3AECB

Crystal structure of porcine heart mitochondrial complex ii bound with 2-iodo-n-(1-methylethyl)-benzamid
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
239
structure length
239
Chain Sequence
PRIKKFAIYRWDPDKTGDKPHMQTYEIDLNNCGPMVLDALIKIKNEIDSTLTFRRSCREGICGSCAMNINGGNTLACTRRIDTNLDKVSKIYPLPHMYVIKDLVPDLSNFYAQYKSIEPYLKKKDESQEGKQQYLQSIEEREKLDGLYECILCACCSTSCPSYWWNGDKYLGPAVLMQAYRWMIDSRDDFTEERLAKLQDPFSLYRCHTIMNCTGTCPKGLNPGKAIAEIKKMMATYKE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Succinate dehydrogenase [ubiquinone] flavoprotein subunit, m
publication title Crystal structure of porcine heart mitochondrial complex II bound with 2-Iodo-N-(1-methylethyl)-benzamid
rcsb
molecule tags Oxidoreductase/oxidoreductase inhibitor
total genus 51
structure length 239
sequence length 239
ec nomenclature ec 1.3.5.1: Succinate dehydrogenase (quinone).
pdb deposition date 2010-02-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF13085 Fer2_3 2Fe-2S iron-sulfur cluster binding domain
B PF13534 Fer4_17 4Fe-4S dicluster domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1060.10 Mainly Alpha Orthogonal Bundle Fumarate Reductase Iron-sulfur Protein; Chain B, domain 2 Alpha-helical ferredoxin 3aecB02
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 3aecB01
2Y5CA 3ABVB 3AE3B 4USAA 2PIAA 2QIEB 4N59A 1TKEA 1N61A 1L6VA 1YQ4B 1OFFA 5MPOA 1FXAA 1JALA 2W54A 1QOAA 5C3JB 1NVID 3B2FA 3AEGB 1B9RA 3EUB2 1N5WA 3DWGC 1FRRA 3ZYYX 2H88B 3AE2B 1J7CA 2E3TA 3AE5B 3RPFC 2MH7A 1A70A 1EWYC 1WWTA 2AX5A 1GPXA 2H89B 3AE8B 1PFDA 2BS4B 3NVYA 1L0VB 4YT0B 1RYJA 4JWSC 1WRIA 1TKYA 3SFEB 1L6UA 1NI3A 1FIQA 1XLOA 1KF6B 4ZHOA 3CIRB 1JWAD 2L83A 3LXFA 2MJEA 3AH7A 1QOGA 1SIJA 1YQ3B 1FM0D 2MJDA 2K22A 1VJKA 3AM9A 5G5GA 2OHFA 1GT8A 2WDVB 1NYQA 1SF0A 3CWIA 4WQMA 2WDQB 3SR6A 2KMMA 1E0ZA 2K9XA 1TYGB 3AB5A 4ZHPA 2KAJA 3AEAB 3VRAB 1DOYA 1WXQA 2WLBA 5EE0A 1OQQA 2MJ3A 1GTEA 1FFVA 3NVZA 2W3RA 3WCQA 1J7AA 4C7YA 1V97A 1FO4A 1NENB 3P63A 3FAHA 1E7PB 3P1MA 3LB8C 1GAQB 2W55A 1CJEA 1N63A 4P6VF 1CZPA 1E9MA 1PUTA 1DOIA 1VLBA 4YTNB 4YTMB 1FFUA 1QOFA 3NVVA 3NRZA 4US9A 1NYRA 1DOXA 2WDRB 3HVZA 3AEEB 3W9CB 4US8A 4YSZB 1RWSA 3PO0A 2K5PA 2LEKA 3FC4A 3AE9B 1QOBA 1AYFA 1VDVA 1WYGA 4HRSA 2L52A 3VRBB 1XO3A 5EE1A 1J7BA 3AN1A 2Q5WD 1H7XA 1YJJA 1F0ZA 2M56B 2DWQA 1H7WA 1QLBB 3AE6B 1FRDA 2JQRB 4YSYB 4HROA 2WU5B 4YTPB 1JWBD 5H8YE 4ITKA 1JW9D 1QT9A 3P4RB 1L5PA 1T3QA 3AMZA 4FXCA 3NVWA 4A9AA 4C80A 3ETRA 3AEBB 3L4PA 2B76B 3AE7B 2BT6A 1N60A 2EKIA 2HTME 4N6EB 3B2GA 1JRPA 1JQ4A 1QF6A 3AEDB 3VR9B 1XLNA 2WU2B 3P4PB 1ZUD2 3VR8B 3HRDD 5EE3A 3P4QB 2CJNA 5EE9A 5AUKA 1R7SA 2ACZB 1ROEA 1OQRA 3P4SB 2CJOA 2DBYA 3KWLA 1NEKB 2JX5A 2N0SB 3W5UB 4YXDB 3AE1B 4JX1C 4N58A 1RFKA 1TKGA 1AWDA 1N5XA 4LTUA 5G5HA 5H92C 1N62A 3AV8A 3DWMA 2W3SA 2WP9B 4KX6B 4ZOHC 1TJEA 4IDIA 2BS3B 2WQYB 1FMAD 1JROA 2PKOA 1SB3C 1DGJA 1YJIA 2G1EA 1RM6C 3AE4B 1XLPA 1XLQA 2CU3A 3BIID 2WS3B 1I7HA 5GXGB 4JWUC 3W5VB 1ZOYB 2BS2B 1KRHA 1WGKA 5C2TB 2M19A 3SFDB 1V8CA 2PVGC 5AUIA 4YSXB 1KFYB 1ZP0B 3AEFB 1UWMA 2PVOD 2FBWB 3HUIA 4C7ZA 2QJLA 3NS1A 1FXIA 1GTHA 3B9JA 3CF4A 1IUEA 3AECB 1PDXA 1E10A 1ZXIA 4WWMA 1E6EB
chains in the Genus database with same CATH superfamily
3ZGZA 1NVID 3AEGB 1WF9A 4W9DA 1WXSA 2LI5A 1YOVB 1A70A 1P7EA 1WWTA 2K39A 4CQNA 2LWPA 1WR6E 3EECA 4HLEA 1NBFC 1UGMA 4JWSC 2C7MB 5IAAC 3NOBA 3ZW3A 2AYOB 4RM8A 1ZDVA 3SEBA 5BYRA 4NQLB 1WIAA 2MJEA 1WJNA 2K8HA 1DYQA 3U52E 2AL3A 2KHWB 3AU4A 4DBGA 3Q3JA 1V86A 3ZNHB 2C9WB 4I6PA 3SR6A 3UQAA 1V5TA 1DOYA 3X23A 2O6VA 1GTEA 2J0MA 5LXIB 4FULA 5L95C 3DVGY 5J17A 3PPAA 2JT4B 4KKJA 1ZW7A 3H6NA 1EM7A 4FLHA 3ZNZB 2WXPA 3IFWB 3QWZB 2GOWA 2ZVOA 3DHGC 3IG3A 2C5LC 1QLBB 4BKGA 4RF1A 1WJ6A 4WH4A 2KJ6A 2WU5B 2A4ZA 5DCNA 3P42A 3ML9A 3P4RB 5BYQA 2ZPNA 5CHVC 4DDGD 2G4SA 4LNNA 2HTHA 1HZ5A 4LNIA 4B95A 5HHDG 5AUKA 1MHXA 3PZDA 1YNTE 4NJCA 4ANXA 2VZKB 5JXVA 4YXDB 1TKGA 1N5XA 3V61A 1SGHA 4OHJA 1DGJA 4M8NA 2K8BA 3QX1A 2WXQA 1FCLA 1ZOYB 2BS2B 2PVGC 4YSXB 4K7WA 1L0XB 3KWVA 2WXJA 1MI0A 4F7ZA 1UWXA 2RDHA 1G6JA 2IJ0A 4IM0A 3RUIB 1J19A 4I6LB 3R7RA 3ZXVA 2RR9A 1HTOA 2FCSA 2ZEQA 1IP9A 4X57B 1UUPA 3QA8A 2GI9A 2Y5BB 3CMMB 3CSFA 3Q14C 1E8WA 2MBHA 2LVOA 4MEMA 1WM2A 3A33B 2MJDA 2RDGA 2V4IB 2CR5A 3LDZE 1GUAB 4ZRJA 1RLFA 2NS5A 4HDQA 3QHTA 1ET6A 3VH3B 4GDLB 5EE0A 2DLBA 1K8RB 2V3PA 1SE2A 1GB1A 5DPTA 3NVVA 2LJIA 1LQBA 5KHOA 2XBBC 4LJOB 4LDTD 2MCNB 2VRRB 3VAWA 1YJJA 4MM3A 5KHQA 3AE6B 3RNBC 4Q2JA 3UI3A 1T3QA 4FXCA 2KDEB 3ETRA 3AEBB 1BMLC 1AN8A 1FNUA 2GBRA 1QF6A 2WU2B 4HWIB 3ZQ4A 3BVMA 2WXMA 1WX7A 3ZDMC 2BQQA 4OVZA 1H8CA 2J42A 3W1YA 2UWQA 4FBJB 2WQYB 3O13A 2KX0A 1D5MC 3PGEA 1XLPA 4II3B 5CHFA 4K81A 1UWMA 1BUIC 3VTUA 1UF0A 2M4NA 3DBHI 2BPSA 1V49A 2NPTA 2QIEB 4N59A 1N61A 4BKTA 3DCGA 1F9JA 3NG0A 4EZLA 2GB1A 2H88B 3KUCB 3BVGA 3DBLI 4MSQB 4MSMB 2BYEA 4GIVA 2K25A 2L32A 4RF0A 4WJQA 2WNMA 1XT9B 3A1QB 4M00A 3SFEB 2JU6X 3IT6B 1UBIA 3Q3MC 2E6XA 1TY2A 1WGHA 2WDQB 2TSSA 1E0ZA 3R8BA 3AB5A 2MP2B 3T8MA 5D3IB 3WCQA 1FEHA 1F52A 4IWOA 3LB8C 3T9LA 1M4VA 1KLVA 1QOFA 3NRZA 2WXOA 4AJWA 2PTLA 4II2B 1C77A 5JH5C 4ZRQA 1JW9D 1QT9A 3ZRCA 3L4PA 1VRAB 3ZKJC 2IGGA 1N60A 2KKCA 1N6ZA 1JQ4A 2N9PC 3P4PB 2MW5A 3IHPC 1ROEA 1KLGD 4B9KA 2MRPA 3UF8A 1XCQL 4BZAA 2KDIA 3TEWA 3RZFA 4KIKA 2KK8A 4RGNA 5E6PA 1EWCA 1QQRA 2V0GA 1XLQA 4XX5A 3RCZA 5D6JB 3U7DA 3DVNV 4G50A 1C78A 2ZCBA 4K3BA 2KACA 1GTHA 1HQRD 1ZKHA 3I5JC 1E8ZA 4XDCA 4P16A 2DYMA 2D3BA 3W2DA 4A90A 1E5WA 3KUZA 3EUB2 1V81A 3QJZA 3L10B 3B0AA 3AE5B 4F1SA 2MH7A 5TR5A 3NZSA 5G55A 4HEA1 3ONSA 1SIFA 4A3OA 1GC7A 4WJPA 3V05A 2WX1A 1QZEA 2LASA 2NVUI 2J0KA 1OGWA 4M01A 5GMVA 1YJ1A 2BW2A 4W9GA 4DHJB 2KTRB 2KMMA 2K9XA 2DZJA 4UDUC 4HJKA 2IO1B 1JRUA 4KZCA 2MJ3A 5LNK1 4ZRKA 