2E6XA

X-ray structure of tt1592 from thermus thermophilus hb8
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
69
structure length
69
Chain Sequence
MEKDLLDKLGQHLVWRMGRAEDEDVLVVRVGLASATPRFRELPRLLNLPEAEMRRLVQEGRVRVEWVEE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural genomics, unknown function
molecule keywords Hypothetical protein TTHA1281
publication title X-ray structure of TT1592 from Thermus thermophilus HB8
rcsb
source organism Thermus thermophilus
total genus 16
structure length 69
sequence length 69
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2007-01-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF11609 DUF3248 Protein of unknown function (DUF3248)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.570 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 2e6xA00
2E6XA
chains in the Genus database with same CATH superfamily
1IBXB 3WAPA 2DENB 2HTHA 3ZUNA 1I7HA 2DNFA 2QC8A 2KLGA 2GBNA 3DHGC 2RD0A 3A1QA 2DZJA 1YNTE 4FBJB 3ZQ4A 3AE1B 5E6NA 4F1SA 4C00A 4JGHB 2JRHA 1EU4A 2V9HA 1FNVA 4MDKE 1Q10A 1DYQA 4A90A 1WXAA 4W9IA 2JY6A 4ICUA 1A70A 4NJ6A 3BZDB 2BPSA 2H89B 2CHZA 2BWFA 1FMAD 5EE3A 3PZDA 1MFWA 4FHKA 2WGSA 2KFJA 2XEWA 2Z0DB 4C56C 2LJ5A 1D6EC 2PMVA 4I6LB 3KWLA 4F8CB 2N0SB 3HM3A 1K53A 2C7MB 2JZZA 5JH5C 4PS7A 1JROA 4HPLB 2W55A 3J9CA 4NZLB 3NVYA 4WWOA 3A33B 2M56B 3IT4B 2INCC 4ZHPA 3NHEB 4MJSA 4MSQB 3UI3A 4ITKA 3SDLC 1GJZA 4DBGA 2E6XA 1KJTA 1EUVB 1NENB 3BINA 1L0YB 2BKRB 1LM8B 4YTPB 4DHZE 3WCQA 3JYUA 2M19A 1T0YA 1CMXB 1M94A 2MBOA 1M4VA 1WRIA 4KIKA 3R7RA 1AWDA 4RGMA 1IBXA 1ZXHA 3P63A 4YTMB 3CIRB 1V86A 2DZMA 3IT6B 3VVWB 2XNAC 1ESFA 2WP9B 3T8MA 1FXAA 2IGGA 4HJKA 1E10A 2R61A 2IY0B 2J0MA 3FAHA 3ZLZA 4W9LA 1ENFA 1F77A 2LZ6A 2HD5B 2GI9A 2W3SA 2KMCA 3IBEA 3MFGA 2REXA 4TQ1A 3Q3NC 3PHWB 3DVGX 1NVID 2MBQA 3Q2AC 1NDDA 3UGBB 1ZDXA 1GNUA 1T0SC 1TKEA 4XDDA 4XE0A 3B9JA 2V3SA 2BF8B 3NVVA 1FCCC 3PT2B 2QHOA 2WDTB 2KWVB 2J4XA 2CU3A 1TKGA 1KH0A 2DBYA 4DK5A 1UZXB 1JQ4A 3P4QB 4HK2A 3VHTC 3PZ8A 3D32A 2GMIC 2IZVB 4XGAB 1GG3A 4W9KA 2DLBA 3FC4A 2WXMA 3P1MA 4W9HA 1KLGD 1VLBA 2KLCA 4ZHOA 3VUWA 2RDBC 3PLVA 4LNKA 3ZGZA 1D5MC 5AZHA 4RFBA 2LVPA 3P4SB 5H92C 3TMPB 2K8HA 4ZYNA 1OEYJ 3CMMB 4PT5A 3ZDTA 1GC6A 3U7ZA 1WFYA 1N60A 2KWDA 3V62A 4NJ7A 3U52E 2QDFA 4FXCA 4GDKB 4R3DA 2D3CA 3AEFB 1QOFA 1F2RC 3ZKJC 4BOSC 1WWTA 3HM6X 4N6EB 1ZE3D 3PREA 4W9EA 2R2QA 3ZRFA 4LLGM 2PLPA 4K81A 4WJOA 1I4XA 1DOIA 2WXQA 1RFAA 3A4RA 2MW5A 4BKTA 3PHXB 1EU3A 1HTOA 1WX9A 1NBFC 4B0EA 4WWPA 1MHHE 1UUPA 5TR5A 4EE2A 2NS5A 5BO4B 4WWNA 2JT4B 4JWSC 2W3RA 3OLMD 2KHWB 1F52A 2O6VB 3BVMA 2VH2A 1U4AA 2I1KA 5IO9A 3ML9A 3T3OA 1WXVA 4RNAA 1T6BX 1CK1A 2MEKA 2MJDA 1HEZE 3TBLD 4GOCA 2N7JA 4ZRKA 5L83A 1V49A 3JSVA 2LGIA 4Q2JA 3B0AA 4RF1A 2D5GA 2KDIA 5D2MB 3PO0A 2FBWB 1JMLA 3A9JB 3N1XC 3H9DA 3AXCA 3ZXRA 3KUZA 3HIZA 3R3MA 4EKUA 3QK0A 1XLNA 4KDLB 2AX5A 1KFYB 2LGDA 2OEDA 2MLBA 4AQ7A 4RCOA 2WXKA 4GDKA 2IO0B 2YEPB 2Y3AA 4FJZA 2WLBA 1OGWA 2FIFA 1SE3A 4XWTA 2DYOA 3TCAA 3WIMA 1J19A 2A5UA 2JYEA 3V60A 2KVZA 4US9A 2N4FA 3ZW3A 1J8CA 4W9FA 2DYMA 1YJJA 1FRDA 1TS3A 1EWCA 4OZBA 2N9EB 1WXSA 1Z2MA 3AE6B 3A9KB 1KOTA 3DVNU 2D11A 1T3QA 1HZ5A 4HEA1 2N1VA 3UIOB 2MHJA 3ZVVA 1WM2A 4ZRQA 2INPE 1GAQB 2KMMA 4ARCA 1UWXA 2O2VB 3Q8FA 1I42A 3DBLI 5CHVC 3QX1A 2D07B 1WJUA 1STEA 4A3OA 5IP4D 4FHJA 5G5GA 3VTVA 1JWBD 3VAWA 3U4EG 4S17A 1IYFA 5HHDG 5HFYA 3N1ZC 2ZJDA 3WANA 2FCMA 5C1ZA 2JXXA 4D2KA 2MJ3A 1BMLC 3LYYA 1RWSA 3U8ZA 2QMTA 4B9KA 3ML8A 3C19A 1C79A 4IKGA 2JSVX 1RAXA 3A9JA 1LGRA 5J18A 2KNBA 2JUOA 2HJ8A 1GB1A 3L17A 3Q14C 1T5XD 1XEEA 3OJ3A 1V81A 3JVZX 2G9HD 2KJ6A 4TUUA 2Q5WD 1NYRA 4K7UA 1OTRB 3T9LA 4B0MA 2JYTA 1YJ1A 1UBIA 5D3IB 1XCQL 4PS3A 1K51A 2QCZA 2AQ1B 2BBCA 2EKEC 5HG2A 1QILA 2H88B 5DPRA 2ZZPB 3DWGC 1WGKA 2Y5PA 4PK1A 2KANA 4L2YA 3W1SA 1C9FA 2KWUB 4JLCA 1ROEA 1H4RA 2DAFA 3AE9B 4RF0A 2M17A 1V9JA 5DPWA 4RM9A 1SJHD 3PTFC 3KLSX 4FN2A 4LJPB 3VRAB 3MTNB 3SHQA 1D3ZA 2KXJA 3GZNI 1JWUD 4EZJA 1FFUA 3DPDA 4IM2A 2O2VA 3ALBA 3Q69A 4GGQA 1WGHA 3KVFB 1F9JA 4ARIA 5KHOA 4MSMB 5E6OA 4GSWA 2DZKA 2LHEA 3ZTCA 2G4SA 2CKHB 3GS2A 1YIWA 5AUIA 4EFOA 1C4CA 3TEXA 3EFCA 1PYWD 1WY8A 4P1CC 3DVNV 1ACCA 2IGHA 5D6JB 1IGCA 3H6NA 3R66C 1SJED 4M02A 4WJQA 2KN5A 4F7ZA 2FCQA 4EUTA 5BMHA 3ZXVA 2AEHA 4DWFA 1FNWA 3WAOA 3X0WA 4W9JA 3LXFA 2NTSA 4ZRJA 4LDTB 4GDLB 1PDXA 4GLSC 2JWUA 4K7WA 3RYTA 4URKA 3NZUA 1RLFA 2KK8A 3ZJTA 5CHFA 5JXVA 1WJ4A 3RD2A 2WS3B 4H2AA 2DYBA 4OVUA 3AB5A 1PFDA 2RPQA 2ZW0A 2G3QB 3KW5B 2AQ3B 3DBRI 2M0AA 4BKSD 4MELA 3ZYYX 3TEYA 1SE2A 1EWYC 2LUMA 3ZNHB 2N9KA 1WJNA 4LK0M 1L4ZB 5IAAC 5LNK1 3AEAB 1WH3A 2Y5CA 3W1SC 5JHAA 3MJWA 2FUHB 1FPYA 1HE8A 2DAJA 3AE2B 2KD0A 1SE4A 1FXTB 1WGYA 4IC7B 1XLPA 2UU7A 1UH6A 3O65B 1TTNA 2RDGA 2M1MA 5TSSA 4YTNB 2LXAA 3DOWA 1WGRA 2C5LC 5AEKB 1YN4A 2N9PC 4KSLC 1QLBB 2MSED 1MG4A 5GMVA 1CQVA 5E6PA 1EO6A 2LXCA 4NQKE 2KC2A 2L00B 4MH0E 2FE8A 1EM7A 5LXIB 2L05A 2DX5B 2DHZA 1JRUA 4HCNB 1ZP0B 1WM3A 4WH4A 3MJ5A 1DGJA 4BBNF 5J17A 4BZAA 4HCPB 1Q0WB 1D5ZC 4RGOS 1WF9A 1SE9A 1L2NA 1NI2A 4L1BA 1L7YA 1L6UA 4DXAB 1AYFA 1V5TA 2JQRB 2LEKA 2CHXA 