2E6XA

X-ray structure of tt1592 from thermus thermophilus hb8
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
69
structure length
69
Chain Sequence
MEKDLLDKLGQHLVWRMGRAEDEDVLVVRVGLASATPRFRELPRLLNLPEAEMRRLVQEGRVRVEWVEE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Hypothetical protein TTHA1281
publication title X-ray structure of TT1592 from Thermus thermophilus HB8
rcsb
source organism Thermus thermophilus
molecule tags Structural genomics, unknown function
total genus 16
structure length 69
sequence length 69
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2007-01-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF11609 DUF3248 Protein of unknown function (DUF3248)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.570 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 2e6xA00
2E6XA
chains in the Genus database with same CATH superfamily
1MG4A 3VH3B 1U4AA 2Z8LA 1YQ3B 5J17A 3VUYA 3PLVA 1C76A 5IA7A 3FC4A 3SFEB 4A3OA 2KKCA 2C9WB 2J53A 3AE6B 2BWFA 4XDCA 1D4BA 3JSVB 3VHTC 1VD2A 3GE8C 3ZDMC 4G3XB 4P6VF 3TEXA 3ML8A 3PRZA 4W9DA 4HDOA 1C79A 2LJ5A 1NBFC 5CX3A 4M0WB 4PYUA 3OWEB 3UGBB 1F77A 1R4MI 4GIVA 5DPTA 1H8CA 1UWMA 1XLQA 3DHGC 2L00B 4DXFA 2NBWB 1FCLA 1SE2A 1WZ3A 3W5VB 3L10B 3AE4B 1T3QA 4FN2A 3DCGA 2N7EA 2M0AA 3I63C 3NVWA 2BF8B 2PIAA 1YQBA 3IT4B 3ZLZA 1I35A 4HRSA 5BMHA 2SAKA 4A8XC 4AP4C 3JVZX 4XC2A 5FKAC 3K9PB 3QQ8B 3RNFC 2ON8A 4BOZB 1S3SG 2BPSA 2C60A 3PLUA 3RN9C 4FULA 5D3IB 2W55A 5CHWA 4BOSC 4ASWC 1SE4A 5FR3A 2G1EA 4LNIA 4GMVA 3Q3FA 4MSMB 5BMIA 1FXIA 3P2BA 1T0SC 3LYYA 4HPPA 2WYQA 1KRHA 2PPHA 2JYTA 1TS3A 2RPVA 4M8MA 2C7NB 1ZPSA 2WXMA 3AEDB 2IJ0A 2XK5B 1EF1A 1D6EC 1E9MA 2G9HD 2WXQA 1ZXHA 2GBKA 4Q2JA 4HKQA 3AEGB 2M56B 3B9JA 2LGXA 2QILA 1R4NB 3SEBA 4AUQC 1BUIC 1UGJA 4C7YA 1GC6A 3CWIA 4LTUA 2KJHB 2MW5A 3H8HA 4EZKA 2WHIA 2KXJA 3AE5B 4KKIA 4DXGA 2G45B 1OEYA 1JWBD 1QOAA 1E6EB 4WQMA 4ZRPA 1AYFA 4WH4A 4JQWC 2N4FA 4IC7B 4IUMB 4LNOA 1L4ZB 4K3BA 4E3CA 4MGZE 2BW2A 2JF5A 2JZPA 4WJOA 1EWYC 4OZBA 1EF5A 1KJTA 4XX5A 1TS2A 2KQ4X 3A4RA 2N1WA 3NS1A 4NPNA 1E7VA 2CU1A 4L23A 4HXDA 1KM7A 3Q3NC 4C4VA 3BYTB 2REXA 1J0GA 5D7GA 1V49A 4FJZA 3EA6A 3VTVA 2VRRB 4KSLC 2BS3B 2IPKD 4NAMA 4A90A 3NG0A 2DWQA 2Z0DB 3P63A 2TSSA 1TJEA 1I42A 1NEKB 4ANUA 2BB5A 2DAJA 1ET6A 1TT5B 4P7IA 3BVMA 1WXVA 2D3GA 2D11A 4IM2A 4KSKC 1UUPA 2NR2A 1WX9A 5D2MB 5HKHA 1E8ZA 2CHZA 1OEYJ 1TGZB 3RNCC 4TMAB 4HJGE 4WJNA 5AZHA 1ZUD2 4BKSA 3MTNB 3Q8FA 4GDKB 3DQVA 4RH6A 2DZKA 2VZKD 4HROA 2AWTA 1ACCA 4JLCA 1YMHE 2JU6X 1WGDA 5JZEB 4USAA 3PS6A 3TBLD 3AE9B 1YJJA 3NZSA 1NYRA 1OQQA 4HVBA 2ZJDA 4H2AA 4BBNC 2V0GA 5G5HA 3APDA 2L0FA 2LVQA 1IP9A 1J7BA 4E74A 3UQBA 3M95A 3AE1B 2PJHA 2PE9A 4RMAA 3APFA 4YT0B 1QLBB 4LJOB 2K6QA 4IWOA 1YNTE 2IO1B 4MJSA 1NI2A 3IHPC 4CHKA 2FCSA 1WE6A 3N3KB 3NVVA 2DYMA 5D3DA 2DYOA 2LFIA 4GGQA 4W9IA 1EU4A 1WM2A 1V8CA 2EKEC 1TIFA 2ZW0A 4RM8A 1L5PA 1Q1OA 3BINA 1K51A 4OVZA 1J19A 2O6VD 4BVUC 3CSFA 5C23A 3TEZA 1L7YA 3I3TB 1OQYA 4JX1C 2IO2B 2OJRA 2MJEA 2C7HA 1L0VB 3CIRB 2DZIA 2JX5A 4REZA 1WM3A 3Q8AA 5T8IA 1AWDA 2JXTA 2K9XA 1BT0A 5D94A 1WF9A 1NVID 3QHTA 4HJKA 1EU3A 2K1FA 2GI9A 4MACA 1L0XB 4LDTD 2INDC 4L2YA 1QKZA 2J0MA 1JQ4A 1CK1A 1XCQL 2R61A 4TKNA 3GOEA 2WGSA 1TS4A 1V5OA 2EELA 2KLGA 2KJRA 3HRDD 3DDCB 2GOWA 3PV1A 4B9KA 1TZ1A 2MBQA 3L54A 2DX5B 4BKGA 2CHXA 3AB5A 3KUZA 3R7RA 2DZJA 5JHBA 2LRWA 2D5GA 3AI5A 3VTUA 2CS4A 4A55A 1CZPA 3U4EG 2LRUA 2XK5A 1UNSA 3NVYA 1AW7A 3NY5A 4EZJA 2LZ6A 2DHZA 2WXGA 4XZ4A 3HIZA 2L7RA 1I4GA 1MHHE 4NNJB 2LHDA 2KTFA 3LJ3A 3M3JA 4YTMB 4YSXB 4DHJB 2MRPA 3Q3JA 3MFGA 2LJIA 2CJOA 3RZFA 1BXTA 2PE6B 2EMTA 2DLBA 2XN9C 1VCBA 2D07B 3V62A 2CHWA 2IGGA 1XXGA 1UZXB 2MJ3A 3DVNV 4ZHPA 1JWUD 1WE7A 2V1YA 1B1ZA 2MBHA 4MSQB 3V05A 2KX3A 2JYEA 2MBEA 3Q69A 4C4VB 2BGFA 4FA6A 2CJNA 2BT6A 3A1QB 3PPAA 3H9DA 2XNAC 3KUCB 2IGHA 3RUIB 2UYZB 4YTPB 3HVZA 1P7FA 3ETRA 1C78A 2BQQA 2WWZA 2MBOA 1NDDA 3FILA 2MSED 2X38A 2ZW1A 4W9CA 2M17A 3DBHI 3WAOA 3O13A 3NOBA 4K81A 4TQ1A 4FADA 1LFDA 4GXBA 2WS3B 1GAQB 1E8YA 1L4DB 2WDVB 1Z2MA 2KK8A 5BMGA 4J6IA 5LNK1 3N1YC 4LNFA 4HWIB 2Y5PA 4HKZE 3ZIMA 1V1OA 2PMVA 4RFBA 4AS1A 4F8CB 3AM9A 5I4DA 3Q8CA 2GBRA 3MC0B 3N1XC 2QIEB 2V3NA 3PZDA 2L8JA 2M4NA 2CKHB 4K7WA 2SEBD 1WWTA 4II2B 3BWUD 3ABVB 3RPFC 1KLGD 2L1AA 2FUG1 2KX0A 2WXOA 2DBYA 4OZAA 2K39A 5KHOA 1UBIA 3RULA 3AU4A 3Q6BA 4NAWA 5LXIB 3AE3B 2KJ6A 1ROEA 1P1AA 4GSWA 1I7HA 1HEZE 1FPYA 1Q5WB 3GP7A 4O1NA 3ALBA 2Z0EB 2FAZA 3N1ZC 1L2NA 3B2FA 5C2TB 3LXFA 2RSUA 1CMXB 2FCNA 1BMLC 2MX2A 3C0RB 4S17A 2M1MA 1T6BX 2W3SA 3PGEA 4JWUC 2FUHB 2KDMA 2ZVNA 4W9FA 2FE8A 3ZTCA 1C77A 1ZXIA 1TKYA 3TIXA 1YJIA 1ET9A 4MJSB 2OHFA 2J0KA 1SB3C 3AEEB 2WXNA 3MJWA 4LCDE 5BYRA 4NJ6A 1Z5SB 4I6LB 2KYWA 5EE1A 3RNAC 2WDQB 3PO0A 4URKA 1XT9B 4HEA1 4IG7B 1XCTL 3T3NA 1FNVA 4XE0A 3OJ4B 4EOYA 3VUXA 1SEBD 3RCZA 2MJDA 1QF6A 1HTOA 2GBJA 5JHAA 3QAQA 1FFUA 3GS2A 3RNGC 3IBEA 3ML9A 4RM9A 5FR6A 1E0ZA 3KYCD 3PRMB 4DBGA 1F0ZA 3A33B 1WI0A 2HJ1A 5DCNA 3KYDD 5TR5A 3KQ4A 2KC1A 3ENEA 3R2TA 3LB8C 2BB6A 2V4IB 1FNWA 5IAAC 1S1QB 2QC8A 4IWQA 4RCOA 2WX0A 5AEKB 1FRRA 5HHDG 4EEWA 4BBNF 