4W9CA

Pvhl:elob:eloc in complex with (2s,4r)-1-(3,3-dimethylbutanoyl)-4-hydroxy-n-(4-(oxazol-5-yl)benzyl)pyrrolidine-2-carboxamide (ligand 2)
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
103
structure length
101
Chain Sequence
MDVFLMIRRHKTTIFTDAKESSTVFELKRIVEGILKRPPDEQRLYKDDQLLDDGKTLGEGFTSQTARPQAPATVGLAFRADDTFEALIEPFSSPPELPDVM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Transcription elongation factor B polypeptide 2
publication title Structure-Guided Design and Optimization of Small Molecules Targeting the Protein-Protein Interaction between the von Hippel-Lindau (VHL) E3 Ubiquitin Ligase and the Hypoxia Inducible Factor (HIF) Alpha Subunit with in Vitro Nanomolar Affinities.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Ligase
total genus 25
structure length 101
sequence length 103
chains with identical sequence D, G, J
ec nomenclature
pdb deposition date 2014-08-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00240 ubiquitin Ubiquitin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 4w9cA00
3C0RB 4GDLB 3WIMA 4W9LA 1NBFC 5KHQA 1LM8B 4KSKC 5L95C 3H9DA 2ASQA 5AZGA 4FJZA 2DHZA 2M4NA 4JIOU 3WAOA 3EFUA 3PPAA 4GDKA 5AEKB 2WYQA 2KMAA 2LXAA 5E6PA 4DBGA 4I6PA 3MJWA 4KIKA 4IC7B 3D32A 2KANA 2PPHA 4ZYNA 3MTNB 2LJ5A 2MP2A 4K7SA 2LUEA 1UZXB 1WGDA 1Q1OA 1WI0A 2Y5BB 3B08A 3H7PB 1IP9A 4ZRJA 3PRPB 4W9FA 4W9EA 2PEAA 3VH4B 4G3XB 3VTUA 3AU4A 3S2AA 2QHOA 1EF5A 3JSVB 3X0WA 2BYEA 5J2RA 3HIZA 2DYBA 3A1QB 3L17A 1S3SG 1V86A 4LCDE 2PE6B 1P0RA 2MBEA 4KZCA 3HM6X 2NVUI 4MGYE 3ALBA 3VFKA 2GBKA 3ECIA 2KQ7A 4MJSB 3ZDTA 1UD7A 2FAZA 2KJHB 5JH5C 3WANA 3V6CB 4GOCA 4G50A 4WJNA 2KFKB 1WJNA 4FHKA 4B95A 3AXCA 3KYDD 3UGBB 2RPQA 3ZVVA 5AZFA 4BFRA 4NQLB 2NS5A 4JQWC 4FBJB 4KDLB 2G3QB 3I3TB 3OLMD 5JHAA 3PLVA 3UIPB 2K8CA 3UINB 1WF9A 2L0FA 4M8MA 2WX1A 3Q3JA 3VAWA 2FIDA 3CMMB 3M63B 3EHVA 2GBNA 4M8NA 2ZPYA 2ZVNA 4K7UA 2CKHB 2NCNA 4AWJA 4DXAB 1LQBA 1WGHA 4K1RB 2FCNA 4TKNA 4ANVA 4ANXA 3ZNHB 2NPTA 3KVFB 2R2OA 2EKEC 3CF6E 4CYEA 2KO3A 3VVWB 4JGHB 2GBJA 2C5LC 4IM2A 2AL3A 4AJYB 5BO4B 2O6VD 4F7ZA 2DZJA 4DHZE 2MW5A 1V6EA 4FN2A 3PTFC 1WX9A 4ASWC 2MCNB 3ZNID 1UBQA 2EMSA 4KIKB 1KOTA 5D7GA 1RFAA 1J0GA 1IPGA 1Q5WB 2C60A 3ZLZA 3PLUA 3ZRFA 4ICUA 4ZRIA 3RD2A 1WM3A 2D2QA 3QARA 2NBWB 1UBIA 2AYOB 2ZZPB 3QQ8B 2WDTB 2M17A 5C23A 3NOBA 1MG8A 4DK5A 3VUXA 4FLHA 4W9DA 3UIOB 4ANUA 3V62A 3U30A 3W1SA 4HLEA 2JZZA 1OQYA 3IHPC 3HM3A 3IFWB 1WGYA 2IBIB 2M1MA 3A4SC 3L16A 3PRMB 3X23A 3DBRI 3H6NA 4GSWA 4EUTA 4LDTD 2HTHA 1VCBA 2FCQA 4E3CA 3T8MA 1V81A 3HHMA 1JRUA 1P3QU 1Y8RC 2BF8B 2LGYA 2DENB 4I6LB 2BWES 4RM8A 4GB9A 2XBBC 2BWFA 4DHJB 2HD5B 2N9XA 2NBVB 4BKSD 2IO2B 1NI2A 3TCAA 4A20A 3W1YA 1J19A 4EZJA 3SDLC 2CS4A 3OJ4B 1TGZB 4MH0E 5CHVC 1Z5SB 3NS8A 5C1ZA 4BKGA 1WY8A 2HE7A 4IG7B 3VH3B 4ANWA 1AARA 3ZKJC 3ML8A 1GJZA 2XK5A 2KDFB 2KK8A 2KNBA 3DQVA 2KWCA 5E6OA 1GC7A 3DVGY 3JYUA 3A33B 1WJ6A 3APCA 4DDID 3A9JA 2AWTA 5DPSA 3EC8A 1FXTB 3QA8A 4DHZB 2O6VB 2REXA 2MRPA 2KMCA 2JT4B 2N1WA 4TQ1A 1SE9A 1WJ4A 2MBOA 2GBRA 4KSLC 1E5WA 1WXVA 2C7MB 2GMIC 5L83A 1TZ1A 1WXMA 2BGFA 2Z0EB 2IO0B 2V3SA 3QJZA 4EKUA 3KYCD 4JLCA 4NAWB 3TIXA 2KXJA 2KOXA 1KM7A 4W9GA 2R2QA 2LVPA 3RCZA 4AUQC 1I42A 3V6EB 3KW5B 1WE6A 3M62B 1VD2A 3N3KB 4BOSC 5D6JB 3OAWA 4MGZE 2L76A 3CSTA 4WJOA 4MSMB 5CX3A 4WWNA 3ZTDA 3VTVA 1K8RB 1WGGA 3VQIA 4HPMB 5DPWA 1F9JA 3WA0A 1WR1A 1WZ3A 3GZNI 2JUOA 1GUAB 2LRWA 2LXCA 3CSFA 4HDOA 1YX5B 4LDTB 4MGKE 4II3B 4TQ0A 2ZNVB 2IO1B 3DBHI 2MBBB 1P9DU 1TTNA 2KC1A 2YVCA 3ML9A 3TMPB 3W1SC 2LRUA 4DHJD 4JL9A 4K81A 3NZUA 2LD9A 2DAFA 3A9KA 4BOZB 1XQQA 5J17A 2LGXA 1ISNA 2G45B 2YLMA 2KLCA 4NJ7A 5LLIA 2MX2A 3RUIB 1E7VA 4NY0A 4YL8A 2ZNVC 3QC8B 2MLBA 2KWVB 4NQKE 4GU2A 4W9IA 5DPRA 1E8XA 3OJ3A 3QAQA 2N9PC 1YJ1A 2DZMA 4AP4C 1R4NI 4LJOB 3VUYA 3RZWC 4GDKB 3H7SA 4ZRKA 2UWQA 4W9CA 4IUMB 1T0YA 2K25A 1X1MA 2A4ZA 2FNJB 3AULA 3PRZA 4G11A 2MBHA 3QX1A 1LXDA 3P2BA 2MP2B 3QCAA 2KHWB 3DCGA 3JW0X 3SD5A 2BKFA 2J7QB 2KDIA 3ZO5B 3DOWA 2JY6A 2O2VA 2N7DA 3M3JA 1V49A 3K9OB 4W9JA 1S1QB 3DVGX 5IA7A 3PS6A 1SGHA 1E7UA 2KFJA 5JZEB 4PS8A 1V2YA 2RD0A 4GIVA 3R7RA 2CHZA 4HWIB 3IBEA 1WH3A 2BYVE 5CHWA 3RZFA 3VDZA 3R7QA 3APFA 4BBNC 2NBUA 3KUZA 3PV1A 2KN5A 1P98A 2LZ6A 1V9JA 1P1AA 3PZDA 1M94A 2LVQA 3B1LX 3L13A 4J6IA 2MSED 4KVGB 3AU5A 2UYZB 1GG3A 3V61A 3VTWA 2OOBB 4MELA 1Q0WB 2I1JA 1PQSA 4HXDA 4CO7A 4LJPB 4ZDVA 3H7PA 2JPHA 3SU8X 2KTFA 2CR5A 2KJ6A 3NHEB 5DPTA 3A9KB 1I35A 1WMHA 3N32A 1UGMA 2K1FA 1TBEA 2WWZA 3K9PB 4PS3A 4EZLA 4GN1A 3H1UA 2MBQA 3RT3B 3A1QA 2I1KA 3DBLI 4KZ0A 4ICVA 4OVUA 4BVUC 5D2MB 2DYOA 4RM9A 2EMTA 1V80A 2NPTB 3U8ZA 3EECA 2KLGA 2JZ3B 2B3AA 2N9EB 5HKHA 4IW0A 5IAAC 1OTRB 1Z2MA 2L7RA 4NJ6A 4HDQA 2J0JA 2DX5B 2BKRB 2GBMA 2L0TA 5TR5A 3UQAA 4EFOA 3PHXB 3O65B 4PS7A 3UQBA 2C7NB 1EF1A 4GXBA 4DWFA 1QZEA 2LWPA 5EDSA 2CHWA 4FJVB 4G0NB 4GMVA 4MM3A 5DCNA 2GOWA 1GC6A 3R3MA 3HK0A 3A4RA 3NZSA 3TBLD 1YIWA 4IWQA 1HE8A 2FCSA 1YQBA 2O2VB 4EOYA 1OGWA 2K39A 3DBSA 3L10B 1WR6E 3IG3A 3KH0A 3LJ3A 2W9NA 1E90A 2BYFA 3ZRCA 4F1SA 1EO6A 2N4FA 2ZCBA 2IO3B 1C1YB 2KDEB 3TL5A 2DZIA 3WAPA 4AOFA 2N7EA 1H8CA 5LXHA 1L7YA 3APDA 3LDZE 2V1YA 2XEWA 3ZTCA 1RLFA 1L2NA 3BY4B 3JVZX 2RSUA 3DVNU 2DYMA 4F8CB 1WX7A 2KQSA 1V5TA 2JRIB 2L00B 3L0WB 1E8WA 2KZRA 4N9F4 4MDKE 3BINA 1WE7A 3VUWA 4P7IA 1ZGUB 4KDIC 3PT2B 2FIFA 3Q3FA 2FUHB 1R4MI 1WJUA 2Z0DB 1WMHB 2KX0A 3VHTC 2KDBA 2JF5A 5AZHA 2KTRA 5KHOA 2LASA 4I6NB 2DZKA 2ZCCA 4PYZA 5CHFA 2MWSB 4II2B 2C9WB 4A3PA 1G6JA 2G4DB 4FA6A 1KLVA 4EEWA 4WQOB 2D3GA 5FR6A 1D3ZA 1EUVB 1UH6A 2XK5B 5JHBA 2ZVOA 1OEYA 3PSEB 4TV3A 4HVBA 3ENEA 1WX8A 1ZW7A 1WZ0A 1H4RA 2IY1B 5D94A 2G4SA 2AL6A 3A9JB 3PGEA 5J18A 4HCPB 4E74A 2WX0A 2ZJDA 2IYDB 3SHQA 2DAJA 4EZKA 2MA9B 3QK0A 1J8CA 2KX3A 2JRHA 4MGIE 2AEHA 2M0XA 5G55A 4NPNA 2ZEQA 3B0AA 3IVFA 4WWOA 1WGRA 4M0WB 4PYUA 4URKA 1ZKHA 2BPSA 3M95A 2LVOA 2L3ZA 2Z59B 3AI5A 2PE9A 3GOEA 2L05A 3ZIMA 1WRDB 4X57B 4HK2A 1WXAA 2KVRA 3RYTA 3PVLA 3KUCB 3ZW3A 4FADA 3QHTA 3VXWA 4AJWA 3ZNGC 3R66C 4E71A 2K8HA 2PJHA 1CMXB 2HJ8A 4GDLA 2M8SA 4CHKA 1C3TA 4MSQB 4XC2A 4KV2A 1WIAA 4RMAA 3WAMA 1NDDA 4XZ4A 2O6VA 4WJPA 3QIJA 3QWZB 2ZPNA 3DVNV 4MEMA 2MQJA 2C7HA 2NR2A 3WALA 2KKCA 1KJTA 2N1VA 1YD8U 1XT9B 3V60A 1E8YA 4FJYA 5E6NA 3T9LA 4A3OA 4WWPA 1GNUA 4WJQA 2KTRB 5G2NA 4DDGD 4TUUA 4NAWA 4NNJB 4W9HA 2D11A 2LGDA 2IZVB 4GGQA 2CHXA 3UF8A 1A5RA 2KWUB 3DDCB 3L08A 3JSVA 1XD3B 2JVCA 2OJRA 2FCMA 1UELA 4BKTA 1SIFA 2D10A 1IYFA 4XX5A 2RGFA 4B9KA 1LFDA 2L8JA 5GMVA 4K7WA 3ZUNA 4FHJA 3MHSD 4B6WA 4OVVA 1BT0A 1YX6B 4MJSA 3RULA 3N30A 1V5OA 5CTRC 2RR9A 1RAXA 3PREA 4WAAA 3TJPA 2KC2A 4BBNF 1WYWB 2KFKA 3PHWB 3ONSA 4HJKA 2J0MA 4IM3A 3DPDA 4IM0A 3U7DA 3ZNZB 2A5UA 5LXIB 3KUDB 2VRRB 2CU1A 2V4LA 1RRBA 1U4AA 2K6QA 2JWZA 4FULA 1WFYA 4HPLB 1OEYJ 4IWOA 4BKSA 1E8ZA 3ZDMC 2K8BA 2D07B 3L54A 2JXXA 2K6DB 2IY0B 1WXSA 2J0KA 3NY5A 4IWPA 2LI5A 2KJRA 4HCNB 1WM2A 4W9KA 2KD0A
chains in the Genus database with same CATH superfamily
