5CHWA

Structure of isg15 in space group p212121
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
154
structure length
154
Chain Sequence
AWDLKVKMLGGNDFLVSVTNSMTVSELKKQIAQKIGVPAFQQRLAHQTAVLQDGLTLSSLGLGPSSTVMLVVQNSSEPLSILVRNERGHSNIYEVFLTQTVDTLKKKVSQREQVHEDQFWLSFEGRPMEDKELLGEYGLKPQCTVIKHLRLRGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ubiquitin-like protein ISG15
publication title Structure of ISG15 in space group P212121
rcsb
source organism Mus musculus
molecule tags Signaling protein
total genus 37
structure length 154
sequence length 154
chains with identical sequence B, C, D, E, F, G, H, I, J
ec nomenclature
pdb deposition date 2015-07-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00240 ubiquitin Ubiquitin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 5chwA02
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 5chwA01
2LGYA 2J7QB 1OEYJ 3PGEA 2KO3A 3WALA 4DDID 1Q0WB 4F1SA 3DPDA 1KM7A 3MTNB 2DYOA 4XZ4A 4JLCA 5DPRA 4MELA 1F9JA 4MGZE 4HK2A 4BFRA 2KDBA 5L95C 2IY1B 3CF6E 1CMXB 3L54A 2IO2B 4K7WA 4JIOU 4P7IA 2D2QA 4WWPA 4MH0E 2REXA 2JPHA 2NCNA 3D32A 4G50A 3V6EB 2JUOA 3JYUA 4GIVA 4B95A 2KX3A 4HVBA 4XX5A 1WXVA 3HM6X 1VD2A 4I6LB 3W1SA 1WM3A 2D10A 2IBIB 2DZKA 2MP2B 2N7EA 2NBWB 3DVGX 4PYZA 2ZCBA 2FCQA 1RFAA 2PPHA 3NZUA 4PS3A 2KWVB 4DBGA 2KANA 5E6OA 5JZEB 2NBVB 3V62A 3VH3B 4W9LA 3M62B 4BKGA 1WH3A 4HDQA 4TUUA 3TJPA 4E74A 5G55A 2LVOA 2MBEA 2KDFB 1XQQA 1V86A 3M95A 3L08A 2OOBB 1WIAA 4OVVA 3WAMA 3M3JA 3UQBA 4W9KA 3I3TB 4DK5A 3PLVA 1XD3B 4NAWA 3UIOB 2FCNA 2V3SA 4OVUA 3H1UA 4M8MA 3VH4B 3PRZA 1WJUA 2ZCCA 2JWZA 2HJ8A 3CMMB 4W9IA 2YVCA 3NHEB 1ZW7A 2RPQA 3A9KA 3RD2A 3RYTA 4A3OA 1K8RB 4BBNF 3DCGA 1R4NI 5BO4B 3PLUA 3ZUNA 2ZJDA 2LUEA 2WX1A 2M17A 1S3SG 2O2VB 4FN2A 4KDIC 4GN1A 3EFUA 2BWES 1RRBA 2FCSA 2LXCA 3SHQA 1GUAB 2GBRA 2A5UA 1UD7A 4EZLA 2KFKB 1LFDA 4AP4C 2KVRA 3DQVA 1LQBA 1UGMA 2KHWB 4HXDA 3TCAA 3JW0X 3PSEB 2FCMA 1UBQA 3ONSA 3DDCB 1WGYA 2N7DA 2AWTA 2V1YA 3X23A 2C7MB 2O6VA 4AJWA 4ANUA 4NQLB 3VXWA 1LM8B 1WX7A 2JRIB 4MDKE 3IG3A 3PREA 2LWPA 1P98A 3KUZA 1WMHA 5CHFA 1HE8A 3PHXB 3X0WA 1WE7A 4A3PA 2N9XA 3L17A 1WR6E 2JT4B 4NY0A 4JGHB 4ZRJA 1EF5A 3Q3FA 2KNBA 4KSKC 2CKHB 1UH6A 3AI5A 2JXXA 4CHKA 2ZZPB 2CHXA 4MSMB 2KDIA 1WXAA 2R2OA 4M8NA 4NQKE 1Z2MA 3ZRFA 3L0WB 3VVWB 2IO1B 2GBJA 3K9PB 3Q3JA 2CR5A 3PPAA 4ANVA 4BOSC 4EZJA 1LXDA 3L13A 2W9NA 3ZLZA 4YL8A 3ALBA 2G3QB 4WJOA 4BKSD 4FADA 1IYFA 2KOXA 1E90A 3MHSD 2K8CA 3VTWA 1X1MA 1WGGA 3VAWA 2NPTA 4ZRKA 2RGFA 4HCNB 4WQOB 3VHTC 4IWOA 2CHZA 5TR5A 1GC7A 3VFKA 2YLMA 4F8CB 2MSED 1ZGUB 3VUYA 3OJ4B 1YX5B 4GGQA 2XK5A 3DBHI 3ZDMC 3QX1A 3NOBA 4K1RB 3W1YA 2LGDA 5C1ZA 1UZXB 2N4FA 2NVUI 2Z59B 4DHZB 3EHVA 4ICUA 3TL5A 2BYVE 2EKEC 4W9EA 5D6JB 2K8BA 1TZ1A 5J2RA 2JY6A 2GOWA 5AEKB 2L05A 3QA8A 4NNJB 1T0YA 3S2AA 2KKCA 2MW5A 4KIKB 1TGZB 3RT3B 2KC1A 4HLEA 2MCNB 1BT0A 4IWQA 4X57B 2GMIC 2BWFA 4MGKE 2D07B 3U7DA 1WM2A 1YQBA 2KLCA 2VRRB 2M8SA 4FLHA 2LRUA 1XT9B 1J0GA 4MEMA 4DXAB 3A1QB 2M1MA 4EOYA 5LXIB 5L83A 4GB9A 1WGHA 2FIDA 4DDGD 2A4ZA 2LI5A 1KLVA 3UGBB 3B08A 3UQAA 2PJHA 4FHKA 1GG3A 1OGWA 2LRWA 3ENEA 2K1FA 3ECIA 4HJKA 3M63B 4GDKB 3GOEA 2MBQA 3WAOA 2KJHB 1WX9A 2KTRA 2JVCA 1I35A 3W1SC 2L8JA 3R3MA 1V9JA 1YX6B 2I1JA 4IG7B 3R7QA 4FHJA 2L0TA 4XC2A 3CSFA 2C5LC 2N9PC 1I42A 1E7VA 2LVQA 2K39A 3PZDA 3H7PA 3C0RB 1WJ6A 3RZWC 2C9WB 1UBIA 4ASWC 4M0WB 3HK0A 5CHWA 4GXBA 3DVNV 4TQ0A 4KIKA 3VUXA 1AARA 2BKRB 4A20A 3NS8A 2XEWA 2R2QA 4ZRIA 1R4MI 4E71A 2IZVB 2ZVOA 3BY4B 2UYZB 2GBNA 3BINA 5CTRC 3UINB 2BGFA 3A33B 4II3B 2KMAA 4RM8A 1V49A 5KHQA 1V5OA 4LDTB 3HM3A 2L76A 2DHZA 2ZPNA 4AOFA 2EMTA 3A9JB 4GDLB 4MM3A 2FUHB 2GBMA 3T8MA 3ZRCA 3AXCA 4NJ7A 4ANXA 2AYOB 3QJZA 1H8CA 2BYEA 4K81A 3ZNGC 2MP2A 1UELA 3CSTA 4B6WA 3AULA 3R7RA 5JHBA 1L2NA 2EMSA 3EC8A 3QARA 1EF1A 2UWQA 4HWIB 1C3TA 5LXHA 4ZDVA 1WRDB 3VUWA 4F7ZA 3QQ8B 4B9KA 3ZTDA 3PT2B 4KV2A 4TV3A 5J17A 1RAXA 1WJNA 2D11A 3KUDB 2G4SA 4GMVA 4II2B 4HCPB 1JRUA 2M0XA 4ZYNA 1KJTA 1L7YA 1WYWB 3ML8A 2MLBA 4IM2A 3PTFC 4IC7B 2JZZA 2K25A 3KUCB 1E5WA 2Z0EB 3ZNHB 2DENB 2IYDB 2ZNVB 4BKSA 5HKHA 4TKNA 5AZFA 1S1QB 3V60A 3QCAA 1Z5SB 3ZTCA 3IBEA 4HPMB 3DVGY 1Y8RC 2PEAA 4KVGB 2O2VA 1C1YB 3JSVB 3ML9A 3A4SC 4URKA 2KQ7A 4GDLA 2DAFA 1FXTB 3TMPB 1EUVB 4PS7A 2KFKA 5EDSA 4TQ1A 3B1LX 3APDA 3N32A 4FBJB 1IPGA 1Q5WB 1TTNA 2IO3B 4WWNA 4FA6A 2G45B 3UIPB 4LDTD 2K8HA 2KXJA 3KYCD 3VDZA 2KWUB 1GJZA 2O6VD 1V6EA 3HHMA 2J0MA 1U4AA 3IFWB 3KYDD 1WX8A 4LCDE 2FAZA 3PRMB 1P0RA 2I1KA 3RCZA 3OJ3A 3ZW3A 2L3ZA 1Q1OA 1KOTA 1WZ0A 2C60A 3WIMA 2WDTB 2AEHA 2LXAA 4HDOA 5IA7A 2L7RA 4IUMB 3IHPC 4W9JA 3H6NA 3WANA 1E7UA 3LDZE 4KZCA 2AL3A 2MRPA 4I6NB 5E6NA 3SD5A 1WE6A 3HIZA 2HD5B 3N30A 1WY8A 3QWZB 4MJSB 2RR9A 4FJYA 2KZRA 1SIFA 1WGDA 4G0NB 3AU5A 2IO0B 4K7UA 1WXSA 2WYQA 4I6PA 5LLIA 5D94A 1P9DU 1NDDA 2LZ6A 3KVFB 1WFYA 4W9GA 2MWSB 1P3QU 3OLMD 3UF8A 1OEYA 3PRPB 1VCBA 3GZNI 4WWOA 3RZFA 2KTFA 4ANWA 4KZ0A 4HPLB 1H4RA 3ZVVA 2ZEQA 3SDLC 3ZDTA 2KLGA 2ZVNA 3A9KB 4IM3A 1J19A 2ZPYA 3DVNU 1V80A 2LD9A 4JQWC 2KD0A 3P2BA 1E8WA 3U8ZA 4GOCA 3WA0A 2RSUA 2MA9B 5JH5C 4NJ6A 2FIFA 4RM9A 4EEWA 2N1VA 2L00B 1V81A 5J18A 2CHWA 4IWPA 4KSLC 4WJPA 2M4NA 2BKFA 4WJQA 3ZNZB 1WF9A 4BBNC 3APFA 2DZIA 4MGIE 4NPNA 4MJSA 3A1QA 1SGHA 2OJRA 2KFJA 4N9F4 2V4LA 2O6VB 4J6IA 2PE6B 2GBKA 1NBFC 4G3XB 1WJ4A 4JL9A 4DHJB 1YJ1A 4GSWA 2DAJA 1WMHB 3PV1A 1NI2A 1MG8A 3DBSA 4GDKA 3H9DA 1PQSA 3QC8B 3OAWA 5KHOA 1SE9A 2C7HA 3DBRI 3ZNID 5FR6A 2HE7A 1A5RA 3VTVA 3QAQA 5DCNA 2KJ6A 3B0AA 1YIWA 2IY0B 1P1AA 3VTUA 1WXMA 4W9FA 3ZIMA 5DPTA 4CO7A 2KJRA 4LJOB 4DWFA 2J0KA 2KN5A 3U30A 3MJWA 2LJ5A 4EZKA 2PE9A 2AL6A 3L16A 5D2MB 5D7GA 1V2YA 1M94A 3ZO5B 1ZKHA 1EO6A 1TBEA 1OQYA 2NPTB 5G2NA 2JZ3B 4FJVB 1YD8U 1V5TA 2DX5B 2Y5BB 2MBHA 4AJYB 2KX0A 4PYUA 2D3GA 4KDLB 4EKUA 4RMAA 2JRHA 4PS8A 2LASA 1WGRA 2K6QA 3SU8X 2XK5B 4E3CA 4AUQC 4FULA 1E8YA 3A9JA 3KH0A 1GC6A 4W9HA 2BPSA 5CX3A 2KMCA 3L10B 4WJNA 4AWJA 4EFOA 2KK8A 4ICVA 2BF8B 1ISNA 3RUIB 4MSQB 2BYFA 3APCA 5DPWA 3TBLD 2C7NB 3PHWB 2J0JA 2N9EB 2LGXA 2RD0A 3H7SA 4BVUC 1WR1A 3VQIA 2JF5A 2KWCA 4LJPB 2DZJA 4DHJD 1E8XA 1J8CA 3AU4A 3NZSA 2HTHA 2G4DB 1GNUA 5C23A 4DHZE 5E6PA 3LJ3A 1IP9A 5AZHA 2CS4A 3N3KB 4W9CA 2MBBB 4G11A 2MBOA 3NY5A 3QHTA 5CHVC 1E8ZA 4MGYE 3V6CB 1D3ZA 3A4RA 3QK0A 2Z0DB 2NBUA 4K7SA 5GMVA 3IVFA 2WWZA 3PVLA 2N1WA 4GU2A 4EUTA 2KTRB 2KQSA 4WAAA 1OTRB 2ZNVC 4CYEA 2LVPA 4IW0A 2WX0A 2DYMA 3O65B 3QIJA 4IM0A 5DPSA 2DYBA 5JHAA 1WZ3A 3JSVA 1G6JA 3K9OB 2CU1A 2ASQA 2NR2A 3DBLI 3JVZX 3R66C 2B3AA 2K6DB 2MX2A 2KC2A 5IAAC 5AZGA 4BOZB 3WAPA 2MQJA 3H7PB 3V61A 3ZKJC 3T9LA 3RULA 2KDEB 1RLFA 3EECA 3KW5B 2FNJB 1WI0A 2DZMA 2NS5A 4W9DA 3TIXA 1QZEA 3DOWA 4FJZA 2QHOA 3PS6A 4BKTA 2L0FA 2XBBC 4NAWB
chains in the Genus database with same CATH superfamily
