1SE3A

Staphylococcal enterotoxin b complexed with gm3 trisaccharide
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
239
structure length
239
Chain Sequence
ESQPDPKPDELHKSSKFTGLMENMKVLYDDNHVSAINVKSIDQFLYFDLIYSIKDTKLGNYDNVRVEFKNKDLADKYKDKYVDVFGANYYYQCYFSKKTNDINSHQTDKRKTCMYGGVTEHNGNQLDKYRSITVRVFEDGKNLLSFDVQTNKKKVTAQELDYLTRHYLVKNKKLYEFNNSPYETGYIKFIENENSFWYDMMPAPGDKFDQSKYLMMYNDNKMVDSKDVKIEVYLTTKKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords STAPHYLOCOCCAL ENTEROTOXIN B
publication title Residues defining V beta specificity in staphylococcal enterotoxins.
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Toxin
total genus 69
structure length 239
sequence length 239
ec nomenclature
pdb deposition date 1996-10-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01123 Stap_Strp_toxin Staphylococcal/Streptococcal toxin, OB-fold domain
A PF02876 Stap_Strp_tox_C Staphylococcal/Streptococcal toxin, beta-grasp domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.110 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1se3A01
3.10.20.120 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1se3A02
4RH6A 3SEBA 1LTAD 1PTOC 1I4QA 1GOZA 1SE4A 4C56C 3V05A 1BCPD 1TS4A 1CK1A 1L0YB 1TY2A 2QILA 1BCPB 4RGMA 4RGNA 1KLGD 2NTTA 1D5MC 1D6EC 1LTRD 1XTCD 1YN4A 1I4PA 1PRTC 1JQYD 1FGBD 1S5FD 2O2LD 1BXTA 1DYQA 1ESFA 1S5DD 1LTTD 1V1OA 3TSSA 2IPKD 2QEJC 3BYTB 1LT5D 1HTLD 3CHBD 5FK9C 1M4VA 1PZJD 5D3DA 1EEID 3MFGA 2XRSD 1JWUD 3BVZA 1RD9D 3BYYB 1PTOH 3DWPA 1LT6D 2RDGA 4RCOA 1ENFA 1XXGA 2G9HD 3O13A 1YN5A 1CHPD 1CQVA 1B44D 1I4GA 1PTOF 3R2IA 1EFID 1V1PB 1SJHD 5ELDA 3KLSX 4TSSA 1MD2D 3EA6A 3DWQA 4O1NA 4RHRA 1JWSD 1RDPD 2RDHA 1KTKA 1D5XC 1L0XB 3R2TA 4K6LA 2IJ0A 1G8ZD 5D3IB 3BVMA 1SBBB 1T5XD 2ICIA 2Z8LA 3BZDB 3MC0B 1AW7A 1SXTA 1PRTF 1HXYD 1TS2A 1EU3A 1FD7D 4L6TB 2J4XA 4DXGA 1PTOD 1TY0A 5ELFA 1EEFD 2TSSA 1PTOB 3R8BA 1S5ED 1LTSD 1CT1D 1DJRD 1SE2A 1V1PA 3DWAA 4Z9CB 1LO5D 1KLUD 5I4DA 1ET6A 1I4RA 1PRTD 1YN3A 1I4HA 5FKAC 1PRTB 2AQ2B 1PZKD 4L63B 1JR0D 1TS5A 4ZYSA 1SEBD 4NZLB 1BCPC 1LT3D 5TSSA 1FNWA 5ELBA 1LTBD 1RCVD 3OWEB 4RGTA 5ELEA 1I4XA 3W2DA 1UUPA 1LTGD 1TS3A 1S5CD 1UNSA 3GP7A 1AN8A 3BVGA 1CHQD 4RGOS 1PYWD 1STEA 4RHSA 1EU4A 1B1ZA 1LT4D 1LTID 1F77A 2R61A 1PZID 1JWMD 1HQRD 3EFXD 1SJED 2XNAC 1SE3A 1FNVA 1EWCA 2AQ1B 4DXFA 1LLRD 2SEBD 1S5BD 2XN9C 4OHJA 1HA5A 1FNUA 2CHBD 1BCPF 4BWGB 1D5ZC 4UDUC 3URYA 2WV6D 2NTSA 4RFBA 5ELCA 1JCKB 1RF2D 2AQ3B 1QILA 1ET9A 2XRQD
chains in the Genus database with same CATH superfamily
1LTAD 4ZRPA 1JICA 1KDBA 1L0YB 4N8FA 3CMAA 4BY7B 1Q5WB 2OTJA 5C3EG 4KV2A 1NR2A 2K8BA 4KZCA 2REXA 5CV7A 3S2AA 1D5MC 3HP3A 4OX9L 4MJSB 1PDXA 4OGQC 2JYTA 4FN2A 1G2TA 2WDVB 1V43A 3ETRA 3RFZB 3FMCA 3HRZC 4X66L 3Q0AA 3V2TA 2E2HH 1I6VC 1XNQL 1EWHA 1WCMG 5FLMH 3W5UB 3PSIA 3U50C 3TZUA 1P7FA 1VZ6A 4RWSC 5DM63 2EY5A 2MPMA 4GGQA 4PZ8A 2L8JA 2OEDA 1GUNA 2PI2A 5G3LD 3KJPA 4AP4C 4GLXA 1DOYA 3A9JA 2PQAA 1T3QA 1IL2A 4ZHOA 3QJYA 3S1QH 2V3NA 3BYYB 4JI5Q 1BUIC 3AE2B 2VNUD 2NVUI 1L1OB 2CWPA 2ZM6Q 5IO9A 2IL8A 2ON8A 3V6CB 3R2IA 3CCMA 2FMMA 5J22A 4DHZB 1HZ5A 3R7RA 4BBSG 3TEYA 2JYOA 3HOYG 2WXOA 2K5QA 5BYRA 4ZAIA 3I4MB 1WWTA 1B9MA 3K7AH 1TWAH 4J15A 5JAVA 5M5XB 2DZKA 2LWPA 4IALA 3U7DA 3N1YC 4JI3L 4L6TB 1RJTA 3AULA 1ZOYB 1E1TA 4KTAA 1J9OA 5CBEE 4B3SQ 4WORA 2KBNA 5EBDA 1S5ED 5FJ8H 2QA4A 2F0EA 2GN5A 3E6ZX 1BBXC 2K5WA 3FEWX 3HOVB 3S14B 1PDQA 5BMIA 4YSYB 2ZZPB 2ES2A 3FRPB 2NZOA 2E5LL 3PO0A 1E2WA 3ONAB 4ARIA 2LZ6A 4C1NI 4LJPB 4MH8A 3D4RA 4L63B 1FVIA 1JROA 5EDSA 4XYQA 2ZNVB 3IXSA 2KHJA 2E76C 5JJIA 2WLBA 2F0HA 2KMMA 3HOXG 2EQSA 2NVXH 1OEYA 1VQIA 2AUKA 1J5EQ 2DYBA 4XWWA 4N9PA 4XQQA 3AEVA 1NMGA 1U4LA 5CR3A 2UXBL 3I91A 3TUOA 1PFDA 2HTME 4ULLA 2NBUA 3NVWA 1YJ1A 3UGBB 1AN8A 2R7ZG 4MGYE 3W1GA 3BVGA 4OWTB 1WMHB 3CRLC 2L83A 5AZHA 1EU4A 1STNA 4LAAA 4ME3A 2Q8IB 2ZTCA 3AU4A 3KUCB 4JWUC 4K1RB 2GB1A 3CF6E 4GNXA 4LMQD 2KA7A 3L4PA 1OXUA 4A3MG 4FYDA 2V4LA 1N6ZA 4IUTA 3W1BA 3I63C 1SR3A 4W9KA 1IBKL 1KDAA 4KHZA 2LUMA 3GTKB 1L1OC 4DUZL 1D3ZA 4DV5L 4IG7B 4OHJA 1UBIA 2KCMA 3ND8A 3S16H 1XT9B 1JT8A 1QKZA 1DONA 2KHSA 3KWVA 1KAWA 2X8XX 1KD1C 2E2JB 3H0GH 4RFBA 2HQLA 2AL3A 2N7DA 1YD8U 3SDLC 2VUMG 1VF7A 2HUGA 4ZKBB 1TBEA 4IUNA 4A75A 2M19A 4RNAA 1ILQA 2ZT9C 1L0VB 2O6VB 2A69C 1KC8C 2WXFA 4WH4A 4JG2A 1EQRA 4IPGA 4KY6A 4IOIE 2F0IA 2KCNA 1HNZQ 3P75A 1PA6A 4IWPA 5JHBA 2JXMB 5JOBA 5FO8B 2D9UA 2CJOA 1QWYA 2BA0A 4FO2A 5M5YB 1HNWQ 3OIPA 1YQBA 4GU2A 1LQBA 1GC6A 1MSGA 2NVTH 1YIWA 4CJ1B 2ZNVC 3RNGC 5C1ZA 5JXVA 4LLGM 2RSOA 1OQQA 3U58A 2BDNA 1UEAB 2A73B 3U2SC 3T1YQ 1EEID 1BQQT 3KF8B 3GTOH 4A3FH 2M56B 3EECA 2MQJA 3ENEA 3OSOA 4WFN3 3UF8A 4NKLA 4DR6Q 2WXQA 3W1SA 4JVZA 1FRDA 1CUKA 4IFDJ 2HJ8A 2B2TC 2PIAA 1YNJD 4JX1C 4JGHB 1B44D 2WKDA 2BGFA 1EY6A 1ML0D 2K04A 3I56A 3BK2A 3I9V1 2LXKA 1MD2D 4CKBA 2D10A 3U8ZA 1A3UA 3EN2A 4QIWE 1L0XB 2NUCA 1HZ9A 2ZW1A 2BA1A 3QWNA 2K1BA 3BZDB 1LFDA 3P2BA 2IHFA 1HZBA 5FLXE 3TS2A 2FE8A 4B9WA 1EUVB 4RKBA 3S1QB 2FXQA 2TSSA 3QO2A 1N9WA 1A70A 3WIMA 1YJ9A 4MGZE 3EVQA 3J81E 1TT5B 2K7VA 2YVCA 4MDKE 2C7HA 4YWMA 3HOUG 2UUAQ 1VQ6A 1X55A 1FEHA 3AEBB 4HSPA 3Q2AC 1E0BA 1I4RA 4LF7L 4HEA1 