1PQSA

Solution structure of the c-terminal opca domain of ycdc24p
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
77
structure length
77
Chain Sequence
SEIFTLLVEKVWNFDDLIMAINSKISNTHNNNISPITKIKYQDEDGDFVVLGSDEDWNVAKEMLAENNEKFLNIRLY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title The solution structure of an N-terminally truncated version of the yeast CDC24p PB1 domain shows a different beta-sheet topology.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Cell cycle
molecule keywords Cell division control protein 24
total genus 15
structure length 77
sequence length 77
ec nomenclature
pdb deposition date 2003-06-19
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 1pqsA00
2CR5A 2N9EB 1WZ3A 4NY0A 3ENEA 3QAQA 1ZGUB 4HWIB 1KJTA 4MJSB 3H6NA 1UZXB 4ZRKA 4DWFA 3ZIMA 3U7DA 3M95A 2GMIC 2CHWA 1K8RB 3KVFB 4NQKE 4WWPA 3KYCD 2R2QA 5E6OA 4ZYNA 4LCDE 4ICVA 2EMSA 2ZZPB 2KXJA 2L8JA 3VQIA 2IO3B 1YIWA 4DHJD 2G4DB 4KIKA 3X23A 2Z59B 5L83A 3DVNU 2V1YA 2BKRB 2KDBA 1RLFA 2HE7A 2JPHA 2GBRA 3PHXB 5J18A 2MQJA 4DHJB 3BY4B 1V5OA 1OGWA 3RZWC 2MWSB 5LLIA 2NVUI 2MP2A 1GUAB 2CU1A 3KYDD 3SU8X 4DDGD 3JVZX 5E6PA 3ZUNA 2C60A 1E8ZA 4DXAB 3NY5A 4GSWA 5KHOA 4FHJA 1LM8B 1E7UA 3L54A 4MGYE 3OJ3A 1WMHB 3VTVA 1D3ZA 2R2OA 1V81A 4LJOB 4EZLA 3I3TB 3KUDB 1E8YA 1XQQA 1YQBA 2NBUA 4G0NB 1WR6E 4PYUA 5DPSA 4F7ZA 5KHQA 1L2NA 3ONSA 3O65B 4J6IA 4MDKE 3V6CB 3HM6X 2L05A 3A33B 1GNUA 1WXMA 2L0TA 3QX1A 2ZJDA 1WYWB 4RMAA 5G2NA 2MBOA 4BKTA 1S3SG 4BKGA 1JRUA 3A1QB 4G50A 2I1KA 1WJ6A 3PRPB 1GC7A 3CSFA 4NQLB 4RM9A 4B9KA 1RRBA 1WM3A 2ZEQA 2DX5B 2KDFB 3QK0A 1TZ1A 1UELA 5DPWA 3A9KA 2GBNA 1Z5SB 4BFRA 4IC7B 3UIPB 2J0KA 3AU5A 2DZIA 3GZNI 3ML9A 2KJ6A 5BO4B 1E90A 2VRRB 1WFYA 3PT2B 1KOTA 3DBRI 1NDDA 3T9LA 4HJKA 3PLUA 2L00B 4FBJB 4IM0A 2RPQA 3PVLA 3TIXA 4HVBA 3Q3JA 4A3PA 2KLGA 1L7YA 2DENB 2NPTB 2N7EA 2LGYA 3JSVA 4MGKE 3V62A 3ZVVA 2EMTA 4MGIE 4EFOA 4MSQB 2CKHB 2M4NA 2IY1B 4NJ7A 3UF8A 2KZRA 3AI5A 2MW5A 4X57B 1EO6A 4MGZE 5EDSA 3ZTCA 2LRUA 2V4LA 3SDLC 2O2VA 1GG3A 4ICUA 3IG3A 3RCZA 1ZKHA 4PS8A 1OEYJ 3ZNGC 1YJ1A 4URKA 2LGXA 2ZPNA 4WJOA 2D10A 2IBIB 3SD5A 2AEHA 3L10B 2JWZA 3U30A 2QHOA 3UINB 2ZNVB 5J2RA 1WGGA 2REXA 4NJ6A 5LXHA 4RM8A 2PE6B 1ZW7A 4KSLC 4OVUA 2WDTB 5D7GA 2D2QA 1ISNA 2O2VB 3NOBA 1TBEA 2AYOB 4NAWA 4JQWC 5DCNA 4AJWA 1WRDB 4M8MA 4MM3A 4XX5A 3WAMA 2OJRA 1V2YA 4IM2A 3ZNID 2ZCBA 4FJZA 2J0JA 3PTFC 3ZTDA 3ZNHB 4I6LB 4KDLB 5IA7A 3DQVA 1E8XA 3V61A 1TTNA 1P9DU 2LD9A 4K81A 1P1AA 1X1MA 2JT4B 3ZKJC 4II3B 2A4ZA 2FIFA 3T8MA 3L13A 4IW0A 3WIMA 5CX3A 1S1QB 4B95A 4WWOA 2AL3A 3LDZE 4CO7A 1IYFA 1H8CA 1WZ0A 3APFA 2FAZA 2LUEA 2WYQA 3A1QA 1GC6A 3QC8B 4GN1A 4GMVA 4M8NA 1KLVA 3DVGY 2KWUB 2IZVB 4YL8A 4MH0E 4JL9A 3VUWA 4AUQC 3WANA 4HCNB 4HK2A 5J17A 3ZO5B 5TR5A 1C3TA 2IO1B 4ZRJA 1WGDA 2C7NB 4MELA 3AU4A 2NPTA 3JSVB 3APCA 4HDQA 4WJPA 2N4FA 3QARA 2KNBA 2MBEA 3ZDTA 2BWES 3UIOB 2NBWB 1WGYA 2N9PC 2FCMA 3L08A 1I42A 2IO2B 2N7DA 3HHMA 4KZ0A 5C23A 4LDTD 4BOSC 2EKEC 3B08A 3QJZA 1SGHA 2LVPA 4F8CB 3NZSA 4LJPB 5JH5C 2BKFA 4IWOA 4ZDVA 2KD0A 1XT9B 1MG8A 1Q5WB 4GXBA 4GDLB 3EFUA 3N3KB 4K7UA 4FADA 2GBMA 3NS8A 2LVOA 4E71A 4W9DA 2N1WA 3TBLD 3CMMB 3AXCA 4FJYA 4EZJA 5HKHA 2KLCA 1OEYA 1UD7A 4ANVA 2Y5BB 2L76A 2KHWB 3H7SA 4IG7B 3ZRCA 3QWZB 3PV1A 2AL6A 1UGMA 2MBQA 2DYMA 3VUXA 2K25A 3ZW3A 1BT0A 3A4RA 1V86A 3H1UA 1M94A 2I1JA 4FLHA 4K1RB 1VCBA 4M0WB 1WH3A 2MRPA 4GU2A 4W9FA 4W9EA 1SIFA 3VAWA 2DYBA 2IYDB 2UYZB 4AWJA 1Q0WB 3DVGX 2C5LC 4FN2A 4BBNF 2GBKA 2M17A 1SE9A 2ZCCA 5AZHA 2XK5B 3IHPC 4IWPA 5D2MB 2KTRA 5AZGA 4ANUA 3TL5A 4AOFA 3IVFA 1WX7A 3DVNV 3DDCB 5AEKB 1LQBA 4BKSA 1C1YB 2BPSA 2LZ6A 4DK5A 4GB9A 4EZKA 4HLEA 2BYVE 2N9XA 1WMHA 2JXXA 5JHAA 3GOEA 3VTWA 2C7HA 4KIKB 1HE8A 2A5UA 2DAJA 4DHZE 3KW5B 2KVRA 1OTRB 2KANA 2KX0A 2DAFA 3W1SC 4BKSD 1H4RA 2KDIA 2DZKA 3Q3FA 4W9HA 2D07B 4K7WA 2JRHA 3OJ4B 2ZPYA 5G55A 3L16A 4CHKA 4WJNA 2JF5A 4ASWC 1V80A 1P0RA 1CMXB 2W9NA 2WWZA 3UQBA 5GMVA 5CHFA 4MJSA 2JZZA 1EF5A 3C0RB 1RAXA 3M63B 2ZNVC 3P2BA 2MBHA 4TV3A 2LVQA 4EOYA 4KVGB 4GIVA 2XBBC 2MLBA 2C9WB 3R7QA 4NNJB 2DZMA 4W9LA 1J19A 1WJNA 2OOBB 4OVVA 4A20A 2PPHA 3EHVA 4W9GA 4AJYB 2XEWA 4E74A 2XK5A 1UH6A 1WR1A 2UWQA 4WWNA 3DOWA 1WIAA 2NBVB 2KMAA 4W9JA 3K9PB 4W9KA 3B1LX 3PS6A 1EUVB 1PQSA 3V6EB 4EKUA 2FIDA 4DHZB 4IUMB 4PS3A 4K7SA 2N1VA 3W1YA 4NAWB 1WI0A 3OLMD 2KFKB 2JVCA 3VDZA 3PHWB 4HDOA 2MCNB 3WALA 4FHKA 2Z0DB 1NBFC 3APDA 4G11A 3WAOA 1R4NI 3QQ8B 3MJWA 3N32A 2CHXA 2NR2A 1I35A 2BYFA 1LFDA 2M1MA 3PGEA 3VH4B 1V6EA 2C7MB 2HD5B 4MEMA 2WX1A 2LASA 1E8WA 2RSUA 1YX5B 4TQ1A 5DPRA 4ZRIA 4EUTA 4HPMB 3VFKA 3QA8A 1WXVA 5IAAC 1AARA 2DYOA 2GOWA 4FA6A 1WJUA 2NS5A 2CS4A 1UBQA 4E3CA 1FXTB 3M3JA 2KJHB 3ZRFA 3DBHI 4HCPB 4ANXA 4II2B 1P98A 3RD2A 2JUOA 2KKCA 3ML8A 2FCQA 2KOXA 2KO3A 3OAWA 4BVUC 2K1FA 2BF8B 3PRMB 3A9JA 4TQ0A 4CYEA 2LGDA 3UGBB 2KDEB 3NZUA 3QHTA 4MSMB 2KC2A 4GDKB 5CHVC 1IPGA 3M62B 2PJHA 2L3ZA 4NPNA 5C1ZA 4KZCA 3QCAA 2MP2B 2LXCA 2KJRA 1F9JA 2MX2A 3DBSA 1E5WA 1WXAA 2IY0B 1TGZB 2K8CA 2HJ8A 1WE7A 4WQOB 1WJ4A 2J7QB 3CSTA 4I6PA 4N9F4 4FJVB 4GGQA 3SHQA 1KM7A 2WX0A 3LJ3A 2O6VB 1Y8RC 2KWVB 2RGFA 3RYTA 3VH3B 3MHSD 3QIJA 4W9IA 2KQSA 3R3MA 4W9CA 4BOZB 1J8CA 2LXAA 2D11A 3H9DA 3VXWA 2DHZA 2PEAA 2MBBB 1WF9A 2BYEA 3HIZA 2JY6A 4JLCA 1OQYA 4KV2A 1NI2A 2NCNA 3RULA 3PRZA 2JZ3B 3CF6E 5CHWA 5FR6A 4HPLB 4IM3A 2ZVOA 1WM2A 3L17A 3V60A 1V9JA 3U8ZA 3UQAA 3DPDA 5JHBA 2GBJA 2G4SA 5DPTA 1A5RA 3K9OB 1EF1A 5D94A 3DBLI 3WA0A 1G6JA 3EECA 2M0XA 4I6NB 2K8HA 5AZFA 3IBEA 4GDKA 3H7PB 3RZFA 1XD3B 3TMPB 4HXDA 3KUZA 3RT3B 4BBNC 2PE9A 4B6WA 4DBGA 3PSEB 1YX6B 2L7RA 3NHEB 2KMCA 5LXIB 2K39A 3AULA 4A3OA 4F1SA 3PZDA 4LDTB 4TUUA 1R4MI 5CTRC 2BGFA 1WX8A 3R66C 1P3QU 2O6VD 4JIOU 1WGRA 2CHZA 3EC8A 2G45B 2KK8A 3MTNB 3H7PA 3VTUA 1T0YA 1V5TA 3VVWB 2AWTA 4ANWA 4DDID 1E7VA 2KX3A 4IWQA 2KFKA 2KC1A 2IO0B 3DCGA 4KDIC 3WAPA 2M8SA 2V3SA 1WE6A 3A9JB 3BINA 4JGHB 2D3GA 2G3QB 2LWPA 2YVCA 2B3AA 2Z0EB 5E6NA 3D32A 3HM3A 3W1SA 3N30A 2K6QA 2LRWA 2KQ7A 3X0WA 1WXSA 2BWFA 3RUIB 1UBIA 2KTFA 2MSED 4GDLA 2K8BA 3VHTC 3A4SC 2FUHB 2L0FA 4PS7A 5JZEB 1QZEA 3VUYA 3JW0X 3PPAA 4P7IA 4XZ4A 4AP4C 3PREA 2K6DB 2RD0A 2RR9A 1U4AA 1J0GA 2ASQA 4EEWA 2JRIB 4XC2A 3S2AA 2J0MA 3TJPA 3KUCB 3ZNZB 2KWCA 4GOCA 2KN5A 5D6JB 1LXDA 2MA9B 2ZVNA 3TCAA 2HTHA 3ECIA 5L95C 4TKNA 2LI5A 2FNJB 3ALBA 1YD8U 2YLMA 1WX9A 2FCNA 3HK0A 3PLVA 3L0WB 4PYZA 4FULA 1WGHA 1Q1OA 3KH0A 3A9KB 3R7RA 1VD2A 1RFAA 3JYUA 2FCSA 3B0AA 4WAAA 4WJQA 3ZDMC 2LJ5A 4KSKC 2KTRB 3ZLZA 1V49A 1GJZA 1Z2MA 2DZJA 2KFJA 3IFWB 4G3XB 2O6VA 1IP9A 1WY8A
chains in the Genus database with same CATH superfamily
