5C1ZA

Parkin (ublr0rbr)
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
405
structure length
384
Chain Sequence
b'MIVFVRFNSSHGFPVEVDSDTSIFQLKEVVAKRQGVPADQLRVIFAGKELRNDWTVQNCDLDQQSIVHIVQRPWRKGQEMNATNSFYVYCKGPCQRVQPGKLRVQCSTCRQATLTLTQGPSCWDDVLIPNRMSGECQSPHCPGTSAEFFFKCGAHPTSDKETSVALHLIATNSRNITCITCTDVRSPVLVFQCNSRHVICLDCFHLYCVTRLNDRQFVHDPQLGYSLPCVAGCPNSLIKELHHFRILGEEQYNRYQQYGAEECVLQMGGVLCPRPGCGAGLLPEPDQRKVTCEGNGFAFCRECKEAYHEGECSAVFEYRVDERAAEQARWEATTKPCPRCHVPVEKNGGCMHMKCPQPQCRLEWCWNCGCEWNRVCMGDHWFDV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords E3 ubiquitin-protein ligase parkin
publication title Disruption of the autoinhibited state primes the E3 ligase parkin for activation and catalysis.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Ligase
total genus 92
structure length 384
sequence length 405
chains with identical sequence B
ec nomenclature ec 2.3.2.31: RBR-type E3 ubiquitin transferase.
pdb deposition date 2015-06-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00240 ubiquitin Ubiquitin family
A PF01485 IBR IBR domain, a half RING-finger domain
A PF17976 zf-RING_12 RING/Ubox like zinc-binding domain
A PF17978 zf-RING_14 RING/Ubox like zinc-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 5c1zA01
2C7MB 4WJQA 2ASQA 1WXMA 2DZJA 2NS5A 1K8RB 2N7DA 4CO7A 3Q3JA 4BOSC 5J17A 2MSED 1IPGA 2FCMA 3WA0A 2NVUI 3W1YA 4K81A 4MGYE 3DDCB 3JW0X 5AZHA 3W1SC 5DPRA 4FBJB 1E8ZA 3KYDD 2KFKB 3JVZX 3VH4B 2HJ8A 3OLMD 1AARA 5L83A 4MELA 3QK0A 5JHAA 3VHTC 2RD0A 2MW5A 5J18A 4DHZE 2FUHB 3RYTA 4LCDE 1V9JA 2C7HA 2IY1B 2DZKA 3ZTDA 4K7SA 1JRUA 1TTNA 3PSEB 3ML9A 2D11A 4GDKB 4KIKB 5TR5A 2IZVB 4MSQB 4HJKA 4WWOA 4NPNA 2DYMA 3W1SA 4JLCA 3LDZE 2FCSA 3JSVA 3R7QA 4M8MA 4WWPA 2KOXA 3IVFA 5C1ZA 2FNJB 5AZFA 4M0WB 1OTRB 2G3QB 4W9HA 4IW0A 4FADA 2IO2B 4GGQA 2DZIA 4FN2A 1XQQA 5G55A 1M94A 3TMPB 1P3QU 3R3MA 1SGHA 3KUDB 3S2AA 4AP4C 2BGFA 4ZDVA 2ZZPB 4IWPA 3WAPA 1WJ6A 4KSLC 4IM2A 4GMVA 3VDZA 2RPQA 4ANVA 2O2VB 2NPTB 1VCBA 1UELA 2DENB 3ZRCA 1OQYA 4A3PA 3ZNHB 3MJWA 4G0NB 4I6NB 1J8CA 3M3JA 3TBLD 4BKTA 2VRRB 5LLIA 3SD5A 2JPHA 4TUUA 4HPLB 3BINA 1SIFA 1KOTA 4KV2A 3KYCD 2KJ6A 2AYOB 2A5UA 2OOBB 2MQJA 1KM7A 1GJZA 3VUYA 4W9CA 4F7ZA 4OVUA 3RZWC 1E8WA 3HM6X 3WANA 2LI5A 1E7VA 4DDID 3PT2B 2KXJA 4FULA 2ZEQA 4ZYNA 4MJSB 2GBNA 2IY0B 3RT3B 4WAAA 2OJRA 2PJHA 2LRWA 2NCNA 4F1SA 1WF9A 1KJTA 2KKCA 3RUIB 1L2NA 4JIOU 3B0AA 2K8BA 2L0TA 4II3B 3IHPC 4HDOA 2MBEA 2G4DB 2KX0A 2C5LC 4NAWA 3RD2A 1C3TA 1WGHA 2KTFA 4GB9A 2B3AA 2MA9B 3R7RA 3L08A 2HE7A 1F9JA 1WJ4A 2MRPA 1J0GA 4FJVB 2W9NA 4KVGB 4MGKE 3PLUA 1V80A 2JY6A 2MP2A 1WM3A 4MGZE 2DAJA 1RLFA 3A9JB 1EO6A 2XEWA 4NQLB 3ZLZA 2O6VD 1WZ0A 2KWCA 2LASA 3V60A 4IM0A 5FR6A 5AZGA 3SHQA 3EFUA 4EZLA 3CSFA 4JGHB 3H7PA 4ICUA 3KH0A 2N7EA 4FHKA 1G6JA 2D3GA 4CYEA 5JZEB 2AWTA 2NBWB 1RAXA 4W9FA 1OEYA 2ZNVB 2N9XA 1H8CA 1YJ1A 2DHZA 2KFKA 3L0WB 1WI0A 2G4SA 2LGYA 4P7IA 2KMAA 3A1QB 2KDBA 3CSTA 4NY0A 4WWNA 5KHOA 1TBEA 1ZW7A 5J2RA 3N32A 2KC2A 3L54A 3PRZA 3DBSA 3L16A 3PTFC 3PRMB 2MX2A 3ONSA 4E71A 2GMIC 1D3ZA 1E8YA 2IBIB 2J0JA 4KIKA 2Y5BB 2MWSB 1A5RA 1UH6A 4IM3A 3APDA 4GDLB 5BO4B 2K8CA 2YVCA 2CR5A 1P98A 3A4RA 3CMMB 2ZJDA 3AU5A 3NZSA 4K1RB 4URKA 1WH3A 3APCA 4AJYB 4ANWA 5E6PA 4I6PA 3L13A 2O6VB 2DX5B 3DBHI 1TZ1A 3SDLC 3DBLI 3X23A 4IUMB 4ZRIA 3AU4A 3V6EB 4CHKA 3QHTA 2L7RA 2JRHA 3DBRI 4II2B 2RR9A 3LJ3A 5CTRC 1NI2A 4DHJD 1PQSA 3IG3A 4JQWC 1UBQA 4FLHA 1V49A 3CF6E 1XD3B 2NPTA 1WX7A 1V86A 3L10B 1P9DU 1NDDA 3M63B 3V62A 2ZVOA 4W9EA 2LRUA 4NNJB 1HE8A 2KC1A 3ECIA 3K9OB 1YQBA 4NJ7A 3PHXB 5DPSA 5G2NA 3HHMA 2YLMA 4WJPA 4LJPB 4TQ1A 2LVOA 1E7UA 2MBOA 3NOBA 4BOZB 4N9F4 3PV1A 2J0KA 4GN1A 4WJNA 1E5WA 3DVNV 2V1YA 2ZPNA 2KWVB 2FCQA 2BPSA 2L00B 4PYUA 2BYFA 3OJ3A 3RULA 3GOEA 2JF5A 5JH5C 2UYZB 3OAWA 4IWOA 1WGYA 1WIAA 1WX9A 4AOFA 4FA6A 4FJYA 1WMHB 3KUZA 2PE9A 1LXDA 2K6DB 3M95A 1XT9B 1LQBA 3RCZA 5JHBA 2JXXA 2N9EB 3PS6A 3WALA 5DPWA 2KANA 2AL3A 4HXDA 4GU2A 2LJ5A 1GUAB 2GBMA 3DPDA 3P2BA 1U4AA 2LGDA 5IA7A 2PE6B 2IO3B 4JL9A 4HLEA 2CHXA 4DHJB 2K6QA 5HKHA 1T0YA 4FHJA 1WE7A 3ZKJC 4NJ6A 2V3SA 4BBNF 2N1WA 2XK5B 5GMVA 3IFWB 1Y8RC 2M4NA 2KTRB 2GBRA 5CHWA 3QWZB 1UBIA 1OEYJ 2BKFA 1I35A 4ASWC 3JSVB 5D2MB 3NY5A 1WGGA 3ZUNA 1R4MI 1WFYA 4AJWA 2KLGA 1WXAA 3A4SC 4W9JA 1WRDB 2CU1A 1V6EA 2JT4B 2BWES 4EFOA 2DYOA 2M1MA 3ZDMC 3EHVA 4DXAB 1WR1A 2KN5A 2M17A 3AI5A 4DBGA 4EZKA 4TQ0A 2MBHA 2LD9A 4M8NA 1MG8A 3OJ4B 4K7UA 3SU8X 2AEHA 4A3OA 3ZVVA 3ZW3A 4BKSD 3A9KA 2MCNB 4AWJA 2IO0B 2LGXA 2ZCBA 2KMCA 2EMSA 2KQ7A 4KZCA 4NQKE 2KO3A 3PGEA 4G3XB 3ZDTA 4XZ4A 4ANXA 4MGIE 1S1QB 2D10A 2JWZA 2KK8A 3MTNB 4FJZA 2CHWA 1GC6A 3M62B 3QJZA 5L95C 5D7GA 3ZNGC 2LUEA 3QC8B 1WGDA 4K7WA 2JVCA 4BKGA 3NS8A 3QIJA 3VTWA 4BVUC 3N30A 1GC7A 1C1YB 3UQBA 4KDIC 2JZZA 3TIXA 2N4FA 2LVQA 1L7YA 2DZMA 3T8MA 2L0FA 3ZNZB 1I42A 4MEMA 2CKHB 2C7NB 3GZNI 2M8SA 2N1VA 4TV3A 2ZCCA 4DWFA 5LXIB 1IP9A 4MH0E 3U7DA 1WY8A 3U8ZA 4GDKA 3KUCB 5EDSA 1FXTB 2KDEB 2BYVE 1V5TA 5LXHA 2L76A 4NAWB 1ZGUB 2D2QA 2L8JA 3ZIMA 4E3CA 5AEKB 4W9IA 3B1LX 2DAFA 1YD8U 3PREA 1ISNA 4XX5A 2MP2B 2IO1B 2M0XA 1P1AA 4HPMB 1Q0WB 2KJHB 2LZ6A 2KHWB 2REXA 3AULA 1NBFC 1OGWA 2K25A 2R2OA 2PEAA 2K1FA 4PS8A 3MHSD 5D94A 5E6NA 2Z0DB 4I6LB 1ZKHA 3ZRFA 2EMTA 4J6IA 3QCAA 3PRPB 3AXCA 3VFKA 2RSUA 3H7PB 1WXVA 2LVPA 4HWIB 4G11A 4TKNA 2O2VA 3PZDA 4W9GA 2A4ZA 1WJNA 2HTHA 4F8CB 2IYDB 2KFJA 1WMHA 2R2QA 2KWUB 2NR2A 3KVFB 3L17A 4OVVA 1VD2A 1UGMA 1P0RA 2KJRA 4GSWA 3X0WA 4HVBA 2Z59B 4WJOA 4IWQA 4PS3A 1WR6E 3BY4B 3KW5B 3NZUA 3IBEA 4WQOB 1WYWB 1YIWA 3H9DA 1WGRA 5KHQA 4GXBA 2I1KA 2XK5A 3H6NA 3Q3FA 2LXCA 2N9PC 2CHZA 3QA8A 4IG7B 4MJSA 2KTRA 4PS7A 4RMAA 1LFDA 1V2YA 2QHOA 2CS4A 1BT0A 4PYZA 3V6CB 1WZ3A 3DOWA 2MBBB 1X1MA 3EC8A 3ZNID 2KZRA 2LXAA 4AUQC 3WAOA 4EUTA 2WWZA 4LDTD 3O65B 4GIVA 2K39A 3VH3B 3PPAA 3WAMA 3DVNU 4B95A 4EOYA 3PVLA 1UD7A 1E90A 1TGZB 4W9LA 2FAZA 2BF8B 2GBJA 2KQSA 2ZNVC 3HM3A 5C23A 2K8HA 3TL5A 1GG3A 4KZ0A 3HK0A 3UQAA 1E8XA 1EUVB 4MSMB 3ENEA 3QARA 5CHFA 3A9JA 5DCNA 2BKRB 2G45B 2KX3A 3NHEB 4DHZB 3K9PB 2C60A 2C9WB 2XBBC 2JUOA 4MM3A 1R4NI 3APFA 4GOCA 4RM8A 2FCNA 5E6OA 3UINB 1J19A 4X57B 3VTVA 3ALBA 4E74A 4ANUA 5CX3A 3H7SA 2BWFA 2DYBA 3HIZA 4HK2A 3QQ8B 3UGBB 2UWQA 4KSKC 2AL6A 1Q5WB 1RFAA 4XC2A 5DPTA 4HCNB 4ZRKA 3VUXA 1LM8B 1S3SG 2I1JA 2L3ZA 3A1QA 1V5OA 3UIPB 2KVRA 3VUWA 4A20A 1Z2MA 4BBNC 2WX0A 1IYFA 4DDGD 4HCPB 2D07B 2KLCA 3ML8A 3UF8A 2NBUA 2WYQA 1V81A 2V4LA 2KNBA 3U30A 1YX5B 2J0MA 1H4RA 3PHWB 4DK5A 4LDTB 1RRBA 3ZTCA 1Q1OA 2Z0EB 3R66C 2KD0A 3PLVA 3RZFA 4YL8A 3T9LA 4W9KA 4GDLA 3VXWA 2JZ3B 1WJUA 2EKEC 2FIFA 2L05A 2MBQA 3D32A 1WXSA 2KDFB 3TJPA 2J7QB 3DVGX 4BKSA 2PPHA 3QAQA 4EZJA 4ICVA 2LWPA 1WX8A 2WDTB 4G50A 2FIDA 4LJOB 2O6VA 3ZO5B 2BYEA 1Z5SB 3DVGY 2GOWA 2JRIB 1EF1A 3H1UA 5IAAC 2NBVB 3JYUA 4B6WA 4ZRJA 4MDKE 1SE9A 1GNUA 1YX6B 4KDLB 1EF5A 5D6JB 4W9DA 1KLVA 3EECA 3A33B 3C0RB 1UZXB 4B9KA 3DQVA 4IC7B 4BFRA 3N3KB 3WIMA 2RGFA 4EEWA 4EKUA 2HD5B 2KDIA 3V61A 5CHVC 2WX1A 3VAWA 3DCGA 1CMXB 3B08A 1WM2A 2MLBA 2GBKA 2ZPYA 4HDQA 3UIOB 2ZVNA 1QZEA 1WE6A 3TCAA 3I3TB 3VQIA 3VVWB 4RM9A 3VTUA 3A9KB 3QX1A
chains in the Genus database with same CATH superfamily
