4W9CA

Pvhl:elob:eloc in complex with (2s,4r)-1-(3,3-dimethylbutanoyl)-4-hydroxy-n-(4-(oxazol-5-yl)benzyl)pyrrolidine-2-carboxamide (ligand 2)
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
103
structure length
101
Chain Sequence
MDVFLMIRRHKTTIFTDAKESSTVFELKRIVEGILKRPPDEQRLYKDDQLLDDGKTLGEGFTSQTARPQAPATVGLAFRADDTFEALIEPFSSPPELPDVM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ligase
molecule keywords Transcription elongation factor B polypeptide 2
publication title Structure-Guided Design and Optimization of Small Molecules Targeting the Protein-Protein Interaction between the von Hippel-Lindau (VHL) E3 Ubiquitin Ligase and the Hypoxia Inducible Factor (HIF) Alpha Subunit with in Vitro Nanomolar Affinities.
pubmed doi rcsb
source organism Homo sapiens
total genus 25
structure length 101
sequence length 103
chains with identical sequence D, G, J
ec nomenclature
pdb deposition date 2014-08-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00240 ubiquitin Ubiquitin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 4w9cA00
4HJKA 2XBBC 4MJSA 5GMVA 3V61A 2L0TA 2MW5A 4GDLA 5BO4B 3WIMA 1L2NA 4RMAA 1WR6E 2A5UA 2HTHA 4KIKA 2BF8B 2EKEC 4G50A 4NJ7A 4ANWA 3SU8X 4FA6A 3RZWC 3T8MA 2KX3A 2NPTA 1Z5SB 3PS6A 1UZXB 2L05A 4MGZE 4PS7A 3QWZB 4G3XB 1WRDB 2ZPYA 2FCSA 4RM8A 3AU4A 3H7SA 1XQQA 2MA9B 3VUYA 2G4DB 5CHFA 3ECIA 3KW5B 3Q3FA 5C1ZA 3ZO5B 4W9HA 2JWZA 2IO2B 5L95C 4LJPB 5JH5C 1OGWA 4MELA 2GBNA 1P0RA 3SDLC 5LXIB 3NS8A 2L0FA 5G55A 2O6VD 3OLMD 3QIJA 2KWUB 3U7DA 1KLVA 2IZVB 1H4RA 3KUZA 3MJWA 4ZRKA 3V6CB 4NAWA 4NJ6A 4BKSA 4M8NA 5D2MB 3V60A 3QARA 1WGHA 4M8MA 3PREA 5JZEB 1NDDA 2MP2A 2K6DB 5E6OA 2REXA 4HLEA 2JRHA 2JUOA 3VTVA 4JQWC 3C0RB 3QC8B 3R66C 2KX0A 2AL3A 5J17A 1Q0WB 4GB9A 4HK2A 2MSED 2G3QB 3DQVA 3KVFB 3NZUA 3PV1A 3BINA 4MJSB 3TBLD 3GOEA 1I42A 2M4NA 4GDLB 1OTRB 2KO3A 4ZDVA 5D6JB 3VHTC 4DHJB 2FNJB 2N7EA 2KLCA 2JRIB 4I6PA 2LGXA 4KIKB 1Z2MA 2MLBA 4GXBA 3N30A 4IW0A 4TKNA 3UQAA 1E8YA 1P1AA 4WJNA 2KXJA 2NPTB 2KANA 3PLUA 3NY5A 4LJOB 3IFWB 1IYFA 4K81A 3ONSA 1WI0A 2DX5B 2PEAA 4CHKA 4KSLC 2FUHB 1WMHB 3U30A 1T0YA 5D7GA 2MBOA 4TV3A 5JHBA 3DVNU 4TUUA 1NI2A 2ASQA 4JGHB 2LUEA 4F7ZA 3GZNI 1EUVB 3M95A 2JXXA 2R2OA 4W9GA 1UBQA 1EO6A 2BKFA 3ZW3A 4II3B 3RULA 2GBKA 3VQIA 1WXAA 2CR5A 3HHMA 3IVFA 4ANVA 2LGYA 4HXDA 2DAJA 2JY6A 5LXHA 2MWSB 3PHWB 4GOCA 1CMXB 2O2VA 2WDTB 3NOBA 4WAAA 3ZTCA 4AP4C 1AARA 2ZNVB 2Z0DB 2GBMA 1WXMA 3WALA 2KJRA 4NQKE 4P7IA 2AWTA 4A20A 3EHVA 4ANXA 1WH3A 3H6NA 2NBUA 3CF6E 4HWIB 2ZPNA 4PYZA 4XX5A 1WX9A 3DPDA 4HPLB 2DYOA 2AYOB 3VVWB 2LASA 2AEHA 3APFA 1A5RA 2KN5A 5C23A 1GC7A 2LVOA 5CHWA 2AL6A 3RYTA 4GU2A 1SIFA 2KJ6A 4GN1A 3L54A 3H9DA 2N4FA 2Y5BB 4W9LA 1EF1A 5E6PA 2KFJA 3DBSA 5EDSA 4IWQA 2C60A 3PRMB 4AOFA 4EZJA 4HVBA 3EECA 3KUCB 1YX6B 2J0KA 2HJ8A 2L76A 4BOSC 4KZ0A 2DYBA 3OJ3A 2KDFB 2RGFA 1WYWB 1Y8RC 2DENB 3CSTA 1V49A 3PT2B 3TL5A 4EKUA 3HIZA 1TBEA 1RFAA 2BYFA 1YQBA 2O2VB 3A4SC 4FJVB 3PPAA 3A9JB 3TJPA 4TQ0A 4HCNB 1WR1A 1YD8U 2ZVNA 3I3TB 4W9DA 4DDGD 2JZ3B 2ZJDA 1ZGUB 4ICUA 4E3CA 3L16A 2MBHA 3R3MA 2JT4B 4HCPB 4W9FA 2WYQA 3RCZA 3RUIB 3ZVVA 4BBNF 3DVGX 1WMHA 1WJ4A 4YL8A 1F9JA 3PGEA 3UIOB 2C5LC 3JSVB 5AZHA 1WGRA 3CMMB 4LDTB 4W9CA 1R4NI 1OEYA 3AI5A 4JL9A 2N9PC 2FAZA 3NZSA 4F1SA 1C1YB 4MM3A 4KZCA 2BYVE 1V9JA 1X1MA 4BBNC 2K25A 3HM6X 3ZRFA 2D11A 2UWQA 3HK0A 2DZIA 2DZMA 2K1FA 2DYMA 2FIDA 2LRWA 2UYZB 2KC1A 4KV2A 2WWZA 3W1SC 2KLGA 2J7QB 4HPMB 3VXWA 1PQSA 2RPQA 3R7QA 3ZDTA 4IM0A 1Q5WB 3ZTDA 2Z59B 4NPNA 1LFDA 3A1QB 4FN2A 4B9KA 5DPSA 1EF5A 3PLVA 3PRZA 4FADA 2CHXA 1H8CA 2B3AA 4FJYA 1RAXA 1GUAB 2LI5A 1WZ3A 2C7HA 2IO3B 3BY4B 3CSFA 2YLMA 3AXCA 5E6NA 4KDLB 4CO7A 5D94A 3ZRCA 1RLFA 3EC8A 2KHWB 2DAFA 3V62A 1J0GA 1WJUA 3K9PB 2K6QA 3QA8A 5HKHA 3UIPB 2CHWA 2WX0A 2KQSA 2BWFA 1WXVA 5FR6A 1GG3A 1M94A 2C7MB 4EOYA 4WJOA 1WX7A 2KVRA 3QX1A 4X57B 4BVUC 3L13A 2M1MA 4FHKA 4GGQA 2MRPA 5J2RA 2IBIB 2JVCA 1G6JA 2GMIC 3LDZE 3VAWA 1LQBA 4MSMB 3JVZX 1KOTA 1YJ1A 1V5OA 1V86A 2KTFA 3DVNV 3D32A 4NNJB 2MBQA 3DBHI 4A3OA 2L7RA 1R4MI 2KMAA 2O6VA 2V1YA 4G11A 4BOZB 3Q3JA 2KQ7A 3TCAA 3DVGY 2L3ZA 2LGDA 3L10B 3DBLI 3A9JA 3QCAA 2RR9A 2N9EB 3MHSD 3WA0A 3ZLZA 5KHOA 3QJZA 3O65B 4FJZA 1S3SG 2N9XA 5G2NA 4DK5A 5DPTA 3NHEB 4FLHA 1UD7A 3SHQA 4XZ4A 3ZNID 3M62B 4WWOA 4XC2A 2MQJA 3ZIMA 2LRUA 2MCNB 3JSVA 3UF8A 2V4LA 4DHJD 3VUXA 4PS8A 4DHZE 3M3JA 2KNBA 2A4ZA 3KYCD 1E5WA 2Z0EB 1U4AA 1ZKHA 2KDBA 3PSEB 3ZDMC 4DDID 5DPWA 4MGYE 1WXSA 2KK8A 2N7DA 3VTUA 3VUWA 3KYDD 2G4SA 5CHVC 1WX8A 1IPGA 2G45B 2KDIA 2KKCA 1V80A 2BWES 4KSKC 1WM2A 2EMTA 2RSUA 3UGBB 3K9OB 2IY1B 4GIVA 5JHAA 4KVGB 1VCBA 2GBJA 2NVUI 2QHOA 2ZZPB 3A4RA 4E71A 2IY0B 4W9EA 3X23A 5LLIA 5DCNA 2R2QA 1YIWA 2D2QA 2LZ6A 3L08A 3JW0X 2ZCBA 2CKHB 2OOBB 3A1QA 2O6VB 3L0WB 4EFOA 3WAOA 4NY0A 2L8JA 3T9LA 4DXAB 3VFKA 2J0JA 4BKSD 2FIFA 1E8ZA 3TMPB 2KTRA 3AU5A 1YX5B 4GDKA 1TGZB 2CS4A 3HM3A 2K8HA 1WGYA 2RD0A 2GOWA 1LM8B 4NQLB 4F8CB 1E7VA 4AWJA 1MG8A 1OEYJ 2M17A 2BPSA 2KWVB 4B6WA 4OVVA 1KM7A 1UGMA 1BT0A 2K8BA 3PRPB 4GSWA 2LJ5A 1UH6A 4BKTA 1KJTA 1GJZA 1UBIA 2IO1B 2KDEB 4JLCA 1WIAA 2LD9A 3H7PA 4IWPA 3UINB 4BFRA 2M0XA 3H1UA 2KJHB 2LVQA 3IHPC 2C7NB 4WWNA 2HE7A 2PE6B 2VRRB 4KDIC 2LXAA 3ZNZB 1FXTB 4J6IA 4ANUA 4FBJB 4II2B 1UELA 4URKA 5KHQA 1OQYA 1V81A 1I35A 3EFUA 4TQ1A 4MGIE 1SE9A 4N9F4 2I1KA 1WGGA 3U8ZA 5IAAC 4G0NB 3DDCB 1P9DU 2D07B 5AZGA 3WANA 1ZW7A 3W1YA 4WJQA 2ZEQA 3S2AA 2PPHA 4K7SA 3TIXA 1GC6A 1S1QB 4EEWA 3ML8A 4PS3A 4OVUA 2MBEA 2LVPA 2KTRB 2OJRA 4W9JA 3A33B 3L17A 2K39A 4GDKB 2NS5A 2KZRA 2XK5B 4B95A 4BKGA 3ZNGC 3QAQA 4HDOA 3KUDB 2GBRA 2FCQA 2LXCA 4EZLA 5AEKB 1C3TA 1P98A 4FHJA 1WY8A 4DHZB 3PZDA 3PTFC 1WFYA 3A9KB 3VDZA 2KFKA 2CU1A 3V6EB 2NCNA 1ISNA 2XEWA 3DOWA 2D10A 1XT9B 3MTNB 1LXDA 4ICVA 1NBFC 2PJHA 3H7PB 3LJ3A 4W9IA 2JZZA 3RD2A 4IC7B 3AULA 1WZ0A 2MX2A 3OAWA 1WGDA 2LWPA 3N3KB 4LDTD 2NR2A 2IO0B 2N1WA 2M8SA 3ZUNA 4GMVA 1E7UA 1WM3A 2YVCA 1WJNA 2FCMA 1WF9A 5AZFA 4CYEA 2DZJA 5J18A 4MSQB 3B08A 4ZRJA 2N1VA 1SGHA 3DCGA 3ZKJC 4IWOA 3VTWA 4FULA 3QHTA 4AJWA 1D3ZA 1V5TA 2HD5B 3ALBA 1Q1OA 4I6LB 3N32A 1V6EA 1TTNA 3M63B 2KOXA 1VD2A 3B0AA 2PE9A 1TZ1A 3RZFA 1WJ6A 3JYUA 3ZNHB 3X0WA 4WWPA 1QZEA 1GNUA 1P3QU 2BGFA 4NAWB 4W9KA 5TR5A 2DZKA 2KMCA 3APCA 3IBEA 3QQ8B 2J0MA 4K1RB 3UQBA 1WE7A 1IP9A 2MP2B 3OJ4B 2C9WB 2WX1A 3APDA 4EZKA 2IYDB 3P2BA 3RT3B 2NBVB 4DWFA 3ENEA 3W1SA 2MBBB 2KFKB 3VH3B 5CX3A 2FCNA 2JF5A 3R7RA 5IA7A 2V3SA 2ZVOA 1E90A 3VH4B 4ZYNA 2CHZA 2ZNVC 3WAPA 4AUQC 1J19A 1E8WA 4IM3A 2I1JA 4ZRIA 4IUMB 2L00B 4K7UA 2W9NA 2KWCA 2D3GA 4A3PA 1K8RB 3WAMA 4PYUA 1RRBA 4ASWC 3PHXB 3QK0A 5L83A 4LCDE 4I6NB 4M0WB 2ZCCA 3IG3A 2DHZA 1XD3B 2KD0A 3SD5A 2BYEA 2BKRB 4IM2A 4K7WA 1L7YA 1V2YA 2XK5A 3ML9A 4IG7B 4MH0E 4MGKE 4AJYB 4MEMA 4HDQA 4DBGA 4JIOU 2NBWB 4WJPA 4MDKE 1HE8A 2K8CA 1WE6A 2EMSA 4EUTA 1J8CA 4E74A 4WQOB 3KH0A 1E8XA 3DBRI 2KC2A 2JPHA 4RM9A 1JRUA 3A9KA 3PVLA 3B1LX 5DPRA 5CTRC
chains in the Genus database with same CATH superfamily
