3SDLC

Crystal structure of human isg15 in complex with ns1 n-terminal region from influenza b virus, northeast structural genomics consortium target ids hx6481, hr2873, and or2
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
151
structure length
151
Chain Sequence
DLTVKMLAGNEFQVSLSSSMSVSELKAQITQKIGVHAFQQRLAVHPSGVALQDRVPLASQGLGPGSTVLLVVDKCDEPLSILVRNNKGRSSTYEVRLTQTVAHLKQQVSGLEGVQDDLFWLTFEGKPLEDQLPLGEYGLKPLSTVFMNLRL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis for the sequence-specific recognition of human ISG15 by the NS1 protein of influenza B virus.
pubmed doi rcsb
source organism Influenza b virus
molecule tags Viral protein/antiviral protein
molecule keywords Non-structural protein 1
total genus 37
structure length 151
sequence length 151
chains with identical sequence D
ec nomenclature
pdb deposition date 2011-06-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00240 ubiquitin Ubiquitin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 3sdlC02
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 3sdlC01
5JH5C 1H4RA 1I35A 4OVVA 2KHWB 2ZNVC 2QHOA 3SHQA 1NI2A 2WX0A 2K25A 1RAXA 2R2QA 1K8RB 5E6NA 3H6NA 3EC8A 2NBUA 1V80A 4J6IA 4NAWA 1EF5A 1S3SG 4MGKE 2MSED 2KKCA 4EEWA 4CHKA 4I6NB 2DAFA 3WAOA 2JZ3B 3RCZA 2MRPA 2KLCA 2N1VA 4A20A 4RM9A 1E8YA 4II3B 4F1SA 4MH0E 2ASQA 4I6LB 3U8ZA 1X1MA 2L00B 4CYEA 2YLMA 2BYVE 1UGMA 4FJZA 2AEHA 1V49A 2RSUA 3C0RB 2FCNA 2LVQA 2MW5A 5DCNA 3JVZX 3DOWA 4E71A 2KTFA 3VXWA 1V2YA 4HPLB 4M8NA 4NJ7A 3UIOB 2CHZA 3DVNV 3HK0A 5LLIA 4ANVA 1U4AA 4WAAA 2DX5B 3ZW3A 3OLMD 2KDEB 2JWZA 4WJOA 4N9F4 1XD3B 2RR9A 5EDSA 1IPGA 4WQOB 4DHZB 4HVBA 3K9PB 2KFKB 2RGFA 1OGWA 3ZNGC 1E8WA 4X57B 4RM8A 2CHXA 1C1YB 1Q0WB 3DDCB 3ZRFA 3RZWC 3KYCD 2K6QA 5LXHA 4NAWB 3HM3A 2RPQA 2N9XA 1WGRA 2M8SA 2GBJA 3KH0A 2KX0A 2XK5B 4GU2A 1LFDA 3RD2A 3EHVA 3RUIB 4FHKA 1L2NA 3PGEA 5C1ZA 1WI0A 2MBOA 5FR6A 3W1SA 4HPMB 3QX1A 4JGHB 4K7WA 2DYMA 4AOFA 3NOBA 2JUOA 3D32A 2YVCA 2DAJA 2MP2A 3AULA 2LRUA 2KWVB 2ZVNA 3QIJA 2GOWA 1FXTB 1WX9A 3EFUA 1ZGUB 4IWQA 3V61A 2ZJDA 3IVFA 4I6PA 3NS8A 3AXCA 1IYFA 4WWPA 1R4MI 2N7EA 2WX1A 5GMVA 4P7IA 2LUEA 3UGBB 2CU1A 3APDA 1WZ0A 5J18A 1YX5B 4E3CA 1P9DU 4GMVA 1E5WA 2EMTA 1UELA 2HE7A 2BKRB 4BVUC 3ALBA 3Q3FA 5KHOA 4PS8A 2N9EB 2ZPYA 4HCPB 4G11A 4PS3A 3PLUA 4EFOA 3ZTCA 2JY6A 3PHWB 1WYWB 3A9KA 4A3OA 3QHTA 2DZIA 4MM3A 5HKHA 3K9OB 4IWOA 1V81A 3RULA 1UBIA 2I1JA 4ANXA 1RLFA 2CS4A 2WDTB 2XK5A 2D11A 3L54A 4FULA 1WXMA 2K8CA 2KMAA 3M63B 3KW5B 4W9LA 4JIOU 2PJHA 1WE6A 5J2RA 1KLVA 4KIKB 1E8ZA 2KDFB 4MELA 3UINB 3VHTC 5G2NA 2DENB 2K39A 1WGGA 4JQWC 4K81A 2FCMA 2M17A 4B95A 3RT3B 2FAZA 4XX5A 2R2OA 4ZRIA 4PYUA 4AJWA 1Y8RC 4OVUA 4MGIE 3L13A 3DBHI 1TBEA 2K8BA 2ZEQA 1M94A 3JW0X 4LDTB 1V6EA 2M0XA 1TTNA 1EO6A 2AL6A 2GBMA 2AYOB 3R7RA 5CHWA 1EUVB 1ZKHA 2ZCCA 3GOEA 3QAQA 4IC7B 4NNJB 3SD5A 4EZLA 3A1QA 1AARA 4JL9A 3N32A 5J17A 3DCGA 3A33B 1WGHA 2PPHA 4IG7B 2LVOA 4MJSA 3TMPB 2G4DB 1Z5SB 4AUQC 5DPSA 2NBVB 2LVPA 1J8CA 4AWJA 3KUCB 4FHJA 3H7PA 4EKUA 2MCNB 1WX8A 2O6VD 3A9JB 2FUHB 1XQQA 4NY0A 3V60A 3ZIMA 2OJRA 3QJZA 2NR2A 3VTVA 2LWPA 5L83A 2KNBA 1OQYA 2ZZPB 5JHAA 2BWFA 2KWUB 4KZCA 1T0YA 1D3ZA 2LJ5A 3B08A 1PQSA 3NY5A 4IW0A 3OJ3A 2CKHB 2JXXA 2IO1B 2VRRB 3JYUA 4HDQA 1P1AA 4AJYB 3S2AA 3QARA 4BFRA 4DHZE 2AL3A 2HD5B 2N9PC 1RFAA 2N4FA 4WWOA 5D94A 1Q1OA 2PE6B 2LXCA 1OTRB 3ZVVA 1J19A 4AP4C 2V4LA 2FIDA 4DHJD 2IO3B 2NS5A 2UWQA 4FJYA 2FCQA 1P0RA 4GDKB 1JRUA 1HE8A 2MLBA 2PE9A 3L08A 3M62B 2M4NA 1L7YA 4ASWC 4B9KA 4BKSA 3B1LX 2FCSA 1WH3A 1WY8A 2BYFA 4W9CA 4XC2A 1V9JA 2BWES 3A4SC 3JSVA 3MJWA 3TIXA 3AU4A 2D3GA 4W9JA 3CF6E 1BT0A 3MHSD 4WWNA 3QQ8B 4GIVA 3UIPB 4CO7A 4URKA 3IHPC 3CMMB 1WXVA 2LGYA 2NPTB 2L8JA 2CHWA 2IO2B 3ML9A 2LASA 2REXA 4TV3A 3R7QA 4GDLB 4IM2A 3VTWA 4ANWA 1ZW7A 1TZ1A 5JZEB 5E6OA 4EUTA 4NQKE 3DBSA 1F9JA 3NHEB 2BKFA 2K8HA 2KQ7A 3A4RA 3LDZE 2ZNVB 2I1KA 2ZVOA 1Q5WB 3IFWB 4G50A 3UQAA 3PLVA 1GNUA 3KVFB 4KDLB 5D6JB 1WGYA 2L0TA 2KJ6A 1WFYA 1XT9B 2W9NA 1GJZA 1QZEA 1V86A 2KQSA 3A9JA 1OEYA 1WM3A 3H7PB 4PYZA 3V6CB 2L7RA 5IA7A 2KVRA 3OJ4B 1GC6A 2JRHA 2LXAA 4EOYA 2O2VB 4HK2A 3ZDTA 2JPHA 4FJVB 3T8MA 3VVWB 3X0WA 4KDIC 4FBJB 3ENEA 4DBGA 2G45B 2JT4B 1E7UA 3TBLD 2JRIB 1WMHB 3APCA 3TJPA 3QK0A 4EZJA 3VH4B 4ZDVA 3SDLC 2C60A 2KDIA 3HHMA 2KX3A 3RZFA 2L0FA 3ZRCA 1WXSA 4GOCA 4E74A 3ECIA 3A1QB 2NCNA 4TUUA 2C7MB 1CMXB 2GBRA 3VFKA 4ZRKA 1YD8U 1KOTA 3KUZA 3PV1A 2WYQA 3ZUNA 1WJUA 4MSQB 2A5UA 2KTRA 2HJ8A 3ZNZB 4TQ0A 3TL5A 2WWZA 4KZ0A 2IO0B 2Z0DB 4M0WB 4GGQA 5KHQA 4GSWA 4NJ6A 3CSTA 3BINA 5C23A 1OEYJ 5L95C 4ZYNA 3LJ3A 5AEKB 3PRMB 2N1WA 2C9WB 2MWSB 4B6WA 4KIKA 3PPAA 1WXAA 2G3QB 2KJRA 2IY0B 4TKNA 2J7QB 2ZPNA 5LXIB 2KTRB 1LXDA 2J0MA 2O2VA 3U7DA 2UYZB 3PHXB 5DPWA 3T9LA 1WX7A 3KUDB 3PZDA 3N30A 5BO4B 2KANA 3WA0A 2RD0A 2LI5A 1SE9A 3VTUA 2MA9B 2DZKA 2G4SA 3PT2B 3RYTA 2C7HA 4BBNF 4BKGA 2MX2A 4HCNB 3VQIA 4ICUA 3PSEB 4W9IA 1GC7A 3AI5A 3O65B 4BKSD 1I42A 2CR5A 3H1UA 2M1MA 2A4ZA 1WF9A 2EMSA 4F8CB 2L3ZA 4LCDE 1UD7A 4GDLA 3WALA 1E7VA 3R66C 1KJTA 2NVUI 4WJNA 1WRDB 2O6VA 3VAWA 2KD0A 2XEWA 4BKTA 3DBRI 2C5LC 3AU5A 3H9DA 3QCAA 2KK8A 4NQLB 3VH3B 1RRBA 3QC8B 1LQBA 4W9GA 1S1QB 4IWPA 4PS7A 4IUMB 2BPSA 4LDTD 4MGYE 3W1SC 4MEMA 1GUAB 1WR1A 5CTRC 3V62A 3H7SA 1SIFA 2MBQA 3JSVB 5CHFA 4F7ZA 4M8MA 4XZ4A 5CX3A 4DWFA 3WIMA 2DZMA 1J0GA 1V5TA 4JLCA 3UQBA 2V1YA 5JHBA 4KSKC 1LM8B 3PVLA 1A5RA 2LD9A 5CHVC 3VUXA 1WZ3A 1NDDA 5D2MB 4HXDA 1KM7A 3N3KB 3DVGY 4FLHA 3IBEA 1WMHA 1H8CA 3PREA 1UBQA 4W9DA 5TR5A 3ZKJC 4DDGD 4KSLC 3KYDD 5AZGA 4GB9A 2BF8B 2DZJA 2XBBC 2Z59B 1YJ1A 3OAWA 2D10A 2DYOA 4RMAA 3V6EB 4K7SA 2MBBB 2KFKA 3HM6X 5AZHA 1P98A 2LGDA 1WJ4A 2MBHA 1WM2A 2LZ6A 1E90A 3VUYA 4G3XB 3ZNID 3TCAA 4HDOA 2K1FA 1YQBA 2DYBA 2MQJA 3PTFC 1VD2A 4MDKE 3ZNHB 2C7NB 4ANUA 2IYDB 2Y5BB 1R4NI 3VUWA 3NZSA 4FADA 4IM0A 3UF8A 4BOSC 4BBNC 2KJHB 4W9FA 3APFA 3ONSA 2L05A 3W1YA 2J0JA 2HTHA 2PEAA 3L17A 4II2B 4K1RB 5IAAC 2KC1A 3PS6A 3ML8A 2MBEA 1WIAA 3Q3JA 2NBWB 2DHZA 3L16A 3X23A 3QWZB 4NPNA 4MSMB 2KO3A 4K7UA 4ZRJA 2V3SA 5G55A 2BGFA 3M3JA 2KZRA 3DVNU 1WR6E 4FN2A 5DPRA 2KFJA 3BY4B 4GDKA 2IY1B 3L10B 3L0WB 3QA8A 2KXJA 1C3TA 4HWIB 5DPTA 1UH6A 2Z0EB 3PRPB 1SGHA 3PRZA 1V5OA 2D2QA 2GMIC 4KV2A 2O6VB 1WE7A 4GN1A 2KMCA 2BYEA 4IM3A 3WANA 1IP9A 5D7GA 2IBIB 1GG3A 3WAMA 2GBNA 5E6PA 4ICVA 1Z2MA 1NBFC 3U30A 4DHJB 4FA6A 4A3PA 3M95A 2KOXA 1E8XA 4W9HA 3DBLI 4DK5A 2JVCA 3I3TB 4DDID 5AZFA 2ZCBA 2JZZA 4HLEA 4LJOB 4W9KA 2FNJB 3DPDA 2EKEC 4GXBA 3GZNI 3R3MA 2LGXA 3IG3A 4W9EA 3HIZA 2KN5A 4MJSB 1WJNA 1TGZB 3NZUA 2LRWA 3SU8X 4LJPB 1VCBA 3MTNB 3A9KB 1UZXB 3ZO5B 1WJ6A 3DQVA 2JF5A 2J0KA 3ZLZA 4BOZB 3WAPA 2KC2A 4TQ1A 1G6JA 2K6DB 1P3QU 1EF1A 1WGDA 2D07B 3B0AA 3P2BA 4HJKA 1MG8A 2MP2B 2AWTA 2B3AA 3CSFA 3ZDMC 4EZKA 2NPTA 1YX6B 2N7DA 4DXAB 4MGZE 4WJQA 3DVGX 2FIFA 2IZVB 2KWCA 2L76A 1YIWA 2KLGA 4YL8A 4KVGB 1ISNA 3EECA 3ZTDA 4G0NB 4WJPA 3VDZA 2OOBB 2KDBA 2GBKA
chains in the Genus database with same CATH superfamily
