5CHVC

Crystal structure of usp18-isg15 complex
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
153
structure length
153
Chain Sequence
AWDLKVKMLGGNDFLVSVTNSMTVSELKKQIAQKIGVPAFQQRLAHQTAVLQDGLTLSSLGLGPSSTVMLVVQNSSEPLSILVRNERGHSNIYEVFLTQTVDTLKKKVSQREQVHEDQFWLSFEGRPMEDKELLGEYGLKPQCTVIKHLRLRG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Ubl carboxyl-terminal hydrolase 18
publication title Structural basis of the specificity of USP18 toward ISG15.
pubmed doi rcsb
source organism Mus musculus
total genus 34
structure length 153
sequence length 153
chains with identical sequence D
ec nomenclature
pdb deposition date 2015-07-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00240 ubiquitin Ubiquitin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 5chvC02
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 5chvC01
2GBJA 1Y8RC 2KMAA 3K9OB 3KW5B 2DYMA 3DVNU 3L13A 2C60A 4HDOA 2ZZPB 1UBIA 4K7UA 2XK5B 2BYEA 1E7UA 2C7MB 2O6VB 3JSVB 1V5OA 2MBHA 3PREA 3WA0A 1WY8A 3CSTA 4FJZA 4WJNA 4BKSD 2RSUA 4GB9A 2KTRA 4AOFA 3ZNHB 3S2AA 4A3PA 1WGHA 3RUIB 5AZHA 1WIAA 3ENEA 2N9EB 1WI0A 3A9KB 3WAPA 2EMTA 4KDLB 1Z2MA 4A3OA 2M8SA 4G50A 1V86A 4IW0A 5JZEB 2IO2B 2AL6A 2N7EA 5IA7A 3PHXB 2KFKA 4WWOA 3HM3A 2MQJA 5JHBA 2LASA 2KD0A 1SGHA 4IWPA 3WALA 4KIKB 1Q0WB 2LGYA 1ISNA 1WGDA 2RD0A 4M0WB 4XX5A 2C9WB 3RZWC 3H9DA 1H8CA 3A9JA 1YQBA 4KV2A 3L10B 4DK5A 3DVNV 5LLIA 2KDBA 2KQSA 2AYOB 4AJWA 1UZXB 2MA9B 5E6PA 4W9LA 2NBVB 3CMMB 4NJ6A 2LRWA 4JGHB 3V62A 2JPHA 3VTVA 2LXCA 1XQQA 3TBLD 1E8YA 4FHJA 4DDID 5J2RA 3ZNZB 2BKRB 3DBHI 2ZPNA 1S3SG 4GOCA 2KTRB 3R7QA 5D94A 5D2MB 3QC8B 1WX8A 1WZ0A 3H7SA 3KUDB 5TR5A 4MSQB 2EMSA 1WXSA 3GZNI 3VUYA 4F8CB 3UF8A 1U4AA 3APFA 3MHSD 2Z59B 1E7VA 3IFWB 5D6JB 2MX2A 3QJZA 4B9KA 4JL9A 3ML9A 3V6CB 4MELA 4I6PA 4IWOA 4RM9A 4HK2A 5FR6A 4NQLB 4HLEA 2KFKB 1GG3A 2KX3A 2GBNA 2R2QA 3KVFB 2M1MA 4IG7B 4ANWA 2K25A 4KSKC 1EO6A 1V49A 4HJKA 4PYUA 2MP2A 2PPHA 5CHWA 3RD2A 2MCNB 1SE9A 3H6NA 3A9JB 3B1LX 1OEYJ 2REXA 4MGYE 4GN1A 5CTRC 3W1SA 3PVLA 4MJSA 3JVZX 3IHPC 1UGMA 4AUQC 5CHVC 4FN2A 3M3JA 2CHXA 4HCNB 2O2VA 1GUAB 5DPSA 4WWNA 2K6QA 4G11A 1MG8A 2GBRA 4I6LB 4NAWA 4PYZA 4W9FA 3W1SC 1EF1A 4IWQA 2MLBA 3ZVVA 2Y5BB 3UIOB 4HDQA 4DHJD 5DPWA 1J0GA 2MRPA 5CX3A 1OGWA 2IZVB 3QQ8B 4URKA 3PZDA 3WAMA 2JY6A 2IO1B 3AXCA 3KH0A 2JRHA 3RZFA 2NPTB 4EFOA 4OVUA 1UD7A 2KJRA 5G2NA 3ZDMC 2ZPYA 2RPQA 1IPGA 1AARA 4FLHA 3B0AA 4MH0E 2N9XA 4MM3A 2DX5B 3CF6E 3M62B 4JQWC 1S1QB 2KXJA 2QHOA 3IG3A 2AWTA 2DZJA 5IAAC 3VQIA 2C7HA 1FXTB 1L2NA 1XT9B 3UIPB 4KVGB 3L08A 1V80A 1RFAA 1WM2A 1K8RB 3VHTC 3OJ3A 1WGYA 2FCSA 3DPDA 2LGXA 4MJSB 1L7YA 2C7NB 1ZW7A 2NBWB 4BKGA 1RRBA 3VVWB 2G45B 3EECA 4DHZE 1UELA 2O2VB 3BINA 2RR9A 1SIFA 2ZNVC 3M63B 3ONSA 4RM8A 4DHJB 2KN5A 4NAWB 5DPTA 2V3SA 4HVBA 1WM3A 4EKUA 3OLMD 3A1QA 3PHWB 4GDLA 4W9DA 4ZRIA 5J17A 2L8JA 1TBEA 4K7SA 2D2QA 3ZRCA 4NJ7A 4WQOB 1P98A 2IY1B 1TTNA 2KNBA 3PLUA 3N30A 1TGZB 1E5WA 3QHTA 2W9NA 3U7DA 4HXDA 4MGZE 1WGGA 3NOBA 1E8ZA 2IY0B 2K39A 3LJ3A 5DCNA 1LFDA 2HE7A 4FBJB 1WMHA 3DDCB 3ZRFA 1C3TA 1Q1OA 2G3QB 2G4SA 2KK8A 3V60A 4B6WA 2L3ZA 2DAJA 5L95C 1OQYA 2KQ7A 2JRIB 4IM3A 1WXVA 3H7PA 2JXXA 3APDA 2IYDB 3JW0X 1KM7A 3QCAA 1TZ1A 4WJQA 3NZUA 3QK0A 1CMXB 4DHZB 3OAWA 2FCQA 4E71A 3CSFA 2PE6B 3DBSA 3VTWA 3PTFC 4EZJA 5AEKB 2J0KA 4E74A 3RCZA 4BBNF 4F1SA 3ALBA 3R7RA 3R66C 4N9F4 4AWJA 3P2BA 2BWES 3A1QB 2KO3A 4KDIC 3L17A 3TIXA 1YIWA 3UINB 2MW5A 4II3B 4EZLA 2J7QB 2KJ6A 4GDLB 1XD3B 4W9GA 4GMVA 3RULA 2UYZB 1E8WA 1X1MA 3VFKA 2FAZA 4LCDE 3TL5A 3NZSA 2DHZA 4GU2A 1I35A 2C5LC 4FHKA 3U30A 2FNJB 1ZGUB 2L00B 3ZNID 1V2YA 3U8ZA 4TQ1A 3AULA 3N32A 1JRUA 3DQVA 4FA6A 4DWFA 1NBFC 1WX7A 4W9IA 5D7GA 4IC7B 3ZKJC 5G55A 4GSWA 1WMHB 2ASQA 3RT3B 4K7WA 2J0MA 4EUTA 2NR2A 3ZNGC 2KTFA 3H7PB 5JHAA 2KZRA 3PSEB 1R4NI 2HTHA 3EFUA 5AZFA 3I3TB 2D11A 4ICUA 1LM8B 4CYEA 2KOXA 3ZO5B 2WDTB 3V61A 4TV3A 4KSLC 2HD5B 4FJVB 3ZDTA 2L7RA 4DBGA 4PS8A 5E6NA 3NHEB 5KHOA 5LXHA 4FJYA 2K6DB 2LJ5A 2L0FA 4K81A 1VD2A 3TCAA 2EKEC 2BPSA 4RMAA 4BKTA 2JZZA 3DBRI 5E6OA 4CO7A 1WJ4A 2MBOA 2FCNA 2GBKA 1EF5A 3KUZA 2KDIA 2KWUB 3VTUA 2NVUI 3ZUNA 1WJUA 4B95A 2JT4B 3VH3B 4DDGD 2YLMA 2O6VA 4OVVA 2KWVB 1P0RA 2ZCCA 2CHWA 4W9CA 4WWPA 2DYOA 1WRDB 2NCNA 4HPLB 2KMCA 3UQBA 4LJOB 1YJ1A 4XC2A 4BVUC 2NBUA 3V6EB 1T0YA 2CR5A 4I6NB 4WJOA 2MP2B 4GIVA 2K8HA 3EC8A 3PLVA 3ZIMA 1UBQA 2KHWB 1R4MI 5JH5C 2D3GA 2LI5A 1VCBA 4GGQA 2K1FA 2L05A 1V6EA 2I1JA 4TUUA 1EUVB 2N9PC 2IO3B 2MWSB 3HK0A 1LXDA 3PS6A 2LUEA 2MBEA 2KJHB 1WYWB 2JZ3B 2XEWA 2KLCA 1WJ6A 1D3ZA 1J19A 2JUOA 2YVCA 4LDTD 4P7IA 1WJNA 2KLGA 4MGKE 3VDZA 2B3AA 2CHZA 3NY5A 3T8MA 1P9DU 1GNUA 3KYCD 4EEWA 2N1VA 3M95A 3QARA 2KKCA 2PEAA 3KYDD 4A20A 3AI5A 4G0NB 3SDLC 3SU8X 3N3KB 2A4ZA 2GMIC 2ZVNA 2ZVOA 4W9EA 2BWFA 2WX1A 4BKSA 1LQBA 1RAXA 1WZ3A 3BY4B 3PV1A 2DENB 3VXWA 4ZRKA 3X23A 1UH6A 3ML8A 2ZNVB 2ZJDA 3UQAA 2VRRB 3GOEA 5CHFA 3HIZA 1WE6A 2JWZA 4ANUA 4NY0A 2V1YA 1RLFA 2KDEB 1OEYA 2UWQA 3KUCB 5DPRA 4HWIB 2KC1A 4DXAB 4M8NA 4X57B 3L0WB 1BT0A 3QAQA 4KZ0A 5BO4B 3K9PB 2IBIB 4MDKE 1F9JA 5C1ZA 4LDTB 3QX1A 3ZLZA 1YX6B 3EHVA 4ZRJA 1WXMA 2M17A 4EZKA 1Z5SB 3DBLI 4CHKA 4FADA 1V81A 3QWZB 4EOYA 1A5RA 2L0TA 1IP9A 4HCPB 4NNJB 2AEHA 3DVGY 3TJPA 3PRMB 5LXIB 5AZGA 3DVGX 3ECIA 5HKHA 4FULA 1QZEA 2LVPA 2LWPA 1ZKHA 2KX0A 3R3MA 2DAFA 1V5TA 3IVFA 4GXBA 1Q5WB 2NS5A 2M0XA 2JF5A 3PPAA 4IM0A 2PE9A 1WGRA 3L16A 1IYFA 2KC2A 3MJWA 4JLCA 3VH4B 4GDKA 4ANXA 1E90A 1YX5B 4ICVA 2AL3A 1I42A 2N7DA 4W9KA 4MGIE 3VUWA 5KHQA 2IO0B 1WX9A 2G4DB 1WXAA 4M8MA 4TQ0A 2BF8B 1WR1A 3MTNB 3RYTA 3SHQA 3WAOA 2KFJA 1H4RA 3DOWA 4PS7A 2BKFA 2KANA 2N1WA 2NPTA 3PT2B 3IBEA 4ZYNA 1G6JA 2LZ6A 2BYVE 4HPMB 2FCMA 4MEMA 1GJZA 2KWCA 3HM6X 1WE7A 2CKHB 3OJ4B 5C23A 2WYQA 3AU4A 4LJPB 3X0WA 2N4FA 4BOZB 1OTRB 2MBQA 1HE8A 2J0JA 3D32A 4PS3A 4TKNA 1PQSA 3Q3JA 2JVCA 4KZCA 1E8XA 1M94A 3TMPB 2PJHA 2LD9A 3PGEA 1WR6E 3H1UA 2OOBB 2K8CA 4II2B 5L83A 3PRZA 1WH3A 3ZTDA 2FIDA 3WANA 4AJYB 1WFYA 2FUHB 2GBMA 1P3QU 2CS4A 4NQKE 2ZCBA 3UGBB 4JIOU 1V9JA 2KVRA 2XBBC 2L76A 2FIFA 4W9HA 2A5UA 5GMVA 4W9JA 3LDZE 3WIMA 1C1YB 2BGFA 2XK5A 3A4RA 3JSVA 4BBNC 2DZIA 4GDKB 3L54A 3ZTCA 1GC7A 2LXAA 3A4SC 2O6VD 1NDDA 4IM2A 3QA8A 1KOTA 3DCGA 2DYBA 5J18A 2DZKA 4WAAA 3JYUA 1KLVA 3C0RB 3O65B 4YL8A 2Z0DB 3A9KA 4G3XB 4BOSC 2D10A 3HHMA 4ASWC 2DZMA 2HJ8A 2RGFA 4WJPA 1P1AA 2CU1A 2MSED 1KJTA 4IUMB 4ZDVA 3A33B 4XZ4A 2K8BA 2LRUA 2KDFB 3NS8A 3W1YA 4ANVA 2I1KA 2MBBB 3AU5A 1WF9A 4F7ZA 4MSMB 2M4NA 3PRPB 4AP4C 3B08A 2GOWA 2D07B 2LGDA 1J8CA 3T9LA 4KIKA 5EDSA 2LVQA 4J6IA 3VAWA 2WWZA 2BYFA 2LVOA 1YD8U 3Q3FA 3VUXA 1NI2A 2OJRA 2Z0EB 3ZW3A 3APCA 2V4LA 2WX0A 2R2OA 4K1RB 4BFRA 1GC6A 3SD5A 4E3CA 2ZEQA 4NPNA 3QIJA
chains in the Genus database with same CATH superfamily