2D3CA 3WIMA 2ICIA 2LUMA 2A5UA 2HTHA 2EKEC 3PS6A 4MGZE 3T3OA 4G3XB 4XE0A 2Y3AA 4YTPB 1TIFA 2V9HA 3IAS1 3NVZA 3GB1A 3NVWA 1B1ZA 4IDIA 5C1ZA 5GXGB 4RGNA 3ZO5B 4W9HA 2JWZA 4LJPB 5JH5C 4MELA 1P0RA 1HZ6A 4RGOS 4YSYB 2KWUB 3U7DA 4YWGG 1F2RC 1FNUA 1H4RA 2IZVB 4NJ6A 4M8NA 2WXIA 3N9YC 4KGTA 2YEPF 5JZEB 3VTVA 4JQWC 1C76A 5G5GA 3QC8B 5J17A 1SB3C 1GPXA 3I57A 4N59A 4ZDVA 4DHJB 1RM6C 2N7EA 2KLCA 4KIKB 4TKNA 1Z2MA 5AUKA 1N60A 1HZ5A 1P1AA 2KXJA 2NPTB 4CHKA 4KSLC 1WMHB 4WH4A 3DVNU 4YSZB 1NI2A 4B0EA 1YN4A 4JGHB 4F7ZA 3M95A 2R2OA 1UBQA 4II3B 1V1PB 3VQIA 3HHMA 2LGYA 2DAJA 4HKZE 2WDTB 3PZ7A 3B9JA 3ZTCA 4AP4C 1YMHE 2JX5A 3BVGA 2ZNVB 2Z0DB 1KH0A 3H6NA 3CF6E 2ZPNA 4HRSA 5EE3A 4P6VF 3VVWB 1OFFA 2W3RA 1N5WA 2LVOA 1WGKA 2L83A 2LHEA 5BYRA 5IO9A 4ARCA 1EF1A 1JROA 5E6PA 1B9RA 3KWVA 2C60A 4AOFA 4HVBA 2HJ8A 2L76A 2WXNA 4LNFA 2DYBA 1YQ3B 4RNAA 3T3NA 3BZDB 1I4RA 3HIZA 1TBEA 2DNFA 3PPAA 4TQ0A 3WCQA 5HHDG 2M56B 4W9DA 2ZJDA 4ICUA 3PZ8A 2JT4B 1ZP0B 3RUIB 1RYJA 4LNKA 4A8XC 1WMHA 1SJHD 3UIOB 3V05A 3CMMB 3AI5A 2N9PC 3NZSA 1V9JA 1X1MA 2D11A 1V1PA 3W2DA 2UWQA 1YN3A 3Q3NC 1PGBA 1XF5L 2DYMA 2LRWA 3BIID 1XLQA 4HPMB 3VXWA 1PQSA 4A6QA 4IM0A 3ZTDA 4FN2A 1VR9A 2QMTA 4HROA 3PRZA 1BXTA 1RAXA 2V4IB 3BY4B 1F77A 4KDLB 2NTSA 4CO7A 4KKIA 3EC8A 1V8CA 1WJUA 3K9PB 2PMVA 3UIPB 2BWFA 1WXVA 1GG3A 4KX6B 2B76B 1WX7A 2M1MA 4FHKA 4GGQA 5J2RA 2JVCA 1L4DB 3VAWA 1KOTA 1V86A 3DVNV 3D32A 2JQRB 2KAJA 3DBHI 4A3OA 2L7RA 3TCAA 3L10B 3EFCA 2QDFA 3NHEB 3SHQA 2BS2B 2E3TA 3ZNID 2LRUA 2K0PA 3AEEB 5IKCM 3HUIA 4DHZE 5FKAC 2A4ZA 1E5WA 1KFYB 1U4AA 4DDID 2JU6X 4MGYE 1WXSA 1JWUD 2G4SA 1WX8A 1PUTA 2KDIA 1V80A 2BWES 4P1CC 3UGBB 5JHAA 1FM0D 2QHOA 2IY0B 2R2QA 2W3SA 2LZ6A 4EFOA 3MC9A 3TEYA 4NY0A 4DXAB 1CJEA 3RNEC 2KTRA 2WXLA 4MT5A 2K8HA 2N9LA 2H89B 1L4ZB 1MG8A 2M17A 2KWVB 4B6WA 5IP4D 2K8BA 1UGMA 1L0YB 1EWCA 2KDEB 4JLCA 1WIAA 4IWPA 3H7PA 4CQNA 2M0XA 1DYQA 2KJHB 5EE1A 3IHPC 3NVYA 2WXKA 3P42A 1HTOA 4J6IA 3NG0A 1MJDA 2RDBC 2QC8A 4C4VA 4RGTA 3EFUA 3V3XA 2RMMA 1WGGA 2HDEA 2WQYB 2PPHA 1TKEA 2MBEA 2LVPA 2V0GA 3L17A 2PKOA 1VZ6A 3QAQA 1SF0A 2L52A 4EZLA 5AEKB 1FCLA 3A9KB 3R2IA 1LXDA 3LJ3A 1L5PA 2LEKA 1KRHA 1WXQA 2PW9A 1WGDA 4LDTD 3N3KB 1FMAD 2IO0B 2M8SA 1WM3A 1I4PA 4ZYSA 3U7ZA 1SE2A 2OEDA 3URYA 3DCGA 2INCC 3QHTA 1M4VA 2WDVB 1V5TA 4I6LB 2IGDA 1TTNA 3M63B 1C9FA 3ZNHB 4YSXB 4WWPA 2W54A 1QZEA 1GNUA 2DZKA 2KMCA 3APCA 3I5JC 1K51A 2MP2B 4ACFA 2WXOA 3DBRB 3RNCC 3APDA 4OHJA 2NBVB 2WXGA 1PYWD 3ENEA 2LGSA 3W1SA 2KFKB 1N63A 3R7RA 4TMAB 3VH4B 4L23A 2ZNVC 4ZRIA 3BK1A 3WAMA 1SJED 3QK0A 1K50A 3AEBB 1V2YA 3ML9A 1ZE3D 4HDQA 2K8CA 2EMSA 4P16A 3AEFB 4E74A 4WQOB 3KH0A 1UF0A 3A9KA 3B1LX 4MJSA 2MW5A 4NJ7A 1TY0A 4FA6A 3W5UB 1HXYD 3EGRA 3RZWC 1DGJA 2BVCA 3T8MA 2KX3A 2WDRB 4NAMA 1WRDB 5EE9A 3AU4A 3H7SA 2NTTA 2MA9B 4LNOA 3ECIA 3Q3FA 1L0VB 2IO2B 5L95C 4HKQA 4WIPA 2L0FA 3GZNB 3DWMA 1KLVA 4N58A 5D2MB 1QF6A 3PREA 1ET9A 2MP2A 4HLEA 2REXA 3SFEB 4HK2A 3NZUA 3PV1A 3RNFC 3BINA 1JCKB 3C8YA 3NRZA 1VZ7A 3VHTC 2FNJB 2VH2A 2WXQA 1FEHA 4GXBA 4IW0A 2WDQB 4WJNA 2KANA 3NY5A 4LJOB 2KYWA 2K5PA 1VRAB 2PEAA 4Q2JA 3W9CB 3N1XC 4XGAB 1MHHE 1SSNA 1EUVB 3O13A 3ZW3A 3RULA 3UI3A 1DOXA 4HXDA 2QILA 1L0XB 1GOZA 1NYQA 5LXHA 1CMXB 2O2VA 1QOGA 2LGIA 2MJDA 1AARA 1OQQA 3MC0B 3U52E 2GBMA 3WALA 4P7IA 3FAHA 2WXJA 3VR9B 4HWIB 4XX5A 1MHXA 1WX9A 3DPDA 1LGRA 2DYOA 1FFVA 4YT0B 1A5RA 3TEZA 1GC7A 5CHWA 3DHHC 2AL6A 2KJ6A 3ZXRA 3L54A 3KWLA 2Y5BB 1ROEA 2IGGA 2KFJA 2IJ0A 5IN7A 1SXTA 1C77A 1AYFA 4KZ0A 1FXIA 2K3UA 2KDFB 3RFZB 1V49A 3PT2B 3TL5A 3Q3OC 1T6BX 1FIQA 1JWSD 4FJVB 4GLSC 4J3OD 2D3AA 1WR1A 1Q10A 1YD8U 2ZVNA 3I3TB 4DDGD 3L16A 2JYTA 4HCPB 2WYQA 4NZLB 3RMKC 3N20C 4YL8A 2I38A 2C5LC 4LDTB 2RPVA 1R4NI 4YTNB 4HPPA 2PVOD 4F1SA 4MM3A 4BBNC 1C4PA 2K25A 3EA6A 4KGSA 3HK0A 2K1FA 2FIDA 2WWZA 3W1SC 1F1HA 1C78A 1LFDA 1YQ4B 2D5GA 1TY2A 1FPYA 2LI5A 1WZ3A 2IO3B 3CSFA 2YLMA 1RWSA 2KHWB 2DAFA 2AQ2B 3RNGC 3QA8A 2W55A 1F2RI 5FR6A 4EOYA 1M94A 4WJOA 2WP9B 4X57B 4BVUC 2ZW1A 1G6JA 2IBIB 4WQMA 1JW9D 2MJ3A 2KTFA 4ZOHC 2AQ3B 2MBQA 4RH6A 1R4MI 1PFDA 3DBLI 2KN4A 2RR9A 3MHSD 1DOYA 3ZLZA 1KLUD 2INDC 4M01A 5KHOA 1D5MC 1S3SG 2J52A 2N9XA 5DPTA 4XZ4A 4WWOA 4XC2A 2MQJA 2MCNB 2V4LA 3VUXA 1NENB 3TSSA 2KNBA 2QCZA 4AS1A 1J7CA 2N7DA 3Q8AA 3KYDD 1D4BA 2KKCA 1JRPA 1TYGB 1WRIA 2EMTA 3AMZA 2RSUA 1P7FA 2IY1B 2I2YA 2NVUI 4E71A 1IGDA 3X23A 3L08A 3JW0X 2FUG1 1Y56A 2L8JA 2J0JA 1TGZB 1WGYA 1JMLA 2GOWA 2FBWB 4XDDA 4NQLB 1HA5A 4AWJA 4XWTA 3PRPB 2KDMA 4GSWA 1VJKA 1UH6A 4BKTA 1JWMD 2V3NA 2LD9A 3UINB 2LVQA 4HEA1 2HE7A 2PE6B 2VRRB 4KDIC 4IOIE 4ANUA 4URKA 3ZGZA 1V81A 1K52A 1SIJA 2QEJC 4MGIE 2RDHA 2OJWA 4ZRQA 2WS3B 1XCQL 3U8ZA 5AZGA 1ZW7A 3W1YA 4WJQA 1QOFA 4XYCA 1FRRA 1AW7A 1GC6A 4EEWA 1V1OA 2BTEA 1GB4A 2WXRA 2KTRB 2OJRA 3A33B 2KMMA 2XK5B 3KUDB 4FHJA 5HG2A 1YJJA 3PZDA 1WWTA 3VDZA 3U2SC 1ISNA 2D10A 5T8IA 2PJHA 3H7PB 2G1EA 2JZZA 3E56A 1TS2A 1VZ8A 1WZ0A 1XLOA 2LWPA 2MX2A 1BUIC 3ZUNA 3MP9A 1E7UA 1ZDXA 3VR8B 1TKYA 2CJOA 1I7HA 1XLPA 4C4VB 4CYEA 4ZRJA 2OHFA 2N1VA 1SGHA 4IWOA 4FULA 4L2YA 2HD5B 4ARIA 3PO0A 3N32A 4C00A 3J9CA 1VD2A 2PE9A 1WJ6A 3N1YC 2BGFA 1I4XA 1LO5D 3IBEA 3QQ8B 1WE7A 2J42A 1ZUD2 3OJ4B 4EZKA 3RT3B 4NJCA 3TEXA 5CX3A 2FCNA 2JF5A 4OZAA 2EELA 3P4QB 4IM3A 1FFUA 5BMIA 2GRIA 2W9NA 3AE4B 3OG5A 2KWCA 1K8RB 4PYUA 1A70A 1E10A 5L83A 4M0WB 2ZCCA 4BZAA 2DHZA 2KD0A 1GAQB 4IM2A 2BQQA 5H8YE 2XK5A 4H2AA 4IG7B 5C2TB 4JIOU 2NBWB 4WJPA 1MI0A 1HE8A 2L32A 4C7YA 2MJEA 4PT5A 1UNSA 4RM9A 4HJKA 1ZDVA 4QAYA 3V61A 2L0TA 1L2NA 4GDLA 4RMAA 2BF8B 1ZPSA 4ANWA 4PS7A 2ZPYA 4RM8A 3SR6A 3Q8CA 5CHFA 2NMQA 1EWYC 3GP7A 1R7SA 2GBNA 3NS8A 5G55A 3OLMD 1HQRD 1VDVA 4ZRKA 3HVDA 3NJTA 1WSPA 1NDDA 5E6OA 3P4SB 2JRHA 4MH8A 3C0RB 3R66C 2AL3A 2DWQA 3BWUD 3KVFB 2G3QB 1XXGA 3AEGB 4MJSB 3TBLD 1I42A 2M4NA 1OTRB 5D6JB 4C56C 2JRIB 4I6PA 2LGXA 3N30A 2KVZA 1UGJA 3I63C 1IYFA 1I4GA 2WGSA 1K53A 2FUHB 3MJ5A 4M0WA 1T0YA 5D7GA 5JHBA 2ASQA 2LUEA 2JXXA 4W9GA 2BKFA 1V97A 4ANVA 2Y5CA 1FNWA 4RF1A 3BVZA 1XCTL 3NOBA 4XDCA 1N62A 4DXFA 4UDUC 2KJRA 3SFDB 2AX5A 4A20A 3EHVA 4ANXA 3CWIA 3U4EG 2KT7A 2NBUA 4HPLB 1L6UA 4PK1A 3AE1B 2KN5A 4M00A 3RYTA 5BMHA 4GN1A 2X8XX 2N4FA 2WXHA 3FILA 3DBSA 5EDSA 4IWQA 4EZJA 4R3DA 3EECA 3KUCB 1YX6B 2J0KA 1XEEA 4BOSC 3OJ3A 2RGFA 4LK0M 1WYWB 1Y8RC 1D5ZC 4EKUA 2LHDA 1TZOA 1T0RC 1RFAA 2BYFA 1YQBA 2O2VB 3A4SC 3AECB 1N6ZA 3A9JB 3Q6BA 4HCNB 1ZGUB 2E6XA 1GB1A 3ZVVA 2JZPA 4YTMB 1NEKB 3PGEA 3Q8FA 3JSVB 5AZHA 1WGRA 3AEAB 3I9V1 4JL9A 3HM6X 3H8HA 2DZIA 1N5XA 2UYZB 4KV2A 2JYEA 1CZPA 4KKJA 3ZYYX 3DBHB 5D3IB 3R7QA 2LJIA 3A1QB 3AM9A 2KACA 4IKGA 4B9KA 5DPSA 1JQ4A 2PVGC 4FADA 2CHXA 4FJYA 4S17A 3NVVA 1GUAB 3ZQ4A 1T0SC 5D94A 1ACCA 3AEDB 1XLNA 3ZRCA 1RLFA 1J0GA 2K6QA 1TJEA 5HKHA 4S0RA 2KQSA 2KVRA 4DXGA 4P1BC 5HFYA 3LDZE 4MM3B 3JVZX 5D3DA 5G5HA 3AE7B 3IXSA 3AV8A 2IGHA 4NNJB 3IT6B 2O6VA 2KMAA 4BOZB 2V1YA 2WU2B 3Q3JA 2IDYA 3A9JA 4LLGM 2N9EB 2R61A 3O65B 2DBYA 4FLHA 1E9MA 3LXFA 3AB5A 4US8A 3M62B 4YXDB 2PTLA 3JSVA 4PS8A 1QOBA 3M3JA 2HJ1A 1ZKHA 1WYGA 3PSEB 2KK8A 3VUWA 2AQ1B 5CHVC 1T5XD 2KQ4X 2G45B 4RGMA 4KSKC 1WM2A 2Q5WD 4HJGE 3K9OB 4GIVA 4KVGB 1VCBA 2ZZPB 3A4RA 4W9EA 1NI3A 5DCNA 2ZCBA 4A90A 2CKHB 2OOBB 2RDGA 3A1QA 3L0WB 5IOIA 1UWMA 4N6EB 2BS3B 1VLBA 3RNAC 3VFKA 3AE2B 2FIFA 3Q69A 3TMPB 1YX5B 4GDKA 3HM3A 1E0ZA 2RD0A 4EE2A 2LMCA 1E7VA 4F8CB 3DHGC 1OEYJ 1YJIA 2BPSA 4OVVA 1GJZA 1UBIA 2Z8LA 3H1UA 3LYYA 1MG4A 1KLGD 3AE8B 2LXAA 3ZNZB 1FXTB 1T0QC 4II2B 1UELA 4ITKA 1OQRA 1SBBB 4JWUC 2YEPB 3SEBA 2I1KA 5IAAC 1FO4A 3MFGA 1P9DU 2D07B 4TSSA 2N0SB 3WANA 3S2AA 1EU4A 3DWGC 4ZHOA 4PS3A 4C80A 2WU5B 2K39A 2KZRA 4B95A 3ZNGC 2JWUA 4HDOA 2GBRA 4MACA 2LXCA 2K22A 1C3TA 