1PQSA

Solution structure of the c-terminal opca domain of ycdc24p
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
77
structure length
77
Chain Sequence
SEIFTLLVEKVWNFDDLIMAINSKISNTHNNNISPITKIKYQDEDGDFVVLGSDEDWNVAKEMLAENNEKFLNIRLY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Cell division control protein 24
publication title The solution structure of an N-terminally truncated version of the yeast CDC24p PB1 domain shows a different beta-sheet topology.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Cell cycle
total genus 15
structure length 77
sequence length 77
ec nomenclature
pdb deposition date 2003-06-19
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 1pqsA00
1G6JA 3QARA 1WM3A 4IWOA 4BFRA 2KTRA 2LGDA 3RULA 4AOFA 1XT9B 3UQAA 4GDLB 3PT2B 4W9CA 2ASQA 4WWPA 3WAMA 2C7NB 2L00B 3EC8A 1XD3B 2IO0B 2NR2A 2OOBB 3PVLA 4MSMB 3W1YA 1RRBA 2L0FA 1SE9A 2KANA 3VH4B 3VH3B 3WAOA 2KXJA 5C23A 3KUCB 2D3GA 2IY1B 2IO1B 4W9LA 2KX3A 1WI0A 3ML9A 4K7WA 5CTRC 5J18A 4NY0A 4W9HA 4AP4C 4TQ0A 1GC6A 2KDFB 3QWZB 1E7VA 2KKCA 3VQIA 4CHKA 2LXAA 4NQLB 3HIZA 2KO3A 3P2BA 1WGYA 2FCNA 3L0WB 4HDQA 2N9EB 1UGMA 3H9DA 1OTRB 1KJTA 2KQSA 2IY0B 2KD0A 2HTHA 1WZ3A 2D2QA 2JRIB 2C7MB 3WAPA 1AARA 2Z0EB 4ANVA 1V49A 2O6VD 1I35A 2K25A 4II2B 1OGWA 1P3QU 1Y8RC 2G45B 4KIKB 4ANUA 2R2OA 2HJ8A 1WX9A 3S2AA 5AZGA 1RAXA 2KFKA 4TQ1A 5D7GA 3TL5A 4DDID 2CKHB 4DHZE 1GC7A 3RUIB 4RMAA 3ZDMC 3DQVA 3ZIMA 1WR1A 4WQOB 4HCPB 4GDKB 3UQBA 2K8HA 1E8ZA 2MCNB 4F8CB 4W9IA 4FLHA 4DHJB 4BKSD 2LD9A 4KVGB 1E8XA 1EO6A 1YIWA 1KM7A 5LLIA 1NDDA 5CHWA 3SD5A 4XZ4A 1YQBA 3JW0X 3OJ4B 5E6NA 1GUAB 5CHVC 1TBEA 2J0MA 3IFWB 1WGDA 3A9KA 2KLGA 1LM8B 3OLMD 5DCNA 1T0YA 2BGFA 2EMTA 2N7DA 3M62B 4JIOU 3TCAA 3SDLC 1IP9A 3X0WA 1WE6A 2DZJA 4MGYE 2J7QB 2M17A 2MBQA 3QC8B 4HPLB 5HKHA 3QAQA 2KZRA 2KQ7A 2MWSB 4GN1A 4WWNA 5D2MB 2VRRB 2W9NA 2N9XA 2J0JA 2JUOA 4BKGA 1R4MI 4MSQB 3ZW3A 4A3OA 4GB9A 5FR6A 3T9LA 2KVRA 4M8MA 4LCDE 3NY5A 2K1FA 4WJOA 3APDA 2C7HA 2I1KA 4M0WB 1ISNA 2ZPNA 1P98A 3V6CB 3KVFB 2KWVB 3NHEB 3WALA 1RLFA 2ZJDA 3AU4A 3H1UA 3EFUA 2FUHB 1J0GA 2JZ3B 4NAWA 4AJYB 4W9GA 3JSVA 2BF8B 3KYCD 3N32A 2KHWB 5AZHA 1TGZB 2NPTB 3RZFA 2JRHA 5JHAA 1K8RB 4IM3A 1WYWB 2JXXA 3MHSD 3APFA 4JL9A 3V6EB 1WGHA 1WXSA 1V2YA 3O65B 3ZTCA 3A4RA 1V6EA 2WYQA 3VDZA 2LI5A 2WX1A 3VXWA 1WMHB 4MJSA 3QA8A 3U8ZA 3QK0A 3ZLZA 3WA0A 2ZCBA 4MGZE 4PS7A 1P0RA 3ZO5B 4B6WA 2A4ZA 1L7YA 1UD7A 2KC2A 1JRUA 2B3AA 4FJYA 4F1SA 1WJ6A 4GU2A 3CSFA 3ZRCA 2KX0A 3H6NA 1KOTA 3K9OB 1OQYA 3ONSA 2KDEB 2LZ6A 3W1SC 4G50A 3U30A 2IO2B 2JPHA 3QIJA 1FXTB 3A9JB 4AWJA 2N1VA 1U4AA 3DBRI 3DBHI 3NS8A 2KTRB 2L3ZA 3CSTA 2RD0A 2A5UA 3NOBA 2KK8A 3GOEA 3L08A 3PS6A 1SGHA 2DHZA 4GGQA 1V86A 1E8YA 4IM0A 4DHZB 3PTFC 2FCMA 3B08A 1UH6A 1Q5WB 4NQKE 3QQ8B 5G2NA 1UBQA 2PPHA 2EKEC 4WWOA 1WF9A 4W9KA 1NBFC 2Z0DB 2Z59B 2C5LC 4JGHB 3IVFA 1YX5B 2G4DB 3APCA 1V9JA 1WGRA 5G55A 3KH0A 3ZRFA 5EDSA 2KDIA 2KC1A 3WANA 1UBIA 2AWTA 3PLUA 3Q3FA 2D10A 4EEWA 5C1ZA 2G3QB 2RPQA 4AUQC 2RGFA 1EF1A 1WH3A 5J17A 2L05A 3ZNID 4CO7A 2CU1A 3BY4B 1E7UA 3PHWB 1WXMA 2JZZA 3PGEA 3PPAA 5BO4B 2FIFA 2D11A 3A1QA 3MTNB 2O2VA 4JQWC 4K1RB 1WR6E 2XK5B 3Q3JA 5DPWA 1BT0A 4FJVB 2XBBC 2V1YA 1Z2MA 4TV3A 4W9DA 4WJPA 1LQBA 1P1AA 1QZEA 3ZTDA 4E3CA 1GJZA 4FHKA 1P9DU 4RM8A 2XEWA 2KJRA 3LDZE 3TIXA 1V5TA 3DVNV 1WRDB 1E8WA 4K81A 4KIKA 5CHFA 2LRWA 4FJZA 3L16A 2Y5BB 2N1WA 1V81A 2CHWA 4DDGD 2K6QA 1WY8A 1WJNA 1X1MA 2KWUB 2LGYA 3VUWA 3C0RB 4GDKA 5KHQA 2KJHB 2MBEA 4DK5A 1S3SG 4XC2A 3B0AA 2GBRA 4W9FA 1H8CA 2N7EA 1GNUA 3KUZA 2DZMA 2OJRA 3SU8X 2MA9B 2LXCA 2RSUA 3DCGA 3N3KB 3RCZA 2GBNA 5JH5C 4NJ6A 4NNJB 3BINA 3D32A 2NVUI 2C60A 2KN5A 4IM2A 3U7DA 5LXHA 4KSKC 2GOWA 2KLCA 2MX2A 2PE6B 3DVGX 1WZ0A 2CS4A 3H7PA 3PV1A 4OVUA 4WAAA 3VUXA 3GZNI 3PHXB 3TBLD 3RT3B 4FULA 4IUMB 4A20A 4I6PA 1NI2A 1WXAA 2DX5B 3VTVA 1WM2A 2IZVB 4EZKA 3UGBB 2NS5A 4II3B 3CF6E 4MH0E 1J8CA 2LASA 3DBLI 4DBGA 3PLVA 4MELA 5E6OA 5GMVA 2HE7A 2WWZA 1EUVB 2DZIA 3JSVB 4G11A 4ICVA 4K7SA 1R4NI 2V3SA 3KUDB 5TR5A 2KOXA 2QHOA 3KYDD 3R7QA 2ZNVC 4BVUC 5J2RA 2LUEA 2KMAA 2GBKA 3N30A 1RFAA 5DPSA 4N9F4 4ASWC 1M94A 3M63B 3QX1A 5IAAC 2DYMA 3B1LX 3VHTC 3OAWA 2BYVE 3QHTA 3L10B 3ENEA 4MJSB 1F9JA 2K8BA 4KDIC 2MW5A 4EFOA 3DVGY 2DAFA 4MDKE 4ANWA 3K9PB 3WIMA 1ZGUB 4XX5A 4PYUA 3VFKA 3V62A 1C1YB 1VCBA 3AULA 1WE7A 1Z5SB 2ZEQA 3JYUA 3L54A 2MP2A 2FCSA 2ZVNA 4ZYNA 4BKTA 2L8JA 2FAZA 3DDCB 2L0TA 5AEKB 2KJ6A 4NPNA 2O6VA 4E74A 1WMHA 1KLVA 2K39A 2ZZPB 2IO3B 2JVCA 3VTWA 4BBNF 1WX7A 4ZRKA 3DVNU 4E71A 2M0XA 4F7ZA 3JVZX 2KWCA 2JY6A 2KFJA 2LGXA 2UWQA 1WFYA 4FADA 1YX6B 2G4SA 1A5RA 3ECIA 4ZRJA 2KTFA 4KV2A 2R2QA 3L17A 4HDOA 4HXDA 2DYOA 5L95C 4YL8A 4HCNB 3SHQA 3ZNGC 3NZUA 1Q1OA 4BKSA 4PS8A 3AXCA 2HD5B 1E5WA 3ML8A 4FN2A 4HPMB 4BOSC 4GOCA 4NJ7A 4GDLA 3M3JA 1H4RA 4IWQA 1C3TA 3QJZA 4I6NB 1LFDA 3HM3A 4KZCA 1WJ4A 2MSED 3ZVVA 4WJQA 2V4LA 5CX3A 5JHBA 4AJWA 1WXVA 4PYZA 3IBEA 4K7UA 3EHVA 1E90A 4HWIB 2M8SA 5IA7A 3V61A 4HJKA 4KZ0A 1V5OA 3EECA 4J6IA 3DPDA 1TZ1A 2YLMA 3HHMA 4B95A 5LXIB 2N4FA 3M95A 2GBJA 3VAWA 3ZUNA 1SIFA 2BKFA 3KW5B 2BYEA 1EF5A 2M4NA 3A1QB 3L13A 3PRZA 4KDLB 2O2VB 2KFKB 4KSLC 3VVWB 2YVCA 4ICUA 2LVPA 2BYFA 2JF5A 1VD2A 4LDTB 1LXDA 2ZVOA 4MEMA 3H7SA 2K6DB 3PRPB 2L7RA 4MGKE 4FA6A 4BBNC 2FCQA 3IHPC 1CMXB 2WDTB 2ZNVB 2NBVB 3HM6X 2CHXA 3A4SC 2XK5A 1UZXB 1MG8A 1YJ1A 3UINB 4DWFA 1HE8A 3ZKJC 1IPGA 4TKNA 2KNBA 2RR9A 3I3TB 3RYTA 2BPSA 1WGGA 2FNJB 1XQQA 2J0KA 1Q0WB 2DYBA 2LVQA 2NBUA 3A9KB 3PSEB 2MBOA 2LWPA 1L2NA 4LJPB 4MGIE 4RM9A 4GXBA 2PE9A 2PEAA 4IW0A 3QCAA 3UIOB 1WIAA 3TMPB 4HVBA 2BWES 3RZWC 1GG3A 2LRUA 3IG3A 4HK2A 2JWZA 2NCNA 4TUUA 3PZDA 4FBJB 1S1QB 1YD8U 2FIDA 3DBSA 1J19A 3R66C 2C9WB 4JLCA 3H7PB 3UIPB 3V60A 3UF8A 4MM3A 2AL3A 5DPRA 4GMVA 2LJ5A 3ZDTA 4IG7B 1ZW7A 5KHOA 1D3ZA 2MQJA 4HLEA 2AEHA 2NBWB 3VTUA 2MBBB 3OJ3A 4BOZB 2N9PC 5D94A 4GSWA 4NAWB 3LJ3A 4W9EA 4ANXA 3W1SA 2AYOB 1WJUA 2REXA 2MRPA 3X23A 2CHZA 5JZEB 4EOYA 3R7RA 1UELA 3DOWA 3MJWA 3NZSA 4M8NA 4W9JA 4LDTD 4CYEA 3ZNHB 2UYZB 4EZLA 1OEYJ 4X57B 2LVOA 4FHJA 2DAJA 5E6PA 4IC7B 5D6JB 2BKRB 3T8MA 2BWFA 3ALBA 3RD2A 2JT4B 2NPTA 5AZFA 4I6LB 2M1MA 3CMMB 1PQSA 4PS3A 5L83A 4DXAB 2D07B 2WX0A 4IWPA 2IYDB 4LJOB 2DZKA 2MP2B 2KDBA 3PRMB 2IBIB 2ZPYA 4DHJD 4G0NB 4EKUA 4B9KA 2K8CA 2MBHA 1ZKHA 1V80A 2O6VB 2EMSA 3A33B 4OVVA 3VUYA 1WX8A 1IYFA 1TTNA 4EUTA 2ZCCA 3ZNZB 4WJNA 4A3PA 4GIVA 3R3MA 2DENB 2L76A 1OEYA 4URKA 3AU5A 3PREA 2KMCA 1I42A 3TJPA 2AL6A 4ZDVA 3AI5A 5DPTA 2CR5A 2I1JA 3A9JA 2GMIC 2GBMA 4ZRIA 4P7IA 2MLBA 3HK0A 4EZJA 4G3XB 2PJHA
chains in the Genus database with same CATH superfamily
