5CHWA

Structure of isg15 in space group p212121
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
154
structure length
154
Chain Sequence
b'AWDLKVKMLGGNDFLVSVTNSMTVSELKKQIAQKIGVPAFQQRLAHQTAVLQDGLTLSSLGLGPSSTVMLVVQNSSEPLSILVRNERGHSNIYEVFLTQTVDTLKKKVSQREQVHEDQFWLSFEGRPMEDKELLGEYGLKPQCTVIKHLRLRGG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ubiquitin-like protein ISG15
publication title Structure of ISG15 in space group P212121
rcsb
source organism Mus musculus
molecule tags Signaling protein
total genus 37
structure length 154
sequence length 154
chains with identical sequence B, C, D, E, F, G, H, I, J
ec nomenclature
pdb deposition date 2015-07-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00240 ubiquitin Ubiquitin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 5chwA02
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 5chwA01
1M94A 2WYQA 3OAWA 1WY8A 1J0GA 4BFRA 3PT2B 1WR1A 4WWNA 3A9KB 1QZEA 2JRIB 3SHQA 3NZUA 2ZPYA 3MHSD 3CSTA 4TUUA 4HVBA 2DX5B 2QHOA 1Z2MA 2JPHA 2LZ6A 3AU4A 3DBLI 2LVQA 2KFKB 4GDLA 3P2BA 4KVGB 2IO3B 1J19A 2MLBA 3H7PA 2KWUB 2FNJB 1E8ZA 5G55A 4E71A 3HM6X 4EFOA 1C3TA 1P1AA 2CR5A 3QJZA 5TR5A 2Z0DB 4FHKA 4MELA 5KHQA 2KC2A 2D10A 1XD3B 3DPDA 4B6WA 3NZSA 1XQQA 2ZPNA 4YL8A 2JY6A 1WX7A 2LXAA 3PRMB 3TCAA 2BWES 2MCNB 2Y5BB 1E5WA 3CF6E 4WJNA 2JT4B 4PYUA 2LI5A 4EZJA 2BF8B 2IO0B 4A3PA 4DWFA 2O6VB 4WQOB 3VQIA 4GSWA 3OJ4B 3TIXA 2JRHA 2DAFA 2KK8A 5DPWA 4FJYA 4IG7B 4IWOA 1V49A 1E90A 1TGZB 1OTRB 1WH3A 4HXDA 3VDZA 3NY5A 4BOZB 4WJQA 2C7HA 1F9JA 1C1YB 2WX0A 1G6JA 1EF1A 3VVWB 3KW5B 5C23A 4DK5A 1RLFA 3L54A 3H7SA 3KVFB 1Q0WB 2XBBC 1EO6A 3WALA 3GZNI 4K7WA 3QCAA 5G2NA 1YIWA 2CHWA 2K25A 2NBUA 3V6EB 4TQ0A 3UQBA 3B0AA 2YLMA 4II2B 1S3SG 1SE9A 3QIJA 4FN2A 4EOYA 5IA7A 3JVZX 2D07B 2L00B 5J2RA 3A4RA 2N1WA 2JF5A 1PQSA 2RD0A 3HHMA 4B95A 1WJ6A 2KDEB 3KUDB 2K8CA 4HPMB 1LFDA 3PZDA 4XZ4A 3JSVB 1WFYA 4DXAB 2MBQA 3KYCD 4W9EA 2GBKA 2IO2B 3WAPA 2V4LA 4HLEA 3PHWB 1GG3A 2N7DA 2N9PC 2KLGA 3DVNU 5E6NA 2C60A 4TV3A 4ICUA 4AJYB 2Z0EB 1BT0A 1Q1OA 3V60A 3ZO5B 3DCGA 4MDKE 1V86A 2KO3A 4AJWA 4W9CA 1R4MI 3V6CB 3Q3JA 4KIKB 4BKSD 2BYVE 4DBGA 3PS6A 4KDIC 4BBNF 1MG8A 5J17A 2O2VA 3ENEA 4B9KA 1YD8U 3DBRI 3PRPB 4EEWA 1I42A 4KSKC 4NQLB 3VUYA 2GMIC 2MW5A 2NR2A 1V6EA 2XK5A 3N3KB 4M8MA 3RZWC 4URKA 1XT9B 2KZRA 4NJ7A 4W9GA 3IG3A 2KFJA 4W9KA 4HK2A 1I35A 2GOWA 2L0TA 2J7QB 2UYZB 1TBEA 1NI2A 2M0XA 4GIVA 4NJ6A 2AYOB 3S2AA 4TQ1A 2KD0A 2C5LC 3PREA 4KDLB 3VH4B 3OLMD 5D2MB 5AZHA 2NBVB 3ZIMA 2DZIA 3TBLD 2KDIA 3VHTC 1H4RA 1T0YA 2KX0A 2NPTB 2C9WB 4ASWC 2C7MB 2LRUA 2N1VA 3X23A 1V2YA 2KTFA 2LJ5A 2L7RA 3ZNZB 3RZFA 3R3MA 2I1KA 3ZDTA 3JYUA 2AEHA 2CHZA 3ML9A 3B08A 1WZ0A 2DYBA 1V80A 2DYMA 1GC7A 4RM8A 2HD5B 5JHAA 3DVGY 1LXDA 4EZKA 1VD2A 2KJ6A 3VTWA 3VTUA 3VXWA 2NS5A 3DVGX 1WE7A 3M62B 4FA6A 2KNBA 2KDFB 5FR6A 2GBRA 3IBEA 4KZ0A 1E8XA 3AULA 4M0WB 2PE9A 1E8YA 1HE8A 1P3QU 3ZNID 1RAXA 2CKHB 2DZKA 4NY0A 1EF5A 3RUIB 3C0RB 3WAOA 4MGYE 3PLUA 4MM3A 3ALBA 1V5TA 1WM2A 2K8HA 3QX1A 2FAZA 3RCZA 4GOCA 4GDLB 4HWIB 4WWPA 1WXSA 4DHJB 4I6PA 3A9JA 3ONSA 4EKUA 3H7PB 4HDOA 3PPAA 3M63B 1UH6A 3V62A 1YJ1A 3LDZE 1V81A 2LVOA 4AOFA 4BVUC 3UIPB 1OQYA 2KHWB 3U8ZA 4E74A 2BWFA 1WE6A 3ZRFA 3ZVVA 4TKNA 2ZJDA 1R4NI 4K7UA 1X1MA 2LASA 1YX5B 4KZCA 1WXMA 2IO1B 3M3JA 4K7SA 4LDTB 3A4SC 4BKGA 1KLVA 1FXTB 2KANA 4JLCA 1WJNA 3ZUNA 3UF8A 3TL5A 3KUCB 4LJPB 3H9DA 1GJZA 4ZDVA 3DBSA 3WA0A 4IM0A 2O6VD 5GMVA 3OJ3A 3IHPC 2LRWA 2CU1A 1YX6B 2JWZA 4HJKA 2KC1A 2EMTA 4IC7B 2KVRA 4LJOB 2RGFA 4P7IA 3KH0A 2AL6A 2ZZPB 2MQJA 3RYTA 3SD5A 2BGFA 3AU5A 3RULA 1LQBA 1WI0A 1GC6A 2LVPA 2KLCA 4KV2A 4GDKA 3CMMB 1V9JA 3PRZA 1RRBA 2BKRB 2MSED 3T9LA 2FCMA 1WJ4A 4G3XB 4W9FA 4G0NB 2ZCCA 4GN1A 2N9EB 3WIMA 1LM8B 3BY4B 2KXJA 5LXIB 1H8CA 4A20A 2L8JA 3VUXA 1YQBA 3ZTDA 3H6NA 2MP2A 4AWJA 2G45B 2G4SA 2ASQA 4WAAA 5LLIA 3QAQA 5DPRA 3EC8A 4EZLA 4N9F4 5EDSA 2LWPA 3DBHI 3K9OB 1NDDA 1TZ1A 2BPSA 3VAWA 1P98A 4AUQC 1WYWB 4FHJA 5JH5C 1UD7A 2HE7A 2KTRA 2MA9B 3UGBB 2HJ8A 4W9HA 3A1QA 4I6LB 4X57B 2VRRB 2D2QA 3HK0A 4MGZE 5J18A 2J0KA 5AEKB 2W9NA 4NNJB 2I1JA 2IY0B 4F8CB 4ZRJA 4F7ZA 2EKEC 4ANWA 1WMHA 4HCNB 5CTRC 4II3B 4W9IA 1WX8A 3PSEB 3PV1A 4MSQB 2PEAA 4PS3A 2NCNA 3A1QB 2V3SA 4MGIE 3EHVA 3SDLC 5DCNA 2O2VB 2DAJA 3SU8X 3L10B 1WR6E 4MJSA 4NAWA 3ZTCA 1P9DU 4W9DA 2DENB 4EUTA 1WF9A 5CHWA 2XK5B 3KUZA 1WX9A 3DDCB 2L0FA 3ZKJC 2AWTA 2AL3A 1L2NA 4A3OA 5DPTA 4BKTA 2M4NA 3MJWA 4IWPA 4MSMB 2UWQA 3DVNV 1AARA 3AXCA 5HKHA 3IFWB 1VCBA 4AP4C 3D32A 3V61A 2BYEA 3UQAA 4DHZE 4OVVA 1A5RA 3EECA 3PTFC 2MWSB 1E8WA 1OEYJ 4IWQA 1SGHA 4GMVA 4LCDE 4MJSB 4NAWB 2JZZA 5CX3A 3RT3B 4ZRIA 2KWCA 3ZLZA 4IM3A 2N9XA 3ZNGC 4HPLB 3Q3FA 2B3AA 3BINA 3K9PB 2FIDA 2DZMA 4GGQA 1ZW7A 3APDA 4W9JA 1WGDA 4GXBA 2ZNVC 2KX3A 5L95C 2R2OA 3DQVA 3R7RA 1WXVA 1WIAA 2KOXA 1OEYA 3A9KA 2BKFA 3NS8A 1ISNA 3PHXB 4G50A 3RD2A 1EUVB 2KN5A 3GOEA 2BYFA 2G4DB 2LGDA 2M8SA 4OVUA 1P0RA 2LUEA 1GNUA 2KFKA 2ZCBA 4E3CA 3R7QA 2K8BA 1WXAA 2K39A 3NOBA 3H1UA 4MGKE 4WJPA 3L13A 3HIZA 2ZVOA 1Y8RC 2KDBA 4JL9A 4K1RB 2C7NB 3AI5A 3W1SC 4KSLC 5DPSA 3ZW3A 4XC2A 4ANXA 4NQKE 2G3QB 3B1LX 4JGHB 1RFAA 2PJHA 2MBEA 1WZ3A 4G11A 2HTHA 2D3GA 3PVLA 5IAAC 2KQ7A 2WDTB 5C1ZA 5JZEB 1K8RB 2JXXA 2GBJA 2MRPA 4CHKA 2O6VA 4F1SA 2YVCA 4BBNC 3VFKA 4DHZB 2IZVB 2WX1A 2L76A 2R2QA 3A9JB 4GU2A 4CO7A 4DHJD 3QARA 4FBJB 3WAMA 3APCA 1WGGA 2LXCA 3WANA 5CHFA 2OOBB 1OGWA 1CMXB 2GBMA 1UBQA 2IBIB 4RM9A 1E7UA 3QK0A 2Z59B 2EMSA 3W1YA 3O65B 5KHOA 3U7DA 3R66C 1ZKHA 2RPQA 3I3TB 4IUMB 3TMPB 1WGYA 2CHXA 1WM3A 2FCNA 2KWVB 4LDTD 2MX2A 5BO4B 2RSUA 4MEMA 1IYFA 1IPGA 3LJ3A 1NBFC 2JVCA 5E6PA 2MBOA 1WJUA 1IP9A 2DHZA 2A5UA 3TJPA 1UBIA 1WGRA 2KMAA 4WWOA 1J8CA 3CSFA 2N7EA 5D7GA 4HDQA 4BKSA 3JSVA 3PGEA 3ZNHB 4IM2A 1U4AA 1UELA 2IY1B 2ZNVB 4GDKB 1L7YA 3L08A 5JHBA 3ZRCA 3W1SA 3M95A 5LXHA 2DZJA 2FUHB 1KJTA 2KMCA 3QC8B 2K1FA 1UGMA 4M8NA 5D6JB 3L16A 2LGYA 3QA8A 3X0WA 2MP2B 2V1YA 4KIKA 1D3ZA 3HM3A 2MBHA 1S1QB 2NBWB 1ZGUB 5D94A 4ZRKA 3T8MA 4JIOU 3QWZB 4FLHA 2IYDB 4FJVB 2WWZA 1Q5WB 5AZGA 1KM7A 2FCQA 2GBNA 1SIFA 4ZYNA 3U30A 2DYOA 5CHVC 2L3ZA 2M1MA 2OJRA 2KTRB 4PS7A 2J0JA 2JZ3B 2FCSA 3UINB 2LGXA 4ANVA 4K81A 4DDGD 1UZXB 5L83A 2N4FA 1V5OA 1WRDB 4RMAA 2ZEQA 3N30A 3N32A 3QHTA 3VH3B 1WMHB 4W9LA 2RR9A 2KKCA 2D11A 4PYZA 3APFA 5AZFA 3ZDMC 2MBBB 4HCPB 2JUOA 3ECIA 3ML8A 4CYEA 3UIOB 4J6IA 2M17A 1TTNA 2REXA 1WGHA 2ZVNA 2NPTA 4FULA 1E7VA 4JQWC 4FADA 2PE6B 1JRUA 2A4ZA 3MTNB 2XEWA 3NHEB 3VUWA 4GB9A 2PPHA 3KYDD 2NVUI 4PS8A 4DDID 2LD9A 4I6NB 4FJZA 3L0WB 4ANUA 2CS4A 3JW0X 2K6QA 3L17A 2KJRA 4ICVA 4NPNA 3VTVA 3EFUA 4WJOA 2K6DB 4IW0A 4MH0E 1KOTA 3QQ8B 5E6OA 3IVFA 3PLVA 1GUAB 3DOWA 1Z5SB 2FIFA 2J0MA 2KJHB 2KQSA 3A33B 2L05A 4XX5A 4BOSC
chains in the Genus database with same CATH superfamily