1P98A 1WY8A 2V3PA 1WFYA 4LNNA 2CU1A 3V6EB 5I4DA 1N61A 1XT9B 4ICVA 1NBFC 4W9IA 1C4CA 3E9SA 1ZXHA 4IC7B 4BAXA 1FRDA 2NR2A 2N1WA 3EUB2 2YVCA 1WJNA 2FCMA 1WF9A 2DZJA 2TSSA 1HEZE 2WXPA 3MC8A 1IBXB 1D3ZA 3ALBA 1NVID 3HRDD 2KOXA 3B0AA 4JE3B 3RZFA 3X0WA 1P3QU 4NAWB 1MPEA 5TR5A 2IPKD 4K1RB 2J0MA 3RNBC 1D6EC 3ZJUA 3IT4B 1FCCC 2ONQA 2C9WB 4B0MA 3P2BA 2JSVX 2SAKA 1UUPA 1YOVB 3VH3B 2V3SA 2ZVOA 2K9XA 1KF6B 1F0ZA 4ZYNA 3Q8EA 3VRBB 4JWSC 4AUQC 1E8WA 4DQOC 2I1JA 4K7UA 2L00B 4A3PA 5AUIA 3Q14C 3RPFC 1RRBA 3R2TA 2KWDA 3Q3MC 4FXCA 2H88B 3SD5A 1L7YA 3MHZA 4AJYB 5EE0A 5FK9C 4MDKE 1WE6A 4EUTA 1E8XA 3DBRI 2KC2A 3PVLA 5DPRA 5CTRC 2XBBC 4M02A 4LTUA 5GMVA 1QLBB 5BO4B 2PLPA 1WR6E 4KIKA 4G50A 2N9KA 3GE3C 4RF0A 3SU8X 2NPTA 1Z5SB 1UZXB 2L05A 3RI7C 3QWZB 2MHJA 2FCSA 2VZKD 1XQQA 3VUYA 2G4DB 1IBXA 3KW5B 2WNMA 2CJNA 1OGWA 1RFKA 3SDLC 5LXIB 2O6VD 1NYRA 2ACZB 2QSDA 3QIJA 3AN1A 3B2GA 3KUZA 3MJWA 3V6CB 4NAWA 4BKSA 3V60A 3QARA 1WGHA 4M8MA 2K6DB 2JUOA 1P7EA 1SEBD 2KX0A 1Q0WB 1JALA 4GB9A 2MSED 3DQVA 1KTKA 4USAA 1C4AA 2WLBA 3GOEA 4GDLB 3W5VB 2KO3A 1EU3A 2JXTA 1MFWA 1MVKA 2MLBA 2GB1A 3UQAA 4A55A 1ET6A 1E8YA 2LFIA 3PLUA 3IFWB 1TKGA 3ONSA 4K81A 1WI0A 2DX5B 3P4PB 3U30A 2MBOA 4TV3A 4TUUA 1AN8A 1T3QA 2XNAC 3GZNI 2X38A 1QT9A 1EO6A 2GBKA 1WXAA 2CR5A 3IVFA 2JY6A 2MWSB 3PHWB 4GOCA 5C3JB 1D5XC 3P4RB 3AE6B 3Q2AC 4WAAA 5E6JA 1ESFA 1WXMA 4NQKE 2AWTA 1WH3A 1ZOYB 4PYZA 1TS3A 2AYOB 2LASA 5TSSA 2AEHA 3APFA 5BYSA 5FR3A 5C23A 1J7AA 4GU2A 1AWDA 1SIFA 3Q8BA 3AE3B 3H9DA 4W9LA 1R4NB 3PRMB 1L6VA 1QKZA 1QILA 2BYTA 4OZCA 1E6EB 2BS4B 3CIRB 3ZJVA 3TEWA 1BMLC 4OZBA 4O1NA 2DENB 2SEBD 3CSTA 1ZXIA 5MPOA 3TJPA 2GLSA 1PGXA 2JZ3B 4E3CA 3BYYB 2MBHA 2BT6A 3R3MA 2EKIA 4W9FA 3RCZA 3AE5B 4BBNF 2WXFA 3DVGX 1WJ4A 1JWBD 1F9JA 4W9CA 3KLSX 1STEA 1OEYA 2VH1A 2FAZA 1C1YB 4KZCA 1HTQA 2BYVE 3FILB 3ZRFA 3BVMA 1XO3A 1E7PB 3ZXVA 3KQ4A 4RFBA 2DZMA 4A9AA 1IUEA 2KC1A 2KLGA 1FD6A 2BB6A 2J7QB 2RPQA 5JXVA 3ZDTA 1R4MB 1Q5WB 2Z59B 1UWXA 3IAM1 4NPNA 2QIEB 3DBLB 1EF5A 1SE3A 3PLVA 1H8CA 2B3AA 2C7HA 5E6NA 3AXCA 5H92C 3R8BA 2BB5A 3V62A 3N1ZC 2GI9A 2CHWA 2WX0A 3GS2A 2C7MB 3QX1A 2G9HD 3L13A 2MRPA 1FNVA 2J53A 2GMIC 3RN9C 1LQBA 4MSMB 1YJ1A 4KGRA 1V5OA 4REZA 3L4PA 5BYQA 4D2KA 4AQ7A 4G11A 1F52A 2KQ7A 1CQVA 3DVGY 2L3ZA 2LGDA 1ENFA 2PIAA 3QCAA 2MH7A 2MEKA 5LNK1 3WA0A 4WURA 3QJZA 4FJZA 5G2NA 4DK5A 2WXMA 1UD7A 2UU7A 4K3BA 1PDXA 3ZIMA 3UF8A 4DHJD 3NZ3A 3KYCD 3B2FA 2Z0EB 3ZDMC 2KDBA 5DPWA 3VTUA 3GE8C 1IPGA 3ABVB 1TS5A 2VZKB 2GBJA 1C79A 5LLIA 1YIWA 2D2QA 3ZJTA 3P63A 2O6VB 2BBCA 3WAOA 1IGCA 3T9LA 4XWWA 3NUHB 4L1BA 4JX1C 4BKSD 1E8ZA 4US9A 1JWAD 3AU5A 1TS4A 2INNE 2CS4A 1QOAA 2N7JA 1LM8B 2M19A 1KM7A 1BT0A 3BYTB 2LJ5A 1KJTA 2IO1B 2WHIA 4K3CA 2FE8A 4BFRA 2INPE 2HTME 2C7NB 4WWNA 3LB8C 4FBJB 5KHQA 1OQYA 1I35A 4TQ1A 1SE9A 4N9F4 4RCOA 4WWMA 1I4QA 4G0NB 3DDCB 2L1AA 4JPSA 2D3BA 2ZEQA 3TIXA 4K7SA 1S1QB 3ML8A 2DLBA 4OVUA 3BK2A 2QJLA 4W9JA 4GDKB 2NS5A 4BKGA 5HI1A 1J7BA 2FCQA 2J4XA 3AE9B 4DHZB 2XN9C 3PTFC 2KFKA 2NCNA 2XEWA 3DOWA 3MTNB 4C7ZA 1QQRA 2Y5PA 1FXAA 3FKYA 3RD2A 3AULA 3OAWA 4ZHPA 3OWEB 4GMVA 5J18A 5AZFA 3AH7A 4MSQB 3B08A 3VRAB 3ZKJC 3VTWA 4AJWA 3ETRA 1PGAA 1Q1OA 2ZW0A 1V6EA 2ON8A 3C19A 1TZ1A 3JYUA 2W82A 1TT5B 4W9KA 3UQBA 1IP9A 3NS1A 1YN5A 2WX1A 2IYDB 4DWFA 2MBBB 4LNIA 1EM7A 2M0AA 5IA7A 1E90A 1CK1A 3P1MA 2CHZA 3WAPA 1J19A 4WAFA 4IUMB 2D3GA 3TUOA 1SE4A 4ASWC 3PHXB 4ZRPA 3FC4A 4I6NB 4LCDE 1YNTE 3HVZA 3IG3A 5BMGA 1XD3B 1I4HA 2BYEA 2BKRB 3DHIC 4K7WA 4MGKE 4MH0E 4MEMA 4DBGA 2CU3A 2BW2A 1J8CA 1DOIA 4OVZA 2JPHA 1JRUA 4OW0A
chains in the Genus database with same CATH topology
4HJKA 2XBBC 4MJSA 5GMVA 3V61A 2L0TA 2MW5A 4GDLA 5BO4B 3WIMA 1L2NA 4RMAA 1WR6E 2A5UA 2HTHA 4KIKA 2BF8B 2EKEC 4G50A 4NJ7A 4ANWA 3SU8X 4FA6A 3RZWC 3T8MA 2KX3A 2NPTA 1Z5SB 3PS6A 1UZXB 2L05A 4MGZE 4PS7A 3QWZB 4G3XB 1WRDB 2ZPYA 2FCSA 4RM8A 3AU4A 3H7SA 1XQQA 2MA9B 3VUYA 2G4DB 5CHFA 3ECIA 3KW5B 3Q3FA 5C1ZA 3ZO5B 4W9HA 2JWZA 2IO2B 5L95C 4LJPB 5JH5C 1OGWA 4MELA 2GBNA 1P0RA 3SDLC 5LXIB 3NS8A 2L0FA 5G55A 2O6VD 3OLMD 3QIJA 2KWUB 3U7DA 1KLVA 2IZVB 1H4RA 3KUZA 3MJWA 4ZRKA 3V6CB 4NAWA 4NJ6A 4BKSA 4M8NA 5D2MB 3V60A 3QARA 1WGHA 4M8MA 3PREA 5JZEB 1NDDA 2MP2A 2K6DB 5E6OA 2REXA 4HLEA 2JRHA 2JUOA 3VTVA 4JQWC 3C0RB 3QC8B 3R66C 2KX0A 2AL3A 5J17A 1Q0WB 4GB9A 4HK2A 2MSED 2G3QB 3DQVA 3KVFB 3NZUA 3PV1A 3BINA 4MJSB 3TBLD 3GOEA 1I42A 2M4NA 4GDLB 1OTRB 2KO3A 4ZDVA 5D6JB 3VHTC 4DHJB 2FNJB 2N7EA 2KLCA 2JRIB 4I6PA 2LGXA 4KIKB 1Z2MA 2MLBA 4GXBA 3N30A 4IW0A 4TKNA 3UQAA 1E8YA 1P1AA 4WJNA 2KXJA 2NPTB 2KANA 3PLUA 3NY5A 4LJOB 3IFWB 1IYFA 4K81A 3ONSA 1WI0A 2DX5B 2PEAA 4CHKA 4KSLC 2FUHB 1WMHB 3U30A 1T0YA 5D7GA 2MBOA 4TV3A 5JHBA 3DVNU 4TUUA 1NI2A 2ASQA 4JGHB 2LUEA 4F7ZA 3GZNI 1EUVB 3M95A 2JXXA 2R2OA 4W9GA 1UBQA 1EO6A 2BKFA 3ZW3A 4II3B 3RULA 2GBKA 3VQIA 1WXAA 2CR5A 3HHMA 3IVFA 4ANVA 2LGYA 4HXDA 2DAJA 2JY6A 5LXHA 2MWSB 3PHWB 4GOCA 1CMXB 2O2VA 2WDTB 3NOBA 4WAAA 3ZTCA 4AP4C 1AARA 2ZNVB 2Z0DB 2GBMA 1WXMA 3WALA 2KJRA 4NQKE 4P7IA 2AWTA 4A20A 3EHVA 4ANXA 1WH3A 3H6NA 2NBUA 3CF6E 4HWIB 2ZPNA 4PYZA 4XX5A 1WX9A 3DPDA 4HPLB 2DYOA 2AYOB 3VVWB 2LASA 2AEHA 3APFA 1A5RA 2KN5A 5C23A 1GC7A 2LVOA 5CHWA 2AL6A 3RYTA 4GU2A 1SIFA 2KJ6A 4GN1A 3L54A 3H9DA 2N4FA 2Y5BB 4W9LA 1EF1A 5E6PA 2KFJA 3DBSA 5EDSA 4IWQA 2C60A 3PRMB 4AOFA 4EZJA 4HVBA 3EECA 3KUCB 1YX6B 2J0KA 2HJ8A 2L76A 4BOSC 4KZ0A 2DYBA 3OJ3A 2KDFB 2RGFA 1WYWB 1Y8RC 2DENB 3CSTA 1V49A 3PT2B 3TL5A 4EKUA 3HIZA 1TBEA 1RFAA 2BYFA 1YQBA 2O2VB 3A4SC 4FJVB 3PPAA 3A9JB 3TJPA 4TQ0A 4HCNB 1WR1A 1YD8U 2ZVNA 3I3TB 4W9DA 4DDGD 2JZ3B 2ZJDA 1ZGUB 4ICUA 4E3CA 3L16A 2MBHA 3R3MA 2JT4B 4HCPB 4W9FA 2WYQA 3RCZA 3RUIB 3ZVVA 4BBNF 3DVGX 1WMHA 1WJ4A 4YL8A 1F9JA 3PGEA 3UIOB 2C5LC 3JSVB 5AZHA 1WGRA 3CMMB 4LDTB 4W9CA 1R4NI 1OEYA 3AI5A 4JL9A 2N9PC 2FAZA 3NZSA 4F1SA 1C1YB 4MM3A 4KZCA 2BYVE 1V9JA 1X1MA 4BBNC 2K25A 3HM6X 3ZRFA 2D11A 2UWQA 3HK0A 2DZIA 2DZMA 2K1FA 2DYMA 2FIDA 2LRWA 2UYZB 2KC1A 4KV2A 2WWZA 3W1SC 2KLGA 2J7QB 4HPMB 3VXWA 1PQSA 2RPQA 3R7QA 3ZDTA 4IM0A 1Q5WB 3ZTDA 2Z59B 4NPNA 1LFDA 3A1QB 4FN2A 4B9KA 5DPSA 1EF5A 3PLVA 3PRZA 4FADA 2CHXA 1H8CA 2B3AA 4FJYA 1RAXA 1GUAB 2LI5A 1WZ3A 2C7HA 2IO3B 3BY4B 3CSFA 2YLMA 3AXCA 5E6NA 4KDLB 4CO7A 5D94A 3ZRCA 1RLFA 3EC8A 2KHWB 2DAFA 3V62A 1J0GA 1WJUA 3K9PB 2K6QA 3QA8A 5HKHA 3UIPB 2CHWA 2WX0A 2KQSA 2BWFA 1WXVA 5FR6A 1GG3A 1M94A 2C7MB 4EOYA 4WJOA 1WX7A 2KVRA 3QX1A 4X57B 4BVUC 3L13A 2M1MA 4FHKA 4GGQA 2MRPA 5J2RA 2IBIB 2JVCA 1G6JA 2GMIC 3LDZE 3VAWA 1LQBA 4MSMB 3JVZX 1KOTA 1YJ1A 1V5OA 1V86A 2KTFA 3DVNV 3D32A 4NNJB 2MBQA 3DBHI 4A3OA 2L7RA 1R4MI 2KMAA 2O6VA 2V1YA 4G11A 4BOZB 3Q3JA 2KQ7A 3TCAA 3DVGY 2L3ZA 2LGDA 3L10B 3DBLI 3A9JA 3QCAA 2RR9A 2N9EB 3MHSD 3WA0A 3ZLZA 5KHOA 3QJZA 3O65B 4FJZA 1S3SG 2N9XA 5G2NA 4DK5A 5DPTA 3NHEB 4FLHA 1UD7A 3SHQA 4XZ4A 3ZNID 3M62B 4WWOA 4XC2A 2MQJA 3ZIMA 2LRUA 2MCNB 3JSVA 3UF8A 2V4LA 4DHJD 3VUXA 4PS8A 4DHZE 3M3JA 2KNBA 2A4ZA 3KYCD 1E5WA 2Z0EB 1U4AA 1ZKHA 2KDBA 3PSEB 3ZDMC 4DDID 5DPWA 4MGYE 1WXSA 2KK8A 2N7DA 3VTUA 3VUWA 3KYDD 2G4SA 5CHVC 1WX8A 1IPGA 2G45B 2KDIA 2KKCA 1V80A 2BWES 4KSKC 1WM2A 2EMTA 2RSUA 3UGBB 3K9OB 2IY1B 4GIVA 5JHAA 4KVGB 1VCBA 2GBJA 2NVUI 2QHOA 2ZZPB 3A4RA 4E71A 2IY0B 4W9EA 3X23A 5LLIA 5DCNA 2R2QA 1YIWA 2D2QA 2LZ6A 3L08A 3JW0X 2ZCBA 2CKHB 2OOBB 3A1QA 2O6VB 3L0WB 4EFOA 3WAOA 4NY0A 