1SE3A

Staphylococcal enterotoxin b complexed with gm3 trisaccharide
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
239
structure length
239
Chain Sequence
b'ESQPDPKPDELHKSSKFTGLMENMKVLYDDNHVSAINVKSIDQFLYFDLIYSIKDTKLGNYDNVRVEFKNKDLADKYKDKYVDVFGANYYYQCYFSKKTNDINSHQTDKRKTCMYGGVTEHNGNQLDKYRSITVRVFEDGKNLLSFDVQTNKKKVTAQELDYLTRHYLVKNKKLYEFNNSPYETGYIKFIENENSFWYDMMPAPGDKFDQSKYLMMYNDNKMVDSKDVKIEVYLTTKKK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords STAPHYLOCOCCAL ENTEROTOXIN B
publication title Residues defining V beta specificity in staphylococcal enterotoxins.
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Toxin
total genus 69
structure length 239
sequence length 239
ec nomenclature
pdb deposition date 1996-10-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01123 Stap_Strp_toxin Staphylococcal/Streptococcal toxin, OB-fold domain
A PF02876 Stap_Strp_tox_C Staphylococcal/Streptococcal toxin, beta-grasp domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.110 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1se3A01
3.10.20.120 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1se3A02
1TS5A 2XRSD 3BYYB 5I4DA 3BVGA 1BCPB 1JWUD 1D5ZC 1YN3A 1PTOH 1FNUA 1JWSD 3BZDB 1JQYD 4DXFA 1F77A 3TSSA 1HA5A 1BCPF 2J4XA 3BYTB 4L63B 1YN4A 2XN9C 2CHBD 3CHBD 4NZLB 1LT3D 1UUPA 1AN8A 1BCPD 4RGNA 5ELDA 1TY0A 1S5BD 1STEA 1KTKA 1HXYD 2RDGA 1S5FD 2IPKD 1G8ZD 1LTID 4UDUC 1GOZA 1S5ED 3R2TA 1I4GA 3MFGA 1FGBD 3MC0B 1PYWD 1AW7A 1ET9A 1EWCA 1I4QA 4C56C 1M4VA 3OWEB 1EU3A 1CHPD 1SEBD 3BVZA 2XRQD 5ELEA 1I4PA 1XTCD 1S5CD 4TSSA 4RGOS 1JR0D 3DWPA 5FKAC 1SXTA 1FD7D 1RD9D 1SJED 1CHQD 1JWMD 1EU4A 3V05A 2O2LD 4RFBA 1TS3A 1LTBD 1PZJD 1SBBB 5D3DA 2ICIA 1CK1A 4Z9CB 1PTOC 1L0YB 2G9HD 1I4HA 3BVMA 1L0XB 1BXTA 1V1PA 4K6LA 4ZYSA 1TS2A 5ELFA 1DYQA 1LT6D 4O1NA 2Z8LA 1PRTC 1I4RA 1RF2D 5ELBA 4RGTA 2XNAC 1S5DD 1LTAD 1ESFA 2IJ0A 1FNVA 5FK9C 1BCPC 1KLGD 1V1OA 4RCOA 3GP7A 1LT5D 1SE2A 1RDPD 3EFXD 1EEFD 1PZID 2R61A 4RGMA 1PTOB 1D6EC 2AQ1B 1QILA 1HTLD 1I4XA 1FNWA 4RHRA 1HQRD 1T5XD 2SEBD 3R2IA 3SEBA 1CQVA 3EA6A 3DWQA 1D5MC 1V1PB 1LTRD 1PTOF 4L6TB 1ENFA 1ET6A 1LLRD 3W2DA 4OHJA 2NTSA 1D5XC 3O13A 1PTOD 1YN5A 1DJRD 1PZKD 1PRTF 1LTTD 1B44D 4RHSA 1SE3A 2AQ3B 1SE4A 1SJHD 2QEJC 3URYA 2TSSA 1PRTD 3DWAA 5TSSA 2NTTA 1LTSD 1KLUD 1TY2A 1RCVD 5D3IB 5ELCA 2WV6D 4DXGA 1LTGD 1LO5D 1TS4A 1LT4D 1CT1D 1JCKB 1EEID 1XXGA 1MD2D 4BWGB 1B1ZA 2QILA 1EFID 3KLSX 4RH6A 3R8BA 1PRTB 1UNSA 2AQ2B 2RDHA
chains in the Genus database with same CATH superfamily
1TKEA 3RNGC 4CDFC 2KC2A 4IM0A 2C5CA 3GTLH 1C4AA 5J2RA 3GE3C 3EJIA 5EE9A 4JYAL 3A33B 4DV7L 2CHZA 2KTRB 1K52A 3A9KA 2DNEA 1VMCA 2L52A 1JWSD 2EIFA 2I0QA 3VH3B 3JVZX 3NWSA 5CORA 2SDFA 3S2HB 1VQDA 1XF5L 1VQJA 5JEAH 3S16B 1OQQA 1BBXC 4LFAL 1WY8A 3ML9A 1EWIA 4AQYL 4MGKE 2PO4A 1EO6A 3GTQH 5M5XH 4JI8L 4PS7A 5LL6S 2N7JA 3BZCA 3MHBA 3J81i 2AWTA 1Z7TA 1S5ED 3PUWA 4BY1B 4KKJA 1XX8A 4A3MH 1BUIC 3RMKC 1P7FA 4NJCA 1IGCA 3VAWA 4X57B 4ZOHC 2B2VC 2UXDL 4RMAA 1VRAB 1JROA 1IXRA 5NUCA 1TWCH 3HOXG 4OL7A 1ZPSA 3I4NH 4GN4B 2YU9B 2WFWA 1UWVA 3M62B 2WAQG 4R9WA 3GTJB 1ILQA 2LRUA 3V96A 3F2CA 2JA7H 5CV8A 2JSOA 3KYHC 3JAMc 1P1AA 1YQ3B 3AMUA 3ZNZB 4WURA 5IA7A 2O2LD 4EZLA 4C7YA 4FADA 2EKEC 3TP7A 3RN5A 1HNWQ 2HE7A 1I6HH 1J7CA 2BF8B 3R7QA 4QGUA 1O78A 4ULLA 3S1MB 3HKSA 5H1SE 2WB1E 3CW2C 2EYHA 4O1NA 4DK6C 3SR6A 5AZFA 2CW0D 4GOPB 5LHY1 2PPBC 5IO9A 4B3MQ 2JZPA 5G55A 3S16H 4N58A 4DXAB 4BBSG 2IJ0A 3A1QA 4LTUA 2X6GA 2KHSA 5JJZA 1A8VA 3VUXA 3RZOB 2RCFA 5G5GA 4HJ9A 1TIFA 1DGJA 4EE2A 2J7ZA 4UP8A 4RGMA 4HEDA 4LF5L 3PO3B 1Q5WB 5J39A 1WVLA 1WXAA 2KJRA 2O4XA 3AE4B 2BOSA 1QILA 4APVA 3AE7B 5AZGA 1HTLD 2B63G 1L0VB 2O6VA 2MCNB 1HQRD 1T5XD 1YX5B 5BR8Q 1CQVA 4KKTA 2K14A 2ID0A 1AZPA 4LNQA 1SYBA 2ZEQA 3H3VI 4A8XC 2LXCA 2JUOA 2JA8G 3D32A 3W2DA 3PUZA 2CWAA 1BO0A 1EQTA 1SNMA 2NVYH 2LGSA 4ZHOA 4DV6L 1A0IA 4PV1C 2INCC 3ZYYX 2AQ3B 4KGRA 4CKCA 4ABNA 4HIKA 3U7DA 3Q2AC 3H9DA 2M56B 4NQLB 5C3WA 1JE4A 1FXAA 1NSNS 2DGYA 5I6WA 3K58A 1PH8A 4K14A 5I6YA 2EY2A 3NSWA 1SGHA 1CT1D 5DPWA 3F8TA 1KLVA 4HK2A 5GROA 4IJHA 2NVQB 4FF4A 3CMMB 4YWMA 3Q23A 2XWJB 4ZAIA 4ZRPA 1T0YA 2LVOA 2J0KA 2M1MA 4RAUC 5I2YA 4HWIB 4ZKCB 2UUAQ 2Z0SA 2QCZA 4BAXA 3RZOH 4J1MA 1BCPB 4XYQA 1D2BA 1TGZB 1F9SA 4RA8A 3ENEA 1ZXIA 3SR1A 2KTRA 3AM9A 3DLLA 3TBIB 5C3XA 5JPMC 2WXHA 2ZM6L 2O5JC 2ALYB 5D65A 1WZ0A 3I4NG 3NTIA 3OTOL 3ZRFA 4JLCA 1JC7A 4LFBL 4EEWA 2KMMA 1YJ1A 4RGNA 2L05A 2JA7G 1TY0A 1E8WA 2WDTB 4EGVA 2INPE 3Q8AA 4XDXA 4DDGD 4PK1A 4NXMQ 3SU8X 4WJWA 4ZQ3A 1A3TA 3DBRI 2UYZB 4XQNA 1E7ZA 3KK7A 2R2OA 1KDBA 1AE3A 4FF3A 1XLPA 4L2YA 3ETRA 3VYSA 5EE0A 2A6ED 3RLNA 3W5UB 4AJYB 1EOTA 2HDLA 5E6NA 2XWBB 4A3DB 5BN5A 3PIO3 1L6UA 4US8A 1CM9A 1B9NA 2PZWA 4KV2A 1XTCD 3H8HA 2M0AA 3S17B 1DOKA 2A6HC 2JQOA 4LFCL 4NPNA 4E71A 1CHQD 3LWUA 3B2GA 4DR7L 5IGBA 1U4AA 4ANUA 5C0XJ 4A3GB 2UU9Q 3UIOB 4FXDA 1SBBB 4DU9A 2KK8A 4ICUA 4BY1G 1VLBA 1EY4A 2DNCA 1B8AA 5COYA 4ACFA 2D07B 4ZDVA 1H9KA 2KACA 4G11A 4DF7A 2I5MX 1RF2D 1SYEA 1H9JA 1STGA 1HTOA 3PLVA 4E3CA 4GN1A 4HDOA 3FKIB 2AUKA 1Y1VH 2BYEA 4TMAB 5D94A 5J22A 1WGDA 1V1OA 1GUOA 1F2YA 1PLFA 4KI0A 5T1GA 1XLNA 4QIWB 