3SDLC

Crystal structure of human isg15 in complex with ns1 n-terminal region from influenza b virus, northeast structural genomics consortium target ids hx6481, hr2873, and or2
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
151
structure length
151
Chain Sequence
DLTVKMLAGNEFQVSLSSSMSVSELKAQITQKIGVHAFQQRLAVHPSGVALQDRVPLASQGLGPGSTVLLVVDKCDEPLSILVRNNKGRSSTYEVRLTQTVAHLKQQVSGLEGVQDDLFWLTFEGKPLEDQLPLGEYGLKPLSTVFMNLRL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Non-structural protein 1
publication title Structural basis for the sequence-specific recognition of human ISG15 by the NS1 protein of influenza B virus.
pubmed doi rcsb
source organism Influenza b virus
molecule tags Viral protein/antiviral protein
total genus 37
structure length 151
sequence length 151
chains with identical sequence D
ec nomenclature
pdb deposition date 2011-06-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00240 ubiquitin Ubiquitin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 3sdlC02
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 3sdlC01
3IFWB 1UZXB 2AL6A 3KUDB 2MX2A 3T9LA 1V2YA 2K1FA 2AEHA 4IWPA 1E8WA 2BYVE 2QHOA 3PHXB 4IWQA 3DBSA 4GN1A 3C0RB 2L05A 2KTRA 4W9FA 2BF8B 3AU4A 1WH3A 2N9EB 4KVGB 3H7SA 2D10A 2O2VA 3APFA 2AYOB 1WF9A 2L00B 4CHKA 2RD0A 2BGFA 1NI2A 2PJHA 2JZZA 2MW5A 4MJSB 1UGMA 1WRDB 3WAMA 2M17A 1WFYA 1Z2MA 1S1QB 3PRZA 4II2B 4WJNA 3W1YA 1IYFA 5D2MB 2MWSB 5DPSA 2J0KA 3A9KA 3PZDA 3DPDA 4IWOA 3T8MA 3NS8A 1WGDA 2MSED 4BKGA 4I6LB 3TJPA 4BKSD 3OLMD 2KKCA 3SU8X 2KJRA 2KDIA 1EF1A 4EFOA 3TIXA 1L2NA 3PSEB 5DCNA 2HJ8A 2K8CA 3H1UA 2PPHA 2HE7A 3LJ3A 4GDKB 3PREA 4GSWA 3QC8B 5DPWA 3RZFA 2XK5B 3A9JA 4BKTA 2G4DB 4AP4C 3ZNID 3AULA 3EFUA 3ONSA 3UIPB 3KUCB 3P2BA 4F1SA 2RSUA 4G11A 2MRPA 4EUTA 1K8RB 4IUMB 3RULA 2C9WB 4K1RB 3ZTDA 2GBRA 4OVUA 1OQYA 2OOBB 1IPGA 3L08A 3AXCA 5CHWA 3V6EB 3A1QB 4URKA 1WMHB 2NPTB 1C1YB 3ALBA 3VUWA 4FADA 3U8ZA 3PPAA 2ZPNA 4JL9A 4BBNC 3RT3B 2HD5B 3KW5B 2XEWA 3NHEB 4HK2A 4FHJA 2G4SA 3UQAA 3UQBA 4IM3A 1RFAA 3RZWC 2KQSA 2FUHB 2KDBA 3NY5A 3QWZB 4NQKE 1P0RA 2BWFA 3A33B 2KX3A 3CSTA 3DOWA 3OJ4B 3ZRCA 3SDLC 3W1SC 5IA7A 2REXA 1WGYA 5C23A 4FLHA 2EMSA 3KYCD 4LDTB 2N9XA 3PGEA 3DBHI 3RD2A 2VRRB 3N32A 5DPRA 4LCDE 1GC6A 2KFJA 2GOWA 2V1YA 2YLMA 2IO2B 2KFKB 1E8YA 2D2QA 4W9JA 5L83A 1UELA 3SD5A 5JH5C 3NZUA 4RM9A 2LWPA 1H4RA 2K6DB 2N9PC 2MP2A 2CHWA 3PRPB 1UBIA 4DK5A 4MGZE 2JF5A 4HJKA 4IG7B 5IAAC 2BKFA 1E7VA 1P9DU 5JHBA 2GBKA 1WXAA 4BBNF 5G55A 4AUQC 1G6JA 4GDLB 3DDCB 4W9IA 4K7SA 3WALA 2KTFA 1EO6A 4E74A 2KDEB 4F7ZA 2MBOA 3R66C 4MSQB 2ZVNA 1ZKHA 4BKSA 1WJ4A 4TKNA 2FCQA 3ZW3A 1V49A 2J7QB 3TBLD 2RPQA 3D32A 3ZNHB 3AI5A 5AZHA 4BOSC 2KJ6A 4LDTD 4WWOA 4GB9A 5C1ZA 2KQ7A 1OTRB 1V6EA 1XT9B 3ENEA 4FULA 4GU2A 4N9F4 2K8BA 2BYEA 3H7PB 5KHOA 4AOFA 4ZDVA 2ZCCA 1S3SG 1ZGUB 2KZRA 3KYDD 4YL8A 5D6JB 4W9LA 2FIDA 4ZRJA 5D94A 3JYUA 2JPHA 1WM2A 2L0TA 4TV3A 4A3OA 4IW0A 4MJSA 4TQ0A 5LXHA 4RMAA 4DHZB 1GG3A 4EZLA 4KZ0A 3VQIA 2LGYA 4GMVA 4ANVA 1WX8A 3EC8A 2DENB 1V80A 4DWFA 4MGYE 1TBEA 3U7DA 1WY8A 3PLVA 3ECIA 4FHKA 1R4MI 1U4AA 2JRIB 5FR6A 2YVCA 3L16A 1WJNA 4HLEA 1C3TA 2WDTB 1KJTA 3EHVA 2KLGA 3ZVVA 3I3TB 1EUVB 1P3QU 3WA0A 1TTNA 2JY6A 4NAWB 3VFKA 2EMTA 4GDKA 1WXVA 4HDQA 3ZUNA 2RGFA 1XD3B 3B08A 4W9HA 1AARA 2XK5A 3H6NA 1Y8RC 2V3SA 3L13A 3SHQA 5KHQA 4ZRIA 2KC2A 3HIZA 2KANA 3GOEA 2KD0A 3DBLI 4FJZA 2KVRA 4DHJD 2KWVB 1GUAB 3A4RA 3VTWA 3VAWA 3A1QA 1WMHA 2NPTA 3ML9A 4HVBA 3DCGA 3V6CB 2K39A 2DHZA 2FNJB 2K25A 2C60A 5DPTA 1WGRA 4B95A 3M95A 4GGQA 3OJ3A 2FCNA 4MGIE 1NDDA 2KWUB 4M8NA 2D11A 2ZZPB 3QQ8B 2Z0DB 1GC7A 2KX0A 2BWES 2JXXA 3VH3B 3OAWA 3WAOA 3DBRI 3R3MA 2FCMA 5CX3A 2C7HA 3PV1A 2KOXA 1NBFC 4P7IA 1YX6B 2NVUI 4WJQA 4G3XB 4EZKA 2KJHB 4PS7A 5J17A 1SIFA 2DZIA 3DQVA 4NY0A 2KFKA 1WZ3A 3L10B 3U30A 2CU1A 3HHMA 3UF8A 2FIFA 3TCAA 4W9DA 4TQ1A 4LJPB 3A4SC 2PE9A 4G0NB 3UGBB 2PE6B 2ZJDA 1WI0A 3QIJA 1H8CA 4NPNA 4KZCA 1F9JA 3VH4B 3HM6X 2DAJA 4DDGD 4GDLA 4IC7B 4XX5A 2N1WA 3AU5A 1YX5B 3KUZA 4JQWC 1YIWA 5E6OA 4AJYB 4CYEA 4MGKE 2MBEA 2KK8A 2LGXA 2L0FA 2DZKA 5CHVC 3V61A 2KLCA 3H9DA 2BPSA 1KOTA 2UYZB 2LUEA 4PYZA 4DHZE 2DYOA 1E90A 3TMPB 2L7RA 1RLFA 4JGHB 1WE7A 2DZJA 3H7PA 3K9OB 4HCNB 4MELA 2LVPA 1RRBA 3QA8A 1V81A 2MCNB 3M63B 4EZJA 2R2QA 2XBBC 2LVQA 1V5OA 2WX0A 1WR6E 2ZVOA 2J0JA 4A20A 2GBMA 1V9JA 1Z5SB 4M8MA 3VUXA 5JHAA 2CHZA 1E8XA 4WQOB 4II3B 4E3CA 1E7UA 2IO1B 4FA6A 3VTVA 3JVZX 1Q1OA 3N3KB 3MHSD 1WGHA 1UH6A 1V5TA 1RAXA 3W1SA 1IP9A 1WIAA 2L8JA 2LVOA 2Z0EB 1WXSA 4WWPA 3Q3FA 3QAQA 3RYTA 2D07B 4W9EA 4EOYA 1FXTB 4NJ7A 4HPMB 4WAAA 5AZFA 1YJ1A 4TUUA 4NNJB 1D3ZA 4A3PA 4MSMB 2IBIB 4K7WA 2G3QB 4KIKB 4NAWA 3QX1A 1OEYA 3ZDTA 4GOCA 1WX9A 1YD8U 1M94A 1QZEA 2IY0B 2M4NA 3PLUA 1WZ0A 4FJVB 2LJ5A 5CTRC 3JW0X 2JVCA 2WYQA 3WIMA 5L95C 2KMAA 4I6NB 3NOBA 3WAPA 4W9CA 3UINB 1WX7A 3R7QA 2DX5B 3APDA 5HKHA 2DZMA 2LI5A 4WJPA 1ISNA 4XZ4A 2JWZA 2JUOA 3QHTA 2A4ZA 1LM8B 2ASQA 1WJ6A 1JRUA 2MBHA 2MA9B 3L0WB 4I6PA 4AJWA 4KV2A 2KN5A 1YQBA 2KMCA 3DVNU 3HM3A 3B0AA 1J0GA 2J0MA 2DAFA 2EKEC 4AWJA 4LJOB 4K81A 1TGZB 2V4LA 5LLIA 1Q0WB 5E6NA 1SE9A 4FN2A 2KC1A 2N7DA 2NR2A 3VXWA 3ZLZA 1E5WA 1X1MA 3M3JA 3PT2B 4HDOA 3QCAA 1OEYJ 3RCZA 1WGGA 3DVGX 3KVFB 1LQBA 2KO3A 4ZYNA 2LRUA 1J19A 4HCPB 2C5LC 3CSFA 1I42A 2KDFB 3PVLA 2ZNVC 2Z59B 4CO7A 2IZVB 2I1KA 2WX1A 2K8HA 2DYBA 5AZGA 2GMIC 2ZEQA 1EF5A 2BKRB 3VUYA 2AWTA 4KDIC 2L76A 2BYFA 1WM3A 3JSVB 4ANWA 2IYDB 5AEKB 3PTFC 3IVFA 4HXDA 2O6VB 3L17A 3MTNB 3QARA 1KLVA 1P1AA 2KHWB 5E6PA 2N4FA 3IHPC 3TL5A 3ZO5B 4E71A 2M1MA 4W9GA 4WJOA 2FAZA 4OVVA 2W9NA 4MEMA 2KTRB 2LGDA 5D7GA 1PQSA 2RR9A 4FBJB 2AL3A 2MBQA 4BVUC 2O2VB 1SGHA 2L3ZA 2IO0B 2G45B 5J2RA 3BY4B 1ZW7A 3VDZA 5LXIB 4PYUA 2JT4B 4GXBA 4IM2A 3ZNGC 4XC2A 2Y5BB 1L7YA 1WYWB 1WXMA 3NZSA 2IO3B 2CS4A 4HWIB 4ICVA 2NCNA 3DVGY 3ZTCA 3DVNV 1HE8A 4ASWC 1LFDA 2N1VA 3APCA 1P98A 1I35A 4FJYA 4RM8A 3A9KB 3O65B 2NBVB 2O6VD 5J18A 3ZRFA 4J6IA 5CHFA 3WANA 4PS3A 1WE6A 2LZ6A 1KM7A 1R4NI 2MBBB 1GNUA 2NBWB 4B6WA 4EKUA 2WWZA 2M8SA 2LXCA 2NS5A 4IM0A 5G2NA 1J8CA 1CMXB 1XQQA 3HK0A 4KIKA 4K7UA 3CMMB 3K9PB 2ZCBA 4W9KA 2LRWA 2ZNVB 3LDZE 2C7MB 3KH0A 4X57B 3ZNZB 4BOZB 3A9JB 2KXJA 2CR5A 2IY1B 1VCBA 1LXDA 2R2OA 3IBEA 4MH0E 3ZKJC 2PEAA 1UBQA 3QJZA 1WJUA 2KNBA 5TR5A 3VVWB 4F8CB 4ICUA 4MM3A 2A5UA 3EECA 1A5RA 2MQJA 2OJRA 1V86A 1UD7A 2LASA 3ZIMA 4EEWA 3L54A 3BINA 3IG3A 1T0YA 2HTHA 3Q3JA 3QK0A 4G50A 1E8ZA 3S2AA 3X23A 2B3AA 5BO4B 3N30A 4B9KA 2ZPYA 4DBGA 2I1JA 3MJWA 2UWQA 2K6QA 3ZDMC 2JZ3B 4DHJB 3VHTC 2DYMA 5EDSA 4JLCA 3PS6A 4MDKE 4ZRKA 4M0WB 3R7RA 3CF6E 4PS8A 1MG8A 3V62A 1GJZA 4KDLB 4DDID 5JZEB 2LXAA 3VTUA 1Q5WB 1OGWA 1TZ1A 2JRHA 2LD9A 3M62B 4JIOU 4WWNA 4ANUA 3UIOB 4NJ6A 2M0XA 3B1LX 3PRMB 4KSLC 4DXAB 2FCSA 2D3GA 2N7EA 2MP2B 4ANXA 4BFRA 2CHXA 1VD2A 2C7NB 4GIVA 4NQLB 2GBNA 2MLBA 2GBJA 3RUIB 3V60A 1WR1A 1BT0A 3X0WA 3ML8A 3JSVA 4HPLB 3GZNI 3PHWB 2KWCA 5GMVA 2NBUA 4KSKC 2O6VA 2CKHB
chains in the Genus database with same CATH superfamily