2GBJA 3KW5B 4WWMA 2C60A 3MC8A 3ABVB 1E7UA 1FXAA 4FJZA 2RSUA 3ZNHB 5G5GA 5AZHA 3GP7A 4PK1A 2N9EB 1F1HA 2IJ0A 2LJIA 2JSVX 2AL6A 3PHXB 2VZKB 4WWOA 5JHBA 4XWTA 2WDVB 4HKZE 3NVYA 2PKOA 3RZWC 1ZUD2 1FMAD 1YQBA 4JE3B 1FEHA 3I5JC 5LLIA 2EKIA 5FK9C 3C8YA 2NBVB 1D5ZC 4NJ6A 2QEJC 4RF0A 2JPHA 1WRIA 2QCZA 2LXCA 1B1ZA 4GLSC 1UNSA 5D94A 2V3NA 3B9JA 1WZ0A 3H7SA 4P16A 2BT6A 1RYJA 2Z59B 3IFWB 1HZ6A 4JL9A 1YJIA 4TMAB 3V6CB 4I6PA 4IWOA 4RM9A 1QILA 1UGJA 2BW2A 2M1MA 1AW7A 2MP2A 3LB8C 5CHWA 3W2DA 1N6ZA 3B1LX 1OEYJ 2REXA 4MGYE 5CTRC 3PVLA 4AQ7A 1JROA 2LGIA 4AUQC 3CIRB 4FN2A 2CHXA 4ZHPA 4NAWA 4PYZA 4IWQA 2MLBA 3ZVVA 2WXQA 4DXFA 1IBXA 2IZVB 4EFOA 2K9XA 2BTEA 1UD7A 2KJRA 5G2NA 3ZDMC 1AARA 4FLHA 3B0AA 1RFKA 1EWYC 1JWAD 3Q8EA 5EE3A 1JWBD 3IG3A 2DZJA 3I9V1 4UDUC 5IAAC 1L2NA 1E0ZA 2W82A 1V80A 4K3BA 3VHTC 3OJ3A 1WGYA 2FCSA 2LGXA 2C7NB 1ZW7A 2WXPA 3ZJUA 2G45B 3BINA 3U2SC 2RR9A 3IT6B 4NAWB 4EKUA 3PHWB 3Q69A 3E9SA 3PO0A 5J17A 1IBXB 2LMCA 1ROEA 2B76B 1SIJA 4WURA 4LNFA 4MGZE 2K39A 3LJ3A 3HRDD 1VLBA 2D3BA 2HE7A 4FBJB 1Q1OA 1JCKB 2KQ7A 3H8HA 4AS1A 3JW0X 1CMXB 1QLBB 4HROA 3VTWA 3PTFC 3P2BA 1TY2A 1WWTA 2KO3A 3L17A 3TEYA 1TJEA 2M0AA 2SAKA 1I35A 1XF5L 3AE6B 4FHKA 3U30A 1E6EB 2FNJB 2DWQA 2L00B 4XYCA 1L0YB 1D4BA 3U8ZA 4K3CA 3DBHB 4TQ1A 3AULA 4C4VB 4FA6A 5D7GA 5G55A 4GSWA 2ASQA 1TKEA 2NR2A 1K50A 4REZA 4HJGE 3PSEB 3P4RB 2D11A 3SFEB 3LYYA 2UU7A 2HD5B 3ZDTA 5HI1A 1T5XD 4PS8A 1PGAA 5LXHA 4FJYA 2L0FA 4K81A 1VD2A 5E6OA 2N0SB 1JWMD 1ACCA 1EF5A 2JX5A 2KDIA 3VTUA 3ZUNA 1WJUA 4B95A 2JT4B 4DDGD 2YLMA 2O6VA 4OVVA 4W9CA 4WWPA 2KMCA 3FILA 3UQBA 4JPSA 1TKYA 2KAJA 2K8HA 2W3SA 3EC8A 2LI5A 1VCBA 2LEKA 1MI0A 4HKQA 2I1JA 3RNAC 1EUVB 2N9PC 2WXFA 2IO3B 1M4VA 3NJTA 3PS6A 2PMVA 2LUEA 2KJHB 3ZJTA 4US9A 1SJHD 2KLCA 1TS2A 4ARCA 1D3ZA 4LDTD 1WJNA 3V05A 4J3OD 4MGKE 3VDZA 2B3AA 1F0ZA 1FCCC 4XE0A 3RMKC 2V0GA 3HVZA 4A20A 3AI5A 4G0NB 1SF0A 3N3KB 4DXGA 2BWFA 1LQBA 1KTKA 1WZ3A 1UH6A 3UQAA 3GOEA 4NY0A 3N20C 1RLFA 4ARIA 3EGRA 1BT0A 5BO4B 4B0MA 4MDKE 2IBIB 5C1ZA 4LDTB 3ZLZA 3NVZA 1ZPSA 2LHEA 2GRIA 1V81A 5BYSA 3NZ3A 3RNGC 3DVGY 3TJPA 2FBWB 3RPFC 1VRAB 5I4DA 1SE3A 1XLQA 2INPE 3IVFA 4GXBA 1Q5WB 2NS5A 1OFFA 3PPAA 3AM9A 3R8BA 1E90A 2AL3A 1I42A 3U7ZA 2IO0B 2INCC 3MTNB 1C4AA 1TT5B 4M01A 1XO3A 2KFJA 2WXHA 3PT2B 1G6JA 1L4DB 4C7YA 3IBEA 5BYRA 3HM6X 1TS5A 4ACFA 2N7JA 3TEWA 4PS3A 4KZCA 2VH2A 2H88B 3RNBC 2AX5A 5L83A 3PRZA 3WANA 2H89B 2FUHB 2GBMA 2WP9B 4OHJA 1I4QA 2G9HD 2KVRA 2XBBC 1F52A 2A5UA 5GMVA 3AN1A 3JSVA 4BBNC 3ZTCA 1GC7A 2K0PA 4A8XC 3Q8CA 2IGDA 2RDGA 2DYBA 3C0RB 4YL8A 3P4PB 1C4CA 3A9KA 1K51A 4BOSC 2RGFA 4WJPA 4EE2A 2MSED 1KJTA 3Q3OC 3Q3MC 4ZDVA 4XZ4A 1YQ4B 2LRUA 4BAXA 2I1KA 1R4MB 1WF9A 4F7ZA 1XCTL 4AP4C 3PRPB 3T9LA 4KIKA 3B2GA 1GOZA 3Q3FA 3VUXA 4JWUC 2W55A 2V4LA 4K1RB 1IP9A 3VR8B 3DVNU 2ZZPB 1L6VA 3JSVB 5HG2A 1V5OA 4HPPA 4WJNA 1SEBD 2FE8A 4BKSD 3P4SB 2KTRA 4AOFA 1DOXA 2XNAC 3S2AA 3TEZA 2RDHA 2WXKA 2I38A 2MH7A 3A9KB 2JYTA 2EMTA 2JU6X 4G50A 2ONQA 4IW0A 2LHDA 2IO2B 2N7EA 3MC9A 4KKJA 1C4PA 2LASA 1A70A 4IWPA 4KIKB 4M02A 1Q0WB 4R3DA 1ISNA 1AWDA 2RD0A 1EM7A 4XX5A 3H9DA 3A9JA 4DK5A 2AYOB 2MA9B 5E6PA 2CU3A 4W9LA 2LRWA 4JGHB 2HTME 3BYYB 3V62A 3VTVA 5T8IA 3TBLD 2V3PA 4DDID 3C19A 2BKRB 1L6UA 4GOCA 1S3SG 2KTRB 3RN9C 1WX8A 3VUYA 4MSQB 3GZNI 1FIQA 3APFA 4XDDA 5EE0A 1E7VA 4B9KA 1ZXIA 1OQRA 5BMGA 2J42A 1BUIC 4HK2A 4OZBA 1WXQA 2KX3A 2GBNA 4YSYB 1HXYD 4ANWA 3ETRA 4PYUA 3H6NA 3A9JB 2ZW1A 3OG5A 3W1SA 3CWIA 3JVZX 3IHPC 1UGMA 5CHVC 3M3JA 4HCNB 2W54A 2O2VA 1FD6A 2K6QA 4G11A 4I6LB 4W9FA 3VRAB 2ON8A 1EF1A 1C79A 2INDC 4L23A 1N5XA 2Y5BB 3UIOB 4HDQA 5DPWA 1YOVB 4P1CC 1OGWA 1FNUA 1NI3A 3TUOA 1V1OA 2NPTB 1IPGA 3NS1A 2N9XA 1V1PA 4JQWC 2PW9A 1S1QB 2JXTA 5FKAC 3E56A 2BS2B 3VQIA 2C7HA 1FXTB 1XT9B 1YN3A 3UIPB 1L7YA 3VVWB 3EECA 2O2VB 3DHGC 2WU2B 3DWMA 2AQ2B 3GE3C 5DPTA 4WQMA 3Q2AC 4GDLA 2CJOA 2CJNA 1TKGA 1PDXA 4K7SA 2D2QA 2KDMA 1T0RC 2WLBA 2IY1B 2BQQA 2WXGA 5H8YE 1TGZB 3EA6A 3QHTA 2W9NA 4JWSC 1WGGA 3NOBA 3MC0B 1E8ZA 1JRPA 5DCNA 1V1PB 1NENB 1WMHA 3DDCB 2G4SA 2KK8A 4B6WA 2L3ZA 3AE7B 4MH8A 2PLPA 1TZ1A 4WJQA 4C56C 2QDFA 1MG4A 3IT4B 3OAWA 2FCQA 4E71A 3CSFA 2PE6B 3DBSA 5AEKB 4BBNF 3R66C 1YNTE 4N9F4 5EDSA 2K22A 4EZLA 2KJ6A 4GDLB 4P6VF 1C9FA 4W9GA 3RULA 2UYZB 3VFKA 4LCDE 2L32A 2IGGA 3NZSA 2DHZA 2WXJA 2C5LC 3Q8AA 1EWCA 1NBFC 4W9IA 2HJ1A 3ZKJC 1WMHB 4K7WA 2J0MA 3TEXA 1F2RI 4QAYA 2KTFA 4L1BA 5MPOA 2WS3B 5AZFA 4ICUA 2M19A 2KOXA 3N1XC 2WXIA 3U4EG 3ZO5B 3VRBB 4DBGA 1PGXA 5KHOA 1STEA 1QF6A 5HFYA 1FO4A 2LJ5A 3TCAA 2BPSA 3J9CA 3O13A 4RMAA 3DBRI 4CO7A 2MBOA 2GBKA 1FFVA 2J4XA 3KUZA 4XWWA 2KWUB 4B0EA 1SB3C 3VH3B 1GPXA 2KWVB 1P0RA 1UF0A 2CHWA 2DNFA 2NCNA 1PFDA 1XLNA 2NBUA 3V6EB 3ZGZA 4WJOA 2MP2B 3FC4A 5JH5C 4YSXB 3BYTB 1SE2A 3KLSX 4TUUA 2Y3AA 1I4XA 1JALA 2MWSB 1LXDA 3NRZA 1T6BX 1J19A 2ACZB 1B9RA 2KLGA 3PZ7A 4A9AA 2CHZA 2PVOD 3KYCD 2N1VA 3M95A 3QARA 2KKCA 3KYDD 3AEFB 4RCOA 2A4ZA 2GMIC 2ZVOA 4W9EA 2AQ1B 1RAXA 3BY4B 2DENB 3VXWA 2JWUA 3DWGC 3X23A 5TSSA 1D5MC 4LNNA 1QOFA 2ZJDA 3P4QB 1WE6A 2JWZA 5JXVA 4DXAB 3KUCB 5DPRA 1F77A 2KC1A 4HWIB 3AMZA 4M8NA 1MHXA 4LNOA 3EHVA 1WXMA 2IGHA 2M17A 1PYWD 1Z5SB 3DBLI 2RDBC 3DHIC 3QWZB 1A5RA 2L0TA 4HCPB 3N9YC 5LXIB 3PRMB 4RF1A 3ECIA 1HQRD 1ZKHA 3R3MA 4FXCA 2M0XA 2BS3B 1IYFA 2KC2A 4GDKA 4W9KA 2M56B 5KHQA 2R61A 4M8MA 4RGOS 2BF8B 1WR1A 3BVZA 5BYQA 3WAOA 3AEEB 2WNMA 2N1WA 4ZYNA 2MJ3A 2LZ6A 2BYVE 4S17A 1E10A 3AU4A 3X0WA 4YXDB 2MBQA 1YMHE 1HE8A 1TS4A 1MVKA 3D32A 1PUTA 3Q3JA 1M94A 3TMPB 1WR6E 2K8CA 4AJYB 1KFYB 2WXNA 1WFYA 2CS4A 3UGBB 2ZCBA 1V9JA 1IGCA 1RWSA 2FIFA 2Y5CA 1BXTA 3WIMA 1VDVA 2BGFA 3Q3NC 1HTOA 4GDKB 3L54A 4WH4A 1L0VB 1TY0A 2O6VD 1NDDA 3AEDB 3HVDA 1KOTA 1SXTA 1C78A 2KN4A 2DZKA 1KLVA 1T0QC 5BMIA 2DZMA 2HJ8A 1P1AA 2CU1A 2BVCA 2K8BA 3W1YA 3NS8A 4ANVA 3ZYYX 3AEBB 3GB1A 4MSMB 3B08A 1YJJA 2D07B 2LGDA 2KQ4X 1J8CA 2LVQA 2WWZA 3BVGA 1YD8U 4RFBA 2OJRA 3ZW3A 3APCA 4RGNA 4E3CA 5IKCM 2KMAA 3K9OB 2DYMA 1FFUA 2C7MB 2O6VB 3PREA 1WY8A 3CSTA 3FILB 4N58A 1WGHA 3RUIB 2PVGC 3Q8BA 3ENEA 2KT7A 3WAPA 2J52A 3SEBA 4ZRPA 1Z2MA 2M8SA 5JZEB 5E6JA 2KFKA 4WIPA 4A6QA 3HM3A 4RGTA 1ET6A 2KD0A 3WALA 2LGYA 1WGDA 2C9WB 1H8CA 4KV2A 2QIEB 4AJWA 2KDBA 1UZXB 3CMMB 2MJEA 3TSSA 1XQQA 1QQRA 4H2AA 1KH0A 1IUEA 3ZNZB 3R7QA 4OVZA 1SBBB 3BVMA 3W5VB 5D2MB 2LFIA 3QC8B 5TR5A 2KMMA 4F8CB 1U4AA 5D6JB 1MPEA 3QJZA 1I4GA 5FR6A 4NQLB 4HLEA 4XGAB 2KFKB 2R2QA 3KVFB 2K25A 4KSKC 1EO6A 2OHFA 1EU3A 1ESFA 4S0RA 4HEA1 2PPHA 1XEEA 3RD2A 2LUMA 1SE9A 1UUPA 1D6EC 2WXRA 1N61A 1SJED 2GBRA 2YEPF 3V3XA 4A55A 3ZXVA 1J0GA 5AUIA 4DHJD 1I4HA 2MRPA 5HHDG 2G1EA 1MJDA 3QQ8B 3KH0A 1LO5D 4OVUA 3Q6BA 2ZPYA 3BK2A 4D2KA 4TSSA 3IXSA 1KLUD 2KWDA 3M62B 2QHOA 2KXJA 1FCLA 1MFWA 2QJLA 3NUHB 4KVGB 3L08A 3DPDA 3AE1B 2NBWB 1QKZA 3M63B 4RM8A 3ONSA 3HUIA 2L83A 2KN5A 4DHJB 4HVBA 1WM3A 3A1QA 4MACA 1ZDXA 4W9DA 4ZRIA 1TBEA 3MP9A 3ZRCA 4C00A 4WQOB 2KNBA 3PLUA 1NEKB 1CJEA 1HTQA 2IY0B 4O1NA 1NVID 3FKYA 1C3TA 2G3QB 2KVZA 3V60A 5L95C 1OQYA 3RNCC 3Q14C 2JXXA 3APDA 3QCAA 3AE3B 3NZUA 4MT5A 3MJ5A 4EZJA 1HZ5A 4E74A 2BB5A 4F1SA 3ALBA 3R7RA 4AWJA 3A1QB 3TIXA 3UINB 4KDIC 1YIWA 2MW5A 4II3B 2J7QB 3P42A 2BB6A 5D3DA 3IAS1 2FAZA 2Q5WD 2WDQB 5FR3A 1KRHA 1ZGUB 3ZNID 1V2YA 1WYGA 3N32A 3DQVA 3I63C 3BWUD 5C3JB 3GZNB 4KX6B 4IC7B 3RT3B 2NTTA 4EUTA 5JHAA 4XDCA 5IOIA 4N6EB 3EFCA 2MJDA 3I57A 5H92C 2WDTB 4N59A 4TV3A 4KSLC 4FJVB 4YTMB 2WXMA 3NHEB 3AE4B 3GS2A 1XCQL 2EKEC 4BKTA 2BYTA 4JX1C 4LNIA 1C76A 2N9KA 2DYOA 1WRDB 3OWEB 4PT5A 1YJ1A 4XC2A 1T0YA 2CR5A 4I6NB 4A90A 2V9HA 1I4RA 3ZIMA 1UBQA 1DYQA 1V6EA 1TZOA 3HK0A 3KWVA 1TS3A 4CQNA 2XEWA 1L0XB 2JUOA 2YVCA 3BIID 3RI7C 4RNAA 3LXFA 3NY5A 1P9DU 1GNUA 1RM6C 2QILA 1TYGB 3RFZB 2KYWA 2PEAA 1OQQA 4ZYSA 3SDLC 2KACA 2X8XX 4LTUA 2WXOA 3PV1A 2JQRB 4ZRKA 3ML8A 2ZNVB 2VRRB 5CHFA 3HIZA 1P7FA 4YTPB 2V1YA 1OEYA 