5CHWA

Structure of isg15 in space group p212121
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
154
structure length
154
Chain Sequence
AWDLKVKMLGGNDFLVSVTNSMTVSELKKQIAQKIGVPAFQQRLAHQTAVLQDGLTLSSLGLGPSSTVMLVVQNSSEPLSILVRNERGHSNIYEVFLTQTVDTLKKKVSQREQVHEDQFWLSFEGRPMEDKELLGEYGLKPQCTVIKHLRLRGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of ISG15 in space group P212121
rcsb
source organism Mus musculus
molecule tags Signaling protein
molecule keywords Ubiquitin-like protein ISG15
total genus 37
structure length 154
sequence length 154
chains with identical sequence B, C, D, E, F, G, H, I, J
ec nomenclature
pdb deposition date 2015-07-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00240 ubiquitin Ubiquitin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 5chwA02
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 5chwA01
1HE8A 1UD7A 5C1ZA 4IWPA 2YVCA 1U4AA 1H8CA 4GDKB 5DPWA 3VTWA 2HE7A 4GDKA 2C7HA 2V3SA 1H4RA 2D2QA 4FN2A 4ICUA 4K7SA 4WWOA 2G4DB 2ZPYA 3IBEA 4OVVA 2MBQA 3CSFA 4PS7A 2KC1A 2ZCBA 5E6OA 2M0XA 4JLCA 3PS6A 1J0GA 2FCSA 4BBNC 5L95C 3WIMA 4NJ6A 3I3TB 4MGZE 4A3OA 3KYCD 3DPDA 4IG7B 1UZXB 1V49A 3ZO5B 2LWPA 3HM3A 4LCDE 5CHWA 2MWSB 3AI5A 4E71A 3QIJA 3IHPC 3UIPB 4WJNA 3R7QA 3IVFA 3VDZA 3WALA 1X1MA 4MDKE 4GDLB 2KWUB 3QK0A 2RGFA 2JY6A 2M1MA 3PRZA 2IYDB 2GBJA 1E8ZA 2KC2A 3APFA 4PS3A 4XC2A 4HWIB 2LJ5A 2VRRB 4HXDA 4BKSA 2DAFA 4DHJB 2BPSA 2L0FA 2CHZA 4RM8A 1C3TA 3L08A 4ZRKA 1L2NA 3VQIA 3PLVA 3EC8A 3ENEA 1WIAA 2RPQA 3PPAA 4FJVB 3KH0A 4CHKA 1WR1A 4NY0A 1VD2A 3DCGA 1PQSA 2BWFA 2KANA 4MGIE 4HCNB 1WXVA 2IY1B 4GN1A 2PE6B 3A4SC 2MP2B 5IAAC 2KQSA 3ZKJC 4A20A 2N7EA 1XT9B 3A9JB 1WRDB 2Z0DB 3ZDMC 4DK5A 2AL6A 3H7PA 2L0TA 2G4SA 3Q3FA 1WF9A 3NHEB 1EO6A 3B1LX 1WE7A 4FJZA 3ECIA 5KHOA 3M95A 1IPGA 4RMAA 4AP4C 4GMVA 2NPTA 1D3ZA 4HCPB 4HPMB 5JZEB 3JYUA 1WGHA 3V61A 1EUVB 1E90A 4NNJB 4ZRJA 4CYEA 2KLCA 4DXAB 1UELA 4G0NB 2FNJB 2MA9B 3GOEA 2A4ZA 2LVQA 1KJTA 4DHZB 2FUHB 2KN5A 4DDID 4EUTA 2O6VB 4WJOA 4ZRIA 4TKNA 3DBRI 3S2AA 5J2RA 2DAJA 1IP9A 3PVLA 4TUUA 3TL5A 3PHWB 3ZRCA 2KX3A 3NY5A 4EKUA 1LQBA 3QCAA 3ZNZB 4K81A 1JRUA 1P1AA 2M8SA 2LGYA 2OJRA 2KMAA 1WGDA 5D2MB 4URKA 4W9JA 4KSKC 4GGQA 1YJ1A 2YLMA 2K8HA 3VUYA 3ONSA 2IO3B 1V80A 2LGDA 3PRMB 3VAWA 2N9EB 3H9DA 4HK2A 5LXIB 4GU2A 4GIVA 4FA6A 3OLMD 3KUCB 3PGEA 4BOZB 4I6PA 5DCNA 3L10B 3QARA 4F7ZA 3ALBA 2DX5B 1WY8A 1LFDA 1OQYA 3CSTA 4KIKA 2DZKA 3UQBA 4IW0A 2D11A 3A9KA 2KX0A 2K39A 1WX7A 2LVPA 2N7DA 5TR5A 1UGMA 4RM9A 3UQAA 3VH4B 3PZDA 2J7QB 1OTRB 5LLIA 3V6CB 2K1FA 2CU1A 3JVZX 2MRPA 2BGFA 1Y8RC 3C0RB 2GBNA 3K9OB 2JRHA 2N9XA 2PJHA 4AJWA 4F1SA 5L83A 4FBJB 2FCNA 3B08A 3OAWA 4EOYA 2JZ3B 2JF5A 2KNBA 4ASWC 4WAAA 5EDSA 3VH3B 3TMPB 3HIZA 2I1KA 5E6PA 3R66C 2KQ7A 4J6IA 3TIXA 4E74A 1TBEA 3ZDTA 3U7DA 2C7MB 2EKEC 3O65B 4XX5A 4LJPB 4FHJA 3SU8X 3ZW3A 2UYZB 3WAOA 3ZNID 2AEHA 3H1UA 4MJSB 5CHFA 1KLVA 5HKHA 4WJQA 3OJ3A 4BKTA 3VXWA 3QHTA 4NQKE 4IM2A 1IYFA 3ZLZA 1WXSA 3KYDD 2KXJA 4BKGA 2AL3A 3WANA 2N1WA 2KJRA 2GBRA 5CX3A 1WJ6A 3DVNV 1XD3B 2L76A 4M8MA 2WYQA 1WE6A 2KO3A 2V4LA 3NZSA 4GOCA 1WM2A 2JPHA 2ZJDA 1P3QU 2KZRA 2BF8B 4IUMB 1V86A 2FCMA 1A5RA 1P0RA 2LRWA 5AZGA 2WDTB 1Q0WB 4II2B 2KHWB 4W9FA 5CHVC 2XEWA 2KDEB 5JHAA 2CHXA 1WGYA 3L16A 1WMHB 3L17A 1SE9A 1WMHA 3ZTDA 1V5OA 2BYEA 2MBHA 4OVUA 3IFWB 4NJ7A 2KWCA 3A33B 4FULA 2LVOA 1WH3A 5LXHA 3SHQA 1I35A 4DWFA 2LASA 2NCNA 2PE9A 4IWQA 4EZKA 1OGWA 2KJ6A 3RCZA 4KSLC 4HDQA 5DPTA 1E5WA 3N3KB 2HTHA 3W1YA 1M94A 3PTFC 4W9IA 2IO1B 4MSMB 4KVGB 2IO0B 2FAZA 3MJWA 1YX5B 2LD9A 3KUDB 1OEYA 2GBMA 4NPNA 1UH6A 2KKCA 3APCA 2PEAA 2N1VA 4FHKA 5E6NA 3A4RA 2AYOB 4JL9A 3M3JA 4K7UA 2KFKB 3V62A 4NAWB 3RZWC 3QAQA 3PRPB 4A3PA 3OJ4B 2BWES 3VTUA 5FR6A 2IZVB 4K7WA 3UGBB 1FXTB 4F8CB 2M4NA 2KTRA 3H7SA 2K6QA 1WI0A 4DHZE 1Z5SB 4X57B 1E8XA 2N4FA 4ANXA 4PS8A 3ZVVA 2WX1A 3PHXB 2KLGA 3DQVA 3LJ3A 4MEMA 4M8NA 1V81A 3ML8A 2WWZA 2L3ZA 1WX8A 4BFRA 4GSWA 2D07B 2C7NB 1WZ3A 1Z2MA 1YD8U 4MH0E 1RRBA 2PPHA 4W9DA 4PYZA 2MCNB 2BYFA 4AUQC 3X23A 2RSUA 4W9GA 5J17A 1K8RB 2ZCCA 3T9LA 1R4NI 1UBQA 3RULA 3QX1A 3ZIMA 3RD2A 3DBHI 1P9DU 1TTNA 1V5TA 4HDOA 3NS8A 2XBBC 3W1SA 4FADA 1SGHA 4KDIC 1UBIA 3DDCB 3RYTA 4W9KA 4GDLA 4P7IA 3BY4B 1WJNA 4M0WB 2NR2A 2IBIB 2DZMA 2D3GA 1RAXA 1WGGA 1NDDA 1WYWB 1GC7A 2DENB 3A9KB 2MBEA 4EZLA 3QA8A 2V1YA 4FLHA 3M62B 1R4MI 2KK8A 4W9EA 1E7UA 4MGYE 4HVBA 1GUAB 4I6LB 2JWZA 2NBWB 5GMVA 2BYVE 3QJZA 1YIWA 4TQ0A 3EHVA 2Z59B 2JT4B 2ZVOA 3A1QA 4ZYNA 3ZRFA 3NOBA 2MQJA 2L8JA 1V9JA 3AU5A 2OOBB 1ISNA 5JH5C 1YQBA 4BOSC 2NS5A 2JUOA 3A9JA 3WAPA 2HD5B 4XZ4A 2LRUA 4W9CA 1Q5WB 1TZ1A 2BKRB 2G45B 4LJOB 1NI2A 2CR5A 4AOFA 1J19A 2K6DB 4LDTB 3IG3A 3ZNHB 2CKHB 2DYMA 1WXAA 3QWZB 3SDLC 5DPSA 3CF6E 5G2NA 3L0WB 2R2OA 2IO2B 1LXDA 4KZCA 4EFOA 2O6VD 3VUWA 4MJSA 3UIOB 2QHOA 4B95A 3V60A 4W9HA 1WR6E 2KFKA 2JZZA 2Y5BB 3PLUA 1E8WA 4IM0A 5AZHA 1GNUA 3UINB 3ZNGC 4II3B 5J18A 1ZGUB 4WQOB 2ZPNA 3JW0X 1I42A 4GB9A 3KUZA 4CO7A 2DHZA 1SIFA 3JSVB 4LDTD 2IY0B 2O6VA 3JSVA 5IA7A 5CTRC 2A5UA 4K1RB 2LGXA 3L13A 2CS4A 4G3XB 2BKFA 5C23A 4WJPA 3SD5A 3VFKA 1YX6B 2UWQA 2D10A 1Q1OA 3APDA 3QQ8B 4AJYB 2GMIC 2KFJA 4I6NB 4BKSD 2LUEA 1V2YA 2KD0A 3VTVA 3N32A 3ZUNA 2L7RA 2RD0A 3KVFB 5AZFA 3RZFA 2R2QA 4PYUA 4HPLB 4IC7B 5KHQA 1L7YA 3L54A 2O2VB 2ASQA 3DOWA 2O2VA 2GOWA 2C9WB 4IM3A 2Z0EB 3AXCA 4IWOA 2MBOA 2RR9A 4KIKB 1MG8A 3X0WA 2LXCA 2FIFA 4B6WA 3M63B 2CHWA 2AWTA 3HHMA 2C5LC 4KZ0A 2KTFA 2REXA 4YL8A 5BO4B 3MTNB 4BBNF 2ZNVC 3VUXA 4ANVA 2MW5A 1P98A 2J0MA 4NAWA 4BVUC 1ZW7A 5D6JB 2XK5A 4EZJA 2L05A 2NBUA 4TV3A 4W9LA 2MBBB 2K25A 2DZIA 2MX2A 3CMMB 2KTRB 1TGZB 3R7RA 2LZ6A 1S1QB 5G55A 2L00B 1QZEA 4ICVA 2KDBA 1E7VA 2KOXA 2KWVB 3TBLD 3WAMA 4ANUA 2NVUI 2J0KA 2KJHB 4G50A 2GBKA 3PT2B 5D7GA 3Q3JA 2MSED 4ANWA 3VVWB 1WFYA 2DYBA 2ZNVB 3DVGX 2G3QB 2FCQA 1E8YA 1GC6A 3AULA 3KW5B 4MELA 3MHSD 3RUIB 1BT0A 2JXXA 3DVNU 1VCBA 3P2BA 3B0AA 3EECA 1EF5A 5D94A 2DYOA 2NPTB 4E3CA 2KDIA 1WGRA 2C60A 1WZ0A 1ZKHA 3HK0A 3ML9A 1WX9A 2DZJA 4JIOU 4MM3A 4NQLB 4KV2A 2W9NA 2LXAA 3N30A 2B3AA 3NZUA 4GXBA 3VHTC 1GG3A 4JGHB 1GJZA 1OEYJ 3TCAA 1KM7A 4DHJD 4KDLB 4ZDVA 3V6EB 3PSEB 2ZEQA 3DVGY 2LI5A 2WX0A 2EMTA 3D32A 1RLFA 4N9F4 1G6JA 1RFAA 3T8MA 4EEWA 3EFUA 2N9PC 3UF8A 1J8CA 3U30A 2KDFB 3W1SC 4B9KA 1F9JA 3PREA 1CMXB 3K9PB 2ZZPB 4G11A 1WJUA 1KOTA 2I1JA 3R3MA 2JRIB 3LDZE 1AARA 3A1QB 2KMCA 2JVCA 3U8ZA 2MP2A 3DBLI 3ZTCA 4HJKA 1LM8B 1S3SG 4JQWC 2M17A 4AWJA 2MLBA 2K8CA 3H7PB 3RT3B 3QC8B 2ZVNA 3TJPA 5JHBA 4TQ1A 1C1YB 4MSQB 4DBGA 2KVRA 5AEKB 4MGKE 1NBFC 2FIDA 2K8BA 3HM6X 1WM3A 4WWNA 1V6EA 3BINA 2EMSA 2HJ8A 4HLEA 1WXMA 3AU4A 3GZNI 2J0JA 1EF1A 4FJYA 4WWPA 1WJ4A 3H6NA 3PV1A 5DPRA 3WA0A 4DDGD 2NBVB 3DBSA 1T0YA 2XK5B 1XQQA
chains in the Genus database with same CATH superfamily
