3AECB

Crystal structure of porcine heart mitochondrial complex ii bound with 2-iodo-n-(1-methylethyl)-benzamid
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
239
structure length
239
Chain Sequence
PRIKKFAIYRWDPDKTGDKPHMQTYEIDLNNCGPMVLDALIKIKNEIDSTLTFRRSCREGICGSCAMNINGGNTLACTRRIDTNLDKVSKIYPLPHMYVIKDLVPDLSNFYAQYKSIEPYLKKKDESQEGKQQYLQSIEEREKLDGLYECILCACCSTSCPSYWWNGDKYLGPAVLMQAYRWMIDSRDDFTEERLAKLQDPFSLYRCHTIMNCTGTCPKGLNPGKAIAEIKKMMATYKE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase/oxidoreductase inhibitor
molecule keywords Succinate dehydrogenase [ubiquinone] flavoprotein subunit, m
publication title Crystal structure of porcine heart mitochondrial complex II bound with 2-Iodo-N-(1-methylethyl)-benzamid
rcsb
total genus 51
structure length 239
sequence length 239
ec nomenclature ec 1.3.5.1: Succinate dehydrogenase (quinone).
pdb deposition date 2010-02-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF13085 Fer2_3 2Fe-2S iron-sulfur cluster binding domain
B PF13534 Fer4_17 4Fe-4S dicluster domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1060.10 Mainly Alpha Orthogonal Bundle Fumarate Reductase Iron-sulfur Protein; Chain B, domain 2 Alpha-helical ferredoxin 3aecB02
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 3aecB01
3AE5B 1QLBB 3VR8B 1XLOA 1XLPA 3HUIA 2DBYA 4JWUC 1B9RA 3W5UB 3NVVA 3VRBB 1TJEA 3FAHA 1ZP0B 3BIID 2Y5CA 5C3JB 1VLBA 3AEDB 1JALA 1F0ZA 1RYJA 1T3QA 2LEKA 5AUIA 1JW9D 2L83A 1PDXA 3P4QB 1J7AA 1XLNA 5G5HA 1J7BA 2PVGC 1E9MA 4JWSC 1WRIA 3W9CB 1YQ3B 2WU5B 1N63A 1L6VA 4FXCA 2K9XA 2B76B 3DWMA 5AUKA 3WCQA 2W55A 1L5PA 5GXGB 1OQRA 4YT0B 1V8CA 1QT9A 1DOXA 1QOFA 3AEAB 1FXIA 2L52A 3ABVB 4HROA 2CJOA 5EE9A 1GAQB 2AX5A 1TKYA 3AE2B 3SFDB 1WXQA 3CWIA 2HTME 3AEEB 3EUB2 3KWLA 4JX1C 4P6VF 4ZHOA 2OHFA 1CZPA 3P63A 1TYGB 1SIJA 1L0VB 2W3RA 1JWAD 2PIAA 1RM6C 1NVID 3NVYA 4WQMA 3P4PB 1V97A 1PFDA 3P4SB 3NS1A 2MJEA 1FRDA 1FFVA 2QJLA 3AEBB 4YSZB 4YTNB 2WLBA 1SF0A 1SB3C 2G1EA 2KMMA 2Q5WD 5MPOA 1ROEA 2E3TA 2WP9B 2W3SA 1N5WA 1RWSA 1DOYA 1E6EB 1NYQA 4IDIA 4ITKA 2ACZB 3RPFC 1E10A 3PO0A 4USAA 1UWMA 2WS3B 2W54A 3AEGB 4YTMB 3L4PA 2WDQB 1JWBD 2MJDA 1FM0D 3AE3B 1FMAD 3AB5A 1FIQA 2JQRB 4YSXB 1FXAA 2WU2B 1H7XA 2WQYB 3NVZA 2WDVB 2M56B 3W5VB 3AE9B 2EKIA 4US8A 4YXDB 3AEFB 1TKEA 3HRDD 3VR9B 2BT6A 1PUTA 1GTEA 1N61A 1WWTA 2MH7A 2PKOA 4ZOHC 5EE0A 1J7CA 1OQQA 1QF6A 1E0ZA 3B2FA 1L6UA 1ZOYB 2N0SB 4A9AA 1YQ4B 2DWQA 3ETRA 1TKGA 3LXFA 1NYRA 4ZHPA 3AE4B 1ZXIA 3AM9A 1DOIA 1FO4A 1NENB 2FBWB 5H8YE 3AE1B 1YJIA 2M19A 1NEKB 2BS3B 1A70A 1FFUA 3CF4A 1N62A 3AN1A 1RFKA 1JRPA 1N60A 3DWGC 3AH7A 5H92C 3SR6A 3AE7B 4KX6B 1EWYC 1QOGA 2JX5A 1CJEA 1H7WA 1NI3A 2K22A 3HVZA 1DGJA 1GPXA 1GT8A 3AMZA 5G5GA 1OFFA 3AV8A 4YTPB 1QOBA 2H89B 1KFYB 1QOAA 5EE3A 1GTHA 2K5PA 4C7YA 3FC4A 1IUEA 4N58A 3CIRB 3P4RB 1I7HA 2PVOD 4WWMA 2CJNA 4C7ZA 4N59A 4C80A 2MJ3A 2H88B 1JROA 3NRZA 5EE1A 3B9JA 1KRHA 5C2TB 1ZUD2 1AWDA 2CU3A 1WYGA 1YJJA 1XLQA 1AYFA 2BS2B 1R7SA 1N5XA 1WGKA 3AECB 3NVWA 4LTUA 4N6EB 1VDVA 2BS4B 1XO3A 2KAJA 3LB8C 4HRSA 1KF6B 3P1MA 2WDRB 3AE8B 3SFEB 3B2GA 3AE6B 3VRAB 3ZYYX 4YSYB 1VJKA 1FRRA 4US9A 1JQ4A 2QIEB 1E7PB
chains in the Genus database with same CATH superfamily
2DYMA 2NS5A 2QILA 4K1RB 3Q69A 4RF1A 5LXHA 3N3KB 1PQSA 1RYJA 1T0RC 1V49A 3K9PB 3N9YC 2PVGC 4NQLB 3W9CB 1C77A 4DBGA 1L6VA 4WJPA 4IOIE 2M8SA 2Z8LA 4JLCA 3Q6BA 3T3OA 3RD2A 3IXSA 2J7QB 2WXHA 1TIFA 2NTSA 3RUIB 4WQMA 1NDDA 2QJLA 5E6OA 1ZXHA 4L1BA 2HE7A 1BUIC 3RULA 4HK2A 1YX6B 2MCNB 3VDZA 3A33B 4G50A 4M8NA 3PO0A 2K8BA 4GOCA 3QC8B 4S0RA 4A55A 4K7UA 4W9IA 3R8BA 4TV3A 1E8ZA 3U2SC 3DQVA 2GBKA 3D32A 2BT6A 1HXYD 2QHOA 1YQ4B 3DHIC 1H4RA 3N20C 4EZJA 1ET6A 2LRUA 4OZBA 2BS3B 2DX5B 3A1QB 1JWUD 2MBOA 2KVRA 3VUYA 1UH6A 2Y5BB 3QAQA 1GNUA 4BZAA 4X57B 3TEWA 2K6DB 1YD8U 2LRWA 2IGHA 3CF6E 1JROA 2INCC 3O13A 4GU2A 1WM2A 4MSMB 2BW2A 4IC7B 2D2QA 1FEHA 1Y8RC 3JSVA 4KSLC 2VH2A 5BMGA 2N9EB 1IPGA 3A9JB 3W5UB 1L2NA 3NVVA 5LXIB 1Y56A 3BZDB 2PTLA 1IGDA 1UBQA 3A9KB 2BYEA 2CHZA 1WRIA 1WGHA 2W55A 2WXJA 3KYCD 3IT4B 3NG0A 1DOXA 3B0AA 4NAWA 4OVVA 3DVNV 1E7UA 3VUWA 4P6VF 1D5ZC 1CZPA 2CS4A 1ZKHA 4JPSA 1R4MI 4NNJB 3RYTA 2IZVB 3ONSA 1L7YA 4W9DA 1MPEA 4P7IA 1JWBD 3W2DA 3WA0A 4LDTB 2BKRB 1UF0A 3MP9A 3OJ3A 1I4HA 1WH3A 3VAWA 3WAPA 3KWVA 2ON8A 2N0SB 2N1WA 2MHJA 1C4CA 5G2NA 3I3TB 1QQRA 2WGSA 1RFKA 1WRDB 4FJYA 4E74A 4KKJA 4A20A 2LHEA 4IM3A 4GGQA 1KTKA 4RMAA 2G45B 5G5GA 2DLBA 5TSSA 1BT0A 1SE3A 1KH0A 2K5PA 3RNGC 3NZ3A 2MLBA 4EZLA 1EWCA 3PGEA 2H88B 3BK2A 4LNIA 5JZEB 2WDTB 3C0RB 1AWDA 1QKZA 1VZ6A 2K6QA 1FCCC 1XD3B 1Q5WB 3Q3NC 5FR3A 4ANVA 1HA5A 1TZOA 1E7PB 2LXCA 1XLPA 4EUTA 2G4DB 3FAHA 3ZQ4A 4S17A 4DXFA 4M02A 4KIKB 2PE6B 1ET9A 4MJSA 1XLNA 2V9HA 4ZRQA 1GC6A 3DCGA 1LGRA 4HLEA 1L5PA 2I2YA 2K8CA 4CQNA 2LFIA 4AUQC 2FUG1 2L52A 2HTME 3T3NA 4GDLA 1EU4A 2O6VD 2DAFA 1JWSD 2L8JA 1NVID 3DDCB 4M8MA 1V1PB 2ASQA 3MFGA 3N1YC 2AL3A 2K25A 2A4ZA 4DWFA 3BVGA 4MEMA 4LDTD 1WGGA 2V3NA 4TQ0A 3CSTA 4B6WA 3BYTB 3APDA 4LJPB 4ANUA 4YSXB 3DBSA 1IGCA 2UU7A 3W5VB 4IWPA 4YXDB 1I4QA 3VTWA 2WXRA 1D5XC 2L32A 2WXQA 4HCPB 4RF0A 1WJUA 1FFUA 1RRBA 1N60A 4ZYSA 5H92C 2L05A 2KT7A 3I9V1 4C4VB 3AU5A 2R2OA 2LGDA 3AV8A 5EE3A 2XK5A 5CX3A 4IWQA 3CIRB 2I38A 1YMHE 1I4PA 3TEXA 3LJ3A 1T6BX 2L76A 1AYFA 2FIDA 3KUCB 4N6EB 4NPNA 1YN3A 2WXMA 2PE9A 2INDC 3AE6B 3B2GA 5FKAC 1GG3A 5C23A 4PK1A 4E71A 5LNK1 4AS1A 1B9RA 2IJ0A 2INPE 3BIID 3UINB 3I5JC 4HEA1 3IAS1 4G11A 4W9EA 3AEDB 1JALA 1JW9D 1FD6A 4HVBA 3RZWC 3PLUA 2KC1A 1ZDXA 3M62B 2PW9A 3OJ4B 3FILA 4MH8A 5AZGA 4HPMB 3ZRCA 4JGHB 2L7RA 2IDYA 4RM8A 2W3RA 3Q8CA 2RDGA 3ZRFA 1PFDA 2RDHA 1YOVB 1YX5B 3U52E 3HK0A 1SF0A 3R66C 5IOIA 1HTQA 5MPOA 2JWUA 2GB1A 1V86A 4DDID 3QHTA 2W3SA 4RH6A 4P1CC 1RWSA 