5CHWA

Structure of isg15 in space group p212121
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
154
structure length
154
Chain Sequence
AWDLKVKMLGGNDFLVSVTNSMTVSELKKQIAQKIGVPAFQQRLAHQTAVLQDGLTLSSLGLGPSSTVMLVVQNSSEPLSILVRNERGHSNIYEVFLTQTVDTLKKKVSQREQVHEDQFWLSFEGRPMEDKELLGEYGLKPQCTVIKHLRLRGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Signaling protein
molecule keywords Ubiquitin-like protein ISG15
publication title Structure of ISG15 in space group P212121
rcsb
source organism Mus musculus
total genus 37
structure length 154
sequence length 154
chains with identical sequence B, C, D, E, F, G, H, I, J
ec nomenclature
pdb deposition date 2015-07-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00240 ubiquitin Ubiquitin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 5chwA02
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 5chwA01
3PGEA 3T8MA 2MP2A 2MCNB 4HVBA 1K8RB 5IAAC 4LJOB 3NS8A 4KV2A 3UQAA 3PTFC 4HPMB 4KDLB 1R4MI 2FCSA 2KQ7A 1EF1A 4N9F4 4E74A 2ZPYA 4M0WB 2O2VB 2CHXA 1EF5A 2KTFA 3NZUA 3AI5A 2J7QB 1TGZB 2J0JA 3PRMB 2MP2B 4GSWA 3DBLI 4IC7B 2KNBA 3VH4B 4GB9A 3L08A 3QC8B 3ZDMC 2DZIA 3ZVVA 4KSKC 4TUUA 4BVUC 1C3TA 1E8YA 1E8ZA 3Q3JA 2PE6B 2AL6A 5D2MB 1V2YA 4LDTB 3VQIA 2YVCA 1T0YA 3UINB 4NAWA 4WQOB 4CO7A 4G0NB 2DYBA 1ZKHA 1AARA 2NBVB 3VDZA 2MBBB 3DOWA 3DQVA 2RGFA 1OTRB 1KJTA 3ZTCA 3OAWA 3IBEA 1E8XA 2IO2B 3IVFA 3ZRFA 3U7DA 4DDGD 2KD0A 1EO6A 4BKTA 5DCNA 3PPAA 3KUDB 3X0WA 3W1SC 4DDID 3VAWA 3KUCB 4IM0A 1YQBA 2ZZPB 3ALBA 3NY5A 3QWZB 2BF8B 4OVVA 5DPTA 3TCAA 2OOBB 2NCNA 3K9PB 2N9PC 4GU2A 4KIKB 4TV3A 5KHQA 2KTRA 3ZNID 1J19A 3KW5B 3PT2B 4IWOA 2KK8A 2BKFA 2JF5A 1NDDA 1RRBA 5LXHA 1D3ZA 3D32A 2KVRA 2Z59B 1XQQA 4EZLA 4K7UA 2N1VA 3L54A 4BOSC 4ZRJA 1WZ0A 5E6PA 4F8CB 4DBGA 3W1YA 2D07B 4MDKE 2ZNVC 4W9KA 1GUAB 2UYZB 2KDEB 1V9JA 2KTRB 3AULA 3MHSD 4FBJB 1P3QU 2NR2A 1SGHA 3R66C 4NPNA 2FNJB 2BYVE 2K25A 2KJHB 2PPHA 3QARA 3TJPA 3ZTDA 2FAZA 2WX0A 4FHKA 3DPDA 4M8MA 2PEAA 1J8CA 4TQ0A 4MM3A 1QZEA 3CSTA 4JGHB 4BKSA 1HE8A 3DBHI 1WXSA 3WA0A 4MGIE 3SHQA 3APFA 4PS8A 1WXMA 3VVWB 4ZRIA 3PHXB 4W9FA 2DZKA 4GDLA 2GBKA 2DYMA 2JT4B 3UIPB 3JSVB 3KVFB 1IPGA 2V4LA 2L0FA 3IG3A 2KFJA 2M17A 3RULA 4RMAA 5G2NA 4EKUA 4DK5A 2WX1A 5JHBA 1ISNA 4EZJA 1P9DU 3V6CB 4MJSB 2KZRA 2KOXA 3VUXA 3HM6X 2IY0B 5AZGA 3VUYA 4GIVA 2VRRB 4ICUA 4IM2A 4GDLB 2BKRB 3PV1A 2CR5A 3OJ4B 2LRWA 1OGWA 3JYUA 3QIJA 4NJ7A 1WXAA 1V5TA 2V3SA 1GC6A 4HXDA 2FIDA 4HCNB 2ZEQA 1H4RA 1RAXA 3VTWA 4IWQA 2L00B 4F7ZA 4XZ4A 3DVNU 3U30A 2JZZA 2XBBC 5JH5C 5J2RA 3QJZA 2O6VD 3K9OB 5D6JB 3UQBA 3ZRCA 4BFRA 3M3JA 3RYTA 4NJ6A 4DHJD 1OEYJ 4JL9A 3VHTC 2O6VA 3ZNGC 2L05A 1P98A 3ZLZA 1WMHB 4W9IA 1EUVB 2EMSA 3V61A 3QA8A 2KDFB 4FHJA 2BYFA 4WWNA 3RCZA 2JVCA 3PLUA 1WIAA 3ECIA 4MGKE 2LASA 4AWJA 1KLVA 4AUQC 3NOBA 4A3PA 1WM2A 1Q1OA 2KWCA 3HHMA 1UH6A 3CMMB 4TKNA 1J0GA 1WGHA 3H7PA 1I35A 2IZVB 2KHWB 3M95A 2I1JA 2XK5A 1CMXB 4F1SA 2R2OA 5JHAA 3QAQA 2MSED 3H7SA 5FR6A 3B08A 2M4NA 3R7RA 3AU4A 4PS7A 2GOWA 1LFDA 1WZ3A 4URKA 2LVPA 4OVUA 3S2AA 3VXWA 4MH0E 2FCQA 2ZVOA 2M8SA 2FCNA 1WR6E 2AEHA 2MLBA 2R2QA 3H9DA 3OJ3A 4IW0A 4KZCA 3APCA 4W9CA 4RM8A 3L0WB 4PYZA 2LXAA 3MTNB 4GN1A 3RUIB 4LDTD 2XK5B 3GOEA 2RD0A 1KOTA 3MJWA 2XEWA 4AOFA 2L0TA 3SD5A 4IG7B 2ZNVB 1WGYA 3B1LX 1WI0A 2KQSA 3DVGY 2PE9A 5BO4B 3OLMD 4LJPB 4KSLC 2HD5B 3BINA 4ANXA 3WALA 1M94A 2EMTA 2K8HA 2LZ6A 1H8CA 2MW5A 2HE7A 5CHVC 2Y5BB 2MRPA 5DPWA 3ML9A 2KWVB 5CX3A 4NAWB 1R4NI 1YJ1A 4W9DA 2KX0A 1JRUA 1BT0A 1VD2A 3HK0A 2NVUI 2DZJA 2JRIB 2LVQA 1WXVA 2LVOA 1LQBA 1UGMA 3V6EB 1ZW7A 3QK0A 3RZWC 2AYOB 1E5WA 2KMCA 5EDSA 3EFUA 2KX3A 2GBMA 4NNJB 2LRUA 2J0KA 5J17A 4GDKA 3PHWB 2ZJDA 4HCPB 3IFWB 4HPLB 3ZNHB 2FIFA 5JZEB 5AEKB 1V86A 2MA9B 2GBRA 4GOCA 1WRDB 5J18A 1YD8U 5DPRA 2KDIA 1ZGUB 2DAFA 4BKGA 1TZ1A 2KJRA 4WJPA 4MSMB 1XD3B 3PRPB 1GC7A 1TBEA 4KZ0A 4JQWC 1WJ6A 2CHZA 3R3MA 1L2NA 4GGQA 1F9JA 4HWIB 4AP4C 4B95A 2KC2A 1WH3A 4KVGB 3L17A 5IA7A 2MBEA 2L3ZA 4G50A 1WX8A 4FN2A 2KMAA 4ANUA 2IBIB 1OQYA 3WAOA 5G55A 2ZVNA 5C23A 2DX5B 3BY4B 3A4SC 2DHZA 1A5RA 4I6NB 3UGBB 5D94A 1U4AA 2K6DB 3O65B 4WAAA 1WJNA 2JZ3B 3PREA 5E6OA 3RD2A 2GBNA 3QQ8B 4ZRKA 2GBJA 3JW0X 2K6QA 3A1QA 2N7EA 4PYUA 3EC8A 4ANWA 1WM3A 2KXJA 3QHTA 4II2B 4EOYA 4GMVA 3SDLC 3VFKA 2RPQA 1V80A 1KM7A 3AU5A 3GZNI 2FCMA 4W9HA 1Q0WB 3A9JA 3X23A 5D7GA 4K7WA 4CYEA 4MGYE 1WY8A 2MX2A 2BWFA 2EKEC 4YL8A 2G4SA 3DDCB 1GG3A 3LJ3A 3A1QB 3TL5A 4FA6A 3KYDD 1WGRA 1I42A 3KH0A 2J0MA 4WWPA 2NPTA 4II3B 4WJOA 1E90A 2BGFA 1GNUA 2CS4A 2IO0B 1Z2MA 4B6WA 3ONSA 2DAJA 2LGYA 2N1WA 3L13A 3EHVA 3CF6E 4I6LB 1C1YB 3I3TB 2C60A 3H1UA 4JIOU 3ENEA 3N3KB 2M0XA 2C7HA 1WYWB 4HJKA 4W9LA 2O6VB 1G6JA 2CU1A 1UD7A 4A20A 3QCAA 2FUHB 3SU8X 4DHJB 1YX6B 3DBRI 1LXDA 1E7UA 3L10B 4PS3A 4FJYA 2RR9A 5L95C 3Q3FA 3PZDA 5E6NA 2REXA 3CSFA 1UELA 4WWOA 2KDBA 2HTHA 2NBWB 3TMPB 4ZDVA 1S1QB 1S3SG 1V6EA 1E8WA 1YX5B 2GMIC 4K7SA 4TQ1A 3H7PB 2ZPNA 2LWPA 1WX7A 1SE9A 4DHZE 3QX1A 2D10A 2WYQA 4MGZE 3VH3B 2N9XA 4ANVA 2C7MB 4KDIC 2L7RA 5CHFA 4EUTA 2I1KA 3KYCD 3T9LA 3V60A 2LJ5A 1MG8A 1UBQA 2KJ6A 4WJNA 3HM3A 4AJWA 2DENB 2OJRA 2IYDB 2C9WB 3PS6A 4AJYB 4DHZB 3TBLD 2KKCA 4ICVA 3VUWA 2Z0EB 2MWSB 4FJVB 4ZYNA 3UF8A 1Y8RC 2C7NB 2D11A 4P7IA 5AZFA 1IP9A 2D3GA 2LXCA 2G3QB 2A5UA 3ZIMA 4DXAB 2K8CA 5AZHA 1OEYA 4W9EA 1WE6A 4NQLB 4KIKA 5L83A 2IY1B 4G11A 3VTVA 2G45B 2BYEA 2JWZA 1UBIA 4MELA 2M1MA 5LLIA 4EZKA 4FULA 4BBNC 3WAPA 2CKHB 3AXCA 2NS5A 2N7DA 3DCGA 3M63B 3RZFA 4HDOA 2CHWA 1LM8B 1V5OA 2MBOA 3R7QA 4W9GA 4E3CA 3ZDTA 3UIOB 4G3XB 3KUZA 3A33B 2MBHA 1RLFA 3H6NA 4BBNF 4NY0A 1L7YA 1YIWA 3WANA 3DVGX 3EECA 2DZMA 4GDKB 4FADA 4EEWA 2YLMA 3NHEB 2KN5A 1V49A 1P1AA 1V81A 4MSQB 2JRHA 3RT3B 4CHKA 1WX9A 1FXTB 2KFKA 2PJHA 2JY6A 4NQKE 1WGGA 4I6PA 2LI5A 1UZXB 2K1FA 4K1RB 1XT9B 2HJ8A 3PRZA 3A9KA 1Z5SB 4XC2A 1WR1A 2WDTB 2JUOA 2ZCBA 1P0RA 1WE7A 3JSVA 2AL3A 2WWZA 1E7VA 5DPSA 1WF9A 1GJZA 3A4RA 3VTUA 3ZW3A 1NI2A 3ZUNA 2KFKB 5KHOA 3L16A 3ZO5B 3V62A 4BKSD 4E71A 2K39A 3LDZE 2IO1B 3C0RB 1SIFA 3TIXA 1PQSA 2W9NA 4DWFA 3U8ZA 3HIZA 4K81A 1WGDA 3PLVA 4MJSA 2BWES 3A9KB 2B3AA 4A3OA 2MBQA 3JVZX 3ZKJC 2D2QA 5CTRC 3IHPC 4BOZB 4HLEA 2JPHA 2UWQA 1VCBA 1WFYA 2KC1A 3PVLA 2IO3B 4JLCA 2LUEA 4IUMB 1WJ4A 4MEMA 1IYFA 3M62B 1X1MA 1WJUA 2KO3A 4HK2A 3DBSA 2G4DB 2K8BA 4IM3A 4WJQA 4RM9A 4B9KA 1TTNA 2DYOA 2L8JA 2MQJA 2NBUA 3PSEB 4FJZA 5GMVA 5C1ZA 2KANA 5TR5A 2N9EB 4HDQA 5CHWA 2A4ZA 3P2BA 2JXXA 1WMHA 2ZCCA 3DVNV 3APDA 2LGXA 2C5LC 1RFAA 3A9JB 3NZSA 2ASQA 2LGDA 3N30A 4IWPA 2L76A 3WIMA 4FLHA 3B0AA 5HKHA 3N32A 2RSUA 3WAMA 2BPSA 4LCDE 4M8NA 4J6IA 4XX5A 2N4FA 2V1YA 3ZNZB 5LXIB 4ASWC 1Q5WB 4X57B 2NPTB 2KLGA 4EFOA 2AWTA 1NBFC 4GXBA 2Z0DB 2KLCA 2LD9A 2QHOA 4W9JA 2O2VA 3ML8A 2KWUB 3W1SA
chains in the Genus database with same CATH superfamily
