5CHVC

Crystal structure of usp18-isg15 complex
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
153
structure length
153
Chain Sequence
AWDLKVKMLGGNDFLVSVTNSMTVSELKKQIAQKIGVPAFQQRLAHQTAVLQDGLTLSSLGLGPSSTVMLVVQNSSEPLSILVRNERGHSNIYEVFLTQTVDTLKKKVSQREQVHEDQFWLSFEGRPMEDKELLGEYGLKPQCTVIKHLRLRG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ubl carboxyl-terminal hydrolase 18
publication title Structural basis of the specificity of USP18 toward ISG15.
pubmed doi rcsb
source organism Mus musculus
molecule tags Hydrolase
total genus 34
structure length 153
sequence length 153
chains with identical sequence D
ec nomenclature
pdb deposition date 2015-07-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00240 ubiquitin Ubiquitin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 5chvC02
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 5chvC01
3ENEA 4MJSA 2ZPYA 3DVNV 3W1SA 1NBFC 2RR9A 4CO7A 2D3GA 2I1JA 4W9GA 2BPSA 1TGZB 3QA8A 2JUOA 2V3SA 2DAFA 5E6NA 4FN2A 3IHPC 4E3CA 2L00B 4A3PA 2LI5A 4W9FA 4NJ6A 2FCSA 3APCA 2EMSA 3R7RA 3ZLZA 4E74A 3U7DA 1WMHB 2VRRB 3UF8A 4MH0E 3ZO5B 3UQAA 2PJHA 4NNJB 3ZNGC 4IC7B 5GMVA 2RSUA 4K81A 2Y5BB 3LJ3A 4LJPB 1UBQA 2GMIC 3MHSD 1UH6A 2K25A 3L08A 3DBHI 2CKHB 2LXCA 3PV1A 1J8CA 2KO3A 3OLMD 2GOWA 2N9EB 4ZRIA 4II3B 4GOCA 3V61A 2PEAA 4MEMA 1LFDA 1QZEA 1K8RB 1WJUA 3IFWB 4JIOU 4HCPB 4W9DA 3RCZA 2JZZA 3UIOB 2G4DB 2EKEC 1JRUA 1ZGUB 2FAZA 2XEWA 5BO4B 3X0WA 4AWJA 4EZKA 1BT0A 4ZRJA 1WX8A 3PVLA 3V60A 1VD2A 3APFA 3NOBA 2MBOA 4WJPA 2MQJA 4K1RB 4BVUC 2BGFA 1EF5A 2NPTA 4AUQC 1P0RA 1GG3A 3AI5A 1P1AA 3C0RB 3R3MA 3QK0A 4MGIE 2NVUI 1XQQA 2BYFA 2C7HA 2Z0DB 4RM9A 2O6VA 1RLFA 2BKFA 1YIWA 2DZKA 2KJHB 3NHEB 3R66C 3ZDTA 3NZUA 3VVWB 2ZNVB 1C1YB 2ZEQA 2KQSA 4GGQA 1EO6A 2WWZA 3JVZX 3ONSA 3H1UA 2ZCBA 3A1QB 4PS7A 3ZNHB 2REXA 3H7PA 5D6JB 2CHWA 5J2RA 1TZ1A 4IWOA 4GXBA 4N9F4 1L2NA 3SU8X 2JRHA 3PGEA 4MSMB 2JRIB 3ALBA 4OVVA 2QHOA 3DVNU 1Z5SB 4XZ4A 4DHZE 5C23A 2Z59B 4KIKB 4W9LA 4MM3A 2G3QB 3OJ3A 2KFKB 5CHWA 2RD0A 3Q3JA 1V5OA 4NY0A 1VCBA 4ANWA 2N4FA 4DHZB 1OTRB 4ICVA 4EZJA 3W1SC 5EDSA 2AEHA 1WM3A 4RM8A 1NI2A 3VTVA 1ISNA 2O6VD 1PQSA 3L0WB 3QHTA 2DENB 3PRPB 3M62B 4EFOA 4TQ0A 3QWZB 2DAJA 1MG8A 3AXCA 3VTUA 3ZIMA 4KDLB 3PHWB 1WMHA 2WDTB 1P98A 1S1QB 3CF6E 2C60A 1UELA 3HIZA 3IG3A 2KWVB 3PT2B 3PTFC 4A20A 4EOYA 1D3ZA 5LXHA 5IAAC 3V62A 4CYEA 4DHJB 2PE9A 4WWNA 4LJOB 2KOXA 4MGZE 3BY4B 4KZ0A 2MSED 4B95A 3HK0A 4PYUA 3PRMB 2G4SA 3K9OB 2O2VA 3L16A 1XD3B 4DK5A 4GSWA 1KOTA 2ZPNA 5AZHA 2YLMA 3WAPA 1SE9A 4P7IA 1TTNA 3L13A 4JLCA 3ZUNA 2ASQA 5CX3A 3DOWA 3MTNB 4WJNA 4EKUA 2BYVE 1V86A 4M8MA 2JT4B 4B6WA 2LVQA 1LXDA 1WR1A 4AJWA 1RRBA 4MELA 2K8CA 3ECIA 4FHKA 3PZDA 2ZCCA 4URKA 4J6IA 3NS8A 1WF9A 1YX5B 2IO1B 1G6JA 2M8SA 4DBGA 3PLUA 4W9IA 3LDZE 2J0MA 3WAOA 1H8CA 1KLVA 3SD5A 1S3SG 2B3AA 4HPLB 2GBMA 2KDFB 2MP2B 2OOBB 2FCNA 1WFYA 2L76A 2M1MA 2NBWB 3A1QA 4IM0A 3RT3B 3ZRCA 4DDGD 2KC1A 2KANA 4HCNB 2IY0B 2KQ7A 1GC7A 1WY8A 4XX5A 2N7DA 3ZRFA 2PE6B 2EMTA 2UYZB 3OJ4B 2KDBA 3ZNID 3ZTDA 1NDDA 3M95A 4IUMB 1E8YA 5TR5A 1F9JA 3OAWA 2XBBC 2R2OA 5L95C 4IM3A 3P2BA 1E8WA 4KIKA 3CSTA 4YL8A 2KFKA 2WX0A 5AEKB 4PS3A 4W9KA 4DWFA 1V6EA 1OQYA 2L8JA 1I35A 1V81A 5DPSA 2NBUA 2MBHA 3KUDB 2MLBA 1WJ6A 2O2VB 3A9KB 5JHBA 4FLHA 4GDKB 4NQLB 2K6QA 3HM6X 3S2AA 2MWSB 3VAWA 2L3ZA 2MW5A 3H6NA 2MRPA 2PPHA 4ZRKA 2DYOA 3GOEA 3I3TB 4TKNA 3UQBA 3TCAA 3W1YA 2MBEA 4ANVA 2KDEB 4EEWA 3RYTA 3DPDA 3VFKA 3RZFA 3WANA 1OGWA 1EF1A 3Q3FA 3NY5A 4ANXA 2XK5B 4LDTB 4IM2A 3B1LX 4NAWB 3U8ZA 4XC2A 2KTRB 2KX0A 4G11A 4TUUA 4FHJA 3JW0X 2HD5B 2HJ8A 4MGKE 4W9HA 3RULA 4W9EA 3U30A 4I6NB 3VHTC 4K7UA 3M3JA 2IZVB 3DBSA 4DXAB 1WX9A 4HJKA 1WI0A 3T8MA 4F7ZA 1YJ1A 2UWQA 5LLIA 1UD7A 4W9CA 4WJQA 4KDIC 4F1SA 5C1ZA 2KNBA 4HXDA 1V80A 1RFAA 2JPHA 1GNUA 2L05A 2LGXA 4B9KA 4NPNA 2CU1A 3A4SC 1Q1OA 4HWIB 2D11A 2IO0B 3CMMB 3QCAA 4FBJB 5G2NA 3PPAA 2C7MB 3D32A 1WGYA 2KJ6A 2HE7A 1Y8RC 3DBRI 4FADA 2A5UA 2ZNVC 5D94A 3VUYA 3PRZA 4GN1A 3ZVVA 2MP2A 4ICUA 1TBEA 2DYMA 4DHJD 4HLEA 3X23A 2C5LC 3UGBB 2I1KA 3QC8B 3DBLI 3VXWA 1WGGA 3VDZA 2M17A 2L0FA 2D07B 4WQOB 2WYQA 1IPGA 4G0NB 4WJOA 2RPQA 5DCNA 1OEYA 2KMCA 3EHVA 3L10B 5HKHA 4G3XB 1WE6A 4I6PA 3GZNI 4ASWC 2C7NB 3JYUA 2D2QA 2LUEA 3PLVA 2K8BA 3WIMA 3AULA 4KZCA 4BKTA 5J18A 1LM8B 5IA7A 3A9KA 1OEYJ 4JGHB 3RZWC 3O65B 1U4AA 3QAQA 4GDKA 4II2B 4M8NA 4JQWC 1WYWB 2JY6A 2CHZA 1WJ4A 2IY1B 2KFJA 3BINA 3EFUA 4KSKC 3ZDMC 2HTHA 1WGDA 1X1MA 3T9LA 4FULA 3RD2A 1UBIA 1ZKHA 4PYZA 2JF5A 4BKGA 1C3TA 1WE7A 2DYBA 2JWZA 4I6LB 1KM7A 1GJZA 2MCNB 4GDLB 3KH0A 2XK5A 3JSVA 4NAWA 4PS8A 2KTRA 3B0AA 3R7QA 2GBRA 2L7RA 1WH3A 2KMAA 4IWQA 1I42A 5AZGA 3QARA 5D7GA 3HHMA 3WAMA 2KK8A 2KDIA 2L0TA 1V2YA 1E7VA 1V5TA 2ZJDA 5KHOA 2MBBB 2MBQA 3DDCB 1WXVA 2Z0EB 1R4NI 5J17A 4GMVA 5LXIB 1Z2MA 2N1VA 2RGFA 2D10A 2JZ3B 4BOSC 1ZW7A 1YX6B 3IBEA 1FXTB 3CSFA 4KV2A 4WWPA 4FJYA 3PS6A 1WZ0A 5E6OA 4HDOA 3A4RA 2BWFA 2FCQA 2LASA 3V6EB 2V4LA 3A9JB 3HM3A 1WX7A 4HVBA 3UINB 2KWCA 4BFRA 2LXAA 2AWTA 1GC6A 1V9JA 2CHXA 2LVPA 2NR2A 2J7QB 3MJWA 2LJ5A 2BF8B 4LDTD 2R2QA 2BKRB 4BOZB 3DCGA 2LZ6A 2DZJA 4EUTA 2GBJA 1YD8U 3ZW3A 1WZ3A 2W9NA 1E90A 2AL6A 3M63B 4JL9A 1XT9B 2C9WB 5JHAA 2ZVNA 5D2MB 1WIAA 3KVFB 2G45B 2IBIB 2DZMA 3QQ8B 2KC2A 5JZEB 4AJYB 1IYFA 1WGHA 2K39A 4EZLA 3AU5A 3JSVB 1EUVB 5DPRA 3QX1A 4HDQA 4X57B 2KLGA 4FJZA 4WAAA 4WWOA 5KHQA 1LQBA 3KYCD 3KYDD 2N9XA 4GB9A 2KZRA 3ZNZB 1J0GA 1V49A 1P9DU 2LVOA 4K7SA 2NS5A 4AOFA 1H4RA 1WXAA 3K9PB 4MSQB 3ML9A 1HE8A 2CR5A 2K1FA 1RAXA 4W9JA 4IG7B 4FA6A 3ZTCA 4E71A 3VH4B 1UZXB 3KUZA 1P3QU 2KX3A 4A3OA 4IW0A 5DPWA 2AYOB 2GBKA 4NQKE 1R4MI 1WXMA 2AL3A 2M0XA 1CMXB 2FUHB 2ZZPB 3KW5B 1E8XA 2DZIA 3B08A 2MA9B 1M94A 2KD0A 2M4NA 2BYEA 3QIJA 3DVGY 4GDLA 4MJSB 3L17A 3ZKJC 2YVCA 2KN5A 3AU4A 3KUCB 3V6CB 2FNJB 4BBNC 1WR6E 3H9DA 1IP9A 2DHZA 1E8ZA 2DX5B 3DQVA 4HPMB 2FCMA 4ZDVA 2GBNA 1E5WA 5L83A 3TIXA 3VUWA 2LGYA 1WGRA 2NCNA 2K8HA 4G50A 4GU2A 2N1WA 4K7WA 4CHKA 1A5RA 2KWUB 2K6DB 4ANUA 3APDA 4BKSA 4LCDE 4MDKE 2KKCA 3N32A 1AARA 3WALA 2KXJA 4KVGB 4BBNF 2ZVOA 3QJZA 2KJRA 3VTWA 4TQ1A 2JXXA 2OJRA 3A9JA 2LWPA 2V1YA 2NBVB 3EECA 3IVFA 5JH5C 1WXSA 3TL5A 4OVUA 3WA0A 2IYDB 2J0KA 5FR6A 3PSEB 3SHQA 2LRUA 3DVGX 5AZFA 3TBLD 3PHXB 3N3KB 1J19A 3VUXA 3RUIB 3VQIA 3VH3B 2CS4A 2FIFA 2LD9A 2N7EA 5CHVC 2NPTB 4M0WB 2KVRA 3UIPB 1L7YA 2N9PC 4TV3A 2JVCA 1WM2A 2O6VB 1SIFA 2LRWA 2FIDA 4HK2A 2IO2B 5CTRC 1SGHA 4IWPA 3TMPB 2J0JA 4BKSD 2IO3B 4RMAA 2KLCA 1GUAB 4F8CB 1UGMA 4ZYNA 3H7PB 3TJPA 3PREA 1Q0WB 3N30A 3A33B 3ML8A 2MX2A 3L54A 4FJVB 1WJNA 2A4ZA 2KTFA 2WX1A 2KHWB 1Q5WB 4MGYE 1KJTA 3EC8A 4KSLC 1T0YA 2LGDA 3H7SA 5CHFA 5DPTA 3SDLC 5E6PA 1E7UA 2BWES 3NZSA 4DDID 1YQBA 4AP4C 5G55A 4NJ7A 4GIVA 1WRDB
chains in the Genus database with same CATH superfamily
