3SDLC

Crystal structure of human isg15 in complex with ns1 n-terminal region from influenza b virus, northeast structural genomics consortium target ids hx6481, hr2873, and or2
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
151
structure length
151
Chain Sequence
DLTVKMLAGNEFQVSLSSSMSVSELKAQITQKIGVHAFQQRLAVHPSGVALQDRVPLASQGLGPGSTVLLVVDKCDEPLSILVRNNKGRSSTYEVRLTQTVAHLKQQVSGLEGVQDDLFWLTFEGKPLEDQLPLGEYGLKPLSTVFMNLRL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Non-structural protein 1
publication title Structural basis for the sequence-specific recognition of human ISG15 by the NS1 protein of influenza B virus.
pubmed doi rcsb
source organism Influenza b virus
molecule tags Viral protein/antiviral protein
total genus 37
structure length 151
sequence length 151
chains with identical sequence D
ec nomenclature
pdb deposition date 2011-06-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00240 ubiquitin Ubiquitin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 3sdlC02
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 3sdlC01
2LVQA 3DVNV 2WDTB 1YD8U 4HPLB 3M95A 2DYOA 2DX5B 3KUDB 4F7ZA 4BVUC 1WFYA 1NBFC 2RPQA 2V1YA 3QHTA 4FJVB 2REXA 2KJ6A 2KHWB 3DVGX 4BOZB 1TZ1A 1WJNA 2L8JA 3SHQA 4BKGA 2LASA 2JWZA 2OOBB 3I3TB 4GN1A 3HHMA 4NY0A 2DZKA 2KQSA 3JW0X 3KUZA 5IA7A 2KMAA 4HDQA 4MSQB 5KHOA 1TBEA 3DBLI 3L13A 4FBJB 4DDID 4WJNA 2PEAA 4FHKA 3V6EB 2C9WB 4IWOA 3QAQA 3C0RB 3QIJA 5LXIB 4JQWC 3VDZA 2AL6A 4EZKA 2PE9A 3PT2B 2ZPYA 2KWUB 2W9NA 3S2AA 4AP4C 3ZNHB 5DPWA 2KN5A 2ZZPB 2IY0B 4E3CA 1S3SG 1E8WA 1WMHA 4W9EA 3VVWB 2N7DA 4GDLA 3OJ3A 2ZNVC 2GBRA 2NBVB 3JSVB 3A1QA 2K39A 5EDSA 3R3MA 3APFA 5D94A 4IWQA 2B3AA 4G50A 4KIKB 3EECA 3VUYA 4EKUA 4W9LA 4JL9A 1SE9A 3ZKJC 1IPGA 1WXSA 1ZGUB 3W1SC 2MA9B 3A9KA 3VUWA 3WIMA 2KWCA 2LRWA 4NNJB 5HKHA 4ZDVA 5AZFA 3PLVA 2A4ZA 4BBNF 3VUXA 5CX3A 1UBQA 2D2QA 3V6CB 4AOFA 4WWPA 3VTVA 4MEMA 3AU4A 3V62A 3SDLC 2MP2B 4KV2A 2KTRA 2CHZA 3H7PA 2L76A 1RAXA 4ANWA 4FJYA 3TJPA 1XD3B 4DDGD 2KKCA 1P3QU 2RD0A 1WE7A 4FHJA 4RM9A 3APDA 2D3GA 1V9JA 2DHZA 3APCA 1X1MA 1PQSA 2FUHB 1WGDA 2FCQA 3ZO5B 4BKTA 4MSMB 4FA6A 2UWQA 2GOWA 4K7UA 4GIVA 4ICUA 3W1SA 1WE6A 2FCSA 2CHXA 3PSEB 4WAAA 3EFUA 3QC8B 1NI2A 2N9XA 4BBNC 4HXDA 1E8YA 3NOBA 3TCAA 3LDZE 1R4MI 4ANUA 3ZDTA 3RZFA 3AXCA 4LJPB 4K7WA 1SGHA 1WGRA 2N1WA 4MJSB 5TR5A 1XT9B 2HTHA 2UYZB 1IYFA 2LD9A 2MBEA 4W9HA 2O2VA 3QX1A 1KM7A 2BYEA 2Y5BB 2KDEB 5J17A 3WAOA 4FULA 4A20A 1OTRB 2KDBA 3ZNZB 4HVBA 3U30A 3L54A 1WY8A 3BINA 4MGKE 2K6DB 1QZEA 2N7EA 3B0AA 2G4DB 5JH5C 2ZCBA 4OVVA 1WX7A 3UGBB 1WGHA 4KDLB 1E7UA 2NS5A 2LWPA 3L0WB 2D11A 5JHBA 4A3OA 4HDOA 4IW0A 2LZ6A 4CO7A 2DYMA 2MBOA 4EOYA 2Z59B 3O65B 2WYQA 3VH3B 2IZVB 3OJ4B 1V5OA 4NAWA 3TIXA 4M0WB 1WRDB 2AL3A 5DPSA 4HWIB 2KC2A 3N30A 4DBGA 2JY6A 3GOEA 3A9JA 1GJZA 4II2B 3B08A 4MDKE 5LLIA 3RT3B 2RGFA 2JT4B 2HJ8A 2BF8B 2V3SA 3DOWA 2D10A 3HK0A 2C7HA 2L00B 4K7SA 3N3KB 4W9CA 2C60A 4GMVA 2FNJB 3TL5A 3VFKA 3ZTDA 3PZDA 2VRRB 2DENB 3A4SC 3L16A 2CHWA 2KTFA 2MBQA 5E6PA 2NPTA 2ZJDA 2JUOA 1OEYA 3V60A 1YQBA 1UGMA 1WGYA 3PS6A 3PV1A 4KSLC 2IO3B 4GGQA 2DAFA 3D32A 2WX1A 1OQYA 5JZEB 1RRBA 3V61A 2O6VA 2KWVB 4PS7A 4PS8A 5DPTA 4IWPA 2FIFA 1J19A 1WMHB 3DVGY 1WXAA 3ZRFA 2M17A 1WGGA 4WJPA 3KVFB 3ALBA 1UH6A 5KHQA 3QCAA 5D6JB 4II3B 2KZRA 4DHZB 2ZVOA 4ICVA 2KMCA 3DQVA 5FR6A 1IP9A 2EMSA 3QQ8B 3ONSA 1P1AA 1WZ0A 2CS4A 2NVUI 4HK2A 2HE7A 3Q3JA 4MM3A 2J0KA 4F8CB 3BY4B 2K1FA 2KNBA 1L7YA 4KSKC 2K6QA 4FADA 4P7IA 4DHZE 2LI5A 4IUMB 4KDIC 1GC7A 1GNUA 3MHSD 4XZ4A 4CYEA 2N9EB 4DWFA 1G6JA 4DHJD 4GDKB 2NBWB 4BKSD 4LJOB 3CSFA 5C1ZA 3QJZA 3WAMA 4FJZA 4ZRJA 2KFKB 1EUVB 1WJUA 2NCNA 2GBJA 2LUEA 4MGZE 3PHXB 4G0NB 2K25A 2ZNVB 1GUAB 4KZ0A 5G55A 1ISNA 4DK5A 2G4SA 3PRZA 2J0JA 3OLMD 1KJTA 3LJ3A 3JSVA 1R4NI 4GSWA 2FCNA 2IO1B 2IY1B 1RFAA 3PPAA 4B9KA 3QARA 2K8CA 4G11A 2CR5A 1GG3A 3DBHI 1V5TA 1WXVA 1YX6B 2FCMA 4WWOA 4G3XB 4IM3A 2KX3A 1E5WA 2KOXA 4HPMB 3H6NA 1WZ3A 3WA0A 2KQ7A 3KYCD 3VHTC 1C1YB 2GBNA 4TQ0A 1UBIA 3HIZA 2LXCA 2QHOA 2M1MA 3AI5A 2ZEQA 1YX5B 3DVNU 2IO0B 2LJ5A 3DCGA 3IVFA 2LRUA 2XEWA 2KANA 3M3JA 2OJRA 3L17A 1RLFA 4TKNA 2M4NA 1JRUA 1EF1A 3HM6X 2JPHA 2MP2A 2XK5A 3RUIB 4E71A 4URKA 1Q5WB 4DHJB 2AEHA 2DZIA 3R7RA 1LXDA 1VCBA 2DZJA 2L0TA 4W9DA 4DXAB 4HLEA 1WM2A 3X0WA 3ZUNA 1Y8RC 2MWSB 4IC7B 4ANVA 2LXAA 1E90A 3NS8A 2M8SA 1Q1OA 3NZSA 4X57B 2MW5A 2BYVE 3T9LA 4NJ6A 1TGZB 5E6OA 3EHVA 3AULA 1YIWA 3R66C 2JVCA 5D7GA 1WX9A 4PYUA 3DBRI 3KYDD 1UD7A 3JYUA 4W9KA 4EUTA 5L95C 1E8ZA 1LM8B 3PHWB 2AYOB 2I1JA 3CF6E 4MJSA 3PRPB 1WJ4A 1WR1A 3ZNID 2GMIC 1FXTB 5GMVA 5LXHA 4AJYB 2BWFA 3B1LX 3PRMB 2FAZA 1K8RB 3CMMB 1H8CA 3KH0A 2LGXA 3H1UA 1WR6E 3N32A 4EZJA 1TTNA 3W1YA 3QA8A 2C5LC 1AARA 2LVPA 1WF9A 2EMTA 1V80A 4NQLB 4WQOB 2ZCCA 1WIAA 5G2NA 1UELA 1U4AA 1VD2A 3DDCB 4HJKA 2KFJA 4WJOA 3GZNI 2K8BA 1WXMA 2L0FA 3H9DA 4PS3A 1A5RA 2HD5B 2MQJA 1ZKHA 4JIOU 1I35A 5AZGA 4B6WA 3U8ZA 2KXJA 4GU2A 1Q0WB 3VH4B 4EEWA 4EZLA 2EKEC 4GDLB 2RSUA 4W9FA 3WANA 4I6NB 3A1QB 3UINB 3ZLZA 1V81A 1Z5SB 3MJWA 4GOCA 2JZZA 5CTRC 2PE6B 3NZUA 2J0MA 2N9PC 4ANXA 3IHPC 3A4RA 1LQBA 4K1RB 1J0GA 4JLCA 3WALA 3ZNGC 4LCDE 3RD2A 2JZ3B 5C23A 3ZVVA 5CHFA 3VQIA 3A9KB 4XX5A 4NJ7A 2MBBB 3K9OB 1V2YA 1WM3A 2I1KA 1EF5A 4MGIE 1T0YA 4EFOA 3M62B 1UZXB 4MH0E 1Z2MA 3UQBA 3NHEB 3A33B 4N9F4 2M0XA 2XBBC 3VXWA 1P98A 1SIFA 3UF8A 3SD5A 2KJHB 2IYDB 2LGYA 1EO6A 4ZRIA 2NBUA 5DPRA 4BOSC 1P0RA 1V6EA 3VAWA 2KTRB 3H7PB 2KK8A 2FIDA 4E74A 1WH3A 2KDIA 1E7VA 5L83A 4FN2A 3ZDMC 2BPSA 1I42A 1H4RA 5BO4B 4W9JA 4PYZA 1WJ6A 1WX8A 4WWNA 3ZW3A 1J8CA 1BT0A 3HM3A 5D2MB 2DYBA 2V4LA 1KLVA 4OVUA 3ZIMA 4KIKA 3QWZB 3R7QA 2MBHA 1KOTA 1E8XA 2PJHA 2MSED 3ECIA 2C7MB 2N4FA 5IAAC 4IM2A 4JGHB 4GDKA 1MG8A 3M63B 4W9GA 2R2QA 3OAWA 4IM0A 1S1QB 1WYWB 2WX0A 5E6NA 4B95A 2BGFA 4ZRKA 3L10B 4KVGB 4AWJA 4RM8A 2A5UA 4K81A 2MX2A 2KFKA 2MLBA 2K8HA 4IG7B 2XK5B 3JVZX 3UQAA 2GBKA 3TMPB 3H7SA 2C7NB 3RYTA 4AJWA 3K9PB 2O2VB 1V86A 3DBSA 4W9IA 2LGDA 1XQQA 2KD0A 2BYFA 1P9DU 2JXXA 3IG3A 4I6PA 4M8NA 4A3PA 3MTNB 3X23A 2KVRA 3EC8A 4TUUA 1L2NA 3ML9A 2JRHA 3PTFC 5CHWA 4AUQC 2G3QB 2BWES 5AEKB 2ZPNA 2N1VA 2L7RA 4HCNB 4HCPB 4GXBA 4BFRA 2ZVNA 2O6VD 2WWZA 3PVLA 4RMAA 3UIPB 2PPHA 4GB9A 4XC2A 2IBIB 2Z0DB 3AU5A 4LDTD 2KLCA 3U7DA 2G45B 3PLUA 1OEYJ 4NAWB 3VTWA 2BKFA 5J2RA 3IFWB 2AWTA 1ZW7A 1F9JA 2MRPA 3ENEA 3WAPA 3KUCB 3RZWC 3Q3FA 3PREA 5CHVC 5AZHA 5DCNA 2LVOA 1WI0A 3A9JB 3VTUA 1V49A 4BKSA 2KLGA 4CHKA 2Z0EB 4YL8A 3SU8X 4MELA 3DPDA 3P2BA 2L05A 2R2OA 3QK0A 3RCZA 2KDFB 2ASQA 2J7QB 4J6IA 3KW5B 2KO3A 2NR2A 1CMXB 4TQ1A 4M8MA 2GBMA 2CKHB 2L3ZA 4FLHA 4TV3A 3RULA 3ZRCA 1D3ZA 5J18A 2D07B 4WJQA 2MCNB 4NPNA 2CU1A 1NDDA 1GC6A 3ML8A 3T8MA 2NPTB 2DAJA 1YJ1A 1C3TA 2JRIB 3PGEA 4ZYNA 3L08A 4NQKE 5JHAA 1HE8A 2KC1A 2O6VB 3TBLD 1OGWA 1M94A 2KJRA 4KZCA 3ZTCA 4F1SA 3CSTA 2RR9A 4LDTB 4I6LB 3UIOB 4MGYE 3IBEA 2YLMA 2JF5A 2KX0A 2DZMA 2BKRB 4ASWC 2YVCA 2IO2B 1LFDA 3NY5A
chains in the Genus database with same CATH superfamily