1WMHA 3DHHC 2W3RA 1XEEA 3MHZA 3W1SC 4S17A 2QCZA 3Q8CA 5AZFA 3VUXA 2CU1A 2Y3AA 3VRBB 2IGHA 1F0ZA 1H7WA 3V6CB 4H2AA 5T8IA 4KV2A 4OZAA 3HK0A 3N1ZC 3ZO5B 4W9KA 3ALBA 2BBCA 4KGTA 3AE7B 2EKIA 3T3NA 1JRPA 2UYZB 5D94A 3DBSA 2ACZB 2W9NA 1OQRA 2XK5B 2CJOA 2MHJA 2BGFA 4ANVA 4MGZE 3AE1B 5LXHA 1EUVB 4LLGM 4CYEA 3ZJTA 1HE8A 1RM6C 3AE4B 3U7ZA 3W5VB 2HJ1A 1FXIA 2PEAA 1K51A 1E10A 2G3QB 2Y5CA 1D4BA 1L4DB 2NTSA 1WJ4A 2LZ6A 1JALA 1UD7A 4M0WB 4EUTA 3AE2B 2MSED 2VZKD 3E9SA 2JWUA 3PHWB 3H1UA 4A3PA 2INDC 4WIPA 1WZ0A 1SXTA 3M63B 3MC0B 3L17A 2G4DB 1C76A 1FM0D 1FNWA 4K3CA 3PSEB 2L1AA 4F8CB 3I63C 3NVZA 4C7YA 4MGIE 2QSDA 3PREA 1P98A 1E9MA 1V2YA 1VLBA 1R4NI 3KQ4A 4WJNA 1HTQA 1HZ6A 1FPYA 4RMAA 1XO3A 4L2YA 5EE1A 2MBOA 3AN1A 3U8ZA 2Z0DB 4A9AA 1YD8U 3PRZA 4M8MA 2INCC 5EE3A 4WWNA 1OQYA 3V60A 1NEKB 2Z59B 2LUMA 3UGBB 3DWMA 4JGHB 4MACA 2G1EA 1Q10A 2JXXA 2KWCA 4D2KA 2CHXA 4R3DA 2KJHB 4TMAB 1TZ1A 4JWUC 1WGKA 4J6IA 1MVKA 2CS4A 1TIFA 3HUIA 3U30A 5J2RA 2KDFB 3VH4B 1ACCA 3I57A 1TS4A 1V1PA 2ZNVC 2BYTA 1FRRA 3R2TA 2L7RA 2O2VB 2J7QB 1ZGUB 4A55A 2NBUA 4IKGA 3ZNGC 2BYFA 3NVYA 4KSLC 1RYJA 1VCBA 1JCKB 1T0RC 3GE8C 2KT7A 4FJYA 1IBXB 2V4LA 1V9JA 4WURA 4PYUA 4B6WA 1GT8A 3CWIA 3GP7A 5DPWA 1WR1A 4HCPB 3TL5A 5DPSA 3AXCA 3FILB 2G45B 2PW9A 2XNAC 1FO4A 2BB5A 1E7PB 3QARA 2MBQA 2D5GA 3PVLA 4P6VF 1TT5B 4C4VB 1RAXA 1FD6A 1NYRA 4ASWC 1KM7A 4KGSA 3GB1A 5IO9A 2DNFA 2KN5A 2DWQA 5FR6A 2KOXA 4HKQA 3KH0A 1JWBD 3R7QA 1WSPA 3URYA 2KMCA 3TSSA 1J8CA 1LM8B 3VR9B 5BMIA 1JWSD 4GMVA 3PLVA 5HFYA 4M02A 2NR2A 3O65B 5BYSA 4BKSD 2R61A 2I2YA 4W9FA 1TJEA 3WAMA 2K6QA 1PQSA 1FNVA 1LXDA 3SFDB 3NZ3A 3BYYB 4ZRIA 3UIOB 2KWVB 2VH1A 3B9JA 4O1NA 4WWMA 2LD9A 1P1AA 3AU5A 3RFZB 5D7GA 1QOAA 2MWSB 1EU4A 2QHOA 1B9RA 2D3CA 4JIOU 3DWGC 2KC2A 3DBRB 1YN4A 2OEDA 2AX5A 1PFDA 2MQJA 2BS4B 1LGRA 3Q69A 2LHEA 2C60A 2RSUA 1D3ZA 3RNCC 4ZHOA 3RNAC 1QOGA 2EMTA 3PZ7A 1YQ3B 4EEWA 3RNEC 2K22A 3FKYA 3UINB 2KYWA 3NY5A 3ZVVA 4IC7B 1UNSA 4TKNA 4AOFA 3WANA 2W55A 3TEYA 2B3AA 3RT3B 4E71A 3TMPB 2KDBA 1Q1OA 3RYTA 2OJRA 1VDVA 4W9CA 1J7BA 2BTEA 4HJGE 2JYEA 5E6NA 5H8YE 2CKHB 3VDZA 1C79A 2PE9A 4DHJD 2L0TA 4RH6A 2RPQA 3Q2AC 2B76B 2BT6A 4GB9A 3B2GA 4E74A 1E7VA 4GSWA 5EE9A 2KVZA 2KQ7A 3GS2A 1P0RA 2V1YA 2O6VB 1BT0A 5G2NA 3K9PB 5G5HA 2N4FA 4KDLB 3AV8A 3IAS1 4RCOA 4LNOA 1KRHA 4XWTA 1R4MB 5AUIA 1KFYB 2PVOD 3KLSX 5IP4D 2M0XA 1BXTA 4LCDE 2LHDA 4JL9A 4GDKB 3A9KA 2SEBD 4NQKE 1KOTA 2AQ3B 2JYTA 4N9F4 2BKFA 1J7CA 2M0AA 4RGTA 4CHKA 1E8YA 3JSVA 3LJ3A 1TBEA 2J0JA 2GBMA 5JHBA 1D6EC 3S2AA 1EO6A 2L3ZA 3PS6A 2CHZA 3SU8X 3VRAB 4ARCA 1F2RI 1V97A 1CJEA 1N63A 2GLSA 1CZPA 4TUUA 4HPPA 2WDRB 4JLCA 3W9CB 1TY0A 1WX8A 1KLUD 1RWSA 4NAWA 3UIPB 4A6QA 3N9YC 2L52A 4NJ7A 4HDOA 1XXGA 2N9LA 3M95A 4YSYB 2FAZA 1U4AA 3NVWA 2WXGA 2BYVE 4ARIA 1GC6A 4MDKE 4AS1A 1YQBA 4IW0A 4OW0A 3EFCA 2FCNA 3DQVA 2N0SB 4G11A 2IO3B 4N58A 1K52A 3APCA 3H7PA 2FIDA 1SB3C 3BIID 3L13A 4DDID 3R3MA 3L16A 2IZVB 3RULA 2QJLA 1C4AA 3GZNI 2AWTA 1M94A 1AARA 1E6EB 1C4PA 3AE3B 2V3NA 2ZJDA 2HJ8A 3OJ4B 2L05A 5FKAC 1TKEA 3WAPA 3RI7C 3RNGC 1VZ8A 1S3SG 2FCQA 2E3TA 1EWYC 1QKZA 2L8JA 1F1HA 3NHEB 1A5RA 4K7UA 1NI3A 1FIQA 2OOBB 3CIRB 2ICIA 1V5OA 3DDCB 1I4GA 3A9JB 4RNAA 5HI1A 4AUQC 3GE3C 2R2OA 4KKIA 2DAFA 1OEYA 2KFKB 4WQMA 2N1VA 3AEAB 3MC8A 3VQIA 3PT2B 2NPTB 3Q8AA 4OZBA 1UELA 2YVCA 2N9KA 3P63A 2GBKA 5IA7A 1GOZA 4KZ0A 1PUTA 4XWWA 1DOXA 3PRPB 2LEKA 3N1XC 4FN2A 3QAQA 4WAAA 1H7XA 1JWUD 2M56B 1VD2A 4ITKA 3Q3NC 4W9EA 4FHJA 4FA6A 1C9FA 1PGAA 5JHAA 2PLPA 3P4QB 3VFKA 2RGFA 4IWPA 2FCMA 2LVQA 1K53A 4WJOA 4GXBA 4JX1C 1RFKA 4LTUA 3MP9A 1WXAA 2IPKD 1FMAD 2N9EB 3H7SA 2AQ2B 3ML8A 3ZIMA 1I7HA 4LNFA 1WGGA 2JWZA 4MELA 5LLIA 2ONQA 2IO0B 3OAWA 3RNFC 2K6DB 3AECB 1ZXIA 4NAMA 3OJ3A 1I42A 2PJHA 4REZA 1YQ4B 2AL6A 2WX0A 2JY6A 4AQ7A 1UH6A 2FNJB 3JYUA 3RN9C 1HA5A 2KQ4X 3MC9A 4MJSB 3U2SC 1LFDA 2BWFA 4RFBA 3HVDA 3QQ8B 4TQ1A 2DAJA 4KGRA 2G9HD 3KYDD 1JWAD 4E3CA 1CMXB 1I35A 1X1MA 4FADA 3V6EB 5L83A 2J4XA 2M1MA 1EF5A 1ZXHA 3AM9A 1Z2MA 4AP4C 3TCAA 2LVPA 2WLBA 1OQQA 3N1YC 1FFVA 4MGYE 2NBVB 3C0RB 1J7AA 4QAYA 1CQVA 1L0YB 2LMCA 3AULA 2IDYA 1IYFA 1TS3A 1MFWA 2N7JA 4YTMB 1T6BX 3SDLC 1F77A 1T0SC 4C00A 1V80A 4HK2A 3H8HA 1YN5A 3VUWA 5BO4B 4DXAB 3IT4B 4C80A 2WXHA 3VTWA 1IBXA 3DBHB 3Q8EA 2KDMA 2HDEA 3TEXA 4MGKE 2LJ5A 4JPSA 3FILA 1R7SA 1WMHB 3DBLB 3NUHB 3KUDB 1I4RA 2NMQA 4XZ4A 2FUG1 4RM9A 4BBNF 1AWDA 2A5UA 4C4VA 4DQOC 4MH0E 2WXIA 2C7NB 1WXVA 4MT5A 1Q0WB 1SEBD 3EC8A 2LGIA 1STEA 5GXGB 3X0WA 1V8CA 4JQWC 2FBWB 2JXTA 3CF4A 4OVVA 3JVZX 2DYOA 2LGYA 2KD0A 2KVRA 4PS8A 3ZRFA 2GRIA 3BK1A 2Z0EB 1UBQA 2ZW1A 5HG2A 5C3JB 1Z5SB 5J18A 2O6VD 2ZZPB 1Y8RC 3RPFC 5AZGA 1B1ZA 3B1LX 3JW0X 1Y56A 1GPXA 4P7IA 2WXNA 1WRIA 1TKYA 3I3TB 4HPLB 2MBEA 1XLOA 4IOIE 4FHKA 3VHTC 1WE6A 3C19A 1MG8A 2YEPB 2IYDB 3AH7A 1SE3A 2EELA 3L08A 1SIJA 2JPHA 1TGZB 1IGDA 2LGSA 2NCNA 3K9OB 2RDBC 3DVGX 4WWPA 3RZWC 3MTNB 5IN7A 3VVWB 1ET9A 1MPEA 1MHHE 2J53A 2N9XA 1TTNA 4A20A 3BVZA 3BY4B 3E56A 1YN3A 3NS8A 3TUOA 4HCNB 2MBBB 3HM6X 3NJTA 2KQSA 2JSVX 2JQRB 4ACFA 1K50A 3U4EG 3GOEA 3L54A 3L0WB 1WGYA 4ICVA 2KWDA 4K7SA 3AEDB 4EZJA 3P4SB 2DBYA 3CSTA 3APDA 2WXRA 1N62A 4HKZE 1KTKA 3R66C 4EE2A 2ZCCA 3IVFA 1LO5D 4KDIC 1IUEA 3DVNU 3ZUNA 1PGXA 4GDLA 3ABVB 1IGCA 4NJ6A 2KJRA 4AWJA 2W54A 2INNE 1PYWD 3MHSD 1V1OA 5DPRA 2BB6A 2X38A 2JRIB 3EGRA 3KVFB 2LXAA 2KLGA 4PYZA 2DZIA 2HD5B 2D11A 4FJZA 2AQ1B 4RGOS 2D3GA 2MLBA 1NDDA 4YWGG 1RFAA 2WGSA 4W9IA 2OHFA 3M3JA 1NYQA 4NY0A 3LYYA 4ZHPA 4GN1A 3CF6E 5D2MB 3EFUA 1I4QA 3PTFC 3MJ5A 4XDDA 1OEYJ 4GDKA 1NENB 3M62B 1V1PB 1WFYA 4DXGA 2FUHB 1DOIA 4YTNB 1P3QU 4US9A 2IBIB 1YX5B 1T0QC 3PZ8A 2Z8LA 2Q5WD 3VUYA 3PHXB 1I4XA 4HXDA 4YTPB 4DHZE 2WXKA 4AJYB 1CK1A 5BMHA 1WZ3A 2IY0B 1ZUD2 1SJHD 2LRWA 3BZDB 3KWLA 4XGAB 2DZMA 3IAM1 1S1QB 3IXSA 4XYCA 1WYWB 3A1QA 3ZXRA 2IGDA 