5C1ZA

Parkin (ublr0rbr)
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
405
structure length
384
Chain Sequence
MIVFVRFNSSHGFPVEVDSDTSIFQLKEVVAKRQGVPADQLRVIFAGKELRNDWTVQNCDLDQQSIVHIVQRPWRKGQEMNATNSFYVYCKGPCQRVQPGKLRVQCSTCRQATLTLTQGPSCWDDVLIPNRMSGECQSPHCPGTSAEFFFKCGAHPTSDKETSVALHLIATNSRNITCITCTDVRSPVLVFQCNSRHVICLDCFHLYCVTRLNDRQFVHDPQLGYSLPCVAGCPNSLIKELHHFRILGEEQYNRYQQYGAEECVLQMGGVLCPRPGCGAGLLPEPDQRKVTCEGNGFAFCRECKEAYHEGECSAVFEYRVDERAAEQARWEATTKPCPRCHVPVEKNGGCMHMKCPQPQCRLEWCWNCGCEWNRVCMGDHWFDV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ligase
molecule keywords E3 ubiquitin-protein ligase parkin
publication title Disruption of the autoinhibited state primes the E3 ligase parkin for activation and catalysis.
pubmed doi rcsb
source organism Homo sapiens
total genus 92
structure length 384
sequence length 405
chains with identical sequence B
ec nomenclature ec 2.3.2.31: RBR-type E3 ubiquitin transferase.
pdb deposition date 2015-06-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00240 ubiquitin Ubiquitin family
A PF01485 IBR IBR domain, a half RING-finger domain
A PF17976 zf-RING_12 RING/Ubox like zinc-binding domain
A PF17978 zf-RING_14 RING/Ubox like zinc-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 5c1zA01
1S1QB 3PVLA 2DYOA 2N9PC 4LCDE 3RUIB 2LZ6A 2Z59B 3SD5A 2KX3A 3QC8B 3NHEB 2N7EA 3S2AA 2IY1B 3U7DA 2JZ3B 2HE7A 2LUEA 4MSQB 4I6PA 5KHQA 4PS8A 2I1KA 2NBUA 1VCBA 3P2BA 2LD9A 1WE7A 1E5WA 3RYTA 1R4MI 4GIVA 1E90A 3DVNU 1WR1A 3NY5A 1YX5B 5CTRC 1OGWA 4MGIE 2AL6A 2AWTA 3PLUA 4HWIB 3UINB 3PRMB 4ASWC 2LASA 1WE6A 2MA9B 4GGQA 2K1FA 4GDKB 4A3OA 3M63B 2KLCA 2LWPA 4GSWA 3LJ3A 3PSEB 3EFUA 4WJNA 1GC7A 2RD0A 4FJVB 2AYOB 4PS7A 1NDDA 1P3QU 2ZCCA 3KYCD 4GDLB 3ZTDA 1I35A 2WDTB 4BVUC 4AUQC 4KIKB 3LDZE 2IZVB 4K81A 2DYBA 2DZJA 4BKSD 2LJ5A 2J0MA 4IWQA 1GUAB 2WYQA 3ZVVA 3TL5A 4JGHB 4NQLB 2O6VD 2IO2B 3VTVA 4OVVA 1HE8A 3Q3JA 2BYFA 2DHZA 4CYEA 4GMVA 2J7QB 1J0GA 1WX8A 4DXAB 4TV3A 3EHVA 4KV2A 3R7QA 2DYMA 2KDEB 5JH5C 3PGEA 4ANWA 5C1ZA 3JVZX 1WFYA 2RGFA 2L05A 4GU2A 4BKTA 1E8YA 4G11A 4FHKA 1QZEA 2KD0A 4BKSA 2LGXA 3QWZB 1P1AA 1WGHA 2O6VA 2I1JA 4MM3A 3SHQA 1CMXB 5CHVC 1TGZB 1F9JA 2IYDB 2KFJA 4NAWA 4B95A 1UGMA 3L10B 3ZNID 4OVUA 1SE9A 4WJQA 1WGDA 2KO3A 2ZZPB 2C7HA 3VHTC 3VTUA 3NS8A 2RR9A 4MGZE 3EECA 2MBEA 2LRUA 1RFAA 1WGGA 3A4RA 3CF6E 1E8ZA 3V6EB 2C7MB 1IYFA 5DPTA 3OLMD 3ZNZB 4AJYB 2V1YA 4B9KA 3K9PB 4DHZE 4WQOB 2XBBC 1J8CA 1E7VA 3PZDA 4W9IA 3H1UA 3A33B 2L0TA 2UYZB 3AI5A 3QQ8B 4KDIC 2QHOA 2J0JA 3O65B 3KH0A 2LVOA 3JSVA 1GJZA 4ICVA 2N1VA 3QJZA 2HD5B 2KXJA 2ZNVB 1RRBA 1WJ4A 3AULA 2MP2B 1YQBA 3H7PA 3ONSA 2K8HA 3M95A 5CHFA 3ZW3A 2PE9A 2NPTA 4FADA 3SDLC 1I42A 3A9JB 2MCNB 2FCSA 1OTRB 3GZNI 2C9WB 3A9KB 5J2RA 3WANA 3K9OB 2CKHB 4NJ6A 3V62A 1LXDA 5DCNA 1UD7A 2JF5A 2DZMA 1IPGA 1BT0A 5DPSA 1WH3A 3L0WB 3VDZA 4FULA 2PEAA 1P9DU 1WM2A 3IFWB 2GBMA 2J0KA 2ZNVC 3RULA 2PJHA 1WJNA 3PTFC 2Y5BB 5D2MB 2NR2A 4G50A 3M62B 4CO7A 4DDGD 5BO4B 3JYUA 2XK5A 2GBKA 3R3MA 4MJSA 4EFOA 1UELA 4W9HA 2M1MA 2WX0A 4HJKA 4M8MA 3PHXB 1KM7A 2ZPYA 4LDTD 2L0FA 4EZLA 2FCNA 4TQ0A 4NAWB 3PRZA 2KTRA 5AEKB 3NZUA 5EDSA 3WA0A 2MLBA 2D2QA 4MGKE 1V9JA 2IY0B 3A1QA 5E6PA 1S3SG 2BF8B 5AZHA 2MQJA 2KQSA 4IM3A 2MWSB 1UBQA 4DHZB 3IBEA 4EKUA 3Q3FA 1ISNA 3V61A 4ANUA 2BPSA 4AJWA 2NBWB 2PE6B 3R66C 3X23A 3C0RB 4JLCA 2KWVB 3H9DA 4E71A 2ZVNA 4GB9A 2KN5A 3ZNHB 5LXHA 5CX3A 3L54A 1ZGUB 3QAQA 4ZYNA 2N9XA 4AP4C 2RSUA 5IA7A 2LVPA 3M3JA 1LFDA 3TMPB 4F1SA 3V60A 4URKA 2A4ZA 1AARA 1UH6A 2ZEQA 5TR5A 3APCA 4JL9A 3W1SA 3VVWB 5GMVA 4N9F4 2IO0B 4HDQA 2B3AA 3H7PB 3KUDB 4HPMB 1WRDB 1WXMA 3U8ZA 2KTFA 2M0XA 2G3QB 1WYWB 2MX2A 2NPTB 4M8NA 4FJZA 1WF9A 3U30A 4ZRIA 3DVGY 3PLVA 3ZO5B 2LGYA 3UGBB 1EF5A 3HM3A 2KJRA 2N4FA 1JRUA 1WI0A 3PHWB 4HPLB 4HXDA 2XEWA 3QHTA 4RM8A 3T8MA 3WAMA 2KDIA 2CHZA 2KKCA 1WMHA 2KWUB 4LJOB 2L7RA 3OAWA 1YJ1A 3VUWA 3QCAA 1V49A 3WALA 5C23A 1K8RB 4E74A 1YD8U 4J6IA 4IM0A 2VRRB 4MGYE 2KJ6A 1G6JA 4K7WA 2BKFA 3ML8A 2XK5B 4GOCA 4MJSB 4KVGB 2LGDA 2IO1B 2V3SA 3IHPC 5HKHA 2ZPNA 5JHBA 3UQBA 4DHJD 2KVRA 4FN2A 3UIPB 3D32A 5L95C 1L2NA 1V5OA 2D11A 2BWES 2K6DB 2CHXA 2N9EB 2ZJDA 3N30A 3QIJA 3UF8A 2KTRB 1GC6A 1V86A 2JWZA 3NOBA 3ZKJC 3NZSA 3A1QB 1R4NI 2DZIA 3V6CB 4JQWC 2EKEC 4M0WB 4MELA 3RD2A 2K8CA 3PS6A 2K25A 1P98A 1V80A 2HTHA 2KANA 2IBIB 1WX9A 1EO6A 3ALBA 2FNJB 1FXTB 4K1RB 4LDTB 3UQAA 2D3GA 2JXXA 1TZ1A 4RM9A 1WZ0A 1KLVA 1WJUA 2KK8A 1J19A 2LRWA 4GXBA 4MDKE 3KVFB 4LJPB 3R7RA 2MBQA 2BGFA 4KDLB 3DBSA 4HK2A 5G55A 3L17A 2BWFA 4ZDVA 5AZGA 3DVGX 3QX1A 1NI2A 2ZCBA 4BOSC 2D07B 4FLHA 2KMCA 1E7UA 1OEYA 3KYDD 4BBNF 4KSKC 1H4RA 2NS5A 2KFKA 3IG3A 3OJ4B 4XC2A 4F8CB 4AOFA 4W9FA 2GBJA 1WXSA 3VTWA 1V6EA 2R2QA 3PT2B 1V81A 2ASQA 4DBGA 2BKRB 1LQBA 3EC8A 3VFKA 3VXWA 4B6WA 2C60A 3HM6X 4FHJA 4YL8A 1KOTA 1TTNA 4A20A 4WJPA 2KHWB 1GNUA 3W1SC 1WMHB 2YVCA 4MEMA 3X0WA 1L7YA 4F7ZA 1C3TA 3A4SC 4BBNC 5E6NA 3ENEA 3RCZA 1OEYJ 5D6JB 1XD3B 1XT9B 4BFRA 4FBJB 2JRIB 4DK5A 2FUHB 3N32A 3DPDA 2HJ8A 2KDFB 2O6VB 3MJWA 1Z5SB 3DOWA 1XQQA 5G2NA 2K39A 3VAWA 1D3ZA 2FCQA 2L8JA 5CHWA 2G4SA 3HHMA 2GOWA 2M8SA 2DZKA 3MTNB 1UZXB 3B1LX 4PYUA 4EZJA 2DENB 5LLIA 1WXAA 4W9EA 2K6QA 3DBRI 2KOXA 4W9LA 2AL3A 4WWOA 2LVQA 3ZTCA 2N7DA 2JPHA 4MSMB 3WAOA 2PPHA 1GG3A 2DAJA 2KZRA 2KC2A 1Q1OA 1EF1A 3VUYA 3ZIMA 3TCAA 1YIWA 1RLFA 4PS3A 3H6NA 2LI5A 4NPNA 2KJHB 2KNBA 1WY8A 2L76A 4DHJB 2AEHA 2D10A 4P7IA 5LXIB 4W9JA 2FIFA 2REXA 4W9DA 3JSVB 3WIMA 3HK0A 3ZDTA 1TBEA 3DVNV 2JT4B 4IW0A 1PQSA 1ZW7A 2JVCA 2MBHA 4BKGA 5DPRA 3VH4B 5DPWA 2KC1A 3B0AA 3H7SA 4IUMB 1EUVB 2KQ7A 1WX7A 4JIOU 4HCPB 2KFKB 3TIXA 1RAXA 3VQIA 2OOBB 3ML9A 4ANXA 3I3TB 4EZKA 4NNJB 3L13A 4G3XB 4MH0E 4NJ7A 4W9CA 4A3PA 4I6NB 5E6OA 2A5UA 2CHWA 2G45B 2MP2A 3BY4B 3ZNGC 2LXAA 5J17A 4PYZA 3L08A 3PV1A 1ZKHA 3WAPA 3QA8A 2L00B 4IWOA 3A9JA 1KJTA 3BINA 4WJOA 3A9KA 4WWPA 2MBOA 1IP9A 4HDOA 2DAFA 2EMTA 1MG8A 2BYEA 2KX0A 2ZVOA 3PPAA 2UWQA 4CHKA 5JZEB 4I6LB 4BOZB 2MSED 4KSLC 3CSTA 4FJYA 2KLGA 2O2VA 3VH3B 1C1YB 1M94A 2JRHA 4IC7B 1Y8RC 3DQVA 2MW5A 4K7SA 3KUCB 4G0NB 4ANVA 2IO3B 3GOEA 3JW0X 5D94A 1Z2MA 2N1WA 3AU4A 5J18A 1UBIA 5JHAA 2M4NA 3ZLZA 3DDCB 1SIFA 2CR5A 2M17A 3DCGA 1WR6E 1WM3A 3KUZA 2BYVE 2NCNA 1LM8B 4XZ4A 2NVUI 3OJ3A 3AXCA 3PRPB 5KHOA 4NQKE 1OQYA 1Q0WB 4II3B 3SU8X 3AU5A 4RMAA 5IAAC 1V5TA 3VUXA 4IG7B 1WGRA 4W9GA 1WZ3A 3DBLI 3APDA 2WWZA 1E8XA 2Z0EB 2KWCA 2OJRA 3DBHI 3IVFA 2R2OA 1E8WA 4HCNB 3RZFA 4HVBA 5L83A 3T9LA 2RPQA 3MHSD 2G4DB 2KMAA 3RZWC 2Z0DB 1T0YA 2MBBB 1WJ6A 4EUTA 2EMSA 3ZRFA 2C5LC 2V4LA 2GMIC 1U4AA 5AZFA 4GN1A 3CSFA 4FA6A 1H8CA 2GBNA 4XX5A 4GDKA 4KZ0A 4TKNA 5D7GA 3ECIA 2L3ZA 4EEWA 1WXVA 2KDBA 1SGHA 4ZRJA 4GDLA 2YLMA 3RT3B 3PREA 3UIOB 4AWJA 4E3CA 4K7UA 1Q5WB 4WAAA 4KIKA 4NY0A 4TQ1A 1YX6B 2NBVB 4ZRKA 2W9NA 1VD2A 3QARA 2K8BA 1P0RA 4HLEA 2GBRA 2C7NB 1A5RA 2JZZA 3CMMB 4TUUA 3TJPA 1NBFC 3QK0A 2CU1A 2JY6A 4IWPA 3ZUNA 3APFA 2CS4A 2JUOA 2O2VB 4II2B 2WX1A 3W1YA 1WGYA 1V2YA 4WWNA 2MRPA 3HIZA 5FR6A 3KW5B 3N3KB 2FAZA 4ICUA 3TBLD 2LXCA 4DDID 3B08A 1X1MA 3ZDMC 4EOYA 4DWFA 1WIAA 2DX5B 4X57B 2FIDA 4KZCA 3L16A 4IM2A 3ZRCA 2FCMA 4W9KA
chains in the Genus database with same CATH superfamily
