3SDLC

Crystal structure of human isg15 in complex with ns1 n-terminal region from influenza b virus, northeast structural genomics consortium target ids hx6481, hr2873, and or2
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
151
structure length
151
Chain Sequence
DLTVKMLAGNEFQVSLSSSMSVSELKAQITQKIGVHAFQQRLAVHPSGVALQDRVPLASQGLGPGSTVLLVVDKCDEPLSILVRNNKGRSSTYEVRLTQTVAHLKQQVSGLEGVQDDLFWLTFEGKPLEDQLPLGEYGLKPLSTVFMNLRL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis for the sequence-specific recognition of human ISG15 by the NS1 protein of influenza B virus.
pubmed doi rcsb
source organism Influenza b virus
molecule tags Viral protein/antiviral protein
molecule keywords Non-structural protein 1
total genus 37
structure length 151
sequence length 151
chains with identical sequence D
ec nomenclature
pdb deposition date 2011-06-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00240 ubiquitin Ubiquitin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 3sdlC02
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 3sdlC01
1QZEA 1Z2MA 3BINA 3M95A 4GB9A 3RULA 4PYUA 2ZZPB 3W1YA 3EC8A 4WJNA 3PLUA 2LJ5A 3WAOA 3NZUA 1CMXB 2IY0B 4FHJA 2FCNA 2UWQA 2KDEB 2ASQA 3B1LX 4B9KA 3A1QA 2MP2A 3H6NA 3PPAA 4MM3A 4A20A 2IO0B 1GNUA 4K7UA 4RMAA 2MBOA 3MTNB 4JLCA 2GBRA 4ZRIA 2LGYA 3QQ8B 1C1YB 3N30A 2BGFA 3PT2B 3ML8A 3R66C 4EKUA 3KUZA 4G50A 1I42A 1LQBA 2NPTB 4F1SA 1SGHA 1LXDA 4JIOU 2A4ZA 3ZKJC 3PREA 1A5RA 3A4RA 1K8RB 1YQBA 2IY1B 2LGXA 4P7IA 2ZPNA 3DCGA 4BFRA 3AXCA 1IP9A 1C3TA 2R2OA 4HLEA 1GUAB 2D10A 3PS6A 4GU2A 2JWZA 2N7DA 3Q3FA 5CHVC 4IG7B 4W9FA 2WWZA 4GMVA 3VTWA 4W9CA 1H4RA 4WWOA 4WWNA 3V61A 5CX3A 3V60A 4AUQC 1XT9B 1YX6B 2BYEA 3KUDB 4HVBA 1IYFA 4HCNB 3AI5A 3SDLC 4K7WA 1VCBA 3ZDTA 3V6EB 2GBJA 2ZCCA 2BF8B 4WAAA 1E8ZA 3L08A 1ZGUB 1D3ZA 4E74A 2KO3A 4ANXA 2L05A 2KVRA 4BOZB 2JZ3B 2PE9A 4OVUA 3B08A 2OOBB 1WJ6A 3VH4B 1WY8A 2KDBA 3ZNHB 4F8CB 4JQWC 4MGIE 2JZZA 5EDSA 2VRRB 1WXSA 1WMHA 2LVQA 2MBHA 4WJQA 4E3CA 1ZW7A 1YJ1A 2BKRB 2NR2A 2LUEA 1KM7A 2LWPA 3ZNGC 5L95C 2NBWB 4HCPB 2KMAA 2J0MA 3RZWC 3ZW3A 4FHKA 1WZ3A 3UINB 4HJKA 2CS4A 3UIPB 3WA0A 2JY6A 1T0YA 1V80A 2O6VB 3V6CB 4PS7A 4NJ7A 4BKSD 2O6VA 3UF8A 4WQOB 3CMMB 3JSVA 1WX7A 5CTRC 1V5OA 1Y8RC 2Z0EB 4DHZE 2W9NA 5J18A 3U30A 3M3JA 2C5LC 3TJPA 2KD0A 2JUOA 3H7PB 3ZLZA 4IWOA 4I6NB 1WM2A 2CHXA 1WX9A 2HTHA 2DENB 3H1UA 1WXVA 2DYMA 4W9HA 4IWPA 2D3GA 4TQ1A 2K8HA 2N9EB 3UIOB 3VUXA 2EMSA 3VTVA 4NQKE 4W9DA 4EEWA 3ONSA 3DQVA 4PS3A 2QHOA 2KN5A 2KDFB 2KLGA 1OEYA 3PLVA 3N32A 2CR5A 4MDKE 3VVWB 3KYCD 1E5WA 4HDOA 1GJZA 2DYOA 4CHKA 5DPRA 2M0XA 1P1AA 3A9JA 3IBEA 2RR9A 4EZKA 2M1MA 3DBRI 4KVGB 3PRMB 4FJYA 2L00B 3RYTA 1S3SG 3U8ZA 3UGBB 4DHZB 1NDDA 5HKHA 1UBQA 3VDZA 2BWES 2IO3B 4TKNA 4MEMA 5AZFA 1TTNA 4MGYE 2DX5B 4MGZE 1MG8A 2K8CA 4XX5A 3WAPA 3APCA 3ZUNA 4GOCA 5L83A 3UQBA 3UQAA 4G0NB 4K7SA 4AJWA 1S1QB 2ZNVC 1OEYJ 5E6PA 5DPWA 1XD3B 3RT3B 1LFDA 1X1MA 2JRIB 3A1QB 1E8XA 2KKCA 3WANA 3HHMA 2KMCA 4PS8A 2IZVB 4B95A 4KIKB 5GMVA 5KHOA 2KFKA 3QA8A 4OVVA 5CHFA 1VD2A 3IVFA 5J17A 2KTRB 4W9EA 3HM3A 1KLVA 2CKHB 2C60A 2XEWA 4FLHA 5AZHA 2KDIA 2N9XA 4N9F4 5BO4B 4ANUA 3A9KB 1YIWA 2KOXA 2KWUB 2KC1A 4NPNA 1UELA 2I1KA 2FCMA 2LZ6A 3QARA 3JW0X 1KJTA 5LLIA 2C7HA 1WE7A 2IBIB 1WZ0A 4LDTD 3PHWB 2FIDA 1WJNA 2V1YA 3OLMD 5E6NA 1WX8A 1R4MI 2K8BA 3GOEA 4A3OA 2O6VD 3WALA 3AU4A 2MSED 1EUVB 3LDZE 3QCAA 4G3XB 2GBMA 1F9JA 1LM8B 2IYDB 2MCNB 4FJZA 4IW0A 1RAXA 2WX0A 4JL9A 1M94A 4FADA 5LXIB 3HIZA 3VHTC 2KC2A 4GGQA 4M8MA 3IFWB 3H9DA 2JVCA 2HJ8A 4HXDA 5C1ZA 1V9JA 4MH0E 4XC2A 4ANVA 1GC7A 4BBNF 1Q1OA 2CHZA 4GSWA 2DZMA 1ISNA 2OJRA 5CHWA 2DYBA 2ZCBA 4LCDE 2GOWA 4FA6A 4GDKA 1P98A 4DBGA 5KHQA 3VUWA 4II3B 1TBEA 2K1FA 2L0TA 4GIVA 1U4AA 2ZVOA 2MP2B 3KYDD 1SE9A 2HE7A 3EHVA 2DHZA 4GDLB 4MJSB 2FCSA 2KJ6A 1WGDA 2ZNVB 1RRBA 4G11A 2LD9A 4RM9A 4M8NA 3APDA 1Q0WB 4HPMB 4FULA 3TMPB 2C7NB 2KNBA 3DVGX 3A33B 4J6IA 3P2BA 3QK0A 4W9GA 3LJ3A 2REXA 2N1VA 3VTUA 4NJ6A 2AYOB 2WDTB 2J0KA 2C9WB 2MBQA 2GBKA 2M17A 3ZVVA 2PEAA 4KSLC 3S2AA 2L76A 4DHJB 2LASA 4BKGA 3ECIA 3OJ4B 4LJOB 3L0WB 4BVUC 4F7ZA 3ZTCA 5J2RA 4ANWA 4DDGD 2NBUA 5DPTA 1WI0A 4RM8A 2Z59B 1R4NI 1E90A 3K9OB 1NI2A 2KLCA 4NNJB 2YVCA 2C7MB 5D7GA 2NBVB 2NS5A 3PRPB 3IHPC 3PSEB 4BKSA 3ML9A 1P0RA 1UD7A 4YL8A 4KDLB 4HK2A 4TV3A 2ZJDA 2PE6B 3DPDA 3HM6X 2BYFA 2DAJA 4K1RB 1WR6E 2FIFA 3KUCB 2LGDA 4JGHB 2MX2A 4XZ4A 1UGMA 1OGWA 4I6LB 3CSFA 1IPGA 2N7EA 2FUHB 3L16A 4FBJB 1L2NA 1WXAA 3EFUA 3NZSA 4NAWA 1E8WA 1WE6A 1WGYA 3RD2A 1H8CA 2KHWB 3O65B 3L10B 4IM2A 3DVNV 3QHTA 2MWSB 3PZDA 1P3QU 3SHQA 2DZKA 2NCNA 3WIMA 2G3QB 3ZNZB 2KQ7A 2M8SA 2MBEA 1WXMA 2XK5B 2LRWA 2AEHA 4EUTA 4TQ0A 4MGKE 3X0WA 2N4FA 5G2NA 2RPQA 1L7YA 3AU5A 1HE8A 4EOYA 4BBNC 2KWVB 4E71A 2D2QA 2AWTA 4K81A 4ZRKA 3L17A 1GC6A 2FCQA 4W9IA 1WGHA 4AWJA 3N3KB 4WWPA 2DZIA 3KH0A 4B6WA 4AOFA 3L13A 4URKA 4EZLA 1BT0A 2XBBC 2JXXA 2FAZA 1FXTB 3ZO5B 2ZPYA 3TL5A 4W9JA 3JVZX 3R7QA 1EF1A 1WH3A 2LVPA 4LDTB 2RGFA 1GG3A 1J0GA 2MLBA 2D07B 2K6QA 1WYWB 2B3AA 4AJYB 4HWIB 4NY0A 3A9KA 3ENEA 3ZTDA 2FNJB 2L7RA 1WIAA 3ZRFA 3BY4B 4MELA 1UBIA 1WGRA 3R3MA 2MRPA 3K9PB 4HDQA 3TBLD 1EO6A 2I1JA 2L8JA 2MW5A 2KFJA 1PQSA 2JRHA 1TZ1A 2EMTA 3PTFC 1OTRB 3DBLI 4WJPA 4CYEA 2PJHA 4W9LA 2M4NA 2JPHA 3QAQA 5JHBA 3EECA 2K39A 2LVOA 3W1SA 3MJWA 4BKTA 3QX1A 3VUYA 2J7QB 2HD5B 3QC8B 4ZDVA 3QJZA 1RFAA 3SD5A 2CU1A 1WJUA 3MHSD 3OJ3A 3PVLA 5IA7A 1YX5B 4I6PA 4GDLA 2D11A 4MJSA 3RUIB 2V3SA 2KQSA 3JYUA 2WYQA 1YD8U 2L3ZA 3NY5A 1V2YA 2KXJA 4X57B 3V62A 4ASWC 4BOSC 4KSKC 2J0JA 2KZRA 2MBBB 1KOTA 3PV1A 4IM3A 3A9JB 3M63B 3QWZB 2CHWA 2KTRA 4W9KA 2R2QA 3TIXA 2IO2B 3VFKA 3NHEB 1EF5A 4KZ0A 3H7PA 4KDIC 2KK8A 5JZEB 1OQYA 1ZKHA 2LXAA 3KW5B 3T8MA 1WJ4A 3ZNID 1WRDB 5DCNA 3IG3A 3VH3B 5D6JB 4DWFA 2EKEC 1TGZB 3KVFB 5FR6A 2KFKB 4WJOA 4NQLB 2ZEQA 1V49A 3DVNU 4DHJD 4GXBA 3DOWA 3X23A 2MA9B 2IO1B 3DBSA 2RSUA 3W1SC 4TUUA 2BKFA 2LI5A 5G55A 1WGGA 3Q3JA 1Q5WB 3M62B 4GDKB 1XQQA 2L0FA 1WF9A 2G4SA 2BWFA 3CSTA 2K25A 3NOBA 1JRUA 2V4LA 2JT4B 3NS8A 2DAFA 1E8YA 4FJVB 3WAMA 1G6JA 2N1WA 1V5TA 3VXWA 2AL6A 2PPHA 4KIKA 2KX0A 2BYVE 2ZVNA 3GZNI 3HK0A 4EZJA 4A3PA 4MSMB 2BPSA 4DK5A 2KX3A 5E6OA 2AL3A 2A5UA 2G4DB 3SU8X 1I35A 2KTFA 3ZDMC 3B0AA 4KV2A 5C23A 1E7UA 2KWCA 5AZGA 2JF5A 4EFOA 3ZRCA 4FN2A 1V86A 2Z0DB 3H7SA 3R7RA 1J8CA 3RCZA 3A4SC 4AP4C 3VQIA 3TCAA 3I3TB 3APFA 4ICUA 2NPTA 4ZYNA 4M0WB 4ZRJA 2UYZB 4IC7B 2NVUI 3L54A 4LJPB 1UH6A 4HPLB 4DDID 3U7DA 4IWQA 2XK5A 3PRZA 2RD0A 5D2MB 1P9DU 4CO7A 1WFYA 5TR5A 1E7VA 3VAWA 1WM3A 4GN1A 3T9LA 3DVGY 2LRUA 2YLMA 3QIJA 1SIFA 1V6EA 2GMIC 2K6DB 5AEKB 2Y5BB 3DDCB 4NAWB 4PYZA 2MQJA 2N9PC 3C0RB 5JHAA 1AARA 4IM0A 4MSQB 1UZXB 2LXCA 4IUMB 5IAAC 1WMHB 3RZFA 3DBHI 4DXAB 2DZJA 3ALBA 2KANA 2GBNA 2WX1A 4II2B 3D32A 4KZCA 2O2VB 2G45B 2KJHB 1RLFA 5DPSA 3CF6E 1J19A 1V81A 4ICVA 2KJRA 1NBFC 5JH5C 1Z5SB 5LXHA 2O2VA 3ZIMA 3PHXB 3AULA 3OAWA 3JSVB 5D94A 3PGEA 1WR1A
chains in the Genus database with same CATH superfamily
