5DPRA

Crystal structure of plekhm1 lir-fused human lc3a_2-121
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
124
structure length
124
Chain Sequence
EWVNVGSPSDRPFKQRRSFADRCKEVQQIRDQHPSKIPVIIERYKGEKQLPVLDKTKFLVPDHVNMSELVKIIRRRLQLNPTQAFFLLVNQHSMVSVSTPIADIYEQEKDEDGFLYMVYASQET
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural and functional analysis of the GABARAP interaction motif (GIM).
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein binding
molecule keywords Pleckstrin homology domain-containing family M member 1,Micr
total genus 29
structure length 124
sequence length 124
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2015-09-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02991 Atg8 Autophagy protein Atg8 ubiquitin like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 5dprA00
1WZ3A 2UWQA 2KDIA 2G4DB 3JW0X 3WANA 3KW5B 4G0NB 1TGZB 2JVCA 1RLFA 2ZCCA 3QAQA 3DQVA 1J0GA 1YQBA 4K7UA 1WI0A 1P0RA 2Y5BB 2A5UA 5DCNA 3VUXA 5GMVA 3QHTA 2JUOA 4KDLB 2YLMA 3B0AA 2JZZA 3LDZE 4ANUA 3QC8B 2R2QA 2K39A 3PSEB 2K6DB 4J6IA 3PPAA 2Z0EB 3CSFA 2KK8A 4JGHB 3ALBA 3BY4B 2O2VB 4IM2A 2KJHB 2L00B 4MGYE 3R7RA 2LVOA 4GN1A 1K8RB 4JQWC 3ML9A 1WYWB 1UH6A 1ZGUB 5KHQA 1H8CA 1U4AA 3OJ3A 2DZKA 2N9EB 4BKGA 3U7DA 2BF8B 1S1QB 2NS5A 2LJ5A 2KLCA 2ZPNA 2CR5A 3ML8A 1IPGA 1RAXA 1OQYA 3A1QA 2MLBA 3MTNB 4DK5A 2RD0A 1ISNA 3UIOB 5FR6A 2LVQA 3A4RA 3VXWA 2L3ZA 3L16A 3VUWA 2G45B 2KWUB 1TBEA 2N9PC 4BFRA 4KDIC 2CHWA 3ZVVA 4BVUC 2CHXA 3EC8A 3H9DA 3IG3A 3L08A 3ZTCA 3RZWC 2KDFB 3UGBB 3VDZA 4ZYNA 1WXMA 3VH4B 1GC7A 1BT0A 3V62A 1XQQA 2MQJA 1ZW7A 3OJ4B 1SE9A 3WA0A 3DBSA 1FXTB 1KOTA 3IVFA 2IZVB 4IM0A 1SIFA 3BINA 4NJ6A 2MP2B 2FIDA 2KQSA 4FA6A 1IP9A 1KLVA 2NR2A 3TBLD 1Q5WB 4N9F4 2L8JA 1AARA 4HDQA 2JRIB 1R4NI 3AXCA 4EUTA 2J7QB 2LI5A 3DCGA 3QARA 1F9JA 1Y8RC 1ZKHA 2FCSA 3MHSD 2ZCBA 4IG7B 2AEHA 5CHFA 4PYZA 4W9GA 5E6OA 4MJSB 2KC1A 2L0TA 4DXAB 4GDLB 2KMAA 3QIJA 2XK5A 3DBLI 2C5LC 3JSVB 4BBNC 4M8MA 4BOZB 4FLHA 2JT4B 1WGDA 2LGXA 2BYEA 2C7HA 2IO2B 3B1LX 2EMSA 1CMXB 2BGFA 2KX3A 3M63B 1WE7A 1H4RA 1C3TA 4JLCA 4MM3A 2FNJB 1GC6A 3HK0A 2O6VD 3WAMA 3AI5A 2MA9B 4FULA 2PEAA 2AWTA 1Q1OA 2WX0A 1LM8B 3NOBA 4K81A 2LASA 4PS7A 1I35A 4LCDE 4MJSA 1IYFA 2IY1B 5JH5C 2BKFA 5AZGA 1WMHA 2AL3A 2G4SA 2ZNVC 3A9KA 4TQ0A 2KOXA 2ZVNA 1WX7A 2KTRA 1WGHA 1WR6E 3VHTC 4F1SA 2V3SA 3OLMD 4HWIB 3VTWA 1D3ZA 2D11A 2DAFA 4KZ0A 4WJPA 2LWPA 3R3MA 5J2RA 3A9JA 4GU2A 2M17A 3SHQA 2LVPA 2GBRA 4RMAA 2L0FA 2CU1A 3TJPA 4W9FA 3NS8A 5LLIA 3X0WA 2JWZA 1UZXB 2LUEA 2C60A 1JRUA 4DHZE 4F8CB 2ZJDA 4KV2A 2LZ6A 3PT2B 2KN5A 4W9CA 2KC2A 5E6PA 3SDLC 3APFA 1WMHB 1YIWA 5TR5A 3A33B 4W9IA 4I6NB 4AJYB 4GDKA 3VQIA 1OEYJ 4RM9A 3VVWB 2L76A 5KHOA 1M94A 3N30A 1J19A 2JZ3B 4IW0A 3L17A 2DYOA 2KKCA 2KFKB 2KLGA 2JRHA 5JZEB 5L95C 4ANVA 1XT9B 1I42A 2D2QA 4A20A 4IWPA 4W9JA 4KZCA 3KUDB 4FJVB 1S3SG 2XK5B 2BWES 4HVBA 3VTVA 2N9XA 2WX1A 4DHJB 1HE8A 2IO0B 3K9OB 1WGRA 4JIOU 4EZKA 2IO1B 4TQ1A 5CHVC 4HDOA 4DWFA 2XEWA 4NNJB 2MW5A 1J8CA 3ZO5B 1E8YA 3DBHI 1WRDB 3PRPB 4BKSA 2BYVE 4NQLB 2KD0A 3UQBA 2L05A 3NHEB 2MRPA 3EHVA 3ZKJC 3HIZA 4MGIE 4NJ7A 3RZFA 3NZUA 3VH3B 2KDBA 2O2VA 2NVUI 1L2NA 2N4FA 4W9DA 4ZRJA 3A9KB 4KVGB 1UBIA 2JPHA 2N1VA 4G3XB 2FCNA 5G2NA 2IO3B 1KJTA 1WXVA 4IC7B 1LXDA 4W9HA 3RD2A 4EFOA 2N7EA 1G6JA 3S2AA 3PLVA 3DPDA 3PREA 1WGYA 2BWFA 4GIVA 1X1MA 2LXAA 4LJPB 3ENEA 3ZNZB 2KWCA 4AJWA 4KIKB 1WM3A 2KNBA 3PLUA 4ZRKA 4EZLA 3QA8A 2KJRA 3X23A 1WXSA 3L54A 4K7SA 1V9JA 4ASWC 3WAPA 4MGKE 5C1ZA 5JHBA 3PHXB 5CHWA 2KJ6A 1YX5B 4WWNA 2LRWA 1E8XA 2FIFA 2PE6B 5CTRC 2MBQA 3TL5A 1P9DU 4IUMB 4W9EA 4FJZA 3KYCD 2AL6A 4F7ZA 2KFKA 4NY0A 4TUUA 4HCNB 4GXBA 2O6VA 4YL8A 2WYQA 2PPHA 2CHZA 1OEYA 3I3TB 4MSQB 4ZDVA 4GB9A 2FAZA 2DZIA 2GBKA 4LJOB 4EEWA 1WX8A 4XC2A 2ASQA 2G3QB 2OJRA 2RR9A 4B6WA 1WH3A 2D3GA 4EOYA 2DENB 4LDTD 3ZTDA 1EF1A 3H1UA 3KH0A 1WJUA 3AU5A 4PYUA 1C1YB 5D2MB 4W9KA 5LXIB 3RULA 3QJZA 4CYEA 2EKEC 3UIPB 2EMTA 2NBWB 2M4NA 4GDKB 3JVZX 2L7RA 2LGDA 2KHWB 5DPTA 3H7PB 3PVLA 4NAWB 1Q0WB 3JYUA 2M1MA 3ECIA 3ZNHB 2GMIC 1UELA 2MSED 1V81A 4FN2A 1SGHA 2Z0DB 3VTUA 3K9PB 4PS3A 3WAOA 4DBGA 1OGWA 3AULA 3HHMA 1R4MI 4KIKA 1E7VA 3LJ3A 4DDGD 2J0MA 4MELA 3GZNI 3ONSA 4P7IA 4DDID 3ZLZA 3T8MA 2K25A 2FCMA 3KUZA 3U30A 1OTRB 1VD2A 2D10A 5DPRA 4DHJD 4WWOA 2NPTB 3SU8X 5IA7A 1P1AA 2KTFA 1V2YA 5CX3A 1GG3A 1UD7A 2XBBC 1WJNA 3N32A 2YVCA 2HJ8A 4XX5A 4BBNF 3PZDA 3U8ZA 4AOFA 4I6LB 3V60A 1LQBA 2DAJA 3ZDMC 3CMMB 2IBIB 1VCBA 3KYDD 1V49A 4I6PA 1E8ZA 1V86A 4BKSD 2GBNA 2Z59B 1WXAA 3UF8A 3KVFB 4MEMA 4W9LA 3UINB 2HE7A 2NBUA 1YJ1A 3ZW3A 3AU4A 3KUCB 3PHWB 4AUQC 3PRZA 4KSLC 2IYDB 1NDDA 1WJ4A 2C7MB 4G50A 4MSMB 3DVGY 5AZFA 4OVVA 3EECA 2KX0A 4TKNA 4II3B 3ZNGC 4HXDA 2M0XA 3VUYA 2LD9A 2DZJA 2AYOB 1P98A 4B9KA 4TV3A 3B08A 1WF9A 1E7UA 3QQ8B 2KXJA 4GMVA 1RFAA 1MG8A 1Z2MA 4WJOA 3APCA 2HD5B 3DDCB 4MGZE 2MBBB 5BO4B 1NI2A 1KM7A 3IBEA 1WJ6A 4ZRIA 4G11A 4PS8A 3L0WB 2DYMA 3N3KB 3V61A 3ZDTA 2MWSB 3IHPC 4FJYA 1V5OA 3H6NA 4AWJA 2N1WA 1UBQA 4II2B 3APDA 4E74A 1WIAA 3VAWA 4ANXA 3DVNV 3TCAA 4HCPB 2HTHA 4NQKE 1WM2A 4OVUA 4CO7A 3DVGX 2BKRB 3EFUA 2C7NB 2JXXA 4A3PA 2MCNB 1XD3B 2FUHB 4WWPA 2DX5B 1WY8A 2A4ZA 1WR1A 2ZEQA 4HLEA 2QHOA 5DPWA 2KWVB 3A9JB 3ZUNA 3RUIB 1E90A 5AEKB 4M8NA 1V80A 3R66C 4LDTB 3M3JA 2DHZA 1WX9A 3PGEA 3L10B 4NAWA 3L13A 3M62B 4ICUA 4IWQA 2CKHB 4ICVA 3NZSA 2VRRB 1WZ0A 2DYBA 3ZIMA 1GNUA 2RGFA 4MDKE 2OOBB 2J0JA 1E5WA 4FADA 4GDLA 1NBFC 5DPSA 3NY5A 1GUAB 4KSKC 3ZRCA 4CHKA 2KMCA 3PRMB 4XZ4A 4IWOA 3HM3A 5D94A 1T0YA 5HKHA 5L83A 2MP2A 4WJNA 3PS6A 2MBOA 5C23A 3T9LA 1WE6A 3UQAA 1RRBA 3RYTA 1V6EA 3ZNID 4URKA 2KZRA 2GOWA 1WGGA 3Q3FA 5J17A 5JHAA 4AP4C 2PE9A 2DZMA 2LXCA 2M8SA 4HJKA 3H7SA 3A1QB 1TZ1A 2C9WB 4A3OA 3WIMA 4BOSC 2JY6A 1YX6B 3GOEA 2KFJA 3Q3JA 3RT3B 2BYFA 2R2OA 3CF6E 1EO6A 2ZVOA 3HM6X 3QK0A 3O65B 4FBJB 4ANWA 2I1KA 3W1YA 4GGQA 2D07B 3H7PA 3R7QA 3W1SA 2JF5A 3MJWA 4WJQA 4EZJA 2KQ7A 3SD5A 4WQOB 5EDSA 3IFWB 2K8HA 1QZEA 2J0KA 3WALA 2MX2A 2LGYA 3M95A 2KVRA 2KDEB 4JL9A 4B95A 2I1JA 5D7GA 5E6NA 3DBRI 2KANA 4K7WA 4M0WB 3TMPB 3V6EB 5D6JB 2NBVB 3TIXA 2ZPYA 1EUVB 4K1RB 5LXHA 2BPSA 2MBEA 2NPTA 2ZZPB 3QX1A 4HPLB 2PJHA 4X57B 2KTRB 2REXA 2WWZA 5AZHA 4RM8A 1YD8U 3P2BA 3VFKA 1PQSA 2K8CA 1EF5A 1A5RA 2WDTB 1WFYA 2FCQA 3QCAA 4WAAA 3DOWA 2NCNA 4IM3A 2IY0B 2ZNVB 3ZRFA 3DVNU 2K6QA 2GBJA 2V1YA 2N7DA 1P3QU 3JSVA 2RSUA 3CSTA 3W1SC 4EKUA 4E71A 4HPMB 1Z5SB 2KO3A 4MH0E 3V6CB 2MBHA 4E3CA 2B3AA 2K8BA 3D32A 5J18A 2O6VB 1E8WA 2V4LA 1L7YA 1GJZA 3RCZA 2CS4A 2RPQA 2UYZB 4DHZB 4NPNA 1TTNA 3C0RB 1UGMA 2GBMA 4GSWA 2W9NA 4FHJA 3QWZB 4HK2A 3OAWA 3PV1A 4BKTA 4FHKA 2K1FA 2LRUA 5G55A 3PTFC 1LFDA 4GOCA 3A4SC 1V5TA 5IAAC
chains in the Genus database with same CATH superfamily
