1PQSA

Solution structure of the c-terminal opca domain of ycdc24p
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
77
structure length
77
Chain Sequence
SEIFTLLVEKVWNFDDLIMAINSKISNTHNNNISPITKIKYQDEDGDFVVLGSDEDWNVAKEMLAENNEKFLNIRLY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Cell division control protein 24
publication title The solution structure of an N-terminally truncated version of the yeast CDC24p PB1 domain shows a different beta-sheet topology.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Cell cycle
total genus 15
structure length 77
sequence length 77
ec nomenclature
pdb deposition date 2003-06-19
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 1pqsA00
3DVGY 3K9PB 1J0GA 3PREA 3N3KB 1V81A 3QA8A 4KV2A 4XZ4A 1U4AA 1OQYA 4WWNA 2L3ZA 4NY0A 4F1SA 4FBJB 2ASQA 2N7EA 5LXIB 4LCDE 4NQLB 1XQQA 3RD2A 4ZRJA 4HK2A 1WJUA 1KJTA 2DYBA 2G4DB 2GBJA 2RSUA 3KVFB 3SD5A 2V4LA 2J0KA 1WJ4A 3WAMA 4MSMB 4EFOA 3VTVA 4URKA 3TMPB 1S3SG 1Q1OA 4W9IA 2K39A 3LDZE 3QARA 4MELA 4MH0E 2KQ7A 3T9LA 3ZIMA 4DXAB 1GC6A 1RLFA 2MBOA 1WY8A 2HTHA 4EZKA 2DZJA 2LI5A 4LJPB 2KWUB 3D32A 2AWTA 3RZWC 1ISNA 3ZDTA 4II2B 5CX3A 4FJYA 3B08A 3U8ZA 4K7UA 3A33B 3UIOB 1V2YA 3PRPB 4WQOB 3O65B 4JL9A 1R4MI 5E6PA 3TJPA 2BKRB 1V80A 3WAPA 4K7WA 3DVGX 3H1UA 4GSWA 4IWOA 5DCNA 4AJWA 3WIMA 3ML8A 1TZ1A 3CSTA 1NI2A 1V86A 5JH5C 3PS6A 1GC7A 1UELA 5J18A 1Q5WB 2M1MA 3ALBA 2KXJA 1J8CA 3PTFC 3DVNU 3IG3A 4GIVA 4J6IA 1Z5SB 4I6LB 1WZ3A 2G3QB 3K9OB 4JGHB 4M0WB 3IVFA 4M8MA 3PLUA 4HXDA 4AP4C 3WANA 2PE6B 4W9HA 1IYFA 2KC2A 3DCGA 2MP2A 4A3OA 4BVUC 3M63B 2D11A 3EECA 2KFKA 4IM0A 3IFWB 3C0RB 4KVGB 2J7QB 2BYEA 2JUOA 3BY4B 2KC1A 2CU1A 2L8JA 2MP2B 1YD8U 2WWZA 3QK0A 2FAZA 3HM3A 3KYCD 4GMVA 3WALA 3ZO5B 2LVOA 2BGFA 2DZIA 5FR6A 2Z0DB 2GBRA 5DPRA 2I1KA 1V5OA 1C1YB 4KZ0A 4M8NA 4DDID 3SHQA 3GZNI 2O2VA 3ZTCA 5KHQA 2MBQA 1WE7A 4BKGA 3DOWA 2ZZPB 2LGDA 2L76A 2CR5A 1WM3A 2N4FA 4HWIB 2C7NB 2O6VD 4TV3A 2BKFA 2IO0B 2CHZA 3PLVA 2GBNA 4RMAA 4MGYE 4IW0A 4MEMA 1A5RA 3VQIA 2BWFA 1UBQA 1G6JA 3X23A 4LDTB 1GG3A 2KQSA 5E6OA 3H7PA 2KD0A 2BPSA 1Q0WB 2GBMA 3A9KA 3ZLZA 4A3PA 3NS8A 4RM9A 4NAWA 4NJ7A 2M0XA 2KJRA 2NPTA 3L10B 2RD0A 3M3JA 3R7RA 3A9KB 4KDIC 3R66C 1E7UA 3X0WA 1LXDA 1NDDA 3APDA 4NAWB 4AOFA 1EF5A 2JXXA 4MGZE 4PYUA 3DQVA 2L0FA 4TQ0A 1UH6A 4IWQA 2KVRA 1J19A 2GBKA 2JF5A 2N1WA 4GB9A 4HCPB 4PS3A 2K8CA 5CTRC 5AZFA 1XT9B 3NY5A 4TUUA 4MGKE 1WH3A 3Q3JA 4W9GA 2JPHA 3VTWA 4AUQC 4XC2A 3HIZA 1PQSA 3VDZA 2KJHB 1WGRA 2JRHA 2K6QA 3OJ3A 4HDOA 4FN2A 1UD7A 4FLHA 3JW0X 4P7IA 2ZCBA 3VTUA 2MBBB 2DAJA 2JWZA 4W9LA 3SDLC 1M94A 2KDFB 3MTNB 2FNJB 2N9PC 1WZ0A 1LFDA 2K6DB 1WE6A 2KMAA 3NZSA 4KZCA 4NJ6A 2KANA 5DPSA 2M4NA 2NVUI 3QAQA 2OOBB 4FHJA 5JZEB 1IPGA 1H8CA 3DDCB 3PHXB 3L0WB 3JYUA 1OEYA 2LVQA 3QWZB 3L13A 2A5UA 2KO3A 2M8SA 3V6CB 4B9KA 1GJZA 2ZPYA 1LM8B 1GNUA 2DX5B 2KMCA 4KSLC 4MJSA 5AZGA 4FJVB 1P98A 4II3B 1RAXA 3PGEA 2XEWA 1ZW7A 3VXWA 5IAAC 1P9DU 4HCNB 4WWOA 2MBHA 3MHSD 3OLMD 4WWPA 1V49A 2KDEB 3HK0A 3B1LX 4G3XB 4NPNA 3W1YA 3ZW3A 2CHWA 2K8BA 2KN5A 4ICUA 4PS8A 1WX9A 2RPQA 1RRBA 3ZKJC 3OJ4B 4AJYB 3A9JA 3JSVA 4ZRIA 4K7SA 1WGDA 2BWES 2IY1B 4W9CA 1HE8A 2MRPA 3EHVA 2D2QA 3PT2B 3RULA 3JSVB 3PZDA 4KSKC 2XK5A 3DBHI 2LASA 2Y5BB 2DHZA 3UQAA 1TBEA 2DYMA 3L08A 4A20A 1D3ZA 2KHWB 2BYFA 4ICVA 3IHPC 3L16A 2LRUA 1KLVA 2KWCA 2CHXA 2LGXA 2WDTB 2KX0A 1TGZB 1NBFC 3KH0A 1WJ6A 1K8RB 2N9XA 2ZNVC 4W9DA 4HLEA 4MM3A 3RYTA 3KYDD 2R2OA 3ZRFA 3TL5A 5G2NA 2V3SA 4JLCA 3TIXA 1WFYA 1ZKHA 2PPHA 4DHJD 3EFUA 3PPAA 1LQBA 1WR1A 4BKSD 1OEYJ 1YIWA 2B3AA 4IG7B 3VFKA 4TQ1A 3V61A 3UF8A 2K25A 3AU4A 4GDLA 4DDGD 1WXSA 2D07B 4XX5A 2G45B 3KW5B 2ZEQA 4ANXA 3TBLD 4E71A 1WMHA 2KFKB 1VD2A 5D2MB 1WR6E 3ENEA 1WMHB 3AU5A 1WGHA 2KTRA 4ANUA 1FXTB 2LXCA 4BOZB 1WXAA 2PE9A 4JIOU 3ZDMC 1WX8A 3QIJA 3VVWB 4JQWC 1MG8A 4GGQA 2IO2B 5LLIA 2RR9A 1X1MA 2IBIB 2LRWA 3JVZX 2MCNB 4DWFA 1C3TA 2EMTA 2QHOA 1P0RA 3KUCB 3QQ8B 4PYZA 3UINB 4X57B 3QCAA 2REXA 3ZNZB 2O2VB 2UYZB 3ZNGC 1SE9A 3A4RA 4FJZA 3Q3FA 1TTNA 2CKHB 4IC7B 4B95A 1ZGUB 3PRMB 2KJ6A 2NS5A 4F8CB 4E74A 1WM2A 3U7DA 4LJOB 4W9FA 3NOBA 3DBRI 4DBGA 2KLGA 4KDLB 1KOTA 1P1AA 2IY0B 2XBBC 3APFA 3H6NA 3H7PB 2MLBA 2MWSB 2LJ5A 4YL8A 3A1QA 1EO6A 4FADA 2BYVE 2FCMA 2PJHA 3MJWA 2NPTB 1IP9A 3BINA 5AZHA 2L0TA 2R2QA 1E90A 2DZKA 1E8XA 2D3GA 2WYQA 2ZCCA 2Z59B 3V60A 4MSQB 4G50A 1WX7A 2GOWA 2Z0EB 4I6PA 2FCSA 3B0AA 3HHMA 3W1SC 4HPMB 3RUIB 3DVNV 3WAOA 5DPWA 3N30A 2IO3B 2ZNVB 3ECIA 4IM3A 4OVVA 3TCAA 1VCBA 2DZMA 2L05A 2JVCA 4MGIE 4F7ZA 3H9DA 3VAWA 5G55A 1L7YA 1Z2MA 3QX1A 2ZJDA 2KWVB 2K1FA 3L17A 4W9KA 3AULA 4DK5A 2ZVOA 3OAWA 4EKUA 4B6WA 2C60A 3M95A 4FA6A 2JZZA 4WJQA 4EUTA 2O6VA 2C9WB 1WXVA 5E6NA 3NZUA 1JRUA 2JY6A 3PHWB 2NCNA 4IM2A 1WGYA 5EDSA 3RCZA 2O6VB 5D7GA 4CO7A 2FIDA 1WIAA 4FHKA 2AL3A 4WAAA 3AI5A 5C1ZA 2IYDB 2KK8A 3N32A 2FUHB 5TR5A 3VHTC 4MJSB 3L54A 2IZVB 3EC8A 2JZ3B 4ZDVA 3UQBA 2KDBA 3PV1A 3KUDB 4EEWA 1CMXB 2J0JA 1WGGA 4HJKA 1WF9A 4ZYNA 2DENB 1EF1A 2AEHA 2KDIA 1WYWB 2EMSA 3UGBB 3NHEB 5HKHA 3PVLA 1UBIA 2K8HA 2C5LC 1E8WA 1E8YA 2YLMA 2KFJA 2FCQA 3VUXA 2RGFA 3R3MA 4E3CA 3I3TB 4BKTA 3VH4B 4TKNA 3DBSA 1L2NA 3A9JB 1H4RA 4OVUA 2DAFA 1WXMA 2LZ6A 1BT0A 2BF8B 5KHOA 3V6EB 3RZFA 2MX2A 4HDQA 2M17A 2N1VA 2YVCA 2XK5B 1XD3B 3CMMB 4BOSC 3QC8B 2GMIC 3M62B 5BO4B 4MDKE 2NR2A 1E7VA 5J17A 3ONSA 5JHBA 2KOXA 2HJ8A 3W1SA 4GOCA 2IO1B 3DPDA 3CF6E 3PSEB 2C7HA 1E8ZA 2G4SA 2LD9A 2UWQA 4LDTD 3T8MA 2N9EB 2LXAA 2LVPA 3QJZA 2AYOB 2KKCA 4GDKA 4RM8A 2L7RA 3QHTA 5J2RA 1T0YA 4FULA 4BBNF 5CHWA 2FCNA 4G11A 5CHFA 4N9F4 4GDKB 5C23A 3ZRCA 5AEKB 2FIFA 1RFAA 3GOEA 4GDLB 3ZNHB 2N7DA 3U30A 3A4SC 2JT4B 3VUWA 2I1JA 4IUMB 1WI0A 1EUVB 4ASWC 4CHKA 4ZRKA 2OJRA 3ML9A 5L83A 3WA0A 1QZEA 2ZPNA 3S2AA 5LXHA 4KIKA 2KTRB 2VRRB 2L00B 3VUYA 3V62A 3ZTDA 4EOYA 3KUZA 2HD5B 3UIPB 4HPLB 4EZLA 4KIKB 1OTRB 5D6JB 4DHZB 4K81A 4HVBA 3SU8X 2MSED 1V6EA 4I6NB 1YX5B 2ZVNA 1AARA 4IWPA 3CSFA 4ANWA 2EKEC 4AWJA 4W9JA 3RT3B 4CYEA 4NNJB 1UZXB 1V5TA 2HE7A 4WJOA 2WX0A 3P2BA 2MA9B 1YQBA 3HM6X 5DPTA 2MW5A 3LJ3A 4WJNA 2JRIB 4BFRA 4NQKE 3IBEA 2KZRA 5GMVA 4EZJA 2AL6A 1OGWA 2KTFA 2W9NA 3R7QA 4BKSA 3A1QB 1WJNA 3H7SA 2PEAA 4GXBA 4DHZE 1S1QB 2NBWB 5L95C 2D10A 1SIFA 2NBUA 5CHVC 1GUAB 5IA7A 1KM7A 2LUEA 2LWPA 4DHJB 1I42A 2LGYA 1V9JA 1SGHA 3ZNID 2A4ZA 3DBLI 3PRZA 2J0MA 2MBEA 1I35A 4PS7A 4G0NB 1P3QU 3ZVVA 2NBVB 4W9EA 1F9JA 1YX6B 2C7MB 3ZUNA 1E5WA 3VH3B 4WJPA 2CS4A 2MQJA 2KLCA 1WRDB 2KNBA 1Y8RC 5D94A 2DYOA 3APCA 1UGMA 4ANVA 4BBNC 4K1RB 2KX3A 2WX1A 3AXCA 1YJ1A 1R4NI 5JHAA 2V1YA 4GN1A 4GU2A