4JE3B 4W9LA 5L95C 1QKZA 2DHZA 2M4NA 1NYRA 3EFUA 3PPAA 4XYCA 3WAOA 2H89B 3D32A 4K7SA 2LUEA 1WI0A 1IP9A 4ZRJA 4L1BA 1T0SC 4PK1A 2DYBA 4HEA1 2MH7A 4L2YA 3HM6X 3ALBA 3VFKA 2GBKA 1EU4A 1FPYA 1WJNA 4RF1A 5HG2A 3KYDD 3UGBB 3FILA 2NS5A 4JQWC 4FBJB 3I3TB 3OLMD 3UIPB 3UINB 4M8MA 2BBCA 2FIDA 3CMMB 3M63B 3EHVA 2ZVNA 1TIFA 2NCNA 3OWEB 4AS1A 3NS1A 1RYJA 1I4QA 3IAS1 3KVFB 4RFBA 4REZA 3C19A 2ZW1A 4YT0B 2C5LC 2AL3A 4F7ZA 4DHZE 2MW5A 1V6EA 4ASWC 1UBQA 2PW9A 2EMSA 4KIKB 2C60A 1WWTA 3ZLZA 3B9JA 2LHEA 4ZRIA 3P4SB 3BWUD 1WM3A 2BTEA 2NBWB 1UBIA 2AYOB 2ZZPB 3NJTA 3TSSA 4DK5A 2QILA 3UIOB 3GS2A 1DOXA 4KKIA 1WGYA 3A4SC 4GSWA 4LDTD 1KF6B 1KFYB 1K51A 1Y8RC 2BF8B 4GB9A 2XBBC 1ZXIA 2N9XA 1B1ZA 1C78A 2CS4A 5CHVC 5C1ZA 5G5HA 4IG7B 1SJED 1T3QA 5E6OA 3APCA 3AEDB 4M00A 1FXTB 1FEHA 2JT4B 4TQ1A 2Q5WD 2GMIC 2WXGA 1N61A 3AE8B 1WXMA 2BGFA 2Z0EB 1XCQL 3VR9B 4EKUA 2QMTA 2N9KA 1V1OA 4NAWB 3TIXA 1WXQA 3VRBB 4NJCA 1D4BA 2LVPA 4AUQC 1TS4A 3URYA 4C4VA 5E6JA 3EFCA 5EE3A 1P7FA 1FNUA 4HPMB 4P16A 3WA0A 2JSVX 1NVID 1YX5B 2IO1B 2YVCA 1TTNA 2KC1A 4ZOHC 3TMPB 3MC9A 4K3BA 1XEEA 2LD9A 1UUPA 3A9KA 2YLMA 3Q2AC 4NJ7A 1E7VA 1KLGD 4OZBA 2JXTA 3QC8B 2E6XA 4LLGM 1UWMA 1BUIC 5EE9A 2UWQA 3AE9B 2KDMA 4P1CC 2FNJB 3AULA 3PRZA 2JU6X 4LNIA 2KDIA 3NZ3A 4LNKA 3DOWA 1DOIA 2WP9B 2O2VA 3Q8AA 3Q8EA 3PS6A 1SGHA 3ZJTA 5D3DA 1V2YA 4GIVA 2CHZA 2ACZB 1PDXA 1P1AA 2BS2B 2OEDA 3L13A 4KVGB 5JXVA 3AU5A 2KWDA 4HKQA 1PGAA 2Y3AA 1JCKB 5C2TB 3C8YA 2I1JA 4HXDA 1L5PA 4ZDVA 3AEGB 2KQ4X 1V1PA 1UGMA 2K1FA 1L0YB 1TBEA 2WWZA 3K9PB 4EZLA 2MBQA 3RT3B 3DBLI 1K53A 4ICVA 2RPVA 2WXMA 2X38A 2QJLA 1D6EC 2NPTB 2JZ3B 2B3AA 2N9EB 5IAAC 1OTRB 2RDHA 5HHDG 1V97A 1T6BX 1ZPSA 2E3TA 2BKRB 5TR5A 3UQAA 2OHFA 4PS7A 1FD6A 1EF1A 4DWFA 1JMLA 4FJVB 5FR3A 2WXJA 5D3IB 1JWBD 1FMAD 1YQBA 4EOYA 2K39A 2K9XA 1WR6E 4AQ7A 1BXTA 2N4FA 1I4PA 1C1YB 4AOFA 5BMHA 2HJ1A 2V1YA 2XEWA 1L2NA 3BY4B 2MJ3A 2WHIA 1NEKB 3NVZA 5EE0A 2RSUA 3DVNU 2JRIB 1YN5A 2KZRA 3AE1B 2BT6A 4MDKE 3BINA 1HQRD 3VUWA 4P7IA 1N62A 4KDIC 1C4AA 3T3NA 1WJUA 2KX0A 3VHTC 2WS3B 4PYZA 2DNFA 4II2B 1SXTA 2C9WB 1FCCC 4A3PA 2J53A 2G4DB 2EKIA 1ET6A 5FR6A 1UH6A 3E9SA 5H92C 2ZVOA 1GB4A 1HXYD 4HVBA 3ENEA 1WZ0A 1H4RA 2AL6A 2JQRB 4N58A 2MA9B 1FNWA 3AEEB 1JWMD 2JRHA 4MGIE 2M0XA 3TUOA 1WGRA 4M0WB 1ZKHA 4QAYA 2BPSA 2PE9A 2WNMA 2RDGA 1WXAA 1XO3A 2INDC 3QHTA 3IT6B 5FK9C 2KN4A 1C3TA 1NDDA 2QEJC 3QIJA 1A70A 1P7EA 1KJTA 1ROEA 3BK1A 1XT9B 1E8YA 5E6NA 1LGRA 1D5MC 4WWPA 2PLPA 4WJQA 3RPFC 2KTRB 4NAWA 3GP7A 4NNJB 4GGQA 3Q8FA 2KWUB 3DDCB 4HKZE 3L08A 1XD3B 1QOBA 2OJRA 4YSXB 2BB5A 2FCMA 2D10A 1IYFA 4DXGA 2L8JA 3Q3MC 4K7WA 1IBXB 2V3NA 4IOIE 3R2IA 3N30A 4NAMA 1V5OA 1RAXA 4BBNF 1ZE3D 4IM3A 3DPDA 4DXFA 2LEKA 4ZHOA 2V4LA 5AUKA 1IGCA 4KKJA 1ZDVA 2JWZA 2NTSA 1E8ZA 2K8BA 3ZJVA 3L54A 4A8XC 5BMIA 1WXSA 2J0KA 2LI5A 1J7BA 4W9KA 5IO9A 4GDLB 1NBFC 1HZ5A 3N9YC 5AZGA 4WWMA 1JROA 4ZHPA 4JIOU 5AEKB 2KMAA 2LXAA 3AEAB 1YJJA 4HJGE 2PPHA 2AQ1B 1UZXB 1WGDA 2LJIA 2Y5BB 2DWQA 2ZW0A 4XDCA 3B2FA 1WYGA 4L23A 4W9EA 3JSVB 1EF5A 4A9AA 5J2RA 3L17A 1V86A 4YTNB 2MJEA 2PE6B 2NVUI 4JWUC 3ECIA 2KQ7A 3ZDTA 1JWSD 1JWUD 2FAZA 2KJHB 2LGSA 3BYYB 5JH5C 4RGTA 2IJ0A 3IAM1 2WXNA 2KFKB 4FHKA 2LMCA 4BFRA 2AX5A 4MM3B 1MHXA 3RMKC 4K7UA 3GE3C 2CKHB 4AWJA 4ANVA 4ANXA 3ZNHB 2NPTA 2R2OA 4OZAA 3CF6E 4CYEA 2KO3A 3VVWB 4JGHB 5BO4B 2O6VD 3SFEB 2CJNA 4LTUA 4RF0A 3AE3B 1FO4A 5D7GA 1RFAA 3I63C 1YOVB 1ESFA 3RD2A 3ZQ4A 2NMQA 1EU3A 2WDTB 2M17A 4USAA 5C23A 2CU3A 4B0EA 3VUXA 4FLHA 4BZAA 2MJDA 1N6ZA 4YWGG 3L16A 1SB3C 3SR6A 1YMHE 3AE5B 3X23A 3Q3NC 4J3OD 2IPKD 2FCQA 4RM8A 4FXCA 1VZ8A 4BKSD 3RI7C 2GI9A 3TCAA 4R3DA 3UI3A 2WGSA 1TGZB 4EE2A 1XLPA 2HE7A 4WAFA 5EE1A 1GJZA 1UNSA 2I2YA 2KNBA 3DQVA 2GLSA 3AV8A 1GC7A 3A33B 1WJ6A 1STEA 5DPSA 3EC8A 1JRPA 5T8IA 2N1WA 3KWVA 2MBOA 2W55A 1SE9A 5L83A 1E5WA 4ARIA 4M0WA 2K22A 2KOXA 1KM7A 2R2QA 3RCZA 1I42A 3V6EB 1SEBD 4RH6A 1VD2A 2J4XA 3N3KB 4MGZE 2L76A 3NVYA 3ZTDA 3VTVA 1K8RB 5GXGB 1WR1A 1ZOYB 3GZNI 1GUAB 4LDTB 4HDOA 4TQ0A 2V3PA 3ML9A 2MBBB 2W3SA 4JL9A 3TEZA 4K81A 3IXSA 2KT7A 2DAFA 1XQQA 1XXGA 2G45B 2KLCA 1C9FA 3AN1A 3P42A 5LLIA 1LO5D 3I9V1 4YL8A 2ZNVC 3AECB 2MLBA 2KWVB 2X8XX 4GU2A 1IBXA 1GPXA 4MT5A 2WDQB 3AEBB 4ZRKA 3H7SA 1KRHA 4W9CA 4IUMB 1XLOA 2A4ZA 2MBHA 3QX1A 3P2BA 1FM0D 2MP2B 2UU7A 3SD5A 2BKFA 2J7QB 3ZO5B 2JY6A 3PO0A 3BK2A 3ZYYX 1N63A 1C4CA 5IA7A 2KFJA 1E7UA 4O1NA 5H8YE 3R2TA 4HWIB 3RZFA 2VZKB 2CJOA 3VDZA 3W9CB 3PZ8A 3KUZA 3Q14C 1M94A 4YSZB 1GG3A 3VTWA 4MELA 2JPHA 2KYWA 5DPTA 1I35A 4PS3A 4A6QA 3KQ4A 4GN1A 2WXHA 3H1UA 4XE0A 5D2MB 4XWWA 2DYOA 1E9MA 1VJKA 4IW0A 2L7RA 4NJ6A 1I4HA 2DX5B 2GBMA 5BYRA 4GXBA 1QZEA 1JWAD 2B76B 2CHWA 4G0NB 5DCNA 4MM3A 1AW7A 5IKCM 3NZSA 4IWQA 4LK0M 3P4PB 5IN7A 2DLBA 3ETRA 2W9NA 2KDEB 2N7EA 4M02A 1L7YA 3APDA 3LDZE 2VZKD 3DHIC 3TEXA 2KQSA 3L0WB 3HVZA 3DWMA 3FC4A 4N9F4 4RGNA 3W5UB 3RNCC 1WE7A 2BYTA 1ZGUB 1HZ6A 2FUHB 1PYWD 5IOIA 2QCZA 1WMHB 2KDBA 1YJIA 5KHOA 4I6NB 2DZKA 2QIEB 3DBHB 4WQOB 1D3ZA 5AUIA 2XK5B 1OEYA 4DQOC 4YXDB 3MC0B 5J18A 4HCPB 2WX0A 2IYDB 1TY0A 2LGIA 4EZKA 3QK0A 3RN9C 2AEHA 1RWSA 5G55A 1QT9A 4NPNA 3B0AA 3IVFA 1JALA 4S17A 4WWOA 1R4NB 3M95A 2L3ZA 3AI5A 3GB1A 2ONQA 3ZIMA 2V4IB 4AJWA 4E71A 2DBYA 3KWLA 1WIAA 5HI1A 1C4PA 4XZ4A 2VH2A 3NG0A 2ZPNA 3WALA 2KKCA 1SE2A 2PIAA 4A3OA 1J7CA 4TUUA 3UF8A 2IZVB 1A5RA 2CHXA 2EELA 2AQ3B 5LNK1 1VDVA 3Q69A 2ICIA 4TMAB 4H2AA 1SIFA 4LNFA 4XX5A 2RGFA 2W3RA 2YEPF 3N1ZC 4HRSA 3ZUNA 4B6WA 1BT0A 1YX6B 1RM6C 1YNTE 3U7DA 2A5UA 5LXIB 3KUDB 2K6QA 1OEYJ 4IWOA 3L4PA 3ZDMC 1XLNA 3NY5A 2GRIA 2KD0A 1LM8B 4KSKC 1QLBB 1F52A 2ASQA 1SIJA 1GB1A 3RFZB 5E6PA 3ABVB 4I6PA 3MJWA 1PUTA 4KIKA 4K3CA 1SSNA 1MI0A 1C79A 2KANA 4ZYNA 3MTNB 2MP2A 3H7PB 1Q1OA 3B08A 4C7ZA 2PEAA 3VTUA 3X0WA 2BYEA 4PT5A 3A1QB 1S3SG 1P0RA 4MGYE 3ZJUA 1IGDA 4MJSB 3WANA 3V6CB 4KGSA 4G50A 4WURA 4WJNA 1OQRA 4B95A 3CWIA 3ZVVA 5AZFA 3P1MA 3MC8A 2G3QB 1TT5B 2K8CA 1WF9A 2D3AA 3T3OA 2J52A 4M8NA 2ZPYA 2HDEA 5IP4D 3EUB2 1WGHA 4K1RB 2FCNA 4YTPB 1YN3A 4TKNA 1TKEA 2GBJA 4IM2A 4AJYB 1N5WA 2DZJA 2D5GA 1DYQA 1E7PB 3PTFC 3P63A 3ZNID 4ZYSA 3RNFC 1KOTA 1I4XA 1IPGA 1Q5WB 3RNBC 3BYTB 2SEBD 4US8A 4ICUA 3SEBA 5TSSA 3OG5A 3DWGC 3QQ8B 3NOBA 3LB8C 3ZXRA 4W9DA 3WCQA 2QSDA 1OQYA 3V05A 3IHPC 2IBIB 2HTME 2M1MA 1F77A 3H6NA 4EUTA 3PZ7A 2RDBC 2MEKA 1VCBA 3FILB 3HHMA 1JRUA 2LGYA 2FBWB 2DENB 4I6LB 3Q3OC 4DHJB 2NBVB 1NI2A 4A20A 1Q10A 4P6VF 1J19A 1FRDA 4EZJA 1HTOA 3OJ4B 1HA5A 3R8BA 4MH0E 1Z5SB 4BKGA 1WY8A 1VZ7A 4ANWA 1YN4A 1AARA 3ZKJC 2IGGA 2XK5A 2KDFB 1T0RC 3FAHA 3J9CA 2KWCA 2L52A 4DDID 2AWTA 4DHZB 2O6VB 2WXRA 1DGJA 2PKOA 2WXOA 1FNVA 1WJ4A 2GBRA 4KSLC 2C7MB 1WXVA 1ZP0B 1TZ1A 1NI3A 3KYCD 3DHGC 4JLCA 1MG4A 2KXJA 4RNAA 3AEFB 4BOSC 5D6JB 3OAWA 3CSTA 4MSMB 1QILA 1WGGA 3VQIA 1WZ3A 3VR8B 2LRWA 3BVZA 4MGKE 4II3B 3MJ5A 3DBHI 1P9DU 2KAJA 4DHJD 3NUHB 1CK1A 3NZUA 1T5XD 2PTLA 1F1HA 2PMVA 4BOZB 2LUMA 5J17A 1ISNA 3NRZA 1HTQA 1VR9A 2MX2A 3RUIB 1MJDA 4NY0A 2QDFA 1WSPA 4NQKE 5DPRA 1E8XA 1YJ1A 2DZMA 2GB1A 3HRDD 4AP4C 1R4NI 3VUYA 3RZWC 4GDKB 1D5ZC 1T0YA 1TS2A 2K25A 3W5VB 2W54A 5FKAC 1LXDA 3QCAA 1B9RA 1FCLA 1SF0A 4IDIA 3Q6BA 4XGAB 3DVGX 5JZEB 4WIPA 4C4VB 2RD0A 2MHJA 2KMMA 3APFA 4BBNC 2NBUA 2KN5A 1GAQB 4KGRA 3PZDA 2LVQA 4J6IA 2D3CA 2UYZB 1EWYC 1V8CA 1Q0WB 3EA6A 1PGBA 3H7PA 3SU8X 2KJ6A 3DBRB 3A9KB 3RNAC 3RNGC 1E10A 4JWSC 4OZCA 3A1QA 4OVUA 1V80A 3U8ZA 3DHHC 3BVMA 5HKHA 1Z2MA 3V3XA 4JPSA 3UQBA 3O65B 1L0VB 5EDSA 4GMVA 1GC6A 3HK0A 3TBLD 1YIWA 2Y5PA 1CZPA 2FCSA 4OHJA 2O2VB 1OGWA 3L10B 3DBSA 3LJ3A 1VLBA 3KH0A 1E90A 3I57A 3MHZA 3ZRCA 1XCTL 2ZCBA 3TL5A 1MFWA 3WAPA 2XNAC 1KH0A 4A90A 3ZTCA 1TZOA 3JVZX 1WGKA 2DYMA 4F8CB 4C56C 1V5TA 1MVKA 4N59A 3Q3FA 