3T8MA 3EUB2 3NS8A 1SIJA 4KV2A 3UQAA 3B9JA 3PTFC 4HPMB 1SJHD 2KQ7A 1EF1A 1F77A 5EE1A 4RCOA 4E74A 3AE4B 2O2VB 2J7QB 4GSWA 2N9LA 1SE3A 3VH4B 4GB9A 3QC8B 3ZDMC 4L1BA 4BVUC 5H8YE 1E8YA 3URYA 1L4ZB 2AL6A 5D2MB 3AEDB 4LDTB 1MFWA 5IP4D 2YVCA 3P4QB 1ZKHA 2NBVB 4YT0B 2MBBB 4A55A 3DQVA 2RGFA 1J7CA 3OAWA 1HA5A 1E8XA 2JYTA 1QLBB 5EE0A 4KX6B 3NUHB 2RDHA 1D4BA 2XNAC 1YN4A 1FPYA 3PPAA 1VJKA 1YQBA 2ZZPB 4JX1C 2BF8B 1LO5D 2FUG1 2N9PC 1L0XB 2L52A 3KW5B 4ZOHC 4IWOA 4MT5A 4C80A 3D32A 4GLSC 2Z59B 1ZP0B 4R3DA 1FNVA 1TKEA 1WZ0A 3IXSA 2D07B 1UUPA 2UYZB 1ZPSA 1TS4A 4FBJB 1P3QU 1F0ZA 1SGHA 2K25A 4C4VB 2FAZA 1SBBB 3ZQ4A 1ZOYB 1OQRA 1PGAA 1WXSA 3DBHI 4MGIE 1WXMA 3DHIC 2VZKD 3NJTA 1E9MA 1V1PA 2DYMA 3E56A 3UIPB 3JSVB 3LXFA 1K51A 2E3TA 3GZNB 4YTNB 1FCCC 2M17A 2D3CA 2BS4B 4EKUA 4DK5A 2WX1A 1FRDA 3VUXA 4P1BC 3HM6X 4GDLB 1IBXB 3ZJVA 3OJ4B 5BMHA 1WXAA 1V5TA 1GC6A 2FIDA 4HCNB 2ZEQA 2W3RA 4IWQA 4XZ4A 5JH5C 2XBBC 5J2RA 3O13A 3VHTC 1TYGB 1DOXA 3ZLZA 3V61A 4WWNA 1Q1OA 3HHMA 3AE3B 2KQ4X 4IKGA 4TKNA 3TUOA 1WGHA 3H7PA 2IZVB 3SR6A 3NG0A 2MSED 4WAFA 3NVZA 5FR6A 3B08A 3R7RA 3N20C 2FCNA 2WXMA 1QF6A 5H92C 4PYZA 2LXAA 1P7FA 3OG5A 3AM9A 1WGYA 2PE9A 3OLMD 2INNE 4RGMA 2EMTA 1H8CA 4YSYB 3ML9A 3P1MA 2KX0A 1BT0A 1VD2A 1B9RA 2DZJA 1WXVA 1KRHA 3V6EB 1N62A 3QK0A 4YTPB 5EE9A 3RNGC 1C77A 4GDKA 3ZNHB 1HEZE 4WURA 4GOCA 2RMMA 1VRAB 1ZGUB 4MSMB 1TBEA 2WU2B 4KZ0A 3ETRA 1J7AA 1L2NA 4GGQA 4B95A 2MJEA 2WXGA 4FN2A 1XCQL 1OQYA 5G55A 2RPVA 1TS2A 3E9SA 4DXGA 4I6NB 3UGBB 1OFFA 2WXLA 2YEPB 1WJNA 5E6OA 2WHIA 4MM3B 1NYRA 3PO0A 2N7EA 4EOYA 1HQRD 1C79A 4GMVA 3RPFC 2RPQA 2AX5A 1YQ3B 1CZPA 1KM7A 4W9HA 1TT5B 5TSSA 3X23A 4K7WA 2BWFA 4YL8A 4BAXA 4FA6A 4HJGE 1GAQB 2QC8A 2PTLA 2Y5PA 1L0VB 1I4PA 1E90A 1EM7A 2N1WA 3L13A 4NAMA 1TKGA 3CF6E 4I6LB 1C1YB 2WGSA 3I3TB 1QOGA 2PKOA 4MH8A 1KTKA 3N3KB 4A90A 2OJWA 4D2KA 1WYWB 2O6VB 2FBWB 1UD7A 3DBRI 4P16A 3CSFA 4WWOA 2KDBA 4XDCA 1S3SG 4TMAB 1F1HA 1WX7A 4XYCA 3QX1A 2N9XA 2C7MB 1DOIA 3T9LA 2KYWA 2KJ6A 1EWYC 3HM3A 4A6QA 2H89B 2Z0EB 1Y56A 1Y8RC 1UGJA 2D11A 2LGIA 2A5UA 4FXCA 1OEYA 3PZ7A 2G45B 3DHHC 3GB1A 4N6EB 2M1MA 1YQ4B 3TEYA 1WYGA 2N7DA 4RH6A 2QEJC 2CHWA 1V5OA 2INDC 2MBOA 2PLPA 3ZDTA 3TEWA 2SAKA 4G3XB 3KUZA 4OVZA 1YIWA 2NTTA 2YLMA 3NHEB 4HROA 1V49A 4MSQB 3RT3B 2BQQA 1FXTB 4C4VA 1WGGA 1UZXB 2JU6X 4ZHPA 5JXVA 3PRZA 1DYQA 1WR1A 1WE7A 3JSVA 1FFVA 1STEA 1WF9A 2AQ1B 3A4RA 1NI2A 4K3BA 2KFKB 5KHOA 1A70A 3TIXA 3LDZE 2IO1B 5HI1A 3U8ZA 3DWGC 3A9KB 3JVZX 3IHPC 1IBXA 1GOZA 1VCBA 2L83A 1TJEA 3P4SB 1FIQA 2LUEA 1WJ4A 4MEMA 3ZYYX 2KO3A 4HK2A 4B9KA 2L8JA 4YTMB 3PSEB 4FJZA 2KANA 4HDQA 2JXXA 1GB1A 2LGXA 2C5LC 1I7HA 4YSZB 5LNK1 4FLHA 2RDBC 3WAMA 4M8NA 1XLNA 3CIRB 4IOIE 1NBFC 2Z0DB 5IKCM 4KGTA 4W9JA 3LB8C 1JRPA 1FXIA 2MP2A 4HVBA 5C2TB 3PZ8A 4KDLB 2YEPF 2FCSA 2RDGA 4N9F4 3T3OA 3Q3NC 2TSSA 1EF5A 1XXGA 2L32A 2J0JA 2QMTA 3DBLI 2KNBA 1AW7A 4LLGM 4KSKC 4TUUA 1E8ZA 2I2YA 1V2YA 4J3OD 3NRZA 1T0YA 3UINB 5AUKA 2X8XX 3B2FA 4N59A 2ZW0A 2CJOA 3RNFC 2JYEA 2QIEB 1WGKA 2IO2B 4BKTA 4JWUC 3KUDB 3X0WA 5AUIA 3W1SC 4DDID 3NY5A 4OVVA 3TCAA 2V4IB 2NCNA 4GU2A 4L2YA 3PT2B 2JF5A 1D3ZA 3SEBA 4K7UA 2N1VA 1RWSA 4ZRJA 2W3SA 4HPPA 4DBGA 3BZDB 1D5MC 1PUTA 4MDKE 4W9KA 1GUAB 3BVGA 2KDEB 3Q3MC 3AEAB 2KTRB 3AULA 1C4PA 4NPNA 3I9V1 2FNJB 4L23A 1DOYA 5IO9A 2KJHB 2PPHA 3QARA 3RNAC 3ZTDA 2WX0A 4M8MA 3L4PA 1J8CA 4TQ0A 3N1YC 4MM3A 4BKSA 3SHQA 1WRIA 2WXRA 3APFA 3VVWB 1JWBD 4W9FA 2INPE 3BVMA 2JWUA 5HHDG 2V4LA 4S17A 3IG3A 1RYJA 4RMAA 5JHBA 3MC0B 2BS3B 2K3UA 2IY0B 5AZGA 5C3JB 4ICUA 2VRRB 4IM2A 4C56C 2CR5A 1SB3C 5G5HA 5HFYA 2V3SA 2D5GA 1M4VA 1I4GA 2BB6A 2PIAA 1V1OA 3U30A 2JZZA 4LNFA 4YSXB 4DQOC 3K9OB 1XLOA 3ZRCA 4DHJD 4AS1A 1OEYJ 5D3DA 2O6VA 3ZNGC 4W9IA 1EUVB 3QA8A 1N63A 4ZHOA 3B2GA 2KACA 3Q8EA 3NOBA 1WM2A 2KWCA 1QQRA 3Q8CA 1I35A 3FILB 4OW0A 2XK5A 2ICIA 2J42A 1WZ3A 3VXWA 3S2AA 4MH0E 2ZVOA 2MLBA 2R2QA 3OJ3A 3P63A 4EE2A 4RM8A 4GN1A 3RUIB 4LDTD 4M01A 3GOEA 4NJCA 1KOTA 3MJWA 4TSSA 2ZNVB 2JXTA 3BK1A 2ACZB 3B1LX 2KQSA 3DVGY 3IAS1 2DLBA 3BINA 1AWDA 5CHVC 1V97A 1RFKA 5CX3A 4NAWB 3FAHA 4W9DA 1KLUD 2JRIB 3W5UB 2M0AA 2KMCA 1E5WA 1C4CA 1ET9A 3EFUA 5EDSA 4NNJB 3UI3A 3PHWB 4H2AA 4HPLB 4HCPB 5JZEB 1XLQA 3U7ZA 1WRDB 2WXPA 3AE6B 2ONQA 1YJIA 2DAFA 4BKGA 1FNUA 4WJPA 4WIPA 1XD3B 3PRPB 4REZA 1WJ6A 4AP4C 1F9JA 3Q14C 5IA7A 4ANUA 1MVKA 2IBIB 2ZVNA 3MFGA 1ZXHA 2DHZA 1U4AA 4HKZE 4LNIA 2JZ3B 2N7JA 3RD2A 2GBNA 3EC8A 4AQ7A 2KXJA 3QHTA 2WXOA 3VFKA 3SDLC 1JWUD 1AYFA 1FNWA 3R8BA 3GZNI 3AE7B 1Q0WB 4LNOA 5T8IA 2MX2A 1GG3A 3LJ3A 3A1QB 3TL5A 2LMCA 1I42A 3KH0A 3I63C 4OZAA 4II3B 3MC9A 3AE9B 2BYTA 1GNUA 3ONSA 1K50A 2DAJA 2LGYA 2JQRB 3RN9C 1ZDXA 3IAM1 3RMKC 2M0XA 1T0QC 2C7HA 5FK9C 3BK2A 1R4MB 1IGCA 3QCAA 3SU8X 1LXDA 1E7UA 3L10B 5E6NA 2CU3A 1K52A 1UELA 2KT7A 2GB1A 3TMPB 1S1QB 2LWPA 1IUEA 2H88B 3V05A 4US9A 4XWTA 2D10A 4MGZE 3VH3B 4KDIC 5CHFA 3AMZA 1UWMA 1UBQA 2G9HD 4WJNA 3HVDA 2LEKA 2B76B 1N61A 2DENB 2GI9A 5EE3A 3DWMA 4LNNA 1L0YB 4ZYNA 1KH0A 3UF8A 1E6EB 1SJED 2D3GA 1KF6B 3Q6BA 3AV8A 4WH4A 3RI7C 3ZIMA 1WE6A 2MJ3A 1TKYA 1GPXA 2QJLA 2BYEA 4YWGG 1UBIA 4MELA 3R2IA 3AH7A 2DWQA 1YN5A 2VH1A 3M63B 3FKYA 4HDOA 4E3CA 4W9GA 1PFDA 2MBHA 1L7YA 1XO3A 4FADA 2GRIA 2KN5A 1HZ5A 1WX9A 2KAJA 1BMLC 1IGDA 2FE8A 4HEA1 1T0SC 1XF5L 4I6PA 2LI5A 2WDTB 2ZCBA 4KKJA 2WWZA 4RF1A 3V3XA 4BKSD 3Q2AC 3C0RB 4DWFA 1SIFA 1PQSA 2WXNA 1T5XD 1WGDA 3HIZA 3PLVA 2BWES 2B3AA 1N60A 2UWQA 2I38A 2OHFA 1IYFA 2G4DB 2K8BA 4RM9A 4HRSA 3HUIA 2NBUA 5IOIA 1ZXIA 5TR5A 2N9EB 1F52A 3P2BA 3A9JB 3IT6B 4IWPA 1JWAD 3B0AA 4JWSC 1FO4A 1HZ6A 1VDVA 2V1YA 3ZNZB 5LXIB 5IN7A 2NPTB 1C76A 5BMIA 2KLGA 2AWTA 2KLCA 3FILA 3P4RB 2LD9A 2QHOA 1KFYB 1N5XA 2O2VA 3Q8AA 3ML8A 1UF0A 2KWUB 1VLBA 3PGEA 2CJNA 2MCNB 3Q8FA 1K8RB 5IAAC 3AECB 2WXIA 4C7ZA 2BVCA 4M0WB 1L5PA 1N5WA 3NZUA 1TGZB 1MJDA 2BB5A 4IC7B 2WU5B 2DZIA 1C3TA 2MHJA 3VQIA 5E6JA 4NAWA 4WQOB 4CO7A 4G0NB 2DYBA 1R4NB 3DOWA 1OTRB 1KJTA 3ZTCA 2V3PA 3IBEA 2PMVA 1TS5A 2W54A 3EFCA 3ALBA 4KIKB 1ENFA 3ZNID 2AQ3B 2BKFA 1RRBA 2KVRA 2L1AA 2V9HA 4BOSC 5E6PA 4F8CB 2WQYB 3W1YA 2K0PA 1V9JA 3MHSD 2NR2A 2BYVE 1MHXA 1NEKB 3TJPA 1EWCA 3DPDA 2PEAA 1FRRA 5D3IB 4ZRIA 3PHXB 4GDLA 4QAYA 1XLPA 3KVFB 1IPGA 2L0FA 2INCC 2KFJA 3RULA 5G2NA 3KWVA 3GS2A 1ISNA 4EZJA 1P9DU 4RGNA 3P42A 3VUYA 4GIVA 2N9KA 4ZRQA 1C78A 2LRWA 1FXAA 4N58A 1H4RA 1SE2A 1RAXA 3IT4B 4F7ZA 3DVNU 1OQQA 3QJZA 5D6JB 3RYTA 4NJ6A 1QT9A 1SXTA 2Q5WD 4JL9A 1WMHB 2IGHA 1HTQA 2KDFB 4FHJA 2BYFA 3RCZA 2JVCA 3PLUA 1WIAA 4ITKA 4MGKE 2LASA 1KLVA 4AUQC 4A3PA 2QILA 1VR9A 1UH6A 1UNSA 2QCZA 2MEKA 3M95A 2R2OA 3QAQA 3H7SA 3AU4A 2JZPA 4PS7A 2KWDA 1XEEA 1BXTA 2GOWA 2QDFA 2M8SA 4OZCA 3H9DA 4LTUA 3VRBB 1JWSD 1NVID 3MTNB 3BIID 2D3BA 3SD5A 1MG4A 3VR9B 5BO4B 3RNEC 4LJPB 4KSLC 4ANXA 2J52A 3WALA 1B1ZA 2MW5A 3ZGZA 2Y5BB 5DPWA 2KWVB 1YJ1A 1VZ6A 1JRUA 1LQBA 3RZWC 2AYOB 1JALA 4P1CC 2LRUA 2J0KA 4XGAB 5J17A 3TEXA 2ZJDA 3AN1A 2FIFA 1V86A 2MA9B 4ZYSA 2GBRA 2KDMA 1TZ1A 3HVZA 1MI0A 4US8A 1F2RI 1P7EA 2MH7A 3I57A 4KVGB 4ACFA 2MBEA 2L3ZA 2KMAA 3WAOA 3AE5B 1E10A 2IPKD 1A5RA 5D94A 2K6DB 3O65B 1EU4A 4ZRKA 3JW0X 4PYUA 3GE8C 1R7SA 1WM3A 4II2B 1V80A 2FCMA 3T3NA 3A9JA 4CYEA 4MGYE 2WXQA 2EKEC 3SFEB 1L6VA 2GLSA 3AEEB 2NPTA 1D6EC 1N6ZA 2BGFA 4B6WA 2WNMA 4WWMA 2C60A 3NZ3A 2WDRB 3ENEA 1V8CA 4W9LA 4HJKA 4A9AA 2EELA 1G6JA 2CU1A 3AE1B 4A20A 2FUHB 4DHJB 1YX6B 4PS3A 2RR9A 4M0WA 5BYQA 3R2TA 5L95C 4OHJA 3Q3FA 2REXA 4ZDVA 1V6EA 1E8WA 3N1ZC 4TQ1A 1SE9A 3N9YC 4DHZE 4A8XC 2WYQA 2DBYA 4EUTA 1TZOA 4ANVA 2L7RA 3KYCD 3AEFB 2LJ5A 2M19A 4RGOS 2OJRA 1RM6C 4AJYB 2C9WB 3PS6A 4ICVA 2MWSB 4FJVB 3OWEB 2K8CA 5AZHA 4NQLB 4KIKA 2IY1B 4G11A 3VTVA 1ACCA 5LLIA 4EZKA 3WAPA 4LK0M 2NS5A 3DCGA 4XWWA 1LM8B 3R7QA 4XE0A 3UIOB 3WCQA 3A33B 3H6NA 4NY0A 4M00A 3DVGX 3EECA 2K5PA 4EEWA 1P1AA 1V81A 2JRHA 2PJHA 2KFKA 4NQKE 3Q3OC 