2N9LA 3HUIA 4W9DA 2K1FA 4MGYE 1YX6B 4WQOB 3NS8A 2J52A 3VRBB 1TGZB 2OJWA 3DHIC 1TY0A 4GDLA 2R2OA 4OW0A 1ZDVA 3AU4A 1T0QC 1UF0A 4KKJA 2HJ1A 2I2YA 1N6ZA 4ZRIA 4HVBA 2GBRA 2WX0A 2ZW1A 3VXWA 1Q1OA 3PSEB 1TT5B 2KT7A 2L8JA 3DCGA 2D2QA 2KTRB 4BFRA 3HK0A 1UWMA 3IVFA 3VH4B 2J53A 4M0WB 3P4PB 4IWPA 2BYEA 1V2YA 3TIXA 3ZO5B 2K8BA 3AEGB 1S3SG 2LD9A 4MGIE 4XZ4A 2OHFA 1D5XC 1XD3B 4A20A 3I63C 2YEPF 2WXRA 2AL3A 4C4VB 4BKSA 4K3CA 1E7PB 1ZGUB 2LGYA 1N61A 2V0GA 2J0JA 3ZJUA 5GXGB 3LB8C 3OWEB 3SU8X 4NAWB 3VDZA 3CF6E 2JX5A 4HKQA 1AN8A 5IN7A 3S2AA 1JWMD 2L1AA 4JQWC 2YVCA 1RFKA 4DHJD 4X57B 3FILB 1FEHA 1KM7A 1WYWB 1FXIA 3N3KB 4WJNA 2QJLA 2WXHA 1GPXA 3NOBA 1LQBA 3UQBA 3GP7A 4AS1A 2C7HA 2X38A 3H1UA 5I4DA 4MACA 1WGGA 4MT5A 4K7SA 4DHJB 4NQLB 3TL5A 2KDMA 4W9CA 3VH3B 4JWUC 1DOYA 4FLHA 4IW0A 2KZRA 5L95C 1YQ3B 2L76A 4OVVA 1YN5A 5H8YE 3B2GA 3EHVA 4HJGE 2L7RA 3OAWA 1I4RA 1SGHA 1VDVA 1C4PA 3ECIA 3RNGC 3RUIB 2W54A 2ZVOA 3B2FA 2BB5A 3AE4B 1SSNA 1BUIC 3Q3MC 1MVKA 2PEAA 3IHPC 1CJEA 2O6VD 4REZA 2N1WA 3QARA 3H7PB 3DQVA 3QWZB 2L83A 3MC9A 2EMTA 2KWCA 3IAS1 3V61A 1F0ZA 1XLQA 3L4PA 2NBUA 3HRDD 3AE3B 1P9DU 5G5HA 4AOFA 2Z59B 1Z5SB 2YLMA 4M0WA 2N7DA 3UQAA 3P4RB 1VZ8A 3WAMA 5LLIA 1V97A 4NPNA 2MWSB 3BYYB 2CS4A 4GXBA 3KH0A 4C4VA 4ASWC 2KX0A 1TYGB 3X23A 2CR5A 2KFKB 2LI5A 3VTUA 2PW9A 5JHBA 1AW7A 4WURA 1N5WA 2NPTB 3Q8AA 2WU2B 4NAWA 2KQSA 4MEMA 2K0PA 2LVOA 2KJRA 4JIOU 3K9PB 4DXFA 2AQ2B 4KKIA 4GIVA 2N7EA 3AM9A 2IO1B 1TKYA 2HE7A 2IY1B 1IPGA 3Q8CA 1FD6A 3OG5A 2CHWA 4G11A 1TBEA 5EE0A 3ZTDA 3PS6A 3W9CB 1N5XA 2BYVE 1HTQA 2MP2B 4ACFA 3CWIA 1E8XA 4ZRPA 3HVDA 3L0WB 3PVLA 1KLVA 2NBWB 3IG3A 3WA0A 4DDID 2K6QA 1GB4A 2WHIA 4KGTA 1WJ6A 4TMAB 2OOBB 2KYWA 3U2SC 2B3AA 2IPKD 2WXIA 3MP9A 3NZSA 3RNAC 5DPSA 2K39A 1SIFA 1TS4A 1WSPA 5JZEB 2JVCA 2PVOD 5BYRA 1WX8A 3H7PA 1E90A 3RZFA 3APCA 3PRPB 2ZCBA 1WZ0A 1YN3A 3VR9B 5IA7A 3SR6A 2AWTA 4ZYSA 2O6VA 5IOIA 2Y5BB 2KX3A 2JWZA 2VRRB 3NRZA 3V3XA 1A5RA 1L0VB 2K5PA 1SXTA 4EZLA 1N63A 3NG0A 2BQQA 2IBIB 3IAM1 3N9YC 2G45B 3NVZA 3DBHI 3RNFC 2KTFA 2FIDA 4HROA 2KFKA 1PGBA 1R4NI 4GN1A 2LRWA 2K25A 3M3JA 1KF6B 2BYTA 2KMAA 2WXNA 3KUDB 2NPTA 3DBLB 2AYOB 3ONSA 3H7SA 1YQBA 3FKYA 2D3BA 2G1EA 2W82A 4IUMB 4AWJA 2L0FA 3QIJA 4ZDVA 1MJDA 2JXTA 4G50A 1R4NB 2L3ZA 2JRIB 3RZWC 2NTTA 3PPAA 4PYUA 4PS8A 4RH6A 1TJEA 4A9AA 5FR6A 3ZJVA 3BVZA 2MP2A 4IWQA 3MHSD 3CSFA 1E9MA 4TKNA 3PLUA 4CYEA 4E74A 2I1JA 2BWES 2LVQA 1C1YB 4GU2A 3UF8A 1XF5L 1TZOA 5T8IA 5FR3A 4GMVA 1FFVA 1VJKA 1WX7A 2ZEQA 3PV1A 1J7CA 3QAQA 1ZOYB 5CHWA 1JCKB 3EUB2 1RM6C 3K9OB 4ANUA 4N58A 2NCNA 1SEBD 5C2TB 1PGXA 1VZ6A 1IGDA 3RNEC 2LUEA 3A9KA 3W1YA 1VCBA 4K1RB 3IFWB 1C78A 4AJYB 2LFIA 5EE1A 1Q5WB 3VUYA 1XCTL 1L4DB 4YL8A 1RYJA 2ZPYA 4BBNC 2L52A 3M63B 5DCNA 3EGRA 3P42A 1LXDA 2SAKA 1E7UA 1EF5A 2C60A 3LDZE 4AUQC 1J7AA 2M4NA 4RGTA 3N1YC 1I4HA 3KUCB 3Q6BA 4S0RA 2KVRA 3TEWA 3GZNB 3U30A 5FK9C 5D3DA 2LASA 2KDFB 4A6QA 3BK1A 4M01A 2MBBB 2BTEA 4DHZB 1PGAA 3CSTA 4EEWA 4RGNA 3RNCC 3ZIMA 1SB3C 1WI0A 2QILA 2RR9A 3URYA 1TS2A 4LDTD 2J42A 4HDOA 4YT0B 2PTLA 2WXJA 1K8RB 4WJPA 1L6VA 2MQJA 3V6CB 1UGJA 3BIID 3R7QA 4I6PA 1LO5D 1QZEA 2QIEB 1XLOA 1YD8U 1L5PA 5CX3A 2UYZB 2K6DB 3NZ3A 3UIPB 3DBSA 4WAFA 4YSXB 3C0RB 2NBVB 2VH1A 2WXGA 1OFFA 4W9GA 1L0XB 4E71A 3ZNZB 2INNE 3BY4B 4EZKA 2LGXA 2KDEB 4RMAA 2J0KA 3QQ8B 3ZRCA 1ISNA 4BAXA 3AV8A 4KVGB 2I38A 1C77A 1ZXIA 1MI0A 1VRAB 3Q8BA 1JWSD 2SEBD 3V05A 4M8NA 1V8CA 3ENEA 2QSDA 2IO3B 4KZCA 3NY5A 4KGSA 3RN9C 1Y8RC 2W9NA 4M8MA 3L54A 4IG7B 2PKOA 2ON8A 1OQRA 2WXFA 3DHHC 1YOVB 2A4ZA 3DBRB 5D94A 1OQYA 5EE9A 1BXTA 4L23A 1E0ZA 4P1BC 1I4PA 3AU5A 1UBQA 2NMQA 3N30A 3SFDB 3AE5B 4NY0A 1WYGA 1C4AA 5G2NA 3VTWA 2JZ3B 4A3PA 4USAA 3AECB 2ACZB 1E6EB 3H8HA 2KAJA 2MX2A 4LNIA 2LHDA 3GOEA 2ZNVB 4TQ0A 4HRSA 2N9XA 4HWIB 4MGKE 2BVCA 4KGRA 3RNBC 2EELA 4BVUC 2KQ4X 2BS4B 1SF0A 4J6IA 4O1NA 4A8XC 2EKIA 4ZOHC 1E8ZA 3VR8B 1HQRD 3R2TA 5EDSA 4JX1C 3ZDMC 1K50A 3Q8EA 3TEZA 2NVUI 1AARA 3RT3B 3TJPA 3E9SA 2MH7A 1FRRA 4YXDB 4LNFA 4BKGA 4DXGA 1WMHB 2IO2B 2PE6B 4AJWA 4GB9A 2V4LA 2ONQA 3ABVB 1GC7A 2PJHA 1MG8A 2LRUA 4ANWA 1OEYA 1UELA 3RI7C 4FULA 2FUG1 5IKCM 2Z8LA 2FNJB 3DWMA 5CTRC 5AZFA 1ET6A 3NVWA 2CJOA 3EC8A 2C9WB 2MCNB 4II3B 2WYQA 3I3TB 2GRIA 2KO3A 1UNSA 3APFA 2PVGC 5E6JA 2PIAA 4KSKC 3SFEB 5BYSA 1P98A 1QKZA 4DDGD 3HHMA 2LGSA 2QEJC 1WXQA 2CJNA 2IGDA 1HZ6A 3APDA 1V6EA 1G6JA 3KWVA 4JPSA 3EFUA 2LJIA 4N59A 2KDBA 4QAYA 4M00A 2HDEA 1FO4A 3GE8C 4CQNA 4UDUC 4FA6A 2CU1A 1ZW7A 2RDHA 3PGEA 3LJ3A 3RCZA 2X8XX 3QCAA 4IM3A 1N62A 4II2B 1XQQA 2NR2A 4HLEA 5J2RA 2IDYA 3B1LX 4OHJA 1FCLA 3BYTB 3I9V1 4JE3B 4BOZB 4B6WA 3DDCB 3JSVB 5AZGA 1QF6A 5C23A 2V3PA 4YSZB 2G4DB 3DVGY 4NAMA 4WIPA 2JZPA 1J0GA 1XT9B 2IYDB 2KQ7A 3SEBA 3GB1A 2BT6A 1ZKHA 3Q3FA 4AP4C 4HXDA 2WDVB 1TIFA 3E56A 4OZAA 1WGDA 4XX5A 3A4SC 4OZCA 1NYQA 3M95A 1QQRA 1YX5B 4TV3A 1E8YA 2B76B 2BYFA 1V1PB 1WMHA 1RRBA 4K3BA 3ETRA 1XXGA 2M0XA 1KTKA 2INDC 1QOAA 2ZPNA 2GB1A 4HPPA 3NS1A 4OVZA 5FKAC 4A55A 3NUHB 3T3NA 2OJRA 1WRDB 1Y56A 3OJ4B 2KTRA 3AEEB 5DPTA 3TUOA 2D10A 2V1YA 4XC2A 4US8A 5LXHA 3AEDB 5BMIA 1NI3A 2GBMA 5BYQA 3M62B 3PZ7A 3Q3JA 3I57A 2LWPA 1WR6E 