5CHWA

Structure of isg15 in space group p212121
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
154
structure length
154
Chain Sequence
AWDLKVKMLGGNDFLVSVTNSMTVSELKKQIAQKIGVPAFQQRLAHQTAVLQDGLTLSSLGLGPSSTVMLVVQNSSEPLSILVRNERGHSNIYEVFLTQTVDTLKKKVSQREQVHEDQFWLSFEGRPMEDKELLGEYGLKPQCTVIKHLRLRGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of ISG15 in space group P212121
rcsb
source organism Mus musculus
molecule tags Signaling protein
molecule keywords Ubiquitin-like protein ISG15
total genus 37
structure length 154
sequence length 154
chains with identical sequence B, C, D, E, F, G, H, I, J
ec nomenclature
pdb deposition date 2015-07-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00240 ubiquitin Ubiquitin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 5chwA02
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 5chwA01
4MSQB 2L8JA 3ZW3A 4WWNA 1E8ZA 4OVUA 2M17A 3X23A 3DVGX 3VUWA 3M62B 2WX1A 4EEWA 2KQSA 1P98A 5LXIB 1UGMA 1LFDA 1VCBA 2KXJA 3PVLA 3K9OB 2CHZA 4BKSA 4ANWA 2K25A 4GDKA 1I35A 2I1JA 5D7GA 3H7PA 3VTVA 1J8CA 1KJTA 2A5UA 3MTNB 1KM7A 2D11A 2M4NA 3DVNV 4NQLB 1OQYA 5D94A 3ZRCA 1MG8A 2JZZA 3QJZA 1WJ4A 2XBBC 3IBEA 3QAQA 3JW0X 1TZ1A 3ZRFA 1WH3A 1D3ZA 3DDCB 3PRZA 2WWZA 1AARA 1E8XA 2ZCBA 1WR1A 3DVNU 4W9LA 3ZTCA 3ECIA 3KYCD 4DWFA 3O65B 1WIAA 4K81A 4ZYNA 1HE8A 2BYEA 4ANUA 1QZEA 4A3PA 4LJOB 2OOBB 1WYWB 3VUYA 3VH3B 2ZJDA 1UBIA 4ZRKA 4DDID 1NBFC 2LRUA 3ML9A 3APCA 2JUOA 2DHZA 2LWPA 1WE7A 1UELA 1V9JA 1VD2A 1LXDA 4HCPB 3TJPA 3PT2B 3TL5A 2BYFA 1WJNA 2KQ7A 4AUQC 3AI5A 3QHTA 2CS4A 2LZ6A 3DBLI 4A20A 3VFKA 2DZJA 2PEAA 4GIVA 5DPRA 5DCNA 2RGFA 2JF5A 3B0AA 1EUVB 1R4NI 2NPTA 4MH0E 3ZNZB 3NHEB 5KHQA 3MHSD 3U8ZA 4DXAB 4IC7B 3KH0A 2XK5A 2FIDA 4MGKE 2L0FA 4W9DA 4MGZE 3JYUA 3DQVA 2WDTB 5LXHA 2PE9A 2KFJA 1ZKHA 3GZNI 2IY1B 4HPLB 5CTRC 1YQBA 2KK8A 2UYZB 4E3CA 4EOYA 2LRWA 4K7WA 4N9F4 2PJHA 3RZFA 3VUXA 3EECA 4JLCA 1ZGUB 3RZWC 2C7MB 3PRMB 1E5WA 5AEKB 3WA0A 5D6JB 3RCZA 2NBVB 2WX0A 4WJOA 4FLHA 5EDSA 2KOXA 3PRPB 4CHKA 2FIFA 2I1KA 2M1MA 5CHFA 2NPTB 3RULA 1WZ0A 3LDZE 2KNBA 1YX6B 1K8RB 4EKUA 3RYTA 1NDDA 1ZW7A 3OAWA 4TKNA 4LDTD 4NAWB 3WAMA 2DAJA 1WRDB 2DAFA 4B9KA 2GMIC 4NJ6A 3ML8A 1OGWA 4MGIE 2K6DB 1WE6A 4HWIB 5J17A 2KFKA 2FCNA 2DZIA 2EMSA 2DX5B 4BBNC 2IBIB 3UIPB 3NS8A 3SDLC 3WAPA 4TV3A 3V61A 4DHJD 2N4FA 1WY8A 4F7ZA 4HCNB 4MEMA 3ZIMA 3KVFB 4WQOB 3VVWB 2OJRA 1YJ1A 2L7RA 2MBBB 4FHKA 4W9GA 4MDKE 3UINB 2N9PC 3MJWA 4K7SA 1F9JA 2MRPA 3VH4B 3ENEA 1L2NA 3JSVB 4WAAA 4W9CA 2G45B 3NZSA 4EUTA 3WAOA 2KDEB 1EF1A 2IO1B 2VRRB 3ZO5B 4TQ0A 1RRBA 4BKTA 3C0RB 1GC7A 1E7UA 2IY0B 4NNJB 2NBUA 4ZDVA 1V2YA 4BKGA 1GC6A 3PHXB 4MGYE 5E6NA 1IYFA 3B1LX 3HM3A 2KANA 1WF9A 4TUUA 1OEYA 1TTNA 2ZCCA 3L17A 2AL6A 4GB9A 4W9FA 1Q5WB 3ZNID 2KWCA 3AU4A 4EZJA 3CSFA 3M63B 1A5RA 1XQQA 1X1MA 4CYEA 1EO6A 1WZ3A 1FXTB 3TCAA 1WFYA 1WMHB 3N32A 5AZHA 2LASA 2CKHB 2IO2B 1WGGA 1V80A 1I42A 1WXVA 3JSVA 4AWJA 3KUZA 2KZRA 1CMXB 3H1UA 4BVUC 2FUHB 1Q0WB 1EF5A 4FN2A 3L16A 2N9XA 4IM3A 1XT9B 5DPWA 3IG3A 2MBQA 1IP9A 2XEWA 1WXMA 2KD0A 4W9IA 3PREA 3PZDA 2LGYA 2RR9A 4GDLB 1R4MI 4F8CB 2HE7A 4KZCA 4BFRA 4G50A 4BOSC 3X0WA 2Z0EB 3ALBA 2WYQA 1E90A 3RT3B 4F1SA 3KYDD 2D10A 2FCSA 2ZEQA 2REXA 4ZRIA 1RFAA 4GSWA 2J0MA 3WANA 2MCNB 3V62A 1V6EA 2DZKA 4NY0A 3TBLD 5TR5A 1BT0A 2JXXA 2O6VA 5IA7A 2RSUA 1Z5SB 2Z0DB 3R3MA 4A3OA 2D07B 3W1SA 2L05A 2V1YA 2NCNA 3QIJA 1TBEA 1WGDA 1WM2A 2KC2A 2KX0A 2L0TA 3Q3JA 3VHTC 1WGYA 4CO7A 2NS5A 4B95A 1P0RA 4WJQA 3SHQA 3VXWA 3PS6A 2ZPYA 1UH6A 2O6VD 4E71A 1JRUA 2ASQA 3CF6E 5E6PA 3PHWB 4MELA 2Y5BB 4FJYA 5C1ZA 2J0KA 3L08A 2MP2A 4BBNF 2FNJB 2L00B 2BWFA 1P1AA 2NVUI 3A9JA 4GMVA 3VTWA 3S2AA 1GG3A 2MX2A 4B6WA 3A33B 1M94A 2CHXA 1T0YA 1TGZB 2DYBA 4KVGB 3VTUA 2MQJA 1P9DU 2AEHA 2LI5A 4GGQA 2C60A 2KJ6A 4TQ1A 2NR2A 3HM6X 2IO3B 3IHPC 4FHJA 3DCGA 2K8HA 3PLVA 3NOBA 4W9HA 1WX9A 4KV2A 1Q1OA 2C7NB 1PQSA 2L76A 2R2OA 3KUDB 2CHWA 5AZFA 1WMHA 2KKCA 4XX5A 3QA8A 3ZNGC 3V6CB 1P3QU 4HPMB 2KC1A 2XK5B 5CX3A 4DK5A 3H6NA 3A9KA 4IG7B 5IAAC 2MWSB 2HTHA 4PS3A 3ZTDA 2UWQA 4KSKC 3A4RA 3APFA 3UQBA 4LCDE 2MLBA 3QC8B 1WXAA 2IZVB 4XZ4A 3NZUA 3K9PB 3M3JA 5DPSA 4URKA 3HIZA 2KTFA 4MJSA 1UZXB 2LVPA 1S3SG 3ZDTA 4II2B 5JHBA 1V49A 3AU5A 2LUEA 2V4LA 3R7QA 4NAWA 3ZKJC 4FJVB 1GNUA 1GJZA 1E7VA 2KO3A 5BO4B 3H7SA 2JY6A 4ZRJA 4PS7A 4GN1A 3A4SC 2LD9A 3I3TB 1E8WA 2JWZA 2K8BA 4AJYB 4DBGA 3WALA 2O2VB 2EKEC 3QCAA 4HXDA 2MA9B 4WJNA 2KWUB 5HKHA 1LM8B 4W9JA 1KOTA 2N7EA 4P7IA 4FJZA 1SIFA 3BINA 4G0NB 3RUIB 5E6OA 1YX5B 2AYOB 4I6NB 2YVCA 4I6LB 3UF8A 3AULA 3EC8A 2O6VB 2M8SA 2JVCA 3VDZA 2G4SA 2K39A 3B08A 2YLMA 5AZGA 3L0WB 1OTRB 4GOCA 2KJRA 2LXCA 5CHVC 4OVVA 4DHZE 4X57B 4ICVA 3U7DA 1H8CA 1WX7A 2QHOA 1WJUA 2K1FA 3DOWA 3M95A 2CR5A 2J0JA 3V6EB 3OJ4B 4E74A 1RAXA 1J19A 2GBRA 2KTRB 2Z59B 2LVQA 3DBHI 3WIMA 1SGHA 4PYUA 5G55A 4BKSD 2O2VA 1RLFA 2EMTA 4WJPA 2FCQA 3APDA 4NJ7A 2AL3A 3T8MA 3QQ8B 4ASWC 3P2BA 3QARA 2NBWB 4NPNA 2KN5A 1V5OA 2C7HA 1UBQA 3UGBB 2DYMA 1NI2A 2DZMA 2ZVNA 1XD3B 4LJPB 2N1VA 4WWOA 3LJ3A 3QX1A 1SE9A 3A9KB 4AOFA 1J0GA 4HJKA 4RM8A 4WWPA 2GBMA 2L3ZA 4HDQA 2JT4B 1Y8RC 3PV1A 2BYVE 4AP4C 1ISNA 4GXBA 3DVGY 4G11A 4LDTB 1U4AA 3ZDMC 2ZVOA 3KUCB 3A9JB 3W1SC 2K8CA 2MBOA 2KX3A 2MW5A 2GOWA 2LGXA 4IM0A 5KHOA 3U30A 3AXCA 1C3TA 2KDFB 2G4DB 4NQKE 1WI0A 1OEYJ 3T9LA 3HHMA 3H9DA 4KIKB 2KLCA 2KLGA 2JZ3B 5D2MB 2CU1A 2BKRB 4IM2A 2MP2B 4ANVA 2BWES 5JZEB 3D32A 1IPGA 2C9WB 3GOEA 2LXAA 3ZVVA 4K7UA 4KZ0A 4HDOA 4YL8A 3A1QB 2D2QA 4G3XB 2RD0A 3PGEA 1V86A 2GBNA 3IVFA 4M0WB 3OJ3A 4W9EA 2MSED 4DDGD 2BPSA 2BGFA 3ZNHB 5JHAA 1GUAB 2N7DA 2KWVB 4FULA 1C1YB 2KDBA 4FA6A 4GU2A 3CMMB 4HVBA 4GDKB 2M0XA 2KDIA 3DBRI 2N1WA 2A4ZA 2JRIB 2HD5B 3PSEB 5J2RA 1LQBA 4JIOU 5J18A 2PE6B 4JGHB 4KIKA 2D3GA 3HK0A 2AWTA 4J6IA 1KLVA 2IO0B 3L54A 2KJHB 4KDLB 4I6PA 2LVOA 3QWZB 1WXSA 2MBEA 2KTRA 2BKFA 2V3SA 4XC2A 3TIXA 4M8MA 2GBKA 2RPQA 4BOZB 4EZLA 3R66C 4K1RB 4HLEA 2JRHA 4FADA 1S1QB 1WM3A 2FAZA 2PPHA 2B3AA 3PTFC 2G3QB 3L13A 5L83A 2ZNVC 2J7QB 4JQWC 5G2NA 3VAWA 3N3KB 3RD2A 3UIOB 1Z2MA 2JPHA 1UD7A 4IWPA 4DHJB 1WGRA 2KMCA 3KW5B 2GBJA 2BF8B 4ICUA 3EHVA 1E8YA 3JVZX 4IWQA 2KMAA 3ZUNA 1G6JA 2LJ5A 3SD5A 2DENB 4ANXA 3W1YA 1WX8A 1YD8U 2C5LC 1H4RA 2K6QA 4HK2A 4DHZB 5L95C 1WJ6A 2FCMA 2KHWB 2N9EB 3VQIA 2ZPNA 4MJSB 4M8NA 1L7YA 1YIWA 5CHWA 4RM9A 2KFKB 2HJ8A 4EZKA 4W9KA 4IWOA 4GDLA 5DPTA 5C23A 3CSTA 2ZNVB 3IFWB 3SU8X 4MM3A 4FBJB 3L10B 4IW0A 3R7RA 5FR6A 2MBHA 2LGDA 3TMPB 3ONSA 4JL9A 4RMAA 3DBSA 5LLIA 1V5TA 3A1QA 2IYDB 2R2QA 3H7PB 4EFOA 3V60A 2ZZPB 3BY4B 2DYOA 3OLMD 5JH5C 5GMVA 3PLUA 1WGHA 2W9NA 4IUMB 4AJWA 1V81A 3QK0A 4KDIC 3EFUA 3PPAA 4II3B 3N30A 4PS8A 3NY5A 2KVRA 3DPDA 3Q3FA 3UQAA 4KSLC 3ZLZA 4PYZA 4MSMB 1WR6E
chains in the Genus database with same CATH superfamily