2FIFA 2Z0DB 1R7SA 1TKYA 1V1PB 2WXIA 2KTRA 3N1XC 3W2DA 5CHFA 2WDRB 2WXQA 4FA6A 1KLVA 4WH4A 3U52E 2TSSA 1TYGB 2Z8LA 3PSEB 3AE2B 1WX8A 1L6VA 1QOAA 3HUIA 1JW9D 2PVGC 2IY1B 3PGEA 3A9JB 4E74A 2ZJDA 2DAJA 2YEPB 1UF0A 2ZEQA 2JYTA 2W82A 3FKYA 4PYUA 4URKA 2LVOA 4S0RA 2Z59B 2INPE 3U7ZA 3GOEA 2N7JA 4HK2A 3PVLA 4FADA 3ZW3A 3VXWA 3R66C 2M56B 4GDLA 3AE4B 4CHKA 2R61A 4YSYB 1L0XB 2VH1A 4KV2A 4RMAA 5MPOA 2O6VA 4WJPA 1CJEA 4C00A 2MQJA 2C7HA 2N1VA 3V60A 3T9LA 4ZRPA 1K52A 1E6EB 5G2NA 4B0MA 4W9HA 1T0QC 2LGDA 1IUEA 1FXAA 3JSVA 2JVCA 1UELA 1ACCA 2I38A 4B9KA 1LFDA 1EWCA 3GE8C 3MHSD 4US9A 3RULA 5CTRC 2RR9A 3PREA 3AE7B 2KC2A 1WYWB 2KFKA 3PHWB 3ONSA 2J0MA 3NVWA 3ZNZB 4IM0A 2FE8A 2CU1A 1RRBA 3SFDB 4BKSA 1N5XA 1NYQA 2JXXA 5BYSA 2K6DB 4ARCA 2IY0B 1F2RI 1FXIA 2AQ2B 4HCNB 1AWDA 1WM2A 3C0RB 3WIMA 5KHQA 2L1AA 2G9HD 2H88B 3H9DA 1TKGA 4FJZA 4D2KA 4GDKA 1XLQA 2WYQA 2JYEA 4DBGA 3CIRB 4IC7B 4RGOS 2N9LA 2LJ5A 2WLBA 1F2RC 3PRPB 4W9FA 1OQQA 2BQQA 3LYYA 3VH4B 4G3XB 3AU4A 3S2AA 2QHOA 3HIZA 2XN9C 2LFIA 2WU5B 4LCDE 1R4MB 2MBEA 4KZCA 2KACA 2LHDA 1UD7A 2WQYB 4GOCA 2J42A 3AXCA 3MP9A 2RPQA 4NQLB 4KDLB 5JHAA 2WXKA 3PLVA 2L0FA 2WX1A 3Q3JA 1TS3A 3VAWA 2GBNA 2BW2A 4Q2JA 4DXAB 1CQVA 1LQBA 2L32A 3B2GA 2JZPA 2EKEC 3RNEC 4C7YA 3TEWA 2WXFA 3O13A 2M0AA 4FN2A 4MH8A 1WX9A 2MCNB 2BS4B 1J0GA 3PLUA 3ZRFA 1E0ZA 2D2QA 3QARA 1MG8A 3N20C 1J7AA 3U4EG 3P4QB 4ANUA 3V62A 1XF5L 3U30A 3W1SA 4HLEA 2JZZA 3PRMB 3HM3A 3IFWB 3DBRI 2HTHA 1MPEA 4E3CA 3T8MA 1V81A 4M01A 1TJEA 1P3QU 1AYFA 2BWES 1TY2A 2BWFA 1I4RA 1SJHD 2HD5B 2IO2B 3W1YA 3SDLC 1FFVA 2WU2B 3NS8A 3EGRA 3VH3B 3ML8A 2KK8A 5BYQA 3BIID 3DVGY 3JYUA 3A9JA 3QA8A 2REXA 2MRPA 4ZRQA 2KMCA 4WQMA 4CQNA 1L4ZB 1D5XC 1SE4A 2ON8A 2IO0B 2V3SA 1L6UA 3QJZA 3E56A 3IT4B 4OVZA 4ACFA 2L83A 4W9GA 1PFDA 3KW5B 1WE6A 3M62B 2NTTA 2INCC 4WJOA 5CX3A 1QOGA 4WWNA 2G1EA 5DPWA 1F9JA 3AE6B 2JUOA 1SBBB 4IKGA 3BVGA 2LXCA 3CSFA 2ZNVB 3W1SC 5HFYA 2V0GA 1ZXHA 2LRUA 1TS5A 3GZNB 3NVVA 1KLUD 3MFGA 2LGXA 1KTKA 3LXFA 4OW0A 4W9IA 1HEZE 3OJ3A 3QAQA 2N9PC 3ZGZA 1L4DB 1Y56A 4LJOB 5G5GA 1C77A 2V9HA 2D3BA 3AH7A 1X1MA 4G11A 2BB6A 1I4GA 1FIQA 2KHWB 3DCGA 3JW0X 2N7DA 3M3JA 1V49A 2WXLA 3K9OB 2FUG1 2M19A 4W9JA 1S1QB 1UGJA 1FFUA 1C76A 4PS8A 4RGMA 3R7RA 3IBEA 1WH3A 4HROA 4ITKA 2BYVE 5CHWA 2IGDA 3R7QA 3PV1A 3Q8BA 1P98A 2LZ6A 1V9JA 1FRRA 3B1LX 2MSED 3V61A 3AMZA 2OOBB 4BAXA 1SE3A 1PQSA 4CO7A 4LJPB 2KTFA 3I5JC 2CR5A 3NHEB 1WMHA 3N32A 4KX6B 4XWTA 1I7HA 1QOFA 2I1KA 4KZ0A 4BVUC 4UDUC 2EMTA 3VRAB 1VRAB 3EECA 2KLGA 1MHHE 3H8HA 2KVZA 4HDQA 2J0JA 1EM7A 2L0TA 4EFOA 3PHXB 2C7NB 3KLSX 2LWPA 1YQ3B 4P1BC 2GOWA 3R3MA 3A4RA 1HE8A 2IGHA 1RFKA 3IG3A 2BYFA 2QC8A 4F1SA 1EO6A 1BMLC 2N0SB 2IO3B 2DZIA 1H8CA 5LXHA 2PVOD 1RLFA 2JX5A 2BS3B 1F0ZA 1YQ4B 2Y5CA 4LNOA 1WX7A 3AB5A 2L00B 1E8WA 3Q8CA 2OJWA 4KGTA 3PT2B 3HVDA 1AN8A 1R4MI 2IDYA 2JF5A 5AZHA 5C3JB 2BVCA 2LASA 2ZCCA 2MWSB 1G6JA 3AM9A 1K50A 4JX1C 4EEWA 2D3GA 1EUVB 3N1YC 1N60A 1PGXA 5JHBA 1QF6A 4TV3A 1ZW7A 1QQRA 5D94A 2G4SA 1JQ4A 5I4DA 1VZ6A 3SHQA 2INNE 1GOZA 1J8CA 2KX3A 4NZLB 4RCOA 2L05A 1WRDB 4X57B 3RYTA 2KVRA 1NENB 3KUCB 1ZUD2 4HPPA 1DOYA 3ZNGC 2K8HA 2PJHA 1CMXB 2HJ8A 1OFFA 2M8SA 4LNNA 4XDDA 4MSQB 1ZDXA 4XC2A 3WAMA 2SAKA 2WDVB 1ENFA 3QWZB 3DVNV 3P4RB 4MEMA 2NR2A 1M4VA 1YD8U 4FJYA 1WRIA 1GNUA 2K0PA 4DDGD 2D11A 5BMGA 4MACA 4A55A 3BZDB 4N6EB 4BKTA 5GMVA 3U2SC 4FHJA 4OVVA 4MJSA 3DBLB 1ET9A 4WAAA 3TJPA 4C80A 4TSSA 4HJKA 1UWXA 2VRRB 2K5PA 2K3UA 2RMMA 1U4AA 4FULA 4HPLB 1WFYA 2JWUA 3TEYA 2D07B 3ZXVA 4YTMB 4IWPA 2KJRA 2WXPA 4GLSC 4RM9A
chains in the Genus database with same CATH topology
3C0RB 4GDLB 3WIMA 4W9LA 1NBFC 5KHQA 1LM8B 4KSKC 5L95C 3H9DA 2ASQA 5AZGA 4FJZA 2DHZA 2M4NA 4JIOU 3WAOA 3EFUA 3PPAA 4GDKA 5AEKB 2WYQA 2KMAA 2LXAA 5E6PA 4DBGA 4I6PA 3MJWA 4KIKA 4IC7B 3D32A 2KANA 2PPHA 4ZYNA 3MTNB 2LJ5A 2MP2A 4K7SA 2LUEA 1UZXB 1WGDA 1Q1OA 1WI0A 2Y5BB 3B08A 3H7PB 1IP9A 4ZRJA 3PRPB 4W9FA 4W9EA 2PEAA 3VH4B 4G3XB 3VTUA 3AU4A 3S2AA 2QHOA 1EF5A 3JSVB 3X0WA 2BYEA 5J2RA 3HIZA 2DYBA 3A1QB 3L17A 1S3SG 1V86A 4LCDE 2PE6B 1P0RA 2MBEA 4KZCA 3HM6X 2NVUI 4MGYE 3ALBA 3VFKA 2GBKA 3ECIA 2KQ7A 4MJSB 3ZDTA 1UD7A 2FAZA 2KJHB 5JH5C 3WANA 3V6CB 4GOCA 4G50A 4WJNA 2KFKB 1WJNA 4FHKA 4B95A 3AXCA 3KYDD 3UGBB 2RPQA 3ZVVA 5AZFA 4BFRA 4NQLB 2NS5A 4JQWC 4FBJB 4KDLB 2G3QB 3I3TB 3OLMD 5JHAA 3PLVA 3UIPB 2K8CA 3UINB 1WF9A 2L0FA 4M8MA 2WX1A 3Q3JA 3VAWA 2FIDA 3CMMB 3M63B 3EHVA 2GBNA 4M8NA 2ZPYA 2ZVNA 4K7UA 2CKHB 2NCNA 4AWJA 4DXAB 1LQBA 1WGHA 4K1RB 2FCNA 4TKNA 4ANVA 4ANXA 3ZNHB 2NPTA 3KVFB 2R2OA 2EKEC 3CF6E 4CYEA 2KO3A 3VVWB 4JGHB 2GBJA 2C5LC 4IM2A 2AL3A 4AJYB 5BO4B 2O6VD 4F7ZA 2DZJA 4DHZE 2MW5A 1V6EA 4FN2A 3PTFC 1WX9A 4ASWC 2MCNB 3ZNID 1UBQA 2EMSA 4KIKB 1KOTA 5D7GA 1RFAA 1J0GA 1IPGA 1Q5WB 2C60A 3ZLZA 3PLUA 3ZRFA 4ICUA 4ZRIA 3RD2A 1WM3A 2D2QA 3QARA 2NBWB 1UBIA 2AYOB 2ZZPB 3QQ8B 2WDTB 2M17A 5C23A 3NOBA 1MG8A 4DK5A 3VUXA 4FLHA 4W9DA 3UIOB 4ANUA 3V62A 3U30A 3W1SA 4HLEA 2JZZA 1OQYA 3IHPC 3HM3A 3IFWB 1WGYA 2IBIB 2M1MA 3A4SC 3L16A 3PRMB 3X23A 3DBRI 3H6NA 4GSWA 4EUTA 4LDTD 2HTHA 1VCBA 2FCQA 4E3CA 3T8MA 1V81A 3HHMA 1JRUA 1P3QU 1Y8RC 2BF8B 2LGYA 2DENB 4I6LB 2BWES 4RM8A 4GB9A 2XBBC 2BWFA 4DHJB 2HD5B 2N9XA 2NBVB 4BKSD 2IO2B 1NI2A 3TCAA 4A20A 3W1YA 1J19A 4EZJA 3SDLC 2CS4A 3OJ4B 1TGZB 4MH0E 5CHVC 1Z5SB 3NS8A 5C1ZA 4BKGA 1WY8A 2HE7A 4IG7B 3VH3B 4ANWA 1AARA 3ZKJC 3ML8A 1GJZA 2XK5A 2KDFB 2KK8A 2KNBA 3DQVA 2KWCA 5E6OA 1GC7A 3DVGY 3JYUA 3A33B 1WJ6A 3APCA 4DDID 3A9JA 2AWTA 5DPSA 3EC8A 1FXTB 3QA8A 4DHZB 2O6VB 2REXA 2MRPA 2KMCA 2JT4B 2N1WA 4TQ1A 1SE9A 1WJ4A 2MBOA 2GBRA 4KSLC 1E5WA 1WXVA 2C7MB 2GMIC 5L83A 1TZ1A 1WXMA 2BGFA 2Z0EB 2IO0B 2V3SA 3QJZA 4EKUA 3KYCD 4JLCA 4NAWB 3TIXA 2KXJA 2KOXA 1KM7A 4W9GA 2R2QA 2LVPA 3RCZA 4AUQC 1I42A 3V6EB 3KW5B 1WE6A 3M62B 1VD2A 3N3KB 4BOSC 5D6JB 3OAWA 4MGZE 2L76A 3CSTA 4WJOA 4MSMB 5CX3A 4WWNA 3ZTDA 3VTVA 1K8RB 1WGGA 3VQIA 4HPMB 5DPWA 1F9JA 3WA0A 1WR1A 1WZ3A 3GZNI 2JUOA 1GUAB 2LRWA 2LXCA 3CSFA 4HDOA 1YX5B 4LDTB 4MGKE 4II3B 4TQ0A 2ZNVB 2IO1B 3DBHI 2MBBB 1P9DU 1TTNA 2KC1A 2YVCA 3ML9A 3TMPB 3W1SC 2LRUA 4DHJD 4JL9A 4K81A 3NZUA 2LD9A 2DAFA 3A9KA 4BOZB 1XQQA 5J17A 2LGXA 1ISNA 2G45B 2YLMA 2KLCA 4NJ7A 5LLIA 2MX2A 3RUIB 1E7VA 4NY0A 4YL8A 2ZNVC 3QC8B 2MLBA 2KWVB 4NQKE 4GU2A 4W9IA 5DPRA 1E8XA 3OJ3A 3QAQA 2N9PC 1YJ1A 2DZMA 4AP4C 1R4NI 4LJOB 3VUYA 3RZWC 4GDKB 3H7SA 4ZRKA 2UWQA 4W9CA 4IUMB 1T0YA 2K25A 1X1MA 2A4ZA 2FNJB 3AULA 3PRZA 4G11A 2MBHA 3QX1A 1LXDA 3P2BA 2MP2B 3QCAA 2KHWB 3DCGA 3JW0X 3SD5A 2BKFA 2J7QB 2KDIA 3ZO5B 3DOWA 2JY6A 2O2VA 2N7DA 3M3JA 1V49A 3K9OB 4W9JA 1S1QB 3DVGX 5IA7A 3PS6A 1SGHA 1E7UA 2KFJA 5JZEB 4PS8A 1V2YA 2RD0A 4GIVA 3R7RA 2CHZA 4HWIB 3IBEA 1WH3A 2BYVE 5CHWA 3RZFA 3VDZA 3R7QA 3APFA 4BBNC 2NBUA 3KUZA 3PV1A 2KN5A 1P98A 2LZ6A 1V9JA 1P1AA 3PZDA 1M94A 2LVQA 3B1LX 3L13A 4J6IA 2MSED 4KVGB 3AU5A 2UYZB 1GG3A 3V61A 3VTWA 2OOBB 4MELA 1Q0WB 2I1JA 1PQSA 4HXDA 4CO7A 4LJPB 4ZDVA 3H7PA 2JPHA 3SU8X 2KTFA 2CR5A 2KJ6A 3NHEB 5DPTA 3A9KB 1I35A 1WMHA 3N32A 1UGMA 2K1FA 1TBEA 2WWZA 3K9PB 4PS3A 4EZLA 4GN1A 3H1UA 2MBQA 3RT3B 3A1QA 2I1KA 3DBLI 4KZ0A 4ICVA 4OVUA 4BVUC 5D2MB 2DYOA 4RM9A 2EMTA 1V80A 2NPTB 3U8ZA 3EECA 2KLGA 2JZ3B 2B3AA 2N9EB 5HKHA 4IW0A 5IAAC 1OTRB 1Z2MA 2L7RA 4NJ6A 4HDQA 2J0JA 2DX5B 2BKRB 2GBMA 2L0TA 5TR5A 3UQAA 4EFOA 3PHXB 3O65B 4PS7A 3UQBA 