1JWMD 2WS3B 1TYGB 4BFRA 3PT2B 1QZEA 4LNNA 3SHQA 3MHSD 1KLGD 4TUUA 1TS2A 2KFKB 1QLBB 1V1PA 3P2BA 4KVGB 1NEKB 1MG4A 3ETRA 4XGAB 4EFOA 1P1AA 3QJZA 2JXTA 3I57A 2Y5PA 2Z0DB 3I9V1 3MFGA 4FHKA 5KHQA 2D10A 2W82A 1XQQA 3AEBB 4YL8A 2LXAA 2BWES 2MCNB 2Y5BB 3H8HA 2WP9B 2RDHA 2O6VB 4WQOB 1WSPA 3VQIA 1UWXA 2JRHA 1FFVA 4ZYSA 1V49A 1E90A 4JPSA 3VDZA 3NY5A 4C7YA 1C1YB 3VVWB 4D2KA 1K50A 2XBBC 1EO6A 3AE9B 4K7WA 3UQBA 1DYQA 4II2B 3W9CB 2L00B 2M19A 3HHMA 2WLBA 2BB6A 2KACA 5BMIA 1ROEA 2K8CA 2ZW1A 1WFYA 2IO2B 2K9XA 2N7DA 3DBLB 1Q1OA 3ZO5B 3DCGA 2WU2B 2BYVE 1FXAA 4DBGA 4YSXB 4B9KA 4DQOC 1YD8U 4EEWA 3PRPB 4KSKC 3Q8FA 2GMIC 1VR9A 1SXTA 1V6EA 4M8MA 3RZWC 1XT9B 4NJ7A 1TS3A 1UGJA 3TEZA 2KFJA 3NVZA 4HK2A 4FXCA 2GOWA 1T0SC 2UYZB 1TBEA 4LK0M 2J4XA 3MJ5A 3AN1A 5AZHA 3ZIMA 1FM0D 2DZIA 5EE3A 2C9WB 2C7MB 2N1VA 1OFFA 2KTFA 2LJ5A 4AQ7A 2L7RA 3RZFA 3R3MA 2I1KA 3JYUA 1MHXA 3ZXVA 1RWSA 1V80A 2HD5B 5BYQA 1I4HA 3VTUA 2Q5WD 3VXWA 1C76A 1WE7A 3E9SA 4LNFA 3IBEA 4ZRPA 1AWDA 4YSZB 2DLBA 1RAXA 5C2TB 1C77A 1ZDXA 2FE8A 4MM3A 3QX1A 3SR6A 2PTLA 4WWPA 2LJIA 1WXSA 4DHJB 4I6PA 3ONSA 4HDOA 1C4PA 4M00A 1UH6A 4AOFA 2IGDA 1OQYA 1WE6A 2IDYA 1X1MA 1MVKA 1TJEA 2IO1B 1FEHA 4BKGA 4LDTB 3T3OA 3SFDB 5H8YE 1C79A 3V05A 3WA0A 4IM0A 3OJ3A 3FC4A 1PGBA 3AE5B 4HEA1 3NVWA 3SD5A 1L6VA 2WQYB 3GE8C 2MSED 3V3XA 3T9LA 1WJ4A 4G3XB 3VR9B 1VZ6A 4G0NB 4W9FA 2KXJA 2L8JA 1FIQA 3ZTDA 2QSDA 3H6NA 3N1XC 2MP2A 3W2DA 3QAQA 3EC8A 3ABVB 2RDBC 1F2RI 1P98A 2JYTA 4RGTA 1TKYA 3UGBB 4YTMB 4X57B 2VRRB 3HK0A 3DHGC 2JWUA 2W9NA 2G9HD 4NNJB 2I1JA 4ANWA 4HCNB 5CTRC 4II3B 2WXMA 3PSEB 3PV1A 2PEAA 4Q2JA 2NCNA 3SDLC 5DCNA 2O2VB 3SU8X 4GLSC 3L10B 1WR6E 2L52A 4NAWA 4P1BC 2DENB 1IBXB 2XK5B 1ZE3D 2L0FA 2AL3A 5DPTA 3T3NA 2WGSA 2UWQA 1AARA 3AXCA 1I4XA 5HKHA 1VCBA 4DHZE 4S17A 1XO3A 4ZRQA 5IOIA 3PTFC 1E8WA 1SGHA 4GMVA 2V9HA 4IM3A 1HQRD 2N9XA 1HZ6A 4HPLB 1ZW7A 3APDA 4A8XC 2BQQA 2KX3A 4L2YA 1WXVA 1WIAA 2PIAA 3NS8A 1WXQA 3AEDB 2BYFA 1JWBD 2G4DB 3HVZA 4OVUA 2KFKA 4E3CA 2K39A 2Y5CA 3H1UA 4MGKE 3L13A 3HIZA 3U7ZA 2GB1A 3W1SC 1GB4A 2PJHA 5IN7A 2MBEA 4G11A 4C4VB 3AE6B 2MRPA 2GBJA 2WXNA 1N63A 2O6VA 4F1SA 2YVCA 1SJED 2IZVB 2WX1A 4JE3B 4FBJB 4R3DA 3APCA 1ZOYB 3WANA 2OOBB 2GBMA 2W3SA 1E7UA 2Z59B 2QJLA 4L1BA 5KHOA 3U7DA 3R66C 1VJKA 1ZKHA 3TMPB 2CHXA 3PZ7A 1P7EA 2FCNA 2KWVB 2MX2A 2AX5A 4QAYA 5HG2A 1NBFC 2JVCA 2Z8LA 2D3BA 3N9YC 1UBIA 2KMAA 4WWOA 3CSFA 1OQRA 5D7GA 4HDQA 3ZNHB 1U4AA 3AE1B 3ZRCA 2QIEB 2KMCA 4M8NA 5D6JB 3L16A 2LGYA 3I63C 1D3ZA 1ZGUB 2AQ3B 3MP9A 3QWZB 4NJCA 4FJVB 4ZYNA 1EWYC 2W3RA 2L3ZA 2J0JA 2JZ3B 3DWGC 3UINB 4DDGD 4A90A 1YJIA 2ZEQA 3N32A 3SFEB 4RGMA 3APFA 4WH4A 3UIOB 2WU5B 1CJEA 2REXA 3KLSX 3VUWA 3ZJUA 4GB9A 3KYDD 2J53A 2LD9A 3L0WB 2DNFA 3VRBB 1D5XC 3DWMA 1ZP0B 2KJRA 3ZQ4A 4WJOA 1GAQB 5E6OA 3DBHB 2YEPB 2KQSA 4BOSC 2WYQA 1J0GA 4WWNA 1VZ8A 2JRIB 2ZPYA 4JWSC 1KLUD 2DX5B 2UU7A 3NZ3A 1Z2MA 2LZ6A 2ACZB 4KKJA 2BT6A 2ZW0A 1C3TA 4P1CC 2JX5A 4MELA 2KC2A 1EM7A 3DPDA 4RH6A 1L0YB 2JY6A 1WX7A 1PYWD 3TCAA 1TS4A 3CF6E 2JT4B 2LI5A 4EZJA 2D5GA 2CU3A 3BVMA 3WCQA 3P4RB 1ZXHA 3CIRB 2HTME 1OTRB 2SAKA 4YSYB 2C7HA 3LXFA 3W5UB 1G6JA 3KW5B 3H7SA 1K51A 4C7ZA 5FK9C 5G2NA 3B0AA 2YLMA 3JVZX 2LMCA 2ICIA 3A4RA 3LB8C 2KDEB 4HPMB 2XNAC 1TKEA 2V4LA 2LGSA 2KMMA 2C60A 4ICUA 2JSVX 4AJYB 3V60A 4AJWA 1V86A 2KO3A 4W9CA 4BKSD 2L83A 3Q3JA 4KIKB 4KDIC 5J17A 2WHIA 2O2VA 2VH1A 2MJ3A 3ENEA 3DBRI 2K0PA 1IUEA 4NQLB 1IBXA 2XK5A 3ZJVA 1SSNA 4URKA 1XXGA 4W9GA 3IG3A 4YT0B 1SB3C 2J7QB 1FPYA 2NTSA 2R61A 1NI2A 2M0XA 4NJ6A 3S2AA 1HEZE 3VH4B 3PREA 5D2MB 2NBVB 2KDIA 1QILA 4RF0A 3VHTC 1H4RA 2NPTB 4ARCA 4ASWC 1XF5L 1T6BX 3DHIC 4RNAA 3ZNZB 4LNIA 2CHZA 2M0AA 3B2FA 1WZ0A 1GC7A 3W5VB 1LXDA 1XLNA 2X38A 3VTWA 4L23A 4K3CA 5FR6A 3BVGA 2RPVA 3AULA 1E8YA 1P3QU 2CKHB 4NY0A 4C4VA 1XLPA 3EFCA 3BZDB 1L4ZB 3AEAB 3ALBA 1FCLA 2FAZA 1XCQL 4HWIB 1WRIA 1L6UA 3PPAA 3V62A 3LDZE 4BVUC 4A9AA 2KHWB 1K53A 3ZVVA 4TKNA 2ZJDA 1R4NI 4K7UA 4S0RA 2LUMA 2LASA 3A4SC 3ZUNA 3HUIA 3TL5A 4LJPB 3H9DA 1GJZA 3RNAC 2IPKD 1YX6B 1NYRA 2EMTA 2KVRA 2RGFA 4P7IA 3KH0A 1QF6A 3AU5A 3RULA 1KF6B 1IGDA 3PRZA 1C4AA 2H89B 3U52E 4UDUC 2BB5A 1I4PA 2FCMA 1CZPA 1H8CA 2N9EB 2IGGA 4AWJA 1C9FA 4EZLA 5EDSA 2PKOA 2LWPA 3DBHI 3K9OB 1D5MC 2HJ8A 3A1QA 5H92C 5J18A 2K3UA 3GS2A 2IY0B 4F7ZA 4B0EA 2INPE 2WDQB 4MSQB 3NVVA 4US9A 4PS3A 2DAJA 1F52A 4MJSA 1QOAA 2I2YA 2CJOA 4IWPA 3GE3C 3DVNV 1T5XD 3UQAA 3D32A 1A5RA 2BYEA 3AE2B 4OVVA 2WXHA 1JRPA 1OEYJ 1YMHE 4M02A 3AECB 1LO5D 3BINA 3K9PB 2FIDA 1WGDA 4GXBA 1EU4A 1VZ7A 1KTKA 4N6EB 3C8YA 2BS3B 4G50A 2D3AA 1ISNA 3PHXB 1EUVB 2KN5A 2W54A 2LGDA 2M8SA 2WDRB 2ZCBA 1YQ4B 3OG5A 1PDXA 1Y8RC 2KDBA 2ZVOA 3MC8A 4JL9A 4RGOS 4K1RB 2C7NB 3AI5A 2J52A 4WWMA 5BMGA 1HTQA 4JGHB 3SEBA 1D4BA 2W55A 2D3GA 5IAAC 2KQ7A 3Q8CA 1YN4A 2LFIA 3VR8B 2RMMA 1T3QA 3VFKA 3Q8BA 2INCC 1JWAD 3B2GA 5FR3A 5BMHA 2BS4B 5CHFA 2JU6X 5I4DA 3AE3B 4C56C 1N61A 1CMXB 1QT9A 3R8BA 1V1OA 3W1YA 3O65B 3HRDD 2RPQA 3I3TB 1J7AA 3Q3MC 5BYRA 1FO4A 5BO4B 3RFZB 3FILB 4REZA 1F0ZA 2MBOA 1J7BA 1IP9A 1PFDA 1WGRA 1J8CA 3Q8EA 2N7EA 1YN3A 2QILA 3PGEA 4IM2A 2IY1B 1AN8A 4GDKB 1L7YA 3W1SA 4N58A 3TEWA 1SBBB 4OW0A 4KIKA 2MBHA 1S1QB 2B76B 4XDDA 2WWZA 4LNKA 2RDGA 1KM7A 2GBNA 1YOVB 2KQ4X 2M1MA 2KTRB 3AMZA 3P4PB 4P6VF 1JWSD 1XLQA 1XCTL 2LGXA 1L4DB 5AUIA 2N4FA 1D5ZC 2JYEA 3QHTA 4W9LA 2RR9A 3TUOA 2MBBB 3ZDMC 3ML8A 2M17A 1P7FA 3R2IA 1WGHA 4DXFA 2NPTA 5HFYA 4JQWC 3MTNB 1FD6A 2NVUI 2OEDA 1Y56A 1ESFA 2NTTA 4ANUA 3JW0X 2K6QA 1MJDA 4ICVA 3EFUA 2K6DB 1GB1A 4IW0A 2WXRA 2OHFA 3QQ8B 5LNK1 4CQNA 3IVFA 1GUAB 3DOWA 2J0MA 3AM9A 4KKIA 1WY8A 1PUTA 3A9KB 2IGHA 5D3DA 3KWVA 3CSTA 3IT6B 4HVBA 2QHOA 2BBCA 5HI1A 3DBLI 2LVQA 5G55A 1J19A 2MLBA 5EE0A 2MEKA 3HM6X 2CR5A 3Q3NC 1CQVA 1FFUA 1OQQA 1B1ZA 3EGRA 3Q8AA 1XD3B 1GOZA 4B6WA 3NZSA 1E5WA 3DHHC 4PYUA 2BF8B 3TIXA 3ZXRA 2DAFA 5DPWA 4FJYA 4IWOA 1TGZB 1MHHE 4HXDA 4WJQA 1UNSA 3AV8A 1EF1A 1ET9A 1RLFA 3L54A 3KVFB 2WXPA 3WALA 5IO9A 1YIWA 2CHWA 2NBUA 4H2AA 4TQ0A 4EOYA 1SE9A 3QIJA 4FN2A 2D07B 5J2RA 1RM6C 1SEBD 2N1WA 2N9LA 1LFDA 3PZDA 4XZ4A 4DXAB 2MBQA 3KYCD 4W9EA 1BMLC 3WAPA 4HLEA 3PHWB 1FNVA 3FKYA 2N9PC 1QKZA 5BYSA 2HDEA 3BK1A 3J9CA 1WWTA 4LLGM 4PK1A 1BT0A 2PLPA 4MDKE 1QOBA 1CK1A 1RFKA 2PW9A 3URYA 1MG8A 4A55A 1I42A 3P63A 3VUYA 1STEA 3N3KB 1FNWA 2KZRA 4W9KA 3NJTA 1E7PB 1MI0A 4GIVA 2AYOB 3Q14C 2HJ1A 3IAS1 4TQ1A 2C5LC 1N5WA 3OLMD 4J3OD 2INNE 1T0YA 2YEPF 4PT5A 2AEHA 1V97A 3ML9A 2DBYA 3B08A 2DYBA 1KRHA 2DYMA 3N20C 2FBWB 3DVGY 3E56A 4EZKA 3DVGX 2J42A 2KDFB 2GBRA 4KZ0A 1E8XA 4BZAA 1F77A 3AE7B 1HE8A 2AQ2B 3ZNID 2DZKA 3WAOA 2V0GA 3C0RB 5G5HA 3EA6A 3PLUA 3RCZA 2Y3AA 4GOCA 4GDLB 4EKUA 3H7PB 1ENFA 3NRZA 3M63B 1YJ1A 1K52A 3UIPB 1FNUA 4E74A 4RGNA 1DOYA 2AQ1B 3ZYYX 2KYWA 2GRIA 4KZCA 1HZ5A 1WXMA 1ACCA 2ONQA 3M3JA 2KANA 4JLCA 1WJNA 3UF8A 4HROA 3FILA 3IHPC 2LRWA 2CU1A 2JWZA 2KC1A 2CJNA 4LJOB 2ZZPB 3RYTA 1FRDA 2BGFA 4HRSA 1LQBA 1GC6A 4KV2A 2KLCA 4GDKA 3CMMB 2ZCCA 4GN1A 3WIMA 5LXIB 2GLSA 3BY4B 4A20A 3VUXA 1ZPSA 1YQBA 4NZLB 2G45B 2ASQA 4WAAA 5LLIA 4DXGA 2D3CA 3EUB2 1PGXA 3VAWA 1TZ1A 2BPSA 5JH5C 4FHJA 4ITKA 5AUKA 2HE7A 2QMTA 2KTRA 2MA9B 1QOFA 4OZCA 3NG0A 2J0KA 4KX6B 2ON8A 4F8CB 4ZRJA 1SF0A 2KDMA 2MJDA 4O1NA 4W9IA 1MFWA 1WX8A 3BYTB 3C19A 1YQ3B 2BVCA 3BWUD 1P9DU 2FUG1 2K5PA 3ZJTA 4C80A 3DDCB 2AWTA 4A3OA 4BKTA 4MSMB 1TZOA 1JROA 3V61A 3GZNB 5IKCM 2BS2B 2MWSB 4IWQA 2L32A 3BYYB 4NAWB 4ZRIA 2KWCA 3O13A 3Q2AC 3ZLZA 1VRAB 1R7SA 3Q3FA 1UF0A 1L0VB 2DZMA 1RYJA 1NI3A 3DQVA 1E6EB 3RNBC 3A9KA 2KOXA 5T8IA 1KFYB 2BKFA 1AW7A 1GNUA 4YWGG 2PVGC 3NOBA 1R4MB 4OHJA 3RN9C 5DPSA 2JQRB 4XC2A 4ANXA 2G3QB 4ACFA 3B1LX 1JWUD 3TSSA 4MACA 1WZ3A 3P4SB 2HTHA 3AH7A 3PVLA 2WDTB 5C1ZA 1K8RB 2LEKA 3P1MA 4BBNC 2WXLA 4DHZB 4GU2A 3A9JB 2L76A 4OZBA 1N5XA 4CO7A 3WAMA 1E10A 4XWTA 1UBQA 4RM9A 1SE2A 4M01A 4MH8A 1WGYA 