2LVQA 2WDTB 2KT7A 2DX5B 2NMQA 3Q3MC 4BVUC 2RPQA 1MHXA 2ICIA 4L23A 1IGDA 2REXA 3RNEC 1FPYA 2L8JA 1C4PA 2WGSA 2KQSA 2KMAA 4K3BA 3N1XC 1L0XB 3DBLI 4RGMA 2PEAA 3FILA 2OHFA 2WNMA 3B2FA 2ON8A 4JQWC 2W9NA 1WMHA 2M19A 2N7DA 3T3NA 2GBRA 2D3AA 3JSVB 5EE9A 3MC9A 3KWLA 5D94A 3U4EG 1JALA 3VUYA 3IT4B 1YOVB 1SE9A 3AEBB 3BYTB 1FNUA 1ROEA 2LRWA 2QIEB 3HUIA 3U2SC 3I57A 2KDMA 4AOFA 4WWPA 3V62A 1SSNA 1QQRA 1MI0A 4FJYA 1XD3B 1Y56A 4FHJA 1WE7A 4RM9A 2DHZA 2FUHB 4IDIA 4MSMB 4K7UA 2GOWA 4ICUA 3ZJUA 1WE6A 2FCSA 2ZW1A 3RNCC 2BYTA 1R4MI 1YNTE 1SE3A 3C19A 3RPFC 1C4CA 3AXCA 1IGCA 4K7WA 1WGRA 2N1WA 5TR5A 1XT9B 1IYFA 3NVYA 4W9HA 2WXQA 4N58A 5J17A 4A20A 2KDBA 4HVBA 1FM0D 3ZGZA 4OVVA 4LTUA 3BVMA 5JHBA 4WIPA 4A3OA 4IW0A 4CO7A 1PFDA 1ZOYB 3O65B 5EE1A 2KN4A 3P4QB 1D5ZC 1TS3A 3N30A 1GJZA 1E6EB 5LLIA 3AV8A 3RT3B 4ARCA 2PVOD 1VLBA 2BF8B 3HK0A 4ZYSA 3N3KB 4W9CA 2FNJB 3TL5A 5HFYA 5FR3A 3A4SC 3L16A 2KTFA 2JUOA 1YQBA 1UGMA 1WGYA 2MH7A 5H8YE 3DWMA 2DAFA 3D32A 5JZEB 2KWVB 4PS7A 1V1PA 1WMHB 3AECB 2M17A 4WJPA 3QCAA 4ICVA 5FR6A 2DNFA 1QLBB 3RNGC 1P1AA 5LNK1 3EFCA 4HK2A 2H89B 3Q69A 1JWMD 4P7IA 2BS2B 1CZPA 4KDIC 3W5VB 2NBWB 5T8IA 4MGZE 3PHXB 4G0NB 2BQQA 1J7AA 1KJTA 2VZKD 4KX6B 3PPAA 2AQ1B 3V05A 2CR5A 1K52A 1YX6B 2FCMA 2GLSA 1N5WA 4FXCA 4IM3A 1SE2A 1E5WA 4TQ0A 1UBIA 3AEFB 2LXCA 1HXYD 2M1MA 1P7EA 2WXPA 2OJRA 1Q5WB 5BYQA 1YJIA 3R7RA 1N61A 4LNKA 4DXAB 1J7CA 2WXRA 1SJHD 1WM2A 1Y8RC 4ANVA 5EE3A 3NZSA 4X57B 1RWSA 2BS3B 2VZKB 3EHVA 3R66C 2JVCA 5D7GA 1WX9A 1AWDA 3DBRI 1FEHA 2AYOB 4MJSA 2Q5WD 2G1EA 3SFEB 2XN9C 2GMIC 2L1AA 1FXTB 5GMVA 3Q14C 4UDUC 4YXDB 3H1UA 3H8HA 3AE6B 1AARA 4XDDA 2EMTA 1V80A 4NQLB 4WQOB 5G2NA 1K50A 3U7ZA 1U4AA 3TSSA 3U52E 3DDCB 1XEEA 4WJOA 1HEZE 1TKGA 2V4IB 1WXMA 4PS3A 2HD5B 3MJ5A 3PZ7A 4JIOU 4GU2A 2L32A 4GDLB 2RSUA 4W9FA 1T0SC 3NZUA 3TEZA 1KF6B 3AE3B 1L0VB 1QKZA 2PW9A 2WXGA 5C23A 4NJ7A 2FE8A 4YSYB 1V2YA 1TKYA 4MGIE 4AS1A 4EFOA 1Z2MA 4HJGE 2M0XA 4XE0A 2WU2B 4CQNA 1SIFA 3UF8A 3VRBB 2LGYA 4ZRIA 5DPRA 2BS4B 3VAWA 2BPSA 1H4RA 3C8YA 2V4LA 2LFIA 1FMAD 1FXAA 1KOTA 2NTSA 1F2RC 4A90A 3MC8A 4W9GA 1JQ4A 3OAWA 5E6NA 1YN4A 1TJEA 2A5UA 2WXHA 2K8HA 4IG7B 2RDBC 3SR6A 4IOIE 3TMPB 3H7SA 4AJWA 1TY0A 1V86A 4HRSA 3VR9B 1FFUA 2EELA 4I6PA 3X23A 2JRHA 1MFWA 3GZNB 3DHGC 2L7RA 2IPKD 2O6VD 1T6BX 3UIPB 2Z0DB 3AU5A 1NYQA 3URYA 3PLUA 1K51A 1WXQA 3IFWB 3KUCB 3PREA 5CHVC 5AZHA 1QF6A 3VTUA 1M4VA 4YL8A 3SU8X 4ACFA 3P2BA 2PVGC 2YEPF 1EU4A 2J7QB 4J6IA 3KW5B 5BMHA 3IAS1 2CKHB 2L3ZA 2IGHA 3ZRCA 4LNIA 5J18A 1ESFA 4NPNA 1NDDA 2DAJA 1YJ1A 1C3TA 2JRIB 4ZYNA 5JHAA 5D3IB 2BT6A 2O6VB 4M0WA 2RR9A 5IOIA 4MGYE 2WDRB 2YLMA 2JF5A 2KX0A 2DZMA 3IVFA 3RNBC 4HPLB 3M95A 2Z8LA 4F7ZA 2WXKA 1K53A 1NBFC 1STEA 3SHQA 4BKGA 2OOBB 1F52A 3BZDB 5IA7A 1WGKA 4WJNA 3V6EB 2HTME 3TEXA 2BW2A 1T0RC 3VDZA 2AL6A 3PT2B 3P1MA 4HEA1 2IY0B 4E3CA 2ZNVC 1XCTL 2NBVB 4C56C 3A1QA 5EDSA 2N9KA 3N1ZC 1BXTA 2R61A 1C78A 1L5PA 4J3OD 1L0YB 1IPGA 1WXSA 3AEGB 3A9KA 3VUWA 3WIMA 2KWCA 1ET6A 4ZDVA 2A4ZA 4BBNF 1ZDVA 1ZDXA 3VUXA 1ET9A 1UBQA 3V6CB 1JROA 2MP2B 3H7PA 2CHZA 4ANWA 5H92C 3TJPA 3APDA 3HRDD 3OG5A 1X1MA 1B1ZA 2V3PA 4BKTA 4DXFA 2UWQA 3W1SA 3Q3NC 2CHXA 3PSEB 3QC8B 4HXDA 1E8YA 3NOBA 1CJEA 3KWVA 4YT0B 1VZ8A 3ZDTA 4RF0A 4A8XC 2LD9A 4YSZB 1KM7A 1N6ZA 3EGRA 4FULA 4BAXA 1MHHE 3U30A 3L54A 1WY8A 4XWWA 2K6DB 3OWEB 5JH5C 2G4DB 4LNNA 3UGBB 3DBLB 2LWPA 4WAFA 3L0WB 2D5GA 2WS3B 4HDOA 3Q8CA 2LZ6A 2MBOA 4EOYA 2WYQA 2K3UA 4YWGG 4M0WB 3B9JA 3VR8B 2KC2A 2JY6A 3GOEA 2W55A 3A9JA 2INNE 3MHZA 3B08A 1GAQB 2JT4B 4LLGM 3RI7C 3DOWA 4TSSA 5IKCM 4YTNB 2C60A 3MFGA 4GMVA 3VFKA 3ZJTA 3ZTDA 4RFBA 1OEYA 3PS6A 2IO3B 2WX1A 4JPSA 3V61A 4ARIA 2YEPB 4B0EA 2FIFA 3DVGY 2IJ0A 3FAHA 4BZAA 2W3SA 3KVFB 5D6JB 4II3B 4DHZB 2ZVOA 3DQVA 2BB5A 1IP9A 4R3DA 3BWUD 2CS4A 2NVUI 3VRAB 3Q3JA 4HROA 4MM3A 2KNBA 1R4MB 4DHZE 1GC7A 4XZ4A 3RNAC 4DWFA 4GDKB 2B76B 4BKSD 4LJOB 3ZJVA 1QOGA 1HTQA 3QJZA 1UNSA 2KFKB 1JWBD 3GE8C 3PRZA 3LJ3A 1TS4A 2GB1A 2H88B 1JWSD 2IO1B 1MJDA 2KAJA 4B9KA 1YJJA 3RN9C 5GXGB 1FRDA 1WXVA 2KX3A 3AE7B 3WA0A 1ZPSA 3T3OA 3KYCD 2GBNA 3HIZA 3AI5A 1N5XA 3MP9A 4JWUC 1VZ6A 3DCGA 3GS2A 2LRUA 2XEWA 2KANA 3M3JA 1EF1A 2XK5A 2DZIA 1VCBA 2DZJA 2MHJA 4W9DA 4HLEA 3X0WA 2MWSB 4IC7B 1YQ4B 2LUMA 2M8SA 1I4XA 4A55A 3ABVB 2MW5A 4NJ6A 1EWCA 1TGZB 1E10A 3AULA 1PUTA 2RMMA 1UD7A 3EUB2 1NENB 5L95C 1XLPA 3CF6E 2HJ1A 1WJ4A 3ZNID 1T0QC 4NJCA 3P63A 3B1LX 1BUIC 2QEJC 1H8CA 1TYGB 2HDEA 2KMMA 3KH0A 2LGXA 1QOFA 1WR6E 3QA8A 2JQRB 1WIAA 2AQ3B 1UELA 2RDHA 3BK2A 1VD2A 3P42A 2K22A 3FILB 4WWMA 5IP4D 2DBYA 3NRZA 1UWMA 4I6NB 2KACA 2PE6B 2J0MA 3AB5A 3IHPC 1XLNA 4IKGA 2WXMA 3Q8EA 3WALA 2DLBA 3EA6A 2JZ3B 3ZVVA 5CHFA 2UU7A 4JWSC 2E3TA 4XX5A 2I1KA 5G5HA 1T0YA 3M62B 3NHEB 3A33B 1P98A 1SJED 3SD5A 4BOSC 2IYDB 1EO6A 2BB6A 1FNVA 3FKYA 1WH3A 2KDIA 3NVZA 5L83A 4C00A 3ZDMC 4PYZA 1WX8A 4WWNA 3DBRB 1J8CA 2ZW0A 5D2MB 4OVUA 4ZOHC 4KIKA 2MBHA 1E8XA 2MSED 2C7MB 4IM2A 2INDC 4JGHB 1MG8A 3M63B 2R2QA 3RNFC 2LEKA 1NEKB 2XK5B 3JVZX 3UQAA 2C7NB 3RYTA 1MG4A 3DBSA 2LGDA 1YN5A 2KD0A 1P9DU 3IG3A 4A3PA 1ZXHA 3FC4A 1WRIA 5IN7A 4TUUA 4C4VA 3PTFC 2BWES 5AEKB 4GXBA 4BFRA 2AX5A 1ENFA 3AE5B 1TS5A 2WWZA 2PPHA 4XC2A 5IO9A 2G45B 2WXJA 2WDQB 3Q8FA 2BKFA 2AWTA 5EE0A 3RZWC 1V8CA 4GLSC 2WU5B 4MELA 3DPDA 2L05A 3RCZA 2KDFB 1UF0A 1YMHE 4TQ1A 4TV3A 4FLHA 3RULA 1D3ZA 3ZQ4A 2DWQA 3GB1A 2MCNB 2BBCA 3ML8A 2J53A 3Q8AA 3P4SB 1F2RI 4HKZE 4NQKE 4Q2JA 2KC1A 1DOXA 3ZTCA 1V1PB 2KJRA 4KZCA 4P1BC 3CSTA 1N62A 2WQYB 4S0RA 2BKRB 4ASWC 4C7ZA 3NY5A 4KGTA 2LHEA 3QHTA 2JYTA 4FJVB 1TY2A 2KHWB 2Y3AA 1TZ1A 1WJNA 4NY0A 2XNAC 3I3TB 3HHMA 2DZKA 3KUZA 4RGOS 3RMKC 3B2GA 1RM6C 2C9WB 2EKIA 4RF1A 4IWOA 4XYCA 1V97A 5LXIB 4XGAB 4EZKA 2V3NA 2ZPYA 3S2AA 4AP4C 1E0ZA 2KN5A 2ZZPB 1E8WA 3VVWB 2QILA 2ACZB 4IWQA 4EE2A 2B3AA 3NUHB 4KIKB 2KWDA 3TEYA 4M01A 4YTMB 4OHJA 4WH4A 1FNWA 3ZKJC 1ZGUB 1WSPA 2MA9B 4PK1A 4NNJB 5AZFA 3PLVA 1BMLC 3W5UB 3W9CB 5CX3A 3BK1A 3SDLC 1DGJA 2J42A 2IGGA 2KTRA 1RAXA 3IXSA 1MVKA 1P3QU 2RD0A 1CQVA 2LHDA 2N0SB 3APCA 4PT5A 1PQSA 1XLQA 1WGDA 2FCQA 4NZLB 1FIQA 1QT9A 4GIVA 4WAAA 1NI2A 3TCAA 2PIAA 4ANUA 4NAMA 1RYJA 3R2TA 4LJPB 1D6EC 1SGHA 2FBWB 4MJSB 5BMGA 2HTHA 2MBEA 2O2VA 1NI3A 4KGRA 1AW7A 2QC8A 3WAOA 1HTOA 1OTRB 2ONQA 1QZEA 1V1OA 1JMLA 3KLSX 4KDLB 1E7UA 2CU3A 3Q6BA 1EU3A 1R7SA 2Z59B 2IZVB 3OJ4B 4NAWA 1OQRA 1WRDB 5DPSA 4C80A 4HWIB 2IDYA 3AE1B 1HA5A 2LJIA 4US9A 4ITKA 3ZXVA 2D10A 2L00B 3AMZA 3GP7A 2DENB 2CHWA 5E6PA 2NPTA 1I4QA 3TUOA 4GGQA 4TMAB 1RRBA 3W2DA 1TT5B 1E9MA 1WXAA 1WGGA 1UUPA 2PLPA 1UH6A 5KHQA 4N6EB 2KZRA 1FD6A 1XCQL 2KMCA 1PYWD 1WZ0A 3BVZA 4XDCA 1D5MC 4KSKC 1C79A 2K6QA 3PO0A 2LI5A 4CYEA 1JCKB 1GNUA 1C77A 2JWUA 2N9EB 2V0GA 3CSFA 5C1ZA 2QJLA 2INCC 1C4AA 4LNOA 1EUVB 1WJUA 2GBJA 3E56A 4LK0M 4KZ0A 1SEBD 1ISNA 4DK5A 2G4SA 2G9HD 3JSVA 1R4NI 1FFVA 4GSWA 1FXIA 1RFAA 3KQ4A 2K8CA 1DYQA 1GG3A 3DBHI 1SF0A 4YSXB 4WWOA 4G3XB 2I38A 1WZ3A 2KQ7A 2L52A 3VHTC 2QHOA 4M02A 2MJEA 2IO0B 2LJ5A 3L17A 1RLFA 1JRUA 1TZOA 3HM6X 3RUIB 4E71A 2J4XA 1F1HA 4URKA 4L1BA 1LXDA 1KLUD 5D3DA 3ZUNA 3Q2AC 1IUEA 2LXAA 4MH8A 1Q1OA 4ZHPA 5E6OA 2MEKA 1YIWA 4PYUA 3JYUA 4W9KA 5JXVA 1QILA 1E8ZA 1LM8B 2WXIA 2LGSA 1WR1A 1SIJA 2LGIA 3PRMB 2CJNA 2FAZA 1K8RB 2RPVA 3CMMB 3N20C 3N32A 4EZJA 1GPXA 3RFZB 3W1YA 2LVPA 1WF9A 2ZCCA 5HHDG 5E6JA 2KFJA 2JYEA 1N63A 2L0FA 3H9DA 1FO4A 1A5RA 2MQJA 4B6WA 3U8ZA 2KXJA 1Q0WB 4JX1C 3VH4B 1SBBB 4EEWA 2EKEC 1PGXA 4RCOA 3LXFA 3WANA 3A1QB 3UINB 3ZLZA 3MJWA 4GOCA 4YTPB 5CTRC 3NZ3A 2N9PC 3A4RA 3HVDA 1J0GA 4JLCA 2MJDA 3RD2A 3VQIA 3A9KB 2MBBB 3K9OB 1P7FA 2JX5A 4MH0E 5C3JB 3UQBA 4N9F4 5C2TB 2KJHB 2NBUA 1V6EA 1UGJA 3H7PB 2KK8A 2FIDA 4E74A 1E7VA 