5DPRA

Crystal structure of plekhm1 lir-fused human lc3a_2-121
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
124
structure length
124
Chain Sequence
b'EWVNVGSPSDRPFKQRRSFADRCKEVQQIRDQHPSKIPVIIERYKGEKQLPVLDKTKFLVPDHVNMSELVKIIRRRLQLNPTQAFFLLVNQHSMVSVSTPIADIYEQEKDEDGFLYMVYASQET'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Pleckstrin homology domain-containing family M member 1,Micr
publication title Structural and functional analysis of the GABARAP interaction motif (GIM).
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein binding
total genus 29
structure length 124
sequence length 124
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2015-09-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02991 Atg8 Autophagy protein Atg8 ubiquitin like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 5dprA00
1V80A 3KYDD 4DDGD 2CHZA 4M8NA 3PV1A 3L13A 2OOBB 1UZXB 4DHZE 1C3TA 4XC2A 1FXTB 4KVGB 4HCPB 1M94A 2O6VB 1UBIA 3Q3JA 3NHEB 1Y8RC 4HCNB 2GBJA 2BYFA 3KH0A 2DYOA 4E74A 4EZJA 4NAWB 5EDSA 1EO6A 3W1SC 4FJVB 3ZNID 2PJHA 4E3CA 1WXVA 2KFJA 2ZJDA 2KX3A 4ANUA 4MGYE 2Z0DB 2ASQA 4KIKA 4KDLB 5D7GA 3R7QA 2NR2A 1WR1A 3A33B 2LRUA 2O2VA 5AZHA 4II2B 5JZEB 3A9JA 3JW0X 3UIPB 4BVUC 2LXCA 3QWZB 4DHJB 3Q3FA 1TZ1A 3ALBA 1I35A 1YX6B 3KVFB 4IG7B 1KOTA 2JY6A 4I6PA 3OAWA 2C60A 4K7SA 3JSVA 4MSQB 2EMSA 1J19A 1V86A 3APCA 4IM2A 2JZZA 3PZDA 5D6JB 1E7VA 4NQKE 2BWES 3D32A 2GMIC 1WE6A 2MQJA 3L16A 4W9JA 3VH4B 3A1QA 3ZLZA 2J7QB 2HD5B 3DVGX 4ICUA 4LJOB 4BBNC 3DVNV 5TR5A 5D2MB 1Q5WB 1GUAB 2N1VA 4I6LB 5E6OA 4II3B 5E6NA 1LQBA 2R2OA 2FCNA 2KFKB 2ZNVC 4AWJA 3M62B 2KKCA 5G2NA 2LD9A 3NZUA 4EFOA 4NPNA 2KNBA 1R4NI 2AL6A 1YX5B 3RUIB 3U7DA 1E8XA 4NY0A 1H8CA 2KMAA 2XBBC 4XZ4A 3L10B 4G0NB 4W9CA 5JHBA 3ONSA 3ZNHB 1QZEA 3WAMA 4BKGA 4AUQC 4WJOA 2L8JA 2IY0B 2K39A 2YLMA 3M3JA 2MRPA 2G3QB 2KZRA 2RPQA 4JIOU 4K1RB 4NNJB 3RZWC 5DPWA 3V6CB 2N7EA 4BKSD 4GDLB 2J0MA 3IBEA 2WWZA 1UBQA 2A4ZA 4EKUA 1HE8A 1Z5SB 3DVNU 2DYBA 4LJPB 4IM0A 3EHVA 2MBQA 4NAWA 2MWSB 2ZPYA 3DBRI 4HLEA 1WE7A 2CU1A 2KQSA 1E8ZA 2AWTA 2L7RA 3A4RA 1GNUA 3IHPC 4TUUA 1I42A 4FA6A 2KVRA 1V5OA 3ZRFA 3M63B 2D2QA 4EUTA 1ZKHA 1SIFA 4GSWA 4GXBA 2CHXA 2WX1A 2G4SA 2M1MA 1S1QB 2KWVB 1UELA 3NY5A 2MP2B 2BYEA 2K8CA 4FBJB 3UINB 2IO2B 2R2QA 3LJ3A 3HHMA 2FAZA 4AOFA 2QHOA 4W9GA 2K1FA 2MSED 2DYMA 3VTWA 3U8ZA 4FULA 2D07B 1WI0A 3PGEA 3CSTA 1V81A 4OVUA 5CHVC 1OQYA 3PPAA 3P2BA 3RT3B 1EF1A 1WGGA 4HVBA 2KFKA 3MTNB 4K7WA 2C9WB 2RGFA 2VRRB 3PRZA 5DPTA 2FUHB 3VTUA 4CYEA 3KUCB 3R3MA 1A5RA 3A9KB 3ZNGC 1Z2MA 3KUDB 2FCMA 3UF8A 2KQ7A 5HKHA 1WGYA 2EKEC 2Y5BB 4G3XB 3WIMA 2MX2A 2M0XA 2MBBB 3SD5A 5LXHA 3QIJA 4W9EA 4URKA 4GDLA 2PPHA 2DAFA 2MBHA 4WJPA 1CMXB 1Q0WB 4IWQA 3AULA 5IAAC 1WJ6A 4KZCA 3TL5A 1ISNA 3NZSA 5G55A 2L76A 3L17A 1E90A 3SDLC 4LDTB 4W9KA 4HJKA 3DQVA 1WFYA 4DWFA 1WM3A 4BKTA 2NVUI 3GOEA 5AEKB 3V62A 2DZKA 2KN5A 2JZ3B 1WXAA 4FADA 1YIWA 1LFDA 5E6PA 4A3PA 4EZLA 2DX5B 4N9F4 1WGDA 1G6JA 2V4LA 2LVPA 4K81A 4LDTD 3CF6E 4GB9A 4GOCA 4A3OA 4B95A 3WAPA 3MHSD 3ZIMA 4FLHA 4WJNA 2LRWA 4TQ1A 2V3SA 4BOSC 2JT4B 3VH3B 2MP2A 2UWQA 1RLFA 2UYZB 4FHJA 4FHKA 3C0RB 4F1SA 2C7NB 2PEAA 1IPGA 3N32A 4MDKE 1RAXA 1D3ZA 2ZNVB 4EZKA 1WJNA 2LWPA 2N9PC 2LVOA 2PE6B 3RCZA 1NDDA 4DHZB 1WF9A 3PREA 2GOWA 1RRBA 1WX8A 2M17A 4GGQA 1K8RB 1TTNA 4TV3A 2PE9A 3L0WB 3PHWB 3QAQA 5CTRC 2IBIB 2KHWB 1XQQA 4HDOA 2AYOB 3EECA 1VD2A 2V1YA 2LGDA 4M0WB 1Q1OA 3A9KA 2KDFB 2K8BA 2XK5A 3DBHI 2KANA 4MGZE 3W1SA 1UH6A 1WZ0A 3ENEA 2W9NA 2L00B 5JHAA 4MELA 3X0WA 1IP9A 3V61A 2ZPNA 4JGHB 1AARA 1H4RA 3VTVA 2MBEA 3JVZX 4I6NB 2JPHA 1F9JA 4B9KA 4F8CB 1OEYJ 2KX0A 3IFWB 4IM3A 3W1YA 2FCQA 1EF5A 4BBNF 5L83A 3PT2B 3BINA 1WYWB 2L05A 4AP4C 2JRHA 2FIFA 3CMMB 3MJWA 1WXMA 2K25A 2D10A 2L3ZA 2BWFA 3A4SC 5FR6A 4ANWA 4ZYNA 2KK8A 5GMVA 5AZGA 2KDEB 3SHQA 2K6QA 1S3SG 3B1LX 2KTRB 2J0JA 3PLUA 1EUVB 1V49A 3JYUA 1WZ3A 2CKHB 3RULA 4XX5A 3UQBA 1WXSA 3QK0A 4JQWC 3V60A 3VUWA 3T9LA 3VVWB 5JH5C 2BKRB 3ML8A 1WX9A 3ZDTA 1WX7A 1P1AA 2L0FA 4J6IA 4MGKE 4W9IA 3ZUNA 5LLIA 2BYVE 1GJZA 2REXA 3B0AA 3AU5A 5D94A 4JLCA 2C7HA 1YD8U 1LM8B 4CHKA 2AL3A 3DBLI 3RYTA 2DZIA 3O65B 4G11A 3DDCB 5CX3A 1NBFC 3PRPB 1T0YA 1SE9A 3AXCA 3PS6A 2CS4A 2KC1A 3H6NA 2MCNB 1UD7A 4OVVA 2LGXA 4FN2A 3PVLA 2KMCA 2N1WA 2NBVB 5DPSA 2DENB 5DPRA 2NBWB 3QC8B 2KTFA 4BKSA 2XK5B 2I1KA 4GDKB 1R4MI 1WGHA 5AZFA 5LXIB 5CHFA 3APFA 2KC2A 2ZCCA 3TMPB 1OTRB 4W9DA 1SGHA 3QCAA 2JWZA 1V9JA 2IO1B 3VDZA 1WMHA 2J0KA 3GZNI 4NJ7A 1XT9B 3UIOB 3EC8A 3HK0A 4LCDE 4RM8A 3TCAA 3K9OB 1P0RA 2KJRA 4ICVA 4WWOA 2IO3B 4F7ZA 4P7IA 3UQAA 3H9DA 3PRMB 2AEHA 3PLVA 3QX1A 2KO3A 2JUOA 4BOZB 2BF8B 2LJ5A 3VUYA 3ZW3A 2LUEA 2IYDB 4MEMA 3WANA 1MG8A 2DAJA 2GBRA 2KLGA 1NI2A 2N4FA 3TBLD 4FJZA 3BY4B 3IVFA 2HJ8A 1V5TA 2KXJA 3L08A 1KLVA 1P98A 3I3TB 1OEYA 4ANVA 1J8CA 3QJZA 2KTRA 5KHOA 2GBMA 2LASA 3H7PA 4NJ6A 4A20A 1GC6A 4DBGA 2KDIA 1YJ1A 1BT0A 1TGZB 3N3KB 3T8MA 4DXAB 2M4NA 2LXAA 4NQLB 4KZ0A 3WA0A 2NPTA 3DCGA 1OGWA 2O6VD 3CSFA 2BPSA 1GG3A 2BKFA 3TJPA 2ZVOA 1E7UA 4TKNA 3ZTDA 4K7UA 4ZDVA 2FCSA 3KYCD 2IZVB 4FJYA 2D11A 4IWOA 2C5LC 4PS7A 2RSUA 3LDZE 2ZVNA 1P9DU 4HXDA 1L2NA 3ECIA 4MSMB 3VUXA 3NOBA 2B3AA 4WWNA 2HTHA 1TBEA 4HPMB 3X23A 1UGMA 2WYQA 1WRDB 4HPLB 2FIDA 3VAWA 1GC7A 4GDKA 2WDTB 4GU2A 4DHJD 1RFAA 2KWUB 3VQIA 3S2AA 3ZVVA 2JVCA 2LVQA 3KUZA 4ZRKA 2K6DB 4ASWC 2ZCBA 3H7SA 2KOXA 1WMHB 2N7DA 4GMVA 4RMAA 3VHTC 3ZTCA 4HK2A 2OJRA 4ANXA 1WR6E 4KV2A 5CHWA 1WH3A 1V6EA 2KWCA 4GIVA 3APDA 2L0TA 4W9LA 3RD2A 2DZJA 3HM3A 3NS8A 4PYZA 3OJ4B 2LZ6A 3WAOA 2IO0B 1KM7A 4JL9A 2NCNA 3QHTA 3ML9A 4MJSB 1PQSA 1WIAA 2RR9A 3U30A 1E5WA 2C7MB 3N30A 3VFKA 4MGIE 2KLCA 2A5UA 4BFRA 3DVGY 1YQBA 5J2RA 4W9HA 3VXWA 2LGYA 4M8MA 4HWIB 1IYFA 2KJ6A 3HM6X 4PS8A 4IC7B 3DBSA 3PTFC 3QA8A 1L7YA 4ZRIA 2CHWA 2N9XA 2MBOA 3H7PB 3EFUA 3RZFA 2O6VA 1KJTA 4E71A 1VCBA 3PHXB 2MLBA 4TQ0A 5C1ZA 2GBKA 5J18A 3ZDMC 2Z59B 3R66C 5BO4B 2NPTB 2CR5A 3DOWA 2D3GA 4WJQA 4HDQA 4EEWA 1P3QU 4WQOB 3AU4A 3V6EB 3ZNZB 4KIKB 2NS5A 5KHQA 2O2VB 4GN1A 3QARA 4CO7A 2KDBA 3A9JB 1V2YA 4PYUA 5DCNA 1ZW7A 2G4DB 4PS3A 3H1UA 4B6WA 1WJUA 2EMTA 3B08A 4KSKC 4ZRJA 3UGBB 2HE7A 2KD0A 1J0GA 1WJ4A 2MA9B 1U4AA 2YVCA 3SU8X 4IWPA 1LXDA 1X1MA 2MW5A 1XD3B 2G45B 4G50A 3JSVB 2IY1B 3M95A 2DZMA 3DPDA 1E8YA 5L95C 2WX0A 4RM9A 5C23A 3WALA 2ZZPB 3QQ8B 3L54A 3ZKJC 2JRIB 2ZEQA 4IW0A 3A1QB 2M8SA 2N9EB 3TIXA 4KSLC 2NBUA 3IG3A 3PSEB 4AJYB 4DK5A 4W9FA 3KW5B 2BGFA 4EOYA 2JF5A 2RD0A 1ZGUB 4MH0E 2GBNA 4IUMB 3HIZA 3OJ3A 2LI5A 4X57B 1WM2A 4DDID 1WGRA 1C1YB 4WWPA 1WY8A 4MJSA 2K8HA 4YL8A 5IA7A 4KDIC 5J17A 2KJHB 1E8WA 2JXXA 3AI5A 2Z0EB 4AJWA 1JRUA 3K9PB 3R7RA 3ZRCA 2FNJB 2XEWA 4WAAA 2DHZA 4MM3A 3ZO5B 2I1JA 3OLMD
chains in the Genus database with same CATH superfamily