4YSZB 1WZ3A 2QC8A 4MJSB 1L4DB 4NQKE 3KYCD 2R2QA 1I4QA 4RF0A 2L8JA 1JWUD 2FE8A 4KIKA 3Q3NC 3DVNU 2BKRB 2KDBA 1RLFA 4H2AA 1Y56A 3W2DA 1OGWA 2K3UA 2NVUI 2KACA 1JCKB 2CU1A 3SU8X 2LHEA 3JVZX 4FHJA 1AN8A 3KWVA 1WMHB 4LJOB 3I3TB 3KUDB 1YQBA 3T3NA 3MC0B 1FNUA 1GNUA 1K53A 3QX1A 4IKGA 2MBOA 1S3SG 2WDQB 2I1KA 2IJ0A 3CSFA 4NQLB 4RGNA 4B9KA 3I63C 3C8YA 3UIPB 3AU5A 2DZIA 2KJ6A 5BO4B 1T6BX 3BK2A 1FEHA 2WXFA 5BYSA 1L7YA 2DENB 3JSVA 2N7EA 1ROEA 4MGKE 1EO6A 3ZTCA 2JYEA 3EFCA 4A9AA 3IG3A 1ACCA 1OEYJ 1C79A 4URKA 3GZNB 4WJOA 3SD5A 4C4VA 3ZJUA 3L10B 1T0RC 2JX5A 1BMLC 1WWTA 5J2RA 4NJ6A 2WDTB 2CU3A 2D2QA 2O2VB 4MACA 2AYOB 4M8MA 2Y5PA 3WAMA 1F0ZA 1L0XB 4R3DA 2SAKA 2M0AA 5BMHA 1A70A 1L6VA 1TTNA 2LD9A 4K81A 1P1AA 2JT4B 1WRIA 3ZKJC 3L13A 4IW0A 4YTPB 1ZUD2 4B95A 1E0ZA 4GMVA 3DVGY 2X8XX 4AUQC 1YQ4B 1CJEA 2IO1B 4RGTA 4ZRJA 3JSVB 4ACFA 3APCA 4WJPA 3QARA 3WCQA 3ZDTA 2BWES 3DBRB 2N9PC 3L08A 2N7DA 4LDTD 4RNAA 4BOSC 2EKEC 4IWOA 1XT9B 1YJJA 1KLUD 5D3IB 2N1WA 2GI9A 2EELA 4EZJA 5HKHA 1LO5D 1UD7A 4ANVA 3E56A 3PV1A 1OQRA 4C80A 1ZOYB 4M0WB 2MRPA 3I5JC 1QF6A 4AWJA 3DVGX 3DBLB 2CJNA 2GBKA 2M17A 1SE9A 1F2RI 3NVYA 1FM0D 3TL5A 3IVFA 1WX7A 3DDCB 1LQBA 2BPSA 2LZ6A 1KRHA 1L0YB 3GOEA 4KIKB 1TS2A 2KX0A 2DAFA 1NEKB 2D07B 3OJ4B 4ASWC 1V80A 1RM6C 1CMXB 3UQBA 1RAXA 4WIPA 3O13A 4NNJB 4RCOA 2DZMA 4LK0M 2FUG1 1EU3A 2XK5A 1HXYD 2N0SB 2KMAA 1YN5A 3B1LX 3PS6A 2DLBA 3V6EB 4KGRA 2B76B 3PHWB 4FHKA 1J7CA 1ZDVA 1VR9A 5HHDG 3QQ8B 3MJWA 3AE9B 2LMCA 5HG2A 1V6EA 3CIRB 1VJKA 1D5MC 2HD5B 3I57A 2KDMA 2RSUA 1N62A 4TQ1A 1GB4A 3QA8A 1DYQA 1AARA 1QT9A 1SEBD 1WJUA 3FILA 4E3CA 2KJHB 1P98A 2XN9C 1SE3A 2KOXA 3V05A 4UDUC 2W55A 1MI0A 3A9JA 1C9FA 4TQ0A 1YOVB 2KC2A 2WU5B 2AQ3B 4RF1A 1I4PA 1D4BA 1D5XC 3QCAA 1SE2A 1R4MB 2OJWA 2AQ1B 2IY0B 3MFGA 5C2TB 1KF6B 5G5HA 4FJVB 4GGQA 3LJ3A 2O6VB 2H88B 1YN3A 4BOZB 3H9DA 2BYEA 4JLCA 2JY6A 2N7JA 3PRZA 4IM3A 1V9JA 3I9V1 2GBJA 1A5RA 3K9OB 2WXLA 3WA0A 1I4RA 1K52A 4I6NB 2K8HA 5AZFA 2L32A 3ZJTA 3DBHB 4KX6B 4BBNC 2PE9A 3Q8BA 1I4XA 1QKZA 1MHHE 2KAJA 3Q14C 2KMCA 4LDTB 5CTRC 2BGFA 2PIAA 1FCLA 2QSDA 1NI3A 2IDYA 3H7PA 1XCQL 3AEGB 4DDID 1E7VA 2BS3B 2W82A 4CQNA 2IO0B 1XLQA 2VZKD 2V3SA 3A9JB 3BINA 4JGHB 4JE3B 1TS5A 4XWTA 5E6NA 3D32A 3RNAC 2J42A 3X0WA 2BWFA 4A8XC 3VHTC 3A4SC 5FKAC 4PS7A 3VUYA 4RFBA 4IOIE 4AP4C 3PREA 4RGMA 2ASQA 2JRIB 3KUCB 4GOCA 4M0WA 2MA9B 2KT7A 3AEBB 5L95C 1SSNA 2LI5A 3U7ZA 2GRIA 3DWMA 1EWYC 1Q1OA 3KH0A 1HA5A 1RFAA 4WAAA 2VZKB 4B0EA 1GJZA 1Z2MA 3IFWB 1XLPA 2O6VA 1TS3A 1EU4A 4US9A 1ZGUB 3BZDB 1UZXB 4ZRKA 4DWFA 3VRBB 3M95A 1N60A 4YSXB 5E6OA 2BT6A 2EMSA 1YIWA 1I4GA 2G4DB 2YEPB 4DHJD 2PLPA 3P4QB 4P6VF 3PHXB 2GBRA 1JWBD 3BY4B 2WXHA 2M19A 1J7AA 4YSYB 1QOBA 2MP2A 3KYDD 3ZUNA 5FK9C 4GSWA 5KHOA 3AH7A 3RNFC 1TZOA 3L54A 2RDHA 1V8CA 2R2OA 1E8YA 1XQQA 5KHQA 4PYUA 3ONSA 4J6IA 3HM6X 3A33B 5G2NA 3NJTA 1WYWB 1ZE3D 4P1BC 4LNNA 4BKTA 3A1QB 4G50A 1B1ZA 1WXQA 2Y3AA 1GC7A 1SBBB 3QK0A 1TZ1A 3EUB2 1T3QA 4HKQA 1L6UA 2WXMA 2J0KA 3NRZA 2V0GA 3ML9A 3P4SB 4USAA 1K51A 1E90A 2VRRB 3URYA 1FRDA 1ET9A 3W5UB 3PVLA 3Q3JA 2KLGA 3AE3B 2BS2B 2LGYA 3V62A 2EMTA 4MSQB 2M4NA 2IY1B 2KZRA 3AI5A 1UWMA 3HVDA 1ESFA 1HTOA 4PS8A 4Q2JA 3ZNGC 1YJ1A 1V1OA 3E9SA 5C3JB 1VZ8A 1RFKA 3C19A 5EE9A 1JALA 2REXA 5LXHA 3AEEB 2BYTA 4KSLC 3LYYA 4L2YA 4S17A 5D7GA 1TBEA 1NYQA 3ZQ4A 3IAS1 2BTEA 4FJZA 1FO4A 5IA7A 2QCZA 1X1MA 3T8MA 3RNCC 3RN9C 4JWUC 4WWOA 2AL3A 2H89B 3LDZE 2LUEA 1GC6A 1F2RC 1GOZA 1C78A 3BYTB 1TKGA 3WANA 4HCNB 1M4VA 1WGDA 4MELA 1PGAA 3NVWA 5BYQA 4C7ZA 1ZXHA 1WGYA 2FCMA 2IO2B 3HHMA 2JSVX 3AM9A 5C23A 4F8CB 3NZSA 5JH5C 2BKFA 3Q3OC 3TUOA 1MG8A 1Q5WB 4K7UA 4FADA 2GBMA 2ONQA 2WXGA 3P1MA 4E71A 3UI3A 3AXCA 4FJYA 1OEYA 2LFIA 3Q3MC 3ZRCA 3QWZB 1UGMA 3GB1A 2K25A 1M94A 4ZRQA 3Q8EA 1WH3A 4N59A 4W9EA 1GPXA 2NTTA 2DYBA 1BUIC 4P16A 4BBNF 3B2FA 5AZHA 2XK5B 4IWPA 4ANUA 2UU7A 5AEKB 3MP9A 1NENB 2PKOA 1TKYA 4DK5A 1PDXA 3TEWA 2BYVE 2N9XA 2JXXA 5JHAA 3VTWA 5MPOA 3MHZA 2A5UA 4DHZE 3KW5B 1YN4A 2KVRA 2L83A 4K3CA 1H4RA 2JRHA 3BIID 4HKZE 4WJNA 2G1EA 5CHFA 2JZZA 3ZXRA 2ZNVC 3P2BA 2LVQA 4KVGB 4GIVA 2XBBC 2MLBA 2C9WB 3R7QA 2WLBA 1XF5L 1TT5B 2OOBB 4A20A 2MJDA 2PPHA 3EHVA 1KFYB 4E74A 1ZXIA 1UH6A 1WYGA 1WIAA 3B9JA 3K9PB 1JMLA 2NTSA 3R8BA 1EM7A 4DHZB 3Q6BA 4PS3A 4K7SA 1BXTA 3SR6A 2JVCA 4NZLB 2PMVA 1FMAD 1STEA 2BYFA 1LFDA 3VH4B 3PO0A 4O1NA 3RFZB 4MEMA 2WX1A 2LASA 1T0QC 4OW0A 1YX5B 4EUTA 2DYOA 2V9HA 2GOWA 4XYCA 3Q2AC 1KH0A 1UBQA 3ZRFA 2OHFA 4MH8A 5HFYA 3N9YC 2D5GA 4ANXA 4II2B 3RD2A 2KKCA 3OAWA 4BVUC 2BB5A 3PRMB 1XLOA 2LGDA 2KDEB 3RPFC 5CHVC 1IPGA 2WNMA 3M62B 1FXIA 4NAMA 1OFFA 4M02A 2K8CA 3GP7A 1J7BA 1CQVA 1YMHE 2HJ8A 4WQOB 2MJ3A 2J7QB 2QJLA 2WU2B 4BAXA 1KM7A 1SB3C 1Y8RC 3VH3B 3RNEC 2MEKA 1AWDA 4MM3B 2D11A 3VXWA 2DHZA 2MBBB 1WF9A 4DXGA 3R2TA 4KV2A 2BW2A 5FR6A 2LGSA 2ZVOA 3U8ZA 3UQAA 4WURA 2G4SA 5DPTA 5D94A 4ZRPA 3EECA 2M0XA 3W9CB 3RZFA 1UGJA 4ZOHC 3U2SC 4HXDA 3KUZA 3RT3B 4B6WA 4DBGA 2IGDA 2L7RA 2VH1A 3AULA 3ABVB 4TUUA 2N9KA 2E6XA 3TSSA 3R66C 1P3QU 2O6VD 2G45B 2MHJA 1T0YA 1V5TA 4ANWA 1F52A 2Q5WD 3DCGA 2IPKD 1QOAA 2M8SA 2D3GA 2LWPA 4JPSA 2B3AA 2Z0EB 2NMQA 4JWSC 2K6QA 2KQ7A 3BVZA 3P4PB 2WXIA 3RUIB 1OQQA 2K8BA 2L0FA 2LHDA 2X38A 5I4DA 5JZEB 1QZEA 3PPAA 2N9LA 2K6DB 2K0PA 3BYYB 4XC2A 3ZGZA 3OWEB 3ZNZB 2KN5A 3TCAA 5TSSA 1V1PB 4TKNA 1JWAD 1YD8U 4PYZA 4FULA 3LXFA 1WGHA 1FNWA 1HTQA 2FCSA 4WJQA 2LJ5A 4KSKC 1JQ4A 3J9CA 2KTRB 1V49A 1IP9A 4G3XB 4US8A 1FFVA 1N63A 2KYWA 3ENEA 2V3PA 2J52A 3QAQA 2EKIA 2WQYB 2QMTA 5H8YE 4YTNB 5IN7A 2CHWA 1K8RB 4WQMA 4WWPA 4WWMA 4WH4A 1VZ6A 2ZZPB 2IO3B 4ARIA 3X23A 2Z59B 5L83A 2HE7A 2JPHA 2MQJA 1I4HA 4ZHPA 1E8ZA 3NY5A 1LM8B 2WS3B 2JXTA 3CWIA 3OJ3A 1SF0A 2J53A 1V81A 4G0NB 2WXJA 1WR6E 4XDCA 1WXMA 2ZJDA 4A6QA 1QOGA 2HJ1A 1WJ6A 3FC4A 4RM9A 2ZEQA 2DX5B 4D2KA 3PZ7A 1UELA 4M01A 1Z5SB 2XNAC 4HRSA 5IOIA 3KLSX 3AMZA 1YQ3B 3PT2B 1KOTA 3DBRI 3T9LA 2L00B 1JROA 4IM0A 4M00A 3TIXA 4HVBA 1FFUA 1SJHD 2JWUA 4A3PA 2WXQA 2YEPF 4NJ7A 3MC8A 3UF8A 2LRUA 2V4LA 1FD6A 2FBWB 2O2VA 1GG3A 4PK1A 2LGXA 3NZ3A 1XO3A 2D10A 2AEHA 1TYGB 3U30A 4YWGG 2ZNVB 4RM8A 2PE6B 5DCNA 4NAWA 4AJWA 1WRDB 4MM3A 4ITKA 4YXDB 4AQ7A 4HJGE 3ZNID 4IDIA 1ZP0B 3PTFC 3ZTDA 3ZNHB 4KDLB 5AUIA 3EA6A 1DGJA 3V61A 3VRAB 2GB1A 1E10A 3ZXVA 4II3B 2A4ZA 1C4CA 2FIFA 4PT5A 5BYRA 1K50A 1S1QB 1H8CA 4CO7A 2Y5CA 3IT4B 4GLSC 4GN1A 1KLVA 4XGAB 4M8NA 1HEZE 2IZVB 3VUWA 4JL9A 3ZO5B 1P7EA 1C3TA 3GE3C 2Z8LA 3AV8A 3AU4A 5IP4D 2PW9A 3DHIC 1EWCA 2NBWB 3AE8B 2V4IB 4TSSA 1L5PA 4KZ0A 3QJZA 3TEXA 4ZDVA 2KD0A 4GXBA 1ZPSA 3EFUA 3N3KB 5LNK1 3NS8A 2LVOA 4W9DA 5BMGA 3TBLD 4DQOC 3CMMB 2Y5BB 2L76A 1VRAB 3RNGC 2AL6A 2DYMA 3ZW3A 1V86A 4K1RB 2K5PA 4GU2A 4W9FA 3SFEB 3VAWA 1FNVA 3BK1A 2C5LC 1C76A 2ZCCA 3IHPC 5D2MB 5AZGA 4RGOS 3P63A 4C7YA 4BKSA 1QLBB 1QQRA 4HLEA 2DBYA 1HE8A 1ET6A 2KANA 3U52E 2W54A 3W1SC 2KDIA 3Q3FA 1IBXA 4K7WA 5G55A 3L16A 2W9NA 2WWZA 1JW9D 4MJSA 1EF5A 3C0RB 3M63B 2MBHA 1MHXA 2V3NA 3RNBC 1WJNA 4OVVA 4AJYB 5T8IA 1WR1A 1YJIA 2NBVB 4W9JA 4MT5A 1TY0A 3AEAB 4EKUA 4IUMB 1XCTL 5IKCM 1NVID 3W1YA 4NAWB 1WI0A 3OLMD 2KFKB 1VLBA 2OEDA 3VDZA 3WALA 1NBFC 3APDA 4G11A 1C4AA 3WAOA 1R4NI 3N32A 2CHXA 2NR2A 1I35A 3PGEA 2M1MA 3Q8AA 1SIJA 2HTME 1I7HA 1V1PA 3N1ZC 5G5GA 1E8WA 5DPRA 4ZRIA 1FRRA 1KLGD 1Q10A 1XXGA 4HPMB 4N58A 2BBCA 1V97A 3VR9B 3P42A 4FA6A 2NS5A 4KKJA 3DBHI 4HCPB 2JU6X 3ML8A 4ARCA 2FCQA 1SE4A 4CYEA 4MSMB 1YNTE 2TSSA 4NPNA 5C1ZA 4KZCA 1MG4A 2LXCA 3NVZA 2QIEB 3TEYA 3R2IA 2MX2A 2BQQA 1E5WA 1WXAA 1TGZB 1E7PB 4LNFA 1WJ4A 3CSTA 1SJED 4I6PA 4N9F4 3SHQA 2RGFA 4W9CA 3QIJA 4W9IA 3R3MA 1J8CA 2L52A 1AYFA 2PEAA 1HZ5A 3HIZA 3TEZA 1OQYA 1NI2A 2NCNA 4A55A 5CHWA 4QAYA 4HPLB 1WM2A 3DPDA 1EF1A 3DBLI 2M56B 1ZDXA 4C00A 4GDKA 4RH6A 1R7SA 4OHJA 1XD3B 3TMPB 4C56C 3AEDB 3PSEB 1YX6B 3NHEB 5LXIB 4XDDA 3AE5B 1PYWD 4JIOU 2CHZA 2KK8A 3VTUA 3VVWB 2AWTA 2KFKA 2KC1A 4KDIC 5FR3A 1MVKA 3WAPA 1WE6A 1C77A 2G3QB 3AE2B 3B2GA 2D3AA 2YVCA 3Q8CA 3W1SA 1UUPA 3GS2A 