2L8JA 3T9LA 4DXAB 3VFKA 2J0JA 4BKSD 2FIFA 1E8ZA 3TMPB 2KTRA 3AU5A 1YX5B 4GDKA 1TGZB 2CS4A 3HM3A 2K8HA 1WGYA 2RD0A 2GOWA 1LM8B 4NQLB 4F8CB 1E7VA 4AWJA 1MG8A 1OEYJ 2M17A 2BPSA 2KWVB 4B6WA 4OVVA 1KM7A 1UGMA 1BT0A 2K8BA 3PRPB 4GSWA 2LJ5A 1UH6A 4BKTA 1KJTA 1GJZA 1UBIA 2IO1B 2KDEB 4JLCA 1WIAA 2LD9A 3H7PA 4IWPA 3UINB 4BFRA 2M0XA 3H1UA 2KJHB 2LVQA 3IHPC 2C7NB 4WWNA 2HE7A 2PE6B 2VRRB 4KDIC 2LXAA 3ZNZB 1FXTB 4J6IA 4ANUA 4FBJB 4II2B 1UELA 4URKA 5KHQA 1OQYA 1V81A 1I35A 3EFUA 4TQ1A 4MGIE 1SE9A 4N9F4 2I1KA 1WGGA 3U8ZA 5IAAC 4G0NB 3DDCB 1P9DU 2D07B 5AZGA 3WANA 1ZW7A 3W1YA 4WJQA 2ZEQA 3S2AA 2PPHA 4K7SA 3TIXA 1GC6A 1S1QB 4EEWA 3ML8A 4PS3A 4OVUA 2MBEA 2LVPA 2KTRB 2OJRA 4W9JA 3A33B 3L17A 2K39A 4GDKB 2NS5A 2KZRA 2XK5B 4B95A 4BKGA 3ZNGC 3QAQA 4HDOA 3KUDB 2GBRA 2FCQA 2LXCA 4EZLA 5AEKB 1C3TA 1P98A 4FHJA 1WY8A 4DHZB 3PZDA 3PTFC 1WFYA 3A9KB 3VDZA 2KFKA 2CU1A 3V6EB 2NCNA 1ISNA 2XEWA 3DOWA 2D10A 1XT9B 3MTNB 1LXDA 4ICVA 1NBFC 2PJHA 3H7PB 3LJ3A 4W9IA 2JZZA 3RD2A 4IC7B 3AULA 1WZ0A 2MX2A 3OAWA 1WGDA 2LWPA 3N3KB 4LDTD 2NR2A 2IO0B 2N1WA 2M8SA 3ZUNA 4GMVA 1E7UA 1WM3A 2YVCA 1WJNA 2FCMA 1WF9A 5AZFA 4CYEA 2DZJA 5J18A 4MSQB 3B08A 4ZRJA 2N1VA 1SGHA 3DCGA 3ZKJC 4IWOA 3VTWA 4FULA 3QHTA 4AJWA 1D3ZA 1V5TA 2HD5B 3ALBA 1Q1OA 4I6LB 3N32A 1V6EA 1TTNA 3M63B 2KOXA 1VD2A 3B0AA 2PE9A 1TZ1A 3RZFA 1WJ6A 3JYUA 3ZNHB 3X0WA 4WWPA 1QZEA 1GNUA 1P3QU 2BGFA 4NAWB 4W9KA 5TR5A 2DZKA 2KMCA 3APCA 3IBEA 3QQ8B 2J0MA 4K1RB 3UQBA 1WE7A 1IP9A 2MP2B 3OJ4B 2C9WB 2WX1A 3APDA 4EZKA 2IYDB 3P2BA 3RT3B 2NBVB 4DWFA 3ENEA 3W1SA 2MBBB 2KFKB 3VH3B 5CX3A 2FCNA 2JF5A 3R7RA 5IA7A 2V3SA 2ZVOA 1E90A 3VH4B 4ZYNA 2CHZA 2ZNVC 3WAPA 4AUQC 1J19A 1E8WA 4IM3A 2I1JA 4ZRIA 4IUMB 2L00B 4K7UA 2W9NA 2KWCA 2D3GA 4A3PA 1K8RB 3WAMA 4PYUA 1RRBA 4ASWC 3PHXB 3QK0A 5L83A 4LCDE 4I6NB 4M0WB 2ZCCA 3IG3A 2DHZA 1XD3B 2KD0A 3SD5A 2BYEA 2BKRB 4IM2A 4K7WA 1L7YA 1V2YA 2XK5A 3ML9A 4IG7B 4MH0E 4MGKE 4AJYB 4MEMA 4HDQA 4DBGA 4JIOU 2NBWB 4WJPA 4MDKE 1HE8A 2K8CA 1WE6A 2EMSA 4EUTA 1J8CA 4E74A 4WQOB 3KH0A 1E8XA 3DBRI 2KC2A 2JPHA 4RM9A 1JRUA 3A9KA 3PVLA 3B1LX 5DPRA 5CTRC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4HJK A;  2XBB C;  4MJS A;  5GMV A;  3V61 A;  2L0T A;  2MW5 A;  4GDL A;  5BO4 B;  3WIM A;  1L2N A;  4RMA A;  1WR6 E;  2A5U A;  2HTH A;  4KIK A;  2BF8 B;  2EKE C;  4G50 A;  4NJ7 A;  4ANW A;  3SU8 X;  4FA6 A;  3RZW C;  3T8M A;  2KX3 A;  2NPT A;  1Z5S B;  3PS6 A;  1UZX B;  2L05 A;  4MGZ E;  4PS7 A;  3QWZ B;  4G3X B;  1WRD B;  2ZPY A;  2FCS A;  4RM8 A;  3AU4 A;  3H7S A;  1XQQ A;  2MA9 B;  3VUY A;  2G4D B;  5CHF A;  3ECI A;  3KW5 B;  3Q3F A;  5C1Z A;  3ZO5 B;  4W9H A;  2JWZ A;  2IO2 B;  5L95 C;  4LJP B;  5JH5 C;  1OGW A;  4MEL A;  2GBN A;  1P0R A;  3SDL C;  5LXI B;  3NS8 A;  2L0F A;  5G55 A;  2O6V D;  3OLM D;  3QIJ A;  2KWU B;  3U7D A;  1KLV A;  2IZV B;  1H4R A;  3KUZ A;  3MJW A;  4ZRK A;  3V6C B;  4NAW A;  4NJ6 A;  4BKS A;  4M8N A;  5D2M B;  3V60 A;  3QAR A;  1WGH A;  4M8M A;  3PRE A;  5JZE B;  1NDD A;  2MP2 A;  2K6D B;  5E6O A;  2REX A;  4HLE A;  2JRH A;  2JUO A;  3VTV A;  4JQW C;  3C0R B;  3QC8 B;  3R66 C;  2KX0 A;  2AL3 A;  5J17 A;  1Q0W B;  4GB9 A;  4HK2 A;  2MSE D;  2G3Q B;  3DQV A;  3KVF B;  3NZU A;  3PV1 A;  3BIN A;  4MJS B;  3TBL D;  3GOE A;  1I42 A;  2M4N A;  4GDL B;  1OTR B;  2KO3 A;  4ZDV A;  5D6J B;  3VHT C;  4DHJ B;  2FNJ B;  2N7E A;  2KLC A;  2JRI B;  4I6P A;  2LGX A;  4KIK B;  1Z2M A;  2MLB A;  4GXB A;  3N30 A;  4IW0 A;  4TKN A;  3UQA A;  1E8Y A;  1P1A A;  4WJN A;  2KXJ A;  2NPT B;  2KAN A;  3PLU A;  3NY5 A;  4LJO B;  3IFW B;  1IYF A;  4K81 A;  3ONS A;  1WI0 A;  2DX5 B;  2PEA A;  4CHK A;  4KSL C;  2FUH B;  1WMH B;  3U30 A;  1T0Y A;  5D7G A;  2MBO A;  4TV3 A;  5JHB A;  3DVN U;  4TUU A;  1NI2 A;  2ASQ A;  4JGH B;  2LUE A;  4F7Z A;  3GZN I;  1EUV B;  3M95 A;  2JXX A;  2R2O A;  4W9G A;  1UBQ A;  1EO6 A;  2BKF A;  3ZW3 A;  4II3 B;  3RUL A;  2GBK A;  3VQI A;  1WXA A;  2CR5 A;  3HHM A;  3IVF A;  4ANV A;  2LGY A;  4HXD A;  2DAJ A;  2JY6 A;  5LXH A;  2MWS B;  3PHW B;  4GOC A;  1CMX B;  2O2V A;  2WDT B;  3NOB A;  4WAA A;  3ZTC A;  4AP4 C;  1AAR A;  2ZNV B;  2Z0D B;  2GBM A;  1WXM A;  3WAL A;  2KJR A;  4NQK E;  4P7I A;  2AWT A;  4A20 A;  3EHV A;  4ANX A;  1WH3 A;  3H6N A;  2NBU A;  3CF6 E;  4HWI B;  2ZPN A;  4PYZ A;  4XX5 A;  1WX9 A;  3DPD A;  4HPL B;  2DYO A;  2AYO B;  3VVW B;  2LAS A;  2AEH A;  3APF A;  1A5R A;  2KN5 A;  5C23 A;  1GC7 A;  2LVO A;  5CHW A;  2AL6 A;  3RYT A;  4GU2 A;  1SIF A;  2KJ6 A;  4GN1 A;  3L54 A;  3H9D A;  2N4F A;  2Y5B B;  4W9L A;  1EF1 A;  5E6P A;  2KFJ A;  3DBS A;  5EDS A;  4IWQ A;  2C60 A;  3PRM B;  4AOF A;  4EZJ A;  4HVB A;  3EEC A;  3KUC B;  1YX6 B;  2J0K A;  2HJ8 A;  2L76 A;  4BOS C;  4KZ0 A;  2DYB A;  3OJ3 A;  2KDF B;  2RGF A;  1WYW B;  1Y8R C;  2DEN B;  3CST A;  1V49 A;  3PT2 B;  3TL5 A;  4EKU A;  3HIZ A;  1TBE A;  1RFA A;  2BYF A;  1YQB A;  2O2V B;  3A4S C;  4FJV B;  3PPA A;  3A9J B;  3TJP A;  4TQ0 A;  4HCN B;  1WR1 A;  1YD8 U;  2ZVN A;  3I3T B;  4W9D A;  4DDG D;  2JZ3 B;  2ZJD A;  1ZGU B;  4ICU A;  4E3C A;  3L16 A;  2MBH A;  3R3M A;  2JT4 B;  4HCP B;  4W9F A;  2WYQ A;  3RCZ A;  3RUI B;  3ZVV A;  4BBN F;  3DVG X;  1WMH A;  1WJ4 A;  4YL8 A;  1F9J A;  3PGE A;  3UIO B;  2C5L C;  3JSV B;  5AZH A;  1WGR A;  3CMM B;  4LDT B;  4W9C A;  1R4N I;  1OEY A;  3AI5 A;  4JL9 A;  2N9P C;  2FAZ A;  3NZS A;  4F1S A;  1C1Y B;  4MM3 A;  4KZC A;  2BYV E;  1V9J A;  1X1M A;  4BBN C;  2K25 A;  3HM6 X;  3ZRF A;  2D11 A;  2UWQ A;  3HK0 A;  2DZI A;  2DZM A;  2K1F A;  2DYM A;  2FID A;  2LRW A;  2UYZ B;  2KC1 A;  4KV2 A;  2WWZ A;  3W1S C;  2KLG A;  2J7Q B;  4HPM B;  3VXW A;  1PQS A;  2RPQ A;  3R7Q A;  3ZDT A;  4IM0 A;  1Q5W B;  3ZTD A;  2Z59 B;  4NPN A;  1LFD A;  3A1Q B;  4FN2 A;  4B9K A;  5DPS A;  1EF5 A;  3PLV A;  3PRZ A;  4FAD A;  2CHX A;  1H8C A;  2B3A A;  4FJY A;  1RAX A;  1GUA B;  2LI5 A;  1WZ3 A;  2C7H A;  2IO3 B;  3BY4 B;  3CSF A;  2YLM A;  3AXC A;  5E6N A;  4KDL B;  4CO7 A;  5D94 A;  3ZRC A;  1RLF A;  3EC8 A;  2KHW B;  2DAF A;  3V62 A;  1J0G A;  1WJU A;  3K9P B;  2K6Q A;  3QA8 A;  5HKH A;  3UIP B;  2CHW A;  2WX0 A;  2KQS A;  2BWF A;  1WXV A;  5FR6 A;  1GG3 A;  1M94 A;  2C7M B;  4EOY A;  4WJO A;  1WX7 A;  2KVR A;  3QX1 A;  4X57 B;  4BVU C;  3L13 A;  2M1M A;  4FHK A;  4GGQ A;  2MRP A;  5J2R A;  2IBI B;  2JVC A;  1G6J A;  2GMI C;  3LDZ E;  3VAW A;  1LQB A;  4MSM B;  3JVZ X;  1KOT A;  1YJ1 A;  1V5O A;  1V86 A;  2KTF A;  3DVN V;  3D32 A;  4NNJ B;  2MBQ A;  3DBH I;  4A3O A;  2L7R A;  1R4M I;  2KMA A;  2O6V A;  2V1Y A;  4G11 A;  4BOZ B;  3Q3J A;  2KQ7 A;  3TCA A;  3DVG Y;  2L3Z A;  2LGD A;  3L10 B;  3DBL I;  3A9J A;  3QCA A;  2RR9 A;  2N9E B;  3MHS D;  3WA0 A;  3ZLZ A;  5KHO A;  3QJZ A;  3O65 B;  4FJZ A;  1S3S G;  2N9X A;  5G2N A;  4DK5 A;  5DPT A;  3NHE B;  4FLH A;  1UD7 A;  3SHQ A;  4XZ4 A;  3ZNI D;  3M62 B;  4WWO A;  4XC2 A;  2MQJ A;  3ZIM A;  2LRU A;  2MCN B;  3JSV A;  3UF8 A;  2V4L A;  4DHJ D;  3VUX A;  4PS8 A;  4DHZ E;  3M3J A;  2KNB A;  2A4Z A;  3KYC D;  1E5W A;  2Z0E B;  1U4A A;  1ZKH A;  2KDB A;  3PSE B;  3ZDM C;  4DDI D;  5DPW A;  4MGY E;  1WXS A;  2KK8 A;  2N7D A;  3VTU A;  3VUW A;  3KYD D;  2G4S A;  5CHV C;  1WX8 A;  1IPG A;  