1OFFA 3ZXRA 3E9SA 3BIID 1I42A 3NS1A 2KVZA 5I4DA 2KYWA 2WDVB 2DYBA 3ZIMA 4RGNA 1NYRA 3J9CA 5HI1A 5IAAC 2V9HA 2JZPA 2WX0A 2K0PA 4ZRKA 4KVGB 1I4HA 2MX2A 2MLBA 4A9AA 4L2YA 1PDXA 2FUG1 4WURA 3K9PB 1A70A 1MPEA 5AUKA 4W9IA 4ZRPA 1KRHA 1WYGA 4M8NA 3TEWA 3I63C 2KVRA 4AUQC 2M0AA 3AEEB 2N1VA 3UI3A 2WHIA 3Q3OC 5TSSA 3PVLA 1ZP0B 4GB9A 2IBIB 3LB8C 1LO5D 5FKAC 1OEYJ 1L4ZB 1XO3A 3VTWA 5J2RA 1ZW7A 3ENEA 3WAPA 3Q3FA 2K5PA 1KLGD 2LVOA 5DCNA 1WI0A 3A9JB 1V49A 1RFKA 4KKJA 2KLGA 2NTTA 2WXFA 4CHKA 5BMIA 2Z0EB 1SXTA 2R2OA 4O1NA 3QK0A 2WLBA 2ASQA 3DHIC 2KO3A 3N9YC 4M8MA 2QSDA 2GBMA 2OEDA 3LYYA 3R2IA 2D07B 3T8MA 1GC6A 1NVID 1YN3A 3PGEA 2JU6X 1HE8A 1QOBA 4OZAA 3TBLD 3AEDB 4P6VF 4DXGA 1I4PA 4I6LB 1PGAA 3IBEA 1I4GA 2YVCA 2IO2B 1LFDA 3DVNV 1YD8U 4LNFA 2J52A 2DYOA 3AE2B 3KUDB 1WFYA 2V1YA 1DOYA 2WP9B 2KJ6A 3DVGX 4MM3B 4BOZB 2LASA 2JWZA 4GN1A 3CWIA 3JW0X 4HDQA 4MSQB 5KHOA 1PGBA 1TBEA 1VR9A 3L13A 4FBJB 4DDID 4FHKA 1D4BA 3AM9A 1JWAD 3QAQA 3C0RB 3QIJA 1F0ZA 2N7JA 2LMCA 2PE9A 2KWUB 3ZNHB 5DPWA 1S3SG 4W9EA 2E6XA 4GDLA 2QCZA 3OJ3A 1VJKA 2K39A 3R3MA 3APFA 1XLOA 4OVZA 4G50A 4D2KA 1EWYC 3EECA 4EKUA 4W9LA 2MJ3A 3P4PB 4JL9A 3W1SC 1SB3C 1SE4A 5HKHA 1L6UA 3IAM1 2Y5CA 3N1YC 3HVZA 2D2QA 1KH0A 3VTVA 4MEMA 3AU4A 1AN8A 4KV2A 4DDGD 2L76A 3DHHC 1VDVA 2KKCA 2TSSA 2D3GA 1V9JA 1D5XC 3ZO5B 4FA6A 2Y5PA 1TS2A 3EFUA 2N9XA 4BBNC 1XXGA 3LDZE 3RZFA 1WWTA 5G5GA 3ETRA 1AYFA 2UYZB 3AE9B 3QX1A 2BYEA 2Y5BB 2KDEB 3MC0B 3ZNZB 3BINA 4K3CA 4MGKE 2PKOA 3CIRB 4B0MA 3B0AA 2N7EA 2ZCBA 1WX7A 1WGHA 2NS5A 4HKQA 2D11A 2PMVA 1HZ6A 1I4RA 2DYMA 3R8BA 3VH3B 3TIXA 1V5OA 2INPE 2QDFA 2AL3A 4DBGA 1JRPA 4HPPA 4II2B 4MDKE 4N59A 2RGFA 3L4PA 2K9XA 2HJ8A 2V3SA 4MACA 2C7HA 2W54A 1FCCC 4K7SA 3GE3C 4JE3B 3PZDA 3I9V1 2VRRB 3AH7A 2MBQA 1LGRA 2ZJDA 3V60A 4KSLC 3PV1A 1OQYA 1YQ3B 2O6VA 4KGSA 4PS8A 3NVWA 4XWTA 5DPTA 3V3XA 4IWPA 1J19A 1T3QA 3ZRFA 1VRAB 3SFDB 2BVCA 3ALBA 4C7YA 3SEBA 2EMSA 3QQ8B 4REZA 3ONSA 1Q10A 2HE7A 2J0KA 4F8CB 3BY4B 2K1FA 4ZHOA 1C76A 1L7YA 5BYRA 4FADA 4AQ7A 2CJOA 4IUMB 4KKIA 2D3BA 3MHSD 1G6JA 4DHJD 3WAMA 1DOIA 4FJZA 4ZRJA 2NCNA 3WCQA 2LUEA 2K25A 1I7HA 2ZNVB 1GUAB 5G55A 1KFYB 2J0JA 3OLMD 3IT6B 2SAKA 5FK9C 2FCNA 2IY1B 4C4VB 3QARA 4G11A 1V5TA 2IGDA 3DWGC 2KOXA 4HPMB 3H6NA 1C1YB 1IBXA 2BTEA 4P16A 4M00A 2ZEQA 1YX5B 3DVNU 2SEBD 1N60A 3AE8B 4TKNA 2M4NA 2JPHA 2MP2A 2N9LA 4DHJB 2AEHA 1ACCA 1ZUD2 4ZRQA 2L0TA 1OQQA 4DQOC 1VZ7A 3BYYB 4RNAA 1E90A 3NS8A 4MT5A 2KQ4X 2BYVE 3T9LA 4OZBA 3KYDD 4USAA 1J7BA 4EUTA 3PHWB 2I1JA 1FRRA 1HQRD 3PRPB 3AE4B 5LXHA 4AJYB 2BWFA 2VH2A 1B9RA 1ZXIA 1QOAA 3NJTA 5AUIA 1TTNA 1T5XD 2C5LC 3ZYYX 2QMTA 1KTKA 4HJKA 1TIFA 3GZNI 4OW0A 5BYSA 2K8BA 1L6VA 1C9FA 1R4NB 1ZKHA 1I35A 5AZGA 3DBHB 4EZLA 1UWXA 1GB1A 1V81A 1Z5SB 2JZZA 4ANXA 4S17A 2AQ2B 1LQBA 4K1RB 3O13A 3ZNGC 4LCDE 1ZE3D 4P1CC 2X38A 3Q8BA 1WM3A 1EF5A 1UZXB 2WXNA 2RDGA 3BVGA 2XBBC 3VXWA 2X8XX 1P0RA 2KTRB 2OJWA 2PTLA 3P4RB 4A6QA 4FN2A 1L4DB 1GB4A 5BO4B 4W9JA 1WJ6A 3ZW3A 4RH6A 1BT0A 1E7PB 3HM3A 1KLVA 3NG0A 5HG2A 3QWZB 3R7QA 1IBXB 4US8A 2PJHA 3ECIA 2N4FA 2WXOA 4GDKA 4IM0A 1S1QB 1WYWB 4B95A 2BGFA 3L10B 1CK1A 4AWJA 4RM8A 2GI9A 1TKEA 4K81A 2KFKA 2GBKA 2VH1A 2O2VB 3PZ8A 1XQQA 2L83A 2BYFA 2JXXA 3MTNB 2M56B 3EC8A 1L2NA 3ML9A 5CHWA 2G3QB 3AN1A 2ZPNA 4HCNB 4HCPB 2W3RA 2ZVNA 4RMAA 4LDTD 2KLCA 4H2AA 3U7DA 2W82A 4NAWB 2I2YA 2MRPA 1F9JA 1HZ5A 1JWUD 4BKSA 1EM7A 4RGTA 1F77A 2WXLA 3AEAB 1FCLA 1GOZA 3NVVA 2NR2A 1CMXB 1XF5L 2JSVX 1JW9D 4WJQA 2CU1A 2GRIA 2NPTB 4WQMA 3L08A 2D3CA 2JXTA 5MPOA 1OGWA 1M94A 4F1SA 4QAYA 4LDTB 3UIOB 4OZCA 3I5JC
chains in the Genus database with same CATH topology
2LVQA 3DVNV 2WDTB 1YD8U 4HPLB 3M95A 2DYOA 2DX5B 3KUDB 4F7ZA 4BVUC 1WFYA 1NBFC 2RPQA 2V1YA 3QHTA 4FJVB 2REXA 2KJ6A 2KHWB 3DVGX 4BOZB 1TZ1A 1WJNA 2L8JA 3SHQA 4BKGA 2LASA 2JWZA 2OOBB 3I3TB 4GN1A 3HHMA 4NY0A 2DZKA 2KQSA 3JW0X 3KUZA 5IA7A 2KMAA 4HDQA 4MSQB 5KHOA 1TBEA 3DBLI 3L13A 4FBJB 4DDID 4WJNA 2PEAA 4FHKA 3V6EB 2C9WB 4IWOA 3QAQA 3C0RB 3QIJA 5LXIB 4JQWC 3VDZA 2AL6A 4EZKA 2PE9A 3PT2B 2ZPYA 2KWUB 2W9NA 3S2AA 4AP4C 3ZNHB 5DPWA 2KN5A 2ZZPB 2IY0B 4E3CA 1S3SG 1E8WA 1WMHA 4W9EA 3VVWB 2N7DA 4GDLA 3OJ3A 2ZNVC 2GBRA 2NBVB 3JSVB 3A1QA 2K39A 5EDSA 3R3MA 3APFA 5D94A 4IWQA 2B3AA 4G50A 4KIKB 3EECA 3VUYA 4EKUA 4W9LA 4JL9A 1SE9A 3ZKJC 1IPGA 1WXSA 1ZGUB 3W1SC 2MA9B 3A9KA 3VUWA 3WIMA 2KWCA 2LRWA 4NNJB 5HKHA 4ZDVA 5AZFA 3PLVA 2A4ZA 4BBNF 3VUXA 5CX3A 1UBQA 2D2QA 3V6CB 4AOFA 4WWPA 3VTVA 4MEMA 3AU4A 3V62A 3SDLC 2MP2B 4KV2A 2KTRA 2CHZA 3H7PA 2L76A 1RAXA 4ANWA 4FJYA 3TJPA 1XD3B 4DDGD 2KKCA 1P3QU 2RD0A 1WE7A 4FHJA 4RM9A 3APDA 2D3GA 1V9JA 2DHZA 3APCA 1X1MA 1PQSA 2FUHB 1WGDA 2FCQA 3ZO5B 4BKTA 4MSMB 4FA6A 2UWQA 2GOWA 4K7UA 4GIVA 4ICUA 3W1SA 1WE6A 2FCSA 2CHXA 3PSEB 4WAAA 3EFUA 3QC8B 1NI2A 2N9XA 4BBNC 4HXDA 1E8YA 3NOBA 3TCAA 3LDZE 1R4MI 4ANUA 3ZDTA 3RZFA 3AXCA 4LJPB 4K7WA 1SGHA 1WGRA 2N1WA 4MJSB 5TR5A 1XT9B 2HTHA 2UYZB 1IYFA 2LD9A 2MBEA 4W9HA 2O2VA 3QX1A 1KM7A 2BYEA 2Y5BB 2KDEB 5J17A 3WAOA 4FULA 4A20A 1OTRB 2KDBA 3ZNZB 4HVBA 3U30A 3L54A 1WY8A 3BINA 4MGKE 2K6DB 1QZEA 2N7EA 3B0AA 2G4DB 5JH5C 2ZCBA 4OVVA 1WX7A 3UGBB 1WGHA 4KDLB 1E7UA 2NS5A 2LWPA 3L0WB 2D11A 5JHBA 4A3OA 4HDOA 4IW0A 2LZ6A 4CO7A 2DYMA 2MBOA 4EOYA 2Z59B 3O65B 2WYQA 3VH3B 2IZVB 3OJ4B 1V5OA 4NAWA 3TIXA 4M0WB 1WRDB 2AL3A 5DPSA 4HWIB 2KC2A 3N30A 4DBGA 2JY6A 3GOEA 3A9JA 1GJZA 4II2B 3B08A 4MDKE 5LLIA 3RT3B 2RGFA 2JT4B 2HJ8A 2BF8B 2V3SA 3DOWA 2D10A 3HK0A 2C7HA 2L00B 4K7SA 3N3KB 4W9CA 2C60A 4GMVA 2FNJB 3TL5A 3VFKA 3ZTDA 3PZDA 2VRRB 2DENB 3A4SC 3L16A 2CHWA 2KTFA 2MBQA 5E6PA 2NPTA 2ZJDA 2JUOA 1OEYA 3V60A 1YQBA 1UGMA 1WGYA 3PS6A 3PV1A 4KSLC 2IO3B 4GGQA 2DAFA 3D32A 2WX1A 1OQYA 5JZEB 1RRBA 3V61A 2O6VA 2KWVB 4PS7A 4PS8A 5DPTA 4IWPA 2FIFA 1J19A 1WMHB 3DVGY 1WXAA 3ZRFA 2M17A 1WGGA 4WJPA 3KVFB 3ALBA 1UH6A 5KHQA 3QCAA 5D6JB 4II3B 2KZRA 4DHZB 2ZVOA 4ICVA 2KMCA 3DQVA 5FR6A 1IP9A 2EMSA 3QQ8B 3ONSA 1P1AA 1WZ0A 2CS4A 2NVUI 4HK2A 2HE7A 3Q3JA 4MM3A 2J0KA 4F8CB 3BY4B 2K1FA 2KNBA 1L7YA 4KSKC 2K6QA 4FADA 4P7IA 4DHZE 2LI5A 4IUMB 4KDIC 1GC7A 1GNUA 3MHSD 4XZ4A 4CYEA 2N9EB 4DWFA 1G6JA 4DHJD 4GDKB 2NBWB 4BKSD 4LJOB 3CSFA 5C1ZA 3QJZA 3WAMA 4FJZA 4ZRJA 2KFKB 1EUVB 1WJUA 2NCNA 2GBJA 2LUEA 4MGZE 3PHXB 4G0NB 2K25A 2ZNVB 1GUAB 4KZ0A 5G55A 1ISNA 4DK5A 2G4SA 3PRZA 2J0JA 3OLMD 1KJTA 3LJ3A 3JSVA 1R4NI 4GSWA 2FCNA 2IO1B 2IY1B 1RFAA 3PPAA 4B9KA 3QARA 2K8CA 4G11A 2CR5A 1GG3A 3DBHI 1V5TA 1WXVA 1YX6B 2FCMA 4WWOA 4G3XB 4IM3A 2KX3A 1E5WA 2KOXA 4HPMB 3H6NA 1WZ3A 3WA0A 2KQ7A 3KYCD 3VHTC 1C1YB 2GBNA 4TQ0A 1UBIA 3HIZA 2LXCA 2QHOA 2M1MA 3AI5A 2ZEQA 1YX5B 3DVNU 2IO0B 2LJ5A 3DCGA 3IVFA 2LRUA 2XEWA 2KANA 3M3JA 2OJRA 3L17A 1RLFA 4TKNA 2M4NA 1JRUA 1EF1A 3HM6X 2JPHA 2MP2A 2XK5A 3RUIB 4E71A 4URKA 1Q5WB 4DHJB 2AEHA 2DZIA 3R7RA 1LXDA 1VCBA 2DZJA 2L0TA 4W9DA 4DXAB 4HLEA 1WM2A 3X0WA 3ZUNA 1Y8RC 2MWSB 4IC7B 4ANVA 2LXAA 1E90A 3NS8A 2M8SA 1Q1OA 3NZSA 4X57B 2MW5A 2BYVE 3T9LA 4NJ6A 1TGZB 5E6OA 3EHVA 3AULA 1YIWA 3R66C 2JVCA 5D7GA 1WX9A 4PYUA 3DBRI 3KYDD 1UD7A 3JYUA 4W9KA 4EUTA 5L95C 1E8ZA 1LM8B 3PHWB 2AYOB 2I1JA 3CF6E 4MJSA 3PRPB 1WJ4A 1WR1A 3ZNID 2GMIC 1FXTB 5GMVA 5LXHA 4AJYB 2BWFA 3B1LX 3PRMB 2FAZA 1K8RB 3CMMB 1H8CA 3KH0A 2LGXA 3H1UA 1WR6E 3N32A 4EZJA 1TTNA 3W1YA 3QA8A 2C5LC 1AARA 2LVPA 1WF9A 2EMTA 1V80A 4NQLB 4WQOB 2ZCCA 1WIAA 5G2NA 1UELA 1U4AA 