1V80A 4PK1A 3H8HA 1T0RC 3N1XC 4XC2A 4IDIA 2G9HD 1OFFA 2WXFA 5C2TB 2ASQA 3R7QA 3A33B 5AZHA 4B0MA 3JW0X 4ZHOA 1TJEA 1GB1A 4HROA 4K7SA 2JY6A 3JSVA 1V86A 3APCA 4IM2A 5D6JB 1E7VA 3MJ5A 3P63A 2GMIC 1WE6A 2MQJA 3L16A 3A1QA 2XN9C 4ICUA 4OZCA 4BBNC 5D2MB 1Q5WB 4HPPA 4I6LB 5E6OA 4II3B 5E6NA 1LQBA 1SBBB 4C4VA 3RFZB 2FCNA 2KFKB 4NPNA 2KNBA 5EE1A 3U7DA 1E8XA 3R8BA 1VJKA 4G0NB 3ONSA 3WAMA 1TS5A 4WJOA 2K39A 2YLMA 1ACCA 3OWEB 1JWBD 2KZRA 2RPQA 5JXVA 3TEYA 3NZ3A 4RH6A 4YWGG 2WWZA 1UBQA 2QILA 4EKUA 1FXAA 4NAWA 1EWYC 1WE7A 2KQSA 2L7RA 4TUUA 4FA6A 2KVRA 3ZRFA 2D2QA 1EWCA 1VRAB 4YSZB 1S1QB 3ETRA 4OZAA 1PFDA 1ZOYB 3OG5A 2IGGA 3Q3OC 4M00A 5EE0A 2IO2B 3HHMA 1HEZE 2WU2B 1L0XB 2K1FA 3T3NA 2DYMA 2V3PA 3B2FA 3VTWA 3U8ZA 3AEAB 2WXGA 2D07B 3CSTA 3PPAA 2PVGC 3P2BA 3RT3B 2WXMA 4CYEA 1A5RA 3KUCB 3R3MA 2L1AA 1SE3A 2CJNA 1FPYA 1SSNA 1AW7A 4G3XB 5LXHA 2M0XA 2MBBB 4W9EA 3BWUD 4URKA 2N9KA 2DAFA 4WJPA 1CMXB 1RYJA 1WJ6A 1XLNA 4KZCA 1CQVA 3TSSA 2QMTA 5G55A 3L17A 4HJKA 3RNEC 2NVUI 3GOEA 2J42A 2KN5A 4DQOC 3AH7A 1LFDA 4YXDB 2DX5B 4N9F4 1ZDXA 1G6JA 4K81A 4OHJA 4LDTD 4GB9A 3NVWA 3WAPA 3W5UB 4WJNA 2LRWA 4MH8A 3BVGA 2V3SA 2JT4B 3VH3B 2L52A 1N60A 2PEAA 1D3ZA 2ZNVB 2I2YA 2BS4B 3AE3B 2LVOA 2PE6B 2ICIA 1WGKA 1TTNA 2J4XA 3AN1A 1LGRA 3ZXRA 3P4RB 2IBIB 2WXQA 1XQQA 4K3BA 3EECA 3DHHC 1Q1OA 2XK5A 3FILA 5I4DA 4OVZA 1C4CA 3IT4B 3Q8CA 5JHAA 3X0WA 3V61A 4DXFA 2ZPNA 4JGHB 1F0ZA 1J7BA 1SJED 2JPHA 2N7JA 2KX0A 3IFWB 4IM3A 3GP7A 3T3OA 1XXGA 4BBNF 3AE9B 5L83A 1WXMA 2BWFA 2KK8A 5AZGA 2KDEB 3SHQA 1S3SG 3B1LX 3NVYA 2LJIA 3PLUA 1AYFA 3JYUA 4LNNA 1ZUD2 3ZJUA 3RULA 4XYCA 2JZPA 1WXSA 2LGSA 3QK0A 5JH5C 3ML8A 4MGKE 3RNBC 3RNCC 1GJZA 3ZQ4A 1GOZA 3AU5A 4JLCA 2C7HA 1LM8B 3DBLI 1TZOA 5CX3A 3O65B 2GLSA 2CS4A 1UD7A 1XCQL 4OVVA 3ZYYX 5DPRA 2NBVB 1DYQA 1SE4A 2XK5B 1R4MI 1NYQA 5CHFA 2ACZB 4W9DA 1UWMA 4P16A 1WMHA 2H89B 2J0KA 3GZNI 4NJ7A 3AEEB 2Y5CA 3EC8A 4RM8A 2KJRA 2IO3B 4A9AA 1UF0A 1JRPA 1UUPA 3ZW3A 2IYDB 3P4QB 3Q3NC 1GB4A 1KLVA 4ANVA 3I3TB 1J8CA 2GBMA 4A20A 3AV8A 1GC6A 1I4RA 4DBGA 2KDIA 1IBXA 3N3KB 2WGSA 5AUIA 4LTUA 2M4NA 2V3NA 1QILA 1L6UA 5IN7A 2ZVOA 1E7UA 2Y3AA 4XDCA 4ZDVA 1T3QA 4IWOA 3EA6A 4PS7A 1YN5A 2C5LC 1HTQA 2RSUA 3LYYA 4HXDA 2RDHA 5IOIA 3VUXA 1RWSA 4IKGA 4HPLB 3AMZA 3I57A 2KWUB 1MHHE 3KUZA 2K6DB 4WH4A 1WMHB 2N7DA 1I7HA 3Q8FA 4GIVA 2L0TA 3J9CA 3HM3A 3NS8A 3OJ4B 2LZ6A 2NCNA 3QHTA 1PQSA 2RR9A 3AE2B 2BB5A 1E5WA 2C7MB 1YMHE 2KLCA 2A5UA 4BFRA 3DVGY 3EFCA 4IC7B 2CHWA 4MT5A 4UDUC 3EFUA 3RZFA 2O6VA 1KJTA 4ZYSA 2MLBA 4TQ0A 4S17A 1VDVA 3R66C 3HRDD 5BO4B 4WJQA 4HDQA 4EEWA 3V6EB 1RM6C 2NS5A 5KHQA 3NG0A 3FKYA 3A9JB 4PYUA 4XWTA 4HKZE 3U7ZA 1MPEA 2EMTA 3UGBB 1J0GA 1PDXA 1WJ4A 2MW5A 3W9CB 2WU5B 2G45B 3M95A 2KT7A 3I9V1 3DPDA 1E8YA 2MJEA 3QQ8B 3AE5B 4IW0A 4KSLC 2WP9B 3KW5B 3RPFC 1ZGUB 2IJ0A 5BYRA 2UU7A 1WM2A 1WGRA 2WDVB 1C1YB 2DNFA 4YL8A 5IA7A 4KDIC 3CWIA 2KJHB 1A70A 3MHZA 3ZRCA 4O1NA 2DHZA 3P4PB 3ZO5B 2I1JA 4F7ZA 2CHZA 2OOBB 1UZXB 3BK2A 3MC9A 2O6VB 4JE3B 4J3OD 3Q3JA 1XF5L 1Y8RC 4HCNB 2BYFA 5EDSA 1EO6A 4FJVB 5BMHA 3ZNID 2PJHA 2QJLA 2KFJA 2ZJDA 4ANUA 2BT6A 4MGYE 2WDRB 1I4HA 4KDLB 5D7GA 1UGJA 3AEFB 2GI9A 3QWZB 1C79A 3Q3FA 3ALBA 2HTME 2RPVA 4DXGA 5EE3A 2YEPF 2INDC 3KVFB 4IG7B 1KOTA 2W54A 3SFEB 2QEJC 2JWUA 3D32A 3VH4B 2M56B 2J7QB 4LJOB 3DVNV 2N1VA 1JWMD 2N0SB 3P42A 2KKCA 3NZUA 2K9XA 2CJOA 1D5ZC 1YX5B 3RUIB 4YTNB 4NY0A 1H8CA 2XBBC 3EUB2 3L10B 3ZNHB 4BKGA 5BYSA 4AUQC 2IY0B 2N7EA 4GDLB 3IBEA 2D3CA 3N9YC 1HE8A 2DYBA 1KRHA 2WXIA 1EM7A 1DOIA 3BVMA 1QOFA 2AWTA 1GNUA 1I42A 1V97A 3MC8A 1P7FA 1V5OA 1L6VA 2PVOD 4EUTA 1ZKHA 4GLSC 1D6EC 4GSWA 4GXBA 2KWVB 3NY5A 2MP2B 1XEEA 2K8CA 2WXKA 3VR9B 1TY2A 2FAZA 2QHOA 3ZJTA 2KAJA 4S0RA 2KYWA 4HEA1 4NAMA 4OVUA 3NRZA 1UWXA 4N59A 2MHJA 1YNTE 2KFKA 1F77A 1YQ3B 1C4PA 3PRZA 2FUHB 3DWGC 1Z2MA 3KUDB 1JALA 3WCQA 1TYGB 1KF6B 3UF8A 5HKHA 1WGYA 3WIMA 2QC8A 4XWWA 2MBHA 1VLBA 1Q0WB 3P1MA 1E0ZA 2L76A 3SDLC 2SAKA 3DQVA 4DWFA 3V62A 3AE7B 1WXAA 1NYRA 4R3DA 5LNK1 1K53A 4HJGE 2IGHA 2LVPA 2Q5WD 2RDBC 1TKYA 4B95A 1C77A 1TS4A 3MHSD 2M0AA 1J7AA 2UWQA 2KVZA 3E56A 4FHKA 4F1SA 4A55A 1RAXA 3NVVA 4RGMA 4EZKA 4C7YA 1B1ZA 1KTKA 3RCZA 1NDDA 1V1OA 1WF9A 2M17A 4ARIA 4LK0M 1P7EA 5TSSA 4HDOA 2ONQA 4US8A 2BVCA 1SXTA 3FC4A 3DBHI 1ZXHA 2KANA 3AEBB 4EE2A 1C4AA 1WZ0A 1I4QA 4IOIE 2L00B 1IP9A 2WQYB 1SIJA 1F9JA 1OEYJ 1NVID 4AS1A 2FCQA 1EF5A 1T0QC 3BINA 1WYWB 4AP4C 2JRHA 1N6ZA 1SF0A 2L3ZA 4C00A 5GMVA 1XLQA 5IP4D 1XLOA 2KTRB 2WHIA 1EUVB 1WZ3A 2NTTA 5IKCM 3RNGC 1P1AA 4W9IA 5LLIA 4ZHPA 2BBCA 2BYVE 5D94A 4CHKA 1YD8U 3RYTA 3TJPA 3DDCB 3FAHA 1NBFC 3PRPB 3PS6A 1SE9A 2KC1A 4FN2A 1FEHA 2DENB 3QC8B 2KTFA 4USAA 5LXIB 3LB8C 2ZCCA 4QAYA 1SGHA 3QCAA 2JWZA 2LFIA 1V9JA 2YEPB 4Q2JA 4ICVA 4WWOA 2IGDA 3U52E 4AQ7A 3QX1A 1HTOA 4JWUC 4MEMA 3L4PA 2N4FA 3TBLD 4FJZA 3BY4B 3Q3MC 2HJ8A 2X8XX 1D5MC 4KKJA 3L08A 4N58A 3QJZA 2L32A 3H7PA 1K52A 1EU4A 1TGZB 3T8MA 2VH1A 4NQLB 1ENFA 4KZ0A 2NPTA 4REZA 3B9JA 3DCGA 2O6VD 2BKFA 4TKNA 4K7UA 2JX5A 2FCSA 2IZVB 1CJEA 1L2NA 3ECIA 3HVZA 3Q8AA 4MSMB 4M01A 4ITKA 1UGMA 1WRDB 2FIDA 1GC7A 2WDTB 3VQIA 3Q8BA 3PO0A 4MACA 3NS1A 1WR6E 5FR3A 3KLSX 1V6EA 2HJ1A 4JL9A 4MJSB 1CK1A 3DBHB 4LNKA 2K5PA 3VFKA 1RFKA 5J2RA 4MM3B 3W2DA 3VXWA 4WURA 4M8MA 1YJJA 1ZDVA 3LXFA 3QA8A 3H7PB 4E71A 1VCBA 1TKGA 5BMIA 1QOAA 2GBKA 2HDEA 1F1HA 2NPTB 2CR5A 3AU4A 3UI3A 4KIKB 5H92C 2O2VB 3QARA 4CO7A 4P1CC 2KDBA 2SEBD 1JWUD 2G4DB 4PS3A 1WJUA 2HE7A 1FNUA 2V4IB 1U4AA 4WQMA 1Q10A 5C23A 4RM9A 1NENB 3WALA 3L54A 2M8SA 2MH7A 1UNSA 2LMCA 1M4VA 3URYA 4P6VF 4X57B 2INNE 1KLGD 1WY8A 2BYTA 2Z0EB 3K9PB 3R7RA 4WAAA 1MFWA 3KYDD 1SE2A 4M8NA 3PV1A 3L13A 4DHZE 4L2YA 1FXTB 1UBIA 1MI0A 3NHEB 2GBJA 4NJCA 3KH0A 2J53A 4EZJA 2DBYA 2EKIA 1D4BA 2MJ3A 3SFDB 4E3CA 1WXVA 3R2IA 3DWMA 4OW0A 2NR2A 1WR1A 2LRUA 5JZEB 1KLUD 3E9SA 3A9JA 4WAFA 2LXCA 4DHJB 1FNWA 1I35A 1YX6B 4I6PA 2C60A 2W55A 3IXSA 4MSQB 1J19A 2K22A 2JZZA 3PZDA 1EU3A 2BWES 2WXPA 5G5GA 3ZLZA 2HD5B 3DHIC 1DOXA 1FD6A 4RFBA 1GUAB 3Q2AC 2QSDA 3C19A 2BB6A 2OJWA 2R2OA 1HQRD 2ZNVC 1LO5D 1R4NI 2AL6A 2WXRA 4XZ4A 5D3DA 1QZEA 2MRPA 2G3QB 5DPWA 4K1RB 4NNJB 3V6CB 4BKSD 1ET9A 2J0MA 2R61A 2FE8A 3I63C 2A4ZA 1Z5SB 1E7PB 4LJPB 4IM0A 3EHVA 3BVZA 4C7ZA 1L4ZB 2MWSB 2ZPYA 2ZW0A 3DBRI 2CU1A 1NEKB 1E8ZA 1FFVA 4HKQA 3M63B 1SIFA 2CHXA 2G4SA 2JYTA 2M1MA 3MFGA 4N6EB 1JW9D 2BYEA 4FBJB 2X38A 3UINB 2R2QA 3LJ3A 1SJHD 1FXIA 3AECB 2QIEB 3DBLB 3PGEA 5CHVC 1FFUA 1OQYA 1FM0D 5BYQA 1EF1A 2RGFA 2VRRB 3AE6B 3KQ4A 2K0PA 3A9KB 1R4MB 4M0WA 2FCMA 4OZBA 1VZ8A 5AUKA 2Y5BB 1K51A 3GZNB 2EELA 3QIJA 4YT0B 3PZ8A 4GDLA 3RN9C 2PPHA 4IWQA 3AULA 2INPE 5IAAC 3N1ZC 4XDDA 1ROEA 1E90A 4LDTB 4W9KA 1WM3A 4BKTA 3BZDB 3PZ7A 5AEKB 5FK9C 2JZ3B 4FADA 2NTSA 5E6PA 3CIRB 3CF6E 1Y56A 3ZIMA 1OQRA 4TQ1A 2E6XA 3TUOA 2MP2A 1RLFA 5T8IA 3TEXA 4MDKE 4XGAB 4C80A 2LWPA 2N9PC 2E3TA 1OQQA 2PTLA 4DHZB 1WX8A 1K8RB 3Q8EA 4TV3A 3B2GA 3PHWB 2KHWB 4L23A 2AYOB 1VD2A 2LGDA 4A8XC 4M0WB 3W5VB 2KDFB 4RF0A 3N1YC 3W1SA 1UH6A 2W9NA 4ACFA 4MELA 3Q6BA 5BMGA 2D3AA 1H4RA 2LEKA 3VTVA 2MBEA 1FRDA 4I6NB 4B9KA 4F8CB 2W3RA 1L0VB 3W1YA 2I38A 1QQRA 4ZOHC 3PT2B 2L05A 4B0EA 3AEDB 2BS3B 2OHFA 2FIFA 3MJWA 2K25A 2D10A 3A4SC 2FUG1 4ANWA 4ZYNA 2BS2B 2K6QA 1V49A 2QDFA 5G5HA 4XX5A 3GB1A 5E6JA 4JQWC 2D3BA 3VUWA 1T0SC 1IUEA 2BKRB 3ZDTA 3ZUNA 3NJTA 2REXA 2AL3A 4YTPB 2DZIA 4G11A 2WXOA 2MCNB 3H6NA 1V1PA 1F52A 1PGBA 3PVLA 2KMCA 5DPSA 4BKSA 5MPOA 1PUTA 4GDKB 1WGHA 3TEWA 3APFA 1OTRB 2DWQA 2IO1B 3VDZA 3UIOB 1XT9B 3HK0A 4LNFA 3TCAA 4ZRPA 3SEBA 2LHDA 3UQAA 2RDGA 2D5GA 1KH0A 3BK1A 2LJ5A 3V05A 1N5XA 2GB1A 3VUYA 3RNAC 2GRIA 2PKOA 1F2RC 5FKAC 1NI2A 1MJDA 3IVFA 1V5TA 1P98A 1OEYA 5KHOA 2KTRA 1YJIA 1BT0A 4DXAB 2LXAA 1T6BX 1WRIA 1L4DB 4TMAB 2BPSA 3ZJVA 4YSXB 2LUMA 3ZTDA 4FJYA 1QOGA 2D11A 2ZVNA 1V1PB 2W3SA 3NOBA 1FMAD 2B3AA 4WWNA 1TBEA 4HPMB 4ARCA 2WYQA 3ABVB 4YSYB 1QKZA 1JWSD 2J52A 4GU2A 4HRSA 1VR9A 4DHJD 1RFAA 2JVCA 2LVQA 4ASWC 2BQQA 2ZCBA 2KOXA 4GMVA 4RMAA 2LHEA 1WWTA 2OJRA 4KV2A 1SEBD 2KQ4X 2V9HA 5CHWA 1WH3A 2KWCA 2QCZA 3APDA 1WYGA 4PYZA 4KGSA 1HXYD 2IDYA 3ML9A 1WIAA 5HI1A 3N30A 4LNIA 1I4GA 2LGYA 1QOBA 2KJ6A 1JROA 3DBSA 3PTFC 4A6QA 1HA5A 1N5WA 1MHXA 2JU6X 3PHXB 4KKIA 2AQ1B 1FCLA 2WNMA 3KWLA 3DOWA 2D3GA 1P3QU 4WQOB 1TIFA 5HG2A 5DCNA 1V2YA 2PMVA 3MC0B 3B08A 2KACA 4KSKC 2YVCA 3SU8X 4IWPA 3IAM1 5HHDG 4G50A 1XD3B 3JSVB 2IY1B 2DZMA 2B76B 1J7CA 4BAXA 2IPKD 2ZZPB 3ZKJC 2ZEQA 2Y5PA 3A1QB 2N9EB 3TIXA 1VZ7A 3IG3A 4PT5A 2MJDA 4DK5A 4W9FA 2BGFA 2XNAC 1WXQA 2JF5A 1JQ4A 4RNAA 2GBNA 4IUMB 4C4VB 4RF1A 3IAS1 3HIZA 2LI5A 4DDID 4RGTA 3EGRA 4MJSA 5J17A 1I4XA 3AI5A 4H2AA 2ON8A 2KWDA 2H88B 2XEWA 4LLGM 4MM3A 3OLMD 1C76A 2K3UA 4DDGD 4BZAA 1C3TA 4KVGB 4HCPB 1M94A 2Z8LA 2DYOA 4E74A 4NAWB 5IO9A 1E10A 3W1SC 2KX3A 1E9MA 2Z0DB 2JXTA 4KIKA 2O2VA 4II2B 4BVUC 1VZ6A 3UIPB 1YQ4B 1TZ1A 1YN3A 1QF6A 1C78A 3NVZA 3OAWA 2EMSA 3TEZA 2VZKB 4NQKE 1YN4A 4W9JA 3DVGX 5TR5A 2PW9A 3VR8B 4AWJA 1XCTL 3M62B 5G2NA 2LD9A 4EFOA 1GPXA 4FXCA 2KMAA 4W9CA 5JHBA 2L8JA 3M3JA 4TSSA 3RZWC 1MG4A 4JIOU 3DVNU 2WS3B 3N20C 2MBQA 1NI3A 4HLEA 3A4RA 3IHPC 4L1BA 1BXTA 3KWVA 2WX1A 2JYEA 2L83A 2WXHA 2KMMA 1UELA 3AE4B 4ZRQA 4KX6B 4LNOA 3ZGZA 4AOFA 4D2KA 3IT6B 1XLPA 1I4PA 3AM9A 4W9GA 4NZLB 2MSED 2AQ2B 4FULA 4JX1C 1WI0A 1V81A 1F2RI 1WGGA 4HVBA 3MTNB 4K7WA 2C9WB 3HVDA 3VTUA 5DPTA 3ZNGC 3FILB 2TSSA 2KQ7A 1N63A 5D3IB 3U2SC 2EKEC 1ESFA 2WLBA 2MX2A 3SD5A 1TKEA 2VH2A 1ZP0B 5H8YE 3TL5A 1ISNA 1K50A 3NZSA 2V0GA 2OEDA 1WFYA 1ET6A 1C9FA 2DZKA 1TY0A 1YIWA 4A3PA 1JCKB 4EZLA 1WGDA 3RNFC 2V4LA 2LGIA 4GOCA 4A3OA 1AN8A 4FLHA 4BOSC 5EE9A 2UYZB 4FHJA 3C8YA 5HFYA 3C0RB 2C7NB 1IPGA 3N32A 1DGJA 1WJNA 2WXNA 1N61A 3PREA 1L0YB 1RRBA 2GOWA 3BYYB 4GGQA 1TS2A 2KDMA 2PE9A 3L0WB 3QAQA 5CTRC 1BMLC 1N62A 2V1YA 4KGRA 3Q69A 3A9KA 2K8BA 1R7SA 2BW2A 4MGZE 3ENEA 1HZ5A 1AARA 1IGDA 3JVZX 1XO3A 2WXJA 4JPSA 5C3JB 3CMMB 4XE0A 3U4EG 3BYTB 5FR6A 4YTMB 3GS2A 1FCCC 2J0JA 3Q14C 1IGCA 2CKHB 1IBXB 3UQBA 3GE8C 3V60A 2N9LA 3T9LA 3VVWB 1WX9A 5L95C 1WX7A 3AE1B 2L0FA 4J6IA 1BUIC 3B0AA 2WXLA 4US9A 4ANXA 1T0YA 3AXCA 3NUHB 1L5PA 3VRAB 4WWMA 2LGXA 2N1WA 4K3CA 2NBWB 1ZXIA 4RCOA 2I1KA 5AZFA 2KC2A 3DHGC 4M02A 3TMPB 2DLBA 3MP9A 2JQRB 3VRBB 1V8CA 4LCDE 2INCC 3K9OB 1P0RA 2PIAA 1FO4A 4P7IA 3H9DA 3PRMB 2AEHA 3PLVA 2KO3A 2JUOA 4BOZB 4RGNA 2CU3A 2BF8B 2FBWB 4A90A 2LUEA 3WANA 1MG8A 2DAJA 2GBRA 2KN4A 2KLGA 1ZE3D 1QLBB 2KXJA 2LASA 1T5XD 4NJ6A 1FRRA 3AEGB 2WDQB 2AX5A 1YJ1A 4CQNA 1B9RA 3I5JC 1E6EB 3WA0A 3SR6A 1OGWA 2RMMA 1MVKA 3CSFA 3HUIA 1GG3A 2AQ3B 1JWAD 3KYCD 4C56C 3LDZE 1P9DU 4P1BC 2HTHA 3X23A 2BTEA 3VAWA 2NMQA 4GDKA 3ZVVA 3S2AA 3RMKC 4ZRKA 1WSPA 3H7SA 3ZTCA 3VHTC 4HK2A 2JSVX 2VZKD 1GAQB 4W9LA 3RD2A 2DZJA 3WAOA 1R4NB 2IO0B 1KM7A 1PGAA 1ZPSA 1D5XC 3U30A 3AE8B 1YOVB 1PGXA 4MGIE 1YQBA 4W9HA 4HWIB 1IYFA 4PS8A 3HM6X 1PYWD 4ZRIA 1L7YA 2PLPA 2N9XA 1HZ6A 2MBOA 5C1ZA 1AWDA 3DBRB 5J18A 3ZDMC 2Z59B 1KFYB 2G1EA 4WIPA 3ZNZB 4GN1A 2W82A 1TT5B 3V3XA 1ZW7A 3H1UA 4B6WA 4ZRJA 4JWSC 3BIID 2KD0A 2MEKA 2MA9B 1QT9A 3P4SB 1LXDA 1X1MA 1JMLA 3GE3C 2WX0A 3AB5A 2JRIB 1CZPA 2NBUA 3PSEB 1SB3C 4AJYB 4EOYA 2RD0A 4MH0E 4RGOS 2M19A 4KGTA 1FIQA 3OJ3A 3O13A 3RI7C 1DOYA 2ZW1A 4WWPA 5GXGB 2K8HA 3R2TA 1E8WA 2JXXA 1STEA 4AJWA 1JRUA 3ZXVA 1FNVA 2FNJB 1TS3A
chains in the Genus database with same CATH topology
1V80A 3KYDD 4DDGD 2CHZA 4M8NA 3PV1A 3L13A 2OOBB 1UZXB 4DHZE 1C3TA 4XC2A 1FXTB 4KVGB 4HCPB 1M94A 2O6VB 1UBIA 3Q3JA 3NHEB 1Y8RC 4HCNB 2GBJA 2BYFA 3KH0A 2DYOA 4E74A 4EZJA 4NAWB 5EDSA 1EO6A 3W1SC 4FJVB 3ZNID 2PJHA 4E3CA 1WXVA 2KFJA 2ZJDA 2KX3A 4ANUA 4MGYE 2Z0DB 2ASQA 4KIKA 4KDLB 5D7GA 3R7QA 2NR2A 1WR1A 3A33B 2LRUA 2O2VA 5AZHA 4II2B 5JZEB 3A9JA 3JW0X 3UIPB 4BVUC 2LXCA 3QWZB 4DHJB 3Q3FA 1TZ1A 3ALBA 1I35A 1YX6B 3KVFB 4IG7B 1KOTA 2JY6A 4I6PA 3OAWA 2C60A 4K7SA 3JSVA 4MSQB 2EMSA 1J19A 1V86A 3APCA 4IM2A 2JZZA 3PZDA 5D6JB 1E7VA 4NQKE 2BWES 3D32A 2GMIC 1WE6A 2MQJA 3L16A 4W9JA 3VH4B 3A1QA 3ZLZA 2J7QB 2HD5B 3DVGX 4ICUA 4LJOB 4BBNC 3DVNV 5TR5A 5D2MB 1Q5WB 1GUAB 2N1VA 4I6LB 5E6OA 4II3B 5E6NA 1LQBA 2R2OA 2FCNA 2KFKB 2ZNVC 4AWJA 3M62B 2KKCA 5G2NA 2LD9A 3NZUA 4EFOA 4NPNA 2KNBA 1R4NI 2AL6A 1YX5B 3RUIB 3U7DA 1E8XA 4NY0A 1H8CA 2KMAA 2XBBC 4XZ4A 3L10B 4G0NB 4W9CA 5JHBA 3ONSA 3ZNHB 1QZEA 3WAMA 4BKGA 4AUQC 4WJOA 2L8JA 2IY0B 2K39A 2YLMA 3M3JA 2MRPA 2G3QB 2KZRA 2RPQA 4JIOU 4K1RB 4NNJB 3RZWC 5DPWA 3V6CB 2N7EA 4BKSD 4GDLB 2J0MA 3IBEA 2WWZA 1UBQA 2A4ZA 4EKUA 1HE8A 1Z5SB 3DVNU 2DYBA 4LJPB 4IM0A 3EHVA 2MBQA 4NAWA 2MWSB 2ZPYA 3DBRI 4HLEA 1WE7A 2CU1A 2KQSA 1E8ZA 2AWTA 2L7RA 3A4RA 1GNUA 3IHPC 4TUUA 1I42A 4FA6A 2KVRA 1V5OA 3ZRFA 3M63B 2D2QA 4EUTA 1ZKHA 1SIFA 4GSWA 4GXBA 2CHXA 2WX1A 2G4SA 2M1MA 1S1QB 2KWVB 1UELA 3NY5A 2MP2B 2BYEA 2K8CA 4FBJB 3UINB 2IO2B 2R2QA 3LJ3A 3HHMA 2FAZA 4AOFA 2QHOA 4W9GA 2K1FA 2MSED 2DYMA 3VTWA 3U8ZA 4FULA 2D07B 1WI0A 3PGEA 3CSTA 1V81A 4OVUA 5CHVC 1OQYA 3PPAA 3P2BA 3RT3B 1EF1A 1WGGA 4HVBA 2KFKA 3MTNB 4K7WA 2C9WB 2RGFA 2VRRB 3PRZA 5DPTA 2FUHB 3VTUA 4CYEA 3KUCB 3R3MA 1A5RA 3A9KB 3ZNGC 1Z2MA 3KUDB 2FCMA 3UF8A 2KQ7A 5HKHA 1WGYA 2EKEC 2Y5BB 4G3XB 3WIMA 2MX2A 2M0XA 2MBBB 3SD5A 5LXHA 3QIJA 4W9EA 4URKA 4GDLA 2PPHA 2DAFA 2MBHA 4WJPA 1CMXB 1Q0WB 4IWQA 3AULA 5IAAC 1WJ6A 4KZCA 3TL5A 1ISNA 3NZSA 5G55A 2L76A 3L17A 1E90A 3SDLC 4LDTB 4W9KA 4HJKA 3DQVA 1WFYA 4DWFA 1WM3A 4BKTA 2NVUI 3GOEA 5AEKB 3V62A 2DZKA 2KN5A 2JZ3B 1WXAA 4FADA 1YIWA 1LFDA 5E6PA 4A3PA 4EZLA 2DX5B 4N9F4 1WGDA 1G6JA 2V4LA 2LVPA 4K81A 4LDTD 3CF6E 4GB9A 4GOCA 4A3OA 4B95A 3WAPA 3MHSD 3ZIMA 4FLHA 4WJNA 2LRWA 4TQ1A 2V3SA 4BOSC 2JT4B 3VH3B 2MP2A 2UWQA 1RLFA 2UYZB 4FHJA 4FHKA 3C0RB 4F1SA 2C7NB 2PEAA 1IPGA 3N32A 4MDKE 1RAXA 1D3ZA 2ZNVB 4EZKA 1WJNA 2LWPA 2N9PC 2LVOA 2PE6B 3RCZA 1NDDA 4DHZB 1WF9A 3PREA 2GOWA 1RRBA 1WX8A 2M17A 4GGQA 1K8RB 1TTNA 4TV3A 2PE9A 3L0WB 3PHWB 3QAQA 5CTRC 2IBIB 2KHWB 1XQQA 4HDOA 2AYOB 3EECA 1VD2A 2V1YA 2LGDA 4M0WB 1Q1OA 3A9KA 2KDFB 2K8BA 2XK5A 3DBHI 2KANA 4MGZE 3W1SA 1UH6A 1WZ0A 3ENEA 2W9NA 2L00B 5JHAA 4MELA 3X0WA 1IP9A 3V61A 2ZPNA 4JGHB 1AARA 1H4RA 3VTVA 2MBEA 3JVZX 4I6NB 2JPHA 1F9JA 4B9KA 4F8CB 1OEYJ 2KX0A 3IFWB 4IM3A 3W1YA 2FCQA 1EF5A 4BBNF 5L83A 3PT2B 3BINA 1WYWB 2L05A 4AP4C 2JRHA 2FIFA 3CMMB 3MJWA 1WXMA 2K25A 2D10A 2L3ZA 2BWFA 3A4SC 5FR6A 4ANWA 4ZYNA 2KK8A 5GMVA 5AZGA 2KDEB 3SHQA 2K6QA 1S3SG 3B1LX 2KTRB 2J0JA 3PLUA 1EUVB 1V49A 3JYUA 1WZ3A 2CKHB 3RULA 4XX5A 3UQBA 1WXSA 3QK0A 4JQWC 3V60A 3VUWA 3T9LA 3VVWB 5JH5C 2BKRB 3ML8A 1WX9A 3ZDTA 1WX7A 1P1AA 2L0FA 4J6IA 4MGKE 4W9IA 3ZUNA 5LLIA 2BYVE 1GJZA 2REXA 3B0AA 3AU5A 5D94A 4JLCA 2C7HA 1YD8U 1LM8B 4CHKA 2AL3A 3DBLI 3RYTA 2DZIA 3O65B 4G11A 3DDCB 5CX3A 1NBFC 3PRPB 1T0YA 1SE9A 3AXCA 3PS6A 2CS4A 2KC1A 3H6NA 2MCNB 1UD7A 4OVVA 2LGXA 4FN2A 3PVLA 2KMCA 2N1WA 2NBVB 5DPSA 2DENB 5DPRA 2NBWB 3QC8B 2KTFA 4BKSA 2XK5B 2I1KA 4GDKB 1R4MI 1WGHA 5AZFA 5LXIB 5CHFA 3APFA 2KC2A 2ZCCA 3TMPB 1OTRB 4W9DA 1SGHA 3QCAA 2JWZA 1V9JA 2IO1B 3VDZA 1WMHA 2J0KA 3GZNI 4NJ7A 1XT9B 3UIOB 3EC8A 3HK0A 4LCDE 4RM8A 3TCAA 3K9OB 1P0RA 2KJRA 4ICVA 4WWOA 2IO3B 4F7ZA 4P7IA 3UQAA 3H9DA 3PRMB 2AEHA 3PLVA 3QX1A 2KO3A 2JUOA 4BOZB 2BF8B 2LJ5A 3VUYA 3ZW3A 2LUEA 2IYDB 4MEMA 3WANA 1MG8A 2DAJA 2GBRA 2KLGA 