2G45 B;  2KDI A;  2KKC A;  1V80 A;  2BWE S;  4KSK C;  1WM2 A;  2EMT A;  2RSU A;  3UGB B;  3K9O B;  2IY1 B;  4GIV A;  5JHA A;  4KVG B;  1VCB A;  2GBJ A;  2NVU I;  2QHO A;  2ZZP B;  3A4R A;  4E71 A;  2IY0 B;  4W9E A;  3X23 A;  5LLI A;  5DCN A;  2R2Q A;  1YIW A;  2D2Q A;  2LZ6 A;  3L08 A;  3JW0 X;  2ZCB A;  2CKH B;  2OOB B;  3A1Q A;  2O6V B;  3L0W B;  4EFO A;  3WAO A;  4NY0 A;  2L8J A;  3T9L A;  4DXA B;  3VFK A;  2J0J A;  4BKS D;  2FIF A;  1E8Z A;  3TMP B;  2KTR A;  3AU5 A;  1YX5 B;  4GDK A;  1TGZ B;  2CS4 A;  3HM3 A;  2K8H A;  1WGY A;  2RD0 A;  2GOW A;  1LM8 B;  4NQL B;  4F8C B;  1E7V A;  4AWJ A;  1MG8 A;  1OEY J;  2M17 A;  2BPS A;  2KWV B;  4B6W A;  4OVV A;  1KM7 A;  1UGM A;  1BT0 A;  2K8B A;  3PRP B;  4GSW A;  2LJ5 A;  1UH6 A;  4BKT A;  1KJT A;  1GJZ A;  1UBI A;  2IO1 B;  2KDE B;  4JLC A;  1WIA A;  2LD9 A;  3H7P A;  4IWP A;  3UIN B;  4BFR A;  2M0X A;  3H1U A;  2KJH B;  2LVQ A;  3IHP C;  2C7N B;  4WWN A;  2HE7 A;  2PE6 B;  2VRR B;  4KDI C;  2LXA A;  3ZNZ B;  1FXT B;  4J6I A;  4ANU A;  4FBJ B;  4II2 B;  1UEL A;  4URK A;  5KHQ A;  1OQY A;  1V81 A;  1I35 A;  3EFU A;  4TQ1 A;  4MGI E;  1SE9 A;  4N9F 4;  2I1K A;  1WGG A;  3U8Z A;  5IAA C;  4G0N B;  3DDC B;  1P9D U;  2D07 B;  5AZG A;  3WAN A;  1ZW7 A;  3W1Y A;  4WJQ A;  2ZEQ A;  3S2A A;  2PPH A;  4K7S A;  3TIX A;  1GC6 A;  1S1Q B;  4EEW A;  3ML8 A;  4PS3 A;  4OVU A;  2MBE A;  2LVP A;  2KTR B;  2OJR A;  4W9J A;  3A33 B;  3L17 A;  2K39 A;  4GDK B;  2NS5 A;  2KZR A;  2XK5 B;  4B95 A;  4BKG A;  3ZNG C;  3QAQ A;  4HDO A;  3KUD B;  2GBR A;  2FCQ A;  2LXC A;  4EZL A;  5AEK B;  1C3T A;  1P98 A;  4FHJ A;  1WY8 A;  4DHZ B;  3PZD A;  3PTF C;  1WFY A;  3A9K B;  3VDZ A;  2KFK A;  2CU1 A;  3V6E B;  2NCN A;  1ISN A;  2XEW A;  3DOW A;  2D10 A;  1XT9 B;  3MTN B;  1LXD A;  4ICV A;  1NBF C;  2PJH A;  3H7P B;  3LJ3 A;  4W9I A;  2JZZ A;  3RD2 A;  4IC7 B;  3AUL A;  1WZ0 A;  2MX2 A;  3OAW A;  1WGD A;  2LWP A;  3N3K B;  4LDT D;  2NR2 A;  2IO0 B;  2N1W A;  2M8S A;  3ZUN A;  4GMV A;  1E7U A;  1WM3 A;  2YVC A;  1WJN A;  2FCM A;  1WF9 A;  5AZF A;  4CYE A;  2DZJ A;  5J18 A;  4MSQ B;  3B08 A;  4ZRJ A;  2N1V A;  1SGH A;  3DCG A;  3ZKJ C;  4IWO A;  3VTW A;  4FUL A;  3QHT A;  4AJW A;  1D3Z A;  1V5T A;  2HD5 B;  3ALB A;  1Q1O A;  4I6L B;  3N32 A;  1V6E A;  1TTN A;  3M63 B;  2KOX A;  1VD2 A;  3B0A A;  2PE9 A;  1TZ1 A;  3RZF A;  1WJ6 A;  3JYU A;  3ZNH B;  3X0W A;  4WWP A;  1QZE A;  1GNU A;  1P3Q U;  2BGF A;  4NAW B;  4W9K A;  5TR5 A;  2DZK A;  2KMC A;  3APC A;  3IBE A;  3QQ8 B;  2J0M A;  4K1R B;  3UQB A;  1WE7 A;  1IP9 A;  2MP2 B;  3OJ4 B;  2C9W B;  2WX1 A;  3APD A;  4EZK A;  2IYD B;  3P2B A;  3RT3 B;  2NBV B;  4DWF A;  3ENE A;  3W1S A;  2MBB B;  2KFK B;  3VH3 B;  5CX3 A;  2FCN A;  2JF5 A;  3R7R A;  5IA7 A;  2V3S A;  2ZVO A;  1E90 A;  3VH4 B;  4ZYN A;  2CHZ A;  2ZNV C;  3WAP A;  4AUQ C;  1J19 A;  1E8W A;  4IM3 A;  2I1J A;  4ZRI A;  4IUM B;  2L00 B;  4K7U A;  2W9N A;  2KWC A;  2D3G A;  4A3P A;  1K8R B;  3WAM A;  4PYU A;  1RRB A;  4ASW C;  3PHX B;  3QK0 A;  5L83 A;  4LCD E;  4I6N B;  4M0W B;  2ZCC A;  3IG3 A;  2DHZ A;  1XD3 B;  2KD0 A;  3SD5 A;  2BYE A;  2BKR B;  4IM2 A;  4K7W A;  1L7Y A;  1V2Y A;  2XK5 A;  3ML9 A;  4IG7 B;  4MH0 E;  4MGK E;  4AJY B;  4MEM A;  4HDQ A;  4DBG A;  4JIO U;  2NBW B;  4WJP A;  4MDK E;  1HE8 A;  2K8C A;  1WE6 A;  2EMS A;  4EUT A;  1J8C A;  4E74 A;  4WQO B;  3KH0 A;  1E8X A;  3DBR I;  2KC2 A;  2JPH A;  4RM9 A;  1JRU A;  3A9K A;  3PVL A;  3B1L X;  5DPR A;  5CTR C; 
#chains in the Genus database with same CATH topology
 2D3C A;  3WIM A;  2ICI A;  2LUM A;  2A5U A;  2HTH A;  2EKE C;  3PS6 A;  4MGZ E;  3T3O A;  4G3X B;  4XE0 A;  2Y3A A;  4YTP B;  1TIF A;  2V9H A;  3IAS 1;  3NVZ A;  3GB1 A;  3NVW A;  1B1Z A;  4IDI A;  5C1Z A;  5GXG B;  4RGN A;  3ZO5 B;  4W9H A;  2JWZ A;  4LJP B;  5JH5 C;  4MEL A;  1P0R A;  1HZ6 A;  4RGO S;  4YSY B;  2KWU B;  3U7D A;  4YWG G;  1F2R C;  1FNU A;  1H4R A;  2IZV B;  4NJ6 A;  4M8N A;  2WXI A;  3N9Y C;  4KGT A;  2YEP F;  5JZE B;  3VTV A;  4JQW C;  1C76 A;  5G5G A;  3QC8 B;  5J17 A;  1SB3 C;  1GPX A;  3I57 A;  4N59 A;  4ZDV A;  4DHJ B;  1RM6 C;  2N7E A;  2KLC A;  4KIK B;  4TKN A;  1Z2M A;  5AUK A;  1N60 A;  1HZ5 A;  1P1A A;  2KXJ A;  2NPT B;  4CHK A;  4KSL C;  1WMH B;  4WH4 A;  3DVN U;  4YSZ B;  1NI2 A;  4B0E A;  1YN4 A;  4JGH B;  4F7Z A;  3M95 A;  2R2O A;  1UBQ A;  4II3 B;  1V1P B;  3VQI A;  3HHM A;  2LGY A;  2DAJ A;  4HKZ E;  2WDT B;  3PZ7 A;  3B9J A;  3ZTC A;  4AP4 C;  1YMH E;  2JX5 A;  3BVG A;  2ZNV B;  2Z0D B;  1KH0 A;  3H6N A;  3CF6 E;  2ZPN A;  4HRS A;  5EE3 A;  4P6V F;  3VVW B;  1OFF A;  2W3R A;  1N5W A;  2LVO A;  1WGK A;  2L83 A;  2LHE A;  5BYR A;  5IO9 A;  4ARC A;  1EF1 A;  1JRO A;  5E6P A;  1B9R A;  3KWV A;  2C60 A;  4AOF A;  4HVB A;  2HJ8 A;  2L76 A;  2WXN A;  4LNF A;  2DYB A;  1YQ3 B;  4RNA A;  3T3N A;  3BZD B;  1I4R A;  3HIZ A;  1TBE A;  2DNF A;  3PPA A;  4TQ0 A;  3WCQ A;  5HHD G;  2M56 B;  4W9D A;  2ZJD A;  4ICU A;  3PZ8 A;  2JT4 B;  1ZP0 B;  3RUI B;  1RYJ A;  4LNK A;  4A8X C;  1WMH A;  1SJH D;  3UIO B;  3V05 A;  3CMM B;  3AI5 A;  2N9P C;  3NZS A;  1V9J A;  1X1M A;  2D11 A;  1V1P A;  3W2D A;  2UWQ A;  1YN3 A;  3Q3N C;  1PGB A;  1XF5 L;  2DYM A;  2LRW A;  3BII D;  1XLQ A;  4HPM B;  3VXW A;  1PQS A;  4A6Q A;  4IM0 A;  3ZTD A;  4FN2 A;  1VR9 A;  2QMT A;  4HRO A;  3PRZ A;  1BXT A;  1RAX A;  2V4I B;  3BY4 B;  1F77 A;  4KDL B;  2NTS A;  4CO7 A;  4KKI A;  3EC8 A;  1V8C A;  1WJU A;  3K9P B;  2PMV A;  3UIP B;  2BWF A;  1WXV A;  1GG3 A;  4KX6 B;  2B76 B;  1WX7 A;  2M1M A;  4FHK A;  4GGQ A;  5J2R A;  2JVC A;  1L4D B;  3VAW A;  1KOT A;  1V86 A;  3DVN V;  3D32 A;  2JQR B;  2KAJ A;  3DBH I;  4A3O A;  2L7R A;  3TCA A;  3L10 B;  3EFC A;  2QDF A;  3NHE B;  3SHQ A;  2BS2 B;  2E3T A;  3ZNI D;  2LRU A;  2K0P A;  3AEE B;  5IKC M;  3HUI A;  4DHZ E;  5FKA C;  2A4Z A;  1E5W A;  1KFY B;  1U4A A;  4DDI D;  2JU6 X;  4MGY E;  1WXS A;  1JWU D;  2G4S A;  1WX8 A;  1PUT A;  2KDI A;  1V80 A;  2BWE S;  4P1C C;  3UGB B;  5JHA A;  1FM0 D;  2QHO A;  2IY0 B;  2R2Q A;  2W3S A;  2LZ6 A;  4EFO A;  3MC9 A;  3TEY A;  4NY0 A;  4DXA B;  1CJE A;  3RNE C;  2KTR A;  2WXL A;  4MT5 A;  2K8H A;  2N9L A;  2H89 B;  1L4Z B;  1MG8 A;  2M17 A;  2KWV B;  4B6W A;  5IP4 D;  2K8B A;  1UGM A;  1L0Y B;  1EWC A;  2KDE B;  4JLC A;  1WIA A;  4IWP A;  3H7P A;  4CQN A;  2M0X A;  1DYQ A;  2KJH B;  5EE1 A;  3IHP C;  3NVY A;  2WXK A;  3P42 A;  1HTO A;  4J6I A;  3NG0 A;  1MJD A;  2RDB C;  2QC8 A;  4C4V A;  4RGT A;  3EFU A;  3V3X A;  2RMM A;  1WGG A;  2HDE A;  2WQY B;  2PPH A;  1TKE A;  2MBE A;  2LVP A;  2V0G A;  3L17 A;  2PKO A;  1VZ6 A;  3QAQ A;  1SF0 A;  2L52 A;  4EZL A;  5AEK B;  1FCL A;  3A9K B;  3R2I A;  1LXD A;  3LJ3 A;  1L5P A;  2LEK A;  1KRH A;  1WXQ A;  2PW9 A;  1WGD A;  4LDT D;  3N3K B;  1FMA D;  2IO0 B;  2M8S A;  1WM3 A;  1I4P A;  4ZYS A;  3U7Z A;  1SE2 A;  2OED A;  3URY A;  3DCG A;  2INC C;  3QHT A;  1M4V A;  2WDV B;  1V5T A;  4I6L B;  2IGD A;  1TTN A;  3M63 B;  1C9F A;  3ZNH B;  4YSX B;  4WWP A;  2W54 A;  1QZE A;  1GNU A;  2DZK A;  2KMC A;  3APC A;  3I5J C;  1K51 A;  2MP2 B;  4ACF A;  2WXO A;  3DBR B;  3RNC C;  3APD A;  4OHJ A;  2NBV B;  