5CHVC

Crystal structure of usp18-isg15 complex
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
153
structure length
153
Chain Sequence
AWDLKVKMLGGNDFLVSVTNSMTVSELKKQIAQKIGVPAFQQRLAHQTAVLQDGLTLSSLGLGPSSTVMLVVQNSSEPLSILVRNERGHSNIYEVFLTQTVDTLKKKVSQREQVHEDQFWLSFEGRPMEDKELLGEYGLKPQCTVIKHLRLRG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis of the specificity of USP18 toward ISG15.
pubmed doi rcsb
source organism Mus musculus
molecule tags Hydrolase
molecule keywords Ubl carboxyl-terminal hydrolase 18
total genus 34
structure length 153
sequence length 153
chains with identical sequence D
ec nomenclature
pdb deposition date 2015-07-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00240 ubiquitin Ubiquitin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 5chvC02
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 5chvC01
2CS4A 1WMHA 2O2VB 3VFKA 2AL6A 4EKUA 3H9DA 3QARA 4AP4C 4BKSD 2ZZPB 3H7SA 2ASQA 1S3SG 3DOWA 3OLMD 4IW0A 4J6IA 2LXAA 4MGIE 1WF9A 2FCQA 4ZRKA 3CMMB 3PPAA 1E8YA 3UIPB 2PJHA 1WM2A 1WZ3A 4W9JA 2DZIA 5D94A 2HTHA 4AJWA 2L00B 2MP2A 1GNUA 3TMPB 1QZEA 3DVNV 1WXVA 4MGKE 3WAOA 2V3SA 1V9JA 4FN2A 1WXSA 1I35A 4DDID 1SGHA 1TTNA 2XEWA 4FJZA 1C3TA 3JVZX 2K8HA 2MCNB 3ZLZA 3APDA 4OVUA 2KWVB 2L0FA 2IZVB 2I1JA 1I42A 3ML9A 3QA8A 1H8CA 1GUAB 4I6PA 4RMAA 2KO3A 2KTRB 2GBNA 2C7MB 4FLHA 4GU2A 4LJPB 3A9JB 2LRUA 3HM3A 5GMVA 2D2QA 1OGWA 3PS6A 4ANUA 1TGZB 1WMHB 4G50A 3H7PA 3PREA 4MJSB 3VVWB 2MW5A 3ML8A 4K7SA 2N1VA 5HKHA 3WAPA 2V1YA 3ZUNA 4M8NA 2M17A 3A1QA 5D6JB 1WX7A 4RM9A 4ICUA 1TBEA 4HLEA 3RYTA 2FNJB 1PQSA 1E7UA 5AZGA 2N9EB 2N4FA 4LCDE 1E5WA 1WY8A 2ZVNA 3ZDMC 3ZNZB 3VHTC 5LXIB 2LVOA 4HCNB 4E74A 2IBIB 3ZRCA 2G3QB 4K7UA 2KX0A 2NBWB 1XD3B 2DAJA 4M0WB 2CHWA 2L3ZA 2IY1B 2KDEB 3UINB 5E6PA 3APFA 2D10A 3BINA 4LDTB 4PS3A 3SD5A 5KHOA 5JH5C 3IFWB 1E8WA 3U7DA 4ZRJA 3A4RA 3PLUA 3VDZA 5DPWA 2HJ8A 4NY0A 2L76A 3SDLC 4DWFA 2J0KA 1FXTB 5DPTA 3L17A 2L8JA 4IWQA 2UYZB 3EHVA 2AWTA 2YVCA 2KKCA 2XK5A 3T8MA 1RAXA 1BT0A 2DZJA 2K39A 1X1MA 1LQBA 1RLFA 3IHPC 5BO4B 4FHKA 1V81A 2N9XA 2UWQA 3DVGY 3PV1A 2KVRA 2MRPA 3VXWA 3WA0A 5FR6A 2BWFA 3PGEA 2KC2A 3OJ3A 3TIXA 1UBQA 4GN1A 4GB9A 3UF8A 4DDGD 2KD0A 4JL9A 2O2VA 1V2YA 1Z5SB 3EECA 3PRZA 2WDTB 4B95A 4WJOA 4JQWC 1E7VA 1OEYA 2JF5A 1IPGA 2ZPYA 2MBBB 2NBVB 3VUWA 2LI5A 2LGDA 4BKTA 3I3TB 1XT9B 1YJ1A 3W1SC 3DCGA 1P98A 3ZTDA 2EMTA 1WGYA 2KMAA 3KUCB 5DPRA 1UBIA 2LASA 2KTFA 2PPHA 4NJ7A 4TV3A 5LLIA 4BOZB 3TJPA 3T9LA 1RRBA 2KLGA 2MP2B 3DQVA 1H4RA 1WYWB 3PT2B 5L83A 2FCMA 2BYEA 2MA9B 3RCZA 3ONSA 4F7ZA 4IM2A 3DBRI 2Z0EB 3QJZA 4E71A 2PE6B 1HE8A 4E3CA 5J2RA 4XC2A 2C7HA 2KC1A 4KDIC 1WGGA 2J0MA 4IM3A 4KSKC 4IWPA 5CHFA 1YX6B 2BWES 3BY4B 1Q1OA 2JVCA 4LJOB 4TKNA 3OJ4B 3JSVB 1D3ZA 3RZWC 4FA6A 1E8XA 3L0WB 3PVLA 4GDLB 1WE7A 1WJ6A 1K8RB 3X23A 2BKFA 1NDDA 4FHJA 4W9IA 4PS7A 3NZSA 1KLVA 2M8SA 3HIZA 2REXA 1Y8RC 2O6VB 1WGRA 3H1UA 4ZRIA 2D11A 2RD0A 3RD2A 1ISNA 2NCNA 1V49A 2GOWA 2NVUI 4MJSA 4OVVA 1SE9A 3PHWB 3OAWA 1TZ1A 1WH3A 4K1RB 2DZMA 2LD9A 4HDOA 1NI2A 2M4NA 1ZGUB 3JYUA 5CHVC 1WXMA 2IO1B 3RUIB 4HCPB 3PZDA 4URKA 3VUXA 4HPLB 2MWSB 2Z0DB 2ZEQA 2KANA 2KJRA 4WJPA 1NBFC 2W9NA 4W9HA 4N9F4 2JT4B 4W9FA 1V5TA 4CHKA 1VCBA 3HHMA 3K9PB 4KZ0A 1P1AA 1WIAA 3U30A 4EFOA 1MG8A 3APCA 2KFKB 2LGYA 1CMXB 4KSLC 2EMSA 4I6NB 2HD5B 3QC8B 2LWPA 2JZZA 3L13A 2MBOA 2NPTA 5TR5A 4NAWA 1UD7A 2GBRA 1P3QU 3A4SC 2MBEA 3RZFA 2GMIC 2KQ7A 2C60A 4MGZE 3M62B 3V6EB 2KWUB 1AARA 2V4LA 2LVPA 5IA7A 1JRUA 3P2BA 4MSMB 3VH3B 1UGMA 3ZNID 4EZKA 1XQQA 3IBEA 3Q3FA 5D2MB 2JRHA 2KOXA 4WWOA 5EDSA 4F1SA 3RULA 2WX1A 2ZJDA 4MELA 4MSQB 2KN5A 5CTRC 3V60A 4I6LB 5J18A 5KHQA 3QIJA 1WFYA 2MSED 3DPDA 2A5UA 4BFRA 4W9CA 1J0GA 2NPTB 4BBNC 3N32A 4BKSA 1L2NA 2IYDB 4RM8A 4FADA 3UQBA 4CO7A 4MGYE 2AEHA 2BYVE 1WM3A 2Z59B 1KJTA 1L7YA 4B6WA 1WX9A 2BKRB 4MH0E 4MEMA 1M94A 4KZCA 1WR1A 4KIKA 2B3AA 3R7RA 1WX8A 2KDFB 3NY5A 3O65B 3AU4A 4NAWB 5DPSA 2JRIB 1R4MI 2D3GA 4GDKB 4IM0A 3KW5B 4KVGB 2I1KA 4AJYB 1WXAA 2GBJA 2AL3A 4TQ1A 3WALA 2JUOA 4WAAA 3A33B 3TCAA 4G3XB 3X0WA 3L08A 4BOSC 5E6NA 2IO2B 1ZW7A 1WJUA 1YQBA 3M3JA 1E8ZA 4HWIB 2KJ6A 3QAQA 2IO3B 4BKGA 2FIDA 1F9JA 2KJHB 2GBKA 2MBHA 3PHXB 3ZKJC 4LDTD 3PRPB 2LJ5A 3L54A 4KDLB 3Q3JA 3QWZB 1RFAA 2BF8B 3IVFA 2KQSA 4AOFA 4IG7B 1YD8U 3WIMA 1EO6A 1V5OA 2GBMA 2L7RA 4ZDVA 2AYOB 2DAFA 4GIVA 4A3PA 1GC6A 4BBNF 2CU1A 3KUZA 2ZPNA 4W9LA 1UZXB 3SU8X 1VD2A 4GDKA 1OEYJ 3JW0X 3M95A 2VRRB 3B08A 2DENB 2KK8A 3CSTA 4NPNA 3UGBB 2KLCA 4WWPA 3SHQA 2CKHB 3TBLD 1WJ4A 2NS5A 4M8MA 2J0JA 2PEAA 3CF6E 3ZRFA 4ZYNA 2FIFA 2DHZA 4KV2A 3ENEA 3ZVVA 2FAZA 3R7QA 2LGXA 2QHOA 1LXDA 5J17A 1V86A 2KX3A 3PTFC 2LZ6A 2M1MA 1YIWA 2KMCA 2ZCCA 1LM8B 5CX3A 2WYQA 4DXAB 5JHBA 1P0RA 4TUUA 2N9PC 3GOEA 3KYCD 4FJYA 5LXHA 3U8ZA 3M63B 1LFDA 1WJNA 2CHZA 1GC7A 4MDKE 2CR5A 2O6VD 3VAWA 1J8CA 2ZNVC 2K8BA 2KZRA 3VTWA 4GGQA 3KYDD 4XX5A 4AWJA 2DZKA 4NQKE 1WE6A 2KHWB 2XK5B 1WZ0A 3VQIA 4WQOB 3DBLI 4ICVA 4HVBA 3ZTCA 4FBJB 3DBHI 2Y5BB 3W1YA 3H6NA 2FCSA 1IYFA 2RPQA 1T0YA 4EZJA 2LVQA 2M0XA 3PLVA 3QHTA 1A5RA 3VH4B 4A20A 1WI0A 3B1LX 1Z2MA 5AZFA 5AEKB 3ZW3A 5L95C 4W9DA 2R2QA 3L10B 4X57B 5IAAC 2LRWA 4MM3A 1UH6A 1KM7A 5C1ZA 3A9KB 4ASWC 2D07B 2O6VA 3GZNI 3RT3B 3N30A 4G11A 1J19A 4PS8A 2N7EA 1P9DU 3AU5A 3WANA 2NBUA 2FUHB 4XZ4A 2KDIA 3D32A 4GDLA 2K6QA 5AZHA 5DCNA 2N7DA 3JSVA 4KIKB 2MX2A 3ZIMA 4DHZE 4NQLB 3AULA 3A9KA 1WR6E 5C23A 5D7GA 4II2B 4B9KA 2C9WB 2MLBA 3DVGX 2HE7A 2KDBA 1E90A 2BGFA 3EC8A 1V6EA 4FJVB 3VTUA 3R3MA 4NNJB 1IP9A 3QQ8B 3CSFA 3A9JA 4W9KA 1EF5A 4BVUC 4ANWA 5E6OA 2K1FA 3WAMA 1GG3A 3UIOB 3VUYA 2DYBA 2G4DB 2XBBC 4FULA 4DK5A 2LXCA 2JXXA 3LJ3A 4DBGA 3HM6X 3N3KB 3PSEB 3V61A 2OOBB 4CYEA 3S2AA 3ZO5B 2ZCBA 4P7IA 3IG3A 3KH0A 5JHAA 4W9EA 2RSUA 4HJKA 2DX5B 3NS8A 2G45B 2OJRA 3V62A 2IY0B 2KXJA 1WGHA 2ZVOA 3K9OB 3QK0A 4JLCA 3VTVA 4NJ6A 1Q0WB 2WWZA 3V6CB 3C0RB 4HK2A 3ZDTA 1S1QB 2KFJA 4W9GA 4YL8A 4AUQC 4ANXA 2PE9A 4WJQA 4HXDA 4PYUA 3UQAA 3QCAA 2DYMA 1KOTA 1SIFA 2DYOA 4EEWA 3KUDB 4WWNA 2C7NB 3ZNHB 1V80A 4GSWA 2YLMA 3EFUA 1ZKHA 5CHWA 4ANVA 4K7WA 3MTNB 4HDQA 3ECIA 1WRDB 1YX5B 3DVNU 3LDZE 4K81A 1WGDA 2IO0B 2NR2A 4PYZA 3A1QB 2WX0A 3B0AA 2BPSA 1UELA 2FCNA 2KFKA 2ZNVB 1Q5WB 3MJWA 4F8CB 3ALBA 1R4NI 4A3OA 3ZNGC 2K25A 4JGHB 2JZ3B 2JY6A 1C1YB 2MQJA 3DDCB 3R66C 4EOYA 2RR9A 5JZEB 1EF1A 2CHXA 4II3B 3KVFB 4GOCA 2J7QB 2KWCA 4IC7B 2N1WA 2JPHA 2K8CA 2KNBA 2LUEA 2C5LC 4EZLA 2BYFA 4DHZB 3AI5A 3MHSD 2R2OA 4WJNA 3QX1A 2EKEC 3TL5A 1OQYA 1OTRB 4HPMB 1U4AA 3NOBA 3W1SA 3DBSA 3H7PB 4EUTA 5G55A 4G0NB 1GJZA 2JWZA 2A4ZA 3AXCA 2RGFA 3PRMB 2K6DB 3NZUA 3L16A 3NHEB 3HK0A 4IUMB 2MBQA 2KTRA 4IWOA 4DHJD 4TQ0A 4GMVA 2G4SA 5G2NA 1EUVB 2L0TA 4GXBA 4JIOU 4DHJB 1G6JA 2L05A
chains in the Genus database with same CATH superfamily
