1SE3A

Staphylococcal enterotoxin b complexed with gm3 trisaccharide
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
239
structure length
239
Chain Sequence
ESQPDPKPDELHKSSKFTGLMENMKVLYDDNHVSAINVKSIDQFLYFDLIYSIKDTKLGNYDNVRVEFKNKDLADKYKDKYVDVFGANYYYQCYFSKKTNDINSHQTDKRKTCMYGGVTEHNGNQLDKYRSITVRVFEDGKNLLSFDVQTNKKKVTAQELDYLTRHYLVKNKKLYEFNNSPYETGYIKFIENENSFWYDMMPAPGDKFDQSKYLMMYNDNKMVDSKDVKIEVYLTTKKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Toxin
molecule keywords STAPHYLOCOCCAL ENTEROTOXIN B
publication title Residues defining V beta specificity in staphylococcal enterotoxins.
pubmed doi rcsb
source organism Staphylococcus aureus
total genus 69
structure length 239
sequence length 239
ec nomenclature
pdb deposition date 1996-10-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01123 Stap_Strp_toxin Staphylococcal/Streptococcal toxin, OB-fold domain
A PF02876 Stap_Strp_tox_C Staphylococcal/Streptococcal toxin, beta-grasp domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.110 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1se3A01
3.10.20.120 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1se3A02
1MD2D 1LT5D 4DXFA 1S5DD 1UNSA 1JCKB 1STEA 1D6EC 1TY0A 5ELFA 2SEBD 1V1PA 5I4DA 1TS3A 1SXTA 1LTID 3CHBD 1PRTB 1D5XC 1TS2A 2QEJC 4RCOA 1FNUA 1EFID 1PTOC 1PZKD 2TSSA 2XRQD 3BVGA 4TSSA 1TS4A 4RGOS 4NZLB 3R2TA 4OHJA 2G9HD 1BCPB 4DXGA 1LT6D 2IJ0A 1YN3A 1I4XA 1XTCD 1LLRD 3URYA 1BCPD 1RCVD 1B1ZA 1G8ZD 3MC0B 2Z8LA 1CHQD 2RDHA 2RDGA 1FGBD 1I4GA 1YN5A 1SEBD 1JR0D 1LTBD 1UUPA 2WV6D 1LTTD 3R8BA 1SJHD 5TSSA 1L0XB 2CHBD 5D3IB 1BCPF 1ESFA 1PYWD 1KLUD 1LT4D 1FD7D 4O1NA 1PTOB 2XRSD 1PTOH 3BYTB 1PRTD 4RH6A 5ELEA 2R61A 1DJRD 1GOZA 1EU4A 5D3DA 1LTRD 1ENFA 1S5BD 3BYYB 1LT3D 4RGTA 1HA5A 3MFGA 1L0YB 1EWCA 1RD9D 1KTKA 4BWGB 1CT1D 2AQ2B 4ZYSA 1AW7A 3BVZA 1FNVA 2IPKD 1S5ED 1PRTF 3BZDB 1KLGD 3KLSX 2QILA 2J4XA 1QILA 3GP7A 1T5XD 3DWPA 4L6TB 2NTSA 2XN9C 4Z9CB 3TSSA 1JWSD 3EFXD 1BXTA 3R2IA 3OWEB 1SJED 4RHSA 1I4RA 4UDUC 1EEID 1PZID 2NTTA 5ELCA 1AN8A 1CK1A 1TY2A 1BCPC 1D5MC 1EU3A 1I4HA 1LO5D 4L63B 1XXGA 5FKAC 1I4QA 1PZJD 4RFBA 1PTOD 4RGNA 1V1PB 4C56C 1V1OA 3DWQA 3V05A 1SBBB 5ELBA 1SE2A 1S5CD 1JWUD 1RDPD 1ET6A 1M4VA 2O2LD 3DWAA 3BVMA 2XNAC 1B44D 4K6LA 1F77A 1EEFD 4RGMA 1PTOF 1ET9A 3EA6A 1D5ZC 1PRTC 5ELDA 1CQVA 1CHPD 3SEBA 1HQRD 5FK9C 3W2DA 1DYQA 1FNWA 1LTSD 1LTAD 2AQ3B 1SE3A 1S5FD 1YN4A 1JWMD 1TS5A 1HXYD 1LTGD 1RF2D 4RHRA 3O13A 1JQYD 1I4PA 2ICIA 1HTLD 1SE4A 2AQ1B
chains in the Genus database with same CATH superfamily
4QUFA 3F2DA 3PIPA 1I6HB 3PZ8A 1IL2A 3B1LX 3MXUA 1YNNC 3KF8A 4FHKA 1WWTA 4P75A 3MXPA 2ONQA 1FR3A 4JW0A 4OO1I 5C23A 5LXHA 4BA2I 4JI0L 1KM7A 3VYSA 2C9WB 1PZKD 4DDID 2EJMA 4NZLB 2A68D 4OHJA 5LXIB 3AMUA 2JUOA 1P1AA 4PZ6A 2NVTB 1EYAA 3HUIA 1G2SA 1JJCB 1YITA 1XTDA 2ZM6L 2WXFA 1T3QA 4A3JB 3KUPA 2IL8A 2R7ZB 1UBQA 3A0JA 3S24A 5CHWA 2LXKA 1LYLA 1Y56A 3ZVVA 2F0GA 3PV1A 4G3XB 4WFN3 3QC8B 4FLHA 1TT5B 2IBIB 1RJTA 1SR3A 4FDBA 5M9OA 1L7YA 3J80c 3ENEA 3HVDA 1PDXA 3U8ZA 2WFWA 1PUTA 1VQBA 1VQHA 3I4NH 2R93B 5D3IB 1MBYA 1PA6A 1TR5A 3AEFB 1C4AA 3HOUH 4URKA 2MA9B 1UAPA 4H13C 4DNRB 1XCQL 4NQKE 5M5YH 3EN2A 2O6VD 3LWUA 1YBYA 3P1MA 1E1TA 4HTHA 2GBJA 2LUMA 3HOVB 2R2OA 1MIUA 5GXGB 2B2YC 3ZO5B 1UEAB 4LF4L 1PGAA 3AEDB 2EY2A 1MHXA 2WDQB 3LJ3A 1IBXA 1Q90A 4XT1B 4B3TQ 3I8ZA 3LNNA 3BVZA 4DN4M 1S5ED 2KDFB 4K7WA 5IYCG 2L4NA 3NS8A 2A19A 5IP7H 2EXDA 3PGZA 1OXUA 3EFXD 3VRAB 3NEMA 5DPTA 1F0ZA 1EEID 1C0AA 3FKYA 3E9IA 1OEYA 5ELCA 1K8GA 2LHEA 1N63A 3WOEA 3H7PA 1QB5D 1TIFA 1BCPC 1HNWQ 1C4CA 3KF8B 4LF9Q 2JYEA 1YJJA 1CMXB 4HPLB 2EQSA 4DHZE 3JAME 2HIXA 2OWOA 2FJ2A 4JBKA 2NN6G 3Q2AC 2LSSA 4KLKA 1MFWA 4R9WA 4JI5Q 2E6XA 2G4SA 3AE3B 3VR4A 4K0KL 1HTPA 2MJEA 1SE2A 3KLSA 1VZ7A 4EFOA 1JWUD 3ERSX 3VXWA 1EQRA 4DK5A 4W9CA 3DWAA 2NBVB 4GNXC 2BH2A 3H7SA 2IY1B 3HOWH 2R93G 2ZEQA 3AE7B 4EZJA 1G6PA 2R3ZA 2DY8A 1J8CA 2LGIA 3A56A 1QOHA 3ZJTA 1ET9A 4YHHQ 5D6JB 2AKWB 1SSOA 4WWMA 4A20A 5BR8Q 4C2MH 2YU9H 4A8XC 4DV7Q 1YNND 4IZ8A 5ISRA 3A9JA 4S17A 4KV6A 3H15A 1MSGA 4FP5D 2WB1E 5FLXE 2GI9A 3EHVA 1N36L 4KGTA 3DVGY 4J6HA 1WTXA 3MXGA 3CMEA 2MW5A 3CSTA 4JWSC 2CWAA 4A3BH 2WIIB 1VQOA 3M95A 1XJVA 3W1SA 3UI3A 1ESRA 4P74A 3JC66 3OMGA 2C5LC 1E6EB 4ICUA 5D7GA 2CW0C 1UNSA 3K7UC 1R4NB 2LGXA 3H91A 4AYBE 1L1OC 1DCZA 1IGCA 3RPFC 1GPXA 3FVQA 3W5UB 4J1MA 1I3QB 1CKOA 3CMAA 5T1IA 4WQMA 3WAMA 2CH4A 2N88A 3X3NA 3GTJH 3TEWA 3TEZA 3QWNA 1TGZB 2G1EA 1KIXA 4HKQA 1Y8PB 2JVCA 2KMAA 2G45B 2CHWA 4GN3B 2EKEC 3W1GA 2LJ5A 3DQVA 1OQRA 2DAFA 1QZHA 1G6JA 5JAVA 2UUAL 4POGA 3N3KB 5AZHA 1HA6A 3H7PB 1VDVA 1L0WA 1FGBD 1VRAB 1VZ8A 4J3OD 5EGTA 1TJEA 2EYLA 1R9TH 1I94L 4CQNA 1D3ZA 2MBEA 1WYWB 2RA4A 1GD7A 4ABNA 1FD7D 3D4WA 1ASZA 2KX3A 4EEWA 4KY5A 2ID0A 4B3ML 1P7EA 4A3PA 4ZRKA 2FMCA 1MHWC 3PQIA 3CC4A 1WXSA 4LDTB 4NJCA 1LFDA 1W6KA 4DV5Q 3TZDA 4NQLB 3RT3B 1LTLA 4JC0A 1KC8C 2PPBC 4I7ZC 4GDLA 3A9JB 5D94A 1FD6A 4C3JB 2BVCA 5J17A 1TBEA 1C3TA 4QF4A 2J52A 1HZBA 2A1AA 4DR6L 2NVYB 3H0GH 3I72A 2ZNVC 3FKIB 4LNFA 1Z6HA 1KD1C 1T5XD 5JPMC 1TZ1A 1F1HA 4UPAA 1NEKB 5GQOA 1HR0L 2VRRB 4NDXA 1H9KA 4DKAC 2B3AA 4I6NB 4CKEA 3M4OH 2KVRA 2ENBA 2Q2HA 