2XK5B 2I5HA 1YJ9A 2MNAA 5KIXA 3V60A 3K5MA 2WACA 5EPJA 5FR3A 4A75A 3NHEB 4V0BA 1G6JA 3H7SA 3V6EB 2A74C 5C3JB 3GDEA 3CRLC 2BB5A 1DOXA 1EM7A 1A62A 2CKHB 3M3YH 4MELA 4FBJB 3PPAA 2L12A 4IDIA 4AYBB 2KTFA 2QCPX 4KMUC 2LY7A 3DBLB 2WKDA 4S0RA 3KUZA 2Y5CA 2K22A 4OO1I 4YHHL 1HUNA 1WJ4A 2ONQA 1KABA 4REZA 4TV3A 3H09A 4JI2L 4JI0L 2QEJC 1IBLQ 3VFKA 2K7VA 1F9JA 2F4IA 4DK3C 4TQ0A 3A74A 4C3IH 3PO3G 1NMGA 3UI2A 1TYGB 1RCVD 2IHEA 1B9MA 1VQIA 2EJGC 3PF5A 2HTHA 4PG3A 3EROA 1TS4A 1IW7D 2HQLA 5E1FA 1VQPA 3I4MB 4ANWA 5KHOA 2L00B 5J18A 4ZYNA 2CQOA 3OHXC 4DV1L 2FMMA 2WKCA 2E3TA 1R9TB 3KYDD 3I5JC 1UH6A 1MHXA 2JJQA 4BA1I 1VQ9A 1SYDA 2IZVB 3C2PA 2LZ6A 5HFYA 3R66C 2DJGC 3AE5B 3TP6A 4DUYL 1PA6A 2M8SA 5IOIA 4KGTA 1JB3A 2WU2B 1VD2A 1E3PA 1T5EA 2GN5A 1XLQA 3ZNID 1V43A 5EKKA 1SMYD 2KQSA 2VXWA 3KF6B 1EF1A 4LNKA 2PE9A 5DM73 2IWHA 2GMIC 4HPMB 4L63B 2K4KA 3VR4A 1YQBA 2XN9C 4QJFA 4B3SQ 1WYWB 2KO3A 2V3SA 1UGJA 2KJ6A 2K1FA 4PZ6A 4PT5A 3PO2B 2K52A 4EQOA 3BG3A 3RNFC 1IBXA 4NXNQ 3T3NA 1SFOB 2LKVA 1QKZA 1X1MA 2LI5A 4AQ7A 4FNFA 1OXXK 4K3CA 4EOYA 1WXSA 2KLCA 3IFTA 3LB8C 2WLBA 5FO8B 2WHIA 1NBFC 1MGSA 1H9MA 4K8IA 3TP8A 2WAQE 3NJTA 1CHPD 2F0GA 5IYBH 3M4QA 2HT1A 1FCCC 2GB1A 3I56A 2PE6B 4TKNA 1PH4A 1XCTL 1Q7YC 1XT9B 1ILPA 5FKAC 1IBKQ 1L5PA 1FJGL 2WP8J 2UXCQ 2L4NA 4OZBA 3ZW3A 2FIFA 3RNCC 2K8HA 2KZRA 1T3QA 2WS3B 4XQQA 3OAWA 3NZ3A 5J17A 2L55A 1VQLA 3VH4B 2FBWB 1X55A 1AARA 1IUEA 2OEOA 4KD3A 1LXDA 2IYDB 4IFDI 4A3DG 3CRKC 5E7NA 2XBBC 1ESFA 4GS3A 3Q3MC 2WXRA 5BN3A 3PO2H 3P4PB 3L2PA 1V80A 2CJNA 4BY7B 4AS1A 2QDBA 3A56A 2C7HA 2EKIA 4S3SA 1E1TA 5FO7B 2MJ3A 3H15A 4A3GG 3EHVA 1SFOH 2WXLA 1PGXA 4LF9L 4MGYE 4DV2Q 4HXDA 3OJ4B 1X32A 2Y5BB 1YNNC 3B0AA 3IHPC 1FVIA 2UWQA 1LYLA 2WXJA 1ET6A 4A3BB 2W82A 1SNDA 3V3XA 1HNXL 3S14H 2EYLA 5JAVA 5GQOA 1A2UA 3FKIG 1Q46A 2EJMA 2MUYA 1PH9A 1NMFA 3AI5A 1Q12A 3TREA 1JJ2A 3C1FA 1AH9A 5D14A 1FFVA 1FXIA 1HEZE 3I63C 2N8NA 2MJ8A 2MW5A 3E56A 3BS1A 5D3IB 4LF8Q 1DOLA 2NVXH 1K73C 3HOUH 1F2LA 2EOTA 4CDEC 1IL8A 1H95A 1JCKB 4KV6A 1MD2D 1NI3A 5LMNL 1WE7A 1B1ZA 4RH6A 1EFID 4AH6A 5LMUQ 2YTVA 4DR3Q 3EQLC 2O5IC 2IGDA 4AYBG 1UNSA 4OIKA 2L76A 3U4EG 4MJSA 4JYAQ 3C3LA 5F2DA 4DV7Q 3E3XA 1PFSA 2NZHA 1JMLA 2V1YA 2BYTA 3DDCB 1AFPA 1DONA 1RYJA 3TEWA 3I4MG 2BA0A 2FAZA 1SNOA 2R93B 4JPSA 2V3NA 4OVVA 1BQQT 1IYJB 2KXJA 3KF6A 2MQHA 2F4VL 2VQEL 1QOHA 4LFAQ 4BOZB 4JQWC 3E0JA 3CHBD 4WRDA 2OOBB 1LT3D 1S40A 4L8JA 3ZDMC 3UQAA 4JI8Q 1A70A 1JOQA 5C44B 1ZKHA 1K50A 4HIDA 2C9OA 3GO5A 1HXYD 2CH4W 3IAYA 2RDGA 1YIJA 2PLPA 1VQKA 4LF6L 1B4OA 3CCUA 3KWLA 4YTNB 1VZ7A 4IUNA 2EYOA 4JI5L 3H0GB 2UXDQ 2KQ4X 2D5GA 4A3KB 4OWWB 1I35A 3FKYA 4BZAA 2LSSA 5BMHA 3HEJA 2RBMA 2K8BA 3MXUA 1P3QU 1EY0A 1PH7A 3OYYA 1M8AA 1IYUA 2CVRA 3OIQA 2M2LA 1JORA 1GC7A 2HTME 1SXTA 2L11A 4G3XB 2VUMB 3PO2G 1FD7D 1Q1BA 4KVGB 3PIP3 1I50H 1JWMD 1EU4A 3WOEA 3J81j 4WJ4A 3APCA 1N33L 4D2KA 1TR5A 3EIVA 3CWIA 4G7HC 3S1NB 4TQ1A 2YVCA 4PZ8A 2AL6A 1EWYC 1FPYA 3VR2A 2LMCB 5C4ZA 2YEPF 3KUDB 4MDKE 1X3QA 4BKSD 4JV5Q 1VQFA 2HDMA 4JI1L 1PRTC 5HGQA 1GHKA 3T51B 3L3OC 1NI2A 1SRUA 2E76C 4I7AA 4BBNC 1ZGUB 1SSOA 2NBFA 4C3HH 3AMZA 3KF8B 2A19A 3K8AA 3VR9B 3S1RH 4HCPB 4KN4C 2V9HA 4ILWA 1PGBA 3C19A 5KYIA 4LF5Q 4FF1A 1RL2A 3GTGB 1AWDA 3X0WA 1PTOB 4GNXB 4HIMA 1VQOA 3HHMA 2XVSA 1NR4A 3EVQA 3E9SA 1WGYA 4TUUA 3CMEA 2A6HD 1GG3A 4GMVA 1FCLA 1WMHA 1GUGA 1TT5B 2MA9B 4HDQA 1PFNA 5M3FH 1D1IA 4X66L 5DPSA 2QDFA 1EYDA 4B3RQ 3TN2A 4Y7NB 4K2KA 4DV6Q 4MEMA 3F2BA 1WFQA 1Z47A 3RUZA 3CSFA 2OWOA 4HJ8A 4BY7G 2WWZA 1BVSA 4KKUA 2MEKA 5TSSA 4X65L 1YHAA 2J42A 4A6QA 1X6OA 3I73A 5BMIA 4PMWA 2J7QB 1MJCA 1SROA 2R92H 4P71A 5FLMH 1WX7A 2FCNA 5LNK1 3A0JA 4FF2A 3D31A 3DVNV 1L1OA 1VQGA 2RA4A 3NVVA 3ZTCA 3GTKB 2QILA 4A3BG 3W3AA 3MVVA 1BBWA 4FVMA 3VRAB 1WXQA 4EKUA 3E6ZX 2WXFA 2UUBL 3U4VA 1EQVA 3SDZA 4CJ2C 1C0AA 1L7YA 3BVGA 1WTWA 4MIUA 2D10A 4HJKA 3CAMA 4LUVA 3AE3B 4M8MA 1KRTA 2A69C 3QQ8B 1PTOH 1BNZA 2ZM6Q 4L5SA 1ZW7A 3FILB 5K36H 1VR9A 4IJLA 1N60A 5CX3A 1OEYJ 4DFAA 1SNPA 4DXFA 1B2TA 4FP5D 5ELNA 2AYOB 2LXJA 4KD4A 3I72A 4KY7A 3PLUA 4MGZE 2N1VA 1UUPA 3W5VB 4JI4L 3W9CB 1O80A 1W6JA 2HCCA 2K04A 5C0XH 1K53A 3CF6E 5M3MB 2KVZA 2QIEB 2JXXA 4HJ7A 1T9HA 1Y56A 2L1AA 2M4NA 3C0RB 1W2BA 1S5FD 1GUWA 2FMCA 3GZNB 4WWPA 4QL5A 1QB5D 1X56A 1AW7A 3TEXA 2R93G 1KJTA 1ZE3D 1V9JA 3MP9A 1SEBD 2HJ1A 5G2NA 3M7GA 4OX9Q 1G291 4IQZA 4TQUS 3K9OB 5CHFA 1TJEA 1EY5A 3M4PA 1EYGA 2MX2A 4NJ7A 3IAM1 5C44G 2DLBA 1G6ZA 4LFCQ 3RMHA 2PTLA 4F7XA 4W9FA 4P73A 3VYTA 4HSPA 4HPLB 3A5UA 4OONA 4DPGA 3AEVA 1PH5A 2KN4A 1I4HA 2QA4A 1L0XB 3H0GG 3PUXA 2D3GA 2KD0A 2OT2A 5TR5A 4C3JH 3HKZB 4DR5Q 4A3KG 1LT6D 1R4MB 1UBIA 2RPQA 2KWDA 4Q2JA 4W9CA 2Z6KA 2Z8LA 4IPGA 4EQ5A 4ZRKA 1CUKA 1MJEA 2G9DA 4MGIE 1CSQA 4TVAB 1K8OA 4X3UA 1FNVA 3Q22A 2DY7A 2VUMG 4CKBA 4IPCA 4JGHB 1E8XA 3AEBB 3RLFA 2PCFB 3W1SA 1SE2A 4N8FA 2B76B 2JXTA 3RCZA 5LMNW 1N62A 2AQ1B 3AEGB 1I3QB 1NTGA 3K0XA 2PMVA 4F88A 4GNXA 1KQSA 4WJ3M 1EZ6A 5FLMG 1XJVA 3H7PB 2NN6H 2OCEA 3EA6A 2KWVB 4W9DA 4KGSA 3DXJC 3ZQ4A 2ZJRA 3EECA 1WGGA 1CKMA 5M5WH 4MACA 5IP9H 3T1HQ 1WTOA 4KLKA 1V81A 3NBIA 5DPRA 1GJXA 2O6VD 2BE5C 4QIWE 2L0TA 2V3PA 5CMDA 5M5YB 4LDTB 4RHSA 4JI2Q 5DNFA 2KWUB 3A1QB 1ESRA 2K28A 2IHFA 1P98A 3AE2B 