1SE3A

Staphylococcal enterotoxin b complexed with gm3 trisaccharide
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
239
structure length
239
Chain Sequence
ESQPDPKPDELHKSSKFTGLMENMKVLYDDNHVSAINVKSIDQFLYFDLIYSIKDTKLGNYDNVRVEFKNKDLADKYKDKYVDVFGANYYYQCYFSKKTNDINSHQTDKRKTCMYGGVTEHNGNQLDKYRSITVRVFEDGKNLLSFDVQTNKKKVTAQELDYLTRHYLVKNKKLYEFNNSPYETGYIKFIENENSFWYDMMPAPGDKFDQSKYLMMYNDNKMVDSKDVKIEVYLTTKKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords STAPHYLOCOCCAL ENTEROTOXIN B
publication title Residues defining V beta specificity in staphylococcal enterotoxins.
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Toxin
total genus 69
structure length 239
sequence length 239
ec nomenclature
pdb deposition date 1996-10-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01123 Stap_Strp_toxin Staphylococcal/Streptococcal toxin, OB-fold domain
A PF02876 Stap_Strp_tox_C Staphylococcal/Streptococcal toxin, beta-grasp domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.110 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1se3A01
3.10.20.120 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1se3A02
1UUPA 1TS3A 1EFID 1V1OA 3W2DA 3R8BA 1AN8A 4NZLB 1D6EC 1RF2D 1FNVA 1I4HA 1EWCA 1LO5D 1TS4A 1V1PA 1DJRD 1PRTB 1PZJD 3GP7A 1SJHD 1PTOC 4TSSA 1I4XA 1L0XB 3R2TA 2O2LD 2TSSA 2SEBD 1BCPF 4RFBA 3V05A 4ZYSA 3EA6A 1LTGD 2NTTA 5ELBA 4C56C 1LLRD 1ENFA 1LTSD 3KLSX 4L63B 1BCPC 3OWEB 4RCOA 1M4VA 1I4PA 1PZID 2WV6D 1TS5A 1PTOH 4RGNA 1HQRD 3BVGA 1JWMD 1LT4D 1SBBB 1S5ED 2XRSD 1JWUD 1LTAD 1GOZA 1LT3D 1D5ZC 2IJ0A 5D3IB 1SJED 1PTOD 1YN5A 1SE4A 3BVMA 5I4DA 4RGMA 1FNWA 1PZKD 3BYYB 3CHBD 5ELEA 1SEBD 1S5CD 1LTRD 2XNAC 1BCPD 4K6LA 4O1NA 1ESFA 1ET9A 4DXGA 1F77A 1CK1A 1DYQA 4RH6A 1PRTF 4RHRA 1RD9D 2NTSA 1I4RA 2ICIA 1YN3A 1I4QA 1LTID 1KLGD 2J4XA 5FK9C 1SE2A 1B1ZA 1B44D 2XRQD 1PTOB 1MD2D 1I4GA 2AQ2B 3EFXD 4BWGB 2AQ1B 1SE3A 3URYA 3BVZA 1QILA 1JWSD 1T5XD 1BCPB 2RDGA 5D3DA 1LTTD 1JR0D 1CQVA 2RDHA 1SXTA 1AW7A 3BZDB 1PRTD 1BXTA 1YN4A 1EU3A 3MC0B 1G8ZD 1TY0A 1XTCD 1XXGA 5FKAC 3SEBA 1PRTC 2QILA 1S5FD 1JQYD 5ELCA 1D5MC 1CT1D 4UDUC 1EU4A 5ELFA 1CHPD 3MFGA 1LTBD 4L6TB 1UNSA 3DWQA 2Z8LA 2QEJC 1HXYD 1S5BD 1TY2A 3BYTB 1PTOF 1FNUA 1KTKA 4Z9CB 4DXFA 1CHQD 3O13A 1V1PB 2IPKD 1FGBD 3DWPA 2CHBD 2G9HD 4RGTA 1TS2A 1HA5A 1JCKB 4OHJA 5ELDA 2AQ3B 3R2IA 3TSSA 1EEFD 1L0YB 1HTLD 1RDPD 1LT5D 2XN9C 1PYWD 3DWAA 1LT6D 1FD7D 1D5XC 1EEID 1KLUD 1S5DD 1STEA 4RHSA 1RCVD 4RGOS 2R61A 5TSSA 1ET6A
chains in the Genus database with same CATH superfamily
1E9MA 3ZTCA 1S40A 2INNE 1AN8A 2F3IA 3WDNA 1WX9A 2L4NA 1H9JA 2PE9A 1I4HA 3I7FA 3NBHA 5DM73 2C5LC 2UUCQ 1R4NB 4A3KH 1GO3E 1V80A 3MEFA 4B3RL 3CSTA 2Y5PA 5E3FA 3S2DH 2O2LD 3E0EA 3I55A 1H9KA 4LF9L 1N61A 2WXRA 4ZRPA 4CYEA 4EE2A 4JPSA 1P3QU 1GUTA 1PHJA 1TVXA 1WOCA 3D4RA 1VQ6A 4G7OC 4YCVA 5EJWA 4X62L 1B2TA 2PMZE 4JX1C 1ENAA 3GD7A 4PZ6A 1P1AA 3E3XA 2WINB 2AL6A 2F4VQ 2E8GA 2XRSD 1H95A 1WXSA 1RTNA 2MJ3A 3OSOA 2R7ZB 3N30A 2F0VA 3PMFA 1R7SA 3NBIA 2IJ0A 4DV4L 2Z0EB 3NY5A 4M00A 3M4OB 3K5LA 1C76A 4DU9A 3I8ZA 4CKEA 3PLVA 3CCLA 2NVXB 2YU9B 3OIPA 4X64Q 2DX5B 1SDFA 2EYPA 2PO4A 3MJWA 1UE5A 4RWSC 1IGDA 3K8AA 3JAMc 1QZHA 1D3ZA 2EYLA 4OGQC 1F77A 2RBMA 3W1GA 4DXGA 4P74A 5M5YH 1C4CA 1UD7A 2LVOA 3RN9C 2CFMA 2KN5A 2BPSA 2BB5A 4A75A 2H4OA 3CCEA 2C9OA 3M4PA 1T9HA 5CV6A 3PVLA 1GUOA 4IN3A 3KLSA 4FP5D 4JI1Q 4Q2JA 2DYBA 4XYCA 2B76B 5LMNW 1V5TA 4TQUS 5KGUA 2R2QA 2N1WA 1I6VC 2CQAA 5C4XG 4IUMB 3RZFA 1JR0D 4BOZB 2LHEA 3PO3B 2F0TA 4WWOA 4PZ8A 2J42A 2CHZA 4YHHL 1J5EQ 1K52A 2P5ZX 3H3VI 1VJKA 2MHJA 4I6PA 5C23A 1Q3LA 5FKAC 3DEPA 4AP4C 1EQVA 3Q6SA 1UAPA 2LD9A 2M2LA 5LMUL 4GDLB 2DYOA 1GKHA 4L6TB 2N9EB 2JRHA 1UNSA 3X0WA 3HOVG 4KTAA 3WANA 3J81i 2HTHA 1I94L 1XLQA 2AX5A 2FAZA 1PTOF 1ZEQX 1FJGL 1MFWA 2AYOB 4M01A 3ZXVA 1STYA 5AFWA 3EFCA 5FLXE 1QVFA 2NN6I 2RMMA 2PNHA 2LSSA 3P20A 1V1PB 3I9V1 1EF5A 2G9HD 2Y5CA 1EOVA 2HIXA 1JB7A 3OMGA 3NUHB 5IODA 1FIQA 3HK0A 4I7ZC 3PPAA 5D14A 3NZUA 3GTOH 1GUAB 3J7ZC 1UWXA 1Y8OB 2GOWA 3ML8A 1LABA 4K81A 4IFDJ 1PYWD 2VH1A 3NS1A 1AE2A 1A63A 4B0EA 3B2GA 4ZHOA 4GGQA 5JJIA 4XIGS 4A3JH 3AEDB 1SN8A 2O6VD 3ENEA 3IXSA 5IWAL 4OX9Q 4M0WA 1SYBA 2VXWA 2KLCA 4GKKL 3X3NA 2Z6BA 2XIWA 2BS3B 3P2BA 4JWSC 2NPTB 3C1EA 2VNUD 2K1BA 3ZKJC 3T3NA 4DA2A 2JA7G 4HPPA 4H44C 4C3HB 1P0RA 4A3DH 2EXDA 4LF8Q 2D3AA 4MEMA 3CQZH 4P6VF 5KEEA 4MJSA 2I2YA 4PK1A 4GNXB 4GDKA 1T0RC 5FR6A 3U8ZA 1K8OA 1JJGA 1X3PA 2KHIA 1RAXA 2K5DA 3UF8A 1E1OA 3Q6BA 2OWOA 5IGDA 3A8JE 3BVGA 1K73C 1S5ED 5DCNA 3APDA 3CIRB 2MW5A 1XNRQ 3W9CB 2PZWA 2PZUA 1NYRA 4DR6Q 1T0YA 4L8JA 3AE1B 1JWAD 1IKMA 3I3CA 2D0PA 4F8CB 3ZO5B 1WH3A 2NR2A 1NENB 5JJLA 3LX0A 3PREA 4EQNA 4C2MB 1L0VB 4A3BH 1MG4A 3UQAA 3K0XA 1VRAB 4A3IB 4LNNA 2WAQG 3M4YA 4ICUA 2BTEA 5C4JH 2UXDQ 3DWMA 1S4ZA 3ZYYX 3E56A 3KJPA 3Q8BA 3VRBB 1TXYA 4FXGC 2NTSA 1YJJA 2ICIA 4K6DA 4WIPA 4BFRA 2GB1A 4BOSC 4JVZA 1X3GA 2BF8B 1CSPA 3RD2A 3NWSA 5BN5A 1G91A 3H0GH 1RFKA 1SE3A 1KXLA 2HD5B 1HRJA 4A9AA 2ES2A 1TR5A 3WCQA 4FHKA 1STGA 3D8GA 4KKUA 1LTTD 5E4XA 3GTGH 4DXAB 2ON8A 3QWZB 4KDIC 1IBLQ 3UDIA 4XQQA 4C3IB 4WFN3 2B2VC 3U4EG 1K53A 2BKRB 2WXNA 5JJZA 1CQFA 4YSZB 3NVZA 1KLVA 