2LGYA 4OZAA 2J7QB 3PGEA 5BMGA 3OG5A 4YWGG 1FXIA 3ZJVA 4KX6B 3CF6E 4K7WA 2IO2B 2NCNA 1KF6B 3V6EB 2JUOA 3JYUA 4GIVA 4HVBA 3HM6X 1J7AA 2IBIB 3EUB2 2N7EA 4RF1A 4PYZA 3P4QB 4PS3A 1MHHE 1E7PB 2WS3B 3NJTA 4NJCA 3V62A 1JWBD 4OVZA 4HDQA 4E74A 1YQ3B 1V86A 3B2FA 3HVZA 3UQBA 1R4MB 2BW2A 2YVCA 2RPQA 3Q69A 1SBBB 3DCGA 1R4NI 3ZUNA 2ZJDA 3EFUA 2BWES 1RRBA 2FCSA 3ZGZA 4XWWA 2A5UA 1XO3A 1KH0A 4ZRPA 3B9JA 4AP4C 1UWXA 2MJDA 4C00A 1N61A 2BTEA 3Q6BA 3DDCB 4ZOHC 2N7DA 1MFWA 3MC9A 3X23A 2C7MB 2O6VA 4ANUA 4NQLB 3DWMA 3IG3A 2LWPA 2M56B 1WMHA 2INNE 3PHXB 4A3PA 4RH6A 3L17A 1WR6E 1YMHE 2JT4B 1HXYD 4JGHB 2NMQA 2KNBA 2B76B 2ZZPB 1OQQA 3N1YC 1TS5A 4ANVA 1E10A 1JCKB 3PPAA 3ZLZA 4YL8A 3W2DA 4A6QA 4K3BA 3MHSD 1E90A 1GOZA 4XE0A 5JXVA 3UI3A 2JXTA 1TJEA 4ZRKA 2J53A 1D5XC 2RGFA 4HCNB 1ZPSA 3VHTC 1KTKA 1ZGUB 4GGQA 4REZA 3DBHI 3NOBA 3W1YA 5C1ZA 2LGDA 2GI9A 2N4FA 4KKJA 5GXGB 2KAJA 3TL5A 2IGHA 5D6JB 2L05A 5HHDG 2E6XA 3S2AA 1I4XA 1NYRA 1C78A 4KIKB 4LNOA 3VRBB 2KC1A 2MCNB 1BT0A 2Y5PA 1V97A 4X57B 4MGKE 4HEA1 1D5ZC 1NVID 1WM2A 2N9LA 2KLCA 1GB4A 1GB1A 1I4RA 1J0GA 4IKGA 1ZE3D 1FNUA 1I7HA 3C19A 2A4ZA 3ZYYX 1NENB 1YJJA 1KLVA 3MHZA 3B08A 3GZNB 1GG3A 2LRWA 3PZ7A 1ZDXA 3WAOA 1D6EC 2V9HA 1YX6B 1ZXHA 2L32A 2I1JA 3R7QA 2L0TA 1HTQA 3CSFA 2N9PC 2FBWB 1E7VA 3FAHA 2PVGC 2LVQA 3H7PA 4MH8A 1WJ6A 3DVNV 4TQ0A 1SE2A 4ZRIA 1QOAA 3GE8C 2I2YA 3ZXRA 4C4VB 5MPOA 4AOFA 4MM3A 2ACZB 2GBMA 4ANXA 2AYOB 2H89B 5T8IA 2BYEA 4K81A 1UELA 3CSTA 1MHXA 1L2NA 5BYRA 5JHBA 3EC8A 3QARA 2L1AA 1C3TA 1YN5A 3I9V1 4OZBA 3QQ8B 3VR9B 1JROA 3ZTDA 1FCLA 4KV2A 4BZAA 4B0MA 3FILA 1RAXA 3N1XC 1F52A 4N58A 5FR3A 1KJTA 1WYWB 4N59A 2D5GA 1HA5A 4IC7B 2JZZA 2K25A 5HKHA 4BKSA 3NS1A 1Z5SB 3IBEA 3ETRA 4HPMB 3N9YC 2KN4A 2LEKA 3BYTB 3A4SC 1F1HA 2KFKA 5EDSA 3B1LX 1VZ7A 3N32A 1IPGA 1Q5WB 1TTNA 2IO3B 1VZ6A 2G45B 3VDZA 2O6VD 1VJKA 1XLQA 2WU2B 3OJ3A 1Q1OA 4US9A 2C60A 2WDTB 1YN3A 2LXAA 4MACA 5IA7A 3KLSX 2JSVX 4W9JA 3WANA 1E7UA 1KLGD 2KACA 4R3DA 3HIZA 2HD5B 1WY8A 1K50A 4MJSB 4G0NB 3AU5A 1C77A 5D94A 1P9DU 2XNAC 3KVFB 1JMLA 2MWSB 2OHFA 1P3QU 3UF8A 1OEYA 3P1MA 2KT7A 4WWOA 4M00A 3ZVVA 2ZEQA 3SDLC 2KLGA 5AUIA 2ZVNA 3RI7C 3DVNU 1UUPA 4AQ7A 1SJED 3RNGC 2AQ1B 2WXMA 3J9CA 3WA0A 2MA9B 5TSSA 4NJ6A 2IGDA 4RM9A 4EEWA 1UNSA 1T5XD 3O13A 2V4IB 2BKFA 4WJQA 1WF9A 2WXKA 4BBNC 3NG0A 4MGIE 1HZ5A 4N9F4 2O6VB 1WSPA 4J6IA 2GBKA 1NBFC 3KWLA 3AE4B 2DLBA 2DAJA 1WMHB 1ZXIA 4S0RA 1NI2A 3H9DA 3OAWA 5KHOA 3W5VB 1R4NB 1YIWA 3VTUA 4W9FA 3ZIMA 2KJRA 2KN5A 4M0WA 1ENFA 2IJ0A 2PE9A 3Q3OC 1M94A 3ZO5B 1ZKHA 2MJEA 3I57A 1YD8U 2DX5B 4AJYB 3T3OA 3SU8X 2DWQA 4AUQC 4FULA 2YEPB 4A8XC 4P1CC 2BPSA 3EGRA 1FFVA 2BF8B 1ISNA 3TBLD 1L6VA 2J0JA 3AE9B 1TT5B 4LLGM 3W9CB 4BVUC 2JF5A 3N1ZC 3AU4A 3NZSA 2HTHA 1GNUA 1M4VA 3LJ3A 1WRIA 3Q8EA 4G11A 3NY5A 2J42A 3L4PA 2WDVB 1D3ZA 3A4RA 5GMVA 2N7JA 2WWZA 2N1WA 1F77A 1OTRB 2TSSA 2NTSA 2WX0A 4IM0A 3FC4A 2CU1A 3R66C 2B3AA 2KC2A 5IAAC 5AZGA 4BOZB 3SEBA 2MQJA 3H7PB 3ZKJC 4WQMA 3DHIC 2PMVA 3TEWA 3WALA 4DDID 3Q8CA 1Q0WB 4F1SA 3Q14C 1KM7A 2G1EA 2WXOA 1MVKA 1K53A 4MELA 4MGZE 5L95C 4S17A 3HVDA 4WWPA 4YSYB 2JPHA 3D32A 4G50A 4B95A 2WQYB 3CWIA 1VD2A 4I6LB 1WM3A 2D10A 2FCQA 4IOIE 2PPHA 3AN1A 2N9KA 5D3DA 1QF6A 4BKGA 3BZDB 1WH3A 3FILB 5G55A 1L0YB 2LVOA 2MBEA 3V05A 4OVVA 5IP4D 3WAMA 1F2RC 3M3JA 4DK5A 3I3TB 1XD3B 1PGXA 4NAWA 1YOVB 2FCNA 2V3SA 4OVUA 4M8MA 3UIOB 3VH4B 1HZ6A 3CMMB 3RYTA 1ZW7A 2I38A 3RD2A 1K8RB 4BBNF 1V1OA 3Q8AA 3PLUA 1I4PA 1S3SG 4KDIC 1MPEA 2LXCA 1GUAB 2KFKB 3FKYA 2BS2B 1AYFA 4HXDA 3TCAA 1VDVA 2FCMA 3AE1B 4LNIA 1YQ4B 3VXWA 3P42A 1RFKA 3KUZA 1P98A 5CHFA 2N9XA 4WURA 3CIRB 1EF5A 3AEEB 1UH6A 2JXXA 5BMIA 1QKZA 4XDDA 1TY2A 4NQKE 2MHJA 3ZRFA 1Z2MA 4EZJA 1LXDA 3AMZA 3E9SA 2MJ3A 1BMLC 1TYGB 2K8CA 1X1MA 2HTME 2RDHA 3OWEB 4IWOA 5TR5A 3AEBB 4F8CB 3IXSA 4WAFA 3VUYA 3OJ4B 5G5HA 3ZDMC 2XK5A 3AV8A 2NVUI 4DHZB 2EKEC 4AS1A 1DOXA 5AEKB 2LMCA 4NNJB 1T0YA 1DGJA 4D2KA 2KKCA 2MW5A 1TGZB 3RT3B 1ET9A 1QLBB 1EU4A 3U7DA 4DXFA 3P63A 3AE8B 1P7FA 4MEMA 2LHDA 3LB8C 4EOYA 4JE3B 4FXCA 3TEYA 1L4ZB 1SXTA 2H88B 3GS2A 2MBQA 2JX5A 2OJWA 2KJHB 2KTRA 4YTMB 2JVCA 2Q5WD 4DQOC 2EELA 1YJIA 3MC0B 4TMAB 1C4AA 4O1NA 4NZLB 2WXHA 2M0AA 4ARIA 4ASWC 4M0WB 5CHWA 1JWUD 4NAMA 1N5WA 3VUXA 2XEWA 2R2QA 4B0EA 2IZVB 3U7ZA 4KGRA 2BGFA 4RM8A 1V5OA 4LDTB 3HM3A 2GRIA 2L76A 2DHZA 1EWYC 4GDLB 3ZRCA 1PGBA 2MP2A 4B6WA 4N6EB 1EF1A 1EWCA 1VLBA 2RDGA 4CQNA 3VUWA 4F7ZA 4LNNA 1JQ4A 3PT2B 3URYA 2WDRB 3KUDB 1WJNA 2D11A 4GMVA 2G4SA 1F0ZA 4II2B 3SFDB 1D4BA 4HCPB 2FUG1 2GLSA 2WHIA 1L7YA 3PZ8A 3H8HA 3ML8A 2MLBA 3KUCB 3RPFC 2DENB 2IYDB 5AZFA 3NZ3A 3R2IA 3V60A 2K5PA 2VH1A 2O2VA 3NRZA 2KQ7A 2DAFA 3V3XA 3RN9C 4JWSC 4WWNA 3UIPB 3KYCD 1GJZA 3WCQA 3IFWB 1DOYA 2FAZA 2KMMA 3PRMB 1P0RA 3HUIA 2W3RA 4J3OD 1VR9A 3WIMA 1B9RA 1C4PA 2AEHA 2L7RA 4IUMB 1L5PA 3H6NA 4ZHOA 2J4XA 3E56A 4YSXB 2AL3A 2MRPA 2JWUA 1R7SA 1WE6A 3N30A 2RDBC 1BUIC 3TSSA 1SIFA 1WGDA 2CJNA 4I6PA 3W5UB 1XF5L 5LNK1 1NDDA 2LZ6A 1WFYA 4W9GA 3PRPB 1VCBA 4HPLB 3ZDTA 5IOIA 1YN4A 1J19A 3ABVB 3NVZA 3Q8BA 1PDXA 1PGAA 4JQWC 2KD0A 3P2BA 2RSUA 3T3NA 1UGJA 2FIFA 4BAXA 4IWPA 4WJPA 1ESFA 3ZNZB 1LO5D 4NPNA 3A1QA 5C3JB 4ZHPA 2KFJA 2V4LA 2PE6B 3IT6B 2EKIA 1FCCC 3PV1A 1DOIA 3DBSA 4GDKA 2LUMA 1SE9A 3ZNID 1TS2A 5DCNA 2KJ6A 1P1AA 4YTNB 1HEZE 1FRDA 2LJ5A 4JWUC 5D7GA 5D2MB 1GAQB 3U4EG 1EO6A 4ZYSA 5G2NA 2JZ3B 1KFYB 2Y5BB 2KX0A 1CJEA 1WGRA 2XK5B 1IBXA 3Q3MC 3A9JA 4W9HA 4AWJA 4ICVA 2WP9B 5BYQA 2K9XA 3APCA 4RF0A 2SAKA 4WWMA 1TIFA 2R61A 3VQIA 2BT6A 2W54A 4LJPB 4RGNA 5C23A 1LGRA 2CS4A 3AE7B 3QHTA 1XLOA 5HI1A 4MGYE 3QK0A 4HKQA 2Z0DB 1JRPA 3PVLA 4GU2A 4EUTA 2KTRB 1N6ZA 4IW0A 2DYMA 2ON8A 4IDIA 2K22A 3SFEB 3IAM1 4HROA 3DBLI 2AQ3B 2MX2A 1FNVA 1L0XB 3MP9A 3V61A 1RLFA 2VH2A 2FNJB 2LGIA 2LHEA 4W9DA 2KQ4X 1QZEA 3DOWA 4FJZA 2QHOA 2L0FA 4ANWA 2KO3A 1V8CA 2DNFA 3DPDA 2DYOA 4XZ4A 2WXRA 4JLCA 1F9JA 4HK2A 3IT4B 4BFRA 1CMXB 3L54A 4P7IA 3SR6A 1SJHD 2D2QA 4MH0E 1L4DB 2WU5B 2KX3A 1XEEA 1WXVA 2DZKA 2MP2B 4YTPB 1E6EB 3DVGX 2ZCBA 3NZUA 4DBGA 5E6OA 2V0GA 4W9LA 3M62B 3MJ5A 4TUUA 3TJPA 1PUTA 1XQQA 4LK0M 1VZ8A 1WIAA 1FPYA 2QCZA 3H1UA 2PKOA 1WJUA 2ZCCA 2JWZA 2HJ8A 4W9IA 3NHEB 3A9KA 2LUEA 3P4SB 1FXAA 2O2VB 5BYSA 1I4QA 4H2AA 3SHQA 2GBRA 4EZLA 1LFDA 3BIID 1JWAD 3RMKC 2KHWB 3JW0X 3PSEB 2BS4B 1WGYA 2BBCA 2AWTA 2V1YA 2WXJA 2WXQA 1WX7A 2JRIB 4MDKE 5EE3A 1HE8A 4JPSA 3X0WA 1WE7A 4NY0A 3TEZA 1T3QA 5FKAC 2CKHB 3AI5A 4CHKA 4RCOA 4MSMB 2HDEA 2KDIA 2R2OA 4M8NA 3L0WB 3VVWB 2IO1B 3K9PB 3Q3JA 3L13A 2BQQA 2W9NA 3ALBA 3KQ4A 4BKSD 1IYFA 2KOXA 4A9AA 2K0PA 1C4CA 3AE2B 2YLMA 2MSED 4MT5A 1K51A 3QX1A 4K3CA 2J52A 2Z59B 2BYVE 1ZDVA 2K8BA 1T0SC 2JY6A 1OFFA 3RFZB 1SE3A 2QILA 2DBYA 4C80A 4HLEA 4IWQA 2BWFA 3KWVA 2D07B 2VRRB 1WGKA 4FLHA 1MJDA 4DXAB 3A1QB 2M1MA 2V3PA 5L83A 4GB9A 3RNEC 1WGHA 2FIDA 4XGAB 2LI5A 3UQAA 5HG2A 1T0QC 1HTOA 2PJHA 4MM3B 4FHKA 1OGWA 3ENEA 1CK1A 2K1FA 3ECIA 1EM7A 4GDKB 3GOEA 2WXIA 2WDQB 2BS3B 3W1SC 2L8JA 1V9JA 4FHJA 3BK2A 4XC2A 2C5LC 3AEAB 1FEHA 4ZRQA 1I42A 2WXLA 3C0RB 3AE6B 1UBIA 3HK0A 4GXBA 4KIKA 1AARA 2BKRB 3NS8A 4E71A 5CTRC 1OQRA 2IPKD 3A33B 4II3B 1Q10A 5H92C 1IBXB 3A9JB 2FUHB 3P4RB 3AXCA 2WXGA 4YSZB 3QJZA 1MG4A 3ZNGC 1WXQA 3AULA 4ARCA 2W55A 1TKYA 1WRDB 1FRRA 1K52A 4LNKA 1RYJA 3RNCC 1UF0A 3GE3C 2M0XA 2LFIA 3BK1A 4IM2A 3PTFC 2ZNVB 1S1QB 1KLUD 3QCAA 1J7BA 3ZTCA 4P16A 1Y8RC 2ZW0A 1ACCA 2PEAA 4KVGB 1C1YB 3C8YA 3N20C 4URKA 4KGTA 1FXTB 4FBJB 4FA6A 1XCQL 2ICIA 4LDTD 2K8HA 2J0MA 1U4AA 2VZKD 1ROEA 1WX8A 2X38A 4C7YA 3R2TA 3ZJTA 3RCZA 1DYQA 5IO9A 1SE4A 1TS4A 3EFCA 3ZW3A 1KOTA 1WZ0A 1QOGA 3AM9A 1SF0A 4DXGA 3IHPC 2G9HD 2WXFA 4XDCA 3SD5A 5EE9A 3QWZB 3DBLB 1N60A 2RR9A 4FJYA 2QDFA 1TZOA 5LLIA 4A90A 1WYGA 2YEPF 2ZW1A 4EE2A 4LTUA 1SEBD 1QILA 1ET6A 5FK9C 3I5JC 1GPXA 2E3TA 2LGSA 3A9KB 3EA6A 2ZPYA 3AE5B 2LD9A 3BVMA 1N62A 1AWDA 