3GP7A 3TSSA 1H4RA 1I35A 1TKEA 4HEA1 2QHOA 1D5XC 1NI2A 1RAXA 2NBUA 2BT6A 4QAYA 2N0SB 1ET9A 2MSED 5BYRA 2KKCA 1L0VB 2PIAA 3T3NA 4I6NB 3DBHB 3WAOA 2DWQA 3AEAB 2KLCA 4A20A 1E8YA 4REZA 4II3B 4F1SA 2ASQA 4I6LB 1X1MA 2L00B 3Q3MC 2BYVE 1V49A 2RSUA 2X38A 2LVQA 1TS3A 1TT5B 2PKOA 1QQRA 3DOWA 4E71A 3VXWA 4HPLB 1JWUD 1I4GA 2KVZA 3DVNV 5LLIA 4AS1A 1HTOA 2RR9A 1IPGA 3K9PB 2RGFA 3ZNGC 2WS3B 2AX5A 1ACCA 3AEFB 1HTQA 1JMLA 3HM3A 2RPQA 2N9XA 4YTPB 2M8SA 3RUIB 3W2DA 2NMQA 3QX1A 4K7WA 2DYMA 2MHJA 3FILB 3D32A 2YVCA 2DAJA 2MP2A 1P7EA 2KACA 2LRUA 3V61A 3FC4A 3AXCA 1L5PA 1XLNA 2WX1A 1QKZA 2LUEA 2CU1A 5J18A 1YX5B 4E3CA 2EMTA 2HE7A 4BVUC 3AE2B 2EKIA 3Q3FA 1T6BX 1V1PA 4PS3A 4EFOA 3NVYA 3PHWB 1WYWB 3A9KA 4A3OA 2Z8LA 3QHTA 4WIPA 4YWGG 3DHGC 4TSSA 5D3IB 2WDTB 4FULA 3M63B 4W9LA 2W54A 2M17A 4B95A 1QOAA 4ZRIA 1JWAD 4PYUA 3AE9B 3L13A 1TBEA 4M0WA 2ZEQA 1TKYA 2AQ2B 1M94A 1D5ZC 1TTNA 2GBMA 2AYOB 1ZKHA 2Q5WD 3ZGZA 3AE6B 5J17A 3A33B 3TMPB 2G4DB 2NBVB 2LVPA 1J8CA 4AWJA 4LNOA 2MCNB 3V60A 3DBRB 4NY0A 2NR2A 3VTVA 5L83A 5JHAA 1ZUD2 2WDVB 3DHIC 3NY5A 2JXXA 1AW7A 1JQ4A 2JU6X 3RNEC 3S2AA 4BFRA 4DHZE 3VRAB 1IUEA 1QOGA 2FIDA 1MVKA 1STEA 2NS5A 3U2SC 4BZAA 4DQOC 2PE9A 3M62B 3HVZA 1C79A 2FCSA 2BWES 3JSVA 3MJWA 1SEBD 3QQ8B 2FBWB 1WXVA 2WXGA 2RDHA 2PLPA 2IO2B 2REXA 3VTWA 3C8YA 5JZEB 5E6OA 3NUHB 3AE7B 4NQKE 1F9JA 1KH0A 3LDZE 2ZNVB 3SFEB 4KDLB 2L0TA 1XT9B 1V86A 2KQSA 3DHHC 1E7PB 4PYZA 1WM3A 3V6CB 5IA7A 2KVRA 2WDRB 3ZQ4A 1J7CA 2JRHA 2MH7A 4EOYA 2O2VB 2JPHA 4FJVB 4FBJB 1UNSA 4DBGA 5FK9C 4YSYB 2JT4B 2V3NA 3TJPA 4ZDVA 1D5MC 1AN8A 3RZFA 4E74A 3ETRA 1ET6A 1HQRD 1WXSA 4C56C 2NCNA 1PGBA 3VFKA 1YD8U 4O1NA 1WJUA 2K3UA 3TL5A 4A90A 4YXDB 2IO0B 2Z0DB 4M0WB 4NJ6A 3CSTA 1BMLC 5C23A 5L95C 2OJWA 3LJ3A 3W9CB 1SE4A 1Y56A 2RPVA 2PMVA 1WXAA 1NYRA 1LXDA 2J0MA 1Q10A 1WX7A 2WXJA 2MJDA 5BO4B 3RNFC 2W82A 2RD0A 1FNVA 3MC9A 1TZOA 2MA9B 5I4DA 2G4SA 3PT2B 4WURA 3NRZA 2MX2A 3O65B 2WXLA 2CJNA 2A4ZA 1MHHE 4F8CB 1UD7A 4GDLA 4C00A 4WJNA 1WRDB 4LTUA 3DBRI 2C5LC 3QCAA 1RYJA 2KK8A 2WU2B 1S1QB 4IWPA 4PS7A 3W1SC 2BPSA 1K52A 4L23A 3V62A 1SIFA 2MBQA 4WH4A 5CX3A 4XZ4A 1J0GA 5BMHA 1A5RA 2LD9A 1N63A 2RDBC 5BYQA 1VR9A 4W9DA 5TR5A 4KGTA 4KSLC 3KYDD 4GB9A 3RI7C 2XBBC 4RGTA 4RMAA 3RNBC 2LGSA 3CIRB 4P1BC 2LGDA 2LZ6A 3ZNID 2LJIA 4XWTA 2D5GA 5BMGA 1YQBA 2DYBA 3PTFC 3ZXRA 4L2YA 2VZKB 1LGRA 4MDKE 1R4NI 2HTME 4BOSC 2IGHA 2HTHA 2D3BA 1TKGA 3L17A 5IAAC 3ML8A 1V1PB 3Q3JA 1XLQA 4MSMB 2BGFA 2R61A 1SSNA 1WR6E 2WXRA 4FN2A 2EELA 3BY4B 3L10B 1KFYB 1EU4A 4HWIB 3E9SA 1V5OA 2D2QA 4GN1A 4IM3A 2G9HD 3FILA 4XWWA 1CZPA 2RDGA 5JXVA 2I38A 2JSVX 2JZZA 4M00A 1HXYD 4HLEA 1FRRA 3DPDA 4LNKA 3GZNI 3R3MA 3IG3A 3MJ5A 1VCBA 4XDCA 3A9KB 3U52E 3DQVA 2M56B 2K6DB 4HRSA 5H8YE 1B1ZA 3PO0A 1IBXB 2AWTA 2KAJA 3CSFA 1YX6B 2N7DA 4MGZE 5AUKA 1T0QC 1YIWA 1YNTE 4N6EB 2G1EA 3ZTDA 4NAMA 1VRAB 2HJ1A 2OOBB 2GBKA 4AQ7A 5JH5C 1PFDA 3URYA 4OVVA 2KHWB 2WXOA 2GB1A 2ZNVC 3SHQA 4LNIA 4N59A 2R2QA 4DXGA 3FKYA 1V80A 1EF5A 2MJEA 1JWMD 4MGKE 1WWTA 2OEDA 1HA5A 1TJEA 2D3CA 5TSSA 3MFGA 3Q6BA 2N1VA 4XGAB 4RM9A 1UGJA 3U8ZA 1R4NB 2JX5A 1KLGD 1VZ7A 3SEBA 2WXNA 2PW9A 3C0RB 3KLSX 1UWMA 2KTFA 4KGSA 1U4AA 4WAAA 2DX5B 1TY0A 4WJOA 5EDSA 4WQOB 3IT4B 4HVBA 2WHIA 1R4MB 4X57B 3RFZB 2CHXA 1Q0WB 3DDCB 4OZCA 3KYCD 3ZJTA 1N62A 4GU2A 1LFDA 5E6JA 1L4DB 1L2NA 2MBOA 2JUOA 3AULA 3B9JA 2GOWA 1WX9A 3EFUA 4IWQA 4I6PA 1IYFA 4WWPA 5GMVA 4P7IA 5H92C 1TS5A 3APDA 1WZ0A 2K22A 1NYQA 2BKRB 1EM7A 1ZP0B 5KHOA 2DNFA 2LHDA 3AECB 2ZPYA 4HCPB 3AV8A 1T0RC 2BS4B 1D4BA 4US8A 4MM3A 1V81A 3RULA 1UBIA 2I1JA 2SAKA 1P7FA 2CS4A 1I4PA 2D11A 1L0YB 2SEBD 4JIOU 2PJHA 1WE6A 1KLVA 3R8BA 4MELA 2KDFB 1OQQA 2FCMA 3RT3B 4XX5A 3AEEB 3CWIA 4AJWA 1PDXA 1N5WA 3DBHI 1I7HA 1FXAA 3RMKC 2H89B 2J42A 2N9LA 1V6EA 2M0XA 3ZUNA 3R7RA 4IC7B 3GOEA 3QAQA 4EZLA 3A1QA 3NS1A 2IGDA 3I9V1 3RNGC 2RMMA 2BQQA 4MJSA 5C3JB 1QILA 1Z5SB 5DPSA 4JWSC 4FHJA 3ZIMA 2FUHB 1K50A 3QJZA 4OW0A 2LWPA 2KNBA 2KWUB 1NENB 4HJGE 2GI9A 1PQSA 3Q8CA 1BXTA 3V05A 2CKHB 3JYUA 3BK1A 1YN5A 3QARA 2AL3A 1WSPA 1ZXHA 2HD5B 2N9PC 1RFAA 2N4FA 4KX6B 2PE6B 3AE8B 4FJYA 1FIQA 2VH2A 1FNUA 2AQ1B 2M4NA 2GRIA 4W9CA 1WH3A 2BYFA 1DOXA 4WWNA 4GIVA 3IHPC 2NPTB 4RF0A 4TV3A 4IM2A 1EWCA 1RWSA 4RFBA 1CK1A 4EUTA 3DBSA 3NHEB 3BZDB 1J7BA 4MACA 3BYYB 1UF0A 1Q5WB 4G50A 1TIFA 3PLVA 5D6JB 1WGYA 4JPSA 1YN4A 1F77A 2L32A 1FEHA 4BAXA 3OJ4B 3Q69A 3Q8BA 4HK2A 3T8MA 3VVWB 3IXSA 3ENEA 5HI1A 4K3CA 3AM9A 1E7UA 1WMHB 3APCA 4EZJA 3SDLC 1NVID 4OVZA 2XN9C 3Q3OC 4TMAB 1IGDA 2GBRA 1KOTA 3KUZA 3PV1A 2WYQA 4MSQB 2A5UA 1N60A 2HJ8A 3TEYA 4C4VA 5BMIA 4GSWA 5G5HA 2PVGC 2KWDA 3DWGC 1WRIA 2C9WB 2MWSB 2ACZB 4KIKA 4A55A 3PPAA 2G3QB 2ZW1A 2KJRA 2IY0B 1IGCA 3AEBB 3W5VB 1L4ZB 4YTNB 2BS3B 3WA0A 2Y5PA 1SE9A 1C77A 2DZKA 4BBNF 2K0PA 4BKGA 2ICIA 4ICUA 1GC7A 1I4QA 2KYWA 3AB5A 1I42A 1QOBA 1YMHE 3MC8A 2M1MA 1WF9A 2OHFA 2EMSA 2L3ZA 4LCDE 3WALA 1E7VA 3R66C 2O6VA 3AE3B 4BKTA 2WXKA 5IKCM 4W9GA 4RGNA 4IUMB 1M4VA 3H7SA 5CHFA 3R2IA 2H88B 3SFDB 4F7ZA 3AEDB 4DWFA 2L1AA 5IP4D 3C19A 3UQBA 4S17A 2J53A 5EE9A 3PVLA 1KLUD 2VH1A 3GE8C 3VUXA 1NDDA 4LNNA 2XNAC 4R3DA 1H8CA 3PREA 1UBQA 1C4PA 5AZGA 4OZAA 1YJ1A 3OAWA 2MBBB 2KFKA 3HM6X 1P98A 4RH6A 3VUYA 3TCAA 4HDOA 2K1FA 3EA6A 1K53A 2C7NB 1I4XA 2IYDB 5IN7A 3NZSA 1XO3A 4FADA 4BBNC 2L05A 2QMTA 2J52A 2JQRB 3PS6A 4M02A 1WIAA 3X23A 4ZRJA 3GZNB 5G55A 2KZRA 4GDKA 3AH7A 3TEZA 2KXJA 3TEXA 1UH6A 1SGHA 3ZXVA 2O6VB 5FR3A 2INPE 4HPPA 2BYEA 4OZBA 2IBIB 1GG3A 2GBNA 4C7YA 1NBFC 4FA6A 3DWMA 2KOXA 1E8XA 4D2KA 2IJ0A 1MHXA 4PT5A 4W9KA 2EKEC 4W9EA 2KN5A 4YSXB 3Q14C 1UZXB 5IOIA 1GB1A 1WJ6A 2KC2A 2BW2A 1P3QU 2W3SA 1WGDA 2D07B 3P2BA 4HJKA 1MFWA 3EFCA 2B3AA 2LMCA 4EZKA 2JYEA 4WJQA 1F0ZA 1L0XB 2FIFA 4WJPA 3VDZA 4JE3B 1QT9A 3H8HA 1GAQB 4XDDA 2WX0A 3AE5B 2K25A 2QILA 4IOIE 2DBYA 1K8RB 5E6NA 3I57A 2MJ3A 3EC8A 4J6IA 3P4RB 2WXFA 5HG2A 1S3SG 3WCQA 4IKGA 2INCC 4EEWA 4CHKA 2JZ3B 3RCZA 3NG0A 4MH0E 4P1CC 1UGMA 4FJZA 3ZJVA 1ZE3D 2FCNA 2QDFA 2TSSA 3I63C 4JX1C 1XCQL 1V2YA 3Q2AC 4NJ7A 3UIOB 2CHZA 4ANVA 3HK0A 5EE0A 3ZW3A 3BVGA 4N9F4 1WYGA 1E8WA 1EU3A 1C1YB 3RZWC 4WQMA 4NAWB 3BVZA 3KH0A 5EE1A 2BB6A 2GBJA 3RD2A 2XK5B 3UI3A 3EHVA 1VJKA 2LUMA 3PGEA 3B2FA 1WI0A 1SJED 2INDC 4HPMB 4WWMA 1B9RA 4AOFA 3NOBA 4K3BA 4DXFA 4WAFA 2KWVB 3QIJA 3P4PB 1FXTB 4RCOA 2ZJDA 1JALA 3IVFA 3NS8A 2WLBA 1KF6B 4CQNA 2N7JA 3NVVA 2JXTA 1XXGA 4GMVA 2N9EB 1L6VA 4G11A 1F1HA 1HZ6A 3ZTCA 4HROA 2DZIA 5HKHA 1YN3A 4NZLB 3RN9C 1V97A 4FXCA 4HKQA 2WP9B 2XK5A 3Q8AA 3L54A 1WXMA 2K8CA 2KMAA 2HDEA 1TY2A 1MI0A 1ZDVA 5G2NA 4IDIA 4JQWC 4C80A 3BVMA 1Y8RC 3GB1A 3AE4B 2K8BA 2KQ4X 1JROA 1EO6A 2AL6A 1EUVB 3BK2A 4B0EA 1AARA 1BUIC 3N32A 3DCGA 1FPYA 3AMZA 1WGHA 1L6UA 2LVOA 2JYTA 2E3TA 1C76A 2ZW0A 4AUQC 2BVCA 1KRHA 3KUCB 3H7PA 4EKUA 1WX8A 2O6VD 3A9JB 2OJRA 2ZZPB 2LJ5A 3B08A 4IW0A 2IO1B 1UUPA 3GS2A 3IAS1 4PK1A 4HDQA 4AJYB 1SE3A 2IDYA 4WWOA 2BS2B 1Q1OA 1OTRB 3ZVVA 2PVOD 3VR8B 1FCCC 3N1ZC 2UWQA 2FCQA 5EE3A 1P0RA 4GDKB 1JRUA 1HE8A 2MLBA 3L08A 4ASWC 1L7YA 4RGMA 1ZDXA 4XC2A 1V9JA 1DOIA 2D3GA 3CF6E 3UIPB 1NI3A 4CO7A 4URKA 2L8JA 2CHWA 4LK0M 3ML9A 1LO5D 3R7QA 1ZW7A 3KWVA 1PUTA 3A4RA 4UDUC 4HKZE 2I1KA 1MJDA 1SBBB 3UQAA 2W9NA 4ACFA 1QZEA 3A9JA 3H7PB 2L7RA 1XLOA 3B2GA 3RNCC 1UWXA 4KDIC 2G45B 1JW9D 4A8XC 5LNK1 2C60A 2KDIA 2KX3A 3ZRCA 5HFYA 4ZRPA 1PGAA 1XCTL 4TUUA 4US9A 1CMXB 4ZRKA 1IBXA 3P42A 2KTRA 3ZNZB 4ZHPA 4KZ0A 4GGQA 5KHQA 3BINA 5D3DA 1OEYJ 4ZYNA 1ZPSA 5AEKB 4YSZB 2N1WA 4B6WA 3DBLB 5LXIB 2KTRB 3U7DA 2UYZB 3T9LA 3N30A 4ZYSA 2KANA 4N58A 3N9YC 3VQIA 1AYFA 4W9IA 1JRPA 3AI5A 3PSEB 2CR5A 2WQYB 1T0SC 3TUOA 1FO4A 1KJTA 1SE2A 2XEWA 3AU5A 1YQ4B 4NQLB 3VH3B 1WR1A 5CTRC 2K9XA 1SF0A 