1G6JA 3QARA 1HXYD 4P6VF 4IWOA 1FO4A 3KLSX 3RULA 5HFYA 3AE4B 1L0YB 2ASQA 4WWPA 1QQRA 2NR2A 2KXJA 1E10A 3KUCB 2IO1B 2KX3A 4KGSA 4YSZB 2I38A 4NY0A 3E56A 2QIEB 4P1CC 4TQ0A 4CHKA 2LMCA 1WGYA 1V1OA 1OTRB 3ZGZA 2JRIB 3MP9A 4II2B 1P3QU 1Y8RC 4IKGA 2R2OA 2JZPA 2XNAC 5AZGA 2L52A 5D7GA 3TL5A 1EU3A 2JQRB 2CKHB 4RMAA 3ZDMC 1QT9A 4GDKB 2K8HA 4F8CB 4W9IA 4NAMA 4DHJB 1QOAA 4BKSD 1TS5A 1KM7A 5LLIA 3BZDB 3JW0X 3OJ4B 3T3OA 1VJKA 5CHVC 3AEDB 1F2RI 1ET6A 2RDGA 3MHZA 3A9KA 2KLGA 1I4PA 1D5MC 5E6JA 5JXVA 2KQ7A 4WWNA 4YWGG 4DXGA 4BKGA 1R4MI 4MSQB 5FR6A 3OG5A 3T9LA 2KVRA 2K1FA 1UF0A 1CK1A 2BB5A 1F2RC 3EUB2 3WALA 3AU4A 4MACA 4W9GA 3JSVA 2BF8B 3KYCD 3ETRA 5AZHA 3HVZA 2OJWA 5JHAA 3MHSD 3T3NA 1WGHA 5IP4D 4WIPA 1FEHA 3DBHB 3DBRB 3AN1A 3N1ZC 3VXWA 3QA8A 3U8ZA 2J53A 4RGOS 1IBXB 2PVGC 1P0RA 2A4ZA 1XCQL 1UD7A 3BWUD 4FJYA 2B3AA 2IGHA 1ROEA 2D3CA 2MHJA 1B1ZA 4LNFA 4RNAA 2WGSA 3ONSA 1TS3A 1I4GA 4O1NA 4NJCA 4N59A 2LGIA 2GI9A 4RCOA 5AUKA 1FXTB 2A5UA 2B76B 3L08A 3PS6A 1SGHA 2DHZA 1AW7A 1TS2A 5I4DA 4KKIA 2WXMA 4IM0A 3Q8CA 1Q5WB 4RF1A 5G2NA 2WU5B 3RNGC 2VH2A 4JGHB 2K22A 3APCA 2M0AA 3ZRFA 3BYYB 4EEWA 2WXLA 1L4ZB 2G3QB 5C1ZA 2RGFA 5J17A 2L05A 4HKZE 1E7UA 3PHWB 1E0ZA 1VDVA 3PGEA 2KQ4X 1FPYA 1J7CA 3A1QA 3R8BA 2EELA 1WRIA 1Z2MA 4LNOA 1LQBA 1N62A 4FHKA 4C56C 1P9DU 4JPSA 1E8WA 5CHFA 4ZOHC 1DOXA 1BMLC 3BK1A 1N5XA 3VUWA 3BYTB 2UU7A 2PLPA 1S3SG 2KDMA 3B0AA 3DHIC 4W9FA 3U2SC 1H8CA 2OEDA 2DZMA 3DBLB 3SR6A 2JXTA 3AMZA 2VZKB 1SEBD 3D32A 1JWAD 4IM2A 4KSKC 2KLCA 2MX2A 1QOFA 2CJNA 3RNAC 3GB1A 4IDIA 2WP9B 4II3B 4L1BA 2KYWA 2DZIA 4K7SA 1VR9A 4BVUC 1RFAA 5IAAC 5BMIA 1D5XC 2BYVE 3ENEA 1GB1A 2K8BA 3V62A 2FCSA 3DDCB 1T6BX 2L0TA 1WYGA 2KJ6A 3MFGA 2L1AA 3KWVA 4XWTA 1KLVA 2K39A 2ZZPB 2IO3B 2VZKD 1WX7A 2IGGA 1FIQA 2LGXA 2KFJA 4A55A 1WFYA 4FADA 3ECIA 4ZRJA 3R2IA 1XO3A 1YOVB 4YL8A 1DOIA 3NZUA 4BKSA 3AXCA 2HD5B 3ML8A 2NTSA 3AEAB 4I6NB 3ZVVA 1K53A 1R7SA 2V4LA 4WAFA 4AJWA 1WXVA 2Y5CA 3IBEA 3EHVA 4YTNB 2M8SA 5IA7A 4KZ0A 3AE2B 3ZUNA 1SIFA 3KW5B 2M4NA 2BYFA 2GB1A 1P7FA 4XDCA 1N61A 3PRPB 2L7RA 5GXGB 2QJLA 3VRBB 3PZ7A 3N9YC 3J9CA 2CHXA 4IOIE 3NVYA 1I4QA 1E6EB 2WXFA 2RR9A 1FM0D 2J0KA 3A9KB 2WHIA 4GXBA 4IW0A 3WCQA 3BK2A 4HKQA 1MJDA 4OZBA 4HK2A 2W82A 5EE9A 3PZDA 4FBJB 2FIDA 3DBSA 1JW9D 3R66C 4JLCA 1I4RA 1TKGA 1HTQA 5DPRA 1ZW7A 3IT6B 2MQJA 2N9PC 4OW0A 4W9EA 3X23A 5EE0A 3AEFB 1UELA 3DOWA 4W9JA 2RPVA 3Q8BA 4X57B 2X38A 4IC7B 3LB8C 2BKRB 5D6JB 3AECB 2LHDA 3Q6BA 1QOBA 4HEA1 1K51A 5L83A 2D07B 1JCKB 3PRMB 1GAQB 2O6VB 3Q3NC 3VUYA 1IYFA 4GLSC 4WJNA 4GIVA 3I5JC 2L76A 3AU5A 1HEZE 1I42A 2AL6A 1SJHD 4P7IA 2MLBA 2J4XA 1WM3A 2J42A 4BFRA 2LGDA 4AOFA 3PT2B 4YTPB 3IT4B 3WAMA 1ESFA 2IO0B 4EE2A 1WI0A 4K7WA 5J18A 3AEBB 3VR8B 2RDBC 1GC6A 2KKCA 2KO3A 3P2BA 4ACFA 2N9EB 1UGMA 1KJTA 2HTHA 1WZ3A 1SBBB 4ANVA 1V49A 2BVCA 2GRIA 2O6VD 1L0XB 1I35A 2G45B 3P1MA 1JRPA 3RFZB 1WX9A 4YT0B 3RNFC 1PDXA 3RUIB 4XE0A 4HCPB 1E8ZA 1TZOA 2R61A 4K3BA 1I4XA 1E8XA 2MJ3A 1EO6A 5CHWA 4XZ4A 2LJIA 1TBEA 2J0MA 1D4BA 1WGDA 1LM8B 4JIOU 3TCAA 1UGJA 1WE6A 4MGYE 5HKHA 3RN9C 3R2TA 2W9NA 2J0JA 3L4PA 4CQNA 2JUOA 3ZW3A 4A3OA 1RFKA 2JU6X 4M8MA 1KF6B 3IXSA 5D3DA 3V6CB 2KWVB 2BW2A 2IJ0A 2ZJDA 1ZPSA 3P42A 3AE8B 2FUHB 5FR3A 4C7ZA 4AJYB 2V3NA 1ACCA 2OHFA 2HJ1A 1TGZB 3NVWA 4IM3A 1WYWB 4JL9A 1MPEA 2RDHA 3V6EB 4YSXB 2N0SB 2PTLA 3ZTCA 2PW9A 5HHDG 5T8IA 2LI5A 4OHJA 1WSPA 1TS4A 3VRAB 4MGZE 1JRUA 3CSFA 1PFDA 1KOTA 1OQYA 2KDEB 3Q8EA 4G50A 2IO2B 2N1VA 4WWMA 1YJIA 2N7JA 1C77A 2KTRB 1M4VA 3NOBA 1YN5A 3AE1B 2KK8A 2WXHA 4D2KA 1V86A 2FCMA 1J7BA 2EKEC 3FAHA 1NBFC 2HTME 5C2TB 5HG2A 5G55A 3KH0A 1BXTA 2KDIA 2KC1A 3Q3FA 2D10A 3E9SA 4OVZA 1WH3A 5TSSA 1FFUA 3PPAA 1C76A 5BO4B 3MTNB 5FK9C 1EWCA 4K1RB 1T0SC 1KLGD 3Q3JA 4TV3A 4W9DA 5IKCM 1WWTA 1F77A 3ZTDA 4E3CA 2KJRA 3TIXA 3ZJUA 4KIKA 5EE1A 1XLPA 2LRWA 4S0RA 2MH7A 2N1WA 2G9HD 3I63C 1T0QC 4XWWA 3GZNB 1ZXIA 3EGRA 1WY8A 4JWSC 1I7HA 1E7PB 1L4DB 2BS4B 4ITKA 2N7EA 4M02A 2OJRA 4ZYSA 2MA9B 1YN3A 1TY2A 3RCZA 1FRRA 3N3KB 3MC0B 4NJ6A 4NNJB 3BINA 2DLBA 1YQ3B 2C60A 2KN5A 3VUXA 3PHXB 3TBLD 4FULA 1WXAA 1WM2A 4EZKA 3UGBB 1N5WA 1CQVA 5E6OA 2HE7A 2WWZA 2WXQA 1VZ7A 1R4NI 5TR5A 1VZ6A 1FCLA 2QDFA 2QHOA 3B2FA 4M0WA 3GP7A 1UNSA 1Q10A 2KMAA 2GBKA 3KWLA 4MJSB 4KDIC 2MW5A 1MFWA 3WIMA 1ZGUB 3VFKA 3L54A 1RYJA 2PMVA 1GB4A 2L8JA 2FAZA 2LUMA 5AEKB 4NPNA 2WNMA 2JYTA 2O6VA 1WMHA 3Q8FA 3VTWA 3AV8A 4ZRKA 1CJEA 4E71A 2V0GA 3JVZX 2JY6A 2Y5PA 2BB6A 2UWQA 4ARCA 3RNEC 2XN9C 2KTFA 1D5ZC 3AE6B 3SFDB 3L17A 4HDOA 1J7AA 5L95C 4HCNB 4BOSC 4HPMB 1E5WA 4FN2A 4OZAA 4GOCA 4NJ7A 1H4RA 4IWQA 3QJZA 4KZCA 3GS2A 4C00A 2AQ2B 1B9RA 5BMGA 4PYZA 4K7UA 3ZJVA 1E90A 4HWIB 1KRHA 1SIJA 4RGNA 3I57A 3BVZA 4AQ7A 3V61A 4HJKA 3EECA 1D6EC 3DPDA 4B95A 3W5UB 2N4FA 3M95A 1SXTA 3V3XA 2BYEA 3PRZA 3Q14C 1NYRA 4KSLC 2YVCA 2LVPA 2JF5A 1LXDA 2ZVOA 4MEMA 1P7EA 3H7SA 4LK0M 2FCQA 3IHPC 2ZNVB 2NBVB 3A4SC 2XK5A 1KTKA 3RPFC 3UINB 3NUHB 1HE8A 1ENFA 2KNBA 3I3TB 2LVQA 4B0MA 2DYBA 1L2NA 4LJPB 3NJTA 2BT6A 4MGIE 1NYQA 3UIOB 1I4HA 1GG3A 2LRUA 3W2DA 2JWZA 3AH7A 3TEXA 1FXIA 4JX1C 3CWIA 3TUOA 1J19A 2C9WB 5IOIA 3H7PB 3UIPB 3UF8A 3DHHC 3H8HA 4HLEA 2AEHA 3U52E 2MBBB 3OJ3A 2X8XX 3LJ3A 2KN4A 3W1SA 2AYOB 2LFIA 2MRPA 2CHZA 4EOYA 3R7RA 4WURA 4H2AA 4CYEA 4EZLA 2UYZB 1OEYJ 1JQ4A 2W55A 4FHJA 2IPKD 3GE8C 3ALBA 3MC8A 4I6LB 3CMMB 4LTUA 3UI3A 4DXAB 1OQQA 3HVDA 2WX0A 3AEGB 4LJOB 2KDBA 4C7YA 1YMHE 2ZPYA 2V3PA 3TEZA 4B9KA 2EMSA 3A33B 4C4VB 1V1PA 2DENB 1OEYA 3PREA 4US9A 2QEJC 1FD6A 4ZDVA 1SE4A 2I1JA 3TSSA 2GMIC 1DYQA 1ZP0B 1HZ6A 3P4PB 2KTRA 5AUIA 1XT9B 3I9V1 4GDLB 1ZDXA 2C7NB 4OZCA 2L00B 3W1YA 1T0RC 1WGKA 1RRBA 2ACZB 2L0FA 2KANA 3VH3B 5C23A 2IY1B 3AE7B 3MJ5A 2KMMA 2ONQA 1NI3A 4MH8A 3ZXRA 4WH4A 4W9HA 4AP4C 3RMKC 3BIID 2KDFB 3VQIA 1E7VA 3B9JA 1FNVA 4N58A 2FCNA 3L0WB 3HRDD 2L83A 4USAA 2D2QA 2CU3A 2K25A 4KIKB 3S2AA 1RAXA 2KFKA 4DDID 3DQVA 2WQYB 1WR1A 4WQOB 3UQBA 2BYTA 3URYA 2WS3B 4BZAA 5H8YE 4FLHA 2WDRB 2LD9A 3MC9A 1R4MB 4A9AA 4ZRPA 1YIWA 1TJEA 4YTMB 4KGTA 1N63A 1VZ8A 5DCNA 4RH6A 3ZXVA 2BGFA 3LYYA 2ZW1A 3M62B 2INPE 3SEBA 1IP9A 3X0WA 4C80A 2J7QB 2M17A 3QC8B 1C4PA 3C8YA 3QAQA 2N9LA 2MWSB 5D2MB 1KFYB 2M19A 4GB9A 1YNTE 3NY5A 4WJOA 2I1KA 4M0WB 3NG0A 3KVFB 2KAJA 1RLFA 2KVZA 2WDQB 3EFUA 4PK1A 1J0GA 2JZ3B 1PUTA 2KHWB 1C79A 2WXNA 3RZFA 2JRHA 3VR9B 1EU4A 2QCZA 1K52A 3ZQ4A 1SE2A 1TT5B 1WXSA 1V2YA 3IAM1 3O65B 2WYQA 3U7ZA 1WMHB 4MJSA 1TY0A 3C19A 2K5PA 3ZLZA 3EFCA 2ZCBA 4HROA 2DNFA 2YEPB 3N1XC 2K0PA 4FXCA 4F1SA 4GU2A 2KX0A 3K9OB 4A90A 2LZ6A 3U30A 3BVGA 2JPHA 3QIJA 4AWJA 1U4AA 1VLBA 2V9HA 3DBHI 3DBRI 3CSTA 2RD0A 3W9CB 1A70A 2SAKA 3GOEA 1C4CA 4GGQA 3AEEB 4DHZB 3B08A 1UH6A 5BMHA 1KLUD 1WF9A 2Z0DB 2Z59B 2D3AA 2C5LC 3IVFA 1YX5B 2G4DB 1V9JA 1WGRA 2EKIA 1UBIA 2AWTA 1HZ5A 4PT5A 1DGJA 2RPQA 1UUPA 4AUQC 4CO7A 3ZNID 3BY4B 2JZZA 2FIFA 4JQWC 4S17A 1MG4A 2XK5B 1QKZA 5DPWA 4HRSA 4WJPA 4RGMA 1P1AA 1QZEA 2XEWA 3LDZE 3DVNV 1JWSD 4XDDA 4FJZA 1JWMD 1TYGB 1V81A 4DDGD 1GOZA 1WJNA 2K3UA 1X1MA 2KWUB 3C0RB 1DOYA 4DK5A 4XC2A 1PYWD 1L0VB 1GNUA 3KUZA 4M00A 2LXCA 3DCGA 5JH5C 2GBNA 2NVUI 5LXHA 3U7DA 4WAAA 3H7PA 1JALA 2CS4A 4A6QA 2INCC 4IUMB 4A20A 1STEA 3AB5A 3VTVA 2DX5B 1FNUA 4XYCA 2RMMA 3CF6E 4Q2JA 5IN7A 3P4SB 3DBLI 4DBGA 3PLVA 4MELA 5GMVA 2W54A 3P63A 4G11A 4ICVA 1JWBD 1ZE3D 2V3SA 3KUDB 2KOXA 3KYDD 4WQMA 2ZNVC 5DPSA 1FCCC 1M94A 3M63B 3QX1A 2ON8A 2DYMA 3B1LX 2CJOA 2Y3AA 3QHTA 1C9FA 2FBWB 1F9JA 4KX6B 4EFOA 2JSVX 4ANWA 3K9PB 4XX5A 1V1PB 3AULA 1Z5SB 2ZEQA 4ZYNA 3ABVB 2BQQA 2JVCA 4C4VA 3N1YC 3FILB 3DVNU 1V97A 1MHXA 2M0XA 4F7ZA 2K9XA 2KWCA 5FKAC 2MEKA 1YX6B 2G4SA 1A5RA 4KV2A 2R2QA 2DYOA 1F0ZA 3PO0A 3ZNGC 4PS8A 1QOGA 5H92C 4GDLA 1C3TA 4P1BC 1LFDA 2FUG1 2MSED 2L32A 3RNBC 1QF6A 5CX3A 1SJED 1XCTL 2FE8A 3B2GA 1SE3A 4BAXA 3FKYA 1V5OA 4J6IA 5LNK1 5LXIB 1T3QA 2WU2B 4N6EB 2BKFA 3TEWA 4K3CA 1EF5A 3L13A 1IUEA 4KDLB 2O2VB 2KFKB 4US8A 3VVWB 2KWDA 2K6DB 4MGKE 4DXFA 1XF5L 4FA6A 2WDTB 1HTOA 1UZXB 1MG8A 1EM7A 