1NI2A 2N4FA 3TBLD 4FJZA 3BY4B 3IVFA 2HJ8A 1V5TA 2KXJA 3L08A 1KLVA 1P98A 3I3TB 1OEYA 4ANVA 1J8CA 3QJZA 2KTRA 5KHOA 2GBMA 2LASA 3H7PA 4NJ6A 4A20A 1GC6A 4DBGA 2KDIA 1YJ1A 1BT0A 1TGZB 3N3KB 3T8MA 4DXAB 2M4NA 2LXAA 4NQLB 4KZ0A 3WA0A 2NPTA 3DCGA 1OGWA 2O6VD 3CSFA 2BPSA 1GG3A 2BKFA 3TJPA 2ZVOA 1E7UA 4TKNA 3ZTDA 4K7UA 4ZDVA 2FCSA 3KYCD 2IZVB 4FJYA 2D11A 4IWOA 2C5LC 4PS7A 2RSUA 3LDZE 2ZVNA 1P9DU 4HXDA 1L2NA 3ECIA 4MSMB 3VUXA 3NOBA 2B3AA 4WWNA 2HTHA 1TBEA 4HPMB 3X23A 1UGMA 2WYQA 1WRDB 4HPLB 2FIDA 3VAWA 1GC7A 4GDKA 2WDTB 4GU2A 4DHJD 1RFAA 2KWUB 3VQIA 3S2AA 3ZVVA 2JVCA 2LVQA 3KUZA 4ZRKA 2K6DB 4ASWC 2ZCBA 3H7SA 2KOXA 1WMHB 2N7DA 4GMVA 4RMAA 3VHTC 3ZTCA 4HK2A 2OJRA 4ANXA 1WR6E 4KV2A 5CHWA 1WH3A 1V6EA 2KWCA 4GIVA 3APDA 2L0TA 4W9LA 3RD2A 2DZJA 3HM3A 3NS8A 4PYZA 3OJ4B 2LZ6A 3WAOA 2IO0B 1KM7A 4JL9A 2NCNA 3QHTA 3ML9A 4MJSB 1PQSA 1WIAA 2RR9A 3U30A 1E5WA 2C7MB 3N30A 3VFKA 4MGIE 2KLCA 2A5UA 4BFRA 3DVGY 1YQBA 5J2RA 4W9HA 3VXWA 2LGYA 4M8MA 4HWIB 1IYFA 2KJ6A 3HM6X 4PS8A 4IC7B 3DBSA 3PTFC 3QA8A 1L7YA 4ZRIA 2CHWA 2N9XA 2MBOA 3H7PB 3EFUA 3RZFA 2O6VA 1KJTA 4E71A 1VCBA 3PHXB 2MLBA 4TQ0A 5C1ZA 2GBKA 5J18A 3ZDMC 2Z59B 3R66C 5BO4B 2NPTB 2CR5A 3DOWA 2D3GA 4WJQA 4HDQA 4EEWA 1P3QU 4WQOB 3AU4A 3V6EB 3ZNZB 4KIKB 2NS5A 5KHQA 2O2VB 4GN1A 3QARA 4CO7A 2KDBA 3A9JB 1V2YA 4PYUA 5DCNA 1ZW7A 2G4DB 4PS3A 3H1UA 4B6WA 1WJUA 2EMTA 3B08A 4KSKC 4ZRJA 3UGBB 2HE7A 2KD0A 1J0GA 1WJ4A 2MA9B 1U4AA 2YVCA 3SU8X 4IWPA 1LXDA 1X1MA 2MW5A 1XD3B 2G45B 4G50A 3JSVB 2IY1B 3M95A 2DZMA 3DPDA 1E8YA 5L95C 2WX0A 4RM9A 5C23A 3WALA 2ZZPB 3QQ8B 3L54A 3ZKJC 2JRIB 2ZEQA 4IW0A 3A1QB 2M8SA 2N9EB 3TIXA 4KSLC 2NBUA 3IG3A 3PSEB 4AJYB 4DK5A 4W9FA 3KW5B 2BGFA 4EOYA 2JF5A 2RD0A 1ZGUB 4MH0E 2GBNA 4IUMB 3HIZA 3OJ3A 2LI5A 4X57B 1WM2A 4DDID 1WGRA 1C1YB 4WWPA 1WY8A 4MJSA 2K8HA 4YL8A 5IA7A 4KDIC 5J17A 2KJHB 1E8WA 2JXXA 3AI5A 2Z0EB 4AJWA 1JRUA 3K9PB 3R7RA 3ZRCA 2FNJB 2XEWA 4WAAA 2DHZA 4MM3A 3ZO5B 2I1JA 3OLMD
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1V80 A;  3KYD D;  4DDG D;  2CHZ A;  4M8N A;  3PV1 A;  3L13 A;  2OOB B;  1UZX B;  4DHZ E;  1C3T A;  4XC2 A;  1FXT B;  4KVG B;  4HCP B;  1M94 A;  2O6V B;  1UBI A;  3Q3J A;  3NHE B;  1Y8R C;  4HCN B;  2GBJ A;  2BYF A;  3KH0 A;  2DYO A;  4E74 A;  4EZJ A;  4NAW B;  5EDS A;  1EO6 A;  3W1S C;  4FJV B;  3ZNI D;  2PJH A;  4E3C A;  1WXV A;  2KFJ A;  2ZJD A;  2KX3 A;  4ANU A;  4MGY E;  2Z0D B;  2ASQ A;  4KIK A;  4KDL B;  5D7G A;  3R7Q A;  2NR2 A;  1WR1 A;  3A33 B;  2LRU A;  2O2V A;  5AZH A;  4II2 B;  5JZE B;  3A9J A;  3JW0 X;  3UIP B;  4BVU C;  2LXC A;  3QWZ B;  4DHJ B;  3Q3F A;  1TZ1 A;  3ALB A;  1I35 A;  1YX6 B;  3KVF B;  4IG7 B;  1KOT A;  2JY6 A;  4I6P A;  3OAW A;  2C60 A;  4K7S A;  3JSV A;  4MSQ B;  2EMS A;  1J19 A;  1V86 A;  3APC A;  4IM2 A;  2JZZ A;  3PZD A;  5D6J B;  1E7V A;  4NQK E;  2BWE S;  3D32 A;  2GMI C;  1WE6 A;  2MQJ A;  3L16 A;  4W9J A;  3VH4 B;  3A1Q A;  3ZLZ A;  2J7Q B;  2HD5 B;  3DVG X;  4ICU A;  4LJO B;  4BBN C;  3DVN V;  5TR5 A;  5D2M B;  1Q5W B;  1GUA B;  2N1V A;  4I6L B;  5E6O A;  4II3 B;  5E6N A;  1LQB A;  2R2O A;  2FCN A;  2KFK B;  2ZNV C;  4AWJ A;  3M62 B;  2KKC A;  5G2N A;  2LD9 A;  3NZU A;  4EFO A;  4NPN A;  2KNB A;  1R4N I;  2AL6 A;  1YX5 B;  3RUI B;  3U7D A;  1E8X A;  4NY0 A;  1H8C A;  2KMA A;  2XBB C;  4XZ4 A;  3L10 B;  4G0N B;  4W9C A;  5JHB A;  3ONS A;  3ZNH B;  1QZE A;  3WAM A;  4BKG A;  4AUQ C;  4WJO A;  2L8J A;  2IY0 B;  2K39 A;  2YLM A;  3M3J A;  2MRP A;  2G3Q B;  2KZR A;  2RPQ A;  4JIO U;  4K1R B;  4NNJ B;  3RZW C;  5DPW A;  3V6C B;  2N7E A;  4BKS D;  4GDL B;  2J0M A;  3IBE A;  2WWZ A;  1UBQ A;  2A4Z A;  4EKU A;  1HE8 A;  1Z5S B;  3DVN U;  2DYB A;  4LJP B;  4IM0 A;  3EHV A;  2MBQ A;  4NAW A;  2MWS B;  2ZPY A;  3DBR I;  4HLE A;  1WE7 A;  2CU1 A;  2KQS A;  1E8Z A;  2AWT A;  2L7R A;  3A4R A;  1GNU A;  3IHP C;  4TUU A;  1I42 A;  4FA6 A;  2KVR A;  1V5O A;  3ZRF A;  3M63 B;  2D2Q A;  4EUT A;  1ZKH A;  1SIF A;  4GSW A;  4GXB A;  2CHX A;  2WX1 A;  2G4S A;  2M1M A;  1S1Q B;  2KWV B;  1UEL A;  3NY5 A;  2MP2 B;  2BYE A;  2K8C A;  4FBJ B;  3UIN B;  2IO2 B;  2R2Q A;  3LJ3 A;  3HHM A;  2FAZ A;  4AOF A;  2QHO A;  4W9G A;  2K1F A;  2MSE D;  2DYM A;  3VTW A;  3U8Z A;  4FUL A;  2D07 B;  1WI0 A;  3PGE A;  3CST A;  1V81 A;  4OVU A;  5CHV C;  1OQY A;  3PPA A;  3P2B A;  3RT3 B;  1EF1 A;  1WGG A;  4HVB A;  2KFK A;  3MTN B;  4K7W A;  2C9W B;  2RGF A;  2VRR B;  3PRZ A;  5DPT A;  2FUH B;  3VTU A;  4CYE A;  3KUC B;  3R3M A;  1A5R A;  3A9K B;  3ZNG C;  1Z2M A;  3KUD B;  2FCM A;  3UF8 A;  2KQ7 A;  5HKH A;  1WGY A;  2EKE C;  2Y5B B;  4G3X B;  3WIM A;  2MX2 A;  2M0X A;  2MBB B;  3SD5 A;  5LXH A;  3QIJ A;  4W9E A;  4URK A;  4GDL A;  2PPH A;  2DAF A;  2MBH A;  4WJP A;  1CMX B;  1Q0W B;  4IWQ A;  3AUL A;  5IAA C;  1WJ6 A;  4KZC A;  3TL5 A;  1ISN A;  3NZS A;  5G55 A;  2L76 A;  3L17 A;  1E90 A;  3SDL C;  4LDT B;  4W9K A;  4HJK A;  3DQV A;  1WFY A;  4DWF A;  1WM3 A;  4BKT A;  2NVU I;  3GOE A;  5AEK B;  3V62 A;  2DZK A;  2KN5 A;  2JZ3 B;  1WXA A;  4FAD A;  1YIW A;  1LFD A;  5E6P A;  4A3P A;  4EZL A;  2DX5 B;  4N9F 4;  1WGD A;  1G6J A;  2V4L A;  2LVP A;  4K81 A;  4LDT D;  3CF6 E;  4GB9 A;  4GOC A;  4A3O A;  4B95 A;  3WAP A;  3MHS D;  3ZIM A;  4FLH A;  4WJN A;  2LRW A;  4TQ1 A;  2V3S A;  4BOS C;  2JT4 B;  3VH3 B;  2MP2 A;  2UWQ A;  1RLF A;  2UYZ B;  4FHJ A;  4FHK A;  3C0R B;  4F1S A;  2C7N B;  2PEA A;  1IPG A;  3N32 A;  4MDK E;  1RAX A;  1D3Z A;  2ZNV B;  4EZK A;  1WJN A;  2LWP A;  2N9P C;  2LVO A;  2PE6 B;  3RCZ A;  1NDD A;  4DHZ B;  1WF9 A;  3PRE A;  2GOW A;  1RRB A;  1WX8 A;  2M17 A;  4GGQ A;  1K8R B;  1TTN A;  4TV3 A;  2PE9 A;  3L0W B;  3PHW B;  3QAQ A;  5CTR C;  2IBI B;  2KHW B;  1XQQ A;  4HDO A;  2AYO B;  3EEC A;  1VD2 A;  2V1Y A;  2LGD A;  4M0W B;  1Q1O A;  3A9K A;  2KDF B;  2K8B A;  2XK5 A;  3DBH I;  2KAN A;  4MGZ E;  3W1S A;  1UH6 A;  1WZ0 A;  3ENE A;  2W9N A;  2L00 B;  5JHA A;  4MEL A;  3X0W A;  1IP9 A;  3V61 A;  2ZPN A;  4JGH B;  1AAR A;  1H4R A;  3VTV A;  2MBE A;  3JVZ X;  4I6N B;  2JPH A;  1F9J A;  4B9K A;  4F8C B;  1OEY J;  2KX0 A;  3IFW B;  4IM3 A;  3W1Y A;  2FCQ A;  1EF5 A;  4BBN F;  5L83 A;  3PT2 B;  3BIN A;  1WYW B;  2L05 A;  4AP4 C;  2JRH A;  2FIF A;  3CMM B;  3MJW A;  1WXM A;  2K25 A;  2D10 A;  2L3Z A;  2BWF A;  3A4S C;  5FR6 A;  4ANW A;  4ZYN A;  2KK8 A;  5GMV A;  5AZG A;  2KDE B;  3SHQ A;  2K6Q A;  1S3S G;  3B1L X;  2KTR B;  2J0J A;  3PLU A;  1EUV B;  1V49 A;  3JYU A;  1WZ3 A;  2CKH B;  3RUL A;  4XX5 A;  3UQB A;  1WXS A;  3QK0 A;  4JQW C;  3V60 A;  3VUW A;  3T9L A;  3VVW B;  5JH5 C;  2BKR B;  3ML8 A;  1WX9 A;  3ZDT A;  1WX7 A;  1P1A A;  2L0F A;  4J6I A;  4MGK E;  4W9I A;  3ZUN A;  5LLI A;  2BYV E;  1GJZ A;  2REX A;  3B0A A;  3AU5 A;  5D94 A;  4JLC A;  2C7H A;  1YD8 U;  1LM8 B;  4CHK A;  2AL3 A;  3DBL I;  3RYT A;  2DZI A;  3O65 B;  4G11 A;  3DDC B;  5CX3 A;  1NBF C;  3PRP B;  1T0Y A;  1SE9 A;  3AXC A;  3PS6 A;  2CS4 A;  2KC1 A;  3H6N A;  2MCN B;  1UD7 A;  4OVV A;  2LGX A;  4FN2 A;  3PVL A;  2KMC A;  2N1W A;  2NBV B;  5DPS A;  2DEN B;  5DPR A;  2NBW B;  3QC8 B;  2KTF A;  4BKS A;  2XK5 B;  2I1K A;  4GDK B;  1R4M I;  1WGH A;  5AZF A;  5LXI B;  