3KUDB 2YEPF 2QHOA 1CQVA 3BZDB 3AE7B 4IWQA 3DBSA 1K53A 4GN1A 2BF8B 3H7SA 2D10A 2O2VA 5BMIA 3ZJTA 2MW5A 3DHHC 4MJSB 1GOZA 3IXSA 3PZ7A 3I63C 2SAKA 2YEPB 1V1PA 2JX5A 4DQOC 3T8MA 3I57A 3TJPA 1LGRA 2KJRA 2KDIA 1ESFA 4OZBA 1OQQA 3TIXA 3PSEB 1ZPSA 3N1YC 2HE7A 3LJ3A 3I5JC 3PREA 2I38A 1V1OA 3BK1A 3RZFA 1R4NB 1HQRD 1SXTA 3ONSA 3KUCB 1VZ6A 2RSUA 1SIJA 5TSSA 2W3SA 1K8RB 4IUMB 4LK0M 4AS1A 1OQYA 3V6EB 3AXCA 3MHZA 1C1YB 3VUWA 1Y56A 2HDEA 2HD5B 2M56B 1I4HA 3OJ4B 3DOWA 3SDLC 5IA7A 3LB8C 1ACCA 3BWUD 2J52A 4LCDE 1GC6A 1JWSD 2IO2B 2ONQA 2KFKB 5L83A 3SD5A 5JH5C 3NZUA 2K6DB 2CHWA 5IN7A 3Q8BA 1E7VA 5EE0A 1T0RC 5G55A 4AUQC 4ITKA 3URYA 4YXDB 3WALA 1EO6A 3R66C 2ZVNA 4WURA 1E0ZA 3ZW3A 1EWYC 2J7QB 2INPE 3BK2A 3TBLD 3AI5A 3HUIA 4BOSC 2KJ6A 3MC8A 1V6EA 1XT9B 5KHOA 2K8BA 4ZDVA 2ZCCA 2FIDA 4A3OA 4MJSA 4TQ0A 5LXHA 3FC4A 1GG3A 1FCLA 3VRAB 1WX8A 4DWFA 4FHKA 3ECIA 2LEKA 2HJ1A 3L16A 3AN1A 2KLGA 4NAWB 3P1MA 3P42A 3ZUNA 3W2DA 1XD3B 3B08A 1UF0A 5KHQA 2KANA 3GOEA 1T3QA 3H8HA 3DBLI 2VZKB 2BT6A 2NMQA 4HVBA 4LNNA 3DCGA 5FKAC 1UNSA 4KGSA 5DPTA 3AE6B 4US8A 4YTNB 2N0SB 1QKZA 1NDDA 3QQ8B 1GC7A 2KX0A 1XLQA 2ON8A 5CX3A 1NBFC 2NVUI 4WJQA 5J17A 2DZIA 2BS4B 2KFKA 1WZ3A 3NZ3A 3TEYA 2VZKD 2FIFA 3UF8A 3TCAA 4TQ1A 4LJPB 3A4SC 2PE9A 2N9KA 4G0NB 5BMHA 2INDC 2ZJDA 3QIJA 1F9JA 1ZDXA 3B2FA 4KGTA 3KUZA 5H92C 5E6OA 1UUPA 1EWCA 4A8XC 4CYEA 2BYTA 3L4PA 2MBEA 2WGSA 2KK8A 2LGXA 2MJEA 3AE8B 2BPSA 2UYZB 1MHHE 1RLFA 4JGHB 4HCNB 3B9JA 1RRBA 2J53A 2LVQA 3J9CA 2J0JA 1Z5SB 4P1CC 2CHZA 3KWVA 4II3B 3VTVA 2FBWB 1C4CA 2D07B 3Q8AA 3RNBC 2MHJA 1IBXB 1D3ZA 2V9HA 4B0MA 1F2RC 2IBIB 4K7WA 1WWTA 4NAWA 1PGBA 4MACA 3ZDTA 4ARCA 2BS3B 4M00A 1YD8U 2IY0B 3WIMA 1WZ0A 2H88B 3SFEB 2WQYB 4I6NB 2WXPA 4OVZA 4W9CA 1V97A 2LI5A 1ISNA 1IGDA 2JUOA 2JWZA 1KFYB 1WJ6A 2MBHA 2MA9B 4YSZB 4KV2A 3FILB 4RGTA 3TEZA 1I4RA 2KMCA 3Q8CA 4O1NA 4HPPA 3B0AA 2K0PA 4YTPB 2WXQA 2J0MA 1TKEA 3NG0A 1PDXA 3GP7A 1TGZB 4FN2A 2KC1A 2N7DA 3ZLZA 2H89B 2I2YA 3QCAA 3RCZA 1WGGA 2LRUA 3HVZA 5HG2A 4CO7A 3DWMA 2DYBA 5AZGA 3AECB 1J7BA 2B76B 4ZRQA 3AEDB 1EF5A 2BKRB 3AE5B 2AWTA 1TT5B 1WM3A 2PTLA 1E7PB 2KN4A 2O6VB 1KLVA 2HTME 4C56C 4E71A 3ZO5B 2M1MA 4RFBA 4WJOA 2FAZA 3EUB2 2W9NA 2KTRB 4L1BA 4ARIA 2AL3A 4BVUC 1SGHA 1F2RI 5J2RA 4MT5A 4LNKA 2E3TA 1SE2A 2Q5WD 3RNEC 4XC2A 1JALA 2W82A 3NZSA 2CS4A 4A9AA 3ZTCA 1NYRA 2WLBA 2N1VA 1I35A 3NVYA 3N20C 2CJOA 2O6VD 5J18A 1FPYA 1TS5A 3KLSX 2GLSA 1QILA 1P7FA 4B6WA 1IBXA 5BYRA 2G1EA 4IM0A 5G2NA 3RNCC 4RNAA 1CMXB 1XQQA 1M4VA 3OG5A 3ZNZB 3A9JB 3AMZA 3C19A 5LNK1 2PEAA 4F8CB 2KVZA 2RDGA 5D3IB 3BVZA 3ZIMA 1B9RA 3L54A 3SFDB 1FEHA 3QK0A 1E8ZA 5BO4B 1MFWA 2ZPYA 4DBGA 2I1JA 2UWQA 3FILA 1NVID 2K6QA 3ZDMC 4DHJB 2DYMA 3IAM1 4JLCA 1I4QA 4M0WB 2BB6A 4DDID 5JZEB 4A55A 1TZ1A 4NJCA 1N5XA 1JWUD 4NJ6A 1FRRA 3B1LX 2WXLA 1CZPA 2AQ3B 3PO0A 4ANXA 4BFRA 4XWWA 2C7NB 3BVGA 2GBJA 1WR1A 1BT0A 5GMVA 4DHJD 2O6VA 2CKHB 1UZXB 2WXGA 1JWAD 1V2YA 2K1FA 2ZW0A 3PHXB 2PKOA 3C0RB 2KTRA 3AU4A 2N9EB 4KVGB 2KAJA 1WF9A 2WS3B 2BGFA 2TSSA 1NI2A 2JZZA 1QT9A 4DXGA 1UGMA 1WRDB 4C7ZA 1C76A 1Z2MA 4II2B 4WJNA 1P7EA 2MWSB 4LNFA 3PZDA 3DPDA 3P4RB 4BKGA 4I6LB 2KKCA 3SU8X 4EFOA 4WQMA 5DCNA 1XCQL 4OZAA 4RF0A 2K8CA 3RN9C 2PPHA 3QC8B 2WXOA 2PW9A 2WXNA 3V3XA 1ROEA 1TS2A 5DPWA 3A9JA 4BKTA 3AULA 4IOIE 4G11A 3AE4B 4EUTA 2QEJC 4N59A 3RULA 5CHWA 4URKA 3NUHB 3A1QB 1WMHB 4B0EA 1ZE3D 2XEWA 1VLBA 4FHJA 2G4SA 4ZYSA 4IM3A 4USAA 3RZWC 3V05A 2KQSA 4NZLB 2FUHB 4NQKE 4M0WA 1KTKA 2Y3AA 1WGYA 4FLHA 4ZRPA 4C80A 2EMSA 3KYCD 1L4DB 2GB1A 2W3RA 2N9XA 3Q3NC 2D2QA 2V0GA 1PYWD 2K3UA 4RM9A 1JWBD 5JHBA 1WXAA 4GDLB 3DDCB 4K7SA 2KDEB 1JW9D 4P16A 1HEZE 2RPQA 3ZNHB 5AZHA 3Q14C 1HZ6A 2LHEA 5C1ZA 1ET6A 1OTRB 4N9F4 4GU2A 2INNE 1S3SG 2KZRA 3KYDD 4YL8A 3W5VB 3BVMA 1UWMA 4W9LA 5D6JB 1BXTA 3JYUA 5D94A 4D2KA 4IW0A 2VH1A 1ENFA 2LGYA 3MP9A 4ANVA 4WH4A 2BW2A 1FIQA 2NTTA 3U7DA 3PLVA 4ZHOA 1L5PA 2JRIB 2YVCA 1OFFA 4C7YA 2WDVB 2WDTB 1XCTL 2RMMA 2PIAA 4HDQA 4W9HA 3GE3C 3H6NA 1VZ7A 4KGRA 3HIZA 2KD0A 4FJZA 3VAWA 3A1QA 1WMHA 3V6CB 2J42A 1FXIA 2JU6X 2OEDA 1TY0A 2X8XX 4B95A 4GGQA 1E9MA 2FCNA 1NENB 2KWUB 2D11A 2ZZPB 3DHGC 2Z0DB 2BWES 3VH3B 1F0ZA 1L0YB 2KOXA 2QILA 1YX6B 1K50A 4G3XB 4OZCA 1SIFA 2V3PA 4NY0A 3HHMA 1WI0A 3TUOA 1VDVA 4NPNA 3N1XC 4Q2JA 4DDGD 4GDLA 5T8IA 1AYFA 1FFVA 1NI3A 3GB1A 3VR8B 4JQWC 2L0FA 2DZKA 3KWLA 5CHVC 3V61A 3GS2A 1DOXA 1KOTA 3AEBB 1SBBB 2DYOA 1E90A 1WE7A 2DZJA 2LVPA 3QA8A 2K5PA 1TZOA 2R2QA 1V5OA 2WU2B 1V9JA 3VUXA 4BAXA 2LFIA 1XXGA 4FA6A 1C4AA 2UU7A 1UH6A 1RAXA 2LVOA 2DBYA 4TSSA 4WWPA 1FXTB 4YSYB 4HPMB 5AZFA 1YJ1A 4XGAB 2WXIA 4PT5A 2MJ3A 5JXVA 1UGJA 3JW0X 2JVCA 1N6ZA 1WYGA 3RMKC 2FE8A 5IOIA 4XYCA 5HKHA 1QOFA 4XZ4A 1FNUA 1LM8B 2ASQA 1F52A 3TEXA 3DBLB 1EU3A 5G5GA 3DHIC 1YQBA 3DVNU 2LUMA 1VR9A 2D3AA 4HJGE 3Q6BA 2WU5B 3NJTA 3VXWA 2D3CA 1X1MA 3PT2B 4HDOA 3B2GA 3DVGX 3KVFB 2KO3A 1A70A 1RYJA 2ZNVC 3PVLA 2W55A 4IDIA 3P4PB 1B1ZA 1ET9A 3T3NA 2BYFA 3JSVB 4ANWA 3IVFA 1L6VA 4EE2A 4HKZE 2N4FA 5HHDG 3RNAC 2KYWA 4MEMA 2LGDA 4FBJB 2MBQA 2L3ZA 5LXIB 3ZNGC 1I7HA 2Y5BB 2WXRA 1WYWB 1WXMA 4ICVA 4HWIB 3DVNV 3FKYA 3SR6A 3APCA 1VZ8A 1P98A 1YOVB 1TKGA 2JQRB 3A9KB 4PK1A 2NBVB 3ZRFA 4J6IA 5CHFA 3NVZA 2ICIA 5EE3A 2MBBB 1GNUA 2NBWB 4CQNA 2BS2B 1F77A 5BYQA 3TEWA 2LXCA 2NS5A 2WNMA 5IP4D 2ZNVB 4N58A 2C7MB 4X57B 2D5GA 1YNTE 2KXJA 2R2OA 1WJUA 5I4DA 5C2TB 4KX6B 4ICUA 1A5RA 2LASA 4LNOA 3BINA 1C78A 3DWGC 1MPEA 3Q3JA 1PUTA 1KLGD 2WXJA 4AQ7A 1N61A 3MJWA 4XE0A 3ZGZA 1TS3A 5EDSA 4MDKE 3PS6A 4ZRKA 1XLPA 1I4PA 1MG8A 2LXAA 3FAHA 1OGWA 3M62B 1YN5A 1D6EC 4WWNA 1N62A 2M0XA 1LO5D 4KSLC 2FCSA 2D3GA 4LLGM 2WDQB 2CHXA 2E6XA 4N6EB 2GBNA 2MLBA 4ZOHC 5D3DA 3ML8A 3JSVA 4J3OD 3PHWB 2KWCA 4KSKC 3IFWB 2AL6A 1XO3A 4A6QA 2M19A 2AEHA 3C8YA 2L05A 3LXFA 2WXKA 2AYOB 3CWIA 4YT0B 2RD0A 2PJHA 1FCCC 3WAMA 3AE1B 2M17A 3TSSA 5BMGA 2DLBA 1S1QB 3W1YA 1IYFA 5D2MB 5DPSA 2ZW1A 3A9KA 2OJWA 3ZYYX 3NS8A 1YJJA 1D4BA 2D3BA 1L2NA 3Q8EA 2WXMA 3H1UA 2IGDA 1GB4A 2LHDA 4S17A 4GSWA 2WXFA 1ZP0B 4M01A 2Z8LA 4HEA1 4RGNA 2G4DB 4AP4C 2QIEB 1YQ4B 4K1RB 2GBRA 5EE1A 1IPGA 2V3NA 3L08A 1EU4A 2NPTB 5IKCM 3ZXVA 3DBHB 3EA6A 3I9V1 4XDDA 3KW5B 4HK2A 3UQBA 2JYEA 2PVGC 3NY5A 1P0RA 2BWFA 3ZRCA 3CSTA 3AH7A 1HZ5A 2RPVA 1FO4A 4LDTB 3PGEA 3DBHI 2VRRB 4C4VB 2WP9B 3N32A 2KFJA 2V1YA 2EELA 4W9JA 3ZXRA 3P4SB 2N9PC 3PRPB 1L6UA 1DOYA 4JWSC 4MGZE 4IG7B 1GB1A 1QOAA 2EKIA 2KTFA 4E74A 4MSQB 1ZKHA 4TKNA 1XLOA 2FUG1 3D32A 3VRBB 2N9LA 3ZJUA 4LDTD 1JMLA 4GB9A 2CJNA 4WWMA 4A3PA 3MC9A 4FULA 3H7PB 4LTUA 1ZGUB 3RT3B 4TV3A 1JWMD 2JPHA 4JX1C 4RMAA 4EZLA 3P63A 2V4IB 1GAQB 1UWXA 2DENB 3AE2B 1WY8A 1U4AA 1SE4A 1C3TA 1WJNA 1MVKA 1YN3A 1KJTA 3ZVVA 3I3TB 3WA0A 1TTNA 2JY6A 5HI1A 2EMTA 1WXVA 1I4GA 3SHQA 4ZRIA 2KC2A 2KMMA 2KVRA 2KWVB 1GUAB 1SEBD 2NPTA 2K39A 2DHZA 4RCOA 2FNJB 2C60A 1WGRA 3NVVA 3M95A 2XNAC 4MGIE 5GXGB 1L4ZB 4M8NA 3WAOA 2JXXA 3R3MA 2FCMA 2C7HA 3PV1A 4C4VA 2AQ2B 2KJHB 1FRDA 1YJIA 3R2IA 1TYGB 5G5HA 2CU1A 1VRAB 3MFGA 3UGBB 5BYSA 5HFYA 4KZCA 1V8CA 2RDBC 4P6VF 3AEAB 2N1WA 1PFDA 1KRHA 3AU5A 3N9YC 3U2SC 2KLCA 4HROA 4DHZE 4MELA 3H7PA 1NEKB 1WRIA 5FK9C 3M63B 4EZJA 2XBBC 1WR6E 2ZVOA 2J4XA 4M8MA 4M02A 5JHAA 1N60A 1E8XA 4K3CA 3EFCA 1E7UA 2IO1B 4A90A 4E3CA 3N3KB 1WGHA 1V5TA 1JCKB 1WIAA 2L8JA 5AUKA 2LGIA 1WXSA 4JE3B 3QAQA 4US9A 4NJ7A 4WAAA 4IKGA 2NTSA 2G3QB 4KIKB 4GOCA 4NAMA 1QZEA 3PLUA 2INCC 4FJVB 2LJ5A 1QLBB 2KMAA 4MM3B 3NOBA 3WAPA 2DX5B 1XF5L 4WJPA 2A4ZA 1FD6A 4I6PA 1VJKA 4AJWA 4K3BA 2KN5A 1QOGA 1KF6B 1TS4A 1J0GA 4P1BC 2EKEC 4AWJA 4RH6A 1C79A 5LLIA 2KQ4X 2V4LA 3Q8FA 5E6NA 1E5WA 1LQBA 4ZYNA 4C00A 1J19A 4HCPB 3CSFA 2KDFB 4YWGG 3AEGB 2K8HA 2GMIC 3W5UB 2JYTA 2Y5PA 2QDFA 