3SDLC

Crystal structure of human isg15 in complex with ns1 n-terminal region from influenza b virus, northeast structural genomics consortium target ids hx6481, hr2873, and or2
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
151
structure length
151
Chain Sequence
DLTVKMLAGNEFQVSLSSSMSVSELKAQITQKIGVHAFQQRLAVHPSGVALQDRVPLASQGLGPGSTVLLVVDKCDEPLSILVRNNKGRSSTYEVRLTQTVAHLKQQVSGLEGVQDDLFWLTFEGKPLEDQLPLGEYGLKPLSTVFMNLRL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Viral protein/antiviral protein
molecule keywords Non-structural protein 1
publication title Structural basis for the sequence-specific recognition of human ISG15 by the NS1 protein of influenza B virus.
pubmed doi rcsb
source organism Influenza b virus
total genus 37
structure length 151
sequence length 151
chains with identical sequence D
ec nomenclature
pdb deposition date 2011-06-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00240 ubiquitin Ubiquitin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 3sdlC02
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 3sdlC01
1LXDA 3I3TB 4MJSB 2KDBA 1KLVA 1MG8A 5IA7A 4NAWA 1LM8B 2JZ3B 4AP4C 4FBJB 2KMCA 3VUYA 4ZDVA 1GC7A 4K81A 5DPTA 1Y8RC 3V6CB 3O65B 4WJPA 4E74A 1OTRB 2DZJA 3QWZB 4NAWB 4RM9A 1VD2A 5G55A 3ZLZA 4A3PA 3H1UA 2KNBA 3R66C 3EFUA 2GBNA 2D07B 5C1ZA 3PLVA 2FCQA 3ZNGC 1BT0A 4AWJA 2RD0A 4B95A 2WX0A 4EOYA 2Z0DB 3OJ3A 2BPSA 2AL6A 5JZEB 2MSED 3W1YA 2MWSB 3DBRI 3NS8A 1WE6A 2G3QB 4HJKA 3U30A 2LGXA 4K1RB 4EZLA 2KHWB 2V4LA 1OEYA 4OVVA 1P1AA 1WX7A 2L00B 4FULA 4NJ6A 3ECIA 4X57B 3ZVVA 2ZVOA 3RUIB 2FCNA 2FIFA 1WE7A 4G50A 4MDKE 1C3TA 4I6PA 1K8RB 1SE9A 3VHTC 3T8MA 4HK2A 3V6EB 3ML9A 1QZEA 2KZRA 3OLMD 4W9JA 4XC2A 2CS4A 3K9PB 2GMIC 1UZXB 2M4NA 3KUCB 4EKUA 3JSVA 1UBIA 4HDQA 3VXWA 2JRIB 3WIMA 2M1MA 3ONSA 4IM2A 1H4RA 2QHOA 3X0WA 3JSVB 2N9PC 2MRPA 3UIPB 2XK5B 1CMXB 1IP9A 1RAXA 1OEYJ 2REXA 2FAZA 2KQ7A 3BY4B 4II2B 4JLCA 5CX3A 2BWFA 4DHZE 4FA6A 3A9KB 4WJQA 3OAWA 2D2QA 3DVGX 1J19A 4OVUA 2PPHA 1WH3A 2MP2A 1NDDA 4GGQA 2FUHB 2KVRA 4W9HA 1NI2A 3CMMB 3NOBA 3DDCB 3U7DA 1TTNA 4ANWA 3VQIA 3PT2B 3VAWA 3GOEA 3UF8A 1SIFA 4FLHA 2LUEA 1IYFA 2A4ZA 2DENB 2Y5BB 5G2NA 2KOXA 3T9LA 1WMHA 4FJZA 2EMTA 1E8ZA 4WWOA 1C1YB 3UGBB 3JW0X 2IY0B 3QARA 2O6VB 2DHZA 1WMHB 3ZNID 3ZDTA 2O6VD 2CHZA 2N7DA 3IVFA 2K8BA 3L0WB 1RLFA 4ICUA 2R2QA 2G45B 4LJPB 5E6OA 4FJYA 2MQJA 3UIOB 4E3CA 2LXCA 4ANUA 2BKRB 2DYMA 2K8HA 3PRZA 1EF1A 1GG3A 4KIKA 2M8SA 2KO3A 1ZKHA 2BKFA 2N9XA 3A33B 3L08A 3PGEA 3V60A 4LJOB 1ISNA 3IG3A 3UQAA 2KJRA 2KMAA 5CHVC 2K6QA 4KIKB 2RPQA 4MM3A 1V5OA 3WALA 5HKHA 2DAJA 3MHSD 1WI0A 2IYDB 3RCZA 2JRHA 5TR5A 3UINB 4FHKA 4NQLB 2KDFB 2IZVB 2J0KA 3DOWA 2DYBA 2JUOA 3KUZA 4HVBA 3NHEB 1E5WA 1YJ1A 3KUDB 3M62B 3S2AA 1WJ4A 2MX2A 2DZKA 2C5LC 2N9EB 2PEAA 1YX5B 3DVNU 3KW5B 3L54A 2K1FA 4JGHB 3U8ZA 3VFKA 4TQ0A 3ZRFA 5D2MB 1PQSA 4AOFA 3LDZE 4HWIB 4IC7B 2ZNVC 4HXDA 4BBNC 1TZ1A 1WJ6A 4AJWA 4BOSC 3R3MA 2C9WB 3A4SC 3MTNB 4G11A 4MSQB 3VVWB 2ZVNA 2G4SA 4BFRA 2BGFA 4JL9A 1LFDA 1T0YA 2PE9A 3CSTA 4GU2A 3H9DA 2GBMA 2V3SA 1P0RA 2KDIA 3PREA 3L13A 2GBKA 3HM6X 4AJYB 2HE7A 2J0MA 1E7UA 2KXJA 3AULA 3PVLA 3VTVA 2CHXA 4FHJA 3SHQA 2NPTA 3JVZX 5AZHA 5KHOA 5JHBA 2EMSA 2LVQA 4GMVA 3QX1A 3PLUA 5BO4B 2MW5A 2NBWB 3AU5A 3HK0A 3JYUA 5FR6A 4TKNA 1KOTA 4K7UA 4DHZB 1WGRA 2KWUB 2L0TA 2OJRA 4W9CA 2CU1A 3UQBA 1I42A 1NBFC 4BKSA 1GJZA 3PSEB 3QQ8B 1WR1A 2IO2B 2LD9A 1XD3B 1V49A 4W9DA 2KX0A 3RULA 3DCGA 4G0NB 1R4NI 2NCNA 4TUUA 1EUVB 5GMVA 4IWPA 3ZO5B 1G6JA 4RM8A 3ML8A 2JY6A 1WFYA 1WXMA 3RYTA 2C7MB 2HTHA 3W1SC 3A1QA 4GDLA 3ZTCA 4PS7A 1WYWB 3HHMA 4KZCA 4N9F4 1SGHA 4W9LA 1WXSA 1RRBA 2KFJA 2M0XA 2D11A 2N1WA 2HD5B 1V9JA 1EO6A 3CF6E 4GDLB 1H8CA 1WGYA 2WDTB 4TV3A 3QA8A 4DDID 4LDTB 4KSKC 2C7HA 2JXXA 2L7RA 3D32A 1YX6B 2J7QB 2C60A 1V81A 3IFWB 4KV2A 2CHWA 5CHWA 3QK0A 4K7WA 2VRRB 4ZRIA 3WAPA 3ZNZB 2FCMA 1WR6E 2I1JA 1WM3A 2RGFA 2ASQA 4XZ4A 4EFOA 3NZSA 3ZRCA 3PHXB 3VH3B 1J8CA 2L0FA 3RD2A 4DHJB 1I35A 1UELA 2JT4B 2KTRA 4DHJD 1P9DU 4KDLB 4J6IA 2MP2B 1AARA 1L7YA 3APCA 1TGZB 4HDOA 2MLBA 2GOWA 4FJVB 2KTRB 5JHAA 2OOBB 4CYEA 2FIDA 4W9IA 3ZDMC 1WJUA 1WZ3A 2NR2A 2AWTA 2KDEB 2LGDA 4MH0E 2O2VA 2KJ6A 1WGDA 2Z59B 4KVGB 2KN5A 2LWPA 4ZRJA 3R7QA 4KDIC 4DWFA 3WAOA 3BINA 3V62A 4M8MA 1GNUA 3ZKJC 3ZUNA 3EECA 2A5UA 3EC8A 1XT9B 2KLGA 2JZZA 2L76A 3QHTA 3M3JA 1HE8A 4II3B 4B9KA 4ANXA 4F8CB 3P2BA 4MELA 3TMPB 2L05A 2DZMA 3L10B 2JVCA 2BYVE 1TBEA 3H7PA 4NJ7A 1ZW7A 2K39A 4MSMB 1E90A 3KYDD 3H7PB 5KHQA 5LXIB 4ICVA 2BF8B 1P98A 1WXVA 3DBSA 2GBRA 1OQYA 1LQBA 5LXHA 4G3XB 4MGZE 2K8CA 1YQBA 3PV1A 4JQWC 3ZNHB 3DBHI 1V5TA 3R7RA 2ZPYA 2YLMA 1IPGA 4DK5A 3PZDA 5J18A 2KK8A 4W9FA 2PE6B 1WGGA 2LVOA 2G4DB 4HPLB 1E8WA 2RSUA 1Z5SB 2LVPA 3C0RB 3LJ3A 4EUTA 1E8YA 3AU4A 1X1MA 4HLEA 2NBVB 4ZYNA 3L16A 1A5RA 3L17A 3WA0A 5EDSA 2I1KA 3PRPB 1S3SG 2KX3A 2UWQA 1UBQA 2YVCA 1VCBA 4W9EA 1WM2A 3ZW3A 3DPDA 3KVFB 3RZWC 4AUQC 2LI5A 2FCSA 5JH5C 3ZTDA 1D3ZA 2ZCBA 3ZIMA 4PYZA 4F7ZA 2LRWA 3CSFA 4MGYE 3IBEA 2LXAA 3H6NA 1GUAB 2N7EA 3NY5A 4IM3A 3PTFC 2IO1B 5AEKB 1XQQA 2HJ8A 2ZEQA 2K6DB 1WZ0A 2N1VA 3SU8X 3H7SA 1S1QB 4FN2A 4I6NB 2MBHA 4MGIE 2NPTB 4GIVA 3DBLI 5J2RA 1U4AA 3DQVA 3PHWB 4BVUC 2XEWA 3VH4B 4MEMA 3VTUA 4GB9A 3TJPA 1WY8A 4BKSD 5L83A 4IG7B 3RT3B 2KC1A 2BYFA 4PS8A 4JIOU 2L3ZA 2KWCA 1YIWA 3NZUA 4WWNA 4HPMB 4PS3A 2EKEC 2IY1B 3QAQA 1UH6A 3A9JA 2M17A 4P7IA 2KC2A 2MA9B 3A1QB 1Q0WB 3ENEA 5AZFA 2D10A 2MBBB 1WF9A 2MBOA 3EHVA 5J17A 4DDGD 4B6WA 2K25A 2W9NA 5IAAC 1KM7A 3A9JB 1M94A 3OJ4B 4CHKA 4BBNF 3PS6A 3HIZA 5L95C 4LDTD 5DCNA 1UD7A 5DPRA 4NQKE 4K7SA 1WRDB 4WWPA 2KWVB 1R4MI 4W9GA 2R2OA 1WGHA 3WAMA 2GBJA 2KQSA 2NS5A 3HM3A 3PRMB 4IWOA 4HCNB 4IUMB 5AZGA 2LZ6A 1EF5A 4WQOB 1RFAA 3V61A 1V2YA 5E6PA 3Q3FA 2KJHB 1WX8A 4F1SA 1WX9A 5CHFA 1L2NA 4IM0A 2NBUA 2WWZA 3DVGY 4YL8A 2MCNB 3AXCA 2XK5A 3B08A 4M0WB 3RZFA 3K9OB 2LASA 1YD8U 5E6NA 1JRUA 3A9KA 4ASWC 1E8XA 4EZJA 3APFA 1Q1OA 4EZKA 5LLIA 3VUXA 2ZNVB 3M95A 4IWQA 2BWES 2L8JA 1Z2MA 1V6EA 3Q3JA 4HCPB 4MGKE 1V80A 2WX1A 4URKA 2ZPNA 4DBGA 2Z0EB 2XBBC 4FADA 4PYUA 2B3AA 3QIJA 1GC6A 2O2VB 2LGYA 2KLCA 3SD5A 3B0AA 4EEWA 2MBQA 2AYOB 3QCAA 3A4RA 4GN1A 2KD0A 2C7NB 1Q5WB 2AEHA 3PPAA 3TL5A 3TBLD 3VTWA 3AI5A 3ALBA 2BYEA 2ZCCA 2LJ5A 4NY0A 4IW0A 2JPHA 3X23A 2O6VA 2KFKA 3B1LX 4NPNA 3SDLC 3VDZA 3TCAA 4BKGA 2IBIB 2KTFA 3M63B 5C23A 4CO7A 4DXAB 2DX5B 2V1YA 2JF5A 5DPSA 2KFKB 2NVUI 1WXAA 4LCDE 5D7GA 3TIXA 4ANVA 2IO0B 4W9KA 1F9JA 3DVNV 4WJOA 5CTRC 4GXBA 3W1SA 2DAFA 2IO3B 1WIAA 2FNJB 2LRUA 4I6LB 4KZ0A 4KSLC 2PJHA 3MJWA 4M8NA 4A20A 1P3QU 2WYQA 4ZRKA 2D3GA 4WJNA 1FXTB 3N3KB 4TQ1A 3KYCD 2MBEA 3N30A 3QJZA 2CKHB 2JWZA 1OGWA 2ZZPB 5D6JB 3IHPC 1E7VA 2DYOA 1UGMA 2RR9A 3APDA 4E71A 2N4FA 2J0JA 1J0GA 2CR5A 3VUWA 4A3OA 5DPWA 1ZGUB 4XX5A 4BKTA 2KKCA 2AL3A 4BOZB 4GDKA 2KANA 4NNJB 2ZJDA 3WANA 1WJNA 4WAAA 1KJTA 4GSWA 3N32A 4MJSA 4RMAA 2UYZB 3GZNI 5D94A 4GOCA 4GDKB 3KH0A 1V86A 3QC8B 2DZIA
chains in the Genus database with same CATH superfamily