1VD2A 3DDCB 4HJKA 2KFJA 4WJOA 3GZNI 2K8BA 1WXMA 2L0FA 3H9DA 4PS3A 1A5RA 2HD5B 2MQJA 1ZKHA 4JIOU 1I35A 5AZGA 4B6WA 3U8ZA 2KXJA 4GU2A 1Q0WB 3VH4B 4EEWA 4EZLA 2EKEC 4GDLB 2RSUA 4W9FA 3WANA 4I6NB 3A1QB 3UINB 3ZLZA 1V81A 1Z5SB 3MJWA 4GOCA 2JZZA 5CTRC 2PE6B 3NZUA 2J0MA 2N9PC 4ANXA 3IHPC 3A4RA 1LQBA 4K1RB 1J0GA 4JLCA 3WALA 3ZNGC 4LCDE 3RD2A 2JZ3B 5C23A 3ZVVA 5CHFA 3VQIA 3A9KB 4XX5A 4NJ7A 2MBBB 3K9OB 1V2YA 1WM3A 2I1KA 1EF5A 4MGIE 1T0YA 4EFOA 3M62B 1UZXB 4MH0E 1Z2MA 3UQBA 3NHEB 3A33B 4N9F4 2M0XA 2XBBC 3VXWA 1P98A 1SIFA 3UF8A 3SD5A 2KJHB 2IYDB 2LGYA 1EO6A 4ZRIA 2NBUA 5DPRA 4BOSC 1P0RA 1V6EA 3VAWA 2KTRB 3H7PB 2KK8A 2FIDA 4E74A 1WH3A 2KDIA 1E7VA 5L83A 4FN2A 3ZDMC 2BPSA 1I42A 1H4RA 5BO4B 4W9JA 4PYZA 1WJ6A 1WX8A 4WWNA 3ZW3A 1J8CA 1BT0A 3HM3A 5D2MB 2DYBA 2V4LA 1KLVA 4OVUA 3ZIMA 4KIKA 3QWZB 3R7QA 2MBHA 1KOTA 1E8XA 2PJHA 2MSED 3ECIA 2C7MB 2N4FA 5IAAC 4IM2A 4JGHB 4GDKA 1MG8A 3M63B 4W9GA 2R2QA 3OAWA 4IM0A 1S1QB 1WYWB 2WX0A 5E6NA 4B95A 2BGFA 4ZRKA 3L10B 4KVGB 4AWJA 4RM8A 2A5UA 4K81A 2MX2A 2KFKA 2MLBA 2K8HA 4IG7B 2XK5B 3JVZX 3UQAA 2GBKA 3TMPB 3H7SA 2C7NB 3RYTA 4AJWA 3K9PB 2O2VB 1V86A 3DBSA 4W9IA 2LGDA 1XQQA 2KD0A 2BYFA 1P9DU 2JXXA 3IG3A 4I6PA 4M8NA 4A3PA 3MTNB 3X23A 2KVRA 3EC8A 4TUUA 1L2NA 3ML9A 2JRHA 3PTFC 5CHWA 4AUQC 2G3QB 2BWES 5AEKB 2ZPNA 2N1VA 2L7RA 4HCNB 4HCPB 4GXBA 4BFRA 2ZVNA 2O6VD 2WWZA 3PVLA 4RMAA 3UIPB 2PPHA 4GB9A 4XC2A 2IBIB 2Z0DB 3AU5A 4LDTD 2KLCA 3U7DA 2G45B 3PLUA 1OEYJ 4NAWB 3VTWA 2BKFA 5J2RA 3IFWB 2AWTA 1ZW7A 1F9JA 2MRPA 3ENEA 3WAPA 3KUCB 3RZWC 3Q3FA 3PREA 5CHVC 5AZHA 5DCNA 2LVOA 1WI0A 3A9JB 3VTUA 1V49A 4BKSA 2KLGA 4CHKA 2Z0EB 4YL8A 3SU8X 4MELA 3DPDA 3P2BA 2L05A 2R2OA 3QK0A 3RCZA 2KDFB 2ASQA 2J7QB 4J6IA 3KW5B 2KO3A 2NR2A 1CMXB 4TQ1A 4M8MA 2GBMA 2CKHB 2L3ZA 4FLHA 4TV3A 3RULA 3ZRCA 1D3ZA 5J18A 2D07B 4WJQA 2MCNB 4NPNA 2CU1A 1NDDA 1GC6A 3ML8A 3T8MA 2NPTB 2DAJA 1YJ1A 1C3TA 2JRIB 3PGEA 4ZYNA 3L08A 4NQKE 5JHAA 1HE8A 2KC1A 2O6VB 3TBLD 1OGWA 1M94A 2KJRA 4KZCA 3ZTCA 4F1SA 3CSTA 2RR9A 4LDTB 4I6LB 3UIOB 4MGYE 3IBEA 2YLMA 2JF5A 2KX0A 2DZMA 2BKRB 4ASWC 2YVCA 2IO2B 1LFDA 3NY5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2LVQ A;  3DVN V;  2WDT B;  1YD8 U;  4HPL B;  3M95 A;  2DYO A;  2DX5 B;  3KUD B;  4F7Z A;  4BVU C;  1WFY A;  1NBF C;  2RPQ A;  2V1Y A;  3QHT A;  4FJV B;  2REX A;  2KJ6 A;  2KHW B;  3DVG X;  4BOZ B;  1TZ1 A;  1WJN A;  2L8J A;  3SHQ A;  4BKG A;  2LAS A;  2JWZ A;  2OOB B;  3I3T B;  4GN1 A;  3HHM A;  4NY0 A;  2DZK A;  2KQS A;  3JW0 X;  3KUZ A;  5IA7 A;  2KMA A;  4HDQ A;  4MSQ B;  5KHO A;  1TBE A;  3DBL I;  3L13 A;  4FBJ B;  4DDI D;  4WJN A;  2PEA A;  4FHK A;  3V6E B;  2C9W B;  4IWO A;  3QAQ A;  3C0R B;  3QIJ A;  5LXI B;  4JQW C;  3VDZ A;  2AL6 A;  4EZK A;  2PE9 A;  3PT2 B;  2ZPY A;  2KWU B;  2W9N A;  3S2A A;  4AP4 C;  3ZNH B;  5DPW A;  2KN5 A;  2ZZP B;  2IY0 B;  4E3C A;  1S3S G;  1E8W A;  1WMH A;  4W9E A;  3VVW B;  2N7D A;  4GDL A;  3OJ3 A;  2ZNV C;  2GBR A;  2NBV B;  3JSV B;  3A1Q A;  2K39 A;  5EDS A;  3R3M A;  3APF A;  5D94 A;  4IWQ A;  2B3A A;  4G50 A;  4KIK B;  3EEC A;  3VUY A;  4EKU A;  4W9L A;  4JL9 A;  1SE9 A;  3ZKJ C;  1IPG A;  1WXS A;  1ZGU B;  3W1S C;  2MA9 B;  3A9K A;  3VUW A;  3WIM A;  2KWC A;  2LRW A;  4NNJ B;  5HKH A;  4ZDV A;  5AZF A;  3PLV A;  2A4Z A;  4BBN F;  3VUX A;  5CX3 A;  1UBQ A;  2D2Q A;  3V6C B;  4AOF A;  4WWP A;  3VTV A;  4MEM A;  3AU4 A;  3V62 A;  3SDL C;  2MP2 B;  4KV2 A;  2KTR A;  2CHZ A;  3H7P A;  2L76 A;  1RAX A;  4ANW A;  4FJY A;  3TJP A;  1XD3 B;  4DDG D;  2KKC A;  1P3Q U;  2RD0 A;  1WE7 A;  4FHJ A;  4RM9 A;  3APD A;  2D3G A;  1V9J A;  2DHZ A;  3APC A;  1X1M A;  1PQS A;  2FUH B;  1WGD A;  2FCQ A;  3ZO5 B;  4BKT A;  4MSM B;  4FA6 A;  2UWQ A;  2GOW A;  4K7U A;  4GIV A;  4ICU A;  3W1S A;  1WE6 A;  2FCS A;  2CHX A;  3PSE B;  4WAA A;  3EFU A;  3QC8 B;  1NI2 A;  2N9X A;  4BBN C;  4HXD A;  1E8Y A;  3NOB A;  3TCA A;  3LDZ E;  1R4M I;  4ANU A;  3ZDT A;  3RZF A;  3AXC A;  4LJP B;  4K7W A;  1SGH A;  1WGR A;  2N1W A;  4MJS B;  5TR5 A;  1XT9 B;  2HTH A;  2UYZ B;  1IYF A;  2LD9 A;  2MBE A;  4W9H A;  2O2V A;  3QX1 A;  1KM7 A;  2BYE A;  2Y5B B;  2KDE B;  5J17 A;  3WAO A;  4FUL A;  4A20 A;  1OTR B;  2KDB A;  3ZNZ B;  4HVB A;  3U30 A;  3L54 A;  1WY8 A;  3BIN A;  4MGK E;  2K6D B;  1QZE A;  2N7E A;  3B0A A;  2G4D B;  5JH5 C;  2ZCB A;  4OVV A;  1WX7 A;  3UGB B;  1WGH A;  4KDL B;  1E7U A;  2NS5 A;  2LWP A;  3L0W B;  2D11 A;  5JHB A;  4A3O A;  4HDO A;  4IW0 A;  2LZ6 A;  4CO7 A;  2DYM A;  2MBO A;  4EOY A;  2Z59 B;  3O65 B;  2WYQ A;  3VH3 B;  2IZV B;  3OJ4 B;  1V5O A;  4NAW A;  3TIX A;  4M0W B;  1WRD B;  2AL3 A;  5DPS A;  4HWI B;  2KC2 A;  3N30 A;  4DBG A;  2JY6 A;  3GOE A;  3A9J A;  1GJZ A;  4II2 B;  3B08 A;  4MDK E;  5LLI A;  3RT3 B;  2RGF A;  2JT4 B;  2HJ8 A;  2BF8 B;  2V3S A;  3DOW A;  2D10 A;  3HK0 A;  2C7H A;  2L00 B;  4K7S A;  3N3K B;  4W9C A;  2C60 A;  4GMV A;  2FNJ B;  3TL5 A;  3VFK A;  3ZTD A;  3PZD A;  2VRR B;  2DEN B;  3A4S C;  3L16 A;  2CHW A;  2KTF A;  2MBQ A;  5E6P A;  2NPT A;  2ZJD A;  2JUO A;  1OEY A;  3V60 A;  1YQB A;  1UGM A;  1WGY A;  3PS6 A;  3PV1 A;  4KSL C;  2IO3 B;  4GGQ A;  2DAF A;  3D32 A;  2WX1 A;  1OQY A;  5JZE B;  1RRB A;  3V61 A;  2O6V A;  2KWV B;  4PS7 A;  4PS8 A;  5DPT A;  4IWP A;  2FIF A;  1J19 A;  1WMH B;  3DVG Y;  1WXA A;  3ZRF A;  2M17 A;  1WGG A;  4WJP A;  3KVF B;  3ALB A;  1UH6 A;  5KHQ A;  3QCA A;  5D6J B;  4II3 B;  2KZR A;  4DHZ B;  2ZVO A;  4ICV A;  2KMC A;  3DQV A;  5FR6 A;  1IP9 A;  2EMS A;  3QQ8 B;  3ONS A;  1P1A A;  1WZ0 A;  2CS4 A;  2NVU I;  4HK2 A;  2HE7 A;  3Q3J A;  4MM3 A;  2J0K A;  4F8C B;  3BY4 B;  2K1F A;  2KNB A;  1L7Y A;  4KSK C;  2K6Q A;  4FAD A;  4P7I A;  4DHZ E;  2LI5 A;  4IUM B;  4KDI C;  1GC7 A;  1GNU A;  3MHS D;  4XZ4 A;  4CYE A;  2N9E B;  4DWF A;  1G6J A;  4DHJ D;  4GDK B;  2NBW B;  4BKS D;  4LJO B;  3CSF A;  5C1Z A;  3QJZ A;  3WAM A;  4FJZ A;  4ZRJ A;  2KFK B;  1EUV B;  1WJU A;  2NCN A;  2GBJ A;  2LUE A;  4MGZ E;  3PHX B;  4G0N B;  2K25 A;  2ZNV B;  1GUA B;  4KZ0 A;  5G55 A;  1ISN A;  4DK5 A;  2G4S A;  3PRZ A;  2J0J A;  3OLM D;  1KJT A;  3LJ3 A;  3JSV A;  1R4N I;  4GSW A;  2FCN A;  2IO1 B;  2IY1 B;  1RFA A;  3PPA A;  4B9K A;  3QAR A;  2K8C A;  4G11 A;  2CR5 A;  1GG3 A;  3DBH I;  1V5T A;  1WXV A;  1YX6 B;  2FCM A;  4WWO A;  4G3X B;  4IM3 A;  2KX3 A;  1E5W A;  2KOX A;  4HPM B;  3H6N A;  1WZ3 A;  3WA0 A;  2KQ7 A;  3KYC D;  3VHT C;  1C1Y B;  2GBN A;  4TQ0 A;  1UBI A;  3HIZ A;  2LXC A;  2QHO A;  2M1M A;  3AI5 A;  2ZEQ A;  1YX5 B;  3DVN U;  2IO0 B;  2LJ5 A;  3DCG A;  3IVF A;  2LRU A;  2XEW A;  2KAN A;  3M3J A;  2OJR A;  3L17 A;  1RLF A;  4TKN A;  2M4N A;  1JRU A;  1EF1 A;  3HM6 X;  2JPH A;  2MP2 A;  2XK5 A;  3RUI B;  4E71 A;  4URK A;  1Q5W B;  4DHJ B;  2AEH A;  2DZI A;  3R7R A;  1LXD A;  1VCB A;  2DZJ A;  2L0T A;  4W9D A;  4DXA B;  4HLE A;  1WM2 A;  3X0W A;  3ZUN A;  1Y8R C;  2MWS B;  4IC7 B;  4ANV A;  2LXA A;  1E90 A;  3NS8 A;  2M8S A;  1Q1O A;  3NZS A;  4X57 B;  2MW5 A;  2BYV E;  3T9L A;  4NJ6 A;  1TGZ B;  5E6O A;  3EHV A;  3AUL A;  1YIW A;  3R66 C;  2JVC A;  5D7G A;  1WX9 A;  4PYU A;  3DBR I;  3KYD D;  1UD7 A;  3JYU A;  4W9K A;  4EUT A;  5L95 C;  1E8Z A;  1LM8 B;  3PHW B;  2AYO