3HVZA 3N30A 2LRWA 4NJCA 1UBIA 2KTFA 2MSED 4GDLA 2JQRB 2FUHB 4L23A 2J4XA 3NVVA 2IGGA 2HDEA 1C4PA 2RD0A 4XWWA 5EE3A 5H92C 4L1BA 1XEEA 4EEWA 3S2AA 3TJPA 2KWCA 2ZVNA 2INNE 2LJIA 2WXNA 2HTHA 3ECIA 1QOFA 4OZAA 4S0RA 3PLVA 2YLMA 1WX9A 2CJOA 4XE0A 2K22A 3W5VB 1MPEA 1VD2A 3JYUA 5IO9A 3B0AA 3ZDMC 1N5XA 1N6ZA 1FPYA 4ZHOA 4KGTA 2CR5A 2N9EB 4NY0A 2QDFA 4HWIB 1KJTA 4OVZA 1F1HA 2JYTA 3H6NA 3ZIMA 3U7DA 3RI7C 2GMIC 1MFWA 3BWUD 3KVFB 1NYRA 2BVCA 4ZYNA 3AE6B 4LCDE 2AQ2B 2RPVA 4ICVA 2KXJA 3VQIA 2V1YA 5J18A 4DHJB 1V5OA 3MC9A 3RZWC 2MWSB 5LLIA 1GUAB 4A90A 4DDGD 5E6PA 2C60A 4DXAB 1E7UA 2RDGA 4MGYE 1AW7A 3VTVA 1D3ZA 4YTMB 4EZLA 2NBUA 5DPSA 1ENFA 4K3BA 3O65B 4MDKE 3V6CB 2L05A 2L0TA 2JZPA 4RMAA 4HROA 4BKGA 2BS4B 1JRUA 1IGDA 3PRPB 3NG0A 1RRBA 1WGKA 1WM3A 2KDFB 2AX5A 5DPWA 3SFDB 1RWSA 3A9KA 2GBNA 4BFRA 4IC7B 2ACZB 3GZNI 1WFYA 3LB8C 5JXVA 3T3OA 1NDDA 4FBJB 4HJKA 3PLUA 2RPQA 2NPTB 1JRPA 3ZVVA 4MGIE 4EFOA 2CKHB 3SEBA 2MW5A 4X57B 4MGZE 5EDSA 1D6EC 2KN4A 1GAQB 3SDLC 4C4VB 4ICUA 1JWMD 3RCZA 1ZKHA 2ZPNA 3FKYA 1PFDA 2IBIB 3ZYYX 2JWZA 1FIQA 2QHOA 3UINB 1UWXA 3L4PA 1WGGA 1ZW7A 4OVUA 2DNFA 2VH2A 1ISNA 1DOXA 3HRDD 3NOBA 2LEKA 4JQWC 2LUMA 4XX5A 2OJRA 1V2YA 4IM2A 2ZCBA 2J0JA 1E9MA 2RMMA 4I6LB 3DQVA 1E8XA 3IXSA 1P9DU 4N6EB 1FXAA 3BVMA 1PGBA 2SEBD 3WIMA 5CX3A 2PVGC 1IYFA 1WZ0A 3APFA 2FAZA 2WYQA 3A1QA 3QC8B 2KWUB 1CZPA 5BMIA 5GXGB 4YL8A 3DHHC 4MH0E 4EE2A 2KMMA 4HK2A 5J17A 5TR5A 4KGSA 2C7NB 1JWSD 2NPTA 3V3XA 4HDQA 1TJEA 2N4FA 2KNBA 2MH7A 2MBEA 2W3SA 2E3TA 2W3RA 1HQRD 3UIOB 5EE1A 1GB1A 1I42A 3B08A 1SGHA 2LVPA 4LJPB 2INCC 3GE8C 1LGRA 4GDLB 1WSPA 2IGHA 2KLCA 1VZ7A 1IBXB 2KHWB 3H7SA 4IG7B 2K9XA 2MBQA 3VUXA 1BT0A 3A4RA 1PGXA 3H1UA 2I1JA 4FLHA 4DXFA 1VCBA 2LGIA 1SIFA 4FXCA 2IYDB 2UYZB 2KVZA 3RMKC 1Q0WB 5D3DA 1HZ6A 4FN2A 4OZCA 2WDVB 1IGCA 2KTRA 1QILA 4AOFA 4OZBA 3DVNV 2ON8A 1C1YB 3AEFB 1VDVA 4GB9A 4EZKA 1WMHA 3AE1B 4LNKA 2BB6A 2C7HA 1FCCC 2DAJA 1OTRB 1IUEA 4BKSD 2DZKA 4W9HA 4CHKA 2ZPYA 4TMAB 2JF5A 2I2YA 4REZA 1P0RA 3NUHB 5GMVA 4BZAA 3HUIA 3AECB 2MJEA 3PZ8A 4TV3A 4EOYA 2G9HD 2QEJC 3IT6B 1T5XD 4W9LA 1J19A 4W9GA 2XEWA 2I38A 4LNOA 1F77A 2UWQA 4WWNA 3DOWA 3AB5A 4W9KA 4LTUA 1EUVB 1PQSA 2WXOA 4KKIA 2FIDA 3N1XC 4P1CC 4WAFA 2N1VA 4ZYSA 2PVOD 1P7FA 4HDOA 2MCNB 2Z0DB 2D3BA 2WXPA 1MJDA 1D5ZC 1N61A 2C7MB 2DWQA 5HI1A 3FILB 5AUKA 3VFKA 1E6EB 1UNSA 1WXVA 3MJ5A 5IAAC 3KWLA 2CS4A 1FXTB 3M3JA 3DHGC 2JUOA 2KO3A 2K1FA 2GLSA 2BF8B 1KTKA 3UGBB 3NZUA 3QHTA 4GDKB 2PJHA 3OG5A 2L3ZA 2D3CA 4LLGM 3P4RB 2MP2B 3H8HA 2KJRA 2ICIA 1F9JA 2WGSA 3DBSA 3U4EG 2KWDA 1WE7A 3Q8FA 1TS4A 2WX0A 3RYTA 2KWVB 3MHSD 2KQSA 2LXAA 3IAM1 3NS1A 3VR8B 3RULA 2JZ3B 3CF6E 3V60A 3L17A 2WHIA 1SXTA 5JHBA 1CK1A 2KQ4X 1T0SC 2QILA 2ZW1A 1G6JA 1TY2A 3AE4B 2INDC 1DOIA 4YT0B 1R4NB 3IBEA 3ZJVA 3AE7B 3H7PB 3DWGC 4HEA1 5E6JA 1N5WA 2K39A 3N20C 4A3OA 4F1SA 3PZDA 4HPPA 1R4MI 4AS1A 3N1YC 1WX8A 2PTLA 1WGRA 2L1AA 2WDRB 3EC8A 3MTNB 2KX3A 4IWQA 3EGRA 3KQ4A 1RYJA 2R61A 2ZW0A 1TKEA 3HM3A 2INPE 3FAHA 4LNIA 1WXSA 1UF0A 1XLNA 2WXRA 3BVGA 1PUTA 2WXKA 3JW0X 4P7IA 4XZ4A 2RR9A 4JX1C 1U4AA 1J0GA 2J0MA 1L4ZB 5D6JB 1LXDA 3Q69A 4J3OD 2RDBC 1DOYA 2FNJB 3ALBA 2FCNA 3HK0A 3ETRA 3L0WB 1L0VB 4B0MA 3A9KB 3AN1A 3R7RA 1B9RA 2WP9B 5EE0A 3ZLZA 2DZJA 2KFJA 4F7ZA 1L2NA 1TIFA 1WY8A
chains in the Genus database with same CATH topology
2CR5A 2N9EB 1WZ3A 4NY0A 3ENEA 3QAQA 1ZGUB 4HWIB 1KJTA 4MJSB 3H6NA 1UZXB 4ZRKA 4DWFA 3ZIMA 3U7DA 3M95A 2GMIC 2CHWA 1K8RB 3KVFB 4NQKE 4WWPA 3KYCD 2R2QA 5E6OA 4ZYNA 4LCDE 4ICVA 2EMSA 2ZZPB 2KXJA 2L8JA 3VQIA 2IO3B 1YIWA 4DHJD 2G4DB 4KIKA 3X23A 2Z59B 5L83A 3DVNU 2V1YA 2BKRB 2KDBA 1RLFA 2HE7A 2JPHA 2GBRA 3PHXB 5J18A 2MQJA 4DHJB 3BY4B 1V5OA 1OGWA 3RZWC 2MWSB 5LLIA 2NVUI 2MP2A 1GUAB 2CU1A 3KYDD 3SU8X 4DDGD 3JVZX 5E6PA 3ZUNA 2C60A 1E8ZA 4DXAB 3NY5A 4GSWA 5KHOA 4FHJA 1LM8B 1E7UA 3L54A 4MGYE 3OJ3A 1WMHB 3VTVA 1D3ZA 2R2OA 1V81A 4LJOB 4EZLA 3I3TB 3KUDB 1E8YA 1XQQA 1YQBA 2NBUA 4G0NB 1WR6E 4PYUA 5DPSA 4F7ZA 5KHQA 1L2NA 3ONSA 3O65B 4J6IA 4MDKE 3V6CB 3HM6X 2L05A 3A33B 1GNUA 1WXMA 2L0TA 3QX1A 2ZJDA 1WYWB 4RMAA 5G2NA 2MBOA 4BKTA 1S3SG 4BKGA 1JRUA 3A1QB 4G50A 2I1KA 1WJ6A 3PRPB 1GC7A 3CSFA 4NQLB 4RM9A 4B9KA 1RRBA 1WM3A 2ZEQA 2DX5B 2KDFB 3QK0A 1TZ1A 1UELA 5DPWA 3A9KA 2GBNA 1Z5SB 4BFRA 4IC7B 3UIPB 2J0KA 3AU5A 2DZIA 3GZNI 3ML9A 2KJ6A 5BO4B 1E90A 2VRRB 1WFYA 3PT2B 1KOTA 3DBRI 1NDDA 3T9LA 4HJKA 3PLUA 2L00B 4FBJB 4IM0A 2RPQA 3PVLA 3TIXA 4HVBA 3Q3JA 4A3PA 2KLGA 1L7YA 2DENB 2NPTB 2N7EA 2LGYA 3JSVA 4MGKE 3V62A 3ZVVA 2EMTA 4MGIE 4EFOA 4MSQB 2CKHB 2M4NA 2IY1B 4NJ7A 3UF8A 2KZRA 3AI5A 2MW5A 4X57B 1EO6A 4MGZE 5EDSA 3ZTCA 2LRUA 2V4LA 3SDLC 2O2VA 1GG3A 4ICUA 3IG3A 3RCZA 1ZKHA 4PS8A 1OEYJ 3ZNGC 1YJ1A 4URKA 2LGXA 2ZPNA 4WJOA 2D10A 2IBIB 3SD5A 2AEHA 3L10B 2JWZA 3U30A 2QHOA 3UINB 2ZNVB 5J2RA 1WGGA 2REXA 4NJ6A 5LXHA 4RM8A 2PE6B 1ZW7A 4KSLC 4OVUA 2WDTB 5D7GA 2D2QA 1ISNA 2O2VB 3NOBA 1TBEA 2AYOB 4NAWA 4JQWC 5DCNA 4AJWA 1WRDB 4M8MA 4MM3A 4XX5A 3WAMA 2OJRA 1V2YA 4IM2A 3ZNID 2ZCBA 4FJZA 2J0JA 3PTFC 3ZTDA 3ZNHB 4I6LB 4KDLB 5IA7A 3DQVA 1E8XA 3V61A 1TTNA 1P9DU 2LD9A 4K81A 1P1AA 1X1MA 2JT4B 3ZKJC 4II3B 2A4ZA 2FIFA 3T8MA 3L13A 4IW0A 3WIMA 5CX3A 1S1QB 4B95A 4WWOA 2AL3A 3LDZE 4CO7A 1IYFA 1H8CA 1WZ0A 3APFA 2FAZA 2LUEA 2WYQA 3A1QA 1GC6A 3QC8B 4GN1A 4GMVA 4M8NA 1KLVA 3DVGY 2KWUB 2IZVB 4YL8A 4MH0E 4JL9A 3VUWA 4AUQC 3WANA 4HCNB 4HK2A 5J17A 3ZO5B 5TR5A 1C3TA 2IO1B 4ZRJA 1WGDA 2C7NB 4MELA 3AU4A 2NPTA 3JSVB 3APCA 4HDQA 4WJPA 2N4FA 3QARA 2KNBA 2MBEA 3ZDTA 2BWES 3UIOB 2NBWB 1WGYA 2N9PC 2FCMA 3L08A 1I42A 2IO2B 2N7DA 3HHMA 4KZ0A 5C23A 4LDTD 4BOSC 2EKEC 3B08A 3QJZA 1SGHA 2LVPA 4F8CB 3NZSA 4LJPB 5JH5C 2BKFA 4IWOA 4ZDVA 2KD0A 1XT9B 1MG8A 1Q5WB 4GXBA 4GDLB 3EFUA 3N3KB 4K7UA 4FADA 2GBMA 3NS8A 2LVOA 4E71A 4W9DA 2N1WA 3TBLD 3CMMB 3AXCA 4FJYA 4EZJA 5HKHA 2KLCA 1OEYA 1UD7A 4ANVA 2Y5BB 2L76A 2KHWB 3H7SA 4IG7B 3ZRCA 3QWZB 3PV1A 2AL6A 1UGMA 2MBQA 2DYMA 3VUXA 2K25A 3ZW3A 1BT0A 3A4RA 1V86A 3H1UA 1M94A 2I1JA 4FLHA 4K1RB 1VCBA 4M0WB 1WH3A 2MRPA 4GU2A 4W9FA 4W9EA 1SIFA 3VAWA 2DYBA 2IYDB 2UYZB 4AWJA 1Q0WB 3DVGX 2C5LC 4FN2A 4BBNF 2GBKA 2M17A 1SE9A 2ZCCA 5AZHA 2XK5B 3IHPC 4IWPA 5D2MB 2KTRA 5AZGA 4ANUA 3TL5A 4AOFA 3IVFA 1WX7A 3DVNV 3DDCB 5AEKB 1LQBA 4BKSA 1C1YB 2BPSA 2LZ6A 4DK5A 4GB9A 4EZKA 4HLEA 2BYVE 2N9XA 1WMHA 2JXXA 5JHAA 3GOEA 3VTWA 2C7HA 4KIKB 1HE8A 2A5UA 2DAJA 4DHZE 3KW5B 2KVRA 1OTRB 2KANA 2KX0A 2DAFA 3W1SC 4BKSD 1H4RA 2KDIA 2DZKA 3Q3FA 4W9HA 2D07B 4K7WA 2JRHA 3OJ4B 2ZPYA 5G55A 3L16A 4CHKA 4WJNA 2JF5A 4ASWC 1V80A 1P0RA 1CMXB 2W9NA 2WWZA 3UQBA 5GMVA 5CHFA 4MJSA 2JZZA 1EF5A 3C0RB 1RAXA 3M63B 2ZNVC 3P2BA 2MBHA 4TV3A 2LVQA 4EOYA 4KVGB 4GIVA 2XBBC 2MLBA 2C9WB 3R7QA 4NNJB 2DZMA 4W9LA 1J19A 1WJNA 2OOBB 4OVVA 4A20A 2PPHA 3EHVA 4W9GA 4AJYB 2XEWA 4E74A 2XK5A 1UH6A 1WR1A 2UWQA 4WWNA 3DOWA 1WIAA 2NBVB 2KMAA 4W9JA 3K9PB 4W9KA 3B1LX 3PS6A 1EUVB 1PQSA 3V6EB 4EKUA 2FIDA 4DHZB 4IUMB 4PS3A 4K7SA 2N1VA 3W1YA 4NAWB 1WI0A 3OLMD 2KFKB 2JVCA 3VDZA 3PHWB 4HDOA 2MCNB 3WALA 4FHKA 2Z0DB 1NBFC 3APDA 4G11A 3WAOA 1R4NI 3QQ8B 3MJWA 3N32A 2CHXA 2NR2A 1I35A 2BYFA 1LFDA 2M1MA 3PGEA 3VH4B 1V6EA 2C7MB 2HD5B 4MEMA 2WX1A 2LASA 1E8WA 2RSUA 1YX5B 4TQ1A 5DPRA 4ZRIA 4EUTA 4HPMB 3VFKA 3QA8A 1WXVA 5IAAC 1AARA 2DYOA 2GOWA 4FA6A 1WJUA 2NS5A 2CS4A 