2DYOA 4B0MA 2KX3A 4WIPA 1ZDXA 2N7EA 3S2AA 2I2YA 3U7DA 3FAHA 4PS8A 2I1KA 2NBUA 1D6EC 2BB5A 3RYTA 1R4MI 3DVNU 4KGSA 4JPSA 4ARCA 1OGWA 4A90A 2AWTA 3PRMB 3B2FA 4GDKB 2KLCA 2BW2A 3LJ3A 4PS7A 2ZCCA 2Y3AA 2QCZA 4BVUC 1HQRD 3MJ5A 1GUAB 4NQLB 2O6VD 2XNAC 3BWUD 1HE8A 2BYFA 3U52E 4N58A 4TV3A 1SE4A 2MHJA 3PGEA 4J3OD 1WFYA 3NJTA 3MP9A 3NVWA 4GU2A 2WNMA 4AS1A 2KD0A 5AUKA 1WGHA 2O6VA 1E10A 1LGRA 2BB6A 1CMXB 5CHVC 1TGZB 2IYDB 4OVUA 3DHIC 3VTUA 1N6ZA 1GB4A 3NS8A 1D5XC 2KACA 2LEKA 1TIFA 3EECA 2MBEA 1IGCA 2Y5PA 2ZW1A 3Q8FA 1E8ZA 5DPTA 3OLMD 1Q10A 3GB1A 2G1EA 2XBBC 3H1UA 2I38A 3O65B 1GJZA 2N1VA 2HD5B 1YQBA 3ONSA 3M95A 3ZW3A 2PE9A 2W54A 4KX6B 2FCSA 3EA6A 1TZOA 3GZNI 3W2DA 3A9KB 5FKAC 1VZ7A 2JSVX 4L2YA 1WH3A 3VDZA 1SE3A 5G5GA 4C7YA 2RDBC 4YTNB 2ZNVC 3PTFC 2Y5BB 5D2MB 3M62B 4CO7A 4DDGD 3ZQ4A 1C4PA 4UDUC 4W9HA 4XWTA 4HJKA 4M8MA 3PHXB 4MM3B 1DOXA 2ON8A 4TQ0A 4NAWB 3PRZA 3TUOA 1SIJA 4KGTA 1QOFA 5EDSA 2MLBA 5E6PA 4M0WA 1ZPSA 3IBEA 4AJWA 3OWEB 3R66C 3U7ZA 3H9DA 2JZPA 3SEBA 2ZVNA 2J53A 1MI0A 3ZNHB 3L54A 4LNKA 3QAQA 4ZYNA 2N9XA 1AN8A 1LFDA 2A4ZA 1AARA 2ZEQA 3W1SA 3VVWB 4N9F4 3H7PB 1WXMA 1CJEA 5IP4D 4FJZA 2WXRA 2LGYA 3VR8B 3UGBB 2N4FA 2B76B 1WI0A 4HXDA 3QHTA 4ZOHC 5TSSA 1VZ6A 3MFGA 2CHZA 1N62A 1YJ1A 1OFFA 3QCAA 3WALA 1BMLC 5C23A 2YEPB 4J6IA 4MGYE 2YEPF 2KJ6A 2BKFA 5HKHA 4KVGB 3IHPC 4M01A 3UQBA 2KVRA 4O1NA 2ZJDA 3Q3MC 1GC6A 2KTRB 1V86A 2JWZA 1IBXB 3KLSX 1T0RC 2DZIA 4JQWC 2EKEC 3P1MA 4MELA 2H89B 1E7PB 1I4XA 2KANA 2CU3A 1YN5A 1I4RA 4LDTB 1HZ5A 3AM9A 2KK8A 2LRWA 3KVFB 1L5PA 2MBQA 2N7JA 2BGFA 3DBSA 4LNOA 3L17A 1FCLA 1XEEA 3DVGX 4PT5A 4BOSC 1F77A 1E7UA 1FFVA 4KSKC 3IG3A 2FUG1 4F8CB 4AOFA 4W9FA 2GBJA 3VTWA 1T5XD 4YT0B 1L6VA 4B6WA 4FHJA 1KOTA 1AW7A 3W1SC 1WMHB 2BT6A 4F7ZA 1FFUA 2HJ1A 3AEAB 2MJ3A 2QILA 3RCZA 3SFDB 1QILA 2HJ8A 1TY2A 4HROA 2KDFB 3C8YA 1VR9A 4RGOS 1XQQA 5G2NA 5BMGA 2L8JA 1BXTA 2DZKA 2J52A 4W9EA 2K6QA 3DBRI 4W9LA 4WWOA 3BZDB 3VRAB 4A9AA 3ZJUA 2WGSA 4WWMA 4H2AA 1M4VA 2KZRA 4WURA 2NMQA 3KWVA 3VUYA 3ZIMA 1RLFA 3CIRB 4K3BA 4K3CA 3H6NA 2KJHB 2KNBA 2L76A 4DHJB 1E9MA 1EU4A 3Q14C 2VH2A 3J9CA 3ZDTA 1YOVB 3GE8C 3DVNV 2JT4B 1VRAB 2JVCA 1WGKA 2JYEA 3HVDA 3B0AA 4IUMB 1EUVB 1UWXA 2KQ7A 3Q8BA 2INPE 4ANXA 3ML9A 4NNJB 1EWYC 4NJ7A 4ARIA 4MACA 1WXQA 4I6NB 5E6OA 3VRBB 2CHWA 5J17A 1FNVA 1TJEA 3N9YC 1D5ZC 3A9KA 3AE4B 2MBOA 1XO3A 4N59A 2BYEA 2CJNA 2V3PA 1P7EA 2UWQA 1FXIA 4I6LB 3U2SC 3CSTA 3NVYA 3FC4A 1Y8RC 3H8HA 3JW0X 1XLQA 2IGHA 3GE3C 2KAJA 3DDCB 2M17A 2CR5A 3DCGA 3ZXRA 1V1OA 2JWUA 1ET9A 3Q8EA 4XZ4A 1E6EB 3AXCA 5KHOA 1Q0WB 4ZYSA 5IAAC 4RMAA 1V5TA 1WGRA 4W9GA 2WWZA 3DBHI 3IVFA 1FNUA 3AB5A 3Q8CA 1FIQA 1WJ6A 1H8CA 2GMIC 1U4AA 4KKIA 4XX5A 1WXVA 3R2IA 1RWSA 3BVZA 2BTEA 1B9RA 3QARA 1P0RA 2C7NB 2DBYA 4WQMA 3R2TA 5IKCM 3RFZB 2Z8LA 2ACZB 1ENFA 3W1YA 1YN3A 2UU7A 1V2YA 4WWNA 2MRPA 3ZJTA 5FR6A 3N3KB 3TBLD 2E6XA 3B08A 1X1MA 3IT6B 3L16A 4IM2A 3ZRCA 4W9KA 3URYA 4D2KA 1S1QB 2N9PC 3RUIB 4YTMB 1Y56A 3SD5A 2K9XA 4MSQB 1LO5D 4I6PA 2KQ4X 1MHXA 1SXTA 1E5WA 4GIVA 1E90A 2JX5A 3AMZA 4MT5A 1WR1A 3UINB 4ASWC 2MA9B 3M63B 1SBBB 2AYOB 1NDDA 2KVZA 3ZTDA 4GDLB 3LXFA 2WDTB 3U4EG 3LDZE 2DYBA 4BKSD 4JWSC 2J0MA 2WYQA 1N5XA 4JGHB 2IO2B 4C4VB 1R4NB 1V1PA 4CYEA 1WX8A 4DXAB 4KV2A 3GS2A 2KDEB 1JALA 1KTKA 1E8YA 5FK9C 4G11A 1QZEA 4BKSA 1FD6A 3QWZB 1P1AA 1TS5A 3AE3B 1YQ4B 1F9JA 2KFJA 1UGMA 2W3SA 2GRIA 1SE9A 2ZZPB 2RR9A 1D4BA 2WDQB 3PO0A 3V6EB 4YSYB 2V1YA 4DHZE 1YJJA 4WQOB 1K51A 1CZPA 1FPYA 2L0TA 3AI5A 3QQ8B 2QHOA 3L4PA 4ICVA 4BZAA 1RRBA 1WJ4A 2K8HA 2L32A 2MCNB 2C9WB 3K9OB 1LXDA 1UD7A 1JROA 3NVZA 4A8XC 2PEAA 5D3DA 2J0KA 3RULA 2PJHA 3MC9A 1C78A 4MJSA 3KQ4A 2WX0A 2WXLA 2ZPYA 4XYCA 1F2RI 4EZLA 3V05A 5AEKB 3WA0A 4MGKE 1S3SG 4DHZB 2KQSA 2VZKD 1ISNA 3V61A 5HG2A 4ANUA 2NBWB 4JLCA 1EWCA 2DWQA 1ZGUB 2WXFA 3PZ8A 4AQ7A 5IA7A 3I9V1 1UH6A 4IOIE 4JL9A 5GMVA 4RNAA 3KUDB 4HPMB 2KTFA 1MHHE 1XXGA 1TYGB 2NPTB 1WF9A 3U30A 4ZRIA 2L83A 4LLGM 2WXIA 2KJRA 4KKJA 3NG0A 2WXHA 3BVMA 4R3DA 3T8MA 3T3NA 3WAMA 2KDIA 5C3JB 4ZRQA 1KLGD 4LJOB 2BS2B 2OHFA 2M56B 1WRIA 2VRRB 4HRSA 4K7WA 3ML8A 2XK5B 3DBLB 4GOCA 1ZOYB 5JHBA 1XLNA 4US9A 4KGRA 3RNCC 5HFYA 2N9EB 3N30A 3QIJA 3AEFB 2WDRB 2WDVB 2D3BA 3Q3NC 5BYQA 3A1QB 4OZAA 3V6CB 2L1AA 4B0EA 1C77A 2K8CA 3N1ZC 3ALBA 2IBIB 5EE9A 3UQAA 3IAS1 4N6EB 4GXBA 3R7RA 4KDLB 5G55A 2WXOA 3BK2A 1V8CA 1A70A 3ZGZA 3AE9B 2ZCBA 4FLHA 2KMCA 1OEYA 4BBNF 5IO9A 3OJ4B 3IXSA 3PT2B 1V81A 4DBGA 1D5MC 1LQBA 1ROEA 3VFKA 4A20A 2LJIA 2RPVA 3NZ3A 4XGAB 4C80A 3X0WA 1C3TA 3N20C 4BFRA 4FBJB 1MFWA 2INDC 4C4VA 4DK5A 3N32A 2J4XA 3BYTB 3TEWA 1Z5SB 3DOWA 4OZCA 3VAWA 1D3ZA 1DYQA 1R4MB 2M8SA 2WS3B 1L6UA 2DENB 5LLIA 1WXAA 2KOXA 3ZXVA 2LVQA 2N7DA 1NI3A 2JPHA 2IGGA 2PPHA 2DAJA 2WU2B 1YIWA 1VLBA 4JE3B 4PS3A 2LI5A 3GP7A 1WY8A 1N61A 2AEHA 1FM0D 2D10A 4P7IA 2VH1A 5LXIB 3EGRA 3PZ7A 2FIFA 4XDDA 1N63A 1T0SC 4ZHPA 1TBEA 1ZE3D 5DPRA 2V0GA 1XF5L 2AX5A 2KC1A 4JIOU 2KFKB 1RAXA 2OOBB 3L13A 4G3XB 4MH0E 4A3PA 2QC8A 2WXQA 2LGSA 2X8XX 2G45B 1QT9A 5BYSA 1JWBD 1ZKHA 3Q6BA 3QA8A 3Q8AA 4WWPA 4NJCA 1MG8A 2KX0A 5JZEB 4CHKA 4KSLC 1UWMA 3P4SB 2O2VA 2K5PA 3VH3B 1C1YB 2JRHA 4K7SA 1QOAA 2IO3B 5BMHA 4OHJA 4LK0M 4JX1C 3AU4A 5J18A 1UBIA 2KN4A 3EUB2 1WR6E 2BYVE 2NVUI 5HI1A 3OJ3A 3PRPB 3AU5A 3GZNB 4USAA 4IG7B 4YSXB 1WZ3A 2ZW0A 3APDA 3NRZA 1KH0A 2Z0EB 2KWCA 4ZDVA 2R2OA 5E6JA 2RPQA 3RZWC 4RGNA 4PK1A 4EUTA 5AZFA 2V4LA 2LHDA 2BS3B 4GDKA 4KZ0A 4RGMA 4EEWA 4BAXA 1TS4A 2KDBA 2YLMA 3UIOB 4E3CA 4K7UA 4NY0A 1MPEA 2JYTA 1YX6B 4RF1A 2NTTA 1GAQB 2PVGC 1C4CA 3N1XC 5H92C 2PIAA 1QQRA 1I4GA 2QSDA 1UGJA 2CU1A 4M00A 3ZUNA 4C56C 1I4QA 4II2B 5EE3A 1YNTE 4DDID 1KLUD 1WIAA 2DX5B 4X57B 3P42A 2FCMA 3Q2AC 2KYWA 2PKOA 3PVLA 4LCDE 4DQOC 4OVZA 4DXFA 2LZ6A 3I63C 1FXAA 1HTOA 3QC8B 4L23A 4TSSA 2IY1B 2JZ3B 2HE7A 4JWUC 1VCBA 1K53A 3P2BA 2LD9A 1EM7A 1YX5B 3P4RB 3ABVB 3PLUA 3HRDD 2WQYB 4GGQA 3AEDB 4A3OA 1TKYA 2LWPA 4GSWA 3EFUA 4WJNA 1GC7A 4FJVB 5D3IB 3KYCD 4P1BC 2GI9A 4AUQC 4KIKB 2IZVB 2DZJA 3TL5A 1VZ8A 3LYYA 1J0GA 4REZA 3BIID 3E56A 1SB3C 2LUMA 3AEBB 4XE0A 5JH5C 1YN4A 1K52A 3WCQA 2L05A 1OQRA 4EE2A 4FHKA 2D3CA 1CK1A 1TT5B 4MM3A 1HEZE 4NZLB 4MH8A 4NAWA 3ZNID 4WJQA 3VHTC 2C7HA 2PVOD 1F52A 4P1CC 3RPFC 3A4RA 2ONQA 4B9KA 1ESFA 1VJKA 1ET6A 2UYZB 2J0JA 4A55A 1JQ4A 2ICIA 3QJZA 3H7PA 2KXJA 2ZNVB 3AULA 1JWAD 2MP2B 5CHFA 4FADA 1F1HA 1I42A 2WXMA 5J2RA 2RDGA 3AEEB 3WANA 2CKHB 4NJ6A 3V62A 5DCNA 2JF5A 3DBRB 2DZMA 1BT0A 1PFDA 3L0WB 4FULA 1J7CA 3AE6B 1P9DU 1WM2A 2GBMA 1WJNA 1F2RC 5BO4B 1C76A 3R3MA 1UELA 2M1MA 4LDTD 2BQQA 1FNWA 1NYQA 2WXKA 2KTRA 1IBXA 1V9JA 2IY0B 2BF8B 5AZHA 4IM3A 2MWSB 2SEBD 3AV8A 4EKUA 3ZYYX 3Q3FA 2BPSA 1E0ZA 1FMAD 2PE6B 4RCOA 3X23A 3C0RB 1XCQL 1PDXA 3RNBC 2QEJC 5LXHA 3AECB 5IN7A 2LVPA 3M3JA 3TMPB 1QOBA 3APCA 4HDQA 2B3AA 4S17A 3U8ZA 1WRDB 1HTQA 1GOZA 4YSZB 2M0XA 2G3QB 4M8NA 4HJGE 3DVGY 3PLVA 3ZO5B 2K22A 3OG5A 1JRUA 3AE2B 4RM8A 1WMHA 2KWUB 2L7RA 1MJDA 3OAWA 1I4PA 3ZJVA 1K8RB 4RH6A 4E74A 3IAM1 2FE8A 4RFBA 3DBHB 2DNFA 4DHJD 3BVGA 3V3XA 1L2NA 1V5OA 2K6DB 3UF8A 3AEGB 3NOBA 2V3NA 3ZKJC 5GXGB 4M0WB 3RD2A 3PS6A 2K25A 1V80A 1EO6A 2D3AA 1FXTB 2JXXA 4RM9A 1WZ0A 2WU5B 1KLVA 1WJUA 4NAMA 4QAYA 5FR3A 3AE5B 2IJ0A 5AZGA 2N9KA 3QX1A 3LB8C 1PGXA 2D07B 3KYDD 1J7AA 1H4RA 2NS5A 4HPPA 4XC2A 1DOYA 5MPOA 1V6EA 2R2QA 2ASQA 1BUIC 1DGJA 3EC8A 2C60A 3HM6X 2WLBA 2XN9C 3O13A 4IDIA 1JWMD 2JXTA 4WJPA 2YVCA 2G9HD 1L7YA 5E6NA 3ENEA 1OEYJ 3AE1B 5D6JB 1XT9B 2IGDA 2JRIB 1PYWD 1ZUD2 2FUHB 2E3TA 2OJWA 1JWSD 3MJWA 2NTSA 2W3RA 2K39A 