5DPRA

Crystal structure of plekhm1 lir-fused human lc3a_2-121
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
124
structure length
124
Chain Sequence
EWVNVGSPSDRPFKQRRSFADRCKEVQQIRDQHPSKIPVIIERYKGEKQLPVLDKTKFLVPDHVNMSELVKIIRRRLQLNPTQAFFLLVNQHSMVSVSTPIADIYEQEKDEDGFLYMVYASQET
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Pleckstrin homology domain-containing family M member 1,Micr
publication title Structural and functional analysis of the GABARAP interaction motif (GIM).
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein binding
total genus 29
structure length 124
sequence length 124
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2015-09-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02991 Atg8 Autophagy protein Atg8 ubiquitin like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 5dprA00
1P3QU 1WR1A 4FHJA 2A4ZA 4NAWA 1V5OA 3RT3B 2J0MA 2FCNA 4F1SA 4FBJB 3N30A 5CTRC 4FADA 3QWZB 2LASA 4MGZE 2MBQA 4BBNC 2Z0EB 2O2VB 4KZCA 2LI5A 2XK5A 2K6DB 3I3TB 4K1RB 2ZPYA 4FLHA 1WH3A 3PREA 2A5UA 1Q5WB 2G4DB 1EO6A 4OVVA 5G2NA 4EOYA 2AWTA 5J18A 1TGZB 4A3PA 2NBVB 3BY4B 4OVUA 5D94A 1WMHB 2AL6A 3S2AA 2YVCA 4MSQB 2N7EA 4WQOB 3T9LA 3ECIA 1RLFA 4JGHB 2L0TA 3BINA 2KTFA 1V86A 2LGDA 2MBHA 4BKSD 1GUAB 1E7VA 3A9KA 3HM6X 1YJ1A 1P1AA 1S1QB 2JRIB 3DVNU 1OGWA 2KWUB 2O6VD 2JUOA 4IM2A 2LD9A 2KFKA 2KJHB 4NQLB 3KYDD 3VAWA 3LDZE 1YX5B 2FNJB 2NCNA 1Z2MA 2HJ8A 3PRZA 3JSVA 3NZSA 3A1QB 1E8YA 1V81A 3H7PA 1WE7A 5AZGA 5EDSA 3EHVA 1V2YA 2KWCA 3DVGX 2OJRA 1XD3B 3KUZA 3ZNID 4W9GA 3EECA 2MP2B 5G55A 3R3MA 4WWOA 2IY0B 3PV1A 2PE9A 4RMAA 4WAAA 2KN5A 2M4NA 3VTUA 2RD0A 2C5LC 2HD5B 2KKCA 3JVZX 2MCNB 1GC6A 3TIXA 4B6WA 4K7WA 1H8CA 1YIWA 4K7UA 2LZ6A 3VH3B 4DBGA 4RM9A 4HJKA 2C7HA 2M17A 1UZXB 4DXAB 4P7IA 4ZDVA 3KVFB 2MA9B 5DPWA 1SE9A 1R4MI 5BO4B 4TKNA 2LGYA 5CHWA 2IO2B 1C3TA 3ZRFA 3NS8A 4EEWA 1V9JA 1WX9A 1ISNA 2EMSA 2KDEB 1YD8U 2WDTB 1I42A 2KO3A 4GDKA 4BBNF 1KM7A 1UH6A 2KDFB 4HPLB 4LDTB 2NPTA 4DHJD 2K8BA 4HWIB 3U7DA 2KDBA 1ZGUB 3DBHI 3IHPC 4FJVB 4E74A 2BKRB 3ML9A 4PS8A 1OEYJ 4X57B 5E6OA 1A5RA 4EZKA 2LRWA 3WAPA 3R7QA 1H4RA 2GBMA 3VDZA 3UIOB 4A3OA 2WYQA 4MH0E 4CHKA 2JPHA 4WJOA 4M8MA 2LVOA 2NBWB 3A4RA 1WE6A 2KLGA 3DQVA 2GOWA 4ICVA 1L7YA 3Q3JA 3SDLC 3ZNGC 4IG7B 2CKHB 1E8WA 3TJPA 5DPRA 3RD2A 4ZRKA 2IO0B 3UQBA 4NQKE 4DHZB 3ZRCA 3WA0A 2N9PC 4NJ7A 2N1VA 4TUUA 1ZW7A 2KTRA 4ICUA 1UBIA 1WGRA 2N7DA 3OJ4B 4G0NB 5AZHA 3X23A 4BKSA 4EFOA 1IYFA 2KVRA 5E6NA 1VD2A 4FJYA 2BYVE 1WX8A 3L08A 2N4FA 4WJNA 2O6VA 1SIFA 2I1KA 4NPNA 2DAJA 2IYDB 2KQSA 2LXAA 1WZ3A 3UINB 2KHWB 2XBBC 2KLCA 3UQAA 4XX5A 1TTNA 2Z0DB 3KYCD 5C23A 1RAXA 2ZNVC 3AXCA 1WYWB 4DDGD 4HXDA 4WJPA 5AEKB 2C7NB 3NZUA 2IO1B 3PS6A 4HCPB 3ZTDA 3SU8X 3L10B 4AWJA 2M0XA 3ZDMC 4HVBA 2DHZA 3L54A 3PHXB 2CHWA 1WGYA 2WX1A 2HE7A 2K8CA 1WM3A 2KFJA 2MW5A 4NAWB 1WRDB 4FN2A 2JRHA 3SHQA 1J19A 2DYOA 4AOFA 3MTNB 4G3XB 2J0KA 5JH5C 3VHTC 2MBBB 3NHEB 4BOZB 3RUIB 4ANVA 2D10A 4JLCA 2I1JA 2IO3B 4MDKE 5D2MB 1WZ0A 3DBRI 1C1YB 3DOWA 3DVNV 4IWOA 2XK5B 4NNJB 4XC2A 4MGKE 4PYZA 1HE8A 5DCNA 3QHTA 1GG3A 2KJ6A 2CHZA 3PTFC 2BWFA 3DVGY 4W9LA 5J2RA 2G45B 2LJ5A 3DBLI 4RM8A 2L3ZA 3PSEB 1Q0WB 2HTHA 4HPMB 3PLUA 4EUTA 3X0WA 3O65B 4II2B 1YX6B 4KDIC 4M0WB 2KWVB 3RCZA 1WGDA 3DBSA 4MM3A 1EUVB 2XEWA 2PPHA 4GU2A 4ZRJA 1NDDA 2DENB 4IC7B 3ZVVA 2GBKA 3A9KB 1WY8A 4IWPA 4KVGB 4TV3A 1WR6E 1J0GA 2LVQA 3ZLZA 3KW5B 4MJSA 1UBQA 2LWPA 1CMXB 4GN1A 4B95A 2KFKB 3WAOA 3PGEA 2EKEC 2L8JA 4II3B 4ANUA 1FXTB 1E8XA 1VCBA 4YL8A 2KX3A 3WAMA 2DZKA 3JSVB 2FIFA 3A33B 1F9JA 3H7PB 4GB9A 1V6EA 2KZRA 2BYFA 1WF9A 4W9CA 2Y5BB 2JVCA 3EC8A 2LGXA 3IG3A 1P9DU 5CHVC 2REXA 1T0YA 1YQBA 1EF5A 2BWES 4E3CA 1WJUA 4I6NB 3AU5A 4KIKA 3UIPB 2MQJA 1EF1A 2D3GA 2FIDA 2IY1B 3U8ZA 1WJNA 1WGHA 4ANWA 3Q3FA 2M8SA 3DPDA 2GBRA 1E5WA 2KC1A 2MBOA 1KJTA 4AUQC 1WIAA 2JZ3B 2FCSA 1PQSA 3B1LX 1QZEA 4IWQA 2DZJA 2JT4B 3A9JA 3P2BA 2WX0A 2UWQA 3PLVA 3WIMA 2L76A 4KZ0A 2RR9A 3IVFA 4URKA 2BKFA 3TL5A 2NS5A 3RZFA 3OLMD 3ZDTA 2K8HA 1V5TA 3V6EB 3H1UA 4KSLC 3UGBB 4W9EA 1KLVA 3HK0A 4K7SA 5L83A 3JYUA 2N9XA 2KNBA 5HKHA 2MBEA 1X1MA 4GDKB 2PEAA 1Y8RC 1E90A 2J7QB 4W9DA 2QHOA 5IA7A 4G11A 4GSWA 3H7SA 3M63B 2V3SA 2KMAA 2K39A 3AI5A 4EZJA 3W1YA 4ZYNA 2MX2A 4GDLA 2LVPA 5IAAC 1WM2A 4F8CB 4F7ZA 4NY0A 2ZVOA 3KUCB 3A4SC 2FCQA 3QA8A 1XQQA 3TBLD 2BPSA 2KDIA 4EZLA 4A20A 4LDTD 2IBIB 4HDQA 1BT0A 4PYUA 3L0WB 4CYEA 1KOTA 2FUHB 4GGQA 4KV2A 1WI0A 4B9KA 1GC7A 3RZWC 1JRUA 1L2NA 1WJ4A 4W9KA 2ASQA 2FCMA 2L0FA 2BYEA 4LJOB 3CF6E 4DWFA 3ZO5B 2GBNA 4M8NA 2AYOB 2JWZA 1OQYA 2KTRB 2NR2A 1WJ6A 3L13A 3QIJA 4MSMB 4AJWA 1J8CA 3ENEA 1WX7A 4DK5A 1Q1OA 2O2VA 2ZCBA 1WXSA 2BF8B 2JZZA 3ONSA 4FHKA 5FR6A 1RRBA 2O6VB 4J6IA 4MGYE 1V49A 2B3AA 4GMVA 4W9FA 3PRPB 2PE6B 4BVUC 4FA6A 1UELA 2J0JA 3TMPB 2N9EB 4LJPB 1S3SG 2DYBA 2KQ7A 1WMHA 3VTVA 2G4SA 3VUYA 1R4NI 4GIVA 3V61A 1K8RB 4CO7A 3KH0A 3APDA 3JW0X 4MELA 2DYMA 1V80A 1Z5SB 5E6PA 3ZNZB 1P0RA 5JHAA 1ZKHA 4I6PA 1OEYA 3OJ3A 5JHBA 3TCAA 4W9HA 1WXVA 4K81A 3C0RB 1WXMA 3EFUA 3AULA 1LFDA 5CHFA 1D3ZA 4HLEA 2KXJA 2JY6A 1E8ZA 2MLBA 4AJYB 2V4LA 3PPAA 2C7MB 3RULA 3V6CB 2GBJA 4IW0A 3VH4B 4ZRIA 2KC2A 3A1QA 4N9F4 2NVUI 3KUDB 4WWPA 3M3JA 3GOEA 3H6NA 3U30A 3VUWA 2Z59B 3R7RA 4BKTA 4BKGA 2IZVB 2D11A 2KANA 2MP2A 2RPQA 1OTRB 4LCDE 5LXIB 5JZEB 1M94A 2M1MA 2ZNVB 1WGGA 2CHXA 3RYTA 4NJ6A 5L95C 2RSUA 2C9WB 3N32A 1LM8B 3B0AA 4HK2A 4WJQA 2CS4A 2KJRA 2K1FA 2LRUA 3QC8B 4JIOU 4DHJB 3CSFA 4DHZE 4E71A 1UGMA 2CR5A 2L05A 4BOSC 2FAZA 3HIZA 4MEMA 1UD7A 3VVWB 5KHQA 2L00B 4AP4C 3H9DA 1SGHA 4MJSB 1TZ1A 2GMIC 2AL3A 1XT9B 5GMVA 3V60A 3K9PB 3MHSD 2W9NA 3W1SC 5C1ZA 1IPGA 2K25A 4I6LB 3OAWA 2DX5B 4DDID 3ML8A 3ZUNA 2ZZPB 3QX1A 4TQ0A 3APCA 4W9IA 4XZ4A 2EMTA 2KD0A 5LLIA 1TBEA 2ZEQA 4ASWC 5DPSA 2MSED 3M95A 4KIKB 3PVLA 1IP9A 3ZIMA 1E7UA 4IUMB 5AZFA 4EKUA 2ZPNA 3T8MA 3B08A 4KDLB 2ZCCA 4JL9A 3VFKA 3D32A 5LXHA 2KOXA 3MJWA 2L7RA 3QARA 3HHMA 4MGIE 4HCNB 2WWZA 1U4AA 4PS3A 2KX0A 2YLMA 3NY5A 5D6JB 5DPTA 2LUEA 2MRPA 2NPTB 1AARA 2RGFA 3A9JB 3QQ8B 3UF8A 3VQIA 4FJZA 5KHOA 2BGFA 2N1WA 1P98A 3CSTA 2AEHA 4BFRA 5J17A 2D2QA 2KMCA 2DZIA 3AU4A 1LQBA 3SD5A 3VXWA 3ZW3A 3W1SA 3PRMB 2PJHA 3L17A 2R2OA 3M62B 2OOBB 3ZNHB 1NI2A 4GXBA 1NBFC 1WFYA 3QK0A 3IBEA 4ANXA 3K9OB 2NBUA 1WXAA 1LXDA 2CU1A 3VUXA 4KSKC 1GNUA 3WALA 3ALBA 2MWSB 2ZVNA 1MG8A 3GZNI 4TQ1A 3VTWA 2ZJDA 3QCAA 4IM3A 3ZTCA 4G50A 3IFWB 3HM3A 3R66C 3V62A 4GDLB 2K6QA 2C60A 2DAFA 4WWNA 1RFAA 3PZDA 5D7GA 3DCGA 2LXCA 3QJZA 3CMMB 4JQWC 4GOCA 1I35A 4IM0A 4PS7A 1G6JA 5CX3A 3APFA 1GJZA 4W9JA 3L16A 3LJ3A 3PHWB 2D07B 2DZMA 2JXXA 3WANA 2UYZB 3QAQA 2KK8A 4HDOA 3N3KB 4FULA 3DDCB 3NOBA 2V1YA 3ZKJC 2G3QB 2JF5A 5TR5A 3PT2B 2VRRB 2R2QA
chains in the Genus database with same CATH superfamily