1BUIC 4ZHPA 1F2MA 1D5MC 5M5XB 5FR6A 4KVGB 1CKMA 3GZNB 4CDFC 4RFBA 3GS2A 4RCNA 2KC1A 1V86A 2D3AA 1JWBD 3P2BA 4DU9A 3DWQA 1SYDA 3V05A 1YJWA 3A4SC 1VQAA 1SYGA 2MO1A 1FRDA 4HMIA 1UGMA 4N59A 4BY7G 4CO7A 1HZ9A 3LWEA 1QOAA 3BVMA 5HFYA 5E4WC 2Z1CA 1WCMB 1JB3A 2K75A 4IPDA 2B8GA 3R3MA 3OJ4B 3KYDD 4IC7B 2H5XA 5ELDA 2GOWA 1JJ2A 3HKZG 1Y1VH 1YNXA 3K8AA 4FXGC 1QLBB 4LNQA 5BYSA 1SYCA 3HOYG 4MELA 5DM73 2K50A 1YN4A 3AEAB 1GC7A 1WD0A 3MWYW 3VTWA 4A55A 1I4PA 4PYUA 5KHQA 1K53A 1JOOA 1MD2D 1AWDA 3AE6B 1YHQA 4LUOA 1L4DB 5C0XI 3I56A 5AUKA 4KN4C 1NENB 2GVBA 4WWPA 5E7NA 1D6EC 1PFMA 2E5LQ 2HHHL 2WXJA 4IM0A 4DV2Q 3BK1A 2SNSA 2MNAA 1B7YB 2XSCA 1HRJA 1EM7A 3IHPC 1IBXB 4C3HG 1UGJA 2YEPF 4GDLB 2BS4B 2WDRB 3R2TA 3KQ4A 1Q81C 1HPCA 1X3QA 5CV9A 5C4JH 1N33Q 2N0SB 2DGYA 1LT6D 1PGBA 2K22A 4DR4Q 2P5ZX 4A93G 4M8MA 2N55A 4C7YA 2K6DB 3P20A 1XMQL 3H9DA 3J7AV 4X62L 3J81j 3RLNA 2JA5G 4FYDA 2IZVB 3D32A 2YVCA 3J80E 2OJRA 2X6LA 1SSNA 2KEDA 3PO2H 3V60A 4OWWB 1N9WA 2HE7A 2C60A 4NPNA 2UU9L 1RWSA 2KWCA 2RDFA 4ULLA 2KT7A 4HDOA 2DYMA 1EQQA 5C44H 1K73C 2LVQA 4AJYB 1YMHE 4L8JA 1FM0D 1BCPF 3V6CB 2IW3A 1RHPA 1PYWD 1CZPA 3JSVA 4A6QA 4YSXB 4JV5Q 5GAGC 1E10A 2K4KA 3IAM1 3KFUA 2BH8A 2EYJA 3M7NA 1K0RA 3E6ZX 5I2YA 3TEXA 5AEKB 2AX5A 4HXDA 1S5BD 3NVVA 4LJPB 1QKZA 1YNJD 4RGTA 1HA5A 1LM8B 5COYA 2Z0SA 2CS4A 2ZPYA 2SNMA 3ND8A 1B9MA 4ZQ3A 3CC2A 4BWGB 2J42A 2KK8A 2N1VA 2NVUI 3IT4B 3CCEA 3OLMD 3J7YW 2FXQA 1HUNA 2KN4A 2IPKD 3H94A 4DNIA 1PH5A 3RZOH 3QQ8B 1HCZA 2X38A 3ULJA 4KHVA 1H4RA 3TZUA 1MJDA 3NVWA 2KCNA 4BBRG 1V5TA 2ASQA 2F0TA 1JWSD 2MJDA 2L0TA 3PO0A 2AUKA 4HR7B 1XQQA 1KAWA 4DF7A 4HIOA 1WFYA 2N49A 2CJNA 2SAKA 1SYFA 1EU3A 4F87A 2C7MB 1CSPA 1PZJD 2KEEA 4LNNA 2L8JA 3TRZA 4C3IB 2I5HA 4C56C 4ILWA 4PMCA 3BIID 4S0RA 1NVID 2JXMB 3MC8A 1VMCA 2KJXA 4GLXA 3H3VH 1I6HH 1TWGB 1ILPA 1TYGB 2INDC 4OZCA 3Q6SA 1QE6A 1UE5A 5HGTA 1JC7A 1O7IA 4B3SQ 5AJ3Q 1BUVT 1QUQA 4Y7NB 5EE3A 1EEFD 2VNUD 1RAXA 4HJ7A 4YXDB 1PFNA 5IYCH 4M8NA 4A3CG 1D8LA 5LMNW 3H3VI 4K1RB 3GTGB 4DUZQ 3QB3A 1RFAA 3ZJYC 4KGRA 1FNWA 1STNA 2JA8B 2L1AA 4M01A 3L16A 1N32Q 5JHAA 3S1MB 1Q82C 2QHOA 2Z59B 2NVQB 3MTNB 2A6EC 2NVTH 4OO1G 2JEAI 2KC2A 4AJWA 3KUCB 3DBSA 4R4IA 2D10A 2A8VA 5CHVC 3KOJA 3JSVB 4A3JH 2JA6G 1RYJA 3ZNHB 1SIJA 3DHHC 2NN6H 1I5FA 4GLVB 1ICWA 3BS1A 2IY5B 4PMWA 3NVZA 1D1IA 2Z6KC 5I4DA 3W3AA 4A90A 2R93H 3PZDA 1Z7TA 3SDZA 2FAZA 4B0EA 1PH4A 5J3BA 1EFID 2NN6I 3A4RA 3BWUD 3N9YC 4FHJA 4NJ6A 2Q2IA 4EZKA 2UUCQ 1XO3A 3ZJVA 3WOFA 1X32A 2QDBA 5FLXL 2BDNA 3D6WA 4KY6A 3GTOB 3AEBB 2MX2A 1EZ6A 3F2UA 1PV4A 2XWJB 3NTHA 4IUNA 3GTMB 4A3DB 1N5XA 3HOVH 1WZ0A 2EOTA 1M90C 1TZOA 4R4TA 2L0FA 1DONA 1ZP0B 3P4RB 1G8ZD 4N9PA 1VQFA 3QK0A 2F3IA 4PK1A 4DV0Q 3S2DH 5EBCA 3L17A 1A15A 2WXPA 1DOKA 3G48A 2D0PA 4JBMA 4YL8A 3UGBB 2C35B 3ONSA 4KKIA 3HOUG 1FJGL 2N7EA 4IM2A 2BQQA 1GVPA 2PVGC 4KY7A 3A9KA 4ZOHC 3ZRFA 2MWSB 1C48A 3M63B 1V5OA 3NZ3A 4LFCQ 2MPMA 4KI0A 2M0AA 5EE0A 3EECA 2F1MA 4PS7A 4WJNA 2EDGA 2PEAA 4F7ZA 2XVSA 1QUQB 1G51A 3NXWA 3GV3A 1EWYC 1KRHA 3ZGZA 1XPRA 1LABA 2K5PA 4JPSA 3ZW3A 3UINB 3OW2A 1U0LA 4IOAA 1VF7A 4LFBQ 1LT3D 2NBUA 3H3VC 2GMIC 5G55A 2Z6BA 3GDEA 1A8VA 1N62A 4LNIA 2CH4W 3M4YA 5IY0A 1PH6A 1Z47A 5LLIA 5DPRA 2B2WC 1A62A 2AL3A 3P4SB 3L2PA 4Q5VA 4XDDA 2KZRA 2LY7A 2HIVA 4XTCS 5JXVA 3ITPA 3S1QB 2BCOA 3JVZX 3RNAC 4W9GA 1XLPA 1SJED 4HCSA 1GUTA 4L5QA 5H1SE 1PFBA 2DLBA 1SNCA 4BXXG 5IGEA 2RGFA 3CWIA 1RLFA 3AMZA 3PRZA 1YHBA 2CHXA 1XNRL 3KLRA 1JOKA 1XXGA 4P73A 2PLPA 2XBBC 1R7SA 4AQ7A 2K32A 1PTOD 3E9HA 3NE5B 4RGNA 1HTOA 4ARIA 4OONA 5LNK1 2O2VA 2QC8A 1B3QA 3BINA 4MIUA 2Y5PA 3ABVB 4A3EB 4FJVB 3OYYA 4A3KG 2VL6A 2JA9A 3HOWG 4DDGD 4K5XA 1G91A 1KNEA 1M4VA 4DUYQ 3BDOA 3D8GA 3ZNID 3EFCA 5JJKA 4P16A 2XNAC 3DBHB 1OXSC 3EUB2 3STBC 1QJOA 1HZ6A 1Y69U 3M3JA 5IE8A 1DGJA 1I3QH 2BBCA 1XPOA 1CQVA 3TS0A 4RMFA 3D31A 1HQRD 4P72A 1WTWA 4ZCKA 2QKIC 1C4PA 3TUOA 4GN1A 1FCLA 3A8JE 3B9JA 4B3RQ 2EMSA 4HJ9A 5BYRA 4X57B 2D0OA 4LWCA 1B8AA 4IKGA 3RD4A 3ZYYX 4IG7B 4WWNA 1S5FD 1H8CA 4JI8Q 3T13A 4I7AA 4A3BG 1J7BA 2ZXRA 3F2CA 1YJ9A 1WF9A 5JJZA 4WWOA 3ZTDA 5CV5A 3G7LA 3A9KB 1BOSA 3T56B 4MZ9A 4GOCA 3PSEB 2EELA 4HMJA 5G3LF 5CYUA 2BGFA 2IWHA 4O2DA 3BK2A 4PS3A 4JI6L 4RM8A 3WA0A 2LMCA 2L15A 4IURA 5K5PA 4DV3Q 2K39A 2CKZB 4DR5Q 5IO9A 2WX1A 3ZNZB 2K5VA 2ZJPA 4UP7A 4A76A 5K36G 3WCQA 4HJAA 5JH5C 3L3OC 1YX5B 2FCMA 3A7AB 4HIMA 3EC8A 5C3JB 2RKSA 3T51B 4B6WA 1FFVA 2VB2X 5M3FB 4I6PA 3SK5A 2REXA 1K3RA 1YZ6A 2Q2UA 1B1ZA 1TWHH 3OIQA 2UUBQ 2WDVB 4C4VA 2KNBA 4QGUA 4DK3C 3K59A 2K1FA 2F3VA 1TU2B 4LW1A 3DM3A 4JI2L 3FKIH 1X9NA 1N34Q 1HJPA 1JR0D 4OZAA 1OXVA 1BBXC 2HD3A 3QJZA 2XGTA 3DCGA 3GTQB 4AQYQ 2O2VB 1KJTA 2MBHA 4YSZB 1XX8A 1SNPA 1BF4A 5M5XH 4FF2A 3AECB 3PVLA 4DHZB 2QA4A 3ERQA 4C3HH 2W82A 4K2KA 4LJOB 1SMYD 4CGYB 2EPBA 4IOCA 1EU4A 2FCNA 1QZEA 4DR1Q 3D0FA 4N9TA 2LS01 1IUEA 1VQLA 3OTOL 3AE1B 3QIJA 3IXSA 1L0YB 1BDOA 1J5EL 2JJQA 2UXDQ 1WJJA 4M00A 4FXKC 2AQ2B 1NBFC 3WWVA 3GZNI 4W9DA 5H92C 3SHQA 3HOXB 3BZDB 4DK1A 3ZLZA 3DXJC 3KLSX 4YWGG 2YTYA 3HRDD 3J80L 1P16A 1HEZE 1MI2A 2F0HA 4BBSG 3Q24A 2PTLA 2WDTB 4DBGA 4W9FA 1T5EA 2WB1B 1YJNA 2FE8A 3OWEB 4XQJA 3AQQA 3BZKA 2GBMA 2F4IA 3X3MA 4ZK9B 2L55A 3KUZA 2VUMB 4W9JA 4L63B 3WIMA 4X64Q 