1TYGB 3JC66 4PNYA 2CH4W 3FKIB 2KWCA 2MX2A 2WXIA 5IO9A 2GI9A 4CQNA 2JY6A 1E8YA 3LB8C 3VYUA 1E6EB 4K3BA 2KD0A 5C5LA 4ARIA 2IT1A 2IY1B 4ODGA 1VLBA 3Q14C 2G9DA 1K51A 3FKYA 2W9NA 2JEAI 2GBRA 2HQLA 5CV7A 2B8GA 2JVCA 1P16A 2N49A 5LMNL 4IJHA 4JI2Q 4I6LB 5GXGB 1F2ZA 3LXFA 1U4MA 4GOPC 1KC8C 2UUCL 4B0MA 3VYRA 2NVTB 3TP5A 2B2UC 4E6IA 3PO2B 1JCKB 3FHWA 4JBJA 4ME3A 1QCBD 2E2IH 3R3OA 3K5NA 2K8HA 4JI8Q 1J7BA 3Q3JA 3B0AA 2HE7A 1G51A 2F0SA 4JW0A 1OTRB 2LXJA 2LJIA 2F4VL 2KQ7A 2RDBC 3Q24A 2L11A 3HOXB 1W3SA 1O7YA 2R7ZH 3AU7A 1IYJB 4B9XA 1ZE3D 1TS3A 3IT4B 5K36G 3TEHB 3IFWB 4DHJB 3VR4A 3M4OH 3H8HA 4KJOA 4MHEA 3KBGA 1MJDA 3B6YA 2NVXH 2YU9H 3GP7A 3W5VB 1QKZA 2MWSB 2X38A 4X64L 1HUNA 2GLSA 4W9JA 2A73B 2KHWB 3A7LA 2NUCA 3NZ3A 4C56C 2QSDA 1ZDVA 1PLFA 1PFSA 2ID0A 2B2VA 1A8VA 3OWEB 4X66Q 3KQ4A 5L95C 1OXVA 4HPMB 3A9KA 1HZAA 4OO1H 3CKIB 4LFBQ 1T6BX 1D1IA 1JWMD 3V96A 1E5WA 3SK4A 5HKHA 5JZEB 3PRPB 1O7ZA 4JI1L 1SB3C 2D11A 1GD7A 1A3UA 5LNK1 2LRWA 1PYSB 2BQQA 4BY1B 2KQ4X 1XNQQ 2MBEA 5COYA 1F2MA 1OQQA 1SMXA 3NENA 1PZKD 3BYYB 3CHBD 3PHXB 5CX3A 3DHQA 5JEAJ 1ZXTA 1WX7A 3PO3H 4AQYQ 2ZPYA 1XO3A 4YCWA 2D5GA 2CKZB 2PCFB 4K6LA 2XSCA 4IWOA 2K8CA 4CDCC 1OGWA 4K14A 4GOPA 4A3MB 2D3CA 1J5EL 1TQOA 1D7QA 5CBAE 5NUCA 2C7HA 4A3GB 2B2UA 2KUMA 4ZQ3A 3G4SA 3K58A 1FMAD 2XRQD 1PTOB 1MD2D 3NK9A 1FPYA 1KABA 3FVQA 4HIOA 3WAOA 3H15A 4N8FA 1IBXA 2ZXRA 2WNMA 4BY7B 4KN7C 1AP0A 2LASA 3VR2A 2K5PA 5CHFA 3NP8A 4IM2A 1SXTA 2NZOA 1EWIA 3TREA 1RTOA 4DHZB 1YX6B 4L5TA 3AFPA 4IOCA 1VD2A 2O6VA 3RNCC 4KKSA 2NBVB 2A6HC 3H3VH 3DCGA 4DAYA 3SEBA 3A5UA 1XXGA 4RMAA 1UWMA 3U9SA 2JJQA 1SYDA 4DUZQ 2DUDA 3JAMi 2R7ZG 3HOZB 4H02A 4X3UA 1VR9A 2O2VB 2YEPF 3MA2B 4RM9A 5AJ3Q 1CJEA 4OX9L 1JWBD 4DV6Q 4HCPB 3T4AC 2V3PA 2DJGC 4WRDA 1Q81C 3K0YA 1GXDC 4EVOA 3P4SB 5BN4A 4C3HH 3VR8B 1WYWB 1XPRA 2MNAA 2PYKA 2I46A 3EBEA 4LF8L 4II3B 4HIDA 2HTME 2GBMA 3ZJVA 4X6AH 4LNFA 4ILWA 4BA1I 2PQEA 3DVNU 1VQDA 4DAVA 3AM9A 3DWAA 4DK3C 2EMSA 4DGZA 3D6CA 1QOAA 3D6WA 4V190 1N33Q 2WACA 2L8JA 1SSNA 4BVUC 4BA2I 4D2KA 4EKUA 3MJ5A 3KWLA 1XNRL 3I4OA 4BXXH 2CCZA 4DR6L 2GBKA 3DBRI 2W3RA 2V4IB 1C78A 1RFAA 3NVWA 4FA6A 3MEHA 3CCJA 1AZPA 3PO3G 1V97A 3KF8A 4C2MH 1K50A 5G2NA 2F0EA 4A3IH 4UP8A 4H13C 4DV2Q 1OEYJ 3RZWC 1I35A 4KI0A 4DF7A 4K8JA 4DR1Q 3S15H 3DBSA 2SEBD 3V05A 5GADC 1Q46A 1QUQA 2UXDL 2NTTA 1T0QC 4C1NK 2OJRA 1IYFA 1I3QB 4W9IA 4DR4Q 1TIFA 4NXMQ 2IW3A 4WJNA 4U68A 1EUVB 4DR2Q 1F9JA 4WQOB 1YHQA 3CCSA 2CW0D 1XLOA 4QUFA 1B4OA 1TS5A 4ZK9B 3GTPB 1HCZA 5F2DA 2PW9A 4FBJB 4MACA 5H92C 2Y0SE 5L83A 1CM9A 3TRZA 2ZJRA 2NZ1D 2FIDA 3CCMA 2QA4A 1Q8KA 2Y5BB 4Q0FA 1N32Q 2KKCA 3RI7C 1PA6A 2Q8IB 3T9LA 1BBUA 1K28A 2AL3A 3SHQA 3TDQA 2K50A 1IBLL 1ZW7A 4C3IH 1AZQA 1B9MA 5GQOA 1FGUA 1LTRD 4NPSA 3S14B 1BCPD 4IALA 1UBIA 2BOSA 4JL9A 1AWDA 4KK7A 2NZHA 1JORA 3F2DA 4B9WA 2NVQH 5J3BA 3GV3A 3GTKH 2LVPA 4ANXA 3W3AA 4RHRA 4RH6A 4EUTA 3FKIH 2PVGC 3PLUA 2VRRB 3P4PB 5IGBA 2RF4A 2RHQB 4LWCA 2WXQA 1U4LA 3GS2A 1CA5A 3SK5A 2BH2A 2JXXA 2XTIA 5KNCA 4EZJA 3E0JA 2E5LQ 1DM0B 3K81C 3DQVA 4KV2A 3ZJTA 1JMCA 1N60A 3CCQA 1T5XD 1VCBA 5D6JB 2XWJB 2MLBA 1CKMA 2R6GA 2VW9A 4JI2L 3HOVB 1F1HA 5ELOA 2DAJA 1C79A 2E75C 3PO2H 3SFEB 1TZOA 2ZM6Q 2WXKA 3BZDB 1L5PA 2E3TA 2LJ5A 5IOIA 2KLGA 2EYMA 5EQ0A 2PI2E 1DGSA 1Z9FA 2BE5C 2DGYA 4YTPB 3W5UB 2FNJB 4TRDA 1YX5B 1XD3B 1G6ZA 2WB1E 5D65A 4GIVA 1KIXA 2V4DA 4LUOA 5KIXA 4ACFA 3CC2A 1J7CA 2X8XX 1GNUA 4BXXG 4KSLC 4AH6A 2LGIA 2GMIC 2F0JA 3X23A 5J17A 3ZDTA 3PV1A 1MSGA 3ULLA 4B08A 3BG3A 4UHVA 2PPBC 3AE7B 1S3SG 4YSYB 2IX0A 5LXHA 1TWGB 2ZNVC 5KYIA 4JE3B 3Q8AA 4HMIA 4ZRZA 3S2HB 1OXUA 4FYDA 4W9DA 4RF1A 2NS5A 4GKJQ 3HM3A 3N32A 4JCVE 2EZVA 1WGHA 4DK0A 4NDXA 2KVZA 4O0AA 3B08A 2LI5A 4KHZA 5G3LD 3IAS1 3A9JA 3V6CB 1DCZA 2NVYB 3AEEB 2ALYB 2ACZB 1XMQQ 2WLBA 3ZLZA 1EEID 3LDZE 4LFBL 5FR3A 2ENBA 5C3XA 3PIOA 4K0KL 3KYDD 3QARA 4P7IA 3D3RA 3R93A 3UI3A 1L1OB 4XQNA 1UUPA 1E1TA 3NWTA 4K2KA 3OG5A 2RD0A 2Q2TA 1D6EC 4C3IG 3UDFA 4A76A 3RN2A 1VQNA 1XNQL 4XC2A 2PW7A 2A4ZA 3A1QB 1WXVA 2D9UA 4AYBE 2D2QA 3SHLA 1ZPSA 2PI2A 3DXJC 4AQYL 2R2OA 3P75A 3FKIG 4MH0E 1SIJA 2UU7A 3VHTC 4XX5A 4HCEA 4FN2A 2WXLA 4A3MH 4IPHA 1P7FA 4O2DA 2WAQB 1WCMG 1ML0D 2K75A 4LUVA 4A3GH 1YIWA 2K04A 4CKBA 3UIOB 4ZKBB 3AEGB 1GM5A 1PTOH 4PMWA 1KOTA 1K0SA 1V5OA 4LNOA 1TWCB 3L7ZC 3DEOA 3PUXA 4N9TA 5I6WA 4BY7H 3CAMA 3EROA 1YJIA 3L13A 1SYGA 1ASYA 4EQ5A 4KHVA 5J2RA 2N7EA 2N9KA 1TT2A 4XDXA 3RLFA 1II3A 2K32A 1Q82C 2KZRA 1YNNC 2A5HA 2WKCA 4JI0Q 1WM3A 2EKEC 2KFKA 3DWGC 3WAPA 2OQ0A 1E2VA 4JV5Q 2KNBA 3AE4B 3Q8CA 1WGRA 3Q0AA 2YEPB 5I9OA 1WYDA 3I91A 1XLPA 2DJFC 1I4QA 5GMVA 5C4ZA 1NBFC 2EVBA 4PS8A 3HOXG 3L0OA 1UE7A 3HOZH 3EFXD 3NSWA 2EOTA 1DD2A 3PUVA 3UE1A 3Q69A 5AJ3L 2CU1A 2KN4A 2R7FA 3STBD 1MJEA 4DV6L 4P72A 4R8NA 3P1MA 1WZ0A 1J19A 1VQBA 4L5QA 1ONLA 1RYJA 2KDIA 4R3DA 1L2NA 2GBJA 2LFIA 3GDEA 4NNJB 3FILB 2RSUA 4KIKA 1A0IA 3CCUA 2L0CA 1LYLA 3CRKC 1ILPA 3RNFC 3RD4A 3N1YC 5I2YA 1BOSA 5EBDA 3PO0A 1MIUA 4MJSB 1HFGA 3D0FA 2QC8A 2R3ZA 5IP9G 1GJZA 1TY0A 3WALA 2K8BA 2F4IA 5IYDH 1BQQT 4K5VA 1N33L 1KDCA 1LXDA 1U9RA 5IA7A 1C1YB 5MPOA 3J7AF 1KM7A 1P8LA 5GAHC 1A15A 1J6QA 4BY1G 1UH6A 2L9HA 4OIJA 4F7XA 1WFYA 2L0TA 2JX5A 4IURA 5C3EB 2CQOA 1U0LA 2F3WA 3GTQB 