1P3QU 2A4ZA 1V5OA 3V05A 2J0MA 1YN5A 3NVZA 2OJWA 1UUPA 3N30A 4KKIA 2MJEA 2VZKB 2Z0EB 2K6DB 3I3TB 2ZPYA 3BIID 3DBHB 4EOYA 1EO6A 4A3PA 5D94A 1WMHB 2YVCA 4WQOB 3T9LA 3ECIA 1QQRA 1RLFA 2E3TA 2WP9B 4RGMA 2PVGC 1B1ZA 2DNFA 4KGRA 1I4GA 2O6VD 2KFKA 2NTSA 1HTOA 3KYDD 3AE3B 2FNJB 2W55A 3EA6A 1K51A 3FILA 5AZGA 1MJDA 1V2YA 2L1AA 1ZPSA 2OJRA 1ET9A 3ZNID 2WNMA 1ZXHA 3EECA 3Q8AA 2HD5B 3AE4B 3IT6B 3TIXA 1KFYB 4DBGA 2C7HA 1TYGB 1UZXB 1SE9A 1BUIC 4IOIE 2WXGA 5D3DA 3ZRFA 3BYTB 1V9JA 1YD8U 2UU7A 1KM7A 1UH6A 2XN9C 4DHJD 3I5JC 1T6BX 1E10A 3IHPC 4X57B 4JPSA 1PGBA 5T8IA 4A3OA 5E6JA 4CHKA 2WDRB 4M8MA 4RH6A 3OG5A 4A9AA 3ZJVA 1VRAB 2RDBC 1BMLC 1P7EA 2LGSA 5DPRA 3RD2A 3UQBA 4JWSC 3ZRCA 1JCKB 2WXRA 4YTNB 1QT9A 2N9PC 4NJ7A 1NENB 1VZ7A 1I7HA 4IDIA 3X23A 4EFOA 1TY0A 1CZPA 2KVRA 4FJYA 3FC4A 3TSSA 3MC8A 4XX5A 1RAXA 2ZNVC 2JX5A 4DDGD 2PTLA 2IO1B 3PS6A 3N1ZC 4HVBA 2DHZA 2WX1A 2HE7A 1WRDB 2ICIA 4OW0A 4FXCA 4HEA1 5JH5C 4BOZB 4ANVA 4JLCA 2I1JA 2IO3B 3V62A 1WZ0A 3DOWA 1C1YB 2GLSA 4IWOA 1ROEA 1QILA 4NNJB 1HEZE 1FRDA 2QJLA 2QCZA 4YSYB 1HE8A 4W9LA 3TUOA 2G45B 2Q5WD 3N20C 3Q3MC 2HTHA 3SFDB 4C7ZA 1WGDA 4GU2A 2EKIA 1NDDA 2VZKD 1YN3A 3W2DA 2DBYA 4GN1A 1KTKA 2KFKB 2WXQA 4YTPB 2EKEC 2L8JA 4II3B 3U52E 2KX3A 3AECB 2BYFA 4NAMA 4JWUC 3IG3A 3DWGC 2L32A 1T0YA 3NVYA 2FIDA 3U8ZA 1WGHA 2QIEB 4GLSC 2GBRA 2MBOA 1KJTA 1XLOA 5FKAC 2FCSA 1PQSA 3Q8CA 4IWQA 2JT4B 3CIRB 2WX0A 4DQOC 2RR9A 3IVFA 2BKFA 2IJ0A 1D6EC 3OLMD 3H1UA 4KSLC 4W9EA 1FO4A 1F0ZA 2KNBA 5HKHA 1X1MA 3I9V1 5IA7A 4G11A 4ZHPA 3B9JA 2V3SA 1D5XC 3AI5A 1HZ6A 3VR8B 4A8XC 4F7ZA 3NVWA 2ONQA 2KDIA 2N9KA 1YN4A 2W3RA 4HDQA 3MC9A 4PYUA 1VZ8A 3WCQA 1KRHA 3RZWC 2BYEA 2GBNA 2K0PA 1OQYA 1A70A 4BZAA 1JALA 2O2VA 3Q3NC 3P4PB 1WXSA 4KGTA 4J6IA 1D5ZC 2B3AA 1MG4A 5HFYA 1R4MB 2N9EB 2DYBA 1KH0A 3VR9B 1N60A 4OVZA 4CO7A 3APDA 2JXTA 1Z5SB 3GE8C 2MJ3A 5E6PA 2HDEA 4QAYA 2K3UA 4RF1A 4I6PA 4NJCA 4A55A 3T3OA 3C0RB 1C9FA 1WXMA 1QOBA 3AULA 4KKJA 3MC0B 2MLBA 4XWTA 1R7SA 2V4LA 2C7MB 1FNWA 3SR6A 3A1QA 4WWMA 5LNK1 2NVUI 4WWPA 1L6VA 3U30A 1FXAA 4BKTA 1SJED 2D11A 3GZNB 2RPQA 3ZJTA 1OTRB 2EELA 3B2FA 2CHXA 1WRIA 1JWBD 5L95C 2C9WB 1LM8B 3B0AA 2LRUA 3QC8B 4JIOU 1UGMA 2CR5A 3P42A 1CQVA 1UD7A 1C78A 1HZ5A 1TZ1A 4YWGG 3K9PB 5C1ZA 3OAWA 2PLPA 1ZUD2 3QX1A 4TQ0A 4K3CA 2LMCA 4W9IA 2MJDA 2EMTA 5LLIA 4ASWC 1ZP0B 2MSED 3PVLA 3VRBB 5AZFA 2ZPNA 3AEGB 2WU5B 3VFKA 5LXHA 3P63A 2I38A 3QARA 4HCNB 2KX0A 2YLMA 1JMLA 3P4RB 2N1WA 3L4PA 2D2QA 3P1MA 3SD5A 2LHDA 3L17A 3PRMB 3M62B 2OOBB 1NI2A 4M02A 3IBEA 3K9OB 2NBUA 3TEZA 2BTEA 2GB1A 1GNUA 5HI1A 1T0RC 4RF0A 3HVZA 1F52A 4IM3A 3IFWB 3HM3A 1QOFA 3DWMA 2DAFA 4P1BC 1RFAA 2YEPF 5D7GA 2LXCA 1SB3C 4PS7A 4RFBA 1YNTE 4HROA 1F2RC 1GJZA 3HRDD 3L16A 3LJ3A 3PHWB 3Q6BA 4FULA 3LXFA 1NI3A 3ZKJC 5D6JB 2WS3B 3PT2B 2VRRB 4HJKA 4FHJA 3EUB2 1GB1A 1D5MC 4FADA 3QWZB 2KACA 2LASA 2JU6X 2O2VB 1V97A 2RMMA 3AE2B 2AWTA 2N0SB 1TGZB 2QMTA 2ACZB 1E6EB 4M0WA 1JW9D 1P1AA 1C4AA 3SEBA 2JRIB 1OGWA 2KWUB 2JUOA 4NQLB 3LDZE 1GPXA 4R3DA 3JSVA 3NZSA 3A1QB 1AWDA 3EHVA 3NJTA 1GAQB 4W9GA 3IT4B 3R3MA 4WWOA 2WXOA 2RD0A 1GC6A 1YIWA 2B76B 2M17A 5BMIA 4XWWA 5DPWA 1K50A 1MI0A 4TKNA 3R2IA 1LO5D 4C4VA 3O13A 1WWTA 1C3TA 1ISNA 2EMSA 2KDEB 4XGAB 2WDTB 1DOXA 5IN7A 3AE9B 4HPLB 2KDFB 4LDTB 4WQMA 2NPTA 2K8BA 3DBHI 1ZGUB 3RNBC 2BKRB 3ML9A 4JE3B 4US9A 1A5RA 3HUIA 1NVID 1P7FA 3VDZA 5EE3A 4MH0E 2JPHA 4WJOA 3A4RA 2BQQA 3ABVB 4PK1A 2Y5CA 1WE6A 1RYJA 3SDLC 3AE5B 2M0AA 4RGNA 3Q14C 4HKQA 4ICUA 1UBIA 1WGRA 3DHHC 3AV8A 2AX5A 3AM9A 1F77A 4ZRPA 3L08A 4MT5A 4YT0B 1VR9A 2PW9A 1WZ3A 3UINB 2XBBC 1TTNA 2Z0DB 3AXCA 1WYWB 3RFZB 4WJPA 3ZTDA 4RCOA 3ZGZA 2WXFA 2M0XA 3ZDMC 4REZA 3L54A 2CHWA 1WM3A 2KFJA 3RI7C 4FN2A 2DYOA 3AE6B 4AOFA 3MTNB 3AEAB 3P4QB 2MBBB 3VHTC 5D2MB 2XNAC 1ET6A 4MGKE 4PYZA 1TS4A 2KJ6A 3SFEB 2LJ5A 2L3ZA 4WIPA 3PSEB 1Q0WB 4HPMB 1C79A 3X0WA 3O65B 4II2B 1YX6B 4M0WB 3RCZA 2KWVB 3DBSA 4MM3A 3AE7B 1PYWD 2PPHA 4ZRJA 5IP4D 1RWSA 1WY8A 1J0GA 2LVQA 3KW5B 1CMXB 1XLPA 4B95A 2FBWB 3PGEA 2N9LA 1SE4A 2QEJC 3WAMA 3JSVB 2FIFA 1F9JA 4GB9A 1WF9A 2Y5BB 2WXIA 3EC8A 2LGXA 1QKZA 1P9DU 2W3SA 2BWES 1WJUA 3AU5A 1XEEA 2RDGA 4ANWA 3N1YC 3DPDA 1XCQL 4AUQC 1QZEA 2DZJA 2OEDA 2INCC 3PLVA 2L76A 2H88B 4KZ0A 2KWDA 2NS5A 4C4VB 3BVGA 3HK0A 1MHHE 1ZDVA 2RPVA 1CJEA 1XF5L 2J7QB 1EWYC 3H7SA 2KMAA 1T0QC 4ZYNA 2MX2A 1F2RI 5IAAC 4NY0A 1MPEA 3Q3OC 3A4SC 2FCQA 3QA8A 1VLBA 3TBLD 4LDTD 1FXIA 1BT0A 4CYEA 1F1HA 2BS2B 2FUHB 1WI0A 1TT5B 2MEKA 3GB1A 1L2NA 2FCMA 4DWFA 4LJOB 3CF6E 4M8NA 2KQ4X 2AYOB 3AMZA 2NR2A 4DK5A 2ZCBA 2Y5PA 4FHKA 3ONSA 1WGKA 1RRBA 1V49A 4GMVA 4W9FA 3PRPB 2PE6B 4FA6A 5MPOA 3TMPB 1SE2A 4LJPB 1S3SG 2KQ7A 2AQ2B 3VTVA 2G4SA 1TZOA 3J9CA 4GIVA 1FNVA 1K8RB 3JW0X 2DYMA 3ZNZB 1P0RA 1ZKHA 1OEYA 3OJ3A 4W9HA 1I4XA 3B2GA 3MJ5A 1N63A 4MH8A 4IW0A 4ZRIA 2KC2A 2J52A 1XLQA 4N9F4 3KUDB 2GI9A 1TS5A 4ZHOA 3GOEA 4C7YA 2IZVB 2KANA 2MP2A 4LCDE 3GS2A 3W5VB 2M1MA 2WLBA 1WGGA 3FILB 3W5UB 4Q2JA 4MM3B 4DHZE 2V3NA 4AS1A 5IKCM 4BOSC 3VVWB 4AP4C 1SGHA 2OHFA 3U4EG 2N7JA 1VZ6A 3KLSX 3MHSD 3FKYA 4I6LB 2K25A 1NEKB 2ZZPB 3U2SC 4N59A 3M95A 2LJIA 3ZIMA 1E7UA 4IUMB 4XDCA 4S17A 3D32A 2KOXA 4MGIE 2WWZA 1U4AA 5H92C 3VQIA 3UF8A 5KHOA 1GOZA 4BFRA 1P98A 3CSTA 3NG0A 4M01A 2YEPB 3VXWA 3AU4A 2PJHA 1AW7A 3AE1B 4ANXA 2X38A 1N6ZA 1WXAA 2CU1A 2VH1A 1MG8A 3GZNI 4TQ1A 3VTWA 4ZYSA 5EE9A 3QCAA 4G50A 3R66C 3PZDA 4CQNA 4YTMB 1I35A 4JQWC 4GOCA 4IM0A 1V1PA 3HVDA 3NUHB 3BK2A 3QAQA 3N3KB 5IO9A 3DDCB 3NOBA 2ON8A 2V1YA 4K3BA 3RNAC 4F1SA 5CTRC 4MGZE 2MBQA 4BBNC 2WHIA 1UWXA 1KF6B 3RNCC 2LI5A 2XK5A 2INPE 4FLHA 2BYTA 1JWUD 4USAA 2A5UA 1Q5WB 4OVVA 5G2NA 5J18A 2CU3A 3P4SB 1YQ3B 2NBVB 3BY4B 4OVUA 5BYRA 2N7EA 1V1OA 4M00A 4P1CC 2KTFA 2JWUA 1V86A 1GB4A 1E7VA 3A9KA 3HM6X 1YJ1A 3TEXA 1S1QB 4ZOHC 3DVNU 4IM2A 4ITKA 2GRIA 1EU4A 1Z2MA 2HJ8A 3PRZA 1E8YA 1V81A 1WE7A 5EDSA 4LNOA 1I4RA 1JWAD 3CWIA 3DVGX 1IUEA 1XD3B 1FFVA 1T0SC 2VH2A 3KUZA 4YSZB 4MACA 2MP2B 4RGOS 3PV1A 2PE9A 4RMAA 2C5LC 2MCNB 5IOIA 5JXVA 2LZ6A 2LGIA 4RM9A 4TSSA 1MFWA 1FFUA 4ZDVA 1FCCC 1QLBB 1J7BA 2D5GA 1UF0A 5D3IB 2IO2B 4YSXB 3NS8A 1SE3A 1I42A 2KO3A 2K9XA 4HWIB 1WXQA 4FJVB 3DBRB 3MP9A 1H4RA 2GBMA 4H2AA 3UIOB 2H89B 1Q10A 2LVOA 2W82A 3DBLB 2NBWB 2BBCA 2KLGA 2BS3B 4BAXA 4IG7B 2CKHB 3TJPA 1D4BA 1XO3A 2QILA 5HHDG 4NQKE 1J7CA 2KN4A 1ZDXA 4TUUA 2FUG1 1ZW7A 3OJ4B 3LYYA 5AZHA 4G0NB 2IGDA 4BKSA 1SBBB 1EM7A 5E6NA 2CJOA 2WXKA 1TS3A 2BYVE 1WX8A 4WJNA 3AH7A 2IYDB 2KQSA 2D3BA 2LXAA 2KHWB 1V1PB 3KYCD 1JWMD 1QOGA 2MHJA 1L4ZB 3IAM1 4HXDA 4HCPB 3SU8X 3L10B 1XLNA 3R2TA 3PHXB 5BYSA 2MW5A 4LNFA 3SHQA 4HJGE 4G3XB 4WURA 2HJ1A 4LTUA 4MDKE 2XK5B 1PGAA 1FPYA 1FD6A 3EGRA 2CHZA 3DVGY 5J2RA 4RM8A 3PLUA 4KDIC 1I4QA 1OQRA 3C8YA 3Q8BA 2DENB 4IC7B 2GBKA 3A9KB 3H8HA 2X8XX 4WAFA 3ZLZA 4MJSA 2LWPA 1YJIA 3WAOA 1FXTB 1E8XA 1VCBA 3BYYB 4HPPA 3GP7A 4YL8A 1V6EA 1UWMA 4ACFA 2JVCA 1ESFA 5G5GA 2REXA 1EF5A 4I6NB 4KIKA 1E9MA 3KWVA 2IY1B 1WJNA 2V0GA 3Q3FA 2JZ3B 2NTTA 2TSSA 3T3NA 3I57A 1R4NB 3A9JA 3P2BA 5AUKA 4N6EB 4URKA 2K8HA 2BB6A 4L23A 1SF0A 2QDFA 1KLVA 4K7SA 5L83A 3NRZA 3JYUA 2SEBD 2N9XA 2MBEA 2WDVB 2PEAA 4GSWA 2LHEA 2WQYB 3AB5A 4GDLA 3OWEB 4F8CB 4HRSA 2WXMA 3KUCB 1MHXA 1XQQA 1SXTA 2BPSA 1YOVB 2IBIB 1JROA 4C00A 3L0WB 1KOTA 4GGQA 4KV2A 4B9KA 1GC7A 1JRUA 1SSNA 2L0FA 3ZO5B 3BVZA 2RDHA 4OZCA 3ZYYX 2JWZA 4MSMB 3C19A 3ENEA 1WX7A 1ENFA 1QOAA 2JZZA 5FR6A 4MGYE 4BVUC 1UELA 1FM0D 2AQ3B 3AE8B 2BW2A 3KH0A 4MELA 2LFIA 3NS1A 5JHAA 4N58A 3RMKC 5JHBA 1L0XB 1WXVA 3EFUA 1LFDA 1D3ZA 4HLEA 2JY6A 4AJYB 4JX1C 3PPAA 3M3JA 1Y56A 2WXPA 3H6NA 3VUWA 2Z59B 3R7RA 3FAHA 4BKGA 1PUTA 1AN8A 5BMGA 2BB5A 2LUMA 5JZEB 1M94A 3RYTA 2K5PA 4NJ6A 2RSUA 3N32A 4HK2A 4WJQA 1QF6A 2KJRA 3ETRA 3CSFA 1TKYA 1STEA 4XE0A 4MEMA 5KHQA 5AUIA 1E0ZA 1OFFA 3H9DA 2QSDA 5G5HA 4MJSB 4RNAA 3IXSA 5GMVA 2W9NA 3R8BA 4TMAB 1IPGA 4B0EA 1JRPA 1FRRA 1I4PA 