1E7ZA 2E76C 1IZ6A 2LMCB 4B9KA 2HD5B 3GV6A 3LXFA 1T0QC 4ZRPA 5KRUA 3N6RA 1HNXQ 2B2TC 4LFAL 2LHDA 5IWAQ 4EUTA 5ELBA 5C1ZA 1AARA 3ULPA 4GKKQ 1B53A 2EY1A 1UELA 5D65A 4KKJA 1KH0A 1RODA 1QNKA 3NELA 4E6IA 1EYGA 2PKOA 5AUIA 1F2LA 3FDTA 2DZMA 3P63A 2NVXB 4EQ5A 3ZDMC 2IO3B 5C0XJ 4C4VB 2JRHA 1ZYRD 1X65A 2V1CC 5HY6A 3U52E 5C0XG 4N8FA 5AFWA 3Q8DA 3QOLA 1LTAD 2MSED 2D3BA 1J7AA 5G5GA 1NMFA 1QNUA 1JALA 1BNZA 4QUCA 3NHEB 4ANUA 4WJQA 1JWMD 4HRSA 4QCLA 1BQQT 2EY6A 4ZRZA 1SYEA 4DGZA 3B2FA 3RZFA 1SRUA 3C46A 3J7A5 2L83A 3C0RB 5DPWA 2ICIA 4L6TB 2C7HA 2AHOB 3JW0X 5C3EB 2N4FA 4A3GG 1X3GA 1PH2A 4JI3Q 4A3MB 2HDMA 2Z9HA 3TP8A 2LWPA 2WB1G 2RPQA 3PCOB 1VMPA 4RWSC 3AU7A 3RZDB 1J9OA 1DOMA 1ZGUB 4ME3A 1PH9A 4C1NK 1FXTB 2RBMA 5BN5A 4A3IG 2ZCBA 2BKRB 1PRTB 1WM2A 5DEHA 3TIXA 2RQXA 1WX7A 2TSSA 2KQ3A 2F0EA 3VR6A 2JPHA 2F0QA 2L76A 5LHY1 1XMOQ 1OXXK 4YCUA 1PH3A 2ZCCA 1GNUA 1AH9A 4AYBG 2X6GA 1IBLQ 2E2JB 5I6WA 5J2RA 1MSHA 2BB5A 3J81c 3J7AF 3K0YA 3GE3C 1TKGA 3PO2G 1XNQQ 2EYFA 3HZXA 1CTMA 4C7ZA 1IYFA 1YN5A 3S15H 2JA6H 5C44G 2M4NA 3KF6A 1YIJA 1GKHA 3V61A 5CORA 5J39A 4N58A 3TS2A 3T53B 2MFIA 3CSFA 3CRLC 1IBMQ 2N9EB 4ANWA 1U4RA 2OTJA 2KHWB 2CQOA 1WRIA 1TT2A 4JPBW 2E2DC 3AI5A 4LMQD 3QA8A 2M8SA 3VA7A 1WGGA 4C3IH 1VJKA 2K5QA 4B0MA 5E6PA 3BYYB 3HOZB 2DX5B 3E3XA 4RNAA 1TWFB 4KHZA 1E8YA 2E75C 4B3TL 2HUGA 1TWGH 4LF7Q 2BYFA 1SNOA 2D5DA 4B9WA 1Z5SB 5IGFA 2GBRA 3NJTA 5EE9A 2K6AA 2QILA 4Y7NH 3DUZA 1NCVA 4R8NA 5KEEA 1X1MA 1D7QA 4LLGM 5EKIA 3RNUA 1BXTA 2KOXA 3GTGH 4YWKA 1L4ZB 1HNWL 2JA8H 1WMHA 2V4IB 1QVFA 4ZRQA 3T3OA 1LO5D 4LF9L 3S1MH 2KA7A 1D1KA 2MJ8A 1GAQB 3R7RA 2NVQH 2MBQA 2F0OA 1ISNA 2UU7A 3RLFA 3PPAA 1Z2MA 4OXPA 1ENCA 1VLBA 3AV8A 3CMMB 4LDTD 5D14A 2IX1A 3HK0A 1SIFA 3KJPA 4IJLA 2WAQE 1ONLA 3RNEC 2O2LD 4JI1Q 2KFKA 4R4OA 3NUHB 1KDAA 2LFNA 5IYDG 4YHHL 5ELOA 4JOIC 1M94A 5BR8L 4DV1Q 3DBRB 5L83A 2E74C 4GN5A 4DV7L 1NYQA 4X3UA 5J22A 4W9IA 1XD3B 3W2DA 5CC4A 4ANXA 3FEWX 5FO8B 1LTSD 4X65Q 1FCCC 3PHXB 5IODA 1SE8A 2HCCA 2JXTA 4BXXH 4GLSC 1JROA 4I65A 2OQKA 3KF6B 1LGRA 2SOBA 1GJXA 1ENAA 3G4SA 2KCCA 5I6YA 4A3JG 2R7ZG 1A70A 1G2TA 2ZVNA 1D5XC 3KBXA 4GS3A 2AQ1B 4RGOS 4YWMA 2KMMA 1QZGA 3P75A 5IGDA 1CKNA 3MC9A 4HIKA 2BE5D 3K7AB 4K6DA 4A3KH 2JX5A 3R7QA 2ZT9C 2IT1A 2OHFA 1WGYA 1PLFA 3FPUB 1J19A 1EO6A 1XF5L 3M3YB 3U50C 4TSSA 2IYDB 3BVGA 2XRQD 3I70A 2Z0EB 1V80A 1HFGA 3SR6A 3VAWA 1C4QA 1QVCA 1EQVA 2ZJRA 3HOVG 1B70B 1FIQA 4K7SA 4BOSC 2K03A 1Y1WB 3AULA 3MHZA 1E5WA 1WXMA 1MGSA 4XIGS 2L52A 2K8CA 3NTIA 5CBEE 3I57A 1RCVD 1U9RA 1CM9A 2JA7B 4MGKE 4YTNB 3C3LA 3U4EG 2NB0A 4XWTA 3HHMA 1WMHB 1RIPA 2M9VA 2QJLA 2RR9A 2WLBA 4XC2A 4IQZA 4NXNQ 3R93A 3CU7A 4TKNA 3X23A 5KGUA 3CCLA 2WHIA 2KENA 2PVOD 2NZ1D 3QWZB 4NNJB 1R4QB 2RVLA 3F1ZA 3S1QH 3HKSA 3FILA 1K8OA 5TSSA 2DNFA 4JVZA 1LT4D 1UE6A 5BMHA 3IRBA 4BKGA 2K9XA 2JWZA 4YTMB 2KFKB 2RCFA 3P1HA 2LASA 5K36H 4DV5L 1IXRA 4CKBA 3U2SC 3TL5A 3Q3FA 3PT2B 2O4XA 2INNE 4CJ1B 2PZWA 3DWGC 5KNCA 4ZYSA 1CT1D 5IOCA 2CFMA 4NXMQ 3S1NH 1A2UA 4DR7L 2DZJA 1IW7D 3ZRCA 2B8FA 4K7UA 4UP8A 4N6EB 5C5LA 3DWPA 2BS2B 1CUKA 1T0YA 3RUZA 3DHIC 3C8YA 5CR3A 1NR2A 1WX8A 4ICVA 4BVUC 1RTNA 3MAQA 4IUVA 3Q22A 2VZKB 3OAWA 4XGAB 2BA1A 3Q3NC 2Q8TA 1CKNB 1Q12A 5C3XA 2JZ3B 2M0XA 5IP9G 3DBHI 1F9PA 4HVBA 1SDFA 1N61A 1BKBA 4KN7C 2Q8RE 2WGSA 1F9SA 3UI2A 2D5GA 4BBNC 3FP9A 3B6YA 4KTAA 4IUUA 3L54A 1WGHA 1LACA 5HURA 2AWOA 5DNFA 3PF5A 4HWIB 4ZLTF 2FHTA 3T1HQ 2WXNA 1ZOYB 2E8GA 2MP1A 1H9SA 1E9MA 1CFMA 2F0SA 1B44D 4RKLA 3HM3A 5FOBB 1O78A 2RSNA 3Q8CA 4RF1A 4N9F4 5H8YE 4RKBA 3VR8B 3CRKC 4BBSH 5EAYA 3VUWA 1TWAB 3AEGB 3WALA 2J0TD 3Q14C 2BYTA 2KVMA 2A73B 1A63A 3T1YQ 3NBIA 2XWBB 2DZIA 1RFKA 2LFIA 1YNJC 4KDLB 3A74A 1AZPA 1P0RA 1ZDVA 3FILB 2NZOA 2BB6A 1Q0WB 3Q8BA 1NY4A 2KACA 3RCZA 2UUAQ 4IPCA 3ML9A 2E5LL 1SN8A 3SD5A 2M56B 1HNZQ 2SEBD 1VQ5A 2KUMA 2L12A 3KLWA 3GTQH 1NTGA 4DV4L 2HJ8A 1U4LA 2B2YA 1I94Q 1FNUA 2E2IH 1OQQA 3APDA 1EY8A 1SE9A 1K8AC 4P7IA 4DR4L 1NDDA 4TQ0A 1VQ9A 5C0XH 1NR4A 2PO4A 2VH2A 1NNXA 1GG3A 3NHHA 4EVOA 4C3JG 4EE2A 3J81E 1SGHA 4HDQA 3A33B 3AB9A 3GTKH 3C2PA 4GIVA 4CBVA 3FKIG 3QHTA 2HTHA 5CX3A 2I07B 4LUZA 5CBAE 3S1RH 5M3MB 4A3GH 2FFKB 4A3FB 4MTKA 3F8TA 5EDSA 3CCQA 2MBOA 2FIDA 3PREA 4JV5L 4J15A 1WD1A 3GTPH 3I55A 5CV7A 2F0DA 2JP1A 3PRPB 4GXBA 4A3IH 3DEOA 2VUMH 2JEBI 1PTOH 3BYTB 4RH6A 1IGDA 1H9SB 3PLVA 1B50A 3B08A 4GNXA 4JI4Q 1NYRA 3VDZA 1Q8KA 4F8MA 3DBLB 5CV8A 4PQXA 5JZEB 2D07B 2RPVA 2EKIA 2PIAA 3Q23A 3U4VA 3KJOA 1I50B 4P2CB 5GADC 1WCMG 4HEDA 2F0KA 2EY5A 3T4AC 1VDZA 3HS0C 1FNVA 3EJIA 3N1YC 3OW7A 4OWXB 3TQYA 3K57A 1A3UA 3GTLH 5M5WB 3I4MB 1EL0A 5IYBG 3UDXA 2KLGA 4OVUA 2FMMA 4CHKA 4PG3A 1K8MA 2NVXH 2OTLA 4WJ3M 3HM6X 3D4RA 3PO3B 3OJ3A 4OW0A 2K01A 3T8MA 1EUVB 5IP4D 1J0GA 3D6CA 1EOVA 1Y8NB 2PQEA 1DZ1A 2V3PA 1TY2A 1LUZA 2AWTA 2N9LA 1I4HA 1U4PA 3VQIA 1CSQA 1R4MB 3IAS1 4BZAA 2YEPB 2JF5A 3NK9A 1W2BA 4BS9A 4O42A 3Q8FA 3PF4A 3LDZE 1V8QA 3C1FA 3NVYA 4A3MH 1AZQA 5FJ8G 3FC4A 5AJ3L 2CJOA 2MRPA 5BYQA 4DR3Q 3T3NA 2WXMA 3RZDH 1MG4A 2W9NA 1V9PA 4QQBX 2KDMA 2EJFC 2VB3X 4RAUC 1E90A 3PIO3 2KKCA 4JGHB 2M2LA 3QAQA 2IY0B 4H7BA 1N32L 1WJ6A 3CCJA 2ZVOA 4GKJQ 3AE4B 1KNAA 1XLQA 2KWDA 2I38A 2EMTA 2L9HA 1HXYD 2QEXA 3S14B 2INCC 1PHJA 5EJWA 5JJLA 