B;  2I1J A;  3CF6 E;  4MJS A;  3PRP B;  1WJ4 A;  1WR1 A;  3ZNI D;  2GMI C;  1FXT B;  5GMV A;  5LXH A;  4AJY B;  2BWF A;  3B1L X;  3PRM B;  2FAZ A;  1K8R B;  3CMM B;  1H8C A;  3KH0 A;  2LGX A;  3H1U A;  1WR6 E;  3N32 A;  4EZJ A;  1TTN A;  3W1Y A;  3QA8 A;  2C5L C;  1AAR A;  2LVP A;  1WF9 A;  2EMT A;  1V80 A;  4NQL B;  4WQO B;  2ZCC A;  1WIA A;  5G2N A;  1UEL A;  1U4A A;  1VD2 A;  3DDC B;  4HJK A;  2KFJ A;  4WJO A;  3GZN I;  2K8B A;  1WXM A;  2L0F A;  3H9D A;  4PS3 A;  1A5R A;  2HD5 B;  2MQJ A;  1ZKH A;  4JIO U;  1I35 A;  5AZG A;  4B6W A;  3U8Z A;  2KXJ A;  4GU2 A;  1Q0W B;  3VH4 B;  4EEW A;  4EZL A;  2EKE C;  4GDL B;  2RSU A;  4W9F A;  3WAN A;  4I6N B;  3A1Q B;  3UIN B;  3ZLZ A;  1V81 A;  1Z5S B;  3MJW A;  4GOC A;  2JZZ A;  5CTR C;  2PE6 B;  3NZU A;  2J0M A;  2N9P C;  4ANX A;  3IHP C;  3A4R A;  1LQB A;  4K1R B;  1J0G A;  4JLC A;  3WAL A;  3ZNG C;  4LCD E;  3RD2 A;  2JZ3 B;  5C23 A;  3ZVV A;  5CHF A;  3VQI A;  3A9K B;  4XX5 A;  4NJ7 A;  2MBB B;  3K9O B;  1V2Y A;  1WM3 A;  2I1K A;  1EF5 A;  4MGI E;  1T0Y A;  4EFO A;  3M62 B;  1UZX B;  4MH0 E;  1Z2M A;  3UQB A;  3NHE B;  3A33 B;  4N9F 4;  2M0X A;  2XBB C;  3VXW A;  1P98 A;  1SIF A;  3UF8 A;  3SD5 A;  2KJH B;  2IYD B;  2LGY A;  1EO6 A;  4ZRI A;  2NBU A;  5DPR A;  4BOS C;  1P0R A;  1V6E A;  3VAW A;  2KTR B;  3H7P B;  2KK8 A;  2FID A;  4E74 A;  1WH3 A;  2KDI A;  1E7V A;  5L83 A;  4FN2 A;  3ZDM C;  2BPS A;  1I42 A;  1H4R A;  5BO4 B;  4W9J A;  4PYZ A;  1WJ6 A;  1WX8 A;  4WWN A;  3ZW3 A;  1J8C A;  1BT0 A;  3HM3 A;  5D2M B;  2DYB A;  2V4L A;  1KLV A;  4OVU A;  3ZIM A;  4KIK A;  3QWZ B;  3R7Q A;  2MBH A;  1KOT A;  1E8X A;  2PJH A;  2MSE D;  3ECI A;  2C7M B;  2N4F A;  5IAA C;  4IM2 A;  4JGH B;  4GDK A;  1MG8 A;  3M63 B;  4W9G A;  2R2Q A;  3OAW A;  4IM0 A;  1S1Q B;  1WYW B;  2WX0 A;  5E6N A;  4B95 A;  2BGF A;  4ZRK A;  3L10 B;  4KVG B;  4AWJ A;  4RM8 A;  2A5U A;  4K81 A;  2MX2 A;  2KFK A;  2MLB A;  2K8H A;  4IG7 B;  2XK5 B;  3JVZ X;  3UQA A;  2GBK A;  3TMP B;  3H7S A;  2C7N B;  3RYT A;  4AJW A;  3K9P B;  2O2V B;  1V86 A;  3DBS A;  4W9I A;  2LGD A;  1XQQ A;  2KD0 A;  2BYF A;  1P9D U;  2JXX A;  3IG3 A;  4I6P A;  4M8N A;  4A3P A;  3MTN B;  3X23 A;  2KVR A;  3EC8 A;  4TUU A;  1L2N A;  3ML9 A;  2JRH A;  3PTF C;  5CHW A;  4AUQ C;  2G3Q B;  2BWE S;  5AEK B;  2ZPN A;  2N1V A;  2L7R A;  4HCN B;  4HCP B;  4GXB A;  4BFR A;  2ZVN A;  2O6V D;  2WWZ A;  3PVL A;  4RMA A;  3UIP B;  2PPH A;  4GB9 A;  4XC2 A;  2IBI B;  2Z0D B;  3AU5 A;  4LDT D;  2KLC A;  3U7D A;  2G45 B;  3PLU A;  1OEY J;  4NAW B;  3VTW A;  2BKF A;  5J2R A;  3IFW B;  2AWT A;  1ZW7 A;  1F9J A;  2MRP A;  3ENE A;  3WAP A;  3KUC B;  3RZW C;  3Q3F A;  3PRE A;  5CHV C;  5AZH A;  5DCN A;  2LVO A;  1WI0 A;  3A9J B;  3VTU A;  1V49 A;  4BKS A;  2KLG A;  4CHK A;  2Z0E B;  4YL8 A;  3SU8 X;  4MEL A;  3DPD A;  3P2B A;  2L05 A;  2R2O A;  3QK0 A;  3RCZ A;  2KDF B;  2ASQ A;  2J7Q B;  4J6I A;  3KW5 B;  2KO3 A;  2NR2 A;  1CMX B;  4TQ1 A;  4M8M A;  2GBM A;  2CKH B;  2L3Z A;  4FLH A;  4TV3 A;  3RUL A;  3ZRC A;  1D3Z A;  5J18 A;  2D07 B;  4WJQ A;  2MCN B;  4NPN A;  2CU1 A;  1NDD A;  1GC6 A;  3ML8 A;  3T8M A;  2NPT B;  2DAJ A;  1YJ1 A;  1C3T A;  2JRI B;  3PGE A;  4ZYN A;  3L08 A;  4NQK E;  5JHA A;  1HE8 A;  2KC1 A;  2O6V B;  3TBL D;  1OGW A;  1M94 A;  2KJR A;  4KZC A;  3ZTC A;  4F1S A;  3CST A;  2RR9 A;  4LDT B;  4I6L B;  3UIO B;  4MGY E;  3IBE A;  2YLM A;  2JF5 A;  2KX0 A;  2DZM A;  2BKR B;  4ASW C;  2YVC A;  2IO2 B;  1LFD A;  3NY5 A; 
#chains in the Genus database with same CATH topology
 2LVQ A;  2WDT B;  2KT7 A;  2DX5 B;  2NMQ A;  3Q3M C;  4BVU C;  2RPQ A;  1MHX A;  2ICI A;  4L23 A;  1IGD A;  2REX A;  3RNE C;  1FPY A;  2L8J A;  1C4P A;  2WGS A;  2KQS A;  2KMA A;  4K3B A;  3N1X C;  1L0X B;  3DBL I;  4RGM A;  2PEA A;  3FIL A;  2OHF A;  2WNM A;  3B2F A;  2ON8 A;  4JQW C;  2W9N A;  1WMH A;  2M19 A;  2N7D A;  3T3N A;  2GBR A;  2D3A A;  3JSV B;  5EE9 A;  3MC9 A;  3KWL A;  5D94 A;  3U4E G;  1JAL A;  3VUY A;  3IT4 B;  1YOV B;  1SE9 A;  3AEB B;  3BYT B;  1FNU A;  1ROE A;  2LRW A;  2QIE B;  3HUI A;  3U2S C;  3I57 A;  2KDM A;  4AOF A;  4WWP A;  3V62 A;  1SSN A;  1QQR A;  1MI0 A;  4FJY A;  1XD3 B;  1Y56 A;  4FHJ A;  1WE7 A;  4RM9 A;  2DHZ A;  2FUH B;  4IDI A;  4MSM B;  4K7U A;  2GOW A;  4ICU A;  3ZJU A;  1WE6 A;  2FCS A;  2ZW1 A;  3RNC C;  2BYT A;  1R4M I;  1YNT E;  1SE3 A;  3C19 A;  3RPF C;  1C4C A;  3AXC A;  1IGC A;  4K7W A;  1WGR A;  2N1W A;  5TR5 A;  1XT9 B;  1IYF A;  3NVY A;  4W9H A;  2WXQ A;  4N58 A;  5J17 A;  4A20 A;  2KDB A;  4HVB A;  1FM0 D;  3ZGZ A;  4OVV A;  4LTU A;  3BVM A;  5JHB A;  4WIP A;  4A3O A;  4IW0 A;  4CO7 A;  1PFD A;  1ZOY B;  3O65 B;  5EE1 A;  2KN4 A;  3P4Q B;  1D5Z C;  1TS3 A;  3N30 A;  1GJZ A;  1E6E B;  5LLI A;  3AV8 A;  3RT3 B;  4ARC A;  2PVO D;  1VLB A;  2BF8 B;  3HK0 A;  4ZYS A;  3N3K B;  4W9C A;  2FNJ B;  3TL5 A;  5HFY A;  5FR3 A;  3A4S C;  3L16 A;  2KTF A;  2JUO A;  1YQB A;  1UGM A;  1WGY A;  2MH7 A;  5H8Y E;  3DWM A;  2DAF A;  3D32 A;  5JZE B;  2KWV B;  4PS7 A;  1V1P A;  1WMH B;  3AEC B;  2M17 A;  4WJP A;  3QCA A;  4ICV A;  5FR6 A;  2DNF A;  1QLB B;  3RNG C;  1P1A A;  5LNK 1;  3EFC A;  4HK2 A;  2H89 B;  3Q69 A;  1JWM D;  4P7I A;  2BS2 B;  1CZP A;  4KDI C;  3W5V B;  2NBW B;  5T8I A;  4MGZ E;  3PHX B;  4G0N B;  2BQQ A;  1J7A A;  1KJT A;  2VZK D;  4KX6 B;  3PPA A;  2AQ1 B;  3V05 A;  2CR5 A;  1K52 A;  1YX6 B;  2FCM A;  2GLS A;  1N5W A;  4FXC A;  4IM3 A;  1SE2 A;  1E5W A;  4TQ0 A;  1UBI A;  3AEF B;  2LXC A;  1HXY D;  2M1M A;  1P7E A;  2WXP A;  2OJR A;  1Q5W B;  5BYQ A;  1YJI A;  3R7R A;  1N61 A;  4LNK A;  4DXA B;  1J7C A;  2WXR A;  1SJH D;  1WM2 A;  1Y8R C;  4ANV A;  5EE3 A;  3NZS A;  4X57 B;  1RWS A;  2BS3 B;  2VZK B;  3EHV A;  3R66 C;  2JVC A;  5D7G A;  1WX9 A;  1AWD A;  3DBR I;  1FEH A;  2AYO B;  4MJS A;  2Q5W D;  2G1E A;  3SFE B;  2XN9 C;  2GMI C;  2L1A A;  1FXT B;  5GMV A;  3Q14 C;  4UDU C;  4YXD B;  3H1U A;  3H8H A;  3AE6 B;  1AAR A;  4XDD A;  2EMT A;  1V80 A;  4NQL B;  4WQO B;  5G2N A;  1K50 A;  3U7Z A;  1U4A A;  3TSS A;  3U52 E;  3DDC B;  1XEE A;  4WJO A;  1HEZ E;  1TKG A;  2V4I B;  1WXM A;  4PS3 A;  2HD5 B;  3MJ5 A;  3PZ7 A;  4JIO U;  4GU2 A;  2L32 A;  4GDL B;  2RSU A;  4W9F A;  1T0S C;  3NZU A;  3TEZ A;  1KF6 B;  3AE3 B;  1L0V B;  1QKZ A;  2PW9 A;  2WXG A;  5C23 A;  4NJ7 A;  2FE8 A;  4YSY B;  1V2Y A;  1TKY A;  4MGI E;  4AS1 A;  4EFO A;  1Z2M A;  4HJG E;  2M0X A;  4XE0 A;  2WU2 B;  4CQN A;  1SIF A;  3UF8 A;  3VRB B;  2LGY A;  4ZRI A;  5DPR A;  2BS4 B;  3VAW A;  2BPS A;  1H4R A;  3C8Y A;  2V4L A;  2LFI A;  1FMA D;  1FXA A;  1KOT A;  2NTS A;  1F2R C;  4A90 A;  3MC8 A;  4W9G A;  1JQ4 A;  3OAW A;  5E6N A;  1YN4 A;  1TJE A;  2A5U A;  2WXH A;  2K8H A;  4IG7 B;  2RDB C;  3SR6 A;  4IOI E;  3TMP B;  3H7S A;  4AJW A;  1TY0 A;  1V86 A;  4HRS A;  3VR9 B;  1FFU A;  2EEL A;  4I6P A;  3X23 A;  2JRH A;  1MFW A;  3GZN B;  3DHG C;  2L7R A;  2IPK D;  2O6V D;  1T6B X;  3UIP B;  2Z0D B;  3AU5 A;  1NYQ A;  3URY A;  3PLU A;  1K51 A;  1WXQ A;  3IFW B;  3KUC B;  3PRE A;  5CHV C;  5AZH A;  1QF6 A;  3VTU A;  1M4V A;  4YL8 A;  3SU8 X;  4ACF A;  3P2B A;  2PVG C;  2YEP F;  1EU4 A;  2J7Q