2WXG A;  1PYW D;  3ENE A;  2LGS A;  3W1S A;  2KFK B;  1N63 A;  3R7R A;  4TMA B;  3VH4 B;  4L23 A;  2ZNV C;  4ZRI A;  3BK1 A;  3WAM A;  1SJE D;  3QK0 A;  1K50 A;  3AEB B;  1V2Y A;  3ML9 A;  1ZE3 D;  4HDQ A;  2K8C A;  2EMS A;  4P16 A;  3AEF B;  4E74 A;  4WQO B;  3KH0 A;  1UF0 A;  3A9K A;  3B1L X;  4MJS A;  2MW5 A;  4NJ7 A;  1TY0 A;  4FA6 A;  3W5U B;  1HXY D;  3EGR A;  3RZW C;  1DGJ A;  2BVC A;  3T8M A;  2KX3 A;  2WDR B;  4NAM A;  1WRD B;  5EE9 A;  3AU4 A;  3H7S A;  2NTT A;  2MA9 B;  4LNO A;  3ECI A;  3Q3F A;  1L0V B;  2IO2 B;  5L95 C;  4HKQ A;  4WIP A;  2L0F A;  3GZN B;  3DWM A;  1KLV A;  4N58 A;  5D2M B;  1QF6 A;  3PRE A;  1ET9 A;  2MP2 A;  4HLE A;  2REX A;  3SFE B;  4HK2 A;  3NZU A;  3PV1 A;  3RNF C;  3BIN A;  1JCK B;  3C8Y A;  3NRZ A;  1VZ7 A;  3VHT C;  2FNJ B;  2VH2 A;  2WXQ A;  1FEH A;  4GXB A;  4IW0 A;  2WDQ B;  4WJN A;  2KAN A;  3NY5 A;  4LJO B;  2KYW A;  2K5P A;  1VRA B;  2PEA A;  4Q2J A;  3W9C B;  3N1X C;  4XGA B;  1MHH E;  1SSN A;  1EUV B;  3O13 A;  3ZW3 A;  3RUL A;  3UI3 A;  1DOX A;  4HXD A;  2QIL A;  1L0X B;  1GOZ A;  1NYQ A;  5LXH A;  1CMX B;  2O2V A;  1QOG A;  2LGI A;  2MJD A;  1AAR A;  1OQQ A;  3MC0 B;  3U52 E;  2GBM A;  3WAL A;  4P7I A;  3FAH A;  2WXJ A;  3VR9 B;  4HWI B;  4XX5 A;  1MHX A;  1WX9 A;  3DPD A;  1LGR A;  2DYO A;  1FFV A;  4YT0 B;  1A5R A;  3TEZ A;  1GC7 A;  5CHW A;  3DHH C;  2AL6 A;  2KJ6 A;  3ZXR A;  3L54 A;  3KWL A;  2Y5B B;  1ROE A;  2IGG A;  2KFJ A;  2IJ0 A;  5IN7 A;  1SXT A;  1C77 A;  1AYF A;  4KZ0 A;  1FXI A;  2K3U A;  2KDF B;  3RFZ B;  1V49 A;  3PT2 B;  3TL5 A;  3Q3O C;  1T6B X;  1FIQ A;  1JWS D;  4FJV B;  4GLS C;  4J3O D;  2D3A A;  1WR1 A;  1Q10 A;  1YD8 U;  2ZVN A;  3I3T B;  4DDG D;  3L16 A;  2JYT A;  4HCP B;  2WYQ A;  4NZL B;  3RMK C;  3N20 C;  4YL8 A;  2I38 A;  2C5L C;  4LDT B;  2RPV A;  1R4N I;  4YTN B;  4HPP A;  2PVO D;  4F1S A;  4MM3 A;  4BBN C;  1C4P A;  2K25 A;  3EA6 A;  4KGS A;  3HK0 A;  2K1F A;  2FID A;  2WWZ A;  3W1S C;  1F1H A;  1C78 A;  1LFD A;  1YQ4 B;  2D5G A;  1TY2 A;  1FPY A;  2LI5 A;  1WZ3 A;  2IO3 B;  3CSF A;  2YLM A;  1RWS A;  2KHW B;  2DAF A;  2AQ2 B;  3RNG C;  3QA8 A;  2W55 A;  1F2R I;  5FR6 A;  4EOY A;  1M94 A;  4WJO A;  2WP9 B;  4X57 B;  4BVU C;  2ZW1 A;  1G6J A;  2IBI B;  4WQM A;  1JW9 D;  2MJ3 A;  2KTF A;  4ZOH C;  2AQ3 B;  2MBQ A;  4RH6 A;  1R4M I;  1PFD A;  3DBL I;  2KN4 A;  2RR9 A;  3MHS D;  1DOY A;  3ZLZ A;  1KLU D;  2IND C;  4M01 A;  5KHO A;  1D5M C;  1S3S G;  2J52 A;  2N9X A;  5DPT A;  4XZ4 A;  4WWO A;  4XC2 A;  2MQJ A;  2MCN B;  2V4L A;  3VUX A;  1NEN B;  3TSS A;  2KNB A;  2QCZ A;  4AS1 A;  1J7C A;  2N7D A;  3Q8A A;  3KYD D;  1D4B A;  2KKC A;  1JRP A;  1TYG B;  1WRI A;  2EMT A;  3AMZ A;  2RSU A;  1P7F A;  2IY1 B;  2I2Y A;  2NVU I;  4E71 A;  1IGD A;  3X23 A;  3L08 A;  3JW0 X;  2FUG 1;  1Y56 A;  2L8J A;  2J0J A;  1TGZ B;  1WGY A;  1JML A;  2GOW A;  2FBW B;  4XDD A;  4NQL B;  1HA5 A;  4AWJ A;  4XWT A;  3PRP B;  2KDM A;  4GSW A;  1VJK A;  1UH6 A;  4BKT A;  1JWM D;  2V3N A;  2LD9 A;  3UIN B;  2LVQ A;  4HEA 1;  2HE7 A;  2PE6 B;  2VRR B;  4KDI C;  4IOI E;  4ANU A;  4URK A;  3ZGZ A;  1V81 A;  1K52 A;  1SIJ A;  2QEJ C;  4MGI E;  2RDH A;  2OJW A;  4ZRQ A;  2WS3 B;  1XCQ L;  3U8Z A;  5AZG A;  1ZW7 A;  3W1Y A;  4WJQ A;  1QOF A;  4XYC A;  1FRR A;  1AW7 A;  1GC6 A;  4EEW A;  1V1O A;  2BTE A;  1GB4 A;  2WXR A;  2KTR B;  2OJR A;  3A33 B;  2KMM A;  2XK5 B;  3KUD B;  4FHJ A;  5HG2 A;  1YJJ A;  3PZD A;  1WWT A;  3VDZ A;  3U2S C;  1ISN A;  2D10 A;  5T8I A;  2PJH A;  3H7P B;  2G1E A;  2JZZ A;  3E56 A;  1TS2 A;  1VZ8 A;  1WZ0 A;  1XLO A;  2LWP A;  2MX2 A;  1BUI C;  3ZUN A;  3MP9 A;  1E7U A;  1ZDX A;  3VR8 B;  1TKY A;  2CJO A;  1I7H A;  1XLP A;  4C4V B;  4CYE A;  4ZRJ A;  2OHF A;  2N1V A;  1SGH A;  4IWO A;  4FUL A;  4L2Y A;  2HD5 B;  4ARI A;  3PO0 A;  3N32 A;  4C00 A;  3J9C A;  1VD2 A;  2PE9 A;  1WJ6 A;  3N1Y C;  2BGF A;  1I4X A;  1LO5 D;  3IBE A;  3QQ8 B;  1WE7 A;  2J42 A;  1ZUD 2;  3OJ4 B;  4EZK A;  3RT3 B;  4NJC A;  3TEX A;  5CX3 A;  2FCN A;  2JF5 A;  4OZA A;  2EEL A;  3P4Q B;  4IM3 A;  1FFU A;  5BMI A;  2GRI A;  2W9N A;  3AE4 B;  3OG5 A;  2KWC A;  1K8R B;  4PYU A;  1A70 A;  1E10 A;  5L83 A;  4M0W B;  2ZCC A;  4BZA A;  2DHZ A;  2KD0 A;  1GAQ B;  4IM2 A;  2BQQ A;  5H8Y E;  2XK5 A;  4H2A A;  4IG7 B;  5C2T B;  4JIO U;  2NBW B;  4WJP A;  1MI0 A;  1HE8 A;  2L32 A;  4C7Y A;  2MJE A;  4PT5 A;  1UNS A;  4RM9 A;  4HJK A;  1ZDV A;  4QAY A;  3V61 A;  2L0T A;  1L2N A;  4GDL A;  4RMA A;  2BF8 B;  1ZPS A;  4ANW A;  4PS7 A;  2ZPY A;  4RM8 A;  3SR6 A;  3Q8C A;  5CHF A;  2NMQ A;  1EWY C;  3GP7 A;  1R7S A;  2GBN A;  3NS8 A;  5G55 A;  3OLM D;  1HQR D;  1VDV A;  4ZRK A;  3HVD A;  3NJT A;  1WSP A;  1NDD A;  5E6O A;  3P4S B;  2JRH A;  4MH8 A;  3C0R B;  3R66 C;  2AL3 A;  2DWQ A;  3BWU D;  3KVF B;  2G3Q B;  1XXG A;  3AEG B;  4MJS B;  3TBL D;  1I42 A;  2M4N A;  1OTR B;  5D6J B;  4C56 C;  2JRI B;  4I6P A;  2LGX A;  3N30 A;  2KVZ A;  1UGJ A;  3I63 C;  1IYF A;  1I4G A;  2WGS A;  1K53 A;  2FUH B;  3MJ5 A;  4M0W A;  1T0Y A;  5D7G A;  5JHB A;  2ASQ A;  2LUE A;  2JXX A;  4W9G A;  2BKF A;  1V97 A;  4ANV A;  2Y5C A;  1FNW A;  4RF1 A;  3BVZ A;  1XCT L;  3NOB A;  4XDC A;  1N62 A;  4DXF A;  4UDU C;  2KJR A;  3SFD B;  2AX5 A;  4A20 A;  3EHV A;  4ANX A;  3CWI A;  3U4E G;  2KT7 A;  2NBU A;  4HPL B;  1L6U A;  4PK1 A;  3AE1 B;  2KN5 A;  4M00 A;  3RYT A;  5BMH A;  4GN1 A;  2X8X X;  2N4F A;  2WXH A;  3FIL A;  3DBS A;  5EDS A;  4IWQ A;  4EZJ A;  4R3D A;  3EEC A;  3KUC B;  1YX6 B;  2J0K A;  1XEE A;  4BOS C;  3OJ3 A;  2RGF A;  4LK0 M;  1WYW B;  1Y8R C;  1D5Z C;  4EKU A;  2LHD A;  1TZO A;  1T0R C;  1RFA A;  2BYF A;  1YQB A;  2O2V B;  3A4S C;  3AEC B;  1N6Z A;  3A9J B;  3Q6B A;  4HCN B;  1ZGU B;  2E6X A;  1GB1 A;  3ZVV A;  2JZP A;  4YTM B;  1NEK B;  3PGE A;  3Q8F A;  3JSV B;  5AZH A;  1WGR A;  3AEA B;  3I9V 1;  4JL9 A;  3HM6 X;  3H8H A;  2DZI A;  1N5X A;  2UYZ B;  4KV2 A;  2JYE A;  1CZP A;  4KKJ A;  3ZYY X;  3DBH B;  5D3I B;  3R7Q A;  2LJI A;  3A1Q B;  3AM9 A;  2KAC A;  4IKG A;  4B9K A;  5DPS A;  1JQ4 A;  2PVG C;  4FAD A;  2CHX A;  4FJY A;  4S17 A;  3NVV A;  1GUA B;  3ZQ4 A;  1T0S C;  5D94 A;  1ACC A;  3AED B;  1XLN A;  3ZRC A;  1RLF A;  1J0G A;  2K6Q A;  1TJE A;  5HKH A;  4S0R A;  2KQS A;  2KVR A;  4DXG A;  4P1B C;  5HFY A;  3LDZ E;  4MM3 B;  3JVZ X;  5D3D A;  5G5H A;  3AE7 B;  3IXS A;  3AV8 A;  2IGH A;  4NNJ B;  3IT6 B;  2O6V A;  2KMA A;  4BOZ B;  2V1Y A;  2WU2 B;  3Q3J A;  2IDY A;  3A9J A;  4LLG M;  2N9E B;  2R61 A;  3O65 B;  2DBY A;  4FLH A;  1E9M A;  3LXF A;  3AB5 A;  4US8 A;  3M62 B;  4YXD B;  2PTL A;  3JSV A;  4PS8 A;  1QOB A;  3M3J A;  2HJ1 A;  1ZKH A;  1WYG A;  3PSE B;  2KK8 A;  3VUW A;  2AQ1 B;  5CHV C;  1T5X D;  2KQ4 X;  2G45 B;  4RGM A;  4KSK C;  1WM2 A;  2Q5W D;  4HJG E;  3K9O B;  4GIV A;  4KVG B;  1VCB A;  2ZZP B;  3A4R A;  4W9E A;  1NI3 A;  5DCN A;  2ZCB A;  4A90 A;  2CKH B;  2OOB B;  2RDG A;  3A1Q A;  3L0W B;  5IOI A;  1UWM A;  4N6E B;  2BS3 B;  1VLB A;  3RNA C;  3VFK A;  3AE2 B;  2FIF A;  3Q69 A;  3TMP B;  1YX5 B;  4GDK A;  3HM3 A;  1E0Z A;  2RD0 A;  4EE2 A;  2LMC A;  1E7V A;  4F8C B;  3DHG C;  1OEY J;  1YJI A;  2BPS A;  4OVV