2CS4A 4KGSA 2O2VB 2GLSA 3QARA 3H7SA 1S3SG 2W3RA 2LXAA 1ZDXA 3VRBB 3CMMB 3OG5A 4RNAA 3PZ7A 2QJLA 3KWVA 2L00B 2MP2A 3RNAC 2MJDA 3WAOA 2V3SA 1I35A 4DDID 2ZW0A 2SAKA 1C3TA 3JVZX 2K8HA 2IZVB 2I1JA 2V3PA 3C8YA 2KTRB 1FM0D 4RF0A 3R2IA 5GMVA 2D2QA 4OHJA 4B0EA 4ANUA 2MW5A 3AE2B 4MM3B 3OWEB 2M17A 3A1QA 4RM9A 2ON8A 4ICUA 2GI9A 1TBEA 3RYTA 1PQSA 2QEJC 1NVID 2ZW1A 2LVOA 2IBIB 3AE5B 2G3QB 4K7UA 2KX0A 1FXIA 1EM7A 3RN9C 4LNNA 4KKIA 2CHWA 1MHHE 2KDEB 5E6PA 1JWAD 3APFA 1EU4A 4LDTB 4PS3A 3SD5A 5KHOA 3MFGA 1N60A 4GLSC 3A4RA 1ROEA 3PLUA 5DPWA 1TS2A 1L6VA 1JWUD 3DHHC 3B2FA 3EHVA 2YVCA 3T8MA 2MJEA 4FHKA 1GB4A 2UWQA 3PV1A 3VXWA 3WA0A 2BWFA 4RFBA 4GN1A 2O2VA 1OEYA 2JF5A 2WDQB 3DCGA 1WGYA 5EE3A 5DPRA 4BOZB 5LLIA 4RGTA 3DQVA 1H4RA 1WYWB 1MPEA 3PT2B 3ZXRA 3RCZA 2RMMA 2Z0EB 2PE6B 3FILA 5J2RA 2C7HA 1BMLC 1XLPA 1C9FA 4IM3A 4LJOB 1E8XA 3PVLA 4GDLB 2BKFA 4W9IA 4FHJA 2OEDA 1TY2A 4LNIA 3LXFA 4ZRIA 2D11A 1D5XC 1T0SC 2WXRA 1FO4A 3OAWA 4K1RB 1TS5A 2LD9A 5AUIA 1ZGUB 1C4PA 2ICIA 2MWSB 2KJRA 4WJPA 2W9NA 4W9HA 4N9F4 1V1OA 4W9FA 1V5TA 1VCBA 1WXQA 2N9KA 5TSSA 1P1AA 3APCA 1JWSD 1CMXB 2EMSA 5IO9A 3Q3OC 2MBOA 2GBRA 3A4SC 3RZFA 4REZA 3W5VB 4S17A 2QSDA 3P2BA 1N5WA 4EZKA 1XQQA 3IBEA 1SE2A 2WXMA 2ZJDA 5CTRC 4MSQB 3V60A 2K0PA 3DPDA 2A5UA 1J0GA 1L2NA 1IGCA 2IYDB 4CO7A 4MGYE 4B6WA 1WX9A 3TEYA 2LHDA 2B3AA 3I5JC 1R4NB 3AU4A 5HFYA 2JRIB 4IM0A 1PYWD 2G9HD 2VH2A 1VZ8A 3TCAA 3U52E 3M3JA 4HWIB 4C7YA 4BKGA 2QC8A 2MBHA 3Q8BA 3ZKJC 4LDTD 3PRPB 4KDLB 1I4RA 4AOFA 2I2YA 1K53A 2AYOB 2DAFA 4GIVA 1VRAB 4W9LA 1VJKA 4OZAA 1A70A 2VRRB 3U2SC 3T3NA 4NPNA 1D5MC 3GZNB 4M8MA 4WURA 3CF6E 5BYQA 1SSNA 2FIFA 3AECB 2LGXA 4R3DA 2OHFA 3N1ZC 3NG0A 1PDXA 2KMCA 1P0RA 2D3BA 2N9PC 3BWUD 1WSPA 5LXHA 3U8ZA 1WJNA 2CHZA 1GC7A 2B76B 2CR5A 1V8CA 3VAWA 4LNFA 1PUTA 2ZNVC 4GGQA 4AWJA 3TEXA 2QILA 2XK5B 5IOIA 4P6VF 4QAYA 3TSSA 4ICVA 4HVBA 2FCSA 3UI3A 4EZJA 2M0XA 2PVGC 1N6ZA 1A5RA 3B1LX 5AZFA 5H92C 3L10B 1XEEA 4X57B 4MM3A 1KM7A 4ASWC 2D07B 2N7EA 3AU5A 3WANA 2M0AA 2NBUA 2INCC 1TKYA 4HEA1 5AZHA 1NEKB 4KIKB 2MX2A 1TKEA 3AULA 1XCQL 3A9KA 5D7GA 4II2B 1MFWA 1C4CA 2MLBA 2K3UA 1V6EA 1ESFA 3R3MA 1IP9A 1UWXA 2KYWA 1I4QA 1EF5A 1JRPA 3WAMA 3I9V1 2WXLA 2NTSA 3CIRB 4DK5A 2JXXA 4DBGA 2LEKA 3PSEB 3V61A 1R4MB 3S2AA 1L0VB 2ZCBA 3BVGA 4P7IA 3I57A 1K50A 3SFDB 3IAS1 2LMCA 4HRSA 2FUG1 1WGHA 3QK0A 2J52A 1EU3A 4KGRA 3VTVA 3ZDTA 1XLQA 1S1QB 4YL8A 4ANXA 2Y3AA 4PYUA 4PK1A 3UQAA 2DYMA 1KOTA 4P16A 3AEEB 5IKCM 5EE9A 2CJOA 2YLMA 3EFUA 1ZKHA 2BW2A 1LGRA 1YX5B 3AB5A 3LDZE 1WGDA 3A1QB 2WX0A 3B0AA 2BPSA 1UELA 1Q5WB 4F8CB 4A3OA 4YSYB 1CJEA 3ZNGC 4EOYA 3R66C 2RR9A 5JZEB 2KWCA 2N1WA 2JPHA 2BYFA 1YN4A 2R2OA 1F2RI 1I7HA 2WS3B 1OQYA 4HPMB 3NOBA 3W2DA 3DBSA 5G55A 4RGMA 4OVZA 1FFVA 1YJIA 3HVDA 3PRMB 2K6DB 1EWYC 5FKAC 2V4IB 3MJ5A 4DHJD 2JWUA 4JIOU 3E56A 2BTEA 1TS3A 1WF9A 2OJWA 3AMZA 1E8YA 1NYQA 4N59A 2PJHA 1WZ3A 5IN7A 4W9JA 5D94A 2PTLA 4AJWA 1GNUA 3TMPB 3SR6A 1WXVA 1AN8A 2KN4A 1TTNA 4M01A 2JQRB 3ZLZA 3Q8EA 1STEA 3DHGC 1DYQA 1QOFA 2V0GA 3KWLA 1I42A 4WAFA 1L0XB 1JALA 4I6PA 2BB6A 4FLHA 3L4PA 4LJPB 3A9JB 3HM3A 2EELA 1JWBD 4XWTA 1TGZB 1DOXA 1C78A 4G50A 3B2GA 4K7SA 4DXGA 5HI1A 4M8NA 2L32A 2PKOA 2WDRB 1QKZA 2WXJA 1WRIA 5AZGA 5D3DA 2N4FA 2ZVNA 3N9YC 3ZDMC 2JZPA 3VHTC 3RNBC 1FRRA 2NBWB 4M0WB 2X38A 2L3ZA 2IY1B 3GS2A 2FBWB 3IFWB 3U7DA 4ZRJA 2FE8A 2J4XA 4S0RA 3VDZA 2HJ8A 1D5ZC 4NY0A 2JYEA 2L76A 4DWFA 4CQNA 3L17A 2L8JA 2KKCA 2WHIA 1LQBA 5BO4B 1V81A 2I38A 5FR6A 4KGTA 1F1HA 3UF8A 1RM6C 3AM9A 2WDTB 4B95A 4ZHPA 1E7VA 3H8HA 4LTUA 3W1SC 3DBRB 3KUCB 2KTFA 2PPHA 4NJ7A 4TV3A 4XE0A 3W9CB 5L83A 1I4PA 2BB5A 2KQ4X 3ZGZA 1OQRA 3IT4B 2KC1A 4KDIC 2PLPA 4KSKC 3BY4B 3P42A 2LGIA 3JSVB 1D3ZA 3RZWC 2IGDA 4ZYSA 4ARIA 1WJ6A 3AEGB 3NZSA 3B9JA 1KLVA 1Y8RC 4XWWA 2JXTA 1T6BX 2RD0A 3RD2A 2NVUI 2NCNA 2GOWA 4XDCA 1ACCA 2L52A 1WH3A 1SE3A 1C76A 4HPLB 2ZEQA 2RDBC 4NZLB 3HHMA 2KFKB 1QQRA 3NVYA 3L13A 1UD7A 2N0SB 3P4SB 2MBEA 5G5HA 3M62B 2KWUB 1JRUA 1NYRA 5HHDG 3V3XA 3VH3B 3ZNID 5FK9C 1FD6A 4HKZE 1E7PB 3RPFC 1FXAA 1WFYA 2MSED 2HTME 2NTTA 4BBNC 1J7CA 4BKSA 4AQ7A 4RM8A 4P1BC 2Z59B 1VR9A 4KKJA 4RGNA 2BKRB 1KH0A 4KZCA 3AEBB 4KIKA 2LUMA 1E0ZA 1XXGA 1WX8A 3NY5A 3O65B 4NAWB 3E9SA 4KVGB 4GDKB 4TSSA 2I1KA 2M56B 4AJYB 4MT5A 4TQ1A 4USAA 1ZW7A 1WJUA 1KTKA 4RCOA 2GBKA 2IPKD 3Q3JA 2QIEB 1QOAA 2KQSA 1ET6A 2RPVA 3WIMA 1YD8U 5C2TB 4JPSA 1V5OA 2GBMA 2DWQA 4A3PA 1GC6A 2PW9A 2CU1A 3DHIC 3SU8X 1VD2A 3ZJUA 3M95A 3B08A 2DENB 2KK8A 2KLCA 3SHQA 3TBLD 4EE2A 1WJ4A 2NS5A 2WU5B 1F2RC 3VR9B 3ZRFA 3R7QA 5J17A 2KX3A 3N1YC 2LZ6A 1OFFA 5JHBA 1MHXA 5CX3A 1LM8B 4DXAB 3DWMA 4JWSC 3DWGC 2D3AA 2HJ1A 4MDKE 2TSSA 2BS4B 3VTWA 3IT6B 2DZKA 4NQKE 1I4XA 1WE6A 2KHWB 1BXTA 5T8IA 3DBLI 4FBJB 3W1YA 2Y5BB 3H6NA 2N9LA 1YMHE 1T0QC 3VH4B 3MC8A 1Q10A 4DXFA 2CU3A 2JX5A 5IAAC 2LRWA 5C1ZA 2O6VA 3RT3B 4G11A 3ZXVA 1F0ZA 2K6QA 1M4VA 5DCNA 1TS4A 5EE0A 5I4DA 2X8XX 4NQLB 1WR6E 3ZJTA 1E90A 2BGFA 3FKYA 4W9KA 4ANWA 2W82A 3FILB 2K1FA 2AQ3B 4LLGM 4FULA 3LJ3A 3U4EG 3LYYA 3PO0A 1IGDA 2RSUA 4HJKA 1L4ZB 2PIAA 4YTMB 2IY0B 1JW9D 2ZVOA 4JLCA 3VRAB 3V6CB 4HK2A 1VDVA 5JXVA 3GE8C 1UWMA 1SF0A 2PE9A 4HXDA 1FNUA 1GPXA 1SIFA 4EEWA 4WWNA 1F52A 2Q5WD 3MTNB 4C56C 4FXCA 2NR2A 4HPPA 3RNCC 2V3NA 2JY6A 4JX1C 1MJDA 3DDCB 1EF1A 4II3B 2J7QB 1PFDA 3EFCA 2MEKA 1DOYA 5MPOA 4M0WA 3KQ4A 2JU6X 2WDVB 1U4AA 3Q8FA 4G0NB 2K22A 3AXCA 3NHEB 2WU2B 2MBQA 2KTRA 4IWOA 2RDGA 3N20C 1QOGA 3IAM1 2G4SA 1KLUD 4GXBA 2L0TA 1G6JA 2H89B 3H9DA 4AP4C 3J9CA 3DOWA 3OLMD 1D6EC 4IW0A 4J6IA 4MGIE 3V05A 3C19A 3PPAA 3UIPB 3Q14C 1VLBA 2DZIA 1MI0A 4FN2A 1JQ4A 1WXSA 2WXOA 2XEWA 2VZKB 2NMQA 2MCNB 4IOIE 2WP9B 3APDA 4OVUA 4RGOS 2W55A 4US9A 3ML9A 2IDYA 1H8CA 1GUAB 1HQRD 3EGRA 3P4PB 2GBNA 2C7MB 3Q6BA 2LRUA 1OGWA 3PS6A 1ZXIA 1WMHB 4WQMA 3PREA 3VVWB 3WAPA 2V1YA 4ZRQA 1N62A 2PVOD 4HLEA 2FNJB 1QT9A 1I4HA 4LCDE 1E5WA 1WY8A 4A8XC 2WXPA 1XD3B 2DAJA 3HVZA 3AE3B 1FRDA 3UINB 1NENB 1E8WA 2BT6A 1Y56A 2WXGA 1YN3A 1ZXHA 1HA5A 5DPTA 3BVZA 4IWQA 2UYZB 4M00A 1BT0A 2DZJA 2KWDA 3IHPC 2N9XA 3DVGY 1B9RA 4K3BA 1P7EA 1UF0A 3PGEA 2KC2A 3TIXA 1UBQA 3P4QB 1RFKA 2L1AA 4JL9A 4WWMA 1V2YA 1Z5SB 2DBYA 3EECA 3PRZA 4WJOA 5BMIA 2MBBB 2NBVB 3VUWA 4BKTA 3FC4A 1XT9B 1YJ1A 4K3CA 1SJHD 2IGHA 2KMAA 4IDIA 1UBIA 2LASA 3TJPA 3T9LA 2MP2B 3HUIA 2FCMA 1CQVA 3ONSA 4IM2A 2K5PA 3DBRI 5H8YE 4F7ZA 3QJZA 4E71A 3VR8B 3GE3C 1XF5L 1IBXB 2J0MA 4IWPA 1YX6B 2BWES 4TKNA 2WXIA 1YQ4B 1K8RB 2MH7A 1NDDA 3T3OA 4PS7A 1WGKA 1TY0A 2M8SA 2W3SA 3HIZA 2O6VB 1WGRA 3MC0B 4MJSA 4OVVA 1SE9A 3PHWB 3W5UB 3NS1A 2M4NA 3JYUA 5CHVC 2IO1B 3BYTB 3RUIB 1E10A 2N7JA 1TT5B 4URKA 2Z0DB 4BZAA 2JT4B 4KZ0A 4EFOA 4KSLC 2HD5B 3QC8B 2LWPA 2JZZA 5TR5A 2LJIA 3AH7A 1J7BA 1P3QU 2KDMA 1SE4A 2JSVX 1ZPSA 2E3TA 2GMIC 3AEAB 3BYYB 1GB1A 4MGZE 5IA7A 1AARA 2LVPA 4MSMB 4US8A 1UGMA 1FPYA 5D2MB 2J42A 2JRHA 2KOXA 3ABVB 4WWOA 5EDSA 4F1SA 1JMLA 2KN5A 5J18A 4W9CA 2NPTB 2UU7A 3N32A 4FADA 4C4VA 1WM3A 1FFUA 3P1MA 1L7YA 4MEMA 1EWCA 1WR1A 3R7RA 4PT5A 1YQ3B 1R4MI 3KW5B 3CWIA 3WALA 2GBJA 2AL3A 2CJNA 1TKGA 2JUOA 4WAAA 4ACFA 4XGAB 3A33B 4G3XB 3X0WA 1V1PB 3L08A 5E6NA 4BOSC 1SEBD 1YQBA 1E8ZA 2KJ6A 3PHXB 2KJHB 1VZ6A 3AE8B 1SIJA 1AWDA 2LJ5A 3L54A 3QWZB 3IVFA 3MC9A 4IG7B 4L1BA 2Z8LA 3Q69A 4ZDVA 4BBNF 2WLBA 3KUZA 1L6UA 1T5XD 2ZPNA 1L4DB 5HG2A 3CSTA 2K9XA 2J0JA 4ZYNA 3HRDD 1ENFA 3ENEA 2FAZA 2QHOA 4KX6B 3NJTA 1LXDA 1HXYD 2M1MA 1YIWA 2ZCCA 4OW0A 5BMGA 4JE3B 4FJYA 1LFDA 1AYFA 2O6VD 2K8BA 2KZRA 4XX5A 1TIFA 4YSZB 3VQIA 1ZUD2 3DBHI 2RPQA 1T0YA 1LO5D 2LVQA 2GRIA 3PLVA 2D5GA 5AEKB 3I63C 4W9DA 4BAXA 4J3OD 3AV8A 1UH6A 4XDDA 1N5XA 3GZNI 1TZOA 1J19A 2FUHB 3NZ3A 4XZ4A 2KDIA 3D32A 4GDLA 4DHZE 1ZDVA 3DVGX 2LHEA 3NVWA 2BS2B 1HZ6A 3QQ8B 3A9JA 4BVUC 3N1XC 2QCZA 1GG3A 3VUYA 1UUPA 2G4DB 4ZRPA 1SB3C 2AQ1B 3HM6X 2OOBB 5AUKA 2EKIA 3NVVA 1V97A 5JHAA 1P7FA 4W9EA 2DX5B 