1QOBA 2GRIA 4DK5A 2AEHA 2CJOA 5CV8A 2JWUA 2LMCA 2M8SA 1ACCA 2QW7A 4FJYA 4P16A 3BK1A 1SR3A 1EZ6A 4DV2L 2IPKD 2XGTA 1RIPA 4B3ML 4DR1L 1TKYA 1K0RA 3HKZG 4OHJA 1EQRA 3EVQA 1I3QH 1XQQA 4DR4L 2AQ3B 5C0XJ 3H1UA 1X54A 1QNKA 4NXML 1RDPD 3ZRCA 2MBOA 3NHHA 4LCDE 4DR2L 4GB9A 1NR2A 1D5XC 4POFA 4MNOA 3PIPA 3GTPH 1S5DD 4XWWA 1WWTA 1L6UA 4BY7G 2I1KA 5TSSA 1RL2A 2EY5A 2KC1A 3KF6A 3J80i 3MAQA 3U2SC 4LK0M 4ITKA 2D62A 1N32L 1Q1OA 2QCPX 4MGKE 4GSWA 4X65Q 2KVRA 4JGHB 5BMHA 4A3EG 4J8QA 4PYZA 5AUKA 1V9PA 1SJHD 3S14H 1KH0A 2MJDA 3AE3B 4RFBA 3CWIA 5C4XH 4DR5Q 2SDFA 1E0ZA 1MHHE 4NQLB 2KMAA 2BS2B 4GU2A 2HQEA 2J0MA 3S1QB 4IM3A 1EY7A 3RPFC 1N9WA 2A5UA 5HURA 2EKIA 1HQRD 1HHVA 4R9WA 2E5LL 2ATWA 2V3NA 4F1SA 1MKHA 1ZUD2 2Z4IA 3TMPB 3K59A 3CMAA 1UE1A 2LXKA 5D3IB 2IX1A 5IOCA 2PE6B 4KGSA 1A5RA 4KZ0A 3BVMA 4II2B 3WIMA 1ZKHA 3HOVH 5JAVA 2YV5A 4NAWB 2QCZA 4ZRQA 1YVCA 5ISRA 2WX0A 4XXEA 1YIJA 1PH1A 1TTNA 1EIHA 5HGTA 1YQ4B 4KDLB 2LXCA 5IP7G 2ZM6L 1SNDA 5DPTA 1PRTF 5IYDG 5EDSA 3L17A 3PZ7A 4N58A 1ZYRD 2MO0A 2BT6A 4OZAA 2EMTA 2L0FA 2F0MA 1A3TA 1ICFB 4K2LA 1L6VA 1QLBB 4H0LC 4NXNQ 4HRSA 1HR0Q 1PUTA 4JI6Q 4I65A 4G4KA 5DPWA 1PFMA 3VTVA 5HG2A 3S2HH 3STBC 5T1IA 4YXDB 1GUNA 2DBYA 3ZQ4A 1SF0A 2K6QA 4XT1B 2AUKA 1MI2A 1VMPA 4MIUA 4GKJL 1AYFA 3TEXA 1WTQA 2XEWA 3PSEB 4FF3A 2Z6KC 2JA7H 3K7AB 4G0NB 4FLHA 3V3XA 3G48A 4OXPA 2NVYH 1G8ZD 1O7LA 4LF7L 2VZAA 3QIJA 1WJJA 1DONA 1I6HH 1H9SB 2B2YC 1XMQL 3CPFA 4LF5Q 1VZ6A 1MGSA 4K3CA 4TQ1A 4W9KA 5C3JB 4AJWA 1BR9A 3JSVB 1LQBA 2FUG1 5IGCA 4FO2A 4MTNA 4CDFC 1J8IA 4IUPA 4JK1C 4N59A 1LM8B 2FHTA 2QEJC 3ERQA 3J81j 2L32A 1X65A 4KGRA 3KH0A 5KHQA 1WMHB 5GROA 2HCIA 2JYOA 1YMHE 3ICEA 4OWTB 2A19A 1V8CA 3FRPB 4ZAIA 1X1MA 3RLOA 1V2YA 2HCCA 2A8VA 2KWVB 3A54A 1TS2A 2I07B 2WP8J 2DZMA 3VR6A 2B63G 2MBBB 2AWNA 3G6JB 3MXNB 1JE5A 2KDFB 4A3LH 4NP5A 1VQ7A 5BYRA 4IFDH 1A2TA 1X6OA 4WWPA 1PMRA 2IL8A 3CP0A 1KD1C 4USAA 2J7ZA 1V43A 3DLLA 2VL6A 4KSKC 4M02A 3DBLI 1KFYB 2PJHA 5JPMC 3Q23A 4WJ4A 2BDNA 1TWCH 1VQGA 4KN4C 2R61A 3SR6A 1VDVA 2F0DA 4R1JA 3AFQA 1KQSA 3W2DA 2IWHA 1F9RA 1FVIA 1UEAB 3QHTA 4DAMA 3TBIB 3DDCB 3OLMD 3PQIA 1TS4A 1DOXA 1O7IA 2B3AA 1PGBA 1J8CA 3RLNA 2QGQA 2KCMA 1VQ9A 2WFWA 3S17B 4GN4B 4JI0L 2W55A 2Y3AA 3R2TA 3OMCA 1CZPA 2KJRA 3CSFA 2K1FA 4LJOB 4JV5L 2E2JB 5IAAC 4DV5Q 2G4DB 2J53A 3A4SC 5M5WB 1GUSA 1G6JA 5EE9A 2O4XA 2JA5B 2XVSA 2VQEQ 3E5SA 2YVCA 1M8AA 1VF5C 3FP9A 2Z6KA 3CXCA 1ROEA 1VQFA 1JWUD 3ABVB 1X3FA 5BR8Q 5DM63 4OL7A 1RM6C 3NRZA 1Z6HA 1WTPA 2MHVA 2B2YA 2CH4A 3T1HQ 1FRRA 2KACA 3ECIA 2EYOA 3DHHC 1G6PA 1WFQA 3BY4B 2VY3A 3BU2A 1ET9A 3FDTA 4K7UA 2MP2A 1Q1BA 2AMCB 3GO5A 3T51B 1D2BA 1FFVA 1NE3A 1PDQA 4BBNF 2LVQA 2A1AA 1Y8NB 1SGHA 3NTKA 1CZWA 2J4XA 3HOWB 3ZTDA 1VDZA 2DY7A 1DZ1A 2D2CC 1YQ3B 3M85A 4ZOHC 4C4VA 2FIFA 1BVSA 3KJOA 1LGRA 2REXA 1TKWB 1WVLA 5JVH3 2OOBB 3RNBC 2K5HA 4JI5Q 1EY4A 4A3PA 1ZYRC 4ARCA 1YOVB 1F9PA 2RDGA 1SE8A 1XEEA 5C3EH 3GTQH 5LLIA 1YITA 2J52A 1IHZA 1E8XA 5T1GA 5AUIA 4KY7A 5FJ8H 5K36H 2C7NB 4DAPA 1OFFA 4E3CA 4GN1A 3K6OA 5M3FG 2LFNA 4A3LG 2WXPA 4ULLA 4R8IA 4IFDG 4KHPQ 2HHHQ 1JALA 4N9F4 4YSXB 1EU3A 2B2WC 2AWOA 1XMOQ 1V9JA 2QDLA 1XTDA 3BDLA 2EYJA 1MJCA 2N55A 3MVVA 4DKAC 2JXMB 3KWVA 1C9OA 4WORA 5JH5C 4X3TA 4ID6A 1GVPA 2PVOD 3T1YQ 2IDYA 2K05A 4OZCA 1NNXA 1FD6A 4HKQA 4IPGA 3TP7A 1DGJA 3VFKA 4BKSD 4X65L 2KQSA 1SYCA 2DHZA 1ESRA 4N8X1 1RLFA 1K8AC 5BYSA 4N6EB 4UP7A 2KTRA 2N4FA 2A6HD 2F0FA 4DNIA 4MELA 3MHSD 2DN8A 4DR5L 1WTRA 4HIMA 1E7ZA 5IY0A 3E6ZX 3SK8A 2X6LA 2DLBA 1LT5D 3S1QH 4YL8A 1Z2MA 1LT6D 3QB3A 1TGZB 2PQAA 2ZJDA 1TKEA 5H8YE 1PFNA 1WCMB 4FJZA 3VDZA 4US8A 2IY0B 1ET6A 2CWAA 2YTVA 2VB3X 1EQQA 2IO0B 4RF0A 3EFUA 3QG1A 4HJKA 4N9PA 3OTOQ 2G3QB 1VQPA 1IGCA 1PRTB 2N9XA 2EE1A 3OOCA 2KDBA 1U4RA 4MTKA 4ZUIA 2M9VA 1C4AA 2KQ3A 4PMBA 3FPPA 3AEVA 1S72A 1F2RI 3EA6A 4MGYE 3VUYA 4B6WA 5D2MB 1SAPA 1LTSD 2PW5A 5BMGA 2FXQA 5AZGA 4W9FA 1LFDA 3TQYA 3VXWA 1Y1WG 4X57B 5G5HA 2MGSA 1Q10A 1PH6A 1M4VA 4UY8C 4GMVA 1QOHA 4JQWC 4IQZA 2IGDA 4JPBW 5EKIA 1HJPA 2B2WA 1ZXIA 4NXNL 2WWZA 3WA0A 3OWFA 1HR0L 3KOJA 4CBVA 5C3EG 4QQBX 4H7BA 4FDBA 1LT3D 1PV4A 4GOCA 1J0GA 3OHXC 3HM6X 4JLCA 4HAEA 1SIFA 1YN5A 4AJYB 5FJ8G 2JYTA 3J9CA 2UXCQ 3BJUA 4RGMA 1U4AA 2M0XA 2E76C 3VDYA 2ZW1A 5EE1A 1IXRA 3AE8B 1NJIC 1E0BA 5FO8B 2N0SB 3DVGY 5CV5A 1TBEA 3NZSA 2JT4B 4CO7A 1XT9B 1CKOA 2BKFA 2R93B 2I5MX 3GTLB 2L83A 1TWAB 5G3LF 3BIID 4NJ7A 3A4RA 3CC4A 1JRUA 3N9YC 4E71A 3VA5A 1YN3A 3L08A 3TMEA 1CI3M 1I50B 3VR9B 3DUZA 2FMMA 3L3OC 4LF5L 3R3MA 4HCNB 1I4GA 3ZVVA 5C44B 5LXIB 1PYBA 4IJLA 1A3VA 1N63A 4BKTA 1O78A 1YNJC 2L12A 4CDEC 5FOBB 5M3MG 2QDFA 1QILA 1JWSD 3KLWA 2VZKD 3H3VC 3M95A 3BWUD 4C7ZA 4R4CA 4P73A 1QZEA 2QIEB 2B3GA 1VQLA 1QG7A 1XCQL 1PFBA 4LTUA 1WJ4A 5AZHA 4L1BA 1LUZA 1SNOA 3I4NB 1FFUA 2DZIA 2BWFA 4RKLA 3CW2C 3TP8A 3KDFB 3HKZB 4YY3Q 2EXZA 4YIJA 1XTCD 1BO0A 2KXJA 1D5MC 1R9TB 2JF5A 5CHVC 4ZKCB 3VYSA 1P98A 1YJ9A 3V61A 5E6JA 4ZDVA 4GNXC 2LGDA 4ZHPA 4MM3B 1NAPA 2WDRB 3H6MA 4C80A 4LFAQ 2LGYA 3I4MB 1IL2A 1FXTB 4NY0A 5IN7A 2J0TD 2GBNA 1HNXQ 2R92B 1CHQD 3QOLA 2A6EC 1LV9A 2BE5D 4C3JB 3S17H 2QEXA 2NVUI 3AE6B 2LS01 4XDDA 1EFWA 2GVBA 3G6EA 2E2JH 4A3EB 2WS3B 3ER0A 3AU4A 5C0XI 4DV5L 5M5WH 5E7NA 3J81L 2F1MA 2NYZD 3MTSA 