1YJ1A 3NVVA 4DWFA 2INDC 1IPGA 4TKNA 2BPSA 1WGGA 1XQQA 1Q0WB 2MBOA 2LWPA 4RM9A 3QCAA 1FMAD 3CIRB 1WIAA 3TMPB 4HVBA 2BWES 3DWMA 1PGXA 3Q3MC 4TUUA 1SB3C 2MJDA 1MI0A 1UWMA 1QILA 4MM3A 4GMVA 1AYFA 2LJ5A 3ZDTA 4IG7B 1D3ZA 2NBWB 2MJEA 3VTUA 1JMLA 3EA6A 4GSWA 5D94A 1K50A 4ANXA 1WJUA 2H89B 3AM9A 2WXRA 4B0EA 3NZSA 3MJWA 4M8NA 2LVOA 1Y56A 3NZ3A 2W3SA 3T8MA 3V05A 2BWFA 2JYEA 2SEBD 5BYQA 3RD2A 2JT4B 1C4AA 2GLSA 4R3DA 1VRAB 2IYDB 2MP2B 2IBIB 2AX5A 4DHJD 2YEPF 4EKUA 2MBHA 1V80A 4OVVA 3Q69A 1WX8A 2M56B 1TTNA 4EUTA 3ZNZB 2W3RA 4A3PA 3R3MA 3NVZA 3TJPA 2IGDA 5DPTA 2CR5A 4ZRIA 3HK0A 2LEKA 1N60A 4G3XB 2JWUA 4ZHPA 3UQAA 4W9CA 5HI1A 3RI7C 3KQ4A 3EC8A 3PVLA 1XD3B 4MSMB 2OOBB 3IAS1 1SE9A 1FXAA 3VH4B 3WAOA 5G5GA 1MVKA 2Z8LA 2PVOD 2D3GA 1LO5D 3RNCC 4W9LA 1CZPA 3ML9A 5CTRC 2E3TA 1TIFA 1F1HA 1EWYC 3QWZB 3DWGC 2LXAA 4NQLB 3HIZA 4HDQA 3H9DA 2I2YA 2V4IB 2WXGA 2KQSA 2BS2B 2IY0B 2KD0A 3WAPA 1OQRA 2C7MB 1AARA 2Z0EB 1OGWA 4ANUA 2HJ8A 5G5HA 4TQ1A 4DHZE 1GC7A 3ZIMA 1RM6C 2E6XA 3SFEB 3W5VB 1JROA 4XGAB 2MCNB 4KVGB 1JWUD 2QMTA 1NDDA 3SD5A 1YQBA 3LXFA 5E6NA 1L6UA 1GUAB 3IFWB 3OLMD 3AE9B 4LNIA 1T0YA 2EMTA 2N7DA 3SDLC 2DZJA 4HPLB 2MBQA 2KZRA 4GN1A 2VRRB 2N9XA 1AN8A 1GPXA 4LCDE 2G1EA 3APDA 2C7HA 1ISNA 2ZPNA 1P98A 3NHEB 3H1UA 4NAWA 5C3JB 3N32A 2NPTB 1K8RB 2JXXA 3APFA 1IGCA 2NTTA 1V6EA 3A4RA 3VDZA 2WX1A 3Q3OC 3QK0A 1NENB 3WA0A 3NS1A 4PS7A 1UWXA 3ZO5B 4B6WA 1L7YA 2KC2A 1WJ6A 1F52A 3ZRCA 3H6NA 4NZLB 5IO9A 2J52A 3W1SC 1V8CA 3FILA 3A9JB 3OWEB 3NS8A 3GE3C 3NRZA 1ET9A 2L3ZA 2Q5WD 3BVMA 1NEKB 3TEYA 4YXDB 1OFFA 1E8YA 3PTFC 4NQKE 3QQ8B 5BYSA 4M01A 1UBQA 2PPHA 4WWOA 4W9KA 1ZOYB 1NVID 3AE3B 1L5PA 2DWQA 3Q2AC 5EDSA 3WANA 3PLUA 1EF1A 3Q8AA 2CU1A 1WXMA 2D11A 2O2VA 1WR6E 1L6VA 1BT0A 2WXPA 4FJVB 2XBBC 2V1YA 4JWUC 1SSNA 1GJZA 2PKOA 4RM8A 1V5TA 2WXOA 2TSSA 1WRDB 4K81A 3L16A 2Y5BB 1FFVA 2CHWA 2K6QA 3O13A 2VH1A 2LGYA 4GDKA 2QC8A 4KKJA 2KJHB 5KHQA 2MBEA 2BTEA 4MM3B 2GBRA 3P4RB 1E9MA 3SU8X 2RSUA 2JX5A 4ZRQA 1R4NB 1SF0A 2GOWA 3PV1A 2IDYA 2PE6B 3DVGX 1WZ0A 3AE5B 4OVUA 1WXQA 3GZNI 3RT3B 4I6PA 1NI2A 1XLNA 2IZVB 1PGAA 1T5XD 2NS5A 4MH0E 3HUIA 1J8CA 3N20C 2LASA 4LNKA 1EUVB 2KT7A 3JSVB 1BUIC 3R7QA 5J2RA 1MHHE 2LUEA 4ZHOA 2BS3B 4A8XC 3N30A 1KH0A 4N9F4 4ASWC 3VHTC 4RGTA 3OAWA 3L10B 2BBCA 1ZXHA 3DVGY 2DAFA 4MDKE 4PYUA 1C1YB 1VCBA 1YJJA 1WE7A 3JYUA 4J3OD 4L2YA 2MP2A 2ZVNA 4BKTA 1FRDA 4E74A 3P4QB 4BBNF 1C78A 4ARIA 1IBXA 2KACA 2D5GA 1ZUD2 2WXIA 4HXDA 3SHQA 2ZW0A 1LGRA 1Q1OA 2INNE 2WXJA 3M3JA 2WLBA 3HM3A 1WJ4A 2AQ3B 4WJQA 1IGDA 5EE3A 4YSYB 5JHBA 3ZJTA 1HQRD 3DHGC 1XEEA 1YN4A 1TZ1A 2YLMA 3HHMA 2GBJA 3VAWA 3A1QB 2D3BA 4JE3B 4ICUA 3U4EG 4AS1A 1VD2A 2QILA 4LDTB 4LNNA 4TSSA 1FNWA 4HPPA 4REZA 4BBNC 2ICIA 1CMXB 4LLGM 3HM6X 5MPOA 3ZKJC 4L23A 3RYTA 2DBYA 3PZ8A 2FNJB 3PSEB 2NBUA 2WXKA 4HJGE 3ZYYX 2PE9A 2PEAA 1PGBA 1RWSA 3RZWC 4KGRA 3IG3A 2NCNA 4RF0A 1N6ZA 1TKEA 4P16A 1S1QB 2LHEA 1YD8U 3V60A 2AL3A 2H88B 1ZDVA 5KHOA 2AQ1B 1XLOA 4BOZB 4NAWB 2REXA 5JZEB 5D3IB 2QSDA 4LDTD 3ZNHB 4TMAB 4RFBA 2DAJA 5E6PA 2PIAA 4MT5A 5BYRA 2NPTA 5AZFA 2M1MA 1PQSA 2WDVB 4PS3A 4DQOC 1XXGA 1QLBB 4IWPA 2DZKA 1HA5A 1XLQA 4G0NB 2K8CA 2LGSA 1ZKHA 2N9KA 2ZCCA 4URKA 2KMCA 3FC4A 4UDUC 3AI5A 4QAYA 3A9JA 2GBMA 1AWDA 2NMQA 1YQ4B 4EZJA 2HDEA 2PJHA 1TKYA
chains in the Genus database with same CATH topology
1G6JA 3QARA 1WM3A 4IWOA 4BFRA 2KTRA 2LGDA 3RULA 4AOFA 1XT9B 3UQAA 4GDLB 3PT2B 4W9CA 2ASQA 4WWPA 3WAMA 2C7NB 2L00B 3EC8A 1XD3B 2IO0B 2NR2A 2OOBB 3PVLA 4MSMB 3W1YA 1RRBA 2L0FA 1SE9A 2KANA 3VH4B 3VH3B 3WAOA 2KXJA 5C23A 3KUCB 2D3GA 2IY1B 2IO1B 4W9LA 2KX3A 1WI0A 3ML9A 4K7WA 5CTRC 5J18A 4NY0A 4W9HA 4AP4C 4TQ0A 1GC6A 2KDFB 3QWZB 1E7VA 2KKCA 3VQIA 4CHKA 2LXAA 4NQLB 3HIZA 2KO3A 3P2BA 1WGYA 2FCNA 3L0WB 4HDQA 2N9EB 1UGMA 3H9DA 1OTRB 1KJTA 2KQSA 2IY0B 2KD0A 2HTHA 1WZ3A 2D2QA 2JRIB 2C7MB 3WAPA 1AARA 2Z0EB 4ANVA 1V49A 2O6VD 1I35A 2K25A 4II2B 1OGWA 1P3QU 1Y8RC 2G45B 4KIKB 4ANUA 2R2OA 2HJ8A 1WX9A 3S2AA 5AZGA 1RAXA 2KFKA 4TQ1A 5D7GA 3TL5A 4DDID 2CKHB 4DHZE 1GC7A 3RUIB 4RMAA 3ZDMC 3DQVA 3ZIMA 1WR1A 4WQOB 4HCPB 4GDKB 3UQBA 2K8HA 1E8ZA 2MCNB 4F8CB 4W9IA 4FLHA 4DHJB 4BKSD 2LD9A 4KVGB 1E8XA 1EO6A 1YIWA 1KM7A 5LLIA 1NDDA 5CHWA 3SD5A 4XZ4A 1YQBA 3JW0X 3OJ4B 5E6NA 1GUAB 5CHVC 1TBEA 2J0MA 3IFWB 1WGDA 3A9KA 2KLGA 1LM8B 3OLMD 5DCNA 1T0YA 2BGFA 2EMTA 2N7DA 3M62B 4JIOU 3TCAA 3SDLC 1IP9A 3X0WA 1WE6A 2DZJA 4MGYE 2J7QB 2M17A 2MBQA 3QC8B 4HPLB 5HKHA 3QAQA 2KZRA 2KQ7A 2MWSB 4GN1A 4WWNA 5D2MB 2VRRB 2W9NA 2N9XA 2J0JA 2JUOA 4BKGA 1R4MI 4MSQB 3ZW3A 4A3OA 4GB9A 5FR6A 3T9LA 2KVRA 4M8MA 4LCDE 3NY5A 2K1FA 4WJOA 3APDA 2C7HA 2I1KA 4M0WB 1ISNA 2ZPNA 1P98A 3V6CB 3KVFB 2KWVB 3NHEB 3WALA 1RLFA 2ZJDA 3AU4A 3H1UA 3EFUA 2FUHB 1J0GA 2JZ3B 4NAWA 4AJYB 4W9GA 3JSVA 2BF8B 3KYCD 3N32A 2KHWB 5AZHA 1TGZB 2NPTB 3RZFA 2JRHA 5JHAA 1K8RB 4IM3A 1WYWB 2JXXA 3MHSD 3APFA 4JL9A 3V6EB 1WGHA 1WXSA 1V2YA 3O65B 3ZTCA 3A4RA 1V6EA 2WYQA 3VDZA 2LI5A 2WX1A 3VXWA 1WMHB 4MJSA 3QA8A 3U8ZA 3QK0A 3ZLZA 3WA0A 2ZCBA 4MGZE 4PS7A 1P0RA 3ZO5B 4B6WA 2A4ZA 1L7YA 1UD7A 2KC2A 1JRUA 2B3AA 4FJYA 4F1SA 1WJ6A 4GU2A 3CSFA 3ZRCA 2KX0A 3H6NA 1KOTA 3K9OB 1OQYA 3ONSA 2KDEB 2LZ6A 3W1SC 4G50A 3U30A 2IO2B 2JPHA 3QIJA 1FXTB 3A9JB 4AWJA 2N1VA 1U4AA 3DBRI 3DBHI 3NS8A 2KTRB 2L3ZA 3CSTA 2RD0A 2A5UA 3NOBA 2KK8A 3GOEA 3L08A 3PS6A 1SGHA 2DHZA 4GGQA 1V86A 1E8YA 4IM0A 4DHZB 3PTFC 2FCMA 3B08A 1UH6A 1Q5WB 4NQKE 3QQ8B 5G2NA 1UBQA 2PPHA 2EKEC 4WWOA 1WF9A 4W9KA 1NBFC 2Z0DB 2Z59B 2C5LC 4JGHB 3IVFA 1YX5B 2G4DB 3APCA 1V9JA 1WGRA 5G55A 3KH0A 3ZRFA 5EDSA 2KDIA 2KC1A 3WANA 1UBIA 2AWTA 3PLUA 3Q3FA 2D10A 4EEWA 5C1ZA 2G3QB 2RPQA 4AUQC 2RGFA 1EF1A 1WH3A 5J17A 2L05A 3ZNID 4CO7A 2CU1A 3BY4B 1E7UA 3PHWB 1WXMA 2JZZA 3PGEA 3PPAA 5BO4B 2FIFA 2D11A 3A1QA 3MTNB 2O2VA 4JQWC 4K1RB 1WR6E 2XK5B 3Q3JA 5DPWA 1BT0A 4FJVB 2XBBC 2V1YA 1Z2MA 4TV3A 4W9DA 4WJPA 1LQBA 1P1AA 1QZEA 3ZTDA 4E3CA 1GJZA 4FHKA 1P9DU 4RM8A 2XEWA 2KJRA 3LDZE 3TIXA 1V5TA 3DVNV 1WRDB 1E8WA 4K81A 4KIKA 5CHFA 2LRWA 4FJZA 3L16A 2Y5BB 2N1WA 1V81A 2CHWA 4DDGD 2K6QA 1WY8A 1WJNA 1X1MA 2KWUB 2LGYA 3VUWA 3C0RB 4GDKA 5KHQA 2KJHB 2MBEA 4DK5A 1S3SG 4XC2A 3B0AA 2GBRA 4W9FA 1H8CA 2N7EA 1GNUA 3KUZA 2DZMA 2OJRA 3SU8X 2MA9B 2LXCA 2RSUA 3DCGA 3N3KB 3RCZA 2GBNA 5JH5C 4NJ6A 4NNJB 3BINA 3D32A 2NVUI 2C60A 2KN5A 4IM2A 3U7DA 5LXHA 4KSKC 2GOWA 2KLCA 2MX2A 2PE6B 3DVGX 1WZ0A 2CS4A 3H7PA 3PV1A 4OVUA 4WAAA 3VUXA 3GZNI 3PHXB 3TBLD 3RT3B 4FULA 4IUMB 4A20A 4I6PA 1NI2A 1WXAA 2DX5B 3VTVA 1WM2A 2IZVB 4EZKA 3UGBB 2NS5A 4II3B 3CF6E 4MH0E 1J8CA 2LASA 3DBLI 4DBGA 3PLVA 4MELA 5E6OA 5GMVA 2HE7A 2WWZA 1EUVB 2DZIA 3JSVB 4G11A 4ICVA 4K7SA 1R4NI 2V3SA 3KUDB 5TR5A 2KOXA 2QHOA 3KYDD 3R7QA 2ZNVC 4BVUC 5J2RA 2LUEA 2KMAA 2GBKA 3N30A 1RFAA 5DPSA 4N9F4 4ASWC 1M94A 3M63B 3QX1A 5IAAC 2DYMA 3B1LX 3VHTC 3OAWA 2BYVE 3QHTA 3L10B 3ENEA 4MJSB 1F9JA 2K8BA 4KDIC 2MW5A 4EFOA 3DVGY 2DAFA 4MDKE 4ANWA 3K9PB 3WIMA 1ZGUB 4XX5A 4PYUA 3VFKA 3V62A 1C1YB 1VCBA 3AULA 1WE7A 1Z5SB 2ZEQA 3JYUA 3L54A 2MP2A 2FCSA 2ZVNA 4ZYNA 4BKTA 2L8JA 2FAZA 3DDCB 2L0TA 5AEKB 2KJ6A 4NPNA 2O6VA 4E74A 1WMHA 1KLVA 2K39A 2ZZPB 2IO3B 2JVCA 3VTWA 4BBNF 1WX7A 4ZRKA 3DVNU 4E71A 2M0XA 4F7ZA 3JVZX 2KWCA 2JY6A 2KFJA 2LGXA 2UWQA 1WFYA 4FADA 1YX6B 2G4SA 1A5RA 3ECIA 4ZRJA 2KTFA 4KV2A 2R2QA 3L17A 4HDOA 4HXDA 