3VUYA 1DOIA 2L76A 2IYDB 5AEKB 1I4XA 1J7CA 3IHPC 3TL5A 4QAYA 4OVVA 4FXCA 1JQ4A 5D7GA 2RR9A 1TIFA 1ZW7A 3VDZA 4PYUA 2JT4B 4GXBA 3AB5A 4IM2A 3VR9B 2IO3B 4H2AA 2NCNA 4L2YA 2DNFA 1HE8A 4ASWC 1LFDA 3U4EG 4FJYA 4RM8A 1F1HA 4HRSA 1ZOYB 1OQRA 3U7ZA 3WANA 4PS3A 2LZ6A 1R4NI 1MG4A 1SB3C 4EKUA 2KDMA 1IUEA 1J8CA 1TJEA 3HK0A 4KIKA 4K7UA 3CMMB 2LRWA 1KLUD 3LDZE 4BOZB 1BMLC 4ZHPA 1FNVA 2IY1B 1LXDA 3IBEA 4MH0E 3ZKJC 2ACZB 2KNBA 5C3JB 3ETRA 4MM3A 2MQJA 1V86A 1UD7A 2RDHA 2HTHA 3X23A 4G50A 3S2AA 2WHIA 2B3AA 4UDUC 2QSDA 3N30A 3BYTB 2JSVX 1C77A 1D5XC 3R7RA 4RGMA 3CF6E 3AE9B 4PS8A 3V62A 1GJZA 2MEKA 3VTUA 1XEEA 2JRHA 2LD9A 4JIOU 4ANUA 3UIOB 1JRPA 3KQ4A 3MJ5A 2MP2B 1J7AA 3OWEB 4L23A 2MH7A 2Y5CA 1VD2A 1WGKA 1T5XD 3AEEB 1WSPA 2MX2A 3T9LA 4IWPA 1E8WA 2BYVE 4W9FA 1WH3A 3APFA 2QMTA 1RM6C 3RNFC 2L00B 2G9HD 2K9XA 1PGXA 4CHKA 3CIRB 1HTQA 1WFYA 3PRZA 1FM0D 3U52E 2J0KA 4IWOA 1WGDA 1ZXIA 2MSED 5MPOA 3BYYB 1KH0A 4BKSD 3OLMD 2KACA 1ZXHA 1EF1A 3WCQA 1GPXA 2HJ8A 4GDKB 3R8BA 2XK5B 1STEA 3ZNID 3EFUA 1R7SA 1T0QC 3UIPB 3P4QB 3P2BA 4F1SA 2MRPA 2M0AA 2PVOD 2BB5A 2C9WB 3Q69A 3ZTDA 4OVUA 5AUIA 2OOBB 2L32A 3ALBA 4FADA 2AX5A 3U8ZA 3PPAA 2ZPNA 4JL9A 4BBNC 4LNIA 3NHEB 3UQAA 2QC8A 1RFAA 2KDBA 3QWZB 2OHFA 3A33B 2KX3A 3W1SC 2REXA 5C23A 3AEFB 3RD2A 1K51A 5DPRA 3NVWA 2YLMA 2GOWA 2CU3A 1K52A 3RNGC 1E8YA 1UELA 2GI9A 2LWPA 1H4RA 2MP2A 1UBIA 4DK5A 2JF5A 4HJKA 3IT6B 2L1AA 5IAAC 3MC0B 2BKFA 1P9DU 1E10A 2GBKA 4BBNF 1G6JA 1CK1A 1DGJA 3HRDD 4W9IA 1PGAA 2L83A 2LGSA 4F7ZA 2MBOA 3UI3A 4BKSA 1WJ4A 2FCQA 1HXYD 2WXHA 1V49A 2IDYA 4JWUC 1AWDA 1HTOA 1C9FA 1N5WA 4DXFA 4WWOA 3ZJVA 3E56A 4BZAA 2KQ7A 3ENEA 1R4MB 2BYEA 4AOFA 4ZRJA 1WM2A 2L0TA 2W54A 3ZQ4A 2K22A 4DHZB 1CJEA 4KZ0A 3VQIA 4GMVA 1D5ZC 3EC8A 1V80A 1YQ3B 4MGYE 1TBEA 1R4MI 1AW7A 5FR6A 4HLEA 3AE3B 3EHVA 1EUVB 2QJLA 1P3QU 3HVDA 3VFKA 3Q3MC 4GDKA 2L52A 2RGFA 1AARA 2XK5A 1Y8RC 2V3SA 3L13A 1L0XB 2IGHA 2SEBD 3A4RA 2WDRB 3VTWA 3ML9A 3DBRB 2K25A 2KWDA 2PMVA 3OJ3A 1FFUA 2N7JA 1SJED 1ZDVA 3OAWA 3DBRI 1FMAD 1YMHE 4P7IA 4EZKA 1WXQA 4ACFA 4PS7A 4XWTA 3RFZB 3DQVA 3GE8C 2PLPA 1L0VB 3L10B 3U30A 4W9DA 2BBCA 2PE6B 4KKIA 1H8CA 2KT7A 3VH4B 3HM6X 2DAJA 3NS1A 4IC7B 4XX5A 3RPFC 2AQ1B 1YX5B 1YIWA 4AJYB 4MGKE 4XDCA 4OHJA 4TMAB 3H9DA 3R2TA 2LUEA 4PYZA 3TMPB 4KKJA 2L7RA 3K9OB 1V81A 4WAFA 1MI0A 2MCNB 2MJDA 2LJIA 2WX0A 4A20A 2GBMA 4WQOB 1E6EB 3JVZX 1Q1OA 3MHSD 1N63A 3W1SA 1IP9A 2Z0EB 3Q3FA 3Q3OC 3RYTA 4W9EA 4EOYA 5H8YE 2IPKD 4TUUA 4NNJB 4MSMB 3IAS1 3QX1A 1OEYA 1WX9A 1M94A 2M4NA 5CTRC 5FR3A 2WYQA 3N1ZC 2IJ0A 5L95C 2BTEA 1EM7A 3UINB 1WX7A 1YN4A 3R7QA 3APDA 2DZMA 3QHTA 1JRUA 3IT4B 3L0WB 2LMCA 3HM3A 2XN9C 1SF0A 5E6JA 2DAFA 2JXTA 3PZ8A 4LJOB 4K81A 1Q0WB 1SE9A 2NR2A 4JPSA 4WIPA 2JWUA 3M3JA 4MH8A 1OEYJ 2C5LC 1I42A 2Z59B 2IZVB 2I1KA 4R3DA 2WX1A 3BIID 2X38A 2ZEQA 3W9CB 1SSNA 4KDIC 1RWSA 3PTFC 4OW0A 3L17A 1Q10A 3MTNB 3QARA 1P1AA 2KHWB 5E6PA 3LYYA 4W9GA 4YSXB 4RF1A 1HA5A 1AN8A 1PQSA 2O2VB 1MJDA 2IO0B 2IGGA 2G45B 3BY4B 3T3OA 1L7YA 3DVGY 1TY2A 1IGCA 1V1PB 4HKQA 1QF6A 3AV8A 3O65B 1ZUD2 2GRIA 1WE6A 1KM7A 1T0SC 4RGOS 2QCZA 1QOBA 2WWZA 5EE9A 2M8SA 4REZA 3NRZA 3K9PB 2ZCBA 4W9KA 4YTMB 5IO9A 1TKYA 3KH0A 1T6BX 2CR5A 1VCBA 3QJZA 1UBQA 3EGRA 4S0RA 5TR5A 3VVWB 3E9SA 2DWQA 2A5UA 3EECA 1QQRA 2OJRA 4EEWA 2BQQA 3IG3A 1T0YA 4B9KA 4GLSC 3ABVB 3Q2AC 2JZ3B 1JROA 3VHTC 3AM9A 4KDLB 1BUIC 1XLNA 1NYQA 3SEBA 1C4PA 1D5MC 1Q5WB 2VH2A 3RI7C 2R61A 3GZNB 1DYQA 3PRMB 4DXAB 1SJHD 2N7EA 2BVCA 1SE3A 2JZPA 1FXAA 1FNWA 4GIVA 4NQLB 1MHXA 3RUIB 3O13A 1RFKA 3V60A 3X0WA 4HPLB 3GZNI 2NBUA 4HXDA
chains in the Genus database with same CATH topology
3IFWB 1UZXB 2AL6A 3KUDB 2MX2A 3T9LA 1V2YA 2K1FA 2AEHA 4IWPA 1E8WA 2BYVE 2QHOA 3PHXB 4IWQA 3DBSA 4GN1A 3C0RB 2L05A 2KTRA 4W9FA 2BF8B 3AU4A 1WH3A 2N9EB 4KVGB 3H7SA 2D10A 2O2VA 3APFA 2AYOB 1WF9A 2L00B 4CHKA 2RD0A 2BGFA 1NI2A 2PJHA 2JZZA 2MW5A 4MJSB 1UGMA 1WRDB 3WAMA 2M17A 1WFYA 1Z2MA 1S1QB 3PRZA 4II2B 4WJNA 3W1YA 1IYFA 5D2MB 2MWSB 5DPSA 2J0KA 3A9KA 3PZDA 3DPDA 4IWOA 3T8MA 3NS8A 1WGDA 2MSED 4BKGA 4I6LB 3TJPA 4BKSD 3OLMD 2KKCA 3SU8X 2KJRA 2KDIA 1EF1A 4EFOA 3TIXA 1L2NA 3PSEB 5DCNA 2HJ8A 2K8CA 3H1UA 2PPHA 2HE7A 3LJ3A 4GDKB 3PREA 4GSWA 3QC8B 5DPWA 3RZFA 2XK5B 3A9JA 4BKTA 2G4DB 4AP4C 3ZNID 3AULA 3EFUA 3ONSA 3UIPB 3KUCB 3P2BA 4F1SA 2RSUA 4G11A 2MRPA 4EUTA 1K8RB 4IUMB 3RULA 2C9WB 4K1RB 3ZTDA 2GBRA 4OVUA 1OQYA 2OOBB 1IPGA 3L08A 3AXCA 5CHWA 3V6EB 3A1QB 4URKA 1WMHB 2NPTB 1C1YB 3ALBA 3VUWA 4FADA 3U8ZA 3PPAA 2ZPNA 4JL9A 4BBNC 3RT3B 2HD5B 3KW5B 2XEWA 3NHEB 4HK2A 4FHJA 2G4SA 3UQAA 3UQBA 4IM3A 1RFAA 3RZWC 2KQSA 2FUHB 2KDBA 3NY5A 3QWZB 4NQKE 1P0RA 2BWFA 3A33B 2KX3A 3CSTA 3DOWA 3OJ4B 3ZRCA 3SDLC 3W1SC 5IA7A 2REXA 1WGYA 5C23A 4FLHA 2EMSA 3KYCD 4LDTB 2N9XA 3PGEA 3DBHI 3RD2A 2VRRB 3N32A 5DPRA 4LCDE 1GC6A 2KFJA 2GOWA 2V1YA 2YLMA 2IO2B 2KFKB 1E8YA 2D2QA 4W9JA 5L83A 1UELA 3SD5A 5JH5C 3NZUA 4RM9A 2LWPA 1H4RA 2K6DB 2N9PC 2MP2A 2CHWA 3PRPB 1UBIA 4DK5A 4MGZE 2JF5A 4HJKA 4IG7B 5IAAC 2BKFA 1E7VA 1P9DU 5JHBA 2GBKA 1WXAA 4BBNF 5G55A 4AUQC 1G6JA 4GDLB 3DDCB 4W9IA 4K7SA 3WALA 2KTFA 1EO6A 4E74A 2KDEB 4F7ZA 2MBOA 3R66C 4MSQB 2ZVNA 1ZKHA 4BKSA 1WJ4A 4TKNA 2FCQA 3ZW3A 1V49A 2J7QB 3TBLD 2RPQA 3D32A 3ZNHB 3AI5A 5AZHA 4BOSC 2KJ6A 4LDTD 4WWOA 4GB9A 5C1ZA 2KQ7A 1OTRB 1V6EA 1XT9B 3ENEA 4FULA 4GU2A 4N9F4 2K8BA 2BYEA 3H7PB 5KHOA 4AOFA 4ZDVA 2ZCCA 1S3SG 1ZGUB 2KZRA 3KYDD 4YL8A 5D6JB 4W9LA 2FIDA 4ZRJA 5D94A 3JYUA 2JPHA 1WM2A 2L0TA 4TV3A 4A3OA 4IW0A 4MJSA 4TQ0A 5LXHA 4RMAA 4DHZB 1GG3A 4EZLA 4KZ0A 3VQIA 2LGYA 4GMVA 4ANVA 1WX8A 3EC8A 2DENB 1V80A 4DWFA 4MGYE 1TBEA 3U7DA 1WY8A 3PLVA 3ECIA 4FHKA 1R4MI 1U4AA 2JRIB 5FR6A 2YVCA 3L16A 1WJNA 4HLEA 1C3TA 2WDTB 1KJTA 3EHVA 2KLGA 3ZVVA 3I3TB 1EUVB 1P3QU 3WA0A 1TTNA 2JY6A 4NAWB 3VFKA 2EMTA 4GDKA 1WXVA 4HDQA 3ZUNA 2RGFA 1XD3B 3B08A 4W9HA 1AARA 2XK5A 3H6NA 1Y8RC 2V3SA 3L13A 3SHQA 5KHQA 4ZRIA 2KC2A 3HIZA 2KANA 3GOEA 2KD0A 3DBLI 4FJZA 2KVRA 4DHJD 2KWVB 1GUAB 3A4RA 3VTWA 3VAWA 3A1QA 1WMHA 2NPTA 3ML9A 4HVBA 3DCGA 3V6CB 2K39A 2DHZA 2FNJB 2K25A 2C60A 5DPTA 1WGRA 4B95A 3M95A 4GGQA 3OJ3A 2FCNA 4MGIE 1NDDA 2KWUB 4M8NA 2D11A 2ZZPB 3QQ8B 2Z0DB 1GC7A 2KX0A 2BWES 2JXXA 3VH3B 3OAWA 3WAOA 3DBRI 3R3MA 2FCMA 5CX3A 2C7HA 3PV1A 2KOXA 1NBFC 4P7IA 1YX6B 2NVUI 4WJQA 4G3XB 4EZKA 2KJHB 4PS7A 5J17A 1SIFA 2DZIA 3DQVA 4NY0A 2KFKA 1WZ3A 3L10B 3U30A 2CU1A 3HHMA 3UF8A 2FIFA 3TCAA 4W9DA 4TQ1A 4LJPB 3A4SC 2PE9A 4G0NB 3UGBB 2PE6B 2ZJDA 1WI0A 3QIJA 1H8CA 4NPNA 4KZCA 1F9JA 3VH4B 3HM6X 2DAJA 4DDGD 4GDLA 4IC7B 4XX5A 2N1WA 3AU5A 1YX5B 3KUZA 4JQWC 1YIWA 5E6OA 4AJYB 4CYEA 4MGKE 2MBEA 2KK8A 2LGXA 2L0FA 2DZKA 5CHVC 3V61A 2KLCA 3H9DA 2BPSA 1KOTA 2UYZB 2LUEA 4PYZA 4DHZE 2DYOA 1E90A 3TMPB 2L7RA 1RLFA 4JGHB 1WE7A 2DZJA 3H7PA 3K9OB 4HCNB 4MELA 2LVPA 1RRBA 3QA8A 1V81A 2MCNB 3M63B 4EZJA 2R2QA 2XBBC 2LVQA 1V5OA 2WX0A 1WR6E 2ZVOA 2J0JA 4A20A 2GBMA 1V9JA 1Z5SB 4M8MA 3VUXA 5JHAA 2CHZA 1E8XA 4WQOB 4II3B 4E3CA 1E7UA 2IO1B 4FA6A 3VTVA 3JVZX 1Q1OA 3N3KB 3MHSD 1WGHA 1UH6A 1V5TA 1RAXA 3W1SA 1IP9A 1WIAA 2L8JA 2LVOA 2Z0EB 1WXSA 4WWPA 3Q3FA 3QAQA 3RYTA 2D07B 4W9EA 4EOYA 1FXTB 4NJ7A 4HPMB 4WAAA 5AZFA 1YJ1A 4TUUA 4NNJB 1D3ZA 4A3PA 4MSMB 2IBIB 4K7WA 2G3QB 4KIKB 4NAWA 3QX1A 1OEYA 3ZDTA 4GOCA 1WX9A 1YD8U 1M94A 1QZEA 2IY0B 2M4NA 3PLUA 1WZ0A 4FJVB 2LJ5A 5CTRC 3JW0X 2JVCA 2WYQA 3WIMA 5L95C 