1E8WA 3U8ZA 4GOCA 5JH5C 1NI3A 2N1VA 5J18A 2CHWA 3VR8B 1MI0A 4KSLC 4L1BA 4LNFA 2M4NA 1CZPA 1L0VB 2DZIA 4MJSA 1SGHA 2OJRA 3AEFB 3PO0A 2VZKB 3BVGA 2QSDA 1WJ4A 4DHJB 1YJ1A 4GSWA 1T0RC 1FM0D 1MG8A 2KWDA 1PQSA 1C79A 2C7HA 3DBRI 5FR6A 1A5RA 1STEA 2W82A 3VTVA 4YT0B 3QAQA 1ZP0B 2IY0B 3Q3NC 1WXMA 5DPTA 2WNMA 4LJOB 4A55A 4DWFA 2J0KA 3MJWA 4EZKA 2AL6A 1V2YA 3AECB 1OQYA 4Q2JA 4FJVB 1V5TA 1FO4A 4EKUA 4RMAA 2JRHA 2QIEB 5HFYA 2K6QA 3NVVA 4KGSA 5C2TB 1QOBA 1E8YA 2KYWA 2W3SA 5CX3A 1NEKB 2KMCA 4WJNA 4JX1C 1T6BX 5DPWA 2N9EB 2LGXA 2M19A 1L6UA 3H7SA 4M01A 4PK1A 2KWCA 2DZJA 1J8CA 2NTTA 4DHZE 2G4DB 5G5GA 4HRSA 1AN8A 5AZHA 3N3KB 2MBBB 1TS3A 1E8ZA 3LXFA 2CU3A 3IVFA 2X8XX 1RM6C 1FNWA 2QEJC 2KQSA 4CYEA 2LVPA 3QIJA 5DPSA 2DYBA 5JHAA 1WZ3A 1YNTE 3Q2AC 3JSVA 2INPE 3NVWA 2NR2A 3JVZX 2D3BA 2K6DB 5AUKA 2KDEB 3RNBC 1F2RI 3EECA 2DZMA 2NS5A 3PS6A 4NAWB 1OEYJ 2WGSA 2CJOA 3MTNB 2WLBA 5DPRA 3TUOA 2KDBA 4RGOS 2IY1B 4WH4A 4JIOU 2Y5CA 1N63A 2REXA 2V3NA 4XX5A 3W1SA 2K3UA 4ACFA 2SEBD 3DHGC 4QAYA 3U52E 2NBWB 1RFAA 4P1BC 1Y56A 2KWVB 2KANA 5JZEB 2NBVB 3VH3B 2BB5A 2KDFB 3M95A 3L08A 2OOBB 1V1PA 4W9KA 3PLVA 3NVYA 3PRZA 2PIAA 5IN7A 2D3AA 2HJ1A 4A3OA 5BO4B 2WX1A 2XN9C 2M17A 4FN2A 4GN1A 1UD7A 1TKGA 2KVRA 3DQVA 1LQBA 1UGMA 1XLPA 2D3CA 1FIQA 3ONSA 1UBQA 5H8YE 2JYTA 4AJWA 1LM8B 4WIPA 3PREA 5EE1A 1NYQA 3P4PB 2OEDA 1AW7A 4ZRJA 3Q3FA 4KSKC 1IUEA 4HPPA 2CHXA 1WXAA 2GBJA 1A70A 2CR5A 4BOSC 2G3QB 4WJOA 4FADA 2GB1A 1XXGA 3VTWA 1WGGA 3I63C 3VAWA 2NPTA 4WQOB 2CHZA 1GC7A 3VFKA 1QQRA 2PLPA 1YX5B 4K1RB 1UZXB 2L83A 2N0SB 3EHVA 4ICUA 4W9EA 1TZ1A 5J2RA 2GOWA 3QA8A 3AEDB 1I4HA 2GMIC 2LJIA 1YQBA 2M8SA 2LRUA 1XT9B 3BWUD 5LXIB 4DDGD 2IGGA 4RFBA 3UGBB 4TSSA 4USAA 4HJKA 3M63B 4UDUC 1UWMA 1WX9A 3ZQ4A 1I35A 3R3MA 4IG7B 1J7CA 2QJLA 1BXTA 1ZUD2 2K39A 3PZDA 3RZWC 2C9WB 4GLSC 1ZOYB 1IGCA 1VRAB 2Z8LA 3NUHB 1SB3C 1JWMD 2L52A 4A20A 1R4MI 2ZVOA 3BY4B 2UYZB 2GBNA 2PTLA 3BINA 2PW9A 3UINB 3B2GA 2KMAA 2PVOD 1V49A 5KHQA 4XYCA 2ZPNA 3ZJUA 3TEXA 2EMTA 3RNFC 4M02A 3T8MA 1H8CA 3IAS1 4NJ7A 2QC8A 3DBRB 1E0ZA 3R7RA 2EMSA 2UWQA 4HWIB 1N5XA 5LXHA 3VRAB 4ZDVA 5I4DA 4B9KA 4TV3A 5J17A 4XWTA 1JRUA 4ZYNA 1IGDA 3AE3B 1E5WA 2Z0EB 3ZNHB 1FMAD 5IKCM 2AQ2B 4TKNA 1XCTL 4ITKA 1SSNA 2INCC 1P7EA 3DVGY 2IDYA 2BYTA 3JSVB 3ML9A 4GDLA 3AEGB 3TMPB 1EUVB 4PS7A 4TQ1A 3APDA 1JWSD 2KXJA 3GP7A 2KWUB 1V6EA 3HHMA 3KYDD 4LCDE 2I1KA 1SIJA 1KRHA 3LYYA 2L3ZA 4HDOA 2JQRB 5E6JA 3LDZE 4KZCA 4I6NB 2RPVA 5E6NA 2JZPA 3DBHB 3GB1A 1JALA 2KZRA 2QMTA 2IO0B 4K7UA 1WXSA 2WYQA 4RNAA 2WXNA 2MEKA 3OLMD 1V1PB 3GZNI 3RZFA 2KTFA 3BYYB 3AH7A 4KZ0A 1QT9A 1H4RA 1QOFA 1C9FA 4IM3A 1V80A 1FD6A 1HQRD 3U2SC 2L00B 1V81A 1B1ZA 4HKZE 1CQVA 3APFA 5EE0A 4OHJA 1JW9D 2BB6A 4G3XB 4JL9A 2AX5A 1C76A 1WWTA 3QC8B 4OW0A 2HE7A 4L2YA 4L23A 1I4GA 3B0AA 2WXPA 4KKIA 3AB5A 4CO7A 3ZXVA 3U30A 3MC8A 3L16A 1TBEA 2NPTB 4RGMA 1PFDA 2MH7A 2MBHA 4PYUA 2D3GA 4KDLB 2KVZA 3MFGA 4C4VA 3BVZA 4PS8A 2LASA 4E3CA 2Y3AA 2JYEA 4P6VF 3KH0A 1GC6A 3L10B 4EFOA 3RNAC 1EU3A 1PYWD 3DHHC 2KK8A 1E9MA 3RUIB 2KDMA 4MSQB 2BYFA 2ONQA 2C7NB 3PHWB 4YXDB 4US8A 2RD0A 1TY0A 1WR1A 3Q8FA 4DHJD 1E8XA 1D5MC 4OZCA 5E6PA 1IP9A 2RMMA 2UU7A 4W9CA 1FFUA 2MBOA 1RWSA 4HJGE 5CHVC 3V6CB 1XLNA 2NBUA 4RGTA 2JU6X 4K7SA 4C56C 1TKEA 4PT5A 4WAAA 2FE8A 2ZNVC 3O65B 3DWGC 1G6JA 5BMHA 3K9OB 2ASQA 4C7ZA 3WAPA 3T9LA 3RULA 2INDC 3KW5B 1WI0A 5D3IB 3TIXA 4BKTA 3HRDD 2BVCA 3R8BA 2XBBC
chains in the Genus database with same CATH topology
2LGYA 2J7QB 1OEYJ 3PGEA 2KO3A 3WALA 4DDID 1Q0WB 4F1SA 3DPDA 1KM7A 3MTNB 2DYOA 4XZ4A 4JLCA 5DPRA 4MELA 1F9JA 4MGZE 4HK2A 4BFRA 2KDBA 5L95C 2IY1B 3CF6E 1CMXB 3L54A 2IO2B 4K7WA 4JIOU 4P7IA 2D2QA 4WWPA 4MH0E 2REXA 2JPHA 2NCNA 3D32A 4G50A 3V6EB 2JUOA 3JYUA 4GIVA 4B95A 2KX3A 4HVBA 4XX5A 1WXVA 3HM6X 1VD2A 4I6LB 3W1SA 1WM3A 2D10A 2IBIB 2DZKA 2MP2B 2N7EA 2NBWB 3DVGX 4PYZA 2ZCBA 2FCQA 1RFAA 2PPHA 3NZUA 4PS3A 2KWVB 4DBGA 2KANA 5E6OA 5JZEB 2NBVB 3V62A 3VH3B 4W9LA 3M62B 4BKGA 1WH3A 4HDQA 4TUUA 3TJPA 4E74A 5G55A 2LVOA 2MBEA 2KDFB 1XQQA 1V86A 3M95A 3L08A 2OOBB 1WIAA 4OVVA 3WAMA 3M3JA 3UQBA 4W9KA 3I3TB 4DK5A 3PLVA 1XD3B 4NAWA 3UIOB 2FCNA 2V3SA 4OVUA 3H1UA 4M8MA 3VH4B 3PRZA 1WJUA 2ZCCA 2JWZA 2HJ8A 3CMMB 4W9IA 2YVCA 3NHEB 1ZW7A 2RPQA 3A9KA 3RD2A 3RYTA 4A3OA 1K8RB 4BBNF 3DCGA 1R4NI 5BO4B 3PLUA 3ZUNA 2ZJDA 2LUEA 2WX1A 2M17A 1S3SG 2O2VB 4FN2A 4KDIC 4GN1A 3EFUA 2BWES 1RRBA 2FCSA 2LXCA 3SHQA 1GUAB 2GBRA 2A5UA 1UD7A 4EZLA 2KFKB 1LFDA 4AP4C 2KVRA 3DQVA 1LQBA 1UGMA 2KHWB 4HXDA 3TCAA 3JW0X 3PSEB 2FCMA 1UBQA 3ONSA 3DDCB 1WGYA 2N7DA 2AWTA 2V1YA 3X23A 2C7MB 2O6VA 4AJWA 4ANUA 4NQLB 3VXWA 1LM8B 1WX7A 2JRIB 4MDKE 3IG3A 3PREA 2LWPA 1P98A 3KUZA 1WMHA 5CHFA 1HE8A 3PHXB 3X0WA 1WE7A 4A3PA 2N9XA 3L17A 1WR6E 2JT4B 4NY0A 4JGHB 4ZRJA 1EF5A 3Q3FA 2KNBA 4KSKC 2CKHB 1UH6A 3AI5A 2JXXA 4CHKA 2ZZPB 2CHXA 4MSMB 2KDIA 1WXAA 2R2OA 4M8NA 4NQKE 1Z2MA 3ZRFA 3L0WB 3VVWB 2IO1B 2GBJA 3K9PB 3Q3JA 2CR5A 3PPAA 4ANVA 4BOSC 4EZJA 1LXDA 3L13A 2W9NA 3ZLZA 4YL8A 3ALBA 2G3QB 4WJOA 4BKSD 4FADA 1IYFA 2KOXA 1E90A 3MHSD 2K8CA 3VTWA 1X1MA 1WGGA 3VAWA 2NPTA 4ZRKA 2RGFA 4HCNB 4WQOB 3VHTC 4IWOA 2CHZA 5TR5A 1GC7A 3VFKA 2YLMA 4F8CB 2MSED 1ZGUB 3VUYA 3OJ4B 1YX5B 4GGQA 2XK5A 3DBHI 3ZDMC 3QX1A 3NOBA 4K1RB 3W1YA 2LGDA 5C1ZA 1UZXB 2N4FA 2NVUI 2Z59B 4DHZB 3EHVA 4ICUA 3TL5A 2BYVE 2EKEC 4W9EA 5D6JB 2K8BA 1TZ1A 5J2RA 2JY6A 2GOWA 5AEKB 2L05A 3QA8A 4NNJB 1T0YA 3S2AA 2KKCA 2MW5A 4KIKB 1TGZB 3RT3B 2KC1A 4HLEA 2MCNB 1BT0A 4IWQA 4X57B 2GMIC 2BWFA 4MGKE 2D07B 3U7DA 1WM2A 1YQBA 2KLCA 2VRRB 2M8SA 4FLHA 2LRUA 1XT9B 1J0GA 4MEMA 4DXAB 3A1QB 2M1MA 4EOYA 5LXIB 5L83A 4GB9A 1WGHA 2FIDA 4DDGD 2A4ZA 2LI5A 1KLVA 3UGBB 3B08A 3UQAA 2PJHA 4FHKA 1GG3A 1OGWA 2LRWA 3ENEA 2K1FA 3ECIA 4HJKA 3M63B 4GDKB 3GOEA 2MBQA 3WAOA 2KJHB 1WX9A 2KTRA 2JVCA 1I35A 3W1SC 2L8JA 3R3MA 1V9JA 1YX6B 2I1JA 4IG7B 3R7QA 4FHJA 2L0TA 4XC2A 3CSFA 2C5LC 2N9PC 1I42A 1E7VA 2LVQA 2K39A 3PZDA 3H7PA 3C0RB 1WJ6A 3RZWC 2C9WB 1UBIA 4ASWC 4M0WB 3HK0A 5CHWA 4GXBA 3DVNV 4TQ0A 4KIKA 3VUXA 1AARA 2BKRB 4A20A 3NS8A 2XEWA 2R2QA 4ZRIA 1R4MI 4E71A 2IZVB 2ZVOA 3BY4B 2UYZB 2GBNA 3BINA 5CTRC 3UINB 2BGFA 3A33B 4II3B 2KMAA 4RM8A 1V49A 5KHQA 1V5OA 4LDTB 3HM3A 2L76A 2DHZA 2ZPNA 4AOFA 2EMTA 3A9JB 4GDLB 4MM3A 2FUHB 2GBMA 3T8MA 3ZRCA 3AXCA 4NJ7A 4ANXA 2AYOB 3QJZA 1H8CA 2BYEA 4K81A 3ZNGC 2MP2A 1UELA 3CSTA 4B6WA 3AULA 3R7RA 5JHBA 1L2NA 2EMSA 3EC8A 3QARA 1EF1A 2UWQA 4HWIB 1C3TA 5LXHA 4ZDVA 1WRDB 3VUWA 4F7ZA 3QQ8B 4B9KA 3ZTDA 3PT2B 4KV2A 4TV3A 5J17A 1RAXA 1WJNA 2D11A 3KUDB 2G4SA 4GMVA 4II2B 4HCPB 1JRUA 2M0XA 4ZYNA 1KJTA 1L7YA 1WYWB 3ML8A 2MLBA 4IM2A 3PTFC 4IC7B 2JZZA 2K25A 3KUCB 1E5WA 2Z0EB 3ZNHB 2DENB 2IYDB 2ZNVB 4BKSA 5HKHA 4TKNA 5AZFA 1S1QB 3V60A 3QCAA 1Z5SB 3ZTCA 3IBEA 4HPMB 3DVGY 1Y8RC 2PEAA 4KVGB 2O2VA 1C1YB 3JSVB 3ML9A 3A4SC 4URKA 2KQ7A 4GDLA 2DAFA 1FXTB 3TMPB 1EUVB 4PS7A 2KFKA 5EDSA 4TQ1A 3B1LX 3APDA 3N32A 4FBJB 1IPGA 1Q5WB 1TTNA 2IO3B 4WWNA 4FA6A 2G45B 3UIPB 4LDTD 2K8HA 2KXJA 3KYCD 3VDZA 2KWUB 1GJZA 2O6VD 1V6EA 3HHMA 2J0MA 1U4AA 3IFWB 3KYDD 1WX8A 4LCDE 2FAZA 3PRMB 1P0RA 2I1KA 3RCZA 3OJ3A 3ZW3A 2L3ZA 1Q1OA 1KOTA 1WZ0A 2C60A 3WIMA 2WDTB 2AEHA 2LXAA 4HDOA 5IA7A 2L7RA 4IUMB 3IHPC 4W9JA 3H6NA 3WANA 1E7UA 3LDZE 4KZCA 2AL3A 2MRPA 4I6NB 5E6NA 3SD5A 1WE6A 3HIZA 2HD5B 3N30A 1WY8A 3QWZB 4MJSB 2RR9A 