3ML8A 1SEBD 2BT6A 3APCA 3DHGC 4XZ4A 2KD0A 1TBEA 5DPSA 4KIKB 3Q8EA 4EKUA 3T8MA 2PVOD 4KDLB 2ZCCA 2IGGA 5C3JB 3RNEC 2IDYA 3NY5A 2LUEA 2MRPA 2NPTB 1AARA 2RGFA 3A9JB 3QQ8B 2INNE 4FJZA 1NYRA 5J17A 5GXGB 1ZOYB 2KMCA 1HA5A 1LQBA 3W1SA 2KYWA 3ZNHB 4J3OD 4GXBA 4B0MA 1WFYA 3QK0A 3AN1A 2JSVX 2WXNA 4HKZE 3N9YC 2WU2B 2D3CA 3VUXA 4KSKC 2Z8LA 3WALA 3ALBA 2MWSB 3RN9C 1KLGD 2ZJDA 3ZTCA 1RFKA 1V8CA 4GDLB 4WWNA 5I4DA 1M4VA 3BZDB 3V3XA 5CX3A 3APFA 2D07B 2DZMA 3WANA 4NZLB 3AEEB 2KK8A 4HDOA 4IKGA 4DXGA 2M19A 2JYEA 2R2QA 1KLUD 1WR1A 4NAWA 1HQRD 3RT3B 2FCNA 4FBJB 1J7AA 1VJKA 4KZCA 4YXDB 4K1RB 1WH3A 3PREA 1BXTA 2G4DB 5EE1A 1N5XA 1N5WA 2AL6A 3S2AA 4MSQB 2JQRB 4JGHB 1N61A 2L0TA 3BINA 2LGDA 4BKSD 2MBHA 1GUAB 1WYGA 4LLGM 3I63C 1K53A 2LD9A 2KJHB 4S0RA 2Y3AA 5H8YE 3VAWA 1YX5B 2NCNA 1PDXA 3H7PA 2ZW1A 4ARIA 3NZ3A 1IGCA 2KDMA 2KWCA 3LB8C 1N62A 4LNNA 2J42A 5G55A 2IY0B 4ZRQA 4WAAA 1JWSD 2DWQA 2KN5A 2M4NA 3VTUA 2KKCA 2M56B 3JVZX 1MVKA 1T3QA 4B6WA 1H8CA 4K7WA 4K7UA 3VH3B 4DXAB 2KVZA 4P7IA 3KVFB 4C56C 3VRAB 2MA9B 1R4MI 5BO4B 2LGYA 5CHWA 1FCLA 1NYQA 1WX9A 4OZAA 3RNGC 2JYTA 2I2YA 1L5PA 4GDKA 2PIAA 4LK0M 5FR3A 4BBNF 2FE8A 3U7DA 2KDBA 4E74A 4PS8A 1OEYJ 5E6OA 4EZKA 2LRWA 2JZPA 3WAPA 3R7QA 1AYFA 2WYQA 3DQVA 2GOWA 4ICVA 1L7YA 3Q3JA 3ZNGC 1E8WA 1L4DB 4ZRKA 2IO0B 4L1BA 4RGTA 4DHZB 4KX6B 4O1NA 1L6UA 3WA0A 4WH4A 2KAJA 2J53A 5FK9C 2N1VA 2KTRA 4EEWA 2N7DA 1IYFA 4P16A 5TSSA 1B9RA 1VD2A 2N4FA 2O6VA 1SIFA 2I1KA 4NPNA 2KMMA 2DAJA 2WDQB 1RM6C 2KLCA 3UQAA 5C23A 1EU3A 4DXFA 5BYQA 3W9CB 1TIFA 5AEKB 2C7NB 3NZUA 1C4CA 4AWJA 4LNKA 3IAS1 4A6QA 1WGYA 2K8CA 4NAWB 5BMHA 2JRHA 1J19A 4A90A 1JQ4A 2J0KA 3E9SA 3NHEB 3RUIB 2D10A 3DBRI 1IGDA 3DVNV 4XC2A 5DCNA 3QHTA 1GG3A 4C80A 3PTFC 2BWFA 3DBLI 2PKOA 4EUTA 3KQ4A 1FEHA 1EUVB 2XEWA 4KGSA 1T5XD 3ZVVA 2LEKA 1IBXA 4IWPA 4KVGB 4TV3A 3TEYA 1WR6E 1UBQA 2L83A 1C4PA 4ANUA 2DZKA 3A33B 3H7PB 2ZW0A 3GE3C 2KZRA 4W9CA 4P6VF 5CHVC 2R61A 1YQBA 4E3CA 3UIPB 2MQJA 1EF1A 2D3GA 2SAKA 1DOIA 1TS2A 2M8SA 2G1EA 1E5WA 2KC1A 1WIAA 3UI3A 2WXLA 3B1LX 2UWQA 1TJEA 3WIMA 3ZXRA 3TL5A 3RZFA 1LGRA 3ZDTA 1V5TA 3V6EB 3UGBB 2WGSA 3BWUD 4PT5A 1DGJA 4GDKB 1YQ4B 1HTQA 1C77A 1E90A 1Y8RC 3URYA 4W9DA 2QHOA 1SIJA 4XDDA 3M63B 3ZJUA 2V3PA 3EFCA 2K39A 4EZJA 3W1YA 2LVPA 5EE0A 4D2KA 1WM2A 3AEFB 1C76A 2BVCA 2ZVOA 4AQ7A 4EZLA 4A20A 2V9HA 4XYCA 2L52A 1TKGA 3NVVA 3PO0A 1FIQA 1WJ4A 4W9KA 2ASQA 4ARCA 2E6XA 4AJWA 2KTRB 3L13A 3QIJA 1WJ6A 1J8CA 1Q1OA 3AEBB 1UGJA 1L0VB 2BF8B 2O6VB 1TKEA 1ZXIA 2J0JA 1FNUA 3Q69A 2K22A 3N1XC 1WMHA 3PZ7A 3VUYA 1R4NI 3V61A 1WSPA 4L2YA 2W54A 1V80A 3Q2AC 5HG2A 3TCAA 2QC8A 3DHIC 4K81A 5CHFA 2PMVA 2KXJA 1E8ZA 3BVMA 2V4IB 2IGHA 3RULA 3V6CB 2GBJA 3VH4B 2WXHA 4LNIA 3ZXVA 1OQQA 3RNFC 1HXYD 4OZBA 5LXIB 3TEWA 2ZNVB 1SJHD 2J4XA 2CS4A 3MFGA 2K1FA 2AQ1B 4DHJB 4E71A 2L05A 1IBXB 2FAZA 3HIZA 5C2TB 2L00B 4US8A 2GMIC 2AL3A 1XT9B 1K52A 3V60A 1FMAD 3W1SC 4EE2A 2HTME 1DYQA 4UDUC 2DX5B 1E7PB 3ZUNA 1XXGA 4DDID 1L0YB 3AEDB 2DLBA 1ACCA 2ZEQA 2BS4B 1IP9A 1I4HA 3B08A 4JL9A 3E56A 3MJWA 2WXJA 3RPFC 2L7RA 3PZ8A 3U7ZA 2G9HD 3HHMA 1YMHE 4PS3A 1TY2A 1PFDA 2MH7A 3ZQ4A 5DPTA 1EWCA 2BGFA 1UNSA 2AEHA 2NMQA 2DZIA 3ZW3A 2R2OA 1NBFC 1DOYA 2KT7A 1LXDA 1ZE3D 2ZVNA 1VDVA 1XCTL 3MHZA 1CK1A 1YJJA 2K6QA 2C60A 2INDC 3DCGA 3QJZA 3CMMB 2CJNA 2IPKD 3Q8FA 3KWLA 1G6JA 2D3AA 4W9JA 3BK1A 4OHJA 2JXXA 2UYZB 1PGXA 2G3QB 2JF5A 5TR5A
chains in the Genus database with same CATH topology
1P3QU 1WR1A 4FHJA 2A4ZA 4NAWA 1V5OA 3RT3B 2J0MA 2FCNA 4F1SA 4FBJB 3N30A 5CTRC 4FADA 3QWZB 2LASA 4MGZE 2MBQA 4BBNC 2Z0EB 2O2VB 4KZCA 2LI5A 2XK5A 2K6DB 3I3TB 4K1RB 2ZPYA 4FLHA 1WH3A 3PREA 2A5UA 1Q5WB 2G4DB 1EO6A 4OVVA 5G2NA 4EOYA 2AWTA 5J18A 1TGZB 4A3PA 2NBVB 3BY4B 4OVUA 5D94A 1WMHB 2AL6A 3S2AA 2YVCA 4MSQB 2N7EA 4WQOB 3T9LA 3ECIA 1RLFA 4JGHB 2L0TA 3BINA 2KTFA 1V86A 2LGDA 2MBHA 4BKSD 1GUAB 1E7VA 3A9KA 3HM6X 1YJ1A 1P1AA 1S1QB 2JRIB 3DVNU 1OGWA 2KWUB 2O6VD 2JUOA 4IM2A 2LD9A 2KFKA 2KJHB 4NQLB 3KYDD 3VAWA 3LDZE 1YX5B 2FNJB 2NCNA 1Z2MA 2HJ8A 3PRZA 3JSVA 3NZSA 3A1QB 1E8YA 1V81A 3H7PA 1WE7A 5AZGA 5EDSA 3EHVA 1V2YA 2KWCA 3DVGX 2OJRA 1XD3B 3KUZA 3ZNID 4W9GA 3EECA 2MP2B 5G55A 3R3MA 4WWOA 2IY0B 3PV1A 2PE9A 4RMAA 4WAAA 2KN5A 2M4NA 3VTUA 2RD0A 2C5LC 2HD5B 2KKCA 3JVZX 2MCNB 1GC6A 3TIXA 4B6WA 4K7WA 1H8CA 1YIWA 4K7UA 2LZ6A 3VH3B 4DBGA 4RM9A 4HJKA 2C7HA 2M17A 1UZXB 4DXAB 4P7IA 4ZDVA 3KVFB 2MA9B 5DPWA 1SE9A 1R4MI 5BO4B 4TKNA 2LGYA 5CHWA 2IO2B 1C3TA 3ZRFA 3NS8A 4EEWA 1V9JA 1WX9A 1ISNA 2EMSA 2KDEB 1YD8U 2WDTB 1I42A 2KO3A 4GDKA 4BBNF 1KM7A 1UH6A 2KDFB 4HPLB 4LDTB 2NPTA 4DHJD 2K8BA 4HWIB 3U7DA 2KDBA 1ZGUB 3DBHI 3IHPC 4FJVB 4E74A 2BKRB 3ML9A 4PS8A 1OEYJ 4X57B 5E6OA 1A5RA 4EZKA 2LRWA 3WAPA 3R7QA 1H4RA 2GBMA 3VDZA 3UIOB 4A3OA 2WYQA 4MH0E 4CHKA 2JPHA 4WJOA 4M8MA 2LVOA 2NBWB 3A4RA 1WE6A 2KLGA 3DQVA 2GOWA 4ICVA 1L7YA 3Q3JA 3SDLC 3ZNGC 4IG7B 2CKHB 1E8WA 3TJPA 5DPRA 3RD2A 4ZRKA 2IO0B 3UQBA 4NQKE 4DHZB 3ZRCA 3WA0A 2N9PC 4NJ7A 2N1VA 4TUUA 1ZW7A 2KTRA 4ICUA 1UBIA 1WGRA 2N7DA 3OJ4B 4G0NB 5AZHA 3X23A 4BKSA 4EFOA 1IYFA 2KVRA 5E6NA 1VD2A 4FJYA 2BYVE 1WX8A 3L08A 2N4FA 4WJNA 2O6VA 1SIFA 2I1KA 4NPNA 2DAJA 2IYDB 2KQSA 2LXAA 1WZ3A 3UINB 2KHWB 2XBBC 2KLCA 3UQAA 4XX5A 1TTNA 2Z0DB 3KYCD 5C23A 1RAXA 2ZNVC 3AXCA 1WYWB 4DDGD 4HXDA 4WJPA 5AEKB 2C7NB 3NZUA 2IO1B 3PS6A 4HCPB 3ZTDA 3SU8X 3L10B 4AWJA 2M0XA 3ZDMC 4HVBA 2DHZA 3L54A 3PHXB 2CHWA 1WGYA 2WX1A 2HE7A 2K8CA 1WM3A 2KFJA 2MW5A 4NAWB 1WRDB 4FN2A 2JRHA 3SHQA 1J19A 2DYOA 4AOFA 3MTNB 4G3XB 2J0KA 5JH5C 3VHTC 2MBBB 3NHEB 4BOZB 3RUIB 4ANVA 2D10A 4JLCA 2I1JA 2IO3B 4MDKE 5D2MB 1WZ0A 3DBRI 1C1YB 3DOWA 3DVNV 4IWOA 2XK5B 4NNJB 4XC2A 4MGKE 4PYZA 1HE8A 5DCNA 3QHTA 1GG3A 2KJ6A 2CHZA 3PTFC 2BWFA 3DVGY 4W9LA 5J2RA 2G45B 2LJ5A 3DBLI 4RM8A 2L3ZA 3PSEB 1Q0WB 2HTHA 4HPMB 3PLUA 4EUTA 3X0WA 3O65B 4II2B 1YX6B 4KDIC 4M0WB 2KWVB 3RCZA 1WGDA 3DBSA 4MM3A 1EUVB 2XEWA 2PPHA 4GU2A 4ZRJA 1NDDA 2DENB 4IC7B 3ZVVA 2GBKA 3A9KB 1WY8A 4IWPA 4KVGB 4TV3A 1WR6E 1J0GA 2LVQA 3ZLZA 3KW5B 4MJSA 1UBQA 2LWPA 1CMXB 4GN1A 4B95A 2KFKB 3WAOA 3PGEA 2EKEC 2L8JA 4II3B 4ANUA 1FXTB 1E8XA 1VCBA 4YL8A 2KX3A 3WAMA 2DZKA 3JSVB 2FIFA 3A33B 1F9JA 3H7PB 4GB9A 1V6EA 2KZRA 2BYFA 1WF9A 4W9CA 2Y5BB 2JVCA 3EC8A 2LGXA 3IG3A 1P9DU 5CHVC 2REXA 1T0YA 1YQBA 1EF5A 2BWES 4E3CA 1WJUA 4I6NB 3AU5A 4KIKA 3UIPB 2MQJA 1EF1A 2D3GA 2FIDA 2IY1B 3U8ZA 1WJNA 1WGHA 4ANWA 3Q3FA 2M8SA 3DPDA 2GBRA 1E5WA 2KC1A 2MBOA 1KJTA 4AUQC 1WIAA 2JZ3B 2FCSA 1PQSA 3B1LX 1QZEA 4IWQA 2DZJA 2JT4B 3A9JA 3P2BA 2WX0A 2UWQA 3PLVA 3WIMA 2L76A 4KZ0A 2RR9A 3IVFA 4URKA 2BKFA 3TL5A 2NS5A 3RZFA 3OLMD 3ZDTA 2K8HA 1V5TA 3V6EB 3H1UA 4KSLC 3UGBB 4W9EA 1KLVA 3HK0A 4K7SA 5L83A 3JYUA 2N9XA 2KNBA 5HKHA 2MBEA 1X1MA 4GDKB 2PEAA 1Y8RC 1E90A 2J7QB 4W9DA 2QHOA 5IA7A 4G11A 4GSWA 3H7SA 3M63B 2V3SA 2KMAA 2K39A 3AI5A 4EZJA 3W1YA 4ZYNA 2MX2A 4GDLA 2LVPA 5IAAC 1WM2A 4F8CB 4F7ZA 4NY0A 2ZVOA 3KUCB 3A4SC 2FCQA 3QA8A 1XQQA 3TBLD 2BPSA 2KDIA 4EZLA 4A20A 4LDTD 2IBIB 4HDQA 1BT0A 4PYUA 3L0WB 4CYEA 1KOTA 2FUHB 4GGQA 4KV2A 1WI0A 4B9KA 1GC7A 3RZWC 1JRUA 1L2NA 1WJ4A 4W9KA 2ASQA 2FCMA 2L0FA 2BYEA 4LJOB 3CF6E 4DWFA 3ZO5B 2GBNA 4M8NA 2AYOB 2JWZA 1OQYA 2KTRB 2NR2A 1WJ6A 3L13A 3QIJA 4MSMB 4AJWA 1J8CA 3ENEA 1WX7A 4DK5A 1Q1OA 2O2VA 2ZCBA 1WXSA 2BF8B 2JZZA 3ONSA 4FHKA 5FR6A 1RRBA 2O6VB 4J6IA 4MGYE 