1CZPA 4P1CC 1FFVA 3DQVA 1J0GA 2JZPA 1K52A 1P0RA 2Y5BB 5DCNA 3VUXA 1FFUA 3QHTA 2JZZA 3LDZE 3QC8B 1FNVA 1FCLA 2K39A 3BWUD 3MFGA 3PSEB 4J6IA 3RNCC 2Z0EB 4JGHB 4MGYE 4US8A 4IM2A 4C00A 1K8RB 1FO4A 3ML9A 1ZGUB 1U4AA 3U7DA 2KLCA 2CR5A 2MLBA 1ISNA 3N1YC 2KWUB 1TBEA 3MHZA 2CHWA 3R2IA 2CHXA 3H9DA 3IG3A 3VDZA 2X38A 2LGIA 1GC7A 3T3NA 1L0XB 2RDBC 5IN7A 1FXTB 1KOTA 2KQSA 2WGSA 1MJDA 4EUTA 2J7QB 1F9JA 1Y8RC 1ZKHA 2FCSA 4BAXA 2KVZA 2J52A 1F52A 4IG7B 5CHFA 5E6OA 1UUPA 4MJSB 2KC1A 4DQOC 4ACFA 1AWDA 2XK5A 1IGDA 3JSVB 1T0QC 2JT4B 1N5XA 2PKOA 2GB1A 1C76A 3M63B 4RGNA 1WE7A 3NRZA 2WXOA 3HK0A 2H88B 3AI5A 3DWGC 2V3PA 1SJED 1FEHA 5AZGA 1XCTL 2ZNVC 2KOXA 1F2RI 2L32A 1WR6E 5G5GA 2MH7A 2V3SA 4HWIB 4WJPA 2D5GA 2M17A 2LVPA 2CU1A 3NS8A 2WP9B 5C2TB 4XDDA 2OHFA 5TR5A 2IPKD 4W9IA 5IP4D 1J19A 1GOZA 2DYOA 5L95C 1YN4A 1F2RC 4A20A 4IWPA 2LFIA 3DBHB 2BWES 4HVBA 2PIAA 1JROA 3K9OB 2AX5A 1VZ7A 4EZKA 4IOIE 1V1PB 4TQ1A 1N61A 2MW5A 1E8YA 3DBHI 1WRDB 3UQBA 4BKSA 2BYVE 4NQLB 2IGHA 1HZ6A 1A70A 1WXQA 2I38A 1FM0D 5G2NA 3RD2A 2D3BA 3DPDA 1WGYA 5JXVA 4C7ZA 3ZNZB 3ZYYX 3IAM1 1JWAD 1SIJA 4EZLA 3WAPA 3PHXB 2WLBA 4WQMA 4WWNA 1GAQB 5BYRA 3ZJUA 3E56A 3GZNB 3N20C 4YTMB 4NJCA 4F7ZA 1PGXA 2KFKA 4NY0A 1E6EB 2V4IB 2O6VA 3Q69A 4GB9A 1KTKA 1WX8A 2LMCA 4D2KA 2G3QB 4B6WA 4P16A 1I4GA 1EF1A 3H1UA 4W9KA 1XCQL 3RULA 4CYEA 1IUEA 2NBWB 1HXYD 1LO5D 3RPFC 3Q8BA 3PVLA 2M1MA 4HRSA 4HKQA 4A55A 1R4MI 1I4PA 2J0MA 4MELA 2VZKB 2JQRB 4LK0M 3ONSA 4P7IA 1J7CA 3ZLZA 2QJLA 2K25A 2RDHA 3U30A 2D10A 2NPTB 1N5WA 3Q8EA 1P1AA 1V2YA 2XBBC 3RNBC 2GRIA 5FK9C 2BQQA 4K3CA 1BUIC 2Z59B 1FMAD 4P1BC 1R4NB 3RN9C 3UINB 2C7MB 3SFEB 1YOVB 4ZYSA 1D5ZC 2LD9A 3TUOA 2AYOB 2PMVA 1WF9A 4LNNA 3NJTA 1RFAA 3DDCB 4MGZE 1SJHD 2BS3B 4G11A 4GLSC 3V61A 2AQ2B 3IHPC 2X8XX 1UBQA 2JX5A 2WU2B 1ZE3D 1QOFA 3DVNV 1TS5A 2E6XA 2H89B 5IO9A 4CO7A 3EFUA 2C7NB 1VDVA 4WAFA 2FUHB 2ZEQA 2KWVB 1OQQA 4M8NA 3R66C 3M62B 4ICUA 2BT6A 1WZ0A 1CQVA 3ZIMA 2RGFA 4MDKE 2OOBB 3VR9B 4FADA 3PZ8A 3I9V1 3TEYA 3T9LA 3ZNID 3Q3FA 4AP4C 2PE9A 4HJKA 1TZ1A 2KFJA 2N9KA 1ZXHA 3RT3B 1ZOYB 2KAJA 4FBJB 3HM6X 3W1YA 1V97A 2D07B 3MJWA 3SD5A 5EDSA 5GXGB 3WALA 1I7HA 1T0RC 2SEBD 3DHHC 4K7WA 3TMPB 2NBVB 2ZPYA 4K1RB 3BIID 2PJHA 4KGTA 4S0RA 4C7YA 1NYRA 1YD8U 2WDTB 1QKZA 2WXNA 4ARIA 2NCNA 4RF0A 1C78A 2J42A 1CJEA 3ZRFA 3DVNU 1P3QU 3CSTA 2KO3A 1JWUD 4MH0E 4PT5A 4E3CA 2K8BA 1STEA 1L7YA 2LHEA 2RPQA 2WNMA 4DHZB 2INDC 1MHXA 3C0RB 1UGMA 2GBMA 4FHJA 4L2YA 3QWZB 3OAWA 3PV1A 4FHKA 4C4VB 2K1FA 5E6JA 4YT0B 4GOCA 2QCZA 1V5TA 2KDIA 5I4DA 3WANA 3KW5B 2YEPF 3VRBB 4IDIA 4K7UA 4WURA 1K50A 2OEDA 3B9JA 3ZXVA 2R2QA 2K6DB 5BYQA 3CSFA 3RNFC 3ALBA 2Y3AA 4MT5A 1SE4A 1XLNA 1FIQA 1UH6A 5KHQA 3OJ3A 2N9EB 1S1QB 1TJEA 2NS5A 1NEKB 1OQYA 4B0EA 3RNAC 2L3ZA 3VUWA 1Q10A 4BFRA 1JWBD 4BVUC 1D4BA 3RZWC 2KDFB 1WXMA 2PLPA 4XYCA 1BT0A 1EWYC 4XGAB 3OJ4B 2CJOA 3ETRA 2WXKA 1SIFA 4NJ6A 2MP2B 2FIDA 5HG2A 2L8JA 1AARA 3MHSD 3FAHA 4W9GA 4WWMA 2LHDA 2EELA 2L0TA 4DXAB 3DBLI 2C5LC 3NVYA 4BOZB 1JWMD 4RCOA 2AQ1B 2IO2B 4N59A 2RMMA 2EMSA 3B1LX 1CMXB 3KQ4A 2BGFA 2KX3A 4JLCA 5HFYA 2MA9B 4JPSA 1I35A 4KKJA 4WIPA 2QSDA 1E0ZA 3Q3NC 3P4SB 1NENB 4A90A 3B2GA 3VHTC 4F1SA 2D11A 5J2RA 3RNEC 3A9JA 4OHJA 2L0FA 5TSSA 5LLIA 1YN3A 3RMKC 2LUEA 2C60A 4DHZE 4KV2A 5E6PA 1TS2A 5D3IB 4I6NB 3VQIA 2KYWA 2L76A 2V9HA 3W2DA 2KFKB 2JYTA 5JZEB 4ANVA 2XN9C 4KGRA 1DYQA 1ROEA 4KZCA 4FJVB 2L52A 4USAA 3IT4B 3L4PA 2IO0B 2W3SA 1MFWA 1V1OA 4HDOA 4KGSA 4YSZB 2KD0A 5FR3A 1L0YB 2L05A 3ZKJC 3HIZA 3NZUA 4A6QA 1QLBB 2KDBA 2LEKA 3GB1A 3AE9B 3ZJVA 3A9KB 1UBIA 1WRIA 4G3XB 1C4CA 1DGJA 1WXVA 4EFOA 1LXDA 2W3RA 3PLVA 3Q8FA 2LXAA 2KWCA 3AE2B 4K3BA 2KNBA 2KJRA 3L54A 1VRAB 5JHBA 1T0SC 5CHWA 1SE3A 1IBXB 1JWSD 1E8XA 2PE6B 1P9DU 4FJZA 4A9AA 3OWEB 2VH1A 4YL8A 5IOIA 2L83A 3P63A 1EU4A 2PPHA 1YN5A 4JX1C 3I3TB 4CQNA 2FAZA 2DZIA 1D6EC 2GBKA 3TSSA 4XC2A 2ASQA 4RF1A 2RR9A 2D3GA 4EOYA 2DENB 4ITKA 4ZOHC 1KF6B 1SEBD 1WJUA 4PYUA 1UNSA 1VLBA 5LXIB 2EKEC 2EMTA 2M4NA 4GDKB 1J7AA 1ZXIA 2LGDA 3JYUA 3ECIA 1N62A 2GMIC 1V81A 2BVCA 1WYGA 2L1AA 3SR6A 3K9PB 3FILB 2D3AA 3Q14C 1I4HA 3OG5A 1NVID 3LYYA 1XXGA 3KUZA 4TSSA 1TS4A 5DPRA 1V1PA 2B76B 3H8HA 3CWIA 1GG3A 2YVCA 2HJ8A 4BBNF 2ON8A 1M4VA 5EE3A 3IAS1 2DAJA 3ZDMC 2GLSA 2IBIB 1VCBA 1V49A 4I6PA 1V86A 4BKSD 2GBNA 4MEMA 2NBUA 2BYTA 3BYTB 1CK1A 4AUQC 3VR8B 1NDDA 2K3UA 4OVVA 3TEZA 4II3B 3ZNGC 2DZJA 1P7EA 4TV3A 3W9CB 4LNFA 3B08A 3QQ8B 1E7UA 1Z2MA 4C4VA 3MC0B 2IDYA 1TY2A 2AQ3B 1V5OA 3H6NA 3HVZA 3W5UB 1XLOA 3APDA 3NUHB 4ANXA 3DHGC 1GB4A 1HZ5A 2XNAC 1XLQA 2WQYB 2BKRB 5LNK1 3PZ7A 4EE2A 4S17A 4A8XC 4A3PA 1N6ZA 2Q5WD 3CIRB 1FNWA 2DX5B 1WY8A 1KFYB 2KACA 5H92C 1WR1A 4UDUC 4HLEA 2QHOA 4RH6A 5AEKB 2PTLA 2CKHB 5AUKA 3NZSA 2N7JA 2BS4B 1RM6C 2K0PA 3ZJTA 2J0JA 5EE0A 2DLBA 5DPSA 4KSKC 4KKIA 3ZRCA 4CHKA 4J3OD 2INNE 3PRMB 4IWOA 5D94A 5L83A 4RGTA 3PS6A 5C23A 3RYTA 1RWSA 2INCC 5J17A 1WGGA 4RGMA 2DZMA 3URYA 2FBWB 2LXCA 1AW7A 1ENFA 3H7SA 3A1QB 3WIMA 1XO3A 4LTUA 4AQ7A 1EO6A 2ZVOA 2WXMA 1ZUD2 2I1KA 3W1SA 1FXAA 1UF0A 4WJQA 2KQ7A 5EE9A 1UWXA 2J0KA 2MX2A 3R2TA 2JWUA 2KVRA 2I1JA 1AYFA 1R7SA 1XEEA 5D7GA 3DBRI 4M0WB 3TIXA 2BPSA 2MBEA 3QX1A 4HPLB 3SFDB 3P2BA 4M00A 1A5RA 1WFYA 2ZW0A 2I2YA 4IM3A 1MG4A 1HQRD 2N7DA 3JSVA 3W1SC 1Y56A 2BS2B 4N58A 3V6CB 2B3AA 3AEBB 1T5XD 2UU7A 3D32A 1VZ6A 2K9XA 2O6VB 2V4LA 3RCZA 1DOXA 3RFZB 4PK1A 2TSSA 4NAMA 5G55A 3AEEB 1WZ3A 2UWQA 1OQRA 3JW0X 1C4PA 1TGZB 2ZCCA 3AE8B 3BVZA 1YQBA 1WI0A 4ANUA 2YLMA 3B0AA 3DWMA 3RNGC 3PPAA 2KK8A 3BY4B 2L00B 1J7BA 1WYWB 5AUIA 4ARCA 2DZKA 4BKGA 1R4MB 1OFFA 2LJ5A 2ZPNA 3I5JC 4RNAA 1IPGA 2D3CA 1ESFA 1FXIA 1RAXA 4HPPA 4DK5A 5FR6A 3A4RA 3VXWA 2G45B 2N9PC 3ZVVA 2NTSA 4OVZA 4M01A 1JW9D 3V62A 1XQQA 1ZW7A 1WWTA 3WA0A 3IVFA 2EKIA 2IZVB 4IM0A 3BINA 1IP9A 2JYEA 3TBLD 1TT5B 1Q5WB 4HDQA 3AXCA 3QARA 3TEWA 4PYZA 2KWDA 3AEAB 3EUB2 1LGRA 1DOYA 4LNKA 3NS1A 2N9LA 1KLGD 4BBNC 2BYEA 3EFCA 2C7HA 2RPVA 2PW9A 2QIEB 1C3TA 4MM3A 2FNJB 3WAMA 2PEAA 2AWTA 4K81A 4LCDE 1IYFA 2IY1B 5JH5C 2MEKA 2VH2A 3AV8A 5BMGA 2G4SA 2QILA 1WGHA 5C3JB 3BZDB 4YXDB 2BBCA 2DAFA 4KZ0A 2LWPA 3R3MA 2YEPB 4GU2A 2V0GA 4RMAA 3TJPA 4RGOS 4W9FA 4YSYB 1YQ4B 2JWZA 4F8CB 2ZJDA 2LZ6A 3PT2B 3ZQ4A 2KN5A 2OJWA 4W9CA 3SDLC 2R61A 3APFA 3TEXA 2E3TA 1M94A 3N30A 3L17A 2KLGA 2JRHA 1SE2A 5HI1A 1XT9B 1I42A 3KUDB 1S3SG 3GE3C 2QEJC 3VTVA 4XWTA 4DHJB 1ZPSA 1HE8A 1AN8A 4JIOU 4DWFA 2XEWA 4NNJB 3ZO5B 3PRPB 1YNTE 1WSPA 4NJ7A 3RZFA 2NVUI 4O1NA 2N4FA 2NTTA 1L6VA 4FXCA 2HJ1A 1TIFA 4W9DA 4KVGB 1QT9A 2N1VA 2FCNA 1KJTA 4W9HA 4MH8A 2N7EA 3DHIC 1JALA 4ZRQA 3PREA 1TZOA 1L4DB 4LJPB 1I4QA 4AJWA 4ZRKA 3EA6A 1WXSA 1V9JA 4MGKE 5C1ZA 2BB6A 2KJ6A 2Y5PA 1TKGA 1BXTA 5CTRC 2K5PA 4IUMB 4W9EA 3KYCD 2AL6A 3RI7C 1RYJA 4TUUA 4HCNB 1MI0A 2RDGA 1EU3A 2DWQA 1OEYA 4MSQB 4ZDVA 1K53A 3P4PB 3IT6B 4OZBA 1QOGA 1WH3A 4LDTD 3ZTDA 1MPEA 4WH4A 1C1YB 2BTEA 3U2SC 1F77A 3HVDA 2BB5A 2L7RA 2KHWB 5DPTA 3H7PB 1Q0WB 3MJ5A 3ZNHB 1UELA 2MSED 3VTUA 2Z0DB 3NVWA 5BMIA 3WAOA 1JMLA 4DBGA 1OGWA 3HHMA 4KIKA 3LJ3A 1ACCA 3T8MA 2FCMA 1OTRB 1GPXA 3AM9A 2M19A 1YJIA 1WJNA 3Q8AA 3CMMB 2IJ0A 1XF5L 1WXAA 3UF8A 3KVFB 3Q2AC 2HE7A 1FRRA 3NVZA 2WHIA 2IYDB 3ZXRA 1WJ4A 4G50A 4MSMB 3DVGY 4TKNA 2KX0A 5MPOA 3VUYA 1P98A 4XDCA 1BMLC 3BYYB 1T3QA 3APCA 2HD5B 5BO4B 3O13A 4PS8A 2DYMA 3N3KB 4FJYA 4LLGM 2N1WA 3T3OA 1SXTA 3N9YC 4II2B 1N60A 1WIAA 3VAWA 3TCAA 3BVMA 2HTHA 1WM2A 3DVGX 4H2AA 2JXXA 2MCNB 4WWPA 1PFDA 3N1ZC 2A4ZA 1KH0A 5DPWA 3A9JB 3RUIB 3M3JA 1WX9A 3L13A 4QAYA 4IWQA 2VRRB 2J4XA 3AN1A 4YTNB 1GUAB 1EM7A 2KMCA 5HKHA 3C8YA 4WJNA 2QDFA 3UQAA 2V3NA 2Z8LA 4URKA 2KZRA 2GOWA 3KWVA 2M0AA 1ET6A 3MP9A 2M8SA 4L23A 1C79A 2C9WB 4A3OA 4BOSC 3GOEA 1YX6B 3AMZA 3Q3JA 1C77A 2BYFA 1TKYA 3W5VB 4GGQA 3H7PA 3R7QA 4OZAA 2ONQA 2LJIA 5BMHA 2WS3B 1C9FA 3M95A 1C4AA 5E6NA 3V6EB 1EUVB 5LXHA 2ZZPB 2WDQB 4X57B 3I63C 2KTRB 2REXA 