5CHF A;  3APF A;  2KC2 A;  2ZCC A;  3TMP B;  1OTR B;  4W9D A;  1SGH A;  3QCA A;  2JWZ A;  1V9J A;  2IO1 B;  3VDZ A;  1WMH A;  2J0K A;  3GZN I;  4NJ7 A;  1XT9 B;  3UIO B;  3EC8 A;  3HK0 A;  4LCD E;  4RM8 A;  3TCA A;  3K9O B;  1P0R A;  2KJR A;  4ICV A;  4WWO A;  2IO3 B;  4F7Z A;  4P7I A;  3UQA A;  3H9D A;  3PRM B;  2AEH A;  3PLV A;  3QX1 A;  2KO3 A;  2JUO A;  4BOZ B;  2BF8 B;  2LJ5 A;  3VUY A;  3ZW3 A;  2LUE A;  2IYD B;  4MEM A;  3WAN A;  1MG8 A;  2DAJ A;  2GBR A;  2KLG A;  1NI2 A;  2N4F A;  3TBL D;  4FJZ A;  3BY4 B;  3IVF A;  2HJ8 A;  1V5T A;  2KXJ A;  3L08 A;  1KLV A;  1P98 A;  3I3T B;  1OEY A;  4ANV A;  1J8C A;  3QJZ A;  2KTR A;  5KHO A;  2GBM A;  2LAS A;  3H7P A;  4NJ6 A;  4A20 A;  1GC6 A;  4DBG A;  2KDI A;  1YJ1 A;  1BT0 A;  1TGZ B;  3N3K B;  3T8M A;  4DXA B;  2M4N A;  2LXA A;  4NQL B;  4KZ0 A;  3WA0 A;  2NPT A;  3DCG A;  1OGW A;  2O6V D;  3CSF A;  2BPS A;  1GG3 A;  2BKF A;  3TJP A;  2ZVO A;  1E7U A;  4TKN A;  3ZTD A;  4K7U A;  4ZDV A;  2FCS A;  3KYC D;  2IZV B;  4FJY A;  2D11 A;  4IWO A;  2C5L C;  4PS7 A;  2RSU A;  3LDZ E;  2ZVN A;  1P9D U;  4HXD A;  1L2N A;  3ECI A;  4MSM B;  3VUX A;  3NOB A;  2B3A A;  4WWN A;  2HTH A;  1TBE A;  4HPM B;  3X23 A;  1UGM A;  2WYQ A;  1WRD B;  4HPL B;  2FID A;  3VAW A;  1GC7 A;  4GDK A;  2WDT B;  4GU2 A;  4DHJ D;  1RFA A;  2KWU B;  3VQI A;  3S2A A;  3ZVV A;  2JVC A;  2LVQ A;  3KUZ A;  4ZRK A;  2K6D B;  4ASW C;  2ZCB A;  3H7S A;  2KOX A;  1WMH B;  2N7D A;  4GMV A;  4RMA A;  3VHT C;  3ZTC A;  4HK2 A;  2OJR A;  4ANX A;  1WR6 E;  4KV2 A;  5CHW A;  1WH3 A;  1V6E A;  2KWC A;  4GIV A;  3APD A;  2L0T A;  4W9L A;  3RD2 A;  2DZJ A;  3HM3 A;  3NS8 A;  4PYZ A;  3OJ4 B;  2LZ6 A;  3WAO A;  2IO0 B;  1KM7 A;  4JL9 A;  2NCN A;  3QHT A;  3ML9 A;  4MJS B;  1PQS A;  1WIA A;  2RR9 A;  3U30 A;  1E5W A;  2C7M B;  3N30 A;  3VFK A;  4MGI E;  2KLC A;  2A5U A;  4BFR A;  3DVG Y;  1YQB A;  5J2R A;  4W9H A;  3VXW A;  2LGY A;  4M8M A;  4HWI B;  1IYF A;  2KJ6 A;  3HM6 X;  4PS8 A;  4IC7 B;  3DBS A;  3PTF C;  3QA8 A;  1L7Y A;  4ZRI A;  2CHW A;  2N9X A;  2MBO A;  3H7P B;  3EFU A;  3RZF A;  2O6V A;  1KJT A;  4E71 A;  1VCB A;  3PHX B;  2MLB A;  4TQ0 A;  5C1Z A;  2GBK A;  5J18 A;  3ZDM C;  2Z59 B;  3R66 C;  5BO4 B;  2NPT B;  2CR5 A;  3DOW A;  2D3G A;  4WJQ A;  4HDQ A;  4EEW A;  1P3Q U;  4WQO B;  3AU4 A;  3V6E B;  3ZNZ B;  4KIK B;  2NS5 A;  5KHQ A;  2O2V B;  4GN1 A;  3QAR A;  4CO7 A;  2KDB A;  3A9J B;  1V2Y A;  4PYU A;  5DCN A;  1ZW7 A;  2G4D B;  4PS3 A;  3H1U A;  4B6W A;  1WJU A;  2EMT A;  3B08 A;  4KSK C;  4ZRJ A;  3UGB B;  2HE7 A;  2KD0 A;  1J0G A;  1WJ4 A;  2MA9 B;  1U4A A;  2YVC A;  3SU8 X;  4IWP A;  1LXD A;  1X1M A;  2MW5 A;  1XD3 B;  2G45 B;  4G50 A;  3JSV B;  2IY1 B;  3M95 A;  2DZM A;  3DPD A;  1E8Y A;  5L95 C;  2WX0 A;  4RM9 A;  5C23 A;  3WAL A;  2ZZP B;  3QQ8 B;  3L54 A;  3ZKJ C;  2JRI B;  2ZEQ A;  4IW0 A;  3A1Q B;  2M8S A;  2N9E B;  3TIX A;  4KSL C;  2NBU A;  3IG3 A;  3PSE B;  4AJY B;  4DK5 A;  4W9F A;  3KW5 B;  2BGF A;  4EOY A;  2JF5 A;  2RD0 A;  1ZGU B;  4MH0 E;  2GBN A;  4IUM B;  3HIZ A;  3OJ3 A;  2LI5 A;  4X57 B;  1WM2 A;  4DDI D;  1WGR A;  1C1Y B;  4WWP A;  1WY8 A;  4MJS A;  2K8H A;  4YL8 A;  5IA7 A;  4KDI C;  5J17 A;  2KJH B;  1E8W A;  2JXX A;  3AI5 A;  2Z0E B;  4AJW A;  1JRU A;  3K9P B;  3R7R A;  3ZRC A;  2FNJ B;  2XEW A;  4WAA A;  2DHZ A;  4MM3 A;  3ZO5 B;  2I1J A;  3OLM D; 
#chains in the Genus database with same CATH topology
 1V80 A;  4PK1 A;  3H8H A;  1T0R C;  3N1X C;  4XC2 A;  4IDI A;  2G9H D;  1OFF A;  2WXF A;  5C2T B;  2ASQ A;  3R7Q A;  3A33 B;  5AZH A;  4B0M A;  3JW0 X;  4ZHO A;  1TJE A;  1GB1 A;  4HRO A;  4K7S A;  2JY6 A;  3JSV A;  1V86 A;  3APC A;  4IM2 A;  5D6J B;  1E7V A;  3MJ5 A;  3P63 A;  2GMI C;  1WE6 A;  2MQJ A;  3L16 A;  3A1Q A;  2XN9 C;  4ICU A;  4OZC A;  4BBN C;  5D2M B;  1Q5W B;  4HPP A;  4I6L B;  5E6O A;  4II3 B;  5E6N A;  1LQB A;  1SBB B;  4C4V A;  3RFZ B;  2FCN A;  2KFK B;  4NPN A;  2KNB A;  5EE1 A;  3U7D A;  1E8X A;  3R8B A;  1VJK A;  4G0N B;  3ONS A;  3WAM A;  1TS5 A;  4WJO A;  2K39 A;  2YLM A;  1ACC A;  3OWE B;  1JWB D;  2KZR A;  2RPQ A;  5JXV A;  3TEY A;  3NZ3 A;  4RH6 A;  4YWG G;  2WWZ A;  1UBQ A;  2QIL A;  4EKU A;  1FXA A;  4NAW A;  1EWY C;  1WE7 A;  2KQS A;  2L7R A;  4TUU A;  4FA6 A;  2KVR A;  3ZRF A;  2D2Q A;  1EWC A;  1VRA B;  4YSZ B;  1S1Q B;  3ETR A;  4OZA A;  1PFD A;  1ZOY B;  3OG5 A;  2IGG A;  3Q3O C;  4M00 A;  5EE0 A;  2IO2 B;  3HHM A;  1HEZ E;  2WU2 B;  1L0X B;  2K1F A;  3T3N A;  2DYM A;  2V3P A;  3B2F A;  3VTW A;  3U8Z A;  3AEA B;  2WXG A;  2D07 B;  3CST A;  3PPA A;  2PVG C;  3P2B A;  3RT3 B;  2WXM A;  4CYE A;  1A5R A;  3KUC B;  3R3M A;  2L1A A;  1SE3 A;  2CJN A;  1FPY A;  1SSN A;  1AW7 A;  4G3X B;  5LXH A;  2M0X A;  2MBB B;  4W9E A;  3BWU D;  4URK A;  2N9K A;  2DAF A;  4WJP A;  1CMX B;  1RYJ A;  1WJ6 A;  1XLN A;  4KZC A;  1CQV A;  3TSS A;  2QMT A;  5G55 A;  3L17 A;  4HJK A;  3RNE C;  2NVU I;  3GOE A;  2J42 A;  2KN5 A;  4DQO C;  3AH7 A;  1LFD A;  4YXD B;  2DX5 B;  4N9F 4;  1ZDX A;  1G6J A;  4K81 A;  4OHJ A;  4LDT D;  4GB9 A;  3NVW A;  3WAP A;  3W5U B;  4WJN A;  2LRW A;  4MH8 A;  3BVG A;  2V3S A;  2JT4 B;  3VH3 B;  2L52 A;  1N60 A;  2PEA A;  1D3Z A;  2ZNV B;  2I2Y A;  2BS4 B;  3AE3 B;  2LVO A;  2PE6 B;  2ICI A;  1WGK A;  1TTN A;  2J4X A;  3AN1 A;  1LGR A;  3ZXR A;  3P4R B;  2IBI B;  2WXQ A;  1XQQ A;  4K3B A;  3EEC A;  3DHH C;  1Q1O A;  2XK5 A;  3FIL A;  5I4D A;  4OVZ A;  1C4C A;  3IT4 B;  3Q8C A;  5JHA A;  3X0W A;  3V61 A;  4DXF A;  2ZPN A;  4JGH B;  1F0Z A;  1J7B A;  1SJE D;  2JPH A;  2N7J A;  2KX0 A;  3IFW B;  4IM3 A;  3GP7 A;  3T3O A;  1XXG A;  4BBN F;  3AE9 B;  5L83 A;  1WXM A;  2BWF A;  2KK8 A;  5AZG A;  2KDE B;  3SHQ A;  1S3S G;  3B1L X;  3NVY A;  2LJI A;  3PLU A;  1AYF A;  3JYU A;  4LNN A;  1ZUD 2;  3ZJU A;  3RUL A;  4XYC A;  2JZP A;  1WXS A;  2LGS A;  3QK0 A;  5JH5 C;  3ML8 A;  4MGK E;  3RNB C;  3RNC C;  1GJZ A;  3ZQ4 A;  1GOZ A;  3AU5 A;  4JLC A;  2C7H A;  1LM8 B;  3DBL I;  1TZO A;  5CX3 A;  3O65 B;  2GLS A;  2CS4 A;  1UD7 A;  1XCQ L;  4OVV A;  3ZYY X;  5DPR A;  2NBV B;  1DYQ A;  1SE4 A;  2XK5 B;  1R4M I;  1NYQ A;  5CHF A;  2ACZ B;  4W9D A;  1UWM A;  4P16 A;  1WMH A;  2H89 B;  2J0K A;  3GZN I;  4NJ7 A;  3AEE B;  2Y5C A;  3EC8 A;  4RM8 A;  2KJR A;  2IO3 B;  4A9A A;  1UF0 A;  1JRP A;  1UUP A;  3ZW3 A;  2IYD B;  3P4Q B;  3Q3N C;  1GB4 A;  1KLV A;  4ANV A;  3I3T B;  1J8C A;  2GBM A;  4A20 A;  3AV8 A;  1GC6 A;  1I4R A;  4DBG A;  2KDI A;  1IBX A;  3N3K B;  2WGS A;  5AUI A;  4LTU A;  2M4N A;  2V3N A;  1QIL A;  1L6U A;  5IN7 A;  2ZVO A;  1E7U A;  2Y3A A;  4XDC A;  4ZDV A;  1T3Q A;  4IWO A;  3EA6 A;  4PS7 A;  1YN5 A;  2C5L C;  1HTQ A;  2RSU A;  3LYY A;  4HXD A;  2RDH A;  5IOI A;  3VUX A;  1RWS A;  4IKG A;  4HPL B;  3AMZ A;  3I57 A;  2KWU B;  1MHH E;  3KUZ A;  2K6D B;  4WH4 A;  1WMH B;  2N7D A;  1I7H A;  3Q8F A;  4GIV A;  2L0T A;  3J9C A;  3HM3 A;  3NS8 A;  3OJ4 B;  2LZ6 A;  2NCN A;  3QHT A;  1PQS A;  2RR9 A;  3AE2 B;  2BB5 A;  1E5W A;  2C7M B;  1YMH E;  2KLC A;  2A5U A;  4BFR A;  3DVG Y;  3EFC A;  4IC7 B;  2CHW A;  4MT5 A;  4UDU C;  3EFU A;  3RZF A;  2O6V A;  1KJT A;  