1UBQA 4E3CA 1FXTB 3M3JA 2KJHB 3ZRFA 3DBHI 4HCPB 4ANXA 4II2B 1P98A 3RD2A 2JUOA 2KKCA 3ML8A 2FCQA 2KOXA 2KO3A 3OAWA 4BVUC 2K1FA 2BF8B 3PRMB 3A9JA 4TQ0A 4CYEA 2LGDA 3UGBB 2KDEB 3NZUA 3QHTA 4MSMB 2KC2A 4GDKB 5CHVC 1IPGA 3M62B 2PJHA 2L3ZA 4NPNA 5C1ZA 4KZCA 3QCAA 2MP2B 2LXCA 2KJRA 1F9JA 2MX2A 3DBSA 1E5WA 1WXAA 2IY0B 1TGZB 2K8CA 2HJ8A 1WE7A 4WQOB 1WJ4A 2J7QB 3CSTA 4I6PA 4N9F4 4FJVB 4GGQA 3SHQA 1KM7A 2WX0A 3LJ3A 2O6VB 1Y8RC 2KWVB 2RGFA 3RYTA 3VH3B 3MHSD 3QIJA 4W9IA 2KQSA 3R3MA 4W9CA 4BOZB 1J8CA 2LXAA 2D11A 3H9DA 3VXWA 2DHZA 2PEAA 2MBBB 1WF9A 2BYEA 3HIZA 2JY6A 4JLCA 1OQYA 4KV2A 1NI2A 2NCNA 3RULA 3PRZA 2JZ3B 3CF6E 5CHWA 5FR6A 4HPLB 4IM3A 2ZVOA 1WM2A 3L17A 3V60A 1V9JA 3U8ZA 3UQAA 3DPDA 5JHBA 2GBJA 2G4SA 5DPTA 1A5RA 3K9OB 1EF1A 5D94A 3DBLI 3WA0A 1G6JA 3EECA 2M0XA 4I6NB 2K8HA 5AZFA 3IBEA 4GDKA 3H7PB 3RZFA 1XD3B 3TMPB 4HXDA 3KUZA 3RT3B 4BBNC 2PE9A 4B6WA 4DBGA 3PSEB 1YX6B 2L7RA 3NHEB 2KMCA 5LXIB 2K39A 3AULA 4A3OA 4F1SA 3PZDA 4LDTB 4TUUA 1R4MI 5CTRC 2BGFA 1WX8A 3R66C 1P3QU 2O6VD 4JIOU 1WGRA 2CHZA 3EC8A 2G45B 2KK8A 3MTNB 3H7PA 3VTUA 1T0YA 1V5TA 3VVWB 2AWTA 4ANWA 4DDID 1E7VA 2KX3A 4IWQA 2KFKA 2KC1A 2IO0B 3DCGA 4KDIC 3WAPA 2M8SA 2V3SA 1WE6A 3A9JB 3BINA 4JGHB 2D3GA 2G3QB 2LWPA 2YVCA 2B3AA 2Z0EB 5E6NA 3D32A 3HM3A 3W1SA 3N30A 2K6QA 2LRWA 2KQ7A 3X0WA 1WXSA 2BWFA 3RUIB 1UBIA 2KTFA 2MSED 4GDLA 2K8BA 3VHTC 3A4SC 2FUHB 2L0FA 4PS7A 5JZEB 1QZEA 3VUYA 3JW0X 3PPAA 4P7IA 4XZ4A 4AP4C 3PREA 2K6DB 2RD0A 2RR9A 1U4AA 1J0GA 2ASQA 4EEWA 2JRIB 4XC2A 3S2AA 2J0MA 3TJPA 3KUCB 3ZNZB 2KWCA 4GOCA 2KN5A 5D6JB 1LXDA 2MA9B 2ZVNA 3TCAA 2HTHA 3ECIA 5L95C 4TKNA 2LI5A 2FNJB 3ALBA 1YD8U 2YLMA 1WX9A 2FCNA 3HK0A 3PLVA 3L0WB 4PYZA 4FULA 1WGHA 1Q1OA 3KH0A 3A9KB 3R7RA 1VD2A 1RFAA 3JYUA 2FCSA 3B0AA 4WAAA 4WJQA 3ZDMC 2LJ5A 4KSKC 2KTRB 3ZLZA 1V49A 1GJZA 1Z2MA 2DZJA 2KFJA 3IFWB 4G3XB 2O6VA 1IP9A 1WY8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2CR5 A;  2N9E B;  1WZ3 A;  4NY0 A;  3ENE A;  3QAQ A;  1ZGU B;  4HWI B;  1KJT A;  4MJS B;  3H6N A;  1UZX B;  4ZRK A;  4DWF A;  3ZIM A;  3U7D A;  3M95 A;  2GMI C;  2CHW A;  1K8R B;  3KVF B;  4NQK E;  4WWP A;  3KYC D;  2R2Q A;  5E6O A;  4ZYN A;  4LCD E;  4ICV A;  2EMS A;  2ZZP B;  2KXJ A;  2L8J A;  3VQI A;  2IO3 B;  1YIW A;  4DHJ D;  2G4D B;  4KIK A;  3X23 A;  2Z59 B;  5L83 A;  3DVN U;  2V1Y A;  2BKR B;  2KDB A;  1RLF A;  2HE7 A;  2JPH A;  2GBR A;  3PHX B;  5J18 A;  2MQJ A;  4DHJ B;  3BY4 B;  1V5O A;  1OGW A;  3RZW C;  2MWS B;  5LLI A;  2NVU I;  2MP2 A;  1GUA B;  2CU1 A;  3KYD D;  3SU8 X;  4DDG D;  3JVZ X;  5E6P A;  3ZUN A;  2C60 A;  1E8Z A;  4DXA B;  3NY5 A;  4GSW A;  5KHO A;  4FHJ A;  1LM8 B;  1E7U A;  3L54 A;  4MGY E;  3OJ3 A;  1WMH B;  3VTV A;  1D3Z A;  2R2O A;  1V81 A;  4LJO B;  4EZL A;  3I3T B;  3KUD B;  1E8Y A;  1XQQ A;  1YQB A;  2NBU A;  4G0N B;  1WR6 E;  4PYU A;  5DPS A;  4F7Z A;  5KHQ A;  1L2N A;  3ONS A;  3O65 B;  4J6I A;  4MDK E;  3V6C B;  3HM6 X;  2L05 A;  3A33 B;  1GNU A;  1WXM A;  2L0T A;  3QX1 A;  2ZJD A;  1WYW B;  4RMA A;  5G2N A;  2MBO A;  4BKT A;  1S3S G;  4BKG A;  1JRU A;  3A1Q B;  4G50 A;  2I1K A;  1WJ6 A;  3PRP B;  1GC7 A;  3CSF A;  4NQL B;  4RM9 A;  4B9K A;  1RRB A;  1WM3 A;  2ZEQ A;  2DX5 B;  2KDF B;  3QK0 A;  1TZ1 A;  1UEL A;  5DPW A;  3A9K A;  2GBN A;  1Z5S B;  4BFR A;  4IC7 B;  3UIP B;  2J0K A;  3AU5 A;  2DZI A;  3GZN I;  3ML9 A;  2KJ6 A;  5BO4 B;  1E90 A;  2VRR B;  1WFY A;  3PT2 B;  1KOT A;  3DBR I;  1NDD A;  3T9L A;  4HJK A;  3PLU A;  2L00 B;  4FBJ B;  4IM0 A;  2RPQ A;  3PVL A;  3TIX A;  4HVB A;  3Q3J A;  4A3P A;  2KLG A;  1L7Y A;  2DEN B;  2NPT B;  2N7E A;  2LGY A;  3JSV A;  4MGK E;  3V62 A;  3ZVV A;  2EMT A;  4MGI E;  4EFO A;  4MSQ B;  2CKH B;  2M4N A;  2IY1 B;  4NJ7 A;  3UF8 A;  2KZR A;  3AI5 A;  2MW5 A;  4X57 B;  1EO6 A;  4MGZ E;  5EDS A;  3ZTC A;  2LRU A;  2V4L A;  3SDL C;  2O2V A;  1GG3 A;  4ICU A;  3IG3 A;  3RCZ A;  1ZKH A;  4PS8 A;  1OEY J;  3ZNG C;  1YJ1 A;  4URK A;  2LGX A;  2ZPN A;  4WJO A;  2D10 A;  2IBI B;  3SD5 A;  2AEH A;  3L10 B;  2JWZ A;  3U30 A;  2QHO A;  3UIN B;  2ZNV B;  5J2R A;  1WGG A;  2REX A;  4NJ6 A;  5LXH A;  4RM8 A;  2PE6 B;  1ZW7 A;  4KSL C;  4OVU A;  2WDT B;  5D7G A;  2D2Q A;  1ISN A;  2O2V B;  3NOB A;  1TBE A;  2AYO B;  4NAW A;  4JQW C;  5DCN A;  4AJW A;  1WRD B;  4M8M A;  4MM3 A;  4XX5 A;  3WAM A;  2OJR A;  1V2Y A;  4IM2 A;  3ZNI D;  2ZCB A;  4FJZ A;  2J0J A;  3PTF C;  3ZTD A;  3ZNH B;  4I6L B;  4KDL B;  5IA7 A;  3DQV A;  1E8X A;  3V61 A;  1TTN A;  1P9D U;  2LD9 A;  4K81 A;  1P1A A;  1X1M A;  2JT4 B;  3ZKJ C;  4II3 B;  2A4Z A;  2FIF A;  3T8M A;  3L13 A;  4IW0 A;  3WIM A;  5CX3 A;  1S1Q B;  4B95 A;  4WWO A;  2AL3 A;  3LDZ E;  4CO7 A;  1IYF A;  1H8C A;  1WZ0 A;  3APF A;  2FAZ A;  2LUE A;  2WYQ A;  3A1Q A;  1GC6 A;  3QC8 B;  4GN1 A;  4GMV A;  4M8N A;  1KLV A;  3DVG Y;  2KWU B;  2IZV B;  4YL8 A;  4MH0 E;  4JL9 A;  3VUW A;  4AUQ C;  3WAN A;  4HCN B;  4HK2 A;  5J17 A;  3ZO5 B;  5TR5 A;  1C3T A;  2IO1 B;  4ZRJ A;  1WGD A;  2C7N B;  4MEL A;  3AU4 A;  2NPT A;  3JSV B;  3APC A;  4HDQ A;  4WJP A;  2N4F A;  3QAR A;  2KNB A;  2MBE A;  3ZDT A;  2BWE S;  3UIO B;  2NBW B;  1WGY A;  2N9P C;  2FCM A;  3L08 A;  1I42 A;  2IO2 B;  2N7D A;  3HHM A;  4KZ0 A;  5C23 A;  4LDT D;  4BOS C;  2EKE C;  3B08 A;  3QJZ A;  1SGH A;  2LVP A;  4F8C B;  3NZS A;  4LJP B;  5JH5 C;  2BKF A;  4IWO A;  4ZDV A;  2KD0 A;  1XT9 B;  1MG8 A;  1Q5W B;  4GXB A;  4GDL B;  3EFU A;  3N3K B;  4K7U A;  4FAD A;  2GBM A;  3NS8 A;  2LVO A;  4E71 A;  4W9D A;  2N1W A;  3TBL D;  3CMM B;  3AXC A;  4FJY A;  4EZJ A;  5HKH A;  2KLC A;  1OEY A;  1UD7 A;  4ANV A;  2Y5B B;  2L76 A;  2KHW B;  3H7S A;  4IG7 B;  3ZRC A;  3QWZ B;  3PV1 A;  2AL6 A;  1UGM A;  2MBQ A;  2DYM A;  3VUX A;  2K25 A;  3ZW3 A;  1BT0 A;  3A4R A;  1V86 A;  3H1U A;  1M94 A;  2I1J A;  4FLH A;  4K1R B;  1VCB A;  4M0W B;  1WH3 A;  2MRP A;  4GU2 A;  4W9F A;  4W9E A;  1SIF A;  3VAW A;  2DYB A;  2IYD B;  2UYZ B;  4AWJ A;  1Q0W B;  3DVG X;  2C5L C;  4FN2 A;  4BBN F;  2GBK A;  2M17 A;  1SE9 A;  2ZCC A;  5AZH A;  2XK5 B;  3IHP C;  4IWP A;  5D2M B;  2KTR A;  5AZG A;  4ANU A;  3TL5 A;  4AOF A;  3IVF A;  1WX7 A;  3DVN V;  3DDC B;  5AEK B;  1LQB A;  4BKS A;  1C1Y B;  2BPS A;  2LZ6 A;  4DK5 A;  4GB9 A;  4EZK A;  4HLE A;  2BYV E;  2N9X A;  1WMH A;  2JXX A;  5JHA A;  3GOE A;  3VTW A;  2C7H A;  4KIK B;  1HE8 A;  2A5U A;  2DAJ A;  4DHZ E;  3KW5 B;  2KVR A;  1OTR B;  2KAN A;  2KX0 A;  2DAF A;  3W1S C;  4BKS D;  1H4R A;  2KDI A;  2DZK A;  3Q3F A;  4W9H A;  2D07 B;  4K7W A;  2JRH A;  3OJ4 B;  2ZPY A;  5G55 A;  3L16 A;  4CHK A;  4WJN A;  2JF5 A;  4ASW C;  1V80 A;  1P0R A;  1CMX B;  2W9N A;  2WWZ A;  3UQB A;  5GMV A;  5CHF A;  4MJS A;  2JZZ A;  1EF5 A;  3C0R B;  1RAX A;  3M63 B;  2ZNV C;  3P2B A;  2MBH A;  4TV3 A;  2LVQ A;  4EOY A;  4KVG B;  4GIV A;  2XBB C;  2MLB A;  2C9W B;  3R7Q A;  4NNJ B;  2DZM A;  4W9L A;  1J19 A;  1WJN A;  2OOB B;  4OVV A;  4A20 A;  2PPH A;  3EHV A;  4W9G A;  4AJY B;  2XEW A;  4E74 A;  2XK5 A;  1UH6 A;  1WR1 A;  2UWQ A;  4WWN A;  3DOW A;  1WIA A;  2NBV B;  2KMA A;  4W9J A;  3K9P B;  4W9K A;  3B1L X;  3PS6 A;  1EUV B;  1PQS A;  3V6E B;  4EKU A;  2FID A;  4DHZ B;  4IUM B;  4PS3 A;  4K7S A;  2N1V A;  3W1Y A;  4NAW B;  1WI0 A;  3OLM D;  2KFK B;  2JVC A;  3VDZ A;  3PHW B;  4HDO A;  2MCN B;  3WAL A;  4FHK A;  2Z0D B;  1NBF C;  3APD A;  4G11 A;  3WAO A;  1R4N I;  3QQ8 B;  3MJW A;  3N32 A;  2CHX A;  2NR2 A;  1I35 A;  2BYF A;  1LFD A;  2M1M A;  3PGE A;  3VH4 B;  1V6E A;  2C7M B;  2HD5 B;  4MEM A;  2WX1 A;  2LAS A;  1E8W A;  2RSU A;  1YX5 B;  4TQ1 A;  5DPR A;  4ZRI A;  4EUT A;  4HPM B;  3VFK A;  3QA8 A;  1WXV A;  5IAA C;  1AAR A;  2DYO A;  2GOW A;  4FA6 A;  1WJU A;  2NS5 A;  2CS4 A;  1UBQ A;  4E3C A;  1FXT B;  3M3J A;  2KJH B;  3ZRF A;  3DBH I;  4HCP B;  4ANX A;  4II2 B;  1P98 A;  3RD2 A;  2JUO A;  2KKC A;  3ML8 A;  2FCQ A;  2KOX A;  2KO3 A;  3OAW A;  4BVU C;  2K1F A;  2BF8 B;  3PRM B;  3A9J A;  4TQ0 A;  4CYE A;  2LGD A;  3UGB B;  2KDE B;  3NZU A;  3QHT A;  4MSM B;  2KC2 A;  4GDK B;  5CHV C;  1IPG A;  3M62 B;  2PJH A;  2L3Z A;  4NPN A;  5C1Z A;  4KZC A;  3QCA A;  2MP2 B;  2LXC A;  2KJR A;  1F9J A;  2MX2 A;  3DBS A;  1E5W A;  1WXA A;  2IY0 B;  1TGZ B;  2K8C A;  2HJ8 A;  1WE7 A;  4WQO B;  1WJ4 A;  2J7Q B;  3CST A;  4I6P A;  4N9F 4;  4FJV B;  4GGQ A;  3SHQ A;  1KM7 A;  2WX0 A;  3LJ3 A;  2O6V B;  1Y8R C;  2KWV B;  2RGF A;  3RYT A;  3VH3 B;  3MHS D;  3QIJ A;  4W9I A;  2KQS A;  3R3M A;  4W9C A;  4BOZ B;  1J8C A;  2LXA A;  2D11 A;  3H9D A;  3VXW A;  2DHZ A;  2PEA A;  2MBB B;  1WF9 A;  2BYE A;  3HIZ A;  2JY6 A;  4JLC A;  1OQY A;  4KV2 A;  1NI2 A;  2NCN A;  3RUL A;  3PRZ A;  2JZ3 B;  3CF6 E;  5CHW A;  5FR6 A;  4HPL B;  4IM3 A;  2ZVO A;  1WM2 A;  3L17 A;  3V60 A;  1V9J A;  3U8Z A;  3UQA A;  3DPD A;  5JHB A;  2GBJ A;  2G4S A;  5DPT A;  1A5R A;  3K9O B;  1EF1 A;  5D94 A;  3DBL I;  3WA0 A;  1G6J A;  3EEC A;  2M0X A;  4I6N B;  2K8H A;  5AZF A;  3IBE A;  4GDK A;  3H7P B;  3RZF A;  1XD3 B;  3TMP B;  4HXD A;  3KUZ A;  3RT3 B;  4BBN C;  2PE9 A;  4B6W A;  4DBG A;  3PSE B;  1YX6 B;  2L7R A;  3NHE B;  2KMC A;  5LXI B;  2K39 A;  3AUL A;  4A3O A;  4F1S A;  3PZD A;  4LDT B;  4TUU A;  1R4M I;  5CTR C;  2BGF A;  1WX8 A;  3R66 C;  1P3Q U;  2O6V D;  4JIO U;  1WGR A;  2CHZ A;  3EC8 A;  2G45 B;  2KK8 A;  3MTN B;  3H7P A;  3VTU A;  1T0Y A;  1V5T A;  3VVW B;  2AWT A;  4ANW A;  4DDI D;  1E7V A;  2KX3 A;  4IWQ A;  2KFK A;  2KC1 A;  2IO0 B;  3DCG A;  4KDI C;  3WAP A;  2M8S A;  2V3S A;  1WE6 A;  3A9J B;  3BIN A;  4JGH B;  2D3G A;  2G3Q B;  2LWP A;  2YVC A;  2B3A A;  2Z0E B;  5E6N A;  3D32 A;  3HM3 A;  3W1S A;  3N30 A;  2K6Q A;  2LRW A;  2KQ7 A;  3X0W A;  1WXS A;  2BWF A;  3RUI B;  1UBI A;  2KTF A;  2MSE D;  4GDL A;  2K8B A;  3VHT C;  3A4S C;  2FUH B;  2L0F A;  4PS7 A;  5JZE B;  1QZE A;  3VUY A;  3JW0 X;  3PPA A;  4P7I A;  4XZ4 A;  4AP4 C;  3PRE A;  2K6D B;  2RD0 A;  2RR9 A;  1U4A A;  1J0G A;  2ASQ A;  4EEW A;  2JRI B;  4XC2 A;  3S2A A;  2J0M A;  3TJP A;  3KUC B;  3ZNZ B;  2KWC A;  4GOC A;  2KN5 A;  5D6J B;  1LXD A;  2MA9 B;  2ZVN A;  3TCA A;  2HTH A;  3ECI A;  5L95 C;  4TKN A;  2LI5 A;  2FNJ B;  3ALB A;  1YD8 U;  2YLM A;  1WX9 A;  2FCN A;  3HK0 A;  3PLV A;  3L0W B;  4PYZ A;  4FUL A;  1WGH A;  1Q1O A;  3KH0 A;  3A9K B;  3R7R A;  1VD2 A;  1RFA A;  3JYU A;  2FCS A;  3B0A A;  4WAA A;  4WJQ A;  3ZDM C;  2LJ5 A;  4KSK C;  2KTR B;  3ZLZ A;  1V49 A;  1GJZ A;  1Z2M A;  2DZJ A;  2KFJ A;  3IFW B;  4G3X B;  2O6V A;  1IP9 A;  1WY8 A; 
#chains in the Genus database with same CATH topology
 4YSZ B;  1WZ3 A;  2QC8 A;  4MJS B;  1L4D B;  4NQK E;  3KYC D;  2R2Q A;  1I4Q A;  4RF0 A;  2L8J A;  1JWU D;  2FE8 A;  4KIK A;  3Q3N C;  3DVN U;  2BKR B;  2KDB A;  1RLF A;  4H2A A;  1Y56 A;  3W2D A;  1OGW A;  2K3U A;  2NVU I;  2KAC A;  1JCK B;  2CU1 A;  3SU8 X;  2LHE A;  3JVZ X;  4FHJ A;  1AN8 A;  3KWV A;  1WMH B;  4LJO B;  3I3T B;  3KUD B;  1YQB A;  3T3N A;  3MC0 B;  1FNU A;  1GNU A;  1K53 A;  3QX1 A;  4IKG A;  2MBO A;  1S3S G;  2WDQ B;  2I1K A;  2IJ0 A;  3CSF A;  4NQL B;  4RGN A;  4B9K A;  3I63 C;  3C8Y A;  3UIP B;  3AU5 A;  2DZI A;  2KJ6 A;  5BO4 B;  1T6B X;  3BK2 A;  1FEH A;  2WXF A;  5BYS A;  1L7Y A;  2DEN B;  3JSV A;  2N7E A;  1ROE A;  4MGK E;  1EO6 A;  3ZTC A;  2JYE A;  3EFC A;  4A9A A;  3IG3 A;  1ACC A;  1OEY J;  1C79 A;  4URK A;  3GZN B;  4WJO A;  3SD5 A;  4C4V A;  3ZJU A;  3L10 B;  1T0R C;  2JX5 A;  1BML C;  1WWT A;  5J2R A;  4NJ6 A;  2WDT B;  2CU3 A;  2D2Q A;  2O2V B;  4MAC A;  2AYO B;  4M8M A;  2Y5P A;  3WAM A;  1F0Z A;  1L0X B;  4R3D A;  2SAK A;  2M0A A;  5BMH A;  1A70 A;  1L6V A;  1TTN A;  2LD9 A;  4K81 A;  1P1A A;  2JT4 B;  1WRI A;  3ZKJ C;  3L13 A;  4IW0 A;  4YTP B;  1ZUD 2;  4B95 A;  1E0Z A;  4GMV A;  3DVG Y;  2X8X X;  4AUQ C;  1YQ4 B;  1CJE A;  2IO1 B;  4RGT A;  4ZRJ A;  3JSV B;  4ACF A;  3APC A;  4WJP A;  3QAR A;  3WCQ A;  3ZDT A;  2BWE S;  3DBR B;  2N9P C;  3L08 A;  2N7D A;  4LDT D;  4RNA A;  4BOS C;  2EKE C;  4IWO A;  1XT9 B;  1YJJ A;  1KLU D;  5D3I B;  2N1W A;  2GI9 A;  2EEL A;  4EZJ A;  5HKH A;  1LO5 D;  1UD7 A;  4ANV A;  3E56 A;  3PV1 A;  1OQR A;  4C80 A;  1ZOY B;  4M0W B;  2MRP A;  3I5J C;  1QF6 A;  4AWJ A;  3DVG X;  3DBL B;  2CJN A;  2GBK A;  2M17 A;  1SE9 A;  1F2R I;  3NVY A;  1FM0 D;  3TL5 A;  3IVF A;  1WX7 A;  3DDC B;  1LQB A;  2BPS A;  2LZ6 A;  1KRH A;  1L0Y B;  3GOE A;  4KIK B;  1TS2 A;  2KX0 A;  2DAF A;  1NEK B;  2D07 B;  3OJ4 B;  4ASW C;  1V80 A;  1RM6 C;  1CMX B;  3UQB A;  1RAX A;  4WIP A;  3O13 A;  4NNJ B;  4RCO A;  2DZM A;  4LK0 M;  2FUG 1;  1EU3 A;  2XK5 A;  1HXY D;  2N0S B;  2KMA A;  1YN5 A;  3B1L X;  3PS6 A;  2DLB A;  3V6E B;  4KGR A;  2B76 B;  3PHW B;  4FHK A;  1J7C A;  1ZDV A;  1VR9 A;  5HHD G;  3QQ8 B;  3MJW A;  3AE9 B;  2LMC A;  5HG2 A;  1V6E A;  3CIR B;  1VJK A;  1D5M C;  2HD5 B;  3I57 A;  2KDM A;  2RSU A;  1N62 A;  4TQ1 A;  1GB4 A;  3QA8 A;  1DYQ A;  1AAR A;  1QT9 A;  1SEB D;  1WJU A;  3FIL A;  4E3C A;  2KJH B;  1P98 A;  2XN9 C;  1SE3 A;  2KOX A;  3V05 A;  4UDU C;  2W55 A;  1MI0 A;  3A9J A;  1C9F A;  4TQ0 A;  1YOV B;  2KC2 A;  2WU5 B;  2AQ3 B;  4RF1 A;  1I4P A;  1D4B A;  1D5X C;  3QCA A;  1SE2 A;  1R4M B;  2OJW A;  2AQ1 B;  2IY0 B;  3MFG A;  5C2T B;  1KF6 B;  5G5H A;  4FJV B;  4GGQ A;  3LJ3 A;  2O6V B;  2H88 B;  1YN3 A;  4BOZ B;  3H9D A;  2BYE A;  4JLC A;  2JY6 A;  2N7J A;  3PRZ A;  4IM3 A;  1V9J A;  3I9V 1;  2GBJ A;  1A5R A;  3K9O B;  2WXL A;  3WA0 A;  1I4R A;  1K52 A;  4I6N B;  2K8H A;  5AZF A;  2L32 A;  3ZJT A;  3DBH B;  4KX6 B;  4BBN C;  2PE9 A;  3Q8B A;  1I4X A;  1QKZ A;  1MHH E;  2KAJ A;  3Q14 C;  2KMC A;  4LDT B;  5CTR C;  2BGF A;  2PIA A;  1FCL A;  2QSD A;  1NI3 A;  2IDY A;  3H7P A;  1XCQ L;  3AEG B;  4DDI D;  1E7V A;  2BS3 B;  2W82 A;  4CQN A;  2IO0 B;  1XLQ A;  2VZK D;  2V3S A;  3A9J B;  3BIN A;  4JGH B;  4JE3 B;  1TS5 A;  4XWT A;  5E6N A;  3D32 A;  3RNA C;  2J42 A;  3X0W A;  2BWF A;  4A8X C;  3VHT C;  3A4S C;  5FKA C;  4PS7 A;  3VUY A;  4RFB A;  4IOI E;  4AP4 C;  3PRE A;  4RGM A;  2ASQ A;  2JRI B;  3KUC B;  4GOC A;  4M0W A;  2MA9 B;  2KT7 A;  3AEB B;  5L95 C;  1SSN A;  2LI5 A;  3U7Z A;  2GRI A;  3DWM A;  1EWY C;  1Q1O A;  3KH0 A;  1HA5 A;  1RFA A;  4WAA A;  2VZK B;  4B0E A;  1GJZ A;  1Z2M A;  3IFW B;  1XLP A;  2O6V A;  1TS3 A;  1EU4 A;  4US9 A;  1ZGU B;  3BZD B;  1UZX B;  4ZRK