3SDLC

Crystal structure of human isg15 in complex with ns1 n-terminal region from influenza b virus, northeast structural genomics consortium target ids hx6481, hr2873, and or2
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
151
structure length
151
Chain Sequence
DLTVKMLAGNEFQVSLSSSMSVSELKAQITQKIGVHAFQQRLAVHPSGVALQDRVPLASQGLGPGSTVLLVVDKCDEPLSILVRNNKGRSSTYEVRLTQTVAHLKQQVSGLEGVQDDLFWLTFEGKPLEDQLPLGEYGLKPLSTVFMNLRL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis for the sequence-specific recognition of human ISG15 by the NS1 protein of influenza B virus.
pubmed doi rcsb
source organism Influenza b virus
molecule tags Viral protein/antiviral protein
molecule keywords Non-structural protein 1
total genus 37
structure length 151
sequence length 151
chains with identical sequence D
ec nomenclature
pdb deposition date 2011-06-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00240 ubiquitin Ubiquitin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 3sdlC02
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 3sdlC01
1UGMA 2AWTA 2KC1A 4BOZB 2CHZA 4W9KA 1WXAA 1RAXA 2L05A 4HLEA 1WJ6A 4IM3A 3UGBB 2IO3B 1EUVB 3VHTC 4ANUA 2DZIA 1YX6B 3IBEA 2AEHA 3JSVA 4HCNB 4K7SA 3OJ3A 4TV3A 2RGFA 4GDKB 4JLCA 1BT0A 2PPHA 2WDTB 1V5OA 2NPTA 3PV1A 1Z2MA 1ZW7A 3ZUNA 1CMXB 3SU8X 3RYTA 2JVCA 3PPAA 4GOCA 3X23A 1F9JA 3DPDA 2KMCA 2LXAA 4ZRIA 3V60A 4DHJD 1E8YA 2N9PC 1V49A 2KQ7A 3S2AA 4BKGA 2UWQA 1WRDB 4IM2A 2KC2A 2LRUA 2HD5B 2LWPA 3W1SA 5C1ZA 4G3XB 3R3MA 2G3QB 3WIMA 2VRRB 3QIJA 2EKEC 2KVRA 1KLVA 4AJWA 3DBSA 1WXMA 2IO2B 3Q3JA 4MEMA 3VTUA 4E71A 3B1LX 2O2VB 4E74A 4M0WB 4W9LA 3B0AA 5DPWA 4B95A 2V4LA 3W1YA 3JW0X 4M8NA 4NY0A 3VTVA 1Q5WB 4MELA 5KHOA 3R7RA 4GIVA 2IO0B 3PHXB 1NBFC 3C0RB 1WX9A 3VH4B 2MBQA 2BYEA 1XQQA 1KM7A 4G0NB 3D32A 3EHVA 1OGWA 2Z59B 1Z5SB 1TZ1A 4KZCA 5D6JB 1VD2A 4MGIE 4GDLA 4WJNA 2KFKB 3MJWA 3ZIMA 2KOXA 3VH3B 2CHXA 3O65B 3QC8B 2J7QB 3PRZA 4FHKA 1WM3A 2DAFA 2N9XA 3ZO5B 2K8HA 2ZJDA 2JZZA 2KWVB 2M17A 4KSLC 2CU1A 2DZJA 5LLIA 4BBNC 2REXA 3X0WA 1V6EA 3HK0A 3U7DA 4GB9A 3KUCB 3PREA 2HTHA 3QQ8B 2RPQA 4GMVA 4BKTA 3RUIB 4IWQA 3HM6X 4EZLA 1WE7A 2KTFA 2NR2A 3DOWA 2JXXA 3DVGX 3A9KA 1WJ4A 3LJ3A 2GBKA 1YD8U 4BKSD 3DBHI 3L16A 4KIKA 3N3KB 4JL9A 2QHOA 4KIKB 1R4NI 1RFAA 2CS4A 4PS8A 2ASQA 4J6IA 2K8CA 2AYOB 3R7QA 1P1AA 5DPSA 1GC6A 4W9GA 4GGQA 4JQWC 4NQLB 2N4FA 4IWOA 2V1YA 1EO6A 2ZVNA 2FAZA 3KYDD 3PTFC 4PYZA 3ZKJC 2BGFA 2NBVB 2LRWA 2Z0DB 2EMSA 2JUOA 4EOYA 5LXIB 2L3ZA 3TBLD 3ZDTA 4NNJB 2N7DA 3KYCD 2D3GA 3ZNGC 3M95A 2K6DB 3QAQA 1UELA 4PS3A 1OQYA 3KW5B 1Y8RC 3AI5A 3CSFA 2MW5A 2DAJA 1UBQA 2WYQA 1R4MI 1GC7A 1MG8A 2D11A 1GJZA 3ECIA 2FUHB 3SDLC 1WMHB 2BKRB 2PJHA 2JRIB 2KJHB 2OOBB 2C5LC 4HWIB 4F8CB 3UIOB 2LGXA 1AARA 2C7NB 2IYDB 3M63B 3MHSD 4FN2A 3VTWA 2MQJA 4MGKE 2Z0EB 1YJ1A 1V9JA 3VXWA 3ZRFA 4MGYE 2GBMA 2O2VA 3M62B 2RSUA 5D94A 1UBIA 4LDTB 2ZNVB 3DQVA 1Q1OA 4MSMB 2ZEQA 4CYEA 4LDTD 5C23A 2FCQA 2RD0A 2DX5B 1E7VA 1GG3A 4I6LB 1WF9A 2XK5A 3EFUA 4ZDVA 4PYUA 5L95C 1LM8B 3IVFA 4AOFA 4IG7B 2ZPNA 4P7IA 3APDA 2MCNB 2N9EB 3TL5A 3ENEA 1WZ0A 4TKNA 4GDLB 1P0RA 2LD9A 4BBNF 3HHMA 2MBHA 3PRPB 1V86A 4MSQB 2C9WB 2YVCA 3UIPB 4RM9A 5AEKB 2K8BA 3A9JB 4RM8A 4URKA 3PHWB 2BKFA 2IO1B 1P9DU 2LASA 1WYWB 3ZNID 4CHKA 2D2QA 3UF8A 5J18A 1IYFA 2MA9B 2KTRA 3PS6A 4DXAB 3ZTCA 3U8ZA 1G6JA 3VUYA 2L0FA 2XK5B 3JSVB 4KDLB 4K7WA 5E6NA 3NZSA 2KNBA 1I35A 2K39A 1SIFA 2JT4B 4NJ6A 4F7ZA 4W9HA 3AU4A 2KZRA 4W9DA 5CHFA 4HDQA 4CO7A 2R2OA 4N9F4 3H9DA 1WGGA 2KJ6A 3SD5A 1OEYA 4ANVA 5JZEB 1ZGUB 2WWZA 2M0XA 2Y5BB 3PZDA 5AZFA 1TGZB 2MBBB 2D10A 1IP9A 5IAAC 4ZYNA 1WGHA 3QJZA 4EKUA 4EZJA 4HVBA 1L7YA 2LVPA 1UH6A 4BKSA 3UINB 5DCNA 2MSED 1S3SG 4DWFA 3ZVVA 2WX1A 3KUDB 3V61A 3V6CB 1H4RA 2FNJB 4AWJA 3MTNB 2KMAA 3NS8A 3R66C 2DZKA 2MRPA 4ANWA 1E5WA 4DK5A 1C3TA 4KDIC 3APCA 2BYFA 2FCMA 5L83A 2O6VB 4K81A 3WANA 2KQSA 1YQBA 2JRHA 2PE9A 5DPRA 2DYOA 4B6WA 4W9FA 3VFKA 4DDID 2M1MA 3JYUA 2KJRA 4I6NB 1E90A 2K1FA 4TUUA 2GMIC 1EF5A 5GMVA 3RULA 2IZVB 2PE6B 4IUMB 1Q0WB 4MJSA 1UD7A 2NCNA 5D7GA 3V6EB 1LQBA 2M8SA 1P98A 3WA0A 3DDCB 4MGZE 2KFKA 2LGDA 5EDSA 3T8MA 2PEAA 3L0WB 1JRUA 3A1QB 3A9JA 3ML9A 4EFOA 4MM3A 2KK8A 4FBJB 2D07B 4EZKA 2KANA 4ICVA 3DVNU 1V2YA 1WXVA 2L00B 4OVVA 2JZ3B 4IM0A 2IY0B 4KSKC 4FA6A 2AL6A 2KX0A 1T0YA 5J2RA 1PQSA 3EECA 1UZXB 3P2BA 2DYMA 4IW0A 1WM2A 2ZCCA 4WJQA 3DVNV 1FXTB 5JHAA 2N1VA 1J19A 3PRMB 3QWZB 2I1KA 5CHVC 2ZPYA 4MJSB 2CKHB 2LUEA 1WIAA 2NS5A 1TTNA 3H7SA 4GXBA 3RZWC 3PVLA 4WJOA 5CX3A 5IA7A 3L17A 1ISNA 1K8RB 3N30A 3B08A 3NOBA 2GOWA 5DPTA 4DHZE 1KJTA 3K9OB 1IPGA 4JGHB 3CF6E 2DYBA 1WZ3A 3DBRI 3DCGA 4JIOU 3WAPA 3HIZA 2KHWB 4F1SA 2MWSB 3AXCA 4TQ1A 2KD0A 4FJVB 2KWUB 4GU2A 3A33B 3QCAA 5LXHA 2LVOA 2FCSA 2KDEB 4G50A 1OTRB 4LJOB 5G55A 1WFYA 3DVGY 4GSWA 3H7PB 1TBEA 1WH3A 4FADA 2GBRA 5AZHA 5TR5A 2LGYA 2AL3A 4X57B 2HE7A 2ZCBA 3QHTA 2G4SA 1LXDA 1D3ZA 5HKHA 3IHPC 3L13A 2V3SA 5G2NA 3ZW3A 1RRBA 2KLCA 2KKCA 2XEWA 2ZZPB 3KH0A 1WE6A 1ZKHA 1WR1A 2BYVE 2JPHA 1YIWA 3K9PB 2BPSA 4NJ7A 2JWZA 4E3CA 4AP4C 4BOSC 1WR6E 4NQKE 4WJPA 1J8CA 3OJ4B 3U30A 5E6OA 3A4RA 3KVFB 1H8CA 4II3B 2A5UA 2J0MA 2KWCA 4FJZA 4I6PA 2K25A 3ZLZA 3OLMD 2KXJA 3A4SC 3WALA 2RR9A 4WAAA 2KO3A 2M4NA 1SE9A 3WAOA 4WWPA 1U4AA 4ZRKA 5KHQA 3APFA 3QA8A 4DDGD 3RZFA 2WX0A 3NZUA 1WXSA 2NBUA 2ZVOA 1YX5B 3CMMB 4W9IA 1M94A 1VCBA 4MDKE 3OAWA 2OJRA 2KLGA 2JY6A 4XX5A 3VDZA 3TJPA 4OVUA 4W9EA 2JF5A 4B9KA 2K6QA 5CHWA 4RMAA 3H1UA 2MP2B 5E6PA 3AU5A 3SHQA 1GUAB 3QX1A 1QZEA 4A20A 1LFDA 1WX7A 2UYZB 3ML8A 2N1WA 4KV2A 4DHZB 2FCNA 1A5RA 4PS7A 2KDFB 2DHZA 2GBJA 4LJPB 4WWOA 3TCAA 3L10B 3QK0A 1WJNA 4EUTA 2HJ8A 1WJUA 2KTRB 1RLFA 3KUZA 1NDDA 2LXCA 3H7PA 4G11A 4NAWA 2GBNA 1L2NA 4K1RB 4A3PA 2G4DB 1WX8A 3VUXA 3AULA 3NHEB 1OEYJ 3ZNHB 4TQ0A 2I1JA 2NPTB 1XT9B 4FLHA 3TMPB 2KN5A 2DZMA 3IFWB 5D2MB 3ZRCA 3I3TB 5AZGA 1WY8A 2C60A 3PSEB 4XC2A 1GNUA 3JVZX 4ZRJA 2MBEA 3Q3FA 3VUWA 4AUQC 2MLBA 4FULA 1I42A 1C1YB 2LI5A 3H6NA 3UQBA 3RT3B 3VAWA 2R2QA 3PGEA 3ONSA 1WGRA 2KFJA 2L7RA 2KDIA 3ALBA 4AJYB 1E8WA 3CSTA 1SGHA 1E7UA 4HJKA 2LJ5A 1V81A 3PT2B 3W1SC 4ANXA 3UQAA 4NAWB 4A3OA 4W9JA 2NVUI 2L8JA 2W9NA 2EMTA 1WGDA 4HK2A 3VQIA 4IWPA 2L0TA 3L54A 4BFRA 2KX3A 2O6VD 2BF8B 5BO4B 3PLVA 2MX2A 1X1MA 2IY1B 1V80A 1E8XA 4WWNA 2NBWB 3RCZA 3L08A 4YL8A 3TIXA 3EC8A 2KDBA 4HPLB 4II2B 3PLUA 3ZNZB 4HDOA 2DENB 2ZNVC 3BY4B 4WQOB 2LVQA 4K7UA 2IBIB 2FIDA 4ICUA 4W9CA 2C7MB 3VVWB 3QARA 1WI0A 5J17A 4LCDE 4M8MA 5JHBA 4KVGB 4FHJA 3ZTDA 4ASWC 3M3JA 5CTRC 4GN1A 1XD3B 4DBGA 2G45B 2A4ZA 2YLMA 3V62A 2BWFA 2N7EA 2J0JA 4NPNA 5JH5C 4FJYA 1P3QU 2J0KA 2O6VA 4MH0E 1KOTA 1HE8A 3IG3A 2MBOA 5FR6A 1V5TA 2BWES 3WAMA 3A9KB 1WMHA 4GDKA 1J0GA 3RD2A 3NY5A 3BINA 3LDZE 1EF1A 3A1QA 3DBLI 4EEWA 1NI2A 3GOEA 2LZ6A 2FIFA 2XBBC 2B3AA 3N32A 2L76A 4HPMB 3T9LA 4BVUC 4HCPB 3HM3A 3GZNI 4HXDA 3ZDMC 4DHJB 2CHWA 2MP2A 2CR5A 4IC7B 2C7HA 1WGYA 4XZ4A 4KZ0A 1E8ZA 1S1QB
chains in the Genus database with same CATH superfamily