4ZYS A;  2MLB A;  4TQ0 A;  4S17 A;  1VDV A;  3R66 C;  3HRD D;  5BO4 B;  4WJQ A;  4HDQ A;  4EEW A;  3V6E B;  1RM6 C;  2NS5 A;  5KHQ A;  3NG0 A;  3FKY A;  3A9J B;  4PYU A;  4XWT A;  4HKZ E;  3U7Z A;  1MPE A;  2EMT A;  3UGB B;  1J0G A;  1PDX A;  1WJ4 A;  2MW5 A;  3W9C B;  2WU5 B;  2G45 B;  3M95 A;  2KT7 A;  3I9V 1;  3DPD A;  1E8Y A;  2MJE A;  3QQ8 B;  3AE5 B;  4IW0 A;  4KSL C;  2WP9 B;  3KW5 B;  3RPF C;  1ZGU B;  2IJ0 A;  5BYR A;  2UU7 A;  1WM2 A;  1WGR A;  2WDV B;  1C1Y B;  2DNF A;  4YL8 A;  5IA7 A;  4KDI C;  3CWI A;  2KJH B;  1A70 A;  3MHZ A;  3ZRC A;  4O1N A;  2DHZ A;  3P4P B;  3ZO5 B;  2I1J A;  4F7Z A;  2CHZ A;  2OOB B;  1UZX B;  3BK2 A;  3MC9 A;  2O6V B;  4JE3 B;  4J3O D;  3Q3J A;  1XF5 L;  1Y8R C;  4HCN B;  2BYF A;  5EDS A;  1EO6 A;  4FJV B;  5BMH A;  3ZNI D;  2PJH A;  2QJL A;  2KFJ A;  2ZJD A;  4ANU A;  2BT6 A;  4MGY E;  2WDR B;  1I4H A;  4KDL B;  5D7G A;  1UGJ A;  3AEF B;  2GI9 A;  3QWZ B;  1C79 A;  3Q3F A;  3ALB A;  2HTM E;  2RPV A;  4DXG A;  5EE3 A;  2YEP F;  2IND C;  3KVF B;  4IG7 B;  1KOT A;  2W54 A;  3SFE B;  2QEJ C;  2JWU A;  3D32 A;  3VH4 B;  2M56 B;  2J7Q B;  4LJO B;  3DVN V;  2N1V A;  1JWM D;  2N0S B;  3P42 A;  2KKC A;  3NZU A;  2K9X A;  2CJO A;  1D5Z C;  1YX5 B;  3RUI B;  4YTN B;  4NY0 A;  1H8C A;  2XBB C;  3EUB 2;  3L10 B;  3ZNH B;  4BKG A;  5BYS A;  4AUQ C;  2IY0 B;  2N7E A;  4GDL B;  3IBE A;  2D3C A;  3N9Y C;  1HE8 A;  2DYB A;  1KRH A;  2WXI A;  1EM7 A;  1DOI A;  3BVM A;  1QOF A;  2AWT A;  1GNU A;  1I42 A;  1V97 A;  3MC8 A;  1P7F A;  1V5O A;  1L6V A;  2PVO D;  4EUT A;  1ZKH A;  4GLS C;  1D6E C;  4GSW A;  4GXB A;  2KWV B;  3NY5 A;  2MP2 B;  1XEE A;  2K8C A;  2WXK A;  3VR9 B;  1TY2 A;  2FAZ A;  2QHO A;  3ZJT A;  2KAJ A;  4S0R A;  2KYW A;  4HEA 1;  4NAM A;  4OVU A;  3NRZ A;  1UWX A;  4N59 A;  2MHJ A;  1YNT E;  2KFK A;  1F77 A;  1YQ3 B;  1C4P A;  3PRZ A;  2FUH B;  3DWG C;  1Z2M A;  3KUD B;  1JAL A;  3WCQ A;  1TYG B;  1KF6 B;  3UF8 A;  5HKH A;  1WGY A;  3WIM A;  2QC8 A;  4XWW A;  2MBH A;  1VLB A;  1Q0W B;  3P1M A;  1E0Z A;  2L76 A;  3SDL C;  2SAK A;  3DQV A;  4DWF A;  3V62 A;  3AE7 B;  1WXA A;  1NYR A;  4R3D A;  5LNK 1;  1K53 A;  4HJG E;  2IGH A;  2LVP A;  2Q5W D;  2RDB C;  1TKY A;  4B95 A;  1C77 A;  1TS4 A;  3MHS D;  2M0A A;  1J7A A;  2UWQ A;  2KVZ A;  3E56 A;  4FHK A;  4F1S A;  4A55 A;  1RAX A;  3NVV A;  4RGM A;  4EZK A;  4C7Y A;  1B1Z A;  1KTK A;  3RCZ A;  1NDD A;  1V1O A;  1WF9 A;  2M17 A;  4ARI A;  4LK0 M;  1P7E A;  5TSS A;  4HDO A;  2ONQ A;  4US8 A;  2BVC A;  1SXT A;  3FC4 A;  3DBH I;  1ZXH A;  2KAN A;  3AEB B;  4EE2 A;  1C4A A;  1WZ0 A;  1I4Q A;  4IOI E;  2L00 B;  1IP9 A;  2WQY B;  1SIJ A;  1F9J A;  1OEY J;  1NVI D;  4AS1 A;  2FCQ A;  1EF5 A;  1T0Q C;  3BIN A;  1WYW B;  4AP4 C;  2JRH A;  1N6Z A;  1SF0 A;  2L3Z A;  4C00 A;  5GMV A;  1XLQ A;  5IP4 D;  1XLO A;  2KTR B;  2WHI A;  1EUV B;  1WZ3 A;  2NTT A;  5IKC M;  3RNG C;  1P1A A;  4W9I A;  5LLI A;  4ZHP A;  2BBC A;  2BYV E;  5D94 A;  4CHK A;  1YD8 U;  3RYT A;  3TJP A;  3DDC B;  3FAH A;  1NBF C;  3PRP B;  3PS6 A;  1SE9 A;  2KC1 A;  4FN2 A;  1FEH A;  2DEN B;  3QC8 B;  2KTF A;  4USA A;  5LXI B;  3LB8 C;  2ZCC A;  4QAY A;  1SGH A;  3QCA A;  2JWZ A;  2LFI A;  1V9J A;  2YEP B;  4Q2J A;  4ICV A;  4WWO A;  2IGD A;  3U52 E;  4AQ7 A;  3QX1 A;  1HTO A;  4JWU C;  4MEM A;  3L4P A;  2N4F A;  3TBL D;  4FJZ A;  3BY4 B;  3Q3M C;  2HJ8 A;  2X8X X;  1D5M C;  4KKJ A;  3L08 A;  4N58 A;  3QJZ A;  2L32 A;  3H7P A;  1K52 A;  1EU4 A;  1TGZ B;  3T8M A;  2VH1 A;  4NQL B;  1ENF A;  4KZ0 A;  2NPT A;  4REZ A;  3B9J A;  3DCG A;  2O6V D;  2BKF A;  4TKN A;  4K7U A;  2JX5 A;  2FCS A;  2IZV B;  1CJE A;  1L2N A;  3ECI A;  3HVZ A;  3Q8A A;  4MSM B;  4M01 A;  4ITK A;  1UGM A;  1WRD B;  2FID A;  1GC7 A;  2WDT B;  3VQI A;  3Q8B A;  3PO0 A;  4MAC A;  3NS1 A;  1WR6 E;  5FR3 A;  3KLS X;  1V6E A;  2HJ1 A;  4JL9 A;  4MJS B;  1CK1 A;  3DBH B;  4LNK A;  2K5P A;  3VFK A;  1RFK A;  5J2R A;  4MM3 B;  3W2D A;  3VXW A;  4WUR A;  4M8M A;  1YJJ A;  1ZDV A;  3LXF A;  3QA8 A;  3H7P B;  4E71 A;  1VCB A;  1TKG A;  5BMI A;  1QOA A;  2GBK A;  2HDE A;  1F1H A;  2NPT B;  2CR5 A;  3AU4 A;  3UI3 A;  4KIK B;  5H92 C;  2O2V B;  3QAR A;  4CO7 A;  4P1C C;  2KDB A;  2SEB D;  1JWU D;  2G4D B;  4PS3 A;  1WJU A;  2HE7 A;  1FNU A;  2V4I B;  1U4A A;  4WQM A;  1Q10 A;  5C23 A;  4RM9 A;  1NEN B;  3WAL A;  3L54 A;  2M8S A;  2MH7 A;  1UNS A;  2LMC A;  1M4V A;  3URY A;  4P6V F;  4X57 B;  2INN E;  1KLG D;  1WY8 A;  2BYT A;  2Z0E B;  3K9P B;  3R7R A;  4WAA A;  1MFW A;  3KYD D;  1SE2 A;  4M8N A;  3PV1 A;  3L13 A;  4DHZ E;  4L2Y A;  1FXT B;  1UBI A;  1MI0 A;  3NHE B;  2GBJ A;  4NJC A;  3KH0 A;  2J53 A;  4EZJ A;  2DBY A;  2EKI A;  1D4B A;  2MJ3 A;  3SFD B;  4E3C A;  1WXV A;  3R2I A;  3DWM A;  4OW0 A;  2NR2 A;  1WR1 A;  2LRU A;  5JZE B;  1KLU D;  3E9S A;  3A9J A;  4WAF A;  2LXC A;  4DHJ B;  1FNW A;  1I35 A;  1YX6 B;  4I6P A;  2C60 A;  2W55 A;  3IXS A;  4MSQ B;  1J19 A;  2K22 A;  2JZZ A;  3PZD A;  1EU3 A;  2BWE S;  2WXP A;  5G5G A;  3ZLZ A;  2HD5 B;  3DHI C;  1DOX A;  1FD6 A;  4RFB A;  1GUA B;  3Q2A C;  2QSD A;  3C19 A;  2BB6 A;  2OJW A;  2R2O A;  1HQR D;  2ZNV C;  1LO5 D;  1R4N I;  2AL6 A;  2WXR A;  4XZ4 A;  5D3D A;  1QZE A;  2MRP A;  2G3Q B;  5DPW A;  4K1R B;  4NNJ B;  3V6C B;  4BKS D;  1ET9 A;  2J0M A;  2R61 A;  2FE8 A;  3I63 C;  2A4Z A;  1Z5S B;  1E7P B;  4LJP B;  4IM0 A;  3EHV A;  3BVZ A;  4C7Z A;  1L4Z B;  2MWS B;  2ZPY A;  2ZW0 A;  3DBR I;  2CU1 A;  1NEK B;  1E8Z A;  1FFV A;  4HKQ A;  3M63 B;  1SIF A;  2CHX A;  2G4S A;  2JYT A;  2M1M A;  3MFG A;  4N6E B;  1JW9 D;  2BYE A;  4FBJ B;  2X38 A;  3UIN B;  2R2Q A;  3LJ3 A;  1SJH D;  1FXI A;  3AEC B;  2QIE B;  3DBL B;  3PGE A;  5CHV C;  1FFU A;  1OQY A;  1FM0 D;  5BYQ A;  1EF1 A;  2RGF A;  2VRR B;  3AE6 B;  3KQ4 A;  2K0P A;  3A9K B;  1R4M B;  4M0W A;  2FCM A;  4OZB A;  1VZ8 A;  5AUK A;  2Y5B B;  1K51 A;  3GZN B;  2EEL A;  3QIJ A;  4YT0 B;  3PZ8 A;  4GDL A;  3RN9 C;  2PPH A;  4IWQ A;  3AUL A;  2INP E;  5IAA C;  3N1Z C;  4XDD A;  1ROE A;  1E90 A;  4LDT B;  4W9K A;  1WM3 A;  4BKT A;  3BZD B;  3PZ7 A;  5AEK B;  5FK9 C;  2JZ3 B;  4FAD A;  2NTS A;  5E6P A;  3CIR B;  3CF6 E;  1Y56 A;  3ZIM A;  1OQR A;  4TQ1 A;  2E6X A;  3TUO A;  2MP2 A;  1RLF A;  5T8I A;  3TEX A;  4MDK E;  4XGA B;  4C80 A;  2LWP A;  2N9P C;  2E3T A;  1OQQ A;  2PTL A;  4DHZ B;  1WX8 A;  1K8R B;  3Q8E A;  4TV3 A;  3B2G A;  3PHW B;  2KHW B;  4L23 A;  2AYO B;  1VD2 A;  2LGD A;  4A8X C;  4M0W B;  3W5V B;  2KDF B;  4RF0 A;  3N1Y C;  3W1S A;  1UH6 A;  2W9N A;  4ACF A;  4MEL A;  3Q6B A;  5BMG A;  2D3A A;  1H4R A;  2LEK A;  3VTV A;  2MBE A;  1FRD A;  4I6N B;  4B9K A;  4F8C B;  2W3R A;  1L0V B;  3W1Y A;  2I38 A;  1QQR A;  4ZOH C;  3PT2 B;  2L05 A;  4B0E A;  3AED B;  2BS3 B;  2OHF A;  2FIF A;  3MJW A;  2K25 A;  2D10 A;  3A4S C;  2FUG 1;  4ANW A;  4ZYN A;  2BS2 B;  2K6Q A;  1V49 A;  2QDF A;  5G5H A;  4XX5 A;  3GB1 A;  5E6J A;  4JQW C;  2D3B A;  3VUW A;  1T0S C;  1IUE A;  2BKR B;  3ZDT A;  3ZUN A;  3NJT A;  2REX A;  2AL3 A;  4YTP B;  2DZI A;  4G11 A;  2WXO A;  2MCN B;  3H6N A;  1V1P A;  1F52 A;  1PGB A;  3PVL A;  2KMC A;  5DPS A;  4BKS