2UXBQ 3S1NB 3ML9A 2JA5H 2G1EA 5C6AA 2ONQA 4GDLA 3MXPA 4P2CB 2F0LA 2VQEL 1C77A 2KJHB 3OW7A 2L52A 4RHSA 2ZVNA 1Q86C 1GHJA 5EBCA 3L54A 5BR8L 4S0RA 3HFZB 3A8IE 2DNEA 5JEAG 3RMKC 1JOKA 3A8KE 3T1HL 1E8WA 1FNVA 1V1PA 1EWCA 4KV6A 3UDXA 4HKZE 2LZ6A 4DR7Q 2E2HB 2D10A 3FC4A 3CU7A 1KRHA 4M1UB 2MPMA 2NN6H 1KL9A 4W9EA 1L2FA 3CMEA 1L0XB 4JBKA 2NB0A 3N6RA 2BW2A 4QCLA 2C9WB 3AV8A 2L15A 2WU5B 4DN4M 2PIAA 3HOWH 4DR3Q 4HEA1 2KT7A 3UIPB 4RCOA 1MSHA 1HPCA 4FF4A 1PZID 3OJ4B 4OELB 1YZ6A 2Z1CA 2A68D 1KF6B 1EY0A 4FF1A 3D32A 4JI5L 1LM0A 3VR5A 1PH3A 2NPTA 1QNUA 1Y14B 5GAGC 2Z9HA 4H2AA 3R7QA 1CKNB 3NUCA 2N8NA 5C4HA 1SFOB 2GA4B 5ELEA 1QT9A 2RHSB 2DNCA 3T56B 1UEBA 4GNXA 3AMZA 5IKCM 3IKJA 1WTVA 4KHPL 3SK6A 2PKOA 2XK5B 3DPDA 2IHEA 1EIGA 1WGKA 1Y1VG 1XLNA 2NBWB 3MWYW 3I5JC 4K1RB 5FLMG 1T3QA 1LTID 3LWEA 4GN3B 1L4DB 2KWUB 2ZZPB 1R4MI 4BKSA 3KFUA 3RZOB 2W3SA 4GXBA 1EQTA 5DPSA 1AARA 2CS4A 1HA6A 2FCNA 5FO9B 4KMUC 1SYFA 2UU9Q 3S9WA 1BCPB 2FINB 3F8TA 2QMTA 1YNND 3E9IA 2IYDB 2BYEA 3DBRB 4OONA 2C5CA 1WTOA 3B1LX 1K8GA 4GN5A 1W6JA 3GZNI 2NWGA 1C48A 4FXDA 1WGYA 2OCEA 4IO9A 2INPE 1GB4A 4BBSB 4LMQD 3AECB 3B9JA 1AW7A 3AU5A 2K6DB 3HP3A 4L5RC 2IGHA 3RNAC 2LY7A 2E74C 4IPDA 2JA5G 2CHXA 5L37A 5FLXL 4HR7B 2IZVB 3TL5A 2B63B 1YI2A 4CHTB 1CT1D 1VQIA 1WCMH 4UPAA 3MFGA 5EE3A 1SLJA 1M94A 1K8RB 4R4TA 2KANA 4NAMA 3L9AX 1R4QB 2GN5A 1N34Q 3OTOL 1XPUA 1MPEA 2NN6G 2K6AA 2JZPA 3AB5A 4OWWB 3GZNB 2WXFA 3I90A 3DBHI 4RAUC 3ULPA 2LUMA 2HDEA 4J3OD 2RA4A 2NVTH 1IW7C 1FGBD 3NBHB 1PH2A 4DV0Q 4MN3A 3ALBA 1D8LA 5IGEA 3HOWG 2DZJA 5EPJA 3TSSA 4FHJA 1C4PA 4JI8L 1VCIA 2XN9C 3NQIA 3W1BA 1NMGA 2JA8B 3HOUG 1UF0A 3J7A5 2EJMA 3HOXH 3HOYG 1EIFA 1RJTA 5EKLA 5C5MA 5IYBG 4CJ1B 1WD0A 3SXHA 3HUIA 3TS2A 4P71A 2MH7A 1LO5D 1WTXA 2UXCL 3X3MA 4XYOA 3MC8A 3NJTA 4JG2A 3V60A 2NCNA 1QQRA 3DBHB 2K22A 1MI0A 4NJ6A 1PTOC 1E90A 2KCCA 3ND9A 3PGZA 1WRIA 2TSSA 2QKIC 4DK6C 2B2TC 4HSVA 1NVID 3CF6E 1WSPA 1Q0WB 2K9XA 2R93H 1VMCA 3GTLH 1TWAH 3KLSX 4AWJA 4G3XB 4KLKA 2K39A 3A56A 2MCNB 3K5OA 3C46A 1HEZE 4X66L 1E22A 2BVCA 1ZKOA 3GTMB 1H8CA 2OXPA 4LDTB 2WV6D 4RGNA 1TKGA 2N9PC 5IP9H 5C44H 2X69A 3U30A 2JQOA 3UI2A 2BYTA 1GOZA 2EJGC 1VZ7A 3EUB2 3ZNID 4G11A 1FCCC 5IT9L 3K5MA 4L23A 2A68C 4F7ZA 4BY1H 5JJKA 1PH9A 2BCOA 1YJNA 3QCAA 2PPHA 2KTFA 1S5CD 3TN2A 3EJIA 3TUOA 3U58A 1NEKB 2HDLA 3AYHB 4DHZE 4CGYB 4YT0B 1U5KA 3RUZA 2K0PA 1B50A 2VUMB 3I56A 1S3OA 4R4OA 5M3FB 1Y69U 4LF6Q 1RWSA 1WJ6A 4YY3L 1KLGD 5FK9C 5GAEC 2PMZB 1N5WA 5BMIA 1B44D 4J1MA 3SGIA 1R9TH 3BDOA 5J1ZA 2M17A 2LGSA 1WGDA 5FO7B 3QK0A 5JXVA 4L2YA 2C35B 3NOBA 4K5WA 5AZFA 3WAMA 4V0BA 2IO3B 4MT5A 3AXCA 2YTXA 4LFAL 1VQ5A 4GLSC 4JI7Q 1FO4A 1FRDA 2R92H 1HNXL 1N5XA 4C3JH 4US9A 2PEAA 2W54A 1IKLA 4A3EH 4WJ3M 1X3QA 4FXCA 3S1MB 1VQKA 1JRPA 4ANVA 2UXBL 3V2TA 4F8MA 2HJ1A 2ZTEA 3PT2B 3Q3OC 4GLVB 2Q2IA 3UE0A 1JOQA 1RHPA 2B2TA 2OF1A 1AFPA 2IGGA 4WAFA 5I2XA 4ZYNA 4DUZL 3RT3B 2BA1A 2D07B 3HEJA 1H9MA 1NUCA 4AIMA 3JVZX 4X3KA 4DV7Q 4FF2A 1KNEA 4B95A 3BDCA 1TY2A 3TEZA 3KUZA 2E2DC 1CFMA 4M0WB 2E2HH 5AEKB 1R4PB 3L2PA 4ANWA 3JAML 4MGZE 2HDMA 1FR3A 5BN3A 3CF5A 1QZGA 3RNEC 3TEWA 2HT1A 2R93G 3DWPA 2FJ2A 1PVOA 3UGBB 2ZJQA 1EY9A 3DM3A 1MVKA 2MRPA 5ELDA 1YQBA 5IP7H 1GC7A 3NS8A 3VUXA 2O2VA 3QR8A 1JQ4A 4IUNA 4GDKB 5C44G 3VAWA 1EWYC 1KLUD 4B3SQ 1AE3A 4A3JB 4RGOS 2HIVA 1EYCA 5IWAQ 1OXTA 1Y1WB 2JSOA 4L5SA 3DHGC 3AE9B 1HNZQ 3QO2A 2QF7A 5IGGA 1WY8A 3IVFA 4TQ0A 2CWPA 1N36Q 3CD6A 4JWUC 2RKSA 5IE8A 3KW5B 4A6QA 4A3FB 3JW0X 1JROA 4G7ZC 3I4NG 4HVBA 3U4VA 1PFDA 2J7QB 2Q8RE 4IUVA 2Q8TA 3N20C 1D1KA 4QL5A 5E1FA 5EPKA 3ZW3A 1SSOA 2WXHA 3KLRA 2L00B 3OAWA 3QOJA 1GJXA 3EN2A 4DDID 3RZOH 3P7JA 3TZUA 5TR5A 1NI3A 4LFCQ 2K25A 1AH9A 2L76A 2E6XA 4WJPA 2KENA 3A5ZB 3RUIB 2V0GA 1KAWA 3I4MG 3ERSX 4HK2A 1EF1A 2UU9L 2O5IC 2R92G 4X3SA 4C3JG 3S24A 1DOIA 1QOFA 5M3MB 4A3BB 3KK7A 1SEBD 1H9RA 3MC9A 4BBSH 3SR1A 3NTIA 3ONAB 3NVYA 4CHKA 3ZJYC 1ESFA 4HTHA 3HIZA 4HJ7A 3QJYA 2UYZB 4W9GA 1YEZA 4XYQA 1GPXA 2MUYA 4BBRG 4PMCA 1D4BA 2B63H 1VQOA 3NE5B 5C3WA 4QIWE 4YCUA 2DZKA 1TT5B 2F0IA 2M19A 2JRIB 3H0GB 1EZ8A 3PV0A 1EY8A 3N1XC 2KYWA 4R4QA 3U52E 2K14A 1YBYA 3AN1A 3BVZA 2SNSA 4AYBG 5M9OA 4OW0A 1N34L 5IT9c 1VQEA 4POGA 1Z5SB 5KRUA 1WTHA 2OTJA 3HRZC 5KYLA 1ZOYB 5C0XG 3I63C 5I6YA 4WJOA 3NQTA 4QB4A 1VF7A 2YTYA 1WXMA 1WYGA 4F87A 1L1OC 1NY4A 1BXTA 3M7GA 2JP1A 4DV0L 2OHFA 3EECA 1M90C 1JJ2A 2UWQA 1W2BA 1YJWA 2WDTB 2G45B 2BGFA 3EIVA 1TJEA 2RSNA 1EWHA 4OVUA 4A8XC 4WWMA 1QB5D 3J7AV 3SE0A 2FUHB 1EU4A 3CC7A 5JOBA 3PGEA 2HD3A 4Y52H 3QX1A 2N7JA 3H7PA 4HROA 1IP9A 3F1ZA 5BYQA 2N78A 4HJ8A 5LMNQ 1V6EA 5I9PA 3J81E 1WX8A 2K33A 2J0JA 1C0AA 3F2CA 1TWGH 2EIFA 4Z9CB 1V81A 2V4LA 2RDFA 5A2QL 1IBKQ 4Y7NB 1SNQA 3M63B 2DYMA 1HA5A 2E2IB 5CR3A 3QAQA 4RG1A 3L10B 3Q8DA 4EZLA 1IBMQ 1ENCA 4LK1C 1LTLA 3R2IA 2WAQE 1L0YB 1HTLD 3B2FA 5CYUA 1A70A 3GQBA 1UELA 2KBNA 3GTMH 5CORA 4OO1I 3C2PA 2EYFA 3W5OA 4JBWA 2UUAQ 2V9HA 2KOXA 1QOGA 2Z0SA 4OZBA 1FEHA 4TV3A 3A9KB 1HFNA 2BB6A 2Z4HA 1GUGA 3RULA 5HFYA 1E3PA 5K5PA 5KNBA 2M1MA 3HG9A 2OEDA 1RF2D 1B3AA 3UINB 4WJWA 2F0UA 4BBSG 3ZDMC 1E24A 1K9MC 1DJRD 1PZJD 2KA7A 1K83B 1T5EA 3U4ZA 5H1SE 3S16B 1E7UA 1WE7A 3KVFB 1I4XA 3IFTA 1STBA 2L3ZA 2RSOA 3AE5B 3V6EB 3KYHC 5ELBA 