2WXGA 3UI3A 4ITKA 2WS3B 1MG8A 2MJDA 2WXPA 3DBHI 4AWJA 1H7XA 2LUMA 3EECA 2KX0A 1MI0A 1FNWA 3APFA 2LJ5A 1OGWA 3DBRI 3PV1A 3X0WA 1UGMA 4MACA 3LXFA 3TJPA 4ZHPA 2RD0A 2ZW1A 1FO4A 2M19A 3BWUD 3IBEA 1JRPA 4BOZB 1VZ7A 4BVUC 1XT9B 3RZFA 1GPXA 3AMZA 2XEWA 1LQBA 1KFYB 3JSVB 2L0FA 4FULA 3KUDB 2RPVA 2NMQA 3QWZB 3RNFC 1IBXA 1WGKA 1VDVA 2KAJA 2D10A 2BYTA 5DPTA 2JZZA 1EM7A 2WNMA 2JRIB 4NAWB 4ICVA 3NS8A 4MM3A 1FXTB 4ZYNA 1UELA 1T3QA 3UGBB 3PS6A 5G55A 2JXTA 1NI2A 2V3SA 4AJYB 4ICUA 3WCQA 2N9KA 1I4RA 1ZE3D 1MJDA 4B0MA 4YT0B 1CQVA 1QT9A 3KLSX 2DAJA 1SGHA 1BXTA 3KW5B 2LHDA 2OJWA 4NQKE 4OW0A 3DVGX 4UDUC 3H8HA 1SE4A 4DXGA 2NTTA 3Q3FA 2KJHB 5JHBA 2KMMA 2YVCA 2LGXA 2KFKA 1F1HA 4ARIA 3AEGB 1WXSA 2FCMA 1SBBB 2WQYB 4B95A 1EF1A 4EEWA 2HD5B 1JMLA 1WGYA 2E6XA 2LVQA 3TIXA 4WJOA 4HKZE 3Q8AA 2C9WB 1ZXIA 3PREA 3AE1B 3H9DA 4M01A 1ESFA 1C4AA 3EFUA 3DWGC 3QA8A 2K22A 2OJRA 1SJHD 3E9SA 3RT3B 1GTHA 4C7YA 2N9XA 2BF8B 4PT5A 1OEYA 3BINA 4DDGD 4HDOA 2CU3A 2BS2B 1EU3A 1UGJA 4MJSB 3PZDA 1XO3A 1Z2MA 1KLUD 1KJTA 1FCLA 1WR1A 3PVLA 4F8CB 2KX3A 1E8YA 2R2QA 3HUIA 4WQOB 2CKHB 4GDLB 4WWPA 3R2TA 4XZ4A 2IPKD 4IG7B 1J7BA 3UQBA 4RGOS 5AEKB 3N32A 3N1ZC 3IHPC 4DHZE 1VD2A 4B9KA 3EGRA 2KMCA 2C60A 4HROA 1WXQA 2JF5A 3KWLA 2AQ2B 4JX1C 1L0VB 3OG5A 1RM6C 2KDBA 3RFZB 3DBHB 2IGGA 2ZVNA 3TCAA 1WZ3A 2G1EA 4EE2A 3S2AA 1ROEA 4TMAB 3APCA 3DBRB 4ANXA 1LXDA 4LNNA 3W1YA 2HJ8A 2KOXA 2VH1A 1OEYJ 1GJZA 2ONQA 1OTRB 2B3AA 1TGZB 4DHJD 4K7SA 4URKA 2INNE 2J53A 4KGTA 3VR9B 1A5RA 1N61A 1E0ZA 2LXAA 3QCAA 1WJ6A 4RFBA 4FN2A 2XK5B 2JU6X 1E7VA 2KFJA 2GMIC 1K53A 1VRAB 3AN1A 2BWFA 1NBFC 2KVZA 2GLSA 2KZRA 4LJOB 2JY6A 3AE7B 1H7WA 1NI3A 2MSED 3L13A 3VTVA 1YJ1A 2K3UA 2SAKA 3NOBA 5HI1A 4PS7A 3FC4A 1GB4A 2C7NB 2MJ3A 2BQQA 5EE1A 3ZJTA 3QQ8B 1D5MC 3ML9A 4XGAB 3ZYYX 1G6JA 2KDIA 2BTEA 1C76A 2D3BA 3Q8FA 3HIZA 2LGSA 5BYRA 3FILB 4G3XB 4ZRIA 3AXCA 4L23A 2MBBB 2LEKA 1PDXA 1FNVA 2WWZA 3L54A 3NZSA 4ZRPA 1P1AA 4FXCA 1D3ZA 2LD9A 2W9NA 1V8CA 1FXIA 3ABVB 3IVFA 5E6NA 3SFDB 3MC8A 5D6JB 1LM8B 3ML8A 4ZHOA 2PIAA 5C1ZA 3P4PB 1FRDA 1V9JA 3DOWA 5LLIA 2JRHA 1WZ0A 2MQJA 3SEBA 1I42A 1HZ5A 2IO1B 1T5XD 3VXWA 3PZ8A 2KLCA 4LNKA 1WXMA 4USAA 1B1ZA 2KTRA 4GXBA 2EMSA 4LLGM 3NZUA 4II2B 4IKGA 1ISNA 3KQ4A 3NVZA 2WDVB 4LNFA 3AEFB 4GDKA 1L6UA 2VRRB 1SIFA 3Q8EA 4KZ0A 4AJWA 4XWTA 3AE4B 3KUZA 5TR5A 1JQ4A 3CF4A 3KVFB 2BB6A 4IWOA 4OHJA 1IBXB 4R3DA 2MRPA 3HVZA 1V5OA 3PTFC 5D3IB 3UQAA 2M17A 1MHHE 4N58A 1I7HA 4WWMA 3NJTA 4MM3B 1TS4A 3ZDTA 1I4GA 2J42A 1YJJA 1AW7A 1EUVB 3PRPB 5I4DA 3ZO5B 1C78A 2N7EA 2N9PC 1J0GA 4KVGB 1QLBB 4RCOA 2L00B 1WI0A 3Q2AC 2ZJDA 4HCNB 4WIPA 5IA7A 4W9JA 2V1YA 2KDEB 2L0TA 4HJKA 3IAM1 1VR9A 3ZNGC 3PT2B 1JRUA 2WHIA 4A90A 3K9OB 2KFKB 4ZRJA 4MGIE 2J52A 2WXNA 1TYGB 1JWAD 2Z0DB 2K8HA 2M0AA 1FNUA 3I63C 4IM2A 2Q5WD 3TSSA 1P9DU 1S1QB 4QAYA 4XE0A 2G3QB 2Y5PA 1F2RI 1E5WA 2LUEA 4ZRKA 1ZW7A 4W9KA 2KWUB 3HM3A 2PEAA 1XF5L 3ZJVA 5IAAC 2Z0EB 4ZOHC 5EE0A 1J7CA 1ZGUB 4IW0A 4A9AA 3ZLZA 2NPTA 2N9LA 4NAMA 1YQBA 2D07B 3UF8A 3MC9A 2ZCBA 3B1LX 3GOEA 2IBIB 1GC7A 2HDEA 3ZW3A 1CK1A 3GZNI 5E6PA 4K81A 2ZCCA 5AZFA 1CJEA 1V80A 3RCZA 1TY0A 2R61A 4LK0M 3DHGC 2KWDA 1F9JA 4C7ZA 3MJ5A 4YL8A 2K0PA 1K50A 2J4XA 1P7FA 2KHWB 2LASA 3AI5A 1UNSA 2MA9B 4A8XC 4MELA 2QSDA 4JWUC 1V81A 2NVUI 3VRBB 2D5GA 3V05A 2Y5CA 4GMVA 3BYYB 5DCNA 2L83A 1J7AA 5JH5C 4JWSC 1WF9A 4ASWC 2B76B 1HEZE 4WJQA 2KXJA 4DXAB 5GXGB 3TMPB 3V60A 4IUMB 3AE2B 4AQ7A 1HTOA 2PMVA 2WXFA 3FKYA 5D7GA 2C7HA 3NS1A 2KQ7A 3L17A 1AARA 2J0KA 4K7WA 3TBLD 1RLFA 1DOYA 1R4MB 2ACZB 3W1SA 3WALA 2RGFA 1K51A 1WM3A 4MSQB 1UZXB 3KYDD 3VTUA 1FIQA 2SEBD 2LI5A 4FA6A 2MP2A 4KGRA 3U30A 3UIOB 1VCBA 1TS2A 2MH7A 1YNTE 1F77A 1WY8A 4HJGE 3BY4B 2WXKA 1NYRA 1SEBD 1U4AA 3Q8BA 1NENB 3UIPB 4RGTA 2IYDB 3M63B 3OAWA 1X1MA 1Z5SB 1EWYC 5D94A 4GSWA 4REZA 2N7JA 2FNJB 3ZJUA 1FPYA 2J0JA 4FBJB 3P2BA 2X38A 1ZUD2 1SXTA 2ZPYA 3AU4A 4KV2A 3N1XC 3NVWA 3Q3OC 1D4BA 3R7RA 4KKIA 4NY0A 4KDIC 4I6PA 2N1VA 2DZIA 3U8ZA 4NJCA 4C56C 1MHXA 2WXOA 1ZP0B 1MG4A 5FK9C 1F0ZA 4NZLB 3T8MA 3P4QB 5G5HA 5DPRA 3ZDMC 1SSNA 2MEKA 2LJIA 2CU1A 1WFYA 1CMXB 2O6VA 3U7DA 1P0RA 4XYCA 4JL9A 1BMLC 2KTRB 2OHFA 2BVCA 3TL5A 1K8RB 4GB9A 1KLGD 4YSZB 3M95A 5DPWA 2LGYA 3A4RA 4GDKB 2ZW0A 3IFWB 2QEJC 4BBNC 2CHXA 2KC2A 4W9HA 2PJHA 1SJED 4OZAA 1E10A 2ZVOA 3VH3B 2V0GA 1IYFA 2JVCA 4TKNA 2BKFA 3HVDA 3ZKJC 3HM6X 1C1YB 1FXAA 4O1NA 4BKGA 2EKIA 1WWTA 2GOWA 1QF6A 4XWWA 1T0SC 2JUOA 3BVMA 1TT5B 2PPHA 5D2MB 1DOIA 4PYZA 2XN9C 1WXAA 2AYOB 1L4ZB 2KLGA 1QOGA 3ECIA 1DGJA 2FE8A 1LFDA 2NBWB 4YTPB 4CYEA 2H89B 3EA6A 1JCKB 4TUUA 2BWES 2XNAC 2G4SA 2CR5A 2DNFA 1KRHA 5C2TB 2FCSA 2I1JA 2ZEQA 2QCZA 4A3OA 1L4DB 3QARA 4HRSA 2UWQA 3P1MA 2WDRB 3L08A 2JWZA 1N6ZA 3PRZA 4KZCA 4YSYB 3SDLC 3VFKA 3IG3A 2V4IB 3Q3JA 4F1SA 2LVOA 3DBLI 1J19A 3PHWB 4I6LB 3SU8X 1EO6A 1C4PA 1VLBA 2IGDA 1WX8A 4WJNA 3Q14C 5AUIA 1WR6E 1WJNA 1P7EA 1TS5A 1E9MA 2BYVE 1YQ3B 2WU5B 1E8WA 3DWMA 4BFRA 5AUKA 4AOFA 5KHQA 1OQRA 2WX0A 3ENEA 5D3DA 4P16A 3GE3C 3ZGZA 2LZ6A 3CWIA 2MX2A 3EC8A 4EFOA 2W82A 2BGFA 2EELA 3QJZA 3WAMA 1V97A 3SD5A 2MJEA 3C8YA 3L10B 2NPTB 4GLSC 2MWSB 3GE8C 1WJ4A 2K1FA 1KM7A 4M00A 2CHWA 4GN1A 3AE9B 1TKEA 1P3QU 1R4NI 3RI7C 5AZHA 1TKGA 4K3BA 1MFWA 2C7MB 4BKSA 3WAOA 1I35A 1IP9A 1I4XA 4W9GA 1GB1A 3NUHB 1C9FA 1QOBA 3O65B 2LVPA 2KTFA 4N59A 4WH4A 2WXLA 2K39A 1XLQA 2FCNA 4BKTA 1KF6B 4HPLB 3AE8B 3SFEB 4YWGG 3JYUA 2PLPA 4US9A 2EMTA 3RNBC 3TEYA 1GOZA 1S3SG 3NHEB 1L0YB 4BOSC 3L0WB 5HFYA 2KDFB 1OQYA 1STEA 1TS3A 3WIMA 1C79A 1WX9A 2MBHA 2AWTA 3ALBA 4J3OD 4NJ6A 2N7DA 2QDFA 3U7ZA 3IT6B 5EE9A 1TKYA 3JW0X 3TUOA 3EUB2 3ZNHB 3E56A 3T9LA 3VUXA 2YEPB 3P63A 2UYZB 4XC2A 4MGYE 5IO9A 4RGNA 3ZTDA 2TSSA 3W1SC 2REXA 4WAAA 2MP2B 1SB3C 2AL6A 2E3TA 1ACCA 4FJZA 4M0WA 1SE9A 4IDIA 2FCQA 2JPHA 4HXDA 2JT4B 3AB5A 1M94A 4US8A 4HKQA 3H7SA 2X8XX 1OQQA 4C00A 4W9FA 2MW5A 5CHWA 3JVZX 4RGMA 3V3XA 2KN4A 2IY0B 3QX1A 5CHFA 3OLMD 1GT8A 2KKCA 4KSKC 2Y3AA 1QOAA 3AULA 1F52A 3LYYA 3KH0A 3EFCA 3DBLB 4HWIB 3NRZA 3QK0A 2EKEC 3H7PA 1R7SA 4I6NB 3AECB 3ZVVA 3VRAB 1VJKA 2GI9A 3DVGY 4KDLB 1HQRD 5IN7A 3R3MA 2QIEB 4C80A 5J2RA 2OOBB 5BO4B 5KHOA 3AE5B 3VR8B 1V5TA 2DBYA 2O6VB 3MJWA 5C3JB 2BYFA 3L16A 1YN4A 1V6EA 4EZKA 2JXXA 1WMHA 3ZNZB 1RAXA 1UWXA 3AEAB 2CJOA 2L1AA 2JSVX 5JHAA 3X23A 3GS2A 4GIVA 1GUAB 4EKUA 3NY5A 1FFVA 4OVZA 2O2VA 4A3PA 5IKCM 4ZDVA 2DHZA 4TQ1A 1R4NB 4MT5A 1NYQA 4BBNF 2D3CA 1PGAA 2WDQB 1FM0D 3AE3B 4RNAA 1PYWD 4WWOA 4LNOA 1H8CA 2LMCA 2DENB 2JZ3B 5HHDG 2PKOA 2M4NA 3H6NA 3ETRA 3DHHC 1V2YA 2VZKB 1WE7A 2FBWB 2ZNVB 5H8YE 2NR2A 2KWCA 2YLMA 2JX5A 1Q10A 4EOYA 1E8XA 2M1MA 2ZNVC 2KMAA 2MBEA 1K52A 2WXIA 2BPSA 1IUEA 4ACFA 2CJNA 4DK5A 1KOTA 4H2AA 4DQOC 2M0XA 3URYA 4RM9A 2LWPA 3V62A 4XX5A 1HZ6A 1UD7A 4P1BC 1P98A 2V4LA 3PZ7A 3HHMA 3SHQA 2AEHA 1WYWB 2LGIA 5L95C 4G0NB 2D3GA 4A6QA 4PYUA 1MVKA 3RNCC 3LDZE 5DPSA 4CO7A 2K9XA 1LO5D 2KNBA 2Z59B 2RR9A 2WYQA 2AQ1B 1QOFA 2RDBC 1GAQB 5J18A 1UBIA 2OEDA 5BYQA 1SIJA 2MBQA 4W9LA 4D2KA 3PSEB 2BBCA 5GMVA 5J17A 2G9HD 4BAXA 3U4EG 2JZPA 1XEEA 3RPFC 1AN8A 3PPAA 5JXVA 2RPQA 1FMAD 2KO3A 3DVNU 5T8IA 5BMIA 3PHXB 2QC8A 2VZKD 4WWNA 2GRIA 2D3AA 4JQWC 1WX7A 1TTNA 2IO3B 1YJIA 3VH4B 2KN5A 3GP7A 4KX6B 2JYEA 2GBRA 2FIFA 3R2IA 1OFFA 5CHVC 4F7ZA 1TBEA 5BYSA 2KDMA 3EHVA 2KACA 3P42A 4W9CA 3B9JA 3MTNB 4J6IA 3V6EB 3A1QA 2N4FA 2DZJA 3DPDA 3ZTCA 1WYGA 3C19A 1ZDVA 3RMKC 3LB8C 1J8CA 1WXVA 3CMMB 2KYWA 2D11A 2ZZPB 1XLOA 4HDQA 4XDDA 4L2YA 3GB1A 4AP4C 2XBBC 2RSUA 3BK1A 4KGSA 4LCDE 2ICIA 2GBMA 3ZXRA 3ZUNA 1KLVA 1TZ1A 2IO0B 1E90A 3Q3MC 3BVZA 4FHKA 3J9CA 3A9JA 5HKHA 4ARCA 4M0WB 2KD0A 1V1OA 2RMMA 1XCTL 1VZ8A 3A9KA 1DYQA 4WAFA 3NVYA 1Q0WB 3TEZA 2KANA 3AEBB 4JE3B 2WLBA 2YEPF 1N5WA 1E6EB 1QZEA 4Q2JA 4BKSD 2W54A 3ZNID 2V3PA 2JQRB 3HRDD 3WANA 4MGKE 2JYTA 1ZOYB 2ZPNA 1F2RC 2J0MA 2NBUA 4NJ7A 3AM9A 3A4SC 4K3CA 3SR6A 3H7PB 4DHZB 4PS8A 3V6CB 1XQQA 3GZNB 3PRMB 5HG2A 1T0QC 2KJRA 3P4RB 2PVOD 4CHKA 2AQ3B 2KQSA 1Q1OA 2WX1A 4E3CA 2IY1B 3MC0B 1D6EC 3CSFA 2IO2B 1N5XA 4LTUA 2BS4B 4JIOU 2I1KA 1QILA 3MHSD 3VHTC 3M3JA 2DYBA 1WMHB 2C5LC 2FUHB 5IP4D 1SE2A 1TJEA 4TSSA 2L3ZA 2KWVB 1L0XB 2FAZA 2KQ4X 1N63A 2DYOA 1JWMD 4MH0E 1RFAA 2O2VB 4OVUA 5FR6A 4MGZE 2AX5A 5E6JA 2NBVB 3AEEB 2NCNA 3N30A 2KK8A 4KIKA 5BMHA 5L83A 2DZMA 2A5UA 4ANWA 4DHJB 4FADA 4FJVB 1PGXA 3P4SB 3ZXVA 1C3TA 4YTNB 3ZIMA 4PS3A 4B0EA 3H1UA 1WGDA 1UUPA 2WP9B 2BB5A 1EF5A 1UWMA 3MHZA 1WSPA 1ZPSA 4YTMB 3RN9C 3L4PA 1ENFA 2WU2B 2M56B 1PGBA 1V1PA 4WURA 2DZKA 5EDSA 3R7QA 1PUTA 1GTEA 3B08A 3B2FA 2HJ1A 3RNAC 2DWQA 2QMTA 1XXGA 1TY2A 2GBJA 5CTRC 1NEKB 1A70A 1HE8A 1N62A 1XCQL 3AH7A 1M4VA 2GBNA 4HPPA 1WIAA 4FLHA 4IM0A 3VQIA 1YIWA 2KJ6A 3PLVA 1T0YA 4II3B 4MDKE 4XDCA 1YN5A 3V61A 1WGRA 2HTHA 1WE6A 4FHJA 4N9F4 4C4VA 3QIJA 3VVWB 3I57A 1FRRA 3RNEC 3OWEB 4OZCA
chains in the Genus database with same CATH topology
2DYMA 3AE5B 3VR8B 2QILA 4JWUC 4NAWB 2DBYA 3VRBB 2D5GA 3Q69A 3V05A 2Y5CA 4RF1A 5C3JB 1RYJA 1T3QA 3BYYB 2JXTA 2L83A 1J7AA 1YN4A 3N9YC 2PVGC 4JWSC 3W9CB 1C77A 1L6VA 3WCQA 2N9KA 2B76B 1HEZE 1I4RA 1ZE3D 4IOIE 4B0MA 2Z8LA 5GXGB 4YT0B 1CQVA 1QT9A 1UWXA 3KLSX 3AEAB 2CJOA 2L1AA 3AE2B 3T3OA 2JSVX 4AQ7A 1BXTA 2LHDA 3IXSA 2PMVA 2WXFA 4OW0A 4UDUC 3GS2A 2WXHA 5D7GA 3H8HA 2NTSA 4WQMA 1SE4A 4DXGA 3NS1A 1FFVA 2NTTA 2QJLA 4OVZA 1ZXHA 4L1BA 2KMMA 1BUIC 1DOYA 4TQ1A 4MT5A 1NYQA 2ACZB 3W1SA 3PO0A 1PGAA 4ARIA 3AEGB 1K51A 2WDQB 1FM0D 4A55A 3AE3B 1SBBB 4RNAA 3R8BA 1FIQA 1PYWD 2SEBD 3U2SC 2WQYB 2LMCA 4KGRA 2BT6A 1TS2A 2PKOA 5HHDG 2MH7A 1YNTE 1HXYD 1JMLA 2E6XA 1F77A 1YQ4B 4HJGE 3ETRA 2WXKA 4HKZE 1NYRA 3Q8AA 1SEBD 2VZKB 1ZXIA 1ET6A 3Q8BA 1NENB 2FBWB 4OZBA 3AE1B 4RGTA 5H8YE 2BS3B 1C4AA 1ESFA 1JWUD 3DWGC 1EWYC 2JX5A 1Q10A 2K22A 1SJHD 4REZA 2N7JA 3E9SA 3ZJUA 1K52A 2WXIA 3TEWA 1GTHA 4C7YA 1IUEA 2CJNA 2IGHA 2X38A 1JROA 4PT5A 4H2AA 4DQOC 1ZUD2 1SXTA 3URYA 2CU3A 3O13A 2BS2B 1EU3A 1UGJA 3NVWA 1D4BA 1HZ6A 1XO3A 4KKIA 2BW2A 3PZ7A 1KLUD 1FEHA 1FCLA 2LGIA 5BMGA 4NJCA 4C56C 3HUIA 1MHXA 4A6QA 2WXOA 1MVKA 3W5UB 3NVVA 1ZP0B 1Y56A 4GDLB 5FK9C 3R2TA 1F0ZA 4NZLB 2IPKD 3BZDB 2PTLA 1IGDA 3P4QB 5G5HA 1J7BA 4RGOS 1WRIA 2K9XA 2WXJA 2W55A 1LO5D 3IT4B 1SSNA 2MEKA 2LJIA 1DOXA 2AQ1B 1QOFA 3EGRA 4HROA 1GAQB 1WXQA 2AQ2B 3KWLA 4JX1C 4P6VF 1BMLC 2OHFA 1D5ZC 2OEDA 1CZPA 5BYQA 1SIJA 1L0VB 1RM6C 4JPSA 4D2KA 3RFZB 2IGGA 1KLGD 2BBCA 4YSZB 2G1EA 4GDKB 4EE2A 2G9HD 2ZW0A 1ROEA 4TMAB 2QEJC 3U4EG 2JZPA 1SJED 1XEEA 4OZAA 3RPFC 1E10A 1MPEA 2V0GA 1AN8A 5JXVA 1JWBD 2ONQA 3W2DA 1FMAD 3HVDA 1FXAA 3MP9A 4O1NA 1I4HA 2EKIA 2INNE 2J53A 4KGTA 5T8IA 3VR9B 5BMIA 1N61A 1WWTA 1E0ZA 1QF6A 3KWVA 2VZKD 2ON8A 2N0SB 4RFBA 4XWWA 2JU6X 2GRIA 3BVMA 1C4CA 1DOIA 1K53A 1QQRA 1YJIA 2XN9C 1VRAB 3AN1A 1RFKA 1L4ZB 4KKJA 3GP7A 3AE7B 4KX6B 1QOGA 2LHEA 1H7WA 1NI3A 1KTKA 1DGJA 2FE8A 2JYEA 5G5GA 3R2IA 1OFFA 2DLBA 4YTPB 5TSSA 1SE3A 2H89B 3EA6A 1KH0A 1JCKB 2K3UA 2SAKA 5HI1A 2K5PA 2XNAC 5BYSA 3FC4A 3NZ3A 2KDMA 2KACA 3P42A 1GB4A 1EWCA 4C80A 2MJ3A 2H88B 5EE1A 3B9JA 3ZJTA 1KRHA 3BK2A 5C2TB 1AWDA 1WYGA 1QKZA 1ZDVA 1L4DB 1VZ6A 3LB8C 4HRSA 3P1MA 2WDRB 1FCCC 1D5MC 3ZYYX 4YSYB 5FR3A 2BTEA 1C76A 1HA5A 3Q8FA 2V4IB 1TZOA 1E7PB 1XLOA 1XLPA 4XDDA 3FAHA 3ZQ4A 4L2YA 1C4PA 3FILB 3GB1A 5BYRA 4DXFA 3BK1A 1VLBA 2IGDA 4L23A 1ET9A 2LEKA 5AUIA 1P7EA 4KGSA 1TS5A 1PDXA 1XLNA 2ICIA 1FNVA 4ZRPA 4ZRQA 1E9MA 1YQ3B 2WU5B 4FXCA 3DWMA 5AUKA 1L5PA 2I2YA 1OQRA 1V8CA 2LFIA 4CQNA 2FUG1 1FXIA 2L52A 3BVZA 3ABVB 3J9CA 5D3DA 4P16A 3ZGZA 4ARCA 3SFDB 3CWIA 2HTME 3T3NA 1EU4A 1V1OA 2RMMA 1JWSD 4ZHOA 1XCTL 2W82A 1VZ8A 2PIAA 4WAFA 1DYQA 2EELA 1NVID 3NVYA 3TEZA 3P4PB 1V97A 2MJEA 1FRDA 3C8YA 3AEBB 1V1PB 2WLBA 4JE3B 2YEPF 3MFGA 3SEBA 1N5WA 