4NQKE 4KGSA 2LGSA 4NZLB 2M8SA 4D2KA 2WXKA 1Q10A 1GNUA 2KNBA 3NZUA 4II3B 2NCNA 2AEHA 4M00A 2N9EB 1GB1A 1V5TA 3R7QA 2BS2B 4DHZE 4XWTA 3I5JC 1T5XD 3J9CA 1WJUA 4OHJA 4RNAA 3TEYA 2BTEA 2M0XA 4C80A 2KWUB 1DOYA 2V3PA 2MLBA 1K8RB 3MHZA 3VVWB 5IOIA 2BS4B 3AMZA 4K3CA 4ZRQA 1K52A 2OOBB 2WXFA 4G0NB 4P1CC 1GUAB 3D32A 5EE3A 2KDBA 5C1ZA 4AJWA 2WDTB 1NYQA 1UD7A 2O2VB 1TBEA 3TEWA 2BYFA 3DBRB 1KF6B 2ASQA 3R3MA 3VRAB 2LXAA 5CHVC 1XEEA 5HFYA 1PGXA 2WXPA 1PYWD 4AJYB 3PTFC 1QILA 2LVPA 2IO0B 4KZ0A 5DPRA 3P42A 2WU5B 3AE7B 2J52A 3HK0A 3L4PA 2W9NA 2IY0B 3QCAA 3JW0X 2LGDA 1LM8B 4W9GA 3FILB 2BBCA 1E5WA 3SFDB 2AL3A 4CO7A 4ZDVA 1MVKA 3WALA 4G11A 3A1QA 1I4XA 2FCMA 2D3AA 1FXTB 4HLEA 1PUTA 3ZNZB 3ZJUA 2KVRA 2RR9A 4TV3A 3QARA 3DBSA 3WIMA 4N9F4 4M02A 2IGDA 4WJQA 4RGOS 4DK5A 1LO5D 3NJTA 4J3OD 2E3TA 4MM3A 4ZYSA 3W1YA 1PFDA 4WWMA 3Q14C 2G4DB 4C00A 2D10A 2PLPA 2ACZB 3AE2B 2MWSB 1TKGA 1FFVA 4MGYE 2KQSA 1GG3A 3EHVA 3ZQ4A 1N62A 4B6WA 3AECB 2CU3A 3VRBB 2NBVB 4JWSC 3ZNGC 3OG5A 4DHZB 3MC8A 2C7MB 5GXGB 4NAWB 4YSZB 3ZJTA 3V3XA 2QMTA 4KDIC 1KOTA 3UI3A 3I9V1 3PT2B 2DENB 4C7ZA 3EFUA 2LGYA 2YLMA 5IN7A 3ZXRA 2KDIA 1V6EA 1YX6B 2L32A 2MP2A 4K1RB 4LNKA 5GMVA 1UBQA 3B2GA 1E10A 2QCZA 1WSPA 2V4LA 2KC2A 3DOWA 2K25A 3FAHA 2EKIA 4L1BA 1KTKA 4KZCA 1IBXB 1JWMD 2KWVB 2NBUA 1V9JA 3RFZB 3QC8B 1SBBB 3UQAA 1I4RA 1RFKA 4YTNB 1R4NI 2N9PC 5L95C 1XD3B 1AARA 1GPXA 1OQRA 1WR6E 4ARCA 2X8XX 4PT5A 1MFWA 3ZVVA 1TKEA 2AYOB 2DYBA 2BYTA 1QOFA 1P3QU 2BVCA 1HZ5A 1IPGA 2B76B 1JWSD 2PKOA 5J18A 2KMAA 1A5RA 4RGMA 3V61A 2LGIA 1ZDXA 2J0JA 2KMMA 2W82A 2K0PA 3I57A 1PGBA 5H92C 1VZ7A 3IVFA 1UF0A 4P1BC 5TSSA 1FNUA 1WGRA 3L0WB 1SXTA 1SIFA 2O6VA 3RMKC 4M01A 3TJPA 5E6OA 5C3JB 4MH0E 4XWWA 1UELA 3DVGX 2YVCA 2G3QB 4HCNB 3SHQA 3DWGC 4AOFA 1TTNA 3H7PA 1Q0WB 1VLBA 3URYA 3WAPA 2QSDA 2M19A 1KFYB 4WQOB 4FXCA 1WGHA 2KWDA 4WAAA 2C5LC 3BZDB 4A9AA 3KWLA 1WX7A 3Q3OC 4EUTA 4PS3A 1GOZA 2RDBC 1QT9A 3W1SA 1XLNA 1WY8A 1T0RC 3T8MA 1WX8A 1JWAD 2JQRB 3L13A 2JZ3B 2WP9B 1VZ8A 3C19A 1MG8A 3GZNB 3IT6B 1K50A 2KT7A 2QDFA 2YEPF 2V3SA 3NZ3A 3PHXB 1RRBA 4OVUA 3UF8A 1E7PB 4K7SA 1FEHA 2RMMA 1E90A 5G5GA 2I38A 2KQ7A 1MHXA 5G2NA 3ZUNA 2PEAA 2NVUI 2I1KA 3R66C 1WXMA 1V81A 2JPHA 3NVZA 2K8HA 3U7ZA 4YWGG 5HG2A 2E6XA 1DGJA 4ICVA 1VZ6A 2RD0A 2HD5B 1SGHA 3H7SA 2ZPYA 2O2VA 2L05A 4IWPA 3Q8BA 2KO3A 2GMIC 1SIJA 3AN1A 4OVVA 1VDVA 3CF6E 4DDGD 2N9KA 1Y56A 2GB1A 3IG3A 1V80A 2JZZA 3SD5A 4AWJA 1WH3A 4ANXA 4US8A 3DBLI 1EO6A 3MJ5A 2PTLA 4PS7A 3M62B 1T0QC 3ZTDA 1YN3A 3ECIA 2ZCCA 3P4PB 4RF1A 5H8YE 1R4MB 1TS5A 1L6VA 1JROA 1WR1A 4MT5A 3ZXVA 3TSSA 1X1MA 1WJNA 4MELA 4MM3B 2MQJA 1I4HA 3WANA 1FXAA 3KVFB 4IOIE 2AL6A 2ZPNA 5E6JA 1F1HA 2KOXA 1B9RA 3U2SC 1D5ZC 1E8XA 1ISNA 1YQ4B 4MDKE 1ZDVA 3VDZA 2W3RA 3W9CB 4JIOU 2BKFA 3K9OB 2GRIA 2AQ1B 3QA8A 2XBBC 4B95A 4XGAB 4C56C 5FK9C 2IDYA 1L0YB 5L83A 1YX5B 4ZHOA 4ICUA 4IW0A 2HTHA 3SU8X 1M94A 2LEKA 2MP2B 2Y5BB 1D3ZA 3PHWB 2FCQA 2RPQA 2LWPA 4KKJA 2VZKB 1OGWA 4RF0A 2NMQA 1JALA 3N9YC 3VUWA 2KN4A 1STEA 1EUVB 2IYDB 2GBNA 4MGIE 1C4CA 3E56A 1M4VA 1MI0A 2D3BA 3APCA 5LXHA 2J4XA 2V9HA 1D5XC 1F9JA 2Y3AA 3AU5A 2LHEA 4WWNA 1DYQA 1IBXA 3BVGA 1P9DU 2WQYB 1UGMA 4E71A 1XF5L 2GBMA 3ZRCA 1GJZA 3ZYYX 3IXSA 2LXCA 3RZWC 2N1VA 2N9XA 5IO9A 1IGCA 4JGHB 4MH8A 2INNE 2PVOD 1YIWA 3QIJA 3AEBB 2KD0A 1SE3A 4WWPA 2HDEA 3HHMA 3BIID 4LLGM 4KIKA 3RI7C 3AH7A 4I6PA 2L0TA 1PQSA 4YSYB 1UH6A 1EWCA 2O6VB 1FRDA 2RGFA 2IBIB 3L16A 3AEFB 3P4SB 1RWSA 1VR9A 1JRPA 3A9JA 2HJ8A 1OTRB 2WU2B 2PW9A 3QK0A 2K8BA 3HM3A 1J7CA 3H7PB 3VR9B 1MPEA 4MEMA 4TUUA 3BVZA 4FBJB 2RDHA 1LQBA 4NJ7A 1R7SA 4GDLA 1G6JA 4LDTB 1P0RA 2HTME 3UIPB 1AN8A 2Z59B 2EMSA 3IAS1 1QZEA 4W9JA 5CTRC 4PK1A 4KX6B 3RT3B 3WCQA 2BWES 4HPLB 2L83A 3U8ZA 3X0WA 2ICIA 1JCKB 1WRIA 2ZNVB 5HI1A 1E8WA 1XQQA 3PRPB 3OAWA 2L52A 1K53A 2D3CA 3B08A 4B0EA 4UDUC 4EZLA 4MGKE 2QJLA 3IAM1 4HCPB 5AUKA 3V6CB 3HM6X 2K5PA 4K7UA 2NPTA 1P7EA 4BKTA 3HVDA 3MP9A 1V1PA 1IYFA 3RYTA 3PZ7A 2QEJC 1N5XA 4A3PA 4KV2A 2KAJA 1C9FA 4DDID 2MHJA 1ENFA 4W9LA 5EE0A 4KDLB 2JWUA 1HA5A 4ZRKA 3NRZA 3VFKA 1EM7A 1F2RI 1ZOYB 4FHKA 4BFRA 4W9EA 1WYWB 3NHEB 5G55A 3U52E 4ARIA 2OJWA 4DHJD 3A9KA 5DPWA 1F2RC 5EDSA 3R8BA 3H6NA 1SSNA 2KANA 3BK1A 3KUDB 1FM0D 2OEDA 4N58A 1CJEA 3NUHB 2KFKA 1KLVA 3E9SA 1KLUD 3AEAB 3N30A 3DHIC 3ZKJC 1OFFA 2WLBA 1FO4A 4F7ZA 1WXAA 2AQ2B 2I2YA 2R2OA 1V2YA 2ZEQA 3A4SC 2AQ3B 4LJPB 3X23A 3CMMB 5E6NA 1T0YA 3SR6A 4WIPA 4DWFA 3CSTA 1V86A 2J7QB 3GB1A 4WWOA 2ONQA 1YN5A 1QOBA 4DXAB 1DOXA 4PS8A 2K8CA 2PVGC 1ZW7A 2MH7A 2WDRB 2BKRB 2LVOA 4OZCA 1A70A 5IKCM 2MBBB 4US9A 3OLMD 4FJVB 1TY0A 1JMLA 1L6UA 3BYYB 1FIQA 2JWZA 4BKSD 4ZRIA 3M63B 1E7UA 2ZCBA 3Q3MC 3Q8EA 3TL5A 3UIOB 3ZDTA 1ESFA 1Y8RC 2QHOA 1I4PA 4IM3A 2WX1A 4YL8A 3B1LX 3MC9A 4WJPA 3KLSX 3KW5B 4X57B 3W1SC 5IP4D 1WXQA 3DWMA 1ZKHA 2W54A 3U30A 3EUB2 4XYCA 3OJ3A 1LGRA 2DNFA 3RNEC 1ZP0B 2KTRB 4JL9A 2ZNVC 4KVGB 4JE3B 2N7DA 1XLOA 4EKUA 1LXDA 3TMPB 1IGDA 2KLCA 2A4ZA 4ZRJA 1RAXA 1HXYD 1GC7A 3ZO5B 1P98A 4OW0A 1D5MC 4QAYA 4BZAA 2WNMA 3U7DA 1WYGA 3N32A 2A5UA 1N61A 1RYJA 3DBRI 1XLPA 3EC8A 4I6NB 1HZ6A 1WMHA 2FBWB 4KIKB 2LUMA 4WAFA 1J7AA 1QQRA 4EE2A 