2UWQA 2L52A 3SFDB 4X57B 3W5UB 2Y5PA 3QAQA 4KZ0A 1WSPA 4ZRJA 4P1BC 5BMHA 4EZKA 4Q2JA 4CHKA 3L4PA 4FADA 4EOYA 2WGSA 4NNJB 5LNK1 3AV8A 3DVGX 5HKHA 4USAA 4FULA 2LWPA 2DAFA 2JF5A 1QOBA 4IM0A 1EU4A 1WGRA 3L16A 1QOGA 4LLGM 4JLCA 4ANXA 1YX5B 1UWMA 3AE5B 4HRSA 2G4DB 4TQ0A 1E9MA 3RYTA 3SHQA 4BZAA 2TSSA 1H4RA 3DOWA 3ZQ4A 4PS7A 2BKFA 2KANA 1GB4A 2FCMA 4MEMA 3OJ4B 5C23A 4LJPB 4BOZB 2N4FA 3R2IA 1OTRB 4US8A 1HEZE 4TKNA 1PQSA 1I4PA 2JVCA 1E8XA 5IO9A 4IDIA 1R7SA 2PJHA 3PGEA 2EELA 3H1UA 2BS4B 2OOBB 3ZTDA 1WH3A 3MHZA 1WGKA 1P3QU 4NQKE 1MHHE 4JIOU 2QMTA 2LGSA 2L76A 4W9HA 4W9JA 5GXGB 2XK5A 2DZIA 3N1YC 2PIAA 2I2YA 2V4IB 3DBRB 3QA8A 1GB1A 1YN4A 4WAAA 3JYUA 5D3IB 2X38A 2Z0DB 2DBYA 2D10A 2JZPA 4ASWC 2RPVA 4IUMB 3A33B 2NTSA 1N5WA 2M4NA 1YQ3B 2GOWA 3SR6A 4M0WA 1FRDA 3VAWA 1K52A 2LVOA 4ZOHC 2WX0A 3WCQA 4BFRA 3SD5A 4NPNA 3QIJA 1I7HA 1QOAA 3GE8C 1Y8RC 3L13A 4HDOA 4NJ7A 4K7UA 3WAMA 1UBIA 2XK5B 2BYEA 3AH7A 3WA0A 2MBHA 1GAQB 4GB9A 3ZXRA 4C7ZA 1ET9A 4A3PA 4YT0B 1WIAA 1WI0A 4NAMA 4KDLB 3U52E 4A3OA 3B2FA 1V86A 1V8CA 3AE9B 4C4VA 3T3NA 2FUG1 5IA7A 1FPYA 5G5HA 3AEAB 2MQJA 1DGJA 3AB5A 1SGHA 4OW0A 3KWLA 4M0WB 3KQ4A 1VR9A 3L10B 1E7PB 3DVNV 2KQSA 2L1AA 2ZW0A 2N9LA 3DBLB 1E8YA 4FHJA 1JQ4A 5J2RA 3DBHI 1SSNA 2ZPNA 3KUDB 2EMSA 1WXSA 3W9CB 4LNKA 3UF8A 3MHSD 4NJCA 2MX2A 3ML9A 4KGSA 1V97A 2W3RA 4MELA 1GG3A 4IG7B 1V49A 4HJKA 2MCNB 2K3UA 4GN1A 4MJSA 2WXLA 3MFGA 1Q10A 1P7EA 3PZ8A 1GUAB 5DPSA 4WWNA 1MG8A 3W1SC 1K53A 1FRRA 1T3QA 5CX3A 3IAM1 4ZHOA 4URKA 3PZDA 2IO1B 2JY6A 3AXCA 4IKGA 2JRHA 3RZFA 2RPQA 5IN7A 4KGRA 1CZPA 1ZP0B 2D3CA 1HA5A 3BK1A 4MH0E 4YTNB 4MM3A 2DX5B 1AN8A 3CF6E 2AWTA 4L2YA 1ZXHA 3EUB2 1RFAA 1WM2A 1L5PA 1K8RB 4IOIE 3BZDB 4M00A 4MJSB 2OJWA 4BKGA 1RRBA 4DHZE 1UELA 1SIFA 1TIFA 2ZNVC 2WQYB 2V3SA 3OLMD 4YWGG 2QSDA 2L8JA 4RH6A 5EE9A 1J7CA 1P98A 1TTNA 3N30A 1E5WA 3U7DA 4HXDA 1XXGA 1LFDA 2D5GA 4MM3B 1N62A 3ZRFA 2DAJA 4LK0M 2JRIB 4IM3A 1WXVA 3H7PA 3ZJVA 2IYDB 1KM7A 3QK0A 4DHZB 3AE2B 2J0KA 4ITKA 3Q8FA 3RCZA 1J7BA 2BWES 1D5XC 1ZE3D 4OZAA 1XD3B 4GMVA 2BBCA 2MEKA 1E8WA 1F2RC 1X1MA 3TL5A 4GU2A 1XLOA 1Y56A 1JRUA 4DWFA 3R2TA 1WX7A 4DQOC 1VZ7A 2J53A 1CQVA 3ZNGC 3VR9B 3H7PB 2KZRA 5EE1A 3FAHA 4ZRQA 1R4NI 2HTHA 3EFUA 1VJKA 1N63A 3I3TB 1QT9A 1LM8B 4CYEA 4YSZB 3V61A 2L7RA 1LGRA 5E6NA 1R4NB 1KLGD 2K6DB 3AE8B 1ZOYB 1YN5A 2JZZA 2VH1A 1WJ4A 2FCNA 1FM0D 2NVUI 1UWXA 1KF6B 4C80A 2ZCCA 1VZ8A 4HPLB 4LJOB 4BVUC 4GIVA 1AYFA 3PLVA 2KHWB 1R4MI 2AQ3B 2D3GA 4GGQA 2K1FA 2L05A 1JWUD 3UI3A 2MBEA 3T3OA 1PGBA 1WYWB 2JZ3B 4KGTA 2WDRB 3RNEC 1WJ6A 1ZDVA 1CK1A 4P7IA 2GLSA 1L4ZB 3T8MA 5AUKA 4EEWA 2WU5B 4RGMA 5IP4D 3SU8X 4BKSA 2ZVNA 2MHJA 2WX1A 1DOYA 1DOIA 4OZCA 2INNE 4ANUA 2IPKD 2KDEB 2GB1A 1T0SC 3L0WB 2QC8A 2ICIA 2PTLA 2D3AA 3K9PB 1F9JA 3QX1A 1YX6B 3RNFC 1IGDA 2AEHA 5AZGA 2YEPB 1QZEA 2LVPA 2KX0A 1V5TA 4NZLB 2PE9A 3MJWA 3VH4B 3P63A 4ICVA 2N7DA 1BMLC 4MGIE 1FNWA 4KKIA 3VUWA 1WX9A 3AECB 1WXAA 2IDYA 2RMMA 2HDEA 1ENFA 3NVVA 1FNVA 2NPTA 4HPMB 4WAFA 1GJZA 2KWCA 1WE7A 2CKHB 2GI9A 1NYQA 2WYQA 1NYRA 2J0JA 2E6XA 1JMLA 1N60A 2JYEA 3NVWA 2LD9A 4II2B 2NMQA 5C2TB 2FIDA 2E3TA 2DLBA 3LDZE 1JWSD 3P1MA 2Z8LA 1C1YB 3A4RA 1VZ6A 1JW9D 2LXAA 3A4SC 4IM2A 3N1ZC 3DCGA 5J18A 3DHHC 3AEGB 3O65B 4G3XB 2K5PA 1SE4A 3HHMA 2SEBD 1C77A 2WHIA 2KDFB 2MBBB 2XN9C 3AU5A 1XLPA 2VZKD 4J6IA 2BYFA 1NI2A 3NG0A 2Z0EB 1FXIA 3URYA 2R2OA 1GC6A 2ZEQA 2OEDA 1J7AA
chains in the Genus database with same CATH topology
2GBJA 1Y8RC 2KMAA 3K9OB 3KW5B 2DYMA 3DVNU 3L13A 2C60A 4HDOA 2ZZPB 1UBIA 4K7UA 2XK5B 2BYEA 1E7UA 2C7MB 2O6VB 3JSVB 1V5OA 2MBHA 3PREA 3WA0A 1WY8A 3CSTA 4FJZA 4WJNA 4BKSD 2RSUA 4GB9A 2KTRA 4AOFA 3ZNHB 3S2AA 4A3PA 1WGHA 3RUIB 5AZHA 1WIAA 3ENEA 2N9EB 1WI0A 3A9KB 3WAPA 2EMTA 4KDLB 1Z2MA 4A3OA 2M8SA 4G50A 1V86A 4IW0A 5JZEB 2IO2B 2AL6A 2N7EA 5IA7A 3PHXB 2KFKA 4WWOA 3HM3A 2MQJA 5JHBA 2LASA 2KD0A 1SGHA 4IWPA 3WALA 4KIKB 1Q0WB 2LGYA 1ISNA 1WGDA 2RD0A 4M0WB 4XX5A 2C9WB 3RZWC 3H9DA 1H8CA 3A9JA 1YQBA 4KV2A 3L10B 4DK5A 3DVNV 5LLIA 2KDBA 2KQSA 2AYOB 4AJWA 1UZXB 2MA9B 5E6PA 4W9LA 2NBVB 3CMMB 4NJ6A 2LRWA 4JGHB 3V62A 2JPHA 3VTVA 2LXCA 1XQQA 3TBLD 1E8YA 4FHJA 4DDID 5J2RA 3ZNZB 2BKRB 3DBHI 2ZPNA 1S3SG 4GOCA 2KTRB 3R7QA 5D94A 5D2MB 3QC8B 1WX8A 1WZ0A 3H7SA 3KUDB 5TR5A 4MSQB 2EMSA 1WXSA 3GZNI 3VUYA 4F8CB 3UF8A 1U4AA 3APFA 3MHSD 2Z59B 1E7VA 3IFWB 5D6JB 2MX2A 3QJZA 4B9KA 4JL9A 3ML9A 3V6CB 4MELA 4I6PA 4IWOA 4RM9A 4HK2A 5FR6A 4NQLB 4HLEA 2KFKB 1GG3A 2KX3A 2GBNA 2R2QA 3KVFB 2M1MA 4IG7B 4ANWA 2K25A 4KSKC 1EO6A 1V49A 4HJKA 4PYUA 2MP2A 2PPHA 5CHWA 3RD2A 2MCNB 1SE9A 3H6NA 3A9JB 3B1LX 1OEYJ 2REXA 4MGYE 4GN1A 5CTRC 3W1SA 3PVLA 4MJSA 3JVZX 3IHPC 1UGMA 4AUQC 5CHVC 4FN2A 3M3JA 2CHXA 4HCNB 2O2VA 1GUAB 5DPSA 4WWNA 2K6QA 4G11A 1MG8A 2GBRA 4I6LB 4NAWA 4PYZA 4W9FA 3W1SC 1EF1A 4IWQA 2MLBA 3ZVVA 2Y5BB 3UIOB 4HDQA 4DHJD 5DPWA 1J0GA 2MRPA 5CX3A 1OGWA 2IZVB 3QQ8B 4URKA 3PZDA 3WAMA 2JY6A 2IO1B 3AXCA 3KH0A 2JRHA 3RZFA 2NPTB 4EFOA 4OVUA 1UD7A 2KJRA 5G2NA 3ZDMC 2ZPYA 2RPQA 1IPGA 1AARA 4FLHA 3B0AA 4MH0E 2N9XA 4MM3A 2DX5B 3CF6E 3M62B 4JQWC 1S1QB 2KXJA 2QHOA 3IG3A 2AWTA 2DZJA 5IAAC 3VQIA 2C7HA 1FXTB 1L2NA 1XT9B 3UIPB 4KVGB 3L08A 1V80A 1RFAA 1WM2A 1K8RB 3VHTC 3OJ3A 1WGYA 2FCSA 3DPDA 2LGXA 4MJSB 1L7YA 2C7NB 1ZW7A 2NBWB 4BKGA 1RRBA 3VVWB 2G45B 3EECA 4DHZE 1UELA 2O2VB 3BINA 2RR9A 1SIFA 2ZNVC 3M63B 3ONSA 4RM8A 4DHJB 2KN5A 4NAWB 5DPTA 2V3SA 4HVBA 1WM3A 4EKUA 3OLMD 3A1QA 3PHWB 4GDLA 4W9DA 4ZRIA 5J17A 2L8JA 1TBEA 4K7SA 2D2QA 3ZRCA 4NJ7A 4WQOB 1P98A 2IY1B 1TTNA 2KNBA 3PLUA 3N30A 1TGZB 1E5WA 3QHTA 2W9NA 3U7DA 4HXDA 4MGZE 1WGGA 3NOBA 1E8ZA 2IY0B 2K39A 3LJ3A 5DCNA 1LFDA 2HE7A 4FBJB 1WMHA 3DDCB 3ZRFA 1C3TA 1Q1OA 2G3QB 2G4SA 2KK8A 3V60A 4B6WA 2L3ZA 2DAJA 5L95C 1OQYA 2KQ7A 2JRIB 4IM3A 1WXVA 3H7PA 2JXXA 3APDA 2IYDB 3JW0X 1KM7A 3QCAA 1TZ1A 4WJQA 3NZUA 3QK0A 1CMXB 4DHZB 3OAWA 2FCQA 4E71A 3CSFA 2PE6B 3DBSA 3VTWA 3PTFC 4EZJA 5AEKB 2J0KA 4E74A 3RCZA 4BBNF 4F1SA 3ALBA 3R7RA 3R66C 4N9F4 4AWJA 3P2BA 2BWES 3A1QB 2KO3A 4KDIC 3L17A 3TIXA 1YIWA 3UINB 2MW5A 4II3B 4EZLA 2J7QB 2KJ6A 4GDLB 1XD3B 4W9GA 4GMVA 3RULA 2UYZB 1E8WA 1X1MA 3VFKA 2FAZA 4LCDE 3TL5A 3NZSA 2DHZA 4GU2A 1I35A 2C5LC 4FHKA 3U30A 2FNJB 1ZGUB 2L00B 3ZNID 1V2YA 3U8ZA 4TQ1A 3AULA 3N32A 1JRUA 3DQVA 4FA6A 4DWFA 1NBFC 1WX7A 4W9IA 5D7GA 4IC7B 3ZKJC 5G55A 4GSWA 1WMHB 2ASQA 3RT3B 4K7WA 2J0MA 4EUTA 2NR2A 3ZNGC 2KTFA 3H7PB 5JHAA 2KZRA 3PSEB 1R4NI 2HTHA 3EFUA 5AZFA 3I3TB 2D11A 4ICUA 1LM8B 4CYEA 2KOXA 3ZO5B 2WDTB 3V61A 4TV3A 4KSLC 2HD5B 4FJVB 3ZDTA 2L7RA 4DBGA 4PS8A 5E6NA 3NHEB 5KHOA 5LXHA 4FJYA 2K6DB 2LJ5A 2L0FA 4K81A 1VD2A 3TCAA 2EKEC 2BPSA 4RMAA 4BKTA 2JZZA 3DBRI 5E6OA 4CO7A 1WJ4A 2MBOA 2FCNA 2GBKA 1EF5A 3KUZA 2KDIA 2KWUB 3VTUA 2NVUI 3ZUNA 1WJUA 4B95A 2JT4B 3VH3B 4DDGD 2YLMA 2O6VA 4OVVA 2KWVB 1P0RA 2ZCCA 2CHWA 4W9CA 4WWPA 2DYOA 1WRDB 2NCNA 4HPLB 2KMCA 3UQBA 4LJOB 1YJ1A 4XC2A 4BVUC 2NBUA 3V6EB 1T0YA 2CR5A 4I6NB 4WJOA 2MP2B 4GIVA 2K8HA 3EC8A 3PLVA 3ZIMA 1UBQA 2KHWB 1R4MI 5JH5C 2D3GA 2LI5A 1VCBA 4GGQA 2K1FA 2L05A 1V6EA 2I1JA 4TUUA 1EUVB 2N9PC 2IO3B 2MWSB 3HK0A 1LXDA 3PS6A 2LUEA 2MBEA 2KJHB 1WYWB 2JZ3B 2XEWA 2KLCA 1WJ6A 1D3ZA 1J19A 2JUOA 2YVCA 4LDTD 4P7IA 1WJNA 2KLGA 4MGKE 3VDZA 2B3AA 2CHZA 3NY5A 3T8MA 1P9DU 1GNUA 3KYCD 4EEWA 2N1VA 3M95A 3QARA 2KKCA 2PEAA 3KYDD 4A20A 3AI5A 