A 1YJ1A 2LASA 3CIRB 5DPTA 4EOYA 4HK2A 1UUPA 1JCKB 2MX2A 2AL3A 1UZXB 2INNE 1XLQA 2JPHA 3EC8A 2UYZB 3NY5A 2Y5BB 1FRRA 2QEJC 3OWEB 1A5RA 1WMHA 2PIAA 3D32A 1I4HA 3B9JA 5BYRA 2LD9A 1V49A 2XBBC 1TS5A 2JZZA 4LNFA 2HDEA 1NDDA 5IOIA 4GB9A 1BMLC 2LGDA 3MFGA 2DAJA 2PE9A 1PGBA 2KJ6A 5KHOA 4DDGD 2NVUI 2WLBA 4EZJA 1VD2A 3U30A 2FUHB 3RNAC 3VUXA 2D5GA 4GU2A 2HJ1A 5IAAC 3R7RA 1SE9A 1XXGA 2FCNA 2JQRB 4IM0A 3QC8B 2E6XA 2K8HA 3ONSA 3ZW3A 3VTWA 1TKGA 1X1MA 5AZHA 3PRPB 1D6EC 1RWSA 4ZRIA 5G2NA 2WXJA 3BWUD 3I5JC 4HPLB 1M4VA 2KTRB 2HJ8A 4HLEA 4X57B 4LJPB 3DBSA 3AE8B 2L83A 2MJ3A 1N63A 4ZRJA 4ZRKA 3W5UB 5D7GA 4WAAA 1MG8A 2NBWB 4BBNF 1WXSA 2KT7A 2J4XA 1P3QU 4REZA 2AL6A 2L1AA 4GDKB 1HXYD 1GC7A 3MP9A 3N30A 4GMVA 4BOZB 2IDYA 3QQ8B 1E7PB 4DXAB 1IGDA 2V0GA 2OHFA 2CS4A 4LDTD 2AQ2B 4A90A 3W1YA 1JRUA 5FR3A 2GB1A 5JXVA 4IUMB 1CMXB 2BKFA 4IKGA 1GJZA 4K3CA 4NJ6A 5H92C 3NOBA 4J6IA 1WWTA 4C4VA 2B3AA 2RDHA 2NTTA 3KUZA 4KGSA 5TSSA 2L05A 1V8CA 3NVYA 3Q3OC 2DYOA 2WU2B 5BMHA 1HEZE 1MI0A 1DYQA 3V60A 2LGIA 2KTFA 1ET6A 2MJDA 5HI1A 5IO9A 2BWFA 2QHOA 4AWJA 2NBVB 1WJNA 2ACZB 1MVKA 4AQ7A 1RM6C 2N1VA 1P9DU 1OEYJ 4YSXB 4RM9A 4HPPA 1WRIA 4I6LB 2KMAA 2J0KA 4KKJA 2DYMA 4XE0A 2WQYB 5CHFA 4JQWC 3AE2B 4K7SA 2KFJA 2AYOB 2KHWB 3A4RA 1C4PA 5GMVA 4K1RB 3L13A 3ZXRA 2LJ5A 2JZPA 2NS5A 1V9JA 4F8CB 1YJIA 2GI9A 5D94A 2ZPYA 5I4DA 1WSPA 3RFZB 4LDTB 4M0WB 2L32A 4ANVA 3A9KA 1TYGB 2MHJA 2PW9A 3RNBC 4DHJD 1SJHD 1ZGUB 2WWZA 3KVFB 4N58A 2FAZA 1R4NB 1TJEA 1L6VA 4OW0A 2NPTB 4W9JA 1TS2A 1JROA 1QF6A 2ZVOA 5C3JB 1ZPSA 2J42A 2Z0DB 1PGAA 3Q3NC 1HTQA 3TUOA 1SGHA 2KOXA 2NCNA 2C7MB 3A9JB 4TUUA 2GMIC 4ICUA 2QSDA 2RDBC 4OZAA 4KSKC 1JWUD 2K9XA 3PREA 1JALA 5IKCM 1WGGA 3IVFA 4RNAA 5AZFA 3UQAA 1HQRD 2V3NA 3AH7A 1TS4A 3W9CB 4TV3A 2N0SB 3WAPA 3WA0A 4WWMA 4WAFA 4HDOA 2LUMA 1PQSA 2FE8A 1RAXA 1UF0A 5BYSA 1UWMA 3DHGC 3SEBA 2KWDA 4USAA 3CMMB 3MTNB 1E8YA 4HDQA 4A20A 4KGRA 4JWUC 4EZKA 4EEWA 1FRDA 4C56C 3HIZA 1FCLA 4B6WA 2C7HA 3PLVA 2KYWA 2YEPB 4DHJB 3WALA 5BMGA 3W5VB 1K50A 4EFOA 5HKHA 2A4ZA 2K8CA 4C00A 4FXCA 2LMCA 4HPMB 2VH2A 3A9KB 2DHZA 1AARA 3PZ7A 4US8A 3VDZA 1VZ7A 3BK2A 1J8CA 3RCZA 4JGHB 2HTME 3DHHC 2WU5B 2QCZA 3KQ4A 4DHZE 3BVGA 2JXXA 3P63A 5LXHA 4IWQA 2K6QA 3RZFA 1XLPA 3VHTC 3ZRFA 4OVUA 2ON8A 4K3BA 3Q8CA 2WDVB 4ANWA 2NR2A 3T3OA 2BS2B 3VTVA 1V2YA 3Q8BA 1RFAA 4F1SA 1WIAA 2IY1B 2RDGA 2MP2B 1F52A 1QLBB 1GUAB 1C3TA 1JWBD 2M0XA 1STEA 3IG3A 2Z59B 2D07B 4WQMA 1WGRA 4KZ0A 4TQ0A 2L76A 3M3JA 4BFRA 1VRAB 3V6CB 2D3CA 2JYEA 2XK5A 3AEEB 3TEZA 2V3PA 1V5OA 1V1OA 4HWIB 4WQOB 2K3UA 3Q3JA 4NZLB 1WZ0A 3PT2B 3R7QA 2D3GA 2EELA 1WXMA 4PYUA 3KUDB 3N3KB 4E3CA 3Q6BA 3MC9A 2N9PC 2Z8LA 3N9YC 3R8BA 1IBXB 3MJ5A 3I9V1 2O6VA 3TIXA 2DZMA 1TY2A 4HJKA 2K5PA 3DVGX 2WXKA 1IYFA 4M8NA 2Y5PA 2WXLA 2J52A 3SD5A 4KZCA 4P16A 1XT9B 2GLSA 1T0RC 2Y3AA 2QC8A 3J9CA 4HROA 5CHWA 3M63B 4KX6B 2I2YA 3DPDA 5LLIA 2OJRA 1LM8B 1V6EA 2ONQA 4IM2A 3A4SC 2JXTA 4I6NB 1ZOYB 4D2KA 4MGIE 3IXSA 1ESFA 4B9KA 3WANA 3X23A 1WGDA 1GB1A 1KLGD 2INPE 2JSVX 4B0MA 3O65B 4GLSC 1WRDB 2WDQB 4NPNA 1SBBB 4P1BC 5J17A 2HD5B 1DOIA 2SEBD 2VZKD 3A33B 4XYCA 3W1SA 1N61A 2RPVA 3DBHB 1TBEA 1OQYA 2CJNA 1L0VB 1KM7A 5J2RA 2W54A 5D2MB 3B2FA 3H8HA 1ZDXA 1Z5SB 1KLUD 1R7SA 4FHKA 4RCOA 1V86A 4YTMB 2CHZA 1EUVB 2NMQA 4GN1A 1B9RA 4CO7A 1L7YA 4IC7B 1D4BA 3QIJA 1JW9D 4IDIA 4WIPA 3UF8A 2OJWA 4PYZA 2RGFA 3V3XA 1OQQA 1P0RA 2BW2A 2MA9B 2BBCA 4DXFA 4K7UA 2EKIA 4RGNA 2HTHA 4HXDA 2JT4B 3RMKC 4LTUA 4BOSC 2O2VA 4JIOU 3ZJUA 1ZE3D 2KLGA 1FEHA 1EF5A 2KQSA 3TBLD 2JZ3B 3DBLI 3ZKJC 4JL9A 1FXTB 5E6PA 3C0RB 4WWPA 5BYQA 1HZ5A 4BKSD 3ZNHB 1J7BA 2N7EA 2VZKB 1JRPA 3B2GA 3VUYA 3QWZB 2BVCA 1R4MI 2C5LC 2LI5A 3ZTDA 3GOEA 3ZIMA 1T3QA 2DBYA 2WXMA 2PTLA 2ZCBA 1SXTA 2H89B 3VVWB 4GDKA 3WIMA 5KHQA 3H7PB 2CHXA 2WXRA 4YTPB 3P42A 2FCSA 4JLCA 1PFDA 5D3IB 1WYWB 2DZIA 1V80A 1DOXA 1YNTE 2LFIA 1WH3A 1LGRA 5E6NA 1NYQA 4KDLB 2KQ4X 2N7DA 3ZYYX 3I3TB 2LJIA 3PRZA 3GP7A 4AUQC 2BT6A 4MGKE 3LJ3A 1QZEA 3VFKA 3V62A 5EE9A 1JWAD 5E6JA 3TMPB 3HVDA 2LVOA 2BF8B 3GS2A 3QCAA 1KF6B 2BYTA 2K22A 3IT6B 3AEDB 1P1AA 2G3QB 1N5XA 2ICIA 4LK0M 4NJ7A 5AZGA 3AM9A 1TZ1A 2D11A 1KLVA 2K39A 3MJWA 2O2VB 3U8ZA 1KTKA 2XN9C 3JYUA 2QDFA 2V4IB 2KANA 2K1FA 2RMMA 4UDUC 5JZEB 2WXGA 3URYA 4E74A 1C76A 3ZDMC 3ZJTA 1S3SG 4F7ZA 2BB5A 1TY0A 1FIQA 3PTFC 4WJPA 1E7UA 3HM6X 1MJDA 2BKRB 1MPEA 3W2DA 3VAWA 3SDLC 1FMAD 3CSTA 1WM3A 2ZJDA 2SAKA 1N5WA 4M0WA 3MC8A 4H2AA 4P1CC 1V5TA 4BKTA 3ECIA 2NTSA 4HCPB 3HHMA 3ZUNA 2MBBB 3NHEB 2NPTA 1EU4A 1C77A 2FUG1 3P2BA 4Q2JA 3VQIA 1HZ6A 2M1MA 3ZRCA 3DQVA 4BZAA 2DZJA 3IFWB 1HA5A 3ZNGC 1E8WA 3A9JA 2MSED 3T8MA 4LNOA 4QAYA 3H9DA 2ZEQA 1IPGA 1RRBA 3FC4A 2IO3B 2YLMA 3U7DA 1QQRA 4N9F4 5IA7A 1C4CA 3EFCA 3WCQA 1V81A 5LNK1 1H4RA 3RUIB 1WGHA 1KRHA 3DOWA 1L0YB 1WJ4A 4A3PA 1K8RB 1UELA 2KC2A 3OAWA 3Q2AC 1OQRA 1WF9A 1V97A 4XC2A 3Q69A 2OEDA 3AB5A 4BAXA 4GDLB 4ZRPA 1VDVA 2Z0EB 3T3NA 2WDRB 3V05A 2KC1A 2W3SA 3AULA 3Q3FA 1I42A 2N9LA 3P4PB 1QKZA 5EDSA 3R2TA 5FKAC 2FBWB 2FNJB 3BYTB 1QOAA 1E90A 1K53A 1XLOA 3APFA 4S17A 3SR6A 2RPQA 4L2YA 5G5HA 2MQJA 4WURA 2KX3A 3L0WB 4OVZA 3UQBA 2EMSA 4MH0E 4YTNB 2QILA 1Y8RC 3MC0B 1TGZB 2WDTB 2JYTA 4DK5A 3AE9B 1YX6B 4WWOA 2Q5WD 3KWVA 1SE3A 2PE6B 1Q5WB 3GB1A 3SFDB 1Z2MA 5CHVC 4US9A 1V1PA 4WH4A 3RZWC 4M8MA 4A55A 1H8CA 1UNSA 1Q0WB 2MP2A 3RYTA 1EWYC 2LHDA 4G0NB 4RF0A 1I35A 3EUB2 4MGZE 2XEWA 5L95C 1XLNA 2CU1A 2B76B 3BK1A 3RULA 4NQKE 2MCNB 1UD7A 2WXNA 4NAMA 3RNFC 2PMVA 4M01A 2M8SA 3KUCB 2I1KA 3TEWA 3L16A 1J0GA 3ZGZA 4G3XB 2TSSA 5IP4D 4KIKB 3PHWB 2MBEA 3DVNV 1ZDVA 4LCDE 2DWQA 4R3DA 1IBXA
chains in the Genus database with same CATH topology
