5CHWA

Structure of isg15 in space group p212121
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
154
structure length
154
Chain Sequence
AWDLKVKMLGGNDFLVSVTNSMTVSELKKQIAQKIGVPAFQQRLAHQTAVLQDGLTLSSLGLGPSSTVMLVVQNSSEPLSILVRNERGHSNIYEVFLTQTVDTLKKKVSQREQVHEDQFWLSFEGRPMEDKELLGEYGLKPQCTVIKHLRLRGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ubiquitin-like protein ISG15
publication title Structure of ISG15 in space group P212121
rcsb
source organism Mus musculus
molecule tags Signaling protein
total genus 37
structure length 154
sequence length 154
chains with identical sequence B, C, D, E, F, G, H, I, J
ec nomenclature
pdb deposition date 2015-07-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00240 ubiquitin Ubiquitin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 5chwA02
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 5chwA01
2D3GA 3APFA 1UBQA 5IAAC 3WA0A 1XT9B 1LXDA 4KZCA 4F7ZA 2G45B 4W9IA 4LJPB 2ZVOA 3DVNU 4IM0A 2MCNB 3APCA 2Z0DB 2HE7A 4HPMB 4B95A 3V6CB 2GBNA 1WZ3A 2KQSA 3PPAA 2CU1A 4J6IA 4PYUA 2N7EA 3KUCB 3AU5A 3DOWA 2ZJDA 4G3XB 4E3CA 4KDLB 1J0GA 2EKEC 2MBBB 1KOTA 4W9EA 2N9EB 3PLVA 1VD2A 4TQ1A 1WE6A 3QHTA 1WR6E 4K1RB 1GUAB 3R66C 4MGKE 2ZCBA 4M0WB 2DYMA 4HDOA 5JHBA 3QX1A 2L3ZA 4HCNB 1IP9A 1WYWB 2DAFA 2N4FA 4ZYNA 2FCQA 1EUVB 2KOXA 3Q3FA 1RLFA 4EZKA 4EZJA 3QJZA 3M95A 1A5RA 3VHTC 4DWFA 1SE9A 3ZIMA 4EFOA 3OJ4B 4ANVA 3JW0X 3RULA 5D94A 2IO0B 1H4RA 2NBUA 3L17A 3K9PB 2KLCA 1LM8B 3W1SA 2KDIA 4XC2A 3K9OB 1P9DU 4PYZA 2N1WA 3DBLI 2DZIA 4GIVA 3VTWA 3AXCA 2LZ6A 3DVGX 4ANXA 3GOEA 1FXTB 1WJ4A 3QIJA 2O2VB 4FJYA 4KSLC 4XX5A 5LXIB 4BKSA 4PS8A 4GU2A 2IY1B 2HD5B 3MHSD 3X23A 1R4MI 3SD5A 4DXAB 1KLVA 3QCAA 1UELA 2MRPA 3VH3B 2JT4B 2O6VA 3PLUA 3NHEB 3U7DA 4G0NB 2FNJB 4HCPB 1ZW7A 2KJRA 3A33B 5EDSA 5E6PA 1M94A 2NBWB 2PE6B 4FLHA 2K25A 2Y5BB 1L7YA 4NJ6A 5GMVA 3UQAA 2N9PC 2BKFA 1GNUA 2G4SA 2GOWA 3PZDA 4I6PA 3UF8A 4W9LA 1VCBA 2AL6A 4I6NB 4AWJA 2YLMA 3H9DA 3ZNZB 1V2YA 2I1JA 2CR5A 4DHZE 4F8CB 4W9FA 3QWZB 3WAMA 4KDIC 3A4RA 4NQLB 4YL8A 2CHWA 1GC6A 2WYQA 4ANWA 2FIFA 2LXAA 2KKCA 4KIKA 4ANUA 1IYFA 1CMXB 4GSWA 3BINA 4DK5A 1TTNA 4HDQA 3A4SC 2DYBA 3L54A 2KNBA 3VVWB 3ZRCA 1YQBA 2KWCA 4IG7B 2O2VA 4NPNA 5DPSA 2GBMA 2L7RA 3LJ3A 2EMSA 2LGYA 5AZFA 3NZUA 4FJVB 1F9JA 2IY0B 4IWPA 4GOCA 3PRZA 1LQBA 4GDLB 3SHQA 4RM8A 3JVZX 2N1VA 2GBKA 4IUMB 2BYFA 3UQBA 1WE7A 4IWQA 5L95C 4MSQB 2R2QA 3VDZA 2JWZA 4IM2A 4GB9A 3R7QA 2D11A 3CSFA 4IC7B 4GMVA 4MELA 3M63B 3OAWA 2Z0EB 2M1MA 5BO4B 2C7NB 4CYEA 3RD2A 4HWIB 4AUQC 3RYTA 5D6JB 4FBJB 2PE9A 5J18A 2KC1A 3TCAA 1G6JA 2KTFA 4KVGB 2BKRB 2JY6A 4DDGD 3P2BA 3B0AA 2L8JA 2XK5B 4HPLB 4BKSD 1XQQA 1YJ1A 2KDFB 2LGDA 3ZLZA 2JRHA 2KVRA 2YVCA 2ZPNA 2KO3A 2BPSA 1HE8A 2EMTA 2KMCA 3ONSA 4HLEA 1U4AA 2LJ5A 2O6VD 2OOBB 1Y8RC 2JXXA 4G50A 4FHJA 2XBBC 2D07B 4FJZA 2I1KA 1RAXA 5FR6A 1MG8A 5LXHA 4FHKA 4NNJB 3NOBA 4ICUA 3GZNI 3DVGY 2NR2A 2KFJA 1V81A 2REXA 5CHWA 4CHKA 3RZFA 3DBSA 3CMMB 3U8ZA 3AULA 4B9KA 1V6EA 1GC7A 1WRDB 4GDLA 2O6VB 1E5WA 2KWUB 3KUZA 3ZKJC 1UBIA 2LRUA 3MJWA 2V4LA 5C23A 4FADA 2HJ8A 5CHVC 3B1LX 3EHVA 3KYCD 4ZRKA 1UD7A 1NI2A 5JZEB 1WMHB 2K8CA 2ZPYA 5JHAA 2NPTB 1ISNA 5AZHA 2K1FA 2BF8B 4K7SA 1V86A 1LFDA 4PS3A 2FCNA 3ZUNA 3PREA 3N30A 5CHFA 2OJRA 3VXWA 2PPHA 2M4NA 4JL9A 2DYOA 2L00B 4TV3A 3TMPB 3TJPA 3L0WB 2MA9B 1YX5B 5D7GA 4MEMA 1D3ZA 2XK5A 5IA7A 3ALBA 2W9NA 4BBNC 2A5UA 2CS4A 1E8WA 1ZGUB 3A1QA 4KIKB 2DAJA 3VUYA 1GJZA 2LXCA 3UIPB 2DENB 5LLIA 5JH5C 1BT0A 2DX5B 1Q0WB 1Q1OA 1V9JA 4W9KA 4TUUA 4GXBA 3L08A 3PRMB 3VUWA 3DBHI 2L05A 4OVUA 2MBQA 4ZDVA 2KFKA 2K6DB 3L16A 4WWPA 4BOZB 3RCZA 3ECIA 3KH0A 4W9HA 4A20A 2KN5A 2MBHA 4KV2A 2D10A 3A9JB 1WM2A 3PT2B 5G2NA 4GN1A 1UZXB 4A3OA 1C3TA 1WMHA 2CHZA 1OEYJ 1WX7A 2D2QA 1WZ0A 2UYZB 1P1AA 2NPTA 2NVUI 2V1YA 2FAZA 3UGBB 3PHXB 3MTNB 3R3MA 2LUEA 4DDID 4I6LB 2C9WB 3WAOA 2ZNVC 4RM9A 5J2RA 4LCDE 1TBEA 4NQKE 3IVFA 4FN2A 1WGYA 2JUOA 3VTVA 4BKTA 1YX6B 3QQ8B 2RSUA 3B08A 4DHZB 3KVFB 2AEHA 3DBRI 4K81A 4E71A 1SIFA 4JGHB 3ZDMC 1P0RA 2MWSB 3ZDTA 3PS6A 4MH0E 3SU8X 4WWOA 4JLCA 5DCNA 1KM7A 3ZTCA 4DHJD 2A4ZA 2MBEA 1RRBA 2RPQA 4TKNA 1C1YB 1WR1A 3QARA 3T8MA 1OQYA 1P98A 1WGGA 1WM3A 4II3B 3CSTA 3V6EB 2JPHA 4A3PA 2K39A 5G55A 3TBLD 1H8CA 2NCNA 3U30A 3ZRFA 1E7UA 2ZEQA 2ASQA 2LD9A 3ZNHB 3T9LA 3IG3A 1OEYA 4BVUC 1EF5A 3A9JA 2AWTA 3H7PB 4K7WA 1X1MA 4DHJB 5J17A 3EECA 4HK2A 1WGRA 1WXMA 4AOFA 3JSVA 2WX0A 2LVOA 1WJ6A 1WF9A 4WWNA 4MGZE 3O65B 3L10B 2KMAA 4WJPA 2DZKA 3PVLA 3NZSA 1RFAA 2JZ3B 3OJ3A 2BWES 2FUHB 3C0RB 2WWZA 2MBOA 4MSMB 4WJNA 4CO7A 4GDKB 1E8YA 3KW5B 1ZKHA 3QK0A 4NJ7A 3A1QB 2FCSA 3UINB 1EF1A 2LGXA 2R2OA 3PRPB 3A9KB 2KQ7A 2J7QB 2M0XA 3CF6E 5DPWA 1EO6A 3BY4B 3VUXA 4ASWC 4BBNF 5E6OA 2RGFA 4EOYA 1UH6A 2KZRA 2KJ6A 3OLMD 3ML9A 2KFKB 4K7UA 5HKHA 3LDZE 4NY0A 2LVPA 2C60A 4IM3A 4W9CA 3EC8A 2NS5A 1JRUA 2KX0A 4WJOA 3X0WA 1V5OA 3DPDA 2CKHB 4LJOB 1Q5WB 3QA8A 3H7PA 2IO3B 3HM3A 1R4NI 2ZNVB 4HJKA 4DBGA 3PV1A 1OGWA 3WANA 4FA6A 1E90A 1NDDA 2MLBA 3N32A 2RR9A 5CTRC 1P3QU 2GBRA 3V60A 1WIAA 2NBVB 1V5TA 1WI0A 1WY8A 2IYDB 2FCMA 2J0JA 2KJHB 2KWVB 1Z2MA 3UIOB 3PTFC 2C7HA 4ICVA 2FIDA 4MJSA 2KK8A 2MW5A 1WGHA 1WJUA 2CHXA 3ZNGC 1I42A 4URKA 4GDKA 2KX3A 4WAAA 1UGMA 3L13A 3RUIB 4II2B 2L0FA 2L0TA 3A9KA 2V3SA 3DDCB 2DHZA 3IHPC 3ZO5B 1I35A 3HIZA 1WH3A 3NY5A 2L76A 3D32A 3W1YA 3WAPA 2QHOA 5L83A 2LRWA 2B3AA 1V80A 2KLGA 2PJHA 3APDA 2G4DB 2KTRB 3ZNID 2M17A 3PSEB 2UWQA 1WX9A 3JYUA 5KHQA 2HTHA 2JVCA 4GGQA 4ZRJA 4EKUA 1WX8A 4NAWB 4N9F4 4EEWA 2GBJA 1GG3A 2C7MB 1AARA 3H1UA 3Q3JA 4M8NA 4W9GA 1WXSA 2MX2A 3WIMA 3PHWB 2BYEA 1E7VA 3PGEA 1NBFC 1WXVA 2PEAA 1E8XA 3JSVB 2KANA 2IO1B 2BYVE 4JQWC 2AYOB 1S1QB 4MM3A 3M62B 4W9DA 1L2NA 3W1SC 5TR5A 4F1SA 4EUTA 5DPRA 3R7RA 3VH4B 1TZ1A 2WX1A 4AP4C 5D2MB 2MP2B 4TQ0A 3KYDD 4KSKC 2ZZPB 3VFKA 2K8BA 5AZGA 1KJTA 5KHOA 3NS8A 3QAQA 2KC2A 4XZ4A 3M3JA 4X57B 1TGZB 5AEKB 2K8HA 4M8MA 2BGFA 3H6NA 3EFUA 2MQJA 4E74A 2VRRB 4MGIE 3S2AA 3IFWB 2LWPA 4BKGA 2C5LC 4G11A 2KTRA 4AJYB 2KD0A 4WQOB 4AJWA 3I3TB 2DZJA 3HM6X 1J19A 2MSED 3HHMA 1SGHA 4NAWA 2KXJA 5E6NA 3VAWA 3VTUA 2G3QB 3H7SA 2K6QA 3TIXA 2KDBA 4BOSC 3QC8B 3SDLC 3RZWC 2N9XA 3ENEA 4PS7A 1WGDA 2ZVNA 1PQSA 2JZZA 4RMAA 3RT3B 4HXDA 4JIOU 1QZEA 4LDTD 5C1ZA 3V61A 1IPGA 1OTRB 3V62A 3WALA 3VQIA 2JF5A 2AL3A 2KDEB 3AI5A 3ZW3A 4MJSB 2N7DA 2IO2B 5CX3A 2Z59B 2MP2A 4IW0A 2J0MA 1V49A 1E8ZA 4IWOA 4HVBA 2LASA 3DVNV 4LDTB 1WJNA 3ZVVA 3HK0A 1WXAA 3IBEA 4B6WA 2GMIC 4P7IA 1Z5SB 1YD8U 1S3SG 2IBIB 2M8SA 3DQVA 4MDKE 3ZTDA 3AU4A 3N3KB 4OVVA 2BWFA 2ZCCA 1YIWA 2JRIB 3TL5A 2LVQA 2DZMA 3KUDB 2J0KA 2XEWA 4MGYE 4BFRA 5DPTA 4ZRIA 4W9JA 4EZLA 2WDTB 2RD0A 2IZVB 1J8CA 1T0YA 3DCGA 1K8RB 4FULA 1XD3B 2KHWB 3ML8A 2LI5A 1WFYA 4WJQA 4KZ0A
chains in the Genus database with same CATH superfamily