2W54A 2Z4IA 3RNBC 2E2JH 3W5VB 2H88B 2IGDA 3I7FA 2KXJA 4OVVA 3KW5B 4IPHA 4IW0A 2CR5A 2GA4B 2IGHA 1LT5D 3RZWC 1CI3M 2Q8IB 1FEHA 2NZHA 3K58A 4GNXB 1ZXIA 1F2ZA 1WGRA 1EFWA 2Z0DB 2K8BA 3QO2A 1GXDC 1F9JA 2F0NA 4BKSA 1JRPA 4AUQC 3CHBD 2KECA 2DN8A 3ULLA 1DGSA 1IBKQ 5IYDH 2UUCL 3AEVA 1PTOC 3BZCA 3B0AA 4E3CA 4IFDH 3PUXA 3UE1A 2J53A 2LJIA 2ICEC 3K80C 5KIXA 4YIJA 4EQPA 3NQIA 1PDQA 1I4XA 3G6EA 1J8IA 4XQNA 3K0XA 1LLRD 4QB4A 1BMLC 1V9JA 3VRBB 3CW2C 5LL6S 1VQIA 1H95A 3NUCA 4DV0L 4F8CB 1QF6A 4IFDI 2RD0A 2Z8LA 3VYUA 3SVMA 2R7ZH 2HJ1A 2WXHA 1N5WA 1FMAD 4E74A 3PIP3 3K6OA 1LTTD 3NWTA 3RLOA 2AMCB 3I4NB 2M00A 4IN3A 4XXEA 3HVZA 1L2FA 4LFCL 2YV5A 1P3QU 2N9XA 1EY9A 1N60A 4CDEC 3JAMi 2PI2E 4JCVE 4BY1B 2WXGA 4GU2A 3TJPA 1A2TA 3DLLA 4BBNF 4C3IG 3N1ZC 3ZTCA 3BG3A 2PE9A 5M5YB 4AH6A 3K5MA 2IO1B 1X3EA 5C6AA 1WXVA 4G4KA 4WJPA 1SF0A 4FXDA 5EKLA 5EBDA 2PZTA 1K50A 3TMEA 2E2HB 2OF1A 3GE8C 2IDYA 3CXCA 4JE3B 3IT6B 1QILA 3VYTA 3CKIB 1WXAA 2JA8G 1E7UA 4TVAB 1D2BA 1EIHA 2H89B 3EIVA 2YLMA 4F88A 3MJWA 2QIEB 3OWFA 2J7QB 1AP0A 4MDKE 1SMXA 4PYZA 2Y5CA 1YOVB 3DBRI 3Q8EA 4OL7A 1Q86C 2RDBC 2RSOA 2N3SA 3V6EB 3PUWA 2K6QA 2MQHA 1VS0A 3TBIB 5IAAC 4ZUJA 3TEHB 2KMCA 3DEPA 3MA2B 2KQSA 1K0SA 3P7JA 4DUYL 3ZIMA 2F0MA 4G7OC 1EY0A 1MVKA 2CU1A 2JSOA 1OTCA 4UY8C 4PV1C 2ACZB 4JBJA 3AE9B 3Q69A 4K14A 1F77A 2KBNA 4FO2A 3K5LA 1XYIA 4BY1G 4LF5L 1NSNS 4LTUA 4GOPA 3U4ZA 2PJHA 4C2MB 3DVNV 1RL2A 3M3YH 2L00B 4B3RL 1VCIA 2RF4A 1SMYC 1GJZA 1NAPA 1AFPA 2G5DA 2OCEA 1L2NA 3L0OA 3IVFA 4H2AA 4A3DG 2JT4B 4JI8L 2OEDA 3MTSA 1Y1WH 2FUHB 5CV4A 4XT3B 4HIDA 4R1JA 1A5RA 4LNKA 5IP9H 4R4CA 1EY5A 4IUMB 2JA7H 3DMUA 1TTNA 3LB8C 4ID6A 3AM9A 1YX6B 3QX1A 1C79A 2H1EA 4KHPQ 3OMCA 2DZKA 4GGQA 4P1BC 1PH8A 1DM0B 4DV3L 2AYOB 3UIOB 4NW2A 3CF6E 4DR5L 4I6LB 4QY7A 5JOBA 2BYVE 3NQTA 2QMTA 1V1PA 4RMAA 2MO0A 4U68A 3E9SA 3M7GA 3GTJB 3VTVA 3HG9A 1QQRA 3N32A 2F0LA 4FN2A 1YVCA 3SR1A 1E1OA 2NPTA 1UWVA 2K33A 4HJ5A 4DAPA 1R4NI 1X3FA 4GLAC 1ZE3D 4J8QA 1NBWA 1O7YA 1CQFA 1TWCB 3MVVA 4OEMB 3BU2A 2UXCQ 2L0CA 1E2VA 2UUBL 1YJIA 1BO0A 2LXJA 3URYA 1T0RC 1HQMC 1Q46A 2BYEA 3GQBA 4ZAIA 3UE0A 2LVPA 1VQNA 1EWHA 4NY0A 3V62A 4ANVA 2MBBB 5BMGA 2V0GA 3Q3OC 1N34L 3Q3JA 4QAYA 2KHSA 4MSMB 2ZW0A 1P98A 1ZYRC 2MLBA 3CIRB 4JX1C 2DNCA 2V4DA 2PYKA 4Q2JA 4EQNA 4AQYL 5GAHC 5C3WA 2QDLA 3M9BA 2CHBD 1VQ4A 4JLCA 5HG2A 2LKVA 2KYWA 4EOYA 1KLUD 4AP4C 1A0IA 3HRZC 2KTFA 4HKZE 3BDCA 1PRTD 3QOJA 4G7HC 1F52A 2R61A 1XNRQ 5G5HA 4W9KA 2JWUA 4A3EG 2DY7A 3HFZB 4DV6Q 1PFDA 3NBHA 5C4HA 1WX9A 3R3OA 2WAQB 4GOPB 2HQEA 2UXDL 2CHZA 3S17B 4IM3A 3MFGA 3J81L 2GVAA 3H6NA 1WFQA 4BA1I 4C3JH 1G6ZA 3ECIA 4HROA 3H0GB 1C77A 2NVYH 1E24A 5CGKA 3V3XA 1VQ8A 2WKDA 4JBWA 4W9LA 4OZBA 3TSSA 2WQYB 2VXWA 2VQEQ 4UDUC 4YCVA 1TWAH 4CYEA 1VQGA 3QIAA 3QCAA 3S9WA 1JQ4A 1PXUA 3OSOA 2PMVA 5EE1A 1CK1A 3CAMA 1QVGA 4QJFA 1T0SC 2KTRA 3L0WB 2WP8J 1HNXL 3U9SA 1E3PA 5IWAL 1WGDA 5J18A 2F3WA 1V1PB 1V1QA 1U5KA 4XQQA 1PH1A 1NI3A 1B9RA 3PLUA 4GKKL 1ZDXA 2HQLA 2I46A 4G57A 2NPTB 1EQTA 4HAEA 2SDFA 2YYZA 1FGUA 1ZEQX 4V190 3WDNA 3WAPA 1WCMH 4LF6L 3TP5A 2R92B 1PTOF 1PGXA 3L10B 4JI7Q 1GHKA 2Q2TA 5T1GA 4APVA 1Y1VB 5FK9C 1WJ4A 5IYBH 3A5ZB 2YTXA 1IKMA 1EYCA 3S2AA 1Q8IA 4M0WA 3UF8A 1SE3A 1KF6B 5M3FG 1VQKA 1QT9A 3S16B 4WJWA 1N6ZA 4BFRA 1LTGD 2QW7A 2B63B 1XLNA 3J80i 4YY3Q 1JQYD 4JK1C 3M62B 4JI3L 3K81C 1SFOB 1E2ZA 1CJEA 2D62A 2VQFQ 3KWLA 5IGCA 5LL6X 3UQAA 1S5DD 3A5UA 2N8NA 5M3MH 3OPOA 1V49A 5FJ8H 2G3QB 1C8CA 1HR0W 1FL0A 1DOYA 1XEEA 2L7RA 2C7NB 3NBHB 1WM3A 4P6VF 1TS3A 1IPGA 5JEAH 2KHIA 4RG1A 2UXBQ 2EE1A 2BF8B 2G4DB 4TRDA 5JVG3 2WX0A 2NWGA 4XDXA 1VQMA 1KDCA 4GZYC 5HI1A 2CVRA 3KVFB 4YT0B 2LVOA 2N9KA 2K04A 2DJGC 5HKHA 2EYMA 2BKFA 2MP2A 1FO4A 4X66Q 2XEWA 4D2KA 3CQZB 1IBLL 1KHIA 4A3OA 1I6VC 2CWPA 3PSIA 4AS1A 2Y0SB 1I50H 3HOXG 3RNGC 3ICEA 1QWYA 4M8AA 1ACCA 4JYAQ 2QCPX 4QMGA 1V97A 3AN1A 2KTRB 2FINB 1I4GA 2RDGA 2INPE 2Y5BB 3DBLI 3LX0A 3I4MH 5M5WH 5EPKA 1LTBD 3CCRA 4KKSA 3SE0A 2PQAA 3SK6A 2F4VQ 2GN5A 5FO9B 2RHSB 4OX9Q 3J9CA 1L0XB 2DUDA 1IBML 2VUMG 3A54A 5EPJA 4DK6C 1NI2A 1YIWA 3W1SC 3AH7A 3SK8A 1X54A 2B63G 3K5OA 1L6VA 2KDEB 3EQLC 4IOIE 3AU5A 5D3DA 3QR8A 1ENFA 4F7XA 1P7FA 3VHTC 2KFJA 1K51A 2BE5C 3ZNGC 1EF5A 3DVNU 2NBFA 5E6NA 2JE6I 1ICFB 4G7ZC 2K0PA 4M0WB 3PUZA 5KYLA 1NUCA 1QG7A 2XN9C 1IYJB 2KD0A 5IOIA 1KDBA 5DCNA 4FNFA 3R66C 4KD3A 1HZAA 4DNTB 2A5UA 1FXAA 4XYQA 4GN4B 2BS3B 1AE3A 4RA8A 2E3TA 3LGJA 5C4ZA 3VVWB 1K3BC 3HIZA 4TQUS 2JK8A 4ZRIA 4S3SA 1SNMA 3MEHA 5LMNQ 3I4LA 3NPPA 5C3EG 2IX3A 2I2YA 2M19A 4A3MG 5C4XB 1VD2A 4LF8Q 1MG8A 4XE0A 3X0WA 1JMCA 4JI1L 1FRRA 2PNRC 3PZ7A 4OWTB 2GBKA 4JQWC 2LGYA 1VQCA 4BOZB 4DV1L 2MP2B 2B2UA 3VR9B 1B9NA 2PMZE 5C5MA 1JOQA 2L32A 4L5TA 4KGSA 3SEBA 1SYBA 4X65L 2B3GA 1VQEA 2PCFB 1I35A 1YQ3B 3FMCA 1CZGA 3BJUA 4DR2Q 4NAWA 1WRDB 3U58A 2VZKD 3NG0A 3NOBA 5LMUQ 1GB4A 3RUIB 4HJ8A 1ASYA 2AWNA 2PQAB 4LJZC 3RI7C 3AFQA 5DLQE 2K14A 4JI5L 2ON8A 1IW7C 2DENB 4OGQC 2VH1A 1ZXTA 1ZXHA 1GUOA 1UE1A 3U7ZA 4DXFA 2KWUB 2L05A 4PNYA 4EQOA 4KZ0A 1UH6A 4YTPB 2DNEA 4TKOB 1TY0A 3TREA 5ELFA 4PT5A 1VQJA 4IFDJ 2HCIA 5D2MB 1H9JA 1T6BX 2B2VA 2HDLA 2KLCA 2R7DA 4IFDG 4WH4A 4H44C 2D2QA 5E6JA 4IDIA 4BY1H 3IFDA 1TS4A 2EYOA 4JI0Q 3K9OB 3ZXRA 2LRWA 5C4XG 