3DBHB 1PGAA 3NS8A 1YJJA 2G45B 2KXJA 1FMAD 2INPE 3K9OB 1D4BA 4Q2JA 4NJ6A 3C0RB 5IP4D 2KFJA 4AUQC 3KLSX 4WJQA 3FAHA 3TUOA 3QCAA 2DYOA 2HDEA 4WIPA 3KUDB 2C7NB 1V80A 4GSWA 1HEZE 5E6JA 3P63A 4ANVA 2YEPF 1BUIC 4HDQA 4N6EB 1C4AA 3ECIA 4MH8A 1TYGB 3DVNU 4N58A 2KFKA 2INDC 2ZNVB 3MJWA 3ALBA 1I4GA 2WXFA 2JZ3B 3R8BA 1C1YB 2GB1A 1FCCC 1UGJA 2CHXA 2VZKD 4GOCA 4IC7B 2KNBA 2LUEA 4A55A 2C5LC 4EZLA 4DHZB 3MHSD 3QX1A 5D3IB 1OTRB 1PGBA 3W1SA 3H7PB 4WH4A 1JCKB 4RF1A 2A4ZA 1CK1A 4LK0M 2RGFA 1F77A 3NZUA 3L16A 1QOBA 3AEDB 1B1ZA 4C00A 2LGSA 4TQ0A 4GMVA 4MACA 5G2NA 4GU2A 3QIJA 1WMHA 2L05A 1R7SA 3VFKA 2AL6A 2IGGA 4EKUA 4BKSD 2ZZPB 2ASQA 1HTQA 4HJGE 2Y5PA 1N63A 3NUHB 2WXHA 2FCQA 4ZRKA 2ACZB 2XN9C 4DQOC 1WM2A 2HTHA 1QZEA 3Q3MC 3DVNV 4MGKE 1V9JA 1SGHA 1GAQB 1YN5A 4FJZA 2KWVB 1WWTA 2L0FA 1E9MA 2G1EA 3QA8A 2WNMA 4RMAA 2KO3A 1L0YB 2KMMA 2BS3B 3H7PA 4MJSB 3ML8A 2N1VA 5HKHA 3BIID 3ZUNA 2R61A 5D6JB 1MG4A 1WX7A 4A6QA 2KVZA 1E7UA 2DLBA 2N9EB 3ZNZB 5LXIB 4HCNB 4E74A 3LB8C 3ZRCA 3U7ZA 1UNSA 1ZP0B 3O13A 4P1CC 1IBXA 2D10A 3BINA 4D2KA 5JH5C 1HZ5A 1K51A 1XCTL 4NAMA 3SDLC 2J0KA 1FXTB 2AWTA 2XK5A 3TEWA 1RAXA 2K39A 1X1MA 1RLFA 3P4RB 2KVRA 2MRPA 3OJ3A 4GB9A 4DDGD 4RH6A 2KD0A 4C7ZA 4JQWC 2DNFA 3EUB2 1IPGA 2ZPYA 4L2YA 2LI5A 2LGDA 3I3TB 1P98A 3ZTDA 2EMTA 3AE4B 2KAJA 1K52A 1RRBA 2KLGA 4A90A 2BYEA 2MA9B 1T3QA 4HROA 5EE1A 2WXQA 2KT7A 1HE8A 2L83A 4E3CA 4O1NA 1KFYB 2MJ3A 1DGJA 3MHZA 3NVZA 4XC2A 4B0MA 3SFEB 1WGGA 4A9AA 5GXGB 3SEBA 3Q8CA 4L23A 5CHFA 1Q1OA 2JVCA 3OJ4B 4FA6A 3L0WB 2PMVA 1WE7A 3X23A 2REXA 3H1UA 2KACA 1ISNA 1V49A 1TZ1A 2DZMA 4HDOA 1NI2A 1WXMA 3Q3NC 1SBBB 4HCPB 1FNVA 3PZDA 1NI3A 3VUXA 2KANA 1NBFC 4ITKA 4YTPB 1XO3A 4CHKA 4YT0B 3K9PB 1KF6B 1WIAA 3AN1A 3U30A 1MG8A 3NRZA 2LGYA 2Y5CA 2QMTA 4I6NB 2IJ0A 1KRHA 2NPTA 1FEHA 4NAWA 1CZPA 2KQ7A 2C60A 3V6EB 2V4LA 3PZ8A 1VZ7A 2XNAC 3Q3FA 4ZOHC 2VH1A 1SJED 1MVKA 3RULA 2WX1A 4MELA 1QF6A 4I6LB 1AW7A 3RNGC 5KHQA 1WYGA 4BFRA 4C80A 3R2TA 2BBCA 3UQBA 2AEHA 2BYVE 5C3JB 1KJTA 4MH0E 3GP7A 2D3CA 1M94A 1JROA 4M02A 2KDFB 1XLNA 5DPSA 2D3GA 1WXAA 2SEBD 1FNWA 2H88B 1RYJA 2IO2B 4IKGA 2M19A 3QAQA 2IO3B 2FIDA 1F9JA 2AQ2B 3WCQA 2WQYB 1RFAA 2BF8B 3RFZB 1QILA 4AS1A 1L5PA 1EO6A 3RNFC 2L7RA 3ZQ4A 1HTOA 1KLGD 1UZXB 3AE6B 3EA6A 4GDKA 1OEYJ 3JW0X 3UGBB 1J7AA 5BYSA 4ZHOA 4WWPA 3IXSA 2CKHB 1QLBB 3TEZA 2PEAA 4OZCA 2DHZA 4KV2A 3ZYYX 3ZVVA 1V86A 3PTFC 2WXKA 2WYQA 2BYTA 4TUUA 3GOEA 3KYCD 2WXNA 3M63B 2YEPB 3DBLB 2BVCA 4OZBA 3Q2AC 1FIQA 1J8CA 4YWGG 3KYDD 1WZ0A 5LNK1 1YOVB 1JWMD 4WQOB 1XLOA 3ZTCA 3RNEC 2MHJA 1ZOYB 1SXTA 3ZJVA 1IYFA 1V1PA 4YTNB 5G5GA 2E6XA 3QHTA 3AE9B 4A20A 1WI0A 1Z2MA 3ZW3A 5L95C 2WGSA 2R2QA 2JYTA 1OQQA 3A9KB 3N30A 4PS8A 4LNKA 4XYCA 1P9DU 5BMHA 4YXDB 4C4VB 3AE7B 1ZE3D 2LFIA 3BZDB 4JWUC 2N7DA 3JSVA 4ARCA 3ZIMA 5C23A 2BQQA 4LNOA 4B9KA 2C9WB 2HE7A 2KDBA 1IUEA 3EC8A 4FJVB 4UDUC 1TJEA 1C79A 3VTUA 4NNJB 3ETRA 1FCLA 3CSFA 5E6OA 1DOIA 2V9HA 3RI7C 3UIOB 3AEFB 2DYBA 2XBBC 2LXCA 2W54A 3N3KB 4CYEA 3AE1B 3ZO5B 1N61A 3IG3A 3KH0A 2J53A 2AX5A 5FR3A 4YSXB 1C77A 1PGXA 2OJRA 2ONQA 3V62A 1RWSA 3Q8AA 4NJCA 1Q0WB 2WWZA 4W9GA 3GB1A 2RDHA 4HKQA 1GOZA 3ZNHB 3BK2A 2QDFA 5CHWA 4K7WA 1WRDB 4K81A 4TMAB 2IO0B 4PYZA 2FCNA 1R4NI 1E6EB 2K25A 4H2AA 4JGHB 5BYRA 2MQJA 2INNE 3KVFB 2K8CA 3URYA 3AI5A 4WJNA 1ET9A 2EKEC 3TL5A 1YNTE 3RMKC 4EUTA 1T0RC 1GJZA 2JWZA 4IUMB 3HK0A 3BVMA 3BK1A 3MP9A 1EUVB 4DHJB
chains in the Genus database with same CATH topology
2CS4A 1WMHA 2O2VB 3VFKA 2AL6A 4EKUA 3H9DA 3QARA 4AP4C 4BKSD 2ZZPB 3H7SA 2ASQA 1S3SG 3DOWA 3OLMD 4IW0A 4J6IA 2LXAA 4MGIE 1WF9A 2FCQA 4ZRKA 3CMMB 3PPAA 1E8YA 3UIPB 2PJHA 1WM2A 1WZ3A 4W9JA 2DZIA 5D94A 2HTHA 4AJWA 2L00B 2MP2A 1GNUA 3TMPB 1QZEA 3DVNV 1WXVA 4MGKE 3WAOA 2V3SA 1V9JA 4FN2A 1WXSA 1I35A 4DDID 1SGHA 1TTNA 2XEWA 4FJZA 1C3TA 3JVZX 2K8HA 2MCNB 3ZLZA 3APDA 4OVUA 2KWVB 2L0FA 2IZVB 2I1JA 1I42A 3ML9A 3QA8A 1H8CA 1GUAB 4I6PA 4RMAA 2KO3A 2KTRB 2GBNA 2C7MB 4FLHA 4GU2A 4LJPB 3A9JB 2LRUA 3HM3A 5GMVA 2D2QA 1OGWA 3PS6A 4ANUA 1TGZB 1WMHB 4G50A 3H7PA 3PREA 4MJSB 3VVWB 2MW5A 3ML8A 4K7SA 2N1VA 5HKHA 3WAPA 2V1YA 3ZUNA 4M8NA 2M17A 3A1QA 5D6JB 1WX7A 4RM9A 4ICUA 1TBEA 4HLEA 3RYTA 2FNJB 1PQSA 1E7UA 5AZGA 2N9EB 2N4FA 4LCDE 1E5WA 1WY8A 2ZVNA 3ZDMC 3ZNZB 3VHTC 5LXIB 2LVOA 4HCNB 4E74A 2IBIB 3ZRCA 2G3QB 4K7UA 2KX0A 2NBWB 1XD3B 2DAJA 4M0WB 2CHWA 2L3ZA 2IY1B 2KDEB 3UINB 5E6PA 3APFA 2D10A 3BINA 4LDTB 4PS3A 3SD5A 5KHOA 5JH5C 3IFWB 1E8WA 3U7DA 4ZRJA 3A4RA 3PLUA 3VDZA 5DPWA 2HJ8A 4NY0A 2L76A 3SDLC 4DWFA 2J0KA 1FXTB 5DPTA 3L17A 2L8JA 4IWQA 2UYZB 3EHVA 2AWTA 2YVCA 2KKCA 2XK5A 3T8MA 1RAXA 1BT0A 2DZJA 2K39A 1X1MA 1LQBA 1RLFA 3IHPC 5BO4B 4FHKA 1V81A 2N9XA 2UWQA 3DVGY 3PV1A 2KVRA 2MRPA 3VXWA 3WA0A 5FR6A 2BWFA 3PGEA 2KC2A 3OJ3A 3TIXA 1UBQA 4GN1A 4GB9A 3UF8A 4DDGD 2KD0A 4JL9A 2O2VA 1V2YA 1Z5SB 3EECA 3PRZA 2WDTB 4B95A 4WJOA 4JQWC 1E7VA 1OEYA 2JF5A 1IPGA 2ZPYA 2MBBB 2NBVB 3VUWA 2LI5A 2LGDA 4BKTA 3I3TB 1XT9B 1YJ1A 3W1SC 3DCGA 1P98A 3ZTDA 2EMTA 1WGYA 2KMAA 3KUCB 5DPRA 1UBIA 2LASA 2KTFA 2PPHA 4NJ7A 4TV3A 5LLIA 4BOZB 3TJPA 3T9LA 1RRBA 2KLGA 2MP2B 3DQVA 1H4RA 1WYWB 3PT2B 5L83A 2FCMA 2BYEA 2MA9B 3RCZA 3ONSA 4F7ZA 4IM2A 3DBRI 2Z0EB 3QJZA 4E71A 2PE6B 1HE8A 4E3CA 5J2RA 4XC2A 2C7HA 2KC1A 4KDIC 1WGGA 2J0MA 4IM3A 4KSKC 4IWPA 5CHFA 1YX6B 2BWES 3BY4B 1Q1OA 2JVCA 4LJOB 4TKNA 3OJ4B 3JSVB 1D3ZA 3RZWC 4FA6A 1E8XA 3L0WB 3PVLA 4GDLB 1WE7A 1WJ6A 1K8RB 3X23A 2BKFA 1NDDA 4FHJA 4W9IA 4PS7A 3NZSA 1KLVA 2M8SA 3HIZA 2REXA 1Y8RC 2O6VB 1WGRA 3H1UA 4ZRIA 2D11A 2RD0A 3RD2A 1ISNA 2NCNA 1V49A 2GOWA 2NVUI 4MJSA 4OVVA 1SE9A 3PHWB 3OAWA 1TZ1A 1WH3A 4K1RB 2DZMA 2LD9A 4HDOA 1NI2A 2M4NA 1ZGUB 3JYUA 5CHVC 1WXMA 2IO1B 3RUIB 4HCPB 3PZDA 4URKA 3VUXA 4HPLB 2MWSB 2Z0DB 2ZEQA 2KANA 2KJRA 4WJPA 1NBFC 2W9NA 4W9HA 4N9F4 2JT4B 4W9FA 1V5TA 4CHKA 1VCBA 3HHMA 3K9PB 4KZ0A 1P1AA 1WIAA 3U30A 4EFOA 1MG8A 3APCA 2KFKB 2LGYA 1CMXB 4KSLC 2EMSA 4I6NB 2HD5B 3QC8B 2LWPA 2JZZA 3L13A 2MBOA 2NPTA 5TR5A 4NAWA 1UD7A 2GBRA 1P3QU 3A4SC 2MBEA 3RZFA 2GMIC 2KQ7A 2C60A 4MGZE 3M62B 3V6EB 2KWUB 1AARA 2V4LA 2LVPA 5IA7A 1JRUA 3P2BA 4MSMB 3VH3B 1UGMA 3ZNID 4EZKA 1XQQA 3IBEA 3Q3FA 5D2MB 2JRHA 2KOXA 4WWOA 5EDSA 4F1SA 3RULA 2WX1A 2ZJDA 4MELA 4MSQB 2KN5A 5CTRC 3V60A 4I6LB 5J18A 5KHQA 3QIJA 1WFYA 2MSED 3DPDA 2A5UA 4BFRA 4W9CA 1J0GA 2NPTB 4BBNC 3N32A 4BKSA 1L2NA 2IYDB 4RM8A 4FADA 3UQBA 4CO7A 4MGYE 2AEHA 2BYVE 1WM3A 2Z59B 1KJTA 1L7YA 4B6WA 1WX9A 2BKRB 4MH0E 4MEMA 1M94A 4KZCA 1WR1A 4KIKA 2B3AA 3R7RA 1WX8A 2KDFB 3NY5A 3O65B 3AU4A 4NAWB 5DPSA 2JRIB 1R4MI 2D3GA 4GDKB 4IM0A 3KW5B 4KVGB 2I1KA 4AJYB 1WXAA 2GBJA 2AL3A 4TQ1A 3WALA 2JUOA 4WAAA 3A33B 3TCAA 4G3XB 3X0WA 3L08A 4BOSC 5E6NA 2IO2B 1ZW7A 1WJUA 1YQBA 3M3JA 1E8ZA 4HWIB 2KJ6A 3QAQA 2IO3B 4BKGA 2FIDA 1F9JA 2KJHB 2GBKA 2MBHA 3PHXB 3ZKJC 4LDTD 3PRPB 2LJ5A 3L54A 4KDLB 3Q3JA 3QWZB 1RFAA 2BF8B 3IVFA 2KQSA 4AOFA 4IG7B 1YD8U 3WIMA 1EO6A 1V5OA 2GBMA 2L7RA 4ZDVA 2AYOB 2DAFA 4GIVA 4A3PA 1GC6A 4BBNF 2CU1A 3KUZA 2ZPNA 4W9LA 1UZXB 3SU8X 1VD2A 4GDKA 1OEYJ 3JW0X 3M95A 2VRRB 3B08A 2DENB 2KK8A 3CSTA 4NPNA 3UGBB 2KLCA 4WWPA 3SHQA 2CKHB 3TBLD 1WJ4A 2NS5A 4M8MA 2J0JA 2PEAA 3CF6E 3ZRFA 4ZYNA 2FIFA 2DHZA 4KV2A 3ENEA 3ZVVA 2FAZA 3R7QA 2LGXA 2QHOA 1LXDA 5J17A 1V86A 2KX3A 3PTFC 2LZ6A 2M1MA 1YIWA 2KMCA 2ZCCA 1LM8B 5CX3A 2WYQA 4DXAB 5JHBA 