1SBBB 1UGMA 4BOZB 1KTKA 1WXAA 4HLEA 2AX5A 1KLGD 4HCNB 1YOVB 1L4DB 4JLCA 3AE9B 3B2GA 2PPHA 2D3AA 3PV1A 1ZW7A 2NTTA 2CJOA 3C8YA 3X23A 2KMCA 1YNTE 4C7ZA 1WRDB 4IM2A 4MM3B 2BVCA 2HD5B 2LWPA 4A90A 5C1ZA 1E7PB 2H88B 2W3RA 3WIMA 3QIJA 2EKEC 4HKZE 2IO2B 4MEMA 4E71A 3VTUA 1YQ3B 2EKIA 2WQYB 4E74A 3B2FA 1EU4A 3JW0X 1YN4A 3VTVA 4MELA 5KHOA 3R7RA 3C0RB 1WX9A 2MBQA 1OQQA 1OGWA 4KZCA 1Z5SB 5D6JB 3PO0A 3MJWA 3VH3B 2CHXA 1YQ4B 2J7QB 1WM3A 2ZJDA 5LLIA 2M17A 4KSLC 1V6EA 3U7DA 2W54A 3KUCB 2HTHA 3Q3MC 2Q5WD 2RPQA 3VRAB 4IWQA 3HM6X 2NR2A 3IAM1 2E6XA 2JU6X 3P63A 3NVYA 1YD8U 3L16A 4KIKA 3BVGA 4PS8A 4OHJA 1L0VB 4J6IA 3P4RB 1MI0A 1VJKA 2L1AA 2AYOB 5DPSA 3GB1A 4W9GA 1EO6A 2KDMA 1FMAD 2Z0DB 4NNJB 2N7DA 3FC4A 2D3GA 4PS3A 3ZJTA 3TSSA 3Q6BA 1UBQA 1R4MI 1MG8A 2LGIA 4C00A 2FUHB 3SDLC 2JRIB 4F8CB 1E6EB 3V05A 2WHIA 4MGKE 4C56C 1V9JA 3ZRFA 1MHXA 3AE5B 3AB5A 3M62B 2WXJA 4LDTB 1Q1OA 4MSMB 4CYEA 5BYSA 1E7VA 4LNFA 1XLPA 2XK5A 2VH1A 3FILA 4AOFA 2WNMA 2ZPNA 2LUMA 3APDA 3TL5A 3ENEA 1WZ0A 2N7JA 4GDLB 3HHMA 2C9WB 5AEKB 2IO1B 1XLNA 1WYWB 3UF8A 2WDQB 1WYGA 3BZDB 4XGAB 2MA9B 2KTRA 2QSDA 3ZTCA 3U8ZA 1G6JA 3FKYA 2BB6A 2XK5B 1K52A 1FNUA 3NZSA 2KNBA 1I35A 2K39A 2JT4B 2KVZA 5CHFA 4HDQA 4CO7A 3SD5A 1OEYA 5AZFA 2Y5BB 3PZDA 1TGZB 2MBBB 2D10A 1ACCA 5IAAC 5E6JA 3UINB 3AEDB 4P1BC 3V6CB 3V61A 2FNJB 3MTNB 2L52A 3R66C 2BQQA 3NVVA 1E5WA 4KDIC 3APCA 1FFVA 2LEKA 4K81A 1PGBA 2WXKA 4B6WA 4W9FA 2M1MA 4I6NB 3BVMA 3RULA 2PE6B 4MJSA 3EA6A 3AMZA 5LNK1 2PEAA 2LHEA 1UWXA 4EFOA 2KK8A 1R4MB 4EZKA 1HEZE 4XYCA 2DNFA 3EECA 4JX1C 3AECB 2DYMA 1WM2A 2H89B 4RGOS 3DVNV 5JHAA 1BXTA 4M00A 3I5JC 4ZYSA 1KH0A 2LUEA 2FBWB 2W3SA 3VRBB 5IA7A 1ROEA 3AEGB 4WWMA 1IGDA 3AE6B 3DBRI 3WAPA 3HIZA 3AXCA 5HFYA 1EWYC 2KACA 2KWUB 3AE1B 3A33B 3AE7B 5LXHA 2KDEB 2R61A 1OTRB 4G50A 3H7PB 1F2RI 4A6QA 2X8XX 5TR5A 3DBHB 2LGYA 4X57B 4HROA 1D3ZA 5HKHA 1V1PB 1ZXIA 2JPHA 2WXQA 3K9PB 1E0ZA 4AP4C 4BOSC 4NQKE 3OJ4B 5E6OA 3A4RA 4HEA1 1GB1A 1H8CA 4II3B 2A5UA 2J0MA 1V8CA 3ZLZA 2KXJA 4WAAA 1AW7A 4A9AA 2WXMA 4WWPA 3WAOA 5KHQA 4DDGD 3NZUA 2QJLA 2KT7A 2YEPF 3OAWA 2OJRA 1E9MA 4W9EA 2JF5A 2KMMA 3SHQA 3AU5A 4L1BA 1GUAB 2RDGA 3MC0B 1WX7A 2K3UA 1KRHA 4EE2A 1WJNA 4EUTA 2HJ8A 1WJUA 1NDDA 1TYGB 3H7PA 4HKQA 1WX8A 1FD6A 2NPTB 4FLHA 3VR8B 3I63C 2QDFA 2DBYA 2Y5CA 1XF5L 4NJCA 2MBEA 1V1PA 3VUWA 4PK1A 2X38A 1C1YB 3ZQ4A 3BK1A 1C4PA 3UQBA 3RT3B 4JWUC 3VAWA 3ONSA 3CSTA 1E7UA 1OFFA 1T5XD 2LJ5A 4OVZA 2N9LA 1J7BA 4IWPA 4YWGG 4YSXB 2TSSA 2IY1B 2OEDA 1V80A 4WH4A 3L08A 4HPLB 1DOIA 4A8XC 2DENB 3ZXVA 2IBIB 4ICUA 4W9CA 1JWAD 3QARA 1WI0A 1STEA 5JHBA 4KVGB 4ASWC 1KLUD 3RNEC 1VZ7A 2LFIA 2YLMA 3V62A 1FXAA 4NPNA 5JH5C 2J52A 3AN1A 2J0KA 4DXFA 3KQ4A 2YEPB 1FNVA 3R2IA 2WXGA 3WAMA 4GDKA 1P7FA 2KYWA 3NY5A 3RD2A 3LDZE 3GP7A 5IO9A 2LZ6A 1I4PA 3I57A 3N32A 2L76A 4HPMB 3T9LA 1L6UA 3HM3A 3GZNI 3B9JA 4KZ0A 3RPFC 2AWTA 2KC1A 1RAXA 2L05A 3P4PB 4IM3A 1EUVB 1QT9A 3IBEA 2AEHA 3OJ3A 2RGFA 1BT0A 2WDTB 1V5OA 3DBRB 3ZUNA 1BMLC 3T3NA 1VDVA 4GOCA 1FCCC 1FFUA 3DWGC 2N9PC 5JXVA 4RGNA 3S2AA 4BKGA 2WU5B 3LXFA 2KVRA 3BIID 1WXMA 1I4GA 1CK1A 2Y3AA 2DWQA 4B95A 1ZDXA 4NY0A 1M4VA 4GIVA 1FRRA 1NBFC 3VH4B 1Q10A 3EHVA 2PVOD 2Z59B 4GDLA 1JWMD 2KFKB 2KOXA 1FIQA 2N9XA 4BBNC 2JZZA 2DZJA 3X0WA 1AN8A 1B1ZA 3QQ8B 3ZJUA 1JQ4A 3RUIB 5AUKA 4EZLA 1HTOA 3DOWA 1DOXA 3DVGX 2GBKA 1NVID 3DBHI 2KWDA 1SF0A 1R4NI 1QF6A 3LB8C 1JWBD 4GGQA 4JQWC 4NQLB 1SE2A 3AM9A 2FAZA 4PYZA 1YMHE 2IDYA 4WURA 5HG2A 2LHDA 2LRWA 5BYRA 2L3ZA 3AEEB 3KYCD 3KWLA 3KW5B 3NUHB 2MW5A 2WYQA 1GJZA 3Q2AC 4XWTA 2XN9C 3T3OA 4P6VF 1QOGA 5D3DA 1AARA 3MHSD 2OJWA 4TSSA 1SJED 1QOBA 1FNWA 2GBMA 2O2VA 5H92C 2JWUA 1A70A 4RNAA 1GG3A 1F2RC 5L95C 4YXDB 2IJ0A 1SSNA 3IVFA 4YTNB 2MCNB 1GPXA 4TKNA 1NEKB 3RNGC 2MBHA 1TS3A 4MSQB 3UIPB 1VZ6A 2K8BA 1DOYA 4URKA 3PHWB 2I38A 1P9DU 2D2QA 5J18A 1QQRA 3PS6A 1TKEA 2IGDA 1T6BX 2WDVB 4K7WA 5E6NA 5IP4D 1I4RA 4NJ6A 3CWIA 2R2OA 5BMGA 1WGGA 1HTQA 1ZGUB 4EZJA 2J42A 1L7YA 2MSED 1TJEA 2WX1A 4N58A 1LO5D 2LMCA 4AWJA 1SE3A 3NS8A 1XLQA 1JW9D 3HVDA 1KF6B 1FEHA 1YQBA 1TZOA 4JE3B 2DYOA 2EELA 3VFKA 2K1FA 5J2RA 2WS3B 4IUMB 1Q0WB 1UD7A 1D6EC 3V6EB 1P98A 3ABVB 1ZPSA 2D5GA 2K22A 3NVZA 4MM3A 2D07B 2KANA 1IUEA 3GE8C 3DVNU 4ICVA 4OZAA 2L00B 2JZ3B 2IY0B 4KSKC 4FA6A 3IT4B 4ARCA 1PQSA 3BYYB 3P2BA 2ZCCA 1F1HA 4WJQA 3WCQA 2AQ1B 3MP9A 2N1VA 3N1ZC 4AS1A 3QWZB 1HZ5A 3RNCC 4MJSB 2CKHB 1WIAA 4C80A 3H7SA 4GXBA 3PVLA 4WJOA 5CX3A 2PTLA 3KLSX 3N30A 3B08A 1KJTA 2JYTA 3CF6E 4PT5A 1PYWD 4LNOA 2V0GA 2NMQA 2PW9A 4ARIA 3AEFB 5H8YE 3QCAA 1JROA 1MJDA 4LJOB 1WFYA 1JMLA 1TBEA 1WH3A 4KGTA 2HDEA 2HE7A 2ZCBA 1JWSD 1LXDA 1SE4A 3IHPC 2V3SA 3DBLB 4WQMA 2KLCA 2KKCA 3KH0A 4S0RA 1WR1A 5HHDG 2BPSA 2JWZA 3HRDD 1UGJA 3CIRB 3EGRA 2KN4A 3A4SC 2BT6A 2KO3A 1U4AA 2MJEA 4J3OD 1N5XA 2NBUA 1K53A 3CMMB 1M94A 1VCBA 4MDKE 5FKAC 2KLGA 3TJPA 4XWWA 2K6QA 4ZHPA 2MP2B 3P42A 2BBCA 2N1WA 3U4EG 4DHZB 2ONQA 4PS7A 3DWMA 3TCAA 4R3DA 4WWOA 4C7YA 2KTRB 1RLFA 2VH2A 2WXFA 2QEJC 3NHEB 2LGSA 2I1JA 4KGRA 1KFYB 1ZUD2 5D2MB 1WY8A 3PSEB 5IOIA 3AEBB 1FXIA 4ZRJA 2KAJA 3HUIA 3Q3FA 1ZOYB 4KKIA 3RNFC 2KFJA 1QOAA 4HJKA 1I4HA 1BUIC 1V81A 4NAWB 4HRSA 2NVUI 4HK2A 5C3JB 2L0TA 3L4PA 2L83A 3L54A 3AEAB 2BF8B 4BZAA 5BO4B 1X1MA 3TIXA 3EC8A 2KDBA 4ITKA 4II2B 2MHJA 4HDOA 2ZNVC 4K7UA 2FIDA 2MEKA 4YTMB 1JRPA 3V3XA 5CTRC 2BB5A 2A4ZA 2BWFA 1TS5A 3BYTB 4XDDA 2MJDA 2RDHA 2MBOA 5FR6A 2BWES 1J0GA 1I4XA 3BINA 3A1QA 1NI2A 4RCOA 1L4ZB 3GOEA 2FIFA 2B3AA 4BVUC 4HXDA 3NVWA 2CHWA 2MP2A 2C7HA 1WGYA 1I4QA 4XE0A 4DHJD 1E10A 4W9KA 1WJ6A 2IO3B 1ENFA 3VHTC 4ANUA 1YX6B 1L5PA 1PGAA 2BW2A 4K7SA 4TV3A 4GDKB 2VZKD 3URYA 4NAMA 1Z2MA 1CMXB 4ZRPA 4RGTA 1F9JA 3DPDA 2LXAA 3SFEB 3V60A 3ZXRA 2K0PA 2UWQA 4K3BA 3RNBC 2V3PA 4OZBA 2SAKA 1HZ6A 1KLVA 4AJWA 3DBSA 3Q3JA 2O2VB 3Q3NC 1JCKB 4M0WB 3TEXA 5DPWA 2V4LA 3W1YA 1L6VA 3PHXB 2BYEA 1XQQA 1KM7A 1R4NB 1SXTA 5AUIA 1VD2A 1AYFA 1F77A 4US9A 2ACZB 3E56A 1R7SA 4FHKA 3PRZA 2DAFA 2KWVB 2REXA 3HK0A 4GB9A 3PREA 2FUG1 4GMVA 3I9V1 4BKTA 1WE7A 5FR3A 2NTSA 1WRIA 1TKGA 3UI3A 4BKSD 3N3KB 2QHOA 4KIKB 1RFAA 2CS4A 4BAXA 2ASQA 2JZPA 4YSYB 4UDUC 4MT5A 3R7QA 1GC6A 3U2SC 4IDIA 2N4FA 4IWOA 4M02A 2V1YA 2Y5PA 2ZVNA 2AQ3B 3KYDD 3PTFC 2BGFA 2NBVB 1MHHE 2EMSA 2JUOA 2IGHA 3ZNGC 3C19A 4MACA 1Y8RC 1D5ZC 4AQ7A 1WSPA 3ECIA 3GE3C 4L2YA 2BKRB 3IAS1 3OWEB 3PZ8A 4WIPA 2KJHB 2OOBB 2C5LC 2WXRA 2LGXA 4RF1A 4D2KA 1RYJA 2MQJA 1SIJA 1DYQA 3VXWA 4NZLB 4MGYE 2UU7A 2JYEA 2ZNVB 3DQVA 3FAHA 2ZEQA 4LNKA 4LDTD 2DX5B 4I6LB 3EFUA 4ZDVA 4PYUA 4ZHOA 4IG7B 3ZJVA 2INDC 4BBNF 3PRPB 1V86A 4P16A 3ZGZA 3RI7C 2YVCA 1F0ZA 1I7HA 3A9JB 4RM8A 2BKFA 3ZNID 2JX5A 3NZ3A 4RF0A 1IYFA 4DXAB 4Q2JA 3VUYA 2L0FA 4KDLB 2JQRB 3JSVB 1GB4A 1SIFA 4FXCA 4LTUA 4F7ZA 4W9HA 3AU4A 4W9DA 3BK2A 4RH6A 2VZKB 2DLBA 5JZEB 2WWZA 2OHFA 2QIEB 1FPYA 4A55A 1PGXA 1WGHA 4EKUA 4YSZB 2LVPA 4RFBA 4H2AA 4BKSA 5DCNA 3ZVVA 1H4RA 2KMAA 4ANWA 1XLOA 4DK5A 3BVZA 1HXYD 2ICIA 2BYFA 2V4IB 5L83A 2O6VB 3WANA 2KQSA 3N1YC 1TT5B 2JRHA 2PE9A 5DPRA 2WXLA 2IGGA 4LLGM 4TUUA 2K5PA 1UUPA 2KJRA 1EF5A 2IZVB 2M56B 4ACFA 3DDCB 4MGZE 5EDSA 3T8MA 3A9JA 3ML9A 2WXNA 1MVKA 1F52A 2QCZA 4TMAB 1ZXHA 1C4CA 1V2YA 1IBXB 1T0YA 4REZA 4K3CA 1VLBA 1FXTB 1UF0A 3GZNB 5BYQA 1J19A 1VRAB 2D3CA 2ZPYA 1V1OA 2M19A 1TTNA 2WXHA 4N6EB 3RZWC 3TEZA 3L17A 2IPKD 3NOBA 2GOWA 4DHZE 4JGHB 3DCGA 2J53A 4JIOU 3RFZB 2KHWB 4F1SA 2MWSB 3DHIC 2KD0A 2G1EA 4FJVB 4GU2A 1MPEA 2W82A 1NYRA 1FCLA 4KX6B 4GSWA 4FADA 2WXIA 4OZCA 1ESFA 2WDRB 5GXGB 2G4SA 1RM6C 5G2NA 3H8HA 4GLSC 2XEWA 2ZZPB 1WE6A 2L32A 1ZKHA 1YIWA 1FRDA 4MH8A 3AE2B 3U30A 2RDBC 3EUB2 3KVFB 4QAYA 4FJZA 4I6PA 2K25A 4WAFA 1WXQA 3WALA 2RR9A 1ET9A 3MHZA 2ON8A 3R8BA 4ZRKA 3APFA 