2C7NB 1EF1A 4GXBA 4DWFA 1QZEA 2LWPA 5EDSA 2CHWA 4FJVB 4G0NB 4GMVA 4MM3A 5DCNA 2GOWA 1GC6A 3R3MA 3HK0A 3A4RA 3NZSA 3TBLD 1YIWA 4IWQA 1HE8A 2FCSA 1YQBA 2O2VB 4EOYA 1OGWA 2K39A 3DBSA 3L10B 1WR6E 3IG3A 3KH0A 3LJ3A 2W9NA 1E90A 2BYFA 3ZRCA 4F1SA 1EO6A 2N4FA 2ZCBA 2IO3B 1C1YB 2KDEB 3TL5A 2DZIA 3WAPA 4AOFA 2N7EA 1H8CA 5LXHA 1L7YA 3APDA 3LDZE 2V1YA 2XEWA 3ZTCA 1RLFA 1L2NA 3BY4B 3JVZX 2RSUA 3DVNU 2DYMA 4F8CB 1WX7A 2KQSA 1V5TA 2JRIB 2L00B 3L0WB 1E8WA 2KZRA 4N9F4 4MDKE 3BINA 1WE7A 3VUWA 4P7IA 1ZGUB 4KDIC 3PT2B 2FIFA 3Q3FA 2FUHB 1R4MI 1WJUA 2Z0DB 1WMHB 2KX0A 3VHTC 2KDBA 2JF5A 5AZHA 2KTRA 5KHOA 2LASA 4I6NB 2DZKA 2ZCCA 4PYZA 5CHFA 2MWSB 4II2B 2C9WB 4A3PA 1G6JA 2G4DB 4FA6A 1KLVA 4EEWA 4WQOB 2D3GA 5FR6A 1D3ZA 1EUVB 1UH6A 2XK5B 5JHBA 2ZVOA 1OEYA 3PSEB 4TV3A 4HVBA 3ENEA 1WX8A 1ZW7A 1WZ0A 1H4RA 2IY1B 5D94A 2G4SA 2AL6A 3A9JB 3PGEA 5J18A 4HCPB 4E74A 2WX0A 2ZJDA 2IYDB 3SHQA 2DAJA 4EZKA 2MA9B 3QK0A 1J8CA 2KX3A 2JRHA 4MGIE 2AEHA 2M0XA 5G55A 4NPNA 2ZEQA 3B0AA 3IVFA 4WWOA 1WGRA 4M0WB 4PYUA 4URKA 1ZKHA 2BPSA 3M95A 2LVOA 2L3ZA 2Z59B 3AI5A 2PE9A 3GOEA 2L05A 3ZIMA 1WRDB 4X57B 4HK2A 1WXAA 2KVRA 3RYTA 3PVLA 3KUCB 3ZW3A 4FADA 3QHTA 3VXWA 4AJWA 3ZNGC 3R66C 4E71A 2K8HA 2PJHA 1CMXB 2HJ8A 4GDLA 2M8SA 4CHKA 1C3TA 4MSQB 4XC2A 4KV2A 1WIAA 4RMAA 3WAMA 1NDDA 4XZ4A 2O6VA 4WJPA 3QIJA 3QWZB 2ZPNA 3DVNV 4MEMA 2MQJA 2C7HA 2NR2A 3WALA 2KKCA 1KJTA 2N1VA 1YD8U 1XT9B 3V60A 1E8YA 4FJYA 5E6NA 3T9LA 4A3OA 4WWPA 1GNUA 4WJQA 2KTRB 5G2NA 4DDGD 4TUUA 4NAWA 4NNJB 4W9HA 2D11A 2LGDA 2IZVB 4GGQA 2CHXA 3UF8A 1A5RA 2KWUB 3DDCB 3L08A 3JSVA 1XD3B 2JVCA 2OJRA 2FCMA 1UELA 4BKTA 1SIFA 2D10A 1IYFA 4XX5A 2RGFA 4B9KA 1LFDA 2L8JA 5GMVA 4K7WA 3ZUNA 4FHJA 3MHSD 4B6WA 4OVVA 1BT0A 1YX6B 4MJSA 3RULA 3N30A 1V5OA 5CTRC 2RR9A 1RAXA 3PREA 4WAAA 3TJPA 2KC2A 4BBNF 1WYWB 2KFKA 3PHWB 3ONSA 4HJKA 2J0MA 4IM3A 3DPDA 4IM0A 3U7DA 3ZNZB 2A5UA 5LXIB 3KUDB 2VRRB 2CU1A 2V4LA 1RRBA 1U4AA 2K6QA 2JWZA 4FULA 1WFYA 4HPLB 1OEYJ 4IWOA 4BKSA 1E8ZA 3ZDMC 2K8BA 2D07B 3L54A 2JXXA 2K6DB 2IY0B 1WXSA 2J0KA 3NY5A 4IWPA 2LI5A 2KJRA 4HCNB 1WM2A 4W9KA 2KD0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3C0R B;  4GDL B;  3WIM A;  4W9L A;  1NBF C;  5KHQ A;  1LM8 B;  4KSK C;  5L95 C;  3H9D A;  2ASQ A;  5AZG A;  4FJZ A;  2DHZ A;  2M4N A;  4JIO U;  3WAO A;  3EFU A;  3PPA A;  4GDK A;  5AEK B;  2WYQ A;  2KMA A;  2LXA A;  5E6P A;  4DBG A;  4I6P A;  3MJW A;  4KIK A;  4IC7 B;  3D32 A;  2KAN A;  2PPH A;  4ZYN A;  3MTN B;  2LJ5 A;  2MP2 A;  4K7S A;  2LUE A;  1UZX B;  1WGD A;  1Q1O A;  1WI0 A;  2Y5B B;  3B08 A;  3H7P B;  1IP9 A;  4ZRJ A;  3PRP B;  4W9F A;  4W9E A;  2PEA A;  3VH4 B;  4G3X B;  3VTU A;  3AU4 A;  3S2A A;  2QHO A;  1EF5 A;  3JSV B;  3X0W A;  2BYE A;  5J2R A;  3HIZ A;  2DYB A;  3A1Q B;  3L17 A;  1S3S G;  1V86 A;  4LCD E;  2PE6 B;  1P0R A;  2MBE A;  4KZC A;  3HM6 X;  2NVU I;  4MGY E;  3ALB A;  3VFK A;  2GBK A;  3ECI A;  2KQ7 A;  4MJS B;  3ZDT A;  1UD7 A;  2FAZ A;  2KJH B;  5JH5 C;  3WAN A;  3V6C B;  4GOC A;  4G50 A;  4WJN A;  2KFK B;  1WJN A;  4FHK A;  4B95 A;  3AXC A;  3KYD D;  3UGB B;  2RPQ A;  3ZVV A;  5AZF A;  4BFR A;  4NQL B;  2NS5 A;  4JQW C;  4FBJ B;  4KDL B;  2G3Q B;  3I3T B;  3OLM D;  5JHA A;  3PLV A;  3UIP B;  2K8C A;  3UIN B;  1WF9 A;  2L0F A;  4M8M A;  2WX1 A;  3Q3J A;  3VAW A;  2FID A;  3CMM B;  3M63 B;  3EHV A;  2GBN A;  4M8N A;  2ZPY A;  2ZVN A;  4K7U A;  2CKH B;  2NCN A;  4AWJ A;  4DXA B;  1LQB A;  1WGH A;  4K1R B;  2FCN A;  4TKN A;  4ANV A;  4ANX A;  3ZNH B;  2NPT A;  3KVF B;  2R2O A;  2EKE C;  3CF6 E;  4CYE A;  2KO3 A;  3VVW B;  4JGH B;  2GBJ A;  2C5L C;  4IM2 A;  2AL3 A;  4AJY B;  5BO4 B;  2O6V D;  4F7Z A;  2DZJ A;  4DHZ E;  2MW5 A;  1V6E A;  4FN2 A;  3PTF C;  1WX9 A;  4ASW C;  2MCN B;  3ZNI D;  1UBQ A;  2EMS A;  4KIK B;  1KOT A;  5D7G A;  1RFA A;  1J0G A;  1IPG A;  1Q5W B;  2C60 A;  3ZLZ A;  3PLU A;  3ZRF A;  4ICU A;  4ZRI A;  3RD2 A;  1WM3 A;  2D2Q A;  3QAR A;  2NBW B;  1UBI A;  2AYO B;  2ZZP B;  3QQ8 B;  2WDT B;  2M17 A;  5C23 A;  3NOB A;  1MG8 A;  4DK5 A;  3VUX A;  4FLH A;  4W9D A;  3UIO B;  4ANU A;  3V62 A;  3U30 A;  3W1S A;  4HLE A;  2JZZ A;  1OQY A;  3IHP C;  3HM3 A;  3IFW B;  1WGY A;  2IBI B;  2M1M A;  3A4S C;  3L16 A;  3PRM B;  3X23 A;  3DBR I;  3H6N A;  4GSW A;  4EUT A;  4LDT D;  2HTH A;  1VCB A;  2FCQ A;  4E3C A;  3T8M A;  1V81 A;  3HHM A;  1JRU A;  1P3Q U;  1Y8R C;  2BF8 B;  2LGY A;  2DEN B;  4I6L B;  2BWE S;  4RM8 A;  4GB9 A;  2XBB C;  2BWF A;  4DHJ B;  2HD5 B;  2N9X A;  2NBV B;  4BKS D;  2IO2 B;  1NI2 A;  3TCA A;  4A20 A;  3W1Y A;  1J19 A;  4EZJ A;  3SDL C;  2CS4 A;  3OJ4 B;  1TGZ B;  4MH0 E;  5CHV C;  1Z5S B;  3NS8 A;  5C1Z A;  4BKG A;  1WY8 A;  2HE7 A;  4IG7 B;  3VH3 B;  4ANW A;  1AAR A;  3ZKJ C;  3ML8 A;  1GJZ A;  2XK5 A;  2KDF B;  2KK8 A;  2KNB A;  3DQV A;  2KWC A;  5E6O A;  1GC7 A;  3DVG Y;  3JYU A;  3A33 B;  1WJ6 A;  3APC A;  4DDI D;  3A9J A;  2AWT A;  5DPS A;  3EC8 A;  1FXT B;  3QA8 A;  4DHZ B;  2O6V B;  2REX A;  2MRP A;  2KMC A;  2JT4 B;  2N1W A;  4TQ1 A;  1SE9 A;  1WJ4 A;  2MBO A;  2GBR A;  4KSL C;  1E5W A;  1WXV A;  2C7M B;  2GMI C;  5L83 A;  1TZ1 A;  1WXM A;  2BGF A;  2Z0E B;  2IO0 B;  2V3S A;  3QJZ A;  4EKU A;  3KYC D;  4JLC A;  4NAW B;  3TIX A;  2KXJ A;  2KOX A;  1KM7 A;  4W9G A;  2R2Q A;  2LVP A;  3RCZ A;  4AUQ C;  1I42 A;  3V6E B;  3KW5 B;  1WE6 A;  3M62 B;  1VD2 A;  3N3K B;  4BOS C;  5D6J B;  3OAW A;  4MGZ E;  2L76 A;  3CST A;  4WJO A;  4MSM B;  5CX3 A;  4WWN A;  3ZTD A;  3VTV A;  1K8R B;  1WGG A;  3VQI A;  4HPM B;  5DPW A;  1F9J A;  3WA0 A;  1WR1 A;  1WZ3 A;  3GZN I;  2JUO A;  1GUA B;  2LRW A;  2LXC A;  3CSF A;  4HDO A;  1YX5 B;  4LDT B;  4MGK E;  4II3 B;  4TQ0 A;  2ZNV B;  2IO1 B;  3DBH I;  2MBB B;  1P9D U;  1TTN A;  2KC1 A;  2YVC A;  3ML9 A;  3TMP B;  3W1S C;  2LRU A;  4DHJ D;  4JL9 A;  4K81 A;  3NZU A;  2LD9 A;  2DAF A;  3A9K A;  4BOZ B;  1XQQ A;  5J17 A;  2LGX A;  1ISN A;  2G45 B;  2YLM A;  2KLC A;  4NJ7 A;  5LLI A;  2MX2 A;  3RUI B;  1E7V A;  4NY0 A;  4YL8 A;  2ZNV C;  3QC8 B;  2MLB A;  2KWV B;  4NQK E;  4GU2 A;  4W9I A;  5DPR A;  1E8X A;  3OJ3 A;  3QAQ A;  2N9P C;  1YJ1 A;  2DZM A;  4AP4 C;  1R4N I;  4LJO B;  3VUY A;  3RZW C;  4GDK B;  3H7S A;  4ZRK A;  2UWQ A;  4W9C A;  4IUM B;  1T0Y A;  2K25 A;  1X1M A;  2A4Z A;  2FNJ B;  3AUL A;  3PRZ A;  4G11 A;  2MBH A;  3QX1 A;  1LXD A;  3P2B A;  2MP2 B;  3QCA A;  2KHW B;  3DCG A;  3JW0 X;  3SD5 A;  2BKF A;  2J7Q B;  2KDI A;  3ZO5 B;  3DOW A;  2JY6 A;  2O2V A;  2N7D A;  3M3J A;  1V49 A;  3K9O B;  4W9J A;  1S1Q B;  3DVG X;  5IA7 A;  3PS6 A;  1SGH A;  1E7U A;  2KFJ A;  5JZE B;  4PS8 A;  1V2Y A;  2RD0 A;  4GIV A;  3R7R A;  2CHZ A;  4HWI B;  3IBE A;  1WH3 A;  2BYV E;  5CHW A;  3RZF A;  3VDZ A;  3R7Q A;  3APF A;  4BBN C;  2NBU A;  3KUZ A;  3PV1 A;  2KN5 A;  1P98 A;  2LZ6 A;  1V9J A;  1P1A A;  3PZD A;  1M94 A;  2LVQ A;  3B1L X;  3L13 A;  4J6I A;  2MSE D;  4KVG B;  3AU5 A;  2UYZ B;  1GG3 A;  3V61 A;  3VTW A;  2OOB B;  4MEL A;  1Q0W B;  2I1J A;  1PQS A;  4HXD A;  4CO7 A;  4LJP B;  4ZDV A;  3H7P A;  2JPH A;  3SU8 X;  2KTF A;  2CR5 A;  2KJ6 A;  3NHE B;  5DPT A;  3A9K B;  1I35 A;  1WMH A;  3N32 A;  1UGM A;  2K1F A;  1TBE A;  2WWZ A;  3K9P B;  4PS3 A;  4EZL A;  4GN1 A;  