1MPEA 3U52E 1C77A 5IAAC 3WA0A 4KZCA 4W9IA 4LJPB 2UU7A 1GOZA 1WXQA 4HPMB 2Z0DB 2HE7A 4B95A 1SIJA 3DOWA 1F2RC 3RN9C 2N9EB 3SR6A 3PLVA 1VD2A 3QHTA 1WR6E 3RFZB 3R66C 4MGKE 4M0WB 5HG2A 3AB5A 4HDOA 1ET6A 1WYWB 4IOIE 2WXOA 2FCQA 2KOXA 4EZJA 3QJZA 3M95A 3RI7C 1A5RA 3VHTC 1FD6A 4L2YA 3SFDB 3GE3C 4DWFA 2PW9A 3W1SA 2KDIA 4PYZA 1YN5A 3AXCA 2LZ6A 3DVGX 4ANXA 3GOEA 3FILA 2O2VB 5LXIB 3PZ8A 3MHSD 4DXAB 3SD5A 1KLVA 3AE2B 2RDGA 4J3OD 3PLUA 5H92C 1OQRA 2KJRA 2NBWB 4FLHA 1P7FA 1FNWA 4OZBA 1GNUA 2G4SA 2FE8A 3UF8A 4AWJA 2BBCA 1ZXHA 3H9DA 2I1JA 4KDIC 3TSSA 1QILA 2BS2B 4YL8A 2WYQA 2KKCA 1ZDVA 4GSWA 4XE0A 3BINA 1WGKA 2INNE 4AS1A 4M00A 3Q8BA 3I57A 3ZRCA 2KWCA 1WSPA 5DPSA 3N9YC 2BQQA 2AX5A 4LNIA 2J42A 4GOCA 2EKIA 1WRIA 4S0RA 2AQ3B 2N1VA 2GBKA 3PO0A 1I4RA 1WE7A 4IWQA 3R7QA 1RYJA 2D11A 3NVYA 2QMTA 4GMVA 3U7ZA 3M63B 2Z0EB 2M1MA 2C7NB 4HWIB 3RYTA 5FK9C 4PT5A 3TCAA 2KTFA 4KVGB 2BKRB 3P2BA 2XK5B 2KACA 5D3IB 1T0QC 1YJ1A 1QOFA 3ZLZA 1D5ZC 1KLUD 3ONSA 4G50A 2LJ5A 4DQOC 4C80A 1Y8RC 2XBBC 4ICUA 3GZNI 2REXA 3RZFA 1F1HA 3CMMB 3AULA 1V6EA 1WRDB 2PKOA 4GDLA 2O6VB 1E5WA 2KWUB 1UBIA 2LRUA 3MJWA 2KAJA 4N59A 4ZRKA 5JZEB 2ZPYA 5E6JA 2AQ2B 2NPTB 4C4VA 3N30A 2M4NA 4JL9A 1XLNA 2DYOA 5C3JB 2G9HD 3L0WB 1E7PB 5D3DA 3P4PB 5IA7A 3ALBA 3A1QA 2DAJA 3AEGB 2LXCA 3LB8C 1BXTA 5FKAC 4QAYA 4KGRA 4KGSA 3PRMB 1RFKA 3DBHI 4OVUA 5EE9A 2KFKA 1I4HA 2K6DB 4WWPA 3ECIA 4W9HA 2KN5A 4KV2A 4YT0B 3PT2B 3V3XA 4A3OA 4L1BA 1OEYJ 1WZ0A 1P1AA 3MC8A 2QDFA 1NENB 2LUEA 4I6LB 1UUPA 4KGTA 2FUG1 2ZNVC 4RCOA 4ACFA 1WGYA 2OHFA 2JUOA 1BMLC 2ZW0A 4DHZB 2AEHA 4JGHB 3ZDMC 1P0RA 3ZDTA 3RNCC 1FNVA 3VR8B 2WXKA 3Q69A 4DHJD 1TS3A 2RPQA 1C1YB 4A3PA 1H8CA 2NCNA 1ACCA 2ZEQA 3IG3A 4LNKA 4BVUC 1EF5A 4ARIA 3H7PB 1MHHE 4K7WA 1MJDA 4ZOHC 1A70A 1WXMA 4AOFA 2LVOA 1F0ZA 4K3BA 2KMAA 2H89B 1DOYA 2DZKA 2BWES 1XO3A 1NYQA 2VZKB 2INDC 4WJNA 2WP9B 3KW5B 1C78A 2BT6A 3DBHB 2J7QB 2B76B 3V05A 1C4CA 3OLMD 4K7UA 1C76A 2JYEA 3LDZE 4NY0A 2LVPA 4IM3A 4W9CA 3X0WA 2KX0A 1V5OA 3FC4A 3DPDA 1Q5WB 1R4NI 1NVID 4DBGA 4US8A 1YNTE 1E90A 1JALA 2D3AA 3J9CA 2RR9A 1N61A 2NBVB 3P4QB 5BMGA 2KWVB 4Q2JA 3PTFC 3UIOB 2MEKA 3EUB2 3ZNGC 4URKA 5FR3A 4GDKA 3N1YC 4C56C 2L0TA 2DHZA 3IHPC 1I35A 2L76A 2EELA 2LRWA 3KWVA 2PJHA 3R8BA 2M17A 2DLBA 1C9FA 1WX9A 3MJ5A 4CQNA 4BZAA 4EKUA 4HRSA 4TSSA 4M8NA 4WH4A 1WXSA 2MX2A 3WIMA 2BYEA 2JZPA 2KANA 1JWUD 4RGMA 2WXPA 4JQWC 3URYA 4F1SA 4EUTA 5DPRA 1TZ1A 1TY0A 3RPFC 4KSKC 2K8BA 5AZGA 5AEKB 2K8HA 3H6NA 4M0WA 2MQJA 4E74A 3IFWB 2WGSA 3W9CB 4BKGA 4G11A 2GRIA 5IO9A 4WQOB 1R4NB 2MSED 2WXLA 1XLPA 3AE4B 2QCZA 3VTUA 3C19A 3TIXA 4BOSC 3QC8B 2KN4A 2WU5B 4PS7A 1PQSA 2JZZA 3RT3B 4HXDA 5C1ZA 3P1MA 3V61A 1IPGA 3RNEC 1YQ3B 2JF5A 1QOGA 3GE8C 2N7DA 1CJEA 2MP2A 4IW0A 1V49A 2GI9A 2WNMA 3IBEA 4RH6A 1YD8U 1S3SG 2DWQA 5G5GA 2IBIB 2M8SA 4MDKE 1GAQB 4N58A 3Q8AA 4OVVA 2ZCCA 1JWBD 2JRIB 3TL5A 3VR9B 4MGYE 5DPTA 4ZRIA 4EZLA 2WDTB 1FO4A 2IZVB 2IDYA 2L52A 2LGSA 4RGOS 3GB1A 3VRBB 2V3PA 4F7ZA 1R4MB 2G45B 2ZVOA 4OZAA 2KWDA 3V6CB 1WZ3A 2KQSA 1CK1A 1T6BX 2CU1A 4PYUA 2OJWA 1IGCA 3AE6B 4KDLB 1J0GA 2EKEC 2BS4B 2MBBB 1KOTA 1ZOYB 3AE9B 1WWTA 4W9EA 3TEZA 3FKYA 4C7ZA 3KWLA 2HTME 5JHBA 2LJIA 1SE4A 4HCNB 2DAFA 2N4FA 1XXGA 1RLFA 4EZKA 3R2IA 4EFOA 4RF1A 3L17A 3K9PB 3IT4B 3H8HA 3K9OB 1P9DU 4XGAB 2HDEA 2WXMA 2DZIA 3VTWA 3AEFB 2RPVA 4KSLC 4BKSA 4GU2A 5GXGB 1SB3C 3QCAA 1TKYA 2O6VA 2KYWA 1JQ4A 5EDSA 5E6PA 1M94A 2K25A 4NJ6A 3UQAA 3RNAC 1SEBD 2N9PC 1JROA 2GOWA 2IJ0A 3I9V1 2AL6A 4I6NB 2YLMA 3ZNZB 2CR5A 4F8CB 4NQLB 5BYSA 2CHWA 2M56B 4ANWA 1SJED 4DK5A 3L54A 1YN4A 4IG7B 2L7RA 3TEYA 2I2YA 2EMSA 3ZQ4A 5BMHA 2NTSA 2R61A 1LQBA 1SSNA 1VDVA 3FAHA 4EE2A 4RM8A 2BYTA 4MT5A 1N60A 2R2QA 3VDZA 4GB9A 1K52A 1FCCC 3CSFA 4UDUC 2XN9C 1FFUA 4AUQC 1AWDA 2QC8A 3B0AA 2L8JA 4HPLB 1XQQA 2LGDA 2BPSA 1VLBA 2EMTA 4XDCA 1J7CA 3RNGC 2JXXA 1DOXA 2I1KA 1I4XA 1V81A 4CHKA 2V3NA 3ZKJC 4P6VF 4FADA 3B1LX 3KYCD 2Y5CA 3BK1A 1V1OA 5JHAA 1J7AA 2CJNA 2L1AA 1IBXA 2BF8B 2INPE 1LFDA 5MPOA 1CQVA 5CHFA 2OJRA 2PPHA 1I4PA 2L00B 2MA9B 1YX5B 4BBNC 2CS4A 1E8WA 4KIKB 4A55A 3UIPB 5JH5C 2ZW1A 1BT0A 2DX5B 1V9JA 1D5XC 1J7BA 4TUUA 3U4EG 2X8XX 2L05A 2W82A 2W54A 2CJOA 5T8IA 1T0RC 2K0PA 3KH0A 1TIFA 2MBHA 3ZGZA 4GN1A 1C3TA 1WMHA 5AUKA 2IGHA 3PHXB 2K3UA 3MTNB 1PGBA 4C00A 2C9WB 2XNAC 4RM9A 4M02A 3DHGC 4NQKE 2HJ1A 3IVFA 3VTVA 1JMLA 2WXQA 1FEHA 1UNSA 2N7JA 1N5XA 2JXTA 2INCC 3AEDB 5DCNA 1WGGA 3V6EB 3CSTA 3TBLD 3U30A 3ZRFA 1E7UA 2LEKA 2W3RA 3T9LA 1OEYA 2E6XA 3A9JA 1BUIC 1X1MA 4DHJB 3EECA 4ZHOA 3BYTB 1JWSD 2WX0A 4WJPA 1TYGB 3NZSA 2JZ3B 3OJ3A 1HXYD 2X38A 3AE7B 4R3DA 4YSYB 1E8YA 1HQRD 1EM7A 2K22A 1EF1A 2R2OA 2N0SB 2M0XA 1EO6A 4WIPA 3VUXA 2TSSA 5E6OA 3NRZA 1RM6C 1RWSA 2KJ6A 3ZJTA 4OZCA 2C60A 3EC8A 1JRUA 4WJOA 3HUIA 2CKHB 4LJOB 3HM3A 4S17A 4HJKA 3PV1A 1OGWA 4FA6A 2MLBA 2GBRA 2NMQA 2RDHA 3V60A 1NEKB 1WI0A 2LHEA 3C8YA 1Z2MA 1ZDXA 2FIDA 2KK8A 2MW5A 1WGHA 1WJUA 2CHXA 1TKGA 1T3QA 3L13A 1ET9A 4II2B 1SXTA 3A9KA 3GP7A 5LNK1 4LK0M 1T0SC 4PK1A 3WAPA 5L83A 3APDA 3ZNID 2UWQA 3AEEB 4ZRJA 2AQ1B 1OFFA 4NAWB 4N9F4 1GG3A 1AARA 5EE1A 4KKIA 4W9GA 3PHWB 3ZJVA 1NBFC 2PEAA 3W2DA 3OWEB 2BYVE 3HVDA 1S1QB 4MM3A 3M62B 3DWMA 5TR5A 2L32A 1V1PA 3Q3NC 2WHIA 5D2MB 2OEDA 3KYDD 2ZZPB 3NS8A 3M3JA 2IGGA 3EFUA 3NVVA 4MGIE 4ZHPA 1KF6B 2LWPA 2KTRA 4AJYB 4AJWA 4YTPB 5BYQA 1JW9D 1PUTA 2QILA 2BW2A 5BMIA 2G3QB 3H7SA 1LO5D 4MH8A 1QT9A 3ENEA 1DGJA 2ZVNA 5JXVA 1VZ7A 3W5UB 5C2TB 4LDTD 1PDXA 5I4DA 3V62A 3VQIA 2IGDA 5IKCM 1I4GA 3AI5A 2IO2B 2Z59B 2KVZA 4P1BC 1L4DB 2LASA 3HK0A 4O1NA 1Q10A 4B6WA 1MHXA 4P7IA 4OW0A 1Z5SB 3BZDB 2DZMA 2J0KA 2KDMA 1T0YA 3DCGA 1XD3B 3DBLB 3VRAB 2KHWB 3ML8A 2LI5A 1WFYA 1HZ6A 2MH7A 1LXDA 3MFGA 3NUHB 4ARCA 3DVNU 4IM0A 2MCNB 3FILB 3PPAA 4J6IA 1MI0A 2N7EA 1NI3A 3KUCB 2WXRA 4E3CA 3P4RB 3AEAB 4K1RB 3N1XC 4AQ7A 2ZCBA 3AE8B 3RNFC 1IP9A 1SBBB 1EUVB 1HTQA 3AM9A 3EA6A 4HJGE 1SE9A 3ZIMA 3OJ4B 3ZYYX 4XC2A 2DNFA 3QIJA 1WJ4A 1WYGA 4HPPA 2WQYB 4PS8A 2IY1B 2G1EA 2HD5B 1R4MI 1VJKA 2MRPA 1FM0D 2JT4B 3NHEB 2PLPA 1QLBB 4YSZB 1ZW7A 2PE6B 1Y56A 1L7YA 1XLQA 3T3NA 3SFEB 4H2AA 2PVGC 3PZDA 4I6PA 1SE2A 4LNOA 4DHZE 3QWZB 1AN8A 3BIID 3A4RA 4LNNA 3KQ4A 4ANUA 4KIKA 1CMXB 3IAS1 3R2TA 3A4SC 2BB6A 2KNBA 3VVWB 1YQBA 2O2VA 1UGJA 1D5MC 1F9JA 2IY0B 4IWPA 3PRZA 1YN3A 4GDLB 3MHZA 3JVZX 2H88B 5L95C 1QF6A 4C4VB 4IDIA 1TS2A 3OAWA 1FXAA 3Q3MC 4CYEA 3RD2A 1VZ8A 1I4QA 4FBJB 5J18A 2KC1A 2Q5WD 1G6JA 2JY6A 4LLGM 2GLSA 1JCKB 1L6VA 2KDFB 1YJJA 2KVRA 2ZPNA 2KO3A 1KH0A 2PVOD 2WXGA 2KMCA 3B2FA 2OOBB 2YEPB 2D07B 1JWAD 4FJZA 5FR6A 1RAXA 1MG8A 3E9SA 1R7SA 3HVZA 4WAFA 3DVGY 2NR2A 2KFJA 2Y3AA 3GS2A 3DBSA 3U8ZA 3EHVA 2WDRB 1PFDA 3OG5A 2YEPF 1ISNA 3TUOA 1V86A 2FCNA 3ZUNA 3HRDD 2V0GA 3VXWA 3IT6B 4M01A 1YJIA 1L0VB 1XCTL 3TMPB 1QOBA 1ROEA 2XK5A 2W9NA 5H8YE 2A5UA 2JWUA 5LLIA 4RF0A 2Z8LA 1Q1OA 4GXBA 1B9RA 3BVGA 4BOZB 2LUMA 1AW7A 1EWYC 1HA5A 4A20A 3UI3A 1V97A 4LNFA 1P7EA 1UZXB 4RGNA 3NJTA 2CHZA 1F52A 3AECB 2D2QA 1WX7A 2UYZB 2NPTA 3UGBB 2BB5A 3R3MA 4DDID 2J52A 3WAOA 4HKZE 1LGRA 1TS4A 1TBEA 1STEA 1TKEA 4FN2A 2KQ4X 3I5JC 1YX6B 2N9KA 3B08A 3KVFB 3MC0B 1DYQA 2MWSB 3DHIC 3PS6A 1HEZE 4MH0E 3N1ZC 4WWOA 1KM7A 3ZTCA 3T8MA 1RRBA 3AE5B 3QARA 1OQYA 4RGTA 2JPHA 5G55A 4RFBA 3NVWA 2ASQA 2LD9A 1VRAB 2CU3A 2JU6X 1WGRA 1WJ6A 1WF9A 4WWNA 1QOAA 2RMMA 3L10B 2SAKA 3PVLA 1L6UA 3E56A 2WWZA 2MBOA 3O13A 1IGDA 1GB1A 2J53A 4CO7A 4GDKB 3Q8CA 2FCSA 3UINB 2DBYA 1YQ4B 2KQ7A 3U2SC 2WXFA 3CF6E 5DPWA 4ASWC 2NTTA 3ML9A 5HKHA 2LMCA 2NS5A 1I7HA 2WXNA 4BAXA 3H7PA 5EE3A 2IO3B 3NZ3A 1MG4A 2ZNVB 1HZ5A 1E10A 3WANA 1NDDA 3N32A 5CTRC 1HTOA 1V5TA 1WY8A 2IYDB 2J0JA 1GPXA 3ETRA 2C7HA 4ICVA 1TZOA 4WAAA 3BVZA 1L0XB 2L0FA 3IAM1 1T5XD 3NS1A 1WH3A 4FXCA 4WURA 2QHOA 2B3AA 2G4DB 3PSEB 3JYUA 4GGQA 4EEWA 3RNBC 2GBJA 1XEEA 2C7MB 3H1UA 2D3CA 1L0YB 3L4PA 1DOIA 5BYRA 1E7VA 