2Z8LA 3RZFA 2WX0A 1WXSA 2ZVOA 1YX5B 1VR9A 1QLBB 2JY6A 4XX5A 3GS2A 3VDZA 3FILB 3N1XC 2CJNA 3MJ5A 3QX1A 1QZEA 4A20A 3ML8A 2UYZB 1A5RA 2DHZA 4LJPB 3L10B 3QK0A 2QILA 1IBXA 3P1MA 3BWUD 4G11A 2ZW0A 1T3QA 2G4DB 3AULA 3ZNHB 1XT9B 2E3TA 3ZRCA 3TMPB 2KN5A 3I3TB 3MC8A 3PZ7A 2C60A 4XC2A 1CZPA 1GNUA 1N6ZA 4AUQC 2MLBA 1I42A 2LI5A 1YN5A 2R2QA 2L7RA 2KDIA 3ALBA 4AJYB 1E8WA 3W1SC 4ANXA 1FO4A 3PT2B 1NYQA 1AWDA 2PMVA 1WGDA 2KX3A 4ZRQA 1YJJA 3PLVA 2MX2A 3RCZA 4YL8A 1OQRA 3PLUA 3BY4B 5J17A 1PDXA 5C2TB 1N63A 3ETRA 2W55A 4GN1A 1XD3B 3R2TA 1UWMA 4DBGA 2G45B 2N7EA 2J0JA 4HJGE 1P3QU 2D3BA 2O6VA 4MH0E 1KOTA 1D4BA 4CQNA 5T8IA 1V5TA 1LGRA 4OW0A 3NS1A 1TKYA 1GOZA 3HVZA 3ZDMC 2CR5A 4IC7B 4XZ4A 1K50A 5D3IB 1T0QC 1E8ZA 1S1QB 5TSSA 2CHZA 1J7AA 4DQOC 3UGBB 1UNSA 3W5UB 1Y56A 4C4VB 2DZIA 3JSVA 4M01A 3IT6B 1D5MC 2NPTA 5HI1A 3SU8X 3RYTA 2JVCA 3PPAA 1N5WA 4ZRIA 2PVGC 4N59A 1T0SC 1E8YA 1V49A 2KQ7A 5IKCM 1C4AA 2KC2A 2LRUA 3W1SA 4G3XB 3R3MA 2G3QB 2VRRB 5FK9C 3B1LX 4HPPA 1C76A 2QMTA 3SFDB 4W9LA 3B0AA 3Q14C 4M8NA 1Q5WB 2IO0B 3U7ZA 1L0YB 1SB3C 4S17A 4XDCA 4G0NB 1HQRD 3D32A 1TZ1A 4MGIE 1YN3A 2GB1A 4WJNA 3MC9A 1J7CA 3ZIMA 3O65B 3QC8B 5G5GA 3SEBA 3ZO5B 2K8HA 3UQAA 2CU1A 1EM7A 2QC8A 3LYYA 4C4VA 2SEBD 4KGSA 3AE8B 2RPVA 3DHHC 2KTFA 2JXXA 1JALA 1CQVA 4US8A 3A9KA 1WJ4A 3EFCA 3LJ3A 3AV8A 2WU2B 3AH7A 4JL9A 2B76B 4O1NA 2K8CA 1P1AA 2GI9A 2HTME 3ZKJC 1TIFA 4B0MA 3TEWA 2GLSA 4LNIA 4EOYA 2PLPA 5LXIB 3TBLD 3KWVA 3ZDTA 3M95A 2K6DB 3QAQA 1UELA 2WXPA 1OQYA 2JSVX 1PUTA 2K9XA 3AI5A 3CSFA 1T0RC 2DAJA 1GC7A 2FE8A 2D11A 1WMHB 2PJHA 4HWIB 4RGMA 5MPOA 1EU3A 3UIOB 3M63B 2C7NB 2IYDB 2G9HD 4FN2A 3VTWA 2Z0EB 1YJ1A 1VZ8A 2WGSA 2RSUA 5D94A 3NG0A 1UBIA 3TUOA 3RN9C 3N20C 5C23A 2FCQA 2RD0A 2XNAC 2LJIA 2J4XA 1WF9A 4L23A 3Q8CA 1LM8B 1RFKA 4P7IA 2N9EB 1P0RA 2BS3B 2LD9A 1WGKA 2PKOA 1XEEA 4RM9A 3W2DA 2N9KA 2WLBA 1NI3A 2LASA 4CHKA 3OG5A 1XCTL 4M0WA 1EWCA 4LK0M 1MFWA 3TEYA 2KZRA 4N9F4 3H9DA 3Q8BA 2KJ6A 4DXGA 4ANVA 2M0XA 1IP9A 4ZYNA 3QJZA 4HVBA 1ET6A 3J9CA 1UH6A 1S3SG 4DWFA 1C78A 3VR9B 3KUDB 2M0AA 2V3NA 1L0XB 3W9CB 2DZKA 2MRPA 5EE9A 3SR6A 1C3TA 2FCMA 1C79A 5EE0A 3AE4B 2INCC 4DDID 3JYUA 5GMVA 1E90A 2GMIC 2RMMA 4B0EA 2MH7A 1TY2A 2NCNA 5D7GA 1LQBA 2M8SA 3WA0A 5EE1A 1PFDA 2HJ1A 2KFKA 2LGDA 1GAQB 3L0WB 1JRUA 3A1QB 4JWSC 3RNAC 4FBJB 2GRIA 3NRZA 4IOIE 3Q3OC 2BYTA 1WXVA 3E9SA 2V9HA 4OVVA 4IM0A 2BS2B 2AL6A 2KX0A 1K51A 1UZXB 4IW0A 3Q8FA 3Q8AA 3PRMB 2I1KA 5CHVC 5BMIA 2NS5A 3RMKC 1ISNA 1K8RB 5DPTA 3K9OB 1IPGA 1ZP0B 2DYBA 1WZ3A 2ZW1A 1TS2A 1CJEA 4TQ1A 2LVOA 2FCSA 5G55A 3DVGY 4KKJA 1QILA 2GBRA 5AZHA 1TY0A 2AL3A 3QHTA 5EE3A 1C9FA 3L13A 3NJTA 3ZW3A 1RRBA 5I4DA 2BYVE 2INPE 1DGJA 4NJ7A 4E3CA 1MG4A 1WR6E 4WJPA 2CU3A 1J8CA 2KWCA 3AE3B 3OLMD 4USAA 1N60A 2M4NA 1SE9A 1V97A 1XCQL 3QA8A 5G5HA 4P1CC 4W9IA 4ZOHC 4JPSA 1ZE3D 1WWTA 2WXOA 4OVUA 2MJ3A 4B9KA 4LNNA 5CHWA 4RMAA 3H1UA 2BTEA 5E6PA 4YTPB 2AQ2B 1LFDA 1TS4A 4KV2A 2FCNA 3Q8EA 2KDFB 2GBJA 1HA5A 4NAWA 2LXCA 3KUZA 1L2NA 2GBNA 4K1RB 1ZDVA 4A3PA 3DHGC 1N62A 1XO3A 3VUXA 1OEYJ 1D5XC 4YT0B 4TQ0A 2DZMA 3IFWB 2BS4B 5AZGA 3Q69A 1NENB 3JVZX 4FULA 1JWUD 1C77A 3H6NA 4IKGA 2INNE 1B9RA 2WP9B 3MFGA 3PGEA 1WGRA 1SGHA 3N9YC 4A3OA 3P4SB 4W9JA 2L8JA 1FM0D 3ZYYX 2W9NA 2EMTA 3VQIA 1P7EA 4BFRA 2O6VD 2N0SB 4WWNA 1E8XA 2NBWB 1SJHD 3ZNZB 4WQOB 1QKZA 2LVQA 2C7MB 3P4QB 2KQ4X 3VVWB 3U52E 4LCDE 4M8MA 4FHJA 3ZTDA 2PIAA 3M3JA 3IXSA 1XXGA 2JXTA 2I2YA 4FJYA 1SEBD 1HE8A 3W5VB 3IG3A 5IN7A 3A9KB 1WMHA 5BMHA 3O13A 1N61A 1EF1A 3DBLI 4EEWA 1YJIA 1IGCA 1RWSA 2XBBC 1QOFA 4HCPB 4DHJB
chains in the Genus database with same CATH topology
1UGMA 2AWTA 2KC1A 4BOZB 2CHZA 4W9KA 1WXAA 1RAXA 2L05A 4HLEA 1WJ6A 4IM3A 3UGBB 2IO3B 1EUVB 3VHTC 4ANUA 2DZIA 1YX6B 3IBEA 2AEHA 3JSVA 4HCNB 4K7SA 3OJ3A 4TV3A 2RGFA 4GDKB 4JLCA 1BT0A 2PPHA 2WDTB 1V5OA 2NPTA 3PV1A 1Z2MA 1ZW7A 3ZUNA 1CMXB 3SU8X 3RYTA 2JVCA 3PPAA 4GOCA 3X23A 1F9JA 3DPDA 2KMCA 2LXAA 4ZRIA 3V60A 4DHJD 1E8YA 2N9PC 1V49A 2KQ7A 3S2AA 4BKGA 2UWQA 1WRDB 4IM2A 2KC2A 2LRUA 2HD5B 2LWPA 3W1SA 5C1ZA 4G3XB 3R3MA 2G3QB 3WIMA 2VRRB 3QIJA 2EKEC 2KVRA 1KLVA 4AJWA 3DBSA 1WXMA 2IO2B 3Q3JA 4MEMA 3VTUA 4E71A 3B1LX 2O2VB 4E74A 4M0WB 4W9LA 3B0AA 5DPWA 4B95A 2V4LA 3W1YA 3JW0X 4M8NA 4NY0A 3VTVA 1Q5WB 4MELA 5KHOA 3R7RA 4GIVA 2IO0B 3PHXB 1NBFC 3C0RB 1WX9A 3VH4B 2MBQA 2BYEA 1XQQA 1KM7A 4G0NB 3D32A 3EHVA 1OGWA 2Z59B 1Z5SB 1TZ1A 4KZCA 5D6JB 1VD2A 4MGIE 4GDLA 4WJNA 2KFKB 3MJWA 3ZIMA 2KOXA 3VH3B 2CHXA 3O65B 3QC8B 2J7QB 3PRZA 4FHKA 1WM3A 2DAFA 2N9XA 3ZO5B 2K8HA 2ZJDA 2JZZA 2KWVB 2M17A 4KSLC 2CU1A 2DZJA 5LLIA 4BBNC 2REXA 3X0WA 1V6EA 3HK0A 3U7DA 4GB9A 3KUCB 3PREA 2HTHA 3QQ8B 2RPQA 4GMVA 4BKTA 3RUIB 4IWQA 3HM6X 4EZLA 1WE7A 2KTFA 2NR2A 3DOWA 2JXXA 3DVGX 3A9KA 1WJ4A 3LJ3A 2GBKA 1YD8U 4BKSD 3DBHI 3L16A 4KIKA 3N3KB 4JL9A 2QHOA 4KIKB 1R4NI 1RFAA 2CS4A 4PS8A 2ASQA 4J6IA 2K8CA 2AYOB 3R7QA 1P1AA 5DPSA 1GC6A 4W9GA 4GGQA 4JQWC 4NQLB 2N4FA 4IWOA 2V1YA 1EO6A 2ZVNA 2FAZA 3KYDD 3PTFC 4PYZA 3ZKJC 2BGFA 2NBVB 2LRWA 2Z0DB 2EMSA 2JUOA 4EOYA 5LXIB 2L3ZA 3TBLD 3ZDTA 4NNJB 2N7DA 3KYCD 2D3GA 3ZNGC 3M95A 2K6DB 3QAQA 1UELA 4PS3A 1OQYA 3KW5B 1Y8RC 3AI5A 3CSFA 2MW5A 2DAJA 1UBQA 2WYQA 1R4MI 1GC7A 1MG8A 2D11A 1GJZA 3ECIA 2FUHB 3SDLC 1WMHB 2BKRB 2PJHA 2JRIB 2KJHB 2OOBB 2C5LC 4HWIB 4F8CB 3UIOB 2LGXA 1AARA 2C7NB 2IYDB 3M63B 3MHSD 4FN2A 3VTWA 2MQJA 4MGKE 2Z0EB 1YJ1A 1V9JA 3VXWA 3ZRFA 4MGYE 2GBMA 2O2VA 3M62B 2RSUA 5D94A 1UBIA 4LDTB 2ZNVB 3DQVA 1Q1OA 4MSMB 2ZEQA 4CYEA 4LDTD 5C23A 2FCQA 2RD0A 2DX5B 1E7VA 1GG3A 4I6LB 1WF9A 2XK5A 3EFUA 4ZDVA 4PYUA 5L95C 1LM8B 3IVFA 4AOFA 4IG7B 2ZPNA 4P7IA 3APDA 2MCNB 2N9EB 3TL5A 3ENEA 1WZ0A 4TKNA 4GDLB 1P0RA 2LD9A 4BBNF 3HHMA 2MBHA 3PRPB 1V86A 4MSQB 2C9WB 2YVCA 3UIPB 4RM9A 5AEKB 2K8BA 3A9JB 4RM8A 4URKA 3PHWB 2BKFA 2IO1B 1P9DU 2LASA 1WYWB 3ZNID 4CHKA 2D2QA 3UF8A 5J18A 1IYFA 2MA9B 2KTRA 3PS6A 4DXAB 3ZTCA 3U8ZA 1G6JA 3VUYA 2L0FA 2XK5B 3JSVB 4KDLB 4K7WA 5E6NA 3NZSA 2KNBA 1I35A 2K39A 1SIFA 2JT4B 4NJ6A 4F7ZA 4W9HA 3AU4A 2KZRA 4W9DA 5CHFA 4HDQA 4CO7A 2R2OA 4N9F4 3H9DA 1WGGA 2KJ6A 3SD5A 1OEYA 4ANVA 5JZEB 1ZGUB 2WWZA 2M0XA 2Y5BB 3PZDA 5AZFA 1TGZB 2MBBB 2D10A 1IP9A 5IAAC 4ZYNA 1WGHA 3QJZA 4EKUA 4EZJA 4HVBA 1L7YA 2LVPA 1UH6A 4BKSA 3UINB 5DCNA 2MSED 1S3SG 4DWFA 3ZVVA 2WX1A 3KUDB 3V61A 3V6CB 1H4RA 2FNJB 4AWJA 3MTNB 2KMAA 3NS8A 3R66C 2DZKA 2MRPA 4ANWA 1E5WA 4DK5A 1C3TA 4KDIC 3APCA 2BYFA 2FCMA 5L83A 2O6VB 4K81A 3WANA 2KQSA 1YQBA 2JRHA 2PE9A 5DPRA 2DYOA 4B6WA 4W9FA 3VFKA 4DDID 2M1MA 3JYUA 2KJRA 4I6NB 1E90A 2K1FA 4TUUA 2GMIC 1EF5A 5GMVA 3RULA 2IZVB 2PE6B 4IUMB 1Q0WB 4MJSA 1UD7A 2NCNA 5D7GA 3V6EB 1LQBA 2M8SA 1P98A 3WA0A 3DDCB 4MGZE 2KFKA 2LGDA 5EDSA 3T8MA 2PEAA 3L0WB 1JRUA 3A1QB 3A9JA 3ML9A 4EFOA 4MM3A 2KK8A 4FBJB 2D07B 4EZKA 2KANA 4ICVA 3DVNU 1V2YA 1WXVA 2L00B 4OVVA 2JZ3B 4IM0A 2IY0B 4KSKC 4FA6A 2AL6A 2KX0A 1T0YA 5J2RA 1PQSA 3EECA 1UZXB 3P2BA 2DYMA 4IW0A 1WM2A 2ZCCA 4WJQA 3DVNV 1FXTB 5JHAA 2N1VA 1J19A 3PRMB 3QWZB 2I1KA 5CHVC 2ZPYA 4MJSB 2CKHB 2LUEA 1WIAA 2NS5A 1TTNA 3H7SA 4GXBA 3RZWC 3PVLA 4WJOA 5CX3A 5IA7A 3L17A 1ISNA 1K8RB 3N30A 3B08A 3NOBA 2GOWA 5DPTA 4DHZE 1KJTA 3K9OB 1IPGA 4JGHB 3CF6E 2DYBA 1WZ3A 3DBRI 3DCGA 4JIOU 3WAPA 3HIZA 2KHWB 4F1SA 2MWSB 3AXCA 4TQ1A 2KD0A 4FJVB 2KWUB 4GU2A 3A33B 3QCAA 5LXHA 2LVOA 2FCSA 2KDEB 4G50A 1OTRB 4LJOB 5G55A 1WFYA 3DVGY 4GSWA 