4MJSA 3W1SA 2RR9A 3URYA 4A55A 1FMAD 5E6NA 4FN2A 3AE9B 4NZLB 2L00B 2LI5A 2WXHA 3BYYB 3APCA 1BXTA 3ZLZA 4ITKA 1WMHB 3DHHC 3Q8BA 4D2KA 4N6EB 2ON8A 3TEXA 1ZDXA 3MFGA 1PGAA 1UBQA 2FUG1 2N9LA 1UH6A 4JPSA 4A9AA 1J8CA 4A8XC 2OJWA 2GOWA 4LNFA 4II3B 2D3CA 3RCZA 3IFWB 4HCPB 3VTVA 2JZZA 3PZ7A 3Q2AC 1KRHA 4YSZB 1WX8A 1YNTE 3NOBA 2MBOA 1LGRA 4K1RB 3AE5B 2CU3A 3AI5A 3C0RB 3RNEC 2W3RA 2Z0DB 4RM9A 2BKFA 2KJHB 2XNAC 2ZEQA 1FEHA 1L0VB 4GGQA 3ONSA 3AEEB 3A1QB 1FPYA 1KFYB 1N60A 3AE6B 5TSSA 4OHJA 2EELA 4C56C 1M4VA 4OVVA 4RGMA 4KIKB 1GB4A 3P4QB 1V5OA 1VCBA 1OTRB 2BQQA 1XLPA 1TZOA 1MFWA 1YQ3B 1NI2A 2E3TA 4YT0B 3PRPB 3B2GA 1L6VA 1B9RA 3QWZB 3ZIMA 1S1QB 2BT6A 1UELA 1PYWD 3HIZA 4EOYA 2WDQB 3I5JC 2PE9A 2KACA 3BY4B 3HK0A 1GOZA 1ZXIA 2W3SA 2O2VA 3L16A 3T3NA 5AZHA 2J52A 1MHXA 4JLCA 4N59A 3MTNB 2BYVE 3BVZA 2JZPA 1D4BA 2LVQA 1WR1A 3PZDA 2ZCCA 4REZA 1MI0A 1K53A 1XF5L 2J0MA 2CJNA 3SD5A 1S3SG 2KDFB 2MP2B 2FCNA 2L76A 3ZRCA 1V1OA 1ZP0B 4P6VF 2KC1A 1JQ4A 2KANA 1JROA 2IY0B 1WY8A 2JX5A 1DOYA 1JMLA 4RNAA 3ZRFA 2EMTA 4US9A 3ZTDA 2GRIA 1AW7A 1IUEA 3Q8FA 3OAWA 5L95C 2FBWB 4IM3A 1KTKA 1C4AA 5AEKB 4PS3A 4W9KA 5DPSA 2NBUA 1WJ6A 2O2VB 3A9KB 2RMMA 2MWSB 3H6NA 3I3TB 2MBEA 4ANVA 4EEWA 3RYTA 3DPDA 1TKEA 3WANA 1T0RC 3NY5A 4IM2A 3B1LX 4XC2A 2KTRB 4FHJA 3JW0X 2HD5B 2HJ8A 4W9HA 4IKGA 4W9EA 4I6NB 2IGHA 3TEWA 4HJKA 1GAQB 5LLIA 1UD7A 3RI7C 4W9CA 4WJQA 1TS2A 4F1SA 2IO0B 2I38A 3DBRI 1JWUD 1F2RI 2A5UA 3NJTA 4HLEA 3X23A 2I1KA 3QC8B 1FM0D 1N63A 3GS2A 2L0FA 2WYQA 1F1HA 3RNCC 5DCNA 3EHVA 2LGSA 4C80A 4G3XB 2C7NB 1I7HA 2W82A 3ZQ4A 2KT7A 4KZCA 1TS3A 4KGTA 3VRAB 1U4AA 3Q8AA 3QAQA 4GDKA 1A5RA 1WYWB 2CHZA 3EFUA 3BINA 3V3XA 3RFZB 2KMMA 2V0GA 4XDDA 3Q69A 1UBIA 2D5GA 4PYZA 2JF5A 1C3TA 2Y3AA 3KH0A 2XK5A 4WH4A 3B0AA 2GBRA 1WH3A 4IWQA 4RCOA 2MHJA 4AS1A 5KHOA 1CQVA 3NRZA 4A90A 1ZPSA 3DDCB 2Z0EB 1R4NI 5J17A 4GMVA 2WXIA 3ABVB 1ZW7A 4WWPA 4FJYA 5E6OA 4HDOA 5G5HA 2LASA 2OHFA 4HPPA 1WX7A 5BMIA 3VR8B 2KWCA 1XCTL 2LXAA 1V9JA 1E9MA 3LB8C 5C3JB 3RNGC 1UGJA 4EUTA 3ZW3A 4FXCA 3LYYA 1J7AA 1XT9B 4MH8A 2IBIB 1OQQA 3QQ8B 1ZDVA 4AJYB 2K39A 1EUVB 2M0AA 1F2RC 4HDQA 5KHQA 3KYCD 3KYDD 2NS5A 3RNFC 1MVKA 4MSQB 1ROEA 3ML9A 2QEJC 3PO0A 4W9JA 3VH4B 1UZXB 3E9SA 3KUZA 4DQOC 1QF6A 3AE7B 2GBKA 4NQKE 1WXMA 2FUHB 1E8XA 3AH7A 5D3IB 2X8XX 1YMHE 3FILB 3ZKJC 1I4HA 1RYJA 3KUCB 4BBNC 1E8ZA 4C4VA 2DX5B 3AE2B 3OWEB 1E5WA 5L83A 2MJ3A 3O13A 1RWSA 4XDCA 2INCC 3BVMA 2AQ2B 4MDKE 1AARA 2JU6X 4KVGB 2ZVOA 1YN5A 3A9JA 5C2TB 2OEDA 3ZJVA 1MPEA 1MG4A 1SIJA 3IVFA 5JH5C 4P16A 2DLBA 4RGOS 3SHQA 1XLOA 3TBLD 3N3KB 1J19A 3VQIA 2CS4A 2N7EA 3R8BA 2NPTB 1J7CA 5CTRC 2J53A 4IWPA 5AUIA 4F8CB 5D3DA 4ZYNA 2G9HD 3A33B 3ML8A 4K3CA 4CQNA 3EC8A 3W2DA 4KSLC 2LMCA 2LGDA 3I9V1 4DDID 4MM3B 5G55A 1J0GA 4RFBA 1N61A 1NENB 1ZXHA 4YTNB 4BAXA 1CK1A 1VZ8A 2L52A 2X38A 2BPSA 2JWUA 2V3SA 2EKIA 4A3PA 4W9FA 1QOAA 2WXMA 3U7DA 2M19A 3ZO5B 3UQAA 2PJHA 5GMVA 4K81A 2WXJA 4LJPB 1IGDA 3MHSD 5JXVA 3L08A 2CKHB 2LXCA 1D6EC 2KO3A 2WHIA 2PEAA 4MEMA 1WJUA 4W9DA 4HROA 2EKEC 1ZGUB 2FAZA 3X0WA 1BT0A 3P1MA 3V60A 2WU2B 3ZXVA 2PVOD 1FD6A 1A70A 4BVUC 4M0WA 1GG3A 2N0SB 2NVUI 3B2FA 3NHEB 2JYTA 3ZDTA 3VVWB 1EO6A 2WWZA 3JVZX 5IOIA 3H1UA 2ZCBA 4L23A 4KKJA 3IAS1 2REXA 3H7PA 1JCKB 2INPE 1P7EA 4IWOA 1HZ6A 4GXBA 4M02A 3AM9A 2KYWA 2MJDA 2QHOA 3ALBA 3DVNU 1Z5SB 4XZ4A 2IGGA 3AECB 2Z59B 1XO3A 4W9LA 5CHWA 1VLBA 3T3OA 2N4FA 1V97A 2ZW1A 4ICVA 4EZJA 1FNUA 3I63C 1QOFA 1XEEA 2AEHA 1WM3A 1L0XB 3EUB2 1ISNA 2O6VD 3L0WB 4MT5A 2W55A 4TQ0A 3VTUA 2HTME 3PHWB 1WMHA 3R2TA 3IXSA 1KLGD 2C60A 3PTFC 4EE2A 3AV8A 4HKQA 1XCQL 1PFDA 4CYEA 2UU7A 1E6EB 4WWNA 4MGZE 3SFDB 3HRDD 3KWVA 1TKYA 4PYUA 3OG5A 2AQ1B 3K9OB 4GSWA 2ZPNA 4L1BA 3GP7A 5AUKA 1C77A 1SE9A 1TTNA 2SAKA 2DWQA 4WJNA 3U2SC 3R2IA 2JT4B 4B6WA 1RRBA 1ZUD2 3PZ8A 4FHKA 2QILA 4J6IA 1YX5B 5BMGA 2K22A 2M8SA 3PLUA 4W9IA 1L6UA 1KLVA 4LLGM 1VJKA 2B3AA 3A1QA 4IM0A 2NBWB 1QILA 5H8YE 4HCNB 2KQ7A 2VZKD 3DBRB 3M95A 2DNFA 4JWSC 1EWYC 5HI1A 2XBBC 3P2BA 4KIKA 2B76B 4YL8A 1V6EA 2WLBA 1C79A 3VAWA 2L3ZA 4US8A 1EU4A 2DYOA 3RNAC 3J9CA 3RZFA 2LEKA 2QSDA 3BVGA 4TUUA 1TY2A 3EGRA 3VHTC 4K7UA 4KX6B 2BS4B 1WSPA 3DBSA 3AEDB 1WI0A 3BWUD 3FKYA 3RNBC 3DHIC 2IJ0A 4S0RA 4HXDA 1R4NB 4GLSC 5GXGB 1RFAA 4B9KA 3A4SC 1Q1OA 4FBJB 3CMMB 3QCAA 5BMHA 4KGSA 2KJ6A 5D94A 4GN1A 3AN1A 3RPFC 2MP2A 4ICUA 3UGBB 2ICIA 3DBLI 3VXWA 3VDZA 1IPGA 3NG0A 1WE6A 4I6PA 3GZNI 2D2QA 2K8BA 4K3BA 3AULA 3MP9A 2PIAA 5IA7A 3A9KA 1OEYJ 4JGHB 4M8NA 4DWFA 4JQWC 4KSKC 1X1MA 2DYBA 2JWZA 1ET9A 1KM7A 1ACCA 2D3BA 2KTRA 2PLPA 2N7JA 1I42A 2L7RA 5AZGA 3QARA 5D7GA 2RDBC 1QLBB 3WAMA 2KK8A 1V2YA 1E7VA 5EE1A 2MBQA 3FAHA 2RDGA 1VR9A 1TJEA 2N1VA 2K9XA 2KAJA 4DXGA 2WXNA 1FCLA 4R3DA 3V6EB 3HM3A 4NJCA 2AWTA 1TIFA 4LDTD 2LZ6A 2GBJA 1YD8U 1ET6A 1IBXB 3M63B 1ZOYB 1F77A 2ZVNA 5D2MB 3KLSX 2DZMA 1EM7A 2KC2A 1WGHA 2FE8A 3AU5A 2KVZA 4WAAA 4WWOA 3HVZA 2KZRA 3ZNZB 1P9DU 1H4RA 2DBYA 2CR5A 2K1FA 2RDHA 3ZTCA 5HHDG 1Q10A 4A3OA 1PGXA 2AYOB 4FADA 1R4MI 1CMXB 4OVZA 3KW5B 2RPVA 1FXIA 2M4NA 5I4DA 3QIJA 3L17A 2KN5A 3AU4A 3BK1A 2PMVA 3BYTB 2V3NA 1KF6B 2DHZA 1TKGA 4HPMB 2GBNA 2QDFA 4GU2A 2N1WA 3NUHB 4K7WA 4ACFA 2KWUB 2LHDA 2WQYB 3AE3B 4BKSA 1IGCA 1MJDA 4LCDE 4DXFA 4B0MA 2KKCA 2WXKA 3WALA 4BBNF 3QJZA 2KJRA 3VTWA 4TQ1A 2LWPA 2GI9A 2V1YA 2NBVB 2K3UA 1WXSA 2BS2B 2LHEA 3WA0A 2J0KA 5EE0A 5FR6A 2LRUA 2TSSA 4HEA1 2BTEA 4RF0A 4LK0M 1HZ5A 2AX5A 2FIFA 2L32A 4OW0A 2WGSA 1SSNA 2JVCA 1WM2A 2O6VB 1SIFA 2YEPB 2IO3B 2KLCA 3TJPA 3AEFB 3NVZA 2BS3B 1E10A 2MX2A 3C8YA 3U4EG 2WXRA 1KJTA 3H7SA 5CHFA 4WIPA 3MHZA 3SDLC 1YJIA 2BWES 3NZSA 4NJ7A 4GIVA 2INDC 3ENEA 3FILA 3DVNV 1WGKA 3AEAB 4W9GA 3QA8A 4USAA 2JUOA 2DAFA 3IHPC 1FFUA 3SR6A 4RGTA 2FCSA 1T3QA 2EMSA 2WS3B 1SXTA 4YSXB 1F52A 1HEZE 5BYRA 3ZNGC 2Y5BB 3LJ3A 2GMIC 2VZKB 3DBHI 3TEZA 3PV1A 4J3OD 3TEYA 3OLMD 5EE9A 1K8RB 1WYGA 3UIOB 1JRUA 2XEWA 5BO4B 1I4QA 4EZKA 3PVLA 1LO5D 2MQJA 1T5XD 1EF5A 2NPTA 4AUQC 1P0RA 3AB5A 3QK0A 1P1AA 4MGIE 2BYFA 2C7HA 3R66C 1RLFA 1YIWA 4YWGG 3NZUA 4HJGE 1YN4A 1C1YB 4PS7A 1WWTA 2CHWA 1TZ1A 3LXFA 4N9F4 3SU8X 4MSMB 2JRIB 2PVGC 4MM3A 2G3QB 3OJ3A 1HQRD 2KFKB 2RD0A 4NY0A 4ANWA 1TS5A 4DHZB 3W1SC 5EDSA 2H89B 3GE3C 3M62B 4EFOA 2DAJA 1MG8A 3AXCA 3NVWA 1DYQA 1UF0A 2WDTB 3CF6E 1VZ6A 3IG3A 3PT2B 4A20A 1D3ZA 3V62A 1FCCC 4H2AA 2KOXA 1QQRA 4B95A 2ZW0A 3PRMB 2G4SA 1KOTA 1XD3B 4DK5A 3KQ4A 3ZXRA 2YLMA 3WAPA 4P7IA 2CJOA 3L13A 5CX3A 3DOWA 4ARIA 3ZJUA 1L5PA 2KQ4X 4M8MA 1NEKB 4AJWA 2K8CA 3ECIA 1SJED 5BYQA 4DBGA 4ZOHC 3TSSA 2ONQA 4RH6A 2Z8LA 1H8CA 1PDXA 4HPLB 2GBMA 3DWMA 1WFYA 4JE3B 4DDGD 1GC7A 4XX5A 2N7DA 3AEBB 3OJ4B 3N1XC 2KDBA 1NDDA 1PUTA 4IUMB 1E8YA 2BB6A 2Q5WD 4LTUA 3DBLB 3CSTA 2YEPF 3N1YC 1OQYA 3KUDB 5T8IA 1N62A 4FLHA 2K6QA 3HM6X 4M01A 3GZNB 3S2AA 4P1CC 2MW5A 2J42A 2MRPA 4ZRKA 1SBBB 4WQMA 3ZJTA 3W1YA 2KDEB 3VFKA 1F0ZA 4YTPB 3ETRA 4IDIA 2WNMA 4LDTB 4NAWB 1C76A 3U8ZA 2KX0A 1FO4A 3IT6B 2WXPA 4MGKE 3RULA 3U30A 1RM6C 2G1EA 3P4RB 2IZVB 1CZPA 1WX9A 1OFFA 3T8MA 4F7ZA 1YJ1A 4ZYSA 2INNE 3TUOA 4KDIC 2LGIA 1CJEA 5C1ZA 2KNBA 1V80A 2L05A 2VH2A 2LGXA 4NPNA 2CU1A 4HWIB 2PTLA 5G2NA 3PPAA 2K0PA 2C7MB 3Q14C 2V9HA 4OZAA 4ZHOA 1JALA 4RF1A 2HE7A 1Y8RC 2ZNVC 3VUYA 2DYMA 4DHJD 1L4DB 2C5LC 1JRPA 3SFEB 2M17A 2Y5PA 4WQOB 2XN9C 1J7BA 1L0YB 2RPQA 3EA6A 4C7ZA 2KMCA 1YQ4B 1I4PA 3BK2A 5HKHA 1QKZA 3PLVA 3WIMA 4PT5A 1N6ZA 3RZWC 3O65B 3ZDMC 2HTHA 1WGDA 1JWMD 3T9LA 3MC8A 3RD2A 4BKGA 1ZKHA 1ENFA 1SEBD 4LNKA 4GDLB 2WXOA 4PS8A 1R4MB 3R7QA 2KMAA 1I4RA 4OZCA 3BIID 2I2YA 2Y5CA 2KDIA 2L0TA 1V5TA 2MBBB 2R61A 4B0EA 5LXIB 2RGFA 1DGJA 1YX6B 3IBEA 1KH0A 3CSFA 4KV2A 2E6XA 3A4RA 1JWBD 4HVBA 1K50A 3UINB 4BFRA 1GC6A 2LVPA 4M00A 1T6BX 3MJWA 2LJ5A 3Q8EA 2BF8B 1XXGA 2R2QA 1C9FA 2BKRB 4BOZB 3DCGA 2DZJA 2MH7A 1WZ3A 1E90A 2C9WB 1WIAA 1UWMA 1IYFA 4EZLA 4XWWA 5DPRA 2D3AA 4X57B 4FJZA 