3A1QA 2KQ7A 3HOZG 2I0QA 1HH2P 3GTOH 1T9HA 1KL9A 4DXGA 1YN3A 4KDIC 4ACFA 3GTMH 1ZPSA 4A3DH 5E4XA 2WXKA 2IO2B 2X69A 4JL9A 4CHTB 4DAYA 5G2NA 2FNJB 1E0ZA 4NXNL 1SROA 3FRPB 2BW2A 2ZM6Q 3S2DB 2E2HH 4KV2A 3L7ZC 3U30A 5DAUA 1O7ZA 3C19A 2N7JA 1C1YB 4A9AA 1KABA 3R8BA 4P1CC 2I5MX 3M4QA 4GDKA 2HDEA 2B2TA 1EY6A 2K8HA 4L5SA 1MI0A 2RHQB 3M4PA 2WXOA 4DHJD 4QIWE 1OO9B 3CCSA 1J6QA 2BA0A 3PRMB 3DOWA 3FAHA 4XYOA 2I1JA 5ELEA 3DPDA 1DJRD 1PMRA 5BN3A 1TKEA 2KCMA 4W9HA 3MEFA 5J1ZA 1GO3E 1LTRD 4KD4A 4O0AA 4TQ1A 1CA5A 2F0UA 2MH7A 2PI2A 2K5NA 2EIFA 4DK0A 5C2TB 4B08A 1ZKHA 3EGRA 4L5RC 2IX0A 4NXML 4ZRJA 3RD2A 4LF4Q 4C80A 2C9OA 1SNDA 1DD2A 1UD7A 4ZKBB 4H02A 1AW7A 3RN5A 2O6VA 1D4BA 4NAWB 3AEEB 5GMVA 3EBEA 5E6OA 1M8AA 2LEKA 3DDCB 2L3ZA 2KO3A 2ALYB 4UHVA 2K52A 2AUJD 1AE2A 4WQOB 2PZUA 1MJCA 3KYHC 4FVMA 4CDCC 1GUWA 4II3B 3I90A 2JSVX 1RKNA 3MXNA 1EWIA 1QOFA 1VCBA 1E22A 5KYIA 2ZTDA 2K3UA 1I4QA 1WE6A 1IL8A 2LZ6A 5IKCM 1WJNA 4WRDA 1WTQA 1WTPA 3T1HL 1HHVA 4A3EH 1KQSA 1S5CD 3T16A 3RMKC 3VFKA 1RDPD 4K0KQ 1VQ6A 2WKCA 5FLMG 3LYYA 3RR5A 3A8IE 4KSLC 3A1QB 4C00A 2Y0SE 4ZDVA 3IKJA 3CC7A 1IYUA 4PZ7A 1UWMA 3U7DA 3F2BA 3L4PA 4HCNB 1D5ZC 4DPGA 1EIGA 2L5TA 1K8RB 3KK7A 4DAYB 1WIAA 3I63C 1K83B 3T1YL 1Y8RC 1DYQA 1Y1WG 3RYTA 2WINB 1VQDA 1X6OA 4MN3A 5I2XA 1DXMA 1TWCH 2L11A 4IWQA 4Q0FA 1WYGA 1N36Q 2JA7G 2NR2A 4R8IA 4GDKB 2DHZA 2F52A 4RHRA 5A2QE 4MSQB 1KAAA 5JJIA 4XZ4A 1BBUA 2NCNA 4R3DA 3L9AX 5IN7A 2WYQA 4WJ4A 1WZ3A 1QCBD 1HNZL 4K8JA 2OXPA 3RNCC 1DOXA 4BY7B 3PS6A 1TS2A 1QOGA 4NB3A 1STBA 1A6XA 3ND9A 2O6VB 1W3SA 4MGIE 2JN4A 3HKZB 1XT9B 3KBGA 2VZAA 3HOYB 1PYBA 3PUVA 2PPHA 2IJ0A 1OEYJ 4KX6B 5M3FH 3I9V1 1BCPD 1TWHB 3S17H 4UP9A 2FCSA 1E2WA 3PTFC 2V3NA 3HEJA 3J7ZC 1WY8A 2UYZB 3MXNB 3D4DA 1Q10A 2KDIA 4KKTA 1CHQD 1XPUA 1DOLA 2K1BA 4DR7Q 3ONAB 4DXAB 2WV6D 1UUPA 1SJHD 2MHVA 4DV2L 2WS3B 4YSYB 1RTOA 4LK0M 2DJFC 1WR1A 3T9LA 4DHJB 4MJSA 3NSWA 2CKHB 1ILQA 1HZCA 2EYPA 4O1NA 1YI2A 3TEYA 1FYCA 4JI4L 2PNHA 1EOTA 3SDLC 4C3HB 1N33L 4ASWC 3VUXA 4B3MQ 1L6UA 1F2RI 1OTRB 1VQPA 2ZJDA 2PW7A 4JOIA 1IHZA 2K05A 4LNOA 4AWJA 3IG3A 4GSWA 2K5HA 3S2HB 1PVOA 4M02A 1EWCA 1Q5WB 2EZVA 1VQ7A 4A93B 1S3SG 4ARCA 3HOXH 2VY3A 4DR6Q 2JA5B 3KDFA 2BWFA 1U4MA 4W9EA 4K5WA 1WTRA 2R92H 2VS1A 2MUYA 2CW0D 2KJRA 1EIFA 2D3CA 2FCQA 1I4RA 3RN2A 1IP9A 1WR6E 1HR0Q 4HEA1 1I7HA 1STYA 1WJUA 4WJOA 1AN8A 3UDIA 4A3LG 4L1BA 2F0IA 5T8IA 2LGSA 4YWLA 3S16H 4PZ8A 3O65B 2ZJQA 1V43A 4NAMA 3TMPB 2B63H 3MHSD 2YTVA 1SFOH 4TV3A 2KHJA 1J7CA 2WACA 3MZ5A 3G6JB 1FPYA 3C1EA 3D3RA 3FHWA 4DR3L 1CA6A 1JW9D 1WE7A 1WXQA 2NUCA 5AZGA 2N7DA 1Q1BA 3PGEA 2A4ZA 3L08A 1VF5C 2I1KA 4PS8A 1WTHA 4DAMA 2FIFA 2OJWA 3PMFA 1B2TA 1K52A 2PE6B 4AOFA 3CCUA 4XYCA 3VUYA 4OIJA 1CHPD 5JVH3 4DV4Q 4BBRB 2I5LX 4GKJL 3QARA 4IJHA 4JWUC 1H9MA 2ASBA 3APFA 5IT9L 4XDCA 2BOSA 5KNDA 3CQZH 1S4ZA 4GOPC 4II2B 4FF3A 3O13A 5CHFA 4H0LC 1L1OA 1EY4A 2LI5A 1HTQA 4MJSB 1PH7A 4KKUA 1S3OA 2WXIA 1H9RA 2JYTA 5M3MG 5C3EH 2QGQA 4BKSD 4A3FG 4B3SL 5JEAJ 4IWPA 1STEA 3WANA 1C9OA 1OFFA 2L1BA 1F2RC 2N1WA 5IGBA 5JEAG 4NPSA 1OGWA 1Y8OB 2HHHQ 3NRZA 3CD6A 1IBKL 2Y3AA 2M17A 1SXTA 3A7LA 3K5NA 3RMHA 3AXCA 3AFPA 1S72A 4K81A 1YEZA 4DUZL 2QEJC 3DHGC 5FR3A 2LRUA 1NJIC 1VR9A 2MJ3A 4CKCA 2Q5WD 2WNMA 3VH3B 5BMIA 2EYHA 2CU3A 5I9OA 4WIPA 1YJ1A 3KDFB 2MQJA 1BCPB 3EVQA 4JG2A 4FF4A 3SFDB 1K28A 3KWVA 4FADA 3G71A 1F9QA 2A6HC 5HGQA 5L37A 2LGDA 2RSUA 2KOLA 3MP9A 4HPPA 1XMQQ 3I4MG 4X62Q 3VR2A 2Z4HA 3SGIA 1U4AA 4ODGA 1E0BA 3S15B 2JA6B 3TN2A 2B29A 2BPSA 3I4OA 3W9CB 2A69C 1V6EA 3ALBA 3VTUA 3PO3G 4BAXA 2EVBA 2M1MA 4FJZA 4FA6A 1YQBA 2ATWA 3I73A 2UU9Q 4L23A 1DOIA 3I91A 1ESFA 1UWXA 1ML0D 1Q1OA 4KJOA 1EZ8A 3MFYA 2DBYA 2W55A 2XRSD 1TIID 1JJGA 3DM1A 4E71A 1GB1A 4FBJB 4LCDE 2RCNA 4HK2A 5AZFA 3DVGX 3VA5A 2BDOA 1JMLA 3PV0A 2N9PC 5TR5A 3BDLA 5C4XH 1HE8A 3KYCD 3HOZH 3N1XC 5E3FA 2DWQA 1TWFH 2B39A 4DAVA 4MGZE 3ML8A 4K8IA 2HTME 3TBLD 1X56A 3EFUA 1O7LA 1KLGD 4XWWA 3IAYA 2PW5A 3ER0A 3SXHA 1IYVA 1C76A 4Z9CB 4A4IA 3ZKJC 2N78A 4M1UB 1Q1EA 1KOTA 1L1OB 4ZUIA 4IUPA 4RHSA 2XTIA 4NJ7A 4US9A 1OQYA 5E1FA 4EKUA 3HOUB 2NTTA 2GLSA 1SB3C 2J0KA 1TXYA 1TKWB 5FKAC 2ZW1A 4B9XA 2LXCA 2LD9A 1HZ5A 3E56A 3QG1A 3AYHB 1LM0A 1A3VA 1GUAB 5BO4B 2H4OA 1ZKOA 3JAML 4LFBL 4MNOA 3HKZE 1C9FA 4KMUC 1RRBA 2AEHA 3NY5A 2J7ZA 4K3BA 2OEOA 4V0BA 4FULA 1KFYB 1PFSA 4ME5A 2IHFA 2K28A 3TP7A 1GUNA 4MT5A 2G9DA 1RM6C 3RFZB 1TQOA 4K6LA 2F0VA 1CZWA 1GM5A 3CCMA 3Q8AA 4U673 1LQBA 1PRTC 4CDDC 1I42A 5G3LD 3RNFC 3SHLA 2IO0B 1VZ6A 4DFAA 2BT6A 2CQAA 3OIPA 2AQ3B 1YNTE 4HN7A 1FVIA 4XX5A 2B76B 3VH4B 5CMDA 5IT9c 3W5OA 1TS5A 2QF7A 2MHJA 5CTRC 4US8A 3L13A 4KHPL 3IBEA 1E8ZA 3H1UA 4OELB 4A75A 3W1YA 3GOEA 4KZCA 3ZUNA 2A74C 1IKLA 5I9PA 2ZZPB 1E7VA 4A3KB 3ZJUA 1JCKB 3K7AH 4POFA 2A6HD 3I4NG 3HOWB 1JORA 2LUEA 3H8HA 4MHEA 3WAOA 3HP3A 2BTEA 4NMZA 5FLMH 2ZNVB 3V96A 2JYOA 2KWVB 4LAAA 2D9UA 3P4PB 4DWFA 4WAAA 5IA7A 3UQBA 4RCOA 2YU9B 4IUTA 1UEBA 3OG5A 3KH0A 3I2ZA 2A69D 1JICA 2A5HA 1QOBA 2QSDA 2G9HD 2UXCL 2O5JC 1ZUD2 5BN4A 1UZXB 4IWOA 1HFNA 3AE2B 3NZUA 2ES2A 2RMMA 4HJKA 1LV9A 2KCTA 3I5JC 1KRTA 5A2QL 4A3BB 2F03A 2JXXA 1V2YA 4OVZA 3B2GA 4R4QA 4IO9A 2W3RA 2WU5B 5IP7G 1UBIA 2RDHA 1JB7A 2JZPA 1WTOA 2GBNA 4MGYE 1BT0A 5JHBA 2KX0A 