2KMAA 4I6NB 3NOBA 3WAPA 4W9CA 3UINB 1WX7A 3R7QA 2DX5B 3APDA 5HKHA 2DZMA 2LI5A 4WJPA 1ISNA 4XZ4A 2JWZA 2JUOA 3QHTA 2A4ZA 1LM8B 2ASQA 1WJ6A 1JRUA 2MBHA 2MA9B 3L0WB 4I6PA 4AJWA 4KV2A 2KN5A 1YQBA 2KMCA 3DVNU 3HM3A 3B0AA 1J0GA 2J0MA 2DAFA 2EKEC 4AWJA 4LJOB 4K81A 1TGZB 2V4LA 5LLIA 1Q0WB 5E6NA 1SE9A 4FN2A 2KC1A 2N7DA 2NR2A 3VXWA 3ZLZA 1E5WA 1X1MA 3M3JA 3PT2B 4HDOA 3QCAA 1OEYJ 3RCZA 1WGGA 3DVGX 3KVFB 1LQBA 2KO3A 4ZYNA 2LRUA 1J19A 4HCPB 2C5LC 3CSFA 1I42A 2KDFB 3PVLA 2ZNVC 2Z59B 4CO7A 2IZVB 2I1KA 2WX1A 2K8HA 2DYBA 5AZGA 2GMIC 2ZEQA 1EF5A 2BKRB 3VUYA 2AWTA 4KDIC 2L76A 2BYFA 1WM3A 3JSVB 4ANWA 2IYDB 5AEKB 3PTFC 3IVFA 4HXDA 2O6VB 3L17A 3MTNB 3QARA 1KLVA 1P1AA 2KHWB 5E6PA 2N4FA 3IHPC 3TL5A 3ZO5B 4E71A 2M1MA 4W9GA 4WJOA 2FAZA 4OVVA 2W9NA 4MEMA 2KTRB 2LGDA 5D7GA 1PQSA 2RR9A 4FBJB 2AL3A 2MBQA 4BVUC 2O2VB 1SGHA 2L3ZA 2IO0B 2G45B 5J2RA 3BY4B 1ZW7A 3VDZA 5LXIB 4PYUA 2JT4B 4GXBA 4IM2A 3ZNGC 4XC2A 2Y5BB 1L7YA 1WYWB 1WXMA 3NZSA 2IO3B 2CS4A 4HWIB 4ICVA 2NCNA 3DVGY 3ZTCA 3DVNV 1HE8A 4ASWC 1LFDA 2N1VA 3APCA 1P98A 1I35A 4FJYA 4RM8A 3A9KB 3O65B 2NBVB 2O6VD 5J18A 3ZRFA 4J6IA 5CHFA 3WANA 4PS3A 1WE6A 2LZ6A 1KM7A 1R4NI 2MBBB 1GNUA 2NBWB 4B6WA 4EKUA 2WWZA 2M8SA 2LXCA 2NS5A 4IM0A 5G2NA 1J8CA 1CMXB 1XQQA 3HK0A 4KIKA 4K7UA 3CMMB 3K9PB 2ZCBA 4W9KA 2LRWA 2ZNVB 3LDZE 2C7MB 3KH0A 4X57B 3ZNZB 4BOZB 3A9JB 2KXJA 2CR5A 2IY1B 1VCBA 1LXDA 2R2OA 3IBEA 4MH0E 3ZKJC 2PEAA 1UBQA 3QJZA 1WJUA 2KNBA 5TR5A 3VVWB 4F8CB 4ICUA 4MM3A 2A5UA 3EECA 1A5RA 2MQJA 2OJRA 1V86A 1UD7A 2LASA 3ZIMA 4EEWA 3L54A 3BINA 3IG3A 1T0YA 2HTHA 3Q3JA 3QK0A 4G50A 1E8ZA 3S2AA 3X23A 2B3AA 5BO4B 3N30A 4B9KA 2ZPYA 4DBGA 2I1JA 3MJWA 2UWQA 2K6QA 3ZDMC 2JZ3B 4DHJB 3VHTC 2DYMA 5EDSA 4JLCA 3PS6A 4MDKE 4ZRKA 4M0WB 3R7RA 3CF6E 4PS8A 1MG8A 3V62A 1GJZA 4KDLB 4DDID 5JZEB 2LXAA 3VTUA 1Q5WB 1OGWA 1TZ1A 2JRHA 2LD9A 3M62B 4JIOU 4WWNA 4ANUA 3UIOB 4NJ6A 2M0XA 3B1LX 3PRMB 4KSLC 4DXAB 2FCSA 2D3GA 2N7EA 2MP2B 4ANXA 4BFRA 2CHXA 1VD2A 2C7NB 4GIVA 4NQLB 2GBNA 2MLBA 2GBJA 3RUIB 3V60A 1WR1A 1BT0A 3X0WA 3ML8A 3JSVA 4HPLB 3GZNI 3PHWB 2KWCA 5GMVA 2NBUA 4KSKC 2O6VA 2CKHB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3IFW B;  1UZX B;  2AL6 A;  3KUD B;  2MX2 A;  3T9L A;  1V2Y A;  2K1F A;  2AEH A;  4IWP A;  1E8W A;  2BYV E;  2QHO A;  3PHX B;  4IWQ A;  3DBS A;  4GN1 A;  3C0R B;  2L05 A;  2KTR A;  4W9F A;  2BF8 B;  3AU4 A;  1WH3 A;  2N9E B;  4KVG B;  3H7S A;  2D10 A;  2O2V A;  3APF A;  2AYO B;  1WF9 A;  2L00 B;  4CHK A;  2RD0 A;  2BGF A;  1NI2 A;  2PJH A;  2JZZ A;  2MW5 A;  4MJS B;  1UGM A;  1WRD B;  3WAM A;  2M17 A;  1WFY A;  1Z2M A;  1S1Q B;  3PRZ A;  4II2 B;  4WJN A;  3W1Y A;  1IYF A;  5D2M B;  2MWS B;  5DPS A;  2J0K A;  3A9K A;  3PZD A;  3DPD A;  4IWO A;  3T8M A;  3NS8 A;  1WGD A;  2MSE D;  4BKG A;  4I6L B;  3TJP A;  4BKS D;  3OLM D;  2KKC A;  3SU8 X;  2KJR A;  2KDI A;  1EF1 A;  4EFO A;  3TIX A;  1L2N A;  3PSE B;  5DCN A;  2HJ8 A;  2K8C A;  3H1U A;  2PPH A;  2HE7 A;  3LJ3 A;  4GDK B;  3PRE A;  4GSW A;  3QC8 B;  5DPW A;  3RZF A;  2XK5 B;  3A9J A;  4BKT A;  2G4D B;  4AP4 C;  3ZNI D;  3AUL A;  3EFU A;  3ONS A;  3UIP B;  3KUC B;  3P2B A;  4F1S A;  2RSU A;  4G11 A;  2MRP A;  4EUT A;  1K8R B;  4IUM B;  3RUL A;  2C9W B;  4K1R B;  3ZTD A;  2GBR A;  4OVU A;  1OQY A;  2OOB B;  1IPG A;  3L08 A;  3AXC A;  5CHW A;  3V6E B;  3A1Q B;  4URK A;  1WMH B;  2NPT B;  1C1Y B;  3ALB A;  3VUW A;  4FAD A;  3U8Z A;  3PPA A;  2ZPN A;  4JL9 A;  4BBN C;  3RT3 B;  2HD5 B;  3KW5 B;  2XEW A;  3NHE B;  4HK2 A;  4FHJ A;  2G4S A;  3UQA A;  3UQB A;  4IM3 A;  1RFA A;  3RZW C;  2KQS A;  2FUH B;  2KDB A;  3NY5 A;  3QWZ B;  4NQK E;  1P0R A;  2BWF A;  3A33 B;  2KX3 A;  3CST A;  3DOW A;  3OJ4 B;  3ZRC A;  3SDL C;  3W1S C;  5IA7 A;  2REX A;  1WGY A;  5C23 A;  4FLH A;  2EMS A;  3KYC D;  4LDT B;  2N9X A;  3PGE A;  3DBH I;  3RD2 A;  2VRR B;  3N32 A;  5DPR A;  4LCD E;  1GC6 A;  2KFJ A;  2GOW A;  2V1Y A;  2YLM A;  2IO2 B;  2KFK B;  1E8Y A;  2D2Q A;  4W9J A;  5L83 A;  1UEL A;  3SD5 A;  5JH5 C;  3NZU A;  4RM9 A;  2LWP A;  1H4R A;  2K6D B;  2N9P C;  2MP2 A;  2CHW A;  3PRP B;  1UBI A;  4DK5 A;  4MGZ E;  2JF5 A;  4HJK A;  4IG7 B;  5IAA C;  2BKF A;  1E7V A;  1P9D U;  5JHB A;  2GBK A;  1WXA A;  4BBN F;  5G55 A;  4AUQ C;  1G6J A;  4GDL B;  3DDC B;  4W9I A;  4K7S A;  3WAL A;  2KTF A;  1EO6 A;  4E74 A;  2KDE B;  4F7Z A;  2MBO A;  3R66 C;  4MSQ B;  2ZVN A;  1ZKH A;  4BKS A;  1WJ4 A;  4TKN A;  2FCQ A;  3ZW3 A;  1V49 A;  2J7Q B;  3TBL D;  2RPQ A;  3D32 A;  3ZNH B;  3AI5 A;  5AZH A;  4BOS C;  2KJ6 A;  4LDT D;  4WWO A;  4GB9 A;  5C1Z A;  2KQ7 A;  1OTR B;  1V6E A;  1XT9 B;  3ENE A;  4FUL A;  4GU2 A;  4N9F 4;  2K8B A;  2BYE A;  3H7P B;  5KHO A;  4AOF A;  4ZDV A;  2ZCC A;  1S3S G;  1ZGU B;  2KZR A;  3KYD D;  4YL8 A;  5D6J B;  4W9L A;  2FID A;  4ZRJ A;  5D94 A;  3JYU A;  2JPH A;  1WM2 A;  2L0T A;  4TV3 A;  4A3O A;  4IW0 A;  4MJS A;  4TQ0 A;  5LXH A;  4RMA A;  4DHZ B;  1GG3 A;  4EZL A;  4KZ0 A;  3VQI A;  2LGY A;  4GMV A;  4ANV A;  1WX8 A;  3EC8 A;  2DEN B;  1V80 A;  4DWF A;  4MGY E;  1TBE A;  3U7D A;  1WY8 A;  3PLV A;  3ECI A;  4FHK A;  1R4M I;  1U4A A;  2JRI B;  5FR6 A;  2YVC A;  3L16 A;  1WJN A;  4HLE A;  1C3T A;  2WDT B;  1KJT A;  3EHV A;  2KLG A;  3ZVV A;  3I3T B;  1EUV B;  1P3Q U;  3WA0 A;  1TTN A;  2JY6 A;  4NAW B;  3VFK A;  2EMT A;  4GDK A;  1WXV A;  4HDQ A;  3ZUN A;  2RGF A;  1XD3 B;  3B08 A;  4W9H A;  1AAR A;  2XK5 A;  3H6N A;  1Y8R C;  2V3S A;  3L13 A;  3SHQ A;  5KHQ A;  4ZRI A;  2KC2 A;  3HIZ A;  2KAN A;  3GOE A;  2KD0 A;  3DBL I;  4FJZ A;  2KVR A;  4DHJ D;  2KWV B;  1GUA B;  3A4R A;  3VTW A;  3VAW A;  3A1Q A;  1WMH A;  2NPT A;  3ML9 A;  4HVB A;  3DCG A;  3V6C B;  2K39 A;  2DHZ A;  2FNJ B;  2K25 A;  2C60 A;  5DPT A;  1WGR A;  4B95 A;  3M95 A;  4GGQ A;  3OJ3 A;  2FCN A;  4MGI E;  1NDD A;  2KWU B;  4M8N A;  2D11 A;  2ZZP B;  3QQ8 B;  2Z0D B;  1GC7 A;  2KX0 A;  2BWE S;  2JXX A;  3VH3 B;  3OAW A;  3WAO A;  3DBR I;  3R3M A;  2FCM A;  5CX3 A;  2C7H A;  3PV1 A;  2KOX A;  1NBF C;  4P7I A;  1YX6 B;  2NVU I;  4WJQ A;  4G3X B;  4EZK A;  2KJH B;  4PS7 A;  5J17 A;  1SIF A;  2DZI A;  3DQV A;  4NY0 A;  2KFK A;  1WZ3 A;  3L10 B;  3U30 A;  2CU1 A;  3HHM A;  3UF8 A;  2FIF A;  3TCA A;  4W9D A;  4TQ1 A;  4LJP B;  3A4S C;  2PE9 A;  4G0N B;  3UGB B;  2PE6 B;  2ZJD A;  1WI0 A;  3QIJ A;  1H8C A;  4NPN A;  4KZC A;  1F9J A;  3VH4 B;  3HM6 X;  2DAJ A;  4DDG D;  4GDL A;  4IC7 B;  4XX5 A;  2N1W A;  3AU5 A;  1YX5 B;  3KUZ A;  4JQW C;  1YIW A;  5E6O A;  4AJY B;  4CYE A;  4MGK E;  2MBE A;  2KK8 A;  2LGX A;  2L0F A;  2DZK A;  5CHV C;  3V61 A;  2KLC A;  3H9D A;  2BPS A;  1KOT A;  2UYZ B;  2LUE A;  4PYZ A;  4DHZ E;  2DYO A;  1E90 A;  3TMP B;  2L7R A;  1RLF A;  4JGH B;  1WE7 A;  2DZJ A;  3H7P A;  3K9O B;  4HCN B;  4MEL A;  2LVP A;  1RRB A;  3QA8 A;  1V81 A;  2MCN B;  3M63 B;  4EZJ A;  2R2Q A;  2XBB C;  2LVQ A;  1V5O A;  2WX0 A;  1WR6 E;  2ZVO A;  2J0J A;  4A20 A;  2GBM A;  1V9J A;  1Z5S B;  4M8M A;  3VUX A;  5JHA A;  2CHZ A;  1E8X A;  4WQO B;  4II3 B;  4E3C A;  1E7U A;  2IO1 B;  4FA6 A;  3VTV A;  3JVZ X;  1Q1O A;  3N3K B;  3MHS D;  1WGH A;  1UH6 A;  1V5T A;  1RAX A;  3W1S A;  1IP9 A;  1WIA A;  2L8J A;  2LVO A;  2Z0E B;  1WXS A;  4WWP A;  3Q3F A;  3QAQ A;  3RYT A;  2D07 B;  4W9E A;  4EOY A;  1FXT B;  4NJ7 A;  4HPM B;  4WAA A;  5AZF A;  1YJ1 A;  4TUU A;  4NNJ B;  1D3Z A;  4A3P A;  4MSM B;  2IBI B;  4K7W A;  2G3Q B;  4KIK B;  4NAW A;  3QX1 A;  1OEY A;  3ZDT A;  4GOC A;  1WX9 A;  1YD8 U;  1M94 A;  1QZE A;  2IY0 B;  2M4N A;  3PLU A;  1WZ0 A;  4FJV B;  2LJ5 A;  5CTR C;  3JW0 X;  2JVC A;  2WYQ A;  3WIM A;  5L95 C;  2KMA A;  4I6N B;  3NOB A;  3WAP A;  4W9C A;  3UIN B;  1WX7 A;  3R7Q A;  2DX5 B;  3APD A;  5HKH A;  2DZM A;  2LI5 A;  4WJP A;  1ISN A;  4XZ4 A;  2JWZ A;  2JUO A;  3QHT A;  2A4Z A;  1LM8 B;  2ASQ A;  1WJ6 A;  1JRU A;  2MBH A;  2MA9 B;  3L0W B;  4I6P A;  4AJW A;  4KV2 A;  2KN5 A;  1YQB A;  2KMC A;  3DVN U;  3HM3 A;  3B0A A;  1J0G A;  2J0M A;  2DAF A;  2EKE C;  4AWJ A;  4LJO B;  4K81 A;  1TGZ B;  2V4L A;  5LLI A;  1Q0W B;  5E6N A;  1SE9 A;  4FN2 A;  2KC1 A;  2N7D A;  2NR2 A;  3VXW A;  3ZLZ A;  1E5W A;  1X1M A;  3M3J A;  3PT2 B;  4HDO A;  3QCA A;  1OEY J;  3RCZ A;  1WGG A;  3DVG X;  3KVF B;  1LQB A;  2KO3 A;  4ZYN A;  2LRU A;  1J19 A;  4HCP B;  2C5L C;  3CSF A;  1I42 A;  2KDF B;  3PVL A;  2ZNV C;  2Z59 B;  4CO7 A;  2IZV B;  2I1K A;  2WX1 A;  2K8H A;  2DYB A;  5AZG A;  2GMI C;  2ZEQ A;  1EF5 A;  2BKR B;  3VUY A;  2AWT A;  4KDI C;  2L76 A;  2BYF A;  1WM3 A;  3JSV B;  4ANW A;  2IYD B;  5AEK B;  3PTF C;  3IVF A;  4HXD A;  2O6V B;  3L17 A;  3MTN B;  3QAR A;  1KLV A;  1P1A A;  2KHW B;  5E6P A;  2N4F A;  3IHP C;  3TL5 A;  3ZO5 B;  4E71 A;  2M1M A;  4W9G A;  4WJO A;  2FAZ A;  4OVV A;  2W9N A;  4MEM A;  2KTR B;  2LGD A;  5D7G A;  1PQS A;  2RR9 A;  4FBJ B;  2AL3 A;  2MBQ A;  4BVU C;  2O2V B;  1SGH A;  2L3Z A;  2IO0 B;  2G45 B;  5J2R A;  3BY4 B;  1ZW7 A;  3VDZ A;  5LXI B;  4PYU A;  2JT4 B;  4GXB A;  4IM2 A;  3ZNG C;  4XC2 A;  2Y5B B;  1L7Y A;  1WYW B;  1WXM A;  3NZS A;  2IO3 B;  2CS4 A;  4HWI B;  4ICV A;  2NCN A;  3DVG Y;  3ZTC A;  3DVN V;  1HE8 A;  4ASW C;  1LFD A;  2N1V A;  3APC A;  1P98 A;  1I35 A;  4FJY A;  4RM8 A;  3A9K B;  3O65 B;  2NBV B;  2O6V D;  5J18 A;  3ZRF A;  4J6I A;  5CHF A;  3WAN A;  4PS3 A;  1WE6 A;  2LZ6 A;  1KM7 A;  1R4N I;  2MBB B;  1GNU A;  2NBW B;  4B6W A;  4EKU A;  2WWZ A;  2M8S A;  2LXC A;  2NS5 A;  4IM0 A;  5G2N A;  1J8C A;  1CMX B;  1XQQ A;  3HK0 A;  4KIK A;  4K7U A;  3CMM B;  3K9P B;  2ZCB A;  4W9K A;  2LRW A;  2ZNV B;  3LDZ E;  2C7M B;  3KH0 A;  4X57 B;  3ZNZ B;  4BOZ B;  3A9J B;  2KXJ A;  2CR5 A;  2IY1 B;  1VCB A;  1LXD A;  2R2O A;  3IBE A;  4MH0 E;  3ZKJ C;  2PEA A;  1UBQ A;  3QJZ A;  1WJU A;  2KNB A;  5TR5 A;  3VVW B;  4F8C B;  4ICU A;  4MM3 A;  2A5U A;  3EEC A;  1A5R A;  2MQJ A;  2OJR A;  1V86 A;  1UD7 A;  2LAS A;  3ZIM A;  4EEW A;  3L54 A;  3BIN A;  3IG3 A;  1T0Y A;  2HTH A;  3Q3J A;  3QK0 A;  4G50 A;  1E8Z A;  3S2A A;  3X23 A;  2B3A A;  5BO4 B;  3N30 A;  4B9K A;  2ZPY A;  4DBG A;  2I1J A;  3MJW A;  2UWQ A;  2K6Q A;  3ZDM C;  2JZ3 B;  4DHJ B;  3VHT C;  2DYM A;  5EDS A;  4JLC A;  3PS6 A;  4MDK E;  4ZRK A;  4M0W B;  3R7R A;  3CF6 E;  4PS8 A;  1MG8 A;  3V62 A;  1GJZ A;  4KDL B;  4DDI D;  5JZE B;  2LXA A;  3VTU A;  1Q5W B;  1OGW A;  1TZ1 A;  2JRH A;  2LD9 A;  3M62 B;  4JIO U;  4WWN A;  4ANU A;  3UIO B;  4NJ6 A;  2M0X A;  3B1L X;  3PRM B;  4KSL C;  4DXA B;  2FCS A;  2D3G A;  2N7E A;  2MP2 B;  4ANX A;  4BFR A;  2CHX A;  1VD2 A;  2C7N B;  4GIV A;  4NQL B;  2GBN A;  2MLB A;  2GBJ A;  3RUI B;  3V60 A;  1WR1 A;  1BT0 A;  3X0W A;  3ML8 A;  3JSV A;  4HPL B;  3GZN I;  3PHW B;  2KWC A;  5GMV A;  2NBU A;  4KSK C;  2O6V A;  2CKH B; 
#chains in the Genus database with same CATH topology
 3KUD B;  2YEP F;  2QHO A;  1CQV A;  3BZD B;  3AE7 B;  4IWQ A;  3DBS A;  1K53 A;  4GN1 A;  2BF8 B;  3H7S A;  2D10 A;  2O2V A;  5BMI A;  3ZJT A;  2MW5 A;  3DHH C;  4MJS B;  1GOZ A;  3IXS A;  3PZ7 A;  3I63 C;  2SAK A;  2YEP B;  1V1P A;  2JX5 A;  4DQO C;  3T8M A;  3I57 A;  3TJP A;  1LGR A;  2KJR A;  2KDI A;  1ESF A;  4OZB A;  1OQQ A;  3TIX A;  3PSE B;  1ZPS A;  3N1Y C;  2HE7 A;  3LJ3 A;  3I5J C;  3PRE A;  2I38 A;  1V1O A;  3BK1 A;  3RZF A;  1R4N B;  1HQR D;  1SXT A;  3ONS A;  3KUC B;  1VZ6 A;  2RSU A;  1SIJ A;  5TSS A;  2W3S A;  1K8R B;  4IUM B;  4LK0 M;  4AS1 A;  1OQY A;  3V6E B;  3AXC A;  3MHZ A;  1C1Y B;  3VUW A;  1Y56 A;  2HDE A;  2HD5 B;  2M56 B;  1I4H A;  3OJ4 B;  3DOW A;  3SDL C;  5IA7 A;  3LB8 C;  1ACC A;  3BWU D;  2J52 A;  4LCD E;  1GC6 A;  1JWS D;  2IO2 B;  2ONQ A;  2KFK B;  5L83 A;  3SD5 A;  5JH5 C;  3NZU A;  2K6D B;  2CHW A;  5IN7 A;  3Q8B A;  1E7V A;  5EE0 A;  1T0R C;  5G55 A;  4AUQ C;  4ITK A;  3URY A;  4YXD B;  3WAL A;  1EO6 A;  3R66 C;  2ZVN A;  4WUR A;  1E0Z A;  3ZW3 A;  1EWY C;  2J7Q B;  2INP E;  3BK2 A;  3TBL D;  3AI5 A;  3HUI A;  4BOS C;  2KJ6 A;  3MC8 A;  1V6E A;  1XT9 B;  5KHO A;  2K8B A;  4ZDV A;  2ZCC A;  2FID A;  4A3O A;  4MJS A;  4TQ0 A;  5LXH A;  3FC4 A;  1GG3 A;  1FCL A;  3VRA B;  1WX8 A;  4DWF A;  4FHK A;  3ECI A;  2LEK A;  2HJ1 A;  3L16 A;  3AN1 A;  2KLG A;  4NAW B;  3P1M A;  3P42 A;  3ZUN A;  3W2D A;  1XD3 B;  3B08 A;  1UF0 A;  5KHQ A;  2KAN A;  3GOE A;  1T3Q A;  3H8H A;  3DBL I;  2VZK B;  2BT6 A;  2NMQ A;  4HVB A;  4LNN A;  3DCG A;  5FKA C;  1UNS A;  4KGS A;  5DPT A;  3AE6 B;  4US8 A;  4YTN B;  2N0S B;  1QKZ A;  1NDD A;  3QQ8 B;  1GC7 A;  2KX0 A;  1XLQ A;  2ON8 A;  5CX3 A;  1NBF C;  2NVU I;  4WJQ A;  5J17 A;  2DZI A;  2BS4 B;  2KFK A;  1WZ3 A;  3NZ3 A;  3TEY A;  2VZK D;  2FIF A;  3UF8 A;  3TCA A;  4TQ1 A;  4LJP B;  3A4S C;  2PE9 A;  2N9K A;  4G0N B;  5BMH A;  2IND C;  2ZJD A;  3QIJ A;  1F9J A;  1ZDX A;  3B2F A;  4KGT A;  3KUZ A;  5H92 C;  5E6O A;  1UUP A;  1EWC A;  4A8X C;  4CYE A;  2BYT A;  3L4P A;  2MBE A;  2WGS A;  2KK8 A;  2LGX A;  2MJE A;  3AE8 B;  2BPS A;  2UYZ B;  1MHH E;  1RLF A;  4JGH B;  4HCN B;  3B9J A;  1RRB A;  2J53 A;  2LVQ A;  3J9C A;  2J0J A;  1Z5S B;  4P1C C;  2CHZ A;  3KWV A;  4II3 B;  3VTV A;  2FBW B;  1C4C A;  2D07 B;  3Q8A A;  3RNB C;  2MHJ A;  1IBX B;  1D3Z A;  2V9H A;  4B0M A;  1F2R C;  2IBI B;  4K7W A;  1WWT A;  4NAW A;  1PGB A;  4MAC A;  3ZDT A;  4ARC A;  2BS3 B;  4M00 A;  1YD8 U;  2IY0 B;  3WIM A;  1WZ0 A;  2H88 B;  3SFE B;  2WQY B;  4I6N B;  2WXP A;  4OVZ A;  4W9C A;  1V97 A;  2LI5 A;  1ISN A;  1IGD A;  2JUO A;  2JWZ A;  1KFY B;  1WJ6 A;  2MBH A;  2MA9 B;  4YSZ B;  4KV2 A;  3FIL B;  4RGT A;  3TEZ A;  1I4R A;  2KMC A;  3Q8C A;  4O1N A;  4HPP A;  3B0A A;  2K0P A;  4YTP B;  2WXQ A;  2J0M A;  1TKE A;  3NG0 A;  1PDX A;  3GP7 A;  1TGZ B;  4FN2 A;  2KC1 A;  2N7D A;  3ZLZ A;  2H89 B;  2I2Y A;  3QCA A;  3RCZ A;  1WGG A;  2LRU A;  3HVZ A;  5HG2 A;  4CO7 A;  3DWM A;  2DYB A;  5AZG A;  3AEC B;  1J7B A;  2B76 B;  4ZRQ A;  3AED B;  1EF5 A;  2BKR B;  3AE5 B;  2AWT A;  1TT5 B;  1WM3 A;  2PTL A;  1E7P B;  2KN4 A;  2O6V B;  1KLV A;  2HTM E;  4C56 C;  4E71 A;  3ZO5 B;  2M1M A;  4RFB A;  4WJO A;  2FAZ A;  3EUB 2;  2W9N A;  2KTR B;  4L1B A;  4ARI A;  2AL3 A;  4BVU C;  1SGH A;  1F2R I;  5J2R A;  4MT5 A;  4LNK A;  2E3T A;  1SE2 A;  2Q5W D;  3RNE C;  4XC2 A;  1JAL A;  2W82 A;  3NZS A;  2CS4 A;  4A9A A;  3ZTC A;  1NYR A;  2WLB A;  2N1V A;  1I35 A;  3NVY A;  3N20 C;  2CJO A;  2O6V D;  5J18 A;  1FPY A;  1TS5 A;  3KLS X;  2GLS A;  1QIL A;  1P7F A;  4B6W A;  1IBX A;  5BYR