1JW9D 2N9XA 4GB9A 1V49A 1FXAA 4K7SA 4AOFA 3K9PB 1WXAA 1HE8A 1RAXA 4IG7B 4FA6A 3MJ5A 1P3QU 3NS1A 2KX3A 2KWDA 4Q2JA 4IW0A 5DPWA 1UNSA 2M0XA 2ZZPB 2DZIA 3B08A 3U7ZA 2MA9B 4MJSB 4C00A 3V6CB 2FNJB 5BYSA 3H9DA 3N1ZC 1IP9A 3DQVA 3N9YC 4ZDVA 1SE3A 4YTMB 3TIXA 3VUWA 2LGYA 2K8HA 1FIQA 1STEA 1SJHD 1C4PA 1WXQA 2KXJA 2QC8A 2JXXA 3EECA 4OVUA 2IYDB 5HFYA 3PSEB 3DBHB 1DOXA 3DVGX 5AZFA 3PHXB 3N20C 3VUXA 3RUIB 1IBXA 3Q3NC 1L7YA 2N9PC 4TV3A 2LRWA 5FKAC 2IO2B 2IDYA 2J0JA 2WDRB 4YXDB 1DOIA 3PREA 3N30A 3L54A 1FRDA 4FJVB 2A4ZA 2KTFA 2V3PA 2KHWB 1Q5WB 4MGYE 5DPTA 3E56A 1YQBA 4AP4C 5E6JA 4ZRIA 3NVVA 1WRDB 2ZPYA 1SE4A 1NBFC 4CO7A 2D3GA 2I1JA 4ZRQA 1TGZB 4XE0A 3SEBA 4E3CA 1OQRA 4NJ6A 4JWUC 3R7RA 1NI3A 4E74A 2NMQA 2VRRB 2KN4A 3UF8A 4MH0E 3WCQA 5IN7A 1R7SA 4NNJB 4IC7B 1SB3C 4TMAB 2RSUA 3P42A 1D5XC 2K25A 1FNVA 2N9EB 4GOCA 3V61A 1LFDA 1QZEA 3AE8B 3CIRB 4JIOU 4BOSC 1BMLC 2G4DB 1QT9A 3AEGB 4AWJA 4ZRJA 1VD2A 3APFA 4WJPA 2N9KA 1MHHE 4UDUC 4NAMA 1N5XA 1SE2A 2BGFA 2BB5A 4A6QA 1AWDA 4LNOA 3R3MA 1JWSD 1XQQA 2O6VA 2DZKA 2ZNVB 3AE1B 2KQSA 4XYCA 4JX1C 3ZNHB 5MPOA 5IP4D 4C7YA 2JYEA 5D6JB 5J2RA 1L2NA 2JRHA 1FFVA 2QCZA 3PGEA 1ZE3D 3GB1A 4DHZE 1VDVA 5C23A 1AYFA 3Q3JA 1K52A 2J4XA 1FRRA 4RM8A 1NYRA 1PQSA 3QHTA 2DENB 2QJLA 4OZBA 1UWXA 2KDMA 3Q8CA 2BVCA 3KWLA 3U52E 4KDLB 2BYTA 1P98A 2IGDA 4MACA 4RGNA 2KWVB 4BZAA 5LXHA 5IAAC 4ARCA 1D5ZC 4DHJB 3BZDB 4LJOB 4KZ0A 2MSED 5H92C 3I57A 2V4IB 4HRSA 2IPKD 2AQ3B 3ZUNA 2ASQA 4EKUA 3P63A 1V86A 1LXDA 2WU5B 4MELA 3B9JA 4URKA 1KLUD 1QOGA 3NS8A 1WF9A 2IO1B 1G6JA 3HUIA 5FR3A 1C4CA 4KGRA 3LDZE 3WAOA 4PK1A 4LNNA 2OOBB 1N5WA 2M1MA 1XLQA 3RT3B 3H8HA 2LFIA 2LJIA 1XLNA 2PE6B 2UYZB 3ZNID 5TR5A 1F9JA 2R2OA 3IT4B 1E8WA 1YOVB 1I4GA 2KFKA 2WX0A 5IKCM 2L8JA 1I35A 1V81A 2M56B 2MBHA 2MLBA 3NVYA 5JHBA 4GDKB 4NQLB 2HJ1A 1BUIC 4QAYA 2PPHA 3GOEA 4TKNA 3UQBA 3TCAA 1OGWA 1EF1A 1D5MC 3NZ3A 3Q3FA 3P4SB 3AE4B 4ANXA 2XK5B 1TS4A 4G11A 4AQ7A 2JXTA 3M3JA 1GPXA 4DXAB 3DWGC 1PGBA 1E0ZA 2UWQA 2WXGA 3MC9A 3GE8C 4P1BC 2JPHA 1GNUA 2QIEB 4HKZE 2D11A 2WXFA 3ZYYX 1VZ7A 3D32A 1WGYA 2PKOA 3P4PB 3PRZA 3ZVVA 3W9CB 1TBEA 1P7FA 1WGGA 2GLSA 4WAFA 1C78A 2D07B 4G0NB 4WJOA 1OEYA 1RFKA 3L10B 4ASWC 1WRIA 3JYUA 2LUEA 4IOIE 5HG2A 4BKTA 5J18A 1LM8B 1YJJA 4XWTA 3UI3A 4II2B 2JY6A 2KFJA 1WJ4A 2IY1B 2WP9B 2VH1A 4ZHPA 4FULA 2MEKA 5LNK1 1SF0A 1WE7A 4I6LB 1GJZA 2MCNB 1EU3A 3DHGC 3JSVA 4NAWA 1V8CA 1Y56A 3FC4A 3HHMA 4C4VB 3RMKC 2QMTA 4O1NA 2ZJDA 1B1ZA 1WXVA 2K5PA 1Z2MA 2D10A 3AMZA 2PW9A 2JZ3B 1FXTB 3PS6A 1WZ0A 1VRAB 1E7PB 2BWFA 1V1PA 2FCQA 1K51A 2V4LA 3A9JB 4L2YA 3HVDA 2CHXA 3MC0B 1L4ZB 2NR2A 2J7QB 1I4XA 1QOBA 1FNWA 1TYGB 2NTTA 3EFCA 2ACZB 3Q3MC 4N58A 2W9NA 3C19A 2AL6A 4JL9A 4KKIA 5JHAA 1ESFA 3KVFB 2G45B 2BW2A 4TSSA 5JZEB 1HTOA 3JSVB 4XGAB 3QX1A 2KLGA 4ZRPA 1LQBA 2WXQA 2LVOA 2NTSA 1GB1A 1EWCA 1T0SC 2SEBD 2LUMA 2BBCA 4E71A 2W54A 1UUPA 3CWIA 2AL3A 3IAM1 1HA5A 2WDVB 1M94A 2KD0A 2BYEA 3DVGY 1V1PB 1T0QC 4GDLA 2GB1A 2YVCA 1NVID 3W5VB 5EE3A 1WR6E 3L4PA 2FCMA 4LNIA 1NYQA 4G50A 1WGRA 2NCNA 4CHKA 2H88B 4S17A 2K6DB 4ANUA 3APDA 1AN8A 3RN9C 4YSYB 3N32A 5IO9A 5FK9C 2OJRA 1TY0A 3ZGZA 3W5UB 3TL5A 3VRBB 2MJEA 3V05A 5G5GA 1YN3A 3VH3B 1HTQA 2HDEA 2LD9A 5CHVC 4M0WB 2KVRA 3UIPB 2L83A 3Q6BA 2FIDA 4HK2A 2JQRB 1SGHA 2JSVX 1HXYD 4BKSD 3TMPB 4WWMA 4RMAA 1GUAB 1UGMA 3Q3OC 3H7PB 1Q0WB 3VR9B 1JWAD 1WJNA 2WX1A 4WURA 1T0YA 1TT5B 5E6PA 1E7UA 2L1AA 2WXLA
chains in the Genus database with same CATH topology
3ENEA 4MJSA 2ZPYA 3DVNV 3W1SA 1NBFC 2RR9A 4CO7A 2D3GA 2I1JA 4W9GA 2BPSA 1TGZB 3QA8A 2JUOA 2V3SA 2DAFA 5E6NA 4FN2A 3IHPC 4E3CA 2L00B 4A3PA 2LI5A 4W9FA 4NJ6A 2FCSA 3APCA 2EMSA 3R7RA 3ZLZA 4E74A 3U7DA 1WMHB 2VRRB 3UF8A 4MH0E 3ZO5B 3UQAA 2PJHA 4NNJB 3ZNGC 4IC7B 5GMVA 2RSUA 4K81A 2Y5BB 3LJ3A 4LJPB 1UBQA 2GMIC 3MHSD 1UH6A 2K25A 3L08A 3DBHI 2CKHB 2LXCA 3PV1A 1J8CA 2KO3A 3OLMD 2GOWA 2N9EB 4ZRIA 4II3B 4GOCA 3V61A 2PEAA 4MEMA 1LFDA 1QZEA 1K8RB 1WJUA 3IFWB 4JIOU 4HCPB 4W9DA 3RCZA 2JZZA 3UIOB 2G4DB 2EKEC 1JRUA 1ZGUB 2FAZA 2XEWA 5BO4B 3X0WA 4AWJA 4EZKA 1BT0A 4ZRJA 1WX8A 3PVLA 3V60A 1VD2A 3APFA 3NOBA 2MBOA 4WJPA 2MQJA 4K1RB 4BVUC 2BGFA 1EF5A 2NPTA 4AUQC 1P0RA 1GG3A 3AI5A 1P1AA 3C0RB 3R3MA 3QK0A 4MGIE 2NVUI 1XQQA 2BYFA 2C7HA 2Z0DB 4RM9A 2O6VA 1RLFA 2BKFA 1YIWA 2DZKA 2KJHB 3NHEB 3R66C 3ZDTA 3NZUA 3VVWB 2ZNVB 1C1YB 2ZEQA 2KQSA 4GGQA 1EO6A 2WWZA 3JVZX 3ONSA 3H1UA 2ZCBA 3A1QB 4PS7A 3ZNHB 2REXA 3H7PA 5D6JB 2CHWA 5J2RA 1TZ1A 4IWOA 4GXBA 4N9F4 1L2NA 3SU8X 2JRHA 3PGEA 4MSMB 2JRIB 3ALBA 4OVVA 2QHOA 3DVNU 1Z5SB 4XZ4A 4DHZE 5C23A 2Z59B 4KIKB 4W9LA 4MM3A 2G3QB 3OJ3A 2KFKB 5CHWA 2RD0A 3Q3JA 1V5OA 4NY0A 1VCBA 4ANWA 2N4FA 4DHZB 1OTRB 4ICVA 4EZJA 3W1SC 5EDSA 2AEHA 1WM3A 4RM8A 1NI2A 3VTVA 1ISNA 2O6VD 1PQSA 3L0WB 3QHTA 2DENB 3PRPB 3M62B 4EFOA 4TQ0A 3QWZB 2DAJA 1MG8A 3AXCA 3VTUA 3ZIMA 4KDLB 3PHWB 1WMHA 2WDTB 1P98A 1S1QB 3CF6E 2C60A 1UELA 3HIZA 3IG3A 2KWVB 3PT2B 3PTFC 4A20A 4EOYA 1D3ZA 5LXHA 5IAAC 3V62A 4CYEA 4DHJB 2PE9A 4WWNA 4LJOB 2KOXA 4MGZE 3BY4B 4KZ0A 2MSED 4B95A 3HK0A 4PYUA 3PRMB 2G4SA 3K9OB 2O2VA 3L16A 1XD3B 4DK5A 4GSWA 1KOTA 2ZPNA 5AZHA 2YLMA 3WAPA 1SE9A 4P7IA 1TTNA 3L13A 4JLCA 3ZUNA 2ASQA 5CX3A 3DOWA 3MTNB 4WJNA 4EKUA 2BYVE 1V86A 4M8MA 2JT4B 4B6WA 2LVQA 1LXDA 1WR1A 4AJWA 1RRBA 4MELA 2K8CA 3ECIA 4FHKA 3PZDA 2ZCCA 4URKA 4J6IA 3NS8A 1WF9A 1YX5B 2IO1B 1G6JA 2M8SA 4DBGA 3PLUA 4W9IA 3LDZE 2J0MA 3WAOA 1H8CA 1KLVA 3SD5A 1S3SG 2B3AA 4HPLB 2GBMA 2KDFB 2MP2B 2OOBB 2FCNA 1WFYA 2L76A 2M1MA 2NBWB 3A1QA 4IM0A 3RT3B 3ZRCA 4DDGD 2KC1A 2KANA 4HCNB 2IY0B 2KQ7A 1GC7A 1WY8A 4XX5A 2N7DA 3ZRFA 2PE6B 2EMTA 2UYZB 3OJ4B 2KDBA 3ZNID 3ZTDA 1NDDA 3M95A 4IUMB 1E8YA 5TR5A 1F9JA 3OAWA 2XBBC 2R2OA 5L95C 4IM3A 3P2BA 1E8WA 4KIKA 3CSTA 4YL8A 2KFKA 2WX0A 5AEKB 4PS3A 4W9KA 4DWFA 1V6EA 1OQYA 2L8JA 1I35A 1V81A 5DPSA 2NBUA 2MBHA 3KUDB 2MLBA 1WJ6A 2O2VB 3A9KB 5JHBA 4FLHA 4GDKB 4NQLB 2K6QA 3HM6X 3S2AA 2MWSB 3VAWA 2L3ZA 2MW5A 3H6NA 2MRPA 2PPHA 4ZRKA 2DYOA 3GOEA 3I3TB 4TKNA 3UQBA 3TCAA 3W1YA 2MBEA 4ANVA 2KDEB 4EEWA 3RYTA 3DPDA 3VFKA 3RZFA 3WANA 1OGWA 1EF1A 3Q3FA 3NY5A 4ANXA 2XK5B 4LDTB 4IM2A 3B1LX 4NAWB 3U8ZA 4XC2A 2KTRB 2KX0A 4G11A 4TUUA 4FHJA 3JW0X 2HD5B 2HJ8A 4MGKE 4W9HA 3RULA 4W9EA 3U30A 4I6NB 3VHTC 4K7UA 3M3JA 2IZVB 3DBSA 4DXAB 1WX9A 4HJKA 1WI0A 3T8MA 4F7ZA 1YJ1A 2UWQA 5LLIA 1UD7A 4W9CA 4WJQA 4KDIC 4F1SA 5C1ZA 2KNBA 4HXDA 1V80A 1RFAA 2JPHA 1GNUA 2L05A 2LGXA 4B9KA 4NPNA 2CU1A 3A4SC 1Q1OA 4HWIB 2D11A 2IO0B 3CMMB 3QCAA 4FBJB 5G2NA 3PPAA 2C7MB 3D32A 1WGYA 2KJ6A 2HE7A 1Y8RC 3DBRI 4FADA 2A5UA 2ZNVC 5D94A 3VUYA 3PRZA 4GN1A 3ZVVA 2MP2A 4ICUA 1TBEA 2DYMA 4DHJD 4HLEA 3X23A 2C5LC 3UGBB 2I1KA 3QC8B 3DBLI 3VXWA 1WGGA 3VDZA 2M17A 2L0FA 2D07B 4WQOB 2WYQA 1IPGA 4G0NB 4WJOA 2RPQA 5DCNA 1OEYA 2KMCA 3EHVA 3L10B 5HKHA 4G3XB 1WE6A 4I6PA 3GZNI 4ASWC 2C7NB 3JYUA 2D2QA 2LUEA 3PLVA 2K8BA 3WIMA 3AULA 4KZCA 4BKTA 5J18A 1LM8B 5IA7A 3A9KA 1OEYJ 4JGHB 3RZWC 3O65B 1U4AA 3QAQA 4GDKA 4II2B 4M8NA 4JQWC 1WYWB 2JY6A 2CHZA 1WJ4A 2IY1B 2KFJA 3BINA 3EFUA 4KSKC 3ZDMC 2HTHA 1WGDA 1X1MA 3T9LA 4FULA 3RD2A 1UBIA 1ZKHA 4PYZA 2JF5A 4BKGA 1C3TA 1WE7A 2DYBA 2JWZA 4I6LB 1KM7A 1GJZA 2MCNB 4GDLB 3KH0A 2XK5A 3JSVA 4NAWA 4PS8A 2KTRA 3B0AA 3R7QA 2GBRA 2L7RA 1WH3A 2KMAA 4IWQA 1I42A 5AZGA 3QARA 5D7GA 3HHMA 3WAMA 2KK8A 2KDIA 2L0TA 1V2YA 1E7VA 1V5TA 