2JY6A 2JPHA 2KN5A 3QJZA 3M63B 2W9NA 2UYZB 3EC8A 3DPDA 1NBFC 2BGFA 5LLIA 3NY5A 2Y5BB 2OJRA 1LM8B 1V6EA 1GC6A 3A4SC 2RSUA 3HK0A 4IM2A 4I6NB 4MEMA 3X0WA 1A5RA 3H7SA 1WMHA 2RR9A 3H6NA 4KDIC 4MGIE 4B9KA 3WANA 3X23A 1WGDA 3D32A 4K7WA 4KIKA 2M4NA 4ZDVA 3O65B 4MDKE 4DBGA 2LD9A 1WRDB 2M17A 2CHWA 1V49A 4NPNA 5LXIB 2K25A 2XBBC 4W9IA 2JZZA 2LGXA 2DYBA 2JRHA 2KK8A 2JF5A 5J17A 2J0MA 3PVLA 2HD5B 1NDDA 2KZRA 2GBJA 3A33B 5C23A 2J0JA 4GB9A 1D3ZA 2LGDA 3VH3B 3W1SA 2JUOA 2KXJA 4WJQA 2DAJA 2PE9A 3PPAA 1E8ZA 1TBEA 2KJ6A 1OQYA 5KHOA 1KM7A 4DDGD 3DVNU 3VXWA 4DHZB 5J2RA 2V4LA 2MBHA 2NVUI 4I6PA 5D2MB 1LXDA 2DX5B 1IP9A 2LVPA 4EZJA 3QARA 3B08A 1VD2A 1Z5SB 3U30A 1WGYA 4FHKA 2FUHB 3QX1A 3VUXA 3SHQA 1ISNA 1V86A 4GU2A 1WX7A 5IAAC 3R7RA 3VH4B 1SE9A 1GNUA 1EF1A 1EUVB 2CHZA 3AI5A 3DBRI 4GN1A 2FCNA 4IM0A 4IWPA 1M94A 1L7YA 4CO7A 3VTUA 3PLUA 3QC8B 4IC7B 2GOWA 2I1JA 1L2NA 3QIJA 4G50A 2BPSA 4GSWA 3UF8A 4PYZA 2K8HA 3ONSA 2RGFA 3ZW3A 2KO3A 5CX3A 3DVGY 1P0RA 2MA9B 4K7UA 2EMTA 3VTWA 4FJYA 1OTRB 1X1MA 2KWCA 5AZHA 2KWVB 3PRPB 1LQBA 3KH0A 1F9JA 2PEAA 2HTHA 2LXCA 4HXDA 4ZRIA 1WZ3A 5G2NA 2LRWA 2JT4B 1YX5B 3RT3B 1J19A 2R2QA 4HPLB 1KOTA 2KTRB 2HJ8A 4BOSC 4HLEA 2O2VA 4X57B 4JIOU 2FIDA 4LJPB 2ZNVC 3UGBB 2KLGA 1OEYA 3DBSA 3RD2A 3TCAA 2IZVB 1EF5A 2KQSA 4ZRJA 3TBLD 4ZRKA 4B95A 2JZ3B 1WXVA 5D7GA 3DBLI 4WAAA 3ZKJC 1MG8A 4JL9A 2NBWB 4BBNF 2LUEA 1WXSA 4ICVA 1P3QU 3PHXB 1FXTB 2D2QA 5E6PA 4IWOA 2AL6A 4ANXA 3C0RB 3N32A 4GDKB 1GC7A 2FCMA 4WWPA 3N30A 4GMVA 4BOZB 4BKSD 3QK0A 3ZNHB 3QQ8B 2VRRB 3B1LX 2IYDB 4K81A 4ZYNA 4DXAB 2K8BA 2N7EA 3SU8X 4RM8A 4OVVA 4W9KA 3APCA 2YVCA 2FCQA 2WX1A 3VUYA 4IW0A 3QWZB 1R4MI 2CS4A 4LDTD 2C5LC 2LI5A 3ZTDA 3W1YA 1WE6A 3GOEA 1JRUA 3ZDTA 3ZIMA 2KDEB 4IUMB 3JVZX 4ANUA 3DDCB 1CMXB 4GOCA 1UBIA 4II2B 2BYFA 2RD0A 2BKFA 2ZCBA 5J18A 2GBKA 4BVUC 2IY0B 1GJZA 3AU4A 4NJ6A 2KDIA 3NOBA 4J6IA 4FLHA 4YL8A 3L17A 3VVWB 4GDKA 1HE8A 2MRPA 2LVQA 2ZPNA 3WIMA 5KHQA 2B3AA 3KUZA 2PPHA 4CHKA 3H7PB 2CHXA 2L05A 4RMAA 3EFUA 1EO6A 2DYOA 3PS6A 2FCSA 4JLCA 3PGEA 2MW5A 4KVGB 4A3OA 4EKUA 3V60A 3EHVA 2KX0A 1WYWB 1WX8A 2KTFA 3PV1A 2DZIA 4PS7A 1V80A 4FULA 1WH3A 2UWQA 5E6NA 4KDLB 2N7DA 3APDA 3I3TB 2BWFA 3JSVA 4FJVB 5C1ZA 2QHOA 4AWJA 3PRZA 2NBVB 1WJNA 3KW5B 4AUQC 3H7PA 1UH6A 4AOFA 1KJTA 2L8JA 4MGKE 2N1VA 2KQ7A 3LJ3A 2K6DB 1E5WA 1P9DU 1OEYJ 3IHPC 1QZEA 3VFKA 3V62A 1WJ6A 2V3SA 4RM9A 3PZDA 3TMPB 2LVOA 4I6LB 2KMAA 2J0KA 1E7VA 2BF8B 3DCGA 2DYMA 4KV2A 4EUTA 3L10B 3QCAA 3KYCD 5CHFA 4JQWC 5CTRC 2LZ6A 4GGQA 2IO2B 2AEHA 2DAFA 4K7SA 1P1AA 2G3QB 2KFJA 3PSEB 2V1YA 2AYOB 3PRMB 4FHJA 2L0FA 2KHWB 3A4RA 4NJ7A 4W9EA 5AZGA 5GMVA 2PJHA 4K1RB 3L08A 1TZ1A 2BYVE 2D11A 3L13A 1KLVA 2LJ5A 2WX0A 2GBRA 2NS5A 2K39A 2L00B 3MJWA 1V9JA 2IBIB 2O2VB 3U8ZA 2KJRA 2ZZPB 4PS8A 2MBQA 5AEKB 4W9CA 4F8CB 3JYUA 2G4DB 2K1FA 2KANA 5D94A 3W1SC 2ZPYA 3EECA 1UBQA 4HCNB 4LDTB 4M0WB 5JZEB 4ANVA 3A9KA 3ZLZA 4E74A 4MM3A 2ZCCA 3ZDMC 3T9LA 4DHJD 1ZGUB 2WWZA 1T0YA 1S3SG 3KVFB 2FAZA 4F7ZA 5L83A 3CF6E 2D10A 3PTFC 2NPTB 1WR1A 4W9JA 3JW0X 4WJPA 1E7UA 1BT0A 3HM6X 2BKRB 4BKSA 2JVCA 3VAWA 3A1QB 3SDLC 3CSTA 1WM3A 2KDBA 2REXA 2ZVOA 3ALBA 4CYEA 4TQ1A 2ZJDA 5E6OA 2Z0DB 1WY8A 4DDID 1R4NI 2JRIB 1SGHA 2KOXA 3WAMA 3BY4B 3QA8A 2NCNA 2C7MB 3A9JB 3R66C 4TUUA 1P98A 2AWTA 2GMIC 1V5TA 4BKTA 4ICUA 3ECIA 4AJWA 5G55A 4HCPB 3HHMA 3AXCA 3KYDD 3ZUNA 2DENB 2MBBB 4NY0A 3NHEB 4KSKC 4P7IA 2LWPA 3PREA 4MJSA 2G4SA 2NPTA 1WGGA 3IVFA 5JH5C 2KJHB 1WM2A 4XX5A 5AZFA 3A1QA 3UQAA 3ZTCA 3P2BA 3VQIA 4TV3A 3BINA 2EKEC 2M1MA 3ZRCA 3DQVA 3WAPA 2DZJA 3WA0A 4HDOA 3IFWB 3ZNGC 1PQSA 1E8WA 1WE7A 2WYQA 3A9JA 2MSED 1RAXA 3JSVB 3L54A 1ZKHA 3T8MA 3K9OB 3H9DA 2C7NB 4W9HA 2KD0A 2ZEQA 1IPGA 1RRBA 2IO3B 2YLMA 1VCBA 2GBNA 3U7DA 3CMMB 3MTNB 4N9F4 1E8YA 2BWES 4HDQA 4A20A 5IA7A 2NBUA 3TJPA 3QAQA 2N1WA 4ASWC 3QHTA 4AJYB 4AP4C 1V81A 2L0TA 1H4RA 3RUIB 5JHAA 1WGHA 1TTNA 3DOWA 4NNJB 4EEWA 4EZKA 1WJ4A 4XZ4A 2O6VD 3HIZA 4WWNA 4A3PA 5DCNA 2MLBA 4B6WA 1K8RB 3ZVVA 2KDFB 3K9PB 1GG3A 2C7HA 3PLVA 1UELA 3WAOA 2KC2A 3OAWA 4W9GA 4DHJB 3WALA 4II3B 1UGMA 2JWZA 5JHBA 1WF9A 2L7RA 4NQLB 4G11A 3VUWA 4XC2A 3M95A 4W9DA 3OJ4B 1NI2A 4BBNC 4EFOA 5HKHA 2A4ZA 2K8CA 2N9XA 3NZUA 4GDLB 5D6JB 1S1QB 2KMCA 2Z0EB 4PS3A 4DWFA 4HPMB 3GZNI 3NS8A 1E8XA 2LXAA 3A9KB 4IM3A 4FN2A 2KC1A 2L3ZA 1U4AA 2BYEA 2DHZA 2KKCA 3AULA 1AARA 4WJNA 3ZNID 1WFYA 3Q3FA 1I42A 1ZW7A 3V61A 2ASQA 3VDZA 2CKHB 1J8CA 2ZNVB 3H1UA 3RCZA 3R3MA 4JGHB 1RLFA 1XD3B 4MELA 5EDSA 2CR5A 4FADA 5BO4B 4DHZE 2JXXA 5LXHA 3OJ3A 2FNJB 4GDLA 4IWQA 4NAWB 1E90A 4E71A 2K6QA 2KLCA 3RZFA 2MBOA 3V6EB 3APFA 1C1YB 3VHTC 2RPQA 3ZRFA 4OVUA 2MQJA 2XK5B 2KX3A 2FIFA 4ANWA 2NR2A 3L0WB 1YIWA 3VTVA 3ZNZB 1V2YA 2DZKA 3DBHI 3UQBA 2EMSA 1RFAA 4MH0E 2GBMA 4KSLC 2C9WB 4F1SA 1WIAA 2KFKB 4MSMB 3IBEA 1Y8RC 2IY1B 2LRUA 4MJSB 2MP2B 2J7QB 1TGZB 1GUAB 3HM3A 2WDTB 1C3TA 2R2OA 4DK5A 3UIPB 2M0XA 3IG3A 2Z59B 2D07B 1YX6B 4WWOA 1WGRA 4KZ0A 1YQBA 4TQ0A 4LJOB 1WXAA 4NAWA 2L76A 2PE6B 3M3JA 4BFRA 1Q5WB 1YD8U 2MWSB 3V6CB 1Z2MA 2KNBA 2A5UA 2XK5A 2O6VB 5DPWA 3UINB 5CHVC 3B0AA 1SIFA 1V5OA 4FA6A 4W9FA 3NZSA 4GIVA 2C60A 5FR6A 4HWIB 4WQOB 2OOBB 3RZWC 3CSFA 3Q3JA 4M8MA 1H8CA 2HE7A 2KFKA 4HVBA 1WZ0A 3PT2B 3ML8A 3R7QA 3M62B 1LFDA 1Q0WB 2MP2A 3RYTA 4W9LA 3S2AA 2D3GA 1WXMA 4PYUA 3UIOB 3AU5A 3KUDB 4G0NB 1WJUA 1WX9A 1G6JA 3N3KB 3MHSD 4E3CA 1I35A 4MGZE 2XEWA 3OLMD 5TR5A 5L95C 2CU1A 4FJZA 1Q1OA 4TKNA 3RULA 3ENEA 2N9PC 3ML9A 5DPRA 4NQKE 2MCNB 1UD7A 2LGYA 2G45B 2O6VA 1OGWA 2DZMA 2M8SA 3TIXA 1WR6E 2N4FA 3KUCB 2KWUB 2I1KA 1XQQA 2KVRA 3ZO5B 2IO1B 3L16A 4EZLA 4BKGA 1J0GA 1WMHB 4IG7B 2KTRA 4G3XB 4HJKA 2ZVNA 4WJOA 4GXBA 2IO0B 3DVGX 3TL5A 4FBJB 4MGYE 5DPSA 1IYFA 4URKA 4M8NA 3LDZE 4KIKB 3PHWB 1YJ1A 2LASA 4EOYA 5DPTA 4KZCA 3SD5A 4HK2A 4MSQB 1WI0A 1XT9B 2MBEA 3DVNV 4LCDE 2N9EB 2MX2A 2AL3A 1UZXB 5CHWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2JY6 