1V49A 2B3AA 4GMVA 4W9FA 3PRPB 2PE6B 4BVUC 4FA6A 1UELA 2J0JA 3TMPB 2N9EB 4LJPB 1S3SG 2DYBA 2KQ7A 1WMHA 3VTVA 2G4SA 3VUYA 1R4NI 4GIVA 3V61A 1K8RB 4CO7A 3KH0A 3APDA 3JW0X 4MELA 2DYMA 1V80A 1Z5SB 5E6PA 3ZNZB 1P0RA 5JHAA 1ZKHA 4I6PA 1OEYA 3OJ3A 5JHBA 3TCAA 4W9HA 1WXVA 4K81A 3C0RB 1WXMA 3EFUA 3AULA 1LFDA 5CHFA 1D3ZA 4HLEA 2KXJA 2JY6A 1E8ZA 2MLBA 4AJYB 2V4LA 3PPAA 2C7MB 3RULA 3V6CB 2GBJA 4IW0A 3VH4B 4ZRIA 2KC2A 3A1QA 4N9F4 2NVUI 3KUDB 4WWPA 3M3JA 3GOEA 3H6NA 3U30A 3VUWA 2Z59B 3R7RA 4BKTA 4BKGA 2IZVB 2D11A 2KANA 2MP2A 2RPQA 1OTRB 4LCDE 5LXIB 5JZEB 1M94A 2M1MA 2ZNVB 1WGGA 2CHXA 3RYTA 4NJ6A 5L95C 2RSUA 2C9WB 3N32A 1LM8B 3B0AA 4HK2A 4WJQA 2CS4A 2KJRA 2K1FA 2LRUA 3QC8B 4JIOU 4DHJB 3CSFA 4DHZE 4E71A 1UGMA 2CR5A 2L05A 4BOSC 2FAZA 3HIZA 4MEMA 1UD7A 3VVWB 5KHQA 2L00B 4AP4C 3H9DA 1SGHA 4MJSB 1TZ1A 2GMIC 2AL3A 1XT9B 5GMVA 3V60A 3K9PB 3MHSD 2W9NA 3W1SC 5C1ZA 1IPGA 2K25A 4I6LB 3OAWA 2DX5B 4DDID 3ML8A 3ZUNA 2ZZPB 3QX1A 4TQ0A 3APCA 4W9IA 4XZ4A 2EMTA 2KD0A 5LLIA 1TBEA 2ZEQA 4ASWC 5DPSA 2MSED 3M95A 4KIKB 3PVLA 1IP9A 3ZIMA 1E7UA 4IUMB 5AZFA 4EKUA 2ZPNA 3T8MA 3B08A 4KDLB 2ZCCA 4JL9A 3VFKA 3D32A 5LXHA 2KOXA 3MJWA 2L7RA 3QARA 3HHMA 4MGIE 4HCNB 2WWZA 1U4AA 4PS3A 2KX0A 2YLMA 3NY5A 5D6JB 5DPTA 2LUEA 2MRPA 2NPTB 1AARA 2RGFA 3A9JB 3QQ8B 3UF8A 3VQIA 4FJZA 5KHOA 2BGFA 2N1WA 1P98A 3CSTA 2AEHA 4BFRA 5J17A 2D2QA 2KMCA 2DZIA 3AU4A 1LQBA 3SD5A 3VXWA 3ZW3A 3W1SA 3PRMB 2PJHA 3L17A 2R2OA 3M62B 2OOBB 3ZNHB 1NI2A 4GXBA 1NBFC 1WFYA 3QK0A 3IBEA 4ANXA 3K9OB 2NBUA 1WXAA 1LXDA 2CU1A 3VUXA 4KSKC 1GNUA 3WALA 3ALBA 2MWSB 2ZVNA 1MG8A 3GZNI 4TQ1A 3VTWA 2ZJDA 3QCAA 4IM3A 3ZTCA 4G50A 3IFWB 3HM3A 3R66C 3V62A 4GDLB 2K6QA 2C60A 2DAFA 4WWNA 1RFAA 3PZDA 5D7GA 3DCGA 2LXCA 3QJZA 3CMMB 4JQWC 4GOCA 1I35A 4IM0A 4PS7A 1G6JA 5CX3A 3APFA 1GJZA 4W9JA 3L16A 3LJ3A 3PHWB 2D07B 2DZMA 2JXXA 3WANA 2UYZB 3QAQA 2KK8A 4HDOA 3N3KB 4FULA 3DDCB 3NOBA 2V1YA 3ZKJC 2G3QB 2JF5A 5TR5A 3PT2B 2VRRB 2R2QA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1P3Q U;  1WR1 A;  4FHJ A;  2A4Z A;  4NAW A;  1V5O A;  3RT3 B;  2J0M A;  2FCN A;  4F1S A;  4FBJ B;  3N30 A;  5CTR C;  4FAD A;  3QWZ B;  2LAS A;  4MGZ E;  2MBQ A;  4BBN C;  2Z0E B;  2O2V B;  4KZC A;  2LI5 A;  2XK5 A;  2K6D B;  3I3T B;  4K1R B;  2ZPY A;  4FLH A;  1WH3 A;  3PRE A;  2A5U A;  1Q5W B;  2G4D B;  1EO6 A;  4OVV A;  5G2N A;  4EOY A;  2AWT A;  5J18 A;  1TGZ B;  4A3P A;  2NBV B;  3BY4 B;  4OVU A;  5D94 A;  1WMH B;  2AL6 A;  3S2A A;  2YVC A;  4MSQ B;  2N7E A;  4WQO B;  3T9L A;  3ECI A;  1RLF A;  4JGH B;  2L0T A;  3BIN A;  2KTF A;  1V86 A;  2LGD A;  2MBH A;  4BKS D;  1GUA B;  1E7V A;  3A9K A;  3HM6 X;  1YJ1 A;  1P1A A;  1S1Q B;  2JRI B;  3DVN U;  1OGW A;  2KWU B;  2O6V D;  2JUO A;  4IM2 A;  2LD9 A;  2KFK A;  2KJH B;  4NQL B;  3KYD D;  3VAW A;  3LDZ E;  1YX5 B;  2FNJ B;  2NCN A;  1Z2M A;  2HJ8 A;  3PRZ A;  3JSV A;  3NZS A;  3A1Q B;  1E8Y A;  1V81 A;  3H7P A;  1WE7 A;  5AZG A;  5EDS A;  3EHV A;  1V2Y A;  2KWC A;  3DVG X;  2OJR A;  1XD3 B;  3KUZ A;  3ZNI D;  4W9G A;  3EEC A;  2MP2 B;  5G55 A;  3R3M A;  4WWO A;  2IY0 B;  3PV1 A;  2PE9 A;  4RMA A;  4WAA A;  2KN5 A;  2M4N A;  3VTU A;  2RD0 A;  2C5L C;  2HD5 B;  2KKC A;  3JVZ X;  2MCN B;  1GC6 A;  3TIX A;  4B6W A;  4K7W A;  1H8C A;  1YIW A;  4K7U A;  2LZ6 A;  3VH3 B;  4DBG A;  4RM9 A;  4HJK A;  2C7H A;  2M17 A;  1UZX B;  4DXA B;  4P7I A;  4ZDV A;  3KVF B;  2MA9 B;  5DPW A;  1SE9 A;  1R4M I;  5BO4 B;  4TKN A;  2LGY A;  5CHW A;  2IO2 B;  1C3T A;  3ZRF A;  3NS8 A;  4EEW A;  1V9J A;  1WX9 A;  1ISN A;  2EMS A;  2KDE B;  1YD8 U;  2WDT B;  1I42 A;  2KO3 A;  4GDK A;  4BBN F;  1KM7 A;  1UH6 A;  2KDF B;  4HPL B;  4LDT B;  2NPT A;  4DHJ D;  2K8B A;  4HWI B;  3U7D A;  2KDB A;  1ZGU B;  3DBH I;  3IHP C;  4FJV B;  4E74 A;  2BKR B;  3ML9 A;  4PS8 A;  1OEY J;  4X57 B;  5E6O A;  1A5R A;  4EZK A;  2LRW A;  3WAP A;  3R7Q A;  1H4R A;  2GBM A;  3VDZ A;  3UIO B;  4A3O A;  2WYQ A;  4MH0 E;  4CHK A;  2JPH A;  4WJO A;  4M8M A;  2LVO A;  2NBW B;  3A4R A;  1WE6 A;  2KLG A;  3DQV A;  2GOW A;  4ICV A;  1L7Y A;  3Q3J A;  3SDL C;  3ZNG C;  4IG7 B;  2CKH B;  1E8W A;  3TJP A;  5DPR A;  3RD2 A;  4ZRK A;  2IO0 B;  3UQB A;  4NQK E;  4DHZ B;  3ZRC A;  3WA0 A;  2N9P C;  4NJ7 A;  2N1V A;  4TUU A;  1ZW7 A;  2KTR A;  4ICU A;  1UBI A;  1WGR A;  2N7D A;  3OJ4 B;  4G0N B;  5AZH A;  3X23 A;  4BKS A;  4EFO A;  1IYF A;  2KVR A;  5E6N A;  1VD2 A;  4FJY A;  2BYV E;  1WX8 A;  3L08 A;  2N4F A;  4WJN A;  2O6V A;  1SIF A;  2I1K A;  4NPN A;  2DAJ A;  2IYD B;  2KQS A;  2LXA A;  1WZ3 A;  3UIN B;  2KHW B;  2XBB C;  2KLC A;  3UQA A;  4XX5 A;  1TTN A;  2Z0D B;  3KYC D;  5C23 A;  1RAX A;  2ZNV C;  3AXC A;  1WYW B;  4DDG D;  4HXD A;  4WJP A;  5AEK B;  2C7N B;  3NZU A;  2IO1 B;  3PS6 A;  4HCP B;  3ZTD A;  3SU8 X;  3L10 B;  4AWJ A;  2M0X A;  3ZDM C;  4HVB A;  2DHZ A;  3L54 A;  3PHX B;  2CHW A;  1WGY A;  2WX1 A;  2HE7 A;  2K8C A;  1WM3 A;  2KFJ A;  2MW5 A;  4NAW B;  1WRD B;  4FN2 A;  2JRH A;  3SHQ A;  1J19 A;  2DYO A;  4AOF A;  3MTN B;  4G3X B;  2J0K A;  5JH5 C;  3VHT C;  2MBB B;  3NHE B;  4BOZ B;  3RUI B;  4ANV A;  2D10 A;  4JLC A;  2I1J A;  2IO3 B;  4MDK E;  5D2M B;  1WZ0 A;  3DBR I;  1C1Y B;  3DOW A;  3DVN V;  4IWO A;  2XK5 B;  4NNJ B;  4XC2 A;  4MGK E;  4PYZ A;  1HE8 A;  5DCN A;  3QHT A;  1GG3 A;  2KJ6 A;  2CHZ A;  3PTF C;  2BWF A;  3DVG Y;  4W9L A;  5J2R A;  2G45 B;  2LJ5 A;  3DBL I;  4RM8 A;  2L3Z A;  3PSE B;  1Q0W B;  2HTH A;  4HPM B;  3PLU A;  4EUT A;  3X0W A;  3O65 B;  4II2 B;  1YX6 B;  4KDI C;  4M0W B;  2KWV B;  3RCZ A;  1WGD A;  3DBS A;  4MM3 A;  1EUV B;  2XEW A;  2PPH A;  4GU2 A;  4ZRJ A;  1NDD A;  2DEN B;  4IC7 B;  3ZVV A;  2GBK A;  3A9K B;  1WY8 A;  4IWP A;  4KVG B;  4TV3 A;  1WR6 E;  1J0G A;  2LVQ A;  3ZLZ A;  3KW5 B;  4MJS A;  1UBQ A;  2LWP A;  1CMX B;  4GN1 A;  4B95 A;  2KFK B;  3WAO A;  3PGE A;  2EKE C;  2L8J A;  4II3 B;  4ANU A;  1FXT B;  1E8X A;  1VCB A;  4YL8 A;  2KX3 A;  3WAM A;  2DZK A;  3JSV B;  2FIF A;  3A33 B;  1F9J A;  3H7P B;  4GB9 A;  1V6E A;  2KZR A;  2BYF A;  1WF9 A;  4W9C A;  2Y5B B;  2JVC A;  3EC8 A;  2LGX A;  3IG3 A;  1P9D U;  5CHV C;  2REX A;  1T0Y A;  1YQB A;  1EF5 A;  2BWE S;  4E3C A;  1WJU A;  4I6N B;  3AU5 A;  4KIK A;  3UIP B;  2MQJ A;  1EF1 A;  2D3G A;  2FID A;  2IY1 B;  3U8Z A;  1WJN A;  1WGH A;  4ANW A;  3Q3F A;  2M8S A;  3DPD A;  2GBR A;  1E5W A;  2KC1 A;  2MBO A;  1KJT A;  4AUQ C;  1WIA A;  2JZ3 B;  2FCS A;  1PQS A;  3B1L X;  1QZE A;  4IWQ A;  2DZJ A;  2JT4 B;  3A9J A;  3P2B A;  2WX0 A;  2UWQ A;  3PLV A;  3WIM A;  2L76 A;  4KZ0 A;  2RR9 A;  3IVF A;  4URK A;  2BKF A;  3TL5 A;  2NS5 A;  3RZF A;  3OLM D;  3ZDT A;  2K8H A;  1V5T A;  3V6E B;  3H1U A;  4KSL C;  3UGB B;  4W9E A;  1KLV A;  3HK0 A;  4K7S A;  5L83 A;  3JYU A;  2N9X A;  2KNB A;  5HKH A;  2MBE A;  1X1M A;  4GDK B;  2PEA A;  1Y8R C;  1E90 A;  2J7Q B;  4W9D A;  2QHO A;  5IA7 A;  4G11 A;  4GSW A;  3H7S A;  3M63 B;  2V3S A;  2KMA A;  2K39 A;  3AI5 A;  4EZJ A;  3W1Y A;  4ZYN A;  2MX2 A;  4GDL A;  2LVP A;  5IAA C;  1WM2 A;  4F8C B;  4F7Z A;  4NY0 A;  2ZVO A;  3KUC B;  3A4S C;  2FCQ A;  3QA8 A;  1XQQ A;  3TBL D;  2BPS A;  2KDI A;  4EZL A;  4A20 A;  4LDT D;  2IBI B;  4HDQ A;  1BT0 