1E8XA 3JSVB 1L2NA 1MVKA 5EE0A 2GB1A 3R7RA 3VH4B 2WX1A 2WDQB 2MP2B 4TQ0A 3RMKC 5KHOA 3Q3OC 3AEBB 3Q6BA 2KC2A 3QAQA 4X57B 4M8MA 2JQRB 2BGFA 4NAMA 3S2AA 2C5LC 1JRPA 3I3TB 2DZJA 3BVMA 1N6ZA 3VAWA 2K6QA 2KDBA 1C79A 3RZWC 2RDBC 5HI1A 1WGDA 4RMAA 1E6EB 4JIOU 1QZEA 4XWWA 2AL3A 1EU4A 3TEXA 4MJSB 1CZPA 3Q8EA 4HVBA 1SE3A 4WWMA 4LDTB 2D3BA 1EU3A 2WLBA 1WXAA 2GMIC 4P1CC 3DQVA 1UWXA 3ZTDA 3AU4A 1K50A 5HFYA 1FPYA 1YIWA 2E3TA 2LVQA 4BFRA 1SJHD 2XEWA 5AUIA 4OHJA 5G5HA 1D6EC 1K8RB 4FULA 2L3ZA 4KZ0A 2D3GA 3APFA 1UBQA 2LHDA 4JWUC 1XT9B 3APCA 2GBNA 1PGAA 1KLGD 3AU5A 4ITKA 2ZJDA 4G3XB 3AE1B 1XLOA 3NG0A 1K51A 4TQ1A 1ZPSA 1WE6A 1GUAB 2DYMA 3QX1A 2I38A 4ZYNA 1N5WA 3Q3FA 4XYCA 1N62A 2IPKD 4ANVA 3JW0X 3RULA 5D94A 2IO0B 1H4RA 2NBUA 1OQQA 2KLCA 1LM8B 1SF0A 4HKQA 1PYWD 2LFIA 2N1WA 3DBLI 4GIVA 3TEWA 1FXTB 1L4ZB 4FJYA 4XX5A 1N63A 3X23A 1UELA 1KRHA 3VH3B 3U7DA 4G0NB 2FNJB 4HCPB 3A33B 2Y5BB 1TT5B 2M19A 5GMVA 1ENFA 3MP9A 2BKFA 4US9A 3NVZA 2M0AA 4W9LA 1VCBA 1FIQA 1V2YA 3LYYA 4W9FA 3WAMA 3ZXRA 5IP4D 1GC6A 1VZ6A 1M4VA 3CWIA 2FIFA 4A9AA 2LXAA 1IYFA 1TTNA 4HDQA 2BS3B 2DYBA 2WDVB 3GZNB 2MJ3A 4B0EA 4A90A 1YMHE 4NPNA 2GBMA 2SEBD 3LJ3A 2BTEA 2LGYA 5AZFA 3NZUA 4FJVB 3B9JA 3KLSX 3P63A 4IKGA 1PGXA 3SHQA 4IUMB 2BYFA 1B1ZA 3UQBA 4MSQB 4YSXB 2JWZA 4IM2A 1IBXB 1QQRA 4IC7B 4MELA 5BO4B 1FFVA 2ACZB 2PTLA 5D6JB 2PE9A 3EFCA 4L23A 4DDGD 3I63C 5TSSA 4BKSD 2MJEA 1FCLA 2JRHA 2YVCA 1HE8A 4HLEA 1U4AA 2O6VD 1TY2A 3BK2A 4FHJA 1ZXIA 1E9MA 5LXHA 4FHKA 4NNJB 3NOBA 4REZA 5CHWA 4B9KA 4A6QA 1F2RI 1GC7A 3KUZA 3B2GA 4DXGA 2V4LA 5C23A 2HJ8A 4B0MA 5CHVC 4ZRPA 1UD7A 4HROA 1NI2A 1WMHB 2K8CA 4DXFA 5AZHA 4YTNB 1C4AA 1F77A 2K1FA 4K7SA 1ZUD2 4PS3A 3W5VB 3PREA 2KT7A 2L83A 4ZRQA 4TV3A 3TJPA 2WU2B 5D7GA 4MEMA 1D3ZA 2J4XA 1ZGUB 3VUYA 4LTUA 1V8CA 4D2KA 1GJZA 3BWUD 2DENB 1FNUA 4XDDA 1ZE3D 1Q0WB 4W9KA 3VUWA 3L08A 3P42A 2MBQA 4K3CA 4ZDVA 1QKZA 3L16A 3RCZA 3EGRA 1FRRA 2FBWB 5IN7A 2D10A 3A9JB 1WM2A 5G2NA 2KMMA 4JX1C 2NVUI 2V1YA 2FAZA 1JWMD 2PMVA 3LXFA 2WXHA 5J2RA 3P4SB 4LCDE 1FMAD 1TJEA 1E0ZA 1VR9A 4YTMB 1GB4A 2VH2A 3IXSA 4BKTA 2W3SA 2V4IB 3QQ8B 2RSUA 2W55A 3DBRI 4K81A 3DHHC 4HEA1 4E71A 1SIFA 3SU8X 4JLCA 2A4ZA 2MBEA 3AH7A 4TKNA 1WR1A 1P98A 1WM3A 4II3B 4USAA 2K39A 3Q8FA 4RNAA 3ZNHB 1ZP0B 2AWTA 5J17A 1YOVB 4HK2A 1KTKA 5IOIA 2ONQA 3PZ7A 3JSVA 2VZKD 4MGZE 3O65B 3SEBA 2D5GA 2JYTA 1RFAA 2FUHB 3C0RB 4MSMB 4C7YA 1ZKHA 3QK0A 4NJ7A 3A1QB 2LGXA 3PRPB 3A9KB 4KX6B 3BY4B 4P16A 4KKJA 4BBNF 2RGFA 4EOYA 1UH6A 2KZRA 2KFKB 4TMAB 2QEJC 3Q14C 3QA8A 1XF5L 2K5PA 1P3QU 4JPSA 1WIAA 2FCMA 4MM3B 2KJHB 5HHDG 2MHJA 3DBRB 4MJSA 1V1PB 1I42A 2LGIA 2N9LA 2V9HA 2KX3A 4NJCA 2PIAA 1UGMA 3RUIB 2V3SA 3DDCB 3ZO5B 3HIZA 3NY5A 2WXIA 3D32A 3W1YA 1V80A 2KLGA 2KTRB 1UWMA 4N6EB 2BVCA 5KHQA 2HTHA 2JVCA 1WX8A 1FRDA 3Q3JA 1NYRA 4OVZA 3PGEA 1WXVA 2IO1B 2AYOB 4W9DA 3W1SC 1UF0A 3BYYB 3AN1A 2MJDA 4AP4C 1K53A 1MFWA 3VFKA 1KJTA 2WXJA 4XZ4A 1TGZB 2QSDA 3MC9A 2JSVX 4WQMA 3AV8A 2VRRB 4XWTA 4YXDB 2KD0A 3AMZA 4NZLB 3HM6X 1J19A 2JX5A 3HHMA 1SGHA 4NAWA 2KXJA 5E6NA 2WS3B 2Y5PA 4JE3B 4MACA 1FXIA 3SDLC 2ON8A 2N9XA 2K9XA 3T3OA 1AYFA 1IUEA 1OTRB 3WALA 3ABVB 1D4BA 3N20C 1TS5A 2KDEB 3ZW3A 5CX3A 1KFYB 1ESFA 2J0MA 3ZJUA 1E8ZA 4IWOA 3WCQA 3DVNV 1L5PA 1WJNA 1XCQL 1C4PA 3ZVVA 3Q2AC 3AE3B 3DWGC 2ICIA 2VH1A 4A8XC 3N3KB 2BWFA 4JWSC 4YWGG 2QJLA 3KUDB 4ZYSA 4W9JA 3ZXVA 3CIRB 2RD0A 1J8CA 4GLSC 1EWCA 4WJQA 2QIEB
chains in the Genus database with same CATH topology
2D3GA 3APFA 1UBQA 5IAAC 3WA0A 1XT9B 1LXDA 4KZCA 4F7ZA 2G45B 4W9IA 4LJPB 2ZVOA 3DVNU 4IM0A 2MCNB 3APCA 2Z0DB 2HE7A 4HPMB 4B95A 3V6CB 2GBNA 1WZ3A 2KQSA 3PPAA 2CU1A 4J6IA 4PYUA 2N7EA 3KUCB 3AU5A 3DOWA 2ZJDA 4G3XB 4E3CA 4KDLB 1J0GA 2EKEC 2MBBB 1KOTA 4W9EA 2N9EB 3PLVA 1VD2A 4TQ1A 1WE6A 3QHTA 1WR6E 4K1RB 1GUAB 3R66C 4MGKE 2ZCBA 4M0WB 2DYMA 4HDOA 5JHBA 3QX1A 2L3ZA 4HCNB 1IP9A 1WYWB 2DAFA 2N4FA 4ZYNA 2FCQA 1EUVB 2KOXA 3Q3FA 1RLFA 4EZKA 4EZJA 3QJZA 3M95A 1A5RA 3VHTC 4DWFA 1SE9A 3ZIMA 4EFOA 3OJ4B 4ANVA 3JW0X 3RULA 5D94A 2IO0B 1H4RA 2NBUA 3L17A 3K9PB 2KLCA 1LM8B 3W1SA 2KDIA 4XC2A 3K9OB 1P9DU 4PYZA 2N1WA 3DBLI 2DZIA 4GIVA 3VTWA 3AXCA 2LZ6A 3DVGX 4ANXA 3GOEA 1FXTB 1WJ4A 3QIJA 2O2VB 4FJYA 4KSLC 4XX5A 5LXIB 4BKSA 4PS8A 4GU2A 2IY1B 2HD5B 3MHSD 3X23A 1R4MI 3SD5A 4DXAB 1KLVA 3QCAA 1UELA 2MRPA 3VH3B 2JT4B 2O6VA 3PLUA 3NHEB 3U7DA 4G0NB 2FNJB 4HCPB 1ZW7A 2KJRA 3A33B 5EDSA 5E6PA 1M94A 2NBWB 2PE6B 4FLHA 2K25A 2Y5BB 1L7YA 4NJ6A 5GMVA 3UQAA 2N9PC 2BKFA 1GNUA 2G4SA 2GOWA 3PZDA 4I6PA 3UF8A 4W9LA 1VCBA 2AL6A 4I6NB 4AWJA 2YLMA 3H9DA 3ZNZB 1V2YA 2I1JA 2CR5A 4DHZE 4F8CB 4W9FA 3QWZB 3WAMA 4KDIC 3A4RA 4NQLB 4YL8A 2CHWA 1GC6A 2WYQA 4ANWA 2FIFA 2LXAA 2KKCA 4KIKA 4ANUA 1IYFA 1CMXB 4GSWA 3BINA 4DK5A 1TTNA 4HDQA 3A4SC 2DYBA 3L54A 2KNBA 3VVWB 3ZRCA 1YQBA 2KWCA 4IG7B 2O2VA 4NPNA 5DPSA 2GBMA 2L7RA 3LJ3A 2EMSA 2LGYA 5AZFA 3NZUA 4FJVB 1F9JA 2IY0B 4IWPA 4GOCA 3PRZA 1LQBA 4GDLB 3SHQA 4RM8A 3JVZX 2N1VA 2GBKA 4IUMB 2BYFA 3UQBA 1WE7A 4IWQA 5L95C 4MSQB 2R2QA 3VDZA 2JWZA 4IM2A 4GB9A 3R7QA 2D11A 3CSFA 4IC7B 4GMVA 4MELA 3M63B 3OAWA 2Z0EB 2M1MA 5BO4B 2C7NB 4CYEA 3RD2A 4HWIB 4AUQC 3RYTA 5D6JB 4FBJB 2PE9A 5J18A 2KC1A 3TCAA 1G6JA 2KTFA 4KVGB 2BKRB 2JY6A 4DDGD 3P2BA 3B0AA 2L8JA 2XK5B 4HPLB 4BKSD 1XQQA 1YJ1A 2KDFB 2LGDA 3ZLZA 2JRHA 2KVRA 2YVCA 2ZPNA 2KO3A 2BPSA 1HE8A 2EMTA 2KMCA 3ONSA 4HLEA 1U4AA 2LJ5A 2O6VD 2OOBB 1Y8RC 2JXXA 4G50A 4FHJA 2XBBC 2D07B 4FJZA 2I1KA 1RAXA 5FR6A 1MG8A 5LXHA 4FHKA 4NNJB 3NOBA 4ICUA 3GZNI 3DVGY 2NR2A 2KFJA 1V81A 2REXA 5CHWA 4CHKA 3RZFA 3DBSA 3CMMB 3U8ZA 3AULA 4B9KA 1V6EA 1GC7A 1WRDB 4GDLA 2O6VB 1E5WA 2KWUB 3KUZA 3ZKJC 1UBIA 2LRUA 3MJWA 2V4LA 5C23A 4FADA 2HJ8A 5CHVC 3B1LX 3EHVA 3KYCD 4ZRKA 1UD7A 1NI2A 5JZEB 1WMHB 2K8CA 2ZPYA 5JHAA 2NPTB 1ISNA 5AZHA 2K1FA 2BF8B 4K7SA 1V86A 1LFDA 4PS3A 2FCNA 3ZUNA 3PREA 3N30A 5CHFA 2OJRA 3VXWA 2PPHA 2M4NA 4JL9A 2DYOA 2L00B 4TV3A 3TMPB 3TJPA 3L0WB 2MA9B 1YX5B 5D7GA 4MEMA 1D3ZA 2XK5A 5IA7A 3ALBA 2W9NA 4BBNC 2A5UA 2CS4A 1E8WA 1ZGUB 3A1QA 4KIKB 2DAJA 3VUYA 1GJZA 2LXCA 3UIPB 2DENB 5LLIA 5JH5C 1BT0A 2DX5B 1Q0WB 1Q1OA 1V9JA 4W9KA 4TUUA 4GXBA 3L08A 3PRMB 3VUWA 3DBHI 2L05A 4OVUA 2MBQA 4ZDVA 2KFKA 2K6DB 3L16A 4WWPA 4BOZB 3RCZA 3ECIA 3KH0A 4W9HA 4A20A 2KN5A 2MBHA 4KV2A 2D10A 3A9JB 1WM2A 3PT2B 5G2NA 4GN1A 1UZXB 4A3OA 1C3TA 1WMHA 2CHZA 1OEYJ 1WX7A 2D2QA 1WZ0A 2UYZB 1P1AA 2NPTA 2NVUI 2V1YA 2FAZA 3UGBB 3PHXB 3MTNB 3R3MA 2LUEA 4DDID 4I6LB 2C9WB 3WAOA 2ZNVC 4RM9A 5J2RA 4LCDE 1TBEA 4NQKE 3IVFA 4FN2A 1WGYA 2JUOA 3VTVA 4BKTA 1YX6B 3QQ8B 2RSUA 3B08A 4DHZB 3KVFB 2AEHA 3DBRI 4K81A 4E71A 1SIFA 4JGHB 3ZDMC 1P0RA 2MWSB 3ZDTA 3PS6A 4MH0E 3SU8X 4WWOA 4JLCA 5DCNA 1KM7A 3ZTCA 4DHJD 2A4ZA 2MBEA 1RRBA 2RPQA 4TKNA 1C1YB 1WR1A 3QARA 3T8MA 1OQYA 1P98A 1WGGA 1WM3A 4II3B 3CSTA 3V6EB 2JPHA 4A3PA 2K39A 5G55A 3TBLD 1H8CA 2NCNA 3U30A 3ZRFA 1E7UA 2ZEQA 2ASQA 2LD9A 3ZNHB 3T9LA 3IG3A 1OEYA 4BVUC 1EF5A 3A9JA 2AWTA 3H7PB 4K7WA 1X1MA 4DHJB 5J17A 3EECA 4HK2A 1WGRA 1WXMA 4AOFA 3JSVA 2WX0A 2LVOA 1WJ6A 1WF9A 4WWNA 4MGZE 3O65B 3L10B 2KMAA 4WJPA 2DZKA 3PVLA 3NZSA 1RFAA 2JZ3B 3OJ3A 2BWES 2FUHB 3C0RB 2WWZA 2MBOA 4MSMB 4WJNA 4CO7A 4GDKB 1E8YA 3KW5B 1ZKHA 3QK0A 4NJ7A 3A1QB 2FCSA 3UINB 1EF1A 2LGXA 2R2OA 3PRPB 3A9KB 2KQ7A 2J7QB 2M0XA 3CF6E 5DPWA 1EO6A 3BY4B 3VUXA 4ASWC 4BBNF 5E6OA 2RGFA 