5FKAC 4RCOA 3EC8A 2LJ5A 3WAOA 2KDEB 2ASQA 2MP2A 2VZKD 3H6NA 3PPAA 4JWSC 4K7UA 4XDCA 1HQRD 3Q3NC 2BGFA 3KUZA 3NVYA 4NAMA 1I42A 1JWBD 2BYTA 1C9FA 4HROA 2A4ZA 3WCQA 3PREA 3A4RA 2PKOA 2LGXA 1KLUD 3EA6A 4BFRA 3Q3FA 2KDMA 2WWZA 3Q6BA 1TKYA 2CJOA 2GB1A 3LB8C 4AUQC 1E10A 3KUDB 2LEKA 1HZ6A 1RYJA 3V6EB 2ZCCA 2BF8B 4WAAA 1I4XA 2KO3A 2KVRA 2WXKA 5D3DA 3N1ZC 1TYGB 1WJ6A 1KH0A 1WY8A 1R4MB 5EDSA 5BMIA 1WMHA 4WJQA 1HTQA 2NR2A 3RNCC 2NBWB 3ZW3A 4FHKA 4BAXA 4HJKA 2N9LA 3UIPB 2KVZA 1D5ZC 3WA0A 4AQ7A 5T8IA 4PS7A 2DNFA 3MC0B 1V5OA 4WIPA 3TJPA 3W5UB 3BVGA 2H88B 2JUOA 3Q8EA 3ZLZA 4IWOA 2JYEA 2DENB 1B9RA 3AECB 5IKCM 2V4IB 2Y5CA 2D3GA 4TQ1A 2N9EB 1YJJA 3UIOB 3VTVA 4W9DA 1KF6B 4PS3A 2KDFB 2KLGA 5FR3A 1YN5A 3J9CA 1BMLC 3FILB 4HDOA 2FE8A 2DYOA 2M0XA 4MT5A 2BS3B 4N6EB 3EGRA 3DHIC 3V3XA 3NRZA 3PRMB 4FJYA 2L00B 4DHZB 3VDZA 2BWES 5D3IB 3SR6A 4BZAA 4MEMA 5AZFA 2QMTA 2V9HA 1E7PB 4HPPA 5DPWA 1XD3B 1LFDA 2JRIB 1E8XA 2KKCA 3HHMA 2WLBA 4XE0A 3U7ZA 5GMVA 3QA8A 4OVVA 5CHFA 1VD2A 2CKHB 2V3PA 1CZPA 5AZHA 1MVKA 5BO4B 1YIWA 2I1KA 2LZ6A 5AUIA 5MPOA 1L4DB 1KJTA 4ARCA 1TIFA 4Q2JA 1WZ0A 1WJNA 2J52A 3OLMD 1R4MI 2K8BA 3GOEA 3N9YC 4A3OA 1F9JA 2WXGA 4FJZA 1RAXA 2MJDA 4FADA 5LXIB 2IJ0A 3IFWB 2JVCA 4XC2A 3ETRA 1GC7A 2DBYA 5CHWA 2DYBA 2CU3A 4LCDE 1A70A 2BTEA 1PYWD 4FA6A 4ZHOA 2W82A 2K1FA 1U4AA 2AX5A 1SE9A 2FCSA 2NTSA 2LD9A 4TMAB 2LFIA 3BK2A 3QK0A 4MM3B 3N1YC 4HJGE 3VTUA 4NJ6A 2WDTB 3ZVVA 2MBQA 2WXNA 3S2AA 2L76A 3ECIA 3OJ4B 4LJOB 3Q8AA 2N7JA 2WP9B 1V1OA 2NBUA 1T6BX 1UWMA 4RM8A 1WI0A 3K9OB 2BS4B 1NI2A 2YVCA 2NBVB 3PRPB 4BKSA 3ML9A 4L2YA 3HUIA 3HM6X 1YMHE 4K1RB 4JGHB 4JX1C 1OGWA 3NG0A 1WSPA 2WXPA 1L2NA 3EFUA 3RD2A 1H8CA 3O65B 3L10B 4IM2A 2E6XA 1P3QU 2NCNA 2NTTA 5EE9A 1MPEA 1YN3A 1C4CA 2LRWA 4EUTA 4TQ0A 2N4FA 4EOYA 3N1XC 2DZIA 2FAZA 3MC9A 3TL5A 1WH3A 5IO9A 1QOAA 2L7RA 3BY4B 1UBIA 4HDQA 1EO6A 2BW2A 1F2RC 1TZ1A 3PTFC 2OEDA 2M4NA 3QAQA 3EECA 1CQVA 2K39A 2B76B 4WURA 2SEBD 3QC8B 1XO3A 3RFZB 1RFAA 3AE8B 2WXFA 4MJSA 3RUIB 3MFGA 3NY5A 2WYQA 2J0JA 2KZRA 1KOTA 2WXJA 3M63B 2CHWA 2KTRA 2INDC 5GXGB 2WXIA 3KWVA 3TIXA 2J4XA 3VFKA 1EF5A 5IOIA 5JZEB 2D5GA 5H92C 1WRDB 5DCNA 4OW0A 4DWFA 4RGNA 1I4GA 1FXIA 3DVNU 2INPE 2RSUA 3BZDB 4ZRPA 2BWFA 2K25A 1CJEA 1VR9A 2JT4B 3NS8A 3WAMA 3VXWA 3HK0A 2KX0A 5BYSA 4A3PA 3R2IA 1ROEA 4REZA 2A5UA 2KYWA 4XYCA 2G4DB 3O13A 2KTFA 3ZDMC 4KV2A 2KWCA 5AZGA 1TY2A 3FILA 4FN2A 1D5XC 2Z0DB 4RH6A 1J8CA 1C77A 3RCZA 4C7ZA 3I3TB 1IBXA 1K51A 4ZYNA 4M0WB 4ZRJA 2MJ3A 2QSDA 1N62A 3U7DA 3PRZA 2XK5A 2RD0A 3I57A 2I2YA 3KWLA 1T0SC 1WFYA 3P4RB 3VAWA 2PVOD 1WYGA 1K50A 2LRUA 1SIFA 2K6DB 2GMIC 3C8YA 2Y5BB 2QILA 2V0GA 1QF6A 4IM0A 1TKGA 3RZFA 4DXAB 3DBHI 3DHHC 2GBNA 3D32A 1MJDA 1RM6C 3CF6E 4ICVA 2J42A 4GLSC 4ZRQA 4YWGG 4MACA 3PHXB 3OAWA 3JSVB 1ZXIA 3M95A 3RULA 2N0SB 1V97A 4XGAB 4WJNA 3GS2A 1EM7A 1L0XB 2FCNA 3B1LX 3A1QA 4A20A 2DWQA 2GBRA 2LGYA 3PO0A 5BMGA 1PDXA 4IDIA 4HEA1 1SBBB 1SGHA 4B0MA 3ZKJC 1YQBA 2IY1B 2M56B 2ZPNA 3DCGA 1JRPA 4ZHPA 4A8XC 2R2OA 4HLEA 1SEBD 2D10A 3PS6A 2JWZA 5CHVC 2X38A 3ZJVA 3DBLB 4W9CA 1H4RA 1N5XA 3RPFC 2BYEA 1STEA 1VCBA 1FNWA 3L08A 1ZGUB 1D3ZA 4ANXA 2L05A 4BOZB 2IDYA 2PE9A 1ACCA 3AE2B 2KDBA 1KLGD 2VRRB 1N61A 1WXSA 2WDVB 2LVQA 4E3CA 1ZW7A 2BKRB 4C7YA 3AE5B 2LUEA 3ZNGC 4HCPB 1WZ3A 3GP7A 3NVZA 3UINB 2CS4A 1JWAD 3E9SA 4M02A 2JY6A 1FCLA 2INNE 3V6CB 1NYRA 2O6VA 3UF8A 4WQOB 1Y8RC 2C5LC 1XF5L 4C4VB 1FIQA 4I6NB 1WX9A 1P7EA 3AH7A 3H1UA 1OFFA 2DYMA 2NMQA 3VUXA 3W2DA 2EMSA 3ONSA 3DQVA 2LMCA 1RWSA 2CR5A 1D6EC 1P1AA 2QCZA 3IBEA 2RR9A 2M1MA 3Q3OC 1HA5A 1ZDVA 1WWTA 1NDDA 1UBQA 1TS4A 3P63A 4MGYE 2DX5B 1I7HA 3ZUNA 5L83A 5JXVA 4K7SA 4JPSA 5E6PA 1OEYJ 2Q5WD 1UUPA 3A1QB 4KKJA 2KMCA 2IZVB 3VRAB 3DWMA 2KFKA 5J17A 1ZOYB 2C60A 4FLHA 2KDIA 4ANUA 3A9KB 1FMAD 1UELA 1UWXA 2IBIB 4YSYB 2FIDA 2V1YA 1JWSD 5E6NA 2O6VD 1K53A 3WALA 3AU4A 2MSED 1OQRA 2K9XA 3KQ4A 1VJKA 2MCNB 4IW0A 5BMHA 2J53A 3HIZA 4M8MA 3H9DA 2VZKB 2HJ8A 2LGIA 1V9JA 5C1ZA 4MH0E 3RN9C 3NUHB 1Q1OA 2CHZA 2R61A 1ISNA 1SE3A 2W55A 1FNVA 4DBGA 1P98A 1TBEA 2L0TA 2ZVOA 4KGRA 4MJSB 2DHZA 1FEHA 2KJ6A 3ZGZA 4M8NA 4HPMB 3TMPB 3ZXRA 1TS2A 2K3UA 2WDRB 3LJ3A 2REXA 2N1VA 1SIJA 4N59A 4DHJB 2LASA 5I4DA 4P1BC 3L0WB 4BVUC 3ZTCA 5DPTA 1YJIA 3B2GA 1D4BA 1CK1A 2C7MB 2Y3AA 2NS5A 3RNGC 1I4PA 1KTKA 1P0RA 1UD7A 4YL8A 4TV3A 2BYFA 1WR6E 4XWTA 2LGDA 2MX2A 4XZ4A 3CSFA 1WXAA 2L32A 3NZSA 1WE6A 1WGYA 2KHWB 2MWSB 2DZKA 1VZ7A 2WXLA 2M8SA 1WXMA 1QT9A 2IGHA 2FBWB 2JWUA 1HE8A 4OZBA 3GE3C 4E71A 1AW7A 1K52A 2D2QA 2AWTA 4ZRKA 1V1PA 1P7FA 1WGHA 4AWJA 3ZJTA 2ZPYA 1FPYA 3R7QA 2KN4A 1GG3A 4YXDB 1XCTL 3ZTDA 3GZNB 2FNJB 3ZRFA 4MELA 3R3MA 3K9PB 3TBLD 1PUTA 2I1JA 4MH8A 2KFJA 2JRHA 4CYEA 3V05A 2QIEB 3W1SA 4NZLB 3SD5A 2CU1A 3RNBC 1WJUA 3MHSD 1VZ6A 3R2TA 2V3SA 2KQSA 3IAM1 2KXJA 4X57B 4BOSC 4KSKC 3NVWA 3R8BA 4DXFA 3NHEB 2IGGA 1ZKHA 2LXAA 4A6QA 1WJ4A 1V8CA 2KMMA 3AE1B 2MJEA 3ZJUA 3IG3A 3VH3B 1JW9D 2WXRA 3U52E 4LTUA 1AWDA 1TJEA 3KVFB 3ZQ4A 4WJOA 2ZEQA 1V49A 4DHJD 1T5XD 3RMKC 2JX5A 3BIID 1ZP0B 3Q8BA 3DBHB 4A9AA 1UF0A 3CSTA 1XLNA 1JRUA 1G6JA 1V5TA 2KT7A 2PPHA 4KIKA 2BYVE 4EZJA 4RNAA 1LO5D 4DK5A 3RNEC 4O1NA 3TEYA 4N58A 3B0AA 1E7UA 2JF5A 3IXSA 1V86A 3H7SA 1QOGA 3P4SB 2RDGA 3EFCA 1UNSA 3VQIA 4JE3B 3TEXA 4DDID 2I38A 2BVCA 3AMZA 1SXTA 1DOXA 4CO7A 5TR5A 1E7VA 4M0WA 1WRIA 4S17A 3DDCB 4NAWB 1JCKB 2M0AA 1QLBB 2LXCA 4R3DA 2KAJA 2DZJA 1J7BA 4II2B 1JQ4A 4KZCA 2PLPA 2KJHB 2HDEA 1AYFA 5DPSA 1J19A 2KJRA 1NBFC 1Z5SB 5LXHA 2O2VA 4LK0M 3AULA 1WR1A 1QZEA 1Z2MA 3NZ3A 4PYUA 3W1YA 3PLUA 3NZUA 1CMXB 2AQ2B 4FHJA 1MFWA 1GNUA 3IAS1 1TS5A 1GAQB 4RMAA 3MTNB 4JLCA 1DOYA 3QQ8B 3RI7C 3N30A 4RF0A 1SB3C 3ML8A 1J7CA 3PT2B 3R66C 4G50A 2SAKA 4JIOU 1A5RA 1K8RB 4S0RA 1L6VA 1GUAB 2ACZB 1GB1A 2FUG1 4IG7B 4W9FA 1ZUD2 2WHIA 4WWNA 2G9HD 3V61A 1IYFA 3SDLC 3EUB2 4K7WA 1GOZA 2D3AA 2MH7A 4XDDA 3H8HA 3ZDTA 4EE2A 4E74A 2JZ3B 4OVUA 4A55A 3B08A 2OOBB 4F8CB 2EKIA 2JZZA 3SFEB 1N6ZA 1C76A 1KM7A 5L95C 2KMAA 1MHXA 2WXOA 1C78A 1EU4A 3ZYYX 1V80A 3AEBB 2O6VB 4NJ7A 4BKSD 4OVZA 4PT5A 3CMMB 5CTRC 5J18A 2Z0EB 2W9NA 3U30A 3RNAC 3M3JA 2WQYB 2KD0A 5FK9C 1WM2A 3AEFB 2IPKD 4JWUC 1WXVA 4AS1A 1UGJA 4IWPA 3Q2AC 2DLBA 1C4AA 2KN5A 2JZPA 2ON8A 1OEYA 1FXAA 4L1BA 3KYCD 1E5WA 2W3SA 3DBRB 4ACFA 4EZKA 3AM9A 3DBRI 4KVGB 1S3SG 2KACA 2UU7A 3UGBB 5C3JB 5HKHA 2BQQA 1T0RC 4TKNA 1TTNA 3SFDB 4MGZE 2VH2A 1L5PA 1PGBA 1MG8A 2WXQA 4XX5A 4M01A 3HRDD 4GOCA 3UQBA 4G0NB 3RT3B 1X1MA 1BXTA 3WANA 3I5JC 4B95A 4KIKB 2WS3B 5KHOA 1MG4A 1VLBA 2XNAC 4W9EA 1KLVA 1JWMD 2XEWA 1TKEA 4OZCA 1VZ8A 4RGOS 2N9XA 2KOXA 2KWUB 5LNK1 1NI3A 1ZPSA 2D3CA 3JW0X 5LLIA 2BB6A 3PHWB 1QOFA 1WX8A 1F77A 4YSXB 2BT6A 2YEPB 3LDZE 1QOBA 4G3XB 3QCAA 1LM8B 2QC8A 2IYDB 2WX0A 1M94A 3VHTC 2INCC 2KC2A 1B1ZA 4A90A 1M4VA 4HXDA 2BS2B 4ANVA 2WXHA 4K3CA 4BBNF 1YNTE 3P42A 1FRRA 4H2AA 2ZCBA 1MI0A 5HI1A 4IKGA 4GDKA 3VUWA 4II3B 2HE7A 4GDLB 2AQ1B 3ABVB 4RF1A 3FC4A 3TEZA 2GI9A 1RRBA 4G11A 4RM9A 5EE3A 3APDA 1JWUD 4FULA 2C7NB 3B9JA 2KNBA 2QDFA 4W9GA 4USAA 4P16A 4M00A 2W3RA 2Z8LA 1D5MC 4FXCA 2AYOB 2J0KA 1C79A 4PK1A 1F2RI 2PEAA 1PGXA 4ANWA 4DDGD 1J7AA 1FM0D 3VRBB 1E6EB 1R4NI 4NNJB 4DQOC 5D7GA 2H89B 1XXGA 2QEJC 1ET9A 3T3OA 3BWUD 2ZJDA 2PE6B 2FIFA 4I6LB 1IPGA 2N7EA 4P1CC 2FUHB 3L16A 4FBJB 2ONQA 4NAWA 1E8WA 3SEBA 1EWYC 3AEDB 3QHTA 3PZDA 3DHGC 1MHHE 2G3QB 3ZNZB 2XN9C 2HTME 2KQ7A 2XK5B 4LLGM 4WWMA 1FRDA 2AEHA 1I4HA 5G2NA 1L7YA 2LGSA 3L17A 1GC6A 4ZOHC 2K0PA 4B6WA 3N3KB 4WWPA 3L13A 4URKA 4EZLA 2RDHA 1BT0A 2XBBC 2JXXA 4OHJA 3ZO5B 2LVPA 2RGFA 1J0GA 2MLBA 1WYWB 2B3AA 5HHDG 4AJYB 3A9KA 3ENEA 1WIAA 1WGRA 4ITKA 2L83A 2MRPA 3VR8B 5G5GA 3DBLI 4WJPA 2PJHA 2LVOA 3MJ5A 3OWEB 4BKTA 2J7QB 1KFYB 