4G0NB 3SDLC 3SU8X 3N3KB 2A4ZA 2GMIC 2ZVNA 2ZVOA 4W9EA 2BWFA 2WX1A 4BKSA 1LQBA 1RAXA 1WZ3A 3BY4B 3PV1A 2DENB 3VXWA 4ZRKA 3X23A 1UH6A 3ML8A 2ZNVB 2ZJDA 3UQAA 2VRRB 3GOEA 5CHFA 3HIZA 1WE6A 2JWZA 4ANUA 4NY0A 2V1YA 1RLFA 2KDEB 1OEYA 2UWQA 3KUCB 5DPRA 4HWIB 2KC1A 4DXAB 4M8NA 4X57B 3L0WB 1BT0A 3QAQA 4KZ0A 5BO4B 3K9PB 2IBIB 4MDKE 1F9JA 5C1ZA 4LDTB 3QX1A 3ZLZA 1YX6B 3EHVA 4ZRJA 1WXMA 2M17A 4EZKA 1Z5SB 3DBLI 4CHKA 4FADA 1V81A 3QWZB 4EOYA 1A5RA 2L0TA 1IP9A 4HCPB 4NNJB 2AEHA 3DVGY 3TJPA 3PRMB 5LXIB 5AZGA 3DVGX 3ECIA 5HKHA 4FULA 1QZEA 2LVPA 2LWPA 1ZKHA 2KX0A 3R3MA 2DAFA 1V5TA 3IVFA 4GXBA 1Q5WB 2NS5A 2M0XA 2JF5A 3PPAA 4IM0A 2PE9A 1WGRA 3L16A 1IYFA 2KC2A 3MJWA 4JLCA 3VH4B 4GDKA 4ANXA 1E90A 1YX5B 4ICVA 2AL3A 1I42A 2N7DA 4W9KA 4MGIE 3VUWA 5KHQA 2IO0B 1WX9A 2G4DB 1WXAA 4M8MA 4TQ0A 2BF8B 1WR1A 3MTNB 3RYTA 3SHQA 3WAOA 2KFJA 1H4RA 3DOWA 4PS7A 2BKFA 2KANA 2N1WA 2NPTA 3PT2B 3IBEA 4ZYNA 1G6JA 2LZ6A 2BYVE 4HPMB 2FCMA 4MEMA 1GJZA 2KWCA 3HM6X 1WE7A 2CKHB 3OJ4B 5C23A 2WYQA 3AU4A 4LJPB 3X0WA 2N4FA 4BOZB 1OTRB 2MBQA 1HE8A 2J0JA 3D32A 4PS3A 4TKNA 1PQSA 3Q3JA 2JVCA 4KZCA 1E8XA 1M94A 3TMPB 2PJHA 2LD9A 3PGEA 1WR6E 3H1UA 2OOBB 2K8CA 4II2B 5L83A 3PRZA 1WH3A 3ZTDA 2FIDA 3WANA 4AJYB 1WFYA 2FUHB 2GBMA 1P3QU 2CS4A 4NQKE 2ZCBA 3UGBB 4JIOU 1V9JA 2KVRA 2XBBC 2L76A 2FIFA 4W9HA 2A5UA 5GMVA 4W9JA 3LDZE 3WIMA 1C1YB 2BGFA 2XK5A 3A4RA 3JSVA 4BBNC 2DZIA 4GDKB 3L54A 3ZTCA 1GC7A 2LXAA 3A4SC 2O6VD 1NDDA 4IM2A 3QA8A 1KOTA 3DCGA 2DYBA 5J18A 2DZKA 4WAAA 3JYUA 1KLVA 3C0RB 3O65B 4YL8A 2Z0DB 3A9KA 4G3XB 4BOSC 2D10A 3HHMA 4ASWC 2DZMA 2HJ8A 2RGFA 4WJPA 1P1AA 2CU1A 2MSED 1KJTA 4IUMB 4ZDVA 3A33B 4XZ4A 2K8BA 2LRUA 2KDFB 3NS8A 3W1YA 4ANVA 2I1KA 2MBBB 3AU5A 1WF9A 4F7ZA 4MSMB 2M4NA 3PRPB 4AP4C 3B08A 2GOWA 2D07B 2LGDA 1J8CA 3T9LA 4KIKA 5EDSA 2LVQA 4J6IA 3VAWA 2WWZA 2BYFA 2LVOA 1YD8U 3Q3FA 3VUXA 1NI2A 2OJRA 2Z0EB 3ZW3A 3APCA 2V4LA 2WX0A 2R2OA 4K1RB 4BFRA 1GC6A 3SD5A 4E3CA 2ZEQA 4NPNA 3QIJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2GBJ A;  1Y8R C;  2KMA A;  3K9O B;  3KW5 B;  2DYM A;  3DVN U;  3L13 A;  2C60 A;  4HDO A;  2ZZP B;  1UBI A;  4K7U A;  2XK5 B;  2BYE A;  1E7U A;  2C7M B;  2O6V B;  3JSV B;  1V5O A;  2MBH A;  3PRE A;  3WA0 A;  1WY8 A;  3CST A;  4FJZ A;  4WJN A;  4BKS D;  2RSU A;  4GB9 A;  2KTR A;  4AOF A;  3ZNH B;  3S2A A;  4A3P A;  1WGH A;  3RUI B;  5AZH A;  1WIA A;  3ENE A;  2N9E B;  1WI0 A;  3A9K B;  3WAP A;  2EMT A;  4KDL B;  1Z2M A;  4A3O A;  2M8S A;  4G50 A;  1V86 A;  4IW0 A;  5JZE B;  2IO2 B;  2AL6 A;  2N7E A;  5IA7 A;  3PHX B;  2KFK A;  4WWO A;  3HM3 A;  2MQJ A;  5JHB A;  2LAS A;  2KD0 A;  1SGH A;  4IWP A;  3WAL A;  4KIK B;  1Q0W B;  2LGY A;  1ISN A;  1WGD A;  2RD0 A;  4M0W B;  4XX5 A;  2C9W B;  3RZW C;  3H9D A;  1H8C A;  3A9J A;  1YQB A;  4KV2 A;  3L10 B;  4DK5 A;  3DVN V;  5LLI A;  2KDB A;  2KQS A;  2AYO B;  4AJW A;  1UZX B;  2MA9 B;  5E6P A;  4W9L A;  2NBV B;  3CMM B;  4NJ6 A;  2LRW A;  4JGH B;  3V62 A;  2JPH A;  3VTV A;  2LXC A;  1XQQ A;  3TBL D;  1E8Y A;  4FHJ A;  4DDI D;  5J2R A;  3ZNZ B;  2BKR B;  3DBH I;  2ZPN A;  1S3S G;  4GOC A;  2KTR B;  3R7Q A;  5D94 A;  5D2M B;  3QC8 B;  1WX8 A;  1WZ0 A;  3H7S A;  3KUD B;  5TR5 A;  4MSQ B;  2EMS A;  1WXS A;  3GZN I;  3VUY A;  4F8C B;  3UF8 A;  1U4A A;  3APF A;  3MHS D;  2Z59 B;  1E7V A;  3IFW B;  5D6J B;  2MX2 A;  3QJZ A;  4B9K A;  4JL9 A;  3ML9 A;  3V6C B;  4MEL A;  4I6P A;  4IWO A;  4RM9 A;  4HK2 A;  5FR6 A;  4NQL B;  4HLE A;  2KFK B;  1GG3 A;  2KX3 A;  2GBN A;  2R2Q A;  3KVF B;  2M1M A;  4IG7 B;  4ANW A;  2K25 A;  4KSK C;  1EO6 A;  1V49 A;  4HJK A;  4PYU A;  2MP2 A;  2PPH A;  5CHW A;  3RD2 A;  2MCN B;  1SE9 A;  3H6N A;  3A9J B;  3B1L X;  1OEY J;  2REX A;  4MGY E;  4GN1 A;  5CTR C;  3W1S A;  3PVL A;  4MJS A;  3JVZ X;  3IHP C;  1UGM A;  4AUQ C;  5CHV C;  4FN2 A;  3M3J A;  2CHX A;  4HCN B;  2O2V A;  1GUA B;  5DPS A;  4WWN A;  2K6Q A;  4G11 A;  1MG8 A;  2GBR A;  4I6L B;  4NAW A;  4PYZ A;  4W9F A;  3W1S C;  1EF1 A;  4IWQ A;  2MLB A;  3ZVV A;  2Y5B B;  3UIO B;  4HDQ A;  4DHJ D;  5DPW A;  1J0G A;  2MRP A;  5CX3 A;  1OGW A;  2IZV B;  3QQ8 B;  4URK A;  3PZD A;  3WAM A;  2JY6 A;  2IO1 B;  3AXC A;  3KH0 A;  2JRH A;  3RZF A;  2NPT B;  4EFO A;  4OVU A;  1UD7 A;  2KJR A;  5G2N A;  3ZDM C;  2ZPY A;  2RPQ A;  1IPG A;  1AAR A;  4FLH A;  3B0A A;  4MH0 E;  2N9X A;  4MM3 A;  2DX5 B;  3CF6 E;  3M62 B;  4JQW C;  1S1Q B;  2KXJ A;  2QHO A;  3IG3 A;  2AWT A;  2DZJ A;  5IAA C;  3VQI A;  2C7H A;  1FXT B;  1L2N A;  1XT9 B;  3UIP B;  4KVG B;  3L08 A;  1V80 A;  1RFA A;  1WM2 A;  1K8R B;  3VHT C;  3OJ3 A;  1WGY A;  2FCS A;  3DPD A;  2LGX A;  4MJS B;  1L7Y A;  2C7N B;  1ZW7 A;  2NBW B;  4BKG A;  1RRB A;  3VVW B;  2G45 B;  3EEC A;  4DHZ E;  1UEL A;  2O2V B;  3BIN A;  2RR9 A;  1SIF A;  2ZNV C;  3M63 B;  3ONS A;  4RM8 A;  4DHJ B;  2KN5 A;  4NAW B;  5DPT A;  2V3S A;  4HVB A;  1WM3 A;  4EKU A;  3OLM D;  3A1Q A;  3PHW B;  4GDL A;  4W9D A;  4ZRI A;  5J17 A;  2L8J A;  1TBE A;  4K7S A;  2D2Q A;  3ZRC A;  4NJ7 A;  4WQO B;  1P98 A;  2IY1 B;  1TTN A;  2KNB A;  3PLU A;  3N30 A;  1TGZ B;  1E5W A;  3QHT A;  2W9N A;  3U7D A;  4HXD A;  4MGZ E;  1WGG A;  3NOB A;  1E8Z A;  2IY0 B;  2K39 A;  3LJ3 A;  5DCN A;  1LFD A;  2HE7 A;  4FBJ B;  1WMH A;  3DDC B;  3ZRF A;  1C3T A;  1Q1O A;  2G3Q B;  2G4S A;  2KK8 A;  3V60 A;  4B6W A;  2L3Z A;  2DAJ A;  5L95 C;  1OQY A;  2KQ7 A;  2JRI B;  4IM3 A;  1WXV A;  3H7P A;  2JXX A;  3APD A;  2IYD B;  3JW0 X;  1KM7 A;  3QCA A;  1TZ1 A;  4WJQ A;  3NZU A;  3QK0 A;  1CMX B;  4DHZ B;  3OAW A;  2FCQ A;  4E71 A;  3CSF A;  2PE6 B;  3DBS A;  3VTW A;  3PTF C;  4EZJ A;  5AEK B;  2J0K A;  4E74 A;  3RCZ A;  4BBN F;  4F1S A;  3ALB A;  3R7R A;  3R66 C;  4N9F 4;  4AWJ A;  3P2B A;  2BWE S;  3A1Q B;  2KO3 A;  4KDI C;  3L17 A;  3TIX A;  1YIW A;  3UIN B;  2MW5 A;  4II3 B;  4EZL A;  2J7Q B;  2KJ6 A;  4GDL B;  1XD3 B;  4W9G A;  4GMV A;  3RUL A;  2UYZ B;  1E8W A;  1X1M A;  3VFK A;  2FAZ A;  4LCD E;  3TL5 A;  3NZS A;  2DHZ A;  4GU2 A;  1I35 A;  2C5L C;  4FHK A;  3U30 A;  2FNJ B;  1ZGU B;  2L00 B;  3ZNI D;  1V2Y A;  3U8Z A;  4TQ1 A;  3AUL A;  3N32 A;  1JRU A;  3DQV A;  4FA6 A;  4DWF A;  1NBF C;  1WX7 A;  4W9I A;  5D7G A;  4IC7 B;  3ZKJ C;  5G55 A;  4GSW A;  1WMH B;  2ASQ A;  3RT3 B;  4K7W A;  2J0M A;  4EUT A;  2NR2 A;  3ZNG C;  2KTF A;  3H7P B;  5JHA A;  2KZR A;  3PSE B;  1R4N I;  2HTH A;  3EFU A;  5AZF A;  3I3T B;  2D11 A;  4ICU A;  1LM8 B;  4CYE A;  2KOX A;  3ZO5 B;  2WDT B;  3V61 A;  4TV3 A;  4KSL C;  2HD5 B;  4FJV B;  3ZDT A;  2L7R A;  4DBG A;  4PS8 A;  5E6N A;  3NHE B;  5KHO A;  5LXH A;  4FJY A;  2K6D B;  2LJ5 A;  2L0F A;  4K81 A;  1VD2 A;  3TCA A;  2EKE C;  2BPS A;  4RMA A;  4BKT A;  2JZZ A;  3DBR I;  5E6O A;  4CO7 A;  1WJ4 A;  2MBO A;  2FCN A;  2GBK A;  1EF5 A;  3KUZ A;  2KDI A;  2KWU B;  3VTU A;  2NVU I;  3ZUN A;  1WJU A;  4B95 A;  2JT4 B;  3VH3 B;  4DDG D;  2YLM A;  2O6V A;  4OVV A;  2KWV B;  1P0R A;  2ZCC A;  2CHW A;  4W9C A;  4WWP A;  2DYO A;  1WRD B;  2NCN A;  4HPL B;  2KMC A;  3UQB A;  4LJO B;  1YJ1 A;  4XC2 A;  4BVU C;  2NBU A;  3V6E B;  1T0Y A;  2CR5 A;  4I6N B;  4WJO A;  2MP2 B;  4GIV A;  2K8H A;  3EC8 A;  3PLV A;  3ZIM A;  1UBQ A;  2KHW B;  