2WIIB 3KYCD 1TY2A 1KLUD 3GTLB 3QB3A 1X54A 1GB4A 2CS4A 2BDOA 5FLXE 4FHKA 2O6VB 4AYBE 3OLMD 3ERQA 2CCZA 1Q1EA 4GKJL 4UAIA 5EAYA 4DUYQ 2FIDA 5EE3A 2AX5A 1YNND 4M01A 1E7VA 3QG1A 3PO0A 3HOYH 3GTQB 1WD1A 1RTNA 5KNCA 5M5XB 1SF0A 4PS8A 4K5XA 4CHTB 3ZNGC 1T0SC 2DZMA 4LF7L 1O7IA 2ZW0A 1JRPA 3K7AH 3T53B 1FNUA 2NCNA 3RN2A 4P72A 1SSNA 5DCNA 3FILA 1MHWC 4USAA 3TSSA 2ATWA 1DM0B 1C3TA 2J4XA 1QZGA 1RJTA 1KIXA 1HRJA 1YN4A 2RCNA 3EBEA 2VZKD 2F0KA 1YI2A 1L6VA 1J9OA 1TWCB 2K05A 1LQBA 1XNRL 3I3TB 2Y0SB 3NHHA 1NYRA 3SFDB 1FM0D 1SNCA 2E2DC 2NZ1D 2JA6B 3SD5A 2BKRB 3CXCA 2UXBL 1VQ8A 4RG1A 5M5YH 1LTID 4UDUC 1GOZA 4GLVB 2QKIC 3ER0A 2VNUD 2VZKB 1ET9A 3NTHA 2V4DA 2BGFA 2I46A 1TWHH 1I6HB 2PW5A 3PIOA 1XYIA 2G4DB 1JALA 2LS01 4LWCA 1LGRA 5BYSA 3ULJA 1J5EQ 4K0KL 3WIMA 5LXIB 2IO2B 5M3MG 4ZKBB 3V05A 4DV4L 4JL9A 2Q8RE 2LHDA 2X6LA 4ZRZA 3ZKJC 3R93A 1XPOA 5JJIA 5D3DA 2WQYB 4KN7C 1L0YB 4WJNA 1E8ZA 2F0DA 1EQRA 1CJEA 1N32L 3BJUA 3Q8EA 1FEHA 4DV0Q 3TMPB 5IP9G 1VQ7A 5ELBA 4C1NK 1WTPA 1R4NB 3RD4A 4DAPA 3ZJTA 4B0MA 3CCJA 3ZGZA 2JRIB 3N32A 5JJKA 2LFNA 3C1EA 4WWNA 1PUTA 3NQIA 1TTNA 4W9GA 1GAQB 3DVNU 2Q2TA 2Z1CA 4A3EH 2JA6H 1XWEA 1NCVA 2NVYB 2YYZA 5FJ8H 2JSVX 1F9PA 5GADC 2IO3B 2E5LL 2WP9B 5E4XA 3ZJYC 3AXCA 3NVYA 3CQZB 4M1UB 4LAAA 3HKZG 4XZ4A 2G5DA 3Q6BA 1F2MA 3DWQA 5IY0A 3H7PA 4BA2I 1L1OC 1XNQQ 3OIPA 3RD2A 1A63A 3AEFB 1CZPA 1F1HA 3AE1B 4N59A 1HNXQ 3BIID 2N9XA 3S9WA 1YN5A 1E2VA 4KHPL 4MM3B 1MKHA 2PI2A 1V9PA 1NUCA 2RGFA 2PNHA 2WXQA 1SE4A 3NVZA 4JVZA 1PRTD 3LX0A 3NVWA 4LCDE 5CV9A 2D0PA 4P2CB 3J7AF 3HP3A 5ELCA 4IWOA 4JI3L 1YZ6A 3J80c 3S15H 4NDXA 1LUZA 2DUDA 4BWGB 2E2HH 4IC7B 4JI6L 2K6DB 4RM8A 4IFDJ 2WXKA 2KOLA 3UGBB 2D3BA 3I7FA 1PRTB 3OMCA 4EQPA 1N34Q 4JWSC 5G5HA 3L17A 2F1MA 2J52A 4Q0FA 2L3ZA 2RSOA 5I4DA 2VQFQ 3PZDA 4GDLA 3A7AB 1WOCA 1WTRA 1XMQL 4BS9A 1QOGA 2G1EA 3I55A 1D5ZC 4QY7A 1GUTA 4IUMB 1YD8U 4KDLB 1WCMH 4A3FB 3CQZH 3LXFA 1VF5C 4GDKB 3B9JA 2VQEQ 3QHTA 4A3JB 3VR5A 4DV5Q 2D9UA 3ZXVA 1C4PA 1LACA 4CDCC 4DR6L 1BCPD 3DHIC 5KHQA 4KJOA 5JEAG 2OQ0A 2MHVA 4GN5A 2RR9A 2QDLA 4AP4C 2M00A 3VXWA 4LF6Q 1STHA 1Y1WB 2IGGA 2R3ZA 3Q69A 1P8LA 1STYA 5HG2A 3U52E 1GB1A 1TIID 4NKLA 2OTLA 5CV4A 1PQSA 3VVWB 1PYWD 2JXMB 1I94Q 2R7ZH 3KLRA 5JJLA 3D3RA 3L54A 1PDXA 2BWFA 4A3MG 2Z6KC 2WXOA 1BT0A 1MSHA 3A4RA 3NZSA 1KNAA 4XX5A 3IFDA 4HCEA 4EUTA 1GUSA 1QNKA 4NQKE 1JJCB 5C4JH 4WH4A 2A69D 1IZ6A 2Y0SG 5JZEB 3JW0X 2ASQA 5EGTA 2JA6G 1QVFA 1NDDA 4IKGA 4XT1B 2CU3A 4ZRJA 1V97A 5IYCH 3PTFC 4H2AA 2PMZB 1Y1VB 3LGJA 2MBEA 2J53A 5GAGC 2JA5H 3HOZH 1IBXB 2ICIA 4C2MH 3EFUA 1PTOC 5J3BA 2DN8A 3NTKA 1XCQL 4GNXC 4GSWA 3J81c 4G0NB 2LGIA 2RKSA 2D2QA 4A3FH 2KN5A 4JI1Q 4PNYA 1GJZA 3GTOB 4RGTA 1VCIA 1S5DD 3AB9A 3I2ZA 5G3LD 4A4IA 4A3JH 1CZWA 4K81A 2UU7A 3JYUA 4KTAA 1EL0A 4NNJB 3M3YB 1UWXA 5FLXL 3PRMB 1HZ6A 3QX1A 4C4VB 2F52A 2BH8A 3AYHB 1Z5SB 2WXGA 3QK0A 1Y1WH 4JX1C 2F0PA 1RRBA 4WWMA 4R3DA 3ZNHB 4UP9A 3H91A 1VJKA 5GXGB 4C3IB 3SEBA 4DK5A 4JBWA 5AJ3L 3QCAA 1A3UA 4MTNA 2J0MA 3KBGA 1E2ZA 2DX5B 4B3TL 1KL9A 3SXHA 2HIXA 2GBKA 2F0OA 5IP4D 5C5LA 4R8IA 2FCMA 3DBLI 2DYOA 1KAWA 4PQXA 2L0FA 1PRTF 4MM3A 3ND9A 2LGXA 3IG3A 3APDA 3P4SB 5GMVA 4O0AA 4POGA 4BBNF 2KAJA 2EZVA 3N3KB 4AIMA 2PQAB 4FXKC 4BOSC 1VQ6A 4K7WA 1C48A 3H3VH 1PH6A 3U9SA 1WJ6A 4HJAA 4ANVA 3HRDD 2M17A 2B3GA 5LL6X 2MBOA 4GU2A 2G3QB 2KUMA 5H92C 3GTOH 3TBLD 4P6VF 2DENB 3W1YA 3ZLZA 1Z9FA 3DCGA 4BVUC 2QC8A 2Z59B 3WAOA 3H6MA 1TS5A 5L37A 4DUZL 3FPPA 3UIPB 5IGEA 1YHBA 1QVGA 3KUPA 4GKKL 4XWWA 2F0NA 3RT3B 3WANA 1BUVT 2R7DA 2O2VA 4MSMB 4K7SA 1WWTA 4YTPB 2BE5D 1IGDA 4F8MA 2WYQA 1BCPF 2QF7A 4GDKA 5T8IA 3KJOA 2K5PA 4J6HA 1S4ZA 1YQ4B 4JI4Q 3PT2B 1MSGA 3WA0A 3CC7A 2AMCB 1V5OA 1WX9A 4LLGM 5IYCG 1SN8A 4I6PA 3KLWA 3ZDTA 1GVPA 1J0GA 1GM5A 3TUOA 4M00A 4XDDA 1HZ5A 1UF0A 2BBCA 1YITA 1VQNA 2F0SA 3LDZE 1I4GA 3PV1A 1FGBD 3QC8B 4GXBA 4MJSB 2F3WA 4QMGA 4DHZB 3GD7A 4A3FG 4C56C 3KUCB 3W1SC 1M4VA 1C78A 1C9OA 3WDNA 5IOCA 1EU3A 1SIFA 4YCWA 5IODA 3RYTA 3KBXA 1JWAD 4A3JG 2A5HA 3U58A 1NVID 1KDCA 3L0OA 3ZJVA 4RCNA 3HGBA 2WDRB 1QJOA 3CCLA 2N9KA 2VL6A 3QWNA 2K5NA 2MP1A 3RZDH 4K7UA 3PIPA 2F03A 4PS3A 1SJED 1H9RA 5K5PA 2ZT9C 4L5TA 4C00A 1Y1WG 4B95A 3HM3A 2ZNVC 3N6RA 3P42A 2G9HD 2K6AA 3AFPA 2LWPA 4HVBA 1V1PA 5IGFA 1JB7A 3B2FA 1DYQA 5G3LF 2Q8IB 4CDDC 2MSED 3X3MA 1YHQA 4N8X1 3N1ZC 3TIXA 2KECA 1WD0A 1KM7A 3P4QB 1N36L 1F9RA 5CHVC 2E74C 4IN3A 4M8AA 4JE3B 1Q3LA 4LJPB 2RD0A 4W9LA 1N9WA 1X3FA 4JCVE 3I8ZA 1HPCA 3S14B 4C4VA 3EFXD 1Y1VG 4L5QA 1C1YB 2N7DA 2RDFA 4NB3A 2HHHQ 3DWGC 4DQOC 4XC2A 1F2ZA 1NEKB 3FVQA 4R8NA 3QOLA 2JYOA 2RVLA 2NVXB 4HMIA 2ZVNA 4CHKA 2GA4B 1TKGA 1E1OA 3OW7A 4DV3L 3CP0A 3HOUB 1ROEA 1LTRD 4L6TB 1J7AA 4IW0A 5IKCM 1GHJA 3AE8B 2K32A 4ITKA 3ND8A 1JICA 3G7LA 2IGHA 1C8CA 2N9LA 2KDBA 2PVGC 5LLIA 4LUOA 1B44D 1F2RC 2C7MB 1K0RA 4I7ZC 3CMAA 1V8QA 4HIOA 2SOBA 3L16A 4N9F4 1LTSD 2E8GA 1JE5A 1HJPA 2PQAA 2WV6D 1ZYRC 4DXGA 4IURA 5IWAL 1MFWA 4IUQA 4DGZA 4C3IG 2IX3A 4YY3Q 2BYFA 1GPXA 4LMQD 1Z2MA 2MHJA 2IT1A 4KX6B 3TMEA 4PMCA 3ZUNA 1UE5A 2LHEA 5C4XH 5D7GA 4OO1H 3KJPA 4IUUA 1WMHB 5CV6A 1UBQA 3VUWA 1WR6E 4IPDA 3CCRA 1YJWA 4DBGA 1HNZQ 3DWMA 1KXLA 3BYYB 2GBJA 2YLMA 4DAVA 1A5RA 4LF7Q 1D3ZA 4BKTA 5CBEE 2ASBA 1QVCA 1HQMC 