1LXDA 2JYTA 4MJSB 1KLVA 2G9HD 2CU3A 5G5HA 2Q5WD 3VUYA 4ZDVA 1FFUA 3DHHC 1SIJA 4E74A 4NAWB 3H1UA 2KNBA 3R66C 3R8BA 2GBNA 1UGJA 2AQ2B 3PLVA 3ZNGC 3MJ5A 3GS2A 3OJ3A 1YN3A 3W1YA 4MH8A 1C78A 3WCQA 3AECB 1J7AA 5HI1A 1GOZA 1T3QA 2KHWB 4AQ7A 4FULA 5C3JB 2PIAA 1F1HA 1VRAB 4I6PA 2PVOD 3ML9A 4XC2A 1L0XB 3K9PB 1UZXB 4HJGE 3EGRA 1FXIA 1UBIA 4HDQA 1VJKA 3Q8CA 1H4RA 1WWTA 3X0WA 2N9PC 3UIPB 4XGAB 1MG4A 1CMXB 1RAXA 2REXA 3Q3NC 4DHZE 4JLCA 4WJQA 3OAWA 2JYEA 2D2QA 2PPHA 4W9HA 1NDDA 4GGQA 3W5VB 2KVRA 2L32A 1QF6A 1V97A 3DDCB 4N59A 1TS2A 3BVGA 3VAWA 1SIFA 3MC0B 2WQYB 1QOGA 3AEAB 1FO4A 2DHZA 3ZDTA 1FPYA 2CHZA 1TKYA 2K8BA 3L0WB 1SE2A 4LJPB 5E6OA 4FJYA 2MQJA 4E3CA 3PRZA 2WDRB 2L52A 3FILA 1TZOA 1GG3A 2BKFA 1JCKB 3V60A 3IG3A 4XE0A 2BVCA 1WI0A 2IYDB 2IGHA 1UWXA 2DYBA 4HVBA 3AN1A 1E5WA 1YJ1A 5T8IA 3KUDB 4OVZA 2N9EB 3KW5B 1YX5B 2JQRB 3L54A 4JGHB 3VFKA 1PQSA 5D3DA 4BBNC 4HXDA 2V4IB 3IAM1 3MTNB 2ZVNA 4BFRA 3H8HA 1LFDA 4ZRQA 2HE7A 1T5XD 1ZDXA 4FHJA 2NPTA 5JHBA 2M0AA 4IOIE 4M02A 5BO4B 2BQQA 2PKOA 3PLUA 3BZDB 1SE4A 2MW5A 1IBXA 3HK0A 4TKNA 1WGRA 2KWUB 2L0TA 2OJRA 2OEDA 1R4MB 5BYRA 4OZCA 2BT6A 1R4NI 1ROEA 4IWPA 5IN7A 1WXMA 1T0QC 1F0ZA 3A1QA 4KZCA 4W9LA 2M0XA 1EO6A 3CF6E 2WXPA 2WDTB 1VDVA 1D5XC 3AH7A 4DDID 1RFKA 4KSKC 2L7RA 3D32A 1YX6B 1V81A 3IFWB 3IT4B 4LTUA 1V8CA 2VRRB 1NVID 4YXDB 1WR6E 3ABVB 4PT5A 4S17A 1F2RI 4EFOA 3NZSA 4KGTA 3ZRCA 2L83A 3VH3B 1J8CA 1I35A 2JU6X 2B76B 1BMLC 4J6IA 2MP2B 4HDOA 4FJVB 3N1YC 2KQ4X 5JHAA 4MH0E 3E56A 2KJ6A 4DWFA 4KVGB 2AQ1B 2WDVB 3R2IA 3BINA 1GNUA 1XT9B 2KLGA 2JZZA 2L76A 1HE8A 1ZW7A 1NYQA 2HDEA 1E90A 1QOFA 3H7PB 5LXIB 3GP7A 1P98A 5LXHA 4JX1C 3PV1A 1YQBA 2JSVX 3DBHI 1MVKA 3R7RA 3PZDA 2IPKD 2RSUA 2WXIA 4MM3B 1C4PA 2BBCA 1X1MA 4ZYNA 1JWAD 3RI7C 1N60A 2W54A 3L17A 3WA0A 1N62A 1SSNA 3DPDA 3KVFB 2WP9B 4AUQC 2LI5A 4ZYSA 4RFBA 2ZCBA 1WSPA 4HEA1 4QAYA 3RNAC 4F7ZA 2LRWA 3Q69A 3ZGZA 4MGYE 2LXAA 4ITKA 1HTOA 2LHDA 4US8A 5BYQA 4IM3A 3PTFC 2N9LA 2ZEQA 2QEJC 1WZ0A 1I4XA 3SU8X 1RM6C 1FXAA 4I6NB 2MBHA 4M00A 4MGIE 4GIVA 3DBLI 4L23A 2KVZA 2OJWA 3DQVA 5FKAC 1J7CA 1WY8A 2LMCA 1L4ZB 5L83A 4FXCA 3ZJUA 4JIOU 2L3ZA 1YIWA 4PS3A 2WHIA 4YWGG 2EKEC 1UH6A 1FCLA 1P7FA 2KC2A 3GE8C 3ENEA 1Q0WB 4OZAA 1JQ4A 4DDGD 4B6WA 3HIZA 5DCNA 5DPRA 3DWMA 1RYJA 2R2OA 3PRMB 1IGDA 4IUMB 1V2YA 1WX8A 4F1SA 4M0WA 5CHFA 2K22A 1MI0A 2XK5A 1V1PB 1FIQA 3RZFA 2BS3B 5BMGA 3K9OB 2LASA 4ASWC 2YEPF 3A9KA 2J42A 2OHFA 1Q1OA 1T0SC 1XCTL 5LLIA 1ZXIA 3VUXA 2WXJA 3PZ8A 1JROA 2V9HA 1GC6A 2LGYA 4EEWA 4IDIA 5G5GA 4PK1A 3AI5A 3ALBA 2BYEA 3VDZA 2QC8A 2KTFA 3M63B 4LK0M 2JF5A 2YEPB 2NVUI 1WXAA 2D3BA 3TIXA 1GB4A 1F9JA 4J3OD 1HZ6A 2DAFA 2IO3B 1WIAA 3C8YA 2H88B 2PJHA 3MJWA 3IXSA 4A20A 1SE3A 3RN9C 4TQ1A 2LEKA 3QJZA 1JW9D 2CKHB 1OGWA 4OHJA 3BK2A 5H92C 4HKZE 2N4FA 5DPWA 3CWIA 3TSSA 1ZGUB 3B2GA 4BOZB 1WJNA 2WXFA 4WAAA 4GSWA 3N32A 3DBRB 2UYZB 2DZIA 5IO9A 3MFGA 1MG8A 4AP4C 1WXQA 2KMCA 1GC7A 4K81A 1DGJA 1OTRB 3QWZB 1AW7A 2MJEA 2QMTA 5C1ZA 1EU3A 2FCQA 4EOYA 5JZEB 1GPXA 2MWSB 3AEGB 3Q2AC 3U4EG 3U30A 1CJEA 2V4LA 1OEYA 1GAQB 4OVVA 2L00B 4NJ6A 3ECIA 3RUIB 3AE6B 2FIFA 1WE7A 4G50A 1C3TA 1I4RA 4ZHPA 1QLBB 1ZXHA 2GMIC 4EKUA 2EELA 3AE9B 2JRIB 3WIMA 2M1MA 3RPFC 1M4VA 1BXTA 1IP9A 4II2B 3T3OA 3BY4B 5CX3A 4FA6A 4C80A 1YNTE 3R2TA 1WH3A 1FRDA 1KLGD 1CZPA 3L4PA 2WNMA 3GOEA 4TSSA 3UF8A 4FLHA 2DENB 5G2NA 3T9LA 5IKCM 4WWOA 1C1YB 3DBHB 3JW0X 2JWUA 4A90A 2O6VB 4A9AA 3IVFA 4NZLB 1GB1A 3AE8B 3P4RB 1RLFA 2R2QA 4WWMA 3ZJVA 4ANUA 2DYMA 3E9SA 2DLBA 4ARIA 4KIKA 3FILB 2M8SA 2HTME 2KO3A 1ZKHA 1HXYD 3L08A 3PGEA 1EWYC 3UQAA 5CHVC 2K6QA 4YSZB 3WALA 5HKHA 1YMHE 2GB1A 5TR5A 5IP4D 2BS2B 2KDFB 4WIPA 3DOWA 1L5PA 4IKGA 1SF0A 3KUZA 2PEAA 3U8ZA 4TQ0A 3ZRFA 4HWIB 2J53A 1TZ1A 4BOSC 3VVWB 3AE3B 3VRBB 4ZHOA 3CSTA 2PMVA 2GBMA 1P0RA 3PREA 3L13A 5HHDG 4AJYB 2D3CA 4P1CC 3VTVA 2ZW0A 2EMSA 1F52A 1TKEA 3QX1A 2LVQA 3AU5A 1PUTA 1KOTA 4K7UA 3UQBA 2CU1A 1TKGA 1I42A 1TS3A 3VR9B 4LNFA 1NENB 3QQ8B 2IO2B 2KN4A 1XD3B 3DCGA 1TS5A 2NCNA 1EUVB 3P4QB 4TMAB 5GMVA 2MEKA 4RM8A 3RYTA 3ZTCA 4GDLA 4PS7A 1WYWB 3HHMA 1AYFA 1WXSA 1RRBA 2KFJA 4MT5A 3KWVA 2WS3B 1V9JA 4O1NA 1K51A 3QA8A 1OQRA 4NAMA 2DWQA 4DQOC 2J7QB 4KV2A 2CHWA 5CHWA 3WAPA 4K7WA 1RWSA 2FCMA 2I1JA 2RGFA 1MHXA 3NRZA 2L0FA 3NVVA 3P1MA 4DHJB 1P9DU 2WXKA 1TGZB 3HRDD 3BIID 4CYEA 3RNCC 3BVZA 1DOIA 1WZ3A 2AWTA 2O2VA 2Z59B 3W2DA 1I4QA 4KDIC 2E6XA 1C4CA 3HVDA 3ZUNA 3EECA 4II3B 4B9KA 4JE3B 3TMPB 2L05A 2DZMA 2KMMA 4B0MA 2BYVE 1TBEA 4NJ7A 4YTMB 5KHQA 3Q14C 3DBSA 3W9CB 1F2RC 2K8CA 5AUIA 3ZQ4A 1IPGA 3EUB2 3TEZA 2LVOA 4HPLB 1E8WA 2WXGA 1Z5SB 2LVPA 1E8YA 2K5PA 3MHZA 3RMKC 4BAXA 1SB3C 5EDSA 1S3SG 2KX3A 2YVCA 2XNAC 1VCBA 4W9EA 1WM2A 3ZW3A 3RZWC 3HUIA 3ZIMA 4L2YA 4PYZA 3MP9A 4C4VA 3H6NA 1TT5B 1GUAB 4AS1A 2WXMA 3ZXRA 4LNOA 2XN9C 2LGSA 5TSSA 5AEKB 1XQQA 2HJ8A 2X8XX 3W5UB 1XLQA 3H7SA 4FN2A 1KTKA 4RCOA 1A70A 3VTUA 3TJPA 1XXGA 1L0VB 4BKSD 1YN4A 3RT3B 2KC1A 4C56C 4PS8A 1FD6A 4WWNA 4K3CA 3QAQA 2MA9B 1VZ8A 3EHVA 4HRSA 1YN5A 5IAAC 1M94A 2ONQA 4CHKA 3PS6A 5L95C 4LDTD 2INDC 3B2FA 2EKIA 2GBJA 4DXGA 4RGMA 2KQSA 5AZGA 1EF5A 4WQOB 1RFAA 3V61A 2NBUA 1TY0A 2MCNB 1E7PB 1UWMA 3AXCA 3B08A 4M0WB 5MPOA 2RPVA 1BUIC 1YD8U 3N1XC 4WAFA 4EZJA 4IWQA 3Q3JA 1ENFA 4HCPB 4MGKE 4DBGA 2Z0EB 3ZYYX 3B0AA 2MBQA 3QCAA 4KGRA 2C7NB 2AEHA 3PPAA 2ZCCA 3SR6A 2KFKA 2PTLA 4NPNA 3SDLC 4UDUC 2J4XA 2Y3AA 4REZA 5DPSA 5D7GA 4RF0A 1ZPSA 3MC9A 5AUKA 3W1SA 2FNJB 3FKYA 4M8NA 2LJIA 1XLNA 4WJNA 1FXTB 3N30A 3IHPC 2V0GA 2DYOA 1UGMA 2W82A 4LNNA 1OFFA 4E71A 2J0JA 1SEBD 2KDMA 2INCC 1PDXA 4GDKA 1KJTA 3FAHA 3URYA 3GZNI 3N9YC 3KH0A 3LYYA 1I4PA 3I3TB 1PGBA 3SFDB 2JZ3B 4FBJB 4YSXB 1Y8RC 1N6ZA 3O65B 4WJPA 1OQQA 2DZJA 2QDFA 4RM9A 3ZLZA 1VD2A 5EE0A 4A3PA 3EFUA 1FM0D 1ESFA 2GLSA 2IGGA 2D07B 4AWJA 4B95A 2RD0A 2WX0A 3U52E 2Z0DB 2AL6A 4US9A 2MSED 1LGRA 2K3UA 2R61A 3NS8A 2G3QB 4HJKA 2LGXA 1HTQA 5BYSA 1HA5A 2KWDA 3ZVVA 2FCNA 1K8RB 3VHTC 3T8MA 2WLBA 4HK2A 3V6EB 2BYTA 1C77A 2RDGA 2M4NA 3KUCB 3JSVA 1NI3A 4IM2A 3ONSA 1SJED 3TEWA 3TUOA 5LNK1 1UF0A 2RDBC 2WXLA 1JMLA 5C2TB 1OEYJ 2FUG1 2FAZA 2KQ7A 2BW2A 2BWFA 1L6VA 1CQVA 3DVGX 2MP2A 2FUHB 1VR9A 2INPE 3CMMB 3NOBA 3U7DA 2E3TA 1TTNA 4ANWA 3PT2B 1HQRD 1LO5D 3Q3MC 2LUEA 2KT7A 1WMHA 1PGXA 2EMTA 2PLPA 1QOAA 4WURA 2K0PA 3GB1A 3UGBB 3QARA 2X38A 2O6VD 2KYWA 1XLOA 2Y5PA 3P42A 2G45B 3BK1A 1VLBA 1D4BA 3UIOB 2K8HA 1L0YB 3DHGC 1WGKA 1K50A 1MHHE 5E6JA 1ISNA 2KJRA 4KIKB 1QKZA 2GI9A 1DOXA 2RPQA 4MM3A 3KWLA 1V5OA 5BMIA 2WDQB 3N1ZC 2DAJA 2IGDA 4NQLB 3SEBA 3GE3C 2IZVB 2J0KA 2LUMA 3M62B 2IJ0A 1WJ4A 2MX2A 1EU4A 4S0RA 3DVNU 2ON8A 2K1FA 4P16A 3VR8B 2MJDA 3LDZE 4IC7B 1C76A 4HPPA 3NJTA 4AJWA 4HKQA 3R3MA 3A4SC 4MSQB 1R4NB 1JWBD 4JL9A 3AE5B 1T0YA 2WGSA 4GU2A 2KDIA 3Q8AA 2KXJA 1E7UA 3PVLA 3SHQA 5KHOA 5AZHA 4GMVA 3IAS1 4DHZB 4W9CA 1NBFC 4BKSA 4W9DA 1QQRA 2QCZA 4G0NB 1JWUD 4TUUA 1XO3A 5EE3A 2KAJA 1G6JA 3ML8A 1WFYA 2HTHA 4N9F4 1SGHA 2ICIA 5IOIA 2D11A 2N1WA 4GDLB 1H8CA 1UUPA 1WGYA 2DBYA 4TV3A 4N58A 4USAA 1SBBB 3ZNZB 2GRIA 1Q10A 1WM3A 3U2SC 2ASQA 4XZ4A 4KKIA 5H8YE 1YOVB 1ZDVA 5JXVA 3RD2A 2JT4B 2KTRA 4DHJD 1E0ZA 1AARA 1KLUD 2MLBA 2GOWA 3BWUD 3NZ3A 2OOBB 3AE1B 1YQ4B 1I7HA 2FIDA 1ZP0B 1WJUA 2NR2A 2LGDA 4RGOS 2VH1A 1WGDA 2LWPA 3V62A 4M8MA 2NTTA 3AB5A 3ZKJC 2H89B 2A5UA 3QHTA 2WXOA 1FMAD 3EA6A 3L10B 4KGSA 1JRPA 1QILA 4MSMB 3U7ZA 3KYDD 4ICVA 4ZOHC 1MJDA 4MGZE 1DYQA 4DK5A 1NYRA 5J18A 2KK8A 2W55A 1WYGA 3Q3OC 1PYWD 3Q8EA 3C0RB 3LJ3A 4EUTA 3AU4A 2UU7A 4HLEA 2NBVB 1PGAA 4A55A 2QILA 2UWQA 1UBQA 3AE4B 3DBLB 2V3NA 3ZTDA 4JPSA 3NUHB 2WU5B 3NS1A 4Q2JA 3HVZA 3AEBB 4NJCA 2LHEA 2N7EA 3NY5A 4C4VB 2K6DB 2I2YA 2N1VA 3C19A 4XWTA 2QIEB 1S1QB 2NPTB 