1R4M I;  5JH5 C;  2D3G A;  2LI5 A;  1VCB A;  4GGQ A;  2K1F A;  2L05 A;  1V6E A;  2I1J A;  4TUU A;  1EUV B;  2N9P C;  2IO3 B;  2MWS B;  3HK0 A;  1LXD A;  3PS6 A;  2LUE A;  2MBE A;  2KJH B;  1WYW B;  2JZ3 B;  2XEW A;  2KLC A;  1WJ6 A;  1D3Z A;  1J19 A;  2JUO A;  2YVC A;  4LDT D;  4P7I A;  1WJN A;  2KLG A;  4MGK E;  3VDZ A;  2B3A A;  2CHZ A;  3NY5 A;  3T8M A;  1P9D U;  1GNU A;  3KYC D;  4EEW A;  2N1V A;  3M95 A;  3QAR A;  2KKC A;  2PEA A;  3KYD D;  4A20 A;  3AI5 A;  4G0N B;  3SDL C;  3SU8 X;  3N3K B;  2A4Z A;  2GMI C;  2ZVN A;  2ZVO A;  4W9E A;  2BWF A;  2WX1 A;  4BKS A;  1LQB A;  1RAX A;  1WZ3 A;  3BY4 B;  3PV1 A;  2DEN B;  3VXW A;  4ZRK A;  3X23 A;  1UH6 A;  3ML8 A;  2ZNV B;  2ZJD A;  3UQA A;  2VRR B;  3GOE A;  5CHF A;  3HIZ A;  1WE6 A;  2JWZ A;  4ANU A;  4NY0 A;  2V1Y A;  1RLF A;  2KDE B;  1OEY A;  2UWQ A;  3KUC B;  5DPR A;  4HWI B;  2KC1 A;  4DXA B;  4M8N A;  4X57 B;  3L0W B;  1BT0 A;  3QAQ A;  4KZ0 A;  5BO4 B;  3K9P B;  2IBI B;  4MDK E;  1F9J A;  5C1Z A;  4LDT B;  3QX1 A;  3ZLZ A;  1YX6 B;  3EHV A;  4ZRJ A;  1WXM A;  2M17 A;  4EZK A;  1Z5S B;  3DBL I;  4CHK A;  4FAD A;  1V81 A;  3QWZ B;  4EOY A;  1A5R A;  2L0T A;  1IP9 A;  4HCP B;  4NNJ B;  2AEH A;  3DVG Y;  3TJP A;  3PRM B;  5LXI B;  5AZG A;  3DVG X;  3ECI A;  5HKH A;  4FUL A;  1QZE A;  2LVP A;  2LWP A;  1ZKH A;  2KX0 A;  3R3M A;  2DAF A;  1V5T A;  3IVF A;  4GXB A;  1Q5W B;  2NS5 A;  2M0X A;  2JF5 A;  3PPA A;  4IM0 A;  2PE9 A;  1WGR A;  3L16 A;  1IYF A;  2KC2 A;  3MJW A;  4JLC A;  3VH4 B;  4GDK A;  4ANX A;  1E90 A;  1YX5 B;  4ICV A;  2AL3 A;  1I42 A;  2N7D A;  4W9K A;  4MGI E;  3VUW A;  5KHQ A;  2IO0 B;  1WX9 A;  2G4D B;  1WXA A;  4M8M A;  4TQ0 A;  2BF8 B;  1WR1 A;  3MTN B;  3RYT A;  3SHQ A;  3WAO A;  2KFJ A;  1H4R A;  3DOW A;  4PS7 A;  2BKF A;  2KAN A;  2N1W A;  2NPT A;  3PT2 B;  3IBE A;  4ZYN A;  1G6J A;  2LZ6 A;  2BYV E;  4HPM B;  2FCM A;  4MEM A;  1GJZ A;  2KWC A;  3HM6 X;  1WE7 A;  2CKH B;  3OJ4 B;  5C23 A;  2WYQ A;  3AU4 A;  4LJP B;  3X0W A;  2N4F A;  4BOZ B;  1OTR B;  2MBQ A;  1HE8 A;  2J0J A;  3D32 A;  4PS3 A;  4TKN A;  1PQS A;  3Q3J A;  2JVC A;  4KZC A;  1E8X A;  1M94 A;  3TMP B;  2PJH A;  2LD9 A;  3PGE A;  1WR6 E;  3H1U A;  2OOB B;  2K8C A;  4II2 B;  5L83 A;  3PRZ A;  1WH3 A;  3ZTD A;  2FID A;  3WAN A;  4AJY B;  1WFY A;  2FUH B;  2GBM A;  1P3Q U;  2CS4 A;  4NQK E;  2ZCB A;  3UGB B;  4JIO U;  1V9J A;  2KVR A;  2XBB C;  2L76 A;  2FIF A;  4W9H A;  2A5U A;  5GMV A;  4W9J A;  3LDZ E;  3WIM A;  1C1Y B;  2BGF A;  2XK5 A;  3A4R A;  3JSV A;  4BBN C;  2DZI A;  4GDK B;  3L54 A;  3ZTC A;  1GC7 A;  2LXA A;  3A4S C;  2O6V D;  1NDD A;  4IM2 A;  3QA8 A;  1KOT A;  3DCG A;  2DYB A;  5J18 A;  2DZK A;  4WAA A;  3JYU A;  1KLV A;  3C0R B;  3O65 B;  4YL8 A;  2Z0D B;  3A9K A;  4G3X B;  4BOS C;  2D10 A;  3HHM A;  4ASW C;  2DZM A;  2HJ8 A;  2RGF A;  4WJP A;  1P1A A;  2CU1 A;  2MSE D;  1KJT A;  4IUM B;  4ZDV A;  3A33 B;  4XZ4 A;  2K8B A;  2LRU A;  2KDF B;  3NS8 A;  3W1Y A;  4ANV A;  2I1K A;  2MBB B;  3AU5 A;  1WF9 A;  4F7Z A;  4MSM B;  2M4N A;  3PRP B;  4AP4 C;  3B08 A;  2GOW A;  2D07 B;  2LGD A;  1J8C A;  3T9L A;  4KIK A;  5EDS A;  2LVQ A;  4J6I A;  3VAW A;  2WWZ A;  2BYF A;  2LVO A;  1YD8 U;  3Q3F A;  3VUX A;  1NI2 A;  2OJR A;  2Z0E B;  3ZW3 A;  3APC A;  2V4L A;  2WX0 A;  2R2O A;  4K1R B;  4BFR A;  1GC6 A;  3SD5 A;  4E3C A;  2ZEQ A;  4NPN A;  3QIJ A; 
#chains in the Genus database with same CATH topology
 2GBJ A;  3KW5 B;  4WWM A;  2C60 A;  3MC8 A;  3ABV B;  1E7U A;  1FXA A;  4FJZ A;  2RSU A;  3ZNH B;  5G5G A;  5AZH A;  3GP7 A;  4PK1 A;  2N9E B;  1F1H A;  2IJ0 A;  2LJI A;  2JSV X;  2AL6 A;  3PHX B;  2VZK B;  4WWO A;  5JHB A;  4XWT A;  2WDV B;  4HKZ E;  3NVY A;  2PKO A;  3RZW C;  1ZUD 2;  1FMA D;  1YQB A;  4JE3 B;  1FEH A;  3I5J C;  5LLI A;  2EKI A;  5FK9 C;  3C8Y A;  2NBV B;  1D5Z C;  4NJ6 A;  2QEJ C;  4RF0 A;  2JPH A;  1WRI A;  2QCZ A;  2LXC A;  1B1Z A;  4GLS C;  1UNS A;  5D94 A;  2V3N A;  3B9J A;  1WZ0 A;  3H7S A;  4P16 A;  2BT6 A;  1RYJ A;  2Z59 B;  3IFW B;  1HZ6 A;  4JL9 A;  1YJI A;  4TMA B;  3V6C B;  4I6P A;  4IWO A;  4RM9 A;  1QIL A;  1UGJ A;  2BW2 A;  2M1M A;  1AW7 A;  2MP2 A;  3LB8 C;  5CHW A;  3W2D A;  1N6Z A;  3B1L X;  1OEY J;  2REX A;  4MGY E;  5CTR C;  3PVL A;  4AQ7 A;  1JRO A;  2LGI A;  4AUQ C;  3CIR B;  4FN2 A;  2CHX A;  4ZHP A;  4NAW A;  4PYZ A;  4IWQ A;  2MLB A;  3ZVV A;  2WXQ A;  4DXF A;  1IBX A;  2IZV B;  4EFO A;  2K9X A;  2BTE A;  1UD7 A;  2KJR A;  5G2N A;  3ZDM C;  1AAR A;  4FLH A;  3B0A A;  1RFK A;  1EWY C;  1JWA D;  3Q8E A;  5EE3 A;  1JWB D;  3IG3 A;  2DZJ A;  3I9V 1;  4UDU C;  5IAA C;  1L2N A;  1E0Z A;  2W82 A;  1V80 A;  4K3B A;  3VHT C;  3OJ3 A;  1WGY A;  2FCS A;  2LGX A;  2C7N B;  1ZW7 A;  2WXP A;  3ZJU A;  2G45 B;  3BIN A;  3U2S C;  2RR9 A;  3IT6 B;  4NAW B;  4EKU A;  3PHW B;  3Q69 A;  3E9S A;  3PO0 A;  5J17 A;  1IBX B;  2LMC A;  1ROE A;  2B76 B;  1SIJ A;  4WUR A;  4LNF A;  4MGZ E;  2K39 A;  3LJ3 A;  3HRD D;  1VLB A;  2D3B A;  2HE7 A;  4FBJ B;  1Q1O A;  1JCK B;  2KQ7 A;  3H8H A;  4AS1 A;  3JW0 X;  1CMX B;  1QLB B;  4HRO A;  3VTW A;  3PTF C;  3P2B A;  1TY2 A;  1WWT A;  2KO3 A;  3L17 A;  3TEY A;  1TJE A;  2M0A A;  2SAK A;  1I35 A;  1XF5 L;  3AE6 B;  4FHK A;  3U30 A;  1E6E B;  2FNJ B;  2DWQ A;  2L00 B;  4XYC A;  1L0Y B;  1D4B A;  3U8Z A;  4K3C A;  3DBH B;  4TQ1 A;  3AUL A;  4C4V B;  4FA6 A;  5D7G A;  5G55 A;  4GSW A;  2ASQ A;  1TKE A;  2NR2 A;  1K50 A;  4REZ A;  4HJG E;  3PSE B;  3P4R B;  2D11 A;  3SFE B;  3LYY A;  2UU7 A;  2HD5 B;  3ZDT A;  5HI1 A;  1T5X D;  4PS8 A;  1PGA A;  5LXH A;  4FJY A;  2L0F A;  4K81 A;  1VD2 A;  5E6O A;  2N0S B;  1JWM D;  1ACC A;  1EF5 A;  2JX5 A;  2KDI A;  3VTU A;  3ZUN A;  1WJU A;  4B95 A;  2JT4 B;  4DDG D;  2YLM A;  2O6V A;  4OVV A;  4W9C A;  4WWP A;  2KMC A;  3FIL A;  3UQB A;  4JPS A;  1TKY A;  2KAJ A;  2K8H A;  2W3S A;  3EC8 A;  2LI5 A;  1VCB A;  2LEK A;  1MI0 A;  4HKQ A;  2I1J A;  3RNA C;  1EUV B;  2N9P C;  2WXF A;  2IO3 B;  1M4V A;  3NJT A;  3PS6 A;  2PMV A;  2LUE A;  2KJH B;  3ZJT A;  4US9 A;  1SJH D;  2KLC A;  1TS2 A;  4ARC A;  1D3Z A;  4LDT D;  1WJN A;  3V05 A;  4J3O D;  4MGK E;  3VDZ A;  2B3A A;  1F0Z A;  1FCC C;  4XE0 A;  3RMK C;  2V0G A;  3HVZ A;  4A20 A;  3AI5 A;  4G0N B;  1SF0 A;  3N3K B;  4DXG A;  2BWF A;  1LQB A;  1KTK A;  1WZ3 A;  1UH6 A;  3UQA A;  3GOE A;  4NY0 A;  3N20 C;  1RLF A;  4ARI A;  3EGR A;  1BT0 A;  5BO4 B;  4B0M A;  4MDK E;  2IBI B;  5C1Z A;  4LDT B;  3ZLZ A;  3NVZ A;  1ZPS A;  2LHE A;  2GRI A;  1V81 A;  5BYS A;  3NZ3 A;  3RNG C;  3DVG Y;  3TJP A;  2FBW B;  3RPF C;  1VRA B;  5I4D A;  1SE3 A;  1XLQ A;  2INP E;  3IVF A;  4GXB A;  1Q5W B;  2NS5 A;  1OFF A;  3PPA A;  3AM9 A;  3R8B A;  1E90 A;  2AL3 A;  1I42 A;  3U7Z A;  2IO0 B;  2INC C;  3MTN B;  1C4A A;  1TT5 B;  4M01 A;  1XO3 A;  2KFJ A;  2WXH A;  3PT2 B;  1G6J A;  1L4D B;  4C7Y A;  3IBE A;  5BYR A;  3HM6 X;  1TS5 A;  4ACF A;  2N7J A;  3TEW A;  4PS3 A;  4KZC A;  2VH2 A;  2H88 B;  3RNB C;  2AX5 A;  5L83 A;  3PRZ A;  3WAN A;  2H89 B;  2FUH B;  2GBM A;  2WP9 B;  4OHJ A;  1I4Q A;  2G9H D;  2KVR A;  2XBB C;  1F52 A;  2A5U A;  5GMV A;  3AN1 A;  3JSV A;  4BBN