2DYOA 5L95C 4YL8A 4HCNB 3SHQA 3ZNGC 3NZUA 1Q1OA 4BKSA 4PS8A 3AXCA 2HD5B 1E5WA 3ML8A 4FN2A 4HPMB 4BOSC 4GOCA 4NJ7A 4GDLA 3M3JA 1H4RA 4IWQA 1C3TA 3QJZA 4I6NB 1LFDA 3HM3A 4KZCA 1WJ4A 2MSED 3ZVVA 4WJQA 2V4LA 5CX3A 5JHBA 4AJWA 1WXVA 4PYZA 3IBEA 4K7UA 3EHVA 1E90A 4HWIB 2M8SA 5IA7A 3V61A 4HJKA 4KZ0A 1V5OA 3EECA 4J6IA 3DPDA 1TZ1A 2YLMA 3HHMA 4B95A 5LXIB 2N4FA 3M95A 2GBJA 3VAWA 3ZUNA 1SIFA 2BKFA 3KW5B 2BYEA 1EF5A 2M4NA 3A1QB 3L13A 3PRZA 4KDLB 2O2VB 2KFKB 4KSLC 3VVWB 2YVCA 4ICUA 2LVPA 2BYFA 2JF5A 1VD2A 4LDTB 1LXDA 2ZVOA 4MEMA 3H7SA 2K6DB 3PRPB 2L7RA 4MGKE 4FA6A 4BBNC 2FCQA 3IHPC 1CMXB 2WDTB 2ZNVB 2NBVB 3HM6X 2CHXA 3A4SC 2XK5A 1UZXB 1MG8A 1YJ1A 3UINB 4DWFA 1HE8A 3ZKJC 1IPGA 4TKNA 2KNBA 2RR9A 3I3TB 3RYTA 2BPSA 1WGGA 2FNJB 1XQQA 2J0KA 1Q0WB 2DYBA 2LVQA 2NBUA 3A9KB 3PSEB 2MBOA 2LWPA 1L2NA 4LJPB 4MGIE 4RM9A 4GXBA 2PE9A 2PEAA 4IW0A 3QCAA 3UIOB 1WIAA 3TMPB 4HVBA 2BWES 3RZWC 1GG3A 2LRUA 3IG3A 4HK2A 2JWZA 2NCNA 4TUUA 3PZDA 4FBJB 1S1QB 1YD8U 2FIDA 3DBSA 1J19A 3R66C 2C9WB 4JLCA 3H7PB 3UIPB 3V60A 3UF8A 4MM3A 2AL3A 5DPRA 4GMVA 2LJ5A 3ZDTA 4IG7B 1ZW7A 5KHOA 1D3ZA 2MQJA 4HLEA 2AEHA 2NBWB 3VTUA 2MBBB 3OJ3A 4BOZB 2N9PC 5D94A 4GSWA 4NAWB 3LJ3A 4W9EA 4ANXA 3W1SA 2AYOB 1WJUA 2REXA 2MRPA 3X23A 2CHZA 5JZEB 4EOYA 3R7RA 1UELA 3DOWA 3MJWA 3NZSA 4M8NA 4W9JA 4LDTD 4CYEA 3ZNHB 2UYZB 4EZLA 1OEYJ 4X57B 2LVOA 4FHJA 2DAJA 5E6PA 4IC7B 5D6JB 2BKRB 3T8MA 2BWFA 3ALBA 3RD2A 2JT4B 2NPTA 5AZFA 4I6LB 2M1MA 3CMMB 1PQSA 4PS3A 5L83A 4DXAB 2D07B 2WX0A 4IWPA 2IYDB 4LJOB 2DZKA 2MP2B 2KDBA 3PRMB 2IBIB 2ZPYA 4DHJD 4G0NB 4EKUA 4B9KA 2K8CA 2MBHA 1ZKHA 1V80A 2O6VB 2EMSA 3A33B 4OVVA 3VUYA 1WX8A 1IYFA 1TTNA 4EUTA 2ZCCA 3ZNZB 4WJNA 4A3PA 4GIVA 3R3MA 2DENB 2L76A 1OEYA 4URKA 3AU5A 3PREA 2KMCA 1I42A 3TJPA 2AL6A 4ZDVA 3AI5A 5DPTA 2CR5A 2I1JA 3A9JA 2GMIC 2GBMA 4ZRIA 4P7IA 2MLBA 3HK0A 4EZJA 4G3XB 2PJHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1G6J A;  3QAR A;  1WM3 A;  4IWO A;  4BFR A;  2KTR A;  2LGD A;  3RUL A;  4AOF A;  1XT9 B;  3UQA A;  4GDL B;  3PT2 B;  4W9C A;  2ASQ A;  4WWP A;  3WAM A;  2C7N B;  2L00 B;  3EC8 A;  1XD3 B;  2IO0 B;  2NR2 A;  2OOB B;  3PVL A;  4MSM B;  3W1Y A;  1RRB A;  2L0F A;  1SE9 A;  2KAN A;  3VH4 B;  3VH3 B;  3WAO A;  2KXJ A;  5C23 A;  3KUC B;  2D3G A;  2IY1 B;  2IO1 B;  4W9L A;  2KX3 A;  1WI0 A;  3ML9 A;  4K7W A;  5CTR C;  5J18 A;  4NY0 A;  4W9H A;  4AP4 C;  4TQ0 A;  1GC6 A;  2KDF B;  3QWZ B;  1E7V A;  2KKC A;  3VQI A;  4CHK A;  2LXA A;  4NQL B;  3HIZ A;  2KO3 A;  3P2B A;  1WGY A;  2FCN A;  3L0W B;  4HDQ A;  2N9E B;  1UGM A;  3H9D A;  1OTR B;  1KJT A;  2KQS A;  2IY0 B;  2KD0 A;  2HTH A;  1WZ3 A;  2D2Q A;  2JRI B;  2C7M B;  3WAP A;  1AAR A;  2Z0E B;  4ANV A;  1V49 A;  2O6V D;  1I35 A;  2K25 A;  4II2 B;  1OGW A;  1P3Q U;  1Y8R C;  2G45 B;  4KIK B;  4ANU A;  2R2O A;  2HJ8 A;  1WX9 A;  3S2A A;  5AZG A;  1RAX A;  2KFK A;  4TQ1 A;  5D7G A;  3TL5 A;  4DDI D;  2CKH B;  4DHZ E;  1GC7 A;  3RUI B;  4RMA A;  3ZDM C;  3DQV A;  3ZIM A;  1WR1 A;  4WQO B;  4HCP B;  4GDK B;  3UQB A;  2K8H A;  1E8Z A;  2MCN B;  4F8C B;  4W9I A;  4FLH A;  4DHJ B;  4BKS D;  2LD9 A;  4KVG B;  1E8X A;  1EO6 A;  1YIW A;  1KM7 A;  5LLI A;  1NDD A;  5CHW A;  3SD5 A;  4XZ4 A;  1YQB A;  3JW0 X;  3OJ4 B;  5E6N A;  1GUA B;  5CHV C;  1TBE A;  2J0M A;  3IFW B;  1WGD A;  3A9K A;  2KLG A;  1LM8 B;  3OLM D;  5DCN A;  1T0Y A;  2BGF A;  2EMT A;  2N7D A;  3M62 B;  4JIO U;  3TCA A;  3SDL C;  1IP9 A;  3X0W A;  1WE6 A;  2DZJ A;  4MGY E;  2J7Q B;  2M17 A;  2MBQ A;  3QC8 B;  4HPL B;  5HKH A;  3QAQ A;  2KZR A;  2KQ7 A;  2MWS B;  4GN1 A;  4WWN A;  5D2M B;  2VRR B;  2W9N A;  2N9X A;  2J0J A;  2JUO A;  4BKG A;  1R4M I;  4MSQ B;  3ZW3 A;  4A3O A;  4GB9 A;  5FR6 A;  3T9L A;  2KVR A;  4M8M A;  4LCD E;  3NY5 A;  2K1F A;  4WJO A;  3APD A;  2C7H A;  2I1K A;  4M0W B;  1ISN A;  2ZPN A;  1P98 A;  3V6C B;  3KVF B;  2KWV B;  3NHE B;  3WAL A;  1RLF A;  2ZJD A;  3AU4 A;  3H1U A;  3EFU A;  2FUH B;  1J0G A;  2JZ3 B;  4NAW A;  4AJY B;  4W9G A;  3JSV A;  2BF8 B;  3KYC D;  3N32 A;  2KHW B;  5AZH A;  1TGZ B;  2NPT B;  3RZF A;  2JRH A;  5JHA A;  1K8R B;  4IM3 A;  1WYW B;  2JXX A;  3MHS D;  3APF A;  4JL9 A;  3V6E B;  1WGH A;  1WXS A;  1V2Y A;  3O65 B;  3ZTC A;  3A4R A;  1V6E A;  2WYQ A;  3VDZ A;  2LI5 A;  2WX1 A;  3VXW A;  1WMH B;  4MJS A;  3QA8 A;  3U8Z A;  3QK0 A;  3ZLZ A;  3WA0 A;  2ZCB A;  4MGZ E;  4PS7 A;  1P0R A;  3ZO5 B;  4B6W A;  2A4Z A;  1L7Y A;  1UD7 A;  2KC2 A;  1JRU A;  2B3A A;  4FJY A;  4F1S A;  1WJ6 A;  4GU2 A;  3CSF A;  3ZRC A;  2KX0 A;  3H6N A;  1KOT A;  3K9O B;  1OQY A;  3ONS A;  2KDE B;  2LZ6 A;  3W1S C;  4G50 A;  3U30 A;  2IO2 B;  2JPH A;  3QIJ A;  1FXT B;  3A9J B;  4AWJ A;  2N1V A;  1U4A A;  3DBR I;  3DBH I;  3NS8 A;  2KTR B;  2L3Z A;  3CST A;  2RD0 A;  2A5U A;  3NOB A;  2KK8 A;  3GOE A;  3L08 A;  3PS6 A;  1SGH A;  2DHZ A;  4GGQ A;  1V86 A;  1E8Y A;  4IM0 A;  4DHZ B;  3PTF C;  2FCM A;  3B08 A;  1UH6 A;  1Q5W B;  4NQK E;  3QQ8 B;  5G2N A;  1UBQ A;  2PPH A;  2EKE C;  4WWO A;  1WF9 A;  4W9K A;  1NBF C;  2Z0D B;  2Z59 B;  2C5L C;  4JGH B;  3IVF A;  1YX5 B;  2G4D B;  3APC A;  1V9J A;  1WGR A;  5G55 A;  3KH0 A;  3ZRF A;  5EDS A;  2KDI A;  2KC1 A;  3WAN A;  1UBI A;  2AWT A;  3PLU A;  3Q3F A;  2D10 A;  4EEW A;  5C1Z A;  2G3Q B;  2RPQ A;  4AUQ C;  2RGF A;  1EF1 A;  1WH3 A;  5J17 A;  2L05 A;  3ZNI D;  4CO7 A;  2CU1 A;  3BY4 B;  1E7U A;  3PHW B;  1WXM A;  2JZZ A;  3PGE A;  3PPA A;  5BO4 B;  2FIF A;  2D11 A;  3A1Q A;  3MTN B;  2O2V A;  4JQW C;  4K1R B;  1WR6 E;  2XK5 B;  3Q3J A;  5DPW A;  1BT0 A;  4FJV B;  2XBB C;  2V1Y A;  1Z2M A;  4TV3 A;  4W9D A;  4WJP A;  1LQB A;  1P1A A;  1QZE A;  3ZTD A;  4E3C A;  1GJZ A;  4FHK A;  1P9D U;  4RM8 A;  2XEW A;  2KJR A;  3LDZ E;  3TIX A;  1V5T A;  3DVN V;  1WRD B;  1E8W A;  4K81 A;  4KIK A;  5CHF A;  2LRW A;  4FJZ A;  3L16 A;  2Y5B B;  2N1W A;  1V81 A;  2CHW A;  4DDG D;  2K6Q A;  1WY8 A;  1WJN A;  1X1M A;  2KWU B;  2LGY A;  3VUW A;  3C0R B;  4GDK A;  5KHQ A;  2KJH B;  2MBE A;  4DK5 A;  1S3S G;  4XC2 A;  3B0A A;  2GBR A;  4W9F A;  1H8C A;  2N7E A;  1GNU A;  3KUZ A;  2DZM A;  2OJR A;  3SU8 X;  2MA9 B;  2LXC A;  2RSU A;  3DCG A;  3N3K B;  3RCZ A;  2GBN A;  5JH5 C;  4NJ6 A;  4NNJ B;  3BIN A;  3D32 A;  2NVU I;  2C60 A;  2KN5 A;  4IM2 A;  3U7D A;  5LXH A;  4KSK C;  2GOW A;  2KLC A;  2MX2 A;  2PE6 B;  3DVG X;  1WZ0 A;  2CS4 A;  3H7P A;  3PV1 A;  4OVU A;  4WAA A;  3VUX A;  3GZN I;  3PHX B;  3TBL D;  3RT3 B;  4FUL A;  4IUM B;  4A20 A;  4I6P A;  1NI2 A;  1WXA A;  2DX5 B;  3VTV A;  1WM2 A;  2IZV B;  4EZK A;  3UGB B;  2NS5 A;  4II3 B;  3CF6 E;  4MH0 E;  1J8C A;  2LAS A;  3DBL I;  4DBG A;  3PLV A;  4MEL A;  5E6O A;  5GMV A;  2HE7 A;  2WWZ A;  1EUV B;  2DZI A;  3JSV B;  4G11 A;  4ICV A;  4K7S A;  1R4N I;  2V3S A;  3KUD B;  5TR5 A;  2KOX A;  2QHO A;  3KYD D;  3R7Q A;  2ZNV C;  4BVU C;  5J2R A;  2LUE A;  2KMA A;  2GBK A;  3N30 A;  1RFA A;  5DPS A;  4N9F 4;  4ASW C;  1M94 A;  3M63 B;  3QX1 A;  5IAA C;  2DYM A;  3B1L X;  3VHT C;  3OAW A;  2BYV E;  3QHT A;  3L10 B;  3ENE A;  4MJS B;  1F9J A;  2K8B A;  4KDI C;  2MW5 A;  4EFO A;  3DVG Y;  2DAF A;  4MDK E;  4ANW A;  3K9P B;  3WIM A;  1ZGU B;  