1WM3A 4HKZE 1N62A 1J7CA 2RSUA 4MEMA 1IYFA 1IPGA 4HKQA 4IDIA 1ZUD2 3IT4B 1N60A 3RPFC 2E6XA 4TSSA 1L5PA 3AEGB 3NS1A 1ET6A 2ZNVB 4N59A 3L08A 4HJGE 5JHBA 3M95A 2DZJA 1KJTA 2BYTA 2K1FA 4B0MA 3X0WA 3QA8A 5D94A 2NBWB 4ZRKA 3T8MA 4JIOU 2IYDB 3FAHA 5AZGA 2FCQA 1NYQA 2IJ0A 3U30A 1F1HA 2OJRA 2FCSA 4K81A 1UZXB 5L83A 1V5OA 2QC8A 3N30A 1EWCA 1WMHB 3AB5A 5EE9A 4IOIE 4PYZA 5AZFA 4BAXA 2M56B 4HCPB 2JUOA 3ECIA 4CYEA 4J6IA 2EKIA 3AE8B 4YXDB 2ZVNA 4FADA 2PE6B 1JRUA 2EELA 2L1AA 3NHEB 2V3PA 4PS8A 4FJZA 5C3JB 3P4QB 2PVOD 4LTUA 3AE4B 2MHJA 2LHEA 3R2TA 3VTVA 3PLVA 2FIFA 2KJHB 2L05A 3NVYA 2X8XX 1M94A 3OAWA 1I4RA 1WR1A 3NZUA 2SEBD 2JPHA 3AU4A 4GDLA 4KGTA 4A6QA 2IO3B 3H7PA 4E71A 2KWUB 2FNJB 1E8ZA 1TY2A 5TR5A 3Q3OC 2QEJC 4OZAA 4WAFA 5IP4D 4ZHPA 2ZPNA 2KWDA 3PRMB 4WJNA 1C78A 3PZ8A 2IO0B 4A3PA 4DWFA 4GSWA 1QOGA 3OJ4B 4P16A 1BUIC 2KK8A 3BK2A 4IG7B 4YTNB 1WH3A 3KWLA 4BOZB 2WXIA 1F9JA 2WX0A 4US8A 3RI7C 2VZKD 5C23A 4DK5A 4YTPB 4RCOA 1Q0WB 3GZNI 3QCAA 3AEEB 2K25A 3V6EB 1EU3A 1S3SG 3VRAB 5IA7A 3IXSA 3RNFC 2BW2A 1PQSA 2JF5A 2RD0A 4B95A 1WJ6A 3KUDB 3JSVB 2GBKA 1GG3A 3HVDA 2V3NA 2KLGA 1TT5B 1JCKB 1NVID 3DVNU 5E6NA 4TV3A 1VLBA 2N0SB 2Z0EB 1R4MI 3B9JA 3V6CB 3PS6A 4BBNF 5TSSA 2QCZA 2KVZA 2MW5A 2NR2A 2LHDA 1E0ZA 3NUHB 1A70A 1TKGA 2KN4A 1I35A 2L0TA 2KD0A 4KDLB 1HXYD 1SE4A 3TBLD 1HA5A 1SJHD 2DWQA 2KX0A 2LRUA 3X23A 1V2YA 3RMKC 3U4EG 1T0RC 3ZDTA 1D6EC 2WDVB 4XYCA 2NMQA 3P42A 3ZGZA 1FRRA 4RM8A 5JHAA 1PGAA 1VD2A 2KJ6A 2KAJA 2NS5A 2MH7A 3M62B 4FA6A 2KNBA 4M0WB 2PE9A 3BIID 1EF5A 3RUIB 4MGYE 4K3BA 1GPXA 1IGCA 1V5TA 1WM2A 2K8HA 5FKAC 4ZOHC 1V1PB 4RFBA 3A9JA 3AEFB 3DBRB 1BXTA 1V81A 2LVOA 1I7HA 4AS1A 4MT5A 3U8ZA 2BWFA 3ZRFA 1DOXA 4IKGA 1YX5B 2TSSA 4K7SA 2JZPA 1KLVA 2N7JA 1FXTB 3KUCB 2WXFA 4ZDVA 3DBSA 1V8CA 2O6VD 5GMVA 1YJJA 4HJKA 3OWEB 4IC7B 1WGKA 2AL6A 2MQJA 2K22A 5D3IB 1WI0A 4HPPA 3GB1A 2LVPA 3RNEC 1V9JA 1RRBA 2BKRB 4WQMA 1LM8B 2WXJA 2BTEA 1MPEA 2PMVA 1F2RC 2G4SA 1HTOA 5DPRA 4N9F4 2VH2A 1NDDA 1I4GA 2OJWA 1WYWB 4AUQC 1UD7A 2H88B 1ZDVA 1JMLA 3PO0A 4W9HA 4I6LB 2D2QA 4MGZE 5AEKB 2WXOA 2EKEC 1E9MA 1WMHA 4WIPA 1YNTE 3N1YC 1FCCC 1B9RA 3TEYA 3A1QB 2V3SA 4MGIE 3EHVA 1R4NB 3CWIA 1DGJA 3ZTCA 4W9DA 4EUTA 1WF9A 5CHWA 3KUZA 4XWWA 2XN9C 1WX9A 3ZKJC 1L2NA 1YN5A 2M4NA 3MJWA 2E3TA 1XEEA 3L4PA 3IFWB 4AP4C 3EECA 1ZXIA 4KGRA 4LCDE 3RT3B 4MJSB 5CX3A 2JZZA 4XDCA 2I38A 1JW9D 3ZNGC 1FMAD 3LYYA 2B3AA 4GGQA 1SIJA 4W9JA 2WXQA 5EE1A 2ZNVC 5L95C 2R2OA 2GI9A 2KT7A 3R7RA 2INDC 1N6ZA 3UI3A 1OEYA 3RNGC 3RD2A 1UUPA 3GOEA 1P0RA 2LUEA 3R7QA 2K8BA 1WXAA 4USAA 4WJPA 2N9KA 3N1ZC 4KSLC 2WXGA 3ZW3A 3Q69A 4NQKE 4ARIA 3BVZA 1TS5A 1RFAA 2QDFA 4C00A 4ZHOA 3U2SC 5JZEB 1XLOA 1VDVA 2JXXA 4CHKA 4MM3B 2MJEA 2LGIA 3MHZA 4DHJD 2R2QA 3QARA 1QQRA 1WGGA 2LXCA 2WXKA 3IAM1 1OGWA 2IBIB 3QK0A 2EMSA 2VZKB 4IUMB 1JALA 5JXVA 4LDTD 3MC0B 1JQ4A 2WNMA 2G1EA 3LJ3A 5G5GA 5E6PA 1WJUA 2DHZA 2A5UA 1LGRA 3TJPA 1NENB 1UWMA 4BKSA 3JSVA 3MC9A 4XE0A 1UELA 4NAMA 1KH0A 5LXHA 2FUHB 3QC8B 1SE3A 1UGMA 2MP2B 2V1YA 2V4IB 3HM3A 4FLHA 1T0QC 5E6JA 1Q5WB 1SIFA 5HHDG 2DYOA 5CHVC 4EE2A 4PS7A 1M4VA 1Q10A 3RNCC 3GP7A 4ANVA 4OVZA 1WRDB 4RMAA 3VH3B 4KGSA 1TY0A 2KKCA 2D11A 1TTNA 4FULA 1E7VA 2A4ZA 3Q6BA 1I4QA 2XEWA 1L0XB 4TMAB 2PPHA 4DDID 4WURA 4RF1A 1TIFA 4LNOA 4I6NB 5GXGB 2CS4A 1FXIA 4JWUC 3L17A 4NPNA 1C4CA 3I5JC 3KQ4A 5MPOA 4MH0E 1KOTA 3TEXA 1AYFA 4JX1C 1Z5SB 1WYGA 3A33B 1DOIA 4XX5A 4M0WA
chains in the Genus database with same CATH topology
1M94A 2WYQA 3OAWA 1WY8A 1J0GA 4BFRA 3PT2B 1WR1A 4WWNA 3A9KB 1QZEA 2JRIB 3SHQA 3NZUA 2ZPYA 3MHSD 3CSTA 4TUUA 4HVBA 2DX5B 2QHOA 1Z2MA 2JPHA 2LZ6A 3AU4A 3DBLI 2LVQA 2KFKB 4GDLA 3P2BA 4KVGB 2IO3B 1J19A 2MLBA 3H7PA 2KWUB 2FNJB 1E8ZA 5G55A 4E71A 3HM6X 4EFOA 1C3TA 1P1AA 2CR5A 3QJZA 5TR5A 2Z0DB 4FHKA 4MELA 5KHQA 2KC2A 2D10A 1XD3B 3DPDA 4B6WA 3NZSA 1XQQA 2ZPNA 4YL8A 2JY6A 1WX7A 2LXAA 3PRMB 3TCAA 2BWES 2MCNB 2Y5BB 1E5WA 3CF6E 4WJNA 2JT4B 4PYUA 2LI5A 4EZJA 2BF8B 2IO0B 4A3PA 4DWFA 2O6VB 4WQOB 3VQIA 4GSWA 3OJ4B 3TIXA 2JRHA 2DAFA 2KK8A 5DPWA 4FJYA 4IG7B 4IWOA 1V49A 1E90A 1TGZB 1OTRB 1WH3A 4HXDA 3VDZA 3NY5A 4BOZB 4WJQA 2C7HA 1F9JA 1C1YB 2WX0A 1G6JA 1EF1A 3VVWB 3KW5B 5C23A 4DK5A 1RLFA 3L54A 3H7SA 3KVFB 1Q0WB 2XBBC 1EO6A 3WALA 3GZNI 4K7WA 3QCAA 5G2NA 1YIWA 2CHWA 2K25A 2NBUA 3V6EB 4TQ0A 3UQBA 3B0AA 2YLMA 4II2B 1S3SG 1SE9A 3QIJA 4FN2A 4EOYA 5IA7A 3JVZX 2D07B 2L00B 5J2RA 3A4RA 2N1WA 2JF5A 1PQSA 2RD0A 3HHMA 4B95A 1WJ6A 2KDEB 3KUDB 2K8CA 4HPMB 1LFDA 3PZDA 4XZ4A 3JSVB 1WFYA 4DXAB 2MBQA 3KYCD 4W9EA 2GBKA 2IO2B 3WAPA 2V4LA 4HLEA 3PHWB 1GG3A 2N7DA 2N9PC 2KLGA 3DVNU 5E6NA 2C60A 4TV3A 4ICUA 4AJYB 2Z0EB 1BT0A 1Q1OA 3V60A 3ZO5B 3DCGA 4MDKE 1V86A 2KO3A 4AJWA 4W9CA 1R4MI 3V6CB 3Q3JA 4KIKB 4BKSD 2BYVE 4DBGA 3PS6A 4KDIC 4BBNF 1MG8A 5J17A 2O2VA 3ENEA 4B9KA 1YD8U 3DBRI 3PRPB 4EEWA 1I42A 4KSKC 4NQLB 3VUYA 2GMIC 2MW5A 2NR2A 1V6EA 2XK5A 3N3KB 4M8MA 3RZWC 4URKA 1XT9B 2KZRA 4NJ7A 4W9GA 3IG3A 2KFJA 4W9KA 4HK2A 1I35A 2GOWA 2L0TA 2J7QB 2UYZB 1TBEA 1NI2A 2M0XA 4GIVA 4NJ6A 2AYOB 3S2AA 4TQ1A 2KD0A 2C5LC 3PREA 4KDLB 3VH4B 3OLMD 5D2MB 5AZHA 2NBVB 3ZIMA 2DZIA 3TBLD 2KDIA 3VHTC 1H4RA 1T0YA 2KX0A 2NPTB 2C9WB 4ASWC 2C7MB 2LRUA 2N1VA 3X23A 1V2YA 2KTFA 2LJ5A 2L7RA 3ZNZB 3RZFA 3R3MA 2I1KA 3ZDTA 3JYUA 2AEHA 2CHZA 3ML9A 3B08A 1WZ0A 2DYBA 1V80A 2DYMA 1GC7A 4RM8A 2HD5B 5JHAA 3DVGY 1LXDA 4EZKA 1VD2A 2KJ6A 3VTWA 3VTUA 3VXWA 2NS5A 3DVGX 1WE7A 3M62B 4FA6A 2KNBA 2KDFB 5FR6A 2GBRA 3IBEA 4KZ0A 1E8XA 3AULA 4M0WB 2PE9A 1E8YA 1HE8A 1P3QU 3ZNID 1RAXA 2CKHB 2DZKA 4NY0A 1EF5A 3RUIB 3C0RB 3WAOA 4MGYE 3PLUA 4MM3A 3ALBA 1V5TA 1WM2A 2K8HA 3QX1A 2FAZA 3RCZA 4GOCA 4GDLB 4HWIB 4WWPA 1WXSA 4DHJB 4I6PA 3A9JA 3ONSA 4EKUA 3H7PB 4HDOA 3PPAA 3M63B 1UH6A 3V62A 1YJ1A 3LDZE 1V81A 2LVOA 4AOFA 4BVUC 3UIPB 1OQYA 2KHWB 3U8ZA 4E74A 2BWFA 1WE6A 3ZRFA 3ZVVA 4TKNA 2ZJDA 1R4NI 4K7UA 1X1MA 2LASA 1YX5B 4KZCA 1WXMA 2IO1B 3M3JA 4K7SA 4LDTB 3A4SC 4BKGA 1KLVA 1FXTB 2KANA 4JLCA 1WJNA 3ZUNA 3UF8A 3TL5A 3KUCB 4LJPB 3H9DA 1GJZA 4ZDVA 3DBSA 3WA0A 4IM0A 2O6VD 5GMVA 3OJ3A 3IHPC 2LRWA 2CU1A 1YX6B 2JWZA 4HJKA 2KC1A 2EMTA 4IC7B 2KVRA 4LJOB 2RGFA 4P7IA 3KH0A 2AL6A 2ZZPB 2MQJA 3RYTA 3SD5A 2BGFA 3AU5A 3RULA 1LQBA 1WI0A 1GC6A 2LVPA 2KLCA 4KV2A 4GDKA 3CMMB 1V9JA 3PRZA 1RRBA 2BKRB 2MSED 3T9LA 2FCMA 1WJ4A 4G3XB 4W9FA 4G0NB 2ZCCA 4GN1A 2N9EB 3WIMA 1LM8B 3BY4B 2KXJA 5LXIB 1H8CA 4A20A 2L8JA 3VUXA 1YQBA 3ZTDA 3H6NA 2MP2A 4AWJA 2G45B 2G4SA 2ASQA 4WAAA 5LLIA 3QAQA 5DPRA 3EC8A 4EZLA 4N9F4 5EDSA 2LWPA 3DBHI 3K9OB 1NDDA 1TZ1A 2BPSA 3VAWA 1P98A 4AUQC 1WYWB 4FHJA 5JH5C 1UD7A 2HE7A 2KTRA 2MA9B 3UGBB 2HJ8A 4W9HA 3A1QA 4I6LB 4X57B 2VRRB 2D2QA 3HK0A 4MGZE 5J18A 2J0KA 5AEKB 2W9NA 4NNJB 2I1JA 2IY0B 4F8CB 4ZRJA 4F7ZA 2EKEC 4ANWA 1WMHA 4HCNB 5CTRC 4II3B 4W9IA 1WX8A 3PSEB 3PV1A 4MSQB 2PEAA 4PS3A 2NCNA 3A1QB 2V3SA 4MGIE 3EHVA 3SDLC 5DCNA 2O2VB 2DAJA 3SU8X 3L10B 1WR6E 4MJSA 4NAWA 3ZTCA 1P9DU 4W9DA 2DENB 4EUTA 1WF9A 5CHWA 2XK5B 3KUZA 1WX9A 3DDCB 2L0FA 3ZKJC 2AWTA 2AL3A 1L2NA 4A3OA 5DPTA 4BKTA 2M4NA 3MJWA 4IWPA 4MSMB 2UWQA 3DVNV 1AARA 3AXCA 5HKHA 3IFWB 1VCBA 4AP4C 3D32A 3V61A 2BYEA 3UQAA 4DHZE 4OVVA 1A5RA 3EECA 3PTFC 2MWSB 1E8WA 1OEYJ 4IWQA 1SGHA 4GMVA 4LCDE 4MJSB 4NAWB 2JZZA 5CX3A 3RT3B 4ZRIA 2KWCA 3ZLZA 4IM3A 2N9XA 3ZNGC 4HPLB 3Q3FA 2B3AA 3BINA 3K9PB 2FIDA 2DZMA 