2VUMH 4JI3Q 1LLRD 1ENFA 5CBEE 5IYCH 5M3FH 4J15A 1Z47A 4CJ2C 3GTJB 4LF6L 1QWYA 5JHBA 4YWKA 4GOPB 1UGJA 2N3SA 1L1OA 1Y1VB 1HR0W 2JE6I 4IOIE 5HGQA 1Q7YC 3APCA 1E2ZA 3WOFA 3A0JA 3IBEA 2NBFA 2KX0A 2N88A 2K3UA 3A1QA 3VVWB 2ZTDA 3RNUA 1I7HA 1HZBA 4A3CH 3PTFC 1IBXB 3SDZA 1FNWA 4JI7L 4R4IA 2EQSA 2IBIB 1TWHB 2FE8A 2XNAC 4DUYQ 4GLXA 4E74A 4FADA 3QWNA 4O1NA 3S1MH 1UE6A 3DHIC 3SVMA 1IL8A 2JEBI 5EE0A 1C8CA 2JA8G 4XTCS 1TU2B 1WR6E 4A93B 1GAQB 5T8IA 1HH2P 2K03A 1Q1EA 2DAFA 5C1ZA 1YJ1A 4TKOB 2O6VB 4UAIA 2KO3A 2WDVB 1WTWA 4WWNA 3DBLB 3G7LA 1ILQA 4DAYB 5J39A 4HSPA 4Q5VA 3DVNV 1HZ9A 3S1RB 2MO1A 3IRBA 4LF4Q 4OVZA 4GS3A 4DV7L 4NQKE 2I0QA 1PXUA 4A3KG 4F88A 2EY6A 2MBQA 2BDOA 3RFZB 3PUWA 4KD3A 2F0OA 1NSNS 3M3JA 2KJ6A 4LW1A 3P4RB 2AWTA 2D5DA 4JYAQ 4G57A 1B9RA 2F0WA 1QVCA 4A4IA 1WGGA 4QUCA 3AB9A 1DOLA 3NXWA 4IUQA 3MC0B 4NW2A 4MSMB 1GB1A 4ZRJA 1JQYD 1YNJD 4OIKA 4PZ7A 1CHPD 4EGVA 4B3SL 1WF9A 2JU6X 4FULA 1Y1WH 1BF4A 1E7VA 1QVGA 2ZVOA 3HOUB 4I6NB 1JICA 1HNZL 2LEKA 4EQOA 4IW0A 1N36L 3BYTB 3M9BA 3FILA 3I72A 3HOYB 3Q8EA 4ANUA 1FNUA 1KTKA 3DMUA 3TP6A 4DNRB 4QF4A 1VQMA 4DXFA 4A3FH 1OTCA 1A62A 3HGBA 4MGIE 2VUMG 1HNWQ 2WHIA 2LRUA 5C2TB 3R7RA 5IYCG 3ZNZB 3KF8B 5G5GA 1FXIA 4DFAA 3APFA 2A69D 4NB3A 3PF4A 2RPVA 2BYFA 3PUYA 5DPRA 1Y8PB 5CGKA 1A2UA 1QUQB 4WQMA 4IKGA 3IHPC 3FEWX 1JOOA 2F0NA 1M1KC 4REZA 5J22A 2H89B 3EC8A 4LJZC 1KJTA 4LFCL 2KCNA 1IUEA 1CZGA 2L5TA 2IX3A 1UGMA 4A3CG 1LACA 1Y8RC 2A6ED 2QJLA 4EX5A 1XF5L 5CC4A 5M3MH 3AQQA 2MBHA 3VRAB 4BAXA 3SU8X 4DV3Q 1V49A 3S15B 3C8YA 3PIO3 4DV1Q 1YD8U 2JSVX 2MFIA 4IWPA 4RM8A 3A33B 4WAAA 1BCPF 4UP9A 3J80L 2ZTCA 3SD5A 1W6KA 1JT8A 4B9KA 2JA6B 1F9SA 2KHSA 1EY6A 5IT9E 1EYAA 3UQBA 1Q12A 2QDBA 1SNPA 1LT4D 5E4WC 3T13A 3QA8A 4FVMA 2FCQA 1LTAD 4XZ4A 2M00A 3AEBB 1V8QA 2PZTA 2ASBA 3IG3A 3MP9A 1D5ZC 1DOKA 3K9PB 4IOAA 3M4QA 1PGXA 1FXAA 2KJXA 2BBCA 5I4DA 2D0OA 4HJAA 4TVAB 3MXUA 2I1JA 4O42A 3I70A 2RGFA 2JZ3B 1WI5A 4WURA 1SNMA 5DEHA 3N3KB 1VQ8A 2LXAA 4ALPA 2NVQB 1F0ZA 2EJFC 3GTKB 1NCVA 2K5NA 4MSQB 4G7HC 5J18A 3PRMB 1C3TA 4PV1C 3H9DA 5IGFA 1SRUA 1TWFB 4GLAC 4KX6B 4A90A 4A3JG 1SE2A 1B1ZA 1Q90A 1K8MA 2AQ2B 1AEXA 3HRDD 1IZ6A 4LUZA 1GUWA 2Y0SB 1XCTL 1CMXB 2AUJD 4NAWA 4JI6L 2AKWB 2RCFA 4A3FG 4A3DG 3R66C 1Q8IA 2KHJA 4OEMB 1HZ5A 5JEAH 3C0RB 3P4QB 3ZUNA 4Y7NH 1IBKL 2C60A 2LGXA 3VUWA 3NTHA 4YWMA 3GE8C 2L05A 1B8AA 3UDGA 1PRTD 2F03A 1IBML 3K7AH 1MG8A 2KECA 2OJWA 2VB2X 1ZXHA 4C1NI 1KRTA 1YHBA 4IM0A 1WZ3A 4W9CA 3SDLC 2QILA 1S5FD 3I2ZA 1WM2A 3A9JB 4NMZA 4P1BC 2VZKB 3JAME 2KC2A 2UUAL 3RR5A 3K57A 3CCRA 2WU2B 1LTBD 3H7SA 1FCLA 1I42A 2ZCBA 4IC7B 5G55A 4P1CC 1T0SC 4AOFA 1KAAA 2H1EA 2CVRA 3NPPA 4A3BG 3I3TB 3RMHA 3FAHA 2YYZA 1NR4A 1B3QA 3DVGX 3ND8A 1ASZA 4KKIA 1K83H 3WWVA 3S16H 2EELA 3AMUA 3O13A 4YTMB 2MP1A 3NHEB 3Q8FA 4DHJD 4EOYA 4DPGA 1PH8A 2PTLA 2DY8A 1S1QB 4YWLA 3QQ8B 4JI3L 3QC8B 3HS0C 1H9SA 3GTJH 1F9QA 3JYUA 4BKGA 4JI4Q 3MFYA 2WB1B 3LJ3A 3H0GG 3JSVA 1FD7D 1K3BC 3VYTA 2KMCA 2A69C 1Y1VH 1HE8A 4K0KQ 1RCVD 2KWDA 5FLMH 3F2BA 5HY6A 2AHOB 3BZKA 4NKLA 3M7NA 5E6PA 2OEOA 5DLQE 3VH4B 1WMHA 2ZJPA 2JK8A 4P75A 4LNKA 1IW7D 2FFKB 4IUTA 2BH8A 3KBXA 4ME5A 3VA7A 2B39A 5CTRC 3PIP3 3MXNA 1TWHH 4OWXB 2M0AA 3U7DA 4DUYL 5JPNC 3ZNHB 1XX8A 1O80A 3A7AB 4LNQA 2JPHA 1E7PB 2FCMA 3NG0A 2KFKB 4A93H 4JOIC 4HPLB 4M8MA 4S17A 4MDKE 4PG3A 3KUPA 2ZNVB 4GZYC 5KNDA 4W9HA 3EQLC 1I4PA 2F0GA 3TIXA 4BBRB 3VTUA 3EGRA 3T53B 3S1RH 4LF4L 5CHWA 4AS1A 5BO4B 1DOYA 1QF6A 3MXGA 2KVMA 3TBLD 3ZNGC 2JYEA 2ZW0A 1PTOD 3PZDA 4G50A 3Q22A 1WJUA 4OVVA 2JA9A 2ZXPA 3ZGZA 2KEDA 1EOTA 4PYUA 4AYBB 1BUVT 1F2YA 4JYAL 3D4WA 1NTGA 3VH3B 4DNTB 3D31A 1BT0A 2PNRC 3E9HA 3C19A 1CK1A 3CRLC 4KKJA 4KIKB 1SE9A 4DK1A 3J80c 1HZ6A 3PF5A 3AULA 4NPNA 2FMCA 4KGTA 3M3YB 3PRZA 3P1HA 4RMFA 1PDXA 3G71A 2KMMA 2LWPA 2HJ8A 3L0WB 3HOUH 4AUQC 3J7YW 2RR9A 2EY2A 4KD4A 5CV4A 5D94A 3ITPA 1MHXA 1OEYA 1STAA 3I57A 3PSIA 3VQIA 3HOYH 1E10A 1WIAA 4IWQA 5IIFA 5IYBH 4RA8A 3CPWA 1UZXB 2KEEA 2Q2HA 4K7WA 3K80C 3VR3A 1HNWL 2K52A 1EY5A 2LMCB 2ASQA 1Z7TA 4KZCA 1WE6A 1ZP0B 3AEFB 4XGAB 4QMGA 1Y56A 1YN4A 2JXTA 2HHHL 4KY6A 4OO1G 3LYYA 1P7EA 1XMOL 1CTMA 4C00A 3TS0A 2F0HA 1PRTC 4UDUC 2PMVA 5JHAA 3S2AA 3RCZA 3U7ZA 3OIQA 5A2QE 1HQMC 2JN4A 4ZUJA 2M4NA 4HLEA 2K01A 4JOIA 3ZIMA 1IYVA 3I4LA 3DWQA 3QIAA 4QY7A 1OXSC 1EUJA 5LL6S 4HJ5A 3T1YL 4YWGG 5JVG3 1VZ8A 3TCAA 3W1YA 1S5BD 1VQHA 4PT5A 3KF6B 3FMCA 1EIYB 3HHMA 3MTNB 4S3SA 2OT2A 2WX1A 1F2LA 4ZCKA 1E8ZA 2H88B 3OYYA 1BUIC 2FCSA 3IL8A 3LGJA 4B3MQ 4DV3L 5E6OA 4A55A 1C7YA 2UUBQ 3GE3C 4EFOA 4DV1L 3U50C 2I38A 2N9LA 4A93G 2F3VA 3V62A 2NMQA 1BNZA 1GC6A 2WXMA 2JA6H 4M8AA 3E9SA 1XPOA 2JWZA 4EZKA 3PUZA 1ZDXA 1NYQA 2JQRB 3RZDB 3OW2A 2HUGA 1QJOA 2IY5B 4WH4A 1R4MB 2YLMA 2CKHB 1JJCB 1X32A 1F2RC 4FJVB 1JC7A 4B3TQ 3OJ3A 1MHWC 3L16A 1GHKA 3W1SC 2EPBA 3MHZA 3R8BA 1BBXC 4NZLB 1CUKA 1FYCA 1NBWA 2F0KA 5LHY1 3P42A 5EAYA 2INDC 3C3LA 3IFDA 1DXMA 3HVZA 1B53A 1BBWA 4FNFA 2WXJA 1B70B 4WJQA 3MZ5A 3K7UC 3BK2A 5C4XB 2NBUA 2KX3A 1LTGD 2B8FA 2B29A 4L63B 1E2WA 2MA9B 3PZ8A 5M5XB 2N7DA 1TWFH 1IPGA 3A55A 2DENB 2MQJA 3P63A 4KJNA 2TMPA 1BKBA 1UBQA 2LUEA 4DWFA 3O65B 1SBBB 4CDDC 2VQFQ 4HJ9A 1C4QA 1KDBA 2KDMA 2ZEQA 4PS3A 3AE2B 3ZXRA 4RCNA 2K28A 1WR1A 