4FJYA 2KZRA 1SIFA 1WGDA 4G0NB 3AU5A 2IO0B 4K7UA 1WXSA 2WYQA 4I6PA 5LLIA 5D94A 1P9DU 1NDDA 2LZ6A 3KVFB 1WFYA 4W9GA 2MWSB 1P3QU 3OLMD 3UF8A 1OEYA 3PRPB 1VCBA 3GZNI 4WWOA 3RZFA 2KTFA 4ANWA 4KZ0A 4HPLB 1H4RA 3ZVVA 2ZEQA 3SDLC 3ZDTA 2KLGA 2ZVNA 3A9KB 4IM3A 1J19A 2ZPYA 3DVNU 1V80A 2LD9A 4JQWC 2KD0A 3P2BA 1E8WA 3U8ZA 4GOCA 3WA0A 2RSUA 2MA9B 5JH5C 4NJ6A 2FIFA 4RM9A 4EEWA 2N1VA 2L00B 1V81A 5J18A 2CHWA 4IWPA 4KSLC 4WJPA 2M4NA 2BKFA 4WJQA 3ZNZB 1WF9A 4BBNC 3APFA 2DZIA 4MGIE 4NPNA 4MJSA 3A1QA 1SGHA 2OJRA 2KFJA 4N9F4 2V4LA 2O6VB 4J6IA 2PE6B 2GBKA 1NBFC 4G3XB 1WJ4A 4JL9A 4DHJB 1YJ1A 4GSWA 2DAJA 1WMHB 3PV1A 1NI2A 1MG8A 3DBSA 4GDKA 3H9DA 1PQSA 3QC8B 3OAWA 5KHOA 1SE9A 2C7HA 3DBRI 3ZNID 5FR6A 2HE7A 1A5RA 3VTVA 3QAQA 5DCNA 2KJ6A 3B0AA 1YIWA 2IY0B 1P1AA 3VTUA 1WXMA 4W9FA 3ZIMA 5DPTA 4CO7A 2KJRA 4LJOB 4DWFA 2J0KA 2KN5A 3U30A 3MJWA 2LJ5A 4EZKA 2PE9A 2AL6A 3L16A 5D2MB 5D7GA 1V2YA 1M94A 3ZO5B 1ZKHA 1EO6A 1TBEA 1OQYA 2NPTB 5G2NA 2JZ3B 4FJVB 1YD8U 1V5TA 2DX5B 2Y5BB 2MBHA 4AJYB 2KX0A 4PYUA 2D3GA 4KDLB 4EKUA 4RMAA 2JRHA 4PS8A 2LASA 1WGRA 2K6QA 3SU8X 2XK5B 4E3CA 4AUQC 4FULA 1E8YA 3A9JA 3KH0A 1GC6A 4W9HA 2BPSA 5CX3A 2KMCA 3L10B 4WJNA 4AWJA 4EFOA 2KK8A 4ICVA 2BF8B 1ISNA 3RUIB 4MSQB 2BYFA 3APCA 5DPWA 3TBLD 2C7NB 3PHWB 2J0JA 2N9EB 2LGXA 2RD0A 3H7SA 4BVUC 1WR1A 3VQIA 2JF5A 2KWCA 4LJPB 2DZJA 4DHJD 1E8XA 1J8CA 3AU4A 3NZSA 2HTHA 2G4DB 1GNUA 5C23A 4DHZE 5E6PA 3LJ3A 1IP9A 5AZHA 2CS4A 3N3KB 4W9CA 2MBBB 4G11A 2MBOA 3NY5A 3QHTA 5CHVC 1E8ZA 4MGYE 3V6CB 1D3ZA 3A4RA 3QK0A 2Z0DB 2NBUA 4K7SA 5GMVA 3IVFA 2WWZA 3PVLA 2N1WA 4GU2A 4EUTA 2KTRB 2KQSA 4WAAA 1OTRB 2ZNVC 4CYEA 2LVPA 4IW0A 2WX0A 2DYMA 3O65B 3QIJA 4IM0A 5DPSA 2DYBA 5JHAA 1WZ3A 3JSVA 1G6JA 3K9OB 2CU1A 2ASQA 2NR2A 3DBLI 3JVZX 3R66C 2B3AA 2K6DB 2MX2A 2KC2A 5IAAC 5AZGA 4BOZB 3WAPA 2MQJA 3H7PB 3V61A 3ZKJC 3T9LA 3RULA 2KDEB 1RLFA 3EECA 3KW5B 2FNJB 1WI0A 2DZMA 2NS5A 4W9DA 3TIXA 1QZEA 3DOWA 4FJZA 2QHOA 3PS6A 4BKTA 2L0FA 2XBBC 4NAWB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2LGY A;  2J7Q B;  1OEY J;  3PGE A;  2KO3 A;  3WAL A;  4DDI D;  1Q0W B;  4F1S A;  3DPD A;  1KM7 A;  3MTN B;  2DYO A;  4XZ4 A;  4JLC A;  5DPR A;  4MEL A;  1F9J A;  4MGZ E;  4HK2 A;  4BFR A;  2KDB A;  5L95 C;  2IY1 B;  3CF6 E;  1CMX B;  3L54 A;  2IO2 B;  4K7W A;  4JIO U;  4P7I A;  2D2Q A;  4WWP A;  4MH0 E;  2REX A;  2JPH A;  2NCN A;  3D32 A;  4G50 A;  3V6E B;  2JUO A;  3JYU A;  4GIV A;  4B95 A;  2KX3 A;  4HVB A;  4XX5 A;  1WXV A;  3HM6 X;  1VD2 A;  4I6L B;  3W1S A;  1WM3 A;  2D10 A;  2IBI B;  2DZK A;  2MP2 B;  2N7E A;  2NBW B;  3DVG X;  4PYZ A;  2ZCB A;  2FCQ A;  1RFA A;  2PPH A;  3NZU A;  4PS3 A;  2KWV B;  4DBG A;  2KAN A;  5E6O A;  5JZE B;  2NBV B;  3V62 A;  3VH3 B;  4W9L A;  3M62 B;  4BKG A;  1WH3 A;  4HDQ A;  4TUU A;  3TJP A;  4E74 A;  5G55 A;  2LVO A;  2MBE A;  2KDF B;  1XQQ A;  1V86 A;  3M95 A;  3L08 A;  2OOB B;  1WIA A;  4OVV A;  3WAM A;  3M3J A;  3UQB A;  4W9K A;  3I3T B;  4DK5 A;  3PLV A;  1XD3 B;  4NAW A;  3UIO B;  2FCN A;  2V3S A;  4OVU A;  3H1U A;  4M8M A;  3VH4 B;  3PRZ A;  1WJU A;  2ZCC A;  2JWZ A;  2HJ8 A;  3CMM B;  4W9I A;  2YVC A;  3NHE B;  1ZW7 A;  2RPQ A;  3A9K A;  3RD2 A;  3RYT A;  4A3O A;  1K8R B;  4BBN F;  3DCG A;  1R4N I;  5BO4 B;  3PLU A;  3ZUN A;  2ZJD A;  2LUE A;  2WX1 A;  2M17 A;  1S3S G;  2O2V B;  4FN2 A;  4KDI C;  4GN1 A;  3EFU A;  2BWE S;  1RRB A;  2FCS A;  2LXC A;  3SHQ A;  1GUA B;  2GBR A;  2A5U A;  1UD7 A;  4EZL A;  2KFK B;  1LFD A;  4AP4 C;  2KVR A;  3DQV A;  1LQB A;  1UGM A;  2KHW B;  4HXD A;  3TCA A;  3JW0 X;  3PSE B;  2FCM A;  1UBQ A;  3ONS A;  3DDC B;  1WGY A;  2N7D A;  2AWT A;  2V1Y A;  3X23 A;  2C7M B;  2O6V A;  4AJW A;  4ANU A;  4NQL B;  3VXW A;  1LM8 B;  1WX7 A;  2JRI B;  4MDK E;  3IG3 A;  3PRE A;  2LWP A;  1P98 A;  3KUZ A;  1WMH A;  5CHF A;  1HE8 A;  3PHX B;  3X0W A;  1WE7 A;  4A3P A;  2N9X A;  3L17 A;  1WR6 E;  2JT4 B;  4NY0 A;  4JGH B;  4ZRJ A;  1EF5 A;  3Q3F A;  2KNB A;  4KSK C;  2CKH B;  1UH6 A;  3AI5 A;  2JXX A;  4CHK A;  2ZZP B;  2CHX A;  4MSM B;  2KDI A;  1WXA A;  2R2O A;  4M8N A;  4NQK E;  1Z2M A;  3ZRF A;  3L0W B;  3VVW B;  2IO1 B;  2GBJ A;  3K9P B;  3Q3J A;  2CR5 A;  3PPA A;  4ANV A;  4BOS C;  4EZJ A;  1LXD A;  3L13 A;  2W9N A;  3ZLZ A;  4YL8 A;  3ALB A;  2G3Q B;  4WJO A;  4BKS D;  4FAD A;  1IYF A;  2KOX A;  1E90 A;  3MHS D;  2K8C A;  3VTW A;  1X1M A;  1WGG A;  3VAW A;  2NPT A;  4ZRK A;  2RGF A;  4HCN B;  4WQO B;  3VHT C;  4IWO A;  2CHZ A;  5TR5 A;  1GC7 A;  3VFK A;  2YLM A;  4F8C B;  2MSE D;  1ZGU B;  3VUY A;  3OJ4 B;  1YX5 B;  4GGQ A;  2XK5 A;  3DBH I;  3ZDM C;  3QX1 A;  3NOB A;  4K1R B;  3W1Y A;  2LGD A;  5C1Z A;  1UZX B;  2N4F A;  2NVU I;  2Z59 B;  4DHZ B;  3EHV A;  4ICU A;  3TL5 A;  2BYV E;  2EKE C;  4W9E A;  5D6J B;  2K8B A;  1TZ1 A;  5J2R A;  2JY6 A;  2GOW A;  5AEK B;  2L05 A;  3QA8 A;  4NNJ B;  1T0Y A;  3S2A A;  2KKC A;  2MW5 A;  4KIK B;  1TGZ B;  3RT3 B;  2KC1 A;  4HLE A;  2MCN B;  1BT0 A;  4IWQ A;  4X57 B;  2GMI C;  2BWF A;  4MGK E;  2D07 B;  3U7D A;  1WM2 A;  1YQB A;  2KLC A;  2VRR B;  2M8S A;  4FLH A;  2LRU A;  1XT9 B;  1J0G A;  4MEM A;  4DXA B;  3A1Q B;  2M1M A;  4EOY A;  5LXI B;  5L83 A;  4GB9 A;  1WGH A;  2FID A;  4DDG D;  2A4Z A;  2LI5 A;  1KLV A;  3UGB B;  3B08 A;  3UQA A;  2PJH A;  4FHK A;  1GG3 A;  1OGW A;  2LRW A;  3ENE A;  2K1F A;  3ECI A;  4HJK A;  3M63 B;  4GDK B;  3GOE A;  2MBQ A;  3WAO A;  2KJH B;  1WX9 A;  2KTR A;  2JVC A;  1I35 A;  3W1S C;  2L8J A;  3R3M A;  1V9J A;  1YX6 B;  2I1J A;  4IG7 B;  3R7Q A;  4FHJ A;  2L0T A;  4XC2 A;  3CSF A;  2C5L C;  2N9P C;  1I42 A;  1E7V A;  2LVQ A;  2K39 A;  3PZD A;  3H7P A;  3C0R B;  1WJ6 A;  3RZW C;  2C9W B;  1UBI A;  4ASW C;  4M0W B;  3HK0 A;  5CHW A;  4GXB A;  3DVN V;  4TQ0 A;  4KIK A;  3VUX A;  1AAR A;  2BKR B;  4A20 A;  3NS8 A;  2XEW A;  2R2Q A;  4ZRI A;  1R4M I;  4E71 A;  2IZV B;  2ZVO A;  3BY4 B;  2UYZ B;  2GBN A;  3BIN A;  5CTR C;  3UIN B;  2BGF A;  3A33 B;  4II3 B;  2KMA A;  4RM8 A;  1V49 A;  5KHQ A;  1V5O A;  4LDT B;  3HM3 A;  2L76 A;  2DHZ A;  2ZPN A;  4AOF A;  2EMT A;  3A9J B;  4GDL B;  4MM3 A;  2FUH B;  2GBM A;  3T8M A;  3ZRC A;  3AXC A;  4NJ7 A;  4ANX A;  2AYO B;  3QJZ A;  1H8C A;  2BYE A;  4K81 A;  3ZNG C;  2MP2 A;  1UEL A;  3CST A;  4B6W A;  3AUL A;  3R7R A;  5JHB A;  1L2N A;  2EMS A;  3EC8 A;  3QAR A;  1EF1 A;  2UWQ A;  4HWI B;  1C3T A;  5LXH A;  4ZDV A;  1WRD B;  3VUW A;  4F7Z A;  3QQ8 B;  4B9K A;  3ZTD A;  3PT2 B;  4KV2 A;  4TV3 A;  5J17 A;  1RAX A;  1WJN A;  2D11 A;  3KUD B;  2G4S A;  4GMV A;  4II2 B;  4HCP B;  1JRU A;  2M0X A;  4ZYN A;  1KJT A;  1L7Y A;  1WYW B;  3ML8 A;  2MLB A;  4IM2 A;  3PTF C;  4IC7 B;  2JZZ A;  2K25 A;  3KUC B;  1E5W A;  2Z0E B;  3ZNH B;  2DEN B;  2IYD B;  2ZNV B;  4BKS A;  5HKH A;  4TKN A;  5AZF A;  1S1Q B;  3V60 A;  3QCA A;  1Z5S B;  3ZTC A;  3IBE A;  4HPM B;  3DVG Y;  1Y8R C;  2PEA A;  4KVG B;  2O2V A;  1C1Y B;  3JSV B;  3ML9 A;  3A4S C;  4URK A;  2KQ7 A;  4GDL A;  2DAF A;  1FXT B;  3TMP B;  1EUV B;  4PS7 A;  2KFK A;  5EDS A;  4TQ1 A;  3B1L X;  3APD A;  3N32 A;  4FBJ B;  1IPG A;  1Q5W B;  1TTN A;  2IO3 B;  4WWN A;  4FA6 A;  2G45 B;  3UIP B;  4LDT D;  2K8H A;  2KXJ A;  3KYC D;  3VDZ A;  