chains in the Genus database with same CATH superfamily
4K3CA 4KKIA 3AEDB 1U4AA 2K0PA 4F1SA 1XCQL 2ASQA 4LCDE 1NENB 1FRDA 2DYBA 2WDVB 2WLBA 2V4IB 2J0KA 3BIID 4MSMB 2K39A 1E9MA 1PGBA 5IO9A 1GC6A 1KFYB 2I2YA 2HTHA 5D3IB 3U52E 3R2IA 2AWTA 3RZWC 2JYEA 1ZOYB 2YEPF 3A33B 1V2YA 4WQOB 2CJNA 2KQ4X 1V80A 4IWOA 3WIMA 3ML8A 1TZ1A 1V86A 4C4VB 1VR9A 2BB5A 2GB1A 1GPXA 3ALBA 1J8CA 4J6IA 2G3QB 3K9OB 3PLUA 2PE6B 4W9HA 2KC2A 3CIRB 2VH2A 2J42A 3RNGC 2E6XA 3NVZA 3EECA 4IM0A 3C0RB 2J7QB 1FM0D 2KC1A 2L8JA 2BW2A 4BAXA 3KYCD 4GMVA 3WALA 1E6EB 1SB3C 2GBRA 5G5GA 3UI3A 4LNIA 4R3DA 2O2VA 5KHQA 1UWXA 2L76A 1WM3A 2J53A 2N4FA 2C7NB 1FPYA 2O6VD 4TV3A 4YTNB 4IW0A 4MEMA 4OVZA 2BWFA 1D6EC 4LDTB 2KQSA 5E6OA 3BYYB 2KD0A 3E9SA 1Q0WB 3NS8A 4RM9A 2M0XA 1Q10A 1OFFA 2PMVA 3A9KB 3R7RA 3X0WA 1GB4A 1HTOA 2JXXA 4TQ0A 4LNNA 3RNCC 4IWQA 3TSSA 1WH3A 3RI7C 2JPHA 4RGMA 4AUQC 1JWSD 1WGRA 3OJ3A 1E7PB 1STEA 4FLHA 4YWGG 2ZCBA 3VTUA 4W9LA 3AECB 2KDFB 4OZCA 1WZ0A 1WE6A 2KMAA 2KWDA 1ZE3D 3QAQA 2D3BA 5JZEB 2W55A 3I9V1 4C56C 3V6CB 2BQQA 4IKGA 2ZPYA 4MJSA 5AZGA 1P98A 3PGEA 3ZJUA 2ACZB 3AMZA 2E3TA 2OJWA 4ARIA 1V1PA 2KDEB 4G3XB 5EE0A 4P6VF 1HA5A 2M56B 5E6JA 2K8BA 1ET9A 2KYWA 1WX9A 2QEJC 2RPQA 1RRBA 3ZKJC 3A9JA 4ZRIA 2WU5B 3W5UB 1T0RC 1HE8A 3EHVA 3C8YA 4KSKC 3DBLB 1TZOA 2DHZA 3UQAA 2DYMA 5EE1A 2KHWB 1HXYD 3WCQA 2WDTB 4AJWA 3VR9B 1TGZB 1NBFC 1FNVA 2RDHA 2WDQB 3P4SB 2R2OA 3ZRFA 3MHZA 2V3SA 1F52A 1ZKHA 2PPHA 3PPAA 1LQBA 2G1EA 4A8XC 4BKSD 1YIWA 1TS4A 1K50A 4TQ1A 3UF8A 4GDLA 3AU4A 1WXSA 2D07B 4HROA 5H8YE 3T3NA 2G45B 3KW5B 2ZEQA 1R4NB 4YSYB 3U4EG 4E71A 1WR6E 3ENEA 3AU5A 4BOZB 1NI3A 4KKJA 1TY2A 3VVWB 4JQWC 4GGQA 5LLIA 1UWMA 4NAMA 1K51A 2EMTA 1P0RA 4PYZA 4XE0A 3UINB 1C79A 2REXA 4A6QA 2O2VB 1SE9A 4LNOA 3P4RB 1NVID 1RYJA 4E74A 1WM2A 4J3OD 1KOTA 2IY0B 3H6NA 3LB8C 3R2TA 3DHHC 2INDC 3A1QA 1EO6A 2PJHA 3MJWA 1WRIA 5AZHA 2DZKA 2WQYB 3BVGA 2D3GA 2WYQA 2ZCCA 3V60A 1WX7A 2GOWA 4KGRA 4I6PA 2Y5CA 4HPMB 3RUIB 1OQRA 3ECIA 4OVVA 3ZJTA 3H9DA 1JROA 2NMQA 2Y3AA 2K1FA 3AULA 2JYTA 1FXAA 1KLUD 2TSSA 1WXVA 1QOAA 3NZUA 4S17A 4IM2A 1WGYA 4WIPA 5GXGB 5EDSA 4HEA1 2EELA 2BB6A 2WXLA 1YOVB 3MC0B 3AI5A 1LO5D 3VHTC 3N32A 2FUHB 4MJSB 3IXSA 1SSNA 3AE2B 2JZ3B 2IPKD 2KDBA 4EEWA 2J0JA 1WGGA 3PZ8A 2JWUA 2C5LC 1L5PA 3T3OA 2X8XX 2FCQA 4E3CA 2RGFA 3ZXVA 1FCLA 3A9JB 1H4RA 2LZ6A 5KHOA 2BF8B 3V6EB 1XO3A 2BT6A 1EU3A 2QIEB 4WAFA 3M62B 4JWUC 2ZW0A 3AEFB 1XEEA 2IO1B 3CF6E 3PSEB 2C7HA 2AYOB 3DHGC 3ABVB 1T0YA 3ZQ4A 4G11A 4M0WA 1J7CA 3ZRCA 2FIFA 4GDLB 4TMAB 1AW7A 2MEKA 2I1JA 1WXQA 5L83A 3WA0A 1QZEA 3AEEB 1N6ZA 2L00B 3ZTDA 1RM6C 2WXHA 1MHHE 2LGIA 5D6JB 4LNFA 4HVBA 2K9XA 3GS2A 4ANWA 3RT3B 4NNJB 1V5TA 2WX0A 1MHXA 1TT5B 5DPTA 2MW5A 4WJNA 4EZJA 5GMVA 3R7QA 3A1QB 1F77A 1WJNA 2PEAA 2WXJA 5IA7A 3SEBA 2A4ZA 3DBLI 2J0MA 4PS7A 2N9KA 4JE3B 4YXDB 5G5HA 2LFIA 4W9EA 1F9JA 2C7MB 2MQJA 3V3XA 1WRDB 4N6EB 4XDDA 4BBNC 4K1RB 2WX1A 3AXCA 1R4NI 1MPEA 4GN1A 2AX5A 2KACA 1V81A 2QSDA 4NY0A 1UNSA 2N7EA 1EU4A 3EUB2 2G4DB 3P42A 2RSUA 3KVFB 2INPE 2V4LA 1WJ4A 1HZ6A 4EFOA 2JU6X 4W9IA 2WXRA 2NTSA 1WGKA 3DBRB 1RFKA 2PTLA 2KWUB 1ISNA 3ZDTA 4II2B 1I4HA 3UIOB 3EGRA 3P1MA 3PRPB 2AQ3B 2W3SA 3WAPA 3DVGX 5DCNA 2WXNA 1VLBA 3PS6A 2M1MA 2AQ2B 4DXFA 4M0WB 1NYQA 1R7SA 2SEBD 4AP4C 4ACFA 1T3QA 1V1OA 3DWMA 2MJ3A 4HKZE 1I4XA 1KRHA 1Y56A 2JUOA 3BY4B 2K5PA 3TEXA 2CU1A 2WWZA 3QK0A 2ON8A 4MH8A 3BYTB 1ENFA 2LVOA 5FR6A 2Z0DB 1V5OA 1C1YB 3IAM1 4KZ0A 3ZTCA 4BKGA 3DOWA 1KH0A 4N59A 1BMLC 2I38A 2GBNA 1EWYC 4RMAA 1UBQA 1G6JA 2BPSA 3A9KA 3O13A 5IN7A 1WYGA 2KJRA 4WH4A 4RGTA 2RD0A 3R66C 3AH7A 2N7JA 4NAWB 3APDA 1EF5A 2DWQA 4MGZE 5H92C 1I4PA 1UH6A 4OHJA 2WDRB 3Q8FA 4HCPB 5CTRC 5AZFA 4TUUA 1PDXA 3VTWA 3V05A 2FE8A 2KJHB 1ROEA 4FN2A 4EE2A 2MBBB 2DAJA 2JWZA 1M94A 1XCTL 2FNJB 1LFDA 2K6DB 4N58A 2NVUI 2OOBB 3EA6A 3L0WB 2LVQA 4ARCA 2M19A 3L13A 4KSLC 4II3B 3VXWA 5IAAC 1FCCC 4WWOA 4K3BA 2Z8LA 3I63C 3AE1B 4YSZB 3ZW3A 2KN5A 3I5JC 4PS8A 4AQ7A 3OJ4B 2IY1B 2MRPA 3JSVB 2LASA 1OQQA 5C3JB 1D3ZA 4ICVA 1DOYA 4WURA 2CHXA 2LGXA 4HLEA 3BVMA 1WJ6A 1ZXIA 2N9XA 3RYTA 2YEPB 2WXFA 4DHJD 3ZJVA 3VRAB 4IG7B 2B3AA 4P1CC 1T6BX 2EKIA 1IGDA 4XX5A 2WXPA 4M00A 4ANXA 3TBLD 2WXGA 4B0MA 1WMHB 1YQ4B 2WXIA 1WGHA 2KTRA 1FXTB 2LXCA 4A90A 1WXAA 2PE9A 3QIJA 3JVZX 4DWFA 2QHOA 3QQ8B 4X57B 3QCAA 3LXFA 3HVDA 4WWMA 1E10A 3Q3FA 2XN9C 3C19A 1TTNA 3Q3MC 4P16A 2CKHB 2BYTA 2KJ6A 4F8CB 4W9FA 3DBRI 3GB1A 2KLGA 2WU2B 4YL8A 3W5VB 4FADA 2IGHA 1IP9A 1R4MB 1E8XA 4MSQB 4G50A 2JXTA 3Q6BA 2Z0EB 5BYQA 3B0AA 3PZ7A 3WAOA 3DVNV 2IO3B 4ITKA 1D5ZC 3VAWA 5G55A 1Z2MA 3QX1A 2V3NA 2C60A 3M95A 1B9RA 3TUOA 4EUTA 1JRUA 2JY6A 2NCNA 4YSXB 2IYDB 2KK8A 3PO0A 5TR5A 3L54A 1ET6A 3EC8A 4NZLB 3AV8A 3NZ3A 2AEHA 2LHDA 2KDIA 2EMSA 1M4VA 3NHEB 5HKHA 3PVLA 2K8HA 1AN8A 1E8YA 2KFJA 3VUXA 2QCZA 1NYRA 2BS3B 5HI1A 2Q5WD 4HDQA 5BYRA 2YVCA 3CMMB 2HDEA 2KDMA 5HFYA 3QC8B 2GMIC 1ZDVA 4GOCA 3DPDA 2G4SA 3H8HA 4LDTD 3T8MA 3QJZA 2KKCA 3QHTA 1FNWA 5CHFA 5AEKB 1RFAA 3GE3C 3ZNHB 2N7DA 3A4SC 4C7ZA 1SE2A 1N62A 1EUVB 4CHKA 4ZRKA 2OJRA 3ML9A 3S2AA 5LXHA 2KTRB 1QOGA 2L52A 3VUYA 1SXTA 2PLPA 1XLPA 3KUZA 3U2SC 2Y5PA 2CJOA 4EZLA 4DHZB 4K81A 2INCC 1F2RC 3RMKC 4MT5A 2QMTA 1YMHE 4AWJA 2OHFA 4CYEA 1XXGA 1L4DB 2MA9B 1YQBA 3HM6X 1HTQA 4BFRA 2JRIB 1NEKB 2OEDA 2KZRA 4RH6A 2WXOA 2NBUA 5CHVC 3RNBC 1I42A 2LGYA 3ZNID 1N60A 3DBHB 1P3QU 2JSVX 1E5WA 1GAQB 2WXQA 1FO4A 1BUIC 2ZW1A 2J52A 1T5XD 1TS2A 4USAA 5D94A 3APCA 4ANVA 1PGAA 2IGGA 1UUPA 1T0SC 1YJ1A 1HQRD 1ZXHA 5JHAA 3J9CA 2V1YA 1XF5L 3Q8AA 4GU2A 1HZ5A 3DVGY 3K9PB 3DHIC 3AM9A 2H89B 3QA8A 4KV2A 4XZ4A 3B9JA 5LXIB 1J7AA 4NQLB 3SFEB 4ZRJA 4HK2A 1WJUA 2MH7A 3WAMA 4LK0M 1Q1OA 1IBXA 3LDZE 3QARA 1SBBB 3BWUD 2KQ7A 4DXAB 2MBOA 1WY8A 2DZJA 4PK1A 2L32A 3D32A 1JWAD 5CX3A 1MG4A 4FJYA 4XDCA 3U8ZA 1QOFA 4K7UA 4JL9A 1R4MI 5E6PA 1MI0A 4ZRPA 4GLSC 4K7WA 3H1UA 3FAHA 3CSTA 1NI2A 1UELA 