A;  2JPH A;  2KN5 A;  3QJZ A;  3M63 B;  2W9N A;  2UYZ B;  3EC8 A;  3DPD A;  1NBF C;  2BGF A;  5LLI A;  3NY5 A;  2Y5B B;  2OJR A;  1LM8 B;  1V6E A;  1GC6 A;  3A4S C;  2RSU A;  3HK0 A;  4IM2 A;  4I6N B;  4MEM A;  3X0W A;  1A5R A;  3H7S A;  1WMH A;  2RR9 A;  3H6N A;  4KDI C;  4MGI E;  4B9K A;  3WAN A;  3X23 A;  1WGD A;  3D32 A;  4K7W A;  4KIK A;  2M4N A;  4ZDV A;  3O65 B;  4MDK E;  4DBG A;  2LD9 A;  1WRD B;  2M17 A;  2CHW A;  1V49 A;  4NPN A;  5LXI B;  2K25 A;  2XBB C;  4W9I A;  2JZZ A;  2LGX A;  2DYB A;  2JRH A;  2KK8 A;  2JF5 A;  5J17 A;  2J0M A;  3PVL A;  2HD5 B;  1NDD A;  2KZR A;  2GBJ A;  3A33 B;  5C23 A;  2J0J A;  4GB9 A;  1D3Z A;  2LGD A;  3VH3 B;  3W1S A;  2JUO A;  2KXJ A;  4WJQ A;  2DAJ A;  2PE9 A;  3PPA A;  1E8Z A;  1TBE A;  2KJ6 A;  1OQY A;  5KHO A;  1KM7 A;  4DDG D;  3DVN U;  3VXW A;  4DHZ B;  5J2R A;  2V4L A;  2MBH A;  2NVU I;  4I6P A;  5D2M B;  1LXD A;  2DX5 B;  1IP9 A;  2LVP A;  4EZJ A;  3QAR A;  3B08 A;  1VD2 A;  1Z5S B;  3U30 A;  1WGY A;  4FHK A;  2FUH B;  3QX1 A;  3VUX A;  3SHQ A;  1ISN A;  1V86 A;  4GU2 A;  1WX7 A;  5IAA C;  3R7R A;  3VH4 B;  1SE9 A;  1GNU A;  1EF1 A;  1EUV B;  2CHZ A;  3AI5 A;  3DBR I;  4GN1 A;  2FCN A;  4IM0 A;  4IWP A;  1M94 A;  1L7Y A;  4CO7 A;  3VTU A;  3PLU A;  3QC8 B;  4IC7 B;  2GOW A;  2I1J A;  1L2N A;  3QIJ A;  4G50 A;  2BPS A;  4GSW A;  3UF8 A;  4PYZ A;  2K8H A;  3ONS A;  2RGF A;  3ZW3 A;  2KO3 A;  5CX3 A;  3DVG Y;  1P0R A;  2MA9 B;  4K7U A;  2EMT A;  3VTW A;  4FJY A;  1OTR B;  1X1M A;  2KWC A;  5AZH A;  2KWV B;  3PRP B;  1LQB A;  3KH0 A;  1F9J A;  2PEA A;  2HTH A;  2LXC A;  4HXD A;  4ZRI A;  1WZ3 A;  5G2N A;  2LRW A;  2JT4 B;  1YX5 B;  3RT3 B;  1J19 A;  2R2Q A;  4HPL B;  1KOT A;  2KTR B;  2HJ8 A;  4BOS C;  4HLE A;  2O2V A;  4X57 B;  4JIO U;  2FID A;  4LJP B;  2ZNV C;  3UGB B;  2KLG A;  1OEY A;  3DBS A;  3RD2 A;  3TCA A;  2IZV B;  1EF5 A;  2KQS A;  4ZRJ A;  3TBL D;  4ZRK A;  4B95 A;  2JZ3 B;  1WXV A;  5D7G A;  3DBL I;  4WAA A;  3ZKJ C;  1MG8 A;  4JL9 A;  2NBW B;  4BBN F;  2LUE A;  1WXS A;  4ICV A;  1P3Q U;  3PHX B;  1FXT B;  2D2Q A;  5E6P A;  4IWO A;  2AL6 A;  4ANX A;  3C0R B;  3N32 A;  4GDK B;  1GC7 A;  2FCM A;  4WWP A;  3N30 A;  4GMV A;  4BOZ B;  4BKS D;  3QK0 A;  3ZNH B;  3QQ8 B;  2VRR B;  3B1L X;  2IYD B;  4K81 A;  4ZYN A;  4DXA B;  2K8B A;  2N7E A;  3SU8 X;  4RM8 A;  4OVV A;  4W9K A;  3APC A;  2YVC A;  2FCQ A;  2WX1 A;  3VUY A;  4IW0 A;  3QWZ B;  1R4M I;  2CS4 A;  4LDT D;  2C5L C;  2LI5 A;  3ZTD A;  3W1Y A;  1WE6 A;  3GOE A;  1JRU A;  3ZDT A;  3ZIM A;  2KDE B;  4IUM B;  3JVZ X;  4ANU A;  3DDC B;  1CMX B;  4GOC A;  1UBI A;  4II2 B;  2BYF A;  2RD0 A;  2BKF A;  2ZCB A;  5J18 A;  2GBK A;  4BVU C;  2IY0 B;  1GJZ A;  3AU4 A;  4NJ6 A;  2KDI A;  3NOB A;  4J6I A;  4FLH A;  4YL8 A;  3L17 A;  3VVW B;  4GDK A;  1HE8 A;  2MRP A;  2LVQ A;  2ZPN A;  3WIM A;  5KHQ A;  2B3A A;  3KUZ A;  2PPH A;  4CHK A;  3H7P B;  2CHX A;  2L05 A;  4RMA A;  3EFU A;  1EO6 A;  2DYO A;  3PS6 A;  2FCS A;  4JLC A;  3PGE A;  2MW5 A;  4KVG B;  4A3O A;  4EKU A;  3V60 A;  3EHV A;  2KX0 A;  1WYW B;  1WX8 A;  2KTF A;  3PV1 A;  2DZI A;  4PS7 A;  1V80 A;  4FUL A;  1WH3 A;  2UWQ A;  5E6N A;  4KDL B;  2N7D A;  3APD A;  3I3T B;  2BWF A;  3JSV A;  4FJV B;  5C1Z A;  2QHO A;  4AWJ A;  3PRZ A;  2NBV B;  1WJN A;  3KW5 B;  4AUQ C;  3H7P A;  1UH6 A;  4AOF A;  1KJT A;  2L8J A;  4MGK E;  2N1V A;  2KQ7 A;  3LJ3 A;  2K6D B;  1E5W A;  1P9D U;  1OEY J;  3IHP C;  1QZE A;  3VFK A;  3V62 A;  1WJ6 A;  2V3S A;  4RM9 A;  3PZD A;  3TMP B;  2LVO A;  4I6L B;  2KMA A;  2J0K A;  1E7V A;  2BF8 B;  3DCG A;  2DYM A;  4KV2 A;  4EUT A;  3L10 B;  3QCA A;  3KYC D;  5CHF A;  4JQW C;  5CTR C;  2LZ6 A;  4GGQ A;  2IO2 B;  2AEH A;  2DAF A;  4K7S A;  1P1A A;  2G3Q B;  2KFJ A;  3PSE B;  2V1Y A;  2AYO B;  3PRM B;  4FHJ A;  2L0F A;  2KHW B;  3A4R A;  4NJ7 A;  4W9E A;  5AZG A;  5GMV A;  2PJH A;  4K1R B;  3L08 A;  1TZ1 A;  2BYV E;  2D11 A;  3L13 A;  1KLV A;  2LJ5 A;  2WX0 A;  2GBR A;  2NS5 A;  2K39 A;  2L00 B;  3MJW A;  1V9J A;  2IBI B;  2O2V B;  3U8Z A;  2KJR A;  2ZZP B;  4PS8 A;  2MBQ A;  5AEK B;  4W9C A;  4F8C B;  3JYU A;  2G4D B;  2K1F A;  2KAN A;  5D94 A;  3W1S C;  2ZPY A;  3EEC A;  1UBQ A;  4HCN B;  4LDT B;  4M0W B;  5JZE B;  4ANV A;  3A9K A;  3ZLZ A;  4E74 A;  4MM3 A;  2ZCC A;  3ZDM C;  3T9L A;  4DHJ D;  1ZGU B;  2WWZ A;  1T0Y A;  1S3S G;  3KVF B;  2FAZ A;  4F7Z A;  5L83 A;  3CF6 E;  2D10 A;  3PTF C;  2NPT B;  1WR1 A;  4W9J A;  3JW0 X;  4WJP A;  1E7U A;  1BT0 A;  3HM6 X;  2BKR B;  4BKS A;  2JVC A;  3VAW A;  3A1Q B;  3SDL C;  3CST A;  1WM3 A;  2KDB A;  2REX A;  2ZVO A;  3ALB A;  4CYE A;  4TQ1 A;  2ZJD A;  5E6O A;  2Z0D B;  1WY8 A;  4DDI D;  1R4N I;  2JRI B;  1SGH A;  2KOX A;  3WAM A;  3BY4 B;  3QA8 A;  2NCN A;  2C7M B;  3A9J B;  3R66 C;  4TUU A;  1P98 A;  2AWT A;  2GMI C;  1V5T A;  4BKT A;  4ICU A;  3ECI A;  4AJW A;  5G55 A;  4HCP B;  3HHM A;  3AXC A;  3KYD D;  3ZUN A;  2DEN B;  2MBB B;  4NY0 A;  3NHE B;  4KSK C;  4P7I A;  2LWP A;  3PRE A;  4MJS A;  2G4S A;  2NPT A;  1WGG A;  3IVF A;  5JH5 C;  2KJH B;  1WM2 A;  4XX5 A;  5AZF A;  3A1Q A;  3UQA A;  3ZTC A;  3P2B A;  3VQI A;  4TV3 A;  3BIN A;  2EKE C;  2M1M A;  3ZRC A;  3DQV A;  3WAP A;  2DZJ A;  3WA0 A;  4HDO A;  3IFW B;  3ZNG C;  1PQS A;  1E8W A;  1WE7 A;  2WYQ A;  3A9J A;  2MSE D;  1RAX A;  3JSV B;  3L54 A;  1ZKH A;  3T8M A;  3K9O B;  3H9D A;  2C7N B;  4W9H A;  2KD0 A;  2ZEQ A;  1IPG A;  1RRB A;  2IO3 B;  2YLM A;  1VCB A;  2GBN A;  3U7D A;  3CMM B;  3MTN B;  4N9F 4;  1E8Y A;  2BWE S;  4HDQ A;  4A20 A;  5IA7 A;  2NBU A;  3TJP A;  3QAQ A;  2N1W A;  4ASW C;  3QHT