4K3BA 1IBXB 1TYGB 1MFWA 4GLSC 3PHWB 2XEWA 1QOBA 4MEMA 3VH4B 2IDYA 4RF1A 1N63A 3NVWA 2RDHA 1K52A 3NZUA 4HPMB 1WRIA 3A9JA 3A1QB 5AZFA 1T6BX 2FBWB 1WF9A 1VZ7A 2M19A 2K25A 1KM7A 1E9MA 4HROA 1I4HA 5FR3A 2SAKA 1UD7A 2BS4B 3I57A 4K7SA 2KWVB 4W9GA 1WGHA 3WAMA 1TY2A 3IT6B 1DOYA 2VZKB 3NVYA 3Q3FA 2KJHB 4P6VF 1L2NA 1R7SA 2JZPA 1KRHA 1E8XA 3APFA 4EZKA 4YTNB 2ZNVB 3M95A 2BWES 1Z2MA 1V6EA 1V80A 4URKA 2ZPNA 4FADA 4PYUA 3QIJA 4XDCA 2KLCA 1J7BA 4LNKA 2AYOB 3A4RA 1Q5WB 3TL5A 2MJ3A 3VTWA 4RGTA 2LJ5A 4IW0A 2O6VA 3B1LX 4RH6A 2IBIB 2BB6A 2V1YA 2KFKB 2WXHA 3RFZB 3RNEC 4ANVA 3FC4A 2WXNA 1FNUA 4GXBA 1FFVA 1SXTA 2LRUA 2D3AA 4KX6B 2WYQA 2D3GA 2WU2B 3ZJTA 2MBEA 2JWZA 1XLPA 3I63C 1XEEA 3APDA 2PVGC 4A3OA 4XWWA 2AL3A 4NNJB 1N61A 2ZJDA 2J52A 4MJSA 4RMAA 2QJLA 5D94A 1KF6B 3TEXA 4GDKB 1V86A 3QC8B 1J0GA 2BTEA 1XF5L 1E6EB 2KDBA 3I5JC 3Q8BA 5IA7A 4NAWA 1LM8B 1EM7A 5DPTA 3V6CB 1XCQL 5G55A 3KLSX 1ZUD2 1BT0A 1AN8A 4DXFA 3NG0A 2BPSA 3DBRI 4M01A 2W3SA 1WE6A 4D2KA 5HG2A 4K1RB 4EZLA 1FNWA 1N5XA 1P1AA 1WX7A 4X57B 2ZVOA 2LGIA 2TSSA 1TIFA 4MDKE 4XYCA 2W3RA 1SE9A 3MC8A 2LFIA 1QZEA 2KZRA 3OLMD 4W9JA 2CS4A 3Q8FA 2I38A 3VXWA 2QHOA 3VRAB 2CJOA 3NVZA 3JSVB 2MRPA 1JWSD 2XK5B 3RNGC 4ARCA 3ETRA 3A9KB 1J19A 4OVUA 2DNFA 1VZ6A 1NEKB 1ET9A 1STEA 1D5MC 1B1ZA 1NI2A 2N9KA 1N5WA 3VQIA 1IYFA 2A4ZA 2Y5BB 3EFCA 2KOXA 4LNIA 4FJZA 1E8ZA 2IY0B 2Y5CA 1WMHB 3ZNID 2N7DA 4L1BA 4ICUA 5BMHA 2Z8LA 2LXCA 2BKRB 3AEEB 2PW9A 4B0EA 1EF1A 5EE9A 2MHJA 4C7YA 4C00A 3A33B 2N9XA 4LJOB 2KMAA 2K9XA 3MHSD 3RCZA 2JRHA 3UINB 4FHKA 4KKJA 2JUOA 3SFEB 2NTSA 3NHEB 2CJNA 3S2AA 4C7ZA 2DZKA 1B9RA 2C5LC 5D2MB 4AOFA 2ZNVC 1WJ6A 2C9WB 4G11A 4XDDA 2G4SA 5HFYA 1L4DB 2BGFA 3V3XA 3ZXVA 1ZE3D 2PE9A 3H9DA 2V3SA 2JX5A 1KH0A 2GBKA 3HM6X 5D3IB 2J0MA 3AULA 4YSYB 4CQNA 3AV8A 2CHXA 3JVZX 2NBWB 3BYYB 1C4AA 1QT9A 3JYUA 5FR6A 1P7EA 1FNVA 2HJ1A 1JALA 1HEZE 3PSEB 1GJZA 1WR1A 2LD9A 1V49A 2KX0A 3RULA 3N20C 4LLGM 3ZO5B 3P4PB 1HZ5A 2JY6A 2C7MB 2RMMA 3W1SC 3RNFC 4P1BC 1EWCA 4R3DA 4JWSC 3PO0A 2HD5B 3AMZA 3DHIC 2AX5A 4LDTB 2C7HA 2JXXA 2C60A 3V05A 4JWUC 3QK0A 4ZRIA 3RNBC 3Q6BA 3PHXB 1UELA 4KDLB 1L7YA 3APCA 5EE1A 4BZAA 2QSDA 2KTRB 3P63A 4W9IA 3ZDMC 4WH4A 1AWDA 2KDEB 4ZRJA 3R7QA 2KN5A 3WAOA 4YTPB 3EC8A 3BVMA 4F8CB 3M3JA 4ANXA 2NMQA 2WXQA 3P2BA 4MELA 2AQ3B 1TS4A 2JVCA 3H7PA 2N0SB 3AE2B 2K39A 3UI3A 1F77A 3I9V1 2BF8B 1WXVA 2GBRA 1OQYA 4MACA 1LQBA 1YJIA 2JXTA 4G3XB 4JQWC 3ZNHB 1V5TA 2ZPYA 2YLMA 1IGCA 4WQMA 4W9FA 2PE6B 4RNAA 1WGGA 2G4DB 2M56B 2BB5A 3AM9A 4RGNA 1MPEA 3L16A 1A5RA 1V1OA 2I1KA 3PRPB 2SEBD 3OWEB 1D3ZA 3AEFB 2FCSA 5JH5C 1T0RC 3CSFA 1E10A 4A6QA 4OW0A 3IBEA 1ET6A 3O13A 2D5GA 1YQ3B 1CK1A 2IO1B 2FE8A 1YJJA 4EE2A 3TEYA 5J2RA 2G1EA 1U4AA 1JWMD 3B9JA 2KACA 4BVUC 2WXRA 4GB9A 3P4SB 1ZOYB 3DWGC 5GXGB 2L1AA 4IG7B 2BYFA 2KWCA 1Y56A 1C9FA 2IY1B 2INNE 3CIRB 2M17A 4P7IA 3AE7B 2D10A 2MBBB 5J17A 2MBOA 1TJEA 2W9NA 3KQ4A 3A9JB 3LB8C 3OJ4B 4BBNF 4OZBA 4NQKE 1WRDB 4WWPA 4N6EB 1R4MI 2ZW1A 2NS5A 3HM3A 4IWOA 4HCNB 2LZ6A 5E6PA 1V1PA 1FCCC 1WX9A 2VZKD 3OG5A 4IM0A 1L6UA 2WWZA 3DVGY 4YL8A 4A8XC 5E6NA 1JRUA 3J9CA 3T3NA 2L8JA 3BYTB 2WX1A 2XBBC 1C79A 2V3PA 4ZRPA 2B3AA 2O2VB 3LXFA 3SD5A 5I4DA 1FRRA 4GN1A 2KD0A 3TBLD 1KFYB 1UNSA 4NY0A 2JPHA 3X23A 1D5ZC 4H2AA 3TCAA 4BKGA 4CO7A 5C23A 4DXAB 2DX5B 4LCDE 2IO0B 4W9KA 3DVNV 4WJOA 5CTRC 1I4GA 3AEDB 4YT0B 4I6LB 4KZ0A 4KSLC 1P3QU 3GZNB 4ZRKA 2ACZB 2VH2A 3N3KB 1ACCA 3KYCD 2N7JA 2ZZPB 5D6JB 1E7VA 1D6EC 5FK9C 2RR9A 1IUEA 3PZ7A 4ACFA 2MH7A 2CR5A 1K53A 3VUWA 4XX5A 4BKTA 2KKCA 2KANA 3WANA 1FEHA 4GOCA 1SJHD 1PFDA
chains in the Genus database with same CATH topology
1LXDA 3I3TB 4MJSB 2KDBA 1KLVA 1MG8A 5IA7A 4NAWA 1LM8B 2JZ3B 4AP4C 4FBJB 2KMCA 3VUYA 4ZDVA 1GC7A 4K81A 5DPTA 1Y8RC 3V6CB 3O65B 4WJPA 4E74A 1OTRB 2DZJA 3QWZB 4NAWB 4RM9A 1VD2A 5G55A 3ZLZA 4A3PA 3H1UA 2KNBA 3R66C 3EFUA 2GBNA 2D07B 5C1ZA 3PLVA 2FCQA 3ZNGC 1BT0A 4AWJA 2RD0A 4B95A 2WX0A 4EOYA 2Z0DB 3OJ3A 2BPSA 2AL6A 5JZEB 2MSED 3W1YA 2MWSB 3DBRI 3NS8A 1WE6A 2G3QB 4HJKA 3U30A 2LGXA 4K1RB 4EZLA 2KHWB 2V4LA 1OEYA 4OVVA 1P1AA 1WX7A 2L00B 4FULA 4NJ6A 3ECIA 4X57B 3ZVVA 2ZVOA 3RUIB 2FCNA 2FIFA 1WE7A 4G50A 4MDKE 1C3TA 4I6PA 1K8RB 1SE9A 3VHTC 3T8MA 4HK2A 3V6EB 3ML9A 1QZEA 2KZRA 3OLMD 4W9JA 4XC2A 2CS4A 3K9PB 2GMIC 1UZXB 2M4NA 3KUCB 4EKUA 3JSVA 1UBIA 4HDQA 3VXWA 2JRIB 3WIMA 2M1MA 3ONSA 4IM2A 1H4RA 2QHOA 3X0WA 3JSVB 2N9PC 2MRPA 3UIPB 2XK5B 1CMXB 1IP9A 1RAXA 1OEYJ 2REXA 2FAZA 2KQ7A 3BY4B 4II2B 4JLCA 5CX3A 2BWFA 4DHZE 4FA6A 3A9KB 4WJQA 3OAWA 2D2QA 3DVGX 1J19A 4OVUA 2PPHA 1WH3A 2MP2A 1NDDA 4GGQA 2FUHB 2KVRA 4W9HA 1NI2A 3CMMB 3NOBA 3DDCB 3U7DA 1TTNA 4ANWA 3VQIA 3PT2B 3VAWA 3GOEA 3UF8A 1SIFA 4FLHA 2LUEA 1IYFA 2A4ZA 2DENB 2Y5BB 5G2NA 2KOXA 3T9LA 1WMHA 4FJZA 2EMTA 1E8ZA 4WWOA 1C1YB 3UGBB 3JW0X 2IY0B 3QARA 2O6VB 2DHZA 1WMHB 3ZNID 3ZDTA 2O6VD 2CHZA 2N7DA 3IVFA 2K8BA 3L0WB 1RLFA 4ICUA 2R2QA 2G45B 4LJPB 5E6OA 4FJYA 2MQJA 3UIOB 4E3CA 2LXCA 4ANUA 2BKRB 2DYMA 2K8HA 3PRZA 1EF1A 1GG3A 4KIKA 2M8SA 2KO3A 1ZKHA 2BKFA 2N9XA 3A33B 3L08A 3PGEA 3V60A 4LJOB 1ISNA 3IG3A 3UQAA 2KJRA 2KMAA 5CHVC 2K6QA 4KIKB 2RPQA 4MM3A 1V5OA 3WALA 5HKHA 2DAJA 3MHSD 1WI0A 2IYDB 3RCZA 2JRHA 5TR5A 3UINB 4FHKA 4NQLB 2KDFB 2IZVB 2J0KA 3DOWA 2DYBA 2JUOA 3KUZA 4HVBA 3NHEB 1E5WA 1YJ1A 3KUDB 3M62B 3S2AA 1WJ4A 2MX2A 2DZKA 2C5LC 2N9EB 2PEAA 1YX5B 3DVNU 3KW5B 3L54A 2K1FA 4JGHB 3U8ZA 3VFKA 4TQ0A 3ZRFA 5D2MB 1PQSA 4AOFA 3LDZE 4HWIB 4IC7B 2ZNVC 4HXDA 4BBNC 1TZ1A 1WJ6A 4AJWA 4BOSC 3R3MA 2C9WB 3A4SC 3MTNB 4G11A 4MSQB 3VVWB 2ZVNA 2G4SA 4BFRA 2BGFA 4JL9A 1LFDA 1T0YA 2PE9A 3CSTA 4GU2A 3H9DA 2GBMA 2V3SA 1P0RA 2KDIA 3PREA 3L13A 2GBKA 3HM6X 4AJYB 2HE7A 2J0MA 1E7UA 2KXJA 3AULA 3PVLA 3VTVA 2CHXA 4FHJA 3SHQA 2NPTA 3JVZX 5AZHA 5KHOA 5JHBA 2EMSA 2LVQA 4GMVA 3QX1A 3PLUA 5BO4B 2MW5A 2NBWB 3AU5A 3HK0A 3JYUA 5FR6A 4TKNA 1KOTA 4K7UA 4DHZB 1WGRA 2KWUB 2L0TA 2OJRA 4W9CA 2CU1A 3UQBA 1I42A 1NBFC 4BKSA 1GJZA 3PSEB 3QQ8B 1WR1A 2IO2B 2LD9A 1XD3B 1V49A 4W9DA 2KX0A 3RULA 3DCGA 4G0NB 1R4NI 2NCNA 4TUUA 1EUVB 5GMVA 4IWPA 3ZO5B 1G6JA 4RM8A 3ML8A 2JY6A 1WFYA 1WXMA 3RYTA 2C7MB 2HTHA 3W1SC 3A1QA 4GDLA 3ZTCA 4PS7A 1WYWB 3HHMA 4KZCA 4N9F4 1SGHA 4W9LA 1WXSA 1RRBA 2KFJA 2M0XA 2D11A 2N1WA 2HD5B 1V9JA 1EO6A 3CF6E 4GDLB 1H8CA 1WGYA 2WDTB 4TV3A 3QA8A 4DDID 4LDTB 4KSKC 2C7HA 2JXXA 2L7RA 3D32A 1YX6B 2J7QB 2C60A 1V81A 3IFWB 4KV2A 2CHWA 5CHWA 3QK0A 4K7WA 2VRRB 4ZRIA 3WAPA 3ZNZB 2FCMA 1WR6E 2I1JA 1WM3A 2RGFA 2ASQA 4XZ4A 4EFOA 3NZSA 3ZRCA 3PHXB 3VH3B 1J8CA 2L0FA 3RD2A 4DHJB 1I35A 1UELA 2JT4B 2KTRA 4DHJD 1P9DU 4KDLB 4J6IA 2MP2B 1AARA 1L7YA 3APCA 1TGZB 4HDOA 2MLBA 2GOWA 4FJVB 2KTRB 5JHAA 2OOBB 4CYEA 2FIDA 4W9IA 3ZDMC 1WJUA 1WZ3A 2NR2A 2AWTA 2KDEB 2LGDA 4MH0E 2O2VA 2KJ6A 1WGDA 2Z59B 4KVGB 2KN5A 2LWPA 4ZRJA 3R7QA 4KDIC 4DWFA 3WAOA 3BINA 3V62A 4M8MA 1GNUA 3ZKJC 3ZUNA 3EECA 2A5UA 3EC8A 1XT9B 2KLGA 2JZZA 2L76A 3QHTA 3M3JA 1HE8A 4II3B 4B9KA 4ANXA 4F8CB 3P2BA 4MELA 3TMPB 2L05A 2DZMA 3L10B 2JVCA 2BYVE 1TBEA 3H7PA 4NJ7A 1ZW7A 2K39A 4MSMB 1E90A 3KYDD 3H7PB 5KHQA 5LXIB 4ICVA 2BF8B 1P98A 1WXVA 3DBSA 2GBRA 1OQYA 1LQBA 5LXHA 4G3XB 4MGZE 2K8CA 1YQBA 3PV1A 4JQWC 3ZNHB 3DBHI 1V5TA 3R7RA 2ZPYA 2YLMA 1IPGA 4DK5A 3PZDA 5J18A 2KK8A 4W9FA 2PE6B 1WGGA 2LVOA 2G4DB 4HPLB 1E8WA 2RSUA 1Z5SB 2LVPA 3C0RB 3LJ3A 4EUTA 1E8YA 3AU4A 1X1MA 4HLEA 2NBVB 4ZYNA 3L16A 