1P0RA 4TUUA 2N9PC 3GOEA 3KYCD 4FJYA 5LXHA 3U8ZA 3M63B 1LFDA 1WJNA 2CHZA 1GC7A 4MDKE 2CR5A 2O6VD 3VAWA 1J8CA 2ZNVC 2K8BA 2KZRA 3VTWA 4GGQA 3KYDD 4XX5A 4AWJA 2DZKA 4NQKE 1WE6A 2KHWB 2XK5B 1WZ0A 3VQIA 4WQOB 3DBLI 4ICVA 4HVBA 3ZTCA 4FBJB 3DBHI 2Y5BB 3W1YA 3H6NA 2FCSA 1IYFA 2RPQA 1T0YA 4EZJA 2LVQA 2M0XA 3PLVA 3QHTA 1A5RA 3VH4B 4A20A 1WI0A 3B1LX 1Z2MA 5AZFA 5AEKB 3ZW3A 5L95C 4W9DA 2R2QA 3L10B 4X57B 5IAAC 2LRWA 4MM3A 1UH6A 1KM7A 5C1ZA 3A9KB 4ASWC 2D07B 2O6VA 3GZNI 3RT3B 3N30A 4G11A 1J19A 4PS8A 2N7EA 1P9DU 3AU5A 3WANA 2NBUA 2FUHB 4XZ4A 2KDIA 3D32A 4GDLA 2K6QA 5AZHA 5DCNA 2N7DA 3JSVA 4KIKB 2MX2A 3ZIMA 4DHZE 4NQLB 3AULA 3A9KA 1WR6E 5C23A 5D7GA 4II2B 4B9KA 2C9WB 2MLBA 3DVGX 2HE7A 2KDBA 1E90A 2BGFA 3EC8A 1V6EA 4FJVB 3VTUA 3R3MA 4NNJB 1IP9A 3QQ8B 3CSFA 3A9JA 4W9KA 1EF5A 4BVUC 4ANWA 5E6OA 2K1FA 3WAMA 1GG3A 3UIOB 3VUYA 2DYBA 2G4DB 2XBBC 4FULA 4DK5A 2LXCA 2JXXA 3LJ3A 4DBGA 3HM6X 3N3KB 3PSEB 3V61A 2OOBB 4CYEA 3S2AA 3ZO5B 2ZCBA 4P7IA 3IG3A 3KH0A 5JHAA 4W9EA 2RSUA 4HJKA 2DX5B 3NS8A 2G45B 2OJRA 3V62A 2IY0B 2KXJA 1WGHA 2ZVOA 3K9OB 3QK0A 4JLCA 3VTVA 4NJ6A 1Q0WB 2WWZA 3V6CB 3C0RB 4HK2A 3ZDTA 1S1QB 2KFJA 4W9GA 4YL8A 4AUQC 4ANXA 2PE9A 4WJQA 4HXDA 4PYUA 3UQAA 3QCAA 2DYMA 1KOTA 1SIFA 2DYOA 4EEWA 3KUDB 4WWNA 2C7NB 3ZNHB 1V80A 4GSWA 2YLMA 3EFUA 1ZKHA 5CHWA 4ANVA 4K7WA 3MTNB 4HDQA 3ECIA 1WRDB 1YX5B 3DVNU 3LDZE 4K81A 1WGDA 2IO0B 2NR2A 4PYZA 3A1QB 2WX0A 3B0AA 2BPSA 1UELA 2FCNA 2KFKA 2ZNVB 1Q5WB 3MJWA 4F8CB 3ALBA 1R4NI 4A3OA 3ZNGC 2K25A 4JGHB 2JZ3B 2JY6A 1C1YB 2MQJA 3DDCB 3R66C 4EOYA 2RR9A 5JZEB 1EF1A 2CHXA 4II3B 3KVFB 4GOCA 2J7QB 2KWCA 4IC7B 2N1WA 2JPHA 2K8CA 2KNBA 2LUEA 2C5LC 4EZLA 2BYFA 4DHZB 3AI5A 3MHSD 2R2OA 4WJNA 3QX1A 2EKEC 3TL5A 1OQYA 1OTRB 4HPMB 1U4AA 3NOBA 3W1SA 3DBSA 3H7PB 4EUTA 5G55A 4G0NB 1GJZA 2JWZA 2A4ZA 3AXCA 2RGFA 3PRMB 2K6DB 3NZUA 3L16A 3NHEB 3HK0A 4IUMB 2MBQA 2KTRA 4IWOA 4DHJD 4TQ0A 4GMVA 2G4SA 5G2NA 1EUVB 2L0TA 4GXBA 4JIOU 4DHJB 1G6JA 2L05A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2CS4 A;  1WMH A;  2O2V B;  3VFK A;  2AL6 A;  4EKU A;  3H9D A;  3QAR A;  4AP4 C;  4BKS D;  2ZZP B;  3H7S A;  2ASQ A;  1S3S G;  3DOW A;  3OLM D;  4IW0 A;  4J6I A;  2LXA A;  4MGI E;  1WF9 A;  2FCQ A;  4ZRK A;  3CMM B;  3PPA A;  1E8Y A;  3UIP B;  2PJH A;  1WM2 A;  1WZ3 A;  4W9J A;  2DZI A;  5D94 A;  2HTH A;  4AJW A;  2L00 B;  2MP2 A;  1GNU A;  3TMP B;  1QZE A;  3DVN V;  1WXV A;  4MGK E;  3WAO A;  2V3S A;  1V9J A;  4FN2 A;  1WXS A;  1I35 A;  4DDI D;  1SGH A;  1TTN A;  2XEW A;  4FJZ A;  1C3T A;  3JVZ X;  2K8H A;  2MCN B;  3ZLZ A;  3APD A;  4OVU A;  2KWV B;  2L0F A;  2IZV B;  2I1J A;  1I42 A;  3ML9 A;  3QA8 A;  1H8C A;  1GUA B;  4I6P A;  4RMA A;  2KO3 A;  2KTR B;  2GBN A;  2C7M B;  4FLH A;  4GU2 A;  4LJP B;  3A9J B;  2LRU A;  3HM3 A;  5GMV A;  2D2Q A;  1OGW A;  3PS6 A;  4ANU A;  1TGZ B;  1WMH B;  4G50 A;  3H7P A;  3PRE A;  4MJS B;  3VVW B;  2MW5 A;  3ML8 A;  4K7S A;  2N1V A;  5HKH A;  3WAP A;  2V1Y A;  3ZUN A;  4M8N A;  2M17 A;  3A1Q A;  5D6J B;  1WX7 A;  4RM9 A;  4ICU A;  1TBE A;  4HLE A;  3RYT A;  2FNJ B;  1PQS A;  1E7U A;  5AZG A;  2N9E B;  2N4F A;  4LCD E;  1E5W A;  1WY8 A;  2ZVN A;  3ZDM C;  3ZNZ B;  3VHT C;  5LXI B;  2LVO A;  4HCN B;  4E74 A;  2IBI B;  3ZRC A;  2G3Q B;  4K7U A;  2KX0 A;  2NBW B;  1XD3 B;  2DAJ A;  4M0W B;  2CHW A;  2L3Z A;  2IY1 B;  2KDE B;  3UIN B;  5E6P A;  3APF A;  2D10 A;  3BIN A;  4LDT B;  4PS3 A;  3SD5 A;  5KHO A;  5JH5 C;  3IFW B;  1E8W A;  3U7D A;  4ZRJ A;  3A4R A;  3PLU A;  3VDZ A;  5DPW A;  2HJ8 A;  4NY0 A;  2L76 A;  3SDL C;  4DWF A;  2J0K A;  1FXT B;  5DPT A;  3L17 A;  2L8J A;  4IWQ A;  2UYZ B;  3EHV A;  2AWT A;  2YVC A;  2KKC A;  2XK5 A;  3T8M A;  1RAX A;  1BT0 A;  2DZJ A;  2K39 A;  1X1M A;  1LQB A;  1RLF A;  3IHP C;  5BO4 B;  4FHK A;  1V81 A;  2N9X A;  2UWQ A;  3DVG Y;  3PV1 A;  2KVR A;  2MRP A;  3VXW A;  3WA0 A;  5FR6 A;  2BWF A;  3PGE A;  2KC2 A;  3OJ3 A;  3TIX A;  1UBQ A;  4GN1 A;  4GB9 A;  3UF8 A;  4DDG D;  2KD0 A;  4JL9 A;  2O2V A;  1V2Y A;  1Z5S B;  3EEC A;  3PRZ A;  2WDT B;  4B95 A;  4WJO A;  4JQW C;  1E7V A;  1OEY A;  2JF5 A;  1IPG A;  2ZPY A;  2MBB B;  2NBV B;  3VUW A;  2LI5 A;  2LGD A;  4BKT A;  3I3T B;  1XT9 B;  1YJ1 A;  3W1S C;  3DCG A;  1P98 A;  3ZTD A;  2EMT A;  1WGY A;  2KMA A;  3KUC B;  5DPR A;  1UBI A;  2LAS A;  2KTF A;  2PPH A;  4NJ7 A;  4TV3 A;  5LLI A;  4BOZ B;  3TJP A;  3T9L A;  1RRB A;  2KLG A;  2MP2 B;  3DQV A;  1H4R A;  1WYW B;  3PT2 B;  5L83 A;  2FCM A;  2BYE A;  2MA9 B;  3RCZ A;  3ONS A;  4F7Z A;  4IM2 A;  3DBR I;  2Z0E B;  3QJZ A;  4E71 A;  2PE6 B;  1HE8 A;  4E3C A;  5J2R A;  4XC2 A;  2C7H A;  2KC1 A;  4KDI C;  1WGG A;  2J0M A;  4IM3 A;  4KSK C;  4IWP A;  5CHF A;  1YX6 B;  2BWE S;  3BY4 B;  1Q1O A;  2JVC A;  4LJO B;  4TKN A;  3OJ4 B;  3JSV B;  1D3Z A;  3RZW C;  4FA6 A;  1E8X A;  3L0W B;  3PVL A;  4GDL B;  1WE7 A;  1WJ6 A;  1K8R B;  3X23 A;  2BKF A;  1NDD A;  4FHJ A;  4W9I A;  4PS7 A;  3NZS A;  1KLV A;  2M8S A;  3HIZ A;  2REX A;  1Y8R C;  2O6V B;  1WGR A;  3H1U A;  4ZRI A;  2D11 A;  2RD0 A;  3RD2 A;  1ISN A;  2NCN A;  1V49 A;  2GOW A;  2NVU I;  4MJS A;  4OVV A;  1SE9 A;  3PHW B;  3OAW A;  1TZ1 A;  1WH3 A;  4K1R B;  2DZM A;  2LD9 A;  4HDO A;  1NI2 A;  2M4N A;  1ZGU B;  3JYU A;  5CHV C;  1WXM A;  2IO1 B;  3RUI B;  4HCP B;  3PZD A;  4URK A;  3VUX A;  4HPL B;  2MWS B;  2Z0D B;  2ZEQ A;  2KAN A;  2KJR A;  4WJP A;  1NBF C;  2W9N A;  4W9H A;  4N9F 4;  2JT4 B;  4W9F A;  1V5T A;  4CHK A;  1VCB A;  3HHM A;  3K9P B;  4KZ0 A;  1P1A A;  1WIA A;  3U30 A;  4EFO A;  1MG8 A;  3APC A;  2KFK B;  2LGY A;  1CMX B;  4KSL C;  2EMS A;  4I6N B;  2HD5 B;  3QC8 B;  2LWP A;  2JZZ A;  3L13 A;  2MBO A;  2NPT A;  5TR5 A;  4NAW A;  1UD7 A;  2GBR A;  1P3Q U;  3A4S C;  2MBE A;  3RZF A;  2GMI C;  2KQ7 A;  2C60 A;  4MGZ E;  3M62 B;  3V6E B;  2KWU B;  1AAR A;  2V4L A;  2LVP A;  5IA7 A;  1JRU A;  3P2B A;  4MSM B;  3VH3 B;  1UGM A;  3ZNI D;  4EZK A;  1XQQ A;  3IBE A;  3Q3F A;  5D2M B;  2JRH A;  2KOX A;  4WWO A;  5EDS A;  4F1S A;  3RUL A;  2WX1 A;  2ZJD A;  4MEL A;  4MSQ B;  2KN5 A;  5CTR C;  3V60 A;  4I6L B;  5J18 A;  5KHQ A;  3QIJ A;  1WFY A;  2MSE D;  3DPD A;  2A5U A;  4BFR A;  4W9C A;  1J0G A;  2NPT B;  4BBN C;  3N32 A;  4BKS A;  1L2N A;  2IYD B;  4RM8 A;  4FAD A;  3UQB A;  4CO7 A;  4MGY E;  2AEH A;  2BYV E;  1WM3 A;  2Z59 B;  1KJT A;  1L7Y A;  4B6W A;  1WX9 A;  2BKR B;  4MH0 E;  4MEM A;  1M94 A;  4KZC A;  1WR1 A;  4KIK A;  2B3A A;  3R7R A;  1WX8 A;  2KDF B;  3NY5 A;  3O65 B;  3AU4 A;  4NAW B;  5DPS A;  2JRI B;  1R4M I;  2D3G A;  4GDK B;  4IM0 A;  3KW5 B;  4KVG B;  2I1K A;  4AJY B;  1WXA A;  2GBJ A;  2AL3 A;  4TQ1 A;  3WAL A;  2JUO A;  4WAA A;  3A33 B;  3TCA A;  4G3X B;  3X0W A;  3L08 A;  4BOS C;  5E6N A;  2IO2 B;  1ZW7 A;  1WJU A;  1YQB A;  3M3J A;  1E8Z A;  4HWI B;  2KJ6 A;  3QAQ A;  2IO3 B;  4BKG A;  2FID A;  1F9J A;  2KJH B;  2GBK A;  2MBH A;  3PHX B;  3ZKJ C;  4LDT D;  3PRP B;  2LJ5 A;  3L54 A;  4KDL B;  3Q3J A;  3QWZ B;  1RFA A;  2BF8 B;  3IVF A;  2KQS A;  4AOF A;  4IG7 B;  1YD8 U;  3WIM A;  1EO6 A;  1V5O A;  2GBM A;  2L7R A;  4ZDV A;  2AYO B;  2DAF A;  4GIV A;  4A3P A;  1GC6 A;  4BBN F;  2CU1 A;  3KUZ A;  2ZPN A;  4W9L