2WGSA 4EEWA 3H7PB 1VQ4A 2ICEC 4LLGM 4LAAA 1YHAA 2L55A 4ABNA 5EGTA 4C3HG 1SE4A 2ZPNA 1I5FA 2WXOA 2F0QA 1HZCA 3ULJA 4A3KB 4B3RQ 3IAYA 4HEDA 1WRDB 5EKKA 4HN7A 1U4PA 1WD1A 4LF9Q 3S2DB 4BS9A 3TZDA 3C1FA 3LWUA 1DOMA 1TIID 1RD9D 4K5XA 1V86A 1VS0A 2W82A 2BS4B 3HKZE 4QIWB 4X62Q 4W9LA 1X55A 3J81c 2C7MB 2KAJA 1GG3A 3LNNA 1SMYD 3D4DA 1I50H 5HI1A 4ZLTF 3EHVA 3T8MA 2MJ8A 3FPUB 4TMAB 2AQ1B 2WIIB 4A20A 1X3EA 2SOBA 3URYA 2KCTA 4XQJA 2RPQA 3TEYA 2I5LX 3GOEA 4DV4Q 4TUUA 2SAKA 3H94A 4A3IG 5D3DA 3HVDA 2EY1A 1EYGA 1NMFA 5ELNA 2Q2UA 2EYHA 4MZ9A 3ETRA 2Z0DB 2RDHA 1XYIA 1B7YB 3W1SA 1STNA 2RVLA 4DQOC 2JA6G 2K5VA 2JA7B 2X6GA 4IDIA 4C7YA 5M5YB 2J0KA 2MEKA 3I4NH 4IFDI 2D3GA 3PS6A 3VTWA 4LF7Q 4JI4L 3BS1A 2GVAA 4BZAA 1PQSA 4A3OA 1I6HB 2G5DA 1K3RA 4BBNC 3Q2AC 4HWIB 1G2SA 4JC0A 1OQRA 3GB1A 3RNGC 2K5QA 4KY5A 1A6XA 5IP4D 2MJEA 4QAYA 4LDTD 1WI0A 2RCNA 5CV9A 4PQXA 2BYVE 3MHBA 3I4MH 2WQYB 5E6NA 2MQHA 2SNMA 4TKNA 4YTNB 4APVA 1RODA 2LHDA 2JUOA 1VQAA 2CHBD 3N52A 4CKCA 3RN5A 3TJPA 3KUDB 1SYEA 2OQKA 3KDFA 4PS7A 1JW9D 1KNAA 3M62B 1UWVA 4YHHQ 1TZ1A 1EEFD 3S1NH 1WXQA 1KHIA 2LKVA 5A35A 2KFJA 4ICVA 3ZJUA 3I73A 1JMLA 4FXKC 4M8NA 4CJ0B 1YNXA 2VS1A 4BBRH 5CMDA 2Y0SG 5LMUQ 1STEA 4LJPB 4NJCA 4URKA 2K5WA 4HIKA 4MM3A 4K8IA 1FM0D 2KOLA 1YNTE 1CA6A 2CW0C 1X9NA 2VH2A 4XWTA 1EFID 1V1OA 3J80E 1I94Q 2K4KA 3HKSA 1N8RC 1EYDA 3HZXA 4KKTA 1WJNA 1NI2A 3A74A 1FJGQ 3PO2G 5KHOA 1J7AA 4HXDA 2DNFA 4K7SA 4JBMA 2D3BA 2IHFA 4DR7L 2QHOA 1N6ZA 1NDDA 4TSSA 1FL0A 3BINA 4HJGE 2WDQB 2R7DA 2INCC 1ISNA 4ZYSA 4HDOA 1HTPA 3OPOA 3PHWB 5C0XH 1BCPC 3GTOB 3QJZA 4XE0A 2RQXA 3PCOB 2MP2B 1SROA 3GV6A 4QGUA 3M3YH 1V1QA 3H91A 1PH5A 3L4PA 1KDAA 3ONSA 5HHDG 5FLXc 3SFDB 3T16A 4DR3L 1RRBA 5D7GA 2A74C 1OQYA 3ZRFA 4ZRIA 3IT6B 2ZXOA 4IG7B 4C4VB 1BMLC 3RYTA 4GKKQ 1SJED 4MH8A 2V1CC 3H09A 2F0PA 3AEAB 2BWES 1EL0A 1PH7A 2PLPA 4J6IA 1SFOH 3NVVA 4LNIA 4RKBA 4A3DB 2CJNA 2DWQA 1C9FA 3CQZB 3K9OB 2L1BA 1P9DU 1N62A 1DYQA 4HMJA 3IAM1 1CSQA 2WB1G 4J6HA 3WOEA 3Q3NC 4DBGA 1B9NA 1L0WA 1PH4A 2V3SA 1I4RA 3KUCB 4IZ8A 2XBBC 5EPLA 2XWBB 1VQCA 1JB3A 1QE6A 2Q5WD 4BWGB 1CKNA 2K7VA 4HCSA 2ZT9C 1SMYC 1BDOA 3DM1A 2WYQA 1XWEA 2H5XA 2KK8A 2WXGA 2O5JC 2CHWA 2L1AA 4ZRKA 1J9OA 4QJFA 1PGAA 1CQVA 1JE4A 2UUBL 3Q3MC 1HTQA 2BA0A 4A3MG 1L7YA 2XK5A 4XT3B 1G291 4IPCA 5C4JB 3F2UA 4A3GG 2KTRB 5LL6X 4ASWC 1OXXK 1MBYA 1HUMA 1G2TA 2G4SA 1VQJA 2IO1B 4KVGB 1OO9B 2FBWB 2M56B 4I7AA 1F52A 3RZDH 5ELCA 1XJVA 5ELFA 1WXAA 3AI5A 3N1ZC 3NEMA 1H4RA 1L4ZB 3H6NA 1Q5WB 3KYCD 2PQAB 4B3TL 2IO2B 4U673 3AH7A 2Z8LA 4HDQA 3U9OA 1HXYD 2JZZA 3T3OA 1RKNA 2WP9B 3GTGB 2CR5A 2EDGA 3DOWA 1R4NI 4DDGD 2V1YA 2ZCCA 1ICWA 1SNCA 2WKDA 1STHA 4RGTA 2Z59B 2CU3A 5DAUA 4EQPA 1ZGUB 4RNAA 4AQ7A 5DNFA 4JIOU 3HOZG 5M5XH 1IYUA 1EO6A 4IUUA 1HTOA 3BZCA 2OTLA 3CMMB 3CCVA 1EM7A 2JA8H 1KRSA 2KDEB 3NELA 1X56A 2VQFL 2L7RA 2I5HA 2N1VA 2F52A 3Q3FA 2MSED 4XDCA
chains in the Genus database with same CATH topology
1E9MA 2INNE 1AN8A 3WDNA 2L4NA 1H9JA 1I4HA 3NBHA 5DM73 2Y5PA 5E3FA 2O2LD 1N61A 2WXRA 1H9KA 4ZRPA 4EE2A 4JPSA 1GUTA 1TVXA 3D4RA 4G7OC 5EJWA 1B2TA 4JX1C 1ENAA 3GD7A 2WINB 2XRSD 1RTNA 2MJ3A 3OSOA 2R7ZB 2F0VA 3PMFA 1R7SA 3NBIA 2IJ0A 3M4OB 3K5LA 1C76A 4DU9A 3I8ZA 4CKEA 2NVXB 2YU9B 3OIPA 1SDFA 2EYPA 2PO4A 4RWSC 1IGDA 2EYLA 4OGQC 1F77A 2RBMA 4DXGA 1C4CA 2BB5A 2H4OA 2C9OA 5CV6A 1GUOA 4IN3A 3KLSA 4FP5D 4Q2JA 2B76B 4TQUS 5KGUA 1I6VC 2CQAA 1JR0D 2LHEA 3PO3B 2F0TA 2J42A 1K52A 1VJKA 1Q3LA 5FKAC 3DEPA 1EQVA 3Q6SA 1UAPA 2M2LA 4GDLB 2DYOA 4L6TB 1UNSA 4KTAA 1XLQA 2AX5A 1PTOF 1ZEQX 1STYA 5AFWA 5FLXE 2NN6I 2RMMA 3I9V1 3P20A 1V1PB 2G9HD 2Y5CA 3OMGA 3NUHB 5IODA 1FIQA 4I7ZC 5D14A 1UWXA 1Y8OB 1LABA 4IFDJ 1PYWD 3NS1A 4B0EA 4ZHOA 3B2GA 4XIGS 3AEDB 3IXSA 4M0WA 1SYBA 2VXWA 3X3NA 2XIWA 2BS3B 4JWSC 3C1EA 2VNUD 2K1BA 3T3NA 4DA2A 4H44C 4C3HB 4P6VF 5KEEA 2I2YA 1K8OA 1X3PA 2K5DA 5IGDA 3A8JE 3BVGA 1S5ED 3CIRB 3W9CB 2PZWA 2PZUA 1NYRA 4L8JA 3AE1B 1JWAD 1IKMA 3I3CA 1NENB 3LX0A 4EQNA 4C2MB 1L0VB 1VRAB 4A3IB 3M4YA 2BTEA 3DWMA 1S4ZA 3ZYYX 3E56A 3Q8BA 3VRBB 4FXGC 2NTSA 1YJJA 2ICIA 4K6DA 4WIPA 2GB1A 3NWSA 5BN5A 1G91A 1RFKA 1SE3A 1HRJA 4A9AA 1TR5A 3WCQA 1STGA 3D8GA 4KKUA 1LTTD 5E4XA 2ON8A 4XQQA 4C3IB 4WFN3 2B2VC 3U4EG 1K53A 2WXNA 5JJZA 1CQFA 4YSZB 3NVZA 1TYGB 4PNYA 3FKIB 2WXIA 4CQNA 2GI9A 3LB8C 3VYUA 1E6EB 5C5LA 4ARIA 2IT1A 4ODGA 1VLBA 2G9DA 1K51A 2JEAI 5CV7A 2B8GA 5GXGB 1F2ZA 3LXFA 1U4MA 4B0MA 3VYRA 2NVTB 3TP5A 2B2UC 4E6IA 3PO2B 1JCKB 1QCBD 3R3OA 3K5NA 1J7BA 2F0SA 2LJIA 3Q24A 2L11A 3HOXB 1O7YA 3AU7A 4B9XA 1ZE3D 1TS3A 3IT4B 5K36G 3VR4A 3H8HA 4KJOA 4MHEA 3KBGA 3W5VB 3GP7A 1QKZA 2X38A 1HUNA 2A73B 3A7LA 2NUCA 3NZ3A 4C56C 2QSDA 1ZDVA 1PLFA 2ID0A 2B2VA 3OWEB 3KQ4A 1OXVA 4OO1H 3CKIB 1T6BX 1D1IA 1JWMD 3V96A 3SK4A 1O7ZA 1SB3C 1A3UA 5LNK1 4BY1B 2KQ4X 5COYA 1F2MA 1OQQA 1PZKD 3BYYB 3CHBD 3DHQA 5JEAJ 1ZXTA 1XO3A 2D5GA 2PCFB 4K6LA 2XSCA 4K14A 4A3MB 1TQOA 5CBAE 5NUCA 4A3GB 2B2UA 2KUMA 4ZQ3A 1FMAD 3K58A 2XRQD 1PTOB 1MD2D 3NK9A 1KABA 3FVQA 1IBXA 2ZXRA 2WNMA 4BY7B 4KN7C 1AP0A 3VR2A 2K5PA 3NP8A 1SXTA 1RTOA 4KKSA 2A6HC 4DAYA 3SEBA 1XXGA 1UWMA 3U9SA 1SYDA 3HOZB 4X3UA 1VR9A 2YEPF 3MA2B 1CJEA 1JWBD 3T4AC 2V3PA 4WRDA 3K0YA 1GXDC 4EVOA 3P4SB 5BN4A 3VR8B 2PYKA 