1FIQA 3R8BA 3NJTA 1UD7A 1IP9A 2K8CA 1HA5A 4NJCA 2FCNA 1WIAA 2WXPA 2KC1A 3BVGA 1D4BA 1P0RA 1IUEA 3EECA 1H8CA 1E8WA 4XYCA 2DWQA 3FILA 2MRPA 1S1QB 4P6VF 3B08A 2ZNVC 4MGZE 2K3UA 4C80A 3W2DA 4LCDE 3U7DA 1JWAD 1PUTA 1B1ZA 1VZ7A 4ANXA 5HKHA 2L0TA 2BB6A 2RMMA 1P1AA 4KV2A 3VFKA 1FM0D 2KJHB 4E3CA 4MH8A 2ZCCA 1B9RA 4DQOC 1JW9D 3AULA 4LNOA 1V1PA 1I4QA 3RFZB 3UINB 2BGFA 4P7IA 5HI1A 3KYCD 2PPHA 2VZKD 3PRMB 2IJ0A 3I5JC 3QJZA 2LMCA 4WAAA 1CZPA 2ICIA 5G55A 1WZ3A 2MBHA 4G0NB 3AEBB 2D3AA 4ANVA 2ASQA 3L13A 4PYZA 4FADA 2E3TA 4C7ZA 3MC0B 4I6NB 2VZKB 2KOXA 2UWQA 1DOXA 1V80A 4MM3B 2XN9C 2WX1A 1K52A 1P7FA 1WXMA 2BW2A 2C7NB 3QHTA 1C3TA 1QOGA 4N9F4 4JL9A 3QA8A 3R2IA 4C7YA 2WDRB 2WDQB 1LFDA 3BWUD 1P3QU 4EOYA 4G3XB 5AUKA 4HPMB 2K9XA 3VQIA 4J3OD 3DBHB 2WU5B 2WWZA 1FNUA 2Z0EB 3O13A 1XO3A 4B95A 2XK5B 3JW0X 2D3GA 1UGMA 1QOBA 3P2BA 4ICVA 2V4IB 3KQ4A 1HXYD 4IDIA 4FJVB 5MPOA 3AH7A 4FJYA 4NNJB 1NEKB 3N20C 4CO7A 3RULA 1PQSA 3AN1A 1YJIA 4HDQA 4IM0A 1YQ4B 4IOIE 1WR1A 1P7EA 2EMSA 3W5UB 3A1QB 3MC8A 4CHKA 4KX6B 4YWGG 3BK2A 1VR9A 1F1HA 1TZ1A 4XWWA 2WXLA 1ZUD2 1KRHA 3Q3OC 2GBKA 2KKCA 1E5WA 2KACA 3PRZA 1MHXA 2JU6X 4HKZE 4LJOB 1MPEA 5C3JB 2V3NA 4LNNA 5KHQA 4KZ0A 1JRPA 4YSYB 2K22A 5BMGA 4MM3A 1V1OA 1R7SA 3AE7B 2M8SA 1EF1A 1E7VA 4RM8A 3L08A 3AE8B 1YMHE 3L16A 3WALA 1C76A 1R4MI 3QC8B 1QT9A 5D7GA 1I35A 2WNMA 4P16A 1ZPSA 3TSSA 2DZIA 3RMKC 2KN4A 2GLSA 3VUXA 2GOWA 2BS2B 3HVZA 2HTME 1SIJA 2TSSA 2MA9B 1KLUD 2BS3B 3AI5A 2L32A 2MBEA 2GBJA 3L10B 2JPHA 3MHZA 3W5VB 1WE6A 1F2RI 4IWOA 2PE9A 2MJEA 1I4GA 1R4MB 2JF5A 2FAZA 3GE3C 1TS5A 4LTUA 4WQMA 1J7BA 1V5OA 1BT0A 2RPVA 3IXSA 3KYDD 3RPFC 2WQYB 4WWMA 4TSSA 1VD2A 4MJSB 2XBBC 1JALA 3SD5A 2XK5A 4KDIC 4XDCA 1ET9A 3C8YA 1X1MA 2FCSA 3V6EB 1GUAB 2WXOA 1SBBB 2RSUA 3EA6A 1GOZA 2AL6A 2J7QB 2RGFA 1TY2A 3N32A 1WE7A 1T0RC 2BKFA 2ZVNA 1OQQA 3AMZA 3ZNGC 3ZNID 4KIKB
chains in the Genus database with same CATH topology
1TYGB 3KWVA 4JPSA 2PW9A 2LJIA 1IBXB 4N59A 1AW7A 4WURA 1I7HA 1N5WA 1GB1A 2HDEA 1FO4A 1T5XD 1XEEA 3Q8AA 2WU2B 4CQNA 4UDUC 2G9HD 2K0PA 2RDHA 2Q5WD 2AQ2B 1NYRA 4KKIA 4DXFA 1YNTE 3ZQ4A 3AE1B 1N62A 3AM9A 1TKYA 4B0MA 1EU4A 2IDYA 3Q8CA 1FD6A 1FNVA 4OHJA 2JYTA 1FCLA 1Q10A 1DYQA 3BYTB 4A90A 3I9V1 4JE3B 5EE0A 1A70A 5D3IB 1XCQL 3W9CB 1N5XA 3BZDB 2H89B 1FMAD 3CWIA 1QF6A 5EE3A 4ZRPA 1K51A 3HVDA 2AQ1B 2V3PA 4YSZB 2BBCA 4NAMA 5HG2A 1QILA 2H88B 4WIPA 2JZPA 1GB4A 3DWGC 4C56C 1WGKA 2Y5PA 3SEBA 4KGTA 1D6EC 4L2YA 3W1SA 3GB1A 2BT6A 1C9FA 2PMVA 1ROEA 3KWLA 4TMAB 3U2SC 2WDVB 3MP9A 2IPKD 2N0SB 2WXIA 3AE9B 3E56A 4RF0A 4OZAA 1K53A 1SJHD 4OZCA 3KLSX 1TS4A 1JROA 1NYQA 3VRAB 1WSPA 1QQRA 2W55A 3J9CA 4NZLB 3NVYA 2B76B 1V1PB 2PVOD 5BYRA 1JWUD 1FFUA 3ETRA 1XXGA 2M56B 3IT4B 3Q69A 1KTKA 4ARIA 1QOAA 1YN3A 4ZHPA 3UI3A 3VR9B 2GB1A 4ITKA 3SR6A 2LHEA 2E6XA 3NS1A 1NENB 4OVZA 5FKAC 4ZYSA 1L0YB 4A55A 3GS2A 4YTPB 3NRZA 3NUHB 3V3XA 3T3NA 1L0VB 5AUIA 2K5PA 3WCQA 1SXTA 1N63A 2M19A 1Y56A 1C4CA 3IAM1 3N9YC 3TEXA 1M4VA 1WRIA 3NVZA 3AEEB 1PYWD 4HROA 3TUOA 1PGBA 1AWDA 4RGMA 1ACCA 2IGHA 1IBXA 1ZXHA 3P63A 4YTMB 4US8A 3AEDB 3CIRB 1KF6B 2BYTA 1IGCA 1SJED 3IT6B 2WXNA 2XNAC 5BMIA 1NI3A 5BYQA 1ESFA 2WP9B 5BMHA 1FNWA 1FXAA 3PZ7A 2IGGA 2G1EA 1E10A 2W82A 3I57A 2R61A 1FIQA 3LXFA 3R8BA 3FAHA 2NTSA 2JXTA 1HA5A 4NJCA 1ENFA 1F77A 4GDLB 1PDXA 2WXPA 4GLSC 2GI9A 2JWUA 2NTTA 2W3SA 3BVGA 3MFGA 3ZJTA 1D4BA 1IUEA 4RH6A 4TQ1A 1TJEA 4A9AA 5JXVA 3ZJVA 1NVID 3BVZA 2DWQA 3FILA 2WS3B 4H2AA 1ZDXA 1E9MA 3AB5A 4P6VF 1TKEA 1PFDA 2ZW0A 4XDDA 4XE0A 2K3UA 2AQ3B 4C80A 3B9JA 3NVVA 3W2DA 2M0AA 1FCCC 1JWAD 1PUTA 3ZYYX 1B1ZA 1SE2A 1EWYC 2LUMA 3TEYA 1VZ7A 2J4XA 1XF5L 2N9KA 2CU3A 1TKGA 1TZOA 1L4ZB 1KH0A 2DBYA 3AEAB 4LK0M 5LNK1 1JQ4A 5T8IA 3P4QB 2Y5CA 5FR3A 2BB6A 2RMMA 1FM0D 1FFVA 3PZ8A 4MH8A 1VJKA 1B9RA 4DQOC 1JW9D 3AE2B 1J7CA 2DLBA 1SE4A 3FC4A 1XLPA 2WXMA 1ZOYB 1JCKB 3EUB2 1RM6C 1V1PA 1I4QA 3P1MA 4N58A 3RFZB 1KLGD 1VLBA 2RDGA 1SEBD 5TSSA 4ZHOA 4YTNB 5C2TB 1PGXA 1VZ6A 1IGDA 5HI1A 3ZGZA 1D5MC 2VZKD 4RFBA 3P4SB 2IJ0A 5H92C 1C78A 1YN4A 2LMCA 2LFIA 5EE1A 1QLBB 1CZPA 2ICIA 4PT5A 3U7ZA 1CQVA 3AEBB 1N60A 2KWDA 1XCTL 1L4DB 3U52E 1RYJA 4FXCA 2FE8A 1EM7A 2E3TA 4GDKB 2L52A 4R3DA 4C7ZA 3MC0B 3AEFB 3EGRA 1QOFA 1F2RC 3P42A 2SAKA 2VZKB 1WWTA 1ZP0B 4N6EB 1ZE3D 1DOXA 4MM3B 1J7AA 4WH4A 4RGTA 2XN9C 1K52A 4LLGM 2PLPA 1I4HA 3MJ5A 1DGJA 1P7FA 3TEWA 5FK9C 1I4XA 1D5ZC 1DOIA 4RGOS 5D3DA 2BW2A 2WXQA 4A6QA 3BK1A 1QOGA 4L1BA 2BTEA 1EU3A 3R2IA 4C7YA 2WDRB 2WDQB 1L6UA 1PGAA 1AYFA 4RGNA 2JQRB 2LEKA 4B0EA 2N9LA 3HUIA 1MHHE 1SB3C 1UUPA 2QILA 3URYA 4EE2A 3BWUD 1TS2A 2J52A 3VRBB 2J42A 4YT0B 2PTLA 2WXJA 4JWSC 1L6VA 1TY0A 4OW0A 2W3RA 1ZDVA 5AUKA 4KKJA 1UGJA 2I2YA 3BIID 2K9XA 3VQIA 1LO5D 2QIEB 4J3OD 1XLOA 1L5PA 3BVMA 2ZW1A 2WU5B 3NZ3A 1FNUA 4WAFA 4YSXB 3T3OA 4RNAA 1T6BX 1CK1A 2WXGA 2MEKA 1OFFA 2MJDA 3O13A 1XO3A 1HEZE 1L0XB 2N7JA 1QOBA 1UWMA 2J53A 2INNE 2V4IB 3KQ4A 1HXYD 4IDIA 3P4PB 2LGIA 4Q2JA 4RF1A 5MPOA 2D5GA 3AH7A 3AV8A 1NEKB 2I38A 3AEGB 3PO0A 2FBWB 2OHFA 1D5XC 1C77A 1ZXIA 1MI0A 1VRAB 3Q8BA 2YEPF 1JWSD 1JMLA 2WXRA 2SEBD 1E7PB 3V05A 1V8CA 2QSDA 3AN1A 1N61A 4KGSA 1YJIA 2V0GA 