1UD7A 3N52A 4A90A 3RNAC 2WB1B 4NJ6A 4K5VA 1DOMA 2K39A 1K28A 3R3MA 4KK7A 2P5ZX 3CCSA 5JEAJ 3JAML 1WJUA 2IBIB 2PIAA 3Q3OC 4GOCA 3UDFA 3F2DA 1XNRQ 1YNTE 4A20A 1B9RA 3HZXA 2N7EA 4DK0A 2RSUA 3PREA 1L1OB 2SAKA 1S5BD 2V4LA 3AU5A 1F9QA 3VR6A 3VYRA 3MXGA 3Q3FA 4P1BC 1BDOA 1CKNB 2LXKA 2UXBQ 1GNUA 2L8JA 1N6ZA 2OHFA 5EJWA 2A4ZA 1WTQA 2FJ2A 2DY8A 1I50B 4ZK9B 5C6AA 1Q81C 3OSOA 1WFYA 1TT2A 2BB6A 3GS2A 3AE9B 1KD1C 3FC4A 4XDCA 4E74A 3T3OA 4WAAA 1F52A 5KGUA 3A55A 4X3TA 4IOCA 3SK6A 2FXQA 4IUVA 2ZXOA 4A3LH 1JW9D 3L9AX 2DYMA 3PRPB 5CHWA 3ZTDA 4W9IA 2H1EA 2AHOB 2KANA 2QJLA 2PKOA 1K83H 4XWTA 5IYBG 3DWPA 4LNNA 3T13A 2V4IB 4EZKA 4J8QA 3X23A 4AQYQ 2BYVE 1U4LA 2Z0EB 4C3HB 4N9PA 2CJOA 2KMCA 3HG9A 4RFBA 1MHHE 2CHXA 1TXYA 1YVCA 3S1RB 4Z9CB 2FUHB 2N9EB 3QO2A 1N32Q 1CI3M 3PCOB 2ICEC 1V86A 2G4SA 2JF5A 2IY5B 3LJ3A 1PFMA 3JC66 3DM1A 1JMCA 1VZ6A 1ACCA 1DCZA 3MZ5A 2I5LX 3Q6SA 1WXMA 2FE8A 1EYCA 2WDQB 3SFEB 1HZ9A 1AP0A 1GC6A 4NY0A 3RZWC 1STAA 1SAPA 5M3FB 4KSKC 3PRZA 3NQTA 1HR0W 2BS2B 2Z9HA 4HROA 3HOWH 5DEHA 5CTRC 1U0LA 1CSPA 2EJFC 3B1LX 2D2CC 2M9VA 5IE8A 4J6IA 1Z6HA 3U9OA 1I4XA 4IFDH 2DYBA 2SEBD 4K6DA 3M4YA 3G71A 2KKCA 1FRRA 1K8AC 5IP7H 1GKHA 3AN1A 1Q82C 2R92B 5CYUA 3DQVA 1J8CA 4XYOA 4WFN3 1YJNA 2UUAL 2NTSA 4QUFA 4KHPQ 1PTOD 2NZOA 2KVMA 1I7HA 3D0FA 2G45B 3DBSA 2Q2HA 4AUQC 2B3AA 3UINB 1UEBA 1U4MA 4WJOA 2EQSA 4WIPA 2IL8A 1YOVB 2AWOA 2FUG1 2NTTA 2YTYA 3VTWA 1PH3A 3P63A 2WXPA 2VH2A 4W9EA 2DAJA 4DNIA 4NPSA 3SGIA 4KZCA 3ZVVA 3GTPH 4JI6Q 3HOVH 3HOUG 1EIGA 1W6KA 4KJNA 4BBRH 2KENA 1FIQA 2WX0A 1B53A 4R4TA 1NBWA 1Q90A 3TQYA 3B08A 4XXEA 1RIPA 4G7ZC 3A5ZB 4OHJA 1YJJA 1WGHA 3OG5A 4OZAA 3ZRCA 3Q14C 1AZQA 4MSQB 4K2LA 1OQYA 2XGTA 2WINB 2K25A 1E9MA 4ALPA 1I6VC 4PMBA 1PFBA 3CC4A 4YSXB 1E7PB 3QA8A 1WIAA 3RUIB 4US9A 2E75C 1V2YA 2PW7A 1WJNA 1H8CA 1GO3E 1V1QA 2Y3AA 5I2XA 2CHBD 4NZLB 2MO0A 4RKBA 1SDFA 1HH2P 1QT9A 2EDGA 1WGKA 2NWGA 2INDC 2UU9L 1OXVA 4PYZA 4KHZA 1RFAA 4JG2A 1OXUA 3CD6A 1B3QA 2Q8TA 1E8YA 1CKNA 1FYCA 2MLBA 4ARCA 4ARIA 4A3PA 3VR3A 3TDQA 3DBHI 1WX8A 3GZNI 3H3VC 4RNAA 5L83A 2YV5A 2WGSA 2WB1G 5GAHC 1N5WA 3OWEB 4DHJD 1RAXA 5KNBA 2F0QA 1E6EB 4C3JB 4L23A 1ZP0B 1WTXA 2IY0B 5KEEA 4WORA 4BKGA 3OTOQ 2BTEA 4U68A 1CA5A 1K9MC 4LFBQ 1SYGA 2M19A 2DNFA 1DOIA 2JT4B 5C23A 1PH1A 3SE0A 4HAEA 3VTVA 2ES2A 1WYDA 2ZJQA 4ZYSA 4K6LA 2LVQA 1LABA 3FDTA 1QWYA 5C2TB 4HCNB 1R4MI 5A2QE 1GXDC 4LK0M 3PGZA 2KDIA 3H6NA 4GLAC 2I2YA 2MP2A 5EKIA 3S24A 1ML0D 1QQRA 2MJDA 4A3OA 1AEXA 2JEAI 1IBLL 4QCLA 3PS6A 5FLXc 5M5WB 2FINB 2PMZE 1K8GA 1KLGD 4F8CB 5BO4B 4A3CH 3ITPA 1LT5D 4OWTB 4C3HG 4X3KA 1YMHE 3SVMA 2PYKA 3I57A 2VRRB 4KZ0A 4DR7Q 4C1NI 1SLJA 1FNWA 3I4LA 4RHRA 4DKAC 2LUEA 4AWJA 2RDBC 1JOOA 1Q1OA 1PXUA 2ON8A 3WCQA 3N20C 1WR1A 1D8LA 4H02A 1PTOF 1ENFA 1IYVA 4B3TQ 1G6PA 2ZCBA 3T8MA 2ZW1A 1PH2A 4GGQA 1JWBD 3MJ5A 1D5XC 5C3EH 3JSVB 1DJRD 1HTPA 4EX5A 1PZKD 4B0EA 5M3FG 2KCTA 3FP9A 3QOJA 5AFWA 3FRPB 3NEMA 5IT9E 2LVPA 2QMTA 1SJHD 1K0SA 3URYA 4G7OC 2KFJA 3HOYB 1B70B 4ICVA 3OOCA 5EDSA 2GBNA 2LGYA 2WAQB 3ABVB 4B3SL 4HEA1 3CSTA 2R6GA 3K5LA 2CHWA 2ZNVB 1HUMA 3K7AB 3Q8FA 3DMUA 3QAQA 1J6QA 2IO0B 4LDTD 1C4QA 2R92G 4LNIA 1A3VA 2EMSA 3SK4A 2X38A 4OEMB 3CCQA 1PGAA 2ZTCA 1IKMA 4DUZQ 1KRHA 1YEZA 2ZXPA 5JHBA 2FCSA 4KY5A 1QUQA 1D4BA 3M85A 3STBC 1DOYA 4YHHQ 1SYFA 3S1QB 4JI0Q 3UE0A 2N1WA 3IRBA 3S2DB 1WRDB 4LK1C 3NS8A 3TJPA 4BFRA 3OWFA 4XYCA 2Y5PA 4YL8A 4URKA 4CJ1B 1K51A 1IBKL 4H7BA 5K36G 2K75A 2UXCL 1TWHB 3JAMi 3PZ8A 3AFQA 2L5TA 3CU7A 4UHVA 1VS0A 1ZYRD 2K5HA 4CKEA 4DV1Q 1XPUA 2FCQA 3P2BA 3KWVA 3GE8C 5C0XG 2I38A 2Z0DB 1UE7A 1TBEA 2OTJA 1ZXHA 2KLGA 4KHVA 4GZYC 3OW2A 4FHJA 4GDLB 2E6XA 1NE3A 3HOXH 2UUCL 1WH3A 3K9PB 4DR1L 5BYQA 1KOTA 1K8RB 2B2YA 2XRQD 4ME5A 2L15A 1WI0A 2JRHA 2ENBA 2LXAA 1CQFA 1I4PA 3D8GA 3P7JA 3BZKA 2BH2A 4QUCA 3U7ZA 4XTCS 3ONSA 4A3CG 1STNA 4RF1A 1XO3A 2NPTA 4KKIA 3T1YL 1EIFA 4DV2L 3VUYA 1Y8NB 2NB0A 1EFWA 1LTBD 3UDXA 1HZCA 2VW9A 4A3EB 2WX1A 5HI1A 4ME3A 1LM0A 3M95A 3IXSA 2KQ3A 4OIJA 3S1QH 1TS2A 3AB5A 5JHAA 1E10A 5DAUA 4JIOU 3S2DH 3Q3NC 4BBSH 2I1KA 2RHSB 4YTMB 1EY7A 1M1KC 1FD6A 1N36Q 5CV5A 4C3JG 1BBUA 1VQCA 1R4NI 2TMPA 1T0RC 3AV8A 3GOEA 3H94A 1MVKA 3IVFA 3PSIA 1QZEA 2MJEA 4R1JA 3MAQA 3T16A 1JQ4A 3J9CA 4HTHA 4OW0A 2B63H 3U2SC 1T0QC 3RR5A 3RNUA 1NAPA 4EQNA 1FJGQ 5HKHA 3RNBC 2MWSB 3MXPA 4NAWA 2F3IA 4HSVA 3PSEB 3WALA 2NBVB 3VRBB 2ZCCA 3T56B 3HK0A 5LMUL 2JA8H 3FPUB 2MRPA 3AU4A 4K1RB 4DV3Q 1CZGA 2KNBA 4MT5A 1H9SB 3O65B 3S15B 1BMLC 1Q8IA 2Z4IA 4XGAB 4C80A 2NN6G 1EUVB 4RMFA 4YCUA 2E2HB 1XMOL 1FRDA 2KDMA 3FAHA 2EY1A 2BDNA 1G51A 3JSVA 3NBHB 3KQ4A 1ENCA 2BW2A 4NAMA 3A9JB 4TKOB 2PVOD 4DDID 3GV3A 1IPGA 2K5DA 2N78A 3TZUA 3BINA 4YWGG 4DA2A 5IIFA 2AL3A 5IWAQ 4LNFA 1KAAA 2V0GA 2PW9A 2K50A 3KOJA 3H1UA 1TZ1A 4FYDA 1VZ8A 2FFKB 1UAPA 4LF9Q 2JPHA 4CO7A 1YBYA 3GV6A 5D2MB 1FFUA 1WCMB 1FGUA 2K1BA 5T1IA 3I9V1 4CYEA 2E2IH 3KLSX 1HTQA 5FOBB 1DXMA 4M0WA 4UP7A 2IDYA 4WQOB 4NMZA 2B2WA 2VB3X 3AEDB 2ZTEA 3QIJA 3NUCA 2JE6I 4KY6A 3ZO5B 2NVUI 3AEAB 5JXVA 2N88A 1E2WA 3HOYG 3X3NA 2JX5A 2IX1A 3J7AV 3E9IA 3I91A 1JQYD 2VY3A 5JVG3 2AKWB 3L13A 1WTVA 1DD2A 3IFWB 1MBYA 1OXSC 2R7ZB 5FR6A 2LASA 2KFKB 1L4DB 2DHZA 3HUIA 4OVZA 4NW2A 1PMRA 1N61A 5LMNQ 5A2QL 4O42A 