3H7PB 1TBEA 1WH3A 4FADA 2GBRA 5AZHA 5TR5A 2LGYA 2AL3A 4X57B 2HE7A 2ZCBA 3QHTA 2G4SA 1LXDA 1D3ZA 5HKHA 3IHPC 3L13A 2V3SA 5G2NA 3ZW3A 1RRBA 2KLCA 2KKCA 2XEWA 2ZZPB 3KH0A 1WE6A 1ZKHA 1WR1A 2BYVE 2JPHA 1YIWA 3K9PB 2BPSA 4NJ7A 2JWZA 4E3CA 4AP4C 4BOSC 1WR6E 4NQKE 4WJPA 1J8CA 3OJ4B 3U30A 5E6OA 3A4RA 3KVFB 1H8CA 4II3B 2A5UA 2J0MA 2KWCA 4FJZA 4I6PA 2K25A 3ZLZA 3OLMD 2KXJA 3A4SC 3WALA 2RR9A 4WAAA 2KO3A 2M4NA 1SE9A 3WAOA 4WWPA 1U4AA 4ZRKA 5KHQA 3APFA 3QA8A 4DDGD 3RZFA 2WX0A 3NZUA 1WXSA 2NBUA 2ZVOA 1YX5B 3CMMB 4W9IA 1M94A 1VCBA 4MDKE 3OAWA 2OJRA 2KLGA 2JY6A 4XX5A 3VDZA 3TJPA 4OVUA 4W9EA 2JF5A 4B9KA 2K6QA 5CHWA 4RMAA 3H1UA 2MP2B 5E6PA 3AU5A 3SHQA 1GUAB 3QX1A 1QZEA 4A20A 1LFDA 1WX7A 2UYZB 3ML8A 2N1WA 4KV2A 4DHZB 2FCNA 1A5RA 4PS7A 2KDFB 2DHZA 2GBJA 4LJPB 4WWOA 3TCAA 3L10B 3QK0A 1WJNA 4EUTA 2HJ8A 1WJUA 2KTRB 1RLFA 3KUZA 1NDDA 2LXCA 3H7PA 4G11A 4NAWA 2GBNA 1L2NA 4K1RB 4A3PA 2G4DB 1WX8A 3VUXA 3AULA 3NHEB 1OEYJ 3ZNHB 4TQ0A 2I1JA 2NPTB 1XT9B 4FLHA 3TMPB 2KN5A 2DZMA 3IFWB 5D2MB 3ZRCA 3I3TB 5AZGA 1WY8A 2C60A 3PSEB 4XC2A 1GNUA 3JVZX 4ZRJA 2MBEA 3Q3FA 3VUWA 4AUQC 2MLBA 4FULA 1I42A 1C1YB 2LI5A 3H6NA 3UQBA 3RT3B 3VAWA 2R2QA 3PGEA 3ONSA 1WGRA 2KFJA 2L7RA 2KDIA 3ALBA 4AJYB 1E8WA 3CSTA 1SGHA 1E7UA 4HJKA 2LJ5A 1V81A 3PT2B 3W1SC 4ANXA 3UQAA 4NAWB 4A3OA 4W9JA 2NVUI 2L8JA 2W9NA 2EMTA 1WGDA 4HK2A 3VQIA 4IWPA 2L0TA 3L54A 4BFRA 2KX3A 2O6VD 2BF8B 5BO4B 3PLVA 2MX2A 1X1MA 2IY1B 1V80A 1E8XA 4WWNA 2NBWB 3RCZA 3L08A 4YL8A 3TIXA 3EC8A 2KDBA 4HPLB 4II2B 3PLUA 3ZNZB 4HDOA 2DENB 2ZNVC 3BY4B 4WQOB 2LVQA 4K7UA 2IBIB 2FIDA 4ICUA 4W9CA 2C7MB 3VVWB 3QARA 1WI0A 5J17A 4LCDE 4M8MA 5JHBA 4KVGB 4FHJA 3ZTDA 4ASWC 3M3JA 5CTRC 4GN1A 1XD3B 4DBGA 2G45B 2A4ZA 2YLMA 3V62A 2BWFA 2N7EA 2J0JA 4NPNA 5JH5C 4FJYA 1P3QU 2J0KA 2O6VA 4MH0E 1KOTA 1HE8A 3IG3A 2MBOA 5FR6A 1V5TA 2BWES 3WAMA 3A9KB 1WMHA 4GDKA 1J0GA 3RD2A 3NY5A 3BINA 3LDZE 1EF1A 3A1QA 3DBLI 4EEWA 1NI2A 3GOEA 2LZ6A 2FIFA 2XBBC 2B3AA 3N32A 2L76A 4HPMB 3T9LA 4BVUC 4HCPB 3HM3A 3GZNI 4HXDA 3ZDMC 4DHJB 2CHWA 2MP2A 2CR5A 4IC7B 2C7HA 1WGYA 4XZ4A 4KZ0A 1E8ZA 1S1QB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1UGM A;  2AWT A;  2KC1 A;  4BOZ B;  2CHZ A;  4W9K A;  1WXA A;  1RAX A;  2L05 A;  4HLE A;  1WJ6 A;  4IM3 A;  3UGB B;  2IO3 B;  1EUV B;  3VHT C;  4ANU A;  2DZI A;  1YX6 B;  3IBE A;  2AEH A;  3JSV A;  4HCN B;  4K7S A;  3OJ3 A;  4TV3 A;  2RGF A;  4GDK B;  4JLC A;  1BT0 A;  2PPH A;  2WDT B;  1V5O A;  2NPT A;  3PV1 A;  1Z2M A;  1ZW7 A;  3ZUN A;  1CMX B;  3SU8 X;  3RYT A;  2JVC A;  3PPA A;  4GOC A;  3X23 A;  1F9J A;  3DPD A;  2KMC A;  2LXA A;  4ZRI A;  3V60 A;  4DHJ D;  1E8Y A;  2N9P C;  1V49 A;  2KQ7 A;  3S2A A;  4BKG A;  2UWQ A;  1WRD B;  4IM2 A;  2KC2 A;  2LRU A;  2HD5 B;  2LWP A;  3W1S A;  5C1Z A;  4G3X B;  3R3M A;  2G3Q B;  3WIM A;  2VRR B;  3QIJ A;  2EKE C;  2KVR A;  1KLV A;  4AJW A;  3DBS A;  1WXM A;  2IO2 B;  3Q3J A;  4MEM A;  3VTU A;  4E71 A;  3B1L X;  2O2V B;  4E74 A;  4M0W B;  4W9L A;  3B0A A;  5DPW A;  4B95 A;  2V4L A;  3W1Y A;  3JW0 X;  4M8N A;  4NY0 A;  3VTV A;  1Q5W B;  4MEL A;  5KHO A;  3R7R A;  4GIV A;  2IO0 B;  3PHX B;  1NBF C;  3C0R B;  1WX9 A;  3VH4 B;  2MBQ A;  2BYE A;  1XQQ A;  1KM7 A;  4G0N B;  3D32 A;  3EHV A;  1OGW A;  2Z59 B;  1Z5S B;  1TZ1 A;  4KZC A;  5D6J B;  1VD2 A;  4MGI E;  4GDL A;  4WJN A;  2KFK B;  3MJW A;  3ZIM A;  2KOX A;  3VH3 B;  2CHX A;  3O65 B;  3QC8 B;  2J7Q B;  3PRZ A;  4FHK A;  1WM3 A;  2DAF A;  2N9X A;  3ZO5 B;  2K8H A;  2ZJD A;  2JZZ A;  2KWV B;  2M17 A;  4KSL C;  2CU1 A;  2DZJ A;  5LLI A;  4BBN C;  2REX A;  3X0W A;  1V6E A;  3HK0 A;  3U7D A;  4GB9 A;  3KUC B;  3PRE A;  2HTH A;  3QQ8 B;  2RPQ A;  4GMV A;  4BKT A;  3RUI B;  4IWQ A;  3HM6 X;  4EZL A;  1WE7 A;  2KTF A;  2NR2 A;  3DOW A;  2JXX A;  3DVG X;  3A9K A;  1WJ4 A;  3LJ3 A;  2GBK A;  1YD8 U;  4BKS D;  3DBH I;  3L16 A;  4KIK A;  3N3K B;  4JL9 A;  2QHO A;  4KIK B;  1R4N I;  1RFA A;  2CS4 A;  4PS8 A;  2ASQ A;  4J6I A;  2K8C A;  2AYO B;  3R7Q A;  1P1A A;  5DPS A;  1GC6 A;  4W9G A;  4GGQ A;  4JQW C;  4NQL B;  2N4F A;  4IWO A;  2V1Y A;  1EO6 A;  2ZVN A;  2FAZ A;  3KYD D;  3PTF C;  4PYZ A;  3ZKJ C;  2BGF A;  2NBV B;  2LRW A;  2Z0D B;  2EMS A;  2JUO A;  4EOY A;  5LXI B;  2L3Z A;  3TBL D;  3ZDT A;  4NNJ B;  2N7D A;  3KYC D;  2D3G A;  3ZNG C;  3M95 A;  2K6D B;  3QAQ A;  1UEL A;  4PS3 A;  1OQY A;  3KW5 B;  1Y8R C;  3AI5 A;  3CSF A;  2MW5 A;  2DAJ A;  1UBQ A;  2WYQ A;  1R4M I;  1GC7 A;  1MG8 A;  2D11 A;  1GJZ A;  3ECI A;  2FUH B;  3SDL C;  1WMH B;  2BKR B;  2PJH A;  2JRI B;  2KJH B;  2OOB B;  2C5L C;  4HWI B;  4F8C B;  3UIO B;  2LGX A;  1AAR A;  2C7N B;  2IYD B;  3M63 B;  3MHS D;  4FN2 A;  3VTW A;  2MQJ A;  4MGK E;  2Z0E B;  1YJ1 A;  1V9J A;  3VXW A;  3ZRF A;  4MGY E;  2GBM A;  2O2V A;  3M62 B;  2RSU A;  5D94 A;  1UBI A;  4LDT B;  2ZNV B;  3DQV A;  1Q1O A;  4MSM B;  2ZEQ A;  4CYE A;  4LDT D;  5C23 A;  2FCQ A;  2RD0 A;  2DX5 B;  1E7V A;  1GG3 A;  4I6L B;  1WF9 A;  2XK5 A;  3EFU A;  4ZDV A;  4PYU A;  5L95 C;  1LM8 B;  3IVF A;  4AOF A;  4IG7 B;  2ZPN A;  4P7I A;  3APD A;  2MCN B;  2N9E B;  3TL5 A;  3ENE A;  1WZ0 A;  4TKN A;  4GDL B;  1P0R A;  2LD9 A;  4BBN F;  3HHM A;  2MBH A;  3PRP B;  1V86 A;  4MSQ B;  2C9W B;  2YVC A;  3UIP B;  4RM9 A;  5AEK B;  2K8B A;  3A9J B;  4RM8 A;  4URK A;  3PHW B;  2BKF A;  2IO1 B;  1P9D U;  2LAS A;  1WYW B;  3ZNI D;  4CHK A;  2D2Q A;  3UF8 A;  5J18 A;  1IYF A;  2MA9 B;  2KTR A;  3PS6 A;  4DXA B;  3ZTC A;  3U8Z A;  1G6J A;  3VUY A;  2L0F A;  2XK5 B;  3JSV B;  4KDL B;  4K7W A;  5E6N A;  3NZS A;  2KNB A;  1I35 A;  2K39 A;  1SIF A;  2JT4 B;  4NJ6 A;  4F7Z A;  4W9H A;  3AU4 A;  2KZR A;  4W9D A;  5CHF A;  4HDQ A;  4CO7 A;  2R2O A;  4N9F 4;  3H9D A;  1WGG A;  2KJ6 A;  3SD5 A;  1OEY A;  4ANV A;  5JZE B;  1ZGU B;  2WWZ A;  2M0X A;  2Y5B B;  3PZD A;  5AZF A;  1TGZ B;  2MBB B;  2D10 A;  1IP9 A;  5IAA C;  4ZYN A;  1WGH A;  3QJZ A;  4EKU A;  4EZJ A;  4HVB A;  1L7Y A;  2LVP A;  1UH6 A;  4BKS A;  3UIN B;  5DCN A;  2MSE D;  1S3S G;  4DWF A;  3ZVV A;  2WX1 A;  3KUD B;  3V61 A;  3V6C B;  1H4R A;  2FNJ B;  4AWJ A;  3MTN B;  2KMA A;  3NS8 A;  3R66 C;  2DZK A;  2MRP A;  4ANW A;  1E5W A;  4DK5 A;  1C3T A;  4KDI C;  3APC A;  2BYF A;  2FCM A;  5L83 A;  2O6V B;  4K81 A;  3WAN A;  2KQS A;  1YQB A;  2JRH A;  2PE9 A;  5DPR A;  2DYO A;  4B6W A;  4W9F A;  3VFK A;  4DDI D;  2M1M A;  3JYU A;  2KJR A;  4I6N B;  1E90 A;  2K1F A;  4TUU A;  2GMI C;  1EF5 A;  5GMV A;  3RUL A;  2IZV B;  2PE6 B;  4IUM B;  1Q0W B;  4MJS A;  1UD7 A;  2NCN A;  5D7G A;  3V6E B;  1LQB A;  2M8S A;  1P98 A;  3WA0 A;  3DDC B;  4MGZ E;  2KFK A;  2LGD A;  5EDS A;  3T8M A;  2PEA A;  3L0W B;  1JRU A;  3A1Q B;  3A9J A;  3ML9 A;  4EFO A;  4MM3 A;  2KK8 A;  4FBJ B;  2D07 B;  4EZK A;  2KAN A;  4ICV A;  3DVN U;  1V2Y A;  1WXV A;  2L00 B;  4OVV A;  2JZ3 B;  4IM0 A;  2IY0 B;  4KSK C;  4FA6 A;  2AL6 A;  2KX0 A;  1T0Y A;  5J2R A;  1PQS A;  3EEC A;  1UZX B;  3P2B A;  2DYM A;  4IW0 A;  1WM2 A;  2ZCC A;  4WJQ A;  3DVN V;  1FXT B;  5JHA A;  2N1V A;  1J19 A;  3PRM B;  3QWZ B;  2I1K A;  5CHV C;  2ZPY A;  4MJS B;  2CKH B;  2LUE A;  1WIA A;  2NS5 A;  1TTN A;  3H7S A;  4GXB A;  3RZW C;  3PVL A;  4WJO A;  5CX3 A;  5IA7 A;  3L17 