B;  4J6I A;  3KW5 B;  5BMH A;  3IAS 1;  2CKH B;  2L3Z A;  2IGH A;  3ZRC A;  4LNI A;  5J18 A;  1ESF A;  4NPN A;  1NDD A;  2DAJ A;  1YJ1 A;  1C3T A;  2JRI B;  4ZYN A;  5JHA A;  5D3I B;  2BT6 A;  2O6V B;  4M0W A;  2RR9 A;  5IOI A;  4MGY E;  2WDR B;  2YLM A;  2JF5 A;  2KX0 A;  2DZM A;  3IVF A;  3RNB C;  4HPL B;  3M95 A;  2Z8L A;  4F7Z A;  2WXK A;  1K53 A;  1NBF C;  1STE A;  3SHQ A;  4BKG A;  2OOB B;  1F52 A;  3BZD B;  5IA7 A;  1WGK A;  4WJN A;  3V6E B;  2HTM E;  3TEX A;  2BW2 A;  1T0R C;  3VDZ A;  2AL6 A;  3PT2 B;  3P1M A;  4HEA 1;  2IY0 B;  4E3C A;  2ZNV C;  1XCT L;  2NBV B;  4C56 C;  3A1Q A;  5EDS A;  2N9K A;  3N1Z C;  1BXT A;  2R61 A;  1C78 A;  1L5P A;  4J3O D;  1L0Y B;  1IPG A;  1WXS A;  3AEG B;  3A9K A;  3VUW A;  3WIM A;  2KWC A;  1ET6 A;  4ZDV A;  2A4Z A;  4BBN F;  1ZDV A;  1ZDX A;  3VUX A;  1ET9 A;  1UBQ A;  3V6C B;  1JRO A;  2MP2 B;  3H7P A;  2CHZ A;  4ANW A;  5H92 C;  3TJP A;  3APD A;  3HRD D;  3OG5 A;  1X1M A;  1B1Z A;  2V3P A;  4BKT A;  4DXF A;  2UWQ A;  3W1S A;  3Q3N C;  2CHX A;  3PSE B;  3QC8 B;  4HXD A;  1E8Y A;  3NOB A;  1CJE A;  3KWV A;  4YT0 B;  1VZ8 A;  3ZDT A;  4RF0 A;  4A8X C;  2LD9 A;  4YSZ B;  1KM7 A;  1N6Z A;  3EGR A;  4FUL A;  4BAX A;  1MHH E;  3U30 A;  3L54 A;  1WY8 A;  4XWW A;  2K6D B;  3OWE B;  5JH5 C;  2G4D B;  4LNN A;  3UGB B;  3DBL B;  2LWP A;  4WAF A;  3L0W B;  2D5G A;  2WS3 B;  4HDO A;  3Q8C A;  2LZ6 A;  2MBO A;  4EOY A;  2WYQ A;  2K3U A;  4YWG G;  4M0W B;  3B9J A;  3VR8 B;  2KC2 A;  2JY6 A;  3GOE A;  2W55 A;  3A9J A;  2INN E;  3MHZ A;  3B08 A;  1GAQ B;  2JT4 B;  4LLG M;  3RI7 C;  3DOW A;  4TSS A;  5IKC M;  4YTN B;  2C60 A;  3MFG A;  4GMV A;  3VFK A;  3ZJT A;  3ZTD A;  4RFB A;  1OEY A;  3PS6 A;  2IO3 B;  2WX1 A;  4JPS A;  3V61 A;  4ARI A;  2YEP B;  4B0E A;  2FIF A;  3DVG Y;  2IJ0 A;  3FAH A;  4BZA A;  2W3S A;  3KVF B;  5D6J B;  4II3 B;  4DHZ B;  2ZVO A;  3DQV A;  2BB5 A;  1IP9 A;  4R3D A;  3BWU D;  2CS4 A;  2NVU I;  3VRA B;  3Q3J A;  4HRO A;  4MM3 A;  2KNB A;  1R4M B;  4DHZ E;  1GC7 A;  4XZ4 A;  3RNA C;  4DWF A;  4GDK B;  2B76 B;  4BKS D;  4LJO B;  3ZJV A;  1QOG A;  1HTQ A;  3QJZ A;  1UNS A;  2KFK B;  1JWB D;  3GE8 C;  3PRZ A;  3LJ3 A;  1TS4 A;  2GB1 A;  2H88 B;  1JWS D;  2IO1 B;  1MJD A;  2KAJ A;  4B9K A;  1YJJ A;  3RN9 C;  5GXG B;  1FRD A;  1WXV A;  2KX3 A;  3AE7 B;  3WA0 A;  1ZPS A;  3T3O A;  3KYC D;  2GBN A;  3HIZ A;  3AI5 A;  1N5X A;  3MP9 A;  4JWU C;  1VZ6 A;  3DCG A;  3GS2 A;  2LRU A;  2XEW A;  2KAN A;  3M3J A;  1EF1 A;  2XK5 A;  2DZI A;  1VCB A;  2DZJ A;  2MHJ A;  4W9D A;  4HLE A;  3X0W A;  2MWS B;  4IC7 B;  1YQ4 B;  2LUM A;  2M8S A;  1I4X A;  4A55 A;  3ABV B;  2MW5 A;  4NJ6 A;  1EWC A;  1TGZ B;  1E10 A;  3AUL A;  1PUT A;  2RMM A;  1UD7 A;  3EUB 2;  1NEN B;  5L95 C;  1XLP A;  3CF6 E;  2HJ1 A;  1WJ4 A;  3ZNI D;  1T0Q C;  4NJC A;  3P63 A;  3B1L X;  1BUI C;  2QEJ C;  1H8C A;  1TYG B;  2HDE A;  2KMM A;  3KH0 A;  2LGX A;  1QOF A;  1WR6 E;  3QA8 A;  2JQR B;  1WIA A;  2AQ3 B;  1UEL A;  2RDH A;  3BK2 A;  1VD2 A;  3P42 A;  2K22 A;  3FIL B;  4WWM A;  5IP4 D;  2DBY A;  3NRZ A;  1UWM A;  4I6N B;  2KAC A;  2PE6 B;  2J0M A;  3AB5 A;  3IHP C;  1XLN A;  4IKG A;  2WXM A;  3Q8E A;  3WAL A;  2DLB A;  3EA6 A;  2JZ3 B;  3ZVV A;  5CHF A;  2UU7 A;  4JWS C;  2E3T A;  4XX5 A;  2I1K A;  5G5H A;  1T0Y A;  3M62 B;  3NHE B;  3A33 B;  1P98 A;  1SJE D;  3SD5 A;  4BOS C;  2IYD B;  1EO6 A;  2BB6 A;  1FNV A;  3FKY A;  1WH3 A;  2KDI A;  3NVZ A;  5L83 A;  4C00 A;  3ZDM C;  4PYZ A;  1WX8 A;  4WWN A;  3DBR B;  1J8C A;  2ZW0 A;  5D2M B;  4OVU A;  4ZOH C;  4KIK A;  2MBH A;  1E8X A;  2MSE D;  2C7M B;  4IM2 A;  2IND C;  4JGH B;  1MG8 A;  3M63 B;  2R2Q A;  3RNF C;  2LEK A;  1NEK B;  2XK5 B;  3JVZ X;  3UQA A;  2C7N B;  3RYT A;  1MG4 A;  3DBS A;  2LGD A;  1YN5 A;  2KD0 A;  1P9D U;  3IG3 A;  4A3P A;  1ZXH A;  3FC4 A;  1WRI A;  5IN7 A;  4TUU A;  4C4V A;  3PTF C;  2BWE S;  5AEK B;  4GXB A;  4BFR A;  2AX5 A;  1ENF A;  3AE5 B;  1TS5 A;  2WWZ A;  2PPH A;  4XC2 A;  5IO9 A;  2G45 B;  2WXJ A;  2WDQ B;  3Q8F A;  2BKF A;  2AWT A;  5EE0 A;  3RZW C;  1V8C A;  4GLS C;  2WU5 B;  4MEL A;  3DPD A;  2L05 A;  3RCZ A;  2KDF B;  1UF0 A;  1YMH E;  4TQ1 A;  4TV3 A;  4FLH A;  3RUL A;  1D3Z A;  3ZQ4 A;  2DWQ A;  3GB1 A;  2MCN B;  2BBC A;  3ML8 A;  2J53 A;  3Q8A A;  3P4S B;  1F2R I;  4HKZ E;  4NQK E;  4Q2J A;  2KC1 A;  1DOX A;  3ZTC A;  1V1P B;  2KJR A;  4KZC A;  4P1B C;  3CST A;  1N62 A;  2WQY B;  4S0R A;  2BKR B;  4ASW C;  4C7Z A;  3NY5 A;  4KGT A;  2LHE A;  3QHT A;  2JYT A;  4FJV B;  1TY2 A;  2KHW B;  2Y3A A;  1TZ1 A;  1WJN A;  4NY0 A;  2XNA C;  3I3T B;  3HHM A;  2DZK A;  3KUZ A;  4RGO S;  3RMK C;  3B2G A;  1RM6 C;  2C9W B;  2EKI A;  4RF1 A;  4IWO A;  4XYC A;  1V97 A;  5LXI B;  4XGA B;  4EZK A;  2V3N A;  2ZPY A;  3S2A A;  4AP4 C;  1E0Z A;  2KN5 A;  2ZZP B;  1E8W A;  3VVW B;  2QIL A;  2ACZ B;  4IWQ A;  4EE2 A;  2B3A A;  3NUH B;  4KIK B;  2KWD A;  3TEY A;  4M01 A;  4YTM B;  4OHJ A;  4WH4 A;  1FNW A;  3ZKJ C;  1ZGU B;  1WSP A;  2MA9 B;  4PK1 A;  4NNJ B;  5AZF A;  3PLV A;  1BML C;  3W5U B;  3W9C B;  5CX3 A;  3BK1 A;  3SDL C;  1DGJ A;  2J42 A;  2IGG A;  2KTR A;  1RAX A;  3IXS A;  1MVK A;  1P3Q U;  2RD0 A;  1CQV A;  2LHD A;  2N0S B;  3APC A;  4PT5 A;  1PQS A;  1XLQ A;  1WGD A;  2FCQ A;  4NZL B;  1FIQ A;  1QT9 A;  4GIV A;  4WAA A;  1NI2 A;  3TCA A;  2PIA A;  4ANU A;  4NAM A;  1RYJ A;  3R2T A;  4LJP B;  1D6E C;  1SGH A;  2FBW B;  4MJS B;  5BMG A;  2HTH A;  2MBE A;  2O2V A;  1NI3 A;  4KGR A;  1AW7 A;  2QC8 A;  3WAO A;  1HTO A;  1OTR B;  2ONQ A;  1QZE A;  1V1O A;  1JML A;  3KLS X;  4KDL B;  1E7U A;  2CU3 A;  3Q6B A;  1EU3 A;  1R7S A;  2Z59 B;  2IZV B;  3OJ4 B;  4NAW A;  1OQR A;  1WRD B;  5DPS A;  4C80 A;  4HWI B;  2IDY A;  3AE1 B;  1HA5 A;  2LJI A;  4US9 A;  4ITK A;  3ZXV A;  2D10 A;  2L00 B;  3AMZ A;  3GP7 A;  2DEN B;  2CHW A;  5E6P A;  2NPT A;  1I4Q A;  3TUO A;  4GGQ A;  4TMA B;  1RRB A;  3W2D A;  1TT5 B;  1E9M A;  1WXA A;  1WGG A;  1UUP A;  2PLP A;  1UH6 A;  5KHQ A;  4N6E B;  2KZR A;  1FD6 A;  1XCQ L;  2KMC A;  1PYW D;  1WZ0 A;  3BVZ A;  4XDC A;  1D5M C;  4KSK C;  1C79 A;  2K6Q A;  3PO0 A;  2LI5 A;  4CYE A;  1JCK B;  1GNU A;  1C77 A;  2JWU A;  2N9E B;  2V0G A;  3CSF A;  5C1Z A;  2QJL A;  2INC C;  1C4A A;  4LNO A;  1EUV B;  1WJU A;  2GBJ A;  3E56 A;  4LK0 M;  4KZ0 A;  1SEB D;  1ISN A;  4DK5 A;  2G4S A;  2G9H D;  3JSV A;  1R4N I;  1FFV A;  4GSW A;  1FXI A;  1RFA A;  3KQ4 A;  2K8C A;  1DYQ A;  1GG3 A;  3DBH I;  1SF0 A;  4YSX B;  4WWO A;  4G3X B;  2I38 A;  1WZ3 A;  2KQ7 A;  2L52 A;  3VHT C;  2QHO A;  4M02 A;  2MJE A;  2IO0 B;  2LJ5 A;  3L17 A;  1RLF A;  1JRU A;  1TZO A;  3HM6 X;  3RUI B;  4E71 A;  2J4X A;  1F1H A;  4URK A;  4L1B A;  1LXD A;  1KLU D;  5D3D A;  3ZUN A;  3Q2A C;  1IUE A;  2LXA A;  4MH8 A;  1Q1O A;  4ZHP A;  5E6O A;  2MEK A;  1YIW A;  4PYU A;  3JYU A;  4W9K A;  5JXV A;  1QIL A;  1E8Z A;  1LM8 B;  2WXI A;  2LGS A;  1WR1 A;  1SIJ A;  2LGI A;  3PRM B;  2CJN A;  2FAZ A;  1K8R B;  2RPV A;  3CMM B;  3N20 C;  3N32 A;  4EZJ A;  1GPX A;  3RFZ B;  3W1Y A;  2LVP A;  1WF9 A;  2ZCC A;  5HHD G;  5E6J A;  2KFJ A;  2JYE A;  1N63 A;  2L0F A;  3H9D A;  1FO4 A;  1A5R A;  2MQJ A;  4B6W A;  