2K1FA 1C9FA 2HJ8A 3DBHB 3VRAB 3A9KA 1Z5SB 1MPEA 1P0RA 1PDXA 2AL3A 5DPSA 4RNAA 4ARCA 3RFZB 3V62A 4E71A 2K39A 2J53A 1VZ7A 4KGSA 2V3NA 4K81A 1AN8A 2MBQA 2VZKB 4BOZB 2JPHA 1QKZA 1WFYA 2KC1A 3PVLA 1I4QA 4JLCA 5HG2A 2G1EA 1F2RC 1X1MA 1ZUD2 4IM3A 4WJQA 2EKIA 1TTNA 2DYOA 2MQJA 3P4PB 5GMVA 5C1ZA 3AB5A 2LUMA 1WMHA 2D3AA 1PGXA 2ZCCA 1RFAA 3NZSA 2Y3AA 2ASQA 3N30A 2BW2A 3WIMA 3N32A 2BPSA 4J6IA 5BYRA 3MC8A 1QOFA 1Q5WB 1T0RC 4EFOA 2ZW1A 4GXBA 2WLBA 3EGRA 1FM0D 4LJOB 3KLSX 4USAA 3W5VB 1R4MI 1T3QA 2ZPYA 2CHXA 4P6VF 2KTFA 3AI5A 4RGTA 3PRMB 2MP2B 1JMLA 3L08A 3ZVVA 1FFUA 3Q3JA 2IDYA 2PE6B 1C4AA 1JQ4A 3VR8B 4DXFA 2LGSA 4M02A 4KKIA 1AARA 2K22A 3VDZA 2V0GA 1D5XC 1JW9D 3U4EG 3LYYA 3ZRFA 3IVFA 3U7DA 4DDGD 2KD0A 1EO6A 1FEHA 5DCNA 4K3CA 3VAWA 3KUCB 4IM0A 2IJ0A 3QWZB 2BS2B 4O1NA 5DPTA 2OOBB 3K9PB 4OZBA 4TV3A 5KHQA 2KTRA 1J19A 4C00A 2KK8A 1NDDA 5LXHA 2NMQA 4ARIA 1SF0A 2DNFA 1XQQA 4EZLA 3L54A 2ZNVC 1NYQA 1SSNA 3R66C 1LGRA 1CQVA 4FHKA 2W82A 1QZEA 3CSTA 4JGHB 1HE8A 3WA0A 4PS8A 1QILA 2WXJA 4JPSA 2DZKA 3BWUD 1ZE3D 2GBKA 2JT4B 1DGJA 3ABVB 2ON8A 2IGDA 3MHZA 3ZJTA 3V6CB 4MJSB 2KZRA 2KOXA 2WP9B 3GP7A 3AE8B 1FCLA 1QOAA 2BKRB 2HJ1A 3PV1A 1OGWA 3JYUA 3QIJA 4NJ7A 4RFBA 3FC4A 4HXDA 4WQMA 3VTWA 2L00B 2PVGC 2O6VD 2PVOD 3UQBA 4BFRA 2Z8LA 3M3JA 5FKAC 2KN4A 2UU7A 2L05A 3W9CB 1P98A 2EMSA 1ESFA 3DBRB 1BUIC 1TY0A 3ECIA 1JCKB 4AWJA 2WDQB 2OEDA 3CMMB 4RF0A 1J0GA 1HXYD 2KHWB 3Q69A 2I1JA 4F1SA 1CMXB 5JHAA 2JSVX 2WXKA 3RNBC 3H8HA 5MPOA 2M4NA 4NZLB 2Y5CA 3ZJUA 1E7PB 3N1XC 1TY2A 4URKA 1LFDA 2BTEA 2LVPA 4OVUA 2AQ2B 2FCQA 1J7BA 4KZCA 4IW0A 1WR6E 2AEHA 4W9CA 3APCA 3L0WB 1K53A 3NS1A 2XK5B 2LHEA 2RD0A 2K9XA 3CWIA 1JROA 4AOFA 1YOVB 2XEWA 2L0TA 3BYYB 3ZXRA 4IG7B 2MJDA 2VH2A 1WI0A 1KLGD 2HD5B 1M94A 2K8HA 2LZ6A 4C7YA 3AE2B 2HE7A 3ZXVA 2MRPA 5GXGB 1ET6A 1R4NI 2WXHA 3HK0A 2NVUI 2LVQA 2LVOA 1UGMA 2WDVB 1ZW7A 1CJEA 2KX3A 2GBMA 2E6XA 3IFWB 5AEKB 4B0EA 4B0MA 2N0SB 5J18A 1YD8U 5DPRA 2KDIA 3KWLA 4XDDA 2KJRA 1L4DB 3J9CA 4MACA 1GC7A 4JQWC 2CHZA 3R3MA 4HWIB 2KC2A 1WH3A 1NENB 3L17A 4G50A 2SEBD 1WX8A 1I4XA 3W2DA 1PYWD 5C23A 2DX5B 3BY4B 3A4SC 1Q10A 2X38A 5BYSA 4WAAA 3PREA 2LFIA 4JE3B 3QQ8B 2GBJA 3Q8BA 3TEZA 2K6QA 3A1QA 4ANWA 1SEBD 1V1PB 5G5GA 2HTME 3U2SC 5FR3A 3AU5A 3TSSA 5D7GA 1L6UA 1WY8A 2G4SA 3DDCB 3KYDD 1WGRA 5BMGA 1YN3A 2J0MA 1CK1A 4WWPA 4WJOA 2NTSA 1VZ8A 2CS4A 2IO0B 1Z2MA 1JWMD 3NVVA 3EHVA 1MHHE 5I4DA 1FD6A 4JIOU 3H1UA 3BYTB 4Q2JA 1ROEA 2J4XA 1QOBA 4ZRPA 1E0ZA 3HRDD 4FJYA 1YMHE 3PZDA 1D5ZC 3SFDB 1UWXA 2NBWB 2HTHA 3DBLB 1I4HA 1YX5B 2GMIC 4K7SA 1TIFA 3H7PB 2ZPNA 3BVZA 2KVZA 3NVWA 3AEGB 2I1KA 3V60A 1MG8A 4AJWA 3KQ4A 2JX5A 2IYDB 1EU3A 4DHZB 3TBLD 2KKCA 2BT6A 3VUWA 1GB4A 2KMMA 2C7NB 3U52E 4P7IA 3RNCC 5AZFA 1IP9A 1WXQA 2LXCA 2G3QB 4DXAB 2PW9A 4W9EA 3MP9A 1XCTL 5L83A 2JWZA 2WS3B 4FULA 4BBNC 4KGRA 2XN9C 2CKHB 3AXCA 3RZFA 4PT5A 1I4RA 4BZAA 1T6BX 1RLFA 4BBNF 1YJJA 3DHGC 4S0RA 3WANA 2DZMA 4GDKB 4YXDB 4CHKA 2LJIA 2JY6A 2M56B 1WSPA 1YNTE 4K1RB 1XT9B 1SE4A 2BBCA 3EA6A 4XC2A 2JUOA 3I5JC 1E7VA 1GJZA 2IGGA 3VTUA 3ZW3A 3ZUNA 1WWTA 3ZO5B 3L16A 2W9NA 3NVYA 4PK1A 3MJ5A 4MJSA 4A3OA 3ZKJC 2D2QA 5CTRC 2HDEA 4HLEA 2LHDA 1FMAD 2IO3B 4IUMB 3M62B 1WJUA 4HKQA 3DBSA 2R61A 3GE3C 1HTOA 3C8YA 1NI3A 5CHWA 2A4ZA 4LNKA 1TS3A 3DVNV 3APDA 2QSDA 4UDUC 2LGDA 2L76A 5HKHA 2W55A 2RSUA 4IDIA 4LCDE 1ZDVA 2WXFA 3C19A 2N4FA 4XX5A 4ASWC 4X57B 4CQNA 1PGBA 3AEBB 3W1SA
chains in the Genus database with same CATH topology
3PGEA 3T8MA 2MP2A 2MCNB 4HVBA 1K8RB 5IAAC 4LJOB 3NS8A 4KV2A 3UQAA 3PTFC 4HPMB 4KDLB 1R4MI 2FCSA 2KQ7A 1EF1A 4N9F4 4E74A 2ZPYA 4M0WB 2O2VB 2CHXA 1EF5A 2KTFA 3NZUA 3AI5A 2J7QB 1TGZB 2J0JA 3PRMB 2MP2B 4GSWA 3DBLI 4IC7B 2KNBA 3VH4B 4GB9A 3L08A 3QC8B 3ZDMC 2DZIA 3ZVVA 4KSKC 4TUUA 4BVUC 1C3TA 1E8YA 1E8ZA 3Q3JA 2PE6B 2AL6A 5D2MB 1V2YA 4LDTB 3VQIA 2YVCA 1T0YA 3UINB 4NAWA 4WQOB 4CO7A 4G0NB 2DYBA 1ZKHA 1AARA 2NBVB 3VDZA 2MBBB 3DOWA 3DQVA 2RGFA 1OTRB 1KJTA 3ZTCA 3OAWA 3IBEA 1E8XA 2IO2B 3IVFA 3ZRFA 3U7DA 4DDGD 2KD0A 1EO6A 4BKTA 5DCNA 3PPAA 3KUDB 3X0WA 3W1SC 4DDID 3VAWA 3KUCB 4IM0A 1YQBA 2ZZPB 3ALBA 3NY5A 3QWZB 2BF8B 4OVVA 5DPTA 3TCAA 2OOBB 2NCNA 3K9PB 2N9PC 4GU2A 4KIKB 4TV3A 5KHQA 2KTRA 3ZNID 1J19A 3KW5B 3PT2B 4IWOA 2KK8A 2BKFA 2JF5A 1NDDA 1RRBA 5LXHA 1D3ZA 3D32A 2KVRA 2Z59B 1XQQA 4EZLA 4K7UA 2N1VA 3L54A 4BOSC 4ZRJA 1WZ0A 5E6PA 4F8CB 4DBGA 3W1YA 2D07B 4MDKE 2ZNVC 4W9KA 1GUAB 2UYZB 2KDEB 1V9JA 2KTRB 3AULA 3MHSD 4FBJB 1P3QU 2NR2A 1SGHA 3R66C 4NPNA 2FNJB 2BYVE 2K25A 2KJHB 2PPHA 3QARA 3TJPA 3ZTDA 2FAZA 2WX0A 4FHKA 3DPDA 4M8MA 2PEAA 1J8CA 4TQ0A 4MM3A 1QZEA 3CSTA 4JGHB 4BKSA 1HE8A 3DBHI 1WXSA 3WA0A 4MGIE 3SHQA 3APFA 4PS8A 1WXMA 3VVWB 4ZRIA 3PHXB 4W9FA 2DZKA 4GDLA 2GBKA 2DYMA 2JT4B 3UIPB 3JSVB 3KVFB 1IPGA 2V4LA 2L0FA 3IG3A 2KFJA 2M17A 3RULA 4RMAA 5G2NA 4EKUA 4DK5A 2WX1A 5JHBA 1ISNA 4EZJA 1P9DU 3V6CB 4MJSB 2KZRA 2KOXA 3VUXA 3HM6X 2IY0B 5AZGA 3VUYA 4GIVA 2VRRB 4ICUA 4IM2A 4GDLB 2BKRB 3PV1A 2CR5A 3OJ4B 2LRWA 1OGWA 3JYUA 3QIJA 4NJ7A 1WXAA 1V5TA 2V3SA 1GC6A 4HXDA 2FIDA 4HCNB 2ZEQA 1H4RA 1RAXA 3VTWA 4IWQA 2L00B 4F7ZA 4XZ4A 3DVNU 3U30A 2JZZA 2XBBC 5JH5C 5J2RA 3QJZA 2O6VD 3K9OB 5D6JB 3UQBA 3ZRCA 4BFRA 3M3JA 3RYTA 4NJ6A 4DHJD 1OEYJ 4JL9A 3VHTC 2O6VA 3ZNGC 2L05A 1P98A 3ZLZA 1WMHB 4W9IA 1EUVB 2EMSA 3V61A 3QA8A 2KDFB 4FHJA 2BYFA 4WWNA 3RCZA 2JVCA 3PLUA 1WIAA 3ECIA 4MGKE 2LASA 4AWJA 1KLVA 4AUQC 3NOBA 4A3PA 1WM2A 1Q1OA 2KWCA 3HHMA 1UH6A 3CMMB 4TKNA 1J0GA 1WGHA 3H7PA 1I35A 2IZVB 2KHWB 3M95A 2I1JA 2XK5A 1CMXB 4F1SA 2R2OA 5JHAA 3QAQA 2MSED 3H7SA 5FR6A 3B08A 2M4NA 3R7RA 3AU4A 4PS7A 2GOWA 1LFDA 1WZ3A 4URKA 2LVPA 4OVUA 3S2AA 3VXWA 4MH0E 2FCQA 2ZVOA 2M8SA 2FCNA 1WR6E 2AEHA 2MLBA 2R2QA 3H9DA 3OJ3A 4IW0A 4KZCA 3APCA 4W9CA 4RM8A 3L0WB 4PYZA 2LXAA 3MTNB 4GN1A 3RUIB 4LDTD 2XK5B 3GOEA 2RD0A 1KOTA 3MJWA 2XEWA 4AOFA 2L0TA 3SD5A 4IG7B 2ZNVB 1WGYA 3B1LX 1WI0A 2KQSA 3DVGY 2PE9A 5BO4B 3OLMD 4LJPB 4KSLC 2HD5B 3BINA 4ANXA 3WALA 1M94A 2EMTA 2K8HA 2LZ6A 1H8CA 2MW5A 2HE7A 5CHVC 2Y5BB 2MRPA 5DPWA 3ML9A 2KWVB 5CX3A 4NAWB 1R4NI 1YJ1A 4W9DA 2KX0A 1JRUA 1BT0A 1VD2A 3HK0A 2NVUI 2DZJA 2JRIB 2LVQA 1WXVA 2LVOA 1LQBA 1UGMA 3V6EB 1ZW7A 3QK0A 3RZWC 2AYOB 1E5WA 2KMCA 5EDSA 3EFUA 2KX3A 2GBMA 4NNJB 2LRUA 2J0KA 5J17A 4GDKA 3PHWB 2ZJDA 4HCPB 3IFWB 4HPLB 3ZNHB 2FIFA 5JZEB 5AEKB 1V86A 2MA9B 2GBRA 4GOCA 1WRDB 5J18A 1YD8U 5DPRA 2KDIA 1ZGUB 2DAFA 4BKGA 1TZ1A 2KJRA 4WJPA 4MSMB 1XD3B 3PRPB 1GC7A 1TBEA 4KZ0A 4JQWC 1WJ6A 2CHZA 3R3MA 1L2NA 4GGQA 1F9JA 4HWIB 4AP4C 4B95A 2KC2A 1WH3A 4KVGB 3L17A 5IA7A 2MBEA 2L3ZA 4G50A 1WX8A 4FN2A 2KMAA 4ANUA 2IBIB 1OQYA 3WAOA 5G55A 2ZVNA 5C23A 2DX5B 3BY4B 3A4SC 2DHZA 1A5RA 4I6NB 3UGBB 5D94A 1U4AA 2K6DB 3O65B 4WAAA 1WJNA 2JZ3B 3PREA 5E6OA 3RD2A 2GBNA 3QQ8B 4ZRKA 2GBJA 3JW0X 2K6QA 3A1QA 2N7EA 4PYUA 3EC8A 4ANWA 1WM3A 2KXJA 3QHTA 4II2B 4EOYA 4GMVA 3SDLC 3VFKA 2RPQA 1V80A 1KM7A 3AU5A 3GZNI 2FCMA 4W9HA 1Q0WB 3A9JA 3X23A 5D7GA 4K7WA 4CYEA 4MGYE 1WY8A 2MX2A 2BWFA 2EKEC 4YL8A 2G4SA 3DDCB 1GG3A 3LJ3A 3A1QB 3TL5A 4FA6A 3KYDD 1WGRA 1I42A 3KH0A 2J0MA 4WWPA 2NPTA 4II3B 4WJOA 1E90A 2BGFA 1GNUA 2CS4A 2IO0B 1Z2MA 4B6WA 3ONSA 2DAJA 2LGYA 2N1WA 3L13A 3EHVA 3CF6E 4I6LB 1C1YB 3I3TB 2C60A 3H1UA 4JIOU 3ENEA 3N3KB 2M0XA 2C7HA 1WYWB 4HJKA 4W9LA 2O6VB 1G6JA 2CU1A 1UD7A 4A20A 3QCAA 2FUHB 3SU8X 4DHJB 