1JMLA 1L2NA 1YJIA 3IBEA 2RD0A 2REXA 2KZRA 1FCCC 2QC8A 2JZPA 2K3UA 3ZNID 3MFGA 3AEFB 4MH8A 3WA0A 2IY1B 1WGDA 4GU2A 3T3OA 3SHQA 4OZCA 3QCAA 2MP2A 1NI2A 4B0MA 1GJZA 1RRBA 1AW7A 2ON8A 3BWUD 1L6VA 2W82A 1WRDB 3AI5A 1EF1A 4IUMB 2PE6B 4W9HA 4BKSA 1R4NB 4IM3A 2H89B 3WIMA 3TBLD 3RD2A 3P2BA 1SE4A 3PLUA 2JZZA 2M17A 1P9DU 4W9JA 3A4RA 4NZLB 4EZKA 2KLCA 1F2RC 1WX9A 5G5GA 3V62A 2N7EA 2WDVB 4NPNA 1WGRA 4WAFA 3QIJA 1TYGB 1HEZE 3EHVA 2AEHA 3FAHA 3H9DA 3OG5A 3EA6A 3ECIA 4BBNC 4K1RB 2LFIA 4KSKC 4BOSC 4YSZB 2K5PA 3AE9B 4GOCA 1QOBA 2OJWA 2DHZA 4HPMB 2BKRB 4PK1A 2GBNA 1FRDA 3Q8BA 1L5PA 3AMZA 4J3OD 3A9JA 3ZLZA 2MX2A 3ZTDA 2KFKA 3KW5B 2JF5A 2JRHA 1XLNA 2EMSA 5MPOA 3RMKC 2V9HA 1GG3A 5FK9C 1MJDA 2WHIA 1T0YA 2KMAA 5E6JA 5H92C 3D32A 1ZDXA 4WWOA 1MG4A 1P7FA 3KYCD 1L4ZB 1C1YB 3NZUA 5IKCM 4XC2A 4L1BA 5D3DA 4HVBA 2KTRA 1E90A 2INPE 4USAA 2KO3A 2DX5B 4TQ0A 1ZE3D 1T5XD 5BMGA 1KJTA 2ZNVB 1V6EA 2KXJA 4XE0A 1L0VB 4YT0B 1L6UA 4MM3B 4C56C 1KF6B 2V3SA 3UQBA 2QILA 4DK5A 5CX3A 3ZJVA 2DZKA 5JZEB 1C3TA 1SF0A 2LGXA 3VTVA 2KAJA 2N1WA 2XK5A 2KWUB 5E6OA 1UGJA 2MEKA 4TV3A 3PRMB 3A9KB 2SAKA 2WWZA 3VXWA 3BYTB 3JSVB 1E8XA 1WH3A 4MJSA 2JVCA 1XQQA 3HM3A 1FXTB 3PV1A 1VZ7A 3OWEB 1GNUA 2LGDA 1L7YA 4ZYNA 2HTME 2L00B 4M0WA 4CO7A 3TJPA 2D3AA 3HRDD 4DWFA 2CJNA 1WJUA 2BVCA 2DENB 2ASQA 4BAXA 2K1FA 4PT5A 3W5UB 4EKUA 5TSSA 4P1BC 2WP9B 1C4CA 2KX3A 2ZPYA 1ESFA 5I4DA 2ZVNA 2ZW0A 2JUOA 4NAWB 2CHWA 2BF8B 2XN9C 2KANA 4GLSC 2XEWA 4EOYA 3HHMA 2D07B 1PDXA 2WDTB 4OVUA 4I6NB 2UU7A 3Q8FA 3TEZA 4DXFA 1OFFA 1FXAA 5C1ZA 1QILA 1N5WA 4LK0M 4ZDVA 2PPHA 4DHZB 5AEKB 4W9LA 3AE8B 1H4RA 4URKA 4LDTB 2WXFA 2JZ3B 3H7PB 3I9V1 2FIFA 3ZTCA 1SBBB 3HIZA 2LRUA 4GGQA 1VJKA 4EFOA 4KVGB 1D5XC 4LJPB 2NTTA 4B0EA 3BK2A 1WXQA 3V3XA 1I4HA 1SE9A 3DOWA 3A4SC 1GAQB 4YL8A 5IOIA 2HE7A 3DBRI 3ZJUA 3WAOA 1FFUA 4KIKB 4BOZB 5HKHA 3HVZA 3DPDA 4BFRA 3PO0A 3ENEA 4PS3A 1E7UA 3FC4A 4LNKA 1WYGA 2LXCA 1OTRB 4ZRPA 2PMVA 2VH2A 3N20C 2KTFA 4ANUA 3APFA 3N3KB 5CTRC 2QDFA 2C7HA 5EDSA 1SSNA 2QEJC 4N6EB 2O2VA 2I38A 2J52A 2JX5A 3N32A 4WQOB 3R2IA 1D5ZC 3BINA 3WALA 4IG7B 3SD5A 4ICUA 4IDIA 2LUEA 1JROA 2CU3A 2WS3B 3QK0A 5C2TB 2M19A 4S0RA 2IO2B 4RGMA 1TS2A 4C7ZA 2R2QA 1TS5A 2KN4A 1WXMA 1XF5L 4PS7A 2PIAA 4NNJB 1ENFA 5FR3A 2RPVA 3B2FA 2I1JA 4P1CC 4IM2A 3ZYYX 2YLMA 1HXYD 5C23A 1GB4A 1WI0A 1WE7A 2FE8A 4TSSA 1YIWA 3Q3FA 1ZPSA 3ZDTA 1UZXB 2KC1A 3N30A 2L83A 1R4MI 3LXFA 2D10A 1YX6B 1SJED 1IPGA 1JWMD 3Q3OC 1YMHE 2MA9B 3Q6BA 1WM3A 2RMMA 4A8XC 3QC8B 1PGBA 5CHWA 1VR9A 2Y5PA 2WXLA 2QMTA 4BVUC 1J0GA 3P1MA 2GBJA 2M8SA 2DYBA 2K8CA 4IWQA 4L23A 3AEEB 3C8YA 4US8A 1AYFA 2N7DA 2K0PA 4HRSA 2YEPF 2WYQA 4JE3B 4FJVB 4HROA 2GMIC 4ZYSA 4G0NB 3DHIC 1I4PA 3GZNB 3J9CA 2EKEC 2KFJA 5AZHA 2X8XX 1EU3A 3VR8B 4G3XB 2I1KA 2L76A 1Q5WB 1VZ6A 1TZOA 3W1SA 3OLMD 1XCTL 2W3SA 4KX6B 4ZOHC 2D2QA 3TIXA 2BS3B 2PKOA 3B08A 4ANWA 3MJWA 1WY8A 1XD3B 2NBWB 1ZP0B 2L0FA 2KNBA 3NS1A 1ISNA 1KH0A 2BWES
chains in the Genus database with same CATH topology
1C4PA 3AE3B 2V3NA 2Y5CA 5FKAC 1D4BA 1L4DB 2ON8A 3BWUD 1TKEA 2NTSA 1L6VA 2W82A 1JALA 3ZGZA 1NVID 3AEGB 1VZ8A 3AE2B 2E3TA 2VZKD 3E9SA 1A70A 1EWYC 1P7EA 1WWTA 2JWUA 4CQNA 1QKZA 2H89B 4JWSC 1NI3A 1FIQA 4WIPA 1SE4A 1SXTA 3CIRB 1ZDVA 3SEBA 2ICIA 3MC0B 5BYRA 2MJEA 1I4GA 4NZLB 1DYQA 3U52E 1C76A 4RNAA 5HI1A 1F2RC 1FM0D 5G5GA 1FNWA 2WDVB 4KKIA 4WQMA 3SR6A 4WAFA 1TYGB 2L1AA 3AEAB 1HEZE 3VQIA 1DOYA 1GTEA 3NVZA 3Q8AA 4C7YA 4OZBA 2N9KA 3FAHA 3P63A 2QSDA 4KKJA 1GOZA 3EA6A 1E9MA 1VLBA 1PUTA 2LFIA 4XWWA 1EM7A 1DOXA 4YSZB 2K5PA 2LEKA 3KQ4A 3AE9B 1HZ6A 2WXPA 1QOBA 1XO3A 4L2YA 5EE1A 3AN1A 1H7XA 1JWUD 2M56B 1QLBB 4RF1A 4WH4A 1FRDA 2WU5B 4ITKA 3Q8BA 3P42A 3P4RB 1L5PA 5BYQA 3AMZA 4J3OD 4A9AA 1HZ5A 1C9FA 1PGAA 1XLNA 5EE3A 2PLPA 5HHDG 5MPOA 5AUKA 3P4QB 1MHXA 5FK9C 1NEKB 2LUMA 1YNTE 4NJCA 1K53A 2VZKB 5JXVA 4YXDB 4JX1C 1RFKA 1TKGA 4LTUA 1N5XA 5E6JA 5H92C 3DWMA 1ZDXA 1P7FA 3MP9A 2IPKD 1FMAD 1L4ZB 4MACA 4OHJA 1DGJA 2G1EA 1Q10A 4D2KA 2AQ2B 4R3DA 1FCLA 1I7HA 2WXQA 4TMAB 4JWUC 4L1BA 1ZOYB 2BS2B 1WGKA 2PVGC 1MVKA 5D3DA 4YSXB 1L0XB 3KWVA 3HUIA 2ONQA 2WXJA 1MI0A 1UWXA 2RDHA 3AECB 2INPE 1ZXIA 4USAA 2IJ0A 4NAMA 4REZA 1ACCA 1YQ4B 3I57A 4TQ0A 1ZE3D 1TS4A 1V1PA 1T5XD 4AQ7A 5BMGA 2BYTA 1FRRA 3R2TA 1HA5A 2KQ4X 4XE0A 4A55A 4IKGA 3U2SC 3NVYA 1L0VB 4YT0B 1RYJA 4RFBA 3HVDA 1L6UA 4TQ1A 4KGRA 1JCKB 1UUPA 2G9HD 4MM3B 2GI9A 4C56C 1KF6B 1JWAD 2QILA 2J4XA 3ZJVA 1IBXB 4WURA 2MJDA 2RDGA 1ZXHA 2V4IB 3AM9A 1GT8A 1SF0A 3CWIA 3GP7A 3FILB 2KAJA 1ET6A 2PW9A 2WLBA 4GDLB 2XNAC 5EE0A 1OQQA 1FFVA 1J7AA 1UGJA 2MEKA 1FO4A 2BB5A 1CQVA 1L0YB 1E7PB 2DLBA 2IDYA 1SE2A 2LMCA 1TS3A 2D5GA 2V3PA 4P6VF 1GB1A 2SAKA 2N7JA 4YTMB 1T6BX 3NVVA 1FD6A 1F77A 1NYRA 2LJIA 3BYTB 3H8HA 1YN5A 4KGSA 3GB1A 1YJJA 1VZ7A 3OWEB 2DWQA 3AE6B 4HKQA 1JWBD 1WSPA 4Q2JA 3IT4B 3URYA 3UI3A 4C80A 1T3QA 2WXHA 4FXCA 1IBXA 3Q8EA 3ETRA 2KDMA 3AEBB 1BMLC 2HDEA 1AN8A 3TEXA 3TSSA 1FNUA 2HTME 4JPSA 4M0WA 1QF6A 3FILA 3VR9B 2WU2B 3HRDD 2CJNA 3ZQ4A 1R7SA 3BVMA 2WXMA 1JWSD 3NUHB 5BMIA 4PT5A 1I4RA 2NMQA 2FUG1 3W5UB 5HFYA 1AWDA 5TSSA 4OVZA 4DQOC 5BYSA 2WXIA 2WP9B 2J42A 2R61A 2I2YA 1TJEA 2WQYB 1C4CA 3O13A 4MT5A 1D5MC 1SEBD 1XLPA 1ESFA 5I4DA 2LGIA 1STEA 5GXGB 2ZW0A 4NAWB 1FNVA 3SFDB 1V8CA 3NZ3A 3BYYB 2XN9C 1UWMA 4GLSC 2FBWB 1BUIC 2JXTA 3B9JA 4O1NA 3CF4A 4WWMA 1PDXA 2DYOA 3Q8FA 2QIEB 4N59A 3TEZA 1N61A 4DXFA 3RFZB 1OFFA 5D7GA 1FXAA 2GRIA 3BK1A 1QOAA 1EU4A 2ZW1A 5HG2A 5C3JB 1B9RA 1QILA 2GB1A 1N5WA 3DWGC 2H88B 4LK0M 3BVGA 3RPFC 1B1ZA 1YN4A 2L32A 2OEDA 2AX5A 4RF0A 1Y56A 1GPXA 3AE8B 1PFDA 3Q69A 2BS4B 2WNMA 2WXNA 1WRIA 1TKYA 2WXFA 2LHEA 3SFEB 4IOIE 1XLOA 2JU6X 3I9V1 4ZHOA 1SBBB 3IT6B 2YEPB 3AH7A 1SE3A 2EELA 1QOGA 3PZ7A 1SIJA 1YQ3B 2E6XA 2K22A 1VJKA 1TY2A 1D5XC 1IGDA 2WDQB 2TSSA 2NTTA 4B0EA 1E0ZA 3R8BA 3AB5A 