2ZW0A 4WJQA 4DXGA 1E7PB 2K22A 1JALA 1K8RB 4LNIA 2INCC 3Q3JA 3Q3OC 2FCMA 1E8ZA 3IAS1 2W82A 3RPFC 1N63A 3AE8B 5L83A 4MELA 1KH0A 5G5GA 2MW5A 2INNE 2C7HA 1I4GA 2WXHA 4IKGA 5LNK1 5E6JA 3HUIA 2R61A 4WWOA 2DYMA 1IGCA 4M8MA 1YMHE 3MJ5A 3KQ4A 4M0WB 4XWTA 2IO2B 2DZIA 3CIRB 4FN2A 5G55A 1P3QU 3R3MA 4AP4C 1SF0A 4AS1A 4IWPA 2HDEA 3AH7A 4GMVA 2CU3A 2RPQA 5BYRA 2KQ4X 4ANVA 4N58A 1OQYA 3ZNHB 1TKEA 1J8CA 3TBLD 2VRRB 1PGXA 4TUUA 1MI0A 2WDRB 2AYOB 1KM7A 4W9CA 1E8WA 3HM6X 3WANA 2LI5A 1F52A 1JCKB 1RM6C 2Z8LA 2IY0B 3RT3B 2WXQA 3O13A 3RUIB 4II3B 4ARCA 3RD2A 2B3AA 1F9JA 1J0GA 3W9CB 1RLFA 1EO6A 2O6VD 1T3QA 2H88B 2LASA 3V60A 4IM0A 1HZ6A 2KDMA 4ICUA 2LFIA 3KH0A 1PGAA 2N7EA 4FHKA 1G6JA 3ZYYX 1IBXB 4CYEA 2AWTA 1RAXA 1QKZA 2N9XA 2KFKA 2G4SA 4WURA 3CSTA 1AN8A 4NY0A 1TBEA 3DBSA 3L16A 4YSYB 5I4DA 3NVZA 3PRMB 2BYTA 3ONSA 1D3ZA 1E8YA 2AQ1B 4KIKA 1TJEA 1FPYA 1ROEA 1T0QC 1DYQA 3A4RA 3AU5A 4K1RB 4AJYB 4ANWA 4M00A 4XDDA 5E6PA 1UF0A 4LNNA 2LHDA 3SDLC 3DBLI 3AU4A 3Q8BA 3QHTA 3DBRI 5CTRC 2CJNA 4DQOC 1PQSA 5BMHA 2LRUA 2QCZA 3ECIA 5GXGB 1YQBA 4K3CA 3PHXB 4IDIA 1TT5B 3AN1A 2YLMA 4LJPB 2LVOA 5FR3A 1KRHA 2MBOA 4BOZB 1J7BA 1UWXA 1QOFA 3BVZA 3PV1A 4GN1A 2ZPNA 2N9KA 2BW2A 1PYWD 2BYFA 5IN7A 3RULA 3OAWA 1WX9A 4A90A 4FA6A 3KUZA 1K52A 1N6ZA 4HKZE 2K6DB 2WNMA 4JWUC 2I38A 4YTMB 2N9EB 3WALA 2AL3A 3Q8AA 1GUAB 1U4AA 2WXLA 3DHIC 1FXIA 2K6QA 4LLGM 4FHJA 2OHFA 1L0YB 3W2DA 3IFWB 2M4NA 2KTRB 1OEYJ 2BKFA 3N20C 4ASWC 2M56B 5BMGA 2KLGA 1WXAA 2QEJC 3A4SC 1WRDB 2CU1A 1V1OA 1C77A 3ZDMC 3EHVA 2M17A 3AI5A 4EZKA 2MBHA 3ZVVA 1MG8A 3SU8X 2V0GA 2L83A 2LHEA 2KVZA 2IGDA 2RMMA 4YTPB 2EMSA 2KO3A 4XZ4A 2JWZA 3MTNB 3M62B 3QC8B 1Q10A 4BKGA 3QIJA 1FNVA 4UDUC 3TIXA 3T8MA 2CKHB 3GZNI 5D3IB 5LXIB 2D5GA 1VZ7A 1YNTE 1FXTB 1F77A 2KDEB 5MPOA 1V5TA 1ZDVA 2WXNA 5AEKB 1BMLC 5HHDG 2DAFA 2KWDA 1YD8U 3N1YC 2VH2A 1A70A 2M0XA 1P1AA 4C4VB 2LZ6A 3B2FA 2Z0DB 2LGIA 1I4HA 1ZKHA 4L1BA 3AXCA 3FILB 2JYEA 3UI3A 1UWMA 3H7PB 4G11A 4F8CB 2HTHA 4A8XC 2Q5WD 1TKGA 3TSSA 4GSWA 3X0WA 2Z59B 4IWQA 4PS3A 1WR6E 1HZ5A 3KW5B 2RDGA 1WYWB 3H9DA 1NYRA 1VDVA 3HRDD 4GXBA 1VJKA 2XK5A 3BIID 2N9PC 1N60A 4IG7B 1CK1A 4ARIA 1LFDA 2N0SB 3NVWA 1BT0A 2MBBB 4ZYSA 4OZCA 2LXAA 2WWZA 4LDTD 2FE8A 4US8A 3WAMA 1TGZB 2GBJA 3HM3A 5C23A 2L52A 2EELA 2YEPB 2IJ0A 3ENEA 3QARA 3A9JA 3K9PB 3J9CA 3VTVA 1SXTA 3LYYA 1XLQA 2J52A 3UGBB 1SSNA 1YN3A 2UWQA 1Q5WB 4XC2A 3RFZB 3VUXA 1SJED 1IYFA 4L23A 2D07B 3UF8A 3ML8A 3AM9A 4P6VF 3U30A 2J0MA 3RNFC 3ZTCA 3R66C 1ZP0B 3T9LA 4W9KA 2JZ3B 3BYTB 1WJUA 1TIFA 2EKEC 3U7ZA 1FNWA 2J7QB 3DVGX 3QAQA 1WX8A 4JPSA 2FIDA 2DNFA 3KWVA 3H1UA 3IT6B 3NJTA 3LB8C 1YX6B 4KDLB 2YEPF 3C0RB 2V3NA 1CJEA 1SE3A 2K5PA 4HEA1 3SFEB 5CHVC 2WX1A 1JW9D 1CMXB 2MLBA 3KWLA 4DXFA 4HDQA 3UIOB 3Q8FA 1UNSA 1QZEA 1WE6A 1FM0D 3TCAA 3VTUA 3NRZA 1D6EC 4PK1A 1WRIA 4YSXB 3BWUD 1BXTA 1WXMA 2X8XX 2KYWA 5JXVA 3EFCA 2N7DA 1I4PA 4N6EB 4BOSC 3ZJUA 1QF6A 5BMIA 4ZHOA 4FBJB 3W1SC 1ESFA 2KT7A 4A6QA 2VH1A 3ETRA 2IPKD 1YJIA 3ZQ4A 2WXGA 5J18A 1QLBB 2TSSA 4YWGG 3RYTA 4LCDE 1JRPA 1JRUA 1R4MB 3ML9A 2D11A 4GDKB 4MSQB 2FCSA 3JSVA 1GPXA 2GI9A 5H8YE 3RNBC 2NMQA 4FADA 4GGQA 2BTEA 3AE7B 3RNGC 4ZDVA 2J42A 1WJ6A 2RDBC 4KSLC 3VDZA 2O2VB 1RFKA 2N9LA 3MJWA 4I6NB 4BKTA 3VR8B 5LLIA 1HA5A 4HPLB 1KOTA 4RGMA 3AECB 2WXOA 2OOBB 2Y3AA 4NZLB 3NG0A 3VUYA 3RNEC 4OVUA 4DDID 1E7VA 3PT2B 2KXJA 2ZEQA 4MJSB 1KF6B 1FO4A 4WAAA 2LRWA 4LNOA 4YSZB 1ZE3D 2KKCA 4JIOU 3P4QB 2K8BA 3IHPC 2MBEA 4WQMA 3AEBB 1C3TA 1VZ8A 2MA9B 3R7RA 3DBHB 2HE7A 2MRPA 3Q3NC 3MC9A 2W9NA 4MGKE 2LEKA 1V80A 2JY6A 2MP2A 4TMAB 1WM3A 2DAJA 2XEWA 1WZ0A 1XEEA 4XDCA 1KFYB 3EFUA 1FRRA 2K0PA 4JGHB 1M4VA 1PFDA 3B2GA 4W9FA 2ZNVB 2WHIA 1QT9A 3MC0B 2MJEA 2DHZA 2QMTA 2KMAA 3A1QB 2KDBA 1E6EB 1ZW7A 3N32A 3AEDB 3PRZA 1SE4A 2N7JA 2GMIC 4A55A 4IM3A 1MVKA 4S17A 4N59A 3HVZA 3E56A 1I7HA 2YVCA 4RFBA 3NZSA 4M0WA 4URKA 2WU5B 4I6PA 1CZPA 3T3OA 1PDXA 5BYSA 4IUMB 2L7RA 3LJ3A 2E6XA 4JQWC 1UBQA 5HI1A 1WX7A 1V86A 2V9HA 1P9DU 4W9EA 3BZDB 1FXAA 1ET9A 4WJPA 4TQ1A 1FCCC 1XLPA 1FRDA 4N9F4 2J0KA 4YXDB 2JWUA 4O1NA 2KWVB 2L00B 5EE0A 1HXYD 3GOEA 5JH5C 4FJYA 1WMHB 2PE9A 1LXDA 1VRAB 2DWQA 5JHBA 1KLUD 5DPWA 2KANA 1RWSA 4GU2A 2LJ5A 4ZRQA 3NS1A 3SR6A 2CHXA 4DHJB 1T0YA 1K53A 1WE7A 4NJ6A 2N1WA 5GMVA 5CHWA 4BAXA 1XCTL 4W9JA 1ZXHA 2BWES 2D3AA 2KN4A 4DXAB 2KN5A 4DBGA 1D4BA 4MH8A 4M8NA 4K7UA 4A3OA 2AEHA 3ZW3A 4PT5A 3A9KA 2MCNB 4AWJA 1UGJA 1WWTA 2ZCBA 4G3XB 4MM3B 4C80A 2GRIA 1S1QB 1SB3C 4RF1A 1SEBD 3R2IA 5L95C 5D7GA 4WWMA 2WDQB 3NS8A 2IGGA 4BVUC 1GC7A 1XF5L 1C1YB 2JZZA 4KGRA 2I2YA 1FMAD 4DWFA 2ZCCA 1DOYA 4MH0E 2KACA 3U8ZA 2GLSA 2D2QA 2WDVB 4QAYA 2SAKA 3RMKC 3PZ7A 3RI7C 1V1PA 1K51A 3KLSX 4M02A 2KJHB 2REXA 2K25A 2PEAA 2K1FA 3QCAA 1QQRA 3GB1A 3ZXRA 2KFJA 2R2QA 2HTME 1HTQA 2NR2A 3L17A 4OVVA 1WGKA 1VD2A 1UGMA 4HVBA 4WJOA 1C4PA 2K9XA 1VLBA 1OFFA 2H89B 4WQOB 1WGRA 3GE8C 3H6NA 1C79A 2LXCA 2CHZA 3QA8A 4RMAA 2KTRA 1V2YA 2JU6X 4PYZA 3ZNID 2WGSA 3WAOA 3O65B 4GIVA 1OQRA 3C8YA 1E90A 2FAZA 3RNCC 2ZNVC 4KZ0A 1FEHA 3P4PB 3UQAA 3DWGC 4MSMB 4GLSC 1L6UA 2KX3A 3NHEB 4DHZB 3U52E 2JUOA 3AE2B 1R4NI 3APFA 4GOCA 4RM8A 2FCNA 3TUOA 1QOAA 3UINB 2WU2B 1J19A 4X57B 1N62A 1YQ3B 3ZXVA 4HK2A 3LXFA 3QQ8B 1RFAA 4HCNB 1S3SG 3UIPB 2ONQA 4D2KA 1Z2MA 3AE3B 4HCPB 2KLCA 2NBUA 2WYQA 2V3PA 4WIPA 1RRBA 1L5PA 1Q1OA 2Z0EB 3PLVA 5BYQA 4GDLA 3P4SB 1C78A 1SIJA 2BS2B 2L05A 2MBQA 5EE9A 2KDFB 3AE6B 4ICVA 2LWPA 3MC8A 4K3BA 2WDTB 4C4VA 4LJOB 2O6VA 2BYEA 3DVGY 2GOWA 1QOGA 1EF1A 2NBVB 3JYUA 1T5XD 4YTNB 3IXSA 2XNAC 4W9DA 1KLVA 4B9KA 3DHGC 3WIMA 2D3BA 1QILA 3B08A 2ZPYA 2MEKA 4AQ7A 3P63A 4NAMA 4RM9A 3OJ4B 1JWUD 3QX1A 1SBBB 2DZJA 1ET6A 4CO7A 4B0EA 2MSED 2NVUI 2G1EA 1Y56A 4K81A 4MGYE 3W1YA 3JW0X 3VR9B 1I4XA 3JVZX 3VH4B 3OLMD 1AARA 4ACFA 1L4DB 1PGBA 2PIAA 1DOIA 3QK0A 5JHAA 1YJJA 4DHZE 2FUHB 1D5MC 3SEBA 2INPE 2IY1B 3ZTDA 1KLGD 4K7SA 3BYYB 3PSEB 3TEXA 5TR5A 4JLCA 3LDZE 3R7QA 4H2AA 1QOBA 4WWPA 1E0ZA 3IVFA 5C1ZA 2FNJB 5AZFA 4HROA 2WXJA 1V97A 2W54A 4W9HA 4IW0A 1BUIC 1XQQA 1M94A 3Q8CA 3TMPB 3S2AA 2BQQA 3PO0A 2BGFA 2ZZPB 3WAPA 4IM2A 2NPTB 4ZOHC 1UELA 3Q6BA 3ZRCA 4A3PA 4G0NB 3P42A 3M3JA 3SD5A 2JPHA 2QILA 1JWBD 2DBYA 3BINA 3W5VB 4KV2A 4MT5A 3KYCD 1ZOYB 1GJZA 4R3DA 3RN9C 1GB1A 3P4RB 4FULA 3BVGA 3H8HA 4OHJA 2OJRA 2PJHA 2NCNA 4JX1C 4F1SA 1WF9A 2W3SA 1KJTA 4L2YA 1L2NA 3B0AA 2L0TA 5D3DA 1PUTA 3I5JC 2G4DB 2KX0A 2C5LC 4NAWA 1WGHA 2KTFA 1JWSD 4FJVB 4KVGB 4RNAA 2WXFA 1T0RC 3A9JB 2ZW1A 2ICIA 1RYJA 2XN9C 5AZGA 3EUB2 3EA6A 4EZLA 3CSFA 2K3UA 1TKYA 2D3GA 2NBWB 1OEYA 3AE4B 1WI0A 2LGYA 4P7IA 1STEA 1D5XC 3BK2A 4XYCA 2KC2A 3U2SC 2MX2A 4RF0A 4E71A 2IBIB 2J0JA 2E3TA 2Y5BB 1A5RA 4OZAA 3APDA 2WLBA 2QDFA 4BZAA 5BO4B 2K8CA 2CR5A 1P98A 2L1AA 3MHZA 1WH3A 3APCA 1EWCA 2MJ3A 2DX5B 3AV8A 3DBHI 2B76B 2BB6A 4ZRIA 2JRHA 4II2B 2RR9A 4DHJD 1NI2A 3NVVA 4ZHPA 4FLHA 4FXCA 1XD3B 3M63B 3V62A 2ZVOA 1DGJA 2WS3B 2KC1A 3K9OB 2EKIA 3E9SA 2WQYB 4RGOS 3TEYA 1GB4A 1HTOA 1E7UA 3AEGB 1N5XA 4WJNA 1E5WA 2FCQA 2BPSA 1YOVB 4IWOA 4AOFA 3M95A 3RCZA 1NEKB 2JXTA 3AE1B 4HXDA 2GBMA 3DPDA 1FFUA 2LGDA 5IA7A 2PE6B 2IO3B 4HLEA 5HKHA 3ZKJC 2V3SA 4BBNF 3OG5A 2BS3B 2GBRA 3AEAB 1I35A 3JSVB 5D2MB 3NY5A 1WFYA 4EFOA 2DYOA 1WR1A 4TQ0A 2LD9A 1I4QA 3SFDB 3NUHB 3AB5A 3I63C 1L0XB 2G9HD 4P1BC 4ANXA 4MGIE 1T6BX 4KKIA 2CHWA 3QJZA 3WCQA 3ZNGC 2QC8A 4K7WA 2OEDA 1P7FA 3N30A 3UQBA 2FBWB 2N4FA 2LVQA 1JROA 1L7YA 2DZMA 4MEMA 2C7NB 1ENFA 2M8SA 2N1VA 1E10A 1IP9A 1WY8A 1HQRD 1NI3A 2Y5CA 5EDSA 1K50A 1ZGUB 2L8JA 4E3CA 2QSDA 3B1LX 4W9IA 3VRAB 3VRBB 