1YQ4B 3ZJUA 5GXGB 3LB8C 3OWEB 4IOIE 4NAWB 2PKOA 2ON8A 1P7EA 1OQRA 2JX5A 2WXFA 4HKQA 1XLNA 1AN8A 3W5UB 1JWMD 2AX5A 1KFYB 4KX6B 4YWGG 3BK2A 2OEDA 5EE9A 2L1AA 1BXTA 1VR9A 4L23A 4XWWA 4AQ7A 1E0ZA 1I4PA 2WXLA 1RFKA 4RCOA 1ZUD2 1KRHA 3FILB 2NMQA 1FEHA 2WXKA 1FXIA 3SFDB 3AE5B 2QJLA 2WXHA 2KACA 1WYGA 1GPXA 1C4AA 1MHXA 2JU6X 4HKZE 2YEPB 2Y3AA 1MPEA 3GP7A 5C3JB 4USAA 4AS1A 2WLBA 2X38A 2V3NA 3AECB 2ACZB 1E6EB 3H8HA 5I4DA 1JRPA 1SE3A 2KAJA 2K22A 4XWTA 1V1OA 2DYOA 1R7SA 3AE7B 4YSYB 2LHDA 4MACA 4MT5A 4TQ0A 4HRSA 2JYEA 2KDMA 4JWUC 1DOYA 3AE8B 1YMHE 4US9A 4KGRA 1C76A 1YQ3B 1YN5A 2EELA 5H8YE 3B2GA 2DYMA 2KQ4X 4HJGE 2BS4B 1QT9A 1SF0A 5D7GA 1I4RA 2WNMA 4P16A 1YJJA 1ZPSA 1FRDA 4O1NA 3TSSA 4A8XC 1VDVA 2EKIA 1TS3A 2KN4A 4ZOHC 1EWCA 1C4PA 2BS2B 3HVZA 4OZBA 2W54A 3VR8B 2HTME 1HQRD 1SIJA 3B2FA 2BB5A 2TSSA 1KLUD 2BS3B 3R2TA 2L32A 3AE6B 3AE4B 4JX1C 1SSNA 1BUIC 3MHZA 1K50A 3Q8EA 1T3QA 3W5VB 3TEZA 1F2RI 1MVKA 3E9SA 1HZ5A 4HEA1 2MH7A 1FRRA 2MJEA 1CJEA 1I4GA 4YXDB 4ZRQA 2INPE 4DXGA 1GAQB 2KMMA 4REZA 1TS5A 4LTUA 4WQMA 4ARCA 1J7BA 2ONQA 3ABVB 1UWXA 2L83A 2RPVA 3IXSA 3RPFC 3Q8FA 2WQYB 4WWMA 3IAS1 5BMGA 1F0ZA 1XLQA 4TSSA 2FUG1 1STEA 1JALA 2Z8LA 3HRDD 3L4PA 3AE3B 3DWMA 1ET6A 5G5HA 5G5GA 4XDCA 1JWBD 2CJOA 3NVWA 1ET9A 3U4EG 3C8YA 5HHDG 5HFYA 2GRIA 4M0WA 1UNSA 2WXOA 1SBBB 2PVGC 5E6JA 2PIAA 3P4RB 1VZ8A 3SFEB 5BYSA 4D2KA 3EA6A 1GOZA 2MJ3A 1V97A 1BMLC 1TY2A 3LYYA 1QKZA 3BYYB 1RWSA 1OQQA 2QEJC 2QMTA 1WXQA 2CJNA 2IGDA 3AMZA 1HZ6A 1C79A 4IKGA 2JSVX
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2E6X A; 
#chains in the Genus database with same CATH topology
 1IBX B;  3WAP A;  2DEN B;  2HTH A;  3ZUN A;  1I7H A;  2DNF A;  2QC8 A;  2KLG A;  2GBN A;  3DHG C;  2RD0 A;  3A1Q A;  2DZJ A;  1YNT E;  4FBJ B;  3ZQ4 A;  3AE1 B;  5E6N A;  4F1S A;  4C00 A;  4JGH B;  2JRH A;  1EU4 A;  2V9H A;  1FNV A;  4MDK E;  1Q10 A;  1DYQ A;  4A90 A;  1WXA A;  4W9I A;  2JY6 A;  4ICU A;  1A70 A;  4NJ6 A;  3BZD B;  2BPS A;  2H89 B;  2CHZ A;  2BWF A;  1FMA D;  5EE3 A;  3PZD A;  1MFW A;  4FHK A;  2WGS A;  2KFJ A;  2XEW A;  2Z0D B;  4C56 C;  2LJ5 A;  1D6E C;  2PMV A;  4I6L B;  3KWL A;  4F8C B;  2N0S B;  3HM3 A;  1K53 A;  2C7M B;  2JZZ A;  5JH5 C;  4PS7 A;  1JRO A;  4HPL B;  2W55 A;  3J9C A;  4NZL B;  3NVY A;  4WWO A;  3A33 B;  2M56 B;  3IT4 B;  2INC C;  4ZHP A;  3NHE B;  4MJS A;  4MSQ B;  3UI3 A;  4ITK A;  3SDL C;  1GJZ A;  4DBG A;  2E6X A;  1KJT A;  1EUV B;  1NEN B;  3BIN A;  1L0Y B;  2BKR B;  1LM8 B;  4YTP B;  4DHZ E;  3WCQ A;  3JYU A;  2M19 A;  1T0Y A;  1CMX B;  1M94 A;  2MBO A;  1M4V A;  1WRI A;  4KIK A;  3R7R A;  1AWD A;  4RGM A;  1IBX A;  1ZXH A;  3P63 A;  4YTM B;  3CIR B;  1V86 A;  2DZM A;  3IT6 B;  3VVW B;  2XNA C;  1ESF A;  2WP9 B;  3T8M A;  1FXA A;  2IGG A;  4HJK A;  1E10 A;  2R61 A;  2IY0 B;  2J0M A;  3FAH A;  3ZLZ A;  4W9L A;  1ENF A;  1F77 A;  2LZ6 A;  2HD5 B;  2GI9 A;  2W3S A;  2KMC A;  3IBE A;  3MFG A;  2REX A;  4TQ1 A;  3Q3N C;  3PHW B;  3DVG X;  1NVI D;  2MBQ A;  3Q2A C;  1NDD A;  3UGB B;  1ZDX A;  1GNU A;  1T0S C;  1TKE A;  4XDD A;  4XE0 A;  3B9J A;  2V3S A;  2BF8 B;  3NVV A;  1FCC C;  3PT2 B;  2QHO A;  2WDT B;  2KWV B;  2J4X A;  2CU3 A;  1TKG A;  1KH0 A;  2DBY A;  4DK5 A;  1UZX B;  1JQ4 A;  3P4Q B;  4HK2 A;  3VHT C;  3PZ8 A;  3D32 A;  2GMI C;  2IZV B;  4XGA B;  1GG3 A;  4W9K A;  2DLB A;  3FC4 A;  2WXM A;  3P1M A;  4W9H A;  1KLG D;  1VLB A;  2KLC A;  4ZHO A;  3VUW A;  2RDB C;  3PLV A;  4LNK A;  3ZGZ A;  1D5M C;  5AZH A;  4RFB A;  2LVP A;  3P4S B;  5H92 C;  3TMP B;  2K8H A;  4ZYN A;  1OEY J;  3CMM B;  4PT5 A;  3ZDT A;  1GC6 A;  3U7Z A;  1WFY A;  1N60 A;  2KWD A;  3V62 A;  4NJ7 A;  3U52 E;  2QDF A;  4FXC A;  4GDK B;  4R3D A;  2D3C A;  3AEF B;  1QOF A;  1F2R C;  3ZKJ C;  4BOS C;  1WWT A;  3HM6 X;  4N6E B;  1ZE3 D;  3PRE A;  4W9E A;  2R2Q A;  3ZRF A;  4LLG M;  2PLP A;  4K81 A;  4WJO A;  1I4X A;  1DOI A;  2WXQ A;  1RFA A;  3A4R A;  2MW5 A;  4BKT A;  3PHX B;  1EU3 A;  1HTO A;  1WX9 A;  1NBF C;  4B0E A;  4WWP A;  1MHH E;  1UUP A;  5TR5 A;  4EE2 A;  2NS5 A;  5BO4 B;  4WWN A;  2JT4 B;  4JWS C;  2W3R A;  3OLM D;  2KHW B;  1F52 A;  2O6V B;  3BVM A;  2VH2 A;  1U4A A;  2I1K A;  5IO9 A;  3ML9 A;  3T3O A;  1WXV A;  4RNA A;  1T6B X;  1CK1 A;  2MEK A;  2MJD A;  1HEZ E;  3TBL D;  4GOC A;  2N7J A;  4ZRK A;  5L83 A;  1V49 A;  3JSV A;  2LGI A;  4Q2J A;  3B0A A;  4RF1 A;  2D5G A;  2KDI A;  5D2M B;  3PO0 A;  2FBW B;  1JML A;  3A9J B;  3N1X C;  3H9D A;  3AXC A;  3ZXR A;  3KUZ A;  3HIZ A;  3R3M A;  4EKU A;  3QK0 A;  1XLN A;  4KDL B;  2AX5 A;  1KFY B;  2LGD A;  2OED A;  2MLB A;  4AQ7 A;  4RCO A;  2WXK A;  4GDK A;  2IO0 B;  2YEP B;  2Y3A A;  4FJZ A;  2WLB A;  1OGW A;  2FIF A;  1SE3 A;  4XWT A;  2DYO A;  3TCA A;  3WIM A;  1J19 A;  2A5U A;  2JYE A;  3V60 A;  2KVZ A;  4US9 A;  2N4F A;  3ZW3 A;  1J8C A;  4W9F A;  2DYM A;  1YJJ A;  1FRD A;  1TS3 A;  1EWC A;  4OZB A;  2N9E B;  1WXS A;  1Z2M A;  3AE6 B;  3A9K B;  1KOT A;  3DVN U;  2D11 A;  1T3Q A;  1HZ5 A;  4HEA 1;  2N1V A;  3UIO B;  2MHJ A;  3ZVV A;  1WM2 A;  4ZRQ A;  2INP E;  1GAQ B;  2KMM A;  4ARC A;  1UWX A;  2O2V B;  3Q8F A;  1I42 A;  3DBL I;  5CHV C;  3QX1 A;  2D07 B;  1WJU A;  1STE A;  4A3O A;  5IP4 D;  4FHJ A;  5G5G A;  3VTV A;  1JWB D;  3VAW A;  3U4E G;  4S17 A;  1IYF A;  5HHD G;  5HFY A;  3N1Z C;  2ZJD A;  3WAN A;  2FCM A;  5C1Z A;  2JXX A;  4D2K A;  2MJ3 A;  1BML C;  3LYY A;  1RWS A;  3U8Z A;  2QMT A;  4B9K A;  3ML8 A;  3C19 A;  1C79 A;  4IKG A;  2JSV X;  1RAX A;  3A9J A;  1LGR A;  5J18 A;  2KNB A;  2JUO A;  2HJ8 A;  1GB1 A;  3L17 A;  3Q14 C;  1T5X D;  1XEE A;  3OJ3 A;  1V81 A;  3JVZ X;  2G9H D;  2KJ6 A;  4TUU A;  2Q5W D;  1NYR A;  4K7U A;  1OTR B;  3T9L A;  4B0M A;  2JYT A;  1YJ1 A;  1UBI A;  5D3I B;  1XCQ L;  4PS3 A;  1K51 A;  2QCZ A;  2AQ1 B;  2BBC A;  2EKE C;  5HG2 A;  1QIL A;  2H88 B;  5DPR A;  2ZZP B;  3DWG C;  1WGK A;  2Y5P A;  4PK1 A;  2KAN A;  4L2Y A;  3W1S A;  1C9F A;  2KWU B;  4JLC A;  1ROE A;  1H4R A;  2DAF A;  3AE9 B;  4RF0 A;  2M17 A;  1V9J A;  5DPW A;  4RM9 A;  1SJH D;  3PTF C;  3KLS X;  4FN2 A;  4LJP B;  3VRA B;  3MTN B;  3SHQ A;  1D3Z A;  2KXJ A;  3GZN I;  1JWU D;  4EZJ A;  1FFU A;  3DPD A;  4IM2 A;  2O2V A;  3ALB A;  3Q69 A;  4GGQ A;  1WGH A;  3KVF B;  1F9J A;  4ARI A;  5KHO A;  4MSM B;  5E6O A;  4GSW A;  2DZK A;  2LHE A;  3ZTC A;  2G4S A;  2CKH B;  3GS2 A;  1YIW A;  5AUI A;  4EFO A;  1C4C A;  3TEX A;  3EFC A;  1PYW D;  1WY8 A;  4P1C C;  3DVN V;  1ACC A;  2IGH A;  5D6J B;  1IGC A;  3H6N A;  3R66 C;  1SJE D;  4M02 A;  4WJQ A;  2KN5 A;  4F7Z A;  2FCQ A;  4EUT A;  5BMH A;  3ZXV A;  2AEH A;  4DWF A;  1FNW A;  3WAO A;  3X0W A;  4W9J A;  3LXF A;  2NTS A;  4ZRJ A;  4LDT B;  4GDL B;  1PDX A;  4GLS C;  2JWU A;  4K7W A;  3RYT A;  4URK A;  3NZU A;  1RLF A;  2KK8 A;  3ZJT A;  5CHF A;  5JXV A;  1WJ4 A;  3RD2 A;  2WS3 B;  4H2A A;  2DYB A;  4OVU A;  3AB5 A;  1PFD A;  2RPQ A;  2ZW0 A;  2G3Q B;  3KW5 B;  2AQ3 B;  3DBR I;  2M0A A;  4BKS D;  4MEL A;  3ZYY X;  3TEY A;  1SE2 A;  1EWY C;  2LUM A;  3ZNH B;  2N9K A;  1WJN A;  4LK0 M;  1L4Z B;  5IAA C;  5LNK 1;  3AEA B;  1WH3 A;  2Y5C A;  3W1S C;  5JHA A;  3MJW A;  2FUH B;  1FPY A;  1HE8 A;  2DAJ A;  3AE2 B;  2KD0 A;  1SE4 A;  1FXT B;  1WGY A;  4IC7 B;  1XLP A;  2UU7 A;  1UH6 A;  3O65 B;  1TTN A;  2RDG A;  2M1M A;  5TSS A;  4YTN B;  2LXA A;  3DOW A;  1WGR A;  2C5L C;  5AEK B;  1YN4 A;  2N9P C;  4KSL C;  1QLB B;  2MSE D;  1MG4 A;  5GMV A;  1CQV A;  5E6P A;  1EO6 A;  2LXC A;  4NQK E;  2KC2 A;  2L00 B;  4MH0 E;  2FE8 A;  1EM7 A;  5LXI B;  2L05 A;  2DX5 B;  2DHZ A;  1JRU A;  4HCN B;  1ZP0 B;  1WM3 A;  4WH4 A;  3MJ5 A;  1DGJ A;  4BBN F;  5J17 A;  4BZA A;  4HCP B;  1Q0W B;  1D5Z C;  4RGO S;  1WF9 A;  1SE9 A;  1L2N A;  1NI2 A;  4L1B A;  1L7Y A;  1L6U A;  4DXA B;  1AYF A;  1V5T A;  2JQR B;  2LEK A;  2CHX A;  2N9L A;  3HUI A;  4W9D A;  2K1F A;  4MGY E;  1YX6 B;  4WQO B;  3NS8 A;  2J52 A;  3VRB B;  1TGZ B;  2OJW A;  3DHI C;  1TY0 A;  4GDL A;  2R2O A;  4OW0 A;  1ZDV A;  3AU4 A;  1T0Q C;  1UF0 A;  4KKJ A;  2HJ1 A;  2I2Y A;  1N6Z A;  4ZRI A;  4HVB A;  2GBR A;  2WX0 A;  2ZW1 A;  3VXW A;  1Q1O A;  3PSE B;  1TT5 B;  2KT7 A;  2L8J A;  3DCG A;  2D2Q A;  2KTR B;  4BFR A;  3HK0 A;  1UWM A;  3IVF A;  3VH4 B;  2J53 A;  4M0W B;  3P4P B;  4IWP A;  2BYE A;  1V2Y A;  3TIX A;  3ZO5 B;  2K8B A;  3AEG B;  1S3S G;  2LD9 A;  4MGI E;  4XZ4 A;  2OHF A;  1D5X C;  1XD3 B;  4A20 A;  3I63 C;  2YEP F;  2WXR A;  2AL3 A;  4C4V B;  4BKS A;  4K3C A;  1E7P B;  1ZGU B;  2LGY A;  1N61 A;  2V0G A;  2J0J A;  3ZJU A;  5GXG B;  3LB8 C;  3OWE B;  3SU8 X;  4NAW B;  3VDZ A;  3CF6 E;  2JX5 A;  4HKQ A;  1AN8 A;  5IN7 A;  3S2A A;  1JWM D;  2L1A A;  4JQW C;  2YVC A;  1RFK A;  4DHJ D;  4X57 B;  3FIL B;  1FEH A;  1KM7 A;  1WYW B;  1FXI A;  3N3K B;  4WJN A;  2QJL A;  2WXH A;  1GPX A;  3NOB A;  1LQB A;  3UQB A;  3GP7 A;  4AS1 A;  2C7H A;  2X38 A;  3H1U A;  5I4D A;  4MAC A;  1WGG A;  4MT5 A;  4K7S A;  4DHJ B;  4NQL B;  3TL5 A;  2KDM A;  4W9C A;  3VH3 B;  4JWU C;  1DOY A;  4FLH A;  4IW0 A;  2KZR A;  5L95 C;  1YQ3 B;  2L76 A;  4OVV A;  1YN5 A;  5H8Y E;  3B2G A;  3EHV A;  4HJG E;  2L7R A;  3OAW A;  1I4R A;  1SGH A;  1VDV A;  1C4P A;  3ECI A;  3RNG C;  3RUI B;  2W54 A;  2ZVO A;  3B2F A;  2BB5 A;  3AE4 B;  1SSN A;  1BUI C;  3Q3M C;  1MVK A;  2PEA A;  3IHP C;  1CJE A;  2O6V D;  4REZ A;  2N1W A;  3QAR A;  3H7P B;  3DQV A;  3QWZ B;  2L83 A;  3MC9 A;  2EMT A;  2KWC A;  3IAS 1;  3V61 A;  1F0Z A;  1XLQ A;  3L4P A;  2NBU A;  3HRD D;  3AE3 B;  1P9D U;  5G5H A;  4AOF A;  2Z59 B;  1Z5S B;  2YLM A;  4M0W A;  2N7D A;  3UQA A;  3P4R B;  1VZ8 A;  3WAM A;  5LLI A;  1V97 A;  4NPN A;  2MWS B;  3BYY B;  2CS4 A;  4GXB A;  3KH0 A;  4C4V A;  4ASW C;  2KX0 A;  1TYG B;  3X23 A;  2CR5 A;  2KFK B;  2LI5 A;  3VTU A;  2PW9 A;  5JHB A;  1AW7 A;  4WUR A;  1N5W A;  2NPT B;  3Q8A A;  2WU2 B;  4NAW A;  2KQS A;  4MEM A;  2K0P A;  2LVO A;  2KJR A;  4JIO U;  3K9P B;  4DXF A;  2AQ2 B;  4KKI A;  4GIV A;  2N7E A;  3AM9 A;  2IO1 B;  1TKY A;  2HE7 A;  2IY1 B;  1IPG A;  3Q8C A;  1FD6 A;  3OG5 A;  2CHW A;  4G11 A;  1TBE A;  5EE0 A;  3ZTD