A;  1UZX B;  3SU8 X;  1VD2 A;  4GDK A;  1OEY J;  3JW0 X;  3M95 A;  2VRR B;  3B08 A;  2DEN B;  2KK8 A;  3CST A;  4NPN A;  3UGB B;  2KLC A;  4WWP A;  3SHQ A;  2CKH B;  3TBL D;  1WJ4 A;  2NS5 A;  4M8M A;  2J0J A;  2PEA A;  3CF6 E;  3ZRF A;  4ZYN A;  2FIF A;  2DHZ A;  4KV2 A;  3ENE A;  3ZVV A;  2FAZ A;  3R7Q A;  2LGX A;  2QHO A;  1LXD A;  5J17 A;  1V86 A;  2KX3 A;  3PTF C;  2LZ6 A;  2M1M A;  1YIW A;  2KMC A;  2ZCC A;  1LM8 B;  5CX3 A;  2WYQ A;  4DXA B;  5JHB A;  1P0R A;  4TUU A;  2N9P C;  3GOE A;  3KYC D;  4FJY A;  5LXH A;  3U8Z A;  3M63 B;  1LFD A;  1WJN A;  2CHZ A;  1GC7 A;  4MDK E;  2CR5 A;  2O6V D;  3VAW A;  1J8C A;  2ZNV C;  2K8B A;  2KZR A;  3VTW A;  4GGQ A;  3KYD D;  4XX5 A;  4AWJ A;  2DZK A;  4NQK E;  1WE6 A;  2KHW B;  2XK5 B;  1WZ0 A;  3VQI A;  4WQO B;  3DBL I;  4ICV A;  4HVB A;  3ZTC A;  4FBJ B;  3DBH I;  2Y5B B;  3W1Y A;  3H6N A;  2FCS A;  1IYF A;  2RPQ A;  1T0Y A;  4EZJ A;  2LVQ A;  2M0X A;  3PLV A;  3QHT A;  1A5R A;  3VH4 B;  4A20 A;  1WI0 A;  3B1L X;  1Z2M A;  5AZF A;  5AEK B;  3ZW3 A;  5L95 C;  4W9D A;  2R2Q A;  3L10 B;  4X57 B;  5IAA C;  2LRW A;  4MM3 A;  1UH6 A;  1KM7 A;  5C1Z A;  3A9K B;  4ASW C;  2D07 B;  2O6V A;  3GZN I;  3RT3 B;  3N30 A;  4G11 A;  1J19 A;  4PS8 A;  2N7E A;  1P9D U;  3AU5 A;  3WAN A;  2NBU A;  2FUH B;  4XZ4 A;  2KDI A;  3D32 A;  4GDL A;  2K6Q A;  5AZH A;  5DCN A;  2N7D A;  3JSV A;  4KIK B;  2MX2 A;  3ZIM A;  4DHZ E;  4NQL B;  3AUL A;  3A9K A;  1WR6 E;  5C23 A;  5D7G A;  4II2 B;  4B9K A;  2C9W B;  2MLB A;  3DVG X;  2HE7 A;  2KDB A;  1E90 A;  2BGF A;  3EC8 A;  1V6E A;  4FJV B;  3VTU A;  3R3M A;  4NNJ B;  1IP9 A;  3QQ8 B;  3CSF A;  3A9J A;  4W9K A;  1EF5 A;  4BVU C;  4ANW A;  5E6O A;  2K1F A;  3WAM A;  1GG3 A;  3UIO B;  3VUY A;  2DYB A;  2G4D B;  2XBB C;  4FUL A;  4DK5 A;  2LXC A;  2JXX A;  3LJ3 A;  4DBG A;  3HM6 X;  3N3K B;  3PSE B;  3V61 A;  2OOB B;  4CYE A;  3S2A A;  3ZO5 B;  2ZCB A;  4P7I A;  3IG3 A;  3KH0 A;  5JHA A;  4W9E A;  2RSU A;  4HJK A;  2DX5 B;  3NS8 A;  2G45 B;  2OJR A;  3V62 A;  2IY0 B;  2KXJ A;  1WGH A;  2ZVO A;  3K9O B;  3QK0 A;  4JLC A;  3VTV A;  4NJ6 A;  1Q0W B;  2WWZ A;  3V6C B;  3C0R B;  4HK2 A;  3ZDT A;  1S1Q B;  2KFJ A;  4W9G A;  4YL8 A;  4AUQ C;  4ANX A;  2PE9 A;  4WJQ A;  4HXD A;  4PYU A;  3UQA A;  3QCA A;  2DYM A;  1KOT A;  1SIF A;  2DYO A;  4EEW A;  3KUD B;  4WWN A;  2C7N B;  3ZNH B;  1V80 A;  4GSW A;  2YLM A;  3EFU A;  1ZKH A;  5CHW A;  4ANV A;  4K7W A;  3MTN B;  4HDQ A;  3ECI A;  1WRD B;  1YX5 B;  3DVN U;  3LDZ E;  4K81 A;  1WGD A;  2IO0 B;  2NR2 A;  4PYZ A;  3A1Q B;  2WX0 A;  3B0A A;  2BPS A;  1UEL A;  2FCN A;  2KFK A;  2ZNV B;  1Q5W B;  3MJW A;  4F8C B;  3ALB A;  1R4N I;  4A3O A;  3ZNG C;  2K25 A;  4JGH B;  2JZ3 B;  2JY6 A;  1C1Y B;  2MQJ A;  3DDC B;  3R66 C;  4EOY A;  2RR9 A;  5JZE B;  1EF1 A;  2CHX A;  4II3 B;  3KVF B;  4GOC A;  2J7Q B;  2KWC A;  4IC7 B;  2N1W A;  2JPH A;  2K8C A;  2KNB A;  2LUE A;  2C5L C;  4EZL A;  2BYF A;  4DHZ B;  3AI5 A;  3MHS D;  2R2O A;  4WJN A;  3QX1 A;  2EKE C;  3TL5 A;  1OQY A;  1OTR B;  4HPM B;  1U4A A;  3NOB A;  3W1S A;  3DBS A;  3H7P B;  4EUT A;  5G55 A;  4G0N B;  1GJZ A;  2JWZ A;  2A4Z A;  3AXC A;  2RGF A;  3PRM B;  2K6D B;  3NZU A;  3L16 A;  3NHE B;  3HK0 A;  4IUM B;  2MBQ A;  2KTR A;  4IWO A;  4DHJ D;  4TQ0 A;  4GMV A;  2G4S A;  5G2N A;  1EUV B;  2L0T A;  4GXB A;  4JIO U;  4DHJ B;  1G6J A;  2L05 A; 
#chains in the Genus database with same CATH topology
 2CS4 A;  4KGS A;  2O2V B;  2GLS A;  3QAR A;  3H7S A;  1S3S G;  2W3R A;  2LXA A;  1ZDX A;  3VRB B;  3CMM B;  3OG5 A;  4RNA A;  3PZ7 A;  2QJL A;  3KWV A;  2L00 B;  2MP2 A;  3RNA C;  2MJD A;  3WAO A;  2V3S A;  1I35 A;  4DDI D;  2ZW0 A;  2SAK A;  1C3T A;  3JVZ X;  2K8H A;  2IZV B;  2I1J A;  2V3P A;  3C8Y A;  2KTR B;  1FM0 D;  4RF0 A;  3R2I A;  5GMV A;  2D2Q A;  4OHJ A;  4B0E A;  4ANU A;  2MW5 A;  3AE2 B;  4MM3 B;  3OWE B;  2M17 A;  3A1Q A;  4RM9 A;  2ON8 A;  4ICU A;  2GI9 A;  1TBE A;  3RYT A;  1PQS A;  2QEJ C;  1NVI D;  2ZW1 A;  2LVO A;  2IBI B;  3AE5 B;  2G3Q B;  4K7U A;  2KX0 A;  1FXI A;  1EM7 A;  3RN9 C;  4LNN A;  4KKI A;  2CHW A;  1MHH E;  2KDE B;  5E6P A;  1JWA D;  3APF A;  1EU4 A;  4LDT B;  4PS3 A;  3SD5 A;  5KHO A;  3MFG A;  1N60 A;  4GLS C;  3A4R A;  1ROE A;  3PLU A;  5DPW A;  1TS2 A;  1L6V A;  1JWU D;  3DHH C;  3B2F A;  3EHV A;  2YVC A;  3T8M A;  2MJE A;  4FHK A;  1GB4 A;  2UWQ A;  3PV1 A;  3VXW A;  3WA0 A;  2BWF A;  4RFB A;  4GN1 A;  2O2V A;  1OEY A;  2JF5 A;  2WDQ B;  3DCG A;  1WGY A;  5EE3 A;  5DPR A;  4BOZ B;  5LLI A;  4RGT A;  3DQV A;  1H4R A;  1WYW B;  1MPE A;  3PT2 B;  3ZXR A;  3RCZ A;  2RMM A;  2Z0E B;  2PE6 B;  3FIL A;  5J2R A;  2C7H A;  1BML C;  1XLP A;  1C9F A;  4IM3 A;  4LJO B;  1E8X A;  3PVL A;  4GDL B;  2BKF A;  4W9I A;  4FHJ A;  2OED A;  1TY2 A;  4LNI A;  3LXF A;  4ZRI A;  2D11 A;  1D5X C;  1T0S C;  2WXR A;  1FO4 A;  3OAW A;  4K1R B;  1TS5 A;  2LD9 A;  5AUI A;  1ZGU B;  1C4P A;  2ICI A;  2MWS B;  2KJR A;  4WJP A;  2W9N A;  4W9H A;  4N9F 4;  1V1O A;  4W9F A;  1V5T A;  1VCB A;  1WXQ A;  2N9K A;  5TSS A;  1P1A A;  3APC A;  1JWS D;  1CMX B;  2EMS A;  5IO9 A;  3Q3O C;  2MBO A;  2GBR A;  3A4S C;  3RZF A;  4REZ A;  3W5V B;  4S17 A;  2QSD A;  3P2B A;  1N5W A;  4EZK A;  1XQQ A;  3IBE A;  1SE2 A;  2WXM A;  2ZJD A;  5CTR C;  4MSQ B;  3V60 A;  2K0P A;  3DPD A;  2A5U A;  1J0G A;  1L2N A;  1IGC A;  2IYD B;  4CO7 A;  4MGY E;  4B6W A;  1WX9 A;  3TEY A;  2LHD A;  2B3A A;  3I5J C;  1R4N B;  3AU4 A;  5HFY A;  2JRI B;  4IM0 A;  1PYW D;  2G9H D;  2VH2 A;  1VZ8 A;  3TCA A;  3U52 E;  3M3J A;  4HWI B;  4C7Y A;  4BKG A;  2QC8 A;  2MBH A;  3Q8B A;  3ZKJ C;  4LDT D;  3PRP B;  4KDL B;  1I4R A;  4AOF A;  2I2Y A;  1K53 A;  2AYO B;  2DAF A;  4GIV A;  1VRA B;  4W9L A;  1VJK A;  4OZA A;  1A70 A;  2VRR B;  3U2S C;  3T3N A;  4NPN A;  1D5M C;  3GZN B;  4M8M A;  4WUR A;  3CF6 E;  5BYQ A;  1SSN A;  2FIF A;  3AEC B;  2LGX A;  4R3D A;  2OHF A;  3N1Z C;  3NG0 A;  1PDX A;  2KMC A;  1P0R A;  2D3B A;  2N9P C;  3BWU D;  1WSP A;  5LXH A;  3U8Z A;  1WJN A;  2CHZ A;  1GC7 A;  2B76 B;  2CR5 A;  1V8C A;  3VAW A;  4LNF A;  1PUT A;  2ZNV C;  4GGQ A;  4AWJ A;  3TEX A;  2QIL A;  2XK5 B;  5IOI A;  4P6V F;  4QAY A;  3TSS A;  4ICV A;  4HVB A;  2FCS A;  3UI3 A;  4EZJ A;  2M0X A;  2PVG C;  1N6Z A;  1A5R A;  3B1L X;  5AZF A;  5H92 C;  3L10 B;  1XEE A;  4X57 B;  4MM3 A;  1KM7 A;  4ASW C;  2D07 B;  2N7E A;  3AU5 A;  3WAN A;  2M0A A;  2NBU A;  2INC C;  1TKY A;  4HEA 1;  5AZH A;  1NEK B;  4KIK B;  2MX2 A;  1TKE A;  3AUL A;  1XCQ L;  3A9K A;  5D7G A;  4II2 B;  1MFW A;  1C4C A;  2MLB A;  2K3U A;  1V6E A;  1ESF A;  3R3M A;  1IP9 A;  1UWX A;  2KYW A;  1I4Q A;  1EF5 A;  1JRP A;  3WAM A;  3I9V 1;  2WXL A;  2NTS A;  3CIR B;  4DK5 A;  2JXX A;  4DBG A;  2LEK A;  3PSE B;  3V61 A;  1R4M B;  3S2A A;  1L0V B;  2ZCB A;  3BVG A;  4P7I A;  3I57 A;  1K50 A;  3SFD B;  3IAS 1;  2LMC A;  4HRS A;  2FUG 1;  1WGH A;  3QK0 A;  2J52 A;  1EU3 A;  4KGR A;  3VTV A;  3ZDT A;  1XLQ A;  1S1Q B;  4YL8 A;  4ANX A;  2Y3A A;  4PYU A;  4PK1 A;  3UQA A;  2DYM A;  1KOT A;  4P16 A;  3AEE B;  5IKC M;  5EE9 A;  2CJO A;  2YLM A;  3EFU A;  1ZKH A;  2BW2 A;  