1MHHE 1FCLA 4OVUA 3ZQ4A 4OHJA 4RGOS 2WX1A 2KQSA 1VCBA 1L0XB 3K9OB 2CHZA 2KN4A 4AS1A 2I1JA 1J8CA 2A5UA 3MTNB 3DVNV 1OQYA 3ZRCA 1RM6C 2J42A 3IBEA 3ZRFA 1JALA 2WWZA 1E8XA 3DVNU 3ECIA 4ZYNA 2BYEA 4A3PA 3PO0A 1UBIA 4DDID 3APCA 1V9JA 4HCPB 3NG0A 1I4PA 3TJPA 3TL5A 2BYFA 3QHTA 2J4XA 3DBLI 1BXTA 2DZJA 2PEAA 5DPRA 2RGFA 1ZPSA 3ZNZB 3NHEB 3U8ZA 3AE1B 1ET9A 2XK5A 1CZPA 1D5ZC 3OG5A 2K5PA 3NVVA 3I5JC 1YQBA 2RMMA 5HI1A 3KLSX 2AQ1B 1SE3A 4E3CA 3VUXA 4PK1A 4N58A 3PRMB 5D6JB 2KOXA 1DOIA 2I1KA 1WZ0A 1NYRA 2WDQB 2J52A 2PKOA 2WP9B 3FKYA 3HVDA 1XEEA 1VZ6A 2GB1A 2DX5B 4BBNC 4RCOA 1JMLA 1L4ZB 3FC4A 1EM7A 4HCNB 2IGHA 4MEMA 3BIID 3ZIMA 3KVFB 4K3CA 4WQOB 2OJRA 2MBBB 4FHKA 3MJWA 2MRPA 4LNIA 2KDEB 2VRRB 3MP9A 5G5GA 1E7UA 2QC8A 4B0MA 1FRRA 3B9JA 4KGTA 3N20C 4ZDVA 4HPPA 1GC6A 3PHXB 4W9FA 1TTNA 2KWDA 4GB9A 2TSSA 3ZNID 1XQQA 1IBXB 2IO2B 1WGGA 2KZRA 1CMXB 2FUHB 2RDGA 3MFGA 2RR9A 4GDLB 4F8CB 1STEA 2D5GA 4UDUC 3X0WA 3DHHC 1B9RA 1E90A 4ZRIA 2J0MA 1V6EA 3Q69A 2INPE 4XE0A 2JXXA 2RSUA 4A3OA 3R3MA 2D07B 2LUMA 1P0RA 4WJQA 1M4VA 3VXWA 3PS6A 1UH6A 3CF6E 5E6PA 2V3PA 3DWGC 1F52A 2MP2A 4RGNA 5AUIA 2L00B 4GMVA 3VTWA 2NVUI 1YMHE 1GG3A 2MX2A 2CHXA 2BB5A 1P9DU 2GRIA 1ROEA 2KJ6A 2NR2A 3HM6X 4FHJA 3GS2A 1L0YB 4ARCA 4YTNB 2WXRA 1QLBB 4KV2A 1Q1OA 2L76A 1SE2A 2KKCA 4M0WA 1FEHA 1TIFA 4IG7B 2HTHA 4PS3A 2UWQA 4KSKC 1YQ4B 3BK2A 3QC8B 1WXAA 3M3JA 1VDVA 1UZXB 4YXDB 2LVPA 4II2B 1JROA 4NAWA 1C79A 4MT5A 1E7VA 1ZE3D 2KO3A 1TY0A 4GLSC 4DBGA 3GE8C 2KWUB 1LM8B 4P7IA 1SIFA 1C76A 4G0NB 5HHDG 3RUIB 1UGJA 4XYCA 2K39A 3LYYA 5AZGA 4GOCA 2KJRA 1B1ZA 2E3TA 2PTLA 1QILA 3OJ4B 1GB1A 1KFYB 1J19A 3DBHI 2Z59B 2LVQA 1AN8A 4NJCA 4L23A 3APDA 3T8MA 2AL3A 4XWTA 3QQ8B 3N1YC 5LNK1 2DBYA 2C7HA 1NI2A 1D5MC 3QX1A 1SE9A 3A9KB 1XCQL 2GBMA 2JT4B 4G11A 2E6XA 5BMIA 3MC8A 2BTEA 4IM0A 1CQVA 3W9CB 2G4DB 4NQKE 1WI0A 1MJDA 3H9DA 3FILB 2KLGA 2JZ3B 1RFKA 3Q8EA 4AQ7A 2BWES 2IJ0A 2C9WB 1D6EC 2DLBA 3ZVVA 4WURA 4WH4A 4K7UA 4KZ0A 4HDOA 1KLUD 5FKAC 2RD0A 3LB8C 1UWXA 3IVFA 3OJ3A 2MSED 3RNGC 5JHAA 2IDYA 3LXFA 2KDBA 4FA6A 3NZ3A 4GU2A 3Q8BA 3SFDB 2KDIA 3PSEB 4JGHB 2D3GA 3HK0A 2D3AA 4BAXA 3AM9A 2LVOA 1WXSA 2INNE 3HVZA 1V8CA 4C56C 4M8MA 2GBKA 2WXJA 2JRHA 4FADA 4LNFA 2PPHA 3PTFC 3L13A 2ZNVC 1DOYA 1Z2MA 1UD7A 1HXYD 1WGRA 3KW5B 2GBJA 1JQ4A 1G6JA 2LJ5A 1WX8A 2C5LC 1L6UA 1WJ6A 1RWSA 2KHWB 3VQIA 4M8NA 3P4QB 4EZKA 5C23A 2ZNVB 1ZXIA 3SU8X 4WAFA 4YSXB 2WU5B 2LGDA 3ONSA 3A1QA 4MACA 4S17A 3H7PB 4ZOHC 2XNAC 3AE8B 2J53A 2WXKA 3IT4B 2V0GA 5JH5C 1T0RC 5GMVA 3PLUA 1V81A 4KDIC 3PPAA 1FNVA 3N30A 4J3OD 3DPDA 3ZLZA 2MHJA 1WR6E 3P4PB 1SBBB 3AEBB 1E8ZA 4NAMA 4A6QA 3M62B 1P98A 3KQ4A 4Q2JA 4BKSA 1FXIA 1SJHD 1C4CA 1N62A 4HKQA 3VTVA 1MI0A 1VR9A 2D11A 2M4NA 5D94A 2KYWA 2JZPA 2JZZA 3QJZA 3QAQA 1EU4A 1N63A 3ZTCA 3KYCD 1FPYA 3Q8AA 4DQOC 1NYQA 1NBFC 2LRUA 3ZXRA 4BZAA 2DHZA 3RI7C 2W54A 2QSDA 1KH0A 1WE7A 2LWPA 1UELA 1LXDA 3PT2B 2N7JA 2KQ7A 4AUQC 3VR9B 2LZ6A 3VFKA 1PGBA 5DCNA 3BYYB 1J7AA 4MM3B 3B0AA 4PT5A 4IC7B 3W5UB 2LHDA 3KH0A 1QOFA 4MGKE 2L0FA 4MGZE 5H92C 2WDTB 1TS4A 2PE9A 5CTRC 2KK8A 4K7WA 4N9F4 3RZFA 1SE4A 2BQQA 4JLCA 1UF0A 3RZWC 4RFBA 1E5WA 3AN1A 1I4QA 3AE7B 1MG4A 2NBVB 3AE9B 1XLOA 1E0ZA 2JYEA 5EDSA 3PRPB 1T3QA 5FK9C 2M1MA 1SEBD 5CHFA 2JQRB 3LDZE 5H8YE 1C77A 4OZBA 1K8RB 3KWVA 3RNEC 1NDDA 4LDTD 3WAMA 1WRDB 1F0ZA 1EWYC 3HUIA 4NJ6A 4TSSA 2WS3B 4MGIE 5IP4D 1WE6A 5J17A 2KFKA 1TZOA 3U4EG 3BK1A 5FR3A 3C19A 2IBIB 4WQMA 3UIPB 3V61A 4DHJD 1WY8A 3AEAB 3N1XC 3R8BA 1XF5L 1WGKA 3VVWB 3BYTB 1F2RC 2WNMA 4P1BC 1EWCA 2N9PC 4K7SA 1UNSA 1L2NA 3JSVB 4WAAA 3WAOA 1EF1A 3C0RB 1GC7A 4NNJB 4BKGA 1IYFA 3B1LX 4L1BA 1WF9A 3EGRA 3Q8FA 2ZCCA 2CJNA 3AU4A 3CSFA 3U52E 1X1MA 3P4RB 1EO6A 3RFZB 3Q8CA 1WMHB 3N32A 2LASA 1WXVA 1GOZA 2M19A 3JSVA 3H1UA 1N60A 2X38A 1ZP0B 3AB5A 2KD0A 3AEGB 3PREA 4H2AA 3PZDA 2LGYA 2QMTA 1T0QC 4BFRA 4KZCA 3BVMA 4BOSC 2WYQA 4F1SA 3AH7A 3P42A 4GSWA 3L4PA 3WANA 2K3UA 1QOGA 1BT0A 5IA7A 4C7YA 4YSYB 3W1SA 3AE6B 3QIJA 2KC2A 3VHTC 3Q3NC 3IXSA 1WGYA 1WSPA 3B2GA 2MEKA 1I4XA 4JWUC 4E71A 1JRUA 3V05A 3PHWB 5C1ZA 2WXPA 2FNJB 2BWFA 1P1AA 4RGTA 3S2AA 2DYBA 4KVGB 2MQJA 2AEHA 2C60A 2IO3B 3NVZA 3PLVA 1WX9A 1HTOA 2C7NB 1PQSA 3ZJUA 3IT6B 2CHWA 5AZFA 2M0AA 2WGSA 1UWMA 2LHEA 2W82A 2INDC 1WRIA 2KC1A 5CX3A 3A9KA 4A55A 1Y56A 1YOVB 2WXGA 3APFA 4P16A 3UI3A 3OWEB 2IZVB 4XZ4A 3NZUA 4URKA 4MJSA 1S3SG 2RPVA 3BWUD 5JHBA 4HJGE 2LUEA 2V4LA 3EFCA 5BO4B 4ZRJA 4OVZA 4GN1A 2LD9A 1E8WA 4AJYB 2O2VB 3QCAA 4WJNA 4HXDA 2MA9B 4HKZE 1KOTA 1C4AA 2N7EA 3EUB2 3P4SB 4FJZA 4ZHOA 4I6NB 2BVCA 2YVCA 3AULA 2WHIA 2JVCA 3VDZA 2G4SA 3I9V1 2YLMA 2LXCA 1I7HA 1QT9A 3Q14C 4X57B 4ICVA 2V3NA 2N9LA 1WJUA 1N61A 1HEZE 2K1FA 2GBRA 2OJWA 2PVGC 4WJPA 1RLFA 1C78A 4ZRPA 1AWDA 1PDXA 2G1EA 4ASWC 3QARA 4NPNA 2NBWB 4JPSA 1V5OA 3UGBB 2DZMA 2ZVNA 4LJPB 3MJ5A 4AOFA 2MJ3A 4HJKA 4RM8A 3PZ8A 4WWPA 4HDQA 2WU2B 2BYVE 4LDTB 3ZDMC 1U4AA 3KUCB 3A9JB 2KAJA 2I2YA 2MBOA 2KX3A 1V1PA 2LGXA 5KHOA 3AXCA 3IAS1 1WWTA 1OEYJ 3T9LA 2KLCA 4IM2A 2OEDA 1JWAD 2MP2B 4ANVA 4QAYA 1IPGA 1R4NB 4YL8A 2X8XX 3PGEA 2N0SB 4M0WB 4W9EA 4DDGD 2BGFA 4FULA 1FD6A 2AX5A 1C1YB 3NS1A 4HVBA 3AMZA 3E56A 4N59A 3DWMA 2N1WA 3NJTA 5J2RA 1PYWD 3TSSA 1WXQA 4RF1A 2JXTA 4O1NA 2JU6X 4J6IA 3AE4B 5AUKA 1KLVA 3Q6BA 4KDLB 3RNFC 5D3DA 3TIXA 1QF6A 1SXTA 4K1RB 1DGJA 4ZYSA 2WXNA 2K0PA 2LEKA 4D2KA 1WM3A 2FAZA 4IDIA 4KGRA 5L83A 1J7BA 2L1AA 3UIOB 2M56B 3TEZA 4LLGM 4DHJB 4ICUA 4IWQA 2KMAA 3ZJVA 5E6JA 5EE9A 1ZUD2 2FCMA 3I63C 2PLPA 1YIWA 5CHWA 2UU7A 4XDCA 4GDLA 3CSTA 3TUOA 4MM3A 1SF0A 1V5TA 2R2QA 2W9NA 4AJWA 1L0VB 3QK0A 3EFUA 2KVRA 1GPXA 2VH2A 1NVID 2MJDA 4MSQB 3NVWA 3X23A 2M17A 3DVGX 3VUWA 4EEWA 5LXIB 1UGMA 1LFDA 2K25A 5BYQA 1I35A 5D7GA 3H7PA 4IOIE 2L52A 4NQLB 1MG8A 3GB1A 1WJ4A 2ON8A 3RNAC 3JW0X 4K3BA 1WH3A 1D3ZA 2KQ4X 3PRZA 4DWFA 1WR1A 1WIAA 4EE2A 4HRSA 1HE8A 2BB6A 1QZEA 3V3XA 2OOBB 1WYWB 3VH3B 2ZJDA 3ML9A 5IO9A 5EE3A 4FXCA 1E7PB 1VD2A 2Z8LA 3AE3B 4HROA 1SB3C 2CS4A 1N6ZA 2JF5A 2WXFA 3GZNB 1YNTE 1R4NI 2Q5WD 4DXAB 4W9DA 4YT0B 3DQVA 5LXHA 2KFJA 1ZKHA 3GZNI 2IY1B 2JX5A 4HPLB 2UYZB 1Q10A 2N9KA 4EOYA 4C4VA 2PJHA 1K52A 1FNUA 1GAQB 3MC0B 2C7MB 1IBXA 4ACFA 5AEKB 1L6VA 3WA0A 4LNOA 4WJOA 1JWBD 4CHKA 1F1HA 4IKGA 3RULA 2KNBA 1NI3A 2WXQA 4EKUA 1WYGA 3OAWA 1OFFA 1XXGA 3VRAB 3FILA 3ML8A 4A9AA 1OGWA 1FRDA 3ZYYX 4HWIB 1CK1A 1XLPA 1DYQA 2EMSA 1JCKB 4DXFA 3WAPA 2N4FA 1HZ6A 2VH1A 4F7ZA 4YWGG 1V97A 2L7RA 2NTSA 4W9GA 4MDKE 3UINB 2GI9A 4W9CA 2G45B 4EUTA 2IO1B 4US9A 1IGCA 4BKTA 2IY0B 3ABVB 5T8IA 1T6BX 2BBCA 1V2YA 4S0RA 1D5XC 4N6EB 4TUUA 2KANA 2H89B 4OZAA 2KWCA 4EZJA 3M63B 1UUPA 1FXTB 2EKIA 3TCAA 1N5WA 1I42A 4OZCA 3KUZA 4BVUC 4XDDA 2L83A 1Q0WB 3RNCC 1ET6A 2MH7A 3L16A 2N9XA 1XT9B 3IG3A 2XEWA 4R3DA 1TT5B 1HTQA 1HA5A 2HE7A 2BS4B 1ACCA 3KYDD 2D10A 2FCSA 1RFAA 3V62A 2DZKA 3TBLD 5TR5A 2CJOA 2W3RA 4USAA 2L05A 3T3NA 2NCNA 1TBEA 1WM2A 2KX0A 2L0TA 3Q3JA 3BVZA 4CO7A 3SHQA 2L32A 2O6VD 2NTTA 2LJIA 1HZ5A 2WXOA 4MELA 2Y5BB 4FJYA 3L08A 3A9JA 1V1OA 3N1ZC 3A33B 1M94A 1TGZB 3AECB 3NVYA 4P1CC 1BUIC 3BZDB 2LI5A 1P7EA 4GGQA 2Y5CA 1F2RI 5BYRA 1KRHA 4A8XC 1WMHA 2PMVA 3QA8A 4RH6A 1P3QU 2XK5B 3H6NA 3R2IA 3KWLA 3A4RA 4ARIA 2MLBA 3K9PB 3VR8B 1E9MA 3HIZA 4US8A 2KTFA 4ZRQA 5IOIA 4YTPB 2LGSA 3AU5A 5TSSA 3ZKJC 4FJVB 1GNUA 1GJZA 3URYA 3H7SA 2JY6A 4HEA1 4PS7A 2DWQA 2ICIA 2JWZA 2K8BA 1YN4A 2AQ3B 1AYFA 4W9JA 2R61A 1PUTA 1F77A 3BINA 2H88B 1YX5B 2AYOB 4I6LB 1FFVA 2M8SA 2NMQA 2QEJC 3B08A 3DBLB 3L0WB 5CHVC 1TS2A 4LNNA 1XCTL 2QHOA 3IAM1 1FO4A 2CR5A 2J0JA 3V6EB 4E74A 1RAXA 2KTRB 4P6VF 2FE8A 1SGHA 4LNKA 5G55A 4BKSD 2O2VA 2VZKD 2IGDA 1R7SA 1UBQA 4WIPA 4C7ZA 1TS5A 4WWOA 2N1VA 2LFIA 3B2FA 4ZHPA 2QCZA 3TEXA 2L3ZA 4AP4C 5JXVA 1ISNA 1YQ3B 3DVGY 2ZVOA 2QDFA 2Y5PA 2GOWA 3HHMA 3DHGC 3GP7A 2V9HA 3AEDB 5D2MB 1FMAD 5EE0A 5JZEB 2HJ1A 1PGAA 3A1QB 4G3XB 1V86A 2GBNA 