A;  1ISN A;  1K8R B;  3N30 A;  3B08 A;  3NOB A;  2GOW A;  5DPT A;  4DHZ E;  1KJT A;  3K9O B;  1IPG A;  4JGH B;  3CF6 E;  2DYB A;  1WZ3 A;  3DBR I;  3DCG A;  4JIO U;  3WAP A;  3HIZ A;  2KHW B;  4F1S A;  2MWS B;  3AXC A;  4TQ1 A;  2KD0 A;  4FJV B;  2KWU B;  4GU2 A;  3A33 B;  3QCA A;  5LXH A;  2LVO A;  2FCS A;  2KDE B;  4G50 A;  1OTR B;  4LJO B;  5G55 A;  1WFY A;  3DVG Y;  4GSW A;  3H7P B;  1TBE A;  1WH3 A;  4FAD A;  2GBR A;  5AZH A;  5TR5 A;  2LGY A;  2AL3 A;  4X57 B;  2HE7 A;  2ZCB A;  3QHT A;  2G4S A;  1LXD A;  1D3Z A;  5HKH A;  3IHP C;  3L13 A;  2V3S A;  5G2N A;  3ZW3 A;  1RRB A;  2KLC A;  2KKC A;  2XEW A;  2ZZP B;  3KH0 A;  1WE6 A;  1ZKH A;  1WR1 A;  2BYV E;  2JPH A;  1YIW A;  3K9P B;  2BPS A;  4NJ7 A;  2JWZ A;  4E3C A;  4AP4 C;  4BOS C;  1WR6 E;  4NQK E;  4WJP A;  1J8C A;  3OJ4 B;  3U30 A;  5E6O A;  3A4R A;  3KVF B;  1H8C A;  4II3 B;  2A5U A;  2J0M A;  2KWC A;  4FJZ A;  4I6P A;  2K25 A;  3ZLZ A;  3OLM D;  2KXJ A;  3A4S C;  3WAL A;  2RR9 A;  4WAA A;  2KO3 A;  2M4N A;  1SE9 A;  3WAO A;  4WWP A;  1U4A A;  4ZRK A;  5KHQ A;  3APF A;  3QA8 A;  4DDG D;  3RZF A;  2WX0 A;  3NZU A;  1WXS A;  2NBU A;  2ZVO A;  1YX5 B;  3CMM B;  4W9I A;  1M94 A;  1VCB A;  4MDK E;  3OAW A;  2OJR A;  2KLG A;  2JY6 A;  4XX5 A;  3VDZ A;  3TJP A;  4OVU A;  4W9E A;  2JF5 A;  4B9K A;  2K6Q A;  5CHW A;  4RMA A;  3H1U A;  2MP2 B;  5E6P A;  3AU5 A;  3SHQ A;  1GUA B;  3QX1 A;  1QZE A;  4A20 A;  1LFD A;  1WX7 A;  2UYZ B;  3ML8 A;  2N1W A;  4KV2 A;  4DHZ B;  2FCN A;  1A5R A;  4PS7 A;  2KDF B;  2DHZ A;  2GBJ A;  4LJP B;  4WWO A;  3TCA A;  3L10 B;  3QK0 A;  1WJN A;  4EUT A;  2HJ8 A;  1WJU A;  2KTR B;  1RLF A;  3KUZ A;  1NDD A;  2LXC A;  3H7P A;  4G11 A;  4NAW A;  2GBN A;  1L2N A;  4K1R B;  4A3P A;  2G4D B;  1WX8 A;  3VUX A;  3AUL A;  3NHE B;  1OEY J;  3ZNH B;  4TQ0 A;  2I1J A;  2NPT B;  1XT9 B;  4FLH A;  3TMP B;  2KN5 A;  2DZM A;  3IFW B;  5D2M B;  3ZRC A;  3I3T B;  5AZG A;  1WY8 A;  2C60 A;  3PSE B;  4XC2 A;  1GNU A;  3JVZ X;  4ZRJ A;  2MBE A;  3Q3F A;  3VUW A;  4AUQ C;  2MLB A;  4FUL A;  1I42 A;  1C1Y B;  2LI5 A;  3H6N A;  3UQB A;  3RT3 B;  3VAW A;  2R2Q A;  3PGE A;  3ONS A;  1WGR A;  2KFJ A;  2L7R A;  2KDI A;  3ALB A;  4AJY B;  1E8W A;  3CST A;  1SGH A;  1E7U A;  4HJK A;  2LJ5 A;  1V81 A;  3PT2 B;  3W1S C;  4ANX A;  3UQA A;  4NAW B;  4A3O A;  4W9J A;  2NVU I;  2L8J A;  2W9N A;  2EMT A;  1WGD A;  4HK2 A;  3VQI A;  4IWP A;  2L0T A;  3L54 A;  4BFR A;  2KX3 A;  2O6V D;  2BF8 B;  5BO4 B;  3PLV A;  2MX2 A;  1X1M A;  2IY1 B;  1V80 A;  1E8X A;  4WWN A;  2NBW B;  3RCZ A;  3L08 A;  4YL8 A;  3TIX A;  3EC8 A;  2KDB A;  4HPL B;  4II2 B;  3PLU A;  3ZNZ B;  4HDO A;  2DEN B;  2ZNV C;  3BY4 B;  4WQO B;  2LVQ A;  4K7U A;  2IBI B;  2FID A;  4ICU A;  4W9C A;  2C7M B;  3VVW B;  3QAR A;  1WI0 A;  5J17 A;  4LCD E;  4M8M A;  5JHB A;  4KVG B;  4FHJ A;  3ZTD A;  4ASW C;  3M3J A;  5CTR C;  4GN1 A;  1XD3 B;  4DBG A;  2G45 B;  2A4Z A;  2YLM A;  3V62 A;  2BWF A;  2N7E A;  2J0J A;  4NPN A;  5JH5 C;  4FJY A;  1P3Q U;  2J0K A;  2O6V A;  4MH0 E;  1KOT A;  1HE8 A;  3IG3 A;  2MBO A;  5FR6 A;  1V5T A;  2BWE S;  3WAM A;  3A9K B;  1WMH A;  4GDK A;  1J0G A;  3RD2 A;  3NY5 A;  3BIN A;  3LDZ E;  1EF1 A;  3A1Q A;  3DBL I;  4EEW A;  1NI2 A;  3GOE A;  2LZ6 A;  2FIF A;  2XBB C;  2B3A A;  3N32 A;  2L76 A;  4HPM B;  3T9L A;  4BVU C;  4HCP B;  3HM3 A;  3GZN I;  4HXD A;  3ZDM C;  4DHJ B;  2CHW A;  2MP2 A;  2CR5 A;  4IC7 B;  2C7H A;  1WGY A;  4XZ4 A;  4KZ0 A;  1E8Z A;  1S1Q B; 
#chains in the Genus database with same CATH topology
 1SBB B;  1UGM A;  4BOZ B;  1KTK A;  1WXA A;  4HLE A;  2AX5 A;  1KLG D;  4HCN B;  1YOV B;  1L4D B;  4JLC A;  3AE9 B;  3B2G A;  2PPH A;  2D3A A;  3PV1 A;  1ZW7 A;  2NTT A;  2CJO A;  3C8Y A;  3X23 A;  2KMC A;  1YNT E;  4C7Z A;  1WRD B;  4IM2 A;  4MM3 B;  2BVC A;  2HD5 B;  2LWP A;  4A90 A;  5C1Z A;  1E7P B;  2H88 B;  2W3R A;  3WIM A;  3QIJ A;  2EKE C;  4HKZ E;  2IO2 B;  4MEM A;  4E71 A;  3VTU A;  1YQ3 B;  2EKI A;  2WQY B;  4E74 A;  3B2F A;  1EU4 A;  3JW0 X;  1YN4 A;  3VTV A;  4MEL A;  5KHO A;  3R7R A;  3C0R B;  1WX9 A;  2MBQ A;  1OQQ A;  1OGW A;  4KZC A;  1Z5S B;  5D6J B;  3PO0 A;  3MJW A;  3VH3 B;  2CHX A;  1YQ4 B;  2J7Q B;  1WM3 A;  2ZJD A;  5LLI A;  2M17 A;  4KSL C;  1V6E A;  3U7D A;  2W54 A;  3KUC B;  2HTH A;  3Q3M C;  2Q5W D;  2RPQ A;  3VRA B;  4IWQ A;  3HM6 X;  2NR2 A;  3IAM 1;  2E6X A;  2JU6 X;  3P63 A;  3NVY A;  1YD8 U;  3L16 A;  4KIK A;  3BVG A;  4PS8 A;  4OHJ A;  1L0V B;  4J6I A;  3P4R B;  1MI0 A;  1VJK A;  2L1A A;  2AYO B;  5DPS A;  3GB1 A;  4W9G A;  1EO6 A;  2KDM A;  1FMA D;  2Z0D B;  4NNJ B;  2N7D A;  3FC4 A;  2D3G A;  4PS3 A;  3ZJT A;  3TSS A;  3Q6B A;  1UBQ A;  1R4M I;  1MG8 A;  2LGI A;  4C00 A;  2FUH B;  3SDL C;  2JRI B;  4F8C B;  1E6E B;  3V05 A;  2WHI A;  4MGK E;  4C56 C;  1V9J A;  3ZRF A;  1MHX A;  3AE5 B;  3AB5 A;  3M62 B;  2WXJ A;  4LDT B;  1Q1O A;  4MSM B;  4CYE A;  5BYS A;  1E7V A;  4LNF A;  1XLP A;  2XK5 A;  2VH1 A;  3FIL A;  4AOF A;  2WNM A;  2ZPN A;  2LUM A;  3APD A;  3TL5 A;  3ENE A;  1WZ0 A;  2N7J A;  4GDL B;  3HHM A;  2C9W B;  5AEK B;  2IO1 B;  1XLN A;  1WYW B;  3UF8 A;  2WDQ B;  1WYG A;  3BZD B;  4XGA B;  2MA9 B;  2KTR A;  2QSD A;  3ZTC A;  3U8Z A;  1G6J A;  3FKY A;  2BB6 A;  2XK5 B;  1K52 A;  1FNU A;  3NZS A;  2KNB A;  1I35 A;  2K39 A;  2JT4 B;  2KVZ A;  5CHF A;  4HDQ A;  4CO7 A;  3SD5 A;  1OEY A;  5AZF A;  2Y5B B;  3PZD A;  1TGZ B;  2MBB B;  2D10 A;  1ACC A;  5IAA C;  5E6J A;  3UIN B;  3AED B;  4P1B C;  3V6C B;  3V61 A;  2FNJ B;  3MTN B;  2L52 A;  3R66 C;  2BQQ A;  3NVV A;  1E5W A;  4KDI C;  3APC A;  1FFV A;  2LEK A;  4K81 A;  1PGB A;  2WXK A;  4B6W A;  4W9F A;  2M1M A;  4I6N B;  3BVM A;  3RUL A;  2PE6 B;  4MJS A;  3EA6 A;  3AMZ A;  5LNK 1;  2PEA A;  2LHE A;  1UWX A;  4EFO A;  2KK8 A;  1R4M B;  4EZK A;  1HEZ E;  4XYC A;  2DNF A;  3EEC A;  4JX1 C;  3AEC B;  2DYM A;  1WM2 A;  2H89 B;  4RGO S;  3DVN V;  5JHA A;  1BXT A;  4M00 A;  3I5J C;  4ZYS A;  1KH0 A;  2LUE A;  2FBW B;  2W3S A;  3VRB B;  5IA7 A;  1ROE A;  3AEG B;  4WWM A;  1IGD A;  3AE6 B;  3DBR I;  3WAP A;  3HIZ A;  3AXC A;  5HFY A;  1EWY C;  2KAC A;  2KWU B;  3AE1 B;  3A33 B;  3AE7 B;  5LXH A;  2KDE B;  2R61 A;  1OTR B;  4G50 A;  3H7P B;  1F2R I;  4A6Q A;  2X8X X;  5TR5 A;  3DBH B;  2LGY A;  4X57 B;  4HRO A;  1D3Z A;  5HKH A;  1V1P B;  1ZXI A;  2JPH A;  2WXQ A;  3K9P B;  1E0Z A;  4AP4 C;  4BOS C;  4NQK E;  3OJ4 B;  5E6O A;  3A4R A;  4HEA 1;  1GB1 A;  1H8C A;  4II3 B;  2A5U A;  2J0M A;  1V8C A;  3ZLZ A;  2KXJ A;  4WAA A;  1AW7 A;  4A9A A;  2WXM A;  4WWP A;  3WAO A;  5KHQ A;  4DDG D;  3NZU A;  2QJL A;  2KT7 A;  2YEP F;  3OAW A;  2OJR A;  1E9M A;  4W9E A;  2JF5 A;  2KMM A;  3SHQ A;  3AU5 A;  4L1B A;  1GUA B;  2RDG A;  3MC0 B;  1WX7 A;  2K3U A;  1KRH A;  4EE2 A;  1WJN A;  4EUT A;  2HJ8 A;  1WJU A;  1NDD A;  1TYG B;  3H7P A;  4HKQ A;  1WX8 A;  1FD6 A;  2NPT B;  4FLH A;  3VR8 B;  3I63 C;  2QDF A;  2DBY A;  2Y5C A;  1XF5 L;  4NJC A;  2MBE A;  1V1P A;  3VUW A;  4PK1 A;  2X38 A;  1C1Y B;  3ZQ4 A;  3BK1 A;  1C4P A;  3UQB A;  3RT3 B;  4JWU C;  3VAW A;  3ONS A;  3CST A;  1E7U A;  1OFF A;  1T5X D;  2LJ5 A;  4OVZ A;  2N9L A;  1J7B A;  