1PQSA

Solution structure of the c-terminal opca domain of ycdc24p
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
77
structure length
77
Chain Sequence
b'SEIFTLLVEKVWNFDDLIMAINSKISNTHNNNISPITKIKYQDEDGDFVVLGSDEDWNVAKEMLAENNEKFLNIRLY'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Cell division control protein 24
publication title The solution structure of an N-terminally truncated version of the yeast CDC24p PB1 domain shows a different beta-sheet topology.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Cell cycle
total genus 15
structure length 77
sequence length 77
ec nomenclature
pdb deposition date 2003-06-19
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 1pqsA00
3D32A 3ECIA 2WX1A 2N7DA 4AWJA 4GB9A 2EMSA 3N3KB 2EKEC 2MBHA 2KJHB 2CHZA 3PREA 4K81A 1J0GA 3PV1A 4A3PA 1UH6A 2Y5BB 2K25A 2KLCA 3KUDB 5E6NA 3VXWA 4G0NB 2KFKA 1WF9A 1I35A 4E74A 4DHJB 3KUZA 3IHPC 3L16A 5E6OA 4BBNF 3DOWA 2LVPA 2LD9A 4F7ZA 4MJSB 4NAWA 3H1UA 3NZSA 2UYZB 1Z5SB 2LXAA 4EOYA 4DBGA 4WWPA 4M8NA 2LWPA 2PE9A 5D7GA 4WJOA 4W9GA 2G4DB 4IG7B 2ZCBA 4IWQA 2ZJDA 2MWSB 1WGYA 4G3XB 4WWNA 4J6IA 2K39A 2MBQA 4WJPA 3HK0A 2MP2B 2C60A 3ZKJC 1QZEA 2JT4B 3X23A 1K8RB 2PJHA 3GZNI 4GDKA 5KHQA 4KIKB 5LXIB 2KDIA 2KFJA 4W9HA 2KC1A 2PPHA 4FJYA 3DPDA 2KKCA 5LXHA 3Q3FA 4ASWC 3DVNU 3ML9A 4GXBA 4K1RB 1WX8A 4IM0A 2PEAA 2LRUA 2MBEA 3A1QA 4MM3A 3RZWC 1LXDA 3ZDMC 4MGYE 3PGEA 4BVUC 4AOFA 4EUTA 3WAOA 1WXAA 2C7MB 4KV2A 3TL5A 5CX3A 2IY1B 1V86A 1YJ1A 1S3SG 1SE9A 3RUIB 1XD3B 4GSWA 2N1WA 3PTFC 4XX5A 2LXCA 2O2VA 1WMHB 4NQLB 4OVUA 1NBFC 1UELA 1RRBA 4W9JA 3U8ZA 4E71A 2C7NB 2A4ZA 1SGHA 3U30A 2WYQA 4JIOU 1NI2A 3H7PB 2N1VA 4KSKC 4X57B 4WWOA 3T8MA 4EZLA 1WGDA 5D2MB 4DK5A 5JHBA 2KQSA 3HM6X 3NZUA 2L05A 4JL9A 1IP9A 2KXJA 3BY4B 4MH0E 2XEWA 3A9KA 2M8SA 2GBJA 1UGMA 5G2NA 3ZLZA 1YX6B 2OJRA 3SDLC 1WX9A 4HDQA 4WJNA 3UIPB 2KDBA 2IO0B 3RT3B 4DDID 2B3AA 2KTFA 1WGRA 2Z0EB 1TGZB 3ML8A 2FIDA 4DHJD 2LZ6A 4GDLA 2M4NA 4HXDA 5C1ZA 1D3ZA 3QQ8B 1TBEA 1F9JA 2O6VA 3HHMA 4IWOA 4DWFA 3PHWB 3DCGA 4PS7A 3H6NA 1KLVA 1XT9B 3AULA 5J17A 1V2YA 2L3ZA 3A9JB 3PLUA 1GJZA 1XQQA 2JZ3B 3UF8A 1RFAA 4W9FA 3JSVB 4NQKE 3V6CB 1WIAA 3NY5A 3TBLD 4LDTB 2KTRA 3AU4A 3KW5B 4FULA 4GOCA 1E8ZA 2KWVB 4WQOB 4ZRIA 3PRPB 4NJ7A 4AJWA 3M62B 3ZTDA 4HWIB 2V4LA 1OEYJ 3I3TB 3JW0X 3ZO5B 2HTHA 2CR5A 1UZXB 3NHEB 2KVRA 3PVLA 4DHZB 3QCAA 1OTRB 4WJQA 1UD7A 3UINB 3W1SA 2KLGA 3QX1A 2ZVOA 3V62A 1C1YB 2FUHB 3OLMD 2LJ5A 3QWZB 4WAAA 2KO3A 4A20A 4ANXA 3B08A 4DDGD 4K7UA 4DXAB 2Z59B 2L7RA 2YVCA 3R3MA 2K8HA 1GNUA 2M0XA 2BYEA 2ZEQA 2JZZA 3PRZA 3PS6A 4NJ6A 1AARA 2DAFA 4W9LA 2KN5A 3X0WA 1A5RA 4BFRA 2JRIB 3RCZA 4YL8A 4EEWA 4II2B 3KVFB 1C3TA 3KYDD 4PS3A 4GIVA 1WJ6A 2K8CA 3N30A 3ZRCA 2C5LC 4NNJB 1UBIA 2MQJA 2JWZA 4JGHB 2BWFA 3DQVA 3RYTA 2NPTA 4F8CB 3CF6E 2XK5A 3EECA 4GGQA 2ASQA 4ZDVA 4JLCA 3VTVA 4EFOA 2LVOA 3CSFA 4HCPB 4FHKA 2KX3A 2JF5A 4B95A 4TKNA 4BKTA 2D3GA 4AJYB 3QIJA 3L08A 4FA6A 1WZ0A 4I6NB 2FNJB 2N9XA 1WXMA 5L83A 1V49A 1WJNA 3EHVA 3ALBA 3UQBA 1EF5A 2FCSA 4MGIE 4BKSA 2J0KA 2FAZA 1U4AA 1P3QU 2KFKB 3PT2B 1TTNA 2RSUA 1UBQA 1VD2A 2KDEB 2D07B 2K1FA 4W9IA 3VAWA 5E6PA 3SU8X 2BKFA 3OJ4B 3L54A 1VCBA 1E5WA 3A33B 2L00B 4LDTD 2FCQA 2HJ8A 4ICVA 4MELA 2KC2A 4IM3A 4NAWB 3L13A 4TV3A 4E3CA 1V5OA 4MSQB 2KQ7A 4HPMB 3LDZE 3L17A 4G11A 4F1SA 5L95C 5DCNA 3WAPA 1SIFA 3DBSA 3EC8A 3PRMB 4K7WA 5DPWA 2K6DB 3VVWB 3M3JA 1P0RA 2DZIA 4KSLC 4ZYNA 2CHWA 1Q0WB 1WGGA 2BPSA 5AEKB 4AP4C 5J18A 1TZ1A 1EUVB 2ZNVB 3ZVVA 4HCNB 3DVNV 4GDKB 1ZW7A 4MSMB 2FCNA 2GBKA 2G3QB 4IM2A 3ZIMA 2N7EA 4K7SA 2GBRA 2AL3A 1YX5B 3VQIA 2KX0A 1LM8B 1P1AA 2DYOA 3TIXA 2KJ6A 4FHJA 3L0WB 2C9WB 4PS8A 1V80A 1WY8A 2IO2B 3MJWA 1Z2MA 3RULA 2V1YA 2KK8A 5TR5A 3VDZA 4I6LB 1LFDA 1L2NA 2LVQA 3QC8B 4HK2A 2CU1A 2KHWB 2DENB 3H7SA 2ZNVC 2L0TA 2RGFA 1JRUA 4EKUA 1WE6A 1WRDB 4LJOB 3TMPB 2BYFA 2KANA 2O2VB 2M1MA 4FJZA 3AI5A 1BT0A 1WM3A 3DBLI 3ZNGC 5EDSA 1Q1OA 3BINA 3EFUA 4B6WA 1MG8A 4EZKA 2AL6A 1E8XA 2L0FA 2BF8B 2K6QA 2PE6B 3AU5A 3V61A 3LJ3A 2FCMA 4W9KA 1WR6E 1WXSA 3PPAA 3APCA 3SHQA 4DHZE 3KH0A 2N9EB 3VUWA 1GC7A 5LLIA 2KOXA 2KD0A 2REXA 1WI0A 3HM3A 3QJZA 3A9KB 1E8YA 2RD0A 2MRPA 2I1KA 3U7DA 1LQBA 2ZPYA 4IUMB 4W9CA 2A5UA 4CYEA 3R7QA 2DZJA 2GBMA 3ZNHB 3B1LX 4HPLB 4GDLB 3UIOB 2O6VB 2RR9A 4JQWC 5FR6A 2LRWA 4TUUA 4IWPA 1EF1A 3IVFA 1G6JA 2HD5B 1Y8RC 1ISNA 2KZRA 2J7QB 3R66C 5AZHA 4AUQC 3K9OB 2IBIB 1H4RA 2AEHA 2NBWB 2KWCA 4G50A 2EMTA 3KYCD 1Q5WB 1OGWA 2IYDB 4MJSA 4HLEA 2KTRB 4N9F4 3S2AA 4OVVA 4KVGB 2D2QA 2LGXA 2MSED 3TCAA 4FN2A 1V81A 4GN1A 4P7IA 2IO1B 2D11A 1WM2A 3IG3A 3WAMA 3UQAA 4FJVB 2VRRB 2KDFB 3PHXB 4PYZA 1KOTA 3P2BA 5D6JB 2MP2A 2LASA 2CKHB 1J8CA 3DBRI 2CS4A 5AZFA 4II3B 3PZDA 1WYWB 2MA9B 2QHOA 2XBBC 2KMAA 3QAQA 5CHFA 3ONSA 1J19A 3JVZX 4RMAA 2MCNB 3R7RA 4LCDE 4KZ0A 5JHAA 3RZFA 4GMVA 4KIKA 3DDCB 1H8CA 3WIMA 3K9PB 5DPSA 3DBHI 2J0MA 1WX7A 3WANA 1OEYA 1ZKHA 4M0WB 4ZRJA 2AWTA 1E90A 3CMMB 2D10A 1YQBA 2JUOA 5KHOA 2DZKA 3M63B 2BGFA 1RAXA 2LI5A 4CO7A 3W1SC 3W1YA 1V9JA 1V6EA 2DHZA 2ZVNA 4HJKA 2GBNA 2V3SA 2NS5A 4MGKE 1T0YA 4LJPB 3ZW3A 2R2QA 4CHKA 2LUEA 3A4SC 1PQSA 2OOBB 2WDTB 1KM7A 3CSTA 3O65B 2JRHA 1WMHA 2CHXA 2L8JA 4B9KA 3ZRFA 2KWUB 1YD8U 1GC6A 2NPTB 2XK5B 2MX2A 4BOSC 1WXVA 2JY6A 1X1MA 1GUAB 2AYOB 2BKRB 3RD2A 3WA0A 2NR2A 1CMXB 3AXCA 5HKHA 3H7PA 2MBBB 2W9NA 5C23A 2G45B 3VUYA 3HIZA 4FBJB 5DPTA 4M8MA 1GG3A 2JPHA 2O6VD 4FLHA 5J2RA 5D94A 3PLVA 3APFA 1EO6A 4ZRKA 2DZMA 1R4NI 3WALA 2DX5B 1P98A 2GMIC 3A4RA 4XC2A 4BKGA 2LGDA 3V60A 2IZVB 5IA7A 1NDDA 4ICUA 4NY0A 2ZCCA 3C0RB 3ENEA 4HDOA 3A1QB 4TQ1A 1E7UA 3TJPA 4URKA 3DVGY 1WJUA 3A9JA 1HE8A 1FXTB 1IPGA 4RM9A 3VTUA 3ZNID 3PSEB 2BYVE 1ZGUB 1V5TA 2ZPNA 4ANWA 1OQYA 2WWZA 2R2OA 3QHTA 2JXXA 3L10B 5CHVC 3SD5A 3JSVA 1WE7A 2MBOA 5CTRC 3UGBB 4W9DA 3T9LA 4XZ4A 3KUCB 4W9EA 3ZDTA 1L7YA 3OAWA 3H9DA 4MGZE 4KDLB 4GU2A 1KJTA 4I6PA 4A3OA 1M94A 2WX0A 4KDIC 5IAAC 2I1JA 3MTNB 4IC7B 5JH5C 3M95A 4IW0A 2UWQA 2JVCA 4MDKE 1P9DU 2C7HA 1WH3A 2DYBA 5G55A 3APDA 2J0JA 3VHTC 3NOBA 2NCNA 2Z0DB 4PYUA 3OJ3A 4BBNC 2GOWA 4MEMA 2IO3B 2HE7A 2K8BA 2NVUI 2ZZPB 2IY0B 2M17A 1WR1A 4FADA 5JZEB 2FIFA 4KZCA 2LGYA 5DPRA 3NS8A 5CHWA 1I42A 1RLFA 4BOZB 3GOEA 2G4SA 4RM8A 2NBVB 3VFKA 2KMCA 4ANUA 3QARA 3QA8A 2N4FA 3MHSD 1IYFA 1WGHA 4ANVA 2BWES 1R4MI 2DAJA 3V6EB 2KJRA 1E8WA 2NBUA 1S1QB 1YIWA 2MLBA 3B0AA 4NPNA 3JYUA 3VUXA 3ZTCA 5BO4B 3IBEA 1WZ3A 3VH3B 1WFYA 3ZNZB 1E7VA 5AZGA 3VH4B 3Q3JA 4HVBA 2DYMA 2KNBA 2N9PC 3VTWA 4EZJA 2YLMA 5GMVA 4BKSD 3IFWB 2RPQA 3ZUNA 3N32A 4TQ0A 2L76A 1WJ4A 3DVGX 3QK0A 2MW5A
chains in the Genus database with same CATH superfamily