A;  5MPO A;  1PUT A;  4GDK B;  1WGH A;  3TEW A;  3APF A;  1OTR B;  2DWQ A;  2IO1 B;  3VDZ A;  3UIO B;  1XT9 B;  3HK0 A;  4LNF A;  3TCA A;  4ZRP A;  3SEB A;  2LHD A;  3UQA A;  2RDG A;  2D5G A;  1KH0 A;  3BK1 A;  2LJ5 A;  3V05 A;  1N5X A;  2GB1 A;  3VUY A;  3RNA C;  2GRI A;  2PKO A;  1F2R C;  5FKA C;  1NI2 A;  1MJD A;  3IVF A;  1V5T A;  1P98 A;  1OEY A;  5KHO A;  2KTR A;  1YJI A;  1BT0 A;  4DXA B;  2LXA A;  1T6B X;  1WRI A;  1L4D B;  4TMA B;  2BPS A;  3ZJV A;  4YSX B;  2LUM A;  3ZTD A;  4FJY A;  1QOG A;  2D11 A;  2ZVN A;  1V1P B;  2W3S A;  3NOB A;  1FMA D;  2B3A A;  4WWN A;  1TBE A;  4HPM B;  4ARC A;  2WYQ A;  3ABV B;  4YSY B;  1QKZ A;  1JWS D;  2J52 A;  4GU2 A;  4HRS A;  1VR9 A;  4DHJ D;  1RFA A;  2JVC A;  2LVQ A;  4ASW C;  2BQQ A;  2ZCB A;  2KOX A;  4GMV A;  4RMA A;  2LHE A;  1WWT A;  2OJR A;  4KV2 A;  1SEB D;  2KQ4 X;  2V9H A;  5CHW A;  1WH3 A;  2KWC A;  2QCZ A;  3APD A;  1WYG A;  4PYZ A;  4KGS A;  1HXY D;  2IDY A;  3ML9 A;  1WIA A;  5HI1 A;  3N30 A;  4LNI A;  1I4G A;  2LGY A;  1QOB A;  2KJ6 A;  1JRO A;  3DBS A;  3PTF C;  4A6Q A;  1HA5 A;  1N5W A;  1MHX A;  2JU6 X;  3PHX B;  4KKI A;  2AQ1 B;  1FCL A;  2WNM A;  3KWL A;  3DOW A;  2D3G A;  1P3Q U;  4WQO B;  1TIF A;  5HG2 A;  5DCN A;  1V2Y A;  2PMV A;  3MC0 B;  3B08 A;  2KAC A;  4KSK C;  2YVC A;  3SU8 X;  4IWP A;  3IAM 1;  5HHD G;  4G50 A;  1XD3 B;  3JSV B;  2IY1 B;  2DZM A;  2B76 B;  1J7C A;  4BAX A;  2IPK D;  2ZZP B;  3ZKJ C;  2ZEQ A;  2Y5P A;  3A1Q B;  2N9E B;  3TIX A;  1VZ7 A;  3IG3 A;  4PT5 A;  2MJD A;  4DK5 A;  4W9F A;  2BGF A;  2XNA C;  1WXQ A;  2JF5 A;  1JQ4 A;  4RNA A;  2GBN A;  4IUM B;  4C4V B;  4RF1 A;  3IAS 1;  3HIZ A;  2LI5 A;  4DDI D;  4RGT A;  3EGR A;  4MJS A;  5J17 A;  1I4X A;  3AI5 A;  4H2A A;  2ON8 A;  2KWD A;  2H88 B;  2XEW A;  4LLG M;  4MM3 A;  3OLM D;  1C76 A;  2K3U A;  4DDG D;  4BZA A;  1C3T A;  4KVG B;  4HCP B;  1M94 A;  2Z8L A;  2DYO A;  4E74 A;  4NAW B;  5IO9 A;  1E10 A;  3W1S C;  2KX3 A;  1E9M A;  2Z0D B;  2JXT A;  4KIK A;  2O2V A;  4II2 B;  4BVU C;  1VZ6 A;  3UIP B;  1YQ4 B;  1TZ1 A;  1YN3 A;  1QF6 A;  1C78 A;  3NVZ A;  3OAW A;  2EMS A;  3TEZ A;  2VZK B;  4NQK E;  1YN4 A;  4W9J A;  3DVG X;  5TR5 A;  2PW9 A;  3VR8 B;  4AWJ A;  1XCT L;  3M62 B;  5G2N A;  2LD9 A;  4EFO A;  1GPX A;  4FXC A;  2KMA A;  4W9C A;  5JHB A;  2L8J A;  3M3J A;  4TSS A;  3RZW C;  1MG4 A;  4JIO U;  3DVN U;  2WS3 B;  3N20 C;  2MBQ A;  1NI3 A;  4HLE A;  3A4R A;  3IHP C;  4L1B A;  1BXT A;  3KWV A;  2WX1 A;  2JYE A;  2L83 A;  2WXH A;  2KMM A;  1UEL A;  3AE4 B;  4ZRQ A;  4KX6 B;  4LNO A;  3ZGZ A;  4AOF A;  4D2K A;  3IT6 B;  1XLP A;  1I4P A;  3AM9 A;  4W9G A;  4NZL B;  2MSE D;  2AQ2 B;  4FUL A;  4JX1 C;  1WI0 A;  1V81 A;  1F2R I;  1WGG A;  4HVB A;  3MTN B;  4K7W A;  2C9W B;  3HVD A;  3VTU A;  5DPT A;  3ZNG C;  3FIL B;  2TSS A;  2KQ7 A;  1N63 A;  5D3I B;  3U2S C;  2EKE C;  1ESF A;  2WLB A;  2MX2 A;  3SD5 A;  1TKE A;  2VH2 A;  1ZP0 B;  5H8Y E;  3TL5 A;  1ISN A;  1K50 A;  3NZS A;  2V0G A;  2OED A;  1WFY A;  1ET6 A;  1C9F A;  2DZK A;  1TY0 A;  1YIW A;  4A3P A;  1JCK B;  4EZL A;  1WGD A;  3RNF C;  2V4L A;  2LGI A;  4GOC A;  4A3O A;  1AN8 A;  4FLH A;  4BOS C;  5EE9 A;  2UYZ B;  4FHJ A;  3C8Y A;  5HFY A;  3C0R B;  2C7N B;  1IPG A;  3N32 A;  1DGJ A;  1WJN A;  2WXN A;  1N61 A;  3PRE A;  1L0Y B;  1RRB A;  2GOW A;  3BYY B;  4GGQ A;  1TS2 A;  2KDM A;  2PE9 A;  3L0W B;  3QAQ A;  5CTR C;  1BML C;  1N62 A;  2V1Y A;  4KGR A;  3Q69 A;  3A9K A;  2K8B A;  1R7S A;  2BW2 A;  4MGZ E;  3ENE A;  1HZ5 A;  1AAR A;  1IGD A;  3JVZ X;  1XO3 A;  2WXJ A;  4JPS A;  5C3J B;  3CMM B;  4XE0 A;  3U4E G;  3BYT B;  5FR6 A;  4YTM B;  3GS2 A;  1FCC C;  2J0J A;  3Q14 C;  1IGC A;  2CKH B;  1IBX B;  3UQB A;  3GE8 C;  3V60 A;  2N9L A;  3T9L A;  3VVW B;  1WX9 A;  5L95 C;  1WX7 A;  3AE1 B;  2L0F A;  4J6I A;  1BUI C;  3B0A A;  2WXL A;  4US9 A;  4ANX A;  1T0Y A;  3AXC A;  3NUH B;  1L5P A;  3VRA B;  4WWM A;  2LGX A;  2N1W A;  4K3C A;  2NBW B;  1ZXI A;  4RCO A;  2I1K A;  5AZF A;  2KC2 A;  3DHG C;  4M02 A;  3TMP B;  2DLB A;  3MP9 A;  2JQR B;  3VRB B;  1V8C A;  4LCD E;  2INC C;  3K9O B;  1P0R A;  2PIA A;  1FO4 A;  4P7I A;  3H9D A;  3PRM B;  2AEH A;  3PLV A;  2KO3 A;  2JUO A;  4BOZ B;  4RGN A;  2CU3 A;  2BF8 B;  2FBW B;  4A90 A;  2LUE A;  3WAN A;  1MG8 A;  2DAJ A;  2GBR A;  2KN4 A;  2KLG A;  1ZE3 D;  1QLB B;  2KXJ A;  2LAS A;  1T5X D;  4NJ6 A;  1FRR A;  3AEG B;  2WDQ B;  2AX5 A;  1YJ1 A;  4CQN A;  1B9R A;  3I5J C;  1E6E B;  3WA0 A;  3SR6 A;  1OGW A;  2RMM A;  1MVK A;  3CSF A;  3HUI A;  1GG3 A;  2AQ3 B;  1JWA D;  3KYC D;  4C56 C;  3LDZ E;  1P9D U;  4P1B C;  2HTH A;  3X23 A;  2BTE A;  3VAW A;  2NMQ A;  4GDK A;  3ZVV A;  3S2A A;  3RMK C;  4ZRK A;  1WSP A;  3H7S A;  3ZTC A;  3VHT C;  4HK2 A;  2JSV X;  2VZK D;  1GAQ B;  4W9L A;  3RD2 A;  2DZJ A;  3WAO A;  1R4N B;  2IO0 B;  1KM7 A;  1PGA A;  1ZPS A;  1D5X C;  3U30 A;  3AE8 B;  1YOV B;  1PGX A;  4MGI E;  1YQB A;  4W9H A;  4HWI B;  1IYF A;  4PS8 A;  3HM6 X;  1PYW D;  4ZRI A;  1L7Y A;  2PLP A;  2N9X A;  1HZ6 A;  2MBO A;  5C1Z A;  1AWD A;  3DBR B;  5J18 A;  3ZDM C;  2Z59 B;  1KFY B;  2G1E A;  4WIP A;  3ZNZ B;  4GN1 A;  2W82 A;  1TT5 B;  3V3X A;  1ZW7 A;  3H1U A;  4B6W A;  4ZRJ A;  4JWS C;  3BII D;  2KD0 A;  2MEK A;  2MA9 B;  1QT9 A;  3P4S B;  1LXD A;  1X1M A;  1JML A;  3GE3 C;  2WX0 A;  3AB5 A;  2JRI B;  1CZP A;  2NBU A;  3PSE B;  1SB3 C;  4AJY B;  4EOY A;  2RD0 A;  4MH0 E;  4RGO S;  2M19 A;  4KGT A;  1FIQ A;  3OJ3 A;  3O13 A;  3RI7 C;  1DOY A;  2ZW1 A;  4WWP A;  5GXG B;  2K8H A;  3R2T A;  1E8W A;  2JXX A;  1STE A;  4AJW A;  1JRU A;  3ZXV A;  1FNV A;  2FNJ B;  1TS3 A; 
#chains in the Genus database with same CATH homology
 1V80 A;  3KYD D;  4DDG D;  2CHZ A;  4M8N A;  3PV1 A;  3L13 A;  2OOB B;  1UZX B;  4DHZ E;  1C3T A;  4XC2 A;  1FXT B;  4KVG B;  4HCP B;  1M94 A;  2O6V B;  1UBI A;  3Q3J A;  3NHE B;  1Y8R C;  4HCN B;  2GBJ A;  2BYF A;  3KH0 A;  2DYO A;  4E74 A;  4EZJ A;  4NAW B;  5EDS A;  1EO6 A;  3W1S C;  4FJV B;  3ZNI D;  2PJH A;  4E3C A;  1WXV A;  2KFJ A;  2ZJD A;  2KX3 A;  4ANU A;  4MGY E;  2Z0D B;  2ASQ A;  4KIK A;  4KDL B;  5D7G A;  3R7Q A;  2NR2 A;  1WR1 A;  3A33 B;  2LRU A;  2O2V A;  5AZH A;  4II2 B;  5JZE B;  3A9J A;  3JW0 X;  3UIP B;  4BVU C;  2LXC A;  3QWZ B;  4DHJ B;  3Q3F A;  1TZ1 A;  3ALB A;  1I35 A;  1YX6 B;  3KVF B;  4IG7 B;  1KOT A;  2JY6 A;  4I6P A;  3OAW A;  2C60 A;  4K7S A;  3JSV A;  4MSQ B;  2EMS A;  1J19 A;  1V86 A;  3APC A;  4IM2 A;  2JZZ A;  3PZD A;  5D6J B;  1E7V A;  4NQK E;  2BWE S;  3D32 A;  2GMI C;  1WE6 A;  2MQJ A;  3L16 A;  4W9J A;  3VH4 B;  3A1Q A;  3ZLZ A;  2J7Q B;  2HD5 B;  3DVG X;  4ICU A;  4LJO B;  4BBN C;  3DVN V;  5TR5 A;  5D2M B;  1Q5W B;  1GUA B;  2N1V A;  4I6L B;  5E6O A;  4II3 B;  5E6N A;  1LQB A;  2R2O A;  2FCN A;  2KFK B;  2ZNV C;  4AWJ A;  3M62 B;  2KKC A;  5G2N A;  2LD9 A;  3NZU A;  4EFO A;  4NPN A;  2KNB A;  1R4N I;  2AL6 A;  1YX5 B;  3RUI B;  3U7D A;  1E8X A;  4NY0 A;  1H8C A;  2KMA A;  2XBB C;  4XZ4 A;  3L10 B;  4G0N B;  4W9C A;  5JHB A;  3ONS A;  3ZNH B;  1QZE A;  3WAM A;  4BKG A;  4AUQ C;  4WJO A;  2L8J A;  2IY0 B;  2K39 A;  2YLM A;  3M3J A;  