A;  2G1E A;  4IM0 A;  5G2N A;  3RNC C;  4RNA A;  1CMX B;  1XQQ A;  1M4V A;  3OG5 A;  3ZNZ B;  3A9J B;  3AMZ A;  3C19 A;  5LNK 1;  2PEA A;  4F8C B;  2KVZ A;  2RDG A;  5D3I B;  3BVZ A;  3ZIM A;  1B9R A;  3L54 A;  3SFD B;  1FEH A;  3QK0 A;  1E8Z A;  5BO4 B;  1MFW A;  2ZPY A;  4DBG A;  2I1J A;  2UWQ A;  3FIL A;  1NVI D;  2K6Q A;  3ZDM C;  4DHJ B;  2DYM A;  3IAM 1;  4JLC A;  1I4Q A;  4M0W B;  2BB6 A;  4DDI D;  5JZE B;  4A55 A;  1TZ1 A;  4NJC A;  1N5X A;  1JWU D;  4NJ6 A;  1FRR A;  3B1L X;  2WXL A;  1CZP A;  2AQ3 B;  3PO0 A;  4ANX A;  4BFR A;  4XWW A;  2C7N B;  3BVG A;  2GBJ A;  1WR1 A;  1BT0 A;  5GMV A;  4DHJ D;  2O6V A;  2CKH B;  1UZX B;  2WXG A;  1JWA D;  1V2Y A;  2K1F A;  2ZW0 A;  3PHX B;  2PKO A;  3C0R B;  2KTR A;  3AU4 A;  2N9E B;  4KVG B;  2KAJ A;  1WF9 A;  2WS3 B;  2BGF A;  2TSS A;  1NI2 A;  2JZZ A;  1QT9 A;  4DXG A;  1UGM A;  1WRD B;  4C7Z A;  1C76 A;  1Z2M A;  4II2 B;  4WJN A;  1P7E A;  2MWS B;  4LNF A;  3PZD A;  3DPD A;  3P4R B;  4BKG A;  4I6L B;  2KKC A;  3SU8 X;  4EFO A;  4WQM A;  5DCN A;  1XCQ L;  4OZA A;  4RF0 A;  2K8C A;  3RN9 C;  2PPH A;  3QC8 B;  2WXO A;  2PW9 A;  2WXN A;  3V3X A;  1ROE A;  1TS2 A;  5DPW A;  3A9J A;  4BKT A;  3AUL A;  4IOI E;  4G11 A;  3AE4 B;  4EUT A;  2QEJ C;  4N59 A;  3RUL A;  5CHW A;  4URK A;  3NUH B;  3A1Q B;  1WMH B;  4B0E A;  1ZE3 D;  2XEW A;  1VLB A;  4FHJ A;  2G4S A;  4ZYS A;  4IM3 A;  4USA A;  3RZW C;  3V05 A;  2KQS A;  4NZL B;  2FUH B;  4NQK E;  4M0W A;  1KTK A;  2Y3A A;  1WGY A;  4FLH A;  4ZRP A;  4C80 A;  2EMS A;  3KYC D;  1L4D B;  2GB1 A;  2W3R A;  2N9X A;  3Q3N C;  2D2Q A;  2V0G A;  1PYW D;  2K3U A;  4RM9 A;  1JWB D;  5JHB A;  1WXA A;  4GDL B;  3DDC B;  4K7S A;  2KDE B;  1JW9 D;  4P16 A;  1HEZ E;  2RPQ A;  3ZNH B;  5AZH A;  3Q14 C;  1HZ6 A;  2LHE A;  5C1Z A;  1ET6 A;  1OTR B;  4N9F 4;  4GU2 A;  2INN E;  1S3S G;  2KZR A;  3KYD D;  4YL8 A;  3W5V B;  3BVM A;  1UWM A;  4W9L A;  5D6J B;  1BXT A;  3JYU A;  5D94 A;  4D2K A;  4IW0 A;  2VH1 A;  1ENF A;  2LGY A;  3MP9 A;  4ANV A;  4WH4 A;  2BW2 A;  1FIQ A;  2NTT A;  3U7D A;  3PLV A;  4ZHO A;  1L5P A;  2JRI B;  2YVC A;  1OFF A;  4C7Y A;  2WDV B;  2WDT B;  1XCT L;  2RMM A;  2PIA A;  4HDQ A;  4W9H A;  3GE3 C;  3H6N A;  1VZ7 A;  4KGR A;  3HIZ A;  2KD0 A;  4FJZ A;  3VAW A;  3A1Q A;  1WMH A;  3V6C B;  2J42 A;  1FXI A;  2JU6 X;  2OED A;  1TY0 A;  2X8X X;  4B95 A;  4GGQ A;  1E9M A;  2FCN A;  1NEN B;  2KWU B;  2D11 A;  2ZZP B;  3DHG C;  2Z0D B;  2BWE S;  3VH3 B;  1F0Z A;  1L0Y B;  2KOX A;  2QIL A;  1YX6 B;  1K50 A;  4G3X B;  4OZC A;  1SIF A;  2V3P A;  4NY0 A;  3HHM A;  1WI0 A;  3TUO A;  1VDV A;  4NPN A;  3N1X C;  4Q2J A;  4DDG D;  4GDL A;  5T8I A;  1AYF A;  1FFV A;  1NI3 A;  3GB1 A;  3VR8 B;  4JQW C;  2L0F A;  2DZK A;  3KWL A;  5CHV C;  3V61 A;  3GS2 A;  1DOX A;  1KOT A;  3AEB B;  1SBB B;  2DYO A;  1E90 A;  1WE7 A;  2DZJ A;  2LVP A;  3QA8 A;  2K5P A;  1TZO A;  2R2Q A;  1V5O A;  2WU2 B;  1V9J A;  3VUX A;  4BAX A;  2LFI A;  1XXG A;  4FA6 A;  1C4A A;  2UU7 A;  1UH6 A;  1RAX A;  2LVO A;  2DBY A;  4TSS A;  4WWP A;  1FXT B;  4YSY B;  4HPM B;  5AZF A;  1YJ1 A;  4XGA B;  2WXI A;  4PT5 A;  2MJ3 A;  5JXV A;  1UGJ A;  3JW0 X;  2JVC A;  1N6Z A;  1WYG A;  3RMK C;  2FE8 A;  5IOI A;  4XYC A;  5HKH A;  1QOF A;  4XZ4 A;  1FNU A;  1LM8 B;  2ASQ A;  1F52 A;  3TEX A;  3DBL B;  1EU3 A;  5G5G A;  3DHI C;  1YQB A;  3DVN U;  2LUM A;  1VR9 A;  2D3A A;  4HJG E;  3Q6B A;  2WU5 B;  3NJT A;  3VXW A;  2D3C A;  1X1M A;  3PT2 B;  4HDO A;  3B2G A;  3DVG X;  3KVF B;  2KO3 A;  1A70 A;  1RYJ A;  2ZNV C;  3PVL A;  2W55 A;  4IDI A;  3P4P B;  1B1Z A;  1ET9 A;  3T3N A;  2BYF A;  3JSV B;  4ANW A;  3IVF A;  1L6V A;  4EE2 A;  4HKZ E;  2N4F A;  5HHD G;  3RNA C;  2KYW A;  4MEM A;  2LGD A;  4FBJ B;  2MBQ A;  2L3Z A;  5LXI B;  3ZNG C;  1I7H A;  2Y5B B;  2WXR A;  1WYW B;  1WXM A;  4ICV A;  4HWI B;  3DVN V;  3FKY A;  3SR6 A;  3APC A;  1VZ8 A;  1P98 A;  1YOV B;  1TKG A;  2JQR B;  3A9K B;  4PK1 A;  2NBV B;  3ZRF A;  4J6I A;  5CHF A;  3NVZ A;  2ICI A;  5EE3 A;  2MBB B;  1GNU A;  2NBW B;  4CQN A;  2BS2 B;  1F77 A;  5BYQ A;  3TEW A;  2LXC A;  2NS5 A;  2WNM A;  5IP4 D;  2ZNV B;  4N58 A;  2C7M B;  4X57 B;  2D5G A;  1YNT E;  2KXJ A;  2R2O A;  1WJU A;  5I4D A;  5C2T B;  4KX6 B;  4ICU A;  1A5R A;  2LAS A;  4LNO A;  3BIN A;  1C78 A;  3DWG C;  1MPE A;  3Q3J A;  1PUT A;  1KLG D;  2WXJ A;  4AQ7 A;  1N61 A;  3MJW A;  4XE0 A;  3ZGZ A;  1TS3 A;  5EDS A;  4MDK E;  3PS6 A;  4ZRK A;  1XLP A;  1I4P A;  1MG8 A;  2LXA A;  3FAH A;  1OGW A;  3M62 B;  1YN5 A;  1D6E C;  4WWN A;  1N62 A;  2M0X A;  1LO5 D;  4KSL C;  2FCS A;  2D3G A;  4LLG M;  2WDQ B;  2CHX A;  2E6X A;  4N6E B;  2GBN A;  2MLB A;  4ZOH C;  5D3D A;  3ML8 A;  3JSV A;  4J3O D;  3PHW B;  2KWC A;  4KSK C;  3IFW B;  2AL6 A;  1XO3 A;  4A6Q A;  2M19 A;  2AEH A;  3C8Y A;  2L05 A;  3LXF A;  2WXK A;  2AYO B;  3CWI A;  4YT0 B;  2RD0 A;  2PJH A;  1FCC C;  3WAM A;  3AE1 B;  2M17 A;  3TSS A;  5BMG A;  2DLB A;  1S1Q B;  3W1Y A;  1IYF A;  5D2M B;  5DPS A;  2ZW1 A;  3A9K A;  2OJW A;  3ZYY X;  3NS8 A;  1YJJ A;  1D4B A;  2D3B A;  1L2N A;  3Q8E A;  2WXM A;  3H1U A;  2IGD A;  1GB4 A;  2LHD A;  4S17 A;  4GSW A;  2WXF A;  1ZP0 B;  4M01 A;  2Z8L A;  4HEA 1;  4RGN A;  2G4D B;  4AP4 C;  2QIE B;  1YQ4 B;  4K1R B;  2GBR A;  5EE1 A;  1IPG A;  2V3N A;  3L08 A;  1EU4 A;  2NPT B;  5IKC M;  3ZXV A;  3DBH B;  3EA6 A;  3I9V 1;  4XDD A;  3KW5 B;  4HK2 A;  3UQB A;  2JYE A;  2PVG C;  3NY5 A;  1P0R A;  2BWF A;  3ZRC A;  3CST A;  3AH7 A;  1HZ5 A;  2RPV A;  1FO4 A;  4LDT B;  3PGE A;  3DBH I;  2VRR B;  4C4V B;  2WP9 B;  3N32 A;  2KFJ A;  2V1Y A;  2EEL A;  4W9J A;  3ZXR A;  3P4S B;  2N9P C;  3PRP B;  1L6U A;  1DOY A;  4JWS C;  4MGZ E;  4IG7 B;  1GB1 A;  1QOA A;  2EKI A;  2KTF A;  4E74 A;  4MSQ B;  1ZKH A;  4TKN A;  1XLO A;  2FUG 1;  3D32 A;  3VRB B;  2N9L A;  3ZJU A;  4LDT D;  1JML A;  4GB9 A;  2CJN A;  4WWM A;  4A3P A;  3MC9 A;  4FUL A;  3H7P B;  4LTU A;  1ZGU B;  3RT3 B;  4TV3 A;  1JWM D;  2JPH A;  4JX1 C;  4RMA A;  4EZL A;  3P63 A;  2V4I B;  1GAQ B;  1UWX A;  2DEN B;  3AE2 B;  1WY8 A;  1U4A A;  1SE4 A;  1C3T A;  1WJN A;  1MVK A;  1YN3 A;  1KJT A;  3ZVV A;  3I3T B;  3WA0 A;  1TTN A;  2JY6 A;  5HI1 A;  2EMT A;  1WXV A;  1I4G A;  3SHQ A;  4ZRI A;  2KC2 A;  2KMM A;  2KVR A;  2KWV B;  1GUA B;  1SEB D;  2NPT A;  2K39 A;  2DHZ A;  4RCO A;  2FNJ B;  2C60 A;  1WGR A;  3NVV A;  3M95 A;  2XNA C;  4MGI E;  5GXG B;  1L4Z B;  4M8N A;  3WAO A;  2JXX A;  3R3M A;  2FCM A;  2C7H A;  3PV1 A;  4C4V A;  2AQ2 B;  2KJH B;  1FRD A;  1YJI A;  3R2I A;  1TYG B;  5G5H A;  2CU1 A;  1VRA B;  3MFG A;  3UGB B;  5BYS A;  5HFY A;  4KZC A;  1V8C A;  2RDB C;  4P6V F;  3AEA B;  2N1W A;  1PFD A;  1KRH A;  3AU5 A;  3N9Y C;  3U2S C;  2KLC A;  4HRO A;  4DHZ E;  4MEL A;  3H7P A;  1NEK B;  1WRI A;  5FK9 C;  3M63 B;  4EZJ A;  2XBB C;  1WR6 E;  2ZVO A;  2J4X A;  4M8M A;  4M02 A;  5JHA A;  1N60 A;  1E8X A;  4K3C A;  3EFC A;  1E7U A;  2IO1 B;  4A90 A;  4E3C A;  3N3K B;  1WGH A;  1V5T A;  1JCK B;  1WIA A;  2L8J A;  5AUK A;  2LGI A;  1WXS A;  4JE3 B;  3QAQ A;  4US9 A;  4NJ7 A;  4WAA A;  4IKG A;  2NTS A;  2G3Q B;  4KIK B;  4GOC A;  4NAM A;  1QZE A;  3PLU A;  2INC C;  4FJV