A;  4AJY B;  4AP4 C;  1V81 A;  2L0T A;  1H4R A;  3RUI B;  5JHA A;  1WGH A;  1TTN A;  3DOW A;  4NNJ B;  4EEW A;  4EZK A;  1WJ4 A;  4XZ4 A;  2O6V D;  3HIZ A;  4WWN A;  4A3P A;  5DCN A;  2MLB A;  4B6W A;  1K8R B;  3ZVV A;  2KDF B;  3K9P B;  1GG3 A;  2C7H A;  3PLV A;  1UEL A;  3WAO A;  2KC2 A;  3OAW A;  4W9G A;  4DHJ B;  3WAL A;  4II3 B;  1UGM A;  2JWZ A;  5JHB A;  1WF9 A;  2L7R A;  4NQL B;  4G11 A;  3VUW A;  4XC2 A;  3M95 A;  4W9D A;  3OJ4 B;  1NI2 A;  4BBN C;  4EFO A;  5HKH A;  2A4Z A;  2K8C A;  2N9X A;  3NZU A;  4GDL B;  5D6J B;  1S1Q B;  2KMC A;  2Z0E B;  4PS3 A;  4DWF A;  4HPM B;  3GZN I;  3NS8 A;  1E8X A;  2LXA A;  3A9K B;  4IM3 A;  4FN2 A;  2KC1 A;  2L3Z A;  1U4A A;  2BYE A;  2DHZ A;  2KKC A;  3AUL A;  1AAR A;  4WJN A;  3ZNI D;  1WFY A;  3Q3F A;  1I42 A;  1ZW7 A;  3V61 A;  2ASQ A;  3VDZ A;  2CKH B;  1J8C A;  2ZNV B;  3H1U A;  3RCZ A;  3R3M A;  4JGH B;  1RLF A;  1XD3 B;  4MEL A;  5EDS A;  2CR5 A;  4FAD A;  5BO4 B;  4DHZ E;  2JXX A;  5LXH A;  3OJ3 A;  2FNJ B;  4GDL A;  4IWQ A;  4NAW B;  1E90 A;  4E71 A;  2K6Q A;  2KLC A;  3RZF A;  2MBO A;  3V6E B;  3APF A;  1C1Y B;  3VHT C;  2RPQ A;  3ZRF A;  4OVU A;  2MQJ A;  2XK5 B;  2KX3 A;  2FIF A;  4ANW A;  2NR2 A;  3L0W B;  1YIW A;  3VTV A;  3ZNZ B;  1V2Y A;  2DZK A;  3DBH I;  3UQB A;  2EMS A;  1RFA A;  4MH0 E;  2GBM A;  4KSL C;  2C9W B;  4F1S A;  1WIA A;  2KFK B;  4MSM B;  3IBE A;  1Y8R C;  2IY1 B;  2LRU A;  4MJS B;  2MP2 B;  2J7Q B;  1TGZ B;  1GUA B;  3HM3 A;  2WDT B;  1C3T A;  2R2O A;  4DK5 A;  3UIP B;  2M0X A;  3IG3 A;  2Z59 B;  2D07 B;  1YX6 B;  4WWO A;  1WGR A;  4KZ0 A;  1YQB A;  4TQ0 A;  4LJO B;  1WXA A;  4NAW A;  2L76 A;  2PE6 B;  3M3J A;  4BFR A;  1Q5W B;  1YD8 U;  2MWS B;  3V6C B;  1Z2M A;  2KNB A;  2A5U A;  2XK5 A;  2O6V B;  5DPW A;  3UIN B;  5CHV C;  3B0A A;  1SIF A;  1V5O A;  4FA6 A;  4W9F A;  3NZS A;  4GIV A;  2C60 A;  5FR6 A;  4HWI B;  4WQO B;  2OOB B;  3RZW C;  3CSF A;  3Q3J A;  4M8M A;  1H8C A;  2HE7 A;  2KFK A;  4HVB A;  1WZ0 A;  3PT2 B;  3ML8 A;  3R7Q A;  3M62 B;  1LFD A;  1Q0W B;  2MP2 A;  3RYT A;  4W9L A;  3S2A A;  2D3G A;  1WXM A;  4PYU A;  3UIO B;  3AU5 A;  3KUD B;  4G0N B;  1WJU A;  1WX9 A;  1G6J A;  3N3K B;  3MHS D;  4E3C A;  1I35 A;  4MGZ E;  2XEW A;  3OLM D;  5TR5 A;  5L95 C;  2CU1 A;  4FJZ A;  1Q1O A;  4TKN A;  3RUL A;  3ENE A;  2N9P C;  3ML9 A;  5DPR A;  4NQK E;  2MCN B;  1UD7 A;  2LGY A;  2G45 B;  2O6V A;  1OGW A;  2DZM A;  2M8S A;  3TIX A;  1WR6 E;  2N4F A;  3KUC B;  2KWU B;  2I1K A;  1XQQ A;  2KVR A;  3ZO5 B;  2IO1 B;  3L16 A;  4EZL A;  4BKG A;  1J0G A;  1WMH B;  4IG7 B;  2KTR A;  4G3X B;  4HJK A;  2ZVN A;  4WJO A;  4GXB A;  2IO0 B;  3DVG X;  3TL5 A;  4FBJ B;  4MGY E;  5DPS A;  1IYF A;  4URK A;  4M8N A;  3LDZ E;  4KIK B;  3PHW B;  1YJ1 A;  2LAS A;  4EOY A;  5DPT A;  4KZC A;  3SD5 A;  4HK2 A;  4MSQ B;  1WI0 A;  1XT9 B;  2MBE A;  3DVN V;  4LCD E;  2N9E B;  2MX2 A;  2AL3 A;  1UZX B;  5CHW A; 
#chains in the Genus database with same CATH topology
 2JY6 A;  2KN5 A;  3QJZ A;  1CQV A;  2BGF A;  1FPY A;  3GE8 C;  2M56 B;  1GC6 A;  2RSU A;  2DNF A;  2WXQ A;  3X0W A;  1D5M C;  3H7S A;  2CJO A;  1JWS D;  3P4S B;  2M4N A;  2GRI A;  4DQO C;  1T0S C;  1QIL A;  4ZDV A;  4HEA 1;  5LXI B;  2QMT A;  2K25 A;  4W9I A;  2LGX A;  2PKO A;  2DYB A;  3AV8 A;  2J0M A;  3PVL A;  1E6E B;  2KZR A;  3ZQ4 A;  2J0J A;  2WXO A;  1D3Z A;  2LEK A;  3PPA A;  4PT5 A;  1ENF A;  1CZP A;  2BS4 B;  1KFY B;  4RF1 A;  3DVN U;  1GB4 A;  5GXG B;  3VXW A;  4DHZ B;  4OHJ A;  2MBH A;  2ZW0 A;  2DX5 B;  2LVP A;  5HHD G;  4L1B A;  3B08 A;  1V1P B;  1WGY A;  3QX1 A;  3BZD B;  1GOZ A;  5T8I A;  3SHQ A;  5IN7 A;  4ACF A;  1WX7 A;  3VH4 B;  3AI5 A;  1GNU A;  1EF1 A;  3DBR I;  1M94 A;  3AE5 B;  3VTU A;  3PLU A;  2GOW A;  1RFK A;  3AE3 B;  3Q8F A;  3DVG Y;  1OTR B;  3IAM 1;  2BB6 A;  1L6U A;  3KH0 A;  1F9J A;  3Q8A A;  2PEA A;  2LXC A;  3DBL B;  3RNE C;  1PYW D;  2LRW A;  5HG2 A;  4RGM A;  3RT3 B;  1J19 A;  2R2Q A;  1KOT A;  2ZNV C;  3DWG C;  3UGB B;  1OEY A;  3RD2 A;  2IZV B;  4B95 A;  1AN8 A;  1L0X B;  5BMI A;  3ABV B;  4ICV A;  2D2Q A;  4IWO A;  2WXH A;  4ANX A;  2FCM A;  3O13 A;  3BVM A;  4ZHO A;  2VRR B;  2IYD B;  4ZYN A;  2K8B A;  3SU8 X;  4RM8 A;  4OVV A;  4W9K A;  3APC A;  2YVC A;  1N62 A;  2WX1 A;  2WS3 B;  4IW0 A;  2UU7 A;  1XF5 L;  4O1N A;  3AMZ A;  4M02 A;  1WE6 A;  1NI3 A;  1F2R C;  3ZDT A;  5G5G A;  4ANU A;  4II2 B;  4GOC A;  1UBI A;  1E10 A;  5J18 A;  2GBK A;  4BVU C;  3BVZ A;  3AU4 A;  1PUT A;  2KDI A;  4FLH A;  3UI3 A;  3L17 A;  2LVQ A;  4CHK A;  3PS6 A;  3PGE A;  2MW5 A;  4EKU A;  3EHV A;  2KX0 A;  1WX8 A;  4PS7 A;  4HRS A;  1I4P A;  2MH7 A;  3APD A;  3JSV A;  1BUI C;  3KW5 B;  3H7P A;  1UH6 A;  4AOF A;  5EE1 A;  1KJT A;  2L8J A;  4KKI A;  2K6D B;  1E5W A;  1AW7 A;  1WJ6 A;  2IGH A;  4YXD B;  1QOB A;  2V3S A;  2X38 A;  4HJG E;  3NVV A;  1L5P A;  2CU3 A;  1E7V A;  4LNI A;  3KYC D;  2M19 A;  3NRZ A;  5CTR C;  2LZ6 A;  4GGQ A;  2AEH A;  1I4X A;  2V1Y A;  4FHJ A;  4W9E A;  2PJH A;  3L08 A;  4N59 A;  2WX0 A;  5H8Y E;  1I4G A;  2IBI B;  2KJR A;  3W1S C;  3EEC A;  2WXP A;  1DGJ A;  4MM3 A;  1SIJ A;  4DXG A;  5L83 A;  3CF6 E;  2D10 A;  1BT0 A;  2QJL A;  4BKS A;  2JX5 A;  3A1Q B;  1MHX A;  2KDB A;  2REX A;  3ALB A;  1MFW A;  4TQ1 A;  3PO0 A;  1WY8 A;  3BY4 B;  3R66 C;  1P98 A;  4A9A A;  5G55 A;  1CK1 A;  3KYD D;  2DEN B;  4NY0 A;  1SSN A;  4MJS A;  2G4S A;  5JH5 C;  2PVO D;  4ITK A;  4XX5 A;  2W55 A;  3ZTC A;  3RI7 C;  4C7Y A;  1JQ4 A;  1K51 A;  3HUI A;  1NEN B;  1L4D B;  1WE7 A;  2WYQ A;  1TZO A;  4N6E B;  3JSV B;  4RGT A;  4XWT A;  1WXQ A;  4MH8 A;  2KD0 A;  