4RM8A 1B1ZA 2ICIA 3VFKA 1EF5A 3QCAA 4WAAA 3MC8A 1FRDA 1L5PA 2K6QA 2GBJA 4YTPB 4HPMB 1IBXA 2MBHA 4BZAA 3Q3OC 5J18A 3IXSA 1E8WA 2W54A 2BW2A 2WXHA 2MHJA 1TKEA 2W9NA 3HUIA 2GI9A 4ZHOA 4HK2A 1L6UA 1WGKA 2WXRA 1E9MA 2G4DB 3P4QB 1JCKB 3U52E 1HEZE 4G0NB 2JVCA 1RLFA 3QAQA 1E10A 2A5UA 2IGGA 2WXIA 5GMVA 2JUOA 4KDLB 1UGJA 3J9CA 2O2VB 2KJHB 3R7RA 2LVOA 2FE8A 4GN1A 1XLPA 2G1EA 4JQWC 1H8CA 2ZW1A 1KRHA 2BF8B 1L0VB 2LUMA 4Q2JA 3ML8A 3A1QA 3MTNB 2RD0A 1ZDVA 1QILA 3Q3MC 3UIOB 2LVQA 3L16A 2QMTA 4IKGA 4KDIC 2IGDA 1D5XC 3EC8A 3L08A 5H8YE 3ZTCA 3UGBB 4ZYNA 3VH4B 1QQRA 3LB8C 2MQJA 1SE9A 3DBSA 2KN4A 1KLVA 4FA6A 2NR2A 4AS1A 1PUTA 1ZDXA 3BK1A 4N9F4 2WXJA 3KLSX 2JRIB 1R4NI 3N1XC 4B0MA 1TYGB 2LI5A 3DCGA 1KLUD 2ZCBA 1VJKA 2AEHA 2G9HD 1SBBB 2WDRB 4GDLB 2KMAA 3QIJA 2KT7A 4C56C 4M8MA 4FLHA 1WGDA 2LGXA 3MC9A 3BK2A 2KMMA 1NYQA 1H4RA 4M02A 1GC6A 4HROA 2O6VD 1QOAA 5G5HA 4FULA 1Q1OA 2WX0A 1LM8B 3B2FA 3SEBA 3NOBA 2LASA 4PS7A 4MJSA 2BKFA 5FKAC 2J53A 1WMHA 2AL3A 3AE6B 2NMQA 3A9KA 4TQ0A 2ZVNA 1WX7A 2KTRA 3AE5B 5EE1A 3OLMD 1D3ZA 3VTWA 3SHQA 2GBRA 3ABVB 3X0WA 2Y5CA 1UZXB 1JRUA 2MJEA 3U4EG 2KC2A 2QC8A 3NG0A 4AJYB 1WMHB 1YIWA 3A33B 5IKCM 4GDKA 1OEYJ 4RM9A 3VVWB 3NZ3A 5KHOA 1GB1A 4IW0A 2JZ3B 1HA5A 2KKCA 4YSXB 2WXPA 3FILA 2D2QA 1NI3A 4W9JA 2VZKD 2XK5B 3LXFA 4US9A 2N9XA 2WX1A 3AEDB 1B9RA 1FPYA 3GS2A 1WGRA 1RFKA 2IO1B 5CHVC 2DNFA 2N0SB 1J8CA 1HTOA 3NHEB 2FUG1 2MRPA 3EHVA 4MGIE 3VH3B 4M0WA 2O2VA 1L2NA 4ZRJA 5D3DA 2JPHA 3P4RB 2IO3B 3R8BA 4IC7B 1T6BX 3P1MA 1G6JA 3S2AA 1SSNA 2BWFA 1X1MA 2M56B 4GIVA 2WDVB 3ENEA 1D5MC 3FKYA 4KIKB 4ZRPA 1WM3A 3PLUA 1FCCC 3QA8A 3X23A 4K7SA 4ASWC 4HEA1 1YX5B 2LRWA 2FIFA 3KWLA 3AH7A 1MHHE 1JRPA 2MBQA 3TL5A 1QOBA 3P42A 2HTME 4GXBA 2WYQA 2CHZA 4OW0A 1PGAA 4LJOB 4EEWA 1UWMA 5T8IA 3BVGA 2MJ3A 2OJRA 1YMHE 3KH0A 3AE3B 3AU5A 5D2MB 1V8CA 2HDEA 3QJZA 3PO0A 3UIPB 3I57A 3JVZX 1PYWD 3GP7A 4MM3B 3Q8CA 4HJGE 4NAWB 1DOIA 4JWSC 4FN2A 1SGHA 4PS3A 1HTQA 4OZCA 3AULA 1E7VA 2ACZB 4DDGD 2DBYA 5HHDG 2KDMA 3GZNI 4JE3B 4DDID 1VD2A 1PGBA 4DHJD 4WWOA 3SU8X 1L4ZB 3VRAB 5IA7A 2KTFA 5CX3A 3DBLB 1UD7A 1I4XA 4DXFA 3AE1B 3N32A 4XX5A 2WXFA 3PZDA 3U8ZA 4I6LB 4AOFA 3V60A 1LQBA 3KYDD 1E8ZA 2CU3A 4W9LA 3ZW3A 1VR9A 1YJ1A 3AU4A 3KUCB 2WU5B 3PHWB 3AE7B 3PRZA 4KSLC 1F0ZA 2W82A 5AZFA 3EECA 4HXDA 2M0XA 4MACA 4B9KA 2INPE 2KXJA 4GMVA 1MG8A 4WJOA 4XE0A 3AEGB 2MBBB 1NI2A 1KM7A 3IBEA 3HRDD 1WJ6A 4ZRIA 3L0WB 3ZDTA 2MWSB 4AWJA 3EGRA 4TMAB 1FD6A 1F1HA 4E74A 2WXGA 2JSVX 4HCPB 4NQKE 1YQ3B 4OVUA 3AB5A 1QF6A 1EWCA 2KQ4X 4C80A 4HKZE 1JQ4A 1XD3B 3ZUNA 1E90A 3C19A 3DBRB 1V80A 4LDTB 3NVVA 4NAWA 2DHZA 3PGEA 3L10B 4KX6B 4ICVA 3WCQA 2DYBA 4NZLB 1SF0A 1GNUA 1PDXA 1E5WA 4P6VF 4GDLA 1NBFC 3NY5A 1SB3C 1K51A 3V3XA 4XZ4A 3AECB 3HM3A 1T0YA 3E9SA 2MP2A 2MBOA 1WE6A 1RRBA 4LNOA 1V6EA 1TS3A 5JHAA 2WXLA 4RFBA 2JY6A 2LGSA 1FNUA 2R2OA 3CF6E 3QK0A 3O65B 4ANWA 3V05A 3UI3A 2PVGC 1ET9A 1IGCA 2JF5A 1YJJA 2WXQA 4EZJA 1ZP0B 4WQOB 3IFWB 2K8HA 1QZEA 1E7PB 2LGYA 2KDEB 3AE4B 4JL9A 4B95A 3ZGZA 2KANA 1MVKA 4N6EB 5D6JB 4YWGG 2NPTA 1TY0A 4JWUC 5BYSA 2MJDA 5AZHA 2WWZA 1N63A 4L1BA 1PQSA 2K8CA 2FCQA 2SAKA 3Q6BA 3U7ZA 3DOWA 1P7FA 3FC4A 2IY0B 2ZNVB 4R3DA 2V1YA 1VZ8A 2RSUA 4LNIA 4EKUA 4E71A 1Z5SB 2CJNA 2JU6X 1GJZA 2K22A 2CS4A 2UYZB 2W55A 4ZHPA 4NPNA 3AEFB 1TTNA 2PVOD 3GE8C 4XWWA 4GSWA 1I4RA 4BKTA 2LRUA 3PTFC 4REZA 1LFDA 3A4SC 2JXTA 5IAAC 4DXGA
chains in the Genus database with same CATH topology
1WZ3A 2UWQA 2KDIA 2G4DB 3JW0X 3WANA 3KW5B 4G0NB 1TGZB 2JVCA 1RLFA 2ZCCA 3QAQA 3DQVA 1J0GA 1YQBA 4K7UA 1WI0A 1P0RA 2Y5BB 2A5UA 5DCNA 3VUXA 5GMVA 3QHTA 2JUOA 4KDLB 2YLMA 3B0AA 2JZZA 3LDZE 4ANUA 3QC8B 2R2QA 2K39A 3PSEB 2K6DB 4J6IA 3PPAA 2Z0EB 3CSFA 2KK8A 4JGHB 3ALBA 3BY4B 2O2VB 4IM2A 2KJHB 2L00B 4MGYE 3R7RA 2LVOA 4GN1A 1K8RB 4JQWC 3ML9A 1WYWB 1UH6A 1ZGUB 5KHQA 1H8CA 1U4AA 3OJ3A 2DZKA 2N9EB 4BKGA 3U7DA 2BF8B 1S1QB 2NS5A 2LJ5A 2KLCA 2ZPNA 2CR5A 3ML8A 1IPGA 1RAXA 1OQYA 3A1QA 2MLBA 3MTNB 4DK5A 2RD0A 1ISNA 3UIOB 5FR6A 2LVQA 3A4RA 3VXWA 2L3ZA 3L16A 3VUWA 2G45B 2KWUB 1TBEA 2N9PC 4BFRA 4KDIC 2CHWA 3ZVVA 4BVUC 2CHXA 3EC8A 3H9DA 3IG3A 3L08A 3ZTCA 3RZWC 2KDFB 3UGBB 3VDZA 4ZYNA 1WXMA 3VH4B 1GC7A 1BT0A 3V62A 1XQQA 2MQJA 1ZW7A 3OJ4B 1SE9A 3WA0A 3DBSA 1FXTB 1KOTA 3IVFA 2IZVB 4IM0A 1SIFA 3BINA 4NJ6A 2MP2B 2FIDA 2KQSA 4FA6A 1IP9A 1KLVA 2NR2A 3TBLD 1Q5WB 4N9F4 2L8JA 1AARA 4HDQA 2JRIB 1R4NI 3AXCA 4EUTA 2J7QB 2LI5A 3DCGA 3QARA 1F9JA 1Y8RC 1ZKHA 2FCSA 3MHSD 2ZCBA 4IG7B 2AEHA 5CHFA 4PYZA 4W9GA 5E6OA 4MJSB 2KC1A 2L0TA 4DXAB 4GDLB 2KMAA 3QIJA 2XK5A 3DBLI 2C5LC 3JSVB 4BBNC 4M8MA 4BOZB 4FLHA 2JT4B 1WGDA 2LGXA 2BYEA 2C7HA 2IO2B 3B1LX 2EMSA 1CMXB 2BGFA 2KX3A 3M63B 1WE7A 1H4RA 1C3TA 4JLCA 4MM3A 2FNJB 1GC6A 3HK0A 2O6VD 3WAMA 3AI5A 2MA9B 4FULA 2PEAA 2AWTA 1Q1OA 2WX0A 1LM8B 3NOBA 4K81A 2LASA 4PS7A 1I35A 4LCDE 4MJSA 1IYFA 2IY1B 5JH5C 2BKFA 5AZGA 1WMHA 2AL3A 2G4SA 2ZNVC 3A9KA 4TQ0A 2KOXA 2ZVNA 1WX7A 2KTRA 1WGHA 1WR6E 3VHTC 4F1SA 2V3SA 3OLMD 4HWIB 3VTWA 1D3ZA 2D11A 2DAFA 4KZ0A 4WJPA 2LWPA 3R3MA 5J2RA 3A9JA 4GU2A 2M17A 3SHQA 2LVPA 2GBRA 4RMAA 2L0FA 2CU1A 3TJPA 4W9FA 3NS8A 5LLIA 3X0WA 2JWZA 1UZXB 2LUEA 2C60A 1JRUA 4DHZE 4F8CB 2ZJDA 4KV2A 2LZ6A 3PT2B 2KN5A 4W9CA 2KC2A 5E6PA 3SDLC 3APFA 1WMHB 1YIWA 5TR5A 3A33B 4W9IA 4I6NB 4AJYB 4GDKA 3VQIA 1OEYJ 4RM9A 3VVWB 2L76A 5KHOA 1M94A 3N30A 1J19A 2JZ3B 4IW0A 3L17A 2DYOA 2KKCA 2KFKB 2KLGA 2JRHA 5JZEB 5L95C 4ANVA 1XT9B 1I42A 2D2QA 4A20A 4IWPA 4W9JA 4KZCA 3KUDB 4FJVB 1S3SG 2XK5B 2BWES 4HVBA 3VTVA 2N9XA 2WX1A 4DHJB 1HE8A 2IO0B 3K9OB 1WGRA 4JIOU 4EZKA 2IO1B 4TQ1A 5CHVC 4HDOA 4DWFA 2XEWA 4NNJB 2MW5A 1J8CA 3ZO5B 1E8YA 3DBHI 1WRDB 3PRPB 4BKSA 2BYVE 4NQLB 2KD0A 3UQBA 2L05A 3NHEB 2MRPA 3EHVA 3ZKJC 3HIZA 4MGIE 4NJ7A 3RZFA 3NZUA 3VH3B 2KDBA 2O2VA 2NVUI 1L2NA 2N4FA 4W9DA 4ZRJA 3A9KB 4KVGB 1UBIA 2JPHA 2N1VA 4G3XB 2FCNA 5G2NA 2IO3B 1KJTA 1WXVA 4IC7B 1LXDA 4W9HA 3RD2A 4EFOA 2N7EA 1G6JA 3S2AA 3PLVA 3DPDA 3PREA 1WGYA 2BWFA 4GIVA 1X1MA 2LXAA 4LJPB 3ENEA 3ZNZB 2KWCA 4AJWA 4KIKB 1WM3A 2KNBA 3PLUA 4ZRKA 4EZLA 3QA8A 2KJRA 3X23A 1WXSA 3L54A 4K7SA 1V9JA 4ASWC 3WAPA 4MGKE 5C1ZA 5JHBA 3PHXB 5CHWA 2KJ6A 1YX5B 4WWNA 2LRWA 1E8XA 2FIFA 2PE6B 5CTRC 2MBQA 3TL5A 1P9DU 4IUMB 4W9EA 4FJZA 3KYCD 2AL6A 4F7ZA 2KFKA 4NY0A 4TUUA 4HCNB 4GXBA 2O6VA 4YL8A 2WYQA 2PPHA 2CHZA 1OEYA 3I3TB 4MSQB 4ZDVA 4GB9A 2FAZA 2DZIA 2GBKA 4LJOB 4EEWA 1WX8A 4XC2A 2ASQA 2G3QB 2OJRA 2RR9A 4B6WA 1WH3A 2D3GA 4EOYA 2DENB 4LDTD 3ZTDA 1EF1A 3H1UA 3KH0A 1WJUA 3AU5A 4PYUA 1C1YB 5D2MB 4W9KA 5LXIB 3RULA 3QJZA 4CYEA 2EKEC 3UIPB 2EMTA 2NBWB 2M4NA 4GDKB 3JVZX 2L7RA 2LGDA 2KHWB 5DPTA 3H7PB 3PVLA 4NAWB 1Q0WB 3JYUA 2M1MA 3ECIA 3ZNHB 2GMIC 1UELA 2MSED 1V81A 4FN2A 1SGHA 2Z0DB 3VTUA 3K9PB 4PS3A 3WAOA 4DBGA 1OGWA 3AULA 3HHMA 1R4MI 4KIKA 1E7VA 3LJ3A 4DDGD 2J0MA 4MELA 3GZNI 3ONSA 4P7IA 4DDID 3ZLZA 3T8MA 2K25A 2FCMA 3KUZA 3U30A 1OTRB 1VD2A 2D10A 5DPRA 4DHJD 4WWOA 2NPTB 3SU8X 5IA7A 1P1AA 2KTFA 1V2YA 5CX3A 1GG3A 1UD7A 2XBBC 1WJNA 3N32A 2YVCA 2HJ8A 4XX5A 4BBNF 3PZDA 3U8ZA 4AOFA 4I6LB 3V60A 1LQBA 2DAJA 3ZDMC 3CMMB 2IBIB 1VCBA 3KYDD 1V49A 4I6PA 1E8ZA 1V86A 4BKSD 2GBNA 2Z59B 1WXAA 3UF8A 3KVFB 4MEMA 4W9LA 3UINB 2HE7A 2NBUA 1YJ1A 3ZW3A 3AU4A 3KUCB 3PHWB 4AUQC 3PRZA 4KSLC 2IYDB 1NDDA 1WJ4A 2C7MB 4G50A 4MSMB 3DVGY 5AZFA 4OVVA 3EECA 2KX0A 4TKNA 