3BK2A 1WXQA 3V3XA 5D3IB 1I4HA 3WCQA 1UNSA 1FEHA 3LB8C 1GAQB 2W55A 1M4VA 1ET9A 1MPEA 3TEYA 1MHHE 2J53A 3ZJUA 1FFUA 1QOFA 3NRZA 3BVZA 2WXOA 3HVZA 3E56A 1YN3A 3PO0A 3FC4A 3TUOA 1VDVA 1WYGA 1J7BA 2BTEA 4HJGE 4ZRPA 2JYEA 2PTLA 1C77A 2PMVA 2JSVX 2JQRB 4ZRQA 5H8YE 1C79A 1K50A 1JW9D 1QT9A 3U4EG 4RH6A 1SSNA 2QEJC 3L4PA 1VRAB 2B76B 2BT6A 2IGGA 1N60A 4N6EB 2KWDA 3B2GA 1JQ4A 3AEDB 5EE9A 3P4PB 3GS2A 1ROEA 3P4SB 2DBYA 2I38A 2J52A 2JX5A 1KLGD 3R2IA 1D5ZC 4OZCA 5G5HA 2WXRA 1N62A 1XCQL 3AV8A 3TEWA 4HKZE 1KTKA 3IAS1 4IDIA 1JROA 4RGNA 1EWCA 1QQRA 2V0GA 1XLQA 2CU3A 4RCOA 2WS3B 4EE2A 1KRHA 4XWTA 5C2TB 2M19A 5AUIA 1C78A 1KFYB 4RGMA 2PVOD 1TS2A 1LO5D 2KACA 3KLSX 4C7ZA 1TS5A 1GTHA 2KN4A 1XF5L 1HQRD 1IUEA 1BXTA 1PGXA 3ABVB 2LHDA 1IGCA 2PIAA 1ENFA 4XDCA 4P16A 5FR3A 2DYMA 2W54A 4GDKB 3W2DA 4A90A 2SEBD 2RPVA 3B2FA 2AQ3B 2INNE 1PYWD 2JYTA 3EUB2 3ZYYX 1J7CA 1HXYD 1V1OA 3AE5B 2M0AA 4RGTA 2MH7A 1GB4A 2BB6A 4HEA1 2X38A 2FE8A 3EGRA 3V05A 4TSSA 1ZPSA 2AQ1B 1D6EC 4RGOS 2L83A 3LXFA 2BW2A 1SJED 4YWGG 1JWMD 1YMHE 2OHFA 1NYQA 2KMMA 2K9XA 3LYYA 4ZHPA 3VRAB 4UDUC 2RMMA 4A8XC 1I4QA 4ARCA 2MJ3A 5LNK1 1PGBA 3MJ5A 1F2RI 2W3RA 1XEEA 3MHZA 4XDDA 1VR9A 2Y5PA 1V97A 1NENB 2WXLA 2QMTA 3P1MA 1V1PB 1CJEA 1N63A 3Q8CA 4DXGA 1CZPA 1DOIA 4YTNB 4US9A 4L23A 2WDRB 3AEEB 3C8YA 1TY0A 2Y3AA 3W9CB 1KLUD 1RWSA 4US8A 1AYFA 2K0PA 4HRSA 3N9YC 2L52A 3VRBB 3PZ8A 4A6QA 2Z8LA 2IGHA 2Q5WD 1F0ZA 2YEPF 1XXGA 4JE3B 2N9LA 1H7WA 4H2AA 1I4XA 4HROA 5T8IA 4YSYB 4YTPB 4ZYSA 4OZAA 1I4PA 2WXKA 3NVWA 2WXGA 1CK1A 2BBCA 5BMHA 3J9CA 4KGTA 3AE7B 2EKIA 3T3NA 4ARIA 1JRPA 1EU3A 1ZUD2 1SJHD 3VR8B 4AS1A 2ACZB 4OW0A 1OQRA 2CJOA 3BZDB 3KWLA 1VZ6A 3IAM1 2N0SB 1TZOA 3IXSA 4N58A 3AE1B 3W1SA 4LLGM 1K52A 1XCTL 2IGDA 2W3SA 1JMLA 4KX6B 4ZOHC 2BS3B 3ZJTA 2PKOA 1SB3C 1AW7A 1YJIA 1RM6C 3AE4B 3BIID 3U7ZA 3W5VB 1ZP0B 1FCCC 2JZPA 2K3UA 3MFGA 3AEFB 4MH8A 3T3OA 2QJLA 3NS1A 1FXIA 1K51A 1C4AA 1E10A 4B0MA 1KH0A 1E6EB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2Y5C A;  3ABV B;  3AE3 B;  4USA A;  2PIA A;  2QIE B;  4N59 A;  1TKE A;  1N61 A;  1L6V A;  1YQ4 B;  1OFF A;  5MPO A;  1FXA A;  1JAL A;  2W54 A;  1QOA A;  5C3J B;  1NVI D;  3B2F A;  3AEG B;  1B9R A;  3EUB 2;  1N5W A;  3DWG C;  1FRR A;  3ZYY X;  2H88 B;  3AE2 B;  1J7C A;  2E3T A;  3AE5 B;  3RPF C;  2MH7 A;  1A70 A;  1EWY C;  1WWT A;  2AX5 A;  1GPX A;  2H89 B;  3AE8 B;  1PFD A;  2BS4 B;  3NVY A;  1L0V B;  4YT0 B;  1RYJ A;  4JWS C;  1WRI A;  1TKY A;  3SFE B;  1L6U A;  1NI3 A;  1FIQ A;  1XLO A;  1KF6 B;  4ZHO A;  3CIR B;  1JWA D;  2L83 A;  3LXF A;  2MJE A;  3AH7 A;  1QOG A;  1SIJ A;  1YQ3 B;  1FM0 D;  2MJD A;  2K22 A;  1VJK A;  3AM9 A;  5G5G A;  2OHF A;  1GT8 A;  2WDV B;  1NYQ A;  1SF0 A;  3CWI A;  4WQM A;  2WDQ B;  3SR6 A;  2KMM A;  1E0Z A;  2K9X A;  1TYG B;  3AB5 A;  4ZHP A;  2KAJ A;  3AEA B;  3VRA B;  1DOY A;  1WXQ A;  2WLB A;  5EE0 A;  1OQQ A;  2MJ3 A;  1GTE A;  1FFV A;  3NVZ A;  2W3R A;  3WCQ A;  1J7A A;  4C7Y A;  1V97 A;  1FO4 A;  1NEN B;  3P63 A;  3FAH A;  1E7P B;  3P1M A;  3LB8 C;  1GAQ B;  2W55 A;  1CJE A;  1N63 A;  4P6V F;  1CZP A;  1E9M A;  1PUT A;  1DOI A;  1VLB A;  4YTN B;  4YTM B;  1FFU A;  1QOF A;  3NVV A;  3NRZ A;  4US9 A;  1NYR A;  1DOX A;  2WDR B;  3HVZ A;  3AEE B;  3W9C B;  4US8 A;  4YSZ B;  1RWS A;  3PO0 A;  2K5P A;  2LEK A;  3FC4 A;  3AE9 B;  1QOB A;  1AYF A;  1VDV A;  1WYG A;  4HRS A;  2L52 A;  3VRB B;  1XO3 A;  5EE1 A;  1J7B A;  3AN1 A;  2Q5W D;  1H7X A;  1YJJ A;  1F0Z A;  2M56 B;  2DWQ A;  1H7W A;  1QLB B;  3AE6 B;  1FRD A;  2JQR B;  4YSY B;  4HRO A;  2WU5 B;  4YTP B;  1JWB D;  5H8Y E;  4ITK A;  1JW9 D;  1QT9 A;  3P4R B;  1L5P A;  1T3Q A;  3AMZ A;  4FXC A;  3NVW A;  4A9A A;  4C80 A;  3ETR A;  3AEB B;  3L4P A;  2B76 B;  3AE7 B;  2BT6 A;  1N60 A;  2EKI A;  2HTM E;  4N6E B;  3B2G A;  1JRP A;  1JQ4 A;  1QF6 A;  3AED B;  3VR9 B;  1XLN A;  2WU2 B;  3P4P B;  1ZUD 2;  3VR8 B;  3HRD D;  5EE3 A;  3P4Q B;  2CJN A;  5EE9 A;  5AUK A;  1R7S A;  2ACZ B;  1ROE A;  1OQR A;  3P4S B;  2CJO A;  2DBY A;  3KWL A;  1NEK B;  2JX5 A;  2N0S B;  3W5U B;  4YXD B;  3AE1 B;  4JX1 C;  4N58 A;  1RFK A;  1TKG A;  1AWD A;  1N5X A;  4LTU A;  5G5H A;  5H92 C;  1N62 A;  3AV8 A;  3DWM A;  2W3S A;  2WP9 B;  4KX6 B;  4ZOH C;  1TJE A;  4IDI A;  2BS3 B;  2WQY B;  1FMA D;  1JRO A;  2PKO A;  1SB3 C;  1DGJ A;  1YJI A;  2G1E A;  1RM6 C;  3AE4 B;  1XLP A;  1XLQ A;  2CU3 A;  3BII D;  2WS3 B;  1I7H A;  5GXG B;  4JWU C;  3W5V B;  1ZOY B;  2BS2 B;  1KRH A;  1WGK A;  5C2T B;  2M19 A;  3SFD B;  1V8C A;  2PVG C;  5AUI A;  4YSX B;  1KFY B;  1ZP0 B;  3AEF B;  1UWM A;  2PVO D;  2FBW B;  3HUI A;  4C7Z A;  2QJL A;  3NS1 A;  1FXI A;  1GTH A;  3B9J A;  3CF4 A;  1IUE A;  3AEC B;  1PDX A;  1E10 A;  1ZXI A;  4WWM A;  1E6E B; 
#chains in the Genus database with same CATH topology
 3ZGZ A;  1NVI D;  3AEG B;  1WF9 A;  4W9D A;  1WXS A;  2LI5 A;  1YOV B;  1A70 A;  1P7E A;  1WWT A;  2K39 A;  4CQN A;  2LWP A;  1WR6 E;  3EEC A;  4HLE A;  1NBF C;  1UGM A;  4JWS C;  2C7M B;  5IAA C;  3NOB A;  3ZW3 A;  2AYO B;  4RM8 A;  1ZDV A;  3SEB A;  5BYR A;  4NQL B;  1WIA A;  2MJE A;  1WJN A;  2K8H A;  1DYQ A;  3U52 E;  2AL3 A;  2KHW B;  3AU4 A;  4DBG A;  3Q3J A;  1V86 A;  3ZNH B;  2C9W B;  4I6P A;  3SR6 A;  3UQA A;  1V5T A;  1DOY A;  3X23 A;  2O6V A;  1GTE A;  2J0M A;  5LXI B;  4FUL A;  5L95 C;  3DVG Y;  5J17 A;  3PPA A;  2JT4 B;  4KKJ A;  1ZW7 A;  3H6N A;  1EM7 A;  4FLH A;  3ZNZ B;  2WXP A;  3IFW B;  3QWZ B;  2GOW A;  2ZVO A;  3DHG C;  3IG3 A;  2C5L C;  1QLB B;  4BKG A;  4RF1 A;  1WJ6 A;  4WH4 A;  2KJ6 A;  2WU5 B;  2A4Z A;  5DCN A;  3P42 A;  3ML9 A;  3P4R B;  5BYQ A;  2ZPN A;  5CHV C;  4DDG D;  2G4S A;  4LNN A;  2HTH A;  1HZ5 A;  4LNI A;  4B95 A;  5HHD G;  