2G4SA 1UUPA 2LGIA 1PGBA 3MTNB 4S0RA 2HDEA 1YJIA 3UI3A 3ZTCA 1STEA 3WAOA 1KF6B 2KT7A 1EF1A 2GB1A 3TCAA 4DXGA 5LNK1 2LMCA 3HVZA 1TKEA 3JSVB 3HK0A 4LNIA 4IW0A 1ZW7A 2MBHA 4BKGA 1DOIA 5DPWA 1SEBD 1WX7A 4HCPB 4EZKA 2INCC 2N9LA 2A5UA 3ZNGC 2MP2A 4OZBA 3PV1A 1FO4A 3WAPA 2L00B 1HZ6A 1KJTA 3BINA 1JMLA 1IP9A 2DAFA 3C19A 3PPAA 4M02A 1TY0A 1TS3A 2IDYA 4FJYA 2KLGA 1SJED 1M94A 4WAFA 2W55A 4IC7B 3DQVA 5C2TB 2MW5A 3W5UB 3AE7B 3KUCB 4G0NB 3E9SA 3GOEA 1Z2MA 2KWDA 3BK1A 3ZLZA 1L4ZB 3KUZA 2NCNA 2L52A 4NQKE 3FILB 3VUXA 3Q3OC 4GLSC 4RGTA 1E8XA 2K0PA 3RZFA 1I7HA 5L83A 4ITKA 3MHSD 2G4DB 2KMAA 2WXGA 1NENB 2Z0DB 1T0YA 2MBBB 2C5LC 3CSFA 1NVID 1QF6A 5D7GA 2WXJA 2L3ZA 4Q2JA 4GDLA 3RT3B 1PGAA 4P6VF 3MC0B 2WP9B 4TQ1A 2PW9A 2KMMA 1VD2A 2TSSA 1FCCC 2K8BA 2GBRA 3CMMB 4TUUA 3TJPA 1T0QC 1NBFC 3QK0A 3APFA 1XLOA 3MC8A 3RI7C 1HA5A 3B2GA 2WX1A 1WGYA 5EE1A 1JRPA 2PLPA 3HIZA 3KW5B 4ICUA 3ZDMC 4EOYA 4DWFA 2FIDA 4KZCA 1QKZA 1JW9D 3TSSA 2Z59B 1P7FA 2M19A 1JCKB 3NHEB 2LUEA 5KHQA 3N1YC 3B9JA 1WE7A 4WH4A 1KRHA 2N0SB 3NY5A 3MHZA 5CTRC 4MGIE 2AL6A 4HWIB 2DLBA 2LASA 1WE6A 5G5HA 2K1FA 2K3UA 3PSEB 2SAKA 2RD0A 1P3QU 1UF0A 1I35A 4K81A 3BYYB 2LJ5A 3TEXA 4IWQA 3ZVVA 4ZRPA 2OEDA 3VTVA 4OVVA 3NS1A 3Q3JA 3RNEC 2DHZA 1JWUD 4GMVA 2J7QB 3EHVA 4ACFA 3R7QA 2DYMA 4ANWA 5C1ZA 3JVZX 2RGFA 4BKTA 1L4DB 3TEYA 2LGXA 1RYJA 2I1JA 2AQ2B 3SHQA 3DWMA 4B95A 3Q69A 3L10B 2WXPA 3P63A 2X38A 1WGDA 2KO3A 2EKIA 4MGZE 2LRUA 1RFAA 3W9CB 1WGGA 3CF6E 1IYFA 2C7MB 4LNNA 3TEZA 3ZNZB 4AJYB 3K9PB 4LTUA 4C7ZA 1J8CA 1E7VA 3PZDA 4W9IA 3IT4B 3A33B 1R7SA 2M0AA 4KDIC 3KH0A 2LVOA 3JSVA 1FRRA 1ZDVA 2WXNA 1TKGA 3DHGC 2NPTA 5I4DA 3SDLC 3A9JB 1OTRB 1N60A 2QJLA 2QMTA 1WWTA 1IPGA 5DPSA 5HHDG 1V1PB 3IFWB 2AQ1B 4HKQA 2NR2A 1ZP0B 4G50A 3ETRA 2WHIA 2MH7A 3JYUA 2XK5A 2GBKA 4EFOA 1KM7A 1J7BA 2L0FA 1UNSA 2FCNA 2JQRB 3DHHC 3NZUA 4CQNA 2JU6X 2D2QA 2Q5WD 3A1QA 2MQJA 1UBQA 3KWLA 3RNFC 2QIEB 2KWVB 3RNAC 4E71A 3FILA 4GB9A 2KN5A 5CX3A 2BBCA 4YTPB 3DWGC 4AP4C 2RSUA 1PUTA 1EU3A 4F1SA 3V60A 4URKA 3NUHB 5TR5A 1NYRA 2IO0B 2GLSA 3FKYA 1B1ZA 1WYWB 2MX2A 2EELA 4L1BA 2LFIA 1EF5A 1XLPA 3HM3A 4YXDB 3PHWB 4HPLB 2XEWA 1L0VB 1TS2A 2KKCA 2W82A 3VUWA 2MJEA 1V49A 3I5JC 1YD8U 3AN1A 4IM0A 4C00A 1G6JA 1ZXHA 1WSPA 1YMHE 1V97A 4MJSB 2LGDA 2IO1B 2V3SA 2ZPNA 3UIPB 1L0YB 4FN2A 3D32A 5L95C 5AUIA 2D11A 1C9FA 2BWES 1GB1A 2CHXA 1QOGA 5JXVA 1FEHA 5T8IA 3NZSA 2Y5CA 1R4NI 2INNE 1IGDA 1MVKA 1KFYB 1T6BX 1P98A 2HTHA 5BMIA 1WX9A 2FNJB 4K1RB 2D5GA 2D3GA 1TZ1A 1J19A 4MDKE 2RDHA 4LJPB 4XWWA 1ZXIA 4HK2A 2BWFA 3SFEB 3SR6A 1NI2A 1ACCA 2VZKB 2BS4B 1L0XB 2KFKA 1RM6C 1WXSA 1T3QA 4ZHOA 2H88B 1OQQA 2BKRB 2PMVA 3VXWA 4YL8A 1TTNA 4US8A 2QDFA 4LNFA 1C79A 2KHWB 1GNUA 1HXYD 4MEMA 3A4SC 4BBNC 2MEKA 1XD3B 3DPDA 2O6VB 2FBWB 2IPKD 2FCQA 5CHWA 2BVCA 3HHMA 1WYGA 2GOWA 2R61A 1UZXB 1VDVA 3B1LX 4PYUA 4EZJA 2AL3A 3RN9C 4A6QA 4MSMB 1GG3A 2KC2A 1Q1OA 4NPNA 4W9JA 2REXA 4W9DA 3WIMA 3AH7A 1PQSA 3VH4B 2J42A 3H7SA 2HTME 3TIXA 3VQIA 3I3TB 4HKZE 2LHEA 4W9CA 1AWDA 3BY4B 5IOIA 2LXAA 3P4QB 4PYZA 3L08A 4IWOA 3A9JA 4WJOA 3W5VB 5BYRA 1FRDA 1GPXA 4HDOA 3VR9B 2EMTA 2MJDA 4FXCA 2ZVOA 4BOZB 2MSED 3HUIA 4XDCA 4TMAB 3AE8B 2V9HA 4ANVA 3I57A 5D94A 2N1WA 1SE2A 1AYFA 3R8BA 3RNGC 5JHAA 2M4NA 1I4HA 1QLBB 1SIFA 1WM3A 2AQ3B 1LM8B 3EFCA 4OW0A 1OQYA 3SU8X 4II3B 1MG4A 1SJHD 4RF0A 3CWIA 1SSNA 3DBLI 3RMKC 2OJRA 1N5WA 4HCNB 1E8WA 4HVBA 1IUEA 3T9LA 2CJOA 2BYTA 1YQ3B 2EMSA 3ZRFA 4GN1A 4FA6A 2GBNA 3T3OA 4TKNA 3ECIA 4IKGA 1F0ZA 1SGHA 4ZRJA 4AWJA 3PREA 1Q5WB 2PTLA 4WAAA 4KIKA 5EE0A 2NBVB 4ZRKA 1CQVA 2W9NA 1C4AA 5H8YE 4P16A 4HLEA 2RMMA 1SF0A 2KDMA 1A5RA 2JZZA 1XCTL 1NEKB 4IWPA 2JY6A 2CS4A 3P4PB 2JUOA 2O2VB 2V4IB 4YWGG 3NVVA 1K50A 2FAZA 2LXCA 4HEA1 1RFKA
chains in the Genus database with same CATH topology
1S1QB 3PVLA 2DYOA 2N9PC 4LCDE 3RUIB 2LZ6A 2Z59B 3SD5A 2KX3A 3QC8B 3NHEB 2N7EA 3S2AA 2IY1B 3U7DA 2JZ3B 2HE7A 2LUEA 4MSQB 4I6PA 5KHQA 4PS8A 2I1KA 2NBUA 1VCBA 3P2BA 2LD9A 1WE7A 1E5WA 3RYTA 1R4MI 4GIVA 1E90A 3DVNU 1WR1A 3NY5A 1YX5B 5CTRC 1OGWA 4MGIE 2AL6A 2AWTA 3PLUA 4HWIB 3UINB 3PRMB 4ASWC 2LASA 1WE6A 2MA9B 4GGQA 2K1FA 4GDKB 4A3OA 3M63B 2KLCA 2LWPA 4GSWA 3LJ3A 3PSEB 3EFUA 4WJNA 1GC7A 2RD0A 4FJVB 2AYOB 4PS7A 1NDDA 1P3QU 2ZCCA 3KYCD 4GDLB 3ZTDA 1I35A 2WDTB 4BVUC 4AUQC 4KIKB 3LDZE 2IZVB 4K81A 2DYBA 2DZJA 4BKSD 2LJ5A 2J0MA 4IWQA 1GUAB 2WYQA 3ZVVA 3TL5A 4JGHB 4NQLB 2O6VD 2IO2B 3VTVA 4OVVA 1HE8A 3Q3JA 2BYFA 2DHZA 4CYEA 4GMVA 2J7QB 1J0GA 1WX8A 4DXAB 4TV3A 3EHVA 4KV2A 3R7QA 2DYMA 2KDEB 5JH5C 3PGEA 4ANWA 5C1ZA 3JVZX 1WFYA 2RGFA 2L05A 4GU2A 4BKTA 1E8YA 4G11A 4FHKA 1QZEA 2KD0A 4BKSA 2LGXA 3QWZB 1P1AA 1WGHA 2O6VA 2I1JA 4MM3A 3SHQA 1CMXB 5CHVC 1TGZB 1F9JA 2IYDB 2KFJA 4NAWA 4B95A 1UGMA 3L10B 3ZNID 4OVUA 1SE9A 4WJQA 1WGDA 2KO3A 2ZZPB 2C7HA 3VHTC 3VTUA 3NS8A 2RR9A 4MGZE 3EECA 2MBEA 2LRUA 1RFAA 1WGGA 3A4RA 3CF6E 1E8ZA 3V6EB 2C7MB 1IYFA 5DPTA 3OLMD 3ZNZB 4AJYB 2V1YA 4B9KA 3K9PB 4DHZE 4WQOB 2XBBC 1J8CA 1E7VA 3PZDA 4W9IA 3H1UA 3A33B 2L0TA 2UYZB 3AI5A 3QQ8B 4KDIC 2QHOA 2J0JA 3O65B 3KH0A 2LVOA 3JSVA 1GJZA 4ICVA 2N1VA 3QJZA 2HD5B 2KXJA 2ZNVB 1RRBA 1WJ4A 3AULA 2MP2B 1YQBA 3H7PA 3ONSA 2K8HA 3M95A 5CHFA 3ZW3A 2PE9A 2NPTA 4FADA 3SDLC 1I42A 3A9JB 2MCNB 2FCSA 1OTRB 3GZNI 2C9WB 3A9KB 5J2RA 3WANA 3K9OB 2CKHB 4NJ6A 3V62A 1LXDA 5DCNA 1UD7A 2JF5A 2DZMA 1IPGA 1BT0A 5DPSA 1WH3A 3L0WB 3VDZA 4FULA 2PEAA 1P9DU 1WM2A 3IFWB 2GBMA 2J0KA 2ZNVC 3RULA 2PJHA 1WJNA 3PTFC 2Y5BB 5D2MB 2NR2A 4G50A 3M62B 4CO7A 4DDGD 5BO4B 3JYUA 2XK5A 2GBKA 3R3MA 4MJSA 4EFOA 1UELA 4W9HA 2M1MA 2WX0A 4HJKA 4M8MA 3PHXB 1KM7A 2ZPYA 4LDTD 2L0FA 4EZLA 2FCNA 4TQ0A 4NAWB 3PRZA 2KTRA 5AEKB 3NZUA 5EDSA 3WA0A 2MLBA 2D2QA 4MGKE 1V9JA 2IY0B 3A1QA 5E6PA 1S3SG 2BF8B 5AZHA 2MQJA 2KQSA 4IM3A 2MWSB 1UBQA 4DHZB 3IBEA 4EKUA 3Q3FA 1ISNA 3V61A 4ANUA 2BPSA 4AJWA 2NBWB 2PE6B 3R66C 3X23A 3C0RB 4JLCA 2KWVB 3H9DA 4E71A 2ZVNA 4GB9A 2KN5A 3ZNHB 5LXHA 5CX3A 3L54A 1ZGUB 3QAQA 4ZYNA 2N9XA 4AP4C 2RSUA 5IA7A 2LVPA 3M3JA 1LFDA 3TMPB 4F1SA 3V60A 4URKA 2A4ZA 1AARA 1UH6A 2ZEQA 5TR5A 3APCA 4JL9A 3W1SA 3VVWB 5GMVA 4N9F4 2IO0B 4HDQA 2B3AA 3H7PB 3KUDB 4HPMB 1WRDB 1WXMA 3U8ZA 2KTFA 2M0XA 2G3QB 1WYWB 2MX2A 2NPTB 4M8NA 4FJZA 1WF9A 3U30A 4ZRIA 3DVGY 3PLVA 3ZO5B 2LGYA 3UGBB 1EF5A 3HM3A 2KJRA 2N4FA 1JRUA 1WI0A 3PHWB 4HPLB 4HXDA 2XEWA 3QHTA 4RM8A 3T8MA 3WAMA 2KDIA 2CHZA 2KKCA 1WMHA 2KWUB 4LJOB 2L7RA 3OAWA 1YJ1A 3VUWA 3QCAA 1V49A 3WALA 5C23A 1K8RB 4E74A 1YD8U 4J6IA 4IM0A 2VRRB 4MGYE 2KJ6A 1G6JA 4K7WA 2BKFA 3ML8A 2XK5B 4GOCA 4MJSB 4KVGB 2LGDA 2IO1B 2V3SA 3IHPC 5HKHA 2ZPNA 5JHBA 3UQBA 4DHJD 2KVRA 4FN2A 3UIPB 3D32A 5L95C 1L2NA 1V5OA 2D11A 2BWES 2K6DB 2CHXA 2N9EB 2ZJDA 3N30A 3QIJA 3UF8A 2KTRB 1GC6A 1V86A 2JWZA 3NOBA 3ZKJC 3NZSA 3A1QB 1R4NI 2DZIA 3V6CB 4JQWC 2EKEC 4M0WB 4MELA 3RD2A 2K8CA 3PS6A 2K25A 1P98A 1V80A 2HTHA 2KANA 2IBIB 1WX9A 1EO6A 3ALBA 2FNJB 1FXTB 4K1RB 4LDTB 3UQAA 2D3GA 2JXXA 1TZ1A 4RM9A 1WZ0A 1KLVA 1WJUA 2KK8A 1J19A 2LRWA 4GXBA 4MDKE 3KVFB 4LJPB 3R7RA 2MBQA 2BGFA 4KDLB 3DBSA 4HK2A 5G55A 3L17A 2BWFA 4ZDVA 5AZGA 3DVGX 3QX1A 1NI2A 2ZCBA 4BOSC 2D07B 4FLHA 2KMCA 1E7UA 1OEYA 3KYDD 4BBNF 4KSKC 1H4RA 2NS5A 2KFKA 3IG3A 3OJ4B 4XC2A 4F8CB 4AOFA 4W9FA 2GBJA 1WXSA 3VTWA 1V6EA 2R2QA 3PT2B 1V81A 2ASQA 4DBGA 2BKRB 1LQBA 3EC8A 3VFKA 3VXWA 4B6WA 2C60A 3HM6X 4FHJA 4YL8A 1KOTA 1TTNA 4A20A 4WJPA 2KHWB 1GNUA 3W1SC 1WMHB 