4EOYA 1UH6A 2KZRA 2KJ6A 3OLMD 3ML9A 2KFKB 4K7UA 5HKHA 3LDZE 4NY0A 2LVPA 2C60A 4IM3A 4W9CA 3EC8A 2NS5A 1JRUA 2KX0A 4WJOA 3X0WA 1V5OA 3DPDA 2CKHB 4LJOB 1Q5WB 3QA8A 3H7PA 2IO3B 3HM3A 1R4NI 2ZNVB 4HJKA 4DBGA 3PV1A 1OGWA 3WANA 4FA6A 1E90A 1NDDA 2MLBA 3N32A 2RR9A 5CTRC 1P3QU 2GBRA 3V60A 1WIAA 2NBVB 1V5TA 1WI0A 1WY8A 2IYDB 2FCMA 2J0JA 2KJHB 2KWVB 1Z2MA 3UIOB 3PTFC 2C7HA 4ICVA 2FIDA 4MJSA 2KK8A 2MW5A 1WGHA 1WJUA 2CHXA 3ZNGC 1I42A 4URKA 4GDKA 2KX3A 4WAAA 1UGMA 3L13A 3RUIB 4II2B 2L0FA 2L0TA 3A9KA 2V3SA 3DDCB 2DHZA 3IHPC 3ZO5B 1I35A 3HIZA 1WH3A 3NY5A 2L76A 3D32A 3W1YA 3WAPA 2QHOA 5L83A 2LRWA 2B3AA 1V80A 2KLGA 2PJHA 3APDA 2G4DB 2KTRB 3ZNID 2M17A 3PSEB 2UWQA 1WX9A 3JYUA 5KHQA 2HTHA 2JVCA 4GGQA 4ZRJA 4EKUA 1WX8A 4NAWB 4N9F4 4EEWA 2GBJA 1GG3A 2C7MB 1AARA 3H1UA 3Q3JA 4M8NA 4W9GA 1WXSA 2MX2A 3WIMA 3PHWB 2BYEA 1E7VA 3PGEA 1NBFC 1WXVA 2PEAA 1E8XA 3JSVB 2KANA 2IO1B 2BYVE 4JQWC 2AYOB 1S1QB 4MM3A 3M62B 4W9DA 1L2NA 3W1SC 5TR5A 4F1SA 4EUTA 5DPRA 3R7RA 3VH4B 1TZ1A 2WX1A 4AP4C 5D2MB 2MP2B 4TQ0A 3KYDD 4KSKC 2ZZPB 3VFKA 2K8BA 5AZGA 1KJTA 5KHOA 3NS8A 3QAQA 2KC2A 4XZ4A 3M3JA 4X57B 1TGZB 5AEKB 2K8HA 4M8MA 2BGFA 3H6NA 3EFUA 2MQJA 4E74A 2VRRB 4MGIE 3S2AA 3IFWB 2LWPA 4BKGA 2C5LC 4G11A 2KTRA 4AJYB 2KD0A 4WQOB 4AJWA 3I3TB 2DZJA 3HM6X 1J19A 2MSED 3HHMA 1SGHA 4NAWA 2KXJA 5E6NA 3VAWA 3VTUA 2G3QB 3H7SA 2K6QA 3TIXA 2KDBA 4BOSC 3QC8B 3SDLC 3RZWC 2N9XA 3ENEA 4PS7A 1WGDA 2ZVNA 1PQSA 2JZZA 4RMAA 3RT3B 4HXDA 4JIOU 1QZEA 4LDTD 5C1ZA 3V61A 1IPGA 1OTRB 3V62A 3WALA 3VQIA 2JF5A 2AL3A 2KDEB 3AI5A 3ZW3A 4MJSB 2N7DA 2IO2B 5CX3A 2Z59B 2MP2A 4IW0A 2J0MA 1V49A 1E8ZA 4IWOA 4HVBA 2LASA 3DVNV 4LDTB 1WJNA 3ZVVA 3HK0A 1WXAA 3IBEA 4B6WA 2GMIC 4P7IA 1Z5SB 1YD8U 1S3SG 2IBIB 2M8SA 3DQVA 4MDKE 3ZTDA 3AU4A 3N3KB 4OVVA 2BWFA 2ZCCA 1YIWA 2JRIB 3TL5A 2LVQA 2DZMA 3KUDB 2J0KA 2XEWA 4MGYE 4BFRA 5DPTA 4ZRIA 4W9JA 4EZLA 2WDTB 2RD0A 2IZVB 1J8CA 1T0YA 3DCGA 1K8RB 4FULA 1XD3B 2KHWB 3ML8A 2LI5A 1WFYA 4WJQA 4KZ0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2D3G A;  3APF A;  1UBQ A;  5IAA C;  3WA0 A;  1XT9 B;  1LXD A;  4KZC A;  4F7Z A;  2G45 B;  4W9I A;  4LJP B;  2ZVO A;  3DVN U;  4IM0 A;  2MCN B;  3APC A;  2Z0D B;  2HE7 A;  4HPM B;  4B95 A;  3V6C B;  2GBN A;  1WZ3 A;  2KQS A;  3PPA A;  2CU1 A;  4J6I A;  4PYU A;  2N7E A;  3KUC B;  3AU5 A;  3DOW A;  2ZJD A;  4G3X B;  4E3C A;  4KDL B;  1J0G A;  2EKE C;  2MBB B;  1KOT A;  4W9E A;  2N9E B;  3PLV A;  1VD2 A;  4TQ1 A;  1WE6 A;  3QHT A;  1WR6 E;  4K1R B;  1GUA B;  3R66 C;  4MGK E;  2ZCB A;  4M0W B;  2DYM A;  4HDO A;  5JHB A;  3QX1 A;  2L3Z A;  4HCN B;  1IP9 A;  1WYW B;  2DAF A;  2N4F A;  4ZYN A;  2FCQ A;  1EUV B;  2KOX A;  3Q3F A;  1RLF A;  4EZK A;  4EZJ A;  3QJZ A;  3M95 A;  1A5R A;  3VHT C;  4DWF A;  1SE9 A;  3ZIM A;  4EFO A;  3OJ4 B;  4ANV A;  3JW0 X;  3RUL A;  5D94 A;  2IO0 B;  1H4R A;  2NBU A;  3L17 A;  3K9P B;  2KLC A;  1LM8 B;  3W1S A;  2KDI A;  4XC2 A;  3K9O B;  1P9D U;  4PYZ A;  2N1W A;  3DBL I;  2DZI A;  4GIV A;  3VTW A;  3AXC A;  2LZ6 A;  3DVG X;  4ANX A;  3GOE A;  1FXT B;  1WJ4 A;  3QIJ A;  2O2V B;  4FJY A;  4KSL C;  4XX5 A;  5LXI B;  4BKS A;  4PS8 A;  4GU2 A;  2IY1 B;  2HD5 B;  3MHS D;  3X23 A;  1R4M I;  3SD5 A;  4DXA B;  1KLV A;  3QCA A;  1UEL A;  2MRP A;  3VH3 B;  2JT4 B;  2O6V A;  3PLU A;  3NHE B;  3U7D A;  4G0N B;  2FNJ B;  4HCP B;  1ZW7 A;  2KJR A;  3A33 B;  5EDS A;  5E6P A;  1M94 A;  2NBW B;  2PE6 B;  4FLH A;  2K25 A;  2Y5B B;  1L7Y A;  4NJ6 A;  5GMV A;  3UQA A;  2N9P C;  2BKF A;  1GNU A;  2G4S A;  2GOW A;  3PZD A;  4I6P A;  3UF8 A;  4W9L A;  1VCB A;  2AL6 A;  4I6N B;  4AWJ A;  2YLM A;  3H9D A;  3ZNZ B;  1V2Y A;  2I1J A;  2CR5 A;  4DHZ E;  4F8C B;  4W9F A;  3QWZ B;  3WAM A;  4KDI C;  3A4R A;  4NQL B;  4YL8 A;  2CHW A;  1GC6 A;  2WYQ A;  4ANW A;  2FIF A;  2LXA A;  2KKC A;  4KIK A;  4ANU A;  1IYF A;  1CMX B;  4GSW A;  3BIN A;  4DK5 A;  1TTN A;  4HDQ A;  3A4S C;  2DYB A;  3L54 A;  2KNB A;  3VVW B;  3ZRC A;  1YQB A;  2KWC A;  4IG7 B;  2O2V A;  4NPN A;  5DPS A;  2GBM A;  2L7R A;  3LJ3 A;  2EMS A;  2LGY A;  5AZF A;  3NZU A;  4FJV B;  1F9J A;  2IY0 B;  4IWP A;  4GOC A;  3PRZ A;  1LQB A;  4GDL B;  3SHQ A;  4RM8 A;  3JVZ X;  2N1V A;  2GBK A;  4IUM B;  2BYF A;  3UQB A;  1WE7 A;  4IWQ A;  5L95 C;  4MSQ B;  2R2Q A;  3VDZ A;  2JWZ A;  4IM2 A;  4GB9 A;  3R7Q A;  2D11 A;  3CSF A;  4IC7 B;  4GMV A;  4MEL A;  3M63 B;  3OAW A;  2Z0E B;  2M1M A;  5BO4 B;  2C7N B;  4CYE A;  3RD2 A;  4HWI B;  4AUQ C;  3RYT A;  5D6J B;  4FBJ B;  2PE9 A;  5J18 A;  2KC1 A;  3TCA A;  1G6J A;  2KTF A;  4KVG B;  2BKR B;  2JY6 A;  4DDG D;  3P2B A;  3B0A A;  2L8J A;  2XK5 B;  4HPL B;  4BKS D;  1XQQ A;  1YJ1 A;  2KDF B;  2LGD A;  3ZLZ A;  2JRH A;  2KVR A;  2YVC A;  2ZPN A;  2KO3 A;  2BPS A;  1HE8 A;  2EMT A;  2KMC A;  3ONS A;  4HLE A;  1U4A A;  2LJ5 A;  2O6V D;  2OOB B;  1Y8R C;  2JXX A;  4G50 A;  4FHJ A;  2XBB C;  2D07 B;  4FJZ A;  2I1K A;  1RAX A;  5FR6 A;  1MG8 A;  5LXH A;  4FHK A;  4NNJ B;  3NOB A;  4ICU A;  3GZN I;  3DVG Y;  2NR2 A;  2KFJ A;  1V81 A;  2REX A;  5CHW A;  4CHK A;  3RZF A;  3DBS A;  3CMM B;  3U8Z A;  3AUL A;  4B9K A;  1V6E A;  1GC7 A;  1WRD B;  4GDL A;  2O6V B;  1E5W A;  2KWU B;  3KUZ A;  3ZKJ C;  1UBI A;  2LRU A;  3MJW A;  2V4L A;  5C23 A;  4FAD A;  2HJ8 A;  5CHV C;  3B1L X;  3EHV A;  3KYC D;  4ZRK A;  1UD7 A;  1NI2 A;  5JZE B;  1WMH B;  2K8C A;  2ZPY A;  5JHA A;  2NPT B;  1ISN A;  5AZH A;  2K1F A;  2BF8 B;  4K7S A;  1V86 A;  1LFD A;  4PS3 A;  2FCN A;  3ZUN A;  3PRE A;  3N30 A;  5CHF A;  2OJR A;  3VXW A;  2PPH A;  2M4N A;  4JL9 A;  2DYO A;  2L00 B;  4TV3 A;  3TMP B;  3TJP A;  3L0W B;  2MA9 B;  1YX5 B;  5D7G A;  4MEM A;  1D3Z A;  2XK5 A;  5IA7 A;  3ALB A;  2W9N A;  4BBN C;  2A5U A;  2CS4 A;  1E8W A;  1ZGU B;  3A1Q A;  4KIK B;  2DAJ A;  3VUY A;  1GJZ A;  2LXC A;  3UIP B;  2DEN B;  5LLI A;  5JH5 C;  1BT0 A;  2DX5 B;  1Q0W B;  1Q1O A;  1V9J A;  4W9K A;  4TUU A;  4GXB A;  3L08 A;  3PRM B;  3VUW A;  3DBH I;  2L05 A;  4OVU A;  2MBQ A;  4ZDV A;  2KFK A;  2K6D B;  3L16 A;  4WWP A;  4BOZ B;  3RCZ A;  3ECI A;  3KH0 A;  4W9H A;  4A20 A;  2KN5 A;  2MBH A;  4KV2 A;  2D10 A;  3A9J B;  1WM2 A;  3PT2 B;  5G2N A;  4GN1 A;  1UZX B;  4A3O A;  1C3T A;  1WMH A;  2CHZ A;  1OEY J;  1WX7 A;  2D2Q A;  1WZ0 A;  2UYZ B;  1P1A A;  2NPT A;  2NVU I;  2V1Y A;  2FAZ A;  3UGB B;  3PHX B;  3MTN B;  3R3M A;  2LUE A;  4DDI D;  4I6L B;  2C9W B;  3WAO A;  2ZNV C;  4RM9 A;  5J2R A;  4LCD E;  1TBE A;  4NQK E;  3IVF A;  4FN2 A;  1WGY A;  2JUO A;  3VTV A;  4BKT A;  1YX6 B;  3QQ8 B;  2RSU A;  3B08 A;  4DHZ B;  3KVF B;  2AEH A;  3DBR I;  4K81 A;  4E71 A;  1SIF A;  4JGH B;  3ZDM C;  1P0R A;  2MWS B;  3ZDT A;  3PS6 A;  4MH0 E;  3SU8 X;  4WWO A;  4JLC A;  5DCN A;  1KM7 A;  3ZTC A;  4DHJ D;  2A4Z A;  2MBE A;  1RRB A;  2RPQ A;  4TKN A;  1C1Y B;  1WR1 A;  3QAR A;  3T8M A;  1OQY A;  1P98 A;  1WGG A;  1WM3 A;  4II3 B;  3CST A;  3V6E B;  2JPH A;  4A3P A;  2K39 A;  5G55 A;  3TBL D;  1H8C A;  2NCN A;  3U30 A;  3ZRF A;  1E7U A;  2ZEQ A;  2ASQ A;  2LD9 A;  3ZNH B;  3T9L A;  3IG3 A;  1OEY A;  4BVU C;  1EF5 A;  3A9J A;  2AWT A;  3H7P B;  4K7W A;  1X1M A;  4DHJ B;  5J17 A;  3EEC A;  4HK2 A;  1WGR A;  1WXM A;  4AOF