4ZDVA 3QJZA 1HZ5A 2GRIA 1SE4A 5TSSA 4LNOA 1L0YB 3PVLA 5IA7A 1YX5B 4I6PA 4IOIE 2L52A 3JYUA 2L3ZA 3KLSX 1C4PA 4RGTA 1F1HA 3QWZB 1SE2A 4W9KA 2IO2B 4D2KA 4KZ0A 3T8MA 1NENB 3ZNID 4DXGA 4QAYA 2ZW1A 2CJNA 2EKEC 1DOIA 3AB5A 3UI3A 3DOWA 3X23A 2MA9B 2IO1B 3DBSA 2BBCA 4HKQA 5AUKA 1Q5WB 3M62B 2MEKA 1WF9A 2G4SA 2BB5A 3NOBA 2DAFA 1L6UA 1E8YA 5BYRA 1JROA 2AL6A 2WU5B 2ZW0A 2ZVNA 3DWGC 2V3NA 2KX3A 3SU8X 3ZRCA 2WXMA 1JALA 3LYYA 1V1PB 3TCAA 2NPTA 2JSVX 3FKYA 2Y5PA 4IC7B 2NVUI 1WXQA 4LJPB 1UH6A 4HPLB 3PZ8A 4IWQA 5D2MB 3I9V1 4GN1A 1SF0A 2YLMA 4PYZA 3BYYB 5JHAA 4IUMB 3BYTB 5IAAC 3ALBA 2WX1A 3P1MA 4LNIA 1RLFA 5JH5C 4C4VA 3BK1A 3ZIMA 1FCCC 4HKZE 3PGEA 5D94A 1R4NB 3URYA 3BINA 4GB9A 2TSSA 2ZZPB 2IY0B 4B9KA 2UWQA 4MM3A 2IO0B 2MBOA 4ZRIA 2EELA 1C1YB 2PIAA 4EKUA 1GB4A 1EWCA 1LQBA 2NPTB 4F1SA 1LXDA 1F0ZA 2WNMA 1TY0A 1TS3A 4P7IA 4WQMA 3AXCA 1IP9A 1C3TA 1XLOA 3OG5A 4GU2A 2N7DA 3MHZA 4YTPB 2PVGC 4GMVA 3VTWA 4WWOA 3Q8FA 3AE3B 5CX3A 3V60A 4HVBA 1XT9B 1YX6B 3Q69A 4HCNB 3AI5A 2GBJA 4P6VF 1E8ZA 4LNFA 4RGMA 5H8YE 1LGRA 3VH4B 3ZNHB 4JQWC 4MGIE 2MBHA 1YJ1A 2LWPA 2J0MA 3RZWC 1QKZA 2X8XX 1YN4A 4YT0B 1T0YA 3W5VB 3PZ7A 4DHZE 3JSVA 1WX7A 3AN1A 4OZAA 1N5WA 3H7PB 3IT6B 2CHXA 2HTHA 1I4RA 4W9HA 1NVID 2K8HA 4NQKE 4EEWA 3U2SC 1YOVB 2QHOA 1ZE3D 3PLVA 3N32A 1NEKB 4MDKE 3VVWB 1VDVA 1GJZA 4CHKA 5DPRA 1T3QA 3A9JA 2KQ4X 1R7SA 2QJLA 4YTMB 3RYTA 3U8ZA 4ZYSA 4US8A 2G1EA 2E3TA 2IO3B 1E9MA 3CWIA 1ESFA 1L0VB 2K8CA 2MHJA 3APCA 3BVZA 3WAPA 1NYQA 3UQAA 4AJWA 1S1QB 2ZNVC 3AE6B 1N63A 5HG2A 1IGCA 1XLPA 4PS8A 1WGKA 5IP4D 3IVFA 2KTRB 3HM3A 4B0EA 1JMLA 1HXYD 1E0ZA 4N9F4 1DYQA 2KC1A 4NPNA 2FCMA 4KGTA 3QARA 4YTNB 2C7HA 1ET6A 4J3OD 1WE7A 4LDTD 3W9CB 2M19A 3BVMA 1EUVB 1N60A 1GPXA 3LXFA 2GBMA 5EE0A 5C2TB 4JL9A 4RFBA 4GGQA 1QQRA 2HJ1A 5IN7A 1ENFA 4GSWA 1IGDA 1TZOA 2DZMA 2OJRA 3AEGB 2GOWA 5KHQA 1FO4A 4GIVA 2MP2B 3KYDD 2W54A 3EHVA 1ZXHA 4K3BA 1WGDA 2ZNVB 2WU2B 2GLSA 1Q0WB 1FNUA 2KWDA 3CIRB 3DVGX 5BYQA 3A33B 4WH4A 4J6IA 3P2BA 1HEZE 3AE9B 2RDBC 3I63C 3Q8CA 2C9WB 2GBKA 2M17A 4KSLC 1DGJA 1T0QC 4BKGA 4US9A 1OQQA 3T3NA 1SSNA 2JQRB 3C19A 3ZXVA 4F7ZA 5J2RA 3IT4B 1SJHD 2Z59B 1E90A 2KLCA 2IGDA 1L4ZB 2JYTA 2JU6X 1ZDXA 2VH1A 2LHEA 3AE4B 3IHPC 3P4PB 1PGAA 3PSEB 1FFVA 3TUOA 2PW9A 2OJWA 4KDLB 4HK2A 4C56C 3DPDA 1XCQL 2DAJA 1SJED 3KUCB 2JXTA 1UGMA 4XWWA 4ARIA 3TSSA 3DVNV 3SHQA 3U4EG 3WIMA 2MBEA 3P4QB 2K22A 4MGKE 4C00A 3X0WA 1KRHA 1XEEA 2RPQA 3AU5A 3AE7B 1YQ4B 4BBNC 2KWVB 1RFKA 3AEAB 4K81A 3HVDA 2FCQA 4L23A 4W9IA 3KH0A 3MC8A 4AOFA 3VR9B 1FXTB 2WDQB 5G5HA 4W9JA 3JVZX 3AEEB 1EF1A 1Q10A 4LDTB 2D07B 2K6QA 1BUIC 4HWIB 4NY0A 4C80A 1IUEA 5E6JA 2L8JA 2MW5A 1PQSA 1AN8A 2EMTA 1OTRB 4LNKA 1QILA 4W9LA 2JPHA 5JHBA 3MJWA 2RMMA 3QX1A 3VUYA 3NJTA 2HD5B 2WGSA 1HTOA 2L1AA 1Y56A 3OJ3A 4KX6B 4GDLA 2D11A 1YD8U 1V2YA 2LHDA 3V62A 4ASWC 3Q3MC 5EE1A 2MBBB 3PV1A 4IM3A 3A9JB 3NS1A 2R2QA 1VRAB 3HVZA 3H7PA 1PFDA 4KDIC 2KK8A 4LNNA 1OQYA 3KW5B 2PMVA 5D6JB 3GE8C 2ICIA 1TGZB 5FR6A 2KFKB 4NQLB 3NVVA 3GB1A 2PTLA 4GXBA 1I4QA 4NJCA 2LUMA 3W1SC 4TUUA 2BKFA 2LI5A 5G55A 1WGGA 3Q3JA 4GDKB 4UDUC 1XQQA 1XLQA 2L0FA 3FAHA 2V4LA 1FD6A 4WAFA 2OHFA 2LJIA 4FJVB 1TT5B 2N1WA 3GZNI 4MSMB 2BPSA 5E6OA 2AL3A 1F52A 1FFUA 1I35A 5C23A 3L4PA 1EU3A 4EFOA 3B2FA 2AQ3B 3R7RA 3A4SC 4AP4C 4KKIA 3APFA 2K5PA 4ICUA 3N20C 1IBXB 2UYZB 3MP9A 3L54A 4TSSA 3Q14C 3E56A 1P9DU 2RPVA 1WM3A 5HFYA 3T9LA 4YSZB 3DVGY 3QIJA 1V6EA 5AEKB 2MQJA 2YEPF 2N9PC 3C0RB 1AARA 4MSQB 1UZXB 4KGSA 1WMHB 2KANA 4CQNA 2O2VB 2G45B 1YQ3B 3AV8A 1V81A 4HRSA 3TEWA 3RNFC 2N9KA 2D3BA
chains in the Genus database with same CATH topology
1QZEA 1Z2MA 3BINA 3M95A 4GB9A 3RULA 4PYUA 2ZZPB 3W1YA 3EC8A 4WJNA 3PLUA 2LJ5A 3WAOA 3NZUA 1CMXB 2IY0B 4FHJA 2FCNA 2UWQA 2KDEB 2ASQA 3B1LX 4B9KA 3A1QA 2MP2A 3H6NA 3PPAA 4MM3A 4A20A 2IO0B 1GNUA 4K7UA 4RMAA 2MBOA 3MTNB 4JLCA 2GBRA 4ZRIA 2LGYA 3QQ8B 1C1YB 3N30A 2BGFA 3PT2B 3ML8A 3R66C 4EKUA 3KUZA 4G50A 1I42A 1LQBA 2NPTB 4F1SA 1SGHA 1LXDA 4JIOU 2A4ZA 3ZKJC 3PREA 1A5RA 3A4RA 1K8RB 1YQBA 2IY1B 2LGXA 4P7IA 2ZPNA 3DCGA 4BFRA 3AXCA 1IP9A 1C3TA 2R2OA 4HLEA 1GUAB 2D10A 3PS6A 4GU2A 2JWZA 2N7DA 3Q3FA 5CHVC 4IG7B 4W9FA 2WWZA 4GMVA 3VTWA 4W9CA 1H4RA 4WWOA 4WWNA 3V61A 5CX3A 3V60A 4AUQC 1XT9B 1YX6B 2BYEA 3KUDB 4HVBA 1IYFA 4HCNB 3AI5A 3SDLC 4K7WA 1VCBA 3ZDTA 3V6EB 2GBJA 2ZCCA 2BF8B 4WAAA 1E8ZA 3L08A 1ZGUB 1D3ZA 4E74A 2KO3A 4ANXA 2L05A 2KVRA 4BOZB 2JZ3B 2PE9A 4OVUA 3B08A 2OOBB 1WJ6A 3VH4B 1WY8A 2KDBA 3ZNHB 4F8CB 4JQWC 4MGIE 2JZZA 5EDSA 2VRRB 1WXSA 1WMHA 2LVQA 2MBHA 4WJQA 4E3CA 1ZW7A 1YJ1A 2BKRB 2NR2A 2LUEA 1KM7A 2LWPA 3ZNGC 5L95C 2NBWB 4HCPB 2KMAA 2J0MA 3RZWC 3ZW3A 4FHKA 1WZ3A 3UINB 4HJKA 2CS4A 3UIPB 3WA0A 2JY6A 1T0YA 1V80A 2O6VB 3V6CB 4PS7A 4NJ7A 4BKSD 2O6VA 3UF8A 4WQOB 3CMMB 3JSVA 1WX7A 5CTRC 1V5OA 1Y8RC 2Z0EB 4DHZE 2W9NA 5J18A 3U30A 3M3JA 2C5LC 3TJPA 2KD0A 2JUOA 3H7PB 3ZLZA 4IWOA 4I6NB 1WM2A 2CHXA 1WX9A 2HTHA 2DENB 3H1UA 1WXVA 2DYMA 4W9HA 4IWPA 2D3GA 4TQ1A 2K8HA 2N9EB 3UIOB 3VUXA 2EMSA 3VTVA 4NQKE 4W9DA 4EEWA 3ONSA 3DQVA 4PS3A 2QHOA 2KN5A 2KDFB 2KLGA 1OEYA 3PLVA 3N32A 2CR5A 4MDKE 3VVWB 3KYCD 1E5WA 4HDOA 1GJZA 2DYOA 4CHKA 5DPRA 2M0XA 1P1AA 3A9JA 3IBEA 2RR9A 4EZKA 2M1MA 3DBRI 4KVGB 3PRMB 4FJYA 2L00B 3RYTA 1S3SG 3U8ZA 3UGBB 4DHZB 1NDDA 5HKHA 1UBQA 3VDZA 2BWES 2IO3B 4TKNA 4MEMA 5AZFA 1TTNA 4MGYE 2DX5B 4MGZE 1MG8A 2K8CA 4XX5A 3WAPA 3APCA 3ZUNA 4GOCA 5L83A 3UQBA 3UQAA 4G0NB 4K7SA 4AJWA 1S1QB 2ZNVC 1OEYJ 5E6PA 5DPWA 1XD3B 3RT3B 1LFDA 1X1MA 2JRIB 3A1QB 1E8XA 2KKCA 3WANA 3HHMA 2KMCA 4PS8A 2IZVB 4B95A 4KIKB 5GMVA 5KHOA 2KFKA 3QA8A 4OVVA 5CHFA 1VD2A 3IVFA 5J17A 2KTRB 4W9EA 3HM3A 1KLVA 2CKHB 2C60A 2XEWA 4FLHA 5AZHA 2KDIA 2N9XA 4N9F4 5BO4B 4ANUA 3A9KB 1YIWA 2KOXA 2KWUB 2KC1A 4NPNA 1UELA 2I1KA 2FCMA 2LZ6A 3QARA 3JW0X 1KJTA 5LLIA 2C7HA 1WE7A 2IBIB 1WZ0A 4LDTD 3PHWB 2FIDA 1WJNA 2V1YA 3OLMD 5E6NA 1WX8A 1R4MI 2K8BA 3GOEA 4A3OA 2O6VD 3WALA 3AU4A 2MSED 1EUVB 3LDZE 3QCAA 4G3XB 2GBMA 1F9JA 1LM8B 2IYDB 2MCNB 4FJZA 4IW0A 1RAXA 2WX0A 4JL9A 1M94A 4FADA 5LXIB 3HIZA 3VHTC 2KC2A 4GGQA 4M8MA 3IFWB 3H9DA 2JVCA 2HJ8A 4HXDA 5C1ZA 1V9JA 4MH0E 4XC2A 4ANVA 1GC7A 4BBNF 1Q1OA 2CHZA 4GSWA 2DZMA 1ISNA 2OJRA 5CHWA 2DYBA 2ZCBA 4LCDE 2GOWA 4FA6A 4GDKA 1P98A 4DBGA 5KHQA 3VUWA 4II3B 1TBEA 2K1FA 2L0TA 4GIVA 1U4AA 2ZVOA 2MP2B 3KYDD 1SE9A 2HE7A 3EHVA 2DHZA 4GDLB 4MJSB 2FCSA 2KJ6A 1WGDA 2ZNVB 1RRBA 4G11A 2LD9A 4RM9A 4M8NA 3APDA 1Q0WB 4HPMB 4FULA 3TMPB 2C7NB 2KNBA 3DVGX 3A33B 4J6IA 3P2BA 3QK0A 4W9GA 3LJ3A 2REXA 2N1VA 3VTUA 4NJ6A 2AYOB 2WDTB 2J0KA 2C9WB 2MBQA 2GBKA 2M17A 3ZVVA 2PEAA 4KSLC 3S2AA 2L76A 4DHJB 2LASA 4BKGA 3ECIA 3OJ4B 4LJOB 3L0WB 4BVUC 4F7ZA 3ZTCA 5J2RA 4ANWA 4DDGD 2NBUA 5DPTA 1WI0A 4RM8A 2Z59B 1R4NI 1E90A 3K9OB 1NI2A 2KLCA 4NNJB 2YVCA 2C7MB 5D7GA 2NBVB 2NS5A 3PRPB 3IHPC 3PSEB 4BKSA 3ML9A 1P0RA 1UD7A 4YL8A 4KDLB 4HK2A 4TV3A 2ZJDA 2PE6B 3DPDA 3HM6X 2BYFA 2DAJA 4K1RB 1WR6E 2FIFA 3KUCB 2LGDA 4JGHB 2MX2A 4XZ4A 1UGMA 1OGWA 4I6LB 3CSFA 1IPGA 2N7EA 2FUHB 3L16A 4FBJB 1L2NA 1WXAA 3EFUA 3NZSA 4NAWA 1E8WA 1WE6A 1WGYA 3RD2A 1H8CA 2KHWB 3O65B 3L10B 4IM2A 3DVNV 3QHTA 2MWSB 3PZDA 1P3QU 3SHQA 2DZKA 2NCNA 3WIMA 2G3QB 3ZNZB 2KQ7A 2M8SA 2MBEA 1WXMA 2XK5B 2LRWA 2AEHA 4EUTA 4TQ0A 4MGKE 3X0WA 2N4FA 5G2NA 2RPQA 1L7YA 3AU5A 1HE8A 4EOYA 4BBNC 2KWVB 4E71A 2D2QA 2AWTA 4K81A 4ZRKA 3L17A 1GC6A 