3S2AA 3DBLB 2B3AA 4KGRA 2UWQA 4F1SA 1N6ZA 4ANVA 1F52A 1RLFA 2WXHA 3A9JB 3VXWA 4GB9A 1N63A 2KACA 2Q5WD 1QOGA 3GE3C 1ZE3D 2LUEA 1SE9A 3KWVA 3ZNHB 1NENB 2N7JA 3FKYA 3JSVA 2ZZPB 3DBHB 3R2IA 2JUOA 5JXVA 1N60A 2D2QA 4XDDA 1CQVA 2MCNB 1UWXA 1FMAD 1KH0A 4CYEA 3P1MA 2MEKA 4GDLB 3N20C 3WAMA 4M0WA 4AQ7A 4N59A 1WGKA 4ACFA 2KVZA 5E6PA 1SF0A 2DZMA 2K3UA 2Y5CA 4ZOHC 2H89B 4HDQA 1DOIA 3ZGZA 4RGNA 3ZRFA 3TCAA 4FJYA 2JY6A 4A6QA 4NY0A 2WXJA 4EFOA 4GU2A 3QWZB 1IUEA 3V6EB 1C4PA 3V60A 1WFYA 3DVGY 1WJ4A 2L76A 4FLHA 2XEWA 1ZGUB 2N9LA 1XO3A 1TYGB 1VRAB 2HE7A 1YOVB 2IZVB 2NPTB 3ZJVA 1V1PB 2JVCA 3C8YA 1WGGA 5CHFA 3RD2A 1YJ1A 1FCCC 1HQRD 1J8CA 3LDZE 1WZ0A 5BYQA 2KMCA 3W2DA 3BY4B 1C1YB 4IKGA 4GN1A 3VQIA 4GOCA 1HE8A 1N5WA 1TZOA 2IY1B 2VH1A 1PGAA 2DAFA 1TY2A 2INCC 2LMCA 1H4RA 1JRUA 5KHQA 3PSEB 5D6JB 3A9KB 3ONSA 3O65B 4HK2A 2YEPB 4ITKA 3T9LA 2KFKB 3W5UB 1HTQA 4KGTA 2ZVOA 4W9HA 2FNJB 4A20A 4CQNA 4B0MA 1NI3A 2LI5A 1RM6C 4FHJA 5BO4B 3T3OA 2AX5A 3AV8A 1I4QA 3KH0A 5AZGA 2KDFB 2JRIB 3P4QB 4NQLB 2KFJA 4BAXA 1YN4A 2H88B 4DQOC 4G50A 2BYVE 2JRHA 4LK0M 4GLSC 4HPMB 2K6DB 3VR8B 4TQ0A 5DPSA 2KN5A 3HUIA 3PREA 5EE9A 3UINB 5MPOA 2LASA 2VH2A 4WURA 4RGTA 1WJ6A 3AULA 3EECA 1YD8U 2KHWB 2WXIA 1WIAA 4JPSA 4ANWA 4TSSA 4IDIA 1GB4A 3TUOA 3EFCA 3VTWA 3L08A 4S0RA 3P4RB 1VJKA 2J42A 2FIFA 2R2QA 2KDEB 3QJZA 2L3ZA 4PYZA 2UU7A 5JH5C 2JXXA 2WXRA 2NTSA 2FIDA 3DVNU 1C4AA 1PDXA 3PVLA 1RFAA 2LD9A 2I1JA 3NS8A 1FD6A 3SDLC 2RDGA 4LNNA 1SJHD 2K22A 2N0SB 3B0AA 1WXSA 3L17A 3WA0A 3AE8B 4R3DA 1C3TA 1WGYA 2CR5A 5BYSA 3IFWB 4N6EB 2KZRA 3H1UA 2INPE 3DHHC 1V97A 2BYEA 1JW9D 3MHSD 1SJED 4GDKA 2KWCA 2IO3B 5LLIA 3GZNI 3Q2AC 2GLSA 4YXDB 3VH4B 3QX1A 1WRDB 4NJCA 2WXLA 1MJDA 3ZNID 3PZ8A 5AUIA 5J2RA 4M8NA 4P16A 3VAWA 2KTRA 3AXCA 4ZYNA 2NS5A 3ZW3A 3RNBC 1WMHB 3JYUA 3DPDA 4W9KA 2NTTA 3BK2A 2JSVX 2G4SA 4IM0A 5AZFA 2MA9B 2JT4B 3EGRA
chains in the Genus database with same CATH topology
3R8BA 4ARCA 1SSNA 4PT5A 2Z8LA 1YQ3B 2IGGA 1XXGA 3BK1A 1TKEA 1C76A 3FC4A 1FM0D 2MJ3A 2OEDA 3SFEB 4ZHPA 2BYTA 1JWUD 1QOFA 4N58A 1CJEA 1B1ZA 3NUHB 2J53A 3AE6B 4XDCA 1HZ5A 3E9SA 3V05A 1D4BA 1KLUD 2JYEA 3Q69A 2B76B 1JWSD 2PKOA 4P6VF 3AEAB 3TEXA 2CJNA 1OFFA 2WLBA 1FO4A 2BT6A 4RGMA 2XNAC 2AQ2B 1C79A 2LGIA 2IGHA 1ZDXA 4YTPB 2I2YA 2KMMA 2W82A 3HVZA 2K0PA 1P7FA 3ETRA 1C78A 3FILA 3I57A 2AQ3B 3OWEB 2X38A 2ZW1A 1F77A 1PGBA 5H92C 1UWMA 1VZ7A 1XLQA 4DXFA 1FCLA 5TSSA 1SE2A 1FNUA 3W5VB 3SR6A 1SXTA 3AE4B 1T3QA 4WIPA 3O13A 2M0AA 4TQ1A 3NVWA 3GB1A 2PIAA 5C3JB 2WS3B 1GAQB 2ONQA 1L4DB 2WDVB 3IT4B 4HRSA 1YN5A 4XWWA 5BMHA 5BMGA 1QOBA 1DOXA 5LNK1 2SAKA 4A8XC 2PVGC 2MH7A 2WDRB 3DWGC 5FKAC 2Y5PA 4HKZE 1V1OA 2PMVA 4RFBA 4AS1A 4OZCA 1A70A 1VLBA 3AM9A 3URYA 5I4DA 2ON8A 2QSDA 3Q8CA 2M19A 1KFYB 4FXCA 4US9A 2KWDA 3MC0B 1TY0A 1JMLA 1L6UA 5D3IB 2W55A 1FIQA 3BYYB 3BZDB 4A9AA 3KWLA 2QIEB 2V3NA 3Q8EA 1SE4A 5FR3A 2G1EA 2SEBD 1WWTA 1ESFA 3BWUD 1I4PA 1GOZA 3ABVB 3RPFC 1KLGD 1QT9A 2L1AA 3W1SA 1XLNA 2FUG1 5BMIA 1JWAD 2JQRB 1FXIA 2WXOA 3LYYA 2WP9B 1VZ8A 2DBYA 1KRHA 4OZAA 2JYTA 1TS3A 3KLSX 2RPVA 3IT6B 1ZPSA 1K50A 2WXMA 3AEDB 3AE3B 1WXQA 1ROEA 2IJ0A 2YEPF 3DWMA 1I7HA 1HEZE 2W54A 3NZ3A 2G9HD 1D6EC 1E9MA 2WXQA 3GP7A 1ZXHA 4O1NA 3EUB2 4Q2JA 3B2FA 5C2TB 3LXFA 4HKQA 3AEGB 1E7PB 2M56B 3B9JA 1FEHA 2RMMA 5G5GA 1BMLC 2I38A 1ZP0B 1MHXA 2QILA 1T6BX 3SEBA 2W3SA 4JE3B 4JWUC 2KDMA 1XLOA 1BUIC 1UGJA 2FE8A 3NVZA 4C7YA 1C77A 1ZXIA 1TKYA 1IGDA 3U7ZA 4YWGG 5HG2A 3CWIA 4LTUA 1HXYD 2E6XA 1YJIA 1DGJA 1VZ6A 3H8HA 1ET9A 2OHFA 4OW0A 3AE5B 3Q8BA 4KKIA 4DXGA 1D5MC 1SB3C 2WNMA 1JWBD 1WYGA 2WXNA 3AEEB 1QOAA 1N61A 1RYJA 5BYRA 1SIJA 3AN1A 1E6EB 1XLPA 4WQMA 4ZRPA 1AYFA 1HZ6A 1VDVA 4WH4A 2FBWB 5EE1A 1L4ZB 2N9KA 2LUMA 1Y56A 2GB1A 2WDQB 2BW2A 3PO0A 2JZPA 4WAFA 4HEA1 1J7AA 1QQRA 1XCTL 3T3NA 4EE2A 1FNVA 4XE0A 1EWYC 4KGRA 4OZBA 4US8A 1TS2A 2KQ4X 3MJ5A 2PTLA 2WXHA 1SEBD 1N63A 2MJDA 1QF6A 1YN3A 2KACA 2Q5WD 1QOGA 3NS1A 3P4PB 1ZE3D 4RF1A 5H8YE 1TS5A 1FFUA 3GS2A 1L6VA 3KWVA 4L23A 1JROA 1NENB 2N7JA 4MT5A 3R2IA 3TSSA 3BYTB 5JXVA 1N60A 1E0ZA 5D7GA 4XDDA 1CQVA 4MM3B 1F0ZA 1UWXA 1I4HA 1FMAD 1KH0A 3EA6A 3P1MA 1FXAA 2MEKA 4GDLB 3KQ4A 4IOIE 4M0WA 4AQ7A 4N59A 5E6JA 1WGKA 2BS3B 3LB8C 2IPKD 3R2TA 2BB6A 4NAMA 4A90A 1B9RA 2DWQA 1SF0A 2K3UA 3U2SC 1D5ZC 2Y5CA 4ZOHC 2V4IB 1FNWA 3P63A 2TSSA 1TJEA 2H89B 1DOIA 1YQ4B 3ZGZA 1ZDVA 4RGNA 4RCOA 1NEKB 2W3RA 3W9CB 2BB5A 4A6QA 1FRRA 2GRIA 2WXJA 2AQ1B 5HHDG 1ET6A 3BVMA 1IUEA 4C56C 5FK9C 1C4PA 1UUPA 2IDYA 4KGSA 4NZLB 4D2KA 1L0YB 2N9LA 4ZHOA 1XO3A 2WXKA 1Q10A 1TYGB 4TMAB 1VRAB 4HJGE 1ZUD2 2LEKA 1GB1A 3ZJVA 3Q8FA 1V1PB 4GDKB 3C8YA 2BS2B 4RH6A 4XWTA 1T5XD 4KKJA 3J9CA 3TEYA 4OHJA 4RNAA 1FCCC 1HQRD 2VZKB 4RF0A 2BTEA 2NMQA 4C80A 1JALA 2VZKD 5BYQA 4HROA 3W2DA 3N9YC 2KN4A 1STEA 1DOYA 4IKGA 2V3PA 1ACCA 3VQIA 3MHZA 2JU6X 1N5WA 1YMHE 4USAA 2BS4B 3AMZA 1TZOA 4ZRQA 1K52A 1C4CA 3E56A 1M4VA 1MI0A 2WXFA 3AE9B 1YJJA 2J4XA 1NYRA 1PGAA 1OQQA 1TY2A 4H2AA 2LMCA 1D5XC 5EE3A 2Y3AA 2V0GA 1NYQA 2LHEA 5G5HA 1DYQA 1IBXA 3BVGA 3TEWA 2WQYB 1J7BA 1KF6B 2YEPB 3VRAB 1XF5L 3AE1B 1XEEA 5HFYA 1PGXA 2WXPA 4ITKA 4YT0B 1PYWD 1QLBB 1QILA 3W5UB 