1VCB A;  3PZ8 A;  2D3A A;  3IT4 B;  4YSZ B;  3L4P A;  3TJP A;  4ASW C;  4AJY B;  4AP4 C;  3E9S A;  5JHA A;  4NNJ B;  1TS3 A;  5DCN A;  2MLB A;  1N60 A;  2KDF B;  3K9P B;  4C7Z A;  4W9G A;  4A6Q A;  4II3 B;  5AUI A;  1UGM A;  1EM7 A;  4YWG G;  5JHB A;  2L7R A;  4NQL B;  1ZXH A;  4G11 A;  2AX5 A;  3M95 A;  3C8Y A;  1TKE A;  3NVW A;  3NZU A;  5D6J B;  2KMC A;  4DWF A;  3GZN I;  1TT5 B;  3E56 A;  3NS8 A;  1XO3 A;  4FN2 A;  1AYF A;  1U4A A;  4MM3 B;  2KN4 A;  4WJN A;  3U4E G;  3ZNI D;  3TEY A;  3ZJV A;  1ZW7 A;  2ASQ A;  2CKH B;  3N20 C;  3H1U A;  1I4R A;  3R3M A;  1RLF A;  4MEL A;  4FAD A;  5BO4 B;  4KGT A;  2IND C;  2QIE B;  4MAC A;  4GDL A;  3BYY B;  4NAW B;  2WGS A;  3V6E B;  2KMM A;  2FIF A;  1T0Q C;  3ETR A;  3ZNZ B;  3DBH I;  3AE6 B;  2GBM A;  1FNU A;  2C9W B;  1E0Z A;  2KFK B;  4MSM B;  3IBE A;  4MJS B;  1QOF A;  1PDX A;  3DHI C;  2J7Q B;  3UIP B;  1B1Z A;  3I57 A;  3VR8 B;  4AS1 A;  1EWC A;  4RH6 A;  1HTO A;  4LJO B;  2LGS A;  2MWS B;  2KNB A;  5DPW A;  3UIN B;  3B0A A;  1SIF A;  1F2R I;  2MJE A;  2G9H D;  1VLB A;  2J53 A;  4GIV A;  2IPK D;  5FR6 A;  3N1X C;  2OOB B;  4TSS A;  1ZXI A;  3P4R B;  5EE0 A;  1Q10 A;  4HVB A;  3ML8 A;  3S2A A;  1OFF A;  1LO5 D;  3AU5 A;  3CWI A;  3KLS X;  3MHS D;  1ZUD 2;  5TR5 A;  2INC C;  4FJZ A;  1Q1O A;  5DPR A;  2N9K A;  3AEC B;  3FIL A;  1FNV A;  4LNK A;  1GAQ B;  1WR6 E;  2KVR A;  1XQQ A;  3ZO5 B;  2IO1 B;  1D5X C;  2D3B A;  1WMH B;  1WGK A;  3DWM A;  1C4A A;  2ZVN A;  4GXB A;  2IJ0 A;  2IO0 B;  3N1Y C;  4LNN A;  4FBJ B;  4MGY E;  5DPS A;  3AEB B;  3TEX A;  4JX1 C;  4MSQ B;  1QOG A;  1WI0 A;  1IGC A;  2N9E B;  1NVI D;  2W9N A;  1NBF C;  3HK0 A;  2X8X X;  4OZB A;  4MEM A;  1P7F A;  3H6N A;  2RR9 A;  3I63 C;  4KDI C;  3SFE B;  2BTE A;  1YN5 A;  1NYR A;  4NJC A;  4K7W A;  4KIK A;  4MDK E;  4DBG A;  1C78 A;  1F0Z A;  1F1H A;  2M17 A;  2CHW A;  2JRH A;  2KK8 A;  2JF5 A;  2JU6 X;  2GBJ A;  1FFV A;  5C23 A;  1Y56 A;  3ZXV A;  3VH3 B;  2JUO A;  2KXJ A;  4WJQ A;  1FM0 D;  2W82 A;  1E8Z A;  4M00 A;  3DBR B;  2V4L A;  1L4Z B;  1SE4 A;  4I6P A;  1LXD A;  1IP9 A;  1UGJ A;  3QAR A;  1P7E A;  1AWD A;  1A70 A;  2IGD A;  1ISN A;  3NG0 A;  2KVZ A;  4IWP A;  1UWX A;  1ZP0 B;  2KAJ A;  2I1J A;  1L2N A;  4G50 A;  2BPS A;  4GSW A;  3AEG B;  2KO3 A;  5CX3 A;  1RYJ A;  2EMT A;  3R2I A;  3FIL B;  4FJY A;  2KWC A;  3MHZ A;  2KWV B;  1LQB A;  2KAC A;  4S0R A;  1WZ3 A;  4RGO S;  4CQN A;  1YX5 B;  3LB8 C;  1IUE A;  2LHE A;  2FID A;  1D5Z C;  3FKY A;  1SJE D;  3TCA A;  2KDM A;  2W3R A;  2E3T A;  2WXI A;  1WXV A;  2LUE A;  3PHX B;  3LYY A;  3N32 A;  4C4V B;  4TMA B;  3QK0 A;  3B1L X;  4K81 A;  2FCQ A;  4ARI A;  2PLP A;  1VR9 A;  3RPF C;  2KDE B;  3JVZ X;  3DDC B;  2BYF A;  2RD0 A;  2IY0 B;  4YL8 A;  3AE4 B;  1HE8 A;  2MRP A;  2ZPN A;  4RFB A;  2DLB A;  2PPH A;  1C9F A;  4RMA A;  3EFU A;  2G1E A;  1EO6 A;  4KVG B;  4A3O A;  1DOY A;  1E9M A;  3PV1 A;  3TSS A;  4FUL A;  2UWQ A;  4FJV B;  5C1Z A;  2XNA C;  2H88 B;  1FCC C;  4ARC A;  1TKY A;  3KWL A;  2I38 A;  2KQ7 A;  3IHP C;  3OG5 A;  3EA6 A;  2WHI A;  3PZD A;  2N7J A;  1MG4 A;  4KV2 A;  4EUT A;  3DCG A;  3L10 B;  3RN9 C;  1FNW A;  2IO2 B;  4B0E A;  2DAF A;  4EE2 A;  3PSE B;  1SEB D;  3PRM B;  2L0F A;  2WXF A;  1NEK B;  1T5X D;  2BYV E;  5C2T B;  1XCQ L;  2GBR A;  3U7Z A;  2L00 B;  3AE1 B;  4ZOH C;  2ZZP B;  4PS8 A;  2MBQ A;  1FXA A;  1QT9 A;  3HRD D;  4W9C A;  5AEK B;  2WP9 B;  2G4D B;  3RNG C;  1KH0 A;  1UBQ A;  5EE3 A;  4HCN B;  4LLG M;  4ZRQ A;  3AEA B;  3ZLZ A;  2ZCC A;  3T9L A;  4ZHP A;  1T0Y A;  1WYG A;  3Q14 C;  1FXI A;  4YSY B;  1WR1 A;  3JW0 X;  3NVZ A;  3VRB B;  2WNM A;  2JVC A;  4CYE A;  5E6O A;  1ET9 A;  4DDI D;  4XGA B;  1R4N I;  4MT5 A;  2JRI B;  2JWU A;  3WAM A;  3QA8 A;  1FO4 A;  1R4M B;  2AWT A;  4AJW A;  3AXC A;  2M0A A;  4P7I A;  2LWP A;  1TIF A;  2KJH B;  1WM2 A;  5HFY A;  3A1Q A;  2VH1 A;  2PVG C;  3BIN A;  2EKE C;  1FFU A;  1YOV B;  2ZW1 A;  1YMH E;  3GE3 C;  1C79 A;  3U2S C;  3P4Q B;  3L54 A;  2L52 A;  1ZKH A;  1VJK A;  2AQ1 B;  3K9O B;  2C7N B;  4C80 A;  4W9H A;  3Q8E A;  1GPX A;  2GBN A;  1JML A;  2BWE S;  3EGR A;  2NBU A;  4PK1 A;  1YQ4 B;  3QAQ A;  2N1W A;  3QHT A;  2L0T A;  1TTN A;  2YEP F;  4XZ4 A;  2O6V D;  4WWN A;  1BXT A;  4HKZ E;  2BQQ A;  3ZVV A;  1GG3 A;  3WAO A;  3VR9 B;  4P6V F;  3GZN B;  1YQ3 B;  2JWZ A;  1VZ8 A;  2Y5C A;  3NJT A;  1FD6 A;  1T6B X;  3VUW A;  3AEF B;  4W9D A;  3OJ4 B;  1NI2 A;  1SB3 C;  4BBN C;  2N9X A;  1S1Q B;  3NUH B;  3Q3M C;  4PS3 A;  1XCT L;  1E8X A;  2LXA A;  4IM3 A;  3U52 E;  2L3Z A;  2BYE A;  3AE7 B;  2KKC A;  1WFY A;  3V61 A;  2ZNV B;  1K52 A;  4JPS A;  1XD3 B;  1YN4 A;  2CR5 A;  5AUK A;  1YJJ A;  3OJ3 A;  1SF0 A;  4E71 A;  2KLC A;  2MBO A;  1SE2 A;  4L23 A;  1C1Y B;  4A8X C;  4XWW A;  1PGX A;  2XK5 B;  4IOI E;  5FK9 C;  1ACC A;  1YIW A;  2DZK A;  1N6Z A;  3NS1 A;  4KSL C;  4ZYS A;  2LRU A;  4XDC A;  1VZ6 A;  3HM3 A;  3IAS 1;  2R2O A;  2BS3 B;  1YQB A;  3RNC C;  1WXA A;  3AN1 A;  1XEE A;  4NAW A;  3N1Z C;  1YD8 U;  2AQ3 B;  3VRA B;  3HVZ A;  4OZC A;  1YN3 A;  2A5U A;  2O6V B;  4JWS C;  2IGG A;  3FAH A;  1ROE A;  4FA6 A;  4W9F A;  3NZS A;  2C60 A;  4XDD A;  1MHH E;  3CSF A;  4J3O D;  2HE7 A;  2KFK A;  1F77 A;  1I4Q A;  3NZ3 A;  4HKQ A;  1I7H A;  3M62 B;  1LFD A;  4JE3 B;  2K0P A;  4W9L A;  3UIO B;  1G6J A;  1J7C A;  1J7A A;  1WJU A;  1WX9 A;  5MPO A;  3C19 A;  3OLM D;  4YT0 B;  4TKN A;  3ENE A;  1CJE A;  3ML9 A;  2LGY A;  2V9H A;  2G45 B;  1OGW A;  2N4F A;  3P1M A;  2KWU B;  3LXF A;  2MEK A;  4EZL A;  4BKG A;  4IG7 B;  2KTR A;  1EU3 A;  3BII D;  4WJO A;  3TL5 A;  5D3D A;  