4IWP A;  4YWG G;  4YSX B;  2TSS A;  2IY1 B;  2OED A;  1V80 A;  4WH4 A;  3L08 A;  4HPL B;  1DOI A;  4A8X C;  2DEN B;  3ZXV A;  2IBI B;  4ICU A;  4W9C A;  1JWA D;  3QAR A;  1WI0 A;  1STE A;  5JHB A;  4KVG B;  4ASW C;  1KLU D;  3RNE C;  1VZ7 A;  2LFI A;  2YLM A;  3V62 A;  1FXA A;  4NPN A;  5JH5 C;  2J52 A;  3AN1 A;  2J0K A;  4DXF A;  3KQ4 A;  2YEP B;  1FNV A;  3R2I A;  2WXG A;  3WAM A;  4GDK A;  1P7F A;  2KYW A;  3NY5 A;  3RD2 A;  3LDZ E;  3GP7 A;  5IO9 A;  2LZ6 A;  1I4P A;  3I57 A;  3N32 A;  2L76 A;  4HPM B;  3T9L A;  1L6U A;  3HM3 A;  3GZN I;  3B9J A;  4KZ0 A;  3RPF C;  2AWT A;  2KC1 A;  1RAX A;  2L05 A;  3P4P B;  4IM3 A;  1EUV B;  1QT9 A;  3IBE A;  2AEH A;  3OJ3 A;  2RGF A;  1BT0 A;  2WDT B;  1V5O A;  3DBR B;  3ZUN A;  1BML C;  3T3N A;  1VDV A;  4GOC A;  1FCC C;  1FFU A;  3DWG C;  2N9P C;  5JXV A;  4RGN A;  3S2A A;  4BKG A;  2WU5 B;  3LXF A;  2KVR A;  3BII D;  1WXM A;  1I4G A;  1CK1 A;  2Y3A A;  2DWQ A;  4B95 A;  1ZDX A;  4NY0 A;  1M4V A;  4GIV A;  1FRR A;  1NBF C;  3VH4 B;  1Q10 A;  3EHV A;  2PVO D;  2Z59 B;  4GDL A;  1JWM D;  2KFK B;  2KOX A;  1FIQ A;  2N9X A;  4BBN C;  2JZZ A;  2DZJ A;  3X0W A;  1AN8 A;  1B1Z A;  3QQ8 B;  3ZJU A;  1JQ4 A;  3RUI B;  5AUK A;  4EZL A;  1HTO A;  3DOW A;  1DOX A;  3DVG X;  2GBK A;  1NVI D;  3DBH I;  2KWD A;  1SF0 A;  1R4N I;  1QF6 A;  3LB8 C;  1JWB D;  4GGQ A;  4JQW C;  4NQL B;  1SE2 A;  3AM9 A;  2FAZ A;  4PYZ A;  1YMH E;  2IDY A;  4WUR A;  5HG2 A;  2LHD A;  2LRW A;  5BYR A;  2L3Z A;  3AEE B;  3KYC D;  3KWL A;  3KW5 B;  3NUH B;  2MW5 A;  2WYQ A;  1GJZ A;  3Q2A C;  4XWT A;  2XN9 C;  3T3O A;  4P6V F;  1QOG A;  5D3D A;  1AAR A;  3MHS D;  2OJW A;  4TSS A;  1SJE D;  1QOB A;  1FNW A;  2GBM A;  2O2V A;  5H92 C;  2JWU A;  1A70 A;  4RNA A;  1GG3 A;  1F2R C;  5L95 C;  4YXD B;  2IJ0 A;  1SSN A;  3IVF A;  4YTN B;  2MCN B;  1GPX A;  4TKN A;  1NEK B;  3RNG C;  2MBH A;  1TS3 A;  4MSQ B;  3UIP B;  1VZ6 A;  2K8B A;  1DOY A;  4URK A;  3PHW B;  2I38 A;  1P9D U;  2D2Q A;  5J18 A;  1QQR A;  3PS6 A;  1TKE A;  2IGD A;  1T6B X;  2WDV B;  4K7W A;  5E6N A;  5IP4 D;  1I4R A;  4NJ6 A;  3CWI A;  2R2O A;  5BMG A;  1WGG A;  1HTQ A;  1ZGU B;  4EZJ A;  2J42 A;  1L7Y A;  2MSE D;  1TJE A;  2WX1 A;  4N58 A;  1LO5 D;  2LMC A;  4AWJ A;  1SE3 A;  3NS8 A;  1XLQ A;  1JW9 D;  3HVD A;  1KF6 B;  1FEH A;  1YQB A;  1TZO A;  4JE3 B;  2DYO A;  2EEL A;  3VFK A;  2K1F A;  5J2R A;  2WS3 B;  4IUM B;  1Q0W B;  1UD7 A;  1D6E C;  3V6E B;  1P98 A;  3ABV B;  1ZPS A;  2D5G A;  2K22 A;  3NVZ A;  4MM3 A;  2D07 B;  2KAN A;  1IUE A;  3GE8 C;  3DVN U;  4ICV A;  4OZA A;  2L00 B;  2JZ3 B;  2IY0 B;  4KSK C;  4FA6 A;  3IT4 B;  4ARC A;  1PQS A;  3BYY B;  3P2B A;  2ZCC A;  1F1H A;  4WJQ A;  3WCQ A;  2AQ1 B;  3MP9 A;  2N1V A;  3N1Z C;  4AS1 A;  3QWZ B;  1HZ5 A;  3RNC C;  4MJS B;  2CKH B;  1WIA A;  4C80 A;  3H7S A;  4GXB A;  3PVL A;  4WJO A;  5CX3 A;  2PTL A;  3KLS X;  3N30 A;  3B08 A;  1KJT A;  2JYT A;  3CF6 E;  4PT5 A;  1PYW D;  4LNO A;  2V0G A;  2NMQ A;  2PW9 A;  4ARI A;  3AEF B;  5H8Y E;  3QCA A;  1JRO A;  1MJD A;  4LJO B;  1WFY A;  1JML A;  1TBE A;  1WH3 A;  4KGT A;  2HDE A;  2HE7 A;  2ZCB A;  1JWS D;  1LXD A;  1SE4 A;  3IHP C;  2V3S A;  3DBL B;  4WQM A;  2KLC A;  2KKC A;  3KH0 A;  4S0R A;  1WR1 A;  5HHD G;  2BPS A;  2JWZ A;  3HRD D;  1UGJ A;  3CIR B;  3EGR A;  2KN4 A;  3A4S C;  2BT6 A;  2KO3 A;  1U4A A;  2MJE A;  4J3O D;  1N5X A;  2NBU A;  1K53 A;  3CMM B;  1M94 A;  1VCB A;  4MDK E;  5FKA C;  2KLG A;  3TJP A;  4XWW A;  2K6Q A;  4ZHP A;  2MP2 B;  3P42 A;  2BBC A;  2N1W A;  3U4E G;  4DHZ B;  2ONQ A;  4PS7 A;  3DWM A;  3TCA A;  4R3D A;  4WWO A;  4C7Y A;  2KTR B;  1RLF A;  2VH2 A;  2WXF A;  2QEJ C;  3NHE B;  2LGS A;  2I1J A;  4KGR A;  1KFY B;  1ZUD 2;  5D2M B;  1WY8 A;  3PSE B;  5IOI A;  3AEB B;  1FXI A;  4ZRJ A;  2KAJ A;  3HUI A;  3Q3F A;  1ZOY B;  4KKI A;  3RNF C;  2KFJ A;  1QOA A;  4HJK A;  1I4H A;  1BUI C;  1V81 A;  4NAW B;  4HRS A;  2NVU I;  4HK2 A;  5C3J B;  2L0T A;  3L4P A;  2L83 A;  3L54 A;  3AEA B;  2BF8 B;  4BZA A;  5BO4 B;  1X1M A;  3TIX A;  3EC8 A;  2KDB A;  4ITK A;  4II2 B;  2MHJ A;  4HDO A;  2ZNV C;  4K7U A;  2FID A;  2MEK A;  4YTM B;  1JRP A;  3V3X A;  5CTR C;  2BB5 A;  2A4Z A;  2BWF A;  1TS5 A;  3BYT B;  4XDD A;  2MJD A;  2RDH A;  2MBO A;  5FR6 A;  2BWE S;  1J0G A;  1I4X A;  3BIN A;  3A1Q A;  1NI2 A;  4RCO A;  1L4Z B;  3GOE A;  2FIF A;  2B3A A;  4BVU C;  4HXD A;  3NVW A;  2CHW A;  2MP2 A;  2C7H A;  1WGY A;  1I4Q A;  4XE0 A;  4DHJ D;  1E10 A;  4W9K A;  1WJ6 A;  2IO3 B;  1ENF A;  3VHT C;  4ANU A;  1YX6 B;  1L5P A;  1PGA A;  2BW2 A;  4K7S A;  4TV3 A;  4GDK B;  2VZK D;  3URY A;  4NAM A;  1Z2M A;  1CMX B;  4ZRP A;  4RGT A;  1F9J A;  3DPD A;  2LXA A;  3SFE B;  3V60 A;  3ZXR A;  2K0P A;  2UWQ A;  4K3B A;  3RNB C;  2V3P A;  4OZB A;  2SAK A;  1HZ6 A;  1KLV A;  4AJW A;  3DBS A;  3Q3J A;  2O2V B;  3Q3N C;  1JCK B;  4M0W B;  3TEX A;  5DPW A;  2V4L A;  3W1Y A;  1L6V A;  3PHX B;  2BYE A;  1XQQ A;  1KM7 A;  1R4N B;  1SXT A;  5AUI A;  1VD2 A;  1AYF A;  1F77 A;  4US9 A;  2ACZ B;  3E56 A;  1R7S A;  4FHK A;  3PRZ A;  2DAF A;  2KWV B;  2REX A;  3HK0 A;  4GB9 A;  3PRE A;  2FUG 1;  4GMV A;  3I9V 1;  4BKT A;  1WE7 A;  5FR3 A;  2NTS A;  1WRI A;  1TKG A;  3UI3 A;  4BKS D;  3N3K B;  2QHO A;  4KIK B;  1RFA A;  2CS4 A;  4BAX A;  2ASQ A;  2JZP A;  4YSY B;  4UDU C;  4MT5 A;  3R7Q A;  1GC6 A;  3U2S C;  4IDI A;  2N4F A;  4IWO A;  4M02 A;  2V1Y A;  2Y5P A;  2ZVN A;  2AQ3 B;  3KYD D;  3PTF C;  2BGF A;  2NBV B;  1MHH E;  2EMS A;  2JUO A;  2IGH A;  3ZNG C;  3C19 A;  4MAC A;  1Y8R C;  1D5Z C;  4AQ7 A;  1WSP A;  3ECI A;  3GE3 C;  4L2Y A;  2BKR B;  3IAS 1;  3OWE B;  3PZ8 A;  4WIP A;  2KJH B;  2OOB B;  2C5L C;  2WXR A;  2LGX A;  4RF1 A;  4D2K A;  1RYJ A;  2MQJ A;  1SIJ A;  1DYQ A;  3VXW A;  4NZL B;  4MGY E;  2UU7 A;  2JYE A;  2ZNV B;  3DQV A;  3FAH A;  2ZEQ A;  4LNK A;  4LDT D;  2DX5 B;  4I6L B;  3EFU A;  4ZDV A;  4PYU A;  4ZHO A;  4IG7 B;  3ZJV A;  2IND C;  4BBN F;  3PRP B;  1V86 A;  4P16 A;  3ZGZ A;  3RI7 C;  2YVC A;  1F0Z A;  1I7H A;  3A9J B;  4RM8 A;  2BKF A;  3ZNI D;  2JX5 A;  3NZ3 A;  4RF0 A;  1IYF A;  4DXA B;  4Q2J A;  3VUY A;  2L0F A;  4KDL B;  2JQR B;  3JSV B;  1GB4 A;  1SIF A;  4FXC A;  4LTU A;  4F7Z A;  4W9H A;  3AU4 A;  4W9D A;  3BK2 A;  4RH6 A;  2VZK B;  2DLB A;  5JZE B;  2WWZ A;  2OHF A;  2QIE B;  1FPY A;  4A55 A;  1PGX A;  1WGH A;  4EKU A;  4YSZ B;  2LVP A;  4RFB A;  4H2A A;  4BKS A;  5DCN A;  3ZVV A;  1H4R A;  2KMA A;  4ANW A;  1XLO A;  4DK5 A;  3BVZ A;  1HXY D;  2ICI A;  2BYF A;  2V4I B;  5L83 A;  2O6V B;  3WAN A;  2KQS A;  3N1Y C;  1TT5 B;  2JRH A;  2PE9 A;  5DPR A;  2WXL A;  2IGG A;  4LLG M;  4TUU A;  2K5P A;  1UUP A;  2KJR A;  1EF5 A;  2IZV B;  2M56 B;  4ACF A;  3DDC B;  4MGZ E;  5EDS A;  3T8M A;  3A9J A;  3ML9 A;  2WXN A;  1MVK A;  1F52 A;  2QCZ A;  4TMA B;  1ZXH A;  1C4C A;  1V2Y A;  1IBX B;  1T0Y A;  4REZ A;  4K3C A;  1VLB A;  1FXT B;  1UF0 A;  3GZN B;  5BYQ A;  1J19 A;  1VRA B;  2D3C A;  2ZPY A;  1V1O A;  2M19 A;  1TTN A;  2WXH A;  4N6E B;  3RZW C;  3TEZ A;  3L17 A;  2IPK D;  3NOB A;  2GOW A;  4DHZ E;  4JGH B;  3DCG A;  2J53 A;  4JIO U;  3RFZ B;  2KHW B;  4F1S A;  2MWS B;  3DHI