3KWVA 1TYGB 3PTFC 3DVNU 3IG3A 1Z5SB 4I6LB 1WZ3A 3IVFA 4M8MA 4HXDA 3WANA 5HG2A 3DCGA 5IOIA 4A3OA 4BVUC 2D11A 3N9YC 4WQMA 1TS3A 1F0ZA 2BYEA 2MP2B 2FAZA 2BGFA 3Q3OC 4NJCA 5DPRA 2V3PA 1IGCA 4RCOA 3SHQA 2MBQA 2RMMA 3GP7A 2PKOA 2ZZPB 4M01A 2CR5A 2BKFA 1JWBD 1MJDA 1A5RA 1CZPA 3X23A 1GG3A 3H7PA 4A3PA 1C76A 1UF0A 4NAWA 4PT5A 3AE3B 2D3CA 2NPTA 3AEGB 1E7UA 2W54A 1NDDA 3DQVA 2L0FA 1FMAD 1I4QA 2KVRA 2MJDA 1J19A 2GBKA 2JF5A 3KQ4A 2MJEA 1AYFA 2N1WA 1XT9B 1RWSA 3NY5A 3Q3JA 2K3UA 3VDZA 4YT0B 1D5XC 3OWEB 3W2DA 2K22A 3SDLC 2N9PC 4NJ6A 3NZSA 1PUTA 4KZCA 2KANA 4HKQA 2PVGC 5DPSA 2M4NA 3IT4B 4KX6B 1H8CA 4RFBA 2L1AA 3NVWA 3QWZB 2A5UA 3RNFC 4B9KA 1GJZA 3RNAC 1GNUA 2DX5B 2KMCA 3HVZA 4FJVB 1P9DU 1C4PA 2WS3B 2KVZA 2MBHA 3MHSD 4WWPA 1TIFA 1V49A 3HK0A 3B1LX 4NPNA 1IBXB 3W1YA 1TKGA 4ICUA 2IJ0A 4AJYB 3FILB 1DOIA 3JSVA 1WGDA 2BWES 4W9CA 3RULA 1SJHD 1YN5A 3PZDA 2L83A 5BYSA 3DBHI 1L0YB 2Y5BB 1PYWD 1TBEA 3L08A 3AN1A 3IHPC 3L16A 2FUG1 4BZAA 1KLVA 2KWCA 4KGSA 5FR3A 1V97A 2KX0A 4MM3A 1SF0A 3TL5A 1AWDA 1WFYA 1FRRA 3EFUA 3TEYA 3NVYA 4DDGD 5TSSA 1WMHA 3B2FA 2SAKA 4HRSA 1P7EA 3ETRA 4XGAB 4ANUA 3ZDMC 1WX8A 1GOZA 2LRWA 1C3TA 3KUCB 4LNKA 3ZNZB 1L6UA 4FJZA 1F2RI 2H88B 4IC7B 4B95A 1ZGUB 3PRMB 2NS5A 2V9HA 1ESFA 1FFUA 4DBGA 3APFA 2XBBC 3H7PB 5BMGA 2DBYA 2MWSB 2LJ5A 3AE6B 1JW9D 1JWUD 1N61A 2NPTB 4C7YA 2L0TA 2IGDA 1KF6B 2FCSA 3HHMA 3W1SC 4O1NA 4YTMB 5DPWA 3N30A 1DGJA 3TCAA 2DZMA 2JVCA 4MGIE 4F7ZA 1L7YA 1SJED 1TY0A 2ZJDA 2KWVB 5IKCM 3L17A 2JX5A 4UDUC 2LEKA 3OAWA 4EKUA 4LTUA 3AEAB 1L4ZB 5IP4D 1ZP0B 4FA6A 2BS2B 2JZZA 4WJQA 4ZRQA 3AB5A 3MC9A 2D3AA 1QT9A 4HJGE 3PHWB 2BVCA 3ZGZA 3NVVA 3RCZA 2O6VB 3P4PB 2FIDA 3FKYA 5C1ZA 2KN4A 1FFVA 2ICIA 4A55A 2N9LA 1ZUD2 2DNFA 4ZDVA 3GZNB 3UQBA 3PV1A 3KUDB 4YTPB 3NJTA 1EF1A 1WYWB 1E8WA 2YLMA 1YN4A 2PIAA 3I3TB 4BKTA 3VH4B 1SE3A 4OVUA 2DAFA 2MX2A 1CQVA 4C00A 1FEHA 4MDKE 2NR2A 1E7VA 3ONSA 2KOXA 2HJ8A 3VR8B 4L1BA 2PW9A 2LD9A 1E8ZA 1P7FA 2N9EB 2LVPA 4MM3B 2L7RA 4RM8A 5J2RA 5BMIA 1JCKB 1N63A 3NS1A 5CHWA 3R8BA 4N9F4 4GDKB 3GOEA 2M0AA 3U30A 3LYYA 1I4RA 4IUMB 2ZPNA 4DXGA 3V62A 3TEWA 3OG5A 3MP9A 1SEBD 4KIKB 1OTRB 2PVOD 2MSED 1ZPSA 1V6EA 4I6NB 1YX5B 2ZVNA 1JQ4A 1V8CA 2EKEC 4W9JA 1UZXB 4WJOA 2X38A 3P2BA 1TKYA 5EE9A 3IBEA 3KLSX 1SIJA 3VRBB 1OGWA 2KTFA 1L6VA 4DHZE 2NBWB 2D10A 1SIFA 2LWPA 1N5XA 2GI9A 1V9JA 1VRAB 4G0NB 3ZVVA 2NBVB 4US9A 4ZHOA 4D2KA 2W82A 5BMHA 2KLCA 3BK2A 1FIQA 1YJIA 2KNBA 1Y8RC 1FNUA 2DYOA 2IDYA 1UGMA 4OW0A 1D5MC 1J0GA 3PREA 3N3KB 3L4PA 2R61A 4WWNA 1OQYA 1VZ8A 2L3ZA 4FBJB 1TKEA 1XQQA 3RD2A 1KJTA 2UU7A 2XNAC 2GBJA 3Q8CA 3SD5A 4ZOHC 1E0ZA 3VTVA 4URKA 3TMPB 3B2GA 1S3SG 4MELA 4MH0E 3SFDB 3T9LA 3ZIMA 5LNK1 2QC8A 3HUIA 1RLFA 4EZKA 2LI5A 4LJPB 1C77A 4QAYA 3B08A 3N1ZC 1JMLA 1ZDXA 3O65B 3TJPA 3HRDD 2BKRB 1PGXA 1I4GA 1XLNA 3DWGC 4AS1A 4GSWA 1EM7A 4IOIE 5JH5C 1GC7A 5J18A 1Q5WB 3AE7B 2KXJA 2D5GA 4GIVA 3SU8X 4JGHB 1XLQA 4C80A 1IYFA 2WNMA 1B1ZA 2MP2A 3M63B 2KFKA 3IFWB 4P1BC 4KVGB 1YD8U 4JWSC 3HM3A 3Q14C 1LGRA 3MC8A 3ZO5B 2DZIA 1YJJA 2I1KA 1CK1A 4M8NA 4DDID 3GZNI 5HHDG 3IAS1 1YQ3B 1WE7A 2RDGA 2LGSA 2GLSA 2QJLA 2LGDA 4HWIB 4RGOS 3RN9C 2IO0B 3PLVA 2CHZA 2NTTA 2V0GA 4MGYE 3VQIA 2VZKB 1L0XB 3P4QB 3FC4A 2GBMA 3ZLZA 5JXVA 2INNE 4NJ7A 1VZ7A 1QKZA 3L10B 2HTME 3M3JA 4KDIC 1LXDA 4AOFA 2QILA 4PYUA 3AE4B 1BXTA 5FKAC 1UGJA 4GB9A 4PS3A 1JWMD 2K8CA 4MGKE 4W9GA 4DQOC 1C4AA 2ONQA 4XC2A 3HIZA 1PQSA 2JRHA 2K6QA 4HDOA 1CJEA 1UD7A 4P7IA 3JW0X 3MTNB 1FXIA 2KMMA 4TSSA 2KAJA 3KWLA 4FHJA 1IPGA 4OZBA 3DDCB 3PHXB 3JYUA 1OEYA 2WGSA 2B76B 2N0SB 2KO3A 2M8SA 1LM8B 4KGTA 1QF6A 2JQRB 1RAXA 2XEWA 1ZW7A 4HCNB 3OLMD 2WXKA 1DYQA 2JZPA 3I57A 2G9HD 2LHEA 3FILA 3BK1A 4JX1C 3RPFC 4L23A 1V1PB 2CHWA 5T8IA 2GRIA 3Q8BA 2CU3A 4K7SA 3BZDB 4M02A 5AUIA 2D2QA 3PT2B 2VH1A 4S0RA 4XWTA 1MFWA 2WP9B 2LJIA 2XK5A 1KTKA 3Q2AC 2DLBA 4A20A 2BYFA 1QOBA 2LRUA 3N1YC 5AUKA 3KH0A 1QILA 1K8RB 2ZNVC 4W9DA 5MPOA 3KYDD 5G2NA 4JLCA 3TIXA 2VZKD 4CQNA 1WR1A 1OEYJ 4L2YA 1HEZE 3U7ZA 3VFKA 3V61A 4RGNA 2K25A 1K53A 1YN3A 2FBWB 2BTEA 2KFKB 1VD2A 2KT7A 3GE8C 5D2MB 1JRPA 1N5WA 4JIOU 1MG8A 2IO2B 2MCNB 2RR9A 1X1MA 1VZ6A 2IBIB 2BS4B 2UYZB 3ZNGC 2J4XA 3A4RA 1YNTE 3U7DA 4LJOB 3NOBA 3AE5B 4KDLB 1F1HA 1P1AA 2MLBA 3W9CB 1ACCA 3SR6A 2BYVE 2FCMA 1IUEA 1DOXA 3BINA 1FD6A 2R2QA 1E90A 4XWWA 4MACA 2Z59B 2MHJA 3N20C 1A70A 2W3RA 2ZNVB 3NRZA 1T0QC 4IM3A 1VCBA 2L05A 5C2TB 4DK5A 4W9KA 1SE4A 2ZVOA 3Q3NC 4B6WA 1QQRA 1QLBB 5FK9C 2O6VA 2C9WB 1PFDA 5E6NA 3AE9B 4CO7A 5D7GA 1WIAA 1I7HA 3AEBB 4FHKA 3NG0A 2AL3A 4WAAA 3Q69A 1GB1A 4US8A 1WWTA 5D3DA 2IZVB 1L0VB 1CMXB 4HJKA 1KLGD 1WF9A 4ZYNA 2DENB 3CWIA 4JPSA 3UGBB 4IDIA 2LMCA 1UBIA 4HPPA 4A9AA 3R3MA 4Q2JA 4TKNA 3DBSA 1L2NA 3AE8B 1WSPA 1WXMA 1TJEA 3ZYYX 1BT0A 3RZFA 2M17A 2N1VA 2XK5B 1XD3B 1VDVA 2WHIA 4BOSC 5BO4B 3Q8EA 5J17A 5JHBA 2BBCA 3W1SA 2UWQA 3RFZB 2LXAA 4GDKA 4C4VA 1J7BA 4FULA 3BVZA 4BBNF 3MFGA 2FCNA 2WXMA 1TS5A 5C23A 2RPVA 2RDBC 4XYCA 4ZYSA 2JT4B 3VUWA 3MJ5A 1WI0A 4ASWC 4RF0A 1JALA 4KIKA 2VRRB 2HJ1A 1EWCA 4EOYA 2HD5B 3UIPB 4HPLB 3NUHB 1VJKA 4H2AA 1XLOA 4RNAA 1AARA 2LUMA 3TEZA 4IWPA 3CSFA 3IT6B 1C78A 3E56A 3EFCA 4REZA 2HE7A 1K52A 3ZXRA 3LJ3A 4NQKE 4ZHPA 3P63A 4OZAA 2AL6A 2QDFA 2W9NA 4BKSA 1C9FA 3H7SA 4GXBA 1S1QB 1C4CA 4B0EA 5L95C 1GUAB 4LLGM 1KM7A 2LUEA 4DHJB 2AQ1B 3URYA 1SGHA 3PRZA 2MBEA 1I35A 5EE3A 1YX6B 4RF1A 3ZUNA 3VH3B 4WJPA 2CS4A 4FXCA 5I4DA 3N1XC 1MVKA 2KX3A 1D4BA 3RNEC
chains in the Genus database with same CATH topology