3H1U A;  2MBQ A;  3RT3 B;  3A1Q A;  2I1K A;  3DBL I;  4KZ0 A;  4ICV A;  4OVU A;  4BVU C;  5D2M B;  2DYO A;  4RM9 A;  2EMT A;  1V80 A;  2NPT B;  3U8Z A;  3EEC A;  2KLG A;  2JZ3 B;  2B3A A;  2N9E B;  5HKH A;  4IW0 A;  5IAA C;  1OTR B;  1Z2M A;  2L7R A;  4NJ6 A;  4HDQ A;  2J0J A;  2DX5 B;  2BKR B;  2GBM A;  2L0T A;  5TR5 A;  3UQA A;  4EFO A;  3PHX B;  3O65 B;  4PS7 A;  3UQB A;  2C7N B;  1EF1 A;  4GXB A;  4DWF A;  1QZE A;  2LWP A;  5EDS A;  2CHW A;  4FJV B;  4G0N B;  4GMV A;  4MM3 A;  5DCN A;  2GOW A;  1GC6 A;  3R3M A;  3HK0 A;  3A4R A;  3NZS A;  3TBL D;  1YIW A;  4IWQ A;  1HE8 A;  2FCS A;  1YQB A;  2O2V B;  4EOY A;  1OGW A;  2K39 A;  3DBS A;  3L10 B;  1WR6 E;  3IG3 A;  3KH0 A;  3LJ3 A;  2W9N A;  1E90 A;  2BYF A;  3ZRC A;  4F1S A;  1EO6 A;  2N4F A;  2ZCB A;  2IO3 B;  1C1Y B;  2KDE B;  3TL5 A;  2DZI A;  3WAP A;  4AOF A;  2N7E A;  1H8C A;  5LXH A;  1L7Y A;  3APD A;  3LDZ E;  2V1Y A;  2XEW A;  3ZTC A;  1RLF A;  1L2N A;  3BY4 B;  3JVZ X;  2RSU A;  3DVN U;  2DYM A;  4F8C B;  1WX7 A;  2KQS A;  1V5T A;  2JRI B;  2L00 B;  3L0W B;  1E8W A;  2KZR A;  4N9F 4;  4MDK E;  3BIN A;  1WE7 A;  3VUW A;  4P7I A;  1ZGU B;  4KDI C;  3PT2 B;  2FIF A;  3Q3F A;  2FUH B;  1R4M I;  1WJU A;  2Z0D B;  1WMH B;  2KX0 A;  3VHT C;  2KDB A;  2JF5 A;  5AZH A;  2KTR A;  5KHO A;  2LAS A;  4I6N B;  2DZK A;  2ZCC A;  4PYZ A;  5CHF A;  2MWS B;  4II2 B;  2C9W B;  4A3P A;  1G6J A;  2G4D B;  4FA6 A;  1KLV A;  4EEW A;  4WQO B;  2D3G A;  5FR6 A;  1D3Z A;  1EUV B;  1UH6 A;  2XK5 B;  5JHB A;  2ZVO A;  1OEY A;  3PSE B;  4TV3 A;  4HVB A;  3ENE A;  1WX8 A;  1ZW7 A;  1WZ0 A;  1H4R A;  2IY1 B;  5D94 A;  2G4S A;  2AL6 A;  3A9J B;  3PGE A;  5J18 A;  4HCP B;  4E74 A;  2WX0 A;  2ZJD A;  2IYD B;  3SHQ A;  2DAJ A;  4EZK A;  2MA9 B;  3QK0 A;  1J8C A;  2KX3 A;  2JRH A;  4MGI E;  2AEH A;  2M0X A;  5G55 A;  4NPN A;  2ZEQ A;  3B0A A;  3IVF A;  4WWO A;  1WGR A;  4M0W B;  4PYU A;  4URK A;  1ZKH A;  2BPS A;  3M95 A;  2LVO A;  2L3Z A;  2Z59 B;  3AI5 A;  2PE9 A;  3GOE A;  2L05 A;  3ZIM A;  1WRD B;  4X57 B;  4HK2 A;  1WXA A;  2KVR A;  3RYT A;  3PVL A;  3KUC B;  3ZW3 A;  4FAD A;  3QHT A;  3VXW A;  4AJW A;  3ZNG C;  3R66 C;  4E71 A;  2K8H A;  2PJH A;  1CMX B;  2HJ8 A;  4GDL A;  2M8S A;  4CHK A;  1C3T A;  4MSQ B;  4XC2 A;  4KV2 A;  1WIA A;  4RMA A;  3WAM A;  1NDD A;  4XZ4 A;  2O6V A;  4WJP A;  3QIJ A;  3QWZ B;  2ZPN A;  3DVN V;  4MEM A;  2MQJ A;  2C7H A;  2NR2 A;  3WAL A;  2KKC A;  1KJT A;  2N1V A;  1YD8 U;  1XT9 B;  3V60 A;  1E8Y A;  4FJY A;  5E6N A;  3T9L A;  4A3O A;  4WWP A;  1GNU A;  4WJQ A;  2KTR B;  5G2N A;  4DDG D;  4TUU A;  4NAW A;  4NNJ B;  4W9H A;  2D11 A;  2LGD A;  2IZV B;  4GGQ A;  2CHX A;  3UF8 A;  1A5R A;  2KWU B;  3DDC B;  3L08 A;  3JSV A;  1XD3 B;  2JVC A;  2OJR A;  2FCM A;  1UEL A;  4BKT A;  1SIF A;  2D10 A;  1IYF A;  4XX5 A;  2RGF A;  4B9K A;  1LFD A;  2L8J A;  5GMV A;  4K7W A;  3ZUN A;  4FHJ A;  3MHS D;  4B6W A;  4OVV A;  1BT0 A;  1YX6 B;  4MJS A;  3RUL A;  3N30 A;  1V5O A;  5CTR C;  2RR9 A;  1RAX A;  3PRE A;  4WAA A;  3TJP A;  2KC2 A;  4BBN F;  1WYW B;  2KFK A;  3PHW B;  3ONS A;  4HJK A;  2J0M A;  4IM3 A;  3DPD A;  4IM0 A;  3U7D A;  3ZNZ B;  2A5U A;  5LXI B;  3KUD B;  2VRR B;  2CU1 A;  2V4L A;  1RRB A;  1U4A A;  2K6Q A;  2JWZ A;  4FUL A;  1WFY A;  4HPL B;  1OEY J;  4IWO A;  4BKS A;  1E8Z A;  3ZDM C;  2K8B A;  2D07 B;  3L54 A;  2JXX A;  2K6D B;  2IY0 B;  1WXS A;  2J0K A;  3NY5 A;  4IWP A;  2LI5 A;  2KJR A;  4HCN B;  1WM2 A;  4W9K A;  2KD0 A; 
#chains in the Genus database with same CATH topology
 4JE3 B;  4W9L A;  5L95 C;  1QKZ A;  2DHZ A;  2M4N A;  1NYR A;  3EFU A;  3PPA A;  4XYC A;  3WAO A;  2H89 B;  3D32 A;  4K7S A;  2LUE A;  1WI0 A;  1IP9 A;  4ZRJ A;  4L1B A;  1T0S C;  4PK1 A;  2DYB A;  4HEA 1;  2MH7 A;  4L2Y A;  3HM6 X;  3ALB A;  3VFK A;  2GBK A;  1EU4 A;  1FPY A;  1WJN A;  4RF1 A;  5HG2 A;  3KYD D;  3UGB B;  3FIL A;  2NS5 A;  4JQW C;  4FBJ B;  3I3T B;  3OLM D;  3UIP B;  3UIN B;  4M8M A;  2BBC A;  2FID A;  3CMM B;  3M63 B;  3EHV A;  2ZVN A;  1TIF A;  2NCN A;  3OWE B;  4AS1 A;  3NS1 A;  1RYJ A;  1I4Q A;  3IAS 1;  3KVF B;  4RFB A;  4REZ A;  3C19 A;  2ZW1 A;  4YT0 B;  2C5L C;  2AL3 A;  4F7Z A;  4DHZ E;  2MW5 A;  1V6E A;  4ASW C;  1UBQ A;  2PW9 A;  2EMS A;  4KIK B;  2C60 A;  1WWT A;  3ZLZ A;  3B9J A;  2LHE A;  4ZRI A;  3P4S B;  3BWU D;  1WM3 A;  2BTE A;  2NBW B;  1UBI A;  2AYO B;  2ZZP B;  3NJT A;  3TSS A;  4DK5 A;  2QIL A;  3UIO B;  3GS2 A;  1DOX A;  4KKI A;  1WGY A;  3A4S C;  4GSW A;  4LDT D;  1KF6 B;  1KFY B;  1K51 A;  1Y8R C;  2BF8 B;  4GB9 A;  2XBB C;  1ZXI A;  2N9X A;  1B1Z A;  1C78 A;  2CS4 A;  5CHV C;  5C1Z A;  5G5H A;  4IG7 B;  1SJE D;  1T3Q A;  5E6O A;  3APC A;  3AED B;  4M00 A;  1FXT B;  1FEH A;  2JT4 B;  4TQ1 A;  2Q5W D;  2GMI C;  2WXG A;  1N61 A;  3AE8 B;  1WXM A;  2BGF A;  2Z0E B;  1XCQ L;  3VR9 B;  4EKU A;  2QMT A;  2N9K A;  1V1O A;  4NAW B;  3TIX A;  1WXQ A;  3VRB B;  4NJC A;  1D4B A;  2LVP A;  4AUQ C;  1TS4 A;  3URY A;  4C4V A;  5E6J A;  3EFC A;  5EE3 A;  1P7F A;  1FNU A;  4HPM B;  4P16 A;  3WA0 A;  2JSV X;  1NVI D;  1YX5 B;  2IO1 B;  2YVC A;  1TTN A;  2KC1 A;  4ZOH C;  3TMP B;  3MC9 A;  4K3B A;  1XEE A;  2LD9 A;  1UUP A;  3A9K A;  2YLM A;  3Q2A C;  4NJ7 A;  1E7V A;  1KLG D;  4OZB A;  2JXT A;  3QC8 B;  2E6X A;  4LLG M;  1UWM A;  1BUI C;  5EE9 A;  2UWQ A;  3AE9 B;  2KDM A;  4P1C C;  2FNJ B;  3AUL A;  3PRZ A;  2JU6 X;  4LNI A;  2KDI A;  3NZ3 A;  4LNK A;  3DOW A;  1DOI A;  2WP9 B;  2O2V A;  3Q8A A;  3Q8E A;  3PS6 A;  1SGH A;  3ZJT A;  5D3D A;  1V2Y A;  4GIV A;  2CHZ A;  2ACZ B;  1PDX A;  1P1A A;  2BS2 B;  2OED A;  3L13 A;  4KVG B;  5JXV A;  3AU5 A;  2KWD A;  4HKQ A;  1PGA A;  2Y3A A;  1JCK B;  5C2T B;  3C8Y A;  2I1J A;  4HXD A;  1L5P A;  4ZDV A;  3AEG B;  2KQ4 X;  1V1P A;  1UGM A;  2K1F A;  1L0Y B;  1TBE A;  2WWZ A;  3K9P B;  4EZL A;  2MBQ A;  3RT3 B;  3DBL I;  1K53 A;  4ICV A;  2RPV A;  2WXM A;  2X38 A;  2QJL A;  1D6E C;  2NPT B;  2JZ3 B;  2B3A A;  2N9E B;  5IAA C;  1OTR B;  2RDH A;  5HHD G;  1V97 A;  1T6B X;  1ZPS A;  2E3T A;  2BKR B;  5TR5 A;  3UQA A;  2OHF A;  4PS7 A;  1FD6 A;  1EF1 A;  4DWF A;  1JML A;  4FJV B;  5FR3 A;  2WXJ A;  5D3I B;  1JWB D;  1FMA D;  1YQB A;  4EOY A;  2K39 A;  2K9X A;  1WR6 E;  4AQ7 A;  1BXT A;  2N4F A;  1I4P A;  1C1Y B;  4AOF A;  5BMH A;  2HJ1 A;  2V1Y A;  2XEW A;  1L2N A;  3BY4 B;  2MJ3 A;  2WHI A;  1NEK B;  3NVZ A;  5EE0 A;  2RSU A;  3DVN U;  2JRI B;  1YN5 A;  2KZR A;  3AE1 B;  2BT6 A;  4MDK E;  3BIN A;  1HQR D;  3VUW A;  4P7I A;  1N62 A;  4KDI C;  1C4A A;  3T3N A;  1WJU A;  2KX0 A;  3VHT C;  2WS3 B;  4PYZ A;  2DNF A;  4II2 B;  1SXT A;  2C9W B;  1FCC C;  4A3P A;  2J53 A;  2G4D B;  2EKI A;  1ET6 A;  5FR6 A;  1UH6 A;  3E9S A;  5H92 C;  2ZVO A;  1GB4 A;  1HXY D;  4HVB A;  3ENE A;  1WZ0 A;  1H4R A;  2AL6 A;  2JQR B;  4N58 A;  2MA9 B;  1FNW A;  3AEE B;  1JWM D;  2JRH A;  4MGI E;  2M0X A;  3TUO A;  1WGR A;  4M0W B;  1ZKH A;  4QAY A;  2BPS A;  2PE9 A;  2WNM A;  2RDG A;  1WXA A;  1XO3 A;  2IND C;  3QHT A;  3IT6 B;  5FK9 C;  2KN4 A;  1C3T A;  1NDD A;  2QEJ C;  3QIJ A;  1A70 A;  1P7E A;  1KJT A;  1ROE A;  3BK1 A;  1XT9 B;  1E8Y A;  5E6N A;  1LGR A;  1D5M C;  