2YVCA 4MEMA 3X0WA 1L7YA 4F7ZA 1C3TA 3A4SC 4BBNC 5E6NA 3ENEA 3RCZA 1OEYJ 5D6JB 1XD3B 1XT9B 4BFRA 4FBJB 2JRIB 4DK5A 2FUHB 3N32A 3DPDA 2HJ8A 2KDFB 2O6VB 3MJWA 1Z5SB 3DOWA 1XQQA 5G2NA 2K39A 3VAWA 1D3ZA 2FCQA 2L8JA 5CHWA 2G4SA 3HHMA 2GOWA 2M8SA 2DZKA 3MTNB 1UZXB 3B1LX 4PYUA 4EZJA 2DENB 5LLIA 1WXAA 4W9EA 2K6QA 3DBRI 2KOXA 4W9LA 2AL3A 4WWOA 2LVQA 3ZTCA 2N7DA 2JPHA 4MSMB 3WAOA 2PPHA 1GG3A 2DAJA 2KZRA 2KC2A 1Q1OA 1EF1A 3VUYA 3ZIMA 3TCAA 1YIWA 1RLFA 4PS3A 3H6NA 2LI5A 4NPNA 2KJHB 2KNBA 1WY8A 2L76A 4DHJB 2AEHA 2D10A 4P7IA 5LXIB 4W9JA 2FIFA 2REXA 4W9DA 3JSVB 3WIMA 3HK0A 3ZDTA 1TBEA 3DVNV 2JT4B 4IW0A 1PQSA 1ZW7A 2JVCA 2MBHA 4BKGA 5DPRA 3VH4B 5DPWA 2KC1A 3B0AA 3H7SA 4IUMB 1EUVB 2KQ7A 1WX7A 4JIOU 4HCPB 2KFKB 3TIXA 1RAXA 3VQIA 2OOBB 3ML9A 4ANXA 3I3TB 4EZKA 4NNJB 3L13A 4G3XB 4MH0E 4NJ7A 4W9CA 4A3PA 4I6NB 5E6OA 2A5UA 2CHWA 2G45B 2MP2A 3BY4B 3ZNGC 2LXAA 5J17A 4PYZA 3L08A 3PV1A 1ZKHA 3WAPA 3QA8A 2L00B 4IWOA 3A9JA 1KJTA 3BINA 4WJOA 3A9KA 4WWPA 2MBOA 1IP9A 4HDOA 2DAFA 2EMTA 1MG8A 2BYEA 2KX0A 2ZVOA 3PPAA 2UWQA 4CHKA 5JZEB 4I6LB 4BOZB 2MSED 4KSLC 3CSTA 4FJYA 2KLGA 2O2VA 3VH3B 1C1YB 1M94A 2JRHA 4IC7B 1Y8RC 3DQVA 2MW5A 4K7SA 3KUCB 4G0NB 4ANVA 2IO3B 3GOEA 3JW0X 5D94A 1Z2MA 2N1WA 3AU4A 5J18A 1UBIA 5JHAA 2M4NA 3ZLZA 3DDCB 1SIFA 2CR5A 2M17A 3DCGA 1WR6E 1WM3A 3KUZA 2BYVE 2NCNA 1LM8B 4XZ4A 2NVUI 3OJ3A 3AXCA 3PRPB 5KHOA 4NQKE 1OQYA 1Q0WB 4II3B 3SU8X 3AU5A 4RMAA 5IAAC 1V5TA 3VUXA 4IG7B 1WGRA 4W9GA 1WZ3A 3DBLI 3APDA 2WWZA 1E8XA 2Z0EB 2KWCA 2OJRA 3DBHI 3IVFA 2R2OA 1E8WA 4HCNB 3RZFA 4HVBA 5L83A 3T9LA 2RPQA 3MHSD 2G4DB 2KMAA 3RZWC 2Z0DB 1T0YA 2MBBB 1WJ6A 4EUTA 2EMSA 3ZRFA 2C5LC 2V4LA 2GMIC 1U4AA 5AZFA 4GN1A 3CSFA 4FA6A 1H8CA 2GBNA 4XX5A 4GDKA 4KZ0A 4TKNA 5D7GA 3ECIA 2L3ZA 4EEWA 1WXVA 2KDBA 1SGHA 4ZRJA 4GDLA 2YLMA 3RT3B 3PREA 3UIOB 4AWJA 4E3CA 4K7UA 1Q5WB 4WAAA 4KIKA 4NY0A 4TQ1A 1YX6B 2NBVB 4ZRKA 2W9NA 1VD2A 3QARA 2K8BA 1P0RA 4HLEA 2GBRA 2C7NB 1A5RA 2JZZA 3CMMB 4TUUA 3TJPA 1NBFC 3QK0A 2CU1A 2JY6A 4IWPA 3ZUNA 3APFA 2CS4A 2JUOA 2O2VB 4II2B 2WX1A 3W1YA 1WGYA 1V2YA 4WWNA 2MRPA 3HIZA 5FR6A 3KW5B 3N3KB 2FAZA 4ICUA 3TBLD 2LXCA 4DDID 3B08A 1X1MA 3ZDMC 4EOYA 4DWFA 1WIAA 2DX5B 4X57B 2FIDA 4KZCA 3L16A 4IM2A 3ZRCA 2FCMA 4W9KA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1S1Q B;  3PVL A;  2DYO A;  2N9P C;  4LCD E;  3RUI B;  2LZ6 A;  2Z59 B;  3SD5 A;  2KX3 A;  3QC8 B;  3NHE B;  2N7E A;  3S2A A;  2IY1 B;  3U7D A;  2JZ3 B;  2HE7 A;  2LUE A;  4MSQ B;  4I6P A;  5KHQ A;  4PS8 A;  2I1K A;  2NBU A;  1VCB A;  3P2B A;  2LD9 A;  1WE7 A;  1E5W A;  3RYT A;  1R4M I;  4GIV A;  1E90 A;  3DVN U;  1WR1 A;  3NY5 A;  1YX5 B;  5CTR C;  1OGW A;  4MGI E;  2AL6 A;  2AWT A;  3PLU A;  4HWI B;  3UIN B;  3PRM B;  4ASW C;  2LAS A;  1WE6 A;  2MA9 B;  4GGQ A;  2K1F A;  4GDK B;  4A3O A;  3M63 B;  2KLC A;  2LWP A;  4GSW A;  3LJ3 A;  3PSE B;  3EFU A;  4WJN A;  1GC7 A;  2RD0 A;  4FJV B;  2AYO B;  4PS7 A;  1NDD A;  1P3Q U;  2ZCC A;  3KYC D;  4GDL B;  3ZTD A;  1I35 A;  2WDT B;  4BVU C;  4AUQ C;  4KIK B;  3LDZ E;  2IZV B;  4K81 A;  2DYB A;  2DZJ A;  4BKS D;  2LJ5 A;  2J0M A;  4IWQ A;  1GUA B;  2WYQ A;  3ZVV A;  3TL5 A;  4JGH B;  4NQL B;  2O6V D;  2IO2 B;  3VTV A;  4OVV A;  1HE8 A;  3Q3J A;  2BYF A;  2DHZ A;  4CYE A;  4GMV A;  2J7Q B;  1J0G A;  1WX8 A;  4DXA B;  4TV3 A;  3EHV A;  4KV2 A;  3R7Q A;  2DYM A;  2KDE B;  5JH5 C;  3PGE A;  4ANW A;  5C1Z A;  3JVZ X;  1WFY A;  2RGF A;  2L05 A;  4GU2 A;  4BKT A;  1E8Y A;  4G11 A;  4FHK A;  1QZE A;  2KD0 A;  4BKS A;  2LGX A;  3QWZ B;  1P1A A;  1WGH A;  2O6V A;  2I1J A;  4MM3 A;  3SHQ A;  1CMX B;  5CHV C;  1TGZ B;  1F9J A;  2IYD B;  2KFJ A;  4NAW A;  4B95 A;  1UGM A;  3L10 B;  3ZNI D;  4OVU A;  1SE9 A;  4WJQ A;  1WGD A;  2KO3 A;  2ZZP B;  2C7H A;  3VHT C;  3VTU A;  3NS8 A;  2RR9 A;  4MGZ E;  3EEC A;  2MBE A;  2LRU A;  1RFA A;  1WGG A;  3A4R A;  3CF6 E;  1E8Z A;  3V6E B;  2C7M B;  1IYF A;  5DPT A;  3OLM D;  3ZNZ B;  4AJY B;  2V1Y A;  4B9K A;  3K9P B;  4DHZ E;  4WQO B;  2XBB C;  1J8C A;  1E7V A;  3PZD A;  4W9I A;  3H1U A;  3A33 B;  2L0T A;  2UYZ B;  3AI5 A;  3QQ8 B;  4KDI C;  2QHO A;  2J0J A;  3O65 B;  3KH0 A;  2LVO A;  3JSV A;  1GJZ A;  4ICV A;  2N1V A;  3QJZ A;  2HD5 B;  2KXJ A;  2ZNV B;  1RRB A;  1WJ4 A;  3AUL A;  2MP2 B;  1YQB A;  3H7P A;  3ONS A;  2K8H A;  3M95 A;  5CHF A;  3ZW3 A;  2PE9 A;  2NPT A;  4FAD A;  3SDL C;  1I42 A;  3A9J B;  2MCN B;  2FCS A;  1OTR B;  3GZN I;  2C9W B;  3A9K B;  5J2R A;  3WAN A;  3K9O B;  2CKH B;  4NJ6 A;  3V62 A;  1LXD A;  5DCN A;  1UD7 A;  2JF5 A;  2DZM A;  1IPG A;  1BT0 A;  5DPS A;  1WH3 A;  3L0W B;  3VDZ A;  4FUL A;  2PEA A;  1P9D U;  1WM2 A;  3IFW B;  2GBM A;  2J0K A;  2ZNV C;  3RUL A;  2PJH A;  1WJN A;  3PTF C;  2Y5B B;  5D2M B;  2NR2 A;  4G50 A;  3M62 B;  4CO7 A;  4DDG D;  5BO4 B;  3JYU A;  2XK5 A;  2GBK A;  3R3M A;  4MJS A;  4EFO A;  1UEL A;  4W9H A;  2M1M A;  2WX0 A;  4HJK A;  4M8M A;  3PHX B;  1KM7 A;  2ZPY A;  4LDT D;  2L0F A;  4EZL A;  2FCN A;  4TQ0 A;  4NAW B;  3PRZ A;  2KTR A;  5AEK B;  3NZU A;  5EDS A;  3WA0 A;  2MLB A;  2D2Q A;  4MGK E;  1V9J A;  2IY0 B;  3A1Q A;  5E6P A;  1S3S G;  2BF8 B;  5AZH A;  2MQJ A;  2KQS A;  4IM3 A;  2MWS B;  1UBQ A;  4DHZ B;  3IBE A;  4EKU A;  3Q3F A;  1ISN A;  3V61 A;  4ANU A;  2BPS A;  4AJW A;  2NBW B;  2PE6 B;  3R66 C;  3X23 A;  3C0R B;  4JLC A;  2KWV B;  3H9D A;  4E71 A;  2ZVN A;  4GB9 A;  2KN5 A;  3ZNH B;  5LXH A;  5CX3 A;  3L54 A;  1ZGU B;  3QAQ A;  4ZYN A;  2N9X A;  4AP4 C;  2RSU A;  5IA7 A;  2LVP A;  3M3J A;  1LFD A;  3TMP B;  4F1S A;  3V60 A;  4URK A;  2A4Z A;  1AAR A;  1UH6 A;  2ZEQ A;  5TR5 A;  3APC A;  4JL9 A;  3W1S A;  3VVW B;  5GMV A;  4N9F 4;  2IO0 B;  4HDQ A;  2B3A A;  3H7P B;  3KUD B;  4HPM B;  1WRD B;  1WXM A;  3U8Z A;  2KTF A;  2M0X A;  2G3Q B;  1WYW B;  2MX2 A;  2NPT B;  4M8N A;  4FJZ A;  1WF9 A;  3U30 A;  4ZRI A;  3DVG Y;  3PLV A;  3ZO5 B;  2LGY A;  3UGB B;  1EF5 A;  3HM3 A;  2KJR A;  2N4F A;  1JRU A;  1WI0 A;  3PHW B;  4HPL B;  4HXD A;  2XEW A;  3QHT A;  4RM8 A;  3T8M A;  3WAM A;  2KDI A;  2CHZ A;  2KKC A;  1WMH A;  2KWU B;  4LJO B;  2L7R A;  3OAW A;  1YJ1 A;  3VUW A;  3QCA A;  1V49 A;  3WAL A;  5C23 A;  1K8R B;  4E74 A;  1YD8 U;  4J6I A;  4IM0 A;  2VRR B;  4MGY E;  2KJ6 A;  1G6J A;  4K7W A;  2BKF A;  3ML8 A;  2XK5 B;  4GOC A;  4MJS B;  4KVG B;  2LGD A;  2IO1 B;  2V3S A;  3IHP C;  5HKH A;  2ZPN A;  5JHB A;  3UQB A;  4DHJ D;  2KVR A;  4FN2 A;  3UIP B;  3D32 A;  5L95 C;  1L2N A;  1V5O A;  2D11 A;  2BWE S;  2K6D B;  2CHX A;  2N9E B;  2ZJD A;  3N30 A;  3QIJ A;  3UF8 A;  2KTR B;  1GC6 A;  1V86 A;  2JWZ A;  3NOB A;  3ZKJ C;  3NZS A;  3A1Q B;  1R4N I;  2DZI A;  3V6C B;  4JQW C;  2EKE C;  4M0W B;  4MEL A;  3RD2 A;  2K8C A;  3PS6 A;  2K25 A;  1P98 A;  1V80 A;  2HTH A;  2KAN A;  2IBI B;  1WX9 A;  1EO6 A;  3ALB A;  2FNJ B;  1FXT B;  4K1R B;  4LDT B;  3UQA A;  2D3G A;  2JXX A;  1TZ1 A;  4RM9 A;  1WZ0 A;  1KLV A;  1WJU A;  2KK8 A;  1J19 A;  2LRW A;  4GXB A;  4MDK E;  3KVF B;  4LJP B;  3R7R A;  2MBQ A;  2BGF A;  4KDL B;  3DBS A;  4HK2 A;  5G55 A;  3L17 A;  2BWF A;  4ZDV A;  5AZG A;  3DVG X;  3QX1 A;  1NI2 A;  2ZCB A;  4BOS C;  2D07 B;  4FLH A;  2KMC A;  1E7U A;  1OEY A;  3KYD D;  4BBN F;  4KSK C;  1H4R A;  2NS5 A;  2KFK A;  3IG3 A;  