1A5RA 3L17A 3WA0A 5EDSA 2I1KA 3PRPB 1S3SG 2KX3A 2UWQA 1UBQA 2YVCA 1VCBA 4W9EA 1WM2A 3ZW3A 3DPDA 3KVFB 3RZWC 4AUQC 2LI5A 2FCSA 5JH5C 3ZTDA 1D3ZA 2ZCBA 3ZIMA 4PYZA 4F7ZA 2LRWA 3CSFA 4MGYE 3IBEA 2LXAA 3H6NA 1GUAB 2N7EA 3NY5A 4IM3A 3PTFC 2IO1B 5AEKB 1XQQA 2HJ8A 2ZEQA 2K6DB 1WZ0A 2N1VA 3SU8X 3H7SA 1S1QB 4FN2A 4I6NB 2MBHA 4MGIE 2NPTB 4GIVA 3DBLI 5J2RA 1U4AA 3DQVA 3PHWB 4BVUC 2XEWA 3VH4B 4MEMA 3VTUA 4GB9A 3TJPA 1WY8A 4BKSD 5L83A 4IG7B 3RT3B 2KC1A 2BYFA 4PS8A 4JIOU 2L3ZA 2KWCA 1YIWA 3NZUA 4WWNA 4HPMB 4PS3A 2EKEC 2IY1B 3QAQA 1UH6A 3A9JA 2M17A 4P7IA 2KC2A 2MA9B 3A1QB 1Q0WB 3ENEA 5AZFA 2D10A 2MBBB 1WF9A 2MBOA 3EHVA 5J17A 4DDGD 4B6WA 2K25A 2W9NA 5IAAC 1KM7A 3A9JB 1M94A 3OJ4B 4CHKA 4BBNF 3PS6A 3HIZA 5L95C 4LDTD 5DCNA 1UD7A 5DPRA 4NQKE 4K7SA 1WRDB 4WWPA 2KWVB 1R4MI 4W9GA 2R2OA 1WGHA 3WAMA 2GBJA 2KQSA 2NS5A 3HM3A 3PRMB 4IWOA 4HCNB 4IUMB 5AZGA 2LZ6A 1EF5A 4WQOB 1RFAA 3V61A 1V2YA 5E6PA 3Q3FA 2KJHB 1WX8A 4F1SA 1WX9A 5CHFA 1L2NA 4IM0A 2NBUA 2WWZA 3DVGY 4YL8A 2MCNB 3AXCA 2XK5A 3B08A 4M0WB 3RZFA 3K9OB 2LASA 1YD8U 5E6NA 1JRUA 3A9KA 4ASWC 1E8XA 4EZJA 3APFA 1Q1OA 4EZKA 5LLIA 3VUXA 2ZNVB 3M95A 4IWQA 2BWES 2L8JA 1Z2MA 1V6EA 3Q3JA 4HCPB 4MGKE 1V80A 2WX1A 4URKA 2ZPNA 4DBGA 2Z0EB 2XBBC 4FADA 4PYUA 2B3AA 3QIJA 1GC6A 2O2VB 2LGYA 2KLCA 3SD5A 3B0AA 4EEWA 2MBQA 2AYOB 3QCAA 3A4RA 4GN1A 2KD0A 2C7NB 1Q5WB 2AEHA 3PPAA 3TL5A 3TBLD 3VTWA 3AI5A 3ALBA 2BYEA 2ZCCA 2LJ5A 4NY0A 4IW0A 2JPHA 3X23A 2O6VA 2KFKA 3B1LX 4NPNA 3SDLC 3VDZA 3TCAA 4BKGA 2IBIB 2KTFA 3M63B 5C23A 4CO7A 4DXAB 2DX5B 2V1YA 2JF5A 5DPSA 2KFKB 2NVUI 1WXAA 4LCDE 5D7GA 3TIXA 4ANVA 2IO0B 4W9KA 1F9JA 3DVNV 4WJOA 5CTRC 4GXBA 3W1SA 2DAFA 2IO3B 1WIAA 2FNJB 2LRUA 4I6LB 4KZ0A 4KSLC 2PJHA 3MJWA 4M8NA 4A20A 1P3QU 2WYQA 4ZRKA 2D3GA 4WJNA 1FXTB 3N3KB 4TQ1A 3KYCD 2MBEA 3N30A 3QJZA 2CKHB 2JWZA 1OGWA 2ZZPB 5D6JB 3IHPC 1E7VA 2DYOA 1UGMA 2RR9A 3APDA 4E71A 2N4FA 2J0JA 1J0GA 2CR5A 3VUWA 4A3OA 5DPWA 1ZGUB 4XX5A 4BKTA 2KKCA 2AL3A 4BOZB 4GDKA 2KANA 4NNJB 2ZJDA 3WANA 1WJNA 4WAAA 1KJTA 4GSWA 3N32A 4MJSA 4RMAA 2UYZB 3GZNI 5D94A 4GOCA 4GDKB 3KH0A 1V86A 3QC8B 2DZIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1LXD A;  3I3T B;  4MJS B;  2KDB A;  1KLV A;  1MG8 A;  5IA7 A;  4NAW A;  1LM8 B;  2JZ3 B;  4AP4 C;  4FBJ B;  2KMC A;  3VUY A;  4ZDV A;  1GC7 A;  4K81 A;  5DPT A;  1Y8R C;  3V6C B;  3O65 B;  4WJP A;  4E74 A;  1OTR B;  2DZJ A;  3QWZ B;  4NAW B;  4RM9 A;  1VD2 A;  5G55 A;  3ZLZ A;  4A3P A;  3H1U A;  2KNB A;  3R66 C;  3EFU A;  2GBN A;  2D07 B;  5C1Z A;  3PLV A;  2FCQ A;  3ZNG C;  1BT0 A;  4AWJ A;  2RD0 A;  4B95 A;  2WX0 A;  4EOY A;  2Z0D B;  3OJ3 A;  2BPS A;  2AL6 A;  5JZE B;  2MSE D;  3W1Y A;  2MWS B;  3DBR I;  3NS8 A;  1WE6 A;  2G3Q B;  4HJK A;  3U30 A;  2LGX A;  4K1R B;  4EZL A;  2KHW B;  2V4L A;  1OEY A;  4OVV A;  1P1A A;  1WX7 A;  2L00 B;  4FUL A;  4NJ6 A;  3ECI A;  4X57 B;  3ZVV A;  2ZVO A;  3RUI B;  2FCN A;  2FIF A;  1WE7 A;  4G50 A;  4MDK E;  1C3T A;  4I6P A;  1K8R B;  1SE9 A;  3VHT C;  3T8M A;  4HK2 A;  3V6E B;  3ML9 A;  1QZE A;  2KZR A;  3OLM D;  4W9J A;  4XC2 A;  2CS4 A;  3K9P B;  2GMI C;  1UZX B;  2M4N A;  3KUC B;  4EKU A;  3JSV A;  1UBI A;  4HDQ A;  3VXW A;  2JRI B;  3WIM A;  2M1M A;  3ONS A;  4IM2 A;  1H4R A;  2QHO A;  3X0W A;  3JSV B;  2N9P C;  2MRP A;  3UIP B;  2XK5 B;  1CMX B;  1IP9 A;  1RAX A;  1OEY J;  2REX A;  2FAZ A;  2KQ7 A;  3BY4 B;  4II2 B;  4JLC A;  5CX3 A;  2BWF A;  4DHZ E;  4FA6 A;  3A9K B;  4WJQ A;  3OAW A;  2D2Q A;  3DVG X;  1J19 A;  4OVU A;  2PPH A;  1WH3 A;  2MP2 A;  1NDD A;  4GGQ A;  2FUH B;  2KVR A;  4W9H A;  1NI2 A;  3CMM B;  3NOB A;  3DDC B;  3U7D A;  1TTN A;  4ANW A;  3VQI A;  3PT2 B;  3VAW A;  3GOE A;  3UF8 A;  1SIF A;  4FLH A;  2LUE A;  1IYF A;  2A4Z A;  2DEN B;  2Y5B B;  5G2N A;  2KOX A;  3T9L A;  1WMH A;  4FJZ A;  2EMT A;  1E8Z A;  4WWO A;  1C1Y B;  3UGB B;  3JW0 X;  2IY0 B;  3QAR A;  2O6V B;  2DHZ A;  1WMH B;  3ZNI D;  3ZDT A;  2O6V D;  2CHZ A;  2N7D A;  3IVF A;  2K8B A;  3L0W B;  1RLF A;  4ICU A;  2R2Q A;  2G45 B;  4LJP B;  5E6O A;  4FJY A;  2MQJ A;  3UIO B;  4E3C A;  2LXC A;  4ANU A;  2BKR B;  2DYM A;  2K8H A;  3PRZ A;  1EF1 A;  1GG3 A;  4KIK A;  2M8S A;  2KO3 A;  1ZKH A;  2BKF A;  2N9X A;  3A33 B;  3L08 A;  3PGE A;  3V60 A;  4LJO B;  1ISN A;  3IG3 A;  3UQA A;  2KJR A;  2KMA A;  5CHV C;  2K6Q A;  4KIK B;  2RPQ A;  4MM3 A;  1V5O A;  3WAL A;  5HKH A;  2DAJ A;  3MHS D;  1WI0 A;  2IYD B;  3RCZ A;  2JRH A;  5TR5 A;  3UIN B;  4FHK A;  4NQL B;  2KDF B;  2IZV B;  2J0K A;  3DOW A;  2DYB A;  2JUO A;  3KUZ A;  4HVB A;  3NHE B;  1E5W A;  1YJ1 A;  3KUD B;  3M62 B;  3S2A A;  1WJ4 A;  2MX2 A;  2DZK A;  2C5L C;  2N9E B;  2PEA A;  1YX5 B;  3DVN U;  3KW5 B;  3L54 A;  2K1F A;  4JGH B;  3U8Z A;  3VFK A;  4TQ0 A;  3ZRF A;  5D2M B;  1PQS A;  4AOF A;  3LDZ E;  4HWI B;  4IC7 B;  2ZNV C;  4HXD A;  4BBN C;  1TZ1 A;  1WJ6 A;  4AJW A;  4BOS C;  3R3M A;  2C9W B;  3A4S C;  3MTN B;  4G11 A;  4MSQ B;  3VVW B;  2ZVN A;  2G4S A;  4BFR A;  2BGF A;  4JL9 A;  1LFD A;  1T0Y A;  2PE9 A;  3CST A;  4GU2 A;  3H9D A;  2GBM A;  2V3S A;  1P0R A;  2KDI A;  3PRE A;  3L13 A;  2GBK A;  3HM6 X;  4AJY B;  2HE7 A;  2J0M A;  1E7U A;  2KXJ A;  3AUL A;  3PVL A;  3VTV A;  2CHX A;  4FHJ A;  3SHQ A;  2NPT A;  3JVZ X;  5AZH A;  5KHO A;  5JHB A;  2EMS A;  2LVQ A;  4GMV A;  3QX1 A;  3PLU A;  5BO4 B;  2MW5 A;  2NBW B;  3AU5 A;  3HK0 A;  3JYU A;  5FR6 A;  4TKN A;  1KOT A;  4K7U A;  4DHZ B;  1WGR A;  2KWU B;  2L0T A;  2OJR A;  4W9C A;  2CU1 A;  3UQB A;  1I42 A;  1NBF C;  4BKS A;  1GJZ A;  3PSE B;  3QQ8 B;  1WR1 A;  2IO2 B;  2LD9 A;  1XD3 B;  1V49 A;  4W9D A;  2KX0 A;  3RUL A;  3DCG A;  4G0N B;  1R4N I;  2NCN A;  4TUU A;  1EUV B;  5GMV A;  4IWP A;  3ZO5 B;  1G6J A;  4RM8 A;  3ML8 A;  2JY6 A;  1WFY A;  1WXM A;  3RYT A;  2C7M B;  2HTH A;  3W1S C;  3A1Q A;  4GDL A;  3ZTC A;  4PS7 A;  1WYW B;  3HHM A;  4KZC A;  4N9F 4;  1SGH A;  4W9L A;  1WXS A;  1RRB A;  2KFJ A;  2M0X A;  2D11 A;  2N1W A;  2HD5 B;  1V9J A;  1EO6 A;  3CF6 E;  4GDL B;  1H8C A;  1WGY A;  2WDT B;  4TV3 A;  3QA8 A;  4DDI D;  4LDT B;  4KSK C;  2C7H A;  2JXX A;  2L7R A;  3D32 A;  1YX6 B;  2J7Q B;  2C60 A;  1V81 A;  3IFW B;  4KV2 A;  2CHW A;  5CHW A;  3QK0 A;  4K7W A;  2VRR B;  4ZRI A;  3WAP A;  3ZNZ B;  2FCM A;  1WR6 E;  2I1J A;  1WM3 A;  2RGF A;  2ASQ A;  4XZ4 A;  4EFO A;  3NZS A;  3ZRC A;  3PHX B;  3VH3 B;  1J8C A;  2L0F A;  3RD2 A;  4DHJ B;  1I35 A;  1UEL A;  2JT4 B;  2KTR A;  4DHJ D;  1P9D U;  4KDL B;  4J6I A;  2MP2 B;  1AAR A;  1L7Y A;  3APC A;  1TGZ B;  4HDO A;  2MLB A;  2GOW A;  4FJV B;  2KTR B;  5JHA A;  2OOB B;  4CYE A;  2FID A;  4W9I A;  3ZDM C;  1WJU A;  1WZ3 A;  2NR2 A;  2AWT A;  2KDE B;  2LGD A;  4MH0 E;  2O2V A;  2KJ6 A;  1WGD A;  2Z59 B;  4KVG B;  2KN5 A;  2LWP A;  4ZRJ A;  3R7Q A;  4KDI C;  4DWF A;  3WAO A;  3BIN A;  3V62 A;  4M8M A;  1GNU A;  3ZKJ C;  3ZUN A;  3EEC A;  2A5U A;  3EC8 A;  1XT9 B;  2KLG A;  2JZZ A;  2L76 A;  3QHT A;  3M3J A;  1HE8 A;  4II3 B;  4B9K A;  4ANX A;  4F8C B;  3P2B A;  4MEL A;  3TMP B;  2L05 A;  2DZM A;  3L10 B;  2JVC A;  2BYV E;  1TBE A;  3H7P A;  4NJ7 A;  1ZW7 A;  2K39 A;  4MSM B;  1E90 A;  3KYD D;  3H7P B;  5KHQ A;  5LXI B;  4ICV A;  2BF8 B;  1P98 A;  1WXV A;  3DBS