4JWUC 4B0MA 1F2RI 4M8MA 3WIMA 2DZMA 3OG5A 4JLCA 2V1YA 5JHBA 4KSKC 1LM8B 5MPOA 1WZ3A 1I4HA 2WU5B 3KWLA 5D2MB 4HXDA 1KM7A 4YTMB 4FLHA 3IBEA 1WMHA 4KKIA 4USAA 4DDGD 2BF8B 3HRDD 1DGJA 4A9AA 2UU7A 2M0AA 4K7SA 5AZHA 1PGXA 2MBHA 2WXQA 1E90A 4G3XB 3ZNHB 2QC8A 2Y5BB 3T3OA 1V8CA 3ONSA 1OFFA 2J0JA 2PEAA 4II2B 1SJHD 4K1RB 2KC1A 2AQ3B 1DOYA 1EWYC 1FM0D 3EUB2 1VDVA 2NBWB 2DHZA 3NVZA 4NPNA 4K7UA 1R7SA 1T5XD 2WGSA 3AN1A 3M3JA 3MHZA 5DPRA 4RF1A 2KFJA 2IY1B 2VZKD 2ON8A 1C3TA 2QCZA 2Z0EB 3VRBB 2KMMA 3PRZA 2GMIC 4KV2A 3LYYA 1WE7A 1HZ5A 2KMCA 1N6ZA 5D7GA 4KKJA 4ITKA 3WAMA 5E6PA 4ICVA 4MM3B 4DHJB 3M95A 4L1BA 4W9HA 3DBLI 4DK5A 2ZCBA 3P1MA 4LJOB 2FNJB 2BTEA 1FFUA 1CQVA 1FNWA 2LGXA 1DYQA 3HIZA 4MJSB 1WJNA 1TGZB 2I2YA 1ESFA 2LHEA 2JF5A 3ZLZA 4BOZB 1GPXA 3WAPA 4TQ1A 1G6JA 2W55A 3B0AA 3GE3C 1SIJA 3BWUD 3E56A 3ZDMC 2NPTA 2IZVB 2MEKA 4G0NB 3HVDA 4XYCA 2KDBA 4ARCA 3AEGB 5BYSA 4RGOS 2KT7A 3H6NA 4NAWA 2GLSA 1TYGB 1E10A 3MP9A 3P63A 4S0RA 2LGIA 2NTSA 2DAFA 1ZOYB 2MRPA 3O13A 1JWSD 1JWBD 3P4SB 3FAHA 1QOFA 4CYEA 2YLMA 2AEHA 2QSDA 1VZ6A 3NVWA 2KN4A 2LEKA 2MW5A 3JVZX 2INNE 4M8NA 1AWDA 3IAM1 1F2RC 2BBCA 2DLBA 3OLMD 2KDEB 2JWZA 4A6QA 1XD3B 1MG4A 2B76B 4DHZB 3LB8C 2KFKB 1OGWA 1SXTA 4RM8A 3OWEB 3ZRFA 2K6QA 5LXHA 4MT5A 1WGRA 2KX0A 4FHKA 5C1ZA 5FR6A 3W1SA 4KGRA 4JGHB 4M01A 5GXGB 2ZVNA 1ZGUB 2JWUA 4NJCA 1R4MI 3N1XC 2N7EA 3SR6A 1CJEA 3I5JC 3UGBB 1P9DU 2KDMA 1E5WA 1K51A 1PYWD 1UELA 3ALBA 4PS8A 3PLUA 2JY6A 2M19A 4Q2JA 2J4XA 3K9OB 4IWOA 4ANXA 1RLFA 2WXIA 4H2AA 2WXPA 3U4EG 4P6VF 2K5PA 3KW5B 1TS4A 5J2RA 4KIKB 1E8ZA 3UINB 3VHTC 2DENB 2K39A 1WGGA 4K81A 4YT0B 2FAZA 2N9KA 2R2OA 2WXMA 4OVUA 4MGIE 4C4VB 2WDQB 2IGGA 3TEWA 4EE2A 4LDTB 2JZPA 3JW0X 4LLGM 5CHWA 2ZCCA 3SD5A 4NNJB 2W3RA 1N61A 2LFIA 3EGRA 4JL9A 2Y3AA 4XE0A 2PPHA 4IG7B 3N1YC 4RNAA 3RNAC 2QIEB 1XQQA 1VZ8A 1KTKA 1QF6A 1OQYA 2YEPF 1SB3C 2BWFA 4KZCA 1T0YA 1D3ZA 3OJ3A 1V1OA 2VRRB 2V0GA 1P1AA 1YOVB 3ZYYX 5D94A 3L4PA 2LXCA 1J19A 4AP4C 2V4LA 4DHJD 1I4RA 2IO3B 2L52A 3PZ7A 1F52A 4BKSA 4B9KA 3ZJUA 3B1LX 5DCNA 1WY8A 3A4SC 3TIXA 3AU4A 1FFVA 4W9JA 2X8XX 1N5XA 4GLSC 1BT0A 2V4IB 3MHSD 3CMMB 2LGYA 3IT6B 2LASA 3P4QB 4GDLB 4ANWA 1TZ1A 2E6XA 2D3AA 1MPEA 3KQ4A 1J7AA 2BYTA 2BKFA 2K8HA 2KQ7A 1FD6A 2ZVOA 3IFWB 1GNUA 3KVFB 3NZ3A 2KJ6A 1WFYA 1WXQA 1GJZA 1OEYA 3VR9B 1GC6A 1YJJA 2LXAA 3ZDTA 3X0WA 1ENFA 3MC0B 3TBLD 2JRIB 5IO9A 1TS2A 3QK0A 4MH8A 3VH4B 3HHMA 2L0FA 4GOCA 3ECIA 3A1QB 5C2TB 2C7MB 2WNMA 3W5UB 4TQ0A 2WWZA 2V9HA 1RM6C 3ABVB 1FRDA 2ONQA 3PRMB 3AE1B 3NJTA 4TKNA 2J7QB 2ZPNA 2O2VA 1A70A 2CJOA 3PHXB 5DPWA 2L83A 2FUG1 2QJLA 3KUDB 3PZDA 4LNFA 1YQ3B 2LI5A 3VTUA 1E0ZA 3RYTA 2C7HA 4HCNB 1D6EC 1FMAD 3HUIA 5FKAC 4BKSD 3H1UA 2CU3A 2BB5A 1QLBB 3RPFC 3BIID 2NVUI 3VAWA 1E9MA 2KD0A 3H9DA 1RRBA 3QC8B 1LQBA 4P16A 4MGYE 4LDTD 4MEMA 1GUAB 3JSVB 1V5TA 2Y5CA 2NTTA 5CHVC 1HEZE 3N3KB 3DVGY 3LXFA 3V3XA 1XF5L 3ZKJC 1E6EB 2DZJA 3R2TA 2YEPB 2Z59B 2D10A 2DYOA 1RFKA 3V6EB 1C78A 2WXHA 1WJ4A 1WM2A 3Q3NC 1FXIA 3Q8FA 1YJIA 2MQJA 4OHJA 1VD2A 4J3OD 1NEKB 2QEJC 4ANUA 3VUWA 4IM0A 3UF8A 2KJHB 4W9FA 3APFA 2PTLA 3W1YA 1JCKB 4ZOHC 3PZ8A 1T3QA 2MBEA 1GOZA 3L16A 1FCLA 3QWZB 2KO3A 2V3SA 5G5GA 4ARIA 3DVNU 1ZXIA 5AUIA 3L0WB 1ROEA 3QA8A 1C4AA 2IPKD 5DPTA 3PRPB 1C4CA 1XLPA 2FE8A 1OQRA 3WANA 1IP9A 1Z2MA 5HHDG 3U30A 4A3PA 1VLBA 2JVCA 3I3TB 4DDID 5AZFA 1XEEA 4ZHOA 4C7ZA 4GXBA 3NZUA 2LRWA 3N20C 3SU8X 4LJPB 3MTNB 3ZO5B 3BYTB 1WGKA 4ZRQA 2J0KA 1C9FA 3Q8EA 3J9CA 1EF1A 5T8IA 1MG8A 2MP2B 2V3PA 3U7ZA 4DXAB 3DVGX 2KWCA 2L76A 2KLGA 4YL8A 4KVGB 1GB4A 1ISNA 3EECA
chains in the Genus database with same CATH topology
5JH5C 1H4RA 1I35A 4OVVA 2KHWB 2ZNVC 2QHOA 3SHQA 1NI2A 2WX0A 2K25A 1RAXA 2R2QA 1K8RB 5E6NA 3H6NA 3EC8A 2NBUA 1V80A 4J6IA 4NAWA 1EF5A 1S3SG 4MGKE 2MSED 2KKCA 4EEWA 4CHKA 4I6NB 2DAFA 3WAOA 2JZ3B 3RCZA 2MRPA 2KLCA 2N1VA 4A20A 4RM9A 1E8YA 4II3B 4F1SA 4MH0E 2ASQA 4I6LB 3U8ZA 1X1MA 2L00B 4CYEA 2YLMA 2BYVE 1UGMA 4FJZA 2AEHA 1V49A 2RSUA 3C0RB 2FCNA 2LVQA 2MW5A 5DCNA 3JVZX 3DOWA 4E71A 2KTFA 3VXWA 1V2YA 4HPLB 4M8NA 4NJ7A 3UIOB 2CHZA 3DVNV 3HK0A 5LLIA 4ANVA 1U4AA 4WAAA 2DX5B 3ZW3A 3OLMD 2KDEB 2JWZA 4WJOA 4N9F4 1XD3B 2RR9A 5EDSA 1IPGA 4WQOB 4DHZB 4HVBA 3K9PB 2KFKB 2RGFA 1OGWA 3ZNGC 1E8WA 4X57B 4RM8A 2CHXA 1C1YB 1Q0WB 3DDCB 3ZRFA 3RZWC 3KYCD 2K6QA 5LXHA 4NAWB 3HM3A 2RPQA 2N9XA 1WGRA 2M8SA 2GBJA 3KH0A 2KX0A 2XK5B 4GU2A 1LFDA 3RD2A 3EHVA 3RUIB 4FHKA 1L2NA 3PGEA 5C1ZA 1WI0A 2MBOA 5FR6A 3W1SA 4HPMB 3QX1A 4JGHB 4K7WA 2DYMA 4AOFA 3NOBA 2JUOA 3D32A 2YVCA 2DAJA 2MP2A 3AULA 2LRUA 2KWVB 2ZVNA 3QIJA 2GOWA 1FXTB 1WX9A 3EFUA 1ZGUB 4IWQA 3V61A 2ZJDA 3IVFA 4I6PA 3NS8A 3AXCA 1IYFA 4WWPA 1R4MI 2N7EA 2WX1A 5GMVA 4P7IA 2LUEA 3UGBB 2CU1A 3APDA 1WZ0A 5J18A 1YX5B 4E3CA 1P9DU 4GMVA 1E5WA 2EMTA 1UELA 2HE7A 2BKRB 4BVUC 3ALBA 3Q3FA 5KHOA 4PS8A 2N9EB 2ZPYA 4HCPB 4G11A 4PS3A 3PLUA 4EFOA 3ZTCA 2JY6A 3PHWB 1WYWB 3A9KA 4A3OA 3QHTA 2DZIA 4MM3A 5HKHA 3K9OB 4IWOA 1V81A 3RULA 1UBIA 2I1JA 4ANXA 1RLFA 2CS4A 2WDTB 2XK5A 2D11A 3L54A 4FULA 1WXMA 2K8CA 2KMAA 3M63B 3KW5B 4W9LA 4JIOU 2PJHA 1WE6A 5J2RA 1KLVA 4KIKB 1E8ZA 2KDFB 4MELA 3UINB 3VHTC 5G2NA 2DENB 2K39A 1WGGA 4JQWC 4K81A 2FCMA 2M17A 4B95A 3RT3B 2FAZA 4XX5A 2R2OA 4ZRIA 4PYUA 4AJWA 1Y8RC 4OVUA 4MGIE 3L13A 3DBHI 1TBEA 2K8BA 2ZEQA 1M94A 3JW0X 4LDTB 1V6EA 2M0XA 1TTNA 1EO6A 2AL6A 2GBMA 2AYOB 3R7RA 5CHWA 1EUVB 1ZKHA 2ZCCA 3GOEA 3QAQA 4IC7B 4NNJB 3SD5A 4EZLA 3A1QA 1AARA 4JL9A 3N32A 5J17A 3DCGA 3A33B 1WGHA 2PPHA 4IG7B 2LVOA 4MJSA 3TMPB 2G4DB 1Z5SB 4AUQC 5DPSA 2NBVB 2LVPA 1J8CA 4AWJA 3KUCB 4FHJA 3H7PA 4EKUA 2MCNB 1WX8A 2O6VD 3A9JB 2FUHB 1XQQA 4NY0A 3V60A 3ZIMA 2OJRA 3QJZA 2NR2A 3VTVA 2LWPA 5L83A 2KNBA 1OQYA 2ZZPB 5JHAA 2BWFA 2KWUB 4KZCA 1T0YA 1D3ZA 2LJ5A 3B08A 1PQSA 3NY5A 4IW0A 3OJ3A 2CKHB 2JXXA 2IO1B 2VRRB 3JYUA 4HDQA 1P1AA 4AJYB 3S2AA 3QARA 4BFRA 4DHZE 2AL3A 2HD5B 2N9PC 1RFAA 2N4FA 4WWOA 5D94A 1Q1OA 2PE6B 2LXCA 1OTRB 3ZVVA 1J19A 4AP4C 2V4LA 2FIDA 4DHJD 2IO3B 2NS5A 2UWQA 4FJYA 2FCQA 1P0RA 4GDKB 1JRUA 1HE8A 2MLBA 2PE9A 3L08A 3M62B 2M4NA 1L7YA 4ASWC 4B9KA 4BKSA 3B1LX 2FCSA 1WH3A 1WY8A 2BYFA 4W9CA 4XC2A 1V9JA 2BWES 3A4SC 3JSVA 3MJWA 3TIXA 3AU4A 2D3GA 4W9JA 3CF6E 1BT0A 3MHSD 4WWNA 3QQ8B 4GIVA 3UIPB 4CO7A 4URKA 3IHPC 3CMMB 1WXVA 2LGYA 2NPTB 2L8JA 2CHWA 2IO2B 3ML9A 2LASA 2REXA 4TV3A 3R7QA 4GDLB 4IM2A 3VTWA 4ANWA 1ZW7A 1TZ1A 5JZEB 5E6OA 4EUTA 4NQKE 3DBSA 1F9JA 3NHEB 2BKFA 2K8HA 2KQ7A 3A4RA 3LDZE 2ZNVB 2I1KA 2ZVOA 1Q5WB 3IFWB 4G50A 3UQAA 3PLVA 1GNUA 3KVFB 4KDLB 5D6JB 1WGYA 2L0TA 2KJ6A 1WFYA 1XT9B 2W9NA 1GJZA 1QZEA 1V86A 2KQSA 3A9JA 1OEYA 1WM3A 3H7PB 4PYZA 3V6CB 2L7RA 5IA7A 2KVRA 3OJ4B 1GC6A 2JRHA 2LXAA 4EOYA 2O2VB 4HK2A 3ZDTA 2JPHA 4FJVB 3T8MA 3VVWB 3X0WA 4KDIC 4FBJB 3ENEA 4DBGA 2G45B 2JT4B 1E7UA 3TBLD 2JRIB 1WMHB 3APCA 3TJPA 3QK0A 4EZJA 3VH4B 4ZDVA 3SDLC 2C60A 2KDIA 3HHMA 2KX3A 3RZFA 2L0FA 3ZRCA 1WXSA 4GOCA 4E74A 3ECIA 3A1QB 2NCNA 4TUUA 2C7MB 1CMXB 2GBRA 3VFKA 4ZRKA 1YD8U 1KOTA 3KUZA 3PV1A 2WYQA 3ZUNA 1WJUA 4MSQB 2A5UA 2KTRA 2HJ8A 3ZNZB 4TQ0A 3TL5A 2WWZA 4KZ0A 2IO0B 2Z0DB 4M0WB 4GGQA 5KHQA 4GSWA 4NJ6A 3CSTA 3BINA 5C23A 1OEYJ 5L95C 4ZYNA 3LJ3A 5AEKB 3PRMB 2N1WA 2C9WB 2MWSB 4B6WA 4KIKA 3PPAA 1WXAA 2G3QB 2KJRA 2IY0B 4TKNA 2J7QB 2ZPNA 5LXIB 2KTRB 1LXDA 2J0MA 2O2VA 3U7DA 2UYZB 3PHXB 5DPWA 3T9LA 1WX7A 3KUDB 3PZDA 3N30A 5BO4B 2KANA 