3DVGY 3K9PB 1J0GA 3PREA 3N3KB 1V81A 3QA8A 4KV2A 4XZ4A 1U4AA 1OQYA 4WWNA 2L3ZA 4NY0A 4F1SA 4FBJB 2ASQA 2N7EA 5LXIB 4LCDE 4NQLB 1XQQA 3RD2A 4ZRJA 4HK2A 1WJUA 1KJTA 2DYBA 2G4DB 2GBJA 2RSUA 3KVFB 3SD5A 2V4LA 2J0KA 1WJ4A 3WAMA 4MSMB 4EFOA 3VTVA 4URKA 3TMPB 1S3SG 1Q1OA 4W9IA 2K39A 3LDZE 3QARA 4MELA 4MH0E 2KQ7A 3T9LA 3ZIMA 4DXAB 1GC6A 1RLFA 2MBOA 1WY8A 2HTHA 4EZKA 2DZJA 2LI5A 4LJPB 2KWUB 3D32A 2AWTA 3RZWC 1ISNA 3ZDTA 4II2B 5CX3A 4FJYA 3B08A 3U8ZA 4K7UA 3A33B 3UIOB 1V2YA 3PRPB 4WQOB 3O65B 4JL9A 1R4MI 5E6PA 3TJPA 2BKRB 1V80A 3WAPA 4K7WA 3DVGX 3H1UA 4GSWA 4IWOA 5DCNA 4AJWA 3WIMA 3ML8A 1TZ1A 3CSTA 1NI2A 1V86A 5JH5C 3PS6A 1GC7A 1UELA 5J18A 1Q5WB 2M1MA 3ALBA 2KXJA 1J8CA 3PTFC 3DVNU 3IG3A 4GIVA 4J6IA 1Z5SB 4I6LB 1WZ3A 2G3QB 3K9OB 4JGHB 4M0WB 3IVFA 4M8MA 3PLUA 4HXDA 4AP4C 3WANA 2PE6B 4W9HA 1IYFA 2KC2A 3DCGA 2MP2A 4A3OA 4BVUC 3M63B 2D11A 3EECA 2KFKA 4IM0A 3IFWB 3C0RB 4KVGB 2J7QB 2BYEA 2JUOA 3BY4B 2KC1A 2CU1A 2L8JA 2MP2B 1YD8U 2WWZA 3QK0A 2FAZA 3HM3A 3KYCD 4GMVA 3WALA 3ZO5B 2LVOA 2BGFA 2DZIA 5FR6A 2Z0DB 2GBRA 5DPRA 2I1KA 1V5OA 1C1YB 4KZ0A 4M8NA 4DDID 3SHQA 3GZNI 2O2VA 3ZTCA 5KHQA 2MBQA 1WE7A 4BKGA 3DOWA 2ZZPB 2LGDA 2L76A 2CR5A 1WM3A 2N4FA 4HWIB 2C7NB 2O6VD 4TV3A 2BKFA 2IO0B 2CHZA 3PLVA 2GBNA 4RMAA 4MGYE 4IW0A 4MEMA 1A5RA 3VQIA 2BWFA 1UBQA 1G6JA 3X23A 4LDTB 1GG3A 2KQSA 5E6OA 3H7PA 2KD0A 2BPSA 1Q0WB 2GBMA 3A9KA 3ZLZA 4A3PA 3NS8A 4RM9A 4NAWA 4NJ7A 2M0XA 2KJRA 2NPTA 3L10B 2RD0A 3M3JA 3R7RA 3A9KB 4KDIC 3R66C 1E7UA 3X0WA 1LXDA 1NDDA 3APDA 4NAWB 4AOFA 1EF5A 2JXXA 4MGZE 4PYUA 3DQVA 2L0FA 4TQ0A 1UH6A 4IWQA 2KVRA 1J19A 2GBKA 2JF5A 2N1WA 4GB9A 4HCPB 4PS3A 2K8CA 5CTRC 5AZFA 1XT9B 3NY5A 4TUUA 4MGKE 1WH3A 3Q3JA 4W9GA 2JPHA 3VTWA 4AUQC 4XC2A 3HIZA 1PQSA 3VDZA 2KJHB 1WGRA 2JRHA 2K6QA 3OJ3A 4HDOA 4FN2A 1UD7A 4FLHA 3JW0X 4P7IA 2ZCBA 3VTUA 2MBBB 2DAJA 2JWZA 4W9LA 3SDLC 1M94A 2KDFB 3MTNB 2FNJB 2N9PC 1WZ0A 1LFDA 2K6DB 1WE6A 2KMAA 3NZSA 4KZCA 4NJ6A 2KANA 5DPSA 2M4NA 2NVUI 3QAQA 2OOBB 4FHJA 5JZEB 1IPGA 1H8CA 3DDCB 3PHXB 3L0WB 3JYUA 1OEYA 2LVQA 3QWZB 3L13A 2A5UA 2KO3A 2M8SA 3V6CB 4B9KA 1GJZA 2ZPYA 1LM8B 1GNUA 2DX5B 2KMCA 4KSLC 4MJSA 5AZGA 4FJVB 1P98A 4II3B 1RAXA 3PGEA 2XEWA 1ZW7A 3VXWA 5IAAC 1P9DU 4HCNB 4WWOA 2MBHA 3MHSD 3OLMD 4WWPA 1V49A 2KDEB 3HK0A 3B1LX 4G3XB 4NPNA 3W1YA 3ZW3A 2CHWA 2K8BA 2KN5A 4ICUA 4PS8A 1WX9A 2RPQA 1RRBA 3ZKJC 3OJ4B 4AJYB 3A9JA 3JSVA 4ZRIA 4K7SA 1WGDA 2BWES 2IY1B 4W9CA 1HE8A 2MRPA 3EHVA 2D2QA 3PT2B 3RULA 3JSVB 3PZDA 4KSKC 2XK5A 3DBHI 2LASA 2Y5BB 2DHZA 3UQAA 1TBEA 2DYMA 3L08A 4A20A 1D3ZA 2KHWB 2BYFA 4ICVA 3IHPC 3L16A 2LRUA 1KLVA 2KWCA 2CHXA 2LGXA 2WDTB 2KX0A 1TGZB 1NBFC 3KH0A 1WJ6A 1K8RB 2N9XA 2ZNVC 4W9DA 4HLEA 4MM3A 3RYTA 3KYDD 2R2OA 3ZRFA 3TL5A 5G2NA 2V3SA 4JLCA 3TIXA 1WFYA 1ZKHA 2PPHA 4DHJD 3EFUA 3PPAA 1LQBA 1WR1A 4BKSD 1OEYJ 1YIWA 2B3AA 4IG7B 3VFKA 4TQ1A 3V61A 3UF8A 2K25A 3AU4A 4GDLA 4DDGD 1WXSA 2D07B 4XX5A 2G45B 3KW5B 2ZEQA 4ANXA 3TBLD 4E71A 1WMHA 2KFKB 1VD2A 5D2MB 1WR6E 3ENEA 1WMHB 3AU5A 1WGHA 2KTRA 4ANUA 1FXTB 2LXCA 4BOZB 1WXAA 2PE9A 4JIOU 3ZDMC 1WX8A 3QIJA 3VVWB 4JQWC 1MG8A 4GGQA 2IO2B 5LLIA 2RR9A 1X1MA 2IBIB 2LRWA 3JVZX 2MCNB 4DWFA 1C3TA 2EMTA 2QHOA 1P0RA 3KUCB 3QQ8B 4PYZA 3UINB 4X57B 3QCAA 2REXA 3ZNZB 2O2VB 2UYZB 3ZNGC 1SE9A 3A4RA 4FJZA 3Q3FA 1TTNA 2CKHB 4IC7B 4B95A 1ZGUB 3PRMB 2KJ6A 2NS5A 4F8CB 4E74A 1WM2A 3U7DA 4LJOB 4W9FA 3NOBA 3DBRI 4DBGA 2KLGA 4KDLB 1KOTA 1P1AA 2IY0B 2XBBC 3APFA 3H6NA 3H7PB 2MLBA 2MWSB 2LJ5A 4YL8A 3A1QA 1EO6A 4FADA 2BYVE 2FCMA 2PJHA 3MJWA 2NPTB 1IP9A 3BINA 5AZHA 2L0TA 2R2QA 1E90A 2DZKA 1E8XA 2D3GA 2WYQA 2ZCCA 2Z59B 3V60A 4MSQB 4G50A 1WX7A 2GOWA 2Z0EB 4I6PA 2FCSA 3B0AA 3HHMA 3W1SC 4HPMB 3RUIB 3DVNV 3WAOA 5DPWA 3N30A 2IO3B 2ZNVB 3ECIA 4IM3A 4OVVA 3TCAA 1VCBA 2DZMA 2L05A 2JVCA 4MGIE 4F7ZA 3H9DA 3VAWA 5G55A 1L7YA 1Z2MA 3QX1A 2ZJDA 2KWVB 2K1FA 3L17A 4W9KA 3AULA 4DK5A 2ZVOA 3OAWA 4EKUA 4B6WA 2C60A 3M95A 4FA6A 2JZZA 4WJQA 4EUTA 2O6VA 2C9WB 1WXVA 5E6NA 3NZUA 1JRUA 2JY6A 3PHWB 2NCNA 4IM2A 1WGYA 5EDSA 3RCZA 2O6VB 5D7GA 4CO7A 2FIDA 1WIAA 4FHKA 2AL3A 4WAAA 3AI5A 5C1ZA 2IYDB 2KK8A 3N32A 2FUHB 5TR5A 3VHTC 4MJSB 3L54A 2IZVB 3EC8A 2JZ3B 4ZDVA 3UQBA 2KDBA 3PV1A 3KUDB 4EEWA 1CMXB 2J0JA 1WGGA 4HJKA 1WF9A 4ZYNA 2DENB 1EF1A 2AEHA 2KDIA 1WYWB 2EMSA 3UGBB 3NHEB 5HKHA 3PVLA 1UBIA 2K8HA 2C5LC 1E8WA 1E8YA 2YLMA 2KFJA 2FCQA 3VUXA 2RGFA 3R3MA 4E3CA 3I3TB 4BKTA 3VH4B 4TKNA 3DBSA 1L2NA 3A9JB 1H4RA 4OVUA 2DAFA 1WXMA 2LZ6A 1BT0A 2BF8B 5KHOA 3V6EB 3RZFA 2MX2A 4HDQA 2M17A 2N1VA 2YVCA 2XK5B 1XD3B 3CMMB 4BOSC 3QC8B 2GMIC 3M62B 5BO4B 4MDKE 2NR2A 1E7VA 5J17A 3ONSA 5JHBA 2KOXA 2HJ8A 3W1SA 4GOCA 2IO1B 3DPDA 3CF6E 3PSEB 2C7HA 1E8ZA 2G4SA 2LD9A 2UWQA 4LDTD 3T8MA 2N9EB 2LXAA 2LVPA 3QJZA 2AYOB 2KKCA 4GDKA 4RM8A 2L7RA 3QHTA 5J2RA 1T0YA 4FULA 4BBNF 5CHWA 2FCNA 4G11A 5CHFA 4N9F4 4GDKB 5C23A 3ZRCA 5AEKB 2FIFA 1RFAA 3GOEA 4GDLB 3ZNHB 2N7DA 3U30A 3A4SC 2JT4B 3VUWA 2I1JA 4IUMB 1WI0A 1EUVB 4ASWC 4CHKA 4ZRKA 2OJRA 3ML9A 5L83A 3WA0A 1QZEA 2ZPNA 3S2AA 5LXHA 4KIKA 2KTRB 2VRRB 2L00B 3VUYA 3V62A 3ZTDA 4EOYA 3KUZA 2HD5B 3UIPB 4HPLB 4EZLA 4KIKB 1OTRB 5D6JB 4DHZB 4K81A 4HVBA 3SU8X 2MSED 1V6EA 4I6NB 1YX5B 2ZVNA 1AARA 4IWPA 3CSFA 4ANWA 2EKEC 4AWJA 4W9JA 3RT3B 4CYEA 4NNJB 1UZXB 1V5TA 2HE7A 4WJOA 2WX0A 3P2BA 2MA9B 1YQBA 3HM6X 5DPTA 2MW5A 3LJ3A 4WJNA 2JRIB 4BFRA 4NQKE 3IBEA 2KZRA 5GMVA 4EZJA 2AL6A 1OGWA 2KTFA 2W9NA 3R7QA 4BKSA 3A1QB 1WJNA 3H7SA 2PEAA 4GXBA 4DHZE 1S1QB 2NBWB 5L95C 2D10A 1SIFA 2NBUA 5CHVC 1GUAB 5IA7A 1KM7A 2LUEA 2LWPA 4DHJB 1I42A 2LGYA 1V9JA 1SGHA 3ZNID 2A4ZA 3DBLI 3PRZA 2J0MA 2MBEA 1I35A 4PS7A 4G0NB 1P3QU 3ZVVA 2NBVB 4W9EA 1F9JA 1YX6B 2C7MB 3ZUNA 1E5WA 3VH3B 4WJPA 2CS4A 2MQJA 2KLCA 1WRDB 2KNBA 1Y8RC 5D94A 2DYOA 3APCA 1UGMA 4ANVA 4BBNC 4K1RB 2KX3A 2WX1A 3AXCA 1YJ1A 1R4NI 5JHAA 2V1YA 4GN1A 4GU2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3DVG Y;  3K9P B;  1J0G A;  3PRE A;  3N3K B;  1V81 A;  3QA8 A;  4KV2 A;  4XZ4 A;  1U4A A;  1OQY A;  4WWN A;  2L3Z A;  4NY0 A;  4F1S A;  4FBJ B;  2ASQ A;  2N7E A;  5LXI B;  4LCD E;  4NQL B;  1XQQ A;  3RD2 A;  4ZRJ A;  4HK2 A;  1WJU A;  1KJT A;  2DYB A;  2G4D B;  2GBJ A;  2RSU A;  3KVF B;  3SD5 A;  2V4L A;  2J0K A;  1WJ4 A;  3WAM A;  4MSM B;  4EFO A;  3VTV A;  4URK A;  3TMP B;  1S3S G;  1Q1O A;  4W9I A;  2K39 A;  3LDZ E;  3QAR A;  4MEL A;  4MH0 E;  2KQ7 A;  3T9L A;  3ZIM A;  4DXA B;  1GC6 A;  1RLF A;  2MBO A;  1WY8 A;  2HTH A;  4EZK A;  2DZJ A;  2LI5 A;  4LJP B;  2KWU B;  3D32 A;  2AWT A;  3RZW C;  1ISN A;  3ZDT A;  4II2 B;  5CX3 A;  4FJY A;  3B08 A;  3U8Z A;  4K7U A;  3A33 B;  3UIO B;  1V2Y A;  3PRP B;  4WQO B;  3O65 B;  4JL9 A;  1R4M I;  5E6P A;  3TJP A;  2BKR B;  1V80 A;  3WAP A;  4K7W A;  3DVG X;  3H1U A;  4GSW A;  4IWO A;  5DCN A;  4AJW A;  3WIM A;  3ML8 A;  1TZ1 A;  3CST A;  1NI2 A;  1V86 A;  5JH5 C;  3PS6 A;  1GC7 A;  1UEL A;  5J18 A;  1Q5W B;  2M1M A;  3ALB A;  2KXJ A;  1J8C A;  3PTF C;  