2ZJDA 5KHOA 2MBBB 2MBQA 3DDCB 1WXVA 2Z0EB 1R4NI 5J17A 4GMVA 5LXIB 1Z2MA 2N1VA 2RGFA 2D10A 2JZ3B 4BOSC 1ZW7A 1YX6B 3IBEA 1FXTB 3CSFA 4KV2A 4WWPA 4FJYA 3PS6A 1WZ0A 5E6OA 4HDOA 3A4RA 2BWFA 2FCQA 2LASA 3V6EB 2V4LA 3A9JB 3HM3A 1WX7A 4HVBA 3UINB 2KWCA 4BFRA 2LXAA 2AWTA 1GC6A 1V9JA 2CHXA 2LVPA 2NR2A 2J7QB 3MJWA 2LJ5A 2BF8B 4LDTD 2R2QA 2BKRB 4BOZB 3DCGA 2LZ6A 2DZJA 4EUTA 2GBJA 1YD8U 3ZW3A 1WZ3A 2W9NA 1E90A 2AL6A 3M63B 4JL9A 1XT9B 2C9WB 5JHAA 2ZVNA 5D2MB 1WIAA 3KVFB 2G45B 2IBIB 2DZMA 3QQ8B 2KC2A 5JZEB 4AJYB 1IYFA 1WGHA 2K39A 4EZLA 3AU5A 3JSVB 1EUVB 5DPRA 3QX1A 4HDQA 4X57B 2KLGA 4FJZA 4WAAA 4WWOA 5KHQA 1LQBA 3KYCD 3KYDD 2N9XA 4GB9A 2KZRA 3ZNZB 1J0GA 1V49A 1P9DU 2LVOA 4K7SA 2NS5A 4AOFA 1H4RA 1WXAA 3K9PB 4MSQB 3ML9A 1HE8A 2CR5A 2K1FA 1RAXA 4W9JA 4IG7B 4FA6A 3ZTCA 4E71A 3VH4B 1UZXB 3KUZA 1P3QU 2KX3A 4A3OA 4IW0A 5DPWA 2AYOB 2GBKA 4NQKE 1R4MI 1WXMA 2AL3A 2M0XA 1CMXB 2FUHB 2ZZPB 3KW5B 1E8XA 2DZIA 3B08A 2MA9B 1M94A 2KD0A 2M4NA 2BYEA 3QIJA 3DVGY 4GDLA 4MJSB 3L17A 3ZKJC 2YVCA 2KN5A 3AU4A 3KUCB 3V6CB 2FNJB 4BBNC 1WR6E 3H9DA 1IP9A 2DHZA 1E8ZA 2DX5B 3DQVA 4HPMB 2FCMA 4ZDVA 2GBNA 1E5WA 5L83A 3TIXA 3VUWA 2LGYA 1WGRA 2NCNA 2K8HA 4G50A 4GU2A 2N1WA 4K7WA 4CHKA 1A5RA 2KWUB 2K6DB 4ANUA 3APDA 4BKSA 4LCDE 4MDKE 2KKCA 3N32A 1AARA 3WALA 2KXJA 4KVGB 4BBNF 2ZVOA 3QJZA 2KJRA 3VTWA 4TQ1A 2JXXA 2OJRA 3A9JA 2LWPA 2V1YA 2NBVB 3EECA 3IVFA 5JH5C 1WXSA 3TL5A 4OVUA 3WA0A 2IYDB 2J0KA 5FR6A 3PSEB 3SHQA 2LRUA 3DVGX 5AZFA 3TBLD 3PHXB 3N3KB 1J19A 3VUXA 3RUIB 3VQIA 3VH3B 2CS4A 2FIFA 2LD9A 2N7EA 5CHVC 2NPTB 4M0WB 2KVRA 3UIPB 1L7YA 2N9PC 4TV3A 2JVCA 1WM2A 2O6VB 1SIFA 2LRWA 2FIDA 4HK2A 2IO2B 5CTRC 1SGHA 4IWPA 3TMPB 2J0JA 4BKSD 2IO3B 4RMAA 2KLCA 1GUAB 4F8CB 1UGMA 4ZYNA 3H7PB 3TJPA 3PREA 1Q0WB 3N30A 3A33B 3ML8A 2MX2A 3L54A 4FJVB 1WJNA 2A4ZA 2KTFA 2WX1A 2KHWB 1Q5WB 4MGYE 1KJTA 3EC8A 4KSLC 1T0YA 2LGDA 3H7SA 5CHFA 5DPTA 3SDLC 5E6PA 1E7UA 2BWES 3NZSA 4DDID 1YQBA 4AP4C 5G55A 4NJ7A 4GIVA 1WRDB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3ENE A;  4MJS A;  2ZPY A;  3DVN V;  3W1S A;  1NBF C;  2RR9 A;  4CO7 A;  2D3G A;  2I1J A;  4W9G A;  2BPS A;  1TGZ B;  3QA8 A;  2JUO A;  2V3S A;  2DAF A;  5E6N A;  4FN2 A;  3IHP C;  4E3C A;  2L00 B;  4A3P A;  2LI5 A;  4W9F A;  4NJ6 A;  2FCS A;  3APC A;  2EMS A;  3R7R A;  3ZLZ A;  4E74 A;  3U7D A;  1WMH B;  2VRR B;  3UF8 A;  4MH0 E;  3ZO5 B;  3UQA A;  2PJH A;  4NNJ B;  3ZNG C;  4IC7 B;  5GMV A;  2RSU A;  4K81 A;  2Y5B B;  3LJ3 A;  4LJP B;  1UBQ A;  2GMI C;  3MHS D;  1UH6 A;  2K25 A;  3L08 A;  3DBH I;  2CKH B;  2LXC A;  3PV1 A;  1J8C A;  2KO3 A;  3OLM D;  2GOW A;  2N9E B;  4ZRI A;  4II3 B;  4GOC A;  3V61 A;  2PEA A;  4MEM A;  1LFD A;  1QZE A;  1K8R B;  1WJU A;  3IFW B;  4JIO U;  4HCP B;  4W9D A;  3RCZ A;  2JZZ A;  3UIO B;  2G4D B;  2EKE C;  1JRU A;  1ZGU B;  2FAZ A;  2XEW A;  5BO4 B;  3X0W A;  4AWJ A;  4EZK A;  1BT0 A;  4ZRJ A;  1WX8 A;  3PVL A;  3V60 A;  1VD2 A;  3APF A;  3NOB A;  2MBO A;  4WJP A;  2MQJ A;  4K1R B;  4BVU C;  2BGF A;  1EF5 A;  2NPT A;  4AUQ C;  1P0R A;  1GG3 A;  3AI5 A;  1P1A A;  3C0R B;  3R3M A;  3QK0 A;  4MGI E;  2NVU I;  1XQQ A;  2BYF A;  2C7H A;  2Z0D B;  4RM9 A;  2O6V A;  1RLF A;  2BKF A;  1YIW A;  2DZK A;  2KJH B;  3NHE B;  3R66 C;  3ZDT A;  3NZU A;  3VVW B;  2ZNV B;  1C1Y B;  2ZEQ A;  2KQS A;  4GGQ A;  1EO6 A;  2WWZ A;  3JVZ X;  3ONS A;  3H1U A;  2ZCB A;  3A1Q B;  4PS7 A;  3ZNH B;  2REX A;  3H7P A;  5D6J B;  2CHW A;  5J2R A;  1TZ1 A;  4IWO A;  4GXB A;  4N9F 4;  1L2N A;  3SU8 X;  2JRH A;  3PGE A;  4MSM B;  2JRI B;  3ALB A;  4OVV A;  2QHO A;  3DVN U;  1Z5S B;  4XZ4 A;  4DHZ E;  5C23 A;  2Z59 B;  4KIK B;  4W9L A;  4MM3 A;  2G3Q B;  3OJ3 A;  2KFK B;  5CHW A;  2RD0 A;  3Q3J A;  1V5O A;  4NY0 A;  1VCB A;  4ANW A;  2N4F A;  4DHZ B;  1OTR B;  4ICV A;  4EZJ A;  3W1S C;  5EDS A;  2AEH A;  1WM3 A;  4RM8 A;  1NI2 A;  3VTV A;  1ISN A;  2O6V D;  1PQS A;  3L0W B;  3QHT A;  2DEN B;  3PRP B;  3M62 B;  4EFO A;  4TQ0 A;  3QWZ B;  2DAJ A;  1MG8 A;  3AXC A;  3VTU A;  3ZIM A;  4KDL B;  3PHW B;  1WMH A;  2WDT B;  1P98 A;  1S1Q B;  3CF6 E;  2C60 A;  1UEL A;  3HIZ A;  3IG3 A;  2KWV B;  3PT2 B;  3PTF C;  4A20 A;  4EOY A;  1D3Z A;  5LXH A;  5IAA C;  3V62 A;  4CYE A;  4DHJ B;  2PE9 A;  4WWN A;  4LJO B;  2KOX A;  4MGZ E;  3BY4 B;  4KZ0 A;  2MSE D;  4B95 A;  3HK0 A;  4PYU A;  3PRM B;  2G4S A;  3K9O B;  2O2V A;  3L16 A;  1XD3 B;  4DK5 A;  4GSW A;  1KOT A;  2ZPN A;  5AZH A;  2YLM A;  3WAP A;  1SE9 A;  4P7I A;  1TTN A;  3L13 A;  4JLC A;  3ZUN A;  2ASQ A;  5CX3 A;  3DOW A;  3MTN B;  4WJN A;  4EKU A;  2BYV E;  1V86 A;  4M8M A;  2JT4 B;  4B6W A;  2LVQ A;  1LXD A;  1WR1 A;  4AJW A;  1RRB A;  4MEL A;  2K8C A;  3ECI A;  4FHK A;  3PZD A;  2ZCC A;  4URK A;  4J6I A;  3NS8 A;  1WF9 A;  1YX5 B;  2IO1 B;  1G6J A;  2M8S A;  4DBG A;  3PLU A;  4W9I A;  3LDZ E;  2J0M A;  3WAO A;  1H8C A;  1KLV A;  3SD5 A;  1S3S G;  2B3A A;  4HPL B;  2GBM A;  2KDF B;  2MP2 B;  2OOB B;  2FCN A;  1WFY A;  2L76 A;  2M1M A;  2NBW B;  3A1Q A;  4IM0 A;  3RT3 B;  3ZRC A;  4DDG D;  2KC1 A;  2KAN A;  4HCN B;  2IY0 B;  2KQ7 A;  1GC7 A;  1WY8 A;  4XX5 A;  2N7D A;  3ZRF A;  2PE6 B;  2EMT A;  2UYZ B;  3OJ4 B;  2KDB A;  3ZNI D;  3ZTD A;  1NDD A;  3M95 A;  4IUM B;  1E8Y A;  5TR5 A;  1F9J A;  3OAW A;  2XBB C;  2R2O A;  5L95 C;  4IM3 A;  3P2B A;  1E8W A;  4KIK A;  3CST A;  4YL8 A;  2KFK A;  2WX0 A;  5AEK B;  4PS3 A;  4W9K A;  4DWF A;  1V6E A;  1OQY A;  2L8J A;  1I35 A;  1V81 A;  5DPS A;  2NBU A;  2MBH A;  3KUD B;  2MLB A;  1WJ6 A;  2O2V B;  3A9K B;  5JHB A;  4FLH A;  4GDK B;  4NQL B;  2K6Q A;  3HM6 X;  3S2A A;  2MWS B;  3VAW A;  2L3Z A;  2MW5 A;  3H6N A;  2MRP A;  2PPH A;  4ZRK A;  2DYO A;  3GOE A;  3I3T B;  4TKN A;  3UQB A;  3TCA A;  3W1Y A;  2MBE A;  4ANV A;  2KDE B;  4EEW A;  3RYT A;  3DPD A;  3VFK A;  3RZF A;  3WAN A;  1OGW A;  1EF1 A;  3Q3F A;  3NY5 A;  4ANX A;  2XK5 B;  4LDT B;  4IM2 A;  3B1L X;  4NAW B;  3U8Z A;  4XC2 A;  2KTR B;  2KX0 A;  4G11 A;  4TUU A;  4FHJ A;  3JW0 X;  2HD5 B;  2HJ8 A;  4MGK E;  4W9H A;  3RUL A;  4W9E A;  3U30 A;  4I6N B;  3VHT C;  4K7U A;  3M3J A;  2IZV B;  3DBS A;  4DXA B;  1WX9 A;  4HJK A;  1WI0 A;  3T8M A;  4F7Z A;  1YJ1 A;  2UWQ A;  5LLI A;  1UD7 A;  4W9C A;  4WJQ A;  4KDI C;  4F1S A;  5C1Z A;  2KNB A;  4HXD A;  1V80 A;  1RFA A;  2JPH A;  1GNU A;  2L05 A;  2LGX A;  4B9K A;  4NPN A;  2CU1 A;  3A4S C;  1Q1O A;  4HWI B;  2D11 A;  2IO0 B;  3CMM B;  3QCA A;  4FBJ B;  5G2N A;  3PPA A;  2C7M B;  3D32 A;  1WGY A;  2KJ6 A;  2HE7 A;  1Y8R C;  3DBR I;  4FAD A;  2A5U A;  2ZNV C;  5D94 A;  3VUY A;  3PRZ A;  4GN1 A;  3ZVV A;  2MP2 A;  4ICU A;  1TBE A;  2DYM A;  4DHJ D;  4HLE A;  3X23 A;  2C5L C;  3UGB B;  2I1K A;  3QC8 B;  3DBL I;  3VXW A;  1WGG A;  3VDZ A;  2M17 A;  2L0F A;  2D07 B;  4WQO B;  2WYQ A;  1IPG A;  4G0N B;  4WJO A;  2RPQ A;  5DCN A;  1OEY A;  2KMC A;  3EHV A;  3L10 B;  5HKH A;  4G3X B;  1WE6 A;  4I6P A;  3GZN I;  4ASW C;  2C7N B;  3JYU A;  2D2Q A;  2LUE A;  3PLV A;  2K8B A;  3WIM A;  3AUL A;  4KZC A;  4BKT A;  5J18 A;  1LM8 B;  5IA7 A;  3A9K A;  1OEY J;  4JGH B;  3RZW C;  3O65 B;  1U4A A;  3QAQ A;  4GDK A;  4II2 B;  4M8N A;  4JQW C;  1WYW B;  2JY6 A;  2CHZ A;  1WJ4 