4XX5 A;  4PYU A;  3VFK A;  3V62 A;  1C1Y B;  1VCB A;  3AUL A;  1WE7 A;  1Z5S B;  2ZEQ A;  3JYU A;  3L54 A;  2MP2 A;  2FCS A;  2ZVN A;  4ZYN A;  4BKT A;  2L8J A;  2FAZ A;  3DDC B;  2L0T A;  5AEK B;  2KJ6 A;  4NPN A;  2O6V A;  4E74 A;  1WMH A;  1KLV A;  2K39 A;  2ZZP B;  2IO3 B;  2JVC A;  3VTW A;  4BBN F;  1WX7 A;  4ZRK A;  3DVN U;  4E71 A;  2M0X A;  4F7Z A;  3JVZ X;  2KWC A;  2JY6 A;  2KFJ A;  2LGX A;  2UWQ A;  1WFY A;  4FAD A;  1YX6 B;  2G4S A;  1A5R A;  3ECI A;  4ZRJ A;  2KTF A;  4KV2 A;  2R2Q A;  3L17 A;  4HDO A;  4HXD A;  2DYO A;  5L95 C;  4YL8 A;  4HCN B;  3SHQ A;  3ZNG C;  3NZU A;  1Q1O A;  4BKS A;  4PS8 A;  3AXC A;  2HD5 B;  1E5W A;  3ML8 A;  4FN2 A;  4HPM B;  4BOS C;  4GOC A;  4NJ7 A;  4GDL A;  3M3J A;  1H4R A;  4IWQ A;  1C3T A;  3QJZ A;  4I6N B;  1LFD A;  3HM3 A;  4KZC A;  1WJ4 A;  2MSE D;  3ZVV A;  4WJQ A;  2V4L A;  5CX3 A;  5JHB A;  4AJW A;  1WXV A;  4PYZ A;  3IBE A;  4K7U A;  3EHV A;  1E90 A;  4HWI B;  2M8S A;  5IA7 A;  3V61 A;  4HJK A;  4KZ0 A;  1V5O A;  3EEC A;  4J6I A;  3DPD A;  1TZ1 A;  2YLM A;  3HHM A;  4B95 A;  5LXI B;  2N4F A;  3M95 A;  2GBJ A;  3VAW A;  3ZUN A;  1SIF A;  2BKF A;  3KW5 B;  2BYE A;  1EF5 A;  2M4N A;  3A1Q B;  3L13 A;  3PRZ A;  4KDL B;  2O2V B;  2KFK B;  4KSL C;  3VVW B;  2YVC A;  4ICU A;  2LVP A;  2BYF A;  2JF5 A;  1VD2 A;  4LDT B;  1LXD A;  2ZVO A;  4MEM A;  3H7S A;  2K6D B;  3PRP B;  2L7R A;  4MGK E;  4FA6 A;  4BBN C;  2FCQ A;  3IHP C;  1CMX B;  2WDT B;  2ZNV B;  2NBV B;  3HM6 X;  2CHX A;  3A4S C;  2XK5 A;  1UZX B;  1MG8 A;  1YJ1 A;  3UIN B;  4DWF A;  1HE8 A;  3ZKJ C;  1IPG A;  4TKN A;  2KNB A;  2RR9 A;  3I3T B;  3RYT A;  2BPS A;  1WGG A;  2FNJ B;  1XQQ A;  2J0K A;  1Q0W B;  2DYB A;  2LVQ A;  2NBU A;  3A9K B;  3PSE B;  2MBO A;  2LWP A;  1L2N A;  4LJP B;  4MGI E;  4RM9 A;  4GXB A;  2PE9 A;  2PEA A;  4IW0 A;  3QCA A;  3UIO B;  1WIA A;  3TMP B;  4HVB A;  2BWE S;  3RZW C;  1GG3 A;  2LRU A;  3IG3 A;  4HK2 A;  2JWZ A;  2NCN A;  4TUU A;  3PZD A;  4FBJ B;  1S1Q B;  1YD8 U;  2FID A;  3DBS A;  1J19 A;  3R66 C;  2C9W B;  4JLC A;  3H7P B;  3UIP B;  3V60 A;  3UF8 A;  4MM3 A;  2AL3 A;  5DPR A;  4GMV A;  2LJ5 A;  3ZDT A;  4IG7 B;  1ZW7 A;  5KHO A;  1D3Z A;  2MQJ A;  4HLE A;  2AEH A;  2NBW B;  3VTU A;  2MBB B;  3OJ3 A;  4BOZ B;  2N9P C;  5D94 A;  4GSW A;  4NAW B;  3LJ3 A;  4W9E A;  4ANX A;  3W1S A;  2AYO B;  1WJU A;  2REX A;  2MRP A;  3X23 A;  2CHZ A;  5JZE B;  4EOY A;  3R7R A;  1UEL A;  3DOW A;  3MJW A;  3NZS A;  4M8N A;  4W9J A;  4LDT D;  4CYE A;  3ZNH B;  2UYZ B;  4EZL A;  1OEY J;  4X57 B;  2LVO A;  4FHJ A;  2DAJ A;  5E6P A;  4IC7 B;  5D6J B;  2BKR B;  3T8M A;  2BWF A;  3ALB A;  3RD2 A;  2JT4 B;  2NPT A;  5AZF A;  4I6L B;  2M1M A;  3CMM B;  1PQS A;  4PS3 A;  5L83 A;  4DXA B;  2D07 B;  2WX0 A;  4IWP A;  2IYD B;  4LJO B;  2DZK A;  2MP2 B;  2KDB A;  3PRM B;  2IBI B;  2ZPY A;  4DHJ D;  4G0N B;  4EKU A;  4B9K A;  2K8C A;  2MBH A;  1ZKH A;  1V80 A;  2O6V B;  2EMS A;  3A33 B;  4OVV A;  3VUY A;  1WX8 A;  1IYF A;  1TTN A;  4EUT A;  2ZCC A;  3ZNZ B;  4WJN A;  4A3P A;  4GIV A;  3R3M A;  2DEN B;  2L76 A;  1OEY A;  4URK A;  3AU5 A;  3PRE A;  2KMC A;  1I42 A;  3TJP A;  2AL6 A;  4ZDV A;  3AI5 A;  5DPT A;  2CR5 A;  2I1J A;  3A9J A;  2GMI C;  2GBM A;  4ZRI A;  4P7I A;  2MLB A;  3HK0 A;  4EZJ A;  4G3X B;  2PJH A; 
#chains in the Genus database with same CATH topology
 1G6J A;  3QAR A;  1HXY D;  4P6V F;  4IWO A;  1FO4 A;  3KLS X;  3RUL A;  5HFY A;  3AE4 B;  1L0Y B;  2ASQ A;  4WWP A;  1QQR A;  2NR2 A;  2KXJ A;  1E10 A;  3KUC B;  2IO1 B;  2KX3 A;  4KGS A;  4YSZ B;  2I38 A;  4NY0 A;  3E56 A;  2QIE B;  4P1C C;  4TQ0 A;  4CHK A;  2LMC A;  1WGY A;  1V1O A;  1OTR B;  3ZGZ A;  2JRI B;  3MP9 A;  4II2 B;  1P3Q U;  1Y8R C;  4IKG A;  2R2O A;  2JZP A;  2XNA C;  5AZG A;  2L52 A;  5D7G A;  3TL5 A;  1EU3 A;  2JQR B;  2CKH B;  4RMA A;  3ZDM C;  1QT9 A;  4GDK B;  2K8H A;  4F8C B;  4W9I A;  4NAM A;  4DHJ B;  1QOA A;  4BKS D;  1TS5 A;  1KM7 A;  5LLI A;  3BZD B;  3JW0 X;  3OJ4 B;  3T3O A;  1VJK A;  5CHV C;  3AED B;  1F2R I;  1ET6 A;  2RDG A;  3MHZ A;  3A9K A;  2KLG A;  1I4P A;  1D5M C;  5E6J A;  5JXV A;  2KQ7 A;  4WWN A;  4YWG G;  4DXG A;  4BKG A;  1R4M I;  4MSQ B;  5FR6 A;  3OG5 A;  3T9L A;  2KVR A;  2K1F A;  1UF0 A;  1CK1 A;  2BB5 A;  1F2R C;  3EUB 2;  3WAL A;  3AU4 A;  4MAC A;  4W9G A;  3JSV A;  2BF8 B;  3KYC D;  3ETR A;  5AZH A;  3HVZ A;  2OJW A;  5JHA A;  3MHS D;  3T3N A;  1WGH A;  5IP4 D;  4WIP A;  1FEH A;  3DBH B;  3DBR B;  3AN1 A;  3N1Z C;  3VXW A;  3QA8 A;  3U8Z A;  2J53 A;  4RGO S;  1IBX B;  2PVG C;  1P0R A;  2A4Z A;  1XCQ L;  1UD7 A;  3BWU D;  4FJY A;  2B3A A;  2IGH A;  1ROE A;  2D3C A;  2MHJ A;  1B1Z A;  4LNF A;  4RNA A;  2WGS A;  3ONS A;  1TS3 A;  1I4G A;  4O1N A;  4NJC A;  4N59 A;  2LGI A;  2GI9 A;  4RCO A;  5AUK A;  1FXT B;  2A5U A;  2B76 B;  3L08 A;  3PS6 A;  1SGH A;  2DHZ A;  1AW7 A;  1TS2 A;  5I4D A;  4KKI A;  2WXM A;  4IM0 A;  3Q8C A;  1Q5W B;  4RF1 A;  5G2N A;  2WU5 B;  3RNG C;  2VH2 A;  4JGH B;  2K22 A;  3APC A;  2M0A A;  3ZRF A;  3BYY B;  4EEW A;  2WXL A;  1L4Z B;  2G3Q B;  5C1Z A;  2RGF A;  5J17 A;  2L05 A;  4HKZ E;  1E7U A;  3PHW B;  1E0Z A;  1VDV A;  3PGE A;  2KQ4 X;  1FPY A;  1J7C A;  3A1Q A;  3R8B A;  2EEL A;  1WRI A;  1Z2M A;  4LNO A;  1LQB A;  1N62 A;  4FHK A;  4C56 C;  1P9D U;  4JPS A;  1E8W A;  5CHF A;  4ZOH C;  1DOX A;  1BML C;  3BK1 A;  1N5X A;  3VUW A;  3BYT B;  2UU7 A;  2PLP A;  1S3S G;  2KDM A;  3B0A A;  3DHI C;  4W9F A;  3U2S C;  1H8C A;  2OED A;  2DZM A;  3DBL B;  3SR6 A;  2JXT A;  3AMZ A;  2VZK B;  1SEB D;  3D32 A;  1JWA D;  4IM2 A;  4KSK C;  2KLC A;  2MX2 A;  1QOF A;  2CJN A;  3RNA C;  3GB1 A;  4IDI A;  2WP9 B;  4II3 B;  4L1B A;  2KYW A;  2DZI A;  4K7S A;  1VR9 A;  4BVU C;  1RFA A;  5IAA C;  5BMI A;  1D5X C;  2BYV E;  3ENE A;  1GB1 A;  2K8B A;  3V62 A;  2FCS A;  3DDC B;  1T6B X;  2L0T A;  1WYG A;  2KJ6 A;  3MFG A;  2L1A A;  3KWV A;  4XWT A;  1KLV A;  2K39 A;  2ZZP B;  2IO3 B;  2VZK D;  1WX7 A;  2IGG A;  1FIQ A;  2LGX A;  2KFJ A;  4A55 A;  1WFY A;  4FAD A;  3ECI A;  4ZRJ A;  3R2I A;  1XO3 A;  1YOV B;  4YL8 A;  1DOI A;  3NZU A;  4BKS A;  3AXC A;  2HD5 B;  3ML8 A;  2NTS A;  3AEA B;  4I6N B;  3ZVV A;  1K53 A;  1R7S A;  2V4L A;  4WAF A;  4AJW A;  1WXV A;  2Y5C A;  3IBE A;  3EHV A;  4YTN B;  2M8S A;  5IA7 A;  4KZ0 A;  3AE2 B;  3ZUN A;  1SIF A;  3KW5 B;  2M4N A;  2BYF A;  2GB1 A;  1P7F A;  4XDC A;  1N61 A;  3PRP B;  2L7R A;  5GXG B;  2QJL A;  3VRB B;  3PZ7 A;  3N9Y C;  3J9C A;  2CHX A;  4IOI E;  3NVY A;  1I4Q A;  1E6E B;  2WXF A;  2RR9 A;  1FM0 D;  2J0K A;  3A9K B;  2WHI A;  4GXB A;  4IW0 A;  3WCQ A;  3BK2 A;  4HKQ A;  1MJD A;  4OZB A;  4HK2 A;  2W82 A;  5EE9 A;  3PZD A;  4FBJ B;  2FID A;  3DBS A;  1JW9 D;  3R66 C;  4JLC A;  1I4R A;  1TKG A;  1HTQ A;  5DPR A;  1ZW7 A;  3IT6 B;  2MQJ A;  2N9P C;  4OW0 A;  4W9E A;  3X23 A;  5EE0 A;  3AEF B;  1UEL A;  3DOW A;  4W9J A;  2RPV A;  3Q8B A;  4X57 B;  2X38 A;  4IC7 B;  3LB8 C;  2BKR B;  5D6J B;  3AEC B;  2LHD A;  3Q6B A;  1QOB A;  4HEA 1;  1K51 A;  5L83 A;  2D07 B;  1JCK B;  3PRM B;  1GAQ B;  2O6V B;  3Q3N C;  3VUY A;  1IYF A;  4GLS C;  4WJN