2FCQA 4W9IA 1WGHA 4AWJA 3N3KB 4WWPA 2DZIA 3KH0A 4B6WA 4AOFA 3L13A 4URKA 4EZLA 1BT0A 2XBBC 2JXXA 2FAZA 1FXTB 3ZO5B 2ZPYA 3TL5A 4W9JA 3JVZX 3R7QA 1EF1A 1WH3A 2LVPA 4LDTB 2RGFA 1GG3A 1J0GA 2MLBA 2D07B 2K6QA 1WYWB 2B3AA 4AJYB 4HWIB 4NY0A 3A9KA 3ENEA 3ZTDA 2FNJB 2L7RA 1WIAA 3ZRFA 3BY4B 4MELA 1UBIA 1WGRA 3R3MA 2MRPA 3K9PB 4HDQA 3TBLD 1EO6A 2I1JA 2L8JA 2MW5A 2KFJA 1PQSA 2JRHA 1TZ1A 2EMTA 3PTFC 1OTRB 3DBLI 4WJPA 4CYEA 2PJHA 4W9LA 2M4NA 2JPHA 3QAQA 5JHBA 3EECA 2K39A 2LVOA 3W1SA 3MJWA 4BKTA 3QX1A 3VUYA 2J7QB 2HD5B 3QC8B 4ZDVA 3QJZA 1RFAA 3SD5A 2CU1A 1WJUA 3MHSD 3OJ3A 3PVLA 5IA7A 1YX5B 4I6PA 4GDLA 2D11A 4MJSA 3RUIB 2V3SA 2KQSA 3JYUA 2WYQA 1YD8U 2L3ZA 3NY5A 1V2YA 2KXJA 4X57B 3V62A 4ASWC 4BOSC 4KSKC 2J0JA 2KZRA 2MBBB 1KOTA 3PV1A 4IM3A 3A9JB 3M63B 3QWZB 2CHWA 2KTRA 4W9KA 2R2QA 3TIXA 2IO2B 3VFKA 3NHEB 1EF5A 4KZ0A 3H7PA 4KDIC 2KK8A 5JZEB 1OQYA 1ZKHA 2LXAA 3KW5B 3T8MA 1WJ4A 3ZNID 1WRDB 5DCNA 3IG3A 3VH3B 5D6JB 4DWFA 2EKEC 1TGZB 3KVFB 5FR6A 2KFKB 4WJOA 4NQLB 2ZEQA 1V49A 3DVNU 4DHJD 4GXBA 3DOWA 3X23A 2MA9B 2IO1B 3DBSA 2RSUA 3W1SC 4TUUA 2BKFA 2LI5A 5G55A 1WGGA 3Q3JA 1Q5WB 3M62B 4GDKB 1XQQA 2L0FA 1WF9A 2G4SA 2BWFA 3CSTA 2K25A 3NOBA 1JRUA 2V4LA 2JT4B 3NS8A 2DAFA 1E8YA 4FJVB 3WAMA 1G6JA 2N1WA 1V5TA 3VXWA 2AL6A 2PPHA 4KIKA 2KX0A 2BYVE 2ZVNA 3GZNI 3HK0A 4EZJA 4A3PA 4MSMB 2BPSA 4DK5A 2KX3A 5E6OA 2AL3A 2A5UA 2G4DB 3SU8X 1I35A 2KTFA 3ZDMC 3B0AA 4KV2A 5C23A 1E7UA 2KWCA 5AZGA 2JF5A 4EFOA 3ZRCA 4FN2A 1V86A 2Z0DB 3H7SA 3R7RA 1J8CA 3RCZA 3A4SC 4AP4C 3VQIA 3TCAA 3I3TB 3APFA 4ICUA 2NPTA 4ZYNA 4M0WB 4ZRJA 2UYZB 4IC7B 2NVUI 3L54A 4LJPB 1UH6A 4HPLB 4DDID 3U7DA 4IWQA 2XK5A 3PRZA 2RD0A 5D2MB 1P9DU 4CO7A 1WFYA 5TR5A 1E7VA 3VAWA 1WM3A 4GN1A 3T9LA 3DVGY 2LRUA 2YLMA 3QIJA 1SIFA 1V6EA 2GMIC 2K6DB 5AEKB 2Y5BB 3DDCB 4NAWB 4PYZA 2MQJA 2N9PC 3C0RB 5JHAA 1AARA 4IM0A 4MSQB 1UZXB 2LXCA 4IUMB 5IAAC 1WMHB 3RZFA 3DBHI 4DXAB 2DZJA 3ALBA 2KANA 2GBNA 2WX1A 4II2B 3D32A 4KZCA 2O2VB 2G45B 2KJHB 1RLFA 5DPSA 3CF6E 1J19A 1V81A 4ICVA 2KJRA 1NBFC 5JH5C 1Z5SB 5LXHA 2O2VA 3ZIMA 3PHXB 3AULA 3OAWA 3JSVB 5D94A 3PGEA 1WR1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1QZE A;  1Z2M A;  3BIN A;  3M95 A;  4GB9 A;  3RUL A;  4PYU A;  2ZZP B;  3W1Y A;  3EC8 A;  4WJN A;  3PLU A;  2LJ5 A;  3WAO A;  3NZU A;  1CMX B;  2IY0 B;  4FHJ A;  2FCN A;  2UWQ A;  2KDE B;  2ASQ A;  3B1L X;  4B9K A;  3A1Q A;  2MP2 A;  3H6N A;  3PPA A;  4MM3 A;  4A20 A;  2IO0 B;  1GNU A;  4K7U A;  4RMA A;  2MBO A;  3MTN B;  4JLC A;  2GBR A;  4ZRI A;  2LGY A;  3QQ8 B;  1C1Y B;  3N30 A;  2BGF A;  3PT2 B;  3ML8 A;  3R66 C;  4EKU A;  3KUZ A;  4G50 A;  1I42 A;  1LQB A;  2NPT B;  4F1S A;  1SGH A;  1LXD A;  4JIO U;  2A4Z A;  3ZKJ C;  3PRE A;  1A5R A;  3A4R A;  1K8R B;  1YQB A;  2IY1 B;  2LGX A;  4P7I A;  2ZPN A;  3DCG A;  4BFR A;  3AXC A;  1IP9 A;  1C3T A;  2R2O A;  4HLE A;  1GUA B;  2D10 A;  3PS6 A;  4GU2 A;  2JWZ A;  2N7D A;  3Q3F A;  5CHV C;  4IG7 B;  4W9F A;  2WWZ A;  4GMV A;  3VTW A;  4W9C A;  1H4R A;  4WWO A;  4WWN A;  3V61 A;  5CX3 A;  3V60 A;  4AUQ C;  1XT9 B;  1YX6 B;  2BYE A;  3KUD B;  4HVB A;  1IYF A;  4HCN B;  3AI5 A;  3SDL C;  4K7W A;  1VCB A;  3ZDT A;  3V6E B;  2GBJ A;  2ZCC A;  2BF8 B;  4WAA A;  1E8Z A;  3L08 A;  1ZGU B;  1D3Z A;  4E74 A;  2KO3 A;  4ANX A;  2L05 A;  2KVR A;  4BOZ B;  2JZ3 B;  2PE9 A;  4OVU A;  3B08 A;  2OOB B;  1WJ6 A;  3VH4 B;  1WY8 A;  2KDB A;  3ZNH B;  4F8C B;  4JQW C;  4MGI E;  2JZZ A;  5EDS A;  2VRR B;  1WXS A;  1WMH A;  2LVQ A;  2MBH A;  4WJQ A;  4E3C A;  1ZW7 A;  1YJ1 A;  2BKR B;  2NR2 A;  2LUE A;  1KM7 A;  2LWP A;  3ZNG C;  5L95 C;  2NBW B;  4HCP B;  2KMA A;  2J0M A;  3RZW C;  3ZW3 A;  4FHK A;  1WZ3 A;  3UIN B;  4HJK A;  2CS4 A;  3UIP B;  3WA0 A;  2JY6 A;  1T0Y A;  1V80 A;  2O6V B;  3V6C B;  4PS7 A;  4NJ7 A;  4BKS D;  2O6V A;  3UF8 A;  4WQO B;  3CMM B;  3JSV A;  1WX7 A;  5CTR C;  1V5O A;  1Y8R C;  2Z0E B;  4DHZ E;  2W9N A;  5J18 A;  3U30 A;  3M3J A;  2C5L C;  3TJP A;  2KD0 A;  2JUO A;  3H7P B;  3ZLZ A;  4IWO A;  4I6N B;  1WM2 A;  2CHX A;  1WX9 A;  2HTH A;  2DEN B;  3H1U A;  1WXV A;  2DYM A;  4W9H A;  4IWP A;  2D3G A;  4TQ1 A;  2K8H A;  2N9E B;  3UIO B;  3VUX A;  2EMS A;  3VTV A;  4NQK E;  4W9D A;  4EEW A;  3ONS A;  3DQV A;  4PS3 A;  2QHO A;  2KN5 A;  2KDF B;  2KLG A;  1OEY A;  3PLV A;  3N32 A;  2CR5 A;  4MDK E;  3VVW B;  3KYC D;  1E5W A;  4HDO A;  1GJZ A;  2DYO A;  4CHK A;  5DPR A;  2M0X A;  1P1A A;  3A9J A;  3IBE A;  2RR9 A;  4EZK A;  2M1M A;  3DBR I;  4KVG B;  3PRM B;  4FJY A;  2L00 B;  3RYT A;  1S3S G;  3U8Z A;  3UGB B;  4DHZ B;  1NDD A;  5HKH A;  1UBQ A;  3VDZ A;  2BWE S;  2IO3 B;  4TKN A;  4MEM A;  5AZF A;  1TTN A;  4MGY E;  2DX5 B;  4MGZ E;  1MG8 A;  2K8C A;  4XX5 A;  3WAP A;  3APC A;  3ZUN A;  4GOC A;  5L83 A;  3UQB A;  3UQA A;  4G0N B;  4K7S A;  4AJW A;  1S1Q B;  2ZNV C;  1OEY J;  5E6P A;  5DPW A;  1XD3 B;  3RT3 B;  1LFD A;  1X1M A;  2JRI B;  3A1Q B;  1E8X A;  2KKC A;  3WAN A;  3HHM A;  2KMC A;  4PS8 A;  2IZV B;  4B95 A;  4KIK B;  5GMV A;  5KHO A;  2KFK A;  3QA8 A;  4OVV A;  5CHF A;  1VD2 A;  3IVF A;  5J17 A;  2KTR B;  4W9E A;  3HM3 A;  1KLV A;  2CKH B;  2C60 A;  2XEW A;  4FLH A;  5AZH A;  2KDI A;  2N9X A;  4N9F 4;  5BO4 B;  4ANU A;  3A9K B;  1YIW A;  2KOX A;  2KWU B;  2KC1 A;  4NPN A;  1UEL A;  2I1K A;  2FCM A;  2LZ6 A;  3QAR A;  3JW0 X;  1KJT A;  5LLI A;  2C7H A;  1WE7 A;  2IBI B;  1WZ0 A;  4LDT D;  3PHW B;  2FID A;  1WJN A;  2V1Y A;  3OLM D;  5E6N A;  1WX8 A;  1R4M I;  2K8B A;  3GOE A;  4A3O A;  2O6V D;  3WAL A;  3AU4 A;  2MSE D;  1EUV B;  3LDZ E;  3QCA A;  4G3X B;  2GBM A;  1F9J A;  1LM8 B;  2IYD B;  2MCN B;  4FJZ A;  4IW0 A;  1RAX A;  2WX0 A;  4JL9 A;  1M94 A;  4FAD A;  5LXI B;  3HIZ A;  3VHT C;  2KC2 A;  4GGQ A;  4M8M A;  3IFW B;  3H9D A;  2JVC A;  2HJ8 A;  4HXD A;  5C1Z A;  1V9J A;  4MH0 E;  4XC2 A;  4ANV A;  1GC7 A;  4BBN F;  1Q1O A;  2CHZ A;  4GSW A;  2DZM A;  1ISN A;  2OJR A;  5CHW A;  2DYB A;  2ZCB A;  4LCD E;  2GOW A;  4FA6 A;  4GDK A;  1P98 A;  4DBG A;  5KHQ A;  3VUW A;  4II3 B;  1TBE A;  2K1F A;  2L0T A;  4GIV A;  1U4A A;  2ZVO A;  2MP2 B;  3KYD D;  1SE9 A;  2HE7 A;  3EHV A;  2DHZ A;  4GDL B;  4MJS B;  2FCS A;  2KJ6 A;  1WGD A;  2ZNV B;  1RRB A;  4G11 A;  2LD9 A;  4RM9 A;  4M8N A;  3APD A;  1Q0W B;  4HPM B;  4FUL A;  3TMP B;  2C7N B;  2KNB A;  3DVG X;  3A33 B;  4J6I A;  3P2B A;  3QK0 A;  4W9G A;  3LJ3 A;  2REX A;  2N1V A;  3VTU A;  4NJ6 A;  2AYO B;  2WDT B;  2J0K A;  2C9W B;  2MBQ A;  2GBK A;  2M17 A;  3ZVV A;  2PEA A;  4KSL C;  3S2A A;  2L76 A;  4DHJ B;  2LAS A;  4BKG A;  3ECI A;  3OJ4 B;  4LJO B;  3L0W B;  4BVU C;  4F7Z A;  3ZTC A;  5J2R A;  4ANW A;  4DDG D;  2NBU A;  5DPT A;  1WI0 A;  4RM8 A;  2Z59 B;  1R4N I;  1E90 A;  3K9O B;  1NI2 A;  2KLC A;  4NNJ B;  2YVC A;  2C7M B;  5D7G A;  2NBV B;  2NS5 A;  3PRP B;  3IHP C;  3PSE B;  4BKS A;  3ML9 A;  1P0R A;  1UD7 A;  4YL8 A;  4KDL B;  4HK2 A;  4TV3 A;  2ZJD A;  2PE6 B;  3DPD A;  3HM6 X;  2BYF A;  2DAJ A;  4K1R B;  1WR6 E;  2FIF A;  3KUC B;  2LGD A;  4JGH B;  2MX2 A;  4XZ4 A;  1UGM A;  1OGW A;  4I6L B;  3CSF A;  1IPG A;  2N7E A;  2FUH B;  3L16 A;  4FBJ B;  1L2N A;  1WXA A;  3EFU A;  3NZS A;  4NAW A;  1E8W A;  1WE6 A;  1WGY A;  3RD2 A;  1H8C A;  2KHW