1E6EB 1HZ5A 1T5XD 3BVGA 3PZ8A 4GLSC 4USAA 4Q2JA 1B1ZA 2V3NA 2W54A 4LLGM 4TQ0A 3BYTB 2V3PA 4IKGA 2JQRB 4YSXB 3KQ4A 1IGCA 3W5VB 3NVZA 2WDVB 3AE9B 4YXDB 3AEFB 1TKEA 3HRDD 2JYTA 1L6UA 1ZOYB 1I4QA 1F2RC 2WXRA 3Q8EA 1D5XC 1TKGA 2L32A 4XWTA 3AE4B 2WXQA 3AM9A 4RF0A 1JQ4A 1FFUA 3CF4A 1N60A 2BB6A 4ZYSA 5H92C 3SR6A 4OHJA 1IBXB 3I9V1 4R3DA 1I4XA 3HVZA 1GB1A 3NUHB 3AV8A 1C9FA 5D3IB 1QOBA 5EE3A 5HG2A 1MHHE 4N58A 3CIRB 2I38A 3P4RB 1I7HA 2PVOD 4WWMA 2AQ3B 1YMHE 4N59A 4WH4A 1I4PA 2WXLA 3TEXA 4MM3B 1T6BX 1TS4A 1I4GA 3MC0B 1D6EC 2J42A 1YJJA 1XLQA 1AYFA 1N5XA 1AW7A 4N6EB 4LTUA 2BS4B 1YN3A 1KF6B 2WXMA 3AE8B 3SFEB 4YWGG 5I4DA 3B2GA 3AE6B 5FKAC 1C78A 2PLPA 1QILA 4US9A 5LNK1 3TEYA 1GOZA 1QLBB 4AS1A 1B9RA 2IJ0A 4RCOA 1SE2A 1TJEA 1L0YB 4TSSA 2INPE 3BIID 4HEA1 3IAS1 3AEDB 1JALA 5HFYA 1JW9D 1STEA 1TS3A 1FD6A 1C79A 4J3OD 4WIPA 1L0XB 2KQ4X 1N63A 2DYOA 1JWMD 3IAM1 3U7ZA 1ZDXA 1VR9A 3IT6B 4A90A 5EE9A 2PW9A 2AX5A 1TKYA 5E6JA 3TUOA 3EUB2 3AEEB 3FILA 4MH8A 3E56A 5BMHA 2J52A 2IDYA 2WXNA 2YEPB 3P63A 1TYGB 2W3RA 1JWAD 3Q8CA 2RDGA 1PGXA 4RGNA 1PFDA 3P4SB 2M0AA 2TSSA 2RDHA 3U52E 1FNUA 4YTNB 1SF0A 1SB3C 4B0EA 5MPOA 2Q5WD 2JWUA 2GB1A 3TSSA 1UUPA 2E3TA 2WP9B 2W3SA 1ACCA 4RH6A 1RWSA 2WXGA 4XE0A 3UI3A 2Y5PA 1F2RI 4M0WA 4IDIA 4ITKA 2BB5A 1UWMA 3MHZA 2WS3B 1WSPA 1ZPSA 4YTMB 3L4PA 2MJDA 2WXPA 3AB5A 1XF5L 1ENFA 2WU2B 1H7XA 3ZJVA 2M56B 1PGBA 4US8A 1V1PA 2LUMA 4WURA 4HKQA 1MI0A 1PUTA 1GTEA 1FNWA 4ZOHC 5EE0A 1J7CA 1OQQA 3B2FA 4A9AA 2DWQA 2N9LA 2QMTA 4MACA 1XXGA 1TY2A 3LXFA 4NAMA 4ZHPA 2ZW1A 1FO4A 2M19A 3BWUD 1NEKB 1A70A 4RGMA 2HDEA 1N62A 2KN4A 1XCQL 3V3XA 1CK1A 1JRPA 3AH7A 1M4VA 1CJEA 1VZ7A 1GPXA 1GT8A 3AMZA 1TY0A 3VQIA 2R61A 2Y3AA 1KFYB 1QOAA 4LK0M 3LYYA 4XDCA 1YN5A 2KWDA 4C7ZA 3MJ5A 3NRZA 2K0PA 1K50A 2J4XA 2RPVA 1P7FA 2NMQA 1IBXA 1WGKA 1R7SA 3AECB 1UNSA 1VDVA 2KAJA 2BYTA 4A8XC 2QSDA 3VRAB 3I57A 1VJKA 2GI9A 1FRRA 1EM7A 2WNMA 1HQRD 2QIEB 3OWEB 4OZCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3AE5 B;  1QLB B;  3VR8 B;  1XLO A;  1XLP A;  3HUI A;  2DBY A;  4JWU C;  1B9R A;  3W5U B;  3NVV A;  3VRB B;  1TJE A;  3FAH A;  1ZP0 B;  3BII D;  2Y5C A;  5C3J B;  1VLB A;  3AED B;  1JAL A;  1F0Z A;  1RYJ A;  1T3Q A;  2LEK A;  5AUI A;  1JW9 D;  2L83 A;  1PDX A;  3P4Q B;  1J7A A;  1XLN A;  5G5H A;  1J7B A;  2PVG C;  1E9M A;  4JWS C;  1WRI A;  3W9C B;  1YQ3 B;  2WU5 B;  1N63 A;  1L6V A;  4FXC A;  2K9X A;  2B76 B;  3DWM A;  5AUK A;  3WCQ A;  2W55 A;  1L5P A;  5GXG B;  1OQR A;  4YT0 B;  1V8C A;  1QT9 A;  1DOX A;  1QOF A;  3AEA B;  1FXI A;  2L52 A;  3ABV B;  4HRO A;  2CJO A;  5EE9 A;  1GAQ B;  2AX5 A;  1TKY A;  3AE2 B;  3SFD B;  1WXQ A;  3CWI A;  2HTM E;  3AEE B;  3EUB 2;  3KWL A;  4JX1 C;  4P6V F;  4ZHO A;  2OHF A;  1CZP A;  3P63 A;  1TYG B;  1SIJ A;  1L0V B;  2W3R A;  1JWA D;  2PIA A;  1RM6 C;  1NVI D;  3NVY A;  4WQM A;  3P4P B;  1V97 A;  1PFD A;  3P4S B;  3NS1 A;  2MJE A;  1FRD A;  1FFV A;  2QJL A;  3AEB B;  4YSZ B;  4YTN B;  2WLB A;  1SF0 A;  1SB3 C;  2G1E A;  2KMM A;  2Q5W D;  5MPO A;  1ROE A;  2E3T A;  2WP9 B;  2W3S A;  1N5W A;  1RWS A;  1DOY A;  1E6E B;  1NYQ A;  4IDI A;  4ITK A;  2ACZ B;  3RPF C;  1E10 A;  3PO0 A;  4USA A;  1UWM A;  2WS3 B;  2W54 A;  3AEG B;  4YTM B;  3L4P A;  2WDQ B;  1JWB D;  2MJD A;  1FM0 D;  3AE3 B;  1FMA D;  3AB5 A;  1FIQ A;  2JQR B;  4YSX B;  1FXA A;  2WU2 B;  1H7X A;  2WQY B;  3NVZ A;  2WDV B;  2M56 B;  3W5V B;  3AE9 B;  2EKI A;  4US8 A;  4YXD B;  3AEF B;  1TKE A;  3HRD D;  3VR9 B;  2BT6 A;  1PUT A;  1GTE A;  1N61 A;  1WWT A;  2MH7 A;  2PKO A;  4ZOH C;  5EE0 A;  1J7C A;  1OQQ A;  1QF6 A;  1E0Z A;  3B2F A;  1L6U A;  1ZOY B;  2N0S B;  4A9A A;  1YQ4 B;  2DWQ A;  3ETR A;  1TKG A;  3LXF A;  1NYR A;  4ZHP A;  3AE4 B;  1ZXI A;  3AM9 A;  1DOI A;  1FO4 A;  1NEN B;  2FBW B;  5H8Y E;  3AE1 B;  1YJI A;  2M19 A;  1NEK B;  2BS3 B;  1A70 A;  1FFU A;  3CF4 A;  1N62 A;  3AN1 A;  1RFK A;  1JRP A;  1N60 A;  3DWG C;  3AH7 A;  5H92 C;  3SR6 A;  3AE7 B;  4KX6 B;  1EWY C;  1QOG A;  2JX5 A;  1CJE A;  1H7W A;  1NI3 A;  2K22 A;  3HVZ A;  1DGJ A;  1GPX A;  1GT8 A;  3AMZ A;  5G5G A;  1OFF A;  3AV8 A;  4YTP B;  1QOB A;  2H89 B;  1KFY B;  1QOA A;  5EE3 A;  1GTH A;  2K5P A;  4C7Y A;  3FC4 A;  1IUE A;  4N58 A;  3CIR B;  3P4R B;  1I7H A;  2PVO D;  4WWM A;  2CJN A;  4C7Z A;  4N59 A;  4C80 A;  2MJ3 A;  2H88 B;  1JRO A;  3NRZ A;  5EE1 A;  3B9J A;  1KRH A;  5C2T B;  1ZUD 2;  1AWD A;  2CU3 A;  1WYG A;  1YJJ A;  1XLQ A;  1AYF A;  2BS2 B;  1R7S A;  1N5X A;  1WGK A;  3AEC B;  3NVW A;  4LTU A;  4N6E B;  1VDV A;  2BS4 B;  1XO3 A;  2KAJ A;  3LB8 C;  4HRS A;  1KF6 B;  3P1M A;  2WDR B;  3AE8 B;  3SFE B;  3B2G A;  3AE6 B;  3VRA B;  3ZYY X;  4YSY B;  1VJK A;  1FRR A;  4US9 A;  1JQ4 A;  2QIE B;  1E7P B; 
#chains in the Genus database with same CATH topology
 2DYM A;  2NS5 A;  2QIL A;  4K1R B;  3Q69 A;  4RF1 A;  5LXH A;  3N3K B;  1PQS A;  1RYJ A;  1T0R C;  1V49 A;  3K9P B;  3N9Y C;  2PVG C;  4NQL B;  3W9C B;  1C77 A;  4DBG A;  1L6V A;  4WJP A;  4IOI E;  2M8S A;  2Z8L A;  4JLC A;  3Q6B A;  3T3O A;  3RD2 A;  3IXS A;  2J7Q B;  2WXH A;  1TIF A;  2NTS A;  3RUI B;  4WQM A;  1NDD A;  2QJL A;  5E6O A;  1ZXH A;  4L1B A;  2HE7 A;  1BUI C;  3RUL A;  4HK2 A;  1YX6 B;  2MCN B;  3VDZ A;  3A33 B;  4G50 A;  4M8N A;  3PO0 A;  2K8B A;  4GOC A;  3QC8 B;  4S0R A;  4A55 A;  4K7U A;  4W9I A;  3R8B A;  4TV3 A;  1E8Z A;  3U2S C;  3DQV A;  2GBK A;  3D32 A;  2BT6 A;  1HXY D;  2QHO A;  1YQ4 B;  3DHI C;  1H4R A;  3N20 C;  4EZJ A;  1ET6 A;  2LRU A;  4OZB A;  2BS3 B;  2DX5 B;  3A1Q B;  1JWU D;  2MBO A;  2KVR A;  3VUY A;  1UH6 A;  2Y5B B;  3QAQ A;  1GNU A;  4BZA A;  4X57 B;  3TEW A;  2K6D B;  1YD8 U;  2LRW A;  2IGH A;  3CF6 E;  1JRO A;  2INC C;  