A;  2IY1 B;  2KFJ A;  3BIN A;  3EFU A;  4KSK C;  3ZDM C;  2HTH A;  1WGD A;  1X1M A;  3T9L A;  4FUL A;  3RD2 A;  1UBI A;  1ZKH A;  4PYZ A;  2JF5 A;  4BKG A;  1C3T A;  1WE7 A;  2DYB A;  2JWZ A;  4I6L B;  1KM7 A;  1GJZ A;  2MCN B;  4GDL B;  3KH0 A;  2XK5 A;  3JSV A;  4NAW A;  4PS8 A;  2KTR A;  3B0A A;  3R7Q A;  2GBR A;  2L7R A;  1WH3 A;  2KMA A;  4IWQ A;  1I42 A;  5AZG A;  3QAR A;  5D7G A;  3HHM A;  3WAM A;  2KK8 A;  2KDI A;  2L0T A;  1V2Y A;  1E7V A;  1V5T A;  2ZJD A;  5KHO A;  2MBB B;  2MBQ A;  3DDC B;  1WXV A;  2Z0E B;  1R4N I;  5J17 A;  4GMV A;  5LXI B;  1Z2M A;  2N1V A;  2RGF A;  2D10 A;  2JZ3 B;  4BOS C;  1ZW7 A;  1YX6 B;  3IBE A;  1FXT B;  3CSF A;  4KV2 A;  4WWP A;  4FJY A;  3PS6 A;  1WZ0 A;  5E6O A;  4HDO A;  3A4R A;  2BWF A;  2FCQ A;  2LAS A;  3V6E B;  2V4L A;  3A9J B;  3HM3 A;  1WX7 A;  4HVB A;  3UIN B;  2KWC A;  4BFR A;  2LXA A;  2AWT A;  1GC6 A;  1V9J A;  2CHX A;  2LVP A;  2NR2 A;  2J7Q B;  3MJW A;  2LJ5 A;  2BF8 B;  4LDT D;  2R2Q A;  2BKR B;  4BOZ B;  3DCG A;  2LZ6 A;  2DZJ A;  4EUT A;  2GBJ A;  1YD8 U;  3ZW3 A;  1WZ3 A;  2W9N A;  1E90 A;  2AL6 A;  3M63 B;  4JL9 A;  1XT9 B;  2C9W B;  5JHA A;  2ZVN A;  5D2M B;  1WIA A;  3KVF B;  2G45 B;  2IBI B;  2DZM A;  3QQ8 B;  2KC2 A;  5JZE B;  4AJY B;  1IYF A;  1WGH A;  2K39 A;  4EZL A;  3AU5 A;  3JSV B;  1EUV B;  5DPR A;  3QX1 A;  4HDQ A;  4X57 B;  2KLG A;  4FJZ A;  4WAA A;  4WWO A;  5KHQ A;  1LQB A;  3KYC D;  3KYD D;  2N9X A;  4GB9 A;  2KZR A;  3ZNZ B;  1J0G A;  1V49 A;  1P9D U;  2LVO A;  4K7S A;  2NS5 A;  4AOF A;  1H4R A;  1WXA A;  3K9P B;  4MSQ B;  3ML9 A;  1HE8 A;  2CR5 A;  2K1F A;  1RAX A;  4W9J A;  4IG7 B;  4FA6 A;  3ZTC A;  4E71 A;  3VH4 B;  1UZX B;  3KUZ A;  1P3Q U;  2KX3 A;  4A3O A;  4IW0 A;  5DPW A;  2AYO B;  2GBK A;  4NQK E;  1R4M I;  1WXM A;  2AL3 A;  2M0X A;  1CMX B;  2FUH B;  2ZZP B;  3KW5 B;  1E8X A;  2DZI A;  3B08 A;  2MA9 B;  1M94 A;  2KD0 A;  2M4N A;  2BYE A;  3QIJ A;  3DVG Y;  4GDL A;  4MJS B;  3L17 A;  3ZKJ C;  2YVC A;  2KN5 A;  3AU4 A;  3KUC B;  3V6C B;  2FNJ B;  4BBN C;  1WR6 E;  3H9D A;  1IP9 A;  2DHZ A;  1E8Z A;  2DX5 B;  3DQV A;  4HPM B;  2FCM A;  4ZDV A;  2GBN A;  1E5W A;  5L83 A;  3TIX A;  3VUW A;  2LGY A;  1WGR A;  2NCN A;  2K8H A;  4G50 A;  4GU2 A;  2N1W A;  4K7W A;  4CHK A;  1A5R A;  2KWU B;  2K6D B;  4ANU A;  3APD A;  4BKS A;  4LCD E;  4MDK E;  2KKC A;  3N32 A;  1AAR A;  3WAL A;  2KXJ A;  4KVG B;  4BBN F;  2ZVO A;  3QJZ A;  2KJR A;  3VTW A;  4TQ1 A;  2JXX A;  2OJR A;  3A9J A;  2LWP A;  2V1Y A;  2NBV B;  3EEC A;  3IVF A;  5JH5 C;  1WXS A;  3TL5 A;  4OVU A;  3WA0 A;  2IYD B;  2J0K A;  5FR6 A;  3PSE B;  3SHQ A;  2LRU A;  3DVG X;  5AZF A;  3TBL D;  3PHX B;  3N3K B;  1J19 A;  3VUX A;  3RUI B;  3VQI A;  3VH3 B;  2CS4 A;  2FIF A;  2LD9 A;  2N7E A;  5CHV C;  2NPT B;  4M0W B;  2KVR A;  3UIP B;  1L7Y A;  2N9P C;  4TV3 A;  2JVC A;  1WM2 A;  2O6V B;  1SIF A;  2LRW A;  2FID A;  4HK2 A;  2IO2 B;  5CTR C;  1SGH A;  4IWP A;  3TMP B;  2J0J A;  4BKS D;  2IO3 B;  4RMA A;  2KLC A;  1GUA B;  4F8C B;  1UGM A;  4ZYN A;  3H7P B;  3TJP A;  3PRE A;  1Q0W B;  3N30 A;  3A33 B;  3ML8 A;  2MX2 A;  3L54 A;  4FJV B;  1WJN A;  2A4Z A;  2KTF A;  2WX1 A;  2KHW B;  1Q5W B;  4MGY E;  1KJT A;  3EC8 A;  4KSL C;  1T0Y A;  2LGD A;  3H7S A;  5CHF A;  5DPT A;  3SDL C;  5E6P A;  1E7U A;  2BWE S;  3NZS A;  4DDI D;  1YQB A;  4AP4 C;  5G55 A;  4NJ7 A;  4GIV A;  1WRD B; 
#chains in the Genus database with same CATH topology
 4MJS A;  3W1S A;  2RR9 A;  3URY A;  4A55 A;  1FMA D;  5E6N A;  4FN2 A;  3AE9 B;  4NZL B;  2L00 B;  2LI5 A;  2WXH A;  3BYY B;  3APC A;  1BXT A;  3ZLZ A;  4ITK A;  1WMH B;  3DHH C;  3Q8B A;  4D2K A;  4N6E B;  2ON8 A;  3TEX A;  1ZDX A;  3MFG A;  1PGA A;  1UBQ A;  2FUG 1;  2N9L A;  1UH6 A;  4JPS A;  4A9A A;  1J8C A;  4A8X C;  2OJW A;  2GOW A;  4LNF A;  4II3 B;  2D3C A;  3RCZ A;  3IFW B;  4HCP B;  3VTV A;  2JZZ A;  3PZ7 A;  3Q2A C;  1KRH A;  4YSZ B;  1WX8 A;  1YNT E;  3NOB A;  2MBO A;  1LGR A;  4K1R B;  3AE5 B;  2CU3 A;  3AI5 A;  3C0R B;  3RNE C;  2W3R A;  2Z0D B;  4RM9 A;  2BKF A;  2KJH B;  2XNA C;  2ZEQ A;  1FEH A;  1L0V B;  4GGQ A;  3ONS A;  3AEE B;  3A1Q B;  1FPY A;  1KFY B;  1N60 A;  3AE6 B;  5TSS A;  4OHJ A;  2EEL A;  4C56 C;  1M4V A;  4OVV A;  4RGM A;  4KIK B;  1GB4 A;  3P4Q B;  1V5O A;  1VCB A;  1OTR B;  2BQQ A;  1XLP A;  1TZO A;  1MFW A;  1YQ3 B;  1NI2 A;  2E3T A;  4YT0 B;  3PRP B;  3B2G A;  1L6V A;  1B9R A;  3QWZ B;  3ZIM A;  1S1Q B;  2BT6 A;  1UEL A;  1PYW D;  3HIZ A;  4EOY A;  2WDQ B;  3I5J C;  2PE9 A;  2KAC A;  3BY4 B;  3HK0 A;  1GOZ A;  1ZXI A;  2W3S A;  2O2V A;  3L16 A;  3T3N A;  5AZH A;  2J52 A;  1MHX A;  4JLC A;  4N59 A;  3MTN B;  2BYV E;  3BVZ A;  2JZP A;  1D4B A;  2LVQ A;  1WR1 A;  3PZD A;  2ZCC A;  4REZ A;  1MI0 A;  1K53 A;  1XF5 L;  2J0M A;  2CJN A;  3SD5 A;  1S3S G;  2KDF B;  2MP2 B;  2FCN A;  2L76 A;  3ZRC A;  1V1O A;  1ZP0 B;  4P6V F;  2KC1 A;  1JQ4 A;  2KAN A;  1JRO A;  2IY0 B;  1WY8 A;  2JX5 A;  1DOY A;  1JML A;  4RNA A;  3ZRF A;  2EMT A;  4US9 A;  3ZTD A;  2GRI A;  1AW7 A;  1IUE A;  3Q8F A;  3OAW A;  5L95 C;  2FBW B;  4IM3 A;  1KTK A;  1C4A A;  5AEK B;  4PS3 A;  4W9K A;  5DPS A;  2NBU A;  1WJ6 A;  2O2V B;  3A9K B;  2RMM A;  2MWS B;  3H6N A;  3I3T B;  2MBE A;  4ANV A;  4EEW A;  3RYT A;  3DPD A;  1TKE A;  3WAN A;  1T0R C;  3NY5 A;  4IM2 A;  3B1L X;  4XC2 A;  2KTR B;  4FHJ A;  3JW0 X;  2HD5 B;  2HJ8 A;  4W9H A;  4IKG A;  4W9E A;  4I6N B;  2IGH A;  3TEW A;  4HJK A;  1GAQ B;  5LLI A;  1UD7 A;  3RI7 C;  4W9C A;  4WJQ A;  1TS2 A;  4F1S A;  2IO0 B;  2I38 A;  3DBR I;  1JWU D;  1F2R I;  2A5U A;  3NJT A;  4HLE A;  3X23 A;  2I1K A;  3QC8 B;  1FM0 D;  1N63 A;  3GS2 A;  2L0F A;  2WYQ A;  1F1H A;  3RNC C;  5DCN A;  3EHV A;  2LGS A;  4C80 A;  4G3X B;  2C7N B;  1I7H A;  2W82 A;  3ZQ4 A;  2KT7 A;  4KZC A;  1TS3 A;  4KGT A;  3VRA B;  1U4A A;  3Q8A A;  3QAQ A;  4GDK A;  1A5R A;  1WYW B;  2CHZ A;  3EFU A;  3BIN A;  3V3X A;  3RFZ B;  2KMM A;  2V0G A;  4XDD A;  3Q69 A;  1UBI A;  2D5G A;  4PYZ A;  2JF5 A;  1C3T A;  2Y3A A;  3KH0 A;  2XK5 A;  4WH4 A;  3B0A A;  2GBR A;  1WH3 A;  4IWQ A;  4RCO A;  2MHJ A;  4AS1 A;  5KHO A;  1CQV A;  3NRZ A;  4A90 A;  1ZPS A;  3DDC B;  2Z0E B;  1R4N I;  5J17 A;  4GMV A;  2WXI A;  3ABV B;  1ZW7 A;  4WWP A;  4FJY A;  5E6O A;  4HDO A;  5G5H A;  2LAS A;  2OHF A;  4HPP A;  1WX7 A;  5BMI A;  3VR8 B;  2KWC A;  1XCT L;  2LXA A;  1V9J A;  1E9M A;  3LB8 C;  5C3J B;  3RNG C;  1UGJ A;  4EUT A;  3ZW3 A;  4FXC A;  3LYY A;  1J7A A;  1XT9 B;  4MH8 A;  2IBI B;  1OQQ A;  3QQ8 B;  1ZDV A;  4AJY B;  2K39 A;  1EUV B;  2M0A A;  1F2R C;  4HDQ A;  5KHQ A;  3KYC D;  3KYD D;  2NS5 A;  3RNF C;  1MVK A;  4MSQ B;  1ROE A;  3ML9 A;  2QEJ C;  3PO0 A;  4W9J A;  3VH4 B;  1UZX B;  3E9S A;  3KUZ A;  4DQO C;  1QF6 A;  3AE7 B;  2GBK A;  4NQK E;  1WXM A;  2FUH B;  1E8X A;  3AH7 A;  5D3I B;  2X8X X;  1YMH E;  3FIL B;  3ZKJ C;  1I4H A;  1RYJ A;  3KUC B;  4BBN C;  1E8Z A;  4C4V A;  2DX5 B;  3AE2 B;  3OWE B;  1E5W A;  5L83 A;  2MJ3 A;  3O13 A;  1RWS A;  4XDC A;  2INC C;  3BVM A;  2AQ2 B;  4MDK E;  1AAR A;  2JU6 X;  4KVG B;  2ZVO A;  1YN5 A;  3A9J A;  5C2T B;  2OED A;  3ZJV A;  1MPE