1UD7A 5C1ZA 2JYTA 1H8CA 1HZ6A 4K7SA 3U2SC 4B0EA 1KFYB 1UGJA 4UDUC 2I2YA 2MBQA 3CSFA 4PS7A 2ZCBA 4BBNC 5L95C 1JMLA 4NJ6A 4L23A 3T3NA 3DPDA 5BMIA 4LCDE 3Q3NC 4ACFA 4ZHOA 2MWSB 3AECB 4E71A 3W5VB 1HEZE 2INPE 1C77A 4KKJA 3R7QA 1NYRA 4GDLB 2RGFA 2JY6A 2M1MA 2IYDB 1E10A 2RDBC 4XC2A 4HWIB 2LJ5A 2GRIA 1OQQA 2DAFA 2FE8A 2LFIA 4DHJB 1IUEA 4ZRKA 1J7BA 3VQIA 4N58A 4K3CA 4CHKA 4OZAA 2CJNA 2OHFA 3BIID 2KANA 2IY1B 1SB3C 3AE9B 1XEEA 2MP2B 5IAAC 4WIPA 3ZKJC 4A20A 1XT9B 2Z0DB 3ZDMC 3H7PA 2L0TA 4WAFA 3NHEB 1IPGA 4GMVA 3H8HA 2J4XA 2NPTA 4HCPB 2AQ1B 3JYUA 4DXAB 2KLCA 1I4RA 4G0NB 3VRBB 2O6VB 3AH7A 3ZGZA 3SFDB 4YSYB 3PVLA 4TUUA 3BZDB 3TL5A 1ZXIA 1FXAA 3BVGA 4K81A 2M8SA 2LGYA 2OJRA 4KX6B 4W9JA 3O13A 3VUYA 2K8HA 2LGDA 3PRMB 2WXOA 2IGDA 4GIVA 3KUCB 2PKOA 4I6PA 3L10B 1E0ZA 3AEAB 3AM9A 4KIKA 2PTLA 3FILA 3MP9A 1XCTL 3HVDA 3IXSA 2N9XA 4AJWA 4F1SA 5L83A 2FCNA 5LNK1 1NVID 3GB1A 4REZA 3TMPB 2I1KA 1TBEA 1C4CA 1STEA 3U7DA 2W54A 1FIQA 3WAOA 2VZKB 3H1UA 4M02A 4NJCA 4BKTA 1DOXA 3QHTA 3I57A 2PLPA 3Q8FA 2AL3A 1L6UA 1XD3B 2HDEA 3R2TA 3Q69A 4M8MA 2WYQA 1WE6A 4H2AA 1WM2A 2JPHA 1P3QU 2LGSA 1F2RI 2BF8B 1TKGA 4IUMB 4RCOA 4R3DA 4FXCA 2DBYA 2XEWA 2J42A 2CHXA 1WGYA 3L16A 2QDFA 3L17A 2BW2A 2N7JA 4NJ7A 3IFWB 4N59A 2KWCA 3A33B 5LXHA 1WH3A 3SHQA 5IP4D 4DWFA 4LNNA 1P7FA 2LASA 1TIFA 4M00A 1EWCA 2NCNA 1TS2A 1E5WA 1TKYA 3PTFC 3AE4B 4W9IA 1VZ6A 3MC8A 4P1BC 3KUDB 1OEYA 1GOZA 1HQRD 4LTUA 4JL9A 3M3JA 3BWUD 4K7UA 1FNUA 2KFKB 3FILB 4US9A 3RZWC 1I7HA 3PRPB 1CK1A 2BWES 3VTUA 5FR6A 3RI7C 1FXTB 2KTRA 4DHZE 3P63A 4ANXA 4PS8A 1QOAA 2WX1A 1WGKA 3GE3C 4YTNB 2WWZA 2L3ZA 4BZAA 5TSSA 2D07B 3P4PB 4MH0E 1MVKA 4PYZA 2GB1A 1K8RB 4P1CC 5JXVA 2D5GA 4MT5A 1R4NI 3RD2A 3NS1A 3PZ7A 3GE8C 1K52A 1SGHA 1UBIA 3RNGC 3DDCB 4WURA 2V0GA 2IPKD 1R4NB 1BUIC 2DZMA 2D3GA 3RMKC 3MC9A 2WXJA 3A9KB 4EZLA 4FLHA 1N61A 4MGYE 1GUAB 2JWZA 1HTOA 1YIWA 3A1QA 3KWLA 2MQJA 2L8JA 2OOBB 1TS3A 2JUOA 1QQRA 2HD5B 2W55A 3U4EG 1VZ7A 1TZ1A 2BKRB 3HVZA 3Q8BA 2CR5A 4HPPA 3DWMA 4RF0A 1J7AA 2BS2B 1WXAA 3CF6E 1XLNA 4EFOA 1LXDA 1C4PA 1YOVB 3NRZA 2KFKA 1GNUA 4XYCA 4II3B 3AE5B 4WQOB 2JQRB 3Q2AC 4GB9A 4JX1C 2DHZA 2IY0B 2O6VA 5IA7A 1JALA 1Q10A 2LGXA 3SEBA 3Q3MC 2UWQA 4HKZE 3AN1A 3QQ8B 2EKIA 2NTSA 1PGBA 2WLBA 3N32A 2NMQA 3KVFB 3RZFA 4PYUA 2V3PA 2UU7A 4IC7B 2O2VB 2ASQA 2C9WB 1RYJA 3UI3A 1NENB 3X0WA 1TY0A 2QILA 3HHMA 3MTNB 2ZNVC 2MW5A 1P98A 1RM6C 1MPEA 2NBUA 1QKZA 4TV3A 2DZIA 3URYA 2LZ6A 1S1QB 4ICVA 3WAMA 4RF1A 2J0KA 3Q8AA 4FBJB 5D7GA 2DYBA 1R4MB 1EWYC 2VZKD 2WNMA 3RUIB 1SE4A 3P2BA 3DVNU 3B0AA 3GS2A 3W9CB 4TSSA 4TMAB 1J7CA 3AE1B 3Q14C 3ZQ4A 1WZ0A 3HK0A 2DZJA 3NZUA 3DWGC 3RNFC 1C76A 3VHTC 1FRDA 1KM7A 3LB8C 1L0XB 2EMTA 3D32A 1G6JA 4USAA 4EEWA 3EFUA 3UF8A 1J8CA 3BK1A 3W1SC 5T8IA 3R3MA 3LDZE 2FUG1 1SE3A 2WU2B 1LM8B 1S3SG 2E3TA 1FCLA 2K8CA 1C1YB 3BVMA 3DHIC 4XDDA 1WM3A 4WWNA 1JQ4A 3Q8CA 2JZPA 3AMZA 4WWPA 4PT5A 3H6NA 3PV1A 4OW0A 2WHIA 1UUPA 5GXGB 1T0YA 1HE8A 1QOFA 3NZ3A 4GDKB 1YJIA 1MI0A 3VTWA 4GDKA 4ICUA 1H4RA 4WWOA 3RNEC 2ZPYA 1ET6A 4OVVA 4MH8A 5E6OA 1GAQB 3WIMA 1F1HA 4MGZE 4IG7B 1TKEA 3IHPC 1KTKA 3VDZA 2MH7A 1X1MA 4IOIE 2PIAA 2GBJA 1RWSA 4BKSA 2BB5A 4C7ZA 1T0QC 1SEBD 1C3TA 3EC8A 4FJVB 1WIAA 3KH0A 1N60A 3DCGA 1PQSA 4LNIA 4MGIE 4HCNB 1WXVA 4GN1A 1BMLC 2LUMA 2LJIA 3DHGC 1WF9A 1EO6A 3B1LX 1SF0A 3AEFB 1JWSD 4FJZA 3ECIA 3GZNB 4D2KA 3HUIA 1QILA 3OG5A 4CYEA 1UWXA 2SEBD 2MA9B 1C4AA 2V4IB 2A4ZA 1C79A 2DLBA 4WJOA 4TKNA 2DAJA 5H8YE 1ENFA 2V3NA 2WXLA 2LGIA 1T3QA 2KX3A 3NY5A 3NVYA 1P1AA 4MACA 2KDMA 3DBRB 2BB6A 4URKA 4GGQA 1QOGA 1YJ1A 3RN9C 4C4VA 3ONSA 2L83A 4GU2A 4FA6A 4NAMA 4YT0B 4BOZB 5DCNA 3QARA 1OQYA 4B0MA 2DZKA 2D11A 3LXFA 1UGMA 4RM9A 4RGTA 3VH4B 3PZDA 1B1ZA 2J7QB 2WP9B 2CU1A 1QLBB 2MRPA 2BGFA 2GBNA 4ZRPA 2PJHA 1MHXA 2WXNA 3B2FA 3HRDD 4ARIA 2FBWB 3HIZA 2EELA 4J6IA 3TIXA 3ZDTA 2C7MB 2JXTA 3O65B 2D3CA 1E7PB 3I63C 1KLVA 2V9HA 3IAS1 4XWWA 5FR3A 3AEGB 1IYFA 2MJ3A 1WXSA 2KXJA 1GB4A 3WANA 2N1WA 3TEZA 3PO0A 1N5WA 1FCCC 1V1OA 2ZW1A 4M01A 2CJOA 4AQ7A 4GOCA 2KZRA 2JWUA 2FCMA 1ESFA 3BVZA 4W9FA 1JRPA 5JHAA 2XNAC 1SE9A 1WMHA 3AEDB 2BYEA 2INCC 3I5JC 3MFGA 2LVOA 2N9LA 2KT7A 1OGWA 4KSLC 4IKGA 3MJWA 1NEKB 1VR9A 2LD9A 2WXMA 4NPNA 2BTEA 2J53A 3A4RA 4A3PA 2M4NA 2K6QA 1Z5SB 4X57B 1E8XA 2WXRA 3PHXB 3EGRA 4P16A 2LHEA 2KLGA 3LJ3A 4M8NA 3ML8A 3FAHA 3I9V1 2C7NB 1ET9A 4W9DA 1RRBA 2BYFA 3X23A 1SXTA 2RSUA 5J17A 1TY2A 1F52A 1I4GA 2Y5CA 4C4VB 1P9DU 1TTNA 1FD6A 4N6EB 3L4PA 4YSXB 5HHDG 4GDLA 1UNSA 4P7IA 4M0WB 1WJNA 2BQQA 2NR2A 3NVZA 1WGGA 1WYWB 2DENB 3KLSX 3N9YC 2KK8A 1XF5L 4HVBA 4GLSC 2TSSA 3QJZA 1PGAA 3N1ZC 1YQ4B 1YQBA 3WAPA 1ZPSA 1D5ZC 1K53A 4RFBA 2G45B 4LJOB 2WS3B 1AW7A 1PUTA 3BYYB 2QIEB 1XO3A 2CKHB 3QWZB 5G2NA 3L0WB 2BYTA 4HROA 2IO2B 4XE0A 3UIOB 4B95A 2BBCA 3V60A 2Y5BB 3SFEB 3RNBC 4YWGG 3KUZA 4LDTD 5CTRC 1T0SC 2A5UA 3L13A 2NTTA 3DHHC 2BKFA 1T0RC 5C23A 2RDHA 3ZUNA 2R2QA 4HPLB 1L7YA 1TJEA 3DOWA 1SIJA 3EA6A 2GOWA 4US8A 1HZ5A 2Z0EB 3AB5A 4IWOA 4KIKB 1MG8A 3M63B 4YL8A 2AWTA 2C5LC 2REXA 1ZDVA 4ANVA 3VUXA 2H88B 2HJ1A 3NG0A 4NAWA 4EZJA 2K25A 2QC8A 2MX2A 3CMMB 2B76B 1TGZB 3R7RA 1QZEA 1FXIA 4ANUA 3MC0B 3PT2B 3VVWB 3DVGX 3NVVA 2FCQA 1E8YA 1JW9D 4MELA 3J9CA 3EFCA 2NPTB 1WGRA 2C60A 4WWMA 1ZKHA 5FKAC 5BMGA 2QEJC 2B3AA 3E56A 4OHJA 1GG3A 1TZOA 1GJZA 3TCAA 4M0WA 4KKIA 1JWAD 1TS5A 1MHHE 3DVGY 5G5GA 1RLFA 2N9PC 4XGAB 3U30A 2KDFB 2ZZPB 2RMMA 1KOTA 2J52A 1WWTA 1KH0A 2KMCA 2JVCA 2MP2A 3DBLI 3ZTCA 4HJKA 4TQ1A 4MGKE 1NBFC 2FIDA 3HM6X 1V6EA 2EMSA 2HJ8A 2G9HD 3AU4A 1WJ4A 4DDGD 5G5HA 5EE3A 2NBVB 1TS4A 2XK5B 1XQQA 4IWPA 2YVCA 1U4AA 4RNAA 5I4DA 2V3SA 3IT6B 2CU3A 3IBEA 1V1PA 2M0XA 4ZOHC 1J0GA 2FCSA 2KVZA 2RPVA 3I3TB 4A3OA 3KYCD 1UZXB 1V49A 1I4QA 2LWPA 3HM3A 5CHWA 4P6VF 3AI5A 4LK0M 2ON8A 3UIPB 1MG4A 4MM3B 4WJNA 3IVFA 3MHZA 5BMHA 2KWUB 2WXGA 4EE2A 1F2RC 1DYQA 1E8ZA 2KC2A 3AEEB 1PGXA 1SSNA 1WXQA 3APFA 1N5XA 2BPSA 2CHZA 1L2NA 3BK2A 4C80A 1YN4A 4NY0A 3R2IA 4BAXA 2PE6B 3A4SC 4DXFA 1P7EA 1N6ZA 2KQSA 2N7EA 3A9JB 2ICIA 2WXKA 2G4SA 3Q3FA 2KN4A 2KWDA 5KHOA 4RMAA 4AP4C 2WDVB 1XCQL 3N1YC 1D3ZA 3Q6BA 5JZEB 1WGHA 1EUVB 3P4QB 4ZRJA 1L6VA 2OJWA 1UELA 2BVCA 2LVQA 4DHZB 1KJTA 2FUHB 2KN5A 4EUTA 3DBRI 2IGHA 3ZYYX 4C56C 1IP9A 1EU4A 2WGSA 1KLGD 4EKUA 1XLQA 2YEPB 3E9SA 1KLUD 1D6EC 5D2MB 1C9FA 4KSKC 2IO3B 1V80A 2PVOD 3TEYA 3PGEA 3RNAC 3FKYA 1WY8A 3A9KA 2KX0A 2K39A 1WX7A 2LVPA 5TR5A 1SJHD 3TUOA 5LLIA 3V6CB 1FM0D 2K1FA 3JVZX 2ZW0A 3C0RB 1Y8RC 3K9OB 5HI1A 3R8BA 2JRHA 3AE6B 4WAAA 4S0RA 3VH3B 2W3SA 1YJJA 3R66C 2KQ7A 4E74A 3TSSA 4XX5A 3ZW3A 4FHJA 3SU8X 2UYZB 4MJSB 5HKHA 5IO9A 3VXWA 4YSZB 2WU5B 4BKGA 2K5PA 3RNCC 2GBRA 2KO3A 5C2TB 2V4LA 2LMCA 2ZJDA 4DXGA 3RFZB 3MJ5A 1P0RA 5AZGA 2WDTB 1Q0WB 4II2B 2KHWB 2KDEB 5EE0A 2QCZA 4WH4A 4A90A 1E9MA 4HRSA 3VR8B 3BYTB 2Z8LA 1YN5A 4IWQA 4EZKA 2KJ6A 2K9XA 3N3KB 2N9KA 4XDCA 1XXGA 1XLPA 2DWQA 4KVGB 2IO0B 2H89B 2WXFA 1UH6A 2GLSA 3RPFC 3APCA 2PEAA 5E6NA 1ZOYB 3V62A 2IZVB 4K7WA 4YTMB 3H7SA 1QOBA 1WI0A 2N4FA 1T5XD 1UF0A 3ZVVA 2WQYB 2R61A 2Y3AA 4MEMA 1V81A 3Q3OC 1WZ3A 1Z2MA 3WCQA 3AE3B 1YD8U 2MCNB 1F0ZA 1ZXHA 4W9GA 2ZCCA 4KGRA 1UBQA 3RULA 1V5TA 2XBBC 4FADA 2WXHA 2IGGA 3RYTA 4WQMA 3BY4B 3ZXRA 1FNVA 2BS4B 1JWMD 1PYWD 3VR9B 2V1YA 1R4MI 4RGNA 4RGOS 1I4XA 2BYVE 2L1AA 5GMVA 3EHVA 2JT4B 3ZRFA 3NOBA 3AU5A 1ISNA 2NS5A 1TT5B 4ZHPA 1IBXB 2K6DB 4LDTB 3IG3A 3ZJTA 1MJDA 3VUWA 4MJSA 1K50A 4J3OD 2QHOA 4DQOC 4W9HA 2ACZB 1XLOA 3UINB 1ZGUB 2W82A 2ZPNA 3JW0X 1PFDA 3JSVB 4ZRQA 3JSVA 1YNTE 4L2YA 5BYRA 5FK9C 2QJLA 2IJ0A 4WJPA 1YMHE 3TEXA 1QF6A 1Q1OA 3APDA 4AJYB 2GMIC 2KFJA 4I6NB 2I38A 3GP7A 4CQNA 1V2YA 2KD0A 2LUEA 2ONQA 5AZFA 2M56B 1E6EB 3L54A 4OZBA 2O2VA 1K51A 1GPXA 2WXQA 3AEBB 2RR9A 1F77A 2FIFA 2LXCA 4B6WA 2INDC 5BO4B 5C3JB 5D3IB 2J0MA 5IKCM 4BVUC 3P42A 2L05A 4W9LA 2MBBB 2KTRB 3U7ZA 5H92C 5E6JA 1VDVA 2KDBA 1E7VA 