B;  2LJ5 A;  1QLB B;  2KMA A;  4MM3 B;  3NOB A;  3WAP A;  2DX5 B;  1XF5 L;  4WJP A;  2A4Z A;  1FD6 A;  4I6P A;  1VJK A;  4AJW A;  4K3B A;  2KN5 A;  1QOG A;  1KF6 B;  1TS4 A;  1J0G A;  4P1B C;  2EKE C;  4AWJ A;  4RH6 A;  1C79 A;  5LLI A;  2KQ4 X;  2V4L A;  3Q8F A;  5E6N A;  1E5W A;  1LQB A;  4ZYN A;  4C00 A;  1J19 A;  4HCP B;  3CSF A;  2KDF B;  4YWG G;  3AEG B;  2K8H A;  2GMI C;  3W5U B;  2JYT A;  2Y5P A;  2QDF A;  3VUY A;  1DOI A;  2L76 A;  2IYD B;  5AEK B;  1I4X A;  1J7C A;  3IHP C;  3TL5 A;  4QAY A;  4OVV A;  4FXC A;  1JQ4 A;  5D7G A;  2RR9 A;  1TIF A;  1ZW7 A;  3VDZ A;  4PYU A;  2JT4 B;  4GXB A;  3AB5 A;  4IM2 A;  3VR9 B;  2IO3 B;  4H2A A;  2NCN A;  4L2Y A;  2DNF A;  1HE8 A;  4ASW C;  1LFD A;  3U4E G;  4FJY A;  4RM8 A;  1F1H A;  4HRS A;  1ZOY B;  1OQR A;  3U7Z A;  3WAN A;  4PS3 A;  2LZ6 A;  1R4N I;  1MG4 A;  1SB3 C;  4EKU A;  2KDM A;  1IUE A;  1J8C A;  1TJE A;  3HK0 A;  4KIK A;  4K7U A;  3CMM B;  2LRW A;  1KLU D;  3LDZ E;  4BOZ B;  1BML C;  4ZHP A;  1FNV A;  2IY1 B;  1LXD A;  3IBE A;  4MH0 E;  3ZKJ C;  2ACZ B;  2KNB A;  5C3J B;  3ETR A;  4MM3 A;  2MQJ A;  1V86 A;  1UD7 A;  2RDH A;  2HTH A;  3X23 A;  4G50 A;  3S2A A;  2WHI A;  2B3A A;  4UDU C;  2QSD A;  3N30 A;  3BYT B;  2JSV X;  1C77 A;  1D5X C;  3R7R A;  4RGM A;  3CF6 E;  3AE9 B;  4PS8 A;  3V62 A;  1GJZ A;  2MEK A;  3VTU A;  1XEE A;  2JRH A;  2LD9 A;  4JIO U;  4ANU A;  3UIO B;  1JRP A;  3KQ4 A;  3MJ5 A;  2MP2 B;  1J7A A;  3OWE B;  4L23 A;  2MH7 A;  2Y5C A;  1VD2 A;  1WGK A;  1T5X D;  3AEE B;  1WSP A;  2MX2 A;  3T9L A;  4IWP A;  1E8W A;  2BYV E;  4W9F A;  1WH3 A;  3APF A;  2QMT A;  1RM6 C;  3RNF C;  2L00 B;  2G9H D;  2K9X A;  1PGX A;  4CHK A;  3CIR B;  1HTQ A;  1WFY A;  3PRZ A;  1FM0 D;  3U52 E;  2J0K A;  4IWO A;  1WGD A;  1ZXI A;  2MSE D;  5MPO A;  3BYY B;  1KH0 A;  4BKS D;  3OLM D;  2KAC A;  1ZXH A;  1EF1 A;  3WCQ A;  1GPX A;  2HJ8 A;  4GDK B;  3R8B A;  2XK5 B;  1STE A;  3ZNI D;  3EFU A;  1R7S A;  1T0Q C;  3UIP B;  3P4Q B;  3P2B A;  4F1S A;  2MRP A;  2M0A A;  2PVO D;  2BB5 A;  2C9W B;  3Q69 A;  3ZTD A;  4OVU A;  5AUI A;  2OOB B;  2L32 A;  3ALB A;  4FAD A;  2AX5 A;  3U8Z A;  3PPA A;  2ZPN A;  4JL9 A;  4BBN C;  4LNI A;  3NHE B;  3UQA A;  2QC8 A;  1RFA A;  2KDB A;  3QWZ B;  2OHF A;  3A33 B;  2KX3 A;  3W1S C;  2REX A;  5C23 A;  3AEF B;  3RD2 A;  1K51 A;  5DPR A;  3NVW A;  2YLM A;  2GOW A;  2CU3 A;  1K52 A;  3RNG C;  1E8Y A;  1UEL A;  2GI9 A;  2LWP A;  1H4R A;  2MP2 A;  1UBI A;  4DK5 A;  2JF5 A;  4HJK A;  3IT6 B;  2L1A A;  5IAA C;  3MC0 B;  2BKF A;  1P9D U;  1E10 A;  2GBK A;  4BBN F;  1G6J A;  1CK1 A;  1DGJ A;  3HRD D;  4W9I A;  1PGA A;  2L83 A;  2LGS A;  4F7Z A;  2MBO A;  3UI3 A;  4BKS A;  1WJ4 A;  2FCQ A;  1HXY D;  2WXH A;  1V49 A;  2IDY A;  4JWU C;  1AWD A;  1HTO A;  1C9F A;  1N5W A;  4DXF A;  4WWO A;  3ZJV A;  3E56 A;  4BZA A;  2KQ7 A;  3ENE A;  1R4M B;  2BYE A;  4AOF A;  4ZRJ A;  1WM2 A;  2L0T A;  2W54 A;  3ZQ4 A;  2K22 A;  4DHZ B;  1CJE A;  4KZ0 A;  3VQI A;  4GMV A;  1D5Z C;  3EC8 A;  1V80 A;  1YQ3 B;  4MGY E;  1TBE A;  1R4M I;  1AW7 A;  5FR6 A;  4HLE A;  3AE3 B;  3EHV A;  1EUV B;  2QJL A;  1P3Q U;  3HVD A;  3VFK A;  3Q3M C;  4GDK A;  2L52 A;  2RGF A;  1AAR A;  2XK5 A;  1Y8R C;  2V3S A;  3L13 A;  1L0X B;  2IGH A;  2SEB D;  3A4R A;  2WDR B;  3VTW A;  3ML9 A;  3DBR B;  2K25 A;  2KWD A;  2PMV A;  3OJ3 A;  1FFU A;  2N7J A;  1SJE D;  1ZDV A;  3OAW A;  3DBR I;  1FMA D;  1YMH E;  4P7I A;  4EZK A;  1WXQ A;  4ACF A;  4PS7 A;  4XWT A;  3RFZ B;  3DQV A;  3GE8 C;  2PLP A;  1L0V B;  3L10 B;  3U30 A;  4W9D A;  2BBC A;  2PE6 B;  4KKI A;  1H8C A;  2KT7 A;  3VH4 B;  3HM6 X;  2DAJ A;  3NS1 A;  4IC7 B;  4XX5 A;  3RPF C;  2AQ1 B;  1YX5 B;  1YIW A;  4AJY B;  4MGK E;  4XDC A;  4OHJ A;  4TMA B;  3H9D A;  3R2T A;  2LUE A;  4PYZ A;  3TMP B;  4KKJ A;  2L7R A;  3K9O B;  1V81 A;  4WAF A;  1MI0 A;  2MCN B;  2MJD A;  2LJI A;  2WX0 A;  4A20 A;  2GBM A;  4WQO B;  1E6E B;  3JVZ X;  1Q1O A;  3MHS D;  1N63 A;  3W1S A;  1IP9 A;  2Z0E B;  3Q3F A;  3Q3O C;  3RYT A;  4W9E A;  4EOY A;  5H8Y E;  2IPK D;  4TUU A;  4NNJ B;  4MSM B;  3IAS 1;  3QX1 A;  1OEY A;  1WX9 A;  1M94 A;  2M4N A;  5CTR C;  5FR3 A;  2WYQ A;  3N1Z C;  2IJ0 A;  5L95 C;  2BTE A;  1EM7 A;  3UIN B;  1WX7 A;  1YN4 A;  3R7Q A;  3APD A;  2DZM A;  3QHT A;  1JRU A;  3IT4 B;  3L0W B;  2LMC A;  3HM3 A;  2XN9 C;  1SF0 A;  5E6J A;  2DAF A;  2JXT A;  3PZ8 A;  4LJO B;  4K81 A;  1Q0W B;  1SE9 A;  2NR2 A;  4JPS A;  4WIP A;  2JWU A;  3M3J A;  4MH8 A;  1OEY J;  2C5L C;  1I42 A;  2Z59 B;  2IZV B;  2I1K A;  4R3D A;  2WX1 A;  3BII D;  2X38 A;  2ZEQ A;  3W9C B;  1SSN A;  4KDI C;  1RWS A;  3PTF C;  4OW0 A;  3L17 A;  1Q10 A;  3MTN B;  3QAR A;  1P1A A;  2KHW B;  5E6P A;  3LYY A;  4W9G A;  4YSX B;  4RF1 A;  1HA5 A;  1AN8 A;  1PQS A;  2O2V B;  1MJD A;  2IO0 B;  2IGG A;  2G45 B;  3BY4 B;  3T3O A;  1L7Y A;  3DVG Y;  1TY2 A;  1IGC A;  1V1P B;  4HKQ A;  1QF6 A;  3AV8 A;  3O65 B;  1ZUD 2;  2GRI A;  1WE6 A;  1KM7 A;  1T0S C;  4RGO S;  2QCZ A;  1QOB A;  2WWZ A;  5EE9 A;  2M8S A;  4REZ A;  3NRZ A;  3K9P B;  2ZCB A;  4W9K A;  4YTM B;  5IO9 A;  1TKY A;  3KH0 A;  1T6B X;  2CR5 A;  1VCB A;  3QJZ A;  1UBQ A;  3EGR A;  4S0R A;  5TR5 A;  3VVW B;  3E9S A;  2DWQ A;  2A5U A;  3EEC A;  1QQR A;  2OJR A;  4EEW A;  2BQQ A;  3IG3 A;  1T0Y A;  4B9K A;  4GLS C;  3ABV B;  3Q2A C;  2JZ3 B;  1JRO A;  3VHT C;  3AM9 A;  4KDL B;  1BUI C;  1XLN A;  1NYQ A;  3SEB A;  1C4P A;  1D5M C;  1Q5W B;  2VH2 A;  3RI7 C;  2R61 A;  3GZN B;  1DYQ A;  3PRM B;  4DXA B;  1SJH D;  2N7E A;  2BVC A;  1SE3 A;  2JZP A;  1FXA A;  1FNW A;  4GIV A;  4NQL B;  1MHX A;  3RUI B;  3O13 A;  1RFK A;  3V60 A;  3X0W A;  4HPL B;  3GZN I;  2NBU A;  4HXD A; 
#chains in the Genus database with same CATH homology
 3IFW B;  1UZX B;  2AL6 A;  3KUD B;  2MX2 A;  3T9L A;  1V2Y A;  2K1F A;  2AEH A;  4IWP A;  1E8W A;  2BYV E;  2QHO A;  3PHX B;  4IWQ A;  3DBS A;  4GN1 A;  3C0R B;  2L05 A;  2KTR A;  4W9F A;  2BF8 B;  3AU4 A;  1WH3 A;  2N9E B;  4KVG B;  3H7S A;  2D10 A;  2O2V A;  3APF A;  2AYO B;  1WF9 A;  2L00 B;  4CHK A;  2RD0 A;  2BGF A;  1NI2 A;  2PJH A;  2JZZ A;  2MW5 A;  4MJS B;  1UGM A;  1WRD B;  3WAM A;  2M17 A;  1WFY A;  1Z2M A;  1S1Q B;  3PRZ A;  4II2 B;  4WJN A;  3W1Y A;  1IYF A;  5D2M B;  2MWS B;  5DPS A;  2J0K A;  3A9K A;  3PZD A;  3DPD A;  4IWO A;  3T8M A;  3NS8 A;  1WGD A;  2MSE D;  4BKG A;  4I6L B;  3TJP A;  4BKS D;  3OLM D;  2KKC A;  3SU8 X;  2KJR A;  2KDI A;  1EF1 A;  4EFO A;  3TIX A;  1L2N A;  3PSE B;  5DCN A;  2HJ8 A;  2K8C A;  3H1U A;  2PPH A;  2HE7 A;  3LJ3 A;  4GDK B;  3PRE A;  4GSW A;  3QC8 B;  5DPW A;  3RZF A;  2XK5 B;  3A9J A;  4BKT A;  2G4D B;  4AP4 C;  3ZNI D;  3AUL A;  3EFU A;  3ONS A;  3UIP B;  3KUC B;  3P2B A;  4F1S A;  2RSU A;  4G11 A;  2MRP A;  4EUT A;  1K8R B;  4IUM B;  3RUL A;  2C9W B;  4K1R B;  3ZTD A;  2GBR A;  4OVU A;  1OQY A;  2OOB B;  1IPG A;  3L08 A;  3AXC A;  5CHW A;  3V6E B;  3A1Q B;  4URK A;  1WMH B;  2NPT B;  1C1Y B;  3ALB A;  3VUW A;  4FAD A;  3U8Z A;  3PPA A;  2ZPN A;  4JL9 A;  4BBN C;  3RT3 B;  2HD5 B;  3KW5 B;  2XEW A;  3NHE B;  4HK2 A;  4FHJ A;  2G4S A;  3UQA A;  3UQB A;  4IM3 A;  1RFA A;  3RZW C;  2KQS A;  2FUH B;  