3U8Z A;  2KXJ A;  1Q0W B;  4JX1 C;  3VH4 B;  1SBB B;  4EEW A;  2EKE C;  1PGX A;  4RCO A;  3LXF A;  3WAN A;  3A1Q B;  3UIN B;  3ZLZ A;  3MJW A;  4GOC A;  4YTP B;  5CTR C;  3NZ3 A;  2N9P C;  3A4R A;  3HVD A;  1J0G A;  4JLC A;  2MJD A;  3RD2 A;  3VQI A;  3A9K B;  2MBB B;  3K9O B;  1P7F A;  2JX5 A;  4MH0 E;  5C3J B;  3UQB A;  4N9F 4;  5C2T B;  2KJH B;  2NBU A;  1V6E A;  1UGJ A;  3H7P B;  2KK8 A;  2FID A;  4E74 A;  1E7V A;  1OFF A;  3ZXR A;  3E9S A;  3BII D;  1I42 A;  3NS1 A;  2KVZ A;  5I4D A;  2KYW A;  2WDV B;  2DYB A;  3ZIM A;  4RGN A;  1NYR A;  3J9C A;  5HI1 A;  5IAA C;  2V9H A;  2JZP A;  2WX0 A;  2K0P A;  4ZRK A;  4KVG B;  1I4H A;  2MX2 A;  2MLB A;  4A9A A;  4L2Y A;  1PDX A;  2FUG 1;  4WUR A;  3K9P B;  1A70 A;  1MPE A;  5AUK A;  4W9I A;  4ZRP A;  1KRH A;  1WYG A;  4M8N A;  3TEW A;  3I63 C;  2KVR A;  4AUQ C;  2M0A A;  3AEE B;  2N1V A;  3UI3 A;  2WHI A;  3Q3O C;  5TSS A;  3PVL A;  1ZP0 B;  4GB9 A;  2IBI B;  3LB8 C;  1LO5 D;  5FKA C;  1OEY J;  1L4Z B;  1XO3 A;  3VTW A;  5J2R A;  1ZW7 A;  3ENE A;  3WAP A;  3Q3F A;  2K5P A;  1KLG D;  2LVO A;  5DCN A;  1WI0 A;  3A9J B;  1V49 A;  1RFK A;  4KKJ A;  2KLG A;  2NTT A;  2WXF A;  4CHK A;  5BMI A;  2Z0E B;  1SXT A;  2R2O A;  4O1N A;  3QK0 A;  2WLB A;  2ASQ A;  3DHI C;  2KO3 A;  3N9Y C;  4M8M A;  2QSD A;  2GBM A;  2OED A;  3LYY A;  3R2I A;  2D07 B;  3T8M A;  1GC6 A;  1NVI D;  1YN3 A;  3PGE A;  2JU6 X;  1HE8 A;  1QOB A;  4OZA A;  3TBL D;  3AED B;  4P6V F;  4DXG A;  1I4P A;  4I6L B;  1PGA A;  3IBE A;  1I4G A;  2YVC A;  2IO2 B;  1LFD A;  3DVN V;  1YD8 U;  4LNF A;  2J52 A;  2DYO A;  3AE2 B;  3KUD B;  1WFY A;  2V1Y A;  1DOY A;  2WP9 B;  2KJ6 A;  3DVG X;  4MM3 B;  4BOZ B;  2LAS A;  2JWZ A;  4GN1 A;  3CWI A;  3JW0 X;  4HDQ A;  4MSQ B;  5KHO A;  1PGB A;  1TBE A;  1VR9 A;  3L13 A;  4FBJ B;  4DDI D;  4FHK A;  1D4B A;  3AM9 A;  1JWA D;  3QAQ A;  3C0R B;  3QIJ A;  1F0Z A;  2N7J A;  2LMC A;  2PE9 A;  2KWU B;  3ZNH B;  5DPW A;  1S3S G;  4W9E A;  2E6X A;  4GDL A;  2QCZ A;  3OJ3 A;  1VJK A;  2K39 A;  3R3M A;  3APF A;  1XLO A;  4OVZ A;  4G50 A;  4D2K A;  1EWY C;  3EEC A;  4EKU A;  4W9L A;  2MJ3 A;  3P4P B;  4JL9 A;  3W1S C;  1SB3 C;  1SE4 A;  5HKH A;  1L6U A;  3IAM 1;  2Y5C A;  3N1Y C;  3HVZ A;  2D2Q A;  1KH0 A;  3VTV A;  4MEM A;  3AU4 A;  1AN8 A;  4KV2 A;  4DDG D;  2L76 A;  3DHH C;  1VDV A;  2KKC A;  2TSS A;  2D3G A;  1V9J A;  1D5X C;  3ZO5 B;  4FA6 A;  2Y5P A;  1TS2 A;  3EFU A;  2N9X A;  4BBN C;  1XXG A;  3LDZ E;  3RZF A;  1WWT A;  5G5G A;  3ETR A;  1AYF A;  2UYZ B;  3AE9 B;  3QX1 A;  2BYE A;  2Y5B B;  2KDE B;  3MC0 B;  3ZNZ B;  3BIN A;  4K3C A;  4MGK E;  2PKO A;  3CIR B;  4B0M A;  3B0A A;  2N7E A;  2ZCB A;  1WX7 A;  1WGH A;  2NS5 A;  4HKQ A;  2D11 A;  2PMV A;  1HZ6 A;  1I4R A;  2DYM A;  3R8B A;  3VH3 B;  3TIX A;  1V5O A;  2INP E;  2QDF A;  2AL3 A;  4DBG A;  1JRP A;  4HPP A;  4II2 B;  4MDK E;  4N59 A;  2RGF A;  3L4P A;  2K9X A;  2HJ8 A;  2V3S A;  4MAC A;  2C7H A;  2W54 A;  1FCC C;  4K7S A;  3GE3 C;  4JE3 B;  3PZD A;  3I9V 1;  2VRR B;  3AH7 A;  2MBQ A;  1LGR A;  2ZJD A;  3V60 A;  4KSL C;  3PV1 A;  1OQY A;  1YQ3 B;  2O6V A;  4KGS A;  4PS8 A;  3NVW A;  4XWT A;  5DPT A;  3V3X A;  4IWP A;  1J19 A;  1T3Q A;  3ZRF A;  1VRA B;  3SFD B;  2BVC A;  3ALB A;  4C7Y A;  3SEB A;  2EMS A;  3QQ8 B;  4REZ A;  3ONS A;  1Q10 A;  2HE7 A;  2J0K A;  4F8C B;  3BY4 B;  2K1F A;  4ZHO A;  1C76 A;  1L7Y A;  5BYR A;  4FAD A;  4AQ7 A;  2CJO A;  4IUM B;  4KKI A;  2D3B A;  3MHS D;  1G6J A;  4DHJ D;  3WAM A;  1DOI A;  4FJZ A;  4ZRJ A;  2NCN A;  3WCQ A;  2LUE A;  2K25 A;  1I7H A;  2ZNV B;  1GUA B;  5G55 A;  1KFY B;  2J0J A;  3OLM D;  3IT6 B;  2SAK A;  5FK9 C;  2FCN A;  2IY1 B;  4C4V B;  3QAR A;  4G11 A;  1V5T A;  2IGD A;  3DWG C;  2KOX A;  4HPM B;  3H6N A;  1C1Y B;  1IBX A;  2BTE A;  4P16 A;  4M00 A;  2ZEQ A;  1YX5 B;  3DVN U;  2SEB D;  1N60 A;  3AE8 B;  4TKN A;  2M4N A;  2JPH A;  2MP2 A;  2N9L A;  4DHJ B;  2AEH A;  1ACC A;  1ZUD 2;  4ZRQ A;  2L0T A;  1OQQ A;  4DQO C;  1VZ7 A;  3BYY B;  4RNA A;  1E90 A;  3NS8 A;  4MT5 A;  2KQ4 X;  2BYV E;  3T9L A;  4OZB A;  3KYD D;  4USA A;  1J7B A;  4EUT A;  3PHW B;  2I1J A;  1FRR A;  1HQR D;  3PRP B;  3AE4 B;  5LXH A;  4AJY B;  2BWF A;  2VH2 A;  1B9R A;  1ZXI A;  1QOA A;  3NJT A;  5AUI A;  1TTN A;  1T5X D;  2C5L C;  3ZYY X;  2QMT A;  1KTK A;  4HJK A;  1TIF A;  3GZN I;  4OW0 A;  5BYS A;  2K8B A;  1L6V A;  1C9F A;  1R4N B;  1ZKH A;  1I35 A;  5AZG A;  3DBH B;  4EZL A;  1UWX A;  1GB1 A;  1V81 A;  1Z5S B;  2JZZ A;  4ANX A;  4S17 A;  2AQ2 B;  1LQB A;  4K1R B;  3O13 A;  3ZNG C;  4LCD E;  1ZE3 D;  4P1C C;  2X38 A;  3Q8B A;  1WM3 A;  1EF5 A;  1UZX B;  2WXN A;  2RDG A;  3BVG A;  2XBB C;  3VXW A;  2X8X X;  1P0R A;  2KTR B;  2OJW A;  2PTL A;  3P4R B;  4A6Q A;  4FN2 A;  1L4D B;  1GB4 A;  5BO4 B;  4W9J A;  1WJ6 A;  3ZW3 A;  4RH6 A;  1BT0 A;  1E7P B;  3HM3 A;  1KLV A;  3NG0 A;  5HG2 A;  3QWZ B;  3R7Q A;  1IBX B;  4US8 A;  2PJH A;  3ECI A;  2N4F A;  2WXO A;  4GDK A;  4IM0 A;  1S1Q B;  1WYW B;  4B95 A;  2BGF A;  3L10 B;  1CK1 A;  4AWJ A;  4RM8 A;  2GI9 A;  1TKE A;  4K81 A;  2KFK A;  2GBK A;  2VH1 A;  2O2V B;  3PZ8 A;  1XQQ A;  2L83 A;  2BYF A;  2JXX A;  3MTN B;  2M56 B;  3EC8 A;  1L2N A;  3ML9 A;  5CHW A;  2G3Q B;  3AN1 A;  2ZPN A;  4HCN B;  4HCP B;  2W3R A;  2ZVN A;  4RMA A;  4LDT D;  2KLC A;  4H2A A;  3U7D A;  2W82 A;  4NAW B;  2I2Y A;  2MRP A;  1F9J A;  1HZ5 A;  1JWU D;  4BKS A;  1EM7 A;  4RGT A;  1F77 A;  2WXL A;  3AEA B;  1FCL A;  1GOZ A;  3NVV A;  2NR2 A;  1CMX B;  1XF5 L;  2JSV X;  1JW9 D;  4WJQ A;  2CU1 A;  2GRI A;  2NPT B;  4WQM A;  3L08 A;  2D3C A;  2JXT A;  5MPO A;  1OGW A;  1M94 A;  4F1S A;  4QAY A;  4LDT B;  3UIO B;  4OZC A;  3I5J C; 
#chains in the Genus database with same CATH homology
 2LVQ A;  3DVN V;  2WDT B;  1YD8 U;  4HPL B;  3M95 A;  2DYO A;  2DX5 B;  3KUD B;  4F7Z A;  4BVU C;  1WFY A;  1NBF C;  2RPQ A;  2V1Y A;  3QHT A;  4FJV B;  2REX A;  2KJ6 A;  2KHW B;  3DVG X;  4BOZ B;  1TZ1 A;  1WJN A;  2L8J A;  3SHQ A;  4BKG A;  2LAS A;  2JWZ A;  2OOB B;  3I3T B;  4GN1 A;  3HHM A;  4NY0 A;  2DZK A;  2KQS A;  3JW0 X;  3KUZ A;  5IA7 A;  2KMA A;  4HDQ A;  4MSQ B;  5KHO A;  1TBE A;  3DBL I;  3L13 A;  4FBJ B;  4DDI D;  4WJN A;  2PEA A;  4FHK A;  3V6E B;  2C9W B;  4IWO A;  3QAQ A;  3C0R B;  3QIJ A;  5LXI B;  4JQW C;  3VDZ A;  2AL6 A;  4EZK A;  2PE9 A;  3PT2 B;  2ZPY A;  2KWU B;  2W9N A;  3S2A A;  4AP4 C;  3ZNH B;  5DPW A;  2KN5 A;  2ZZP B;  2IY0 B;  4E3C A;  1S3S G;  1E8W A;  1WMH A;  4W9E A;  3VVW B;  2N7D A;  4GDL A;  3OJ3 A;  2ZNV C;  2GBR A;  2NBV B;  3JSV B;  3A1Q A;  2K39 A;  5EDS A;  3R3M A;  3APF A;  5D94 A;  4IWQ A;  2B3A A;  4G50 A;  4KIK B;  3EEC A;  3VUY A;  4EKU A;  4W9L A;  4JL9 A;  1SE9 A;  3ZKJ C;  1IPG A;  1WXS A;  1ZGU B;  3W1S C;  2MA9 B;  3A9K A;  3VUW A;  3WIM A;  2KWC A;  2LRW A;  4NNJ B;  5HKH A;  4ZDV A;  5AZF A;  3PLV A;  2A4Z A;  4BBN F;  3VUX A;  5CX3 A;  1UBQ A;  2D2Q A;  3V6C B;  4AOF A;  4WWP A;  3VTV A;  4MEM A;  3AU4 A;  3V62 A;  3SDL C;  2MP2 B;  4KV2 A;  2KTR A;  2CHZ A;  3H7P A;  2L76 A;  1RAX A;  4ANW A;  4FJY A;  3TJP A;  1XD3 B;  4DDG D;  2KKC A;  1P3Q U;  2RD0 A;  1WE7 A;  4FHJ A;  4RM9 A;  3APD A;  