B;  3O65 B;  3L10 B;  4IM2 A;  3DVN V;  3QHT A;  2MWS B;  3PZD A;  1P3Q U;  3SHQ A;  2DZK A;  2NCN A;  3WIM A;  2G3Q B;  3ZNZ B;  2KQ7 A;  2M8S A;  2MBE A;  1WXM A;  2XK5 B;  2LRW A;  2AEH A;  4EUT A;  4TQ0 A;  4MGK E;  3X0W A;  2N4F A;  5G2N A;  2RPQ A;  1L7Y A;  3AU5 A;  1HE8 A;  4EOY A;  4BBN C;  2KWV B;  4E71 A;  2D2Q A;  2AWT A;  4K81 A;  4ZRK A;  3L17 A;  1GC6 A;  2FCQ A;  4W9I A;  1WGH A;  4AWJ A;  3N3K B;  4WWP A;  2DZI A;  3KH0 A;  4B6W A;  4AOF A;  3L13 A;  4URK A;  4EZL A;  1BT0 A;  2XBB C;  2JXX A;  2FAZ A;  1FXT B;  3ZO5 B;  2ZPY A;  3TL5 A;  4W9J A;  3JVZ X;  3R7Q A;  1EF1 A;  1WH3 A;  2LVP A;  4LDT B;  2RGF A;  1GG3 A;  1J0G A;  2MLB A;  2D07 B;  2K6Q A;  1WYW B;  2B3A A;  4AJY B;  4HWI B;  4NY0 A;  3A9K A;  3ENE A;  3ZTD A;  2FNJ B;  2L7R A;  1WIA A;  3ZRF A;  3BY4 B;  4MEL A;  1UBI A;  1WGR A;  3R3M A;  2MRP A;  3K9P B;  4HDQ A;  3TBL D;  1EO6 A;  2I1J A;  2L8J A;  2MW5 A;  2KFJ A;  1PQS A;  2JRH A;  1TZ1 A;  2EMT A;  3PTF C;  1OTR B;  3DBL I;  4WJP A;  4CYE A;  2PJH A;  4W9L A;  2M4N A;  2JPH A;  3QAQ A;  5JHB A;  3EEC A;  2K39 A;  2LVO A;  3W1S A;  3MJW A;  4BKT A;  3QX1 A;  3VUY A;  2J7Q B;  2HD5 B;  3QC8 B;  4ZDV A;  3QJZ A;  1RFA A;  3SD5 A;  2CU1 A;  1WJU A;  3MHS D;  3OJ3 A;  3PVL A;  5IA7 A;  1YX5 B;  4I6P A;  4GDL A;  2D11 A;  4MJS A;  3RUI B;  2V3S A;  2KQS A;  3JYU A;  2WYQ A;  1YD8 U;  2L3Z A;  3NY5 A;  1V2Y A;  2KXJ A;  4X57 B;  3V62 A;  4ASW C;  4BOS C;  4KSK C;  2J0J A;  2KZR A;  2MBB B;  1KOT A;  3PV1 A;  4IM3 A;  3A9J B;  3M63 B;  3QWZ B;  2CHW A;  2KTR A;  4W9K A;  2R2Q A;  3TIX A;  2IO2 B;  3VFK A;  3NHE B;  1EF5 A;  4KZ0 A;  3H7P A;  4KDI C;  2KK8 A;  5JZE B;  1OQY A;  1ZKH A;  2LXA A;  3KW5 B;  3T8M A;  1WJ4 A;  3ZNI D;  1WRD B;  5DCN A;  3IG3 A;  3VH3 B;  5D6J B;  4DWF A;  2EKE C;  1TGZ B;  3KVF B;  5FR6 A;  2KFK B;  4WJO A;  4NQL B;  2ZEQ A;  1V49 A;  3DVN U;  4DHJ D;  4GXB A;  3DOW A;  3X23 A;  2MA9 B;  2IO1 B;  3DBS A;  2RSU A;  3W1S C;  4TUU A;  2BKF A;  2LI5 A;  5G55 A;  1WGG A;  3Q3J A;  1Q5W B;  3M62 B;  4GDK B;  1XQQ A;  2L0F A;  1WF9 A;  2G4S A;  2BWF A;  3CST A;  2K25 A;  3NOB A;  1JRU A;  2V4L A;  2JT4 B;  3NS8 A;  2DAF A;  1E8Y A;  4FJV B;  3WAM A;  1G6J A;  2N1W A;  1V5T A;  3VXW A;  2AL6 A;  2PPH A;  4KIK A;  2KX0 A;  2BYV E;  2ZVN A;  3GZN I;  3HK0 A;  4EZJ A;  4A3P A;  4MSM B;  2BPS A;  4DK5 A;  2KX3 A;  5E6O A;  2AL3 A;  2A5U A;  2G4D B;  3SU8 X;  1I35 A;  2KTF A;  3ZDM C;  3B0A A;  4KV2 A;  5C23 A;  1E7U A;  2KWC A;  5AZG A;  2JF5 A;  4EFO A;  3ZRC A;  4FN2 A;  1V86 A;  2Z0D B;  3H7S A;  3R7R A;  1J8C A;  3RCZ A;  3A4S C;  4AP4 C;  3VQI A;  3TCA A;  3I3T B;  3APF A;  4ICU A;  2NPT A;  4ZYN A;  4M0W B;  4ZRJ A;  2UYZ B;  4IC7 B;  2NVU I;  3L54 A;  4LJP B;  1UH6 A;  4HPL B;  4DDI D;  3U7D A;  4IWQ A;  2XK5 A;  3PRZ A;  2RD0 A;  5D2M B;  1P9D U;  4CO7 A;  1WFY A;  5TR5 A;  1E7V A;  3VAW A;  1WM3 A;  4GN1 A;  3T9L A;  3DVG Y;  2LRU A;  2YLM A;  3QIJ A;  1SIF A;  1V6E A;  2GMI C;  2K6D B;  5AEK B;  2Y5B B;  3DDC B;  4NAW B;  4PYZ A;  2MQJ A;  2N9P C;  3C0R B;  5JHA A;  1AAR A;  4IM0 A;  4MSQ B;  1UZX B;  2LXC A;  4IUM B;  5IAA C;  1WMH B;  3RZF A;  3DBH I;  4DXA B;  2DZJ A;  3ALB A;  2KAN A;  2GBN A;  2WX1 A;  4II2 B;  3D32 A;  4KZC A;  2O2V B;  2G45 B;  2KJH B;  1RLF A;  5DPS A;  3CF6 E;  1J19 A;  1V81 A;  4ICV A;  2KJR A;  1NBF C;  5JH5 C;  1Z5S B;  5LXH A;  2O2V A;  3ZIM A;  3PHX B;  3AUL A;  3OAW A;  3JSV B;  5D94 A;  3PGE A;  1WR1 A; 
#chains in the Genus database with same CATH topology
 5FKA C;  4RCO A;  3EC8 A;  2LJ5 A;  3WAO A;  2KDE B;  2ASQ A;  2MP2 A;  2VZK D;  3H6N A;  3PPA A;  4JWS C;  4K7U A;  4XDC A;  1HQR D;  3Q3N C;  2BGF A;  3KUZ A;  3NVY A;  4NAM A;  1I42 A;  1JWB D;  2BYT A;  1C9F A;  4HRO A;  2A4Z A;  3WCQ A;  3PRE A;  3A4R A;  2PKO A;  2LGX A;  1KLU D;  3EA6 A;  4BFR A;  3Q3F A;  2KDM A;  2WWZ A;  3Q6B A;  1TKY A;  2CJO A;  2GB1 A;  3LB8 C;  4AUQ C;  1E10 A;  3KUD B;  2LEK A;  1HZ6 A;  1RYJ A;  3V6E B;  2ZCC A;  2BF8 B;  4WAA A;  1I4X A;  2KO3 A;  2KVR A;  2WXK A;  5D3D A;  3N1Z C;  1TYG B;  1WJ6 A;  1KH0 A;  1WY8 A;  1R4M B;  5EDS A;  5BMI A;  1WMH A;  4WJQ A;  1HTQ A;  2NR2 A;  3RNC C;  2NBW B;  3ZW3 A;  4FHK A;  4BAX A;  4HJK A;  2N9L A;  3UIP B;  2KVZ A;  1D5Z C;  3WA0 A;  4AQ7 A;  5T8I A;  4PS7 A;  2DNF A;  3MC0 B;  1V5O A;  4WIP A;  3TJP A;  3W5U B;  3BVG A;  2H88 B;  2JUO A;  3Q8E A;  3ZLZ A;  4IWO A;  2JYE A;  2DEN B;  1B9R A;  3AEC B;  5IKC M;  2V4I B;  2Y5C A;  2D3G A;  4TQ1 A;  2N9E B;  1YJJ A;  3UIO B;  3VTV A;  4W9D A;  1KF6 B;  4PS3 A;  2KDF B;  2KLG A;  5FR3 A;  1YN5 A;  3J9C A;  1BML C;  3FIL B;  4HDO A;  2FE8 A;  2DYO A;  2M0X A;  4MT5 A;  2BS3 B;  4N6E B;  3EGR A;  3DHI C;  3V3X A;  3NRZ A;  3PRM B;  4FJY A;  2L00 B;  4DHZ B;  3VDZ A;  2BWE S;  5D3I B;  3SR6 A;  4BZA A;  4MEM A;  5AZF A;  2QMT A;  2V9H A;  1E7P B;  4HPP A;  5DPW A;  1XD3 B;  1LFD A;  2JRI B;  1E8X A;  2KKC A;  3HHM A;  2WLB A;  4XE0 A;  3U7Z A;  5GMV A;  3QA8 A;  4OVV A;  5CHF A;  1VD2 A;  2CKH B;  2V3P A;  1CZP A;  5AZH A;  1MVK A;  5BO4 B;  1YIW A;  2I1K A;  2LZ6 A;  5AUI A;  5MPO A;  1L4D B;  1KJT A;  4ARC A;  1TIF A;  4Q2J A;  1WZ0 A;  1WJN A;  2J52 A;  3OLM D;  1R4M I;  2K8B A;  3GOE A;  3N9Y C;  4A3O A;  1F9J A;  2WXG A;  4FJZ A;  1RAX A;  2MJD A;  4FAD A;  5LXI B;  2IJ0 A;  3IFW B;  2JVC A;  4XC2 A;  3ETR A;  1GC7 A;  2DBY A;  5CHW A;  2DYB A;  2CU3 A;  4LCD E;  1A70 A;  2BTE A;  1PYW D;  4FA6 A;  4ZHO A;  2W82 A;  2K1F A;  1U4A A;  2AX5 A;  1SE9 A;  2FCS A;  2NTS A;  2LD9 A;  4TMA B;  2LFI A;  3BK2 A;  3QK0 A;  4MM3 B;  3N1Y C;  4HJG E;  3VTU A;  4NJ6 A;  2WDT B;  3ZVV A;  2MBQ A;  2WXN A;  3S2A A;  2L76 A;  3ECI A;  3OJ4 B;  4LJO B;  3Q8A A;  2N7J A;  2WP9 B;  1V1O A;  2NBU A;  1T6B X;  1UWM A;  4RM8 A;  1WI0 A;  3K9O B;  2BS4 B;  1NI2 A;  2YVC A;  2NBV B;  3PRP B;  4BKS A;  3ML9 A;  4L2Y A;  3HUI A;  3HM6 X;  1YMH E;  4K1R B;  4JGH B;  4JX1 C;  1OGW A;  3NG0 A;  1WSP A;  2WXP A;  1L2N A;  3EFU A;  3RD2 A;  1H8C A;  3O65 B;  3L10 B;  4IM2 A;  2E6X A;  1P3Q U;  2NCN A;  2NTT A;  5EE9 A;  1MPE A;  1YN3 A;  1C4C A;  2LRW A;  4EUT A;  4TQ0 A;  2N4F A;  4EOY A;  3N1X C;  2DZI A;  2FAZ A;  3MC9 A;  3TL5 A;  1WH3 A;  5IO9 A;  1QOA A;  2L7R A;  3BY4 B;  1UBI A;  4HDQ A;  1EO6 A;  2BW2 A;  1F2R C;  1TZ1 A;  3PTF C;  2OED A;  2M4N A;  3QAQ A;  3EEC A;  1CQV A;  2K39 A;  2B76 B;  4WUR A;  2SEB D;  3QC8 B;  1XO3 A;  3RFZ B;  1RFA A;  3AE8 B;  2WXF A;  4MJS A;  3RUI B;  3MFG A;  3NY5 A;  2WYQ A;  2J0J A;  2KZR A;  1KOT A;  2WXJ A;  3M63 B;  2CHW A;  2KTR A;  2IND C;  5GXG B;  2WXI A;  3KWV A;  3TIX A;  2J4X A;  3VFK A;  1EF5 A;  5IOI A;  5JZE B;  2D5G A;  5H92 C;  1WRD B;  5DCN A;  4OW0 A;  4DWF A;  4RGN A;  1I4G A;  1FXI A;  3DVN U;  2INP E;  2RSU A;  3BZD B;  4ZRP A;  2BWF A;  2K25 A;  1CJE A;  1VR9 A;  2JT4 B;  3NS8 A;  3WAM A;  3VXW A;  3HK0 A;  2KX0 A;  5BYS A;  4A3P A;  3R2I A;  1ROE A;  4REZ A;  2A5U A;  2KYW A;  4XYC A;  2G4D B;  3O13 A;  2KTF A;  3ZDM C;  4KV2 A;  2KWC A;  5AZG A;  1TY2 A;  3FIL A;  4FN2 A;  1D5X C;  2Z0D B;  4RH6 A;  1J8C A;  1C77 A;  3RCZ A;  4C7Z A;  3I3T B;  