A;  2GBR A;  1OQY A;  1LQB A;  5LXH A;  4G3X B;  4MGZ E;  2K8C A;  1YQB A;  3PV1 A;  4JQW C;  3ZNH B;  3DBH I;  1V5T A;  3R7R A;  2ZPY A;  2YLM A;  1IPG A;  4DK5 A;  3PZD A;  5J18 A;  2KK8 A;  4W9F A;  2PE6 B;  1WGG A;  2LVO A;  2G4D B;  4HPL B;  1E8W A;  2RSU A;  1Z5S B;  2LVP A;  3C0R B;  3LJ3 A;  4EUT A;  1E8Y A;  3AU4 A;  1X1M A;  4HLE A;  2NBV B;  4ZYN A;  3L16 A;  1A5R A;  3L17 A;  3WA0 A;  5EDS A;  2I1K A;  3PRP B;  1S3S G;  2KX3 A;  2UWQ A;  1UBQ A;  2YVC A;  1VCB A;  4W9E A;  1WM2 A;  3ZW3 A;  3DPD A;  3KVF B;  3RZW C;  4AUQ C;  2LI5 A;  2FCS A;  5JH5 C;  3ZTD A;  1D3Z A;  2ZCB A;  3ZIM A;  4PYZ A;  4F7Z A;  2LRW A;  3CSF A;  4MGY E;  3IBE A;  2LXA A;  3H6N A;  1GUA B;  2N7E A;  3NY5 A;  4IM3 A;  3PTF C;  2IO1 B;  5AEK B;  1XQQ A;  2HJ8 A;  2ZEQ A;  2K6D B;  1WZ0 A;  2N1V A;  3SU8 X;  3H7S A;  1S1Q B;  4FN2 A;  4I6N B;  2MBH A;  4MGI E;  2NPT B;  4GIV A;  3DBL I;  5J2R A;  1U4A A;  3DQV A;  3PHW B;  4BVU C;  2XEW A;  3VH4 B;  4MEM A;  3VTU A;  4GB9 A;  3TJP A;  1WY8 A;  4BKS D;  5L83 A;  4IG7 B;  3RT3 B;  2KC1 A;  2BYF A;  4PS8 A;  4JIO U;  2L3Z A;  2KWC A;  1YIW A;  3NZU A;  4WWN A;  4HPM B;  4PS3 A;  2EKE C;  2IY1 B;  3QAQ A;  1UH6 A;  3A9J A;  2M17 A;  4P7I A;  2KC2 A;  2MA9 B;  3A1Q B;  1Q0W B;  3ENE A;  5AZF A;  2D10 A;  2MBB B;  1WF9 A;  2MBO A;  3EHV A;  5J17 A;  4DDG D;  4B6W A;  2K25 A;  2W9N A;  5IAA C;  1KM7 A;  3A9J B;  1M94 A;  3OJ4 B;  4CHK A;  4BBN F;  3PS6 A;  3HIZ A;  5L95 C;  4LDT D;  5DCN A;  1UD7 A;  5DPR A;  4NQK E;  4K7S A;  1WRD B;  4WWP A;  2KWV B;  1R4M I;  4W9G A;  2R2O A;  1WGH A;  3WAM A;  2GBJ A;  2KQS A;  2NS5 A;  3HM3 A;  3PRM B;  4IWO A;  4HCN B;  4IUM B;  5AZG A;  2LZ6 A;  1EF5 A;  4WQO B;  1RFA A;  3V61 A;  1V2Y A;  5E6P A;  3Q3F A;  2KJH B;  1WX8 A;  4F1S A;  1WX9 A;  5CHF A;  1L2N A;  4IM0 A;  2NBU A;  2WWZ A;  3DVG Y;  4YL8 A;  2MCN B;  3AXC A;  2XK5 A;  3B08 A;  4M0W B;  3RZF A;  3K9O B;  2LAS A;  1YD8 U;  5E6N A;  1JRU A;  3A9K A;  4ASW C;  1E8X A;  4EZJ A;  3APF A;  1Q1O A;  4EZK A;  5LLI A;  3VUX A;  2ZNV B;  3M95 A;  4IWQ A;  2BWE S;  2L8J A;  1Z2M A;  1V6E A;  3Q3J A;  4HCP B;  4MGK E;  1V80 A;  2WX1 A;  4URK A;  2ZPN A;  4DBG A;  2Z0E B;  2XBB C;  4FAD A;  4PYU A;  2B3A A;  3QIJ A;  1GC6 A;  2O2V B;  2LGY A;  2KLC A;  3SD5 A;  3B0A A;  4EEW A;  2MBQ A;  2AYO B;  3QCA A;  3A4R A;  4GN1 A;  2KD0 A;  2C7N B;  1Q5W B;  2AEH A;  3PPA A;  3TL5 A;  3TBL D;  3VTW A;  3AI5 A;  3ALB A;  2BYE A;  2ZCC A;  2LJ5 A;  4NY0 A;  4IW0 A;  2JPH A;  3X23 A;  2O6V A;  2KFK A;  3B1L X;  4NPN A;  3SDL C;  3VDZ A;  3TCA A;  4BKG A;  2IBI B;  2KTF A;  3M63 B;  5C23 A;  4CO7 A;  4DXA B;  2DX5 B;  2V1Y A;  2JF5 A;  5DPS A;  2KFK B;  2NVU I;  1WXA A;  4LCD E;  5D7G A;  3TIX A;  4ANV A;  2IO0 B;  4W9K A;  1F9J A;  3DVN V;  4WJO A;  5CTR C;  4GXB A;  3W1S A;  2DAF A;  2IO3 B;  1WIA A;  2FNJ B;  2LRU A;  4I6L B;  4KZ0 A;  4KSL C;  2PJH A;  3MJW A;  4M8N A;  4A20 A;  1P3Q U;  2WYQ A;  4ZRK A;  2D3G A;  4WJN A;  1FXT B;  3N3K B;  4TQ1 A;  3KYC D;  2MBE A;  3N30 A;  3QJZ A;  2CKH B;  2JWZ A;  1OGW A;  2ZZP B;  5D6J B;  3IHP C;  1E7V A;  2DYO A;  1UGM A;  2RR9 A;  3APD A;  4E71 A;  2N4F A;  2J0J A;  1J0G A;  2CR5 A;  3VUW A;  4A3O A;  5DPW A;  1ZGU B;  4XX5 A;  4BKT A;  2KKC A;  2AL3 A;  4BOZ B;  4GDK A;  2KAN A;  4NNJ B;  2ZJD A;  3WAN A;  1WJN A;  4WAA A;  1KJT A;  4GSW A;  3N32 A;  4MJS A;  4RMA A;  2UYZ B;  3GZN I;  5D94 A;  4GOC A;  4GDK B;  3KH0 A;  1V86 A;  3QC8 B;  2DZI A; 
#chains in the Genus database with same CATH topology
 1LXD A;  2JYT A;  4MJS B;  1KLV A;  2G9H D;  2CU3 A;  5G5H A;  2Q5W D;  3VUY A;  4ZDV A;  1FFU A;  3DHH C;  1SIJ A;  4E74 A;  4NAW B;  3H1U A;  2KNB A;  3R66 C;  3R8B A;  2GBN A;  1UGJ A;  2AQ2 B;  3PLV A;  3ZNG C;  3MJ5 A;  3GS2 A;  3OJ3 A;  1YN3 A;  3W1Y A;  4MH8 A;  1C78 A;  3WCQ A;  3AEC B;  1J7A A;  5HI1 A;  1GOZ A;  1T3Q A;  2KHW B;  4AQ7 A;  4FUL A;  5C3J B;  2PIA A;  1F1H A;  1VRA B;  4I6P A;  2PVO D;  3ML9 A;  4XC2 A;  1L0X B;  3K9P B;  1UZX B;  4HJG E;  3EGR A;  1FXI A;  1UBI A;  4HDQ A;  1VJK A;  3Q8C A;  1H4R A;  1WWT A;  3X0W A;  2N9P C;  3UIP B;  4XGA B;  1MG4 A;  1CMX B;  1RAX A;  2REX A;  3Q3N C;  4DHZ E;  4JLC A;  4WJQ A;  3OAW A;  2JYE A;  2D2Q A;  2PPH A;  4W9H A;  1NDD A;  4GGQ A;  3W5V B;  2KVR A;  2L32 A;  1QF6 A;  1V97 A;  3DDC B;  4N59 A;  1TS2 A;  3BVG A;  3VAW A;  1SIF A;  3MC0 B;  2WQY B;  1QOG A;  3AEA B;  1FO4 A;  2DHZ A;  3ZDT A;  1FPY A;  2CHZ A;  1TKY A;  2K8B A;  3L0W B;  1SE2 A;  4LJP B;  5E6O A;  4FJY A;  2MQJ A;  4E3C A;  3PRZ A;  2WDR B;  2L52 A;  3FIL A;  1TZO A;  1GG3 A;  2BKF A;  1JCK B;  3V60 A;  3IG3 A;  4XE0 A;  2BVC A;  1WI0 A;  2IYD B;  2IGH A;  1UWX A;  2DYB A;  4HVB A;  3AN1 A;  1E5W A;  1YJ1 A;  5T8I A;  3KUD B;  4OVZ A;  2N9E B;  3KW5 B;  1YX5 B;  2JQR B;  3L54 A;  4JGH B;  3VFK A;  1PQS A;  5D3D A;  4BBN C;  4HXD A;  2V4I B;  3IAM 1;  3MTN B;  2ZVN A;  4BFR A;  3H8H A;  1LFD A;  4ZRQ A;  2HE7 A;  1T5X D;  1ZDX A;  4FHJ A;  2NPT A;  5JHB A;  2M0A A;  4IOI E;  4M02 A;  5BO4 B;  2BQQ A;  2PKO A;  3PLU A;  3BZD B;  1SE4 A;  2MW5 A;  1IBX A;  3HK0 A;  4TKN A;  1WGR A;  2KWU B;  2L0T A;  2OJR A;  2OED A;  1R4M B;  5BYR A;  4OZC A;  2BT6 A;  1R4N I;  1ROE A;  4IWP A;  5IN7 A;  1WXM A;  1T0Q C;  1F0Z A;  3A1Q A;  4KZC A;  4W9L A;  2M0X A;  1EO6 A;  3CF6 E;  2WXP A;  2WDT B;  1VDV A;  1D5X C;  3AH7 A;  4DDI D;  1RFK A;  4KSK C;  2L7R A;  3D32 A;  1YX6 B;  1V81 A;  3IFW B;  3IT4 B;  4LTU A;  1V8C A;  2VRR B;  1NVI D;  4YXD B;  1WR6 E;  3ABV B;  4PT5 A;  4S17 A;  1F2R I;  4EFO A;  3NZS A;  4KGT A;  3ZRC A;  2L83 A;  3VH3 B;  1J8C A;  1I35 A;  2JU6 X;  2B76 B;  1BML C;  4J6I A;  2MP2 B;  4HDO A;  4FJV B;  3N1Y C;  2KQ4 X;  5JHA A;  4MH0 E;  3E56 A;  2KJ6 A;  4DWF A;  4KVG B;  2AQ1 B;  2WDV B;  3R2I A;  3BIN A;  1GNU A;  1XT9 B;  2KLG A;  2JZZ A;  2L76 A;  1HE8 A;  1ZW7 A;  1NYQ A;  2HDE A;  1E90 A;  1QOF A;  3H7P B;  5LXI B;  3GP7 A;  1P98 A;  5LXH A;  4JX1 C;  3PV1 A;  1YQB A;  2JSV X;  3DBH I;  1MVK A;  3R7R A;  3PZD A;  2IPK D;  2RSU A;  2WXI A;  4MM3 B;  1C4P A;  2BBC A;  1X1M A;  4ZYN A;  1JWA D;  3RI7 C;  1N60 A;  2W54 A;  3L17 A;  3WA0 A;  1N62 A;  1SSN A;  3DPD A;  3KVF B;  2WP9 B;  4AUQ C;  2LI5 A;  4ZYS A;  4RFB A;  2ZCB A;  1WSP A;  4HEA 1;  4QAY A;  3RNA C;  4F7Z A;  2LRW A;  3Q69 A;  3ZGZ A;  4MGY E;  2LXA A;  4ITK A;  1HTO A;  2LHD A;  4US8 A;  5BYQ A;  4IM3 A;  3PTF C;  2N9L A;  2ZEQ A;  2QEJ C;  1WZ0 A;  1I4X A;  3SU8 X;  1RM6 C;  1FXA A;  4I6N B;  2MBH A;  4M00 A;  4MGI E;  4GIV A;  3DBL I;  4L23 A;  2KVZ A;  2OJW A;  3DQV A;  5FKA C;  1J7C A;  1WY8 A;  2LMC A;  1L4Z B;  5L83 A;  4FXC A;  3ZJU A;  4JIO U;  2L3Z A;  1YIW A;  4PS3 A;  2WHI A;  4YWG G;  2EKE C;  1UH6 A;  1FCL A;  1P7F A;  2KC2 A;  3GE8 C;  3ENE A;  1Q0W B;  4OZA A;  1JQ4 A;  4DDG D;  4B6W A;  3HIZ A;  5DCN A;  5DPR A;  3DWM A;  1RYJ A;  2R2O A;  3PRM B;  1IGD A;  4IUM B;  1V2Y A;  1WX8 A;  4F1S A;  4M0W A;  5CHF A;  2K22 A;  1MI0 A;  2XK5 A;  1V1P B;  1FIQ A;  3RZF A;  2BS3 B;  5BMG A;  3K9O B;  2LAS A;  4ASW C;  2YEP F;  3A9K A;  2J42 A;  2OHF A;  1Q1O A;  1T0S C;  1XCT L;  