3WA0A 2RD0A 2LI5A 1SE9A 3VTUA 2MA9B 2DZKA 2G4SA 3PT2B 3RYTA 2C7HA 4BBNF 4BKGA 2MX2A 4HCNB 3VQIA 4ICUA 3PSEB 4W9IA 1GC7A 3AI5A 3O65B 4BKSD 1I42A 2CR5A 3H1UA 2M1MA 2A4ZA 1WF9A 2EMSA 4F8CB 2L3ZA 4LCDE 1UD7A 4GDLA 3WALA 1E7VA 3R66C 1KJTA 2NVUI 4WJNA 1WRDB 2O6VA 3VAWA 2KD0A 2XEWA 4BKTA 3DBRI 2C5LC 3AU5A 3H9DA 3QCAA 2KK8A 4NQLB 3VH3B 1RRBA 3QC8B 1LQBA 4W9GA 1S1QB 4IWPA 4PS7A 4IUMB 2BPSA 4LDTD 4MGYE 3W1SC 4MEMA 1GUAB 1WR1A 5CTRC 3V62A 3H7SA 1SIFA 2MBQA 3JSVB 5CHFA 4F7ZA 4M8MA 4XZ4A 5CX3A 4DWFA 3WIMA 2DZMA 1J0GA 1V5TA 4JLCA 3UQBA 2V1YA 5JHBA 4KSKC 1LM8B 3PVLA 1A5RA 2LD9A 5CHVC 3VUXA 1WZ3A 1NDDA 5D2MB 4HXDA 1KM7A 3N3KB 3DVGY 4FLHA 3IBEA 1WMHA 1H8CA 3PREA 1UBQA 4W9DA 5TR5A 3ZKJC 4DDGD 4KSLC 3KYDD 5AZGA 4GB9A 2BF8B 2DZJA 2XBBC 2Z59B 1YJ1A 3OAWA 2D10A 2DYOA 4RMAA 3V6EB 4K7SA 2MBBB 2KFKA 3HM6X 5AZHA 1P98A 2LGDA 1WJ4A 2MBHA 1WM2A 2LZ6A 1E90A 3VUYA 4G3XB 3ZNID 3TCAA 4HDOA 2K1FA 1YQBA 2DYBA 2MQJA 3PTFC 1VD2A 4MDKE 3ZNHB 2C7NB 4ANUA 2IYDB 2Y5BB 1R4NI 3VUWA 3NZSA 4FADA 4IM0A 3UF8A 4BOSC 4BBNC 2KJHB 4W9FA 3APFA 3ONSA 2L05A 3W1YA 2J0JA 2HTHA 2PEAA 3L17A 4II2B 4K1RB 5IAAC 2KC1A 3PS6A 3ML8A 2MBEA 1WIAA 3Q3JA 2NBWB 2DHZA 3L16A 3X23A 3QWZB 4NPNA 4MSMB 2KO3A 4K7UA 4ZRJA 2V3SA 5G55A 2BGFA 3M3JA 2KZRA 3DVNU 1WR6E 4FN2A 5DPRA 2KFJA 3BY4B 4GDKA 2IY1B 3L10B 3L0WB 3QA8A 2KXJA 1C3TA 4HWIB 5DPTA 1UH6A 2Z0EB 3PRPB 1SGHA 3PRZA 1V5OA 2D2QA 2GMIC 4KV2A 2O6VB 1WE7A 4GN1A 2KMCA 2BYEA 4IM3A 3WANA 1IP9A 5D7GA 2IBIB 1GG3A 3WAMA 2GBNA 5E6PA 4ICVA 1Z2MA 1NBFC 3U30A 4DHJB 4FA6A 4A3PA 3M95A 2KOXA 1E8XA 4W9HA 3DBLI 4DK5A 2JVCA 3I3TB 4DDID 5AZFA 2ZCBA 2JZZA 4HLEA 4LJOB 4W9KA 2FNJB 3DPDA 2EKEC 4GXBA 3GZNI 3R3MA 2LGXA 3IG3A 4W9EA 3HIZA 2KN5A 4MJSB 1WJNA 1TGZB 3NZUA 2LRWA 3SU8X 4LJPB 1VCBA 3MTNB 3A9KB 1UZXB 3ZO5B 1WJ6A 3DQVA 2JF5A 2J0KA 3ZLZA 4BOZB 3WAPA 2KC2A 4TQ1A 1G6JA 2K6DB 1P3QU 1EF1A 1WGDA 2D07B 3B0AA 3P2BA 4HJKA 1MG8A 2MP2B 2AWTA 2B3AA 3CSFA 3ZDMC 4EZKA 2NPTA 1YX6B 2N7DA 4DXAB 4MGZE 4WJQA 3DVGX 2FIFA 2IZVB 2KWCA 2L76A 1YIWA 2KLGA 4YL8A 4KVGB 1ISNA 3EECA 3ZTDA 4G0NB 4WJPA 3VDZA 2OOBB 2KDBA 2GBKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5JH5 C;  1H4R A;  1I35 A;  4OVV A;  2KHW B;  2ZNV C;  2QHO A;  3SHQ A;  1NI2 A;  2WX0 A;  2K25 A;  1RAX A;  2R2Q A;  1K8R B;  5E6N A;  3H6N A;  3EC8 A;  2NBU A;  1V80 A;  4J6I A;  4NAW A;  1EF5 A;  1S3S G;  4MGK E;  2MSE D;  2KKC A;  4EEW A;  4CHK A;  4I6N B;  2DAF A;  3WAO A;  2JZ3 B;  3RCZ A;  2MRP A;  2KLC A;  2N1V A;  4A20 A;  4RM9 A;  1E8Y A;  4II3 B;  4F1S A;  4MH0 E;  2ASQ A;  4I6L B;  3U8Z A;  1X1M A;  2L00 B;  4CYE A;  2YLM A;  2BYV E;  1UGM A;  4FJZ A;  2AEH A;  1V49 A;  2RSU A;  3C0R B;  2FCN A;  2LVQ A;  2MW5 A;  5DCN A;  3JVZ X;  3DOW A;  4E71 A;  2KTF A;  3VXW A;  1V2Y A;  4HPL B;  4M8N A;  4NJ7 A;  3UIO B;  2CHZ A;  3DVN V;  3HK0 A;  5LLI A;  4ANV A;  1U4A A;  4WAA A;  2DX5 B;  3ZW3 A;  3OLM D;  2KDE B;  2JWZ A;  4WJO A;  4N9F 4;  1XD3 B;  2RR9 A;  5EDS A;  1IPG A;  4WQO B;  4DHZ B;  4HVB A;  3K9P B;  2KFK B;  2RGF A;  1OGW A;  3ZNG C;  1E8W A;  4X57 B;  4RM8 A;  2CHX A;  1C1Y B;  1Q0W B;  3DDC B;  3ZRF A;  3RZW C;  3KYC D;  2K6Q A;  5LXH A;  4NAW B;  3HM3 A;  2RPQ A;  2N9X A;  1WGR A;  2M8S A;  2GBJ A;  3KH0 A;  2KX0 A;  2XK5 B;  4GU2 A;  1LFD A;  3RD2 A;  3EHV A;  3RUI B;  4FHK A;  1L2N A;  3PGE A;  5C1Z A;  1WI0 A;  2MBO A;  5FR6 A;  3W1S A;  4HPM B;  3QX1 A;  4JGH B;  4K7W A;  2DYM A;  4AOF A;  3NOB A;  2JUO A;  3D32 A;  2YVC A;  2DAJ A;  2MP2 A;  3AUL A;  2LRU A;  2KWV B;  2ZVN A;  3QIJ A;  2GOW A;  1FXT B;  1WX9 A;  3EFU A;  1ZGU B;  4IWQ A;  3V61 A;  2ZJD A;  3IVF A;  4I6P A;  3NS8 A;  3AXC A;  1IYF A;  4WWP A;  1R4M I;  2N7E A;  2WX1 A;  5GMV A;  4P7I A;  2LUE A;  3UGB B;  2CU1 A;  3APD A;  1WZ0 A;  5J18 A;  1YX5 B;  4E3C A;  1P9D U;  4GMV A;  1E5W A;  2EMT A;  1UEL A;  2HE7 A;  2BKR B;  4BVU C;  3ALB A;  3Q3F A;  5KHO A;  4PS8 A;  2N9E B;  2ZPY A;  4HCP B;  4G11 A;  4PS3 A;  3PLU A;  4EFO A;  3ZTC A;  2JY6 A;  3PHW B;  1WYW B;  3A9K A;  4A3O A;  3QHT A;  2DZI A;  4MM3 A;  5HKH A;  3K9O B;  4IWO A;  1V81 A;  3RUL A;  1UBI A;  2I1J A;  4ANX A;  1RLF A;  2CS4 A;  2WDT B;  2XK5 A;  2D11 A;  3L54 A;  4FUL A;  1WXM A;  2K8C A;  2KMA A;  3M63 B;  3KW5 B;  4W9L A;  4JIO U;  2PJH A;  1WE6 A;  5J2R A;  1KLV A;  4KIK B;  1E8Z A;  2KDF B;  4MEL A;  3UIN B;  3VHT C;  5G2N A;  2DEN B;  2K39 A;  1WGG A;  4JQW C;  4K81 A;  2FCM A;  2M17 A;  4B95 A;  3RT3 B;  2FAZ A;  4XX5 A;  2R2O A;  4ZRI A;  4PYU A;  4AJW A;  1Y8R C;  4OVU A;  4MGI E;  3L13 A;  3DBH I;  1TBE A;  2K8B A;  2ZEQ A;  1M94 A;  3JW0 X;  4LDT B;  1V6E A;  2M0X A;  1TTN A;  1EO6 A;  2AL6 A;  2GBM A;  2AYO B;  3R7R A;  5CHW A;  1EUV B;  1ZKH A;  2ZCC A;  3GOE A;  3QAQ A;  4IC7 B;  4NNJ B;  3SD5 A;  4EZL A;  3A1Q A;  1AAR A;  4JL9 A;  3N32 A;  5J17 A;  3DCG A;  3A33 B;  1WGH A;  2PPH A;  4IG7 B;  2LVO A;  4MJS A;  3TMP B;  2G4D B;  1Z5S B;  4AUQ C;  5DPS A;  2NBV B;  2LVP A;  1J8C A;  4AWJ A;  3KUC B;  4FHJ A;  3H7P A;  4EKU A;  2MCN B;  1WX8 A;  2O6V D;  3A9J B;  2FUH B;  1XQQ A;  4NY0 A;  3V60 A;  3ZIM A;  2OJR A;  3QJZ A;  2NR2 A;  3VTV A;  2LWP A;  5L83 A;  2KNB A;  1OQY A;  2ZZP B;  5JHA A;  2BWF A;  2KWU B;  4KZC A;  1T0Y A;  1D3Z A;  2LJ5 A;  3B08 A;  1PQS A;  3NY5 A;  4IW0 A;  3OJ3 A;  2CKH B;  2JXX A;  2IO1 B;  2VRR B;  3JYU A;  4HDQ A;  1P1A A;  4AJY B;  3S2A A;  3QAR A;  4BFR A;  4DHZ E;  2AL3 A;  2HD5 B;  2N9P C;  1RFA A;  2N4F A;  4WWO A;  5D94 A;  1Q1O A;  2PE6 B;  2LXC A;  1OTR B;  3ZVV A;  1J19 A;  4AP4 C;  2V4L A;  2FID A;  4DHJ D;  2IO3 B;  2NS5 A;  2UWQ A;  4FJY A;  2FCQ A;  1P0R A;  4GDK B;  1JRU A;  1HE8 A;  2MLB A;  2PE9 A;  3L08 A;  3M62 B;  2M4N A;  1L7Y A;  4ASW C;  4B9K A;  4BKS A;  3B1L X;  2FCS A;  1WH3 A;  1WY8 A;  2BYF A;  4W9C A;  4XC2 A;  1V9J A;  2BWE S;  3A4S C;  3JSV A;  3MJW A;  3TIX A;  3AU4 A;  2D3G A;  4W9J A;  3CF6 E;  1BT0 A;  3MHS D;  4WWN A;  3QQ8 B;  4GIV A;  3UIP B;  4CO7 A;  4URK A;  3IHP C;  3CMM B;  1WXV A;  2LGY A;  2NPT B;  2L8J A;  2CHW A;  2IO2 B;  3ML9 A;  2LAS A;  2REX A;  4TV3 A;  3R7Q A;  4GDL B;  4IM2 A;  3VTW A;  4ANW A;  1ZW7 A;  1TZ1 A;  5JZE B;  5E6O A;  4EUT A;  4NQK E;  3DBS A;  1F9J A;  3NHE B;  2BKF A;  2K8H A;  2KQ7 A;  3A4R A;  3LDZ E;  2ZNV B;  2I1K A;  2ZVO A;  1Q5W B;  3IFW B;  4G50 A;  3UQA A;  3PLV A;  1GNU A;  3KVF B;  4KDL B;  5D6J B;  1WGY A;  2L0T A;  2KJ6 A;  1WFY A;  1XT9 B;  2W9N A;  1GJZ A;  1QZE A;  1V86 A;  2KQS A;  3A9J A;  1OEY A;  1WM3 A;  3H7P B;  4PYZ A;  3V6C B;  2L7R A;  5IA7 A;  2KVR A;  3OJ4 B;  1GC6 A;  2JRH A;  2LXA A;  4EOY A;  2O2V B;  4HK2 A;  3ZDT A;  2JPH A;  4FJV B;  3T8M A;  3VVW B;  3X0W A;  4KDI C;  4FBJ B;  3ENE A;  4DBG A;  2G45 B;  2JT4 B;  1E7U A;  3TBL D;  2JRI B;  1WMH B;  3APC A;  3TJP A;  3QK0 A;  4EZJ A;  3VH4 B;  4ZDV A;  3SDL C;  2C60 A;  2KDI A;  3HHM A;  2KX3 A;  3RZF A;  2L0F A;  3ZRC A;  1WXS A;  4GOC A;  4E74 A;  3ECI A;  3A1Q B;  2NCN A;  4TUU A;  2C7M B;  1CMX B;  2GBR A;  3VFK A;  4ZRK A;  1YD8 U;  1KOT A;  3KUZ A;  3PV1 A;  2WYQ A;  3ZUN A;  1WJU A;  4MSQ B;  2A5U A;  2KTR A;  2HJ8 A;  3ZNZ B;  4TQ0 A;  3TL5 A;  2WWZ A;  4KZ0 A;  2IO0 B;  2Z0D B;  4M0W B;  4GGQ A;  5KHQ A;  4GSW A;  4NJ6 A;  3CST A;  3BIN A;  5C23 A;  1OEY J;  5L95 C;  4ZYN A;  3LJ3 A;  5AEK B;  3PRM B;  2N1W A;  2C9W B;  2MWS B;  4B6W A;  4KIK A;  3PPA A;  1WXA A;  2G3Q B;  2KJR A;  2IY0 B;  4TKN A;  2J7Q B;  2ZPN A;  5LXI B;  2KTR B;  1LXD A;  2J0M A;  2O2V A;  3U7D A;  2UYZ B;  3PHX B;  5DPW A;  3T9L A;  1WX7 A;  3KUD B;  3PZD A;  3N30 A;  5BO4 B;  2KAN A;  3WA0 A;  2RD0 A;  2LI5 A;  1SE9 A;  3VTU A;  2MA9 B;  2DZK A;  2G4S A;  3PT2 B;  3RYT A;  2C7H A;  4BBN F;  4BKG A;  2MX2 A;  4HCN B;  3VQI A;  4ICU A;  3PSE B;  4W9I A;  1GC7 A;  3AI5 A;  3O65 B;  4BKS D;  1I42 A;  2CR5 A;  3H1U A;  2M1M A;  2A4Z A;  1WF9 A;  2EMS A;  4F8C B;  2L3Z A;  4LCD E;  1UD7 A;  4GDL A;  3WAL A;  1E7V A;  3R66 C;  1KJT A;  2NVU I;  4WJN A;  1WRD B;  2O6V A;  3VAW A;  2KD0 A;  2XEW A;  4BKT A;  3DBR I;  2C5L C;  3AU5 A;  3H9D A;  3QCA A;  2KK8 A;  4NQL B;  3VH3 B;  1RRB A;  3QC8 B;  1LQB A;  4W9G A;  1S1Q B;  4IWP A;  4PS7 A;  4IUM B;  2BPS A;  4LDT D;  4MGY E;  3W1S C;  4MEM A;  1GUA B;  1WR1 A;  5CTR C;  3V62 A;  3H7S A;  1SIF A;  2MBQ A;  3JSV B;  5CHF A;  4F7Z A;  4M8M A;  4XZ4 A;  5CX3 A;  4DWF A;  3WIM A;  2DZM A;  1J0G A;  1V5T A;  4JLC A;  3UQB A;  2V1Y A;  5JHB A;  4KSK C;  1LM8 B;  3PVL A;  1A5R A;  2LD9 A;  5CHV C;  3VUX A;  1WZ3 A;  1NDD A;  5D2M B;  4HXD A;  1KM7 A;  3N3K B;  3DVG Y;  4FLH A;  3IBE A;  1WMH A;  1H8C A;  3PRE A;  1UBQ A;  4W9D A;  5TR5 A;  3ZKJ C;  4DDG D;  4KSL C;  3KYD D;  5AZG A;  4GB9 A;  2BF8 B;  2DZJ A;  2XBB C;  2Z59 B;  1YJ1 A;  3OAW A;  2D10 A;  2DYO A;  4RMA A;  3V6E B;  4K7S A;  2MBB B;  2KFK A;  3HM6 X;  5AZH A;  1P98 A;  2LGD A;  1WJ4 A;  2MBH A;  1WM2 A;  2LZ6 A;  1E90 A;  3VUY A;  4G3X B;  3ZNI D;  3TCA A;  4HDO A;  2K1F A;  1YQB A;  2DYB A;  2MQJ A;  3PTF C;  1VD2 A;  4MDK E;  3ZNH B;  2C7N B;  4ANU A;  2IYD B;  2Y5B B;  1R4N I;  3VUW A;  3NZS A;  4FAD A;  4IM0 A;  3UF8 A;  4BOS C;  4BBN C;  2KJH B;  4W9F A;  3APF A;  3ONS A;  2L05 A;  3W1Y A;  2J0J A;  2HTH A;  2PEA A;  3L17 A;  4II2 B;  4K1R B;  5IAA C;  2KC1 A;  3PS6 A;  3ML8 A;  2MBE A;  1WIA A;  3Q3J A;  2NBW B;  2DHZ A;  3L16 A;  3X23 A;  3QWZ B;  4NPN A;  4MSM B;  2KO3 A;  4K7U A;  4ZRJ A;  2V3S A;  5G55 A;  2BGF A;  3M3J A;  2KZR A;  3DVN U;  1WR6 E;  4FN2 A;  5DPR A;  2KFJ A;  3BY4 B;  4GDK A;  2IY1 B;  3L10 B;  3L0W B;  3QA8 A;  2KXJ A;  1C3T A;  4HWI B;  5DPT A;  1UH6 A;  2Z0E B;  3PRP B;  1SGH A;  3PRZ A;  1V5O A;  2D2Q A;  2GMI C;  4KV2 A;  2O6V B;  1WE7 A;  4GN1 A;  2KMC A;  2BYE A;  4IM3 A;  3WAN A;  1IP9 A;  5D7G A;  2IBI B;  1GG3 A;  3WAM A;  2GBN A;  5E6P A;  4ICV A;  1Z2M A;  1NBF C;  3U30 A;  4DHJ B;  4FA6 A;  4A3P A;  3M95 A;  2KOX A;  1E8X A;  4W9H A;  3DBL I;  4DK5 A;  2JVC A;  3I3T B;  4DDI D;  5AZF A;  2ZCB A;  2JZZ A;  4HLE A;  4LJO B;  4W9K A;  2FNJ B;  3DPD A;  2EKE C;  4GXB A;  3GZN I;  3R3M A;  2LGX A;  3IG3 A;  4W9E A;  3HIZ A;  2KN5 A;  4MJS B;  1WJN A;  1TGZ B;  3NZU A;  2LRW A;  3SU8 X;  4LJP B;  1VCB A;  3MTN B;  3A9K B;  1UZX B;  3ZO5 B;  1WJ6 A;  3DQV A;  2JF5 A;  2J0K A;  3ZLZ A;  4BOZ B;  3WAP A;  2KC2 A;  4TQ1 A;  1G6J A;  2K6D B;  1P3Q U;  1EF1 A;  1WGD A;  2D07 B;  3B0A A;  3P2B A;  4HJK A;  1MG8 A;  2MP2 B;  2AWT A;  2B3A A;  3CSF A;  3ZDM C;  4EZK A;  2NPT A;  1YX6 B;  2N7D A;  4DXA B;  4MGZ E;  4WJQ A;  3DVG X;  2FIF A;  2IZV B;  2KWC A;  2L76 A;  1YIW A;  2KLG A;  4YL8 A;  4KVG B;  1ISN A;  3EEC A;  3ZTD A;  4G0N B;  4WJP A;  3VDZ A;  2OOB B;  2KDB A;  2GBK A; 
#chains in the Genus database with same CATH topology
 3GP7 A;  3TSS A;  1H4R A;  1I35 A;  1TKE A;  4HEA 1;  2QHO A;  1D5X C;  1NI2 A;  1RAX A;  2NBU A;  2BT6 A;  4QAY A;  2N0S B;  1ET9 A;  2MSE D;  5BYR A;  2KKC A;  1L0V B;  2PIA A;  3T3N A;  4I6N B;  3DBH B;  3WAO A;  2DWQ A;  3AEA B;  2KLC A;  4A20 A;  1E8Y A;  4REZ A;  4II3 B;  4F1S A;  2ASQ A;  4I6L B;  1X1M A;  2L00 B;  3Q3M C;  2BYV E;  1V49 A;  2RSU A;  2X38 A;  2LVQ A;  1TS3 A;  1TT5 B;  2PKO A;  1QQR A;  3DOW A;  4E71 A;  3VXW A;  4HPL B;  1JWU D;  1I4G A;  2KVZ A;  3DVN V;  5LLI A;  4AS1 A;  1HTO A;  2RR9 A;  1IPG A;  3K9P B;  2RGF A;  3ZNG C;  2WS3 B;  2AX5 A;  1ACC A;  3AEF B;  1HTQ A;  1JML A;  3HM3 A;  2RPQ A;  2N9X A;  4YTP B;  2M8S A;  3RUI B;  3W2D A;  2NMQ A;  3QX1 A;  4K7W A;  2DYM A;  2MHJ A;  3FIL B;  3D32 A;  2YVC A;  2DAJ A;  2MP2 A;  1P7E A;  2KAC A;  2LRU A;  3V61 A;  3FC4 A;  3AXC A;  1L5P A;  1XLN A;  2WX1 A;  1QKZ A;  2LUE A;  2CU1 A;  5J18 A;  1YX5 B;  4E3C A;  2EMT A;  2HE7 A;  4BVU C;  3AE2 B;  2EKI A;  3Q3F A;  1T6B X;  1V1P A;  4PS3 A;  4EFO A;  3NVY A;  3PHW B;  1WYW B;  3A9K A;  4A3O A;  2Z8L A;  3QHT A;  4WIP A;  4YWG G;  3DHG C;  4TSS A;  5D3I B;  2WDT B;  4FUL A;  3M63 B;  4W9L A;  2W54 A;  2M17 A;  4B95 A;  1QOA A;  4ZRI A;  1JWA D;  4PYU A;  3AE9 B;  3L13 A;  1TBE A;  4M0W A;  2ZEQ A;  1TKY A;  2AQ2 B;  1M94 A;  1D5Z C;  1TTN A;  2GBM A;  2AYO B;  1ZKH A;  2Q5W D;  3ZGZ A;  3AE6 B;  5J17 A;  3A33 B;  3TMP B;  2G4D B;  2NBV B;  2LVP A;  1J8C A;  4AWJ A;  4LNO A;  2MCN B;  3V60 A;  3DBR B;  4NY0 A;  2NR2 A;  3VTV A;  5L83 A;  5JHA A;  1ZUD 2;  2WDV B;  3DHI C;  3NY5 A;  2JXX A;  1AW7 A;  1JQ4 A;  2JU6 X;  3RNE C;  3S2A A;  4BFR A;  4DHZ E;  3VRA B;  1IUE A;  1QOG A;  2FID A;  1MVK A;  1STE A;  2NS5 A;  3U2S C;  4BZA A;  4DQO C;  2PE9 A;  3M62 B;  3HVZ A;  1C79 A;  2FCS A;  2BWE S;  3JSV A;  3MJW A;  1SEB D;  3QQ8 B;  2FBW B;  1WXV A;  2WXG A;  2RDH A;  2PLP A;  2IO2 B;  2REX A;  3VTW A;  3C8Y A;  5JZE B;  5E6O A;  3NUH B;  3AE7 B;  4NQK E;  1F9J A;  1KH0 A;  3LDZ E;  2ZNV B;  3SFE B;  4KDL B;  2L0T A;  1XT9 B;  1V86 A;  2KQS A;  3DHH C;  1E7P B;  4PYZ A;  1WM3 A;  3V6C B;  5IA7 A;  2KVR A;  2WDR B;  3ZQ4 A;  1J7C A;  2JRH A;  2MH7 A;  4EOY A;  2O2V B;  2JPH A;  4FJV B;  4FBJ B;  1UNS A;  4DBG A;  5FK9 C;  4YSY B;  2JT4 B;  2V3N A;  3TJP A;  4ZDV A;  1D5M C;  1AN8 A;  3RZF A;  4E74 A;  3ETR A;  1ET6 A;  1HQR D;  1WXS A;  4C56 C;  2NCN A;  1PGB A;  3VFK A;  1YD8 U;  4O1N A;  1WJU A;  2K3U A;  3TL5 A;  4A90 A;  4YXD B;  2IO0 B;  2Z0D B;  4M0W B;  4NJ6 A;  3CST A;  1BML C;  5C23 A;  5L95 C;  2OJW A;  3LJ3 A;  3W9C B;  1SE4 A;  1Y56 A;  2RPV A;  2PMV A;  1WXA A;  1NYR A;  1LXD A;  2J0M A;  1Q10 A;  1WX7 A;  2WXJ A;  2MJD A;  5BO4 B;  3RNF C;  2W82 A;  2RD0 A;  1FNV A;  3MC9 A;  1TZO A;  2MA9 B;  5I4D A;  2G4S A;  3PT2 B;  4WUR A;  3NRZ A;  2MX2 A;  3O65 B;  2WXL A;  2CJN A;  2A4Z A;  1MHH E;  4F8C B;  1UD7 A;  4GDL A;  4C00 A;  4WJN A;  1WRD B;  4LTU A;  3DBR I;  2C5L C;  3QCA A;  1RYJ A;  2KK8 A;  2WU2 B;  1S1Q B;  4IWP A;  4PS7 A;  3W1S C;  2BPS A;  1K52 A;  4L23 A;  3V62 A;  1SIF A;  2MBQ A;  4WH4 A;  5CX3 A;  4XZ4 A;  1J0G A;  5BMH A;  1A5R A;  2LD9 A;  1N63 A;  2RDB C;  5BYQ A;  1VR9 A;  4W9D A;  5TR5 A;  4KGT A;  4KSL C;  3KYD D;  4GB9 A;  3RI7 C;  2XBB C;  4RGT A;  4RMA A;  3RNB C;  2LGS A;  3CIR B;  4P1B C;  2LGD A;  2LZ6 A;  3ZNI D;  2LJI A;  4XWT A;  2D5G A;  5BMG A;  1YQB A;  2DYB A;  3PTF C;  3ZXR A;  4L2Y A;  2VZK B;  1LGR A;  4MDK E;  1R4N I;  2HTM E;  4BOS C;  2IGH A;  2HTH A;  2D3B A;  1TKG A;  3L17 A;  5IAA C;  3ML8 A;  1V1P B;  3Q3J A;  1XLQ A;  4MSM B;  