2BPSA 1YJIA 1GUAB 2N7DA 2WDVB 4KKJA 4GDKB 2M0XA 2QILA 2BW2A 2A4ZA 2JRIB 1DOXA 2JWUA 4OW0A 1LQBA 3DBHB 4JIOU 5J18A 4KIKA 2WXIA 2AWTA 1JWSD 3L54A 3QWZB 2MBEA 3SR6A 4XC2A 2RPQA 3R66C 1K53A 3Q3MC 2YEPB 2B3AA 4JWSC 2J7QB 4JQWC 4YSZB 1GB4A 3N3KB 3RD2A 5IN7A 1L4DB 2KMCA 2BF8B 1FM0D 1E8YA 3JVZX 3ZUNA 2QJLA 2DENB 4HK2A 4DHZB 1EU3A 2N9EB 2XN9C 4C80A 3P63A 2KT7A 5DPTA 4IWOA 3R2TA 2OHFA 2RDHA 3ZGZA 3R7RA 3TMPB 2HTME 2MBHA 4JL9A 4RMAA 3DBSA 5LLIA 1KLGD 2ZZPB 3AV8A 2KDMA 4IUMB 4II3B 3FAHA 3RPFC 3NY5A 3Q3FA 3UQAA 2WLBA 4KSLC 4TMAB 2L8JA 2PVOD 1PGXA 1NEKB 3ZW3A 4WWNA 1OQQA 2KXJA 2Y3AA 2PW9A 3PVLA 4ANWA 1SJED 4GDKA 3NUHB 4LK0M 2FBWB 1TKEA 1KJTA 2K9XA 1KM7A 4MH8A 1R4MB 2XBBC 2BT6A 3SEBA 3U2SC 1JWMD 1TZ1A 5C3JB 3DDCB 1AARA 2ZCBA 4W9LA 1XLQA 1T5XD 3O65B 4K81A 4KX6B 4ANUA 1TY2A 1T0SC 2D3BA 4LJOB 3VUYA 3GE3C 4ZRKA 1QOAA 2JUOA 5IKCM 1PFDA 1WJNA 3AI5A 1RYJA 4A20A 4GIVA 3RN9C 2BS3B 1EUVB 3RMKC 2NPTA 4WWMA 4MH0E 5KHQA 2WDRB 3MHSD 2FIDA 3TEWA 2SEBD 1ZDVA 3JYUA 4JE3B 3HRDD 2I38A 1MHXA 4KGSA 2LRWA 3EECA 1ZGUB 1TS3A 2CU3A 3RCZA 2WX0A 4FLHA 2PIAA 1JWUD 2FIFA 1NENB 2NPTB 1YX6B 1XLNA 3RYTA 1ZW7A 4TKNA 1P7FA 4NAWB 2DAJA 2DAFA 4B9KA 3P1MA 3SFEB 2GMIC 3AE2B 2JSVX 4XGAB 4ITKA 2BS2B 2K6DB 1AW7A 1SSNA 1BMLC 4B0EA 2FCNA 1K50A 1LGRA 2DZIA 3NS8A 3SDLC 4TV3A 3NRZA 3AEFB 2LMCA 3N9YC 4C00A 1YJ1A 1F9JA 3VH4B 3ENEA 3NZSA 1QQRA 1I4HA 3ZO5B 1N5XA 4TQ0A 1RRBA 2IPKD 2NBUA 4MGYE 5E6NA 4LTUA 3HM3A 3AE5B 2K22A 1OEYA 4JX1C 3L17A 1FCCC 2AL6A 2VZKB 1Q5WB 4C4VB 2W3SA 1A5RA 4CYEA 3T3OA 1WZ3A 1WFYA 5AZHA 2GLSA 2CKHB 1V80A 1VRAB 4AWJA 1IGDA 3DHIC 1EF5A 4FN2A 4IM3A 5DPWA 2MBQA 1IP9A 1JW9D 1WXMA 4W9IA 2W55A 1MVKA 1TYGB 1R4MI 2KMMA 4G50A 3AEEB 1YJJA 2Z0EB 3ALBA 3RT3B 2ZEQA 4M00A 2REXA 1OQRA 4RNAA 2ONQA 2MCNB 5BMHA 2ZW0A 4NY0A 2O6VA 1FIQA 4A90A 1Z5SB 5HFYA 2Z0DB 2V1YA 2RDBC 3CWIA 1WGDA 2WXMA 4XWWA 5C2TB 2NS5A 4B95A 1ZOYB 3MC9A 2LGIA 2ZPYA 2ASQA 1TKYA 2WXHA 1C9FA 2ACZB 2J0KA 4BBNF 3DBRB 1D4BA 1TKGA 3Q2AC 5D3IB 4B6WA 4RF0A 1T0YA 4RGMA 3VTUA 2QIEB 4TQ1A 1SIJA 2B76B 3IHPC 3DCGA 2K8HA 3NOBA 4W9HA 2BYTA 1A70A 2R2OA 3KUDB 1FNWA 2WXLA 4XX5A 3ZNGC 3V6CB 5EE1A 4HPMB 1FXAA 4DK5A 5IAAC 2MWSB 3ZTDA 1YN3A 3UQBA 1YN5A 4LCDE 3O13A 5DPSA 3ZDTA 2IGGA 4L2YA 1V49A 3H8HA 3R7QA 3PZ7A 2V4IB 3EA6A 3A4SC 1VLBA 1TJEA 3I3TB 2YEPF 4REZA 1MFWA 3WALA 2EKEC 5HKHA 1J7CA 1MPEA 5HG2A 2D3CA 5E6OA 4NZLB 3UF8A 3EC8A 2O6VB 1I4RA 1OTRB 4OVVA 4DHZE 4M01A 2SAKA 3U7DA 1H8CA 3W2DA 1WX7A 3DOWA 3M95A 4DXGA 1ENFA 3WIMA 5BMGA 1KF6B 4PYUA 1QOBA 2EMTA 2MJEA 2FCQA 4NJ7A 3P2BA 3WCQA 2KN5A 1K51A 2DYMA 2AQ2B 3VRBB 1XD3B 2KVZA 3LJ3A 1J0GA 4M02A 1Y8RC 3PV1A 4GXBA 3W1SC 2K8CA 2MW5A 3RNBC 3U30A 1C3TA 2KDFB 4KIKB 2KACA 3BVGA 1V1PB 1IUEA 1JRPA 2CU1A 2BKRB 3ZJTA 5G5HA 1CJEA 2WQYB 3D32A 1QKZA 3GOEA 2LXAA 4CQNA 1LO5D 1ZDXA 2D2QA 2DNFA 1E6EB 3ZNHB 2KWVB 3ETRA 1I4GA 3CMMB 5BYSA 2G9HD 3I57A 3DBRI 4KKIA 2HD5B 2PE6B 1XO3A 3C8YA 2IO0B 3ZXVA 2FUG1 2KJHB 4I6PA 2BKFA 2KTRA 2JYTA 1VJKA 2V3SA 5I4DA 1VZ7A 3Q3OC 4BOZB 4EZLA 1E10A 4HLEA 1FFUA 3TEYA 1S1QB 2G3QB 2HDEA 5G2NA 3VAWA 2JPHA 4IWPA 3CIRB 3EHVA 1C4PA 3SD5A 3E9SA 4ANXA 3W1YA 1YD8U 1ZXHA 2ZW1A 1KTKA 1H4RA 2K6QA 5L95C 5GXGB 2INCC 2ZPNA 4MJSB 1L7YA 4RM9A 2KFKB 2HJ8A 4W9KA 1ESFA 3IFWB 4FBJB 3L10B 4IW0A 5FR6A 1L5PA 4EFOA 2IYDB 3V60A 5MPOA 3BY4B 2DYOA 3OLMD 2EELA 3W5VB 1WGHA 3MHZA 3U7ZA 1HQRD 4PS8A 3J9CA 1VZ8A 4PYZA 4MSMB 4YTMB
chains in the Genus database with same CATH topology
4MSQB 2L8JA 3ZW3A 4WWNA 1E8ZA 4OVUA 2M17A 3X23A 3DVGX 3VUWA 3M62B 2WX1A 4EEWA 2KQSA 1P98A 5LXIB 1UGMA 1LFDA 1VCBA 2KXJA 3PVLA 3K9OB 2CHZA 4BKSA 4ANWA 2K25A 4GDKA 1I35A 2I1JA 5D7GA 3H7PA 3VTVA 1J8CA 1KJTA 2A5UA 3MTNB 1KM7A 2D11A 2M4NA 3DVNV 4NQLB 1OQYA 5D94A 3ZRCA 1MG8A 2JZZA 3QJZA 1WJ4A 2XBBC 3IBEA 3QAQA 3JW0X 1TZ1A 3ZRFA 1WH3A 1D3ZA 3DDCB 3PRZA 2WWZA 1AARA 1E8XA 2ZCBA 1WR1A 3DVNU 4W9LA 3ZTCA 3ECIA 3KYCD 4DWFA 3O65B 1WIAA 4K81A 4ZYNA 1HE8A 2BYEA 4ANUA 1QZEA 4A3PA 4LJOB 2OOBB 1WYWB 3VUYA 3VH3B 2ZJDA 1UBIA 4ZRKA 4DDID 1NBFC 2LRUA 3ML9A 3APCA 2JUOA 2DHZA 2LWPA 1WE7A 1UELA 1V9JA 1VD2A 1LXDA 4HCPB 3TJPA 3PT2B 3TL5A 2BYFA 1WJNA 2KQ7A 4AUQC 3AI5A 3QHTA 2CS4A 2LZ6A 3DBLI 4A20A 3VFKA 2DZJA 2PEAA 4GIVA 5DPRA 5DCNA 2RGFA 2JF5A 3B0AA 1EUVB 1R4NI 2NPTA 4MH0E 3ZNZB 3NHEB 5KHQA 3MHSD 3U8ZA 4DXAB 4IC7B 3KH0A 2XK5A 2FIDA 4MGKE 2L0FA 4W9DA 4MGZE 3JYUA 3DQVA 2WDTB 5LXHA 2PE9A 2KFJA 1ZKHA 3GZNI 2IY1B 4HPLB 5CTRC 1YQBA 2KK8A 2UYZB 4E3CA 4EOYA 2LRWA 4K7WA 4N9F4 2PJHA 3RZFA 3VUXA 3EECA 4JLCA 1ZGUB 3RZWC 2C7MB 3PRMB 1E5WA 5AEKB 3WA0A 5D6JB 3RCZA 2NBVB 2WX0A 4WJOA 4FLHA 5EDSA 2KOXA 3PRPB 4CHKA 2FIFA 2I1KA 2M1MA 5CHFA 2NPTB 3RULA 1WZ0A 3LDZE 2KNBA 1YX6B 1K8RB 4EKUA 3RYTA 1NDDA 1ZW7A 3OAWA 4TKNA 4LDTD 4NAWB 3WAMA 2DAJA 1WRDB 2DAFA 4B9KA 2GMIC 4NJ6A 3ML8A 1OGWA 4MGIE 2K6DB 1WE6A 4HWIB 5J17A 2KFKA 2FCNA 2DZIA 2EMSA 2DX5B 4BBNC 2IBIB 3UIPB 3NS8A 3SDLC 3WAPA 4TV3A 3V61A 4DHJD 2N4FA 1WY8A 4F7ZA 4HCNB 4MEMA 3ZIMA 3KVFB 4WQOB 3VVWB 2OJRA 1YJ1A 2L7RA 2MBBB 4FHKA 4W9GA 4MDKE 3UINB 2N9PC 3MJWA 4K7SA 1F9JA 2MRPA 3VH4B 3ENEA 1L2NA 3JSVB 4WAAA 4W9CA 2G45B 3NZSA 4EUTA 3WAOA 2KDEB 1EF1A 2IO1B 2VRRB 3ZO5B 4TQ0A 1RRBA 4BKTA 3C0RB 1GC7A 1E7UA 2IY0B 4NNJB 2NBUA 4ZDVA 1V2YA 4BKGA 1GC6A 3PHXB 4MGYE 5E6NA 1IYFA 3B1LX 3HM3A 2KANA 1WF9A 4TUUA 1OEYA 1TTNA 2ZCCA 3L17A 2AL6A 4GB9A 4W9FA 1Q5WB 3ZNID 2KWCA 3AU4A 4EZJA 3CSFA 3M63B 1A5RA 1XQQA 1X1MA 4CYEA 1EO6A 1WZ3A 1FXTB 3TCAA 1WFYA 1WMHB 3N32A 5AZHA 2LASA 2CKHB 2IO2B 1WGGA 1V80A 1I42A 1WXVA 3JSVA 4AWJA 3KUZA 2KZRA 1CMXB 3H1UA 4BVUC 2FUHB 1Q0WB 1EF5A 4FN2A 3L16A 2N9XA 4IM3A 1XT9B 5DPWA 3IG3A 2MBQA 1IP9A 2XEWA 1WXMA 2KD0A 4W9IA 3PREA 3PZDA 2LGYA 2RR9A 4GDLB 1R4MI 4F8CB 2HE7A 4KZCA 4BFRA 4G50A 4BOSC 3X0WA 2Z0EB 3ALBA 2WYQA 1E90A 3RT3B 4F1SA 3KYDD 2D10A 2FCSA 2ZEQA 2REXA 4ZRIA 1RFAA 4GSWA 2J0MA 3WANA 2MCNB 3V62A 1V6EA 2DZKA 4NY0A 3TBLD 5TR5A 1BT0A 2JXXA 2O6VA 5IA7A 2RSUA 1Z5SB 2Z0DB 3R3MA 4A3OA 2D07B 3W1SA 2L05A 2V1YA 2NCNA 3QIJA 1TBEA 1WGDA 1WM2A 2KC2A 2KX0A 2L0TA 3Q3JA 3VHTC 1WGYA 4CO7A 2NS5A 4B95A 1P0RA 4WJQA 3SHQA 3VXWA 3PS6A 2ZPYA 1UH6A 2O6VD 4E71A 1JRUA 2ASQA 3CF6E 5E6PA 3PHWB 4MELA 2Y5BB 4FJYA 5C1ZA 2J0KA 3L08A 2MP2A 4BBNF 2FNJB 2L00B 2BWFA 1P1AA 2NVUI 3A9JA 4GMVA 3VTWA 3S2AA 1GG3A 2MX2A 4B6WA 3A33B 1M94A 2CHXA 1T0YA 1TGZB 2DYBA 4KVGB 3VTUA 2MQJA 1P9DU 2AEHA 2LI5A 4GGQA 2C60A 2KJ6A 4TQ1A 2NR2A 3HM6X 2IO3B 3IHPC 4FHJA 3DCGA 2K8HA 3PLVA 3NOBA 4W9HA 1WX9A 4KV2A 1Q1OA 2C7NB 1PQSA 2L76A 2R2OA 3KUDB 2CHWA 5AZFA 1WMHA 2KKCA 4XX5A 3QA8A 3ZNGC 3V6CB 1P3QU 4HPMB 2KC1A 2XK5B 5CX3A 4DK5A 3H6NA 3A9KA 4IG7B 5IAAC 2MWSB 2HTHA 4PS3A 3ZTDA 2UWQA 4KSKC 3A4RA 3APFA 3UQBA 4LCDE 2MLBA 3QC8B 1WXAA 2IZVB 4XZ4A 3NZUA 3K9PB 3M3JA 5DPSA 4URKA 3HIZA 2KTFA 4MJSA 1UZXB 2LVPA 1S3SG 3ZDTA 4II2B 5JHBA 1V49A 3AU5A 2LUEA 2V4LA 3R7QA 4NAWA 3ZKJC 4FJVB 1GNUA 1GJZA 1E7VA 2KO3A 5BO4B 3H7SA 2JY6A 4ZRJA 4PS7A 4GN1A 3A4SC 2LD9A 3I3TB 1E8WA 2JWZA 2K8BA 4AJYB 4DBGA 3WALA 2O2VB 2EKEC 3QCAA 4HXDA 2MA9B 4WJNA 2KWUB 5HKHA 1LM8B 4W9JA 1KOTA 2N7EA 4P7IA 4FJZA 1SIFA 3BINA 4G0NB 3RUIB 5E6OA 1YX5B 2AYOB 4I6NB 2YVCA 4I6LB 3UF8A 3AULA 3EC8A 2O6VB 2M8SA 2JVCA 3VDZA 2G4SA 2K39A 3B08A 2YLMA 5AZGA 3L0WB 1OTRB 4GOCA 2KJRA 2LXCA 5CHVC 4OVVA 4DHZE 4X57B 4ICVA 3U7DA 1H8CA 1WX7A 2QHOA 1WJUA 2K1FA 