2IY1B

Senp1 (mutant) full length sumo1
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
83
structure length
83
Chain Sequence
EYIKLKVIGQDSSEIHFKVKMTTHLKKLKESYCQRQGVPMNSLRFLFEGQRIADNHTPKELGMEEEDVIEVYQEQTGGHSTVC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Sumo Protease Senp1 Induces Isomerization of the Scissile Peptide Bond.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/nuclear protein
molecule keywords SENTRIN-SPECIFIC PROTEASE 1
total genus 18
structure length 83
sequence length 83
chains with identical sequence D
ec nomenclature
pdb deposition date 2006-07-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF11976 Rad60-SLD Ubiquitin-2 like Rad60 SUMO-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 2iy1B00
3P2BA 5CHVC 2JF5A 1IP9A 2DX5B 4JGHB 3X23A 4DDID 4K1RB 2AL6A 2KK8A 5C23A 2ASQA 4GDKA 4IW0A 1PQSA 2BGFA 2KQ7A 4KSLC 5E6NA 1NI2A 2MWSB 3PRZA 3PREA 3A9JB 4ICVA 2ZEQA 3ZVVA 2AL3A 4JL9A 1YX6B 2KDFB 2CS4A 3NOBA 4J6IA 4KVGB 5J2RA 2LXAA 3L16A 2MBQA 3JYUA 4AUQC 4HPLB 4OVVA 5CHFA 2LGDA 5KHOA 3R7QA 1L2NA 5DPSA 3PS6A 2O6VD 2XK5A 3KH0A 4FA6A 2C7HA 1SE9A 2KQSA 4II3B 3ENEA 3TMPB 1GC7A 1WJUA 2KC2A 3A9JA 3VH3B 3PGEA 3VXWA 2WWZA 2BYFA 4IM0A 3HK0A 2L05A 2N1WA 2MQJA 3A33B 2KFJA 2KFKB 2K8BA 2MW5A 2ZPYA 4MJSB 1WX7A 2L0TA 3K9PB 4MGZE 3QARA 1WR1A 2KANA 2WX0A 3H7SA 3SDLC 4AJWA 5DPWA 4EKUA 3RUIB 3H9DA 1S1QB 2FCSA 2JY6A 3TJPA 4HDOA 2N9PC 4DHZE 2V1YA 3QX1A 4TKNA 2LXCA 2M4NA 3A9KB 3QWZB 4BBNC 1WY8A 2MBHA 4W9JA 2DZIA 4NY0A 4GN1A 5LLIA 1P3QU 3RT3B 2KHWB 1GNUA 2KKCA 2O6VB 2HJ8A 3RD2A 2KC1A 3H7PB 3NHEB 4XZ4A 4AOFA 4BOSC 1YIWA 2IZVB 2GBMA 4BKSA 1OTRB 4W9IA 1KOTA 4HLEA 1IYFA 2R2QA 1WE6A 2ZNVB 3AULA 3ZDTA 3V6EB 1UELA 1P98A 3CSTA 2VRRB 1WX9A 3DVNV 3ML9A 4FN2A 3L08A 3N30A 4FJVB 4X57B 2DZMA 1RFAA 3DBHI 1YD8U 2LZ6A 3W1SC 1WZ3A 3RZWC 4GDLB 2V4LA 3WAPA 3ZDMC 4URKA 4E3CA 4DXAB 1VCBA 2XK5B 1XT9B 3OJ3A 4DDGD 2LD9A 2LWPA 1V5OA 1V81A 2HTHA 2O6VA 1JRUA 2N4FA 3MJWA 1WI0A 4EZKA 2O2VB 4BKTA 3BINA 3W1SA 3NZUA 2ZPNA 4WJNA 3APCA 3M3JA 3APDA 3ZW3A 2BWFA 2K8CA 3JW0X 2FIDA 2WX1A 3EFUA 2G4SA 3DVNU 3LDZE 4FHKA 4P7IA 4EFOA 1CMXB 3U8ZA 1T0YA 4W9EA 4AP4C 5KHQA 2DYBA 2KJ6A 5HKHA 3UINB 1QZEA 1UZXB 2IY0B 2KJHB 3CMMB 3KUDB 3ZIMA 3UQBA 4IWQA 3T9LA 4ZDVA 2KOXA 3H6NA 1U4AA 2K39A 4FJYA 5D94A 5G2NA 1WM2A 2K8HA 3SD5A 1KM7A 2KN5A 2C7NB 4NQKE 2KTRA 2KNBA 2KDIA 2QHOA 3DVGX 3UQAA 4DHJB 1BT0A 1V49A 2LVQA 2GBNA 3B08A 1E5WA 3MTNB 4HK2A 1Z5SB 4MGIE 2IBIB 3X0WA 2NBWB 3VUWA 2CHWA 4LCDE 2KTRB 3QQ8B 4I6PA 2KXJA 3PLVA 1ZW7A 1SGHA 4IUMB 4K7UA 1WJ6A 1ZGUB 2UYZB 2KFKA 4A20A 4ICUA 4KDIC 3W1YA 4BKSD 3M95A 5D2MB 1NBFC 3KW5B 2NBVB 4GDLA 1WMHB 3GZNI 4W9FA 4JQWC 4DWFA 1WGDA 4IG7B 3NS8A 4B9KA 1NDDA 3NZSA 3TCAA 2KWUB 1A5RA 2JZ3B 2KWCA 2D3GA 5DPTA 3TL5A 4HCNB 1J19A 2LGXA 2C7MB 1EF5A 2N1VA 2KDBA 2RD0A 2PPHA 4MGYE 1E7UA 2L3ZA 2C9WB 4WQOB 4EUTA 2G3QB 1K8RB 2D10A 4IWPA 4HXDA 3B0AA 3KUZA 3WAOA 4LDTD 4E74A 3QCAA 2A5UA 2DAFA 3PV1A 4W9CA 1P0RA 4BVUC 1H4RA 3JSVB 2FCQA 5D6JB 2D2QA 3ONSA 2IO2B 3ECIA 2IY1B 2KD0A 2XEWA 4IM3A 4ZYNA 1V80A 2BKRB 4KZCA 2ZVOA 4AWJA 3VUYA 1E7VA 1E8ZA 1J0GA 2R2OA 2KZRA 4TUUA 4ZRJA 2V3SA 1UD7A 3ZUNA 5DPRA 2D11A 3AU4A 4JLCA 2CU1A 3HM6X 4M8NA 2M17A 2HD5B 3B1LX 2L7RA 1WX8A 1RAXA 3TIXA 1WJ4A 2JRHA 2AYOB 4A3OA 1AARA 4WJPA 2IO3B 4PS7A 1M94A 3QHTA 2L76A 4MGKE 2O2VA 4DHZB 4KZ0A 3QC8B 2BYEA 4II2B 1E8XA 5CX3A 4KIKA 5JHAA 1YX5B 3L10B 4MSQB 4FADA 2WYQA 4W9DA 4FULA 3PLUA 4ANUA 2KVRA 1LM8B 3V6CB 2K1FA 2ZVNA 4HWIB 4MSMB 5D7GA 4GMVA 4PYZA 2GMIC 2MX2A 3ML8A 3JVZX 1C3TA 4GIVA 2DHZA 5AZHA 2JT4B 2LUEA 1L7YA 3L13A 4JIOU 1WF9A 3QJZA 3ZKJC 3CSFA 3ZO5B 4GGQA 4CHKA 3N3KB 4GB9A 2LRWA 3WANA 3DVGY 2KX3A 4F1SA 4HVBA 4FHJA 3VTWA 4EZLA 3L0WB 2J0JA 2FUHB 4I6LB 1WRDB 4DHJD 2MLBA 1Q0WB 3KYCD 4FJZA 2FIFA 2HE7A 1MG8A 2RGFA 4GSWA 4W9HA 3ZNZB 4W9GA 2ZZPB 3PSEB 2IYDB 1WXSA 4EZJA 3T8MA 1I42A 1OQYA 4IWOA 4YL8A 2KLGA 4NJ7A 3UIPB 4ZRIA 1GG3A 2MA9B 3V61A 4GXBA 4GU2A 2GBRA 1UGMA 4HDQA 1LQBA 3O65B 2KTFA 4HCPB 3UIOB 3ZNID 4F8CB 3HHMA 1WJNA 1UBQA 3VH4B 3RULA 1F9JA 1GC6A 2N7DA 2KJRA 1WGRA 2XBBC 2NPTA 2PEAA 3DBSA 3U7DA 1G6JA 5DCNA 1UH6A 2KX0A 3RZFA 2JVCA 3KVFB 5G55A 2DENB 3L54A 4ZRKA 2A4ZA 2LVPA 1FXTB 1TTNA 4NNJB 3UF8A 4LDTB 5E6OA 3PTFC 3VHTC 3LJ3A 5AEKB 1X1MA 1V5TA 1TZ1A 2YLMA 3OJ4B 3VTUA 3A4SC 3A1QA 4TQ1A 4PS8A 1EO6A 3PHXB 4LJPB 2BF8B 1LFDA 2FNJB 4IM2A 2KO3A 2LASA 4G50A 4NAWA 1YQBA 3WIMA 4OVUA 1EUVB 4WWOA 4AJYB 3L17A 4LJOB 4MELA 1XQQA 2NPTB 2RSUA 4NQLB 3S2AA 2DAJA 2C5LC 2PJHA 3HM3A 5IAAC 3VVWB 5LXIB 1V2YA 2DZJA 3R3MA 5L83A 2GOWA 3HIZA 3ALBA 3D32A 4XX5A 2MCNB 3K9OB 3VUXA 4CO7A 2REXA 4DK5A 3KYDD 1WXMA 4A3PA 1R4NI 3ZRFA 4KSKC 2AWTA 3C0RB 3DPDA 2FCMA 1WZ0A 3ZNGC 2EMSA 1WMHA 3ZNHB 4B95A 1GJZA 2MP2A 3R66C 4G3XB 2EKEC 4W9KA 4F7ZA 3TBLD 1ISNA 1WH3A 4EEWA 2CHZA 1P1AA 2BKFA 2BPSA 3ZTDA 3RYTA 2I1JA 3PPAA 4W9LA 2MBEA 4ANWA 1WGHA 3EHVA 2EMTA 3WAMA 3IVFA 2MRPA 4BKGA 3SU8X 3V60A 2OJRA 1OEYJ 3NY5A 3CF6E 3R7RA 2JRIB 4EOYA 3DOWA 2KDEB 1E8YA 3QA8A 4K7SA 3PZDA 4KV2A 2CR5A 1WGYA 3DCGA 4ANXA 3VFKA 1HE8A 3MHSD 5TR5A 2WDTB 3EECA 1EF1A 4KDLB 1OEYA 2N7EA 2NCNA 5E6PA 1SIFA 2KMCA 2ZCCA 3Q3FA 3ZTCA 3M62B 2L0FA 3RCZA 2C60A 2IO1B 1P9DU 1WGGA 2BWES 4WJQA 2L8JA 3H1UA 1ZKHA 5LXHA 3PVLA 4GOCA 4RMAA 3GOEA 1WXAA 2W9NA 5CHWA 4WJOA 3JSVA 2NR2A 5AZGA 2PE9A 4G11A 3OAWA 5AZFA 2Z0DB 4NJ6A 2K25A 3PRMB 2K6QA 3A1QB 1D3ZA 5BO4B 2IO0B 3PT2B 1WXVA 5J18A 1IPGA 3DQVA 4GDKB 5FR6A 1Z2MA 3QIJA 4ANVA 3ZRCA 2PE6B 2M8SA 3IFWB 1Y8RC 2MBOA 3KUCB 3DDCB 4WWNA 1KJTA 4ASWC 4WWPA 3OLMD 1GUAB 1WYWB 2MP2B 2GBKA 2DZKA 4K7WA 3U30A 2M1MA 1UBIA 1H8CA 3VAWA 2LGYA 2K6DB 1E90A 1S3SG 4NPNA 3I3TB 2J0MA 3QK0A 4NAWB 3IHPC 1E8WA 2J0KA 2JZZA 1Q1OA 1TBEA 3VQIA 5EDSA 5IA7A 2ZCBA 5L95C 4E71A 1WFYA 4IC7B 4CYEA 2DYOA 2KLCA 1WE7A 2OOBB 4K81A 3ZLZA 4N9F4 2JWZA 3VDZA 4RM8A 2AEHA 4M8MA 5J17A 4BOZB 2Z59B 3DBRI 4MEMA 1R4MI 2CHXA 2L00B 3Q3JA 4G0NB 2M0XA 3AI5A 2UWQA 1I35A 5JZEB 4PYUA 4PS3A 2J7QB 1C1YB 2GBJA 4KIKB 2Z0EB 5GMVA 5JH5C 1VD2A 3PHWB 4FLHA 1WIAA 1KLVA 2NVUI 2RPQA 3SHQA 3IG3A 4I6NB 2G4DB 5C1ZA 2LVOA 3WA0A 1RLFA 3VTVA 1LXDA 1XD3B 1WM3A 3H7PA 3AU5A 3N32A 2D07B 2N9EB 2Y5BB 2YVCA 4RM9A 2JUOA 3V62A 3APFA 2JXXA 4FBJB 2B3AA 3A9KA 3M63B 4HJKA 2I1KA 2NS5A 1V9JA 4DBGA 1V86A 1YJ1A 2LI5A 1V6EA 2LRUA 2RR9A 4WAAA 4BBNF 4MH0E 2DYMA 4BFRA 2FCNA 4MDKE 5JHBA 4TV3A 2G45B 2KWVB 1WR6E 3AXCA 3QAQA 4HPMB 3DBLI 1TGZB 2ZNVC 2N9XA 4MM3A 4MJSA 2MSED 2NBUA 3BY4B 1J8CA 3A4RA 4TQ0A 4XC2A 3IBEA 2LJ5A 1RRBA 3PRPB 2ZJDA 3EC8A 1Q5WB 2KMAA 3WALA 1OGWA 2BYVE 2FAZA 3UGBB 4B6WA 5CTRC 2MBBB 4M0WB 2CKHB 2JPHA
chains in the Genus database with same CATH superfamily