3O13 A;  4GU2 A;  1WM2 A;  4MSM B;  2BW2 A;  4IC7 B;  2D2Q A;  1FEH A;  1Y8R C;  3JSV A;  4KSL C;  2VH2 A;  5BMG A;  2N9E B;  1IPG A;  3A9J B;  3W5U B;  1L2N A;  3NVV A;  5LXI B;  1Y56 A;  3BZD B;  2PTL A;  1IGD A;  1UBQ A;  3A9K B;  2BYE A;  2CHZ A;  1WRI A;  1WGH A;  2W55 A;  2WXJ A;  3KYC D;  3IT4 B;  3NG0 A;  1DOX A;  3B0A A;  4NAW A;  4OVV A;  3DVN V;  1E7U A;  3VUW A;  4P6V F;  1D5Z C;  1CZP A;  2CS4 A;  1ZKH A;  4JPS A;  1R4M I;  4NNJ B;  3RYT A;  2IZV B;  3ONS A;  1L7Y A;  4W9D A;  1MPE A;  4P7I A;  1JWB D;  3W2D A;  3WA0 A;  4LDT B;  2BKR B;  1UF0 A;  3MP9 A;  3OJ3 A;  1I4H A;  1WH3 A;  3VAW A;  3WAP A;  3KWV A;  2ON8 A;  2N0S B;  2N1W A;  2MHJ A;  1C4C A;  5G2N A;  3I3T B;  1QQR A;  2WGS A;  1RFK A;  1WRD B;  4FJY A;  4E74 A;  4KKJ A;  4A20 A;  2LHE A;  4IM3 A;  4GGQ A;  1KTK A;  4RMA A;  2G45 B;  5G5G A;  2DLB A;  5TSS A;  1BT0 A;  1SE3 A;  1KH0 A;  2K5P A;  3RNG C;  3NZ3 A;  2MLB A;  4EZL A;  1EWC A;  3PGE A;  2H88 B;  3BK2 A;  4LNI A;  5JZE B;  2WDT B;  3C0R B;  1AWD A;  1QKZ A;  1VZ6 A;  2K6Q A;  1FCC C;  1XD3 B;  1Q5W B;  3Q3N C;  5FR3 A;  4ANV A;  1HA5 A;  1TZO A;  1E7P B;  2LXC A;  1XLP A;  4EUT A;  2G4D B;  3FAH A;  3ZQ4 A;  4S17 A;  4DXF A;  4M02 A;  4KIK B;  2PE6 B;  1ET9 A;  4MJS A;  1XLN A;  2V9H A;  4ZRQ A;  1GC6 A;  3DCG A;  1LGR A;  4HLE A;  1L5P A;  2I2Y A;  2K8C A;  4CQN A;  2LFI A;  4AUQ C;  2FUG 1;  2L52 A;  2HTM E;  3T3N A;  4GDL A;  1EU4 A;  2O6V D;  2DAF A;  1JWS D;  2L8J A;  1NVI D;  3DDC B;  4M8M A;  1V1P B;  2ASQ A;  3MFG A;  3N1Y C;  2AL3 A;  2K25 A;  2A4Z A;  4DWF A;  3BVG A;  4MEM A;  4LDT D;  1WGG A;  2V3N A;  4TQ0 A;  3CST A;  4B6W A;  3BYT B;  3APD A;  4LJP B;  4ANU A;  4YSX B;  3DBS A;  1IGC A;  2UU7 A;  3W5V B;  4IWP A;  4YXD B;  1I4Q A;  3VTW A;  2WXR A;  1D5X C;  2L32 A;  2WXQ A;  4HCP B;  4RF0 A;  1WJU A;  1FFU A;  1RRB A;  1N60 A;  4ZYS A;  5H92 C;  2L05 A;  2KT7 A;  3I9V 1;  4C4V B;  3AU5 A;  2R2O A;  2LGD A;  3AV8 A;  5EE3 A;  2XK5 A;  5CX3 A;  4IWQ A;  3CIR B;  2I38 A;  1YMH E;  1I4P A;  3TEX A;  3LJ3 A;  1T6B X;  2L76 A;  1AYF A;  2FID A;  3KUC B;  4N6E B;  4NPN A;  1YN3 A;  2WXM A;  2PE9 A;  2IND C;  3AE6 B;  3B2G A;  5FKA C;  1GG3 A;  5C23 A;  4PK1 A;  4E71 A;  5LNK 1;  4AS1 A;  1B9R A;  2IJ0 A;  2INP E;  3BII D;  3UIN B;  3I5J C;  4HEA 1;  3IAS 1;  4G11 A;  4W9E A;  3AED B;  1JAL A;  1JW9 D;  1FD6 A;  4HVB A;  3RZW C;  3PLU A;  2KC1 A;  1ZDX A;  3M62 B;  2PW9 A;  3OJ4 B;  3FIL A;  4MH8 A;  5AZG A;  4HPM B;  3ZRC A;  4JGH B;  2L7R A;  2IDY A;  4RM8 A;  2W3R A;  3Q8C A;  2RDG A;  3ZRF A;  1PFD A;  2RDH A;  1YOV B;  1YX5 B;  3U52 E;  3HK0 A;  1SF0 A;  3R66 C;  5IOI A;  1HTQ A;  5MPO A;  2JWU A;  2GB1 A;  1V86 A;  4DDI D;  3QHT A;  2W3S A;  4RH6 A;  4P1C C;  1RWS A;  2WXG A;  3UI3 A;  4ITK A;  2WS3 B;  1MG8 A;  2MJD A;  2WXP A;  3DBH I;  4AWJ A;  1H7X A;  2LUM A;  3EEC A;  2KX0 A;  1MI0 A;  1FNW A;  3APF A;  2LJ5 A;  1OGW A;  3DBR I;  3PV1 A;  3X0W A;  1UGM A;  4MAC A;  3LXF A;  3TJP A;  4ZHP A;  2RD0 A;  2ZW1 A;  1FO4 A;  2M19 A;  3BWU D;  3IBE A;  1JRP A;  4BOZ B;  1VZ7 A;  4BVU C;  1XT9 B;  3RZF A;  1GPX A;  3AMZ A;  2XEW A;  1LQB A;  1KFY B;  3JSV B;  2L0F A;  4FUL A;  3KUD B;  2RPV A;  2NMQ A;  3QWZ B;  3RNF C;  1IBX A;  1WGK A;  1VDV A;  2KAJ A;  2D10 A;  2BYT A;  5DPT A;  2JZZ A;  1EM7 A;  2WNM A;  2JRI B;  4NAW B;  4ICV A;  3NS8 A;  4MM3 A;  1FXT B;  4ZYN A;  1UEL A;  1T3Q A;  3UGB B;  3PS6 A;  5G55 A;  2JXT A;  1NI2 A;  2V3S A;  4AJY B;  4ICU A;  3WCQ A;  2N9K A;  1I4R A;  1ZE3 D;  1MJD A;  4B0M A;  4YT0 B;  1CQV A;  1QT9 A;  3KLS X;  2DAJ A;  1SGH A;  1BXT A;  3KW5 B;  2LHD A;  2OJW A;  4NQK E;  4OW0 A;  3DVG X;  4UDU C;  3H8H A;  1SE4 A;  4DXG A;  2NTT A;  3Q3F A;  2KJH B;  5JHB A;  2KMM A;  2YVC A;  2LGX A;  2KFK A;  1F1H A;  4ARI A;  3AEG B;  1WXS A;  2FCM A;  1SBB B;  2WQY B;  4B95 A;  1EF1 A;  4EEW A;  2HD5 B;  1JML A;  1WGY A;  2E6X A;  2LVQ A;  3TIX A;  4WJO A;  4HKZ E;  3Q8A A;  2C9W B;  1ZXI A;  3PRE A;  3AE1 B;  3H9D A;  4M01 A;  1ESF A;  1C4A A;  3EFU A;  3DWG C;  3QA8 A;  2K22 A;  2OJR A;  1SJH D;  3E9S A;  3RT3 B;  1GTH A;  4C7Y A;  2N9X A;  2BF8 B;  4PT5 A;  1OEY A;  3BIN A;  4DDG D;  4HDO A;  2CU3 A;  2BS2 B;  1EU3 A;  1UGJ A;  4MJS B;  3PZD A;  1XO3 A;  1Z2M A;  1KLU D;  1KJT A;  1FCL A;  1WR1 A;  3PVL A;  4F8C B;  2KX3 A;  1E8Y A;  2R2Q A;  3HUI A;  4WQO B;  2CKH B;  4GDL B;  4WWP A;  3R2T A;  4XZ4 A;  2IPK D;  4IG7 B;  1J7B A;  3UQB A;  4RGO S;  5AEK B;  3N32 A;  3N1Z C;  3IHP C;  4DHZ E;  1VD2 A;  4B9K A;  3EGR A;  2KMC A;  2C60 A;  4HRO A;  1WXQ A;  2JF5 A;  3KWL A;  2AQ2 B;  4JX1 C;  1L0V B;  3OG5 A;  1RM6 C;  2KDB A;  3RFZ B;  3DBH B;  2IGG A;  2ZVN A;  3TCA A;  1WZ3 A;  2G1E A;  4EE2 A;  3S2A A;  1ROE A;  4TMA B;  3APC A;  3DBR B;  4ANX A;  1LXD A;  4LNN A;  3W1Y A;  2HJ8 A;  2KOX A;  2VH1 A;  1OEY J;  1GJZ A;  2ONQ A;  1OTR B;  2B3A A;  1TGZ B;  4DHJ D;  4K7S A;  4URK A;  2INN E;  2J53 A;  4KGT A;  3VR9 B;  1A5R A;  1N61 A;  1E0Z A;  2LXA A;  3QCA A;  1WJ6 A;  4RFB A;  4FN2 A;  2XK5 B;  2JU6 X;  1E7V A;  2KFJ A;  2GMI C;  1K53 A;  1VRA B;  3AN1 A;  2BWF A;  1NBF C;  2KVZ A;  2GLS A;  2KZR A;  4LJO B;  2JY6 A;  3AE7 B;  1H7W A;  1NI3 A;  2MSE D;  3L13 A;  3VTV A;  1YJ1 A;  2K3U A;  2SAK A;  3NOB A;  5HI1 A;  4PS7 A;  3FC4 A;  1GB4 A;  2C7N B;  2MJ3 A;  2BQQ A;  5EE1 A;  3ZJT A;  3QQ8 B;  1D5M C;  3ML9 A;  4XGA B;  3ZYY X;  1G6J A;  2KDI A;  2BTE A;  1C76 A;  2D3B A;  3Q8F A;  3HIZ A;  2LGS A;  5BYR A;  3FIL B;  4G3X B;  4ZRI A;  3AXC A;  4L23 A;  2MBB B;  2LEK A;  1PDX A;  1FNV A;  2WWZ A;  3L54 A;  3NZS A;  4ZRP A;  1P1A A;  4FXC A;  1D3Z A;  2LD9 A;  2W9N A;  