5C4JB 3N1XC 1YJIA 2NBUA 4P1CC 3LYYA 4QAYA 2DBYA 3KDFB 4DWFA 3A8KE 4W9KA 4G50A 3RZFA 4JV5L 2EPBA 1EY8A 2KCNA 4X62L 3S2HH 2N55A 3HOZB 2JA5B 1XQQA 2O2VB 4C2MB 1EIHA 1G2TA 1UE6A 3U4ZA 1WZ3A 3HVZA 3U30A 3Q24A 4RWSC 1OTRB 3AH7A 3NWTA 1R4QB 3NK9A 4A93B 1RKNA 4HJ5A 4TSSA 3DPDA 3DOWA 1JT8A 1U5KA 4WJQA 2F4VQ 5AUIA 4FJVB 4XQJA 1RD9D 3J7A5 4AOFA 4BY1H 1II3A 2BA1A 3HIZA 3KFUA 3ULLA 3ICEA 2F0JA 3G4SA 3CC2A 3D4RA 2RMMA 3MHZA 1UGMA 5IT9L 2YU9H 1HA6A 1C7YA 5ELFA 3W1BA 2DAFA 3GTJH 4B3RL 2EYJA 4JI5Q 2XNAC 2KJHB 3ALBA 3V61A 1JOKA 1TWAB 4B9XA 4GLSC 4HMJA 2MPMA 1HE8A 4DR4L 4EZJA 4K5WA 1FMAD 3UQBA 1ICFB 1VQAA 3NENA 3UDIA 5JVH3 4L1BA 1RDPD 4DR2L 1PZID 3LWEA 1Q86C 3S1MH 3ULPA 1NYQA 1D6EC 1PYBA 4ZLTF 4A3EG 2JWZA 3EGRA 3L10B 3GQBA 2X8XX 1N33Q 5KYLA 1ZOYB 2J0JA 5FJ8G 3MHSD 4K3BA 2KA7A 3VYUA 5CV7A 2L83A 1K8MA 1D5MC 3JAME 1NR2A 1V1PB 1E7UA 1WE6A 5IN7A 3Q8DA 1H9SA 3SK5A 4YIJA 2ZPNA 4YWKA 4A93H 4ASWC 2KEEA 1CTMA 1QZHA 2K5VA 1L0WA 3R3OA 3PO3H 2B2UC 1ASYA 5JPNC 3NE5B 3M7NA 1WGRA 2GLSA 3M63B 3NBHA 3TEYA 2VB2X 3A9JA 2TSSA 1B7YB 3QJYA 3DWAA 1H4RA 2MQJA 4MNOA 1WRIA 3EUB2 4FN2A 2Z4HA 3K5OA 4UPAA 3IKJA 1HZBA 2EXZA 4E6IA 3ERSX 1XLOA 1OXTA 1X65A 2EELA 4JOIA 4ID6A 2W54A 5DM63 1YIWA 3J80E 2WU5B 2PPHA 1ZUD2 1WTHA 1C76A 3DM3A 3VTUA 1TWAH 3F2UA 1AE2A 4MHEA 4LW1A 1CKOA 5C4HA 2XRSD 4H13C 4X66Q 3J7YW 1A15A 2WXMA 4I6NB 1M94A 4HR7B 2QW7A 3TS0A 3C46A 2NS5A 3RI7C 1JWUD 1IBML 5JOBA 2EVBA 2JEBI 4OX9L 2KBNA 4MN3A 3K7UC 2NVQH 3BU2A 3QJZA 1PHJA 1QCBD 2SNMA 1QG7A 2B2YC 1HA5A 4X65Q 5E6PA 1WCMG 1N63A 1P0RA 4LJZC 5H8YE 1TWFB 3DEPA 3W1GA 1HR0L 5GAEC 2KFKA 1K3BC 2MBHA 1BR9A 1OO9B 1YNXA 2PZUA 2KVRA 1HHVA 3L0WB 2RSNA 5BYRA 3P20A 3DBRB 4IM2A 1WM3A 3RZDB 4JBMA 1RLFA 4HPPA 2UUBQ 3KDFA 4DR5L 4W9JA 4F7ZA 3ECIA 3N1YC 3VQIA 1FXTB 2QSDA 4GOPA 4DN4M 1VQ4A 1I4QA 2B29A 4QB4A 3PHWB 3RFZB 3G6EA 3SDLC 5KNDA 2HUGA 5ELOA 4OVUA 3BK2A 5ISRA 1V6EA 3MXNB 2R7ZG 2K9XA 1HCZA 1V49A 1VQHA 4HN7A 1OQRA 1JR0D 3STBD 2A68C 4ZHPA 2K01A 4YXDB 2JP1A 3MTSA 1BF4A 1RWSA 2OJRA 2A73B 4OGQC 3D6WA 1KFYB 1E24A 1Q10A 4DNTB 1E0BA 3DEOA 3UDGA 2E2JB 2LEKA 3M9BA 2LFIA 2BPSA 1CK1A 2N4FA 3CF5A 1L2FA 1MG4A 2JZ3B 1BXTA 3NELA 2BCOA 4A3DH 2KDFB 4MZ9A 3T1HL 4YSYB 2JA5G 3HOZG 1TWGB 4ZUIA 5IYDH 3ZJUA 2N49A 1LM8B 1OGWA 1TKWB 3S17H 2B2TA 3J81E 1OTCA 3TS2A 4A93G 1LTAD 1JRUA 2D3CA 3CCEA 3MFYA 3A4SC 3B6YA 1TWFH 5CBAE 4MH8A 1PDQA 5FK9C 3RULA 4A76A 4RKLA 4DAMA 4A3GH 2JU6X 2JYEA 4X64L 1MIUA 1VF7A 5BN4A 1MJDA 4P7IA 1EEFD 3TRZA 2JA9A 5CGKA 2V1CC 3K81C 3C8YA 1OEYA 1R4PB 3TCAA 1ZEQX 2JY6A 1ASZA 4PZ7A 3PVLA 3K80C 1T6BX 4A9AA 3FKIH 2RQXA 4K8JA 4N9TA 3PHXB 4M8NA 2JK8A 2N3SA 1ENAA 2B2WC 2F0WA 5C4XB 3K59A 3MEHA 4JI7L 5BMGA 2F0FA 1SE3A 2KDEB 4IZ8A 1S72A 2C60A 4LF4L 3CKIB 2E2JH 2ZVOA 2W3RA 4A3IB 3MC9A 3CCVA 2W9NA 2H88B 2KHJA 3DHHC 3RN9C 4FA6A 3E9HA 2W55A 5EBCA 2MH7A 1SNQA 4ODGA 1CFMA 1EYAA 4F1SA 1XXGA 3HKZE 3KH0A 2XSCA 1TWGH 3NZUA 3TL5A 2VS1A 4WWOA 3S2AA 3R8BA 4II3B 4IUPA 3QARA 3VDZA 1MI2A 2Z6BA 2MBBB 1EY9A 1TVXA 1ZKOA 2I07B 2AUJD 4CGYB 3I4MH 4W9HA 3UE1A 1YN3A 1QOAA 1X3GA 3J7ZC 2LUMA 4MH0E 2D62A 1NY4A 4R4CA 4ZRIA 1WI5A 1DGSA 3KLSA 4P75A 1R9TH 1F77A 4H0LC 1J5EL 2LJIA 4IG7B 4J3OD 2BQQA 4TRDA 4BXXH 2K03A 3RNEC 1S3SG 4HKZE 4ANXA 2F0TA 3A8IE 3M4OB 3NS1A 2I1JA 1AN8A 5ELDA 1JJGA 1O7YA 2IO1B 2NMQA 2KYWA 4O2DA 1K83B 1BKBA 2D0OA 2PI2E 4GKJQ 5HHDG 3WAPA 4B08A 3NOBA 3DVGX 3MC8A 4JC0A 3TZDA 3ONAB 3R2TA 1HFNA 4DV0L 5IGDA 2UUCQ 2MBQA 3D4DA 2N9PC 2CU1A 4DR1Q 1EWCA 2L9HA 3BDLA 3RLOA 4A3IH 3VDYA 1P7EA 2L0CA 3APFA 3NUHB 4ZUJA 5IYDG 4IPHA 1EWHA 3V62A 3PZ7A 4QQBX 1OFFA 2Q2UA 1X3EA 2K5WA 1WXVA 3MXNA 1S5CD 2KC1A 2QHOA 2W3SA 1KHIA 3EFCA 2XK5A 3T1YQ 2JYTA 4DK1A 5HGTA 2YEPB 2BS4B 3DHQA 2XEWA 3BDOA 1EUJA 4JBKA 4YWLA 1Q0WB 1HNWL 1J19A 2EXDA 3HOWB 3UI3A 3K5NA 1XNQL 1SMXA 2DZIA 2EYMA 1N5XA 2L32A 3P1HA 1YX6B 4ZRQA 3IAS1 1FR3A 1GD7A 2OF1A 3HRZC 4Y52H 3CPWA 2INNE 4JWUC 5D6JB 1N8RC 4X3SA 4CBVA 5J1ZA 3VR8B 3AECB 4B9WA 4C7ZA 2DJFC 1KDAA 1XPRA 4B3ML 3PF4A 4KIKB 2JZZA 2K5QA 1QOBA 3M4OH 1EQQA 3Q8BA 1YNJC 2Y0SE 2CWPA 3AE6B 2J0TD 1SE8A 3GP7A 4K0KQ 2A5UA 3J80L 1DZ1A 4YT0B 4HRSA 2R61A 2KOXA 3MTNB 3D4WA 3NXWA 3BK1A 3Q8CA 4DV4Q 2A1AA 3P1MA 1M90C 4Q5VA 2CH4A 2PNRC 1UE1A 2QEXA 3MA2B 1MG8A 3P75A 5BR8L 2XIWA 1HZAA 2IY1B 4JOIC 1N34L 3NRZA 4A55A 4I65A 2C7NB 1X9NA 1XMOQ 2VQFL 4B6WA 3O13A 3GTPB 3HOVB 3NPPA 3G48A 4BBRB 4BY7H 2FNJB 2BWES 5E3FA 2MP2B 1EOVA 2OEDA 2DZJA 5DPTA 1LTTD 2R2QA 1ZDVA 4B9KA 2ZXRA 2WNMA 4KSLC 3K0YA 4YSZB 3E0EA 3V2TA 1XD3B 1V5TA 1W3SA 2KWCA 1AYFA 4PYUA 1R7SA 1Y69U 1LTGD 1LO5D 4P16A 4DV5L 1VQMA 3A54A 3TEZA 3KW5B 4FO2A 5E6JA 4A3BH 4BXXG 1FO4A 2E5LQ 1QOFA 1EEID 2M0XA 1D7QA 4JBJA 4CQNA 3QR8A 5HY6A 5E4WC 4H44C 4DAYB 1LFDA 1B3AA 2EYFA 2PJHA 2NBWB 4FJYA 1G2SA 2AQ2B 5EBDA 3AQQA 5C4XG 3VA5A 4OO1G 4GLXA 3DHGC 5C0XI 4GN3B 3SHQA 1J7BA 3OPOA 1I94L 1ZDXA 1Y8PB 3U50C 2GBMA 5MPOA 4A3IG 4GOPC 1G91A 1P16A 1RODA 2EY5A 5L95C 1NENB 1WF9A 4JI3Q 3BYTB 4CJ0B 1C4CA 2MO1A 2PZTA 2EYPA 2EMTA 3TP5A 3WOFA 2B8FA 1QLBB 2CQAA 4KKSA 1IL2A 3J81L 4NXML 2CW0C 1G8ZD 1D1KA 1NJIC 1WSPA 2H5XA 4FLHA 3SK8A 5CR3A 2R93H 4X62Q 2GBRA 5AEKB 3MC0B 4IOAA 4IO9A 1VQEA 1QUQB 1XMQQ 3Q3JA 2X69A 3W5OA 1NNXA 2MGSA 4X6AH 2KQ7A 5ELEA 