A;  3JSV A;  2WX0 A;  2LVO A;  1WJ6 A;  1WF9 A;  4WWN A;  4MGZ E;  3O65 B;  3L10 B;  2KMA A;  4WJP A;  2DZK A;  3PVL A;  3NZS A;  1RFA A;  2JZ3 B;  3OJ3 A;  2BWE S;  2FUH B;  3C0R B;  2WWZ A;  2MBO A;  4MSM B;  4WJN A;  4CO7 A;  4GDK B;  1E8Y A;  3KW5 B;  1ZKH A;  3QK0 A;  4NJ7 A;  3A1Q B;  2FCS A;  3UIN B;  1EF1 A;  2LGX A;  2R2O A;  3PRP B;  3A9K B;  2KQ7 A;  2J7Q B;  2M0X A;  3CF6 E;  5DPW A;  1EO6 A;  3BY4 B;  3VUX A;  4ASW C;  4BBN F;  5E6O A;  2RGF A;  4EOY A;  1UH6 A;  2KZR A;  2KJ6 A;  3OLM D;  3ML9 A;  2KFK B;  4K7U A;  5HKH A;  3LDZ E;  4NY0 A;  2LVP A;  2C60 A;  4IM3 A;  4W9C A;  3EC8 A;  2NS5 A;  1JRU A;  2KX0 A;  4WJO A;  3X0W A;  1V5O A;  3DPD A;  2CKH B;  4LJO B;  1Q5W B;  3QA8 A;  3H7P A;  2IO3 B;  3HM3 A;  1R4N I;  2ZNV B;  4HJK A;  4DBG A;  3PV1 A;  1OGW A;  3WAN A;  4FA6 A;  1E90 A;  1NDD A;  2MLB A;  3N32 A;  2RR9 A;  5CTR C;  1P3Q U;  2GBR A;  3V60 A;  1WIA A;  2NBV B;  1V5T A;  1WI0 A;  1WY8 A;  2IYD B;  2FCM A;  2J0J A;  2KJH B;  2KWV B;  1Z2M A;  3UIO B;  3PTF C;  2C7H A;  4ICV A;  2FID A;  4MJS A;  2KK8 A;  2MW5 A;  1WGH A;  1WJU A;  2CHX A;  3ZNG C;  1I42 A;  4URK A;  4GDK A;  2KX3 A;  4WAA A;  1UGM A;  3L13 A;  3RUI B;  4II2 B;  2L0F A;  2L0T A;  3A9K A;  2V3S A;  3DDC B;  2DHZ A;  3IHP C;  3ZO5 B;  1I35 A;  3HIZ A;  1WH3 A;  3NY5 A;  2L76 A;  3D32 A;  3W1Y A;  3WAP A;  2QHO A;  5L83 A;  2LRW A;  2B3A A;  1V80 A;  2KLG A;  2PJH A;  3APD A;  2G4D B;  2KTR B;  3ZNI D;  2M17 A;  3PSE B;  2UWQ A;  1WX9 A;  3JYU A;  5KHQ A;  2HTH A;  2JVC A;  4GGQ A;  4ZRJ A;  4EKU A;  1WX8 A;  4NAW B;  4N9F 4;  4EEW A;  2GBJ A;  1GG3 A;  2C7M B;  1AAR A;  3H1U A;  3Q3J A;  4M8N A;  4W9G A;  1WXS A;  2MX2 A;  3WIM A;  3PHW B;  2BYE A;  1E7V A;  3PGE A;  1NBF C;  1WXV A;  2PEA A;  1E8X A;  3JSV B;  2KAN A;  2IO1 B;  2BYV E;  4JQW C;  2AYO B;  1S1Q B;  4MM3 A;  3M62 B;  4W9D A;  1L2N A;  3W1S C;  5TR5 A;  4F1S A;  4EUT A;  5DPR A;  3R7R A;  3VH4 B;  1TZ1 A;  2WX1 A;  4AP4 C;  5D2M B;  2MP2 B;  4TQ0 A;  3KYD D;  4KSK C;  2ZZP B;  3VFK A;  2K8B A;  5AZG A;  1KJT A;  5KHO A;  3NS8 A;  3QAQ A;  2KC2 A;  4XZ4 A;  3M3J A;  4X57 B;  1TGZ B;  5AEK B;  2K8H A;  4M8M A;  2BGF A;  3H6N A;  3EFU A;  2MQJ A;  4E74 A;  2VRR B;  4MGI E;  3S2A A;  3IFW B;  2LWP A;  4BKG A;  2C5L C;  4G11 A;  2KTR A;  4AJY B;  2KD0 A;  4WQO B;  4AJW A;  3I3T B;  2DZJ A;  3HM6 X;  1J19 A;  2MSE D;  3HHM A;  1SGH A;  4NAW A;  2KXJ A;  5E6N A;  3VAW A;  3VTU A;  2G3Q B;  3H7S A;  2K6Q A;  3TIX A;  2KDB A;  4BOS C;  3QC8 B;  3SDL C;  3RZW C;  2N9X A;  3ENE A;  4PS7 A;  1WGD A;  2ZVN A;  1PQS A;  2JZZ A;  4RMA A;  3RT3 B;  4HXD A;  4JIO U;  1QZE A;  4LDT D;  5C1Z A;  3V61 A;  1IPG A;  1OTR B;  3V62 A;  3WAL A;  3VQI A;  2JF5 A;  2AL3 A;  2KDE B;  3AI5 A;  3ZW3 A;  4MJS B;  2N7D A;  2IO2 B;  5CX3 A;  2Z59 B;  2MP2 A;  4IW0 A;  2J0M A;  1V49 A;  1E8Z A;  4IWO A;  4HVB A;  2LAS A;  3DVN V;  4LDT B;  1WJN A;  3ZVV A;  3HK0 A;  1WXA A;  3IBE A;  4B6W A;  2GMI C;  4P7I A;  1Z5S B;  1YD8 U;  1S3S G;  2IBI B;  2M8S A;  3DQV A;  4MDK E;  3ZTD A;  3AU4 A;  3N3K B;  4OVV A;  2BWF A;  2ZCC A;  1YIW A;  2JRI B;  3TL5 A;  2LVQ A;  2DZM A;  3KUD B;  2J0K A;  2XEW A;  4MGY E;  4BFR A;  5DPT A;  4ZRI A;  4W9J A;  4EZL A;  2WDT B;  2RD0 A;  2IZV B;  1J8C A;  1T0Y A;  3DCG A;  1K8R B;  4FUL A;  1XD3 B;  2KHW B;  3ML8 A;  2LI5 A;  1WFY A;  4WJQ A;  4KZ0 A; 
#chains in the Genus database with same CATH topology
 1MPE A;  3U52 E;  1C77 A;  5IAA C;  3WA0 A;  4KZC A;  4W9I A;  4LJP B;  2UU7 A;  1GOZ A;  1WXQ A;  4HPM B;  2Z0D B;  2HE7 A;  4B95 A;  1SIJ A;  3DOW A;  1F2R C;  3RN9 C;  2N9E B;  3SR6 A;  3PLV A;  1VD2 A;  3QHT A;  1WR6 E;  3RFZ B;  3R66 C;  4MGK E;  4M0W B;  5HG2 A;  3AB5 A;  4HDO A;  1ET6 A;  1WYW B;  4IOI E;  2WXO A;  2FCQ A;  2KOX A;  4EZJ A;  3QJZ A;  3M95 A;  3RI7 C;  1A5R A;  3VHT C;  1FD6 A;  4L2Y A;  3SFD B;  3GE3 C;  4DWF A;  2PW9 A;  3W1S A;  2KDI A;  4PYZ A;  1YN5 A;  3AXC A;  2LZ6 A;  3DVG X;  4ANX A;  3GOE A;  3FIL A;  2O2V B;  5LXI B;  3PZ8 A;  3MHS D;  4DXA B;  3SD5 A;  1KLV A;  3AE2 B;  2RDG A;  4J3O D;  3PLU A;  5H92 C;  1OQR A;  2KJR A;  2NBW B;  4FLH A;  1P7F A;  1FNW A;  4OZB A;  1GNU A;  2G4S A;  2FE8 A;  3UF8 A;  4AWJ A;  2BBC A;  1ZXH A;  3H9D A;  2I1J A;  4KDI C;  3TSS A;  1QIL A;  2BS2 B;  4YL8 A;  2WYQ A;  2KKC A;  1ZDV A;  4GSW A;  4XE0 A;  3BIN A;  1WGK A;  2INN E;  4AS1 A;  4M00 A;  3Q8B A;  3I57 A;  3ZRC A;  2KWC A;  1WSP A;  5DPS A;  3N9Y C;  2BQQ A;  2AX5 A;  4LNI A;  2J42 A;  4GOC A;  2EKI A;  1WRI A;  4S0R A;  2AQ3 B;  2N1V A;  2GBK A;  3PO0 A;  1I4R A;  1WE7 A;  4IWQ A;  3R7Q A;  1RYJ A;  2D11 A;  3NVY A;  2QMT A;  4GMV A;  3U7Z A;  3M63 B;  2Z0E B;  2M1M A;  2C7N B;  4HWI B;  3RYT A;  5FK9 C;  4PT5 A;  3TCA A;  2KTF A;  4KVG B;  2BKR B;  3P2B A;  2XK5 B;  2KAC A;  5D3I B;  1T0Q C;  1YJ1 A;  1QOF A;  3ZLZ A;  1D5Z C;  1KLU D;  3ONS A;  4G50 A;  2LJ5 A;  4DQO C;  4C80 A;  1Y8R C;  2XBB C;  4ICU A;  3GZN I;  2REX A;  3RZF A;  1F1H A;  3CMM B;  3AUL A;  1V6E A;  1WRD B;  2PKO A;  4GDL A;  2O6V B;  1E5W A;  2KWU B;  1UBI A;  2LRU A;  3MJW A;  2KAJ A;  4N59 A;  4ZRK A;  5JZE B;  2ZPY A;  5E6J A;  2AQ2 B;  2NPT B;  4C4V A;  3N30 A;  2M4N A;  4JL9 A;  1XLN A;  2DYO A;  5C3J B;  2G9H D;  3L0W B;  1E7P B;  5D3D A;  3P4P B;  5IA7 A;  3ALB A;  3A1Q A;  2DAJ A;  3AEG B;  2LXC A;  3LB8 C;  1BXT A;  5FKA C;  4QAY A;  4KGR A;  4KGS A;  3PRM B;  1RFK A;  3DBH I;  4OVU A;  5EE9 A;  2KFK A;  1I4H A;  2K6D B;  4WWP A;  3ECI A;  4W9H A;  2KN5 A;  4KV2 A;  4YT0 B;  3PT2 B;  3V3X A;  4A3O A;  4L1B A;  1OEY J;  1WZ0 A;  1P1A A;  3MC8 A;  2QDF A;  1NEN B;  2LUE A;  4I6L B;  1UUP A;  4KGT A;  2FUG 1;  2ZNV C;  4RCO A;  4ACF A;  1WGY A;  2OHF A;  2JUO A;  1BML C;  2ZW0 A;  4DHZ B;  2AEH A;  4JGH B;  3ZDM C;  1P0R A;  3ZDT A;  3RNC C;  1FNV A;  3VR8 B;  2WXK A;  3Q69 A;  4DHJ D;  1TS3 A;  2RPQ A;  1C1Y B;  4A3P A;  1H8C A;  2NCN A;  1ACC A;  2ZEQ A;  3IG3 A;  4LNK A;  4BVU C;  1EF5 A;  4ARI A;  3H7P B;  1MHH E;  4K7W A;  1MJD A;  4ZOH C;  1A70 A;  1WXM A;  4AOF A;  2LVO A;  1F0Z A;  4K3B A;  2KMA A;  2H89 B;  1DOY A;  2DZK A;  2BWE S;  1XO3 A;  1NYQ A;  2VZK B;  2IND C;  4WJN A;  2WP9 B;  3KW5 B;  1C78 A;  2BT6 A;  3DBH B;  2J7Q B;  2B76 B;  3V05 A;  1C4C A;  3OLM D;  4K7U A;  1C76 A;  2JYE A;  3LDZ E;  4NY0 A;  2LVP A;  4IM3 A;  4W9C A;  3X0W A;  2KX0 A;  1V5O A;  3FC4 A;  3DPD A;  1Q5W B;  1R4N I;  1NVI D;  4DBG A;  4US8 A;  1YNT E;  1E90 A;  1JAL A;  2D3A A;  3J9C A;  2RR9 A;  1N61 A;  2NBV B;  3P4Q B;  5BMG A;  2KWV B;  4Q2J A;  3PTF C;  3UIO B;  2MEK A;  3EUB 2;  3ZNG C;  4URK A;  5FR3 A;  4GDK A;  3N1Y C;  4C56 C;  2L0T A;  2DHZ A;  3IHP C;  1I35 A;  2L76 A;  2EEL A;  2LRW A;  3KWV A;  2PJH A;  3R8B A;  2M17 A;  2DLB A;  1C9F A;  1WX9 A;  3MJ5 A;  4CQN A;  4BZA A;  4EKU A;  4HRS A;  4TSS A;  4M8N A;  4WH4 A;  1WXS A;  2MX2 A;  3WIM A;  2BYE A;  2JZP A;  2KAN A;  1JWU D;  4RGM A;  2WXP A;  4JQW C;  3URY A;  4F1S A;  4EUT A;  5DPR A;  1TZ1 A;  1TY0 A;  3RPF C;  4KSK C;  2K8B A;  5AZG A;  5AEK B;  2K8H A;  3H6N A;  4M0W A;  2MQJ A;  4E74 A;  3IFW B;  2WGS