A;  1MG4 A;  1SIJ A;  3IVF A;  5JH5 C;  4P16 A;  2DLB A;  4RGO S;  3SHQ A;  1XLO A;  3TBL D;  3N3K B;  1J19 A;  3VQI A;  2CS4 A;  2N7E A;  3R8B A;  2NPT B;  1J7C A;  5CTR C;  2J53 A;  4IWP A;  5AUI A;  4F8C B;  5D3D A;  4ZYN A;  2G9H D;  3A33 B;  3ML8 A;  4K3C A;  4CQN A;  3EC8 A;  3W2D A;  4KSL C;  2LMC A;  2LGD A;  3I9V 1;  4DDI D;  4MM3 B;  5G55 A;  1J0G A;  4RFB A;  1N61 A;  1NEN B;  1ZXH A;  4YTN B;  4BAX A;  1CK1 A;  1VZ8 A;  2L52 A;  2X38 A;  2BPS A;  2JWU A;  2V3S A;  2EKI A;  4A3P A;  4W9F A;  1QOA A;  2WXM A;  3U7D A;  2M19 A;  3ZO5 B;  3UQA A;  2PJH A;  5GMV A;  4K81 A;  2WXJ A;  4LJP B;  1IGD A;  3MHS D;  5JXV A;  3L08 A;  2CKH B;  2LXC A;  1D6E C;  2KO3 A;  2WHI A;  2PEA A;  4MEM A;  1WJU A;  4W9D A;  4HRO A;  2EKE C;  1ZGU B;  2FAZ A;  3X0W A;  1BT0 A;  3P1M A;  3V60 A;  2WU2 B;  3ZXV A;  2PVO D;  1FD6 A;  1A70 A;  4BVU C;  4M0W A;  1GG3 A;  2N0S B;  2NVU I;  3B2F A;  3NHE B;  2JYT A;  3ZDT A;  3VVW B;  1EO6 A;  2WWZ A;  3JVZ X;  5IOI A;  3H1U A;  2ZCB A;  4L23 A;  4KKJ A;  3IAS 1;  2REX A;  3H7P A;  1JCK B;  2INP E;  1P7E A;  4IWO A;  1HZ6 A;  4GXB A;  4M02 A;  3AM9 A;  2KYW A;  2MJD A;  2QHO A;  3ALB A;  3DVN U;  1Z5S B;  4XZ4 A;  2IGG A;  3AEC B;  2Z59 B;  1XO3 A;  4W9L A;  5CHW A;  1VLB A;  3T3O A;  2N4F A;  1V97 A;  2ZW1 A;  4ICV A;  4EZJ A;  1FNU A;  3I63 C;  1QOF A;  1XEE A;  2AEH A;  1WM3 A;  1L0X B;  3EUB 2;  1ISN A;  2O6V D;  3L0W B;  4MT5 A;  2W55 A;  4TQ0 A;  3VTU A;  2HTM E;  3PHW B;  1WMH A;  3R2T A;  3IXS A;  1KLG D;  2C60 A;  3PTF C;  4EE2 A;  3AV8 A;  4HKQ A;  1XCQ L;  1PFD A;  4CYE A;  2UU7 A;  1E6E B;  4WWN A;  4MGZ E;  3SFD B;  3HRD D;  3KWV A;  1TKY A;  4PYU A;  3OG5 A;  2AQ1 B;  3K9O B;  4GSW A;  2ZPN A;  4L1B A;  3GP7 A;  5AUK A;  1C77 A;  1SE9 A;  1TTN A;  2SAK A;  2DWQ A;  4WJN A;  3U2S C;  3R2I A;  2JT4 B;  4B6W A;  1RRB A;  1ZUD 2;  3PZ8 A;  4FHK A;  2QIL A;  4J6I A;  1YX5 B;  5BMG A;  2K22 A;  2M8S A;  3PLU A;  4W9I A;  1L6U A;  1KLV A;  4LLG M;  1VJK A;  2B3A A;  3A1Q A;  4IM0 A;  2NBW B;  1QIL A;  5H8Y E;  4HCN B;  2KQ7 A;  2VZK D;  3DBR B;  3M95 A;  2DNF A;  4JWS C;  1EWY C;  5HI1 A;  2XBB C;  3P2B A;  4KIK A;  2B76 B;  4YL8 A;  1V6E A;  2WLB A;  1C79 A;  3VAW A;  2L3Z A;  4US8 A;  1EU4 A;  2DYO A;  3RNA C;  3J9C A;  3RZF A;  2LEK A;  2QSD A;  3BVG A;  4TUU A;  1TY2 A;  3EGR A;  3VHT C;  4K7U A;  4KX6 B;  2BS4 B;  1WSP A;  3DBS A;  3AED B;  1WI0 A;  3BWU D;  3FKY A;  3RNB C;  3DHI C;  2IJ0 A;  4S0R A;  4HXD A;  1R4N B;  4GLS C;  5GXG B;  1RFA A;  4B9K A;  3A4S C;  1Q1O A;  4FBJ B;  3CMM B;  3QCA A;  5BMH A;  4KGS A;  2KJ6 A;  5D94 A;  4GN1 A;  3AN1 A;  3RPF C;  2MP2 A;  4ICU A;  3UGB B;  2ICI A;  3DBL I;  3VXW A;  3VDZ A;  1IPG A;  3NG0 A;  1WE6 A;  4I6P A;  3GZN I;  2D2Q A;  2K8B A;  4K3B A;  3AUL A;  3MP9 A;  2PIA A;  5IA7 A;  3A9K A;  1OEY J;  4JGH B;  4M8N A;  4DWF A;  4JQW C;  4KSK C;  1X1M A;  2DYB A;  2JWZ A;  1ET9 A;  1KM7 A;  1ACC A;  2D3B A;  2KTR A;  2PLP A;  2N7J A;  1I42 A;  2L7R A;  5AZG A;  3QAR A;  5D7G A;  2RDB C;  1QLB B;  3WAM A;  2KK8 A;  1V2Y A;  1E7V A;  5EE1 A;  2MBQ A;  3FAH A;  2RDG A;  1VR9 A;  1TJE A;  2N1V A;  2K9X A;  2KAJ A;  4DXG A;  2WXN A;  1FCL A;  4R3D A;  3V6E B;  3HM3 A;  4NJC A;  2AWT A;  1TIF A;  4LDT D;  2LZ6 A;  2GBJ A;  1YD8 U;  1ET6 A;  1IBX B;  3M63 B;  1ZOY B;  1F77 A;  2ZVN A;  5D2M B;  3KLS X;  2DZM A;  1EM7 A;  2KC2 A;  1WGH A;  2FE8 A;  3AU5 A;  2KVZ A;  4WAA A;  4WWO A;  3HVZ A;  2KZR A;  3ZNZ B;  1P9D U;  1H4R A;  2DBY A;  2CR5 A;  2K1F A;  2RDH A;  3ZTC A;  5HHD G;  1Q10 A;  4A3O A;  1PGX A;  2AYO B;  4FAD A;  1R4M I;  1CMX B;  4OVZ A;  3KW5 B;  2RPV A;  1FXI A;  2M4N A;  5I4D A;  3QIJ A;  3L17 A;  2KN5 A;  3AU4 A;  3BK1 A;  2PMV A;  3BYT B;  2V3N A;  1KF6 B;  2DHZ A;  1TKG A;  4HPM B;  2GBN A;  2QDF A;  4GU2 A;  2N1W A;  3NUH B;  4K7W A;  4ACF A;  2KWU B;  2LHD A;  2WQY B;  3AE3 B;  4BKS A;  1IGC A;  1MJD A;  4LCD E;  4DXF A;  4B0M A;  2KKC A;  2WXK A;  3WAL A;  4BBN F;  3QJZ A;  2KJR A;  3VTW A;  4TQ1 A;  2LWP A;  2GI9 A;  2V1Y A;  2NBV B;  2K3U A;  1WXS A;  2BS2 B;  2LHE A;  3WA0 A;  2J0K A;  5EE0 A;  5FR6 A;  2LRU A;  2TSS A;  4HEA 1;  2BTE A;  4RF0 A;  4LK0 M;  1HZ5 A;  2AX5 A;  2FIF A;  2L32 A;  4OW0 A;  2WGS A;  1SSN A;  2JVC A;  1WM2 A;  2O6V B;  1SIF A;  2YEP B;  2IO3 B;  2KLC A;  3TJP A;  3AEF B;  3NVZ A;  2BS3 B;  1E10 A;  2MX2 A;  3C8Y A;  3U4E G;  2WXR A;  1KJT A;  3H7S A;  5CHF A;  4WIP A;  3MHZ A;  3SDL C;  1YJI A;  2BWE S;  3NZS A;  4NJ7 A;  4GIV A;  2IND C;  3ENE A;  3FIL A;  3DVN V;  1WGK A;  3AEA B;  4W9G A;  3QA8 A;  4USA A;  2JUO A;  2DAF A;  3IHP C;  1FFU A;  3SR6 A;  4RGT A;  2FCS A;  1T3Q A;  2EMS A;  2WS3 B;  1SXT A;  4YSX B;  1F52 A;  1HEZ E;  5BYR A;  3ZNG C;  2Y5B B;  3LJ3 A;  2GMI C;  2VZK B;  3DBH I;  3TEZ A;  3PV1 A;  4J3O D;  3TEY A;  3OLM D;  5EE9 A;  1K8R B;  1WYG A;  3UIO B;  1JRU A;  2XEW A;  5BO4 B;  1I4Q A;  4EZK A;  3PVL A;  1LO5 D;  2MQJ A;  1T5X D;  1EF5 A;  2NPT A;  4AUQ C;  1P0R A;  3AB5 A;  3QK0 A;  1P1A A;  4MGI E;  2BYF A;  2C7H A;  3R66 C;  1RLF A;  1YIW A;  4YWG G;  3NZU A;  4HJG E;  1YN4 A;  1C1Y B;  4PS7 A;  1WWT A;  2CHW A;  1TZ1 A;  3LXF A;  4N9F 4;  3SU8 X;  4MSM B;  2JRI B;  2PVG C;  4MM3 A;  2G3Q B;  3OJ3 A;  1HQR D;  2KFK B;  2RD0 A;  4NY0 A;  4ANW A;  1TS5 A;  4DHZ B;  3W1S C;  5EDS A;  2H89 B;  3GE3 C;  3M62 B;  4EFO A;  2DAJ A;  1MG8 A;  3AXC A;  3NVW A;  1DYQ A;  1UF0 A;  2WDT B;  3CF6 E;  1VZ6 A;  3IG3 A;  3PT2 B;  4A20 A;  1D3Z A;  3V62 A;  1FCC C;  4H2A A;  2KOX A;  1QQR A;  4B95 A;  2ZW0 A;  3PRM B;  2G4S A;  1KOT A;  1XD3 B;  4DK5 A;  3KQ4 A;  3ZXR A;  2YLM A;  3WAP A;  4P7I A;  2CJO A;  3L13 A;  5CX3 A;  3DOW A;  4ARI A;  3ZJU A;  1L5P A;  2KQ4 X;  4M8M A;  1NEK B;  4AJW A;  2K8C A;  3ECI A;  1SJE D;  5BYQ A;  4DBG A;  4ZOH C;  3TSS A;  2ONQ A;  4RH6 A;  2Z8L A;  1H8C A;  1PDX A;  4HPL B;  2GBM A;  3DWM A;  1WFY A;  4JE3 B;  4DDG D;  1GC7 A;  4XX5 A;  2N7D A;  3AEB B;  3OJ4 B;  3N1X C;  2KDB A;  1NDD A;  1PUT A;  4IUM B;  1E8Y A;  2BB6 A;  2Q5W D;  4LTU A;  3DBL B;  3CST A;  2YEP F;  3N1Y C;  1OQY A;  3KUD B;  5T8I A;  1N62 A;  4FLH A;  2K6Q A;  3HM6 X;  4M01 A;  3GZN B;  3S2A A;  4P1C C;  2MW5 A;  2J42 A;  2MRP A;  4ZRK A;  1SBB B;  4WQM A;  3ZJT A;  3W1Y A;  2KDE B;  3VFK A;  1F0Z A;  4YTP B;  3ETR A;  4IDI A;  2WNM A;  4LDT B;  4NAW B;  1C76 A;  3U8Z A;  2KX0 A;  1FO4 A;  3IT6 B;  2WXP A;  4MGK E;  3RUL A;  3U30 A;  1RM6 C;  2G1E A;  3P4R B;  2IZV B;  1CZP A;  1WX9 A;  1OFF A;  3T8M A;  4F7Z A;  1YJ1 A;  4ZYS A;  2INN E;  3TUO A;  4KDI C;  2LGI A;  1CJE A;  5C1Z A;  2KNB A;  1V80 A;  2L05 A;  2VH2 A;  2LGX A;  4NPN A;  2CU1 A;  4HWI B;  2PTL A;  5G2N A;  3PPA A;  2K0P A;  2C7M B;  3Q14 C;  2V9H A;  4OZA A;  4ZHO A;  1JAL A;  4RF1 A;  2HE7 A;  1Y8R C;  2ZNV C;  3VUY A;  2DYM A;  4DHJ D;  1L4D B;  2C5L C;  1JRP A;  3SFE B;  2M17 A;  2Y5P A;  4WQO B;  2XN9 C;  1J7B A;  1L0Y B;  2RPQ A;  3EA6 A;  4C7Z A;  2KMC A;  1YQ4 B;  1I4P A;  3BK2 A;  5HKH A;  1QKZ A;  3PLV A;  3WIM A;  4PT5 A;  1N6Z A;  3RZW C;  3O65 B;  3ZDM C;  2HTH A;  1WGD A;  1JWM D;  3T9L A;  3MC8 A;  