2EJGC 3UDFA 2OOBB 1WOCA 2X8XX 3CF5A 2O5IC 3AB5A 1FJGQ 3SFEB 4X3KA 1LXDA 2WU2B 4X3TA 1JT8A 2BWES 5DM63 5HHDG 4DQOC 4IALA 2ZXPA 5F2DA 3H09A 1F9RA 2ZXOA 4K2LA 3NS1A 3H6MA 4DV6L 1GOZA 1E8XA 1L5PA 3ETRA 2XK5A 3GO5A 1P9DU 1JWAD 2V4LA 1V8CA 1YQ4B 4MH8A 2A6ED 3QJYA 3PHWB 1KTKA 5CV6A 3S1NB 4GMVA 3U9OA 4ZYNA 1PQSA 4C1NI 1YD8U 2R2QA 2PMZB 4BKTA 4USAA 2KQ4X 4G0NB 5KHOA 3GD7A 2VW9A 2JRIB 3E0EA 2DAJA 1TVXA 1XCTL 1R9TB 2ZTEA 4NKLA 2D11A 4FJYA 4ALPA 3DHQA 1X3PA 2VQEL 1XLOA 4LF5Q 3ZDTA 1II3A 1WH3A 2KDBA 1K83H 2KN5A 1L0VB 1PZID 3SU8X 4QL5A 1JE5A 3N52A 1AYFA 4KK7A 2KJ6A 2KJHB 3GB1A 1FFUA 2K5DA 2DYBA 3AU4A 1X55A 4WORA 1A3TA 2V1YA 4DR1L 4MTNA 4MH0E 2R6GA 3PUYA 3V2TA 1V1OA 2V9HA 3JAMc 1SBBB 3ZXVA 5ELNA 4DA2A 1XWEA 3CPWA 1NE3A 1WVLA 1GHJA 3VR5A 4KJNA 2AL6A 1EYDA 4KIKA 1P8LA 2MGSA 1SAPA 3VYRA 4LK1C 4BY7H 3JYUA 2ZTCA 4JI7L 1WGKA 4LUVA 2FBWB 3KUDB 3EA6A 1GUGA 2NS5A 2F0WA 3A55A 1K9MC 3Q6BA 4G50A 1N8RC 4BBSB 1EIYB 1OXTA 3SK4A 4L2YA 4TUUA 5KNBA 3M4OB 1ZW7A 2OQ0A 4F1SA 4X64L 3A8KE 3J81i 2NBWB 5FLXc 4Y52H 2B2UC 3OHXC 2MCNB 1WTVA 1S40A 3HOYH 3K9PB 2K5WA 1R4PB 4YCWA 4MM3A 4YY3L 4EGVA 3ZQ4A 4G11A 1RF2D 4A3LH 4J6IA 2WP9B 2XIWA 4REZA 2TMPA 3HGBA 2VQFL 4CJ2C 2NYZD 2Z6KA 5L95C 1HTLD 1SE4A 1E8WA 4HCPB 3IFWB 1Y14B 4HJGE 1TKYA 3M85A 4TMAB 4MACA 2KVZA 3Q3MC 5MPOA 3E5SA 1KLVA 1Z9FA 4JI6Q 3NWSA 1KRSA 4P71A 2UXBL 3P42A 4QIWB 2XK5B 1LTID 1STGA 2J0MA 2E2IB 1KXLA 3DWMA 4ZKCB 2WXRA 1WSPA 1SLJA 3Q0AA 1WI0A 4HSPA 3RULA 2D2CC 4X66L 1B4OA 1B3AA 1HUMA 2GRIA 4EX5A 2JU6X 2QDFA 2WAQG 2LXAA 2B2VC 1XTCD 2F0FA 4FF1A 3W1BA 3GTKB 3TDQA 4JYAL 1MKHA 3S2HH 3H0GG 2C5CA 1C78A 3I3TB 2WWZA 3TCAA 2J0JA 2JZZA 3MC0B 5EQ0A 4A93H 2WXQA 1JRUA 2DYOA 3S1RB 1UF0A 2F4VL 1AEXA 2JA5H 4A3GB 1SEBD 4CJ0B 2WXLA 4JI2Q 2K7VA 5JPNC 4A3FH 2A68C 4OX9L 4IUQA 5EPLA 2GB1A 1C7YA 4UAIA 2F0JA 3GTPB 4FXCA 4KSKC 2IGGA 1S1QB 3MJ5A 3CP0A 3I3CA 1STHA 4K5VA 3STBD 3RN9C 4A3IB 4HCEA 1PTOB 1O80A 3NTKA 5GROA 1UE7A 4PMBA 4AIMA 3BY4B 4KIKB 1XMOL 2R7FA 5C4JB 3FPPA 2D3GA 4HLEA 3UDGA 4GB9A 3N20C 2B2WA 4WAFA 4B95A 4X6AH 2JQOA 4RF0A 4HSVA 5IIFA 4K3CA 3OTOQ 4AYBB 4ZHOA 3VDYA 1RD9D 2JQRB 1XNQL 3IFTA 1J5EQ 4IPGA 2JY6A 3NZSA 2R92G 3NENA 4ITKA 4WURA 1PRTF 3OOCA 1GUSA 3PIOA 3GTLB 1E7PB 3PO2B 2J4XA 1V81A 1Y1VG 3GP7A 4LF6Q 4MM3B 2NTSA 2W3SA 2OT2A 4OIKA 1FXIA 3R2IA 5C44B 1EY7A 1ROEA 2K25A 1W6JA 4BBRH 5NUCA 3PO3H 3APCA 1STAA 1MPEA 4EZLA 5GAEC 4MEMA 5A35A 5LMNL 2UWQA 1YHAA 1EF1A 1SNQA 1Q3LA 1MHHE 2IHEA 1PYSB 3AE5B 4LF8L 3P4QB 3E0JA 4LFAQ 1WI5A 2PW9A 3IL8A 4LF7L 2FUG1 1ET6A 1R4MI 2HT1A 5EKKA 4JIOU 3RZOB 1G291 3MHBA 2ZPNA 2QCZA 3NP8A 4RGMA 2KANA 5DPSA 1GC6A 3UIPB 5FO7B 3TP6A 1BVSA 4N8X1 3VR3A 3AE8B 4DR2L 4NP5A 1Q7YC 1BBWA 1MJEA 2F0PA 1WYDA 5LMUL 1M1KC 4A3CH 5IT9E 2NMQA 4RM9A 3N30A 4HPMB 3CPFA 2Y0SG 2MEKA 1JE4A 1BR9A 3S14H 3CCVA 1F2YA 3EROA 4X3SA 2CCZA 5IGGA 1NMGA 1EUJA 2EXZA 4OO1H 2KAJA 2V3SA
chains in the Genus database with same CATH topology
4QUFA 1I6HB 3PZ8A 3MXUA 1YNNC 3KF8A 1WWTA 3MXPA 2ONQA 1FR3A 4OO1I 4BA2I 3VYSA 1PZKD 2EJMA 4NZLB 2A68D 4OHJA 3AMUA 2NVTB 1EYAA 3HUIA 1G2SA 2WXFA 1T3QA 4A3JB 3KUPA 2IL8A 2R7ZB 1Y56A 2F0GA 4WFN3 1RJTA 5M9OA 3HVDA 1PDXA 1PUTA 2R93B 5D3IB 1MBYA 3AEFB 1TR5A 1C4AA 1UAPA 4H13C 4DNRB 1XCQL 3LWUA 3P1MA 4HTHA 2LUMA 3HOVB 5GXGB 2B2YC 1UEAB 1PGAA 3AEDB 2EY2A 1MHXA 2WDQB 1Q90A 4XT1B 3I8ZA 3LNNA 3BVZA 4DN4M 1S5ED 2L4NA 1OXUA 3EFXD 3VRAB 1F0ZA 1EEID 5ELCA 2LHEA 1N63A 3WOEA 1QB5D 1BCPC 1C4CA 2JYEA 1YJJA 3JAME 2FJ2A 2NN6G 3AE3B 3ZJVA 4R9WA 2E6XA 3VR4A 1HTPA 2MJEA 1SE2A 3KLSA 1VZ7A 1JWUD 3DWAA 3AE7B 2R3ZA 2DY8A 2LGIA 3A56A 1QOHA 3ZJTA 1ET9A 1SSOA 4WWMA 4A8XC 1YNND 4IZ8A 5ISRA 4KV6A 1MSGA 4FP5D 5FLXE 2GI9A 4KGTA 4J6HA 1WTXA 3MXGA 4JWSC 2WIIB 3W1SA 3UI3A 1ESRA 3OMGA 1E6EB 5D7GA 2CW0C 1UNSA 3H91A 1DCZA 1IGCA 3RPFC 1GPXA 3FVQA 3W5UB 4J1MA 1I3QB 5T1IA 4WQMA 3X3NA 2N88A 3TEZA 3TEWA 3QWNA 2G1EA 4HKQA 1Y8PB 1OQRA 5JAVA 1HA6A 1VDVA 1VRAB 1FGBD 1VZ8A 4J3OD 5EGTA 1TJEA 2EYLA 4CQNA 2RA4A 4ABNA 1FD7D 3D4WA 4KY5A 2ID0A 1P7EA 2FMCA 4NJCA 1W6KA 3TZDA 2PPBC 1IBXA 4I7ZC 1FD6A 4C3JB 4QF4A 2J52A 2NVYB 3I72A 3FKIB 1Z6HA 1T5XD 5JPMC 1NEKB 4NDXA 1H9KA 4CKEA 2ENBA 1BUIC 4ZHPA 1F2MA 1D5MC 5M5XB 4RFBA 3GS2A 4RCNA 1JWBD 4DU9A 3DWQA 1SYDA 3V05A 1SYGA 1FRDA 4HMIA 4N59A 3LWEA 1QOAA 5HFYA 3BVMA 5E4WC 2Z1CA 1WCMB 1JB3A 2B8GA 5ELDA 4FXGC 1QLBB 5BYSA 1SYCA 5DM73 1YN4A 3AEAB 1WD0A 3MWYW 4A55A 1I4PA 1K53A 1JOOA 1MD2D 1AWDA 3AE6B 1L4DB 5C0XI 5AUKA 4KN4C 1NENB 2WXJA 1D6EC 1PFMA 3BK1A 2SNSA 2XSCA 1HRJA 1EM7A 1IBXB 4C3HG 1UGJA 2YEPF 4GDLB 2BS4B 2WDRB 3R2TA 3KQ4A 1HPCA 1X3QA 5CV9A 2N0SB 1LT6D 1PGBA 2K22A 4C7YA 2N55A 3P20A 3J7AV 4FYDA 3J80E 2X6LA 1SSNA 2KEDA 1RWSA 2RDFA 4ULLA 2DYMA 1YMHE 4L8JA 1FM0D 1BCPF 4A6QA 2IW3A 1RHPA 1PYWD 1CZPA 4YSXB 1E10A 3IAM1 2EYJA 3M7NA 3E6ZX 5I2YA 3TEXA 2AX5A 1S5BD 3NVVA 1QKZA 1YNJD 4RGTA 1HA5A 5COYA 2SNMA 3ND8A 1B9MA 4ZQ3A 3IT4B 4BWGB 2J42A 3J7YW 1HUNA 2KN4A 2IPKD 3H94A 1HCZA 2X38A 4KHVA 3TZUA 3NVWA 2KCNA 2F0TA 1JWSD 2MJDA 3PO0A 2AUKA 4HR7B 4DF7A 2CJNA 2SAKA 1SYFA 1EU3A 4F87A 1PZJD 2KEEA 4C3IB 4C56C 4ILWA 4PMCA 3BIID 1NVID 2JXMB 1VMCA 2KJXA 1ILPA 4OZCA 1TWGB 1TYGB 3Q6SA 1QE6A 5HGTA 1JC7A 1BUVT 4Y7NB 5EE3A 1EEFD 2VNUD 