5AUK A;  1MHX A;  3PZD A;  1YNT E;  4NJC A;  4ANX A;  2VZK B;  5JXV A;  4YXD B;  1TKG A;  1N5X A;  3V61 A;  1SGH A;  4OHJ A;  1DGJ A;  4M8N A;  2K8B A;  3QX1 A;  2WXQ A;  1FCL A;  1ZOY B;  2BS2 B;  2PVG C;  4YSX B;  4K7W A;  1L0X B;  3KWV A;  2WXJ A;  1MI0 A;  4F7Z A;  1UWX A;  2RDH A;  1G6J A;  2IJ0 A;  4IM0 A;  3RUI B;  1J19 A;  4I6L B;  3R7R A;  3ZXV A;  2RR9 A;  1HTO A;  2FCS A;  2ZEQ A;  1IP9 A;  4X57 B;  1UUP A;  3QA8 A;  2GI9 A;  2Y5B B;  3CMM B;  3CSF A;  3Q14 C;  1E8W A;  2MBH A;  2LVO A;  4MEM A;  1WM2 A;  3A33 B;  2MJD A;  2RDG A;  2V4I B;  2CR5 A;  3LDZ E;  1GUA B;  4ZRJ A;  1RLF A;  2NS5 A;  4HDQ A;  3QHT A;  1ET6 A;  3VH3 B;  4GDL B;  5EE0 A;  2DLB A;  1K8R B;  2V3P A;  1SE2 A;  1GB1 A;  5DPT A;  3NVV A;  2LJI A;  1LQB A;  5KHO A;  2XBB C;  4LJO B;  4LDT D;  2MCN B;  2VRR B;  3VAW A;  1YJJ A;  4MM3 A;  5KHQ A;  3AE6 B;  3RNB C;  4Q2J A;  3UI3 A;  1T3Q A;  4FXC A;  2KDE B;  3ETR A;  3AEB B;  1BML C;  1AN8 A;  1FNU A;  2GBR A;  1QF6 A;  2WU2 B;  4HWI B;  3ZQ4 A;  3BVM A;  2WXM A;  1WX7 A;  3ZDM C;  2BQQ A;  4OVZ A;  1H8C A;  2J42 A;  3W1Y A;  2UWQ A;  4FBJ B;  2WQY B;  3O13 A;  2KX0 A;  1D5M C;  3PGE A;  1XLP A;  4II3 B;  5CHF A;  4K81 A;  1UWM A;  1BUI C;  3VTU A;  1UF0 A;  2M4N A;  3DBH I;  2BPS A;  1V49 A;  2NPT A;  2QIE B;  4N59 A;  1N61 A;  4BKT A;  3DCG A;  1F9J A;  3NG0 A;  4EZL A;  2GB1 A;  2H88 B;  3KUC B;  3BVG A;  3DBL I;  4MSQ B;  4MSM B;  2BYE A;  4GIV A;  2K25 A;  2L32 A;  4RF0 A;  4WJQ A;  2WNM A;  1XT9 B;  3A1Q B;  4M00 A;  3SFE B;  2JU6 X;  3IT6 B;  1UBI A;  3Q3M C;  2E6X A;  1TY2 A;  1WGH A;  2WDQ B;  2TSS A;  1E0Z A;  3R8B A;  3AB5 A;  2MP2 B;  3T8M A;  5D3I B;  3WCQ A;  1FEH A;  1F52 A;  4IWO A;  3LB8 C;  3T9L A;  1M4V A;  1KLV A;  1QOF A;  3NRZ A;  2WXO A;  4AJW A;  2PTL A;  4II2 B;  1C77 A;  5JH5 C;  4ZRQ A;  1JW9 D;  1QT9 A;  3ZRC A;  3L4P A;  1VRA B;  3ZKJ C;  2IGG A;  1N60 A;  2KKC A;  1N6Z A;  1JQ4 A;  2N9P C;  3P4P B;  2MW5 A;  3IHP C;  1ROE A;  1KLG D;  4B9K A;  2MRP A;  3UF8 A;  1XCQ L;  4BZA A;  2KDI A;  3TEW A;  3RZF A;  4KIK A;  2KK8 A;  4RGN A;  5E6P A;  1EWC A;  1QQR A;  2V0G A;  1XLQ A;  4XX5 A;  3RCZ A;  5D6J B;  3U7D A;  3DVN V;  4G50 A;  1C78 A;  2ZCB A;  4K3B A;  2KAC A;  1GTH A;  1HQR D;  1ZKH A;  3I5J C;  1E8Z A;  4XDC A;  4P16 A;  2DYM A;  2D3B A;  3W2D A;  4A90 A;  1E5W A;  3KUZ A;  3EUB 2;  1V81 A;  3QJZ A;  3L10 B;  3B0A A;  3AE5 B;  4F1S A;  2MH7 A;  5TR5 A;  3NZS A;  5G55 A;  4HEA 1;  3ONS A;  1SIF A;  4A3O A;  1GC7 A;  4WJP A;  3V05 A;  2WX1 A;  1QZE A;  2LAS A;  2NVU I;  2J0K A;  1OGW A;  4M01 A;  5GMV A;  1YJ1 A;  2BW2 A;  4W9G A;  4DHJ B;  2KTR B;  2KMM A;  2K9X A;  2DZJ A;  4UDU C;  4HJK A;  2IO1 B;  1JRU A;  4KZC A;  2MJ3 A;  5LNK 1;  4ZRK A;  1WMH A;  3DHH C;  2W3R A;  1XEE A;  3MHZ A;  3W1S C;  4S17 A;  2QCZ A;  3Q8C A;  5AZF A;  3VUX A;  2CU1 A;  2Y3A A;  3VRB B;  2IGH A;  1F0Z A;  1H7W A;  3V6C B;  4H2A A;  5T8I A;  4KV2 A;  4OZA A;  3HK0 A;  3N1Z C;  3ZO5 B;  4W9K A;  3ALB A;  2BBC A;  4KGT A;  3AE7 B;  2EKI A;  3T3N A;  1JRP A;  2UYZ B;  5D94 A;  3DBS A;  2ACZ B;  2W9N A;  1OQR A;  2XK5 B;  2CJO A;  2MHJ A;  2BGF A;  4ANV A;  4MGZ E;  3AE1 B;  5LXH A;  1EUV B;  4LLG M;  4CYE A;  3ZJT A;  1HE8 A;  1RM6 C;  3AE4 B;  3U7Z A;  3W5V B;  2HJ1 A;  1FXI A;  2PEA A;  1K51 A;  1E10 A;  2G3Q B;  2Y5C A;  1D4B A;  1L4D B;  2NTS A;  1WJ4 A;  2LZ6 A;  1JAL A;  1UD7 A;  4M0W B;  4EUT A;  3AE2 B;  2MSE D;  2VZK D;  3E9S A;  2JWU A;  3PHW B;  3H1U A;  4A3P A;  2IND C;  4WIP A;  1WZ0 A;  1SXT A;  3M63 B;  3MC0 B;  3L17 A;  2G4D B;  1C76 A;  1FM0 D;  1FNW A;  4K3C A;  3PSE B;  2L1A A;  4F8C B;  3I63 C;  3NVZ A;  4C7Y A;  4MGI E;  2QSD A;  3PRE A;  1P98 A;  1E9M A;  1V2Y A;  1VLB A;  1R4N I;  3KQ4 A;  4WJN A;  1HTQ A;  1HZ6 A;  1FPY A;  4RMA A;  1XO3 A;  4L2Y A;  5EE1 A;  2MBO A;  3AN1 A;  3U8Z A;  2Z0D B;  4A9A A;  1YD8 U;  3PRZ A;  4M8M A;  2INC C;  5EE3 A;  4WWN A;  1OQY A;  3V60 A;  1NEK B;  2Z59 B;  2LUM A;  3UGB B;  3DWM A;  4JGH B;  4MAC A;  2G1E A;  1Q10 A;  2JXX A;  2KWC A;  4D2K A;  2CHX A;  4R3D A;  2KJH B;  4TMA B;  1TZ1 A;  4JWU C;  1WGK A;  4J6I A;  1MVK A;  2CS4 A;  1TIF A;  3HUI A;  3U30 A;  5J2R A;  2KDF B;  3VH4 B;  1ACC A;  3I57 A;  1TS4 A;  1V1P A;  2ZNV C;  2BYT A;  1FRR A;  3R2T A;  2L7R A;  2O2V B;  2J7Q B;  1ZGU B;  4A55 A;  2NBU A;  4IKG A;  3ZNG C;  2BYF A;  3NVY A;  4KSL C;  1RYJ A;  1VCB A;  1JCK B;  1T0R C;  3GE8 C;  2KT7 A;  4FJY A;  1IBX B;  2V4L A;  1V9J A;  4WUR A;  4PYU A;  4B6W A;  1GT8 A;  3CWI A;  3GP7 A;  5DPW A;  1WR1 A;  4HCP B;  3TL5 A;  5DPS A;  3AXC A;  3FIL B;  2G45 B;  2PW9 A;  2XNA C;  1FO4 A;  2BB5 A;  1E7P B;  3QAR A;  2MBQ A;  2D5G A;  3PVL A;  4P6V F;  1TT5 B;  4C4V B;  1RAX A;  1FD6 A;  1NYR A;  4ASW C;  1KM7 A;  4KGS A;  3GB1 A;  5IO9 A;  2DNF A;  2KN5 A;  2DWQ A;  5FR6 A;  2KOX A;  4HKQ A;  3KH0 A;  1JWB D;  3R7Q A;  1WSP A;  3URY A;  2KMC A;  3TSS A;  1J8C A;  1LM8 B;  3VR9 B;  5BMI A;  1JWS D;  4GMV A;  3PLV A;  5HFY A;  4M02 A;  2NR2 A;  3O65 B;  5BYS A;  4BKS D;  2R61 A;  2I2Y A;  4W9F A;  1TJE A;  3WAM A;  2K6Q A;  1PQS A;  1FNV A;  1LXD A;  3SFD B;  3NZ3 A;  3BYY B;  4ZRI A;  3UIO B;  2KWV B;  2VH1 A;  3B9J A;  4O1N A;  4WWM A;  2LD9 A;  1P1A A;  3AU5 A;  3RFZ B;  5D7G A;  1QOA A;  2MWS B;  1EU4 A;  2QHO A;  1B9R A;  2D3C A;  4JIO U;  3DWG C;  2KC2 A;  3DBR B;  1YN4 A;  2OED A;  2AX5 A;  1PFD A;  2MQJ A;  2BS4 B;  1LGR A;  3Q69 A;  2LHE A;  2C60 A;  2RSU A;  1D3Z A;  3RNC C;  4ZHO A;  3RNA C;  1QOG A;  2EMT A;  3PZ7 A;  1YQ3 B;  4EEW A;  3RNE C;  2K22 A;  3FKY A;  3UIN B;  2KYW A;  3NY5 A;  3ZVV A;  4IC7 B;  1UNS A;  4TKN A;  4AOF