4GGQA 1ZW7A 3APDA 4W9JA 1WGDA 4GXBA 2ZNVC 2KX3A 5L95C 2R2OA 3DQVA 3R7RA 1WXVA 1WIAA 2KOXA 1OEYA 3A9KA 2BKFA 3NS8A 1ISNA 3PHXB 4G50A 3RD2A 1EUVB 2KN5A 3GOEA 2BYFA 2G4DB 2LGDA 2M8SA 4OVUA 1P0RA 2LUEA 1GNUA 2KFKA 2ZCBA 4E3CA 3R7QA 2K8BA 1WXAA 2K39A 3NOBA 3H1UA 4MGKE 4WJPA 3L13A 3HIZA 2ZVOA 1Y8RC 2KDBA 4JL9A 4K1RB 2C7NB 3AI5A 3W1SC 4KSLC 5DPSA 3ZW3A 4XC2A 4ANXA 4NQKE 2G3QB 3B1LX 4JGHB 1RFAA 2PJHA 2MBEA 1WZ3A 4G11A 2HTHA 2D3GA 3PVLA 5IAAC 2KQ7A 2WDTB 5C1ZA 5JZEB 1K8RB 2JXXA 2GBJA 2MRPA 4CHKA 2O6VA 4F1SA 2YVCA 4BBNC 3VFKA 4DHZB 2IZVB 2WX1A 2L76A 2R2QA 3A9JB 4GU2A 4CO7A 4DHJD 3QARA 4FBJB 3WAMA 3APCA 1WGGA 2LXCA 3WANA 5CHFA 2OOBB 1OGWA 1CMXB 2GBMA 1UBQA 2IBIB 4RM9A 1E7UA 3QK0A 2Z59B 2EMSA 3W1YA 3O65B 5KHOA 3U7DA 3R66C 1ZKHA 2RPQA 3I3TB 4IUMB 3TMPB 1WGYA 2CHXA 1WM3A 2FCNA 2KWVB 4LDTD 2MX2A 5BO4B 2RSUA 4MEMA 1IYFA 1IPGA 3LJ3A 1NBFC 2JVCA 5E6PA 2MBOA 1WJUA 1IP9A 2DHZA 2A5UA 3TJPA 1UBIA 1WGRA 2KMAA 4WWOA 1J8CA 3CSFA 2N7EA 5D7GA 4HDQA 4BKSA 3JSVA 3PGEA 3ZNHB 4IM2A 1U4AA 1UELA 2IY1B 2ZNVB 4GDKB 1L7YA 3L08A 5JHBA 3ZRCA 3W1SA 3M95A 5LXHA 2DZJA 2FUHB 1KJTA 2KMCA 3QC8B 2K1FA 1UGMA 4M8NA 5D6JB 3L16A 2LGYA 3QA8A 3X0WA 2MP2B 2V1YA 4KIKA 1D3ZA 3HM3A 2MBHA 1S1QB 2NBWB 1ZGUB 5D94A 4ZRKA 3T8MA 4JIOU 3QWZB 4FLHA 2IYDB 4FJVB 2WWZA 1Q5WB 5AZGA 1KM7A 2FCQA 2GBNA 1SIFA 4ZYNA 3U30A 2DYOA 5CHVC 2L3ZA 2M1MA 2OJRA 2KTRB 4PS7A 2J0JA 2JZ3B 2FCSA 3UINB 2LGXA 4ANVA 4K81A 4DDGD 1UZXB 5L83A 2N4FA 1V5OA 1WRDB 4RMAA 2ZEQA 3N30A 3N32A 3QHTA 3VH3B 1WMHB 4W9LA 2RR9A 2KKCA 2D11A 4PYZA 3APFA 5AZFA 3ZDMC 2MBBB 4HCPB 2JUOA 3ECIA 3ML8A 4CYEA 3UIOB 4J6IA 2M17A 1TTNA 2REXA 1WGHA 2ZVNA 2NPTA 4FULA 1E7VA 4JQWC 4FADA 2PE6B 1JRUA 2A4ZA 3MTNB 2XEWA 3NHEB 3VUWA 4GB9A 2PPHA 3KYDD 2NVUI 4PS8A 4DDID 2LD9A 4I6NB 4FJZA 3L0WB 4ANUA 2CS4A 3JW0X 2K6QA 3L17A 2KJRA 4ICVA 4NPNA 3VTVA 3EFUA 4WJOA 2K6DB 4IW0A 4MH0E 1KOTA 3QQ8B 5E6OA 3IVFA 3PLVA 1GUAB 3DOWA 1Z5SB 2FIFA 2J0MA 2KJHB 2KQSA 3A33B 2L05A 4XX5A 4BOSC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1M94 A;  2WYQ A;  3OAW A;  1WY8 A;  1J0G A;  4BFR A;  3PT2 B;  1WR1 A;  4WWN A;  3A9K B;  1QZE A;  2JRI B;  3SHQ A;  3NZU A;  2ZPY A;  3MHS D;  3CST A;  4TUU A;  4HVB A;  2DX5 B;  2QHO A;  1Z2M A;  2JPH A;  2LZ6 A;  3AU4 A;  3DBL I;  2LVQ A;  2KFK B;  4GDL A;  3P2B A;  4KVG B;  2IO3 B;  1J19 A;  2MLB A;  3H7P A;  2KWU B;  2FNJ B;  1E8Z A;  5G55 A;  4E71 A;  3HM6 X;  4EFO A;  1C3T A;  1P1A A;  2CR5 A;  3QJZ A;  5TR5 A;  2Z0D B;  4FHK A;  4MEL A;  5KHQ A;  2KC2 A;  2D10 A;  1XD3 B;  3DPD A;  4B6W A;  3NZS A;  1XQQ A;  2ZPN A;  4YL8 A;  2JY6 A;  1WX7 A;  2LXA A;  3PRM B;  3TCA A;  2BWE S;  2MCN B;  2Y5B B;  1E5W A;  3CF6 E;  4WJN A;  2JT4 B;  4PYU A;  2LI5 A;  4EZJ A;  2BF8 B;  2IO0 B;  4A3P A;  4DWF A;  2O6V B;  4WQO B;  3VQI A;  4GSW A;  3OJ4 B;  3TIX A;  2JRH A;  2DAF A;  2KK8 A;  5DPW A;  4FJY A;  4IG7 B;  4IWO A;  1V49 A;  1E90 A;  1TGZ B;  1OTR B;  1WH3 A;  4HXD A;  3VDZ A;  3NY5 A;  4BOZ B;  4WJQ A;  2C7H A;  1F9J A;  1C1Y B;  2WX0 A;  1G6J A;  1EF1 A;  3VVW B;  3KW5 B;  5C23 A;  4DK5 A;  1RLF A;  3L54 A;  3H7S A;  3KVF B;  1Q0W B;  2XBB C;  1EO6 A;  3WAL A;  3GZN I;  4K7W A;  3QCA A;  5G2N A;  1YIW A;  2CHW A;  2K25 A;  2NBU A;  3V6E B;  4TQ0 A;  3UQB A;  3B0A A;  2YLM A;  4II2 B;  1S3S G;  1SE9 A;  3QIJ A;  4FN2 A;  4EOY A;  5IA7 A;  3JVZ X;  2D07 B;  2L00 B;  5J2R A;  3A4R A;  2N1W A;  2JF5 A;  1PQS A;  2RD0 A;  3HHM A;  4B95 A;  1WJ6 A;  2KDE B;  3KUD B;  2K8C A;  4HPM B;  1LFD A;  3PZD A;  4XZ4 A;  3JSV B;  1WFY A;  4DXA B;  2MBQ A;  3KYC D;  4W9E A;  2GBK A;  2IO2 B;  3WAP A;  2V4L A;  4HLE A;  3PHW B;  1GG3 A;  2N7D A;  2N9P C;  2KLG A;  3DVN U;  5E6N A;  2C60 A;  4TV3 A;  4ICU A;  4AJY B;  2Z0E B;  1BT0 A;  1Q1O A;  3V60 A;  3ZO5 B;  3DCG A;  4MDK E;  1V86 A;  2KO3 A;  4AJW A;  4W9C A;  1R4M I;  3V6C B;  3Q3J A;  4KIK B;  4BKS D;  2BYV E;  4DBG A;  3PS6 A;  4KDI C;  4BBN F;  1MG8 A;  5J17 A;  2O2V A;  3ENE A;  4B9K A;  1YD8 U;  3DBR I;  3PRP B;  4EEW A;  1I42 A;  4KSK C;  4NQL B;  3VUY A;  2GMI C;  2MW5 A;  2NR2 A;  1V6E A;  2XK5 A;  3N3K B;  4M8M A;  3RZW C;  4URK A;  1XT9 B;  2KZR A;  4NJ7 A;  4W9G A;  3IG3 A;  2KFJ A;  4W9K A;  4HK2 A;  1I35 A;  2GOW A;  2L0T A;  2J7Q B;  2UYZ B;  1TBE A;  1NI2 A;  2M0X A;  4GIV A;  4NJ6 A;  2AYO B;  3S2A A;  4TQ1 A;  2KD0 A;  2C5L C;  3PRE A;  4KDL B;  3VH4 B;  3OLM D;  5D2M B;  5AZH A;  2NBV B;  3ZIM A;  2DZI A;  3TBL D;  2KDI A;  3VHT C;  1H4R A;  1T0Y A;  2KX0 A;  2NPT B;  2C9W B;  4ASW C;  2C7M B;  2LRU A;  2N1V A;  3X23 A;  1V2Y A;  2KTF A;  2LJ5 A;  2L7R A;  3ZNZ B;  3RZF A;  3R3M A;  2I1K A;  3ZDT A;  3JYU A;  2AEH A;  2CHZ A;  3ML9 A;  3B08 A;  1WZ0 A;  2DYB A;  1V80 A;  2DYM A;  1GC7 A;  4RM8 A;  2HD5 B;  5JHA A;  3DVG Y;  1LXD A;  4EZK A;  1VD2 A;  2KJ6 A;  3VTW A;  3VTU A;  3VXW A;  2NS5 A;  3DVG X;  1WE7 A;  3M62 B;  4FA6 A;  2KNB A;  2KDF B;  5FR6 A;  2GBR A;  3IBE A;  4KZ0 A;  1E8X A;  3AUL A;  4M0W B;  2PE9 A;  1E8Y A;  1HE8 A;  1P3Q U;  3ZNI D;  1RAX A;  2CKH B;  2DZK A;  4NY0 A;  1EF5 A;  3RUI B;  3C0R B;  3WAO A;  4MGY E;  3PLU A;  4MM3 A;  3ALB A;  1V5T A;  1WM2 A;  2K8H A;  3QX1 A;  2FAZ A;  3RCZ A;  4GOC A;  4GDL B;  4HWI B;  4WWP A;  1WXS A;  4DHJ B;  4I6P A;  3A9J A;  3ONS A;  4EKU A;  3H7P B;  4HDO A;  3PPA A;  3M63 B;  1UH6 A;  3V62 A;  1YJ1 A;  3LDZ E;  1V81 A;  2LVO A;  4AOF A;  4BVU C;  3UIP B;  1OQY A;  2KHW B;  3U8Z A;  4E74 A;  2BWF A;  1WE6 A;  3ZRF A;  3ZVV A;  4TKN A;  2ZJD A;  1R4N I;  4K7U A;  1X1M A;  2LAS A;  1YX5 B;  4KZC A;  1WXM A;  2IO1 B;  3M3J A;  4K7S A;  4LDT B;  3A4S C;  4BKG A;  1KLV A;  1FXT B;  2KAN A;  4JLC A;  1WJN A;  3ZUN A;  3UF8 A;  3TL5 A;  3KUC B;  4LJP B;  3H9D A;  1GJZ A;  4ZDV A;  3DBS A;  3WA0 A;  4IM0 A;  2O6V D;  5GMV A;  3OJ3 A;  3IHP C;  2LRW A;  2CU1 A;  1YX6 B;  2JWZ A;  4HJK A;  2KC1 A;  2EMT A;  4IC7 B;  2KVR A;  4LJO B;  2RGF A;  4P7I A;  3KH0 A;  2AL6 A;  2ZZP B;  2MQJ A;  3RYT A;  3SD5 A;  2BGF A;  3AU5 A;  3RUL A;  1LQB A;  1WI0 A;  1GC6 A;  2LVP A;  2KLC A;  4KV2 A;  4GDK A;  3CMM B;  1V9J A;  3PRZ A;  1RRB A;  2BKR B;  2MSE D;  3T9L A;  2FCM A;  1WJ4 A;  4G3X B;  4W9F A;  4G0N B;  2ZCC A;  4GN1 A;  2N9E B;  3WIM A;  1LM8 B;  3BY4 B;  2KXJ A;  5LXI B;  1H8C A;  4A20 A;  2L8J A;  3VUX A;  1YQB A;  3ZTD A;  3H6N A;  2MP2 A;  4AWJ A;  2G45 B;  2G4S A;  2ASQ A;  4WAA A;  5LLI A;  3QAQ A;  5DPR A;  3EC8 A;  4EZL A;  4N9F 4;  5EDS A;  2LWP A;  3DBH I;  3K9O B;  1NDD A;  1TZ1 A;  2BPS A;  3VAW A;  1P98 A;  4AUQ C;  1WYW B;  4FHJ A;  5JH5 C;  1UD7 A;  2HE7 A;  2KTR A;  2MA9 B;  3UGB B;  2HJ8 A;  4W9H A;  3A1Q A;  4I6L B;  4X57 B;  2VRR B;  2D2Q A;  3HK0 A;  4MGZ E;  5J18 A;  2J0K A;  5AEK B;  2W9N A;  4NNJ B;  2I1J A;  2IY0 B;  4F8C B;  4ZRJ A;  4F7Z A;  2EKE C;  4ANW A;  1WMH A;  4HCN B;  5CTR C;  4II3 B;  4W9I A;  1WX8 A;  3PSE B;  3PV1 A;  4MSQ B;  2PEA A;  4PS3 A;  2NCN A;  3A1Q B;  2V3S A;  4MGI E;  3EHV A;  3SDL C;  5DCN A;  2O2V B;  2DAJ A;  3SU8 X;  3L10 B;  1WR6 E;  4MJS A;  4NAW A;  3ZTC A;  1P9D U;  4W9D A;  2DEN B;  4EUT A;  1WF9 A;  5CHW A;  2XK5 B;  3KUZ A;  1WX9 A;  3DDC B;  2L0F A;  3ZKJ C;  2AWT A;  2AL3 