1LGR A;  1YX5 B;  3AB5 A;  3LDZ E;  1WGD A;  3A1Q B;  2WX0 A;  3B0A A;  2BPS A;  1UEL A;  1Q5W B;  4F8C B;  4A3O A;  4YSY B;  1CJE A;  3ZNG C;  4EOY A;  3R66 C;  2RR9 A;  5JZE B;  2KWC A;  2N1W A;  2JPH A;  2BYF A;  1YN4 A;  2R2O A;  1F2R I;  1I7H A;  2WS3 B;  1OQY A;  4HPM B;  3NOB A;  3W2D A;  3DBS A;  5G55 A;  4RGM A;  4OVZ A;  1FFV A;  1YJI A;  3HVD A;  3PRM B;  2K6D B;  1EWY C;  5FKA C;  2V4I B;  3MJ5 A;  4DHJ D;  2JWU A;  4JIO U;  3E56 A;  2BTE A;  1TS3 A;  1WF9 A;  2OJW A;  3AMZ A;  1E8Y A;  1NYQ A;  4N59 A;  2PJH A;  1WZ3 A;  5IN7 A;  4W9J A;  5D94 A;  2PTL A;  4AJW A;  1GNU A;  3TMP B;  3SR6 A;  1WXV A;  1AN8 A;  2KN4 A;  1TTN A;  4M01 A;  2JQR B;  3ZLZ A;  3Q8E A;  1STE A;  3DHG C;  1DYQ A;  1QOF A;  2V0G A;  3KWL A;  1I42 A;  4WAF A;  1L0X B;  1JAL A;  4I6P A;  2BB6 A;  4FLH A;  3L4P A;  4LJP B;  3A9J B;  3HM3 A;  2EEL A;  1JWB D;  4XWT A;  1TGZ B;  1DOX A;  1C78 A;  4G50 A;  3B2G A;  4K7S A;  4DXG A;  5HI1 A;  4M8N A;  2L32 A;  2PKO A;  2WDR B;  1QKZ A;  2WXJ A;  1WRI A;  5AZG A;  5D3D A;  2N4F A;  2ZVN A;  3N9Y C;  3ZDM C;  2JZP A;  3VHT C;  3RNB C;  1FRR A;  2NBW B;  4M0W B;  2X38 A;  2L3Z A;  2IY1 B;  3GS2 A;  2FBW B;  3IFW B;  3U7D A;  4ZRJ A;  2FE8 A;  2J4X A;  4S0R A;  3VDZ A;  2HJ8 A;  1D5Z C;  4NY0 A;  2JYE A;  2L76 A;  4DWF A;  4CQN A;  3L17 A;  2L8J A;  2KKC A;  2WHI A;  1LQB A;  5BO4 B;  1V81 A;  2I38 A;  5FR6 A;  4KGT A;  1F1H A;  3UF8 A;  1RM6 C;  3AM9 A;  2WDT B;  4B95 A;  4ZHP A;  1E7V A;  3H8H A;  4LTU A;  3W1S C;  3DBR B;  3KUC B;  2KTF A;  2PPH A;  4NJ7 A;  4TV3 A;  4XE0 A;  3W9C B;  5L83 A;  1I4P A;  2BB5 A;  2KQ4 X;  3ZGZ A;  1OQR A;  3IT4 B;  2KC1 A;  4KDI C;  2PLP A;  4KSK C;  3BY4 B;  3P42 A;  2LGI A;  3JSV B;  1D3Z A;  3RZW C;  2IGD A;  4ZYS A;  4ARI A;  1WJ6 A;  3AEG B;  3NZS A;  3B9J A;  1KLV A;  1Y8R C;  4XWW A;  2JXT A;  1T6B X;  2RD0 A;  3RD2 A;  2NVU I;  2NCN A;  2GOW A;  4XDC A;  1ACC A;  2L52 A;  1WH3 A;  1SE3 A;  1C76 A;  4HPL B;  2ZEQ A;  2RDB C;  4NZL B;  3HHM A;  2KFK B;  1QQR A;  3NVY A;  3L13 A;  1UD7 A;  2N0S B;  3P4S B;  2MBE A;  5G5H A;  3M62 B;  2KWU B;  1JRU A;  1NYR A;  5HHD G;  3V3X A;  3VH3 B;  3ZNI D;  5FK9 C;  1FD6 A;  4HKZ E;  1E7P B;  3RPF C;  1FXA A;  1WFY A;  2MSE D;  2HTM E;  2NTT A;  4BBN C;  1J7C A;  4BKS A;  4AQ7 A;  4RM8 A;  4P1B C;  2Z59 B;  1VR9 A;  4KKJ A;  4RGN A;  2BKR B;  1KH0 A;  4KZC A;  3AEB B;  4KIK A;  2LUM A;  1E0Z A;  1XXG A;  1WX8 A;  3NY5 A;  3O65 B;  4NAW B;  3E9S A;  4KVG B;  4GDK B;  4TSS A;  2I1K A;  2M56 B;  4AJY B;  4MT5 A;  4TQ1 A;  4USA A;  1ZW7 A;  1WJU A;  1KTK A;  4RCO A;  2GBK A;  2IPK D;  3Q3J A;  2QIE B;  1QOA A;  2KQS A;  1ET6 A;  2RPV A;  3WIM A;  1YD8 U;  5C2T B;  4JPS A;  1V5O A;  2GBM A;  2DWQ A;  4A3P A;  1GC6 A;  2PW9 A;  2CU1 A;  3DHI C;  3SU8 X;  1VD2 A;  3ZJU A;  3M95 A;  3B08 A;  2DEN B;  2KK8 A;  2KLC A;  3SHQ A;  3TBL D;  4EE2 A;  1WJ4 A;  2NS5 A;  2WU5 B;  1F2R C;  3VR9 B;  3ZRF A;  3R7Q A;  5J17 A;  2KX3 A;  3N1Y C;  2LZ6 A;  1OFF A;  5JHB A;  1MHX A;  5CX3 A;  1LM8 B;  4DXA B;  3DWM A;  4JWS C;  3DWG C;  2D3A A;  2HJ1 A;  4MDK E;  2TSS A;  2BS4 B;  3VTW A;  3IT6 B;  2DZK A;  4NQK E;  1I4X A;  1WE6 A;  2KHW B;  1BXT A;  5T8I A;  3DBL I;  4FBJ B;  3W1Y A;  2Y5B B;  3H6N A;  2N9L A;  1YMH E;  1T0Q C;  3VH4 B;  3MC8 A;  1Q10 A;  4DXF A;  2CU3 A;  2JX5 A;  5IAA C;  2LRW A;  5C1Z A;  2O6V A;  3RT3 B;  4G11 A;  3ZXV A;  1F0Z A;  2K6Q A;  1M4V A;  5DCN A;  1TS4 A;  5EE0 A;  5I4D A;  2X8X X;  4NQL B;  1WR6 E;  3ZJT A;  1E90 A;  2BGF A;  3FKY A;  4W9K A;  4ANW A;  2W82 A;  3FIL B;  2K1F A;  2AQ3 B;  4LLG M;  4FUL A;  3LJ3 A;  3U4E G;  3LYY A;  3PO0 A;  1IGD A;  2RSU A;  4HJK A;  1L4Z B;  2PIA A;  4YTM B;  2IY0 B;  1JW9 D;  2ZVO A;  4JLC A;  3VRA B;  3V6C B;  4HK2 A;  1VDV A;  5JXV A;  3GE8 C;  1UWM A;  1SF0 A;  2PE9 A;  4HXD A;  1FNU A;  1GPX A;  1SIF A;  4EEW A;  4WWN A;  1F52 A;  2Q5W D;  3MTN B;  4C56 C;  4FXC A;  2NR2 A;  4HPP A;  3RNC C;  2V3N A;  2JY6 A;  4JX1 C;  1MJD A;  3DDC B;  1EF1 A;  4II3 B;  2J7Q B;  1PFD A;  3EFC A;  2MEK A;  1DOY A;  5MPO A;  4M0W A;  3KQ4 A;  2JU6 X;  2WDV B;  1U4A A;  3Q8F A;  4G0N B;  2K22 A;  3AXC A;  3NHE B;  2WU2 B;  2MBQ A;  2KTR A;  4IWO A;  2RDG A;  3N20 C;  1QOG A;  3IAM 1;  2G4S A;  1KLU D;  4GXB A;  2L0T A;  1G6J A;  2H89 B;  3H9D A;  4AP4 C;  3J9C A;  3DOW A;  3OLM D;  1D6E C;  4IW0 A;  4J6I A;  4MGI E;  3V05 A;  3C19 A;  3PPA A;  3UIP B;  3Q14 C;  1VLB A;  2DZI A;  1MI0 A;  4FN2 A;  1JQ4 A;  1WXS A;  2WXO A;  2XEW A;  2VZK B;  2NMQ A;  2MCN B;  4IOI E;  2WP9 B;  3APD A;  4OVU A;  4RGO S;  2W55 A;  4US9 A;  3ML9 A;  2IDY A;  1H8C A;  1GUA B;  1HQR D;  3EGR A;  3P4P B;  2GBN A;  2C7M B;  3Q6B A;  2LRU A;  1OGW A;  3PS6 A;  1ZXI A;  1WMH B;  4WQM A;  3PRE A;  3VVW B;  3WAP A;  2V1Y A;  4ZRQ A;  1N62 A;  2PVO D;  4HLE A;  2FNJ B;  1QT9 A;  1I4H A;  4LCD E;  1E5W A;  1WY8 A;  4A8X C;  2WXP A;  1XD3 B;  2DAJ A;  3HVZ A;  3AE3 B;  1FRD A;  3UIN B;  1NEN B;  1E8W A;  2BT6 A;  1Y56 A;  2WXG A;  1YN3 A;  1ZXH A;  1HA5 A;  5DPT A;  3BVZ A;  4IWQ A;  2UYZ B;  4M00 A;  1BT0 A;  2DZJ A;  2KWD A;  3IHP C;  2N9X A;  3DVG Y;  1B9R A;  4K3B A;  1P7E A;  1UF0 A;  3PGE A;  2KC2 A;  3TIX A;  1UBQ A;  3P4Q B;  1RFK A;  2L1A A;  4JL9 A;  4WWM A;  1V2Y A;  1Z5S B;  2DBY A;  3EEC A;  3PRZ A;  4WJO A;  5BMI A;  2MBB B;  2NBV B;  3VUW A;  4BKT A;  3FC4 A;  1XT9 B;  1YJ1 A;  4K3C A;  1SJH D;  2IGH A;  2KMA A;  4IDI A;  1UBI A;  2LAS A;  3TJP A;  3T9L A;  2MP2 B;  3HUI A;  2FCM A;  1CQV A;  3ONS A;  4IM2 A;  2K5P A;  3DBR I;  5H8Y E;  4F7Z A;  3QJZ A;  4E71 A;  3VR8 B;  3GE3 C;  1XF5 L;  1IBX B;  2J0M A;  4IWP A;  1YX6 B;  2BWE S;  4TKN A;  2WXI A;  1YQ4 B;  1K8R B;  2MH7 A;  1NDD A;  3T3O A;  4PS7 A;  1WGK A;  1TY0 A;  2M8S A;  2W3S A;  3HIZ A;  2O6V B;  1WGR A;  3MC0 B;  4MJS A;  4OVV A;  1SE9 A;  3PHW B;  3W5U B;  3NS1 A;  2M4N A;  3JYU A;  5CHV C;  2IO1 B;  3BYT B;  3RUI B;  1E10 A;  2N7J A;  1TT5 B;  4URK A;  2Z0D B;  4BZA A;  2JT4 B;  4KZ0 A;  4EFO A;  4KSL C;  2HD5 B;  3QC8 B;  2LWP A;  2JZZ A;  5TR5 A;  2LJI A;  3AH7 A;  1J7B A;  1P3Q U;  2KDM A;  1SE4 A;  2JSV X;  1ZPS A;  2E3T A;  2GMI C;  3AEA B;  3BYY B;  1GB1 A;  4MGZ E;  5IA7 A;  1AAR A;  2LVP A;  4MSM B;  4US8 A;  1UGM A;  1FPY A;  5D2M B;  2J42 A;  2JRH A;  2KOX A;  3ABV B;  4WWO A;  5EDS A;  4F1S A;  1JML A;  2KN5 A;  5J18 A;  4W9C A;  2NPT B;  2UU7 A;  3N32 A;  4FAD A;  4C4V A;  1WM3 A;  1FFU A;  3P1M A;  1L7Y A;  4MEM A;  1EWC A;  1WR1 A;  3R7R A;  4PT5 A;  1YQ3 B;  1R4M I;  3KW5 B;  3CWI A;  3WAL A;  2GBJ A;  2AL3 A;  2CJN A;  1TKG A;  2JUO A;  4WAA A;  4ACF A;  4XGA B;  3A33 B;  4G3X B;  3X0W A;  1V1P B;  3L08 A;  5E6N A;  4BOS C;  1SEB D;  1YQB A;  1E8Z A;  2KJ6 A;  3PHX B;  2KJH B;  1VZ6 A;  3AE8 B;  1SIJ A;  1AWD A;  2LJ5 A;  3L54 A;  3QWZ B;  3IVF A;  3MC9 A;  4IG7 B;  4L1B A;  2Z8L A;  3Q69 A;  4ZDV A;  4BBN F;  2WLB A;  3KUZ A;  1L6U A;  1T5X D;  2ZPN A;  1L4D B;  5HG2 A;  3CST A;  2K9X A;  2J0J A;  4ZYN A;  3HRD D;  1ENF A;  3ENE A;  2FAZ A;  2QHO A;  4KX6 B;  3NJT A;  1LXD A;  1HXY D;  2M1M A;  1YIW A;  2ZCC A;  4OW0 A;  