4WWP A;  2PLP A;  4WJQ A;  3RPF C;  2KTR B;  4NAW A;  3GP7 A;  4NNJ B;  4GGQ A;  3Q8F A;  2KWU B;  3DDC B;  4HKZ E;  3L08 A;  1XD3 B;  1QOB A;  2OJR A;  4YSX B;  2BB5 A;  2FCM A;  2D10 A;  1IYF A;  4DXG A;  2L8J A;  3Q3M C;  4K7W A;  1IBX B;  2V3N A;  4IOI E;  3R2I A;  3N30 A;  4NAM A;  1V5O A;  1RAX A;  4BBN F;  1ZE3 D;  4IM3 A;  3DPD A;  4DXF A;  2LEK A;  4ZHO A;  2V4L A;  5AUK A;  1IGC A;  4KKJ A;  1ZDV A;  2JWZ A;  2NTS A;  1E8Z A;  2K8B A;  3ZJV A;  3L54 A;  4A8X C;  5BMI A;  1WXS A;  2J0K A;  2LI5 A;  1J7B A;  4W9K A;  5IO9 A;  4GDL B;  1NBF C;  1HZ5 A;  3N9Y C;  5AZG A;  4WWM A;  1JRO A;  4ZHP A;  4JIO U;  5AEK B;  2KMA A;  2LXA A;  3AEA B;  1YJJ A;  4HJG E;  2PPH A;  2AQ1 B;  1UZX B;  1WGD A;  2LJI A;  2Y5B B;  2DWQ A;  2ZW0 A;  4XDC A;  3B2F A;  1WYG A;  4L23 A;  4W9E A;  3JSV B;  1EF5 A;  4A9A A;  5J2R A;  3L17 A;  1V86 A;  4YTN B;  2MJE A;  2PE6 B;  2NVU I;  4JWU C;  3ECI A;  2KQ7 A;  3ZDT A;  1JWS D;  1JWU D;  2FAZ A;  2KJH B;  2LGS A;  3BYY B;  5JH5 C;  4RGT A;  2IJ0 A;  3IAM 1;  2WXN A;  2KFK B;  4FHK A;  2LMC A;  4BFR A;  2AX5 A;  4MM3 B;  1MHX A;  3RMK C;  4K7U A;  3GE3 C;  2CKH B;  4AWJ A;  4ANV A;  4ANX A;  3ZNH B;  2NPT A;  2R2O A;  4OZA A;  3CF6 E;  4CYE A;  2KO3 A;  3VVW B;  4JGH B;  5BO4 B;  2O6V D;  3SFE B;  2CJN A;  4LTU A;  4RF0 A;  3AE3 B;  1FO4 A;  5D7G A;  1RFA A;  3I63 C;  1YOV B;  1ESF A;  3RD2 A;  3ZQ4 A;  2NMQ A;  1EU3 A;  2WDT B;  2M17 A;  4USA A;  5C23 A;  2CU3 A;  4B0E A;  3VUX A;  4FLH A;  4BZA A;  2MJD A;  1N6Z A;  4YWG G;  3L16 A;  1SB3 C;  3SR6 A;  1YMH E;  3AE5 B;  3X23 A;  3Q3N C;  4J3O D;  2IPK D;  2FCQ A;  4RM8 A;  4FXC A;  1VZ8 A;  4BKS D;  3RI7 C;  2GI9 A;  3TCA A;  4R3D A;  3UI3 A;  2WGS A;  1TGZ B;  4EE2 A;  1XLP A;  2HE7 A;  4WAF A;  5EE1 A;  1GJZ A;  1UNS A;  2I2Y A;  2KNB A;  3DQV A;  2GLS A;  3AV8 A;  1GC7 A;  3A33 B;  1WJ6 A;  1STE A;  5DPS A;  3EC8 A;  1JRP A;  5T8I A;  2N1W A;  3KWV A;  2MBO A;  2W55 A;  1SE9 A;  5L83 A;  1E5W A;  4ARI A;  4M0W A;  2K22 A;  2KOX A;  1KM7 A;  2R2Q A;  3RCZ A;  1I42 A;  3V6E B;  1SEB D;  4RH6 A;  1VD2 A;  2J4X A;  3N3K B;  4MGZ E;  2L76 A;  3NVY A;  3ZTD A;  3VTV A;  1K8R B;  5GXG B;  1WR1 A;  1ZOY B;  3GZN I;  1GUA B;  4LDT B;  4HDO A;  4TQ0 A;  2V3P A;  3ML9 A;  2MBB B;  2W3S A;  4JL9 A;  3TEZ A;  4K81 A;  3IXS A;  2KT7 A;  2DAF A;  1XQQ A;  1XXG A;  2G45 B;  2KLC A;  1C9F A;  3AN1 A;  3P42 A;  5LLI A;  1LO5 D;  3I9V 1;  4YL8 A;  2ZNV C;  3AEC B;  2MLB A;  2KWV B;  2X8X X;  4GU2 A;  1IBX A;  1GPX A;  4MT5 A;  2WDQ B;  3AEB B;  4ZRK A;  3H7S A;  1KRH A;  4W9C A;  4IUM B;  1XLO A;  2A4Z A;  2MBH A;  3QX1 A;  3P2B A;  1FM0 D;  2MP2 B;  2UU7 A;  3SD5 A;  2BKF A;  2J7Q B;  3ZO5 B;  2JY6 A;  3PO0 A;  3BK2 A;  3ZYY X;  1N63 A;  1C4C A;  5IA7 A;  2KFJ A;  1E7U A;  4O1N A;  5H8Y E;  3R2T A;  4HWI B;  3RZF A;  2VZK B;  2CJO A;  3VDZ A;  3W9C B;  3PZ8 A;  3KUZ A;  3Q14 C;  1M94 A;  4YSZ B;  1GG3 A;  3VTW A;  4MEL A;  2JPH A;  2KYW A;  5DPT A;  1I35 A;  4PS3 A;  4A6Q A;  3KQ4 A;  4GN1 A;  2WXH A;  3H1U A;  4XE0 A;  5D2M B;  4XWW A;  2DYO A;  1E9M A;  1VJK A;  4IW0 A;  2L7R A;  4NJ6 A;  1I4H A;  2DX5 B;  2GBM A;  5BYR A;  4GXB A;  1QZE A;  1JWA D;  2B76 B;  2CHW A;  4G0N B;  5DCN A;  4MM3 A;  1AW7 A;  5IKC M;  3NZS A;  4IWQ A;  4LK0 M;  3P4P B;  5IN7 A;  2DLB A;  3ETR A;  2W9N A;  2KDE B;  2N7E A;  4M02 A;  1L7Y A;  3APD A;  3LDZ E;  2VZK D;  3DHI C;  3TEX A;  2KQS A;  3L0W B;  3HVZ A;  3DWM A;  3FC4 A;  4N9F 4;  4RGN A;  3W5U B;  3RNC C;  1WE7 A;  2BYT A;  1ZGU B;  1HZ6 A;  2FUH B;  1PYW D;  5IOI A;  2QCZ A;  1WMH B;  2KDB A;  1YJI A;  5KHO A;  4I6N B;  2DZK A;  2QIE B;  3DBH B;  4WQO B;  1D3Z A;  5AUI A;  2XK5 B;  1OEY A;  4DQO C;  4YXD B;  3MC0 B;  5J18 A;  4HCP B;  2WX0 A;  2IYD B;  1TY0 A;  2LGI A;  4EZK A;  3QK0 A;  3RN9 C;  2AEH A;  1RWS A;  5G55 A;  1QT9 A;  4NPN A;  3B0A A;  3IVF A;  1JAL A;  4S17 A;  4WWO A;  1R4N B;  3M95 A;  2L3Z A;  3AI5 A;  3GB1 A;  2ONQ A;  3ZIM A;  2V4I B;  4AJW A;  4E71 A;  2DBY A;  3KWL A;  1WIA A;  5HI1 A;  1C4P A;  4XZ4 A;  2VH2 A;  3NG0 A;  2ZPN A;  3WAL A;  2KKC A;  1SE2 A;  2PIA A;  4A3O A;  1J7C A;  4TUU A;  3UF8 A;  2IZV B;  1A5R A;  2CHX A;  2EEL A;  2AQ3 B;  5LNK 1;  1VDV A;  3Q69 A;  2ICI A;  4TMA B;  4H2A A;  1SIF A;  4LNF A;  4XX5 A;  2RGF A;  2W3R A;  2YEP F;  3N1Z C;  4HRS A;  3ZUN A;  4B6W A;  1BT0 A;  1YX6 B;  1RM6 C;  1YNT E;  3U7D A;  2A5U A;  5LXI B;  3KUD B;  2K6Q A;  1OEY J;  4IWO A;  3L4P A;  3ZDM C;  1XLN A;  3NY5 A;  2GRI A;  2KD0 A;  1LM8 B;  4KSK C;  1QLB B;  1F52 A;  2ASQ A;  1SIJ A;  1GB1 A;  3RFZ B;  5E6P A;  3ABV B;  4I6P A;  3MJW A;  1PUT A;  4KIK A;  4K3C A;  1SSN A;  1MI0 A;  1C79 A;  2KAN A;  4ZYN A;  3MTN B;  2MP2 A;  3H7P B;  1Q1O A;  3B08 A;  4C7Z A;  2PEA A;  3VTU A;  3X0W A;  2BYE A;  4PT5 A;  3A1Q B;  1S3S G;  1P0R A;  4MGY E;  3ZJU A;  1IGD A;  4MJS B;  3WAN A;  3V6C B;  4KGS A;  4G50 A;  4WUR A;  4WJN A;  1OQR A;  4B95 A;  3CWI A;  3ZVV A;  5AZF A;  3P1M A;  3MC8 A;  2G3Q B;  1TT5 B;  2K8C A;  1WF9 A;  2D3A A;  3T3O A;  2J52 A;  4M8N A;  2ZPY A;  2HDE A;  5IP4 D;  3EUB 2;  1WGH A;  4K1R B;  2FCN A;  4YTP B;  1YN3 A;  4TKN A;  1TKE A;  2GBJ A;  4IM2 A;  4AJY B;  1N5W A;  2DZJ A;  2D5G A;  1DYQ A;  1E7P B;  3PTF C;  3P63 A;  3ZNI D;  4ZYS A;  3RNF C;  1KOT A;  1I4X A;  1IPG A;  1Q5W B;  3RNB C;  3BYT B;  2SEB D;  4US8 A;  4ICU A;  3SEB A;  5TSS A;  3OG5 A;  3DWG C;  3QQ8 B;  3NOB A;  3LB8 C;  3ZXR A;  4W9D A;  3WCQ A;  2QSD A;  1OQY A;  3V05 A;  3IHP C;  2IBI B;  2HTM E;  2M1M A;  1F77 A;  3H6N A;  4EUT A;  3PZ7 A;  2RDB C;  2MEK A;  1VCB A;  3FIL B;  3HHM A;  1JRU A;  2LGY A;  2FBW B;  2DEN B;  4I6L B;  3Q3O C;  4DHJ B;  2NBV B;  1NI2 A;  4A20 A;  1Q10 A;  4P6V F;  1J19 A;  1FRD A;  4EZJ A;  1HTO A;  3OJ4 B;  1HA5 A;  3R8B A;  4MH0 E;  1Z5S B;  4BKG A;  1WY8 A;  1VZ7 A;  4ANW A;  1YN4 A;  1AAR A;  3ZKJ C;  2IGG A;  2XK5 A;  2KDF B;  1T0R C;  3FAH A;  3J9C A;  2KWC A;  2L52 A;  4DDI D;  2AWT A;  4DHZ B;  2O6V B;  2WXR A;  1DGJ A;  2PKO A;  2WXO A;  1FNV A;  1WJ4 A;  2GBR A;  4KSL C;  2C7M B;  1WXV A;  1ZP0 B;  1TZ1 A;  1NI3 A;  3KYC D;  3DHG C;  4JLC A;  1MG4 A;  2KXJ A;  4RNA A;  3AEF B;  4BOS C;  5D6J B;  3OAW A;  3CST A;  4MSM B;  1QIL A;  1WGG A;  3VQI A;  1WZ3 A;  3VR8 B;  2LRW A;  3BVZ A;  4MGK E;  4II3 B;  3MJ5 A;  3DBH I;  1P9D U;  2KAJ A;  4DHJ D;  3NUH B;  1CK1 A;  3NZU A;  1T5X D;  2PTL A;  1F1H A;  2PMV A;  4BOZ B;  2LUM A;  5J17 A;  1ISN A;  3NRZ A;  1HTQ A;  1VR9 A;  2MX2 A;  3RUI B;  1MJD A;  4NY0 A;  2QDF A;  1WSP A;  4NQK E;  5DPR A;  1E8X A;  1YJ1 A;  2DZM A;  2GB1 A;  3HRD D;  4AP4 C;  1R4N I;  3VUY A;  3RZW C;  4GDK B;  1D5Z C;  1T0Y A;  1TS2 A;  2K25 A;  3W5V B;  2W54 A;  5FKA C;  1LXD A;  3QCA A;  1B9R A;  1FCL A;  1SF0 A;  4IDI A;  3Q6B A;  4XGA B;  3DVG X;  5JZE B;  4WIP A;  4C4V B;  2RD0 A;  2MHJ A;  2KMM A;  3APF A;  4BBN C;  2NBU A;  2KN5 A;  1GAQ B;  4KGR A;  3PZD A;  2LVQ A;  4J6I A;  2D3C A;  2UYZ B;  1EWY C;  1V8C A;  1Q0W B;  3EA6 A;  1PGB A;  3H7P A;  3SU8 X;  2KJ6 A;  3DBR B;  3A9K B;  3RNA C;  3RNG C;  1E10 A;  4JWS C;  4OZC A;  3A1Q A;  4OVU A;  1V80 A;  3U8Z