1YX6B 3DBRI 1LXDA 1E7UA 3L10B 4PS3A 4FJYA 2RR9A 5L95C 3Q3FA 3PZDA 5E6NA 2REXA 3CSFA 1UELA 4WWOA 2KDBA 2HTHA 2NBWB 3TMPB 4ZDVA 1S1QB 1S3SG 1V6EA 1E8WA 1YX5B 2GMIC 4K7SA 4TQ1A 3H7PB 2ZPNA 2LWPA 1WX7A 1SE9A 4DHZE 3QX1A 2D10A 2WYQA 4MGZE 3VH3B 2N9XA 4ANVA 2C7MB 4KDIC 2L7RA 5CHFA 4EUTA 2I1KA 3KYCD 3T9LA 3V60A 2LJ5A 1MG8A 1UBQA 2KJ6A 4WJNA 3HM3A 4AJWA 2DENB 2OJRA 2IYDB 2C9WB 3PS6A 4AJYB 4DHZB 3TBLD 2KKCA 4ICVA 3VUWA 2Z0EB 2MWSB 4FJVB 4ZYNA 3UF8A 1Y8RC 2C7NB 2D11A 4P7IA 5AZFA 1IP9A 2D3GA 2LXCA 2G3QB 2A5UA 3ZIMA 4DXAB 2K8CA 5AZHA 1OEYA 4W9EA 1WE6A 4NQLB 4KIKA 5L83A 2IY1B 4G11A 3VTVA 2G45B 2BYEA 2JWZA 1UBIA 4MELA 2M1MA 5LLIA 4EZKA 4FULA 4BBNC 3WAPA 2CKHB 3AXCA 2NS5A 2N7DA 3DCGA 3M63B 3RZFA 4HDOA 2CHWA 1LM8B 1V5OA 2MBOA 3R7QA 4W9GA 4E3CA 3ZDTA 3UIOB 4G3XB 3KUZA 3A33B 2MBHA 1RLFA 3H6NA 4BBNF 4NY0A 1L7YA 1YIWA 3WANA 3DVGX 3EECA 2DZMA 4GDKB 4FADA 4EEWA 2YLMA 3NHEB 2KN5A 1V49A 1P1AA 1V81A 4MSQB 2JRHA 3RT3B 4CHKA 1WX9A 1FXTB 2KFKA 2PJHA 2JY6A 4NQKE 1WGGA 4I6PA 2LI5A 1UZXB 2K1FA 4K1RB 1XT9B 2HJ8A 3PRZA 3A9KA 1Z5SB 4XC2A 1WR1A 2WDTB 2JUOA 2ZCBA 1P0RA 1WE7A 3JSVA 2AL3A 2WWZA 1E7VA 5DPSA 1WF9A 1GJZA 3A4RA 3VTUA 3ZW3A 1NI2A 3ZUNA 2KFKB 5KHOA 3L16A 3ZO5B 3V62A 4BKSD 4E71A 2K39A 3LDZE 2IO1B 3C0RB 1SIFA 3TIXA 1PQSA 2W9NA 4DWFA 3U8ZA 3HIZA 4K81A 1WGDA 3PLVA 4MJSA 2BWES 3A9KB 2B3AA 4A3OA 2MBQA 3JVZX 3ZKJC 2D2QA 5CTRC 3IHPC 4BOZB 4HLEA 2JPHA 2UWQA 1VCBA 1WFYA 2KC1A 3PVLA 2IO3B 4JLCA 2LUEA 4IUMB 1WJ4A 4MEMA 1IYFA 3M62B 1X1MA 1WJUA 2KO3A 4HK2A 3DBSA 2G4DB 2K8BA 4IM3A 4WJQA 4RM9A 4B9KA 1TTNA 2DYOA 2L8JA 2MQJA 2NBUA 3PSEB 4FJZA 5GMVA 5C1ZA 2KANA 5TR5A 2N9EB 4HDQA 5CHWA 2A4ZA 3P2BA 2JXXA 1WMHA 2ZCCA 3DVNV 3APDA 2LGXA 2C5LC 1RFAA 3A9JB 3NZSA 2ASQA 2LGDA 3N30A 4IWPA 2L76A 3WIMA 4FLHA 3B0AA 5HKHA 3N32A 2RSUA 3WAMA 2BPSA 4LCDE 4M8NA 4J6IA 4XX5A 2N4FA 2V1YA 3ZNZB 5LXIB 4ASWC 1Q5WB 4X57B 2NPTB 2KLGA 4EFOA 2AWTA 1NBFC 4GXBA 2Z0DB 2KLCA 2LD9A 2QHOA 4W9JA 2O2VA 3ML8A 2KWUB 3W1SA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3PGE A;  3T8M A;  2MP2 A;  2MCN B;  4HVB A;  1K8R B;  5IAA C;  4LJO B;  3NS8 A;  4KV2 A;  3UQA A;  3PTF C;  4HPM B;  4KDL B;  1R4M I;  2FCS A;  2KQ7 A;  1EF1 A;  4N9F 4;  4E74 A;  2ZPY A;  4M0W B;  2O2V B;  2CHX A;  1EF5 A;  2KTF A;  3NZU A;  3AI5 A;  2J7Q B;  1TGZ B;  2J0J A;  3PRM B;  2MP2 B;  4GSW A;  3DBL I;  4IC7 B;  2KNB A;  3VH4 B;  4GB9 A;  3L08 A;  3QC8 B;  3ZDM C;  2DZI A;  3ZVV A;  4KSK C;  4TUU A;  4BVU C;  1C3T A;  1E8Y A;  1E8Z A;  3Q3J A;  2PE6 B;  2AL6 A;  5D2M B;  1V2Y A;  4LDT B;  3VQI A;  2YVC A;  1T0Y A;  3UIN B;  4NAW A;  4WQO B;  4CO7 A;  4G0N B;  2DYB A;  1ZKH A;  1AAR A;  2NBV B;  3VDZ A;  2MBB B;  3DOW A;  3DQV A;  2RGF A;  1OTR B;  1KJT A;  3ZTC A;  3OAW A;  3IBE A;  1E8X A;  2IO2 B;  3IVF A;  3ZRF A;  3U7D A;  4DDG D;  2KD0 A;  1EO6 A;  4BKT A;  5DCN A;  3PPA A;  3KUD B;  3X0W A;  3W1S C;  4DDI D;  3VAW A;  3KUC B;  4IM0 A;  1YQB A;  2ZZP B;  3ALB A;  3NY5 A;  3QWZ B;  2BF8 B;  4OVV A;  5DPT A;  3TCA A;  2OOB B;  2NCN A;  3K9P B;  2N9P C;  4GU2 A;  4KIK B;  4TV3 A;  5KHQ A;  2KTR A;  3ZNI D;  1J19 A;  3KW5 B;  3PT2 B;  4IWO A;  2KK8 A;  2BKF A;  2JF5 A;  1NDD A;  1RRB A;  5LXH A;  1D3Z A;  3D32 A;  2KVR A;  2Z59 B;  1XQQ A;  4EZL A;  4K7U A;  2N1V A;  3L54 A;  4BOS C;  4ZRJ A;  1WZ0 A;  5E6P A;  4F8C B;  4DBG A;  3W1Y A;  2D07 B;  4MDK E;  2ZNV C;  4W9K A;  1GUA B;  2UYZ B;  2KDE B;  1V9J A;  2KTR B;  3AUL A;  3MHS D;  4FBJ B;  1P3Q U;  2NR2 A;  1SGH A;  3R66 C;  4NPN A;  2FNJ B;  2BYV E;  2K25 A;  2KJH B;  2PPH A;  3QAR A;  3TJP A;  3ZTD A;  2FAZ A;  2WX0 A;  4FHK A;  3DPD A;  4M8M A;  2PEA A;  1J8C A;  4TQ0 A;  4MM3 A;  1QZE A;  3CST A;  4JGH B;  4BKS A;  1HE8 A;  3DBH I;  1WXS A;  3WA0 A;  4MGI E;  3SHQ A;  3APF A;  4PS8 A;  1WXM A;  3VVW B;  4ZRI A;  3PHX B;  4W9F A;  2DZK A;  4GDL A;  2GBK A;  2DYM A;  2JT4 B;  3UIP B;  3JSV B;  3KVF B;  1IPG A;  2V4L A;  2L0F A;  3IG3 A;  2KFJ A;  2M17 A;  3RUL A;  4RMA A;  5G2N A;  4EKU A;  4DK5 A;  2WX1 A;  5JHB A;  1ISN A;  4EZJ A;  1P9D U;  3V6C B;  4MJS B;  2KZR A;  2KOX A;  3VUX A;  3HM6 X;  2IY0 B;  5AZG A;  3VUY A;  4GIV A;  2VRR B;  4ICU A;  4IM2 A;  4GDL B;  2BKR B;  3PV1 A;  2CR5 A;  3OJ4 B;  2LRW A;  1OGW A;  3JYU A;  3QIJ A;  4NJ7 A;  1WXA A;  1V5T A;  2V3S A;  1GC6 A;  4HXD A;  2FID A;  4HCN B;  2ZEQ A;  1H4R A;  1RAX A;  3VTW A;  4IWQ A;  2L00 B;  4F7Z A;  4XZ4 A;  3DVN U;  3U30 A;  2JZZ A;  2XBB C;  5JH5 C;  5J2R A;  3QJZ A;  2O6V D;  3K9O B;  5D6J B;  3UQB A;  3ZRC A;  4BFR A;  3M3J A;  3RYT A;  4NJ6 A;  4DHJ D;  1OEY J;  4JL9 A;  3VHT C;  2O6V A;  3ZNG C;  2L05 A;  1P98 A;  3ZLZ A;  1WMH B;  4W9I A;  1EUV B;  2EMS A;  3V61 A;  3QA8 A;  2KDF B;  4FHJ A;  2BYF A;  4WWN A;  3RCZ A;  2JVC A;  3PLU A;  1WIA A;  3ECI A;  4MGK E;  2LAS A;  4AWJ A;  1KLV A;  4AUQ C;  3NOB A;  4A3P A;  1WM2 A;  1Q1O A;  2KWC A;  3HHM A;  1UH6 A;  3CMM B;  4TKN A;  1J0G A;  1WGH A;  3H7P A;  1I35 A;  2IZV B;  2KHW B;  3M95 A;  2I1J A;  2XK5 A;  1CMX B;  4F1S A;  2R2O A;  5JHA A;  3QAQ A;  2MSE D;  3H7S A;  5FR6 A;  3B08 A;  2M4N A;  3R7R A;  3AU4 A;  4PS7 A;  2GOW A;  1LFD A;  1WZ3 A;  4URK A;  2LVP A;  4OVU A;  3S2A A;  3VXW A;  4MH0 E;  2FCQ A;  2ZVO A;  2M8S A;  2FCN A;  1WR6 E;  2AEH A;  2MLB A;  2R2Q A;  3H9D A;  3OJ3 A;  4IW0 A;  4KZC A;  3APC A;  4W9C A;  4RM8 A;  3L0W B;  4PYZ A;  2LXA A;  3MTN B;  4GN1 A;  3RUI B;  4LDT D;  2XK5 B;  3GOE A;  2RD0 A;  1KOT A;  3MJW A;  2XEW A;  4AOF A;  2L0T A;  3SD5 A;  4IG7 B;  2ZNV B;  1WGY A;  3B1L X;  1WI0 A;  2KQS A;  3DVG Y;  2PE9 A;  5BO4 B;  3OLM D;  4LJP B;  4KSL C;  2HD5 B;  3BIN A;  4ANX A;  3WAL A;  1M94 A;  2EMT A;  2K8H A;  2LZ6 A;  1H8C A;  2MW5 A;  2HE7 A;  5CHV C;  2Y5B B;  2MRP A;  5DPW A;  3ML9 A;  2KWV B;  5CX3 A;  4NAW B;  1R4N I;  1YJ1 A;  4W9D A;  2KX0 A;  1JRU A;  1BT0 A;  1VD2 A;  3HK0 A;  2NVU I;  2DZJ A;  2JRI B;  2LVQ A;  1WXV A;  2LVO A;  1LQB A;  1UGM A;  3V6E B;  1ZW7 A;  3QK0 A;  3RZW C;  2AYO B;  1E5W A;  2KMC A;  5EDS A;  3EFU A;  2KX3 A;  2GBM A;  4NNJ B;  2LRU A;  2J0K A;  5J17 A;  4GDK A;  3PHW B;  2ZJD A;  4HCP B;  3IFW B;  4HPL B;  3ZNH B;  2FIF A;  5JZE B;  5AEK B;  1V86 A;  2MA9 B;  2GBR A;  4GOC A;  1WRD B;  5J18 A;  1YD8 U;  5DPR A;  2KDI A;  1ZGU B;  2DAF A;  4BKG A;  1TZ1 A;  2KJR A;  4WJP A;  4MSM B;  1XD3 B;  3PRP B;  1GC7 A;  1TBE A;  4KZ0 A;  4JQW C;  1WJ6 A;  2CHZ A;  3R3M A;  1L2N A;  4GGQ A;  1F9J A;  4HWI B;  4AP4 C;  4B95 A;  2KC2 A;  1WH3 A;  4KVG B;  3L17 A;  5IA7 A;  2MBE A;  2L3Z A;  4G50 A;  1WX8 A;  4FN2 A;  2KMA A;  4ANU A;  2IBI B;  1OQY A;  3WAO A;  5G55 A;  2ZVN A;  5C23 A;  2DX5 B;  3BY4 B;  3A4S C;  2DHZ A;  1A5R A;  4I6N B;  3UGB B;  5D94 A;  1U4A A;  2K6D B;  3O65 B;  4WAA A;  1WJN A;  2JZ3 B;  3PRE A;  5E6O A;  3RD2 A;  2GBN A;  3QQ8 B;  4ZRK A;  2GBJ A;  3JW0 X;  2K6Q A;  3A1Q A;  2N7E A;  4PYU A;  3EC8 A;  4ANW A;  1WM3 A;  2KXJ A;  3QHT A;  4II2 B;  4EOY A;  4GMV A;  3SDL C;  3VFK A;  2RPQ A;  1V80 A;  1KM7 A;  3AU5 A;  3GZN I;  2FCM A;  4W9H A;  1Q0W B;  3A9J A;  3X23 A;  5D7G A;  4K7W A;  4CYE A;  4MGY E;  1WY8 A;  2MX2 A;  2BWF A;  2EKE C;  4YL8 A;  2G4S A;  3DDC