1JWBD 1IP9A 5HG2A 2J4XA 4K1RB 2ASQA 4IW0A 1KF6B 2KQ7A 2QILA 5JXVA 3PRZA 3U2SC 4ICVA 2I38A 2CS4A 1TS4A 4J6IA 5J2RA 2LXAA 2MBQA 4AUQC 1IBXB 1L2NA 1BMLC 4FA6A 1SE9A 4II3B 1WJUA 1TKYA 3AE7B 2LHEA 3VH3B 3PGEA 1PGXA 4RGMA 4YTNB 2MQJA 3QARA 1WR1A 4XWWA 1K50A 2OJWA 3H7SA 3RUIB 4US9A 2JY6A 4MT5A 3EGRA 4K3CA 2V1YA 3QX1A 2M19A 4IKGA 2M4NA 3QWZB 2DZIA 4GN1A 1AW7A 5LLIA 3RD2A 3NHEB 4XYCA 5G5GA 4KGTA 3BVMA 2ZNVB 3N9YC 3V6EB 1QKZA 1UELA 2LJIA 1SF0A 1RWSA 2V4LA 3AM9A 3ZDMC 4KKJA 1XLQA 3ZXRA 2BVCA 4E3CA 1XT9B 3OJ3A 1P7FA 2LD9A 1LO5D 3GP7A 1WI0A 2ZPNA 4WJNA 3APCA 3EFUA 3LDZE 4FHKA 3U8ZA 1T0YA 5KHQA 3J9CA 3UINB 2KJHB 3I57A 2V0GA 4HEA1 4IWQA 4WAFA 1U4AA 2QEJC 3AEAB 3HRDD 1WM2A 1YN3A 1VZ6A 1KM7A 2KDIA 3UQAA 2M0AA 1TYGB 1FXIA 3B08A 3IAS1 3MTNB 3X0WA 4MGIE 2IBIB 2NBWB 3VUWA 1TT5B 2KTRB 4I6PA 3PLVA 1ZW7A 1L6VA 2QC8A 3SFDB 2WXQA 1ZE3D 4RNAA 4K7UA 4BKSD 3M95A 4KGSA 1J7BA 3GZNI 4JQWC 3ABVB 4BZAA 2KWCA 2D3GA 1XXGA 2QJLA 1EF5A 3IAM1 1E7UA 2L3ZA 3ZJVA 2J53A 2ZW0A 3FC4A 2WXHA 4HXDA 4IWPA 1ZXIA 5IP4D 3WAOA 4LDTD 4E74A 2A5UA 1P0RA 5H92C 3AN1A 4BVUC 3EUB2 1FFUA 3EA6A 2D2QA 3ONSA 4ZYNA 1V80A 3IXSA 1L0XB 3I5JC 1E7VA 2Y3AA 1HEZE 2R2OA 2W54A 4ZRJA 3AU4A 4OZCA 2KMMA 2L7RA 3TIXA 1RAXA 4K3BA 2AYOB 4A3OA 1AARA 4PS7A 3QHTA 4XDDA 4DHZB 4KZ0A 4PT5A 1IBXA 4II2B 4US8A 4KIKA 5JHAA 2WDRB 4MSQB 3Q8AA 3VRAB 1PGAA 5D7GA 4TMAB 4PYZA 3EFCA 2DHZA 5AZHA 2JT4B 1L7YA 2LMCA 3QJZA 1RYJA 3ZO5B 2FUHB 1WRDB 4FJZA 2FIFA 2LFIA 2RGFA 4W9HA 3ZNZB 4HRSA 2IYDB 5TSSA 4EZJA 2L1AA 1C77A 1RFKA 3UIPB 4ZRIA 1GG3A 2PVOD 3V61A 4HDQA 3O65B 3ZNID 4F8CB 1GC6A 5BMGA 1WGRA 1NI3A 1R4NB 3DHHC 3RFZB 1E10A 1UH6A 3KVFB 2DENB 3ETRA 2LVPA 3VHTC 1JWSD 3VTUA 3FKYA 4NAMA 3A4SC 4TQ1A 1QF6A 1EU3A 2FNJB 1CK1A 2KO3A 3WIMA 4LJOB 2AQ2B 4RGNA 2GRIA 2RDGA 3S2AA 2E6XA 2PJHA 3VVWB 1D5MC 4XX5A 3TUOA 2REXA 5AUIA 3AEBB 3NUHB 1WXMA 1B1ZA 1R4NI 1E9MA 3C0RB 1HTOA 1FEHA 4G3XB 1F2RI 4F7ZA 3RMKC 1ISNA 1P1AA 2BKFA 2IGGA 3PZ8A 4IDIA 3RYTA 2I1JA 3PPAA 1WGHA 2EMTA 5LNK1 3KQ4A 2UU7A 3WCQA 3CF6E 1FMAD 1NVID 5IOIA 2GB1A 3DOWA 1KLGD 1CZPA 1ZUD2 1V1PB 4ACFA 5TR5A 2WDTB 2N7EA 2NCNA 1UGJA 3MC9A 1FNWA 2WXNA 2L0FA 2EELA 4Q2JA 1VDVA 3RPFC 3W5UB 3E56A 1WXAA 5CHWA 4P1CC 2PE9A 5AZFA 4KGRA 3VR9B 2BB5A 1A70A 2IDYA 2IO0B 2NMQA 1KH0A 4ANVA 5BMIA 3I9V1 3DDCB 1KJTA 3OLMD 3DWGC 4L1BA 3E9SA 4RGOS 1UBIA 3TSSA 3VAWA 1H8CA 1ZPSA 4HJGE 4WH4A 3Q3OC 4NAWB 1TIFA 3VQIA 5L95C 1WFYA 1EWCA 3Q8BA 2KLCA 4K81A 2KN4A 3ZLZA 4N9F4 4WIPA 3URYA 4L23A 2WGSA 1R7SA 4A9AA 1R4MI 3DBLB 3AI5A 1JROA 2Z0EB 2INPE 5GMVA 4FLHA 2WXJA 1YMHE 4I6NB 1XF5L 1RLFA 2HDEA 2D3CA 3MC0B 2YVCA 1ENFA 3APFA 2I1KA 2B76B 4DBGA 3RI7C 2WU2B 2LRUA 4BBNF 3L4PA 4BFRA 1WR6E 1TGZB 4MM3A 3BY4B 1UWMA 4A8XC 1TY2A 2LJ5A 4YSZB 2J42A 2KMAA 3WALA 1E0ZA 4KKIA 3P2BA 2BYTA 1IGCA 1MJDA 2JF5A 2DX5B 4JGHB 3X23A 2AL6A 5C23A 4C56C 2KWDA 2JYEA 2MJEA 4RGTA 4LNFA 2J52A 2ZEQA 1JCKB 5BYRA 1YX6B 4AS1A 2INCC 3L16A 1NYRA 2E3TA 3BK1A 5CHFA 2JYTA 5DPSA 2XN9C 3P4QB 3W9CB 3AE2B 5EE1A 3TMPB 1TS5A 4IM0A 3HK0A 2N1WA 4MJSB 1RM6C 1WX7A 3K9PB 1T0QC 2HTME 1I4XA 4AJWA 2D5GA 4EKUA 1S1QB 1MPEA 1V97A 3NVYA 4OZBA 4DHZE 4TKNA 2LXCA 3A9KB 3P1MA 1WY8A 4W9JA 1EM7A 2KHWB 4M02A 2HJ8A 3H7PB 1YIWA 2IZVB 2GBMA 4H2AA 4BKSA 1IYFA 1WE6A 1LGRA 1EWYC 1P98A 2WXLA 2QMTA 3ML9A 2KVZA 4FN2A 3L08A 2MEKA 3N30A 1RFAA 4OW0A 1OQRA 3RZWC 1JWAD 3RN9C 2MJDA 1VCBA 1PDXA 3V05A 1QOFA 2LWPA 2YEPB 3RNAC 2O2VB 3BINA 2WQYB 2BWFA 2K8CA 3JW0X 3KWVA 1VJKA 4WQMA 4EFOA 4P7IA 1CMXB 1SSNA 4W9EA 4XWTA 2KYWA 5HKHA 1ESFA 3Q2AC 1QZEA 3KUDB 3ZIMA 1FNUA 2KOXA 2K39A 1TS2A 1F77A 2C7NB 2ACZB 1F2RC 1C79A 4NZLB 1V49A 1BXTA 1YQ3B 4YTMB 4LCDE 3QQ8B 2XNAC 1ZGUB 5FKAC 3U4EG 4A20A 5H8YE 2ON8A 1WMHB 3C8YA 1WGDA 4IG7B 3BK2A 2JQRB 2JZ3B 5DPTA 2RD0A 2MHJA 2PPHA 4S0RA 4EUTA 1K8RB 3B0AA 1B9RA 3HUIA 1JMLA 2DNFA 3PV1A 1WRIA 3MJ5A 2PMVA 2XEWA 4P1BC 3SR6A 3BZDB 2JSVX 2ZVOA 4AWJA 1YOVB 2ONQA 3NRZA 2KZRA 5T8IA 1FIQA 1UD7A 3ZUNA 3AECB 3HM6X 2K9XA 3GE3C 4S17A 2RMMA 1YNTE 4MGKE 3CIRB 4KX6B 3L10B 3N1XC 4FADA 4W9DA 1TKGA 3PLUA 2KVRA 2K1FA 4HWIB 4MSMB 2QDFA 2GMIC 3JVZX 3DWMA 1MFWA 1FRRA 4LNKA 4IOIE 4JIOU 4M00A 4GGQA 4CHKA 4HVBA 4FHJA 3VTWA 4EZLA 3KYCD 2BS2B 2V3PA 2HE7A 1MG8A 4GSWA 1DOXA 1ZDXA 1OQYA 4IWOA 4YL8A 3IT4B 4N58A 2Y5CA 4GXBA 4GU2A 1PYWD 1LQBA 1WJNA 3VH4B 1F9JA 2L52A 2XBBC 2NPTA 2AQ3B 5BYSA 2KX0A 3RZFA 5G55A 4M01A 2PW9A 2CKHB 4LDTB 1V5TA 3OJ4B 1CJEA 2WXIA 1DOIA 3L17A 4NQLB 2DAJA 1OFFA 1TZOA 5IKCM 1V2YA 2JU6X 2GOWA 3HIZA 3ALBA 3D32A 3MP9A 3KYDD 4A3PA 2BTEA 1SJHD 2AWTA 1K53A 1WZ0A 3ZNGC 2EMSA 3ZNHB 1GJZA 2IGDA 2MP2A 4A55A 1WH3A 2IPKD 4JWUC 3WAMA 3AE4B 3RNCC 4BKGA 3SU8X 1ZDVA 3I63C 2OJRA 3NY5A 3R7RA 1UF0A 4K7SA 2WXRA 1WGYA 3DCGA 1D4BA 1VLBA 1OEYA 5E6PA 4TSSA 1FFVA 2BW2A 3M62B 3AE3B 2GLSA 4QAYA 2G9HD 5LXHA 3PVLA 3GOEA 2W9NA 3CWIA 4G11A 3OAWA 5BMHA 4NJ6A 2K25A 2K6QA 3PT2B 1M4VA 1WXVA 1IPGA 5C2TB 1JALA 2PE6B 3ZRCA 2MBOA 3KUCB 4WWNA 4XGAB 4ASWC 1SBBB 1GUAB 2MP2B 4K7WA 2WXKA 5GXGB 1E90A 3PO0A 4YSXB 3I3TB 2J0MA 3IHPC 2W82A 2JZZA 3NS1A 4ZRQA 1I4RA 4IC7B 4AQ7A 4LK0M 4LNNA 4RM8A 4M8MA 5J17A 4BOZB 2Z59B 2L00B 4G0NB 2M0XA 3ZJUA 5JZEB 4PYUA 5JH5C 1VD2A 1WIAA 1KLVA 2NVUI 2K22A 2RPQA 5C1ZA 3N32A 2D07B 2N9EB 2Y5BB 4RM9A 5IO9A 3V62A 4FBJB 3ZJTA 3GE8C 1FNVA 2ICIA 1YJ1A 2LI5A 1WXQA 2RR9A 4B0EA 1MI0A 2FCNA 5JHBA 3T3OA 2KWVB 1ET6A 3QAQA 4HPMB 2MJ3A 3DBLI 1J8CA 3A4RA 4C4VB 4XC2A 1WWTA 3IBEA 1RRBA 2INNE 3BYYB 2BYVE 2FAZA 3UGBB 5CTRC 3BVGA 2HJ1A 1FO4A 1CQVA 4R3DA 5BYQA 2FE8A 3OG5A 3TEZA 2KK8A 3MHZA 4M0WA 4KSLC 1NI2A 1C9FA 1YN5A 3A9JB 1UNSA 2KDFB 3NOBA 4KVGB 1XEEA 2NTTA 2W55A 1MHHE 3OWEB 3R7QA 5EE0A 2BS3B 2XK5A 2KQSA 1I7HA 2KT7A 1GC7A 2WXPA 3A9JA 3VXWA 2WWZA 2L05A 1HZ5A 3A33B 2ZPYA 4MGZE 2AX5A 3SDLC 2Z8LA 3H9DA 2KACA 2FCSA 1QOBA 4XE0A 2N9PC 3LYYA 1KLUD 4RF0A 2K5PA 1SIJA 2KKCA 4A90A 4XZ4A 4HPPA 4W9IA 4HLEA 2RDBC 1GPXA 3AULA 3NVZA 2BS4B 1BUIC 3ZDTA 3AEGB 4X57B 2FBWB 1SXTA 4FJVB 2DZMA 3DBHI 1YD8U 3W1SC 1WZ3A 1YQ4B 4YSYB 4DXAB 2XK5B 4DDGD 1JRUA 2N4FA 3O13A 3W1SA 4HKZE 3ZW3A 2VH1A 4JWSC 1I4PA 2WX1A 2G4SA 3DVNU 2I2YA 3RNBC 2WS3B 3P63A 2DYBA 3UI3A 3TEXA 2IY0B 3CMMB 3DBHB 3UQBA 4ZDVA 3H6NA 2DBYA 4ITKA 1I4HA 2K8HA 2KN5A 2KTRA 2KNBA 2QHOA 3DVGX 5G5HA 4DHJB 3Q8FA 2GBNA 1E5WA 3HVDA 3AE9B 3AB5A 2L32A 2WU5B 2CHWA 5HFYA 4UDUC 4IUMB 4KDIC 3W1YA 4PK1A 3KW5B 2NBVB 4W9FA 4DWFA 1EU4A 3NS8A 1SE4A 3TCAA 2KWUB 3TL5A 1J19A 2LGXA 2N1VA 3RNGC 2KDBA 4ZHPA 4MGYE 4LTUA 4YT0B 2RDHA 4WQOB 1F0ZA 2G3QB 2VZKB 2D10A 2M56B 3QCAA 2DAFA 2WP9B 1JRPA 1Q10A 3JSVB 1YJIA 2QSDA 2FCQA 4IM3A 3ECIA 2KD0A 3R2TA 4KZCA 4RH6A 3HVZA 4BAXA 2IJ0A 2H89B 3VUYA 4TUUA 2V3SA 3MC8A 4M8NA 2HD5B 2R61A 4ZOHC 2JRHA 2IO3B 2L76A 4C80A 3RNEC 1L0VB 1D6EC 3PZ7A 1E8XA 2MH7A 1YX5B 1YN4A 1TY0A 1LM8B 2ZVNA 4YTPB 1SB3C 3FILA 5EE9A 2MX2A 3ML8A 3AE5B 4C00A 1OQQA 2LUEA 3L13A 1WF9A 3ZKJC 1PGBA 3DVGY 3L0WB 2J0JA 1C78A 4DHJD 2NTSA 3Q69A 3PSEB 2D3AA 3T8MA 1I42A 3KLSX 1VR9A 2KLGA 2N9LA 3Q3NC 4WWMA 2MA9B 1WYGA 2X38A 2KTFA 1UBQA 3RULA 2KJRA 1SJED 2N7DA 1G6JA 3U7DA 1PFDA 3L54A 2A4ZA 1FXTB 4NNJB 3UF8A 5E6OA 3PTFC 3LJ3A 5AEKB 1X1MA 3A1QA 4PS8A 1EO6A 4WURA 3PHXB 4LJPB 1HQRD 1LFDA 3U7ZA 4NAWA 4AJYB 4WWOA 1EUVB 4MELA 1XQQA 2RSUA 2C5LC 3NVVA 5IAAC 5LXIB 2DZJA 1PUTA 4LNOA 1F52A 2MCNB 3VUXA 1C4AA 1JQ4A 4J3OD 4DK5A 3Q14C 1Y56A 3ZRFA 4KSKC 1SE2A 1K51A 3ZGZA 1WMHA 3VR8B 2EKEC 4W9KA 3TBLD 1E7PB 4EEWA 2CHZA 2BPSA 2N7JA 1VRAB 4OZAA 4W9LA 2JZPA 4DXGA 3EHVA 5EE3A 2QCZA 1QQRA 1SE3A 2JXTA 1JW9D 1FM0D 1YJJA 2KDEB 4MH8A 2WXGA 1JWMD 2CR5A 2N0SB 2RPVA 1XCQL 3T3NA 3VFKA 1HE8A 3N1ZC 1L4DB 3DHIC 3EECA 1EF1A 2WHIA 4KDLB 3ZTCA 3IT6B 2C60A 2IO1B 1P9DU 2L8JA 3H1UA 1QT9A 4GOCA 2PKOA 5AZGA 4WJOA 3JSVA 2CJOA 2NR2A 2Z0DB 3PRMB 1D3ZA 5J18A 3DQVA 4GDKB 4N6EB 5FR6A 2INDC 1Y8RC 3AH7A 4WWPA 1QILA 1V1OA 2FUG1 5MPOA 1ROEA 2GBKA 3BYTB 2DZKA 2M1MA 2BBCA 2LGYA 2K6DB 1S3SG 1NEKB 3QK0A 2J0KA 2X8XX 1TBEA 5EDSA 2W3SA 