3ZYYX 3IXSA 1YNTE 3P42A 4KGTA 2WU5B 3AE7B 2J52A 4CQNA 4B0MA 1IGCA 1NI3A 1RM6C 4MH8A 2INNE 3L4PA 2PVOD 3NVVA 3T3OA 2AX5A 2DYMA 5D3DA 3AEBB 3AV8A 2DYOA 1I4QA 2LFIA 1SE3A 2HDEA 3FILB 2BBCA 3BIID 4LLGM 3P4QB 1EU4A 3AH7A 1V8CA 3SFDB 2ZW0A 1YN4A 2H88B 1L5PA 1MVKA 4YSYB 4DQOC 1EWCA 1FRDA 4LK0M 1I4XA 1K51A 4OVZA 4GLSC 3AEFB 3VR8B 3P4SB 1RWSA 4TQ0A 1VR9A 1JRPA 3TEZA 3HUIA 1PUTA 5EE9A 5MPOA 3ZJUA 4JX1C 4WURA 2WU2B 4RGTA 2MJEA 2PW9A 1L0VB 3CIRB 2JX5A 4REZA 2IGDA 3Q8AA 5T8IA 1J7CA 4RGOS 1AWDA 2JXTA 2K9XA 3VR9B 2WXIA 4JPSA 1LO5D 1NVID 1MPEA 4J3OD 4TSSA 4IDIA 2E3TA 1GB4A 3TUOA 4ZYSA 3BVZA 1EU3A 1PFDA 4WWMA 2RDHA 3P4RB 1VJKA 2PLPA 1R7SA 2ACZB 2J42A 3AE2B 2GI9A 2HTME 1AN8A 1TKGA 4MACA 1FFVA 1L0XB 3IAS1 4L2YA 1QKZA 2WXRA 1JQ4A 2NTSA 3ZQ4A 1CK1A 1N62A 1XCQL 4KX6B 3AECB 1C4AA 1PDXA 2CU3A 2R61A 3VRBB 3WCQA 1TS4A 2EELA 4JWSC 2L83A 3HRDD 1FD6A 5GXGB 2ICIA 2RDGA 4NAWB 4YSZB 1JCKB 3ZJTA 1SJHD 1WRIA 5HI1A 3V3XA 2K22A 2N0SB 2QMTA 2L52A 3UI3A 1K53A 3I9V1 3AB5A 4B0EA 3AE8B 4R3DA 4UDUC 4C7ZA 5BYSA 2QJLA 3IAM1 5AUKA 4N6EB 2D5GA 2K5PA 2INPE 2L32A 1V97A 1JW9D 1P7EA 1SJED 3HVDA 1V1PA 3MP9A 3B2GA 1E10A 3PZ7A 2QEJC 1N5XA 4YXDB 1WSPA 2KAJA 1C9FA 4A55A 4NJCA 1CZPA 3FAHA 3U4EG 2WXLA 2EKIA 4L1BA 1UNSA 3NVYA 1ENFA 1KTKA 5EE0A 1AW7A 1JWMD 3PZ8A 1IBXB 3RFZB 5AUIA 4P16A 2JWUA 1SBBB 1HA5A 2WXGA 1I4RA 3NRZA 1I4GA 1EM7A 1MHHE 1RFKA 4YTNB 1F2RI 2LHDA 1ZOYB 4YTMB 4YSXB 2NTTA 3U52E 4ARIA 3BK2A 2JSVX 3MFGA 2LJIA 2CJOA 1GPXA 1BXTA 1OQRA 1F2RC 2DLBA 2XN9C 3EGRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2E6X A; 
#chains in the Genus database with same CATH topology
 1MG4 A;  3VH3 B;  1U4A A;  2Z8L A;  1YQ3 B;  5J17 A;  3VUY A;  3PLV A;  1C76 A;  5IA7 A;  3FC4 A;  3SFE B;  4A3O A;  2KKC A;  2C9W B;  2J53 A;  3AE6 B;  2BWF A;  4XDC A;  1D4B A;  3JSV B;  3VHT C;  1VD2 A;  3GE8 C;  3ZDM C;  4G3X B;  4P6V F;  3TEX A;  3ML8 A;  3PRZ A;  4W9D A;  4HDO A;  1C79 A;  2LJ5 A;  1NBF C;  5CX3 A;  4M0W B;  4PYU A;  3OWE B;  3UGB B;  1F77 A;  1R4M I;  4GIV A;  5DPT A;  1H8C A;  1UWM A;  1XLQ A;  3DHG C;  2L00 B;  4DXF A;  2NBW B;  1FCL A;  1SE2 A;  1WZ3 A;  3W5V B;  3L10 B;  3AE4 B;  1T3Q A;  4FN2 A;  3DCG A;  2N7E A;  2M0A A;  3I63 C;  3NVW A;  2BF8 B;  2PIA A;  1YQB A;  3IT4 B;  3ZLZ A;  1I35 A;  4HRS A;  5BMH A;  2SAK A;  4A8X C;  4AP4 C;  3JVZ X;  4XC2 A;  5FKA C;  3K9P B;  3QQ8 B;  3RNF C;  2ON8 A;  4BOZ B;  1S3S G;  2BPS A;  2C60 A;  3PLU A;  3RN9 C;  4FUL A;  5D3I B;  2W55 A;  5CHW A;  4BOS C;  4ASW C;  1SE4 A;  5FR3 A;  2G1E A;  4LNI A;  4GMV A;  3Q3F A;  4MSM B;  5BMI A;  1FXI A;  3P2B A;  1T0S C;  3LYY A;  4HPP A;  2WYQ A;  1KRH A;  2PPH A;  2JYT A;  1TS3 A;  2RPV A;  4M8M A;  2C7N B;  1ZPS A;  2WXM A;  3AED B;  2IJ0 A;  2XK5 B;  1EF1 A;  1D6E C;  1E9M A;  2G9H D;  2WXQ A;  1ZXH A;  2GBK A;  4Q2J A;  4HKQ A;  3AEG B;  2M56 B;  3B9J A;  2LGX A;  2QIL A;  1R4N B;  3SEB A;  4AUQ C;  1BUI C;  1UGJ A;  4C7Y A;  1GC6 A;  3CWI A;  4LTU A;  2KJH B;  2MW5 A;  3H8H A;  4EZK A;  2WHI A;  2KXJ A;  3AE5 B;  4KKI A;  4DXG A;  2G45 B;  1OEY A;  1JWB D;  1QOA A;  1E6E B;  4WQM A;  4ZRP A;  1AYF A;  4WH4 A;  4JQW C;  2N4F A;  4IC7 B;  4IUM B;  4LNO A;  1L4Z B;  4K3B A;  4E3C A;  4MGZ E;  2BW2 A;  2JF5 A;  2JZP A;  4WJO A;  1EWY C;  4OZB A;  1EF5 A;  1KJT A;  4XX5 A;  1TS2 A;  2KQ4 X;  3A4R A;  2N1W A;  3NS1 A;  4NPN A;  1E7V A;  2CU1 A;  4L23 A;  4HXD A;  1KM7 A;  3Q3N C;  4C4V A;  3BYT B;  2REX A;  1J0G A;  5D7G A;  1V49 A;  4FJZ A;  3EA6 A;  3VTV A;  2VRR B;  4KSL C;  2BS3 B;  2IPK D;  4NAM A;  4A90 A;  3NG0 A;  2DWQ A;  2Z0D B;  3P63 A;  2TSS A;  1TJE A;  1I42 A;  1NEK B;  4ANU A;  2BB5 A;  2DAJ A;  1ET6 A;  1TT5 B;  4P7I A;  3BVM A;  1WXV A;  2D3G A;  2D11 A;  4IM2 A;  4KSK C;  1UUP A;  2NR2 A;  1WX9 A;  5D2M B;  5HKH A;  1E8Z A;  2CHZ A;  1OEY J;  1TGZ B;  3RNC C;  4TMA B;  4HJG E;  4WJN A;  5AZH A;  1ZUD 2;  4BKS A;  3MTN B;  3Q8F A;  4GDK B;  3DQV A;  4RH6 A;  2DZK A;  2VZK D;  4HRO A;  2AWT A;  1ACC A;  4JLC A;  1YMH E;  2JU6 X;  1WGD A;  5JZE B;  4USA A;  3PS6 A;  3TBL D;  3AE9 B;  1YJJ A;  3NZS A;  1NYR A;  1OQQ A;  4HVB A;  2ZJD A;  4H2A A;  4BBN C;  2V0G A;  5G5H A;  3APD A;  2L0F A;  2LVQ A;  1IP9 A;  1J7B A;  4E74 A;  3UQB A;  3M95 A;  3AE1 B;  2PJH A;  2PE9 A;  4RMA A;  3APF A;  4YT0 B;  1QLB B;  4LJO B;  2K6Q A;  4IWO A;  1YNT E;  2IO1 B;  4MJS A;  1NI2 A;  3IHP C;  4CHK A;  2FCS A;  1WE6 A;  3N3K B;  3NVV A;  2DYM A;  5D3D A;  2DYO A;  2LFI A;  4GGQ A;  4W9I A;  1EU4 A;  1WM2 A;  1V8C A;  2EKE C;  1TIF A;  2ZW0 A;  4RM8 A;  1L5P A;  1Q1O A;  3BIN A;  1K51 A;  4OVZ A;  1J19 A;  2O6V D;  4BVU C;  3CSF A;  5C23 A;  3TEZ A;  1L7Y A;  3I3T B;  1OQY A;  4JX1 C;  2IO2 B;  2OJR A;  2MJE A;  2C7H A;  1L0V B;  3CIR B;  2DZI A;  2JX5 A;  4REZ A;  1WM3 A;  3Q8A A;  5T8I A;  1AWD A;  2JXT A;  2K9X A;  1BT0 A;  5D94 A;  1WF9 A;  1NVI D;  3QHT A;  4HJK A;  1EU3 A;  2K1F A;  2GI9 A;  4MAC A;  1L0X B;  4LDT D;  2IND C;  4L2Y A;  1QKZ A;  2J0M A;  1JQ4 A;  1CK1 A;  1XCQ L;  2R61 A;  4TKN A;  