4XX5A 1TZOA 2MP2B 1B1ZA 4HPMB 1Q0WB 1MHXA 2KHWB 1NBFC 4PS8A 3MHSD 3ZRFA 3PRPB 3FC4A 1LO5D 2RSUA 3BVMA 1WXVA 3ABVB 3PZDA 4W9GA 1WJNA 1WMHA 3FAHA 2OJWA 3KVFB 2LUMA 2KJRA 2Y5PA 5HFYA 3NZUA 2CJOA 3IBEA 3I57A 2I1KA 3AEEB 2QHOA 3V6CB 1WZ3A 5AUIA 5C3JB 2KZRA 4AUQC 3PZ8A 4EUTA 3VH3B 3PPAA 2PKOA 4B95A 5IKCM 3PVLA 4P16A 4TSSA 4W9LA 3W5UB 1NENB 2INDC 4S0RA 2K8HA 3TL5A 1GG3A 3HK0A 1EUVB 3V05A 3MP9A 2BKRB 3IT4B 1L0VB 4MM3A 2MHJA 3HVDA 1MFWA 4B0MA 3AE9B 2JX5A 2KAJA 3T3NA 3ALBA 5IOIA 4E74A 4ANUA 3H7SA 4XGAB 2DYBA 1IBXA 1MJDA 1TY2A 1AWDA 1LGRA 4KSKC 1J7CA 1LM8B 1MPEA 1V5OA 4BBNC 2WX0A 4ZRPA 4DDGD 2WXRA 4M01A 1F2RC 4C56C 5EE1A 4J3OD 3Q2AC 2KNBA 5FKAC 2PW9A 3PHWB 2BT6A 2KD0A 3VXWA 4C00A 2UU7A 3D32A 1ACCA 3TJPA 2PPHA 1I4RA 1FFVA 4RGNA 4G50A 1XLNA 3BK1A 5IAAC 1TS3A 4ZRJA 1J7AA 1SE9A 2PLPA 1GNUA 1EF5A 5D6JB 3A33B 4BFRA 3DQVA 4IC7B 4WH4A 3N9YC 2RGFA 4EKUA 2HD5B 3V61A 1F1HA 2JQRB 2VZKB 3DCGA 1WM2A 2GBKA 5T8IA 2ZVNA 4XE0A 3DHHC 1MHHE 2V4IB 3I3TB 3VVWB 4MACA 3AMZA 3A9KB 5IO9A 2C7MB 3C19A 2ASQA 2AQ3B 2NS5A 3EGRA 5J17A 1IPGA 3WA0A 1N5WA 5AZHA 3DDCB 4EE2A 5DPRA 3KYDD 2KFKB 1ZUD2 3N1XC 2HJ8A 4KGSA 4LK0M 3VHTC 2RD0A 1V9JA 4ITKA 2DZKA 1C76A 1TTNA 3NVYA 4HKQA 4OW0A 4KIKB 2IZVB 3L4PA 4HJKA 4NPNA 3W1SA 2WP9B 4REZA 2KOXA 2WXKA 1E9MA 4OVZA 1EU3A 1OTRB 2G3QB 1V1PB 2M19A 1B9RA 1YN5A 1SGHA 3KUDB 1P7EA 2PVGC 1XCQL 1VCBA 2DENB 4HJGE 1CQVA 1SIFA 2BB5A 2KJ6A 5C2TB 2A5UA 2MQJA 4F7ZA 3RZWC 1D5ZC 2LGSA 2IDYA 3Q69A 4ZYNA 1R7SA 1NVID 1UUPA 2GBNA 1YN4A 4C7YA 1MG4A 4HDOA 3B9JA 2NTTA 4GB9A 3L08A 1WJ4A 3DBLB 3PLUA 3DBRB 1WYGA 4MGZE 3U4EG 1AW7A 4NQLB 3ZLZA 2KWCA 1L6VA 5FR6A 4LNKA 3SHQA 3FILA 1GOZA 3H7PA 4RGTA 5JZEB 2JSVX 2D3CA 1H8CA 1YJ1A 3L0WB 1XLOA 4WAFA 4HRSA 1TS5A 4WWNA 5KHOA 3P1MA 5J2RA 2W55A 3L54A 3TEWA 3GS2A 3PTFC 1XXGA 1HEZE 1C4CA 2MWSB 2WXMA 1UH6A 4GDLB 1KTKA 3URYA 2RDHA 3CMMB 2ZJDA 4JE3B 1EM7A 1FCLA 2RPVA 3L13A 2O6VB 1TZ1A 3X23A 3R2TA 2FUG1 3MFGA 3V6EB 4CHKA 1R4NB 1XO3A 1JQ4A 1ZXIA 3TEZA 3IG3A 1V49A 3CF6E 2NPTA 3L10B 1NDDA 3V3XA 4NNJB 1HE8A 4RH6A 2AX5A 4NJ7A 5DPSA 5G2NA 3HHMA 1YQ4B 1L4ZB 3NOBA 1IGDA 1TS4A 1T0SC 3DVNV 2V1YA 4PYUA 3ZGZA 3OJ3A 2JF5A 2UYZB 1WGYA 1WIAA 1XT9B 1LQBA 2KMMA 2JXXA 3PS6A 1SE2A 3IAM1 3P2BA 4JL9A 1DOXA 3GZNB 1F2RI 2LMCA 2HJ1A 1TYGB 2XK5B 1Y8RC 3QWZB 1UBIA 1JMLA 3ZJTA 1WGGA 1EWYC 1AYFA 1R4MI 3ZUNA 4AJWA 4Q2JA 1V6EA 2JT4B 2M1MA 2SEBD 1ZDXA 1FNUA 2BVCA 4P1CC 2X38A 3RNAC 3N1ZC 4BKSD 1IUEA 2BBCA 5TSSA 2IO0B 2LGXA 2KMCA 2KQ7A 4KZCA 4IOIE 4NQKE 3PGEA 5FK9C 3ZDTA 2D10A 2KK8A 1VZ6A 4FJZA 1GC6A 2LUEA 1WGDA 2JVCA 3NZ3A 1N61A 1WSPA 2J4XA 3VTWA 1TY0A 1FD6A 4KDIC 2JZPA 3ZNZB 2L0FA 1I42A 1C9FA 3Q3MC 4TV3A 3R8BA 2DLBA 3U7DA 4GDKA 3KUCB 4NJCA 2BYVE 5LXHA 2L76A 4NAWB 3ZIMA 1GAQB 5H92C 3PREA 1ISNA 2IO1B 2PTLA 3AULA 5D94A 1OGWA 5E6NA 2R2OA 1NYQA 3FKYA 4I6LB 2EMTA 4J6IA 3CWIA 5AUKA 3VFKA 2MJDA 2ON8A 2LVPA 4HWIB 4TKNA 4HPPA 2O2VA 2A4ZA 5HG2A 2IYDB 4CQNA 2KWUB 1P0RA 2QJLA 3BY4B 3I9V1 4XWWA 2AQ2B 2JYTA 1YIWA 5KHQA 4JWSC 1TS2A 2NTSA 2M0AA 3Q3FA 4PS7A 4MJSA 4YT0B 2PVOD 1EU4A 2CS4A 1VR9A 3DOWA 1X1MA 3EC8A 3AEFB 3Q14C 4KGTA 4OZBA 2K39A 3DVNU 2GB1A 4EOYA 1UD7A 4KX6B 2KQSA 3GE3C 2BF8B 1E8XA 1F0ZA 5CHFA 2PMVA 5DCNA 2G45B 2C60A 2C9WB 2XBBC 5E6OA 3DWMA 5CX3A 3GP7A 2BWFA 3HIZA 2MH7A 3Q8EA 3OWEB 1WXQA 1FIQA 2AL6A 5DPTA 2VZKD 4ZRKA 4LNFA 1ZPSA 2I1JA 3A1QA 2L3ZA 3VUWA 4A20A 2KVRA 4LTUA 1JWAD 2IGHA 1V81A 5IP4D 2V4LA 4C7ZA 1YX5B 1H4RA 4DK5A 4LDTB 3AE5B 1OQQA 3RZFA 4YL8A 3ZJVA 2FIFA 2LJIA 1WXSA 2J53A 2W3RA 4BKSA 4EZJA 4US9A 4RCOA 1V8CA 3ZO5B 1Z5SB 2JRIB 1JWMD 4B6WA 2ACZB 5EE3A 1SJHD 4MDKE 3EECA 1UZXB 3N3KB 2WXPA 4EEWA 1C4AA 2KDIA 2QIEB 2WXIA 4USAA 3VAWA 4A9AA 5G5HA 2BS4B 2L32A 3VQIA 4KKJA
chains in the Genus database with same CATH topology
2C7MB 4WJQA 2ASQA 1WXMA 2DZJA 2NS5A 1K8RB 2N7DA 4CO7A 3Q3JA 4BOSC 5J17A 2MSED 1IPGA 2FCMA 3WA0A 2NVUI 3W1YA 4K81A 4MGYE 3DDCB 3JW0X 5AZHA 3W1SC 5DPRA 4FBJB 1E8ZA 3KYDD 2KFKB 3JVZX 3VH4B 2HJ8A 3OLMD 1AARA 5L83A 4MELA 3QK0A 5JHAA 3VHTC 2RD0A 2MW5A 5J18A 4DHZE 2FUHB 3RYTA 4LCDE 1V9JA 2C7HA 2IY1B 2DZKA 3ZTDA 4K7SA 1JRUA 1TTNA 3PSEB 3ML9A 2D11A 4GDKB 4KIKB 5TR5A 2IZVB 4MSQB 4HJKA 4WWOA 4NPNA 2DYMA 3W1SA 4JLCA 3LDZE 2FCSA 3JSVA 3R7QA 4M8MA 4WWPA 2KOXA 3IVFA 5C1ZA 2FNJB 5AZFA 4M0WB 1OTRB 2G3QB 4W9HA 4IW0A 4FADA 2IO2B 4GGQA 2DZIA 4FN2A 1XQQA 5G55A 1M94A 3TMPB 1P3QU 3R3MA 1SGHA 3KUDB 3S2AA 4AP4C 2BGFA 4ZDVA 2ZZPB 4IWPA 3WAPA 1WJ6A 4KSLC 4IM2A 4GMVA 3VDZA 2RPQA 4ANVA 2O2VB 2NPTB 1VCBA 1UELA 2DENB 3ZRCA 1OQYA 4A3PA 3ZNHB 3MJWA 4G0NB 4I6NB 1J8CA 3M3JA 3TBLD 4BKTA 2VRRB 5LLIA 3SD5A 2JPHA 4TUUA 4HPLB 3BINA 1SIFA 1KOTA 4KV2A 3KYCD 2KJ6A 2AYOB 2A5UA 2OOBB 2MQJA 1KM7A 1GJZA 3VUYA 4W9CA 4F7ZA 4OVUA 3RZWC 1E8WA 3HM6X 3WANA 2LI5A 1E7VA 4DDID 3PT2B 2KXJA 4FULA 2ZEQA 4ZYNA 4MJSB 2GBNA 2IY0B 3RT3B 4WAAA 2OJRA 2PJHA 2LRWA 2NCNA 4F1SA 1WF9A 1KJTA 2KKCA 3RUIB 1L2NA 4JIOU 3B0AA 2K8BA 2L0TA 4II3B 3IHPC 4HDOA 2MBEA 2G4DB 2KX0A 2C5LC 4NAWA 3RD2A 1C3TA 1WGHA 2KTFA 4GB9A 2B3AA 2MA9B 3R7RA 3L08A 2HE7A 1F9JA 1WJ4A 2MRPA 1J0GA 4FJVB 2W9NA 4KVGB 4MGKE 3PLUA 1V80A 2JY6A 2MP2A 1WM3A 4MGZE 2DAJA 1RLFA 3A9JB 1EO6A 2XEWA 4NQLB 3ZLZA 2O6VD 1WZ0A 2KWCA 2LASA 3V60A 4IM0A 5FR6A 5AZGA 3SHQA 3EFUA 4EZLA 3CSFA 4JGHB 3H7PA 4ICUA 3KH0A 2N7EA 4FHKA 1G6JA 2D3GA 4CYEA 5JZEB 2AWTA 2NBWB 1RAXA 4W9FA 1OEYA 2ZNVB 2N9XA 1H8CA 1YJ1A 2DHZA 2KFKA 3L0WB 1WI0A 2G4SA 2LGYA 4P7IA 2KMAA 3A1QB 2KDBA 3CSTA 4NY0A 4WWNA 5KHOA 1TBEA 1ZW7A 5J2RA 3N32A 2KC2A 3L54A 3PRZA 3DBSA 3L16A 3PTFC 3PRMB 2MX2A 3ONSA 4E71A 2GMIC 1D3ZA 1E8YA 2IBIB 2J0JA 4KIKA 2Y5BB 2MWSB 1A5RA 1UH6A 4IM3A 3APDA 4GDLB 5BO4B 2K8CA 2YVCA 2CR5A 1P98A 3A4RA 3CMMB 2ZJDA 3AU5A 3NZSA 4K1RB 4URKA 1WH3A 3APCA 4AJYB 4ANWA 5E6PA 4I6PA 3L13A 2O6VB 2DX5B 3DBHI 1TZ1A 3SDLC 3DBLI 3X23A 4IUMB 4ZRIA 3AU4A 3V6EB 4CHKA 3QHTA 2L7RA 2JRHA 3DBRI 4II2B 2RR9A 3LJ3A 5CTRC 1NI2A 4DHJD 1PQSA 3IG3A 4JQWC 1UBQA 4FLHA 1V49A 3CF6E 1XD3B 2NPTA 1WX7A 1V86A 3L10B 1P9DU 1NDDA 3M63B 3V62A 2ZVOA 4W9EA 2LRUA 4NNJB 1HE8A 2KC1A 3ECIA 3K9OB 1YQBA 4NJ7A 3PHXB 5DPSA 5G2NA 3HHMA 2YLMA 4WJPA 4LJPB 4TQ1A 2LVOA 1E7UA 2MBOA 3NOBA 4BOZB 4N9F4 3PV1A 2J0KA 4GN1A 4WJNA 1E5WA 3DVNV 2V1YA 2ZPNA 2KWVB 2FCQA 2BPSA 2L00B 4PYUA 2BYFA 3OJ3A 3RULA 3GOEA 2JF5A 5JH5C 2UYZB 3OAWA 4IWOA 1WGYA 1WIAA 1WX9A 4AOFA 4FA6A 4FJYA 1WMHB 3KUZA 2PE9A 1LXDA 2K6DB 3M95A 1XT9B 1LQBA 3RCZA 5JHBA 2JXXA 2N9EB 3PS6A 3WALA 5DPWA 2KANA 2AL3A 4HXDA 4GU2A 2LJ5A 1GUAB 2GBMA 3DPDA 3P2BA 1U4AA 2LGDA 5IA7A 2PE6B 2IO3B 4JL9A 4HLEA 2CHXA 4DHJB 2K6QA 5HKHA 1T0YA 4FHJA 1WE7A 3ZKJC 4NJ6A 2V3SA 4BBNF 2N1WA 2XK5B 5GMVA 3IFWB 1Y8RC 2M4NA 2KTRB 2GBRA 5CHWA 3QWZB 1UBIA 1OEYJ 2BKFA 1I35A 4ASWC 3JSVB 5D2MB 3NY5A 1WGGA 3ZUNA 1R4MI 1WFYA 4AJWA 2KLGA 1WXAA 3A4SC 4W9JA 1WRDB 2CU1A 1V6EA 2JT4B 2BWES 4EFOA 2DYOA 2M1MA 3ZDMC 3EHVA 4DXAB 1WR1A 2KN5A 2M17A 3AI5A 4DBGA 4EZKA 4TQ0A 2MBHA 2LD9A 4M8NA 1MG8A 3OJ4B 4K7UA 3SU8X 2AEHA 4A3OA 3ZVVA 3ZW3A 4BKSD 3A9KA 2MCNB 4AWJA 2IO0B 2LGXA 2ZCBA 2KMCA 2EMSA 2KQ7A 4KZCA 4NQKE 2KO3A 3PGEA 4G3XB 3ZDTA 4XZ4A 4ANXA 4MGIE 1S1QB 2D10A 2JWZA 2KK8A 3MTNB 4FJZA 2CHWA 1GC6A 3M62B 3QJZA 5L95C 5D7GA 3ZNGC 2LUEA 3QC8B 1WGDA 4K7WA 2JVCA 4BKGA 3NS8A 3QIJA 3VTWA 4BVUC 3N30A 1GC7A 1C1YB 3UQBA 4KDIC 2JZZA 3TIXA 2N4FA 2LVQA 1L7YA 2DZMA 3T8MA 2L0FA 3ZNZB 1I42A 4MEMA 2CKHB 2C7NB 