2DYOA 3VRBB 4C7ZA 2JWZA 3VDZA 3DBRI 1N62A 2CHXA 1I35A 1N5XA 2UWQA 1HXYD 2WNMA 3N20C 4PS3A 2J7QB 2GBJA 3P4PB 4KIKB 3W2DA 2BQQA 3WA0A 1LXDA 3P42A 3H7PA 1ZXHA 3FILB 1I4QA 3GB1A 5HHDG 1UWXA 2VZKD 4REZA 3ZXVA 2QIEB 1NYQA 2JUOA 2B3AA 3M63B 2NS5A 1V86A 3MFGA 5FK9C 2WXOA 2DYMA 4MDKE 3AXCA 2ZNVC 4MJSA 1GB4A 4HROA 2TSSA 2CU3A 3PRPB 1Q5WB 1OGWA 3H8HA 3Q8EA 3AMZA 3SFEB 1TS3A 5CHVC 3RNFC 4DDID 1GAQB 4GDKA 1PQSA 2BGFA 5E6NA 1ACCA 1T3QA 1ET9A 2MWSB 3PREA 3ZVVA 1L6UA 2WDQB 1L5PA 2AL3A 4JL9A 1FD6A 1ZP0B 3JYUA 4HPLB 4OVVA 2LGDA 3AV8A 3Q6BA 5KHOA 2KDMA 1ZOYB 3AEFB 3PS6A 2O6VD 2WLBA 3KH0A 2C7HA 5FR3A 3ENEA 2KC2A 4JPSA 3U52E 2KAJA 1MHXA 3R8BA 2WXFA 3ZYYX 2BYFA 2LEKA 5HI1A 1FCCC 1WGKA 2KFJA 2KFKB 5C3JB 2K8BA 2VH2A 2MW5A 4MM3B 3P4RB 2L0TA 1QOGA 2OHFA 2KANA 2WX0A 2D3BA 1JWUD 5DPWA 1N63A 4HDOA 2PVGC 2LHDA 2V4IB 2G1EA 4BBNC 4YXDB 2MBHA 4ZHOA 4NY0A 1P3QU 3RT3B 1GNUA 2O6VB 2KC1A 4AOFA 4BOSC 1N61A 1OTRB 1KOTA 2R2QA 2V3NA 3CSTA 1AN8A 1WX9A 2VRRB 3DVNV 3TJPA 3B2FA 4JE3B 1L4ZB 1WSPA 2LZ6A 3B9JA 4GDLB 1T0SC 3WAPA 4URKA 1QOAA 1IGDA 1V5OA 1V81A 2HTHA 2O6VA 4LLGM 3NG0A 3MJWA 4EZKA 1C4PA 1C4CA 4BKTA 4HKQA 3FAHA 3NZUA 3M3JA 3APDA 2FIDA 4AP4C 2KJ6A 5IN7A 2OEDA 1UZXB 3T9LA 4FJYA 5D94A 5G2NA 4RCOA 3SD5A 2KQ4X 4NQKE 4N59A 1KRHA 1GB1A 1BT0A 2LVQA 4HK2A 4NJCA 1Z5SB 3W5VB 1MG4A 2KXJA 2Y5PA 1SGHA 1VZ8A 1WJ6A 2UYZB 2KFKA 3TEYA 4ICUA 2DLBA 5D2MB 1NBFC 4GDLA 1V1PA 4B9KA 1NDDA 3NZSA 1A5RA 4HCNB 2C7MB 3DBRB 2C9WB 3AEEB 3KUZA 1D5XC 4RF1A 3Q8CA 4W9CA 1HZ6A 1H4RA 5D6JB 2IO2B 2IY1B 2BKRB 1C76A 5D3DA 2DWQA 1J0GA 1E8ZA 5DPRA 1F1HA 2D11A 4JLCA 2CU1A 1SEBD 4P16A 2M17A 1J7AA 3B1LX 2BT6A 1WX8A 1WJ4A 4WJPA 3TEWA 4P6VF 1M94A 2LUMA 2O2VA 3QC8B 2IGHA 2BYEA 2K3UA 4FXCA 5CX3A 2AQ1B 1XLNA 2WYQA 4FULA 2PLPA 4OVZA 4ANUA 5AUKA 2YEPF 3V6CB 2JWUA 4GMVA 3KWLA 1TKEA 3GZNB 1C3TA 4GIVA 1XLOA 3CSFA 2GI9A 3N3KB 4GB9A 2LRWA 3WANA 2H88B 2KX3A 4F1SA 2BB6A 4I6LB 3BIID 5D3IB 2MLBA 1Q0WB 4W9GA 1IUEA 2ZZPB 1WXSA 3ZQ4A 3R2IA 5E6JA 2CJNA 2W3RA 1R4MB 4NJ7A 2K0PA 4RFBA 2GBRA 1UGMA 4HCPB 2ZW1A 3UIOB 1TJEA 3HHMA 3B2GA 2PEAA 3DBSA 5DCNA 1L0YB 1QLBB 2JVCA 3BVZA 4C4VA 4ZRKA 1TTNA 4YWGG 4DXFA 2YLMA 1TZ1A 3NJTA 2BF8B 4IM2A 2LASA 4G50A 1YQBA 4OVUA 1KTKA 1XCTL 2NPTB 1HA5A 1N6ZA 3HM3A 3R3MA 4LNIA 3LXFA 5L83A 4EE2A 1GOZA 3K9OB 4CO7A 4ZYSA 4GLSC 3DPDA 2FCMA 1K52A 4B95A 3R66C 4ARCA 3ZTDA 4ANWA 1AWDA 2MBEA 3IVFA 4C7YA 2MRPA 1J7CA 4CQNA 3AE8B 3V60A 1OEYJ 1UUPA 2JRIB 4EOYA 1E8YA 4KV2A 3QA8A 3PZDA 4A6QA 2EKIA 2N9KA 1P7EA 4O1NA 1NENB 4ANXA 4OHJA 3MHSD 3AEDB 1SIFA 2KMCA 2ZCCA 3Q3FA 3GS2A 3RCZA 4WJQA 1I4GA 1WGGA 2BWES 2V9HA 1ZKHA 1T0RC 1STEA 2LGSA 4DQOC 4RMAA 2LGIA 1V8CA 4B0MA 1FCLA 3A1QB 1T5XD 5BO4B 4ZRPA 1Z2MA 3C19A 3QIJA 1FPYA 2M8SA 4L2YA 3IFWB 2SEBD 1D5ZC 1FRDA 1AYFA 1WYWB 2PTLA 3U30A 4NPNA 1E8WA 1Q1OA 5IA7A 2ZCBA 4E71A 4CYEA 1WE7A 2OOBB 3P4SB 1E6EB 2L83A 1KFYB 2AEHA 3NZ3A 4D2KA 4MEMA 1XLPA 1XO3A 3Q3JA 4XDCA 1C1YB 3PHWB 1MVKA 4ARIA 3SHQA 3IG3A 2G4DB 2LVOA 3VTVA 1XD3B 1DYQA 1DGJA 1WM3A 3AU5A 5I4DA 2PIAA 2WXMA 1DOYA 4MACA 2SAKA 3SEBA 2JXXA 3NVWA 3A9KA 3BWUD 4HJKA 3LB8C 1V9JA 4WAAA 1V6EA 3AE1B 4MH0E 2Q5WD 1FXAA 2WDVB 3Q3MC 2JX5A 4TV3A 1N60A 2G45B 3AE6B 1T6BX 2N9XA 2MSED 2NBUA 4TQ0A 1N5WA 3V3XA 3N1YC 1HTQA 2ZJDA 3EC8A 4USAA 1VZ7A 4B6WA 2MBBB 4M0WB 4JX1C 3DHGC 2JPHA
chains in the Genus database with same CATH topology
3P2BA 5CHVC 2JF5A 1IP9A 2DX5B 4JGHB 3X23A 4DDID 4K1RB 2AL6A 2KK8A 5C23A 2ASQA 4GDKA 4IW0A 1PQSA 2BGFA 2KQ7A 4KSLC 5E6NA 1NI2A 2MWSB 3PRZA 3PREA 3A9JB 4ICVA 2ZEQA 3ZVVA 2AL3A 4JL9A 1YX6B 2KDFB 2CS4A 3NOBA 4J6IA 4KVGB 5J2RA 2LXAA 3L16A 2MBQA 3JYUA 4AUQC 4HPLB 4OVVA 5CHFA 2LGDA 5KHOA 3R7QA 1L2NA 5DPSA 3PS6A 2O6VD 2XK5A 3KH0A 4FA6A 2C7HA 1SE9A 2KQSA 4II3B 3ENEA 3TMPB 1GC7A 1WJUA 2KC2A 3A9JA 3VH3B 3PGEA 3VXWA 2WWZA 2BYFA 4IM0A 3HK0A 2L05A 2N1WA 2MQJA 3A33B 2KFJA 2KFKB 2K8BA 2MW5A 2ZPYA 4MJSB 1WX7A 2L0TA 3K9PB 4MGZE 3QARA 1WR1A 2KANA 2WX0A 3H7SA 3SDLC 4AJWA 5DPWA 4EKUA 3RUIB 3H9DA 1S1QB 2FCSA 2JY6A 3TJPA 4HDOA 2N9PC 4DHZE 2V1YA 3QX1A 4TKNA 2LXCA 2M4NA 3A9KB 3QWZB 4BBNC 1WY8A 2MBHA 4W9JA 2DZIA 4NY0A 4GN1A 5LLIA 1P3QU 3RT3B 2KHWB 1GNUA 2KKCA 2O6VB 2HJ8A 3RD2A 2KC1A 3H7PB 3NHEB 4XZ4A 4AOFA 4BOSC 1YIWA 2IZVB 2GBMA 4BKSA 1OTRB 4W9IA 1KOTA 4HLEA 1IYFA 2R2QA 1WE6A 2ZNVB 3AULA 3ZDTA 3V6EB 1UELA 1P98A 3CSTA 2VRRB 1WX9A 3DVNV 3ML9A 4FN2A 3L08A 3N30A 4FJVB 4X57B 2DZMA 1RFAA 3DBHI 1YD8U 2LZ6A 3W1SC 1WZ3A 3RZWC 4GDLB 2V4LA 3WAPA 3ZDMC 4URKA 4E3CA 4DXAB 1VCBA 2XK5B 1XT9B 3OJ3A 4DDGD 2LD9A 2LWPA 1V5OA 1V81A 2HTHA 2O6VA 1JRUA 2N4FA 3MJWA 1WI0A 4EZKA 2O2VB 4BKTA 3BINA 3W1SA 3NZUA 2ZPNA 4WJNA 3APCA 3M3JA 3APDA 3ZW3A 2BWFA 2K8CA 3JW0X 2FIDA 2WX1A 3EFUA 2G4SA 3DVNU 3LDZE 4FHKA 4P7IA 4EFOA 1CMXB 3U8ZA 1T0YA 4W9EA 4AP4C 5KHQA 2DYBA 2KJ6A 5HKHA 3UINB 1QZEA 1UZXB 2IY0B 2KJHB 3CMMB 3KUDB 3ZIMA 3UQBA 4IWQA 3T9LA 4ZDVA 2KOXA 3H6NA 1U4AA 2K39A 4FJYA 5D94A 5G2NA 1WM2A 2K8HA 3SD5A 1KM7A 2KN5A 2C7NB 4NQKE 2KTRA 2KNBA 2KDIA 2QHOA 3DVGX 3UQAA 4DHJB 1BT0A 1V49A 2LVQA 2GBNA 3B08A 1E5WA 3MTNB 4HK2A 1Z5SB 4MGIE 2IBIB 3X0WA 2NBWB 3VUWA 2CHWA 4LCDE 2KTRB 3QQ8B 4I6PA 2KXJA 3PLVA 1ZW7A 1SGHA 4IUMB 4K7UA 1WJ6A 1ZGUB 2UYZB 2KFKA 4A20A 4ICUA 4KDIC 3W1YA 4BKSD 3M95A 5D2MB 1NBFC 3KW5B 2NBVB 4GDLA 1WMHB 3GZNI 4W9FA 4JQWC 4DWFA 1WGDA 4IG7B 3NS8A 4B9KA 1NDDA 3NZSA 3TCAA 2KWUB 1A5RA 2JZ3B 2KWCA 2D3GA 5DPTA 3TL5A 4HCNB 1J19A 2LGXA 2C7MB 1EF5A 2N1VA 2KDBA 2RD0A 2PPHA 4MGYE 1E7UA 2L3ZA 2C9WB 4WQOB 4EUTA 2G3QB 1K8RB 2D10A 4IWPA 4HXDA 3B0AA 3KUZA 3WAOA 4LDTD 4E74A 3QCAA 2A5UA 2DAFA 3PV1A 4W9CA 1P0RA 4BVUC 1H4RA 3JSVB 2FCQA 5D6JB 2D2QA 3ONSA 2IO2B 3ECIA 2IY1B 2KD0A 2XEWA 4IM3A 4ZYNA 1V80A 2BKRB 4KZCA 2ZVOA 4AWJA 3VUYA 1E7VA 1E8ZA 1J0GA 2R2OA 2KZRA 4TUUA 4ZRJA 2V3SA 1UD7A 3ZUNA 5DPRA 2D11A 3AU4A 4JLCA 2CU1A 3HM6X 4M8NA 2M17A 2HD5B 3B1LX 2L7RA 1WX8A 1RAXA 3TIXA 1WJ4A 2JRHA 2AYOB 4A3OA 1AARA 4WJPA 2IO3B 4PS7A 1M94A 3QHTA 2L76A 4MGKE 2O2VA 4DHZB 4KZ0A 3QC8B 2BYEA 4II2B 1E8XA 5CX3A 4KIKA 5JHAA 1YX5B 3L10B 4MSQB 4FADA 2WYQA 4W9DA 4FULA 3PLUA 4ANUA 2KVRA 1LM8B 3V6CB 2K1FA 2ZVNA 4HWIB 4MSMB 5D7GA 4GMVA 4PYZA 2GMIC 2MX2A 3ML8A 3JVZX 1C3TA 4GIVA 2DHZA 5AZHA 2JT4B 2LUEA 1L7YA 3L13A 4JIOU 1WF9A 3QJZA 3ZKJC 3CSFA 3ZO5B 4GGQA 4CHKA 3N3KB 4GB9A 2LRWA 3WANA 3DVGY 2KX3A 4F1SA 4HVBA 4FHJA 3VTWA 4EZLA 3L0WB 2J0JA 2FUHB 4I6LB 1WRDB 4DHJD 2MLBA 1Q0WB 3KYCD 4FJZA 2FIFA 2HE7A 1MG8A 2RGFA 4GSWA 4W9HA 3ZNZB 4W9GA 2ZZPB 3PSEB 2IYDB 1WXSA 4EZJA 3T8MA 1I42A 1OQYA 4IWOA 4YL8A 2KLGA 4NJ7A 3UIPB 4ZRIA 1GG3A 2MA9B 3V61A 4GXBA 4GU2A 2GBRA 1UGMA 4HDQA 1LQBA 3O65B 2KTFA 4HCPB 3UIOB 3ZNID 4F8CB 3HHMA 1WJNA 1UBQA 3VH4B 3RULA 1F9JA 1GC6A 2N7DA 2KJRA 1WGRA 2XBBC 2NPTA 2PEAA 3DBSA 3U7DA 1G6JA 5DCNA 1UH6A 2KX0A 3RZFA 2JVCA 3KVFB 5G55A 2DENB 3L54A 4ZRKA 2A4ZA 2LVPA 1FXTB 1TTNA 4NNJB 3UF8A 4LDTB 5E6OA 3PTFC 3VHTC 3LJ3A 5AEKB 1X1MA 1V5TA 1TZ1A 2YLMA 3OJ4B 3VTUA 3A4SC 3A1QA 4TQ1A 4PS8A 1EO6A 3PHXB 4LJPB 2BF8B 1LFDA 2FNJB 4IM2A 2KO3A 2LASA 4G50A 4NAWA 1YQBA 3WIMA 4OVUA 1EUVB 4WWOA 4AJYB 3L17A 4LJOB 4MELA 1XQQA 2NPTB 2RSUA 4NQLB 3S2AA 2DAJA 2C5LC 2PJHA 3HM3A 5IAAC 3VVWB 5LXIB 1V2YA 2DZJA 3R3MA 5L83A 2GOWA 3HIZA 3ALBA 3D32A 4XX5A 2MCNB 3K9OB 3VUXA 4CO7A 2REXA 4DK5A 3KYDD 1WXMA 4A3PA 1R4NI 3ZRFA 4KSKC 2AWTA 