1WGYA 3KDFA 5IGCA 3P4PB 4W9EA 2BW2A 2V4DA 2VY3A 3K7AB 1TWAB 3GQBA 4N59A 4B95A 1LT3D 2D3BA 3NPPA 2WAQG 4DPGA 1LTBD 1G6ZA 4PYZA 2JYEA 4KIKA 4Q5VA 3RI7C 2LASA 1LTLA 4KZ0A 1I42A 1WI0A 4KDIC 3NQIA 1WI5A 3NK9A 1DOXA 1RODA 4RGOS 2D5DA 3D3RA 4KSKC 3ZNHB 1V9PA 1Z9FA 2L05A 1BNZA 2ONQA 3I73A 3KLRA 3MXUA 3D32A 3ONSA 4GLAC 4HR7B 1EYDA 3TRZA 1HFGA 3JC66 4YTNB 3EFXD 4QGUA 5M3FH 1XNRQ 4ANVA 3W1YA 1IYVA 4GDKB 4UP9A 2NVXB 1I6HB 3K5OA 1WM3A 2G45B 1H8CA 4KVGB 4YCWA 2DNCA 1N62A 3MEHA 3LJ3A 4M02A 5KHQA 1IW7D 4K7SA 4K2LA 1VRAB 2LRWA 2V4IB 3PHXB 2QDFA 4UDUC 4BS9A 5JVG3 2F0QA 4AWJA 1UD7A 3KW5B 2MO0A 1MJEA 5ELCA 1YNTE 2QDLA 3PIOA 1KXLA 2ZTDA 2KFJA 2M17A 2B2WA 3MC9A 1UF0A 3HKZG 4O2DA 1O7LA 1EOVA 4L23A 3KLSA 4G7OC 5JEAJ 1K51A 3Q24A 3IAS1 4CGYB 2IGGA 2WXKA 2KCCA 1C8CA 2N1VA 3DLLA 1W3SA 1FJGL 4RGMA 1WTVA 2I2YA 4R1JA 3S1RH 1Q86C 3S16B 1BDOA 2R93H 5BMGA 4PT5A 1DCZA 3PV0A 1PHJA 5FLXL 2EJFC 1U4PA 3RCZA 4DXAB 3H0GB 4GLVB 2WAQE 1SN8A 4M0WA 2VQFL 2D2QA 2B2UA 1IYUA 2Z4IA 1D4BA 1P8LA 3P7JA 3MFGA 3F1ZA 3CWIA 3I3CA 1RD9D 1IP9A 4LNIA 3ALBA 3NVYA 2MW5A 3FVQA 4X3TA 1LT6D 5BMHA 4ALPA 1XXGA 4XQNA 3T53B 4G50A 1KQSA 4IKGA 4DV6Q 3I7FA 4G7HC 4Q2JA 4TRDA 4JBWA 3H7PA 4RCNA 1E9MA 1N61A 4I6PA 1A3TA 3BDOA 1AEXA 3OMCA 4TKOB 1ZUD2 1TIID 3RLNA 2NVTB 1TQOA 1HTOA 2O5IC 3TEXA 3VAWA 4JPSA 1KTKA 5IGFA 4DR5Q 2UUBQ 1B9RA 2QMTA 3PO3G 1EUJA 3G48A 1TS2A 2MJ8A 4ABNA 2BE5D 3M62B 2Q2IA 1TWFH 3GTOB 4A3FB 1PMRA 3MFYA 4V190 1ZP0B 1ESRA 4DR4Q 4X64Q 3MXNB 3OPOA 2IZVB 3RT3B 4WWOA 3VUXA 1F2YA 3SK8A 1I3QH 1MFWA 2J7ZA 4BXXG 5EBCA 2JWZA 4IPDA 3P4RB 4MELA 1WTRA 1KLUD 1Q8IA 1F2RI 1I7HA 3D0FA 3MJWA 2YTVA 3CMMB 4H44C 3QCAA 1WJ4A 4KGSA 4XT1B 5IYBG 3FAHA 4A3DG 3I5JC 3ZJYC 1EM7A 3W1SC 1GJXA 1FNWA 2B2VC 5C0XI 2FCNA 3A55A 2A6ED 1N33L 2IT1A 1Y1VH 3HS0C 4GN1A 1UNSA 4OX9Q 3H8HA 1WGGA 1QOFA 2NZ1D 2UYZB 4II2B 3OMGA 4DHJD 1E8YA 1EY0A 4O42A 3A8IE 4KSLC 1HZAA 3HHMA 2A68C 1SMXA 1GM5A 4JI6Q 1XNQQ 3H94A 3HOWG 3NELA 1V86A 2IDYA 3HM3A 1V1QA 2R61A 2DNEA 1BO0A 4H0LC 2Y5BB 2LVPA 3D6CA 1B3AA 1QUQA 3CC2A 4X62L 1SE3A 1DD2A 2KAJA 3WA0A 4BKTA 1WZ3A 4EFOA 2PMZB 1LLRD 3N32A 2V1YA 4C3HH 3CCSA 3RNEC 3KYCD 3ZTDA 4JE3B 4K0KQ 3VUWA 1JMLA 2RR9A 4D2KA 5C3EH 4XIGS 1G91A 2R6GA 3PTFC 3CKIB 4YTPB 5DLQE 2LFNA 2UU9Q 1C4PA 4MM3B 3U52E 5HGTA 2L0CA 4PQXA 4DF7A 4EVOA 2WU2B 4JL9A 1ZKHA 2EPBA 4DK6C 5CC4A 2PMVA 1NI3A 1N8RC 2I38A 2HQEA 4JI3Q 3PV1A 2X6LA 1AZPA 5C4XG 3VR9B 4Q0FA 5CHWA 3UI2A 1SYDA 3FHWA 2K5PA 3T9LA 2KX3A 1CK1A 2KUMA 2E2IH 1BBUA 4GN3B 4YL8A 2Q2HA 4MZ9A 1TKYA 4ZLTF 1C48A 3IVFA 1RRBA 5A2QE 2D62A 2ZCBA 2KQ4X 3H7PB 2E5LQ 3MAQA 4G0NB 2DN8A 1M8AA 3WOEA 2O5JC 2KWCA 2WX0A 4AUQC 4BKSA 4BBSH 1CSPA 3IKJA 3VR6A 2HD5B 5LMNL 4A90A 3TSSA 3BYTB 3E3XA 3HOYH 2PO4A 4HJ5A 5BN3A 1PH1A 2I5HA 3ML9A 2A69D 2BTEA 1J8CA 3N1XC 1HTLD 1Q1EA 3UIOB 1XTDA 1EWYC 1PGBA 4LNKA 4NQKE 4HPPA 3BVZA 2FCSA 5J39A 4CDDC 4FXGC 2N7EA 2WWZA 3DWPA 1B8AA 1YNNC 3QWZB 3OAWA 1PFBA 2NN6I 1GHJA 1HQMC 4GN5A 4F8MA 3S1RB 1NI2A 2WXRA 2R93B 3U30A 2PE6B 1YBYA 5ELDA 1JORA 4TSSA 1XO3A 4A9AA 2NYZD 3GTJH 2D0PA 1XYIA 3AE4B 2Z6KC 2N4FA 3WANA 1VDVA 3AEGB 1I35A 3Q14C 4HJAA 2Z8LA 1BBWA 1SYCA 4DUZQ 1HXYD 5C23A 4DV5Q 5DPSA 5AUKA 2XGTA 2BWES 2F0WA 1W6KA 2D3GA 2HD3A 1PLFA 1V97A 2EMTA 3M4QA 3WAOA 3A5ZB 1CT1D 4NPNA 1G6JA 4QL5A 5TR5A 1L6VA 4J8QA 5FO7B 3DVGY 3DBLB 1OXVA 1GO3E 4L5TA 2INNE 2L7RA 2F0GA 4A3MH 1NBWA 2OTLA 4WQOB 1EIYB 4ZYSA 4XDDA 1QUQB 5H92C 2EIFA 3ZGZA 1UAPA 4M1UB 2LI5A 3Q8BA 4IUPA 4K5WA 2QJLA 1TWFB 4C80A 5GADC 1SNOA 4HCSA 4IQZA 4TUUA 4AJYB 2KO3A 3W2DA 4OL7A 4IOAA 1TR5A 4HXDA 4OIKA 3IFDA 1PYWD 1YQ3B 1HCZA 4LF9L 2E74C 1B1ZA 2PLPA 4DR2L 5EE9A 2VUMH 1I50B 4NJ7A 4A76A 2DY7A 3K57A 1WJUA 2KDMA 1JWBD 1SJED 4NXML 3KLWA 2JF5A 5A2QL 4HJKA 3HZXA 4CO7A 1NY4A 4ASWC 2LGDA 3M4PA 3H9DA 3J81i 1JW9D 1WYGA 2MHVA 4C3JH 1FNUA 1Y1VB 2KLGA 2VB3X 4JI7L 4QB4A 2F0DA 1A3VA 3KOJA 4EQPA 1BCPF 3AU7A 4P6VF 1YVCA 1SROA 3DUZA 3KF6B 4QAYA 1T9HA 2A8VA 4QMGA 2BDOA 2NTSA 2DBYA 2JA8G 3TBLD 1RF2D 4LF6L 2JSVX 3K8AA 1PVOA 2NN6G 4A3JG 2JA5G 2XRQD 4JBMA 3CD6A 3SHLA 3V61A 1TXYA 3DQVA 4C3HB 4IZ8A 3NVZA 3MHSD 5C3EB 5M3MG 2MJ3A 4BY1H 1Y56A 4EQ5A 2GBJA 2LKVA 2INCC 4C7ZA 3DWMA 2LHDA 1FGUA 1ESFA 1SMYC 3BJUA 4LF7Q 2L0TA 3J9CA 4DWFA 3C2PA 4IM2A 1PFSA 1SNPA 4JI4Q 1C76A 3ABVB 2AWNA 2QEJC 3LWEA 1CZGA 2ASBA 2XVSA 3GV3A 1NJIC 4HJGE 2RQXA 4R8NA 2N3SA 3LDZE 2R92G 4WURA 3WWVA 4B3ML 2JA6G 4IO9A 1PH6A 1IGCA 2PE9A 3DBSA 4AQYL 2Q2TA 5A35A 4MSQB 1TZ1A 5KNDA 4NNJB 2KCTA 4TQ1A 1XMOL 5BYSA 2QSDA 3UE1A 1SNCA 3CCEA 1CA6A 2F0SA 3NTHA 3HOUH 3KLSX 4NJCA 2JA7H 4A93B 2FIDA 5AFWA 3K80C 1F9QA 1HTPA 1WOCA 2K6QA 3KWLA 1HJPA 3HOYB 3KH0A 3EQLC 2IX0A 4K81A 2QC8A 1RFAA 1PRTF 3K5LA 2MH7A 1QZHA 1UBQA 2B63G 1R4MB 3OW7A 1PTOD 4IPCA 3SD5A 3HRDD 3MWYW 2AEHA 1N34L 2P5ZX 3RZDH 2CHXA 3AM9A 2EOTA 2D5GA 4C3IG 5CMDA 1IHZA 4FXCA 1DOLA 4B3TQ 1QQRA 3GTJB 2Z0DB 4BZAA 3TEZA 4FVMA 4DN4M 3VYUA 1H9KA 1V6EA 2ATWA 4DAPA 5LL6S 3VR3A 1ZPSA 1EY9A 1FJGQ 1ACCA 2K0PA 3M63B 1Y8RC 5AEKB 1MSHA 3HKSA 3M3YH 4ARCA 2JP1A 4UP7A 1S5CD 3RNUA 1QT9A 1F0ZA 4YWKA 3T51B 4AYBG 4ZKCB 2OT2A 1EZ6A 1WTQA 2FHTA 3G4SA 2KDEB 3OLMD 1E7VA 2KEEA 4PV1C 1VQ7A 2VL6A 3P1HA 2VQFQ 3SFEB 3T8MA 3AE3B 1PYBA 3WAMA 4A3MB 4JK1C 2H4OA 