C;  3ZTC A;  1GC7 A;  2K0P A;  4A8X C;  3Q8C A;  2IGD A;  2RDG A;  2DYB A;  3C0R B;  4YL8 A;  3P4P B;  1C4C A;  3A9K A;  1K51 A;  4BOS C;  2RGF A;  4WJP A;  4EE2 A;  2MSE D;  1KJT A;  3Q3O C;  3Q3M C;  4ZDV A;  4XZ4 A;  1YQ4 B;  2LRU A;  4BAX A;  2I1K A;  1R4M B;  1WF9 A;  4F7Z A;  1XCT L;  4AP4 C;  3PRP B;  3T9L A;  4KIK A;  3B2G A;  1GOZ A;  3Q3F A;  3VUX A;  4JWU C;  2W55 A;  2V4L A;  4K1R B;  1IP9 A;  3VR8 B;  3DVN U;  2ZZP B;  1L6V A;  3JSV B;  5HG2 A;  1V5O A;  4HPP A;  4WJN A;  1SEB D;  2FE8 A;  4BKS D;  3P4S B;  2KTR A;  4AOF A;  1DOX A;  2XNA C;  3S2A A;  3TEZ A;  2RDH A;  2WXK A;  2I38 A;  2MH7 A;  3A9K B;  2JYT A;  2EMT A;  2JU6 X;  4G50 A;  2ONQ A;  4IW0 A;  2LHD A;  2IO2 B;  2N7E A;  3MC9 A;  4KKJ A;  1C4P A;  2LAS A;  1A70 A;  4IWP A;  4KIK B;  4M02 A;  1Q0W B;  4R3D A;  1ISN A;  1AWD A;  2RD0 A;  1EM7 A;  4XX5 A;  3H9D A;  3A9J A;  4DK5 A;  2AYO B;  2MA9 B;  5E6P A;  2CU3 A;  4W9L A;  2LRW A;  4JGH B;  2HTM E;  3BYY B;  3V62 A;  3VTV A;  5T8I A;  3TBL D;  2V3P A;  4DDI D;  3C19 A;  2BKR B;  1L6U A;  4GOC A;  1S3S G;  2KTR B;  3RN9 C;  1WX8 A;  3VUY A;  4MSQ B;  3GZN I;  1FIQ A;  3APF A;  4XDD A;  5EE0 A;  1E7V A;  4B9K A;  1ZXI A;  1OQR A;  5BMG A;  2J42 A;  1BUI C;  4HK2 A;  4OZB A;  1WXQ A;  2KX3 A;  2GBN A;  4YSY B;  1HXY D;  4ANW A;  3ETR A;  4PYU A;  3H6N A;  3A9J B;  2ZW1 A;  3OG5 A;  3W1S A;  3CWI A;  3JVZ X;  3IHP C;  1UGM A;  5CHV C;  3M3J A;  4HCN B;  2W54 A;  2O2V A;  1FD6 A;  2K6Q A;  4G11 A;  4I6L B;  4W9F A;  3VRA B;  2ON8 A;  1EF1 A;  1C79 A;  2IND C;  4L23 A;  1N5X A;  2Y5B B;  3UIO B;  4HDQ A;  5DPW A;  1YOV B;  4P1C C;  1OGW A;  1FNU A;  1NI3 A;  3TUO A;  1V1O A;  2NPT B;  1IPG A;  3NS1 A;  2N9X A;  1V1P A;  4JQW C;  2PW9 A;  1S1Q B;  2JXT A;  5FKA C;  3E56 A;  2BS2 B;  3VQI A;  2C7H A;  1FXT B;  1XT9 B;  1YN3 A;  3UIP B;  1L7Y A;  3VVW B;  3EEC A;  2O2V B;  3DHG C;  2WU2 B;  3DWM A;  2AQ2 B;  3GE3 C;  5DPT A;  4WQM A;  3Q2A C;  4GDL A;  2CJO A;  2CJN A;  1TKG A;  1PDX A;  4K7S A;  2D2Q A;  2KDM A;  1T0R C;  2WLB A;  2IY1 B;  2BQQ A;  2WXG A;  5H8Y E;  1TGZ B;  3EA6 A;  3QHT A;  2W9N A;  4JWS C;  1WGG A;  3NOB A;  3MC0 B;  1E8Z A;  1JRP A;  5DCN A;  1V1P B;  1NEN B;  1WMH A;  3DDC B;  2G4S A;  2KK8 A;  4B6W A;  2L3Z A;  3AE7 B;  4MH8 A;  2PLP A;  1TZ1 A;  4WJQ A;  4C56 C;  2QDF A;  1MG4 A;  3IT4 B;  3OAW A;  2FCQ A;  4E71 A;  3CSF A;  2PE6 B;  3DBS A;  5AEK B;  4BBN F;  3R66 C;  1YNT E;  4N9F 4;  5EDS A;  2K22 A;  4EZL A;  2KJ6 A;  4GDL B;  4P6V F;  1C9F A;  4W9G A;  3RUL A;  2UYZ B;  3VFK A;  4LCD E;  2L32 A;  2IGG A;  3NZS A;  2DHZ A;  2WXJ A;  2C5L C;  3Q8A A;  1EWC A;  1NBF C;  4W9I A;  2HJ1 A;  3ZKJ C;  1WMH B;  4K7W A;  2J0M A;  3TEX A;  1F2R I;  4QAY A;  2KTF A;  4L1B A;  5MPO A;  2WS3 B;  5AZF A;  4ICU A;  2M19 A;  2KOX A;  3N1X C;  2WXI A;  3U4E G;  3ZO5 B;  3VRB B;  4DBG A;  1PGX A;  5KHO A;  1STE A;  1QF6 A;  5HFY A;  1FO4 A;  2LJ5 A;  3TCA A;  2BPS A;  3J9C A;  3O13 A;  4RMA A;  3DBR I;  4CO7 A;  2MBO A;  2GBK A;  1FFV A;  2J4X A;  3KUZ A;  4XWW A;  2KWU B;  4B0E A;  1SB3 C;  3VH3 B;  1GPX A;  2KWV B;  1P0R A;  1UF0 A;  2CHW A;  2DNF A;  2NCN A;  1PFD A;  1XLN A;  2NBU A;  3V6E B;  3ZGZ A;  4WJO A;  2MP2 B;  3FC4 A;  5JH5 C;  4YSX B;  3BYT B;  1SE2 A;  3KLS X;  4TUU A;  2Y3A A;  1I4X A;  1JAL A;  2MWS B;  1LXD A;  3NRZ A;  1T6B X;  1J19 A;  2ACZ B;  1B9R A;  2KLG A;  3PZ7 A;  4A9A A;  2CHZ A;  2PVO D;  3KYC D;  2N1V A;  3M95 A;  3QAR A;  2KKC A;  3KYD D;  3AEF B;  4RCO A;  2A4Z A;  2GMI C;  2ZVO A;  4W9E A;  2AQ1 B;  1RAX A;  3BY4 B;  2DEN B;  3VXW A;  2JWU A;  3DWG C;  3X23 A;  5TSS A;  1D5M C;  4LNN A;  1QOF A;  2ZJD A;  3P4Q B;  1WE6 A;  2JWZ A;  5JXV A;  4DXA B;  3KUC B;  5DPR A;  1F77 A;  2KC1 A;  4HWI B;  3AMZ A;  4M8N A;  1MHX A;  4LNO A;  3EHV A;  1WXM A;  2IGH A;  2M17 A;  1PYW D;  1Z5S B;  3DBL I;  2RDB C;  3DHI C;  3QWZ B;  1A5R A;  2L0T A;  4HCP B;  3N9Y C;  5LXI B;  3PRM B;  4RF1 A;  3ECI A;  1HQR D;  1ZKH A;  3R3M A;  4FXC A;  2M0X A;  2BS3 B;  1IYF A;  2KC2 A;  4GDK A;  4W9K A;  2M56 B;  5KHQ A;  2R61 A;  4M8M A;  4RGO S;  2BF8 B;  1WR1 A;  3BVZ A;  5BYQ A;  3WAO A;  3AEE B;  2WNM A;  2N1W A;  4ZYN A;  2MJ3 A;  2LZ6 A;  2BYV E;  4S17 A;  1E10 A;  3AU4 A;  3X0W A;  4YXD B;  2MBQ A;  1YMH E;  1HE8 A;  1TS4 A;  1MVK A;  3D32 A;  1PUT A;  3Q3J A;  1M94 A;  3TMP B;  1WR6 E;  2K8C A;  4AJY B;  1KFY B;  2WXN A;  1WFY A;  2CS4 A;  3UGB B;  2ZCB A;  1V9J A;  1IGC A;  1RWS A;  2FIF A;  2Y5C A;  1BXT A;  3WIM A;  1VDV A;  2BGF A;  3Q3N C;  1HTO A;  4GDK B;  3L54 A;  4WH4 A;  1L0V B;  1TY0 A;  2O6V D;  1NDD A;  3AED B;  3HVD A;  1KOT A;  1SXT A;  1C78 A;  2KN4 A;  2DZK A;  1KLV A;  1T0Q C;  5BMI A;  2DZM A;  2HJ8 A;  1P1A A;  2CU1 A;  2BVC A;  2K8B A;  3W1Y A;  3NS8 A;  4ANV A;  3ZYY X;  3AEB B;  3GB1 A;  4MSM B;  3B08 A;  1YJJ A;  2D07 B;  2LGD A;  2KQ4 X;  1J8C A;  2LVQ A;  2WWZ A;  3BVG A;  1YD8 U;  4RFB A;  2OJR A;  3ZW3 A;  3APC A;  4RGN A;  4E3C A;  5IKC M;  2KMA A;  3K9O B;  2DYM A;  1FFU A;  2C7M B;  2O6V B;  3PRE A;  1WY8 A;  3CST A;  3FIL B;  4N58 A;  1WGH A;  3RUI B;  2PVG C;  3Q8B A;  3ENE A;  2KT7 A;  3WAP A;  2J52 A;  3SEB A;  4ZRP A;  1Z2M A;  2M8S A;  5JZE B;  5E6J A;  2KFK A;  4WIP A;  4A6Q A;  3HM3 A;  4RGT A;  1ET6 A;  2KD0 A;  3WAL A;  2LGY A;  1WGD A;  2C9W B;  1H8C A;  4KV2 A;  2QIE B;  4AJW A;  2KDB A;  1UZX B;  3CMM B;  2MJE A;  3TSS A;  1XQQ A;  1QQR A;  4H2A A;  1KH0 A;  1IUE A;  3ZNZ B;  3R7Q A;  4OVZ A;  1SBB B;  3BVM A;  3W5V B;  5D2M B;  2LFI A;  3QC8 B;  5TR5 A;  2KMM A;  4F8C B;  1U4A A;  5D6J B;  1MPE A;  3QJZ A;  1I4G A;  5FR6 A;  4NQL B;  4HLE A;  4XGA B;  2KFK B;  2R2Q A;  3KVF B;  2K25 A;  4KSK C;  1EO6 A;  2OHF A;  1EU3 A;  1ESF A;  4S0R A;  4HEA 1;  2PPH A;  1XEE A;  3RD2 A;  2LUM A;  1SE9 A;  1UUP A;  1D6E C;  2WXR A;  1N61 A;  1SJE D;  2GBR A;  2YEP F;  3V3X A;  4A55 A;  3ZXV A;  1J0G A;  5AUI A;  4DHJ D;  1I4H A;  2MRP A;  5HHD G;  2G1E A;  1MJD A;  3QQ8 B;  3KH0 A;  1LO5 D;  4OVU A;  3Q6B A;  2ZPY A;  3BK2 A;  4D2K A;  4TSS A;  3IXS A;  1KLU D;  2KWD A;  3M62 B;  2QHO A;  2KXJ A;  1FCL A;  1MFW A;  2QJL A;  3NUH B;  4KVG B;  3L08 A;  3DPD A;  3AE1 B;  2NBW B;  1QKZ A;  3M63 B;  4RM8 A;  3ONS A;  3HUI A;  2L83 A;  2KN5 A;  4DHJ B;  4HVB A;  1WM3 A;  3A1Q A;  4MAC A;  1ZDX A;  4W9D A;  4ZRI A;  1TBE A;  3MP9 A;  3ZRC A;  4C00 A;  4WQO B;  2KNB A;  3PLU A;  1NEK B;  1CJE A;  1HTQ A;  2IY0 B;  4O1N A;  1NVI D;  3FKY A;  1C3T A;  2G3Q B;  2KVZ A;  3V60 A;  5L95 C;  1OQY A;  3RNC C;  3Q14 C;  2JXX A;  3APD A;  3QCA A;  3AE3 B;  3NZU A;  4MT5 A;  3MJ5 A;  4EZJ A;  1HZ5 A;  4E74 A;  2BB5 A;  4F1S A;  3ALB A;  3R7R A;  4AWJ A;  3A1Q B;  3TIX A;  3UIN B;  4KDI C;  1YIW A;  2MW5 A;  4II3 B;  2J7Q B;  3P42 A;  2BB6 A;  5D3D A;  3IAS 1;  2FAZ A;  2Q5W D;  2WDQ B;  5FR3 A;  1KRH A;  1ZGU B;  3ZNI D;  1V2Y A;  1WYG A;  3N32 A;  3DQV A;  3I63 C;  3BWU D;  5C3J B;  3GZN B;  4KX6 B;  4IC7 B;  3RT3 B;  2NTT A;  4EUT A;  5JHA A;  4XDC A;  5IOI A;  4N6E B;  3EFC A;  2MJD A;  3I57 A;  5H92 C;  2WDT B;  4N59 A;  4TV3 A;  4KSL C;  4FJV B;  4YTM B;  2WXM