3C0RB 3DPDA 2FCMA 1WZ0A 3ZNGC 2EMSA 1WMHA 3ZNHB 4B95A 1GJZA 2MP2A 3R66C 4G3XB 2EKEC 4W9KA 4F7ZA 3TBLD 1ISNA 1WH3A 4EEWA 2CHZA 1P1AA 2BKFA 2BPSA 3ZTDA 3RYTA 2I1JA 3PPAA 4W9LA 2MBEA 4ANWA 1WGHA 3EHVA 2EMTA 3WAMA 3IVFA 2MRPA 4BKGA 3SU8X 3V60A 2OJRA 1OEYJ 3NY5A 3CF6E 3R7RA 2JRIB 4EOYA 3DOWA 2KDEB 1E8YA 3QA8A 4K7SA 3PZDA 4KV2A 2CR5A 1WGYA 3DCGA 4ANXA 3VFKA 1HE8A 3MHSD 5TR5A 2WDTB 3EECA 1EF1A 4KDLB 1OEYA 2N7EA 2NCNA 5E6PA 1SIFA 2KMCA 2ZCCA 3Q3FA 3ZTCA 3M62B 2L0FA 3RCZA 2C60A 2IO1B 1P9DU 1WGGA 2BWES 4WJQA 2L8JA 3H1UA 1ZKHA 5LXHA 3PVLA 4GOCA 4RMAA 3GOEA 1WXAA 2W9NA 5CHWA 4WJOA 3JSVA 2NR2A 5AZGA 2PE9A 4G11A 3OAWA 5AZFA 2Z0DB 4NJ6A 2K25A 3PRMB 2K6QA 3A1QB 1D3ZA 5BO4B 2IO0B 3PT2B 1WXVA 5J18A 1IPGA 3DQVA 4GDKB 5FR6A 1Z2MA 3QIJA 4ANVA 3ZRCA 2PE6B 2M8SA 3IFWB 1Y8RC 2MBOA 3KUCB 3DDCB 4WWNA 1KJTA 4ASWC 4WWPA 3OLMD 1GUAB 1WYWB 2MP2B 2GBKA 2DZKA 4K7WA 3U30A 2M1MA 1UBIA 1H8CA 3VAWA 2LGYA 2K6DB 1E90A 1S3SG 4NPNA 3I3TB 2J0MA 3QK0A 4NAWB 3IHPC 1E8WA 2J0KA 2JZZA 1Q1OA 1TBEA 3VQIA 5EDSA 5IA7A 2ZCBA 5L95C 4E71A 1WFYA 4IC7B 4CYEA 2DYOA 2KLCA 1WE7A 2OOBB 4K81A 3ZLZA 4N9F4 2JWZA 3VDZA 4RM8A 2AEHA 4M8MA 5J17A 4BOZB 2Z59B 3DBRI 4MEMA 1R4MI 2CHXA 2L00B 3Q3JA 4G0NB 2M0XA 3AI5A 2UWQA 1I35A 5JZEB 4PYUA 4PS3A 2J7QB 1C1YB 2GBJA 4KIKB 2Z0EB 5GMVA 5JH5C 1VD2A 3PHWB 4FLHA 1WIAA 1KLVA 2NVUI 2RPQA 3SHQA 3IG3A 4I6NB 2G4DB 5C1ZA 2LVOA 3WA0A 1RLFA 3VTVA 1LXDA 1XD3B 1WM3A 3H7PA 3AU5A 3N32A 2D07B 2N9EB 2Y5BB 2YVCA 4RM9A 2JUOA 3V62A 3APFA 2JXXA 4FBJB 2B3AA 3A9KA 3M63B 4HJKA 2I1KA 2NS5A 1V9JA 4DBGA 1V86A 1YJ1A 2LI5A 1V6EA 2LRUA 2RR9A 4WAAA 4BBNF 4MH0E 2DYMA 4BFRA 2FCNA 4MDKE 5JHBA 4TV3A 2G45B 2KWVB 1WR6E 3AXCA 3QAQA 4HPMB 3DBLI 1TGZB 2ZNVC 2N9XA 4MM3A 4MJSA 2MSED 2NBUA 3BY4B 1J8CA 3A4RA 4TQ0A 4XC2A 3IBEA 2LJ5A 1RRBA 3PRPB 2ZJDA 3EC8A 1Q5WB 2KMAA 3WALA 1OGWA 2BYVE 2FAZA 3UGBB 4B6WA 5CTRC 2MBBB 4M0WB 2CKHB 2JPHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3P2B A;  5CHV C;  2JF5 A;  1IP9 A;  2DX5 B;  4JGH B;  3X23 A;  4DDI D;  4K1R B;  2AL6 A;  2KK8 A;  5C23 A;  2ASQ A;  4GDK A;  4IW0 A;  1PQS A;  2BGF A;  2KQ7 A;  4KSL C;  5E6N A;  1NI2 A;  2MWS B;  3PRZ A;  3PRE A;  3A9J B;  4ICV A;  2ZEQ A;  3ZVV A;  2AL3 A;  4JL9 A;  1YX6 B;  2KDF B;  2CS4 A;  3NOB A;  4J6I A;  4KVG B;  5J2R A;  2LXA A;  3L16 A;  2MBQ A;  3JYU A;  4AUQ C;  4HPL B;  4OVV A;  5CHF A;  2LGD A;  5KHO A;  3R7Q A;  1L2N A;  5DPS A;  3PS6 A;  2O6V D;  2XK5 A;  3KH0 A;  4FA6 A;  2C7H A;  1SE9 A;  2KQS A;  4II3 B;  3ENE A;  3TMP B;  1GC7 A;  1WJU A;  2KC2 A;  3A9J A;  3VH3 B;  3PGE A;  3VXW A;  2WWZ A;  2BYF A;  4IM0 A;  3HK0 A;  2L05 A;  2N1W A;  2MQJ A;  3A33 B;  2KFJ A;  2KFK B;  2K8B A;  2MW5 A;  2ZPY A;  4MJS B;  1WX7 A;  2L0T A;  3K9P B;  4MGZ E;  3QAR A;  1WR1 A;  2KAN A;  2WX0 A;  3H7S A;  3SDL C;  4AJW A;  5DPW A;  4EKU A;  3RUI B;  3H9D A;  1S1Q B;  2FCS A;  2JY6 A;  3TJP A;  4HDO A;  2N9P C;  4DHZ E;  2V1Y A;  3QX1 A;  4TKN A;  2LXC A;  2M4N A;  3A9K B;  3QWZ B;  4BBN C;  1WY8 A;  2MBH A;  4W9J A;  2DZI A;  4NY0 A;  4GN1 A;  5LLI A;  1P3Q U;  3RT3 B;  2KHW B;  1GNU A;  2KKC A;  2O6V B;  2HJ8 A;  3RD2 A;  2KC1 A;  3H7P B;  3NHE B;  4XZ4 A;  4AOF A;  4BOS C;  1YIW A;  2IZV B;  2GBM A;  4BKS A;  1OTR B;  4W9I A;  1KOT A;  4HLE A;  1IYF A;  2R2Q A;  1WE6 A;  2ZNV B;  3AUL A;  3ZDT A;  3V6E B;  1UEL A;  1P98 A;  3CST A;  2VRR B;  1WX9 A;  3DVN V;  3ML9 A;  4FN2 A;  3L08 A;  3N30 A;  4FJV B;  4X57 B;  2DZM A;  1RFA A;  3DBH I;  1YD8 U;  2LZ6 A;  3W1S C;  1WZ3 A;  3RZW C;  4GDL B;  2V4L A;  3WAP A;  3ZDM C;  4URK A;  4E3C A;  4DXA B;  1VCB A;  2XK5 B;  1XT9 B;  3OJ3 A;  4DDG D;  2LD9 A;  2LWP A;  1V5O A;  1V81 A;  2HTH A;  2O6V A;  1JRU A;  2N4F A;  3MJW A;  1WI0 A;  4EZK A;  2O2V B;  4BKT A;  3BIN A;  3W1S A;  3NZU A;  2ZPN A;  4WJN A;  3APC A;  3M3J A;  3APD A;  3ZW3 A;  2BWF A;  2K8C A;  3JW0 X;  2FID A;  2WX1 A;  3EFU A;  2G4S A;  3DVN U;  3LDZ E;  4FHK A;  4P7I A;  4EFO A;  1CMX B;  3U8Z A;  1T0Y A;  4W9E A;  4AP4 C;  5KHQ A;  2DYB A;  2KJ6 A;  5HKH A;  3UIN B;  1QZE A;  1UZX B;  2IY0 B;  2KJH B;  3CMM B;  3KUD B;  3ZIM A;  3UQB A;  4IWQ A;  3T9L A;  4ZDV A;  2KOX A;  3H6N A;  1U4A A;  2K39 A;  4FJY A;  5D94 A;  5G2N A;  1WM2 A;  2K8H A;  3SD5 A;  1KM7 A;  2KN5 A;  2C7N B;  4NQK E;  2KTR A;  2KNB A;  2KDI A;  2QHO A;  3DVG X;  3UQA A;  4DHJ B;  1BT0 A;  1V49 A;  2LVQ A;  2GBN A;  3B08 A;  1E5W A;  3MTN B;  4HK2 A;  1Z5S B;  4MGI E;  2IBI B;  3X0W A;  2NBW B;  3VUW A;  2CHW A;  4LCD E;  2KTR B;  3QQ8 B;  4I6P A;  2KXJ A;  3PLV A;  1ZW7 A;  1SGH A;  4IUM B;  4K7U A;  1WJ6 A;  1ZGU B;  2UYZ B;  2KFK A;  4A20 A;  4ICU A;  4KDI C;  3W1Y A;  4BKS D;  3M95 A;  5D2M B;  1NBF C;  3KW5 B;  2NBV B;  4GDL A;  1WMH B;  3GZN I;  4W9F A;  4JQW C;  4DWF A;  1WGD A;  4IG7 B;  3NS8 A;  4B9K A;  1NDD A;  3NZS A;  3TCA A;  2KWU B;  1A5R A;  2JZ3 B;  2KWC A;  2D3G A;  5DPT A;  3TL5 A;  4HCN B;  1J19 A;  2LGX A;  2C7M B;  1EF5 A;  2N1V A;  2KDB A;  2RD0 A;  2PPH A;  4MGY E;  1E7U A;  2L3Z A;  2C9W B;  4WQO B;  4EUT A;  2G3Q B;  1K8R B;  2D10 A;  4IWP A;  4HXD A;  3B0A A;  3KUZ A;  3WAO A;  4LDT D;  4E74 A;  3QCA A;  2A5U A;  2DAF A;  3PV1 A;  4W9C A;  1P0R A;  4BVU C;  1H4R A;  3JSV B;  2FCQ A;  5D6J B;  2D2Q A;  3ONS A;  2IO2 B;  3ECI A;  2IY1 B;  2KD0 A;  2XEW A;  4IM3 A;  4ZYN A;  1V80 A;  2BKR B;  4KZC A;  2ZVO A;  4AWJ A;  3VUY A;  1E7V A;  1E8Z A;  1J0G A;  2R2O A;  2KZR A;  4TUU A;  4ZRJ A;  2V3S A;  1UD7 A;  3ZUN A;  5DPR A;  2D11 A;  3AU4 A;  4JLC A;  2CU1 A;  3HM6 X;  4M8N A;  2M17 A;  2HD5 B;  3B1L X;  2L7R A;  1WX8 A;  1RAX A;  3TIX A;  1WJ4 A;  2JRH A;  2AYO B;  4A3O A;  1AAR A;  4WJP A;  2IO3 B;  4PS7 A;  1M94 A;  3QHT A;  2L76 A;  4MGK E;  2O2V A;  4DHZ B;  4KZ0 A;  3QC8 B;  2BYE A;  4II2 B;  1E8X A;  5CX3 A;  4KIK A;  5JHA A;  1YX5 B;  3L10 B;  4MSQ B;  4FAD A;  2WYQ A;  4W9D A;  4FUL A;  3PLU A;  4ANU A;  2KVR A;  1LM8 B;  3V6C B;  2K1F A;  2ZVN A;  4HWI B;  4MSM B;  5D7G A;  4GMV A;  4PYZ A;  2GMI C;  2MX2 A;  3ML8 A;  3JVZ X;  1C3T A;  4GIV A;  2DHZ A;  5AZH A;  2JT4 B;  2LUE A;  1L7Y A;  3L13 A;  4JIO U;  1WF9 A;  3QJZ A;  3ZKJ C;  3CSF A;  3ZO5 B;  4GGQ A;  4CHK A;  3N3K B;  4GB9 A;  2LRW A;  3WAN A;  3DVG Y;  2KX3 A;  4F1S A;  4HVB A;  4FHJ A;  3VTW A;  4EZL A;  3L0W B;  2J0J A;  2FUH B;  4I6L B;  1WRD B;  4DHJ D;  2MLB A;  1Q0W B;  3KYC D;  4FJZ A;  2FIF A;  2HE7 A;  1MG8 A;  2RGF A;  4GSW A;  4W9H A;  3ZNZ B;  4W9G A;  2ZZP B;  3PSE B;  2IYD B;  1WXS A;  4EZJ A;  3T8M A;  1I42 A;  1OQY A;  4IWO A;  4YL8 A;  2KLG A;  4NJ7 A;  3UIP B;  4ZRI A;  1GG3 A;  2MA9 B;  3V61 A;  4GXB A;  4GU2 A;  2GBR A;  1UGM A;  4HDQ A;  1LQB A;  3O65 B;  2KTF A;  4HCP B;  3UIO B;  3ZNI D;  4F8C B;  3HHM A;  1WJN A;  1UBQ A;  3VH4 B;  3RUL A;  1F9J A;  1GC6 A;  2N7D A;  2KJR A;  1WGR A;  2XBB C;  2NPT A;  2PEA A;  3DBS A;  3U7D A;  1G6J A;  5DCN A;  1UH6 A;  2KX0 A;  3RZF A;  2JVC A;  3KVF B;  5G55 A;  2DEN B;  3L54 A;  4ZRK A;  2A4Z A;  2LVP A;  1FXT B;  1TTN A;  4NNJ B;  3UF8 A;  4LDT B;  5E6O A;  3PTF C;  3VHT C;  3LJ3 A;  5AEK B;  1X1M A;  1V5T A;  1TZ1 A;  2YLM A;  3OJ4 B;  3VTU A;  3A4S C;  