C;  2KD0 A;  2G1E A;  4FJV B;  4GU2 A;  1MPE A;  2W82 A;  1NYR A;  1FCL A;  4KX6 B;  4GSW A;  4FAD A;  2WXI A;  4OZC A;  1ESF A;  2WDR B;  5GXG B;  2G4S A;  1RM6 C;  5G2N A;  3H8H A;  4GLS C;  2XEW A;  2ZZP B;  1WE6 A;  2L32 A;  1ZKH A;  1YIW A;  1FRD A;  4MH8 A;  3AE2 B;  3U30 A;  2RDB C;  3EUB 2;  3KVF B;  4QAY A;  4FJZ A;  4I6P A;  2K25 A;  4WAF A;  1WXQ A;  3WAL A;  2RR9 A;  1ET9 A;  3MHZ A;  2ON8 A;  3R8B A;  4ZRK A;  3APF A;  2Z8L A;  3RZF A;  2WX0 A;  1WXS A;  2ZVO A;  1YX5 B;  1VR9 A;  1QLB B;  2JY6 A;  4XX5 A;  3GS2 A;  3VDZ A;  3FIL B;  3N1X C;  2CJN A;  3MJ5 A;  3QX1 A;  1QZE A;  4A20 A;  3ML8 A;  2UYZ B;  1A5R A;  2DHZ A;  4LJP B;  3L10 B;  3QK0 A;  2QIL A;  1IBX A;  3P1M A;  3BWU D;  4G11 A;  2ZW0 A;  1T3Q A;  2G4D B;  3AUL A;  3ZNH B;  1XT9 B;  2E3T A;  3ZRC A;  3TMP B;  2KN5 A;  3I3T B;  3MC8 A;  3PZ7 A;  2C60 A;  4XC2 A;  1CZP A;  1GNU A;  1N6Z A;  4AUQ C;  2MLB A;  1I42 A;  2LI5 A;  1YN5 A;  2R2Q A;  2L7R A;  2KDI A;  3ALB A;  4AJY B;  1E8W A;  3W1S C;  4ANX A;  1FO4 A;  3PT2 B;  1NYQ A;  1AWD A;  2PMV A;  1WGD A;  2KX3 A;  4ZRQ A;  1YJJ A;  3PLV A;  2MX2 A;  3RCZ A;  4YL8 A;  1OQR A;  3PLU A;  3BY4 B;  5J17 A;  1PDX A;  5C2T B;  1N63 A;  3ETR A;  2W55 A;  4GN1 A;  1XD3 B;  3R2T A;  1UWM A;  4DBG A;  2G45 B;  2N7E A;  2J0J A;  4HJG E;  1P3Q U;  2D3B A;  2O6V A;  4MH0 E;  1KOT A;  1D4B A;  4CQN A;  5T8I A;  1V5T A;  1LGR A;  4OW0 A;  3NS1 A;  1TKY A;  1GOZ A;  3HVZ A;  3ZDM C;  2CR5 A;  4IC7 B;  4XZ4 A;  1K50 A;  5D3I B;  1T0Q C;  1E8Z A;  1S1Q B;  5TSS A;  2CHZ A;  1J7A A;  4DQO C;  3UGB B;  1UNS A;  3W5U B;  1Y56 A;  4C4V B;  2DZI A;  3JSV A;  4M01 A;  3IT6 B;  1D5M C;  2NPT A;  5HI1 A;  3SU8 X;  3RYT A;  2JVC A;  3PPA A;  1N5W A;  4ZRI A;  2PVG C;  4N59 A;  1T0S C;  1E8Y A;  1V49 A;  2KQ7 A;  5IKC M;  1C4A A;  2KC2 A;  2LRU A;  3W1S A;  4G3X B;  3R3M A;  2G3Q B;  2VRR B;  5FK9 C;  3B1L X;  4HPP A;  1C76 A;  2QMT A;  3SFD B;  4W9L A;  3B0A A;  3Q14 C;  4M8N A;  1Q5W B;  2IO0 B;  3U7Z A;  1L0Y B;  1SB3 C;  4S17 A;  4XDC A;  4G0N B;  1HQR D;  3D32 A;  1TZ1 A;  4MGI E;  1YN3 A;  2GB1 A;  4WJN A;  3MC9 A;  1J7C A;  3ZIM A;  3O65 B;  3QC8 B;  5G5G A;  3SEB A;  3ZO5 B;  2K8H A;  3UQA A;  2CU1 A;  1EM7 A;  2QC8 A;  3LYY A;  4C4V A;  2SEB D;  4KGS A;  3AE8 B;  2RPV A;  3DHH C;  2KTF A;  2JXX A;  1JAL A;  1CQV A;  4US8 A;  3A9K A;  1WJ4 A;  3EFC A;  3LJ3 A;  3AV8 A;  2WU2 B;  3AH7 A;  4JL9 A;  2B76 B;  4O1N A;  2K8C A;  1P1A A;  2GI9 A;  2HTM E;  3ZKJ C;  1TIF A;  4B0M A;  3TEW A;  2GLS A;  4LNI A;  4EOY A;  2PLP A;  5LXI B;  3TBL D;  3KWV A;  3ZDT A;  3M95 A;  2K6D B;  3QAQ A;  1UEL A;  2WXP A;  1OQY A;  2JSV X;  1PUT A;  2K9X A;  3AI5 A;  3CSF A;  1T0R C;  2DAJ A;  1GC7 A;  2FE8 A;  2D11 A;  1WMH B;  2PJH A;  4HWI B;  4RGM A;  5MPO A;  1EU3 A;  3UIO B;  3M63 B;  2C7N B;  2IYD B;  2G9H D;  4FN2 A;  3VTW A;  2Z0E B;  1YJ1 A;  1VZ8 A;  2WGS A;  2RSU A;  5D94 A;  3NG0 A;  1UBI A;  3TUO A;  3RN9 C;  3N20 C;  5C23 A;  2FCQ A;  2RD0 A;  2XNA C;  2LJI A;  2J4X A;  1WF9 A;  4L23 A;  3Q8C A;  1LM8 B;  1RFK A;  4P7I A;  2N9E B;  1P0R A;  2BS3 B;  2LD9 A;  1WGK A;  2PKO A;  1XEE A;  4RM9 A;  3W2D A;  2N9K A;  2WLB A;  1NI3 A;  2LAS A;  4CHK A;  3OG5 A;  1XCT L;  4M0W A;  1EWC A;  4LK0 M;  1MFW A;  3TEY A;  2KZR A;  4N9F 4;  3H9D A;  3Q8B A;  2KJ6 A;  4DXG A;  4ANV A;  2M0X A;  1IP9 A;  4ZYN A;  3QJZ A;  4HVB A;  1ET6 A;  3J9C A;  1UH6 A;  1S3S G;  4DWF A;  1C78 A;  3VR9 B;  3KUD B;  2M0A A;  2V3N A;  1L0X B;  3W9C B;  2DZK A;  2MRP A;  5EE9 A;  3SR6 A;  1C3T A;  2FCM A;  1C79 A;  5EE0 A;  3AE4 B;  2INC C;  4DDI D;  3JYU A;  5GMV A;  1E90 A;  2GMI C;  2RMM A;  4B0E A;  2MH7 A;  1TY2 A;  2NCN A;  5D7G A;  1LQB A;  2M8S A;  3WA0 A;  5EE1 A;  1PFD A;  2HJ1 A;  2KFK A;  2LGD A;  1GAQ B;  3L0W B;  1JRU A;  3A1Q B;  4JWS C;  3RNA C;  4FBJ B;  2GRI A;  3NRZ A;  4IOI E;  3Q3O C;  2BYT A;  1WXV A;  3E9S A;  2V9H A;  4OVV A;  4IM0 A;  2BS2 B;  2AL6 A;  2KX0 A;  1K51 A;  1UZX B;  4IW0 A;  3Q8F A;  3Q8A A;  3PRM B;  2I1K A;  5CHV C;  5BMI A;  2NS5 A;  3RMK C;  1ISN A;  1K8R B;  5DPT A;  3K9O B;  1IPG A;  1ZP0 B;  2DYB A;  1WZ3 A;  2ZW1 A;  1TS2 A;  1CJE A;  4TQ1 A;  2LVO A;  2FCS A;  5G55 A;  3DVG Y;  4KKJ A;  1QIL A;  2GBR A;  5AZH A;  1TY0 A;  2AL3 A;  3QHT A;  5EE3 A;  1C9F A;  3L13 A;  3NJT A;  3ZW3 A;  1RRB A;  5I4D A;  2BYV E;  2INP E;  1DGJ A;  4NJ7 A;  4E3C A;  1MG4 A;  1WR6 E;  4WJP A;  2CU3 A;  1J8C A;  2KWC A;  3AE3 B;  3OLM D;  4USA A;  1N60 A;  2M4N A;  1SE9 A;  1V97 A;  1XCQ L;  3QA8 A;  5G5H A;  4P1C C;  4W9I A;  4ZOH C;  4JPS A;  1ZE3 D;  1WWT A;  2WXO A;  4OVU A;  2MJ3 A;  4B9K A;  4LNN A;  5CHW A;  4RMA A;  3H1U A;  2BTE A;  5E6P A;  4YTP B;  2AQ2 B;  1LFD A;  1TS4 A;  4KV2 A;  2FCN A;  3Q8E A;  2KDF B;  2GBJ A;  1HA5 A;  4NAW A;  2LXC A;  3KUZ A;  1L2N A;  2GBN A;  4K1R B;  1ZDV A;  4A3P A;  3DHG C;  1N62 A;  1XO3 A;  3VUX A;  1OEY J;  1D5X C;  4YT0 B;  4TQ0 A;  2DZM A;  3IFW B;  2BS4 B;  5AZG A;  3Q69 A;  1NEN B;  3JVZ X;  4FUL A;  1JWU D;  1C77 A;  3H6N A;  4IKG A;  2INN E;  1B9R A;  2WP9 B;  3MFG A;  3PGE A;  1WGR A;  1SGH A;  3N9Y C;  4A3O A;  3P4S B;  4W9J A;  2L8J A;  1FM0 D;  3ZYY X;  2W9N A;  2EMT A;  3VQI A;  1P7E A;  4BFR A;  2O6V D;  2N0S B;  4WWN A;  1E8X A;  2NBW B;  1SJH D;  3ZNZ B;  4WQO B;  1QKZ A;  2LVQ A;  2C7M B;  3P4Q B;  2KQ4 X;  3VVW B;  3U52 E;  4LCD E;  4M8M A;  4FHJ A;  3ZTD A;  2PIA A;  3M3J A;  3IXS A;  1XXG A;  2JXT A;  2I2Y A;  4FJY A;  1SEB D;  1HE8 A;  3W5V B;  3IG3 A;  5IN7 A;  3A9K B;  1WMH A;  5BMH A;  3O13 A;  1N61 A;  1EF1 A;  3DBL I;  4EEW A;  1YJI A;  1IGC A;  1RWS A;  2XBB C;  1QOF A;  4HCP B;  4DHJ B; 
#chains in the Genus database with same CATH homology
 1UGM A;  2AWT A;  2KC1 A;  4BOZ B;  2CHZ A;  4W9K A;  1WXA A;  1RAX A;  2L05 A;  4HLE A;  1WJ6 A;  4IM3 A;  3UGB B;  2IO3 B;  1EUV B;  3VHT C;  4ANU A;  2DZI A;  1YX6 B;  3IBE A;  2AEH A;  3JSV A;  4HCN B;  4K7S A;  3OJ3 A;  4TV3 A;  2RGF A;  4GDK B;  4JLC A;  1BT0 A;  2PPH A;  2WDT B;  1V5O A;  2NPT A;  3PV1 A;  1Z2M A;  1ZW7 A;  3ZUN A;  1CMX B;  3SU8 X;  3RYT A;  2JVC A;  3PPA A;  4GOC A;  3X23 A;  1F9J A;  3DPD A;  2KMC A;  2LXA A;  4ZRI A;  3V60 A;  4DHJ D;  1E8Y A;  2N9P C;  1V49 A;  2KQ7 A;  3S2A A;  4BKG A;  2UWQ A;  1WRD B;  4IM2 A;  2KC2 A;  2LRU A;  2HD5 B;  2LWP A;  3W1S A;  5C1Z A;  4G3X B;  3R3M A;  2G3Q B;  3WIM A;  2VRR B;  3QIJ A;  2EKE C;  2KVR A;  1KLV A;  4AJW A;  3DBS A;  1WXM A;  2IO2 B;  3Q3J A;  4MEM A;  3VTU A;  4E71 A;  3B1L X;  2O2V B;  4E74 A;  4M0W B;  4W9L A;  3B0A A;  5DPW A;  4B95 A;  2V4L A;  3W1Y A;  3JW0 X;  4M8N A;  4NY0 A;  3VTV A;  1Q5W B;  4MEL A;  5KHO A;  3R7R A;  4GIV A;  2IO0 B;  3PHX B;  1NBF C;  3C0R B;  1WX9 A;  3VH4 B;  2MBQ A;  2BYE A;  1XQQ A;  1KM7 A;  4G0N B;  3D32 A;  3EHV A;  1OGW A;  2Z59 B;  1Z5S B;  1TZ1 A;  4KZC A;  5D6J B;  1VD2 A;  4MGI E;  4GDL A;  4WJN A;  2KFK B;  3MJW A;  3ZIM A;  2KOX A;  3VH3 B;  2CHX A;  3O65 B;  3QC8 B;  2J7Q B;  3PRZ A;  4FHK A;  1WM3 A;  2DAF A;  2N9X A;  3ZO5 B;  2K8H A;  2ZJD A;  2JZZ A;  2KWV B;  2M17 A;  4KSL C;  2CU1 A;  2DZJ A;  5LLI A;  4BBN C;  2REX A;  