A;  3WAN A;  2W55 A;  3TEY A;  2B3A A;  3RT3 B;  4E71 A;  3TMP B;  2KDB A;  1Q1O A;  3RYT A;  2OJR A;  1VDV A;  4W9C A;  1J7B A;  2BTE A;  4HJG E;  2JYE A;  5E6N A;  5H8Y E;  2CKH B;  3VDZ A;  1C79 A;  2PE9 A;  4DHJ D;  2L0T A;  4RH6 A;  2RPQ A;  3Q2A C;  2B76 B;  2BT6 A;  4GB9 A;  3B2G A;  4E74 A;  1E7V A;  4GSW A;  5EE9 A;  2KVZ A;  2KQ7 A;  3GS2 A;  1P0R A;  2V1Y A;  2O6V B;  1BT0 A;  5G2N A;  3K9P B;  5G5H A;  2N4F A;  4KDL B;  3AV8 A;  3IAS 1;  4RCO A;  4LNO A;  1KRH A;  4XWT A;  1R4M B;  5AUI A;  1KFY B;  2PVO D;  3KLS X;  5IP4 D;  2M0X A;  1BXT A;  4LCD E;  2LHD A;  4JL9 A;  4GDK B;  3A9K A;  2SEB D;  4NQK E;  1KOT A;  2AQ3 B;  2JYT A;  4N9F 4;  2BKF A;  1J7C A;  2M0A A;  4RGT A;  4CHK A;  1E8Y A;  3JSV A;  3LJ3 A;  1TBE A;  2J0J A;  2GBM A;  5JHB A;  1D6E C;  3S2A A;  1EO6 A;  2L3Z A;  3PS6 A;  2CHZ A;  3SU8 X;  3VRA B;  4ARC A;  1F2R I;  1V97 A;  1CJE A;  1N63 A;  2GLS A;  1CZP A;  4TUU A;  4HPP A;  2WDR B;  4JLC A;  3W9C B;  1TY0 A;  1WX8 A;  1KLU D;  1RWS A;  4NAW A;  3UIP B;  4A6Q A;  3N9Y C;  2L52 A;  4NJ7 A;  4HDO A;  1XXG A;  2N9L A;  3M95 A;  4YSY B;  2FAZ A;  1U4A A;  3NVW A;  2WXG A;  2BYV E;  4ARI A;  1GC6 A;  4MDK E;  4AS1 A;  1YQB A;  4IW0 A;  4OW0 A;  3EFC A;  2FCN A;  3DQV A;  2N0S B;  4G11 A;  2IO3 B;  4N58 A;  1K52 A;  3APC A;  3H7P A;  2FID A;  1SB3 C;  3BII D;  3L13 A;  4DDI D;  3R3M A;  3L16 A;  2IZV B;  3RUL A;  2QJL A;  1C4A A;  3GZN I;  2AWT A;  1M94 A;  1AAR A;  1E6E B;  1C4P A;  3AE3 B;  2V3N A;  2ZJD A;  2HJ8 A;  3OJ4 B;  2L05 A;  5FKA C;  1TKE A;  3WAP A;  3RI7 C;  3RNG C;  1VZ8 A;  1S3S G;  2FCQ A;  2E3T A;  1EWY C;  1QKZ A;  2L8J A;  1F1H A;  3NHE B;  1A5R A;  4K7U A;  1NI3 A;  1FIQ A;  2OOB B;  3CIR B;  2ICI A;  1V5O A;  3DDC B;  1I4G A;  3A9J B;  4RNA A;  5HI1 A;  4AUQ C;  3GE3 C;  2R2O A;  4KKI A;  2DAF A;  1OEY A;  2KFK B;  4WQM A;  2N1V A;  3AEA B;  3MC8 A;  3VQI A;  3PT2 B;  2NPT B;  3Q8A A;  4OZB A;  1UEL A;  2YVC A;  2N9K A;  3P63 A;  2GBK A;  5IA7 A;  1GOZ A;  4KZ0 A;  1PUT A;  4XWW A;  1DOX A;  3PRP B;  2LEK A;  3N1X C;  4FN2 A;  3QAQ A;  4WAA A;  1H7X A;  1JWU D;  2M56 B;  1VD2 A;  4ITK A;  3Q3N C;  4W9E A;  4FHJ A;  4FA6 A;  1C9F A;  1PGA A;  5JHA A;  2PLP A;  3P4Q B;  3VFK A;  2RGF A;  4IWP A;  2FCM A;  2LVQ A;  1K53 A;  4WJO A;  4GXB A;  4JX1 C;  1RFK A;  4LTU A;  3MP9 A;  1WXA A;  2IPK D;  1FMA D;  2N9E B;  3H7S A;  2AQ2 B;  3ML8 A;  3ZIM A;  1I7H A;  4LNF A;  1WGG A;  2JWZ A;  4MEL A;  5LLI A;  2ONQ A;  2IO0 B;  3OAW A;  3RNF C;  2K6D B;  3AEC B;  1ZXI A;  4NAM A;  3OJ3 A;  1I42 A;  2PJH A;  4REZ A;  1YQ4 B;  2AL6 A;  2WX0 A;  2JY6 A;  4AQ7 A;  1UH6 A;  2FNJ B;  3JYU A;  3RN9 C;  1HA5 A;  2KQ4 X;  3MC9 A;  4MJS B;  3U2S C;  1LFD A;  2BWF A;  4RFB A;  3HVD A;  3QQ8 B;  4TQ1 A;  2DAJ A;  4KGR A;  2G9H D;  3KYD D;  1JWA D;  4E3C A;  1CMX B;  1I35 A;  1X1M A;  4FAD A;  3V6E B;  5L83 A;  2J4X A;  2M1M A;  1EF5 A;  1ZXH A;  3AM9 A;  1Z2M A;  4AP4 C;  3TCA A;  2LVP A;  2WLB A;  1OQQ A;  3N1Y C;  1FFV A;  4MGY E;  2NBV B;  3C0R B;  1J7A A;  4QAY A;  1CQV A;  1L0Y B;  2LMC A;  3AUL A;  2IDY A;  1IYF A;  1TS3 A;  1MFW A;  2N7J A;  4YTM B;  1T6B X;  3SDL C;  1F77 A;  1T0S C;  4C00 A;  1V80 A;  4HK2 A;  3H8H A;  1YN5 A;  3VUW A;  5BO4 B;  4DXA B;  3IT4 B;  4C80 A;  2WXH A;  3VTW A;  1IBX A;  3DBH B;  3Q8E A;  2KDM A;  2HDE A;  3TEX A;  4MGK E;  2LJ5 A;  4JPS A;  3FIL A;  1R7S A;  1WMH B;  3DBL B;  3NUH B;  3KUD B;  1I4R A;  2NMQ A;  4XZ4 A;  2FUG 1;  4RM9 A;  4BBN F;  1AWD A;  2A5U A;  4C4V A;  4DQO C;  4MH0 E;  2WXI A;  2C7N B;  1WXV A;  4MT5 A;  1Q0W B;  1SEB D;  3EC8 A;  2LGI A;  1STE A;  5GXG B;  3X0W A;  1V8C A;  4JQW C;  2FBW B;  2JXT A;  3CF4 A;  4OVV A;  3JVZ X;  2DYO A;  2LGY A;  2KD0 A;  2KVR A;  4PS8 A;  3ZRF A;  2GRI A;  3BK1 A;  2Z0E B;  1UBQ A;  2ZW1 A;  5HG2 A;  5C3J B;  1Z5S B;  5J18 A;  2O6V D;  2ZZP B;  1Y8R C;  3RPF C;  5AZG A;  1B1Z A;  3B1L X;  3JW0 X;  1Y56 A;  1GPX A;  4P7I A;  2WXN A;  1WRI A;  1TKY A;  3I3T B;  4HPL B;  2MBE A;  1XLO A;  4IOI E;  4FHK A;  3VHT C;  1WE6 A;  3C19 A;  1MG8 A;  2YEP B;  2IYD B;  3AH7 A;  1SE3 A;  2EEL A;  3L08 A;  1SIJ A;  2JPH A;  1TGZ B;  1IGD A;  2LGS A;  2NCN A;  3K9O B;  2RDB C;  3DVG X;  4WWP A;  3RZW C;  3MTN B;  5IN7 A;  3VVW B;  1ET9 A;  1MPE A;  1MHH E;  2J53 A;  2N9X A;  1TTN A;  4A20 A;  3BVZ A;  3BY4 B;  3E56 A;  1YN3 A;  3NS8 A;  3TUO A;  4HCN B;  2MBB B;  3HM6 X;  3NJT A;  2KQS A;  2JSV X;  2JQR B;  4ACF A;  1K50 A;  3U4E G;  3GOE A;  3L54 A;  3L0W B;  1WGY A;  4ICV A;  2KWD A;  4K7S A;  3AED B;  4EZJ A;  3P4S B;  2DBY A;  3CST A;  3APD A;  2WXR A;  1N62 A;  4HKZ E;  1KTK A;  3R66 C;  4EE2 A;  2ZCC A;  3IVF A;  1LO5 D;  4KDI C;  1IUE A;  3DVN U;  3ZUN A;  1PGX A;  4GDL A;  3ABV B;  1IGC A;  4NJ6 A;  2KJR A;  4AWJ A;  2W54 A;  2INN E;  1PYW D;  3MHS D;  1V1O A;  5DPR A;  2BB6 A;  2X38 A;  2JRI B;  3EGR A;  3KVF B;  2LXA A;  2KLG A;  4PYZ A;  2DZI A;  2HD5 B;  2D11 A;  4FJZ A;  2AQ1 B;  4RGO S;  2D3G A;  2MLB A;  1NDD A;  4YWG G;  1RFA A;  2WGS A;  4W9I A;  2OHF A;  3M3J A;  1NYQ A;  4NY0 A;  3LYY A;  4ZHP A;  4GN1 A;  3CF6 E;  5D2M B;  3EFU A;  1I4Q A;  3PTF C;  3MJ5 A;  4XDD A;  1OEY J;  4GDK A;  1NEN B;  3M62 B;  1V1P B;  1WFY A;  4DXG A;  2FUH B;  1DOI A;  4YTN B;  1P3Q U;  4US9 A;  2IBI B;  1YX5 B;  1T0Q C;  3PZ8 A;  2Z8L A;  2Q5W D;  3VUY A;  3PHX B;  1I4X A;  4HXD A;  4YTP B;  4DHZ E;  2WXK A;  4AJY B;  1CK1 A;  5BMH A;  1WZ3 A;  2IY0 B;  1ZUD 2;  1SJH D;  2LRW A;  3BZD B;  3KWL A;  4XGA B;  2DZM A;  3IAM 1;  1S1Q B;  3IXS A;  4XYC A;  1WYW B;  3A1Q A;  3ZXR A;  2IGD A;  1JML A;  1L2N A;  1YJI A;  3IBE A;  2RD0 A;  2REX A;  2KZR