A;  4DWF A;  3VRB B;  3M95 A;  1N60 A;  4YSX B;  5E6O A;  2BT6 A;  2EMS A;  1YIW A;  1I4G A;  2G4D B;  2YEP B;  4DHJ D;  2PLP A;  3P4Q B;  4P6V F;  3PHX B;  2GBR A;  1JWB D;  3BY4 B;  2WXH A;  2M19 A;  1J7A A;  4YSY B;  1QOB A;  2MP2 A;  3KYD D;  3ZUN A;  5FK9 C;  4GSW A;  5KHO A;  3AH7 A;  3RNF C;  1TZO A;  3L54 A;  2RDH A;  1V8C A;  2R2O A;  1E8Y A;  1XQQ A;  5KHQ A;  4PYU A;  3ONS A;  4J6I A;  3HM6 X;  3A33 B;  5G2N A;  3NJT A;  1WYW B;  1ZE3 D;  4P1B C;  4LNN A;  4BKT A;  3A1Q B;  4G50 A;  1B1Z A;  1WXQ A;  2Y3A A;  1GC7 A;  1SBB B;  3QK0 A;  1TZ1 A;  3EUB 2;  1T3Q A;  4HKQ A;  1L6U A;  2WXM A;  2J0K A;  3NRZ A;  2V0G A;  3ML9 A;  3P4S B;  4USA A;  1K51 A;  1E90 A;  2VRR B;  3URY A;  1FRD A;  1ET9 A;  3W5U B;  3PVL A;  3Q3J A;  2KLG A;  3AE3 B;  2BS2 B;  2LGY A;  3V62 A;  2EMT A;  4MSQ B;  2M4N A;  2IY1 B;  2KZR A;  3AI5 A;  1UWM A;  3HVD A;  1ESF A;  1HTO A;  4PS8 A;  4Q2J A;  3ZNG C;  1YJ1 A;  1V1O A;  3E9S A;  5C3J B;  1VZ8 A;  1RFK A;  3C19 A;  5EE9 A;  1JAL A;  2REX A;  5LXH A;  3AEE B;  2BYT A;  4KSL C;  3LYY A;  4L2Y A;  4S17 A;  5D7G A;  1TBE A;  1NYQ A;  3ZQ4 A;  3IAS 1;  2BTE A;  4FJZ A;  1FO4 A;  5IA7 A;  2QCZ A;  1X1M A;  3T8M A;  3RNC C;  3RN9 C;  4JWU C;  4WWO A;  2AL3 A;  2H89 B;  3LDZ E;  2LUE A;  1GC6 A;  1F2R C;  1GOZ A;  1C78 A;  3BYT B;  1TKG A;  3WAN A;  4HCN B;  1M4V A;  1WGD A;  4MEL A;  1PGA A;  3NVW A;  5BYQ A;  4C7Z A;  1ZXH A;  1WGY A;  2FCM A;  2IO2 B;  3HHM A;  2JSV X;  3AM9 A;  5C23 A;  4F8C B;  3NZS A;  5JH5 C;  2BKF A;  3Q3O C;  3TUO A;  1MG8 A;  1Q5W B;  4K7U A;  4FAD A;  2GBM A;  2ONQ A;  2WXG A;  3P1M A;  4E71 A;  3UI3 A;  3AXC A;  4FJY A;  1OEY A;  2LFI A;  3Q3M C;  3ZRC A;  3QWZ B;  1UGM A;  3GB1 A;  2K25 A;  1M94 A;  4ZRQ A;  3Q8E A;  1WH3 A;  4N59 A;  4W9E A;  1GPX A;  2NTT A;  2DYB A;  1BUI C;  4P16 A;  4BBN F;  3B2F A;  5AZH A;  2XK5 B;  4IWP A;  4ANU A;  2UU7 A;  5AEK B;  3MP9 A;  1NEN B;  2PKO A;  1TKY A;  4DK5 A;  1PDX A;  3TEW A;  2BYV E;  2N9X A;  2JXX A;  5JHA A;  3VTW A;  5MPO A;  3MHZ A;  2A5U A;  4DHZ E;  3KW5 B;  1YN4 A;  2KVR A;  2L83 A;  4K3C A;  1H4R A;  2JRH A;  3BII D;  4HKZ E;  4WJN A;  2G1E A;  5CHF A;  2JZZ A;  3ZXR A;  2ZNV C;  3P2B A;  2LVQ A;  4KVG B;  4GIV A;  2XBB C;  2MLB A;  2C9W B;  3R7Q A;  2WLB A;  1XF5 L;  1TT5 B;  2OOB B;  4A20 A;  2MJD A;  2PPH A;  3EHV A;  1KFY B;  4E74 A;  1ZXI A;  1UH6 A;  1WYG A;  1WIA A;  3B9J A;  3K9P B;  1JML A;  2NTS A;  3R8B A;  1EM7 A;  4DHZ B;  3Q6B A;  4PS3 A;  4K7S A;  1BXT A;  3SR6 A;  2JVC A;  4NZL B;  2PMV A;  1FMA D;  1STE A;  2BYF A;  1LFD A;  3VH4 B;  3PO0 A;  4O1N A;  3RFZ B;  4MEM A;  2WX1 A;  2LAS A;  1T0Q C;  4OW0 A;  1YX5 B;  4EUT A;  2DYO A;  2V9H A;  2GOW A;  4XYC A;  3Q2A C;  1KH0 A;  1UBQ A;  3ZRF A;  2OHF A;  4MH8 A;  5HFY A;  3N9Y C;  2D5G A;  4ANX A;  4II2 B;  3RD2 A;  2KKC A;  3OAW A;  4BVU C;  2BB5 A;  3PRM B;  1XLO A;  2LGD A;  2KDE B;  3RPF C;  5CHV C;  1IPG A;  2WNM A;  3M62 B;  1FXI A;  4NAM A;  1OFF A;  4M02 A;  2K8C A;  3GP7 A;  1J7B A;  1CQV A;  1YMH E;  2HJ8 A;  4WQO B;  2MJ3 A;  2J7Q B;  2QJL A;  2WU2 B;  4BAX A;  1KM7 A;  1SB3 C;  1Y8R C;  3VH3 B;  3RNE C;  2MEK A;  1AWD A;  4MM3 B;  2D11 A;  3VXW A;  2DHZ A;  2MBB B;  1WF9 A;  4DXG A;  3R2T A;  4KV2 A;  2BW2 A;  5FR6 A;  2LGS A;  2ZVO A;  3U8Z A;  3UQA A;  4WUR A;  2G4S A;  5DPT A;  5D94 A;  4ZRP A;  3EEC A;  2M0X A;  3W9C B;  3RZF A;  1UGJ A;  4ZOH C;  3U2S C;  4HXD A;  3KUZ A;  3RT3 B;  4B6W A;  4DBG A;  2IGD A;  2L7R A;  2VH1 A;  3AUL A;  3ABV B;  4TUU A;  2N9K A;  2E6X A;  3TSS A;  3R66 C;  1P3Q U;  2O6V D;  2G45 B;  2MHJ A;  1T0Y A;  1V5T A;  4ANW A;  1F52 A;  2Q5W D;  3DCG A;  2IPK D;  1QOA A;  2M8S A;  2D3G A;  2LWP A;  4JPS A;  2B3A A;  2Z0E B;  2NMQ A;  4JWS C;  2K6Q A;  2KQ7 A;  3BVZ A;  3P4P B;  2WXI A;  3RUI B;  1OQQ A;  2K8B A;  2L0F A;  2LHD A;  2X38 A;  5I4D A;  5JZE B;  1QZE A;  3PPA A;  2N9L A;  2K6D B;  2K0P A;  3BYY B;  4XC2 A;  3ZGZ A;  3OWE B;  3ZNZ B;  2KN5 A;  3TCA A;  5TSS A;  1V1P B;  4TKN A;  1JWA D;  1YD8 U;  4PYZ A;  4FUL A;  3LXF A;  1WGH A;  1FNW A;  1HTQ A;  2FCS A;  4WJQ A;  2LJ5 A;  4KSK C;  1JQ4 A;  3J9C A;  2KTR B;  1V49 A;  1IP9 A;  4G3X B;  4US8 A;  1FFV A;  1N63 A;  2KYW A;  3ENE A;  2V3P A;  2J52 A;  3QAQ A;  2EKI A;  2WQY B;  2QMT A;  5H8Y E;  4YTN B;  5IN7 A;  2CHW A;  1K8R B;  4WQM A;  4WWP A;  4WWM A;  4WH4 A;  1VZ6 A;  2ZZP B;  2IO3 B;  4ARI A;  3X23 A;  2Z59 B;  5L83 A;  2HE7 A;  2JPH A;  2MQJ A;  1I4H A;  4ZHP A;  1E8Z A;  3NY5 A;  1LM8 B;  2WS3 B;  2JXT A;  3CWI A;  3OJ3 A;  1SF0 A;  2J53 A;  1V81 A;  4G0N B;  2WXJ A;  1WR6 E;  4XDC A;  1WXM A;  2ZJD A;  4A6Q A;  1QOG A;  2HJ1 A;  1WJ6 A;  3FC4 A;  4RM9 A;  2ZEQ A;  2DX5 B;  4D2K A;  3PZ7 A;  1UEL A;  4M01 A;  1Z5S B;  2XNA C;  4HRS A;  5IOI A;  3KLS X;  3AMZ A;  1YQ3 B;  3PT2 B;  1KOT A;  3DBR I;  3T9L A;  2L00 B;  1JRO A;  4IM0 A;  4M00 A;  3TIX A;  4HVB A;  1FFU A;  1SJH D;  2JWU A;  4A3P A;  2WXQ A;  2YEP F;  4NJ7 A;  3MC8 A;  3UF8 A;  2LRU A;  2V4L A;  1FD6 A;  2FBW B;  2O2V A;  1GG3 A;  4PK1 A;  2LGX A;  3NZ3 A;  1XO3 A;  2D10 A;  2AEH A;  1TYG B;  3U30 A;  4YWG G;  2ZNV B;  4RM8 A;  2PE6 B;  5DCN A;  4NAW A;  4AJW A;  1WRD B;  4MM3 A;  4ITK A;  4YXD B;  4AQ7 A;  4HJG E;  3ZNI D;  4IDI A;  1ZP0 B;  3PTF C;  3ZTD A;  3ZNH B;  4KDL B;  5AUI A;  3EA6 A;  1DGJ A;  3V61 A;  3VRA B;  2GB1 A;  1E10 A;  3ZXV A;  4II3 B;  2A4Z A;  1C4C A;  2FIF A;  4PT5 A;  5BYR A;  1K50 A;  1S1Q B;  1H8C A;  4CO7 A;  2Y5C A;  3IT4 B;  4GLS C;  4GN1 A;  1KLV A;  4XGA B;  4M8N A;  1HEZ E;  2IZV B;  3VUW A;  4JL9 A;  3ZO5 B;  1P7E A;  1C3T A;  3GE3 C;  2Z8L A;  3AV8 A;  3AU4 A;  5IP4 D;  2PW9 A;  3DHI C;  1EWC A;  2NBW B;  3AE8 B;  2V4I B;  4TSS A;  1L5P A;  4KZ0 A;  3QJZ A;  3TEX A;  4ZDV A;  2KD0 A;  4GXB A;  1ZPS A;  3EFU A;  3N3K B;  5LNK 1;  3NS8 A;  2LVO A;  4W9D A;  5BMG A;  3TBL D;  4DQO C;  3CMM B;  2Y5B B;  2L76 A;  1VRA B;  3RNG C;  2AL6 A;  2DYM A;  3ZW3 A;  1V86 A;  4K1R B;  2K5P A;  4GU2 A;  4W9F A;  3SFE B;  3VAW A;  1FNV A;  3BK1 A;  2C5L C;  1C76 A;  2ZCC A;  3IHP C;  5D2M B;  5AZG A;  4RGO S;  3P63 A;  4C7Y A;  4BKS A;  1QLB B;  1QQR A;  4HLE A;  2DBY A;  1HE8 A;  1ET6 A;  2KAN A;  3U52 E;  2W54 A;  3W1S C;  2KDI A;  3Q3F A;  1IBX A;  4K7W A;  5G55 A;  3L16 A;  2W9N A;  2WWZ A;  1JW9 D;  4MJS A;  1EF5 A;  3C0R B;  3M63 B;  2MBH A;  1MHX A;  2V3N A;  3RNB C;  1WJN A;  4OVV A;  4AJY B;  5T8I A;  1WR1 A;  1YJI A;  2NBV B;  4W9J A;  4MT5 A;  1TY0 A;  3AEA B;  4EKU A;  4IUM B;  1XCT L;  5IKC M;  1NVI D;  3W1Y A;  4NAW B;  1WI0 A;  3OLM D;  2KFK B;  1VLB A;  2OED A;  3VDZ A;  3WAL A;  1NBF C;  3APD A;  4G11 A;  1C4A A;  3WAO A;  1R4N I;  3N32 A;  2CHX A;  2NR2 A;  1I35 A;  3PGE A;  2M1M A;  3Q8A A;  1SIJ A;  2HTM E;  1I7H A;  1V1P A;  3N1Z C;  5G5G A;  1E8W A;  5DPR A;  4ZRI A;  1FRR A;  1KLG D;  1Q10 A;  1XXG A;  4HPM B;  4N58 A;  2BBC A;  1V97 A;  3VR9 B;  3P42 A;  4FA6 A;  2NS5 A;  4KKJ A;  3DBH I;  4HCP B;  2JU6 X;  3ML8 A;  4ARC A;  2FCQ A;  1SE4 A;  4CYE A;  4MSM B;  1YNT E;  2TSS A;  4NPN A;  5C1Z A;  4KZC A;  1MG4 A;  