4II3B 3ZNGC 4HXDA 2M0XA 3VUYA 2LD9A 2DZJA 2AYOB 1P98A 4B9KA 4TV3A 3B08A 1WF9A 1E7UA 3QQ8B 2KXJA 4GMVA 1RFAA 1MG8A 1Z2MA 4WJOA 3APCA 2HD5B 3DDCB 4MGZE 2MBBB 5BO4B 1NI2A 1KM7A 3IBEA 1WJ6A 4ZRIA 4G11A 4PS8A 3L0WB 2DYMA 3N3KB 3V61A 3ZDTA 2MWSB 3IHPC 4FJYA 1V5OA 3H6NA 4AWJA 2N1WA 1UBQA 4II2B 3APDA 4E74A 1WIAA 3VAWA 4ANXA 3DVNV 3TCAA 4HCPB 2HTHA 4NQKE 1WM2A 4OVUA 4CO7A 3DVGX 2BKRB 3EFUA 2C7NB 2JXXA 4A3PA 2MCNB 1XD3B 2FUHB 4WWPA 2DX5B 1WY8A 2A4ZA 1WR1A 2ZEQA 4HLEA 2QHOA 5DPWA 2KWVB 3A9JB 3ZUNA 3RUIB 1E90A 5AEKB 4M8NA 1V80A 3R66C 4LDTB 3M3JA 2DHZA 1WX9A 3PGEA 3L10B 4NAWA 3L13A 3M62B 4ICUA 4IWQA 2CKHB 4ICVA 3NZSA 2VRRB 1WZ0A 2DYBA 3ZIMA 1GNUA 2RGFA 4MDKE 2OOBB 2J0JA 1E5WA 4FADA 4GDLA 1NBFC 5DPSA 3NY5A 1GUAB 4KSKC 3ZRCA 4CHKA 2KMCA 3PRMB 4XZ4A 4IWOA 3HM3A 5D94A 1T0YA 5HKHA 5L83A 2MP2A 4WJNA 3PS6A 2MBOA 5C23A 3T9LA 1WE6A 3UQAA 1RRBA 3RYTA 1V6EA 3ZNID 4URKA 2KZRA 2GOWA 1WGGA 3Q3FA 5J17A 5JHAA 4AP4C 2PE9A 2DZMA 2LXCA 2M8SA 4HJKA 3H7SA 3A1QB 1TZ1A 2C9WB 4A3OA 3WIMA 4BOSC 2JY6A 1YX6B 3GOEA 2KFJA 3Q3JA 3RT3B 2BYFA 2R2OA 3CF6E 1EO6A 2ZVOA 3HM6X 3QK0A 3O65B 4FBJB 4ANWA 2I1KA 3W1YA 4GGQA 2D07B 3H7PA 3R7QA 3W1SA 2JF5A 3MJWA 4WJQA 4EZJA 2KQ7A 3SD5A 4WQOB 5EDSA 3IFWB 2K8HA 1QZEA 2J0KA 3WALA 2MX2A 2LGYA 3M95A 2KVRA 2KDEB 4JL9A 4B95A 2I1JA 5D7GA 5E6NA 3DBRI 2KANA 4K7WA 4M0WB 3TMPB 3V6EB 5D6JB 2NBVB 3TIXA 2ZPYA 1EUVB 4K1RB 5LXHA 2BPSA 2MBEA 2NPTA 2ZZPB 3QX1A 4HPLB 2PJHA 4X57B 2KTRB 2REXA 2WWZA 5AZHA 4RM8A 1YD8U 3P2BA 3VFKA 1PQSA 2K8CA 1EF5A 1A5RA 2WDTB 1WFYA 2FCQA 3QCAA 4WAAA 3DOWA 2NCNA 4IM3A 2IY0B 2ZNVB 3ZRFA 3DVNU 2K6QA 2GBJA 2V1YA 2N7DA 1P3QU 3JSVA 2RSUA 3CSTA 3W1SC 4EKUA 4E71A 4HPMB 1Z5SB 2KO3A 4MH0E 3V6CB 2MBHA 4E3CA 2B3AA 2K8BA 3D32A 5J18A 2O6VB 1E8WA 2V4LA 1L7YA 1GJZA 3RCZA 2CS4A 2RPQA 2UYZB 4DHZB 4NPNA 1TTNA 3C0RB 1UGMA 2GBMA 4GSWA 2W9NA 4FHJA 3QWZB 4HK2A 3OAWA 3PV1A 4BKTA 4FHKA 2K1FA 2LRUA 5G55A 3PTFC 1LFDA 4GOCA 3A4SC 1V5TA 5IAAC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1WZ3 A;  2UWQ A;  2KDI A;  2G4D B;  3JW0 X;  3WAN A;  3KW5 B;  4G0N B;  1TGZ B;  2JVC A;  1RLF A;  2ZCC A;  3QAQ A;  3DQV A;  1J0G A;  1YQB A;  4K7U A;  1WI0 A;  1P0R A;  2Y5B B;  2A5U A;  5DCN A;  3VUX A;  5GMV A;  3QHT A;  2JUO A;  4KDL B;  2YLM A;  3B0A A;  2JZZ A;  3LDZ E;  4ANU A;  3QC8 B;  2R2Q A;  2K39 A;  3PSE B;  2K6D B;  4J6I A;  3PPA A;  2Z0E B;  3CSF A;  2KK8 A;  4JGH B;  3ALB A;  3BY4 B;  2O2V B;  4IM2 A;  2KJH B;  2L00 B;  4MGY E;  3R7R A;  2LVO A;  4GN1 A;  1K8R B;  4JQW C;  3ML9 A;  1WYW B;  1UH6 A;  1ZGU B;  5KHQ A;  1H8C A;  1U4A A;  3OJ3 A;  2DZK A;  2N9E B;  4BKG A;  3U7D A;  2BF8 B;  1S1Q B;  2NS5 A;  2LJ5 A;  2KLC A;  2ZPN A;  2CR5 A;  3ML8 A;  1IPG A;  1RAX A;  1OQY A;  3A1Q A;  2MLB A;  3MTN B;  4DK5 A;  2RD0 A;  1ISN A;  3UIO B;  5FR6 A;  2LVQ A;  3A4R A;  3VXW A;  2L3Z A;  3L16 A;  3VUW A;  2G45 B;  2KWU B;  1TBE A;  2N9P C;  4BFR A;  4KDI C;  2CHW A;  3ZVV A;  4BVU C;  2CHX A;  3EC8 A;  3H9D A;  3IG3 A;  3L08 A;  3ZTC A;  3RZW C;  2KDF B;  3UGB B;  3VDZ A;  4ZYN A;  1WXM A;  3VH4 B;  1GC7 A;  1BT0 A;  3V62 A;  1XQQ A;  2MQJ A;  1ZW7 A;  3OJ4 B;  1SE9 A;  3WA0 A;  3DBS A;  1FXT B;  1KOT A;  3IVF A;  2IZV B;  4IM0 A;  1SIF A;  3BIN A;  4NJ6 A;  2MP2 B;  2FID A;  2KQS A;  4FA6 A;  1IP9 A;  1KLV A;  2NR2 A;  3TBL D;  1Q5W B;  4N9F 4;  2L8J A;  1AAR A;  4HDQ A;  2JRI B;  1R4N I;  3AXC A;  4EUT A;  2J7Q B;  2LI5 A;  3DCG A;  3QAR A;  1F9J A;  1Y8R C;  1ZKH A;  2FCS A;  3MHS D;  2ZCB A;  4IG7 B;  2AEH A;  5CHF A;  4PYZ A;  4W9G A;  5E6O A;  4MJS B;  2KC1 A;  2L0T A;  4DXA B;  4GDL B;  2KMA A;  3QIJ A;  2XK5 A;  3DBL I;  2C5L C;  3JSV B;  4BBN C;  4M8M A;  4BOZ B;  4FLH A;  2JT4 B;  1WGD A;  2LGX A;  2BYE A;  2C7H A;  2IO2 B;  3B1L X;  2EMS A;  1CMX B;  2BGF A;  2KX3 A;  3M63 B;  1WE7 A;  1H4R A;  1C3T A;  4JLC A;  4MM3 A;  2FNJ B;  1GC6 A;  3HK0 A;  2O6V D;  3WAM A;  3AI5 A;  2MA9 B;  4FUL A;  2PEA A;  2AWT A;  1Q1O A;  2WX0 A;  1LM8 B;  3NOB A;  4K81 A;  2LAS A;  4PS7 A;  1I35 A;  4LCD E;  4MJS A;  1IYF A;  2IY1 B;  5JH5 C;  2BKF A;  5AZG A;  1WMH A;  2AL3 A;  2G4S A;  2ZNV C;  3A9K A;  4TQ0 A;  2KOX A;  2ZVN A;  1WX7 A;  2KTR A;  1WGH A;  1WR6 E;  3VHT C;  4F1S A;  2V3S A;  3OLM D;  4HWI B;  3VTW A;  1D3Z A;  2D11 A;  2DAF A;  4KZ0 A;  4WJP A;  2LWP A;  3R3M A;  5J2R A;  3A9J A;  4GU2 A;  2M17 A;  3SHQ A;  2LVP A;  2GBR A;  4RMA A;  2L0F A;  2CU1 A;  3TJP A;  4W9F A;  3NS8 A;  5LLI A;  3X0W A;  2JWZ A;  1UZX B;  2LUE A;  2C60 A;  1JRU A;  4DHZ E;  4F8C B;  2ZJD A;  4KV2 A;  2LZ6 A;  3PT2 B;  2KN5 A;  4W9C A;  2KC2 A;  5E6P A;  3SDL C;  3APF A;  1WMH B;  1YIW A;  5TR5 A;  3A33 B;  4W9I A;  4I6N B;  4AJY B;  4GDK A;  3VQI A;  1OEY J;  4RM9 A;  3VVW B;  2L76 A;  5KHO A;  1M94 A;  3N30 A;  1J19 A;  2JZ3 B;  4IW0 A;  3L17 A;  2DYO A;  2KKC A;  2KFK B;  2KLG A;  2JRH A;  5JZE B;  5L95 C;  4ANV A;  1XT9 B;  1I42 A;  2D2Q A;  4A20 A;  4IWP A;  4W9J A;  4KZC A;  3KUD B;  4FJV B;  1S3S G;  2XK5 B;  2BWE S;  4HVB A;  3VTV A;  2N9X A;  2WX1 A;  4DHJ B;  1HE8 A;  2IO0 B;  3K9O B;  1WGR A;  4JIO U;  4EZK A;  2IO1 B;  4TQ1 A;  5CHV C;  4HDO A;  4DWF A;  2XEW A;  4NNJ B;  2MW5 A;  1J8C A;  3ZO5 B;  1E8Y A;  3DBH I;  1WRD B;  3PRP B;  4BKS A;  2BYV E;  4NQL B;  2KD0 A;  3UQB A;  2L05 A;  3NHE B;  2MRP A;  3EHV A;  3ZKJ C;  3HIZ A;  4MGI E;  4NJ7 A;  3RZF A;  3NZU A;  3VH3 B;  2KDB A;  2O2V A;  2NVU I;  1L2N A;  2N4F A;  4W9D A;  4ZRJ A;  3A9K B;  4KVG B;  1UBI A;  2JPH A;  2N1V A;  4G3X B;  2FCN A;  5G2N A;  2IO3 B;  1KJT A;  1WXV A;  4IC7 B;  1LXD A;  4W9H A;  3RD2 A;  4EFO A;  2N7E A;  1G6J A;  3S2A A;  3PLV A;  3DPD A;  3PRE A;  1WGY A;  2BWF A;  4GIV A;  1X1M A;  2LXA A;  4LJP B;  3ENE A;  3ZNZ B;  2KWC A;  4AJW A;  4KIK B;  1WM3 A;  2KNB A;  3PLU A;  4ZRK A;  4EZL A;  3QA8 A;  2KJR A;  3X23 A;  1WXS A;  3L54 A;  4K7S A;  1V9J A;  4ASW C;  3WAP A;  4MGK E;  5C1Z A;  5JHB A;  3PHX B;  5CHW A;  2KJ6 A;  1YX5 B;  4WWN A;  2LRW A;  1E8X A;  2FIF A;  2PE6 B;  5CTR C;  2MBQ A;  3TL5 A;  1P9D U;  4IUM B;  4W9E A;  4FJZ A;  3KYC D;  2AL6 A;  4F7Z A;  2KFK A;  4NY0 A;  4TUU A;  4HCN B;  4GXB A;  2O6V A;  4YL8 A;  2WYQ A;  2PPH A;  2CHZ A;  1OEY A;  3I3T B;  4MSQ B;  4ZDV A;  4GB9 A;  2FAZ A;  2DZI A;  2GBK A;  4LJO B;  4EEW A;  1WX8 A;  4XC2 A;  2ASQ A;  2G3Q B;  2OJR A;  2RR9 A;  4B6W A;  1WH3 A;  2D3G A;  4EOY A;  2DEN B;  4LDT D;  3ZTD A;  1EF1 A;  3H1U A;  3KH0 A;  1WJU A;  3AU5 A;  4PYU A;  1C1Y B;  5D2M B;  4W9K A;  5LXI B;  3RUL A;  3QJZ A;  4CYE A;  2EKE C;  3UIP B;  2EMT A;  2NBW B;  2M4N A;  4GDK B;  3JVZ X;  2L7R A;  2LGD A;  2KHW B;  5DPT A;  3H7P B;  3PVL A;  4NAW B;  1Q0W B;  3JYU A;  2M1M A;  3ECI A;  3ZNH B;  2GMI C;  1UEL A;  2MSE D;  1V81 A;  4FN2 A;  1SGH A;  2Z0D B;  3VTU A;  3K9P B;  4PS3 A;  3WAO A;  4DBG A;  1OGW A;  3AUL A;  3HHM A;  1R4M I;  4KIK A;  1E7V A;  3LJ3 A;  4DDG D;  2J0M A;  4MEL A;  3GZN I;  3ONS A;  4P7I A;  4DDI D;  3ZLZ A;  3T8M A;  2K25 A;  2FCM A;  3KUZ A;  3U30 A;  1OTR B;  1VD2 A;  2D10 A;  5DPR A;  4DHJ D;  4WWO A;  2NPT B;  3SU8 X;  5IA7 A;  1P1A A;  2KTF A;  1V2Y A;  5CX3 A;  1GG3 A;  1UD7 A;  2XBB C;  1WJN