3A1Q A;  4TQ1 A;  4PS8 A;  1EO6 A;  3PHX B;  4LJP B;  2BF8 B;  1LFD A;  2FNJ B;  4IM2 A;  2KO3 A;  2LAS A;  4G50 A;  4NAW A;  1YQB A;  3WIM A;  4OVU A;  1EUV B;  4WWO A;  4AJY B;  3L17 A;  4LJO B;  4MEL A;  1XQQ A;  2NPT B;  2RSU A;  4NQL B;  3S2A A;  2DAJ A;  2C5L C;  2PJH A;  3HM3 A;  5IAA C;  3VVW B;  5LXI B;  1V2Y A;  2DZJ A;  3R3M A;  5L83 A;  2GOW A;  3HIZ A;  3ALB A;  3D32 A;  4XX5 A;  2MCN B;  3K9O B;  3VUX A;  4CO7 A;  2REX A;  4DK5 A;  3KYD D;  1WXM A;  4A3P A;  1R4N I;  3ZRF A;  4KSK C;  2AWT A;  3C0R B;  3DPD A;  2FCM A;  1WZ0 A;  3ZNG C;  2EMS A;  1WMH A;  3ZNH B;  4B95 A;  1GJZ A;  2MP2 A;  3R66 C;  4G3X B;  2EKE C;  4W9K A;  4F7Z A;  3TBL D;  1ISN A;  1WH3 A;  4EEW A;  2CHZ A;  1P1A A;  2BKF A;  2BPS A;  3ZTD A;  3RYT A;  2I1J A;  3PPA A;  4W9L A;  2MBE A;  4ANW A;  1WGH A;  3EHV A;  2EMT A;  3WAM A;  3IVF A;  2MRP A;  4BKG A;  3SU8 X;  3V60 A;  2OJR A;  1OEY J;  3NY5 A;  3CF6 E;  3R7R A;  2JRI B;  4EOY A;  3DOW A;  2KDE B;  1E8Y A;  3QA8 A;  4K7S A;  3PZD A;  4KV2 A;  2CR5 A;  1WGY A;  3DCG A;  4ANX A;  3VFK A;  1HE8 A;  3MHS D;  5TR5 A;  2WDT B;  3EEC A;  1EF1 A;  4KDL B;  1OEY A;  2N7E A;  2NCN A;  5E6P A;  1SIF A;  2KMC A;  2ZCC A;  3Q3F A;  3ZTC A;  3M62 B;  2L0F A;  3RCZ A;  2C60 A;  2IO1 B;  1P9D U;  1WGG A;  2BWE S;  4WJQ A;  2L8J A;  3H1U A;  1ZKH A;  5LXH A;  3PVL A;  4GOC A;  4RMA A;  3GOE A;  1WXA A;  2W9N A;  5CHW A;  4WJO A;  3JSV A;  2NR2 A;  5AZG A;  2PE9 A;  4G11 A;  3OAW A;  5AZF A;  2Z0D B;  4NJ6 A;  2K25 A;  3PRM B;  2K6Q A;  3A1Q B;  1D3Z A;  5BO4 B;  2IO0 B;  3PT2 B;  1WXV A;  5J18 A;  1IPG A;  3DQV A;  4GDK B;  5FR6 A;  1Z2M A;  3QIJ A;  4ANV A;  3ZRC A;  2PE6 B;  2M8S A;  3IFW B;  1Y8R C;  2MBO A;  3KUC B;  3DDC B;  4WWN A;  1KJT A;  4ASW C;  4WWP A;  3OLM D;  1GUA B;  1WYW B;  2MP2 B;  2GBK A;  2DZK A;  4K7W A;  3U30 A;  2M1M A;  1UBI A;  1H8C A;  3VAW A;  2LGY A;  2K6D B;  1E90 A;  1S3S G;  4NPN A;  3I3T B;  2J0M A;  3QK0 A;  4NAW B;  3IHP C;  1E8W A;  2J0K A;  2JZZ A;  1Q1O A;  1TBE A;  3VQI A;  5EDS A;  5IA7 A;  2ZCB A;  5L95 C;  4E71 A;  1WFY A;  4IC7 B;  4CYE A;  2DYO A;  2KLC A;  1WE7 A;  2OOB B;  4K81 A;  3ZLZ A;  4N9F 4;  2JWZ A;  3VDZ A;  4RM8 A;  2AEH A;  4M8M A;  5J17 A;  4BOZ B;  2Z59 B;  3DBR I;  4MEM A;  1R4M I;  2CHX A;  2L00 B;  3Q3J A;  4G0N B;  2M0X A;  3AI5 A;  2UWQ A;  1I35 A;  5JZE B;  4PYU A;  4PS3 A;  2J7Q B;  1C1Y B;  2GBJ A;  4KIK B;  2Z0E B;  5GMV A;  5JH5 C;  1VD2 A;  3PHW B;  4FLH A;  1WIA A;  1KLV A;  2NVU I;  2RPQ A;  3SHQ A;  3IG3 A;  4I6N B;  2G4D B;  5C1Z A;  2LVO A;  3WA0 A;  1RLF A;  3VTV A;  1LXD A;  1XD3 B;  1WM3 A;  3H7P A;  3AU5 A;  3N32 A;  2D07 B;  2N9E B;  2Y5B B;  2YVC A;  4RM9 A;  2JUO A;  3V62 A;  3APF A;  2JXX A;  4FBJ B;  2B3A A;  3A9K A;  3M63 B;  4HJK A;  2I1K A;  2NS5 A;  1V9J A;  4DBG A;  1V86 A;  1YJ1 A;  2LI5 A;  1V6E A;  2LRU A;  2RR9 A;  4WAA A;  4BBN F;  4MH0 E;  2DYM A;  4BFR A;  2FCN A;  4MDK E;  5JHB A;  4TV3 A;  2G45 B;  2KWV B;  1WR6 E;  3AXC A;  3QAQ A;  4HPM B;  3DBL I;  1TGZ B;  2ZNV C;  2N9X A;  4MM3 A;  4MJS A;  2MSE D;  2NBU A;  3BY4 B;  1J8C A;  3A4R A;  4TQ0 A;  4XC2 A;  3IBE A;  2LJ5 A;  1RRB A;  3PRP B;  2ZJD A;  3EC8 A;  1Q5W B;  2KMA A;  3WAL A;  1OGW A;  2BYV E;  2FAZ A;  3UGB B;  4B6W A;  5CTR C;  2MBB B;  4M0W B;  2CKH B;  2JPH A; 
#chains in the Genus database with same CATH topology
 1JWB D;  1IP9 A;  5HG2 A;  2J4X A;  4K1R B;  2ASQ A;  4IW0 A;  1KF6 B;  2KQ7 A;  2QIL A;  5JXV A;  3PRZ A;  3U2S C;  4ICV A;  2I38 A;  2CS4 A;  1TS4 A;  4J6I A;  5J2R A;  2LXA A;  2MBQ A;  4AUQ C;  1IBX B;  1L2N A;  1BML C;  4FA6 A;  1SE9 A;  4II3 B;  1WJU A;  1TKY A;  3AE7 B;  2LHE A;  3VH3 B;  3PGE A;  1PGX A;  4RGM A;  4YTN B;  2MQJ A;  3QAR A;  1WR1 A;  4XWW A;  1K50 A;  2OJW A;  3H7S A;  3RUI B;  4US9 A;  2JY6 A;  4MT5 A;  3EGR A;  4K3C A;  2V1Y A;  3QX1 A;  2M19 A;  4IKG A;  2M4N A;  3QWZ B;  2DZI A;  4GN1 A;  1AW7 A;  5LLI A;  3RD2 A;  3NHE B;  4XYC A;  5G5G A;  4KGT A;  3BVM A;  2ZNV B;  3N9Y C;  3V6E B;  1QKZ A;  1UEL A;  2LJI A;  1SF0 A;  1RWS A;  2V4L A;  3AM9 A;  3ZDM C;  4KKJ A;  1XLQ A;  3ZXR A;  2BVC A;  4E3C A;  1XT9 B;  3OJ3 A;  1P7F A;  2LD9 A;  1LO5 D;  3GP7 A;  1WI0 A;  2ZPN A;  4WJN A;  3APC A;  3EFU A;  3LDZ E;  4FHK A;  3U8Z A;  1T0Y A;  5KHQ A;  3J9C A;  3UIN B;  2KJH B;  3I57 A;  2V0G A;  4HEA 1;  4IWQ A;  4WAF A;  1U4A A;  2QEJ C;  3AEA B;  3HRD D;  1WM2 A;  1YN3 A;  1VZ6 A;  1KM7 A;  2KDI A;  3UQA A;  2M0A A;  1TYG B;  1FXI A;  3B08 A;  3IAS 1;  3MTN B;  3X0W A;  4MGI E;  2IBI B;  2NBW B;  3VUW A;  1TT5 B;  2KTR B;  4I6P A;  3PLV A;  1ZW7 A;  1L6V A;  2QC8 A;  3SFD B;  2WXQ A;  1ZE3 D;  4RNA A;  4K7U A;  4BKS D;  3M95 A;  4KGS A;  1J7B A;  3GZN I;  4JQW C;  3ABV B;  4BZA A;  2KWC A;  2D3G A;  1XXG A;  2QJL A;  1EF5 A;  3IAM 1;  1E7U A;  2L3Z A;  3ZJV A;  2J53 A;  2ZW0 A;  3FC4 A;  2WXH A;  4HXD A;  4IWP A;  1ZXI A;  5IP4 D;  3WAO A;  4LDT D;  4E74 A;  2A5U A;  1P0R A;  5H92 C;  3AN1 A;  4BVU C;  3EUB 2;  1FFU A;  3EA6 A;  2D2Q A;  3ONS A;  4ZYN A;  1V80 A;  3IXS A;  1L0X B;  3I5J C;  1E7V A;  2Y3A A;  1HEZ E;  2R2O A;  2W54 A;  4ZRJ A;  3AU4 A;  4OZC A;  2KMM A;  2L7R A;  3TIX A;  1RAX A;  4K3B A;  2AYO B;  4A3O A;  1AAR A;  4PS7 A;  3QHT A;  4XDD A;  4DHZ B;  4KZ0 A;  4PT5 A;  1IBX A;  4II2 B;  4US8 A;  4KIK A;  5JHA A;  2WDR B;  4MSQ B;  3Q8A A;  3VRA B;  1PGA A;  5D7G A;  4TMA B;  4PYZ A;  3EFC A;  2DHZ A;  5AZH A;  2JT4 B;  1L7Y A;  2LMC A;  3QJZ A;  1RYJ A;  3ZO5 B;  2FUH B;  1WRD B;  4FJZ A;  2FIF A;  2LFI A;  2RGF A;  4W9H A;  3ZNZ B;  4HRS A;  2IYD B;  5TSS A;  4EZJ A;  2L1A A;  1C77 A;  1RFK A;  3UIP B;  4ZRI A;  1GG3 A;  2PVO D;  3V61 A;  4HDQ A;  3O65 B;  3ZNI D;  4F8C B;  1GC6 A;  5BMG A;  1WGR A;  1NI3 A;  1R4N B;  3DHH C;  3RFZ B;  1E10 A;  1UH6 A;  3KVF B;  2DEN B;  3ETR A;  2LVP A;  3VHT C;  1JWS D;  3VTU A;  3FKY A;  4NAM A;  3A4S C;  4TQ1 A;  1QF6 A;  1EU3 A;  2FNJ B;  1CK1 A;  2KO3 A;  3WIM A;  4LJO B;  2AQ2 B;  4RGN A;  2GRI A;  2RDG A;  3S2A A;  2E6X A;  2PJH A;  3VVW B;  1D5M C;  4XX5 A;  3TUO A;  2REX A;  5AUI A;  3AEB B;  3NUH B;  1WXM A;  1B1Z A;  1R4N I;  1E9M A;  3C0R B;  1HTO A;  1FEH A;  4G3X B;  1F2R I;  4F7Z A;  3RMK C;  1ISN A;  1P1A A;  2BKF A;  2IGG A;  3PZ8 A;  4IDI A;  3RYT A;  2I1J A;  3PPA A;  1WGH A;  2EMT A;  5LNK 1;  3KQ4 A;  2UU7 A;  3WCQ A;  3CF6 E;  1FMA D;  1NVI D;  5IOI A;  2GB1 A;  3DOW A;  1KLG D;  1CZP A;  1ZUD 2;  1V1P B;  4ACF A;  5TR5 A;  2WDT B;  2N7E A;  2NCN A;  1UGJ A;  3MC9 A;  1FNW A;  2WXN A;  2L0F A;  2EEL A;  4Q2J A;  1VDV A;  3RPF C;  3W5U B;  3E56 A;  1WXA A;  5CHW A;  4P1C C;  2PE9 A;  5AZF A;  4KGR A;  3VR9 B;  2BB5 A;  1A70 A;  2IDY A;  2IO0 B;  2NMQ A;  1KH0 A;  4ANV A;  5BMI A;  3I9V 1;  3DDC B;  1KJT A;  3OLM D;  3DWG C;  4L1B A;  3E9S A;  4RGO S;  1UBI A;  3TSS A;  3VAW A;  1H8C A;  1ZPS A;  4HJG E;  4WH4 A;  3Q3O C;  4NAW B;  1TIF A;  3VQI A;  5L95 C;  1WFY A;  1EWC A;  3Q8B A;  2KLC A;  4K81 A;  2KN4 A;  3ZLZ A;  4N9F 4;  4WIP A;  3URY A;  4L23 A;  2WGS A;  1R7S A;  4A9A A;  1R4M I;  3DBL B;  3AI5 A;  1JRO A;  2Z0E