3NUCA 3MC8A 3ML8A 3VR2A 4KI0A 1WH3A 2G4SA 2LVQA 2ACZB 1STHA 1N32L 3MHZA 4QIWB 1WY8A 1V5OA 3H91A 4DBGA 4YSXB 1TVXA 4P1CC 3HOZG 5G55A 4OW0A 2A68D 1YQ4B 4KHPL 2ZVNA 4C00A 3D4WA 2F0FA 2NPTA 4RMFA 2I07B 3AB9A 3URYA 4F7ZA 4PZ6A 3S17B 4A3KH 3FDTA 5GAEC 2VUMB 3GDEA 1VQOA 4B9XA 2ASQA 5CGKA 2PNRC 1N5WA 2VZKB 4JBKA 3KYDD 1R4NB 1QOAA 4WJ3M 4X3KA 2L0FA 3V05A 3I4OA 1BCPB 2WXIA 4TV3A 3CSFA 1HR0L 3PZ7A 4H02A 1JC7A 1KNAA 2F0VA 4C3JB 3UIPB 1E7UA 2F52A 1T0QC 1TKEA 3I4LA 1WTXA 3D31A 3NY5A 5EKIA 1J8IA 4WWPA 1L7YA 5IP4D 4XT3B 2IPKD 3NSWA 3JAME 3A7LA 1FIQA 1WMHA 4HKZE 3E9SA 4LCDE 3PO3H 3J7ZC 3P42A 2B2TA 3Q6SA 1WIAA 4LFBL 4OZAA 3N9YC 4GOPB 1N33Q 4W9CA 2XRSD 1WRIA 2BYEA 3WCQA 4KK7A 1ZDVA 3GZNI 3PLVA 3VQIA 3VVWB 1WTOA 2M9VA 3MEFA 1VS0A 4BY1B 1I5FA 3P20A 1U4AA 1XLNA 2BF8B 4HVBA 1F9JA 5IE8A 4BXXH 2CWAA 3RYTA 2YTYA 4WJNA 3NXWA 2L1AA 5CHVC 1WX9A 5E4WC 2UXDL 1RDPD 4ZQ3A 5EJWA 1D5XC 4K7UA 2BYTA 3CCJA 1S1QB 4MGIE 1WTWA 2ICIA 3NUHB 5IYBH 4A3DH 1TWHH 2KWUB 3J80c 1KLVA 3M95A 1FXIA 1LM8B 2R3ZA 1QNKA 1B50A 1ONLA 2O6VA 1CA5A 4YY3L 3AEDB 2RDBC 5CV6A 4A3BH 1XCQL 1LO5D 2MBEA 3AECB 1X54A 3HOWH 3IAM1 3HOUB 4A3GG 2CH4A 2KVZA 1I94L 2JA7B 3MXGA 1PRTB 1L2NA 4DV4L 4FLHA 4WJ4A 3DBHI 1BCPC 4BAXA 2N0SB 4RMAA 5ELOA 4RM8A 3VH4B 4W9LA 2EDGA 3S2HH 2EZVA 2IY5B 2WQYB 2WAQB 4PS7A 4FHKA 3SU8X 2D2CC 2MFIA 2RSNA 3NS8A 1UE1A 1MKHA 2OXPA 2RD0A 3Q69A 4DAVA 1Y8PB 3KF8A 1O80A 1JB7A 4R4QA 3RZDB 1EFWA 2JY6A 2CKZB 4RAUC 4S3SA 1IBXA 3AE7B 5IKCM 3BWUD 4HIDA 2CCZA 2LJ5A 3ZTCA 4GOPC 3PIPA 2A4ZA 4B3RL 1GB4A 3NBHA 5C4XH 2BS2B 4ZDVA 3ZLZA 2QKIC 4TVAB 4QF4A 4EKUA 4NAWA 2LGSA 1WD1A 3K0YA 1CTMA 4DDID 1S5BD 2B76B 2EELA 4GB9A 3M3YB 2DHZA 3K0XA 3JAML 4QQBX 1E6EB 1N60A 2E2DC 3ZYYX 3J7AV 3OJ3A 2MWSB 4WAFA 3I4NG 4FNFA 4KN7C 2RPQA 2VRRB 1FD6A 1GUAB 1G51A 2BB6A 4YXDB 1B7YB 4FF2A 2XWJB 4XYOA 2BH8A 1FR3A 3SEBA 3AI5A 4JI2L 3P4SB 1WXSA 1FFUA 4DV7L 1WXQA 4IURA 2IO2B 1WTPA 4A3PA 5J3BA 3WOFA 1Q7YC 2QDBA 2PVGC 2DLBA 4HIKA 3NP8A 4IFDH 3GD7A 1A5RA 4UY8C 4OO1I 1YN4A 1S5FD 1PRTC 2MHJA 3OYYA 1JWAD 2DNFA 2CW0D 1WR6E 1GUOA 4KJNA 2UU7A 2F0PA 2FIFA 2L11A 4A3KB 2JU6X 1A2UA 4GZYC 1K0SA 1P1AA 4XDCA 3EBEA 5D3DA 4JWSC 4DA2A 1RM6C 1F2MA 3HM6X 2NBWB 2ZXOA 4YT0B 4DU9A 1GNUA 4LF8L 2NB0A 3TBIB 4DNRB 2JJQA 4LF9Q 2KLCA 4GDKA 2N8NA 4ZUJA 1CHPD 3UE0A 1BT0A 4B0MA 3RLOA 1LM0A 4DR2Q 3T3NA 1VQ4A 3TN2A 2JX5A 2LXCA 5IOIA 5COYA 2F4VL 4FF4A 2E3TA 1C9FA 3T4AC 3S1NH 2DZJA 1IBML 3KUZA 4L1BA 3A4RA 5D3IB 3UDFA 4LJOB 5CBAE 1EU3A 1OQYA 1TGZB 3CCUA 3R7QA 5CHFA 2ENBA 2K32A 4I7ZC 4NDXA 3SR1A 4JI7Q 2IBIB 5EGTA 3UDXA 3R8BA 1GG3A 4L5QA 2H88B 2LGIA 1KDCA 2VS1A 4R4TA 4LNQA 4WJWA 1DJRD 4LNNA 2LRUA 4AQ7A 4PS3A 3ER0A 4P2CB 1LUZA 4LF6Q 5I4DA 2BS3B 1JQ4A 1IBXB 3VYRA 4A8XC 1K9MC 2B2VA 1N36Q 4KY5A 1X9NA 1VLBA 2YV5A 2SNSA 1JR0D 2W82A 5J18A 4A3LG 5C0XJ 1J7AA 2KVRA 4A3DB 3NBHB 4RG1A 3AE6B 2X38A 3NS1A 1TWHB 2E2HB 3K6OA 5E3FA 5HURA 5I2YA 1PV4A 2I1KA 3QIAA 2F0UA 4UP8A 3CPWA 4NAWB 3ZXRA 1MHXA 4L5RC 1X65A 1NYRA 2RDFA 3PO2G 1Z5SB 3QK0A 4GSWA 3X23A 4DV1L 4BBNF 4BKSD 3PMFA 1YHQA 5GAHC 2E6XA 5I6WA 2D3AA 5ELNA 1NUCA 3H1UA 4PMCA 2QHOA 1F9RA 4A3BB 4MTNA 1ZW7A 4G4KA 2QIEB 3HOWB 1RTOA 2JA8H 5C6AA 1L4ZB 5JJZA 3CP0A 1Q82C 1VZ8A 3E0EA 4EZLA 5IN7A 5BYQA 4B3MQ 4EGVA 2JA5H 2XNAC 2N78A 3EROA 2ZVOA 3KBGA 1H9SA 5JEAH 4O0AA 1FFVA 1RAXA 2ZCCA 1BMLC 1XMOQ 1QJOA 5EAYA 3VA7A 2FAZA 1SYBA 2CQAA 3B2GA 2A74C 2PPBC 2BBCA 2KYWA 5M3MH 2EKIA 4YCUA 2IYDB 1KM7A 3ND9A 1UE5A 4NPSA 3SR6A 2IY0B 3S9WA 4KY7A 4C2MH 4DAMA 3MXNA 2BKRB 1P16A 2JUOA 1MJCA 3EFCA 3RN5A 3CPFA 3PF5A 1EYCA 4ODGA 2KTRB 2FBWB 2GI9A 1E7ZA 2R2QA 3H7SA 4IWQA 3ZO5B 4RH6A 2R92H 1QCBD 2RSUA 3NRZA 2Q5WD 1GJZA 5C4XB 5IP7H 2J53A 3JSVA 4CDCC 3QOLA 2QILA 1V9JA 1FXAA 3GB1A 2V3PA 1OXTA 5G3LF 4NMZA 3SVMA 2VH2A 4RGNA 2EE1A 1KLGD 1NE3A 5I2XA 1SAPA 2F3VA 3STBC 4DK1A 4AS1A 1LABA 1YX5B 3ZRCA 2B3AA 2N49A 5JPNC 2K6DB 2BQQA 2Y0SG 4IUVA 1N5XA 2L32A 1G2SA 3K59A 2CS4A 2W3RA 3CCVA 4CYEA 1VMPA 5CV5A 1HUMA 1KHIA 1RLFA 3TP6A 4DFAA 3ICEA 4A4IA 2B63H 3HOVG 2NVYH 4A3IG 1XCTL 4DV0L 4C7YA 3DOWA 2Z6KA 2WXHA 1VQ9A 3NVVA 2M2LA 4HCNB 3J7YW 1HNXL 4RA8A 1VQBA 2F0OA 2NBVB 4C3IH 4M00A 5G5GA 1XPUA 2FINB 5HY6A 2Z4HA 3VYTA 4EQOA 1V8CA 3AE5B 3IG3A 1HH2P 1QVCA 4O1NA 3GTPH 1WM2A 4YWGG 2LEKA 4ANUA 2KQSA 2RDHA 4MM3A 3BZCA 3JW0X 4ZRKA 1ASYA 1T6BX 1N32Q 3CMEA 2EVBA 2HIXA 2NBFA 3H3VH 1E8ZA 1JB3A 5CYUA 4HIMA 2HE7A 5HGQA 3HK0A 2JSOA 2Y5PA 4IUUA 4NAMA 4X3UA 3RR5A 4GKJL 3A8JE 1WRDB 1IL8A 4JC0A 5E6PA 1J0GA 2MLBA 5E6NA 1K73C 1T5EA 3GTGH 4KHPQ 2M8SA 1NTGA 4ANXA 4P72A 4IM3A 2QCZA 3W9CB 2PQEA 3JAMi 2GA4B 2JQOA 4URKA 4APVA 1UE6A 4R4OA 1JJCB 2ZJRA 3L2PA 5KRUA 1K0RA 4V0BA 1KRHA 3S1NB 3DVGX 3QA8A 3PRPB 3J7AF 4NY0A 1G291 4QCLA 1UZXB 1K3BC 1H9SB 4KKUA 5IYCG 1B2TA 5G5HA 2WDTB 3EUB2 2KJHB 1SGHA 2G5DA 4LK1C 3AMZA 3R66C 1TYGB 2KEDA 1I4XA 4PK1A 1EWIA 3CQZH 2Y0SE 4HAEA 3GP7A 2JPHA 4MACA 3VFKA 4EZJA 5IGEA 3F2CA 1P7EA 5E6OA 1H4RA 4M8AA 1TKGA 4KV6A 3CCRA 1DM0B 1C79A 1NDDA 3BY4B 3GTMH 3BINA 2DENB 3GE3C 1UEBA 1Z7TA 4RKLA 4GKKL 4LFBQ 3FC4A 1RTNA 3HKZE 3CC7A 3A74A 3CAMA 2AYOB 4ILWA 3IL8A 2SAKA 3JSVB 1FYCA 4GDLA 1NMFA 3MVVA 1U9RA 4X3SA 1RHPA 3DDCB 1NBFC 1BOSA 2WGSA 1S3SG 4IPHA 1O7YA 2JE6I 2N9KA 4LDTB 4B9KA 