4URK A;  3LDZ E;  1JWM D;  2R61 A;  1YJ1 A;  2LAS A;  3CIR B;  5DPT A;  4EOY A;  4HK2 A;  1UUP A;  1JCK B;  2MX2 A;  2AL3 A;  1UZX B;  2INN E;  1XLQ A;  2JPH A;  3EC8 A;  2UYZ B;  3NY5 A;  2Y5B B;  1FRR A;  2QEJ C;  3OWE B;  1A5R A;  1WMH A;  2PIA A;  3D32 A;  1I4H A;  3B9J A;  5BYR A;  2LD9 A;  1V49 A;  2XBB C;  1TS5 A;  2JZZ A;  4LNF A;  2HDE A;  1NDD A;  5IOI A;  4GB9 A;  1BML C;  2LGD A;  3MFG A;  2DAJ A;  2PE9 A;  1PGB A;  2KJ6 A;  5KHO A;  4DDG D;  2NVU I;  2WLB A;  4EZJ A;  1VD2 A;  3U30 A;  2FUH B;  3RNA C;  3VUX A;  2D5G A;  4GU2 A;  2HJ1 A;  5IAA C;  3R7R A;  1SE9 A;  1XXG A;  2FCN A;  2JQR B;  4IM0 A;  3QC8 B;  2E6X A;  2K8H A;  3ONS A;  3ZW3 A;  3VTW A;  1TKG A;  1X1M A;  5AZH A;  3PRP B;  1D6E C;  1RWS A;  4ZRI A;  5G2N A;  2WXJ A;  3BWU D;  3I5J C;  4HPL B;  1M4V A;  2KTR B;  2HJ8 A;  4HLE A;  4X57 B;  4LJP B;  3DBS A;  3AE8 B;  2L83 A;  2MJ3 A;  1N63 A;  4ZRJ A;  4ZRK A;  3W5U B;  5D7G A;  4WAA A;  1MG8 A;  2NBW B;  4BBN F;  1WXS A;  2KT7 A;  2J4X A;  1P3Q U;  4REZ A;  2AL6 A;  2L1A A;  4GDK B;  1HXY D;  1GC7 A;  3MP9 A;  3N30 A;  4GMV A;  4BOZ B;  2IDY A;  3QQ8 B;  1E7P B;  4DXA B;  1IGD A;  2V0G A;  2OHF A;  2CS4 A;  4LDT D;  2AQ2 B;  4A90 A;  3W1Y A;  1JRU A;  5FR3 A;  2GB1 A;  5JXV A;  4IUM B;  1CMX B;  2BKF A;  4IKG A;  1GJZ A;  4K3C A;  4NJ6 A;  5H92 C;  3NOB A;  4J6I A;  1WWT A;  4C4V A;  2B3A A;  2RDH A;  2NTT A;  3KUZ A;  4KGS A;  5TSS A;  2L05 A;  1V8C A;  3NVY A;  3Q3O C;  2DYO A;  2WU2 B;  5BMH A;  1HEZ E;  1MI0 A;  1DYQ A;  3V60 A;  2LGI A;  2KTF A;  1ET6 A;  2MJD A;  5HI1 A;  5IO9 A;  2BWF A;  2QHO A;  4AWJ A;  2NBV B;  1WJN A;  2ACZ B;  1MVK A;  4AQ7 A;  1RM6 C;  2N1V A;  1P9D U;  1OEY J;  4YSX B;  4RM9 A;  4HPP A;  1WRI A;  4I6L B;  2KMA A;  2J0K A;  4KKJ A;  2DYM A;  4XE0 A;  2WQY B;  5CHF A;  4JQW C;  3AE2 B;  4K7S A;  2KFJ A;  2AYO B;  2KHW B;  3A4R A;  1C4P A;  5GMV A;  4K1R B;  3L13 A;  3ZXR A;  2LJ5 A;  2JZP A;  2NS5 A;  1V9J A;  4F8C B;  1YJI A;  2GI9 A;  5D94 A;  2ZPY A;  5I4D A;  1WSP A;  3RFZ B;  4LDT B;  4M0W B;  2L32 A;  4ANV A;  3A9K A;  1TYG B;  2MHJ A;  2PW9 A;  3RNB C;  4DHJ D;  1SJH D;  1ZGU B;  2WWZ A;  3KVF B;  4N58 A;  2FAZ A;  1R4N B;  1TJE A;  1L6V A;  4OW0 A;  2NPT B;  4W9J A;  1TS2 A;  1JRO A;  1QF6 A;  2ZVO A;  5C3J B;  1ZPS A;  2J42 A;  2Z0D B;  1PGA A;  3Q3N C;  1HTQ A;  3TUO A;  1SGH A;  2KOX A;  2NCN A;  2C7M B;  3A9J B;  4TUU A;  2GMI C;  4ICU A;  2QSD A;  2RDB C;  4OZA A;  4KSK C;  1JWU D;  2K9X A;  3PRE A;  1JAL A;  5IKC M;  1WGG A;  3IVF A;  4RNA A;  5AZF A;  3UQA A;  1HQR D;  2V3N A;  3AH7 A;  1TS4 A;  3W9C B;  4TV3 A;  2N0S B;  3WAP A;  3WA0 A;  4WWM A;  4WAF A;  4HDO A;  2LUM A;  1PQS A;  2FE8 A;  1RAX A;  1UF0 A;  5BYS A;  1UWM A;  3DHG C;  3SEB A;  2KWD A;  4USA A;  3CMM B;  3MTN B;  1E8Y A;  4HDQ A;  4A20 A;  4KGR A;  4JWU C;  4EZK A;  4EEW A;  1FRD A;  4C56 C;  3HIZ A;  1FCL A;  4B6W A;  2C7H A;  3PLV A;  2KYW A;  2YEP B;  4DHJ B;  3WAL A;  5BMG A;  3W5V B;  1K50 A;  4EFO A;  5HKH A;  2A4Z A;  2K8C A;  4C00 A;  4FXC A;  2LMC A;  4HPM B;  2VH2 A;  3A9K B;  2DHZ A;  1AAR A;  3PZ7 A;  4US8 A;  3VDZ A;  1VZ7 A;  3BK2 A;  1J8C A;  3RCZ A;  4JGH B;  2HTM E;  3DHH C;  2WU5 B;  2QCZ A;  3KQ4 A;  4DHZ E;  3BVG A;  2JXX A;  3P63 A;  5LXH A;  4IWQ A;  2K6Q A;  3RZF A;  1XLP A;  3VHT C;  3ZRF A;  4OVU A;  2ON8 A;  4K3B A;  3Q8C A;  2WDV B;  4ANW A;  2NR2 A;  3T3O A;  2BS2 B;  3VTV A;  1V2Y A;  3Q8B A;  1RFA A;  4F1S A;  1WIA A;  2IY1 B;  2RDG A;  2MP2 B;  1F52 A;  1QLB B;  1GUA B;  1C3T A;  1JWB D;  2M0X A;  1STE A;  3IG3 A;  2Z59 B;  2D07 B;  4WQM A;  1WGR A;  4KZ0 A;  4TQ0 A;  2L76 A;  3M3J A;  4BFR A;  1VRA B;  3V6C B;  2D3C A;  2JYE A;  2XK5 A;  3AEE B;  3TEZ A;  2V3P A;  1V5O A;  1V1O A;  4HWI B;  4WQO B;  2K3U A;  3Q3J A;  4NZL B;  1WZ0 A;  3PT2 B;  3R7Q A;  2D3G A;  2EEL A;  1WXM A;  4PYU A;  3KUD B;  3N3K B;  4E3C A;  3Q6B A;  3MC9 A;  2N9P C;  2Z8L A;  3N9Y C;  3R8B A;  1IBX B;  3MJ5 A;  3I9V 1;  2O6V A;  3TIX A;  2DZM A;  1TY2 A;  4HJK A;  2K5P A;  3DVG X;  2WXK A;  1IYF A;  4M8N A;  2Y5P A;  2WXL A;  2J52 A;  3SD5 A;  4KZC A;  4P16 A;  1XT9 B;  2GLS A;  1T0R C;  2Y3A A;  2QC8 A;  3J9C A;  4HRO A;  5CHW A;  3M63 B;  4KX6 B;  2I2Y A;  3DPD A;  5LLI A;  2OJR A;  1LM8 B;  1V6E A;  2ONQ A;  4IM2 A;  3A4S C;  2JXT A;  4I6N B;  1ZOY B;  4D2K A;  4MGI E;  3IXS A;  1ESF A;  4B9K A;  3WAN A;  3X23 A;  1WGD A;  1GB1 A;  1KLG D;  2INP E;  2JSV X;  4B0M A;  3O65 B;  4GLS C;  1WRD B;  2WDQ B;  4NPN A;  1SBB B;  4P1B C;  5J17 A;  2HD5 B;  1DOI A;  2SEB D;  2VZK D;  3A33 B;  4XYC A;  3W1S A;  1N61 A;  2RPV A;  3DBH B;  1TBE A;  1OQY A;  2CJN A;  1L0V B;  1KM7 A;  5J2R A;  2W54 A;  5D2M B;  3B2F A;  3H8H A;  1ZDX A;  1Z5S B;  1KLU D;  1R7S A;  4FHK A;  4RCO A;  1V86 A;  4YTM B;  2CHZ A;  1EUV B;  2NMQ A;  4GN1 A;  1B9R A;  4CO7 A;  1L7Y A;  4IC7 B;  1D4B A;  3QIJ A;  1JW9 D;  4IDI A;  4WIP A;  3UF8 A;  2OJW A;  4PYZ A;  2RGF A;  3V3X A;  1OQQ A;  1P0R A;  2BW2 A;  2MA9 B;  2BBC A;  4DXF A;  4K7U A;  2EKI A;  4RGN A;  2HTH A;  4HXD A;  2JT4 B;  3RMK C;  4LTU A;  4BOS C;  2O2V A;  4JIO U;  3ZJU A;  1ZE3 D;  2KLG A;  1FEH A;  1EF5 A;  2KQS A;  3TBL D;  2JZ3 B;  3DBL I;  3ZKJ C;  4JL9 A;  1FXT B;  5E6P A;  3C0R B;  4WWP A;  5BYQ A;  1HZ5 A;  4BKS D;  3ZNH B;  1J7B A;  2N7E A;  2VZK B;  1JRP A;  3B2G A;  3VUY A;  3QWZ B;  2BVC A;  1R4M I;  2C5L C;  2LI5 A;  3ZTD A;  3GOE A;  3ZIM A;  1T3Q A;  2DBY A;  2WXM A;  2PTL A;  2ZCB A;  1SXT A;  2H89 B;  3VVW B;  4GDK A;  3WIM A;  5KHQ A;  3H7P B;  2CHX A;  2WXR A;  4YTP B;  3P42 A;  2FCS A;  4JLC A;  