1IBX A;  1K51 A;  4ZYN A;  4M0W B;  4ZRJ A;  2MJ3 A;  2QSD A;  1N62 A;  3U7D A;  3PRZ A;  2XK5 A;  2RD0 A;  3I57 A;  2I2Y A;  3KWL A;  1T0S C;  1WFY A;  3P4R B;  3VAW A;  2PVO D;  1WYG A;  1K50 A;  2LRU A;  1SIF A;  2K6D B;  2GMI C;  3C8Y A;  2Y5B B;  2QIL A;  2V0G A;  1QF6 A;  4IM0 A;  1TKG A;  3RZF A;  4DXA B;  3DBH I;  3DHH C;  2GBN A;  3D32 A;  1MJD A;  1RM6 C;  3CF6 E;  4ICV A;  2J42 A;  4GLS C;  4ZRQ A;  4YWG G;  4MAC A;  3PHX B;  3OAW A;  3JSV B;  1ZXI A;  3M95 A;  3RUL A;  2N0S B;  1V97 A;  4XGA B;  4WJN A;  3GS2 A;  1EM7 A;  1L0X B;  2FCN A;  3B1L X;  3A1Q A;  4A20 A;  2DWQ A;  2GBR A;  2LGY A;  3PO0 A;  5BMG A;  1PDX A;  4IDI A;  4HEA 1;  1SBB B;  1SGH A;  4B0M A;  3ZKJ C;  1YQB A;  2IY1 B;  2M56 B;  2ZPN A;  3DCG A;  1JRP A;  4ZHP A;  4A8X C;  2R2O A;  4HLE A;  1SEB D;  2D10 A;  3PS6 A;  2JWZ A;  5CHV C;  2X38 A;  3ZJV A;  3DBL B;  4W9C A;  1H4R A;  1N5X A;  3RPF C;  2BYE A;  1STE A;  1VCB A;  1FNW A;  3L08 A;  1ZGU B;  1D3Z A;  4ANX A;  2L05 A;  4BOZ B;  2IDY A;  2PE9 A;  1ACC A;  3AE2 B;  2KDB A;  1KLG D;  2VRR B;  1N61 A;  1WXS A;  2WDV B;  2LVQ A;  4E3C A;  1ZW7 A;  2BKR B;  4C7Y A;  3AE5 B;  2LUE A;  3ZNG C;  4HCP B;  1WZ3 A;  3GP7 A;  3NVZ A;  3UIN B;  2CS4 A;  1JWA D;  3E9S A;  4M02 A;  2JY6 A;  1FCL A;  2INN E;  3V6C B;  1NYR A;  2O6V A;  3UF8 A;  4WQO B;  1Y8R C;  2C5L C;  1XF5 L;  4C4V B;  1FIQ A;  4I6N B;  1WX9 A;  1P7E A;  3AH7 A;  3H1U A;  1OFF A;  2DYM A;  2NMQ A;  3VUX A;  3W2D A;  2EMS A;  3ONS A;  3DQV A;  2LMC A;  1RWS A;  2CR5 A;  1D6E C;  1P1A A;  2QCZ A;  3IBE A;  2RR9 A;  2M1M A;  3Q3O C;  1HA5 A;  1ZDV A;  1WWT A;  1NDD A;  1UBQ A;  1TS4 A;  3P63 A;  4MGY E;  2DX5 B;  1I7H A;  3ZUN A;  5L83 A;  5JXV A;  4K7S A;  4JPS A;  5E6P A;  1OEY J;  2Q5W D;  1UUP A;  3A1Q B;  4KKJ A;  2KMC A;  2IZV B;  3VRA B;  3DWM A;  2KFK A;  5J17 A;  1ZOY B;  2C60 A;  4FLH A;  2KDI A;  4ANU A;  3A9K B;  1FMA D;  1UEL A;  1UWX A;  2IBI B;  4YSY B;  2FID A;  2V1Y A;  1JWS D;  5E6N A;  2O6V D;  1K53 A;  3WAL A;  3AU4 A;  2MSE D;  1OQR A;  2K9X A;  3KQ4 A;  1VJK A;  2MCN B;  4IW0 A;  5BMH A;  2J53 A;  3HIZ A;  4M8M A;  3H9D A;  2VZK B;  2HJ8 A;  2LGI A;  1V9J A;  5C1Z A;  4MH0 E;  3RN9 C;  3NUH B;  1Q1O A;  2CHZ A;  2R61 A;  1ISN A;  1SE3 A;  2W55 A;  1FNV A;  4DBG A;  1P98 A;  1TBE A;  2L0T A;  2ZVO A;  4KGR A;  4MJS B;  2DHZ A;  1FEH A;  2KJ6 A;  3ZGZ A;  4M8N A;  4HPM B;  3TMP B;  3ZXR A;  1TS2 A;  2K3U A;  2WDR B;  3LJ3 A;  2REX A;  2N1V A;  1SIJ A;  4N59 A;  4DHJ B;  2LAS A;  5I4D A;  4P1B C;  3L0W B;  4BVU C;  3ZTC A;  5DPT A;  1YJI A;  3B2G A;  1D4B A;  1CK1 A;  2C7M B;  2Y3A A;  2NS5 A;  3RNG C;  1I4P A;  1KTK A;  1P0R A;  1UD7 A;  4YL8 A;  4TV3 A;  2BYF A;  1WR6 E;  4XWT A;  2LGD A;  2MX2 A;  4XZ4 A;  3CSF A;  1WXA A;  2L32 A;  3NZS A;  1WE6 A;  1WGY A;  2KHW B;  2MWS B;  2DZK A;  1VZ7 A;  2WXL A;  2M8S A;  1WXM A;  1QT9 A;  2IGH A;  2FBW B;  2JWU A;  1HE8 A;  4OZB A;  3GE3 C;  4E71 A;  1AW7 A;  1K52 A;  2D2Q A;  2AWT A;  4ZRK A;  1V1P A;  1P7F A;  1WGH A;  4AWJ A;  3ZJT A;  2ZPY A;  1FPY A;  3R7Q A;  2KN4 A;  1GG3 A;  4YXD B;  1XCT L;  3ZTD A;  3GZN B;  2FNJ B;  3ZRF A;  4MEL A;  3R3M A;  3K9P B;  3TBL D;  1PUT A;  2I1J A;  4MH8 A;  2KFJ A;  2JRH A;  4CYE A;  3V05 A;  2QIE B;  3W1S A;  4NZL B;  3SD5 A;  2CU1 A;  3RNB C;  1WJU A;  3MHS D;  1VZ6 A;  3R2T A;  2V3S A;  2KQS A;  3IAM 1;  2KXJ A;  4X57 B;  4BOS C;  4KSK C;  3NVW A;  3R8B A;  4DXF A;  3NHE B;  2IGG A;  1ZKH A;  2LXA A;  4A6Q A;  1WJ4 A;  1V8C A;  2KMM A;  3AE1 B;  2MJE A;  3ZJU A;  3IG3 A;  3VH3 B;  1JW9 D;  2WXR A;  3U52 E;  4LTU A;  1AWD A;  1TJE A;  3KVF B;  3ZQ4 A;  4WJO A;  2ZEQ A;  1V49 A;  4DHJ D;  1T5X D;  3RMK C;  2JX5 A;  3BII D;  1ZP0 B;  3Q8B A;  3DBH B;  4A9A A;  1UF0 A;  3CST A;  1XLN A;  1JRU A;  1G6J A;  1V5T A;  2KT7 A;  2PPH A;  4KIK A;  2BYV E;  4EZJ A;  4RNA A;  1LO5 D;  4DK5 A;  3RNE C;  4O1N A;  3TEY A;  4N58 A;  3B0A A;  1E7U A;  2JF5 A;  3IXS A;  1V86 A;  3H7S A;  1QOG A;  3P4S B;  2RDG A;  3EFC A;  1UNS A;  3VQI A;  4JE3 B;  3TEX A;  4DDI D;  2I38 A;  2BVC A;  3AMZ A;  1SXT A;  1DOX A;  4CO7 A;  5TR5 A;  1E7V A;  4M0W A;  1WRI A;  4S17 A;  3DDC B;  4NAW B;  1JCK B;  2M0A A;  1QLB B;  2LXC A;  4R3D A;  2KAJ A;  2DZJ A;  1J7B A;  4II2 B;  1JQ4 A;  4KZC A;  2PLP A;  2KJH B;  2HDE A;  1AYF A;  5DPS A;  1J19 A;  2KJR A;  1NBF C;  1Z5S B;  5LXH A;  2O2V A;  4LK0 M;  3AUL A;  1WR1 A;  1QZE A;  1Z2M A;  3NZ3 A;  4PYU A;  3W1Y A;  3PLU A;  3NZU A;  1CMX B;  2AQ2 B;  4FHJ A;  1MFW A;  1GNU A;  3IAS 1;  1TS5 A;  1GAQ B;  4RMA A;  3MTN B;  4JLC A;  1DOY A;  3QQ8 B;  3RI7 C;  3N30 A;  4RF0 A;  1SB3 C;  3ML8 A;  1J7C A;  3PT2 B;  3R66 C;  4G50 A;  2SAK A;  4JIO U;  1A5R A;  1K8R B;  4S0R A;  1L6V A;  1GUA B;  2ACZ B;  1GB1 A;  2FUG 1;  4IG7 B;  4W9F A;  1ZUD 2;  2WHI A;  4WWN A;  2G9H D;  3V61 A;  1IYF A;  3SDL C;  3EUB 2;  4K7W A;  1GOZ A;  2D3A A;  2MH7 A;  4XDD A;  3H8H A;  3ZDT A;  4EE2 A;  4E74 A;  2JZ3 B;  4OVU A;  4A55 A;  3B08 A;  2OOB B;  4F8C B;  2EKI A;  2JZZ A;  3SFE B;  1N6Z A;  1C76 A;  1KM7 A;  5L95 C;  2KMA A;  1MHX A;  2WXO A;  1C78 A;  1EU4 A;  3ZYY X;  1V80 A;  3AEB B;  2O6V B;  4NJ7 A;  4BKS D;  4OVZ A;  4PT5 A;  3CMM B;  5CTR C;  5J18 A;  2Z0E B;  2W9N A;  3U30 A;  3RNA C;  3M3J A;  2WQY B;  2KD0 A;  5FK9 C;  1WM2 A;  3AEF B;  2IPK D;  4JWU C;  1WXV A;  4AS1 A;  1UGJ A;  4IWP A;  3Q2A C;  2DLB A;  1C4A A;  2KN5 A;  2JZP A;  2ON8 A;  1OEY A;  1FXA A;  4L1B A;  3KYC D;  1E5W A;  2W3S A;  3DBR B;  4ACF A;  4EZK A;  3AM9 A;  3DBR I;  4KVG B;  1S3S G;  2KAC A;  2UU7 A;  3UGB B;  5C3J B;  5HKH A;  2BQQ A;  1T0R C;  4TKN A;  1TTN A;  3SFD B;  4MGZ E;  2VH2 A;  1L5P A;  1PGB A;  1MG8 A;  2WXQ A;  4XX5 A;  4M01 A;  3HRD D;  4GOC A;  3UQB A;  4G0N B;  3RT3 B;  1X1M A;  1BXT A;  3WAN A;  3I5J C;  4B95 A;  4KIK B;  2WS3 B;  5KHO A;  1MG4 A;  1VLB A;  2XNA C;  4W9E A;  1KLV A;  1JWM D;  2XEW A;  1TKE A;  4OZC A;  1VZ8 A;  4RGO S;  2N9X A;  2KOX A;  2KWU B;  5LNK 1;  1NI3 A;  1ZPS A;  2D3C A;  3JW0 X;  5LLI A;  2BB6 A;  3PHW B;  1QOF A;  1WX8 A;  1F77 A;  4YSX B;  2BT6 A;  2YEP B;  3LDZ E;  1QOB A;  4G3X B;  3QCA A;  1LM8 B;  2QC8 A;  2IYD B;  2WX0 A;  1M94 A;  3VHT C;  2INC C;  2KC2 A;  1B1Z A;  4A90 A;  1M4V A;  4HXD A;  2BS2 B;  4ANV A;  2WXH A;  4K3C A;  4BBN F;  1YNT E;  3P42 A;  1FRR A;  4H2A A;  2ZCB A;  1MI0 A;  5HI1 A;  4IKG A;  4GDK A;  3VUW A;  4II3 B;  2HE7 A;  4GDL B;  2AQ1 B;  3ABV B;  4RF1 A;  3FC4 A;  3TEZ A;  2GI9 A;  1RRB A;  4G11 A;  4RM9 A;  5EE3 A;  3APD A;  1JWU D;  4FUL A;  2C7N B;  3B9J A;  2KNB A;  2QDF A;  4W9G A;  4USA A;  4P16 A;  4M00 A;  2W3R A;  2Z8L A;  1D5M C;  4FXC A;  2AYO B;  2J0K A;  1C79 A;  4PK1 A;  1F2R I;  2PEA A;  1PGX A;  4ANW A;  4DDG D;  1J7A A;  1FM0 D;  3VRB B;  1E6E B;  1R4N I;  4NNJ B;  4DQO C;  5D7G A;  2H89 B;  1XXG A;  2QEJ C;  1ET9 A;  3T3O A;  3BWU D;  2ZJD A;  2PE6 B;  2FIF A;  4I6L B;  1IPG A;  2N7E A;  4P1C C;  2FUH B;  3L16 A;  4FBJ B;  2ONQ A;  4NAW A;  1E8W A;  3SEB A;  1EWY C;  3AED B;  3QHT A;  3PZD A;  3DHG C;  1MHH E;  2G3Q B;  3ZNZ B;  2XN9 C;  2HTM E;  2KQ7 A;  2XK5 B;  4LLG M;  4WWM