3FKYA 1SE9A 2G4DB 4J6HA 2WXJA 2PZUA 3AE1B 4X66Q 3NEMA 2LVOA 5C5LA 4GOCA 1E3PA 2JA5B 2AWTA 2JXXA 1ZGUB 2GMIC 2OF1A 2RHSB 1IGDA 4GIVA 3AEAB 2VQEL 3S1MH 4HJ7A 1VQNA 2DYOA 1F2LA 1KRTA 2CH4W 3NBIA 1PGAA 1VZ7A 1YJWA 3TMPB 1WGKA 5M3MB 3ZIMA 4LF4L 5C3WA 4XTCS 1ZEQX 3QIJA 2NZHA 4K6DA 1I4PA 1FGBD 2AMCB 4JI0L 4C2MB 3OW2A 5LLIA 1E7PB 1V81A 2BCOA 1K53A 3B0AA 3DBRB 1LT5D 3O65B 2FNJB 3J80L 1X3GA 3DM1A 1QOGA 1LGRA 3G6EA 4OXPA 1WCMH 1C77A 2WXPA 1CI3M 5FR3A 1EQTA 2K05A 1M1KC 4HDOA 5M3FB 2JA9A 4YHHL 1AP0A 1WGRA 3QX1A 5JJKA 4X65L 1BR9A 1EFID 3FPPA 5I9OA 2EJGC 3V60A 4DAYB 4A3GH 4WJPA 3DWQA 2XTIA 5IP9G 1DZ1A 1JWSD 1PFMA 3FPUB 4K6LA 2DZMA 4PYUA 3SK6A 3KUDB 2BPSA 3KF6A 3MC0B 3UI3A 1SNDA 5FJ8G 2I1JA 2INDC 1VQHA 3TP8A 2Y3AA 2F0MA 4GLSC 4FULA 2B63B 1O7ZA 1PH9A 3RNFC 1PYSB 3ZXVA 2NVYB 2ZM6L 1DOIA 1Q90A 3VTVA 2A19A 2A6HC 2C7MB 3QARA 2UXBQ 4C3IB 1KH0A 4XYCA 5FR6A 4LFCL 1KRSA 2EXDA 2NWGA 3ULJA 2HCIA 3VYSA 1PH7A 2OHFA 3GTPB 5FKAC 4POGA 1VCIA 1VQGA 4JI2Q 1EO6A 3L16A 1SEBD 4BVUC 2K03A 4DV7Q 1T0YA 2PW9A 5C0XG 3V62A 4NB3A 2M4NA 3MA2B 2K22A 2K52A 3L7ZC 5IT9c 4B3SL 2YU9H 2PNHA 4TMAB 4GDLB 3S15H 3PLUA 3OWEB 3T56B 1IBKQ 3APFA 5I6YA 3JYUA 3HEJA 4LUOA 4J6IA 5F2DA 4BOZB 3HOXH 3PQIA 3JVZX 4BA1I 5D65A 3GTGB 2KOLA 1OTRB 1YJJA 2EYOA 1Y69U 3A1QB 3AFQA 4RHSA 4K7WA 3I4NH 4KKSA 1QB5D 4LFAL 4FF1A 5EKKA 2R7ZH 4W9FA 2HIVA 1PZID 1STYA 3KJOA 1HQRD 2MQHA 1GUTA 3IFTA 3Q3JA 2M00A 4CDEC 3E9IA 1O7IA 2K50A 3D8GA 2ZJPA 1J5EL 1JRUA 2J0MA 1JOKA 1VQJA 3WAPA 4DXFA 2RPVA 5KNCA 1H9MA 5D6JB 1Y8OB 2DAFA 1H9RA 5JVH3 2WS3B 5DPTA 3CQZB 2RGFA 3H0GG 2LS01 1EY5A 3Q6BA 1HZCA 1H9JA 4CBVA 4W9HA 2F4VQ 3AEFB 3ZDMC 3K58A 1B4OA 2VB2X 2PJHA 4EOYA 4ZUIA 3GTMB 1I3QB 5LNK1 4JI1L 2HCCA 3PZ8A 2ALYB 5IIFA 2KN4A 2O6VD 2MP2A 4OVUA 5T8IA 1ICFB 2HDEA 3LX0A 3Q8AA 1SIFA 1HUNA 4MTKA 1W6JA 2NMQA 2GBMA 2B2YC 2KD0A 2KXJA 4IDIA 4LNFA 1YX6B 2PTLA 3UQAA 4MHEA 3V96A 1X3PA 1D7QA 5LHY1 3NHHA 1KFYB 4IOCA 1A0IA 3D4DA 3TMEA 4K5XA 3H3VC 3L10B 5IGDA 4LWCA 1VQKA 3DXJC 4W9JA 1MI2A 2K3UA 2K4KA 3ITPA 1AFPA 4OIJA 5AUIA 1PZJD 1VQCA 4A6QA 4LJZC 3CCLA 3PHWB 3C1FA 1A15A 2ZXRA 4DV1Q 3S1MB 3L0WB 4E71A 2JT4B 2BOSA 1SIJA 1ENFA 1NEKB 3PPAA 3O13A 1R9TH 2IO3B 4MIUA 4GN4B 3MJ5A 1M94A 3H09A 1GUWA 2KHIA 3EA6A 2HDLA 4F88A 3QHTA 2F0TA 4RHRA 4XWTA 3R2TA 5C44G 3RN2A 1G6PA 5KYLA 1A8VA 5KYIA 3T1YL 4KX6B 2Z6BA 4M01A 5LL6X 4A3LH 3HG9A 2WIIB 4YIJA 5C4ZA 1XMQL 2GBKA 4FF3A 1JRPA 2CR5A 1WCMB 3M7NA 4DR6L 1F9PA 3NJTA 3CXCA 1B9NA 1TY0A 1XF5L 2L76A 3PO2H 2MJDA 3PRMB 1EIFA 5CV9A 4KLKA 3PGZA 3ULLA 3N1ZC 2EY6A 2KECA 2WFWA 1R7SA 1SE2A 1V1PA 4Z9CB 5IWAL 1K8MA 2E2IB 4PS8A 1WJNA 4P16A 3EJIA 4I7AA 1ET6A 5BR8L 4A3GB 3DBLI 3NZSA 2AQ2B 2Q2UA 2KC2A 5D94A 1OQRA 4CDFC 2KZRA 2ZTEA 2N9EB 2LY7A 4BBSB 2Z0EB 2Z0SA 3VRBB 3NG0A 4P7IA 4RGTA 5ELEA 2I0QA 4IN3A 2V0GA 1SE8A 4I65A 1YJIA 4GOPA 5C3JB 3K7UC 4MGKE 2NVQH 1T0SC 1FM0D 4F87A 2N1WA 2HHHL 3Q3MC 1VQMA 2L4NA 1OO9B 1IXRA 2OWOA 4K2KA 1XJVA 2L12A 4B6WA 2IX1A 2X6GA 4HIOA 4DR7L 3E0JA 2MP2B 3TP7A 1FNVA 1K50A 3M4YA 1Y1WG 4EE2A 1EWCA 4DV0Q 3WDNA 4HSVA 2KOXA 2YU9B 1V2YA 1VF5C 4R9WA 1YNJC 4FXKC 3S15B 2XBBC 1HNXQ 3AFPA 4R4CA 1NVID 2OJWA 3SGIA 4A3EG 3IRBA 3HOXB 3VUYA 1XX8A 1MJDA 1EL0A 2BH2A 4ICVA 3ZRFA 3L3OC 3Q22A 3I4NB 1P9DU 4WJOA 1JCKB 1WXVA 2R7ZB 4XQJA 2AQ3B 1YZ6A 2IO1B 1QILA 4R4IA 3I55A 5GAGC 1ET9A 1TT2A 4HJ8A 1ZDXA 2IW3A 3SK4A 5G2NA 1PXUA 3A7AB 4GKJQ 4WWNA 1ICWA 4XE0A 3HOVH 4P74A 2H89B 1QF6A 4A3IH 2JZ3B 1TS4A 2K8CA 3T1HL 2YEPF 4E6IA 3Q8FA 1X3FA 4H7BA 1KJTA 5FLXc 3J7A5 2E8GA 3AMUA 2GBNA 3AV8A 2GVBA 2FUHB 1BXTA 2N9PC 1HA6A 2A5UA 3OG5A 3CW2C 1RL2A 3AB5A 3J81c 4KGTA 2KQ3A 2JWUA 5CORA 1M90C 4A3CG 3P4QB 2DZIA 4XC2A 1FRRA 2ZPYA 3NZ3A 3A54A 1IUEA 4NP5A 3OHXC 5CV8A 1F52A 5IY0A 2MO1A 2WHIA 3C3LA 4R3DA 4WIPA 1VQ5A 1HRJA 1EY8A 2MGSA 1V49A 5M9OA 4W9DA 1SDFA 1MGSA 1VQDA 1V1PB 2N7JA 1R4PB 4E3CA 5JZEB 4GKKQ 4JQWC 5GXGB 4QUCA 3GTKH 1QVGA 4BBRG 1WF9A 3ZKJC 4C4VB 2PKOA 3BVMA 2MP1A 3RNBC 3RD2A 1AW7A 1HHVA 3PF4A 1YHBA 1FD7D 1OXXK 5IYCH 1WTHA 1UWVA 2K6AA 2EYLA 2WXGA 1IW7C 3N52A 1JJGA 1TWGH 2A1AA 1R4MI 2L3ZA 2PW5A 1EIHA 2LGXA 1TTNA 1IZ6A 4AYBE 4LNOA 3IBEA 2EYHA 3QAQA 2V1CC 1RIPA 1CZWA 2KFKB 2WXNA 3OJ4B 3MTSA 2K75A 4REZA 4N6EB 4DR5L 1E22A 1DXMA 1SYFA 1XPOA 5LXIB 4MN3A 4J3OD 2XEWA 3HUIA 4ZHPA 3CSTA 2KWVB 3TL5A 1Y1VG 2E75C 2VQEQ 5JHAA 3SFDB 1GC7A 4JPBW 4X62Q 2HDMA 3Q8DA 5L37A 1STBA 4RM9A 1K3RA 4JLCA 1PH5A 1GUGA 4LF4Q 3DVNU 2C9WB 4JI0Q 3B1LX 1CHQD 1A63A 5D2MB 1YNND 2F1MA 2SDFA 3OIQA 2JQRB 2I5LX 5D14A 1F77A 2XSCA 1ENAA 1JWMD 4C3HG 1K8OA 3C0RB 2O2VB 1TJEA 2DYMA 2CHZA 2ZJDA 4DR1L 2SEBD 3K5NA 4YHHQ 3KUPA 4JI8L 3RUIB 1HA5A 2M0AA 4X65Q 3M7GA 3P1MA 1GXDC 2F0JA 4JI6L 5E6JA 4BWGB 2NVQB 2ZEQA 3DVNV 4ZCKA 5JJLA 3V3XA 3EGRA 1FL0A 1SSNA 3FKIG 4FP5D 4X57B 3GS2A 2JVCA 1X32A 3PIO3 4F1SA 1NR4A 2BE5C 3DEOA 4IUMB 1FO4A 1C0AA 5LMNQ 2IY1B 1WE7A 4K0KL 2M0XA 1R4NI 3NE5B 2KJRA 2F0LA 4HTHA 2Z9HA 3RZFA 1U0LA 2DY8A 1QZGA 2UU9L 4DV2L 1V8QA 2QF7A 4WRDA 2JXTA 3AEEB 4A93G 1K8RB 1E0ZA 2CFMA 3T3OA 1TKWB 1AE3A 4H13C 4ME5A 3G71A 4LFCQ 1JQYD 2LMCA 1C78A 1ZE3D 1S5DD 4PNYA 3IT6B 2UXCL 4CQNA 1GPXA 5IP9H 2Y0SB 2D07B 5LMUL 2ZJQA 5C5MA 1U4MA 1FPYA 2K5NA 2YEPB 2A6EC 2I46A 5EPKA 2FJ2A 3KK7A 3IT4B 