A;  4PYU A;  3L0W B;  4CYE A;  1KOT A;  2FUH B;  4GGQ A;  4KV2 A;  1WI0 A;  4B9K A;  1GC7 A;  3RZW C;  1JRU A;  1L2N A;  1WJ4 A;  4W9K A;  2ASQ A;  2FCM A;  2L0F A;  2BYE A;  4LJO B;  3CF6 E;  4DWF A;  3ZO5 B;  2GBN A;  4M8N A;  2AYO B;  2JWZ A;  1OQY A;  2KTR B;  2NR2 A;  1WJ6 A;  3L13 A;  3QIJ A;  4MSM B;  4AJW A;  1J8C A;  3ENE A;  1WX7 A;  4DK5 A;  1Q1O A;  2O2V A;  2ZCB A;  1WXS A;  2BF8 B;  2JZZ A;  3ONS A;  4FHK A;  5FR6 A;  1RRB A;  2O6V B;  4J6I A;  4MGY E;  1V49 A;  2B3A A;  4GMV A;  4W9F A;  3PRP B;  2PE6 B;  4BVU C;  4FA6 A;  1UEL A;  2J0J A;  3TMP B;  2N9E B;  4LJP B;  1S3S G;  2DYB A;  2KQ7 A;  1WMH A;  3VTV A;  2G4S A;  3VUY A;  1R4N I;  4GIV A;  3V61 A;  1K8R B;  4CO7 A;  3KH0 A;  3APD A;  3JW0 X;  4MEL A;  2DYM A;  1V80 A;  1Z5S B;  5E6P A;  3ZNZ B;  1P0R A;  5JHA A;  1ZKH A;  4I6P A;  1OEY A;  3OJ3 A;  5JHB A;  3TCA A;  4W9H A;  1WXV A;  4K81 A;  3C0R B;  1WXM A;  3EFU A;  3AUL A;  1LFD A;  5CHF A;  1D3Z A;  4HLE A;  2KXJ A;  2JY6 A;  1E8Z A;  2MLB A;  4AJY B;  2V4L A;  3PPA A;  2C7M B;  3RUL A;  3V6C B;  2GBJ A;  4IW0 A;  3VH4 B;  4ZRI A;  2KC2 A;  3A1Q A;  4N9F 4;  2NVU I;  3KUD B;  4WWP A;  3M3J A;  3GOE A;  3H6N A;  3U30 A;  3VUW A;  2Z59 B;  3R7R A;  4BKT A;  4BKG A;  2IZV B;  2D11 A;  2KAN A;  2MP2 A;  2RPQ A;  1OTR B;  4LCD E;  5LXI B;  5JZE B;  1M94 A;  2M1M A;  2ZNV B;  1WGG A;  2CHX A;  3RYT A;  4NJ6 A;  5L95 C;  2RSU A;  2C9W B;  3N32 A;  1LM8 B;  3B0A A;  4HK2 A;  4WJQ A;  2CS4 A;  2KJR A;  2K1F A;  2LRU A;  3QC8 B;  4JIO U;  4DHJ B;  3CSF A;  4DHZ E;  4E71 A;  1UGM A;  2CR5 A;  2L05 A;  4BOS C;  2FAZ A;  3HIZ A;  4MEM A;  1UD7 A;  3VVW B;  5KHQ A;  2L00 B;  4AP4 C;  3H9D A;  1SGH A;  4MJS B;  1TZ1 A;  2GMI C;  2AL3 A;  1XT9 B;  5GMV A;  3V60 A;  3K9P B;  3MHS D;  2W9N A;  3W1S C;  5C1Z A;  1IPG A;  2K25 A;  4I6L B;  3OAW A;  2DX5 B;  4DDI D;  3ML8 A;  3ZUN A;  2ZZP B;  3QX1 A;  4TQ0 A;  3APC A;  4W9I A;  4XZ4 A;  2EMT A;  2KD0 A;  5LLI A;  1TBE A;  2ZEQ A;  4ASW C;  5DPS A;  2MSE D;  3M95 A;  4KIK B;  3PVL A;  1IP9 A;  3ZIM A;  1E7U A;  4IUM B;  5AZF A;  4EKU A;  2ZPN A;  3T8M A;  3B08 A;  4KDL B;  2ZCC A;  4JL9 A;  3VFK A;  3D32 A;  5LXH A;  2KOX A;  3MJW A;  2L7R A;  3QAR A;  3HHM A;  4MGI E;  4HCN B;  2WWZ A;  1U4A A;  4PS3 A;  2KX0 A;  2YLM A;  3NY5 A;  5D6J B;  5DPT A;  2LUE A;  2MRP A;  2NPT B;  1AAR A;  2RGF A;  3A9J B;  3QQ8 B;  3UF8 A;  3VQI A;  4FJZ A;  5KHO A;  2BGF A;  2N1W A;  1P98 A;  3CST A;  2AEH A;  4BFR A;  5J17 A;  2D2Q A;  2KMC A;  2DZI A;  3AU4 A;  1LQB A;  3SD5 A;  3VXW A;  3ZW3 A;  3W1S A;  3PRM B;  2PJH A;  3L17 A;  2R2O A;  3M62 B;  2OOB B;  3ZNH B;  1NI2 A;  4GXB A;  1NBF C;  1WFY A;  3QK0 A;  3IBE A;  4ANX A;  3K9O B;  2NBU A;  1WXA A;  1LXD A;  2CU1 A;  3VUX A;  4KSK C;  1GNU A;  3WAL A;  3ALB A;  2MWS B;  2ZVN A;  1MG8 A;  3GZN I;  4TQ1 A;  3VTW A;  2ZJD A;  3QCA A;  4IM3 A;  3ZTC A;  4G50 A;  3IFW B;  3HM3 A;  3R66 C;  3V62 A;  4GDL B;  2K6Q A;  2C60 A;  2DAF A;  4WWN A;  1RFA A;  3PZD A;  5D7G A;  3DCG A;  2LXC A;  3QJZ A;  3CMM B;  4JQW C;  4GOC A;  1I35 A;  4IM0 A;  4PS7 A;  1G6J A;  5CX3 A;  3APF A;  1GJZ A;  4W9J A;  3L16 A;  3LJ3 A;  3PHW B;  2D07 B;  2DZM A;  2JXX A;  3WAN A;  2UYZ B;  3QAQ A;  2KK8 A;  4HDO A;  3N3K B;  4FUL A;  3DDC B;  3NOB A;  2V1Y A;  3ZKJ C;  2G3Q B;  2JF5 A;  5TR5 A;  3PT2 B;  2VRR B;  2R2Q A; 
#chains in the Genus database with same CATH topology
 1P3Q U;  2A4Z A;  1V5O A;  3V05 A;  2J0M A;  1YN5 A;  3NVZ A;  2OJW A;  1UUP A;  3N30 A;  4KKI A;  2MJE A;  2VZK B;  2Z0E B;  2K6D B;  3I3T B;  2ZPY A;  3BII D;  3DBH B;  4EOY A;  1EO6 A;  4A3P A;  5D94 A;  1WMH B;  2YVC A;  4WQO B;  3T9L A;  3ECI A;  1QQR A;  1RLF A;  2E3T A;  2WP9 B;  4RGM A;  2PVG C;  1B1Z A;  2DNF A;  4KGR A;  1I4G A;  2O6V D;  2KFK A;  2NTS A;  1HTO A;  3KYD D;  3AE3 B;  2FNJ B;  2W55 A;  3EA6 A;  1K51 A;  3FIL A;  5AZG A;  1MJD A;  1V2Y A;  2L1A A;  1ZPS A;  2OJR A;  1ET9 A;  3ZNI D;  2WNM A;  1ZXH A;  3EEC A;  3Q8A A;  2HD5 B;  3AE4 B;  3IT6 B;  3TIX A;  1KFY B;  4DBG A;  2C7H A;  1TYG B;  1UZX B;  1SE9 A;  1BUI C;  4IOI E;  2WXG A;  5D3D A;  3ZRF A;  3BYT B;  1V9J A;  1YD8 U;  2UU7 A;  1KM7 A;  1UH6 A;  2XN9 C;  4DHJ D;  3I5J C;  1T6B X;  1E10 A;  3IHP C;  4X57 B;  4JPS A;  1PGB A;  5T8I A;  4A3O A;  5E6J A;  4CHK A;  2WDR B;  4M8M A;  4RH6 A;  3OG5 A;  4A9A A;  3ZJV A;  1VRA B;  2RDB C;  1BML C;  1P7E A;  2LGS A;  5DPR A;  3RD2 A;  3UQB A;  4JWS C;  3ZRC A;  1JCK B;  2WXR A;  4YTN B;  1QT9 A;  2N9P C;  4NJ7 A;  1NEN B;  1VZ7 A;  1I7H A;  4IDI A;  3X23 A;  4EFO A;  1TY0 A;  1CZP A;  2KVR A;  4FJY A;  3FC4 A;  3TSS A;  3MC8 A;  4XX5 A;  1RAX A;  2ZNV C;  2JX5 A;  4DDG D;  2PTL A;  2IO1 B;  3PS6 A;  3N1Z C;  4HVB A;  2DHZ A;  2WX1 A;  2HE7 A;  1WRD B;  2ICI A;  4OW0 A;  4FXC A;  4HEA 1;  5JH5 C;  4BOZ B;  4ANV A;  4JLC A;  2I1J A;  2IO3 B;  3V62 A;  1WZ0 A;  3DOW A;  1C1Y B;  2GLS A;  4IWO A;  1ROE A;  1QIL A;  4NNJ B;  1HEZ E;  1FRD A;  2QJL A;  2QCZ A;  4YSY B;  1HE8 A;  4W9L A;  3TUO A;  2G45 B;  2Q5W D;  3N20 C;  3Q3M C;  2HTH A;  3SFD B;  4C7Z A;  1WGD A;  4GU2 A;  2EKI A;  1NDD A;  2VZK D;  1YN3 A;  3W2D A;  2DBY A;  4GN1 A;  1KTK A;  2KFK B;  2WXQ A;  4YTP B;  2EKE C;  2L8J A;  4II3 B;  3U52 E;  2KX3 A;  3AEC B;  2BYF A;  4NAM A;  4JWU C;  3IG3 A;  3DWG C;  2L32 A;  1T0Y A;  3NVY A;  2FID A;  3U8Z A;  1WGH A;  2QIE B;  4GLS C;  2GBR A;  2MBO A;  1KJT A;  1XLO A;  5FKA C;  2FCS A;  1PQS A;  3Q8C A;  4IWQ A;  2JT4 B;  3CIR B;  2WX0 A;  4DQO C;  2RR9 A;  3IVF A;  2BKF A;  2IJ0 A;  1D6E C;  3OLM D;  3H1U A;  4KSL C;  4W9E A;  1FO4 A;  1F0Z A;  2KNB A;  5HKH A;  1X1M A;  3I9V 1;  5IA7 A;  4G11 A;  4ZHP A;  3B9J A;  2V3S A;  1D5X C;  3AI5 A;  1HZ6 A;  3VR8 B;  4A8X C;  4F7Z A;  3NVW A;  2ONQ A;  2KDI A;  2N9K A;  1YN4 A;  2W3R A;  4HDQ A;  3MC9 A;  4PYU A;  1VZ8 A;  3WCQ A;  1KRH A;  3RZW C;  2BYE A;  2GBN A;  2K0P A;  1OQY A;  1A70 A;  4BZA A;  1JAL A;  2O2V A;  3Q3N C;  3P4P B;  1WXS A;  4KGT A;  4J6I A;  1D5Z C;  2B3A A;  1MG4 A;  5HFY A;  1R4M B;  2N9E B;  2DYB A;  1KH0 A;  3VR9 B;  1N60 A;  4OVZ A;  4CO7 A;  3APD A;  2JXT A;  1Z5S B;  3GE8 C;  2MJ3 A;  5E6P A;  2HDE A;  4QAY A;  2K3U A;  4RF1 A;  4I6P A;  4NJC A;  4A55 A;  3T3O A;  3C0R B;  1C9F A;  1WXM A;  1QOB A;  3AUL A;  4KKJ A;  3MC0 B;  2MLB A;  4XWT A;  1R7S A;  2V4L A;  2C7M B;  1FNW A;  3SR6 A;  3A1Q A;  4WWM A;  5LNK 1;  2NVU I;  4WWP A;  1L6V A;  3U30 A;  1FXA A;  4BKT A;  1SJE D;  2D11 A;  3GZN B;  2RPQ A;  3ZJT A;  1OTR B;  2EEL A;  3B2F A;  2CHX A;  1WRI A;  1JWB D;  5L95 C;  2C9W B;  1LM8 B;  3B0A A;  2LRU A;  3QC8 B;  4JIO U;  1UGM A;  2CR5 A;  3P42 A;  1CQV A;  1UD7 A;  1C78 A;  1HZ5 A;  1TZ1 A;  4YWG G;  3K9P B;  5C1Z A;  3OAW A;  2PLP A;  1ZUD 2;  3QX1 A;  4TQ0 A;  4K3C A;  2LMC A;  4W9I A;  2MJD A;  2EMT A;  5LLI A;  4ASW C;  1ZP0 B;  2MSE D;  3PVL A;  3VRB B;  5AZF A;  2ZPN A;  3AEG B;  2WU5 B;  3VFK A;  5LXH A;  3P63 A;  2I38 A;  3QAR A;  4HCN B;  2KX0 A;  2YLM A;  1JML A;  3P4R B;  2N1W A;  3L4P A;  2D2Q A;  3P1M A;  3SD5 A;  2LHD A;  3L17 A;  3PRM B;  3M62 B;  2OOB B;  1NI2 A;  