5BMG A;  4JE3 B;  4FJY A;  1LFD A;  1AYF A;  2O6V D;  2K8B A;  2KZR A;  4XX5 A;  1TIF A;  4YSZ B;  3VQI A;  1ZUD 2;  3DBH I;  2RPQ A;  1T0Y A;  1LO5 D;  2LVQ A;  2GRI A;  3PLV A;  2D5G A;  5AEK B;  3I63 C;  4W9D A;  4BAX A;  4J3O D;  3AV8 A;  1UH6 A;  4XDD A;  1N5X A;  3GZN I;  1TZO A;  1J19 A;  2FUH B;  3NZ3 A;  4XZ4 A;  2KDI A;  3D32 A;  4GDL A;  4DHZ E;  1ZDV A;  3DVG X;  2LHE A;  3NVW A;  2BS2 B;  1HZ6 A;  3QQ8 B;  3A9J A;  4BVU C;  3N1X C;  2QCZ A;  1GG3 A;  3VUY A;  1UUP A;  2G4D B;  4ZRP A;  1SB3 C;  2AQ1 B;  3HM6 X;  2OOB B;  5AUK A;  2EKI A;  3NVV A;  1V97 A;  5JHA A;  1P7F A;  4W9E A;  2DX5 B;  3DBH B;  1PGA A;  3NS8 A;  1YJJ A;  2G45 B;  2KXJ A;  1FMA D;  2INP E;  3K9O B;  1D4B A;  4Q2J A;  4NJ6 A;  3C0R B;  5IP4 D;  2KFJ A;  4AUQ C;  3KLS X;  4WJQ A;  3FAH A;  3TUO A;  3QCA A;  2DYO A;  2HDE A;  4WIP A;  3KUD B;  2C7N B;  1V80 A;  4GSW A;  1HEZ E;  5E6J A;  3P63 A;  4ANV A;  2YEP F;  1BUI C;  4HDQ A;  4N6E B;  1C4A A;  3ECI A;  4MH8 A;  1TYG B;  3DVN U;  4N58 A;  2KFK A;  2IND C;  2ZNV B;  3MJW A;  3ALB A;  1I4G A;  2WXF A;  2JZ3 B;  3R8B A;  1C1Y B;  2GB1 A;  1FCC C;  1UGJ A;  2CHX A;  2VZK D;  4GOC A;  4IC7 B;  2KNB A;  2LUE A;  4A55 A;  2C5L C;  4EZL A;  4DHZ B;  3MHS D;  3QX1 A;  5D3I B;  1OTR B;  1PGB A;  3W1S A;  3H7P B;  4WH4 A;  1JCK B;  4RF1 A;  2A4Z A;  1CK1 A;  4LK0 M;  2RGF A;  1F77 A;  3NZU A;  3L16 A;  1QOB A;  3AED B;  1B1Z A;  4C00 A;  2LGS A;  4TQ0 A;  4GMV A;  4MAC A;  5G2N A;  4GU2 A;  3QIJ A;  1WMH A;  2L05 A;  1R7S A;  3VFK A;  2AL6 A;  2IGG A;  4EKU A;  4BKS D;  2ZZP B;  2ASQ A;  1HTQ A;  4HJG E;  2Y5P A;  1N63 A;  3NUH B;  2WXH A;  2FCQ A;  4ZRK A;  2ACZ B;  2XN9 C;  4DQO C;  1WM2 A;  2HTH A;  1QZE A;  3Q3M C;  3DVN V;  4MGK E;  1V9J A;  1SGH A;  1GAQ B;  1YN5 A;  4FJZ A;  2KWV B;  1WWT A;  2L0F A;  1E9M A;  2G1E A;  3QA8 A;  2WNM A;  4RMA A;  2KO3 A;  1L0Y B;  2KMM A;  2BS3 B;  3H7P A;  4MJS B;  3ML8 A;  2N1V A;  5HKH A;  3BII D;  3ZUN A;  2R61 A;  5D6J B;  1MG4 A;  1WX7 A;  4A6Q A;  2KVZ A;  1E7U A;  2DLB A;  2N9E B;  3ZNZ B;  5LXI B;  4HCN B;  4E74 A;  3LB8 C;  3ZRC A;  3U7Z A;  1UNS A;  1ZP0 B;  3O13 A;  4P1C C;  1IBX A;  2D10 A;  3BIN A;  4D2K A;  5JH5 C;  1HZ5 A;  1K51 A;  1XCT L;  4NAM A;  3SDL C;  2J0K A;  1FXT B;  2AWT A;  2XK5 A;  3TEW A;  1RAX A;  2K39 A;  1X1M A;  1RLF A;  3P4R B;  2KVR A;  2MRP A;  3OJ3 A;  4GB9 A;  4DDG D;  4RH6 A;  2KD0 A;  4C7Z A;  4JQW C;  2DNF A;  3EUB 2;  1IPG A;  2ZPY A;  4L2Y A;  2LI5 A;  2LGD A;  3I3T B;  1P98 A;  3ZTD A;  2EMT A;  3AE4 B;  2KAJ A;  1K52 A;  1RRB A;  2KLG A;  4A90 A;  2BYE A;  2MA9 B;  1T3Q A;  4HRO A;  5EE1 A;  2WXQ A;  2KT7 A;  1HE8 A;  2L83 A;  4E3C A;  4O1N A;  1KFY B;  2MJ3 A;  1DGJ A;  3MHZ A;  3NVZ A;  4XC2 A;  4B0M A;  3SFE B;  1WGG A;  4A9A A;  5GXG B;  3SEB A;  3Q8C A;  4L23 A;  5CHF A;  1Q1O A;  2JVC A;  3OJ4 B;  4FA6 A;  3L0W B;  2PMV A;  1WE7 A;  3X23 A;  2REX A;  3H1U A;  2KAC A;  1ISN A;  1V49 A;  1TZ1 A;  2DZM A;  4HDO A;  1NI2 A;  1WXM A;  3Q3N C;  1SBB B;  4HCP B;  1FNV A;  3PZD A;  1NI3 A;  3VUX A;  2KAN A;  1NBF C;  4ITK A;  4YTP B;  1XO3 A;  4CHK A;  4YT0 B;  3K9P B;  1KF6 B;  1WIA A;  3AN1 A;  3U30 A;  1MG8 A;  3NRZ A;  2LGY A;  2Y5C A;  2QMT A;  4I6N B;  2IJ0 A;  1KRH A;  2NPT A;  1FEH A;  4NAW A;  1CZP A;  2KQ7 A;  2C60 A;  3V6E B;  2V4L A;  3PZ8 A;  1VZ7 A;  2XNA C;  3Q3F A;  4ZOH C;  2VH1 A;  1SJE D;  1MVK A;  3RUL A;  2WX1 A;  4MEL A;  1QF6 A;  4I6L B;  1AW7 A;  3RNG C;  5KHQ A;  1WYG A;  4BFR A;  4C80 A;  3R2T A;  2BBC A;  3UQB A;  2AEH A;  2BYV E;  5C3J B;  1KJT A;  4MH0 E;  3GP7 A;  2D3C A;  1M94 A;  1JRO A;  4M02 A;  2KDF B;  1XLN A;  5DPS A;  2D3G A;  1WXA A;  2SEB D;  1FNW A;  2H88 B;  1RYJ A;  2IO2 B;  4IKG A;  2M19 A;  3QAQ A;  2IO3 B;  2FID A;  1F9J A;  2AQ2 B;  3WCQ A;  2WQY B;  1RFA A;  2BF8 B;  3RFZ B;  1QIL A;  4AS1 A;  1L5P A;  1EO6 A;  3RNF C;  2L7R A;  3ZQ4 A;  1HTO A;  1KLG D;  1UZX B;  3AE6 B;  3EA6 A;  4GDK A;  1OEY J;  3JW0 X;  3UGB B;  1J7A A;  5BYS A;  4ZHO A;  4WWP A;  3IXS A;  2CKH B;  1QLB B;  3TEZ A;  2PEA A;  4OZC A;  2DHZ A;  4KV2 A;  3ZYY X;  3ZVV A;  1V86 A;  3PTF C;  2WXK A;  2WYQ A;  2BYT A;  4TUU A;  3GOE A;  3KYC D;  2WXN A;  3M63 B;  2YEP B;  3DBL B;  2BVC A;  4OZB A;  3Q2A C;  1FIQ A;  1J8C A;  4YWG G;  3KYD D;  1WZ0 A;  5LNK 1;  1YOV B;  1JWM D;  4WQO B;  1XLO A;  3ZTC A;  3RNE C;  2MHJ A;  1ZOY B;  1SXT A;  3ZJV A;  1IYF A;  1V1P A;  4YTN B;  5G5G A;  2E6X A;  3QHT A;  3AE9 B;  4A20 A;  1WI0 A;  1Z2M A;  3ZW3 A;  5L95 C;  2WGS A;  2R2Q A;  2JYT A;  1OQQ A;  3A9K B;  3N30 A;  4PS8 A;  4LNK A;  4XYC A;  1P9D U;  5BMH A;  4YXD B;  4C4V B;  3AE7 B;  1ZE3 D;  2LFI A;  3BZD B;  4JWU C;  2N7D A;  3JSV A;  4ARC A;  3ZIM A;  5C23 A;  2BQQ A;  4LNO A;  4B9K A;  2C9W B;  2HE7 A;  2KDB A;  1IUE A;  3EC8 A;  4FJV B;  4UDU C;  1TJE A;  1C79 A;  3VTU A;  4NNJ B;  3ETR A;  1FCL A;  3CSF A;  5E6O A;  1DOI A;  2V9H A;  3RI7 C;  3UIO B;  3AEF B;  2DYB A;  2XBB C;  2LXC A;  2W54 A;  3N3K B;  4CYE A;  3AE1 B;  3ZO5 B;  1N61 A;  3IG3 A;  3KH0 A;  2J53 A;  2AX5 A;  5FR3 A;  4YSX B;  1C77 A;  1PGX A;  2OJR A;  2ONQ A;  3V62 A;  1RWS A;  3Q8A A;  4NJC A;  1Q0W B;  2WWZ A;  4W9G A;  3GB1 A;  2RDH A;  4HKQ A;  1GOZ A;  3ZNH B;  3BK2 A;  2QDF A;  5CHW A;  4K7W A;  1WRD B;  4K81 A;  4TMA B;  2IO0 B;  4PYZ A;  2FCN A;  1R4N I;  1E6E B;  2K25 A;  4H2A A;  4JGH B;  5BYR A;  2MQJ A;  2INN E;  3KVF B;  2K8C A;  3URY A;  3AI5 A;  4WJN A;  1ET9 A;  2EKE C;  3TL5 A;  1YNT E;  3RMK C;  4EUT A;  1T0R C;  1GJZ A;  2JWZ A;  4IUM B;  3HK0 A;  3BVM A;  3BK1 A;  3MP9 A;  1EUV B;  4DHJ B; 
#chains in the Genus database with same CATH homology
 2CS4 A;  1WMH A;  2O2V B;  3VFK A;  2AL6 A;  4EKU A;  3H9D A;  3QAR A;  4AP4 C;  4BKS D;  2ZZP B;  3H7S A;  2ASQ A;  1S3S G;  3DOW A;  3OLM D;  4IW0 A;  4J6I A;  2LXA A;  4MGI E;  1WF9 A;  2FCQ A;  4ZRK A;  3CMM B;  3PPA A;  1E8Y A;  3UIP B;  2PJH A;  1WM2 A;  1WZ3 A;  4W9J A;  2DZI A;  5D94 A;  2HTH A;  4AJW A;  2L00 B;  2MP2 A;  1GNU A;  3TMP B;  1QZE A;  3DVN V;  1WXV A;  4MGK E;  3WAO A;  2V3S A;  1V9J A;  4FN2 A;  1WXS A;  1I35 A;  4DDI D;  1SGH A;  1TTN A;  2XEW A;  4FJZ A;  1C3T A;  3JVZ X;  2K8H A;  2MCN B;  3ZLZ A;  3APD A;  4OVU A;  2KWV B;  2L0F A;  2IZV B;  2I1J A;  1I42 A;  3ML9 A;  3QA8 A;  1H8C A;  1GUA B;  4I6P A;  4RMA A;  2KO3 A;  2KTR B;  2GBN A;  2C7M B;  4FLH A;  4GU2 A;  4LJP B;  3A9J B;  2LRU A;  3HM3 A;  5GMV A;  2D2Q A;  1OGW A;  3PS6 A;  4ANU A;  1TGZ B;  1WMH B;  4G50 A;  3H7P A;  3PRE A;  4MJS B;  3VVW B;  2MW5 A;  3ML8 A;  4K7S A;  2N1V A;  5HKH A;  3WAP A;  2V1Y A;  3ZUN A;  4M8N A;  2M17 A;  3A1Q A;  5D6J B;  1WX7 A;  4RM9 A;  4ICU A;  1TBE A;  4HLE A;  3RYT A;  2FNJ B;  1PQS A;  1E7U A;  5AZG A;  2N9E B;  2N4F A;  4LCD E;  1E5W A;  1WY8 A;  2ZVN A;  3ZDM C;  3ZNZ B;  3VHT C;  5LXI B;  2LVO A;  4HCN B;  4E74 A;  2IBI B;  3ZRC A;  2G3Q B;  4K7U A;  2KX0 A;  2NBW B;  1XD3 B;  2DAJ A;  4M0W B;  2CHW A;  2L3Z A;  2IY1 B;  2KDE B;  3UIN B;  5E6P A;  3APF A;  2D10 A;  3BIN A;  4LDT B;  4PS3 A;  3SD5 A;  5KHO A;  5JH5 C;  3IFW B;  1E8W A;  3U7D A;  