3NOBA 2CQOA 2LSSA 2KNBA 5IGBA 4PG3A 4A3IB 1PTOH 3EFUA 4HRSA 3PSEB 3HKZB 4MEMA 2G9DA 4N58A 1EYAA 4DGZA 2L5TA 1O78A 4HMIA 1PTOF 4WWMA 2OQ0A 4LFAQ 3Q8EA 3Q23A 1PGXA 4KKTA 3V6EB 3U9OA 2BB5A 2FCMA 5L83A 4HLEA 1I6HH 3NTIA 2IJ0A 2BYVE 1QE6A 3R3OA 2L15A 2DX5B 2MBBB 2PYKA 2PCFB 5IT9L 5C0XH 4HWIB 3ZQ4A 3PT2B 2WP9B 1EOTA 1OEYJ 3IAYA 2KTRA 4DKAC 1C9OA 2F0NA 4R8IA 1XLQA 1T0RC 5ELFA 3S24A 2M1MA 4NXNL 3L17A 2C5CA 1WFQA 1ZYRC 5BN5A 3FILB 4ICUA 4KGRA 3M9BA 1GVPA 2K33A 1YITA 3PS6A 3HVDA 2KWDA 4ZRZA 2UWQA 4HEDA 4JI1Q 3U4VA 3AE8B 5HG2A 3MHBA 4JOIC 3QJZA 4LTUA 1SMYD 5E4XA 1F2ZA 3FP9A 1EF5A 5K36G 1HFNA 4ZK9B 5C3XA 4X6AH 5HKHA 1II3A 4EX5A 4US8A 2H5XA 4NXMQ 3EHVA 2B3GA 1CKMA 2LGYA 3TEHB 5JPMC 3ERQA 1TWGB 1IKMA 5EE0A 1MPEA 3PO3B 1TS3A 1MG8A 1X3EA 1E8XA 4XXEA 3GV6A 1A62A 1VDZA 4OONA 4P75A 4QUFA 1ILPA 5C2TB 2WP8J 5T1GA 2O4XA 3GOEA 1OTCA 4PMWA 2EXZA 4DUYL 2MBOA 1SYGA 4G3XB 2XK5A 3K9OB 2DAJA 4M8MA 4TQ0A 3A9JB 2PQAB 3DHQA 1ASZA 4G7ZC 3EC8A 2MCNB 4HCPB 1NAPA 1STGA 4K3CA 3N6RA 4C3JG 2WB1G 3RZWC 2AQ1B 3X0WA 3NWSA 4OELB 3W5OA 2EMSA 2K28A 4A55A 2CJNA 2KKCA 5C4HA 4AH6A 2PEAA 2J0JA 2DGYA 2MEKA 4W9GA 1A2TA 1L0WA 3TQYA 3CIRB 1D5ZC 1AARA 1E8WA 2LMCB 2EYFA 3ZNID 3ZJVA 3RUZA 4IM0A 1EF1A 1SNMA 3E56A 2IX3A 5E1FA 3BZKA 3CRKC 5IA7A 4NJ6A 1BVSA 1XMQQ 4DV3L 2MNAA 4JV5L 4BY1G 3KVFB 5H1SE 2NN6H 1YHAA 3VR5A 4BY7G 4A3JH 5I9PA 1P0RA 2MJEA 2WNMA 2AHOB 4OO1G 1JJ2A 1S72A 4DR3L 4AQYQ 5IWAQ 3BS1A 4B08A 1MI0A 3C8YA 2JEBI 3S2HB 1C3TA 3E9HA 1AH9A 5BR8Q 2DUDA 1UWMA 3NHEB 3PUZA 3CU7A 1LTTD 1L5PA 2FUG1 1C1YB 5C44H 5BO4B 4IW0A 1Q1BA 3B9JA 2K9XA 3RULA 3J81j 1M4VA 3I8ZA 1S3OA 4JW0A 2AKWB 4OZCA 2LD9A 4K5VA 2MBQA 3C46A 3AU5A 2JRIB 4J1MA 5DAUA 2RVLA 3PCOB 2JA6H 3N30A 2HHHQ 2F4IA 2JA7G 4GNXB 1E10A 3RN9C 2R7FA 1QVFA 1NYQA 1N34Q 4JI4L 1DOMA 4OEMB 3VDYA 3R3MA 3UDIA 3K9PB 1XLPA 2WB1E 3QC8B 4USAA 2QW7A 2TMPA 3M4OH 4DR7Q 1HTQA 5HFYA 4P73A 1F9SA 3F2DA 3I4MG 1DGJA 1Z2MA 2N9LA 4DQOC 2MUYA 2OCEA 4CHTB 1OFFA 1P98A 1EIGA 3K81C 4KJOA 5AZGA 1EEFD 1PTOB 2VW9A 1S4ZA 4MSMB 3PGEA 4UPAA 1J19A 3HGBA 1LTSD 2ZW0A 3BIID 3QOJA 1Q3LA 4YCVA 1Q12A 3NENA 4US9A 5KIXA 3DWAA 2FMCA 3PUXA 2W55A 2GBRA 2UUCL 3C1EA 1DGSA 3RD4A 1TZOA 2CU3A 4F7XA 2D3CA 2XK5B 1I4HA 3E5SA 4IC7B 1H95A 1Y8NB 2FFKB 3ZUNA 4NW2A 5FOBB 4NZLB 1Y1WH 3A56A 1L4DB 4K3BA 1D1IA 5TSSA 5IYDG 3T1HQ 4M8NA 3SK5A 4A20A 2K5HA 1ZKOA 2F3WA 1RCVD 3HFZB 3KQ4A 2KN5A 2MX2A 1UUPA 4AIMA 3A8KE 4A3EH 3I72A 3LNNA 1RYJA 4B3TL 1XD3B 2MBHA 1XPRA 1IBLL 5KNBA 1WYWB 3DCGA 4K8JA 2EYJA 2KENA 1CKOA 3LWUA 3LXFA 3LYYA 3G7LA 1LTID 2XIWA 1GUSA 2B39A 3J80E 3BU2A 1HE8A 1C4CA 1UELA 3LB8C 4H2AA 4MT5A 3BK1A 4DAYA 3F8TA 1YOVB 4CKCA 3MP9A 4LUZA 4GNXC 4DHZE 4LF5L 1EY7A 1Q81C 1CM9A 2N55A 4EUTA 4PZ7A 2CKHB 2QEXA 3APCA 4A3KG 1HR0Q 2VH1A 1C4QA 5LMNW 3L08A 3U7ZA 2PPHA 2SOBA 2KC1A 1WZ0A 1CSQA 1UGJA 3PUYA 3J81L 4BFRA 3RZOH 3HOZH 2PVOD 1PH3A 1MHWC 3T16A 2B2YA 1RWSA 5ISRA 3AXCA 2KJ6A 3RMHA 1E24A 1N63A 1E2VA 2RHQB 2VZKD 2RKSA 3I2ZA 3QR8A 1RKNA 1PTOC 4A3CH 1XQQA 3U4ZA 1LACA 1HPCA 3ULPA 3VTWA 2NS5A 1SE4A 4C56C 1CJEA 4I6LB 3ZNZB 1BCPD 2I5MX 1X56A 1R4QB 4XDXA 5EKLA 1PH8A 1F2RC 4N9TA 5AJ3L 3VDZA 3I70A 3OTOL 4CKEA 4L2YA 2WKCA 3GE8C 2OQKA 1FCCC 1K8GA 3A33B 1B70B 1K8AC 1LTRD 1XTCD 2KMAA 2RMMA 3KDFB 5CV4A 1V80A 1WGDA 2K1FA 5EE1A 4FXDA 1DYQA 4HROA 3M85A 4JYAL 2B8FA 3BDLA 2YLMA 3A1QA 1CMXB 3Q3OC 4BBRH 5T1IA 3Q3NC 4HPLB 3TREA 2RBMA 3MZ5A 1PH2A 2UXDQ 4KIKB 3CHBD 3F2BA 5FK9C 1ENCA 4NQLB 4W9IA 2WXLA 2JA8B 1EY4A 1D2BA 3AH7A 1FCLA 3ZW3A 2C60A 1P3QU 5CTRC 4TQUS 3DMUA 4A3JB 1WSPA 1CFMA 1C4AA 2RDGA 4RCOA 2G9HD 3ZVVA 1I50H 2KDFB 2SNMA 3KFUA 1AE2A 3B08A 1PFNA 1SJHD 4IFDI 1SRUA 1X1MA 4I6NB 2EYMA 4YY3Q 1VQFA 2C7NB 3I3TB 5C4JH 1C7YA 3ZDTA 2LFIA 1WFYA 5FLMG 1CQFA 4IJHA 5C44B 3N20C 3VR8B 4GXBA 1YMHE 1SBBB 1T5XD 4LW1A 1I94Q 5NUCA 1XLOA 4DR1Q 2KDIA 1PUTA 1EYGA 4DV4Q 1SF0A 3KYHC 2J42A 3HIZA 1ZXTA 1JOQA 3M3JA 3RLFA 4JI8Q 2GOWA 5AZFA 4A3BG 5EPLA 1WYDA 3OWFA 2HTHA 1E2ZA 5E7NA 2YYZA 2R92B 4ZRIA 2JA6B 1WX8A 4HK2A 3RMKC 5GMVA 2W54A 1HZ6A 3SDZA 5LXHA 3P63A 1U5KA 4P71A 2PI2E 1PRTD 3H15A 3M4OB 1YN3A 2K25A 1S40A 1PZKD 1TS5A 1VMCA 4K8IA 1JMCA 2GLSA 1K83H 3PUVA 3W3AA 1EQVA 4B3RQ 4II3B 1VR9A 1LYLA 5ELBA 1XEEA 2AX5A 4BBNC 4DV2Q 2RCFA 3S2DH 1ZYRD 4FDBA 1VQPA 2BVCA 1L6UA 2QCPX 4JI5L 3QB3A 1STEA 2UXCQ 1MVKA 1UGMA 4G11A 4IUQA 5LMUQ 3IFWB 4M0WB 3FKIH 4ZYNA 3L13A 2WYQA 1VD2A 1QOBA 2QGQA 2NCNA 3BDCA 1IYJB 1YEZA 1Y1WB 2KQ7A 3DHHC 4B0EA 5J2RA 3IHPC 3JAMc 4S17A 4Y7NH 3T13A 2ICEC 1WXAA 2N9XA 2KANA 4KDLB 2WXMA 2C9OA 4A93H 2J0KA 1STAA 4A3EB 4DNIA 2EY1A 4U673 2C35B 1BKBA 4G57A 2ID0A 3A9KA 3B6YA 2WU5B 1UWXA 2AWOA 4ID6A 4AYBB 3K5MA 4N9F4 1NSNS 3TS0A 2BT6A 1JALA 4C1NK 1VJKA 3SE0A 1CZPA 3GTQH 5HI1A 1WXMA 3TIXA 4AOFA 4FA6A 2A5HA 4KKIA 1I4QA 4IFDG 1GOZA 1KAAA 2B29A 4NXNQ 3MXPA 1SFOH 3H6NA 4L5SA 2GVAA 3U9SA 1OGWA 2ZXPA 3AE9B 3CF5A 2NR2A 2B2WC 1KOTA 1KNEA 3NWTA 3TCAA 1ISNA 3F2UA 3BG3A 1TU2B 2L55A 4DNTB 3U4EG 2NTTA 1VCBA 4LF8Q 1D6EC 1GD7A 2R7DA 2WACA 3CCQA 1RFKA 2JEAI 1MHHE 5GQOA 5DPWA 4N8X1 3Q8CA 1X3QA 3RNCC 2AUJD 3RZOB 3HOZB 3VHTC 4AJWA 5D7GA 1IBMQ 3DBRI 1GKHA 1JE5A 1YNXA 1JWUD 3ERSX 2EKEC 4QJFA 3WALA 4L8JA 4FHJA 5K5PA 5M5WH 4WQMA 2Z59B 4CJ0B 1VQLA 