B;  2INP E;  5GMV A;  4FLH A;  2WXJ A;  1YMH E;  4I6N B;  1XF5 L;  1RLF A;  2HDE A;  2D3C A;  3MC0 B;  2YVC A;  1ENF A;  3APF A;  2I1K A;  2B76 B;  4DBG A;  3RI7 C;  2WU2 B;  2LRU A;  4BBN F;  3L4P A;  4BFR A;  1WR6 E;  1TGZ B;  4MM3 A;  3BY4 B;  1UWM A;  4A8X C;  1TY2 A;  2LJ5 A;  4YSZ B;  2J42 A;  2KMA A;  3WAL A;  1E0Z A;  4KKI A;  3P2B A;  2BYT A;  1IGC A;  1MJD A;  2JF5 A;  2DX5 B;  4JGH B;  3X23 A;  2AL6 A;  5C23 A;  4C56 C;  2KWD A;  2JYE A;  2MJE A;  4RGT A;  4LNF A;  2J52 A;  2ZEQ A;  1JCK B;  5BYR A;  1YX6 B;  4AS1 A;  2INC C;  3L16 A;  1NYR A;  2E3T A;  3BK1 A;  5CHF A;  2JYT A;  5DPS A;  2XN9 C;  3P4Q B;  3W9C B;  3AE2 B;  5EE1 A;  3TMP B;  1TS5 A;  4IM0 A;  3HK0 A;  2N1W A;  4MJS B;  1RM6 C;  1WX7 A;  3K9P B;  1T0Q C;  2HTM E;  1I4X A;  4AJW A;  2D5G A;  4EKU A;  1S1Q B;  1MPE A;  1V97 A;  3NVY A;  4OZB A;  4DHZ E;  4TKN A;  2LXC A;  3A9K B;  3P1M A;  1WY8 A;  4W9J A;  1EM7 A;  2KHW B;  4M02 A;  2HJ8 A;  3H7P B;  1YIW A;  2IZV B;  2GBM A;  4H2A A;  4BKS A;  1IYF A;  1WE6 A;  1LGR A;  1EWY C;  1P98 A;  2WXL A;  2QMT A;  3ML9 A;  2KVZ A;  4FN2 A;  3L08 A;  2MEK A;  3N30 A;  1RFA A;  4OW0 A;  1OQR A;  3RZW C;  1JWA D;  3RN9 C;  2MJD A;  1VCB A;  1PDX A;  3V05 A;  1QOF A;  2LWP A;  2YEP B;  3RNA C;  2O2V B;  3BIN A;  2WQY B;  2BWF A;  2K8C A;  3JW0 X;  3KWV A;  1VJK A;  4WQM A;  4EFO A;  4P7I A;  1CMX B;  1SSN A;  4W9E A;  4XWT A;  2KYW A;  5HKH A;  1ESF A;  3Q2A C;  1QZE A;  3KUD B;  3ZIM A;  1FNU A;  2KOX A;  2K39 A;  1TS2 A;  1F77 A;  2C7N B;  2ACZ B;  1F2R C;  1C79 A;  4NZL B;  1V49 A;  1BXT A;  1YQ3 B;  4YTM B;  4LCD E;  3QQ8 B;  2XNA C;  1ZGU B;  5FKA C;  3U4E G;  4A20 A;  5H8Y E;  2ON8 A;  1WMH B;  3C8Y A;  1WGD A;  4IG7 B;  3BK2 A;  2JQR B;  2JZ3 B;  5DPT A;  2RD0 A;  2MHJ A;  2PPH A;  4S0R A;  4EUT A;  1K8R B;  3B0A A;  1B9R A;  3HUI A;  1JML A;  2DNF A;  3PV1 A;  1WRI A;  3MJ5 A;  2PMV A;  2XEW A;  4P1B C;  3SR6 A;  3BZD B;  2JSV X;  2ZVO A;  4AWJ A;  1YOV B;  2ONQ A;  3NRZ A;  2KZR A;  5T8I A;  1FIQ A;  1UD7 A;  3ZUN A;  3AEC B;  3HM6 X;  2K9X A;  3GE3 C;  4S17 A;  2RMM A;  1YNT E;  4MGK E;  3CIR B;  4KX6 B;  3L10 B;  3N1X C;  4FAD A;  4W9D A;  1TKG A;  3PLU A;  2KVR A;  2K1F A;  4HWI B;  4MSM B;  2QDF A;  2GMI C;  3JVZ X;  3DWM A;  1MFW A;  1FRR A;  4LNK A;  4IOI E;  4JIO U;  4M00 A;  4GGQ A;  4CHK A;  4HVB A;  4FHJ A;  3VTW A;  4EZL A;  3KYC D;  2BS2 B;  2V3P A;  2HE7 A;  1MG8 A;  4GSW A;  1DOX A;  1ZDX A;  1OQY A;  4IWO A;  4YL8 A;  3IT4 B;  4N58 A;  2Y5C A;  4GXB A;  4GU2 A;  1PYW D;  1LQB A;  1WJN A;  3VH4 B;  1F9J A;  2L52 A;  2XBB C;  2NPT A;  2AQ3 B;  5BYS A;  2KX0 A;  3RZF A;  5G55 A;  4M01 A;  2PW9 A;  2CKH B;  4LDT B;  1V5T A;  3OJ4 B;  1CJE A;  2WXI A;  1DOI A;  3L17 A;  4NQL B;  2DAJ A;  1OFF A;  1TZO A;  5IKC M;  1V2Y A;  2JU6 X;  2GOW A;  3HIZ A;  3ALB A;  3D32 A;  3MP9 A;  3KYD D;  4A3P A;  2BTE A;  1SJH D;  2AWT A;  1K53 A;  1WZ0 A;  3ZNG C;  2EMS A;  3ZNH B;  1GJZ A;  2IGD A;  2MP2 A;  4A55 A;  1WH3 A;  2IPK D;  4JWU C;  3WAM A;  3AE4 B;  3RNC C;  4BKG A;  3SU8 X;  1ZDV A;  3I63 C;  2OJR A;  3NY5 A;  3R7R A;  1UF0 A;  4K7S A;  2WXR A;  1WGY A;  3DCG A;  1D4B A;  1VLB A;  1OEY A;  5E6P A;  4TSS A;  1FFV A;  2BW2 A;  3M62 B;  3AE3 B;  2GLS A;  4QAY A;  2G9H D;  5LXH A;  3PVL A;  3GOE A;  2W9N A;  3CWI A;  4G11 A;  3OAW A;  5BMH A;  4NJ6 A;  2K25 A;  2K6Q A;  3PT2 B;  1M4V A;  1WXV A;  1IPG A;  5C2T B;  1JAL A;  2PE6 B;  3ZRC A;  2MBO A;  3KUC B;  4WWN A;  4XGA B;  4ASW C;  1SBB B;  1GUA B;  2MP2 B;  4K7W A;  2WXK A;  5GXG B;  1E90 A;  3PO0 A;  4YSX B;  3I3T B;  2J0M A;  3IHP C;  2W82 A;  2JZZ A;  3NS1 A;  4ZRQ A;  1I4R A;  4IC7 B;  4AQ7 A;  4LK0 M;  4LNN A;  4RM8 A;  4M8M A;  5J17 A;  4BOZ B;  2Z59 B;  2L00 B;  4G0N B;  2M0X A;  3ZJU A;  5JZE B;  4PYU A;  5JH5 C;  1VD2 A;  1WIA A;  1KLV A;  2NVU I;  2K22 A;  2RPQ A;  5C1Z A;  3N32 A;  2D07 B;  2N9E B;  2Y5B B;  4RM9 A;  5IO9 A;  3V62 A;  4FBJ B;  3ZJT A;  3GE8 C;  1FNV A;  2ICI A;  1YJ1 A;  2LI5 A;  1WXQ A;  2RR9 A;  4B0E A;  1MI0 A;  2FCN A;  5JHB A;  3T3O A;  2KWV B;  1ET6 A;  3QAQ A;  4HPM B;  2MJ3 A;  3DBL I;  1J8C A;  3A4R A;  4C4V B;  4XC2 A;  1WWT A;  3IBE A;  1RRB A;  2INN E;  3BYY B;  2BYV E;  2FAZ A;  3UGB B;  5CTR C;  3BVG A;  2HJ1 A;  1FO4 A;  1CQV A;  4R3D A;  5BYQ A;  2FE8 A;  3OG5 A;  3TEZ A;  2KK8 A;  3MHZ A;  4M0W A;  4KSL C;  1NI2 A;  1C9F A;  1YN5 A;  3A9J B;  1UNS A;  2KDF B;  3NOB A;  4KVG B;  1XEE A;  2NTT A;  2W55 A;  1MHH E;  3OWE B;  3R7Q A;  5EE0 A;  2BS3 B;  2XK5 A;  2KQS A;  1I7H A;  2KT7 A;  1GC7 A;  2WXP A;  3A9J A;  3VXW A;  2WWZ A;  2L05 A;  1HZ5 A;  3A33 B;  2ZPY A;  4MGZ E;  2AX5 A;  3SDL C;  2Z8L A;  3H9D A;  2KAC A;  2FCS A;  1QOB A;  4XE0 A;  2N9P C;  3LYY A;  1KLU D;  4RF0 A;  2K5P A;  1SIJ A;  2KKC A;  4A90 A;  4XZ4 A;  4HPP A;  4W9I A;  4HLE A;  2RDB C;  1GPX A;  3AUL A;  3NVZ A;  2BS4 B;  1BUI C;  3ZDT A;  3AEG B;  4X57 B;  2FBW B;  1SXT A;  4FJV B;  2DZM A;  3DBH I;  1YD8 U;  3W1S C;  1WZ3 A;  1YQ4 B;  4YSY B;  4DXA B;  2XK5 B;  4DDG D;  1JRU A;  2N4F A;  3O13 A;  3W1S A;  4HKZ E;  3ZW3 A;  2VH1 A;  4JWS C;  1I4P A;  2WX1 A;  2G4S A;  3DVN U;  2I2Y A;  3RNB C;  2WS3 B;  3P63 A;  2DYB A;  3UI3 A;  3TEX A;  2IY0 B;  3CMM B;  3DBH B;  3UQB A;  4ZDV A;  3H6N A;  2DBY A;  4ITK A;  1I4H A;  2K8H A;  2KN5 A;  2KTR A;  2KNB A;  2QHO A;  3DVG X;  5G5H A;  4DHJ B;  3Q8F A;  2GBN A;  1E5W A;  3HVD A;  3AE9 B;  3AB5 A;  2L32 A;  2WU5 B;  2CHW A;  5HFY A;  4UDU C;  4IUM B;  4KDI C;  3W1Y A;  4PK1 A;  3KW5 B;  2NBV B;  4W9F A;  4DWF A;  1EU4 A;  3NS8 A;  1SE4 A;  3TCA A;  2KWU B;  3TL5 A;  1J19 A;  2LGX A;  2N1V A;  3RNG C;  2KDB A;  4ZHP A;  4MGY E;  4LTU A;  4YT0 B;  2RDH A;  4WQO B;  1F0Z A;  2G3Q B;  2VZK B;  2D10 A;  2M56 B;  3QCA A;  2DAF A;  2WP9 B;  1JRP A;  1Q10 A;  3JSV B;  1YJI A;  2QSD A;  2FCQ A;  4IM3 A;  3ECI A;  2KD0 A;  3R2T A;  4KZC A;  4RH6 A;  3HVZ A;  4BAX A;  2IJ0 A;  2H89 B;  3VUY A;  4TUU A;  2V3S A;  3MC8 A;  4M8N A;  2HD5 B;  2R61 A;  4ZOH C;  2JRH A;  2IO3 B;  2L76 A;  4C80 A;  3RNE C;  1L0V B;  1D6E C;  3PZ7 A;  1E8X A;  2MH7 A;  1YX5 B;  1YN4 A;  1TY0 A;  1LM8 B;  2ZVN A;  4YTP B;  1SB3 C;  3FIL A;  5EE9 A;  2MX2 A;  3ML8 A;  3AE5 B;  4C00 A;  1OQQ A;  2LUE A;  3L13 A;  1WF9 A;  3ZKJ C;  1PGB A;  3DVG Y;  3L0W B;  2J0J A;  1C78 A;  4DHJ D;  2NTS A;  3Q69 A;  3PSE B;  2D3A A;  3T8M A;  1I42 A;  3KLS X;  1VR9 A;  2KLG A;  2N9L A;  3Q3N C;  4WWM A;  2MA9 B;  1WYG A;  2X38 A;  2KTF A;  1UBQ A;  3RUL A;  2KJR A;  1SJE D;  2N7D A;  1G6J A;  3U7D A;  1PFD A;  3L54 A;  2A4Z A;  1FXT B;  4NNJ B;  3UF8 A;  5E6O A;  3PTF C;  3LJ3 A;  5AEK B;  1X1M A;  3A1Q A;  4PS8 A;  1EO6 A;  4WUR A;  3PHX B;  4LJP B;  1HQR D;  1LFD A;  3U7Z A;  4NAW A;  4AJY B;  4WWO A;  1EUV B;  4MEL A;  1XQQ A;  2RSU A;  2C5L C;  3NVV A;  5IAA C;  5LXI B;  2DZJ A;  1PUT A;  4LNO A;  1F52 A;  2MCN B;  3VUX A;  1C4A A;  1JQ4 A;  4J3O D;  4DK5 A;  3Q14 C;  1Y56 A;  3ZRF A;  4KSK C;  1SE2 A;  1K51 A;  3ZGZ A;  1WMH A;  3VR8 B;  2EKE C;  4W9K A;  3TBL D;  1E7P B;  4EEW A;  2CHZ A;  2BPS A;  2N7J A;  1VRA B;  