3GOE A;  2WGS A;  1TS4 A;  1V5O A;  2EEL A;  2KLG A;  2KJR A;  3HRD D;  3DDC B;  2GOW A;  3PV1 A;  4B9K A;  1TZ1 A;  2MBQ A;  3L54 A;  2DX5 B;  4BKG A;  2CHX A;  3AB5 A;  3KUZ A;  3R7R A;  2DZJ A;  5JHB A;  2LRW A;  2D5G A;  3AI5 A;  3VTU A;  2CS4 A;  4A55 A;  1CZP A;  3U4E G;  2LRU A;  2XK5 A;  1UNS A;  3NVY A;  1AW7 A;  3NY5 A;  4EZJ A;  2LZ6 A;  2DHZ A;  2WXG A;  4XZ4 A;  3HIZ A;  2L7R A;  1I4G A;  1MHH E;  4NNJ B;  2LHD A;  2KTF A;  3LJ3 A;  3M3J A;  4YTM B;  4YSX B;  4DHJ B;  2MRP A;  3Q3J A;  3MFG A;  2LJI A;  2CJO A;  3RZF A;  1BXT A;  2PE6 B;  2EMT A;  2DLB A;  2XN9 C;  1VCB A;  2D07 B;  3V62 A;  2CHW A;  2IGG A;  1XXG A;  1UZX B;  2MJ3 A;  3DVN V;  4ZHP A;  1JWU D;  1WE7 A;  2V1Y A;  1B1Z A;  2MBH A;  4MSQ B;  3V05 A;  2KX3 A;  2JYE A;  2MBE A;  3Q69 A;  4C4V B;  2BGF A;  4FA6 A;  2CJN A;  2BT6 A;  3A1Q B;  3PPA A;  3H9D A;  2XNA C;  3KUC B;  2IGH A;  3RUI B;  2UYZ B;  4YTP B;  3HVZ A;  1P7F A;  3ETR A;  1C78 A;  2BQQ A;  2WWZ A;  2MBO A;  1NDD A;  3FIL A;  2MSE D;  2X38 A;  2ZW1 A;  4W9C A;  2M17 A;  3DBH I;  3WAO A;  3O13 A;  3NOB A;  4K81 A;  4TQ1 A;  4FAD A;  1LFD A;  4GXB A;  2WS3 B;  1GAQ B;  1E8Y A;  1L4D B;  2WDV B;  1Z2M A;  2KK8 A;  5BMG A;  4J6I A;  5LNK 1;  3N1Y C;  4LNF A;  4HWI B;  2Y5P A;  4HKZ E;  3ZIM A;  1V1O A;  2PMV A;  4RFB A;  4AS1 A;  4F8C B;  3AM9 A;  5I4D A;  3Q8C A;  2GBR A;  3MC0 B;  3N1X C;  2QIE B;  2V3N A;  3PZD A;  2L8J A;  2M4N A;  2CKH B;  4K7W A;  2SEB D;  1WWT A;  4II2 B;  3BWU D;  3ABV B;  3RPF C;  1KLG D;  2L1A A;  2FUG 1;  2KX0 A;  2WXO A;  2DBY A;  4OZA A;  2K39 A;  5KHO A;  1UBI A;  3RUL A;  3AU4 A;  3Q6B A;  4NAW A;  5LXI B;  3AE3 B;  2KJ6 A;  1ROE A;  1P1A A;  4GSW A;  1I7H A;  1HEZ E;  1FPY A;  1Q5W B;  3GP7 A;  4O1N A;  3ALB A;  2Z0E B;  2FAZ A;  3N1Z C;  1L2N A;  3B2F A;  5C2T B;  3LXF A;  2RSU A;  1CMX B;  2FCN A;  1BML C;  2MX2 A;  3C0R B;  4S17 A;  2M1M A;  1T6B X;  2W3S A;  3PGE A;  4JWU C;  2FUH B;  2KDM A;  2ZVN A;  4W9F A;  2FE8 A;  3ZTC A;  1C77 A;  1ZXI A;  1TKY A;  3TIX A;  1YJI A;  1ET9 A;  4MJS B;  2OHF A;  2J0K A;  1SB3 C;  3AEE B;  2WXN A;  3MJW A;  4LCD E;  5BYR A;  4NJ6 A;  1Z5S B;  4I6L B;  2KYW A;  5EE1 A;  3RNA C;  2WDQ B;  3PO0 A;  4URK A;  1XT9 B;  4HEA 1;  4IG7 B;  1XCT L;  3T3N A;  1FNV A;  4XE0 A;  3OJ4 B;  4EOY A;  3VUX A;  1SEB D;  3RCZ A;  2MJD A;  1QF6 A;  1HTO A;  2GBJ A;  5JHA A;  3QAQ A;  1FFU A;  3GS2 A;  3RNG C;  3IBE A;  3ML9 A;  4RM9 A;  5FR6 A;  1E0Z A;  3KYC D;  3PRM B;  4DBG A;  1F0Z A;  3A33 B;  1WI0 A;  2HJ1 A;  5DCN A;  3KYD D;  5TR5 A;  3KQ4 A;  2KC1 A;  3ENE A;  3R2T A;  3LB8 C;  2BB6 A;  2V4I B;  1FNW A;  5IAA C;  1S1Q B;  2QC8 A;  4IWQ A;  4RCO A;  2WX0 A;  5AEK B;  1FRR A;  5HHD G;  4EEW A;  4BBN F;  4NQK E;  4KGS A;  2LGS A;  4NZL B;  2M8S A;  4D2K A;  2WXK A;  1Q10 A;  1GNU A;  2KNB A;  3NZU A;  4II3 B;  2NCN A;  2AEH A;  4M00 A;  2N9E B;  1GB1 A;  1V5T A;  3R7Q A;  2BS2 B;  4DHZ E;  4XWT A;  3I5J C;  1T5X D;  3J9C A;  1WJU A;  4OHJ A;  4RNA A;  3TEY A;  2BTE A;  2M0X A;  4C80 A;  2KWU B;  1DOY A;  2V3P A;  2MLB A;  1K8R B;  3MHZ A;  3VVW B;  5IOI A;  2BS4 B;  3AMZ A;  4K3C A;  4ZRQ A;  1K52 A;  2OOB B;  2WXF A;  4G0N B;  4P1C C;  1GUA B;  3D32 A;  5EE3 A;  2KDB A;  5C1Z A;  4AJW A;  2WDT B;  1NYQ A;  1UD7 A;  2O2V B;  1TBE A;  3TEW A;  2BYF A;  3DBR B;  1KF6 B;  2ASQ A;  3R3M A;  3VRA B;  2LXA A;  5CHV C;  1XEE A;  5HFY A;  1PGX A;  2WXP A;  1PYW D;  4AJY B;  3PTF C;  1QIL A;  2LVP A;  2IO0 B;  4KZ0 A;  5DPR A;  3P42 A;  2WU5 B;  3AE7 B;  2J52 A;  3HK0 A;  3L4P A;  2W9N A;  2IY0 B;  3QCA A;  3JW0 X;  2LGD A;  1LM8 B;  4W9G A;  3FIL B;  2BBC A;  1E5W A;  3SFD B;  2AL3 A;  4CO7 A;  4ZDV A;  1MVK A;  3WAL A;  4G11 A;  3A1Q A;  1I4X A;  2FCM A;  2D3A A;  1FXT B;  4HLE A;  1PUT A;  3ZNZ B;  3ZJU A;  2KVR A;  2RR9 A;  4TV3 A;  3QAR A;  3DBS A;  3WIM A;  4N9F 4;  4M02 A;  2IGD A;  4WJQ A;  4RGO S;  4DK5 A;  1LO5 D;  3NJT A;  4J3O D;  2E3T A;  4MM3 A;  4ZYS A;  3W1Y A;  1PFD A;  4WWM A;  3Q14 C;  2G4D B;  4C00 A;  2D10 A;  2PLP A;  2ACZ B;  3AE2 B;  2MWS B;  1TKG A;  1FFV A;  4MGY E;  2KQS A;  1GG3 A;  3EHV A;  3ZQ4 A;  1N62 A;  4B6W A;  3AEC B;  2CU3 A;  3VRB B;  2NBV B;  4JWS C;  3ZNG C;  3OG5 A;  4DHZ B;  3MC8 A;  2C7M B;  5GXG B;  4NAW B;  4YSZ B;  3ZJT A;  3V3X A;  2QMT A;  4KDI C;  1KOT A;  3UI3 A;  3I9V 1;  3PT2 B;  2DEN B;  4C7Z A;  3EFU A;  2LGY A;  2YLM A;  5IN7 A;  3ZXR A;  2KDI A;  1V6E A;  1YX6 B;  2L32 A;  2MP2 A;  4K1R B;  4LNK A;  5GMV A;  1UBQ A;  3B2G A;  1E10 A;  2QCZ A;  1WSP A;  2V4L A;  2KC2 A;  3DOW A;  2K25 A;  3FAH A;  2EKI A;  4L1B A;  1KTK A;  4KZC A;  1IBX B;  1JWM D;  2KWV B;  2NBU A;  1V9J A;  3RFZ B;  3QC8 B;  1SBB B;  3UQA A;  1I4R A;  1RFK A;  4YTN B;  1R4N I;  2N9P C;  5L95 C;  1XD3 B;  1AAR A;  1GPX A;  1OQR A;  1WR6 E;  4ARC A;  2X8X X;  4PT5 A;  1MFW A;  3ZVV A;  1TKE A;  2AYO B;  2DYB A;  2BYT A;  1QOF A;  1P3Q U;  2BVC A;  1HZ5 A;  1IPG A;  2B76 B;  1JWS D;  2PKO A;  5J18 A;  2KMA A;  1A5R A;  4RGM