3DOWA 3M95A 2CR5A 2J0JA 3V6EB 3OJ4B 4E74A 1RAXA 1J19A 2GBRA 2KTRB 2Z59B 2LVQA 3DBHI 3WIMA 1SGHA 4PYUA 5G55A 4BKSD 2O2VA 1RLFA 2EMTA 4WJPA 2FCQA 3APDA 4NJ7A 2AL3A 3T8MA 3QQ8B 4ASWC 3P2BA 3QARA 2NBWB 4NPNA 2KN5A 1V5OA 2C7HA 1UBQA 3UGBB 2DYMA 1NI2A 2DZMA 2ZVNA 1XD3B 4LJPB 2N1VA 4WWOA 3LJ3A 3QX1A 1SE9A 3A9KB 4AOFA 1J0GA 4HJKA 4RM8A 4WWPA 2GBMA 2L3ZA 4HDQA 2JT4B 1Y8RC 3PV1A 2BYVE 4AP4C 1ISNA 4GXBA 3DVGY 4G11A 4LDTB 1U4AA 3ZDMC 2ZVOA 3KUCB 3A9JB 3W1SC 2K8CA 2MBOA 2KX3A 2MW5A 2GOWA 2LGXA 4IM0A 5KHOA 3U30A 3AXCA 1C3TA 2KDFB 2G4DB 4NQKE 1WI0A 1OEYJ 3T9LA 3HHMA 3H9DA 4KIKB 2KLCA 2KLGA 2JZ3B 5D2MB 2CU1A 2BKRB 4IM2A 2MP2B 4ANVA 2BWES 5JZEB 3D32A 1IPGA 2C9WB 3GOEA 2LXAA 3ZVVA 4K7UA 4KZ0A 4HDOA 4YL8A 3A1QB 2D2QA 4G3XB 2RD0A 3PGEA 1V86A 2GBNA 3IVFA 4M0WB 3OJ3A 4W9EA 2MSED 4DDGD 2BPSA 2BGFA 3ZNHB 5JHAA 1GUAB 2N7DA 2KWVB 4FULA 1C1YB 2KDBA 4FA6A 4GU2A 3CMMB 4HVBA 4GDKB 2M0XA 2KDIA 3DBRI 2N1WA 2A4ZA 2JRIB 2HD5B 3PSEB 5J2RA 1LQBA 4JIOU 5J18A 2PE6B 4JGHB 4KIKA 2D3GA 3HK0A 2AWTA 4J6IA 1KLVA 2IO0B 3L54A 2KJHB 4KDLB 4I6PA 2LVOA 3QWZB 1WXSA 2MBEA 2KTRA 2BKFA 2V3SA 4XC2A 3TIXA 4M8MA 2GBKA 2RPQA 4BOZB 4EZLA 3R66C 4K1RB 4HLEA 2JRHA 4FADA 1S1QB 1WM3A 2FAZA 2PPHA 2B3AA 3PTFC 2G3QB 3L13A 5L83A 2ZNVC 2J7QB 4JQWC 5G2NA 3VAWA 3N3KB 3RD2A 3UIOB 1Z2MA 2JPHA 1UD7A 4IWPA 4DHJB 1WGRA 2KMCA 3KW5B 2GBJA 2BF8B 4ICUA 3EHVA 1E8YA 3JVZX 4IWQA 2KMAA 3ZUNA 1G6JA 2LJ5A 3SD5A 2DENB 4ANXA 3W1YA 1WX8A 1YD8U 2C5LC 1H4RA 2K6QA 4HK2A 4DHZB 5L95C 1WJ6A 2FCMA 2KHWB 2N9EB 3VQIA 2ZPNA 4MJSB 4M8NA 1L7YA 1YIWA 5CHWA 4RM9A 2KFKB 2HJ8A 4EZKA 4W9KA 4IWOA 4GDLA 5DPTA 5C23A 3CSTA 2ZNVB 3IFWB 3SU8X 4MM3A 4FBJB 3L10B 4IW0A 3R7RA 5FR6A 2MBHA 2LGDA 3TMPB 3ONSA 4JL9A 4RMAA 3DBSA 5LLIA 1V5TA 3A1QA 2IYDB 2R2QA 3H7PB 4EFOA 3V60A 2ZZPB 3BY4B 2DYOA 3OLMD 5JH5C 5GMVA 3PLUA 1WGHA 2W9NA 4IUMB 4AJWA 1V81A 3QK0A 4KDIC 3EFUA 3PPAA 4II3B 3N30A 4PS8A 3NY5A 2KVRA 3DPDA 3Q3FA 3UQAA 4KSLC 3ZLZA 4PYZA 4MSMB 1WR6E
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4MSQ B;  2L8J A;  3ZW3 A;  4WWN A;  1E8Z A;  4OVU A;  2M17 A;  3X23 A;  3DVG X;  3VUW A;  3M62 B;  2WX1 A;  4EEW A;  2KQS A;  1P98 A;  5LXI B;  1UGM A;  1LFD A;  1VCB A;  2KXJ A;  3PVL A;  3K9O B;  2CHZ A;  4BKS A;  4ANW A;  2K25 A;  4GDK A;  1I35 A;  2I1J A;  5D7G A;  3H7P A;  3VTV A;  1J8C A;  1KJT A;  2A5U A;  3MTN B;  1KM7 A;  2D11 A;  2M4N A;  3DVN V;  4NQL B;  1OQY A;  5D94 A;  3ZRC A;  1MG8 A;  2JZZ A;  3QJZ A;  1WJ4 A;  2XBB C;  3IBE A;  3QAQ A;  3JW0 X;  1TZ1 A;  3ZRF A;  1WH3 A;  1D3Z A;  3DDC B;  3PRZ A;  2WWZ A;  1AAR A;  1E8X A;  2ZCB A;  1WR1 A;  3DVN U;  4W9L A;  3ZTC A;  3ECI A;  3KYC D;  4DWF A;  3O65 B;  1WIA A;  4K81 A;  4ZYN A;  1HE8 A;  2BYE A;  4ANU A;  1QZE A;  4A3P A;  4LJO B;  2OOB B;  1WYW B;  3VUY A;  3VH3 B;  2ZJD A;  1UBI A;  4ZRK A;  4DDI D;  1NBF C;  2LRU A;  3ML9 A;  3APC A;  2JUO A;  2DHZ A;  2LWP A;  1WE7 A;  1UEL A;  1V9J A;  1VD2 A;  1LXD A;  4HCP B;  3TJP A;  3PT2 B;  3TL5 A;  2BYF A;  1WJN A;  2KQ7 A;  4AUQ C;  3AI5 A;  3QHT A;  2CS4 A;  2LZ6 A;  3DBL I;  4A20 A;  3VFK A;  2DZJ A;  2PEA A;  4GIV A;  5DPR A;  5DCN A;  2RGF A;  2JF5 A;  3B0A A;  1EUV B;  1R4N I;  2NPT A;  4MH0 E;  3ZNZ B;  3NHE B;  5KHQ A;  3MHS D;  3U8Z A;  4DXA B;  4IC7 B;  3KH0 A;  2XK5 A;  2FID A;  4MGK E;  2L0F A;  4W9D A;  4MGZ E;  3JYU A;  3DQV A;  2WDT B;  5LXH A;  2PE9 A;  2KFJ A;  1ZKH A;  3GZN I;  2IY1 B;  4HPL B;  5CTR C;  1YQB A;  2KK8 A;  2UYZ B;  4E3C A;  4EOY A;  2LRW A;  4K7W A;  4N9F 4;  2PJH A;  3RZF A;  3VUX A;  3EEC A;  4JLC A;  1ZGU B;  3RZW C;  2C7M B;  3PRM B;  1E5W A;  5AEK B;  3WA0 A;  5D6J B;  3RCZ A;  2NBV B;  2WX0 A;  4WJO A;  4FLH A;  5EDS A;  2KOX A;  3PRP B;  4CHK A;  2FIF A;  2I1K A;  2M1M A;  5CHF A;  2NPT B;  3RUL A;  1WZ0 A;  3LDZ E;  2KNB A;  1YX6 B;  1K8R B;  4EKU A;  3RYT A;  1NDD A;  1ZW7 A;  3OAW A;  4TKN A;  4LDT D;  4NAW B;  3WAM A;  2DAJ A;  1WRD B;  2DAF A;  4B9K A;  2GMI C;  4NJ6 A;  3ML8 A;  1OGW A;  4MGI E;  2K6D B;  1WE6 A;  4HWI B;  5J17 A;  2KFK A;  2FCN A;  2DZI A;  2EMS A;  2DX5 B;  4BBN C;  2IBI B;  3UIP B;  3NS8 A;  3SDL C;  3WAP A;  4TV3 A;  3V61 A;  4DHJ D;  2N4F A;  1WY8 A;  4F7Z A;  4HCN B;  4MEM A;  3ZIM A;  3KVF B;  4WQO B;  3VVW B;  2OJR A;  1YJ1 A;  2L7R A;  2MBB B;  4FHK A;  4W9G A;  4MDK E;  3UIN B;  2N9P C;  3MJW A;  4K7S A;  1F9J A;  2MRP A;  3VH4 B;  3ENE A;  1L2N A;  3JSV B;  4WAA A;  4W9C A;  2G45 B;  3NZS A;  4EUT A;  3WAO A;  2KDE B;  1EF1 A;  2IO1 B;  2VRR B;  3ZO5 B;  4TQ0 A;  1RRB A;  4BKT A;  3C0R B;  1GC7 A;  1E7U A;  2IY0 B;  4NNJ B;  2NBU A;  4ZDV A;  1V2Y A;  4BKG A;  1GC6 A;  3PHX B;  4MGY E;  5E6N A;  1IYF A;  3B1L X;  3HM3 A;  2KAN A;  1WF9 A;  4TUU A;  1OEY A;  1TTN A;  2ZCC A;  3L17 A;  2AL6 A;  4GB9 A;  4W9F A;  1Q5W B;  3ZNI D;  2KWC A;  3AU4 A;  4EZJ A;  3CSF A;  3M63 B;  1A5R A;  1XQQ A;  1X1M A;  4CYE A;  1EO6 A;  1WZ3 A;  1FXT B;  3TCA A;  1WFY A;  1WMH B;  3N32 A;  5AZH A;  2LAS A;  2CKH B;  2IO2 B;  1WGG A;  1V80 A;  1I42 A;  1WXV A;  3JSV A;  4AWJ A;  3KUZ A;  2KZR A;  1CMX B;  3H1U A;  4BVU C;  2FUH B;  1Q0W B;  1EF5 A;  4FN2 A;  3L16 A;  2N9X A;  4IM3 A;  1XT9 B;  5DPW A;  3IG3 A;  2MBQ A;  1IP9 A;  2XEW A;  1WXM A;  2KD0 A;  4W9I A;  3PRE A;  3PZD A;  2LGY A;  2RR9 A;  4GDL B;  1R4M I;  4F8C B;  2HE7 A;  4KZC A;  4BFR A;  4G50 A;  4BOS C;  3X0W A;  2Z0E B;  3ALB A;  2WYQ A;  1E90 A;  3RT3 B;  4F1S A;  3KYD D;  2D10 A;  2FCS A;  2ZEQ A;  2REX A;  4ZRI A;  1RFA A;  4GSW A;  2J0M A;  3WAN A;  2MCN B;  3V62 A;  1V6E A;  2DZK A;  4NY0 A;  3TBL D;  5TR5 A;  1BT0 A;  2JXX A;  2O6V A;  5IA7 A;  2RSU A;  1Z5S B;  2Z0D B;  3R3M A;  4A3O A;  2D07 B;  3W1S A;  2L05 A;  2V1Y A;  2NCN A;  3QIJ A;  1TBE A;  1WGD A;  1WM2 A;  2KC2 A;  2KX0 A;  2L0T A;  3Q3J A;  3VHT C;  1WGY A;  4CO7 A;  2NS5 A;  4B95 A;  1P0R A;  4WJQ A;  3SHQ A;  3VXW A;  3PS6 A;  2ZPY A;  1UH6 A;  2O6V D;  4E71 A;  1JRU A;  2ASQ A;  3CF6 E;  5E6P A;  3PHW B;  4MEL A;  2Y5B B;  4FJY A;  5C1Z A;  2J0K A;  3L08 A;  2MP2 A;  4BBN F;  2FNJ B;  2L00 B;  2BWF A;  1P1A A;  2NVU I;  3A9J A;  4GMV A;  3VTW A;  3S2A A;  1GG3 A;  2MX2 A;  4B6W A;  3A33 B;  1M94 A;  2CHX A;  1T0Y A;  1TGZ B;  2DYB A;  4KVG B;  3VTU A;  2MQJ A;  1P9D U;  2AEH A;  2LI5 A;  4GGQ A;  2C60 A;  2KJ6 A;  4TQ1 A;  2NR2 A;  3HM6 X;  2IO3 B;  3IHP C;  4FHJ A;  3DCG A;  2K8H A;  3PLV A;  3NOB A;  4W9H A;  1WX9 A;  4KV2 A;  1Q1O A;  2C7N B;  1PQS A;  2L76 A;  2R2O A;  3KUD B;  2CHW A;  5AZF A;  1WMH A;  2KKC A;  4XX5 A;  3QA8 A;  3ZNG C;  3V6C B;  1P3Q U;  4HPM B;  2KC1 A;  2XK5 B;  5CX3 A;  4DK5 A;  3H6N A;  3A9K A;  4IG7 B;  5IAA C;  2MWS B;  2HTH A;  4PS3 A;  3ZTD A;  2UWQ A;  4KSK C;  3A4R A;  3APF A;  3UQB A;  4LCD E;  2MLB A;  3QC8 B;  1WXA A;  2IZV B;  4XZ4 A;  3NZU A;  3K9P B;  3M3J A;  5DPS A;  4URK A;  3HIZ A;  2KTF A;  4MJS A;  1UZX B;  2LVP A;  1S3S G;  3ZDT A;  4II2 B;  5JHB A;  1V49 A;  3AU5 A;  2LUE A;  2V4L A;  3R7Q A;  4NAW A;  3ZKJ C;  4FJV B;  1GNU A;  1GJZ A;  1E7V A;  2KO3 A;  5BO4 B;  3H7S A;  2JY6 A;  4ZRJ A;  4PS7 A;  4GN1 A;  3A4S C;  2LD9 A;  3I3T B;  1E8W A;  2JWZ A;  2K8B A;  4AJY B;  4DBG A;  3WAL A;  2O2V