2D3G A;  1V9J A;  2DHZ A;  3APC A;  1X1M A;  1PQS A;  2FUH B;  1WGD A;  2FCQ A;  3ZO5 B;  4BKT A;  4MSM B;  4FA6 A;  2UWQ A;  2GOW A;  4K7U A;  4GIV A;  4ICU A;  3W1S A;  1WE6 A;  2FCS A;  2CHX A;  3PSE B;  4WAA A;  3EFU A;  3QC8 B;  1NI2 A;  2N9X A;  4BBN C;  4HXD A;  1E8Y A;  3NOB A;  3TCA A;  3LDZ E;  1R4M I;  4ANU A;  3ZDT A;  3RZF A;  3AXC A;  4LJP B;  4K7W A;  1SGH A;  1WGR A;  2N1W A;  4MJS B;  5TR5 A;  1XT9 B;  2HTH A;  2UYZ B;  1IYF A;  2LD9 A;  2MBE A;  4W9H A;  2O2V A;  3QX1 A;  1KM7 A;  2BYE A;  2Y5B B;  2KDE B;  5J17 A;  3WAO A;  4FUL A;  4A20 A;  1OTR B;  2KDB A;  3ZNZ B;  4HVB A;  3U30 A;  3L54 A;  1WY8 A;  3BIN A;  4MGK E;  2K6D B;  1QZE A;  2N7E A;  3B0A A;  2G4D B;  5JH5 C;  2ZCB A;  4OVV A;  1WX7 A;  3UGB B;  1WGH A;  4KDL B;  1E7U A;  2NS5 A;  2LWP A;  3L0W B;  2D11 A;  5JHB A;  4A3O A;  4HDO A;  4IW0 A;  2LZ6 A;  4CO7 A;  2DYM A;  2MBO A;  4EOY A;  2Z59 B;  3O65 B;  2WYQ A;  3VH3 B;  2IZV B;  3OJ4 B;  1V5O A;  4NAW A;  3TIX A;  4M0W B;  1WRD B;  2AL3 A;  5DPS A;  4HWI B;  2KC2 A;  3N30 A;  4DBG A;  2JY6 A;  3GOE A;  3A9J A;  1GJZ A;  4II2 B;  3B08 A;  4MDK E;  5LLI A;  3RT3 B;  2RGF A;  2JT4 B;  2HJ8 A;  2BF8 B;  2V3S A;  3DOW A;  2D10 A;  3HK0 A;  2C7H A;  2L00 B;  4K7S A;  3N3K B;  4W9C A;  2C60 A;  4GMV A;  2FNJ B;  3TL5 A;  3VFK A;  3ZTD A;  3PZD A;  2VRR B;  2DEN B;  3A4S C;  3L16 A;  2CHW A;  2KTF A;  2MBQ A;  5E6P A;  2NPT A;  2ZJD A;  2JUO A;  1OEY A;  3V60 A;  1YQB A;  1UGM A;  1WGY A;  3PS6 A;  3PV1 A;  4KSL C;  2IO3 B;  4GGQ A;  2DAF A;  3D32 A;  2WX1 A;  1OQY A;  5JZE B;  1RRB A;  3V61 A;  2O6V A;  2KWV B;  4PS7 A;  4PS8 A;  5DPT A;  4IWP A;  2FIF A;  1J19 A;  1WMH B;  3DVG Y;  1WXA A;  3ZRF A;  2M17 A;  1WGG A;  4WJP A;  3KVF B;  3ALB A;  1UH6 A;  5KHQ A;  3QCA A;  5D6J B;  4II3 B;  2KZR A;  4DHZ B;  2ZVO A;  4ICV A;  2KMC A;  3DQV A;  5FR6 A;  1IP9 A;  2EMS A;  3QQ8 B;  3ONS A;  1P1A A;  1WZ0 A;  2CS4 A;  2NVU I;  4HK2 A;  2HE7 A;  3Q3J A;  4MM3 A;  2J0K A;  4F8C B;  3BY4 B;  2K1F A;  2KNB A;  1L7Y A;  4KSK C;  2K6Q A;  4FAD A;  4P7I A;  4DHZ E;  2LI5 A;  4IUM B;  4KDI C;  1GC7 A;  1GNU A;  3MHS D;  4XZ4 A;  4CYE A;  2N9E B;  4DWF A;  1G6J A;  4DHJ D;  4GDK B;  2NBW B;  4BKS D;  4LJO B;  3CSF A;  5C1Z A;  3QJZ A;  3WAM A;  4FJZ A;  4ZRJ A;  2KFK B;  1EUV B;  1WJU A;  2NCN A;  2GBJ A;  2LUE A;  4MGZ E;  3PHX B;  4G0N B;  2K25 A;  2ZNV B;  1GUA B;  4KZ0 A;  5G55 A;  1ISN A;  4DK5 A;  2G4S A;  3PRZ A;  2J0J A;  3OLM D;  1KJT A;  3LJ3 A;  3JSV A;  1R4N I;  4GSW A;  2FCN A;  2IO1 B;  2IY1 B;  1RFA A;  3PPA A;  4B9K A;  3QAR A;  2K8C A;  4G11 A;  2CR5 A;  1GG3 A;  3DBH I;  1V5T A;  1WXV A;  1YX6 B;  2FCM A;  4WWO A;  4G3X B;  4IM3 A;  2KX3 A;  1E5W A;  2KOX A;  4HPM B;  3H6N A;  1WZ3 A;  3WA0 A;  2KQ7 A;  3KYC D;  3VHT C;  1C1Y B;  2GBN A;  4TQ0 A;  1UBI A;  3HIZ A;  2LXC A;  2QHO A;  2M1M A;  3AI5 A;  2ZEQ A;  1YX5 B;  3DVN U;  2IO0 B;  2LJ5 A;  3DCG A;  3IVF A;  2LRU A;  2XEW A;  2KAN A;  3M3J A;  2OJR A;  3L17 A;  1RLF A;  4TKN A;  2M4N A;  1JRU A;  1EF1 A;  3HM6 X;  2JPH A;  2MP2 A;  2XK5 A;  3RUI B;  4E71 A;  4URK A;  1Q5W B;  4DHJ B;  2AEH A;  2DZI A;  3R7R A;  1LXD A;  1VCB A;  2DZJ A;  2L0T A;  4W9D A;  4DXA B;  4HLE A;  1WM2 A;  3X0W A;  3ZUN A;  1Y8R C;  2MWS B;  4IC7 B;  4ANV A;  2LXA A;  1E90 A;  3NS8 A;  2M8S A;  1Q1O A;  3NZS A;  4X57 B;  2MW5 A;  2BYV E;  3T9L A;  4NJ6 A;  1TGZ B;  5E6O A;  3EHV A;  3AUL A;  1YIW A;  3R66 C;  2JVC A;  5D7G A;  1WX9 A;  4PYU A;  3DBR I;  3KYD D;  1UD7 A;  3JYU A;  4W9K A;  4EUT A;  5L95 C;  1E8Z A;  1LM8 B;  3PHW B;  2AYO B;  2I1J A;  3CF6 E;  4MJS A;  3PRP B;  1WJ4 A;  1WR1 A;  3ZNI D;  2GMI C;  1FXT B;  5GMV A;  5LXH A;  4AJY B;  2BWF A;  3B1L X;  3PRM B;  2FAZ A;  1K8R B;  3CMM B;  1H8C A;  3KH0 A;  2LGX A;  3H1U A;  1WR6 E;  3N32 A;  4EZJ A;  1TTN A;  3W1Y A;  3QA8 A;  2C5L C;  1AAR A;  2LVP A;  1WF9 A;  2EMT A;  1V80 A;  4NQL B;  4WQO B;  2ZCC A;  1WIA A;  5G2N A;  1UEL A;  1U4A A;  1VD2 A;  3DDC B;  4HJK A;  2KFJ A;  4WJO A;  3GZN I;  2K8B A;  1WXM A;  2L0F A;  3H9D A;  4PS3 A;  1A5R A;  2HD5 B;  2MQJ A;  1ZKH A;  4JIO U;  1I35 A;  5AZG A;  4B6W A;  3U8Z A;  2KXJ A;  4GU2 A;  1Q0W B;  3VH4 B;  4EEW A;  4EZL A;  2EKE C;  4GDL B;  2RSU A;  4W9F A;  3WAN A;  4I6N B;  3A1Q B;  3UIN B;  3ZLZ A;  1V81 A;  1Z5S B;  3MJW A;  4GOC A;  2JZZ A;  5CTR C;  2PE6 B;  3NZU A;  2J0M A;  2N9P C;  4ANX A;  3IHP C;  3A4R A;  1LQB A;  4K1R B;  1J0G A;  4JLC A;  3WAL A;  3ZNG C;  4LCD E;  3RD2 A;  2JZ3 B;  5C23 A;  3ZVV A;  5CHF A;  3VQI A;  3A9K B;  4XX5 A;  4NJ7 A;  2MBB B;  3K9O B;  1V2Y A;  1WM3 A;  2I1K A;  1EF5 A;  4MGI E;  1T0Y A;  4EFO A;  3M62 B;  1UZX B;  4MH0 E;  1Z2M A;  3UQB A;  3NHE B;  3A33 B;  4N9F 4;  2M0X A;  2XBB C;  3VXW A;  1P98 A;  1SIF A;  3UF8 A;  3SD5 A;  2KJH B;  2IYD B;  2LGY A;  1EO6 A;  4ZRI A;  2NBU A;  5DPR A;  4BOS C;  1P0R A;  1V6E A;  3VAW A;  2KTR B;  3H7P B;  2KK8 A;  2FID A;  4E74 A;  1WH3 A;  2KDI A;  1E7V A;  5L83 A;  4FN2 A;  3ZDM C;  2BPS A;  1I42 A;  1H4R A;  5BO4 B;  4W9J A;  4PYZ A;  1WJ6 A;  1WX8 A;  4WWN A;  3ZW3 A;  1J8C A;  1BT0 A;  3HM3 A;  5D2M B;  2DYB A;  2V4L A;  1KLV A;  4OVU A;  3ZIM A;  4KIK A;  3QWZ B;  3R7Q A;  2MBH A;  1KOT A;  1E8X A;  2PJH A;  2MSE D;  3ECI A;  2C7M B;  2N4F A;  5IAA C;  4IM2 A;  4JGH B;  4GDK A;  1MG8 A;  3M63 B;  4W9G A;  2R2Q A;  3OAW A;  4IM0 A;  1S1Q B;  1WYW B;  2WX0 A;  5E6N A;  4B95 A;  2BGF A;  4ZRK A;  3L10 B;  4KVG B;  4AWJ A;  4RM8 A;  2A5U A;  4K81 A;  2MX2 A;  2KFK A;  2MLB A;  2K8H A;  4IG7 B;  2XK5 B;  3JVZ X;  3UQA A;  2GBK A;  3TMP B;  3H7S A;  2C7N B;  3RYT A;  4AJW A;  3K9P B;  2O2V B;  1V86 A;  3DBS A;  4W9I A;  2LGD A;  1XQQ A;  2KD0 A;  2BYF A;  1P9D U;  2JXX A;  3IG3 A;  4I6P A;  4M8N A;  4A3P A;  3MTN B;  3X23 A;  2KVR A;  3EC8 A;  4TUU A;  1L2N A;  3ML9 A;  2JRH A;  3PTF C;  5CHW A;  4AUQ C;  2G3Q B;  2BWE S;  5AEK B;  2ZPN A;  2N1V A;  2L7R A;  4HCN B;  4HCP B;  4GXB A;  4BFR A;  2ZVN A;  2O6V D;  2WWZ A;  3PVL A;  4RMA A;  3UIP B;  2PPH A;  4GB9 A;  4XC2 A;  2IBI B;  2Z0D B;  3AU5 A;  4LDT D;  2KLC A;  3U7D A;  2G45 B;  3PLU A;  1OEY J;  4NAW B;  3VTW A;  2BKF A;  5J2R A;  3IFW B;  2AWT A;  1ZW7 A;  1F9J A;  2MRP A;  3ENE A;  3WAP A;  3KUC B;  3RZW C;  3Q3F A;  3PRE A;  5CHV C;  5AZH A;  5DCN A;  2LVO A;  1WI0 A;  3A9J B;  3VTU A;  1V49 A;  4BKS A;  2KLG A;  4CHK A;  2Z0E B;  4YL8 A;  3SU8 X;  4MEL A;  3DPD A;  3P2B A;  2L05 A;  2R2O A;  3QK0 A;  3RCZ A;  2KDF B;  2ASQ A;  2J7Q B;  4J6I A;  3KW5 B;  2KO3 A;  2NR2 A;  1CMX B;  4TQ1 A;  4M8M A;  2GBM A;  2CKH B;  2L3Z A;  4FLH A;  4TV3 A;  3RUL A;  3ZRC A;  1D3Z A;  5J18 A;  2D07 B;  4WJQ A;  2MCN B;  4NPN A;  2CU1 A;  1NDD A;  1GC6 A;  3ML8 A;  3T8M A;  2NPT B;  2DAJ A;  1YJ1 A;  1C3T A;  2JRI B;  3PGE A;  4ZYN A;  3L08 A;  4NQK E;  5JHA A;  1HE8 A;  2KC1 A;  2O6V B;  3TBL D;  1OGW A;  1M94 A;  2KJR A;  4KZC A;  3ZTC A;  4F1S A;  3CST A;  2RR9 A;  4LDT B;  4I6L B;  3UIO B;  4MGY E;  3IBE A;  2YLM A;  2JF5 A;  2KX0 A;  2DZM A;  2BKR B;  4ASW C;  2YVC A;  2IO2 B;  1LFD A;  3NY5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...