1PFD A;  5D3I B;  1WYW B;  2DZI A;  1V80 A;  1DOX A;  1YNT E;  2LFI A;  1WH3 A;  1LGR A;  5E6N A;  1NYQ A;  4KDL B;  2KQ4 X;  2N7D A;  3ZYY X;  3I3T B;  2LJI A;  3PRZ A;  3GP7 A;  4AUQ C;  2BT6 A;  4MGK E;  3LJ3 A;  1QZE A;  3VFK A;  3V62 A;  5EE9 A;  1JWA D;  5E6J A;  3TMP B;  3HVD A;  2LVO A;  2BF8 B;  3GS2 A;  3QCA A;  1KF6 B;  2BYT A;  2K22 A;  3IT6 B;  3AED B;  1P1A A;  2G3Q B;  1N5X A;  2ICI A;  4LK0 M;  4NJ7 A;  5AZG A;  3AM9 A;  1TZ1 A;  2D11 A;  1KLV A;  2K39 A;  3MJW A;  2O2V B;  3U8Z A;  1KTK A;  2XN9 C;  3JYU A;  2QDF A;  2V4I B;  2KAN A;  2K1F A;  2RMM A;  4UDU C;  5JZE B;  2WXG A;  3URY A;  4E74 A;  1C76 A;  3ZDM C;  3ZJT A;  1S3S G;  4F7Z A;  2BB5 A;  1TY0 A;  1FIQ A;  3PTF C;  4WJP A;  1E7U A;  3HM6 X;  1MJD A;  2BKR B;  1MPE A;  3W2D A;  3VAW A;  3SDL C;  1FMA D;  3CST A;  1WM3 A;  2ZJD A;  2SAK A;  1N5W A;  4M0W A;  3MC8 A;  4H2A A;  4P1C C;  1V5T A;  4BKT A;  3ECI A;  2NTS A;  4HCP B;  3HHM A;  3ZUN A;  2MBB B;  3NHE B;  2NPT A;  1EU4 A;  1C77 A;  2FUG 1;  3P2B A;  4Q2J A;  3VQI A;  1HZ6 A;  2M1M A;  3ZRC A;  3DQV A;  4BZA A;  2DZJ A;  3IFW B;  1HA5 A;  3ZNG C;  1E8W A;  3A9J A;  2MSE D;  3T8M A;  4LNO A;  4QAY A;  3H9D A;  2ZEQ A;  1IPG A;  1RRB A;  3FC4 A;  2IO3 B;  2YLM A;  3U7D A;  1QQR A;  4N9F 4;  5IA7 A;  1C4C A;  3EFC A;  3WCQ A;  1V81 A;  5LNK 1;  1H4R A;  3RUI B;  1WGH A;  1KRH A;  3DOW A;  1L0Y B;  1WJ4 A;  4A3P A;  1K8R B;  1UEL A;  2KC2 A;  3OAW A;  3Q2A C;  1OQR A;  1WF9 A;  1V97 A;  4XC2 A;  3Q69 A;  2OED A;  3AB5 A;  4BAX A;  4GDL B;  4ZRP A;  1VDV A;  2Z0E B;  3T3N A;  2WDR B;  3V05 A;  2KC1 A;  2W3S A;  3AUL A;  3Q3F A;  1I42 A;  2N9L A;  3P4P B;  1QKZ A;  5EDS A;  3R2T A;  5FKA C;  2FBW B;  2FNJ B;  3BYT B;  1QOA A;  1E90 A;  1K53 A;  1XLO A;  3APF A;  4S17 A;  3SR6 A;  2RPQ A;  4L2Y A;  5G5H A;  2MQJ A;  4WUR A;  2KX3 A;  3L0W B;  4OVZ A;  3UQB A;  2EMS A;  4MH0 E;  4YTN B;  2QIL A;  1Y8R C;  3MC0 B;  1TGZ B;  2WDT B;  2JYT A;  4DK5 A;  3AE9 B;  1YX6 B;  4WWO A;  2Q5W D;  3KWV A;  1SE3 A;  2PE6 B;  1Q5W B;  3GB1 A;  3SFD B;  1Z2M A;  5CHV C;  4US9 A;  1V1P A;  4WH4 A;  3RZW C;  4M8M A;  4A55 A;  1H8C A;  1UNS A;  1Q0W B;  2MP2 A;  3RYT A;  1EWY C;  2LHD A;  4G0N B;  4RF0 A;  1I35 A;  3EUB 2;  4MGZ E;  2XEW A;  5L95 C;  1XLN A;  2CU1 A;  2B76 B;  3BK1 A;  3RUL A;  4NQK E;  2MCN B;  1UD7 A;  2WXN A;  4NAM A;  3RNF C;  2PMV A;  4M01 A;  2M8S A;  3KUC B;  2I1K A;  3TEW A;  3L16 A;  1J0G A;  3ZGZ A;  4G3X B;  2TSS A;  5IP4 D;  4KIK B;  3PHW B;  2MBE A;  3DVN V;  1ZDV A;  4LCD E;  2DWQ A;  4R3D A;  1IBX A; 
#chains in the Genus database with same CATH homology
 2JY6 A;  2JPH A;  2KN5 A;  3QJZ A;  3M63 B;  2W9N A;  2UYZ B;  3EC8 A;  3DPD A;  1NBF C;  2BGF A;  5LLI A;  3NY5 A;  2Y5B B;  2OJR A;  1LM8 B;  1V6E A;  1GC6 A;  3A4S C;  2RSU A;  3HK0 A;  4IM2 A;  4I6N B;  4MEM A;  3X0W A;  1A5R A;  3H7S A;  1WMH A;  2RR9 A;  3H6N A;  4KDI C;  4MGI E;  4B9K A;  3WAN A;  3X23 A;  1WGD A;  3D32 A;  4K7W A;  4KIK A;  2M4N A;  4ZDV A;  3O65 B;  4MDK E;  4DBG A;  2LD9 A;  1WRD B;  2M17 A;  2CHW A;  1V49 A;  4NPN A;  5LXI B;  2K25 A;  2XBB C;  4W9I A;  2JZZ A;  2LGX A;  2DYB A;  2JRH A;  2KK8 A;  2JF5 A;  5J17 A;  2J0M A;  3PVL A;  2HD5 B;  1NDD A;  2KZR A;  2GBJ A;  3A33 B;  5C23 A;  2J0J A;  4GB9 A;  1D3Z A;  2LGD A;  3VH3 B;  3W1S A;  2JUO A;  2KXJ A;  4WJQ A;  2DAJ A;  2PE9 A;  3PPA A;  1E8Z A;  1TBE A;  2KJ6 A;  1OQY A;  5KHO A;  1KM7 A;  4DDG D;  3DVN U;  3VXW A;  4DHZ B;  5J2R A;  2V4L A;  2MBH A;  2NVU I;  4I6P A;  5D2M B;  1LXD A;  2DX5 B;  1IP9 A;  2LVP A;  4EZJ A;  3QAR A;  3B08 A;  1VD2 A;  1Z5S B;  3U30 A;  1WGY A;  4FHK A;  2FUH B;  3QX1 A;  3VUX A;  3SHQ A;  1ISN A;  1V86 A;  4GU2 A;  1WX7 A;  5IAA C;  3R7R A;  3VH4 B;  1SE9 A;  1GNU A;  1EF1 A;  1EUV B;  2CHZ A;  3AI5 A;  3DBR I;  4GN1 A;  2FCN A;  4IM0 A;  4IWP A;  1M94 A;  1L7Y A;  4CO7 A;  3VTU A;  3PLU A;  3QC8 B;  4IC7 B;  2GOW A;  2I1J A;  1L2N A;  3QIJ A;  4G50 A;  2BPS A;  4GSW A;  3UF8 A;  4PYZ A;  2K8H A;  3ONS A;  2RGF A;  3ZW3 A;  2KO3 A;  5CX3 A;  3DVG Y;  1P0R A;  2MA9 B;  4K7U A;  2EMT A;  3VTW A;  4FJY A;  1OTR B;  1X1M A;  2KWC A;  5AZH A;  2KWV B;  3PRP B;  1LQB A;  3KH0 A;  1F9J A;  2PEA A;  2HTH A;  2LXC A;  4HXD A;  4ZRI A;  1WZ3 A;  5G2N A;  2LRW A;  2JT4 B;  1YX5 B;  3RT3 B;  1J19 A;  2R2Q A;  4HPL B;  1KOT A;  2KTR B;  2HJ8 A;  4BOS C;  4HLE A;  2O2V A;  4X57 B;  4JIO U;  2FID A;  4LJP B;  2ZNV C;  3UGB B;  2KLG A;  1OEY A;  3DBS A;  3RD2 A;  3TCA A;  2IZV B;  1EF5 A;  2KQS A;  4ZRJ A;  3TBL D;  4ZRK A;  4B95 A;  2JZ3 B;  1WXV A;  5D7G A;  3DBL I;  4WAA A;  3ZKJ C;  1MG8 A;  4JL9 A;  2NBW B;  4BBN F;  2LUE A;  1WXS A;  4ICV A;  1P3Q U;  3PHX B;  1FXT B;  2D2Q A;  5E6P A;  4IWO A;  2AL6 A;  4ANX A;  3C0R B;  3N32 A;  4GDK B;  1GC7 A;  2FCM A;  4WWP A;  3N30 A;  4GMV A;  4BOZ B;  4BKS D;  3QK0 A;  3ZNH B;  3QQ8 B;  2VRR B;  3B1L X;  2IYD B;  4K81 A;  4ZYN A;  4DXA B;  2K8B A;  2N7E A;  3SU8 X;  4RM8 A;  4OVV A;  4W9K A;  3APC A;  2YVC A;  2FCQ A;  2WX1 A;  3VUY A;  4IW0 A;  3QWZ B;  1R4M I;  2CS4 A;  4LDT D;  2C5L C;  2LI5 A;  3ZTD A;  3W1Y A;  1WE6 A;  3GOE A;  1JRU A;  3ZDT A;  3ZIM A;  2KDE B;  4IUM B;  3JVZ X;  4ANU A;  3DDC B;  1CMX B;  4GOC A;  1UBI A;  4II2 B;  2BYF A;  2RD0 A;  2BKF A;  2ZCB A;  5J18 A;  2GBK A;  4BVU C;  2IY0 B;  1GJZ A;  3AU4 A;  4NJ6 A;  2KDI A;  3NOB A;  4J6I A;  4FLH A;  4YL8 A;  3L17 A;  3VVW B;  4GDK A;  1HE8 A;  2MRP A;  2LVQ A;  2ZPN A;  3WIM A;  5KHQ A;  2B3A A;  3KUZ A;  2PPH A;  4CHK A;  3H7P B;  2CHX A;  2L05 A;  4RMA A;  3EFU A;  1EO6 A;  2DYO A;  