1L5PA 1OQRA 2MSED 3Q3JA 4ANWA 2RDGA 2G3QB 1HXYD 4C00A 1AWDA 3AULA 2JXXA 4KGTA 3EECA 1EF5A 5D94A 2DYOA 4E3CA 2KDIA 2LHDA 3ML9A 1WX9A 2W9NA 3N30A 1OEYJ 4A9AA 1I4HA 4KDLB 1SJED 4AS1A 4ZYSA 4ITKA 2JYEA 2VH1A 2WX0A 4N9F4 1RFAA 3T8MA 4HJGE 1AYFA 1F9JA 2X38A 3PREA 4G11A 1FFVA 1WJUA 2I1JA 2JRIB 5IOIA 3A1QB 2INNE 4S17A 4JQWC 1L0VB 5HG2A 4MSQB 1SE2A 2KVRA 4DBGA 5AEKB 1FRRA 2BT6A 1IBXA 3CIRB 1HA5A 4HLEA 1WXMA 2J0JA 1EF1A 2W3RA 4A55A 1VZ8A 5DPWA 2HE7A 2Y5PA 2C7HA 4FN2A 2D2QA 1ZP0B 2G4DB 1ZE3D 2KC1A 4XWTA 3P1MA 3C19A 4JLCA 3PS6A 2XN9C 2YEPF 1ZUD2 3ZO5B 4L1BA 3QIJA 1NI3A 2WDQB 1ACCA 3WALA 4MDKE 1QT9A 3ABVB 3QK0A 3PRZA 1D4BA 4PS3A 1JCKB 2VRRB 4HXDA 3PZ8A 2L0FA 2PMVA 4RM8A 3L08A 3PLVA 3ENEA 2RPQA 2KQ4X 3PPAA 1WR1A 1VD2A 1WSPA 2BWFA 2K3UA 5EE9A 1IGDA 1WRDB 4DK5A 2AL6A 3P4SB 1WE7A 2M19A 1WRIA 2G1EA 4JE3B 3M95A 4LNOA 1MFWA 4HPMB 3OWEB 3V61A 1E90A 4NNJB 5AUKA 2JSVX 4RH6A 2FNJB 3GOEA 3W5UB 3DBLB 4DDID 5HFYA 4ZRIA 3S2AA 5J2RA 3PHWB 3ZRCA 4QAYA 1SBBB 1IGCA 1LQBA 3QCAA 3ZNZB 4LLGM 1KF6B 1JRUA 1V97A 4C7YA 2M0AA 3N20C 3AE7B 2KMAA 1WGDA 4ARCA 2SAKA 2YLMA 1FO4A 5LXIB 3VAWA 2N9EB 3H9DA 4HK2A 2OEDA 3OLMD 2IDYA 4F7ZA 3ALBA 2DX5B 1C78A 1LFDA 3CSTA 1EM7A 3UQBA 4IW0A 4RGMA 5AUIA 3ZXVA 3NUHB 2N7DA 3UQAA 2LEKA 4YTPB 2VH2A 1OTRB 3ZJUA 3B08A 3OAWA 4EOYA 2JZ3B 2JF5A 2KNBA 4ASWC 5EDSA 5E6PA 2KACA 1DGJA 2Q5WD 1LGRA 1N62A 4Q2JA 2EKEC 2KYWA 1V8CA 4LJPB 2MHJA 3V3XA 3ZNID 2AEHA 1CQVA 5CHFA 4WJQA 3OJ3A 4NQKE 4IM2A 3ZLZA 3AE2B 3KYDD 4LNKA 2KJRA 3U52E 1RFKA 5CX3A 1WJ6A 3DVNV 1EU3A 2L76A 2HTME 2JU6X 3NZSA 1GB1A 1FMAD 1V86A 2AX5A 1A5RA 2LRWA 3AE8B 5CHVC 1I4PA 1WMHB 4A6QA 3ZTDA 1V5OA 2MBHA 4OVUA 3KQ4A 5EE1A 3EUB2 4FULA 1I35A 2PE9A 1OFFA 3RCZA 1B9RA 4HDQA 2MJDA 5DPTA 1L4DB 2HTHA 3W1YA 1M94A 1ROEA 2IO1B 4MSMB 2GI9A 2FAZA 1YX5B 4OZCA 2KMMA 1Y56A 2GBMA 4KGSA 4O1NA 2KKCA 4FHKA 2N1VA 1PDXA 2AYOB 1R7SA 4NAWB 3QAQA 3OJ4B 3UGBB 4F8CB 1L0YB 4HEA1 1L4ZB 3DQVA 5IN7A 4A8XC 1V1PB 1WX8A 4BFRA 5BYSA 4GSWA 1A70A 2PPHA 3KWVA 4AUQC 1UWMA 3T9LA 3QX1A 2E6XA 3TEWA 3ZIMA 3DBHI 4HDOA 3NS8A 3W1SA 4KDIC 1VRAB 3ZJVA 4W9KA 3IT4B 2IBIB 1RAXA 1FPYA 1NDDA 1GC7A 3V05A 3C8YA 2MBEA 5BYQA 3QA8A 4JWSC 3M62B 3VRAB 4W9EA 1E7UA 2JX5A 4I6LB 2NBWB 4TQ0A 3IAM1 2Z59B 2ZVOA 4ZYNA 1V9JA 5JH5C 2QMTA 4BOSC 3A9JA 2QSDA 3FC4A 3W2DA 4XZ4A 2LRUA 4W9CA 1Q5WB 1NI2A 1JROA 3ETRA 4AOFA 1J19A 3ZNHB 2K0PA 3SDLC 2DYMA 5DPSA 2KAJA 2R2OA 4KZCA 2O6VD 2X8XX 1HTQA 2BS3B 4K3BA 1WR6E 3PLUA 4IM0A 2JZZA 5AZHA 1E8WA 3N1XC 4HKQA 3ZNGC 2WDRB 5J18A 1I42A 1LO5D 4CO7A 1SIFA 3CWIA 4JWUC 4G3XB 4K1RB 2CS4A 2PW9A 3P4RB 1KRHA 3SD5A 3VFKA 1YX6B 5MPOA 1CZPA 3LYYA 2D10A 4IDIA 4BKSD 4OVZA 5D3DA 3VTVA 3SR6A 2L7RA 2RD0A 1FFUA 5KHQA 1NYQA 2DNFA 3AV8A 4JPSA 4IM3A 3AXCA 2MBOA 2AQ2B 4LNFA 2CHWA 1BXTA 2D3BA 4KZ0A 2KTFA 4BBNF 2N0SB 1TYGB 1D5XC 1WYGA 1ZDXA 1ZW7A 3NJTA 2L52A 2XK5A 2MEKA 5D6JB 3Q8EA 5G55A 2L00B 2KOXA 2KWVB 3TBLD 2NVUI 2KJHB 1YQ3B 4G50A 2GBKA 1WFYA 2ZNVB 2PVGC 1GC6A 1YN3A 3KW5B 3MHSD 1BT0A 1T6BX 1VCBA 3B2GA 4PK1A 2K22A 4NZLB 3T3OA 4NQLB 4JIOU 4MM3A 1DOIA 4KV2A 2LXAA 4GXBA 4JGHB 3DBHB 4DHJD 2D3AA 2WXPA 4ZDVA 1N63A 3V6EB 3B9JA 1CJEA 3PSEB 2ZEQA 1VJKA 2LI5A 1AN8A 1D5MC 1DOYA 1M4VA 4B9KA 1CMXB 2AQ3B 3K9PB 1AARA 1FNWA 1JWBD 3U8ZA 1VLBA 2L32A 2M17A 4AWJA 2MLBA 3RT3B 3H7PB 3QC8B 2ZVNA 3TJPA 2WXIA 5JHBA 2MJEA 2K8BA 1JWUD 3BINA 4YXDB 3NVWA 3GZNI 4FJYA 5DPRA 3WA0A 1FEHA 3DBSA
chains in the Genus database with same CATH topology
1HE8A 1UD7A 5C1ZA 4IWPA 2YVCA 1U4AA 1H8CA 4GDKB 5DPWA 3VTWA 2HE7A 4GDKA 2C7HA 2V3SA 1H4RA 2D2QA 4FN2A 4ICUA 4K7SA 4WWOA 2G4DB 2ZPYA 3IBEA 4OVVA 2MBQA 3CSFA 4PS7A 2KC1A 2ZCBA 5E6OA 2M0XA 4JLCA 3PS6A 1J0GA 2FCSA 4BBNC 5L95C 3WIMA 4NJ6A 3I3TB 4MGZE 4A3OA 3KYCD 3DPDA 4IG7B 1UZXB 1V49A 3ZO5B 2LWPA 3HM3A 4LCDE 5CHWA 2MWSB 3AI5A 4E71A 3QIJA 3IHPC 3UIPB 4WJNA 3R7QA 3IVFA 3VDZA 3WALA 1X1MA 4MDKE 4GDLB 2KWUB 3QK0A 2RGFA 2JY6A 2M1MA 3PRZA 2IYDB 2GBJA 1E8ZA 2KC2A 3APFA 4PS3A 4XC2A 4HWIB 2LJ5A 2VRRB 4HXDA 4BKSA 2DAFA 4DHJB 2BPSA 2L0FA 2CHZA 4RM8A 1C3TA 3L08A 4ZRKA 1L2NA 3VQIA 3PLVA 3EC8A 3ENEA 1WIAA 2RPQA 3PPAA 4FJVB 3KH0A 4CHKA 1WR1A 4NY0A 1VD2A 3DCGA 1PQSA 2BWFA 2KANA 4MGIE 4HCNB 1WXVA 2IY1B 4GN1A 2PE6B 3A4SC 2MP2B 5IAAC 2KQSA 3ZKJC 4A20A 2N7EA 1XT9B 3A9JB 1WRDB 2Z0DB 3ZDMC 4DK5A 2AL6A 3H7PA 2L0TA 2G4SA 3Q3FA 1WF9A 3NHEB 1EO6A 3B1LX 1WE7A 4FJZA 3ECIA 5KHOA 3M95A 1IPGA 4RMAA 4AP4C 4GMVA 2NPTA 1D3ZA 4HCPB 4HPMB 5JZEB 3JYUA 1WGHA 3V61A 1EUVB 1E90A 4NNJB 4ZRJA 4CYEA 2KLCA 4DXAB 1UELA 4G0NB 2FNJB 2MA9B 3GOEA 2A4ZA 2LVQA 1KJTA 4DHZB 2FUHB 2KN5A 4DDID 4EUTA 2O6VB 4WJOA 4ZRIA 4TKNA 3DBRI 3S2AA 5J2RA 2DAJA 1IP9A 3PVLA 4TUUA 3TL5A 3PHWB 3ZRCA 2KX3A 3NY5A 4EKUA 1LQBA 3QCAA 3ZNZB 4K81A 1JRUA 1P1AA 2M8SA 2LGYA 2OJRA 2KMAA 1WGDA 5D2MB 4URKA 4W9JA 4KSKC 4GGQA 1YJ1A 2YLMA 2K8HA 3VUYA 3ONSA 2IO3B 1V80A 2LGDA 3PRMB 3VAWA 2N9EB 3H9DA 4HK2A 5LXIB 4GU2A 4GIVA 4FA6A 3OLMD 3KUCB 3PGEA 4BOZB 4I6PA 5DCNA 3L10B 3QARA 4F7ZA 3ALBA 2DX5B 1WY8A 1LFDA 1OQYA 3CSTA 4KIKA 2DZKA 3UQBA 4IW0A 2D11A 3A9KA 2KX0A 2K39A 1WX7A 2LVPA 2N7DA 5TR5A 1UGMA 4RM9A 3UQAA 3VH4B 3PZDA 2J7QB 1OTRB 5LLIA 3V6CB 2K1FA 2CU1A 3JVZX 2MRPA 2BGFA 1Y8RC 3C0RB 2GBNA 3K9OB 2JRHA 2N9XA 2PJHA 4AJWA 4F1SA 5L83A 4FBJB 2FCNA 3B08A 3OAWA 4EOYA 2JZ3B 2JF5A 2KNBA 4ASWC 4WAAA 5EDSA 3VH3B 3TMPB 3HIZA 2I1KA 5E6PA 3R66C 2KQ7A 4J6IA 3TIXA 4E74A 1TBEA 3ZDTA 3U7DA 2C7MB 2EKEC 3O65B 4XX5A 4LJPB 4FHJA 3SU8X 3ZW3A 2UYZB 3WAOA 3ZNID 2AEHA 3H1UA 4MJSB 5CHFA 1KLVA 5HKHA 4WJQA 3OJ3A 4BKTA 3VXWA 3QHTA 4NQKE 4IM2A 1IYFA 3ZLZA 1WXSA 3KYDD 2KXJA 4BKGA 2AL3A 3WANA 2N1WA 2KJRA 2GBRA 5CX3A 1WJ6A 3DVNV 1XD3B 2L76A 4M8MA 2WYQA 1WE6A 2KO3A 2V4LA 3NZSA 4GOCA 1WM2A 2JPHA 2ZJDA 1P3QU 2KZRA 2BF8B 4IUMB 1V86A 2FCMA 1A5RA 1P0RA 2LRWA 5AZGA 2WDTB 1Q0WB 4II2B 2KHWB 4W9FA 5CHVC 2XEWA 2KDEB 5JHAA 2CHXA 1WGYA 3L16A 1WMHB 3L17A 1SE9A 1WMHA 3ZTDA 1V5OA 2BYEA 2MBHA 4OVUA 3IFWB 4NJ7A 2KWCA 3A33B 4FULA 2LVOA 1WH3A 5LXHA 3SHQA 1I35A 4DWFA 2LASA 2NCNA 2PE9A 4IWQA 4EZKA 1OGWA 2KJ6A 3RCZA 4KSLC 4HDQA 5DPTA 1E5WA 3N3KB 2HTHA 3W1YA 1M94A 3PTFC 4W9IA 2IO1B 4MSMB 4KVGB 2IO0B 2FAZA 3MJWA 1YX5B 2LD9A 3KUDB 1OEYA 2GBMA 4NPNA 1UH6A 2KKCA 3APCA 2PEAA 2N1VA 4FHKA 5E6NA 3A4RA 2AYOB 4JL9A 3M3JA 4K7UA 2KFKB 3V62A 4NAWB 3RZWC 3QAQA 3PRPB 4A3PA 3OJ4B 2BWES 3VTUA 5FR6A 2IZVB 4K7WA 3UGBB 1FXTB 4F8CB 2M4NA 2KTRA 3H7SA 2K6QA 1WI0A 4DHZE 1Z5SB 4X57B 1E8XA 2N4FA 4ANXA 4PS8A 3ZVVA 2WX1A 3PHXB 2KLGA 3DQVA 3LJ3A 4MEMA 4M8NA 1V81A 3ML8A 2WWZA 2L3ZA 1WX8A 4BFRA 4GSWA 2D07B 2C7NB 1WZ3A 1Z2MA 1YD8U 4MH0E 1RRBA 2PPHA 4W9DA 4PYZA 2MCNB 2BYFA 4AUQC 3X23A 2RSUA 4W9GA 5J17A 1K8RB 2ZCCA 3T9LA 1R4NI 1UBQA 3RULA 3QX1A 3ZIMA 3RD2A 3DBHI 1P9DU 1TTNA 1V5TA 4HDOA 3NS8A 2XBBC 3W1SA 4FADA 1SGHA 4KDIC 1UBIA 3DDCB 3RYTA 4W9KA 4GDLA 4P7IA 3BY4B 1WJNA 4M0WB 2NR2A 2IBIB 2DZMA 2D3GA 1RAXA 1WGGA 1NDDA 1WYWB 1GC7A 2DENB 3A9KB 2MBEA 4EZLA 3QA8A 2V1YA 4FLHA 3M62B 1R4MI 2KK8A 4W9EA 1E7UA 4MGYE 4HVBA 1GUAB 4I6LB 2JWZA 2NBWB 5GMVA 2BYVE 3QJZA 1YIWA 4TQ0A 3EHVA 2Z59B 2JT4B 2ZVOA 3A1QA 4ZYNA 3ZRFA 3NOBA 2MQJA 2L8JA 1V9JA 3AU5A 2OOBB 1ISNA 5JH5C 1YQBA 4BOSC 2NS5A 2JUOA 3A9JA 3WAPA 2HD5B 4XZ4A 2LRUA 4W9CA 1Q5WB 1TZ1A 2BKRB 2G45B 4LJOB 1NI2A 2CR5A 4AOFA 1J19A 2K6DB 4LDTB 3IG3A 3ZNHB 2CKHB 2DYMA 1WXAA 3QWZB 3SDLC 5DPSA 