B;  1GG3 A;  3LJ3 A;  3A1Q B;  3TL5 A;  4FA6 A;  3KYD D;  1WGR A;  1I42 A;  3KH0 A;  2J0M A;  4WWP A;  2NPT A;  4II3 B;  4WJO A;  1E90 A;  2BGF A;  1GNU A;  2CS4 A;  2IO0 B;  1Z2M A;  4B6W A;  3ONS A;  2DAJ A;  2LGY A;  2N1W A;  3L13 A;  3EHV A;  3CF6 E;  4I6L B;  1C1Y B;  3I3T B;  2C60 A;  3H1U A;  4JIO U;  3ENE A;  3N3K B;  2M0X A;  2C7H A;  1WYW B;  4HJK A;  4W9L A;  2O6V B;  1G6J A;  2CU1 A;  1UD7 A;  4A20 A;  3QCA A;  2FUH B;  3SU8 X;  4DHJ B;  1YX6 B;  3DBR I;  1LXD A;  1E7U A;  3L10 B;  4PS3 A;  4FJY A;  2RR9 A;  5L95 C;  3Q3F A;  3PZD A;  5E6N A;  2REX A;  3CSF A;  1UEL A;  4WWO A;  2KDB A;  2HTH A;  2NBW B;  3TMP B;  4ZDV A;  1S1Q B;  1S3S G;  1V6E A;  1E8W A;  1YX5 B;  2GMI C;  4K7S A;  4TQ1 A;  3H7P B;  2ZPN A;  2LWP A;  1WX7 A;  1SE9 A;  4DHZ E;  3QX1 A;  2D10 A;  2WYQ A;  4MGZ E;  3VH3 B;  2N9X A;  4ANV A;  2C7M B;  4KDI C;  2L7R A;  5CHF A;  4EUT A;  2I1K A;  3KYC D;  3T9L A;  3V60 A;  2LJ5 A;  1MG8 A;  1UBQ A;  2KJ6 A;  4WJN A;  3HM3 A;  4AJW A;  2DEN B;  2OJR A;  2IYD B;  2C9W B;  3PS6 A;  4AJY B;  4DHZ B;  3TBL D;  2KKC A;  4ICV A;  3VUW A;  2Z0E B;  2MWS B;  4FJV B;  4ZYN A;  3UF8 A;  1Y8R C;  2C7N B;  2D11 A;  4P7I A;  5AZF A;  1IP9 A;  2D3G A;  2LXC A;  2G3Q B;  2A5U A;  3ZIM A;  4DXA B;  2K8C A;  5AZH A;  1OEY A;  4W9E A;  1WE6 A;  4NQL B;  4KIK A;  5L83 A;  2IY1 B;  4G11 A;  3VTV A;  2G45 B;  2BYE A;  2JWZ A;  1UBI A;  4MEL A;  2M1M A;  5LLI A;  4EZK A;  4FUL A;  4BBN C;  3WAP A;  2CKH B;  3AXC A;  2NS5 A;  2N7D A;  3DCG A;  3M63 B;  3RZF A;  4HDO A;  2CHW A;  1LM8 B;  1V5O A;  2MBO A;  3R7Q A;  4W9G A;  4E3C A;  3ZDT A;  3UIO B;  4G3X B;  3KUZ A;  3A33 B;  2MBH A;  1RLF A;  3H6N A;  4BBN F;  4NY0 A;  1L7Y A;  1YIW A;  3WAN A;  3DVG X;  3EEC A;  2DZM A;  4GDK B;  4FAD A;  4EEW A;  2YLM A;  3NHE B;  2KN5 A;  1V49 A;  1P1A A;  1V81 A;  4MSQ B;  2JRH A;  3RT3 B;  4CHK A;  1WX9 A;  1FXT B;  2KFK A;  2PJH A;  2JY6 A;  4NQK E;  1WGG A;  4I6P A;  2LI5 A;  1UZX B;  2K1F A;  4K1R B;  1XT9 B;  2HJ8 A;  3PRZ A;  3A9K A;  1Z5S B;  4XC2 A;  1WR1 A;  2WDT B;  2JUO A;  2ZCB A;  1P0R A;  1WE7 A;  3JSV A;  2AL3 A;  2WWZ A;  1E7V A;  5DPS A;  1WF9 A;  1GJZ A;  3A4R A;  3VTU A;  3ZW3 A;  1NI2 A;  3ZUN A;  2KFK B;  5KHO A;  3L16 A;  3ZO5 B;  3V62 A;  4BKS D;  4E71 A;  2K39 A;  3LDZ E;  2IO1 B;  3C0R B;  1SIF A;  3TIX A;  1PQS A;  2W9N A;  4DWF A;  3U8Z A;  3HIZ A;  4K81 A;  1WGD A;  3PLV A;  4MJS A;  2BWE S;  3A9K B;  2B3A A;  4A3O A;  2MBQ A;  3JVZ X;  3ZKJ C;  2D2Q A;  5CTR C;  3IHP C;  4BOZ B;  4HLE A;  2JPH A;  2UWQ A;  1VCB A;  1WFY A;  2KC1 A;  3PVL A;  2IO3 B;  4JLC A;  2LUE A;  4IUM B;  1WJ4 A;  4MEM A;  1IYF A;  3M62 B;  1X1M A;  1WJU A;  2KO3 A;  4HK2 A;  3DBS A;  2G4D B;  2K8B A;  4IM3 A;  4WJQ A;  4RM9 A;  4B9K A;  1TTN A;  2DYO A;  2L8J A;  2MQJ A;  2NBU A;  3PSE B;  4FJZ A;  5GMV A;  5C1Z A;  2KAN A;  5TR5 A;  2N9E B;  4HDQ A;  5CHW A;  2A4Z A;  3P2B A;  2JXX A;  1WMH A;  2ZCC A;  3DVN V;  3APD A;  2LGX A;  2C5L C;  1RFA A;  3A9J B;  3NZS A;  2ASQ A;  2LGD A;  3N30 A;  4IWP A;  2L76 A;  3WIM A;  4FLH A;  3B0A A;  5HKH A;  3N32 A;  2RSU A;  3WAM A;  2BPS A;  4LCD E;  4M8N A;  4J6I A;  4XX5 A;  2N4F A;  2V1Y A;  3ZNZ B;  5LXI B;  4ASW C;  1Q5W B;  4X57 B;  2NPT B;  2KLG A;  4EFO A;  2AWT A;  1NBF C;  4GXB A;  2Z0D B;  2KLC A;  2LD9 A;  2QHO A;  4W9J A;  2O2V A;  3ML8 A;  2KWU B;  3W1S A; 
#chains in the Genus database with same CATH topology
 3T8M A;  3EUB 2;  3NS8 A;  1SIJ A;  4KV2 A;  3UQA A;  3B9J A;  3PTF C;  4HPM B;  1SJH D;  2KQ7 A;  1EF1 A;  1F77 A;  5EE1 A;  4RCO A;  4E74 A;  3AE4 B;  2O2V B;  2J7Q B;  4GSW A;  2N9L A;  1SE3 A;  3VH4 B;  4GB9 A;  3QC8 B;  3ZDM C;  4L1B A;  4BVU C;  5H8Y E;  1E8Y A;  3URY A;  1L4Z B;  2AL6 A;  5D2M B;  3AED B;  4LDT B;  1MFW A;  5IP4 D;  2YVC A;  3P4Q B;  1ZKH A;  2NBV B;  4YT0 B;  2MBB B;  4A55 A;  3DQV A;  2RGF A;  1J7C A;  3OAW A;  1HA5 A;  1E8X A;  2JYT A;  1QLB B;  5EE0 A;  4KX6 B;  3NUH B;  2RDH A;  1D4B A;  2XNA C;  1YN4 A;  1FPY A;  3PPA A;  1VJK A;  1YQB A;  2ZZP B;  4JX1 C;  2BF8 B;  1LO5 D;  2FUG 1;  2N9P C;  1L0X B;  2L52 A;  3KW5 B;  4ZOH C;  4IWO A;  4MT5 A;  4C80 A;  3D32 A;  4GLS C;  2Z59 B;  1ZP0 B;  4R3D A;  1FNV A;  1TKE A;  1WZ0 A;  3IXS A;  2D07 B;  1UUP A;  2UYZ B;  1ZPS A;  1TS4 A;  4FBJ B;  1P3Q U;  1F0Z A;  1SGH A;  2K25 A;  4C4V B;  2FAZ A;  1SBB B;  3ZQ4 A;  1ZOY B;  1OQR A;  1PGA A;  1WXS A;  3DBH I;  4MGI E;  1WXM A;  3DHI C;  2VZK D;  3NJT A;  1E9M A;  1V1P A;  2DYM A;  3E56 A;  3UIP B;  3JSV B;  3LXF A;  1K51 A;  2E3T A;  3GZN B;  4YTN B;  1FCC C;  2M17 A;  2D3C A;  2BS4 B;  4EKU A;  4DK5 A;  2WX1 A;  1FRD A;  3VUX A;  4P1B C;  3HM6 X;  4GDL B;  1IBX B;  3ZJV A;  3OJ4 B;  5BMH A;  1WXA A;  1V5T A;  1GC6 A;  2FID A;  4HCN B;  2ZEQ A;  2W3R A;  4IWQ A;  4XZ4 A;  5JH5 C;  2XBB C;  5J2R A;  3O13 A;  3VHT C;  1TYG B;  1DOX A;  3ZLZ A;  3V61 A;  4WWN A;  1Q1O A;  3HHM A;  3AE3 B;  2KQ4 X;  4IKG A;  4TKN A;  3TUO A;  1WGH A;  3H7P A;  2IZV B;  3SR6 A;  3NG0 A;  2MSE D;  4WAF A;  3NVZ A;  5FR6 A;  3B08 A;  3R7R A;  3N20 C;  2FCN A;  2WXM A;  1QF6 A;  5H92 C;  4PYZ A;  2LXA A;  1P7F A;  3OG5 A;  3AM9 A;  1WGY A;  2PE9 A;  3OLM D;  2INN E;  4RGM A;  2EMT A;  1H8C A;  4YSY B;  3ML9 A;  3P1M A;  2KX0 A;  1BT0 A;  1VD2 A;  1B9R A;  2DZJ A;  1WXV A;  1KRH A;  3V6E B;  1N62 A;  3QK0 A;  4YTP B;  5EE9 A;  3RNG C;  1C77 A;  4GDK A;  3ZNH B;  1HEZ E;  4WUR A;  4GOC A;  2RMM A;  1VRA B;  1ZGU B;  4MSM B;  1TBE A;  2WU2 B;  4KZ0 A;  3ETR A;  1J7A A;  1L2N A;  4GGQ A;  4B95 A;  2MJE A;  2WXG A;  4FN2 A;  1XCQ L;  1OQY A;  5G55 A;  2RPV A;  1TS2 A;  3E9S A;  4DXG A;  4I6N B;  3UGB B;  1OFF A;  2WXL A;  2YEP B;  1WJN A;  5E6O A;  2WHI A;  4MM3 B;  1NYR A;  3PO0 A;  2N7E A;  4EOY A;  1HQR D;  1C79 A;  4GMV A;  3RPF C;  2RPQ A;  2AX5 A;  1YQ3 B;  1CZP A;  1KM7 A;  4W9H A;  1TT5 B;  5TSS A;  3X23 A;  4K7W A;  2BWF A;  4YL8 A;  4BAX A;  4FA6 A;  4HJG E;  1GAQ B;  2QC8 A;  2PTL A;  2Y5P A;  1L0V B;  1I4P A;  1E90 A;  1EM7 A;  2N1W A;  3L13 A;  4NAM A;  1TKG A;  3CF6 E;  4I6L B;  1C1Y B;  2WGS A;  3I3T B;  1QOG A;  2PKO A;  4MH8 A;  1KTK A;  3N3K B;  4A90 A;  2OJW A;  4D2K A;  1WYW B;  2O6V B;  2FBW B;  1UD7 A;  3DBR I;  4P16 A;  3CSF A;  4WWO A;  2KDB A;  4XDC A;  1S3S G;  4TMA B;  1F1H A;  1WX7 A;  4XYC A;  3QX1 A;  2N9X A;  2C7M B;  1DOI A;  3T9L A;  2KYW A;  2KJ6 A;  1EWY C;  3HM3 A;  4A6Q A;  2H89 B;  2Z0E B;  1Y56 A;  1Y8R C;  1UGJ A;  2D11 A;  2LGI A;  2A5U A;  4FXC A;  1OEY A;  3PZ7 A;  2G45 B;  3DHH C;  3GB1 A;  4N6E B;  2M1M A;  1YQ4 B;  3TEY A;  1WYG A;  2N7D A;  4RH6 A;  2QEJ C;  2CHW A;  1V5O A;  2IND C;  2MBO A;  2PLP A;  3ZDT A;  3TEW A;  2SAK A;  4G3X B;  3KUZ A;  4OVZ A;  1YIW A;  2NTT A;  2YLM A;  3NHE B;  4HRO A;  1V49 A;  4MSQ B;  3RT3 B;  2BQQ A;  1FXT B;  4C4V A;  1WGG A;  1UZX B;  2JU6 X;  4ZHP A;  5JXV A;  3PRZ A;  1DYQ A;  1WR1 A;  1WE7 A;  3JSV A;  1FFV A;  1STE A;  1WF9 A;  2AQ1 B;  3A4R A;  1NI2 A;  4K3B A;  2KFK B;  5KHO A;  1A70 A;  3TIX A;  3LDZ E;  2IO1 B;  5HI1 A;  3U8Z A;  3DWG C;  3A9K B;  3JVZ X;  3IHP C;  1IBX A;  1GOZ A;  1VCB