A;  1L2N A;  4A3O A;  5DPT A;  4BKT A;  2M4N A;  3MJW A;  4IWP A;  4MSM B;  2UWQ A;  3DVN V;  1AAR A;  3AXC A;  5HKH A;  3IFW B;  1VCB A;  4AP4 C;  3D32 A;  3V61 A;  2BYE A;  3UQA A;  4DHZ E;  4OVV A;  1A5R A;  3EEC A;  3PTF C;  2MWS B;  1E8W A;  1OEY J;  4IWQ A;  1SGH A;  4GMV A;  4LCD E;  4MJS B;  4NAW B;  2JZZ A;  5CX3 A;  3RT3 B;  4ZRI A;  2KWC A;  3ZLZ A;  4IM3 A;  2N9X A;  3ZNG C;  4HPL B;  3Q3F A;  2B3A A;  3BIN A;  3K9P B;  2FID A;  2DZM A;  4GGQ A;  1ZW7 A;  3APD A;  4W9J A;  1WGD A;  4GXB A;  2ZNV C;  2KX3 A;  5L95 C;  2R2O A;  3DQV A;  3R7R A;  1WXV A;  1WIA A;  2KOX A;  1OEY A;  3A9K A;  2BKF A;  3NS8 A;  1ISN A;  3PHX B;  4G50 A;  3RD2 A;  1EUV B;  2KN5 A;  3GOE A;  2BYF A;  2G4D B;  2LGD A;  2M8S A;  4OVU A;  1P0R A;  2LUE A;  1GNU A;  2KFK A;  2ZCB A;  4E3C A;  3R7Q A;  2K8B A;  1WXA A;  2K39 A;  3NOB A;  3H1U A;  4MGK E;  4WJP A;  3L13 A;  3HIZ A;  2ZVO A;  1Y8R C;  2KDB A;  4JL9 A;  4K1R B;  2C7N B;  3AI5 A;  3W1S C;  4KSL C;  5DPS A;  3ZW3 A;  4XC2 A;  4ANX A;  4NQK E;  2G3Q B;  3B1L X;  4JGH B;  1RFA A;  2PJH A;  2MBE A;  1WZ3 A;  4G11 A;  2HTH A;  2D3G A;  3PVL A;  5IAA C;  2KQ7 A;  2WDT B;  5C1Z A;  5JZE B;  1K8R B;  2JXX A;  2GBJ A;  2MRP A;  4CHK A;  2O6V A;  4F1S A;  2YVC A;  4BBN C;  3VFK A;  4DHZ B;  2IZV B;  2WX1 A;  2L76 A;  2R2Q A;  3A9J B;  4GU2 A;  4CO7 A;  4DHJ D;  3QAR A;  4FBJ B;  3WAM A;  3APC A;  1WGG A;  2LXC A;  3WAN A;  5CHF A;  2OOB B;  1OGW A;  1CMX B;  2GBM A;  1UBQ A;  2IBI B;  4RM9 A;  1E7U A;  3QK0 A;  2Z59 B;  2EMS A;  3W1Y A;  3O65 B;  5KHO A;  3U7D A;  3R66 C;  1ZKH A;  2RPQ A;  3I3T B;  4IUM B;  3TMP B;  1WGY A;  2CHX A;  1WM3 A;  2FCN A;  2KWV B;  4LDT D;  2MX2 A;  5BO4 B;  2RSU A;  4MEM A;  1IYF A;  1IPG A;  3LJ3 A;  1NBF C;  2JVC A;  5E6P A;  2MBO A;  1WJU A;  1IP9 A;  2DHZ A;  2A5U A;  3TJP A;  1UBI A;  1WGR A;  2KMA A;  4WWO A;  1J8C A;  3CSF A;  2N7E A;  5D7G A;  4HDQ A;  4BKS A;  3JSV A;  3PGE A;  3ZNH B;  4IM2 A;  1U4A A;  1UEL A;  2IY1 B;  2ZNV B;  4GDK B;  1L7Y A;  3L08 A;  5JHB A;  3ZRC A;  3W1S A;  3M95 A;  5LXH A;  2DZJ A;  2FUH B;  1KJT A;  2KMC A;  3QC8 B;  2K1F A;  1UGM A;  4M8N A;  5D6J B;  3L16 A;  2LGY A;  3QA8 A;  3X0W A;  2MP2 B;  2V1Y A;  4KIK A;  1D3Z A;  3HM3 A;  2MBH A;  1S1Q B;  2NBW B;  1ZGU B;  5D94 A;  4ZRK A;  3T8M A;  4JIO U;  3QWZ B;  4FLH A;  2IYD B;  4FJV B;  2WWZ A;  1Q5W B;  5AZG A;  1KM7 A;  2FCQ A;  2GBN A;  1SIF A;  4ZYN A;  3U30 A;  2DYO A;  5CHV C;  2L3Z A;  2M1M A;  2OJR A;  2KTR B;  4PS7 A;  2J0J A;  2JZ3 B;  2FCS A;  3UIN B;  2LGX A;  4ANV A;  4K81 A;  4DDG D;  1UZX B;  5L83 A;  2N4F A;  1V5O A;  1WRD B;  4RMA A;  2ZEQ A;  3N30 A;  3N32 A;  3QHT A;  3VH3 B;  1WMH B;  4W9L A;  2RR9 A;  2KKC A;  2D11 A;  4PYZ A;  3APF A;  5AZF A;  3ZDM C;  2MBB B;  4HCP B;  2JUO A;  3ECI A;  3ML8 A;  4CYE A;  3UIO B;  4J6I A;  2M17 A;  1TTN A;  2REX A;  1WGH A;  2ZVN A;  2NPT A;  4FUL A;  1E7V A;  4JQW C;  4FAD A;  2PE6 B;  1JRU A;  2A4Z A;  3MTN B;  2XEW A;  3NHE B;  3VUW A;  4GB9 A;  2PPH A;  3KYD D;  2NVU I;  4PS8 A;  4DDI D;  2LD9 A;  4I6N B;  4FJZ A;  3L0W B;  4ANU A;  2CS4 A;  3JW0 X;  2K6Q A;  3L17 A;  2KJR A;  4ICV A;  4NPN A;  3VTV A;  3EFU A;  4WJO A;  2K6D B;  4IW0 A;  4MH0 E;  1KOT A;  3QQ8 B;  5E6O A;  3IVF A;  3PLV A;  1GUA B;  3DOW A;  1Z5S B;  2FIF A;  2J0M A;  2KJH B;  2KQS A;  3A33 B;  2L05 A;  4XX5 A;  4BOS C; 
#chains in the Genus database with same CATH topology
 1JWM D;  2WS3 B;  1TYG B;  4BFR A;  3PT2 B;  1QZE A;  4LNN A;  3SHQ A;  3MHS D;  1KLG D;  4TUU A;  1TS2 A;  2KFK B;  1QLB B;  1V1P A;  3P2B A;  4KVG B;  1NEK B;  1MG4 A;  3ETR A;  4XGA B;  4EFO A;  1P1A A;  3QJZ A;  2JXT A;  3I57 A;  2Y5P A;  2Z0D B;  3I9V 1;  3MFG A;  4FHK A;  5KHQ A;  2D10 A;  2W82 A;  1XQQ A;  3AEB B;  4YL8 A;  2LXA A;  2BWE S;  2MCN B;  2Y5B B;  3H8H A;  2WP9 B;  2RDH A;  2O6V B;  4WQO B;  1WSP A;  3VQI A;  1UWX A;  2JRH A;  1FFV A;  4ZYS A;  1V49 A;  1E90 A;  4JPS A;  3VDZ A;  3NY5 A;  4C7Y A;  1C1Y B;  3VVW B;  4D2K A;  1K50 A;  2XBB C;  1EO6 A;  3AE9 B;  4K7W A;  3UQB A;  1DYQ A;  4II2 B;  3W9C B;  2L00 B;  2M19 A;  3HHM A;  2WLB A;  2BB6 A;  2KAC A;  5BMI A;  1ROE A;  2K8C A;  2ZW1 A;  1WFY A;  2IO2 B;  2K9X A;  2N7D A;  3DBL B;  1Q1O A;  3ZO5 B;  3DCG A;  2WU2 B;  2BYV E;  1FXA A;  4DBG A;  4YSX B;  4B9K A;  4DQO C;  1YD8 U;  4EEW A;  3PRP B;  4KSK C;  3Q8F A;  2GMI C;  1VR9 A;  1SXT A;  1V6E A;  4M8M A;  3RZW C;  1XT9 B;  4NJ7 A;  1TS3 A;  1UGJ A;  3TEZ A;  2KFJ A;  3NVZ A;  4HK2 A;  4FXC A;  2GOW A;  1T0S C;  2UYZ B;  1TBE A;  4LK0 M;  2J4X A;  3MJ5 A;  3AN1 A;  5AZH A;  3ZIM A;  1FM0 D;  2DZI A;  5EE3 A;  2C9W B;  2C7M B;  2N1V A;  1OFF A;  2KTF A;  2LJ5 A;  4AQ7 A;  2L7R A;  3RZF A;  3R3M A;  2I1K A;  3JYU A;  1MHX A;  3ZXV A;  1RWS A;  1V80 A;  2HD5 B;  5BYQ A;  1I4H A;  3VTU A;  2Q5W D;  3VXW A;  1C76 A;  1WE7 A;  3E9S A;  4LNF A;  3IBE A;  4ZRP A;  1AWD A;  4YSZ B;  2DLB A;  1RAX A;  5C2T B;  1C77 A;  1ZDX A;  2FE8 A;  4MM3 A;  3QX1 A;  3SR6 A;  2PTL A;  4WWP A;  2LJI A;  1WXS A;  4DHJ B;  4I6P A;  3ONS A;  4HDO A;  1C4P A;  4M00 A;  1UH6 A;  4AOF A;  2IGD A;  1OQY A;  1WE6 A;  2IDY A;  1X1M A;  1MVK A;  1TJE A;  2IO1 B;  1FEH A;  4BKG A;  4LDT B;  3T3O A;  3SFD B;  5H8Y E;  1C79 A;  3V05 A;  3WA0 A;  4IM0 A;  3OJ3 A;  3FC4 A;  1PGB A;  3AE5 B;  4HEA 1;  3NVW A;  3SD5 A;  1L6V A;  2WQY B;  3GE8 C;  2MSE D;  3V3X A;  3T9L A;  1WJ4 A;  4G3X B;  3VR9 B;  1VZ6 A;  4G0N B;  4W9F A;  2KXJ A;  2L8J A;  1FIQ A;  3ZTD A;  2QSD A;  3H6N A;  3N1X C;  2MP2 A;  3W2D A;  3QAQ A;  3EC8 A;  3ABV B;  2RDB C;  1F2R I;  1P98 A;  2JYT A;  4RGT A;  1TKY A;  3UGB B;  4YTM B;  4X57 B;  2VRR B;  3HK0 A;  3DHG C;  2JWU A;  2W9N A;  2G9H D;  4NNJ B;  2I1J A;  4ANW A;  4HCN B;  5CTR C;  4II3 B;  2WXM A;  3PSE B;  3PV1 A;  2PEA A;  4Q2J A;  2NCN A;  3SDL C;  5DCN A;  2O2V B;  3SU8 X;  4GLS C;  3L10 B;  1WR6 E;  2L52 A;  4NAW A;  4P1B C;  2DEN B;  1IBX B;  2XK5 B;  1ZE3 D;  2L0F A;  2AL3 A;  5DPT A;  3T3N A;  2WGS A;  2UWQ A;  1AAR A;  3AXC A;  1I4X A;  5HKH A;  1VCB A;  4DHZ E;  4S17 A;  1XO3 A;  4ZRQ A;  5IOI A;  3PTF C;  1E8W A;  1SGH A;  4GMV A;  2V9H A;  4IM3 A;  1HQR D;  2N9X A;  1HZ6 A;  4HPL B;  1ZW7 A;  3APD A;  4A8X C;  2BQQ A;  2KX3 A;  4L2Y A;  1WXV A;  1WIA A;  2PIA A;  3NS8 A;  1WXQ A;  3AED B;  2BYF A;  1JWB D;  2G4D B;  3HVZ A;  4OVU A;  2KFK A;  4E3C A;  2K39 A;  2Y5C A;  3H1U A;  4MGK E;  3L13 A;  3HIZ A;  3U7Z A;  2GB1 A;  3W1S C;  1GB4 A;  2PJH A;  5IN7 A;  2MBE A;  4G11 A;  4C4V B;  3AE6 B;  2MRP A;  2GBJ A;  2WXN A;  1N63 A;  2O6V A;  4F1S A;  2YVC A;  1SJE D;  2IZV B;  2WX1 A;  4JE3 B;  4FBJ B;  4R3D A;  3APC A;  1ZOY B;  3WAN A;  2OOB B;  2GBM A;  2W3S A;  1E7U A;  2Z59 B;  2QJL A;  4L1B A;  5KHO A;  3U7D A;  3R66 C;  1VJK A;  1ZKH A;  3TMP B;  2CHX A;  3PZ7 A;  1P7E A;  2FCN A;  2KWV B;  2MX2 A;  2AX5 A;  4QAY A;  5HG2 A;  1NBF C;  2JVC A;  2Z8L A;  2D3B A;  3N9Y C;  1UBI A;  2KMA A;  4WWO A;  3CSF A;  1OQR A;  5D7G A;  4HDQ A;  3ZNH B;  1U4A A;  3AE1 B;  3ZRC A;  2QIE B;  2KMC A;  4M8N A;  5D6J B;  3L16 A;  2LGY A;  3I63 C;  1D3Z A;  1ZGU