3CF6E 5G2NA 3L0WB 2R2OA 2IO2B 1LXDA 4KZCA 4EFOA 2O6VD 3VUWA 4MJSA 3UIOB 2QHOA 4B95A 3V60A 4W9HA 1WR6E 2KFKA 2JZZA 2Y5BB 3PLUA 1E8WA 4IM0A 5AZHA 1GNUA 3UINB 3ZNGC 4II3B 5J18A 1ZGUB 4WQOB 2ZPNA 3JW0X 1I42A 4GB9A 3KUZA 4CO7A 2DHZA 1SIFA 3JSVB 4LDTD 2IY0B 2O6VA 3JSVA 5IA7A 5CTRC 2A5UA 4K1RB 2LGXA 3L13A 2CS4A 4G3XB 2BKFA 5C23A 4WJPA 3SD5A 3VFKA 1YX6B 2UWQA 2D10A 1Q1OA 3APDA 3QQ8B 4AJYB 2GMIC 2KFJA 4I6NB 4BKSD 2LUEA 1V2YA 2KD0A 3VTVA 3N32A 3ZUNA 2L7RA 2RD0A 3KVFB 5AZFA 3RZFA 2R2QA 4PYUA 4HPLB 4IC7B 5KHQA 1L7YA 3L54A 2O2VB 2ASQA 3DOWA 2O2VA 2GOWA 2C9WB 4IM3A 2Z0EB 3AXCA 4IWOA 2MBOA 2RR9A 4KIKB 1MG8A 3X0WA 2LXCA 2FIFA 4B6WA 3M63B 2CHWA 2AWTA 3HHMA 2C5LC 4KZ0A 2KTFA 2REXA 4YL8A 5BO4B 3MTNB 4BBNF 2ZNVC 3VUXA 4ANVA 2MW5A 1P98A 2J0MA 4NAWA 4BVUC 1ZW7A 5D6JB 2XK5A 4EZJA 2L05A 2NBUA 4TV3A 4W9LA 2MBBB 2K25A 2DZIA 2MX2A 3CMMB 2KTRB 1TGZB 3R7RA 2LZ6A 1S1QB 5G55A 2L00B 1QZEA 4ICVA 2KDBA 1E7VA 2KOXA 2KWVB 3TBLD 3WAMA 4ANUA 2NVUI 2J0KA 2KJHB 4G50A 2GBKA 3PT2B 5D7GA 3Q3JA 2MSED 4ANWA 3VVWB 1WFYA 2DYBA 2ZNVB 3DVGX 2G3QB 2FCQA 1E8YA 1GC6A 3AULA 3KW5B 4MELA 3MHSD 3RUIB 1BT0A 2JXXA 3DVNU 1VCBA 3P2BA 3B0AA 3EECA 1EF5A 5D94A 2DYOA 2NPTB 4E3CA 2KDIA 1WGRA 2C60A 1WZ0A 1ZKHA 3HK0A 3ML9A 1WX9A 2DZJA 4JIOU 4MM3A 4NQLB 4KV2A 2W9NA 2LXAA 3N30A 2B3AA 3NZUA 4GXBA 3VHTC 1GG3A 4JGHB 1GJZA 1OEYJ 3TCAA 1KM7A 4DHJD 4KDLB 4ZDVA 3V6EB 3PSEB 2ZEQA 3DVGY 2LI5A 2WX0A 2EMTA 3D32A 1RLFA 4N9F4 1G6JA 1RFAA 3T8MA 4EEWA 3EFUA 2N9PC 3UF8A 1J8CA 3U30A 2KDFB 3W1SC 4B9KA 1F9JA 3PREA 1CMXB 3K9PB 2ZZPB 4G11A 1WJUA 1KOTA 2I1JA 3R3MA 2JRIB 3LDZE 1AARA 3A1QB 2KMCA 2JVCA 3U8ZA 2MP2A 3DBLI 3ZTCA 4HJKA 1LM8B 1S3SG 4JQWC 2M17A 4AWJA 2MLBA 2K8CA 3H7PB 3RT3B 3QC8B 2ZVNA 3TJPA 5JHBA 4TQ1A 1C1YB 4MSQB 4DBGA 2KVRA 5AEKB 4MGKE 1NBFC 2FIDA 2K8BA 3HM6X 1WM3A 4WWNA 1V6EA 3BINA 2EMSA 2HJ8A 4HLEA 1WXMA 3AU4A 3GZNI 2J0JA 1EF1A 4FJYA 4WWPA 1WJ4A 3H6NA 3PV1A 5DPRA 3WA0A 4DDGD 2NBVB 3DBSA 1T0YA 2XK5B 1XQQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1HE8 A;  1UD7 A;  5C1Z A;  4IWP A;  2YVC A;  1U4A A;  1H8C A;  4GDK B;  5DPW A;  3VTW A;  2HE7 A;  4GDK A;  2C7H A;  2V3S A;  1H4R A;  2D2Q A;  4FN2 A;  4ICU A;  4K7S A;  4WWO A;  2G4D B;  2ZPY A;  3IBE A;  4OVV A;  2MBQ A;  3CSF A;  4PS7 A;  2KC1 A;  2ZCB A;  5E6O A;  2M0X A;  4JLC A;  3PS6 A;  1J0G A;  2FCS A;  4BBN C;  5L95 C;  3WIM A;  4NJ6 A;  3I3T B;  4MGZ E;  4A3O A;  3KYC D;  3DPD A;  4IG7 B;  1UZX B;  1V49 A;  3ZO5 B;  2LWP A;  3HM3 A;  4LCD E;  5CHW A;  2MWS B;  3AI5 A;  4E71 A;  3QIJ A;  3IHP C;  3UIP B;  4WJN A;  3R7Q A;  3IVF A;  3VDZ A;  3WAL A;  1X1M A;  4MDK E;  4GDL B;  2KWU B;  3QK0 A;  2RGF A;  2JY6 A;  2M1M A;  3PRZ A;  2IYD B;  2GBJ A;  1E8Z A;  2KC2 A;  3APF A;  4PS3 A;  4XC2 A;  4HWI B;  2LJ5 A;  2VRR B;  4HXD A;  4BKS A;  2DAF A;  4DHJ B;  2BPS A;  2L0F A;  2CHZ A;  4RM8 A;  1C3T A;  3L08 A;  4ZRK A;  1L2N A;  3VQI A;  3PLV A;  3EC8 A;  3ENE A;  1WIA A;  2RPQ A;  3PPA A;  4FJV B;  3KH0 A;  4CHK A;  1WR1 A;  4NY0 A;  1VD2 A;  3DCG A;  1PQS A;  2BWF A;  2KAN A;  4MGI E;  4HCN B;  1WXV A;  2IY1 B;  4GN1 A;  2PE6 B;  3A4S C;  2MP2 B;  5IAA C;  2KQS A;  3ZKJ C;  4A20 A;  2N7E A;  1XT9 B;  3A9J B;  1WRD B;  2Z0D B;  3ZDM C;  4DK5 A;  2AL6 A;  3H7P A;  2L0T A;  2G4S A;  3Q3F A;  1WF9 A;  3NHE B;  1EO6 A;  3B1L X;  1WE7 A;  4FJZ A;  3ECI A;  5KHO A;  3M95 A;  1IPG A;  4RMA A;  4AP4 C;  4GMV A;  2NPT A;  1D3Z A;  4HCP B;  4HPM B;  5JZE B;  3JYU A;  1WGH A;  3V61 A;  1EUV B;  1E90 A;  4NNJ B;  4ZRJ A;  4CYE A;  2KLC A;  4DXA B;  1UEL A;  4G0N B;  2FNJ B;  2MA9 B;  3GOE A;  2A4Z A;  2LVQ A;  1KJT A;  4DHZ B;  2FUH B;  2KN5 A;  4DDI D;  4EUT A;  2O6V B;  4WJO A;  4ZRI A;  4TKN A;  3DBR I;  3S2A A;  5J2R A;  2DAJ A;  1IP9 A;  3PVL A;  4TUU A;  3TL5 A;  3PHW B;  3ZRC A;  2KX3 A;  3NY5 A;  4EKU A;  1LQB A;  3QCA A;  3ZNZ B;  4K81 A;  1JRU A;  1P1A A;  2M8S A;  2LGY A;  2OJR A;  2KMA A;  1WGD A;  5D2M B;  4URK A;  4W9J A;  4KSK C;  4GGQ A;  1YJ1 A;  2YLM A;  2K8H A;  3VUY A;  3ONS A;  2IO3 B;  1V80 A;  2LGD A;  3PRM B;  3VAW A;  2N9E B;  3H9D A;  4HK2 A;  5LXI B;  4GU2 A;  4GIV A;  4FA6 A;  3OLM D;  3KUC B;  3PGE A;  4BOZ B;  4I6P A;  5DCN A;  3L10 B;  3QAR A;  4F7Z A;  3ALB A;  2DX5 B;  1WY8 A;  1LFD A;  1OQY A;  3CST A;  4KIK A;  2DZK A;  3UQB A;  4IW0 A;  2D11 A;  3A9K A;  2KX0 A;  2K39 A;  1WX7 A;  2LVP A;  2N7D A;  5TR5 A;  1UGM A;  4RM9 A;  3UQA A;  3VH4 B;  3PZD A;  2J7Q B;  1OTR B;  5LLI A;  3V6C B;  2K1F A;  2CU1 A;  3JVZ X;  2MRP A;  2BGF A;  1Y8R C;  3C0R B;  2GBN A;  3K9O B;  2JRH A;  2N9X A;  2PJH A;  4AJW A;  4F1S A;  5L83 A;  4FBJ B;  2FCN A;  3B08 A;  3OAW A;  4EOY A;  2JZ3 B;  2JF5 A;  2KNB A;  4ASW C;  4WAA A;  5EDS A;  3VH3 B;  3TMP B;  3HIZ A;  2I1K A;  5E6P A;  3R66 C;  2KQ7 A;  4J6I A;  3TIX A;  4E74 A;  1TBE A;  3ZDT A;  3U7D A;  2C7M B;  2EKE C;  3O65 B;  4XX5 A;  4LJP B;  4FHJ A;  3SU8 X;  3ZW3 A;  2UYZ B;  3WAO A;  3ZNI D;  2AEH A;  3H1U A;  4MJS B;  5CHF A;  1KLV A;  5HKH A;  4WJQ A;  3OJ3 A;  4BKT A;  3VXW A;  3QHT A;  4NQK E;  4IM2 A;  1IYF A;  3ZLZ A;  1WXS A;  3KYD D;  2KXJ A;  4BKG A;  2AL3 A;  3WAN A;  2N1W A;  2KJR A;  2GBR A;  5CX3 A;  1WJ6 A;  3DVN V;  1XD3 B;  2L76 A;  4M8M A;  2WYQ A;  1WE6 A;  2KO3 A;  2V4L A;  3NZS A;  4GOC A;  1WM2 A;  2JPH A;  2ZJD A;  1P3Q U;  2KZR A;  2BF8 B;  4IUM B;  1V86 A;  2FCM A;  1A5R A;  1P0R A;  2LRW A;  5AZG A;  2WDT B;  1Q0W B;  4II2 B;  2KHW B;  4W9F A;  5CHV C;  2XEW A;  2KDE B;  5JHA A;  2CHX A;  1WGY A;  3L16 A;  1WMH B;  3L17 A;  1SE9 A;  1WMH A;  3ZTD A;  1V5O A;  2BYE A;  2MBH A;  4OVU A;  3IFW B;  4NJ7 A;  2KWC A;  3A33 B;  4FUL A;  2LVO A;  1WH3 A;  5LXH A;  3SHQ A;  1I35 A;  4DWF A;  2LAS A;  2NCN A;  2PE9 A;  4IWQ A;  4EZK A;  1OGW A;  2KJ6 A;  3RCZ A;  4KSL C;  4HDQ A;  5DPT A;  1E5W A;  3N3K B;  2HTH A;  3W1Y A;  1M94 A;  3PTF C;  4W9I A;  2IO1 B;  4MSM B;  4KVG B;  2IO0 B;  2FAZ A;  3MJW A;  1YX5 B;  2LD9 A;  3KUD B;  1OEY A;  2GBM A;  4NPN A;  1UH6 A;  2KKC A;  3APC A;  2PEA A;  2N1V A;  4FHK A;  5E6N A;  3A4R A;  2AYO B;  4JL9 A;  3M3J A;  4K7U A;  2KFK B;  3V62 A;  4NAW B;  3RZW C;  3QAQ A;  3PRP B;  4A3P A;  3OJ4 B;  2BWE S;  3VTU A;  5FR6 A;  2IZV B;  4K7W A;  3UGB B;  1FXT B;  4F8C B;  2M4N A;  2KTR A;  3H7S A;  2K6Q A;  1WI0 A;  4DHZ E;  1Z5S B;  4X57 B;  1E8X A;  2N4F A;  4ANX A;  4PS8 A;  3ZVV A;  2WX1 A;  3PHX B;  2KLG A;  3DQV A;  3LJ3 A;  4MEM A;  4M8N A;  1V81 A;  3ML8 A;  2WWZ A;  2L3Z A;  1WX8 A;  4BFR A;  4GSW A;  2D07 B;  2C7N B;  1WZ3 A;  1Z2M A;  1YD8 U;  4MH0 E;  1RRB A;  2PPH A;  4W9D A;  4PYZ A;  2MCN B;  2BYF A;  4AUQ C;  3X23 A;  2RSU A;  4W9G A;  5J17 A;  1K8R B;  2ZCC A;  3T9L A;  1R4N I;  1UBQ A;  3RUL A;  3QX1 A;  3ZIM A;  3RD2 A;  3DBH I;  1P9D U;  1TTN A;  1V5T A;  4HDO A;  3NS8 A;  2XBB C;  3W1S A;  4FAD A;  1SGH A;  4KDI C;  1UBI A;  3DDC B;  3RYT A;  4W9K A;  4GDL A;  4P7I A;  3BY4 B;  1WJN A;  4M0W B;  2NR2 A;  2IBI B;  2DZM A;  2D3G A;  1RAX A;  1WGG A;  1NDD A;  1WYW B;  1GC7 A;  2DEN B;  3A9K B;  2MBE A;  4EZL A;  3QA8 A;  2V1Y A;  4FLH A;  3M62 B;  1R4M I;  2KK8 A;  4W9E A;  1E7U A;  4MGY E;  4HVB A;  1GUA B;  4I6L