2BGF A;  2R61 A;  1SSN A;  1WR6 E;  2WXR A;  4FN2 A;  2EEL A;  3BY4 B;  3L10 B;  1KFY B;  1EU4 A;  4HWI B;  3E9S A;  1V5O A;  2D2Q A;  4GN1 A;  4IM3 A;  2G9H D;  3FIL A;  4XWW A;  1CZP A;  2RDG A;  5JXV A;  2I38 A;  2JSV X;  2JZZ A;  4M00 A;  1HXY D;  4HLE A;  1FRR A;  3DPD A;  4LNK A;  3GZN I;  3R3M A;  3IG3 A;  3MJ5 A;  1VCB A;  4XDC A;  3A9K B;  3U52 E;  3DQV A;  2M56 B;  2K6D B;  4HRS A;  5H8Y E;  1B1Z A;  3PO0 A;  1IBX B;  2AWT A;  2KAJ A;  3CSF A;  1YX6 B;  2N7D A;  4MGZ E;  5AUK A;  1T0Q C;  1YIW A;  1YNT E;  4N6E B;  2G1E A;  3ZTD A;  4NAM A;  1VRA B;  2HJ1 A;  2OOB B;  2GBK A;  4AQ7 A;  5JH5 C;  1PFD A;  3URY A;  4OVV A;  2KHW B;  2WXO A;  2GB1 A;  2ZNV C;  3SHQ A;  4LNI A;  4N59 A;  2R2Q A;  4DXG A;  3FKY A;  1V80 A;  1EF5 A;  2MJE A;  1JWM D;  4MGK E;  1WWT A;  2OED A;  1HA5 A;  1TJE A;  2D3C A;  5TSS A;  3MFG A;  3Q6B A;  2N1V A;  4XGA B;  4RM9 A;  1UGJ A;  3U8Z A;  1R4N B;  2JX5 A;  1KLG D;  1VZ7 A;  3SEB A;  2WXN A;  2PW9 A;  3C0R B;  3KLS X;  1UWM A;  2KTF A;  4KGS A;  1U4A A;  4WAA A;  2DX5 B;  1TY0 A;  4WJO A;  5EDS A;  4WQO B;  3IT4 B;  4HVB A;  2WHI A;  1R4M B;  4X57 B;  3RFZ B;  2CHX A;  1Q0W B;  3DDC B;  4OZC A;  3KYC D;  3ZJT A;  1N62 A;  4GU2 A;  1LFD A;  5E6J A;  1L4D B;  1L2N A;  2MBO A;  2JUO A;  3AUL A;  3B9J A;  2GOW A;  1WX9 A;  3EFU A;  4IWQ A;  4I6P A;  1IYF A;  4WWP A;  5GMV A;  4P7I A;  5H92 C;  1TS5 A;  3APD A;  1WZ0 A;  2K22 A;  1NYQ A;  2BKR B;  1EM7 A;  1ZP0 B;  5KHO A;  2DNF A;  2LHD A;  3AEC B;  2ZPY A;  4HCP B;  3AV8 A;  1T0R C;  2BS4 B;  1D4B A;  4US8 A;  4MM3 A;  1V81 A;  3RUL A;  1UBI A;  2I1J A;  2SAK A;  1P7F A;  2CS4 A;  1I4P A;  2D11 A;  1L0Y B;  2SEB D;  4JIO U;  2PJH A;  1WE6 A;  1KLV A;  3R8B A;  4MEL A;  2KDF B;  1OQQ A;  2FCM A;  3RT3 B;  4XX5 A;  3AEE B;  3CWI A;  4AJW A;  1PDX A;  1N5W A;  3DBH I;  1I7H A;  1FXA A;  3RMK C;  2H89 B;  2J42 A;  2N9L A;  1V6E A;  2M0X A;  3ZUN A;  3R7R A;  4IC7 B;  3GOE A;  3QAQ A;  4EZL A;  3A1Q A;  3NS1 A;  2IGD A;  3I9V 1;  3RNG C;  2RMM A;  2BQQ A;  4MJS A;  5C3J B;  1QIL A;  1Z5S B;  5DPS A;  4JWS C;  4FHJ A;  3ZIM A;  2FUH B;  1K50 A;  3QJZ A;  4OW0 A;  2LWP A;  2KNB A;  2KWU B;  1NEN B;  4HJG E;  2GI9 A;  1PQS A;  3Q8C A;  1BXT A;  3V05 A;  2CKH B;  3JYU A;  3BK1 A;  1YN5 A;  3QAR A;  2AL3 A;  1WSP A;  1ZXH A;  2HD5 B;  2N9P C;  1RFA A;  2N4F A;  4KX6 B;  2PE6 B;  3AE8 B;  4FJY A;  1FIQ A;  2VH2 A;  1FNU A;  2AQ1 B;  2M4N A;  2GRI A;  4W9C A;  1WH3 A;  2BYF A;  1DOX A;  4WWN A;  4GIV A;  3IHP C;  2NPT B;  4RF0 A;  4TV3 A;  4IM2 A;  1EWC A;  1RWS A;  4RFB A;  1CK1 A;  4EUT A;  3DBS A;  3NHE B;  3BZD B;  1J7B A;  4MAC A;  3BYY B;  1UF0 A;  1Q5W B;  4G50 A;  1TIF A;  3PLV A;  5D6J B;  1WGY A;  4JPS A;  1YN4 A;  1F77 A;  2L32 A;  1FEH A;  4BAX A;  3OJ4 B;  3Q69 A;  3Q8B A;  4HK2 A;  3T8M A;  3VVW B;  3IXS A;  3ENE A;  5HI1 A;  4K3C A;  3AM9 A;  1E7U A;  1WMH B;  3APC A;  4EZJ A;  3SDL C;  1NVI D;  4OVZ A;  2XN9 C;  3Q3O C;  4TMA B;  1IGD A;  2GBR A;  1KOT A;  3KUZ A;  3PV1 A;  2WYQ A;  4MSQ B;  2A5U A;  1N60 A;  2HJ8 A;  3TEY A;  4C4V A;  5BMI A;  4GSW A;  5G5H A;  2PVG C;  2KWD A;  3DWG C;  1WRI A;  2C9W B;  2MWS B;  2ACZ B;  4KIK A;  4A55 A;  3PPA A;  2G3Q B;  2ZW1 A;  2KJR A;  2IY0 B;  1IGC A;  3AEB B;  3W5V B;  1L4Z B;  4YTN B;  2BS3 B;  3WA0 A;  2Y5P A;  1SE9 A;  1C77 A;  2DZK A;  4BBN F;  2K0P A;  4BKG A;  2ICI A;  4ICU A;  1GC7 A;  1I4Q A;  2KYW A;  3AB5 A;  1I42 A;  1QOB A;  1YMH E;  3MC8 A;  2M1M A;  1WF9 A;  2OHF A;  2EMS A;  2L3Z A;  4LCD E;  3WAL A;  1E7V A;  3R66 C;  2O6V A;  3AE3 B;  4BKT A;  2WXK A;  5IKC M;  4W9G A;  4RGN A;  4IUM B;  1M4V A;  3H7S A;  5CHF A;  3R2I A;  2H88 B;  3SFD B;  4F7Z A;  3AED B;  4DWF A;  2L1A A;  5IP4 D;  3C19 A;  3UQB A;  4S17 A;  2J53 A;  5EE9 A;  3PVL A;  1KLU D;  2VH1 A;  3GE8 C;  3VUX A;  1NDD A;  4LNN A;  2XNA C;  4R3D A;  1H8C A;  3PRE A;  1UBQ A;  1C4P A;  5AZG A;  4OZA A;  1YJ1 A;  3OAW A;  2MBB B;  2KFK A;  3HM6 X;  1P98 A;  4RH6 A;  3VUY A;  3TCA A;  4HDO A;  2K1F A;  3EA6 A;  1K53 A;  2C7N B;  1I4X A;  2IYD B;  5IN7 A;  3NZS A;  1XO3 A;  4FAD A;  4BBN C;  2L05 A;  2QMT A;  2J52 A;  2JQR B;  3PS6 A;  4M02 A;  1WIA A;  3X23 A;  4ZRJ A;  3GZN B;  5G55 A;  2KZR A;  4GDK A;  3AH7 A;  3TEZ A;  2KXJ A;  3TEX A;  1UH6 A;  1SGH A;  3ZXV A;  2O6V B;  5FR3 A;  2INP E;  4HPP A;  2BYE A;  4OZB A;  2IBI B;  1GG3 A;  2GBN A;  4C7Y A;  1NBF C;  4FA6 A;  3DWM A;  2KOX A;  1E8X A;  4D2K A;  2IJ0 A;  1MHX A;  4PT5 A;  4W9K A;  2EKE C;  4W9E A;  2KN5 A;  4YSX B;  3Q14 C;  1UZX B;  5IOI A;  1GB1 A;  1WJ6 A;  2KC2 A;  2BW2 A;  1P3Q U;  2W3S A;  1WGD A;  2D07 B;  3P2B A;  4HJK A;  1MFW A;  3EFC A;  2B3A A;  2LMC A;  4EZK A;  2JYE A;  4WJQ A;  1F0Z A;  1L0X B;  2FIF A;  4WJP A;  3VDZ A;  4JE3 B;  1QT9 A;  3H8H A;  1GAQ B;  4XDD A;  2WX0 A;  3AE5 B;  2K25 A;  2QIL A;  4IOI E;  2DBY A;  1K8R B;  5E6N A;  3I57 A;  2MJ3 A;  3EC8 A;  4J6I A;  3P4R B;  2WXF A;  5HG2 A;  1S3S G;  3WCQ A;  4IKG A;  2INC C;  4EEW A;  4CHK A;  2JZ3 B;  3RCZ A;  3NG0 A;  4MH0 E;  4P1C C;  1UGM A;  4FJZ A;  3ZJV A;  1ZE3 D;  2FCN A;  2QDF A;  2TSS A;  3I63 C;  4JX1 C;  1XCQ L;  1V2Y A;  3Q2A C;  4NJ7 A;  3UIO B;  2CHZ A;  4ANV A;  3HK0 A;  5EE0 A;  3ZW3 A;  3BVG A;  4N9F 4;  1WYG A;  1E8W A;  1EU3 A;  1C1Y B;  3RZW C;  4WQM A;  4NAW B;  3BVZ A;  3KH0 A;  5EE1 A;  2BB6 A;  2GBJ A;  3RD2 A;  2XK5 B;  3UI3 A;  3EHV A;  1VJK A;  2LUM A;  3PGE A;  3B2F A;  1WI0 A;  1SJE D;  2IND C;  4HPM B;  4WWM A;  1B9R A;  4AOF A;  3NOB A;  4K3B A;  4DXF A;  4WAF A;  2KWV B;  3QIJ A;  3P4P B;  1FXT B;  4RCO A;  2ZJD A;  1JAL A;  3IVF A;  3NS8 A;  2WLB A;  1KF6 B;  4CQN A;  2N7J A;  3NVV A;  2JXT A;  1XXG A;  4GMV A;  2N9E B;  1L6V A;  4G11 A;  1F1H A;  1HZ6 A;  3ZTC A;  4HRO A;  2DZI A;  5HKH A;  1YN3 A;  4NZL B;  3RN9 C;  1V97 A;  4FXC A;  4HKQ A;  2WP9 B;  2XK5 A;  3Q8A A;  3L54 A;  1WXM A;  2K8C A;  2KMA A;  2HDE A;  1TY2 A;  1MI0 A;  1ZDV A;  5G2N A;  4IDI A;  4JQW C;  4C80 A;  3BVM A;  1Y8R C;  3GB1 A;  3AE4 B;  2K8B A;  2KQ4 X;  1JRO A;  1EO6 A;  2AL6 A;  1EUV B;  3BK2 A;  4B0E A;  1AAR A;  1BUI C;  3N32 A;  3DCG A;  1FPY A;  3AMZ A;  1WGH A;  1L6U A;  2LVO A;  2JYT A;  2E3T A;  1C76 A;  2ZW0 A;  4AUQ C;  2BVC A;  1KRH A;  3KUC B;  3H7P A;  4EKU A;  1WX8 A;  2O6V D;  3A9J B;  2OJR A;  2ZZP B;  2LJ5 A;  3B08 A;  4IW0 A;  2IO1 B;  1UUP A;  3GS2 A;  3IAS 1;  4PK1 A;  4HDQ A;  4AJY B;  1SE3 A;  2IDY A;  4WWO A;  2BS2 B;  1Q1O A;  1OTR B;  3ZVV A;  2PVO D;  3VR8 B;  1FCC C;  3N1Z C;  2UWQ A;  2FCQ A;  5EE3 A;  1P0R A;  4GDK B;  1JRU A;  1HE8 A;  2MLB A;  3L08 A;  4ASW C;  1L7Y A;  4RGM A;  1ZDX A;  4XC2 A;  1V9J A;  1DOI A;  2D3G A;  3CF6 E;  3UIP B;  1NI3 A;  4CO7 A;  4URK A;  2L8J A;  2CHW A;  4LK0 M;  3ML9 A;  1LO5 D;  3R7Q A;  1ZW7 A;  3KWV A;  1PUT A;  3A4R A;  4UDU C;  4HKZ E;  2I1K A;  1MJD A;  1SBB B;  3UQA A;  2W9N A;  4ACF A;  1QZE A;  3A9J A;  3H7P B;  2L7R A;  1XLO A;  3B2G A;  3RNC C;  1UWX A;  4KDI C;  2G45 B;  1JW9 D;  4A8X C;  5LNK 1;  2C60 A;  2KDI A;  2KX3 A;  3ZRC A;  5HFY A;  4ZRP A;  1PGA A;  1XCT L;  4TUU A;  4US9 A;  1CMX B;  4ZRK A;  1IBX A;  3P42 