3OJ4 B;  4XC2 A;  4F8C B;  4AOF A;  4W9F A;  2GBJ A;  1WXS A;  3VTW A;  1V6E A;  2R2Q A;  3PT2 B;  1V81 A;  2ASQ A;  4DBG A;  2BKR B;  1LQB A;  3EC8 A;  3VFK A;  3VXW A;  4B6W A;  2C60 A;  3HM6 X;  4FHJ A;  4YL8 A;  1KOT A;  1TTN A;  4A20 A;  4WJP A;  2KHW B;  1GNU A;  3W1S C;  1WMH B;  2YVC A;  4MEM A;  3X0W A;  1L7Y A;  4F7Z A;  1C3T A;  3A4S C;  4BBN C;  5E6N A;  3ENE A;  3RCZ A;  1OEY J;  5D6J B;  1XD3 B;  1XT9 B;  4BFR A;  4FBJ B;  2JRI B;  4DK5 A;  2FUH B;  3N32 A;  3DPD A;  2HJ8 A;  2KDF B;  2O6V B;  3MJW A;  1Z5S B;  3DOW A;  1XQQ A;  5G2N A;  2K39 A;  3VAW A;  1D3Z A;  2FCQ A;  2L8J A;  5CHW A;  2G4S A;  3HHM A;  2GOW A;  2M8S A;  2DZK A;  3MTN B;  1UZX B;  3B1L X;  4PYU A;  4EZJ A;  2DEN B;  5LLI A;  1WXA A;  4W9E A;  2K6Q A;  3DBR I;  2KOX A;  4W9L A;  2AL3 A;  4WWO A;  2LVQ A;  3ZTC A;  2N7D A;  2JPH A;  4MSM B;  3WAO A;  2PPH A;  1GG3 A;  2DAJ A;  2KZR A;  2KC2 A;  1Q1O A;  1EF1 A;  3VUY A;  3ZIM A;  3TCA A;  1YIW A;  1RLF A;  4PS3 A;  3H6N A;  2LI5 A;  4NPN A;  2KJH B;  2KNB A;  1WY8 A;  2L76 A;  4DHJ B;  2AEH A;  2D10 A;  4P7I A;  5LXI B;  4W9J A;  2FIF A;  2REX A;  4W9D A;  3JSV B;  3WIM A;  3HK0 A;  3ZDT A;  1TBE A;  3DVN V;  2JT4 B;  4IW0 A;  1PQS A;  1ZW7 A;  2JVC A;  2MBH A;  4BKG A;  5DPR A;  3VH4 B;  5DPW A;  2KC1 A;  3B0A A;  3H7S A;  4IUM B;  1EUV B;  2KQ7 A;  1WX7 A;  4JIO U;  4HCP B;  2KFK B;  3TIX A;  1RAX A;  3VQI A;  2OOB B;  3ML9 A;  4ANX A;  3I3T B;  4EZK A;  4NNJ B;  3L13 A;  4G3X B;  4MH0 E;  4NJ7 A;  4W9C A;  4A3P A;  4I6N B;  5E6O A;  2A5U A;  2CHW A;  2G45 B;  2MP2 A;  3BY4 B;  3ZNG C;  2LXA A;  5J17 A;  4PYZ A;  3L08 A;  3PV1 A;  1ZKH A;  3WAP A;  3QA8 A;  2L00 B;  4IWO A;  3A9J A;  1KJT A;  3BIN A;  4WJO A;  3A9K A;  4WWP A;  2MBO A;  1IP9 A;  4HDO A;  2DAF A;  2EMT A;  1MG8 A;  2BYE A;  2KX0 A;  2ZVO A;  3PPA A;  2UWQ A;  4CHK A;  5JZE B;  4I6L B;  4BOZ B;  2MSE D;  4KSL C;  3CST A;  4FJY A;  2KLG A;  2O2V A;  3VH3 B;  1C1Y B;  1M94 A;  2JRH A;  4IC7 B;  1Y8R C;  3DQV A;  2MW5 A;  4K7S A;  3KUC B;  4G0N B;  4ANV A;  2IO3 B;  3GOE A;  3JW0 X;  5D94 A;  1Z2M A;  2N1W A;  3AU4 A;  5J18 A;  1UBI A;  5JHA A;  2M4N A;  3ZLZ A;  3DDC B;  1SIF A;  2CR5 A;  2M17 A;  3DCG A;  1WR6 E;  1WM3 A;  3KUZ A;  2BYV E;  2NCN A;  1LM8 B;  4XZ4 A;  2NVU I;  3OJ3 A;  3AXC A;  3PRP B;  5KHO A;  4NQK E;  1OQY A;  1Q0W B;  4II3 B;  3SU8 X;  3AU5 A;  4RMA A;  5IAA C;  1V5T A;  3VUX A;  4IG7 B;  1WGR A;  4W9G A;  1WZ3 A;  3DBL I;  3APD A;  2WWZ A;  1E8X A;  2Z0E B;  2KWC A;  2OJR A;  3DBH I;  3IVF A;  2R2O A;  1E8W A;  4HCN B;  3RZF A;  4HVB A;  5L83 A;  3T9L A;  2RPQ A;  3MHS D;  2G4D B;  2KMA A;  3RZW C;  2Z0D B;  1T0Y A;  2MBB B;  1WJ6 A;  4EUT A;  2EMS A;  3ZRF A;  2C5L C;  2V4L A;  2GMI C;  1U4A A;  5AZF A;  4GN1 A;  3CSF A;  4FA6 A;  1H8C A;  2GBN A;  4XX5 A;  4GDK A;  4KZ0 A;  4TKN A;  5D7G A;  3ECI A;  2L3Z A;  4EEW A;  1WXV A;  2KDB A;  1SGH A;  4ZRJ A;  4GDL A;  2YLM A;  3RT3 B;  3PRE A;  3UIO B;  4AWJ A;  4E3C A;  4K7U A;  1Q5W B;  4WAA A;  4KIK A;  4NY0 A;  4TQ1 A;  1YX6 B;  2NBV B;  4ZRK A;  2W9N A;  1VD2 A;  3QAR A;  2K8B A;  1P0R A;  4HLE A;  2GBR A;  2C7N B;  1A5R A;  2JZZ A;  3CMM B;  4TUU A;  3TJP A;  1NBF C;  3QK0 A;  2CU1 A;  2JY6 A;  4IWP A;  3ZUN A;  3APF A;  2CS4 A;  2JUO A;  2O2V B;  4II2 B;  2WX1 A;  3W1Y A;  1WGY A;  1V2Y A;  4WWN A;  2MRP A;  3HIZ A;  5FR6 A;  3KW5 B;  3N3K B;  2FAZ A;  4ICU A;  3TBL D;  2LXC A;  4DDI D;  3B08 A;  1X1M A;  3ZDM C;  4EOY A;  4DWF A;  1WIA A;  2DX5 B;  4X57 B;  2FID A;  4KZC A;  3L16 A;  4IM2 A;  3ZRC A;  2FCM A;  4W9K A; 
#chains in the Genus database with same CATH topology
 2DYO A;  4B0M A;  2KX3 A;  4WIP A;  1ZDX A;  2N7E A;  3S2A A;  2I2Y A;  3U7D A;  3FAH A;  4PS8 A;  2I1K A;  2NBU A;  1D6E C;  2BB5 A;  3RYT A;  1R4M I;  3DVN U;  4KGS A;  4JPS A;  4ARC A;  1OGW A;  4A90 A;  2AWT A;  3PRM B;  3B2F A;  4GDK B;  2KLC A;  2BW2 A;  3LJ3 A;  4PS7 A;  2ZCC A;  2Y3A A;  2QCZ A;  4BVU C;  1HQR D;  3MJ5 A;  1GUA B;  4NQL B;  2O6V D;  2XNA C;  3BWU D;  1HE8 A;  2BYF A;  3U52 E;  4N58 A;  4TV3 A;  1SE4 A;  2MHJ A;  3PGE A;  4J3O D;  1WFY A;  3NJT A;  3MP9 A;  3NVW A;  4GU2 A;  2WNM A;  4AS1 A;  2KD0 A;  5AUK A;  1WGH A;  2O6V A;  1E10 A;  1LGR A;  2BB6 A;  1CMX B;  5CHV C;  1TGZ B;  2IYD B;  4OVU A;  3DHI C;  3VTU A;  1N6Z A;  1GB4 A;  3NS8 A;  1D5X C;  2KAC A;  2LEK A;  1TIF A;  3EEC A;  2MBE A;  1IGC A;  2Y5P A;  2ZW1 A;  3Q8F A;  1E8Z A;  5DPT A;  3OLM D;  1Q10 A;  3GB1 A;  2G1E A;  2XBB C;  3H1U A;  2I38 A;  3O65 B;  1GJZ A;  2N1V A;  2HD5 B;  1YQB A;  3ONS A;  3M95 A;  3ZW3 A;  2PE9 A;  2W54 A;  4KX6 B;  2FCS A;  3EA6 A;  1TZO A;  3GZN I;  3W2D A;  3A9K B;  5FKA C;  1VZ7 A;  2JSV X;  4L2Y A;  1WH3 A;  3VDZ A;  1SE3 A;  5G5G A;  4C7Y A;  2RDB C;  4YTN B;  2ZNV C;  3PTF C;  2Y5B B;  5D2M B;  3M62 B;  4CO7 A;  4DDG D;  3ZQ4 A;  1C4P A;  4UDU C;  4W9H A;  4XWT A;  4HJK A;  4M8M A;  3PHX B;  4MM3 B;  1DOX A;  2ON8 A;  4TQ0 A;  4NAW B;  3PRZ A;  3TUO A;  1SIJ A;  4KGT A;  1QOF A;  5EDS A;  2MLB A;  5E6P A;  4M0W A;  1ZPS A;  3IBE A;  4AJW A;  3OWE B;  3R66 C;  3U7Z A;  3H9D A;  2JZP A;  3SEB A;  2ZVN A;  2J53 A;  1MI0 A;  3ZNH B;  3L54 A;  4LNK A;  3QAQ A;  4ZYN A;  2N9X A;  1AN8 A;  1LFD A;  2A4Z A;  1AAR A;  2ZEQ A;  3W1S A;  3VVW B;  4N9F 4;  3H7P B;  1WXM A;  1CJE A;  5IP4 D;  4FJZ A;  2WXR A;  2LGY A;  3VR8 B;  3UGB B;  2N4F A;  2B76 B;  1WI0 A;  4HXD A;  3QHT A;  4ZOH C;  5TSS A;  1VZ6 A;  3MFG A;  2CHZ A;  1N62 A;  1YJ1 A;  1OFF A;  3QCA A;  3WAL A;  1BML C;  5C23 A;  2YEP B;  4J6I A;  4MGY E;  2YEP F;  2KJ6 A;  2BKF A;  5HKH A;  4KVG B;  3IHP C;  4M01 A;  3UQB A;  2KVR A;  4O1N A;  2ZJD A;  3Q3M C;  1GC6 A;  2KTR B;  1V86 A;  2JWZ A;  1IBX B;  3KLS X;  1T0R C;  2DZI A;  4JQW C;  2EKE C;  3P1M A;  4MEL A;  2H89 B;  1E7P B;  1I4X A;  2KAN A;  2CU3 A;  1YN5 A;  1I4R A;  4LDT B;  1HZ5 A;  3AM9 A;  2KK8 A;  2LRW A;  3KVF B;  1L5P A;  2MBQ A;  2N7J A;  2BGF A;  3DBS A;  4LNO A;  3L17 A;  1FCL A;  1XEE A;  3DVG X;  4PT5 A;  4BOS C;  1F77 A;  1E7U A;  1FFV A;  4KSK C;  3IG3 A;  2FUG 1;  4F8C B;  4AOF A;  4W9F A;  2GBJ A;  3VTW A;  1T5X D;  4YT0 B;  1L6V A;  4B6W A;  4FHJ A;  1KOT A;  1AW7 A;  3W1S C;  1WMH B;  2BT6 A;  4F7Z A;  1FFU A;  2HJ1 A;  3AEA B;  2MJ3 A;  2QIL A;  3RCZ A;  3SFD B;  1QIL A;  2HJ8 A;  1TY2 A;  4HRO A;  2KDF B;  3C8Y A;  1VR9 A;  4RGO S;  1XQQ A;  5G2N A;  5BMG A;  2L8J A;  1BXT A;  2DZK A;  2J52 A;  4W9E A;  2K6Q A;  3DBR I;  4W9L A;  4WWO A;  3BZD B;  3VRA B;  4A9A A;  3ZJU A;  2WGS A;  4WWM A;  4H2A A;  1M4V A;  2KZR A;  4WUR A;  2NMQ A;  3KWV A;  3VUY A;  3ZIM A;  1RLF A;  3CIR B;  4K3B A;  4K3C A;  3H6N A;  2KJH B;  2KNB A;  2L76 A;  4DHJ B;  1E9M A;  1EU4 A;  3Q14 C;  2VH2 A;  3J9C A;  3ZDT A;  1YOV B;  3GE8 C;  3DVN V;  2JT4 B;  1VRA B;  2JVC A;  1WGK A;  2JYE A;  3HVD A;  3B0A A;  4IUM B;  1EUV B;  1UWX A;  2KQ7 A;  3Q8B A;  2INP E;  4ANX A;  3ML9 A;  4NNJ B;  1EWY C;  4NJ7 A;  4ARI A;  4MAC A;  1WXQ A;  4I6N B;  5E6O A;  3VRB B;  2CHW A;  5J17 A;  1FNV A;  1TJE A;  3N9Y C;  1D5Z C;  3A9K A;  3AE4 B;  2MBO A;  1XO3 A;  4N59 A;  2BYE A;  2CJN A;  2V3P A;  1P7E A;  2UWQ A;  1FXI