3DVN U;  3IG3 A;  4GIV A;  4J6I A;  1Z5S B;  4I6L B;  1WZ3 A;  2G3Q B;  3K9O B;  4JGH B;  4M0W B;  3IVF A;  4M8M A;  3PLU A;  4HXD A;  4AP4 C;  3WAN A;  2PE6 B;  4W9H A;  1IYF A;  2KC2 A;  3DCG A;  2MP2 A;  4A3O A;  4BVU C;  3M63 B;  2D11 A;  3EEC A;  2KFK A;  4IM0 A;  3IFW B;  3C0R B;  4KVG B;  2J7Q B;  2BYE A;  2JUO A;  3BY4 B;  2KC1 A;  2CU1 A;  2L8J A;  2MP2 B;  1YD8 U;  2WWZ A;  3QK0 A;  2FAZ A;  3HM3 A;  3KYC D;  4GMV A;  3WAL A;  3ZO5 B;  2LVO A;  2BGF A;  2DZI A;  5FR6 A;  2Z0D B;  2GBR A;  5DPR A;  2I1K A;  1V5O A;  1C1Y B;  4KZ0 A;  4M8N A;  4DDI D;  3SHQ A;  3GZN I;  2O2V A;  3ZTC A;  5KHQ A;  2MBQ A;  1WE7 A;  4BKG A;  3DOW A;  2ZZP B;  2LGD A;  2L76 A;  2CR5 A;  1WM3 A;  2N4F A;  4HWI B;  2C7N B;  2O6V D;  4TV3 A;  2BKF A;  2IO0 B;  2CHZ A;  3PLV A;  2GBN A;  4RMA A;  4MGY E;  4IW0 A;  4MEM A;  1A5R A;  3VQI A;  2BWF A;  1UBQ A;  1G6J A;  3X23 A;  4LDT B;  1GG3 A;  2KQS A;  5E6O A;  3H7P A;  2KD0 A;  2BPS A;  1Q0W B;  2GBM A;  3A9K A;  3ZLZ A;  4A3P A;  3NS8 A;  4RM9 A;  4NAW A;  4NJ7 A;  2M0X A;  2KJR A;  2NPT A;  3L10 B;  2RD0 A;  3M3J A;  3R7R A;  3A9K B;  4KDI C;  3R66 C;  1E7U A;  3X0W A;  1LXD A;  1NDD A;  3APD A;  4NAW B;  4AOF A;  1EF5 A;  2JXX A;  4MGZ E;  4PYU A;  3DQV A;  2L0F A;  4TQ0 A;  1UH6 A;  4IWQ A;  2KVR A;  1J19 A;  2GBK A;  2JF5 A;  2N1W A;  4GB9 A;  4HCP B;  4PS3 A;  2K8C A;  5CTR C;  5AZF A;  1XT9 B;  3NY5 A;  4TUU A;  4MGK E;  1WH3 A;  3Q3J A;  4W9G A;  2JPH A;  3VTW A;  4AUQ C;  4XC2 A;  3HIZ A;  1PQS A;  3VDZ A;  2KJH B;  1WGR A;  2JRH A;  2K6Q A;  3OJ3 A;  4HDO A;  4FN2 A;  1UD7 A;  4FLH A;  3JW0 X;  4P7I A;  2ZCB A;  3VTU A;  2MBB B;  2DAJ A;  2JWZ A;  4W9L A;  3SDL C;  1M94 A;  2KDF B;  3MTN B;  2FNJ B;  2N9P C;  1WZ0 A;  1LFD A;  2K6D B;  1WE6 A;  2KMA A;  3NZS A;  4KZC A;  4NJ6 A;  2KAN A;  5DPS A;  2M4N A;  2NVU I;  3QAQ A;  2OOB B;  4FHJ A;  5JZE B;  1IPG A;  1H8C A;  3DDC B;  3PHX B;  3L0W B;  3JYU A;  1OEY A;  2LVQ A;  3QWZ B;  3L13 A;  2A5U A;  2KO3 A;  2M8S A;  3V6C B;  4B9K A;  1GJZ A;  2ZPY A;  1LM8 B;  1GNU A;  2DX5 B;  2KMC A;  4KSL C;  4MJS A;  5AZG A;  4FJV B;  1P98 A;  4II3 B;  1RAX A;  3PGE A;  2XEW A;  1ZW7 A;  3VXW A;  5IAA C;  1P9D U;  4HCN B;  4WWO A;  2MBH A;  3MHS D;  3OLM D;  4WWP A;  1V49 A;  2KDE B;  3HK0 A;  3B1L X;  4G3X B;  4NPN A;  3W1Y A;  3ZW3 A;  2CHW A;  2K8B A;  2KN5 A;  4ICU A;  4PS8 A;  1WX9 A;  2RPQ A;  1RRB A;  3ZKJ C;  3OJ4 B;  4AJY B;  3A9J A;  3JSV A;  4ZRI A;  4K7S A;  1WGD A;  2BWE S;  2IY1 B;  4W9C A;  1HE8 A;  2MRP A;  3EHV A;  2D2Q A;  3PT2 B;  3RUL A;  3JSV B;  3PZD A;  4KSK C;  2XK5 A;  3DBH I;  2LAS A;  2Y5B B;  2DHZ A;  3UQA A;  1TBE A;  2DYM A;  3L08 A;  4A20 A;  1D3Z A;  2KHW B;  2BYF A;  4ICV A;  3IHP C;  3L16 A;  2LRU A;  1KLV A;  2KWC A;  2CHX A;  2LGX A;  2WDT B;  2KX0 A;  1TGZ B;  1NBF C;  3KH0 A;  1WJ6 A;  1K8R B;  2N9X A;  2ZNV C;  4W9D A;  4HLE A;  4MM3 A;  3RYT A;  3KYD D;  2R2O A;  3ZRF A;  3TL5 A;  5G2N A;  2V3S A;  4JLC A;  3TIX A;  1WFY A;  1ZKH A;  2PPH A;  4DHJ D;  3EFU A;  3PPA A;  1LQB A;  1WR1 A;  4BKS D;  1OEY J;  1YIW A;  2B3A A;  4IG7 B;  3VFK A;  4TQ1 A;  3V61 A;  3UF8 A;  2K25 A;  3AU4 A;  4GDL A;  4DDG D;  1WXS A;  2D07 B;  4XX5 A;  2G45 B;  3KW5 B;  2ZEQ A;  4ANX A;  3TBL D;  4E71 A;  1WMH A;  2KFK B;  1VD2 A;  5D2M B;  1WR6 E;  3ENE A;  1WMH B;  3AU5 A;  1WGH A;  2KTR A;  4ANU A;  1FXT B;  2LXC A;  4BOZ B;  1WXA A;  2PE9 A;  4JIO U;  3ZDM C;  1WX8 A;  3QIJ A;  3VVW B;  4JQW C;  1MG8 A;  4GGQ A;  2IO2 B;  5LLI A;  2RR9 A;  1X1M A;  2IBI B;  2LRW A;  3JVZ X;  2MCN B;  4DWF A;  1C3T A;  2EMT A;  2QHO A;  1P0R A;  3KUC B;  3QQ8 B;  4PYZ A;  3UIN B;  4X57 B;  3QCA A;  2REX A;  3ZNZ B;  2O2V B;  2UYZ B;  3ZNG C;  1SE9 A;  3A4R A;  4FJZ A;  3Q3F A;  1TTN A;  2CKH B;  4IC7 B;  4B95 A;  1ZGU B;  3PRM B;  2KJ6 A;  2NS5 A;  4F8C B;  4E74 A;  1WM2 A;  3U7D A;  4LJO B;  4W9F A;  3NOB A;  3DBR I;  4DBG A;  2KLG A;  4KDL B;  1KOT A;  1P1A A;  2IY0 B;  2XBB C;  3APF A;  3H6N A;  3H7P B;  2MLB A;  2MWS B;  2LJ5 A;  4YL8 A;  3A1Q A;  1EO6 A;  4FAD A;  2BYV E;  2FCM A;  2PJH A;  3MJW A;  2NPT B;  1IP9 A;  3BIN A;  5AZH A;  2L0T A;  2R2Q A;  1E90 A;  2DZK A;  1E8X A;  2D3G A;  2WYQ A;  2ZCC A;  2Z59 B;  3V60 A;  4MSQ B;  4G50 A;  1WX7 A;  2GOW A;  2Z0E B;  4I6P A;  2FCS A;  3B0A A;  3HHM A;  3W1S C;  4HPM B;  3RUI B;  3DVN V;  3WAO A;  5DPW A;  3N30 A;  2IO3 B;  2ZNV B;  3ECI A;  4IM3 A;  4OVV A;  3TCA A;  1VCB A;  2DZM A;  2L05 A;  2JVC A;  4MGI E;  4F7Z A;  3H9D A;  3VAW A;  5G55 A;  1L7Y A;  1Z2M A;  3QX1 A;  2ZJD A;  2KWV B;  2K1F A;  3L17 A;  4W9K A;  3AUL A;  4DK5 A;  2ZVO A;  3OAW A;  4EKU A;  4B6W A;  2C60 A;  3M95 A;  4FA6 A;  2JZZ A;  4WJQ A;  4EUT A;  2O6V A;  2C9W B;  1WXV A;  5E6N A;  3NZU A;  1JRU A;  2JY6 A;  3PHW B;  2NCN A;  4IM2 A;  1WGY A;  5EDS A;  3RCZ A;  2O6V B;  5D7G A;  4CO7 A;  2FID A;  1WIA A;  4FHK A;  2AL3 A;  4WAA A;  3AI5 A;  5C1Z A;  2IYD B;  2KK8 A;  3N32 A;  2FUH B;  5TR5 A;  3VHT C;  4MJS B;  3L54 A;  2IZV B;  3EC8 A;  2JZ3 B;  4ZDV A;  3UQB A;  2KDB A;  3PV1 A;  3KUD B;  4EEW A;  1CMX B;  2J0J A;  1WGG A;  4HJK A;  1WF9 A;  4ZYN A;  2DEN B;  1EF1 A;  2AEH A;  2KDI A;  1WYW B;  2EMS A;  3UGB B;  3NHE B;  5HKH A;  3PVL A;  1UBI A;  2K8H A;  2C5L C;  1E8W A;  1E8Y A;  2YLM A;  2KFJ A;  2FCQ A;  3VUX A;  2RGF A;  3R3M A;  4E3C A;  3I3T B;  4BKT A;  3VH4 B;  4TKN A;  3DBS A;  1L2N A;  3A9J B;  1H4R A;  4OVU A;  2DAF A;  1WXM A;  2LZ6 A;  1BT0 A;  2BF8 B;  5KHO A;  3V6E B;  3RZF A;  2MX2 A;  4HDQ A;  2M17 A;  2N1V A;  2YVC A;  2XK5 B;  1XD3 B;  3CMM B;  4BOS C;  3QC8 B;  2GMI C;  3M62 B;  5BO4 B;  4MDK E;  2NR2 A;  1E7V A;  5J17 A;  3ONS A;  5JHB A;  2KOX A;  2HJ8 A;  3W1S A;  4GOC A;  2IO1 B;  3DPD A;  3CF6 E;  3PSE B;  2C7H A;  1E8Z A;  2G4S A;  2LD9 A;  2UWQ A;  4LDT D;  3T8M A;  2N9E B;  2LXA A;  2LVP A;  3QJZ A;  2AYO B;  2KKC A;  4GDK A;  4RM8 A;  2L7R A;  3QHT A;  5J2R A;  1T0Y A;  4FUL A;  4BBN F;  5CHW A;  2FCN A;  4G11 A;  5CHF A;  4N9F 4;  4GDK B;  5C23 A;  3ZRC A;  5AEK B;  2FIF