2LXC A;  3NVZ A;  2QIE B;  3TEY A;  3R2I A;  2MX2 A;  2BQQ A;  1E5W A;  1WXA A;  1TGZ B;  1E7P B;  4LNF A;  1WJ4 A;  3CST A;  1SJE D;  4I6P A;  4N9F 4;  3SHQ A;  2RGF A;  4W9C A;  3QIJ A;  4W9I A;  3R3M A;  1J8C A;  2L52 A;  1AYF A;  2PEA A;  1HZ5 A;  3HIZ A;  3TEZ A;  1OQY A;  1NI2 A;  2NCN A;  4A55 A;  5CHW A;  4QAY A;  4HPL B;  1WM2 A;  3DPD A;  1EF1 A;  3DBL I;  2M56 B;  1ZDX A;  4C00 A;  4GDK A;  4RH6 A;  1R7S A;  4OHJ A;  1XD3 B;  3TMP B;  4C56 C;  3AED B;  3PSE B;  1YX6 B;  3NHE B;  5LXI B;  4XDD A;  3AE5 B;  1PYW D;  4JIO U;  2CHZ A;  2KK8 A;  3VTU A;  3VVW B;  2AWT A;  2KFK A;  2KC1 A;  4KDI C;  5FR3 A;  1MVK A;  3WAP A;  1WE6 A;  1C77 A;  2G3Q B;  3AE2 B;  3B2G A;  2D3A A;  2YVC A;  3Q8C A;  3W1S A;  1UUP A;  3GS2 A;  3HVZ A;  3N30 A;  2LRW A;  4NJC A;  1UBI A;  2KTF A;  2MSE D;  4GDL A;  2JQR B;  2FUH B;  4L23 A;  2J4X A;  3NVV A;  2IGG A;  2HDE A;  1C4P A;  2RD0 A;  4XWW A;  5EE3 A;  5H92 C;  4L1B A;  1XEE A;  4EEW A;  3S2A A;  3TJP A;  2KWC A;  2ZVN A;  2INN E;  2LJI A;  2WXN A;  2HTH A;  3ECI A;  1QOF A;  4OZA A;  4S0R A;  3PLV A;  2YLM A;  1WX9 A;  2CJO A;  4XE0 A;  2K22 A;  3W5V B;  1MPE A;  1VD2 A;  3JYU A;  5IO9 A;  3B0A A;  3ZDM C;  1N5X A;  1N6Z A;  1FPY A;  4ZHO A;  4KGT A;  2CR5 A;  2N9E B;  4NY0 A;  2QDF A;  4HWI B;  1KJT A;  4OVZ A;  1F1H A;  2JYT A;  3H6N A;  3ZIM A;  3U7D A;  3RI7 C;  2GMI C;  1MFW A;  3BWU D;  3KVF B;  1NYR A;  2BVC A;  4ZYN A;  3AE6 B;  4LCD E;  2AQ2 B;  2RPV A;  4ICV A;  2KXJ A;  3VQI A;  2V1Y A;  5J18 A;  4DHJ B;  1V5O A;  3MC9 A;  3RZW C;  2MWS B;  5LLI A;  1GUA B;  4A90 A;  4DDG D;  5E6P A;  2C60 A;  4DXA B;  1E7U A;  2RDG A;  4MGY E;  1AW7 A;  3VTV A;  1D3Z A;  4YTM B;  4EZL A;  2NBU A;  5DPS A;  1ENF A;  4K3B A;  3O65 B;  4MDK E;  3V6C B;  2L05 A;  2L0T A;  2JZP A;  4RMA A;  4HRO A;  4BKG A;  2BS4 B;  1JRU A;  1IGD A;  3PRP B;  3NG0 A;  1RRB A;  1WGK A;  1WM3 A;  2KDF B;  2AX5 A;  5DPW A;  3SFD B;  1RWS A;  3A9K A;  2GBN A;  4BFR A;  4IC7 B;  2ACZ B;  3GZN I;  1WFY A;  3LB8 C;  5JXV A;  3T3O A;  1NDD A;  4FBJ B;  4HJK A;  3PLU A;  2RPQ A;  2NPT B;  1JRP A;  3ZVV A;  4MGI E;  4EFO A;  2CKH B;  3SEB A;  2MW5 A;  4X57 B;  4MGZ E;  5EDS A;  1D6E C;  2KN4 A;  1GAQ B;  3SDL C;  4C4V B;  4ICU A;  1JWM D;  3RCZ A;  1ZKH A;  2ZPN A;  3FKY A;  1PFD A;  2IBI B;  3ZYY X;  2JWZ A;  1FIQ A;  2QHO A;  3UIN B;  1UWX A;  3L4P A;  1WGG A;  1ZW7 A;  4OVU A;  2DNF A;  2VH2 A;  1ISN A;  1DOX A;  3HRD D;  3NOB A;  2LEK A;  4JQW C;  2LUM A;  4XX5 A;  2OJR A;  1V2Y A;  4IM2 A;  2ZCB A;  2J0J A;  1E9M A;  2RMM A;  4I6L B;  3DQV A;  1E8X A;  3IXS A;  1P9D U;  4N6E B;  1FXA A;  3BVM A;  1PGB A;  2SEB D;  3WIM A;  5CX3 A;  2PVG C;  1IYF A;  1WZ0 A;  3APF A;  2FAZ A;  2WYQ A;  3A1Q A;  3QC8 B;  2KWU B;  1CZP A;  5BMI A;  5GXG B;  4YL8 A;  3DHH C;  4MH0 E;  4EE2 A;  2KMM A;  4HK2 A;  5J17 A;  5TR5 A;  4KGS A;  2C7N B;  1JWS D;  2NPT A;  3V3X A;  4HDQ A;  1TJE A;  2N4F A;  2KNB A;  2MH7 A;  2MBE A;  2W3S A;  2E3T A;  2W3R A;  1HQR D;  3UIO B;  5EE1 A;  1GB1 A;  1I42 A;  3B08 A;  1SGH A;  2LVP A;  4LJP B;  2INC C;  3GE8 C;  1LGR A;  4GDL B;  1WSP A;  2IGH A;  2KLC A;  1VZ7 A;  1IBX B;  2KHW B;  3H7S A;  4IG7 B;  2K9X A;  2MBQ A;  3VUX A;  1BT0 A;  3A4R A;  1PGX A;  3H1U A;  2I1J A;  4FLH A;  4DXF A;  1VCB A;  2LGI A;  1SIF A;  4FXC A;  2IYD B;  2UYZ B;  2KVZ A;  3RMK C;  1Q0W B;  5D3D A;  1HZ6 A;  4FN2 A;  4OZC A;  2WDV B;  1IGC A;  2KTR A;  1QIL A;  4AOF A;  4OZB A;  3DVN V;  2ON8 A;  1C1Y B;  3AEF B;  1VDV A;  4GB9 A;  4EZK A;  1WMH A;  3AE1 B;  4LNK A;  2BB6 A;  2C7H A;  1FCC C;  2DAJ A;  1OTR B;  1IUE A;  4BKS D;  2DZK A;  4W9H A;  4CHK A;  2ZPY A;  4TMA B;  2JF5 A;  2I2Y A;  4REZ A;  1P0R A;  3NUH B;  5GMV A;  4BZA A;  3HUI A;  3AEC B;  2MJE A;  3PZ8 A;  4TV3 A;  4EOY A;  2G9H D;  2QEJ C;  3IT6 B;  1T5X D;  4W9L A;  1J19 A;  4W9G A;  2XEW A;  2I38 A;  4LNO A;  1F77 A;  2UWQ A;  4WWN A;  3DOW A;  3AB5 A;  4W9K A;  4LTU A;  1EUV B;  1PQS A;  2WXO A;  4KKI A;  2FID A;  3N1X C;  4P1C C;  4WAF A;  2N1V A;  4ZYS A;  2PVO D;  1P7F A;  4HDO A;  2MCN B;  2Z0D B;  2D3B A;  2WXP A;  1MJD A;  1D5Z C;  1N61 A;  2C7M B;  2DWQ A;  5HI1 A;  3FIL B;  5AUK A;  3VFK A;  1E6E B;  1UNS A;  1WXV A;  3MJ5 A;  5IAA C;  3KWL A;  2CS4 A;  1FXT B;  3M3J A;  3DHG C;  2JUO A;  2KO3 A;  2K1F A;  2GLS A;  2BF8 B;  1KTK A;  3UGB B;  3NZU A;  3QHT A;  4GDK B;  2PJH A;  3OG5 A;  2L3Z A;  2D3C A;  4LLG M;  3P4R B;  2MP2 B;  3H8H A;  2KJR A;  2ICI A;  1F9J A;  2WGS A;  3DBS A;  3U4E G;  2KWD A;  1WE7 A;  3Q8F A;  1TS4 A;  2WX0 A;  3RYT A;  2KWV B;  3MHS D;  2KQS A;  2LXA A;  3IAM 1;  3NS1 A;  3VR8 B;  3RUL A;  2JZ3 B;  3CF6 E;  3V60 A;  3L17 A;  2WHI A;  1SXT A;  5JHB A;  1CK1 A;  2KQ4 X;  1T0S C;  2QIL A;  2ZW1 A;  1G6J A;  1TY2 A;  3AE4 B;  2IND C;  1DOI A;  4YT0 B;  1R4N B;  3IBE A;  3ZJV A;  3AE7 B;  3H7P B;  3DWG C;  4HEA 1;  5E6J A;  1N5W A;  2K39 A;  3N20 C;  4A3O A;  4F1S A;  3PZD A;  4HPP A;  1R4M I;  4AS1 A;  3N1Y C;  1WX8 A;  2PTL A;  1WGR A;  2L1A A;  2WDR B;  3EC8 A;  3MTN B;  2KX3 A;  4IWQ A;  3EGR A;  3KQ4 A;  1RYJ A;  2R61 A;  2ZW0 A;  1TKE A;  3HM3 A;  2INP E;  3FAH A;  4LNI A;  1WXS A;  1UF0 A;  1XLN A;  2WXR A;  3BVG A;  1PUT A;  2WXK A;  3JW0 X;  4P7I A;  4XZ4 A;  2RR9 A;  4JX1 C;  1U4A A;  1J0G A;  2J0M A;  1L4Z B;  5D6J B;  1LXD A;  3Q69 A;  4J3O D;  2RDB C;  1DOY A;  2FNJ B;  3ALB A;  2FCN A;  3HK0 A;  3ETR A;  3L0W B;  1L0V B;  4B0M A;  3A9K B;  3AN1 A;  3R7R A;  1B9R A;  2WP9 B;  5EE0 A;  3ZLZ A;  2DZJ A;  2KFJ A;  4F7Z A;  1L2N A;  1TIF A;  1WY8 A; 
#chains in the Genus database with same CATH homology
 2CR5 A;  2N9E B;  1WZ3 A;  4NY0 A;  3ENE A;  3QAQ A;  1ZGU B;  4HWI B;  1KJT A;  4MJS B;  3H6N A;  1UZX B;  4ZRK A;  4DWF A;  3ZIM A;  3U7D A;  3M95 A;  2GMI C;  2CHW A;  1K8R B;  3KVF B;  4NQK E;  4WWP A;  3KYC D;  2R2Q A;  5E6O A;  4ZYN A;  4LCD E;  4ICV A;  2EMS A;  2ZZP B;  2KXJ A;  2L8J A;  3VQI A;  2IO3 B;  1YIW A;  4DHJ D;  2G4D B;  4KIK A;  3X23 A;  2Z59 B;  5L83 A;  3DVN U;  2V1Y A;  2BKR B;  2KDB A;  1RLF A;  2HE7 A;  2JPH A;  2GBR A;  3PHX B;  5J18 A;  2MQJ A;  4DHJ B;  3BY4 B;  1V5O A;  1OGW A;  3RZW C;  2MWS B;  5LLI A;  2NVU I;  2MP2 A;  1GUA B;  2CU1 A;  3KYD D;  3SU8 X;  4DDG D;  3JVZ X;  5E6P A;  3ZUN A;  2C60 A;  1E8Z A;  4DXA B;  3NY5 A;  4GSW A;  5KHO A;  4FHJ A;  1LM8 B;  1E7U A;  3L54 A;  4MGY E;  3OJ3 A;  1WMH B;  3VTV A;  1D3Z A;  2R2O A;  1V81 A;  4LJO B;  4EZL A;  3I3T B;  3KUD B;  1E8Y A;  1XQQ A;  1YQB A;  2NBU A;  4G0N B;  1WR6 E;  4PYU A;  5DPS A;  4F7Z A;  5KHQ A;  1L2N A;  3ONS A;  3O65 B;  4J6I A;  4MDK E;  3V6C B;  3HM6 X;  2L05 A;  3A33 B;  1GNU A;  1WXM A;  2L0T A;  3QX1 A;  2ZJD A;  1WYW B;  4RMA A;  5G2N A;  2MBO A;  4BKT A;  1S3S G;  4BKG A;  1JRU A;  3A1Q B;  4G50 A;  2I1K A;  1WJ6 A;  3PRP B;  1GC7 A;  3CSF A;  4NQL B;  4RM9 A;  4B9K A;  1RRB A;  1WM3 A;  2ZEQ A;  2DX5 B;  2KDF B;  3QK0 A;  1TZ1 A;  1UEL A;  5DPW A;  3A9K A;  2GBN A;  1Z5S B;  4BFR A;  4IC7 B;  3UIP B;  2J0K A;  3AU5 A;  2DZI A;  3GZN I;  3ML9 A;  2KJ6 A;  5BO4 B;  1E90 A;  2VRR B;  