A;  1FCC C;  2QC8 A;  2JZP A;  2K3U A;  3ZNI D;  3MFG A;  3AEF B;  4MH8 A;  3WA0 A;  2IY1 B;  1WGD A;  4GU2 A;  3T3O A;  3SHQ A;  4OZC A;  3QCA A;  2MP2 A;  1NI2 A;  4B0M A;  1GJZ A;  1RRB A;  1AW7 A;  2ON8 A;  3BWU D;  1L6V A;  2W82 A;  1WRD B;  3AI5 A;  1EF1 A;  4IUM B;  2PE6 B;  4W9H A;  4BKS A;  1R4N B;  4IM3 A;  2H89 B;  3WIM A;  3TBL D;  3RD2 A;  3P2B A;  1SE4 A;  3PLU A;  2JZZ A;  2M17 A;  1P9D U;  4W9J A;  3A4R A;  4NZL B;  4EZK A;  2KLC A;  1F2R C;  1WX9 A;  5G5G A;  3V62 A;  2N7E A;  2WDV B;  4NPN A;  1WGR A;  4WAF A;  3QIJ A;  1TYG B;  1HEZ E;  3EHV A;  2AEH A;  3FAH A;  3H9D A;  3OG5 A;  3EA6 A;  3ECI A;  4BBN C;  4K1R B;  2LFI A;  4KSK C;  4BOS C;  4YSZ B;  2K5P A;  3AE9 B;  4GOC A;  1QOB A;  2OJW A;  2DHZ A;  4HPM B;  2BKR B;  4PK1 A;  2GBN A;  1FRD A;  3Q8B A;  1L5P A;  3AMZ A;  4J3O D;  3A9J A;  3ZLZ A;  2MX2 A;  3ZTD A;  2KFK A;  3KW5 B;  2JF5 A;  2JRH A;  1XLN A;  2EMS A;  5MPO A;  3RMK C;  2V9H A;  1GG3 A;  5FK9 C;  1MJD A;  2WHI A;  1T0Y A;  2KMA A;  5E6J A;  5H92 C;  3D32 A;  1ZDX A;  4WWO A;  1MG4 A;  1P7F A;  3KYC D;  1L4Z B;  1C1Y B;  3NZU A;  5IKC M;  4XC2 A;  4L1B A;  5D3D A;  4HVB A;  2KTR A;  1E90 A;  2INP E;  4USA A;  2KO3 A;  2DX5 B;  4TQ0 A;  1ZE3 D;  1T5X D;  5BMG A;  1KJT A;  2ZNV B;  1V6E A;  2KXJ A;  4XE0 A;  1L0V B;  4YT0 B;  1L6U A;  4MM3 B;  4C56 C;  1KF6 B;  2V3S A;  3UQB A;  2QIL A;  4DK5 A;  5CX3 A;  3ZJV A;  2DZK A;  5JZE B;  1C3T A;  1SF0 A;  2LGX A;  3VTV A;  2KAJ A;  2N1W A;  2XK5 A;  2KWU B;  5E6O A;  1UGJ A;  2MEK A;  4TV3 A;  3PRM B;  3A9K B;  2SAK A;  2WWZ A;  3VXW A;  3BYT B;  3JSV B;  1E8X A;  1WH3 A;  4MJS A;  2JVC A;  1XQQ A;  3HM3 A;  1FXT B;  3PV1 A;  1VZ7 A;  3OWE B;  1GNU A;  2LGD A;  1L7Y A;  4ZYN A;  2HTM E;  2L00 B;  4M0W A;  4CO7 A;  3TJP A;  2D3A A;  3HRD D;  4DWF A;  2CJN A;  1WJU A;  2BVC A;  2DEN B;  2ASQ A;  4BAX A;  2K1F A;  4PT5 A;  3W5U B;  4EKU A;  5TSS A;  4P1B C;  2WP9 B;  1C4C A;  2KX3 A;  2ZPY A;  1ESF A;  5I4D A;  2ZVN A;  2ZW0 A;  2JUO A;  4NAW B;  2CHW A;  2BF8 B;  2XN9 C;  2KAN A;  4GLS C;  2XEW A;  4EOY A;  3HHM A;  2D07 B;  1PDX A;  2WDT B;  4OVU A;  4I6N B;  2UU7 A;  3Q8F A;  3TEZ A;  4DXF A;  1OFF A;  1FXA A;  5C1Z A;  1QIL A;  1N5W A;  4LK0 M;  4ZDV A;  2PPH A;  4DHZ B;  5AEK B;  4W9L A;  3AE8 B;  1H4R A;  4URK A;  4LDT B;  2WXF A;  2JZ3 B;  3H7P B;  3I9V 1;  2FIF A;  3ZTC A;  1SBB B;  3HIZ A;  2LRU A;  4GGQ A;  1VJK A;  4EFO A;  4KVG B;  1D5X C;  4LJP B;  2NTT A;  4B0E A;  3BK2 A;  1WXQ A;  3V3X A;  1I4H A;  1SE9 A;  3DOW A;  3A4S C;  1GAQ B;  4YL8 A;  5IOI A;  2HE7 A;  3DBR I;  3ZJU A;  3WAO A;  1FFU A;  4KIK B;  4BOZ B;  5HKH A;  3HVZ A;  3DPD A;  4BFR A;  3PO0 A;  3ENE A;  4PS3 A;  1E7U A;  3FC4 A;  4LNK A;  1WYG A;  2LXC A;  1OTR B;  4ZRP A;  2PMV A;  2VH2 A;  3N20 C;  2KTF A;  4ANU A;  3APF A;  3N3K B;  5CTR C;  2QDF A;  2C7H A;  5EDS A;  1SSN A;  2QEJ C;  4N6E B;  2O2V A;  2I38 A;  2J52 A;  2JX5 A;  3N32 A;  4WQO B;  3R2I A;  1D5Z C;  3BIN A;  3WAL A;  4IG7 B;  3SD5 A;  4ICU A;  4IDI A;  2LUE A;  1JRO A;  2CU3 A;  2WS3 B;  3QK0 A;  5C2T B;  2M19 A;  4S0R A;  2IO2 B;  4RGM A;  1TS2 A;  4C7Z A;  2R2Q A;  1TS5 A;  2KN4 A;  1WXM A;  1XF5 L;  4PS7 A;  2PIA A;  4NNJ B;  1ENF A;  5FR3 A;  2RPV A;  3B2F A;  2I1J A;  4P1C C;  4IM2 A;  3ZYY X;  2YLM A;  1HXY D;  5C23 A;  1GB4 A;  1WI0 A;  1WE7 A;  2FE8 A;  4TSS A;  1YIW A;  3Q3F A;  1ZPS A;  3ZDT A;  1UZX B;  2KC1 A;  3N30 A;  2L83 A;  1R4M I;  3LXF A;  2D10 A;  1YX6 B;  1SJE D;  1IPG A;  1JWM D;  3Q3O C;  1YMH E;  2MA9 B;  3Q6B A;  1WM3 A;  2RMM A;  4A8X C;  3QC8 B;  1PGB A;  5CHW A;  1VR9 A;  2Y5P A;  2WXL A;  2QMT A;  4BVU C;  1J0G A;  3P1M A;  2GBJ A;  2M8S A;  2DYB A;  2K8C A;  4IWQ A;  4L23 A;  3AEE B;  3C8Y A;  4US8 A;  1AYF A;  2N7D A;  2K0P A;  4HRS A;  2YEP F;  2WYQ A;  4JE3 B;  4FJV B;  4HRO A;  2GMI C;  4ZYS A;  4G0N B;  3DHI C;  1I4P A;  3GZN B;  3J9C A;  2EKE C;  2KFJ A;  5AZH A;  2X8X X;  1EU3 A;  3VR8 B;  4G3X B;  2I1K A;  2L76 A;  1Q5W B;  1VZ6 A;  1TZO A;  3W1S A;  3OLM D;  1XCT L;  2W3S A;  4KX6 B;  4ZOH C;  2D2Q A;  3TIX A;  2BS3 B;  2PKO A;  3B08 A;  4ANW A;  3MJW A;  1WY8 A;  1XD3 B;  2NBW B;  1ZP0 B;  2L0F A;  2KNB A;  3NS1 A;  1ISN A;  1KH0 A;  2BWE S; 
#chains in the Genus database with same CATH homology
 1C4P A;  3AE3 B;  2V3N A;  2Y5C A;  5FKA C;  1D4B A;  1L4D B;  2ON8 A;  3BWU D;  1TKE A;  2NTS A;  1L6V A;  2W82 A;  1JAL A;  3ZGZ A;  1NVI D;  3AEG B;  1VZ8 A;  3AE2 B;  2E3T A;  2VZK D;  3E9S A;  1A70 A;  1EWY C;  1P7E A;  1WWT A;  2JWU A;  4CQN A;  1QKZ A;  2H89 B;  4JWS C;  1NI3 A;  1FIQ A;  4WIP A;  1SE4 A;  1SXT A;  3CIR B;  1ZDV A;  3SEB A;  2ICI A;  3MC0 B;  5BYR A;  2MJE A;  1I4G A;  4NZL B;  1DYQ A;  3U52 E;  1C76 A;  4RNA A;  5HI1 A;  1F2R C;  1FM0 D;  5G5G A;  1FNW A;  2WDV B;  4KKI A;  4WQM A;  3SR6 A;  4WAF A;  1TYG B;  2L1A A;  3AEA B;  1HEZ E;  3VQI A;  1DOY A;  1GTE A;  3NVZ A;  3Q8A A;  4C7Y A;  4OZB A;  2N9K A;  3FAH A;  3P63 A;  2QSD A;  4KKJ A;  1GOZ A;  3EA6 A;  1E9M A;  1VLB A;  1PUT A;  2LFI A;  4XWW A;  1EM7 A;  1DOX A;  4YSZ B;  2K5P A;  2LEK A;  3KQ4 A;  3AE9 B;  1HZ6 A;  2WXP A;  1QOB A;  1XO3 A;  4L2Y A;  5EE1 A;  3AN1 A;  1H7X A;  1JWU D;  2M56 B;  1QLB B;  4RF1 A;  4WH4 A;  1FRD A;  2WU5 B;  4ITK A;  3Q8B A;  3P42 A;  3P4R B;  1L5P A;  5BYQ A;  3AMZ A;  4J3O D;  4A9A A;  1HZ5 A;  1C9F A;  1PGA A;  1XLN A;  5EE3 A;  2PLP A;  5HHD G;  5MPO A;  5AUK A;  3P4Q B;  1MHX A;  5FK9 C;  1NEK B;  2LUM A;  1YNT E;  4NJC A;  1K53 A;  2VZK B;  5JXV A;  4YXD B;  4JX1 C;  1RFK A;  1TKG A;  4LTU A;  1N5X A;  5E6J A;  5H92 C;  3DWM A;  1ZDX A;  1P7F A;  3MP9 A;  2IPK D;  