A;  3V61 A;  2LGI A;  1ZDX A;  2J0J A;  2KMM A;  2W82 A;  2K0P A;  3I57 A;  1PGB A;  5H92 C;  1VZ7 A;  3IVF A;  1UF0 A;  4P1B C;  5TSS A;  1FNU A;  1WGR A;  3L0W B;  1SXT A;  1SIF A;  2O6V A;  3RMK C;  4M01 A;  3TJP A;  5E6O A;  5C3J B;  4MH0 E;  4XWW A;  1UEL A;  3DVG X;  2YVC A;  2G3Q B;  4HCN B;  3SHQ A;  3DWG C;  4AOF A;  1TTN A;  3H7P A;  1Q0W B;  1VLB A;  3URY A;  3WAP A;  2QSD A;  2M19 A;  1KFY B;  4WQO B;  4FXC A;  1WGH A;  2KWD A;  4WAA A;  2C5L C;  3BZD B;  4A9A A;  3KWL A;  1WX7 A;  3Q3O C;  4EUT A;  4PS3 A;  1GOZ A;  2RDB C;  1QT9 A;  3W1S A;  1XLN A;  1WY8 A;  1T0R C;  3T8M A;  1WX8 A;  1JWA D;  2JQR B;  3L13 A;  2JZ3 B;  2WP9 B;  1VZ8 A;  3C19 A;  1MG8 A;  3GZN B;  3IT6 B;  1K50 A;  2KT7 A;  2QDF A;  2YEP F;  2V3S A;  3NZ3 A;  3PHX B;  1RRB A;  4OVU A;  3UF8 A;  1E7P B;  4K7S A;  1FEH A;  2RMM A;  1E90 A;  5G5G A;  2I38 A;  2KQ7 A;  1MHX A;  5G2N A;  3ZUN A;  2PEA A;  2NVU I;  2I1K A;  3R66 C;  1WXM A;  1V81 A;  2JPH A;  3NVZ A;  2K8H A;  3U7Z A;  4YWG G;  5HG2 A;  2E6X A;  1DGJ A;  4ICV A;  1VZ6 A;  2RD0 A;  2HD5 B;  1SGH A;  3H7S A;  2ZPY A;  2O2V A;  2L05 A;  4IWP A;  3Q8B A;  2KO3 A;  2GMI C;  1SIJ A;  3AN1 A;  4OVV A;  1VDV A;  3CF6 E;  4DDG D;  2N9K A;  1Y56 A;  2GB1 A;  3IG3 A;  1V80 A;  2JZZ A;  3SD5 A;  4AWJ A;  1WH3 A;  4ANX A;  4US8 A;  3DBL I;  1EO6 A;  3MJ5 A;  2PTL A;  4PS7 A;  3M62 B;  1T0Q C;  3ZTD A;  1YN3 A;  3ECI A;  2ZCC A;  3P4P B;  4RF1 A;  5H8Y E;  1R4M B;  1TS5 A;  1L6V A;  1JRO A;  1WR1 A;  4MT5 A;  3ZXV A;  3TSS A;  1X1M A;  1WJN A;  4MEL A;  4MM3 B;  2MQJ A;  1I4H A;  3WAN A;  1FXA A;  3KVF B;  4IOI E;  2AL6 A;  2ZPN A;  5E6J A;  1F1H A;  2KOX A;  1B9R A;  3U2S C;  1D5Z C;  1E8X A;  1ISN A;  1YQ4 B;  4MDK E;  1ZDV A;  3VDZ A;  2W3R A;  3W9C B;  4JIO U;  2BKF A;  3K9O B;  2GRI A;  2AQ1 B;  3QA8 A;  2XBB C;  4B95 A;  4XGA B;  4C56 C;  5FK9 C;  2IDY A;  1L0Y B;  5L83 A;  1YX5 B;  4ZHO A;  4ICU A;  4IW0 A;  2HTH A;  3SU8 X;  1M94 A;  2LEK A;  2MP2 B;  2Y5B B;  1D3Z A;  3PHW B;  2FCQ A;  2RPQ A;  2LWP A;  4KKJ A;  2VZK B;  1OGW A;  4RF0 A;  2NMQ A;  1JAL A;  3N9Y C;  3VUW A;  2KN4 A;  1STE A;  1EUV B;  2IYD B;  2GBN A;  4MGI E;  1C4C A;  3E56 A;  1M4V A;  1MI0 A;  2D3B A;  3APC A;  5LXH A;  2J4X A;  2V9H A;  1D5X C;  1F9J A;  2Y3A A;  3AU5 A;  2LHE A;  4WWN A;  1DYQ A;  1IBX A;  3BVG A;  1P9D U;  2WQY B;  1UGM A;  4E71 A;  1XF5 L;  2GBM A;  3ZRC A;  1GJZ A;  3ZYY X;  3IXS A;  2LXC A;  3RZW C;  2N1V A;  2N9X A;  5IO9 A;  1IGC A;  4JGH B;  4MH8 A;  2INN E;  2PVO D;  1YIW A;  3QIJ A;  3AEB B;  2KD0 A;  1SE3 A;  4WWP A;  2HDE A;  3HHM A;  3BII D;  4LLG M;  4KIK A;  3RI7 C;  3AH7 A;  4I6P A;  2L0T A;  1PQS A;  4YSY B;  1UH6 A;  1EWC A;  2O6V B;  1FRD A;  2RGF A;  2IBI B;  3L16 A;  3AEF B;  3P4S B;  1RWS A;  1VR9 A;  1JRP A;  3A9J A;  2HJ8 A;  1OTR B;  2WU2 B;  2PW9 A;  3QK0 A;  2K8B A;  3HM3 A;  1J7C A;  3H7P B;  3VR9 B;  1MPE A;  4MEM A;  4TUU A;  3BVZ A;  4FBJ B;  2RDH A;  1LQB A;  4NJ7 A;  1R7S A;  4GDL A;  1G6J A;  4LDT B;  1P0R A;  2HTM E;  3UIP B;  1AN8 A;  2Z59 B;  2EMS A;  3IAS 1;  1QZE A;  4W9J A;  5CTR C;  4PK1 A;  4KX6 B;  3RT3 B;  3WCQ A;  2BWE S;  4HPL B;  2L83 A;  3U8Z A;  3X0W A;  2ICI A;  1JCK B;  1WRI A;  2ZNV B;  5HI1 A;  1E8W A;  1XQQ A;  3PRP B;  3OAW A;  2L52 A;  1K53 A;  2D3C A;  3B08 A;  4B0E A;  4UDU C;  4EZL A;  4MGK E;  2QJL A;  3IAM 1;  4HCP B;  5AUK A;  3V6C B;  3HM6 X;  2K5P A;  4K7U A;  2NPT A;  1P7E A;  4BKT A;  3HVD A;  3MP9 A;  1V1P A;  1IYF A;  3RYT A;  3PZ7 A;  2QEJ C;  1N5X A;  4A3P A;  4KV2 A;  2KAJ A;  1C9F A;  4DDI D;  2MHJ A;  1ENF A;  4W9L A;  5EE0 A;  4KDL B;  2JWU A;  1HA5 A;  4ZRK A;  3NRZ A;  3VFK A;  1EM7 A;  1F2R I;  1ZOY B;  4FHK A;  4BFR A;  4W9E A;  1WYW B;  3NHE B;  5G55 A;  3U52 E;  4ARI A;  2OJW A;  4DHJ D;  3A9K A;  5DPW A;  1F2R C;  5EDS A;  3R8B A;  3H6N A;  1SSN A;  2KAN A;  3BK1 A;  3KUD B;  1FM0 D;  2OED A;  4N58 A;  1CJE A;  3NUH B;  2KFK A;  1KLV A;  3E9S A;  1KLU D;  3AEA B;  3N30 A;  3DHI C;  3ZKJ C;  1OFF A;  2WLB A;  1FO4 A;  4F7Z A;  1WXA A;  2AQ2 B;  2I2Y A;  2R2O A;  1V2Y A;  2ZEQ A;  3A4S C;  2AQ3 B;  4LJP B;  3X23 A;  3CMM B;  5E6N A;  1T0Y A;  3SR6 A;  4WIP A;  4DWF A;  3CST A;  1V86 A;  2J7Q B;  3GB1 A;  4WWO A;  2ONQ A;  1YN5 A;  1QOB A;  4DXA B;  1DOX A;  4PS8 A;  2K8C A;  2PVG C;  1ZW7 A;  2MH7 A;  2WDR B;  2BKR B;  2LVO A;  4OZC A;  1A70 A;  5IKC M;  2MBB B;  4US9 A;  3OLM D;  4FJV B;  1TY0 A;  1JML A;  1L6U A;  3BYY B;  1FIQ A;  2JWZ A;  4BKS D;  4ZRI A;  3M63 B;  1E7U A;  2ZCB A;  3Q3M C;  3Q8E A;  3TL5 A;  3UIO B;  3ZDT A;  1ESF A;  1Y8R C;  2QHO A;  1I4P A;  4IM3 A;  2WX1 A;  4YL8 A;  3B1L X;  3MC9 A;  4WJP A;  3KLS X;  3KW5 B;  4X57 B;  3W1S C;  5IP4 D;  1WXQ A;  3DWM A;  1ZKH A;  2W54 A;  3U30 A;  3EUB 2;  4XYC A;  3OJ3 A;  1LGR A;  2DNF A;  3RNE C;  1ZP0 B;  2KTR B;  4JL9 A;  2ZNV C;  4KVG B;  4JE3 B;  2N7D A;  1XLO A;  4EKU A;  1LXD A;  3TMP B;  1IGD A;  2KLC A;  2A4Z A;  4ZRJ A;  1RAX A;  1HXY D;  1GC7 A;  3ZO5 