4GIVA 1UEAB 1U9RA 5C44H 1FL0A 3K57A 2B2TC 5C5MA 4A3LG 2BT6A 4OZCA 3UF8A 1QF6A 3A7LA 2HD5B 4RGOS 1QE6A 2D11A 2PQEA 3ZXRA 3NP8A 2R7FA 4DR6Q 4LNOA 1IKLA 1KH0A 3H0GH 4POFA 4YCVA 1PZJD 2KEDA 4A3KH 2L1BA 3HS0C 1O7LA 4HCSA 3BVMA 1BOSA 5IT9c 2B2VA 2XTIA 1E5WA 2BS3B 1SE9A 4DHJB 1RM6C 4V190 2C9WB 1I4RA 3PUVA 2VUMH 5CC4A 3MWYW 2NN6I 2RPVA 2GRIA 4KIKA 4DR4Q 2F0VA 2HDEA 3CIRB 1BCPC 4I6LB 3AU7A 3S1NH 1J8IA 1STBA 5C3EB 3AEEB 4DR2Q 2NYZD 4R4QA 2EE1A 4RM9A 1EY6A 1WM2A 3HVDA 3FHWA 2NPTB 2WXNA 1GUNA 4RF0A 4IM3A 3HOWG 5DLQE 4G4KA 2A68D 3TEHB 3R2IA 3SHLA 2MFIA 3K6OA 3HFZB 1E22A 1Y8RC 2C5LC 2NR2A 1CA6A 1KRSA 4P74A 4IFDG 3IBEA 3I90A 1VQBA 1VDVA 2CFMA 2RHQB 4IALA 2PEAA 5IP7G 1C79A 1KF6B 2ZPYA 3NY5A 3GB1A 1I42A 3GTMB 3EC8A 3IT6B 4IUTA 1ISNA 2HIVA 1PV4A 2F0LA 3GTGH 4II2B 4IWPA 1E90A 2OXPA 3L7ZC 4ZCKA 2VZAA 1VQ5A 3N30A 1F0ZA 1QNUA 3OJ3A 4NP5A 2EY6A 3PV0A 2B39A 2JWUA 2K8CA 4WJPA 1E0ZA 1LT4D 5HURA 4S17A 3I4OA 5EPKA 4JPBW 4NAWB 2BVCA 1MI0A 1WJJA 4FXCA 2LJ5A 3CCMA 1LTLA 2Q5WD 4Y7NH 5AUKA 3IT4B 2A8VA 1IP9A 2K33A 5AJ3Q 2A6EC 2D5DA 3M3JA 4DAYA 3HOVG 1GUAB 2GVBA 1L4ZB 2CR5A 4BBRG 5M9OA 3DBHB 4LUZA 2F0IA 3I3CA 2KT7A 3QIAA 4KDIC 4QF4A 1UZXB 5JH5C 5EQ0A 2HD3A 1TKYA 1IBMQ 1U4PA 3G6JB 2C35B 1LV9A 3A9KB 5C1ZA 2OQKA 5I9PA 2RF4A 2KCCA 1HFGA 2GOWA 2Q2IA 1P9DU 1X3PA 2ZTDA 3GTKH 3BZDB 2HJ8A 1B50A 2B8GA 3FMCA 3HOXB 2QGQA 2F0MA 3I70A 2KMAA 1SB3C 1EIYB 2D3AA 2ACZB 2JVCA 2NVTB 4U673 2LD9A 1HR0Q 2OJWA 1Q8KA 4N6EB 4EFOA 2ZJDA 4WAFA 2KHIA 2IW3A 1Y14B 4FDBA 1CMXB 1STEA 4HJGE 4DNRB 5EE1A 1KTKA 3GTMH 4XE0A 4FXGC 1EF5A 4M0WB 2KHWB 2IPKD 4NXNL 1WYGA 2K0PA 3E5SA 1ZXTA 3KVFB 3PQIA 2LMCA 4OELB 1VDZA 5LXHA 3MFGA 2NUCA 2LGDA 3T4AC 1F2RI 2B2UA 2ZZPB 2HQEA 4R4OA 4R4IA 3ML8A 1IHZA 1SYCA 4GKKQ 5E6OA 5IGGA 4OXPA 3PMFA 1EZ8A 1SIJA 2GVAA 3BVZA 1U4RA 3BWUD 1V8CA 3Q0AA 5M3MH 2WDVB 3U8ZA 4FJZA 2K6QA 1SR3A 3KF8A 4OWXB 2KX0A 5IGCA 3MJWA 4BBSB 3P4RB 3L4PA 5AZHA 2FHTA 3V6CB 1I5FA 3ZIMA 4F87A 4BKSA 2H4OA 1TZOA 2CKZB 2HHHL 2AWNA 4IOIE 3OMGA 1TS3A 3BY4B 3IL8A 1A6XA 3PGEA 2F0HA 1VMPA 2VH1A 2B63B 2GI9A 2L7RA 2F0UA 1MPEA 2REXA 4UY8C 1PYSB 1L2NA 3AULA 4JK1C 3R7RA 1A2TA 2JA8B 1ONLA 2DWQA 3MEFA 3LNNA 2NVTH 2IX0A 4J15A 5KRUA 1IW7C 3WAMA 3QWZB 4X64Q 4WQMA 4RCOA 3D6CA 3BDCA 2LRWA 1RTOA 1C77A 3J80i 5A35A 4HLEA 4YY3L 2HCIA 4GB9A 2K3UA 3DVGY 2AEHA 4EVOA 2BKFA 4MTKA 3FEWX 4DHZE 2N0SB 4JW0A 1KC8C 1XEEA 3N9YC 2YTXA 3RPFC 2KCMA 1S3OA 4G57A 3NG0A 5IAAC 2JN4A 3HM6X 1HNZL 2DZKA 1LLRD 3DUZA 3WWVA 2JQRB 1TU2B 1ICWA 1SMYC 4AJWA 3CPFA 3EN2A 1K3RA 1UWMA 2E2IB 4FULA 4IWQA 4LJOB 5EPLA 4XIGS 4JI7Q 2KX3A 2KJXA 3PUYA 5FO9B 1I3QH 5C3EG 2SNSA 1VCBA 1XTDA 1Y8OB 3VA7A 2H89B 5EKLA 4A3MB 4LF4Q 3A8JE 2WXIA 4LF8L 4L5RC 1UELA 3F1ZA 2ZJPA 3T9LA 3VHTC 3L08A 1YNJD 3I4NB 1PVOA 4XT3B 1RHPA 5I9OA 2F3VA 1IYFA 2F0EA 1TQOA 1C9FA 4HKQA 1O7ZA 1S1QB 4DR3L 2JA7B 1KNEA 1RFKA 4M02A 1PFDA 2RDHA
chains in the Genus database with same CATH topology
1TKEA 2C5CA 1C4AA 3EJIA 5EE9A 1K52A 2DNEA 1VMCA 2L52A 1JWSD 3NWSA 5CORA 2SDFA 3S2HB 1XF5L 5JEAH 3S16B 1OQQA 1BBXC 2PO4A 5LL6S 2N7JA 3MHBA 1Z7TA 1S5ED 3PUWA 4BY1B 4KKJA 1XX8A 1BUIC 1P7FA 4NJCA 1IGCA 4ZOHC 2B2VC 1VRAB 1JROA 5NUCA 4OL7A 1ZPSA 2YU9B 4R9WA 3GTJB 1ILQA 3V96A 5CV8A 2JSOA 1YQ3B 3AMUA 4WURA 2O2LD 4C7YA 3TP7A 1J7CA 1O78A 4ULLA 3S1MB 4O1NA 2EYHA 3SR6A 2CW0D 2PPBC 5LHY1 2JZPA 4N58A 2IJ0A 4LTUA 2X6GA 2KHSA 5JJZA 3RZOB 5G5GA 1DGJA 4EE2A 2J7ZA 4RGMA 4HEDA 3PO3B 3AE4B 3BWUD 5J39A 1WVLA 2O4XA 2BOSA 1QILA 3AE7B 1HTLD 1L0VB 1HQRD 1T5XD 1CQVA 4KKTA 1AZPA 2ID0A 1SYBA 4A8XC 3W2DA 3PUZA 1BO0A 1EQTA 1SNMA 4ZHOA 4PV1C 4KGRA 3ZYYX 2AQ3B 4CKCA 4ABNA 2M56B 5C3WA 1JE4A 1FXAA 1NSNS 5I6WA 3K58A 4K14A 5I6YA 2EY2A 3NSWA 1CT1D 2NVQB 4FF4A 3Q23A 2XWJB 4ZAIA 4ZRPA 4RAUC 5I2YA 4ZKCB 4J1MA 1BCPB 4XYQA 1D2BA 1F9SA 4RA8A 1ZXIA 3SR1A 3AM9A 3TBIB 5C3XA 5JPMC 2WXHA 2O5JC 5D65A 3NTIA 1JC7A 2KMMA 4RGNA 1TY0A 4EGVA 2INPE 3Q8AA 4XDXA 4WJWA 4ZQ3A 1A3TA 4XQNA 3KK7A 1KDBA 4FF3A 1XLPA 4L2YA 3ETRA 3VYSA 5EE0A 2A6ED 3W5UB 1EOTA 2HDLA 2XWBB 4A3DB 5BN5A 3PIO3 1L6UA 4US8A 1CM9A 1B9NA 2PZWA 1XTCD 3H8HA 2M0AA 3S17B 1DOKA 2A6HC 1CHQD 3LWUA 3B2GA 5IGBA 5C0XJ 4A3GB 4FXDA 1SBBB 4DU9A 1VLBA 1EY4A 2DNCA 5COYA 1H9KA 2KACA 4DF7A 1RF2D 1SYEA 1H9JA 1STGA 3FKIB 2AUKA 4TMAB 5J22A 1V1OA 1GUOA 1F2YA 1PLFA 4KI0A 5T1GA 1XLNA 4QIWB 5KIXA 5FR3A 3K5MA 2WACA 5EPJA 4V0BA 2A74C 5C3JB 3CRLC 2BB5A 1DOXA 1EM7A 2L12A 4IDIA 4AYBB 2QCPX 4KMUC 2LY7A 2WKDA 2Y5CA 2K22A 4OO1I 1HUNA 2ONQA 4REZA 1KABA 3H09A 2QEJC 4TQ0A 2K7VA 2F4IA 1TYGB 3UI2A 1RCVD 1B9MA 2EJGC 3EROA 1TS4A 1IW7D 5E1FA 3I4MB 3OHXC 2E3TA 2FMMA 2WKCA 1R9TB 1MHXA 4BA1I 5HFYA 1SYDA 3C2PA 3AE5B 3TP6A 4KGTA 1JB3A 2WU2B 1T5EA 1XLQA 1V43A 5EKKA 1SMYD 2VXWA 5DM73 2IWHA 4L63B 3VR4A 2XN9C 1UGJA 4PT5A 3PO2B 4EQOA 3BG3A 1IBXA 3T3NA 1SFOB 2LKVA 1QKZA 4AQ7A 4FNFA 1OXXK 3IFTA 3LB8C 2WLBA 5FO8B 1MGSA 1H9MA 4K8IA 3TP8A 1CHPD 2F0GA 1FCCC 2GB1A 1XCTL 1ILPA 5FKAC 1L5PA 2WP8J 2L4NA 4OZBA 1T3QA 2WS3B 4XQQA 3NZ3A 2L55A 2FBWB 1IUEA 2OEOA 4KD3A 4IFDI 3CRKC 1ESFA 2WXRA 5BN3A 3P4PB 2CJNA 4BY7B 4AS1A 2QDBA 3A56A 2EKIA 4S3SA 5FO7B 2MJ3A 2WXLA 1PGXA 1X32A 1YNNC 2WXJA 1ET6A 4A3BB 2W82A 1SNDA 3V3XA 2EYLA 5JAVA 1A2UA 2EJMA 2MUYA 