5LLI A;  1ZXI A;  3VUX A;  2WXJ A;  3PZ8 A;  1JRO A;  2V9H A;  1GC6 A;  2LGY A;  4EEW A;  4IDI A;  5G5G A;  4PK1 A;  3AI5 A;  3ALB A;  2BYE A;  3VDZ A;  2QC8 A;  2KTF A;  3M63 B;  4LK0 M;  2JF5 A;  2YEP B;  2NVU I;  1WXA A;  2D3B A;  3TIX A;  1GB4 A;  1F9J A;  4J3O D;  1HZ6 A;  2DAF A;  2IO3 B;  1WIA A;  3C8Y A;  2H88 B;  2PJH A;  3MJW A;  3IXS A;  4A20 A;  1SE3 A;  3RN9 C;  4TQ1 A;  2LEK A;  3QJZ A;  1JW9 D;  2CKH B;  1OGW A;  4OHJ A;  3BK2 A;  5H92 C;  4HKZ E;  2N4F A;  5DPW A;  3CWI A;  3TSS A;  1ZGU B;  3B2G A;  4BOZ B;  1WJN A;  2WXF A;  4WAA A;  4GSW A;  3N32 A;  3DBR B;  2UYZ B;  2DZI A;  5IO9 A;  3MFG A;  1MG8 A;  4AP4 C;  1WXQ A;  2KMC A;  1GC7 A;  4K81 A;  1DGJ A;  1OTR B;  3QWZ B;  1AW7 A;  2MJE A;  2QMT A;  5C1Z A;  1EU3 A;  2FCQ A;  4EOY A;  5JZE B;  1GPX A;  2MWS B;  3AEG B;  3Q2A C;  3U4E G;  3U30 A;  1CJE A;  2V4L A;  1OEY A;  1GAQ B;  4OVV A;  2L00 B;  4NJ6 A;  3ECI A;  3RUI B;  3AE6 B;  2FIF A;  1WE7 A;  4G50 A;  1C3T A;  1I4R A;  4ZHP A;  1QLB B;  1ZXH A;  2GMI C;  4EKU A;  2EEL A;  3AE9 B;  2JRI B;  3WIM A;  2M1M A;  3RPF C;  1M4V A;  1BXT A;  1IP9 A;  4II2 B;  3T3O A;  3BY4 B;  5CX3 A;  4FA6 A;  4C80 A;  1YNT E;  3R2T A;  1WH3 A;  1FRD A;  1KLG D;  1CZP A;  3L4P A;  2WNM A;  3GOE A;  4TSS A;  3UF8 A;  4FLH A;  2DEN B;  5G2N A;  3T9L A;  5IKC M;  4WWO A;  1C1Y B;  3DBH B;  3JW0 X;  2JWU A;  4A90 A;  2O6V B;  4A9A A;  3IVF A;  4NZL B;  1GB1 A;  3AE8 B;  3P4R B;  1RLF A;  2R2Q A;  4WWM A;  3ZJV A;  4ANU A;  2DYM A;  3E9S A;  2DLB A;  4ARI A;  4KIK A;  3FIL B;  2M8S A;  2HTM E;  2KO3 A;  1ZKH A;  1HXY D;  3L08 A;  3PGE A;  1EWY C;  3UQA A;  5CHV C;  2K6Q A;  4YSZ B;  3WAL A;  5HKH A;  1YMH E;  2GB1 A;  5TR5 A;  5IP4 D;  2BS2 B;  2KDF B;  4WIP A;  3DOW A;  1L5P A;  4IKG A;  1SF0 A;  3KUZ A;  2PEA A;  3U8Z A;  4TQ0 A;  3ZRF A;  4HWI B;  2J53 A;  1TZ1 A;  4BOS C;  3VVW B;  3AE3 B;  3VRB B;  4ZHO A;  3CST A;  2PMV A;  2GBM A;  1P0R A;  3PRE A;  3L13 A;  5HHD G;  4AJY B;  2D3C A;  4P1C C;  3VTV A;  2ZW0 A;  2EMS A;  1F52 A;  1TKE A;  3QX1 A;  2LVQ A;  3AU5 A;  1PUT A;  1KOT A;  4K7U A;  3UQB A;  2CU1 A;  1TKG A;  1I42 A;  1TS3 A;  3VR9 B;  4LNF A;  1NEN B;  3QQ8 B;  2IO2 B;  2KN4 A;  1XD3 B;  3DCG A;  1TS5 A;  2NCN A;  1EUV B;  3P4Q B;  4TMA B;  5GMV A;  2MEK A;  4RM8 A;  3RYT A;  3ZTC A;  4GDL A;  4PS7 A;  1WYW B;  3HHM A;  1AYF A;  1WXS A;  1RRB A;  2KFJ A;  4MT5 A;  3KWV A;  2WS3 B;  1V9J A;  4O1N A;  1K51 A;  3QA8 A;  1OQR A;  4NAM A;  2DWQ A;  4DQO C;  2J7Q B;  4KV2 A;  2CHW A;  5CHW A;  3WAP A;  4K7W A;  1RWS A;  2FCM A;  2I1J A;  2RGF A;  1MHX A;  3NRZ A;  2L0F A;  3NVV A;  3P1M A;  4DHJ B;  1P9D U;  2WXK A;  1TGZ B;  3HRD D;  3BII D;  4CYE A;  3RNC C;  3BVZ A;  1DOI A;  1WZ3 A;  2AWT A;  2O2V A;  2Z59 B;  3W2D A;  1I4Q A;  4KDI C;  2E6X A;  1C4C A;  3HVD A;  3ZUN A;  3EEC A;  4II3 B;  4B9K A;  4JE3 B;  3TMP B;  2L05 A;  2DZM A;  2KMM A;  4B0M A;  2BYV E;  1TBE A;  4NJ7 A;  4YTM B;  5KHQ A;  3Q14 C;  3DBS A;  3W9C B;  1F2R C;  2K8C A;  5AUI A;  3ZQ4 A;  1IPG A;  3EUB 2;  3TEZ A;  2LVO A;  4HPL B;  1E8W A;  2WXG A;  1Z5S B;  2LVP A;  1E8Y A;  2K5P A;  3MHZ A;  3RMK C;  4BAX A;  1SB3 C;  5EDS A;  1S3S G;  2KX3 A;  2YVC A;  2XNA C;  1VCB A;  4W9E A;  1WM2 A;  3ZW3 A;  3RZW C;  3HUI A;  3ZIM A;  4L2Y A;  4PYZ A;  3MP9 A;  4C4V A;  3H6N A;  1TT5 B;  1GUA B;  4AS1 A;  2WXM A;  3ZXR A;  4LNO A;  2XN9 C;  2LGS A;  5TSS A;  5AEK B;  1XQQ A;  2HJ8 A;  2X8X X;  3W5U B;  1XLQ A;  3H7S A;  4FN2 A;  1KTK A;  4RCO A;  1A70 A;  3VTU A;  3TJP A;  1XXG A;  1L0V B;  4BKS D;  1YN4 A;  3RT3 B;  2KC1 A;  4C56 C;  4PS8 A;  1FD6 A;  4WWN A;  4K3C A;  3QAQ A;  2MA9 B;  1VZ8 A;  3EHV A;  4HRS A;  1YN5 A;  5IAA C;  1M94 A;  2ONQ A;  4CHK A;  3PS6 A;  5L95 C;  4LDT D;  2IND C;  3B2F A;  2EKI A;  2GBJ A;  4DXG A;  4RGM A;  2KQS A;  5AZG A;  1EF5 A;  4WQO B;  1RFA A;  3V61 A;  2NBU A;  1TY0 A;  2MCN B;  1E7P B;  1UWM A;  3AXC A;  3B08 A;  4M0W B;  5MPO A;  2RPV A;  1BUI C;  1YD8 U;  3N1X C;  4WAF A;  4EZJ A;  4IWQ A;  3Q3J A;  1ENF A;  4HCP B;  4MGK E;  4DBG A;  2Z0E B;  3ZYY X;  3B0A A;  2MBQ A;  3QCA A;  4KGR A;  2C7N B;  2AEH A;  3PPA A;  2ZCC A;  3SR6 A;  2KFK A;  2PTL A;  4NPN A;  3SDL C;  4UDU C;  2J4X A;  2Y3A A;  4REZ A;  5DPS A;  5D7G A;  4RF0 A;  1ZPS A;  3MC9 A;  5AUK A;  3W1S A;  2FNJ B;  3FKY A;  4M8N A;  2LJI A;  1XLN A;  4WJN A;  1FXT B;  3N30 A;  3IHP C;  2V0G A;  2DYO A;  1UGM A;  2W82 A;  4LNN A;  1OFF A;  4E71 A;  2J0J A;  1SEB D;  2KDM A;  2INC C;  1PDX A;  4GDK A;  1KJT A;  3FAH A;  3URY A;  3GZN I;  3N9Y C;  3KH0 A;  3LYY A;  1I4P A;  3I3T B;  1PGB A;  3SFD B;  2JZ3 B;  4FBJ B;  4YSX B;  1Y8R C;  1N6Z A;  3O65 B;  4WJP A;  1OQQ A;  2DZJ A;  2QDF A;  4RM9 A;  3ZLZ A;  1VD2 A;  5EE0 A;  4A3P A;  3EFU A;  1FM0 D;  1ESF A;  2GLS A;  2IGG A;  2D07 B;  4AWJ A;  4B95 A;  2RD0 A;  2WX0 A;  3U52 E;  2Z0D B;  2AL6 A;  4US9 A;  2MSE D;  1LGR A;  2K3U A;  2R61 A;  3NS8 A;  2G3Q B;  4HJK A;  2LGX A;  1HTQ A;  5BYS A;  1HA5 A;  2KWD A;  3ZVV A;  2FCN A;  1K8R B;  3VHT C;  3T8M A;  2WLB A;  4HK2 A;  3V6E B;  2BYT A;  1C77 A;  2RDG A;  2M4N A;  3KUC B;  3JSV A;  1NI3 A;  4IM2 A;  3ONS A;  1SJE D;  3TEW A;  3TUO A;  5LNK 1;  1UF0 A;  2RDB C;  2WXL A;  1JML A;  5C2T B;  1OEY J;  2FUG 1;  2FAZ A;  2KQ7 A;  2BW2 A;  2BWF A;  1L6V A;  1CQV A;  3DVG X;  2MP2 A;  2FUH B;  1VR9 A;  2INP E;  3CMM B;  3NOB A;  3U7D A;  2E3T A;  1TTN A;  4ANW A;  3PT2 B;  1HQR D;  1LO5 D;  3Q3M C;  2LUE A;  2KT7 A;  1WMH A;  1PGX A;  2EMT A;  2PLP A;  1QOA A;  4WUR A;  2K0P A;  3GB1 A;  3UGB B;  3QAR A;  2X38 A;  2O6V D;  2KYW A;  1XLO A;  2Y5P A;  3P42 A;  2G45 B;  3BK1 A;  1VLB A;  1D4B A;  3UIO B;  2K8H A;  1L0Y B;  3DHG C;  1WGK A;  1K50 A;  1MHH E;  5E6J A;  1ISN A;  2KJR A;  4KIK B;  1QKZ A;  2GI9 A;  1DOX A;  2RPQ A;  4MM3 A;  3KWL A;  1V5O A;  5BMI A;  2WDQ B;  3N1Z C;  2DAJ A;  2IGD A;  4NQL B;  3SEB A;  3GE3 C;  2IZV B;  2J0K A;  2LUM A;  3M62 B;  2IJ0 A;  1WJ4 A;  2MX2 A;  1EU4 A;  4S0R A;  3DVN U;  2ON8 A;  2K1F A;  4P16 A;  3VR8 B;  2MJD A;  3LDZ E;  4IC7 B;  1C76 A;  4HPP A;  3NJT A;  4AJW A;  4HKQ A;  3R3M A;  3A4S C;  4MSQ B;  1R4N B;  1JWB D;  4JL9 A;  3AE5 B;  1T0Y A;  2WGS A;  4GU2 A;  2KDI A;  3Q8A A;  2KXJ A;  1E7U A;  3PVL A;  3SHQ A;  5KHO A;  5AZH A;  4GMV A;  3IAS 1;  4DHZ B;  4W9C A;  1NBF C;  4BKS A;  4W9D A;  1QQR A;  2QCZ A;  4G0N B;  1JWU D;  4TUU A;  1XO3 A;  5EE3 A;  2KAJ A;  1G6J A;  3ML8 A;  1WFY A;  2HTH A;  4N9F 4;  1SGH A;  2ICI A;  5IOI A;  2D11 A;  2N1W A;  4GDL B;  1H8C A;  1UUP A;  1WGY A;  2DBY A;  4TV3 A;  4N58 A;  4USA A;  1SBB B;  3ZNZ B;  2GRI A;  1Q10 A;  1WM3 A;  3U2S C;  2ASQ A;  4XZ4 A;  4KKI A;  5H8Y E;  1YOV B;  1ZDV A;  5JXV A;  3RD2 A;  2JT4 B;  2KTR A;  4DHJ D;  1E0Z A;  1AAR A;  1KLU D;  2MLB A;  2GOW A;  3BWU D;  3NZ3 A;  2OOB B;  3AE1 B;  1YQ4 B;  1I7H A;  2FID A;  1ZP0 B;  1WJU A;  2NR2 A;  2LGD A;  4RGO S;  2VH1 A;  1WGD A;  2LWP A;  3V62 A;  4M8M A;  2NTT A;  3AB5 A;  3ZKJ C;  2H89 B;  2A5U A;  3QHT A;  2WXO A;  1FMA D;  3EA6 A;  3L10 B;  4KGS A;  1JRP A;  1QIL A;  4MSM B;  3U7Z A;  3KYD D;  4ICV A;  4ZOH C;  1MJD A;  