1WFY A;  3PT2 B;  1KOT A;  3DBR I;  1NDD A;  3T9L A;  4HJK A;  3PLU A;  2L00 B;  4FBJ B;  4IM0 A;  2RPQ A;  3PVL A;  3TIX A;  4HVB A;  3Q3J A;  4A3P A;  2KLG A;  1L7Y A;  2DEN B;  2NPT B;  2N7E A;  2LGY A;  3JSV A;  4MGK E;  3V62 A;  3ZVV A;  2EMT A;  4MGI E;  4EFO A;  4MSQ B;  2CKH B;  2M4N A;  2IY1 B;  4NJ7 A;  3UF8 A;  2KZR A;  3AI5 A;  2MW5 A;  4X57 B;  1EO6 A;  4MGZ E;  5EDS A;  3ZTC A;  2LRU A;  2V4L A;  3SDL C;  2O2V A;  1GG3 A;  4ICU A;  3IG3 A;  3RCZ A;  1ZKH A;  4PS8 A;  1OEY J;  3ZNG C;  1YJ1 A;  4URK A;  2LGX A;  2ZPN A;  4WJO A;  2D10 A;  2IBI B;  3SD5 A;  2AEH A;  3L10 B;  2JWZ A;  3U30 A;  2QHO A;  3UIN B;  2ZNV B;  5J2R A;  1WGG A;  2REX A;  4NJ6 A;  5LXH A;  4RM8 A;  2PE6 B;  1ZW7 A;  4KSL C;  4OVU A;  2WDT B;  5D7G A;  2D2Q A;  1ISN A;  2O2V B;  3NOB A;  1TBE A;  2AYO B;  4NAW A;  4JQW C;  5DCN A;  4AJW A;  1WRD B;  4M8M A;  4MM3 A;  4XX5 A;  3WAM A;  2OJR A;  1V2Y A;  4IM2 A;  3ZNI D;  2ZCB A;  4FJZ A;  2J0J A;  3PTF C;  3ZTD A;  3ZNH B;  4I6L B;  4KDL B;  5IA7 A;  3DQV A;  1E8X A;  3V61 A;  1TTN A;  1P9D U;  2LD9 A;  4K81 A;  1P1A A;  1X1M A;  2JT4 B;  3ZKJ C;  4II3 B;  2A4Z A;  2FIF A;  3T8M A;  3L13 A;  4IW0 A;  3WIM A;  5CX3 A;  1S1Q B;  4B95 A;  4WWO A;  2AL3 A;  3LDZ E;  4CO7 A;  1IYF A;  1H8C A;  1WZ0 A;  3APF A;  2FAZ A;  2LUE A;  2WYQ A;  3A1Q A;  1GC6 A;  3QC8 B;  4GN1 A;  4GMV A;  4M8N A;  1KLV A;  3DVG Y;  2KWU B;  2IZV B;  4YL8 A;  4MH0 E;  4JL9 A;  3VUW A;  4AUQ C;  3WAN A;  4HCN B;  4HK2 A;  5J17 A;  3ZO5 B;  5TR5 A;  1C3T A;  2IO1 B;  4ZRJ A;  1WGD A;  2C7N B;  4MEL A;  3AU4 A;  2NPT A;  3JSV B;  3APC A;  4HDQ A;  4WJP A;  2N4F A;  3QAR A;  2KNB A;  2MBE A;  3ZDT A;  2BWE S;  3UIO B;  2NBW B;  1WGY A;  2N9P C;  2FCM A;  3L08 A;  1I42 A;  2IO2 B;  2N7D A;  3HHM A;  4KZ0 A;  5C23 A;  4LDT D;  4BOS C;  2EKE C;  3B08 A;  3QJZ A;  1SGH A;  2LVP A;  4F8C B;  3NZS A;  4LJP B;  5JH5 C;  2BKF A;  4IWO A;  4ZDV A;  2KD0 A;  1XT9 B;  1MG8 A;  1Q5W B;  4GXB A;  4GDL B;  3EFU A;  3N3K B;  4K7U A;  4FAD A;  2GBM A;  3NS8 A;  2LVO A;  4E71 A;  4W9D A;  2N1W A;  3TBL D;  3CMM B;  3AXC A;  4FJY A;  4EZJ A;  5HKH A;  2KLC A;  1OEY A;  1UD7 A;  4ANV A;  2Y5B B;  2L76 A;  2KHW B;  3H7S A;  4IG7 B;  3ZRC A;  3QWZ B;  3PV1 A;  2AL6 A;  1UGM A;  2MBQ A;  2DYM A;  3VUX A;  2K25 A;  3ZW3 A;  1BT0 A;  3A4R A;  1V86 A;  3H1U A;  1M94 A;  2I1J A;  4FLH A;  4K1R B;  1VCB A;  4M0W B;  1WH3 A;  2MRP A;  4GU2 A;  4W9F A;  4W9E A;  1SIF A;  3VAW A;  2DYB A;  2IYD B;  2UYZ B;  4AWJ A;  1Q0W B;  3DVG X;  2C5L C;  4FN2 A;  4BBN F;  2GBK A;  2M17 A;  1SE9 A;  2ZCC A;  5AZH A;  2XK5 B;  3IHP C;  4IWP A;  5D2M B;  2KTR A;  5AZG A;  4ANU A;  3TL5 A;  4AOF A;  3IVF A;  1WX7 A;  3DVN V;  3DDC B;  5AEK B;  1LQB A;  4BKS A;  1C1Y B;  2BPS A;  2LZ6 A;  4DK5 A;  4GB9 A;  4EZK A;  4HLE A;  2BYV E;  2N9X A;  1WMH A;  2JXX A;  5JHA A;  3GOE A;  3VTW A;  2C7H A;  4KIK B;  1HE8 A;  2A5U A;  2DAJ A;  4DHZ E;  3KW5 B;  2KVR A;  1OTR B;  2KAN A;  2KX0 A;  2DAF A;  3W1S C;  4BKS D;  1H4R A;  2KDI A;  2DZK A;  3Q3F A;  4W9H A;  2D07 B;  4K7W A;  2JRH A;  3OJ4 B;  2ZPY A;  5G55 A;  3L16 A;  4CHK A;  4WJN A;  2JF5 A;  4ASW C;  1V80 A;  1P0R A;  1CMX B;  2W9N A;  2WWZ A;  3UQB A;  5GMV A;  5CHF A;  4MJS A;  2JZZ A;  1EF5 A;  3C0R B;  1RAX A;  3M63 B;  2ZNV C;  3P2B A;  2MBH A;  4TV3 A;  2LVQ A;  4EOY A;  4KVG B;  4GIV A;  2XBB C;  2MLB A;  2C9W B;  3R7Q A;  4NNJ B;  2DZM A;  4W9L A;  1J19 A;  1WJN A;  2OOB B;  4OVV A;  4A20 A;  2PPH A;  3EHV A;  4W9G A;  4AJY B;  2XEW A;  4E74 A;  2XK5 A;  1UH6 A;  1WR1 A;  2UWQ A;  4WWN A;  3DOW A;  1WIA A;  2NBV B;  2KMA A;  4W9J A;  3K9P B;  4W9K A;  3B1L X;  3PS6 A;  1EUV B;  1PQS A;  3V6E B;  4EKU A;  2FID A;  4DHZ B;  4IUM B;  4PS3 A;  4K7S A;  2N1V A;  3W1Y A;  4NAW B;  1WI0 A;  3OLM D;  2KFK B;  2JVC A;  3VDZ A;  3PHW B;  4HDO A;  2MCN B;  3WAL A;  4FHK A;  2Z0D B;  1NBF C;  3APD A;  4G11 A;  3WAO A;  1R4N I;  3QQ8 B;  3MJW A;  3N32 A;  2CHX A;  2NR2 A;  1I35 A;  2BYF A;  1LFD A;  2M1M A;  3PGE A;  3VH4 B;  1V6E A;  2C7M B;  2HD5 B;  4MEM A;  2WX1 A;  2LAS A;  1E8W A;  2RSU A;  1YX5 B;  4TQ1 A;  5DPR A;  4ZRI A;  4EUT A;  4HPM B;  3VFK A;  3QA8 A;  1WXV A;  5IAA C;  1AAR A;  2DYO A;  2GOW A;  4FA6 A;  1WJU A;  2NS5 A;  2CS4 A;  1UBQ A;  4E3C A;  1FXT B;  3M3J A;  2KJH B;  3ZRF A;  3DBH I;  4HCP B;  4ANX A;  4II2 B;  1P98 A;  3RD2 A;  2JUO A;  2KKC A;  3ML8 A;  2FCQ A;  2KOX A;  2KO3 A;  3OAW A;  4BVU C;  2K1F A;  2BF8 B;  3PRM B;  3A9J A;  4TQ0 A;  4CYE A;  2LGD A;  3UGB B;  2KDE B;  3NZU A;  3QHT A;  4MSM B;  2KC2 A;  4GDK B;  5CHV C;  1IPG A;  3M62 B;  2PJH A;  2L3Z A;  4NPN A;  5C1Z A;  4KZC A;  3QCA A;  2MP2 B;  2LXC A;  2KJR A;  1F9J A;  2MX2 A;  3DBS A;  1E5W A;  1WXA A;  2IY0 B;  1TGZ B;  2K8C A;  2HJ8 A;  1WE7 A;  4WQO B;  1WJ4 A;  2J7Q B;  3CST A;  4I6P A;  4N9F 4;  4FJV B;  4GGQ A;  3SHQ A;  1KM7 A;  2WX0 A;  3LJ3 A;  2O6V B;  1Y8R C;  2KWV B;  2RGF A;  3RYT A;  3VH3 B;  3MHS D;  3QIJ A;  4W9I A;  2KQS A;  3R3M A;  4W9C A;  4BOZ B;  1J8C A;  2LXA A;  2D11 A;  3H9D A;  3VXW A;  2DHZ A;  2PEA A;  2MBB B;  1WF9 A;  2BYE A;  3HIZ A;  2JY6 A;  4JLC A;  1OQY A;  4KV2 A;  1NI2 A;  2NCN A;  3RUL A;  3PRZ A;  2JZ3 B;  3CF6 E;  5CHW A;  5FR6 A;  4HPL B;  4IM3 A;  2ZVO A;  1WM2 A;  3L17 A;  3V60 A;  1V9J A;  3U8Z A;  3UQA A;  3DPD A;  5JHB A;  2GBJ A;  2G4S A;  5DPT A;  1A5R A;  3K9O B;  1EF1 A;  5D94 A;  3DBL I;  3WA0 A;  1G6J A;  3EEC A;  2M0X A;  4I6N B;  2K8H A;  5AZF A;  3IBE A;  4GDK A;  3H7P B;  3RZF A;  1XD3 B;  3TMP B;  4HXD A;  3KUZ A;  3RT3 B;  4BBN C;  2PE9 A;  4B6W A;  4DBG A;  3PSE B;  1YX6 B;  2L7R A;  3NHE B;  2KMC A;  5LXI B;  2K39 A;  3AUL A;  4A3O A;  4F1S A;  3PZD A;  4LDT B;  4TUU A;  1R4M I;  5CTR C;  2BGF A;  1WX8 A;  3R66 C;  1P3Q U;  2O6V D;  4JIO U;  1WGR A;  2CHZ A;  3EC8 A;  2G45 B;  2KK8 A;  3MTN B;  3H7P A;  3VTU A;  1T0Y A;  1V5T A;  3VVW B;  2AWT A;  4ANW A;  4DDI D;  1E7V A;  2KX3 A;  4IWQ A;  2KFK A;  2KC1 A;  2IO0 B;  3DCG A;  4KDI C;  3WAP A;  2M8S A;  2V3S A;  1WE6 A;  3A9J B;  3BIN A;  4JGH B;  2D3G A;  2G3Q B;  2LWP A;  2YVC A;  2B3A A;  2Z0E B;  5E6N A;  3D32 A;  3HM3 A;  3W1S A;  3N30 A;  2K6Q A;  2LRW A;  2KQ7 A;  3X0W A;  1WXS A;  2BWF A;  3RUI B;  1UBI A;  2KTF A;  2MSE D;  4GDL A;  2K8B A;  3VHT C;  3A4S C;  2FUH B;  2L0F A;  4PS7 A;  5JZE B;  1QZE A;  3VUY A;  3JW0 X;  3PPA A;  4P7I A;  4XZ4 A;  4AP4 C;  3PRE A;  2K6D B;  2RD0 A;  2RR9 A;  1U4A A;  1J0G A;  2ASQ A;  4EEW A;  2JRI B;  4XC2 A;  3S2A A;  2J0M A;  3TJP A;  3KUC B;  3ZNZ B;  2KWC A;  4GOC A;  2KN5 A;  5D6J B;  1LXD A;  2MA9 B;  2ZVN A;  3TCA A;  2HTH A;  3ECI A;  5L95 C;  4TKN A;  2LI5 A;  2FNJ B;  3ALB A;  1YD8 U;  2YLM A;  1WX9 A;  2FCN A;  3HK0 A;  3PLV A;  3L0W B;  4PYZ A;  4FUL A;  1WGH A;  1Q1O A;  3KH0 A;  3A9K B;  3R7R A;  1VD2 A;  1RFA A;  3JYU A;  2FCS A;  3B0A A;  4WAA A;  4WJQ A;  3ZDM C;  2LJ5 A;  4KSK C;  2KTR B;  3ZLZ A;  1V49 A;  1GJZ A;  1Z2M A;  2DZJ A;  2KFJ A;  3IFW B;  4G3X B;  2O6V A;  1IP9 A;  1WY8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...