A;  3N32 A;  2YVC A;  2HJ8 A;  4XX5 A;  4BBN F;  3PZD A;  3U8Z A;  4AOF A;  4I6L B;  3V60 A;  1LQB A;  2DAJ A;  3ZDM C;  3CMM B;  2IBI B;  1VCB A;  3KYD D;  1V49 A;  4I6P A;  1E8Z A;  1V86 A;  4BKS D;  2GBN A;  2Z59 B;  1WXA A;  3UF8 A;  3KVF B;  4MEM A;  4W9L A;  3UIN B;  2HE7 A;  2NBU A;  1YJ1 A;  3ZW3 A;  3AU4 A;  3KUC B;  3PHW B;  4AUQ C;  3PRZ A;  4KSL C;  2IYD B;  1NDD A;  1WJ4 A;  2C7M B;  4G50 A;  4MSM B;  3DVG Y;  5AZF A;  4OVV A;  3EEC A;  2KX0 A;  4TKN A;  4II3 B;  3ZNG C;  4HXD A;  2M0X A;  3VUY A;  2LD9 A;  2DZJ A;  2AYO B;  1P98 A;  4B9K A;  4TV3 A;  3B08 A;  1WF9 A;  1E7U A;  3QQ8 B;  2KXJ A;  4GMV A;  1RFA A;  1MG8 A;  1Z2M A;  4WJO A;  3APC A;  2HD5 B;  3DDC B;  4MGZ E;  2MBB B;  5BO4 B;  1NI2 A;  1KM7 A;  3IBE A;  1WJ6 A;  4ZRI A;  4G11 A;  4PS8 A;  3L0W B;  2DYM A;  3N3K B;  3V61 A;  3ZDT A;  2MWS B;  3IHP C;  4FJY A;  1V5O A;  3H6N A;  4AWJ A;  2N1W A;  1UBQ A;  4II2 B;  3APD A;  4E74 A;  1WIA A;  3VAW A;  4ANX A;  3DVN V;  3TCA A;  4HCP B;  2HTH A;  4NQK E;  1WM2 A;  4OVU A;  4CO7 A;  3DVG X;  2BKR B;  3EFU A;  2C7N B;  2JXX A;  4A3P A;  2MCN B;  1XD3 B;  2FUH B;  4WWP A;  2DX5 B;  1WY8 A;  2A4Z A;  1WR1 A;  2ZEQ A;  4HLE A;  2QHO A;  5DPW A;  2KWV B;  3A9J B;  3ZUN A;  3RUI B;  1E90 A;  5AEK B;  4M8N A;  1V80 A;  3R66 C;  4LDT B;  3M3J A;  2DHZ A;  1WX9 A;  3PGE A;  3L10 B;  4NAW A;  3L13 A;  3M62 B;  4ICU A;  4IWQ A;  2CKH B;  4ICV A;  3NZS A;  2VRR B;  1WZ0 A;  2DYB A;  3ZIM A;  1GNU A;  2RGF A;  4MDK E;  2OOB B;  2J0J A;  1E5W A;  4FAD A;  4GDL A;  1NBF C;  5DPS A;  3NY5 A;  1GUA B;  4KSK C;  3ZRC A;  4CHK A;  2KMC A;  3PRM B;  4XZ4 A;  4IWO A;  3HM3 A;  5D94 A;  1T0Y A;  5HKH A;  5L83 A;  2MP2 A;  4WJN A;  3PS6 A;  2MBO A;  5C23 A;  3T9L A;  1WE6 A;  3UQA A;  1RRB A;  3RYT A;  1V6E A;  3ZNI D;  4URK A;  2KZR A;  2GOW A;  1WGG A;  3Q3F A;  5J17 A;  5JHA A;  4AP4 C;  2PE9 A;  2DZM A;  2LXC A;  2M8S A;  4HJK A;  3H7S A;  3A1Q B;  1TZ1 A;  2C9W B;  4A3O A;  3WIM A;  4BOS C;  2JY6 A;  1YX6 B;  3GOE A;  2KFJ A;  3Q3J A;  3RT3 B;  2BYF A;  2R2O A;  3CF6 E;  1EO6 A;  2ZVO A;  3HM6 X;  3QK0 A;  3O65 B;  4FBJ B;  4ANW A;  2I1K A;  3W1Y A;  4GGQ A;  2D07 B;  3H7P A;  3R7Q A;  3W1S A;  2JF5 A;  3MJW A;  4WJQ A;  4EZJ A;  2KQ7 A;  3SD5 A;  4WQO B;  5EDS A;  3IFW B;  2K8H A;  1QZE A;  2J0K A;  3WAL A;  2MX2 A;  2LGY A;  3M95 A;  2KVR A;  2KDE B;  4JL9 A;  4B95 A;  2I1J A;  5D7G A;  5E6N A;  3DBR I;  2KAN A;  4K7W A;  4M0W B;  3TMP B;  3V6E B;  5D6J B;  2NBV B;  3TIX A;  2ZPY A;  1EUV B;  4K1R B;  5LXH A;  2BPS A;  2MBE A;  2NPT A;  2ZZP B;  3QX1 A;  4HPL B;  2PJH A;  4X57 B;  2KTR B;  2REX A;  2WWZ A;  5AZH A;  4RM8 A;  1YD8 U;  3P2B A;  3VFK A;  1PQS A;  2K8C A;  1EF5 A;  1A5R A;  2WDT B;  1WFY A;  2FCQ A;  3QCA A;  4WAA A;  3DOW A;  2NCN A;  4IM3 A;  2IY0 B;  2ZNV B;  3ZRF A;  3DVN U;  2K6Q A;  2GBJ A;  2V1Y A;  2N7D A;  1P3Q U;  3JSV A;  2RSU A;  3CST A;  3W1S C;  4EKU A;  4E71 A;  4HPM B;  1Z5S B;  2KO3 A;  4MH0 E;  3V6C B;  2MBH A;  4E3C A;  2B3A A;  2K8B A;  3D32 A;  5J18 A;  2O6V B;  1E8W A;  2V4L A;  1L7Y A;  1GJZ A;  3RCZ A;  2CS4 A;  2RPQ A;  2UYZ B;  4DHZ B;  4NPN A;  1TTN A;  3C0R B;  1UGM A;  2GBM A;  4GSW A;  2W9N A;  4FHJ A;  3QWZ B;  4HK2 A;  3OAW A;  3PV1 A;  4BKT A;  4FHK A;  2K1F A;  2LRU A;  5G55 A;  3PTF C;  1LFD A;  4GOC A;  3A4S C;  1V5T A;  5IAA C; 
#chains in the Genus database with same CATH topology
 1CZP A;  4P1C C;  1FFV A;  3DQV A;  1J0G A;  2JZP A;  1K52 A;  1P0R A;  2Y5B B;  5DCN A;  3VUX A;  1FFU A;  3QHT A;  2JZZ A;  3LDZ E;  3QC8 B;  1FNV A;  1FCL A;  2K39 A;  3BWU D;  3MFG A;  3PSE B;  4J6I A;  3RNC C;  2Z0E B;  4JGH B;  4MGY E;  4US8 A;  4IM2 A;  4C00 A;  1K8R B;  1FO4 A;  3ML9 A;  1ZGU B;  1U4A A;  3U7D A;  2KLC A;  2CR5 A;  2MLB A;  1ISN A;  3N1Y C;  2KWU B;  1TBE A;  3MHZ A;  2CHW A;  3R2I A;  2CHX A;  3H9D A;  3IG3 A;  3VDZ A;  2X38 A;  2LGI A;  1GC7 A;  3T3N A;  1L0X B;  2RDB C;  5IN7 A;  1FXT B;  1KOT A;  2KQS A;  2WGS A;  1MJD A;  4EUT A;  2J7Q B;  1F9J A;  1Y8R C;  1ZKH A;  2FCS A;  4BAX A;  2KVZ A;  2J52 A;  1F52 A;  4IG7 B;  5CHF A;  5E6O A;  1UUP A;  4MJS B;  2KC1 A;  4DQO C;  4ACF A;  1AWD A;  2XK5 A;  1IGD A;  3JSV B;  1T0Q C;  2JT4 B;  1N5X A;  2PKO A;  2GB1 A;  1C76 A;  3M63 B;  4RGN A;  1WE7 A;  3NRZ A;  2WXO A;  3HK0 A;  2H88 B;  3AI5 A;  3DWG C;  2V3P A;  1SJE D;  1FEH A;  5AZG A;  1XCT L;  2ZNV C;  2KOX A;  1F2R I;  2L32 A;  1WR6 E;  5G5G A;  2MH7 A;  2V3S A;  4HWI B;  4WJP A;  2D5G A;  2M17 A;  2LVP A;  2CU1 A;  3NS8 A;  2WP9 B;  5C2T B;  4XDD A;  2OHF A;  5TR5 A;  2IPK D;  4W9I A;  5IP4 D;  1J19 A;  1GOZ A;  2DYO A;  5L95 C;  1YN4 A;  1F2R C;  4A20 A;  4IWP A;  2LFI A;  3DBH B;  2BWE S;  4HVB A;  2PIA A;  1JRO A;  3K9O B;  2AX5 A;  1VZ7 A;  4EZK A;  4IOI E;  1V1P B;  4TQ1 A;  1N61 A;  2MW5 A;  1E8Y A;  3DBH I;  1WRD B;  3UQB A;  4BKS A;  2BYV E;  4NQL B;  2IGH A;  1HZ6 A;  1A70 A;  1WXQ A;  2I38 A;  1FM0 D;  5G2N A;  3RD2 A;  2D3B A;  3DPD A;  1WGY A;  5JXV A;  4C7Z A;  3ZNZ B;  3ZYY X;  3IAM 1;  1JWA D;  1SIJ A;  4EZL A;  3WAP A;  3PHX B;  2WLB A;  4WQM A;  4WWN A;  1GAQ B;  5BYR A;  3ZJU A;  3E56 A;  3GZN B;  3N20 C;  4YTM B;  4NJC A;  4F7Z A;  1PGX A;  2KFK A;  4NY0 A;  1E6E B;  2V4I B;  2O6V A;  3Q69 A;  4GB9 A;  1KTK A;  1WX8 A;  2LMC A;  4D2K A;  2G3Q B;  4B6W A;  4P16 A;  1I4G A;  1EF1 A;  3H1U A;  4W9K A;  1XCQ L;  3RUL A;  4CYE A;  1IUE A;  2NBW B;  1HXY D;  1LO5 D;  3RPF C;  3Q8B A;  3PVL A;  2M1M A;  4HRS A;  4HKQ A;  4A55 A;  1R4M I;  1I4P A;  2J0M A;  4MEL A;  2VZK B;  2JQR B;  4LK0 M;  3ONS A;  4P7I A;  1J7C A;  3ZLZ A;  2QJL A;  2K25 A;  2RDH A;  3U30 A;  2D10 A;  2NPT B;  1N5W A;  3Q8E A;  1P1A A;  1V2Y A;  2XBB C;  3RNB C;  2GRI A;  5FK9 C;  2BQQ A;  4K3C A;  1BUI C;  2Z59 B;  1FMA D;  4P1B C;  1R4N B;  3RN9 C;  3UIN B;  2C7M B;  3SFE B;  1YOV B;  4ZYS A;  1D5Z C;  2LD9 A;  3TUO A;  2AYO B;  2PMV A;  1WF9 A;  4LNN A;  3NJT A;  1RFA A;  3DDC B;  4MGZ E;  1SJH D;  2BS3 B;  4G11 A;  4GLS C;  3V61 A;  2AQ2 B;  3IHP C;  2X8X X;  1UBQ A;  2JX5 A;  2WU2 B;  1ZE3 D;  1QOF A;  3DVN V;  1TS5 A;  2E6X A;  2H89 B;  5IO9 A;  4CO7 A;  3EFU A;  2C7N B;  1VDV A;  4WAF A;  2FUH B;  2ZEQ A;  2KWV B;  1OQQ A;  4M8N A;  3R66 C;  3M62 B;  4ICU A;  2BT6 A;  1WZ0 A;  1CQV A;  3ZIM A;  2RGF A;  4MDK E;  2OOB B;  3VR9 B;  4FAD A;  3PZ8 A;  3I9V 1;  3TEY A;  3T9L A;  3ZNI D;  3Q3F A;  4AP4 C;  2PE9 A;  4HJK A;  1TZ1 A;  2KFJ A;  2N9K A;  1ZXH A;  3RT3 B;  1ZOY B;  2KAJ A;  4FBJ B;  3HM6 X;  3W1Y A;  1V97 A;  2D07 B;  3MJW A;  3SD5 A;  5EDS A;  5GXG B;  3WAL A;  1I7H A;  1T0R C;  2SEB D;  3DHH C;  4K7W A;  3TMP B;  2NBV B;  2ZPY A;  4K1R B;  3BII D;  2PJH A;  4KGT A;  4S0R A;  4C7Y A;  1NYR A;  1YD8 U;  2WDT B;  1QKZ A;  2WXN A;  4ARI A;  2NCN A;  4RF0 A;  1C78 A;  2J42 A;  1CJE A;  3ZRF A;  3DVN U;  1P3Q U;  3CST A;  2KO3 A;  1JWU D;  4MH0 E;  4PT5 A;  4E3C A;  2K8B A;  1STE A;  1L7Y A;  2LHE A;  2RPQ A;  2WNM A;  4DHZ B;  2IND C;  1MHX A;  3C0R B;  1UGM A;  2GBM A;  4FHJ A;  4L2Y A;  3QWZ B;  3OAW A;  3PV1 A;  4FHK A;  4C4V B;  2K1F A;  5E6J A;  4YT0 B;  