4OZA A;  4W9L A;  2JZP A;  4DXG A;  3EHV A;  5EE3 A;  2QCZ A;  1QQR A;  1SE3 A;  2JXT A;  1JW9 D;  1FM0 D;  1YJJ A;  2KDE B;  4MH8 A;  2WXG A;  1JWM D;  2CR5 A;  2N0S B;  2RPV A;  1XCQ L;  3T3N A;  3VFK A;  1HE8 A;  3N1Z C;  1L4D B;  3DHI C;  3EEC A;  1EF1 A;  2WHI A;  4KDL B;  3ZTC A;  3IT6 B;  2C60 A;  2IO1 B;  1P9D U;  2L8J A;  3H1U A;  1QT9 A;  4GOC A;  2PKO A;  5AZG A;  4WJO A;  3JSV A;  2CJO A;  2NR2 A;  2Z0D B;  3PRM B;  1D3Z A;  5J18 A;  3DQV A;  4GDK B;  4N6E B;  5FR6 A;  2IND C;  1Y8R C;  3AH7 A;  4WWP A;  1QIL A;  1V1O A;  2FUG 1;  5MPO A;  1ROE A;  2GBK A;  3BYT B;  2DZK A;  2M1M A;  2BBC A;  2LGY A;  2K6D B;  1S3S G;  1NEK B;  3QK0 A;  2J0K A;  2X8X X;  1TBE A;  5EDS A;  2W3S A;  2DYO A;  3VRB B;  4C7Z A;  2JWZ A;  3VDZ A;  3DBR I;  1N62 A;  2CHX A;  1I35 A;  1N5X A;  2UWQ A;  1HXY D;  2WNM A;  3N20 C;  4PS3 A;  2J7Q B;  2GBJ A;  3P4P B;  4KIK B;  3W2D A;  2BQQ A;  3WA0 A;  1LXD A;  3P42 A;  3H7P A;  1ZXH A;  3FIL B;  1I4Q A;  3GB1 A;  5HHD G;  1UWX A;  2VZK D;  4REZ A;  3ZXV A;  2QIE B;  1NYQ A;  2JUO A;  2B3A A;  3M63 B;  2NS5 A;  1V86 A;  3MFG A;  5FK9 C;  2WXO A;  2DYM A;  4MDK E;  3AXC A;  2ZNV C;  4MJS A;  1GB4 A;  4HRO A;  2TSS A;  2CU3 A;  3PRP B;  1Q5W B;  1OGW A;  3H8H A;  3Q8E A;  3AMZ A;  3SFE B;  1TS3 A;  5CHV C;  3RNF C;  4DDI D;  1GAQ B;  4GDK A;  1PQS A;  2BGF A;  5E6N A;  1ACC A;  1T3Q A;  1ET9 A;  2MWS B;  3PRE A;  3ZVV A;  1L6U A;  2WDQ B;  1L5P A;  2AL3 A;  4JL9 A;  1FD6 A;  1ZP0 B;  3JYU A;  4HPL B;  4OVV A;  2LGD A;  3AV8 A;  3Q6B A;  5KHO A;  2KDM A;  1ZOY B;  3AEF B;  3PS6 A;  2O6V D;  2WLB A;  3KH0 A;  2C7H A;  5FR3 A;  3ENE A;  2KC2 A;  4JPS A;  3U52 E;  2KAJ A;  1MHX A;  3R8B A;  2WXF A;  3ZYY X;  2BYF A;  2LEK A;  5HI1 A;  1FCC C;  1WGK A;  2KFJ A;  2KFK B;  5C3J B;  2K8B A;  2VH2 A;  2MW5 A;  4MM3 B;  3P4R B;  2L0T A;  1QOG A;  2OHF A;  2KAN A;  2WX0 A;  2D3B A;  1JWU D;  5DPW A;  1N63 A;  4HDO A;  2PVG C;  2LHD A;  2V4I B;  2G1E A;  4BBN C;  4YXD B;  2MBH A;  4ZHO A;  4NY0 A;  1P3Q U;  3RT3 B;  1GNU A;  2O6V B;  2KC1 A;  4AOF A;  4BOS C;  1N61 A;  1OTR B;  1KOT A;  2R2Q A;  2V3N A;  3CST A;  1AN8 A;  1WX9 A;  2VRR B;  3DVN V;  3TJP A;  3B2F A;  4JE3 B;  1L4Z B;  1WSP A;  2LZ6 A;  3B9J A;  4GDL B;  1T0S C;  3WAP A;  4URK A;  1QOA A;  1IGD A;  1V5O A;  1V81 A;  2HTH A;  2O6V A;  4LLG M;  3NG0 A;  3MJW A;  4EZK A;  1C4P A;  1C4C A;  4BKT A;  4HKQ A;  3FAH A;  3NZU A;  3M3J A;  3APD A;  2FID A;  4AP4 C;  2KJ6 A;  5IN7 A;  2OED A;  1UZX B;  3T9L A;  4FJY A;  5D94 A;  5G2N A;  4RCO A;  3SD5 A;  2KQ4 X;  4NQK E;  4N59 A;  1KRH A;  1GB1 A;  1BT0 A;  2LVQ A;  4HK2 A;  4NJC A;  1Z5S B;  3W5V B;  1MG4 A;  2KXJ A;  2Y5P A;  1SGH A;  1VZ8 A;  1WJ6 A;  2UYZ B;  2KFK A;  3TEY A;  4ICU A;  2DLB A;  5D2M B;  1NBF C;  4GDL A;  1V1P A;  4B9K A;  1NDD A;  3NZS A;  1A5R A;  4HCN B;  2C7M B;  3DBR B;  2C9W B;  3AEE B;  3KUZ A;  1D5X C;  4RF1 A;  3Q8C A;  4W9C A;  1HZ6 A;  1H4R A;  5D6J B;  2IO2 B;  2IY1 B;  2BKR B;  1C76 A;  5D3D A;  2DWQ A;  1J0G A;  1E8Z A;  5DPR A;  1F1H A;  2D11 A;  4JLC A;  2CU1 A;  1SEB D;  4P16 A;  2M17 A;  1J7A A;  3B1L X;  2BT6 A;  1WX8 A;  1WJ4 A;  4WJP A;  3TEW A;  4P6V F;  1M94 A;  2LUM A;  2O2V A;  3QC8 B;  2IGH A;  2BYE A;  2K3U A;  4FXC A;  5CX3 A;  2AQ1 B;  1XLN A;  2WYQ A;  4FUL A;  2PLP A;  4OVZ A;  4ANU A;  5AUK A;  2YEP F;  3V6C B;  2JWU A;  4GMV A;  3KWL A;  1TKE A;  3GZN B;  1C3T A;  4GIV A;  1XLO A;  3CSF A;  2GI9 A;  3N3K B;  4GB9 A;  2LRW A;  3WAN A;  2H88 B;  2KX3 A;  4F1S A;  2BB6 A;  4I6L B;  3BII D;  5D3I B;  2MLB A;  1Q0W B;  4W9G A;  1IUE A;  2ZZP B;  1WXS A;  3ZQ4 A;  3R2I A;  5E6J A;  2CJN A;  2W3R A;  1R4M B;  4NJ7 A;  2K0P A;  4RFB A;  2GBR A;  1UGM A;  4HCP B;  2ZW1 A;  3UIO B;  1TJE A;  3HHM A;  3B2G A;  2PEA A;  3DBS A;  5DCN A;  1L0Y B;  1QLB B;  2JVC A;  3BVZ A;  4C4V A;  4ZRK A;  1TTN A;  4YWG G;  4DXF A;  2YLM A;  1TZ1 A;  3NJT A;  2BF8 B;  4IM2 A;  2LAS A;  4G50 A;  1YQB A;  4OVU A;  1KTK A;  1XCT L;  2NPT B;  1HA5 A;  1N6Z A;  3HM3 A;  3R3M A;  4LNI A;  3LXF A;  5L83 A;  4EE2 A;  1GOZ A;  3K9O B;  4CO7 A;  4ZYS A;  4GLS C;  3DPD A;  2FCM A;  1K52 A;  4B95 A;  3R66 C;  4ARC A;  3ZTD A;  4ANW A;  1AWD A;  2MBE A;  3IVF A;  4C7Y A;  2MRP A;  1J7C A;  4CQN A;  3AE8 B;  3V60 A;  1OEY J;  1UUP A;  2JRI B;  4EOY A;  1E8Y A;  4KV2 A;  3QA8 A;  3PZD A;  4A6Q A;  2EKI A;  2N9K A;  1P7E A;  4O1N A;  1NEN B;  4ANX A;  4OHJ A;  3MHS D;  3AED B;  1SIF A;  2KMC A;  2ZCC A;  3Q3F A;  3GS2 A;  3RCZ A;  4WJQ A;  1I4G A;  1WGG A;  2BWE S;  2V9H A;  1ZKH A;  1T0R C;  1STE A;  2LGS A;  4DQO C;  4RMA A;  2LGI A;  1V8C A;  4B0M A;  1FCL A;  3A1Q B;  1T5X D;  5BO4 B;  4ZRP A;  1Z2M A;  3C19 A;  3QIJ A;  1FPY A;  2M8S A;  4L2Y A;  3IFW B;  2SEB D;  1D5Z C;  1FRD A;  1AYF A;  1WYW B;  2PTL A;  3U30 A;  4NPN A;  1E8W A;  1Q1O A;  5IA7 A;  2ZCB A;  4E71 A;  4CYE A;  1WE7 A;  2OOB B;  3P4S B;  1E6E B;  2L83 A;  1KFY B;  2AEH A;  3NZ3 A;  4D2K A;  4MEM A;  1XLP A;  1XO3 A;  3Q3J A;  4XDC A;  1C1Y B;  3PHW B;  1MVK A;  4ARI A;  3SHQ A;  3IG3 A;  2G4D B;  2LVO A;  3VTV A;  1XD3 B;  1DYQ A;  1DGJ A;  1WM3 A;  3AU5 A;  5I4D A;  2PIA A;  2WXM A;  1DOY A;  4MAC A;  2SAK A;  3SEB A;  2JXX A;  3NVW A;  3A9K A;  3BWU D;  4HJK A;  3LB8 C;  1V9J A;  4WAA A;  1V6E A;  3AE1 B;  4MH0 E;  2Q5W D;  1FXA A;  2WDV B;  3Q3M C;  2JX5 A;  4TV3 A;  1N60 A;  2G45 B;  3AE6 B;  1T6B X;  2N9X A;  2MSE D;  2NBU A;  4TQ0 A;  1N5W A;  3V3X A;  3N1Y C;  1HTQ A;  2ZJD A;  3EC8 A;  4USA A;  1VZ7 A;  4B6W A;  2MBB B;  4M0W B;  4JX1 C;  3DHG C;  2JPH A; 
#chains in the Genus database with same CATH homology
 3P2B A;  5CHV C;  2JF5 A;  1IP9 A;  2DX5 B;  4JGH B;  3X23 A;  4DDI D;  4K1R B;  2AL6 A;  2KK8 A;  5C23 A;  2ASQ A;  4GDK A;  4IW0 A;  1PQS A;  2BGF A;  2KQ7 A;  4KSL C;  5E6N A;  1NI2 A;  2MWS B;  3PRZ A;  3PRE A;  3A9J B;  4ICV A;  2ZEQ A;  3ZVV A;  2AL3 A;  4JL9 A;  1YX6 B;  2KDF B;  2CS4 A;  3NOB A;  4J6I A;  4KVG B;  5J2R A;  2LXA A;  3L16 A;  2MBQ A;  3JYU A;  4AUQ C;  4HPL B;  4OVV A;  5CHF A;  2LGD A;  5KHO A;  3R7Q A;  1L2N A;  5DPS A;  3PS6 A;  2O6V D;  2XK5 A;  3KH0 A;  4FA6 A;  2C7H A;  1SE9 A;  2KQS A;  4II3 B;  3ENE A;  3TMP B;  1GC7 A;  1WJU A;  2KC2 A;  3A9J A;  3VH3 B;  3PGE A;  3VXW A;  2WWZ A;  2BYF A;  4IM0 A;  3HK0 A;  2L05 A;  2N1W A;  2MQJ A;  3A33 B;  2KFJ A;  2KFK B;  2K8B A;  2MW5 A;  2ZPY A;  4MJS B;  1WX7 A;  2L0T A;  3K9P B;  4MGZ E;  3QAR A;  1WR1 A;  2KAN A;  2WX0 A;  3H7S A;  3SDL C;  4AJW A;  5DPW A;  4EKU A;  3RUI B;  3H9D A;  1S1Q B;  2FCS A;  2JY6 A;  3TJP A;  4HDO A;  2N9P C;  4DHZ E;  2V1Y A;  3QX1 A;  4TKN A;  2LXC A;  2M4N A;  3A9K B;  3QWZ B;  4BBN C;  1WY8 A;  2MBH A;  4W9J A;  2DZI A;  4NY0 A;  4GN1 A;  5LLI A;  1P3Q U;  3RT3 B;  2KHW B;  1GNU A;  2KKC A;  2O6V B;  2HJ8 A;  3RD2 A;  2KC1 A;  3H7P B;  3NHE B;  4XZ4 A;  4AOF A;  4BOS C;  1YIW A;  2IZV B;  2GBM A;  4BKS A;  1OTR B;  4W9I A;  1KOT A;  4HLE A;  1IYF A;  2R2Q A;  1WE6 A;  2ZNV B;  3AUL A;  3ZDT A;  3V6E B;  1UEL A;  1P98 A;  3CST A;  2VRR B;  1WX9 A;  3DVN V;  3ML9 A;  4FN2 A;  