A;  1RFA A;  3GOE A;  4GDL B;  3ZNH B;  2N7D A;  3U30 A;  3A4S C;  2JT4 B;  3VUW A;  2I1J A;  4IUM B;  1WI0 A;  1EUV B;  4ASW C;  4CHK A;  4ZRK A;  2OJR A;  3ML9 A;  5L83 A;  3WA0 A;  1QZE A;  2ZPN A;  3S2A A;  5LXH A;  4KIK A;  2KTR B;  2VRR B;  2L00 B;  3VUY A;  3V62 A;  3ZTD A;  4EOY A;  3KUZ A;  2HD5 B;  3UIP B;  4HPL B;  4EZL A;  4KIK B;  1OTR B;  5D6J B;  4DHZ B;  4K81 A;  4HVB A;  3SU8 X;  2MSE D;  1V6E A;  4I6N B;  1YX5 B;  2ZVN A;  1AAR A;  4IWP A;  3CSF A;  4ANW A;  2EKE C;  4AWJ A;  4W9J A;  3RT3 B;  4CYE A;  4NNJ B;  1UZX B;  1V5T A;  2HE7 A;  4WJO A;  2WX0 A;  3P2B A;  2MA9 B;  1YQB A;  3HM6 X;  5DPT A;  2MW5 A;  3LJ3 A;  4WJN A;  2JRI B;  4BFR A;  4NQK E;  3IBE A;  2KZR A;  5GMV A;  4EZJ A;  2AL6 A;  1OGW A;  2KTF A;  2W9N A;  3R7Q A;  4BKS A;  3A1Q B;  1WJN A;  3H7S A;  2PEA A;  4GXB A;  4DHZ E;  1S1Q B;  2NBW B;  5L95 C;  2D10 A;  1SIF A;  2NBU A;  5CHV C;  1GUA B;  5IA7 A;  1KM7 A;  2LUE A;  2LWP A;  4DHJ B;  1I42 A;  2LGY A;  1V9J A;  1SGH A;  3ZNI D;  2A4Z A;  3DBL I;  3PRZ A;  2J0M A;  2MBE A;  1I35 A;  4PS7 A;  4G0N B;  1P3Q U;  3ZVV A;  2NBV B;  4W9E A;  1F9J A;  1YX6 B;  2C7M B;  3ZUN A;  1E5W A;  3VH3 B;  4WJP A;  2CS4 A;  2MQJ A;  2KLC A;  1WRD B;  2KNB A;  1Y8R C;  5D94 A;  2DYO A;  3APC A;  1UGM A;  4ANV A;  4BBN C;  4K1R B;  2KX3 A;  2WX1 A;  3AXC A;  1YJ1 A;  1R4N I;  5JHA A;  2V1Y A;  4GN1 A;  4GU2 A; 
#chains in the Genus database with same CATH topology
 4K3C A;  4KKI A;  3AED B;  1U4A A;  2K0P A;  4F1S A;  1XCQ L;  2ASQ A;  4LCD E;  1NEN B;  1FRD A;  2DYB A;  2WDV B;  2WLB A;  2V4I B;  2J0K A;  3BII D;  4MSM B;  2K39 A;  1E9M A;  1PGB A;  5IO9 A;  1GC6 A;  1KFY B;  2I2Y A;  2HTH A;  5D3I B;  3U52 E;  3R2I A;  2AWT A;  3RZW C;  2JYE A;  1ZOY B;  2YEP F;  3A33 B;  1V2Y A;  4WQO B;  2CJN A;  2KQ4 X;  1V80 A;  4IWO A;  3WIM A;  3ML8 A;  1TZ1 A;  1V86 A;  4C4V B;  1VR9 A;  2BB5 A;  2GB1 A;  1GPX A;  3ALB A;  1J8C A;  4J6I A;  2G3Q B;  3K9O B;  3PLU A;  2PE6 B;  4W9H A;  2KC2 A;  3CIR B;  2VH2 A;  2J42 A;  3RNG C;  2E6X A;  3NVZ A;  3EEC A;  4IM0 A;  3C0R B;  2J7Q B;  1FM0 D;  2KC1 A;  2L8J A;  2BW2 A;  4BAX A;  3KYC D;  4GMV A;  3WAL A;  1E6E B;  1SB3 C;  2GBR A;  5G5G A;  3UI3 A;  4LNI A;  4R3D A;  2O2V A;  5KHQ A;  1UWX A;  2L76 A;  1WM3 A;  2J53 A;  2N4F A;  2C7N B;  1FPY A;  2O6V D;  4TV3 A;  4YTN B;  4IW0 A;  4MEM A;  4OVZ A;  2BWF A;  1D6E C;  4LDT B;  2KQS A;  5E6O A;  3BYY B;  2KD0 A;  3E9S A;  1Q0W B;  3NS8 A;  4RM9 A;  2M0X A;  1Q10 A;  1OFF A;  2PMV A;  3A9K B;  3R7R A;  3X0W A;  1GB4 A;  1HTO A;  2JXX A;  4TQ0 A;  4LNN A;  3RNC C;  4IWQ A;  3TSS A;  1WH3 A;  3RI7 C;  2JPH A;  4RGM A;  4AUQ C;  1JWS D;  1WGR A;  3OJ3 A;  1E7P B;  1STE A;  4FLH A;  4YWG G;  2ZCB A;  3VTU A;  4W9L A;  3AEC B;  2KDF B;  4OZC A;  1WZ0 A;  1WE6 A;  2KMA A;  2KWD A;  1ZE3 D;  3QAQ A;  2D3B A;  5JZE B;  2W55 A;  3I9V 1;  4C56 C;  3V6C B;  2BQQ A;  4IKG A;  2ZPY A;  4MJS A;  5AZG A;  1P98 A;  3PGE A;  3ZJU A;  2ACZ B;  3AMZ A;  2E3T A;  2OJW A;  4ARI A;  1V1P A;  2KDE B;  4G3X B;  5EE0 A;  4P6V F;  1HA5 A;  2M56 B;  5E6J A;  2K8B A;  1ET9 A;  2KYW A;  1WX9 A;  2QEJ C;  2RPQ A;  1RRB A;  3ZKJ C;  3A9J A;  4ZRI A;  2WU5 B;  3W5U B;  1T0R C;  1HE8 A;  3EHV A;  3C8Y A;  4KSK C;  3DBL B;  1TZO A;  2DHZ A;  3UQA A;  2DYM A;  5EE1 A;  2KHW B;  1HXY D;  3WCQ A;  2WDT B;  4AJW A;  3VR9 B;  1TGZ B;  1NBF C;  1FNV A;  2RDH A;  2WDQ B;  3P4S B;  2R2O A;  3ZRF A;  3MHZ A;  2V3S A;  1F52 A;  1ZKH A;  2PPH A;  3PPA A;  1LQB A;  2G1E A;  4A8X C;  4BKS D;  1YIW A;  1TS4 A;  1K50 A;  4TQ1 A;  3UF8 A;  4GDL A;  3AU4 A;  1WXS A;  2D07 B;  4HRO A;  5H8Y E;  3T3N A;  2G45 B;  3KW5 B;  2ZEQ A;  1R4N B;  4YSY B;  3U4E G;  4E71 A;  1WR6 E;  3ENE A;  3AU5 A;  4BOZ B;  1NI3 A;  4KKJ A;  1TY2 A;  3VVW B;  4JQW C;  4GGQ A;  5LLI A;  1UWM A;  4NAM A;  1K51 A;  2EMT A;  1P0R A;  4PYZ A;  4XE0 A;  3UIN B;  1C79 A;  2REX A;  4A6Q A;  2O2V B;  1SE9 A;  4LNO A;  3P4R B;  1NVI D;  1RYJ A;  4E74 A;  1WM2 A;  4J3O D;  1KOT A;  2IY0 B;  3H6N A;  3LB8 C;  3R2T A;  3DHH C;  2IND C;  3A1Q A;  1EO6 A;  2PJH A;  3MJW A;  1WRI A;  5AZH A;  2DZK A;  2WQY B;  3BVG A;  2D3G A;  2WYQ A;  2ZCC A;  3V60 A;  1WX7 A;  2GOW A;  4KGR A;  4I6P A;  2Y5C A;  4HPM B;  3RUI B;  1OQR A;  3ECI A;  4OVV A;  3ZJT A;  3H9D A;  1JRO A;  2NMQ A;  2Y3A A;  2K1F A;  3AUL A;  2JYT A;  1FXA A;  1KLU D;  2TSS A;  1WXV A;  1QOA A;  3NZU A;  4S17 A;  4IM2 A;  1WGY A;  4WIP A;  5GXG B;  5EDS A;  4HEA 1;  2EEL A;  2BB6 A;  2WXL A;  1YOV B;  3MC0 B;  3AI5 A;  1LO5 D;  3VHT C;  3N32 A;  2FUH B;  4MJS B;  3IXS A;  1SSN A;  3AE2 B;  2JZ3 B;  2IPK D;  2KDB A;  4EEW A;  2J0J A;  1WGG A;  3PZ8 A;  2JWU A;  2C5L C;  1L5P A;  3T3O A;  2X8X X;  2FCQ A;  4E3C A;  2RGF A;  3ZXV A;  1FCL A;  3A9J B;  1H4R A;  2LZ6 A;  5KHO A;  2BF8 B;  3V6E B;  1XO3 A;  2BT6 A;  1EU3 A;  2QIE B;  4WAF A;  3M62 B;  4JWU C;  2ZW0 A;  3AEF B;  1XEE A;  2IO1 B;  3CF6 E;  3PSE B;  2C7H A;  2AYO B;  3DHG C;  3ABV B;  1T0Y A;  3ZQ4 A;  4G11 A;  4M0W A;  1J7C A;  3ZRC A;  2FIF A;  4GDL B;  4TMA B;  1AW7 A;  2MEK A;  2I1J A;  1WXQ A;  5L83 A;  3WA0 A;  1QZE A;  3AEE B;  1N6Z A;  2L00 B;  3ZTD A;  1RM6 C;  2WXH A;  1MHH E;  2LGI A;  5D6J B;  4LNF A;  4HVB A;  2K9X A;  3GS2 A;  4ANW A;  3RT3 B;  4NNJ B;  1V5T A;  2WX0 A;  1MHX A;  1TT5 B;  5DPT A;  2MW5 A;  4WJN A;  4EZJ A;  5GMV A;  3R7Q A;  3A1Q B;  1F77 A;  1WJN A;  2PEA A;  2WXJ A;  5IA7 A;  3SEB A;  2A4Z A;  3DBL I;  2J0M A;  4PS7 A;  2N9K A;  4JE3 B;  4YXD B;  5G5H A;  2LFI A;  4W9E A;  1F9J A;  2C7M B;  2MQJ A;  3V3X A;  1WRD B;  4N6E B;  4XDD A;  4BBN C;  4K1R B;  2WX1 A;  3AXC A;  1R4N I;  1MPE A;  4GN1 A;  2AX5 A;  2KAC A;  1V81 A;  2QSD A;  4NY0 A;  1UNS A;  2N7E A;  1EU4 A;  3EUB 2;  2G4D B;  3P42 A;  2RSU A;  3KVF B;  2INP E;  2V4L A;  1WJ4 A;  1HZ6 A;  4EFO A;  2JU6 X;  4W9I A;  2WXR A;  2NTS A;  1WGK A;  3DBR B;  1RFK A;  2PTL A;  2KWU B;  1ISN A;  3ZDT A;  4II2 B;  1I4H A;  3UIO B;  3EGR A;  3P1M A;  3PRP B;  2AQ3 B;  2W3S A;  3WAP A;  3DVG X;  5DCN A;  