4M02 A;  3IBE A;  3K9O B;  2NBU A;  3TEZ A;  2BTE A;  2GB1 A;  1GNU A;  5HI1 A;  1T0R C;  4RF0 A;  3HVZ A;  1F52 A;  4IM3 A;  3IFW B;  3HM3 A;  1QOF A;  3DWM A;  2DAF A;  4P1B C;  1RFA A;  2YEP F;  5D7G A;  2LXC A;  1SB3 C;  4PS7 A;  4RFB A;  1YNT E;  4HRO A;  1F2R C;  1GJZ A;  3HRD D;  3L16 A;  3LJ3 A;  3PHW B;  3Q6B A;  4FUL A;  3LXF A;  1NI3 A;  3ZKJ C;  5D6J B;  2WS3 B;  3PT2 B;  2VRR B;  4HJK A;  4FHJ A;  3EUB 2;  1GB1 A;  1D5M C;  4FAD A;  3QWZ B;  2KAC A;  2LAS A;  2JU6 X;  2O2V B;  1V97 A;  2RMM A;  3AE2 B;  2AWT A;  2N0S B;  1TGZ B;  2QMT A;  2ACZ B;  1E6E B;  4M0W A;  1JW9 D;  1P1A A;  1C4A A;  3SEB A;  2JRI B;  1OGW A;  2KWU B;  2JUO A;  4NQL B;  3LDZ E;  1GPX A;  4R3D A;  3JSV A;  3NZS A;  3A1Q B;  1AWD A;  3EHV A;  3NJT A;  1GAQ B;  4W9G A;  3IT4 B;  3R3M A;  4WWO A;  2WXO A;  2RD0 A;  1GC6 A;  1YIW A;  2B76 B;  2M17 A;  5BMI A;  4XWW A;  5DPW A;  1K50 A;  1MI0 A;  4TKN A;  3R2I A;  1LO5 D;  4C4V A;  3O13 A;  1WWT A;  1C3T A;  1ISN A;  2EMS A;  2KDE B;  4XGA B;  2WDT B;  1DOX A;  5IN7 A;  3AE9 B;  4HPL B;  2KDF B;  4LDT B;  4WQM A;  2NPT A;  2K8B A;  3DBH I;  1ZGU B;  3RNB C;  2BKR B;  3ML9 A;  4JE3 B;  4US9 A;  1A5R A;  3HUI A;  1NVI D;  1P7F A;  3VDZ A;  5EE3 A;  4MH0 E;  2JPH A;  4WJO A;  3A4R A;  2BQQ A;  3ABV B;  4PK1 A;  2Y5C A;  1WE6 A;  1RYJ A;  3SDL C;  3AE5 B;  2M0A A;  4RGN A;  3Q14 C;  4HKQ A;  4ICU A;  1UBI A;  1WGR A;  3DHH C;  3AV8 A;  2AX5 A;  3AM9 A;  1F77 A;  4ZRP A;  3L08 A;  4MT5 A;  4YT0 B;  1VR9 A;  2PW9 A;  1WZ3 A;  3UIN B;  2XBB C;  1TTN A;  2Z0D B;  3AXC A;  1WYW B;  3RFZ B;  4WJP A;  3ZTD A;  4RCO A;  3ZGZ A;  2WXF A;  2M0X A;  3ZDM C;  4REZ A;  3L54 A;  2CHW A;  1WM3 A;  2KFJ A;  3RI7 C;  4FN2 A;  2DYO A;  3AE6 B;  4AOF A;  3MTN B;  3AEA B;  3P4Q B;  2MBB B;  3VHT C;  5D2M B;  2XNA C;  1ET6 A;  4MGK E;  4PYZ A;  1TS4 A;  2KJ6 A;  3SFE B;  2LJ5 A;  2L3Z A;  4WIP A;  3PSE B;  1Q0W B;  4HPM B;  1C79 A;  3X0W A;  3O65 B;  4II2 B;  1YX6 B;  4M0W B;  3RCZ A;  2KWV B;  3DBS A;  4MM3 A;  3AE7 B;  1PYW D;  2PPH A;  4ZRJ A;  5IP4 D;  1RWS A;  1WY8 A;  1J0G A;  2LVQ A;  3KW5 B;  1CMX B;  1XLP A;  4B95 A;  2FBW B;  3PGE A;  2N9L A;  1SE4 A;  2QEJ C;  3WAM A;  3JSV B;  2FIF A;  1F9J A;  4GB9 A;  1WF9 A;  2Y5B B;  2WXI A;  3EC8 A;  2LGX A;  1QKZ A;  1P9D U;  2W3S A;  2BWE S;  1WJU A;  3AU5 A;  1XEE A;  2RDG A;  4ANW A;  3N1Y C;  3DPD A;  1XCQ L;  4AUQ C;  1QZE A;  2DZJ A;  2OED A;  2INC C;  3PLV A;  2L76 A;  2H88 B;  4KZ0 A;  2KWD A;  2NS5 A;  4C4V B;  3BVG A;  3HK0 A;  1MHH E;  1ZDV A;  2RPV A;  1CJE A;  1XF5 L;  2J7Q B;  1EWY C;  3H7S A;  2KMA A;  1T0Q C;  4ZYN A;  2MX2 A;  1F2R I;  5IAA C;  4NY0 A;  1MPE A;  3Q3O C;  3A4S C;  2FCQ A;  3QA8 A;  1VLB A;  3TBL D;  4LDT D;  1FXI A;  1BT0 A;  4CYE A;  1F1H A;  2BS2 B;  2FUH B;  1WI0 A;  1TT5 B;  2MEK A;  3GB1 A;  1L2N A;  2FCM A;  4DWF A;  4LJO B;  3CF6 E;  4M8N A;  2KQ4 X;  2AYO B;  3AMZ A;  2NR2 A;  4DK5 A;  2ZCB A;  2Y5P A;  4FHK A;  3ONS A;  1WGK A;  1RRB A;  1V49 A;  4GMV A;  4W9F A;  3PRP B;  2PE6 B;  4FA6 A;  5MPO A;  3TMP B;  1SE2 A;  4LJP B;  1S3S G;  2KQ7 A;  2AQ2 B;  3VTV A;  2G4S A;  1TZO A;  3J9C A;  4GIV A;  1FNV A;  1K8R B;  3JW0 X;  2DYM A;  3ZNZ B;  1P0R A;  1ZKH A;  1OEY A;  3OJ3 A;  4W9H A;  1I4X A;  3B2G A;  3MJ5 A;  1N63 A;  4MH8 A;  4IW0 A;  4ZRI A;  2KC2 A;  2J52 A;  1XLQ A;  4N9F 4;  3KUD B;  2GI9 A;  1TS5 A;  4ZHO A;  3GOE A;  4C7Y A;  2IZV B;  2KAN A;  2MP2 A;  4LCD E;  3GS2 A;  3W5V B;  2M1M A;  2WLB A;  1WGG A;  3FIL B;  3W5U B;  4Q2J A;  4MM3 B;  4DHZ E;  2V3N A;  4AS1 A;  5IKC M;  4BOS C;  3VVW B;  4AP4 C;  1SGH A;  2OHF A;  3U4E G;  2N7J A;  1VZ6 A;  3KLS X;  3MHS D;  3FKY A;  4I6L B;  2K25 A;  1NEK B;  2ZZP B;  3U2S C;  4N59 A;  3M95 A;  2LJI A;  3ZIM A;  1E7U A;  4IUM B;  4XDC A;  4S17 A;  3D32 A;  2KOX A;  4MGI E;  2WWZ A;  1U4A A;  5H92 C;  3VQI A;  3UF8 A;  5KHO A;  1GOZ A;  4BFR A;  1P98 A;  3CST A;  3NG0 A;  4M01 A;  2YEP B;  3VXW A;  3AU4 A;  2PJH A;  1AW7 A;  3AE1 B;  4ANX A;  2X38 A;  1N6Z A;  1WXA A;  2CU1 A;  2VH1 A;  1MG8 A;  3GZN I;  4TQ1 A;  3VTW A;  4ZYS A;  5EE9 A;  3QCA A;  4G50 A;  3R66 C;  3PZD A;  4CQN A;  4YTM B;  1I35 A;  4JQW C;  4GOC A;  4IM0 A;  1V1P A;  3HVD A;  3NUH B;  3BK2 A;  3QAQ A;  3N3K B;  5IO9 A;  3DDC B;  3NOB A;  2ON8 A;  2V1Y A;  4K3B A;  3RNA C;  4F1S A;  5CTR C;  4MGZ E;  2MBQ A;  4BBN C;  2WHI A;  1UWX A;  1KF6 B;  3RNC C;  2LI5 A;  2XK5 A;  2INP E;  4FLH A;  2BYT A;  1JWU D;  4USA A;  2A5U A;  1Q5W B;  4OVV A;  5G2N A;  5J18 A;  2CU3 A;  3P4S B;  1YQ3 B;  2NBV B;  3BY4 B;  4OVU A;  5BYR A;  2N7E A;  1V1O A;  4M00 A;  4P1C C;  2KTF A;  2JWU A;  1V86 A;  1GB4 A;  1E7V A;  3A9K A;  3HM6 X;  1YJ1 A;  3TEX A;  1S1Q B;  4ZOH C;  3DVN U;  4IM2 A;  4ITK A;  2GRI A;  1EU4 A;  1Z2M A;  2HJ8 A;  3PRZ A;  1E8Y A;  1V81 A;  1WE7 A;  5EDS A;  4LNO A;  1I4R A;  1JWA D;  3CWI A;  3DVG X;  1IUE A;  1XD3 B;  1FFV A;  1T0S C;  2VH2 A;  3KUZ A;  4YSZ B;  4MAC A;  2MP2 B;  4RGO S;  3PV1 A;  2PE9 A;  4RMA A;  2C5L C;  2MCN B;  5IOI A;  5JXV A;  2LZ6 A;  2LGI A;  4RM9 A;  4TSS A;  1MFW A;  1FFU A;  4ZDV A;  1FCC C;  1QLB B;  1J7B A;  2D5G A;  1UF0 A;  5D3I B;  2IO2 B;  4YSX B;  3NS8 A;  1SE3 A;  1I42 A;  2KO3 A;  2K9X A;  4HWI B;  1WXQ A;  4FJV B;  3DBR B;  3MP9 A;  1H4R A;  2GBM A;  4H2A A;  3UIO B;  2H89 B;  1Q10 A;  2LVO A;  2W82 A;  3DBL B;  2NBW B;  2BBC A;  2KLG A;  2BS3 B;  4BAX A;  4IG7 B;  2CKH B;  3TJP A;  1D4B A;  1XO3 A;  2QIL A;  5HHD G;  4NQK E;  1J7C A;  2KN4 A;  1ZDX A;  4TUU A;  2FUG 1;  1ZW7 A;  3OJ4 B;  3LYY A;  5AZH A;  4G0N B;  2IGD A;  4BKS A;  1SBB B;  1EM7 A;  5E6N A;  2CJO A;  2WXK A;  1TS3 A;  2BYV E;  1WX8 A;  4WJN A;  3AH7 A;  2IYD B;  2KQS A;  2D3B A;  2LXA A;  2KHW B;  1V1P B;  3KYC D;  1JWM D;  1QOG A;  2MHJ A;  1L4Z B;  3IAM 1;  4HXD A;  4HCP B;  3SU8 X;  3L10 B;  1XLN A;  3R2T A;  3PHX B;  5BYS A;  2MW5 A;  4LNF A;  3SHQ A;  4HJG E;  4G3X B;  4WUR A;  2HJ1 A;  4LTU A;  4MDK E;  2XK5 B;  1PGA A;  1FPY A;  1FD6 A;  3EGR A;  2CHZ A;  3DVG Y;  5J2R A;  4RM8 A;  3PLU A;  4KDI C;  1I4Q A;  1OQR A;  3C8Y A;  3Q8B A;  2DEN B;  4IC7 B;  2GBK A;  3A9K B;  3H8H A;  2X8X X;  4WAF A;  3ZLZ A;  4MJS A;  2LWP A;  1YJI A;  3WAO A;  1FXT B;  1E8X A;  1VCB A;  3BYY B;  4HPP A;  3GP7 A;  4YL8 A;  1V6E A;  1UWM A;  4ACF A;  2JVC A;  1ESF A;  5G5G A;  2REX A;  1EF5 A;  4I6N B;  4KIK A;  1E9M A;  3KWV A;  2IY1 B;  1WJN A;  2V0G A;  3Q3F A;  2JZ3 B;  2NTT A;  2TSS A;  3T3N A;  3I57 A;  1R4N B;  3A9J A;  3P2B A;  5AUK A;  4N6E B;  4URK A;  2K8H A;  2BB6 A;  4L23 A;  1SF0 A;  2QDF A;  1KLV A;  4K7S A;  5L83 A;  3NRZ A;  3JYU A;  2SEB D;  2N9X A;  2MBE A;  2WDV B;  2PEA A;  4GSW A;  2LHE A;  2WQY B;  3AB5 A;  4GDL A;  3OWE B;  4F8C B;  4HRS A;  2WXM A;  3KUC B;  1MHX A;  1XQQ A;  1SXT A;  2BPS A;  1YOV B;  2IBI B;  1JRO A;  4C00 A;  3L0W B;  1KOT A;  4GGQ A;  4KV2 A;  4B9K A;  1GC7 A;  1JRU A;  1SSN A;  2L0F A;  3ZO5 B;  3BVZ A;  2RDH A;  4OZC A;  3ZYY X;  2JWZ A;  4MSM B;  3C19 A;  3ENE A;  1WX7 A;  1ENF A;  1QOA A;  2JZZ A;  5FR6 A;  4MGY E;  4BVU C;  1UEL A;  1FM0 D;  2AQ3 B;  3AE8 