2I46A 2HTME 3ZJVA 4ILWA 4BA1I 2PQEA 4DAVA 3AM9A 3DWAA 4DGZA 3D6CA 1QOAA 3D6WA 4V190 2WACA 1SSNA 4BA2I 4D2KA 3MJ5A 3KWLA 2W3RA 2V4IB 1C78A 3NVWA 3MEHA 1AZPA 1V97A 3KF8A 1K50A 2F0EA 4H13C 4KI0A 4DF7A 4K8JA 2SEBD 3V05A 2NTTA 4C1NK 1I3QB 2IW3A 4U68A 2CW0D 1XLOA 4QUFA 1B4OA 1TS5A 4ZK9B 3GTPB 1HCZA 5F2DA 2PW9A 4MACA 5H92C 1CM9A 2NZ1D 4Q0FA 2Q8IB 3TDQA 1AZQA 1B9MA 1LTRD 3S14B 1BCPD 4IALA 2BOSA 1AWDA 4KK7A 1JORA 4B9WA 3GV3A 3W3AA 4RHRA 4RH6A 2PVGC 3P4PB 5IGBA 2WXQA 1U4LA 3GS2A 1CA5A 3SK5A 5KNCA 3E0JA 1DM0B 3ZJTA 1N60A 1T5XD 2XWJB 2R6GA 3HOVB 1C79A 2E75C 3SFEB 1TZOA 2WXKA 3BZDB 1L5PA 2E3TA 2EYMA 5EQ0A 4YTPB 2BE5C 3W5UB 4TRDA 1G6ZA 5D65A 2V4DA 5KIXA 1J7CA 2LGIA 2F0JA 1MSGA 4B08A 3BG3A 2PPBC 3AE7B 4YSYB 2IX0A 1TWGB 4JE3B 5KYIA 3Q8AA 4HMIA 4ZRZA 3S2HB 1OXUA 4FYDA 4RF1A 2EZVA 4DK0A 4NDXA 4KHZA 5G3LD 3IAS1 1DCZA 2NVYB 3AEEB 2ACZB 2WLBA 1EEID 5FR3A 2ENBA 5C3XA 3D3RA 3R93A 3UI3A 4XQNA 1UUPA 3NWTA 4K2KA 1D6EC 4C3IG 2PW7A 2D9UA 3SHLA 1ZPSA 3DXJC 3P75A 1SIJA 4HCEA 2WXLA 1P7FA 2WAQB 1ML0D 2K04A 4CKBA 4ZKBB 3AEGB 1PTOH 4PMWA 1TWCB 3L7ZC 3DEOA 3PUXA 4N9TA 5I6WA 3EROA 1YJIA 1SYGA 4KHVA 2N9KA 1TT2A 4XDXA 3RLFA 1II3A 2K32A 1YNNC 2A5HA 2WKCA 3DWGC 1E2VA 3AE4B 3Q8CA 3Q0AA 2YEPB 5I9OA 3I91A 1XLPA 1I4QA 5C4ZA 2EVBA 3EFXD 3NSWA 2EOTA 1DD2A 3PUVA 3Q69A 2KN4A 4R8NA 3P1MA 1RYJA 1ONLA 4R3DA 2LFIA 3FILB 2L0CA 3CRKC 1ILPA 3RD4A 5I2YA 1BOSA 5EBDA 3PO0A 1HFGA 2R3ZA 1TY0A 2F4IA 1BQQT 4K5VA 1KDCA 1U9RA 5MPOA 3J7AF 1A15A 2L9HA 4OIJA 4F7XA 2JX5A 4IURA 5C3EB 3GTQB 2F3WA 1QOBA 2GRIA 2CJOA 5CV8A 2JWUA 2LMCA 4P16A 1ACCA 3BK1A 1EZ6A 2IPKD 1TKYA 4OHJA 3EVQA 2AQ3B 5C0XJ 1QNKA 1RDPD 3NHHA 1NR2A 1D5XC 1S5DD 4XWWA 1WWTA 1L6UA 5TSSA 2EY5A 3MAQA 3U2SC 4LK0M 4ITKA 2D62A 2QCPX 5BMHA 4J8QA 5AUKA 1SJHD 1KH0A 2MJDA 3AE3B 4RFBA 3CWIA 2SDFA 1E0ZA 1MHHE 2BS2B 2HQEA 3S1QB 1EY7A 5HURA 2EKIA 1HQRD 1HHVA 4R9WA 2V3NA 1ZUD2 2Z4IA 3K59A 5D3IB 2IX1A 5IOCA 4KGSA 3BVMA 5JAVA 4NAWB 4ZRQA 5ISRA 4XXEA 1EIHA 5HGTA 1YQ4B 1SNDA 1PRTF 3PZ7A 4N58A 1ZYRD 2BT6A 4OZAA 2F0MA 1A3TA 4K2LA 1L6VA 1QLBB 4H0LC 4HRSA 1PUTA 4I65A 4G4KA 1PFMA 5HG2A 5T1IA 4YXDB 1GUNA 2DBYA 3ZQ4A 1SF0A 4XT1B 2AUKA 1MI2A 1VMPA 4MIUA 1AYFA 3TEXA 1WTQA 4FF3A 3K7AB 3V3XA 1G8ZD 1O7LA 1DONA 1H9SB 2B2YC 1VZ6A 4TQ1A 1MGSA 5C3JB 1BR9A 2FUG1 5IGCA 4FO2A 1J8IA 4IUPA 4JK1C 4N59A 2FHTA 2QEJC 3ERQA 2L32A 4KGRA 1YMHE 2HCIA 2JYOA 1V8CA 3FRPB 4ZAIA 2HCCA 3A54A 1TS2A 2I07B 2WP8J 3VR6A 2AWNA 3G6JB 4NP5A 5BYRA 4IFDH 1A2TA 1PMRA 2IL8A 4USAA 2J7ZA 1V43A 1KFYB 5JPMC 3Q23A 2BDNA 4KN4C 2R61A 3SR6A 1VDVA 2F0DA 3W2DA 2IWHA 1F9RA 1UEAB 3TBIB 1TS4A 1DOXA 1PGBA 2W55A 2Y3AA 3S17B 3R2TA 3OMCA 1CZPA 2E2JB 2J53A 5M5WB 1GUSA 5EE9A 2O4XA 2JA5B 2XVSA 3E5SA 1M8AA 1VF5C 1ROEA 1JWUD 3ABVB 5DM63 4OL7A 1RM6C 3NRZA 1Z6HA 1WTPA 2MHVA 2B2YA 1FRRA 2KACA 2EYOA 1ET9A 3FDTA 1Q1BA 3GO5A 3T51B 1D2BA 1FFVA 1PDQA 1Y8NB 3NTKA 1CZWA 2J4XA 3HOWB 1VDZA 2DY7A 1DZ1A 2D2CC 1YQ3B 3M85A 4ZOHC 1TKWB 1WVLA 5JVH3 4ARCA 1EY4A 1ZYRC 1F9PA 2RDGA 1XEEA 2J52A 1IHZA 5T1GA 5AUIA 4KY7A 5K36H 4DAPA 1OFFA 3K6OA 2LFNA 2WXPA 4ULLA 4R8IA 4IFDG 1JALA 4YSXB 1EU3A 2B2WC 2AWOA 3BDLA 2EYJA 2N55A 3MVVA 2JXMB 3KWVA 4WORA 4X3TA 4ID6A 2PVOD 2IDYA 2K05A 4OZCA 1FD6A 4HKQA 3TP7A 1DGJA 1SYCA 1ESRA 5BYSA 4N6EB 2A6HD 2F0FA 2DN8A 1WTRA 3E6ZX 3SK8A 2X6LA 2DLBA 1LT5D 1LT6D 3QB3A 5H8YE 1TKEA 1PFNA 1WCMB 4US8A 1ET6A 2VB3X 4RF0A 3QG1A 4N9PA 1IGCA 1PRTB 2EE1A 3OOCA 1U4RA 4ZUIA 2M9VA 1C4AA 2KQ3A 4PMBA 3FPPA 1F2RI 3EA6A 1SAPA 1LTSD 2PW5A 5BMGA 5G5HA 2MGSA 1Q10A 1M4VA 1QOHA 4IQZA 2IGDA 5EKIA 2B2WA 1ZXIA 3OWFA 4CBVA 4H7BA 1LT3D 3OHXC 4HAEA 1YN5A 2JYTA 3J9CA 4RGMA 2E76C 2ZW1A 5EE1A 3AE8B 1E0BA 5FO8B 2N0SB 5CV5A 2R93B 3GTLB 2L83A 1TWAB 5G3LF 3BIID 3N9YC 3VA5A 1YN3A 3TMEA 1CI3M 1I50B 3VR9B 3DUZA 2FMMA 3L3OC 1I4GA 5C44B 1A3VA 1N63A 1O78A 1YNJC 2L12A 5FOBB 1QILA 1JWSD 2VZKD 3H3VC 3BWUD 4C7ZA 2QIEB 1QG7A 1XCQL 1PFBA 4LTUA 4L1BA 1SNOA 3I4NB 1FFUA 4RKLA 3TP8A 3HKZB 2EXZA 4YIJA 1XTCD 1BO0A 1D5MC 1R9TB 4ZKCB 3VYSA 5E6JA 4ZHPA 4MM3B 1NAPA 2WDRB 3H6MA 4C80A 3I4MB 2J0TD 2R92B 1CHQD 3QOLA 2A6EC 1LV9A 2BE5D 4C3JB 3AE6B 4XDDA 2LS01 4A3EB 2WS3B 5C0XI 3J81L 2F1MA 2NYZD 3MTSA 3S1NB 2G1EA 5C6AA 2ONQA 3MXPA 4P2CB 2F0LA 1C77A 3OW7A 2L52A 4RHSA 1GHJA 5EBCA 3A8IE 2DNEA 5JEAG 1JOKA 3A8KE 1FNVA 1V1PA 1EWCA 4KV6A 4HKZE 2E2HB 3FC4A 3CU7A 1KRHA 4M1UB 2MPMA 2NN6H 1L0XB 2NB0A 3N6RA 2BW2A 4QCLA 3AV8A 2WU5B 4DN4M 2PIAA 4HEA1 4RCOA 1MSHA 1HPCA 4FF4A 1PZID 2Z1CA 2A68D 1KF6B 1EY0A 4FF1A 3VR5A 1QNUA 4H2AA 3NUCA 5C4HA 1SFOB 2GA4B 5ELEA 1QT9A 2DNCA 3T56B 3AMZA 3IKJA 1WTVA 3SK6A 2PKOA 1EIGA 1WGKA 1XLNA 3MWYW 1T3QA 1LTID 3LWEA 1L4DB 3RZOB 2W3SA 1EQTA 1HA6A 5FO9B 4KMUC 1SYFA 3S9WA 1BCPB 2FINB 2QMTA 1YNND 2C5CA 1WTOA 1W6JA 2NWGA 1C48A 4FXDA 2INPE 1GB4A 4BBSB 4LMQD 3AECB 3B9JA 1AW7A 3HP3A 2IGHA 2LY7A 2E74C 5FLXL 4HR7B 2B63B 4CHTB 1CT1D 3MFGA 5EE3A 4NAMA 3L9AX 1R4QB 1MPEA 2NN6G 2K6AA 2JZPA 3AB5A 2WXFA 3I90A 4RAUC 2LUMA 2HDEA 4J3OD 2RA4A 1IW7C 1FGBD 4MN3A 5IGEA 5EPJA 3TSSA 1C4PA 1VCIA 2XN9C 3NQIA 2JA8B 2EJMA 1RJTA 5EKLA 5C5MA 4CJ1B 1WD0A 3SXHA 3HUIA 2MH7A 1LO5D 1WTXA 3X3MA 4XYOA 1QQRA 2K22A 1MI0A 1PTOC 2KCCA 3ND9A 1WRIA 2TSSA 2QKIC 1NVID 2B2TC 4HSVA 1WSPA 2K9XA 