2KWU B;  1GJZ A;  2O6V D;  1V6E A;  3HHM A;  2J0M A;  1U4A A;  3IFW B;  3KYD D;  1WX8 A;  4LCD E;  2FAZ A;  3PRM B;  1P0R A;  2I1K A;  3RCZ A;  3OJ3 A;  3ZW3 A;  2L3Z A;  1Q1O A;  1KOT A;  1WZ0 A;  2C60 A;  3WIM A;  2WDT B;  2AEH A;  2LXA A;  4HDO A;  5IA7 A;  2L7R A;  4IUM B;  3IHP C;  4W9J A;  3H6N A;  3WAN A;  1E7U A;  3LDZ E;  4KZC A;  2AL3 A;  2MRP A;  4I6N B;  5E6N A;  3SD5 A;  1WE6 A;  3HIZ A;  2HD5 B;  3N30 A;  1WY8 A;  3QWZ B;  4MJS B;  2RR9 A;  4FJY A;  2KZR A;  1SIF A;  1WGD A;  4G0N B;  3AU5 A;  2IO0 B;  4K7U A;  1WXS A;  2WYQ A;  4I6P A;  5LLI A;  5D94 A;  1P9D U;  1NDD A;  2LZ6 A;  3KVF B;  1WFY A;  4W9G A;  2MWS B;  1P3Q U;  3OLM D;  3UF8 A;  1OEY A;  3PRP B;  1VCB A;  3GZN I;  4WWO A;  3RZF A;  2KTF A;  4ANW A;  4KZ0 A;  4HPL B;  1H4R A;  3ZVV A;  2ZEQ A;  3SDL C;  3ZDT A;  2KLG A;  2ZVN A;  3A9K B;  4IM3 A;  1J19 A;  2ZPY A;  3DVN U;  1V80 A;  2LD9 A;  4JQW C;  2KD0 A;  3P2B A;  1E8W A;  3U8Z A;  4GOC A;  3WA0 A;  2RSU A;  2MA9 B;  5JH5 C;  4NJ6 A;  2FIF A;  4RM9 A;  4EEW A;  2N1V A;  2L00 B;  1V81 A;  5J18 A;  2CHW A;  4IWP A;  4KSL C;  4WJP A;  2M4N A;  2BKF A;  4WJQ A;  3ZNZ B;  1WF9 A;  4BBN C;  3APF A;  2DZI A;  4MGI E;  4NPN A;  4MJS A;  3A1Q A;  1SGH A;  2OJR A;  2KFJ A;  4N9F 4;  2V4L A;  2O6V B;  4J6I A;  2PE6 B;  2GBK A;  1NBF C;  4G3X B;  1WJ4 A;  4JL9 A;  4DHJ B;  1YJ1 A;  4GSW A;  2DAJ A;  1WMH B;  3PV1 A;  1NI2 A;  1MG8 A;  3DBS A;  4GDK A;  3H9D A;  1PQS A;  3QC8 B;  3OAW A;  5KHO A;  1SE9 A;  2C7H A;  3DBR I;  3ZNI D;  5FR6 A;  2HE7 A;  1A5R A;  3VTV A;  3QAQ A;  5DCN A;  2KJ6 A;  3B0A A;  1YIW A;  2IY0 B;  1P1A A;  3VTU A;  1WXM A;  4W9F A;  3ZIM A;  5DPT A;  4CO7 A;  2KJR A;  4LJO B;  4DWF A;  2J0K A;  2KN5 A;  3U30 A;  3MJW A;  2LJ5 A;  4EZK A;  2PE9 A;  2AL6 A;  3L16 A;  5D2M B;  5D7G A;  1V2Y A;  1M94 A;  3ZO5 B;  1ZKH A;  1EO6 A;  1TBE A;  1OQY A;  2NPT B;  5G2N A;  2JZ3 B;  4FJV B;  1YD8 U;  1V5T A;  2DX5 B;  2Y5B B;  2MBH A;  4AJY B;  2KX0 A;  4PYU A;  2D3G A;  4KDL B;  4EKU A;  4RMA A;  2JRH A;  4PS8 A;  2LAS A;  1WGR A;  2K6Q A;  3SU8 X;  2XK5 B;  4E3C A;  4AUQ C;  4FUL A;  1E8Y A;  3A9J A;  3KH0 A;  1GC6 A;  4W9H A;  2BPS A;  5CX3 A;  2KMC A;  3L10 B;  4WJN A;  4AWJ A;  4EFO A;  2KK8 A;  4ICV A;  2BF8 B;  1ISN A;  3RUI B;  4MSQ B;  2BYF A;  3APC A;  5DPW A;  3TBL D;  2C7N B;  3PHW B;  2J0J A;  2N9E B;  2LGX A;  2RD0 A;  3H7S A;  4BVU C;  1WR1 A;  3VQI A;  2JF5 A;  2KWC A;  4LJP B;  2DZJ A;  4DHJ D;  1E8X A;  1J8C A;  3AU4 A;  3NZS A;  2HTH A;  2G4D B;  1GNU A;  5C23 A;  4DHZ E;  5E6P A;  3LJ3 A;  1IP9 A;  5AZH A;  2CS4 A;  3N3K B;  4W9C A;  2MBB B;  4G11 A;  2MBO A;  3NY5 A;  3QHT A;  5CHV C;  1E8Z A;  4MGY E;  3V6C B;  1D3Z A;  3A4R A;  3QK0 A;  2Z0D B;  2NBU A;  4K7S A;  5GMV A;  3IVF A;  2WWZ A;  3PVL A;  2N1W A;  4GU2 A;  4EUT A;  2KTR B;  2KQS A;  4WAA A;  1OTR B;  2ZNV C;  4CYE A;  2LVP A;  4IW0 A;  2WX0 A;  2DYM A;  3O65 B;  3QIJ A;  4IM0 A;  5DPS A;  2DYB A;  5JHA A;  1WZ3 A;  3JSV A;  1G6J A;  3K9O B;  2CU1 A;  2ASQ A;  2NR2 A;  3DBL I;  3JVZ X;  3R66 C;  2B3A A;  2K6D B;  2MX2 A;  2KC2 A;  5IAA C;  5AZG A;  4BOZ B;  3WAP A;  2MQJ A;  3H7P B;  3V61 A;  3ZKJ C;  3T9L A;  3RUL A;  2KDE B;  1RLF A;  3EEC A;  3KW5 B;  2FNJ B;  1WI0 A;  2DZM A;  2NS5 A;  4W9D A;  3TIX A;  1QZE A;  3DOW A;  4FJZ A;  2QHO A;  3PS6 A;  4BKT A;  2L0F A;  2XBB C;  4NAW B; 
#chains in the Genus database with same CATH topology
 2LGY A;  4OZA A;  2J7Q B;  3PGE A;  5BMG A;  3OG5 A;  4YWG G;  1FXI A;  3ZJV A;  4KX6 B;  3CF6 E;  4K7W A;  2IO2 B;  2NCN A;  1KF6 B;  3V6E B;  2JUO A;  3JYU A;  4GIV A;  4HVB A;  3HM6 X;  1J7A A;  2IBI B;  3EUB 2;  2N7E A;  4RF1 A;  4PYZ A;  3P4Q B;  4PS3 A;  1MHH E;  1E7P B;  2WS3 B;  3NJT A;  4NJC A;  3V62 A;  1JWB D;  4OVZ A;  4HDQ A;  4E74 A;  1YQ3 B;  1V86 A;  3B2F A;  3HVZ A;  3UQB A;  1R4M B;  2BW2 A;  2YVC A;  2RPQ A;  3Q69 A;  1SBB B;  3DCG A;  1R4N I;  3ZUN A;  2ZJD A;  3EFU A;  2BWE S;  1RRB A;  2FCS A;  3ZGZ A;  4XWW A;  2A5U A;  1XO3 A;  1KH0 A;  4ZRP A;  3B9J A;  4AP4 C;  1UWX A;  2MJD A;  4C00 A;  1N61 A;  2BTE A;  3Q6B A;  3DDC B;  4ZOH C;  2N7D A;  1MFW A;  3MC9 A;  3X23 A;  2C7M B;  2O6V A;  4ANU A;  4NQL B;  3DWM A;  3IG3 A;  2LWP A;  2M56 B;  1WMH A;  2INN E;  3PHX B;  4A3P A;  4RH6 A;  3L17 A;  1WR6 E;  1YMH E;  2JT4 B;  1HXY D;  4JGH B;  2NMQ A;  2KNB A;  2B76 B;  2ZZP B;  1OQQ A;  3N1Y C;  1TS5 A;  4ANV A;  1E10 A;  1JCK B;  3PPA A;  3ZLZ A;  4YL8 A;  3W2D A;  4A6Q A;  4K3B A;  3MHS D;  1E90 A;  1GOZ A;  4XE0 A;  5JXV A;  3UI3 A;  2JXT A;  1TJE A;  4ZRK A;  2J53 A;  1D5X C;  2RGF A;  4HCN B;  1ZPS A;  3VHT C;  1KTK A;  1ZGU B;  4GGQ A;  4REZ A;  3DBH I;  3NOB A;  3W1Y A;  5C1Z A;  2LGD A;  2GI9 A;  2N4F A;  4KKJ A;  5GXG B;  2KAJ A;  3TL5 A;  2IGH A;  5D6J B;  2L05 A;  5HHD G;  2E6X A;  3S2A A;  1I4X A;  1NYR A;  1C78 A;  4KIK B;  4LNO A;  3VRB B;  2KC1 A;  2MCN B;  1BT0 A;  2Y5P A;  1V97 A;  4X57 B;  4MGK E;  4HEA 1;  1D5Z C;  1NVI D;  1WM2 A;  2N9L A;  2KLC A;  1GB4 A;  1GB1 A;  1I4R A;  1J0G A;  4IKG A;  1ZE3 D;  1FNU A;  1I7H A;  3C19 A;  2A4Z A;  3ZYY X;  1NEN B;  1YJJ A;  1KLV A;  3MHZ A;  3B08 A;  3GZN B;  1GG3 A;  2LRW A;  3PZ7 A;  1ZDX A;  3WAO A;  1D6E C;  2V9H A;  1YX6 B;  1ZXH A;  2L32 A;  2I1J A;  3R7Q A;  2L0T A;  1HTQ A;  3CSF A;  2N9P C;  2FBW B;  1E7V A;  3FAH A;  2PVG C;  2LVQ A;  3H7P A;  4MH8 A;  1WJ6 A;  3DVN V;  4TQ0 A;  1SE2 A;  4ZRI A;  1QOA A;  3GE8 C;  2I2Y A;  3ZXR A;  4C4V B;  5MPO A;  4AOF A;  4MM3 A;  2ACZ B;  2GBM A;  4ANX A;  2AYO B;  2H89 B;  5T8I A;  2BYE A;  4K81 A;  1UEL A;  3CST A;  1MHX A;  1L2N A;  5BYR A;  5JHB A;  3EC8 A;  3QAR A;  2L1A A;  1C3T A;  1YN5 A;  3I9V 1;  4OZB A;  3QQ8 B;  3VR9 B;  1JRO A;  3ZTD A;  1FCL A;  4KV2 A;  4BZA A;  4B0M A;  3FIL A;  1RAX A;  3N1X C;  1F52 A;  4N58 A;  5FR3 A;  1KJT A;  1WYW B;  4N59 A;  2D5G A;  1HA5 A;  4IC7 B;  2JZZ A;  2K25 A;  5HKH A;  4BKS A;  3NS1 A;  1Z5S B;  3IBE A;  3ETR A;  4HPM B;  3N9Y C;  2KN4 A;  2LEK A;  3BYT B;  3A4S C;  1F1H A;  2KFK A;  5EDS A;  3B1L X;  1VZ7 A;  3N32 A;  1IPG A;  1Q5W B;  1TTN A;  2IO3 B;  1VZ6 A;  2G45 B;  3VDZ A;  2O6V D;  1VJK A;  1XLQ A;  2WU2 B;  3OJ3 A;  1Q1O A;  4US9 A;  2C60 A;  2WDT B;  1YN3 A;  2LXA A;  4MAC A;  5IA7 A;  3KLS X;  2JSV X;  4W9J A;  3WAN A;  1E7U A;  1KLG D;  2KAC A;  4R3D A;  3HIZ A;  2HD5 B;  1WY8 A;  1K50 A;  4MJS B;  4G0N B;  3AU5 A;  1C77 A;  5D94 A;  1P9D U;  2XNA C;  3KVF B;  1JML A;  2MWS B;  2OHF A;  1P3Q U;  3UF8 A;  1OEY A;  3P1M A;  2KT7 A;  4WWO A;  4M00 A;  3ZVV A;  2ZEQ A;  3SDL C;  2KLG A;  5AUI A;  2ZVN A;  3RI7 C;  3DVN U;  1UUP A;  4AQ7 A;  1SJE D;  3RNG C;  2AQ1 B;  2WXM A;  3J9C A;  3WA0 A;  2MA9 B;  5TSS A;  4NJ6 A;  2IGD A;  4RM9 A;  4EEW A;  1UNS A;  1T5X D;  3O13 A;  2V4I B;  2BKF A;  4WJQ A;  1WF9 A;  2WXK A;  4BBN C;  3NG0 A;  4MGI E;  1HZ5 A;  4N9F 4;  2O6V B;  1WSP A;  4J6I A;  2GBK A;  1NBF C;  3KWL A;  3AE4 B;  2DLB A;  2DAJ A;  1WMH B;  1ZXI A;  4S0R A;  1NI2 A;  3H9D A;  3OAW A;  5KHO A;  3W5V B;  1R4N B;  1YIW A;  3VTU A;  4W9F A;  3ZIM A;  2KJR A;  2KN5 A;  4M0W A;  1ENF A;  