B;  2JWZ A;  2NBW B;  5GMV A;  2BYV E;  3QJZ A;  1YIW A;  4TQ0 A;  3EHV A;  2Z59 B;  2JT4 B;  2ZVO A;  3A1Q A;  4ZYN A;  3ZRF A;  3NOB A;  2MQJ A;  2L8J A;  1V9J A;  3AU5 A;  2OOB B;  1ISN A;  5JH5 C;  1YQB A;  4BOS C;  2NS5 A;  2JUO A;  3A9J A;  3WAP A;  2HD5 B;  4XZ4 A;  2LRU A;  4W9C A;  1Q5W B;  1TZ1 A;  2BKR B;  2G45 B;  4LJO B;  1NI2 A;  2CR5 A;  4AOF A;  1J19 A;  2K6D B;  4LDT B;  3IG3 A;  3ZNH B;  2CKH B;  2DYM A;  1WXA A;  3QWZ B;  3SDL C;  5DPS A;  3CF6 E;  5G2N A;  3L0W B;  2R2O A;  2IO2 B;  1LXD A;  4KZC A;  4EFO A;  2O6V D;  3VUW A;  4MJS A;  3UIO B;  2QHO A;  4B95 A;  3V60 A;  4W9H A;  1WR6 E;  2KFK A;  2JZZ A;  2Y5B B;  3PLU A;  1E8W A;  4IM0 A;  5AZH A;  1GNU A;  3UIN B;  3ZNG C;  4II3 B;  5J18 A;  1ZGU B;  4WQO B;  2ZPN A;  3JW0 X;  1I42 A;  4GB9 A;  3KUZ A;  4CO7 A;  2DHZ A;  1SIF A;  3JSV B;  4LDT D;  2IY0 B;  2O6V A;  3JSV A;  5IA7 A;  5CTR C;  2A5U A;  4K1R B;  2LGX A;  3L13 A;  2CS4 A;  4G3X B;  2BKF A;  5C23 A;  4WJP A;  3SD5 A;  3VFK A;  1YX6 B;  2UWQ A;  2D10 A;  1Q1O A;  3APD A;  3QQ8 B;  4AJY B;  2GMI C;  2KFJ A;  4I6N B;  4BKS D;  2LUE A;  1V2Y A;  2KD0 A;  3VTV A;  3N32 A;  3ZUN A;  2L7R A;  2RD0 A;  3KVF B;  5AZF A;  3RZF A;  2R2Q A;  4PYU A;  4HPL B;  4IC7 B;  5KHQ A;  1L7Y A;  3L54 A;  2O2V B;  2ASQ A;  3DOW A;  2O2V A;  2GOW A;  2C9W B;  4IM3 A;  2Z0E B;  3AXC A;  4IWO A;  2MBO A;  2RR9 A;  4KIK B;  1MG8 A;  3X0W A;  2LXC A;  2FIF A;  4B6W A;  3M63 B;  2CHW A;  2AWT A;  3HHM A;  2C5L C;  4KZ0 A;  2KTF A;  2REX A;  4YL8 A;  5BO4 B;  3MTN B;  4BBN F;  2ZNV C;  3VUX A;  4ANV A;  2MW5 A;  1P98 A;  2J0M A;  4NAW A;  4BVU C;  1ZW7 A;  5D6J B;  2XK5 A;  4EZJ A;  2L05 A;  2NBU A;  4TV3 A;  4W9L A;  2MBB B;  2K25 A;  2DZI A;  2MX2 A;  3CMM B;  2KTR B;  1TGZ B;  3R7R A;  2LZ6 A;  1S1Q B;  5G55 A;  2L00 B;  1QZE A;  4ICV A;  2KDB A;  1E7V A;  2KOX A;  2KWV B;  3TBL D;  3WAM A;  4ANU A;  2NVU I;  2J0K A;  2KJH B;  4G50 A;  2GBK A;  3PT2 B;  5D7G A;  3Q3J A;  2MSE D;  4ANW A;  3VVW B;  1WFY A;  2DYB A;  2ZNV B;  3DVG X;  2G3Q B;  2FCQ A;  1E8Y A;  1GC6 A;  3AUL A;  3KW5 B;  4MEL A;  3MHS D;  3RUI B;  1BT0 A;  2JXX A;  3DVN U;  1VCB A;  3P2B A;  3B0A A;  3EEC A;  1EF5 A;  5D94 A;  2DYO A;  2NPT B;  4E3C A;  2KDI A;  1WGR A;  2C60 A;  1WZ0 A;  1ZKH A;  3HK0 A;  3ML9 A;  1WX9 A;  2DZJ A;  4JIO U;  4MM3 A;  4NQL B;  4KV2 A;  2W9N A;  2LXA A;  3N30 A;  2B3A A;  3NZU A;  4GXB A;  3VHT C;  1GG3 A;  4JGH B;  1GJZ A;  1OEY J;  3TCA A;  1KM7 A;  4DHJ D;  4KDL B;  4ZDV A;  3V6E B;  3PSE B;  2ZEQ A;  3DVG Y;  2LI5 A;  2WX0 A;  2EMT A;  3D32 A;  1RLF A;  4N9F 4;  1G6J A;  1RFA A;  3T8M A;  4EEW A;  3EFU A;  2N9P C;  3UF8 A;  1J8C A;  3U30 A;  2KDF B;  3W1S C;  4B9K A;  1F9J A;  3PRE A;  1CMX B;  3K9P B;  2ZZP B;  4G11 A;  1WJU A;  1KOT A;  2I1J A;  3R3M A;  2JRI B;  3LDZ E;  1AAR A;  3A1Q B;  2KMC A;  2JVC A;  3U8Z A;  2MP2 A;  3DBL I;  3ZTC A;  4HJK A;  1LM8 B;  1S3S G;  4JQW C;  2M17 A;  4AWJ A;  2MLB A;  2K8C A;  3H7P B;  3RT3 B;  3QC8 B;  2ZVN A;  3TJP A;  5JHB A;  4TQ1 A;  1C1Y B;  4MSQ B;  4DBG A;  2KVR A;  5AEK B;  4MGK E;  1NBF C;  2FID A;  2K8B A;  3HM6 X;  1WM3 A;  4WWN A;  1V6E A;  3BIN A;  2EMS A;  2HJ8 A;  4HLE A;  1WXM A;  3AU4 A;  3GZN I;  2J0J A;  1EF1 A;  4FJY A;  4WWP A;  1WJ4 A;  3H6N A;  3PV1 A;  5DPR A;  3WA0 A;  4DDG D;  2NBV B;  3DBS A;  1T0Y A;  2XK5 B;  1XQQ A; 
#chains in the Genus database with same CATH topology
 1UD7 A;  5C1Z A;  2JYT A;  1H8C A;  1HZ6 A;  4K7S A;  3U2S C;  4B0E A;  1KFY B;  1UGJ A;  4UDU C;  2I2Y A;  2MBQ A;  3CSF A;  4PS7 A;  2ZCB A;  4BBN C;  5L95 C;  1JML A;  4NJ6 A;  4L23 A;  3T3N A;  3DPD A;  5BMI A;  4LCD E;  3Q3N C;  4ACF A;  4ZHO A;  2MWS B;  3AEC B;  4E71 A;  3W5V B;  1HEZ E;  2INP E;  1C77 A;  4KKJ A;  3R7Q A;  1NYR A;  4GDL B;  2RGF A;  2JY6 A;  2M1M A;  2IYD B;  1E10 A;  2RDB C;  4XC2 A;  4HWI B;  2LJ5 A;  2GRI A;  1OQQ A;  2DAF A;  2FE8 A;  2LFI A;  4DHJ B;  1IUE A;  4ZRK A;  1J7B A;  3VQI A;  4N58 A;  4K3C A;  4CHK A;  4OZA A;  2CJN A;  2OHF A;  3BII D;  2KAN A;  2IY1 B;  1SB3 C;  3AE9 B;  1XEE A;  2MP2 B;  5IAA C;  4WIP A;  3ZKJ C;  4A20 A;  1XT9 B;  2Z0D B;  3ZDM C;  3H7P A;  2L0T A;  4WAF A;  3NHE B;  1IPG A;  4GMV A;  3H8H A;  2J4X A;  2NPT A;  4HCP B;  2AQ1 B;  3JYU A;  4DXA B;  2KLC A;  1I4R A;  4G0N B;  3VRB B;  2O6V B;  3AH7 A;  3ZGZ A;  3SFD B;  4YSY B;  3PVL A;  4TUU A;  3BZD B;  3TL5 A;  1ZXI A;  1FXA A;  3BVG A;  4K81 A;  2M8S A;  2LGY A;  2OJR A;  4KX6 B;  4W9J A;  3O13 A;  3VUY A;  2K8H A;  2LGD A;  3PRM B;  2WXO A;  2IGD A;  4GIV A;  3KUC B;  2PKO A;  4I6P A;  3L10 B;  1E0Z A;  3AEA B;  3AM9 A;  4KIK A;  2PTL A;  3FIL A;  3MP9 A;  1XCT L;  3HVD A;  3IXS A;  2N9X A;  4AJW A;  4F1S A;  5L83 A;  2FCN A;  5LNK 1;  1NVI D;  3GB1 A;  4REZ A;  3TMP B;  2I1K A;  1TBE A;  1C4C A;  1STE A;  3U7D A;  2W54 A;  1FIQ A;  3WAO A;  2VZK B;  3H1U A;  4M02 A;  4NJC A;  4BKT A;  1DOX A;  3QHT A;  3I57 A;  2PLP A;  3Q8F A;  2AL3 A;  1L6U A;  1XD3 B;  2HDE A;  3R2T A;  3Q69 A;  4M8M A;  2WYQ A;  1WE6 A;  4H2A A;  1WM2 A;  2JPH A;  1P3Q U;  2LGS A;  1F2R I;  2BF8 B;  1TKG A;  4IUM B;  4RCO A;  4R3D A;  4FXC A;  2DBY A;  2XEW A;  2J42 A;  2CHX A;  1WGY A;  3L16 A;  2QDF A;  3L17 A;  2BW2 A;  2N7J A;  4NJ7 A;  3IFW B;  4N59 A;  2KWC A;  3A33 B;  5LXH A;  1WH3 A;  3SHQ A;  5IP4 D;  4DWF A;  4LNN A;  1P7F A;  2LAS A;  1TIF A;  4M00 A;  1EWC A;  2NCN A;  1TS2 A;  1E5W A;  1TKY A;  3PTF C;  3AE4 B;  4W9I A;  1VZ6 A;  3MC8 A;  4P1B C;  3KUD B;  1OEY A;  1GOZ A;  1HQR D;  4LTU A;  4JL9 A;  3M3J A;  3BWU D;  4K7U A;  1FNU A;  2KFK B;  3FIL B;  4US9 A;  3RZW C;  1I7H A;  3PRP B;  1CK1 A;  2BWE S;  3VTU A;  5FR6 A;  3RI7 C;  1FXT B;  2KTR A;  4DHZ E;  3P63 A;  4ANX A;  4PS8 A;  1QOA A;  2WX1 A;  1WGK A;  3GE3 C;  4YTN B;  2WWZ A;  2L3Z A;  4BZA A;  5TSS A;  2D07 B;  3P4P B;  4MH0 E;  1MVK A;  4PYZ A;  2GB1 A;  1K8R B;  4P1C C;  5JXV A;  2D5G A;  4MT5 A;  1R4N I;  3RD2 A;  3NS1 A;  3PZ7 A;  3GE8 C;  1K52 A;  1SGH A;  1UBI A;  3RNG C;  3DDC B;  4WUR A;  2V0G A;  2IPK D;  1R4N B;  1BUI C;  2DZM A;  2D3G A;  3RMK C;  3MC9 A;  2WXJ A;  3A9K B;  4EZL A;  4FLH A;  1N61 A;  4MGY E;  1GUA B;  2JWZ A;  1HTO A;  1YIW A;  3A1Q A;  3KWL A;  2MQJ A;  2L8J A;  2OOB B;  1TS3 A;  2JUO A;  1QQR A;  2HD5 B;  2W55 A;  3U4E G;  1VZ7 A;  1TZ1 A;  2BKR B;  3HVZ A;  3Q8B A;  2CR5 A;  4HPP A;  3DWM A;  4RF0 A;  1J7A A;  2BS2 B;  1WXA A;  3CF6 E;  1XLN A;  4EFO A;  1LXD A;  1C4P A;  1YOV B;  3NRZ A;  2KFK A;  1GNU A;  4XYC A;  4II3 B;  3AE5 B;  4WQO B;  2JQR B;  3Q2A C;  4GB9 A;  4JX1 C;  2DHZ A;  2IY0 B;  2O6V A;  5IA7 A;  1JAL A;  1Q10 A;  2LGX A;  3SEB A;  3Q3M C;  2UWQ A;  4HKZ E;  3AN1 A;  3QQ8 B;  2EKI A;  2NTS A;  1PGB A;  2WLB A;  3N32 A;  2NMQ A;  3KVF B;  3RZF A;  4PYU A;  2V3P A;  2UU7 A;  4IC7 B;  2O2V B;  2ASQ A;  2C9W B;  1RYJ A;  3UI3 A;  1NEN B;  3X0W A;  1TY0 A;  2QIL A;  3HHM A;  3MTN B;  2ZNV C;  2MW5 A;  1P98 A;  1RM6 C;  1MPE A;  2NBU A;  1QKZ A;  4TV3 A;  2DZI A;  3URY A;  2LZ6 A;  1S1Q B;  4ICV A;  3WAM A;  4RF1 A;  2J0K A;  3Q8A A;  4FBJ B;  5D7G A;  2DYB A;  1R4M B;  