A;  3PS6 A;  3W9C B;  1N5X A;  2BYV E;  1HTQ A;  2MP2 B;  4ACF A;  3CWI A;  1E8X A;  4ZRP A;  3HVD A;  3L0W B;  3PVL A;  1KLV A;  2NBW B;  3IG3 A;  3WA0 A;  4DDI D;  2K6Q A;  1GB4 A;  2WHI A;  4KGT A;  1WJ6 A;  4TMA B;  2OOB B;  2KYW A;  3U2S C;  2B3A A;  2IPK D;  2WXI A;  3MP9 A;  3NZS A;  3RNA C;  5DPS A;  2K39 A;  1SIF A;  1TS4 A;  1WSP A;  5JZE B;  2JVC A;  2PVO D;  5BYR A;  1WX8 A;  3H7P A;  1E90 A;  3RZF A;  3APC A;  3PRP B;  2ZCB A;  1WZ0 A;  1YN3 A;  3VR9 B;  5IA7 A;  3SR6 A;  2AWT A;  4ZYS A;  2O6V A;  5IOI A;  2Y5B B;  2KX3 A;  2JWZ A;  2VRR B;  3NRZ A;  3V3X A;  1A5R A;  1L0V B;  2K5P A;  1SXT A;  4EZL A;  1N63 A;  3NG0 A;  2BQQ A;  2IBI B;  3IAM 1;  3N9Y C;  2G45 B;  3NVZ A;  3DBH I;  3RNF C;  2KTF A;  2FID A;  4HRO A;  2KFK A;  1PGB A;  1R4N I;  4GN1 A;  2LRW A;  2K25 A;  3M3J A;  1KF6 B;  2BYT A;  2KMA A;  2WXN A;  3KUD B;  2NPT A;  3DBL B;  2AYO B;  3ONS A;  3H7S A;  1YQB A;  3FKY A;  2D3B A;  2G1E A;  2W82 A;  4IUM B;  4AWJ A;  2L0F A;  3QIJ A;  4ZDV A;  1MJD A;  2JXT A;  4G50 A;  1R4N B;  2L3Z A;  2JRI B;  3RZW C;  2NTT A;  3PPA A;  4PYU A;  4PS8 A;  4RH6 A;  1TJE A;  4A9A A;  5FR6 A;  3ZJV A;  3BVZ A;  2MP2 A;  4IWQ A;  3MHS D;  3CSF A;  1E9M A;  4TKN A;  3PLU A;  4CYE A;  4E74 A;  2I1J A;  2BWE S;  2LVQ A;  1C1Y B;  4GU2 A;  3UF8 A;  1XF5 L;  1TZO A;  5T8I A;  5FR3 A;  4GMV A;  1FFV A;  1VJK A;  1WX7 A;  2ZEQ A;  3PV1 A;  1J7C A;  3QAQ A;  1ZOY B;  5CHW A;  1JCK B;  3EUB 2;  1RM6 C;  3K9O B;  4ANU A;  4N58 A;  2NCN A;  1SEB D;  5C2T B;  1PGX A;  1VZ6 A;  1IGD A;  3RNE C;  2LUE A;  3A9K A;  3W1Y A;  1VCB A;  4K1R B;  3IFW B;  1C78 A;  4AJY B;  2LFI A;  5EE1 A;  1Q5W B;  3VUY A;  1XCT L;  1L4D B;  4YL8 A;  1RYJ A;  2ZPY A;  4BBN C;  2L52 A;  3M63 B;  5DCN A;  3EGR A;  3P42 A;  1LXD A;  2SAK A;  1E7U A;  1EF5 A;  2C60 A;  3LDZ E;  4AUQ C;  1J7A A;  2M4N A;  4RGT A;  3N1Y C;  1I4H A;  3KUC B;  3Q6B A;  4S0R A;  2KVR A;  3TEW A;  3GZN B;  3U30 A;  5FK9 C;  5D3D A;  2LAS A;  2KDF B;  4A6Q A;  3BK1 A;  4M01 A;  2MBB B;  2BTE A;  4DHZ B;  1PGA A;  3CST A;  4EEW A;  4RGN A;  3RNC C;  3ZIM A;  1SB3 C;  1WI0 A;  2QIL A;  2RR9 A;  3URY A;  1TS2 A;  4LDT D;  2J42 A;  4HDO A;  4YT0 B;  2PTL A;  2WXJ A;  1K8R B;  4WJP A;  1L6V A;  2MQJ A;  3V6C B;  1UGJ A;  3BII D;  3R7Q A;  4I6P A;  1LO5 D;  1QZE A;  2QIE B;  1XLO A;  1YD8 U;  1L5P A;  5CX3 A;  2UYZ B;  2K6D B;  3NZ3 A;  3UIP B;  3DBS A;  4WAF A;  4YSX B;  3C0R B;  2NBV B;  2VH1 A;  2WXG A;  1OFF A;  4W9G A;  1L0X B;  4E71 A;  3ZNZ B;  2INN E;  3BY4 B;  4EZK A;  2LGX A;  2KDE B;  4RMA A;  2J0K A;  3QQ8 B;  3ZRC A;  1ISN A;  4BAX A;  3AV8 A;  4KVG B;  2I38 A;  1C77 A;  1ZXI A;  1MI0 A;  1VRA B;  3Q8B A;  1JWS D;  2SEB D;  3V05 A;  4M8N A;  1V8C A;  3ENE A;  2QSD A;  2IO3 B;  4KZC A;  3NY5 A;  4KGS A;  3RN9 C;  1Y8R C;  2W9N A;  4M8M A;  3L54 A;  4IG7 B;  2PKO A;  2ON8 A;  1OQR A;  2WXF A;  3DHH C;  1YOV B;  2A4Z A;  3DBR B;  5D94 A;  1OQY A;  5EE9 A;  1BXT A;  4L23 A;  1E0Z A;  4P1B C;  1I4P A;  3AU5 A;  1UBQ A;  2NMQ A;  3N30 A;  3SFD B;  3AE5 B;  4NY0 A;  1WYG A;  1C4A A;  5G2N A;  3VTW A;  2JZ3 B;  4A3P A;  4USA A;  3AEC B;  2ACZ B;  1E6E B;  3H8H A;  2KAJ A;  2MX2 A;  4LNI A;  2LHD A;  3GOE A;  2ZNV B;  4TQ0 A;  4HRS A;  2N9X A;  4HWI B;  4MGK E;  2BVC A;  4KGR A;  3RNB C;  2EEL A;  4BVU C;  2KQ4 X;  2BS4 B;  1SF0 A;  4J6I A;  4O1N A;  4A8X C;  2EKI A;  4ZOH C;  1E8Z A;  3VR8 B;  1HQR D;  3R2T A;  5EDS A;  4JX1 C;  3ZDM C;  1K50 A;  3Q8E A;  3TEZ A;  2NVU I;  1AAR A;  3RT3 B;  3TJP A;  3E9S A;  2MH7 A;  1FRR A;  4YXD B;  4LNF A;  4BKG A;  4DXG A;  1WMH B;  2IO2 B;  2PE6 B;  4AJW A;  4GB9 A;  2V4L A;  2ONQ A;  3ABV B;  1GC7 A;  2PJH A;  1MG8 A;  2LRU A;  4ANW A;  1OEY A;  1UEL A;  3RI7 C;  4FUL A;  2FUG 1;  5IKC M;  2Z8L A;  2FNJ B;  3DWM A;  5CTR C;  5AZF A;  1ET6 A;  3NVW A;  2CJO A;  3EC8 A;  2C9W B;  2MCN B;  4II3 B;  2WYQ A;  3I3T B;  2GRI A;  2KO3 A;  1UNS A;  3APF A;  2PVG C;  5E6J A;  2PIA A;  4KSK C;  3SFE B;  5BYS A;  1P98 A;  1QKZ A;  4DDG D;  3HHM A;  2LGS A;  2QEJ C;  1WXQ A;  2CJN A;  2IGD A;  1HZ6 A;  3APD A;  1V6E A;  1G6J A;  3KWV A;  4JPS A;  3EFU A;  2LJI A;  4N59 A;  2KDB A;  4QAY A;  4M00 A;  2HDE A;  1FO4 A;  3GE8 C;  4CQN A;  4UDU C;  4FA6 A;  2CU1 A;  1ZW7 A;  2RDH A;  3PGE A;  3LJ3 A;  3RCZ A;  2X8X X;  3QCA A;  4IM3 A;  1N62 A;  4II2 B;  1XQQ A;  2NR2 A;  4HLE A;  5J2R A;  2IDY A;  3B1L X;  4OHJ A;  1FCL A;  3BYT B;  3I9V 1;  4JE3 B;  4BOZ B;  4B6W A;  3DDC B;  3JSV B;  5AZG A;  1QF6 A;  5C23 A;  2V3P A;  4YSZ B;  2G4D B;  3DVG Y;  4NAM A;  4WIP A;  2JZP A;  1J0G A;  1XT9 B;  2IYD B;  2KQ7 A;  3SEB A;  3GB1 A;  2BT6 A;  1ZKH A;  3Q3F A;  4AP4 C;  4HXD A;  2WDV B;  1TIF A;  3E56 A;  4OZA A;  1WGD A;  4XX5 A;  3A4S C;  4OZC A;  1NYQ A;  3M95 A;  1QQR A;  1YX5 B;  4TV3 A;  1E8Y A;  2B76 B;  2BYF A;  1V1P B;  1WMH A;  1RRB A;  4K3B A;  3ETR A;  1XXG A;  2M0X A;  1KTK A;  2IND C;  1QOA A;  2ZPN A;  2GB1 A;  4HPP A;  3NS1 A;  4OVZ A;  5FKA C;  4A55 