4GOC A;  2QCZ A;  1V5T A;  2KDI A;  5I4D A;  3WAN A;  3KW5 B;  2YEP F;  3VRB B;  4IDI A;  4K7U A;  4WUR A;  1K50 A;  2OED A;  3B9J A;  3ZXV A;  2R2Q A;  2K6D B;  5BYQ A;  3CSF A;  3RNF C;  3ALB A;  2Y3A A;  4MT5 A;  1SE4 A;  1XLN A;  1FIQ A;  1UH6 A;  5KHQ A;  3OJ3 A;  2N9E B;  1S1Q B;  1TJE A;  2NS5 A;  1NEK B;  1OQY A;  4B0E A;  3RNA C;  2L3Z A;  3VUW A;  1Q10 A;  4BFR A;  1JWB D;  4BVU C;  1D4B A;  3RZW C;  2KDF B;  1WXM A;  2PLP A;  4XYC A;  1BT0 A;  1EWY C;  4XGA B;  3OJ4 B;  2CJO A;  3ETR A;  2WXK A;  1SIF A;  4NJ6 A;  2MP2 B;  2FID A;  5HG2 A;  2L8J A;  1AAR A;  3MHS D;  3FAH A;  4W9G A;  4WWM A;  2LHD A;  2EEL A;  2L0T A;  4DXA B;  3DBL I;  2C5L C;  3NVY A;  4BOZ B;  1JWM D;  4RCO A;  2AQ1 B;  2IO2 B;  4N59 A;  2RMM A;  2EMS A;  3B1L X;  1CMX B;  3KQ4 A;  2BGF A;  2KX3 A;  4JLC A;  5HFY A;  2MA9 B;  4JPS A;  1I35 A;  4KKJ A;  4WIP A;  2QSD A;  1E0Z A;  3Q3N C;  3P4S B;  1NEN B;  4A90 A;  3B2G A;  3VHT C;  4F1S A;  2D11 A;  5J2R A;  3RNE C;  3A9J A;  4OHJ A;  2L0F A;  5TSS A;  5LLI A;  1YN3 A;  3RMK C;  2LUE A;  2C60 A;  4DHZ E;  4KV2 A;  5E6P A;  1TS2 A;  5D3I B;  4I6N B;  3VQI A;  2KYW A;  2L76 A;  2V9H A;  3W2D A;  2KFK B;  2JYT A;  5JZE B;  4ANV A;  2XN9 C;  4KGR A;  1DYQ A;  1ROE A;  4KZC A;  4FJV B;  2L52 A;  4USA A;  3IT4 B;  3L4P A;  2IO0 B;  2W3S A;  1MFW A;  1V1O A;  4HDO A;  4KGS A;  4YSZ B;  2KD0 A;  5FR3 A;  1L0Y B;  2L05 A;  3ZKJ C;  3HIZ A;  3NZU A;  4A6Q A;  1QLB B;  2KDB A;  2LEK A;  3GB1 A;  3AE9 B;  3ZJV A;  3A9K B;  1UBI A;  1WRI A;  4G3X B;  1C4C A;  1DGJ A;  1WXV A;  4EFO A;  1LXD A;  2W3R A;  3PLV A;  3Q8F A;  2LXA A;  2KWC A;  3AE2 B;  4K3B A;  2KNB A;  2KJR A;  3L54 A;  1VRA B;  5JHB A;  1T0S C;  5CHW A;  1SE3 A;  1IBX B;  1JWS D;  1E8X A;  2PE6 B;  1P9D U;  4FJZ A;  4A9A A;  3OWE B;  2VH1 A;  4YL8 A;  5IOI A;  2L83 A;  3P63 A;  1EU4 A;  2PPH A;  1YN5 A;  4JX1 C;  3I3T B;  4CQN A;  2FAZ A;  2DZI A;  1D6E C;  2GBK A;  3TSS A;  4XC2 A;  2ASQ A;  4RF1 A;  2RR9 A;  2D3G A;  4EOY A;  2DEN B;  4ITK A;  4ZOH C;  1KF6 B;  1SEB D;  1WJU A;  4PYU A;  1UNS A;  1VLB A;  5LXI B;  2EKE C;  2EMT A;  2M4N A;  4GDK B;  1J7A A;  1ZXI A;  2LGD A;  3JYU A;  3ECI A;  1N62 A;  2GMI C;  1V81 A;  2BVC A;  1WYG A;  2L1A A;  3SR6 A;  3K9P B;  3FIL B;  2D3A A;  3Q14 C;  1I4H A;  3OG5 A;  1NVI D;  3LYY A;  1XXG A;  3KUZ A;  4TSS A;  1TS4 A;  5DPR A;  1V1P A;  2B76 B;  3H8H A;  3CWI A;  1GG3 A;  2YVC A;  2HJ8 A;  4BBN F;  2ON8 A;  1M4V A;  5EE3 A;  3IAS 1;  2DAJ A;  3ZDM C;  2GLS A;  2IBI B;  1VCB A;  1V49 A;  4I6P A;  1V86 A;  4BKS D;  2GBN A;  4MEM A;  2NBU A;  2BYT A;  3BYT B;  1CK1 A;  4AUQ C;  3VR8 B;  1NDD A;  2K3U A;  4OVV A;  3TEZ A;  4II3 B;  3ZNG C;  2DZJ A;  1P7E A;  4TV3 A;  3W9C B;  4LNF A;  3B08 A;  3QQ8 B;  1E7U A;  1Z2M A;  4C4V A;  3MC0 B;  2IDY A;  1TY2 A;  2AQ3 B;  1V5O A;  3H6N A;  3HVZ A;  3W5U B;  1XLO A;  3APD A;  3NUH B;  4ANX A;  3DHG C;  1GB4 A;  1HZ5 A;  2XNA C;  1XLQ A;  2WQY B;  2BKR B;  5LNK 1;  3PZ7 A;  4EE2 A;  4S17 A;  4A8X C;  4A3P A;  1N6Z A;  2Q5W D;  3CIR B;  1FNW A;  2DX5 B;  1WY8 A;  1KFY B;  2KAC A;  5H92 C;  1WR1 A;  4UDU C;  4HLE A;  2QHO A;  4RH6 A;  5AEK B;  2PTL A;  2CKH B;  5AUK A;  3NZS A;  2N7J A;  2BS4 B;  1RM6 C;  2K0P A;  3ZJT A;  2J0J A;  5EE0 A;  2DLB A;  5DPS A;  4KSK C;  4KKI A;  3ZRC A;  4CHK A;  4J3O D;  2INN E;  3PRM B;  4IWO A;  5D94 A;  5L83 A;  4RGT A;  3PS6 A;  5C23 A;  3RYT A;  1RWS A;  2INC C;  5J17 A;  1WGG A;  4RGM A;  2DZM A;  3URY A;  2FBW B;  2LXC A;  1AW7 A;  1ENF A;  3H7S A;  3A1Q B;  3WIM A;  1XO3 A;  4LTU A;  4AQ7 A;  1EO6 A;  2ZVO A;  2WXM A;  1ZUD 2;  2I1K A;  3W1S A;  1FXA A;  1UF0 A;  4WJQ A;  2KQ7 A;  5EE9 A;  1UWX A;  2J0K A;  2MX2 A;  3R2T A;  2JWU A;  2KVR A;  2I1J A;  1AYF A;  1R7S A;  1XEE A;  5D7G A;  3DBR I;  4M0W B;  3TIX A;  2BPS A;  2MBE A;  3QX1 A;  4HPL B;  3SFD B;  3P2B A;  4M00 A;  1A5R A;  1WFY A;  2ZW0 A;  2I2Y A;  4IM3 A;  1MG4 A;  1HQR D;  2N7D A;  3JSV A;  3W1S C;  1Y56 A;  2BS2 B;  4N58 A;  3V6C B;  2B3A A;  3AEB B;  1T5X D;  2UU7 A;  3D32 A;  1VZ6 A;  2K9X A;  2O6V B;  2V4L A;  3RCZ A;  1DOX A;  3RFZ B;  4PK1 A;  2TSS A;  4NAM A;  5G55 A;  3AEE B;  1WZ3 A;  2UWQ A;  1OQR A;  3JW0 X;  1C4P A;  1TGZ B;  2ZCC A;  3AE8 B;  3BVZ A;  1YQB A;  1WI0 A;  4ANU A;  2YLM A;  3B0A A;  3DWM A;  3RNG C;  3PPA A;  2KK8 A;  3BY4 B;  2L00 B;  1J7B A;  1WYW B;  5AUI A;  4ARC A;  2DZK A;  4BKG A;  1R4M B;  1OFF A;  2LJ5 A;  2ZPN A;  3I5J C;  4RNA A;  1IPG A;  2D3C A;  1ESF A;  1FXI A;  1RAX A;  4HPP A;  4DK5 A;  5FR6 A;  3A4R A;  3VXW A;  2G45 B;  2N9P C;  3ZVV A;  2NTS A;  4OVZ A;  4M01 A;  1JW9 D;  3V62 A;  1XQQ A;  1ZW7 A;  1WWT A;  3WA0 A;  3IVF A;  2EKI A;  2IZV B;  4IM0 A;  3BIN A;  1IP9 A;  2JYE A;  3TBL D;  1TT5 B;  1Q5W B;  4HDQ A;  3AXC A;  3QAR A;  3TEW A;  4PYZ A;  2KWD A;  3AEA B;  3EUB 2;  1LGR A;  1DOY A;  4LNK A;  3NS1 A;  2N9L A;  1KLG D;  4BBN C;  2BYE A;  3EFC A;  2C7H A;  2RPV A;  2PW9 A;  2QIE B;  1C3T A;  4MM3 A;  2FNJ B;  3WAM A;  2PEA A;  2AWT A;  4K81 A;  4LCD E;  1IYF A;  2IY1 B;  5JH5 C;  2MEK A;  2VH2 A;  3AV8 A;  5BMG A;  2G4S A;  2QIL A;  1WGH A;  5C3J B;  3BZD B;  4YXD B;  2BBC A;  2DAF A;  4KZ0 A;  2LWP A;  3R3M A;  2YEP B;  4GU2 A;  2V0G A;  4RMA A;  3TJP A;  4RGO S;  4W9F A;  4YSY B;  1YQ4 B;  2JWZ A;  4F8C B;  2ZJD A;  2LZ6 A;  3PT2 B;  3ZQ4 A;  2KN5 A;  2OJW A;  4W9C A;  3SDL C;  2R61 A;  3APF A;  3TEX A;  2E3T A;  1M94 A;  3N30 A;  3L17 A;  2KLG A;  2JRH A;  1SE2 A;  5HI1 A;  1XT9 B;  1I42 A;  3KUD B;  1S3S G;  3GE3 C;  2QEJ C;  3VTV A;  4XWT A;  4DHJ B;  1ZPS A;  1HE8 A;  1AN8 A;  4JIO U;  4DWF A;  2XEW A;  4NNJ B;  3ZO5 B;  3PRP B;  1YNT E;  1WSP A;  4NJ7 A;  3RZF A;  2NVU I;  4O1N A;  2N4F A;  2NTT A;  1L6V A;  4FXC A;  2HJ1 A;  1TIF A;  4W9D A;  4KVG B;  1QT9 A;  2N1V A;  2FCN A;  1KJT A;  4W9H A;  4MH8 A;  2N7E A;  3DHI C;  1JAL A;  4ZRQ A;  3PRE A;  1TZO A;  1L4D B;  4LJP B;  1I4Q A;  4AJW A;  4ZRK A;  3EA6 A;  1WXS A;  1V9J A;  4MGK E;  5C1Z A;  2BB6 A;  2KJ6 A;  2Y5P A;  1TKG A;  1BXT A;  5CTR C;  2K5P A;  4IUM B;  4W9E A;  3KYC D;  2AL6 A;  3RI7 C;  1RYJ A;  4TUU A;  4HCN B;  1MI0 A;  2RDG A;  1EU3 A;  2DWQ A;  1OEY A;  4MSQ B;  4ZDV A;  1K53 A;  3P4P B;  3IT6 B;  4OZB A;  1QOG A;  1WH3 A;  4LDT D;  3ZTD A;  1MPE A;  4WH4 A;  1C1Y B;  2BTE A;  3U2S C;  1F77 A;  3HVD A;  2BB5 A;  2L7R A;  2KHW B;  5DPT A;  3H7P B;  1Q0W B;  3MJ5 A;  3ZNH B;  1UEL A;  2MSE D;  3VTU A;  2Z0D B;  3NVW A;  5BMI A;  3WAO A;  1JML A;  4DBG A;  1OGW A;  3HHM A;  4KIK A;  3LJ3 A;  1ACC A;  3T8M A;  2FCM A;  1OTR B;  1GPX A;  3AM9 A;  2M19 A;  1YJI A;  1WJN A;  3Q8A A;  3CMM B;  2IJ0 A;  1XF5 L;  1WXA A;  3UF8 A;  3KVF B;  3Q2A C;  2HE7 A;  1FRR A;  3NVZ A;  2WHI A;  2IYD B;  3ZXR A;  1WJ4 A;  4G50 A;  4MSM B;  3DVG Y;  4TKN A;  2KX0 A;  5MPO A;  3VUY A;  1P98 A;  4XDC A;  1BML C;  3BYY B;  1T3Q A;  3APC A;  2HD5 B;  5BO4 B;  3O13 A;  4PS8 A;  2DYM A;  3N3K B;  4FJY A;  4LLG M;  2N1W A;  3T3O A;  1SXT A;  3N9Y C;  4II2 B;  1N60 A;  1WIA A;  3VAW A;  3TCA A;  3BVM A;  2HTH A;  1WM2 A;  3DVG X;  4H2A A;  2JXX A;  2MCN B;  