A;  3W9C B;  4BKG A;  4G11 A;  2GRI A;  5IO9 A;  4WQO B;  1R4N B;  2MSE D;  2WXL A;  1XLP A;  3AE4 B;  2QCZ A;  3VTU A;  3C19 A;  3TIX A;  4BOS C;  3QC8 B;  2KN4 A;  2WU5 B;  4PS7 A;  1PQS A;  2JZZ A;  3RT3 B;  4HXD A;  5C1Z A;  3P1M A;  3V61 A;  1IPG A;  3RNE C;  1YQ3 B;  2JF5 A;  1QOG A;  3GE8 C;  2N7D A;  1CJE A;  2MP2 A;  4IW0 A;  1V49 A;  2GI9 A;  2WNM A;  3IBE A;  4RH6 A;  1YD8 U;  1S3S G;  2DWQ A;  5G5G A;  2IBI B;  2M8S A;  4MDK E;  1GAQ B;  4N58 A;  3Q8A A;  4OVV A;  2ZCC A;  1JWB D;  2JRI B;  3TL5 A;  3VR9 B;  4MGY E;  5DPT A;  4ZRI A;  4EZL A;  2WDT B;  1FO4 A;  2IZV B;  2IDY A;  2L52 A;  2LGS A;  4RGO S;  3GB1 A;  3VRB B;  2V3P A;  4F7Z A;  1R4M B;  2G45 B;  2ZVO A;  4OZA A;  2KWD A;  3V6C B;  1WZ3 A;  2KQS A;  1CK1 A;  1T6B X;  2CU1 A;  4PYU A;  2OJW A;  1IGC A;  3AE6 B;  4KDL B;  1J0G A;  2EKE C;  2BS4 B;  2MBB B;  1KOT A;  1ZOY B;  3AE9 B;  1WWT A;  4W9E A;  3TEZ A;  3FKY A;  4C7Z A;  3KWL A;  2HTM E;  5JHB A;  2LJI A;  1SE4 A;  4HCN B;  2DAF A;  2N4F A;  1XXG A;  1RLF A;  4EZK A;  3R2I A;  4EFO A;  4RF1 A;  3L17 A;  3K9P B;  3IT4 B;  3H8H A;  3K9O B;  1P9D U;  4XGA B;  2HDE A;  2WXM A;  2DZI A;  3VTW A;  3AEF B;  2RPV A;  4KSL C;  4BKS A;  4GU2 A;  5GXG B;  1SB3 C;  3QCA A;  1TKY A;  2O6V A;  2KYW A;  1JQ4 A;  5EDS A;  5E6P A;  1M94 A;  2K25 A;  4NJ6 A;  3UQA A;  3RNA C;  1SEB D;  2N9P C;  1JRO A;  2GOW A;  2IJ0 A;  3I9V 1;  2AL6 A;  4I6N B;  2YLM A;  3ZNZ B;  2CR5 A;  4F8C B;  4NQL B;  5BYS A;  2CHW A;  2M56 B;  4ANW A;  1SJE D;  4DK5 A;  3L54 A;  1YN4 A;  4IG7 B;  2L7R A;  3TEY A;  2I2Y A;  2EMS A;  3ZQ4 A;  5BMH A;  2NTS A;  2R61 A;  1LQB A;  1SSN A;  1VDV A;  3FAH A;  4EE2 A;  4RM8 A;  2BYT A;  4MT5 A;  1N60 A;  2R2Q A;  3VDZ A;  4GB9 A;  1K52 A;  1FCC C;  3CSF A;  4UDU C;  2XN9 C;  1FFU A;  4AUQ C;  1AWD A;  2QC8 A;  3B0A A;  2L8J A;  4HPL B;  1XQQ A;  2LGD A;  2BPS A;  1VLB A;  2EMT A;  4XDC A;  1J7C A;  3RNG C;  2JXX A;  1DOX A;  2I1K A;  1I4X A;  1V81 A;  4CHK A;  2V3N A;  3ZKJ C;  4P6V F;  4FAD A;  3B1L X;  3KYC D;  2Y5C A;  3BK1 A;  1V1O A;  5JHA A;  1J7A A;  2CJN A;  2L1A A;  1IBX A;  2BF8 B;  2INP E;  1LFD A;  5MPO A;  1CQV A;  5CHF A;  2OJR A;  2PPH A;  1I4P A;  2L00 B;  2MA9 B;  1YX5 B;  4BBN C;  2CS4 A;  1E8W A;  4KIK B;  4A55 A;  3UIP B;  5JH5 C;  2ZW1 A;  1BT0 A;  2DX5 B;  1V9J A;  1D5X C;  1J7B A;  4TUU A;  3U4E G;  2X8X X;  2L05 A;  2W82 A;  2W54 A;  2CJO A;  5T8I A;  1T0R C;  2K0P A;  3KH0 A;  1TIF A;  2MBH A;  3ZGZ A;  4GN1 A;  1C3T A;  1WMH A;  5AUK A;  2IGH A;  3PHX B;  2K3U A;  3MTN B;  1PGB A;  4C00 A;  2C9W B;  2XNA C;  4RM9 A;  4M02 A;  3DHG C;  4NQK E;  2HJ1 A;  3IVF A;  3VTV A;  1JML A;  2WXQ A;  1FEH A;  1UNS A;  2N7J A;  1N5X A;  2JXT A;  2INC C;  3AED B;  5DCN A;  1WGG A;  3V6E B;  3CST A;  3TBL D;  3U30 A;  3ZRF A;  1E7U A;  2LEK A;  2W3R A;  3T9L A;  1OEY A;  2E6X A;  3A9J A;  1BUI C;  1X1M A;  4DHJ B;  3EEC A;  4ZHO A;  3BYT B;  1JWS D;  2WX0 A;  4WJP A;  1TYG B;  3NZS A;  2JZ3 B;  3OJ3 A;  1HXY D;  2X38 A;  3AE7 B;  4R3D A;  4YSY B;  1E8Y A;  1HQR D;  1EM7 A;  2K22 A;  1EF1 A;  2R2O A;  2N0S B;  2M0X A;  1EO6 A;  4WIP A;  3VUX A;  2TSS A;  5E6O A;  3NRZ A;  1RM6 C;  1RWS A;  2KJ6 A;  3ZJT A;  4OZC A;  2C60 A;  3EC8 A;  1JRU A;  4WJO A;  3HUI A;  2CKH B;  4LJO B;  3HM3 A;  4S17 A;  4HJK A;  3PV1 A;  1OGW A;  4FA6 A;  2MLB A;  2GBR A;  2NMQ A;  2RDH A;  3V60 A;  1NEK B;  1WI0 A;  2LHE A;  3C8Y A;  1Z2M A;  1ZDX A;  2FID A;  2KK8 A;  2MW5 A;  1WGH A;  1WJU A;  2CHX A;  1TKG A;  1T3Q A;  3L13 A;  1ET9 A;  4II2 B;  1SXT A;  3A9K A;  3GP7 A;  5LNK 1;  4LK0 M;  1T0S C;  4PK1 A;  3WAP A;  5L83 A;  3APD A;  3ZNI D;  2UWQ A;  3AEE B;  4ZRJ A;  2AQ1 B;  1OFF A;  4NAW B;  4N9F 4;  1GG3 A;  1AAR A;  5EE1 A;  4KKI A;  4W9G A;  3PHW B;  3ZJV A;  1NBF C;  2PEA A;  3W2D A;  3OWE B;  2BYV E;  3HVD A;  1S1Q B;  4MM3 A;  3M62 B;  3DWM A;  5TR5 A;  2L32 A;  1V1P A;  3Q3N C;  2WHI A;  5D2M B;  2OED A;  3KYD D;  2ZZP B;  3NS8 A;  3M3J A;  2IGG A;  3EFU A;  3NVV A;  4MGI E;  4ZHP A;  1KF6 B;  2LWP A;  2KTR A;  4AJY B;  4AJW A;  4YTP B;  5BYQ A;  1JW9 D;  1PUT A;  2QIL A;  2BW2 A;  5BMI A;  2G3Q B;  3H7S A;  1LO5 D;  4MH8 A;  1QT9 A;  3ENE A;  1DGJ A;  2ZVN A;  5JXV A;  1VZ7 A;  3W5U B;  5C2T B;  4LDT D;  1PDX A;  5I4D A;  3V62 A;  3VQI A;  2IGD A;  5IKC M;  1I4G A;  3AI5 A;  2IO2 B;  2Z59 B;  2KVZ A;  4P1B C;  1L4D B;  2LAS A;  3HK0 A;  4O1N A;  1Q10 A;  4B6W A;  1MHX A;  4P7I A;  4OW0 A;  1Z5S B;  3BZD B;  2DZM A;  2J0K A;  2KDM A;  1T0Y A;  3DCG A;  1XD3 B;  3DBL B;  3VRA B;  2KHW B;  3ML8 A;  2LI5 A;  1WFY A;  1HZ6 A;  2MH7 A;  1LXD A;  3MFG A;  3NUH B;  4ARC A;  3DVN U;  4IM0 A;  2MCN B;  3FIL B;  3PPA A;  4J6I A;  1MI0 A;  2N7E A;  1NI3 A;  3KUC B;  2WXR A;  4E3C A;  3P4R B;  3AEA B;  4K1R B;  3N1X C;  4AQ7 A;  2ZCB A;  3AE8 B;  3RNF C;  1IP9 A;  1SBB B;  1EUV B;  1HTQ A;  3AM9 A;  3EA6 A;  4HJG E;  1SE9 A;  3ZIM A;  3OJ4 B;  3ZYY X;  4XC2 A;  2DNF A;  3QIJ A;  1WJ4 A;  1WYG A;  4HPP A;  2WQY B;  4PS8 A;  2IY1 B;  2G1E A;  2HD5 B;  1R4M I;  1VJK A;  2MRP A;  1FM0 D;  2JT4 B;  3NHE B;  2PLP A;  1QLB B;  4YSZ B;  1ZW7 A;  2PE6 B;  1Y56 A;  1L7Y A;  1XLQ A;  3T3N A;  3SFE B;  4H2A A;  2PVG C;  3PZD A;  4I6P A;  1SE2 A;  4LNO A;  4DHZ E;  3QWZ B;  1AN8 A;  3BII D;  3A4R A;  4LNN A;  3KQ4 A;  4ANU A;  4KIK A;  1CMX B;  3IAS 1;  3R2T A;  3A4S C;  2BB6 A;  2KNB A;  3VVW B;  1YQB A;  2O2V A;  1UGJ A;  1D5M C;  1F9J A;  2IY0 B;  4IWP A;  3PRZ A;  1YN3 A;  4GDL B;  3MHZ A;  3JVZ X;  2H88 B;  5L95 C;  1QF6 A;  4C4V B;  4IDI A;  1TS2 A;  3OAW A;  1FXA A;  3Q3M C;  4CYE A;  3RD2 A;  1VZ8 A;  1I4Q A;  4FBJ B;  5J18 A;  2KC1 A;  2Q5W D;  1G6J A;  2JY6 A;  4LLG M;  2GLS A;  1JCK B;  1L6V A;  2KDF B;  1YJJ A;  2KVR A;  2ZPN A;  2KO3 A;  1KH0 A;  2PVO D;  2WXG A;  2KMC A;  3B2F A;  2OOB B;  2YEP B;  2D07 B;  1JWA D;  4FJZ A;  5FR6 A;  1RAX A;  1MG8 A;  3E9S A;  1R7S A;  3HVZ A;  4WAF A;  3DVG Y;  2NR2 A;  2KFJ A;  2Y3A A;  3GS2 A;  3DBS A;  3U8Z A;  3EHV A;  2WDR B;  1PFD A;  3OG5 A;  2YEP F;  1ISN A;  3TUO A;  1V86 A;  2FCN A;  3ZUN A;  3HRD D;  2V0G A;  3VXW A;  3IT6 B;  4M01 A;  1YJI A;  1L0V B;  1XCT L;  3TMP B;  1QOB A;  1ROE A;  2XK5 A;  2W9N A;  5H8Y E;  2A5U A;  2JWU A;  5LLI A;  4RF0 A;  2Z8L A;  1Q1O A;  4GXB A;  1B9R A;  3BVG A;  4BOZ B;  2LUM A;  1AW7 A;  1EWY C;  1HA5 A;  4A20 A;  3UI3 A;  1V97 A;  4LNF A;  1P7E A;  1UZX B;  4RGN A;  3NJT A;  2CHZ A;  1F52 A;  3AEC B;  2D2Q A;  1WX7 A;  2UYZ B;  2NPT A;  3UGB B;  2BB5 A;  3R3M A;  4DDI D;  2J52 A;  3WAO A;  4HKZ E;  1LGR A;  1TS4 A;  1TBE A;  1STE A;  1TKE A;  4FN2 A;  2KQ4 X;  3I5J C;  1YX6 B;  2N9K A;  3B08 A;  3KVF B;  3MC0 B;  1DYQ A;  2MWS B;  3DHI C;  3PS6 A;  1HEZ E;  4MH0 E;  3N1Z C;  4WWO A;  1KM7 A;  3ZTC A;  3T8M A;  1RRB A;  3AE5 B;  3QAR A;  1OQY A;  4RGT A;  2JPH A;  5G55 A;  4RFB A;  3NVW A;  2ASQ A;  2LD9 A;  1VRA B;  2CU3 A;  2JU6 X;  1WGR A;  1WJ6 A;  1WF9 A;  4WWN A;  1QOA A;  2RMM A;  3L10 B;  2SAK A;  3PVL A;  1L6U A;  3E56 A;  2WWZ A;  2MBO A;  3O13 A;  1IGD A;  1GB1 A;  2J53 A;  4CO7 A;  4GDK B;  3Q8C A;  2FCS A;  3UIN