1V8C A;  1FXI A;  3ABV B;  3IVF A;  5E6N A;  3SFD B;  3MC8 A;  5D6J B;  1LM8 B;  3ML8 A;  4ZHO A;  2PIA A;  5C1Z A;  3P4P B;  1FRD A;  1V9J A;  3DOW A;  5LLI A;  2JRH A;  1WZ0 A;  2MQJ A;  3SEB A;  1I42 A;  1HZ5 A;  2IO1 B;  1T5X D;  3VXW A;  3PZ8 A;  2KLC A;  4LNK A;  1WXM A;  4USA A;  1B1Z A;  2KTR A;  4GXB A;  2EMS A;  4LLG M;  3NZU A;  4II2 B;  4IKG A;  1ISN A;  3KQ4 A;  3NVZ A;  2WDV B;  4LNF A;  3AEF B;  4GDK A;  1L6U A;  2VRR B;  1SIF A;  3Q8E A;  4KZ0 A;  4AJW A;  4XWT A;  3AE4 B;  3KUZ A;  5TR5 A;  1JQ4 A;  3CF4 A;  3KVF B;  2BB6 A;  4IWO A;  4OHJ A;  1IBX B;  4R3D A;  2MRP A;  3HVZ A;  1V5O A;  3PTF C;  5D3I B;  3UQA A;  2M17 A;  1MHH E;  4N58 A;  1I7H A;  4WWM A;  3NJT A;  4MM3 B;  1TS4 A;  3ZDT A;  1I4G A;  2J42 A;  1YJJ A;  1AW7 A;  1EUV B;  3PRP B;  5I4D A;  3ZO5 B;  1C78 A;  2N7E A;  2N9P C;  1J0G A;  4KVG B;  1QLB B;  4RCO A;  2L00 B;  1WI0 A;  3Q2A C;  2ZJD A;  4HCN B;  4WIP A;  5IA7 A;  4W9J A;  2V1Y A;  2KDE B;  2L0T A;  4HJK A;  3IAM 1;  1VR9 A;  3ZNG C;  3PT2 B;  1JRU A;  2WHI A;  4A90 A;  3K9O B;  2KFK B;  4ZRJ A;  4MGI E;  2J52 A;  2WXN A;  1TYG B;  1JWA D;  2Z0D B;  2K8H A;  2M0A A;  1FNU A;  3I63 C;  4IM2 A;  2Q5W D;  3TSS A;  1P9D U;  1S1Q B;  4QAY A;  4XE0 A;  2G3Q B;  2Y5P A;  1F2R I;  1E5W A;  2LUE A;  4ZRK A;  1ZW7 A;  4W9K A;  2KWU B;  3HM3 A;  2PEA A;  1XF5 L;  3ZJV A;  5IAA C;  2Z0E B;  4ZOH C;  5EE0 A;  1J7C A;  1ZGU B;  4IW0 A;  4A9A A;  3ZLZ A;  2NPT A;  2N9L A;  4NAM A;  1YQB A;  2D07 B;  3UF8 A;  3MC9 A;  2ZCB A;  3B1L X;  3GOE A;  2IBI B;  1GC7 A;  2HDE A;  3ZW3 A;  1CK1 A;  3GZN I;  5E6P A;  4K81 A;  2ZCC A;  5AZF A;  1CJE A;  1V80 A;  3RCZ A;  1TY0 A;  2R61 A;  4LK0 M;  3DHG C;  2KWD A;  1F9J A;  4C7Z A;  3MJ5 A;  4YL8 A;  2K0P A;  1K50 A;  2J4X A;  1P7F A;  2KHW B;  2LAS A;  3AI5 A;  1UNS A;  2MA9 B;  4A8X C;  4MEL A;  2QSD A;  4JWU C;  1V81 A;  2NVU I;  3VRB B;  2D5G A;  3V05 A;  2Y5C A;  4GMV A;  3BYY B;  5DCN A;  2L83 A;  1J7A A;  5JH5 C;  4JWS C;  1WF9 A;  4ASW C;  2B76 B;  1HEZ E;  4WJQ A;  2KXJ A;  4DXA B;  5GXG B;  3TMP B;  3V60 A;  4IUM B;  3AE2 B;  4AQ7 A;  1HTO A;  2PMV A;  2WXF A;  3FKY A;  5D7G A;  2C7H A;  3NS1 A;  2KQ7 A;  3L17 A;  1AAR A;  2J0K A;  4K7W A;  3TBL D;  1RLF A;  1DOY A;  1R4M B;  2ACZ B;  3W1S A;  3WAL A;  2RGF A;  1K51 A;  1WM3 A;  4MSQ B;  1UZX B;  3KYD D;  3VTU A;  1FIQ A;  2SEB D;  2LI5 A;  4FA6 A;  2MP2 A;  4KGR A;  3U30 A;  3UIO B;  1VCB A;  1TS2 A;  2MH7 A;  1YNT E;  1F77 A;  1WY8 A;  4HJG E;  3BY4 B;  2WXK A;  1NYR A;  1SEB D;  1U4A A;  3Q8B A;  1NEN B;  3UIP B;  4RGT A;  2IYD B;  3M63 B;  3OAW A;  1X1M A;  1Z5S B;  1EWY C;  5D94 A;  4GSW A;  4REZ A;  2N7J A;  2FNJ B;  3ZJU A;  1FPY A;  2J0J A;  4FBJ B;  3P2B A;  2X38 A;  1ZUD 2;  1SXT A;  2ZPY A;  3AU4 A;  4KV2 A;  3N1X C;  3NVW A;  3Q3O C;  1D4B A;  3R7R A;  4KKI A;  4NY0 A;  4KDI C;  4I6P A;  2N1V A;  2DZI A;  3U8Z A;  4NJC A;  4C56 C;  1MHX A;  2WXO A;  1ZP0 B;  1MG4 A;  5FK9 C;  1F0Z A;  4NZL B;  3T8M A;  3P4Q B;  5G5H A;  5DPR A;  3ZDM C;  1SSN A;  2MEK A;  2LJI A;  2CU1 A;  1WFY A;  1CMX B;  2O6V A;  3U7D A;  1P0R A;  4XYC A;  4JL9 A;  1BML C;  2KTR B;  2OHF A;  2BVC A;  3TL5 A;  1K8R B;  4GB9 A;  1KLG D;  4YSZ B;  3M95 A;  5DPW A;  2LGY A;  3A4R A;  4GDK B;  2ZW0 A;  3IFW B;  2QEJ C;  4BBN C;  2CHX A;  2KC2 A;  4W9H A;  2PJH A;  1SJE D;  4OZA A;  1E10 A;  2ZVO A;  3VH3 B;  2V0G A;  1IYF A;  2JVC A;  4TKN A;  2BKF A;  3HVD A;  3ZKJ C;  3HM6 X;  1C1Y B;  1FXA A;  4O1N A;  4BKG A;  2EKI A;  1WWT A;  2GOW A;  1QF6 A;  4XWW A;  1T0S C;  2JUO A;  3BVM A;  1TT5 B;  2PPH A;  5D2M B;  1DOI A;  4PYZ A;  2XN9 C;  1WXA A;  2AYO B;  1L4Z B;  2KLG A;  1QOG A;  3ECI A;  1DGJ A;  2FE8 A;  1LFD A;  2NBW B;  4YTP B;  4CYE A;  2H89 B;  3EA6 A;  1JCK B;  4TUU A;  2BWE S;  2XNA C;  2G4S A;  2CR5 A;  2DNF A;  1KRH A;  5C2T B;  2FCS A;  2I1J A;  2ZEQ A;  2QCZ A;  4A3O A;  1L4D B;  3QAR A;  4HRS A;  2UWQ A;  3P1M A;  2WDR B;  3L08 A;  2JWZ A;  1N6Z A;  3PRZ A;  4KZC A;  4YSY B;  3SDL C;  3VFK A;  3IG3 A;  2V4I B;  3Q3J A;  4F1S A;  2LVO A;  3DBL I;  1J19 A;  3PHW B;  4I6L B;  3SU8 X;  1EO6 A;  1C4P A;  1VLB A;  2IGD A;  1WX8 A;  4WJN A;  3Q14 C;  5AUI A;  1WR6 E;  1WJN A;  1P7E A;  1TS5 A;  1E9M A;  2BYV E;  1YQ3 B;  2WU5 B;  1E8W A;  3DWM A;  4BFR A;  5AUK A;  4AOF A;  5KHQ A;  1OQR A;  2WX0 A;  3ENE A;  5D3D A;  4P16 A;  3GE3 C;  3ZGZ A;  2LZ6 A;  3CWI A;  2MX2 A;  3EC8 A;  4EFO A;  2W82 A;  2BGF A;  2EEL A;  3QJZ A;  3WAM A;  1V97 A;  3SD5 A;  2MJE A;  3C8Y A;  3L10 B;  2NPT B;  4GLS C;  2MWS B;  3GE8 C;  1WJ4 A;  2K1F A;  1KM7 A;  4M00 A;  2CHW A;  4GN1 A;  3AE9 B;  1TKE A;  1P3Q U;  1R4N I;  3RI7 C;  5AZH A;  1TKG A;  4K3B A;  1MFW A;  2C7M B;  4BKS A;  3WAO A;  1I35 A;  1IP9 A;  1I4X A;  4W9G A;  1GB1 A;  3NUH B;  1C9F A;  1QOB A;  3O65 B;  2LVP A;  2KTF A;  4N59 A;  4WH4 A;  2WXL A;  2K39 A;  1XLQ A;  2FCN A;  4BKT A;  1KF6 B;  4HPL B;  3AE8 B;  3SFE B;  4YWG G;  3JYU A;  2PLP A;  4US9 A;  2EMT A;  3RNB C;  3TEY A;  1GOZ A;  1S3S G;  3NHE B;  1L0Y B;  4BOS C;  3L0W B;  5HFY A;  2KDF B;  1OQY A;  1STE A;  1TS3 A;  3WIM A;  1C79 A;  1WX9 A;  2MBH A;  2AWT A;  3ALB A;  4J3O D;  4NJ6 A;  2N7D A;  2QDF A;  3U7Z A;  3IT6 B;  5EE9 A;  1TKY A;  3JW0 X;  3TUO A;  3EUB 2;  3ZNH B;  3E56 A;  3T9L A;  3VUX A;  2YEP B;  3P63 A;  2UYZ B;  4XC2 A;  4MGY E;  5IO9 A;  4RGN A;  3ZTD A;  2TSS A;  3W1S C;  2REX A;  4WAA A;  2MP2 B;  1SB3 C;  2AL6 A;  2E3T A;  1ACC A;  4FJZ A;  4M0W A;  1SE9 A;  4IDI A;  2FCQ A;  2JPH A;  4HXD A;  2JT4 B;  3AB5 A;  1M94 A;  4US8 A;  4HKQ A;  3H7S A;  2X8X X;  1OQQ A;  4C00 A;  4W9F A;  2MW5 A;  5CHW A;  3JVZ X;  4RGM A;  3V3X A;  2KN4 A;  2IY0 B;  3QX1 A;  5CHF A;  3OLM D;  1GT8 A;  2KKC A;  4KSK C;  2Y3A A;  1QOA A;  3AUL A;  1F52 A;  3LYY A;  3KH0 A;  3EFC A;  3DBL B;  4HWI B;  3NRZ A;  3QK0 A;  2EKE C;  3H7P A;  1R7S A;  4I6N B;  3AEC B;  3ZVV A;  3VRA B;  1VJK A;  2GI9 A;  3DVG Y;  4KDL B;  1HQR D;  5IN7 A;  3R3M A;  2QIE B;  4C80 A;  5J2R A;  2OOB B;  5BO4 B;  5KHO A;  3AE5 B;  3VR8 B;  1V5T A;  2DBY A;  2O6V B;  3MJW A;  5C3J B;  2BYF A;  3L16 A;  1YN4 A;  1V6E A;  4EZK A;  2JXX A;  1WMH A;  3ZNZ B;  1RAX A;  1UWX A;  3AEA B;  2CJO A;  2L1A A;  2JSV X;  5JHA A;  3X23 A;  3GS2 A;  4GIV A;  1GUA B;  4EKU A;  3NY5 A;  1FFV A;  4OVZ A;  2O2V A;  4A3P A;  5IKC M;  4ZDV A;  2DHZ A;  4TQ1 A;  1R4N B;  4MT5 A;  1NYQ A;  4BBN F;  2D3C A;  1PGA A;  2WDQ B;  1FM0 D;  3AE3 B;  4RNA A;  1PYW D;  4WWO A;  4LNO A;  1H8C A;  2LMC A;  2DEN B;  2JZ3 B;  5HHD G;  2PKO A;  2M4N A;  3H6N A;  3ETR A;  3DHH C;  1V2Y A;  2VZK B;  1WE7 A;  2FBW B;  2ZNV B;  5H8Y E;  2NR2 A;  2KWC A;  2YLM A;  2JX5 A;  1Q10 A;  4EOY A;  1E8X A;  2M1M A;  2ZNV C;  2KMA A;  2MBE A;  1K52 A;  2WXI A;  2BPS A;  1IUE A;  4ACF A;  2CJN A;  4DK5 A;  1KOT A;  4H2A A;  4DQO C;  2M0X A;  3URY A;  4RM9 A;  2LWP A;  3V62 A;  4XX5 A;  1HZ6 A;  1UD7 A;  4P1B C;  1P98 A;  2V4L A;  3PZ7 A;  3HHM A;  3SHQ A;  2AEH A;  1WYW B;  2LGI A;  5L95 C;  4G0N B;  2D3G A;  4A6Q A;  4PYU A;  1MVK A;  3RNC C;  3LDZ E;  5DPS A;  4CO7 A;  2K9X A;  1LO5 D;  2KNB A;  2Z59 B;  2RR9 A;  2WYQ A;  2AQ1 B;  1QOF A;  2RDB C;  1GAQ B;  5J18 A;  1UBI A;  2OED A;  5BYQ A;  1SIJ A;  2MBQ A;  4W9L A;  4D2K A;  3PSE B;  2BBC A;  5GMV A;  5J17 A;  2G9H D;  4BAX A;  3U4E G;  2JZP A;  1XEE A;  3RPF C;  1AN8 A;  3PPA A;  5JXV A;  2RPQ A;  1FMA D;  2KO3 A;  3DVN U;  5T8I A;  5BMI A;  3PHX B;  2QC8 A;  2VZK D;  4WWN A;  2GRI A;  2D3A A;  4JQW C;  1WX7 A;  1TTN A;  2IO3 B;  1YJI A;  3VH4 B;  2KN5 A;  3GP7 A;  4KX6 B;  2JYE A;  2GBR A;  2FIF A;  3R2I A;  1OFF A;  5CHV C;  4F7Z A;  1TBE A;  5BYS A;  2KDM A;  3EHV A;  2KAC A;  3P42 A;  4W9C A;  3B9J A;  3MTN B;  4J6I A;  3V6E B;  3A1Q A;  2N4F A;  2DZJ A;  3DPD A;  3ZTC A;  1WYG A;  3C19 A;  1ZDV A;  3RMK C;  3LB8 C;  1J8C A;  1WXV A;  3CMM B;  2KYW A;  2D11 A;  2ZZP B;  1XLO A;  4HDQ A;  4XDD A;  4L2Y A;  3GB1 A;  4AP4 C;  2XBB C;  2RSU A;  3BK1 A;  4KGS A;  4LCD E;  2ICI A;  2GBM A;  3ZXR A;  3ZUN A;  1KLV A;  1TZ1 A;  2IO0 B;  1E90 A;  3Q3M C;  3BVZ A;  4FHK A;  3J9C A;  3A9J A;  5HKH A;  4ARC A;  4M0W B;  2KD0 A;  1V1O A;  2RMM A;  1XCT L;  1VZ8 A;  3A9K A;  1DYQ A;  4WAF A;  3NVY A;  1Q0W B;  3TEZ A;  2KAN A;  3AEB B;  4JE3 B;  2WLB A;  2YEP F;  1N5W A;  1E6E B;  1QZE A;  4Q2J A;  4BKS D;  2W54 A;  3ZNI D;  2V3P A;  2JQR B;  3HRD D;  3WAN A;  4MGK E;  2JYT A;  1ZOY B;  2ZPN A;  1F2R C;  2J0M A;  2NBU A;  4NJ7 A;  3AM9 A;  3A4S C;  4K3C A;  3SR6 A;  3H7P B;  4DHZ B;  4PS8 A;  3V6C B;  1XQQ A;  3GZN B;  3PRM B;  5HG2 A;  1T0Q C;  2KJR A;  3P4R B;  2PVO D;  4CHK A;  2AQ3 B;  2KQS A;  1Q1O A;  2WX1 A;  4E3C A;  2IY1 B;  3MC0 B;  1D6E C;  3CSF A;  2IO2 B;  1N5X A;  4LTU A;  2BS4 B;  4JIO U;  2I1K A;  1QIL A;  3MHS D;  3VHT C;  3M3J A;  2DYB A;  1WMH B;  2C5L C;  2FUH B;  5IP4 D;  1SE2 A;  1TJE A;  4TSS A;  2L3Z A;  2KWV B;  1L0X B;  2FAZ A;  2KQ4 X;  1N63 A;  2DYO A;  1JWM D;  4MH0 E;  1RFA A;  2O2V B;  4OVU A;  5FR6 A;  4MGZ E;  2AX5 A;  5E6J A;  2NBV B;  3AEE B;  2NCN A;  3N30 A;  2KK8 A;  4KIK A;  5BMH A;  5L83 A;  2DZM A;  2A5U A;  4ANW A;  4DHJ B;  4FAD A;  4FJV B;  1PGX A;  3P4S B;  3ZXV A;  1C3T A;  4YTN B;  3ZIM A;  4PS3 A;  4B0E A;  3H1U A;  1WGD A;  1UUP A;  2WP9 B;  2BB5 A;  1EF5 A;  1UWM A;  3MHZ A;  1WSP A;  1ZPS A;  4YTM B;  3RN9 C;  3L4P A;  1ENF A;  2WU2 B;  2M56 B;  1PGB A;  1V1P A;  4WUR A;  2DZK A;  5EDS A;  3R7Q A;  1PUT A;  1GTE A;  3B08 A;  3B2F A;  2HJ1 A;  3RNA C;  2DWQ A;  2QMT A;  1XXG A;  1TY2 A;  2GBJ A;  5CTR C;  1NEK B;  1A70 A;  1HE8 A;  1N62 A;  1XCQ L;  3AH7 A;  1M4V A;  2GBN A;  4HPP A;  1WIA A;  4FLH A;  4IM0 A;  3VQI A;  1YIW A;  2KJ6 A;  3PLV A;  1T0Y A;  4II3 B;  4MDK E;  4XDC A;  1YN5 A;  3V61 A;  1WGR A;  2HTH A;  1WE6 A;  4FHJ A;  4N9F 4;  4C4V A;  3QIJ A;  3VVW B;  3I57 A;  1FRR A;  3RNE C;  3OWE B;  4OZC A; 
#chains in the Genus database with same CATH homology
 2DYM A;  3AE5 B;  3VR8 B;  2QIL A;  4JWU C;  4NAW B;  2DBY A;  3VRB B;  2D5G A;  3Q69 A;  3V05 A;  2Y5C A;  4RF1 A;  5C3J B;  1RYJ A;  1T3Q A;  3BYY B;  2JXT A;  2L83 A;  1J7A A;  1YN4 A;  3N9Y C;  2PVG C;  4JWS C;  3W9C B;  1C77 A;  1L6V A;  3WCQ A;  2N9K A;  2B76 B;  1HEZ E;  1I4R A;  1ZE3 D;  4IOI E;  4B0M A;  2Z8L A;  5GXG B;  4YT0 B;  1CQV A;  1QT9 A;  1UWX A;  3KLS X;  3AEA B;  2CJO A;  2L1A A;  3AE2 B;  3T3O A;  2JSV X;  4AQ7 A;  1BXT A;  2LHD A;  3IXS A;  2PMV A;  2WXF A;  4OW0 A;  4UDU C;  3GS2 A;  2WXH A;  5D7G A;  3H8H A;  2NTS A;  4WQM A;  1SE4 A;  4DXG A;  3NS1 A;  1FFV A;  2NTT A;  2QJL A;  4OVZ A;  1ZXH A;  4L1B A;  2KMM A;  1BUI C;  1DOY A;  4TQ1 A;  4MT5 A;  1NYQ A;  2ACZ B;  3W1S A;  3PO0 A;  1PGA A;  4ARI A;  3AEG B;  1K51 A;  2WDQ B;  1FM0 D;  4A55 A;  3AE3 B;  1SBB B;  4RNA A;  3R8B A;  1FIQ A;  1PYW D;  2SEB D;  3U2S C;  2WQY B;  2LMC A;  4KGR A;  2BT6 A;  1TS2 A;  2PKO A;  5HHD G;  2MH7 A;  1YNT E;  1HXY D;  1JML A;  2E6X A;  1F77 A;  1YQ4 B;  4HJG E;  3ETR A;  2WXK A;  4HKZ E;  1NYR A;  3Q8A A;  1SEB D;  2VZK B;  1ZXI A;  1ET6 A;  3Q8B A;  1NEN B;  2FBW B;  4OZB A;  3AE1 B;  4RGT A;  5H8Y E;  2BS3 B;  1C4A A;  1ESF A;  1JWU D;  3DWG C;  1EWY C;  2JX5 A;  1Q10 A;  2K22 A;  1SJH D;  4REZ A;  2N7J A;  3E9S A;  3ZJU A;  1K52 A;  2WXI A;  3TEW A;  1GTH A;  4C7Y A;  