1FMA D;  1L4Z B;  4MAC A;  4OHJ A;  1DGJ A;  2G1E A;  1Q10 A;  4D2K A;  2AQ2 B;  4R3D A;  1FCL A;  1I7H A;  2WXQ A;  4TMA B;  4JWU C;  4L1B A;  1ZOY B;  2BS2 B;  1WGK A;  2PVG C;  1MVK A;  5D3D A;  4YSX B;  1L0X B;  3KWV A;  3HUI A;  2ONQ A;  2WXJ A;  1MI0 A;  1UWX A;  2RDH A;  3AEC B;  2INP E;  1ZXI A;  4USA A;  2IJ0 A;  4NAM A;  4REZ A;  1ACC A;  1YQ4 B;  3I57 A;  4TQ0 A;  1ZE3 D;  1TS4 A;  1V1P A;  1T5X D;  4AQ7 A;  5BMG A;  2BYT A;  1FRR A;  3R2T A;  1HA5 A;  2KQ4 X;  4XE0 A;  4A55 A;  4IKG A;  3U2S C;  3NVY A;  1L0V B;  4YT0 B;  1RYJ A;  4RFB A;  3HVD A;  1L6U A;  4TQ1 A;  4KGR A;  1JCK B;  1UUP A;  2G9H D;  4MM3 B;  2GI9 A;  4C56 C;  1KF6 B;  1JWA D;  2QIL A;  2J4X A;  3ZJV A;  1IBX B;  4WUR A;  2MJD A;  2RDG A;  1ZXH A;  2V4I B;  3AM9 A;  1GT8 A;  1SF0 A;  3CWI A;  3GP7 A;  3FIL B;  2KAJ A;  1ET6 A;  2PW9 A;  2WLB A;  4GDL B;  2XNA C;  5EE0 A;  1OQQ A;  1FFV A;  1J7A A;  1UGJ A;  2MEK A;  1FO4 A;  2BB5 A;  1CQV A;  1L0Y B;  1E7P B;  2DLB A;  2IDY A;  1SE2 A;  2LMC A;  1TS3 A;  2D5G A;  2V3P A;  4P6V F;  1GB1 A;  2SAK A;  2N7J A;  4YTM B;  1T6B X;  3NVV A;  1FD6 A;  1F77 A;  1NYR A;  2LJI A;  3BYT B;  3H8H A;  1YN5 A;  4KGS A;  3GB1 A;  1YJJ A;  1VZ7 A;  3OWE B;  2DWQ A;  3AE6 B;  4HKQ A;  1JWB D;  1WSP A;  4Q2J A;  3IT4 B;  3URY A;  3UI3 A;  4C80 A;  1T3Q A;  2WXH A;  4FXC A;  1IBX A;  3Q8E A;  3ETR A;  2KDM A;  3AEB B;  1BML C;  2HDE A;  1AN8 A;  3TEX A;  3TSS A;  1FNU A;  2HTM E;  4JPS A;  4M0W A;  1QF6 A;  3FIL A;  3VR9 B;  2WU2 B;  3HRD D;  2CJN A;  3ZQ4 A;  1R7S A;  3BVM A;  2WXM A;  1JWS D;  3NUH B;  5BMI A;  4PT5 A;  1I4R A;  2NMQ A;  2FUG 1;  3W5U B;  5HFY A;  1AWD A;  5TSS A;  4OVZ A;  4DQO C;  5BYS A;  2WXI A;  2WP9 B;  2J42 A;  2R61 A;  2I2Y A;  1TJE A;  2WQY B;  1C4C A;  3O13 A;  4MT5 A;  1D5M C;  1SEB D;  1XLP A;  1ESF A;  5I4D A;  2LGI A;  1STE A;  5GXG B;  2ZW0 A;  4NAW B;  1FNV A;  3SFD B;  1V8C A;  3NZ3 A;  3BYY B;  2XN9 C;  1UWM A;  4GLS C;  2FBW B;  1BUI C;  2JXT A;  3B9J A;  4O1N A;  3CF4 A;  4WWM A;  1PDX A;  2DYO A;  3Q8F A;  2QIE B;  4N59 A;  3TEZ A;  1N61 A;  4DXF A;  3RFZ B;  1OFF A;  5D7G A;  1FXA A;  2GRI A;  3BK1 A;  1QOA A;  1EU4 A;  2ZW1 A;  5HG2 A;  5C3J B;  1B9R A;  1QIL A;  2GB1 A;  1N5W A;  3DWG C;  2H88 B;  4LK0 M;  3BVG A;  3RPF C;  1B1Z A;  1YN4 A;  2L32 A;  2OED A;  2AX5 A;  4RF0 A;  1Y56 A;  1GPX A;  3AE8 B;  1PFD A;  3Q69 A;  2BS4 B;  2WNM A;  2WXN A;  1WRI A;  1TKY A;  2WXF A;  2LHE A;  3SFE B;  4IOI E;  1XLO A;  2JU6 X;  3I9V 1;  4ZHO A;  1SBB B;  3IT6 B;  2YEP B;  3AH7 A;  1SE3 A;  2EEL A;  1QOG A;  3PZ7 A;  1SIJ A;  1YQ3 B;  2E6X A;  2K22 A;  1VJK A;  1TY2 A;  1D5X C;  1IGD A;  2WDQ B;  2TSS A;  2NTT A;  4B0E A;  1E0Z A;  3R8B A;  3AB5 A;  3BK2 A;  1WXQ A;  3V3X A;  5D3I B;  1I4H A;  3WCQ A;  1UNS A;  1FEH A;  3LB8 C;  1GAQ B;  2W55 A;  1M4V A;  1ET9 A;  1MPE A;  3TEY A;  1MHH E;  2J53 A;  3ZJU A;  1FFU A;  1QOF A;  3NRZ A;  3BVZ A;  2WXO A;  3HVZ A;  3E56 A;  1YN3 A;  3PO0 A;  3FC4 A;  3TUO A;  1VDV A;  1WYG A;  1J7B A;  2BTE A;  4HJG E;  4ZRP A;  2JYE A;  2PTL A;  1C77 A;  2PMV A;  2JSV X;  2JQR B;  4ZRQ A;  5H8Y E;  1C79 A;  1K50 A;  1JW9 D;  1QT9 A;  3U4E G;  4RH6 A;  1SSN A;  2QEJ C;  3L4P A;  1VRA B;  2B76 B;  2BT6 A;  2IGG A;  1N60 A;  4N6E B;  2KWD A;  3B2G A;  1JQ4 A;  3AED B;  5EE9 A;  3P4P B;  3GS2 A;  1ROE A;  3P4S B;  2DBY A;  2I38 A;  2J52 A;  2JX5 A;  1KLG D;  3R2I A;  1D5Z C;  4OZC A;  5G5H A;  2WXR A;  1N62 A;  1XCQ L;  3AV8 A;  3TEW A;  4HKZ E;  1KTK A;  3IAS 1;  4IDI A;  1JRO A;  4RGN A;  1EWC A;  1QQR A;  2V0G A;  1XLQ A;  2CU3 A;  4RCO A;  2WS3 B;  4EE2 A;  1KRH A;  4XWT A;  5C2T B;  2M19 A;  5AUI A;  1C78 A;  1KFY B;  4RGM A;  2PVO D;  1TS2 A;  1LO5 D;  2KAC A;  3KLS X;  4C7Z A;  1TS5 A;  1GTH A;  2KN4 A;  1XF5 L;  1HQR D;  1IUE A;  1BXT A;  1PGX A;  3ABV B;  2LHD A;  1IGC A;  2PIA A;  1ENF A;  4XDC A;  4P16 A;  5FR3 A;  2DYM A;  2W54 A;  4GDK B;  3W2D A;  4A90 A;  2SEB D;  2RPV A;  3B2F A;  2AQ3 B;  2INN E;  1PYW D;  2JYT A;  3EUB 2;  3ZYY X;  1J7C A;  1HXY D;  1V1O A;  3AE5 B;  2M0A A;  4RGT A;  2MH7 A;  1GB4 A;  2BB6 A;  4HEA 1;  2X38 A;  2FE8 A;  3EGR A;  3V05 A;  4TSS A;  1ZPS A;  2AQ1 B;  1D6E C;  4RGO S;  2L83 A;  3LXF A;  2BW2 A;  1SJE D;  4YWG G;  1JWM D;  1YMH E;  2OHF A;  1NYQ A;  2KMM A;  2K9X A;  3LYY A;  4ZHP A;  3VRA B;  4UDU C;  2RMM A;  4A8X C;  1I4Q A;  4ARC A;  2MJ3 A;  5LNK 1;  1PGB A;  3MJ5 A;  1F2R I;  2W3R A;  1XEE A;  3MHZ A;  4XDD A;  1VR9 A;  2Y5P A;  1V97 A;  1NEN B;  2WXL A;  2QMT A;  3P1M A;  1V1P B;  1CJE A;  1N63 A;  3Q8C A;  4DXG A;  1CZP A;  1DOI A;  4YTN B;  4US9 A;  4L23 A;  2WDR B;  3AEE B;  3C8Y A;  1TY0 A;  2Y3A A;  3W9C B;  1KLU D;  1RWS A;  4US8 A;  1AYF A;  2K0P A;  4HRS A;  3N9Y C;  2L52 A;  3VRB B;  3PZ8 A;  4A6Q A;  2Z8L A;  2IGH A;  2Q5W D;  1F0Z A;  2YEP F;  1XXG A;  4JE3 B;  2N9L A;  1H7W A;  4H2A A;  1I4X A;  4HRO A;  5T8I A;  4YSY B;  4YTP B;  4ZYS A;  4OZA A;  1I4P A;  2WXK A;  3NVW A;  2WXG A;  1CK1 A;  2BBC A;  5BMH A;  3J9C A;  4KGT A;  3AE7 B;  2EKI A;  3T3N A;  4ARI A;  1JRP A;  1EU3 A;  1ZUD 2;  1SJH D;  3VR8 B;  4AS1 A;  2ACZ B;  4OW0 A;  1OQR A;  2CJO A;  3BZD B;  3KWL A;  1VZ6 A;  3IAM 1;  2N0S B;  1TZO A;  3IXS A;  4N58 A;  3AE1 B;  3W1S A;  4LLG M;  1K52 A;  1XCT L;  2IGD A;  2W3S A;  1JML A;  4KX6 B;  4ZOH C;  2BS3 B;  3ZJT A;  2PKO A;  1SB3 C;  1AW7 A;  1YJI A;  1RM6 C;  3AE4 B;  3BII D;  3U7Z A;  3W5V B;  1ZP0 B;  1FCC C;  2JZP A;  2K3U A;  3MFG A;  3AEF B;  4MH8 A;  3T3O A;  2QJL A;  3NS1 A;  1FXI A;  1K51 A;  1C4A A;  1E10 A;  4B0M A;  1KH0 A;  1E6E B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...