B;  2DBY A;  1YQ4 B;  2KQ7 A;  3U2S C;  2WXF A;  3CF6 E;  5DPW A;  4ASW C;  2NTT A;  3ML9 A;  5HKH A;  2LMC A;  2NS5 A;  1I7H A;  2WXN A;  4BAX A;  3H7P A;  5EE3 A;  2IO3 B;  3NZ3 A;  1MG4 A;  2ZNV B;  1HZ5 A;  1E10 A;  3WAN A;  1NDD A;  3N32 A;  5CTR C;  1HTO A;  1V5T A;  1WY8 A;  2IYD B;  2J0J A;  1GPX A;  3ETR A;  2C7H A;  4ICV A;  1TZO A;  4WAA A;  3BVZ A;  1L0X B;  2L0F A;  3IAM 1;  1T5X D;  3NS1 A;  1WH3 A;  4FXC A;  4WUR A;  2QHO A;  2B3A A;  2G4D B;  3PSE B;  3JYU A;  4GGQ A;  4EEW A;  3RNB C;  2GBJ A;  1XEE A;  2C7M B;  3H1U A;  2D3C A;  1L0Y B;  3L4P A;  1DOI A;  5BYR A;  1E7V A;  1E8X A;  3JSV B;  1L2N A;  1MVK A;  5EE0 A;  2GB1 A;  3R7R A;  3VH4 B;  2WX1 A;  2WDQ B;  2MP2 B;  4TQ0 A;  3RMK C;  5KHO A;  3Q3O C;  3AEB B;  3Q6B A;  2KC2 A;  3QAQ A;  4X57 B;  4M8M A;  2JQR B;  2BGF A;  4NAM A;  3S2A A;  2C5L C;  1JRP A;  3I3T B;  2DZJ A;  3BVM A;  1N6Z A;  3VAW A;  2K6Q A;  2KDB A;  1C79 A;  3RZW C;  2RDB C;  5HI1 A;  1WGD A;  4RMA A;  1E6E B;  4JIO U;  1QZE A;  4XWW A;  2AL3 A;  1EU4 A;  3TEX A;  4MJS B;  1CZP A;  3Q8E A;  4HVB A;  1SE3 A;  4WWM A;  4LDT B;  2D3B A;  1EU3 A;  2WLB A;  1WXA A;  2GMI C;  4P1C C;  3DQV A;  1UWX A;  3ZTD A;  3AU4 A;  1K50 A;  5HFY A;  1FPY A;  1YIW A;  2E3T A;  2LVQ A;  4BFR A;  1SJH D;  2XEW A;  5AUI A;  4OHJ A;  5G5H A;  1D6E C;  1K8R B;  4FUL A;  2L3Z A;  4KZ0 A;  2D3G A;  3APF A;  1UBQ A;  2LHD A;  4JWU C;  1XT9 B;  3APC A;  2GBN A;  1PGA A;  1KLG D;  3AU5 A;  4ITK A;  2ZJD A;  4G3X B;  3AE1 B;  1XLO A;  3NG0 A;  1K51 A;  4TQ1 A;  1ZPS A;  1WE6 A;  1GUA B;  2DYM A;  3QX1 A;  2I38 A;  4ZYN A;  1N5W A;  3Q3F A;  4XYC A;  1N62 A;  2IPK D;  4ANV A;  3JW0 X;  3RUL A;  5D94 A;  2IO0 B;  1H4R A;  2NBU A;  1OQQ A;  2KLC A;  1LM8 B;  1SF0 A;  4HKQ A;  1PYW D;  2LFI A;  2N1W A;  3DBL I;  4GIV A;  3TEW A;  1FXT B;  1L4Z B;  4FJY A;  4XX5 A;  1N63 A;  3X23 A;  1UEL A;  1KRH A;  3VH3 B;  3U7D A;  4G0N B;  2FNJ B;  4HCP B;  3A33 B;  2Y5B B;  1TT5 B;  2M19 A;  5GMV A;  1ENF A;  3MP9 A;  2BKF A;  4US9 A;  3NVZ A;  2M0A A;  4W9L A;  1VCB A;  1FIQ A;  1V2Y A;  3LYY A;  4W9F A;  3WAM A;  3ZXR A;  5IP4 D;  1GC6 A;  1VZ6 A;  1M4V A;  3CWI A;  2FIF A;  4A9A A;  2LXA A;  1IYF A;  1TTN A;  4HDQ A;  2BS3 B;  2DYB A;  2WDV B;  3GZN B;  2MJ3 A;  4B0E A;  4A90 A;  1YMH E;  4NPN A;  2GBM A;  2SEB D;  3LJ3 A;  2BTE A;  2LGY A;  5AZF A;  3NZU A;  4FJV B;  3B9J A;  3KLS X;  3P63 A;  4IKG A;  1PGX A;  3SHQ A;  4IUM B;  2BYF A;  1B1Z A;  3UQB A;  4MSQ B;  4YSX B;  2JWZ A;  4IM2 A;  1IBX B;  1QQR A;  4IC7 B;  4MEL A;  5BO4 B;  1FFV A;  2ACZ B;  2PTL A;  5D6J B;  2PE9 A;  3EFC A;  4L23 A;  4DDG D;  3I63 C;  5TSS A;  4BKS D;  2MJE A;  1FCL A;  2JRH A;  2YVC A;  1HE8 A;  4HLE A;  1U4A A;  2O6V D;  1TY2 A;  3BK2 A;  4FHJ A;  1ZXI A;  1E9M A;  5LXH A;  4FHK A;  4NNJ B;  3NOB A;  4REZ A;  5CHW A;  4B9K A;  4A6Q A;  1F2R I;  1GC7 A;  3KUZ A;  3B2G A;  4DXG A;  2V4L A;  5C23 A;  2HJ8 A;  4B0M A;  5CHV C;  4ZRP A;  1UD7 A;  4HRO A;  1NI2 A;  1WMH B;  2K8C A;  4DXF A;  5AZH A;  4YTN B;  1C4A A;  1F77 A;  2K1F A;  4K7S A;  1ZUD 2;  4PS3 A;  3W5V B;  3PRE A;  2KT7 A;  2L83 A;  4ZRQ A;  4TV3 A;  3TJP A;  2WU2 B;  5D7G A;  4MEM A;  1D3Z A;  2J4X A;  1ZGU B;  3VUY A;  4LTU A;  1V8C A;  4D2K A;  1GJZ A;  3BWU D;  2DEN B;  1FNU A;  4XDD A;  1ZE3 D;  1Q0W B;  4W9K A;  3VUW A;  3L08 A;  3P42 A;  2MBQ A;  4K3C A;  4ZDV A;  1QKZ A;  3L16 A;  3RCZ A;  3EGR A;  1FRR A;  2FBW B;  5IN7 A;  2D10 A;  3A9J B;  1WM2 A;  5G2N A;  2KMM A;  4JX1 C;  2NVU I;  2V1Y A;  2FAZ A;  1JWM D;  2PMV A;  3LXF A;  2WXH A;  5J2R A;  3P4S B;  4LCD E;  1FMA D;  1TJE A;  1E0Z A;  1VR9 A;  4YTM B;  1GB4 A;  2VH2 A;  3IXS A;  4BKT A;  2W3S A;  2V4I B;  3QQ8 B;  2RSU A;  2W55 A;  3DBR I;  4K81 A;  3DHH C;  4HEA 1;  4E71 A;  1SIF A;  3SU8 X;  4JLC A;  2A4Z A;  2MBE A;  3AH7 A;  4TKN A;  1WR1 A;  1P98 A;  1WM3 A;  4II3 B;  4USA A;  2K39 A;  3Q8F A;  4RNA A;  3ZNH B;  1ZP0 B;  2AWT A;  5J17 A;  1YOV B;  4HK2 A;  1KTK A;  5IOI A;  2ONQ A;  3PZ7 A;  3JSV A;  2VZK D;  4MGZ E;  3O65 B;  3SEB A;  2D5G A;  2JYT A;  1RFA A;  2FUH B;  3C0R B;  4MSM B;  4C7Y A;  1ZKH A;  3QK0 A;  4NJ7 A;  3A1Q B;  2LGX A;  3PRP B;  3A9K B;  4KX6 B;  3BY4 B;  4P16 A;  4KKJ A;  4BBN F;  2RGF A;  4EOY A;  1UH6 A;  2KZR A;  2KFK B;  4TMA B;  2QEJ C;  3Q14 C;  3QA8 A;  1XF5 L;  2K5P A;  1P3Q U;  4JPS A;  1WIA A;  2FCM A;  4MM3 B;  2KJH B;  5HHD G;  2MHJ A;  3DBR B;  4MJS A;  1V1P B;  1I42 A;  2LGI A;  2N9L A;  2V9H A;  2KX3 A;  4NJC A;  2PIA A;  1UGM A;  3RUI B;  2V3S A;  3DDC B;  3ZO5 B;  3HIZ A;  3NY5 A;  2WXI A;  3D32 A;  3W1Y A;  1V80 A;  2KLG A;  2KTR B;  1UWM A;  4N6E B;  2BVC A;  5KHQ A;  2HTH A;  2JVC A;  1WX8 A;  1FRD A;  3Q3J A;  1NYR A;  4OVZ A;  3PGE A;  1WXV A;  2IO1 B;  2AYO B;  4W9D A;  3W1S C;  1UF0 A;  3BYY B;  3AN1 A;  2MJD A;  4AP4 C;  1K53 A;  1MFW A;  3VFK A;  1KJT A;  2WXJ A;  4XZ4 A;  1TGZ B;  2QSD A;  3MC9 A;  2JSV X;  4WQM A;  3AV8 A;  2VRR B;  4XWT A;  4YXD B;  2KD0 A;  3AMZ A;  4NZL B;  3HM6 X;  1J19 A;  2JX5 A;  3HHM A;  1SGH A;  4NAW A;  2KXJ A;  5E6N A;  2WS3 B;  2Y5P A;  4JE3 B;  4MAC A;  1FXI A;  3SDL C;  2ON8 A;  2N9X A;  2K9X A;  3T3O A;  1AYF A;  1IUE A;  1OTR B;  3WAL A;  3ABV B;  1D4B A;  3N20 C;  1TS5 A;  2KDE B;  3ZW3 A;  5CX3 A;  1KFY B;  1ESF A;  2J0M A;  3ZJU A;  1E8Z A;  4IWO A;  3WCQ A;  3DVN V;  1L5P A;  1WJN A;  1XCQ L;  1C4P A;  3ZVV A;  3Q2A C;  3AE3 B;  3DWG C;  2ICI A;  2VH1 A;  4A8X C;  3N3K B;  2BWF A;  4JWS C;  4YWG G;  2QJL A;  3KUD B;  4ZYS A;  4W9J A;  3ZXV A;  3CIR B;  2RD0 A;  1J8C A;  4GLS C;  1EWC A;  4WJQ A;  2QIE B; 
#chains in the Genus database with same CATH homology
 2D3G A;  3APF A;  1UBQ A;  5IAA C;  3WA0 A;  1XT9 B;  1LXD A;  4KZC A;  4F7Z A;  2G45 B;  4W9I A;  4LJP B;  2ZVO A;  3DVN U;  4IM0 A;  2MCN B;  3APC A;  2Z0D B;  2HE7 A;  4HPM B;  4B95 A;  3V6C B;  2GBN A;  1WZ3 A;  2KQS A;  3PPA A;  2CU1 A;  4J6I A;  4PYU A;  2N7E A;  3KUC B;  3AU5 A;  3DOW A;  2ZJD A;  4G3X B;  4E3C A;  4KDL B;  1J0G A;  2EKE C;  2MBB B;  1KOT A;  4W9E A;  2N9E B;  3PLV A;  1VD2 A;  4TQ1 A;  1WE6 A;  3QHT A;  1WR6 E;  4K1R B;  1GUA B;  3R66 C;  4MGK E;  2ZCB A;  4M0W B;  2DYM A;  4HDO A;  5JHB A;  3QX1 A;  2L3Z A;  4HCN B;  1IP9 A;  1WYW B;  2DAF A;  2N4F A;  4ZYN A;  2FCQ A;  1EUV B;  2KOX A;  3Q3F A;  1RLF A;  4EZK A;  4EZJ A;  3QJZ A;  3M95 A;  1A5R A;  3VHT C;  4DWF A;  1SE9 A;  3ZIM A;  4EFO A;  3OJ4 B;  4ANV A;  3JW0 X;  3RUL A;  5D94 A;  2IO0 B;  1H4R A;  2NBU A;  3L17 A;  3K9P B;  2KLC A;  1LM8 B;  3W1S A;  2KDI A;  4XC2 A;  3K9O B;  1P9D U;  4PYZ A;  2N1W A;  3DBL I;  2DZI A;  4GIV A;  3VTW A;  3AXC A;  2LZ6 A;  3DVG X;  4ANX A;  3GOE A;  1FXT B;  1WJ4 A;  3QIJ A;  2O2V B;  4FJY A;  4KSL C;  4XX5 A;  5LXI B;  4BKS A;  4PS8 A;  4GU2 A;  2IY1 B;  2HD5 B;  3MHS D;  3X23 A;  1R4M I;  3SD5 A;  4DXA B;  1KLV A;  3QCA A;  1UEL A;  2MRP A;  3VH3 B;  2JT4 B;  2O6V A;  3PLU A;  3NHE B;  3U7D A;  4G0N B;  2FNJ B;  4HCP B;  1ZW7 A;  2KJR A;  3A33 B;  5EDS A;  5E6P A;  1M94 A;  2NBW B;  2PE6 B;  4FLH A;  2K25 A;  2Y5B B;  1L7Y A;  4NJ6 A;  5GMV A;  3UQA