2IJ0 A;  2PE9 A;  3Q3O C;  1M94 A;  3ZO5 B;  1ZKH A;  2MJE A;  3I57 A;  1YD8 U;  2DX5 B;  4AJY B;  3T3O A;  3SU8 X;  2DWQ A;  4AUQ C;  4FUL A;  2YEP B;  4A8X C;  4P1C C;  2BPS A;  3EGR A;  1FFV A;  2BF8 B;  1ISN A;  3TBL D;  1L6V A;  2J0J A;  3AE9 B;  1TT5 B;  4LLG M;  3W9C B;  4BVU C;  2JF5 A;  3N1Z C;  3AU4 A;  3NZS A;  2HTH A;  1GNU A;  1M4V A;  3LJ3 A;  1WRI A;  3Q8E A;  4G11 A;  3NY5 A;  2J42 A;  3L4P A;  2WDV B;  1D3Z A;  3A4R A;  5GMV A;  2N7J A;  2WWZ A;  2N1W A;  1F77 A;  1OTR B;  2TSS A;  2NTS A;  2WX0 A;  4IM0 A;  3FC4 A;  2CU1 A;  3R66 C;  2B3A A;  2KC2 A;  5IAA C;  5AZG A;  4BOZ B;  3SEB A;  2MQJ A;  3H7P B;  3ZKJ C;  4WQM A;  3DHI C;  2PMV A;  3TEW A;  3WAL A;  4DDI D;  3Q8C A;  1Q0W B;  4F1S A;  3Q14 C;  1KM7 A;  2G1E A;  2WXO A;  1MVK A;  1K53 A;  4MEL A;  4MGZ E;  5L95 C;  4S17 A;  3HVD A;  4WWP A;  4YSY B;  2JPH A;  3D32 A;  4G50 A;  4B95 A;  2WQY B;  3CWI A;  1VD2 A;  4I6L B;  1WM3 A;  2D10 A;  2FCQ A;  4IOI E;  2PPH A;  3AN1 A;  2N9K A;  5D3D A;  1QF6 A;  4BKG A;  3BZD B;  1WH3 A;  3FIL B;  5G55 A;  1L0Y B;  2LVO A;  2MBE A;  3V05 A;  4OVV A;  5IP4 D;  3WAM A;  1F2R C;  3M3J A;  4DK5 A;  3I3T B;  1XD3 B;  1PGX A;  4NAW A;  1YOV B;  2FCN A;  2V3S A;  4OVU A;  4M8M A;  3UIO B;  3VH4 B;  1HZ6 A;  3CMM B;  3RYT A;  1ZW7 A;  2I38 A;  3RD2 A;  1K8R B;  4BBN F;  1V1O A;  3Q8A A;  3PLU A;  1I4P A;  1S3S G;  4KDI C;  1MPE A;  2LXC A;  1GUA B;  2KFK B;  3FKY A;  2BS2 B;  1AYF A;  4HXD A;  3TCA A;  1VDV A;  2FCM A;  3AE1 B;  4LNI A;  1YQ4 B;  3VXW A;  3P42 A;  1RFK A;  3KUZ A;  1P98 A;  5CHF A;  2N9X A;  4WUR A;  3CIR B;  1EF5 A;  3AEE B;  1UH6 A;  2JXX A;  5BMI A;  1QKZ A;  4XDD A;  1TY2 A;  4NQK E;  2MHJ A;  3ZRF A;  1Z2M A;  4EZJ A;  1LXD A;  3AMZ A;  3E9S A;  2MJ3 A;  1BML C;  1TYG B;  2K8C A;  1X1M A;  2HTM E;  2RDH A;  3OWE B;  4IWO A;  5TR5 A;  3AEB B;  4F8C B;  3IXS A;  4WAF A;  3VUY A;  3OJ4 B;  5G5H A;  3ZDM C;  2XK5 A;  3AV8 A;  2NVU I;  4DHZ B;  2EKE C;  4AS1 A;  1DOX A;  5AEK B;  2LMC A;  4NNJ B;  1T0Y A;  1DGJ A;  4D2K A;  2KKC A;  2MW5 A;  1TGZ B;  3RT3 B;  1ET9 A;  1QLB B;  1EU4 A;  3U7D A;  4DXF A;  3P63 A;  3AE8 B;  1P7F A;  4MEM A;  2LHD A;  3LB8 C;  4EOY A;  4JE3 B;  4FXC A;  3TEY A;  1L4Z B;  1SXT A;  2H88 B;  3GS2 A;  2MBQ A;  2JX5 A;  2OJW A;  2KJH B;  2KTR A;  4YTM B;  2JVC A;  2Q5W D;  4DQO C;  2EEL A;  1YJI A;  3MC0 B;  4TMA B;  1C4A A;  4O1N A;  4NZL B;  2WXH A;  2M0A A;  4ARI A;  4ASW C;  4M0W B;  5CHW A;  1JWU D;  4NAM A;  1N5W A;  3VUX A;  2XEW A;  2R2Q A;  4B0E A;  2IZV B;  3U7Z A;  4KGR A;  2BGF A;  4RM8 A;  1V5O A;  4LDT B;  3HM3 A;  2GRI A;  2L76 A;  2DHZ A;  1EWY C;  4GDL B;  3ZRC A;  1PGB A;  2MP2 A;  4B6W A;  4N6E B;  1EF1 A;  1EWC A;  1VLB A;  2RDG A;  4CQN A;  3VUW A;  4F7Z A;  4LNN A;  1JQ4 A;  3PT2 B;  3URY A;  2WDR B;  3KUD B;  1WJN A;  2D11 A;  4GMV A;  2G4S A;  1F0Z A;  4II2 B;  3SFD B;  1D4B A;  4HCP B;  2FUG 1;  2GLS A;  2WHI A;  1L7Y A;  3PZ8 A;  3H8H A;  3ML8 A;  2MLB A;  3KUC B;  3RPF C;  2DEN B;  2IYD B;  5AZF A;  3NZ3 A;  3R2I A;  3V60 A;  2K5P A;  2VH1 A;  2O2V A;  3NRZ A;  2KQ7 A;  2DAF A;  3V3X A;  3RN9 C;  4JWS C;  4WWN A;  3UIP B;  3KYC D;  1GJZ A;  3WCQ A;  3IFW B;  1DOY A;  2FAZ A;  2KMM A;  3PRM B;  1P0R A;  3HUI A;  2W3R A;  4J3O D;  1VR9 A;  3WIM A;  1B9R A;  1C4P A;  2AEH A;  2L7R A;  4IUM B;  1L5P A;  3H6N A;  4ZHO A;  2J4X A;  3E56 A;  4YSX B;  2AL3 A;  2MRP A;  2JWU A;  1R7S A;  1WE6 A;  3N30 A;  2RDB C;  1BUI C;  3TSS A;  1SIF A;  1WGD A;  2CJN A;  4I6P A;  3W5U B;  1XF5 L;  5LNK 1;  1NDD A;  2LZ6 A;  1WFY A;  4W9G A;  3PRP B;  1VCB A;  4HPL B;  3ZDT A;  5IOI A;  1YN4 A;  1J19 A;  3ABV B;  3NVZ A;  3Q8B A;  1PDX A;  1PGA A;  4JQW C;  2KD0 A;  3P2B A;  2RSU A;  3T3N A;  1UGJ A;  2FIF A;  4BAX A;  4IWP A;  4WJP A;  1ESF A;  3ZNZ B;  1LO5 D;  4NPN A;  3A1Q A;  5C3J B;  4ZHP A;  2KFJ A;  2V4L A;  2PE6 B;  3IT6 B;  2EKI A;  1FCC C;  3PV1 A;  1DOI A;  3DBS A;  4GDK A;  2LUM A;  1SE9 A;  3ZNI D;  1TS2 A;  5DCN A;  2KJ6 A;  1P1A A;  4YTN B;  1HEZ E;  1FRD A;  2LJ5 A;  4JWU C;  5D7G A;  5D2M B;  1GAQ B;  3U4E G;  1EO6 A;  4ZYS A;  5G2N A;  2JZ3 B;  1KFY B;  2Y5B B;  2KX0 A;  1CJE A;  1WGR A;  2XK5 B;  1IBX A;  3Q3M C;  3A9J A;  4W9H A;  4AWJ A;  4ICV A;  2WP9 B;  5BYQ A;  2K9X A;  3APC A;  4RF0 A;  2SAK A;  4WWM A;  1TIF A;  2R61 A;  3VQI A;  2BT6 A;  2W54 A;  4LJP B;  4RGN A;  5C23 A;  1LGR A;  2CS4 A;  3AE7 B;  3QHT A;  1XLO A;  5HI1 A;  4MGY E;  3QK0 A;  4HKQ A;  2Z0D B;  1JRP A;  3PVL A;  4GU2 A;  4EUT A;  2KTR B;  1N6Z A;  4IW0 A;  2DYM A;  2ON8 A;  4IDI A;  2K22 A;  3SFE B;  3IAM 1;  4HRO A;  3DBL I;  2AQ3 B;  2MX2 A;  1FNV A;  1L0X B;  3MP9 A;  3V61 A;  1RLF A;  2VH2 A;  2FNJ B;  2LGI A;  2LHE A;  4W9D A;  2KQ4 X;  1QZE A;  3DOW A;  4FJZ A;  2QHO A;  2L0F A;  4ANW A;  2KO3 A;  1V8C A;  2DNF A;  3DPD A;  2DYO A;  4XZ4 A;  2WXR A;  4JLC A;  1F9J A;  4HK2 A;  3IT4 B;  4BFR A;  1CMX B;  3L54 A;  4P7I A;  3SR6 A;  1SJH D;  2D2Q A;  4MH0 E;  1L4D B;  2WU5 B;  2KX3 A;  1XEE A;  1WXV A;  2DZK A;  2MP2 B;  4YTP B;  1E6E B;  3DVG X;  2ZCB A;  3NZU A;  4DBG A;  5E6O A;  2V0G A;  4W9L A;  3M62 B;  3MJ5 A;  4TUU A;  3TJP A;  1PUT A;  1XQQ A;  4LK0 M;  1VZ8 A;  1WIA A;  1FPY A;  2QCZ A;  3H1U A;  2PKO A;  1WJU A;  2ZCC A;  2JWZ A;  2HJ8 A;  4W9I A;  3NHE B;  3A9K A;  2LUE A;  3P4S B;  1FXA A;  2O2V B;  5BYS A;  1I4Q A;  4H2A A;  3SHQ A;  2GBR A;  4EZL A;  1LFD A;  3BII D;  1JWA D;  3RMK C;  2KHW B;  3JW0 X;  3PSE B;  2BS4 B;  1WGY A;  2BBC A;  2AWT A;  2V1Y A;  2WXJ A;  2WXQ A;  1WX7 A;  2JRI B;  4MDK E;  5EE3 A;  1HE8 A;  4JPS A;  3X0W A;  1WE7 A;  4NY0 A;  3TEZ A;  1T3Q A;  5FKA C;  2CKH B;  3AI5 A;  4CHK A;  4RCO A;  4MSM B;  2HDE A;  2KDI A;  2R2O A;  4M8N A;  3L0W B;  3VVW B;  2IO1 B;  3K9P B;  3Q3J A;  3L13 A;  2BQQ A;  2W9N A;  3ALB A;  3KQ4 A;  4BKS D;  1IYF A;  2KOX A;  4A9A A;  2K0P A;  1C4C A;  3AE2 B;  2YLM A;  2MSE D;  4MT5 A;  1K51 A;  3QX1 A;  4K3C A;  2J52 A;  2Z59 B;  2BYV E;  1ZDV A;  2K8B A;  1T0S C;  2JY6 A;  1OFF A;  3RFZ B;  1SE3 A;  2QIL A;  2DBY A;  4C80 A;  4HLE A;  4IWQ A;  2BWF A;  3KWV A;  2D07 B;  2VRR B;  1WGK A;  4FLH A;  1MJD A;  4DXA B;  3A1Q B;  2M1M A;  2V3P A;  5L83 A;  4GB9 A;  3RNE C;  1WGH A;  2FID A;  4XGA B;  2LI5 A;  3UQA A;  5HG2 A;  1T0Q C;  1HTO A;  2PJH A;  4MM3 B;  4FHK A;  1OGW A;  3ENE A;  1CK1 A;  2K1F A;  3ECI A;  1EM7 A;  4GDK B;  3GOE A;  2WXI A;  2WDQ B;  2BS3 B;  3W1S C;  2L8J A;  1V9J A;  4FHJ A;  3BK2 A;  4XC2 A;  2C5L C;  3AEA B;  1FEH A;  4ZRQ A;  1I42 A;  2WXL A;  3C0R B;  3AE6 B;  1UBI A;  3HK0 A;  4GXB A;  4KIK A;  1AAR A;  2BKR B;  3NS8 A;  4E71 A;  5CTR C;  1OQR A;  2IPK D;  3A33 B;  4II3 B;  1Q10 A;  5H92 C;  1IBX B;  3A9J B;  2FUH B;  3P4R B;  3AXC A;  2WXG A;  4YSZ B;  3QJZ A;  1MG4 A;  3ZNG C;  1WXQ A;  3AUL A;  4ARC A;  2W55 A;  1TKY A;  1WRD B;  1FRR A;  1K52 A;  4LNK A;  1RYJ A;  3RNC C;  1UF0 A;  3GE3 C;  2M0X A;  2LFI A;  3BK1 A;  4IM2 A;  3PTF C;  2ZNV B;  1S1Q B;  1KLU D;  3QCA A;  1J7B A;  3ZTC A;  4P16 A;  1Y8R C;  2ZW0 A;  1ACC A;  2PEA A;  4KVG B;  1C1Y B;  3C8Y A;  3N20 C;  4URK A;  