5BMIA 1N5WA 4OZBA 4GB9A 2EMSA 2MBHA 3PV1A 3U52E 4G0NB 2KFKA 4E74A 4DHJB 3IHPC 5E6OA 3DOWA 2INPE 2JWUA 2LVPA 3NZSA 2LXAA 4M8NA 2LWPA 1FMAD 4JPSA 1C77A 2G4DB 4XWTA 1KF6B 4L2YA 2MBQA 3BYYB 2MP2B 3AH7A 1QZEA 1K8RB 3GZNI 1GAQB 2I2YA 1MHXA 3ETRA 2KC1A 2BB6A 3IAM1 2LUMA 4K1RB 3RZWC 4BVUC 2WXIA 4AOFA 4YTNB 2IDYA 1WXAA 4KV2A 3TL5A 1V86A 1YJ1A 4KX6B 2LMCA 3RUIB 2PKOA 3AEAB 2AX5A 4OVUA 1UELA 3U8ZA 2WDQB 2A4ZA 3E56A 4JIOU 5HFYA 5H92C 4KSKC 2N1VA 4B0EA 3ZXRA 3I57A 4DK5A 2KQSA 3HM6X 1IP9A 3A9KA 1FNVA 1C78A 4XGAB 2OJRA 1N63A 3R8BA 3UIPB 1F2RI 2IO0B 2Z0EB 2FIDA 2LZ6A 5C1ZA 1SJHD 4HKQA 1TBEA 1I4GA 3AE4B 2WNMA 1XT9B 3AULA 1HQRD 4S0RA 1GJZA 4N58A 2D3AA 3ZXVA 3URYA 4NJ7A 3M62B 3AE8B 3JW0X 2HTHA 1UZXB 1GB4A 2KVRA 1OTRB 4OW0A 1TS5A 2ZVOA 2ZW1A 2Q5WD 4A20A 4DDGD 2GLSA 1SE4A 3R2IA 2K8HA 3BVMA 4M0WA 1GNUA 2DAFA 1AWDA 3X0WA 2JRIB 4YL8A 1QOFA 4XWWA 3KYDD 4PS3A 3ZRCA 2K8CA 3N30A 2C5LC 4NNJB 1UBIA 2LFIA 1NYRA 3FKYA 2WGSA 1MFWA 2LVOA 1P7EA 3CSFA 4XE0A 3P4RB 3L08A 1V8CA 1WZ0A 4L23A 4I6NB 2FNJB 2N9XA 1SE2A 3MC8A 5L83A 3ALBA 1DOIA 2R61A 1U4AA 3N1YC 3W5UB 2KDEB 1HTOA 3IT4B 1VCBA 4YWGG 1E5WA 2KC2A 4TV3A 2KQ7A 5DCNA 3WAPA 3EC8A 3PRMB 1TS3A 1P0RA 2DZIA 2H88B 4KSLC 3SEBA 4ACFA 3AE6B 1WGGA 5J18A 1QOAA 1FD6A 4HCNB 3DVNV 4LTUA 4MSMB 1CJEA 2G3QB 4IM2A 3ZIMA 5EE3A 1NVID 3VQIA 3TIXA 2WP9B 2QEJC 2JYEA 5EE1A 1Z2MA 4HRSA 1T3QA 1D5XC 3BWUD 2KK8A 1LFDA 2RDHA 3HUIA 2KHWB 5HHDG 4US9A 2ZNVC 1R7SA 2L0TA 1JRUA 4LNFA 1WE6A 1PDXA 2O2VB 1BT0A 3LB8C 3BINA 1E8XA 2K6QA 2PE6B 3Q2AC 4W9KA 3PPAA 2V0GA 3AE7B 1ENFA 1FXAA 3KH0A 2M0AA 3AE9B 4HROA 4WWMA 1PFDA 2REXA 1E8YA 3U7DA 2A5UA 3R7QA 4GDLB 1QKZA 2RR9A 5IP4D 1V1PA 2LRWA 1EF1A 1VZ8A 2KZRA 2NTSA 1RFKA 2KWCA 2EMTA 4P1BC 2D3CA 3FILA 1PGBA 1NYQA 4N9F4 4A9AA 2D2QA 2LGXA 3TCAA 2LGIA 1V81A 1FRDA 2BW2A 3UQAA 3P2BA 2GRIA 3DHIC 3DBRI 2QHOA 1XF5L 2XBBC 1TIFA 4RMAA 1J19A 5DPSA 1YN4A 3DBHI 1OEYA 2D10A 4OVZA 1JRPA 2QMTA 2DHZA 1V6EA 4HJKA 2WU2B 4MGKE 4LJPB 3ZGZA 4YSZB 2LUEA 1PQSA 2WDTB 3VRAB 2JRHA 2L8JA 2XK5B 1I4QA 4BOSC 3P42A 1X1MA 2AYOB 4NJCA 3RD2A 4ZOHC 1TS4A 2KQ4X 5HKHA 3H7PA 3VR8B 2G45B 1FEHA 5FKAC 3FAHA 3VUYA 3BK2A 1L6VA 2O6VD 3MFGA 2JYTA 1JCKB 4WIPA 3WALA 3A4RA 3V60A 2N0SB 2K3UA 1BXTA 3RN9C 3A1QB 4TQ1A 3DWMA 3TJPA 4URKA 1GB1A 3DVGY 1WJUA 1ZGUB 1V5TA 3C19A 1EU4A 1LGRA 3JSVA 3ZDTA 4XZ4A 4W9EA 2PMVA 1L7YA 3GB1A 4I6PA 4A3OA 2M56B 2QJLA 1YJJA 3M95A 2WHIA 2MJDA 1WH3A 5AUKA 2J0JA 1I7HA 2NCNA 2GOWA 2J52A 2FBWB 3W5VB 3Q8BA 3SFDB 2K0PA 4BOZB 3P4PB 2G4SA 3RI7C 4ANUA 1IYFA 3PZ7A 3EA6A 2BWES 1V1OA 3V6EB 2DAJA 3EFCA 1S1QB 3OWEB 2MLBA 4NPNA 1E7PB 4RGMA 3VUXA 3ZTCA 2QC8A 3ABVB 2ICIA 2WXGA 4PT5A 4HVBA 2KNBA 2N9PC 1ZUD2 4EZJA 1WYGA 2FE8A 1ROEA 2WXOA 4TQ0A 3P63A 2L76A 3DVGX 3D32A 3BYTB 1PYWD 2WQYB 3ECIA 3RNFC 4H2AA 1UUPA 3N3KB 2EKEC 3R2TA 4L1BA 3PREA 4K81A 3N1ZC 4A3PA 4ZRQA 3VXWA 1WF9A 3L16A 4MJSB 3H1UA 4WJOA 3NJTA 2GB1A 2ZCBA 4IWQA 4G3XB 4WJPA 4C4VB 2XNAC 4M00A 1SIJA 4GDKA 3AEDB 1FPYA 2PLPA 3NUHB 2KDIA 3RFZB 2V3PA 2PPHA 4FJYA 4OZCA 5LXHA 3DVNU 3ML9A 1ZPSA 1WX8A 2LRUA 3EGRA 4MM3A 5HI1A 4USAA 1XEEA 2IY1B 1SE9A 2V4IB 1WMHB 4W9JA 4WWOA 1WWTA 1XLNA 5D2MB 2Y3AA 5D3IB 4JL9A 5H8YE 3N1XC 2XEWA 2GBJA 3ZLZA 1ZOYB 1JWSD 1TJEA 1WX9A 2KDBA 3ZJTA 2MJEA 3T3NA 4DHJD 4HXDA 3QQ8B 4DWFA 3PHWB 3DCGA 4PS7A 1ET9A 2L3ZA 3A9JB 1FM0D 1XQQA 2WDRB 5TSSA 1RFAA 4W9FA 2UU7A 4NQKE 3V6CB 3NY5A 2K5PA 2RMMA 4LDTB 3Q3OC 4TSSA 3KW5B 1EWYC 4FULA 1E8ZA 2KWVB 2IPKD 1OEYJ 2V4LA 1YN3A 3ZO5B 1BUIC 2CR5A 3NHEB 3PVLA 1TKGA 5C2TB 1UD7A 2KLGA 3QX1A 1ZP0B 3QWZB 4WAAA 4ANXA 2Z59B 4A6QA 1FXIA 2ZEQA 1QLBB 4PK1A 4IDIA 3PS6A 3B2GA 1R4NB 2KN5A 1A5RA 2KYWA 3RCZA 1KRHA 2K22A 4II2B 3J9CA 3KVFB 1I4RA 1C3TA 2JWZA 2BWFA 3DQVA 2NPTA 2J53A 2MHJA 3VTVA 1CK1A 4FHKA 2JF5A 2QSDA 2B76B 4B95A 4BKTA 3QIJA 1BMLC 4FA6A 2BS2B 1WXMA 3EHVA 1EF5A 4BKSA 3N20C 3AN1A 3L4PA 2FAZA 1P3QU 2KFKB 3PT2B 1TTNA 1UBQA 1VD2A 5EE0A 2D07B 2K1FA 1ZDVA 2KN4A 3L54A 2ACZB 1QQRA 2K9XA 4E3CA 1SIFA 1N62A 3DBSA 4K7WA 4UDUC 1C9FA 2K6DB 5BYRA 2KVZA 1EWCA 2BPSA 5AEKB 4AP4C 1B9RA 1TZ1A 1YQ3B 2G1EA 2INDC 1ZW7A 2GBRA 2AL3A 1UWXA 1SJED 3AE1B 2DYOA 4RF1A 4PS8A 1V80A 2IO2B 3RULA 3VDZA 4I6LB 1L2NA 4ITKA 1E10A 2DENB 3H7SA 4LJOB 3TMPB 2BYFA 2KANA 2M1MA 3AI5A 1WM3A 3DBLI 3ZNGC 2BB5A 2KMMA 2VH1A 3EFUA 2L0FA 3AU5A 3BK1A 2FCMA 1WR6E 4M01A 2N9EB 3VUWA 1GC7A 2KOXA 1FNUA 3A9KB 5JXVA 2WS3B 2MRPA 2LHEA 2I1KA 4IUMB 1SE3A 2GBMA 3ZNHB 3NRZA 4JQWC 3KLSX 3GZNB 5FR6A 4RGNA 3AE5B 2HD5B 1Y8RC 1ISNA 3AEBB 2J7QB 2AQ1B 2M19A 2IBIB 1H4RA 2AEHA 2NBWB 3AEGB 1OGWA 4HLEA 3S2AA 4OVVA 4KVGB 2MSED 4FN2A 2INNE 2X38A 4M02A 1C76A 3IG3A 1WM2A 3Q8AA 2VRRB 4PYZA 4GLSC 2LASA 2CKHB 2CS4A 4II3B 3PZDA 4RF0A 3QAQA 4YTPB 5JHAA 4DQOC 2VZKB 4KIKA 4RGTA 3WIMA 4D2KA 1D6EC 4C7YA 1WX7A 1J7BA 1ZKHA 4M0WB 2NMQA 4ZRJA 2AWTA 1E90A 3CMMB 5E6JA 1YQBA 3U4EG 2LI5A 3W1SC 3W1YA 1V9JA 1QT9A 2ZVNA 4OZAA 2GBNA 2V3SA 3ZW3A 4CHKA 4A90A 3O65B 2OOBB 4N59A 4B9KA 3ZRFA 2KWUB 3Q8EA 5D3DA 1C4CA 1JALA 1FFUA 3NVVA 3WA0A 3AXCA 2MBBB 5LNK1 4HJGE 1FIQA 1D5MC 4FLHA 1K50A 4ZHPA 1QOGA 1P98A 2GMIC 4BKGA 1JROA 1NDDA 4ICUA 2E3TA 4HDOA 4WH4A 1E7UA 3TEYA 1HE8A 1IPGA 2BYVE 4ANWA 4ARCA 3QHTA 3DHHC 1DOXA 4MT5A 4KGRA 4W9DA 1VZ6A 3Q3NC 4KDIC 1E6EB 3AEEB 4C56C 3B9JA 4IW0A 5G55A 1MG4A 4K3CA 2JQRB 2HE7A 2K8BA 4XYCA 2NVUI 2IY0B 5EE9A 4BZAA 2FIFA 5DPRA 3NS8A 5CHWA 2KWDA 1DYQA 3VFKA 2KMCA 3QARA 1WGHA 1GPXA 1ACCA 1R4MI 1C4PA 4HKZE 2KJRA 4P16A 1E8WA 2NBUA 4JWSC 3JYUA 3MP9A 3VH3B 3VH4B 2IGDA 2YLMA 3ZQ4A 4A55A 3SFEB 3BZDB 3QK0A 2BTEA 2WX1A 2N7DA 4OHJA 3PZ8A 3RNEC 3AECB 3Q8FA 2KJHB 2CHZA 1UH6A 1V1PB 2Y5BB 2K25A 2KLCA 2DLBA 3U2SC 1XXGA 1WRIA 3KUZA 3AEFB 3FILB 4F7ZA 4NAWA 1Z5SB 3O13A 4EOYA 4CQNA 5C3JB 2PE9A 5D7GA 3KWLA 3BVGA 4W9GA 4IG7B 2ZJDA 3GP7A 2K39A 3BIID 2C60A 2JT4B 1L0YB 3P1MA 5KHQA 1ZXHA 2WXKA 5LXIB 4HEA1 2KFJA 3Q3FA 2PEAA 2MBEA 3ZDMC 3A1QA 5IOIA 1ZE3D 1LXDA 1OFFA 4MGYE 2BQQA 3PGEA 3WAOA 2C7MB 1N60A 1S3SG 2WXMA 1XD3B 2W3SA 4NQLB 3GS2A 2SEBD 1SGHA 1TS2A 1JWAD 2WYQA 2HJ1A 1YJIA 1NI2A 3H7PB 4EZLA 3T8MA 1WGDA 1STEA 2WXPA 1RYJA 2M8SA 1UGMA 1CQVA 2OJWA 3Q14C 1YX6B 1XO3A 3SDLC 4HDQA 4WJNA 4DDID 3RT3B 2B3AA 2V9HA 3ZJUA 2BS3B 1IGDA 1TGZB 3ML8A 1VDVA 2L32A 2M4NA 1D3ZA 3DBRB 3HHMA 2O6VA 4YTMB 2G9HD 4IWOA 1KLVA 4ARIA 1N61A 1V2YA 3W9CB 3PLUA 3DBHB 2AQ3B 2ONQA 3JSVB 1VLBA 1WIAA 3TBLD 2KTRA 4GOCA 4AJWA 4HWIB 1IUEA 4DHZB 2PIAA 3QCAA 4WJQA 3UINB 3V62A 3CIRB 1SB3C 2LJ5A 4DXAB 4K7UA 2YVCA 1L0VB 3Q3MC 2M0XA 4KGTA 1KH0A 2BYEA 4LLGM 3MJ5A 1FNWA 2RDGA 2WXLA 3VR9B 4JGHB 3RYTA 4F8CB 3I5JC 3NS1A 3EECA 2DWQA 4GGQA 2W82A 1IGCA 3I9V1 4HCPB 1Q10A 1T0RC 4AJYB 3TEXA 1C79A 4AS1A 1K53A 3RMKC 1V49A 1JQ4A 4NAMA 2RSUA 1N5XA 5E6PA 3SU8X 3LYYA 3A33B 2L00B 4LDTD 2FCQA 3T3OA 4QAYA 3L13A 5IO9A 4MSQB 4HPMB 5L95C 3L17A 4N6EB 5DPWA 3VVWB 3M3JA 3Q8CA 3DWGC 2L52A 2CHWA 2NTTA 1IBXA 4P6VF 2Y5PA 2JSVX 4GDKB 2FCNA 4WURA 1L4DB 1AN8A 1K52A 1YX5B 2BT6A 2KX0A 1LM8B 2W3RA 4FHJA 3L0WB 4Q2JA 1WY8A 1JMLA 4MM3B 1KFYB 3NVYA 5TR5A 1QF6A 3DHGC 1OQRA 2LVQA 3TEWA 3AE3B 1T5XD 2RGFA 4B0MA 3TEZA 2JX5A 3B2FA 4FJZA 5EDSA 4EZKA 2AL6A 5I4DA 2BF8B 5IN7A 3V61A 3SHQA 4DHZE 1SXTA 2KD0A 2HDEA 2RD0A 3Q69A 4JE3B 2DZJA 1HZ6A 1NENB 3B1LX 3UIOB 2PVOD 3AM9A 2LJIA 4TUUA 4LNNA 1B1ZA 3IVFA 2CU3A 3NVWA 3R66C 5AZHA 3K9OB 2INCC 4G50A 3KYCD 1C4AA 1K51A 2L1AA 4P7IA 4GN1A 2D11A 1MI0A 3P4QB 2BS4B 2KDFB 3PHXB 1MHHE 2MP2A 2RPVA 5AZFA 5T8IA 4BAXA 2KMAA 2QDFA 2QIEB 3R7RA 3RZFA 1H8CA 1DOYA 3K9PB 2N7JA 3WANA 1VRAB 5BMGA 2D5GA 2WXQA 5BYQA 2DZKA 3UI3A 4C7ZA 1RAXA 4HPPA 4CO7A 2NS5A 3IAS1 2R2QA 4ZYSA 3CSTA 1KM7A 1TY0A 2CHXA 3TUOA 2NPTB 1YD8U 2MX2A 2JY6A 5G5GA 2NR2A 2OHFA 1CMXB 2IGGA 1QOBA 5MPOA 4C80A 1F2RC 3EUB2 3HIZA 4FBJB 5DPTA 2JPHA 5J2RA 5D94A 1KLGD 2WU5B 3APFA 1FFVA 2DX5B 4XC2A 2LGDA 5IA7A 3E9SA 1HTQA 1HEZE 4US8A 1TKEA 2QILA 3VTUA 3ZNID 3PSEB 1OQYA 1E9MA 2R2OA 3L10B 2JXXA 5CHVC 3SD5A 3UQBA 1WE7A 2DNFA 3P4SB 5CTRC 3T9LA 3KUCB 2WXRA 