3X0W A;  1V6E A;  3HK0 A;  3U7D A;  4GB9 A;  3KUC B;  3PRE A;  2HTH A;  3QQ8 B;  2RPQ A;  4GMV A;  4BKT A;  3RUI B;  4IWQ A;  3HM6 X;  4EZL A;  1WE7 A;  2KTF A;  2NR2 A;  3DOW A;  2JXX A;  3DVG X;  3A9K A;  1WJ4 A;  3LJ3 A;  2GBK A;  1YD8 U;  4BKS D;  3DBH I;  3L16 A;  4KIK A;  3N3K B;  4JL9 A;  2QHO A;  4KIK B;  1R4N I;  1RFA A;  2CS4 A;  4PS8 A;  2ASQ A;  4J6I A;  2K8C A;  2AYO B;  3R7Q A;  1P1A A;  5DPS A;  1GC6 A;  4W9G A;  4GGQ A;  4JQW C;  4NQL B;  2N4F A;  4IWO A;  2V1Y A;  1EO6 A;  2ZVN A;  2FAZ A;  3KYD D;  3PTF C;  4PYZ A;  3ZKJ C;  2BGF A;  2NBV B;  2LRW A;  2Z0D B;  2EMS A;  2JUO A;  4EOY A;  5LXI B;  2L3Z A;  3TBL D;  3ZDT A;  4NNJ B;  2N7D A;  3KYC D;  2D3G A;  3ZNG C;  3M95 A;  2K6D B;  3QAQ A;  1UEL A;  4PS3 A;  1OQY A;  3KW5 B;  1Y8R C;  3AI5 A;  3CSF A;  2MW5 A;  2DAJ A;  1UBQ A;  2WYQ A;  1R4M I;  1GC7 A;  1MG8 A;  2D11 A;  1GJZ A;  3ECI A;  2FUH B;  3SDL C;  1WMH B;  2BKR B;  2PJH A;  2JRI B;  2KJH B;  2OOB B;  2C5L C;  4HWI B;  4F8C B;  3UIO B;  2LGX A;  1AAR A;  2C7N B;  2IYD B;  3M63 B;  3MHS D;  4FN2 A;  3VTW A;  2MQJ A;  4MGK E;  2Z0E B;  1YJ1 A;  1V9J A;  3VXW A;  3ZRF A;  4MGY E;  2GBM A;  2O2V A;  3M62 B;  2RSU A;  5D94 A;  1UBI A;  4LDT B;  2ZNV B;  3DQV A;  1Q1O A;  4MSM B;  2ZEQ A;  4CYE A;  4LDT D;  5C23 A;  2FCQ A;  2RD0 A;  2DX5 B;  1E7V A;  1GG3 A;  4I6L B;  1WF9 A;  2XK5 A;  3EFU A;  4ZDV A;  4PYU A;  5L95 C;  1LM8 B;  3IVF A;  4AOF A;  4IG7 B;  2ZPN A;  4P7I A;  3APD A;  2MCN B;  2N9E B;  3TL5 A;  3ENE A;  1WZ0 A;  4TKN A;  4GDL B;  1P0R A;  2LD9 A;  4BBN F;  3HHM A;  2MBH A;  3PRP B;  1V86 A;  4MSQ B;  2C9W B;  2YVC A;  3UIP B;  4RM9 A;  5AEK B;  2K8B A;  3A9J B;  4RM8 A;  4URK A;  3PHW B;  2BKF A;  2IO1 B;  1P9D U;  2LAS A;  1WYW B;  3ZNI D;  4CHK A;  2D2Q A;  3UF8 A;  5J18 A;  1IYF A;  2MA9 B;  2KTR A;  3PS6 A;  4DXA B;  3ZTC A;  3U8Z A;  1G6J A;  3VUY A;  2L0F A;  2XK5 B;  3JSV B;  4KDL B;  4K7W A;  5E6N A;  3NZS A;  2KNB A;  1I35 A;  2K39 A;  1SIF A;  2JT4 B;  4NJ6 A;  4F7Z A;  4W9H A;  3AU4 A;  2KZR A;  4W9D A;  5CHF A;  4HDQ A;  4CO7 A;  2R2O A;  4N9F 4;  3H9D A;  1WGG A;  2KJ6 A;  3SD5 A;  1OEY A;  4ANV A;  5JZE B;  1ZGU B;  2WWZ A;  2M0X A;  2Y5B B;  3PZD A;  5AZF A;  1TGZ B;  2MBB B;  2D10 A;  1IP9 A;  5IAA C;  4ZYN A;  1WGH A;  3QJZ A;  4EKU A;  4EZJ A;  4HVB A;  1L7Y A;  2LVP A;  1UH6 A;  4BKS A;  3UIN B;  5DCN A;  2MSE D;  1S3S G;  4DWF A;  3ZVV A;  2WX1 A;  3KUD B;  3V61 A;  3V6C B;  1H4R A;  2FNJ B;  4AWJ A;  3MTN B;  2KMA A;  3NS8 A;  3R66 C;  2DZK A;  2MRP A;  4ANW A;  1E5W A;  4DK5 A;  1C3T A;  4KDI C;  3APC A;  2BYF A;  2FCM A;  5L83 A;  2O6V B;  4K81 A;  3WAN A;  2KQS A;  1YQB A;  2JRH A;  2PE9 A;  5DPR A;  2DYO A;  4B6W A;  4W9F A;  3VFK A;  4DDI D;  2M1M A;  3JYU A;  2KJR A;  4I6N B;  1E90 A;  2K1F A;  4TUU A;  2GMI C;  1EF5 A;  5GMV A;  3RUL A;  2IZV B;  2PE6 B;  4IUM B;  1Q0W B;  4MJS A;  1UD7 A;  2NCN A;  5D7G A;  3V6E B;  1LQB A;  2M8S A;  1P98 A;  3WA0 A;  3DDC B;  4MGZ E;  2KFK A;  2LGD A;  5EDS A;  3T8M A;  2PEA A;  3L0W B;  1JRU A;  3A1Q B;  3A9J A;  3ML9 A;  4EFO A;  4MM3 A;  2KK8 A;  4FBJ B;  2D07 B;  4EZK A;  2KAN A;  4ICV A;  3DVN U;  1V2Y A;  1WXV A;  2L00 B;  4OVV A;  2JZ3 B;  4IM0 A;  2IY0 B;  4KSK C;  4FA6 A;  2AL6 A;  2KX0 A;  1T0Y A;  5J2R A;  1PQS A;  3EEC A;  1UZX B;  3P2B A;  2DYM A;  4IW0 A;  1WM2 A;  2ZCC A;  4WJQ A;  3DVN V;  1FXT B;  5JHA A;  2N1V A;  1J19 A;  3PRM B;  3QWZ B;  2I1K A;  5CHV C;  2ZPY A;  4MJS B;  2CKH B;  2LUE A;  1WIA A;  2NS5 A;  1TTN A;  3H7S A;  4GXB A;  3RZW C;  3PVL A;  4WJO A;  5CX3 A;  5IA7 A;  3L17 A;  1ISN A;  1K8R B;  3N30 A;  3B08 A;  3NOB A;  2GOW A;  5DPT A;  4DHZ E;  1KJT A;  3K9O B;  1IPG A;  4JGH B;  3CF6 E;  2DYB A;  1WZ3 A;  3DBR I;  3DCG A;  4JIO U;  3WAP A;  3HIZ A;  2KHW B;  4F1S A;  2MWS B;  3AXC A;  4TQ1 A;  2KD0 A;  4FJV B;  2KWU B;  4GU2 A;  3A33 B;  3QCA A;  5LXH A;  2LVO A;  2FCS A;  2KDE B;  4G50 A;  1OTR B;  4LJO B;  5G55 A;  1WFY A;  3DVG Y;  4GSW A;  3H7P B;  1TBE A;  1WH3 A;  4FAD A;  2GBR A;  5AZH A;  5TR5 A;  2LGY A;  2AL3 A;  4X57 B;  2HE7 A;  2ZCB A;  3QHT A;  2G4S A;  1LXD A;  1D3Z A;  5HKH A;  3IHP C;  3L13 A;  2V3S A;  5G2N A;  3ZW3 A;  1RRB A;  2KLC A;  2KKC A;  2XEW A;  2ZZP B;  3KH0 A;  1WE6 A;  1ZKH A;  1WR1 A;  2BYV E;  2JPH A;  1YIW A;  3K9P B;  2BPS A;  4NJ7 A;  2JWZ A;  4E3C A;  4AP4 C;  4BOS C;  1WR6 E;  4NQK E;  4WJP A;  1J8C A;  3OJ4 B;  3U30 A;  5E6O A;  3A4R A;  3KVF B;  1H8C A;  4II3 B;  2A5U A;  2J0M A;  2KWC A;  4FJZ A;  4I6P A;  2K25 A;  3ZLZ A;  3OLM D;  2KXJ A;  3A4S C;  3WAL A;  2RR9 A;  4WAA A;  2KO3 A;  2M4N A;  1SE9 A;  3WAO A;  4WWP A;  1U4A A;  4ZRK A;  5KHQ A;  3APF A;  3QA8 A;  4DDG D;  3RZF A;  2WX0 A;  3NZU A;  1WXS A;  2NBU A;  2ZVO A;  1YX5 B;  3CMM B;  4W9I A;  1M94 A;  1VCB A;  4MDK E;  3OAW A;  2OJR A;  2KLG A;  2JY6 A;  4XX5 A;  3VDZ A;  3TJP A;  4OVU A;  4W9E A;  2JF5 A;  4B9K A;  2K6Q A;  5CHW A;  4RMA A;  3H1U A;  2MP2 B;  5E6P A;  3AU5 A;  3SHQ A;  1GUA B;  3QX1 A;  1QZE A;  4A20 A;  1LFD A;  1WX7 A;  2UYZ B;  3ML8 A;  2N1W A;  4KV2 A;  4DHZ B;  2FCN A;  1A5R A;  4PS7 A;  2KDF B;  2DHZ A;  2GBJ A;  4LJP B;  4WWO A;  3TCA A;  3L10 B;  3QK0 A;  1WJN A;  4EUT A;  2HJ8 A;  1WJU A;  2KTR B;  1RLF A;  3KUZ A;  1NDD A;  2LXC A;  3H7P A;  4G11 A;  4NAW A;  2GBN A;  1L2N A;  4K1R B;  4A3P A;  2G4D B;  1WX8 A;  3VUX A;  3AUL A;  3NHE B;  1OEY J;  3ZNH B;  4TQ0 A;  2I1J A;  2NPT B;  1XT9 B;  4FLH A;  3TMP B;  2KN5 A;  2DZM A;  3IFW B;  5D2M B;  3ZRC A;  3I3T B;  5AZG A;  1WY8 A;  2C60 A;  3PSE B;  4XC2 A;  1GNU A;  3JVZ X;  4ZRJ A;  2MBE A;  3Q3F A;  3VUW A;  4AUQ C;  2MLB A;  4FUL A;  1I42 A;  1C1Y B;  2LI5 A;  3H6N A;  3UQB A;  3RT3 B;  3VAW A;  2R2Q A;  3PGE A;  3ONS A;  1WGR A;  2KFJ A;  2L7R A;  2KDI A;  3ALB A;  4AJY B;  1E8W A;  3CST A;  1SGH A;  1E7U A;  4HJK A;  2LJ5 A;  1V81 A;  3PT2 B;  3W1S C;  4ANX A;  3UQA A;  4NAW B;  4A3O A;  4W9J A;  2NVU I;  2L8J A;  2W9N A;  2EMT A;  1WGD A;  4HK2 A;  3VQI A;  4IWP A;  2L0T A;  3L54 A;  4BFR A;  2KX3 A;  2O6V D;  2BF8 B;  5BO4 B;  3PLV A;  2MX2 A;  1X1M A;  2IY1 B;  1V80 A;  1E8X A;  4WWN A;  2NBW B;  3RCZ A;  3L08 A;  4YL8 A;  3TIX A;  3EC8 A;  2KDB A;  4HPL B;  4II2 B;  3PLU A;  3ZNZ B;  4HDO A;  2DEN B;  2ZNV C;  3BY4 B;  4WQO B;  2LVQ A;  4K7U A;  2IBI B;  2FID A;  4ICU A;  4W9C A;  2C7M B;  3VVW B;  3QAR A;  1WI0 A;  5J17 A;  4LCD E;  4M8M A;  5JHB A;  4KVG B;  4FHJ A;  3ZTD A;  4ASW C;  3M3J A;  5CTR C;  4GN1 A;  1XD3 B;  4DBG A;  2G45 B;  2A4Z A;  2YLM A;  3V62 A;  2BWF A;  2N7E A;  2J0J A;  4NPN A;  5JH5 C;  4FJY A;  1P3Q U;  2J0K A;  2O6V A;  4MH0 E;  1KOT A;  1HE8 A;  3IG3 A;  2MBO A;  5FR6 A;  1V5T A;  2BWE S;  3WAM A;  3A9K B;  1WMH A;  4GDK A;  1J0G A;  3RD2 A;  3NY5 A;  3BIN A;  3LDZ E;  1EF1 A;  3A1Q A;  3DBL I;  4EEW A;  1NI2 A;  3GOE A;  2LZ6 A;  2FIF A;  2XBB C;  2B3A A;  3N32 A;  2L76 A;  4HPM B;  3T9L A;  4BVU C;  4HCP B;  3HM3 A;  3GZN I;  4HXD A;  3ZDM C;  4DHJ B;  2CHW A;  2MP2 A;  2CR5 A;  4IC7 B;  2C7H A;  1WGY A;  4XZ4 A;  4KZ0 A;  1E8Z A;  1S1Q B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...