4KGT A;  1FXT B;  4FBJ B;  4FA6 A;  1XCQ L;  2ICI A;  4LDT D;  2K8H A;  2J0M A;  1U4A A;  2VZK D;  1ROE A;  1WX8 A;  2X38 A;  4C7Y A;  3R2T A;  3ZJT A;  3RCZ A;  1DYQ A;  5IO9 A;  1SE4 A;  1TS4 A;  3EFC A;  3ZW3 A;  1KOT A;  1WZ0 A;  1QOG A;  3AM9 A;  1SF0 A;  4DXG A;  3IHP C;  2G9H D;  2WXF A;  4XDC A;  3SD5 A;  5EE9 A;  3QWZ B;  3DBL B;  1N60 A;  2RR9 A;  4FJY A;  2QDF A;  1TZO A;  5LLI A;  4A90 A;  1WYG A;  2YEP F;  2ZW1 A;  4EE2 A;  4LTU A;  1SEB D;  1QIL A;  1ET6 A;  5FK9 C;  3I5J C;  1GPX A;  2E3T A;  2LGS A;  3A9K B;  3EA6 A;  2ZPY A;  3AE5 B;  2LD9 A;  3BVM A;  1N62 A;  1AWD A;  1E8W A;  3U8Z A;  4GOC A;  5JH5 C;  1NI3 A;  2N1V A;  5J18 A;  2CHW A;  3VR8 B;  1MI0 A;  4KSL C;  4L1B A;  4LNF A;  2M4N A;  1CZP A;  1L0V B;  2DZI A;  4MJS A;  1SGH A;  2OJR A;  3AEF B;  3PO0 A;  2VZK B;  3BVG A;  2QSD A;  1WJ4 A;  4DHJ B;  1YJ1 A;  4GSW A;  1T0R C;  1FM0 D;  1MG8 A;  2KWD A;  1PQS A;  1C79 A;  2C7H A;  3DBR I;  5FR6 A;  1A5R A;  1STE A;  2W82 A;  3VTV A;  4YT0 B;  3QAQ A;  1ZP0 B;  2IY0 B;  3Q3N C;  1WXM A;  5DPT A;  2WNM A;  4LJO B;  4A55 A;  4DWF A;  2J0K A;  3MJW A;  4EZK A;  2AL6 A;  1V2Y A;  3AEC B;  1OQY A;  4Q2J A;  4FJV B;  1V5T A;  1FO4 A;  4EKU A;  4RMA A;  2JRH A;  2QIE B;  5HFY A;  2K6Q A;  3NVV A;  4KGS A;  5C2T B;  1QOB A;  1E8Y A;  2KYW A;  2W3S A;  5CX3 A;  1NEK B;  2KMC A;  4WJN A;  4JX1 C;  1T6B X;  5DPW A;  2N9E B;  2LGX A;  2M19 A;  1L6U A;  3H7S A;  4M01 A;  4PK1 A;  2KWC A;  2DZJ A;  1J8C A;  2NTT A;  4DHZ E;  2G4D B;  5G5G A;  4HRS A;  1AN8 A;  5AZH A;  3N3K B;  2MBB B;  1TS3 A;  1E8Z A;  3LXF A;  2CU3 A;  3IVF A;  2X8X X;  1RM6 C;  1FNW A;  2QEJ C;  2KQS A;  4CYE A;  2LVP A;  3QIJ A;  5DPS A;  2DYB A;  5JHA A;  1WZ3 A;  1YNT E;  3Q2A C;  3JSV A;  2INP E;  3NVW A;  2NR2 A;  3JVZ X;  2D3B A;  2K6D B;  5AUK A;  2KDE B;  3RNB C;  1F2R I;  3EEC A;  2DZM A;  2NS5 A;  3PS6 A;  4NAW B;  1OEY J;  2WGS A;  2CJO A;  3MTN B;  2WLB A;  5DPR A;  3TUO A;  2KDB A;  4RGO S;  2IY1 B;  4WH4 A;  4JIO U;  2Y5C A;  1N63 A;  2REX A;  2V3N A;  4XX5 A;  3W1S A;  2K3U A;  4ACF A;  2SEB D;  3DHG C;  4QAY A;  3U52 E;  2NBW B;  1RFA A;  4P1B C;  1Y56 A;  2KWV B;  2KAN A;  5JZE B;  2NBV B;  3VH3 B;  2BB5 A;  2KDF B;  3M95 A;  3L08 A;  2OOB B;  1V1P A;  4W9K A;  3PLV A;  3NVY A;  3PRZ A;  2PIA A;  5IN7 A;  2D3A A;  2HJ1 A;  4A3O A;  5BO4 B;  2WX1 A;  2XN9 C;  2M17 A;  4FN2 A;  4GN1 A;  1UD7 A;  1TKG A;  2KVR A;  3DQV A;  1LQB A;  1UGM A;  1XLP A;  2D3C A;  1FIQ A;  3ONS A;  1UBQ A;  5H8Y E;  2JYT A;  4AJW A;  1LM8 B;  4WIP A;  3PRE A;  5EE1 A;  1NYQ A;  3P4P B;  2OED A;  1AW7 A;  4ZRJ A;  3Q3F A;  4KSK C;  1IUE A;  4HPP A;  2CHX A;  1WXA A;  2GBJ A;  1A70 A;  2CR5 A;  4BOS C;  2G3Q B;  4WJO A;  4FAD A;  2GB1 A;  1XXG A;  3VTW A;  1WGG A;  3I63 C;  3VAW A;  2NPT A;  4WQO B;  2CHZ A;  1GC7 A;  3VFK A;  1QQR A;  2PLP A;  1YX5 B;  4K1R B;  1UZX B;  2L83 A;  2N0S B;  3EHV A;  4ICU A;  4W9E A;  1TZ1 A;  5J2R A;  2GOW A;  3QA8 A;  3AED B;  1I4H A;  2GMI C;  2LJI A;  1YQB A;  2M8S A;  2LRU A;  1XT9 B;  3BWU D;  5LXI B;  4DDG D;  2IGG A;  4RFB A;  3UGB B;  4TSS A;  4USA A;  4HJK A;  3M63 B;  4UDU C;  1UWM A;  1WX9 A;  3ZQ4 A;  1I35 A;  3R3M A;  4IG7 B;  1J7C A;  2QJL A;  1BXT A;  1ZUD 2;  2K39 A;  3PZD A;  3RZW C;  2C9W B;  4GLS C;  1ZOY B;  1IGC A;  1VRA B;  2Z8L A;  3NUH B;  1SB3 C;  1JWM D;  2L52 A;  4A20 A;  1R4M I;  2ZVO A;  3BY4 B;  2UYZ B;  2GBN A;  2PTL A;  3BIN A;  2PW9 A;  3UIN B;  3B2G A;  2KMA A;  2PVO D;  1V49 A;  5KHQ A;  4XYC A;  2ZPN A;  3ZJU A;  3TEX A;  2EMT A;  3RNF C;  4M02 A;  3T8M A;  1H8C A;  3IAS 1;  4NJ7 A;  2QC8 A;  3DBR B;  1E0Z A;  3R7R A;  2EMS A;  2UWQ A;  4HWI B;  1N5X A;  5LXH A;  3VRA B;  4ZDV A;  5I4D A;  4B9K A;  4TV3 A;  5J17 A;  4XWT A;  1JRU A;  4ZYN A;  1IGD A;  3AE3 B;  1E5W A;  2Z0E B;  3ZNH B;  1FMA D;  5IKC M;  2AQ2 B;  4TKN A;  1XCT L;  4ITK A;  1SSN A;  2INC C;  1P7E A;  3DVG Y;  2IDY A;  2BYT A;  3JSV B;  3ML9 A;  4GDL A;  3AEG B;  3TMP B;  1EUV B;  4PS7 A;  4TQ1 A;  3APD A;  1JWS D;  2KXJ A;  3GP7 A;  2KWU B;  1V6E A;  3HHM A;  3KYD D;  4LCD E;  2I1K A;  1SIJ A;  1KRH A;  3LYY A;  2L3Z A;  4HDO A;  2JQR B;  5E6J A;  3LDZ E;  4KZC A;  4I6N B;  2RPV A;  5E6N A;  2JZP A;  3DBH B;  3GB1 A;  1JAL A;  2KZR A;  2QMT A;  2IO0 B;  4K7U A;  1WXS A;  2WYQ A;  4RNA A;  2WXN A;  2MEK A;  3OLM D;  1V1P B;  3GZN I;  3RZF A;  2KTF A;  3BYY B;  3AH7 A;  4KZ0 A;  1QT9 A;  1H4R A;  1QOF A;  1C9F A;  4IM3 A;  1V80 A;  1FD6 A;  1HQR D;  3U2S C;  2L00 B;  1V81 A;  1B1Z A;  4HKZ E;  1CQV A;  3APF A;  5EE0 A;  4OHJ A;  1JW9 D;  2BB6 A;  4G3X B;  4JL9 A;  2AX5 A;  1C76 A;  1WWT A;  3QC8 B;  4OW0 A;  2HE7 A;  4L2Y A;  4L23 A;  1I4G A;  3B0A A;  2WXP A;  4KKI A;  3AB5 A;  4CO7 A;  3ZXV A;  3U30 A;  3MC8 A;  3L16 A;  1TBE A;  2NPT B;  4RGM A;  1PFD A;  2MH7 A;  2MBH A;  4PYU A;  2D3G A;  4KDL B;  2KVZ A;  3MFG A;  4C4V A;  3BVZ A;  4PS8 A;  2LAS A;  4E3C A;  2Y3A A;  2JYE A;  4P6V F;  3KH0 A;  1GC6 A;  3L10 B;  4EFO A;  3RNA C;  1EU3 A;  1PYW D;  3DHH C;  2KK8 A;  1E9M A;  3RUI B;  2KDM A;  4MSQ B;  2BYF A;  2ONQ A;  2C7N B;  3PHW B;  4YXD B;  4US8 A;  2RD0 A;  1TY0 A;  1WR1 A;  3Q8F A;  4DHJ D;  1E8X A;  1D5M C;  4OZC A;  5E6P A;  1IP9 A;  2RMM A;  2UU7 A;  4W9C A;  1FFU A;  2MBO A;  1RWS A;  4HJG E;  5CHV C;  3V6C B;  1XLN A;  2NBU A;  4RGT A;  2JU6 X;  4K7S A;  4C56 C;  1TKE A;  4PT5 A;  4WAA A;  2FE8 A;  2ZNV C;  3O65 B;  3DWG C;  1G6J A;  5BMH A;  3K9O B;  2ASQ A;  4C7Z A;  3WAP A;  3T9L A;  3RUL A;  2IND C;  3KW5 B;  1WI0 A;  5D3I B;  3TIX A;  4BKT A;  3HRD D;  2BVC A;  3R8B A;  2XBB C; 
#chains in the Genus database with same CATH homology
 2LGY A;  2J7Q B;  1OEY J;  3PGE A;  2KO3 A;  3WAL A;  4DDI D;  1Q0W B;  4F1S A;  3DPD A;  1KM7 A;  3MTN B;  2DYO A;  4XZ4 A;  4JLC A;  5DPR A;  4MEL A;  1F9J A;  4MGZ E;  4HK2 A;  4BFR A;  2KDB A;  5L95 C;  2IY1 B;  3CF6 E;  1CMX B;  3L54 A;  2IO2 B;  4K7W A;  4JIO U;  4P7I A;  2D2Q A;  4WWP A;  4MH0 E;  2REX A;  2JPH A;  2NCN A;  3D32 A;  4G50 A;  3V6E B;  2JUO A;  3JYU A;  4GIV A;  4B95 A;  2KX3 A;  4HVB A;  4XX5 A;  1WXV A;  3HM6 X;  1VD2 A;  4I6L B;  3W1S A;  1WM3 A;  2D10 A;  2IBI B;  2DZK A;  2MP2 B;  2N7E A;  2NBW B;  3DVG X;  4PYZ A;  2ZCB A;  2FCQ A;  1RFA A;  2PPH A;  3NZU A;  4PS3 A;  2KWV B;  4DBG A;  2KAN A;  5E6O A;  5JZE B;  2NBV B;  3V62 A;  3VH3 B;  4W9L A;  3M62 B;  4BKG A;  1WH3 A;  4HDQ A;  4TUU A;  3TJP A;  4E74 A;  5G55 A;  2LVO A;  2MBE A;  2KDF B;  1XQQ A;  1V86 A;  3M95 A;  3L08 A;  2OOB B;  1WIA A;  4OVV A;  3WAM A;  3M3J A;  3UQB A;  4W9K A;  3I3T B;  4DK5 A;  3PLV A;  1XD3 B;  4NAW A;  3UIO B;  2FCN A;  2V3S A;  4OVU A;  3H1U A;  4M8M A;  3VH4 B;  3PRZ A;  1WJU A;  2ZCC A;  2JWZ A;  2HJ8 A;  3CMM B;  4W9I A;  2YVC A;  3NHE B;  1ZW7 A;  2RPQ A;  3A9K A;  3RD2 A;  3RYT A;  4A3O A;  1K8R B;  4BBN F;  3DCG A;  1R4N I;  5BO4 B;  3PLU A;  3ZUN A;  2ZJD A;  2LUE A;  2WX1 A;  2M17 A;  1S3S G;  2O2V B;  4FN2 A;  4KDI C;  4GN1 A;  3EFU A;  2BWE S;  1RRB A;  2FCS A;  2LXC A;  3SHQ A;  1GUA B;  2GBR A;  2A5U A;  1UD7 A;  4EZL A;  2KFK B;  1LFD A;  4AP4 C;  