B;  2BW2 A;  3KH0 A;  4MEL A;  2LFI A;  3NS1 A;  5JHA A;  4N58 A;  3RMK C;  5JHB A;  1L0X B;  1WXV A;  3EFU A;  1LFD A;  1D3Z A;  4HLE A;  2JY6 A;  4AJY B;  4JX1 C;  3PPA A;  3M3J A;  1Y56 A;  2WXP A;  3H6N A;  3VUW A;  2Z59 B;  3R7R A;  3FAH A;  4BKG A;  1PUT A;  1AN8 A;  5BMG A;  2BB5 A;  2LUM A;  5JZE B;  1M94 A;  3RYT A;  2K5P A;  4NJ6 A;  2RSU A;  3N32 A;  4HK2 A;  4WJQ A;  1QF6 A;  2KJR A;  3ETR A;  3CSF A;  1TKY A;  1STE A;  4XE0 A;  4MEM A;  5KHQ A;  5AUI A;  1E0Z A;  1OFF A;  3H9D A;  2QSD A;  5G5H A;  4MJS B;  4RNA A;  3IXS A;  5GMV A;  2W9N A;  3R8B A;  4TMA B;  1IPG A;  4B0E A;  1JRP A;  1FRR A;  1I4P A;  3ML8 A;  1SEB D;  2BT6 A;  3APC A;  3DHG C;  4XZ4 A;  2KD0 A;  1TBE A;  5DPS A;  4KIK B;  3Q8E A;  4EKU A;  3T8M A;  2PVO D;  4KDL B;  2ZCC A;  2IGG A;  5C3J B;  3RNE C;  2IDY A;  3NY5 A;  2LUE A;  2MRP A;  2NPT B;  1AAR A;  2RGF A;  3A9J B;  3QQ8 B;  2INN E;  4FJZ A;  1NYR A;  5J17 A;  5GXG B;  1ZOY B;  2KMC A;  1HA5 A;  1LQB A;  3W1S A;  2KYW A;  3ZNH B;  4J3O D;  4GXB A;  4B0M A;  1WFY A;  3QK0 A;  3AN1 A;  2JSV X;  2WXN A;  4HKZ E;  3N9Y C;  2WU2 B;  2D3C A;  3VUX A;  4KSK C;  2Z8L A;  3WAL A;  3ALB A;  2MWS B;  3RN9 C;  1KLG D;  2ZJD A;  3ZTC A;  1RFK A;  1V8C A;  4GDL B;  4WWN A;  5I4D A;  1M4V A;  3BZD B;  3V3X A;  5CX3 A;  3APF A;  2D07 B;  2DZM A;  3WAN A;  4NZL B;  3AEE B;  2KK8 A;  4HDO A;  4IKG A;  4DXG A;  2M19 A;  2JYE A;  2R2Q A;  1KLU D;  1WR1 A;  4NAW A;  1HQR D;  3RT3 B;  2FCN A;  4FBJ B;  1J7A A;  1VJK A;  4KZC A;  4YXD B;  4K1R B;  1WH3 A;  3PRE A;  1BXT A;  2G4D B;  5EE1 A;  1N5X A;  1N5W A;  2AL6 A;  3S2A A;  4MSQ B;  2JQR B;  4JGH B;  1N61 A;  2L0T A;  3BIN A;  2LGD A;  4BKS D;  2MBH A;  1GUA B;  1WYG A;  4LLG M;  3I63 C;  1K53 A;  2LD9 A;  2KJH B;  4S0R A;  2Y3A A;  5H8Y E;  3VAW A;  1YX5 B;  2NCN A;  1PDX A;  3H7P A;  2ZW1 A;  4ARI A;  3NZ3 A;  1IGC A;  2KDM A;  2KWC A;  3LB8 C;  1N62 A;  4LNN A;  2J42 A;  5G55 A;  2IY0 B;  4ZRQ A;  4WAA A;  1JWS D;  2DWQ A;  2KN5 A;  2M4N A;  3VTU A;  2KKC A;  2M56 B;  3JVZ X;  1MVK A;  1T3Q A;  4B6W A;  1H8C A;  4K7W A;  4K7U A;  3VH3 B;  4DXA B;  2KVZ A;  4P7I A;  3KVF B;  4C56 C;  3VRA B;  2MA9 B;  1R4M I;  5BO4 B;  2LGY A;  5CHW A;  1FCL A;  1NYQ A;  1WX9 A;  4OZA A;  3RNG C;  2JYT A;  2I2Y A;  1L5P A;  4GDK A;  2PIA A;  4LK0 M;  5FR3 A;  4BBN F;  2FE8 A;  3U7D A;  2KDB A;  4E74 A;  4PS8 A;  1OEY J;  5E6O A;  4EZK A;  2LRW A;  2JZP A;  3WAP A;  3R7Q A;  1AYF A;  2WYQ A;  3DQV A;  2GOW A;  4ICV A;  1L7Y A;  3Q3J A;  3ZNG C;  1E8W A;  1L4D B;  4ZRK A;  2IO0 B;  4L1B A;  4RGT A;  4DHZ B;  4KX6 B;  4O1N A;  1L6U A;  3WA0 A;  4WH4 A;  2KAJ A;  2J53 A;  5FK9 C;  2N1V A;  2KTR A;  4EEW A;  2N7D A;  1IYF A;  4P16 A;  5TSS A;  1B9R A;  1VD2 A;  2N4F A;  2O6V A;  1SIF A;  2I1K A;  4NPN A;  2KMM A;  2DAJ A;  2WDQ B;  1RM6 C;  2KLC A;  3UQA A;  5C23 A;  1EU3 A;  4DXF A;  5BYQ A;  3W9C B;  1TIF A;  5AEK B;  2C7N B;  3NZU A;  1C4C A;  4AWJ A;  4LNK A;  3IAS 1;  4A6Q A;  1WGY A;  2K8C A;  4NAW B;  5BMH A;  2JRH A;  1J19 A;  4A90 A;  1JQ4 A;  2J0K A;  3E9S A;  3NHE B;  3RUI B;  2D10 A;  3DBR I;  1IGD A;  3DVN V;  4XC2 A;  5DCN A;  3QHT A;  1GG3 A;  4C80 A;  3PTF C;  2BWF A;  3DBL I;  2PKO A;  4EUT A;  3KQ4 A;  1FEH A;  1EUV B;  2XEW A;  4KGS A;  1T5X D;  3ZVV A;  2LEK A;  1IBX A;  4IWP A;  4KVG B;  4TV3 A;  3TEY A;  1WR6 E;  1UBQ A;  2L83 A;  1C4P A;  4ANU A;  2DZK A;  3A33 B;  3H7P B;  2ZW0 A;  3GE3 C;  2KZR A;  4W9C A;  4P6V F;  5CHV C;  2R61 A;  1YQB A;  4E3C A;  3UIP B;  2MQJ A;  1EF1 A;  2D3G A;  2SAK A;  1DOI A;  1TS2 A;  2M8S A;  2G1E A;  1E5W A;  2KC1 A;  1WIA A;  3UI3 A;  2WXL A;  3B1L X;  2UWQ A;  1TJE A;  3WIM A;  3ZXR A;  3TL5 A;  3RZF A;  1LGR A;  3ZDT A;  1V5T A;  3V6E B;  3UGB B;  2WGS A;  3BWU D;  4PT5 A;  1DGJ A;  4GDK B;  1YQ4 B;  1HTQ A;  1C77 A;  1E90 A;  1Y8R C;  3URY A;  4W9D A;  2QHO A;  1SIJ A;  4XDD A;  3M63 B;  3ZJU A;  2V3P A;  3EFC A;  2K39 A;  4EZJ A;  3W1Y A;  2LVP A;  5EE0 A;  4D2K A;  1WM2 A;  3AEF B;  1C76 A;  2BVC A;  2ZVO A;  4AQ7 A;  4EZL A;  4A20 A;  2V9H A;  4XYC A;  2L52 A;  1TKG A;  3NVV A;  3PO0 A;  1FIQ A;  1WJ4 A;  4W9K A;  2ASQ A;  4ARC A;  2E6X A;  4AJW A;  2KTR B;  3L13 A;  3QIJ A;  1WJ6 A;  1J8C A;  1Q1O A;  3AEB B;  1UGJ A;  1L0V B;  2BF8 B;  2O6V B;  1TKE A;  1ZXI A;  2J0J A;  1FNU A;  3Q69 A;  2K22 A;  3N1X C;  1WMH A;  3PZ7 A;  3VUY A;  1R4N I;  3V61 A;  1WSP A;  4L2Y A;  2W54 A;  1V80 A;  3Q2A C;  5HG2 A;  3TCA A;  2QC8 A;  3DHI C;  4K81 A;  5CHF A;  2PMV A;  2KXJ A;  1E8Z A;  3BVM A;  2V4I B;  2IGH A;  3RUL A;  3V6C B;  2GBJ A;  3VH4 B;  2WXH A;  4LNI A;  3ZXV A;  1OQQ A;  3RNF C;  1HXY D;  4OZB A;  5LXI B;  3TEW A;  2ZNV B;  1SJH D;  2J4X A;  2CS4 A;  3MFG A;  2K1F A;  2AQ1 B;  4DHJ B;  4E71 A;  2L05 A;  1IBX B;  2FAZ A;  3HIZ A;  5C2T B;  2L00 B;  4US8 A;  2GMI C;  2AL3 A;  1XT9 B;  1K52 A;  3V60 A;  1FMA D;  3W1S C;  4EE2 A;  2HTM E;  1DYQ A;  4UDU C;  2DX5 B;  1E7P B;  3ZUN A;  1XXG A;  4DDI D;  1L0Y B;  3AED B;  2DLB A;  1ACC A;  2ZEQ A;  2BS4 B;  1IP9 A;  1I4H A;  3B08 A;  4JL9 A;  3E56 A;  3MJW A;  2WXJ A;  3RPF C;  2L7R A;  3PZ8 A;  3U7Z A;  2G9H D;  3HHM A;  1YMH E;  4PS3 A;  1TY2 A;  1PFD A;  2MH7 A;  3ZQ4 A;  5DPT A;  1EWC A;  2BGF A;  1UNS A;  2AEH A;  2NMQ A;  2DZI A;  3ZW3 A;  2R2O A;  1NBF C;  1DOY A;  2KT7 A;  1LXD A;  1ZE3 D;  2ZVN A;  1VDV A;  1XCT L;  3MHZ A;  1CK1 A;  1YJJ A;  2K6Q A;  2C60 A;  2IND C;  3DCG A;  3QJZ A;  3CMM B;  2CJN A;  2IPK D;  3Q8F A;  3KWL A;  1G6J A;  2D3A A;  4W9J A;  3BK1 A;  4OHJ A;  2JXX A;  2UYZ B;  1PGX A;  2G3Q B;  2JF5 A;  5TR5 A; 
#chains in the Genus database with same CATH homology
 1P3Q U;  1WR1 A;  4FHJ A;  2A4Z A;  4NAW A;  1V5O A;  3RT3 B;  2J0M A;  2FCN A;  4F1S A;  4FBJ B;  3N30 A;  5CTR C;  4FAD A;  3QWZ B;  2LAS A;  4MGZ E;  2MBQ A;  4BBN C;  2Z0E B;  2O2V B;  4KZC A;  2LI5 A;  2XK5 A;  2K6D B;  3I3T B;  4K1R B;  2ZPY A;  4FLH A;  1WH3 A;  3PRE A;  2A5U A;  1Q5W B;  2G4D B;  1EO6 A;  4OVV A;  5G2N A;  4EOY A;  2AWT A;  5J18 A;  1TGZ B;  4A3P A;  2NBV B;  3BY4 B;  4OVU A;  5D94 A;  1WMH B;  2AL6 A;  3S2A A;  2YVC A;  4MSQ B;  2N7E A;  4WQO B;  3T9L A;  3ECI A;  1RLF A;  4JGH B;  2L0T A;  3BIN A;  2KTF A;  1V86 A;  2LGD A;  2MBH A;  4BKS D;  1GUA B;  1E7V A;  3A9K A;  3HM6 X;  1YJ1 A;  1P1A A;  1S1Q B;  2JRI B;  3DVN U;  1OGW A;  2KWU B;  2O6V D;  2JUO A;  4IM2 A;  2LD9 A;  2KFK A;  2KJH B;  4NQL B;  3KYD D;  3VAW A;  3LDZ E;  1YX5 B;  2FNJ B;  2NCN A;  1Z2M A;  2HJ8 A;  3PRZ A;  3JSV A;  3NZS A;  3A1Q B;  1E8Y A;  1V81 A;  3H7P A;  1WE7 A;  5AZG A;  5EDS A;  3EHV A;  1V2Y A;  2KWC A;  3DVG X;  2OJR A;  1XD3 B;  3KUZ A;  3ZNI D;  4W9G A;  3EEC A;  2MP2 B;  5G55 A;  3R3M A;  4WWO A;  2IY0 B;  3PV1 A;  2PE9 A;  4RMA A;  4WAA A;  2KN5 A;  2M4N A;  3VTU A;  2RD0 A;  2C5L C;  2HD5 B;  2KKC A;  3JVZ X;  2MCN B;  1GC6 A;  3TIX A;  4B6W A;  4K7W A;  1H8C A;  1YIW A;  4K7U A;  2LZ6 A;  3VH3 B;  4DBG A;  4RM9 A;  4HJK A;  2C7H A;  2M17 A;  1UZX B;  4DXA B;  4P7I A;  4ZDV A;  3KVF B;  2MA9 B;  5DPW A;  1SE9 A;  1R4M I;  5BO4 B;  4TKN A;  2LGY A;  5CHW A;  