A;  4GIV A;  3I5J C;  2L76 A;  3AU5 A;  1HEZ E;  1I42 A;  2AL6 A;  1SJH D;  4P7I A;  2MLB A;  2J4X A;  1WM3 A;  2J42 A;  4BFR A;  2LGD A;  4AOF A;  3PT2 B;  4YTP B;  3IT4 B;  3WAM A;  1ESF A;  2IO0 B;  4EE2 A;  1WI0 A;  4K7W A;  5J18 A;  3AEB B;  3VR8 B;  2RDB C;  1GC6 A;  2KKC A;  2KO3 A;  3P2B A;  4ACF A;  2N9E B;  1UGM A;  1KJT A;  2HTH A;  1WZ3 A;  1SBB B;  4ANV A;  1V49 A;  2BVC A;  2GRI A;  2O6V D;  1L0X B;  1I35 A;  2G45 B;  3P1M A;  1JRP A;  3RFZ B;  1WX9 A;  4YT0 B;  3RNF C;  1PDX A;  3RUI B;  4XE0 A;  4HCP B;  1E8Z A;  1TZO A;  2R61 A;  4K3B A;  1I4X A;  1E8X A;  2MJ3 A;  1EO6 A;  5CHW A;  4XZ4 A;  2LJI A;  1TBE A;  2J0M A;  1D4B A;  1WGD A;  1LM8 B;  4JIO U;  3TCA A;  1UGJ A;  1WE6 A;  4MGY E;  5HKH A;  3RN9 C;  3R2T A;  2W9N A;  2J0J A;  3L4P A;  4CQN A;  2JUO A;  3ZW3 A;  4A3O A;  1RFK A;  2JU6 X;  4M8M A;  1KF6 B;  3IXS A;  5D3D A;  3V6C B;  2KWV B;  2BW2 A;  2IJ0 A;  2ZJD A;  1ZPS A;  3P42 A;  3AE8 B;  2FUH B;  5FR3 A;  4C7Z A;  4AJY B;  2V3N A;  1ACC A;  2OHF A;  2HJ1 A;  1TGZ B;  3NVW A;  4IM3 A;  1WYW B;  4JL9 A;  1MPE A;  2RDH A;  3V6E B;  4YSX B;  2N0S B;  2PTL A;  3ZTC A;  2PW9 A;  5HHD G;  5T8I A;  2LI5 A;  4OHJ A;  1WSP A;  1TS4 A;  3VRA B;  4MGZ E;  1JRU A;  3CSF A;  1PFD A;  1KOT A;  1OQY A;  2KDE B;  3Q8E A;  4G50 A;  2IO2 B;  2N1V A;  4WWM A;  1YJI A;  2N7J A;  1C77 A;  2KTR B;  1M4V A;  3NOB A;  1YN5 A;  3AE1 B;  2KK8 A;  2WXH A;  4D2K A;  1V86 A;  2FCM A;  1J7B A;  2EKE C;  3FAH A;  1NBF C;  2HTM E;  5C2T B;  5HG2 A;  5G55 A;  3KH0 A;  1BXT A;  2KDI A;  2KC1 A;  3Q3F A;  2D10 A;  3E9S A;  4OVZ A;  1WH3 A;  5TSS A;  1FFU A;  3PPA A;  1C76 A;  5BO4 B;  3MTN B;  5FK9 C;  1EWC A;  4K1R B;  1T0S C;  1KLG D;  3Q3J A;  4TV3 A;  4W9D A;  5IKC M;  1WWT A;  1F77 A;  3ZTD A;  4E3C A;  2KJR A;  3TIX A;  3ZJU A;  4KIK A;  5EE1 A;  1XLP A;  2LRW A;  4S0R A;  2MH7 A;  2N1W A;  2G9H D;  3I63 C;  1T0Q C;  4XWW A;  3GZN B;  1ZXI A;  3EGR A;  1WY8 A;  4JWS C;  1I7H A;  1E7P B;  1L4D B;  2BS4 B;  4ITK A;  2N7E A;  4M02 A;  2OJR A;  4ZYS A;  2MA9 B;  1YN3 A;  1TY2 A;  3RCZ A;  1FRR A;  3N3K B;  3MC0 B;  4NJ6 A;  4NNJ B;  3BIN A;  2DLB A;  1YQ3 B;  2C60 A;  2KN5 A;  3VUX A;  3PHX B;  3TBL D;  4FUL A;  1WXA A;  1WM2 A;  4EZK A;  3UGB B;  1N5W A;  1CQV A;  5E6O A;  2HE7 A;  2WWZ A;  2WXQ A;  1VZ7 A;  1R4N I;  5TR5 A;  1VZ6 A;  1FCL A;  2QDF A;  2QHO A;  3B2F A;  4M0W A;  3GP7 A;  1UNS A;  1Q10 A;  2KMA A;  2GBK A;  3KWL A;  4MJS B;  4KDI C;  2MW5 A;  1MFW A;  3WIM A;  1ZGU B;  3VFK A;  3L54 A;  1RYJ A;  2PMV A;  1GB4 A;  2L8J A;  2FAZ A;  2LUM A;  5AEK B;  4NPN A;  2WNM A;  2JYT A;  2O6V A;  1WMH A;  3Q8F A;  3VTW A;  3AV8 A;  4ZRK A;  1CJE A;  4E71 A;  2V0G A;  3JVZ X;  2JY6 A;  2Y5P A;  2BB6 A;  2UWQ A;  4ARC A;  3RNE C;  2XN9 C;  2KTF A;  1D5Z C;  3AE6 B;  3SFD B;  3L17 A;  4HDO A;  1J7A A;  5L95 C;  4HCN B;  4BOS C;  4HPM B;  1E5W A;  4FN2 A;  4OZA A;  4GOC A;  4NJ7 A;  1H4R A;  4IWQ A;  3QJZ A;  4KZC A;  3GS2 A;  4C00 A;  2AQ2 B;  1B9R A;  5BMG A;  4PYZ A;  4K7U A;  3ZJV A;  1E90 A;  4HWI B;  1KRH A;  1SIJ A;  4RGN A;  3I57 A;  3BVZ A;  4AQ7 A;  3V61 A;  4HJK A;  3EEC A;  1D6E C;  3DPD A;  4B95 A;  3W5U B;  2N4F A;  3M95 A;  1SXT A;  3V3X A;  2BYE A;  3PRZ A;  3Q14 C;  1NYR A;  4KSL C;  2YVC A;  2LVP A;  2JF5 A;  1LXD A;  2ZVO A;  4MEM A;  1P7E A;  3H7S A;  4LK0 M;  2FCQ A;  3IHP C;  2ZNV B;  2NBV B;  3A4S C;  2XK5 A;  1KTK A;  3RPF C;  3UIN B;  3NUH B;  1HE8 A;  1ENF A;  2KNB A;  3I3T B;  2LVQ A;  4B0M A;  2DYB A;  1L2N A;  4LJP B;  3NJT A;  2BT6 A;  4MGI E;  1NYQ A;  3UIO B;  1I4H A;  1GG3 A;  2LRU A;  3W2D A;  2JWZ A;  3AH7 A;  3TEX A;  1FXI A;  4JX1 C;  3CWI A;  3TUO A;  1J19 A;  2C9W B;  5IOI A;  3H7P B;  3UIP B;  3UF8 A;  3DHH C;  3H8H A;  4HLE A;  2AEH A;  3U52 E;  2MBB B;  3OJ3 A;  2X8X X;  3LJ3 A;  2KN4 A;  3W1S A;  2AYO B;  2LFI A;  2MRP A;  2CHZ A;  4EOY A;  3R7R A;  4WUR A;  4H2A A;  4CYE A;  4EZL A;  2UYZ B;  1OEY J;  1JQ4 A;  2W55 A;  4FHJ A;  2IPK D;  3GE8 C;  3ALB A;  3MC8 A;  4I6L B;  3CMM B;  4LTU A;  3UI3 A;  4DXA B;  1OQQ A;  3HVD A;  2WX0 A;  3AEG B;  4LJO B;  2KDB A;  4C7Y A;  1YMH E;  2ZPY A;  2V3P A;  3TEZ A;  4B9K A;  2EMS A;  3A33 B;  4C4V B;  1V1P A;  2DEN B;  1OEY A;  3PRE A;  4US9 A;  2QEJ C;  1FD6 A;  4ZDV A;  1SE4 A;  2I1J A;  3TSS A;  2GMI C;  1DYQ A;  1ZP0 B;  1HZ6 A;  3P4P B;  2KTR A;  5AUI A;  1XT9 B;  3I9V 1;  4GDL B;  1ZDX A;  2C7N B;  4OZC A;  2L00 B;  3W1Y A;  1T0R C;  1WGK A;  1RRB A;  2ACZ B;  2L0F A;  2KAN A;  3VH3 B;  5C23 A;  2IY1 B;  3AE7 B;  3MJ5 A;  2KMM A;  2ONQ A;  1NI3 A;  4MH8 A;  3ZXR A;  4WH4 A;  4W9H A;  4AP4 C;  3RMK C;  3BII D;  2KDF B;  3VQI A;  1E7V A;  3B9J A;  1FNV A;  4N58 A;  2FCN A;  3L0W B;  3HRD D;  2L83 A;  4USA A;  2D2Q A;  2CU3 A;  2K25 A;  4KIK B;  3S2A A;  1RAX A;  2KFK A;  4DDI D;  3DQV A;  2WQY B;  1WR1 A;  4WQO B;  3UQB A;  2BYT A;  3URY A;  2WS3 B;  4BZA A;  5H8Y E;  4FLH A;  2WDR B;  2LD9 A;  3MC9 A;  1R4M B;  4A9A A;  4ZRP A;  1YIW A;  1TJE A;  4YTM B;  4KGT A;  1N63 A;  1VZ8 A;  5DCN A;  4RH6 A;  3ZXV A;  2BGF A;  3LYY A;  2ZW1 A;  3M62 B;  2INP E;  3SEB A;  1IP9 A;  3X0W A;  4C80 A;  2J7Q B;  2M17 A;  3QC8 B;  1C4P A;  3C8Y A;  3QAQ A;  2N9L A;  2MWS B;  5D2M B;  1KFY B;  2M19 A;  4GB9 A;  1YNT E;  3NY5 A;  4WJO A;  2I1K A;  4M0W B;  3NG0 A;  3KVF B;  2KAJ A;  1RLF A;  2KVZ A;  2WDQ B;  3EFU A;  4PK1 A;  1J0G A;  2JZ3 B;  1PUT A;  2KHW B;  1C79 A;  2WXN A;  3RZF A;  2JRH A;  3VR9 B;  1EU4 A;  2QCZ A;  1K52 A;  3ZQ4 A;  1SE2 A;  1TT5 B;  1WXS A;  1V2Y A;  3IAM 1;  3O65 B;  2WYQ A;  3U7Z A;  1WMH B;  4MJS A;  1TY0 A;  3C19 A;  2K5P A;  3ZLZ A;  3EFC A;  2ZCB A;  4HRO A;  2DNF A;  2YEP B;  3N1X C;  2K0P A;  4FXC A;  4F1S A;  4GU2 A;  2KX0 A;  3K9O B;  4A90 A;  2LZ6 A;  3U30 A;  3BVG A;  2JPH A;  3QIJ A;  4AWJ A;  1U4A A;  1VLB A;  2V9H A;  3DBH I;  3DBR I;  3CST A;  2RD0 A;  3W9C B;  1A70 A;  2SAK A;  3GOE A;  1C4C A;  4GGQ A;  3AEE B;  4DHZ B;  3B08 A;  1UH6 A;  5BMH A;  1KLU D;  1WF9 A;  2Z0D B;  2Z59 B;  2D3A A;  2C5L C;  3IVF A;  1YX5 B;  2G4D B;  1V9J A;  1WGR A;  2EKI A;  1UBI A;  2AWT A;  1HZ5 A;  4PT5 A;  1DGJ A;  2RPQ A;  1UUP A;  4AUQ C;  4CO7 A;  3ZNI D;  3BY4 B;  2JZZ A;  2FIF A;  4JQW C;  4S17 A;  1MG4 A;  2XK5 B;  1QKZ A;  5DPW A;  4HRS A;  4WJP A;  4RGM A;  1P1A A;  1QZE A;  2XEW A;  3LDZ E;  3DVN V;  1JWS D;  4XDD A;  4FJZ A;  1JWM D;  1TYG B;  1V81 A;  4DDG D;  1GOZ A;  1WJN A;  2K3U A;  1X1M A;  2KWU B;  3C0R B;  1DOY A;  4DK5 A;  4XC2 A;  1PYW D;  1L0V B;  1GNU A;  3KUZ A;  4M00 A;  2LXC A;  3DCG A;  5JH5 C;  2GBN A;  2NVU I;  5LXH A;  3U7D A;  4WAA A;  3H7P A;  1JAL A;  2CS4 A;  4A6Q A;  2INC C;  4IUM B;  4A20 A;  1STE A;  3AB5 A;  3VTV A;  2DX5 B;  1FNU A;  4XYC A;  2RMM A;  3CF6 E;  4Q2J A;  5IN7 A;  3P4S B;  3DBL I;  4DBG A;  3PLV A;  4MEL A;  5GMV A;  2W54 A;  3P63 A;  4G11 A;  4ICV A;  1JWB D;  1ZE3 D;  2V3S A;  3KUD B;  2KOX A;  3KYD D;  4WQM A;  2ZNV C;  5DPS A;  1FCC C;  1M94 A;  3M63 B;  3QX1 A;  2ON8 A;  2DYM A;  3B1L X;  2CJO A;  2Y3A A;  3QHT A;  1C9F A;  2FBW B;  1F9J A;  4KX6 B;  4EFO