A;  3NUH B;  3T3N A;  2OJR A;  1WRD B;  1Y56 A;  3OJ4 B;  2KTR A;  3AEE B;  5DPT A;  3TUO A;  2D10 A;  2V1Y A;  4XC2 A;  4US8 A;  5LXH A;  3AED B;  5BMI A;  1NI3 A;  2GBM A;  5BYQ A;  3M62 B;  3PZ7 A;  3Q3J A;  3I57 A;  2LWP A;  1WR6 E;  1FIQ A;  3R8B A;  3NJT A;  1UD7 A;  1IP9 A;  2K8C A;  1HA5 A;  4NJC A;  2FCN A;  1WIA A;  2WXP A;  2KC1 A;  3BVG A;  1D4B A;  1P0R A;  1IUE A;  3EEC A;  1H8C A;  1E8W A;  4XYC A;  2DWQ A;  3FIL A;  2MRP A;  1S1Q B;  4P6V F;  3B08 A;  2ZNV C;  4MGZ E;  2K3U A;  4C80 A;  3W2D A;  4LCD E;  3U7D A;  1JWA D;  1PUT A;  1B1Z A;  1VZ7 A;  4ANX A;  5HKH A;  2L0T A;  2BB6 A;  2RMM A;  1P1A A;  4KV2 A;  3VFK A;  1FM0 D;  2KJH B;  4E3C A;  4MH8 A;  2ZCC A;  1B9R A;  4DQO C;  1JW9 D;  3AUL A;  4LNO A;  1V1P A;  1I4Q A;  3RFZ B;  3UIN B;  2BGF A;  4P7I A;  5HI1 A;  3KYC D;  2PPH A;  2VZK D;  3PRM B;  2IJ0 A;  3I5J C;  3QJZ A;  2LMC A;  4WAA A;  1CZP A;  2ICI A;  5G55 A;  1WZ3 A;  2MBH A;  4G0N B;  3AEB B;  2D3A A;  4ANV A;  2ASQ A;  3L13 A;  4PYZ A;  4FAD A;  2E3T A;  4C7Z A;  3MC0 B;  4I6N B;  2VZK B;  2KOX A;  2UWQ A;  1DOX A;  1V80 A;  4MM3 B;  2XN9 C;  2WX1 A;  1K52 A;  1P7F A;  1WXM A;  2BW2 A;  2C7N B;  3QHT A;  1C3T A;  1QOG A;  4N9F 4;  4JL9 A;  3QA8 A;  3R2I A;  4C7Y A;  2WDR B;  2WDQ B;  1LFD A;  3BWU D;  1P3Q U;  4EOY A;  4G3X B;  5AUK A;  4HPM B;  2K9X A;  3VQI A;  4J3O D;  3DBH B;  2WU5 B;  2WWZ A;  1FNU A;  2Z0E B;  3O13 A;  1XO3 A;  4B95 A;  2XK5 B;  3JW0 X;  2D3G A;  1UGM A;  1QOB A;  3P2B A;  4ICV A;  2V4I B;  3KQ4 A;  1HXY D;  4IDI A;  4FJV B;  5MPO A;  3AH7 A;  4FJY A;  4NNJ B;  1NEK B;  3N20 C;  4CO7 A;  3RUL A;  1PQS A;  3AN1 A;  1YJI A;  4HDQ A;  4IM0 A;  1YQ4 B;  4IOI E;  1WR1 A;  1P7E A;  2EMS A;  3W5U B;  3A1Q B;  3MC8 A;  4CHK A;  4KX6 B;  4YWG G;  3BK2 A;  1VR9 A;  1F1H A;  1TZ1 A;  4XWW A;  2WXL A;  1ZUD 2;  1KRH A;  3Q3O C;  2GBK A;  2KKC A;  1E5W A;  2KAC A;  3PRZ A;  1MHX A;  2JU6 X;  4HKZ E;  4LJO B;  1MPE A;  5C3J B;  2V3N A;  4LNN A;  5KHQ A;  4KZ0 A;  1JRP A;  4YSY B;  2K22 A;  5BMG A;  4MM3 A;  1V1O A;  1R7S A;  3AE7 B;  2M8S A;  1EF1 A;  1E7V A;  4RM8 A;  3L08 A;  3AE8 B;  1YMH E;  3L16 A;  3WAL A;  1C76 A;  1R4M I;  3QC8 B;  1QT9 A;  5D7G A;  1I35 A;  2WNM A;  4P16 A;  1ZPS A;  3TSS A;  2DZI A;  3RMK C;  2KN4 A;  2GLS A;  3VUX A;  2GOW A;  2BS2 B;  3HVZ A;  2HTM E;  1SIJ A;  2TSS A;  2MA9 B;  1KLU D;  2BS3 B;  3AI5 A;  2L32 A;  2MBE A;  2GBJ A;  3L10 B;  2JPH A;  3MHZ A;  3W5V B;  1WE6 A;  1F2R I;  4IWO A;  2PE9 A;  2MJE A;  1I4G A;  1R4M B;  2JF5 A;  2FAZ A;  3GE3 C;  1TS5 A;  4LTU A;  4WQM A;  1J7B A;  1V5O A;  1BT0 A;  2RPV A;  3IXS A;  3KYD D;  3RPF C;  2WQY B;  4WWM A;  4TSS A;  1VD2 A;  4MJS B;  2XBB C;  1JAL A;  3SD5 A;  2XK5 A;  4KDI C;  4XDC A;  1ET9 A;  3C8Y A;  1X1M A;  2FCS A;  3V6E B;  1GUA B;  2WXO A;  1SBB B;  2RSU A;  3EA6 A;  1GOZ A;  2AL6 A;  2J7Q B;  2RGF A;  1TY2 A;  3N32 A;  1WE7 A;  1T0R C;  2BKF A;  2ZVN A;  1OQQ A;  3AMZ A;  3ZNG C;  3ZNI D;  4KIK B; 
#chains in the Genus database with same CATH homology
 1TYG B;  3KWV A;  4JPS A;  2PW9 A;  2LJI A;  1IBX B;  4N59 A;  1AW7 A;  4WUR A;  1I7H A;  1N5W A;  1GB1 A;  2HDE A;  1FO4 A;  1T5X D;  1XEE A;  3Q8A A;  2WU2 B;  4CQN A;  4UDU C;  2G9H D;  2K0P A;  2RDH A;  2Q5W D;  2AQ2 B;  1NYR A;  4KKI A;  4DXF A;  1YNT E;  3ZQ4 A;  3AE1 B;  1N62 A;  3AM9 A;  1TKY A;  4B0M A;  1EU4 A;  2IDY A;  3Q8C A;  1FD6 A;  1FNV A;  4OHJ A;  2JYT A;  1FCL A;  1Q10 A;  1DYQ A;  3BYT B;  4A90 A;  3I9V 1;  4JE3 B;  5EE0 A;  1A70 A;  5D3I B;  1XCQ L;  3W9C B;  1N5X A;  3BZD B;  2H89 B;  1FMA D;  3CWI A;  1QF6 A;  5EE3 A;  4ZRP A;  1K51 A;  3HVD A;  2AQ1 B;  2V3P A;  4YSZ B;  2BBC A;  4NAM A;  5HG2 A;  1QIL A;  2H88 B;  4WIP A;  2JZP A;  1GB4 A;  3DWG C;  4C56 C;  1WGK A;  2Y5P A;  3SEB A;  4KGT A;  1D6E C;  4L2Y A;  3W1S A;  3GB1 A;  2BT6 A;  1C9F A;  2PMV A;  1ROE A;  3KWL A;  4TMA B;  3U2S C;  2WDV B;  3MP9 A;  2IPK D;  2N0S B;  2WXI A;  3AE9 B;  3E56 A;  4RF0 A;  4OZA A;  1K53 A;  1SJH D;  4OZC A;  3KLS X;  1TS4 A;  1JRO A;  1NYQ A;  3VRA B;  1WSP A;  1QQR A;  2W55 A;  3J9C A;  4NZL B;  3NVY A;  2B76 B;  1V1P B;  2PVO D;  5BYR A;  1JWU D;  1FFU A;  3ETR A;  1XXG A;  2M56 B;  3IT4 B;  3Q69 A;  1KTK A;  4ARI A;  1QOA A;  1YN3 A;  4ZHP A;  3UI3 A;  3VR9 B;  2GB1 A;  4ITK A;  3SR6 A;  2LHE A;  2E6X A;  3NS1 A;  1NEN B;  4OVZ A;  5FKA C;  4ZYS A;  1L0Y B;  4A55 A;  3GS2 A;  4YTP B;  3NRZ A;  3NUH B;  3V3X A;  3T3N A;  1L0V B;  5AUI A;  2K5P A;  3WCQ A;  1SXT A;  1N63 A;  2M19 A;  1Y56 A;  1C4C A;  3IAM 1;  3N9Y C;  3TEX A;  1M4V A;  1WRI A;  3NVZ A;  3AEE B;  1PYW D;  4HRO A;  3TUO A;  1PGB A;  1AWD A;  4RGM A;  1ACC A;  2IGH A;  1IBX A;  1ZXH A;  3P63 A;  4YTM B;  4US8 A;  3AED B;  3CIR B;  1KF6 B;  2BYT A;  1IGC A;  1SJE D;  3IT6 B;  2WXN A;  2XNA C;  5BMI A;  1NI3 A;  5BYQ A;  1ESF A;  2WP9 B;  5BMH A;  1FNW A;  1FXA A;  3PZ7 A;  2IGG A;  2G1E A;  1E10 A;  2W82 A;  3I57 A;  2R61 A;  1FIQ A;  3LXF A;  3R8B A;  3FAH A;  2NTS A;  