4MGZ E;  1DYQ A;  4DK5 A;  1NYR A;  5J18 A;  2KK8 A;  2W55 A;  1WYG A;  3Q3O C;  1PYW D;  3Q8E A;  3C0R B;  3LJ3 A;  4EUT A;  3AU4 A;  2UU7 A;  4HLE A;  2NBV B;  1PGA A;  4A55 A;  2QIL A;  2UWQ A;  1UBQ A;  3AE4 B;  3DBL B;  2V3N A;  3ZTD A;  4JPS A;  3NUH B;  2WU5 B;  3NS1 A;  4Q2J A;  3HVZ A;  3AEB B;  4NJC A;  2LHE A;  2N7E A;  3NY5 A;  4C4V B;  2K6D B;  2I2Y A;  2N1V A;  3C19 A;  4XWT A;  2QIE B;  1S1Q B;  2NPT B;  4K3B A;  1IBX B;  1TYG B;  1MFW A;  4GLS C;  3PHW B;  2XEW A;  1QOB A;  4MEM A;  3VH4 B;  2IDY A;  4RF1 A;  1N63 A;  3NVW A;  2RDH A;  1K52 A;  3NZU A;  4HPM B;  1WRI A;  3A9J A;  3A1Q B;  5AZF A;  1T6B X;  2FBW B;  1WF9 A;  1VZ7 A;  2M19 A;  2K25 A;  1KM7 A;  1E9M A;  4HRO A;  1I4H A;  5FR3 A;  2SAK A;  1UD7 A;  2BS4 B;  3I57 A;  4K7S A;  2KWV B;  4W9G A;  1WGH A;  3WAM A;  1TY2 A;  3IT6 B;  1DOY A;  2VZK B;  3NVY A;  3Q3F A;  2KJH B;  4P6V F;  1L2N A;  1R7S A;  2JZP A;  1KRH A;  1E8X A;  3APF A;  4EZK A;  4YTN B;  2ZNV B;  3M95 A;  2BWE S;  1Z2M A;  1V6E A;  1V80 A;  4URK A;  2ZPN A;  4FAD A;  4PYU A;  3QIJ A;  4XDC A;  2KLC A;  1J7B A;  4LNK A;  2AYO B;  3A4R A;  1Q5W B;  3TL5 A;  2MJ3 A;  3VTW A;  4RGT A;  2LJ5 A;  4IW0 A;  2O6V A;  3B1L X;  4RH6 A;  2IBI B;  2BB6 A;  2V1Y A;  2KFK B;  2WXH A;  3RFZ B;  3RNE C;  4ANV A;  3FC4 A;  2WXN A;  1FNU A;  4GXB A;  1FFV A;  1SXT A;  2LRU A;  2D3A A;  4KX6 B;  2WYQ A;  2D3G A;  2WU2 B;  3ZJT A;  2MBE A;  2JWZ A;  1XLP A;  3I63 C;  1XEE A;  3APD A;  2PVG C;  4A3O A;  4XWW A;  2AL3 A;  4NNJ B;  1N61 A;  2ZJD A;  2J52 A;  4MJS A;  4RMA A;  2QJL A;  5D94 A;  1KF6 B;  3TEX A;  4GDK B;  1V86 A;  3QC8 B;  1J0G A;  2BTE A;  1XF5 L;  1E6E B;  2KDB A;  3I5J C;  3Q8B A;  5IA7 A;  4NAW A;  1LM8 B;  1EM7 A;  5DPT A;  3V6C B;  1XCQ L;  5G55 A;  3KLS X;  1ZUD 2;  1BT0 A;  1AN8 A;  4DXF A;  3NG0 A;  2BPS A;  3DBR I;  4M01 A;  2W3S A;  1WE6 A;  4D2K A;  5HG2 A;  4K1R B;  4EZL A;  1FNW A;  1N5X A;  1P1A A;  1WX7 A;  4X57 B;  2ZVO A;  2LGI A;  2TSS A;  1TIF A;  4MDK E;  4XYC A;  2W3R A;  1SE9 A;  3MC8 A;  2LFI A;  1QZE A;  2KZR A;  3OLM D;  4W9J A;  2CS4 A;  3Q8F A;  2I38 A;  3VXW A;  2QHO A;  3VRA B;  2CJO A;  3NVZ A;  3JSV B;  2MRP A;  1JWS D;  2XK5 B;  3RNG C;  4ARC A;  3ETR A;  3A9K B;  1J19 A;  4OVU A;  2DNF A;  1VZ6 A;  1NEK B;  1ET9 A;  1STE A;  1D5M C;  1B1Z A;  1NI2 A;  2N9K A;  1N5W A;  3VQI A;  1IYF A;  2A4Z A;  2Y5B B;  3EFC A;  2KOX A;  4LNI A;  4FJZ A;  1E8Z A;  2IY0 B;  2Y5C A;  1WMH B;  3ZNI D;  2N7D A;  4L1B A;  4ICU A;  5BMH A;  2Z8L A;  2LXC A;  2BKR B;  3AEE B;  2PW9 A;  4B0E A;  1EF1 A;  5EE9 A;  2MHJ A;  4C7Y A;  4C00 A;  3A33 B;  2N9X A;  4LJO B;  2KMA A;  2K9X A;  3MHS D;  3RCZ A;  2JRH A;  3UIN B;  4FHK A;  4KKJ A;  2JUO A;  3SFE B;  2NTS A;  3NHE B;  2CJN A;  3S2A A;  4C7Z A;  2DZK A;  1B9R A;  2C5L C;  5D2M B;  4AOF A;  2ZNV C;  1WJ6 A;  2C9W B;  4G11 A;  4XDD A;  2G4S A;  5HFY A;  1L4D B;  2BGF A;  3V3X A;  3ZXV A;  1ZE3 D;  2PE9 A;  3H9D A;  2V3S A;  2JX5 A;  1KH0 A;  2GBK A;  3HM6 X;  5D3I B;  2J0M A;  3AUL A;  4YSY B;  4CQN A;  3AV8 A;  2CHX A;  3JVZ X;  2NBW B;  3BYY B;  1C4A A;  1QT9 A;  3JYU A;  5FR6 A;  1P7E A;  1FNV A;  2HJ1 A;  1JAL A;  1HEZ E;  3PSE B;  1GJZ A;  1WR1 A;  2LD9 A;  1V49 A;  2KX0 A;  3RUL A;  3N20 C;  4LLG M;  3ZO5 B;  3P4P B;  1HZ5 A;  2JY6 A;  2C7M B;  2RMM A;  3W1S C;  3RNF C;  4P1B C;  1EWC A;  4R3D A;  4JWS C;  3PO0 A;  2HD5 B;  3AMZ A;  3DHI C;  2AX5 A;  4LDT B;  2C7H A;  2JXX A;  2C60 A;  3V05 A;  4JWU C;  3QK0 A;  4ZRI A;  3RNB C;  3Q6B A;  3PHX B;  1UEL A;  4KDL B;  1L7Y A;  3APC A;  5EE1 A;  4BZA A;  2QSD A;  2KTR B;  3P63 A;  4W9I A;  3ZDM C;  4WH4 A;  1AWD A;  2KDE B;  4ZRJ A;  3R7Q A;  2KN5 A;  3WAO A;  4YTP B;  3EC8 A;  3BVM A;  4F8C B;  3M3J A;  4ANX A;  2NMQ A;  2WXQ A;  3P2B A;  4MEL A;  2AQ3 B;  1TS4 A;  2JVC A;  3H7P A;  2N0S B;  3AE2 B;  2K39 A;  3UI3 A;  1F77 A;  3I9V 1;  2BF8 B;  1WXV A;  2GBR A;  1OQY A;  4MAC A;  1LQB A;  1YJI A;  2JXT A;  4G3X B;  4JQW C;  3ZNH B;  1V5T A;  2ZPY A;  2YLM A;  1IGC A;  4WQM A;  4W9F A;  2PE6 B;  4RNA A;  1WGG A;  2G4D B;  2M56 B;  2BB5 A;  3AM9 A;  4RGN A;  1MPE A;  3L16 A;  1A5R A;  1V1O A;  2I1K A;  3PRP B;  2SEB D;  3OWE B;  1D3Z A;  3AEF B;  2FCS A;  5JH5 C;  1T0R C;  3CSF A;  1E10 A;  4A6Q A;  4OW0 A;  3IBE A;  1ET6 A;  3O13 A;  2D5G A;  1YQ3 B;  1CK1 A;  2IO1 B;  2FE8 A;  1YJJ A;  4EE2 A;  3TEY A;  5J2R A;  2G1E A;  1U4A A;  1JWM D;  3B9J A;  2KAC A;  4BVU C;  2WXR A;  4GB9 A;  3P4S B;  1ZOY B;  3DWG C;  5GXG B;  2L1A A;  4IG7 B;  2BYF A;  2KWC A;  1Y56 A;  1C9F A;  2IY1 B;  2INN E;  3CIR B;  2M17 A;  4P7I A;  3AE7 B;  2D10 A;  2MBB B;  5J17 A;  2MBO A;  1TJE A;  2W9N A;  3KQ4 A;  3A9J B;  3LB8 C;  3OJ4 B;  4BBN F;  4OZB A;  4NQK E;  1WRD B;  4WWP A;  4N6E B;  1R4M I;  2ZW1 A;  2NS5 A;  3HM3 A;  4IWO A;  4HCN B;  2LZ6 A;  5E6P A;  1V1P A;  1FCC C;  1WX9 A;  2VZK D;  3OG5 A;  4IM0 A;  1L6U A;  2WWZ A;  3DVG Y;  4YL8 A;  4A8X C;  5E6N A;  1JRU A;  3J9C A;  3T3N A;  2L8J A;  3BYT B;  2WX1 A;  2XBB C;  1C79 A;  2V3P A;  4ZRP A;  2B3A A;  2O2V B;  3LXF A;  3SD5 A;  5I4D A;  1FRR A;  4GN1 A;  2KD0 A;  3TBL D;  1KFY B;  1UNS A;  4NY0 A;  2JPH A;  3X23 A;  1D5Z C;  4H2A A;  3TCA A;  4BKG A;  4CO7 A;  5C23 A;  4DXA B;  2DX5 B;  4LCD E;  2IO0 B;  4W9K A;  3DVN V;  4WJO A;  5CTR C;  1I4G A;  3AED B;  4YT0 B;  4I6L B;  4KZ0 A;  4KSL C;  1P3Q U;  3GZN B;  4ZRK A;  2ACZ B;  2VH2 A;  3N3K B;  1ACC A;  3KYC D;  2N7J A;  2ZZP B;  5D6J B;  1E7V A;  1D6E C;  5FK9 C;  2RR9 A;  1IUE A;  3PZ7 A;  4ACF A;  2MH7 A;  2CR5 A;  1K53 A;  3VUW A;  4XX5 A;  4BKT A;  2KKC A;  2KAN A;  3WAN A;  1FEH A;  4GOC A;  1SJH D;  1PFD A; 
#chains in the Genus database with same CATH homology
 1LXD A;  3I3T B;  4MJS B;  2KDB A;  1KLV A;  1MG8 A;  5IA7 A;  4NAW A;  1LM8 B;  2JZ3 B;  4AP4 C;  4FBJ B;  2KMC A;  3VUY A;  4ZDV A;  1GC7 A;  4K81 A;  5DPT A;  1Y8R C;  3V6C B;  3O65 B;  4WJP A;  4E74 A;  1OTR B;  2DZJ A;  3QWZ B;  4NAW B;  4RM9 A;  1VD2 A;  5G55 A;  3ZLZ A;  4A3P A;  3H1U A;  2KNB A;  3R66 C;  3EFU A;  2GBN A;  2D07 B;  5C1Z A;  3PLV A;  2FCQ A;  3ZNG C;  1BT0 A;  4AWJ A;  2RD0 A;  4B95 A;  2WX0 A;  4EOY A;  2Z0D B;  3OJ3 A;  2BPS A;  2AL6 A;  5JZE B;  2MSE D;  3W1Y A;  2MWS B;  3DBR I;  3NS8 A;  1WE6 A;  2G3Q B;  4HJK A;  3U30 A;  2LGX A;  4K1R B;  4EZL A;  2KHW B;  2V4L A;  1OEY A;  4OVV A;  1P1A A;  1WX7 A;  2L00 B;  4FUL A;  4NJ6 A;  3ECI A;  4X57 B;  3ZVV A;  2ZVO A;  3RUI B;  2FCN A;  2FIF A;  1WE7 A;  4G50 A;  4MDK E;  1C3T A;  4I6P A;  1K8R B;  1SE9 A;  3VHT C;  3T8M A;  4HK2 A;  3V6E B;  3ML9 A;  1QZE A;  2KZR A;  3OLM D;  4W9J A;  4XC2 A;  2CS4 A;  3K9P B;  2GMI C;  1UZX B;  2M4N A;  3KUC B;  4EKU A;  3JSV A;  1UBI A;  4HDQ A;  3VXW A;  2JRI B;  3WIM A;  2M1M A;  3ONS A;  4IM2 A;  1H4R A;  2QHO A;  3X0W A;  3JSV B;  2N9P C;  2MRP A;  3UIP B;  2XK5 B;  1CMX B;  1IP9 A;  1RAX A;  1OEY J;  2REX A;  2FAZ A;  2KQ7 A;  3BY4 B;  4II2 B;  4JLC A;  5CX3 A;  2BWF A;  4DHZ E;  4FA6 A;  3A9K B;  4WJQ A;  3OAW A;  2D2Q A;  3DVG X;  1J19 A;  4OVU A;  2PPH A;  1WH3 A;  2MP2 A;  1NDD A;  4GGQ A;  2FUH B;  2KVR A;  4W9H A;  1NI2 A;  