A;  1GJZ A;  1UBI A;  2Z8L A;  3H1U A;  3LYY A;  1MG4 A;  1KLG D;  3AE8 B;  2LXA A;  3ZNZ B;  1FXT B;  1T0Q C;  4II2 B;  1UEL A;  4ITK A;  1OQR A;  1SBB B;  4JWU C;  2YEP B;  3SEB A;  2I1K A;  5IAA C;  1FO4 A;  3MFG A;  1P9D U;  2D07 B;  4TSS A;  2N0S B;  3WAN A;  3S2A A;  1EU4 A;  3DWG C;  4ZHO A;  4PS3 A;  4C80 A;  2WU5 B;  2K39 A;  2KZR A;  4B95 A;  3ZNG C;  2JWU A;  4HDO A;  2GBR A;  4MAC A;  2LXC A;  2K22 A;  1C3T A;  1P98 A;  1WY8 A;  2V3P A;  1WFY A;  4LNN A;  2CU1 A;  3V6E B;  5I4D A;  1N61 A;  1XT9 B;  4ICV A;  1NBF C;  4W9I A;  1C4C A;  3E9S A;  1ZXH A;  4IC7 B;  4BAX A;  1FRD A;  2NR2 A;  2N1W A;  3EUB 2;  2YVC A;  1WJN A;  2FCM A;  1WF9 A;  2DZJ A;  2TSS A;  1HEZ E;  2WXP A;  3MC8 A;  1IBX B;  1D3Z A;  3ALB A;  1NVI D;  3HRD D;  2KOX A;  3B0A A;  4JE3 B;  3RZF A;  3X0W A;  1P3Q U;  4NAW B;  1MPE A;  5TR5 A;  2IPK D;  4K1R B;  2J0M A;  3RNB C;  1D6E C;  3ZJU A;  3IT4 B;  1FCC C;  2ONQ A;  2C9W B;  4B0M A;  3P2B A;  2JSV X;  2SAK A;  1UUP A;  1YOV B;  3VH3 B;  2V3S A;  2ZVO A;  2K9X A;  1KF6 B;  1F0Z A;  4ZYN A;  3Q8E A;  3VRB B;  4JWS C;  4AUQ C;  1E8W A;  4DQO C;  2I1J A;  4K7U A;  2L00 B;  4A3P A;  5AUI A;  3Q14 C;  3RPF C;  1RRB A;  3R2T A;  2KWD A;  3Q3M C;  4FXC A;  2H88 B;  3SD5 A;  1L7Y A;  3MHZ A;  4AJY B;  5EE0 A;  5FK9 C;  4MDK E;  1WE6 A;  4EUT A;  1E8X A;  3DBR I;  2KC2 A;  3PVL A;  5DPR A;  5CTR C;  2XBB C;  4M02 A;  4LTU A;  5GMV A;  1QLB B;  5BO4 B;  2PLP A;  1WR6 E;  4KIK A;  4G50 A;  2N9K A;  3GE3 C;  4RF0 A;  3SU8 X;  2NPT A;  1Z5S B;  1UZX B;  2L05 A;  3RI7 C;  3QWZ B;  2MHJ A;  2FCS A;  2VZK D;  1XQQ A;  3VUY A;  2G4D B;  1IBX A;  3KW5 B;  2WNM A;  2CJN A;  1OGW A;  1RFK A;  3SDL C;  5LXI B;  2O6V D;  1NYR A;  2ACZ B;  2QSD A;  3QIJ A;  3AN1 A;  3B2G A;  3KUZ A;  3MJW A;  3V6C B;  4NAW A;  4BKS A;  3V60 A;  3QAR A;  1WGH A;  4M8M A;  2K6D B;  2JUO A;  1P7E A;  1SEB D;  2KX0 A;  1Q0W B;  1JAL A;  4GB9 A;  2MSE D;  3DQV A;  1KTK A;  4USA A;  1C4A A;  2WLB A;  3GOE A;  4GDL B;  3W5V B;  2KO3 A;  1EU3 A;  2JXT A;  1MFW A;  1MVK A;  2MLB A;  2GB1 A;  3UQA A;  4A55 A;  1ET6 A;  1E8Y A;  2LFI A;  3PLU A;  3IFW B;  1TKG A;  3ONS A;  4K81 A;  1WI0 A;  2DX5 B;  3P4P B;  3U30 A;  2MBO A;  4TV3 A;  4TUU A;  1AN8 A;  1T3Q A;  2XNA C;  3GZN I;  2X38 A;  1QT9 A;  1EO6 A;  2GBK A;  1WXA A;  2CR5 A;  3IVF A;  2JY6 A;  2MWS B;  3PHW B;  4GOC A;  5C3J B;  1D5X C;  3P4R B;  3AE6 B;  3Q2A C;  4WAA A;  5E6J A;  1ESF A;  1WXM A;  4NQK E;  2AWT A;  1WH3 A;  1ZOY B;  4PYZ A;  1TS3 A;  2AYO B;  2LAS A;  5TSS A;  2AEH A;  3APF A;  5BYS A;  5FR3 A;  5C23 A;  1J7A A;  4GU2 A;  1AWD A;  1SIF A;  3Q8B A;  3AE3 B;  3H9D A;  4W9L A;  1R4N B;  3PRM B;  1L6V A;  1QKZ A;  1QIL A;  2BYT A;  4OZC A;  1E6E B;  2BS4 B;  3CIR B;  3ZJV A;  3TEW A;  1BML C;  4OZB A;  4O1N A;  2DEN B;  2SEB D;  3CST A;  1ZXI A;  5MPO A;  3TJP A;  2GLS A;  1PGX A;  2JZ3 B;  4E3C A;  3BYY B;  2MBH A;  2BT6 A;  3R3M A;  2EKI A;  4W9F A;  3RCZ A;  3AE5 B;  4BBN F;  2WXF A;  3DVG X;  1WJ4 A;  1JWB D;  1F9J A;  4W9C A;  3KLS X;  1STE A;  1OEY A;  2VH1 A;  2FAZ A;  1C1Y B;  4KZC A;  1HTQ A;  2BYV E;  3FIL B;  3ZRF A;  3BVM A;  1XO3 A;  1E7P B;  3ZXV A;  3KQ4 A;  4RFB A;  2DZM A;  4A9A A;  1IUE A;  2KC1 A;  2KLG A;  1FD6 A;  2BB6 A;  2J7Q B;  2RPQ A;  5JXV A;  3ZDT A;  1R4M B;  1Q5W B;  2Z59 B;  1UWX A;  3IAM 1;  4NPN A;  2QIE B;  3DBL B;  1EF5 A;  1SE3 A;  3PLV A;  1H8C A;  2B3A A;  2C7H A;  5E6N A;  3AXC A;  5H92 C;  3R8B A;  2BB5 A;  3V62 A;  3N1Z C;  2GI9 A;  2CHW A;  2WX0 A;  3GS2 A;  2C7M B;  3QX1 A;  2G9H D;  3L13 A;  2MRP A;  1FNV A;  2J53 A;  2GMI C;  3RN9 C;  1LQB A;  4MSM B;  1YJ1 A;  4KGR A;  1V5O A;  4REZ A;  3L4P A;  5BYQ A;  4D2K A;  4AQ7 A;  4G11 A;  1F52 A;  2KQ7 A;  1CQV A;  3DVG Y;  2L3Z A;  2LGD A;  1ENF A;  2PIA A;  3QCA A;  2MH7 A;  2MEK A;  5LNK 1;  3WA0 A;  4WUR A;  3QJZ A;  4FJZ A;  5G2N A;  4DK5 A;  2WXM A;  1UD7 A;  2UU7 A;  4K3B A;  1PDX A;  3ZIM A;  3UF8 A;  4DHJ D;  3NZ3 A;  3KYC D;  3B2F A;  2Z0E B;  3ZDM C;  2KDB A;  5DPW A;  3VTU A;  3GE8 C;  1IPG A;  3ABV B;  1TS5 A;  2VZK B;  2GBJ A;  1C79 A;  5LLI A;  1YIW A;  2D2Q A;  3ZJT A;  3P63 A;  2O6V B;  2BBC A;  3WAO A;  1IGC A;  3T9L A;  4XWW A;  3NUH B;  4L1B A;  4JX1 C;  4BKS D;  1E8Z A;  4US9 A;  1JWA D;  3AU5 A;  1TS4 A;  2INN E;  2CS4 A;  1QOA A;  2N7J A;  1LM8 B;  2M19 A;  1KM7 A;  1BT0 A;  3BYT B;  2LJ5 A;  1KJT A;  2IO1 B;  2WHI A;  4K3C A;  2FE8 A;  4BFR A;  2INP E;  2HTM E;  2C7N B;  4WWN A;  3LB8 C;  4FBJ B;  5KHQ A;  1OQY A;  1I35 A;  4TQ1 A;  1SE9 A;  4N9F 4;  4RCO A;  4WWM A;  1I4Q A;  4G0N B;  3DDC B;  2L1A A;  4JPS A;  2D3B A;  2ZEQ A;  3TIX A;  4K7S A;  1S1Q B;  3ML8 A;  2DLB A;  4OVU A;  3BK2 A;  2QJL A;  4W9J A;  4GDK B;  2NS5 A;  4BKG A;  5HI1 A;  1J7B A;  2FCQ A;  2J4X A;  3AE9 B;  4DHZ B;  2XN9 C;  3PTF C;  2KFK A;  2NCN A;  2XEW A;  3DOW A;  3MTN B;  4C7Z A;  1QQR A;  2Y5P A;  1FXA A;  3FKY A;  3RD2 A;  3AUL A;  3OAW A;  4ZHP A;  3OWE B;  4GMV A;  5J18 A;  5AZF A;  3AH7 A;  4MSQ B;  3B08 A;  3VRA B;  3ZKJ C;  3VTW A;  4AJW A;  3ETR A;  1PGA A;  1Q1O A;  2ZW0 A;  1V6E A;  2ON8 A;  3C19 A;  1TZ1 A;  3JYU A;  2W82 A;  1TT5 B;  4W9K A;  3UQB A;  1IP9 A;  3NS1 A;  1YN5 A;  2WX1 A;  2IYD B;  4DWF A;  2MBB B;  4LNI A;  1EM7 A;  2M0A A;  5IA7 A;  1E90 A;  1CK1 A;  3P1M A;  2CHZ A;  3WAP A;  1J19 A;  4WAF A;  4IUM B;  2D3G A;  3TUO A;  1SE4 A;  4ASW C;  3PHX B;  4ZRP A;  3FC4 A;  4I6N B;  4LCD E;  1YNT E;  3HVZ A;  3IG3 A;  5BMG A;  1XD3 B;  1I4H A;  2BYE A;  2BKR B;  3DHI C;  4K7W A;  4MGK E;  4MH0 E;  4MEM A;  4DBG A;  2CU3 A;  2BW2 A;  1J8C A;  1DOI A;  4OVZ A;  2JPH A;  1JRU A;  4OW0 A; 
#chains in the Genus database with same CATH homology
 4HJK A;  2XBB C;  4MJS A;  5GMV A;  3V61 A;  2L0T A;  2MW5 A;  4GDL A;  5BO4 B;  3WIM A;  1L2N A;  4RMA A;  1WR6 E;  2A5U A;  2HTH A;  4KIK A;  2BF8 B;  2EKE C;  4G50 A;  4NJ7 A;  4ANW A;  3SU8 X;  4FA6 A;  3RZW C;  3T8M A;  2KX3 A;  2NPT A;  1Z5S B;  3PS6 A;  1UZX B;  2L05 A;  4MGZ E;  4PS7 A;  3QWZ B;  4G3X B;  1WRD B;  2ZPY A;  2FCS A;  4RM8 A;  3AU4 A;  3H7S A;  1XQQ A;  2MA9 B;  3VUY A;  2G4D B;  5CHF A;  3ECI A;  3KW5 B;  3Q3F A;  5C1Z A;  3ZO5 B;  4W9H A;  2JWZ A;  2IO2 B;  5L95 C;  4LJP B;  5JH5 C;  1OGW A;  4MEL A;  2GBN A;  1P0R A;  3SDL C;  5LXI B;  3NS8 A;  2L0F A;  5G55 A;  2O6V D;  3OLM D;  3QIJ A;  2KWU B;  3U7D A;  1KLV A;  2IZV B;  1H4R A;  3KUZ A;  3MJW A;  4ZRK A;  3V6C B;  4NAW A;  4NJ6 A;  4BKS A;  4M8N A;  5D2M B;  3V60 A;  3QAR A;  1WGH A;  4M8M A;  3PRE A;  5JZE B;  1NDD A;  2MP2 A;  2K6D B;  5E6O A;  2REX A;  4HLE A;  2JRH A;  2JUO A;  3VTV A;  4JQW C;  3C0R B;  3QC8 B;  3R66 C;  2KX0 A;  2AL3 A;  5J17 A;  1Q0W B;  4GB9 A;  4HK2 A;  2MSE D;  2G3Q B;  3DQV A;  3KVF B;  3NZU A;  3PV1 A;  3BIN A;  4MJS B;  3TBL D;  3GOE A;  1I42 A;  2M4N A;  4GDL B;  1OTR B;  2KO3 A;  4ZDV A;  5D6J B;  3VHT C;  4DHJ B;  2FNJ B;  2N7E A;  2KLC A;  2JRI B;  4I6P A;  2LGX A;  4KIK B;  1Z2M A;  2MLB A;  4GXB A;  3N30 A;  4IW0 A;  4TKN A;  3UQA A;  1E8Y A;  1P1A A;  4WJN A;  2KXJ A;  2NPT B;  2KAN A;  3PLU A;  3NY5 A;  4LJO B;  3IFW B;  1IYF A;  