4YXDB 1PFNA 3GTGB 3QB3A 4KGRA 1FNWA 1STNA 2JA8B 2L1AA 3S1MB 2NVQB 2A6EC 4OO1G 2JEAI 1RYJA 1SIJA 2NN6H 1ICWA 3BS1A 4PMWA 3NVZA 1D1IA 5I4DA 3W3AA 4A90A 1Z7TA 3SDZA 4B0EA 1EFID 2NN6I 3BWUD 3N9YC 1XO3A 3WOFA 1X32A 2QDBA 5FLXL 2BDNA 3D6WA 4KY6A 3GTOB 3AEBB 1EZ6A 3F2UA 2XWJB 3NTHA 4IUNA 3GTMB 4A3DB 1N5XA 2EOTA 1TZOA 1DONA 1ZP0B 3P4RB 1G8ZD 4N9PA 5EBCA 1A15A 2WXPA 1DOKA 4KKIA 2PVGC 4KY7A 4ZOHC 1C48A 3NZ3A 2MPMA 4KI0A 2M0AA 5EE0A 2F1MA 2EDGA 2XVSA 3NXWA 1KRHA 1EWYC 3GV3A 3ZGZA 1LABA 2K5PA 4JPSA 1VF7A 1LT3D 3H3VC 1N62A 3M4YA 1Z47A 2B2WC 3P4SB 4Q5VA 4XDDA 2LY7A 4XTCS 5JXVA 3ITPA 3S1QB 2BCOA 1XLPA 1SJED 4HCSA 1GUTA 2DLBA 5E6JA 1PFBA 3AMZA 1SNCA 3CWIA 5IGEA 3KLRA 1JOKA 1XXGA 4AQ7A 2PLPA 1R7SA 2K32A 1PTOD 3NE5B 4RGNA 4ARIA 5LNK1 4MIUA 2Y5PA 3ABVB 4A3EB 4K5XA 1G91A 1KNEA 1M4VA 3BDOA 3D8GA 4P16A 2XNAC 3EUB2 1OXSC 1QJOA 1HZ6A 1Y69U 2BBCA 1DGJA 1CQVA 1WTWA 3D31A 1HQRD 3TUOA 2QKIC 1C4PA 1FCLA 3A8JE 3B9JA 5BYRA 4IKGA 3RD4A 3ZYYX 1S5FD 3T13A 1J7BA 2ZXRA 5JJZA 5CV5A 3G7LA 1BOSA 3T56B 2EELA 4HMJA 5G3LF 5CYUA 2IWHA 3BK2A 2LMCA 4IURA 5K5PA 3WCQA 5K36G 3L3OC 3A7AB 5C3JB 2RKSA 3T51B 1FFVA 2VB2X 5M3FB 3SK5A 2WDVB 1B1ZA 3OIQA 3K59A 2F3VA 1TU2B 4OZAA 1JR0D 1OXVA 1BBXC 3GTQB 4YSZB 1XX8A 1SNPA 1BF4A 4FF2A 3AECB 3ERQA 2W82A 4K2KA 1SMYD 4CGYB 2EPBA 1EU4A 4N9TA 2LS01 1IUEA 3AE1B 3IXSA 1L0YB 1BDOA 4FXKC 2AQ2B 5H92C 3HOXB 3BZDB 4DK1A 3DXJC 3KLSX 4YWGG 3HRDD 3J80L 2PTLA 1HEZE 1MI2A 2F0HA 3Q24A 1T5EA 2WB1B 2FE8A 3OWEB 4XQJA 2F4IA 3X3MA 4ZK9B 2L55A 2VUMB 4L63B 2E76C 2LMCB 4ZRPA 3GV6A 3LXFA 5KRUA 3N6RA 2B2TC 2LHDA 5ELBA 1B53A 2EY1A 5D65A 4KKJA 1KH0A 1RODA 1QNKA 4E6IA 2PKOA 5AUIA 1F2LA 3FDTA 3P63A 2NVXB 5C0XJ 1ZYRD 3U52E 5C0XG 5AFWA 3QOLA 1LTAD 5G5GA 1J7AA 1QNUA 1JALA 1BNZA 4QUCA 1JWMD 4HRSA 4QCLA 1BQQT 2EY6A 4ZRZA 1SYEA 4DGZA 3B2FA 3C46A 2L83A 2ICIA 4L6TB 5C3EB 4A3MB 2HDMA 3TP8A 4RWSC 1VMPA 3AU7A 3RZDB 1J9OA 1DOMA 4C1NK 2RBMA 5BN5A 1PRTB 5DEHA 2RQXA 2TSSA 2KQ3A 2F0EA 3VR6A 2F0QA 5LHY1 1OXXK 2X6GA 2E2JB 5I6WA 1MSHA 2BB5A 3J7AF 3K0YA 1TKGA 2EYFA 3HZXA 1CTMA 4C7ZA 1YN5A 5CORA 5J39A 4N58A 3T53B 3CRLC 1U4RA 1WRIA 1TT2A 2E2DC 4LMQD 3VA7A 1VJKA 2K5QA 4B0MA 3BYYB 3HOZB 4RNAA 1TWFB 4KHZA 2E75C 2HUGA 1SNOA 2D5DA 4B9WA 5IGFA 5EE9A 2K6AA 2QILA 3DUZA 1NCVA 4R8NA 5KEEA 4LLGM 5EKIA 1BXTA 1L4ZB 2V4IB 4ZRQA 3T3OA 1LO5D 2KA7A 1D1KA 2MJ8A 1GAQB 2F0OA 3RLFA 1ENCA 1VLBA 3AV8A 5D14A 2IX1A 1ONLA 2O2LD 3NUHB 1KDAA 2LFNA 2E74C 1NYQA 4X3UA 5J22A 3W2DA 5CC4A 3FEWX 5FO8B 1LTSD 1FCCC 5IODA 2HCCA 2JXTA 4GLSC 1JROA 4I65A 2SOBA 1GJXA 1ENAA 2KCCA 5I6YA 1A70A 1G2TA 1D5XC 3KBXA 2AQ1B 4RGOS 2KMMA 3P75A 5IGDA 2BE5D 3K7AB 4K6DA 2JX5A 2ZT9C 2IT1A 2OHFA 1PLFA 3FPUB 1XF5L 3M3YB 4TSSA 3BVGA 2XRQD 3I70A 1HFGA 3SR6A 1C4QA 1FIQA 1EQVA 2K03A 1Y1WB 3MHZA 1MGSA 4XIGS 2L52A 3NTIA 5CBEE 3I57A 1RCVD 1U9RA 1CM9A 2JA7B 4YTNB 3C3LA 3U4EG 2NB0A 4XWTA 2QJLA 2WLBA 2M9VA 4IQZA 3R93A 3CU7A 5KGUA 2PVOD 2NZ1D 1R4QB 2RVLA 3FILA 1K8OA 5TSSA 1LT4D 5BMHA 2K9XA 4YTMB 3P1HA 5K36H 4CKBA 3U2SC 2O4XA 2INNE 4CJ1B 2PZWA 3DWGC 5KNCA 4ZYSA 1CT1D 5IOCA 1A2UA 1IW7D 2B8FA 4N6EB 5C5LA 3DWPA 2BS2B 3RUZA 3C8YA 5CR3A 1NR2A 1RTNA 3MAQA 4IUVA 3Q22A 2VZKB 2BA1A 2Q8TA 5C3XA 1Q12A 1F9PA 1SDFA 1N61A 4KN7C 2Q8RE 1F9SA 3UI2A 2D5GA 4KTAA 4IUUA 1LACA 5HURA 2AWOA 5DNFA 4ZLTF 2FHTA 2WXNA 1ZOYB 2MP1A 1H9SA 1E9MA 1CFMA 2F0SA 1B44D 4RKLA 5FOBB 1O78A 2RSNA 3Q8CA 4RF1A 5H8YE 4RKBA 3VR8B 3CRKC 1TWAB 3AEGB 2BYTA 2J0TD 2KVMA 2A73B 3NBIA 2XWBB 1RFKA 2LFIA 1YNJC 1AZPA 1ZDVA 3FILB 2BB6A 3Q8BA 2KACA 2M56B 2SEBD 2KUMA 2L12A 1U4LA 2B2YA 1FNUA 1OQQA 1EY8A 4TQ0A 5C0XH 1NR4A 2PO4A 3NHHA 4EVOA 4C3JG 4EE2A 3J81E 3AB9A 3C2PA 4CBVA 2I07B 5CBAE 5M3MB 2FFKB 4A3FB 1WD1A 5CV7A 2F0DA 2JP1A 3DEOA 2JEBI 1PTOH 3BYTB 4RH6A 1IGDA 1H9SB 1B50A 1NYRA 4F8MA 5CV8A 4PQXA 2RPVA 2EKIA 2PIAA 3Q23A 1I50B 4P2CB 4HEDA 2F0KA 2EY5A 3T4AC 1VDZA 3HS0C 1FNVA 3EJIA 3OW7A 3K57A 1EL0A 1A3UA 3I4MB 5M5WB 2FMMA 1K8MA 3D4RA 3PO3B 4OW0A 2K01A 3D6CA 1Y8NB 2PQEA 1DZ1A 2V3PA 1TY2A 2N9LA 3VQIA 1I4HA 1U4PA 3IAS1 2YEPB 3NK9A 4BS9A 4O42A 3Q8FA 1V8QA 3C1FA 3NVYA 1AZQA 3FC4A 2CJOA 5BYQA 3T3NA 2WXMA 2KDMA 2EJFC 2VB3X 4RAUC 3PIO3 2M2LA 4H7BA 3AE4B 1KNAA 1XLQA 2KWDA 2I38A 2L9HA 1HXYD 3S14B 5EJWA 2W54A 2Z4IA 3W5VB 2H88B 2IGDA 2GA4B 2IGHA 1LT5D 1CI3M 2Q8IB 1FEHA 3K58A 1ZXIA 1F2ZA 3QO2A 1GXDC 2F0NA 1JRPA 3CHBD 2KECA 2DN8A 1PTOC 4IFDH 3PUXA 2J53A 2LJIA 2ICEC 5KIXA 4YIJA 4EQPA 3NQIA 1PDQA 1I4XA 1J8IA 4XQNA 1LLRD 4QB4A 1BMLC 3VRBB 5LL6S 3NUCA 1QF6A 4IFDI 2Z8LA 3VYUA 3SVMA 2WXHA 1N5WA 1FMAD 3PIP3 3K6OA 1LTTD 3NWTA 3I4NB 2M00A 4IN3A 4XXEA 3HVZA 1EY9A 1N60A 4BY1B 2WXGA 1A2TA 4C3IG 3BG3A 5M5YB 3K5MA 5C6AA 4G4KA 1SF0A 4FXDA 5EKLA 5EBDA 2PZTA 1K50A 3TMEA 2E2HB 2OF1A 2IDYA 4JE3B 3IT6B 1QILA 3VYTA 3CKIB 1D2BA 1EIHA 2H89B 4F88A 2QIEB 3OWFA 1AP0A 2Y5CA 3Q8EA 4OL7A 2RSOA 3PUWA 3TBIB 4ZUJA 3DEPA 3MA2B 3P7JA 2F0MA 4G7OC 1EY0A 1MVKA 2JSOA 3AE9B 2ACZB 4PV1C 3Q69A 4K14A 1F77A 4FO2A 3K5LA 1XYIA 1NSNS 4LTUA 4C2MB 1VCIA 1SMYC 1NAPA 1AFPA 4H2AA 2OEDA 3MTSA 5CV4A 4XT3B 1EY5A 3DMUA 3LB8C 4ID6A 3AM9A 1C79A 2H1EA 3OMCA 1DM0B 4NW2A 5JOBA 3NQTA 2QMTA 1V1PA 4U68A 3E9SA 3M7GA 3GTJB 3HG9A 1QQRA 2F0LA 3SR1A 2K33A 4DAPA 1ZE3D 4J8QA 1O7YA 