A;  2L83 A;  1TJE A;  3P4S B;  1FIQ A;  2LUE A;  1WJ4 A;  4MEM A;  3ZYY X;  2KO3 A;  4HK2 A;  4B9K A;  2L8J A;  4YTM B;  3PSE B;  4FJZ A;  2KAN A;  4HDQ A;  2JXX A;  1GB1 A;  2LGX A;  2C5L C;  1I7H A;  4YSZ B;  5LNK 1;  4FLH A;  2RDB C;  3WAM A;  4M8N A;  1XLN A;  3CIR B;  4IOI E;  1NBF C;  2Z0D B;  5IKC M;  4KGT A;  4W9J A;  3LB8 C;  1JRP A;  1FXI A;  2MP2 A;  4HVB A;  5C2T B;  3PZ8 A;  4KDL B;  2YEP F;  2FCS A;  2RDG A;  4N9F 4;  3T3O A;  3Q3N C;  2TSS A;  1EF5 A;  1XXG A;  2L32 A;  2J0J A;  2QMT A;  3DBL I;  2KNB A;  1AW7 A;  4LLG M;  4KSK C;  4TUU A;  1E8Z A;  2I2Y A;  1V2Y A;  4J3O D;  3NRZ A;  1T0Y A;  3UIN B;  5AUK A;  2X8X X;  3B2F A;  4N59 A;  2ZW0 A;  2CJO A;  3RNF C;  2JYE A;  2QIE B;  1WGK A;  2IO2 B;  4BKT A;  4JWU C;  3KUD B;  3X0W A;  5AUI A;  3W1S C;  4DDI D;  3NY5 A;  4OVV A;  3TCA A;  2V4I B;  2NCN A;  4GU2 A;  4L2Y A;  3PT2 B;  2JF5 A;  1D3Z A;  3SEB A;  4K7U A;  2N1V A;  1RWS A;  4ZRJ A;  2W3S A;  4HPP A;  4DBG A;  3BZD B;  1D5M C;  1PUT A;  4MDK E;  4W9K A;  1GUA B;  3BVG A;  2KDE B;  3Q3M C;  3AEA B;  2KTR B;  3AUL A;  1C4P A;  4NPN A;  3I9V 1;  2FNJ B;  4L23 A;  1DOY A;  5IO9 A;  2KJH B;  2PPH A;  3QAR A;  3RNA C;  3ZTD A;  2WX0 A;  4M8M A;  3L4P A;  1J8C A;  4TQ0 A;  3N1Y C;  4MM3 A;  4BKS A;  3SHQ A;  1WRI A;  2WXR A;  3APF A;  3VVW B;  1JWB D;  4W9F A;  2INP E;  3BVM A;  2JWU A;  5HHD G;  2V4L A;  4S17 A;  3IG3 A;  1RYJ A;  4RMA A;  5JHB A;  3MC0 B;  2BS3 B;  2K3U A;  2IY0 B;  5AZG A;  5C3J B;  4ICU A;  2VRR B;  4IM2 A;  4C56 C;  2CR5 A;  1SB3 C;  5G5H A;  5HFY A;  2V3S A;  2D5G A;  1M4V A;  1I4G A;  2BB6 A;  2PIA A;  1V1O A;  3U30 A;  2JZZ A;  4LNF A;  4YSX B;  4DQO C;  3K9O B;  1XLO A;  3ZRC A;  4DHJ D;  4AS1 A;  1OEY J;  5D3D A;  2O6V A;  3ZNG C;  4W9I A;  1EUV B;  3QA8 A;  1N63 A;  4ZHO A;  3B2G A;  2KAC A;  3Q8E A;  3NOB A;  1WM2 A;  2KWC A;  1QQR A;  3Q8C A;  1I35 A;  3FIL B;  4OW0 A;  2XK5 A;  2ICI A;  2J42 A;  1WZ3 A;  3VXW A;  3S2A A;  4MH0 E;  2ZVO A;  2MLB A;  2R2Q A;  3OJ3 A;  3P63 A;  4EE2 A;  4RM8 A;  4GN1 A;  3RUI B;  4LDT D;  4M01 A;  3GOE A;  4NJC A;  1KOT A;  3MJW A;  4TSS A;  2ZNV B;  2JXT A;  3BK1 A;  2ACZ B;  3B1L X;  2KQS A;  3DVG Y;  3IAS 1;  2DLB A;  3BIN A;  1AWD A;  5CHV C;  1V97 A;  1RFK A;  5CX3 A;  4NAW B;  3FAH A;  4W9D A;  1KLU D;  2JRI B;  3W5U B;  2M0A A;  2KMC A;  1E5W A;  1C4C A;  1ET9 A;  3EFU A;  5EDS A;  4NNJ B;  3UI3 A;  3PHW B;  4H2A A;  4HPL B;  4HCP B;  5JZE B;  1XLQ A;  3U7Z A;  1WRD B;  2WXP A;  3AE6 B;  2ONQ A;  1YJI A;  2DAF A;  4BKG A;  1FNU A;  4WJP A;  4WIP A;  1XD3 B;  3PRP B;  4REZ A;  1WJ6 A;  4AP4 C;  1F9J A;  3Q14 C;  5IA7 A;  4ANU A;  1MVK A;  2IBI B;  2ZVN A;  3MFG A;  1ZXH A;  2DHZ A;  1U4A A;  4HKZ E;  4LNI A;  2JZ3 B;  2N7J A;  3RD2 A;  2GBN A;  3EC8 A;  4AQ7 A;  2KXJ A;  3QHT A;  2WXO A;  3VFK A;  3SDL C;  1JWU D;  1AYF A;  1FNW A;  3R8B A;  3GZN I;  3AE7 B;  1Q0W B;  4LNO A;  5T8I A;  2MX2 A;  1GG3 A;  3LJ3 A;  3A1Q B;  3TL5 A;  2LMC A;  1I42 A;  3KH0 A;  3I63 C;  4OZA A;  4II3 B;  3MC9 A;  3AE9 B;  2BYT A;  1GNU A;  3ONS A;  1K50 A;  2DAJ A;  2LGY A;  2JQR B;  3RN9 C;  1ZDX A;  3IAM 1;  3RMK C;  2M0X A;  1T0Q C;  2C7H A;  5FK9 C;  3BK2 A;  1R4M B;  1IGC A;  3QCA A;  3SU8 X;  1LXD A;  1E7U A;  3L10 B;  5E6N A;  2CU3 A;  1K52 A;  1UEL A;  2KT7 A;  2GB1 A;  3TMP B;  1S1Q B;  2LWP A;  1IUE A;  2H88 B;  3V05 A;  4US9 A;  4XWT A;  2D10 A;  4MGZ E;  3VH3 B;  4KDI C;  5CHF A;  3AMZ A;  1UWM A;  1UBQ A;  2G9H D;  4WJN A;  3HVD A;  2LEK A;  2B76 B;  1N61 A;  2DEN B;  2GI9 A;  5EE3 A;  3DWM A;  4LNN A;  1L0Y B;  4ZYN A;  1KH0 A;  3UF8 A;  1E6E B;  1SJE D;  2D3G A;  1KF6 B;  3Q6B A;  3AV8 A;  4WH4 A;  3RI7 C;  3ZIM A;  1WE6 A;  2MJ3 A;  1TKY A;  1GPX A;  2QJL A;  2BYE A;  4YWG G;  1UBI A;  4MEL A;  3R2I A;  3AH7 A;  2DWQ A;  1YN5 A;  2VH1 A;  3M63 B;  3FKY A;  4HDO A;  4E3C A;  4W9G A;  1PFD A;  2MBH A;  1L7Y A;  1XO3 A;  4FAD A;  2GRI A;  2KN5 A;  1HZ5 A;  1WX9 A;  2KAJ A;  1BML C;  1IGD A;  2FE8 A;  4HEA 1;  1T0S C;  1XF5 L;  4I6P A;  2LI5 A;  2WDT B;  2ZCB A;  4KKJ A;  2WWZ A;  4RF1 A;  3V3X A;  4BKS D;  3Q2A C;  3C0R B;  4DWF A;  1SIF A;  1PQS A;  2WXN A;  1T5X D;  1WGD A;  3HIZ A;  3PLV A;  2BWE S;  2B3A A;  1N60 A;  2UWQ A;  2I38 A;  2OHF A;  1IYF A;  2G4D B;  2K8B A;  4RM9 A;  4HRS A;  3HUI A;  2NBU A;  5IOI A;  1ZXI A;  5TR5 A;  2N9E B;  1F52 A;  3P2B A;  3A9J B;  3IT6 B;  4IWP A;  1JWA D;  3B0A A;  4JWS C;  1FO4 A;  1HZ6 A;  1VDV A;  2V1Y A;  3ZNZ B;  5LXI B;  5IN7 A;  2NPT B;  1C76 A;  5BMI A;  2KLG A;  2AWT A;  2KLC A;  3FIL A;  3P4R B;  2LD9 A;  2QHO A;  1KFY B;  1N5X A;  2O2V A;  3Q8A A;  3ML8 A;  1UF0 A;  2KWU B;  1VLB A;  3PGE A;  2CJN A;  2MCN B;  3Q8F A;  1K8R B;  5IAA C;  3AEC B;  2WXI A;  4C7Z A;  2BVC A;  4M0W B;  1L5P A;  1N5W A;  3NZU A;  1TGZ B;  1MJD A;  2BB5 A;  4IC7 B;  2WU5 B;  2DZI A;  1C3T A;  2MHJ A;  3VQI A;  5E6J A;  4NAW A;  4WQO B;  4CO7 A;  4G0N B;  2DYB A;  1R4N B;  3DOW A;  1OTR B;  1KJT A;  3ZTC A;  2V3P A;  3IBE A;  2PMV A;  1TS5 A;  2W54 A;  3EFC A;  3ALB A;  4KIK B;  1ENF A;  3ZNI D;  2AQ3 B;  2BKF A;  1RRB A;  2KVR A;  2L1A A;  2V9H A;  4BOS C;  5E6P A;  4F8C B;  2WQY B;  3W1Y A;  2K0P A;  1V9J A;  3MHS D;  2NR2 A;  2BYV E;  1MHX A;  1NEK B;  3TJP A;  1EWC A;  3DPD A;  2PEA A;  1FRR A;  5D3I B;  4ZRI A;  3PHX B;  4GDL A;  4QAY A;  1XLP A;  3KVF B;  1IPG A;  2L0F A;  2INC C;  2KFJ A;  3RUL A;  5G2N A;  3KWV A;  3GS2 A;  1ISN A;  4EZJ A;  1P9D U;  4RGN A;  3P42 A;  3VUY A;  4GIV A;  2N9K A;  4ZRQ A;  1C78 A;  2LRW A;  1FXA A;  4N58 A;  1H4R A;  1SE2 A;  1RAX A;  3IT4 B;  4F7Z A;  3DVN U;  1OQQ A;  3QJZ A;  5D6J B;  3RYT A;  4NJ6 A;  1QT9 A;  1SXT A;  2Q5W D;  4JL9 A;  1WMH B;  2IGH A;  1HTQ A;  2KDF B;  4FHJ A;  2BYF A;  3RCZ A;  2JVC A;  3PLU A;  1WIA A;  4ITK A;  4MGK E;  2LAS A;  1KLV A;  4AUQ C;  4A3P A;  2QIL A;  1VR9 A;  1UH6 A;  1UNS A;  2QCZ A;  2MEK A;  3M95 A;  2R2O A;  3QAQ A;  3H7S A;  3AU4 A;  2JZP A;  4PS7 A;  2KWD A;  1XEE A;  1BXT A;  2GOW A;  2QDF A;  2M8S A;  4OZC A;  3H9D A;  4LTU A;  3VRB B;  1JWS D;  1NVI D;  3MTN B;  3BII D;  2D3B A;  3SD5 A;  1MG4 A;  3VR9 B;  5BO4 B;  3RNE C;  4LJP B;  4KSL C;  4ANX A;  2J52 A;  3WAL A;  1B1Z A;  2MW5 A;  3ZGZ A;  2Y5B B;  5DPW A;  2KWV B;  1YJ1 A;  1VZ6 A;  1JRU A;  1LQB A;  3RZW C;  2AYO B;  1JAL A;  4P1C C;  2LRU A;  2J0K A;  4XGA B;  5J17 A;  3TEX A;  2ZJD A;  3AN1 A;  2FIF A;  1V86 A;  2MA9 B;  4ZYS A;  2GBR A;  2KDM A;  1TZ1 A;  3HVZ A;  1MI0 A;  4US8 A;  1F2R I;  1P7E A;  2MH7 A;  3I57 A;  4KVG B;  4ACF A;  2MBE A;  2L3Z A;  2KMA A;  3WAO A;  3AE5 B;  1E10 A;  2IPK D;  1A5R A;  5D94 A;  2K6D B;  3O65 B;  1EU4 A;  4ZRK A;  3JW0 X;  4PYU A;  3GE8 C;  1R7S A;  1WM3 A;  4II2 B;  1V80 A;  2FCM A;  3T3N A;  3A9J A;  4CYE A;  4MGY E;  2WXQ A;  2EKE C;  3SFE B;  1L6V A;  2GLS A;  3AEE B;  2NPT A;  1D6E C;  1N6Z A;  2BGF A;  4B6W A;  2WNM A;  4WWM A;  2C60 A;  3NZ3 A;  2WDR B;  3ENE A;  1V8C A;  4W9L A;  4HJK A;  4A9A A;  2EEL A;  1G6J A;  2CU1 A;  3AE1 B;  4A20 A;  2FUH B;  4DHJ B;  1YX6 B;  4PS3 A;  2RR9 A;  4M0W A;  5BYQ A;  3R2T A;  5L95 C;  4OHJ A;  3Q3F A;  2REX A;  4ZDV A;  1V6E A;  1E8W A;  3N1Z C;  4TQ1 A;  1SE9 A;  3N9Y C;  4DHZ E;  4A8X C;  2WYQ A;  2DBY A;  4EUT A;  1TZO A;  4ANV A;  2L7R A;  3KYC D;  3AEF B;  2LJ5 A;  2M19 A;  4RGO S;  2OJR A;  1RM6 C;  4AJY B;  2C9W B;  3PS6 A;  4ICV A;  2MWS B;  4FJV B;  3OWE B;  2K8C A;  5AZH A;  4NQL B;  4KIK A;  2IY1 B;  4G11 A;  3VTV A;  1ACC A;  5LLI A;  4EZK A;  3WAP A;  4LK0 M;  2NS5 A;  3DCG A;  4XWW A;  1LM8 B;  3R7Q A;  4XE0 A;  3UIO B;  3WCQ A;  3A33 B;  3H6N A;  4NY0 A;  4M00 A;  3DVG X;  3EEC A;  2K5P A;  4EEW A;  1P1A A;  1V81 A;  2JRH A;  2PJH A;  2KFK A;  4NQK E;  3Q3O C;  2K1F A;  1C9F A;  2HJ8 A;  3DBH B;  3VRA B;  3A9K A;  1Z5S B;  1MPE A;  1P0R A;  1PDX A;  2AL3 A;  5DPS A;  4RNA A;  4ARC A;  3RFZ B;  3V62 A;  4E71 A;  2K39 A;  2J53 A;  1VZ7 A;  4KGS A;  2V3N A;  4K81 A;  1AN8 A;  2MBQ A;  2VZK B;  4BOZ B;  2JPH A;  1QKZ A;  1WFY A;  2KC1 A;  3PVL A;  1I4Q A;  4JLC A;  5HG2 A;  2G1E A;  1F2R C;  1X1M A;  1ZUD 2;  4IM3 A;  4WJQ A;  2EKI A;  1TTN A;  2DYO A;  2MQJ A;  3P4P B;  5GMV A;  5C1Z A;  3AB5 A;  2LUM A;  1WMH A;  2D3A A;  1PGX A;  2ZCC A;  1RFA A;  3NZS A;  2Y3A A;  2ASQ A;  3N30 A;  2BW2 A;  3WIM A;  3N32 A;  2BPS A;  4J6I A;  5BYR A;  3MC8 A;  1QOF A;  1Q5W B;  1T0R C;  4EFO A;  2ZW1 A;  4GXB A;  2WLB A;  3EGR A;  1FM0 D;  4LJO B;  3KLS X;  4USA A;  3W5V B;  1R4M I;  1T3Q A;  2ZPY A;  2CHX A;  4P6V F;  2KTF A;  3AI5 A;  4RGT A;  3PRM B;  2MP2 B;  1JML A;  3L08 A;  3ZVV A;  1FFU A;  3Q3J A;  2IDY A;  2PE6 B;  1C4A A;  1JQ4 A;  3VR8 B;  4DXF A;  2LGS A;  4M02 A;  4KKI A;  1AAR A;  2K22 A;  3VDZ A;  2V0G A;  1D5X C;  1JW9 D;  3U4E G;  3LYY A;  3ZRF A;  3IVF A;  3U7D A;  4DDG D;  2KD0 A;  1EO6 A;  1FEH A;  5DCN A;  4K3C A;  3VAW A;  3KUC B;  4IM0 A;  2IJ0 A;  3QWZ B;  2BS2 B;  4O1N A;  5DPT A;  2OOB B;  3K9P B;  4OZB A;  4TV3 A;  5KHQ A;  2KTR A;  1J19 A;  4C00 A;  2KK8 A;  1NDD A;  5LXH A;  2NMQ A;  4ARI A;  1SF0 A;  2DNF A;  1XQQ A;  4EZL A;  3L54 A;  2ZNV C;  1NYQ A;  1SSN A;  3R66 C;  1LGR A;  1CQV A;  4FHK A;  2W82 A;  1QZE A;  3CST A;  4JGH B;  1HE8 A;  3WA0 A;  4PS8 A;  1QIL A;  2WXJ A;  4JPS A;  2DZK A;  3BWU D;  1ZE3 D;  2GBK A;  2JT4 B;  1DGJ A;  3ABV B;  2ON8 A;  2IGD A;  3MHZ A;  3ZJT A;  3V6C B;  4MJS B;  2KZR A;  2KOX A;  2WP9 B;  3GP7 A;  3AE8 B;  1FCL A;  1QOA A;  2BKR B;  2HJ1 A;  3PV1 A;  1OGW A;  3JYU A;  3QIJ A;  4NJ7 A;  4RFB A;  3FC4 A;  4HXD A;  4WQM A;  3VTW A;  2L00 B;  2PVG C;  2O6V D;  2PVO D;  3UQB A;  4BFR A;  2Z8L A;  3M3J A;  5FKA C;  2KN4 A;  2UU7 A;  2L05 A;  3W9C B;  1P98 A;  2EMS A;  1ESF A;  3DBR B;  1BUI C;  1TY0 A;  3ECI A;  1JCK B;  4AWJ A;  2WDQ B;  2OED A;  3CMM B;  4RF0 A;  1J0G A;  1HXY D;  2KHW B;  3Q69 A;  2I1J A;  4F1S A;  1CMX B;  5JHA A;  2JSV X;  2WXK A;  3RNB C;  3H8H A;  5MPO A;  2M4N A;  4NZL B;  2Y5C A;  3ZJU A;  1E7P B;  3N1X C;  1TY2 A;  4URK A;  1LFD A;  2BTE A;  2LVP A;  4OVU A;  2AQ2 B;  2FCQ A;  1J7B A;  4KZC A;  4IW0 A;  1WR6 E;  2AEH A;  4W9C A;  3APC A;  3L0W B;  1K53 A;  3NS1 A;  2XK5 B;  2LHE A;  2RD0 A;  2K9X A;  3CWI A;  1JRO A;  4AOF A;  1YOV B;  2XEW A;  2L0T A;  3BYY B;  3ZXR A;  4IG7 B;  2MJD A;  2VH2 A;  1WI0 A;  1KLG D;  2HD5 B;  1M94 A;  2K8H A;  2LZ6 A;  4C7Y A;  3AE2 B;  2HE7 A;  3ZXV A;  2MRP A;  5GXG B;  1ET6 A;  1R4N I;  2WXH A;  3HK0 A;  2NVU I;  2LVQ A;  2LVO A;  1UGM A;  2WDV B;  1ZW7 A;  1CJE A;  2KX3 A;  2GBM A;  2E6X A;  3IFW B;  5AEK B;  4B0E A;  4B0M A;  2N0S B;  5J18 A;  1YD8 U;  5DPR A;  2KDI A;  3KWL A;  4XDD A;  2KJR A;  1L4D B;  3J9C A;  4MAC A;  1GC7 A;  4JQW C;  2CHZ A;  3R3M A;  4HWI B;  2KC2 A;  1WH3 A;  1NEN B;  3L17 A;  4G50 A;  2SEB D;  1WX8 A;  1I4X A;  3W2D A;  1PYW D;  5C23 A;  2DX5 B;  3BY4 B;  3A4S C;  1Q10 A;  2X38 A;  5BYS A;  4WAA A;  3PRE A;  2LFI A;  4JE3 B;  3QQ8 B;  2GBJ A;  3Q8B A;  3TEZ A;  2K6Q A;  3A1Q A;  4ANW A;  1SEB D;  1V1P B;  5G5G A;  2HTM E;  3U2S C;  5FR3 A;  3AU5 A;  3TSS A;  5D7G A;  1L6U A;  1WY8 A;  2G4S A;  3DDC B;  3KYD D;  1WGR A;  5BMG A;  1YN3 A;  2J0M A;  1CK1 A;  4WWP A;  4WJO A;  2NTS A;  1VZ8 A;  2CS4 A;  2IO0 B;  1Z2M A;  1JWM D;  3NVV A;  3EHV A;  1MHH E;  5I4D A;  1FD6 A;  4JIO U;  3H1U A;  3BYT B;  4Q2J A;  1ROE A;  2J4X A;  1QOB A;  4ZRP A;  1E0Z A;  3HRD D;  4FJY A;  1YMH E;  3PZD A;  1D5Z C;  3SFD B;  1UWX A;  2NBW B;  2HTH A;  3DBL B;  1I4H A;  1YX5 B;  2GMI C;  4K7S A;  1TIF A;  3H7P B;  2ZPN A;  3BVZ A;  2KVZ A;  3NVW A;  3AEG B;  2I1K A;  3V60 A;  1MG8 A;  4AJW A;  3KQ4 A;  2JX5 A;  2IYD B;  1EU3 A;  4DHZ B;  3TBL D;  2KKC A;  2BT6 A;  3VUW A;  1GB4 A;  2KMM A;  2C7N B;  3U52 E;  4P7I A;  3RNC C;  5AZF A;  1IP9 A;  1WXQ A;  2LXC A;  2G3Q B;  4DXA B;  2PW9 A;  4W9E A;  3MP9 A;  1XCT L;  5L83 A;  2JWZ A;  2WS3 B;  4FUL A;  4BBN C;  4KGR A;  2XN9 C;  2CKH B;  3AXC A;  3RZF A;  4PT5 A;  1I4R A;  4BZA A;  1T6B X;  1RLF A;  4BBN F;  1YJJ A;  3DHG C;  4S0R A;  3WAN A;  2DZM A;  4GDK B;  4YXD B;  4CHK A;  2LJI A;  2JY6 A;  2M56 B;  1WSP A;  1YNT E;  4K1R B;  1XT9 B;  1SE4 A;  2BBC A;  3EA6 A;  4XC2 A;  2JUO A;  3I5J C;  1E7V A;  1GJZ A;  2IGG A;  3VTU A;  3ZW3 A;  3ZUN A;  1WWT A;  3ZO5 B;  3L16 A;  2W9N A;  3NVY A;  4PK1 A;  3MJ5 A;  4MJS A;  4A3O A;  3ZKJ C;  2D2Q A;  5CTR C;  2HDE A;  4HLE A;  2LHD A;  1FMA D;  2IO3 B;  4IUM B;  3M62 B;  1WJU A;  4HKQ A;  3DBS A;  2R61 A;  3GE3 C;  1HTO A;  3C8Y A;  1NI3 A;  5CHW A;  2A4Z A;  4LNK A;  1TS3 A;  3DVN V;  3APD A;  2QSD A;  4UDU C;  2LGD A;  2L76 A;  5HKH A;  2W55 A;  2RSU A;  4IDI A;  4LCD E;  1ZDV A;  2WXF A;  3C19 A;  2N4F A;  4XX5 A;  4ASW C;  4X57 B;  4CQN A;  1PGB A;  3AEB B;  3W1S A; 
#chains in the Genus database with same CATH homology
 3PGE A;  3T8M A;  2MP2 A;  2MCN B;  4HVB A;  1K8R B;  5IAA C;  4LJO B;  3NS8 A;  4KV2 A;  3UQA A;  3PTF C;  4HPM B;  4KDL B;  1R4M I;  2FCS A;  2KQ7 A;  1EF1 A;  4N9F 4;  4E74 A;  2ZPY A;  4M0W B;  2O2V B;  2CHX A;  1EF5 A;  2KTF A;  3NZU A;  3AI5 A;  2J7Q B;  1TGZ B;  2J0J A;  3PRM B;  2MP2 B;  4GSW A;  3DBL I;  4IC7 B;  2KNB A;  3VH4 B;  4GB9 A;  3L08 A;  3QC8 B;  3ZDM C;  2DZI A;  3ZVV A;  4KSK C;  4TUU A;  4BVU C;  1C3T A;  1E8Y A;  1E8Z A;  3Q3J A;  2PE6 B;  2AL6 A;  5D2M B;  1V2Y A;  4LDT B;  3VQI A;  2YVC A;  1T0Y A;  3UIN B;  4NAW A;  4WQO B;  4CO7 A;  4G0N B;  2DYB A;  1ZKH A;  1AAR A;  2NBV B;  3VDZ A;  2MBB B;  3DOW A;  3DQV A;  2RGF A;  1OTR B;  1KJT A;  3ZTC A;  3OAW A;  3IBE A;  1E8X A;  2IO2 B;  3IVF A;  3ZRF A;  3U7D A;  4DDG D;  2KD0 A;  1EO6 A;  4BKT A;  5DCN A;  3PPA A;  3KUD B;  3X0W A;  3W1S C;  4DDI D;  3VAW A;  3KUC B;  4IM0 A;  1YQB A;  2ZZP B;  3ALB A;  3NY5 A;  3QWZ B;  2BF8 B;  4OVV A;  5DPT A;  3TCA A;  2OOB B;  2NCN A;  3K9P B;  2N9P C;  4GU2 A;  4KIK B;  4TV3 A;  5KHQ A;  2KTR A;  3ZNI D;  1J19 A;  3KW5 B;  3PT2 B;  4IWO A;  2KK8 A;  2BKF A;  2JF5 A;  1NDD A;  1RRB A;  5LXH A;  1D3Z A;  3D32 A;  2KVR A;  2Z59 B;  1XQQ A;  4EZL A;  4K7U A;  2N1V A;  3L54 A;  4BOS C;  4ZRJ A;  1WZ0 A;  5E6P A;  4F8C B;  4DBG A;  3W1Y A;  2D07 B;  4MDK E;  2ZNV C;  4W9K A;  1GUA B;  2UYZ B;  2KDE B;  1V9J A;  2KTR B;  3AUL A;  3MHS D;  4FBJ B;  1P3Q U;  2NR2 