3H9DA 4MGZE 1KJTA 1M94A 2SAKA 2WX0A 1JWMD 3HVZA 2I1JA 3MTNB 1FCLA 2VZKD 4IC7B 3V3XA 4DXGA 5JH5C 2C7HA 3APDA 3VHTC 2Z0DB 2EELA 4PYUA 4MEMA 2IO3B 2ZZPB 1FO4A 3H8HA 2MH7A 2M17A 1WR1A 5JZEB 2LGYA 4R3DA 3FC4A 1I42A 3MHZA 2N9KA 1RLFA 3LXFA 4O1NA 2J4XA 2NBVB 4ZHOA 3QA8A 2N4FA 2CJNA 3ZNZB 1E7VA 5AZGA 1SF0A 1F52A 5GMVA 3ZUNA 1WJ4A 4KKJA 1MVKA 4AWJA 1Y56A 5AUIA 1WGKA 1HXYD 3AMZA 1KTKA 1XCTL 2WXFA 1J0GA 3KUDB 5E6NA 3AE2B 1I35A 1TZOA 3PO0A 4BBNF 4NZLB 2LD9A 2UYZB 4S17A 3RNCC 4DBGA 4WWPA 4YXDB 2LGSA 3IT6B 2X8XX 4A8XC 1GOZA 3U7ZA 2MWSB 1WGYA 4WWNA 4YSYB 4J6IA 3DBLB 1F77A 3HK0A 3ZKJC 3X23A 2PJHA 4LK0M 4KIKB 4W9HA 3DPDA 2KKCA 4ASWC 4GXBA 1NEKB 4IM0A 1MPEA 1V97A 1UGJA 4EUTA 1DGJA 3RNBC 3Q6BA 4XDDA 5CX3A 1UWMA 4GSWA 2N1WA 3PTFC 5HG2A 4XX5A 3IXSA 1RWSA 2LXCA 2O2VA 1EU3A 1NBFC 1RRBA 4E71A 2C7NB 2EKIA 3U30A 3GE8C 4WQMA 1TKYA 4X57B 3NVZA 5JHBA 2L83A 2L05A 3NZUA 2KXJA 3BY4B 4MH0E 5G2NA 4LNOA 3RNAC 4LNIA 1AW7A 4KGSA 3KQ4A 4J3OD 2WXNA 2KTFA 1WGRA 4GDLA 1LO5D 2KT7A 1F9JA 1YQ4B 4EE2A 1F1HA 3N9YC 3H6NA 2IGHA 5J17A 5GXGB 2JZ3B 3UF8A 2D3BA 3RPFC 4RNAA 5FR3A 1E0ZA 3AU4A 1L6UA 4JWUC 4WQOB 4ZRIA 3PRPB 4KKIA 3ZTDA 3I3TB 4MACA 3W1SA 1C1YB 2FUHB 2ZW0A 3OLMD 2KO3A 3B08A 1VR9A 2L7RA 1VZ7A 2OEDA 4K3BA 3MC9A 3R3MA 2WDVB 2JZZA 3PRZA 4RGOS 4XDCA 2GI9A 4NJ6A 1AARA 2BBCA 4W9LA 4BFRA 4EEWA 1SBBB 3VRBB 2VH2A 1HZ5A 4GIVA 1J7CA 1WJ6A 5BYSA 2MQJA 2QCZA 3CF6E 2XK5A 2ASQA 4IOIE 4ZDVA 4JLCA 3V05A 4EFOA 2KX3A 4C00A 4TKNA 2D3GA 2FUG1 3I63C 3ZYYX 1WJNA 1L4ZB 2FCSA 4MGIE 2J0KA 2LEKA 4W9IA 3VAWA 1EM7A 2BKFA 3OJ4B 1YMHE 2HJ8A 3BVZA 4ICVA 4MELA 2J42A 2CJOA 4IM3A 4NAWB 1V5OA 1XCQL 3LDZE 4G11A 4F1SA 2JU6X 4ZYNA 1WSPA 1R4MB 1Q0WB 1XLPA 1I4HA 4RCOA 1EUVB 2ZNVB 3ZVVA 5BMHA 1L0XB 2RDBC 2GBKA 2N7EA 4K7SA 1FRRA 1ZXIA 1P1AA 4MH8A 2KJ6A 2C9WB 2HTME 3C8YA 3MJWA 2JZPA 2V1YA 1JW9D 1TYGB 2WXJA 1SEBD 3QC8B 4HK2A 2CU1A 1T0SC 5IKCM 2V3NA 4EKUA 3NZ3A 2I38A 1WRDB 3HVDA 1N6ZA 4REZA 1YNTE 1Q1OA 4P1CC 4B6WA 1MG8A 1OQQA 2N9LA 1J7AA 3LJ3A 1WXSA 3APCA 2MJ3A 1FCCC 5LLIA 1WI0A 1ESFA 3HM3A 3SR6A 3QJZA 1F0ZA 3HRDD 4IKGA 1ZDXA 2W54A 1LQBA 2ZPYA 4W9CA 1QILA 1TY2A 2KACA 4CYEA 3W2DA 4HPLB 4RH6A 2O6VB 1CZPA 1P7FA 4IWPA 1G6JA 2XN9C 4AUQC 2Z8LA 1HA5A 1AYFA 1Q5WB 4MJSA 2IYDB 2KDMA 2KTRB 5FK9C 1D4BA 2IO1B 2YEPB 4YT0B 3GE3C 3WAMA 4FJVB 1KOTA 2LHDA 4C4VA 1A70A 5D6JB 2BVCA 1M4VA 1WYWB 2MA9B 2TSSA 4LNKA 4JX1C 3OG5A 5CHFA 3ONSA 3JVZX 2MCNB 4LCDE 4KZ0A 4GMVA 3DDCB 3AB5A 1XLQA 2J0MA 2JXTA 4FXCA 2JUOA 5KHOA 3M63B 2BGFA 4ZRPA 2W55A 1T0YA 2Y5CA 3A4SC 2PVGC 2PTLA 1WMHA 1UF0A 1GC6A 1WXVA 1WXQA 1GUAB 2BKRB 2W9NA 5C23A 2PW9A 1I4PA 3CWIA 3TSSA 2KAJA 4M8MA 1PGAA 1GG3A 3PLVA 5G5HA 1EO6A 4ZRKA 2DZMA 3AV8A 1R4NI 2IZVB 1ET6A 1YOVB 2ZCCA 3C0RB 4NY0A 4RFBA 3ENEA 2MEKA 1D5ZC 1XLOA 1T0QC 1I4XA 2ON8A 3A9JA 1FXTB 4RM9A 1SSNA 3RNGC 2ZPNA 3KWVA 2WWZA 2WLBA 1J8CA 2MBOA 3UGBB 2WXHA 1MJDA 1NI3A 3OAWA 1TT5B 4KDLB 2YEPF 4GU2A 5IAAC 3ZJVA 1IBXB 3WCQA 2H89B 2UWQA 2JVCA 4MDKE 1P9DU 2DYBA 3NOBA 3OJ3A 4BBNC 1UNSA 1VJKA 3NG0A 4AQ7A 2AQ2B 2IJ0A 4FADA 3MC0B 4KZCA 1JWBD 3GOEA 1PUTA 4RM8A 1L5PA 4TMAB 1JWUD 3MHSD 4YSXB 4ANVA 1PGXA 2DBYA 1KLUD 2BYTA 1YIWA 3B0AA 1YN5A 5BO4B 4WAFA 3IBEA 1WZ3A 2E6XA 1WFYA 1T6BX 3Q3JA 4DXFA 2DYMA 3VTWA 4BKSD 3IFWB 2RPQA 3N32A 1RM6C 2MW5A
chains in the Genus database with same CATH topology
3D32A 3ECIA 2WX1A 2N7DA 4AWJA 4GB9A 2EMSA 3N3KB 2EKEC 2MBHA 2KJHB 2CHZA 3PREA 4K81A 1J0GA 3PV1A 4A3PA 1UH6A 2Y5BB 2K25A 2KLCA 3KUDB 5E6NA 3VXWA 4G0NB 2KFKA 1WF9A 1I35A 4E74A 4DHJB 3KUZA 3IHPC 3L16A 5E6OA 4BBNF 3DOWA 2LVPA 2LD9A 4F7ZA 4MJSB 4NAWA 3H1UA 3NZSA 2UYZB 1Z5SB 2LXAA 4EOYA 4DBGA 4WWPA 4M8NA 2LWPA 2PE9A 5D7GA 4WJOA 4W9GA 2G4DB 4IG7B 2ZCBA 4IWQA 2ZJDA 2MWSB 1WGYA 4G3XB 4WWNA 4J6IA 2K39A 2MBQA 4WJPA 3HK0A 2MP2B 2C60A 3ZKJC 1QZEA 2JT4B 3X23A 1K8RB 2PJHA 3GZNI 4GDKA 5KHQA 4KIKB 5LXIB 2KDIA 2KFJA 4W9HA 2KC1A 2PPHA 4FJYA 3DPDA 2KKCA 5LXHA 3Q3FA 4ASWC 3DVNU 3ML9A 4GXBA 4K1RB 1WX8A 4IM0A 2PEAA 2LRUA 2MBEA 3A1QA 4MM3A 3RZWC 1LXDA 3ZDMC 4MGYE 3PGEA 4BVUC 4AOFA 4EUTA 3WAOA 1WXAA 2C7MB 4KV2A 3TL5A 5CX3A 2IY1B 1V86A 1YJ1A 1S3SG 1SE9A 3RUIB 1XD3B 4GSWA 2N1WA 3PTFC 4XX5A 2LXCA 2O2VA 1WMHB 4NQLB 4OVUA 1NBFC 1UELA 1RRBA 4W9JA 3U8ZA 4E71A 2C7NB 2A4ZA 1SGHA 3U30A 2WYQA 4JIOU 1NI2A 3H7PB 2N1VA 4KSKC 4X57B 4WWOA 3T8MA 4EZLA 1WGDA 5D2MB 4DK5A 5JHBA 2KQSA 3HM6X 3NZUA 2L05A 4JL9A 1IP9A 2KXJA 3BY4B 4MH0E 2XEWA 3A9KA 2M8SA 2GBJA 1UGMA 5G2NA 3ZLZA 1YX6B 2OJRA 3SDLC 1WX9A 4HDQA 4WJNA 3UIPB 2KDBA 2IO0B 3RT3B 4DDID 2B3AA 2KTFA 1WGRA 2Z0EB 1TGZB 3ML8A 2FIDA 4DHJD 2LZ6A 4GDLA 2M4NA 4HXDA 5C1ZA 1D3ZA 3QQ8B 1TBEA 1F9JA 2O6VA 3HHMA 4IWOA 4DWFA 3PHWB 3DCGA 4PS7A 3H6NA 1KLVA 1XT9B 3AULA 5J17A 1V2YA 2L3ZA 3A9JB 3PLUA 1GJZA 1XQQA 2JZ3B 3UF8A 1RFAA 4W9FA 3JSVB 4NQKE 3V6CB 1WIAA 3NY5A 3TBLD 4LDTB 2KTRA 3AU4A 3KW5B 4FULA 4GOCA 1E8ZA 2KWVB 4WQOB 4ZRIA 3PRPB 4NJ7A 4AJWA 3M62B 3ZTDA 4HWIB 2V4LA 1OEYJ 3I3TB 3JW0X 3ZO5B 2HTHA 2CR5A 1UZXB 3NHEB 2KVRA 3PVLA 4DHZB 3QCAA 1OTRB 4WJQA 1UD7A 3UINB 3W1SA 2KLGA 3QX1A 2ZVOA 3V62A 1C1YB 2FUHB 3OLMD 2LJ5A 3QWZB 4WAAA 2KO3A 4A20A 4ANXA 3B08A 4DDGD 4K7UA 4DXAB 2Z59B 2L7RA 2YVCA 3R3MA 2K8HA 1GNUA 2M0XA 2BYEA 2ZEQA 2JZZA 3PRZA 3PS6A 4NJ6A 1AARA 2DAFA 4W9LA 2KN5A 3X0WA 1A5RA 4BFRA 2JRIB 3RCZA 4YL8A 4EEWA 4II2B 3KVFB 1C3TA 3KYDD 4PS3A 4GIVA 1WJ6A 2K8CA 3N30A 3ZRCA 2C5LC 4NNJB 1UBIA 2MQJA 2JWZA 4JGHB 2BWFA 3DQVA 3RYTA 2NPTA 4F8CB 3CF6E 2XK5A 3EECA 4GGQA 2ASQA 4ZDVA 4JLCA 3VTVA 4EFOA 2LVOA 3CSFA 4HCPB 4FHKA 2KX3A 2JF5A 4B95A 4TKNA 4BKTA 2D3GA 4AJYB 3QIJA 3L08A 4FA6A 1WZ0A 4I6NB 2FNJB 2N9XA 1WXMA 5L83A 1V49A 1WJNA 3EHVA 3ALBA 3UQBA 1EF5A 2FCSA 4MGIE 4BKSA 2J0KA 2FAZA 1U4AA 1P3QU 2KFKB 3PT2B 1TTNA 2RSUA 1UBQA 1VD2A 2KDEB 2D07B 2K1FA 4W9IA 3VAWA 5E6PA 3SU8X 2BKFA 3OJ4B 3L54A 1VCBA 1E5WA 3A33B 2L00B 4LDTD 2FCQA 2HJ8A 4ICVA 4MELA 2KC2A 4IM3A 4NAWB 3L13A 4TV3A 4E3CA 1V5OA 4MSQB 2KQ7A 4HPMB 3LDZE 3L17A 4G11A 4F1SA 5L95C 5DCNA 3WAPA 1SIFA 3DBSA 3EC8A 3PRMB 4K7WA 5DPWA 2K6DB 3VVWB 3M3JA 1P0RA 2DZIA 4KSLC 4ZYNA 2CHWA 1Q0WB 1WGGA 2BPSA 5AEKB 4AP4C 5J18A 1TZ1A 1EUVB 2ZNVB 3ZVVA 4HCNB 3DVNV 4GDKB 1ZW7A 4MSMB 2FCNA 2GBKA 2G3QB 4IM2A 3ZIMA 2N7EA 4K7SA 2GBRA 2AL3A 1YX5B 3VQIA 2KX0A 1LM8B 1P1AA 2DYOA 3TIXA 2KJ6A 4FHJA 3L0WB 2C9WB 4PS8A 1V80A 1WY8A 2IO2B 3MJWA 1Z2MA 3RULA 2V1YA 2KK8A 5TR5A 3VDZA 4I6LB 1LFDA 1L2NA 2LVQA 3QC8B 4HK2A 2CU1A 2KHWB 2DENB 3H7SA 2ZNVC 2L0TA 2RGFA 1JRUA 4EKUA 1WE6A 1WRDB 4LJOB 3TMPB 2BYFA 2KANA 2O2VB 2M1MA 4FJZA 3AI5A 1BT0A 1WM3A 3DBLI 3ZNGC 5EDSA 1Q1OA 3BINA 3EFUA 4B6WA 1MG8A 4EZKA 2AL6A 1E8XA 2L0FA 2BF8B 2K6QA 2PE6B 3AU5A 3V61A 3LJ3A 2FCMA 4W9KA 1WR6E 1WXSA 3PPAA 3APCA 3SHQA 4DHZE 3KH0A 2N9EB 3VUWA 1GC7A 5LLIA 2KOXA 2KD0A 2REXA 1WI0A 3HM3A 3QJZA 3A9KB 1E8YA 2RD0A 2MRPA 2I1KA 3U7DA 1LQBA 2ZPYA 4IUMB 4W9CA 2A5UA 4CYEA 3R7QA 2DZJA 2GBMA 3ZNHB 3B1LX 4HPLB 4GDLB 3UIOB 2O6VB 2RR9A 4JQWC 5FR6A 2LRWA 4TUUA 4IWPA 1EF1A 3IVFA 1G6JA 2HD5B 1Y8RC 1ISNA 2KZRA 2J7QB 3R66C 5AZHA 4AUQC 3K9OB 2IBIB 1H4RA 2AEHA 2NBWB 2KWCA 4G50A 2EMTA 3KYCD 1Q5WB 1OGWA 2IYDB 4MJSA 4HLEA 2KTRB 4N9F4 3S2AA 4OVVA 4KVGB 2D2QA 2LGXA 2MSED 3TCAA 4FN2A 1V81A 4GN1A 4P7IA 2IO1B 2D11A 1WM2A 3IG3A 3WAMA 3UQAA 4FJVB 2VRRB 2KDFB 3PHXB 4PYZA 1KOTA 3P2BA 5D6JB 2MP2A 2LASA 2CKHB 1J8CA 3DBRI 2CS4A 5AZFA 4II3B 3PZDA 1WYWB 2MA9B 2QHOA 2XBBC 2KMAA 3QAQA 5CHFA 3ONSA 1J19A 3JVZX 4RMAA 2MCNB 3R7RA 4LCDE 4KZ0A 5JHAA 3RZFA 4GMVA 4KIKA 3DDCB 1H8CA 3WIMA 3K9PB 5DPSA 3DBHI 2J0MA 1WX7A 3WANA 1OEYA 1ZKHA 4M0WB 4ZRJA 2AWTA 1E90A 3CMMB 2D10A 1YQBA 2JUOA 5KHOA 2DZKA 3M63B 2BGFA 1RAXA 2LI5A 4CO7A 3W1SC 3W1YA 1V9JA 1V6EA 2DHZA 2ZVNA 4HJKA 2GBNA 2V3SA 2NS5A 4MGKE 1T0YA 4LJPB 3ZW3A 2R2QA 4CHKA 2LUEA 3A4SC 1PQSA 2OOBB 2WDTB 1KM7A 3CSTA 3O65B 2JRHA 1WMHA 2CHXA 2L8JA 4B9KA 3ZRFA 2KWUB 1YD8U 1GC6A 2NPTB 2XK5B 2MX2A 4BOSC 1WXVA 2JY6A 1X1MA 1GUAB 2AYOB 2BKRB 3RD2A 3WA0A 2NR2A 1CMXB 3AXCA 5HKHA 3H7PA 2MBBB 2W9NA 5C23A 2G45B 3VUYA 3HIZA 4FBJB 5DPTA 4M8MA 1GG3A 2JPHA 2O6VD 4FLHA 5J2RA 5D94A 3PLVA 3APFA 1EO6A 4ZRKA 2DZMA 1R4NI 3WALA 2DX5B 1P98A 2GMIC 3A4RA 4XC2A 4BKGA 2LGDA 3V60A 2IZVB 5IA7A 1NDDA 4ICUA 4NY0A 2ZCCA 3C0RB 3ENEA 4HDOA 3A1QB 4TQ1A 1E7UA 3TJPA 4URKA 3DVGY 1WJUA 3A9JA 1HE8A 1FXTB 1IPGA 4RM9A 3VTUA 3ZNID 3PSEB 2BYVE 1ZGUB 1V5TA 2ZPNA 4ANWA 1OQYA 2WWZA 2R2OA 3QHTA 2JXXA 3L10B 5CHVC 3SD5A 3JSVA 1WE7A 2MBOA 5CTRC 3UGBB 4W9DA 3T9LA 4XZ4A 3KUCB 4W9EA 3ZDTA 1L7YA 3OAWA 3H9DA 4MGZE 4KDLB 4GU2A 1KJTA 4I6PA 4A3OA 1M94A 2WX0A 4KDIC 5IAAC 2I1JA 3MTNB 4IC7B 5JH5C 3M95A 4IW0A 2UWQA 2JVCA 4MDKE 1P9DU 2C7HA 1WH3A 2DYBA 5G55A 3APDA 2J0JA 3VHTC 3NOBA 2NCNA 2Z0DB 4PYUA 3OJ3A 4BBNC 2GOWA 4MEMA 2IO3B 2HE7A 2K8BA 2NVUI 2ZZPB 2IY0B 2M17A 1WR1A 4FADA 5JZEB 2FIFA 4KZCA 2LGYA 5DPRA 3NS8A 5CHWA 1I42A 1RLFA 4BOZB 3GOEA 2G4SA 4RM8A 2NBVB 3VFKA 2KMCA 4ANUA 3QARA 3QA8A 2N4FA 3MHSD 1IYFA 1WGHA 4ANVA 2BWES 1R4MI 2DAJA 3V6EB 2KJRA 1E8WA 2NBUA 1S1QB 1YIWA 2MLBA 3B0AA 4NPNA 3JYUA 3VUXA 3ZTCA 5BO4B 3IBEA 1WZ3A 3VH3B 1WFYA 3ZNZB 1E7VA 5AZGA 3VH4B 3Q3JA 4HVBA 2DYMA 2KNBA 2N9PC 3VTWA 4EZJA 2YLMA 5GMVA 4BKSD 3IFWB 2RPQA 3ZUNA 3N32A 4TQ0A 2L76A 1WJ4A 3DVGX 3QK0A 2MW5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3D32 A;  3ECI A;  2WX1 A;  2N7D A;  4AWJ A;  4GB9 A;  2EMS A;  3N3K B;  2EKE C;  2MBH A;  2KJH B;  2CHZ A;  3PRE A;  4K81 A;  1J0G A;  3PV1 A;  4A3P A;  1UH6 A;  2Y5B B;  2K25 A;  2KLC A;  3KUD B;  5E6N A;  3VXW A;  4G0N B;  2KFK A;  1WF9 A;  1I35 A;  4E74 A;  4DHJ B;  3KUZ A;  3IHP C;  3L16 A;  5E6O A;  4BBN F;  3DOW A;  2LVP A;  2LD9 A;  4F7Z A;  4MJS B;  4NAW A;  3H1U A;  3NZS A;  2UYZ B;  1Z5S B;  2LXA A;  4EOY A;  4DBG A;  4WWP A;  4M8N A;  2LWP A;  2PE9 A;  5D7G A;  4WJO A;  4W9G A;  2G4D B;  4IG7 B;  2ZCB A;  4IWQ A;  2ZJD A;  2MWS B;  1WGY A;  4G3X B;  4WWN A;  4J6I A;  2K39 A;  2MBQ A;  4WJP A;  3HK0 A;  2MP2 B;  2C60 A;  3ZKJ C;  1QZE A;  2JT4 B;  3X23 A;  1K8R B;  2PJH A;  3GZN I;  4GDK A;  5KHQ A;  4KIK B;  5LXI B;  2KDI A;  2KFJ A;  4W9H A;  2KC1 A;  2PPH A;  4FJY A;  3DPD A;  2KKC A;  5LXH A;  3Q3F A;  4ASW C;  3DVN U;  3ML9 A;  4GXB A;  4K1R B;  1WX8 A;  4IM0 A;  2PEA A;  2LRU A;  2MBE A;  3A1Q A;  4MM3 A;  3RZW C;  1LXD A;  3ZDM C;  4MGY E;  3PGE A;  4BVU C;  4AOF A;  4EUT A;  3WAO A;  1WXA A;  2C7M B;  4KV2 A;  3TL5 A;  5CX3 A;  2IY1 B;  1V86 A;  1YJ1 A;  1S3S G;  1SE9 A;  3RUI B;  1XD3 B;  4GSW A;  2N1W A;  3PTF C;  4XX5 A;  2LXC A;  2O2V A;  1WMH B;  4NQL B;  4OVU A;  1NBF C;  1UEL A;  1RRB A;  4W9J A;  3U8Z A;  4E71 A;  2C7N B;  2A4Z A;  1SGH A;  3U30 A;  2WYQ A;  4JIO U;  1NI2 A;  3H7P B;  2N1V A;  4KSK C;  4X57 B;  4WWO A;  3T8M A;  4EZL A;  1WGD A;  5D2M B;  4DK5 A;  5JHB A;  2KQS A;  3HM6 X;  3NZU A;  2L05 A;  4JL9 A;  1IP9 A;  2KXJ A;  3BY4 B;  4MH0 E;  2XEW A;  3A9K A;  2M8S A;  2GBJ A;  1UGM A;  5G2N A;  3ZLZ A;  1YX6 B;  2OJR A;  3SDL C;  1WX9 A;  4HDQ A;  4WJN A;  3UIP B;  2KDB A;  2IO0 B;  3RT3 B;  4DDI D;  2B3A A;  2KTF A;  1WGR A;  2Z0E B;  1TGZ B;  3ML8 A;  2FID A;  4DHJ D;  2LZ6 A;  4GDL A;  2M4N A;  4HXD A;  5C1Z A;  1D3Z A;  3QQ8 B;  1TBE A;  1F9J A;  2O6V A;  3HHM A;  4IWO A;  4DWF A;  3PHW B;  3DCG A;  4PS7 A;  3H6N A;  1KLV A;  1XT9 B;  3AUL A;  5J17 A;  1V2Y A;  2L3Z A;  3A9J B;  3PLU A;  1GJZ A;  1XQQ A;  2JZ3 B;  3UF8 A;  1RFA A;  4W9F A;  3JSV B;  4NQK E;  3V6C B;  1WIA A;  3NY5 A;  3TBL D;  4LDT B;  2KTR A;  3AU4 A;  3KW5 B;  4FUL A;  4GOC A;  1E8Z A;  2KWV B;  4WQO B;  4ZRI A;  3PRP B;  4NJ7 A;  4AJW A;  3M62 B;  3ZTD A;  4HWI B;  2V4L A;  1OEY J;  3I3T B;  3JW0 X;  3ZO5 B;  2HTH A;  2CR5 A;  1UZX B;  3NHE B;  2KVR A;  3PVL A;  4DHZ B;  3QCA A;  1OTR B;  4WJQ A;  1UD7 A;  3UIN B;  3W1S A;  2KLG A;  3QX1 A;  2ZVO A;  3V62 A;  1C1Y B;  2FUH B;  3OLM D;  2LJ5 A;  3QWZ B;  4WAA A;  2KO3 A;  4A20 A;  4ANX A;  3B08 A;  4DDG D;  4K7U A;  4DXA B;  2Z59 B;  2L7R A;  2YVC A;  3R3M A;  2K8H A;  1GNU A;  2M0X A;  2BYE A;  2ZEQ A;  2JZZ A;  3PRZ A;  3PS6 A;  4NJ6 A;  1AAR A;  2DAF A;  4W9L A;  2KN5 A;  3X0W A;  1A5R A;  4BFR A;  2JRI B;  3RCZ A;  4YL8 A;  4EEW A;  4II2 B;  3KVF B;  1C3T A;  3KYD D;  4PS3 A;  4GIV A;  1WJ6 A;  2K8C A;  3N30 A;  3ZRC A;  2C5L C;  4NNJ B;  1UBI A;  2MQJ A;  2JWZ A;  4JGH B;  2BWF A;  3DQV A;  3RYT A;  2NPT A;  4F8C B;  3CF6 E;  2XK5 A;  3EEC A;  4GGQ A;  2ASQ A;  4ZDV A;  4JLC A;  3VTV A;  4EFO A;  2LVO A;  3CSF A;  4HCP B;  4FHK A;  2KX3 A;  2JF5 A;  4B95 A;  4TKN A;  4BKT A;  2D3G A;  4AJY B;  3QIJ A;  3L08 A;  4FA6 A;  1WZ0 A;  4I6N B;  2FNJ B;  2N9X A;  1WXM A;  5L83 A;  1V49 A;  1WJN A;  3EHV A;  3ALB A;  3UQB A;  1EF5 A;  2FCS A;  4MGI E;  4BKS A;  2J0K A;  2FAZ A;  1U4A A;  1P3Q U;  2KFK B;  3PT2 B;  1TTN A;  2RSU A;  1UBQ A;  1VD2 A;  2KDE B;  2D07 B;  2K1F A;  4W9I A;  3VAW A;  5E6P A;  3SU8 X;  2BKF A;  3OJ4 B;  3L54 A;  1VCB A;  1E5W A;  3A33 B;  2L00 B;  4LDT D;  2FCQ A;  2HJ8 A;  4ICV A;  4MEL A;  2KC2 A;  4IM3 A;  4NAW B;  3L13 A;  4TV3 A;  4E3C A;  1V5O A;  4MSQ B;  2KQ7 A;  4HPM B;  3LDZ E;  3L17 A;  4G11 A;  4F1S A;  5L95 C;  5DCN A;  3WAP A;  1SIF A;  3DBS A;  3EC8 A;  3PRM B;  4K7W A;  5DPW A;  2K6D B;  3VVW B;  3M3J A;  1P0R A;  2DZI A;  4KSL C;  4ZYN A;  2CHW A;  1Q0W B;  1WGG A;  2BPS A;  5AEK B;  4AP4 C;  5J18 A;  1TZ1 A;  1EUV B;  2ZNV B;  3ZVV A;  4HCN B;  3DVN V;  4GDK B;  1ZW7 A;  4MSM B;  2FCN A;  2GBK A;  2G3Q B;  4IM2 A;  3ZIM A;  2N7E A;  4K7S A;  2GBR A;  2AL3 A;  1YX5 B;  3VQI A;  2KX0 A;  1LM8 B;  1P1A A;  2DYO A;  3TIX A;  2KJ6 A;  4FHJ A;  3L0W B;  2C9W B;  4PS8 A;  1V80 A;  1WY8 A;  2IO2 B;  3MJW A;  1Z2M A;  3RUL A;  2V1Y A;  2KK8 A;  5TR5 A;  3VDZ A;  4I6L B;  1LFD A;  1L2N A;  2LVQ A;  3QC8 B;  4HK2 A;  2CU1 A;  2KHW B;  2DEN B;  3H7S A;  2ZNV C;  2L0T A;  2RGF A;  1JRU A;  4EKU A;  1WE6 A;  1WRD B;  4LJO B;  3TMP B;  2BYF A;  2KAN A;  2O2V B;  2M1M A;  4FJZ A;  3AI5 A;  1BT0 A;  1WM3 A;  3DBL I;  3ZNG C;  5EDS A;  1Q1O A;  3BIN A;  3EFU A;  4B6W A;  1MG8 A;  4EZK A;  2AL6 A;  1E8X A;  2L0F A;  2BF8 B;  2K6Q A;  2PE6 B;  3AU5 A;  3V61 A;  3LJ3 A;  2FCM A;  4W9K A;  1WR6 E;  1WXS A;  3PPA A;  3APC A;  3SHQ A;  4DHZ E;  3KH0 A;  2N9E B;  3VUW A;  1GC7 A;  5LLI A;  2KOX A;  2KD0 A;  2REX A;  1WI0 A;  3HM3 A;  3QJZ A;  3A9K B;  1E8Y A;  2RD0 A;  2MRP A;  2I1K A;  3U7D A;  1LQB A;  2ZPY A;  4IUM B;  4W9C A;  2A5U A;  4CYE A;  3R7Q A;  2DZJ A;  2GBM A;  3ZNH B;  3B1L X;  4HPL B;  4GDL B;  3UIO B;  2O6V B;  2RR9 A;  4JQW C;  