1CQFA 1TWCB 3MVVA 2L0CA 1E2VA 1YJIA 1BO0A 3URYA 1HQMC 3GQBA 4ZAIA 1EWHA 5BMGA 2V0GA 2KHSA 2ZW0A 1ZYRC 3CIRB 4JX1C 2DNCA 2V4DA 2PYKA 4Q2JA 4EQNA 5C3WA 2CHBD 5HG2A 2LKVA 1KLUD 3HRZC 4HKZE 3BDCA 1PRTD 3QOJA 4G7HC 2R61A 5G5HA 2JWUA 2DY7A 1PFDA 3NBHA 5C4HA 3R3OA 2WAQB 2HQEA 3S17B 3MFGA 3J81L 4BA1I 1G6ZA 4HROA 3H0GB 1C77A 5CGKA 3V3XA 2WKDA 4JBWA 4OZBA 3TSSA 2WQYB 2VXWA 4UDUC 1JQ4A 3QIAA 3S9WA 1PXUA 3OSOA 2PMVA 5EE1A 1CK1A 2WP8J 3U9SA 2F3WA 1V1PB 4XQQA 1NI3A 1B9RA 1ZDXA 2I46A 4G57A 1EQTA 4HAEA 2SDFA 2YYZA 1ZEQX 4V190 3WDNA 3TP5A 2R92B 1PTOF 1PGXA 1GHKA 5T1GA 1Y1VB 5FK9C 1IKMA 1EYCA 1Q8IA 4M0WA 1SE3A 1KF6B 1QT9A 3S16B 4WJWA 1LTGD 2B63B 1XLNA 1JQYD 4JK1C 1CJEA 1SFOB 1E2ZA 2D62A 3KWLA 5IGCA 5LL6X 1S5DD 3OPOA 1C8CA 1DOYA 1XEEA 4P6VF 1TS3A 5JEAH 2EE1A 4TRDA 5JVG3 4XDXA 2NWGA 4GZYC 1KDCA 5HI1A 2CVRA 4YT0B 2N9KA 2K04A 2EYMA 1FO4A 4D2KA 3CQZB 1I6VC 4AS1A 2Y0SB 1QWYA 4M8AA 1ACCA 1V97A 2QCPX 4QMGA 3AN1A 2FINB 1I4GA 2RDGA 2INPE 3LX0A 5EPKA 1LTBD 4KKSA 3SE0A 3SK6A 5FO9B 3J9CA 1L0XB 3A54A 5EPJA 3AH7A 3SK8A 3K5OA 1L6VA 3EQLC 4IOIE 5D3DA 4F7XA 1ENFA 1P7FA 1K51A 2BE5C 2NBFA 2JE6I 4G7ZC 2K0PA 3PUZA 5KYLA 1NUCA 1QG7A 2XN9C 1KDBA 4FNFA 4KD3A 4DNTB 1FXAA 4XYQA 2BS3B 4RA8A 2E3TA 5C4ZA 4TQUS 4S3SA 1SNMA 3MEHA 3I4LA 3NPPA 2IX3A 2I2YA 2M19A 5C4XB 4XE0A 1FRRA 2PNRC 3PZ7A 2B2UA 3VR9B 1B9NA 5C5MA 1JOQA 2L32A 4KGSA 3SEBA 1SYBA 2PCFB 1YQ3B 3FMCA 1CZGA 2VZKD 1GB4A 2AWNA 4LJZC 2ON8A 1IW7C 4OGQC 1ZXTA 1ZXHA 1GUOA 3U7ZA 4DXFA 4PNYA 4EQOA 4YTPB 2DNEA 4TKOB 1TY0A 5ELFA 4PT5A 4IFDJ 2HCIA 1H9JA 1T6BX 2B2VA 2HDLA 4IFDG 4WH4A 4H44C 4IDIA 3IFDA 1TS4A 2EYOA 4DXGA 1YN3A 1ZPSA 5E4XA 2WXKA 2X69A 4CHTB 4DAYA 1E0ZA 2BW2A 3FRPB 3S2DB 3L7ZC 5DAUA 1O7ZA 4A9AA 2N7JA 1KABA 3R8BA 2HDEA 2B2TA 1EY6A 1MI0A 2WXOA 1OO9B 2BA0A 3FAHA 4XYOA 5ELEA 1DJRD 1PMRA 5BN3A 1TKEA 5J1ZA 1LTRD 4KD4A 4TQ1A 1CA5A 2F0UA 2MH7A 5C2TB 4DK0A 4B08A 3EGRA 2IX0A 4C80A 2C9OA 1SNDA 1DD2A 4ZKBB 1D4BA 1AW7A 4NAWB 3AEEB 1M8AA 2LEKA 2AUJD 2PZUA 4FVMA 1GUWA 3I90A 2JSVX 1RKNA 3MXNA 1QOFA 5KYIA 2K3UA 1I4QA 1IL8A 4WRDA 1WTQA 1WTPA 1HHVA 1S5CD 3T16A 1RDPD 2WKCA 3LYYA 3A8IE 3IKJA 1IYUA 1UWMA 3L4PA 1D5ZC 1EIGA 2L5TA 3KK7A 1K83B 1DYQA 2WINB 4MN3A 5I2XA 1DXMA 2L11A 4Q0FA 1WYGA 4R8IA 4GDKB 4RHRA 5A2QE 1KAAA 4R3DA 3L9AX 1QCBD 4K8JA 2OXPA 1DOXA 4BY7B 1TS2A 1QOGA 1STBA 1A6XA 3ND9A 3HKZB 3KBGA 3HOYB 3PUVA 2IJ0A 4KX6B 3I9V1 1BCPD 1TWHB 1E2WA 2V3NA 3HEJA 3D4DA 1Q10A 4KKTA 1CHQD 1DOLA 2K1BA 3ONAB 2WV6D 1UUPA 1SJHD 2MHVA 4YSYB 2WS3B 1RTOA 4LK0M 3NSWA 1ILQA 2EYPA 4O1NA 3TEYA 1FYCA 1EOTA 4C3HB 1L6UA 1F2RI 2PW7A 1IHZA 2K05A 3S2HB 1EWCA 2EZVA 4A93B 4ARCA 2JA5B 1U4MA 4K5WA 1WTRA 2MUYA 2CW0D 1I4RA 4HEA1 1I7HA 1STYA 1AN8A 4L1BA 2F0IA 5T8IA 1V43A 4NAMA 1J7CA 2WACA 3MZ5A 3G6JB 3C1EA 3D3RA 1CA6A 1JW9D 1WXQA 2NUCA 1Q1BA 1VF5C 3PMFA 1B2TA 1K52A 4OIJA 1CHPD 5JVH3 4BBRB 4JWUC 1H9MA 5IT9L 4XDCA 2BOSA 5KNDA 1S4ZA 4FF3A 3O13A 4H0LC 1EY4A 4KKUA 2WXIA 1H9RA 2JYTA 5JEAJ 1STEA 1OFFA 2L1BA 1F2RC 5IGBA 5JEAG 1Y8OB 3NRZA 2Y3AA 1SXTA 3A7LA 3K5NA 3RMHA 2QEJC 5FR3A 1VR9A 2MJ3A 4CKCA 2Q5WD 2WNMA 5BMIA 2EYHA 2CU3A 5I9OA 4WIPA 1BCPB 3EVQA 4FF4A 3SFDB 3KWVA 1F9QA 2A6HC 2KOLA 3MP9A 3VR2A 2Z4HA 4ODGA 1E0BA 3S15B 2JA6B 3TN2A 3W9CB 2A69C 2EVBA 3I73A 4L23A 1DOIA 3I91A 1ESFA 1UWXA 1ML0D 4KJOA 1EZ8A 3MFYA 2DBYA 2W55A 2XRSD 1TIID 1GB1A 3DM1A 3VA5A 2BDOA 1JMLA 3PV0A 3BDLA 5E3FA 2DWQA 4DAVA 2B39A 4K8IA 2HTME 1O7LA 1KLGD 4XWWA 3IAYA 2PW5A 3SXHA 1IYVA 1C76A 4Z9CB 4M1UB 1Q1EA 4ZUIA 4IUPA 4RHSA 4US9A 5E1FA 3HOUB 2NTTA 1SB3C 1TKWB 5FKAC 2ZW1A 4B9XA 3E56A 1HZ5A 3QG1A 1A3VA 2H4OA 1ZKOA 3JAML 1C9FA 4KMUC 2J7ZA 2OEOA 4V0BA 1KFYB 4ME5A 2K28A 3TP7A 1GUNA 4MT5A 2G9DA 1RM6C 3RFZB 1TQOA 4K6LA 2F0VA 1CZWA 3Q8AA 4U673 1PRTC 5G3LD 3SHLA 1VZ6A 4DFAA 2BT6A 2CQAA 3OIPA 2AQ3B 1YNTE 4HN7A 2B76B 5CMDA 1TS5A 2QF7A 4US8A 2A74C 1IKLA 5I9PA 4A3KB 3ZJUA 1JCKB 3HOWB 2A6HD 1JORA 3H8HA 2BTEA 4MHEA 3HP3A 4NMZA 3V96A 2JYOA 4LAAA 2D9UA 3P4PB 4RCOA 2YU9B 4IUTA 2A69D 1JICA 2A5HA 1QOBA 2QSDA 2G9HD 2O5JC 1ZUD2 5BN4A 1HFNA 3AE2B 2RMMA 1LV9A 5A2QL 4A3BB 2F03A 4OVZA 3B2GA 2W3RA 2WU5B 2RDHA 2JZPA 1WTOA 2EJGC 2O5IC 3AB5A 3SFEB 4X3KA 2WU2B 4X3TA 4DQOC 5DM63 5HHDG 4IALA 2ZXPA 5F2DA 3H09A 1F9RA 2ZXOA 4K2LA 3NS1A 3H6MA 1GOZA 1L5PA 3ETRA 3GO5A 1JWAD 1V8CA 1YQ4B 4MH8A 2A6ED 3QJYA 1KTKA 5CV6A 3S1NB 3U9OA 4C1NI 2PMZB 4USAA 2KQ4X 3GD7A 1TVXA 1XCTL 1R9TB 4NKLA 3DHQA 1X3PA 1XLOA 1II3A 1L0VB 1PZID 3N52A 1AYFA 4KK7A 3GB1A 1FFUA 2K5DA 4WORA 1A3TA 2R6GA 3PUYA 3V2TA 1V1OA 1SBBB 4DA2A 1XWEA 1WVLA 1GHJA 3VR5A 4KJNA 1EYDA 2MGSA 1SAPA 3VYRA 4LK1C 1WGKA 2FBWB 3EA6A 1GUGA 2F0WA 3A55A 4BBSB 1OXTA 3SK4A 4L2YA 5KNBA 3M4OB 3A8KE 2B2UC 3OHXC 1WTVA 2K5WA 1R4PB 4EGVA 3ZQ4A 1RF2D 2WP9B 2XIWA 4REZA 2TMPA 3HGBA 4CJ2C 2NYZD 1HTLD 1SE4A 4HJGE 4TMAB 1TKYA 3M85A 4MACA 5MPOA 3E5SA 3NWSA 3P42A 4QIWB 1LTID 1STGA 2E2IB 3DWMA 4ZKCB 2WXRA 1WSPA 3Q0AA 4HSPA 2D2CC 1B4OA 1B3AA 1HUMA 2GRIA 2JU6X 2B2VC 1XTCD 2F0FA 4FF1A 3GTKB 3TDQA 1C78A 2C5CA 3MC0B 5EQ0A 2WXQA 2DYOA 3S1RB 1AEXA 4A3GB 1SEBD 4CJ0B 2WXLA 2K7VA 5JPNC 2A68C 4IUQA 5EPLA 2GB1A 4UAIA 2F0JA 3GTPB 4FXCA 2IGGA 3MJ5A 3I3CA 1STHA 4K5VA 4A3IB 4HCEA 1PTOB 1O80A 3NTKA 4PMBA 5C4JB 3FPPA 2B2WA