A;  4I6L B;  3U2S C;  3CST A;  3NVY A;  3FC4 A;  1Y8R C;  3H8H A;  3JW0 X;  1XLQ A;  2IGH A;  3GE3 C;  2KAJ A;  3DDC B;  2M17 A;  2CR5 A;  3DCG A;  3ZXR A;  1V1O A;  2JWU A;  1ET9 A;  3Q8E A;  4XZ4 A;  1E6E B;  3AXC A;  5KHO A;  1Q0W B;  4ZYS A;  5IAA C;  4RMA A;  1V5T A;  1WGR A;  4W9G A;  2WWZ A;  3DBH I;  3IVF A;  1FNU A;  3AB5 A;  3Q8C A;  1FIQ A;  1WJ6 A;  1H8C A;  2GMI C;  1U4A A;  4KKI A;  4XX5 A;  1WXV A;  3R2I A;  1RWS A;  3BVZ A;  2BTE A;  1B9R A;  3QAR A;  1P0R A;  2C7N B;  2DBY A;  4WQM A;  3R2T A;  5IKC M;  3RFZ B;  2Z8L A;  2ACZ B;  1ENF A;  3W1Y A;  1YN3 A;  2UU7 A;  1V2Y A;  4WWN A;  2MRP A;  3ZJT A;  5FR6 A;  3N3K B;  3TBL D;  2E6X A;  3B08 A;  1X1M A;  3IT6 B;  3L16 A;  4IM2 A;  3ZRC A;  4W9K A;  3URY A;  4D2K A;  1S1Q B;  2N9P C;  3RUI B;  4YTM B;  1Y56 A;  3SD5 A;  2K9X A;  4MSQ B;  1LO5 D;  4I6P A;  2KQ4 X;  1MHX A;  1SXT A;  1E5W A;  4GIV A;  1E90 A;  2JX5 A;  3AMZ A;  4MT5 A;  1WR1 A;  3UIN B;  4ASW C;  2MA9 B;  3M63 B;  1SBB B;  2AYO B;  1NDD A;  2KVZ A;  3ZTD A;  4GDL B;  3LXF A;  2WDT B;  3U4E G;  3LDZ E;  2DYB A;  4BKS D;  4JWS C;  2J0M A;  2WYQ A;  1N5X A;  4JGH B;  2IO2 B;  4C4V B;  1R4N B;  1V1P A;  4CYE A;  1WX8 A;  4DXA B;  4KV2 A;  3GS2 A;  2KDE B;  1JAL A;  1KTK A;  1E8Y A;  5FK9 C;  4G11 A;  1QZE A;  4BKS A;  1FD6 A;  3QWZ B;  1P1A A;  1TS5 A;  3AE3 B;  1YQ4 B;  1F9J A;  2KFJ A;  1UGM A;  2W3S A;  2GRI A;  1SE9 A;  2ZZP B;  2RR9 A;  1D4B A;  2WDQ B;  3PO0 A;  3V6E B;  4YSY B;  2V1Y A;  4DHZ E;  1YJJ A;  4WQO B;  1K51 A;  1CZP A;  1FPY A;  2L0T A;  3AI5 A;  3QQ8 B;  2QHO A;  3L4P A;  4ICV A;  4BZA A;  1RRB A;  1WJ4 A;  2K8H A;  2L32 A;  2MCN B;  2C9W B;  3K9O B;  1LXD A;  1UD7 A;  1JRO A;  3NVZ A;  4A8X C;  2PEA A;  5D3D A;  2J0K A;  3RUL A;  2PJH A;  3MC9 A;  1C78 A;  4MJS A;  3KQ4 A;  2WX0 A;  2WXL A;  2ZPY A;  4XYC A;  1F2R I;  4EZL A;  3V05 A;  5AEK B;  3WA0 A;  4MGK E;  1S3S G;  4DHZ B;  2KQS A;  2VZK D;  1ISN A;  3V61 A;  5HG2 A;  4ANU A;  2NBW B;  4JLC A;  1EWC A;  2DWQ A;  1ZGU B;  2WXF A;  3PZ8 A;  4AQ7 A;  5IA7 A;  3I9V 1;  1UH6 A;  4IOI E;  4JL9 A;  5GMV A;  4RNA A;  3KUD B;  4HPM B;  2KTF A;  1MHH E;  1XXG A;  1TYG B;  2NPT B;  1WF9 A;  3U30 A;  4ZRI A;  2L83 A;  4LLG M;  2WXI A;  2KJR A;  4KKJ A;  3NG0 A;  2WXH A;  3BVM A;  4R3D A;  3T8M A;  3T3N A;  3WAM A;  2KDI A;  5C3J B;  4ZRQ A;  1KLG D;  4LJO B;  2BS2 B;  2OHF A;  2M56 B;  1WRI A;  2VRR B;  4HRS A;  4K7W A;  3ML8 A;  2XK5 B;  3DBL B;  4GOC A;  1ZOY B;  5JHB A;  1XLN A;  4US9 A;  4KGR A;  3RNC C;  5HFY A;  2N9E B;  3N30 A;  3QIJ A;  3AEF B;  2WDR B;  2WDV B;  2D3B A;  3Q3N C;  5BYQ A;  3A1Q B;  4OZA A;  3V6C B;  2L1A A;  4B0E A;  1C77 A;  2K8C A;  3N1Z C;  3ALB A;  2IBI B;  5EE9 A;  3UQA A;  3IAS 1;  4N6E B;  4GXB A;  3R7R A;  4KDL B;  5G55 A;  2WXO A;  3BK2 A;  1V8C A;  1A70 A;  3ZGZ A;  3AE9 B;  2ZCB A;  4FLH A;  2KMC A;  1OEY A;  4BBN F;  5IO9 A;  3OJ4 B;  3IXS A;  3PT2 B;  1V81 A;  4DBG A;  1D5M C;  1LQB A;  1ROE A;  3VFK A;  4A20 A;  2LJI A;  2RPV A;  3NZ3 A;  4XGA B;  4C80 A;  3X0W A;  1C3T A;  3N20 C;  4BFR A;  4FBJ B;  1MFW A;  2IND C;  4C4V A;  4DK5 A;  3N32 A;  2J4X A;  3BYT B;  3TEW A;  1Z5S B;  3DOW A;  4OZC A;  3VAW A;  1D3Z A;  1DYQ A;  1R4M B;  2M8S A;  2WS3 B;  1L6U A;  2DEN B;  5LLI A;  1WXA A;  2KOX A;  3ZXV A;  2LVQ A;  2N7D A;  1NI3 A;  2JPH A;  2IGG A;  2PPH A;  2DAJ A;  2WU2 B;  1YIW A;  1VLB A;  4JE3 B;  4PS3 A;  2LI5 A;  3GP7 A;  1WY8 A;  1N61 A;  2AEH A;  1FM0 D;  2D10 A;  4P7I A;  2VH1 A;  5LXI B;  3EGR A;  3PZ7 A;  2FIF A;  4XDD A;  1N63 A;  1T0S C;  4ZHP A;  1TBE A;  1ZE3 D;  5DPR A;  2V0G A;  1XF5 L;  2AX5 A;  2KC1 A;  4JIO U;  2KFK B;  1RAX A;  2OOB B;  3L13 A;  4G3X B;  4MH0 E;  4A3P A;  2QC8 A;  2WXQ A;  2LGS A;  2X8X X;  2G45 B;  1QT9 A;  5BYS A;  1JWB D;  1ZKH A;  3Q6B A;  3QA8 A;  3Q8A A;  4WWP A;  4NJC A;  1MG8 A;  2KX0 A;  5JZE B;  4CHK A;  4KSL C;  1UWM A;  3P4S B;  2O2V A;  2K5P A;  3VH3 B;  1C1Y B;  2JRH A;  4K7S A;  1QOA A;  2IO3 B;  5BMH A;  4OHJ A;  4LK0 M;  4JX1 C;  3AU4 A;  5J18 A;  1UBI A;  2KN4 A;  3EUB 2;  1WR6 E;  2BYV E;  2NVU I;  5HI1 A;  3OJ3 A;  3PRP B;  3AU5 A;  3GZN B;  4USA A;  4IG7 B;  4YSX B;  1WZ3 A;  2ZW0 A;  3APD A;  3NRZ A;  1KH0 A;  2Z0E B;  2KWC A;  4ZDV A;  2R2O A;  5E6J A;  2RPQ A;  3RZW C;  4RGN A;  4PK1 A;  4EUT A;  5AZF A;  2V4L A;  2LHD A;  2BS3 B;  4GDK A;  4KZ0 A;  4RGM A;  4EEW A;  4BAX A;  1TS4 A;  2KDB A;  2YLM A;  3UIO B;  4E3C A;  4K7U A;  4NY0 A;  1MPE A;  2JYT A;  1YX6 B;  4RF1 A;  2NTT A;  1GAQ B;  2PVG C;  1C4C A;  3N1X C;  5H92 C;  2PIA A;  1QQR A;  1I4G A;  2QSD A;  1UGJ A;  2CU1 A;  4M00 A;  3ZUN A;  4C56 C;  1I4Q A;  4II2 B;  5EE3 A;  1YNT E;  4DDI D;  1KLU D;  1WIA A;  2DX5 B;  4X57 B;  3P42 A;  2FCM A;  3Q2A C;  2KYW A;  2PKO A;  3PVL A;  4LCD E;  4DQO C;  4OVZ A;  4DXF A;  2LZ6 A;  3I63 C;  1FXA A;  1HTO A;  3QC8 B;  4L23 A;  4TSS A;  2IY1 B;  2JZ3 B;  2HE7 A;  4JWU C;  1VCB A;  1K53 A;  3P2B A;  2LD9 A;  1EM7 A;  1YX5 B;  3P4R B;  3ABV B;  3PLU A;  3HRD D;  2WQY B;  4GGQ A;  3AED B;  4A3O A;  1TKY A;  2LWP A;  4GSW A;  3EFU A;  4WJN A;  1GC7 A;  4FJV B;  5D3I B;  3KYC D;  4P1B C;  2GI9 A;  4AUQ C;  4KIK B;  2IZV B;  2DZJ A;  3TL5 A;  1VZ8 A;  3LYY A;  1J0G A;  4REZ A;  3BII D;  3E56 A;  1SB3 C;  2LUM A;  3AEB B;  4XE0 A;  5JH5 C;  1YN4 A;  1K52 A;  3WCQ A;  2L05 A;  1OQR A;  4EE2 A;  4FHK A;  2D3C A;  1CK1 A;  1TT5 B;  4MM3 A;  1HEZ E;  4NZL B;  4MH8 A;  4NAW A;  3ZNI D;  4WJQ A;  3VHT C;  2C7H A;  2PVO D;  1F52 A;  4P1C C;  3RPF C;  3A4R A;  2ONQ A;  4B9K A;  1ESF A;  1VJK A;  1ET6 A;  2UYZ B;  2J0J A;  4A55 A;  1JQ4 A;  2ICI A;  3QJZ A;  3H7P A;  2KXJ A;  2ZNV B;  3AUL A;  1JWA D;  2MP2 B;  5CHF A;  4FAD A;  1F1H A;  1I42 A;  2WXM A;  5J2R A;  2RDG A;  3AEE B;  3WAN A;  2CKH B;  4NJ6 A;  3V62 A;  5DCN A;  2JF5 A;  3DBR B;  2DZM A;  1BT0 A;  1PFD A;  3L0W B;  4FUL A;  1J7C A;  3AE6 B;  1P9D U;  1WM2 A;  2GBM A;  1WJN A;  1F2R C;  5BO4 B;  1C76 A;  3R3M A;  1UEL A;  2M1M A;  4LDT D;  2BQQ A;  1FNW A;  1NYQ A;  2WXK A;  2KTR A;  1IBX A;  1V9J A;  2IY0 B;  2BF8 B;  5AZH A;  4IM3 A;  2MWS B;  2SEB D;  3AV8 A;  4EKU A;  3ZYY X;  3Q3F A;  2BPS A;  1E0Z A;  1FMA D;  2PE6 B;  4RCO A;  3X23 A;  3C0R B;  1XCQ L;  1PDX A;  3RNB C;  2QEJ C;  5LXH A;  3AEC B;  5IN7 A;  2LVP A;  3M3J A;  3TMP B;  1QOB A;  3APC A;  4HDQ A;  2B3A A;  4S17 A;  3U8Z A;  1WRD B;  1HTQ A;  1GOZ A;  4YSZ B;  2M0X A;  2G3Q B;  4M8N A;  4HJG E;  3DVG Y;  3PLV A;  3ZO5 B;  2K22 A;  3OG5 A;  1JRU A;  3AE2 B;  4RM8 A;  1WMH A;  2KWU B;  2L7R A;  1MJD A;  3OAW A;  1I4P A;  3ZJV A;  1K8R B;  4RH6 A;  4E74 A;  3IAM 1;  2FE8 A;  4RFB A;  3DBH B;  2DNF A;  4DHJ D;  3BVG A;  3V3X A;  1L2N A;  1V5O A;  2K6D B;  3UF8 A;  3AEG B;  3NOB A;  2V3N A;  3ZKJ C;  5GXG B;  4M0W B;  3RD2 A;  3PS6 A;  2K25 A;  1V80 A;  1EO6 A;  2D3A A;  1FXT B;  2JXX A;  4RM9 A;  1WZ0 A;  2WU5 B;  1KLV A;  1WJU A;  4NAM A;  4QAY A;  5FR3 A;  3AE5 B;  2IJ0 A;  5AZG A;  2N9K A;  3QX1 A;  3LB8 C;  1PGX A;  2D07 B;  3KYD D;  1J7A A;  1H4R A;  2NS5 A;  4HPP A;  4XC2 A;  1DOY A;  5MPO A;  1V6E A;  2R2Q A;  2ASQ A;  1BUI C;  1DGJ A;  3EC8 A;  2C60 A;  3HM6 X;  