A;  3NHE B;  3AE4 B;  3GS2 A;  1XCQ L;  2EKE C;  4BKT A;  2BYT A;  4JX1 C;  4LNI A;  1C76 A;  2N9K A;  2DYO A;  1WRD B;  3OWE B;  4PT5 A;  1YJ1 A;  4XC2 A;  1T0Y A;  2CR5 A;  4I6N B;  4A90 A;  2V9H A;  1I4R A;  3ZIM A;  1UBQ A;  1DYQ A;  1V6E A;  1TZO A;  3HK0 A;  3KWV A;  1TS3 A;  4CQN A;  2XEW A;  1L0X B;  2JUO A;  2YVC A;  3BII D;  3RI7 C;  4RNA A;  3LXF A;  3NY5 A;  1P9D U;  1GNU A;  1RM6 C;  2QIL A;  1TYG B;  3RFZ B;  2KYW A;  2PEA A;  1OQQ A;  4ZYS A;  3SDL C;  2KAC A;  2X8X X;  4LTU A;  2WXO A;  3PV1 A;  2JQR B;  4ZRK A;  3ML8 A;  2ZNV B;  2VRR B;  5CHF A;  3HIZ A;  1P7F A;  4YTP B;  2V1Y A;  1OEY A;  2UWQ A;  2L52 A;  3SFD B;  4X57 B;  3W5U B;  2Y5P A;  3QAQ A;  4KZ0 A;  1WSP A;  4ZRJ A;  4P1B C;  5BMH A;  4EZK A;  4Q2J A;  4CHK A;  3L4P A;  4FAD A;  4EOY A;  2WGS A;  4NNJ B;  5LNK 1;  3AV8 A;  3DVG X;  5HKH A;  4USA A;  4FUL A;  2LWP A;  2DAF A;  2JF5 A;  1QOB A;  4IM0 A;  1EU4 A;  1WGR A;  3L16 A;  1QOG A;  4LLG M;  4JLC A;  4ANX A;  1YX5 B;  1UWM A;  3AE5 B;  4HRS A;  2G4D B;  4TQ0 A;  1E9M A;  3RYT A;  3SHQ A;  4BZA A;  2TSS A;  1H4R A;  3DOW A;  3ZQ4 A;  4PS7 A;  2BKF A;  2KAN A;  1GB4 A;  2FCM A;  4MEM A;  3OJ4 B;  5C23 A;  4LJP B;  4BOZ B;  2N4F A;  3R2I A;  1OTR B;  4US8 A;  1HEZ E;  4TKN A;  1PQS A;  1I4P A;  2JVC A;  1E8X A;  5IO9 A;  4IDI A;  1R7S A;  2PJH A;  3PGE A;  2EEL A;  3H1U A;  2BS4 B;  2OOB B;  3ZTD A;  1WH3 A;  3MHZ A;  1WGK A;  1P3Q U;  4NQK E;  1MHH E;  4JIO U;  2QMT A;  2LGS A;  2L76 A;  4W9H A;  4W9J A;  5GXG B;  2XK5 A;  2DZI A;  3N1Y C;  2PIA A;  2I2Y A;  2V4I B;  3DBR B;  3QA8 A;  1GB1 A;  1YN4 A;  4WAA A;  3JYU A;  5D3I B;  2X38 A;  2Z0D B;  2DBY A;  2D10 A;  2JZP A;  4ASW C;  2RPV A;  4IUM B;  3A33 B;  2NTS A;  1N5W A;  2M4N A;  1YQ3 B;  2GOW A;  3SR6 A;  4M0W A;  1FRD A;  3VAW A;  1K52 A;  2LVO A;  4ZOH C;  2WX0 A;  3WCQ A;  4BFR A;  3SD5 A;  4NPN A;  3QIJ A;  1I7H A;  1QOA A;  3GE8 C;  1Y8R C;  3L13 A;  4HDO A;  4NJ7 A;  4K7U A;  3WAM A;  1UBI A;  2XK5 B;  2BYE A;  3AH7 A;  3WA0 A;  2MBH A;  1GAQ B;  4GB9 A;  3ZXR A;  4C7Z A;  1ET9 A;  4A3P A;  4YT0 B;  1WIA A;  1WI0 A;  4NAM A;  4KDL B;  3U52 E;  4A3O A;  3B2F A;  1V86 A;  1V8C A;  3AE9 B;  4C4V A;  3T3N A;  2FUG 1;  5IA7 A;  1FPY A;  5G5H A;  3AEA B;  2MQJ A;  1DGJ A;  3AB5 A;  1SGH A;  4OW0 A;  3KWL A;  4M0W B;  3KQ4 A;  1VR9 A;  3L10 B;  1E7P B;  3DVN V;  2KQS A;  2L1A A;  2ZW0 A;  2N9L A;  3DBL B;  1E8Y A;  4FHJ A;  1JQ4 A;  5J2R A;  3DBH I;  1SSN A;  2ZPN A;  3KUD B;  2EMS A;  1WXS A;  3W9C B;  4LNK A;  3UF8 A;  3MHS D;  4NJC A;  2MX2 A;  3ML9 A;  4KGS A;  1V97 A;  2W3R A;  4MEL A;  1GG3 A;  4IG7 B;  1V49 A;  4HJK A;  2MCN B;  2K3U A;  4GN1 A;  4MJS A;  2WXL A;  3MFG A;  1Q10 A;  1P7E A;  3PZ8 A;  1GUA B;  5DPS A;  4WWN A;  1MG8 A;  3W1S C;  1K53 A;  1FRR A;  1T3Q A;  5CX3 A;  3IAM 1;  4ZHO A;  4URK A;  3PZD A;  2IO1 B;  2JY6 A;  3AXC A;  4IKG A;  2JRH A;  3RZF A;  2RPQ A;  5IN7 A;  4KGR A;  1CZP A;  1ZP0 B;  2D3C A;  1HA5 A;  3BK1 A;  4MH0 E;  4YTN B;  4MM3 A;  2DX5 B;  1AN8 A;  3CF6 E;  2AWT A;  4L2Y A;  1ZXH A;  3EUB 2;  1RFA A;  1WM2 A;  1L5P A;  1K8R B;  4IOI E;  3BZD B;  4M00 A;  4MJS B;  2OJW A;  4BKG A;  1RRB A;  4DHZ E;  1UEL A;  1SIF A;  1TIF A;  2ZNV C;  2WQY B;  2V3S A;  3OLM D;  4YWG G;  2QSD A;  2L8J A;  4RH6 A;  5EE9 A;  1J7C A;  1P98 A;  1TTN A;  3N30 A;  1E5W A;  3U7D A;  4HXD A;  1XXG A;  1LFD A;  2D5G A;  4MM3 B;  1N62 A;  3ZRF A;  2DAJ A;  4LK0 M;  2JRI B;  4IM3 A;  1WXV A;  3H7P A;  3ZJV A;  2IYD B;  1KM7 A;  3QK0 A;  4DHZ B;  3AE2 B;  2J0K A;  4ITK A;  3Q8F A;  3RCZ A;  1J7B A;  2BWE S;  1D5X C;  1ZE3 D;  4OZA A;  1XD3 B;  4GMV A;  2BBC A;  2MEK A;  1E8W A;  1F2R C;  1X1M A;  3TL5 A;  4GU2 A;  1XLO A;  1Y56 A;  1JRU A;  4DWF A;  3R2T A;  1WX7 A;  4DQO C;  1VZ7 A;  2J53 A;  1CQV A;  3ZNG C;  3VR9 B;  3H7P B;  2KZR A;  5EE1 A;  3FAH A;  4ZRQ A;  1R4N I;  2HTH A;  3EFU A;  1VJK A;  1N63 A;  3I3T B;  1QT9 A;  1LM8 B;  4CYE A;  4YSZ B;  3V61 A;  2L7R A;  1LGR A;  5E6N A;  1R4N B;  1KLG D;  2K6D B;  3AE8 B;  1ZOY B;  1YN5 A;  2JZZ A;  2VH1 A;  1WJ4 A;  2FCN A;  1FM0 D;  2NVU I;  1UWX A;  1KF6 B;  4C80 A;  2ZCC A;  1VZ8 A;  4HPL B;  4LJO B;  4BVU C;  4GIV A;  1AYF A;  3PLV A;  2KHW B;  1R4M I;  2AQ3 B;  2D3G A;  4GGQ A;  2K1F A;  2L05 A;  1JWU D;  3UI3 A;  2MBE A;  3T3O A;  1PGB A;  1WYW B;  2JZ3 B;  4KGT A;  2WDR B;  3RNE C;  1WJ6 A;  1ZDV A;  1CK1 A;  4P7I A;  2GLS A;  1L4Z B;  3T8M A;  5AUK A;  4EEW A;  2WU5 B;  4RGM A;  5IP4 D;  3SU8 X;  4BKS A;  2ZVN A;  2MHJ A;  2WX1 A;  1DOY A;  1DOI A;  4OZC A;  2INN E;  4ANU A;  2IPK D;  2KDE B;  2GB1 A;  1T0S C;  3L0W B;  2QC8 A;  2ICI A;  2PTL A;  2D3A A;  3K9P B;  1F9J A;  3QX1 A;  1YX6 B;  3RNF C;  1IGD A;  2AEH A;  5AZG A;  2YEP B;  1QZE A;  2LVP A;  2KX0 A;  1V5T A;  4NZL B;  2PE9 A;  3MJW A;  3VH4 B;  3P63 A;  4ICV A;  2N7D A;  1BML C;  4MGI E;  1FNW A;  4KKI A;  3VUW A;  1WX9 A;  3AEC B;  1WXA A;  2IDY A;  2RMM A;  2HDE A;  1ENF A;  3NVV A;  1FNV A;  2NPT A;  4HPM B;  4WAF A;  1GJZ A;  2KWC A;  1WE7 A;  2CKH B;  2GI9 A;  1NYQ A;  2WYQ A;  1NYR A;  2J0J A;  2E6X A;  1JML A;  1N60 A;  2JYE A;  3NVW A;  2LD9 A;  4II2 B;  2NMQ A;  5C2T B;  2FID A;  2E3T A;  2DLB A;  3LDZ E;  1JWS D;  3P1M A;  2Z8L A;  1C1Y B;  3A4R A;  1VZ6 A;  1JW9 D;  2LXA A;  3A4S C;  4IM2 A;  3N1Z C;  3DCG A;  5J18 A;  3DHH C;  3AEG B;  3O65 B;  4G3X B;  2K5P A;  1SE4 A;  3HHM A;  2SEB D;  1C77 A;  2WHI A;  2KDF B;  2MBB B;  2XN9 C;  3AU5 A;  1XLP A;  2VZK D;  4J6I A;  2BYF A;  1NI2 A;  3NG0 A;  2Z0E B;  1FXI A;  3URY A;  2R2O A;  1GC6 A;  2ZEQ A;  2OED A;  1J7A A; 
#chains in the Genus database with same CATH homology
 2GBJ A;  1Y8R C;  2KMA A;  3K9O B;  3KW5 B;  2DYM A;  3DVN U;  3L13 A;  2C60 A;  4HDO A;  2ZZP B;  1UBI A;  4K7U A;  2XK5 B;  2BYE A;  1E7U A;  2C7M B;  2O6V B;  3JSV B;  1V5O A;  2MBH A;  3PRE A;  3WA0 A;  1WY8 A;  3CST A;  4FJZ A;  4WJN A;  4BKS D;  2RSU A;  4GB9 A;  2KTR A;  4AOF A;  3ZNH B;  3S2A A;  4A3P A;  1WGH A;  3RUI B;  5AZH A;  1WIA A;  3ENE A;  2N9E B;  1WI0 A;  3A9K B;  3WAP A;  2EMT A;  4KDL B;  1Z2M A;  4A3O A;  2M8S A;  4G50 A;  1V86 A;  4IW0 A;  5JZE B;  2IO2 B;  2AL6 A;  2N7E A;  5IA7 A;  3PHX B;  2KFK A;  4WWO A;  3HM3 A;  2MQJ A;  5JHB A;  2LAS A;  2KD0 A;  1SGH A;  4IWP A;  3WAL A;  4KIK B;  1Q0W B;  2LGY A;  1ISN A;  1WGD A;  2RD0 A;  4M0W B;  4XX5 A;  2C9W B;  3RZW C;  3H9D A;  1H8C A;  3A9J A;  1YQB A;  4KV2 A;  3L10 B;  4DK5 A;  3DVN V;  5LLI A;  2KDB A;  2KQS A;  2AYO B;  4AJW A;  1UZX B;  2MA9 B;  5E6P A;  4W9L A;  2NBV B;  3CMM B;  4NJ6 A;  2LRW A;  4JGH B;  3V62 A;  2JPH A;  3VTV A;  2LXC A;  1XQQ A;  3TBL D;  1E8Y A;  4FHJ A;  4DDI D;  5J2R A;  3ZNZ B;  2BKR B;  3DBH I;  2ZPN A;  1S3S G;  4GOC A;  2KTR B;  3R7Q A;  5D94 A;  5D2M B;  3QC8 B;  1WX8 A;  1WZ0 A;  3H7S A;  3KUD B;  5TR5 A;  4MSQ B;  2EMS A;  1WXS A;  3GZN I;  3VUY A;  4F8C B;  3UF8 A;  1U4A A;  3APF A;  3MHS D;  2Z59 B;  1E7V A;  3IFW B;  5D6J B;  2MX2 A;  3QJZ A;  4B9K A;  4JL9 A;  3ML9 A;  3V6C B;  4MEL A;  4I6P A;  4IWO A;  4RM9 A;  4HK2 A;  5FR6 A;  4NQL B;  4HLE A;  2KFK B;  