5FR6 A;  2LRW A;  4TUU A;  4IWP A;  1EF1 A;  3IVF A;  1G6J A;  2HD5 B;  1Y8R C;  1ISN A;  2KZR A;  2J7Q B;  3R66 C;  5AZH A;  4AUQ C;  3K9O B;  2IBI B;  1H4R A;  2AEH A;  2NBW B;  2KWC A;  4G50 A;  2EMT A;  3KYC D;  1Q5W B;  1OGW A;  2IYD B;  4MJS A;  4HLE A;  2KTR B;  4N9F 4;  3S2A A;  4OVV A;  4KVG B;  2D2Q A;  2LGX A;  2MSE D;  3TCA A;  4FN2 A;  1V81 A;  4GN1 A;  4P7I A;  2IO1 B;  2D11 A;  1WM2 A;  3IG3 A;  3WAM A;  3UQA A;  4FJV B;  2VRR B;  2KDF B;  3PHX B;  4PYZ A;  1KOT A;  3P2B A;  5D6J B;  2MP2 A;  2LAS A;  2CKH B;  1J8C A;  3DBR I;  2CS4 A;  5AZF A;  4II3 B;  3PZD A;  1WYW B;  2MA9 B;  2QHO A;  2XBB C;  2KMA A;  3QAQ A;  5CHF A;  3ONS A;  1J19 A;  3JVZ X;  4RMA A;  2MCN B;  3R7R A;  4LCD E;  4KZ0 A;  5JHA A;  3RZF A;  4GMV A;  4KIK A;  3DDC B;  1H8C A;  3WIM A;  3K9P B;  5DPS A;  3DBH I;  2J0M A;  1WX7 A;  3WAN A;  1OEY A;  1ZKH A;  4M0W B;  4ZRJ A;  2AWT A;  1E90 A;  3CMM B;  2D10 A;  1YQB A;  2JUO A;  5KHO A;  2DZK A;  3M63 B;  2BGF A;  1RAX A;  2LI5 A;  4CO7 A;  3W1S C;  3W1Y A;  1V9J A;  1V6E A;  2DHZ A;  2ZVN A;  4HJK A;  2GBN A;  2V3S A;  2NS5 A;  4MGK E;  1T0Y A;  4LJP B;  3ZW3 A;  2R2Q A;  4CHK A;  2LUE A;  3A4S C;  1PQS A;  2OOB B;  2WDT B;  1KM7 A;  3CST A;  3O65 B;  2JRH A;  1WMH A;  2CHX A;  2L8J A;  4B9K A;  3ZRF A;  2KWU B;  1YD8 U;  1GC6 A;  2NPT B;  2XK5 B;  2MX2 A;  4BOS C;  1WXV A;  2JY6 A;  1X1M A;  1GUA B;  2AYO B;  2BKR B;  3RD2 A;  3WA0 A;  2NR2 A;  1CMX B;  3AXC A;  5HKH A;  3H7P A;  2MBB B;  2W9N A;  5C23 A;  2G45 B;  3VUY A;  3HIZ A;  4FBJ B;  5DPT A;  4M8M A;  1GG3 A;  2JPH A;  2O6V D;  4FLH A;  5J2R A;  5D94 A;  3PLV A;  3APF A;  1EO6 A;  4ZRK A;  2DZM A;  1R4N I;  3WAL A;  2DX5 B;  1P98 A;  2GMI C;  3A4R A;  4XC2 A;  4BKG A;  2LGD A;  3V60 A;  2IZV B;  5IA7 A;  1NDD A;  4ICU A;  4NY0 A;  2ZCC A;  3C0R B;  3ENE A;  4HDO A;  3A1Q B;  4TQ1 A;  1E7U A;  3TJP A;  4URK A;  3DVG Y;  1WJU A;  3A9J A;  1HE8 A;  1FXT B;  1IPG A;  4RM9 A;  3VTU A;  3ZNI D;  3PSE B;  2BYV E;  1ZGU B;  1V5T A;  2ZPN A;  4ANW A;  1OQY A;  2WWZ A;  2R2O A;  3QHT A;  2JXX A;  3L10 B;  5CHV C;  3SD5 A;  3JSV A;  1WE7 A;  2MBO A;  5CTR C;  3UGB B;  4W9D A;  3T9L A;  4XZ4 A;  3KUC B;  4W9E A;  3ZDT A;  1L7Y A;  3OAW A;  3H9D A;  4MGZ E;  4KDL B;  4GU2 A;  1KJT A;  4I6P A;  4A3O A;  1M94 A;  2WX0 A;  4KDI C;  5IAA C;  2I1J A;  3MTN B;  4IC7 B;  5JH5 C;  3M95 A;  4IW0 A;  2UWQ A;  2JVC A;  4MDK E;  1P9D U;  2C7H A;  1WH3 A;  2DYB A;  5G55 A;  3APD A;  2J0J A;  3VHT C;  3NOB A;  2NCN A;  2Z0D B;  4PYU A;  3OJ3 A;  4BBN C;  2GOW A;  4MEM A;  2IO3 B;  2HE7 A;  2K8B A;  2NVU I;  2ZZP B;  2IY0 B;  2M17 A;  1WR1 A;  4FAD A;  5JZE B;  2FIF A;  4KZC A;  2LGY A;  5DPR A;  3NS8 A;  5CHW A;  1I42 A;  1RLF A;  4BOZ B;  3GOE A;  2G4S A;  4RM8 A;  2NBV B;  3VFK A;  2KMC A;  4ANU A;  3QAR A;  3QA8 A;  2N4F A;  3MHS D;  1IYF A;  1WGH A;  4ANV A;  2BWE S;  1R4M I;  2DAJ A;  3V6E B;  2KJR A;  1E8W A;  2NBU A;  1S1Q B;  1YIW A;  2MLB A;  3B0A A;  4NPN A;  3JYU A;  3VUX A;  3ZTC A;  5BO4 B;  3IBE A;  1WZ3 A;  3VH3 B;  1WFY A;  3ZNZ B;  1E7V A;  5AZG A;  3VH4 B;  3Q3J A;  4HVB A;  2DYM A;  2KNB A;  2N9P C;  3VTW A;  4EZJ A;  2YLM A;  5GMV A;  4BKS D;  3IFW B;  2RPQ A;  3ZUN A;  3N32 A;  4TQ0 A;  2L76 A;  1WJ4 A;  3DVG X;  3QK0 A;  2MW5 A; 
#chains in the Genus database with same CATH topology
 5BMI A;  1N5W A;  4OZB A;  4GB9 A;  2EMS A;  2MBH A;  3PV1 A;  3U52 E;  4G0N B;  2KFK A;  4E74 A;  4DHJ B;  3IHP C;  5E6O A;  3DOW A;  2INP E;  2JWU A;  2LVP A;  3NZS A;  2LXA A;  4M8N A;  2LWP A;  1FMA D;  4JPS A;  1C77 A;  2G4D B;  4XWT A;  1KF6 B;  4L2Y A;  2MBQ A;  3BYY B;  2MP2 B;  3AH7 A;  1QZE A;  1K8R B;  3GZN I;  1GAQ B;  2I2Y A;  1MHX A;  3ETR A;  2KC1 A;  2BB6 A;  3IAM 1;  2LUM A;  4K1R B;  3RZW C;  4BVU C;  2WXI A;  4AOF A;  4YTN B;  2IDY A;  1WXA A;  4KV2 A;  3TL5 A;  1V86 A;  1YJ1 A;  4KX6 B;  2LMC A;  3RUI B;  2PKO A;  3AEA B;  2AX5 A;  4OVU A;  1UEL A;  3U8Z A;  2WDQ B;  2A4Z A;  3E56 A;  4JIO U;  5HFY A;  5H92 C;  4KSK C;  2N1V A;  4B0E A;  3ZXR A;  3I57 A;  4DK5 A;  2KQS A;  3HM6 X;  1IP9 A;  3A9K A;  1FNV A;  1C78 A;  4XGA B;  2OJR A;  1N63 A;  3R8B A;  3UIP B;  1F2R I;  2IO0 B;  2Z0E B;  2FID A;  2LZ6 A;  5C1Z A;  1SJH D;  4HKQ A;  1TBE A;  1I4G A;  3AE4 B;  2WNM A;  1XT9 B;  3AUL A;  1HQR D;  4S0R A;  1GJZ A;  4N58 A;  2D3A A;  3ZXV A;  3URY A;  4NJ7 A;  3M62 B;  3AE8 B;  3JW0 X;  2HTH A;  1UZX B;  1GB4 A;  2KVR A;  1OTR B;  4OW0 A;  1TS5 A;  2ZVO A;  2ZW1 A;  2Q5W D;  4A20 A;  4DDG D;  2GLS A;  1SE4 A;  3R2I A;  2K8H A;  3BVM A;  4M0W A;  1GNU A;  2DAF A;  1AWD A;  3X0W A;  2JRI B;  4YL8 A;  1QOF A;  4XWW A;  3KYD D;  4PS3 A;  3ZRC A;  2K8C A;  3N30 A;  2C5L C;  4NNJ B;  1UBI A;  2LFI A;  1NYR A;  3FKY A;  2WGS A;  1MFW A;  2LVO A;  1P7E A;  3CSF A;  4XE0 A;  3P4R B;  3L08 A;  1V8C A;  1WZ0 A;  4L23 A;  4I6N B;  2FNJ B;  2N9X A;  1SE2 A;  3MC8 A;  5L83 A;  3ALB A;  1DOI A;  2R61 A;  1U4A A;  3N1Y C;  3W5U B;  2KDE B;  1HTO A;  3IT4 B;  1VCB A;  4YWG G;  1E5W A;  2KC2 A;  4TV3 A;  2KQ7 A;  5DCN A;  3WAP A;  3EC8 A;  3PRM B;  1TS3 A;  1P0R A;  2DZI A;  2H88 B;  4KSL C;  3SEB A;  4ACF A;  3AE6 B;  1WGG A;  5J18 A;  1QOA A;  1FD6 A;  4HCN B;  3DVN V;  4LTU A;  4MSM B;  1CJE A;  2G3Q B;  4IM2 A;  3ZIM A;  5EE3 A;  1NVI D;  3VQI A;  3TIX A;  2WP9 B;  2QEJ C;  2JYE A;  5EE1 A;  1Z2M A;  4HRS A;  1T3Q A;  1D5X C;  3BWU D;  2KK8 A;  1LFD A;  2RDH A;  3HUI A;  2KHW B;  5HHD G;  4US9 A;  2ZNV C;  1R7S A;  2L0T A;  1JRU A;  4LNF A;  1WE6 A;  1PDX A;  2O2V B;  1BT0 A;  3LB8 C;  3BIN A;  1E8X A;  2K6Q A;  2PE6 B;  3Q2A C;  4W9K A;  3PPA A;  2V0G A;  3AE7 B;  1ENF A;  1FXA A;  3KH0 A;  2M0A A;  3AE9 B;  4HRO A;  4WWM A;  1PFD A;  2REX A;  1E8Y A;  3U7D A;  2A5U A;  3R7Q A;  4GDL B;  1QKZ A;  2RR9 A;  5IP4 D;  1V1P A;  2LRW A;  1EF1 A;  1VZ8 A;  2KZR A;  2NTS A;  1RFK A;  2KWC A;  2EMT A;  4P1B C;  2D3C A;  3FIL A;  1PGB A;  1NYQ A;  4N9F 4;  4A9A A;  2D2Q A;  2LGX A;  3TCA A;  2LGI A;  1V81 A;  1FRD A;  2BW2 A;  3UQA A;  3P2B A;  2GRI A;  3DHI C;  3DBR I;  2QHO A;  1XF5 L;  2XBB C;  1TIF A;  4RMA A;  1J19 A;  5DPS A;  1YN4 A;  3DBH I;  1OEY A;  2D10 A;  4OVZ A;  1JRP A;  2QMT A;  2DHZ A;  1V6E A;  4HJK A;  2WU2 B;  4MGK E;  4LJP B;  3ZGZ A;  4YSZ B;  2LUE A;  1PQS A;  2WDT B;  3VRA B;  2JRH A;  2L8J A;  2XK5 B;  1I4Q A;  4BOS C;  3P42 A;  1X1M A;  2AYO B;  4NJC A;  3RD2 A;  4ZOH C;  1TS4 A;  2KQ4 X;  5HKH A;  3H7P A;  3VR8 B;  2G45 B;  1FEH A;  5FKA C;  3FAH A;  3VUY A;  3BK2 A;  1L6V A;  2O6V D;  3MFG A;  2JYT A;  1JCK B;  4WIP A;  3WAL A;  3A4R A;  3V60 A;  2N0S B;  2K3U A;  1BXT A;  3RN9 C;  3A1Q B;  4TQ1 A;  3DWM A;  3TJP A;  4URK A;  1GB1 A;  3DVG Y;  1WJU A;  1ZGU B;  1V5T A;  3C19 A;  1EU4 A;  1LGR A;  3JSV A;  3ZDT A;  4XZ4 A;  4W9E A;  2PMV A;  1L7Y A;  3GB1 A;  4I6P A;  4A3O A;  2M56 B;  2QJL A;  1YJJ A;  3M95 A;  2WHI A;  2MJD A;  1WH3 A;  5AUK A;  2J0J A;  1I7H A;  2NCN A;  2GOW A;  2J52 A;  2FBW B;  3W5V B;  3Q8B A;  3SFD B;  2K0P A;  4BOZ B;  3P4P B;  2G4S A;  3RI7 C;  4ANU A;  1IYF A;  3PZ7 A;  3EA6 A;  2BWE