B;  2EKE C;  3QCA A;  4HXD A;  2MA9 B;  4WJN A;  2KWU B;  5HKH A;  1LM8 B;  4W9J A;  1KOT A;  2N7E A;  4P7I A;  4FJZ A;  1SIF A;  3BIN A;  4G0N B;  3RUI B;  5E6O A;  1YX5 B;  2AYO B;  4I6N B;  2YVC A;  4I6L B;  3UF8 A;  3AUL A;  3EC8 A;  2O6V B;  2M8S A;  2JVC A;  3VDZ A;  2G4S A;  2K39 A;  3B08 A;  2YLM A;  5AZG A;  3L0W B;  1OTR B;  4GOC A;  2KJR A;  2LXC A;  5CHV C;  4OVV A;  4DHZ E;  4X57 B;  4ICV A;  3U7D A;  1H8C A;  1WX7 A;  2QHO A;  1WJU A;  2K1F A;  3DOW A;  3M95 A;  2CR5 A;  2J0J A;  3V6E B;  3OJ4 B;  4E74 A;  1RAX A;  1J19 A;  2GBR A;  2KTR B;  2Z59 B;  2LVQ A;  3DBH I;  3WIM A;  1SGH A;  4PYU A;  5G55 A;  4BKS D;  2O2V A;  1RLF A;  2EMT A;  4WJP A;  2FCQ A;  3APD A;  4NJ7 A;  2AL3 A;  3T8M A;  3QQ8 B;  4ASW C;  3P2B A;  3QAR A;  2NBW B;  4NPN A;  2KN5 A;  1V5O A;  2C7H A;  1UBQ A;  3UGB B;  2DYM A;  1NI2 A;  2DZM A;  2ZVN A;  1XD3 B;  4LJP B;  2N1V A;  4WWO A;  3LJ3 A;  3QX1 A;  1SE9 A;  3A9K B;  4AOF A;  1J0G A;  4HJK A;  4RM8 A;  4WWP A;  2GBM A;  2L3Z A;  4HDQ A;  2JT4 B;  1Y8R C;  3PV1 A;  2BYV E;  4AP4 C;  1ISN A;  4GXB A;  3DVG Y;  4G11 A;  4LDT B;  1U4A A;  3ZDM C;  2ZVO A;  3KUC B;  3A9J B;  3W1S C;  2K8C A;  2MBO A;  2KX3 A;  2MW5 A;  2GOW A;  2LGX A;  4IM0 A;  5KHO A;  3U30 A;  3AXC A;  1C3T A;  2KDF B;  2G4D B;  4NQK E;  1WI0 A;  1OEY J;  3T9L A;  3HHM A;  3H9D A;  4KIK B;  2KLC A;  2KLG A;  2JZ3 B;  5D2M B;  2CU1 A;  2BKR B;  4IM2 A;  2MP2 B;  4ANV A;  2BWE S;  5JZE B;  3D32 A;  1IPG A;  2C9W B;  3GOE A;  2LXA A;  3ZVV A;  4K7U A;  4KZ0 A;  4HDO A;  4YL8 A;  3A1Q B;  2D2Q A;  4G3X B;  2RD0 A;  3PGE A;  1V86 A;  2GBN A;  3IVF A;  4M0W B;  3OJ3 A;  4W9E A;  2MSE D;  4DDG D;  2BPS A;  2BGF A;  3ZNH B;  5JHA A;  1GUA B;  2N7D A;  2KWV B;  4FUL A;  1C1Y B;  2KDB A;  4FA6 A;  4GU2 A;  3CMM B;  4HVB A;  4GDK B;  2M0X A;  2KDI A;  3DBR I;  2N1W A;  2A4Z A;  2JRI B;  2HD5 B;  3PSE B;  5J2R A;  1LQB A;  4JIO U;  5J18 A;  2PE6 B;  4JGH B;  4KIK A;  2D3G A;  3HK0 A;  2AWT A;  4J6I A;  1KLV A;  2IO0 B;  3L54 A;  2KJH B;  4KDL B;  4I6P A;  2LVO A;  3QWZ B;  1WXS A;  2MBE A;  2KTR A;  2BKF A;  2V3S A;  4XC2 A;  3TIX A;  4M8M A;  2GBK A;  2RPQ A;  4BOZ B;  4EZL A;  3R66 C;  4K1R B;  4HLE A;  2JRH A;  4FAD A;  1S1Q B;  1WM3 A;  2FAZ A;  2PPH A;  2B3A A;  3PTF C;  2G3Q B;  3L13 A;  5L83 A;  2ZNV C;  2J7Q B;  4JQW C;  5G2N A;  3VAW A;  3N3K B;  3RD2 A;  3UIO B;  1Z2M A;  2JPH A;  1UD7 A;  4IWP A;  4DHJ B;  1WGR A;  2KMC A;  3KW5 B;  2GBJ A;  2BF8 B;  4ICU A;  3EHV A;  1E8Y A;  3JVZ X;  4IWQ A;  2KMA A;  3ZUN A;  1G6J A;  2LJ5 A;  3SD5 A;  2DEN B;  4ANX A;  3W1Y A;  1WX8 A;  1YD8 U;  2C5L C;  1H4R A;  2K6Q A;  4HK2 A;  4DHZ B;  5L95 C;  1WJ6 A;  2FCM A;  2KHW B;  2N9E B;  3VQI A;  2ZPN A;  4MJS B;  4M8N A;  1L7Y A;  1YIW A;  5CHW A;  4RM9 A;  2KFK B;  2HJ8 A;  4EZK A;  4W9K A;  4IWO A;  4GDL A;  5DPT A;  5C23 A;  3CST A;  2ZNV B;  3IFW B;  3SU8 X;  4MM3 A;  4FBJ B;  3L10 B;  4IW0 A;  3R7R A;  5FR6 A;  2MBH A;  2LGD A;  3TMP B;  3ONS A;  4JL9 A;  4RMA A;  3DBS A;  5LLI A;  1V5T A;  3A1Q A;  2IYD B;  2R2Q A;  3H7P B;  4EFO A;  3V60 A;  2ZZP B;  3BY4 B;  2DYO A;  3OLM D;  5JH5 C;  5GMV A;  3PLU A;  1WGH A;  2W9N A;  4IUM B;  4AJW A;  1V81 A;  3QK0 A;  4KDI C;  3EFU A;  3PPA A;  4II3 B;  3N30 A;  4PS8 A;  3NY5 A;  2KVR A;  3DPD A;  3Q3F A;  3UQA A;  4KSL C;  3ZLZ A;  4PYZ A;  4MSM B;  1WR6 E; 
#chains in the Genus database with same CATH topology
 1MHH E;  1FCL A;  4OVU A;  3ZQ4 A;  4OHJ A;  4RGO S;  2WX1 A;  2KQS A;  1VCB A;  1L0X B;  3K9O B;  2CHZ A;  2KN4 A;  4AS1 A;  2I1J A;  1J8C A;  2A5U A;  3MTN B;  3DVN V;  1OQY A;  3ZRC A;  1RM6 C;  2J42 A;  3IBE A;  3ZRF A;  1JAL A;  2WWZ A;  1E8X A;  3DVN U;  3ECI A;  4ZYN A;  2BYE A;  4A3P A;  3PO0 A;  1UBI A;  4DDI D;  3APC A;  1V9J A;  4HCP B;  3NG0 A;  1I4P A;  3TJP A;  3TL5 A;  2BYF A;  3QHT A;  2J4X A;  3DBL I;  1BXT A;  2DZJ A;  2PEA A;  5DPR A;  2RGF A;  1ZPS A;  3ZNZ B;  3NHE B;  3U8Z A;  3AE1 B;  1ET9 A;  2XK5 A;  1CZP A;  1D5Z C;  3OG5 A;  2K5P A;  3NVV A;  3I5J C;  1YQB A;  2RMM A;  5HI1 A;  3KLS X;  2AQ1 B;  1SE3 A;  4E3C A;  3VUX A;  4PK1 A;  4N58 A;  3PRM B;  5D6J B;  2KOX A;  1DOI A;  2I1K A;  1WZ0 A;  1NYR A;  2WDQ B;  2J52 A;  2PKO A;  2WP9 B;  3FKY A;  3HVD A;  1XEE A;  1VZ6 A;  2GB1 A;  2DX5 B;  4BBN C;  4RCO A;  1JML A;  1L4Z B;  3FC4 A;  1EM7 A;  4HCN B;  2IGH A;  4MEM A;  3BII D;  3ZIM A;  3KVF B;  4K3C A;  4WQO B;  2OJR A;  2MBB B;  4FHK A;  3MJW A;  2MRP A;  4LNI A;  2KDE B;  2VRR B;  3MP9 A;  5G5G A;  1E7U A;  2QC8 A;  4B0M A;  1FRR A;  3B9J A;  4KGT A;  3N20 C;  4ZDV A;  4HPP A;  1GC6 A;  3PHX B;  4W9F A;  1TTN A;  2KWD A;  4GB9 A;  2TSS A;  3ZNI D;  1XQQ A;  1IBX B;  2IO2 B;  1WGG A;  2KZR A;  1CMX B;  2FUH B;  2RDG A;  3MFG A;  2RR9 A;  4GDL B;  4F8C B;  1STE A;  2D5G A;  4UDU C;  3X0W A;  3DHH C;  1B9R A;  1E90 A;  4ZRI A;  2J0M A;  1V6E A;  3Q69 A;  2INP E;  4XE0 A;  2JXX A;  2RSU A;  4A3O A;  3R3M A;  2D07 B;  2LUM A;  1P0R A;  4WJQ A;  1M4V A;  3VXW A;  3PS6 A;  1UH6 A;  3CF6 E;  5E6P A;  2V3P A;  3DWG C;  1F52 A;  2MP2 A;  4RGN A;  5AUI A;  2L00 B;  4GMV A;  3VTW A;  2NVU I;  1YMH E;  1GG3 A;  2MX2 A;  2CHX A;  2BB5 A;  1P9D U;  2GRI A;  1ROE A;  2KJ6 A;  2NR2 A;  3HM6 X;  4FHJ A;  3GS2 A;  1L0Y B;  4ARC A;  4YTN B;  2WXR A;  1QLB B;  4KV2 A;  1Q1O A;  2L76 A;  1SE2 A;  2KKC A;  4M0W A;  1FEH A;  1TIF A;  4IG7 B;  2HTH A;  4PS3 A;  2UWQ A;  4KSK C;  1YQ4 B;  3BK2 A;  3QC8 B;  1WXA A;  3M3J A;  1VDV A;  1UZX B;  4YXD B;  2LVP A;  4II2 B;  1JRO A;  4NAW A;  1C79 A;  4MT5 A;  1E7V A;  1ZE3 D;  2KO3 A;  1TY0 A;  4GLS C;  4DBG A;  3GE8 C;  2KWU B;  1LM8 B;  4P7I A;  1SIF A;  1C76 A;  4G0N B;  5HHD G;  3RUI B;  1UGJ A;  4XYC A;  2K39 A;  3LYY A;  5AZG A;  4GOC A;  2KJR A;  1B1Z A;  2E3T A;  2PTL A;  1QIL A;  3OJ4 B;  1GB1 A;  1KFY B;  1J19 A;  3DBH I;  2Z59 B;  2LVQ A;  1AN8 A;  4NJC A;  4L23 A;  3APD A;  3T8M A;  2AL3 A;  4XWT A;  3QQ8 B;  3N1Y C;  5LNK 1;  2DBY A;  2C7H A;  1NI2 A;  1D5M C;  3QX1 A;  1SE9 A;  3A9K B;  1XCQ L;  2GBM A;  2JT4 B;  4G11 A;  2E6X A;  5BMI A;  3MC8 A;  2BTE A;  4IM0 A;  1CQV A;  3W9C B;  2G4D B;  4NQK E;  1WI0 A;  1MJD A;  3H9D A;  3FIL B;  2KLG A;  2JZ3 B;  1RFK A;  3Q8E A;  4AQ7 A;  2BWE S;  2IJ0 A;  2C9W B;  1D6E C;  2DLB A;  3ZVV A;  4WUR A;  4WH4 A;  4K7U A;  4KZ0 A;  4HDO A;  1KLU D;  5FKA C;  2RD0 A;  3LB8 C;  1UWX A;  3IVF A;  3OJ3 A;  2MSE D;  3RNG C;  5JHA A;  2IDY A;  3LXF A;  2KDB A;  4FA6 A;  3NZ3 A;  4GU2 A;  3Q8B A;  3SFD B;  2KDI A;  3PSE B;  4JGH B;  2D3G A;  3HK0 A;  2D3A A;  4BAX A;  3AM9 A;  2LVO A;  1WXS A;  2INN E;  3HVZ A;  1V8C A;  4C56 C;  4M8M A;  2GBK A;  2WXJ A;  2JRH A;  4FAD A;  4LNF A;  2PPH A;  3PTF C;  3L13 A;  2ZNV C;  1DOY A;  1Z2M A;  1UD7 A;  1HXY D;  1WGR A;  3KW5 B;  2GBJ A;  1JQ4 A;  1G6J A;  2LJ5 A;  1WX8 A;  2C5L C;  1L6U A;  1WJ6 A;  1RWS A;  2KHW B;  3VQI A;  4M8N A;  3P4Q B;  4EZK A;  5C23 A;  2ZNV B;  1ZXI A;  3SU8 X;  4WAF A;  4YSX B;  2WU5 B;  2LGD A;  3ONS A;  3A1Q A;  4MAC A;  4S17 A;  3H7P B;  4ZOH C;  2XNA C;  3AE8 B;  2J53 A;  2WXK A;  3IT4 B;  2V0G A;  5JH5 C;  