3GZNI 2M8SA 2N1VA 4TV3A 2ZCCA 4DWFA 5LXIB 1IP9A 4MH0E 3U7DA 1WY8A 3U8ZA 4GDKA 3KUCB 5EDSA 1FXTB 2KDEB 2BYVE 1V5TA 5LXHA 2L76A 4NAWB 1ZGUB 2D2QA 2L8JA 3ZIMA 4E3CA 5AEKB 4W9IA 3B1LX 2DAFA 1YD8U 3PREA 1ISNA 4XX5A 2MP2B 2IO1B 2M0XA 1P1AA 4HPMB 1Q0WB 2KJHB 2LZ6A 2KHWB 2REXA 3AULA 1NBFC 1OGWA 2K25A 2R2OA 2PEAA 2K1FA 4PS8A 3MHSD 5D94A 5E6NA 2Z0DB 4I6LB 1ZKHA 3ZRFA 2EMTA 4J6IA 3QCAA 3PRPB 3AXCA 3VFKA 2RSUA 3H7PB 1WXVA 2LVPA 4HWIB 4G11A 4TKNA 2O2VA 3PZDA 4W9GA 2A4ZA 1WJNA 2HTHA 4F8CB 2IYDB 2KFJA 1WMHA 2R2QA 2KWUB 2NR2A 3KVFB 3L17A 4OVVA 1VD2A 1UGMA 1P0RA 2KJRA 4GSWA 3X0WA 4HVBA 2Z59B 4WJOA 4IWQA 4PS3A 1WR6E 3BY4B 3KW5B 3NZUA 3IBEA 4WQOB 1WYWB 1YIWA 3H9DA 1WGRA 5KHQA 4GXBA 2I1KA 2XK5A 3H6NA 3Q3FA 2LXCA 2N9PC 2CHZA 3QA8A 4IG7B 4MJSA 2KTRA 4PS7A 4RMAA 1LFDA 1V2YA 2QHOA 2CS4A 1BT0A 4PYZA 3V6CB 1WZ3A 3DOWA 2MBBB 1X1MA 3EC8A 3ZNID 2KZRA 2LXAA 4AUQC 3WAOA 4EUTA 2WWZA 4LDTD 3O65B 4GIVA 2K39A 3VH3B 3PPAA 3WAMA 3DVNU 4B95A 4EOYA 3PVLA 1UD7A 1E90A 1TGZB 4W9LA 2FAZA 2BF8B 2GBJA 2KQSA 2ZNVC 3HM3A 5C23A 2K8HA 3TL5A 1GG3A 4KZ0A 3HK0A 3UQAA 1E8XA 1EUVB 4MSMB 3ENEA 3QARA 5CHFA 3A9JA 5DCNA 2BKRB 2G45B 2KX3A 3NHEB 4DHZB 3K9PB 2C60A 2C9WB 2XBBC 2JUOA 4MM3A 1R4NI 3APFA 4GOCA 4RM8A 2FCNA 5E6OA 3UINB 1J19A 4X57B 3VTVA 3ALBA 4E74A 4ANUA 5CX3A 3H7SA 2BWFA 2DYBA 3HIZA 4HK2A 3QQ8B 3UGBB 2UWQA 4KSKC 2AL6A 1Q5WB 1RFAA 4XC2A 5DPTA 4HCNB 4ZRKA 3VUXA 1LM8B 1S3SG 2I1JA 2L3ZA 3A1QA 1V5OA 3UIPB 2KVRA 3VUWA 4A20A 1Z2MA 4BBNC 2WX0A 1IYFA 4DDGD 4HCPB 2D07B 2KLCA 3ML8A 3UF8A 2NBUA 2WYQA 1V81A 2V4LA 2KNBA 3U30A 1YX5B 2J0MA 1H4RA 3PHWB 4DK5A 4LDTB 1RRBA 3ZTCA 1Q1OA 2Z0EB 3R66C 2KD0A 3PLVA 3RZFA 4YL8A 3T9LA 4W9KA 4GDLA 3VXWA 2JZ3B 1WJUA 2EKEC 2FIFA 2L05A 2MBQA 3D32A 1WXSA 2KDFB 3TJPA 2J7QB 3DVGX 4BKSA 2PPHA 3QAQA 4EZJA 4ICVA 2LWPA 1WX8A 2WDTB 4G50A 2FIDA 4LJOB 2O6VA 3ZO5B 2BYEA 1Z5SB 3DVGY 2GOWA 2JRIB 1EF1A 3H1UA 5IAAC 2NBVB 3JYUA 4B6WA 4ZRJA 4MDKE 1SE9A 1GNUA 1YX6B 4KDLB 1EF5A 5D6JB 4W9DA 1KLVA 3EECA 3A33B 3C0RB 1UZXB 4B9KA 3DQVA 4IC7B 4BFRA 3N3KB 3WIMA 2RGFA 4EEWA 4EKUA 2HD5B 2KDIA 3V61A 5CHVC 2WX1A 3VAWA 3DCGA 1CMXB 3B08A 1WM2A 2MLBA 2GBKA 2ZPYA 4HDQA 3UIOB 2ZVNA 1QZEA 1WE6A 3TCAA 3I3TB 3VQIA 3VVWB 4RM9A 3VTUA 3A9KB 3QX1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2C7M B;  4WJQ A;  2ASQ A;  1WXM A;  2DZJ A;  2NS5 A;  1K8R B;  2N7D A;  4CO7 A;  3Q3J A;  4BOS C;  5J17 A;  2MSE D;  1IPG A;  2FCM A;  3WA0 A;  2NVU I;  3W1Y A;  4K81 A;  4MGY E;  3DDC B;  3JW0 X;  5AZH A;  3W1S C;  5DPR A;  4FBJ B;  1E8Z A;  3KYD D;  2KFK B;  3JVZ X;  3VH4 B;  2HJ8 A;  3OLM D;  1AAR A;  5L83 A;  4MEL A;  3QK0 A;  5JHA A;  3VHT C;  2RD0 A;  2MW5 A;  5J18 A;  4DHZ E;  2FUH B;  3RYT A;  4LCD E;  1V9J A;  2C7H A;  2IY1 B;  2DZK A;  3ZTD A;  4K7S A;  1JRU A;  1TTN A;  3PSE B;  3ML9 A;  2D11 A;  4GDK B;  4KIK B;  5TR5 A;  2IZV B;  4MSQ B;  4HJK A;  4WWO A;  4NPN A;  2DYM A;  3W1S A;  4JLC A;  3LDZ E;  2FCS A;  3JSV A;  3R7Q A;  4M8M A;  4WWP A;  2KOX A;  3IVF A;  5C1Z A;  2FNJ B;  5AZF A;  4M0W B;  1OTR B;  2G3Q B;  4W9H A;  4IW0 A;  4FAD A;  2IO2 B;  4GGQ A;  2DZI A;  4FN2 A;  1XQQ A;  5G55 A;  1M94 A;  3TMP B;  1P3Q U;  3R3M A;  1SGH A;  3KUD B;  3S2A A;  4AP4 C;  2BGF A;  4ZDV A;  2ZZP B;  4IWP A;  3WAP A;  1WJ6 A;  4KSL C;  4IM2 A;  4GMV A;  3VDZ A;  2RPQ A;  4ANV A;  2O2V B;  2NPT B;  1VCB A;  1UEL A;  2DEN B;  3ZRC A;  1OQY A;  4A3P A;  3ZNH B;  3MJW A;  4G0N B;  4I6N B;  1J8C A;  3M3J A;  3TBL D;  4BKT A;  2VRR B;  5LLI A;  3SD5 A;  2JPH A;  4TUU A;  4HPL B;  3BIN A;  1SIF A;  1KOT A;  4KV2 A;  3KYC D;  2KJ6 A;  2AYO B;  2A5U A;  2OOB B;  2MQJ A;  1KM7 A;  1GJZ A;  3VUY A;  4W9C A;  4F7Z A;  4OVU A;  3RZW C;  1E8W A;  3HM6 X;  3WAN A;  2LI5 A;  1E7V A;  4DDI D;  3PT2 B;  2KXJ A;  4FUL A;  2ZEQ A;  4ZYN A;  4MJS B;  2GBN A;  2IY0 B;  3RT3 B;  4WAA A;  2OJR A;  2PJH A;  2LRW A;  2NCN A;  4F1S A;  1WF9 A;  1KJT A;  2KKC A;  3RUI B;  1L2N A;  4JIO U;  3B0A A;  2K8B A;  2L0T A;  4II3 B;  3IHP C;  4HDO A;  2MBE A;  2G4D B;  2KX0 A;  2C5L C;  4NAW A;  3RD2 A;  1C3T A;  1WGH A;  2KTF A;  4GB9 A;  2B3A A;  2MA9 B;  3R7R A;  3L08 A;  2HE7 A;  1F9J A;  1WJ4 A;  2MRP A;  1J0G A;  4FJV B;  2W9N A;  4KVG B;  4MGK E;  3PLU A;  1V80 A;  2JY6 A;  2MP2 A;  1WM3 A;  4MGZ E;  2DAJ A;  1RLF A;  3A9J B;  1EO6 A;  2XEW A;  4NQL B;  3ZLZ A;  2O6V D;  1WZ0 A;  2KWC A;  2LAS A;  3V60 A;  4IM0 A;  5FR6 A;  5AZG A;  3SHQ A;  3EFU A;  4EZL A;  3CSF A;  4JGH B;  3H7P A;  4ICU A;  3KH0 A;  2N7E A;  4FHK A;  1G6J A;  2D3G A;  4CYE A;  5JZE B;  2AWT A;  2NBW B;  1RAX A;  4W9F A;  1OEY A;  2ZNV B;  2N9X A;  1H8C A;  1YJ1 A;  2DHZ A;  2KFK A;  3L0W B;  1WI0 A;  2G4S A;  2LGY A;  4P7I A;  2KMA A;  3A1Q B;  2KDB A;  3CST A;  4NY0 A;  4WWN A;  5KHO A;  1TBE A;  1ZW7 A;  5J2R A;  3N32 A;  2KC2 A;  3L54 A;  3PRZ A;  3DBS A;  3L16 A;  3PTF C;  3PRM B;  2MX2 A;  3ONS A;  4E71 A;  2GMI C;  1D3Z A;  1E8Y A;  2IBI B;  2J0J A;  4KIK A;  2Y5B B;  2MWS B;  1A5R A;  1UH6 A;  4IM3 A;  3APD A;  4GDL B;  5BO4 B;  2K8C A;  2YVC A;  2CR5 A;  1P98 A;  3A4R A;  3CMM B;  2ZJD A;  3AU5 A;  3NZS A;  4K1R B;  4URK A;  1WH3 A;  3APC A;  4AJY B;  4ANW A;  5E6P A;  4I6P A;  3L13 A;  2O6V B;  2DX5 B;  3DBH I;  1TZ1 A;  3SDL C;  3DBL I;  3X23 A;  4IUM B;  4ZRI A;  3AU4 A;  3V6E B;  4CHK A;  3QHT A;  2L7R A;  2JRH A;  3DBR I;  4II2 B;  2RR9 A;  3LJ3 A;  5CTR C;  1NI2 A;  4DHJ D;  1PQS A;  3IG3 A;  4JQW C;  1UBQ A;  4FLH A;  1V49 A;  3CF6 E;  1XD3 B;  2NPT A;  1WX7 A;  1V86 A;  3L10 B;  1P9D U;  1NDD A;  3M63 B;  3V62 A;  2ZVO A;  4W9E A;  2LRU A;  4NNJ B;  1HE8 A;  2KC1 A;  3ECI A;  3K9O B;  1YQB A;  4NJ7 A;  3PHX B;  5DPS A;  5G2N A;  3HHM A;  2YLM A;  4WJP A;  4LJP B;  4TQ1 A;  2LVO A;  1E7U A;  2MBO A;  3NOB A;  4BOZ B;  4N9F 4;  3PV1 A;  2J0K A;  4GN1 A;  4WJN A;  1E5W A;  3DVN V;  2V1Y A;  2ZPN A;  2KWV B;  2FCQ A;  2BPS A;  2L00 B;  4PYU A;  2BYF A;  3OJ3 A;  3RUL A;  3GOE A;  2JF5 A;  5JH5 C;  2UYZ B;  3OAW A;  4IWO A;  1WGY A;  1WIA A;  1WX9 A;  4AOF A;  4FA6 A;  4FJY A;  1WMH B;  3KUZ A;  2PE9 A;  1LXD A;  2K6D B;  3M95 A;  1XT9 B;  1LQB A;  3RCZ A;  5JHB A;  2JXX A;  2N9E B;  3PS6 A;  3WAL A;  5DPW A;  2KAN A;  2AL3 A;  4HXD A;  4GU2 A;  2LJ5 A;  1GUA B;  2GBM A;  3DPD A;  3P2B A;  1U4A A;  2LGD A;  5IA7 A;  2PE6 B;  2IO3 B;  4JL9 A;  4HLE A;  2CHX A;  4DHJ B;  2K6Q A;  5HKH A;  1T0Y A;  4FHJ A;  1WE7 A;  3ZKJ C;  4NJ6 A;  2V3S A;  4BBN F;  2N1W A;  2XK5 B;  5GMV A;  3IFW B;  1Y8R C;  2M4N A;  2KTR B;  2GBR A;  5CHW A;  3QWZ B;  1UBI A;  1OEY J;  2BKF A;  1I35 A;  4ASW C;  3JSV B;  5D2M B;  3NY5 A;  1WGG A;  3ZUN A;  1R4M I;  1WFY A;  4AJW A;  2KLG A;  1WXA A;  3A4S C;  4W9J A;  1WRD B;  2CU1 A;  1V6E A;  2JT4 B;  2BWE S;  4EFO A;  2DYO A;  2M1M A;  3ZDM C;  3EHV A;  4DXA B;  1WR1 A;  2KN5 A;  2M17 A;  3AI5 A;  4DBG A;  4EZK A;  4TQ0 A;  2MBH A;  2LD9 A;  4M8N A;  1MG8 A;  3OJ4 B;  4K7U A;  3SU8 X;  2AEH A;  4A3O A;  3ZVV A;  3ZW3 A;  4BKS D;  3A9K A;  2MCN B;  4AWJ A;  2IO0 B;  2LGX A;  2ZCB A;  2KMC A;  2EMS A;  2KQ7 A;  4KZC A;  4NQK E;  2KO3 A;  3PGE A;  4G3X B;  3ZDT A;  4XZ4 A;  4ANX A;  4MGI E;  1S1Q B;  2D10 A;  2JWZ A;  2KK8 A;  3MTN B;  4FJZ A;  2CHW A;  1GC6 A;  3M62 B;  3QJZ A;  5L95 C;  5D7G A;  3ZNG C;  2LUE A;  3QC8 B;  1WGD A;  4K7W A;  2JVC A;  4BKG A;  3NS8 A;  3QIJ A;  3VTW A;  4BVU C;  3N30 A;  1GC7 A;  1C1Y B;  3UQB A;  4KDI C;  2JZZ A;  3TIX A;  2N4F A;  2LVQ A;  1L7Y A;  2DZM A;  3T8M A;  2L0F A;  3ZNZ B;  1I42 A;  4MEM A;  2CKH B;  2C7N B;  3GZN I;  2M8S A;  2N1V A;  4TV3 A;  2ZCC A;  4DWF A;  5LXI B;  1IP9 A;  4MH0 E;  3U7D A;  1WY8 A;  3U8Z A;  4GDK A;  3KUC B;  5EDS A;  1FXT B;  2KDE B;  2BYV E;  1V5T A;  5LXH A;  2L76 A;  4NAW B;  1ZGU B;  2D2Q A;  2L8J A;  3ZIM A;  4E3C A;  5AEK B;  4W9I A;  3B1L X;  2DAF A;  1YD8 U;  3PRE A;  1ISN A;  4XX5 A;  2MP2 B;  2IO1 B;  2M0X A;  1P1A A;  4HPM B;  1Q0W B;  2KJH B;  2LZ6 A;  2KHW B;  2REX A;  3AUL A;  1NBF C;  1OGW A;  2K25 A;  2R2O A;  2PEA A;  2K1F A;  4PS8 A;  3MHS D;  5D94 A;  5E6N A;  2Z0D B;  4I6L B;  1ZKH A;  3ZRF A;  2EMT A;  4J6I A;  3QCA A;  3PRP B;  3AXC A;  3VFK A;  2RSU A;  3H7P B;  1WXV A;  2LVP A;  4HWI B;  4G11 A;  4TKN A;  2O2V A;  3PZD A;  4W9G A;  2A4Z A;  1WJN A;  2HTH A;  4F8C B;  2IYD B;  2KFJ A;  1WMH A;  2R2Q A;  2KWU B;  2NR2 A;  3KVF B;  3L17 A;  4OVV A;  1VD2 A;  1UGM A;  1P0R A;  2KJR A;  4GSW A;  3X0W A;  4HVB A;  2Z59 B;  4WJO A;  4IWQ A;  4PS3 A;  1WR6 E;  3BY4 B;  3KW5 B;  3NZU A;  3IBE A;  4WQO B;  1WYW B;  1YIW A;  3H9D A;  1WGR A;  5KHQ A;  4GXB A;  2I1K A;  2XK5 A;  3H6N A;  3Q3F A;  2LXC A;  2N9P C;  2CHZ A;  3QA8 A;  4IG7 B;  4MJS A;  2KTR A;  4PS7 A;  4RMA A;  1LFD A;  1V2Y A;  2QHO A;  2CS4 A;  1BT0 A;  4PYZ A;  3V6C B;  1WZ3 A;  3DOW A;  2MBB B;  1X1M A;  3EC8 A;  3ZNI D;  2KZR A;  2LXA A;  4AUQ C;  3WAO A;  4EUT A;  2WWZ A;  4LDT D;  3O65 B;  4GIV A;  2K39 A;  3VH3 B;  3PPA A;  3WAM A;  3DVN U;  4B95 A;  4EOY A;  3PVL A;  1UD7 A;  1E90 A;  1TGZ B;  4W9L A;  2FAZ A;  2BF8 B;  2GBJ A;  2KQS A;  2ZNV C;  3HM3 A;  5C23 A;  2K8H A;  3TL5 A;  1GG3 A;  4KZ0 A;  3HK0 A;  3UQA A;  1E8X A;  1EUV B;  4MSM B;  3ENE A;  3QAR A;  5CHF A;  3A9J A;  5DCN A;  2BKR B;  2G45 B;  2KX3 A;  3NHE B;  4DHZ B;  3K9P B;  2C60 A;  2C9W B;  2XBB C;  2JUO A;  4MM3 A;  1R4N I;  3APF A;  4GOC A;  4RM8 A;  2FCN A;  5E6O A;  3UIN B;  1J19 A;  4X57 B;  3VTV A;  3ALB A;  4E74 A;  4ANU A;  5CX3 A;  3H7S A;  2BWF A;  2DYB A;  3HIZ A;  4HK2 A;  3QQ8 B;  3UGB B;  2UWQ A;  4KSK C;  2AL6 A;  1Q5W B;  1RFA A;  4XC2 A;  5DPT A;  4HCN B;  4ZRK A;  3VUX A;  1LM8 B;  1S3S G;  2I1J A;  2L3Z A;  3A1Q A;  1V5O A;  3UIP B;  2KVR A;  3VUW A;  4A20 A;  1Z2M A;  4BBN C;  2WX0 A;  1IYF A;  4DDG D;  4HCP B;  2D07 B;  2KLC A;  3ML8 A;  3UF8 A;  2NBU A;  2WYQ A;  1V81 A;  2V4L A;  2KNB A;  3U30 A;  1YX5 B;  2J0M A;  1H4R A;  3PHW B;  4DK5 A;  4LDT B;  1RRB A;  3ZTC A;  1Q1O A;  2Z0E B;  3R66 C;  2KD0 A;  3PLV A;  3RZF A;  4YL8 A;  3T9L A;  4W9K A;  4GDL A;  3VXW A;  2JZ3 B;  1WJU A;  2EKE C;  2FIF A;  2L05 A;  2MBQ A;  3D32 A;  1WXS A;  2KDF B;  3TJP A;  2J7Q B;  3DVG X;  4BKS A;  2PPH A;  3QAQ A;  4EZJ A;  4ICV A;  2LWP A;  1WX8 A;  2WDT B;  4G50 A;  2FID A;  4LJO B;  2O6V A;  3ZO5 B;  2BYE A;  1Z5S B;  3DVG Y;  2GOW A;  2JRI B;  1EF1 A;  3H1U A;  5IAA C;  2NBV B;  3JYU A;  4B6W A;  4ZRJ A;  4MDK E;  1SE9 A;  1GNU A;  1YX6 B;  4KDL B;  1EF5 A;  5D6J B;  4W9D A;  1KLV A;  3EEC A;  3A33 B;  3C0R B;  1UZX B;  4B9K A;  3DQV A;  4IC7 B;  4BFR A;  3N3K B;  3WIM A;  2RGF A;  4EEW A;  4EKU A;  2HD5 B;  2KDI A;  3V61 A;  5CHV C;  2WX1 A;  3VAW A;  3DCG A;  1CMX B;  3B08 A;  1WM2 A;  2MLB A;  2GBK A;  2ZPY A;  4HDQ A;  3UIO B;  2ZVN A;  1QZE A;  1WE6 A;  3TCA A;  3I3T B;  3VQI A;  3VVW B;  4RM9 A;  3VTU A;  3A9K B;  3QX1 A; 
#chains in the Genus database with same CATH topology
 2ZW0 A;  4WJQ A;  4DXG A;  1E7P B;  2K22 A;  1JAL A;  1K8R B;  4LNI A;  2INC C;  3Q3J A;  3Q3O C;  2FCM A;  1E8Z A;  3IAS 1;  2W82 A;  3RPF C;  1N63 A;  3AE8 B;  5L83 A;  4MEL A;  1KH0 A;  5G5G A;  2MW5 A;  2INN E;  2C7H A;  1I4G A;  2WXH A;  4IKG A;  5LNK 1;  5E6J A;  3HUI A;  2R61 A;  4WWO A;  2DYM A;  1IGC A;  4M8M A;  1YMH E;  3MJ5 A;  3KQ4 A;  4M0W B;  4XWT A;  2IO2 B;  2DZI A;  3CIR B;  4FN2 A;  5G55 A;  1P3Q U;  3R3M A;  4AP4 C;  1SF0 A;  4AS1 A;  4IWP A;  2HDE A;  3AH7 A;  4GMV A;  2CU3 A;  2RPQ A;  5BYR A;  2KQ4 X;  4ANV A;  4N58 A;  1OQY A;  3ZNH B;  1TKE A;  1J8C A;  3TBL D;  2VRR B;  1PGX A;  4TUU A;  1MI0 A;  2WDR B;  2AYO B;  1KM7 A;  4W9C A;  1E8W A;  3HM6 X;  3WAN A;  2LI5 A;  1F52 A;  1JCK B;  1RM6 C;  2Z8L A;  2IY0 B;  3RT3 B;  2WXQ A;  3O13 A;  3RUI B;  4II3 B;  4ARC A;  3RD2 A;  2B3A A;  1F9J A;  1J0G A;  3W9C B;  1RLF A;  1EO6 A;  2O6V D;  1T3Q A;  2H88 B;  2LAS A;  3V60 A;  4IM0 A;  1HZ6 A;  2KDM A;  4ICU A;  2LFI A;  3KH0 A;  1PGA A;  2N7E A;  4FHK A;  1G6J A;  3ZYY X;  1IBX B;  4CYE A;  2AWT A;  1RAX A;  1QKZ A;  2N9X A;  2KFK A;  2G4S A;  4WUR A;  3CST A;  1AN8 A;  4NY0 A;  1TBE A;  3DBS A;  3L16 A;  4YSY B;  5I4D A;  3NVZ A;  3PRM B;  2BYT A;  3ONS A;  1D3Z A;  1E8Y A;  2AQ1 B;  4KIK A;  1TJE A;  1FPY A;  1ROE A;  1T0Q C;  1DYQ A;  3A4R A;  3AU5 A;  4K1R B;  4AJY B;  4ANW A;  4M00 A;  4XDD A;  5E6P A;  1UF0 A;  4LNN A;  2LHD A;  3SDL C;  3DBL I;  3AU4 A;  3Q8B A;  3QHT A;  3DBR I;  5CTR C;  2CJN A;  4DQO C;  1PQS A;  5BMH A;  2LRU A;  2QCZ A;  3ECI A;  5GXG B;  1YQB A;  4K3C A;  3PHX B;  4IDI A;  1TT5 B;  3AN1 A;  2YLM A;  4LJP B;  2LVO A;  5FR3 A;  1KRH A;  2MBO A;  4BOZ B;  1J7B A;  1UWX A;  1QOF A;  3BVZ A;  3PV1 A;  4GN1 A;  2ZPN A;  2N9K A;  2BW2 A;  1PYW D;  2BYF A;  5IN7 A;  3RUL A;  3OAW A;  1WX9 A;  4A90 A;  4FA6 A;  3KUZ A;  1K52 A;  1N6Z A;  4HKZ E;  2K6D B;  2WNM A;  4JWU C;  2I38 A;  4YTM B;  2N9E B;  3WAL A;  2AL3 A;  3Q8A A;  1GUA B;  1U4A A;  2WXL A;  3DHI C;  1FXI A;  2K6Q A;  4LLG M;  4FHJ A;  2OHF A;  1L0Y B;  3W2D A;  3IFW B;  2M4N A;  2KTR B;  1OEY J;  2BKF A;  3N20 C;  4ASW C;  2M56 B;  5BMG A;  2KLG A;  1WXA A;  2QEJ C;  3A4S C;  1WRD B;  2CU1 A;  1V1O A;  1C77 A;  3ZDM C;  3EHV A;  2M17 A;  3AI5 A;  4EZK A;  2MBH A;  3ZVV A;  1MG8 A;  3SU8 X;  2V0G A;  2L83 A;  2LHE A;  2KVZ A;  2IGD A;  2RMM A;  4YTP B;  2EMS A;  2KO3 A;  4XZ4 A;  2JWZ A;  3MTN B;  3M62 B;  3QC8 B;  1Q10 A;  4BKG A;  3QIJ A;  1FNV A;  4UDU C;  3TIX A;  3T8M A;  2CKH B;  3GZN I;  5D3I B;  5LXI B;  2D5G A;  1VZ7 A;  1YNT E;  1FXT B;  1F77 A;  2KDE B;  5MPO A;  1V5T A;  1ZDV A;  2WXN A;  5AEK B;  1BML C;  5HHD G;  2DAF A;  2KWD A;  1YD8 U;  3N1Y C;  2VH2 A;  1A70 A;  2M0X A;  1P1A A;  4C4V B;  2LZ6 A;  3B2F A;  2Z0D B;  2LGI A;  1I4H A;  1ZKH A;  4L1B A;  3AXC A;  3FIL B;  2JYE A;  3UI3 A;  1UWM A;  3H7P B;  4G11 A;  4F8C B;  2HTH A;  4A8X C;  2Q5W D;  1TKG A;  3TSS A;  4GSW A;  3X0W A;  2Z59 B;  4IWQ A;  4PS3 A;  1WR6 E;  1HZ5 A;  3KW5 B;  2RDG A;  1WYW B;  3H9D A;  1NYR A;  1VDV A;  3HRD D;  4GXB A;  1VJK A;  2XK5 A;  3BII D;  2N9P C;  1N60 A;  4IG7 B;  1CK1 A;  4ARI A;  1LFD A;  2N0S B;  3NVW A;  1BT0 A;  2MBB B;  4ZYS A;  4OZC A;  2LXA A;  2WWZ A;  4LDT D;  2FE8 A;  4US8 A;  3WAM A;  1TGZ B;  2GBJ A;  3HM3 A;  5C23 A;  2L52 A;  2EEL A;  2YEP B;  2IJ0 A;  3ENE A;  3QAR A;  3A9J A;  3K9P B;  3J9C A;  3VTV A;  1SXT A;  3LYY A;  1XLQ A;  2J52 A;  3UGB B;  1SSN A;  1YN3 A;  2UWQ A;  1Q5W B;  4XC2 A;  3RFZ B;  3VUX