B;  1P98 A;  4OW0 A;  1D5M C;  4QAY A;  4BZA A;  2WNM A;  3U7D A;  1WYG A;  3N32 A;  2A5U A;  1N61 A;  1RYJ A;  3DBR I;  1XLP A;  3EC8 A;  4I6N B;  1HZ6 A;  1WMH A;  2FBW B;  4KIK B;  2LUM A;  4WAF A;  1J7A A;  1QQR A;  4EE2 A;  3S2A A;  3DBL B;  2B3A A;  4KGR A;  2UWQ A;  4F1S A;  1N6Z A;  4ANV A;  1F52 A;  1RLF A;  2WXH A;  3A9J B;  3VXW A;  4GB9 A;  1N63 A;  2KAC A;  2Q5W D;  1QOG A;  3GE3 C;  1ZE3 D;  2LUE A;  1SE9 A;  3KWV A;  3ZNH B;  1NEN B;  2N7J A;  3FKY A;  3JSV A;  2ZZP B;  3DBH B;  3R2I A;  2JUO A;  5JXV A;  1N60 A;  2D2Q A;  4XDD A;  1CQV A;  2MCN B;  1UWX A;  1FMA D;  1KH0 A;  4CYE A;  3P1M A;  2MEK A;  4GDL B;  3N20 C;  3WAM A;  4M0W A;  4AQ7 A;  4N59 A;  1WGK A;  4ACF A;  2KVZ A;  5E6P A;  1SF0 A;  2DZM A;  2K3U A;  2Y5C A;  4ZOH C;  2H89 B;  4HDQ A;  1DOI A;  3ZGZ A;  4RGN A;  3ZRF A;  3TCA A;  4FJY A;  2JY6 A;  4A6Q A;  4NY0 A;  2WXJ A;  4EFO A;  4GU2 A;  3QWZ B;  1IUE A;  3V6E B;  1C4P A;  3V60 A;  1WFY A;  3DVG Y;  1WJ4 A;  2L76 A;  4FLH A;  2XEW A;  1ZGU B;  2N9L A;  1XO3 A;  1TYG B;  1VRA B;  2HE7 A;  1YOV B;  2IZV B;  2NPT B;  3ZJV A;  1V1P B;  2JVC A;  3C8Y A;  1WGG A;  5CHF A;  3RD2 A;  1YJ1 A;  1FCC C;  1HQR D;  1J8C A;  3LDZ E;  1WZ0 A;  5BYQ A;  2KMC A;  3W2D A;  3BY4 B;  1C1Y B;  4IKG A;  4GN1 A;  3VQI A;  4GOC A;  1HE8 A;  1N5W A;  1TZO A;  2IY1 B;  2VH1 A;  1PGA A;  2DAF A;  1TY2 A;  2INC C;  2LMC A;  1H4R A;  1JRU A;  5KHQ A;  3PSE B;  5D6J B;  3A9K B;  3ONS A;  3O65 B;  4HK2 A;  2YEP B;  4ITK A;  3T9L A;  2KFK B;  3W5U B;  1HTQ A;  4KGT A;  2ZVO A;  4W9H A;  2FNJ B;  4A20 A;  4CQN A;  4B0M A;  1NI3 A;  2LI5 A;  1RM6 C;  4FHJ A;  5BO4 B;  3T3O A;  2AX5 A;  3AV8 A;  1I4Q A;  3KH0 A;  5AZG A;  2KDF B;  2JRI B;  3P4Q B;  4NQL B;  2KFJ A;  4BAX A;  1YN4 A;  2H88 B;  4DQO C;  4G50 A;  2BYV E;  2JRH A;  4LK0 M;  4GLS C;  4HPM B;  2K6D B;  3VR8 B;  4TQ0 A;  5DPS A;  2KN5 A;  3HUI A;  3PRE A;  5EE9 A;  3UIN B;  5MPO A;  2LAS A;  2VH2 A;  4WUR A;  4RGT A;  1WJ6 A;  3AUL A;  3EEC A;  1YD8 U;  2KHW B;  2WXI A;  1WIA A;  4JPS A;  4ANW A;  4TSS A;  4IDI A;  1GB4 A;  3TUO A;  3EFC A;  3VTW A;  3L08 A;  4S0R A;  3P4R B;  1VJK A;  2J42 A;  2FIF A;  2R2Q A;  2KDE B;  3QJZ A;  2L3Z A;  4PYZ A;  2UU7 A;  5JH5 C;  2JXX A;  2WXR A;  2NTS A;  2FID A;  3DVN U;  1C4A A;  1PDX A;  3PVL A;  1RFA A;  2LD9 A;  2I1J A;  3NS8 A;  1FD6 A;  3SDL C;  2RDG A;  4LNN A;  1SJH D;  2K22 A;  2N0S B;  3B0A A;  1WXS A;  3L17 A;  3WA0 A;  3AE8 B;  4R3D A;  1C3T A;  1WGY A;  2CR5 A;  5BYS A;  3IFW B;  4N6E B;  2KZR A;  3H1U A;  2INP E;  3DHH C;  1V97 A;  2BYE A;  1JW9 D;  3MHS D;  1SJE D;  4GDK A;  2KWC A;  2IO3 B;  5LLI A;  3GZN I;  3Q2A C;  2GLS A;  4YXD B;  3VH4 B;  3QX1 A;  1WRD B;  4NJC A;  2WXL A;  1MJD A;  3ZNI D;  3PZ8 A;  5AUI A;  5J2R A;  4M8N A;  4P16 A;  3VAW A;  2KTR A;  3AXC A;  4ZYN A;  2NS5 A;  3ZW3 A;  3RNB C;  1WMH B;  3JYU A;  3DPD A;  4W9K A;  2NTT A;  3BK2 A;  2JSV X;  2G4S A;  4IM0 A;  5AZF A;  2MA9 B;  2JT4 B;  3EGR A; 
#chains in the Genus database with same CATH homology
 3R8B A;  4ARC A;  1SSN A;  4PT5 A;  2Z8L A;  1YQ3 B;  2IGG A;  1XXG A;  3BK1 A;  1TKE A;  1C76 A;  3FC4 A;  1FM0 D;  2MJ3 A;  2OED A;  3SFE B;  4ZHP A;  2BYT A;  1JWU D;  1QOF A;  4N58 A;  1CJE A;  1B1Z A;  3NUH B;  2J53 A;  3AE6 B;  4XDC A;  1HZ5 A;  3E9S A;  3V05 A;  1D4B A;  1KLU D;  2JYE A;  3Q69 A;  2B76 B;  1JWS D;  2PKO A;  4P6V F;  3AEA B;  3TEX A;  2CJN A;  1OFF A;  2WLB A;  1FO4 A;  2BT6 A;  4RGM A;  2XNA C;  2AQ2 B;  1C79 A;  2LGI A;  2IGH A;  1ZDX A;  4YTP B;  2I2Y A;  2KMM A;  2W82 A;  3HVZ A;  2K0P A;  1P7F A;  3ETR A;  1C78 A;  3FIL A;  3I57 A;  2AQ3 B;  3OWE B;  2X38 A;  2ZW1 A;  1F77 A;  1PGB A;  5H92 C;  1UWM A;  1VZ7 A;  1XLQ A;  4DXF A;  1FCL A;  5TSS A;  1SE2 A;  1FNU A;  3W5V B;  3SR6 A;  1SXT A;  3AE4 B;  1T3Q A;  4WIP A;  3O13 A;  2M0A A;  4TQ1 A;  3NVW A;  3GB1 A;  2PIA A;  5C3J B;  2WS3 B;  1GAQ B;  2ONQ A;  1L4D B;  2WDV B;  3IT4 B;  4HRS A;  1YN5 A;  4XWW A;  5BMH A;  5BMG A;  1QOB A;  1DOX A;  5LNK 1;  2SAK A;  4A8X C;  2PVG C;  2MH7 A;  2WDR B;  3DWG C;  5FKA C;  2Y5P A;  4HKZ E;  1V1O A;  2PMV A;  4RFB A;  4AS1 A;  4OZC A;  1A70 A;  1VLB A;  3AM9 A;  3URY A;  5I4D A;  2ON8 A;  2QSD A;  3Q8C A;  2M19 A;  1KFY B;  4FXC A;  4US9 A;  2KWD A;  3MC0 B;  1TY0 A;  1JML A;  1L6U A;  5D3I B;  2W55 A;  1FIQ A;  3BYY B;  3BZD B;  4A9A A;  3KWL A;  2QIE B;  2V3N A;  3Q8E A;  1SE4 A;  5FR3 A;  2G1E A;  2SEB D;  1WWT A;  1ESF A;  3BWU D;  1I4P A;  1GOZ A;  3ABV B;  3RPF C;  1KLG D;  1QT9 A;  2L1A A;  3W1S A;  1XLN A;  2FUG 1;  5BMI A;  1JWA D;  2JQR B;  1FXI A;  2WXO A;  3LYY A;  2WP9 B;  1VZ8 A;  2DBY A;  1KRH A;  4OZA A;  2JYT A;  1TS3 A;  3KLS X;  2RPV A;  3IT6 B;  1ZPS A;  1K50 A;  2WXM A;  3AED B;  3AE3 B;  1WXQ A;  1ROE A;  2IJ0 A;  2YEP F;  3DWM A;  1I7H A;  1HEZ E;  2W54 A;  3NZ3 A;  2G9H D;  1D6E C;  1E9M A;  2WXQ A;  3GP7 A;  1ZXH A;  4O1N A;  3EUB 2;  4Q2J A;  3B2F A;  5C2T B;  3LXF A;  4HKQ A;  3AEG B;  1E7P B;  2M56 