2WXN A;  1VLB A;  3PS6 A;  2M1M A;  2AQ2 B;  4DXF A;  4M0W B;  1NYQ A;  1R7S A;  2SEB D;  4AP4 C;  4ACF A;  1T3Q A;  1V1O A;  3DWM A;  2MJ3 A;  4HKZ E;  1I4X A;  1KRH A;  1Y56 A;  2JUO A;  3BY4 B;  2K5P A;  3TEX A;  2CU1 A;  2WWZ A;  3QK0 A;  2ON8 A;  4MH8 A;  3BYT B;  1ENF A;  2LVO A;  5FR6 A;  2Z0D B;  1V5O A;  1C1Y B;  3IAM 1;  4KZ0 A;  3ZTC A;  4BKG A;  3DOW A;  1KH0 A;  4N59 A;  1BML C;  2I38 A;  2GBN A;  1EWY C;  4RMA A;  1UBQ A;  1G6J A;  2BPS A;  3A9K A;  3O13 A;  5IN7 A;  1WYG A;  2KJR A;  4WH4 A;  4RGT A;  2RD0 A;  3R66 C;  3AH7 A;  2N7J A;  4NAW B;  3APD A;  1EF5 A;  2DWQ A;  4MGZ E;  5H92 C;  1I4P A;  1UH6 A;  4OHJ A;  2WDR B;  3Q8F A;  4HCP B;  5CTR C;  5AZF A;  4TUU A;  1PDX A;  3VTW A;  3V05 A;  2FE8 A;  2KJH B;  1ROE A;  4FN2 A;  4EE2 A;  2MBB B;  2DAJ A;  2JWZ A;  1M94 A;  1XCT L;  2FNJ B;  1LFD A;  2K6D B;  4N58 A;  2NVU I;  2OOB B;  3EA6 A;  3L0W B;  2LVQ A;  4ARC A;  2M19 A;  3L13 A;  4KSL C;  4II3 B;  3VXW A;  5IAA C;  1FCC C;  4WWO A;  4K3B A;  2Z8L A;  3I63 C;  3AE1 B;  4YSZ B;  3ZW3 A;  2KN5 A;  3I5J C;  4PS8 A;  4AQ7 A;  3OJ4 B;  2IY1 B;  2MRP A;  3JSV B;  2LAS A;  1OQQ A;  5C3J B;  1D3Z A;  4ICV A;  1DOY A;  4WUR A;  2CHX A;  2LGX A;  4HLE A;  3BVM A;  1WJ6 A;  1ZXI A;  2N9X A;  3RYT A;  2YEP B;  2WXF A;  4DHJ D;  3ZJV A;  3VRA B;  4IG7 B;  2B3A A;  4P1C C;  1T6B X;  2EKI A;  1IGD A;  4XX5 A;  2WXP A;  4M00 A;  4ANX A;  3TBL D;  2WXG A;  4B0M A;  1WMH B;  1YQ4 B;  2WXI A;  1WGH A;  2KTR A;  1FXT B;  2LXC A;  4A90 A;  1WXA A;  2PE9 A;  3QIJ A;  3JVZ X;  4DWF A;  2QHO A;  3QQ8 B;  4X57 B;  3QCA A;  3LXF A;  3HVD A;  4WWM A;  1E10 A;  3Q3F A;  2XN9 C;  3C19 A;  1TTN A;  3Q3M C;  4P16 A;  2CKH B;  2BYT A;  2KJ6 A;  4F8C B;  4W9F A;  3DBR I;  3GB1 A;  2KLG A;  2WU2 B;  4YL8 A;  3W5V B;  4FAD A;  2IGH A;  1IP9 A;  1R4M B;  1E8X A;  4MSQ B;  4G50 A;  2JXT A;  3Q6B A;  2Z0E B;  5BYQ A;  3B0A A;  3PZ7 A;  3WAO A;  3DVN V;  2IO3 B;  4ITK A;  1D5Z C;  3VAW A;  5G55 A;  1Z2M A;  3QX1 A;  2V3N A;  2C60 A;  3M95 A;  1B9R A;  3TUO A;  4EUT A;  1JRU A;  2JY6 A;  2NCN A;  4YSX B;  2IYD B;  2KK8 A;  3PO0 A;  5TR5 A;  3L54 A;  1ET6 A;  3EC8 A;  4NZL B;  3AV8 A;  3NZ3 A;  2AEH A;  2LHD A;  2KDI A;  2EMS A;  1M4V A;  3NHE B;  5HKH A;  3PVL A;  2K8H A;  1AN8 A;  1E8Y A;  2KFJ A;  3VUX A;  2QCZ A;  1NYR A;  2BS3 B;  5HI1 A;  2Q5W D;  4HDQ A;  5BYR A;  2YVC A;  3CMM B;  2HDE A;  2KDM A;  5HFY A;  3QC8 B;  2GMI C;  1ZDV A;  4GOC A;  3DPD A;  2G4S A;  3H8H A;  4LDT D;  3T8M A;  3QJZ A;  2KKC A;  3QHT A;  1FNW A;  5CHF A;  5AEK B;  1RFA A;  3GE3 C;  3ZNH B;  2N7D A;  3A4S C;  4C7Z A;  1SE2 A;  1N62 A;  1EUV B;  4CHK A;  4ZRK A;  2OJR A;  3ML9 A;  3S2A A;  5LXH A;  2KTR B;  1QOG A;  2L52 A;  3VUY A;  1SXT A;  2PLP A;  1XLP A;  3KUZ A;  3U2S C;  2Y5P A;  2CJO A;  4EZL A;  4DHZ B;  4K81 A;  2INC C;  1F2R C;  3RMK C;  4MT5 A;  2QMT A;  1YMH E;  4AWJ A;  2OHF A;  4CYE A;  1XXG A;  1L4D B;  2MA9 B;  1YQB A;  3HM6 X;  1HTQ A;  4BFR A;  2JRI B;  1NEK B;  2OED A;  2KZR A;  4RH6 A;  2WXO A;  2NBU A;  5CHV C;  3RNB C;  1I42 A;  2LGY A;  3ZNI D;  1N60 A;  3DBH B;  1P3Q U;  2JSV X;  1E5W A;  1GAQ B;  2WXQ A;  1FO4 A;  1BUI C;  2ZW1 A;  2J52 A;  1T5X D;  1TS2 A;  4USA A;  5D94 A;  3APC A;  4ANV A;  1PGA A;  2IGG A;  1UUP A;  1T0S C;  1YJ1 A;  1HQR D;  1ZXH A;  5JHA A;  3J9C A;  2V1Y A;  1XF5 L;  3Q8A A;  4GU2 A;  1HZ5 A;  3DVG Y;  3K9P B;  3DHI C;  3AM9 A;  2H89 B;  3QA8 A;  4KV2 A;  4XZ4 A;  3B9J A;  5LXI B;  1J7A A;  4NQL B;  3SFE B;  4ZRJ A;  4HK2 A;  1WJU A;  2MH7 A;  3WAM A;  4LK0 M;  1Q1O A;  1IBX A;  3LDZ E;  3QAR A;  1SBB B;  3BWU D;  2KQ7 A;  4DXA B;  2MBO A;  1WY8 A;  2DZJ A;  4PK1 A;  2L32 A;  3D32 A;  1JWA D;  5CX3 A;  1MG4 A;  4FJY A;  4XDC A;  3U8Z A;  1QOF A;  4K7U A;  4JL9 A;  1R4M I;  5E6P A;  1MI0 A;  4ZRP A;  4GLS C;  4K7W A;  3H1U A;  3FAH A;  3CST A;  1NI2 A;  1UEL A;  3KWV A;  1TYG B;  3PTF C;  3DVN U;  3IG3 A;  1Z5S B;  4I6L B;  1WZ3 A;  3IVF A;  4M8M A;  4HXD A;  3WAN A;  5HG2 A;  3DCG A;  5IOI A;  4A3O A;  4BVU C;  2D11 A;  3N9Y C;  4WQM A;  1TS3 A;  1F0Z A;  2BYE A;  2MP2 B;  2FAZ A;  2BGF A;  3Q3O C;  4NJC A;  5DPR A;  2V3P A;  1IGC A;  4RCO A;  3SHQ A;  2MBQ A;  2RMM A;  3GP7 A;  2PKO A;  2ZZP B;  4M01 A;  2CR5 A;  2BKF A;  1JWB D;  1MJD A;  1A5R A;  1CZP A;  3X23 A;  1GG3 A;  3H7P A;  4A3P A;  1C76 A;  1UF0 A;  4NAW A;  4PT5 A;  3AE3 B;  2D3C A;  2NPT A;  3AEG B;  1E7U A;  2W54 A;  1NDD A;  3DQV A;  2L0F A;  1FMA D;  1I4Q A;  2KVR A;  2MJD A;  1J19 A;  2GBK A;  2JF5 A;  3KQ4 A;  2MJE A;  1AYF A;  2N1W A;  1XT9 B;  1RWS A;  3NY5 A;  3Q3J A;  2K3U A;  3VDZ A;  4YT0 B;  1D5X C;  3OWE B;  3W2D A;  2K22 A;  3SDL C;  2N9P C;  4NJ6 A;  3NZS A;  1PUT A;  4KZC A;  2KAN A;  4HKQ A;  2PVG C;  5DPS A;  2M4N A;  3IT4 B;  4KX6 B;  1H8C A;  4RFB A;  2L1A A;  3NVW A;  3QWZ B;  2A5U A;  3RNF C;  4B9K A;  1GJZ A;  3RNA C;  1GNU A;  2DX5 B;  2KMC A;  3HVZ A;  4FJV B;  1P9D U;  1C4P A;  2WS3 B;  2KVZ A;  2MBH A;  3MHS D;  4WWP A;  1TIF A;  1V49 A;  3HK0 A;  3B1L X;  4NPN A;  1IBX B;  3W1Y A;  1TKG A;  4ICU A;  2IJ0 A;  4AJY B;  3FIL B;  1DOI A;  3JSV A;  1WGD A;  2BWE S;  4W9C A;  3RUL A;  1SJH D;  1YN5 A;  3PZD A;  2L83 A;  5BYS A;  3DBH I;  1L0Y B;  2Y5B B;  1PYW D;  1TBE A;  3L08 A;  3AN1 A;  3IHP C;  3L16 A;  2FUG 1;  4BZA A;  1KLV A;  2KWC A;  4KGS A;  5FR3 A;  1V97 A;  2KX0 A;  4MM3 A;  1SF0 A;  3TL5 A;  1AWD A;  1WFY A;  1FRR A;  3EFU A;  3TEY A;  3NVY A;  4DDG D;  5TSS A;  1WMH A;  3B2F A;  2SAK A;  4HRS A;  1P7E A;  3ETR A;  4XGA B;  4ANU A;  3ZDM C;  1WX8 A;  1GOZ A;  2LRW A;  1C3T A;  3KUC B;  4LNK A;  3ZNZ B;  1L6U A;  4FJZ A;  1F2R I;  2H88 B;  4IC7 B;  4B95 A;  1ZGU B;  3PRM B;  2NS5 A;  2V9H A;  1ESF A;  1FFU A;  4DBG A;  3APF A;  2XBB C;  3H7P B;  5BMG A;  2DBY A;  2MWS B;  2LJ5 A;  3AE6 B;  1JW9 D;  1JWU D;  1N61 A;  2NPT B;  4C7Y A;  2L0T A;  2IGD A;  1KF6 B;  2FCS A;  3HHM A;  3W1S C;  4O1N A;  4YTM B;  5DPW A;  3N30 A;  1DGJ A;  3TCA A;  2DZM A;  2JVC A;  4MGI E;  4F7Z A;  1L7Y A;  1SJE D;  1TY0 A;  2ZJD