2WLB A;  2XN9 C;  3O13 A;  4IDI A;  1JWM D;  2JXT A;  4WJP A;  2YVC A;  2G9H D;  1L7Y A;  5E6N A;  3ENE A;  1OEY J;  3AE1 B;  5D6J B;  1XT9 B;  2IGD A;  2JRI B;  1PYW D;  1ZUD 2;  2FUH B;  2E3T A;  2OJW A;  1JWS D;  3MJW A;  2NTS A;  2W3R A;  2K39 A;  2G4S A;  1UUP A;  2LGI A;  1PGB A;  3MTN B;  4S0R A;  2HDE A;  1YJI A;  3UI3 A;  3ZTC A;  1STE A;  3WAO A;  1KF6 B;  2KT7 A;  1EF1 A;  2GB1 A;  3TCA A;  4DXG A;  5LNK 1;  2LMC A;  3HVZ A;  1TKE A;  3JSV B;  3HK0 A;  4LNI A;  4IW0 A;  1ZW7 A;  2MBH A;  4BKG A;  1DOI A;  5DPW A;  1SEB D;  1WX7 A;  4HCP B;  4EZK A;  2INC C;  2N9L A;  2A5U A;  3ZNG C;  2MP2 A;  4OZB A;  3PV1 A;  1FO4 A;  3WAP A;  2L00 B;  1HZ6 A;  1KJT A;  3BIN A;  1JML A;  1IP9 A;  2DAF A;  3C19 A;  3PPA A;  4M02 A;  1TY0 A;  1TS3 A;  2IDY A;  4FJY A;  2KLG A;  1SJE D;  1M94 A;  4WAF A;  2W55 A;  4IC7 B;  3DQV A;  5C2T B;  2MW5 A;  3W5U B;  3AE7 B;  3KUC B;  4G0N B;  3E9S A;  3GOE A;  1Z2M A;  2KWD A;  3BK1 A;  3ZLZ A;  1L4Z B;  3KUZ A;  2NCN A;  2L52 A;  4NQK E;  3FIL B;  3VUX A;  3Q3O C;  4GLS C;  4RGT A;  1E8X A;  2K0P A;  3RZF A;  1I7H A;  5L83 A;  4ITK A;  3MHS D;  2G4D B;  2KMA A;  2WXG A;  1NEN B;  2Z0D B;  1T0Y A;  2MBB B;  2C5L C;  3CSF A;  1NVI D;  1QF6 A;  5D7G A;  2WXJ A;  2L3Z A;  4Q2J A;  4GDL A;  3RT3 B;  1PGA A;  4P6V F;  3MC0 B;  2WP9 B;  4TQ1 A;  2PW9 A;  2KMM A;  1VD2 A;  2TSS A;  1FCC C;  2K8B A;  2GBR A;  3CMM B;  4TUU A;  3TJP A;  1T0Q C;  1NBF C;  3QK0 A;  3APF A;  1XLO A;  3MC8 A;  3RI7 C;  1HA5 A;  3B2G A;  2WX1 A;  1WGY A;  5EE1 A;  1JRP A;  2PLP A;  3HIZ A;  3KW5 B;  4ICU A;  3ZDM C;  4EOY A;  4DWF A;  2FID A;  4KZC A;  1QKZ A;  1JW9 D;  3TSS A;  2Z59 B;  1P7F A;  2M19 A;  1JCK B;  3NHE B;  2LUE A;  5KHQ A;  3N1Y C;  3B9J A;  1WE7 A;  4WH4 A;  1KRH A;  2N0S B;  3NY5 A;  3MHZ A;  5CTR C;  4MGI E;  2AL6 A;  4HWI B;  2DLB A;  2LAS A;  1WE6 A;  5G5H A;  2K1F A;  2K3U A;  3PSE B;  2SAK A;  2RD0 A;  1P3Q U;  1UF0 A;  1I35 A;  4K81 A;  3BYY B;  2LJ5 A;  3TEX A;  4IWQ A;  3ZVV A;  4ZRP A;  2OED A;  3VTV A;  4OVV A;  3NS1 A;  3Q3J A;  3RNE C;  2DHZ A;  1JWU D;  4GMV A;  2J7Q B;  3EHV A;  4ACF A;  3R7Q A;  2DYM A;  4ANW A;  5C1Z A;  3JVZ X;  2RGF A;  4BKT A;  1L4D B;  3TEY A;  2LGX A;  1RYJ A;  2I1J A;  2AQ2 B;  3SHQ A;  3DWM A;  4B95 A;  3Q69 A;  3L10 B;  2WXP A;  3P63 A;  2X38 A;  1WGD A;  2KO3 A;  2EKI A;  4MGZ E;  2LRU A;  1RFA A;  3W9C B;  1WGG A;  3CF6 E;  1IYF A;  2C7M B;  4LNN A;  3TEZ A;  3ZNZ B;  4AJY B;  3K9P B;  4LTU A;  4C7Z A;  1J8C A;  1E7V A;  3PZD A;  4W9I A;  3IT4 B;  3A33 B;  1R7S A;  2M0A A;  4KDI C;  3KH0 A;  2LVO A;  3JSV A;  1FRR A;  1ZDV A;  2WXN A;  1TKG A;  3DHG C;  2NPT A;  5I4D A;  3SDL C;  3A9J B;  1OTR B;  1N60 A;  2QJL A;  2QMT A;  1WWT A;  1IPG A;  5DPS A;  5HHD G;  1V1P B;  3IFW B;  2AQ1 B;  4HKQ A;  2NR2 A;  1ZP0 B;  4G50 A;  3ETR A;  2WHI A;  2MH7 A;  3JYU A;  2XK5 A;  2GBK A;  4EFO A;  1KM7 A;  1J7B A;  2L0F A;  1UNS A;  2FCN A;  2JQR B;  3DHH C;  3NZU A;  4CQN A;  2JU6 X;  2D2Q A;  2Q5W D;  3A1Q A;  2MQJ A;  1UBQ A;  3KWL A;  3RNF C;  2QIE B;  2KWV B;  3RNA C;  4E71 A;  3FIL A;  4GB9 A;  2KN5 A;  5CX3 A;  2BBC A;  4YTP B;  3DWG C;  4AP4 C;  2RSU A;  1PUT A;  1EU3 A;  4F1S A;  3V60 A;  4URK A;  3NUH B;  5TR5 A;  1NYR A;  2IO0 B;  2GLS A;  3FKY A;  1B1Z A;  1WYW B;  2MX2 A;  2EEL A;  4L1B A;  2LFI A;  1EF5 A;  1XLP A;  3HM3 A;  4YXD B;  3PHW B;  4HPL B;  2XEW A;  1L0V B;  1TS2 A;  2KKC A;  2W82 A;  3VUW A;  2MJE A;  1V49 A;  3I5J C;  1YD8 U;  3AN1 A;  4IM0 A;  4C00 A;  1G6J A;  1ZXH A;  1WSP A;  1YMH E;  1V97 A;  4MJS B;  2LGD A;  2IO1 B;  2V3S A;  2ZPN A;  3UIP B;  1L0Y B;  4FN2 A;  3D32 A;  5L95 C;  5AUI A;  2D11 A;  1C9F A;  2BWE S;  1GB1 A;  2CHX A;  1QOG A;  5JXV A;  1FEH A;  5T8I A;  3NZS A;  2Y5C A;  1R4N I;  2INN E;  1IGD A;  1MVK A;  1KFY B;  1T6B X;  1P98 A;  2HTH A;  5BMI A;  1WX9 A;  2FNJ B;  4K1R B;  2D5G A;  2D3G A;  1TZ1 A;  1J19 A;  4MDK E;  2RDH A;  4LJP B;  4XWW A;  1ZXI A;  4HK2 A;  2BWF A;  3SFE B;  3SR6 A;  1NI2 A;  1ACC A;  2VZK B;  2BS4 B;  1L0X B;  2KFK A;  1RM6 C;  1WXS A;  1T3Q A;  4ZHO A;  2H88 B;  1OQQ A;  2BKR B;  2PMV A;  3VXW A;  4YL8 A;  1TTN A;  4US8 A;  2QDF A;  4LNF A;  1C79 A;  2KHW B;  1GNU A;  1HXY D;  4MEM A;  3A4S C;  4BBN C;  2MEK A;  1XD3 B;  3DPD A;  2O6V B;  2FBW B;  2IPK D;  2FCQ A;  5CHW A;  2BVC A;  3HHM A;  1WYG A;  2GOW A;  2R61 A;  1UZX B;  1VDV A;  3B1L X;  4PYU A;  4EZJ A;  2AL3 A;  3RN9 C;  4A6Q A;  4MSM B;  1GG3 A;  2KC2 A;  1Q1O A;  4NPN A;  4W9J A;  2REX A;  4W9D A;  3WIM A;  3AH7 A;  1PQS A;  3VH4 B;  2J42 A;  3H7S A;  2HTM E;  3TIX A;  3VQI A;  3I3T B;  4HKZ E;  2LHE A;  4W9C A;  1AWD A;  3BY4 B;  5IOI A;  2LXA A;  3P4Q B;  4PYZ A;  3L08 A;  4IWO A;  3A9J A;  4WJO A;  3W5V B;  5BYR A;  1FRD A;  1GPX A;  4HDO A;  3VR9 B;  2EMT A;  2MJD A;  4FXC A;  2ZVO A;  4BOZ B;  2MSE D;  3HUI A;  4XDC A;  4TMA B;  3AE8 B;  2V9H A;  4ANV A;  3I57 A;  5D94 A;  2N1W A;  1SE2 A;  1AYF A;  3R8B A;  3RNG C;  5JHA A;  2M4N A;  1I4H A;  1QLB B;  1SIF A;  1WM3 A;  2AQ3 B;  1LM8 B;  3EFC A;  4OW0 A;  1OQY A;  3SU8 X;  4II3 B;  1MG4 A;  1SJH D;  4RF0 A;  3CWI A;  1SSN A;  3DBL I;  3RMK C;  2OJR A;  1N5W A;  4HCN B;  1E8W A;  4HVB A;  1IUE A;  3T9L A;  2CJO A;  2BYT A;  1YQ3 B;  2EMS A;  3ZRF A;  4GN1 A;  4FA6 A;  2GBN A;  3T3O A;  4TKN A;  3ECI A;  4IKG A;  1F0Z A;  1SGH A;  4ZRJ A;  4AWJ A;  3PRE A;  1Q5W B;  2PTL A;  4WAA A;  4KIK A;  5EE0 A;  2NBV B;  4ZRK A;  1CQV A;  2W9N A;  1C4A A;  5H8Y E;  4P16 A;  4HLE A;  2RMM A;  1SF0 A;  2KDM A;  1A5R A;  2JZZ A;  1XCT L;  1NEK B;  4IWP A;  2JY6 A;  2CS4 A;  3P4P B;  2JUO A;  2O2V B;  2V4I B;  4YWG G;  3NVV A;  1K50 A;  2FAZ A;  2LXC A;  4HEA 1;  1RFK A; 
#chains in the Genus database with same CATH homology
 1S1Q B;  3PVL A;  2DYO A;  2N9P C;  4LCD E;  3RUI B;  2LZ6 A;  2Z59 B;  3SD5 A;  2KX3 A;  3QC8 B;  3NHE B;  2N7E A;  3S2A A;  2IY1 B;  3U7D A;  2JZ3 B;  2HE7 A;  2LUE A;  4MSQ B;  4I6P A;  5KHQ A;  4PS8 A;  2I1K A;  2NBU A;  1VCB A;  3P2B A;  2LD9 A;  1WE7 A;  1E5W A;  3RYT A;  1R4M I;  4GIV A;  1E90 A;  3DVN U;  1WR1 A;  3NY5 A;  1YX5 B;  5CTR C;  1OGW A;  4MGI E;  2AL6 A;  2AWT A;  3PLU A;  4HWI B;  3UIN B;  3PRM B;  4ASW C;  2LAS A;  1WE6 A;  2MA9 B;  4GGQ A;  2K1F A;  4GDK B;  4A3O A;  3M63 B;  2KLC A;  2LWP A;  4GSW A;  3LJ3 A;  3PSE B;  3EFU A;  4WJN A;  1GC7 A;  2RD0 A;  4FJV B;  2AYO B;  4PS7 A;  1NDD A;  1P3Q U;  2ZCC A;  3KYC D;  4GDL B;  3ZTD A;  1I35 A;  2WDT B;  4BVU C;  4AUQ C;  4KIK B;  3LDZ E;  2IZV B;  4K81 A;  2DYB A;  2DZJ A;  4BKS D;  2LJ5 A;  2J0M A;  4IWQ A;  1GUA B;  2WYQ A;  3ZVV A;  3TL5 A;  4JGH B;  4NQL B;  2O6V D;  2IO2 B;  3VTV A;  4OVV A;  1HE8 A;  3Q3J A;  2BYF A;  2DHZ A;  4CYE A;  4GMV A;  2J7Q B;  1J0G A;  1WX8 A;  4DXA B;  4TV3 A;  3EHV A;  4KV2 A;  3R7Q A;  2DYM A;  2KDE B;  5JH5 C;  3PGE A;  4ANW A;  5C1Z A;  3JVZ X;  1WFY A;  2RGF A;  2L05 A;  4GU2 A;  4BKT A;  1E8Y A;  4G11 A;  4FHK A;  1QZE A;  2KD0 A;  4BKS A;  2LGX A;  3QWZ B;  1P1A A;  1WGH A;  2O6V A;  2I1J A;  4MM3 A;  3SHQ A;  1CMX B;  5CHV C;  1TGZ B;  1F9J A;  2IYD B;  2KFJ A;  4NAW A;  4B95 A;  1UGM A;  3L10 B;  3ZNI D;  4OVU