1Q12A 1FFVA 3C1FA 1HEZE 5D14A 1FXIA 2MJ8A 3E56A 3BS1A 5D3IB 1DOLA 1F2LA 2EOTA 1IL8A 1JCKB 4KV6A 1MD2D 1NI3A 1B1ZA 4RH6A 1EFID 3EQLC 2O5IC 2IGDA 1UNSA 4OIKA 3U4EG 3C3LA 5F2DA 1JMLA 1AFPA 1DONA 1RYJA 3TEWA 2BA0A 1SNOA 2R93B 4JPSA 2V3NA 1BQQT 1QOHA 3E0JA 3CHBD 4WRDA 1LT3D 4L8JA 1A70A 1JOQA 5C44B 1K50A 2C9OA 3GO5A 1HXYD 3IAYA 2RDGA 2PLPA 1B4OA 3KWLA 4YTNB 1VZ7A 4IUNA 2EYOA 3H0GB 2KQ4X 2D5GA 4A3KB 5BMHA 3HEJA 2RBMA 3MXUA 1EY0A 1M8AA 1IYUA 2CVRA 3OIQA 2M2LA 1JORA 2HTME 1SXTA 2L11A 2VUMB 1FD7D 1Q1BA 3PIP3 1JWMD 1EU4A 3WOEA 4D2KA 1TR5A 3CWIA 4G7HC 3S1NB 4TQ1A 1EWYC 3VR2A 2LMCB 5C4ZA 2YEPF 1X3QA 2HDMA 1PRTC 1GHKA 3T51B 3L3OC 2E76C 1SSOA 2NBFA 3AMZA 3VR9B 4KN4C 4ILWA 1PGBA 5KYIA 4FF1A 3GTGB 1AWDA 1PTOB 2XVSA 1NR4A 3EVQA 3E9SA 2A6HD 1FCLA 1GUGA 1PFNA 1D1IA 1EYDA 3TN2A 4Y7NB 4K2KA 1Z47A 3RUZA 4KKUA 2MEKA 5TSSA 2J42A 4A6QA 3I73A 5BMIA 4PMWA 5LNK1 4FF2A 3D31A 2RA4A 3NVVA 3GTKB 2QILA 3W3AA 3MVVA 4FVMA 3VRAB 1WXQA 3E6ZX 2WXFA 1EQVA 3SDZA 4CJ2C 3BVGA 1WTWA 4MIUA 3AE3B 2A69C 1PTOH 1BNZA 3FILB 5K36H 1VR9A 1N60A 4DFAA 1SNPA 4DXFA 1B2TA 4FP5D 4KD4A 3I72A 4KY7A 1UUPA 3W5VB 3W9CB 1O80A 1W6JA 2HCCA 2K04A 5C0XH 1K53A 5M3MB 2QIEB 1Y56A 2L1AA 1S5FD 1GUWA 2FMCA 1QB5D 1AW7A 3TEXA 1ZE3D 3MP9A 1SEBD 3M7GA 1G291 4IQZA 4TQUS 1TJEA 1EY5A 3IAM1 2DLBA 1G6ZA 3RMHA 2PTLA 4F7XA 3VYTA 4HSPA 2KN4A 1I4HA 1L0XB 3PUXA 2OT2A 3HKZB 1LT6D 2KWDA 4Q2JA 2Z8LA 2G9DA 1K8OA 4X3UA 1FNVA 3Q22A 2DY7A 4CKBA 3AEBB 3RLFA 2PCFB 3W1SA 1SE2A 2B76B 2JXTA 1N62A 2AQ1B 3AEGB 1I3QB 2PMVA 4F88A 1EZ6A 2NN6H 3EA6A 4KGSA 3DXJC 3ZQ4A 4MACA 1WTOA 3NBIA 1GJXA 2BE5C 2V3PA 5CMDA 5M5YB 4RHSA 5DNFA 1ESRA 2K28A 3AE2B 2WIIB 1TY2A 1KLUD 3GTLB 3QB3A 1GB4A 2BDOA 5FLXE 3ERQA 1Q1EA 4UAIA 5EE3A 2AX5A 1YNND 3QG1A 3PO0A 3GTQB 1WD1A 1RTNA 5KNCA 5M5XB 1SF0A 4K5XA 4CHTB 2ZW0A 1JRPA 3T53B 1FNUA 1SSNA 3FILA 4USAA 3TSSA 1DM0B 2J4XA 1RJTA 2VZKD 1HRJA 1YN4A 2F0KA 1L6VA 1J9OA 1TWCB 2K05A 2Y0SB 3NHHA 1NYRA 3SFDB 1FM0D 1SNCA 2E2DC 2NZ1D 2JA6B 1LTID 4UDUC 1GOZA 2QKIC 2VNUD 2VZKB 1ET9A 3NTHA 2V4DA 2I46A 1I6HB 2PW5A 1XYIA 1JALA 2LS01 5BYSA 4ZKBB 3V05A 2Q8RE 2LHDA 2X6LA 4ZRZA 3R93A 5D3DA 2WQYB 4KN7C 1L0YB 2F0DA 1CJEA 3Q8EA 1FEHA 5ELBA 4C1NK 1WTPA 3RD4A 4DAPA 3ZJTA 4B0MA 3ZGZA 2LFNA 3C1EA 1PUTA 3NQIA 1GAQB 2Z1CA 1XWEA 1NCVA 2NVYB 2YYZA 2JSVX 1F9PA 2WP9B 5E4XA 3NVYA 3CQZB 4M1UB 4LAAA 1F2MA 3DWQA 4BA2I 3OIPA 3AEFB 1CZPA 3AE1B 4N59A 3BIID 3S9WA 1YN5A 1E2VA 4MM3B 1NUCA 2WXQA 1SE4A 3NVZA 1PRTD 3LX0A 3NVWA 5CV9A 4P2CB 3J7AF 3HP3A 5ELCA 4NDXA 4BWGB 4IFDJ 2WXKA 2KOLA 1PRTB 3OMCA 4EQPA 4JWSC 5G5HA 2F1MA 2J52A 4Q0FA 2RSOA 5I4DA 3A7AB 1WTRA 4BS9A 1QOGA 2G1EA 1D5ZC 1GUTA 4A3FB 3LXFA 1VF5C 4GDKB 3B9JA 4A3JB 3VR5A 2D9UA 1C4PA 1LACA 1BCPD 4KJOA 5JEAG 2MHVA 2M00A 1STHA 1Y1WB 2IGGA 2R3ZA 3Q69A 5HG2A 1STYA 3U52E 1GB1A 1TIID 4NKLA 5CV4A 1PYWD 2JXMB 3KLRA 3D3RA 1PDXA 2WXOA 1MSHA 1KNAA 3IFDA 4HCEA 1GUSA 1QNKA 4WH4A 2A69D 5EGTA 4IKGA 4XT1B 2CU3A 1V97A 4H2AA 2PMZB 1Y1VB 2J53A 1IBXB 2ICIA 1PTOC 2DN8A 3NTKA 1XCQL 2LGIA 2RKSA 4PNYA 3GTOB 4RGTA 1VCIA 1S5DD 3AB9A 5G3LD 1CZWA 4KTAA 1EL0A 3M3YB 1UWXA 5FLXL 1HZ6A 2WXGA 4JX1C 2F0PA 4WWMA 4R3DA 1VJKA 3H91A 5GXGB 4C3IB 3SEBA 4JBWA 1A3UA 1E2ZA 3KBGA 3SXHA 2F0OA 5C5LA 4R8IA 2DYOA 4PQXA 1PRTF 3ND9A 3P4SB 2KAJA 2EZVA 4FXKC 1C48A 3U9SA 3HRDD 5LL6X 2KUMA 5H92C 4P6VF 3H6MA 1TS5A 3FPPA 5IGEA 3KUPA 4XWWA 2F0NA 1BUVT 1WWTA 4YTPB 2BE5D 1IGDA 4F8MA 1BCPF 2QF7A 5T8IA 2K5PA 4J6HA 1S4ZA 1YQ4B 1MSGA 4LLGM 3TUOA 4XDDA 1HZ5A 2BBCA 2F0SA 1I4GA 1FGBD 2F3WA 4QMGA 3GD7A 4C56C 1M4VA 1C78A 3WDNA 5IOCA 1EU3A 5IODA 3KBXA 1JWAD 2A5HA 1NVID 1KDCA 3ZJVA 4RCNA 3HGBA 2WDRB 1QJOA 2N9KA 3QWNA 2MP1A 2F03A 1SJED 1H9RA 5K5PA 2ZT9C 3N6RA 3P42A 2G9HD 2K6AA 1V1PA 5IGFA 3B2FA 1DYQA 5G3LF 2Q8IB 3X3MA 2KECA 1WD0A 3P4QB 1F9RA 2E74C 4IN3A 4M8AA 4JE3B 1Q3LA 3I8ZA 1HPCA 3S14B 3EFXD 2RDFA 4DQOC 3DWGC 1F2ZA 1NEKB 3FVQA 4R8NA 3QOLA 2JYOA 2RVLA 2NVXB 4HMIA 2GA4B 1TKGA 3OW7A 3HOUB 1ROEA 1LTRD 4L6TB 1J7AA 1GHJA 3AE8B 2K32A 4ITKA 3ND8A 1JICA 3G7LA 2IGHA 1C8CA 2N9LA 2PVGC 1B44D 1F2RC 4I7ZC 1V8QA 2SOBA 1LTSD 2WV6D 4DXGA 1ZYRC 4IURA 4IUQA 4DGZA 4C3IG 2IX3A 1GPXA 4LMQD 2IT1A 4KX6B 3TMEA 4PMCA 2LHEA 5D7GA 4OO1H 4IUUA 5CV6A 3DWMA 3BYYB 4DAVA 5CBEE 1HQMC 3N52A 4A90A 2WB1B 4K5VA 1DOMA 4KK7A 5JEAJ 3JAML 2PIAA 1YNTE 1B9RA 3HZXA 4DK0A 2SAKA 1S5BD 1F9QA 3VR6A 3VYRA 3MXGA 1BDOA 2OHFA 5EJWA 1WTQA 2FJ2A 2DY8A 1I50B 4ZK9B 5C6AA 3GS2A 3OSOA 2BB6A 1TT2A 4XDCA 3T3OA 3AE9B 3FC4A 5KGUA 3A55A 4X3TA 3SK6A 4IUVA 1JW9D 2ZXOA 2DYMA 3L9AX 2H1EA 2QJLA 2PKOA 4XWTA 3DWPA 3T13A 2V4IB 4J8QA 1U4LA 4C3HB 4N9PA 2CJOA 3HG9A 4RFBA 1MHHE 3S1RB 4Z9CB 3QO2A 1CI3M 2ICEC 1PFMA 3DM1A 1VZ6A 1ACCA 1DCZA 3MZ5A 3Q6SA 2FE8A 2WDQB 1EYCA 3SFEB 1AP0A 1STAA 1SAPA 5M3FB 3NQTA 2BS2B 4HROA 5DEHA 2EJFC 2D2CC 2M9VA 1Z6HA 3U9OA 1I4XA 4IFDH 2SEBD 4K6DA 3M4YA 1FRRA 3AN1A 2R92B 5CYUA 4XYOA 4WFN3 2NTSA 4QUFA 1PTOD 2KVMA 1I7HA 1U4MA 4WIPA 2IL8A 2AWOA 2FUG1 2NTTA 3P63A 2WXPA 1FIQA 1EIGA 1W6KA 4KJNA 1B53A 1Q90A 4XXEA 4G7ZC 1YJJA 4OHJA 4OZAA 1AZQA 4K2LA 2WINB 1E9MA 1I6VC 4PMBA 1PFBA 4YSXB 1E7PB 4US9A 2E75C 2PW7A 2Y3AA 5I2XA 2CHBD 4NZLB 4RKBA 1SDFA 1QT9A 2EDGA 1WGKA 2NWGA 1OXVA 4KHZA 1OXUA 2Q8TA 1FYCA 4ARCA 