3CMM B;  3NOB A;  3DDC B;  3U7D A;  1TTN A;  4ANW A;  3VQI A;  3PT2 B;  3VAW A;  3GOE A;  3UF8 A;  1SIF A;  4FLH A;  2LUE A;  1IYF A;  2A4Z A;  2DEN B;  2Y5B B;  5G2N A;  2KOX A;  3T9L A;  1WMH A;  4FJZ A;  2EMT A;  1E8Z A;  4WWO A;  1C1Y B;  3UGB B;  3JW0 X;  2IY0 B;  3QAR A;  2O6V B;  2DHZ A;  1WMH B;  3ZNI D;  3ZDT A;  2O6V D;  2CHZ A;  2N7D A;  3IVF A;  2K8B A;  3L0W B;  1RLF A;  4ICU A;  2R2Q A;  2G45 B;  4LJP B;  5E6O A;  4FJY A;  2MQJ A;  3UIO B;  4E3C A;  2LXC A;  4ANU A;  2BKR B;  2DYM A;  2K8H A;  3PRZ A;  1EF1 A;  1GG3 A;  4KIK A;  2M8S A;  2KO3 A;  1ZKH A;  2BKF A;  2N9X A;  3A33 B;  3L08 A;  3PGE A;  3V60 A;  4LJO B;  1ISN A;  3IG3 A;  3UQA A;  2KJR A;  2KMA A;  5CHV C;  2K6Q A;  4KIK B;  2RPQ A;  4MM3 A;  1V5O A;  3WAL A;  5HKH A;  2DAJ A;  3MHS D;  1WI0 A;  2IYD B;  3RCZ A;  2JRH A;  5TR5 A;  3UIN B;  4FHK A;  4NQL B;  2KDF B;  2IZV B;  2J0K A;  3DOW A;  2DYB A;  2JUO A;  3KUZ A;  4HVB A;  3NHE B;  1E5W A;  1YJ1 A;  3KUD B;  3M62 B;  3S2A A;  1WJ4 A;  2MX2 A;  2DZK A;  2C5L C;  2N9E B;  2PEA A;  1YX5 B;  3DVN U;  3KW5 B;  3L54 A;  2K1F A;  4JGH B;  3U8Z A;  3VFK A;  4TQ0 A;  3ZRF A;  5D2M B;  1PQS A;  4AOF A;  3LDZ E;  4HWI B;  4IC7 B;  2ZNV C;  4HXD A;  4BBN C;  1TZ1 A;  1WJ6 A;  4AJW A;  4BOS C;  3R3M A;  2C9W B;  3A4S C;  3MTN B;  4G11 A;  4MSQ B;  3VVW B;  2ZVN A;  2G4S A;  4BFR A;  2BGF A;  4JL9 A;  1LFD A;  1T0Y A;  2PE9 A;  3CST A;  4GU2 A;  3H9D A;  2GBM A;  2V3S A;  1P0R A;  2KDI A;  3PRE A;  3L13 A;  2GBK A;  3HM6 X;  4AJY B;  2HE7 A;  2J0M A;  1E7U A;  2KXJ A;  3AUL A;  3PVL A;  3VTV A;  2CHX A;  4FHJ A;  3SHQ A;  2NPT A;  3JVZ X;  5AZH A;  5KHO A;  5JHB A;  2EMS A;  2LVQ A;  4GMV A;  3QX1 A;  3PLU A;  5BO4 B;  2MW5 A;  2NBW B;  3AU5 A;  3HK0 A;  3JYU A;  5FR6 A;  4TKN A;  1KOT A;  4K7U A;  4DHZ B;  1WGR A;  2KWU B;  2L0T A;  2OJR A;  4W9C A;  2CU1 A;  3UQB A;  1I42 A;  1NBF C;  4BKS A;  1GJZ A;  3PSE B;  3QQ8 B;  1WR1 A;  2IO2 B;  2LD9 A;  1XD3 B;  1V49 A;  4W9D A;  2KX0 A;  3RUL A;  3DCG A;  4G0N B;  1R4N I;  2NCN A;  4TUU A;  1EUV B;  5GMV A;  4IWP A;  3ZO5 B;  1G6J A;  4RM8 A;  3ML8 A;  2JY6 A;  1WFY A;  1WXM A;  3RYT A;  2C7M B;  2HTH A;  3W1S C;  3A1Q A;  4GDL A;  3ZTC A;  4PS7 A;  1WYW B;  3HHM A;  4KZC A;  4N9F 4;  1SGH A;  4W9L A;  1WXS A;  1RRB A;  2KFJ A;  2M0X A;  2D11 A;  2N1W A;  2HD5 B;  1V9J A;  1EO6 A;  3CF6 E;  4GDL B;  1H8C A;  1WGY A;  2WDT B;  4TV3 A;  3QA8 A;  4DDI D;  4LDT B;  4KSK C;  2C7H A;  2JXX A;  2L7R A;  3D32 A;  1YX6 B;  2J7Q B;  2C60 A;  1V81 A;  3IFW B;  4KV2 A;  2CHW A;  5CHW A;  3QK0 A;  4K7W A;  2VRR B;  4ZRI A;  3WAP A;  3ZNZ B;  2FCM A;  1WR6 E;  2I1J A;  1WM3 A;  2RGF A;  2ASQ A;  4XZ4 A;  4EFO A;  3NZS A;  3ZRC A;  3PHX B;  3VH3 B;  1J8C A;  2L0F A;  3RD2 A;  4DHJ B;  1I35 A;  1UEL A;  2JT4 B;  2KTR A;  4DHJ D;  1P9D U;  4KDL B;  4J6I A;  2MP2 B;  1AAR A;  1L7Y A;  3APC A;  1TGZ B;  4HDO A;  2MLB A;  2GOW A;  4FJV B;  2KTR B;  5JHA A;  2OOB B;  4CYE A;  2FID A;  4W9I A;  3ZDM C;  1WJU A;  1WZ3 A;  2NR2 A;  2AWT A;  2KDE B;  2LGD A;  4MH0 E;  2O2V A;  2KJ6 A;  1WGD A;  2Z59 B;  4KVG B;  2KN5 A;  2LWP A;  4ZRJ A;  3R7Q A;  4KDI C;  4DWF A;  3WAO A;  3BIN A;  3V62 A;  4M8M A;  1GNU A;  3ZKJ C;  3ZUN A;  3EEC A;  2A5U A;  3EC8 A;  1XT9 B;  2KLG A;  2JZZ A;  2L76 A;  3QHT A;  3M3J A;  1HE8 A;  4II3 B;  4B9K A;  4ANX A;  4F8C B;  3P2B A;  4MEL A;  3TMP B;  2L05 A;  2DZM A;  3L10 B;  2JVC A;  2BYV E;  1TBE A;  3H7P A;  4NJ7 A;  1ZW7 A;  2K39 A;  4MSM B;  1E90 A;  3KYD D;  3H7P B;  5KHQ A;  5LXI B;  4ICV A;  2BF8 B;  1P98 A;  1WXV A;  3DBS A;  2GBR A;  1OQY A;  1LQB A;  5LXH A;  4G3X B;  4MGZ E;  2K8C A;  1YQB A;  3PV1 A;  4JQW C;  3ZNH B;  3DBH I;  1V5T A;  3R7R A;  2ZPY A;  2YLM A;  1IPG A;  4DK5 A;  3PZD A;  5J18 A;  2KK8 A;  4W9F A;  2PE6 B;  1WGG A;  2LVO A;  2G4D B;  4HPL B;  1E8W A;  2RSU A;  1Z5S B;  2LVP A;  3C0R B;  3LJ3 A;  4EUT A;  1E8Y A;  3AU4 A;  1X1M A;  4HLE A;  2NBV B;  4ZYN A;  3L16 A;  1A5R A;  3L17 A;  3WA0 A;  5EDS A;  2I1K A;  3PRP B;  1S3S G;  2KX3 A;  2UWQ A;  1UBQ A;  2YVC A;  1VCB A;  4W9E A;  1WM2 A;  3ZW3 A;  3DPD A;  3KVF B;  3RZW C;  4AUQ C;  2LI5 A;  2FCS A;  5JH5 C;  3ZTD A;  1D3Z A;  2ZCB A;  3ZIM A;  4PYZ A;  4F7Z A;  2LRW A;  3CSF A;  4MGY E;  3IBE A;  2LXA A;  3H6N A;  1GUA B;  2N7E A;  3NY5 A;  4IM3 A;  3PTF C;  2IO1 B;  5AEK B;  1XQQ A;  2HJ8 A;  2ZEQ A;  2K6D B;  1WZ0 A;  2N1V A;  3SU8 X;  3H7S A;  1S1Q B;  4FN2 A;  4I6N B;  2MBH A;  4MGI E;  2NPT B;  4GIV A;  3DBL I;  5J2R A;  1U4A A;  3DQV A;  3PHW B;  4BVU C;  2XEW A;  3VH4 B;  4MEM A;  3VTU A;  4GB9 A;  3TJP A;  1WY8 A;  4BKS D;  5L83 A;  4IG7 B;  3RT3 B;  2KC1 A;  2BYF A;  4PS8 A;  4JIO U;  2L3Z A;  2KWC A;  1YIW A;  3NZU A;  4WWN A;  4HPM B;  4PS3 A;  2EKE C;  2IY1 B;  3QAQ A;  1UH6 A;  3A9J A;  2M17 A;  4P7I A;  2KC2 A;  2MA9 B;  3A1Q B;  1Q0W B;  3ENE A;  5AZF A;  2D10 A;  2MBB B;  1WF9 A;  2MBO A;  3EHV A;  5J17 A;  4DDG D;  4B6W A;  2K25 A;  2W9N A;  5IAA C;  1KM7 A;  3A9J B;  1M94 A;  3OJ4 B;  4CHK A;  4BBN F;  3PS6 A;  3HIZ A;  5L95 C;  4LDT D;  5DCN A;  1UD7 A;  5DPR A;  4NQK E;  4K7S A;  1WRD B;  4WWP A;  2KWV B;  1R4M I;  4W9G A;  2R2O A;  1WGH A;  3WAM A;  2GBJ A;  2KQS A;  2NS5 A;  3HM3 A;  3PRM B;  4IWO A;  4HCN B;  4IUM B;  5AZG A;  2LZ6 A;  1EF5 A;  4WQO B;  1RFA A;  3V61 A;  1V2Y A;  5E6P A;  3Q3F A;  2KJH B;  1WX8 A;  4F1S A;  1WX9 A;  5CHF A;  1L2N A;  4IM0 A;  2NBU A;  2WWZ A;  3DVG Y;  4YL8 A;  2MCN B;  3AXC A;  2XK5 A;  3B08 A;  4M0W B;  3RZF A;  3K9O B;  2LAS A;  1YD8 U;  5E6N A;  1JRU A;  3A9K A;  4ASW C;  1E8X A;  4EZJ A;  3APF A;  1Q1O A;  4EZK A;  5LLI A;  3VUX A;  2ZNV B;  3M95 A;  4IWQ A;  2BWE S;  2L8J A;  1Z2M A;  1V6E A;  3Q3J A;  4HCP B;  4MGK E;  1V80 A;  2WX1 A;  4URK A;  2ZPN A;  4DBG A;  2Z0E B;  2XBB C;  4FAD A;  4PYU A;  2B3A A;  3QIJ A;  1GC6 A;  2O2V B;  2LGY A;  2KLC A;  3SD5 A;  3B0A A;  4EEW A;  2MBQ A;  2AYO B;  3QCA A;  3A4R A;  4GN1 A;  2KD0 A;  2C7N B;  1Q5W B;  2AEH A;  3PPA A;  3TL5 A;  3TBL D;  3VTW A;  3AI5 A;  3ALB A;  2BYE A;  2ZCC A;  2LJ5 A;  4NY0 A;  4IW0 A;  2JPH A;  3X23 A;  2O6V A;  2KFK A;  3B1L X;  4NPN A;  3SDL C;  3VDZ A;  3TCA A;  4BKG A;  2IBI B;  2KTF A;  3M63 B;  5C23 A;  4CO7 A;  4DXA B;  2DX5 B;  2V1Y A;  2JF5 A;  5DPS A;  2KFK B;  2NVU I;  1WXA A;  4LCD E;  5D7G A;  3TIX A;  4ANV A;  2IO0 B;  4W9K A;  1F9J A;  3DVN V;  4WJO A;  5CTR C;  4GXB A;  3W1S A;  2DAF A;  2IO3 B;  1WIA A;  2FNJ B;  2LRU A;  4I6L B;  4KZ0 A;  4KSL C;  2PJH A;  3MJW A;  4M8N A;  4A20 A;  1P3Q U;  2WYQ A;  4ZRK A;  2D3G A;  4WJN A;  1FXT B;  3N3K B;  4TQ1 A;  3KYC D;  2MBE A;  3N30 A;  3QJZ A;  2CKH B;  2JWZ A;  1OGW A;  2ZZP B;  5D6J B;  3IHP C;  1E7V A;  2DYO A;  1UGM A;  2RR9 A;  3APD A;  4E71 A;  2N4F A;  2J0J A;  1J0G A;  2CR5 A;  3VUW A;  4A3O A;  5DPW A;  1ZGU B;  4XX5 A;  4BKT A;  2KKC A;  2AL3 A;  4BOZ B;  4GDK A;  2KAN A;  4NNJ B;  2ZJD A;  3WAN A;  1WJN A;  4WAA A;  1KJT A;  4GSW A;  3N32 A;  4MJS A;  4RMA A;  2UYZ B;  3GZN I;  5D94 A;  4GOC A;  4GDK B;  3KH0 A;  1V86 A;  3QC8 B;  2DZI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...