A;  1SE9 A;  4WJQ A;  1WGD A;  2KO3 A;  2ZZP B;  2C7H A;  3VHT C;  3VTU A;  3NS8 A;  2RR9 A;  4MGZ E;  3EEC A;  2MBE A;  2LRU A;  1RFA A;  1WGG A;  3A4R A;  3CF6 E;  1E8Z A;  3V6E B;  2C7M B;  1IYF A;  5DPT A;  3OLM D;  3ZNZ B;  4AJY B;  2V1Y A;  4B9K A;  3K9P B;  4DHZ E;  4WQO B;  2XBB C;  1J8C A;  1E7V A;  3PZD A;  4W9I A;  3H1U A;  3A33 B;  2L0T A;  2UYZ B;  3AI5 A;  3QQ8 B;  4KDI C;  2QHO A;  2J0J A;  3O65 B;  3KH0 A;  2LVO A;  3JSV A;  1GJZ A;  4ICV A;  2N1V A;  3QJZ A;  2HD5 B;  2KXJ A;  2ZNV B;  1RRB A;  1WJ4 A;  3AUL A;  2MP2 B;  1YQB A;  3H7P A;  3ONS A;  2K8H A;  3M95 A;  5CHF A;  3ZW3 A;  2PE9 A;  2NPT A;  4FAD A;  3SDL C;  1I42 A;  3A9J B;  2MCN B;  2FCS A;  1OTR B;  3GZN I;  2C9W B;  3A9K B;  5J2R A;  3WAN A;  3K9O B;  2CKH B;  4NJ6 A;  3V62 A;  1LXD A;  5DCN A;  1UD7 A;  2JF5 A;  2DZM A;  1IPG A;  1BT0 A;  5DPS A;  1WH3 A;  3L0W B;  3VDZ A;  4FUL A;  2PEA A;  1P9D U;  1WM2 A;  3IFW B;  2GBM A;  2J0K A;  2ZNV C;  3RUL A;  2PJH A;  1WJN A;  3PTF C;  2Y5B B;  5D2M B;  2NR2 A;  4G50 A;  3M62 B;  4CO7 A;  4DDG D;  5BO4 B;  3JYU A;  2XK5 A;  2GBK A;  3R3M A;  4MJS A;  4EFO A;  1UEL A;  4W9H A;  2M1M A;  2WX0 A;  4HJK A;  4M8M A;  3PHX B;  1KM7 A;  2ZPY A;  4LDT D;  2L0F A;  4EZL A;  2FCN A;  4TQ0 A;  4NAW B;  3PRZ A;  2KTR A;  5AEK B;  3NZU A;  5EDS A;  3WA0 A;  2MLB A;  2D2Q A;  4MGK E;  1V9J A;  2IY0 B;  3A1Q A;  5E6P A;  1S3S G;  2BF8 B;  5AZH A;  2MQJ A;  2KQS A;  4IM3 A;  2MWS B;  1UBQ A;  4DHZ B;  3IBE A;  4EKU A;  3Q3F A;  1ISN A;  3V61 A;  4ANU A;  2BPS A;  4AJW A;  2NBW B;  2PE6 B;  3R66 C;  3X23 A;  3C0R B;  4JLC A;  2KWV B;  3H9D A;  4E71 A;  2ZVN A;  4GB9 A;  2KN5 A;  3ZNH B;  5LXH A;  5CX3 A;  3L54 A;  1ZGU B;  3QAQ A;  4ZYN A;  2N9X A;  4AP4 C;  2RSU A;  5IA7 A;  2LVP A;  3M3J A;  1LFD A;  3TMP B;  4F1S A;  3V60 A;  4URK A;  2A4Z A;  1AAR A;  1UH6 A;  2ZEQ A;  5TR5 A;  3APC A;  4JL9 A;  3W1S A;  3VVW B;  5GMV A;  4N9F 4;  2IO0 B;  4HDQ A;  2B3A A;  3H7P B;  3KUD B;  4HPM B;  1WRD B;  1WXM A;  3U8Z A;  2KTF A;  2M0X A;  2G3Q B;  1WYW B;  2MX2 A;  2NPT B;  4M8N A;  4FJZ A;  1WF9 A;  3U30 A;  4ZRI A;  3DVG Y;  3PLV A;  3ZO5 B;  2LGY A;  3UGB B;  1EF5 A;  3HM3 A;  2KJR A;  2N4F A;  1JRU A;  1WI0 A;  3PHW B;  4HPL B;  4HXD A;  2XEW A;  3QHT A;  4RM8 A;  3T8M A;  3WAM A;  2KDI A;  2CHZ A;  2KKC A;  1WMH A;  2KWU B;  4LJO B;  2L7R A;  3OAW A;  1YJ1 A;  3VUW A;  3QCA A;  1V49 A;  3WAL A;  5C23 A;  1K8R B;  4E74 A;  1YD8 U;  4J6I A;  4IM0 A;  2VRR B;  4MGY E;  2KJ6 A;  1G6J A;  4K7W A;  2BKF A;  3ML8 A;  2XK5 B;  4GOC A;  4MJS B;  4KVG B;  2LGD A;  2IO1 B;  2V3S A;  3IHP C;  5HKH A;  2ZPN A;  5JHB A;  3UQB A;  4DHJ D;  2KVR A;  4FN2 A;  3UIP B;  3D32 A;  5L95 C;  1L2N A;  1V5O A;  2D11 A;  2BWE S;  2K6D B;  2CHX A;  2N9E B;  2ZJD A;  3N30 A;  3QIJ A;  3UF8 A;  2KTR B;  1GC6 A;  1V86 A;  2JWZ A;  3NOB A;  3ZKJ C;  3NZS A;  3A1Q B;  1R4N I;  2DZI A;  3V6C B;  4JQW C;  2EKE C;  4M0W B;  4MEL A;  3RD2 A;  2K8C A;  3PS6 A;  2K25 A;  1P98 A;  1V80 A;  2HTH A;  2KAN A;  2IBI B;  1WX9 A;  1EO6 A;  3ALB A;  2FNJ B;  1FXT B;  4K1R B;  4LDT B;  3UQA A;  2D3G A;  2JXX A;  1TZ1 A;  4RM9 A;  1WZ0 A;  1KLV A;  1WJU A;  2KK8 A;  1J19 A;  2LRW A;  4GXB A;  4MDK E;  3KVF B;  4LJP B;  3R7R A;  2MBQ A;  2BGF A;  4KDL B;  3DBS A;  4HK2 A;  5G55 A;  3L17 A;  2BWF A;  4ZDV A;  5AZG A;  3DVG X;  3QX1 A;  1NI2 A;  2ZCB A;  4BOS C;  2D07 B;  4FLH A;  2KMC A;  1E7U A;  1OEY A;  3KYD D;  4BBN F;  4KSK C;  1H4R A;  2NS5 A;  2KFK A;  3IG3 A;  3OJ4 B;  4XC2 A;  4F8C B;  4AOF A;  4W9F A;  2GBJ A;  1WXS A;  3VTW A;  1V6E A;  2R2Q A;  3PT2 B;  1V81 A;  2ASQ A;  4DBG A;  2BKR B;  1LQB A;  3EC8 A;  3VFK A;  3VXW A;  4B6W A;  2C60 A;  3HM6 X;  4FHJ A;  4YL8 A;  1KOT A;  1TTN A;  4A20 A;  4WJP A;  2KHW B;  1GNU A;  3W1S C;  1WMH B;  2YVC A;  4MEM A;  3X0W A;  1L7Y A;  4F7Z A;  1C3T A;  3A4S C;  4BBN C;  5E6N A;  3ENE A;  3RCZ A;  1OEY J;  5D6J B;  1XD3 B;  1XT9 B;  4BFR A;  4FBJ B;  2JRI B;  4DK5 A;  2FUH B;  3N32 A;  3DPD A;  2HJ8 A;  2KDF B;  2O6V B;  3MJW A;  1Z5S B;  3DOW A;  1XQQ A;  5G2N A;  2K39 A;  3VAW A;  1D3Z A;  2FCQ A;  2L8J A;  5CHW A;  2G4S A;  3HHM A;  2GOW A;  2M8S A;  2DZK A;  3MTN B;  1UZX B;  3B1L X;  4PYU A;  4EZJ A;  2DEN B;  5LLI A;  1WXA A;  4W9E A;  2K6Q A;  3DBR I;  2KOX A;  4W9L A;  2AL3 A;  4WWO A;  2LVQ A;  3ZTC A;  2N7D A;  2JPH A;  4MSM B;  3WAO A;  2PPH A;  1GG3 A;  2DAJ A;  2KZR A;  2KC2 A;  1Q1O A;  1EF1 A;  3VUY A;  3ZIM A;  3TCA A;  1YIW A;  1RLF A;  4PS3 A;  3H6N A;  2LI5 A;  4NPN A;  2KJH B;  2KNB A;  1WY8 A;  2L76 A;  4DHJ B;  2AEH A;  2D10 A;  4P7I A;  5LXI B;  4W9J A;  2FIF A;  2REX A;  4W9D A;  3JSV B;  3WIM A;  3HK0 A;  3ZDT A;  1TBE A;  3DVN V;  2JT4 B;  4IW0 A;  1PQS A;  1ZW7 A;  2JVC A;  2MBH A;  4BKG A;  5DPR A;  3VH4 B;  5DPW A;  2KC1 A;  3B0A A;  3H7S A;  4IUM B;  1EUV B;  2KQ7 A;  1WX7 A;  4JIO U;  4HCP B;  2KFK B;  3TIX A;  1RAX A;  3VQI A;  2OOB B;  3ML9 A;  4ANX A;  3I3T B;  4EZK A;  4NNJ B;  3L13 A;  4G3X B;  4MH0 E;  4NJ7 A;  4W9C A;  4A3P A;  4I6N B;  5E6O A;  2A5U A;  2CHW A;  2G45 B;  2MP2 A;  3BY4 B;  3ZNG C;  2LXA A;  5J17 A;  4PYZ A;  3L08 A;  3PV1 A;  1ZKH A;  3WAP A;  3QA8 A;  2L00 B;  4IWO A;  3A9J A;  1KJT A;  3BIN A;  4WJO A;  3A9K A;  4WWP A;  2MBO A;  1IP9 A;  4HDO A;  2DAF A;  2EMT A;  1MG8 A;  2BYE A;  2KX0 A;  2ZVO A;  3PPA A;  2UWQ A;  4CHK A;  5JZE B;  4I6L B;  4BOZ B;  2MSE D;  4KSL C;  3CST A;  4FJY A;  2KLG A;  2O2V A;  3VH3 B;  1C1Y B;  1M94 A;  2JRH A;  4IC7 B;  1Y8R C;  3DQV A;  2MW5 A;  4K7S A;  3KUC B;  4G0N B;  4ANV A;  2IO3 B;  3GOE A;  3JW0 X;  5D94 A;  1Z2M A;  2N1W A;  3AU4 A;  5J18 A;  1UBI A;  5JHA A;  2M4N A;  3ZLZ A;  3DDC B;  1SIF A;  2CR5 A;  2M17 A;  3DCG A;  1WR6 E;  1WM3 A;  3KUZ A;  2BYV E;  2NCN A;  1LM8 B;  4XZ4 A;  2NVU I;  3OJ3 A;  3AXC A;  3PRP B;  5KHO A;  4NQK E;  1OQY A;  1Q0W B;  4II3 B;  3SU8 X;  3AU5 A;  4RMA A;  5IAA C;  1V5T A;  3VUX A;  4IG7 B;  1WGR A;  4W9G A;  1WZ3 A;  3DBL I;  3APD A;  2WWZ A;  1E8X A;  2Z0E B;  2KWC A;  2OJR A;  3DBH I;  3IVF A;  2R2O A;  1E8W A;  4HCN B;  3RZF A;  4HVB A;  5L83 A;  3T9L A;  2RPQ A;  3MHS D;  2G4D B;  2KMA A;  3RZW C;  2Z0D B;  1T0Y A;  2MBB B;  1WJ6 A;  4EUT A;  2EMS A;  3ZRF A;  2C5L C;  2V4L A;  2GMI C;  1U4A A;  5AZF A;  4GN1 A;  3CSF A;  4FA6 A;  1H8C A;  2GBN A;  4XX5 A;  4GDK A;  4KZ0 A;  4TKN A;  5D7G A;  3ECI A;  2L3Z A;  4EEW A;  1WXV A;  2KDB A;  1SGH A;  4ZRJ A;  4GDL A;  2YLM A;  3RT3 B;  3PRE A;  3UIO B;  4AWJ A;  4E3C A;  4K7U A;  1Q5W B;  4WAA A;  4KIK A;  4NY0 A;  4TQ1 A;  1YX6 B;  2NBV B;  4ZRK A;  2W9N A;  1VD2 A;  3QAR A;  2K8B A;  1P0R A;  4HLE A;  2GBR A;  2C7N B;  1A5R A;  2JZZ A;  3CMM B;  4TUU A;  3TJP A;  1NBF C;  3QK0 A;  2CU1 A;  2JY6 A;  4IWP A;  3ZUN A;  3APF A;  2CS4 A;  2JUO A;  2O2V B;  4II2 B;  2WX1 A;  3W1Y A;  1WGY A;  1V2Y A;  4WWN A;  2MRP A;  3HIZ A;  5FR6 A;  3KW5 B;  3N3K B;  2FAZ A;  4ICU A;  3TBL D;  2LXC A;  4DDI D;  3B08 A;  1X1M A;  3ZDM C;  4EOY A;  4DWF A;  1WIA A;  2DX5 B;  4X57 B;  2FID A;  4KZC A;  3L16 A;  4IM2 A;  3ZRC A;  2FCM A;  4W9K A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...