S;  1V1O A;  3V6E B;  2DAJ A;  3EFC A;  1S1Q B;  3OWE B;  2MLB A;  4NPN A;  1E7P B;  4RGM A;  3VUX A;  3ZTC A;  2QC8 A;  3ABV B;  2ICI A;  2WXG A;  4PT5 A;  4HVB A;  2KNB A;  2N9P C;  1ZUD 2;  4EZJ A;  1WYG A;  2FE8 A;  1ROE A;  2WXO A;  4TQ0 A;  3P63 A;  2L76 A;  3DVG X;  3D32 A;  3BYT B;  1PYW D;  2WQY B;  3ECI A;  3RNF C;  4H2A A;  1UUP A;  3N3K B;  2EKE C;  3R2T A;  4L1B A;  3PRE A;  4K81 A;  3N1Z C;  4A3P A;  4ZRQ A;  3VXW A;  1WF9 A;  3L16 A;  4MJS B;  3H1U A;  4WJO A;  3NJT A;  2GB1 A;  2ZCB A;  4IWQ A;  4G3X B;  4WJP A;  4C4V B;  2XNA C;  4M00 A;  1SIJ A;  4GDK A;  3AED B;  1FPY A;  2PLP A;  3NUH B;  2KDI A;  3RFZ B;  2V3P A;  2PPH A;  4FJY A;  4OZC A;  5LXH A;  3DVN U;  3ML9 A;  1ZPS A;  1WX8 A;  2LRU A;  3EGR A;  4MM3 A;  5HI1 A;  4USA A;  1XEE A;  2IY1 B;  1SE9 A;  2V4I B;  1WMH B;  4W9J A;  4WWO A;  1WWT A;  1XLN A;  5D2M B;  2Y3A A;  5D3I B;  4JL9 A;  5H8Y E;  3N1X C;  2XEW A;  2GBJ A;  3ZLZ A;  1ZOY B;  1JWS D;  1TJE A;  1WX9 A;  2KDB A;  3ZJT A;  2MJE A;  3T3N A;  4DHJ D;  4HXD A;  3QQ8 B;  4DWF A;  3PHW B;  3DCG A;  4PS7 A;  1ET9 A;  2L3Z A;  3A9J B;  1FM0 D;  1XQQ A;  2WDR B;  5TSS A;  1RFA A;  4W9F A;  2UU7 A;  4NQK E;  3V6C B;  3NY5 A;  2K5P A;  2RMM A;  4LDT B;  3Q3O C;  4TSS A;  3KW5 B;  1EWY C;  4FUL A;  1E8Z A;  2KWV B;  2IPK D;  1OEY J;  2V4L A;  1YN3 A;  3ZO5 B;  1BUI C;  2CR5 A;  3NHE B;  3PVL A;  1TKG A;  5C2T B;  1UD7 A;  2KLG A;  3QX1 A;  1ZP0 B;  3QWZ B;  4WAA A;  4ANX A;  2Z59 B;  4A6Q A;  1FXI A;  2ZEQ A;  1QLB B;  4PK1 A;  4IDI A;  3PS6 A;  3B2G A;  1R4N B;  2KN5 A;  1A5R A;  2KYW A;  3RCZ A;  1KRH A;  2K22 A;  4II2 B;  3J9C A;  3KVF B;  1I4R A;  1C3T A;  2JWZ A;  2BWF A;  3DQV A;  2NPT A;  2J53 A;  2MHJ A;  3VTV A;  1CK1 A;  4FHK A;  2JF5 A;  2QSD A;  2B76 B;  4B95 A;  4BKT A;  3QIJ A;  1BML C;  4FA6 A;  2BS2 B;  1WXM A;  3EHV A;  1EF5 A;  4BKS A;  3N20 C;  3AN1 A;  3L4P A;  2FAZ A;  1P3Q U;  2KFK B;  3PT2 B;  1TTN A;  1UBQ A;  1VD2 A;  5EE0 A;  2D07 B;  2K1F A;  1ZDV A;  2KN4 A;  3L54 A;  2ACZ B;  1QQR A;  2K9X A;  4E3C A;  1SIF A;  1N62 A;  3DBS A;  4K7W A;  4UDU C;  1C9F A;  2K6D B;  5BYR A;  2KVZ A;  1EWC A;  2BPS A;  5AEK B;  4AP4 C;  1B9R A;  1TZ1 A;  1YQ3 B;  2G1E A;  2IND C;  1ZW7 A;  2GBR A;  2AL3 A;  1UWX A;  1SJE D;  3AE1 B;  2DYO A;  4RF1 A;  4PS8 A;  1V80 A;  2IO2 B;  3RUL A;  3VDZ A;  4I6L B;  1L2N A;  4ITK A;  1E10 A;  2DEN B;  3H7S A;  4LJO B;  3TMP B;  2BYF A;  2KAN A;  2M1M A;  3AI5 A;  1WM3 A;  3DBL I;  3ZNG C;  2BB5 A;  2KMM A;  2VH1 A;  3EFU A;  2L0F A;  3AU5 A;  3BK1 A;  2FCM A;  1WR6 E;  4M01 A;  2N9E B;  3VUW A;  1GC7 A;  2KOX A;  1FNU A;  3A9K B;  5JXV A;  2WS3 B;  2MRP A;  2LHE A;  2I1K A;  4IUM B;  1SE3 A;  2GBM A;  3ZNH B;  3NRZ A;  4JQW C;  3KLS X;  3GZN B;  5FR6 A;  4RGN A;  3AE5 B;  2HD5 B;  1Y8R C;  1ISN A;  3AEB B;  2J7Q B;  2AQ1 B;  2M19 A;  2IBI B;  1H4R A;  2AEH A;  2NBW B;  3AEG B;  1OGW A;  4HLE A;  3S2A A;  4OVV A;  4KVG B;  2MSE D;  4FN2 A;  2INN E;  2X38 A;  4M02 A;  1C76 A;  3IG3 A;  1WM2 A;  3Q8A A;  2VRR B;  4PYZ A;  4GLS C;  2LAS A;  2CKH B;  2CS4 A;  4II3 B;  3PZD A;  4RF0 A;  3QAQ A;  4YTP B;  5JHA A;  4DQO C;  2VZK B;  4KIK A;  4RGT A;  3WIM A;  4D2K A;  1D6E C;  4C7Y A;  1WX7 A;  1J7B A;  1ZKH A;  4M0W B;  2NMQ A;  4ZRJ A;  2AWT A;  1E90 A;  3CMM B;  5E6J A;  1YQB A;  3U4E G;  2LI5 A;  3W1S C;  3W1Y A;  1V9J A;  1QT9 A;  2ZVN A;  4OZA A;  2GBN A;  2V3S A;  3ZW3 A;  4CHK A;  4A90 A;  3O65 B;  2OOB B;  4N59 A;  4B9K A;  3ZRF A;  2KWU B;  3Q8E A;  5D3D A;  1C4C A;  1JAL A;  1FFU A;  3NVV A;  3WA0 A;  3AXC A;  2MBB B;  5LNK 1;  4HJG E;  1FIQ A;  1D5M C;  4FLH A;  1K50 A;  4ZHP A;  1QOG A;  1P98 A;  2GMI C;  4BKG A;  1JRO A;  1NDD A;  4ICU A;  2E3T A;  4HDO A;  4WH4 A;  1E7U A;  3TEY A;  1HE8 A;  1IPG A;  2BYV E;  4ANW A;  4ARC A;  3QHT A;  3DHH C;  1DOX A;  4MT5 A;  4KGR A;  4W9D A;  1VZ6 A;  3Q3N C;  4KDI C;  1E6E B;  3AEE B;  4C56 C;  3B9J A;  4IW0 A;  5G55 A;  1MG4 A;  4K3C A;  2JQR B;  2HE7 A;  2K8B A;  4XYC A;  2NVU I;  2IY0 B;  5EE9 A;  4BZA A;  2FIF A;  5DPR A;  3NS8 A;  5CHW A;  2KWD A;  1DYQ A;  3VFK A;  2KMC A;  3QAR A;  1WGH A;  1GPX A;  1ACC A;  1R4M I;  1C4P A;  4HKZ E;  2KJR A;  4P16 A;  1E8W A;  2NBU A;  4JWS C;  3JYU A;  3MP9 A;  3VH3 B;  3VH4 B;  2IGD A;  2YLM A;  3ZQ4 A;  4A55 A;  3SFE B;  3BZD B;  3QK0 A;  2BTE A;  2WX1 A;  2N7D A;  4OHJ A;  3PZ8 A;  3RNE C;  3AEC B;  3Q8F A;  2KJH B;  2CHZ A;  1UH6 A;  1V1P B;  2Y5B B;  2K25 A;  2KLC A;  2DLB A;  3U2S C;  1XXG A;  1WRI A;  3KUZ A;  3AEF B;  3FIL B;  4F7Z A;  4NAW A;  1Z5S B;  3O13 A;  4EOY A;  4CQN A;  5C3J B;  2PE9 A;  5D7G A;  3KWL A;  3BVG A;  4W9G A;  4IG7 B;  2ZJD A;  3GP7 A;  2K39 A;  3BII D;  2C60 A;  2JT4 B;  1L0Y B;  3P1M A;  5KHQ A;  1ZXH A;  2WXK A;  5LXI B;  4HEA 1;  2KFJ A;  3Q3F A;  2PEA A;  2MBE A;  3ZDM C;  3A1Q A;  5IOI A;  1ZE3 D;  1LXD A;  1OFF A;  4MGY E;  2BQQ A;  3PGE A;  3WAO A;  2C7M B;  1N60 A;  1S3S G;  2WXM A;  1XD3 B;  2W3S A;  4NQL B;  3GS2 A;  2SEB D;  1SGH A;  1TS2 A;  1JWA D;  2WYQ A;  2HJ1 A;  1YJI A;  1NI2 A;  3H7P B;  4EZL A;  3T8M A;  1WGD A;  1STE A;  2WXP A;  1RYJ A;  2M8S A;  1UGM A;  1CQV A;  2OJW A;  3Q14 C;  1YX6 B;  1XO3 A;  3SDL C;  4HDQ A;  4WJN A;  4DDI D;  3RT3 B;  2B3A A;  2V9H A;  3ZJU A;  2BS3 B;  1IGD A;  1TGZ B;  3ML8 A;  1VDV A;  2L32 A;  2M4N A;  1D3Z A;  3DBR B;  3HHM A;  2O6V A;  4YTM B;  2G9H D;  4IWO A;  1KLV A;  4ARI A;  1N61 A;  1V2Y A;  3W9C B;  3PLU A;  3DBH B;  2AQ3 B;  2ONQ A;  3JSV B;  1VLB A;  1WIA A;  3TBL D;  2KTR A;  4GOC A;  4AJW A;  4HWI B;  1IUE A;  4DHZ B;  2PIA A;  3QCA A;  4WJQ A;  3UIN B;  3V62 A;  3CIR B;  1SB3 C;  2LJ5 A;  4DXA B;  4K7U A;  2YVC A;  1L0V B;  3Q3M C;  2M0X A;  4KGT A;  1KH0 A;  2BYE A;  4LLG M;  3MJ5 A;  1FNW A;  2RDG A;  2WXL A;  3VR9 B;  4JGH B;  3RYT A;  4F8C B;  3I5J C;  3NS1 A;  3EEC A;  2DWQ A;  4GGQ A;  2W82 A;  1IGC A;  3I9V 1;  4HCP B;  1Q10 A;  1T0R C;  4AJY B;  3TEX A;  1C79 A;  4AS1 A;  1K53 A;  3RMK C;  1V49 A;  1JQ4 A;  4NAM A;  2RSU A;  1N5X A;  5E6P A;  3SU8 X;  3LYY A;  3A33 B;  2L00 B;  4LDT D;  2FCQ A;  3T3O A;  4QAY A;  3L13 A;  5IO9 A;  4MSQ B;  4HPM B;  5L95 C;  3L17 A;  4N6E B;  5DPW A;  3VVW B;  3M3J A;  3Q8C A;  3DWG C;  2L52 A;  2CHW A;  2NTT A;  1IBX A;  4P6V F;  2Y5P A;  2JSV X;  4GDK B;  2FCN A;  4WUR A;  1L4D B;  1AN8 A;  1K52 A;  1YX5 B;  2BT6 A;  2KX0 A;  1LM8 B;  2W3R A;  4FHJ A;  3L0W B;  4Q2J A;  1WY8 A;  1JML A;  4MM3 B;  1KFY B;  3NVY A;  5TR5 A;  1QF6 A;  3DHG C;  1OQR A;  2LVQ A;  3TEW A;  3AE3 B;  1T5X D;  2RGF A;  4B0M A;  3TEZ A;  2JX5 A;  3B2F A;  4FJZ A;  5EDS A;  4EZK A;  2AL6 A;  5I4D A;  2BF8 B;  5IN7 A;  3V61 A;  3SHQ A;  4DHZ E;  1SXT A;  2KD0 A;  2HDE A;  2RD0 A;  3Q69 A;  4JE3 B;  2DZJ A;  1HZ6 A;  1NEN B;  3B1L X;  3UIO B;  2PVO D;  3AM9 A;  2LJI A;  4TUU A;  4LNN A;  1B1Z A;  3IVF A;  2CU3 A;  3NVW A;  3R66 C;  5AZH A;  3K9O B;  2INC C;  4G50 A;  3KYC D;  1C4A A;  1K51 A;  2L1A A;  4P7I A;  4GN1 A;  2D11 A;  1MI0 A;  3P4Q B;  2BS4 B;  2KDF B;  3PHX B;  1MHH E;  2MP2 A;  2RPV A;  5AZF A;  5T8I A;  4BAX A;  