A;  1FRD A;  2AEH A;  1I4H A;  5G2N A;  1L7Y A;  2LGS A;  3L17 A;  1GC6 A;  4ZOH C;  2K0P A;  4B6W A;  3N3K B;  4WWP A;  3L13 A;  4URK A;  4EZL A;  2RDH A;  1BT0 A;  2XBB C;  2JXX A;  4OHJ A;  3ZO5 B;  2LVP A;  2RGF A;  1J0G A;  2MLB A;  1WYW B;  2B3A A;  5HHD G;  4AJY B;  3A9K A;  3ENE A;  1WIA A;  1WGR A;  4ITK A;  2L83 A;  2MRP A;  3VR8 B;  5G5G A;  3DBL I;  4WJP A;  2PJH A;  2LVO A;  3MJ5 A;  3OWE B;  4BKT A;  2J7Q B;  1KFY B;  4ZDV A;  3QJZ A;  1HZ5 A;  2GRI A;  1SE4 A;  5TSS A;  4LNO A;  1L0Y B;  3PVL A;  5IA7 A;  1YX5 B;  4I6P A;  4IOI E;  2L52 A;  3JYU A;  2L3Z A;  3KLS X;  1C4P A;  4RGT A;  1F1H A;  3QWZ B;  1SE2 A;  4W9K A;  2IO2 B;  4D2K A;  4KZ0 A;  3T8M A;  1NEN B;  3ZNI D;  4DXG A;  4QAY A;  2ZW1 A;  2CJN A;  2EKE C;  1DOI A;  3AB5 A;  3UI3 A;  3DOW A;  3X23 A;  2MA9 B;  2IO1 B;  3DBS A;  2BBC A;  4HKQ A;  5AUK A;  1Q5W B;  3M62 B;  2MEK A;  1WF9 A;  2G4S A;  2BB5 A;  3NOB A;  2DAF A;  1L6U A;  1E8Y A;  5BYR A;  1JRO A;  2AL6 A;  2WU5 B;  2ZW0 A;  2ZVN A;  3DWG C;  2V3N A;  2KX3 A;  3SU8 X;  3ZRC A;  2WXM A;  1JAL A;  3LYY A;  1V1P B;  3TCA A;  2NPT A;  2JSV X;  3FKY A;  2Y5P A;  4IC7 B;  2NVU I;  1WXQ A;  4LJP B;  1UH6 A;  4HPL B;  3PZ8 A;  4IWQ A;  5D2M B;  3I9V 1;  4GN1 A;  1SF0 A;  2YLM A;  4PYZ A;  3BYY B;  5JHA A;  4IUM B;  3BYT B;  5IAA C;  3ALB A;  2WX1 A;  3P1M A;  4LNI A;  1RLF A;  5JH5 C;  4C4V A;  3BK1 A;  3ZIM A;  1FCC C;  4HKZ E;  3PGE A;  5D94 A;  1R4N B;  3URY A;  3BIN A;  4GB9 A;  2TSS A;  2ZZP B;  2IY0 B;  4B9K A;  2UWQ A;  4MM3 A;  2IO0 B;  2MBO A;  4ZRI A;  2EEL A;  1C1Y B;  2PIA A;  4EKU A;  1GB4 A;  1EWC A;  1LQB A;  2NPT B;  4F1S A;  1LXD A;  1F0Z A;  2WNM A;  1TY0 A;  1TS3 A;  4P7I A;  4WQM A;  3AXC A;  1IP9 A;  1C3T A;  1XLO A;  3OG5 A;  4GU2 A;  2N7D A;  3MHZ A;  4YTP B;  2PVG C;  4GMV A;  3VTW A;  4WWO A;  3Q8F A;  3AE3 B;  5CX3 A;  3V60 A;  4HVB A;  1XT9 B;  1YX6 B;  3Q69 A;  4HCN B;  3AI5 A;  2GBJ A;  4P6V F;  1E8Z A;  4LNF A;  4RGM A;  5H8Y E;  1LGR A;  3VH4 B;  3ZNH B;  4JQW C;  4MGI E;  2MBH A;  1YJ1 A;  2LWP A;  2J0M A;  3RZW C;  1QKZ A;  2X8X X;  1YN4 A;  4YT0 B;  1T0Y A;  3W5V B;  3PZ7 A;  4DHZ E;  3JSV A;  1WX7 A;  3AN1 A;  4OZA A;  1N5W A;  3H7P B;  3IT6 B;  2CHX A;  2HTH A;  1I4R A;  4W9H A;  1NVI D;  2K8H A;  4NQK E;  4EEW A;  3U2S C;  1YOV B;  2QHO A;  1ZE3 D;  3PLV A;  3N32 A;  1NEK B;  4MDK E;  3VVW B;  1VDV A;  1GJZ A;  4CHK A;  5DPR A;  1T3Q A;  3A9J A;  2KQ4 X;  1R7S A;  2QJL A;  4YTM B;  3RYT A;  3U8Z A;  4ZYS A;  4US8 A;  2G1E A;  2E3T A;  2IO3 B;  1E9M A;  3CWI A;  1ESF A;  1L0V B;  2K8C A;  2MHJ A;  3APC A;  3BVZ A;  3WAP A;  1NYQ A;  3UQA A;  4AJW A;  1S1Q B;  2ZNV C;  3AE6 B;  1N63 A;  5HG2 A;  1IGC A;  1XLP A;  4PS8 A;  1WGK A;  5IP4 D;  3IVF A;  2KTR B;  3HM3 A;  4B0E A;  1JML A;  1HXY D;  1E0Z A;  4N9F 4;  1DYQ A;  2KC1 A;  4NPN A;  2FCM A;  4KGT A;  3QAR A;  4YTN B;  2C7H A;  1ET6 A;  4J3O D;  1WE7 A;  4LDT D;  3W9C B;  2M19 A;  3BVM A;  1EUV B;  1N60 A;  1GPX A;  3LXF A;  2GBM A;  5EE0 A;  5C2T B;  4JL9 A;  4RFB A;  4GGQ A;  1QQR A;  2HJ1 A;  5IN7 A;  1ENF A;  4GSW A;  1IGD A;  1TZO A;  2DZM A;  2OJR A;  3AEG B;  2GOW A;  5KHQ A;  1FO4 A;  4GIV A;  2MP2 B;  3KYD D;  2W54 A;  3EHV A;  1ZXH A;  4K3B A;  1WGD A;  2ZNV B;  2WU2 B;  2GLS A;  1Q0W B;  1FNU A;  2KWD A;  3CIR B;  3DVG X;  5BYQ A;  3A33 B;  4WH4 A;  4J6I A;  3P2B A;  1HEZ E;  3AE9 B;  2RDB C;  3I63 C;  3Q8C A;  2C9W B;  2GBK A;  2M17 A;  4KSL C;  1DGJ A;  1T0Q C;  4BKG A;  4US9 A;  1OQQ A;  3T3N A;  1SSN A;  2JQR B;  3C19 A;  3ZXV A;  4F7Z A;  5J2R A;  3IT4 B;  1SJH D;  2Z59 B;  1E90 A;  2KLC A;  2IGD A;  1L4Z B;  2JYT A;  2JU6 X;  1ZDX A;  2VH1 A;  2LHE A;  3AE4 B;  3IHP C;  3P4P B;  1PGA A;  3PSE B;  1FFV A;  3TUO A;  2PW9 A;  2OJW A;  4KDL B;  4HK2 A;  4C56 C;  3DPD A;  1XCQ L;  2DAJ A;  1SJE D;  3KUC B;  2JXT A;  1UGM A;  4XWW A;  4ARI A;  3TSS A;  3DVN V;  3SHQ A;  3U4E G;  3WIM A;  2MBE A;  3P4Q B;  2K22 A;  4MGK E;  4C00 A;  3X0W A;  1KRH A;  1XEE A;  2RPQ A;  3AU5 A;  3AE7 B;  1YQ4 B;  4BBN C;  2KWV B;  1RFK A;  3AEA B;  4K81 A;  3HVD A;  2FCQ A;  4L23 A;  4W9I A;  3KH0 A;  3MC8 A;  4AOF A;  3VR9 B;  1FXT B;  2WDQ B;  5G5H A;  4W9J A;  3JVZ X;  3AEE B;  1EF1 A;  1Q10 A;  4LDT B;  2D07 B;  2K6Q A;  1BUI C;  4HWI B;  4NY0 A;  4C80 A;  1IUE A;  5E6J A;  2L8J A;  2MW5 A;  1PQS A;  1AN8 A;  2EMT A;  1OTR B;  4LNK A;  1QIL A;  4W9L A;  2JPH A;  5JHB A;  3MJW A;  2RMM A;  3QX1 A;  3VUY A;  3NJT A;  2HD5 B;  2WGS A;  1HTO A;  2L1A A;  1Y56 A;  3OJ3 A;  4KX6 B;  4GDL A;  2D11 A;  1YD8 U;  1V2Y A;  2LHD A;  3V62 A;  4ASW C;  3Q3M C;  5EE1 A;  2MBB B;  3PV1 A;  4IM3 A;  3A9J B;  3NS1 A;  2R2Q A;  1VRA B;  3HVZ A;  3H7P A;  1PFD A;  4KDI C;  2KK8 A;  4LNN A;  1OQY A;  3KW5 B;  2PMV A;  5D6J B;  3GE8 C;  2ICI A;  1TGZ B;  5FR6 A;  2KFK B;  4NQL B;  3NVV A;  3GB1 A;  2PTL A;  4GXB A;  1I4Q A;  4NJC A;  2LUM A;  3W1S C;  4TUU A;  2BKF A;  2LI5 A;  5G55 A;  1WGG A;  3Q3J A;  4GDK B;  4UDU C;  1XQQ A;  1XLQ A;  2L0F A;  3FAH A;  2V4L A;  1FD6 A;  4WAF A;  2OHF A;  2LJI A;  4FJV B;  1TT5 B;  2N1W A;  3GZN I;  4MSM B;  2BPS A;  5E6O A;  2AL3 A;  1F52 A;  1FFU A;  1I35 A;  5C23 A;  3L4P A;  1EU3 A;  4EFO A;  3B2F A;  2AQ3 B;  3R7R A;  3A4S C;  4AP4 C;  4KKI A;  3APF A;  2K5P A;  4ICU A;  3N20 C;  1IBX B;  2UYZ B;  3MP9 A;  3L54 A;  4TSS A;  3Q14 C;  3E56 A;  1P9D U;  2RPV A;  1WM3 A;  5HFY A;  3T9L A;  4YSZ B;  3DVG Y;  3QIJ A;  1V6E A;  5AEK B;  2MQJ A;  2YEP F;  2N9P C;  3C0R B;  1AAR A;  4MSQ B;  1UZX B;  4KGS A;  1WMH B;  2KAN A;  4CQN A;  2O2V B;  2G45 B;  1YQ3 B;  3AV8 A;  1V81 A;  4HRS A;  3TEW A;  3RNF C;  2N9K A;  2D3B A; 
#chains in the Genus database with same CATH homology
 1QZE A;  1Z2M A;  3BIN A;  3M95 A;  4GB9 A;  3RUL A;  4PYU A;  2ZZP B;  3W1Y A;  3EC8 A;  4WJN A;  3PLU A;  2LJ5 A;  3WAO A;  3NZU A;  1CMX B;  2IY0 B;  4FHJ A;  2FCN A;  2UWQ A;  2KDE B;  2ASQ A;  3B1L X;  4B9K A;  3A1Q A;  2MP2 A;  3H6N A;  3PPA A;  4MM3 A;  4A20 A;  2IO0 B;  1GNU A;  4K7U A;  4RMA A;  2MBO A;  3MTN B;  4JLC A;  2GBR A;  4ZRI A;  2LGY A;  3QQ8 B;  1C1Y B;  3N30 A;  2BGF A;  3PT2 B;  3ML8 A;  3R66 C;  4EKU A;  3KUZ A;  4G50 A;  1I42 A;  1LQB A;  2NPT B;  4F1S A;  1SGH A;  1LXD A;  4JIO U;  2A4Z A;  3ZKJ C;  3PRE A;  1A5R A;  3A4R A;  1K8R B;  1YQB A;  2IY1 B;  2LGX A;  4P7I A;  2ZPN A;  3DCG A;  4BFR A;  3AXC A;  1IP9 A;  1C3T A;  2R2O A;  4HLE A;  1GUA B;  2D10 A;  3PS6 A;  4GU2 A;  2JWZ A;  2N7D A;  3Q3F A;  5CHV C;  4IG7 B;  4W9F A;  2WWZ A;  4GMV A;  3VTW A;  4W9C A;  1H4R A;  4WWO A;  4WWN A;  3V61 A;  5CX3 A;  3V60 A;  4AUQ C;  1XT9 B;  1YX6 B;  2BYE A;  3KUD B;  4HVB A;  1IYF A;  4HCN B;  3AI5 A;  3SDL C;  4K7W A;  1VCB A;  3ZDT A;  3V6E B;  2GBJ A;  2ZCC A;  2BF8 B;  4WAA A;  1E8Z A;  3L08 A;  1ZGU B;  1D3Z A;  4E74 A;  2KO3 A;  4ANX A;  2L05 A;  2KVR A;  4BOZ B;  2JZ3 B;  2PE9 A;  4OVU A;  3B08 A;  2OOB B;  1WJ6 A;  3VH4 B;  1WY8 A;  2KDB A;  3ZNH B;  4F8C B;  4JQW C;  4MGI E;  2JZZ A;  5EDS A;  2VRR B;  1WXS A;  1WMH A;  2LVQ A;  2MBH A;  4WJQ A;  4E3C A;  1ZW7 A;  1YJ1 A;  2BKR B;  2NR2 A;  2LUE A;  1KM7 A;  2LWP A;  