1EWY C;  2VZK D;  2WNM A;  3RUI B;  1SE4 A;  3P2B A;  3DVN U;  3B0A A;  3GS2 A;  3W9C B;  4TSS A;  4TMA B;  1J7C A;  3AE1 B;  3Q14 C;  3ZQ4 A;  1WZ0 A;  3HK0 A;  2DZJ A;  3NZU A;  3DWG C;  3RNF C;  1C76 A;  3VHT C;  1FRD A;  1KM7 A;  3LB8 C;  1L0X B;  2EMT A;  3D32 A;  1G6J A;  4USA A;  4EEW A;  3EFU A;  3UF8 A;  1J8C A;  3BK1 A;  3W1S C;  5T8I A;  3R3M A;  3LDZ E;  2FUG 1;  1SE3 A;  2WU2 B;  1LM8 B;  1S3S G;  2E3T A;  1FCL A;  2K8C A;  1C1Y B;  3BVM A;  3DHI C;  4XDD A;  1WM3 A;  4WWN A;  1JQ4 A;  3Q8C A;  2JZP A;  3AMZ A;  4WWP A;  4PT5 A;  3H6N A;  3PV1 A;  4OW0 A;  2WHI A;  1UUP A;  5GXG B;  1T0Y A;  1HE8 A;  1QOF A;  3NZ3 A;  4GDK B;  1YJI A;  1MI0 A;  3VTW A;  4GDK A;  4ICU A;  1H4R A;  4WWO A;  3RNE C;  2ZPY A;  1ET6 A;  4OVV A;  4MH8 A;  5E6O A;  1GAQ B;  3WIM A;  1F1H A;  4MGZ E;  4IG7 B;  1TKE A;  3IHP C;  1KTK A;  3VDZ A;  2MH7 A;  1X1M A;  4IOI E;  2PIA A;  2GBJ A;  1RWS A;  4BKS A;  2BB5 A;  4C7Z A;  1T0Q C;  1SEB D;  1C3T A;  3EC8 A;  4FJV B;  1WIA A;  3KH0 A;  1N60 A;  3DCG A;  1PQS A;  4LNI A;  4MGI E;  4HCN B;  1WXV A;  4GN1 A;  1BML C;  2LUM A;  2LJI A;  3DHG C;  1WF9 A;  1EO6 A;  3B1L X;  1SF0 A;  3AEF B;  1JWS D;  4FJZ A;  3ECI A;  3GZN B;  4D2K A;  3HUI A;  1QIL A;  3OG5 A;  4CYE A;  1UWX A;  2SEB D;  2MA9 B;  1C4A A;  2V4I B;  2A4Z A;  1C79 A;  2DLB A;  4WJO A;  4TKN A;  2DAJ A;  5H8Y E;  1ENF A;  2V3N A;  2WXL A;  2LGI A;  1T3Q A;  2KX3 A;  3NY5 A;  3NVY A;  1P1A A;  4MAC A;  2KDM A;  3DBR B;  2BB6 A;  4URK A;  4GGQ A;  1QOG A;  1YJ1 A;  3RN9 C;  4C4V A;  3ONS A;  2L83 A;  4GU2 A;  4FA6 A;  4NAM A;  4YT0 B;  4BOZ B;  5DCN A;  3QAR A;  1OQY A;  4B0M A;  2DZK A;  2D11 A;  3LXF A;  1UGM A;  4RM9 A;  4RGT A;  3VH4 B;  3PZD A;  1B1Z A;  2J7Q B;  2WP9 B;  2CU1 A;  1QLB B;  2MRP A;  2BGF A;  2GBN A;  4ZRP A;  2PJH A;  1MHX A;  2WXN A;  3B2F A;  3HRD D;  4ARI A;  2FBW B;  3HIZ A;  2EEL A;  4J6I A;  3TIX A;  3ZDT A;  2C7M B;  2JXT A;  3O65 B;  2D3C A;  1E7P B;  3I63 C;  1KLV A;  2V9H A;  3IAS 1;  4XWW A;  5FR3 A;  3AEG B;  1IYF A;  2MJ3 A;  1WXS A;  2KXJ A;  1GB4 A;  3WAN A;  2N1W A;  3TEZ A;  3PO0 A;  1N5W A;  1FCC C;  1V1O A;  2ZW1 A;  4M01 A;  2CJO A;  4AQ7 A;  4GOC A;  2KZR A;  2JWU A;  2FCM A;  1ESF A;  3BVZ A;  4W9F A;  1JRP A;  5JHA A;  2XNA C;  1SE9 A;  1WMH A;  3AED B;  2BYE A;  2INC C;  3I5J C;  3MFG A;  2LVO A;  2N9L A;  2KT7 A;  1OGW A;  4KSL C;  4IKG A;  3MJW A;  1NEK B;  1VR9 A;  2LD9 A;  2WXM A;  4NPN A;  2BTE A;  2J53 A;  3A4R A;  4A3P A;  2M4N A;  2K6Q A;  1Z5S B;  4X57 B;  1E8X A;  2WXR A;  3PHX B;  3EGR A;  4P16 A;  2LHE A;  2KLG A;  3LJ3 A;  4M8N A;  3ML8 A;  3FAH A;  3I9V 1;  2C7N B;  1ET9 A;  4W9D A;  1RRB A;  2BYF A;  3X23 A;  1SXT A;  2RSU A;  5J17 A;  1TY2 A;  1F52 A;  1I4G A;  2Y5C A;  4C4V B;  1P9D U;  1TTN A;  1FD6 A;  4N6E B;  3L4P A;  4YSX B;  5HHD G;  4GDL A;  1UNS A;  4P7I A;  4M0W B;  1WJN A;  2BQQ A;  2NR2 A;  3NVZ A;  1WGG A;  1WYW B;  2DEN B;  3KLS X;  3N9Y C;  2KK8 A;  1XF5 L;  4HVB A;  4GLS C;  2TSS A;  3QJZ A;  1PGA A;  3N1Z C;  1YQ4 B;  1YQB A;  3WAP A;  1ZPS A;  1D5Z C;  1K53 A;  4RFB A;  2G45 B;  4LJO B;  2WS3 B;  1AW7 A;  1PUT A;  3BYY B;  2QIE B;  1XO3 A;  2CKH B;  3QWZ B;  5G2N A;  3L0W B;  2BYT A;  4HRO A;  2IO2 B;  4XE0 A;  3UIO B;  4B95 A;  2BBC A;  3V60 A;  2Y5B B;  3SFE B;  3RNB C;  4YWG G;  3KUZ A;  4LDT D;  5CTR C;  1T0S C;  2A5U A;  3L13 A;  2NTT A;  3DHH C;  2BKF A;  1T0R C;  5C23 A;  2RDH A;  3ZUN A;  2R2Q A;  4HPL B;  1L7Y A;  1TJE A;  3DOW A;  1SIJ A;  3EA6 A;  2GOW A;  4US8 A;  1HZ5 A;  2Z0E B;  3AB5 A;  4IWO A;  4KIK B;  1MG8 A;  3M63 B;  4YL8 A;  2AWT A;  2C5L C;  2REX A;  1ZDV A;  4ANV A;  3VUX A;  2H88 B;  2HJ1 A;  3NG0 A;  4NAW A;  4EZJ A;  2K25 A;  2QC8 A;  2MX2 A;  3CMM B;  2B76 B;  1TGZ B;  3R7R A;  1QZE A;  1FXI A;  4ANU A;  3MC0 B;  3PT2 B;  3VVW B;  3DVG X;  3NVV A;  2FCQ A;  1E8Y A;  1JW9 D;  4MEL A;  3J9C A;  3EFC A;  2NPT B;  1WGR A;  2C60 A;  4WWM A;  1ZKH A;  5FKA C;  5BMG A;  2QEJ C;  2B3A A;  3E56 A;  4OHJ A;  1GG3 A;  1TZO A;  1GJZ A;  3TCA A;  4M0W A;  4KKI A;  1JWA D;  1TS5 A;  1MHH E;  3DVG Y;  5G5G A;  1RLF A;  2N9P C;  4XGA B;  3U30 A;  2KDF B;  2ZZP B;  2RMM A;  1KOT A;  2J52 A;  1WWT A;  1KH0 A;  2KMC A;  2JVC A;  2MP2 A;  3DBL I;  3ZTC A;  4HJK A;  4TQ1 A;  4MGK E;  1NBF C;  2FID A;  3HM6 X;  1V6E A;  2EMS A;  2HJ8 A;  2G9H D;  3AU4 A;  1WJ4 A;  4DDG D;  5G5H A;  5EE3 A;  2NBV B;  1TS4 A;  2XK5 B;  1XQQ A;  4IWP A;  2YVC A;  1U4A A;  4RNA A;  5I4D A;  2V3S A;  3IT6 B;  2CU3 A;  3IBE A;  1V1P A;  2M0X A;  4ZOH C;  1J0G A;  2FCS A;  2KVZ A;  2RPV A;  3I3T B;  4A3O A;  3KYC D;  1UZX B;  1V49 A;  1I4Q A;  2LWP A;  3HM3 A;  5CHW A;  4P6V F;  3AI5 A;  4LK0 M;  2ON8 A;  3UIP B;  1MG4 A;  4MM3 B;  4WJN A;  3IVF A;  3MHZ A;  5BMH A;  2KWU B;  2WXG A;  4EE2 A;  1F2R C;  1DYQ A;  1E8Z A;  2KC2 A;  3AEE B;  1PGX A;  1SSN A;  1WXQ A;  3APF A;  1N5X A;  2BPS A;  2CHZ A;  1L2N A;  3BK2 A;  4C80 A;  1YN4 A;  4NY0 A;  3R2I A;  4BAX A;  2PE6 B;  3A4S C;  4DXF A;  1P7E A;  1N6Z A;  2KQS A;  2N7E A;  3A9J B;  2ICI A;  2WXK A;  2G4S A;  3Q3F A;  2KN4 A;  2KWD A;  5KHO A;  4RMA A;  4AP4 C;  2WDV B;  1XCQ L;  3N1Y C;  1D3Z A;  3Q6B A;  5JZE B;  1WGH A;  1EUV B;  3P4Q B;  4ZRJ A;  1L6V A;  2OJW A;  1UEL A;  2BVC A;  2LVQ A;  4DHZ B;  1KJT A;  2FUH B;  2KN5 A;  4EUT A;  3DBR I;  2IGH A;  3ZYY X;  4C56 C;  1IP9 A;  1EU4 A;  2WGS A;  1KLG D;  4EKU A;  1XLQ A;  2YEP B;  3E9S A;  1KLU D;  1D6E C;  5D2M B;  1C9F A;  4KSK C;  2IO3 B;  1V80 A;  2PVO D;  3TEY A;  3PGE A;  3RNA C;  3FKY A;  1WY8 A;  3A9K A;  2KX0 A;  2K39 A;  1WX7 A;  2LVP A;  5TR5 A;  1SJH D;  3TUO A;  5LLI A;  3V6C B;  1FM0 D;  2K1F A;  3JVZ X;  2ZW0 A;  3C0R B;  1Y8R C;  3K9O B;  5HI1 A;  3R8B A;  2JRH A;  3AE6 B;  4WAA A;  4S0R A;  3VH3 B;  2W3S A;  1YJJ A;  3R66 C;  2KQ7 A;  4E74 A;  3TSS A;  4XX5 A;  3ZW3 A;  4FHJ A;  3SU8 X;  2UYZ B;  4MJS B;  5HKH A;  5IO9 A;  3VXW A;  4YSZ B;  2WU5 B;  4BKG A;  2K5P A;  3RNC C;  2GBR A;  2KO3 A;  5C2T B;  2V4L A;  2LMC A;  2ZJD A;  4DXG A;  3RFZ B;  3MJ5 A;  1P0R A;  5AZG A;  2WDT B;  1Q0W B;  4II2 B;  2KHW B;  2KDE B;  5EE0 A;  2QCZ A;  4WH4 A;  4A90 A;  1E9M A;  4HRS A;  3VR8 B;  3BYT B;  2Z8L A;  1YN5 A;  4IWQ A;  4EZK A;  2KJ6 A;  2K9X A;  3N3K B;  2N9K A;  4XDC A;  1XXG A;  1XLP A;  2DWQ A;  4KVG B;  2IO0 B;  2H89 B;  2WXF A;  1UH6 A;  2GLS A;  3RPF C;  3APC A;  2PEA A;  5E6N A;  1ZOY B;  3V62 A;  2IZV B;  4K7W A;  4YTM B;  3H7S A;  1QOB A;  1WI0 A;  2N4F A;  1T5X D;  1UF0 A;  3ZVV A;  2WQY B;  2R61 A;  2Y3A A;  4MEM A;  1V81 A;  3Q3O C;  1WZ3 A;  1Z2M A;  3WCQ A;  3AE3 B;  1YD8 U;  2MCN B;  1F0Z A;  1ZXH A;  4W9G A;  2ZCC A;  4KGR A;  1UBQ A;  3RUL A;  1V5T A;  2XBB C;  4FAD A;  2WXH A;  2IGG A;  3RYT A;  4WQM A;  3BY4 B;  3ZXR A;  1FNV A;  2BS4 B;  1JWM D;  1PYW D;  3VR9 B;  2V1Y A;  1R4M I;  4RGN A;  4RGO S;  1I4X A;  2BYV E;  2L1A A;  5GMV A;  3EHV A;  2JT4 B;  3ZRF A;  3NOB A;  3AU5 A;  1ISN A;  2NS5 A;  1TT5 B;  4ZHP A;  1IBX B;  2K6D B;  4LDT B;  3IG3 A;  3ZJT A;  1MJD A;  3VUW A;  4MJS A;  1K50 A;  4J3O D;  2QHO A;  4DQO C;  4W9H A;  