2KVR A;  3DQV A;  1LQB A;  1UGM A;  2KHW B;  4HXD A;  3TCA A;  3JW0 X;  3PSE B;  2FCM A;  1UBQ A;  3ONS A;  3DDC B;  1WGY A;  2N7D A;  2AWT A;  2V1Y A;  3X23 A;  2C7M B;  2O6V A;  4AJW A;  4ANU A;  4NQL B;  3VXW A;  1LM8 B;  1WX7 A;  2JRI B;  4MDK E;  3IG3 A;  3PRE A;  2LWP A;  1P98 A;  3KUZ A;  1WMH A;  5CHF A;  1HE8 A;  3PHX B;  3X0W A;  1WE7 A;  4A3P A;  2N9X A;  3L17 A;  1WR6 E;  2JT4 B;  4NY0 A;  4JGH B;  4ZRJ A;  1EF5 A;  3Q3F A;  2KNB A;  4KSK C;  2CKH B;  1UH6 A;  3AI5 A;  2JXX A;  4CHK A;  2ZZP B;  2CHX A;  4MSM B;  2KDI A;  1WXA A;  2R2O A;  4M8N A;  4NQK E;  1Z2M A;  3ZRF A;  3L0W B;  3VVW B;  2IO1 B;  2GBJ A;  3K9P B;  3Q3J A;  2CR5 A;  3PPA A;  4ANV A;  4BOS C;  4EZJ A;  1LXD A;  3L13 A;  2W9N A;  3ZLZ A;  4YL8 A;  3ALB A;  2G3Q B;  4WJO A;  4BKS D;  4FAD A;  1IYF A;  2KOX A;  1E90 A;  3MHS D;  2K8C A;  3VTW A;  1X1M A;  1WGG A;  3VAW A;  2NPT A;  4ZRK A;  2RGF A;  4HCN B;  4WQO B;  3VHT C;  4IWO A;  2CHZ A;  5TR5 A;  1GC7 A;  3VFK A;  2YLM A;  4F8C B;  2MSE D;  1ZGU B;  3VUY A;  3OJ4 B;  1YX5 B;  4GGQ A;  2XK5 A;  3DBH I;  3ZDM C;  3QX1 A;  3NOB A;  4K1R B;  3W1Y A;  2LGD A;  5C1Z A;  1UZX B;  2N4F A;  2NVU I;  2Z59 B;  4DHZ B;  3EHV A;  4ICU A;  3TL5 A;  2BYV E;  2EKE C;  4W9E A;  5D6J B;  2K8B A;  1TZ1 A;  5J2R A;  2JY6 A;  2GOW A;  5AEK B;  2L05 A;  3QA8 A;  4NNJ B;  1T0Y A;  3S2A A;  2KKC A;  2MW5 A;  4KIK B;  1TGZ B;  3RT3 B;  2KC1 A;  4HLE A;  2MCN B;  1BT0 A;  4IWQ A;  4X57 B;  2GMI C;  2BWF A;  4MGK E;  2D07 B;  3U7D A;  1WM2 A;  1YQB A;  2KLC A;  2VRR B;  2M8S A;  4FLH A;  2LRU A;  1XT9 B;  1J0G A;  4MEM A;  4DXA B;  3A1Q B;  2M1M A;  4EOY A;  5LXI B;  5L83 A;  4GB9 A;  1WGH A;  2FID A;  4DDG D;  2A4Z A;  2LI5 A;  1KLV A;  3UGB B;  3B08 A;  3UQA A;  2PJH A;  4FHK A;  1GG3 A;  1OGW A;  2LRW A;  3ENE A;  2K1F A;  3ECI A;  4HJK A;  3M63 B;  4GDK B;  3GOE A;  2MBQ A;  3WAO A;  2KJH B;  1WX9 A;  2KTR A;  2JVC A;  1I35 A;  3W1S C;  2L8J A;  3R3M A;  1V9J A;  1YX6 B;  2I1J A;  4IG7 B;  3R7Q A;  4FHJ A;  2L0T A;  4XC2 A;  3CSF A;  2C5L C;  2N9P C;  1I42 A;  1E7V A;  2LVQ A;  2K39 A;  3PZD A;  3H7P A;  3C0R B;  1WJ6 A;  3RZW C;  2C9W B;  1UBI A;  4ASW C;  4M0W B;  3HK0 A;  5CHW A;  4GXB A;  3DVN V;  4TQ0 A;  4KIK A;  3VUX A;  1AAR A;  2BKR B;  4A20 A;  3NS8 A;  2XEW A;  2R2Q A;  4ZRI A;  1R4M I;  4E71 A;  2IZV B;  2ZVO A;  3BY4 B;  2UYZ B;  2GBN A;  3BIN A;  5CTR C;  3UIN B;  2BGF A;  3A33 B;  4II3 B;  2KMA A;  4RM8 A;  1V49 A;  5KHQ A;  1V5O A;  4LDT B;  3HM3 A;  2L76 A;  2DHZ A;  2ZPN A;  4AOF A;  2EMT A;  3A9J B;  4GDL B;  4MM3 A;  2FUH B;  2GBM A;  3T8M A;  3ZRC A;  3AXC A;  4NJ7 A;  4ANX A;  2AYO B;  3QJZ A;  1H8C A;  2BYE A;  4K81 A;  3ZNG C;  2MP2 A;  1UEL A;  3CST A;  4B6W A;  3AUL A;  3R7R A;  5JHB A;  1L2N A;  2EMS A;  3EC8 A;  3QAR A;  1EF1 A;  2UWQ A;  4HWI B;  1C3T A;  5LXH A;  4ZDV A;  1WRD B;  3VUW A;  4F7Z A;  3QQ8 B;  4B9K A;  3ZTD A;  3PT2 B;  4KV2 A;  4TV3 A;  5J17 A;  1RAX A;  1WJN A;  2D11 A;  3KUD B;  2G4S A;  4GMV A;  4II2 B;  4HCP B;  1JRU A;  2M0X A;  4ZYN A;  1KJT A;  1L7Y A;  1WYW B;  3ML8 A;  2MLB A;  4IM2 A;  3PTF C;  4IC7 B;  2JZZ A;  2K25 A;  3KUC B;  1E5W A;  2Z0E B;  3ZNH B;  2DEN B;  2IYD B;  2ZNV B;  4BKS A;  5HKH A;  4TKN A;  5AZF A;  1S1Q B;  3V60 A;  3QCA A;  1Z5S B;  3ZTC A;  3IBE A;  4HPM B;  3DVG Y;  1Y8R C;  2PEA A;  4KVG B;  2O2V A;  1C1Y B;  3JSV B;  3ML9 A;  3A4S C;  4URK A;  2KQ7 A;  4GDL A;  2DAF A;  1FXT B;  3TMP B;  1EUV B;  4PS7 A;  2KFK A;  5EDS A;  4TQ1 A;  3B1L X;  3APD A;  3N32 A;  4FBJ B;  1IPG A;  1Q5W B;  1TTN A;  2IO3 B;  4WWN A;  4FA6 A;  2G45 B;  3UIP B;  4LDT D;  2K8H A;  2KXJ A;  3KYC D;  3VDZ A;  2KWU B;  1GJZ A;  2O6V D;  1V6E A;  3HHM A;  2J0M A;  1U4A A;  3IFW B;  3KYD D;  1WX8 A;  4LCD E;  2FAZ A;  3PRM B;  1P0R A;  2I1K A;  3RCZ A;  3OJ3 A;  3ZW3 A;  2L3Z A;  1Q1O A;  1KOT A;  1WZ0 A;  2C60 A;  3WIM A;  2WDT B;  2AEH A;  2LXA A;  4HDO A;  5IA7 A;  2L7R A;  4IUM B;  3IHP C;  4W9J A;  3H6N A;  3WAN A;  1E7U A;  3LDZ E;  4KZC A;  2AL3 A;  2MRP A;  4I6N B;  5E6N A;  3SD5 A;  1WE6 A;  3HIZ A;  2HD5 B;  3N30 A;  1WY8 A;  3QWZ B;  4MJS B;  2RR9 A;  4FJY A;  2KZR A;  1SIF A;  1WGD A;  4G0N B;  3AU5 A;  2IO0 B;  4K7U A;  1WXS A;  2WYQ A;  4I6P A;  5LLI A;  5D94 A;  1P9D U;  1NDD A;  2LZ6 A;  3KVF B;  1WFY A;  4W9G A;  2MWS B;  1P3Q U;  3OLM D;  3UF8 A;  1OEY A;  3PRP B;  1VCB A;  3GZN I;  4WWO A;  3RZF A;  2KTF A;  4ANW A;  4KZ0 A;  4HPL B;  1H4R A;  3ZVV A;  2ZEQ A;  3SDL C;  3ZDT A;  2KLG A;  2ZVN A;  3A9K B;  4IM3 A;  1J19 A;  2ZPY A;  3DVN U;  1V80 A;  2LD9 A;  4JQW C;  2KD0 A;  3P2B A;  1E8W A;  3U8Z A;  4GOC A;  3WA0 A;  2RSU A;  2MA9 B;  5JH5 C;  4NJ6 A;  2FIF A;  4RM9 A;  4EEW A;  2N1V A;  2L00 B;  1V81 A;  5J18 A;  2CHW A;  4IWP A;  4KSL C;  4WJP A;  2M4N A;  2BKF A;  4WJQ A;  3ZNZ B;  1WF9 A;  4BBN C;  3APF A;  2DZI A;  4MGI E;  4NPN A;  4MJS A;  3A1Q A;  1SGH A;  2OJR A;  2KFJ A;  4N9F 4;  2V4L A;  2O6V B;  4J6I A;  2PE6 B;  2GBK A;  1NBF C;  4G3X B;  1WJ4 A;  4JL9 A;  4DHJ B;  1YJ1 A;  4GSW A;  2DAJ A;  1WMH B;  3PV1 A;  1NI2 A;  1MG8 A;  3DBS A;  4GDK A;  3H9D A;  1PQS A;  3QC8 B;  3OAW A;  5KHO A;  1SE9 A;  2C7H A;  3DBR I;  3ZNI D;  5FR6 A;  2HE7 A;  1A5R A;  3VTV A;  3QAQ A;  5DCN A;  2KJ6 A;  3B0A A;  1YIW A;  2IY0 B;  1P1A A;  3VTU A;  1WXM A;  4W9F A;  3ZIM A;  5DPT A;  4CO7 A;  2KJR A;  4LJO B;  4DWF A;  2J0K A;  2KN5 A;  3U30 A;  3MJW A;  2LJ5 A;  4EZK A;  2PE9 A;  2AL6 A;  3L16 A;  5D2M B;  5D7G A;  1V2Y A;  1M94 A;  3ZO5 B;  1ZKH A;  1EO6 A;  1TBE A;  1OQY A;  2NPT B;  5G2N A;  2JZ3 B;  4FJV B;  1YD8 U;  1V5T A;  2DX5 B;  2Y5B B;  2MBH A;  4AJY B;  2KX0 A;  4PYU A;  2D3G A;  4KDL B;  4EKU A;  4RMA A;  2JRH A;  4PS8 A;  2LAS A;  1WGR A;  2K6Q A;  3SU8 X;  2XK5 B;  4E3C A;  4AUQ C;  4FUL A;  1E8Y A;  3A9J A;  3KH0 A;  1GC6 A;  4W9H A;  2BPS A;  5CX3 A;  2KMC A;  3L10 B;  4WJN A;  4AWJ A;  4EFO A;  2KK8 A;  4ICV A;  2BF8 B;  1ISN A;  3RUI B;  4MSQ B;  2BYF A;  3APC A;  5DPW A;  3TBL D;  2C7N B;  3PHW B;  2J0J A;  2N9E B;  2LGX A;  2RD0 A;  3H7S A;  4BVU C;  1WR1 A;  3VQI A;  2JF5 A;  2KWC A;  4LJP B;  2DZJ A;  4DHJ D;  1E8X A;  1J8C A;  3AU4 A;  3NZS A;  2HTH A;  2G4D B;  1GNU A;  5C23 A;  4DHZ E;  5E6P A;  3LJ3 A;  1IP9 A;  5AZH A;  2CS4 A;  3N3K B;  4W9C A;  2MBB B;  4G11 A;  2MBO A;  3NY5 A;  3QHT A;  5CHV C;  1E8Z A;  4MGY E;  3V6C B;  1D3Z A;  3A4R A;  3QK0 A;  2Z0D B;  2NBU A;  4K7S A;  5GMV A;  3IVF A;  2WWZ A;  3PVL A;  2N1W A;  4GU2 A;  4EUT A;  2KTR B;  2KQS A;  4WAA A;  1OTR B;  2ZNV C;  4CYE A;  2LVP A;  4IW0 A;  2WX0 A;  2DYM A;  3O65 B;  3QIJ A;  4IM0 A;  5DPS A;  2DYB A;  5JHA A;  1WZ3 A;  3JSV A;  1G6J A;  3K9O B;  2CU1 A;  2ASQ A;  2NR2 A;  3DBL I;  3JVZ X;  3R66 C;  2B3A A;  2K6D B;  2MX2 A;  2KC2 A;  5IAA C;  5AZG A;  4BOZ B;  3WAP A;  2MQJ A;  3H7P B;  3V61 A;  3ZKJ C;  3T9L A;  3RUL A;  2KDE B;  1RLF A;  3EEC A;  3KW5 B;  2FNJ B;  1WI0 A;  2DZM A;  2NS5 A;  4W9D A;  3TIX A;  1QZE A;  3DOW A;  4FJZ A;  2QHO A;  3PS6 A;  4BKT A;  2L0F A;  2XBB C;  4NAW B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...