3L08 A;  3N30 A;  4FJV B;  4X57 B;  2DZM A;  1RFA A;  3DBH I;  1YD8 U;  2LZ6 A;  3W1S C;  1WZ3 A;  3RZW C;  4GDL B;  2V4L A;  3WAP A;  3ZDM C;  4URK A;  4E3C A;  4DXA B;  1VCB A;  2XK5 B;  1XT9 B;  3OJ3 A;  4DDG D;  2LD9 A;  2LWP A;  1V5O A;  1V81 A;  2HTH A;  2O6V A;  1JRU A;  2N4F A;  3MJW A;  1WI0 A;  4EZK A;  2O2V B;  4BKT A;  3BIN A;  3W1S A;  3NZU A;  2ZPN A;  4WJN A;  3APC A;  3M3J A;  3APD A;  3ZW3 A;  2BWF A;  2K8C A;  3JW0 X;  2FID A;  2WX1 A;  3EFU A;  2G4S A;  3DVN U;  3LDZ E;  4FHK A;  4P7I A;  4EFO A;  1CMX B;  3U8Z A;  1T0Y A;  4W9E A;  4AP4 C;  5KHQ A;  2DYB A;  2KJ6 A;  5HKH A;  3UIN B;  1QZE A;  1UZX B;  2IY0 B;  2KJH B;  3CMM B;  3KUD B;  3ZIM A;  3UQB A;  4IWQ A;  3T9L A;  4ZDV A;  2KOX A;  3H6N A;  1U4A A;  2K39 A;  4FJY A;  5D94 A;  5G2N A;  1WM2 A;  2K8H A;  3SD5 A;  1KM7 A;  2KN5 A;  2C7N B;  4NQK E;  2KTR A;  2KNB A;  2KDI A;  2QHO A;  3DVG X;  3UQA A;  4DHJ B;  1BT0 A;  1V49 A;  2LVQ A;  2GBN A;  3B08 A;  1E5W A;  3MTN B;  4HK2 A;  1Z5S B;  4MGI E;  2IBI B;  3X0W A;  2NBW B;  3VUW A;  2CHW A;  4LCD E;  2KTR B;  3QQ8 B;  4I6P A;  2KXJ A;  3PLV A;  1ZW7 A;  1SGH A;  4IUM B;  4K7U A;  1WJ6 A;  1ZGU B;  2UYZ B;  2KFK A;  4A20 A;  4ICU A;  4KDI C;  3W1Y A;  4BKS D;  3M95 A;  5D2M B;  1NBF C;  3KW5 B;  2NBV B;  4GDL A;  1WMH B;  3GZN I;  4W9F A;  4JQW C;  4DWF A;  1WGD A;  4IG7 B;  3NS8 A;  4B9K A;  1NDD A;  3NZS A;  3TCA A;  2KWU B;  1A5R A;  2JZ3 B;  2KWC A;  2D3G A;  5DPT A;  3TL5 A;  4HCN B;  1J19 A;  2LGX A;  2C7M B;  1EF5 A;  2N1V A;  2KDB A;  2RD0 A;  2PPH A;  4MGY E;  1E7U A;  2L3Z A;  2C9W B;  4WQO B;  4EUT A;  2G3Q B;  1K8R B;  2D10 A;  4IWP A;  4HXD A;  3B0A A;  3KUZ A;  3WAO A;  4LDT D;  4E74 A;  3QCA A;  2A5U A;  2DAF A;  3PV1 A;  4W9C A;  1P0R A;  4BVU C;  1H4R A;  3JSV B;  2FCQ A;  5D6J B;  2D2Q A;  3ONS A;  2IO2 B;  3ECI A;  2IY1 B;  2KD0 A;  2XEW A;  4IM3 A;  4ZYN A;  1V80 A;  2BKR B;  4KZC A;  2ZVO A;  4AWJ A;  3VUY A;  1E7V A;  1E8Z A;  1J0G A;  2R2O A;  2KZR A;  4TUU A;  4ZRJ A;  2V3S A;  1UD7 A;  3ZUN A;  5DPR A;  2D11 A;  3AU4 A;  4JLC A;  2CU1 A;  3HM6 X;  4M8N A;  2M17 A;  2HD5 B;  3B1L X;  2L7R A;  1WX8 A;  1RAX A;  3TIX A;  1WJ4 A;  2JRH A;  2AYO B;  4A3O A;  1AAR A;  4WJP A;  2IO3 B;  4PS7 A;  1M94 A;  3QHT A;  2L76 A;  4MGK E;  2O2V A;  4DHZ B;  4KZ0 A;  3QC8 B;  2BYE A;  4II2 B;  1E8X A;  5CX3 A;  4KIK A;  5JHA A;  1YX5 B;  3L10 B;  4MSQ B;  4FAD A;  2WYQ A;  4W9D A;  4FUL A;  3PLU A;  4ANU A;  2KVR A;  1LM8 B;  3V6C B;  2K1F A;  2ZVN A;  4HWI B;  4MSM B;  5D7G A;  4GMV A;  4PYZ A;  2GMI C;  2MX2 A;  3ML8 A;  3JVZ X;  1C3T A;  4GIV A;  2DHZ A;  5AZH A;  2JT4 B;  2LUE A;  1L7Y A;  3L13 A;  4JIO U;  1WF9 A;  3QJZ A;  3ZKJ C;  3CSF A;  3ZO5 B;  4GGQ A;  4CHK A;  3N3K B;  4GB9 A;  2LRW A;  3WAN A;  3DVG Y;  2KX3 A;  4F1S A;  4HVB A;  4FHJ A;  3VTW A;  4EZL A;  3L0W B;  2J0J A;  2FUH B;  4I6L B;  1WRD B;  4DHJ D;  2MLB A;  1Q0W B;  3KYC D;  4FJZ A;  2FIF A;  2HE7 A;  1MG8 A;  2RGF A;  4GSW A;  4W9H A;  3ZNZ B;  4W9G A;  2ZZP B;  3PSE B;  2IYD B;  1WXS A;  4EZJ A;  3T8M A;  1I42 A;  1OQY A;  4IWO A;  4YL8 A;  2KLG A;  4NJ7 A;  3UIP B;  4ZRI A;  1GG3 A;  2MA9 B;  3V61 A;  4GXB A;  4GU2 A;  2GBR A;  1UGM A;  4HDQ A;  1LQB A;  3O65 B;  2KTF A;  4HCP B;  3UIO B;  3ZNI D;  4F8C B;  3HHM A;  1WJN A;  1UBQ A;  3VH4 B;  3RUL A;  1F9J A;  1GC6 A;  2N7D A;  2KJR A;  1WGR A;  2XBB C;  2NPT A;  2PEA A;  3DBS A;  3U7D A;  1G6J A;  5DCN A;  1UH6 A;  2KX0 A;  3RZF A;  2JVC A;  3KVF B;  5G55 A;  2DEN B;  3L54 A;  4ZRK A;  2A4Z A;  2LVP A;  1FXT B;  1TTN A;  4NNJ B;  3UF8 A;  4LDT B;  5E6O A;  3PTF C;  3VHT C;  3LJ3 A;  5AEK B;  1X1M A;  1V5T A;  1TZ1 A;  2YLM A;  3OJ4 B;  3VTU A;  3A4S C;  3A1Q A;  4TQ1 A;  4PS8 A;  1EO6 A;  3PHX B;  4LJP B;  2BF8 B;  1LFD A;  2FNJ B;  4IM2 A;  2KO3 A;  2LAS A;  4G50 A;  4NAW A;  1YQB A;  3WIM A;  4OVU A;  1EUV B;  4WWO A;  4AJY B;  3L17 A;  4LJO B;  4MEL A;  1XQQ A;  2NPT B;  2RSU A;  4NQL B;  3S2A A;  2DAJ A;  2C5L C;  2PJH A;  3HM3 A;  5IAA C;  3VVW B;  5LXI B;  1V2Y A;  2DZJ A;  3R3M A;  5L83 A;  2GOW A;  3HIZ A;  3ALB A;  3D32 A;  4XX5 A;  2MCN B;  3K9O B;  3VUX A;  4CO7 A;  2REX A;  4DK5 A;  3KYD D;  1WXM A;  4A3P A;  1R4N I;  3ZRF A;  4KSK C;  2AWT A;  3C0R B;  3DPD A;  2FCM A;  1WZ0 A;  3ZNG C;  2EMS A;  1WMH A;  3ZNH B;  4B95 A;  1GJZ A;  2MP2 A;  3R66 C;  4G3X B;  2EKE C;  4W9K A;  4F7Z A;  3TBL D;  1ISN A;  1WH3 A;  4EEW A;  2CHZ A;  1P1A A;  2BKF A;  2BPS A;  3ZTD A;  3RYT A;  2I1J A;  3PPA A;  4W9L A;  2MBE A;  4ANW A;  1WGH A;  3EHV A;  2EMT A;  3WAM A;  3IVF A;  2MRP A;  4BKG A;  3SU8 X;  3V60 A;  2OJR A;  1OEY J;  3NY5 A;  3CF6 E;  3R7R A;  2JRI B;  4EOY A;  3DOW A;  2KDE B;  1E8Y A;  3QA8 A;  4K7S A;  3PZD A;  4KV2 A;  2CR5 A;  1WGY A;  3DCG A;  4ANX A;  3VFK A;  1HE8 A;  3MHS D;  5TR5 A;  2WDT B;  3EEC A;  1EF1 A;  4KDL B;  1OEY A;  2N7E A;  2NCN A;  5E6P A;  1SIF A;  2KMC A;  2ZCC A;  3Q3F A;  3ZTC A;  3M62 B;  2L0F A;  3RCZ A;  2C60 A;  2IO1 B;  1P9D U;  1WGG A;  2BWE S;  4WJQ A;  2L8J A;  3H1U A;  1ZKH A;  5LXH A;  3PVL A;  4GOC A;  4RMA A;  3GOE A;  1WXA A;  2W9N A;  5CHW A;  4WJO A;  3JSV A;  2NR2 A;  5AZG A;  2PE9 A;  4G11 A;  3OAW A;  5AZF A;  2Z0D B;  4NJ6 A;  2K25 A;  3PRM B;  2K6Q A;  3A1Q B;  1D3Z A;  5BO4 B;  2IO0 B;  3PT2 B;  1WXV A;  5J18 A;  1IPG A;  3DQV A;  4GDK B;  5FR6 A;  1Z2M A;  3QIJ A;  4ANV A;  3ZRC A;  2PE6 B;  2M8S A;  3IFW B;  1Y8R C;  2MBO A;  3KUC B;  3DDC B;  4WWN A;  1KJT A;  4ASW C;  4WWP A;  3OLM D;  1GUA B;  1WYW B;  2MP2 B;  2GBK A;  2DZK A;  4K7W A;  3U30 A;  2M1M A;  1UBI A;  1H8C A;  3VAW A;  2LGY A;  2K6D B;  1E90 A;  1S3S G;  4NPN A;  3I3T B;  2J0M A;  3QK0 A;  4NAW B;  3IHP C;  1E8W A;  2J0K A;  2JZZ A;  1Q1O A;  1TBE A;  3VQI A;  5EDS A;  5IA7 A;  2ZCB A;  5L95 C;  4E71 A;  1WFY A;  4IC7 B;  4CYE A;  2DYO A;  2KLC A;  1WE7 A;  2OOB B;  4K81 A;  3ZLZ A;  4N9F 4;  2JWZ A;  3VDZ A;  4RM8 A;  2AEH A;  4M8M A;  5J17 A;  4BOZ B;  2Z59 B;  3DBR I;  4MEM A;  1R4M I;  2CHX A;  2L00 B;  3Q3J A;  4G0N B;  2M0X A;  3AI5 A;  2UWQ A;  1I35 A;  5JZE B;  4PYU A;  4PS3 A;  2J7Q B;  1C1Y B;  2GBJ A;  4KIK B;  2Z0E B;  5GMV A;  5JH5 C;  1VD2 A;  3PHW B;  4FLH A;  1WIA A;  1KLV A;  2NVU I;  2RPQ A;  3SHQ A;  3IG3 A;  4I6N B;  2G4D B;  5C1Z A;  2LVO A;  3WA0 A;  1RLF A;  3VTV A;  1LXD A;  1XD3 B;  1WM3 A;  3H7P A;  3AU5 A;  3N32 A;  2D07 B;  2N9E B;  2Y5B B;  2YVC A;  4RM9 A;  2JUO A;  3V62 A;  3APF A;  2JXX A;  4FBJ B;  2B3A A;  3A9K A;  3M63 B;  4HJK A;  2I1K A;  2NS5 A;  1V9J A;  4DBG A;  1V86 A;  1YJ1 A;  2LI5 A;  1V6E A;  2LRU A;  2RR9 A;  4WAA A;  4BBN F;  4MH0 E;  2DYM A;  4BFR A;  2FCN A;  4MDK E;  5JHB A;  4TV3 A;  2G45 B;  2KWV B;  1WR6 E;  3AXC A;  3QAQ A;  4HPM B;  3DBL I;  1TGZ B;  2ZNV C;  2N9X A;  4MM3 A;  4MJS A;  2MSE D;  2NBU A;  3BY4 B;  1J8C A;  3A4R A;  4TQ0 A;  4XC2 A;  3IBE A;  2LJ5 A;  1RRB A;  3PRP B;  2ZJD A;  3EC8 A;  1Q5W B;  2KMA A;  3WAL A;  1OGW A;  2BYV E;  2FAZ A;  3UGB B;  4B6W A;  5CTR C;  2MBB B;  4M0W B;  2CKH B;  2JPH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...