A;  2N9P C;  2BKF A;  1GNU A;  2G4S A;  2GOW A;  3PZD A;  4I6P A;  3UF8 A;  4W9L A;  1VCB A;  2AL6 A;  4I6N B;  4AWJ A;  2YLM A;  3H9D A;  3ZNZ B;  1V2Y A;  2I1J A;  2CR5 A;  4DHZ E;  4F8C B;  4W9F A;  3QWZ B;  3WAM A;  4KDI C;  3A4R A;  4NQL B;  4YL8 A;  2CHW A;  1GC6 A;  2WYQ A;  4ANW A;  2FIF A;  2LXA A;  2KKC A;  4KIK A;  4ANU A;  1IYF A;  1CMX B;  4GSW A;  3BIN A;  4DK5 A;  1TTN A;  4HDQ A;  3A4S C;  2DYB A;  3L54 A;  2KNB A;  3VVW B;  3ZRC A;  1YQB A;  2KWC A;  4IG7 B;  2O2V A;  4NPN A;  5DPS A;  2GBM A;  2L7R A;  3LJ3 A;  2EMS A;  2LGY A;  5AZF A;  3NZU A;  4FJV B;  1F9J A;  2IY0 B;  4IWP A;  4GOC A;  3PRZ A;  1LQB A;  4GDL B;  3SHQ A;  4RM8 A;  3JVZ X;  2N1V A;  2GBK A;  4IUM B;  2BYF A;  3UQB A;  1WE7 A;  4IWQ A;  5L95 C;  4MSQ B;  2R2Q A;  3VDZ A;  2JWZ A;  4IM2 A;  4GB9 A;  3R7Q A;  2D11 A;  3CSF A;  4IC7 B;  4GMV A;  4MEL A;  3M63 B;  3OAW A;  2Z0E B;  2M1M A;  5BO4 B;  2C7N B;  4CYE A;  3RD2 A;  4HWI B;  4AUQ C;  3RYT A;  5D6J B;  4FBJ B;  2PE9 A;  5J18 A;  2KC1 A;  3TCA A;  1G6J A;  2KTF A;  4KVG B;  2BKR B;  2JY6 A;  4DDG D;  3P2B A;  3B0A A;  2L8J A;  2XK5 B;  4HPL B;  4BKS D;  1XQQ A;  1YJ1 A;  2KDF B;  2LGD A;  3ZLZ A;  2JRH A;  2KVR A;  2YVC A;  2ZPN A;  2KO3 A;  2BPS A;  1HE8 A;  2EMT A;  2KMC A;  3ONS A;  4HLE A;  1U4A A;  2LJ5 A;  2O6V D;  2OOB B;  1Y8R C;  2JXX A;  4G50 A;  4FHJ A;  2XBB C;  2D07 B;  4FJZ A;  2I1K A;  1RAX A;  5FR6 A;  1MG8 A;  5LXH A;  4FHK A;  4NNJ B;  3NOB A;  4ICU A;  3GZN I;  3DVG Y;  2NR2 A;  2KFJ A;  1V81 A;  2REX A;  5CHW A;  4CHK A;  3RZF A;  3DBS A;  3CMM B;  3U8Z A;  3AUL A;  4B9K A;  1V6E A;  1GC7 A;  1WRD B;  4GDL A;  2O6V B;  1E5W A;  2KWU B;  3KUZ A;  3ZKJ C;  1UBI A;  2LRU A;  3MJW A;  2V4L A;  5C23 A;  4FAD A;  2HJ8 A;  5CHV C;  3B1L X;  3EHV A;  3KYC D;  4ZRK A;  1UD7 A;  1NI2 A;  5JZE B;  1WMH B;  2K8C A;  2ZPY A;  5JHA A;  2NPT B;  1ISN A;  5AZH A;  2K1F A;  2BF8 B;  4K7S A;  1V86 A;  1LFD A;  4PS3 A;  2FCN A;  3ZUN A;  3PRE A;  3N30 A;  5CHF A;  2OJR A;  3VXW A;  2PPH A;  2M4N A;  4JL9 A;  2DYO A;  2L00 B;  4TV3 A;  3TMP B;  3TJP A;  3L0W B;  2MA9 B;  1YX5 B;  5D7G A;  4MEM A;  1D3Z A;  2XK5 A;  5IA7 A;  3ALB A;  2W9N A;  4BBN C;  2A5U A;  2CS4 A;  1E8W A;  1ZGU B;  3A1Q A;  4KIK B;  2DAJ A;  3VUY A;  1GJZ A;  2LXC A;  3UIP B;  2DEN B;  5LLI A;  5JH5 C;  1BT0 A;  2DX5 B;  1Q0W B;  1Q1O A;  1V9J A;  4W9K A;  4TUU A;  4GXB A;  3L08 A;  3PRM B;  3VUW A;  3DBH I;  2L05 A;  4OVU A;  2MBQ A;  4ZDV A;  2KFK A;  2K6D B;  3L16 A;  4WWP A;  4BOZ B;  3RCZ A;  3ECI A;  3KH0 A;  4W9H A;  4A20 A;  2KN5 A;  2MBH A;  4KV2 A;  2D10 A;  3A9J B;  1WM2 A;  3PT2 B;  5G2N A;  4GN1 A;  1UZX B;  4A3O A;  1C3T A;  1WMH A;  2CHZ A;  1OEY J;  1WX7 A;  2D2Q A;  1WZ0 A;  2UYZ B;  1P1A A;  2NPT A;  2NVU I;  2V1Y A;  2FAZ A;  3UGB B;  3PHX B;  3MTN B;  3R3M A;  2LUE A;  4DDI D;  4I6L B;  2C9W B;  3WAO A;  2ZNV C;  4RM9 A;  5J2R A;  4LCD E;  1TBE A;  4NQK E;  3IVF A;  4FN2 A;  1WGY A;  2JUO A;  3VTV A;  4BKT A;  1YX6 B;  3QQ8 B;  2RSU A;  3B08 A;  4DHZ B;  3KVF B;  2AEH A;  3DBR I;  4K81 A;  4E71 A;  1SIF A;  4JGH B;  3ZDM C;  1P0R A;  2MWS B;  3ZDT A;  3PS6 A;  4MH0 E;  3SU8 X;  4WWO A;  4JLC A;  5DCN A;  1KM7 A;  3ZTC A;  4DHJ D;  2A4Z A;  2MBE A;  1RRB A;  2RPQ A;  4TKN A;  1C1Y B;  1WR1 A;  3QAR A;  3T8M A;  1OQY A;  1P98 A;  1WGG A;  1WM3 A;  4II3 B;  3CST A;  3V6E B;  2JPH A;  4A3P A;  2K39 A;  5G55 A;  3TBL D;  1H8C A;  2NCN A;  3U30 A;  3ZRF A;  1E7U A;  2ZEQ A;  2ASQ A;  2LD9 A;  3ZNH B;  3T9L A;  3IG3 A;  1OEY A;  4BVU C;  1EF5 A;  3A9J A;  2AWT A;  3H7P B;  4K7W A;  1X1M A;  4DHJ B;  5J17 A;  3EEC A;  4HK2 A;  1WGR A;  1WXM A;  4AOF A;  3JSV A;  2WX0 A;  2LVO A;  1WJ6 A;  1WF9 A;  4WWN A;  4MGZ E;  3O65 B;  3L10 B;  2KMA A;  4WJP A;  2DZK A;  3PVL A;  3NZS A;  1RFA A;  2JZ3 B;  3OJ3 A;  2BWE S;  2FUH B;  3C0R B;  2WWZ A;  2MBO A;  4MSM B;  4WJN A;  4CO7 A;  4GDK B;  1E8Y A;  3KW5 B;  1ZKH A;  3QK0 A;  4NJ7 A;  3A1Q B;  2FCS A;  3UIN B;  1EF1 A;  2LGX A;  2R2O A;  3PRP B;  3A9K B;  2KQ7 A;  2J7Q B;  2M0X A;  3CF6 E;  5DPW A;  1EO6 A;  3BY4 B;  3VUX A;  4ASW C;  4BBN F;  5E6O A;  2RGF A;  4EOY A;  1UH6 A;  2KZR A;  2KJ6 A;  3OLM D;  3ML9 A;  2KFK B;  4K7U A;  5HKH A;  3LDZ E;  4NY0 A;  2LVP A;  2C60 A;  4IM3 A;  4W9C A;  3EC8 A;  2NS5 A;  1JRU A;  2KX0 A;  4WJO A;  3X0W A;  1V5O A;  3DPD A;  2CKH B;  4LJO B;  1Q5W B;  3QA8 A;  3H7P A;  2IO3 B;  3HM3 A;  1R4N I;  2ZNV B;  4HJK A;  4DBG A;  3PV1 A;  1OGW A;  3WAN A;  4FA6 A;  1E90 A;  1NDD A;  2MLB A;  3N32 A;  2RR9 A;  5CTR C;  1P3Q U;  2GBR A;  3V60 A;  1WIA A;  2NBV B;  1V5T A;  1WI0 A;  1WY8 A;  2IYD B;  2FCM A;  2J0J A;  2KJH B;  2KWV B;  1Z2M A;  3UIO B;  3PTF C;  2C7H A;  4ICV A;  2FID A;  4MJS A;  2KK8 A;  2MW5 A;  1WGH A;  1WJU A;  2CHX A;  3ZNG C;  1I42 A;  4URK A;  4GDK A;  2KX3 A;  4WAA A;  1UGM A;  3L13 A;  3RUI B;  4II2 B;  2L0F A;  2L0T A;  3A9K A;  2V3S A;  3DDC B;  2DHZ A;  3IHP C;  3ZO5 B;  1I35 A;  3HIZ A;  1WH3 A;  3NY5 A;  2L76 A;  3D32 A;  3W1Y A;  3WAP A;  2QHO A;  5L83 A;  2LRW A;  2B3A A;  1V80 A;  2KLG A;  2PJH A;  3APD A;  2G4D B;  2KTR B;  3ZNI D;  2M17 A;  3PSE B;  2UWQ A;  1WX9 A;  3JYU A;  5KHQ A;  2HTH A;  2JVC A;  4GGQ A;  4ZRJ A;  4EKU A;  1WX8 A;  4NAW B;  4N9F 4;  4EEW A;  2GBJ A;  1GG3 A;  2C7M B;  1AAR A;  3H1U A;  3Q3J A;  4M8N A;  4W9G A;  1WXS A;  2MX2 A;  3WIM A;  3PHW B;  2BYE A;  1E7V A;  3PGE A;  1NBF C;  1WXV A;  2PEA A;  1E8X A;  3JSV B;  2KAN A;  2IO1 B;  2BYV E;  4JQW C;  2AYO B;  1S1Q B;  4MM3 A;  3M62 B;  4W9D A;  1L2N A;  3W1S C;  5TR5 A;  4F1S A;  4EUT A;  5DPR A;  3R7R A;  3VH4 B;  1TZ1 A;  2WX1 A;  4AP4 C;  5D2M B;  2MP2 B;  4TQ0 A;  3KYD D;  4KSK C;  2ZZP B;  3VFK A;  2K8B A;  5AZG A;  1KJT A;  5KHO A;  3NS8 A;  3QAQ A;  2KC2 A;  4XZ4 A;  3M3J A;  4X57 B;  1TGZ B;  5AEK B;  2K8H A;  4M8M A;  2BGF A;  3H6N A;  3EFU A;  2MQJ A;  4E74 A;  2VRR B;  4MGI E;  3S2A A;  3IFW B;  2LWP A;  4BKG A;  2C5L C;  4G11 A;  2KTR A;  4AJY B;  2KD0 A;  4WQO B;  4AJW A;  3I3T B;  2DZJ A;  3HM6 X;  1J19 A;  2MSE D;  3HHM A;  1SGH A;  4NAW A;  2KXJ A;  5E6N A;  3VAW A;  3VTU A;  2G3Q B;  3H7S A;  2K6Q A;  3TIX A;  2KDB A;  4BOS C;  3QC8 B;  3SDL C;  3RZW C;  2N9X A;  3ENE A;  4PS7 A;  1WGD A;  2ZVN A;  1PQS A;  2JZZ A;  4RMA A;  3RT3 B;  4HXD A;  4JIO U;  1QZE A;  4LDT D;  5C1Z A;  3V61 A;  1IPG A;  1OTR B;  3V62 A;  3WAL A;  3VQI A;  2JF5 A;  2AL3 A;  2KDE B;  3AI5 A;  3ZW3 A;  4MJS B;  2N7D A;  2IO2 B;  5CX3 A;  2Z59 B;  2MP2 A;  4IW0 A;  2J0M A;  1V49 A;  1E8Z A;  4IWO A;  4HVB A;  2LAS A;  3DVN V;  4LDT B;  1WJN A;  3ZVV A;  3HK0 A;  1WXA A;  3IBE A;  4B6W A;  2GMI C;  4P7I A;  1Z5S B;  1YD8 U;  1S3S G;  2IBI B;  2M8S A;  3DQV A;  4MDK E;  3ZTD A;  3AU4 A;  3N3K B;  4OVV A;  2BWF A;  2ZCC A;  1YIW A;  2JRI B;  3TL5 A;  2LVQ A;  2DZM A;  3KUD B;  2J0K A;  2XEW A;  4MGY E;  4BFR A;  5DPT A;  4ZRI A;  4W9J A;  4EZL A;  2WDT B;  2RD0 A;  2IZV B;  1J8C A;  1T0Y A;  3DCG A;  1K8R B;  4FUL A;  1XD3 B;  2KHW B;  3ML8 A;  2LI5 A;  1WFY A;  4WJQ A;  4KZ0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...