2ACZ B;  1XLO A;  3UIN B;  1ZGU B;  2W82 A;  2ZPN A;  3JW0 X;  1PFD A;  3JSV B;  4ZRQ A;  3JSV A;  1YNT E;  4L2Y A;  5BYR A;  5FK9 C;  2QJL A;  2IJ0 A;  4WJP A;  1YMH E;  3TEX A;  1QF6 A;  1Q1O A;  3APD A;  4AJY B;  2GMI C;  2KFJ A;  4I6N B;  2I38 A;  3GP7 A;  4CQN A;  1V2Y A;  2KD0 A;  2LUE A;  2ONQ A;  5AZF A;  2M56 B;  1E6E B;  3L54 A;  4OZB A;  2O2V A;  1K51 A;  1GPX A;  2WXQ A;  3AEB B;  2RR9 A;  1F77 A;  2FIF A;  2LXC A;  4B6W A;  2IND C;  5BO4 B;  5C3J B;  5D3I B;  2J0M A;  5IKC M;  4BVU C;  3P42 A;  2L05 A;  4W9L A;  2MBB B;  2KTR B;  3U7Z A;  5H92 C;  5E6J A;  1VDV A;  2KDB A;  1E7V A;  1L5P A;  1OQR A;  2MSE D;  3Q3J A;  4ANW A;  2RDG A;  2G3Q B;  1HXY D;  4C00 A;  1AWD A;  3AUL A;  2JXX A;  4KGT A;  3EEC A;  1EF5 A;  5D94 A;  2DYO A;  4E3C A;  2KDI A;  2LHD A;  3ML9 A;  1WX9 A;  2W9N A;  3N30 A;  1OEY J;  4A9A A;  1I4H A;  4KDL B;  1SJE D;  4AS1 A;  4ZYS A;  4ITK A;  2JYE A;  2VH1 A;  2WX0 A;  4N9F 4;  1RFA A;  3T8M A;  4HJG E;  1AYF A;  1F9J A;  2X38 A;  3PRE A;  4G11 A;  1FFV A;  1WJU A;  2I1J A;  2JRI B;  5IOI A;  3A1Q B;  2INN E;  4S17 A;  4JQW C;  1L0V B;  5HG2 A;  4MSQ B;  1SE2 A;  2KVR A;  4DBG A;  5AEK B;  1FRR A;  2BT6 A;  1IBX A;  3CIR B;  1HA5 A;  4HLE A;  1WXM A;  2J0J A;  1EF1 A;  2W3R A;  4A55 A;  1VZ8 A;  5DPW A;  2HE7 A;  2Y5P A;  2C7H A;  4FN2 A;  2D2Q A;  1ZP0 B;  2G4D B;  1ZE3 D;  2KC1 A;  4XWT A;  3P1M A;  3C19 A;  4JLC A;  3PS6 A;  2XN9 C;  2YEP F;  1ZUD 2;  3ZO5 B;  4L1B A;  3QIJ A;  1NI3 A;  2WDQ B;  1ACC A;  3WAL A;  4MDK E;  1QT9 A;  3ABV B;  3QK0 A;  3PRZ A;  1D4B A;  4PS3 A;  1JCK B;  2VRR B;  4HXD A;  3PZ8 A;  2L0F A;  2PMV A;  4RM8 A;  3L08 A;  3PLV A;  3ENE A;  2RPQ A;  2KQ4 X;  3PPA A;  1WR1 A;  1VD2 A;  1WSP A;  2BWF A;  2K3U A;  5EE9 A;  1IGD A;  1WRD B;  4DK5 A;  2AL6 A;  3P4S B;  1WE7 A;  2M19 A;  1WRI A;  2G1E A;  4JE3 B;  3M95 A;  4LNO A;  1MFW A;  4HPM B;  3OWE B;  3V61 A;  1E90 A;  4NNJ B;  5AUK A;  2JSV X;  4RH6 A;  2FNJ B;  3GOE A;  3W5U B;  3DBL B;  4DDI D;  5HFY A;  4ZRI A;  3S2A A;  5J2R A;  3PHW B;  3ZRC A;  4QAY A;  1SBB B;  1IGC A;  1LQB A;  3QCA A;  3ZNZ B;  4LLG M;  1KF6 B;  1JRU A;  1V97 A;  4C7Y A;  2M0A A;  3N20 C;  3AE7 B;  2KMA A;  1WGD A;  4ARC A;  2SAK A;  2YLM A;  1FO4 A;  5LXI B;  3VAW A;  2N9E B;  3H9D A;  4HK2 A;  2OED A;  3OLM D;  2IDY A;  4F7Z A;  3ALB A;  2DX5 B;  1C78 A;  1LFD A;  3CST A;  1EM7 A;  3UQB A;  4IW0 A;  4RGM A;  5AUI A;  3ZXV A;  3NUH B;  2N7D A;  3UQA A;  2LEK A;  4YTP B;  2VH2 A;  1OTR B;  3ZJU A;  3B08 A;  3OAW A;  4EOY A;  2JZ3 B;  2JF5 A;  2KNB A;  4ASW C;  5EDS A;  5E6P A;  2KAC A;  1DGJ A;  2Q5W D;  1LGR A;  1N62 A;  4Q2J A;  2EKE C;  2KYW A;  1V8C A;  4LJP B;  2MHJ A;  3V3X A;  3ZNI D;  2AEH A;  1CQV A;  5CHF A;  4WJQ A;  3OJ3 A;  4NQK E;  4IM2 A;  3ZLZ A;  3AE2 B;  3KYD D;  4LNK A;  2KJR A;  3U52 E;  1RFK A;  5CX3 A;  1WJ6 A;  3DVN V;  1EU3 A;  2L76 A;  2HTM E;  2JU6 X;  3NZS A;  1GB1 A;  1FMA D;  1V86 A;  2AX5 A;  1A5R A;  2LRW A;  3AE8 B;  5CHV C;  1I4P A;  1WMH B;  4A6Q A;  3ZTD A;  1V5O A;  2MBH A;  4OVU A;  3KQ4 A;  5EE1 A;  3EUB 2;  4FUL A;  1I35 A;  2PE9 A;  1OFF A;  3RCZ A;  1B9R A;  4HDQ A;  2MJD A;  5DPT A;  1L4D B;  2HTH A;  3W1Y A;  1M94 A;  1ROE A;  2IO1 B;  4MSM B;  2GI9 A;  2FAZ A;  1YX5 B;  4OZC A;  2KMM A;  1Y56 A;  2GBM A;  4KGS A;  4O1N A;  2KKC A;  4FHK A;  2N1V A;  1PDX A;  2AYO B;  1R7S A;  4NAW B;  3QAQ A;  3OJ4 B;  3UGB B;  4F8C B;  1L0Y B;  4HEA 1;  1L4Z B;  3DQV A;  5IN7 A;  4A8X C;  1V1P B;  1WX8 A;  4BFR A;  5BYS A;  4GSW A;  1A70 A;  2PPH A;  3KWV A;  4AUQ C;  1UWM A;  3T9L A;  3QX1 A;  2E6X A;  3TEW A;  3ZIM A;  3DBH I;  4HDO A;  3NS8 A;  3W1S A;  4KDI C;  1VRA B;  3ZJV A;  4W9K A;  3IT4 B;  2IBI B;  1RAX A;  1FPY A;  1NDD A;  1GC7 A;  3V05 A;  3C8Y A;  2MBE A;  5BYQ A;  3QA8 A;  4JWS C;  3M62 B;  3VRA B;  4W9E A;  1E7U A;  2JX5 A;  4I6L B;  2NBW B;  4TQ0 A;  3IAM 1;  2Z59 B;  2ZVO A;  4ZYN A;  1V9J A;  5JH5 C;  2QMT A;  4BOS C;  3A9J A;  2QSD A;  3FC4 A;  3W2D A;  4XZ4 A;  2LRU A;  4W9C A;  1Q5W B;  1NI2 A;  1JRO A;  3ETR A;  4AOF A;  1J19 A;  3ZNH B;  2K0P A;  3SDL C;  2DYM A;  5DPS A;  2KAJ A;  2R2O A;  4KZC A;  2O6V D;  2X8X X;  1HTQ A;  2BS3 B;  4K3B A;  1WR6 E;  3PLU A;  4IM0 A;  2JZZ A;  5AZH A;  1E8W A;  3N1X C;  4HKQ A;  3ZNG C;  2WDR B;  5J18 A;  1I42 A;  1LO5 D;  4CO7 A;  1SIF A;  3CWI A;  4JWU C;  4G3X B;  4K1R B;  2CS4 A;  2PW9 A;  3P4R B;  1KRH A;  3SD5 A;  3VFK A;  1YX6 B;  5MPO A;  1CZP A;  3LYY A;  2D10 A;  4IDI A;  4BKS D;  4OVZ A;  5D3D A;  3VTV A;  3SR6 A;  2L7R A;  2RD0 A;  1FFU A;  5KHQ A;  1NYQ A;  2DNF A;  3AV8 A;  4JPS A;  4IM3 A;  3AXC A;  2MBO A;  2AQ2 B;  4LNF A;  2CHW A;  1BXT A;  2D3B A;  4KZ0 A;  2KTF A;  4BBN F;  2N0S B;  1TYG B;  1D5X C;  1WYG A;  1ZDX A;  1ZW7 A;  3NJT A;  2L52 A;  2XK5 A;  2MEK A;  5D6J B;  3Q8E A;  5G55 A;  2L00 B;  2KOX A;  2KWV B;  3TBL D;  2NVU I;  2KJH B;  1YQ3 B;  4G50 A;  2GBK A;  1WFY A;  2ZNV B;  2PVG C;  1GC6 A;  1YN3 A;  3KW5 B;  3MHS D;  1BT0 A;  1T6B X;  1VCB A;  3B2G A;  4PK1 A;  2K22 A;  4NZL B;  3T3O A;  4NQL B;  4JIO U;  4MM3 A;  1DOI A;  4KV2 A;  2LXA A;  4GXB A;  4JGH B;  3DBH B;  4DHJ D;  2D3A A;  2WXP A;  4ZDV A;  1N63 A;  3V6E B;  3B9J A;  1CJE A;  3PSE B;  2ZEQ A;  1VJK A;  2LI5 A;  1AN8 A;  1D5M C;  1DOY A;  1M4V A;  4B9K A;  1CMX B;  2AQ3 B;  3K9P B;  1AAR A;  1FNW A;  1JWB D;  3U8Z A;  1VLB A;  2L32 A;  2M17 A;  4AWJ A;  2MLB A;  3RT3 B;  3H7P B;  3QC8 B;  2ZVN A;  3TJP A;  2WXI A;  5JHB A;  2MJE A;  2K8B A;  1JWU D;  3BIN A;  4YXD B;  3NVW A;  3GZN I;  4FJY A;  5DPR A;  3WA0 A;  1FEH A;  3DBS A; 
#chains in the Genus database with same CATH homology
 1HE8 A;  1UD7 A;  5C1Z A;  4IWP A;  2YVC A;  1U4A A;  1H8C A;  4GDK B;  5DPW A;  3VTW A;  2HE7 A;  4GDK A;  2C7H A;  2V3S A;  1H4R A;  2D2Q A;  4FN2 A;  4ICU A;  4K7S A;  4WWO A;  2G4D B;  2ZPY A;  3IBE A;  4OVV A;  2MBQ A;  3CSF A;  4PS7 A;  2KC1 A;  2ZCB A;  5E6O A;  2M0X A;  4JLC A;  3PS6 A;  1J0G A;  2FCS A;  4BBN C;  5L95 C;  3WIM A;  4NJ6 A;  3I3T B;  4MGZ E;  4A3O A;  3KYC D;  3DPD A;  4IG7 B;  1UZX B;  1V49 A;  3ZO5 B;  2LWP A;  3HM3 A;  4LCD E;  5CHW A;  2MWS B;  3AI5 A;  4E71 A;  3QIJ A;  3IHP C;  3UIP B;  4WJN A;  3R7Q A;  3IVF A;  3VDZ A;  3WAL A;  1X1M A;  4MDK E;  4GDL B;  2KWU B;  3QK0 A;  2RGF A;  2JY6 A;  2M1M A;  3PRZ A;  2IYD B;  2GBJ A;  1E8Z A;  2KC2 A;  3APF A;  4PS3 A;  4XC2 A;  4HWI B;  2LJ5 A;  2VRR B;  4HXD A;  4BKS A;  2DAF A;  4DHJ B;  2BPS A;  2L0F A;  2CHZ A;  4RM8 A;  1C3T A;  3L08 A;  4ZRK A;  1L2N A;  3VQI A;  3PLV A;  3EC8 A;  3ENE A;  1WIA A;  2RPQ A;  3PPA A;  4FJV B;  3KH0 A;  4CHK A;  1WR1 A;  4NY0 A;  1VD2 A;  3DCG A;  1PQS A;  2BWF A;  2KAN A;  4MGI E;  4HCN B;  1WXV A;  2IY1 B;  4GN1 A;  2PE6 B;  3A4S C;  2MP2 B;  5IAA C;  2KQS A;  3ZKJ C;  4A20 A;  2N7E A;  1XT9 B;  3A9J B;  1WRD B;  2Z0D B;  3ZDM C;  4DK5 A;  2AL6 A;  3H7P A;  2L0T A;  2G4S A;  3Q3F A;  1WF9 A;  3NHE B;  1EO6 A;  3B1L X;  1WE7 A;  4FJZ A;  3ECI A;  5KHO A;  3M95 A;  1IPG A;  4RMA A;  4AP4 C;  4GMV A;  2NPT A;  1D3Z A;  4HCP B;  4HPM B;  5JZE B;  3JYU A;  1WGH