B;  2AQ3 B;  3MP9 A;  3QWZ B;  4NJC A;  4FJV B;  4ZYN A;  1EWY C;  2W3R A;  2L3Z A;  2J0J A;  2JZ3 B;  3DWG C;  3UIN B;  4DDG D;  4A90 A;  1YJI A;  2ZEQ A;  3N32 A;  3SFE B;  4RGM A;  3APF A;  4WH4 A;  3UIO B;  2WU5 B;  1CJE A;  2REX A;  3KLS X;  3VUW A;  3ZJU A;  4GB9 A;  3KYD D;  2J53 A;  2LD9 A;  3L0W B;  2DNF A;  3VRB B;  1D5X C;  3DWM A;  1ZP0 B;  2KJR A;  3ZQ4 A;  4WJO A;  1GAQ B;  5E6O A;  3DBH B;  2YEP B;  2KQS A;  4BOS C;  2WYQ A;  1J0G A;  4WWN A;  1VZ8 A;  2JRI B;  2ZPY A;  4JWS C;  1KLU D;  2DX5 B;  2UU7 A;  3NZ3 A;  1Z2M A;  2LZ6 A;  2ACZ B;  4KKJ A;  2BT6 A;  2ZW0 A;  1C3T A;  4P1C C;  2JX5 A;  4MEL A;  2KC2 A;  1EM7 A;  3DPD A;  4RH6 A;  1L0Y B;  2JY6 A;  1WX7 A;  1PYW D;  3TCA A;  1TS4 A;  3CF6 E;  2JT4 B;  2LI5 A;  4EZJ A;  2D5G A;  2CU3 A;  3BVM A;  3WCQ A;  3P4R B;  1ZXH A;  3CIR B;  2HTM E;  1OTR B;  2SAK A;  4YSY B;  2C7H A;  3LXF A;  3W5U B;  1G6J A;  3KW5 B;  3H7S A;  1K51 A;  4C7Z A;  5FK9 C;  5G2N A;  3B0A A;  2YLM A;  3JVZ X;  2LMC A;  2ICI A;  3A4R A;  3LB8 C;  2KDE B;  4HPM B;  2XNA C;  1TKE A;  2V4L A;  2LGS A;  2KMM A;  2C60 A;  4ICU A;  2JSV X;  4AJY B;  3V60 A;  4AJW A;  1V86 A;  2KO3 A;  4W9C A;  4BKS D;  2L83 A;  3Q3J A;  4KIK B;  4KDI C;  5J17 A;  2WHI A;  2O2V A;  2VH1 A;  2MJ3 A;  3ENE A;  3DBR I;  2K0P A;  1IUE A;  4NQL B;  1IBX A;  2XK5 A;  3ZJV A;  1SSN A;  4URK A;  1XXG A;  4W9G A;  3IG3 A;  4YT0 B;  1SB3 C;  2J7Q B;  1FPY A;  2NTS A;  2R61 A;  1NI2 A;  2M0X A;  4NJ6 A;  3S2A A;  1HEZ E;  3VH4 B;  3PRE A;  5D2M B;  2NBV B;  2KDI A;  1QIL A;  4RF0 A;  3VHT C;  1H4R A;  2NPT B;  4ARC A;  4ASW C;  1XF5 L;  1T6B X;  3DHI C;  4RNA A;  3ZNZ B;  4LNI A;  2CHZ A;  2M0A A;  3B2F A;  1WZ0 A;  1GC7 A;  3W5V B;  1LXD A;  1XLN A;  2X38 A;  3VTW A;  4L23 A;  4K3C A;  5FR6 A;  3BVG A;  2RPV A;  3AUL A;  1E8Y A;  1P3Q U;  2CKH B;  4NY0 A;  4C4V A;  1XLP A;  3EFC A;  3BZD B;  1L4Z B;  3AEA B;  3ALB A;  1FCL A;  2FAZ A;  1XCQ L;  4HWI B;  1WRI A;  1L6U A;  3PPA A;  3V62 A;  3LDZ E;  4BVU C;  4A9A A;  2KHW B;  1K53 A;  3ZVV A;  4TKN A;  2ZJD A;  1R4N I;  4K7U A;  4S0R A;  2LUM A;  2LAS A;  3A4S C;  3ZUN A;  3HUI A;  3TL5 A;  4LJP B;  3H9D A;  1GJZ A;  3RNA C;  2IPK D;  1YX6 B;  1NYR A;  2EMT A;  2KVR A;  2RGF A;  4P7I A;  3KH0 A;  1QF6 A;  3AU5 A;  3RUL A;  1KF6 B;  1IGD A;  3PRZ A;  1C4A A;  2H89 B;  3U52 E;  4UDU C;  2BB5 A;  1I4P A;  2FCM A;  1CZP A;  1H8C A;  2N9E B;  2IGG A;  4AWJ A;  1C9F A;  4EZL A;  5EDS A;  2PKO A;  2LWP A;  3DBH I;  3K9O B;  1D5M C;  2HJ8 A;  3A1Q A;  5H92 C;  5J18 A;  2K3U A;  3GS2 A;  2IY0 B;  4F7Z A;  4B0E A;  2INP E;  2WDQ B;  4MSQ B;  3NVV A;  4US9 A;  4PS3 A;  2DAJ A;  1F52 A;  4MJS A;  1QOA A;  2I2Y A;  2CJO A;  4IWP A;  3GE3 C;  3DVN V;  1T5X D;  3UQA A;  3D32 A;  1A5R A;  2BYE A;  3AE2 B;  4OVV A;  2WXH A;  1JRP A;  1OEY J;  1YMH E;  4M02 A;  3AEC B;  1LO5 D;  3BIN A;  3K9P B;  2FID A;  1WGD A;  4GXB A;  1EU4 A;  1VZ7 A;  1KTK A;  4N6E B;  3C8Y A;  2BS3 B;  4G50 A;  2D3A A;  1ISN A;  3PHX B;  1EUV B;  2KN5 A;  2W54 A;  2LGD A;  2M8S A;  2WDR B;  2ZCB A;  1YQ4 B;  3OG5 A;  1PDX A;  1Y8R C;  2KDB A;  2ZVO A;  3MC8 A;  4JL9 A;  4RGO S;  4K1R B;  2C7N B;  3AI5 A;  2J52 A;  4WWM A;  5BMG A;  1HTQ A;  4JGH B;  3SEB A;  1D4B A;  2W55 A;  2D3G A;  5IAA C;  2KQ7 A;  3Q8C A;  1YN4 A;  2LFI A;  3VR8 B;  2RMM A;  1T3Q A;  3VFK A;  3Q8B A;  2INC C;  1JWA D;  3B2G A;  5FR3 A;  5BMH A;  2BS4 B;  5CHF A;  2JU6 X;  5I4D A;  3AE3 B;  4C56 C;  1N61 A;  1CMX B;  1QT9 A;  3R8B A;  1V1O A;  3W1Y A;  3O65 B;  3HRD D;  2RPQ A;  3I3T B;  1J7A A;  3Q3M C;  5BYR A;  1FO4 A;  5BO4 B;  3RFZ B;  3FIL B;  4REZ A;  1F0Z A;  2MBO A;  1J7B A;  1IP9 A;  1PFD A;  1WGR A;  1J8C A;  3Q8E A;  2N7E A;  1YN3 A;  2QIL A;  3PGE A;  4IM2 A;  2IY1 B;  1AN8 A;  4GDK B;  1L7Y A;  3W1S A;  4N58 A;  3TEW A;  1SBB B;  4OW0 A;  4KIK A;  2MBH A;  1S1Q B;  2B76 B;  4XDD A;  2WWZ A;  4LNK A;  2RDG A;  1KM7 A;  2GBN A;  1YOV B;  2KQ4 X;  2M1M A;  2KTR B;  3AMZ A;  3P4P B;  4P6V F;  1JWS D;  1XLQ A;  1XCT L;  2LGX A;  1L4D B;  5AUI A;  2N4F A;  1D5Z C;  2JYE A;  3QHT A;  4W9L A;  2RR9 A;  3TUO A;  2MBB B;  3ZDM C;  3ML8 A;  2M17 A;  1P7F A;  3R2I A;  1WGH A;  4DXF A;  2NPT A;  5HFY A;  4JQW C;  3MTN B;  1FD6 A;  2NVU I;  2OED A;  1Y56 A;  1ESF A;  2NTT A;  4ANU A;  3JW0 X;  2K6Q A;  1MJD A;  4ICV A;  3EFU A;  2K6D B;  1GB1 A;  4IW0 A;  2WXR A;  2OHF A;  3QQ8 B;  5LNK 1;  4CQN A;  3IVF A;  1GUA B;  3DOW A;  2J0M A;  3AM9 A;  4KKI A;  1WY8 A;  1PUT A;  3A9K B;  2IGH A;  5D3D A;  3KWV A;  3CST A;  3IT6 B;  4HVB A;  2QHO A;  2BBC A;  5HI1 A;  3DBL I;  2LVQ A;  5G55 A;  1J19 A;  2MLB A;  5EE0 A;  2MEK A;  3HM6 X;  2CR5 A;  3Q3N C;  1CQV A;  1FFU A;  1OQQ A;  1B1Z A;  3EGR A;  3Q8A A;  1XD3 B;  1GOZ A;  4B6W A;  3NZS A;  1E5W A;  3DHH C;  4PYU A;  2BF8 B;  3TIX A;  3ZXR A;  2DAF A;  5DPW A;  4FJY A;  4IWO A;  1TGZ B;  1MHH E;  4HXD A;  4WJQ A;  1UNS A;  3AV8 A;  1EF1 A;  1ET9 A;  1RLF A;  3L54 A;  3KVF B;  2WXP A;  3WAL A;  5IO9 A;  1YIW A;  2CHW A;  2NBU A;  4H2A A;  4TQ0 A;  4EOY A;  1SE9 A;  3QIJ A;  4FN2 A;  2D07 B;  5J2R A;  1RM6 C;  1SEB D;  2N1W A;  2N9L A;  1LFD A;  3PZD A;  4XZ4 A;  4DXA B;  2MBQ A;  3KYC D;  4W9E A;  1BML C;  3WAP A;  4HLE A;  3PHW B;  1FNV A;  3FKY A;  2N9P C;  1QKZ A;  5BYS A;  2HDE A;  3BK1 A;  3J9C A;  1WWT A;  4LLG M;  4PK1 A;  1BT0 A;  2PLP A;  4MDK E;  1QOB A;  1CK1 A;  1RFK A;  2PW9 A;  3URY A;  1MG8 A;  4A55 A;  1I42 A;  3P63 A;  3VUY A;  1STE A;  3N3K B;  1FNW A;  2KZR A;  4W9K A;  3NJT A;  1E7P B;  1MI0 A;  4GIV A;  2AYO B;  3Q14 C;  2HJ1 A;  3IAS 1;  4TQ1 A;  2C5L C;  1N5W A;  3OLM D;  4J3O D;  2INN E;  1T0Y A;  2YEP F;  4PT5 A;  2AEH A;  1V97 A;  3ML9 A;  2DBY A;  3B08 A;  2DYB A;  1KRH A;  2DYM A;  3N20 C;  2FBW B;  3DVG Y;  3E56 A;  4EZK A;  3DVG X;  2J42 A;  2KDF B;  2GBR A;  4KZ0 A;  1E8X A;  4BZA A;  1F77 A;  3AE7 B;  1HE8 A;  2AQ2 B;  3ZNI D;  2DZK A;  3WAO A;  2V0G A;  3C0R B;  5G5H A;  3EA6 A;  3PLU A;  3RCZ A;  2Y3A A;  4GOC A;  4GDL B;  4EKU A;  3H7P B;  1ENF A;  3NRZ A;  3M63 B;  1YJ1 A;  1K52 A;  3UIP B;  1FNU A;  4E74 A;  4RGN A;  1DOY A;  2AQ1 B;  3ZYY X;  2KYW A;  2GRI A;  4KZC A;  1HZ5 A;  1WXM A;  1ACC A;  2ONQ A;  3M3J A;  2KAN A;  4JLC A;  1WJN A;  3UF8 A;  4HRO A;  3FIL A;  3IHP C;  2LRW A;  2CU1 A;  2JWZ A;  2KC1 A;  2CJN A;  4LJO B;  2ZZP B;  3RYT A;  1FRD A;  2BGF A;  4HRS A;  1LQB A;  1GC6 A;  4KV2 A;  2KLC A;  4GDK A;  3CMM B;  2ZCC A;  4GN1 A;  3WIM A;  5LXI B;  2GLS A;  3BY4 B;  4A20 A;  3VUX A;  1ZPS A;  1YQB A;  4NZL B;  2G45 B;  2ASQ A;  4WAA A;  5LLI A;  4DXG A;  2D3C A;  3EUB 2;  1PGX A;  3VAW A;  1TZ1 A;  2BPS A;  5JH5 C;  4FHJ A;  4ITK A;  5AUK A;  2HE7 A;  2QMT A;  2KTR A;  2MA9 B;  1QOF A;  4OZC A;  3NG0 A;  2J0K A;  4KX6 B;  2ON8 A;  4F8C B;  4ZRJ A;  1SF0 A;  2KDM A;  2MJD A;  4O1N A;  4W9I A;  1MFW A;  1WX8 A;  3BYT B;  3C19 A;  1YQ3 B;  2BVC A;  3BWU D;  1P9D U;  2FUG 1;  2K5P A;  3ZJT A;  4C80 A;  3DDC B;  2AWT A;  4A3O A;  4BKT A;  4MSM B;  1TZO A;  1JRO A;  3V61 A;  3GZN B;  5IKC M;  2BS2 B;  2MWS B;  4IWQ A;  2L32 A;  3BYY B;  4NAW B;  4ZRI