A;  1SGH A;  3R66 C;  4NPN A;  2FNJ B;  2BYV E;  2K25 A;  2KJH B;  2PPH A;  3QAR A;  3TJP A;  3ZTD A;  2FAZ A;  2WX0 A;  4FHK A;  3DPD A;  4M8M A;  2PEA A;  1J8C A;  4TQ0 A;  4MM3 A;  1QZE A;  3CST A;  4JGH B;  4BKS A;  1HE8 A;  3DBH I;  1WXS A;  3WA0 A;  4MGI E;  3SHQ A;  3APF A;  4PS8 A;  1WXM A;  3VVW B;  4ZRI A;  3PHX B;  4W9F A;  2DZK A;  4GDL A;  2GBK A;  2DYM A;  2JT4 B;  3UIP B;  3JSV B;  3KVF B;  1IPG A;  2V4L A;  2L0F A;  3IG3 A;  2KFJ A;  2M17 A;  3RUL A;  4RMA A;  5G2N A;  4EKU A;  4DK5 A;  2WX1 A;  5JHB A;  1ISN A;  4EZJ A;  1P9D U;  3V6C B;  4MJS B;  2KZR A;  2KOX A;  3VUX A;  3HM6 X;  2IY0 B;  5AZG A;  3VUY A;  4GIV A;  2VRR B;  4ICU A;  4IM2 A;  4GDL B;  2BKR B;  3PV1 A;  2CR5 A;  3OJ4 B;  2LRW A;  1OGW A;  3JYU A;  3QIJ A;  4NJ7 A;  1WXA A;  1V5T A;  2V3S A;  1GC6 A;  4HXD A;  2FID A;  4HCN B;  2ZEQ A;  1H4R A;  1RAX A;  3VTW A;  4IWQ A;  2L00 B;  4F7Z A;  4XZ4 A;  3DVN U;  3U30 A;  2JZZ A;  2XBB C;  5JH5 C;  5J2R A;  3QJZ A;  2O6V D;  3K9O B;  5D6J B;  3UQB A;  3ZRC A;  4BFR A;  3M3J A;  3RYT A;  4NJ6 A;  4DHJ D;  1OEY J;  4JL9 A;  3VHT C;  2O6V A;  3ZNG C;  2L05 A;  1P98 A;  3ZLZ A;  1WMH B;  4W9I A;  1EUV B;  2EMS A;  3V61 A;  3QA8 A;  2KDF B;  4FHJ A;  2BYF A;  4WWN A;  3RCZ A;  2JVC A;  3PLU A;  1WIA A;  3ECI A;  4MGK E;  2LAS A;  4AWJ A;  1KLV A;  4AUQ C;  3NOB A;  4A3P A;  1WM2 A;  1Q1O A;  2KWC A;  3HHM A;  1UH6 A;  3CMM B;  4TKN A;  1J0G A;  1WGH A;  3H7P A;  1I35 A;  2IZV B;  2KHW B;  3M95 A;  2I1J A;  2XK5 A;  1CMX B;  4F1S A;  2R2O A;  5JHA A;  3QAQ A;  2MSE D;  3H7S A;  5FR6 A;  3B08 A;  2M4N A;  3R7R A;  3AU4 A;  4PS7 A;  2GOW A;  1LFD A;  1WZ3 A;  4URK A;  2LVP A;  4OVU A;  3S2A A;  3VXW A;  4MH0 E;  2FCQ A;  2ZVO A;  2M8S A;  2FCN A;  1WR6 E;  2AEH A;  2MLB A;  2R2Q A;  3H9D A;  3OJ3 A;  4IW0 A;  4KZC A;  3APC A;  4W9C A;  4RM8 A;  3L0W B;  4PYZ A;  2LXA A;  3MTN B;  4GN1 A;  3RUI B;  4LDT D;  2XK5 B;  3GOE A;  2RD0 A;  1KOT A;  3MJW A;  2XEW A;  4AOF A;  2L0T A;  3SD5 A;  4IG7 B;  2ZNV B;  1WGY A;  3B1L X;  1WI0 A;  2KQS A;  3DVG Y;  2PE9 A;  5BO4 B;  3OLM D;  4LJP B;  4KSL C;  2HD5 B;  3BIN A;  4ANX A;  3WAL A;  1M94 A;  2EMT A;  2K8H A;  2LZ6 A;  1H8C A;  2MW5 A;  2HE7 A;  5CHV C;  2Y5B B;  2MRP A;  5DPW A;  3ML9 A;  2KWV B;  5CX3 A;  4NAW B;  1R4N I;  1YJ1 A;  4W9D A;  2KX0 A;  1JRU A;  1BT0 A;  1VD2 A;  3HK0 A;  2NVU I;  2DZJ A;  2JRI B;  2LVQ A;  1WXV A;  2LVO A;  1LQB A;  1UGM A;  3V6E B;  1ZW7 A;  3QK0 A;  3RZW C;  2AYO B;  1E5W A;  2KMC A;  5EDS A;  3EFU A;  2KX3 A;  2GBM A;  4NNJ B;  2LRU A;  2J0K A;  5J17 A;  4GDK A;  3PHW B;  2ZJD A;  4HCP B;  3IFW B;  4HPL B;  3ZNH B;  2FIF A;  5JZE B;  5AEK B;  1V86 A;  2MA9 B;  2GBR A;  4GOC A;  1WRD B;  5J18 A;  1YD8 U;  5DPR A;  2KDI A;  1ZGU B;  2DAF A;  4BKG A;  1TZ1 A;  2KJR A;  4WJP A;  4MSM B;  1XD3 B;  3PRP B;  1GC7 A;  1TBE A;  4KZ0 A;  4JQW C;  1WJ6 A;  2CHZ A;  3R3M A;  1L2N A;  4GGQ A;  1F9J A;  4HWI B;  4AP4 C;  4B95 A;  2KC2 A;  1WH3 A;  4KVG B;  3L17 A;  5IA7 A;  2MBE A;  2L3Z A;  4G50 A;  1WX8 A;  4FN2 A;  2KMA A;  4ANU A;  2IBI B;  1OQY A;  3WAO A;  5G55 A;  2ZVN A;  5C23 A;  2DX5 B;  3BY4 B;  3A4S C;  2DHZ A;  1A5R A;  4I6N B;  3UGB B;  5D94 A;  1U4A A;  2K6D B;  3O65 B;  4WAA A;  1WJN A;  2JZ3 B;  3PRE A;  5E6O A;  3RD2 A;  2GBN A;  3QQ8 B;  4ZRK A;  2GBJ A;  3JW0 X;  2K6Q A;  3A1Q A;  2N7E A;  4PYU A;  3EC8 A;  4ANW A;  1WM3 A;  2KXJ A;  3QHT A;  4II2 B;  4EOY A;  4GMV A;  3SDL C;  3VFK A;  2RPQ A;  1V80 A;  1KM7 A;  3AU5 A;  3GZN I;  2FCM A;  4W9H A;  1Q0W B;  3A9J A;  3X23 A;  5D7G A;  4K7W A;  4CYE A;  4MGY E;  1WY8 A;  2MX2 A;  2BWF A;  2EKE C;  4YL8 A;  2G4S A;  3DDC B;  1GG3 A;  3LJ3 A;  3A1Q B;  3TL5 A;  4FA6 A;  3KYD D;  1WGR A;  1I42 A;  3KH0 A;  2J0M A;  4WWP A;  2NPT A;  4II3 B;  4WJO A;  1E90 A;  2BGF A;  1GNU A;  2CS4 A;  2IO0 B;  1Z2M A;  4B6W A;  3ONS A;  2DAJ A;  2LGY A;  2N1W A;  3L13 A;  3EHV A;  3CF6 E;  4I6L B;  1C1Y B;  3I3T B;  2C60 A;  3H1U A;  4JIO U;  3ENE A;  3N3K B;  2M0X A;  2C7H A;  1WYW B;  4HJK A;  4W9L A;  2O6V B;  1G6J A;  2CU1 A;  1UD7 A;  4A20 A;  3QCA A;  2FUH B;  3SU8 X;  4DHJ B;  1YX6 B;  3DBR I;  1LXD A;  1E7U A;  3L10 B;  4PS3 A;  4FJY A;  2RR9 A;  5L95 C;  3Q3F A;  3PZD A;  5E6N A;  2REX A;  3CSF A;  1UEL A;  4WWO A;  2KDB A;  2HTH A;  2NBW B;  3TMP B;  4ZDV A;  1S1Q B;  1S3S G;  1V6E A;  1E8W A;  1YX5 B;  2GMI C;  4K7S A;  4TQ1 A;  3H7P B;  2ZPN A;  2LWP A;  1WX7 A;  1SE9 A;  4DHZ E;  3QX1 A;  2D10 A;  2WYQ A;  4MGZ E;  3VH3 B;  2N9X A;  4ANV A;  2C7M B;  4KDI C;  2L7R A;  5CHF A;  4EUT A;  2I1K A;  3KYC D;  3T9L A;  3V60 A;  2LJ5 A;  1MG8 A;  1UBQ A;  2KJ6 A;  4WJN A;  3HM3 A;  4AJW A;  2DEN B;  2OJR A;  2IYD B;  2C9W B;  3PS6 A;  4AJY B;  4DHZ B;  3TBL D;  2KKC A;  4ICV A;  3VUW A;  2Z0E B;  2MWS B;  4FJV B;  4ZYN A;  3UF8 A;  1Y8R C;  2C7N B;  2D11 A;  4P7I A;  5AZF A;  1IP9 A;  2D3G A;  2LXC A;  2G3Q B;  2A5U A;  3ZIM A;  4DXA B;  2K8C A;  5AZH A;  1OEY A;  4W9E A;  1WE6 A;  4NQL B;  4KIK A;  5L83 A;  2IY1 B;  4G11 A;  3VTV A;  2G45 B;  2BYE A;  2JWZ A;  1UBI A;  4MEL A;  2M1M A;  5LLI A;  4EZK A;  4FUL A;  4BBN C;  3WAP A;  2CKH B;  3AXC A;  2NS5 A;  2N7D A;  3DCG A;  3M63 B;  3RZF A;  4HDO A;  2CHW A;  1LM8 B;  1V5O A;  2MBO A;  3R7Q A;  4W9G A;  4E3C A;  3ZDT A;  3UIO B;  4G3X B;  3KUZ A;  3A33 B;  2MBH A;  1RLF A;  3H6N A;  4BBN F;  4NY0 A;  1L7Y A;  1YIW A;  3WAN A;  3DVG X;  3EEC A;  2DZM A;  4GDK B;  4FAD A;  4EEW A;  2YLM A;  3NHE B;  2KN5 A;  1V49 A;  1P1A A;  1V81 A;  4MSQ B;  2JRH A;  3RT3 B;  4CHK A;  1WX9 A;  1FXT B;  2KFK A;  2PJH A;  2JY6 A;  4NQK E;  1WGG A;  4I6P A;  2LI5 A;  1UZX B;  2K1F A;  4K1R B;  1XT9 B;  2HJ8 A;  3PRZ A;  3A9K A;  1Z5S B;  4XC2 A;  1WR1 A;  2WDT B;  2JUO A;  2ZCB A;  1P0R A;  1WE7 A;  3JSV A;  2AL3 A;  2WWZ A;  1E7V A;  5DPS A;  1WF9 A;  1GJZ A;  3A4R A;  3VTU A;  3ZW3 A;  1NI2 A;  3ZUN A;  2KFK B;  5KHO A;  3L16 A;  3ZO5 B;  3V62 A;  4BKS D;  4E71 A;  2K39 A;  3LDZ E;  2IO1 B;  3C0R B;  1SIF A;  3TIX A;  1PQS A;  2W9N A;  4DWF A;  3U8Z A;  3HIZ A;  4K81 A;  1WGD A;  3PLV A;  4MJS A;  2BWE S;  3A9K B;  2B3A A;  4A3O A;  2MBQ A;  3JVZ X;  3ZKJ C;  2D2Q A;  5CTR C;  3IHP C;  4BOZ B;  4HLE A;  2JPH A;  2UWQ A;  1VCB A;  1WFY A;  2KC1 A;  3PVL A;  2IO3 B;  4JLC A;  2LUE A;  4IUM B;  1WJ4 A;  4MEM A;  1IYF A;  3M62 B;  1X1M A;  1WJU A;  2KO3 A;  4HK2 A;  3DBS A;  2G4D B;  2K8B A;  4IM3 A;  4WJQ A;  4RM9 A;  4B9K A;  1TTN A;  2DYO A;  2L8J A;  2MQJ A;  2NBU A;  3PSE B;  4FJZ A;  5GMV A;  5C1Z A;  2KAN A;  5TR5 A;  2N9E B;  4HDQ A;  5CHW A;  2A4Z A;  3P2B A;  2JXX A;  1WMH A;  2ZCC A;  3DVN V;  3APD A;  2LGX A;  2C5L C;  1RFA A;  3A9J B;  3NZS A;  2ASQ A;  2LGD A;  3N30 A;  4IWP A;  2L76 A;  3WIM A;  4FLH A;  3B0A A;  5HKH A;  3N32 A;  2RSU A;  3WAM A;  2BPS A;  4LCD E;  4M8N A;  4J6I A;  4XX5 A;  2N4F A;  2V1Y A;  3ZNZ B;  5LXI B;  4ASW C;  1Q5W B;  4X57 B;  2NPT B;  2KLG A;  4EFO A;  2AWT A;  1NBF C;  4GXB A;  2Z0D B;  2KLC A;  2LD9 A;  2QHO A;  4W9J A;  2O2V A;  3ML8 A;  2KWU B;  3W1S A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...