3RD2 A;  4BKG A;  1ZKH A;  1ENF A;  1SEB D;  4LNK A;  4GDL B;  2WXO A;  4PS8 A;  1R4M B;  3R7Q A;  2KMA A;  1I4R A;  4OZC A;  3BII D;  2I2Y A;  2Y5C A;  2KDI A;  2L0T A;  1V5T A;  2MBB B;  2R61 A;  4B0E A;  5LXI B;  2RGF A;  1DGJ A;  1YX6 B;  3IBE A;  1KH0 A;  3CSF A;  4KV2 A;  2E6X A;  3A4R A;  1JWB D;  4HVB A;  1K50 A;  3UIN B;  4BFR A;  1GC6 A;  2LVP A;  4M00 A;  1T6B X;  3MJW A;  2LJ5 A;  3Q8E A;  2BF8 B;  1XXG A;  2R2Q A;  1C9F A;  2BKR B;  4BOZ B;  3DCG A;  2DZJ A;  2MH7 A;  1WZ3 A;  1E90 A;  2C9W B;  1WIA A;  1UWM A;  1IYF A;  4EZL A;  4XWW A;  5DPR A;  2D3A A;  4X57 B;  4FJZ A;  1JW9 D;  2N9X A;  4GB9 A;  1V49 A;  1FXA A;  4K7S A;  4AOF A;  3K9P B;  1WXA A;  1HE8 A;  1RAX A;  4IG7 B;  4FA6 A;  3MJ5 A;  1P3Q U;  3NS1 A;  2KX3 A;  2KWD A;  4Q2J A;  4IW0 A;  5DPW A;  1UNS A;  2M0X A;  2ZZP B;  2DZI A;  3B08 A;  3U7Z A;  2MA9 B;  4MJS B;  4C00 A;  3V6C B;  2FNJ B;  5BYS A;  3H9D A;  3N1Z C;  1IP9 A;  3DQV A;  3N9Y C;  4ZDV A;  1SE3 A;  4YTM B;  3TIX A;  3VUW A;  2LGY A;  2K8H A;  1FIQ A;  1STE A;  1SJH D;  1C4P A;  1WXQ A;  2KXJ A;  2QC8 A;  2JXX A;  3EEC A;  4OVU A;  2IYD B;  5HFY A;  3PSE B;  3DBH B;  1DOX A;  3DVG X;  5AZF A;  3PHX B;  3N20 C;  3VUX A;  3RUI B;  1IBX A;  3Q3N C;  1L7Y A;  2N9P C;  4TV3 A;  2LRW A;  5FKA C;  2IO2 B;  2IDY A;  2J0J A;  2WDR B;  4YXD B;  1DOI A;  3PRE A;  3N30 A;  3L54 A;  1FRD A;  4FJV B;  2A4Z A;  2KTF A;  2V3P A;  2KHW B;  1Q5W B;  4MGY E;  5DPT A;  3E56 A;  1YQB A;  4AP4 C;  5E6J A;  4ZRI A;  3NVV A;  1WRD B;  2ZPY A;  1SE4 A;  1NBF C;  4CO7 A;  2D3G A;  2I1J A;  4ZRQ A;  1TGZ B;  4XE0 A;  3SEB A;  4E3C A;  1OQR A;  4NJ6 A;  4JWU C;  3R7R A;  1NI3 A;  4E74 A;  2NMQ A;  2VRR B;  2KN4 A;  3UF8 A;  4MH0 E;  3WCQ A;  5IN7 A;  1R7S A;  4NNJ B;  4IC7 B;  1SB3 C;  4TMA B;  2RSU A;  3P42 A;  1D5X C;  2K25 A;  1FNV A;  2N9E B;  4GOC A;  3V61 A;  1LFD A;  1QZE A;  3AE8 B;  3CIR B;  4JIO U;  4BOS C;  1BML C;  2G4D B;  1QT9 A;  3AEG B;  4AWJ A;  4ZRJ A;  1VD2 A;  3APF A;  4WJP A;  2N9K A;  1MHH E;  4UDU C;  4NAM A;  1N5X A;  1SE2 A;  2BGF A;  2BB5 A;  4A6Q A;  1AWD A;  4LNO A;  3R3M A;  1JWS D;  1XQQ A;  2O6V A;  2DZK A;  2ZNV B;  3AE1 B;  2KQS A;  4XYC A;  4JX1 C;  3ZNH B;  5MPO A;  5IP4 D;  4C7Y A;  2JYE A;  5D6J B;  5J2R A;  1L2N A;  2JRH A;  1FFV A;  2QCZ A;  3PGE A;  1ZE3 D;  3GB1 A;  4DHZ E;  1VDV A;  5C23 A;  1AYF A;  3Q3J A;  1K52 A;  2J4X A;  1FRR A;  4RM8 A;  1NYR A;  1PQS A;  3QHT A;  2DEN B;  2QJL A;  4OZB A;  1UWX A;  2KDM A;  3Q8C A;  2BVC A;  3KWL A;  3U52 E;  4KDL B;  2BYT A;  1P98 A;  2IGD A;  4MAC A;  4RGN A;  2KWV B;  4BZA A;  5LXH A;  5IAA C;  4ARC A;  1D5Z C;  4DHJ B;  3BZD B;  4LJO B;  4KZ0 A;  2MSE D;  5H92 C;  3I57 A;  2V4I B;  4HRS A;  2IPK D;  2AQ3 B;  3ZUN A;  2ASQ A;  4EKU A;  3P63 A;  1V86 A;  1LXD A;  2WU5 B;  4MEL A;  3B9J A;  4URK A;  1KLU D;  1QOG A;  3NS8 A;  1WF9 A;  2IO1 B;  1G6J A;  3HUI A;  5FR3 A;  1C4C A;  4KGR A;  3LDZ E;  3WAO A;  4PK1 A;  4LNN A;  2OOB B;  1N5W A;  2M1M A;  1XLQ A;  3RT3 B;  3H8H A;  2LFI A;  2LJI A;  1XLN A;  2PE6 B;  2UYZ B;  3ZNI D;  5TR5 A;  1F9J A;  2R2O A;  3IT4 B;  1E8W A;  1YOV B;  1I4G A;  2KFK A;  2WX0 A;  5IKC M;  2L8J A;  1I35 A;  1V81 A;  2M56 B;  2MBH A;  2MLB A;  3NVY A;  5JHB A;  4GDK B;  4NQL B;  2HJ1 A;  1BUI C;  4QAY A;  2PPH A;  3GOE A;  4TKN A;  3UQB A;  3TCA A;  1OGW A;  1EF1 A;  1D5M C;  3NZ3 A;  3Q3F A;  3P4S B;  3AE4 B;  4ANX A;  2XK5 B;  1TS4 A;  4G11 A;  4AQ7 A;  2JXT A;  3M3J A;  1GPX A;  4DXA B;  3DWG C;  1PGB A;  1E0Z A;  2UWQ A;  2WXG A;  3MC9 A;  3GE8 C;  4P1B C;  2JPH A;  1GNU A;  2QIE B;  4HKZ E;  2D11 A;  2WXF A;  3ZYY X;  1VZ7 A;  3D32 A;  1WGY A;  2PKO A;  3P4P B;  3PRZ A;  3ZVV A;  3W9C B;  1TBE A;  1P7F A;  1WGG A;  2GLS A;  4WAF A;  1C78 A;  2D07 B;  4G0N B;  4WJO A;  1OEY A;  1RFK A;  3L10 B;  4ASW C;  1WRI A;  3JYU A;  2LUE A;  4IOI E;  5HG2 A;  4BKT A;  5J18 A;  1LM8 B;  1YJJ A;  4XWT A;  3UI3 A;  4II2 B;  2JY6 A;  2KFJ A;  1WJ4 A;  2IY1 B;  2WP9 B;  2VH1 A;  4ZHP A;  4FUL A;  2MEK A;  5LNK 1;  1SF0 A;  1WE7 A;  4I6L B;  1GJZ A;  2MCN B;  1EU3 A;  3DHG C;  3JSV A;  4NAW A;  1V8C A;  1Y56 A;  3FC4 A;  3HHM A;  4C4V B;  3RMK C;  2QMT A;  4O1N A;  2ZJD A;  1B1Z A;  1WXV A;  2K5P A;  1Z2M A;  2D10 A;  3AMZ A;  2PW9 A;  2JZ3 B;  1FXT B;  3PS6 A;  1WZ0 A;  1VRA B;  1E7P B;  2BWF A;  1V1P A;  2FCQ A;  1K51 A;  2V4L A;  3A9J B;  4L2Y A;  3HVD A;  2CHX A;  3MC0 B;  1L4Z B;  2NR2 A;  2J7Q B;  1I4X A;  1QOB A;  1FNW A;  1TYG B;  2NTT A;  3EFC A;  2ACZ B;  3Q3M C;  4N58 A;  2W9N A;  3C19 A;  2AL6 A;  4JL9 A;  4KKI A;  5JHA A;  1ESF A;  3KVF B;  2G45 B;  2BW2 A;  4TSS A;  5JZE B;  1HTO A;  3JSV B;  4XGA B;  3QX1 A;  2KLG A;  4ZRP A;  1LQB A;  2WXQ A;  2LVO A;  2NTS A;  1GB1 A;  1EWC A;  1T0S C;  2SEB D;  2LUM A;  2BBC A;  4E71 A;  2W54 A;  1UUP A;  3CWI A;  2AL3 A;  3IAM 1;  1HA5 A;  2WDV B;  1M94 A;  2KD0 A;  2BYE A;  3DVG Y;  1V1P B;  1T0Q C;  4GDL A;  2GB1 A;  2YVC A;  1NVI D;  3W5V B;  5EE3 A;  1WR6 E;  3L4P A;  2FCM A;  4LNI A;  1NYQ A;  4G50 A;  1WGR A;  2NCN A;  4CHK A;  2H88 B;  4S17 A;  2K6D B;  4ANU A;  3APD A;  1AN8 A;  3RN9 C;  4YSY B;  3N32 A;  5IO9 A;  5FK9 C;  2OJR A;  1TY0 A;  3ZGZ A;  3W5U B;  3TL5 A;  3VRB B;  2MJE A;  3V05 A;  5G5G A;  1YN3 A;  3VH3 B;  1HTQ A;  2HDE A;  2LD9 A;  5CHV C;  4M0W B;  2KVR A;  3UIP B;  2L83 A;  3Q6B A;  2FID A;  4HK2 A;  2JQR B;  1SGH A;  2JSV X;  1HXY D;  4BKS D;  3TMP B;  4WWM A;  4RMA A;  1GUA B;  1UGM A;  3Q3O C;  3H7P B;  1Q0W B;  3VR9 B;  1JWA D;  1WJN A;  2WX1 A;  4WUR A;  1T0Y A;  1TT5 B;  5E6P A;  1E7U A;  2L1A A;  2WXL A; 
#chains in the Genus database with same CATH homology
 3ENE A;  4MJS A;  2ZPY A;  3DVN V;  3W1S A;  1NBF C;  2RR9 A;  4CO7 A;  2D3G A;  2I1J A;  4W9G A;  2BPS A;  1TGZ B;  3QA8 A;  2JUO A;  2V3S A;  2DAF A;  5E6N A;  4FN2 A;  3IHP C;  4E3C A;  2L00 B;  4A3P A;  2LI5 A;  4W9F A;  4NJ6 A;  2FCS A;  3APC A;  2EMS A;  3R7R A;  3ZLZ A;  4E74 A;  3U7D A;  1WMH B;  2VRR B;  3UF8 A;  4MH0 E;  3ZO5 B;  3UQA A;  2PJH A;  4NNJ B;  3ZNG C;  4IC7 B;  5GMV A;  2RSU A;  4K81 A;  2Y5B B;  3LJ3 A;  4LJP B;  1UBQ A;  2GMI C;  3MHS D;  1UH6 A;  2K25 A;  3L08 A;  3DBH I;  2CKH B;  2LXC A;  3PV1 A;  1J8C A;  2KO3 A;  3OLM D;  2GOW A;  2N9E B;  4ZRI A;  4II3 B;  4GOC A;  3V61 A;  2PEA A;  4MEM A;  1LFD A;  1QZE A;  1K8R B;  1WJU A;  3IFW B;  4JIO U;  4HCP B;  4W9D A;  3RCZ A;  2JZZ A;  3UIO B;  2G4D B;  2EKE C;  1JRU A;  1ZGU B;  2FAZ A;  2XEW A;  5BO4 B;  3X0W A;  4AWJ A;  4EZK A;  1BT0 A;  4ZRJ A;  1WX8 A;  3PVL A;  3V60 A;  1VD2 A;  3APF A;  3NOB A;  2MBO A;  4WJP A;  2MQJ A;  4K1R B;  4BVU C;  2BGF A;  1EF5 A;  2NPT A;  4AUQ C;  1P0R A;  1GG3 A;  3AI5 A;  1P1A A;  3C0R B;  3R3M A;  3QK0 A;  4MGI E;  2NVU I;  1XQQ A;  2BYF A;  2C7H A;  2Z0D B;  4RM9 A;  2O6V A;  1RLF A;  2BKF A;  1YIW A;  2DZK A;  2KJH B;  3NHE B;  3R66 C;  3ZDT A;  3NZU A;  3VVW B;  2ZNV B;  1C1Y B;  2ZEQ A;  2KQS A;  4GGQ A;  1EO6 A;  2WWZ A;  3JVZ X;  3ONS A;  3H1U A;  2ZCB A;  3A1Q B;  4PS7 A;  3ZNH B;  2REX A;  3H7P A;  5D6J B;  2CHW A;  5J2R A;  1TZ1 A;  4IWO A;  4GXB A;  