2KMA A;  2QDF A;  2QIE B;  3R7R A;  3RZF A;  1H8C A;  1DOY A;  3K9P B;  2N7J A;  3WAN A;  1VRA B;  5BMG A;  2D5G A;  2WXQ A;  5BYQ A;  2DZK A;  3UI3 A;  4C7Z A;  1RAX A;  4HPP A;  4CO7 A;  2NS5 A;  3IAS 1;  2R2Q A;  4ZYS A;  3CST A;  1KM7 A;  1TY0 A;  2CHX A;  3TUO A;  2NPT B;  1YD8 U;  2MX2 A;  2JY6 A;  5G5G A;  2NR2 A;  2OHF A;  1CMX B;  2IGG A;  1QOB A;  5MPO A;  4C80 A;  1F2R C;  3EUB 2;  3HIZ A;  4FBJ B;  5DPT A;  2JPH A;  5J2R A;  5D94 A;  1KLG D;  2WU5 B;  3APF A;  1FFV A;  2DX5 B;  4XC2 A;  2LGD A;  5IA7 A;  3E9S A;  1HTQ A;  1HEZ E;  4US8 A;  1TKE A;  2QIL A;  3VTU A;  3ZNI D;  3PSE B;  1OQY A;  1E9M A;  2R2O A;  3L10 B;  2JXX A;  5CHV C;  3SD5 A;  3UQB A;  1WE7 A;  2DNF A;  3P4S B;  5CTR C;  3T9L A;  3KUC B;  2WXR A;  3H9D A;  4MGZ E;  1KJT A;  1M94 A;  2SAK A;  2WX0 A;  1JWM D;  3HVZ A;  2I1J A;  3MTN B;  1FCL A;  2VZK D;  4IC7 B;  3V3X A;  4DXG A;  5JH5 C;  2C7H A;  3APD A;  3VHT C;  2Z0D B;  2EEL A;  4PYU A;  4MEM A;  2IO3 B;  2ZZP B;  1FO4 A;  3H8H A;  2MH7 A;  2M17 A;  1WR1 A;  5JZE B;  2LGY A;  4R3D A;  3FC4 A;  1I42 A;  3MHZ A;  2N9K A;  1RLF A;  3LXF A;  4O1N A;  2J4X A;  2NBV B;  4ZHO A;  3QA8 A;  2N4F A;  2CJN A;  3ZNZ B;  1E7V A;  5AZG A;  1SF0 A;  1F52 A;  5GMV A;  3ZUN A;  1WJ4 A;  4KKJ A;  1MVK A;  4AWJ A;  1Y56 A;  5AUI A;  1WGK A;  1HXY D;  3AMZ A;  1KTK A;  1XCT L;  2WXF A;  1J0G A;  3KUD B;  5E6N A;  3AE2 B;  1I35 A;  1TZO A;  3PO0 A;  4BBN F;  4NZL B;  2LD9 A;  2UYZ B;  4S17 A;  3RNC C;  4DBG A;  4WWP A;  4YXD B;  2LGS A;  3IT6 B;  2X8X X;  4A8X C;  1GOZ A;  3U7Z A;  2MWS B;  1WGY A;  4WWN A;  4YSY B;  4J6I A;  3DBL B;  1F77 A;  3HK0 A;  3ZKJ C;  3X23 A;  2PJH A;  4LK0 M;  4KIK B;  4W9H A;  3DPD A;  2KKC A;  4ASW C;  4GXB A;  1NEK B;  4IM0 A;  1MPE A;  1V97 A;  1UGJ A;  4EUT A;  1DGJ A;  3RNB C;  3Q6B A;  4XDD A;  5CX3 A;  1UWM A;  4GSW A;  2N1W A;  3PTF C;  5HG2 A;  4XX5 A;  3IXS A;  1RWS A;  2LXC A;  2O2V A;  1EU3 A;  1NBF C;  1RRB A;  4E71 A;  2C7N B;  2EKI A;  3U30 A;  3GE8 C;  4WQM A;  1TKY A;  4X57 B;  3NVZ A;  5JHB A;  2L83 A;  2L05 A;  3NZU A;  2KXJ A;  3BY4 B;  4MH0 E;  5G2N A;  4LNO A;  3RNA C;  4LNI A;  1AW7 A;  4KGS A;  3KQ4 A;  4J3O D;  2WXN A;  2KTF A;  1WGR A;  4GDL A;  1LO5 D;  2KT7 A;  1F9J A;  1YQ4 B;  4EE2 A;  1F1H A;  3N9Y C;  3H6N A;  2IGH A;  5J17 A;  5GXG B;  2JZ3 B;  3UF8 A;  2D3B A;  3RPF C;  4RNA A;  5FR3 A;  1E0Z A;  3AU4 A;  1L6U A;  4JWU C;  4WQO B;  4ZRI A;  3PRP B;  4KKI A;  3ZTD A;  3I3T B;  4MAC A;  3W1S A;  1C1Y B;  2FUH B;  2ZW0 A;  3OLM D;  2KO3 A;  3B08 A;  1VR9 A;  2L7R A;  1VZ7 A;  2OED A;  4K3B A;  3MC9 A;  3R3M A;  2WDV B;  2JZZ A;  3PRZ A;  4RGO S;  4XDC A;  2GI9 A;  4NJ6 A;  1AAR A;  2BBC A;  4W9L A;  4BFR A;  4EEW A;  1SBB B;  3VRB B;  2VH2 A;  1HZ5 A;  4GIV A;  1J7C A;  1WJ6 A;  5BYS A;  2MQJ A;  2QCZ A;  3CF6 E;  2XK5 A;  2ASQ A;  4IOI E;  4ZDV A;  4JLC A;  3V05 A;  4EFO A;  2KX3 A;  4C00 A;  4TKN A;  2D3G A;  2FUG 1;  3I63 C;  3ZYY X;  1WJN A;  1L4Z B;  2FCS A;  4MGI E;  2J0K A;  2LEK A;  4W9I A;  3VAW A;  1EM7 A;  2BKF A;  3OJ4 B;  1YMH E;  2HJ8 A;  3BVZ A;  4ICV A;  4MEL A;  2J42 A;  2CJO A;  4IM3 A;  4NAW B;  1V5O A;  1XCQ L;  3LDZ E;  4G11 A;  4F1S A;  2JU6 X;  4ZYN A;  1WSP A;  1R4M B;  1Q0W B;  1XLP A;  1I4H A;  4RCO A;  1EUV B;  2ZNV B;  3ZVV A;  5BMH A;  1L0X B;  2RDB C;  2GBK A;  2N7E A;  4K7S A;  1FRR A;  1ZXI A;  1P1A A;  4MH8 A;  2KJ6 A;  2C9W B;  2HTM E;  3C8Y A;  3MJW A;  2JZP A;  2V1Y A;  1JW9 D;  1TYG B;  2WXJ A;  1SEB D;  3QC8 B;  4HK2 A;  2CU1 A;  1T0S C;  5IKC M;  2V3N A;  4EKU A;  3NZ3 A;  2I38 A;  1WRD B;  3HVD A;  1N6Z A;  4REZ A;  1YNT E;  1Q1O A;  4P1C C;  4B6W A;  1MG8 A;  1OQQ A;  2N9L A;  1J7A A;  3LJ3 A;  1WXS A;  3APC A;  2MJ3 A;  1FCC C;  5LLI A;  1WI0 A;  1ESF A;  3HM3 A;  3SR6 A;  3QJZ A;  1F0Z A;  3HRD D;  4IKG A;  1ZDX A;  2W54 A;  1LQB A;  2ZPY A;  4W9C A;  1QIL A;  1TY2 A;  2KAC A;  4CYE A;  3W2D A;  4HPL B;  4RH6 A;  2O6V B;  1CZP A;  1P7F A;  4IWP A;  1G6J A;  2XN9 C;  4AUQ C;  2Z8L A;  1HA5 A;  1AYF A;  1Q5W B;  4MJS A;  2IYD B;  2KDM A;  2KTR B;  5FK9 C;  1D4B A;  2IO1 B;  2YEP B;  4YT0 B;  3GE3 C;  3WAM A;  4FJV B;  1KOT A;  2LHD A;  4C4V A;  1A70 A;  5D6J B;  2BVC A;  1M4V A;  1WYW B;  2MA9 B;  2TSS A;  4LNK A;  4JX1 C;  3OG5 A;  5CHF A;  3ONS A;  3JVZ X;  2MCN B;  4LCD E;  4KZ0 A;  4GMV A;  3DDC B;  3AB5 A;  1XLQ A;  2J0M A;  2JXT A;  4FXC A;  2JUO A;  5KHO A;  3M63 B;  2BGF A;  4ZRP A;  2W55 A;  1T0Y A;  2Y5C A;  3A4S C;  2PVG C;  2PTL A;  1WMH A;  1UF0 A;  1GC6 A;  1WXV A;  1WXQ A;  1GUA B;  2BKR B;  2W9N A;  5C23 A;  2PW9 A;  1I4P A;  3CWI A;  3TSS A;  2KAJ A;  4M8M A;  1PGA A;  1GG3 A;  3PLV A;  5G5H A;  1EO6 A;  4ZRK A;  2DZM A;  3AV8 A;  1R4N I;  2IZV B;  1ET6 A;  1YOV B;  2ZCC A;  3C0R B;  4NY0 A;  4RFB A;  3ENE A;  2MEK A;  1D5Z C;  1XLO A;  1T0Q C;  1I4X A;  2ON8 A;  3A9J A;  1FXT B;  4RM9 A;  1SSN A;  3RNG C;  2ZPN A;  3KWV A;  2WWZ A;  2WLB A;  1J8C A;  2MBO A;  3UGB B;  2WXH A;  1MJD A;  1NI3 A;  3OAW A;  1TT5 B;  4KDL B;  2YEP F;  4GU2 A;  5IAA C;  3ZJV A;  1IBX B;  3WCQ A;  2H89 B;  2UWQ A;  2JVC A;  4MDK E;  1P9D U;  2DYB A;  3NOB A;  3OJ3 A;  4BBN C;  1UNS A;  1VJK A;  3NG0 A;  4AQ7 A;  2AQ2 B;  2IJ0 A;  4FAD A;  3MC0 B;  4KZC A;  1JWB D;  3GOE A;  1PUT A;  4RM8 A;  1L5P A;  4TMA B;  1JWU D;  3MHS D;  4YSX B;  4ANV A;  1PGX A;  2DBY A;  1KLU D;  2BYT A;  1YIW A;  3B0A A;  1YN5 A;  5BO4 B;  4WAF A;  3IBE A;  1WZ3 A;  2E6X A;  1WFY A;  1T6B X;  3Q3J A;  4DXF A;  2DYM A;  3VTW A;  4BKS D;  3IFW B;  2RPQ A;  3N32 A;  1RM6 C;  2MW5 A; 
#chains in the Genus database with same CATH homology
 3D32 A;  3ECI A;  2WX1 A;  2N7D A;  4AWJ A;  4GB9 A;  2EMS A;  3N3K B;  2EKE C;  2MBH A;  2KJH B;  2CHZ A;  3PRE A;  4K81 A;  1J0G A;  3PV1 A;  4A3P A;  1UH6 A;  2Y5B B;  2K25 A;  2KLC A;  3KUD B;  5E6N A;  3VXW A;  4G0N B;  2KFK A;  1WF9 A;  1I35 A;  4E74 A;  4DHJ B;  3KUZ A;  3IHP C;  3L16 A;  5E6O A;  4BBN F;  3DOW A;  2LVP A;  2LD9 A;  4F7Z A;  4MJS B;  4NAW A;  3H1U A;  3NZS A;  2UYZ B;  1Z5S B;  2LXA A;  4EOY A;  4DBG A;  4WWP A;  4M8N A;  2LWP A;  2PE9 A;  5D7G A;  4WJO A;  4W9G A;  2G4D B;  4IG7 B;  2ZCB A;  4IWQ A;  2ZJD A;  2MWS B;  1WGY A;  4G3X B;  4WWN A;  4J6I A;  2K39 A;  2MBQ A;  4WJP A;  3HK0 A;  2MP2 B;  2C60 A;  3ZKJ C;  1QZE A;  2JT4 B;  3X23 A;  1K8R B;  2PJH A;  3GZN I;  4GDK A;  5KHQ A;  4KIK B;  5LXI B;  2KDI A;  2KFJ A;  4W9H A;  2KC1 A;  2PPH A;  4FJY A;  3DPD A;  2KKC A;  5LXH A;  3Q3F A;  4ASW C;  3DVN U;  3ML9 A;  4GXB A;  4K1R B;  1WX8 A;  4IM0 A;  2PEA A;  2LRU A;  2MBE A;  3A1Q A;  4MM3 A;  3RZW C;  1LXD A;  3ZDM C;  4MGY E;  3PGE A;  4BVU C;  4AOF A;  4EUT A;  3WAO A;  1WXA A;  2C7M B;  4KV2 A;  3TL5 A;  5CX3 A;  2IY1 B;  1V86 A;  1YJ1 A;  1S3S G;  1SE9 A;  3RUI B;  1XD3 B;  4GSW A;  2N1W A;  3PTF C;  4XX5 A;  2LXC A;  2O2V A;  1WMH B;  4NQL B;  4OVU A;  1NBF C;  1UEL A;  1RRB A;  4W9J A;  3U8Z A;  4E71 A;  2C7N B;  2A4Z A;  1SGH A;  3U30 A;  2WYQ A;  4JIO U;  1NI2 A;  3H7P B;  2N1V A;  4KSK C;  4X57 B;  4WWO A;  3T8M A;  4EZL A;  1WGD A;  5D2M B;  4DK5 A;  