4K81 A;  3ONS A;  1WI0 A;  2DX5 B;  2PEA A;  4CHK A;  4KSL C;  2FUH B;  1WMH B;  3U30 A;  1T0Y A;  5D7G A;  2MBO A;  4TV3 A;  5JHB A;  3DVN U;  4TUU A;  1NI2 A;  2ASQ A;  4JGH B;  2LUE A;  4F7Z A;  3GZN I;  1EUV B;  3M95 A;  2JXX A;  2R2O A;  4W9G A;  1UBQ A;  1EO6 A;  2BKF A;  3ZW3 A;  4II3 B;  3RUL A;  2GBK A;  3VQI A;  1WXA A;  2CR5 A;  3HHM A;  3IVF A;  4ANV A;  2LGY A;  4HXD A;  2DAJ A;  2JY6 A;  5LXH A;  2MWS B;  3PHW B;  4GOC A;  1CMX B;  2O2V A;  2WDT B;  3NOB A;  4WAA A;  3ZTC A;  4AP4 C;  1AAR A;  2ZNV B;  2Z0D B;  2GBM A;  1WXM A;  3WAL A;  2KJR A;  4NQK E;  4P7I A;  2AWT A;  4A20 A;  3EHV A;  4ANX A;  1WH3 A;  3H6N A;  2NBU A;  3CF6 E;  4HWI B;  2ZPN A;  4PYZ A;  4XX5 A;  1WX9 A;  3DPD A;  4HPL B;  2DYO A;  2AYO B;  3VVW B;  2LAS A;  2AEH A;  3APF A;  1A5R A;  2KN5 A;  5C23 A;  1GC7 A;  2LVO A;  5CHW A;  2AL6 A;  3RYT A;  4GU2 A;  1SIF A;  2KJ6 A;  4GN1 A;  3L54 A;  3H9D A;  2N4F A;  2Y5B B;  4W9L A;  1EF1 A;  5E6P A;  2KFJ A;  3DBS A;  5EDS A;  4IWQ A;  2C60 A;  3PRM B;  4AOF A;  4EZJ A;  4HVB A;  3EEC A;  3KUC B;  1YX6 B;  2J0K A;  2HJ8 A;  2L76 A;  4BOS C;  4KZ0 A;  2DYB A;  3OJ3 A;  2KDF B;  2RGF A;  1WYW B;  1Y8R C;  2DEN B;  3CST A;  1V49 A;  3PT2 B;  3TL5 A;  4EKU A;  3HIZ A;  1TBE A;  1RFA A;  2BYF A;  1YQB A;  2O2V B;  3A4S C;  4FJV B;  3PPA A;  3A9J B;  3TJP A;  4TQ0 A;  4HCN B;  1WR1 A;  1YD8 U;  2ZVN A;  3I3T B;  4W9D A;  4DDG D;  2JZ3 B;  2ZJD A;  1ZGU B;  4ICU A;  4E3C A;  3L16 A;  2MBH A;  3R3M A;  2JT4 B;  4HCP B;  4W9F A;  2WYQ A;  3RCZ A;  3RUI B;  3ZVV A;  4BBN F;  3DVG X;  1WMH A;  1WJ4 A;  4YL8 A;  1F9J A;  3PGE A;  3UIO B;  2C5L C;  3JSV B;  5AZH A;  1WGR A;  3CMM B;  4LDT B;  4W9C A;  1R4N I;  1OEY A;  3AI5 A;  4JL9 A;  2N9P C;  2FAZ A;  3NZS A;  4F1S A;  1C1Y B;  4MM3 A;  4KZC A;  2BYV E;  1V9J A;  1X1M A;  4BBN C;  2K25 A;  3HM6 X;  3ZRF A;  2D11 A;  2UWQ A;  3HK0 A;  2DZI A;  2DZM A;  2K1F A;  2DYM A;  2FID A;  2LRW A;  2UYZ B;  2KC1 A;  4KV2 A;  2WWZ A;  3W1S C;  2KLG A;  2J7Q B;  4HPM B;  3VXW A;  1PQS A;  2RPQ A;  3R7Q A;  3ZDT A;  4IM0 A;  1Q5W B;  3ZTD A;  2Z59 B;  4NPN A;  1LFD A;  3A1Q B;  4FN2 A;  4B9K A;  5DPS A;  1EF5 A;  3PLV A;  3PRZ A;  4FAD A;  2CHX A;  1H8C A;  2B3A A;  4FJY A;  1RAX A;  1GUA B;  2LI5 A;  1WZ3 A;  2C7H A;  2IO3 B;  3BY4 B;  3CSF A;  2YLM A;  3AXC A;  5E6N A;  4KDL B;  4CO7 A;  5D94 A;  3ZRC A;  1RLF A;  3EC8 A;  2KHW B;  2DAF A;  3V62 A;  1J0G A;  1WJU A;  3K9P B;  2K6Q A;  3QA8 A;  5HKH A;  3UIP B;  2CHW A;  2WX0 A;  2KQS A;  2BWF A;  1WXV A;  5FR6 A;  1GG3 A;  1M94 A;  2C7M B;  4EOY A;  4WJO A;  1WX7 A;  2KVR A;  3QX1 A;  4X57 B;  4BVU C;  3L13 A;  2M1M A;  4FHK A;  4GGQ A;  2MRP A;  5J2R A;  2IBI B;  2JVC A;  1G6J A;  2GMI C;  3LDZ E;  3VAW A;  1LQB A;  4MSM B;  3JVZ X;  1KOT A;  1YJ1 A;  1V5O A;  1V86 A;  2KTF A;  3DVN V;  3D32 A;  4NNJ B;  2MBQ A;  3DBH I;  4A3O A;  2L7R A;  1R4M I;  2KMA A;  2O6V A;  2V1Y A;  4G11 A;  4BOZ B;  3Q3J A;  2KQ7 A;  3TCA A;  3DVG Y;  2L3Z A;  2LGD A;  3L10 B;  3DBL I;  3A9J A;  3QCA A;  2RR9 A;  2N9E B;  3MHS D;  3WA0 A;  3ZLZ A;  5KHO A;  3QJZ A;  3O65 B;  4FJZ A;  1S3S G;  2N9X A;  5G2N A;  4DK5 A;  5DPT A;  3NHE B;  4FLH A;  1UD7 A;  3SHQ A;  4XZ4 A;  3ZNI D;  3M62 B;  4WWO A;  4XC2 A;  2MQJ A;  3ZIM A;  2LRU A;  2MCN B;  3JSV A;  3UF8 A;  2V4L A;  4DHJ D;  3VUX A;  4PS8 A;  4DHZ E;  3M3J A;  2KNB A;  2A4Z A;  3KYC D;  1E5W A;  2Z0E B;  1U4A A;  1ZKH A;  2KDB A;  3PSE B;  3ZDM C;  4DDI D;  5DPW A;  4MGY E;  1WXS A;  2KK8 A;  2N7D A;  3VTU A;  3VUW A;  3KYD D;  2G4S A;  5CHV C;  1WX8 A;  1IPG A;  2G45 B;  2KDI A;  2KKC A;  1V80 A;  2BWE S;  4KSK C;  1WM2 A;  2EMT A;  2RSU A;  3UGB B;  3K9O B;  2IY1 B;  4GIV A;  5JHA A;  4KVG B;  1VCB A;  2GBJ A;  2NVU I;  2QHO A;  2ZZP B;  3A4R A;  4E71 A;  2IY0 B;  4W9E A;  3X23 A;  5LLI A;  5DCN A;  2R2Q A;  1YIW A;  2D2Q A;  2LZ6 A;  3L08 A;  3JW0 X;  2ZCB A;  2CKH B;  2OOB B;  3A1Q A;  2O6V B;  3L0W B;  4EFO A;  3WAO A;  4NY0 A;  2L8J A;  3T9L A;  4DXA B;  3VFK A;  2J0J A;  4BKS D;  2FIF A;  1E8Z A;  3TMP B;  2KTR A;  3AU5 A;  1YX5 B;  4GDK A;  1TGZ B;  2CS4 A;  3HM3 A;  2K8H A;  1WGY A;  2RD0 A;  2GOW A;  1LM8 B;  4NQL B;  4F8C B;  1E7V A;  4AWJ A;  1MG8 A;  1OEY J;  2M17 A;  2BPS A;  2KWV B;  4B6W A;  4OVV A;  1KM7 A;  1UGM A;  1BT0 A;  2K8B A;  3PRP B;  4GSW A;  2LJ5 A;  1UH6 A;  4BKT A;  1KJT A;  1GJZ A;  1UBI A;  2IO1 B;  2KDE B;  4JLC A;  1WIA A;  2LD9 A;  3H7P A;  4IWP A;  3UIN B;  4BFR A;  2M0X A;  3H1U A;  2KJH B;  2LVQ A;  3IHP C;  2C7N B;  4WWN A;  2HE7 A;  2PE6 B;  2VRR B;  4KDI C;  2LXA A;  3ZNZ B;  1FXT B;  4J6I A;  4ANU A;  4FBJ B;  4II2 B;  1UEL A;  4URK A;  5KHQ A;  1OQY A;  1V81 A;  1I35 A;  3EFU A;  4TQ1 A;  4MGI E;  1SE9 A;  4N9F 4;  2I1K A;  1WGG A;  3U8Z A;  5IAA C;  4G0N B;  3DDC B;  1P9D U;  2D07 B;  5AZG A;  3WAN A;  1ZW7 A;  3W1Y A;  4WJQ A;  2ZEQ A;  3S2A A;  2PPH A;  4K7S A;  3TIX A;  1GC6 A;  1S1Q B;  4EEW A;  3ML8 A;  4PS3 A;  4OVU A;  2MBE A;  2LVP A;  2KTR B;  2OJR A;  4W9J A;  3A33 B;  3L17 A;  2K39 A;  4GDK B;  2NS5 A;  2KZR A;  2XK5 B;  4B95 A;  4BKG A;  3ZNG C;  3QAQ A;  4HDO A;  3KUD B;  2GBR A;  2FCQ A;  2LXC A;  4EZL A;  5AEK B;  1C3T A;  1P98 A;  4FHJ A;  1WY8 A;  4DHZ B;  3PZD A;  3PTF C;  1WFY A;  3A9K B;  3VDZ A;  2KFK A;  2CU1 A;  3V6E B;  2NCN A;  1ISN A;  2XEW A;  3DOW A;  2D10 A;  1XT9 B;  3MTN B;  1LXD A;  4ICV A;  1NBF C;  2PJH A;  3H7P B;  3LJ3 A;  4W9I A;  2JZZ A;  3RD2 A;  4IC7 B;  3AUL A;  1WZ0 A;  2MX2 A;  3OAW A;  1WGD A;  2LWP A;  3N3K B;  4LDT D;  2NR2 A;  2IO0 B;  2N1W A;  2M8S A;  3ZUN A;  4GMV A;  1E7U A;  1WM3 A;  2YVC A;  1WJN A;  2FCM A;  1WF9 A;  5AZF A;  4CYE A;  2DZJ A;  5J18 A;  4MSQ B;  3B08 A;  4ZRJ A;  2N1V A;  1SGH A;  3DCG A;  3ZKJ C;  4IWO A;  3VTW A;  4FUL A;  3QHT A;  4AJW A;  1D3Z A;  1V5T A;  2HD5 B;  3ALB A;  1Q1O A;  4I6L B;  3N32 A;  1V6E A;  1TTN A;  3M63 B;  2KOX A;  1VD2 A;  3B0A A;  2PE9 A;  1TZ1 A;  3RZF A;  1WJ6 A;  3JYU A;  3ZNH B;  3X0W A;  4WWP A;  1QZE A;  1GNU A;  1P3Q U;  2BGF A;  4NAW B;  4W9K A;  5TR5 A;  2DZK A;  2KMC A;  3APC A;  3IBE A;  3QQ8 B;  2J0M A;  4K1R B;  3UQB A;  1WE7 A;  1IP9 A;  2MP2 B;  3OJ4 B;  2C9W B;  2WX1 A;  3APD A;  4EZK A;  2IYD B;  3P2B A;  3RT3 B;  2NBV B;  4DWF A;  3ENE A;  3W1S A;  2MBB B;  2KFK B;  3VH3 B;  5CX3 A;  2FCN A;  2JF5 A;  3R7R A;  5IA7 A;  2V3S A;  2ZVO A;  1E90 A;  3VH4 B;  4ZYN A;  2CHZ A;  2ZNV C;  3WAP A;  4AUQ C;  1J19 A;  1E8W A;  4IM3 A;  2I1J A;  4ZRI A;  4IUM B;  2L00 B;  4K7U A;  2W9N A;  2KWC A;  2D3G A;  4A3P A;  1K8R B;  3WAM A;  4PYU A;  1RRB A;  4ASW C;  3PHX B;  3QK0 A;  5L83 A;  4LCD E;  4I6N B;  4M0W B;  2ZCC A;  3IG3 A;  2DHZ A;  1XD3 B;  2KD0 A;  3SD5 A;  2BYE A;  2BKR B;  4IM2 A;  4K7W A;  1L7Y A;  1V2Y A;  2XK5 A;  3ML9 A;  4IG7 B;  4MH0 E;  4MGK E;  4AJY B;  4MEM A;  4HDQ A;  4DBG A;  4JIO U;  2NBW B;  4WJP A;  4MDK E;  1HE8 A;  2K8C A;  1WE6 A;  2EMS A;  4EUT A;  1J8C A;  4E74 A;  4WQO B;  3KH0 A;  1E8X A;  3DBR I;  2KC2 A;  2JPH A;  4RM9 A;  1JRU A;  3A9K A;  3PVL A;  3B1L X;  5DPR A;  5CTR C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...