4N9F 4;  1L2N A;  3SU8 X;  2JRH A;  3PGE A;  4MSM B;  2JRI B;  3ALB A;  4OVV A;  2QHO A;  3DVN U;  1Z5S B;  4XZ4 A;  4DHZ E;  5C23 A;  2Z59 B;  4KIK B;  4W9L A;  4MM3 A;  2G3Q B;  3OJ3 A;  2KFK B;  5CHW A;  2RD0 A;  3Q3J A;  1V5O A;  4NY0 A;  1VCB A;  4ANW A;  2N4F A;  4DHZ B;  1OTR B;  4ICV A;  4EZJ A;  3W1S C;  5EDS A;  2AEH A;  1WM3 A;  4RM8 A;  1NI2 A;  3VTV A;  1ISN A;  2O6V D;  1PQS A;  3L0W B;  3QHT A;  2DEN B;  3PRP B;  3M62 B;  4EFO A;  4TQ0 A;  3QWZ B;  2DAJ A;  1MG8 A;  3AXC A;  3VTU A;  3ZIM A;  4KDL B;  3PHW B;  1WMH A;  2WDT B;  1P98 A;  1S1Q B;  3CF6 E;  2C60 A;  1UEL A;  3HIZ A;  3IG3 A;  2KWV B;  3PT2 B;  3PTF C;  4A20 A;  4EOY A;  1D3Z A;  5LXH A;  5IAA C;  3V62 A;  4CYE A;  4DHJ B;  2PE9 A;  4WWN A;  4LJO B;  2KOX A;  4MGZ E;  3BY4 B;  4KZ0 A;  2MSE D;  4B95 A;  3HK0 A;  4PYU A;  3PRM B;  2G4S A;  3K9O B;  2O2V A;  3L16 A;  1XD3 B;  4DK5 A;  4GSW A;  1KOT A;  2ZPN A;  5AZH A;  2YLM A;  3WAP A;  1SE9 A;  4P7I A;  1TTN A;  3L13 A;  4JLC A;  3ZUN A;  2ASQ A;  5CX3 A;  3DOW A;  3MTN B;  4WJN A;  4EKU A;  2BYV E;  1V86 A;  4M8M A;  2JT4 B;  4B6W A;  2LVQ A;  1LXD A;  1WR1 A;  4AJW A;  1RRB A;  4MEL A;  2K8C A;  3ECI A;  4FHK A;  3PZD A;  2ZCC A;  4URK A;  4J6I A;  3NS8 A;  1WF9 A;  1YX5 B;  2IO1 B;  1G6J A;  2M8S A;  4DBG A;  3PLU A;  4W9I A;  3LDZ E;  2J0M A;  3WAO A;  1H8C A;  1KLV A;  3SD5 A;  1S3S G;  2B3A A;  4HPL B;  2GBM A;  2KDF B;  2MP2 B;  2OOB B;  2FCN A;  1WFY A;  2L76 A;  2M1M A;  2NBW B;  3A1Q A;  4IM0 A;  3RT3 B;  3ZRC A;  4DDG D;  2KC1 A;  2KAN A;  4HCN B;  2IY0 B;  2KQ7 A;  1GC7 A;  1WY8 A;  4XX5 A;  2N7D A;  3ZRF A;  2PE6 B;  2EMT A;  2UYZ B;  3OJ4 B;  2KDB A;  3ZNI D;  3ZTD A;  1NDD A;  3M95 A;  4IUM B;  1E8Y A;  5TR5 A;  1F9J A;  3OAW A;  2XBB C;  2R2O A;  5L95 C;  4IM3 A;  3P2B A;  1E8W A;  4KIK A;  3CST A;  4YL8 A;  2KFK A;  2WX0 A;  5AEK B;  4PS3 A;  4W9K A;  4DWF A;  1V6E A;  1OQY A;  2L8J A;  1I35 A;  1V81 A;  5DPS A;  2NBU A;  2MBH A;  3KUD B;  2MLB A;  1WJ6 A;  2O2V B;  3A9K B;  5JHB A;  4FLH A;  4GDK B;  4NQL B;  2K6Q A;  3HM6 X;  3S2A A;  2MWS B;  3VAW A;  2L3Z A;  2MW5 A;  3H6N A;  2MRP A;  2PPH A;  4ZRK A;  2DYO A;  3GOE A;  3I3T B;  4TKN A;  3UQB A;  3TCA A;  3W1Y A;  2MBE A;  4ANV A;  2KDE B;  4EEW A;  3RYT A;  3DPD A;  3VFK A;  3RZF A;  3WAN A;  1OGW A;  1EF1 A;  3Q3F A;  3NY5 A;  4ANX A;  2XK5 B;  4LDT B;  4IM2 A;  3B1L X;  4NAW B;  3U8Z A;  4XC2 A;  2KTR B;  2KX0 A;  4G11 A;  4TUU A;  4FHJ A;  3JW0 X;  2HD5 B;  2HJ8 A;  4MGK E;  4W9H A;  3RUL A;  4W9E A;  3U30 A;  4I6N B;  3VHT C;  4K7U A;  3M3J A;  2IZV B;  3DBS A;  4DXA B;  1WX9 A;  4HJK A;  1WI0 A;  3T8M A;  4F7Z A;  1YJ1 A;  2UWQ A;  5LLI A;  1UD7 A;  4W9C A;  4WJQ A;  4KDI C;  4F1S A;  5C1Z A;  2KNB A;  4HXD A;  1V80 A;  1RFA A;  2JPH A;  1GNU A;  2L05 A;  2LGX A;  4B9K A;  4NPN A;  2CU1 A;  3A4S C;  1Q1O A;  4HWI B;  2D11 A;  2IO0 B;  3CMM B;  3QCA A;  4FBJ B;  5G2N A;  3PPA A;  2C7M B;  3D32 A;  1WGY A;  2KJ6 A;  2HE7 A;  1Y8R C;  3DBR I;  4FAD A;  2A5U A;  2ZNV C;  5D94 A;  3VUY A;  3PRZ A;  4GN1 A;  3ZVV A;  2MP2 A;  4ICU A;  1TBE A;  2DYM A;  4DHJ D;  4HLE A;  3X23 A;  2C5L C;  3UGB B;  2I1K A;  3QC8 B;  3DBL I;  3VXW A;  1WGG A;  3VDZ A;  2M17 A;  2L0F A;  2D07 B;  4WQO B;  2WYQ A;  1IPG A;  4G0N B;  4WJO A;  2RPQ A;  5DCN A;  1OEY A;  2KMC A;  3EHV A;  3L10 B;  5HKH A;  4G3X B;  1WE6 A;  4I6P A;  3GZN I;  4ASW C;  2C7N B;  3JYU A;  2D2Q A;  2LUE A;  3PLV A;  2K8B A;  3WIM A;  3AUL A;  4KZC A;  4BKT A;  5J18 A;  1LM8 B;  5IA7 A;  3A9K A;  1OEY J;  4JGH B;  3RZW C;  3O65 B;  1U4A A;  3QAQ A;  4GDK A;  4II2 B;  4M8N A;  4JQW C;  1WYW B;  2JY6 A;  2CHZ A;  1WJ4 A;  2IY1 B;  2KFJ A;  3BIN A;  3EFU A;  4KSK C;  3ZDM C;  2HTH A;  1WGD A;  1X1M A;  3T9L A;  4FUL A;  3RD2 A;  1UBI A;  1ZKH A;  4PYZ A;  2JF5 A;  4BKG A;  1C3T A;  1WE7 A;  2DYB A;  2JWZ A;  4I6L B;  1KM7 A;  1GJZ A;  2MCN B;  4GDL B;  3KH0 A;  2XK5 A;  3JSV A;  4NAW A;  4PS8 A;  2KTR A;  3B0A A;  3R7Q A;  2GBR A;  2L7R A;  1WH3 A;  2KMA A;  4IWQ A;  1I42 A;  5AZG A;  3QAR A;  5D7G A;  3HHM A;  3WAM A;  2KK8 A;  2KDI A;  2L0T A;  1V2Y A;  1E7V A;  1V5T A;  2ZJD A;  5KHO A;  2MBB B;  2MBQ A;  3DDC B;  1WXV A;  2Z0E B;  1R4N I;  5J17 A;  4GMV A;  5LXI B;  1Z2M A;  2N1V A;  2RGF A;  2D10 A;  2JZ3 B;  4BOS C;  1ZW7 A;  1YX6 B;  3IBE A;  1FXT B;  3CSF A;  4KV2 A;  4WWP A;  4FJY A;  3PS6 A;  1WZ0 A;  5E6O A;  4HDO A;  3A4R A;  2BWF A;  2FCQ A;  2LAS A;  3V6E B;  2V4L A;  3A9J B;  3HM3 A;  1WX7 A;  4HVB A;  3UIN B;  2KWC A;  4BFR A;  2LXA A;  2AWT A;  1GC6 A;  1V9J A;  2CHX A;  2LVP A;  2NR2 A;  2J7Q B;  3MJW A;  2LJ5 A;  2BF8 B;  4LDT D;  2R2Q A;  2BKR B;  4BOZ B;  3DCG A;  2LZ6 A;  2DZJ A;  4EUT A;  2GBJ A;  1YD8 U;  3ZW3 A;  1WZ3 A;  2W9N A;  1E90 A;  2AL6 A;  3M63 B;  4JL9 A;  1XT9 B;  2C9W B;  5JHA A;  2ZVN A;  5D2M B;  1WIA A;  3KVF B;  2G45 B;  2IBI B;  2DZM A;  3QQ8 B;  2KC2 A;  5JZE B;  4AJY B;  1IYF A;  1WGH A;  2K39 A;  4EZL A;  3AU5 A;  3JSV B;  1EUV B;  5DPR A;  3QX1 A;  4HDQ A;  4X57 B;  2KLG A;  4FJZ A;  4WAA A;  4WWO A;  5KHQ A;  1LQB A;  3KYC D;  3KYD D;  2N9X A;  4GB9 A;  2KZR A;  3ZNZ B;  1J0G A;  1V49 A;  1P9D U;  2LVO A;  4K7S A;  2NS5 A;  4AOF A;  1H4R A;  1WXA A;  3K9P B;  4MSQ B;  3ML9 A;  1HE8 A;  2CR5 A;  2K1F A;  1RAX A;  4W9J A;  4IG7 B;  4FA6 A;  3ZTC A;  4E71 A;  3VH4 B;  1UZX B;  3KUZ A;  1P3Q U;  2KX3 A;  4A3O A;  4IW0 A;  5DPW A;  2AYO B;  2GBK A;  4NQK E;  1R4M I;  1WXM A;  2AL3 A;  2M0X A;  1CMX B;  2FUH B;  2ZZP B;  3KW5 B;  1E8X A;  2DZI A;  3B08 A;  2MA9 B;  1M94 A;  2KD0 A;  2M4N A;  2BYE A;  3QIJ A;  3DVG Y;  4GDL A;  4MJS B;  3L17 A;  3ZKJ C;  2YVC A;  2KN5 A;  3AU4 A;  3KUC B;  3V6C B;  2FNJ B;  4BBN C;  1WR6 E;  3H9D A;  1IP9 A;  2DHZ A;  1E8Z A;  2DX5 B;  3DQV A;  4HPM B;  2FCM A;  4ZDV A;  2GBN A;  1E5W A;  5L83 A;  3TIX A;  3VUW A;  2LGY A;  1WGR A;  2NCN A;  2K8H A;  4G50 A;  4GU2 A;  2N1W A;  4K7W A;  4CHK A;  1A5R A;  2KWU B;  2K6D B;  4ANU A;  3APD A;  4BKS A;  4LCD E;  4MDK E;  2KKC A;  3N32 A;  1AAR A;  3WAL A;  2KXJ A;  4KVG B;  4BBN F;  2ZVO A;  3QJZ A;  2KJR A;  3VTW A;  4TQ1 A;  2JXX A;  2OJR A;  3A9J A;  2LWP A;  2V1Y A;  2NBV B;  3EEC A;  3IVF A;  5JH5 C;  1WXS A;  3TL5 A;  4OVU A;  3WA0 A;  2IYD B;  2J0K A;  5FR6 A;  3PSE B;  3SHQ A;  2LRU A;  3DVG X;  5AZF A;  3TBL D;  3PHX B;  3N3K B;  1J19 A;  3VUX A;  3RUI B;  3VQI A;  3VH3 B;  2CS4 A;  2FIF A;  2LD9 A;  2N7E A;  5CHV C;  2NPT B;  4M0W B;  2KVR A;  3UIP B;  1L7Y A;  2N9P C;  4TV3 A;  2JVC A;  1WM2 A;  2O6V B;  1SIF A;  2LRW A;  2FID A;  4HK2 A;  2IO2 B;  5CTR C;  1SGH A;  4IWP A;  3TMP B;  2J0J A;  4BKS D;  2IO3 B;  4RMA A;  2KLC A;  1GUA B;  4F8C B;  1UGM A;  4ZYN A;  3H7P B;  3TJP A;  3PRE A;  1Q0W B;  3N30 A;  3A33 B;  3ML8 A;  2MX2 A;  3L54 A;  4FJV B;  1WJN A;  2A4Z A;  2KTF A;  2WX1 A;  2KHW B;  1Q5W B;  4MGY E;  1KJT A;  3EC8 A;  4KSL C;  1T0Y A;  2LGD A;  3H7S A;  5CHF A;  5DPT A;  3SDL C;  5E6P A;  1E7U A;  2BWE S;  3NZS A;  4DDI D;  1YQB A;  4AP4 C;  5G55 A;  4NJ7 A;  4GIV A;  1WRD B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...