A;  2JSV X;  4ANW A;  3K9P B;  4XX5 A;  1V1P B;  3AUL A;  1Z5S B;  2ZEQ A;  4ZYN A;  3ABV B;  2BQQ A;  2JVC A;  4C4V A;  3N1Y C;  3FIL B;  3DVN U;  1V97 A;  1MHX A;  2M0X A;  4F7Z A;  2K9X A;  2KWC A;  5FKA C;  2MEK A;  1YX6 B;  2G4S A;  1A5R A;  4KV2 A;  2R2Q A;  2DYO A;  1F0Z A;  3PO0 A;  3ZNG C;  4PS8 A;  1QOG A;  5H92 C;  4GDL A;  1C3T A;  4P1B C;  1LFD A;  2FUG 1;  2MSE D;  2L32 A;  3RNB C;  1QF6 A;  5CX3 A;  1SJE D;  1XCT L;  2FE8 A;  3B2G A;  1SE3 A;  4BAX A;  3FKY A;  1V5O A;  4J6I A;  5LNK 1;  5LXI B;  1T3Q A;  2WU2 B;  4N6E B;  2BKF A;  3TEW A;  4K3C A;  1EF5 A;  3L13 A;  1IUE A;  4KDL B;  2O2V B;  2KFK B;  4US8 A;  3VVW B;  2KWD A;  2K6D B;  4MGK E;  4DXF A;  1XF5 L;  4FA6 A;  2WDT B;  1HTO A;  1UZX B;  1MG8 A;  1EM7 A;  1YJ1 A;  3NVV A;  4DWF A;  2IND C;  1IPG A;  4TKN A;  2BPS A;  1WGG A;  1XQQ A;  1Q0W B;  2MBO A;  2LWP A;  4RM9 A;  3QCA A;  1FMA D;  3CIR B;  1WIA A;  3TMP B;  4HVB A;  2BWE S;  3DWM A;  1PGX A;  3Q3M C;  4TUU A;  1SB3 C;  2MJD A;  1MI0 A;  1UWM A;  1QIL A;  4MM3 A;  4GMV A;  1AYF A;  2LJ5 A;  3ZDT A;  4IG7 B;  1D3Z A;  2NBW B;  2MJE A;  3VTU A;  1JML A;  3EA6 A;  4GSW A;  5D94 A;  1K50 A;  4ANX A;  1WJU A;  2H89 B;  3AM9 A;  2WXR A;  4B0E A;  3NZS A;  3MJW A;  4M8N A;  2LVO A;  1Y56 A;  3NZ3 A;  2W3S A;  3T8M A;  3V05 A;  2BWF A;  2JYE A;  2SEB D;  5BYQ A;  3RD2 A;  2JT4 B;  1C4A A;  2GLS A;  4R3D A;  1VRA B;  2IYD B;  2MP2 B;  2IBI B;  2AX5 A;  4DHJ D;  2YEP F;  4EKU A;  2MBH A;  1V80 A;  4OVV A;  3Q69 A;  1WX8 A;  2M56 B;  1TTN A;  4EUT A;  3ZNZ B;  2W3R A;  4A3P A;  3R3M A;  3NVZ A;  3TJP A;  2IGD A;  5DPT A;  2CR5 A;  4ZRI A;  3HK0 A;  2LEK A;  1N60 A;  4G3X B;  2JWU A;  4ZHP A;  3UQA A;  4W9C A;  5HI1 A;  3RI7 C;  3KQ4 A;  3EC8 A;  3PVL A;  1XD3 B;  4MSM B;  2OOB B;  3IAS 1;  1SE9 A;  1FXA A;  3VH4 B;  3WAO A;  5G5G A;  1MVK A;  2Z8L A;  2PVO D;  2D3G A;  1LO5 D;  3RNC C;  4W9L A;  1CZP A;  3ML9 A;  5CTR C;  2E3T A;  1TIF A;  1F1H A;  1EWY C;  3QWZ B;  3DWG C;  2LXA A;  4NQL B;  3HIZ A;  4HDQ A;  3H9D A;  2I2Y A;  2V4I B;  2WXG A;  2KQS A;  2BS2 B;  2IY0 B;  2KD0 A;  3WAP A;  1OQR A;  2C7M B;  1AAR A;  2Z0E B;  1OGW A;  4ANU A;  2HJ8 A;  5G5H A;  4TQ1 A;  4DHZ E;  1GC7 A;  3ZIM A;  1RM6 C;  2E6X A;  3SFE B;  3W5V B;  1JRO A;  4XGA B;  2MCN B;  4KVG B;  1JWU D;  2QMT A;  1NDD A;  3SD5 A;  1YQB A;  3LXF A;  5E6N A;  1L6U A;  1GUA B;  3IFW B;  3OLM D;  3AE9 B;  4LNI A;  1T0Y A;  2EMT A;  2N7D A;  3SDL C;  2DZJ A;  4HPL B;  2MBQ A;  2KZR A;  4GN1 A;  2VRR B;  2N9X A;  1AN8 A;  1GPX A;  4LCD E;  2G1E A;  3APD A;  2C7H A;  1ISN A;  2ZPN A;  1P98 A;  3NHE B;  3H1U A;  4NAW A;  5C3J B;  3N32 A;  2NPT B;  1K8R B;  2JXX A;  3APF A;  1IGC A;  2NTT A;  1V6E A;  3A4R A;  3VDZ A;  2WX1 A;  3Q3O C;  3QK0 A;  1NEN B;  3WA0 A;  3NS1 A;  4PS7 A;  1UWX A;  3ZO5 B;  4B6W A;  1L7Y A;  2KC2 A;  1WJ6 A;  1F52 A;  3ZRC A;  3H6N A;  4NZL B;  5IO9 A;  2J52 A;  3W1S C;  1V8C A;  3FIL A;  3A9J B;  3OWE B;  3NS8 A;  3GE3 C;  3NRZ A;  1ET9 A;  2L3Z A;  2Q5W D;  3BVM A;  1NEK B;  3TEY A;  4YXD B;  1OFF A;  1E8Y A;  3PTF C;  4NQK E;  3QQ8 B;  5BYS A;  4M01 A;  1UBQ A;  2PPH A;  4WWO A;  4W9K A;  1ZOY B;  1NVI D;  3AE3 B;  1L5P A;  2DWQ A;  3Q2A C;  5EDS A;  3WAN A;  3PLU A;  1EF1 A;  3Q8A A;  2CU1 A;  1WXM A;  2D11 A;  2O2V A;  1WR6 E;  1L6V A;  1BT0 A;  2WXP A;  4FJV B;  2XBB C;  2V1Y A;  4JWU C;  1SSN A;  1GJZ A;  2PKO A;  4RM8 A;  1V5T A;  2WXO A;  2TSS A;  1WRD B;  4K81 A;  3L16 A;  2Y5B B;  1FFV A;  2CHW A;  2K6Q A;  3O13 A;  2VH1 A;  2LGY A;  4GDK A;  2QC8 A;  4KKJ A;  2KJH B;  5KHQ A;  2MBE A;  2BTE A;  4MM3 B;  2GBR A;  3P4R B;  1E9M A;  3SU8 X;  2RSU A;  2JX5 A;  4ZRQ A;  1R4N B;  1SF0 A;  2GOW A;  3PV1 A;  2IDY A;  2PE6 B;  3DVG X;  1WZ0 A;  3AE5 B;  4OVU A;  1WXQ A;  3GZN I;  3RT3 B;  4I6P A;  1NI2 A;  1XLN A;  2IZV B;  1PGA A;  1T5X D;  2NS5 A;  4MH0 E;  3HUI A;  1J8C A;  3N20 C;  2LAS A;  4LNK A;  1EUV B;  2KT7 A;  3JSV B;  1BUI C;  3R7Q A;  5J2R A;  1MHH E;  2LUE A;  4ZHO A;  2BS3 B;  4A8X C;  3N30 A;  1KH0 A;  4N9F 4;  4ASW C;  3VHT C;  4RGT A;  3OAW A;  3L10 B;  2BBC A;  1ZXH A;  3DVG Y;  2DAF A;  4MDK E;  4PYU A;  1C1Y B;  1VCB A;  1YJJ A;  1WE7 A;  3JYU A;  4J3O D;  4L2Y A;  2MP2 A;  2ZVN A;  4BKT A;  1FRD A;  4E74 A;  3P4Q B;  4BBN F;  1C78 A;  4ARI A;  1IBX A;  2KAC A;  2D5G A;  1ZUD 2;  2WXI A;  4HXD A;  3SHQ A;  2ZW0 A;  1LGR A;  1Q1O A;  2INN E;  2WXJ A;  3M3J A;  2WLB A;  3HM3 A;  1WJ4 A;  2AQ3 B;  4WJQ A;  1IGD A;  5EE3 A;  4YSY B;  5JHB A;  3ZJT A;  1HQR D;  3DHG C;  1XEE A;  1YN4 A;  1TZ1 A;  2YLM A;  3HHM A;  2GBJ A;  3VAW A;  3A1Q B;  2D3B A;  4JE3 B;  4ICU A;  3U4E G;  4AS1 A;  1VD2 A;  2QIL A;  4LDT B;  4LNN A;  4TSS A;  1FNW A;  4HPP A;  4REZ A;  4BBN C;  2ICI A;  1CMX B;  4LLG M;  3HM6 X;  5MPO A;  3ZKJ C;  4L23 A;  3RYT A;  2DBY A;  3PZ8 A;  2FNJ B;  3PSE B;  2NBU A;  2WXK A;  4HJG E;  3ZYY X;  2PE9 A;  2PEA A;  1PGB A;  1RWS A;  3RZW C;  4KGR A;  3IG3 A;  2NCN A;  4RF0 A;  1N6Z A;  1TKE A;  4P16 A;  1S1Q B;  2LHE A;  1YD8 U;  3V60 A;  2AL3 A;  2H88 B;  1ZDV A;  5KHO A;  2AQ1 B;  1XLO A;  4BOZ B;  4NAW B;  2REX A;  5JZE B;  5D3I B;  2QSD A;  4LDT D;  3ZNH B;  4TMA B;  4RFB A;  2DAJ A;  5E6P A;  2PIA A;  4MT5 A;  5BYR A;  2NPT A;  5AZF A;  2M1M A;  1PQS A;  2WDV B;  4PS3 A;  4DQO C;  1XXG A;  1QLB B;  4IWP A;  2DZK A;  1HA5 A;  1XLQ A;  4G0N B;  2K8C A;  2LGS A;  1ZKH A;  2N9K A;  2ZCC A;  4URK A;  2KMC A;  3FC4 A;  4UDU C;  3AI5 A;  4QAY A;  3A9J A;  2GBM A;  1AWD A;  2NMQ A;  1YQ4 B;  4EZJ A;  2HDE A;  2PJH A;  1TKY A; 
#chains in the Genus database with same CATH homology
 1G6J A;  3QAR A;  1WM3 A;  4IWO A;  4BFR A;  2KTR A;  2LGD A;  3RUL A;  4AOF A;  1XT9 B;  3UQA A;  4GDL B;  3PT2 B;  4W9C A;  2ASQ A;  4WWP A;  3WAM A;  2C7N B;  2L00 B;  3EC8 A;  1XD3 B;  2IO0 B;  2NR2 A;  2OOB B;  3PVL A;  4MSM B;  3W1Y A;  1RRB A;  2L0F A;  1SE9 A;  2KAN A;  3VH4 B;  3VH3 B;  3WAO A;  2KXJ A;  5C23 A;  3KUC B;  2D3G A;  2IY1 B;  2IO1 B;  4W9L A;  2KX3 A;  1WI0 A;  3ML9 A;  4K7W A;  5CTR C;  5J18 A;  4NY0 A;  4W9H A;  4AP4 C;  4TQ0 A;  1GC6 A;  2KDF B;  3QWZ B;  1E7V A;  2KKC A;  3VQI A;  4CHK A;  2LXA A;  4NQL B;  3HIZ A;  2KO3 A;  3P2B A;  1WGY A;  2FCN A;  3L0W B;  4HDQ A;  2N9E B;  1UGM A;  3H9D A;  1OTR B;  1KJT A;  2KQS A;  2IY0 B;  2KD0 A;  2HTH A;  1WZ3 A;  2D2Q A;  2JRI B;  2C7M B;  3WAP A;  1AAR A;  2Z0E B;  4ANV A;  1V49 A;  2O6V D;  1I35 A;  2K25 A;  4II2 B;  1OGW A;  1P3Q U;  1Y8R C;  2G45 B;  4KIK B;  4ANU A;  2R2O A;  2HJ8 A;  1WX9 A;  3S2A A;  5AZG A;  1RAX A;  2KFK A;  4TQ1 A;  5D7G A;  3TL5 A;  4DDI D;  2CKH B;  4DHZ E;  1GC7 A;  3RUI B;  4RMA A;  3ZDM C;  3DQV A;  3ZIM A;  1WR1 A;  4WQO B;  4HCP B;  4GDK B;  3UQB A;  2K8H A;  1E8Z A;  2MCN B;  4F8C B;  4W9I A;  4FLH A;  4DHJ B;  4BKS D;  2LD9 A;  4KVG B;  1E8X A;  1EO6 A;  1YIW A;  1KM7 A;  5LLI A;  1NDD A;  5CHW A;  3SD5 A;  4XZ4 A;  1YQB A;  3JW0 X;  3OJ4 B;  5E6N A;  1GUA B;  5CHV C;  1TBE A;  2J0M A;  3IFW B;  1WGD A;  3A9K A;  2KLG A;  1LM8 B;  3OLM D;  5DCN A;  1T0Y A;  2BGF A;  2EMT A;  2N7D A;  