A;  2KTR A;  3ZNZ B;  4ZHP A;  4KZ0 A;  4GGQ A;  5KHQ A;  3BIN A;  5D3D A;  1OEY J;  4ZYN A;  1ZPS A;  5AEK B;  4YSZ B;  2N1W A;  4B6W A;  3DBL B;  5LXI B;  2KTR B;  3U7D A;  2UYZ B;  3T9L A;  3N30 A;  4ZYS A;  2KAN A;  4N58 A;  3N9Y C;  3VQI A;  1AYF A;  4W9I A;  1JRP A;  3AI5 A;  3PSE B;  2CR5 A;  2WQY B;  1T0S C;  3TUO A;  1FO4 A;  1KJT A;  1SE2 A;  2XEW A;  3AU5 A;  1YQ4 B;  4NQL B;  3VH3 B;  1WR1 A;  5CTR C;  2K9X A;  1SF0 A;  4JWU C;  4B0M A;  1F2R I;  4M8M A;  3WIM A;  2DZM A;  3OG5 A;  4JLC A;  2V1Y A;  5JHB A;  4KSK C;  1LM8 B;  5MPO A;  1WZ3 A;  1I4H A;  2WU5 B;  3KWL A;  5D2M B;  4HXD A;  1KM7 A;  4YTM B;  4FLH A;  3IBE A;  1WMH A;  4KKI A;  4USA A;  4DDG D;  2BF8 B;  3HRD D;  1DGJ A;  4A9A A;  2UU7 A;  2M0A A;  4K7S A;  5AZH A;  1PGX A;  2MBH A;  2WXQ A;  1E90 A;  4G3X B;  3ZNH B;  2QC8 A;  2Y5B B;  3T3O A;  1V8C A;  3ONS A;  1OFF A;  2J0J A;  2PEA A;  4II2 B;  1SJH D;  4K1R B;  2KC1 A;  2AQ3 B;  1DOY A;  1EWY C;  1FM0 D;  3EUB 2;  1VDV A;  2NBW B;  2DHZ A;  3NVZ A;  4NPN A;  4K7U A;  1R7S A;  1T5X D;  2WGS A;  3AN1 A;  3M3J A;  3MHZ A;  5DPR A;  4RF1 A;  2KFJ A;  2IY1 B;  2VZK D;  2ON8 A;  1C3T A;  2QCZ A;  2Z0E B;  3VRB B;  2KMM A;  3PRZ A;  2GMI C;  4KV2 A;  3LYY A;  1WE7 A;  1HZ5 A;  2KMC A;  1N6Z A;  5D7G A;  4KKJ A;  4ITK A;  3WAM A;  5E6P A;  4ICV A;  4MM3 B;  4DHJ B;  3M95 A;  4L1B A;  4W9H A;  3DBL I;  4DK5 A;  2ZCB A;  3P1M A;  4LJO B;  2FNJ B;  2BTE A;  1FFU A;  1CQV A;  1FNW A;  2LGX A;  1DYQ A;  3HIZ A;  4MJS B;  1WJN A;  1TGZ B;  2I2Y A;  1ESF A;  2LHE A;  2JF5 A;  3ZLZ A;  4BOZ B;  1GPX A;  3WAP A;  4TQ1 A;  1G6J A;  2W55 A;  3B0A A;  3GE3 C;  1SIJ A;  3BWU D;  3E56 A;  3ZDM C;  2NPT A;  2IZV B;  2MEK A;  4G0N B;  3HVD A;  4XYC A;  2KDB A;  4ARC A;  3AEG B;  5BYS A;  4RGO S;  2KT7 A;  3H6N A;  4NAW A;  2GLS A;  1TYG B;  1E10 A;  3MP9 A;  3P63 A;  4S0R A;  2LGI A;  2NTS A;  2DAF A;  1ZOY B;  2MRP A;  3O13 A;  1JWS D;  1JWB D;  3P4S B;  3FAH A;  1QOF A;  4CYE A;  2YLM A;  2AEH A;  2QSD A;  1VZ6 A;  3NVW A;  2KN4 A;  2LEK A;  2MW5 A;  3JVZ X;  2INN E;  4M8N A;  1AWD A;  3IAM 1;  1F2R C;  2BBC A;  2DLB A;  3OLM D;  2KDE B;  2JWZ A;  4A6Q A;  1XD3 B;  1MG4 A;  2B76 B;  4DHZ B;  3LB8 C;  2KFK B;  1OGW A;  1SXT A;  4RM8 A;  3OWE B;  3ZRF A;  2K6Q A;  5LXH A;  4MT5 A;  1WGR A;  2KX0 A;  4FHK A;  5C1Z A;  5FR6 A;  3W1S A;  4KGR A;  4JGH B;  4M01 A;  5GXG B;  2ZVN A;  1ZGU B;  2JWU A;  4NJC A;  1R4M I;  3N1X C;  2N7E A;  3SR6 A;  1CJE A;  3I5J C;  3UGB B;  1P9D U;  2KDM A;  1E5W A;  1K51 A;  1PYW D;  1UEL A;  3ALB A;  4PS8 A;  3PLU A;  2JY6 A;  2M19 A;  4Q2J A;  2J4X A;  3K9O B;  4IWO A;  4ANX A;  1RLF A;  2WXI A;  4H2A A;  2WXP A;  3U4E G;  4P6V F;  2K5P A;  3KW5 B;  1TS4 A;  5J2R A;  4KIK B;  1E8Z A;  3UIN B;  3VHT C;  2DEN B;  2K39 A;  1WGG A;  4K81 A;  4YT0 B;  2FAZ A;  2N9K A;  2R2O A;  2WXM A;  4OVU A;  4MGI E;  4C4V B;  2WDQ B;  2IGG A;  3TEW A;  4EE2 A;  4LDT B;  2JZP A;  3JW0 X;  4LLG M;  5CHW A;  2ZCC A;  3SD5 A;  4NNJ B;  2W3R A;  1N61 A;  2LFI A;  3EGR A;  4JL9 A;  2Y3A A;  4XE0 A;  2PPH A;  4IG7 B;  3N1Y C;  4RNA A;  3RNA C;  2QIE B;  1XQQ A;  1VZ8 A;  1KTK A;  1QF6 A;  1OQY A;  2YEP F;  1SB3 C;  2BWF A;  4KZC A;  1T0Y A;  1D3Z A;  3OJ3 A;  1V1O A;  2VRR B;  2V0G A;  1P1A A;  1YOV B;  3ZYY X;  5D94 A;  3L4P A;  2LXC A;  1J19 A;  4AP4 C;  2V4L A;  4DHJ D;  1I4R A;  2IO3 B;  2L52 A;  3PZ7 A;  1F52 A;  4BKS A;  4B9K A;  3ZJU A;  3B1L X;  5DCN A;  1WY8 A;  3A4S C;  3TIX A;  3AU4 A;  1FFV A;  4W9J A;  2X8X X;  1N5X A;  4GLS C;  1BT0 A;  2V4I B;  3MHS D;  3CMM B;  2LGY A;  3IT6 B;  2LAS A;  3P4Q B;  4GDL B;  4ANW A;  1TZ1 A;  2E6X A;  2D3A A;  1MPE A;  3KQ4 A;  1J7A A;  2BYT A;  2BKF A;  2K8H A;  2KQ7 A;  1FD6 A;  2ZVO A;  3IFW B;  1GNU A;  3KVF B;  3NZ3 A;  2KJ6 A;  1WFY A;  1WXQ A;  1GJZ A;  1OEY A;  3VR9 B;  1GC6 A;  1YJJ A;  2LXA A;  3ZDT A;  3X0W A;  1ENF A;  3MC0 B;  3TBL D;  2JRI B;  5IO9 A;  1TS2 A;  3QK0 A;  4MH8 A;  3VH4 B;  3HHM A;  2L0F A;  4GOC A;  3ECI A;  3A1Q B;  5C2T B;  2C7M B;  2WNM A;  3W5U B;  4TQ0 A;  2WWZ A;  2V9H A;  1RM6 C;  3ABV B;  1FRD A;  2ONQ A;  3PRM B;  3AE1 B;  3NJT A;  4TKN A;  2J7Q B;  2ZPN A;  2O2V A;  1A70 A;  2CJO A;  3PHX B;  5DPW A;  2L83 A;  2FUG 1;  2QJL A;  3KUD B;  3PZD A;  4LNF A;  1YQ3 B;  2LI5 A;  3VTU A;  1E0Z A;  3RYT A;  2C7H A;  4HCN B;  1D6E C;  1FMA D;  3HUI A;  5FKA C;  4BKS D;  3H1U A;  2CU3 A;  2BB5 A;  1QLB B;  3RPF C;  3BII D;  2NVU I;  3VAW A;  1E9M A;  2KD0 A;  3H9D A;  1RRB A;  3QC8 B;  1LQB A;  4P16 A;  4MGY E;  4LDT D;  4MEM A;  1GUA B;  3JSV B;  1V5T A;  2Y5C A;  2NTT A;  5CHV C;  1HEZ E;  3N3K B;  3DVG Y;  3LXF A;  3V3X A;  1XF5 L;  3ZKJ C;  1E6E B;  2DZJ A;  3R2T A;  2YEP B;  2Z59 B;  2D10 A;  2DYO A;  1RFK A;  3V6E B;  1C78 A;  2WXH A;  1WJ4 A;  1WM2 A;  3Q3N C;  1FXI A;  3Q8F A;  1YJI A;  2MQJ A;  4OHJ A;  1VD2 A;  4J3O D;  1NEK B;  2QEJ C;  4ANU A;  3VUW A;  4IM0 A;  3UF8 A;  2KJH B;  4W9F A;  3APF A;  2PTL A;  3W1Y A;  1JCK B;  4ZOH C;  3PZ8 A;  1T3Q A;  2MBE A;  1GOZ A;  3L16 A;  1FCL A;  3QWZ B;  2KO3 A;  2V3S A;  5G5G A;  4ARI A;  3DVN U;  1ZXI A;  5AUI A;  3L0W B;  1ROE A;  3QA8 A;  1C4A A;  2IPK D;  5DPT A;  3PRP B;  1C4C A;  1XLP A;  2FE8 A;  1OQR A;  3WAN A;  1IP9 A;  1Z2M A;  5HHD G;  3U30 A;  4A3P A;  1VLB A;  2JVC A;  3I3T B;  4DDI D;  5AZF A;  1XEE A;  4ZHO A;  4C7Z A;  4GXB A;  3NZU A;  2LRW A;  3N20 C;  3SU8 X;  4LJP B;  3MTN B;  3ZO5 B;  3BYT B;  1WGK A;  4ZRQ A;  2J0K A;  1C9F A;  3Q8E A;  3J9C A;  1EF1 A;  5T8I A;  1MG8 A;  2MP2 B;  2V3P A;  3U7Z A;  4DXA B;  3DVG X;  2KWC A;  2L76 A;  2KLG A;  4YL8 A;  4KVG B;  1GB4 A;  1ISN A;  3EEC A; 
#chains in the Genus database with same CATH homology
 5JH5 C;  1H4R A;  1I35 A;  4OVV A;  2KHW B;  2ZNV C;  2QHO A;  3SHQ A;  1NI2 A;  2WX0 A;  2K25 A;  1RAX A;  2R2Q A;  1K8R B;  5E6N A;  3H6N A;  3EC8 A;  2NBU A;  1V80 A;  4J6I A;  4NAW A;  1EF5 A;  1S3S G;  4MGK E;  2MSE D;  2KKC A;  4EEW A;  4CHK A;  4I6N B;  2DAF A;  3WAO A;  2JZ3 B;  3RCZ A;  2MRP A;  2KLC A;  2N1V A;  4A20 A;  4RM9 A;  1E8Y A;  4II3 B;  4F1S A;  4MH0 E;  2ASQ A;  4I6L B;  3U8Z A;  1X1M A;  2L00 B;  4CYE A;  2YLM A;  2BYV E;  1UGM A;  4FJZ A;  2AEH A;  1V49 A;  2RSU A;  3C0R B;  2FCN A;  2LVQ A;  2MW5 A;  5DCN A;  3JVZ X;  3DOW A;  4E71 A;  2KTF A;  3VXW A;  1V2Y A;  4HPL B;  4M8N A;  4NJ7 A;  3UIO B;  2CHZ A;  3DVN V;  3HK0 A;  5LLI A;  4ANV A;  1U4A A;  4WAA A;  2DX5 B;  3ZW3 A;  3OLM D;  2KDE B;  2JWZ A;  4WJO A;  4N9F 4;  1XD3 B;  2RR9 A;  5EDS A;  1IPG A;  4WQO B;  4DHZ B;  4HVB A;  3K9P B;  2KFK B;  2RGF A;  1OGW A;  3ZNG C;  1E8W A;  4X57 B;  4RM8 A;  2CHX A;  1C1Y B;  1Q0W B;  3DDC B;  3ZRF A;  3RZW C;  3KYC D;  2K6Q A;  5LXH A;  4NAW B;  3HM3 A;  2RPQ A;  2N9X A;  1WGR A;  2M8S A;  2GBJ A;  3KH0 A;  2KX0 A;  2XK5 B;  4GU2 A;  1LFD A;  3RD2 A;  3EHV A;  3RUI B;  4FHK A;  1L2N A;  3PGE A;  5C1Z A;  1WI0 A;  2MBO A;  5FR6 A;  3W1S A;  4HPM B;  3QX1 A;  4JGH B;  4K7W A;  2DYM A;  4AOF A;  3NOB A;  2JUO A;  3D32 A;  2YVC A;  2DAJ A;  2MP2 A;  3AUL A;  2LRU A;  2KWV B;  2ZVN A;  3QIJ A;  2GOW A;  1FXT B;  1WX9 A;  3EFU A;  