1VMCA 3KLSX 3A56A 3K5OA 3C46A 1HEZE 1ZKOA 3GTMB 2OXPA 2WV6D 4RGNA 1TKGA 2X69A 3UI2A 2BYTA 1GOZA 2EJGC 1VZ7A 3EUB2 1FCCC 5IT9L 3K5MA 4L23A 2A68C 2BCOA 1S5CD 3TN2A 3EJIA 3TUOA 1NEKB 2HDLA 4CGYB 4YT0B 3RUZA 2K0PA 1B50A 2VUMB 5M3FB 1Y69U 1RWSA 1KLGD 5FK9C 2PMZB 1N5WA 5BMIA 1B44D 4J1MA 3BDOA 5J1ZA 5FO7B 5JXVA 4L2YA 4K5WA 4V0BA 4MT5A 4GLSC 1FO4A 1FRDA 1N5XA 4US9A 2W54A 1IKLA 1X3QA 4FXCA 3S1MB 1JRPA 3V2TA 4F8MA 1JOQA 1RHPA 2B2TA 2OF1A 1AFPA 2IGGA 4WAFA 5I2XA 2BA1A 3HEJA 1H9MA 1NUCA 4X3KA 4FF2A 1KNEA 3BDCA 1TY2A 3TEZA 2E2DC 1CFMA 1R4PB 3JAML 2HDMA 1FR3A 5BN3A 3TEWA 3DWPA 2FJ2A 1EY9A 1MVKA 5ELDA 1JQ4A 4IUNA 4GDKB 1EWYC 1KLUD 4A3JB 4RGOS 1EYCA 1Y1WB 1OXTA 2JSOA 3AE9B 4TQ0A 3QO2A 2QF7A 5IGGA 4JWUC 2RKSA 4A6QA 4A3FB 1JROA 4G7ZC 1PFDA 2Q8RE 4IUVA 2Q8TA 1D1KA 5EPKA 5E1FA 1SSOA 2WXHA 3KLRA 3QOJA 1GJXA 3P7JA 3TZUA 1NI3A 2V0GA 2E6XA 2O5IC 4X3SA 4C3JG 1DOIA 1QOFA 5M3MB 4A3BB 3KK7A 1SEBD 1H9RA 3SR1A 3NTIA 3ONAB 3NVYA 1ESFA 4HTHA 3QJYA 1GPXA 4XYQA 2MUYA 4PMCA 1D4BA 3NE5B 5C3WA 2F0IA 2M19A 3H0GB 1EZ8A 3PV0A 1EY8A 3U52E 3AN1A 3BVZA 2SNSA 5M9OA 4OW0A 5KRUA 3HRZC 5KYLA 1ZOYB 5C0XG 5I6YA 3NQTA 4QB4A 1VF7A 1WYGA 4F87A 3M7GA 1BXTA 2OHFA 2JP1A 1TJEA 4A8XC 2RSNA 1EWHA 4WWMA 1QB5D 3J7AV 3SE0A 1EU4A 5JOBA 2N7JA 4HROA 5BYQA 5I9PA 3J81E 2K33A 4Z9CB 2RDFA 5A2QL 4Y7NB 1SNQA 2DYMA 1HA5A 2E2IB 5CR3A 1ENCA 4LK1C 3R2IA 1L0YB 1HTLD 3B2FA 5CYUA 1A70A 3GQBA 5CORA 4OO1I 3C2PA 2EYFA 4JBWA 1QOGA 4OZBA 1FEHA 1HFNA 2BB6A 2Z4HA 1GUGA 5HFYA 5K5PA 5KNBA 3HG9A 2OEDA 1RF2D 1B3AA 4WJWA 2F0UA 1DJRD 1PZJD 2KA7A 1K83B 1T5EA 3S16B 1I4XA 3IFTA 1STBA 2RSOA 3AE5B 5ELBA 1LLRD 1ENFA 5CBEE 1Z47A 4CJ2C 3GTJB 1QWYA 1UGJA 1Y1VB 4IOIE 2JE6I 1E2ZA 3WOFA 2NBFA 2N88A 2K3UA 1I7HA 1IBXB 3SDZA 1FNWA 1TWHB 2FE8A 2XNAC 3QWNA 4O1NA 3SVMA 1IL8A 2JEBI 5EE0A 1C8CA 5T8IA 4XTCS 1TU2B 4A93B 1GAQB 2K03A 1Q1EA 4TKOB 4UAIA 2WDVB 1WTWA 3G7LA 1ILQA 5J39A 4Q5VA 4HSPA 3S1RB 4OVZA 1PXUA 4F88A 2EY6A 2BDOA 3RFZB 3PUWA 4KD3A 2F0OA 1NSNS 3P4RB 2D5DA 4G57A 1B9RA 2F0WA 4QUCA 3AB9A 1DOLA 3NXWA 4IUQA 3MC0B 4NW2A 1GB1A 1JQYD 1YNJD 4OIKA 1CHPD 4EGVA 2JU6X 1BF4A 3HOUB 1JICA 2LEKA 4EQOA 3FILA 3BYTB 3I72A 3HOYB 3Q8EA 1FNUA 1KTKA 3DMUA 3TP6A 4DNRB 4QF4A 4DXFA 3HGBA 5C2TB 5G5GA 1FXIA 4DFAA 2A69D 2RPVA 3PUYA 1Y8PB 5CGKA 1A2UA 4WQMA 4IKGA 3FEWX 1JOOA 2F0NA 4REZA 5J22A 2H89B 4LJZC 2KCNA 1IUEA 1CZGA 2L5TA 2IX3A 1LACA 2QJLA 2A6ED 1XF5L 5CC4A 3VRAB 3S15B 3C8YA 3PIO3 2JSVX 1BCPF 3J80L 1W6KA 2JA6B 1F9SA 2KHSA 1EY6A 5IT9E 1EYAA 1Q12A 2QDBA 1SNPA 1LT4D 5E4WC 3T13A 4FVMA 1LTAD 2M00A 3AEBB 1V8QA 2PZTA 3MP9A 1D5ZC 1DOKA 1PGXA 1FXAA 2KJXA 2BBCA 5I4DA 3MXUA 4O42A 3I70A 4WURA 1SNMA 5DEHA 2NVQB 1F0ZA 2EJFC 3GTKB 1NCVA 4G7HC 4PV1C 5IGFA 1TWFB 4KX6B 4A90A 1SE2A 1B1ZA 1Q90A 1K8MA 2AQ2B 1AEXA 3HRDD 1GUWA 2Y0SB 1XCTL 2AUJD 1Q8IA 1HZ5A 3P4QB 5JEAH 3NTHA 1PRTD 2F03A 2KECA 2VB2X 1ZXHA 4C1NI 2QILA 1S5FD 4NMZA 2VZKB 3JAME 3K57A 1FCLA 2WU2B 1LTBD 1KAAA 2H1EA 2CVRA 3NPPA 3RMHA 3FAHA 2YYZA 1NR4A 3ND8A 4KKIA 2EELA 3AMUA 3O13A 4YTMB 2MP1A 3Q8FA 2PTLA 2DY8A 3HS0C 1H9SA 1F9QA 3MFYA 2WB1B 1FD7D 3VYTA 2A69C 1RCVD 2KWDA 4NKLA 3M7NA 2OEOA 1IW7D 2FFKB 4IUTA 3KBXA 4ME5A 3VA7A 2B39A 3PIP3 3MXNA 2M0AA 5JPNC 1XX8A 1O80A 3A7AB 1E7PB 3KUPA 4GZYC 5KNDA 3EQLC 1I4PA 2F0GA 4BBRB 3EGRA 3T53B 4AS1A 1DOYA 1QF6A 3MXGA 2KVMA 2JYEA 2ZW0A 1PTOD 3Q22A 2ZXPA 3ZGZA 2KEDA 1EOTA 4AYBB 1BUVT 1F2YA 3D4WA 4DNTB 3D31A 2PNRC 4KKJA 1CK1A 3CRLC 4DK1A 1HZ6A 2FMCA 4KGTA 3M3YB 3P1HA 1PDXA 2KMMA 3J7YW 2EY2A 4KD4A 5CV4A 3ITPA 1MHXA 1STAA 3I57A 3VQIA 1E10A 5IIFA 4RA8A 2KEEA 3VR3A 1EY5A 2LMCB 1Z7TA 1ZP0B 3AEFB 4QMGA 1Y56A 1YN4A 2JXTA 4KY6A 4OO1G 3LYYA 1P7EA 1CTMA 2F0HA 1PRTC 4UDUC 2PMVA 3U7ZA 3OIQA 5A2QE 1HQMC 4ZUJA 2K01A 1IYVA 3I4LA 3DWQA 3QIAA 4YWGG 1OXSC 3RPFC 5LL6S 5JVG3 1VZ8A 1S5BD 4PT5A 3FMCA 4S3SA 2OT2A 1F2LA 2H88B 1BUIC 3IL8A 4A55A 2I38A 2N9LA 2F3VA 2NMQA 1BNZA 2WXMA 4M8AA 3E9SA 3PUZA 1ZDXA 1NYQA 2JQRB 3RZDB 2HUGA 1QJOA 4WH4A 1X32A 1F2RC 1JC7A 1GHKA 2EPBA 3MHZA 3R8BA 1BBXC 4NZLB 1FYCA 2F0KA 5LHY1 3P42A 3C3LA 3IFDA 1DXMA 3HVZA 1B53A 4FNFA 2WXJA 3MZ5A 3BK2A 5C4XB 1LTGD 2B8FA 4L63B 1E2WA 3PZ8A 5M5XB 3A55A 3P63A 4KJNA 2TMPA 1SBBB 1C4QA 1KDBA 2KDMA 3AE2B 4RCNA 2K28A 2ICEC 4LLGM 4LAAA 2L55A 4ABNA 4C3HG 5EGTA 1SE4A 2WXOA 2F0QA 4A3KB 3IAYA 4HEDA 5EKKA 4HN7A 1U4PA 1WD1A 3S2DB 4BS9A 3TZDA 3C1FA 3LWUA 1DOMA 1TIID 1RD9D 4K5XA 2W82A 2BS4B 4QIWB 2KAJA 3LNNA 1SMYD 3D4DA 5HI1A 4ZLTF 2MJ8A 3FPUB 4TMAB 2AQ1B 2WIIB 2SOBA 3URYA 4XQJA 3TEYA 2SAKA 3H94A 5D3DA 3HVDA 2EY1A 3ETRA 2EYHA 2RDHA 1XYIA 3W1SA 1STNA 2RVLA 4DQOC 2JA7B 4C7YA 2X6GA 4IDIA 5M5YB 2MEKA 4IFDI 3BS1A 1I6HB 1G2SA 1OQRA 3GB1A 2K5QA 4KY5A 1A6XA 2MJEA 5CV9A 4PQXA 3MHBA 2WQYB 2SNMA 4YTNB 1RODA 2LHDA 4CKCA 2CHBD 3N52A 1SYEA 1JW9D 1KNAA 1EEFD 1WXQA 2LKVA 5A35A 3ZJUA 3I73A 1JMLA 4FXKC 4CJ0B 5CMDA 1STEA 4NJCA 2K5WA 4K8IA 1FM0D 2KOLA 1YNTE 1CA6A 2CW0C 4XWTA 1EFID 1V1OA 3J80E 1EYDA 3HZXA 4KKTA 1J7AA 4TSSA 4HJGE 2WDQB 4ZYSA 1HTPA 3OPOA 5C0XH 1BCPC 3GTOB 4XE0A 2RQXA 3GV6A 3H91A 3L4PA 5HHDG 1KDAA 3SFDB 3T16A 5D7GA 2A74C 3IT6B 2ZXOA 1BMLC 1SJED 4MH8A 3H09A 2F0PA 3AEAB 1EL0A 2PLPA 3NVVA 4RKBA 4A3DB 2CJNA 2DWQA 1C9FA 3CQZB 2L1BA 1N62A 1DYQA 4HMJ