B;  3B9J A;  1FEH A;  2RMM A;  5G5G A;  1BML C;  2I38 A;  1ZP0 B;  1MHX A;  2QIL A;  1T6B X;  3SEB A;  2W3S A;  4JE3 B;  4JWU C;  2KDM A;  1XLO A;  1BUI C;  1UGJ A;  2FE8 A;  3NVZ A;  4C7Y A;  1C77 A;  1ZXI A;  1TKY A;  1IGD A;  3U7Z A;  4YWG G;  5HG2 A;  3CWI A;  4LTU A;  1HXY D;  2E6X A;  1YJI A;  1DGJ A;  1VZ6 A;  3H8H A;  1ET9 A;  2OHF A;  4OW0 A;  3AE5 B;  3Q8B A;  4KKI A;  4DXG A;  1D5M C;  1SB3 C;  2WNM A;  1JWB D;  1WYG A;  2WXN A;  3AEE B;  1QOA A;  1N61 A;  1RYJ A;  5BYR A;  1SIJ A;  3AN1 A;  1E6E B;  1XLP A;  4WQM A;  4ZRP A;  1AYF A;  1HZ6 A;  1VDV A;  4WH4 A;  2FBW B;  5EE1 A;  1L4Z B;  2N9K A;  2LUM A;  1Y56 A;  2GB1 A;  2WDQ B;  2BW2 A;  3PO0 A;  2JZP A;  4WAF A;  4HEA 1;  1J7A A;  1QQR A;  1XCT L;  3T3N A;  4EE2 A;  1FNV A;  4XE0 A;  1EWY C;  4KGR A;  4OZB A;  4US8 A;  1TS2 A;  2KQ4 X;  3MJ5 A;  2PTL A;  2WXH A;  1SEB D;  1N63 A;  2MJD A;  1QF6 A;  1YN3 A;  2KAC A;  2Q5W D;  1QOG A;  3NS1 A;  3P4P B;  1ZE3 D;  4RF1 A;  5H8Y E;  1TS5 A;  1FFU A;  3GS2 A;  1L6V A;  3KWV A;  4L23 A;  1JRO A;  1NEN B;  2N7J A;  4MT5 A;  3R2I A;  3TSS A;  3BYT B;  5JXV A;  1N60 A;  1E0Z A;  5D7G A;  4XDD A;  1CQV A;  4MM3 B;  1F0Z A;  1UWX A;  1I4H A;  1FMA D;  1KH0 A;  3EA6 A;  3P1M A;  1FXA A;  2MEK A;  4GDL B;  3KQ4 A;  4IOI E;  4M0W A;  4AQ7 A;  4N59 A;  5E6J A;  1WGK A;  2BS3 B;  3LB8 C;  2IPK D;  3R2T A;  2BB6 A;  4NAM A;  4A90 A;  1B9R A;  2DWQ A;  1SF0 A;  2K3U A;  3U2S C;  1D5Z C;  2Y5C A;  4ZOH C;  2V4I B;  1FNW A;  3P63 A;  2TSS A;  1TJE A;  2H89 B;  1DOI A;  1YQ4 B;  3ZGZ A;  1ZDV A;  4RGN A;  4RCO A;  1NEK B;  2W3R A;  3W9C B;  2BB5 A;  4A6Q A;  1FRR A;  2GRI A;  2WXJ A;  2AQ1 B;  5HHD G;  1ET6 A;  3BVM A;  1IUE A;  4C56 C;  5FK9 C;  1C4P A;  1UUP A;  2IDY A;  4KGS A;  4NZL B;  4D2K A;  1L0Y B;  2N9L A;  4ZHO A;  1XO3 A;  2WXK A;  1Q10 A;  1TYG B;  4TMA B;  1VRA B;  4HJG E;  1ZUD 2;  2LEK A;  1GB1 A;  3ZJV A;  3Q8F A;  1V1P B;  4GDK B;  3C8Y A;  2BS2 B;  4RH6 A;  4XWT A;  1T5X D;  4KKJ A;  3J9C A;  3TEY A;  4OHJ A;  4RNA A;  1FCC C;  1HQR D;  2VZK B;  4RF0 A;  2BTE A;  2NMQ A;  4C80 A;  1JAL A;  2VZK D;  5BYQ A;  4HRO A;  3W2D A;  3N9Y C;  2KN4 A;  1STE A;  1DOY A;  4IKG A;  2V3P A;  1ACC A;  3VQI A;  3MHZ A;  2JU6 X;  1N5W A;  1YMH E;  4USA A;  2BS4 B;  3AMZ A;  1TZO A;  4ZRQ A;  1K52 A;  1C4C A;  3E56 A;  1M4V A;  1MI0 A;  2WXF A;  3AE9 B;  1YJJ A;  2J4X A;  1NYR A;  1PGA A;  1OQQ A;  1TY2 A;  4H2A A;  2LMC A;  1D5X C;  5EE3 A;  2Y3A A;  2V0G A;  1NYQ A;  2LHE A;  5G5H A;  1DYQ A;  1IBX A;  3BVG A;  3TEW A;  2WQY B;  1J7B A;  1KF6 B;  2YEP B;  3VRA B;  1XF5 L;  3AE1 B;  1XEE A;  5HFY A;  1PGX A;  2WXP A;  4ITK A;  4YT0 B;  1PYW D;  1QLB B;  1QIL A;  3W5U B;  3ZYY X;  3IXS A;  1YNT E;  3P42 A;  4KGT A;  2WU5 B;  3AE7 B;  2J52 A;  4CQN A;  4B0M A;  1IGC A;  1NI3 A;  1RM6 C;  4MH8 A;  2INN E;  3L4P A;  2PVO D;  3NVV A;  3T3O A;  2AX5 A;  2DYM A;  5D3D A;  3AEB B;  3AV8 A;  2DYO A;  1I4Q A;  2LFI A;  1SE3 A;  2HDE A;  3FIL B;  2BBC A;  3BII D;  4LLG M;  3P4Q B;  1EU4 A;  3AH7 A;  1V8C A;  3SFD B;  2ZW0 A;  1YN4 A;  2H88 B;  1L5P A;  1MVK A;  4YSY B;  4DQO C;  1EWC A;  1FRD A;  4LK0 M;  1I4X A;  1K51 A;  4OVZ A;  4GLS C;  3AEF B;  3VR8 B;  3P4S B;  1RWS A;  4TQ0 A;  1VR9 A;  1JRP A;  3TEZ A;  3HUI A;  1PUT A;  5EE9 A;  5MPO A;  3ZJU A;  4JX1 C;  4WUR A;  2WU2 B;  4RGT A;  2MJE A;  2PW9 A;  1L0V B;  3CIR B;  2JX5 A;  4REZ A;  2IGD A;  3Q8A A;  5T8I A;  1J7C A;  4RGO S;  1AWD A;  2JXT A;  2K9X A;  3VR9 B;  2WXI A;  4JPS A;  1LO5 D;  1NVI D;  1MPE A;  4J3O D;  4TSS A;  4IDI A;  2E3T A;  1GB4 A;  3TUO A;  4ZYS A;  3BVZ A;  1EU3 A;  1PFD A;  4WWM A;  2RDH A;  3P4R B;  1VJK A;  2PLP A;  1R7S A;  2ACZ B;  2J42 A;  3AE2 B;  2GI9 A;  2HTM E;  1AN8 A;  1TKG A;  4MAC A;  1FFV A;  1L0X B;  3IAS 1;  4L2Y A;  1QKZ A;  2WXR A;  1JQ4 A;  2NTS A;  3ZQ4 A;  1CK1 A;  1N62 A;  1XCQ L;  4KX6 B;  3AEC B;  1C4A A;  1PDX A;  2CU3 A;  2R61 A;  3VRB B;  3WCQ A;  1TS4 A;  2EEL A;  4JWS C;  2L83 A;  3HRD D;  1FD6 A;  5GXG B;  2ICI A;  2RDG A;  4NAW B;  4YSZ B;  1JCK B;  3ZJT A;  1SJH D;  1WRI A;  5HI1 A;  3V3X A;  2K22 A;  2N0S B;  2QMT A;  2L52 A;  3UI3 A;  1K53 A;  3I9V 1;  3AB5 A;  4B0E A;  3AE8 B;  4R3D A;  4UDU C;  4C7Z A;  5BYS A;  2QJL A;  3IAM 1;  5AUK A;  4N6E B;  2D5G A;  2K5P A;  2INP E;  2L32 A;  1V97 A;  1JW9 D;  1P7E A;  1SJE D;  3HVD A;  1V1P A;  3MP9 A;  3B2G A;  1E10 A;  3PZ7 A;  2QEJ C;  1N5X A;  4YXD B;  1WSP A;  2KAJ A;  1C9F A;  4A55 A;  4NJC A;  1CZP A;  3FAH A;  3U4E G;  2WXL A;  2EKI A;  4L1B A;  1UNS A;  3NVY A;  1ENF A;  1KTK A;  5EE0 A;  1AW7 A;  1JWM D;  3PZ8 A;  1IBX B;  3RFZ B;  5AUI A;  4P16 A;  2JWU A;  1SBB B;  1HA5 A;  2WXG A;  1I4R A;  3NRZ A;  1I4G A;  1EM7 A;  1MHH E;  1RFK A;  4YTN B;  1F2R I;  2LHD A;  1ZOY B;  4YTM B;  4YSX B;  2NTT A;  3U52 E;  4ARI A;  3BK2 A;  2JSV X;  3MFG A;  2LJI A;  2CJO A;  1GPX A;  1BXT A;  1OQR A;  1F2R C;  2DLB A;  2XN9 C;  3EGR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...