1ZGU B;  4IWQ A;  3V61 A;  2ZJD A;  3IVF A;  4I6P A;  3NS8 A;  3AXC A;  1IYF A;  4WWP A;  1R4M I;  2N7E A;  2WX1 A;  5GMV A;  4P7I A;  2LUE A;  3UGB B;  2CU1 A;  3APD A;  1WZ0 A;  5J18 A;  1YX5 B;  4E3C A;  1P9D U;  4GMV A;  1E5W A;  2EMT A;  1UEL A;  2HE7 A;  2BKR B;  4BVU C;  3ALB A;  3Q3F A;  5KHO A;  4PS8 A;  2N9E B;  2ZPY A;  4HCP B;  4G11 A;  4PS3 A;  3PLU A;  4EFO A;  3ZTC A;  2JY6 A;  3PHW B;  1WYW B;  3A9K A;  4A3O A;  3QHT A;  2DZI A;  4MM3 A;  5HKH A;  3K9O B;  4IWO A;  1V81 A;  3RUL A;  1UBI A;  2I1J A;  4ANX A;  1RLF A;  2CS4 A;  2WDT B;  2XK5 A;  2D11 A;  3L54 A;  4FUL A;  1WXM A;  2K8C A;  2KMA A;  3M63 B;  3KW5 B;  4W9L A;  4JIO U;  2PJH A;  1WE6 A;  5J2R A;  1KLV A;  4KIK B;  1E8Z A;  2KDF B;  4MEL A;  3UIN B;  3VHT C;  5G2N A;  2DEN B;  2K39 A;  1WGG A;  4JQW C;  4K81 A;  2FCM A;  2M17 A;  4B95 A;  3RT3 B;  2FAZ A;  4XX5 A;  2R2O A;  4ZRI A;  4PYU A;  4AJW A;  1Y8R C;  4OVU A;  4MGI E;  3L13 A;  3DBH I;  1TBE A;  2K8B A;  2ZEQ A;  1M94 A;  3JW0 X;  4LDT B;  1V6E A;  2M0X A;  1TTN A;  1EO6 A;  2AL6 A;  2GBM A;  2AYO B;  3R7R A;  5CHW A;  1EUV B;  1ZKH A;  2ZCC A;  3GOE A;  3QAQ A;  4IC7 B;  4NNJ B;  3SD5 A;  4EZL A;  3A1Q A;  1AAR A;  4JL9 A;  3N32 A;  5J17 A;  3DCG A;  3A33 B;  1WGH A;  2PPH A;  4IG7 B;  2LVO A;  4MJS A;  3TMP B;  2G4D B;  1Z5S B;  4AUQ C;  5DPS A;  2NBV B;  2LVP A;  1J8C A;  4AWJ A;  3KUC B;  4FHJ A;  3H7P A;  4EKU A;  2MCN B;  1WX8 A;  2O6V D;  3A9J B;  2FUH B;  1XQQ A;  4NY0 A;  3V60 A;  3ZIM A;  2OJR A;  3QJZ A;  2NR2 A;  3VTV A;  2LWP A;  5L83 A;  2KNB A;  1OQY A;  2ZZP B;  5JHA A;  2BWF A;  2KWU B;  4KZC A;  1T0Y A;  1D3Z A;  2LJ5 A;  3B08 A;  1PQS A;  3NY5 A;  4IW0 A;  3OJ3 A;  2CKH B;  2JXX A;  2IO1 B;  2VRR B;  3JYU A;  4HDQ A;  1P1A A;  4AJY B;  3S2A A;  3QAR A;  4BFR A;  4DHZ E;  2AL3 A;  2HD5 B;  2N9P C;  1RFA A;  2N4F A;  4WWO A;  5D94 A;  1Q1O A;  2PE6 B;  2LXC A;  1OTR B;  3ZVV A;  1J19 A;  4AP4 C;  2V4L A;  2FID A;  4DHJ D;  2IO3 B;  2NS5 A;  2UWQ A;  4FJY A;  2FCQ A;  1P0R A;  4GDK B;  1JRU A;  1HE8 A;  2MLB A;  2PE9 A;  3L08 A;  3M62 B;  2M4N A;  1L7Y A;  4ASW C;  4B9K A;  4BKS A;  3B1L X;  2FCS A;  1WH3 A;  1WY8 A;  2BYF A;  4W9C A;  4XC2 A;  1V9J A;  2BWE S;  3A4S C;  3JSV A;  3MJW A;  3TIX A;  3AU4 A;  2D3G A;  4W9J A;  3CF6 E;  1BT0 A;  3MHS D;  4WWN A;  3QQ8 B;  4GIV A;  3UIP B;  4CO7 A;  4URK A;  3IHP C;  3CMM B;  1WXV A;  2LGY A;  2NPT B;  2L8J A;  2CHW A;  2IO2 B;  3ML9 A;  2LAS A;  2REX A;  4TV3 A;  3R7Q A;  4GDL B;  4IM2 A;  3VTW A;  4ANW A;  1ZW7 A;  1TZ1 A;  5JZE B;  5E6O A;  4EUT A;  4NQK E;  3DBS A;  1F9J A;  3NHE B;  2BKF A;  2K8H A;  2KQ7 A;  3A4R A;  3LDZ E;  2ZNV B;  2I1K A;  2ZVO A;  1Q5W B;  3IFW B;  4G50 A;  3UQA A;  3PLV A;  1GNU A;  3KVF B;  4KDL B;  5D6J B;  1WGY A;  2L0T A;  2KJ6 A;  1WFY A;  1XT9 B;  2W9N A;  1GJZ A;  1QZE A;  1V86 A;  2KQS A;  3A9J A;  1OEY A;  1WM3 A;  3H7P B;  4PYZ A;  3V6C B;  2L7R A;  5IA7 A;  2KVR A;  3OJ4 B;  1GC6 A;  2JRH A;  2LXA A;  4EOY A;  2O2V B;  4HK2 A;  3ZDT A;  2JPH A;  4FJV B;  3T8M A;  3VVW B;  3X0W A;  4KDI C;  4FBJ B;  3ENE A;  4DBG A;  2G45 B;  2JT4 B;  1E7U A;  3TBL D;  2JRI B;  1WMH B;  3APC A;  3TJP A;  3QK0 A;  4EZJ A;  3VH4 B;  4ZDV A;  3SDL C;  2C60 A;  2KDI A;  3HHM A;  2KX3 A;  3RZF A;  2L0F A;  3ZRC A;  1WXS A;  4GOC A;  4E74 A;  3ECI A;  3A1Q B;  2NCN A;  4TUU A;  2C7M B;  1CMX B;  2GBR A;  3VFK A;  4ZRK A;  1YD8 U;  1KOT A;  3KUZ A;  3PV1 A;  2WYQ A;  3ZUN A;  1WJU A;  4MSQ B;  2A5U A;  2KTR A;  2HJ8 A;  3ZNZ B;  4TQ0 A;  3TL5 A;  2WWZ A;  4KZ0 A;  2IO0 B;  2Z0D B;  4M0W B;  4GGQ A;  5KHQ A;  4GSW A;  4NJ6 A;  3CST A;  3BIN A;  5C23 A;  1OEY J;  5L95 C;  4ZYN A;  3LJ3 A;  5AEK B;  3PRM B;  2N1W A;  2C9W B;  2MWS B;  4B6W A;  4KIK A;  3PPA A;  1WXA A;  2G3Q B;  2KJR A;  2IY0 B;  4TKN A;  2J7Q B;  2ZPN A;  5LXI B;  2KTR B;  1LXD A;  2J0M A;  2O2V A;  3U7D A;  2UYZ B;  3PHX B;  5DPW A;  3T9L A;  1WX7 A;  3KUD B;  3PZD A;  3N30 A;  5BO4 B;  2KAN A;  3WA0 A;  2RD0 A;  2LI5 A;  1SE9 A;  3VTU A;  2MA9 B;  2DZK A;  2G4S A;  3PT2 B;  3RYT A;  2C7H A;  4BBN F;  4BKG A;  2MX2 A;  4HCN B;  3VQI A;  4ICU A;  3PSE B;  4W9I A;  1GC7 A;  3AI5 A;  3O65 B;  4BKS D;  1I42 A;  2CR5 A;  3H1U A;  2M1M A;  2A4Z A;  1WF9 A;  2EMS A;  4F8C B;  2L3Z A;  4LCD E;  1UD7 A;  4GDL A;  3WAL A;  1E7V A;  3R66 C;  1KJT A;  2NVU I;  4WJN A;  1WRD B;  2O6V A;  3VAW A;  2KD0 A;  2XEW A;  4BKT A;  3DBR I;  2C5L C;  3AU5 A;  3H9D A;  3QCA A;  2KK8 A;  4NQL B;  3VH3 B;  1RRB A;  3QC8 B;  1LQB A;  4W9G A;  1S1Q B;  4IWP A;  4PS7 A;  4IUM B;  2BPS A;  4LDT D;  4MGY E;  3W1S C;  4MEM A;  1GUA B;  1WR1 A;  5CTR C;  3V62 A;  3H7S A;  1SIF A;  2MBQ A;  3JSV B;  5CHF A;  4F7Z A;  4M8M A;  4XZ4 A;  5CX3 A;  4DWF A;  3WIM A;  2DZM A;  1J0G A;  1V5T A;  4JLC A;  3UQB A;  2V1Y A;  5JHB A;  4KSK C;  1LM8 B;  3PVL A;  1A5R A;  2LD9 A;  5CHV C;  3VUX A;  1WZ3 A;  1NDD A;  5D2M B;  4HXD A;  1KM7 A;  3N3K B;  3DVG Y;  4FLH A;  3IBE A;  1WMH A;  1H8C A;  3PRE A;  1UBQ A;  4W9D A;  5TR5 A;  3ZKJ C;  4DDG D;  4KSL C;  3KYD D;  5AZG A;  4GB9 A;  2BF8 B;  2DZJ A;  2XBB C;  2Z59 B;  1YJ1 A;  3OAW A;  2D10 A;  2DYO A;  4RMA A;  3V6E B;  4K7S A;  2MBB B;  2KFK A;  3HM6 X;  5AZH A;  1P98 A;  2LGD A;  1WJ4 A;  2MBH A;  1WM2 A;  2LZ6 A;  1E90 A;  3VUY A;  4G3X B;  3ZNI D;  3TCA A;  4HDO A;  2K1F A;  1YQB A;  2DYB A;  2MQJ A;  3PTF C;  1VD2 A;  4MDK E;  3ZNH B;  2C7N B;  4ANU A;  2IYD B;  2Y5B B;  1R4N I;  3VUW A;  3NZS A;  4FAD A;  4IM0 A;  3UF8 A;  4BOS C;  4BBN C;  2KJH B;  4W9F A;  3APF A;  3ONS A;  2L05 A;  3W1Y A;  2J0J A;  2HTH A;  2PEA A;  3L17 A;  4II2 B;  4K1R B;  5IAA C;  2KC1 A;  3PS6 A;  3ML8 A;  2MBE A;  1WIA A;  3Q3J A;  2NBW B;  2DHZ A;  3L16 A;  3X23 A;  3QWZ B;  4NPN A;  4MSM B;  2KO3 A;  4K7U A;  4ZRJ A;  2V3S A;  5G55 A;  2BGF A;  3M3J A;  2KZR A;  3DVN U;  1WR6 E;  4FN2 A;  5DPR A;  2KFJ A;  3BY4 B;  4GDK A;  2IY1 B;  3L10 B;  3L0W B;  3QA8 A;  2KXJ A;  1C3T A;  4HWI B;  5DPT A;  1UH6 A;  2Z0E B;  3PRP B;  1SGH A;  3PRZ A;  1V5O A;  2D2Q A;  2GMI C;  4KV2 A;  2O6V B;  1WE7 A;  4GN1 A;  2KMC A;  2BYE A;  4IM3 A;  3WAN A;  1IP9 A;  5D7G A;  2IBI B;  1GG3 A;  3WAM A;  2GBN A;  5E6P A;  4ICV A;  1Z2M A;  1NBF C;  3U30 A;  4DHJ B;  4FA6 A;  4A3P A;  3M95 A;  2KOX A;  1E8X A;  4W9H A;  3DBL I;  4DK5 A;  2JVC A;  3I3T B;  4DDI D;  5AZF A;  2ZCB A;  2JZZ A;  4HLE A;  4LJO B;  4W9K A;  2FNJ B;  3DPD A;  2EKE C;  4GXB A;  3GZN I;  3R3M A;  2LGX A;  3IG3 A;  4W9E A;  3HIZ A;  2KN5 A;  4MJS B;  1WJN A;  1TGZ B;  3NZU A;  2LRW A;  3SU8 X;  4LJP B;  1VCB A;  3MTN B;  3A9K B;  1UZX B;  3ZO5 B;  1WJ6 A;  3DQV A;  2JF5 A;  2J0K A;  3ZLZ A;  4BOZ B;  3WAP A;  2KC2 A;  4TQ1 A;  1G6J A;  2K6D B;  1P3Q U;  1EF1 A;  1WGD A;  2D07 B;  3B0A A;  3P2B A;  4HJK A;  1MG8 A;  2MP2 B;  2AWT A;  2B3A A;  3CSF A;  3ZDM C;  4EZK A;  2NPT A;  1YX6 B;  2N7D A;  4DXA B;  4MGZ E;  4WJQ A;  3DVG X;  2FIF A;  2IZV B;  2KWC A;  2L76 A;  1YIW A;  2KLG A;  4YL8 A;  4KVG B;  1ISN A;  3EEC A;  3ZTD A;  4G0N B;  4WJP A;  3VDZ A;  2OOB B;  2KDB A;  2GBK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...