1GG3 A;  2KX3 A;  2GBN A;  2R2Q A;  3KVF B;  2M1M A;  4IG7 B;  4ANW A;  2K25 A;  4KSK C;  1EO6 A;  1V49 A;  4HJK A;  4PYU A;  2MP2 A;  2PPH A;  5CHW A;  3RD2 A;  2MCN B;  1SE9 A;  3H6N A;  3A9J B;  3B1L X;  1OEY J;  2REX A;  4MGY E;  4GN1 A;  5CTR C;  3W1S A;  3PVL A;  4MJS A;  3JVZ X;  3IHP C;  1UGM A;  4AUQ C;  5CHV C;  4FN2 A;  3M3J A;  2CHX A;  4HCN B;  2O2V A;  1GUA B;  5DPS A;  4WWN A;  2K6Q A;  4G11 A;  1MG8 A;  2GBR A;  4I6L B;  4NAW A;  4PYZ A;  4W9F A;  3W1S C;  1EF1 A;  4IWQ A;  2MLB A;  3ZVV A;  2Y5B B;  3UIO B;  4HDQ A;  4DHJ D;  5DPW A;  1J0G A;  2MRP A;  5CX3 A;  1OGW A;  2IZV B;  3QQ8 B;  4URK A;  3PZD A;  3WAM A;  2JY6 A;  2IO1 B;  3AXC A;  3KH0 A;  2JRH A;  3RZF A;  2NPT B;  4EFO A;  4OVU A;  1UD7 A;  2KJR A;  5G2N A;  3ZDM C;  2ZPY A;  2RPQ A;  1IPG A;  1AAR A;  4FLH A;  3B0A A;  4MH0 E;  2N9X A;  4MM3 A;  2DX5 B;  3CF6 E;  3M62 B;  4JQW C;  1S1Q B;  2KXJ A;  2QHO A;  3IG3 A;  2AWT A;  2DZJ A;  5IAA C;  3VQI A;  2C7H A;  1FXT B;  1L2N A;  1XT9 B;  3UIP B;  4KVG B;  3L08 A;  1V80 A;  1RFA A;  1WM2 A;  1K8R B;  3VHT C;  3OJ3 A;  1WGY A;  2FCS A;  3DPD A;  2LGX A;  4MJS B;  1L7Y A;  2C7N B;  1ZW7 A;  2NBW B;  4BKG A;  1RRB A;  3VVW B;  2G45 B;  3EEC A;  4DHZ E;  1UEL A;  2O2V B;  3BIN A;  2RR9 A;  1SIF A;  2ZNV C;  3M63 B;  3ONS A;  4RM8 A;  4DHJ B;  2KN5 A;  4NAW B;  5DPT A;  2V3S A;  4HVB A;  1WM3 A;  4EKU A;  3OLM D;  3A1Q A;  3PHW B;  4GDL A;  4W9D A;  4ZRI A;  5J17 A;  2L8J A;  1TBE A;  4K7S A;  2D2Q A;  3ZRC A;  4NJ7 A;  4WQO B;  1P98 A;  2IY1 B;  1TTN A;  2KNB A;  3PLU A;  3N30 A;  1TGZ B;  1E5W A;  3QHT A;  2W9N A;  3U7D A;  4HXD A;  4MGZ E;  1WGG A;  3NOB A;  1E8Z A;  2IY0 B;  2K39 A;  3LJ3 A;  5DCN A;  1LFD A;  2HE7 A;  4FBJ B;  1WMH A;  3DDC B;  3ZRF A;  1C3T A;  1Q1O A;  2G3Q B;  2G4S A;  2KK8 A;  3V60 A;  4B6W A;  2L3Z A;  2DAJ A;  5L95 C;  1OQY A;  2KQ7 A;  2JRI B;  4IM3 A;  1WXV A;  3H7P A;  2JXX A;  3APD A;  2IYD B;  3JW0 X;  1KM7 A;  3QCA A;  1TZ1 A;  4WJQ A;  3NZU A;  3QK0 A;  1CMX B;  4DHZ B;  3OAW A;  2FCQ A;  4E71 A;  3CSF A;  2PE6 B;  3DBS A;  3VTW A;  3PTF C;  4EZJ A;  5AEK B;  2J0K A;  4E74 A;  3RCZ A;  4BBN F;  4F1S A;  3ALB A;  3R7R A;  3R66 C;  4N9F 4;  4AWJ A;  3P2B A;  2BWE S;  3A1Q B;  2KO3 A;  4KDI C;  3L17 A;  3TIX A;  1YIW A;  3UIN B;  2MW5 A;  4II3 B;  4EZL A;  2J7Q B;  2KJ6 A;  4GDL B;  1XD3 B;  4W9G A;  4GMV A;  3RUL A;  2UYZ B;  1E8W A;  1X1M A;  3VFK A;  2FAZ A;  4LCD E;  3TL5 A;  3NZS A;  2DHZ A;  4GU2 A;  1I35 A;  2C5L C;  4FHK A;  3U30 A;  2FNJ B;  1ZGU B;  2L00 B;  3ZNI D;  1V2Y A;  3U8Z A;  4TQ1 A;  3AUL A;  3N32 A;  1JRU A;  3DQV A;  4FA6 A;  4DWF A;  1NBF C;  1WX7 A;  4W9I A;  5D7G A;  4IC7 B;  3ZKJ C;  5G55 A;  4GSW A;  1WMH B;  2ASQ A;  3RT3 B;  4K7W A;  2J0M A;  4EUT A;  2NR2 A;  3ZNG C;  2KTF A;  3H7P B;  5JHA A;  2KZR A;  3PSE B;  1R4N I;  2HTH A;  3EFU A;  5AZF A;  3I3T B;  2D11 A;  4ICU A;  1LM8 B;  4CYE A;  2KOX A;  3ZO5 B;  2WDT B;  3V61 A;  4TV3 A;  4KSL C;  2HD5 B;  4FJV B;  3ZDT A;  2L7R A;  4DBG A;  4PS8 A;  5E6N A;  3NHE B;  5KHO A;  5LXH A;  4FJY A;  2K6D B;  2LJ5 A;  2L0F A;  4K81 A;  1VD2 A;  3TCA A;  2EKE C;  2BPS A;  4RMA A;  4BKT A;  2JZZ A;  3DBR I;  5E6O A;  4CO7 A;  1WJ4 A;  2MBO A;  2FCN A;  2GBK A;  1EF5 A;  3KUZ A;  2KDI A;  2KWU B;  3VTU A;  2NVU I;  3ZUN A;  1WJU A;  4B95 A;  2JT4 B;  3VH3 B;  4DDG D;  2YLM A;  2O6V A;  4OVV A;  2KWV B;  1P0R A;  2ZCC A;  2CHW A;  4W9C A;  4WWP A;  2DYO A;  1WRD B;  2NCN A;  4HPL B;  2KMC A;  3UQB A;  4LJO B;  1YJ1 A;  4XC2 A;  4BVU C;  2NBU A;  3V6E B;  1T0Y A;  2CR5 A;  4I6N B;  4WJO A;  2MP2 B;  4GIV A;  2K8H A;  3EC8 A;  3PLV A;  3ZIM A;  1UBQ A;  2KHW B;  1R4M I;  5JH5 C;  2D3G A;  2LI5 A;  1VCB A;  4GGQ A;  2K1F A;  2L05 A;  1V6E A;  2I1J A;  4TUU A;  1EUV B;  2N9P C;  2IO3 B;  2MWS B;  3HK0 A;  1LXD A;  3PS6 A;  2LUE A;  2MBE A;  2KJH B;  1WYW B;  2JZ3 B;  2XEW A;  2KLC A;  1WJ6 A;  1D3Z A;  1J19 A;  2JUO A;  2YVC A;  4LDT D;  4P7I A;  1WJN A;  2KLG A;  4MGK E;  3VDZ A;  2B3A A;  2CHZ A;  3NY5 A;  3T8M A;  1P9D U;  1GNU A;  3KYC D;  4EEW A;  2N1V A;  3M95 A;  3QAR A;  2KKC A;  2PEA A;  3KYD D;  4A20 A;  3AI5 A;  4G0N B;  3SDL C;  3SU8 X;  3N3K B;  2A4Z A;  2GMI C;  2ZVN A;  2ZVO A;  4W9E A;  2BWF A;  2WX1 A;  4BKS A;  1LQB A;  1RAX A;  1WZ3 A;  3BY4 B;  3PV1 A;  2DEN B;  3VXW A;  4ZRK A;  3X23 A;  1UH6 A;  3ML8 A;  2ZNV B;  2ZJD A;  3UQA A;  2VRR B;  3GOE A;  5CHF A;  3HIZ A;  1WE6 A;  2JWZ A;  4ANU A;  4NY0 A;  2V1Y A;  1RLF A;  2KDE B;  1OEY A;  2UWQ A;  3KUC B;  5DPR A;  4HWI B;  2KC1 A;  4DXA B;  4M8N A;  4X57 B;  3L0W B;  1BT0 A;  3QAQ A;  4KZ0 A;  5BO4 B;  3K9P B;  2IBI B;  4MDK E;  1F9J A;  5C1Z A;  4LDT B;  3QX1 A;  3ZLZ A;  1YX6 B;  3EHV A;  4ZRJ A;  1WXM A;  2M17 A;  4EZK A;  1Z5S B;  3DBL I;  4CHK A;  4FAD A;  1V81 A;  3QWZ B;  4EOY A;  1A5R A;  2L0T A;  1IP9 A;  4HCP B;  4NNJ B;  2AEH A;  3DVG Y;  3TJP A;  3PRM B;  5LXI B;  5AZG A;  3DVG X;  3ECI A;  5HKH A;  4FUL A;  1QZE A;  2LVP A;  2LWP A;  1ZKH A;  2KX0 A;  3R3M A;  2DAF A;  1V5T A;  3IVF A;  4GXB A;  1Q5W B;  2NS5 A;  2M0X A;  2JF5 A;  3PPA A;  4IM0 A;  2PE9 A;  1WGR A;  3L16 A;  1IYF A;  2KC2 A;  3MJW A;  4JLC A;  3VH4 B;  4GDK A;  4ANX A;  1E90 A;  1YX5 B;  4ICV A;  2AL3 A;  1I42 A;  2N7D A;  4W9K A;  4MGI E;  3VUW A;  5KHQ A;  2IO0 B;  1WX9 A;  2G4D B;  1WXA A;  4M8M A;  4TQ0 A;  2BF8 B;  1WR1 A;  3MTN B;  3RYT A;  3SHQ A;  3WAO A;  2KFJ A;  1H4R A;  3DOW A;  4PS7 A;  2BKF A;  2KAN A;  2N1W A;  2NPT A;  3PT2 B;  3IBE A;  4ZYN A;  1G6J A;  2LZ6 A;  2BYV E;  4HPM B;  2FCM A;  4MEM A;  1GJZ A;  2KWC A;  3HM6 X;  1WE7 A;  2CKH B;  3OJ4 B;  5C23 A;  2WYQ A;  3AU4 A;  4LJP B;  3X0W A;  2N4F A;  4BOZ B;  1OTR B;  2MBQ A;  1HE8 A;  2J0J A;  3D32 A;  4PS3 A;  4TKN A;  1PQS A;  3Q3J A;  2JVC A;  4KZC A;  1E8X A;  1M94 A;  3TMP B;  2PJH A;  2LD9 A;  3PGE A;  1WR6 E;  3H1U A;  2OOB B;  2K8C A;  4II2 B;  5L83 A;  3PRZ A;  1WH3 A;  3ZTD A;  2FID A;  3WAN A;  4AJY B;  1WFY A;  2FUH B;  2GBM A;  1P3Q U;  2CS4 A;  4NQK E;  2ZCB A;  3UGB B;  4JIO U;  1V9J A;  2KVR A;  2XBB C;  2L76 A;  2FIF A;  4W9H A;  2A5U A;  5GMV A;  4W9J A;  3LDZ E;  3WIM A;  1C1Y B;  2BGF A;  2XK5 A;  3A4R A;  3JSV A;  4BBN C;  2DZI A;  4GDK B;  3L54 A;  3ZTC A;  1GC7 A;  2LXA A;  3A4S C;  2O6V D;  1NDD A;  4IM2 A;  3QA8 A;  1KOT A;  3DCG A;  2DYB A;  5J18 A;  2DZK A;  4WAA A;  3JYU A;  1KLV A;  3C0R B;  3O65 B;  4YL8 A;  2Z0D B;  3A9K A;  4G3X B;  4BOS C;  2D10 A;  3HHM A;  4ASW C;  2DZM A;  2HJ8 A;  2RGF A;  4WJP A;  1P1A A;  2CU1 A;  2MSE D;  1KJT A;  4IUM B;  4ZDV A;  3A33 B;  4XZ4 A;  2K8B A;  2LRU A;  2KDF B;  3NS8 A;  3W1Y A;  4ANV A;  2I1K A;  2MBB B;  3AU5 A;  1WF9 A;  4F7Z A;  4MSM B;  2M4N A;  3PRP B;  4AP4 C;  3B08 A;  2GOW A;  2D07 B;  2LGD A;  1J8C A;  3T9L A;  4KIK A;  5EDS A;  2LVQ A;  4J6I A;  3VAW A;  2WWZ A;  2BYF A;  2LVO A;  1YD8 U;  3Q3F A;  3VUX A;  1NI2 A;  2OJR A;  2Z0E B;  3ZW3 A;  3APC A;  2V4L A;  2WX0 A;  2R2O A;  4K1R B;  4BFR A;  1GC6 A;  3SD5 A;  4E3C A;  2ZEQ A;  4NPN A;  3QIJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...