4WWP A;  1PFD A;  3N1Z C;  2A4Z A;  1KH0 A;  5DPW A;  3A9J B;  3RUI B;  3M3J A;  1WX9 A;  3L13 A;  4QAY A;  4IWQ A;  2VRR B;  2J4X A;  3AN1 A;  4YTN B;  1GUA B;  1EM7 A;  2KMC A;  5HKH A;  3C8Y A;  4WJN A;  2QDF A;  3UQA A;  2V3N A;  2Z8L A;  4URK A;  2KZR A;  2GOW A;  3KWV A;  2M0A A;  1ET6 A;  3MP9 A;  2M8S A;  4L23 A;  1C79 A;  2C9W B;  4A3O A;  4BOS C;  3GOE A;  1YX6 B;  3AMZ A;  3Q3J A;  1C77 A;  2BYF A;  1TKY A;  3W5V B;  4GGQ A;  3H7P A;  3R7Q A;  4OZA A;  2ONQ A;  2LJI A;  5BMH A;  2WS3 B;  1C9F A;  3M95 A;  1C4A A;  5E6N A;  3V6E B;  1EUV B;  5LXH A;  2ZZP B;  2WDQ B;  4X57 B;  3I63 C;  2KTR B;  2REX A;  4RM8 A;  1B1Z A;  2ICI A;  3VFK A;  1EF5 A;  3QCA A;  4WAA A;  3MC8 A;  1FRD A;  1L5P A;  2K6Q A;  2GBJ A;  4YTP B;  4HPM B;  1IBX A;  2MBH A;  4BZA A;  3Q3O C;  5J18 A;  3IXS A;  1E8W A;  2W54 A;  2BW2 A;  2WXH A;  2MHJ A;  1TKE A;  2W9N A;  3HUI A;  2GI9 A;  4ZHO A;  4HK2 A;  1L6U A;  1WGK A;  2WXR A;  1E9M A;  2G4D B;  3P4Q B;  1JCK B;  3U52 E;  1HEZ E;  4G0N B;  2JVC A;  1RLF A;  3QAQ A;  1E10 A;  2A5U A;  2IGG A;  2WXI A;  5GMV A;  2JUO A;  4KDL B;  1UGJ A;  3J9C A;  2O2V B;  2KJH B;  3R7R A;  2LVO A;  2FE8 A;  4GN1 A;  1XLP A;  2G1E A;  4JQW C;  1H8C A;  2ZW1 A;  1KRH A;  2BF8 B;  1L0V B;  2LUM A;  4Q2J A;  3ML8 A;  3A1Q A;  3MTN B;  2RD0 A;  1ZDV A;  1QIL A;  3Q3M C;  3UIO B;  2LVQ A;  3L16 A;  2QMT A;  4IKG A;  4KDI C;  2IGD A;  1D5X C;  3EC8 A;  3L08 A;  5H8Y E;  3ZTC A;  3UGB B;  4ZYN A;  3VH4 B;  1QQR A;  3LB8 C;  2MQJ A;  1SE9 A;  3DBS A;  2KN4 A;  1KLV A;  4FA6 A;  2NR2 A;  4AS1 A;  1PUT A;  1ZDX A;  3BK1 A;  4N9F 4;  2WXJ A;  3KLS X;  2JRI B;  1R4N I;  3N1X C;  4B0M A;  1TYG B;  2LI5 A;  3DCG A;  1KLU D;  2ZCB A;  1VJK A;  2AEH A;  2G9H D;  1SBB B;  2WDR B;  4GDL B;  2KMA A;  3QIJ A;  2KT7 A;  4C56 C;  4M8M A;  4FLH A;  1WGD A;  2LGX A;  3MC9 A;  3BK2 A;  2KMM A;  1NYQ A;  1H4R A;  4M02 A;  1GC6 A;  4HRO A;  2O6V D;  1QOA A;  5G5H A;  4FUL A;  1Q1O A;  2WX0 A;  1LM8 B;  3B2F A;  3SEB A;  3NOB A;  2LAS A;  4PS7 A;  4MJS A;  2BKF A;  5FKA C;  2J53 A;  1WMH A;  2AL3 A;  3AE6 B;  2NMQ A;  3A9K A;  4TQ0 A;  2ZVN A;  1WX7 A;  2KTR A;  3AE5 B;  5EE1 A;  3OLM D;  1D3Z A;  3VTW A;  3SHQ A;  2GBR A;  3ABV B;  3X0W A;  2Y5C A;  1UZX B;  1JRU A;  2MJE A;  3U4E G;  2KC2 A;  2QC8 A;  3NG0 A;  4AJY B;  1WMH B;  1YIW A;  3A33 B;  5IKC M;  4GDK A;  1OEY J;  4RM9 A;  3VVW B;  3NZ3 A;  5KHO A;  1GB1 A;  4IW0 A;  2JZ3 B;  1HA5 A;  2KKC A;  4YSX B;  2WXP A;  3FIL A;  2D2Q A;  1NI3 A;  4W9J A;  2VZK D;  2XK5 B;  3LXF A;  4US9 A;  2N9X A;  2WX1 A;  3AED B;  1B9R A;  1FPY A;  3GS2 A;  1WGR A;  1RFK A;  2IO1 B;  5CHV C;  2DNF A;  2N0S B;  1J8C A;  1HTO A;  3NHE B;  2FUG 1;  2MRP A;  3EHV A;  4MGI E;  3VH3 B;  4M0W A;  2O2V A;  1L2N A;  4ZRJ A;  5D3D A;  2JPH A;  3P4R B;  2IO3 B;  3R8B A;  4IC7 B;  1T6B X;  3P1M A;  1G6J A;  3S2A A;  1SSN A;  2BWF A;  1X1M A;  2M56 B;  4GIV A;  2WDV B;  3ENE A;  1D5M C;  3FKY A;  4KIK B;  4ZRP A;  1WM3 A;  3PLU A;  1FCC C;  3QA8 A;  3X23 A;  4K7S A;  4ASW C;  4HEA 1;  1YX5 B;  2LRW A;  2FIF A;  3KWL A;  3AH7 A;  1MHH E;  1JRP A;  2MBQ A;  3TL5 A;  1QOB A;  3P42 A;  2HTM E;  4GXB A;  2WYQ A;  2CHZ A;  4OW0 A;  1PGA A;  4LJO B;  4EEW A;  1UWM A;  5T8I A;  3BVG A;  2MJ3 A;  2OJR A;  1YMH E;  3KH0 A;  3AE3 B;  3AU5 A;  5D2M B;  1V8C A;  2HDE A;  3QJZ A;  3PO0 A;  3UIP B;  3I57 A;  3JVZ X;  1PYW D;  3GP7 A;  4MM3 B;  3Q8C A;  4HJG E;  4NAW B;  1DOI A;  4JWS C;  4FN2 A;  1SGH A;  4PS3 A;  1HTQ A;  4OZC A;  3AUL A;  1E7V A;  2ACZ B;  4DDG D;  2DBY A;  5HHD G;  2KDM A;  3GZN I;  4JE3 B;  4DDI D;  1VD2 A;  1PGB A;  4DHJ D;  4WWO A;  3SU8 X;  1L4Z B;  3VRA B;  5IA7 A;  2KTF A;  5CX3 A;  3DBL B;  1UD7 A;  1I4X A;  4DXF A;  3AE1 B;  3N32 A;  4XX5 A;  2WXF A;  3PZD A;  3U8Z A;  4I6L B;  4AOF A;  3V60 A;  1LQB A;  3KYD D;  1E8Z A;  2CU3 A;  4W9L A;  3ZW3 A;  1VR9 A;  1YJ1 A;  3AU4 A;  3KUC B;  2WU5 B;  3PHW B;  3AE7 B;  3PRZ A;  4KSL C;  1F0Z A;  2W82 A;  5AZF A;  3EEC A;  4HXD A;  2M0X A;  4MAC A;  4B9K A;  2INP E;  2KXJ A;  4GMV A;  1MG8 A;  4WJO A;  4XE0 A;  3AEG B;  2MBB B;  1NI2 A;  1KM7 A;  3IBE A;  3HRD D;  1WJ6 A;  4ZRI A;  3L0W B;  3ZDT A;  2MWS B;  4AWJ A;  3EGR A;  4TMA B;  1FD6 A;  1F1H A;  4E74 A;  2WXG A;  2JSV X;  4HCP B;  4NQK E;  1YQ3 B;  4OVU A;  3AB5 A;  1QF6 A;  1EWC A;  2KQ4 X;  4C80 A;  4HKZ E;  1JQ4 A;  1XD3 B;  3ZUN A;  1E90 A;  3C19 A;  3DBR B;  1V80 A;  4LDT B;  3NVV A;  4NAW A;  2DHZ A;  3PGE A;  3L10 B;  4KX6 B;  4ICV A;  3WCQ A;  2DYB A;  4NZL B;  1SF0 A;  1GNU A;  1PDX A;  1E5W A;  4P6V F;  4GDL A;  1NBF C;  3NY5 A;  1SB3 C;  1K51 A;  3V3X A;  4XZ4 A;  3AEC B;  3HM3 A;  1T0Y A;  3E9S A;  2MP2 A;  2MBO A;  1WE6 A;  1RRB A;  4LNO A;  1V6E A;  1TS3 A;  5JHA A;  2WXL A;  4RFB A;  2JY6 A;  2LGS A;  1FNU A;  2R2O A;  3CF6 E;  3QK0 A;  3O65 B;  4ANW A;  3V05 A;  3UI3 A;  2PVG C;  1ET9 A;  1IGC A;  2JF5 A;  1YJJ A;  2WXQ A;  4EZJ A;  1ZP0 B;  4WQO B;  3IFW B;  2K8H A;  1QZE A;  1E7P B;  2LGY A;  2KDE B;  3AE4 B;  4JL9 A;  4B95 A;  3ZGZ A;  2KAN A;  1MVK A;  4N6E B;  5D6J B;  4YWG G;  2NPT A;  1TY0 A;  4JWU C;  5BYS A;  2MJD A;  5AZH A;  2WWZ A;  1N63 A;  4L1B A;  1PQS A;  2K8C A;  2FCQ A;  2SAK A;  3Q6B A;  3U7Z A;  3DOW A;  1P7F A;  3FC4 A;  2IY0 B;  2ZNV B;  4R3D A;  2V1Y A;  1VZ8 A;  2RSU A;  4LNI A;  4EKU A;  4E71 A;  1Z5S B;  2CJN A;  2JU6 X;  1GJZ A;  2K22 A;  2CS4 A;  2UYZ B;  2W55 A;  4ZHP A;  4NPN A;  3AEF B;  1TTN A;  2PVO D;  3GE8 C;  4XWW A;  4GSW A;  1I4R A;  4BKT A;  2LRU A;  3PTF C;  4REZ A;  1LFD A;  3A4S C;  2JXT A;  5IAA C;  4DXG A; 
#chains in the Genus database with same CATH homology
 1WZ3 A;  2UWQ A;  2KDI A;  2G4D B;  3JW0 X;  3WAN A;  3KW5 B;  4G0N B;  1TGZ B;  2JVC A;  1RLF A;  2ZCC A;  3QAQ A;  3DQV A;  1J0G A;  1YQB A;  4K7U A;  1WI0 A;  1P0R A;  2Y5B B;  2A5U A;  5DCN A;  3VUX A;  5GMV A;  3QHT A;  2JUO A;  4KDL B;  2YLM A;  3B0A A;  2JZZ A;  3LDZ E;  4ANU A;  3QC8 B;  2R2Q A;  2K39 A;  3PSE B;  2K6D B;  4J6I A;  3PPA A;  2Z0E B;  3CSF A;  2KK8 A;  4JGH B;  3ALB A;  3BY4 B;  2O2V B;  4IM2 A;  2KJH B;  2L00 B;  4MGY E;  3R7R A;  2LVO A;  4GN1 A;  1K8R B;  4JQW C;  3ML9 A;  1WYW B;  1UH6 A;  1ZGU B;  5KHQ A;  1H8C A;  1U4A A;  3OJ3 A;  2DZK A;  2N9E B;  4BKG A;  3U7D A;  2BF8 B;  1S1Q B;  2NS5 A;  2LJ5 A;  2KLC A;  2ZPN A;  2CR5 A;  3ML8 A;  1IPG A;  1RAX A;  1OQY A;  3A1Q A;  2MLB A;  3MTN B;  4DK5 A;  2RD0 A;  1ISN A;  3UIO B;  5FR6 A;  2LVQ A;  3A4R A;  3VXW A;  2L3Z A;  3L16 A;  3VUW A;  2G45 B;  2KWU B;  1TBE A;  2N9P C;  4BFR A;  4KDI C;  2CHW A;  3ZVV A;  4BVU C;  2CHX A;  3EC8 A;  3H9D A;  3IG3 A;  3L08 A;  3ZTC A;  3RZW C;  2KDF B;  3UGB B;  3VDZ A;  4ZYN A;  1WXM A;  3VH4 B;  1GC7 A;  1BT0 A;  3V62 A;  1XQQ A;  2MQJ A;  1ZW7 A;  3OJ4 B;  1SE9 A;  3WA0 A;  3DBS A;  1FXT B;  1KOT A;  3IVF A;  2IZV B;  4IM0 A;  1SIF A;  3BIN A;  4NJ6 A;  2MP2 B;  2FID A;  2KQS A;  4FA6 A;  1IP9 A;  1KLV A;  2NR2 A;  3TBL D;  1Q5W B;  4N9F 4;  2L8J A;  1AAR A;  4HDQ A;  2JRI B;  1R4N I;  3AXC A;  4EUT A;  2J7Q B;  2LI5 A;  3DCG A;  3QAR A;  1F9J A;  1Y8R C;  1ZKH A;  2FCS A;  3MHS D;  2ZCB A;  4IG7 B;  2AEH A;  5CHF A;  4PYZ A;  4W9G A;  5E6O A;  4MJS B;  2KC1 A;  2L0T A;  4DXA B;  4GDL B;  2KMA A;  3QIJ A;  2XK5 A;  3DBL I;  2C5L C;  3JSV B;  4BBN C;  4M8M A;  4BOZ B;  4FLH A;  2JT4 B;  1WGD A;  2LGX A;  2BYE A;  2C7H A;  2IO2 B;  3B1L X;  2EMS A;  1CMX B;  2BGF A;  2KX3 A;  3M63 B;  1WE7 A;  1H4R A;  1C3T A;  4JLC A;  4MM3 A;  2FNJ B;  1GC6 A;  3HK0 A;  2O6V D;  3WAM A;  3AI5 A;  2MA9 B;  4FUL A;  2PEA A;  2AWT A;  1Q1O A;  2WX0 A;  1LM8 B;  3NOB A;  4K81 A;  2LAS A;  4PS7 A;  1I35 A;  4LCD E;  4MJS A;  1IYF A;  2IY1 B;  5JH5 C;  2BKF A;  5AZG A;  1WMH A;  2AL3 A;  2G4S A;  2ZNV C;  3A9K A;  4TQ0 A;  2KOX A;  2ZVN A;  1WX7 A;  2KTR A;  1WGH A;  1WR6 E;  3VHT C;  4F1S A;  2V3S A;  3OLM D;  4HWI B;  3VTW A;  1D3Z A;  2D11 A;  2DAF A;  4KZ0 A;  4WJP A;  2LWP A;  3R3M A;  5J2R A;  3A9J A;  4GU2 A;  2M17 A;  3SHQ A;  2LVP A;  2GBR A;  4RMA A;  2L0F A;  2CU1 A;  3TJP A;  4W9F A;  3NS8 A;  5LLI A;  3X0W A;  2JWZ A;  1UZX B;  2LUE A;  2C60 A;  1JRU A;  4DHZ E;  4F8C B;  2ZJD A;  4KV2 A;  2LZ6 A;  3PT2 B;  2KN5 A;  4W9C A;  2KC2 A;  5E6P A;  3SDL C;  3APF A;  1WMH B;  1YIW A;  5TR5 A;  3A33 B;  4W9I A;  4I6N B;  4AJY B;  4GDK A;  3VQI A;  1OEY J;  4RM9 A;  3VVW B;  2L76 A;  5KHO A;  1M94 A;  3N30 A;  1J19 A;  2JZ3 B;  4IW0 A;  3L17 A;  2DYO A;  2KKC A;  2KFK B;  2KLG A;  2JRH A;  5JZE B;  5L95 C;  4ANV A;  1XT9 B;  1I42 A;  2D2Q A;  4A20 A;  4IWP A;  4W9J A;  4KZC A;  3KUD B;  4FJV B;  1S3S G;  2XK5 B;  2BWE S;  4HVB A;  3VTV A;  2N9X A;  2WX1 A;  4DHJ B;  1HE8 A;  2IO0 B;  3K9O B;  1WGR A;  4JIO U;  4EZK A;  2IO1 B;  4TQ1 A;  5CHV C;  4HDO A;  4DWF A;  2XEW A;  4NNJ B;  2MW5 A;  1J8C A;  3ZO5 B;  1E8Y A;  3DBH I;  1WRD B;  3PRP B;  4BKS A;  2BYV E;  4NQL B;  2KD0 A;  3UQB A;  2L05 A;  3NHE B;  2MRP A;  3EHV A;  3ZKJ C;  3HIZ A;  4MGI E;  4NJ7 A;  3RZF A;  3NZU A;  3VH3 B;  2KDB A;  2O2V A;  2NVU I;  1L2N A;  2N4F A;  4W9D A;  4ZRJ A;  3A9K B;  4KVG B;  1UBI A;  2JPH A;  2N1V A;  4G3X B;  2FCN A;  5G2N A;  2IO3 B;  1KJT A;  1WXV A;  4IC7 B;  1LXD A;  4W9H A;  3RD2 A;  4EFO A;  2N7E A;  1G6J A;  3S2A A;  3PLV A;  3DPD A;  3PRE A;  1WGY A;  2BWF A;  4GIV A;  1X1M A;  2LXA A;  4LJP B;  3ENE A;  3ZNZ B;  2KWC A;  4AJW A;  4KIK B;  1WM3 A;  2KNB A;  3PLU A;  4ZRK A;  4EZL A;  3QA8 A;  2KJR A;  3X23 A;  1WXS A;  3L54 A;  4K7S A;  1V9J A;  4ASW C;  3WAP A;  4MGK E;  5C1Z A;  5JHB A;  3PHX B;  5CHW A;  2KJ6 A;  1YX5 B;  4WWN A;  2LRW A;  1E8X A;  2FIF A;  2PE6 B;  5CTR C;  2MBQ A;  3TL5 A;  1P9D U;  4IUM B;  4W9E A;  4FJZ A;  3KYC D;  2AL6 A;  4F7Z A;  2KFK A;  4NY0 A;  4TUU A;  4HCN B;  4GXB A;  2O6V A;  4YL8 A;  2WYQ A;  2PPH A;  2CHZ A;  1OEY A;  3I3T B;  4MSQ B;  4ZDV A;  4GB9 A;  2FAZ A;  2DZI A;  2GBK A;  4LJO B;  4EEW A;  1WX8 A;  4XC2 A;  2ASQ A;  2G3Q B;  2OJR A;  2RR9 A;  4B6W A;  1WH3 A;  2D3G A;  4EOY A;  2DEN B;  4LDT D;  3ZTD A;  1EF1 A;  3H1U A;  3KH0 A;  1WJU A;  3AU5 A;  4PYU A;  1C1Y B;  5D2M B;  4W9K A;  5LXI B;  3RUL A;  3QJZ A;  4CYE A;  2EKE C;  3UIP B;  2EMT A;  2NBW B;  2M4N A;  4GDK B;  3JVZ X;  2L7R A;  2LGD A;  2KHW B;  5DPT A;  3H7P B;  3PVL A;  4NAW B;  1Q0W B;  3JYU A;  2M1M A;  3ECI A;  3ZNH B;  2GMI C;  1UEL A;  2MSE D;  1V81 A;  4FN2 A;  1SGH A;  2Z0D B;  3VTU A;  3K9P B;  4PS3 A;  3WAO A;  4DBG A;  1OGW A;  3AUL A;  3HHM A;  1R4M I;  4KIK A;  1E7V A;  3LJ3 A;  4DDG D;  2J0M A;  4MEL A;  3GZN I;  3ONS A;  4P7I A;  4DDI D;  3ZLZ A;  3T8M A;  2K25 A;  2FCM A;  3KUZ A;  3U30 A;  1OTR B;  1VD2 A;  2D10 A;  5DPR A;  4DHJ D;  4WWO A;  2NPT B;  3SU8 X;  5IA7 A;  1P1A A;  2KTF A;  1V2Y A;  5CX3 A;  1GG3 A;  1UD7 A;  2XBB C;  1WJN A;  3N32 A;  2YVC A;  2HJ8 A;  4XX5 A;  4BBN F;  3PZD A;  3U8Z A;  4AOF A;  4I6L B;  3V60 A;  1LQB A;  2DAJ A;  3ZDM C;  3CMM B;  2IBI B;  1VCB A;  3KYD D;  1V49 A;  4I6P A;  1E8Z A;  1V86 A;  4BKS D;  2GBN A;  2Z59 B;  1WXA A;  3UF8 A;  3KVF B;  4MEM A;  4W9L A;  3UIN B;  2HE7 A;  2NBU A;  1YJ1 A;  3ZW3 A;  3AU4 A;  3KUC B;  3PHW B;  4AUQ C;  3PRZ A;  4KSL C;  2IYD B;  1NDD A;  1WJ4 A;  2C7M B;  4G50 A;  4MSM B;  3DVG Y;  5AZF A;  4OVV A;  3EEC A;  2KX0 A;  4TKN A;  4II3 B;  3ZNG C;  4HXD A;  2M0X A;  3VUY A;  2LD9 A;  2DZJ A;  2AYO B;  1P98 A;  4B9K A;  4TV3 A;  3B08 A;  1WF9 A;  1E7U A;  3QQ8 B;  2KXJ A;  4GMV A;  1RFA A;  1MG8 A;  1Z2M A;  4WJO A;  3APC A;  2HD5 B;  3DDC B;  4MGZ E;  2MBB B;  5BO4 B;  1NI2 A;  1KM7 A;  3IBE A;  1WJ6 A;  4ZRI A;  4G11 A;  4PS8 A;  3L0W B;  2DYM A;  3N3K B;  3V61 A;  3ZDT A;  2MWS B;  3IHP C;  4FJY A;  1V5O A;  3H6N A;  4AWJ A;  2N1W A;  1UBQ A;  4II2 B;  3APD A;  4E74 A;  1WIA A;  3VAW A;  4ANX A;  3DVN V;  3TCA A;  4HCP B;  2HTH A;  4NQK E;  1WM2 A;  4OVU A;  4CO7 A;  3DVG X;  2BKR B;  3EFU A;  2C7N B;  2JXX A;  4A3P A;  2MCN B;  1XD3 B;  2FUH B;  4WWP A;  2DX5 B;  1WY8 A;  2A4Z A;  1WR1 A;  2ZEQ A;  4HLE A;  2QHO A;  5DPW A;  2KWV B;  3A9J B;  3ZUN A;  3RUI B;  1E90 A;  5AEK B;  4M8N A;  1V80 A;  3R66 C;  4LDT B;  3M3J A;  2DHZ A;  1WX9 A;  3PGE A;  3L10 B;  4NAW A;  3L13 A;  3M62 B;  4ICU A;  4IWQ A;  2CKH B;  4ICV A;  3NZS A;  2VRR B;  1WZ0 A;  2DYB A;  3ZIM A;  1GNU A;  2RGF A;  4MDK E;  2OOB B;  2J0J A;  1E5W A;  4FAD A;  4GDL A;  1NBF C;  5DPS A;  3NY5 A;  1GUA B;  4KSK C;  3ZRC A;  4CHK A;  2KMC A;  3PRM B;  4XZ4 A;  4IWO A;  3HM3 A;  5D94 A;  1T0Y A;  5HKH A;  5L83 A;  2MP2 A;  4WJN A;  3PS6 A;  2MBO A;  5C23 A;  3T9L A;  1WE6 A;  3UQA A;  1RRB A;  3RYT A;  1V6E A;  3ZNI D;  4URK A;  2KZR A;  2GOW A;  1WGG A;  3Q3F A;  5J17 A;  5JHA A;  4AP4 C;  2PE9 A;  2DZM A;  2LXC A;  2M8S A;  4HJK A;  3H7S A;  3A1Q B;  1TZ1 A;  2C9W B;  4A3O A;  3WIM A;  4BOS C;  2JY6 A;  1YX6 B;  3GOE A;  2KFJ A;  3Q3J A;  3RT3 B;  2BYF A;  2R2O A;  3CF6 E;  1EO6 A;  2ZVO A;  3HM6 X;  3QK0 A;  3O65 B;  4FBJ B;  4ANW A;  2I1K A;  3W1Y A;  4GGQ A;  2D07 B;  3H7P A;  3R7Q A;  3W1S A;  2JF5 A;  3MJW A;  4WJQ A;  4EZJ A;  2KQ7 A;  3SD5 A;  4WQO B;  5EDS A;  3IFW B;  2K8H A;  1QZE A;  2J0K A;  3WAL A;  2MX2 A;  2LGY A;  3M95 A;  2KVR A;  2KDE B;  4JL9 A;  4B95 A;  2I1J A;  5D7G A;  5E6N A;  3DBR I;  2KAN A;  4K7W A;  4M0W B;  3TMP B;  3V6E B;  5D6J B;  2NBV B;  3TIX A;  2ZPY A;  1EUV B;  4K1R B;  5LXH A;  2BPS A;  2MBE A;  2NPT A;  2ZZP B;  3QX1 A;  4HPL B;  2PJH A;  4X57 B;  2KTR B;  2REX A;  2WWZ A;  5AZH A;  4RM8 A;  1YD8 U;  3P2B A;  3VFK A;  1PQS A;  2K8C A;  1EF5 A;  1A5R A;  2WDT B;  1WFY A;  2FCQ A;  3QCA A;  4WAA A;  3DOW A;  2NCN A;  4IM3 A;  2IY0 B;  2ZNV B;  3ZRF A;  3DVN U;  2K6Q A;  2GBJ A;  2V1Y A;  2N7D A;  1P3Q U;  3JSV A;  2RSU A;  3CST A;  3W1S C;  4EKU A;  4E71 A;  4HPM B;  1Z5S B;  2KO3 A;  4MH0 E;  3V6C B;  2MBH A;  4E3C A;  2B3A A;  2K8B A;  3D32 A;  5J18 A;  2O6V B;  1E8W A;  2V4L A;  1L7Y A;  1GJZ A;  3RCZ A;  2CS4 A;  2RPQ A;  2UYZ B;  4DHZ B;  4NPN A;  1TTN A;  3C0R B;  1UGM A;  2GBM A;  4GSW A;  2W9N A;  4FHJ A;  3QWZ B;  4HK2 A;  3OAW A;  3PV1 A;  4BKT A;  4FHK A;  2K1F A;  2LRU A;  5G55 A;  3PTF C;  1LFD A;  4GOC A;  3A4S C;  1V5T A;  5IAA C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...