2JXT A;  1HA5 A;  4NJC A;  1ENF A;  1F77 A;  4GDL B;  1PDX A;  2WXP A;  4GLS C;  2GI9 A;  2JWU A;  2NTT A;  2W3S A;  3BVG A;  3MFG A;  3ZJT A;  1D4B A;  1IUE A;  4RH6 A;  4TQ1 A;  1TJE A;  4A9A A;  5JXV A;  3ZJV A;  1NVI D;  3BVZ A;  2DWQ A;  3FIL A;  2WS3 B;  4H2A A;  1ZDX A;  1E9M A;  3AB5 A;  4P6V F;  1TKE A;  1PFD A;  2ZW0 A;  4XDD A;  4XE0 A;  2K3U A;  2AQ3 B;  4C80 A;  3B9J A;  3NVV A;  3W2D A;  2M0A A;  1FCC C;  1JWA D;  1PUT A;  3ZYY X;  1B1Z A;  1SE2 A;  1EWY C;  2LUM A;  3TEY A;  1VZ7 A;  2J4X A;  1XF5 L;  2N9K A;  2CU3 A;  1TKG A;  1TZO A;  1L4Z B;  1KH0 A;  2DBY A;  3AEA B;  4LK0 M;  5LNK 1;  1JQ4 A;  5T8I A;  3P4Q B;  2Y5C A;  5FR3 A;  2BB6 A;  2RMM A;  1FM0 D;  1FFV A;  3PZ8 A;  4MH8 A;  1VJK A;  1B9R A;  4DQO C;  1JW9 D;  3AE2 B;  1J7C A;  2DLB A;  1SE4 A;  3FC4 A;  1XLP A;  2WXM A;  1ZOY B;  1JCK B;  3EUB 2;  1RM6 C;  1V1P A;  1I4Q A;  3P1M A;  4N58 A;  3RFZ B;  1KLG D;  1VLB A;  2RDG A;  1SEB D;  5TSS A;  4ZHO A;  4YTN B;  5C2T B;  1PGX A;  1VZ6 A;  1IGD A;  5HI1 A;  3ZGZ A;  1D5M C;  2VZK D;  4RFB A;  3P4S B;  2IJ0 A;  5H92 C;  1C78 A;  1YN4 A;  2LMC A;  2LFI A;  5EE1 A;  1QLB B;  1CZP A;  2ICI A;  4PT5 A;  3U7Z A;  1CQV A;  3AEB B;  1N60 A;  2KWD A;  1XCT L;  1L4D B;  3U52 E;  1RYJ A;  4FXC A;  2FE8 A;  1EM7 A;  2E3T A;  4GDK B;  2L52 A;  4R3D A;  4C7Z A;  3MC0 B;  3AEF B;  3EGR A;  1QOF A;  1F2R C;  3P42 A;  2SAK A;  2VZK B;  1WWT A;  1ZP0 B;  4N6E B;  1ZE3 D;  1DOX A;  4MM3 B;  1J7A A;  4WH4 A;  4RGT A;  2XN9 C;  1K52 A;  4LLG M;  2PLP A;  1I4H A;  3MJ5 A;  1DGJ A;  1P7F A;  3TEW A;  5FK9 C;  1I4X A;  1D5Z C;  1DOI A;  4RGO S;  5D3D A;  2BW2 A;  2WXQ A;  4A6Q A;  3BK1 A;  1QOG A;  4L1B A;  2BTE A;  1EU3 A;  3R2I A;  4C7Y A;  2WDR B;  2WDQ B;  1L6U A;  1PGA A;  1AYF A;  4RGN A;  2JQR B;  2LEK A;  4B0E A;  2N9L A;  3HUI A;  1MHH E;  1SB3 C;  1UUP A;  2QIL A;  3URY A;  4EE2 A;  3BWU D;  1TS2 A;  2J52 A;  3VRB B;  2J42 A;  4YT0 B;  2PTL A;  2WXJ A;  4JWS C;  1L6V A;  1TY0 A;  4OW0 A;  2W3R A;  1ZDV A;  5AUK A;  4KKJ A;  1UGJ A;  2I2Y A;  3BII D;  2K9X A;  3VQI A;  1LO5 D;  2QIE B;  4J3O D;  1XLO A;  1L5P A;  3BVM A;  2ZW1 A;  2WU5 B;  3NZ3 A;  1FNU A;  4WAF A;  4YSX B;  3T3O A;  4RNA A;  1T6B X;  1CK1 A;  2WXG A;  2MEK A;  1OFF A;  2MJD A;  3O13 A;  1XO3 A;  1HEZ E;  1L0X B;  2N7J A;  1QOB A;  1UWM A;  2J53 A;  2INN E;  2V4I B;  3KQ4 A;  1HXY D;  4IDI A;  3P4P B;  2LGI A;  4Q2J A;  4RF1 A;  5MPO A;  2D5G A;  3AH7 A;  3AV8 A;  1NEK B;  2I38 A;  3AEG B;  3PO0 A;  2FBW B;  2OHF A;  1D5X C;  1C77 A;  1ZXI A;  1MI0 A;  1VRA B;  3Q8B A;  2YEP F;  1JWS D;  1JML A;  2WXR A;  2SEB D;  1E7P B;  3V05 A;  1V8C A;  2QSD A;  3AN1 A;  1N61 A;  4KGS A;  1YJI A;  2V0G A;  1YQ4 B;  3ZJU A;  5GXG B;  3LB8 C;  3OWE B;  4IOI E;  4NAW B;  2PKO A;  2ON8 A;  1P7E A;  1OQR A;  2JX5 A;  2WXF A;  4HKQ A;  1XLN A;  1AN8 A;  3W5U B;  1JWM D;  2AX5 A;  1KFY B;  4KX6 B;  4YWG G;  3BK2 A;  2OED A;  5EE9 A;  2L1A A;  1BXT A;  1VR9 A;  4L23 A;  4XWW A;  4AQ7 A;  1E0Z A;  1I4P A;  2WXL A;  1RFK A;  4RCO A;  1ZUD 2;  1KRH A;  3FIL B;  2NMQ A;  1FEH A;  2WXK A;  1FXI A;  3SFD B;  3AE5 B;  2QJL A;  2WXH A;  2KAC A;  1WYG A;  1GPX A;  1C4A A;  1MHX A;  2JU6 X;  4HKZ E;  2YEP B;  2Y3A A;  1MPE A;  3GP7 A;  5C3J B;  4USA A;  4AS1 A;  2WLB A;  2X38 A;  2V3N A;  3AEC B;  2ACZ B;  1E6E B;  3H8H A;  5I4D A;  1JRP A;  1SE3 A;  2KAJ A;  2K22 A;  4XWT A;  1V1O A;  2DYO A;  1R7S A;  3AE7 B;  4YSY B;  2LHD A;  4MAC A;  4MT5 A;  4TQ0 A;  4HRS A;  2JYE A;  2KDM A;  4JWU C;  1DOY A;  3AE8 B;  1YMH E;  4US9 A;  4KGR A;  1C76 A;  1YQ3 B;  1YN5 A;  2EEL A;  5H8Y E;  3B2G A;  2DYM A;  2KQ4 X;  4HJG E;  2BS4 B;  1QT9 A;  1SF0 A;  5D7G A;  1I4R A;  2WNM A;  4P16 A;  1YJJ A;  1ZPS A;  1FRD A;  4O1N A;  3TSS A;  4A8X C;  1VDV A;  2EKI A;  1TS3 A;  2KN4 A;  4ZOH C;  1EWC A;  1C4P A;  2BS2 B;  3HVZ A;  4OZB A;  2W54 A;  3VR8 B;  2HTM E;  1HQR D;  1SIJ A;  3B2F A;  2BB5 A;  2TSS A;  1KLU D;  2BS3 B;  3R2T A;  2L32 A;  3AE6 B;  3AE4 B;  4JX1 C;  1SSN A;  1BUI C;  3MHZ A;  1K50 A;  3Q8E A;  1T3Q A;  3W5V B;  3TEZ A;  1F2R I;  1MVK A;  3E9S A;  1HZ5 A;  4HEA 1;  2MH7 A;  1FRR A;  2MJE A;  1CJE A;  1I4G A;  4YXD B;  4ZRQ A;  2INP E;  4DXG A;  1GAQ B;  2KMM A;  4REZ A;  1TS5 A;  4LTU A;  4WQM A;  4ARC A;  1J7B A;  2ONQ A;  3ABV B;  1UWX A;  2L83 A;  2RPV A;  3IXS A;  3RPF C;  3Q8F A;  2WQY B;  4WWM A;  3IAS 1;  5BMG A;  1F0Z A;  1XLQ A;  4TSS A;  2FUG 1;  1STE A;  1JAL A;  2Z8L A;  3HRD D;  3L4P A;  3AE3 B;  3DWM A;  1ET6 A;  5G5H A;  5G5G A;  4XDC A;  1JWB D;  2CJO A;  3NVW A;  1ET9 A;  3U4E G;  3C8Y A;  5HHD G;  5HFY A;  2GRI A;  4M0W A;  1UNS A;  2WXO A;  1SBB B;  2PVG C;  5E6J A;  2PIA A;  3P4R B;  1VZ8 A;  3SFE B;  5BYS A;  4D2K A;  3EA6 A;  1GOZ A;  2MJ3 A;  1V97 A;  1BML C;  1TY2 A;  3LYY A;  1QKZ A;  3BYY B;  1RWS A;  1OQQ A;  2QEJ C;  2QMT A;  1WXQ A;  2CJN A;  2IGD A;  3AMZ A;  1HZ6 A;  1C79 A;  4IKG A;  2JSV X; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...