3PS6 A;  2FCS A;  4JLC A;  3PGE A;  2MW5 A;  4KVG B;  4A3O A;  4EKU A;  3V60 A;  3EHV A;  2KX0 A;  1WYW B;  1WX8 A;  2KTF A;  3PV1 A;  2DZI A;  4PS7 A;  1V80 A;  4FUL A;  1WH3 A;  2UWQ A;  5E6N A;  4KDL B;  2N7D A;  3APD A;  3I3T B;  2BWF A;  3JSV A;  4FJV B;  5C1Z A;  2QHO A;  4AWJ A;  3PRZ A;  2NBV B;  1WJN A;  3KW5 B;  4AUQ C;  3H7P A;  1UH6 A;  4AOF A;  1KJT A;  2L8J A;  4MGK E;  2N1V A;  2KQ7 A;  3LJ3 A;  2K6D B;  1E5W A;  1P9D U;  1OEY J;  3IHP C;  1QZE A;  3VFK A;  3V62 A;  1WJ6 A;  2V3S A;  4RM9 A;  3PZD A;  3TMP B;  2LVO A;  4I6L B;  2KMA A;  2J0K A;  1E7V A;  2BF8 B;  3DCG A;  2DYM A;  4KV2 A;  4EUT A;  3L10 B;  3QCA A;  3KYC D;  5CHF A;  4JQW C;  5CTR C;  2LZ6 A;  4GGQ A;  2IO2 B;  2AEH A;  2DAF A;  4K7S A;  1P1A A;  2G3Q B;  2KFJ A;  3PSE B;  2V1Y A;  2AYO B;  3PRM B;  4FHJ A;  2L0F A;  2KHW B;  3A4R A;  4NJ7 A;  4W9E A;  5AZG A;  5GMV A;  2PJH A;  4K1R B;  3L08 A;  1TZ1 A;  2BYV E;  2D11 A;  3L13 A;  1KLV A;  2LJ5 A;  2WX0 A;  2GBR A;  2NS5 A;  2K39 A;  2L00 B;  3MJW A;  1V9J A;  2IBI B;  2O2V B;  3U8Z A;  2KJR A;  2ZZP B;  4PS8 A;  2MBQ A;  5AEK B;  4W9C A;  4F8C B;  3JYU A;  2G4D B;  2K1F A;  2KAN A;  5D94 A;  3W1S C;  2ZPY A;  3EEC A;  1UBQ A;  4HCN B;  4LDT B;  4M0W B;  5JZE B;  4ANV A;  3A9K A;  3ZLZ A;  4E74 A;  4MM3 A;  2ZCC A;  3ZDM C;  3T9L A;  4DHJ D;  1ZGU B;  2WWZ A;  1T0Y A;  1S3S G;  3KVF B;  2FAZ A;  4F7Z A;  5L83 A;  3CF6 E;  2D10 A;  3PTF C;  2NPT B;  1WR1 A;  4W9J A;  3JW0 X;  4WJP A;  1E7U A;  1BT0 A;  3HM6 X;  2BKR B;  4BKS A;  2JVC A;  3VAW A;  3A1Q B;  3SDL C;  3CST A;  1WM3 A;  2KDB A;  2REX A;  2ZVO A;  3ALB A;  4CYE A;  4TQ1 A;  2ZJD A;  5E6O A;  2Z0D B;  1WY8 A;  4DDI D;  1R4N I;  2JRI B;  1SGH A;  2KOX A;  3WAM A;  3BY4 B;  3QA8 A;  2NCN A;  2C7M B;  3A9J B;  3R66 C;  4TUU A;  1P98 A;  2AWT A;  2GMI C;  1V5T A;  4BKT A;  4ICU A;  3ECI A;  4AJW A;  5G55 A;  4HCP B;  3HHM A;  3AXC A;  3KYD D;  3ZUN A;  2DEN B;  2MBB B;  4NY0 A;  3NHE B;  4KSK C;  4P7I A;  2LWP A;  3PRE A;  4MJS A;  2G4S A;  2NPT A;  1WGG A;  3IVF A;  5JH5 C;  2KJH B;  1WM2 A;  4XX5 A;  5AZF A;  3A1Q A;  3UQA A;  3ZTC A;  3P2B A;  3VQI A;  4TV3 A;  3BIN A;  2EKE C;  2M1M A;  3ZRC A;  3DQV A;  3WAP A;  2DZJ A;  3WA0 A;  4HDO A;  3IFW B;  3ZNG C;  1PQS A;  1E8W A;  1WE7 A;  2WYQ A;  3A9J A;  2MSE D;  1RAX A;  3JSV B;  3L54 A;  1ZKH A;  3T8M A;  3K9O B;  3H9D A;  2C7N B;  4W9H A;  2KD0 A;  2ZEQ A;  1IPG A;  1RRB A;  2IO3 B;  2YLM A;  1VCB A;  2GBN A;  3U7D A;  3CMM B;  3MTN B;  4N9F 4;  1E8Y A;  2BWE S;  4HDQ A;  4A20 A;  5IA7 A;  2NBU A;  3TJP A;  3QAQ A;  2N1W A;  4ASW C;  3QHT A;  4AJY B;  4AP4 C;  1V81 A;  2L0T A;  1H4R A;  3RUI B;  5JHA A;  1WGH A;  1TTN A;  3DOW A;  4NNJ B;  4EEW A;  4EZK A;  1WJ4 A;  4XZ4 A;  2O6V D;  3HIZ A;  4WWN A;  4A3P A;  5DCN A;  2MLB A;  4B6W A;  1K8R B;  3ZVV A;  2KDF B;  3K9P B;  1GG3 A;  2C7H A;  3PLV A;  1UEL A;  3WAO A;  2KC2 A;  3OAW A;  4W9G A;  4DHJ B;  3WAL A;  4II3 B;  1UGM A;  2JWZ A;  5JHB A;  1WF9 A;  2L7R A;  4NQL B;  4G11 A;  3VUW A;  4XC2 A;  3M95 A;  4W9D A;  3OJ4 B;  1NI2 A;  4BBN C;  4EFO A;  5HKH A;  2A4Z A;  2K8C A;  2N9X A;  3NZU A;  4GDL B;  5D6J B;  1S1Q B;  2KMC A;  2Z0E B;  4PS3 A;  4DWF A;  4HPM B;  3GZN I;  3NS8 A;  1E8X A;  2LXA A;  3A9K B;  4IM3 A;  4FN2 A;  2KC1 A;  2L3Z A;  1U4A A;  2BYE A;  2DHZ A;  2KKC A;  3AUL A;  1AAR A;  4WJN A;  3ZNI D;  1WFY A;  3Q3F A;  1I42 A;  1ZW7 A;  3V61 A;  2ASQ A;  3VDZ A;  2CKH B;  1J8C A;  2ZNV B;  3H1U A;  3RCZ A;  3R3M A;  4JGH B;  1RLF A;  1XD3 B;  4MEL A;  5EDS A;  2CR5 A;  4FAD A;  5BO4 B;  4DHZ E;  2JXX A;  5LXH A;  3OJ3 A;  2FNJ B;  4GDL A;  4IWQ A;  4NAW B;  1E90 A;  4E71 A;  2K6Q A;  2KLC A;  3RZF A;  2MBO A;  3V6E B;  3APF A;  1C1Y B;  3VHT C;  2RPQ A;  3ZRF A;  4OVU A;  2MQJ A;  2XK5 B;  2KX3 A;  2FIF A;  4ANW A;  2NR2 A;  3L0W B;  1YIW A;  3VTV A;  3ZNZ B;  1V2Y A;  2DZK A;  3DBH I;  3UQB A;  2EMS A;  1RFA A;  4MH0 E;  2GBM A;  4KSL C;  2C9W B;  4F1S A;  1WIA A;  2KFK B;  4MSM B;  3IBE A;  1Y8R C;  2IY1 B;  2LRU A;  4MJS B;  2MP2 B;  2J7Q B;  1TGZ B;  1GUA B;  3HM3 A;  2WDT B;  1C3T A;  2R2O A;  4DK5 A;  3UIP B;  2M0X A;  3IG3 A;  2Z59 B;  2D07 B;  1YX6 B;  4WWO A;  1WGR A;  4KZ0 A;  1YQB A;  4TQ0 A;  4LJO B;  1WXA A;  4NAW A;  2L76 A;  2PE6 B;  3M3J A;  4BFR A;  1Q5W B;  1YD8 U;  2MWS B;  3V6C B;  1Z2M A;  2KNB A;  2A5U A;  2XK5 A;  2O6V B;  5DPW A;  3UIN B;  5CHV C;  3B0A A;  1SIF A;  1V5O A;  4FA6 A;  4W9F A;  3NZS A;  4GIV A;  2C60 A;  5FR6 A;  4HWI B;  4WQO B;  2OOB B;  3RZW C;  3CSF A;  3Q3J A;  4M8M A;  1H8C A;  2HE7 A;  2KFK A;  4HVB A;  1WZ0 A;  3PT2 B;  3ML8 A;  3R7Q A;  3M62 B;  1LFD A;  1Q0W B;  2MP2 A;  3RYT A;  4W9L A;  3S2A A;  2D3G A;  1WXM A;  4PYU A;  3UIO B;  3AU5 A;  3KUD B;  4G0N B;  1WJU A;  1WX9 A;  1G6J A;  3N3K B;  3MHS D;  4E3C A;  1I35 A;  4MGZ E;  2XEW A;  3OLM D;  5TR5 A;  5L95 C;  2CU1 A;  4FJZ A;  1Q1O A;  4TKN A;  3RUL A;  3ENE A;  2N9P C;  3ML9 A;  5DPR A;  4NQK E;  2MCN B;  1UD7 A;  2LGY A;  2G45 B;  2O6V A;  1OGW A;  2DZM A;  2M8S A;  3TIX A;  1WR6 E;  2N4F A;  3KUC B;  2KWU B;  2I1K A;  1XQQ A;  2KVR A;  3ZO5 B;  2IO1 B;  3L16 A;  4EZL A;  4BKG A;  1J0G A;  1WMH B;  4IG7 B;  2KTR A;  4G3X B;  4HJK A;  2ZVN A;  4WJO A;  4GXB A;  2IO0 B;  3DVG X;  3TL5 A;  4FBJ B;  4MGY E;  5DPS A;  1IYF A;  4URK A;  4M8N A;  3LDZ E;  4KIK B;  3PHW B;  1YJ1 A;  2LAS A;  4EOY A;  5DPT A;  4KZC A;  3SD5 A;  4HK2 A;  4MSQ B;  1WI0 A;  1XT9 B;  2MBE A;  3DVN V;  4LCD E;  2N9E B;  2MX2 A;  2AL3 A;  1UZX B;  5CHW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...