2IO2 B;  1C3T A;  3ZRF A;  3NS8 A;  4EEW A;  1V9J A;  1WX9 A;  1ISN A;  2EMS A;  2KDE B;  1YD8 U;  2WDT B;  1I42 A;  2KO3 A;  4GDK A;  4BBN F;  1KM7 A;  1UH6 A;  2KDF B;  4HPL B;  4LDT B;  2NPT A;  4DHJ D;  2K8B A;  4HWI B;  3U7D A;  2KDB A;  1ZGU B;  3DBH I;  3IHP C;  4FJV B;  4E74 A;  2BKR B;  3ML9 A;  4PS8 A;  1OEY J;  4X57 B;  5E6O A;  1A5R A;  4EZK A;  2LRW A;  3WAP A;  3R7Q A;  1H4R A;  2GBM A;  3VDZ A;  3UIO B;  4A3O A;  2WYQ A;  4MH0 E;  4CHK A;  2JPH A;  4WJO A;  4M8M A;  2LVO A;  2NBW B;  3A4R A;  1WE6 A;  2KLG A;  3DQV A;  2GOW A;  4ICV A;  1L7Y A;  3Q3J A;  3SDL C;  3ZNG C;  4IG7 B;  2CKH B;  1E8W A;  3TJP A;  5DPR A;  3RD2 A;  4ZRK A;  2IO0 B;  3UQB A;  4NQK E;  4DHZ B;  3ZRC A;  3WA0 A;  2N9P C;  4NJ7 A;  2N1V A;  4TUU A;  1ZW7 A;  2KTR A;  4ICU A;  1UBI A;  1WGR A;  2N7D A;  3OJ4 B;  4G0N B;  5AZH A;  3X23 A;  4BKS A;  4EFO A;  1IYF A;  2KVR A;  5E6N A;  1VD2 A;  4FJY A;  2BYV E;  1WX8 A;  3L08 A;  2N4F A;  4WJN A;  2O6V A;  1SIF A;  2I1K A;  4NPN A;  2DAJ A;  2IYD B;  2KQS A;  2LXA A;  1WZ3 A;  3UIN B;  2KHW B;  2XBB C;  2KLC A;  3UQA A;  4XX5 A;  1TTN A;  2Z0D B;  3KYC D;  5C23 A;  1RAX A;  2ZNV C;  3AXC A;  1WYW B;  4DDG D;  4HXD A;  4WJP A;  5AEK B;  2C7N B;  3NZU A;  2IO1 B;  3PS6 A;  4HCP B;  3ZTD A;  3SU8 X;  3L10 B;  4AWJ A;  2M0X A;  3ZDM C;  4HVB A;  2DHZ A;  3L54 A;  3PHX B;  2CHW A;  1WGY A;  2WX1 A;  2HE7 A;  2K8C A;  1WM3 A;  2KFJ A;  2MW5 A;  4NAW B;  1WRD B;  4FN2 A;  2JRH A;  3SHQ A;  1J19 A;  2DYO A;  4AOF A;  3MTN B;  4G3X B;  2J0K A;  5JH5 C;  3VHT C;  2MBB B;  3NHE B;  4BOZ B;  3RUI B;  4ANV A;  2D10 A;  4JLC A;  2I1J A;  2IO3 B;  4MDK E;  5D2M B;  1WZ0 A;  3DBR I;  1C1Y B;  3DOW A;  3DVN V;  4IWO A;  2XK5 B;  4NNJ B;  4XC2 A;  4MGK E;  4PYZ A;  1HE8 A;  5DCN A;  3QHT A;  1GG3 A;  2KJ6 A;  2CHZ A;  3PTF C;  2BWF A;  3DVG Y;  4W9L A;  5J2R A;  2G45 B;  2LJ5 A;  3DBL I;  4RM8 A;  2L3Z A;  3PSE B;  1Q0W B;  2HTH A;  4HPM B;  3PLU A;  4EUT A;  3X0W A;  3O65 B;  4II2 B;  1YX6 B;  4KDI C;  4M0W B;  2KWV B;  3RCZ A;  1WGD A;  3DBS A;  4MM3 A;  1EUV B;  2XEW A;  2PPH A;  4GU2 A;  4ZRJ A;  1NDD A;  2DEN B;  4IC7 B;  3ZVV A;  2GBK A;  3A9K B;  1WY8 A;  4IWP A;  4KVG B;  4TV3 A;  1WR6 E;  1J0G A;  2LVQ A;  3ZLZ A;  3KW5 B;  4MJS A;  1UBQ A;  2LWP A;  1CMX B;  4GN1 A;  4B95 A;  2KFK B;  3WAO A;  3PGE A;  2EKE C;  2L8J A;  4II3 B;  4ANU A;  1FXT B;  1E8X A;  1VCB A;  4YL8 A;  2KX3 A;  3WAM A;  2DZK A;  3JSV B;  2FIF A;  3A33 B;  1F9J A;  3H7P B;  4GB9 A;  1V6E A;  2KZR A;  2BYF A;  1WF9 A;  4W9C A;  2Y5B B;  2JVC A;  3EC8 A;  2LGX A;  3IG3 A;  1P9D U;  5CHV C;  2REX A;  1T0Y A;  1YQB A;  1EF5 A;  2BWE S;  4E3C A;  1WJU A;  4I6N B;  3AU5 A;  4KIK A;  3UIP B;  2MQJ A;  1EF1 A;  2D3G A;  2FID A;  2IY1 B;  3U8Z A;  1WJN A;  1WGH A;  4ANW A;  3Q3F A;  2M8S A;  3DPD A;  2GBR A;  1E5W A;  2KC1 A;  2MBO A;  1KJT A;  4AUQ C;  1WIA A;  2JZ3 B;  2FCS A;  1PQS A;  3B1L X;  1QZE A;  4IWQ A;  2DZJ A;  2JT4 B;  3A9J A;  3P2B A;  2WX0 A;  2UWQ A;  3PLV A;  3WIM A;  2L76 A;  4KZ0 A;  2RR9 A;  3IVF A;  4URK A;  2BKF A;  3TL5 A;  2NS5 A;  3RZF A;  3OLM D;  3ZDT A;  2K8H A;  1V5T A;  3V6E B;  3H1U A;  4KSL C;  3UGB B;  4W9E A;  1KLV A;  3HK0 A;  4K7S A;  5L83 A;  3JYU A;  2N9X A;  2KNB A;  5HKH A;  2MBE A;  1X1M A;  4GDK B;  2PEA A;  1Y8R C;  1E90 A;  2J7Q B;  4W9D A;  2QHO A;  5IA7 A;  4G11 A;  4GSW A;  3H7S A;  3M63 B;  2V3S A;  2KMA A;  2K39 A;  3AI5 A;  4EZJ A;  3W1Y A;  4ZYN A;  2MX2 A;  4GDL A;  2LVP A;  5IAA C;  1WM2 A;  4F8C B;  4F7Z A;  4NY0 A;  2ZVO A;  3KUC B;  3A4S C;  2FCQ A;  3QA8 A;  1XQQ A;  3TBL D;  2BPS A;  2KDI A;  4EZL A;  4A20 A;  4LDT D;  2IBI B;  4HDQ A;  1BT0 A;  4PYU A;  3L0W B;  4CYE A;  1KOT A;  2FUH B;  4GGQ A;  4KV2 A;  1WI0 A;  4B9K A;  1GC7 A;  3RZW C;  1JRU A;  1L2N A;  1WJ4 A;  4W9K A;  2ASQ A;  2FCM A;  2L0F A;  2BYE A;  4LJO B;  3CF6 E;  4DWF A;  3ZO5 B;  2GBN A;  4M8N A;  2AYO B;  2JWZ A;  1OQY A;  2KTR B;  2NR2 A;  1WJ6 A;  3L13 A;  3QIJ A;  4MSM B;  4AJW A;  1J8C A;  3ENE A;  1WX7 A;  4DK5 A;  1Q1O A;  2O2V A;  2ZCB A;  1WXS A;  2BF8 B;  2JZZ A;  3ONS A;  4FHK A;  5FR6 A;  1RRB A;  2O6V B;  4J6I A;  4MGY E;  1V49 A;  2B3A A;  4GMV A;  4W9F A;  3PRP B;  2PE6 B;  4BVU C;  4FA6 A;  1UEL A;  2J0J A;  3TMP B;  2N9E B;  4LJP B;  1S3S G;  2DYB A;  2KQ7 A;  1WMH A;  3VTV A;  2G4S A;  3VUY A;  1R4N I;  4GIV A;  3V61 A;  1K8R B;  4CO7 A;  3KH0 A;  3APD A;  3JW0 X;  4MEL A;  2DYM A;  1V80 A;  1Z5S B;  5E6P A;  3ZNZ B;  1P0R A;  5JHA A;  1ZKH A;  4I6P A;  1OEY A;  3OJ3 A;  5JHB A;  3TCA A;  4W9H A;  1WXV A;  4K81 A;  3C0R B;  1WXM A;  3EFU A;  3AUL A;  1LFD A;  5CHF A;  1D3Z A;  4HLE A;  2KXJ A;  2JY6 A;  1E8Z A;  2MLB A;  4AJY B;  2V4L A;  3PPA A;  2C7M B;  3RUL A;  3V6C B;  2GBJ A;  4IW0 A;  3VH4 B;  4ZRI A;  2KC2 A;  3A1Q A;  4N9F 4;  2NVU I;  3KUD B;  4WWP A;  3M3J A;  3GOE A;  3H6N A;  3U30 A;  3VUW A;  2Z59 B;  3R7R A;  4BKT A;  4BKG A;  2IZV B;  2D11 A;  2KAN A;  2MP2 A;  2RPQ A;  1OTR B;  4LCD E;  5LXI B;  5JZE B;  1M94 A;  2M1M A;  2ZNV B;  1WGG A;  2CHX A;  3RYT A;  4NJ6 A;  5L95 C;  2RSU A;  2C9W B;  3N32 A;  1LM8 B;  3B0A A;  4HK2 A;  4WJQ A;  2CS4 A;  2KJR A;  2K1F A;  2LRU A;  3QC8 B;  4JIO U;  4DHJ B;  3CSF A;  4DHZ E;  4E71 A;  1UGM A;  2CR5 A;  2L05 A;  4BOS C;  2FAZ A;  3HIZ A;  4MEM A;  1UD7 A;  3VVW B;  5KHQ A;  2L00 B;  4AP4 C;  3H9D A;  1SGH A;  4MJS B;  1TZ1 A;  2GMI C;  2AL3 A;  1XT9 B;  5GMV A;  3V60 A;  3K9P B;  3MHS D;  2W9N A;  3W1S C;  5C1Z A;  1IPG A;  2K25 A;  4I6L B;  3OAW A;  2DX5 B;  4DDI D;  3ML8 A;  3ZUN A;  2ZZP B;  3QX1 A;  4TQ0 A;  3APC A;  4W9I A;  4XZ4 A;  2EMT A;  2KD0 A;  5LLI A;  1TBE A;  2ZEQ A;  4ASW C;  5DPS A;  2MSE D;  3M95 A;  4KIK B;  3PVL A;  1IP9 A;  3ZIM A;  1E7U A;  4IUM B;  5AZF A;  4EKU A;  2ZPN A;  3T8M A;  3B08 A;  4KDL B;  2ZCC A;  4JL9 A;  3VFK A;  3D32 A;  5LXH A;  2KOX A;  3MJW A;  2L7R A;  3QAR A;  3HHM A;  4MGI E;  4HCN B;  2WWZ A;  1U4A A;  4PS3 A;  2KX0 A;  2YLM A;  3NY5 A;  5D6J B;  5DPT A;  2LUE A;  2MRP A;  2NPT B;  1AAR A;  2RGF A;  3A9J B;  3QQ8 B;  3UF8 A;  3VQI A;  4FJZ A;  5KHO A;  2BGF A;  2N1W A;  1P98 A;  3CST A;  2AEH A;  4BFR A;  5J17 A;  2D2Q A;  2KMC A;  2DZI A;  3AU4 A;  1LQB A;  3SD5 A;  3VXW A;  3ZW3 A;  3W1S A;  3PRM B;  2PJH A;  3L17 A;  2R2O A;  3M62 B;  2OOB B;  3ZNH B;  1NI2 A;  4GXB A;  1NBF C;  1WFY A;  3QK0 A;  3IBE A;  4ANX A;  3K9O B;  2NBU A;  1WXA A;  1LXD A;  2CU1 A;  3VUX A;  4KSK C;  1GNU A;  3WAL A;  3ALB A;  2MWS B;  2ZVN A;  1MG8 A;  3GZN I;  4TQ1 A;  3VTW A;  2ZJD A;  3QCA A;  4IM3 A;  3ZTC A;  4G50 A;  3IFW B;  3HM3 A;  3R66 C;  3V62 A;  4GDL B;  2K6Q A;  2C60 A;  2DAF A;  4WWN A;  1RFA A;  3PZD A;  5D7G A;  3DCG A;  2LXC A;  3QJZ A;  3CMM B;  4JQW C;  4GOC A;  1I35 A;  4IM0 A;  4PS7 A;  1G6J A;  5CX3 A;  3APF A;  1GJZ A;  4W9J A;  3L16 A;  3LJ3 A;  3PHW B;  2D07 B;  2DZM A;  2JXX A;  3WAN A;  2UYZ B;  3QAQ A;  2KK8 A;  4HDO A;  3N3K B;  4FUL A;  3DDC B;  3NOB A;  2V1Y A;  3ZKJ C;  2G3Q B;  2JF5 A;  5TR5 A;  3PT2 B;  2VRR B;  2R2Q A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...