4ZRJ A;  3A4R A;  3PLU A;  3VDZ A;  5DPW A;  2HJ8 A;  4NY0 A;  2L76 A;  3SDL C;  4DWF A;  2J0K A;  1FXT B;  5DPT A;  3L17 A;  2L8J A;  4IWQ A;  2UYZ B;  3EHV A;  2AWT A;  2YVC A;  2KKC A;  2XK5 A;  3T8M A;  1RAX A;  1BT0 A;  2DZJ A;  2K39 A;  1X1M A;  1LQB A;  1RLF A;  3IHP C;  5BO4 B;  4FHK A;  1V81 A;  2N9X A;  2UWQ A;  3DVG Y;  3PV1 A;  2KVR A;  2MRP A;  3VXW A;  3WA0 A;  5FR6 A;  2BWF A;  3PGE A;  2KC2 A;  3OJ3 A;  3TIX A;  1UBQ A;  4GN1 A;  4GB9 A;  3UF8 A;  4DDG D;  2KD0 A;  4JL9 A;  2O2V A;  1V2Y A;  1Z5S B;  3EEC A;  3PRZ A;  2WDT B;  4B95 A;  4WJO A;  4JQW C;  1E7V A;  1OEY A;  2JF5 A;  1IPG A;  2ZPY A;  2MBB B;  2NBV B;  3VUW A;  2LI5 A;  2LGD A;  4BKT A;  3I3T B;  1XT9 B;  1YJ1 A;  3W1S C;  3DCG A;  1P98 A;  3ZTD A;  2EMT A;  1WGY A;  2KMA A;  3KUC B;  5DPR A;  1UBI A;  2LAS A;  2KTF A;  2PPH A;  4NJ7 A;  4TV3 A;  5LLI A;  4BOZ B;  3TJP A;  3T9L A;  1RRB A;  2KLG A;  2MP2 B;  3DQV A;  1H4R A;  1WYW B;  3PT2 B;  5L83 A;  2FCM A;  2BYE A;  2MA9 B;  3RCZ A;  3ONS A;  4F7Z A;  4IM2 A;  3DBR I;  2Z0E B;  3QJZ A;  4E71 A;  2PE6 B;  1HE8 A;  4E3C A;  5J2R A;  4XC2 A;  2C7H A;  2KC1 A;  4KDI C;  1WGG A;  2J0M A;  4IM3 A;  4KSK C;  4IWP A;  5CHF A;  1YX6 B;  2BWE S;  3BY4 B;  1Q1O A;  2JVC A;  4LJO B;  4TKN A;  3OJ4 B;  3JSV B;  1D3Z A;  3RZW C;  4FA6 A;  1E8X A;  3L0W B;  3PVL A;  4GDL B;  1WE7 A;  1WJ6 A;  1K8R B;  3X23 A;  2BKF A;  1NDD A;  4FHJ A;  4W9I A;  4PS7 A;  3NZS A;  1KLV A;  2M8S A;  3HIZ A;  2REX A;  1Y8R C;  2O6V B;  1WGR A;  3H1U A;  4ZRI A;  2D11 A;  2RD0 A;  3RD2 A;  1ISN A;  2NCN A;  1V49 A;  2GOW A;  2NVU I;  4MJS A;  4OVV A;  1SE9 A;  3PHW B;  3OAW A;  1TZ1 A;  1WH3 A;  4K1R B;  2DZM A;  2LD9 A;  4HDO A;  1NI2 A;  2M4N A;  1ZGU B;  3JYU A;  5CHV C;  1WXM A;  2IO1 B;  3RUI B;  4HCP B;  3PZD A;  4URK A;  3VUX A;  4HPL B;  2MWS B;  2Z0D B;  2ZEQ A;  2KAN A;  2KJR A;  4WJP A;  1NBF C;  2W9N A;  4W9H A;  4N9F 4;  2JT4 B;  4W9F A;  1V5T A;  4CHK A;  1VCB A;  3HHM A;  3K9P B;  4KZ0 A;  1P1A A;  1WIA A;  3U30 A;  4EFO A;  1MG8 A;  3APC A;  2KFK B;  2LGY A;  1CMX B;  4KSL C;  2EMS A;  4I6N B;  2HD5 B;  3QC8 B;  2LWP A;  2JZZ A;  3L13 A;  2MBO A;  2NPT A;  5TR5 A;  4NAW A;  1UD7 A;  2GBR A;  1P3Q U;  3A4S C;  2MBE A;  3RZF A;  2GMI C;  2KQ7 A;  2C60 A;  4MGZ E;  3M62 B;  3V6E B;  2KWU B;  1AAR A;  2V4L A;  2LVP A;  5IA7 A;  1JRU A;  3P2B A;  4MSM B;  3VH3 B;  1UGM A;  3ZNI D;  4EZK A;  1XQQ A;  3IBE A;  3Q3F A;  5D2M B;  2JRH A;  2KOX A;  4WWO A;  5EDS A;  4F1S A;  3RUL A;  2WX1 A;  2ZJD A;  4MEL A;  4MSQ B;  2KN5 A;  5CTR C;  3V60 A;  4I6L B;  5J18 A;  5KHQ A;  3QIJ A;  1WFY A;  2MSE D;  3DPD A;  2A5U A;  4BFR A;  4W9C A;  1J0G A;  2NPT B;  4BBN C;  3N32 A;  4BKS A;  1L2N A;  2IYD B;  4RM8 A;  4FAD A;  3UQB A;  4CO7 A;  4MGY E;  2AEH A;  2BYV E;  1WM3 A;  2Z59 B;  1KJT A;  1L7Y A;  4B6W A;  1WX9 A;  2BKR B;  4MH0 E;  4MEM A;  1M94 A;  4KZC A;  1WR1 A;  4KIK A;  2B3A A;  3R7R A;  1WX8 A;  2KDF B;  3NY5 A;  3O65 B;  3AU4 A;  4NAW B;  5DPS A;  2JRI B;  1R4M I;  2D3G A;  4GDK B;  4IM0 A;  3KW5 B;  4KVG B;  2I1K A;  4AJY B;  1WXA A;  2GBJ A;  2AL3 A;  4TQ1 A;  3WAL A;  2JUO A;  4WAA A;  3A33 B;  3TCA A;  4G3X B;  3X0W A;  3L08 A;  4BOS C;  5E6N A;  2IO2 B;  1ZW7 A;  1WJU A;  1YQB A;  3M3J A;  1E8Z A;  4HWI B;  2KJ6 A;  3QAQ A;  2IO3 B;  4BKG A;  2FID A;  1F9J A;  2KJH B;  2GBK A;  2MBH A;  3PHX B;  3ZKJ C;  4LDT D;  3PRP B;  2LJ5 A;  3L54 A;  4KDL B;  3Q3J A;  3QWZ B;  1RFA A;  2BF8 B;  3IVF A;  2KQS A;  4AOF A;  4IG7 B;  1YD8 U;  3WIM A;  1EO6 A;  1V5O A;  2GBM A;  2L7R A;  4ZDV A;  2AYO B;  2DAF A;  4GIV A;  4A3P A;  1GC6 A;  4BBN F;  2CU1 A;  3KUZ A;  2ZPN A;  4W9L A;  1UZX B;  3SU8 X;  1VD2 A;  4GDK A;  1OEY J;  3JW0 X;  3M95 A;  2VRR B;  3B08 A;  2DEN B;  2KK8 A;  3CST A;  4NPN A;  3UGB B;  2KLC A;  4WWP A;  3SHQ A;  2CKH B;  3TBL D;  1WJ4 A;  2NS5 A;  4M8M A;  2J0J A;  2PEA A;  3CF6 E;  3ZRF A;  4ZYN A;  2FIF A;  2DHZ A;  4KV2 A;  3ENE A;  3ZVV A;  2FAZ A;  3R7Q A;  2LGX A;  2QHO A;  1LXD A;  5J17 A;  1V86 A;  2KX3 A;  3PTF C;  2LZ6 A;  2M1M A;  1YIW A;  2KMC A;  2ZCC A;  1LM8 B;  5CX3 A;  2WYQ A;  4DXA B;  5JHB A;  1P0R A;  4TUU A;  2N9P C;  3GOE A;  3KYC D;  4FJY A;  5LXH A;  3U8Z A;  3M63 B;  1LFD A;  1WJN A;  2CHZ A;  1GC7 A;  4MDK E;  2CR5 A;  2O6V D;  3VAW A;  1J8C A;  2ZNV C;  2K8B A;  2KZR A;  3VTW A;  4GGQ A;  3KYD D;  4XX5 A;  4AWJ A;  2DZK A;  4NQK E;  1WE6 A;  2KHW B;  2XK5 B;  1WZ0 A;  3VQI A;  4WQO B;  3DBL I;  4ICV A;  4HVB A;  3ZTC A;  4FBJ B;  3DBH I;  2Y5B B;  3W1Y A;  3H6N A;  2FCS A;  1IYF A;  2RPQ A;  1T0Y A;  4EZJ A;  2LVQ A;  2M0X A;  3PLV A;  3QHT A;  1A5R A;  3VH4 B;  4A20 A;  1WI0 A;  3B1L X;  1Z2M A;  5AZF A;  5AEK B;  3ZW3 A;  5L95 C;  4W9D A;  2R2Q A;  3L10 B;  4X57 B;  5IAA C;  2LRW A;  4MM3 A;  1UH6 A;  1KM7 A;  5C1Z A;  3A9K B;  4ASW C;  2D07 B;  2O6V A;  3GZN I;  3RT3 B;  3N30 A;  4G11 A;  1J19 A;  4PS8 A;  2N7E A;  1P9D U;  3AU5 A;  3WAN A;  2NBU A;  2FUH B;  4XZ4 A;  2KDI A;  3D32 A;  4GDL A;  2K6Q A;  5AZH A;  5DCN A;  2N7D A;  3JSV A;  4KIK B;  2MX2 A;  3ZIM A;  4DHZ E;  4NQL B;  3AUL A;  3A9K A;  1WR6 E;  5C23 A;  5D7G A;  4II2 B;  4B9K A;  2C9W B;  2MLB A;  3DVG X;  2HE7 A;  2KDB A;  1E90 A;  2BGF A;  3EC8 A;  1V6E A;  4FJV B;  3VTU A;  3R3M A;  4NNJ B;  1IP9 A;  3QQ8 B;  3CSF A;  3A9J A;  4W9K A;  1EF5 A;  4BVU C;  4ANW A;  5E6O A;  2K1F A;  3WAM A;  1GG3 A;  3UIO B;  3VUY A;  2DYB A;  2G4D B;  2XBB C;  4FUL A;  4DK5 A;  2LXC A;  2JXX A;  3LJ3 A;  4DBG A;  3HM6 X;  3N3K B;  3PSE B;  3V61 A;  2OOB B;  4CYE A;  3S2A A;  3ZO5 B;  2ZCB A;  4P7I A;  3IG3 A;  3KH0 A;  5JHA A;  4W9E A;  2RSU A;  4HJK A;  2DX5 B;  3NS8 A;  2G45 B;  2OJR A;  3V62 A;  2IY0 B;  2KXJ A;  1WGH A;  2ZVO A;  3K9O B;  3QK0 A;  4JLC A;  3VTV A;  4NJ6 A;  1Q0W B;  2WWZ A;  3V6C B;  3C0R B;  4HK2 A;  3ZDT A;  1S1Q B;  2KFJ A;  4W9G A;  4YL8 A;  4AUQ C;  4ANX A;  2PE9 A;  4WJQ A;  4HXD A;  4PYU A;  3UQA A;  3QCA A;  2DYM A;  1KOT A;  1SIF A;  2DYO A;  4EEW A;  3KUD B;  4WWN A;  2C7N B;  3ZNH B;  1V80 A;  4GSW A;  2YLM A;  3EFU A;  1ZKH A;  5CHW A;  4ANV A;  4K7W A;  3MTN B;  4HDQ A;  3ECI A;  1WRD B;  1YX5 B;  3DVN U;  3LDZ E;  4K81 A;  1WGD A;  2IO0 B;  2NR2 A;  4PYZ A;  3A1Q B;  2WX0 A;  3B0A A;  2BPS A;  1UEL A;  2FCN A;  2KFK A;  2ZNV B;  1Q5W B;  3MJW A;  4F8C B;  3ALB A;  1R4N I;  4A3O A;  3ZNG C;  2K25 A;  4JGH B;  2JZ3 B;  2JY6 A;  1C1Y B;  2MQJ A;  3DDC B;  3R66 C;  4EOY A;  2RR9 A;  5JZE B;  1EF1 A;  2CHX A;  4II3 B;  3KVF B;  4GOC A;  2J7Q B;  2KWC A;  4IC7 B;  2N1W A;  2JPH A;  2K8C A;  2KNB A;  2LUE A;  2C5L C;  4EZL A;  2BYF A;  4DHZ B;  3AI5 A;  3MHS D;  2R2O A;  4WJN A;  3QX1 A;  2EKE C;  3TL5 A;  1OQY A;  1OTR B;  4HPM B;  1U4A A;  3NOB A;  3W1S A;  3DBS A;  3H7P B;  4EUT A;  5G55 A;  4G0N B;  1GJZ A;  2JWZ A;  2A4Z A;  3AXC A;  2RGF A;  3PRM B;  2K6D B;  3NZU A;  3L16 A;  3NHE B;  3HK0 A;  4IUM B;  2MBQ A;  2KTR A;  4IWO A;  4DHJ D;  4TQ0 A;  4GMV A;  2G4S A;  5G2N A;  1EUV B;  2L0T A;  4GXB A;  4JIO U;  4DHJ B;  1G6J A;  2L05 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...