A;  2KWC A;  3O13 A;  3Q2A C;  3ZLZ A;  1VRA B;  1R7S A;  3Q3F A;  1UF0 A;  1L0V B;  2DZM A;  1RYJ A;  1NI3 A;  3DQV A;  1E6E B;  3RNB C;  3A9K A;  2KOX A;  5T8I A;  1KFY B;  2BKF A;  1AW7 A;  1GNU A;  4YWG G;  2PVG C;  3NOB A;  1R4M B;  4OHJ A;  3RN9 C;  5DPS A;  2JQR B;  4XC2 A;  4ANX A;  2G3Q B;  4ACF A;  3B1L X;  1JWU D;  3TSS A;  4MAC A;  1WZ3 A;  3P4S B;  2HTH A;  3AH7 A;  3PVL A;  2WDT B;  5C1Z A;  1K8R B;  2LEK A;  3P1M A;  4BBN C;  2WXL A;  4DHZ B;  4GU2 A;  3A9J B;  2L76 A;  4OZB A;  1N5X A;  4CO7 A;  3WAM A;  1E10 A;  4XWT A;  1UBQ A;  4RM9 A;  1SE2 A;  4M01 A;  4MH8 A;  1WGY A;  1WM3 A;  4HKZ E;  1N62 A;  1J7C A;  2RSU A;  4MEM A;  1IYF A;  1IPG A;  4HKQ A;  4IDI A;  1ZUD 2;  3IT4 B;  1N60 A;  3RPF C;  2E6X A;  4TSS A;  1L5P A;  3AEG B;  3NS1 A;  1ET6 A;  2ZNV B;  4N59 A;  3L08 A;  4HJG E;  5JHB A;  3M95 A;  2DZJ A;  1KJT A;  2BYT A;  2K1F A;  4B0M A;  3X0W A;  3QA8 A;  5D94 A;  2NBW B;  4ZRK A;  3T8M A;  4JIO U;  2IYD B;  3FAH A;  5AZG A;  2FCQ A;  1NYQ A;  2IJ0 A;  3U30 A;  1F1H A;  2OJR A;  2FCS A;  4K81 A;  1UZX B;  5L83 A;  1V5O A;  2QC8 A;  3N30 A;  1EWC A;  1WMH B;  3AB5 A;  5EE9 A;  4IOI E;  4PYZ A;  5AZF A;  4BAX A;  2M56 B;  4HCP B;  2JUO A;  3ECI A;  4CYE A;  4J6I A;  2EKI A;  3AE8 B;  4YXD B;  2ZVN A;  4FAD A;  2PE6 B;  1JRU A;  2EEL A;  2L1A A;  3NHE B;  2V3P A;  4PS8 A;  4FJZ A;  5C3J B;  3P4Q B;  2PVO D;  4LTU A;  3AE4 B;  2MHJ A;  2LHE A;  3R2T A;  3VTV A;  3PLV A;  2FIF A;  2KJH B;  2L05 A;  3NVY A;  2X8X X;  1M94 A;  3OAW A;  1I4R A;  1WR1 A;  3NZU A;  2SEB D;  2JPH A;  3AU4 A;  4GDL A;  4KGT A;  4A6Q A;  2IO3 B;  3H7P A;  4E71 A;  2KWU B;  2FNJ B;  1E8Z A;  1TY2 A;  5TR5 A;  3Q3O C;  2QEJ C;  4OZA A;  4WAF A;  5IP4 D;  4ZHP A;  2ZPN A;  2KWD A;  3PRM B;  4WJN A;  1C78 A;  3PZ8 A;  2IO0 B;  4A3P A;  4DWF A;  4GSW A;  1QOG A;  3OJ4 B;  4P16 A;  1BUI C;  2KK8 A;  3BK2 A;  4IG7 B;  4YTN B;  1WH3 A;  3KWL A;  4BOZ B;  2WXI A;  1F9J A;  2WX0 A;  4US8 A;  3RI7 C;  2VZK D;  5C23 A;  4DK5 A;  4YTP B;  4RCO A;  1Q0W B;  3GZN I;  3QCA A;  3AEE B;  2K25 A;  3V6E B;  1EU3 A;  1S3S G;  3VRA B;  5IA7 A;  3IXS A;  3RNF C;  2BW2 A;  1PQS A;  2JF5 A;  2RD0 A;  4B95 A;  1WJ6 A;  3KUD B;  3JSV B;  2GBK A;  1GG3 A;  3HVD A;  2V3N A;  2KLG A;  1TT5 B;  1JCK B;  1NVI D;  3DVN U;  5E6N A;  4TV3 A;  1VLB A;  2N0S B;  2Z0E B;  1R4M I;  3B9J A;  3V6C B;  3PS6 A;  4BBN F;  5TSS A;  2QCZ A;  2KVZ A;  2MW5 A;  2NR2 A;  2LHD A;  1E0Z A;  3NUH B;  1A70 A;  1TKG A;  2KN4 A;  1I35 A;  2L0T A;  2KD0 A;  4KDL B;  1HXY D;  1SE4 A;  3TBL D;  1HA5 A;  1SJH D;  2DWQ A;  2KX0 A;  2LRU A;  3X23 A;  1V2Y A;  3RMK C;  3U4E G;  1T0R C;  3ZDT A;  1D6E C;  2WDV B;  4XYC A;  2NMQ A;  3P42 A;  3ZGZ A;  1FRR A;  4RM8 A;  5JHA A;  1PGA A;  1VD2 A;  2KJ6 A;  2KAJ A;  2NS5 A;  2MH7 A;  3M62 B;  4FA6 A;  2KNB A;  4M0W B;  2PE9 A;  3BII D;  1EF5 A;  3RUI B;  4MGY E;  4K3B A;  1GPX A;  1IGC A;  1V5T A;  1WM2 A;  2K8H A;  5FKA C;  4ZOH C;  1V1P B;  4RFB A;  3A9J A;  3AEF B;  3DBR B;  1BXT A;  1V81 A;  2LVO A;  1I7H A;  4AS1 A;  4MT5 A;  3U8Z A;  2BWF A;  3ZRF A;  1DOX A;  4IKG A;  1YX5 B;  2TSS A;  4K7S A;  2JZP A;  1KLV A;  2N7J A;  1FXT B;  3KUC B;  2WXF A;  4ZDV A;  3DBS A;  1V8C A;  2O6V D;  5GMV A;  1YJJ A;  4HJK A;  3OWE B;  4IC7 B;  1WGK A;  2AL6 A;  2MQJ A;  2K22 A;  5D3I B;  1WI0 A;  4HPP A;  3GB1 A;  2LVP A;  3RNE C;  1V9J A;  1RRB A;  2BKR B;  4WQM A;  1LM8 B;  2WXJ A;  2BTE A;  1MPE A;  2PMV A;  1F2R C;  2G4S A;  1HTO A;  5DPR A;  4N9F 4;  2VH2 A;  1NDD A;  1I4G A;  2OJW A;  1WYW B;  4AUQ C;  1UD7 A;  2H88 B;  1ZDV A;  1JML A;  3PO0 A;  4W9H A;  4I6L B;  2D2Q A;  4MGZ E;  5AEK B;  2WXO A;  2EKE C;  1E9M A;  1WMH A;  4WIP A;  1YNT E;  3N1Y C;  1FCC C;  1B9R A;  3TEY A;  3A1Q B;  2V3S A;  4MGI E;  3EHV A;  1R4N B;  3CWI A;  1DGJ A;  3ZTC A;  4W9D A;  4EUT A;  1WF9 A;  5CHW A;  3KUZ A;  4XWW A;  2XN9 C;  1WX9 A;  3ZKJ C;  1L2N A;  1YN5 A;  2M4N A;  3MJW A;  2E3T A;  1XEE A;  3L4P A;  3IFW B;  4AP4 C;  3EEC A;  1ZXI A;  4KGR A;  4LCD E;  3RT3 B;  4MJS B;  5CX3 A;  2JZZ A;  4XDC A;  2I38 A;  1JW9 D;  3ZNG C;  1FMA D;  3LYY A;  2B3A A;  4GGQ A;  1SIJ A;  4W9J A;  2WXQ A;  5EE1 A;  2ZNV C;  5L95 C;  2R2O A;  2GI9 A;  2KT7 A;  3R7R A;  2IND C;  1N6Z A;  3UI3 A;  1OEY A;  3RNG C;  3RD2 A;  1UUP A;  3GOE A;  1P0R A;  2LUE A;  3R7Q A;  2K8B A;  1WXA A;  4USA A;  4WJP A;  2N9K A;  3N1Z C;  4KSL C;  2WXG A;  3ZW3 A;  3Q69 A;  4NQK E;  4ARI A;  3BVZ A;  1TS5 A;  1RFA A;  2QDF A;  4C00 A;  4ZHO A;  3U2S C;  5JZE B;  1XLO A;  1VDV A;  2JXX A;  4CHK A;  4MM3 B;  2MJE A;  2LGI A;  3MHZ A;  4DHJ D;  2R2Q A;  3QAR A;  1QQR A;  1WGG A;  2LXC A;  2WXK A;  3IAM 1;  1OGW A;  2IBI B;  3QK0 A;  2EMS A;  2VZK B;  4IUM B;  1JAL A;  5JXV A;  4LDT D;  3MC0 B;  1JQ4 A;  2WNM A;  2G1E A;  3LJ3 A;  5G5G A;  5E6P A;  1WJU A;  2DHZ A;  2A5U A;  1LGR A;  3TJP A;  1NEN B;  1UWM A;  4BKS A;  3JSV A;  3MC9 A;  4XE0 A;  1UEL A;  4NAM A;  1KH0 A;  5LXH A;  2FUH B;  3QC8 B;  1SE3 A;  1UGM A;  2MP2 B;  2V1Y A;  2V4I B;  3HM3 A;  4FLH A;  1T0Q C;  5E6J A;  1Q5W B;  1SIF A;  5HHD G;  2DYO A;  5CHV C;  4EE2 A;  4PS7 A;  1M4V A;  1Q10 A;  3RNC C;  3GP7 A;  4ANV A;  4OVZ A;  1WRD B;  4RMA A;  3VH3 B;  4KGS A;  1TY0 A;  2KKC A;  2D11 A;  1TTN A;  4FUL A;  1E7V A;  2A4Z A;  3Q6B A;  1I4Q A;  2XEW A;  1L0X B;  4TMA B;  2PPH A;  4DDI D;  4WUR A;  4RF1 A;  1TIF A;  4LNO A;  4I6N B;  5GXG B;  2CS4 A;  1FXI A;  4JWU C;  3L17 A;  4NPN A;  1C4C A;  3I5J C;  3KQ4 A;  5MPO A;  4MH0 E;  1KOT A;  3TEX A;  1AYF A;  4JX1 C;  1Z5S B;  1WYG A;  3A33 B;  1DOI A;  4XX5 A;  4M0W A; 
#chains in the Genus database with same CATH homology
 1M94 A;  2WYQ A;  3OAW A;  1WY8 A;  1J0G A;  4BFR A;  3PT2 B;  1WR1 A;  4WWN A;  3A9K B;  1QZE A;  2JRI B;  3SHQ A;  3NZU A;  2ZPY A;  3MHS D;  3CST A;  4TUU A;  4HVB A;  2DX5 B;  2QHO A;  1Z2M A;  2JPH A;  2LZ6 A;  3AU4 A;  3DBL I;  2LVQ A;  2KFK B;  4GDL A;  3P2B A;  4KVG B;  2IO3 B;  1J19 A;  2MLB A;  3H7P A;  2KWU B;  2FNJ B;  1E8Z A;  5G55 A;  4E71 A;  3HM6 X;  4EFO A;  1C3T A;  1P1A A;  2CR5 A;  3QJZ A;  5TR5 A;  2Z0D B;  4FHK A;  4MEL A;  5KHQ A;  2KC2 A;  2D10 A;  1XD3 B;  3DPD A;  4B6W A;  3NZS A;  1XQQ A;  2ZPN A;  4YL8 A;  2JY6 A;  1WX7 A;  2LXA A;  3PRM B;  3TCA A;  2BWE S;  2MCN B;  2Y5B B;  1E5W A;  3CF6 E;  4WJN A;  2JT4 B;  4PYU A;  2LI5 A;  4EZJ A;  2BF8 B;  2IO0 B;  4A3P A;  4DWF A;  2O6V B;  4WQO B;  3VQI A;  4GSW A;  3OJ4 B;  3TIX A;  2JRH A;  2DAF A;  2KK8 A;  5DPW A;  4FJY A;  4IG7 B;  4IWO A;  1V49 A;  1E90 A;  1TGZ B;  1OTR B;  1WH3 A;  4HXD A;  3VDZ A;  3NY5 A;  4BOZ B;  4WJQ A;  2C7H A;  1F9J A;  1C1Y B;  2WX0 A;  1G6J A;  1EF1 A;  3VVW B;  3KW5 B;  5C23 A;  4DK5 A;  1RLF A;  3L54 A;  3H7S A;  3KVF B;  1Q0W B;  2XBB C;  1EO6 A;  3WAL A;  3GZN I;  4K7W A;  3QCA A;  5G2N A;  1YIW A;  2CHW A;  2K25 A;  2NBU A;  3V6E B;  4TQ0 A;  3UQB A;  3B0A A;  2YLM A;  4II2 B;  1S3S G;  1SE9 A;  3QIJ A;  4FN2 A;  4EOY A;  5IA7 A;  3JVZ X;  2D07 B;  2L00 B;  5J2R A;  3A4R A;  2N1W A;  2JF5 A;  1PQS A;  2RD0 A;  3HHM A;  4B95 A;  1WJ6 A;  2KDE B;  3KUD B;  2K8C