4ARIA 3VR3A 3TDQA 3H3VC 4RNAA 1N5WA 3OWEB 5KNBA 2F0QA 1E6EB 4C3JB 4L23A 1ZP0B 1WTXA 5KEEA 4WORA 2BTEA 4U68A 1CA5A 1SYGA 2M19A 1DOIA 3SE0A 4HAEA 4ZYSA 4K6LA 1LABA 3FDTA 1QWYA 5C2TB 5A2QE 1GXDC 4LK0M 2I2YA 5EKIA 1ML0D 1QQRA 2MJDA 1AEXA 2JEAI 4QCLA 5M5WB 2FINB 1KLGD 3ITPA 1LT5D 4C3HG 4X3KA 1YMHE 3SVMA 2PYKA 4C1NI 1FNWA 3I4LA 4RHRA 1JOOA 3WCQA 1PXUA 2ON8A 1PTOF 1ENFA 1IYVA 2ZW1A 1JWBD 3MJ5A 1D5XC 1DJRD 1HTPA 1PZKD 4B0EA 3QOJA 5AFWA 3FRPB 5IT9E 2QMTA 1SJHD 3URYA 4G7OC 3HOYB 3OOCA 2WAQB 3ABVB 4HEA1 2R6GA 3K5LA 3Q8FA 1HUMA 3K7AB 3DMUA 1C4QA 1A3VA 3SK4A 2X38A 1PGAA 1IKMA 1KRHA 2ZXPA 4KY5A 1D4BA 3M85A 1DOYA 1SYFA 3S1QB 3S2DB 4LK1C 3OWFA 2Y5PA 4CJ1B 1K51A 4H7BA 5K36G 1TWHB 3PZ8A 2L5TA 3CU7A 1ZYRD 4CKEA 3KWVA 5C0XG 2I38A 1ZXHA 4KHVA 4GZYC 4GDLB 2E6XA 5BYQA 2B2YA 2XRQD 4ME5A 2ENBA 1CQFA 1I4PA 3D8GA 3P7JA 3U7ZA 4QUCA 4XTCS 1STNA 4RF1A 1XO3A 4KKIA 1Y8NB 2NB0A 1LTBD 4A3EB 5HI1A 3IXSA 2KQ3A 4OIJA 3AB5A 1TS2A 1E10A 5DAUA 4YTMB 1EY7A 1FD6A 5CV5A 4C3JG 2TMPA 3AV8A 3H94A 1MVKA 2MJEA 3MAQA 3T16A 1JQ4A 3J9CA 4HTHA 4OW0A 3U2SC 2BYTA 1NAPA 4EQNA 3MXPA 4HSVA 3VRBB 3T56B 3FPUB 1CZGA 4MT5A 1H9SB 3S15B 1BMLC 1Q8IA 2Z4IA 4C80A 2NN6G 2E2HB 2KDMA 1FRDA 3FAHA 2EY1A 2BDNA 3KQ4A 1ENCA 2BW2A 4NAMA 4TKOB 2PVOD 3GV3A 4YWGG 2K5DA 3TZUA 4DA2A 5IIFA 1KAAA 2V0GA 2PW9A 1VZ8A 4FYDA 2FFKB 1UAPA 3GV6A 1FFUA 1WCMB 2K1BA 5T1IA 3I9V1 3KLSX 5FOBB 1DXMA 4M0WA 2IDYA 4NMZA 2B2WA 2VB3X 3AEDB 3NUCA 2JE6I 4KY6A 3AEAB 5JXVA 2N88A 1E2WA 3X3NA 2JX5A 2IX1A 3J7AV 3I91A 1JQYD 5JVG3 1WTVA 1DD2A 1MBYA 1OXSC 2R7ZB 1L4DB 3HUIA 4OVZA 4NW2A 1PMRA 1N61A 5A2QL 4O42A 5C4JB 1YJIA 3LYYA 2DBYA 3A8KE 2EPBA 1EY8A 2KCNA 2N55A 3HOZB 2JA5B 3HVZA 4C2MB 1EIHA 1G2TA 3Q24A 4RWSC 3AH7A 3NWTA 1R4QB 3NK9A 4A93B 1RKNA 4TSSA 5AUIA 4XQJA 1RD9D 1II3A 2BA1A 2F0JA 3D4RA 2RMMA 3MHZA 5IT9L 1HA6A 5ELFA 2EYJA 2XNAC 1JOKA 1TWAB 4B9XA 4GLSC 4HMJA 2MPMA 4K5WA 1FMAD 5JVH3 4L1BA 1RDPD 1PZID 3LWEA 1NYQA 1D6EC 4ZLTF 3EGRA 3GQBA 1ZOYB 5KYLA 2KA7A 3VYUA 5CV7A 2L83A 1K8MA 1D5MC 3JAME 1NR2A 1V1PB 1H9SA 3SK5A 4YIJA 2KEEA 1CTMA 3R3OA 2B2UC 3M7NA 5JPNC 3NE5B 3TEYA 3NBHA 2VB2X 2TSSA 3QJYA 3DWAA 1WRIA 3EUB2 2Z4HA 3K5OA 3IKJA 2EXZA 4E6IA 1XLOA 1OXTA 2EELA 4ID6A 2W54A 5DM63 2WU5B 3J80E 1ZUD2 1C76A 3F2UA 4MHEA 5C4HA 2XRSD 4H13C 3J7YW 1A15A 2WXMA 4HR7B 3C46A 1JWUD 5JOBA 2EVBA 2JEBI 4MN3A 1QCBD 2SNMA 1QG7A 2B2YC 1HA5A 1N63A 4LJZC 5H8YE 1TWFB 3DEPA 1BR9A 1OO9B 2PZUA 1HHVA 2RSNA 5BYRA 3P20A 3RZDB 3VQIA 2QSDA 4DN4M 1I4QA 4QB4A 3RFZB 5KNDA 2HUGA 3BK2A 5ISRA 2K9XA 1HCZA 4HN7A 1OQRA 1JR0D 4ZHPA 2A68C 2K01A 4YXDB 2JP1A 3MTSA 1BF4A 1RWSA 2A73B 4OGQC 3D6WA 1KFYB 1Q10A 4DNTB 1E0BA 3DEOA 2E2JB 2LEKA 2LFIA 3I57A 1CK1A 1BXTA 2BCOA 4YSYB 1TWGB 4ZUIA 3ZJUA 1TKWB 2B2TA 3J81E 1LTAD 3MFYA 4MH8A 5CBAE 1PDQA 5FK9C 4RKLA 2JU6X 2JYEA 1VF7A 5BN4A 1EEFD 5CGKA 3C8YA 1R4PB 1ZEQX 1T6BX 4A9AA 2RQXA 4K8JA 4N9TA 1ENAA 2B2WC 2F0WA 5C4XB 3K59A 3MEHA 5BMGA 2F0FA 1SE3A 4IZ8A 3CKIB 2W3RA 4A3IB 2H88B 2W55A 5EBCA 2MH7A 1SNQA 4ODGA 1CFMA 1EYAA 1XXGA 2XSCA 3R8BA 4IUPA 1MI2A 1EY9A 1TVXA 1ZKOA 2I07B 2AUJD 4CGYB 1YN3A 1QOAA 2LUMA 2D62A 3KLSA 2LJIA 1F77A 4H0LC 4J3OD 4TRDA 2K03A 4HKZE 2F0TA 3A8IE 3M4OB 3NS1A 1AN8A 5ELDA 1O7YA 2NMQA 1K83B 5HHDG 4B08A 3TZDA 3ONAB 3R2TA 1HFNA 5IGDA 3D4DA 1EWCA 2L9HA 3BDLA 1P7EA 2L0CA 3NUHB 4ZUJA 1EWHA 3PZ7A 1OFFA 2K5WA 3MXNA 1S5CD 2W3SA 2JYTA 4DK1A 5HGTA 2YEPB 2BS4B 3DHQA 3BDOA 3HOWB 3UI3A 3K5NA 2EYMA 1N5XA 2L32A 3P1HA 4ZRQA 3IAS1 1FR3A 3HRZC 2OF1A 4JWUC 2INNE 3VR8B 4X3SA 4CBVA 5J1ZA 4C7ZA 3AECB 4B9WA 1KDAA 2K5QA 1QOBA 3Q8BA 1YNJC 3AE6B 2J0TD 3GP7A 3J80L 1DZ1A 4YT0B 4HRSA 2R61A 3D4WA 3NXWA 3BK1A 3Q8CA 3P1MA 4Q5VA 2PNRC 3MA2B 3P75A 2XIWA 3NRZA 4A55A 4I65A 3O13A 3GTPB 3HOVB 3NPPA 2OEDA 4BBRB 5E3FA 1LTTD 1ZDVA 2ZXRA 2WNMA 3K0YA 4YSZB 3V2TA 1AYFA 1R7SA 1Y69U 1LTGD 1LO5D 4P16A 3A54A 3TEZA 4FO2A 5E6JA 1FO4A 1QOFA 1EEID 4CQNA 5E4WC 4H44C 1B3AA 2EYFA 1G2SA 2AQ2B 5EBDA 3VA5A 4OO1G 5C0XI 1J7BA 3OPOA 1ZDXA 1Y8PB 5MPOA 1G91A 1RODA 2EY5A 1NENB 3BYTB 4CJ0B 1C4CA 2PZTA 2EYPA 3TP5A 3WOFA 2B8FA 1QLBB 2CQAA 4KKSA 3J81L 2CW0C 1G8ZD 1D1KA 1WSPA 3SK8A 5CR3A 3MC0B 2X69A 2MGSA 5ELEA 1UEAB 1U9RA 3K57A 2BT6A 2B2TC 5C5MA 4OZCA 1QF6A 3A7LA 4RGOS 1QE6A 2PQEA 3NP8A 1IKLA 1KH0A 1PZJD 2KEDA 2L1BA 3HS0C 1O7LA 4HCSA 3BVMA 1BOSA 2B2VA 2BS3B 1RM6C 4V190 1I4RA 3PUVA 5CC4A 3MWYW 2NN6I 2RPVA 2GRIA 2F0VA 2HDEA 3CIRB 1BCPC 3AU7A 1J8IA 1STBA 5C3EB 3AEEB 2NYZD 2EE1A 1EY6A 3HVDA 2WXNA 1GUNA 4RF0A 4G4KA 2A68D 3R2IA 3SHLA 3K6OA 1CA6A 4IFDG 3I90A 1VDVA 4IALA 1C79A 1KF6B 3GB1A 3GTMB 3IT6B 4IUTA 2F0LA 2OXPA 3L7ZC 1F0ZA 1QNUA 4NP5A 2EY6A 3PV0A 2B39A 2JWUA 1E0ZA 1LT4D 5HURA 5EPKA 4NAWB 1MI0A 4FXCA 2Q5WD 5AUKA 3IT4B 2K33A 2A6EC 2D5DA 4DAYA 1L4ZB 5M9OA 2F0IA 3I3CA 3QIAA 4QF4A 5EQ0A 1TKYA 1U4PA 3G6JB 1LV9A 5I9PA 2KCCA 1HFGA 1X3PA 3BZDB 1B50A 2B8GA 3FMCA 3HOXB 2F0MA 3I70A 1SB3C 2ACZB 2NVTB 4U673 4N6EB 4WAFA 2IW3A 1STEA 4HJGE 4DNRB 5EE1A 1KTKA 4XE0A 4FXGC 2IPKD 1WYGA 2K0PA 3E5SA 1ZXTA 2LMCA 1VDZA 3MFGA 2NUCA 3T4AC 1F2RI 2B2UA 2HQEA 1IHZA 1SYCA 5IGGA 1EZ8A 3PMFA 1SIJA 3BVZA 1U4RA 1V8CA 3Q0AA 2WDVB 3KF8A 5IGCA 3P4RB 4BBSB 3L4PA 2FHTA 4F87A 2H4OA 1TZOA 2AWNA 4IOIE 3OMGA 1TS3A 3IL8A 1A6XA