2MRP A;  2G3Q B;  2KZR A;  2RPQ A;  4JIO U;  4K1R B;  4NNJ B;  3RZW C;  5DPW A;  3V6C B;  2N7E A;  4BKS D;  4GDL B;  2J0M A;  3IBE A;  2WWZ A;  1UBQ A;  2A4Z A;  4EKU A;  1HE8 A;  1Z5S B;  3DVN U;  2DYB A;  4LJP B;  4IM0 A;  3EHV A;  2MBQ A;  4NAW A;  2MWS B;  2ZPY A;  3DBR I;  4HLE A;  1WE7 A;  2CU1 A;  2KQS A;  1E8Z A;  2AWT A;  2L7R A;  3A4R A;  1GNU A;  3IHP C;  4TUU A;  1I42 A;  4FA6 A;  2KVR A;  1V5O A;  3ZRF A;  3M63 B;  2D2Q A;  4EUT A;  1ZKH A;  1SIF A;  4GSW A;  4GXB A;  2CHX A;  2WX1 A;  2G4S A;  2M1M A;  1S1Q B;  2KWV B;  1UEL A;  3NY5 A;  2MP2 B;  2BYE A;  2K8C A;  4FBJ B;  3UIN B;  2IO2 B;  2R2Q A;  3LJ3 A;  3HHM A;  2FAZ A;  4AOF A;  2QHO A;  4W9G A;  2K1F A;  2MSE D;  2DYM A;  3VTW A;  3U8Z A;  4FUL A;  2D07 B;  1WI0 A;  3PGE A;  3CST A;  1V81 A;  4OVU A;  5CHV C;  1OQY A;  3PPA A;  3P2B A;  3RT3 B;  1EF1 A;  1WGG A;  4HVB A;  2KFK A;  3MTN B;  4K7W A;  2C9W B;  2RGF A;  2VRR B;  3PRZ A;  5DPT A;  2FUH B;  3VTU A;  4CYE A;  3KUC B;  3R3M A;  1A5R A;  3A9K B;  3ZNG C;  1Z2M A;  3KUD B;  2FCM A;  3UF8 A;  2KQ7 A;  5HKH A;  1WGY A;  2EKE C;  2Y5B B;  4G3X B;  3WIM A;  2MX2 A;  2M0X A;  2MBB B;  3SD5 A;  5LXH A;  3QIJ A;  4W9E A;  4URK A;  4GDL A;  2PPH A;  2DAF A;  2MBH A;  4WJP A;  1CMX B;  1Q0W B;  4IWQ A;  3AUL A;  5IAA C;  1WJ6 A;  4KZC A;  3TL5 A;  1ISN A;  3NZS A;  5G55 A;  2L76 A;  3L17 A;  1E90 A;  3SDL C;  4LDT B;  4W9K A;  4HJK A;  3DQV A;  1WFY A;  4DWF A;  1WM3 A;  4BKT A;  2NVU I;  3GOE A;  5AEK B;  3V62 A;  2DZK A;  2KN5 A;  2JZ3 B;  1WXA A;  4FAD A;  1YIW A;  1LFD A;  5E6P A;  4A3P A;  4EZL A;  2DX5 B;  4N9F 4;  1WGD A;  1G6J A;  2V4L A;  2LVP A;  4K81 A;  4LDT D;  3CF6 E;  4GB9 A;  4GOC A;  4A3O A;  4B95 A;  3WAP A;  3MHS D;  3ZIM A;  4FLH A;  4WJN A;  2LRW A;  4TQ1 A;  2V3S A;  4BOS C;  2JT4 B;  3VH3 B;  2MP2 A;  2UWQ A;  1RLF A;  2UYZ B;  4FHJ A;  4FHK A;  3C0R B;  4F1S A;  2C7N B;  2PEA A;  1IPG A;  3N32 A;  4MDK E;  1RAX A;  1D3Z A;  2ZNV B;  4EZK A;  1WJN A;  2LWP A;  2N9P C;  2LVO A;  2PE6 B;  3RCZ A;  1NDD A;  4DHZ B;  1WF9 A;  3PRE A;  2GOW A;  1RRB A;  1WX8 A;  2M17 A;  4GGQ A;  1K8R B;  1TTN A;  4TV3 A;  2PE9 A;  3L0W B;  3PHW B;  3QAQ A;  5CTR C;  2IBI B;  2KHW B;  1XQQ A;  4HDO A;  2AYO B;  3EEC A;  1VD2 A;  2V1Y A;  2LGD A;  4M0W B;  1Q1O A;  3A9K A;  2KDF B;  2K8B A;  2XK5 A;  3DBH I;  2KAN A;  4MGZ E;  3W1S A;  1UH6 A;  1WZ0 A;  3ENE A;  2W9N A;  2L00 B;  5JHA A;  4MEL A;  3X0W A;  1IP9 A;  3V61 A;  2ZPN A;  4JGH B;  1AAR A;  1H4R A;  3VTV A;  2MBE A;  3JVZ X;  4I6N B;  2JPH A;  1F9J A;  4B9K A;  4F8C B;  1OEY J;  2KX0 A;  3IFW B;  4IM3 A;  3W1Y A;  2FCQ A;  1EF5 A;  4BBN F;  5L83 A;  3PT2 B;  3BIN A;  1WYW B;  2L05 A;  4AP4 C;  2JRH A;  2FIF A;  3CMM B;  3MJW A;  1WXM A;  2K25 A;  2D10 A;  2L3Z A;  2BWF A;  3A4S C;  5FR6 A;  4ANW A;  4ZYN A;  2KK8 A;  5GMV A;  5AZG A;  2KDE B;  3SHQ A;  2K6Q A;  1S3S G;  3B1L X;  2KTR B;  2J0J A;  3PLU A;  1EUV B;  1V49 A;  3JYU A;  1WZ3 A;  2CKH B;  3RUL A;  4XX5 A;  3UQB A;  1WXS A;  3QK0 A;  4JQW C;  3V60 A;  3VUW A;  3T9L A;  3VVW B;  5JH5 C;  2BKR B;  3ML8 A;  1WX9 A;  3ZDT A;  1WX7 A;  1P1A A;  2L0F A;  4J6I A;  4MGK E;  4W9I A;  3ZUN A;  5LLI A;  2BYV E;  1GJZ A;  2REX A;  3B0A A;  3AU5 A;  5D94 A;  4JLC A;  2C7H A;  1YD8 U;  1LM8 B;  4CHK A;  2AL3 A;  3DBL I;  3RYT A;  2DZI A;  3O65 B;  4G11 A;  3DDC B;  5CX3 A;  1NBF C;  3PRP B;  1T0Y A;  1SE9 A;  3AXC A;  3PS6 A;  2CS4 A;  2KC1 A;  3H6N A;  2MCN B;  1UD7 A;  4OVV A;  2LGX A;  4FN2 A;  3PVL A;  2KMC A;  2N1W A;  2NBV B;  5DPS A;  2DEN B;  5DPR A;  2NBW B;  3QC8 B;  2KTF A;  4BKS A;  2XK5 B;  2I1K A;  4GDK B;  1R4M I;  1WGH A;  5AZF A;  5LXI B;  5CHF A;  3APF A;  2KC2 A;  2ZCC A;  3TMP B;  1OTR B;  4W9D A;  1SGH A;  3QCA A;  2JWZ A;  1V9J A;  2IO1 B;  3VDZ A;  1WMH A;  2J0K A;  3GZN I;  4NJ7 A;  1XT9 B;  3UIO B;  3EC8 A;  3HK0 A;  4LCD E;  4RM8 A;  3TCA A;  3K9O B;  1P0R A;  2KJR A;  4ICV A;  4WWO A;  2IO3 B;  4F7Z A;  4P7I A;  3UQA A;  3H9D A;  3PRM B;  2AEH A;  3PLV A;  3QX1 A;  2KO3 A;  2JUO A;  4BOZ B;  2BF8 B;  2LJ5 A;  3VUY A;  3ZW3 A;  2LUE A;  2IYD B;  4MEM A;  3WAN A;  1MG8 A;  2DAJ A;  2GBR A;  2KLG A;  1NI2 A;  2N4F A;  3TBL D;  4FJZ A;  3BY4 B;  3IVF A;  2HJ8 A;  1V5T A;  2KXJ A;  3L08 A;  1KLV A;  1P98 A;  3I3T B;  1OEY A;  4ANV A;  1J8C A;  3QJZ A;  2KTR A;  5KHO A;  2GBM A;  2LAS A;  3H7P A;  4NJ6 A;  4A20 A;  1GC6 A;  4DBG A;  2KDI A;  1YJ1 A;  1BT0 A;  1TGZ B;  3N3K B;  3T8M A;  4DXA B;  2M4N A;  2LXA A;  4NQL B;  4KZ0 A;  3WA0 A;  2NPT A;  3DCG A;  1OGW A;  2O6V D;  3CSF A;  2BPS A;  1GG3 A;  2BKF A;  3TJP A;  2ZVO A;  1E7U A;  4TKN A;  3ZTD A;  4K7U A;  4ZDV A;  2FCS A;  3KYC D;  2IZV B;  4FJY A;  2D11 A;  4IWO A;  2C5L C;  4PS7 A;  2RSU A;  3LDZ E;  2ZVN A;  1P9D U;  4HXD A;  1L2N A;  3ECI A;  4MSM B;  3VUX A;  3NOB A;  2B3A A;  4WWN A;  2HTH A;  1TBE A;  4HPM B;  3X23 A;  1UGM A;  2WYQ A;  1WRD B;  4HPL B;  2FID A;  3VAW A;  1GC7 A;  4GDK A;  2WDT B;  4GU2 A;  4DHJ D;  1RFA A;  2KWU B;  3VQI A;  3S2A A;  3ZVV A;  2JVC A;  2LVQ A;  3KUZ A;  4ZRK A;  2K6D B;  4ASW C;  2ZCB A;  3H7S A;  2KOX A;  1WMH B;  2N7D A;  4GMV A;  4RMA A;  3VHT C;  3ZTC A;  4HK2 A;  2OJR A;  4ANX A;  1WR6 E;  4KV2 A;  5CHW A;  1WH3 A;  1V6E A;  2KWC A;  4GIV A;  3APD A;  2L0T A;  4W9L A;  3RD2 A;  2DZJ A;  3HM3 A;  3NS8 A;  4PYZ A;  3OJ4 B;  2LZ6 A;  3WAO A;  2IO0 B;  1KM7 A;  4JL9 A;  2NCN A;  3QHT A;  3ML9 A;  4MJS B;  1PQS A;  1WIA A;  2RR9 A;  3U30 A;  1E5W A;  2C7M B;  3N30 A;  3VFK A;  4MGI E;  2KLC A;  2A5U A;  4BFR A;  3DVG Y;  1YQB A;  5J2R A;  4W9H A;  3VXW A;  2LGY A;  4M8M A;  4HWI B;  1IYF A;  2KJ6 A;  3HM6 X;  4PS8 A;  4IC7 B;  3DBS A;  3PTF C;  3QA8 A;  1L7Y A;  4ZRI A;  2CHW A;  2N9X A;  2MBO A;  3H7P B;  3EFU A;  3RZF A;  2O6V A;  1KJT A;  4E71 A;  1VCB A;  3PHX B;  2MLB A;  4TQ0 A;  5C1Z A;  2GBK A;  5J18 A;  3ZDM C;  2Z59 B;  3R66 C;  5BO4 B;  2NPT B;  2CR5 A;  3DOW A;  2D3G A;  4WJQ A;  4HDQ A;  4EEW A;  1P3Q U;  4WQO B;  3AU4 A;  3V6E B;  3ZNZ B;  4KIK B;  2NS5 A;  5KHQ A;  2O2V B;  4GN1 A;  3QAR A;  4CO7 A;  2KDB A;  3A9J B;  1V2Y A;  4PYU A;  5DCN A;  1ZW7 A;  2G4D B;  4PS3 A;  3H1U A;  4B6W A;  1WJU A;  2EMT A;  3B08 A;  4KSK C;  4ZRJ A;  3UGB B;  2HE7 A;  2KD0 A;  1J0G A;  1WJ4 A;  2MA9 B;  1U4A A;  2YVC A;  3SU8 X;  4IWP A;  1LXD A;  1X1M A;  2MW5 A;  1XD3 B;  2G45 B;  4G50 A;  3JSV B;  2IY1 B;  3M95 A;  2DZM A;  3DPD A;  1E8Y A;  5L95 C;  2WX0 A;  4RM9 A;  5C23 A;  3WAL A;  2ZZP B;  3QQ8 B;  3L54 A;  3ZKJ C;  2JRI B;  2ZEQ A;  4IW0 A;  3A1Q B;  2M8S A;  2N9E B;  3TIX A;  4KSL C;  2NBU A;  3IG3 A;  3PSE B;  4AJY B;  4DK5 A;  4W9F A;  3KW5 B;  2BGF A;  4EOY A;  2JF5 A;  2RD0 A;  1ZGU B;  4MH0 E;  2GBN A;  4IUM B;  3HIZ A;  3OJ3 A;  2LI5 A;  4X57 B;  1WM2 A;  4DDI D;  1WGR A;  1C1Y B;  4WWP A;  1WY8 A;  4MJS A;  2K8H A;  4YL8 A;  5IA7 A;  4KDI C;  5J17 A;  2KJH B;  1E8W A;  2JXX A;  3AI5 A;  2Z0E B;  4AJW A;  1JRU A;  3K9P B;  3R7R A;  3ZRC A;  2FNJ B;  2XEW A;  4WAA A;  2DHZ A;  4MM3 A;  3ZO5 B;  2I1J A;  3OLM D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...