A;  4HPM B;  1LFD A;  3PZD A;  4XZ4 A;  3JSV B;  1WFY A;  4DXA B;  2MBQ A;  3KYC D;  4W9E A;  2GBK A;  2IO2 B;  3WAP A;  2V4L A;  4HLE A;  3PHW B;  1GG3 A;  2N7D A;  2N9P C;  2KLG A;  3DVN U;  5E6N A;  2C60 A;  4TV3 A;  4ICU A;  4AJY B;  2Z0E B;  1BT0 A;  1Q1O A;  3V60 A;  3ZO5 B;  3DCG A;  4MDK E;  1V86 A;  2KO3 A;  4AJW A;  4W9C A;  1R4M I;  3V6C B;  3Q3J A;  4KIK B;  4BKS D;  2BYV E;  4DBG A;  3PS6 A;  4KDI C;  4BBN F;  1MG8 A;  5J17 A;  2O2V A;  3ENE A;  4B9K A;  1YD8 U;  3DBR I;  3PRP B;  4EEW A;  1I42 A;  4KSK C;  4NQL B;  3VUY A;  2GMI C;  2MW5 A;  2NR2 A;  1V6E A;  2XK5 A;  3N3K B;  4M8M A;  3RZW C;  4URK A;  1XT9 B;  2KZR A;  4NJ7 A;  4W9G A;  3IG3 A;  2KFJ A;  4W9K A;  4HK2 A;  1I35 A;  2GOW A;  2L0T A;  2J7Q B;  2UYZ B;  1TBE A;  1NI2 A;  2M0X A;  4GIV A;  4NJ6 A;  2AYO B;  3S2A A;  4TQ1 A;  2KD0 A;  2C5L C;  3PRE A;  4KDL B;  3VH4 B;  3OLM D;  5D2M B;  5AZH A;  2NBV B;  3ZIM A;  2DZI A;  3TBL D;  2KDI A;  3VHT C;  1H4R A;  1T0Y A;  2KX0 A;  2NPT B;  2C9W B;  4ASW C;  2C7M B;  2LRU A;  2N1V A;  3X23 A;  1V2Y A;  2KTF A;  2LJ5 A;  2L7R A;  3ZNZ B;  3RZF A;  3R3M A;  2I1K A;  3ZDT A;  3JYU A;  2AEH A;  2CHZ A;  3ML9 A;  3B08 A;  1WZ0 A;  2DYB A;  1V80 A;  2DYM A;  1GC7 A;  4RM8 A;  2HD5 B;  5JHA A;  3DVG Y;  1LXD A;  4EZK A;  1VD2 A;  2KJ6 A;  3VTW A;  3VTU A;  3VXW A;  2NS5 A;  3DVG X;  1WE7 A;  3M62 B;  4FA6 A;  2KNB A;  2KDF B;  5FR6 A;  2GBR A;  3IBE A;  4KZ0 A;  1E8X A;  3AUL A;  4M0W B;  2PE9 A;  1E8Y A;  1HE8 A;  1P3Q U;  3ZNI D;  1RAX A;  2CKH B;  2DZK A;  4NY0 A;  1EF5 A;  3RUI B;  3C0R B;  3WAO A;  4MGY E;  3PLU A;  4MM3 A;  3ALB A;  1V5T A;  1WM2 A;  2K8H A;  3QX1 A;  2FAZ A;  3RCZ A;  4GOC A;  4GDL B;  4HWI B;  4WWP A;  1WXS A;  4DHJ B;  4I6P A;  3A9J A;  3ONS A;  4EKU A;  3H7P B;  4HDO A;  3PPA A;  3M63 B;  1UH6 A;  3V62 A;  1YJ1 A;  3LDZ E;  1V81 A;  2LVO A;  4AOF A;  4BVU C;  3UIP B;  1OQY A;  2KHW B;  3U8Z A;  4E74 A;  2BWF A;  1WE6 A;  3ZRF A;  3ZVV A;  4TKN A;  2ZJD A;  1R4N I;  4K7U A;  1X1M A;  2LAS A;  1YX5 B;  4KZC A;  1WXM A;  2IO1 B;  3M3J A;  4K7S A;  4LDT B;  3A4S C;  4BKG A;  1KLV A;  1FXT B;  2KAN A;  4JLC A;  1WJN A;  3ZUN A;  3UF8 A;  3TL5 A;  3KUC B;  4LJP B;  3H9D A;  1GJZ A;  4ZDV A;  3DBS A;  3WA0 A;  4IM0 A;  2O6V D;  5GMV A;  3OJ3 A;  3IHP C;  2LRW A;  2CU1 A;  1YX6 B;  2JWZ A;  4HJK A;  2KC1 A;  2EMT A;  4IC7 B;  2KVR A;  4LJO B;  2RGF A;  4P7I A;  3KH0 A;  2AL6 A;  2ZZP B;  2MQJ A;  3RYT A;  3SD5 A;  2BGF A;  3AU5 A;  3RUL A;  1LQB A;  1WI0 A;  1GC6 A;  2LVP A;  2KLC A;  4KV2 A;  4GDK A;  3CMM B;  1V9J A;  3PRZ A;  1RRB A;  2BKR B;  2MSE D;  3T9L A;  2FCM A;  1WJ4 A;  4G3X B;  4W9F A;  4G0N B;  2ZCC A;  4GN1 A;  2N9E B;  3WIM A;  1LM8 B;  3BY4 B;  2KXJ A;  5LXI B;  1H8C A;  4A20 A;  2L8J A;  3VUX A;  1YQB A;  3ZTD A;  3H6N A;  2MP2 A;  4AWJ A;  2G45 B;  2G4S A;  2ASQ A;  4WAA A;  5LLI A;  3QAQ A;  5DPR A;  3EC8 A;  4EZL A;  4N9F 4;  5EDS A;  2LWP A;  3DBH I;  3K9O B;  1NDD A;  1TZ1 A;  2BPS A;  3VAW A;  1P98 A;  4AUQ C;  1WYW B;  4FHJ A;  5JH5 C;  1UD7 A;  2HE7 A;  2KTR A;  2MA9 B;  3UGB B;  2HJ8 A;  4W9H A;  3A1Q A;  4I6L B;  4X57 B;  2VRR B;  2D2Q A;  3HK0 A;  4MGZ E;  5J18 A;  2J0K A;  5AEK B;  2W9N A;  4NNJ B;  2I1J A;  2IY0 B;  4F8C B;  4ZRJ A;  4F7Z A;  2EKE C;  4ANW A;  1WMH A;  4HCN B;  5CTR C;  4II3 B;  4W9I A;  1WX8 A;  3PSE B;  3PV1 A;  4MSQ B;  2PEA A;  4PS3 A;  2NCN A;  3A1Q B;  2V3S A;  4MGI E;  3EHV A;  3SDL C;  5DCN A;  2O2V B;  2DAJ A;  3SU8 X;  3L10 B;  1WR6 E;  4MJS A;  4NAW A;  3ZTC A;  1P9D U;  4W9D A;  2DEN B;  4EUT A;  1WF9 A;  5CHW A;  2XK5 B;  3KUZ A;  1WX9 A;  3DDC B;  2L0F A;  3ZKJ C;  2AWT A;  2AL3 A;  1L2N A;  4A3O A;  5DPT A;  4BKT A;  2M4N A;  3MJW A;  4IWP A;  4MSM B;  2UWQ A;  3DVN V;  1AAR A;  3AXC A;  5HKH A;  3IFW B;  1VCB A;  4AP4 C;  3D32 A;  3V61 A;  2BYE A;  3UQA A;  4DHZ E;  4OVV A;  1A5R A;  3EEC A;  3PTF C;  2MWS B;  1E8W A;  1OEY J;  4IWQ A;  1SGH A;  4GMV A;  4LCD E;  4MJS B;  4NAW B;  2JZZ A;  5CX3 A;  3RT3 B;  4ZRI A;  2KWC A;  3ZLZ A;  4IM3 A;  2N9X A;  3ZNG C;  4HPL B;  3Q3F A;  2B3A A;  3BIN A;  3K9P B;  2FID A;  2DZM A;  4GGQ A;  1ZW7 A;  3APD A;  4W9J A;  1WGD A;  4GXB A;  2ZNV C;  2KX3 A;  5L95 C;  2R2O A;  3DQV A;  3R7R A;  1WXV A;  1WIA A;  2KOX A;  1OEY A;  3A9K A;  2BKF A;  3NS8 A;  1ISN A;  3PHX B;  4G50 A;  3RD2 A;  1EUV B;  2KN5 A;  3GOE A;  2BYF A;  2G4D B;  2LGD A;  2M8S A;  4OVU A;  1P0R A;  2LUE A;  1GNU A;  2KFK A;  2ZCB A;  4E3C A;  3R7Q A;  2K8B A;  1WXA A;  2K39 A;  3NOB A;  3H1U A;  4MGK E;  4WJP A;  3L13 A;  3HIZ A;  2ZVO A;  1Y8R C;  2KDB A;  4JL9 A;  4K1R B;  2C7N B;  3AI5 A;  3W1S C;  4KSL C;  5DPS A;  3ZW3 A;  4XC2 A;  4ANX A;  4NQK E;  2G3Q B;  3B1L X;  4JGH B;  1RFA A;  2PJH A;  2MBE A;  1WZ3 A;  4G11 A;  2HTH A;  2D3G A;  3PVL A;  5IAA C;  2KQ7 A;  2WDT B;  5C1Z A;  5JZE B;  1K8R B;  2JXX A;  2GBJ A;  2MRP A;  4CHK A;  2O6V A;  4F1S A;  2YVC A;  4BBN C;  3VFK A;  4DHZ B;  2IZV B;  2WX1 A;  2L76 A;  2R2Q A;  3A9J B;  4GU2 A;  4CO7 A;  4DHJ D;  3QAR A;  4FBJ B;  3WAM A;  3APC A;  1WGG A;  2LXC A;  3WAN A;  5CHF A;  2OOB B;  1OGW A;  1CMX B;  2GBM A;  1UBQ A;  2IBI B;  4RM9 A;  1E7U A;  3QK0 A;  2Z59 B;  2EMS A;  3W1Y A;  3O65 B;  5KHO A;  3U7D A;  3R66 C;  1ZKH A;  2RPQ A;  3I3T B;  4IUM B;  3TMP B;  1WGY A;  2CHX A;  1WM3 A;  2FCN A;  2KWV B;  4LDT D;  2MX2 A;  5BO4 B;  2RSU A;  4MEM A;  1IYF A;  1IPG A;  3LJ3 A;  1NBF C;  2JVC A;  5E6P A;  2MBO A;  1WJU A;  1IP9 A;  2DHZ A;  2A5U A;  3TJP A;  1UBI A;  1WGR A;  2KMA A;  4WWO A;  1J8C A;  3CSF A;  2N7E A;  5D7G A;  4HDQ A;  4BKS A;  3JSV A;  3PGE A;  3ZNH B;  4IM2 A;  1U4A A;  1UEL A;  2IY1 B;  2ZNV B;  4GDK B;  1L7Y A;  3L08 A;  5JHB A;  3ZRC A;  3W1S A;  3M95 A;  5LXH A;  2DZJ A;  2FUH B;  1KJT A;  2KMC A;  3QC8 B;  2K1F A;  1UGM A;  4M8N A;  5D6J B;  3L16 A;  2LGY A;  3QA8 A;  3X0W A;  2MP2 B;  2V1Y A;  4KIK A;  1D3Z A;  3HM3 A;  2MBH A;  1S1Q B;  2NBW B;  1ZGU B;  5D94 A;  4ZRK A;  3T8M A;  4JIO U;  3QWZ B;  4FLH A;  2IYD B;  4FJV B;  2WWZ A;  1Q5W B;  5AZG A;  1KM7 A;  2FCQ A;  2GBN A;  1SIF A;  4ZYN A;  3U30 A;  2DYO A;  5CHV C;  2L3Z A;  2M1M A;  2OJR A;  2KTR B;  4PS7 A;  2J0J A;  2JZ3 B;  2FCS A;  3UIN B;  2LGX A;  4ANV A;  4K81 A;  4DDG D;  1UZX B;  5L83 A;  2N4F A;  1V5O A;  1WRD B;  4RMA A;  2ZEQ A;  3N30 A;  3N32 A;  3QHT A;  3VH3 B;  1WMH B;  4W9L A;  2RR9 A;  2KKC A;  2D11 A;  4PYZ A;  3APF A;  5AZF A;  3ZDM C;  2MBB B;  4HCP B;  2JUO A;  3ECI A;  3ML8 A;  4CYE A;  3UIO B;  4J6I A;  2M17 A;  1TTN A;  2REX A;  1WGH A;  2ZVN A;  2NPT A;  4FUL A;  1E7V A;  4JQW C;  4FAD A;  2PE6 B;  1JRU A;  2A4Z A;  3MTN B;  2XEW A;  3NHE B;  3VUW A;  4GB9 A;  2PPH A;  3KYD D;  2NVU I;  4PS8 A;  4DDI D;  2LD9 A;  4I6N B;  4FJZ A;  3L0W B;  4ANU A;  2CS4 A;  3JW0 X;  2K6Q A;  3L17 A;  2KJR A;  4ICV A;  4NPN A;  3VTV A;  3EFU A;  4WJO A;  2K6D B;  4IW0 A;  4MH0 E;  1KOT A;  3QQ8 B;  5E6O A;  3IVF A;  3PLV A;  1GUA B;  3DOW A;  1Z5S B;  2FIF A;  2J0M A;  2KJH B;  2KQS A;  3A33 B;  2L05 A;  4XX5 A;  4BOS C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...