1T0R C;  5GMV A;  3PLU A;  1V81 A;  4KDI C;  3PPA A;  1FNV A;  3N30 A;  4J3O D;  3DPD A;  3ZLZ A;  2MHJ A;  1WR6 E;  3P4P B;  1SBB B;  3AEB B;  1E8Z A;  4NAM A;  4A6Q A;  3M62 B;  1P98 A;  3KQ4 A;  4Q2J A;  4BKS A;  1FXI A;  1SJH D;  1C4C A;  1N62 A;  4HKQ A;  3VTV A;  1MI0 A;  1VR9 A;  2D11 A;  2M4N A;  5D94 A;  2KYW A;  2JZP A;  2JZZ A;  3QJZ A;  3QAQ A;  1EU4 A;  1N63 A;  3ZTC A;  3KYC D;  1FPY A;  3Q8A A;  4DQO C;  1NYQ A;  1NBF C;  2LRU A;  3ZXR A;  4BZA A;  2DHZ A;  3RI7 C;  2W54 A;  2QSD A;  1KH0 A;  1WE7 A;  2LWP A;  1UEL A;  1LXD A;  3PT2 B;  2N7J A;  2KQ7 A;  4AUQ C;  3VR9 B;  2LZ6 A;  3VFK A;  1PGB A;  5DCN A;  3BYY B;  1J7A A;  4MM3 B;  3B0A A;  4PT5 A;  4IC7 B;  3W5U B;  2LHD A;  3KH0 A;  1QOF A;  4MGK E;  2L0F A;  4MGZ E;  5H92 C;  2WDT B;  1TS4 A;  2PE9 A;  5CTR C;  2KK8 A;  4K7W A;  4N9F 4;  3RZF A;  1SE4 A;  2BQQ A;  4JLC A;  1UF0 A;  3RZW C;  4RFB A;  1E5W A;  3AN1 A;  1I4Q A;  3AE7 B;  1MG4 A;  2NBV B;  3AE9 B;  1XLO A;  1E0Z A;  2JYE A;  5EDS A;  3PRP B;  1T3Q A;  5FK9 C;  2M1M A;  1SEB D;  5CHF A;  2JQR B;  3LDZ E;  5H8Y E;  1C77 A;  4OZB A;  1K8R B;  3KWV A;  3RNE C;  1NDD A;  4LDT D;  3WAM A;  1WRD B;  1F0Z A;  1EWY C;  3HUI A;  4NJ6 A;  4TSS A;  2WS3 B;  4MGI E;  5IP4 D;  1WE6 A;  5J17 A;  2KFK A;  1TZO A;  3U4E G;  3BK1 A;  5FR3 A;  3C19 A;  2IBI B;  4WQM A;  3UIP B;  3V61 A;  4DHJ D;  1WY8 A;  3AEA B;  3N1X C;  3R8B A;  1XF5 L;  1WGK A;  3VVW B;  3BYT B;  1F2R C;  2WNM A;  4P1B C;  1EWC A;  2N9P C;  4K7S A;  1UNS A;  1L2N A;  3JSV B;  4WAA A;  3WAO A;  1EF1 A;  3C0R B;  1GC7 A;  4NNJ B;  4BKG A;  1IYF A;  3B1L X;  4L1B A;  1WF9 A;  3EGR A;  3Q8F A;  2ZCC A;  2CJN A;  3AU4 A;  3CSF A;  3U52 E;  1X1M A;  3P4R B;  1EO6 A;  3RFZ B;  3Q8C A;  1WMH B;  3N32 A;  2LAS A;  1WXV A;  1GOZ A;  2M19 A;  3JSV A;  3H1U A;  1N60 A;  2X38 A;  1ZP0 B;  3AB5 A;  2KD0 A;  3AEG B;  3PRE A;  4H2A A;  3PZD A;  2LGY A;  2QMT A;  1T0Q C;  4BFR A;  4KZC A;  3BVM A;  4BOS C;  2WYQ A;  4F1S A;  3AH7 A;  3P42 A;  4GSW A;  3L4P A;  3WAN A;  2K3U A;  1QOG A;  1BT0 A;  5IA7 A;  4C7Y A;  4YSY B;  3W1S A;  3AE6 B;  3QIJ A;  2KC2 A;  3VHT C;  3Q3N C;  3IXS A;  1WGY A;  1WSP A;  3B2G A;  2MEK A;  1I4X A;  4JWU C;  4E71 A;  1JRU A;  3V05 A;  3PHW B;  5C1Z A;  2WXP A;  2FNJ B;  2BWF A;  1P1A A;  4RGT A;  3S2A A;  2DYB A;  4KVG B;  2MQJ A;  2AEH A;  2C60 A;  2IO3 B;  3NVZ A;  3PLV A;  1WX9 A;  1HTO A;  2C7N B;  1PQS A;  3ZJU A;  3IT6 B;  2CHW A;  5AZF A;  2M0A A;  2WGS A;  1UWM A;  2LHE A;  2W82 A;  2IND C;  1WRI A;  2KC1 A;  5CX3 A;  3A9K A;  4A55 A;  1Y56 A;  1YOV B;  2WXG A;  3APF A;  4P16 A;  3UI3 A;  3OWE B;  2IZV B;  4XZ4 A;  3NZU A;  4URK A;  4MJS A;  1S3S G;  2RPV A;  3BWU D;  5JHB A;  4HJG E;  2LUE A;  2V4L A;  3EFC A;  5BO4 B;  4ZRJ A;  4OVZ A;  4GN1 A;  2LD9 A;  1E8W A;  4AJY B;  2O2V B;  3QCA A;  4WJN A;  4HXD A;  2MA9 B;  4HKZ E;  1KOT A;  1C4A A;  2N7E A;  3EUB 2;  3P4S B;  4FJZ A;  4ZHO A;  4I6N B;  2BVC A;  2YVC A;  3AUL A;  2WHI A;  2JVC A;  3VDZ A;  2G4S A;  3I9V 1;  2YLM A;  2LXC A;  1I7H A;  1QT9 A;  3Q14 C;  4X57 B;  4ICV A;  2V3N A;  2N9L A;  1WJU A;  1N61 A;  1HEZ E;  2K1F A;  2GBR A;  2OJW A;  2PVG C;  4WJP A;  1RLF A;  1C78 A;  4ZRP A;  1AWD A;  1PDX A;  2G1E A;  4ASW C;  3QAR A;  4NPN A;  2NBW B;  4JPS A;  1V5O A;  3UGB B;  2DZM A;  2ZVN A;  4LJP B;  3MJ5 A;  4AOF A;  2MJ3 A;  4HJK A;  4RM8 A;  3PZ8 A;  4WWP A;  4HDQ A;  2WU2 B;  2BYV E;  4LDT B;  3ZDM C;  1U4A A;  3KUC B;  3A9J B;  2KAJ A;  2I2Y A;  2MBO A;  2KX3 A;  1V1P A;  2LGX A;  5KHO A;  3AXC A;  3IAS 1;  1WWT A;  1OEY J;  3T9L A;  2KLC A;  4IM2 A;  2OED A;  1JWA D;  2MP2 B;  4ANV A;  4QAY A;  1IPG A;  1R4N B;  4YL8 A;  2X8X X;  3PGE A;  2N0S B;  4M0W B;  4W9E A;  4DDG D;  2BGF A;  4FUL A;  1FD6 A;  2AX5 A;  1C1Y B;  3NS1 A;  4HVB A;  3AMZ A;  3E56 A;  4N59 A;  3DWM A;  2N1W A;  3NJT A;  5J2R A;  1PYW D;  3TSS A;  1WXQ A;  4RF1 A;  2JXT A;  4O1N A;  2JU6 X;  4J6I A;  3AE4 B;  5AUK A;  1KLV A;  3Q6B A;  4KDL B;  3RNF C;  5D3D A;  3TIX A;  1QF6 A;  1SXT A;  4K1R B;  1DGJ A;  4ZYS A;  2WXN A;  2K0P A;  2LEK A;  4D2K A;  1WM3 A;  2FAZ A;  4IDI A;  4KGR A;  5L83 A;  1J7B A;  2L1A A;  3UIO B;  2M56 B;  3TEZ A;  4LLG M;  4DHJ B;  4ICU A;  4IWQ A;  2KMA A;  3ZJV A;  5E6J A;  5EE9 A;  1ZUD 2;  2FCM A;  3I63 C;  2PLP A;  1YIW A;  5CHW A;  2UU7 A;  4XDC A;  4GDL A;  3CST A;  3TUO A;  4MM3 A;  1SF0 A;  1V5T A;  2R2Q A;  2W9N A;  4AJW A;  1L0V B;  3QK0 A;  3EFU A;  2KVR A;  1GPX A;  2VH2 A;  1NVI D;  2MJD A;  4MSQ B;  3NVW A;  3X23 A;  2M17 A;  3DVG X;  3VUW A;  4EEW A;  5LXI B;  1UGM A;  1LFD A;  2K25 A;  5BYQ A;  1I35 A;  5D7G A;  3H7P A;  4IOI E;  2L52 A;  4NQL B;  1MG8 A;  3GB1 A;  1WJ4 A;  2ON8 A;  3RNA C;  3JW0 X;  4K3B A;  1WH3 A;  1D3Z A;  2KQ4 X;  3PRZ A;  4DWF A;  1WR1 A;  1WIA A;  4EE2 A;  4HRS A;  1HE8 A;  2BB6 A;  1QZE A;  3V3X A;  2OOB B;  1WYW B;  3VH3 B;  2ZJD A;  3ML9 A;  5IO9 A;  5EE3 A;  4FXC A;  1E7P B;  1VD2 A;  2Z8L A;  3AE3 B;  4HRO A;  1SB3 C;  2CS4 A;  1N6Z A;  2JF5 A;  2WXF A;  3GZN B;  1YNT E;  1R4N I;  2Q5W D;  4DXA B;  4W9D A;  4YT0 B;  3DQV A;  5LXH A;  2KFJ A;  1ZKH A;  3GZN I;  2IY1 B;  2JX5 A;  4HPL B;  2UYZ B;  1Q10 A;  2N9K A;  4EOY A;  4C4V A;  2PJH A;  1K52 A;  1FNU A;  1GAQ B;  3MC0 B;  2C7M B;  1IBX A;  4ACF A;  5AEK B;  1L6V A;  3WA0 A;  4LNO A;  4WJO A;  1JWB D;  4CHK A;  1F1H A;  4IKG A;  3RUL A;  2KNB A;  1NI3 A;  2WXQ A;  4EKU A;  1WYG A;  3OAW A;  1OFF A;  1XXG A;  3VRA B;  3FIL A;  3ML8 A;  4A9A A;  1OGW A;  1FRD A;  3ZYY X;  4HWI B;  1CK1 A;  1XLP A;  1DYQ A;  2EMS A;  1JCK B;  4DXF A;  3WAP A;  2N4F A;  1HZ6 A;  2VH1 A;  4F7Z A;  4YWG G;  1V97 A;  2L7R A;  2NTS A;  4W9G A;  4MDK E;  3UIN B;  2GI9 A;  4W9C A;  2G45 B;  4EUT A;  2IO1 B;  4US9 A;  1IGC A;  4BKT A;  2IY0 B;  3ABV B;  5T8I A;  1T6B X;  2BBC A;  1V2Y A;  4S0R A;  1D5X C;  4N6E B;  4TUU A;  2KAN A;  2H89 B;  4OZA A;  2KWC A;  4EZJ A;  3M63 B;  1UUP A;  1FXT B;  2EKI A;  3TCA A;  1N5W A;  1I42 A;  4OZC A;  3KUZ A;  4BVU C;  4XDD A;  2L83 A;  1Q0W B;  3RNC C;  1ET6 A;  2MH7 A;  3L16 A;  2N9X A;  1XT9 B;  3IG3 A;  2XEW A;  4R3D A;  1TT5 B;  1HTQ A;  1HA5 A;  2HE7 A;  2BS4 B;  1ACC A;  3KYD D;  2D10 A;  2FCS A;  1RFA A;  3V62 A;  2DZK A;  3TBL D;  5TR5 A;  2CJO A;  2W3R A;  4USA A;  2L05 A;  3T3N A;  2NCN A;  1TBE A;  1WM2 A;  2KX0 A;  2L0T A;  3Q3J A;  3BVZ A;  4CO7 A;  3SHQ A;  2L32 A;  2O6V D;  2NTT A;  2LJI A;  1HZ5 A;  2WXO A;  4MEL A;  2Y5B B;  4FJY A;  3L08 A;  3A9J A;  1V1O A;  3N1Z C;  3A33 B;  1M94 A;  1TGZ B;  3AEC B;  3NVY A;  4P1C C;  1BUI C;  3BZD B;  2LI5 A;  1P7E A;  4GGQ A;  2Y5C A;  1F2R I;  5BYR A;  1KRH A;  4A8X C;  1WMH A;  2PMV A;  3QA8 A;  4RH6 A;  1P3Q U;  2XK5 B;  3H6N A;  3R2I A;  3KWL A;  3A4R A;  4ARI A;  2MLB A;  3K9P B;  3VR8 B;  1E9M A;  3HIZ A;  4US8 A;  2KTF A;  4ZRQ A;  5IOI A;  4YTP B;  2LGS A;  3AU5 A;  5TSS A;  3ZKJ C;  4FJV B;  1GNU A;  1GJZ A;  3URY A;  3H7S A;  2JY6 A;  4HEA 1;  4PS7 A;  2DWQ A;  2ICI A;  2JWZ A;  2K8B A;  1YN4 A;  2AQ3 B;  1AYF A;  4W9J A;  2R61 A;  1PUT A;  1F77 A;  3BIN A;  2H88 B;  1YX5 B;  2AYO B;  