A;  3DHH C;  3BVM A;  5HKH A;  1Z2M A;  3V3X A;  4JPS A;  3UQB A;  3O65 B;  1L0V B;  5EDS A;  4GMV A;  1GC6 A;  3HK0 A;  3TBL D;  1YIW A;  2Y5P A;  1CZP A;  2FCS A;  4OHJ A;  2O2V B;  1OGW A;  3L10 B;  3DBS A;  3LJ3 A;  1VLB A;  3KH0 A;  1E90 A;  3I57 A;  3MHZ A;  3ZRC A;  1XCT L;  2ZCB A;  3TL5 A;  1MFW A;  3WAP A;  2XNA C;  1KH0 A;  4A90 A;  3ZTC A;  1TZO A;  3JVZ X;  1WGK A;  2DYM A;  4F8C B;  4C56 C;  1V5T A;  1MVK A;  4N59 A;  3Q3F A;  2FIF A;  2Z0D B;  1R7S A;  1TKY A;  1V1P B;  2WXI A;  2KTR A;  3N1X C;  3W2D A;  5CHF A;  2WDR B;  2WXQ A;  4FA6 A;  1KLV A;  4WH4 A;  3U52 E;  2TSS A;  1TYG B;  2Z8L A;  3PSE B;  3AE2 B;  1WX8 A;  1L6V A;  1QOA A;  3HUI A;  1JW9 D;  2PVG C;  2IY1 B;  3PGE A;  3A9J B;  4E74 A;  2ZJD A;  2DAJ A;  2YEP B;  1UF0 A;  2ZEQ A;  2JYT A;  2W82 A;  3FKY A;  4PYU A;  4URK A;  2LVO A;  4S0R A;  2Z59 B;  2INP E;  3U7Z A;  3GOE A;  2N7J A;  4HK2 A;  3PVL A;  4FAD A;  3ZW3 A;  3VXW A;  3R66 C;  2M56 B;  4GDL A;  3AE4 B;  4CHK A;  2R61 A;  4YSY B;  1L0X B;  2VH1 A;  4KV2 A;  4RMA A;  5MPO A;  2O6V A;  4WJP A;  1CJE A;  4C00 A;  2MQJ A;  2C7H A;  2N1V A;  3V60 A;  3T9L A;  4ZRP A;  1K52 A;  1E6E B;  5G2N A;  4B0M A;  4W9H A;  1T0Q C;  2LGD A;  1IUE A;  1FXA A;  3JSV A;  2JVC A;  1UEL A;  1ACC A;  2I38 A;  4B9K A;  1LFD A;  1EWC A;  3GE8 C;  3MHS D;  4US9 A;  3RUL A;  5CTR C;  2RR9 A;  3PRE A;  3AE7 B;  2KC2 A;  1WYW B;  2KFK A;  3PHW B;  3ONS A;  2J0M A;  3NVW A;  3ZNZ B;  4IM0 A;  2FE8 A;  2CU1 A;  1RRB A;  3SFD B;  4BKS A;  1N5X A;  1NYQ A;  2JXX A;  5BYS A;  2K6D B;  4ARC A;  2IY0 B;  1F2R I;  1FXI A;  2AQ2 B;  4HCN B;  1AWD A;  1WM2 A;  3C0R B;  3WIM A;  5KHQ A;  2L1A A;  2G9H D;  2H88 B;  3H9D A;  1TKG A;  4FJZ A;  4D2K A;  4GDK A;  1XLQ A;  2WYQ A;  2JYE A;  4DBG A;  3CIR B;  4IC7 B;  4RGO S;  2N9L A;  2LJ5 A;  2WLB A;  1F2R C;  3PRP B;  4W9F A;  1OQQ A;  2BQQ A;  3LYY A;  3VH4 B;  4G3X B;  3AU4 A;  3S2A A;  2QHO A;  3HIZ A;  2XN9 C;  2LFI A;  2WU5 B;  4LCD E;  1R4M B;  2MBE A;  4KZC A;  2KAC A;  2LHD A;  1UD7 A;  2WQY B;  4GOC A;  2J42 A;  3AXC A;  3MP9 A;  2RPQ A;  4NQL B;  4KDL B;  5JHA A;  2WXK A;  3PLV A;  2L0F A;  2WX1 A;  3Q3J A;  1TS3 A;  3VAW A;  2GBN A;  2BW2 A;  4Q2J A;  4DXA B;  1CQV A;  1LQB A;  2L32 A;  3B2G A;  2JZP A;  2EKE C;  3RNE C;  4C7Y A;  3TEW A;  2WXF A;  3O13 A;  2M0A A;  4FN2 A;  4MH8 A;  1WX9 A;  2MCN B;  2BS4 B;  1J0G A;  3PLU A;  3ZRF A;  1E0Z A;  2D2Q A;  3QAR A;  1MG8 A;  3N20 C;  1J7A A;  3U4E G;  3P4Q B;  4ANU A;  3V62 A;  1XF5 L;  3U30 A;  3W1S A;  4HLE A;  2JZZ A;  3PRM B;  3HM3 A;  3IFW B;  3DBR I;  2HTH A;  1MPE A;  4E3C A;  3T8M A;  1V81 A;  4M01 A;  1TJE A;  1P3Q U;  1AYF A;  2BWE S;  1TY2 A;  2BWF A;  1I4R A;  1SJH D;  2HD5 B;  2IO2 B;  3W1Y A;  3SDL C;  1FFV A;  2WU2 B;  3NS8 A;  3EGR A;  3VH3 B;  3ML8 A;  2KK8 A;  5BYQ A;  3BII D;  3DVG Y;  3JYU A;  3A9J A;  3QA8 A;  2REX A;  2MRP A;  4ZRQ A;  2KMC A;  4WQM A;  4CQN A;  1L4Z B;  1D5X C;  1SE4 A;  2ON8 A;  2IO0 B;  2V3S A;  1L6U A;  3QJZ A;  3E56 A;  3IT4 B;  4OVZ A;  4ACF A;  2L83 A;  4W9G A;  1PFD A;  3KW5 B;  1WE6 A;  3M62 B;  2NTT A;  2INC C;  4WJO A;  5CX3 A;  1QOG A;  4WWN A;  2G1E A;  5DPW A;  1F9J A;  3AE6 B;  2JUO A;  1SBB B;  4IKG A;  3BVG A;  2LXC A;  3CSF A;  2ZNV B;  3W1S C;  5HFY A;  2V0G A;  1ZXH A;  2LRU A;  1TS5 A;  3GZN B;  3NVV A;  1KLU D;  3MFG A;  2LGX A;  1KTK A;  3LXF A;  4OW0 A;  4W9I A;  1HEZ E;  3OJ3 A;  3QAQ A;  2N9P C;  3ZGZ A;  1L4D B;  1Y56 A;  4LJO B;  5G5G A;  1C77 A;  2V9H A;  2D3B A;  3AH7 A;  1X1M A;  4G11 A;  2BB6 A;  1I4G A;  1FIQ A;  2KHW B;  3DCG A;  3JW0 X;  2N7D A;  3M3J A;  1V49 A;  2WXL A;  3K9O B;  2FUG 1;  2M19 A;  4W9J A;  1S1Q B;  1UGJ A;  1FFU A;  1C76 A;  4PS8 A;  4RGM A;  3R7R A;  3IBE A;  1WH3 A;  4HRO A;  4ITK A;  2BYV E;  5CHW A;  2IGD A;  3R7Q A;  3PV1 A;  3Q8B A;  1P98 A;  2LZ6 A;  1V9J A;  1FRR A;  3B1L X;  2MSE D;  3V61 A;  3AMZ A;  2OOB B;  4BAX A;  1SE3 A;  1PQS A;  4CO7 A;  4LJP B;  2KTF A;  3I5J C;  2CR5 A;  3NHE B;  1WMH A;  3N32 A;  4KX6 B;  4XWT A;  1I7H A;  1QOF A;  2I1K A;  4KZ0 A;  4BVU C;  4UDU C;  2EMT A;  3VRA B;  1VRA B;  3EEC A;  2KLG A;  1MHH E;  3H8H A;  2KVZ A;  4HDQ A;  2J0J A;  1EM7 A;  2L0T A;  4EFO A;  3PHX B;  2C7N B;  3KLS X;  2LWP A;  1YQ3 B;  4P1B C;  2GOW A;  3R3M A;  3A4R A;  1HE8 A;  2IGH A;  1RFK A;  3IG3 A;  2BYF A;  2QC8 A;  4F1S A;  1EO6 A;  1BML C;  2N0S B;  2IO3 B;  2DZI A;  1H8C A;  5LXH A;  2PVO D;  1RLF A;  2JX5 A;  2BS3 B;  1F0Z A;  1YQ4 B;  2Y5C A;  4LNO A;  1WX7 A;  3AB5 A;  2L00 B;  1E8W A;  3Q8C A;  2OJW A;  4KGT A;  3PT2 B;  3HVD A;  1AN8 A;  1R4M I;  2IDY A;  2JF5 A;  5AZH A;  5C3J B;  2BVC A;  2LAS A;  2ZCC A;  2MWS B;  1G6J A;  3AM9 A;  1K50 A;  4JX1 C;  4EEW A;  2D3G A;  1EUV B;  3N1Y C;  1N60 A;  1PGX A;  5JHB A;  1QF6 A;  4TV3 A;  1ZW7 A;  1QQR A;  5D94 A;  2G4S A;  1JQ4 A;  5I4D A;  1VZ6 A;  3SHQ A;  2INN E;  1GOZ A;  1J8C A;  2KX3 A;  4NZL B;  4RCO A;  2L05 A;  1WRD B;  4X57 B;  3RYT A;  2KVR A;  1NEN B;  3KUC B;  1ZUD 2;  4HPP A;  1DOY A;  3ZNG C;  2K8H A;  2PJH A;  1CMX B;  2HJ8 A;  1OFF A;  2M8S A;  4LNN A;  4XDD A;  4MSQ B;  1ZDX A;  4XC2 A;  3WAM A;  2SAK A;  2WDV B;  1ENF A;  3QWZ B;  3DVN V;  3P4R B;  4MEM A;  2NR2 A;  1M4V A;  1YD8 U;  4FJY A;  1WRI A;  1GNU A;  2K0P A;  4DDG D;  2D11 A;  5BMG A;  4MAC A;  4A55 A;  3BZD B;  4N6E B;  4BKT A;  5GMV A;  3U2S C;  4FHJ A;  4OVV A;  4MJS A;  3DBL B;  1ET9 A;  4WAA A;  3TJP A;  4C80 A;  4TSS A;  4HJK A;  1UWX A;  2VRR B;  2K5P A;  2K3U A;  2RMM A;  1U4A A;  4FUL A;  4HPL B;  1WFY A;  2JWU A;  3TEY A;  2D07 B;  3ZXV A;  4YTM B;  4IWP A;  2KJR A;  2WXP A;  4GLS C;  4RM9 A; 
#chains in the Genus database with same CATH homology
 3C0R B;  4GDL B;  3WIM A;  4W9L A;  1NBF C;  5KHQ A;  1LM8 B;  4KSK C;  5L95 C;  3H9D A;  2ASQ A;  5AZG A;  4FJZ A;  2DHZ A;  2M4N A;  4JIO U;  3WAO A;  3EFU A;  3PPA A;  4GDK A;  5AEK B;  2WYQ A;  2KMA A;  2LXA A;  5E6P A;  4DBG A;  4I6P A;  3MJW A;  4KIK A;  4IC7 B;  3D32 A;  2KAN A;  2PPH A;  4ZYN A;  3MTN B;  2LJ5 A;  2MP2 A;  4K7S A;  2LUE A;  1UZX B;  1WGD A;  1Q1O A;  1WI0 A;  2Y5B B;  3B08 A;  3H7P B;  1IP9 A;  4ZRJ A;  3PRP B;  4W9F A;  4W9E A;  2PEA A;  3VH4 B;  4G3X B;  3VTU A;  3AU4 A;  3S2A A;  2QHO A;  1EF5 A;  3JSV B;  3X0W A;  2BYE A;  5J2R A;  3HIZ A;  2DYB A;  3A1Q B;  3L17 A;  1S3S G;  1V86 A;  4LCD E;  2PE6 B;  1P0R A;  2MBE A;  4KZC A;  3HM6 X;  2NVU I;  4MGY E;  3ALB A;  3VFK A;  2GBK A;  3ECI A;  2KQ7 A;  4MJS B;  3ZDT A;  1UD7 A;  2FAZ A;  2KJH B;  5JH5 C;  3WAN A;  3V6C B;  4GOC A;  4G50 A;  4WJN A;  2KFK B;  1WJN A;  4FHK A;  4B95 A;  3AXC A;  3KYD D;  3UGB B;  2RPQ A;  3ZVV A;  5AZF A;  4BFR A;  4NQL B;  2NS5 A;  4JQW C;  4FBJ B;  4KDL B;  2G3Q B;  3I3T B;  3OLM D;  5JHA A;  3PLV A;  3UIP B;  2K8C A;  3UIN B;  1WF9 A;  2L0F A;  4M8M A;  2WX1 A;  3Q3J A;  3VAW A;  2FID A;  3CMM B;  3M63 B;  3EHV A;  2GBN A;  4M8N A;  2ZPY A;  2ZVN A;  4K7U A;  2CKH B;  2NCN A;  4AWJ A;  4DXA B;  1LQB A;  1WGH A;  4K1R B;  2FCN A;  4TKN A;  4ANV A;  4ANX A;  3ZNH B;  2NPT A;  3KVF B;  2R2O A;  2EKE C;  3CF6 E;  4CYE A;  2KO3 A;  3VVW B;  