5JHB A;  2KQS A;  3HM6 X;  3NZU A;  2L05 A;  4JL9 A;  1IP9 A;  2KXJ A;  3BY4 B;  4MH0 E;  2XEW A;  3A9K A;  2M8S A;  2GBJ A;  1UGM A;  5G2N A;  3ZLZ A;  1YX6 B;  2OJR A;  3SDL C;  1WX9 A;  4HDQ A;  4WJN A;  3UIP B;  2KDB A;  2IO0 B;  3RT3 B;  4DDI D;  2B3A A;  2KTF A;  1WGR A;  2Z0E B;  1TGZ B;  3ML8 A;  2FID A;  4DHJ D;  2LZ6 A;  4GDL A;  2M4N A;  4HXD A;  5C1Z A;  1D3Z A;  3QQ8 B;  1TBE A;  1F9J A;  2O6V A;  3HHM A;  4IWO A;  4DWF A;  3PHW B;  3DCG A;  4PS7 A;  3H6N A;  1KLV A;  1XT9 B;  3AUL A;  5J17 A;  1V2Y A;  2L3Z A;  3A9J B;  3PLU A;  1GJZ A;  1XQQ A;  2JZ3 B;  3UF8 A;  1RFA A;  4W9F A;  3JSV B;  4NQK E;  3V6C B;  1WIA A;  3NY5 A;  3TBL D;  4LDT B;  2KTR A;  3AU4 A;  3KW5 B;  4FUL A;  4GOC A;  1E8Z A;  2KWV B;  4WQO B;  4ZRI A;  3PRP B;  4NJ7 A;  4AJW A;  3M62 B;  3ZTD A;  4HWI B;  2V4L A;  1OEY J;  3I3T B;  3JW0 X;  3ZO5 B;  2HTH A;  2CR5 A;  1UZX B;  3NHE B;  2KVR A;  3PVL A;  4DHZ B;  3QCA A;  1OTR B;  4WJQ A;  1UD7 A;  3UIN B;  3W1S A;  2KLG A;  3QX1 A;  2ZVO A;  3V62 A;  1C1Y B;  2FUH B;  3OLM D;  2LJ5 A;  3QWZ B;  4WAA A;  2KO3 A;  4A20 A;  4ANX A;  3B08 A;  4DDG D;  4K7U A;  4DXA B;  2Z59 B;  2L7R A;  2YVC A;  3R3M A;  2K8H A;  1GNU A;  2M0X A;  2BYE A;  2ZEQ A;  2JZZ A;  3PRZ A;  3PS6 A;  4NJ6 A;  1AAR A;  2DAF A;  4W9L A;  2KN5 A;  3X0W A;  1A5R A;  4BFR A;  2JRI B;  3RCZ A;  4YL8 A;  4EEW A;  4II2 B;  3KVF B;  1C3T A;  3KYD D;  4PS3 A;  4GIV A;  1WJ6 A;  2K8C A;  3N30 A;  3ZRC A;  2C5L C;  4NNJ B;  1UBI A;  2MQJ A;  2JWZ A;  4JGH B;  2BWF A;  3DQV A;  3RYT A;  2NPT A;  4F8C B;  3CF6 E;  2XK5 A;  3EEC A;  4GGQ A;  2ASQ A;  4ZDV A;  4JLC A;  3VTV A;  4EFO A;  2LVO A;  3CSF A;  4HCP B;  4FHK A;  2KX3 A;  2JF5 A;  4B95 A;  4TKN A;  4BKT A;  2D3G A;  4AJY B;  3QIJ A;  3L08 A;  4FA6 A;  1WZ0 A;  4I6N B;  2FNJ B;  2N9X A;  1WXM A;  5L83 A;  1V49 A;  1WJN A;  3EHV A;  3ALB A;  3UQB A;  1EF5 A;  2FCS A;  4MGI E;  4BKS A;  2J0K A;  2FAZ A;  1U4A A;  1P3Q U;  2KFK B;  3PT2 B;  1TTN A;  2RSU A;  1UBQ A;  1VD2 A;  2KDE B;  2D07 B;  2K1F A;  4W9I A;  3VAW A;  5E6P A;  3SU8 X;  2BKF A;  3OJ4 B;  3L54 A;  1VCB A;  1E5W A;  3A33 B;  2L00 B;  4LDT D;  2FCQ A;  2HJ8 A;  4ICV A;  4MEL A;  2KC2 A;  4IM3 A;  4NAW B;  3L13 A;  4TV3 A;  4E3C A;  1V5O A;  4MSQ B;  2KQ7 A;  4HPM B;  3LDZ E;  3L17 A;  4G11 A;  4F1S A;  5L95 C;  5DCN A;  3WAP A;  1SIF A;  3DBS A;  3EC8 A;  3PRM B;  4K7W A;  5DPW A;  2K6D B;  3VVW B;  3M3J A;  1P0R A;  2DZI A;  4KSL C;  4ZYN A;  2CHW A;  1Q0W B;  1WGG A;  2BPS A;  5AEK B;  4AP4 C;  5J18 A;  1TZ1 A;  1EUV B;  2ZNV B;  3ZVV A;  4HCN B;  3DVN V;  4GDK B;  1ZW7 A;  4MSM B;  2FCN A;  2GBK A;  2G3Q B;  4IM2 A;  3ZIM A;  2N7E A;  4K7S A;  2GBR A;  2AL3 A;  1YX5 B;  3VQI A;  2KX0 A;  1LM8 B;  1P1A A;  2DYO A;  3TIX A;  2KJ6 A;  4FHJ A;  3L0W B;  2C9W B;  4PS8 A;  1V80 A;  1WY8 A;  2IO2 B;  3MJW A;  1Z2M A;  3RUL A;  2V1Y A;  2KK8 A;  5TR5 A;  3VDZ A;  4I6L B;  1LFD A;  1L2N A;  2LVQ A;  3QC8 B;  4HK2 A;  2CU1 A;  2KHW B;  2DEN B;  3H7S A;  2ZNV C;  2L0T A;  2RGF A;  1JRU A;  4EKU A;  1WE6 A;  1WRD B;  4LJO B;  3TMP B;  2BYF A;  2KAN A;  2O2V B;  2M1M A;  4FJZ A;  3AI5 A;  1BT0 A;  1WM3 A;  3DBL I;  3ZNG C;  5EDS A;  1Q1O A;  3BIN A;  3EFU A;  4B6W A;  1MG8 A;  4EZK A;  2AL6 A;  1E8X A;  2L0F A;  2BF8 B;  2K6Q A;  2PE6 B;  3AU5 A;  3V61 A;  3LJ3 A;  2FCM A;  4W9K A;  1WR6 E;  1WXS A;  3PPA A;  3APC A;  3SHQ A;  4DHZ E;  3KH0 A;  2N9E B;  3VUW A;  1GC7 A;  5LLI A;  2KOX A;  2KD0 A;  2REX A;  1WI0 A;  3HM3 A;  3QJZ A;  3A9K B;  1E8Y A;  2RD0 A;  2MRP A;  2I1K A;  3U7D A;  1LQB A;  2ZPY A;  4IUM B;  4W9C A;  2A5U A;  4CYE A;  3R7Q A;  2DZJ A;  2GBM A;  3ZNH B;  3B1L X;  4HPL B;  4GDL B;  3UIO B;  2O6V B;  2RR9 A;  4JQW C;  5FR6 A;  2LRW A;  4TUU A;  4IWP A;  1EF1 A;  3IVF A;  1G6J A;  2HD5 B;  1Y8R C;  1ISN A;  2KZR A;  2J7Q B;  3R66 C;  5AZH A;  4AUQ C;  3K9O B;  2IBI B;  1H4R A;  2AEH A;  2NBW B;  2KWC A;  4G50 A;  2EMT A;  3KYC D;  1Q5W B;  1OGW A;  2IYD B;  4MJS A;  4HLE A;  2KTR B;  4N9F 4;  3S2A A;  4OVV A;  4KVG B;  2D2Q A;  2LGX A;  2MSE D;  3TCA A;  4FN2 A;  1V81 A;  4GN1 A;  4P7I A;  2IO1 B;  2D11 A;  1WM2 A;  3IG3 A;  3WAM A;  3UQA A;  4FJV B;  2VRR B;  2KDF B;  3PHX B;  4PYZ A;  1KOT A;  3P2B A;  5D6J B;  2MP2 A;  2LAS A;  2CKH B;  1J8C A;  3DBR I;  2CS4 A;  5AZF A;  4II3 B;  3PZD A;  1WYW B;  2MA9 B;  2QHO A;  2XBB C;  2KMA A;  3QAQ A;  5CHF A;  3ONS A;  1J19 A;  3JVZ X;  4RMA A;  2MCN B;  3R7R A;  4LCD E;  4KZ0 A;  5JHA A;  3RZF A;  4GMV A;  4KIK A;  3DDC B;  1H8C A;  3WIM A;  3K9P B;  5DPS A;  3DBH I;  2J0M A;  1WX7 A;  3WAN A;  1OEY A;  1ZKH A;  4M0W B;  4ZRJ A;  2AWT A;  1E90 A;  3CMM B;  2D10 A;  1YQB A;  2JUO A;  5KHO A;  2DZK A;  3M63 B;  2BGF A;  1RAX A;  2LI5 A;  4CO7 A;  3W1S C;  3W1Y A;  1V9J A;  1V6E A;  2DHZ A;  2ZVN A;  4HJK A;  2GBN A;  2V3S A;  2NS5 A;  4MGK E;  1T0Y A;  4LJP B;  3ZW3 A;  2R2Q A;  4CHK A;  2LUE A;  3A4S C;  1PQS A;  2OOB B;  2WDT B;  1KM7 A;  3CST A;  3O65 B;  2JRH A;  1WMH A;  2CHX A;  2L8J A;  4B9K A;  3ZRF A;  2KWU B;  1YD8 U;  1GC6 A;  2NPT B;  2XK5 B;  2MX2 A;  4BOS C;  1WXV A;  2JY6 A;  1X1M A;  1GUA B;  2AYO B;  2BKR B;  3RD2 A;  3WA0 A;  2NR2 A;  1CMX B;  3AXC A;  5HKH A;  3H7P A;  2MBB B;  2W9N A;  5C23 A;  2G45 B;  3VUY A;  3HIZ A;  4FBJ B;  5DPT A;  4M8M A;  1GG3 A;  2JPH A;  2O6V D;  4FLH A;  5J2R A;  5D94 A;  3PLV A;  3APF A;  1EO6 A;  4ZRK A;  2DZM A;  1R4N I;  3WAL A;  2DX5 B;  1P98 A;  2GMI C;  3A4R A;  4XC2 A;  4BKG A;  2LGD A;  3V60 A;  2IZV B;  5IA7 A;  1NDD A;  4ICU A;  4NY0 A;  2ZCC A;  3C0R B;  3ENE A;  4HDO A;  3A1Q B;  4TQ1 A;  1E7U A;  3TJP A;  4URK A;  3DVG Y;  1WJU A;  3A9J A;  1HE8 A;  1FXT B;  1IPG A;  4RM9 A;  3VTU A;  3ZNI D;  3PSE B;  2BYV E;  1ZGU B;  1V5T A;  2ZPN A;  4ANW A;  1OQY A;  2WWZ A;  2R2O A;  3QHT A;  2JXX A;  3L10 B;  5CHV C;  3SD5 A;  3JSV A;  1WE7 A;  2MBO A;  5CTR C;  3UGB B;  4W9D A;  3T9L A;  4XZ4 A;  3KUC B;  4W9E A;  3ZDT A;  1L7Y A;  3OAW A;  3H9D A;  4MGZ E;  4KDL B;  4GU2 A;  1KJT A;  4I6P A;  4A3O A;  1M94 A;  2WX0 A;  4KDI C;  5IAA C;  2I1J A;  3MTN B;  4IC7 B;  5JH5 C;  3M95 A;  4IW0 A;  2UWQ A;  2JVC A;  4MDK E;  1P9D U;  2C7H A;  1WH3 A;  2DYB A;  5G55 A;  3APD A;  2J0J A;  3VHT C;  3NOB A;  2NCN A;  2Z0D B;  4PYU A;  3OJ3 A;  4BBN C;  2GOW A;  4MEM A;  2IO3 B;  2HE7 A;  2K8B A;  2NVU I;  2ZZP B;  2IY0 B;  2M17 A;  1WR1 A;  4FAD A;  5JZE B;  2FIF A;  4KZC A;  2LGY A;  5DPR A;  3NS8 A;  5CHW A;  1I42 A;  1RLF A;  4BOZ B;  3GOE A;  2G4S A;  4RM8 A;  2NBV B;  3VFK A;  2KMC A;  4ANU A;  3QAR A;  3QA8 A;  2N4F A;  3MHS D;  1IYF A;  1WGH A;  4ANV A;  2BWE S;  1R4M I;  2DAJ A;  3V6E B;  2KJR A;  1E8W A;  2NBU A;  1S1Q B;  1YIW A;  2MLB A;  3B0A A;  4NPN A;  3JYU A;  3VUX A;  3ZTC A;  5BO4 B;  3IBE A;  1WZ3 A;  3VH3 B;  1WFY A;  3ZNZ B;  1E7V A;  5AZG A;  3VH4 B;  3Q3J A;  4HVB A;  2DYM A;  2KNB A;  2N9P C;  3VTW A;  4EZJ A;  2YLM A;  5GMV A;  4BKS D;  3IFW B;  2RPQ A;  3ZUN A;  3N32 A;  4TQ0 A;  2L76 A;  1WJ4 A;  3DVG X;  3QK0 A;  2MW5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...