4I6L B;  1FFV A;  2M8S A;  2NMQ A;  2QEJ C;  3B08 A;  3DBL B;  3L0W B;  5CHV C;  1TS2 A;  4LNN A;  1XCT L;  2QHO A;  3IAM 1;  1FO4 A;  2CR5 A;  2J0J A;  3V6E B;  4E74 A;  1RAX A;  2KTR B;  4P6V F;  2FE8 A;  1SGH A;  4LNK A;  5G55 A;  4BKS D;  2O2V A;  2VZK D;  2IGD A;  1R7S A;  1UBQ A;  4WIP A;  4C7Z A;  1TS5 A;  4WWO A;  2N1V A;  2LFI A;  3B2F A;  4ZHP A;  2QCZ A;  3TEX A;  2L3Z A;  4AP4 C;  5JXV A;  1ISN A;  1YQ3 B;  3DVG Y;  2ZVO A;  2QDF A;  2Y5P A;  2GOW A;  3HHM A;  3DHG C;  3GP7 A;  2V9H A;  3AED B;  5D2M B;  1FMA D;  5EE0 A;  5JZE B;  2HJ1 A;  1PGA A;  3A1Q B;  4G3X B;  1V86 A;  2GBN A;  2BPS A;  1YJI A;  1GUA B;  2N7D A;  2WDV B;  4KKJ A;  4GDK B;  2M0X A;  2QIL A;  2BW2 A;  2A4Z A;  2JRI B;  1DOX A;  2JWU A;  4OW0 A;  1LQB A;  3DBH B;  4JIO U;  5J18 A;  4KIK A;  2WXI A;  2AWT A;  1JWS D;  3L54 A;  3QWZ B;  2MBE A;  3SR6 A;  4XC2 A;  2RPQ A;  3R66 C;  1K53 A;  3Q3M C;  2YEP B;  2B3A A;  4JWS C;  2J7Q B;  4JQW C;  4YSZ B;  1GB4 A;  3N3K B;  3RD2 A;  5IN7 A;  1L4D B;  2KMC A;  2BF8 B;  1FM0 D;  1E8Y A;  3JVZ X;  3ZUN A;  2QJL A;  2DEN B;  4HK2 A;  4DHZ B;  1EU3 A;  2N9E B;  2XN9 C;  4C80 A;  3P63 A;  2KT7 A;  5DPT A;  4IWO A;  3R2T A;  2OHF A;  2RDH A;  3ZGZ A;  3R7R A;  3TMP B;  2HTM E;  2MBH A;  4JL9 A;  4RMA A;  3DBS A;  5LLI A;  1KLG D;  2ZZP B;  3AV8 A;  2KDM A;  4IUM B;  4II3 B;  3FAH A;  3RPF C;  3NY5 A;  3Q3F A;  3UQA A;  2WLB A;  4KSL C;  4TMA B;  2L8J A;  2PVO D;  1PGX A;  1NEK B;  3ZW3 A;  4WWN A;  1OQQ A;  2KXJ A;  2Y3A A;  2PW9 A;  3PVL A;  4ANW A;  1SJE D;  4GDK A;  3NUH B;  4LK0 M;  2FBW B;  1TKE A;  1KJT A;  2K9X A;  1KM7 A;  4MH8 A;  1R4M B;  2XBB C;  2BT6 A;  3SEB A;  3U2S C;  1JWM D;  1TZ1 A;  5C3J B;  3DDC B;  1AAR A;  2ZCB A;  4W9L A;  1XLQ A;  1T5X D;  3O65 B;  4K81 A;  4KX6 B;  4ANU A;  1TY2 A;  1T0S C;  2D3B A;  4LJO B;  3VUY A;  3GE3 C;  4ZRK A;  1QOA A;  2JUO A;  5IKC M;  1PFD A;  1WJN A;  3AI5 A;  1RYJ A;  4A20 A;  4GIV A;  3RN9 C;  2BS3 B;  1EUV B;  3RMK C;  2NPT A;  4WWM A;  4MH0 E;  5KHQ A;  2WDR B;  3MHS D;  2FID A;  3TEW A;  2SEB D;  1ZDV A;  3JYU A;  4JE3 B;  3HRD D;  2I38 A;  1MHX A;  4KGS A;  2LRW A;  3EEC A;  1ZGU B;  1TS3 A;  2CU3 A;  3RCZ A;  2WX0 A;  4FLH A;  2PIA A;  1JWU D;  2FIF A;  1NEN B;  2NPT B;  1YX6 B;  1XLN A;  3RYT A;  1ZW7 A;  4TKN A;  1P7F A;  4NAW B;  2DAJ A;  2DAF A;  4B9K A;  3P1M A;  3SFE B;  2GMI C;  3AE2 B;  2JSV X;  4XGA B;  4ITK A;  2BS2 B;  2K6D B;  1AW7 A;  1SSN A;  1BML C;  4B0E A;  2FCN A;  1K50 A;  1LGR A;  2DZI A;  3NS8 A;  3SDL C;  4TV3 A;  3NRZ A;  3AEF B;  2LMC A;  3N9Y C;  4C00 A;  1YJ1 A;  1F9J A;  3VH4 B;  3ENE A;  3NZS A;  1QQR A;  1I4H A;  3ZO5 B;  1N5X A;  4TQ0 A;  1RRB A;  2IPK D;  2NBU A;  4MGY E;  5E6N A;  4LTU A;  3HM3 A;  3AE5 B;  2K22 A;  1OEY A;  4JX1 C;  3L17 A;  1FCC C;  2AL6 A;  2VZK B;  1Q5W B;  4C4V B;  2W3S A;  1A5R A;  4CYE A;  3T3O A;  1WZ3 A;  1WFY A;  5AZH A;  2GLS A;  2CKH B;  1V80 A;  1VRA B;  4AWJ A;  1IGD A;  3DHI C;  1EF5 A;  4FN2 A;  4IM3 A;  5DPW A;  2MBQ A;  1IP9 A;  1JW9 D;  1WXM A;  4W9I A;  2W55 A;  1MVK A;  1TYG B;  1R4M I;  2KMM A;  4G50 A;  3AEE B;  1YJJ A;  2Z0E B;  3ALB A;  3RT3 B;  2ZEQ A;  4M00 A;  2REX A;  1OQR A;  4RNA A;  2ONQ A;  2MCN B;  5BMH A;  2ZW0 A;  4NY0 A;  2O6V A;  1FIQ A;  4A90 A;  1Z5S B;  5HFY A;  2Z0D B;  2V1Y A;  2RDB C;  3CWI A;  1WGD A;  2WXM A;  4XWW A;  5C2T B;  2NS5 A;  4B95 A;  1ZOY B;  3MC9 A;  2LGI A;  2ZPY A;  2ASQ A;  1TKY A;  2WXH A;  1C9F A;  2ACZ B;  2J0K A;  4BBN F;  3DBR B;  1D4B A;  1TKG A;  3Q2A C;  5D3I B;  4B6W A;  4RF0 A;  1T0Y A;  4RGM A;  3VTU A;  2QIE B;  4TQ1 A;  1SIJ A;  2B76 B;  3IHP C;  3DCG A;  2K8H A;  3NOB A;  4W9H A;  2BYT A;  1A70 A;  2R2O A;  3KUD B;  1FNW A;  2WXL A;  4XX5 A;  3ZNG C;  3V6C B;  5EE1 A;  4HPM B;  1FXA A;  4DK5 A;  5IAA C;  2MWS B;  3ZTD A;  1YN3 A;  3UQB A;  1YN5 A;  4LCD E;  3O13 A;  5DPS A;  3ZDT A;  2IGG A;  4L2Y A;  1V49 A;  3H8H A;  3R7Q A;  3PZ7 A;  2V4I B;  3EA6 A;  3A4S C;  1VLB A;  1TJE A;  3I3T B;  2YEP F;  4REZ A;  1MFW A;  3WAL A;  2EKE C;  5HKH A;  1J7C A;  1MPE A;  5HG2 A;  2D3C A;  5E6O A;  4NZL B;  3UF8 A;  3EC8 A;  2O6V B;  1I4R A;  1OTR B;  4OVV A;  4DHZ E;  4M01 A;  2SAK A;  3U7D A;  1H8C A;  3W2D A;  1WX7 A;  3DOW A;  3M95 A;  4DXG A;  1ENF A;  3WIM A;  5BMG A;  1KF6 B;  4PYU A;  1QOB A;  2EMT A;  2MJE A;  2FCQ A;  4NJ7 A;  3P2B A;  3WCQ A;  2KN5 A;  1K51 A;  2DYM A;  2AQ2 B;  3VRB B;  1XD3 B;  2KVZ A;  3LJ3 A;  1J0G A;  4M02 A;  1Y8R C;  3PV1 A;  4GXB A;  3W1S C;  2K8C A;  2MW5 A;  3RNB C;  3U30 A;  1C3T A;  2KDF B;  4KIK B;  2KAC A;  3BVG A;  1V1P B;  1IUE A;  1JRP A;  2CU1 A;  2BKR B;  3ZJT A;  5G5H A;  1CJE A;  2WQY B;  3D32 A;  1QKZ A;  3GOE A;  2LXA A;  4CQN A;  1LO5 D;  1ZDX A;  2D2Q A;  2DNF A;  1E6E B;  3ZNH B;  2KWV B;  3ETR A;  1I4G A;  3CMM B;  5BYS A;  2G9H D;  3I57 A;  3DBR I;  4KKI A;  2HD5 B;  2PE6 B;  1XO3 A;  3C8Y A;  2IO0 B;  3ZXV A;  2FUG 1;  2KJH B;  4I6P A;  2BKF A;  2KTR A;  2JYT A;  1VJK A;  2V3S A;  5I4D A;  1VZ7 A;  3Q3O C;  4BOZ B;  4EZL A;  1E10 A;  4HLE A;  1FFU A;  3TEY A;  1S1Q B;  2G3Q B;  2HDE A;  5G2N A;  3VAW A;  2JPH A;  4IWP A;  3CIR B;  3EHV A;  1C4P A;  3SD5 A;  3E9S A;  4ANX A;  3W1Y A;  1YD8 U;  1ZXH A;  2ZW1 A;  1KTK A;  1H4R A;  2K6Q A;  5L95 C;  5GXG B;  2INC C;  2ZPN A;  4MJS B;  1L7Y A;  4RM9 A;  2KFK B;  2HJ8 A;  4W9K A;  1ESF A;  3IFW B;  4FBJ B;  3L10 B;  4IW0 A;  5FR6 A;  1L5P A;  4EFO A;  2IYD B;  3V60 A;  5MPO A;  3BY4 B;  2DYO A;  3OLM D;  2EEL A;  3W5V B;  1WGH A;  3MHZ A;  3U7Z A;  1HQR D;  4PS8 A;  3J9C A;  1VZ8 A;  4PYZ A;  4MSM B;  4YTM B; 
#chains in the Genus database with same CATH homology
 4MSQ B;  2L8J A;  3ZW3 A;  4WWN A;  1E8Z A;  4OVU A;  2M17 A;  3X23 A;  3DVG X;  3VUW A;  3M62 B;  2WX1 A;  4EEW A;  2KQS A;  1P98 A;  5LXI B;  1UGM A;  1LFD A;  1VCB A;  2KXJ A;  3PVL A;  3K9O B;  2CHZ A;  4BKS A;  4ANW A;  2K25 A;  4GDK A;  1I35 A;  2I1J A;  5D7G A;  3H7P A;  3VTV A;  1J8C A;  1KJT A;  2A5U A;  3MTN B;  1KM7 A;  2D11 A;  2M4N A;  3DVN V;  4NQL B;  1OQY A;  5D94 A;  3ZRC A;  1MG8 A;  2JZZ A;  3QJZ A;  1WJ4 A;  2XBB C;  3IBE A;  3QAQ A;  3JW0 X;  1TZ1 A;  3ZRF A;  1WH3 A;  1D3Z A;  3DDC B;  3PRZ A;  2WWZ A;  1AAR A;  1E8X A;  2ZCB A;  1WR1 A;  3DVN U;  4W9L A;  3ZTC A;  3ECI A;  3KYC D;  4DWF A;  3O65 B;  1WIA A;  4K81 A;  4ZYN A;  1HE8 A;  2BYE A;  4ANU A;  1QZE A;  4A3P A;  4LJO B;  2OOB B;  1WYW B;  3VUY A;  3VH3 B;  2ZJD A;  1UBI A;  4ZRK A;  4DDI D;  1NBF C;  2LRU A;  3ML9 A;  3APC A;  2JUO A;  2DHZ A;  2LWP A;  1WE7 A;  1UEL A;  1V9J A;  1VD2 A;  1LXD A;  4HCP B;  3TJP A;  3PT2 B;  3TL5 A;  2BYF A;  1WJN A;  2KQ7 A;  4AUQ C;  3AI5 A;  3QHT A;  2CS4 A;  2LZ6 A;  3DBL I;  4A20 A;  3VFK A;  2DZJ A;  2PEA A;  4GIV A;  5DPR A;  5DCN A;  2RGF A;  2JF5 A;  3B0A A;  1EUV B;  1R4N I;  2NPT A;  4MH0 E;  3ZNZ B;  3NHE B;  5KHQ A;  3MHS D;  3U8Z A;  4DXA B;  4IC7 B;  3KH0 A;  2XK5 A;  2FID A;  4MGK E;  2L0F A;  4W9D A;  4MGZ E;  3JYU A;  3DQV A;  2WDT B;  5LXH A;  2PE9 A;  2KFJ A;  1ZKH A;  3GZN I;  2IY1 B;  4HPL B;  5CTR C;  1YQB A;  2KK8 A;  2UYZ B;  4E3C A;  