1QNUA 2DJGC 2JK8A 2YTXA 2B2UC 3TDQA 4HCEA 3PZDA 1CQVA 1WVLA 4DK5A 4DUYQ 1WJ6A 1KABA 1QLBB 3TZDA 2DWQA 2RA4A 1K52A 2Y5CA 3VTUA 2IWHA 1Z6HA 2EY2A 5L95C 1MG4A 2WDQB 4XGAB 2KJXA 1QG7A 1E5WA 1G8ZD 4BBRB 5K36H 1IPGA 3PVLA 1X6OA 5KEEA 1AZQA 2K01A 5EQ0A 1UH6A 1Q8KA 5DEHA 2J0TD 4PMBA 1V5TA 2BS4B 3N3KB 4ITKA 2KMCA 3ZJTA 1VQAA 4HJ9A 4A3FG 2L9HA 4DXGA 4UAIA 1SYEA 2KTFA 2G1EA 3PREA 1FXTB 2H1EA 1HNZL 3ZJUA 1LXDA 4E74A 3S17H 2CU1A 2PW7A 5J17A 2LJIA 3X3NA 2KHWB 1K28A 2JZZA 1E1OA 4ZOHC 4DDGD 1WE6A 4FJVB 1HNWL 4F8CB 3STBD 1CKNA 3QQ8B 1AWDA 4DV3Q 5C4JB 4JV5Q 3GTLH 2FCQA 4OWWB 3DPDA 4HDQA 2IHEA 2OEOA 4IJLA 4HKQA 1NENB 3C19A 4OWXB 3ZNGC 2KVMA 4JBJA 5DPRA 1KL9A 4WAAA 3H3VI 4DR3Q 2EYPA 2KX0A 2INPE 1LTGD 2F03A 4JIOU 1FMAD 4U68A 4OZBA 3DEPA 2CW0C 2Q8RE 1WJJA 1ROEA 1N36L 3R93A 2ZPNA 1TWCH 1LT4D 2LXJA 3EIVA 3A9KB 3VXWA 3I90A 1SSOA 5JEAG 3CC4A 2K5DA 2W3SA 3AYHB 2AL6A 3PIP3 5JH5C 2LUEA 1GHKA 1HR0W 1K83B 1QZEA 1SLJA 1Z47A 4C4VA 4BY7H 1D1KA 4KHVA 3NQTA 2PZTA 3VA5A 2K14A 1PH4A 3S2DB 4WJQA 4OO1H 1J7CA 2L1BA 2WX1A 1EQQA 4JCVE 2BKFA 4ZRQA 1TIFA 3A0JA 1UE7A 3FKIB 2WV6D 3H6MA 1ZXHA 2F0KA 1PQSA 2MA9B 5CX3A 2Z1CA 5DNFA 1NNXA 4KN4C 5IP7G 1U4RA 1YI2A 2UUAL 2KFKA 3B2FA 3VH3B 4FADA 3NTKA 5EE3A 2B8GA 5M3FG 5GROA 2OOBB 4BKGA 1HEZE 3L54A 2X69A 1E90A 3W5VB 2VXWA 3L9AX 4LUVA 4FJZA 1TY2A 1EZ8A 3L0OA 4Y7NB 4LK0M 1SNQA 1YIJA 1IKLA 4ZRJA 2KDBA 2HT1A 3J80i 2BYFA 4OVZA 2DJFC 2EJMA 2UUCQ 2O2LD 5IAAC 2KK8A 4RF1A 1QOHA 1B3QA 1V1OA 2RCNA 3PRZA 3RNAC 4KMUC 2MRPA 2K39A 2C5LC 2K8HA 3I4MH 5M5XH 2F3IA 2NPTB 2JN4A 1MIUA 4K14A 3G6JB 3GTQB 1MBYA 5EPJA 3A4SC 3APDA 3GZNB 5HHDG 4BOSC 5KHOA 1BUVT 1XNRL 2HJ1A 2O2VA 4CHKA 1SFOB 4GMVA 3AN1A 3VR4A 2IGHA 1IBLQ 4OVVA 3I57A 1WGHA 1YN5A 3S14H 2R93G 4MJSA 2V9HA 1I4GA 4TKNA 2W9NA 1Q10A 2IGDA 2PMZE 4ACFA 1CKNB 3UDGA 2WINB 1A6XA 4S0RA 1NCVA 3GO5A 2L00B 5MPOA 2G3QB 1Q0WB 5IGGA 2GRIA 1SXTA 2KT7A 5IYDH 3UQBA 2J4XA 4LF5Q 4FBJB 4HN7A 4XZ4A 4EZKA 5M5WB 1YJNA 5DM73 2CHWA 4JOIA 3DWGC 2PZWA 1L1OA 2VZAA 3UINB 4POFA 2IO0B 3TEWA 3LGJA 1VQEA 3VRAB 2N88A 3DHIC 2D0OA 4Y52H 4GS3A 3DHGC 2K5VA 4HPMB 5H8YE 4BA2I 4YSZB 3DBHB 2KACA 2V3SA 3SXHA 2Q8TA 1WX7A 3RPFC 4DK0A 1KF6B 1D8LA 4UHVA 1BF4A 1AYFA 3Q3FA 5AJ3Q 1GAQB 4YTMB 3OTOQ 1JOOA 2CVRA 1J6QA 5DCNA 4KD3A 1WD0A 3DM3A 1Q46A 2JRHA 1F1HA 4DK3C 3SHQA 3AQQA 1DOKA 2J7QB 4A3OA 4ANWA 4JYAQ 1LV9A 4RF0A 4DV6L 1W2BA 1KIXA 4CJ2C 4KD4A 2E2JH 5J1ZA 2WDRB 2JZPA 4IWOA 4QY7A 5KGUA 1R9TB 1VQ8A 3TP5A 1ZXIA 3PUWA 2BWFA 3GTLB 3ECIA 3X3MA 1J7BA 3MTNB 4KKJA 4EEWA 3KBXA 4YWLA 2UUBL 1B53A 2WB1B 2LXAA 1JE4A 5IODA 2R2OA 4EQNA 3OOCA 2XWBB 3TJPA 5FO9B 5IOCA 1WR1A 3HVZA 2XN9C 1SB3C 1Q1OA 1OXSC 4DR4L 5M5YH 2OJRA 4X64L 2CHBD 4XX5A 2MSED 2J52A 3A5UA 3QG1A 4LDTD 4MH0E 4MNOA 2A6HD 1L2FA 3NZUA 4P1BC 3PO2B 1Y14B 1TWCB 3FILA 2L52A 4HMJA 3D6WA 5IT9E 4FJYA 2LHEA 1XWEA 1IYFA 4DHJB 2D11A 2RF4A 5BN4A 1GB1A
chains in the Genus database with same CATH topology
1LTAD 4ZRPA 1JICA 1KDBA 1L0YB 4BY7B 1NR2A 5CV7A 1D5MC 3HP3A 1PDXA 4OGQC 2JYTA 1G2TA 2WDVB 1V43A 3ETRA 3RFZB 3FMCA 3HRZC 3Q0AA 3V2TA 1I6VC 1EWHA 3W5UB 1P7FA 3TZUA 1VZ6A 4RWSC 5DM63 2EY5A 2MPMA 2OEDA 1GUNA 5G3LD 1DOYA 1T3QA 4ZHOA 3QJYA 2V3NA 3AE2B 3BYYB 1BUIC 2VNUD 2IL8A 2ON8A 3R2IA 2FMMA 5J22A 1HZ5A 3TEYA 2JYOA 2WXOA 2K5QA 5BYRA 4ZAIA 3I4MB 1WWTA 1B9MA 5JAVA 5M5XB 4IALA 4L6TB 1RJTA 1ZOYB 4KTAA 1J9OA 5CBEE 4WORA 5EBDA 1S5ED 2F0EA 3E6ZX 1BBXC 2K5WA 3FEWX 3HOVB 3S14B 1PDQA 5BMIA 4YSYB 3FRPB 3PO0A 1E2WA 3ONAB 4ARIA 4C1NI 4MH8A 3D4RA 4L63B 1JROA 4XYQA 3IXSA 2E76C 2WLBA 2F0HA 2KMMA 2AUKA 4XWWA 4N9PA 4XQQA 3TUOA 1U4LA 5CR3A 3I91A 1PFDA 2HTME 4ULLA 3NVWA 1AN8A 3BVGA 3CRLC 2L83A 1EU4A 1STNA 4LAAA 2Q8IB 4JWUC 2GB1A 4LMQD 2KA7A 3L4PA 1OXUA 4FYDA 4IUTA 1KDAA 4KHZA 2LUMA 3GTKB 4OHJA 3ND8A 1QKZA 1DONA 2KHSA 3KWVA 2E2JB 4RFBA 1VF7A 2HUGA 4ZKBB 4IUNA 2M19A 4RNAA 1ILQA 2ZT9C 1L0VB 4WH4A 2A69C 2WXFA 4KY6A 4IOIE 2F0IA 2KCNA 3P75A 2JXMB 5JOBA 5FO8B 2D9UA 2CJOA 1QWYA 2BA0A 4FO2A 5M5YB 3OIPA 1MSGA 4CJ1B 5JXVA 4LLGM 2RSOA 1OQQA 2BDNA 1UEAB 2A73B 3U2SC 1EEID 1BQQT 2M56B 3OSOA 4WFN3 4NKLA 2WXQA 3W1SA 1FRDA 4IFDJ 2PIAA 2B2TC 1YNJD 4JX1C 1B44D 2WKDA 3I9V1 1EY6A 1ML0D 2K04A 3BK2A 1MD2D 4CKBA 1A3UA 1L0XB 2NUCA 2ZW1A 2BA1A 3QWNA 2K1BA 3BZDB 5FLXE 2FE8A 4B9WA 4RKBA 3S1QB 2TSSA 3QO2A 1A70A 3EVQA 3J81E 2K7VA 3AEBB 1FEHA 4HSPA 1E0BA 1I4RA 4HEA1 5IGCA 3P4PB 2BW2A 2V4DA 4N59A 3K7AB 1TWAB 3GQBA 1LT3D 3NPPA 1LTBD 1G6ZA 2JYEA 4Q5VA 3NQIA 3NK9A 1DOXA 1RODA 4RGOS 2D5DA 3D3RA 1BNZA 2ONQA 3I73A 3KLRA 3MXUA 4HR7B 1EYDA 1HFGA 4YTNB 3EFXD 1IYVA 4GDKB 2NVXB 1I6HB 3K5OA 2DNCA 1N62A 3MEHA 1IW7D 4K2LA 1VRAB 2V4IB 4UDUC 4BS9A 5JVG3 2F0QA 5ELCA 1YNTE 2B2WA 1O7LA 4L23A 3KLSA 4G7OC 5JEAJ 1K51A 3Q24A 3IAS1 4CGYB 2IGGA 2WXKA 2KCCA 1C8CA 4RGMA 1WTVA 2I2YA 3S16B 1BDOA 5BMGA 4PT5A 1DCZA 3PV0A 5FLXL 2EJFC 1U4PA 3H0GB 4M0WA 2B2UA 1IYUA 2Z4IA 1D4BA 3P7JA 3MFGA 3CWIA 3I3CA 1RD9D 3NVYA 3FVQA 4X3TA 1LT6D 5BMHA 4IKGA 1XXGA 4XQNA 3T53B 4G7HC 4Q2JA 4TRDA 4JBWA 4RCNA 1E9MA 1N61A 1A3TA 3BDOA 1AEXA 3OMCA 4TKOB 1ZUD2 1TIID 2NVTB 1TQOA 2O5IC 3TEXA 4JPSA 1KTKA 5IGFA 1B9RA 2QMTA 1TS2A 2MJ8A 4ABNA 2BE5D 3GTOB 4A3FB 1PMRA 3MFYA 4V190 1ZP0B 1ESRA 3OPOA 1F2YA 3SK8A 2J7ZA 