3M62 B;  4JIO U;  3TCA A;  3SDL C;  1IP9 A;  3X0W A;  1WE6 A;  2DZJ A;  4MGY E;  2J7Q B;  2M17 A;  2MBQ A;  3QC8 B;  4HPL B;  5HKH A;  3QAQ A;  2KZR A;  2KQ7 A;  2MWS B;  4GN1 A;  4WWN A;  5D2M B;  2VRR B;  2W9N A;  2N9X A;  2J0J A;  2JUO A;  4BKG A;  1R4M I;  4MSQ B;  3ZW3 A;  4A3O A;  4GB9 A;  5FR6 A;  3T9L A;  2KVR A;  4M8M A;  4LCD E;  3NY5 A;  2K1F A;  4WJO A;  3APD A;  2C7H A;  2I1K A;  4M0W B;  1ISN A;  2ZPN A;  1P98 A;  3V6C B;  3KVF B;  2KWV B;  3NHE B;  3WAL A;  1RLF A;  2ZJD A;  3AU4 A;  3H1U A;  3EFU A;  2FUH B;  1J0G A;  2JZ3 B;  4NAW A;  4AJY B;  4W9G A;  3JSV A;  2BF8 B;  3KYC D;  3N32 A;  2KHW B;  5AZH A;  1TGZ B;  2NPT B;  3RZF A;  2JRH A;  5JHA A;  1K8R B;  4IM3 A;  1WYW B;  2JXX A;  3MHS D;  3APF A;  4JL9 A;  3V6E B;  1WGH A;  1WXS A;  1V2Y A;  3O65 B;  3ZTC A;  3A4R A;  1V6E A;  2WYQ A;  3VDZ A;  2LI5 A;  2WX1 A;  3VXW A;  1WMH B;  4MJS A;  3QA8 A;  3U8Z A;  3QK0 A;  3ZLZ A;  3WA0 A;  2ZCB A;  4MGZ E;  4PS7 A;  1P0R A;  3ZO5 B;  4B6W A;  2A4Z A;  1L7Y A;  1UD7 A;  2KC2 A;  1JRU A;  2B3A A;  4FJY A;  4F1S A;  1WJ6 A;  4GU2 A;  3CSF A;  3ZRC A;  2KX0 A;  3H6N A;  1KOT A;  3K9O B;  1OQY A;  3ONS A;  2KDE B;  2LZ6 A;  3W1S C;  4G50 A;  3U30 A;  2IO2 B;  2JPH A;  3QIJ A;  1FXT B;  3A9J B;  4AWJ A;  2N1V A;  1U4A A;  3DBR I;  3DBH I;  3NS8 A;  2KTR B;  2L3Z A;  3CST A;  2RD0 A;  2A5U A;  3NOB A;  2KK8 A;  3GOE A;  3L08 A;  3PS6 A;  1SGH A;  2DHZ A;  4GGQ A;  1V86 A;  1E8Y A;  4IM0 A;  4DHZ B;  3PTF C;  2FCM A;  3B08 A;  1UH6 A;  1Q5W B;  4NQK E;  3QQ8 B;  5G2N A;  1UBQ A;  2PPH A;  2EKE C;  4WWO A;  1WF9 A;  4W9K A;  1NBF C;  2Z0D B;  2Z59 B;  2C5L C;  4JGH B;  3IVF A;  1YX5 B;  2G4D B;  3APC A;  1V9J A;  1WGR A;  5G55 A;  3KH0 A;  3ZRF A;  5EDS A;  2KDI A;  2KC1 A;  3WAN A;  1UBI A;  2AWT A;  3PLU A;  3Q3F A;  2D10 A;  4EEW A;  5C1Z A;  2G3Q B;  2RPQ A;  4AUQ C;  2RGF A;  1EF1 A;  1WH3 A;  5J17 A;  2L05 A;  3ZNI D;  4CO7 A;  2CU1 A;  3BY4 B;  1E7U A;  3PHW B;  1WXM A;  2JZZ A;  3PGE A;  3PPA A;  5BO4 B;  2FIF A;  2D11 A;  3A1Q A;  3MTN B;  2O2V A;  4JQW C;  4K1R B;  1WR6 E;  2XK5 B;  3Q3J A;  5DPW A;  1BT0 A;  4FJV B;  2XBB C;  2V1Y A;  1Z2M A;  4TV3 A;  4W9D A;  4WJP A;  1LQB A;  1P1A A;  1QZE A;  3ZTD A;  4E3C A;  1GJZ A;  4FHK A;  1P9D U;  4RM8 A;  2XEW A;  2KJR A;  3LDZ E;  3TIX A;  1V5T A;  3DVN V;  1WRD B;  1E8W A;  4K81 A;  4KIK A;  5CHF A;  2LRW A;  4FJZ A;  3L16 A;  2Y5B B;  2N1W A;  1V81 A;  2CHW A;  4DDG D;  2K6Q A;  1WY8 A;  1WJN A;  1X1M A;  2KWU B;  2LGY A;  3VUW A;  3C0R B;  4GDK A;  5KHQ A;  2KJH B;  2MBE A;  4DK5 A;  1S3S G;  4XC2 A;  3B0A A;  2GBR A;  4W9F A;  1H8C A;  2N7E A;  1GNU A;  3KUZ A;  2DZM A;  2OJR A;  3SU8 X;  2MA9 B;  2LXC A;  2RSU A;  3DCG A;  3N3K B;  3RCZ A;  2GBN A;  5JH5 C;  4NJ6 A;  4NNJ B;  3BIN A;  3D32 A;  2NVU I;  2C60 A;  2KN5 A;  4IM2 A;  3U7D A;  5LXH A;  4KSK C;  2GOW A;  2KLC A;  2MX2 A;  2PE6 B;  3DVG X;  1WZ0 A;  2CS4 A;  3H7P A;  3PV1 A;  4OVU A;  4WAA A;  3VUX A;  3GZN I;  3PHX B;  3TBL D;  3RT3 B;  4FUL A;  4IUM B;  4A20 A;  4I6P A;  1NI2 A;  1WXA A;  2DX5 B;  3VTV A;  1WM2 A;  2IZV B;  4EZK A;  3UGB B;  2NS5 A;  4II3 B;  3CF6 E;  4MH0 E;  1J8C A;  2LAS A;  3DBL I;  4DBG A;  3PLV A;  4MEL A;  5E6O A;  5GMV A;  2HE7 A;  2WWZ A;  1EUV B;  2DZI A;  3JSV B;  4G11 A;  4ICV A;  4K7S A;  1R4N I;  2V3S A;  3KUD B;  5TR5 A;  2KOX A;  2QHO A;  3KYD D;  3R7Q A;  2ZNV C;  4BVU C;  5J2R A;  2LUE A;  2KMA A;  2GBK A;  3N30 A;  1RFA A;  5DPS A;  4N9F 4;  4ASW C;  1M94 A;  3M63 B;  3QX1 A;  5IAA C;  2DYM A;  3B1L X;  3VHT C;  3OAW A;  2BYV E;  3QHT A;  3L10 B;  3ENE A;  4MJS B;  1F9J A;  2K8B A;  4KDI C;  2MW5 A;  4EFO A;  3DVG Y;  2DAF A;  4MDK E;  4ANW A;  3K9P B;  3WIM A;  1ZGU B;  4XX5 A;  4PYU A;  3VFK A;  3V62 A;  1C1Y B;  1VCB A;  3AUL A;  1WE7 A;  1Z5S B;  2ZEQ A;  3JYU A;  3L54 A;  2MP2 A;  2FCS A;  2ZVN A;  4ZYN A;  4BKT A;  2L8J A;  2FAZ A;  3DDC B;  2L0T A;  5AEK B;  2KJ6 A;  4NPN A;  2O6V A;  4E74 A;  1WMH A;  1KLV A;  2K39 A;  2ZZP B;  2IO3 B;  2JVC A;  3VTW A;  4BBN F;  1WX7 A;  4ZRK A;  3DVN U;  4E71 A;  2M0X A;  4F7Z A;  3JVZ X;  2KWC A;  2JY6 A;  2KFJ A;  2LGX A;  2UWQ A;  1WFY A;  4FAD A;  1YX6 B;  2G4S A;  1A5R A;  3ECI A;  4ZRJ A;  2KTF A;  4KV2 A;  2R2Q A;  3L17 A;  4HDO A;  4HXD A;  2DYO A;  5L95 C;  4YL8 A;  4HCN B;  3SHQ A;  3ZNG C;  3NZU A;  1Q1O A;  4BKS A;  4PS8 A;  3AXC A;  2HD5 B;  1E5W A;  3ML8 A;  4FN2 A;  4HPM B;  4BOS C;  4GOC A;  4NJ7 A;  4GDL A;  3M3J A;  1H4R A;  4IWQ A;  1C3T A;  3QJZ A;  4I6N B;  1LFD A;  3HM3 A;  4KZC A;  1WJ4 A;  2MSE D;  3ZVV A;  4WJQ A;  2V4L A;  5CX3 A;  5JHB A;  4AJW A;  1WXV A;  4PYZ A;  3IBE A;  4K7U A;  3EHV A;  1E90 A;  4HWI B;  2M8S A;  5IA7 A;  3V61 A;  4HJK A;  4KZ0 A;  1V5O A;  3EEC A;  4J6I A;  3DPD A;  1TZ1 A;  2YLM A;  3HHM A;  4B95 A;  5LXI B;  2N4F A;  3M95 A;  2GBJ A;  3VAW A;  3ZUN A;  1SIF A;  2BKF A;  3KW5 B;  2BYE A;  1EF5 A;  2M4N A;  3A1Q B;  3L13 A;  3PRZ A;  4KDL B;  2O2V B;  2KFK B;  4KSL C;  3VVW B;  2YVC A;  4ICU A;  2LVP A;  2BYF A;  2JF5 A;  1VD2 A;  4LDT B;  1LXD A;  2ZVO A;  4MEM A;  3H7S A;  2K6D B;  3PRP B;  2L7R A;  4MGK E;  4FA6 A;  4BBN C;  2FCQ A;  3IHP C;  1CMX B;  2WDT B;  2ZNV B;  2NBV B;  3HM6 X;  2CHX A;  3A4S C;  2XK5 A;  1UZX B;  1MG8 A;  1YJ1 A;  3UIN B;  4DWF A;  1HE8 A;  3ZKJ C;  1IPG A;  4TKN A;  2KNB A;  2RR9 A;  3I3T B;  3RYT A;  2BPS A;  1WGG A;  2FNJ B;  1XQQ A;  2J0K A;  1Q0W B;  2DYB A;  2LVQ A;  2NBU A;  3A9K B;  3PSE B;  2MBO A;  2LWP A;  1L2N A;  4LJP B;  4MGI E;  4RM9 A;  4GXB A;  2PE9 A;  2PEA A;  4IW0 A;  3QCA A;  3UIO B;  1WIA A;  3TMP B;  4HVB A;  2BWE S;  3RZW C;  1GG3 A;  2LRU A;  3IG3 A;  4HK2 A;  2JWZ A;  2NCN A;  4TUU A;  3PZD A;  4FBJ B;  1S1Q B;  1YD8 U;  2FID A;  3DBS A;  1J19 A;  3R66 C;  2C9W B;  4JLC A;  3H7P B;  3UIP B;  3V60 A;  3UF8 A;  4MM3 A;  2AL3 A;  5DPR A;  4GMV A;  2LJ5 A;  3ZDT A;  4IG7 B;  1ZW7 A;  5KHO A;  1D3Z A;  2MQJ A;  4HLE A;  2AEH A;  2NBW B;  3VTU A;  2MBB B;  3OJ3 A;  4BOZ B;  2N9P C;  5D94 A;  4GSW A;  4NAW B;  3LJ3 A;  4W9E A;  4ANX A;  3W1S A;  2AYO B;  1WJU A;  2REX A;  2MRP A;  3X23 A;  2CHZ A;  5JZE B;  4EOY A;  3R7R A;  1UEL A;  3DOW A;  3MJW A;  3NZS A;  4M8N A;  4W9J A;  4LDT D;  4CYE A;  3ZNH B;  2UYZ B;  4EZL A;  1OEY J;  4X57 B;  2LVO A;  4FHJ A;  2DAJ A;  5E6P A;  4IC7 B;  5D6J B;  2BKR B;  3T8M A;  2BWF A;  3ALB A;  3RD2 A;  2JT4 B;  2NPT A;  5AZF A;  4I6L B;  2M1M A;  3CMM B;  1PQS A;  4PS3 A;  5L83 A;  4DXA B;  2D07 B;  2WX0 A;  4IWP A;  2IYD B;  4LJO B;  2DZK A;  2MP2 B;  2KDB A;  3PRM B;  2IBI B;  2ZPY A;  4DHJ D;  4G0N B;  4EKU A;  4B9K A;  2K8C A;  2MBH A;  1ZKH A;  1V80 A;  2O6V B;  2EMS A;  3A33 B;  4OVV A;  3VUY A;  1WX8 A;  1IYF A;  1TTN A;  4EUT A;  2ZCC A;  3ZNZ B;  4WJN A;  4A3P A;  4GIV A;  3R3M A;  2DEN B;  2L76 A;  1OEY A;  4URK A;  3AU5 A;  3PRE A;  2KMC A;  1I42 A;  3TJP A;  2AL6 A;  4ZDV A;  3AI5 A;  5DPT A;  2CR5 A;  2I1J A;  3A9J A;  2GMI C;  2GBM A;  4ZRI A;  4P7I A;  2MLB A;  3HK0 A;  4EZJ A;  4G3X B;  2PJH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...