3ZNG C;  5L95 C;  2NBW B;  4HCP B;  2KMA A;  2J0M A;  3RZW C;  3ZW3 A;  4FHK A;  1WZ3 A;  3UIN B;  4HJK A;  2CS4 A;  3UIP B;  3WA0 A;  2JY6 A;  1T0Y A;  1V80 A;  2O6V B;  3V6C B;  4PS7 A;  4NJ7 A;  4BKS D;  2O6V A;  3UF8 A;  4WQO B;  3CMM B;  3JSV A;  1WX7 A;  5CTR C;  1V5O A;  1Y8R C;  2Z0E B;  4DHZ E;  2W9N A;  5J18 A;  3U30 A;  3M3J A;  2C5L C;  3TJP A;  2KD0 A;  2JUO A;  3H7P B;  3ZLZ A;  4IWO A;  4I6N B;  1WM2 A;  2CHX A;  1WX9 A;  2HTH A;  2DEN B;  3H1U A;  1WXV A;  2DYM A;  4W9H A;  4IWP A;  2D3G A;  4TQ1 A;  2K8H A;  2N9E B;  3UIO B;  3VUX A;  2EMS A;  3VTV A;  4NQK E;  4W9D A;  4EEW A;  3ONS A;  3DQV A;  4PS3 A;  2QHO A;  2KN5 A;  2KDF B;  2KLG A;  1OEY A;  3PLV A;  3N32 A;  2CR5 A;  4MDK E;  3VVW B;  3KYC D;  1E5W A;  4HDO A;  1GJZ A;  2DYO A;  4CHK A;  5DPR A;  2M0X A;  1P1A A;  3A9J A;  3IBE A;  2RR9 A;  4EZK A;  2M1M A;  3DBR I;  4KVG B;  3PRM B;  4FJY A;  2L00 B;  3RYT A;  1S3S G;  3U8Z A;  3UGB B;  4DHZ B;  1NDD A;  5HKH A;  1UBQ A;  3VDZ A;  2BWE S;  2IO3 B;  4TKN A;  4MEM A;  5AZF A;  1TTN A;  4MGY E;  2DX5 B;  4MGZ E;  1MG8 A;  2K8C A;  4XX5 A;  3WAP A;  3APC A;  3ZUN A;  4GOC A;  5L83 A;  3UQB A;  3UQA A;  4G0N B;  4K7S A;  4AJW A;  1S1Q B;  2ZNV C;  1OEY J;  5E6P A;  5DPW A;  1XD3 B;  3RT3 B;  1LFD A;  1X1M A;  2JRI B;  3A1Q B;  1E8X A;  2KKC A;  3WAN A;  3HHM A;  2KMC A;  4PS8 A;  2IZV B;  4B95 A;  4KIK B;  5GMV A;  5KHO A;  2KFK A;  3QA8 A;  4OVV A;  5CHF A;  1VD2 A;  3IVF A;  5J17 A;  2KTR B;  4W9E A;  3HM3 A;  1KLV A;  2CKH B;  2C60 A;  2XEW A;  4FLH A;  5AZH A;  2KDI A;  2N9X A;  4N9F 4;  5BO4 B;  4ANU A;  3A9K B;  1YIW A;  2KOX A;  2KWU B;  2KC1 A;  4NPN A;  1UEL A;  2I1K A;  2FCM A;  2LZ6 A;  3QAR A;  3JW0 X;  1KJT A;  5LLI A;  2C7H A;  1WE7 A;  2IBI B;  1WZ0 A;  4LDT D;  3PHW B;  2FID A;  1WJN A;  2V1Y A;  3OLM D;  5E6N A;  1WX8 A;  1R4M I;  2K8B A;  3GOE A;  4A3O A;  2O6V D;  3WAL A;  3AU4 A;  2MSE D;  1EUV B;  3LDZ E;  3QCA A;  4G3X B;  2GBM A;  1F9J A;  1LM8 B;  2IYD B;  2MCN B;  4FJZ A;  4IW0 A;  1RAX A;  2WX0 A;  4JL9 A;  1M94 A;  4FAD A;  5LXI B;  3HIZ A;  3VHT C;  2KC2 A;  4GGQ A;  4M8M A;  3IFW B;  3H9D A;  2JVC A;  2HJ8 A;  4HXD A;  5C1Z A;  1V9J A;  4MH0 E;  4XC2 A;  4ANV A;  1GC7 A;  4BBN F;  1Q1O A;  2CHZ A;  4GSW A;  2DZM A;  1ISN A;  2OJR A;  5CHW A;  2DYB A;  2ZCB A;  4LCD E;  2GOW A;  4FA6 A;  4GDK A;  1P98 A;  4DBG A;  5KHQ A;  3VUW A;  4II3 B;  1TBE A;  2K1F A;  2L0T A;  4GIV A;  1U4A A;  2ZVO A;  2MP2 B;  3KYD D;  1SE9 A;  2HE7 A;  3EHV A;  2DHZ A;  4GDL B;  4MJS B;  2FCS A;  2KJ6 A;  1WGD A;  2ZNV B;  1RRB A;  4G11 A;  2LD9 A;  4RM9 A;  4M8N A;  3APD A;  1Q0W B;  4HPM B;  4FUL A;  3TMP B;  2C7N B;  2KNB A;  3DVG X;  3A33 B;  4J6I A;  3P2B A;  3QK0 A;  4W9G A;  3LJ3 A;  2REX A;  2N1V A;  3VTU A;  4NJ6 A;  2AYO B;  2WDT B;  2J0K A;  2C9W B;  2MBQ A;  2GBK A;  2M17 A;  3ZVV A;  2PEA A;  4KSL C;  3S2A A;  2L76 A;  4DHJ B;  2LAS A;  4BKG A;  3ECI A;  3OJ4 B;  4LJO B;  3L0W B;  4BVU C;  4F7Z A;  3ZTC A;  5J2R A;  4ANW A;  4DDG D;  2NBU A;  5DPT A;  1WI0 A;  4RM8 A;  2Z59 B;  1R4N I;  1E90 A;  3K9O B;  1NI2 A;  2KLC A;  4NNJ B;  2YVC A;  2C7M B;  5D7G A;  2NBV B;  2NS5 A;  3PRP B;  3IHP C;  3PSE B;  4BKS A;  3ML9 A;  1P0R A;  1UD7 A;  4YL8 A;  4KDL B;  4HK2 A;  4TV3 A;  2ZJD A;  2PE6 B;  3DPD A;  3HM6 X;  2BYF A;  2DAJ A;  4K1R B;  1WR6 E;  2FIF A;  3KUC B;  2LGD A;  4JGH B;  2MX2 A;  4XZ4 A;  1UGM A;  1OGW A;  4I6L B;  3CSF A;  1IPG A;  2N7E A;  2FUH B;  3L16 A;  4FBJ B;  1L2N A;  1WXA A;  3EFU A;  3NZS A;  4NAW A;  1E8W A;  1WE6 A;  1WGY A;  3RD2 A;  1H8C A;  2KHW B;  3O65 B;  3L10 B;  4IM2 A;  3DVN V;  3QHT A;  2MWS B;  3PZD A;  1P3Q U;  3SHQ A;  2DZK A;  2NCN A;  3WIM A;  2G3Q B;  3ZNZ B;  2KQ7 A;  2M8S A;  2MBE A;  1WXM A;  2XK5 B;  2LRW A;  2AEH A;  4EUT A;  4TQ0 A;  4MGK E;  3X0W A;  2N4F A;  5G2N A;  2RPQ A;  1L7Y A;  3AU5 A;  1HE8 A;  4EOY A;  4BBN C;  2KWV B;  4E71 A;  2D2Q A;  2AWT A;  4K81 A;  4ZRK A;  3L17 A;  1GC6 A;  2FCQ A;  4W9I A;  1WGH A;  4AWJ A;  3N3K B;  4WWP A;  2DZI A;  3KH0 A;  4B6W A;  4AOF A;  3L13 A;  4URK A;  4EZL A;  1BT0 A;  2XBB C;  2JXX A;  2FAZ A;  1FXT B;  3ZO5 B;  2ZPY A;  3TL5 A;  4W9J A;  3JVZ X;  3R7Q A;  1EF1 A;  1WH3 A;  2LVP A;  4LDT B;  2RGF A;  1GG3 A;  1J0G A;  2MLB A;  2D07 B;  2K6Q A;  1WYW B;  2B3A A;  4AJY B;  4HWI B;  4NY0 A;  3A9K A;  3ENE A;  3ZTD A;  2FNJ B;  2L7R A;  1WIA A;  3ZRF A;  3BY4 B;  4MEL A;  1UBI A;  1WGR A;  3R3M A;  2MRP A;  3K9P B;  4HDQ A;  3TBL D;  1EO6 A;  2I1J A;  2L8J A;  2MW5 A;  2KFJ A;  1PQS A;  2JRH A;  1TZ1 A;  2EMT A;  3PTF C;  1OTR B;  3DBL I;  4WJP A;  4CYE A;  2PJH A;  4W9L A;  2M4N A;  2JPH A;  3QAQ A;  5JHB A;  3EEC A;  2K39 A;  2LVO A;  3W1S A;  3MJW A;  4BKT A;  3QX1 A;  3VUY A;  2J7Q B;  2HD5 B;  3QC8 B;  4ZDV A;  3QJZ A;  1RFA A;  3SD5 A;  2CU1 A;  1WJU A;  3MHS D;  3OJ3 A;  3PVL A;  5IA7 A;  1YX5 B;  4I6P A;  4GDL A;  2D11 A;  4MJS A;  3RUI B;  2V3S A;  2KQS A;  3JYU A;  2WYQ A;  1YD8 U;  2L3Z A;  3NY5 A;  1V2Y A;  2KXJ A;  4X57 B;  3V62 A;  4ASW C;  4BOS C;  4KSK C;  2J0J A;  2KZR A;  2MBB B;  1KOT A;  3PV1 A;  4IM3 A;  3A9J B;  3M63 B;  3QWZ B;  2CHW A;  2KTR A;  4W9K A;  2R2Q A;  3TIX A;  2IO2 B;  3VFK A;  3NHE B;  1EF5 A;  4KZ0 A;  3H7P A;  4KDI C;  2KK8 A;  5JZE B;  1OQY A;  1ZKH A;  2LXA A;  3KW5 B;  3T8M A;  1WJ4 A;  3ZNI D;  1WRD B;  5DCN A;  3IG3 A;  3VH3 B;  5D6J B;  4DWF A;  2EKE C;  1TGZ B;  3KVF B;  5FR6 A;  2KFK B;  4WJO A;  4NQL B;  2ZEQ A;  1V49 A;  3DVN U;  4DHJ D;  4GXB A;  3DOW A;  3X23 A;  2MA9 B;  2IO1 B;  3DBS A;  2RSU A;  3W1S C;  4TUU A;  2BKF A;  2LI5 A;  5G55 A;  1WGG A;  3Q3J A;  1Q5W B;  3M62 B;  4GDK B;  1XQQ A;  2L0F A;  1WF9 A;  2G4S A;  2BWF A;  3CST A;  2K25 A;  3NOB A;  1JRU A;  2V4L A;  2JT4 B;  3NS8 A;  2DAF A;  1E8Y A;  4FJV B;  3WAM A;  1G6J A;  2N1W A;  1V5T A;  3VXW A;  2AL6 A;  2PPH A;  4KIK A;  2KX0 A;  2BYV E;  2ZVN A;  3GZN I;  3HK0 A;  4EZJ A;  4A3P A;  4MSM B;  2BPS A;  4DK5 A;  2KX3 A;  5E6O A;  2AL3 A;  2A5U A;  2G4D B;  3SU8 X;  1I35 A;  2KTF A;  3ZDM C;  3B0A A;  4KV2 A;  5C23 A;  1E7U A;  2KWC A;  5AZG A;  2JF5 A;  4EFO A;  3ZRC A;  4FN2 A;  1V86 A;  2Z0D B;  3H7S A;  3R7R A;  1J8C A;  3RCZ A;  3A4S C;  4AP4 C;  3VQI A;  3TCA A;  3I3T B;  3APF A;  4ICU A;  2NPT A;  4ZYN A;  4M0W B;  4ZRJ A;  2UYZ B;  4IC7 B;  2NVU I;  3L54 A;  4LJP B;  1UH6 A;  4HPL B;  4DDI D;  3U7D A;  4IWQ A;  2XK5 A;  3PRZ A;  2RD0 A;  5D2M B;  1P9D U;  4CO7 A;  1WFY A;  5TR5 A;  1E7V A;  3VAW A;  1WM3 A;  4GN1 A;  3T9L A;  3DVG Y;  2LRU A;  2YLM A;  3QIJ A;  1SIF A;  1V6E A;  2GMI C;  2K6D B;  5AEK B;  2Y5B B;  3DDC B;  4NAW B;  4PYZ A;  2MQJ A;  2N9P C;  3C0R B;  5JHA A;  1AAR A;  4IM0 A;  4MSQ B;  1UZX B;  2LXC A;  4IUM B;  5IAA C;  1WMH B;  3RZF A;  3DBH I;  4DXA B;  2DZJ A;  3ALB A;  2KAN A;  2GBN A;  2WX1 A;  4II2 B;  3D32 A;  4KZC A;  2O2V B;  2G45 B;  2KJH B;  1RLF A;  5DPS A;  3CF6 E;  1J19 A;  1V81 A;  4ICV A;  2KJR A;  1NBF C;  5JH5 C;  1Z5S B;  5LXH A;  2O2V A;  3ZIM A;  3PHX B;  3AUL A;  3OAW A;  3JSV B;  5D94 A;  3PGE A;  1WR1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...