5EBCA 3P4RB 1WTRA 1KLUD 1Q8IA 1F2RI 1I7HA 4H44C 4KGSA 4XT1B 3FAHA 1EM7A 1GJXA 1FNWA 2B2VC 5C0XI 3A55A 2A6ED 2IT1A 3HS0C 1UNSA 3H8HA 1QOFA 2NZ1D 3OMGA 1EY0A 4O42A 3A8IE 2A68C 3H94A 2IDYA 2R61A 2DNEA 1BO0A 4H0LC 3D6CA 1B3AA 1DD2A 1SE3A 2KAJA 2PMZB 1LLRD 4JE3B 1JMLA 4D2KA 4XIGS 1G91A 2R6GA 3CKIB 4YTPB 2LFNA 1C4PA 4MM3B 3U52E 5HGTA 2L0CA 4PQXA 4DF7A 4EVOA 2WU2B 2EPBA 5CC4A 2PMVA 1NI3A 2I38A 2HQEA 2X6LA 1AZPA 3VR9B 4Q0FA 3UI2A 1SYDA 2K5PA 1CK1A 2KUMA 1TKYA 4ZLTF 1C48A 5A2QE 2D62A 2KQ4X 3MAQA 2DN8A 1M8AA 3WOEA 2O5JC 3IKJA 3VR6A 4A90A 3TSSA 3BYTB 2PO4A 5BN3A 2BTEA 2A69D 1HTLD 1Q1EA 1EWYC 1PGBA 3BVZA 5J39A 4FXGC 3DWPA 1YNNC 1PFBA 2NN6I 1GHJA 1HQMC 4F8MA 3S1RB 2WXRA 2R93B 5ELDA 1JORA 4TSSA 1XO3A 4A9AA 2NYZD 1XYIA 3AE4B 1VDVA 3AEGB 2Z8LA 1SYCA 1HXYD 5AUKA 2F0WA 1W6KA 1V97A 1PLFA 1CT1D 1L6VA 4J8QA 5FO7B 1OXVA 2INNE 2F0GA 4XDDA 4ZYSA 5H92C 3ZGZA 1UAPA 4M1UB 3Q8BA 4IUPA 4K5WA 2QJLA 1TWFB 4C80A 1SNOA 4HCSA 4IQZA 3W2DA 4OL7A 1TR5A 4OIKA 3IFDA 1PYWD 1YQ3B 1HCZA 2E74C 1B1ZA 2PLPA 5EE9A 1I50B 2DY7A 3K57A 2KDMA 1JWBD 1SJED 5A2QL 3HZXA 1JW9D 1WYGA 2MHVA 1FNUA 1Y1VB 2VB3X 4QB4A 2F0DA 1A3VA 4EQPA 1BCPF 3AU7A 4P6VF 3DUZA 4QMGA 2BDOA 2NTSA 2DBYA 1RF2D 2JSVX 2NN6G 2XRQD 3SHLA 4C3HB 4IZ8A 3NVZA 5C3EB 2MJ3A 1Y56A 2LKVA 4C7ZA 3DWMA 2LHDA 1ESFA 1SMYC 3J9CA 3C2PA 1SNPA 1C76A 3ABVB 2AWNA 2QEJC 3LWEA 1CZGA 2XVSA 3GV3A 4HJGE 2RQXA 4R8NA 4WURA 1IGCA 5A35A 5KNDA 4TQ1A 5BYSA 2QSDA 1SNCA 1CA6A 2F0SA 3NTHA 3KLSX 4NJCA 4A93B 5AFWA 1F9QA 1HTPA 3KWLA 3HOYB 3EQLC 2IX0A 2MH7A 1PRTF 3K5LA 3OW7A 1PTOD 3HRDD 3MWYW 3AM9A 2EOTA 2D5GA 4C3IG 5CMDA 1IHZA 4FXCA 1DOLA 1QQRA 3GTJB 3TEZA 4FVMA 4DN4M 3VYUA 1H9KA 4DAPA 5LL6S 3VR3A 1ZPSA 1EY9A 1ACCA 2K0PA 1MSHA 4ARCA 2JP1A 1S5CD 1QT9A 1F0ZA 4ZKCB 3T51B 2OT2A 1EZ6A 1WTQA 2FHTA 2KEEA 4PV1C 3P1HA 3SFEB 3AE3B 4A3MB 4JK1C 2H4OA 3NUCA 3VR2A 4KI0A 2ACZB 1STHA 3MHZA 4QIWB 3H91A 4YSXB 1TVXA 4OW0A 2A68D 1YQ4B 3D4WA 2I07B 3AB9A 3URYA 3S17B 3FDTA 2VUMB 4B9XA 5CGKA 2PNRC 1N5WA 2VZKB 1QOAA 4X3KA 3V05A 1BCPB 2WXIA 3PZ7A 1JC7A 1KNAA 2F0VA 4C3JB 1TKEA 3I4LA 1WTXA 3D31A 5EKIA 1J8IA 4XT3B 2IPKD 3NSWA 3JAME 3A7LA 1FIQA 4HKZE 3E9SA 3P42A 4OZAA 2B2TA 3Q6SA 3N9YC 2XRSD 1WRIA 3WCQA 4KK7A 1ZDVA 3VQIA 1WTOA 2M9VA 4BY1B 3P20A 1XLNA 3NXWA 2L1AA 5E4WC 1RDPD 4ZQ3A 5EJWA 1D5XC 2BYTA 1WTWA 2ICIA 3NUHB 1FXIA 2R3ZA 1QNKA 1B50A 1ONLA 1CA5A 3AEDB 5CV6A 1XCQL 1LO5D 3AECB 3IAM1 3HOUB 2JA7B 3MXGA 1PRTB 1BCPC 2N0SB 2EDGA 2EZVA 2WQYB 2WAQB 2D2CC 2RSNA 2OXPA 3Q69A 4DAVA 1Y8PB 3KF8A 1O80A 3RZDB 4RAUC 4S3SA 1IBXA 3AE7B 3BWUD 1GB4A 3NBHA 2BS2B 2QKIC 4QF4A 1WD1A 3K0YA 1CTMA 1S5BD 2B76B 2EELA 3M3YB 3JAML 1E6EB 1N60A 2E2DC 3ZYYX 3J7AV 4WAFA 4FNFA 4KN7C 1FD6A 2BB6A 4YXDB 4FF2A 2XWJB 4XYOA 1FR3A 3SEBA 3P4SB 1FFUA 1WXQA 4IURA 1WTPA 3WOFA 2QDBA 2PVGC 2DLBA 3NP8A 4IFDH 3GD7A 4OO1I 1YN4A 1S5FD 1PRTC 1JWAD 2CW0D 1GUOA 4KJNA 2F0PA 2L11A 4A3KB 2JU6X 1A2UA 4GZYC 4XDCA 5D3DA 4JWSC 4DA2A 1RM6C 1F2MA 4YT0B 2ZXOA 4DU9A 2NB0A 3TBIB 4DNRB 4ZUJA 1CHPD 4B0MA 3T3NA 3TN2A 2JX5A 5COYA 2E3TA 4FF4A 1C9FA 3T4AC 4L1BA 5D3IB 5CBAE 1EU3A 2ENBA 2K32A 4I7ZC 4NDXA 3SR1A 5EGTA 3R8BA 2H88B 2LGIA 1KDCA 4WJWA 1DJRD 4AQ7A 4P2CB 1JQ4A 5I4DA 2BS3B 1IBXB 3VYRA 4A8XC 2B2VA 4KY5A 1VLBA 2SNSA 1JR0D 2W82A 1J7AA 5C0XJ 4A3DB 3AE6B 3NS1A 2X38A 1TWHB 2E2HB 3K6OA 5E3FA 5HURA 5I2YA 2LEKA 4NAWB 3QIAA 2F0UA 1MHXA 1NYRA 2RDFA 3PMFA 2E6XA 5I6WA 1NUCA 4PMCA 1F9RA 4A3BB 4G4KA 2QIEB 3HOWB 1RTOA 5C6AA 1L4ZB 5JJZA 1VZ8A 5BYQA 4EGVA 2XNAC 3EROA 3KBGA 1H9SA 5JEAH 1FFVA 1BMLC 1QJOA 3VA7A 1SYBA 2CQAA 3B2GA 2A74C 2PPBC 2BBCA 2EKIA 3ND9A 3SR6A 3S9WA 4KY7A 3MXNA 1EYCA 4ODGA 2FBWB 2GI9A 4RH6A 1QCBD 3NRZA 2Q5WD 5C4XB 2J53A 3QOLA 2QILA 1FXAA 3GB1A 2V3PA 1OXTA 5G3LF 4NMZA 3SVMA 4RGNA 2EE1A 1KLGD 5I2XA 1SAPA 2F3VA 4DK1A 4AS1A 1LABA 5JPNC 4IUVA 1N5XA 2L32A 1G2SA 3K59A 2W3RA 1VMPA 5CV5A 1HUMA 3TP6A 4DFAA 1XCTL 2WXHA 3NVVA 2M2LA 3J7YW 4RA8A 2F0OA 5G5GA 1V8CA 2FINB 4B0EA 2Z4HA 3VYTA 4EQOA 3AE5B 4O1NA 4YWGG 2RDHA 1T6BX 2EVBA 2NBFA 1JB3A 5CYUA 2JSOA 2Y5PA 4IUUA 4NAMA 4X3UA 3A8JE 1IL8A 1T5EA 3W9CB 2PQEA 2GA4B 5KRUA 1KRHA 4V0BA 3S1NB 3J7AF 1G291 4QCLA 4KKUA 1H9SB 1B2TA 5G5HA 3EUB2 4LK1C 1TYGB 2KEDA 1I4XA 4HAEA 3GP7A 4MACA 5IGEA 1P7EA 4M8AA 1TKGA 4KV6A 1DM0B 1C79A 1Z7TA 4RKLA 3FC4A 1RTNA 4ILWA 3IL8A 2SAKA 1FYCA 3MVVA 1U9RA 4X3SA 1RHPA 1BOSA 1O7YA 2JE6I 2N9KA 4J6HA 2WXJA 2PZUA 3AE1B 5C5LA 2JA5B 2OF1A 1IGDA 3AEAB 2DYOA 1F2LA 1PGAA 3NBIA 1VZ7A 1WGKA 5M3MB 5C3WA 4XTCS 1ZEQX 4K6DA 1I4PA 1FGBD 4C2MB 1E7PB 2BCOA 1K53A 1LT5D 3J80L 3DM1A 1QOGA 1C77A 2WXPA 1CI3M 5FR3A 1EQTA 2K05A 5M3FB 1AP0A 1BR9A 1EFID 3FPPA 5I9OA 2EJGC 3DWQA 1DZ1A 1JWSD 1PFMA 3FPUB 4K6LA 3SK6A 3MC0B 3UI3A 1SNDA 3TP8A 2Y3AA 2F0MA 4GLSC 2B63B 1O7ZA 2NVYB 1DOIA 1Q90A 2A6HC 4C3IB 1KH0A 2NWGA 2HCIA 3VYSA 2OHFA 3GTPB 5FKAC 1VCIA 1SEBD 2K03A 2PW9A 5C0XG 3MA2B 2K22A 3L7ZC 4TMAB 4GDLB 3OWEB 3T56B 5I6YA 3HEJA 5F2DA 4BA1I 5D65A 3GTGB 2KOLA 1YJJA 2EYOA 1Y69U 4RHSA 4KKSA 1QB5D 4FF1A 5EKKA 1PZID 1STYA 1HQRD 3IFTA 1GUTA 2M00A 3D8GA 1JOKA 4DXFA 2RPVA 5KNCA 1H9MA 1Y8OB 1H9RA 5JVH3 2WS3B 3CQZB 2LS01 1EY5A 1H9JA 4CBVA 3AEFB 3K58A 1B4OA 2VB2X 4ZUIA 3GTMB 1I3QB 5LNK1 3PZ8A 2HCCA 5IIFA 2KN4A 5T8IA 