A;  1SJE D;  1IYF A;  4L23 A;  2D07 B;  3UF8 A;  3ML8 A;  3AM9 A;  4P6V F;  3U30 A;  2J0M A;  3RNF C;  3ZTC A;  3R66 C;  1ZP0 B;  3T9L A;  4W9K A;  2JZ3 B;  3BYT B;  1WJU A;  1TIF A;  2EKE C;  3U7Z A;  1FNW A;  2J7Q B;  3DVG X;  3QAQ A;  1WX8 A;  4JPS A;  2FID A;  2DNF A;  3KWV A;  3H1U A;  3IT6 B;  3NJT A;  3LB8 C;  1YX6 B;  4KDL B;  2YEP F;  3C0R B;  2V3N A;  1CJE A;  1SE3 A;  2K5P A;  4HEA 1;  3SFE B;  5CHV C;  2WX1 A;  1JW9 D;  1CMX B;  2MLB A;  3KWL A;  4DXF A;  4HDQ A;  3UIO B;  3Q8F A;  1UNS A;  1QZE A;  1WE6 A;  1FM0 D;  3TCA A;  3VTU A;  3NRZ A;  1D6E C;  4PK1 A;  1WRI A;  4YSX B;  3BWU D;  1BXT A;  1WXM A;  2X8X X;  2KYW A;  5JXV A;  3EFC A;  2N7D A;  1I4P A;  4N6E B;  4BOS C;  3ZJU A;  1QF6 A;  5BMI A;  4ZHO A;  4FBJ B;  3W1S C;  1ESF A;  2KT7 A;  4A6Q A;  2VH1 A;  3ETR A;  2IPK D;  1YJI A;  3ZQ4 A;  2WXG A;  5J18 A;  1QLB B;  2TSS A;  4YWG G;  3RYT A;  4LCD E;  1JRP A;  1JRU A;  1R4M B;  3ML9 A;  2D11 A;  4GDK B;  4MSQ B;  2FCS A;  3JSV A;  1GPX A;  2GI9 A;  5H8Y E;  3RNB C;  2NMQ A;  4FAD A;  4GGQ A;  2BTE A;  3AE7 B;  3RNG C;  4ZDV A;  2J42 A;  1WJ6 A;  2RDB C;  4KSL C;  3VDZ A;  2O2V B;  1RFK A;  2N9L A;  3MJW A;  4I6N B;  4BKT A;  3VR8 B;  5LLI A;  1HA5 A;  4HPL B;  1KOT A;  4RGM A;  3AEC B;  2WXO A;  2OOB B;  2Y3A A;  4NZL B;  3NG0 A;  3VUY A;  3RNE C;  4OVU A;  4DDI D;  1E7V A;  3PT2 B;  2KXJ A;  2ZEQ A;  4MJS B;  1KF6 B;  1FO4 A;  4WAA A;  2LRW A;  4LNO A;  4YSZ B;  1ZE3 D;  2KKC A;  4JIO U;  3P4Q B;  2K8B A;  3IHP C;  2MBE A;  4WQM A;  3AEB B;  1C3T A;  1VZ8 A;  2MA9 B;  3R7R A;  3DBH B;  2HE7 A;  2MRP A;  3Q3N C;  3MC9 A;  2W9N A;  4MGK E;  2LEK A;  1V80 A;  2JY6 A;  2MP2 A;  4TMA B;  1WM3 A;  2DAJ A;  2XEW A;  1WZ0 A;  1XEE A;  4XDC A;  1KFY B;  3EFU A;  1FRR A;  2K0P A;  4JGH B;  1M4V A;  1PFD A;  3B2G A;  4W9F A;  2ZNV B;  2WHI A;  1QT9 A;  3MC0 B;  2MJE A;  2DHZ A;  2QMT A;  2KMA A;  3A1Q B;  2KDB A;  1E6E B;  1ZW7 A;  3N32 A;  3AED B;  3PRZ A;  1SE4 A;  2N7J A;  2GMI C;  4A55 A;  4IM3 A;  1MVK A;  4S17 A;  4N59 A;  3HVZ A;  3E56 A;  1I7H A;  2YVC A;  4RFB A;  3NZS A;  4M0W A;  4URK A;  2WU5 B;  4I6P A;  1CZP A;  3T3O A;  1PDX A;  5BYS A;  4IUM B;  2L7R A;  3LJ3 A;  2E6X A;  4JQW C;  1UBQ A;  5HI1 A;  1WX7 A;  1V86 A;  2V9H A;  1P9D U;  4W9E A;  3BZD B;  1FXA A;  1ET9 A;  4WJP A;  4TQ1 A;  1FCC C;  1XLP A;  1FRD A;  4N9F 4;  2J0K A;  4YXD B;  2JWU A;  4O1N A;  2KWV B;  2L00 B;  5EE0 A;  1HXY D;  3GOE A;  5JH5 C;  4FJY A;  1WMH B;  2PE9 A;  1LXD A;  1VRA B;  2DWQ A;  5JHB A;  1KLU D;  5DPW A;  2KAN A;  1RWS A;  4GU2 A;  2LJ5 A;  4ZRQ A;  3NS1 A;  3SR6 A;  2CHX A;  4DHJ B;  1T0Y A;  1K53 A;  1WE7 A;  4NJ6 A;  2N1W A;  5GMV A;  5CHW A;  4BAX A;  1XCT L;  4W9J A;  1ZXH A;  2BWE S;  2D3A A;  2KN4 A;  4DXA B;  2KN5 A;  4DBG A;  1D4B A;  4MH8 A;  4M8N A;  4K7U A;  4A3O A;  2AEH A;  3ZW3 A;  4PT5 A;  3A9K A;  2MCN B;  4AWJ A;  1UGJ A;  1WWT A;  2ZCB A;  4G3X B;  4MM3 B;  4C80 A;  2GRI A;  1S1Q B;  1SB3 C;  4RF1 A;  1SEB D;  3R2I A;  5L95 C;  5D7G A;  4WWM A;  2WDQ B;  3NS8 A;  2IGG A;  4BVU C;  1GC7 A;  1XF5 L;  1C1Y B;  2JZZ A;  4KGR A;  2I2Y A;  1FMA D;  4DWF A;  2ZCC A;  1DOY A;  4MH0 E;  2KAC A;  3U8Z A;  2GLS A;  2D2Q A;  2WDV B;  4QAY A;  2SAK A;  3RMK C;  3PZ7 A;  3RI7 C;  1V1P A;  1K51 A;  3KLS X;  4M02 A;  2KJH B;  2REX A;  2K25 A;  2PEA A;  2K1F A;  3QCA A;  1QQR A;  3GB1 A;  3ZXR A;  2KFJ A;  2R2Q A;  2HTM E;  1HTQ A;  2NR2 A;  3L17 A;  4OVV A;  1WGK A;  1VD2 A;  1UGM A;  4HVB A;  4WJO A;  1C4P A;  2K9X A;  1VLB A;  1OFF A;  2H89 B;  4WQO B;  1WGR A;  3GE8 C;  3H6N A;  1C79 A;  2LXC A;  2CHZ A;  3QA8 A;  4RMA A;  2KTR A;  1V2Y A;  2JU6 X;  4PYZ A;  3ZNI D;  2WGS A;  3WAO A;  3O65 B;  4GIV A;  1OQR A;  3C8Y A;  1E90 A;  2FAZ A;  3RNC C;  2ZNV C;  4KZ0 A;  1FEH A;  3P4P B;  3UQA A;  3DWG C;  4MSM B;  4GLS C;  1L6U A;  2KX3 A;  3NHE B;  4DHZ B;  3U52 E;  2JUO A;  3AE2 B;  1R4N I;  3APF A;  4GOC A;  4RM8 A;  2FCN A;  3TUO A;  1QOA A;  3UIN B;  2WU2 B;  1J19 A;  4X57 B;  1N62 A;  1YQ3 B;  3ZXV A;  4HK2 A;  3LXF A;  3QQ8 B;  1RFA A;  4HCN B;  1S3S G;  3UIP B;  2ONQ A;  4D2K A;  1Z2M A;  3AE3 B;  4HCP B;  2KLC A;  2NBU A;  2WYQ A;  2V3P A;  4WIP A;  1RRB A;  1L5P A;  1Q1O A;  2Z0E B;  3PLV A;  5BYQ A;  4GDL A;  3P4S B;  1C78 A;  1SIJ A;  2BS2 B;  2L05 A;  2MBQ A;  5EE9 A;  2KDF B;  3AE6 B;  4ICV A;  2LWP A;  3MC8 A;  4K3B A;  2WDT B;  4C4V A;  4LJO B;  2O6V A;  2BYE A;  3DVG Y;  2GOW A;  1QOG A;  1EF1 A;  2NBV B;  3JYU A;  1T5X D;  4YTN B;  3IXS A;  2XNA C;  4W9D A;  1KLV A;  4B9K A;  3DHG C;  3WIM A;  2D3B A;  1QIL A;  3B08 A;  2ZPY A;  2MEK A;  4AQ7 A;  3P63 A;  4NAM A;  4RM9 A;  3OJ4 B;  1JWU D;  3QX1 A;  1SBB B;  2DZJ A;  1ET6 A;  4CO7 A;  4B0E A;  2MSE D;  2NVU I;  2G1E A;  1Y56 A;  4K81 A;  4MGY E;  3W1Y A;  3JW0 X;  3VR9 B;  1I4X A;  3JVZ X;  3VH4 B;  3OLM D;  1AAR A;  4ACF A;  1L4D B;  1PGB A;  2PIA A;  1DOI A;  3QK0 A;  5JHA A;  1YJJ A;  4DHZ E;  2FUH B;  1D5M C;  3SEB A;  2INP E;  2IY1 B;  3ZTD A;  1KLG D;  4K7S A;  3BYY B;  3PSE B;  3TEX A;  5TR5 A;  4JLC A;  3LDZ E;  3R7Q A;  4H2A A;  1QOB A;  4WWP A;  1E0Z A;  3IVF A;  5C1Z A;  2FNJ B;  5AZF A;  4HRO A;  2WXJ A;  1V97 A;  2W54 A;  4W9H A;  4IW0 A;  1BUI C;  1XQQ A;  1M94 A;  3Q8C A;  3TMP B;  3S2A A;  2BQQ A;  3PO0 A;  2BGF A;  2ZZP B;  3WAP A;  4IM2 A;  2NPT B;  4ZOH C;  1UEL A;  3Q6B A;  3ZRC A;  4A3P A;  4G0N B;  3P42 A;  3M3J A;  3SD5 A;  2JPH A;  2QIL A;  1JWB D;  2DBY A;  3BIN A;  3W5V B;  4KV2 A;  4MT5 A;  3KYC D;  1ZOY B;  1GJZ A;  4R3D A;  3RN9 C;  1GB1 A;  3P4R B;  4FUL A;  3BVG A;  3H8H A;  4OHJ A;  2OJR A;  2PJH A;  2NCN A;  4JX1 C;  4F1S A;  1WF9 A;  2W3S A;  1KJT A;  4L2Y A;  1L2N A;  3B0A A;  2L0T A;  5D3D A;  1PUT A;  3I5J C;  2G4D B;  2KX0 A;  2C5L C;  4NAW A;  1WGH A;  2KTF A;  1JWS D;  4FJV B;  4KVG B;  4RNA A;  2WXF A;  1T0R C;  3A9J B;  2ZW1 A;  2ICI A;  1RYJ A;  2XN9 C;  5AZG A;  3EUB 2;  3EA6 A;  4EZL A;  3CSF A;  2K3U A;  1TKY A;  2D3G A;  2NBW B;  1OEY A;  3AE4 B;  1WI0 A;  2LGY A;  4P7I A;  1STE A;  1D5X C;  3BK2 A;  4XYC A;  2KC2 A;  3U2S C;  2MX2 A;  4RF0 A;  4E71 A;  2IBI B;  2J0J A;  2E3T A;  2Y5B B;  1A5R A;  4OZA A;  3APD A;  2WLB A;  2QDF A;  4BZA A;  5BO4 B;  2K8C A;  2CR5 A;  1P98 A;  2L1A A;  3MHZ A;  1WH3 A;  3APC A;  1EWC A;  2MJ3 A;  2DX5 B;  3AV8 A;  3DBH I;  2B76 B;  2BB6 A;  4ZRI A;  2JRH A;  4II2 B;  2RR9 A;  4DHJ D;  1NI2 A;  3NVV A;  4ZHP A;  4FLH A;  4FXC A;  1XD3 B;  3M63 B;  3V62 A;  2ZVO A;  1DGJ A;  2WS3 B;  2KC1 A;  3K9O B;  2EKI A;  3E9S A;  2WQY B;  4RGO S;  3TEY A;  1GB4 A;  1HTO A;  1E7U A;  3AEG B;  1N5X A;  4WJN A;  1E5W A;  2FCQ A;  2BPS A;  1YOV B;  4IWO A;  4AOF A;  3M95 A;  3RCZ A;  1NEK B;  2JXT A;  3AE1 B;  4HXD A;  2GBM A;  3DPD A;  1FFU A;  2LGD A;  5IA7 A;  2PE6 B;  2IO3 B;  4HLE A;  5HKH A;  3ZKJ C;  2V3S A;  4BBN F;  3OG5 A;  2BS3 B;  2GBR A;  3AEA B;  1I35 A;  3JSV B;  5D2M B;  3NY5 A;  1WFY A;  4EFO A;  2DYO A;  1WR1 A;  4TQ0 A;  2LD9 A;  1I4Q A;  3SFD B;  3NUH B;  3AB5 A;  3I63 C;  1L0X B;  2G9H D;  4P1B C;  4ANX A;  4MGI E;  1T6B X;  4KKI A;  2CHW A;  3QJZ A;  3WCQ A;  3ZNG C;  2QC8 A;  4K7W A;  2OED A;  1P7F A;  3N30 A;  3UQB A;  2FBW B;  2N4F A;  2LVQ A;  1JRO A;  1L7Y A;  2DZM A;  4MEM A;  2C7N B;  1ENF A;  2M8S A;  2N1V A;  1E10 A;  1IP9 A;  1WY8 A;  1HQR D;  1NI3 A;  2Y5C A;  5EDS A;  1K50 A;  1ZGU B;  2L8J A;  4E3C A;  2QSD A;  3B1L X;  4W9I A;  3VRA B;  3VRB B;  4XX5 A;  1TZO A;  2MP2 B;  1B1Z A;  4HPM B;  1Q0W B;  1MHX A;  2KHW B;  1NBF C;  4PS8 A;  3MHS D;  3ZRF A;  3PRP B;  3FC4 A;  1LO5 D;  2RSU A;  3BVM A;  1WXV A;  3ABV B;  3PZD A;  4W9G A;  1WJN A;  1WMH A;  3FAH A;  2OJW A;  3KVF B;  2LUM A;  2KJR A;  2Y5P A;  5HFY A;  3NZU A;  2CJO A;  3IBE A;  3I57 A;  2I1K A;  3AEE B;  2QHO A;  3V6C B;  1WZ3 A;  5AUI A;  5C3J B;  2KZR A;  4AUQ C;  3PZ8 A;  4EUT A;  3VH3 B;  3PPA A;  2PKO A;  4B95 A;  5IKC M;  3PVL A;  4P16 A;  4TSS A;  4W9L A;  3W5U B;  1NEN B;  2IND C;  4S0R A;  2K8H A;  3TL5 A;  1GG3 A;  3HK0 A;  1EUV B;  3V05 A;  3MP9 A;  2BKR B;  3IT4 B;  1L0V B;  4MM3 A;  2MHJ A;  3HVD A;  1MFW A;  4B0M A;  3AE9 B;  2JX5 A;  2KAJ A;  3T3N A;  3ALB A;  5IOI A;  4E74 A;  4ANU A;  3H7S A;  4XGA B;  2DYB A;  1IBX A;  1MJD A;  1TY2 A;  1AWD A;  1LGR A;  4KSK C;  1J7C A;  1LM8 B;  1MPE A;  1V5O A;  4BBN C;  2WX0 A;  4ZRP A;  4DDG D;  2WXR A;  4M01 A;  1F2R C;  4C56 C;  5EE1 A;  4J3O D;  3Q2A C;  2KNB A;  5FKA C;  2PW9 A;  3PHW B;  2BT6 A;  2KD0 A;  3VXW A;  4C00 A;  2UU7 A;  3D32 A;  1ACC A;  3TJP A;  2PPH A;  1I4R A;  1FFV A;  4RGN A;  4G50 A;  1XLN A;  3BK1 A;  5IAA C;  1TS3 A;  4ZRJ A;  1J7A A;  1SE9 A;  2PLP A;  1GNU A;  1EF5 A;  5D6J B;  3A33 B;  4BFR A;  3DQV A;  4IC7 B;  4WH4 A;  3N9Y C;  2RGF A;  4EKU A;  2HD5 B;  3V61 A;  1F1H A;  2JQR B;  2VZK B;  3DCG A;  1WM2 A;  2GBK A;  5T8I A;  2ZVN A;  4XE0 A;  3DHH C;  1MHH E;  2V4I B;  3I3T B;  3VVW B;  4MAC A;  3AMZ A;  3A9K B;  5IO9 A;  2C7M B;  3C19 A;  2ASQ A;  2AQ3 B;  2NS5 A;  3EGR A;  5J17 A;  1IPG A;  3WA0 A;  1N5W A;  5AZH A;  3DDC B;  4EE2 A;  5DPR A;  3KYD D;  2KFK B;  1ZUD 2;  3N1X C;  2HJ8 A;  4KGS A;  4LK0 M;  3VHT C;  2RD0 A;  1V9J A;  4ITK A;  2DZK A;  1C76 A;  1TTN A;  3NVY A;  4HKQ A;  4OW0 A;  4KIK B;  2IZV B;  3L4P A;  4HJK A;  4NPN A;  3W1S A;  2WP9 B;  4REZ A;  2KOX A;  2WXK A;  1E9M A;  4OVZ A;  1EU3 A;  1OTR B;  2G3Q B;  1V1P B;  2M19 A;  1B9R A;  1YN5 A;  1SGH A;  3KUD B;  1P7E A;  2PVG C;  1XCQ L;  1VCB A;  2DEN B;  4HJG E;  1CQV A;  1SIF A;  2BB5 A;  2KJ6 A;  5C2T B;  2A5U A;  2MQJ A;  4F7Z A;  3RZW C;  1D5Z C;  2LGS A;  2IDY A;  3Q69 A;  4ZYN A;  1R7S A;  1NVI D;  1UUP A;  2GBN A;  1YN4 A;  4C7Y A;  1MG4 A;  4HDO A;  3B9J A;  2NTT A;  4GB9 A;  3L08 A;  1WJ4 A;  3DBL B;  3PLU A;  3DBR B;  1WYG A;  4MGZ E;  3U4E G;  1AW7 A;  4NQL B;  3ZLZ A;  2KWC A;  1L6V A;  5FR6 A;  4LNK A;  3SHQ A;  3FIL A;  1GOZ A;  3H7P A;  4RGT A;  5JZE B;  2JSV X;  2D3C A;  1H8C A;  1YJ1 A;  3L0W B;  1XLO A;  4WAF A;  4HRS A;  1TS5 A;  4WWN A;  5KHO A;  3P1M A;  5J2R A;  2W55 A;  3L54 A;  3TEW A;  3GS2 A;  3PTF C;  1XXG A;  1HEZ E;  1C4C A;  2MWS B;  2WXM A;  1UH6 A;  4GDL B;  1KTK A;  3URY A;  2RDH A;  3CMM B;  2ZJD A;  4JE3 B;  1EM7 A;  1FCL A;  2RPV A;  3L13 A;  2O6V B;  1TZ1 A;  3X23 A;  3R2T A;  2FUG 1;  3MFG A;  3V6E B;  4CHK A;  1R4N B;  1XO3 A;  1JQ4 A;  1ZXI A;  3TEZ A;  3IG3 A;  1V49 A;  3CF6 E;  2NPT A;  3L10 B;  1NDD A;  3V3X A;  4NNJ B;  1HE8 A;  4RH6 A;  2AX5 A;  4NJ7 A;  5DPS A;  5G2N A;  3HHM A;  1YQ4 B;  1L4Z B;  3NOB A;  1IGD A;  1TS4 A;  1T0S C;  3DVN V;  2V1Y A;  4PYU A;  3ZGZ A;  3OJ3 A;  2JF5 A;  2UYZ B;  1WGY A;  1WIA A;  1XT9 B;  1LQB A;  2KMM A;  2JXX A;  3PS6 A;  1SE2 A;  3IAM 1;  3P2B A;  4JL9 A;  1DOX A;  3GZN B;  1F2R I;  2LMC A;  2HJ1 A;  1TYG B;  2XK5 B;  1Y8R C;  3QWZ B;  1UBI A;  1JML A;  3ZJT A;  1WGG A;  1EWY C;  1AYF A;  1R4M I;  3ZUN A;  4AJW A;  4Q2J A;  1V6E A;  2JT4 B;  2M1M A;  2SEB D;  1ZDX A;  1FNU A;  2BVC A;  4P1C C;  2X38 A;  3RNA C;  3N1Z C;  4BKS D;  1IUE A;  2BBC A;  5TSS A;  2IO0 B;  2LGX A;  2KMC A;  2KQ7 A;  4KZC A;  4IOI E;  4NQK E;  3PGE A;  5FK9 C;  3ZDT A;  2D10 A;  2KK8 A;  1VZ6 A;  4FJZ A;  1GC6 A;  2LUE A;  1WGD A;  2JVC A;  3NZ3 A;  1N61 A;  1WSP A;  2J4X A;  3VTW A;  1TY0 A;  1FD6 A;  4KDI C;  2JZP A;  3ZNZ B;  2L0F A;  1I42 A;  1C9F A;  3Q3M C;  4TV3 A;  3R8B A;  2DLB A;  3U7D A;  4GDK A;  3KUC B;  4NJC A;  2BYV E;  5LXH A;  2L76 A;  4NAW B;  3ZIM A;  1GAQ B;  5H92 C;  3PRE A;  1ISN A;  2IO1 B;  2PTL A;  3AUL A;  5D94 A;  1OGW A;  5E6N A;  2R2O A;  1NYQ A;  3FKY A;  4I6L B;  2EMT A;  4J6I A;  3CWI A;  5AUK A;  3VFK A;  2MJD A;  2ON8 A;  2LVP A;  4HWI B;  4TKN A;  4HPP A;  2O2V A;  2A4Z A;  5HG2 A;  2IYD B;  4CQN A;  2KWU B;  1P0R A;  2QJL A;  3BY4 B;  3I9V 1;  4XWW A;  2AQ2 B;  2JYT A;  1YIW A;  5KHQ A;  4JWS C;  1TS2 A;  2NTS A;  2M0A A;  3Q3F A;  4PS7 A;  4MJS A;  4YT0 B;  2PVO D;  1EU4 A;  2CS4 A;  1VR9 A;  3DOW A;  1X1M A;  3EC8 A;  3AEF B;  3Q14 C;  4KGT A;  4OZB A;  2K39 A;  3DVN U;  2GB1 A;  4EOY A;  1UD7 A;  4KX6 B;  2KQS A;  3GE3 C;  2BF8 B;  1E8X A;  1F0Z A;  5CHF A;  2PMV A;  5DCN A;  2G45 B;  2C60 A;  2C9W B;  2XBB C;  5E6O A;  3DWM A;  5CX3 A;  3GP7 A;  2BWF A;  3HIZ A;  2MH7 A;  3Q8E A;  3OWE B;  1WXQ A;  1FIQ A;  2AL6 A;  5DPT A;  2VZK D;  4ZRK A;  4LNF A;  1ZPS A;  2I1J A;  3A1Q A;  2L3Z A;  3VUW A;  4A20 A;  2KVR A;  4LTU A;  1JWA D;  2IGH A;  1V81 A;  5IP4 D;  2V4L A;  4C7Z A;  1YX5 B;  1H4R A;  4DK5 A;  4LDT B;  3AE5 B;  1OQQ A;  3RZF A;  4YL8 A;  3ZJV A;  2FIF A;  2LJI A;  1WXS A;  2J53 A;  2W3R A;  4BKS A;  4EZJ A;  4US9 A;  4RCO A;  1V8C A;  3ZO5 B;  1Z5S B;  2JRI B;  1JWM D;  4B6W A;  2ACZ B;  5EE3 A;  1SJH D;  4MDK E;  3EEC A;  1UZX B;  3N3K B;  2WXP A;  4EEW A;  1C4A A;  2KDI A;  2QIE B;  2WXI A;  4USA A;  3VAW A;  4A9A A;  5G5H A;  2BS4 B;  2L32 A;  3VQI A;  4KKJ A; 
#chains in the Genus database with same CATH homology
 2C7M B;  4WJQ A;  2ASQ A;  1WXM A;  2DZJ A;  2NS5 A;  1K8R B;  2N7D A;  4CO7 A;  3Q3J A;  4BOS C;  5J17 A;  2MSE D;  1IPG A;  2FCM A;  3WA0 A;  2NVU I;  3W1Y A;  4K81 A;  4MGY E;  3DDC B;  3JW0 X;  5AZH A;  3W1S C;  5DPR A;  4FBJ B;  1E8Z A;  3KYD D;  2KFK B;  3JVZ X;  3VH4 B;  2HJ8 A;  3OLM D;  1AAR A;  5L83 A;  4MEL A;  3QK0 A;  5JHA A;  3VHT C;  2RD0 A;  2MW5 A;  5J18 A;  4DHZ E;  2FUH B;  3RYT A;  4LCD E;  1V9J A;  2C7H A;  2IY1 B;  2DZK A;  3ZTD A;  4K7S A;  1JRU A;  1TTN A;  3PSE B;  3ML9 A;  2D11 A;  4GDK B;  4KIK B;  5TR5 A;  2IZV B;  4MSQ B;  4HJK A;  4WWO A;  4NPN A;  2DYM A;  3W1S A;  4JLC A;  3LDZ E;  2FCS A;  3JSV A;  3R7Q A;  4M8M A;  4WWP A;  2KOX A;  3IVF A;  5C1Z A;  2FNJ B;  5AZF A;  4M0W B;  1OTR B;  2G3Q B;  4W9H A;  4IW0 A;  4FAD A;  2IO2 B;  4GGQ A;  2DZI A;  4FN2 A;  1XQQ A;  5G55 A;  1M94 A;  3TMP B;  1P3Q U;  3R3M A;  1SGH A;  3KUD B;  3S2A A;  4AP4 C;  2BGF A;  4ZDV A;  2ZZP B;  4IWP A;  3WAP A;  1WJ6 A;  4KSL C;  4IM2 A;  4GMV A;  3VDZ A;  2RPQ A;  4ANV A;  2O2V B;  2NPT B;  1VCB A;  1UEL A;  2DEN B;  3ZRC A;  1OQY A;  4A3P A;  3ZNH B;  3MJW A;  4G0N B;  4I6N B;  1J8C A;  3M3J A;  3TBL D;  4BKT A;  2VRR B;  5LLI A;  3SD5 A;  2JPH A;  4TUU A;  4HPL B;  3BIN A;  1SIF A;  1KOT A;  4KV2 A;  3KYC D;  2KJ6 A;  2AYO B;  2A5U A;  2OOB B;  2MQJ A;  1KM7 A;  1GJZ A;  3VUY A;  4W9C A;  4F7Z A;  4OVU A;  