4EOY A;  2LRW A;  4K7W A;  4N9F 4;  2PJH A;  3RZF A;  3VUX A;  3EEC A;  4JLC A;  1ZGU B;  3RZW C;  2C7M B;  3PRM B;  1E5W A;  5AEK B;  3WA0 A;  5D6J B;  3RCZ A;  2NBV B;  2WX0 A;  4WJO A;  4FLH A;  5EDS A;  2KOX A;  3PRP B;  4CHK A;  2FIF A;  2I1K A;  2M1M A;  5CHF A;  2NPT B;  3RUL A;  1WZ0 A;  3LDZ E;  2KNB A;  1YX6 B;  1K8R B;  4EKU A;  3RYT A;  1NDD A;  1ZW7 A;  3OAW A;  4TKN A;  4LDT D;  4NAW B;  3WAM A;  2DAJ A;  1WRD B;  2DAF A;  4B9K A;  2GMI C;  4NJ6 A;  3ML8 A;  1OGW A;  4MGI E;  2K6D B;  1WE6 A;  4HWI B;  5J17 A;  2KFK A;  2FCN A;  2DZI A;  2EMS A;  2DX5 B;  4BBN C;  2IBI B;  3UIP B;  3NS8 A;  3SDL C;  3WAP A;  4TV3 A;  3V61 A;  4DHJ D;  2N4F A;  1WY8 A;  4F7Z A;  4HCN B;  4MEM A;  3ZIM A;  3KVF B;  4WQO B;  3VVW B;  2OJR A;  1YJ1 A;  2L7R A;  2MBB B;  4FHK A;  4W9G A;  4MDK E;  3UIN B;  2N9P C;  3MJW A;  4K7S A;  1F9J A;  2MRP A;  3VH4 B;  3ENE A;  1L2N A;  3JSV B;  4WAA A;  4W9C A;  2G45 B;  3NZS A;  4EUT A;  3WAO A;  2KDE B;  1EF1 A;  2IO1 B;  2VRR B;  3ZO5 B;  4TQ0 A;  1RRB A;  4BKT A;  3C0R B;  1GC7 A;  1E7U A;  2IY0 B;  4NNJ B;  2NBU A;  4ZDV A;  1V2Y A;  4BKG A;  1GC6 A;  3PHX B;  4MGY E;  5E6N A;  1IYF A;  3B1L X;  3HM3 A;  2KAN A;  1WF9 A;  4TUU A;  1OEY A;  1TTN A;  2ZCC A;  3L17 A;  2AL6 A;  4GB9 A;  4W9F A;  1Q5W B;  3ZNI D;  2KWC A;  3AU4 A;  4EZJ A;  3CSF A;  3M63 B;  1A5R A;  1XQQ A;  1X1M A;  4CYE A;  1EO6 A;  1WZ3 A;  1FXT B;  3TCA A;  1WFY A;  1WMH B;  3N32 A;  5AZH A;  2LAS A;  2CKH B;  2IO2 B;  1WGG A;  1V80 A;  1I42 A;  1WXV A;  3JSV A;  4AWJ A;  3KUZ A;  2KZR A;  1CMX B;  3H1U A;  4BVU C;  2FUH B;  1Q0W B;  1EF5 A;  4FN2 A;  3L16 A;  2N9X A;  4IM3 A;  1XT9 B;  5DPW A;  3IG3 A;  2MBQ A;  1IP9 A;  2XEW A;  1WXM A;  2KD0 A;  4W9I A;  3PRE A;  3PZD A;  2LGY A;  2RR9 A;  4GDL B;  1R4M I;  4F8C B;  2HE7 A;  4KZC A;  4BFR A;  4G50 A;  4BOS C;  3X0W A;  2Z0E B;  3ALB A;  2WYQ A;  1E90 A;  3RT3 B;  4F1S A;  3KYD D;  2D10 A;  2FCS A;  2ZEQ A;  2REX A;  4ZRI A;  1RFA A;  4GSW A;  2J0M A;  3WAN A;  2MCN B;  3V62 A;  1V6E A;  2DZK A;  4NY0 A;  3TBL D;  5TR5 A;  1BT0 A;  2JXX A;  2O6V A;  5IA7 A;  2RSU A;  1Z5S B;  2Z0D B;  3R3M A;  4A3O A;  2D07 B;  3W1S A;  2L05 A;  2V1Y A;  2NCN A;  3QIJ A;  1TBE A;  1WGD A;  1WM2 A;  2KC2 A;  2KX0 A;  2L0T A;  3Q3J A;  3VHT C;  1WGY A;  4CO7 A;  2NS5 A;  4B95 A;  1P0R A;  4WJQ A;  3SHQ A;  3VXW A;  3PS6 A;  2ZPY A;  1UH6 A;  2O6V D;  4E71 A;  1JRU A;  2ASQ A;  3CF6 E;  5E6P A;  3PHW B;  4MEL A;  2Y5B B;  4FJY A;  5C1Z A;  2J0K A;  3L08 A;  2MP2 A;  4BBN F;  2FNJ B;  2L00 B;  2BWF A;  1P1A A;  2NVU I;  3A9J A;  4GMV A;  3VTW A;  3S2A A;  1GG3 A;  2MX2 A;  4B6W A;  3A33 B;  1M94 A;  2CHX A;  1T0Y A;  1TGZ B;  2DYB A;  4KVG B;  3VTU A;  2MQJ A;  1P9D U;  2AEH A;  2LI5 A;  4GGQ A;  2C60 A;  2KJ6 A;  4TQ1 A;  2NR2 A;  3HM6 X;  2IO3 B;  3IHP C;  4FHJ A;  3DCG A;  2K8H A;  3PLV A;  3NOB A;  4W9H A;  1WX9 A;  4KV2 A;  1Q1O A;  2C7N B;  1PQS A;  2L76 A;  2R2O A;  3KUD B;  2CHW A;  5AZF A;  1WMH A;  2KKC A;  4XX5 A;  3QA8 A;  3ZNG C;  3V6C B;  1P3Q U;  4HPM B;  2KC1 A;  2XK5 B;  5CX3 A;  4DK5 A;  3H6N A;  3A9K A;  4IG7 B;  5IAA C;  2MWS B;  2HTH A;  4PS3 A;  3ZTD A;  2UWQ A;  4KSK C;  3A4R A;  3APF A;  3UQB A;  4LCD E;  2MLB A;  3QC8 B;  1WXA A;  2IZV B;  4XZ4 A;  3NZU A;  3K9P B;  3M3J A;  5DPS A;  4URK A;  3HIZ A;  2KTF A;  4MJS A;  1UZX B;  2LVP A;  1S3S G;  3ZDT A;  4II2 B;  5JHB A;  1V49 A;  3AU5 A;  2LUE A;  2V4L A;  3R7Q A;  4NAW A;  3ZKJ C;  4FJV B;  1GNU A;  1GJZ A;  1E7V A;  2KO3 A;  5BO4 B;  3H7S A;  2JY6 A;  4ZRJ A;  4PS7 A;  4GN1 A;  3A4S C;  2LD9 A;  3I3T B;  1E8W A;  2JWZ A;  2K8B A;  4AJY B;  4DBG A;  3WAL A;  2O2V B;  2EKE C;  3QCA A;  4HXD A;  2MA9 B;  4WJN A;  2KWU B;  5HKH A;  1LM8 B;  4W9J A;  1KOT A;  2N7E A;  4P7I A;  4FJZ A;  1SIF A;  3BIN A;  4G0N B;  3RUI B;  5E6O A;  1YX5 B;  2AYO B;  4I6N B;  2YVC A;  4I6L B;  3UF8 A;  3AUL A;  3EC8 A;  2O6V B;  2M8S A;  2JVC A;  3VDZ A;  2G4S A;  2K39 A;  3B08 A;  2YLM A;  5AZG A;  3L0W B;  1OTR B;  4GOC A;  2KJR A;  2LXC A;  5CHV C;  4OVV A;  4DHZ E;  4X57 B;  4ICV A;  3U7D A;  1H8C A;  1WX7 A;  2QHO A;  1WJU A;  2K1F A;  3DOW A;  3M95 A;  2CR5 A;  2J0J A;  3V6E B;  3OJ4 B;  4E74 A;  1RAX A;  1J19 A;  2GBR A;  2KTR B;  2Z59 B;  2LVQ A;  3DBH I;  3WIM A;  1SGH A;  4PYU A;  5G55 A;  4BKS D;  2O2V A;  1RLF A;  2EMT A;  4WJP A;  2FCQ A;  3APD A;  4NJ7 A;  2AL3 A;  3T8M A;  3QQ8 B;  4ASW C;  3P2B A;  3QAR A;  2NBW B;  4NPN A;  2KN5 A;  1V5O A;  2C7H A;  1UBQ A;  3UGB B;  2DYM A;  1NI2 A;  2DZM A;  2ZVN A;  1XD3 B;  4LJP B;  2N1V A;  4WWO A;  3LJ3 A;  3QX1 A;  1SE9 A;  3A9K B;  4AOF A;  1J0G A;  4HJK A;  4RM8 A;  4WWP A;  2GBM A;  2L3Z A;  4HDQ A;  2JT4 B;  1Y8R C;  3PV1 A;  2BYV E;  4AP4 C;  1ISN A;  4GXB A;  3DVG Y;  4G11 A;  4LDT B;  1U4A A;  3ZDM C;  2ZVO A;  3KUC B;  3A9J B;  3W1S C;  2K8C A;  2MBO A;  2KX3 A;  2MW5 A;  2GOW A;  2LGX A;  4IM0 A;  5KHO A;  3U30 A;  3AXC A;  1C3T A;  2KDF B;  2G4D B;  4NQK E;  1WI0 A;  1OEY J;  3T9L A;  3HHM A;  3H9D A;  4KIK B;  2KLC A;  2KLG A;  2JZ3 B;  5D2M B;  2CU1 A;  2BKR B;  4IM2 A;  2MP2 B;  4ANV A;  2BWE S;  5JZE B;  3D32 A;  1IPG A;  2C9W B;  3GOE A;  2LXA A;  3ZVV A;  4K7U A;  4KZ0 A;  4HDO A;  4YL8 A;  3A1Q B;  2D2Q A;  4G3X B;  2RD0 A;  3PGE A;  1V86 A;  2GBN A;  3IVF A;  4M0W B;  3OJ3 A;  4W9E A;  2MSE D;  4DDG D;  2BPS A;  2BGF A;  3ZNH B;  5JHA A;  1GUA B;  2N7D A;  2KWV B;  4FUL A;  1C1Y B;  2KDB A;  4FA6 A;  4GU2 A;  3CMM B;  4HVB A;  4GDK B;  2M0X A;  2KDI A;  3DBR I;  2N1W A;  2A4Z A;  2JRI B;  2HD5 B;  3PSE B;  5J2R A;  1LQB A;  4JIO U;  5J18 A;  2PE6 B;  4JGH B;  4KIK A;  2D3G A;  3HK0 A;  2AWT A;  4J6I A;  1KLV A;  2IO0 B;  3L54 A;  2KJH B;  4KDL B;  4I6P A;  2LVO A;  3QWZ B;  1WXS A;  2MBE A;  2KTR A;  2BKF A;  2V3S A;  4XC2 A;  3TIX A;  4M8M A;  2GBK A;  2RPQ A;  4BOZ B;  4EZL A;  3R66 C;  4K1R B;  4HLE A;  2JRH A;  4FAD A;  1S1Q B;  1WM3 A;  2FAZ A;  2PPH A;  2B3A A;  3PTF C;  2G3Q B;  3L13 A;  5L83 A;  2ZNV C;  2J7Q B;  4JQW C;  5G2N A;  3VAW A;  3N3K B;  3RD2 A;  3UIO B;  1Z2M A;  2JPH A;  1UD7 A;  4IWP A;  4DHJ B;  1WGR A;  2KMC A;  3KW5 B;  2GBJ A;  2BF8 B;  4ICU A;  3EHV A;  1E8Y A;  3JVZ X;  4IWQ A;  2KMA A;  3ZUN A;  1G6J A;  2LJ5 A;  3SD5 A;  2DEN B;  4ANX A;  3W1Y A;  1WX8 A;  1YD8 U;  2C5L C;  1H4R A;  2K6Q A;  4HK2 A;  4DHZ B;  5L95 C;  1WJ6 A;  2FCM A;  2KHW B;  2N9E B;  3VQI A;  2ZPN A;  4MJS B;  4M8N A;  1L7Y A;  1YIW A;  5CHW A;  4RM9 A;  2KFK B;  2HJ8 A;  4EZK A;  4W9K A;  4IWO A;  4GDL A;  5DPT A;  5C23 A;  3CST A;  2ZNV B;  3IFW B;  3SU8 X;  4MM3 A;  4FBJ B;  3L10 B;  4IW0 A;  3R7R A;  5FR6 A;  2MBH A;  2LGD A;  3TMP B;  3ONS A;  4JL9 A;  4RMA A;  3DBS A;  5LLI A;  1V5T A;  3A1Q A;  2IYD B;  2R2Q A;  3H7P B;  4EFO A;  3V60 A;  2ZZP B;  3BY4 B;  2DYO A;  3OLM D;  5JH5 C;  5GMV A;  3PLU A;  1WGH A;  2W9N A;  4IUM B;  4AJW A;  1V81 A;  3QK0 A;  4KDI C;  3EFU A;  3PPA A;  4II3 B;  3N30 A;  4PS8 A;  3NY5 A;  2KVR A;  3DPD A;  3Q3F A;  3UQA A;  4KSL C;  3ZLZ A;  4PYZ A;  4MSM B;  1WR6 E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...