2HDEA 3LX0A 3Q8AA 1HUNA 1W6JA 2NMQA 2B2YC 4IDIA 2PTLA 4MHEA 3V96A 1X3PA 5LHY1 3NHHA 1KFYB 3D4DA 3TMEA 4K5XA 3H3VC 5IGDA 3DXJC 1MI2A 2K3UA 1AFPA 3ITPA 4OIJA 5AUIA 1PZJD 4A6QA 4LJZC 3C1FA 1A15A 2ZXRA 3S1MB 2BOSA 1SIJA 1ENFA 1NEKB 3O13A 4MIUA 3MJ5A 3H09A 1GUWA 3EA6A 2HDLA 4F88A 2F0TA 4RHRA 4XWTA 3R2TA 5KYLA 4KX6B 5KYIA 5LL6X 3HG9A 2WIIB 4YIJA 5C4ZA 4FF3A 1JRPA 1WCMB 3M7NA 1F9PA 1B9NA 1TY0A 1XF5L 2MJDA 5CV9A 2EY6A 2KECA 1R7SA 1SE2A 1V1PA 4Z9CB 1K8MA 2E2IB 4P16A 3EJIA 4A3GB 1ET6A 2AQ2B 1OQRA 2LY7A 4BBSB 3VRBB 4RGTA 5ELEA 4IN3A 2V0GA 4I65A 1YJIA 5C3JB 1FM0D 4F87A 2L4NA 1OO9B 4K2KA 2L12A 2IX1A 2X6GA 4EE2A 3E0JA 3TP7A 1FNVA 1K50A 3M4YA 1EWCA 3WDNA 4HSVA 2YU9B 1VF5C 4R9WA 1YNJC 4FXKC 3S15B 1NVID 3HOXB 1XX8A 1EL0A 3L3OC 3Q22A 3I4NB 1JCKB 2R7ZB 4XQJA 2AQ3B 1QILA 1ET9A 1TT2A 1ZDXA 2IW3A 3SK4A 1PXUA 3A7AB 1ICWA 4XE0A 2H89B 1QF6A 2YEPF 1TS4A 4E6IA 3Q8FA 4H7BA 3AMUA 3AV8A 1BXTA 1HA6A 3AB5A 4KGTA 2KQ3A 2JWUA 5CORA 3P4QB 1FRRA 3NZ3A 3A54A 1IUEA 4NP5A 3OHXC 5CV8A 4R3DA 4WIPA 3C3LA 1HRJA 1EY8A 2MGSA 5M9OA 1SDFA 1MGSA 1V1PB 2N7JA 1R4PB 5GXGB 4QUCA 2PKOA 3BVMA 2MP1A 1AW7A 1HHVA 1FD7D 1OXXK 2K6AA 2EYLA 2WXGA 1IW7C 3N52A 2PW5A 1EIHA 2EYHA 1CZWA 2WXNA 3MTSA 4REZA 4N6EB 1DXMA 1SYFA 4MN3A 4J3OD 3HUIA 4ZHPA 2E75C 3SFDB 2HDMA 1STBA 1GUGA 1CHQD 1YNND 2F1MA 2SDFA 3OIQA 2JQRB 5D14A 1F77A 2XSCA 1ENAA 1JWMD 4C3HG 1K8OA 1TJEA 2DYMA 2SEBD 3K5NA 3KUPA 1HA5A 2M0AA 3M7GA 3P1MA 1GXDC 2F0JA 5E6JA 4BWGB 2NVQB 3V3XA 3EGRA 1SSNA 4FP5D 3GS2A 1X32A 3PIO3 1NR4A 2BE5C 3DEOA 1FO4A 3NE5B 2F0LA 4HTHA 2DY8A 1E0ZA 1V8QA 2QF7A 4WRDA 2JXTA 3AEEB 3T3OA 1TKWB 4H13C 4ME5A 1JQYD 2LMCA 1C78A 1ZE3D 1S5DD 4PNYA 3IT6B 4CQNA 1GPXA 2Y0SB 5C5MA 1U4MA 2YEPB 2A6EC 2I46A 5EPKA 2FJ2A 3KK7A 3IT4B 5IGBA 4A3IB 1PTOH 4HRSA 3HKZB 2G9DA 4N58A 1EYAA 4DGZA 2L5TA 1O78A 4HMIA 1PTOF 4WWMA 3Q8EA 3Q23A 1PGXA 4KKTA 3U9OA 2BB5A 3NTIA 2IJ0A 1QE6A 3R3OA 2PYKA 2PCFB 5IT9L 5C0XH 3ZQ4A 2WP9B 1EOTA 3IAYA 2F0NA 4R8IA 1XLQA 5ELFA 2C5CA 1ZYRC 5BN5A 3FILB 4KGRA 2K33A 3HVDA 2KWDA 4ZRZA 4HEDA 3AE8B 5HG2A 3MHBA 4LTUA 1SMYD 5E4XA 1F2ZA 5K36G 1HFNA 4ZK9B 5C3XA 1II3A 4US8A 5JPMC 3ERQA 1TWGB 1IKMA 5EE0A 1MPEA 3PO3B 1TS3A 4XXEA 3GV6A 1VDZA 1ILPA 4QUFA 5C2TB 2WP8J 5T1GA 2O4XA 4PMWA 2EXZA 1SYGA 4TQ0A 3DHQA 4G7ZC 1NAPA 1STGA 3N6RA 4C3JG 2AQ1B 3NWSA 2K28A 4A55A 2CJNA 5C4HA 2MEKA 1A2TA 3CIRB 1D5ZC 2LMCB 2EYFA 3ZJVA 3RUZA 1SNMA 3E56A 2IX3A 5E1FA 3CRKC 2WNMA 2NN6H 3VR5A 2MJEA 5I9PA 4OO1G 3C8YA 1MI0A 3BS1A 4B08A 2JEBI 3S2HB 1UWMA 3PUZA 3CU7A 1LTTD 1L5PA 2FUG1 1Q1BA 3B9JA 2K9XA 1M4VA 3I8ZA 4OZCA 4K5VA 3C46A 4J1MA 5DAUA 2RVLA 2F4IA 1E10A 1NYQA 1DOMA 1XLPA 4USAA 2TMPA 5HFYA 1F9SA 1DGJA 2N9LA 4DQOC 2MUYA 4CHTB 1OFFA 1EIGA 4KJOA 1EEFD 1PTOB 1S4ZA 3HGBA 1LTSD 2ZW0A 3BIID 3QOJA 1Q3LA 1Q12A 4US9A 5KIXA 3DWAA 2FMCA 3PUXA 2W55A 3C1EA 3RD4A 1TZOA 2CU3A 4F7XA 1I4HA 3E5SA 1Y8NB 2FFKB 4NW2A 5FOBB 4NZLB 3A56A 1L4DB 1D1IA 5TSSA 3SK5A 1ZKOA 2F3WA 1RCVD 3KQ4A 1UUPA 3A8KE 3I72A 3LNNA 1RYJA 5KNBA 4K8JA 2EYJA 3LWUA 3LXFA 3LYYA 3G7LA 1LTID 2XIWA 1GUSA 2B39A 3J80E 3LB8C 4H2AA 1C4CA 4MT5A 3BK1A 4DAYA 4CKCA 3MP9A 1EY7A 1CM9A 2N55A 1C4QA 3U7ZA 2SOBA 1UGJA 3PUYA 3J81L 2PVOD 3T16A 2B2YA 1RWSA 5ISRA 3RMHA 1N63A 1E2VA 2VZKD 2RKSA 1RKNA 1PTOC 1LACA 1HPCA 1SE4A 4C56C 1CJEA 1BCPD 4XDXA 1GAQB 1R4QB 5EKLA 3AMZA 1F2RC 4N9TA 3I70A 4CKEA 4L2YA 2WKCA 1FCCC 1LTRD 1XTCD 2RMMA 5CV4A 5EE1A 4FXDA 1DYQA 4HROA 3M85A 2B8FA 3BDLA 5T1IA 2RBMA 3MZ5A 3CHBD 5FK9C 1ENCA 2WXLA 2JA8B 1EY4A 1D2BA 3AH7A 1FCLA 4TQUS 3DMUA 4A3JB 1WSPA 1CFMA 1C4AA 2RDGA 4RCOA 2G9HD 2SNMA 1PFNA 1SJHD 4IFDI 2EYMA 2LFIA 1CQFA 5C44B 3VR8B 1YMHE 1SBBB 1T5XD 1XLOA 5NUCA 1PUTA 1SF0A 2J42A 1ZXTA 1JOQA 3RLFA 5EPLA 3OWFA 1E2ZA 2R92B 2YYZA 2JA6B 2W54A 1HZ6A 3SDZA 3P63A 1PRTD 3M4OB 1YN3A 1PZKD 1TS5A 1VMCA 4K8IA 3PUVA 3W3AA 1EQVA 1VR9A 5ELBA 1XEEA 2AX5A 1ZYRD 1L6UA 2QCPX 3QB3A 1STEA 1MVKA 4IUQA 1QOBA 3BDCA 1Y1WB 3T13A 2ICEC 2WXMA 2C9OA 1STAA 4A3EB 2EY1A 4U673 4G57A 2ID0A 2WU5B 1UWXA 2AWOA 4ID6A 4AYBB 3K5MA 1NSNS 2BT6A 1JALA 4C1NK 1VJKA 3SE0A 1CZPA 5HI1A 2A5HA 4KKIA 1I4QA 4IFDG 1GOZA 1KAAA 3MXPA 3U9SA 2ZXPA 3AE9B 2B2WC 1KNEA 3NWTA 3F2UA 3BG3A 1TU2B 2L55A 4DNTB 3U4EG 2NTTA 1D6EC 2WACA 1RFKA 2JEAI 1MHHE 3Q8CA 1X3QA 2AUJD 3RZOB 3HOZB 5D7GA 1JWUD 4L8JA 5K5PA 4WQMA 4CJ0B 1QNUA 3TDQA 2B2UC 4HCEA 1CQVA 1WVLA 1KABA 1QLBB 3TZDA 2DWQA 2RA4A 1K52A 2Y5CA 2IWHA 1Z6HA 2EY2A 2WDQB 2KJXA 1QG7A 1G8ZD 4BBRB 5K36H 5KEEA 1AZQA 2K01A 5EQ0A 5DEHA 2BS4B 2J0TD 4PMBA 4ITKA 3ZJTA 2L9HA 4DXGA 4UAIA 1SYEA 2G1EA 2H1EA 3ZJUA 2PW7A 2LJIA 3X3NA 4ZOHC 1AWDA 5C4JB 2OEOA 4HKQA 1NENB 2KVMA 2EYPA 2INPE 1LTGD 2F03A 1FMAD 4U68A 4OZBA 3DEPA 2CW0C 2Q8RE 1ROEA 3R93A 1LT4D 3I90A 1SSOA 5JEAG 2K5DA 2W3SA 3PIP3 1GHKA 1K83B 1Z47A 1D1KA 4KHVA 3NQTA 2PZTA 3VA5A 3S2DB 4OO1H 1J7CA 2L1BA 4ZRQA 3H6MA 3FKIB 2WV6D 1ZXHA 2F0KA 4C7YA 2Z1CA 5DNFA 4KN4C 3B2FA 1U4RA 3NTKA 5EE3A 2B8GA 1HEZE 2X69A 3W5VB 2VXWA 3L9AX 1TY2A 1EZ8A 4Y7NB 4LK0M 1SNQA 1IKLA 4OVZA 2EJMA 2O2LD 4RF1A 1QOHA 1V1OA 4KMUC 3GTQB 4K14A 3G6JB 5HHDG 1MBYA 5EPJA 1BUVT 1SFOB 3AN1A 3VR4A 2IGHA 3I57A 1YN5A 1I4GA 1Q10A 2IGDA 2WINB 1A6XA 1NCVA 3GO5A 5MPOA 5IGGA 2GRIA 1SXTA 2J4XA 4HN7A 5M5WB 5DM73 3DWG