2KDB A;  3NY5 A;  3QWZ B;  4NQK E;  1P0R A;  2BWF A;  3A33 B;  2KX3 A;  3CST A;  3DOW A;  3OJ4 B;  3ZRC A;  3SDL C;  3W1S C;  5IA7 A;  2REX A;  1WGY A;  5C23 A;  4FLH A;  2EMS A;  3KYC D;  4LDT B;  2N9X A;  3PGE A;  3DBH I;  3RD2 A;  2VRR B;  3N32 A;  5DPR A;  4LCD E;  1GC6 A;  2KFJ A;  2GOW A;  2V1Y A;  2YLM A;  2IO2 B;  2KFK B;  1E8Y A;  2D2Q A;  4W9J A;  5L83 A;  1UEL A;  3SD5 A;  5JH5 C;  3NZU A;  4RM9 A;  2LWP A;  1H4R A;  2K6D B;  2N9P C;  2MP2 A;  2CHW A;  3PRP B;  1UBI A;  4DK5 A;  4MGZ E;  2JF5 A;  4HJK A;  4IG7 B;  5IAA C;  2BKF A;  1E7V A;  1P9D U;  5JHB A;  2GBK A;  1WXA A;  4BBN F;  5G55 A;  4AUQ C;  1G6J A;  4GDL B;  3DDC B;  4W9I A;  4K7S A;  3WAL A;  2KTF A;  1EO6 A;  4E74 A;  2KDE B;  4F7Z A;  2MBO A;  3R66 C;  4MSQ B;  2ZVN A;  1ZKH A;  4BKS A;  1WJ4 A;  4TKN A;  2FCQ A;  3ZW3 A;  1V49 A;  2J7Q B;  3TBL D;  2RPQ A;  3D32 A;  3ZNH B;  3AI5 A;  5AZH A;  4BOS C;  2KJ6 A;  4LDT D;  4WWO A;  4GB9 A;  5C1Z A;  2KQ7 A;  1OTR B;  1V6E A;  1XT9 B;  3ENE A;  4FUL A;  4GU2 A;  4N9F 4;  2K8B A;  2BYE A;  3H7P B;  5KHO A;  4AOF A;  4ZDV A;  2ZCC A;  1S3S G;  1ZGU B;  2KZR A;  3KYD D;  4YL8 A;  5D6J B;  4W9L A;  2FID A;  4ZRJ A;  5D94 A;  3JYU A;  2JPH A;  1WM2 A;  2L0T A;  4TV3 A;  4A3O A;  4IW0 A;  4MJS A;  4TQ0 A;  5LXH A;  4RMA A;  4DHZ B;  1GG3 A;  4EZL A;  4KZ0 A;  3VQI A;  2LGY A;  4GMV A;  4ANV A;  1WX8 A;  3EC8 A;  2DEN B;  1V80 A;  4DWF A;  4MGY E;  1TBE A;  3U7D A;  1WY8 A;  3PLV A;  3ECI A;  4FHK A;  1R4M I;  1U4A A;  2JRI B;  5FR6 A;  2YVC A;  3L16 A;  1WJN A;  4HLE A;  1C3T A;  2WDT B;  1KJT A;  3EHV A;  2KLG A;  3ZVV A;  3I3T B;  1EUV B;  1P3Q U;  3WA0 A;  1TTN A;  2JY6 A;  4NAW B;  3VFK A;  2EMT A;  4GDK A;  1WXV A;  4HDQ A;  3ZUN A;  2RGF A;  1XD3 B;  3B08 A;  4W9H A;  1AAR A;  2XK5 A;  3H6N A;  1Y8R C;  2V3S A;  3L13 A;  3SHQ A;  5KHQ A;  4ZRI A;  2KC2 A;  3HIZ A;  2KAN A;  3GOE A;  2KD0 A;  3DBL I;  4FJZ A;  2KVR A;  4DHJ D;  2KWV B;  1GUA B;  3A4R A;  3VTW A;  3VAW A;  3A1Q A;  1WMH A;  2NPT A;  3ML9 A;  4HVB A;  3DCG A;  3V6C B;  2K39 A;  2DHZ A;  2FNJ B;  2K25 A;  2C60 A;  5DPT A;  1WGR A;  4B95 A;  3M95 A;  4GGQ A;  3OJ3 A;  2FCN A;  4MGI E;  1NDD A;  2KWU B;  4M8N A;  2D11 A;  2ZZP B;  3QQ8 B;  2Z0D B;  1GC7 A;  2KX0 A;  2BWE S;  2JXX A;  3VH3 B;  3OAW A;  3WAO A;  3DBR I;  3R3M A;  2FCM A;  5CX3 A;  2C7H A;  3PV1 A;  2KOX A;  1NBF C;  4P7I A;  1YX6 B;  2NVU I;  4WJQ A;  4G3X B;  4EZK A;  2KJH B;  4PS7 A;  5J17 A;  1SIF A;  2DZI A;  3DQV A;  4NY0 A;  2KFK A;  1WZ3 A;  3L10 B;  3U30 A;  2CU1 A;  3HHM A;  3UF8 A;  2FIF A;  3TCA A;  4W9D A;  4TQ1 A;  4LJP B;  3A4S C;  2PE9 A;  4G0N B;  3UGB B;  2PE6 B;  2ZJD A;  1WI0 A;  3QIJ A;  1H8C A;  4NPN A;  4KZC A;  1F9J A;  3VH4 B;  3HM6 X;  2DAJ A;  4DDG D;  4GDL A;  4IC7 B;  4XX5 A;  2N1W A;  3AU5 A;  1YX5 B;  3KUZ A;  4JQW C;  1YIW A;  5E6O A;  4AJY B;  4CYE A;  4MGK E;  2MBE A;  2KK8 A;  2LGX A;  2L0F A;  2DZK A;  5CHV C;  3V61 A;  2KLC A;  3H9D A;  2BPS A;  1KOT A;  2UYZ B;  2LUE A;  4PYZ A;  4DHZ E;  2DYO A;  1E90 A;  3TMP B;  2L7R A;  1RLF A;  4JGH B;  1WE7 A;  2DZJ A;  3H7P A;  3K9O B;  4HCN B;  4MEL A;  2LVP A;  1RRB A;  3QA8 A;  1V81 A;  2MCN B;  3M63 B;  4EZJ A;  2R2Q A;  2XBB C;  2LVQ A;  1V5O A;  2WX0 A;  1WR6 E;  2ZVO A;  2J0J A;  4A20 A;  2GBM A;  1V9J A;  1Z5S B;  4M8M A;  3VUX A;  5JHA A;  2CHZ A;  1E8X A;  4WQO B;  4II3 B;  4E3C A;  1E7U A;  2IO1 B;  4FA6 A;  3VTV A;  3JVZ X;  1Q1O A;  3N3K B;  3MHS D;  1WGH A;  1UH6 A;  1V5T A;  1RAX A;  3W1S A;  1IP9 A;  1WIA A;  2L8J A;  2LVO A;  2Z0E B;  1WXS A;  4WWP A;  3Q3F A;  3QAQ A;  3RYT A;  2D07 B;  4W9E A;  4EOY A;  1FXT B;  4NJ7 A;  4HPM B;  4WAA A;  5AZF A;  1YJ1 A;  4TUU A;  4NNJ B;  1D3Z A;  4A3P A;  4MSM B;  2IBI B;  4K7W A;  2G3Q B;  4KIK B;  4NAW A;  3QX1 A;  1OEY A;  3ZDT A;  4GOC A;  1WX9 A;  1YD8 U;  1M94 A;  1QZE A;  2IY0 B;  2M4N A;  3PLU A;  1WZ0 A;  4FJV B;  2LJ5 A;  5CTR C;  3JW0 X;  2JVC A;  2WYQ A;  3WIM A;  5L95 C;  2KMA A;  4I6N B;  3NOB A;  3WAP A;  4W9C A;  3UIN B;  1WX7 A;  3R7Q A;  2DX5 B;  3APD A;  5HKH A;  2DZM A;  2LI5 A;  4WJP A;  1ISN A;  4XZ4 A;  2JWZ A;  2JUO A;  3QHT A;  2A4Z A;  1LM8 B;  2ASQ A;  1WJ6 A;  1JRU A;  2MBH A;  2MA9 B;  3L0W B;  4I6P A;  4AJW A;  4KV2 A;  2KN5 A;  1YQB A;  2KMC A;  3DVN U;  3HM3 A;  3B0A A;  1J0G A;  2J0M A;  2DAF A;  2EKE C;  4AWJ A;  4LJO B;  4K81 A;  1TGZ B;  2V4L A;  5LLI A;  1Q0W B;  5E6N A;  1SE9 A;  4FN2 A;  2KC1 A;  2N7D A;  2NR2 A;  3VXW A;  3ZLZ A;  1E5W A;  1X1M A;  3M3J A;  3PT2 B;  4HDO A;  3QCA A;  1OEY J;  3RCZ A;  1WGG A;  3DVG X;  3KVF B;  1LQB A;  2KO3 A;  4ZYN A;  2LRU A;  1J19 A;  4HCP B;  2C5L C;  3CSF A;  1I42 A;  2KDF B;  3PVL A;  2ZNV C;  2Z59 B;  4CO7 A;  2IZV B;  2I1K A;  2WX1 A;  2K8H A;  2DYB A;  5AZG A;  2GMI C;  2ZEQ A;  1EF5 A;  2BKR B;  3VUY A;  2AWT A;  4KDI C;  2L76 A;  2BYF A;  1WM3 A;  3JSV B;  4ANW A;  2IYD B;  5AEK B;  3PTF C;  3IVF A;  4HXD A;  2O6V B;  3L17 A;  3MTN B;  3QAR A;  1KLV A;  1P1A A;  2KHW B;  5E6P A;  2N4F A;  3IHP C;  3TL5 A;  3ZO5 B;  4E71 A;  2M1M A;  4W9G A;  4WJO A;  2FAZ A;  4OVV A;  2W9N A;  4MEM A;  2KTR B;  2LGD A;  5D7G A;  1PQS A;  2RR9 A;  4FBJ B;  2AL3 A;  2MBQ A;  4BVU C;  2O2V B;  1SGH A;  2L3Z A;  2IO0 B;  2G45 B;  5J2R A;  3BY4 B;  1ZW7 A;  3VDZ A;  5LXI B;  4PYU A;  2JT4 B;  4GXB A;  4IM2 A;  3ZNG C;  4XC2 A;  2Y5B B;  1L7Y A;  1WYW B;  1WXM A;  3NZS A;  2IO3 B;  2CS4 A;  4HWI B;  4ICV A;  2NCN A;  3DVG Y;  3ZTC A;  3DVN V;  1HE8 A;  4ASW C;  1LFD A;  2N1V A;  3APC A;  1P98 A;  1I35 A;  4FJY A;  4RM8 A;  3A9K B;  3O65 B;  2NBV B;  2O6V D;  5J18 A;  3ZRF A;  4J6I A;  5CHF A;  3WAN A;  4PS3 A;  1WE6 A;  2LZ6 A;  1KM7 A;  1R4N I;  2MBB B;  1GNU A;  2NBW B;  4B6W A;  4EKU A;  2WWZ A;  2M8S A;  2LXC A;  2NS5 A;  4IM0 A;  5G2N A;  1J8C A;  1CMX B;  1XQQ A;  3HK0 A;  4KIK A;  4K7U A;  3CMM B;  3K9P B;  2ZCB A;  4W9K A;  2LRW A;  2ZNV B;  3LDZ E;  2C7M B;  3KH0 A;  4X57 B;  3ZNZ B;  4BOZ B;  3A9J B;  2KXJ A;  2CR5 A;  2IY1 B;  1VCB A;  1LXD A;  2R2O A;  3IBE A;  4MH0 E;  3ZKJ C;  2PEA A;  1UBQ A;  3QJZ A;  1WJU A;  2KNB A;  5TR5 A;  3VVW B;  4F8C B;  4ICU A;  4MM3 A;  2A5U A;  3EEC A;  1A5R A;  2MQJ A;  2OJR A;  1V86 A;  1UD7 A;  2LAS A;  3ZIM A;  4EEW A;  3L54 A;  3BIN A;  3IG3 A;  1T0Y A;  2HTH A;  3Q3J A;  3QK0 A;  4G50 A;  1E8Z A;  3S2A A;  3X23 A;  2B3A A;  5BO4 B;  3N30 A;  4B9K A;  2ZPY A;  4DBG A;  2I1J A;  3MJW A;  2UWQ A;  2K6Q A;  3ZDM C;  2JZ3 B;  4DHJ B;  3VHT C;  2DYM A;  5EDS A;  4JLC A;  3PS6 A;  4MDK E;  4ZRK A;  4M0W B;  3R7R A;  3CF6 E;  4PS8 A;  1MG8 A;  3V62 A;  1GJZ A;  4KDL B;  4DDI D;  5JZE B;  2LXA A;  3VTU A;  1Q5W B;  1OGW A;  1TZ1 A;  2JRH A;  2LD9 A;  3M62 B;  4JIO U;  4WWN A;  4ANU A;  3UIO B;  4NJ6 A;  2M0X A;  3B1L X;  3PRM B;  4KSL C;  4DXA B;  2FCS A;  2D3G A;  2N7E A;  2MP2 B;  4ANX A;  4BFR A;  2CHX A;  1VD2 A;  2C7N B;  4GIV A;  4NQL B;  2GBN A;  2MLB A;  2GBJ A;  3RUI B;  3V60 A;  1WR1 A;  1BT0 A;  3X0W A;  3ML8 A;  3JSV A;  4HPL B;  3GZN I;  3PHW B;  2KWC A;  5GMV A;  2NBU A;  4KSK C;  2O6V A;  2CKH B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...