4JGH B;  2GBJ A;  2C5L C;  4IM2 A;  2AL3 A;  4AJY B;  5BO4 B;  2O6V D;  4F7Z A;  2DZJ A;  4DHZ E;  2MW5 A;  1V6E A;  4FN2 A;  3PTF C;  1WX9 A;  4ASW C;  2MCN B;  3ZNI D;  1UBQ A;  2EMS A;  4KIK B;  1KOT A;  5D7G A;  1RFA A;  1J0G A;  1IPG A;  1Q5W B;  2C60 A;  3ZLZ A;  3PLU A;  3ZRF A;  4ICU A;  4ZRI A;  3RD2 A;  1WM3 A;  2D2Q A;  3QAR A;  2NBW B;  1UBI A;  2AYO B;  2ZZP B;  3QQ8 B;  2WDT B;  2M17 A;  5C23 A;  3NOB A;  1MG8 A;  4DK5 A;  3VUX A;  4FLH A;  4W9D A;  3UIO B;  4ANU A;  3V62 A;  3U30 A;  3W1S A;  4HLE A;  2JZZ A;  1OQY A;  3IHP C;  3HM3 A;  3IFW B;  1WGY A;  2IBI B;  2M1M A;  3A4S C;  3L16 A;  3PRM B;  3X23 A;  3DBR I;  3H6N A;  4GSW A;  4EUT A;  4LDT D;  2HTH A;  1VCB A;  2FCQ A;  4E3C A;  3T8M A;  1V81 A;  3HHM A;  1JRU A;  1P3Q U;  1Y8R C;  2BF8 B;  2LGY A;  2DEN B;  4I6L B;  2BWE S;  4RM8 A;  4GB9 A;  2XBB C;  2BWF A;  4DHJ B;  2HD5 B;  2N9X A;  2NBV B;  4BKS D;  2IO2 B;  1NI2 A;  3TCA A;  4A20 A;  3W1Y A;  1J19 A;  4EZJ A;  3SDL C;  2CS4 A;  3OJ4 B;  1TGZ B;  4MH0 E;  5CHV C;  1Z5S B;  3NS8 A;  5C1Z A;  4BKG A;  1WY8 A;  2HE7 A;  4IG7 B;  3VH3 B;  4ANW A;  1AAR A;  3ZKJ C;  3ML8 A;  1GJZ A;  2XK5 A;  2KDF B;  2KK8 A;  2KNB A;  3DQV A;  2KWC A;  5E6O A;  1GC7 A;  3DVG Y;  3JYU A;  3A33 B;  1WJ6 A;  3APC A;  4DDI D;  3A9J A;  2AWT A;  5DPS A;  3EC8 A;  1FXT B;  3QA8 A;  4DHZ B;  2O6V B;  2REX A;  2MRP A;  2KMC A;  2JT4 B;  2N1W A;  4TQ1 A;  1SE9 A;  1WJ4 A;  2MBO A;  2GBR A;  4KSL C;  1E5W A;  1WXV A;  2C7M B;  2GMI C;  5L83 A;  1TZ1 A;  1WXM A;  2BGF A;  2Z0E B;  2IO0 B;  2V3S A;  3QJZ A;  4EKU A;  3KYC D;  4JLC A;  4NAW B;  3TIX A;  2KXJ A;  2KOX A;  1KM7 A;  4W9G A;  2R2Q A;  2LVP A;  3RCZ A;  4AUQ C;  1I42 A;  3V6E B;  3KW5 B;  1WE6 A;  3M62 B;  1VD2 A;  3N3K B;  4BOS C;  5D6J B;  3OAW A;  4MGZ E;  2L76 A;  3CST A;  4WJO A;  4MSM B;  5CX3 A;  4WWN A;  3ZTD A;  3VTV A;  1K8R B;  1WGG A;  3VQI A;  4HPM B;  5DPW A;  1F9J A;  3WA0 A;  1WR1 A;  1WZ3 A;  3GZN I;  2JUO A;  1GUA B;  2LRW A;  2LXC A;  3CSF A;  4HDO A;  1YX5 B;  4LDT B;  4MGK E;  4II3 B;  4TQ0 A;  2ZNV B;  2IO1 B;  3DBH I;  2MBB B;  1P9D U;  1TTN A;  2KC1 A;  2YVC A;  3ML9 A;  3TMP B;  3W1S C;  2LRU A;  4DHJ D;  4JL9 A;  4K81 A;  3NZU A;  2LD9 A;  2DAF A;  3A9K A;  4BOZ B;  1XQQ A;  5J17 A;  2LGX A;  1ISN A;  2G45 B;  2YLM A;  2KLC A;  4NJ7 A;  5LLI A;  2MX2 A;  3RUI B;  1E7V A;  4NY0 A;  4YL8 A;  2ZNV C;  3QC8 B;  2MLB A;  2KWV B;  4NQK E;  4GU2 A;  4W9I A;  5DPR A;  1E8X A;  3OJ3 A;  3QAQ A;  2N9P C;  1YJ1 A;  2DZM A;  4AP4 C;  1R4N I;  4LJO B;  3VUY A;  3RZW C;  4GDK B;  3H7S A;  4ZRK A;  2UWQ A;  4W9C A;  4IUM B;  1T0Y A;  2K25 A;  1X1M A;  2A4Z A;  2FNJ B;  3AUL A;  3PRZ A;  4G11 A;  2MBH A;  3QX1 A;  1LXD A;  3P2B A;  2MP2 B;  3QCA A;  2KHW B;  3DCG A;  3JW0 X;  3SD5 A;  2BKF A;  2J7Q B;  2KDI A;  3ZO5 B;  3DOW A;  2JY6 A;  2O2V A;  2N7D A;  3M3J A;  1V49 A;  3K9O B;  4W9J A;  1S1Q B;  3DVG X;  5IA7 A;  3PS6 A;  1SGH A;  1E7U A;  2KFJ A;  5JZE B;  4PS8 A;  1V2Y A;  2RD0 A;  4GIV A;  3R7R A;  2CHZ A;  4HWI B;  3IBE A;  1WH3 A;  2BYV E;  5CHW A;  3RZF A;  3VDZ A;  3R7Q A;  3APF A;  4BBN C;  2NBU A;  3KUZ A;  3PV1 A;  2KN5 A;  1P98 A;  2LZ6 A;  1V9J A;  1P1A A;  3PZD A;  1M94 A;  2LVQ A;  3B1L X;  3L13 A;  4J6I A;  2MSE D;  4KVG B;  3AU5 A;  2UYZ B;  1GG3 A;  3V61 A;  3VTW A;  2OOB B;  4MEL A;  1Q0W B;  2I1J A;  1PQS A;  4HXD A;  4CO7 A;  4LJP B;  4ZDV A;  3H7P A;  2JPH A;  3SU8 X;  2KTF A;  2CR5 A;  2KJ6 A;  3NHE B;  5DPT A;  3A9K B;  1I35 A;  1WMH A;  3N32 A;  1UGM A;  2K1F A;  1TBE A;  2WWZ A;  3K9P B;  4PS3 A;  4EZL A;  4GN1 A;  3H1U A;  2MBQ A;  3RT3 B;  3A1Q A;  2I1K A;  3DBL I;  4KZ0 A;  4ICV A;  4OVU A;  4BVU C;  5D2M B;  2DYO A;  4RM9 A;  2EMT A;  1V80 A;  2NPT B;  3U8Z A;  3EEC A;  2KLG A;  2JZ3 B;  2B3A A;  2N9E B;  5HKH A;  4IW0 A;  5IAA C;  1OTR B;  1Z2M A;  2L7R A;  4NJ6 A;  4HDQ A;  2J0J A;  2DX5 B;  2BKR B;  2GBM A;  2L0T A;  5TR5 A;  3UQA A;  4EFO A;  3PHX B;  3O65 B;  4PS7 A;  3UQB A;  2C7N B;  1EF1 A;  4GXB A;  4DWF A;  1QZE A;  2LWP A;  5EDS A;  2CHW A;  4FJV B;  4G0N B;  4GMV A;  4MM3 A;  5DCN A;  2GOW A;  1GC6 A;  3R3M A;  3HK0 A;  3A4R A;  3NZS A;  3TBL D;  1YIW A;  4IWQ A;  1HE8 A;  2FCS A;  1YQB A;  2O2V B;  4EOY A;  1OGW A;  2K39 A;  3DBS A;  3L10 B;  1WR6 E;  3IG3 A;  3KH0 A;  3LJ3 A;  2W9N A;  1E90 A;  2BYF A;  3ZRC A;  4F1S A;  1EO6 A;  2N4F A;  2ZCB A;  2IO3 B;  1C1Y B;  2KDE B;  3TL5 A;  2DZI A;  3WAP A;  4AOF A;  2N7E A;  1H8C A;  5LXH A;  1L7Y A;  3APD A;  3LDZ E;  2V1Y A;  2XEW A;  3ZTC A;  1RLF A;  1L2N A;  3BY4 B;  3JVZ X;  2RSU A;  3DVN U;  2DYM A;  4F8C B;  1WX7 A;  2KQS A;  1V5T A;  2JRI B;  2L00 B;  3L0W B;  1E8W A;  2KZR A;  4N9F 4;  4MDK E;  3BIN A;  1WE7 A;  3VUW A;  4P7I A;  1ZGU B;  4KDI C;  3PT2 B;  2FIF A;  3Q3F A;  2FUH B;  1R4M I;  1WJU A;  2Z0D B;  1WMH B;  2KX0 A;  3VHT C;  2KDB A;  2JF5 A;  5AZH A;  2KTR A;  5KHO A;  2LAS A;  4I6N B;  2DZK A;  2ZCC A;  4PYZ A;  5CHF A;  2MWS B;  4II2 B;  2C9W B;  4A3P A;  1G6J A;  2G4D B;  4FA6 A;  1KLV A;  4EEW A;  4WQO B;  2D3G A;  5FR6 A;  1D3Z A;  1EUV B;  1UH6 A;  2XK5 B;  5JHB A;  2ZVO A;  1OEY A;  3PSE B;  4TV3 A;  4HVB A;  3ENE A;  1WX8 A;  1ZW7 A;  1WZ0 A;  1H4R A;  2IY1 B;  5D94 A;  2G4S A;  2AL6 A;  3A9J B;  3PGE A;  5J18 A;  4HCP B;  4E74 A;  2WX0 A;  2ZJD A;  2IYD B;  3SHQ A;  2DAJ A;  4EZK A;  2MA9 B;  3QK0 A;  1J8C A;  2KX3 A;  2JRH A;  4MGI E;  2AEH A;  2M0X A;  5G55 A;  4NPN A;  2ZEQ A;  3B0A A;  3IVF A;  4WWO A;  1WGR A;  4M0W B;  4PYU A;  4URK A;  1ZKH A;  2BPS A;  3M95 A;  2LVO A;  2L3Z A;  2Z59 B;  3AI5 A;  2PE9 A;  3GOE A;  2L05 A;  3ZIM A;  1WRD B;  4X57 B;  4HK2 A;  1WXA A;  2KVR A;  3RYT A;  3PVL A;  3KUC B;  3ZW3 A;  4FAD A;  3QHT A;  3VXW A;  4AJW A;  3ZNG C;  3R66 C;  4E71 A;  2K8H A;  2PJH A;  1CMX B;  2HJ8 A;  4GDL A;  2M8S A;  4CHK A;  1C3T A;  4MSQ B;  4XC2 A;  4KV2 A;  1WIA A;  4RMA A;  3WAM A;  1NDD A;  4XZ4 A;  2O6V A;  4WJP A;  3QIJ A;  3QWZ B;  2ZPN A;  3DVN V;  4MEM A;  2MQJ A;  2C7H A;  2NR2 A;  3WAL A;  2KKC A;  1KJT A;  2N1V A;  1YD8 U;  1XT9 B;  3V60 A;  1E8Y A;  4FJY A;  5E6N A;  3T9L A;  4A3O A;  4WWP A;  1GNU A;  4WJQ A;  2KTR B;  5G2N A;  4DDG D;  4TUU A;  4NAW A;  4NNJ B;  4W9H A;  2D11 A;  2LGD A;  2IZV B;  4GGQ A;  2CHX A;  3UF8 A;  1A5R A;  2KWU B;  3DDC B;  3L08 A;  3JSV A;  1XD3 B;  2JVC A;  2OJR A;  2FCM A;  1UEL A;  4BKT A;  1SIF A;  2D10 A;  1IYF A;  4XX5 A;  2RGF A;  4B9K A;  1LFD A;  2L8J A;  5GMV A;  4K7W A;  3ZUN A;  4FHJ A;  3MHS D;  4B6W A;  4OVV A;  1BT0 A;  1YX6 B;  4MJS A;  3RUL A;  3N30 A;  1V5O A;  5CTR C;  2RR9 A;  1RAX A;  3PRE A;  4WAA A;  3TJP A;  2KC2 A;  4BBN F;  1WYW B;  2KFK A;  3PHW B;  3ONS A;  4HJK A;  2J0M A;  4IM3 A;  3DPD A;  4IM0 A;  3U7D A;  3ZNZ B;  2A5U A;  5LXI B;  3KUD B;  2VRR B;  2CU1 A;  2V4L A;  1RRB A;  1U4A A;  2K6Q A;  2JWZ A;  4FUL A;  1WFY A;  4HPL B;  1OEY J;  4IWO A;  4BKS A;  1E8Z A;  3ZDM C;  2K8B A;  2D07 B;  3L54 A;  2JXX A;  2K6D B;  2IY0 B;  1WXS A;  2J0K A;  3NY5 A;  4IWP A;  2LI5 A;  2KJR A;  4HCN B;  1WM2 A;  4W9K A;  2KD0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...