1IUE A;  2CJN A;  2IGH A;  2X38 A;  1JRO A;  4PT5 A;  4H2A A;  4DQO C;  1ZUD 2;  1SXT A;  3URY A;  2CU3 A;  3O13 A;  2BS2 B;  1EU3 A;  1UGJ A;  3NVW A;  1D4B A;  1HZ6 A;  1XO3 A;  4KKI A;  2BW2 A;  3PZ7 A;  1KLU D;  1FEH A;  1FCL A;  2LGI A;  5BMG A;  4NJC A;  4C56 C;  3HUI A;  1MHX A;  4A6Q A;  2WXO A;  1MVK A;  3W5U B;  3NVV A;  1ZP0 B;  1Y56 A;  4GDL B;  5FK9 C;  3R2T A;  1F0Z A;  4NZL B;  2IPK D;  3BZD B;  2PTL A;  1IGD A;  3P4Q B;  5G5H A;  1J7B A;  4RGO S;  1WRI A;  2K9X A;  2WXJ A;  2W55 A;  1LO5 D;  3IT4 B;  1SSN A;  2MEK A;  2LJI A;  1DOX A;  2AQ1 B;  1QOF A;  3EGR A;  4HRO A;  1GAQ B;  1WXQ A;  2AQ2 B;  3KWL A;  4JX1 C;  4P6V F;  1BML C;  2OHF A;  1D5Z C;  2OED A;  1CZP A;  5BYQ A;  1SIJ A;  1L0V B;  1RM6 C;  4JPS A;  4D2K A;  3RFZ B;  2IGG A;  1KLG D;  2BBC A;  4YSZ B;  2G1E A;  4GDK B;  4EE2 A;  2G9H D;  2ZW0 A;  1ROE A;  4TMA B;  2QEJ C;  3U4E G;  2JZP A;  1SJE D;  1XEE A;  4OZA A;  3RPF C;  1E10 A;  1MPE A;  2V0G A;  1AN8 A;  5JXV A;  1JWB D;  2ONQ A;  3W2D A;  1FMA D;  3HVD A;  1FXA A;  3MP9 A;  4O1N A;  1I4H A;  2EKI A;  2INN E;  2J53 A;  4KGT A;  5T8I A;  3VR9 B;  5BMI A;  1N61 A;  1WWT A;  1E0Z A;  1QF6 A;  3KWV A;  2VZK D;  2ON8 A;  2N0S B;  4RFB A;  4XWW A;  2JU6 X;  2GRI A;  3BVM A;  1C4C A;  1DOI A;  1K53 A;  1QQR A;  1YJI A;  2XN9 C;  1VRA B;  3AN1 A;  1RFK A;  1L4Z B;  4KKJ A;  3GP7 A;  3AE7 B;  4KX6 B;  1QOG A;  2LHE A;  1H7W A;  1NI3 A;  1KTK A;  1DGJ A;  2FE8 A;  2JYE A;  5G5G A;  3R2I A;  1OFF A;  2DLB A;  4YTP B;  5TSS A;  1SE3 A;  2H89 B;  3EA6 A;  1KH0 A;  1JCK B;  2K3U A;  2SAK A;  5HI1 A;  2K5P A;  2XNA C;  5BYS A;  3FC4 A;  3NZ3 A;  2KDM A;  2KAC A;  3P42 A;  1GB4 A;  1EWC A;  4C80 A;  2MJ3 A;  2H88 B;  5EE1 A;  3B9J A;  3ZJT A;  1KRH A;  3BK2 A;  5C2T B;  1AWD A;  1WYG A;  1QKZ A;  1ZDV A;  1L4D B;  1VZ6 A;  3LB8 C;  4HRS A;  3P1M A;  2WDR B;  1FCC C;  1D5M C;  3ZYY X;  4YSY B;  5FR3 A;  2BTE A;  1C76 A;  1HA5 A;  3Q8F A;  2V4I B;  1TZO A;  1E7P B;  1XLO A;  1XLP A;  4XDD A;  3FAH A;  3ZQ4 A;  4L2Y A;  1C4P A;  3FIL B;  3GB1 A;  5BYR A;  4DXF A;  3BK1 A;  1VLB A;  2IGD A;  4L23 A;  1ET9 A;  2LEK A;  5AUI A;  1P7E A;  4KGS A;  1TS5 A;  1PDX A;  1XLN A;  2ICI A;  1FNV A;  4ZRP A;  4ZRQ A;  1E9M A;  1YQ3 B;  2WU5 B;  4FXC A;  3DWM A;  5AUK A;  1L5P A;  2I2Y A;  1OQR A;  1V8C A;  2LFI A;  4CQN A;  2FUG 1;  1FXI A;  2L52 A;  3BVZ A;  3ABV B;  3J9C A;  5D3D A;  4P16 A;  3ZGZ A;  4ARC A;  3SFD B;  3CWI A;  2HTM E;  3T3N A;  1EU4 A;  1V1O A;  2RMM A;  1JWS D;  4ZHO A;  1XCT L;  2W82 A;  1VZ8 A;  2PIA A;  4WAF A;  1DYQ A;  2EEL A;  1NVI D;  3NVY A;  3TEZ A;  3P4P B;  1V97 A;  2MJE A;  1FRD A;  3C8Y A;  3AEB B;  1V1P B;  2WLB A;  4JE3 B;  2YEP F;  3MFG A;  3SEB A;  1N5W A;  1E6E B;  1HZ5 A;  1T5X D;  3BVG A;  3PZ8 A;  4GLS C;  4USA A;  4Q2J A;  1B1Z A;  2V3N A;  2W54 A;  4LLG M;  4TQ0 A;  3BYT B;  2V3P A;  4IKG A;  2JQR B;  4YSX B;  3KQ4 A;  1IGC A;  3W5V B;  3NVZ A;  2WDV B;  3AE9 B;  4YXD B;  3AEF B;  1TKE A;  3HRD D;  2JYT A;  1L6U A;  1ZOY B;  1I4Q A;  1F2R C;  2WXR A;  3Q8E A;  1D5X C;  1TKG A;  2L32 A;  4XWT A;  3AE4 B;  2WXQ A;  3AM9 A;  4RF0 A;  1JQ4 A;  1FFU A;  3CF4 A;  1N60 A;  2BB6 A;  4ZYS A;  5H92 C;  3SR6 A;  4OHJ A;  1IBX B;  3I9V 1;  4R3D A;  1I4X A;  3HVZ A;  1GB1 A;  3NUH B;  3AV8 A;  1C9F A;  5D3I B;  1QOB A;  5EE3 A;  5HG2 A;  1MHH E;  4N58 A;  3CIR B;  2I38 A;  3P4R B;  1I7H A;  2PVO D;  4WWM A;  2AQ3 B;  1YMH E;  4N59 A;  4WH4 A;  1I4P A;  2WXL A;  3TEX A;  4MM3 B;  1T6B X;  1TS4 A;  1I4G A;  3MC0 B;  1D6E C;  2J42 A;  1YJJ A;  1XLQ A;  1AYF A;  1N5X A;  1AW7 A;  4N6E B;  4LTU A;  2BS4 B;  1YN3 A;  1KF6 B;  2WXM A;  3AE8 B;  3SFE B;  4YWG G;  5I4D A;  3B2G A;  3AE6 B;  5FKA C;  1C78 A;  2PLP A;  1QIL A;  4US9 A;  5LNK 1;  3TEY A;  1GOZ A;  1QLB B;  4AS1 A;  1B9R A;  2IJ0 A;  4RCO A;  1SE2 A;  1TJE A;  1L0Y B;  4TSS A;  2INP E;  3BII D;  4HEA 1;  3IAS 1;  3AED B;  1JAL A;  5HFY A;  1JW9 D;  1STE A;  1TS3 A;  1FD6 A;  1C79 A;  4J3O D;  4WIP A;  1L0X B;  2KQ4 X;  1N63 A;  2DYO A;  1JWM D;  3IAM 1;  3U7Z A;  1ZDX A;  1VR9 A;  3IT6 B;  4A90 A;  5EE9 A;  2PW9 A;  2AX5 A;  1TKY A;  5E6J A;  3TUO A;  3EUB 2;  3AEE B;  3FIL A;  4MH8 A;  3E56 A;  5BMH A;  2J52 A;  2IDY A;  2WXN A;  2YEP B;  3P63 A;  1TYG B;  2W3R A;  1JWA D;  3Q8C A;  2RDG A;  1PGX A;  4RGN A;  1PFD A;  3P4S B;  2M0A A;  2TSS A;  2RDH A;  3U52 E;  1FNU A;  4YTN B;  1SF0 A;  1SB3 C;  4B0E A;  5MPO A;  2Q5W D;  2JWU A;  2GB1 A;  3TSS A;  1UUP A;  2E3T A;  2WP9 B;  2W3S A;  1ACC A;  4RH6 A;  1RWS A;  2WXG A;  4XE0 A;  3UI3 A;  2Y5P A;  1F2R I;  4M0W A;  4IDI A;  4ITK A;  2BB5 A;  1UWM A;  3MHZ A;  2WS3 B;  1WSP A;  1ZPS A;  4YTM B;  3L4P A;  2MJD A;  2WXP A;  3AB5 A;  1XF5 L;  1ENF A;  2WU2 B;  1H7X A;  3ZJV A;  2M56 B;  1PGB A;  4US8 A;  1V1P A;  2LUM A;  4WUR A;  4HKQ A;  1MI0 A;  1PUT A;  1GTE A;  1FNW A;  4ZOH C;  5EE0 A;  1J7C A;  1OQQ A;  3B2F A;  4A9A A;  2DWQ A;  2N9L A;  2QMT A;  4MAC A;  1XXG A;  1TY2 A;  3LXF A;  4NAM A;  4ZHP A;  2ZW1 A;  1FO4 A;  2M19 A;  3BWU D;  1NEK B;  1A70 A;  4RGM A;  2HDE A;  1N62 A;  2KN4 A;  1XCQ L;  3V3X A;  1CK1 A;  1JRP A;  3AH7 A;  1M4V A;  1CJE A;  1VZ7 A;  1GPX A;  1GT8 A;  3AMZ A;  1TY0 A;  3VQI A;  2R61 A;  2Y3A A;  1KFY B;  1QOA A;  4LK0 M;  3LYY A;  4XDC A;  1YN5 A;  2KWD A;  4C7Z A;  3MJ5 A;  3NRZ A;  2K0P A;  1K50 A;  2J4X A;  2RPV A;  1P7F A;  2NMQ A;  1IBX A;  1WGK A;  1R7S A;  3AEC B;  1UNS A;  1VDV A;  2KAJ A;  2BYT A;  4A8X C;  2QSD A;  3VRA B;  3I57 A;  1VJK A;  2GI9 A;  1FRR A;  1EM7 A;  2WNM A;  1HQR D;  2QIE B;  3OWE B;  4OZC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...