A;  3V61 A;  1EUV B;  1E90 A;  4NNJ B;  4ZRJ A;  4CYE A;  2KLC A;  4DXA B;  1UEL A;  4G0N B;  2FNJ B;  2MA9 B;  3GOE A;  2A4Z A;  2LVQ A;  1KJT A;  4DHZ B;  2FUH B;  2KN5 A;  4DDI D;  4EUT A;  2O6V B;  4WJO A;  4ZRI A;  4TKN A;  3DBR I;  3S2A A;  5J2R A;  2DAJ A;  1IP9 A;  3PVL A;  4TUU A;  3TL5 A;  3PHW B;  3ZRC A;  2KX3 A;  3NY5 A;  4EKU A;  1LQB A;  3QCA A;  3ZNZ B;  4K81 A;  1JRU A;  1P1A A;  2M8S A;  2LGY A;  2OJR A;  2KMA A;  1WGD A;  5D2M B;  4URK A;  4W9J A;  4KSK C;  4GGQ A;  1YJ1 A;  2YLM A;  2K8H A;  3VUY A;  3ONS A;  2IO3 B;  1V80 A;  2LGD A;  3PRM B;  3VAW A;  2N9E B;  3H9D A;  4HK2 A;  5LXI B;  4GU2 A;  4GIV A;  4FA6 A;  3OLM D;  3KUC B;  3PGE A;  4BOZ B;  4I6P A;  5DCN A;  3L10 B;  3QAR A;  4F7Z A;  3ALB A;  2DX5 B;  1WY8 A;  1LFD A;  1OQY A;  3CST A;  4KIK A;  2DZK A;  3UQB A;  4IW0 A;  2D11 A;  3A9K A;  2KX0 A;  2K39 A;  1WX7 A;  2LVP A;  2N7D A;  5TR5 A;  1UGM A;  4RM9 A;  3UQA A;  3VH4 B;  3PZD A;  2J7Q B;  1OTR B;  5LLI A;  3V6C B;  2K1F A;  2CU1 A;  3JVZ X;  2MRP A;  2BGF A;  1Y8R C;  3C0R B;  2GBN A;  3K9O B;  2JRH A;  2N9X A;  2PJH A;  4AJW A;  4F1S A;  5L83 A;  4FBJ B;  2FCN A;  3B08 A;  3OAW A;  4EOY A;  2JZ3 B;  2JF5 A;  2KNB A;  4ASW C;  4WAA A;  5EDS A;  3VH3 B;  3TMP B;  3HIZ A;  2I1K A;  5E6P A;  3R66 C;  2KQ7 A;  4J6I A;  3TIX A;  4E74 A;  1TBE A;  3ZDT A;  3U7D A;  2C7M B;  2EKE C;  3O65 B;  4XX5 A;  4LJP B;  4FHJ A;  3SU8 X;  3ZW3 A;  2UYZ B;  3WAO A;  3ZNI D;  2AEH A;  3H1U A;  4MJS B;  5CHF A;  1KLV A;  5HKH A;  4WJQ A;  3OJ3 A;  4BKT A;  3VXW A;  3QHT A;  4NQK E;  4IM2 A;  1IYF A;  3ZLZ A;  1WXS A;  3KYD D;  2KXJ A;  4BKG A;  2AL3 A;  3WAN A;  2N1W A;  2KJR A;  2GBR A;  5CX3 A;  1WJ6 A;  3DVN V;  1XD3 B;  2L76 A;  4M8M A;  2WYQ A;  1WE6 A;  2KO3 A;  2V4L A;  3NZS A;  4GOC A;  1WM2 A;  2JPH A;  2ZJD A;  1P3Q U;  2KZR A;  2BF8 B;  4IUM B;  1V86 A;  2FCM A;  1A5R A;  1P0R A;  2LRW A;  5AZG A;  2WDT B;  1Q0W B;  4II2 B;  2KHW B;  4W9F A;  5CHV C;  2XEW A;  2KDE B;  5JHA A;  2CHX A;  1WGY A;  3L16 A;  1WMH B;  3L17 A;  1SE9 A;  1WMH A;  3ZTD A;  1V5O A;  2BYE A;  2MBH A;  4OVU A;  3IFW B;  4NJ7 A;  2KWC A;  3A33 B;  4FUL A;  2LVO A;  1WH3 A;  5LXH A;  3SHQ A;  1I35 A;  4DWF A;  2LAS A;  2NCN A;  2PE9 A;  4IWQ A;  4EZK A;  1OGW A;  2KJ6 A;  3RCZ A;  4KSL C;  4HDQ A;  5DPT A;  1E5W A;  3N3K B;  2HTH A;  3W1Y A;  1M94 A;  3PTF C;  4W9I A;  2IO1 B;  4MSM B;  4KVG B;  2IO0 B;  2FAZ A;  3MJW A;  1YX5 B;  2LD9 A;  3KUD B;  1OEY A;  2GBM A;  4NPN A;  1UH6 A;  2KKC A;  3APC A;  2PEA A;  2N1V A;  4FHK A;  5E6N A;  3A4R A;  2AYO B;  4JL9 A;  3M3J A;  4K7U A;  2KFK B;  3V62 A;  4NAW B;  3RZW C;  3QAQ A;  3PRP B;  4A3P A;  3OJ4 B;  2BWE S;  3VTU A;  5FR6 A;  2IZV B;  4K7W A;  3UGB B;  1FXT B;  4F8C B;  2M4N A;  2KTR A;  3H7S A;  2K6Q A;  1WI0 A;  4DHZ E;  1Z5S B;  4X57 B;  1E8X A;  2N4F A;  4ANX A;  4PS8 A;  3ZVV A;  2WX1 A;  3PHX B;  2KLG A;  3DQV A;  3LJ3 A;  4MEM A;  4M8N A;  1V81 A;  3ML8 A;  2WWZ A;  2L3Z A;  1WX8 A;  4BFR A;  4GSW A;  2D07 B;  2C7N B;  1WZ3 A;  1Z2M A;  1YD8 U;  4MH0 E;  1RRB A;  2PPH A;  4W9D A;  4PYZ A;  2MCN B;  2BYF A;  4AUQ C;  3X23 A;  2RSU A;  4W9G A;  5J17 A;  1K8R B;  2ZCC A;  3T9L A;  1R4N I;  1UBQ A;  3RUL A;  3QX1 A;  3ZIM A;  3RD2 A;  3DBH I;  1P9D U;  1TTN A;  1V5T A;  4HDO A;  3NS8 A;  2XBB C;  3W1S A;  4FAD A;  1SGH A;  4KDI C;  1UBI A;  3DDC B;  3RYT A;  4W9K A;  4GDL A;  4P7I A;  3BY4 B;  1WJN A;  4M0W B;  2NR2 A;  2IBI B;  2DZM A;  2D3G A;  1RAX A;  1WGG A;  1NDD A;  1WYW B;  1GC7 A;  2DEN B;  3A9K B;  2MBE A;  4EZL A;  3QA8 A;  2V1Y A;  4FLH A;  3M62 B;  1R4M I;  2KK8 A;  4W9E A;  1E7U A;  4MGY E;  4HVB A;  1GUA B;  4I6L B;  2JWZ A;  2NBW B;  5GMV A;  2BYV E;  3QJZ A;  1YIW A;  4TQ0 A;  3EHV A;  2Z59 B;  2JT4 B;  2ZVO A;  3A1Q A;  4ZYN A;  3ZRF A;  3NOB A;  2MQJ A;  2L8J A;  1V9J A;  3AU5 A;  2OOB B;  1ISN A;  5JH5 C;  1YQB A;  4BOS C;  2NS5 A;  2JUO A;  3A9J A;  3WAP A;  2HD5 B;  4XZ4 A;  2LRU A;  4W9C A;  1Q5W B;  1TZ1 A;  2BKR B;  2G45 B;  4LJO B;  1NI2 A;  2CR5 A;  4AOF A;  1J19 A;  2K6D B;  4LDT B;  3IG3 A;  3ZNH B;  2CKH B;  2DYM A;  1WXA A;  3QWZ B;  3SDL C;  5DPS A;  3CF6 E;  5G2N A;  3L0W B;  2R2O A;  2IO2 B;  1LXD A;  4KZC A;  4EFO A;  2O6V D;  3VUW A;  4MJS A;  3UIO B;  2QHO A;  4B95 A;  3V60 A;  4W9H A;  1WR6 E;  2KFK A;  2JZZ A;  2Y5B B;  3PLU A;  1E8W A;  4IM0 A;  5AZH A;  1GNU A;  3UIN B;  3ZNG C;  4II3 B;  5J18 A;  1ZGU B;  4WQO B;  2ZPN A;  3JW0 X;  1I42 A;  4GB9 A;  3KUZ A;  4CO7 A;  2DHZ A;  1SIF A;  3JSV B;  4LDT D;  2IY0 B;  2O6V A;  3JSV A;  5IA7 A;  5CTR C;  2A5U A;  4K1R B;  2LGX A;  3L13 A;  2CS4 A;  4G3X B;  2BKF A;  5C23 A;  4WJP A;  3SD5 A;  3VFK A;  1YX6 B;  2UWQ A;  2D10 A;  1Q1O A;  3APD A;  3QQ8 B;  4AJY B;  2GMI C;  2KFJ A;  4I6N B;  4BKS D;  2LUE A;  1V2Y A;  2KD0 A;  3VTV A;  3N32 A;  3ZUN A;  2L7R A;  2RD0 A;  3KVF B;  5AZF A;  3RZF A;  2R2Q A;  4PYU A;  4HPL B;  4IC7 B;  5KHQ A;  1L7Y A;  3L54 A;  2O2V B;  2ASQ A;  3DOW A;  2O2V A;  2GOW A;  2C9W B;  4IM3 A;  2Z0E B;  3AXC A;  4IWO A;  2MBO A;  2RR9 A;  4KIK B;  1MG8 A;  3X0W A;  2LXC A;  2FIF A;  4B6W A;  3M63 B;  2CHW A;  2AWT A;  3HHM A;  2C5L C;  4KZ0 A;  2KTF A;  2REX A;  4YL8 A;  5BO4 B;  3MTN B;  4BBN F;  2ZNV C;  3VUX A;  4ANV A;  2MW5 A;  1P98 A;  2J0M A;  4NAW A;  4BVU C;  1ZW7 A;  5D6J B;  2XK5 A;  4EZJ A;  2L05 A;  2NBU A;  4TV3 A;  4W9L A;  2MBB B;  2K25 A;  2DZI A;  2MX2 A;  3CMM B;  2KTR B;  1TGZ B;  3R7R A;  2LZ6 A;  1S1Q B;  5G55 A;  2L00 B;  1QZE A;  4ICV A;  2KDB A;  1E7V A;  2KOX A;  2KWV B;  3TBL D;  3WAM A;  4ANU A;  2NVU I;  2J0K A;  2KJH B;  4G50 A;  2GBK A;  3PT2 B;  5D7G A;  3Q3J A;  2MSE D;  4ANW A;  3VVW B;  1WFY A;  2DYB A;  2ZNV B;  3DVG X;  2G3Q B;  2FCQ A;  1E8Y A;  1GC6 A;  3AUL A;  3KW5 B;  4MEL A;  3MHS D;  3RUI B;  1BT0 A;  2JXX A;  3DVN U;  1VCB A;  3P2B A;  3B0A A;  3EEC A;  1EF5 A;  5D94 A;  2DYO A;  2NPT B;  4E3C A;  2KDI A;  1WGR A;  2C60 A;  1WZ0 A;  1ZKH A;  3HK0 A;  3ML9 A;  1WX9 A;  2DZJ A;  4JIO U;  4MM3 A;  4NQL B;  4KV2 A;  2W9N A;  2LXA A;  3N30 A;  2B3A A;  3NZU A;  4GXB A;  3VHT C;  1GG3 A;  4JGH B;  1GJZ A;  1OEY J;  3TCA A;  1KM7 A;  4DHJ D;  4KDL B;  4ZDV A;  3V6E B;  3PSE B;  2ZEQ A;  3DVG Y;  2LI5 A;  2WX0 A;  2EMT A;  3D32 A;  1RLF A;  4N9F 4;  1G6J A;  1RFA A;  3T8M A;  4EEW A;  3EFU A;  2N9P C;  3UF8 A;  1J8C A;  3U30 A;  2KDF B;  3W1S C;  4B9K A;  1F9J A;  3PRE A;  1CMX B;  3K9P B;  2ZZP B;  4G11 A;  1WJU A;  1KOT A;  2I1J A;  3R3M A;  2JRI B;  3LDZ E;  1AAR A;  3A1Q B;  2KMC A;  2JVC A;  3U8Z A;  2MP2 A;  3DBL I;  3ZTC A;  4HJK A;  1LM8 B;  1S3S G;  4JQW C;  2M17 A;  4AWJ A;  2MLB A;  2K8C A;  3H7P B;  3RT3 B;  3QC8 B;  2ZVN A;  3TJP A;  5JHB A;  4TQ1 A;  1C1Y B;  4MSQ B;  4DBG A;  2KVR A;  5AEK B;  4MGK E;  1NBF C;  2FID A;  2K8B A;  3HM6 X;  1WM3 A;  4WWN A;  1V6E A;  3BIN A;  2EMS A;  2HJ8 A;  4HLE A;  1WXM A;  3AU4 A;  3GZN I;  2J0J A;  1EF1 A;  4FJY A;  4WWP A;  1WJ4 A;  3H6N A;  3PV1 A;  5DPR A;  3WA0 A;  4DDG D;  2NBV B;  3DBS A;  1T0Y A;  2XK5 B;  1XQQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...