3RZW C;  1E8W A;  3HM6 X;  3WAN A;  2LI5 A;  1E7V A;  4DDI D;  3PT2 B;  2KXJ A;  4FUL A;  2ZEQ A;  4ZYN A;  4MJS B;  2GBN A;  2IY0 B;  3RT3 B;  4WAA A;  2OJR A;  2PJH A;  2LRW A;  2NCN A;  4F1S A;  1WF9 A;  1KJT A;  2KKC A;  3RUI B;  1L2N A;  4JIO U;  3B0A A;  2K8B A;  2L0T A;  4II3 B;  3IHP C;  4HDO A;  2MBE A;  2G4D B;  2KX0 A;  2C5L C;  4NAW A;  3RD2 A;  1C3T A;  1WGH A;  2KTF A;  4GB9 A;  2B3A A;  2MA9 B;  3R7R A;  3L08 A;  2HE7 A;  1F9J A;  1WJ4 A;  2MRP A;  1J0G A;  4FJV B;  2W9N A;  4KVG B;  4MGK E;  3PLU A;  1V80 A;  2JY6 A;  2MP2 A;  1WM3 A;  4MGZ E;  2DAJ A;  1RLF A;  3A9J B;  1EO6 A;  2XEW A;  4NQL B;  3ZLZ A;  2O6V D;  1WZ0 A;  2KWC A;  2LAS A;  3V60 A;  4IM0 A;  5FR6 A;  5AZG A;  3SHQ A;  3EFU A;  4EZL A;  3CSF A;  4JGH B;  3H7P A;  4ICU A;  3KH0 A;  2N7E A;  4FHK A;  1G6J A;  2D3G A;  4CYE A;  5JZE B;  2AWT A;  2NBW B;  1RAX A;  4W9F A;  1OEY A;  2ZNV B;  2N9X A;  1H8C A;  1YJ1 A;  2DHZ A;  2KFK A;  3L0W B;  1WI0 A;  2G4S A;  2LGY A;  4P7I A;  2KMA A;  3A1Q B;  2KDB A;  3CST A;  4NY0 A;  4WWN A;  5KHO A;  1TBE A;  1ZW7 A;  5J2R A;  3N32 A;  2KC2 A;  3L54 A;  3PRZ A;  3DBS A;  3L16 A;  3PTF C;  3PRM B;  2MX2 A;  3ONS A;  4E71 A;  2GMI C;  1D3Z A;  1E8Y A;  2IBI B;  2J0J A;  4KIK A;  2Y5B B;  2MWS B;  1A5R A;  1UH6 A;  4IM3 A;  3APD A;  4GDL B;  5BO4 B;  2K8C A;  2YVC A;  2CR5 A;  1P98 A;  3A4R A;  3CMM B;  2ZJD A;  3AU5 A;  3NZS A;  4K1R B;  4URK A;  1WH3 A;  3APC A;  4AJY B;  4ANW A;  5E6P A;  4I6P A;  3L13 A;  2O6V B;  2DX5 B;  3DBH I;  1TZ1 A;  3SDL C;  3DBL I;  3X23 A;  4IUM B;  4ZRI A;  3AU4 A;  3V6E B;  4CHK A;  3QHT A;  2L7R A;  2JRH A;  3DBR I;  4II2 B;  2RR9 A;  3LJ3 A;  5CTR C;  1NI2 A;  4DHJ D;  1PQS A;  3IG3 A;  4JQW C;  1UBQ A;  4FLH A;  1V49 A;  3CF6 E;  1XD3 B;  2NPT A;  1WX7 A;  1V86 A;  3L10 B;  1P9D U;  1NDD A;  3M63 B;  3V62 A;  2ZVO A;  4W9E A;  2LRU A;  4NNJ B;  1HE8 A;  2KC1 A;  3ECI A;  3K9O B;  1YQB A;  4NJ7 A;  3PHX B;  5DPS A;  5G2N A;  3HHM A;  2YLM A;  4WJP A;  4LJP B;  4TQ1 A;  2LVO A;  1E7U A;  2MBO A;  3NOB A;  4BOZ B;  4N9F 4;  3PV1 A;  2J0K A;  4GN1 A;  4WJN A;  1E5W A;  3DVN V;  2V1Y A;  2ZPN A;  2KWV B;  2FCQ A;  2BPS A;  2L00 B;  4PYU A;  2BYF A;  3OJ3 A;  3RUL A;  3GOE A;  2JF5 A;  5JH5 C;  2UYZ B;  3OAW A;  4IWO A;  1WGY A;  1WIA A;  1WX9 A;  4AOF A;  4FA6 A;  4FJY A;  1WMH B;  3KUZ A;  2PE9 A;  1LXD A;  2K6D B;  3M95 A;  1XT9 B;  1LQB A;  3RCZ A;  5JHB A;  2JXX A;  2N9E B;  3PS6 A;  3WAL A;  5DPW A;  2KAN A;  2AL3 A;  4HXD A;  4GU2 A;  2LJ5 A;  1GUA B;  2GBM A;  3DPD A;  3P2B A;  1U4A A;  2LGD A;  5IA7 A;  2PE6 B;  2IO3 B;  4JL9 A;  4HLE A;  2CHX A;  4DHJ B;  2K6Q A;  5HKH A;  1T0Y A;  4FHJ A;  1WE7 A;  3ZKJ C;  4NJ6 A;  2V3S A;  4BBN F;  2N1W A;  2XK5 B;  5GMV A;  3IFW B;  1Y8R C;  2M4N A;  2KTR B;  2GBR A;  5CHW A;  3QWZ B;  1UBI A;  1OEY J;  2BKF A;  1I35 A;  4ASW C;  3JSV B;  5D2M B;  3NY5 A;  1WGG A;  3ZUN A;  1R4M I;  1WFY A;  4AJW A;  2KLG A;  1WXA A;  3A4S C;  4W9J A;  1WRD B;  2CU1 A;  1V6E A;  2JT4 B;  2BWE S;  4EFO A;  2DYO A;  2M1M A;  3ZDM C;  3EHV A;  4DXA B;  1WR1 A;  2KN5 A;  2M17 A;  3AI5 A;  4DBG A;  4EZK A;  4TQ0 A;  2MBH A;  2LD9 A;  4M8N A;  1MG8 A;  3OJ4 B;  4K7U A;  3SU8 X;  2AEH A;  4A3O A;  3ZVV A;  3ZW3 A;  4BKS D;  3A9K A;  2MCN B;  4AWJ A;  2IO0 B;  2LGX A;  2ZCB A;  2KMC A;  2EMS A;  2KQ7 A;  4KZC A;  4NQK E;  2KO3 A;  3PGE A;  4G3X B;  3ZDT A;  4XZ4 A;  4ANX A;  4MGI E;  1S1Q B;  2D10 A;  2JWZ A;  2KK8 A;  3MTN B;  4FJZ A;  2CHW A;  1GC6 A;  3M62 B;  3QJZ A;  5L95 C;  5D7G A;  3ZNG C;  2LUE A;  3QC8 B;  1WGD A;  4K7W A;  2JVC A;  4BKG A;  3NS8 A;  3QIJ A;  3VTW A;  4BVU C;  3N30 A;  1GC7 A;  1C1Y B;  3UQB A;  4KDI C;  2JZZ A;  3TIX A;  2N4F A;  2LVQ A;  1L7Y A;  2DZM A;  3T8M A;  2L0F A;  3ZNZ B;  1I42 A;  4MEM A;  2CKH B;  2C7N B;  3GZN I;  2M8S A;  2N1V A;  4TV3 A;  2ZCC A;  4DWF A;  5LXI B;  1IP9 A;  4MH0 E;  3U7D A;  1WY8 A;  3U8Z A;  4GDK A;  3KUC B;  5EDS A;  1FXT B;  2KDE B;  2BYV E;  1V5T A;  5LXH A;  2L76 A;  4NAW B;  1ZGU B;  2D2Q A;  2L8J A;  3ZIM A;  4E3C A;  5AEK B;  4W9I A;  3B1L X;  2DAF A;  1YD8 U;  3PRE A;  1ISN A;  4XX5 A;  2MP2 B;  2IO1 B;  2M0X A;  1P1A A;  4HPM B;  1Q0W B;  2KJH B;  2LZ6 A;  2KHW B;  2REX A;  3AUL A;  1NBF C;  1OGW A;  2K25 A;  2R2O A;  2PEA A;  2K1F A;  4PS8 A;  3MHS D;  5D94 A;  5E6N A;  2Z0D B;  4I6L B;  1ZKH A;  3ZRF A;  2EMT A;  4J6I A;  3QCA A;  3PRP B;  3AXC A;  3VFK A;  2RSU A;  3H7P B;  1WXV A;  2LVP A;  4HWI B;  4G11 A;  4TKN A;  2O2V A;  3PZD A;  4W9G A;  2A4Z A;  1WJN A;  2HTH A;  4F8C B;  2IYD B;  2KFJ A;  1WMH A;  2R2Q A;  2KWU B;  2NR2 A;  3KVF B;  3L17 A;  4OVV A;  1VD2 A;  1UGM A;  1P0R A;  2KJR A;  4GSW A;  3X0W A;  4HVB A;  2Z59 B;  4WJO A;  4IWQ A;  4PS3 A;  1WR6 E;  3BY4 B;  3KW5 B;  3NZU A;  3IBE A;  4WQO B;  1WYW B;  1YIW A;  3H9D A;  1WGR A;  5KHQ A;  4GXB A;  2I1K A;  2XK5 A;  3H6N A;  3Q3F A;  2LXC A;  2N9P C;  2CHZ A;  3QA8 A;  4IG7 B;  4MJS A;  2KTR A;  4PS7 A;  4RMA A;  1LFD A;  1V2Y A;  2QHO A;  2CS4 A;  1BT0 A;  4PYZ A;  3V6C B;  1WZ3 A;  3DOW A;  2MBB B;  1X1M A;  3EC8 A;  3ZNI D;  2KZR A;  2LXA A;  4AUQ C;  3WAO A;  4EUT A;  2WWZ A;  4LDT D;  3O65 B;  4GIV A;  2K39 A;  3VH3 B;  3PPA A;  3WAM A;  3DVN U;  4B95 A;  4EOY A;  3PVL A;  1UD7 A;  1E90 A;  1TGZ B;  4W9L A;  2FAZ A;  2BF8 B;  2GBJ A;  2KQS A;  2ZNV C;  3HM3 A;  5C23 A;  2K8H A;  3TL5 A;  1GG3 A;  4KZ0 A;  3HK0 A;  3UQA A;  1E8X A;  1EUV B;  4MSM B;  3ENE A;  3QAR A;  5CHF A;  3A9J A;  5DCN A;  2BKR B;  2G45 B;  2KX3 A;  3NHE B;  4DHZ B;  3K9P B;  2C60 A;  2C9W B;  2XBB C;  2JUO A;  4MM3 A;  1R4N I;  3APF A;  4GOC A;  4RM8 A;  2FCN A;  5E6O A;  3UIN B;  1J19 A;  4X57 B;  3VTV A;  3ALB A;  4E74 A;  4ANU A;  5CX3 A;  3H7S A;  2BWF A;  2DYB A;  3HIZ A;  4HK2 A;  3QQ8 B;  3UGB B;  2UWQ A;  4KSK C;  2AL6 A;  1Q5W B;  1RFA A;  4XC2 A;  5DPT A;  4HCN B;  4ZRK A;  3VUX A;  1LM8 B;  1S3S G;  2I1J A;  2L3Z A;  3A1Q A;  1V5O A;  3UIP B;  2KVR A;  3VUW A;  4A20 A;  1Z2M A;  4BBN C;  2WX0 A;  1IYF A;  4DDG D;  4HCP B;  2D07 B;  2KLC A;  3ML8 A;  3UF8 A;  2NBU A;  2WYQ A;  1V81 A;  2V4L A;  2KNB A;  3U30 A;  1YX5 B;  2J0M A;  1H4R A;  3PHW B;  4DK5 A;  4LDT B;  1RRB A;  3ZTC A;  1Q1O A;  2Z0E B;  3R66 C;  2KD0 A;  3PLV A;  3RZF A;  4YL8 A;  3T9L A;  4W9K A;  4GDL A;  3VXW A;  2JZ3 B;  1WJU A;  2EKE C;  2FIF A;  2L05 A;  2MBQ A;  3D32 A;  1WXS A;  2KDF B;  3TJP A;  2J7Q B;  3DVG X;  4BKS A;  2PPH A;  3QAQ A;  4EZJ A;  4ICV A;  2LWP A;  1WX8 A;  2WDT B;  4G50 A;  2FID A;  4LJO B;  2O6V A;  3ZO5 B;  2BYE A;  1Z5S B;  3DVG Y;  2GOW A;  2JRI B;  1EF1 A;  3H1U A;  5IAA C;  2NBV B;  3JYU A;  4B6W A;  4ZRJ A;  4MDK E;  1SE9 A;  1GNU A;  1YX6 B;  4KDL B;  1EF5 A;  5D6J B;  4W9D A;  1KLV A;  3EEC A;  3A33 B;  3C0R B;  1UZX B;  4B9K A;  3DQV A;  4IC7 B;  4BFR A;  3N3K B;  3WIM A;  2RGF A;  4EEW A;  4EKU A;  2HD5 B;  2KDI A;  3V61 A;  5CHV C;  2WX1 A;  3VAW A;  3DCG A;  1CMX B;  3B08 A;  1WM2 A;  2MLB A;  2GBK A;  2ZPY A;  4HDQ A;  3UIO B;  2ZVN A;  1QZE A;  1WE6 A;  3TCA A;  3I3T B;  3VQI A;  3VVW B;  4RM9 A;  3VTU A;  3A9K B;  3QX1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...