A;  2KWV B;  5IKC M;  3L17 A;  2JX5 A;  4UDU C;  2LEK A;  3OAW A;  4EKU A;  4LTU A;  3AEA B;  1L4Z B;  5IP4 D;  1ZP0 B;  4FA6 A;  2BS2 B;  2JZZ A;  4WJQ A;  4ZRQ A;  3AB5 A;  3MC9 A;  2D3A A;  1QT9 A;  4HJG E;  3PHW B;  2BVC A;  3ZGZ A;  3NVV A;  3RCZ A;  2O6V B;  3P4P B;  2FID A;  3FKY A;  5C1Z A;  2KN4 A;  1FFV A;  2ICI A;  4A55 A;  2N9L A;  1ZUD 2;  2DNF A;  4ZDV A;  3GZN B;  3UQB A;  3PV1 A;  3KUD B;  4YTP B;  3NJT A;  1EF1 A;  1WYW B;  1E8W A;  2YLM A;  1YN4 A;  2PIA A;  3I3T B;  4BKT A;  3VH4 B;  1SE3 A;  4OVU A;  2DAF A;  2MX2 A;  1CQV A;  4C00 A;  1FEH A;  4MDK E;  2NR2 A;  1E7V A;  3ONS A;  2KOX A;  2HJ8 A;  3VR8 B;  4L1B A;  2PW9 A;  2LD9 A;  1E8Z A;  1P7F A;  2N9E B;  2LVP A;  4MM3 B;  2L7R A;  4RM8 A;  5J2R A;  5BMI A;  1JCK B;  1N63 A;  3NS1 A;  5CHW A;  3R8B A;  4N9F 4;  4GDK B;  3GOE A;  2M0A A;  3U30 A;  3LYY A;  1I4R A;  4IUM B;  2ZPN A;  4DXG A;  3V62 A;  3TEW A;  3OG5 A;  3MP9 A;  1SEB D;  4KIK B;  1OTR B;  2PVO D;  2MSE D;  1ZPS A;  1V6E A;  4I6N B;  1YX5 B;  2ZVN A;  1JQ4 A;  1V8C A;  2EKE C;  4W9J A;  1UZX B;  4WJO A;  2X38 A;  3P2B A;  1TKY A;  5EE9 A;  3IBE A;  3KLS X;  1SIJ A;  3VRB B;  1OGW A;  2KTF A;  1L6V A;  4DHZ E;  2NBW B;  2D10 A;  1SIF A;  2LWP A;  1N5X A;  2GI9 A;  1V9J A;  1VRA B;  4G0N B;  3ZVV A;  2NBV B;  4US9 A;  4ZHO A;  4D2K A;  2W82 A;  5BMH A;  2KLC A;  3BK2 A;  1FIQ A;  1YJI A;  2KNB A;  1Y8R C;  1FNU A;  2DYO A;  2IDY A;  1UGM A;  4OW0 A;  1D5M C;  1J0G A;  3PRE A;  3N3K B;  3L4P A;  2R61 A;  4WWN A;  1OQY A;  1VZ8 A;  2L3Z A;  4FBJ B;  1TKE A;  1XQQ A;  3RD2 A;  1KJT A;  2UU7 A;  2XNA C;  2GBJ A;  3Q8C A;  3SD5 A;  4ZOH C;  1E0Z A;  3VTV A;  4URK A;  3TMP B;  3B2G A;  1S3S G;  4MEL A;  4MH0 E;  3SFD B;  3T9L A;  3ZIM A;  5LNK 1;  2QC8 A;  3HUI A;  1RLF A;  4EZK A;  2LI5 A;  4LJP B;  1C77 A;  4QAY A;  3B08 A;  3N1Z C;  1JML A;  1ZDX A;  3O65 B;  3TJP A;  3HRD D;  2BKR B;  1PGX A;  1I4G A;  1XLN A;  3DWG C;  4AS1 A;  4GSW A;  1EM7 A;  4IOI E;  5JH5 C;  1GC7 A;  5J18 A;  1Q5W B;  3AE7 B;  2KXJ A;  2D5G A;  4GIV A;  3SU8 X;  4JGH B;  1XLQ A;  4C80 A;  1IYF A;  2WNM A;  1B1Z A;  2MP2 A;  3M63 B;  2KFK A;  3IFW B;  4P1B C;  4KVG B;  1YD8 U;  4JWS C;  3HM3 A;  3Q14 C;  1LGR A;  3MC8 A;  3ZO5 B;  2DZI A;  1YJJ A;  2I1K A;  1CK1 A;  4M8N A;  4DDI D;  3GZN I;  5HHD G;  3IAS 1;  1YQ3 B;  1WE7 A;  2RDG A;  2LGS A;  2GLS A;  2QJL A;  2LGD A;  4HWI B;  4RGO S;  3RN9 C;  2IO0 B;  3PLV A;  2CHZ A;  2NTT A;  2V0G A;  4MGY E;  3VQI A;  2VZK B;  1L0X B;  3P4Q B;  3FC4 A;  2GBM A;  3ZLZ A;  5JXV A;  2INN E;  4NJ7 A;  1VZ7 A;  1QKZ A;  3L10 B;  2HTM E;  3M3J A;  4KDI C;  1LXD A;  4AOF A;  2QIL A;  4PYU A;  3AE4 B;  1BXT A;  5FKA C;  1UGJ A;  4GB9 A;  4PS3 A;  1JWM D;  2K8C A;  4MGK E;  4W9G A;  4DQO C;  1C4A A;  2ONQ A;  4XC2 A;  3HIZ A;  1PQS A;  2JRH A;  2K6Q A;  4HDO A;  1CJE A;  1UD7 A;  4P7I A;  3JW0 X;  3MTN B;  1FXI A;  2KMM A;  4TSS A;  2KAJ A;  3KWL A;  4FHJ A;  1IPG A;  4OZB A;  3DDC B;  3PHX B;  3JYU A;  1OEY A;  2WGS A;  2B76 B;  2N0S B;  2KO3 A;  2M8S A;  1LM8 B;  4KGT A;  1QF6 A;  2JQR B;  1RAX A;  2XEW A;  1ZW7 A;  4HCN B;  3OLM D;  2WXK A;  1DYQ A;  2JZP A;  3I57 A;  2G9H D;  2LHE A;  3FIL A;  3BK1 A;  4JX1 C;  3RPF C;  4L23 A;  1V1P B;  2CHW A;  5T8I A;  2GRI A;  3Q8B A;  2CU3 A;  4K7S A;  3BZD B;  4M02 A;  5AUI A;  2D2Q A;  3PT2 B;  2VH1 A;  4S0R A;  4XWT A;  1MFW A;  2WP9 B;  2LJI A;  2XK5 A;  1KTK A;  3Q2A C;  2DLB A;  4A20 A;  2BYF A;  1QOB A;  2LRU A;  3N1Y C;  5AUK A;  3KH0 A;  1QIL A;  1K8R B;  2ZNV C;  4W9D A;  5MPO A;  3KYD D;  5G2N A;  4JLC A;  3TIX A;  2VZK D;  4CQN A;  1WR1 A;  1OEY J;  4L2Y A;  1HEZ E;  3U7Z A;  3VFK A;  3V61 A;  4RGN A;  2K25 A;  1K53 A;  1YN3 A;  2FBW B;  2BTE A;  2KFK B;  1VD2 A;  2KT7 A;  3GE8 C;  5D2M B;  1JRP A;  1N5W A;  4JIO U;  1MG8 A;  2IO2 B;  2MCN B;  2RR9 A;  1X1M A;  1VZ6 A;  2IBI B;  2BS4 B;  2UYZ B;  3ZNG C;  2J4X A;  3A4R A;  1YNT E;  3U7D A;  4LJO B;  3NOB A;  3AE5 B;  4KDL B;  1F1H A;  1P1A A;  2MLB A;  3W9C B;  1ACC A;  3SR6 A;  2BYV E;  2FCM A;  1IUE A;  1DOX A;  3BIN A;  1FD6 A;  2R2Q A;  1E90 A;  4XWW A;  4MAC A;  2Z59 B;  2MHJ A;  3N20 C;  1A70 A;  2W3R A;  2ZNV B;  3NRZ A;  1T0Q C;  4IM3 A;  1VCB A;  2L05 A;  5C2T B;  4DK5 A;  4W9K A;  1SE4 A;  2ZVO A;  3Q3N C;  4B6W A;  1QQR A;  1QLB B;  5FK9 C;  2O6V A;  2C9W B;  1PFD A;  5E6N A;  3AE9 B;  4CO7 A;  5D7G A;  1WIA A;  1I7H A;  3AEB B;  4FHK A;  3NG0 A;  2AL3 A;  4WAA A;  3Q69 A;  1GB1 A;  4US8 A;  1WWT A;  5D3D A;  2IZV B;  1L0V B;  1CMX B;  4HJK A;  1KLG D;  1WF9 A;  4ZYN A;  2DEN B;  3CWI A;  4JPS A;  3UGB B;  4IDI A;  2LMC A;  1UBI A;  4HPP A;  4A9A A;  3R3M A;  4Q2J A;  4TKN A;  3DBS A;  1L2N A;  3AE8 B;  1WSP A;  1WXM A;  1TJE A;  3ZYY X;  1BT0 A;  3RZF A;  2M17 A;  2N1V A;  2XK5 B;  1XD3 B;  1VDV A;  2WHI A;  4BOS C;  5BO4 B;  3Q8E A;  5J17 A;  5JHB A;  2BBC A;  3W1S A;  2UWQ A;  3RFZ B;  2LXA A;  4GDK A;  4C4V A;  1J7B A;  4FUL A;  3BVZ A;  4BBN F;  3MFG A;  2FCN A;  2WXM A;  1TS5 A;  5C23 A;  2RPV A;  2RDB C;  4XYC A;  4ZYS A;  2JT4 B;  3VUW A;  3MJ5 A;  1WI0 A;  4ASW C;  4RF0 A;  1JAL A;  4KIK A;  2VRR B;  2HJ1 A;  1EWC A;  4EOY A;  2HD5 B;  3UIP B;  4HPL B;  3NUH B;  1VJK A;  4H2A A;  1XLO A;  4RNA A;  1AAR A;  2LUM A;  3TEZ A;  4IWP A;  3CSF A;  3IT6 B;  1C78 A;  3E56 A;  3EFC A;  4REZ A;  2HE7 A;  1K52 A;  3ZXR A;  3LJ3 A;  4NQK E;  4ZHP A;  3P63 A;  4OZA A;  2AL6 A;  2QDF A;  2W9N A;  4BKS A;  1C9F A;  3H7S A;  4GXB A;  1S1Q B;  1C4C A;  4B0E A;  5L95 C;  1GUA B;  4LLG M;  1KM7 A;  2LUE A;  4DHJ B;  2AQ1 B;  3URY A;  1SGH A;  3PRZ A;  2MBE A;  1I35 A;  5EE3 A;  1YX6 B;  4RF1 A;  3ZUN A;  3VH3 B;  4WJP A;  2CS4 A;  4FXC A;  5I4D A;  3N1X C;  1MVK A;  2KX3 A;  1D4B A;  3RNE C; 
#chains in the Genus database with same CATH homology
 3DVG Y;  3K9P B;  1J0G A;  3PRE A;  3N3K B;  1V81 A;  3QA8 A;  4KV2 A;  4XZ4 A;  1U4A A;  1OQY A;  4WWN A;  2L3Z A;  4NY0 A;  4F1S A;  4FBJ B;  2ASQ A;  2N7E A;  5LXI B;  4LCD E;  4NQL B;  1XQQ A;  3RD2 A;  4ZRJ A;  4HK2 A;  1WJU A;  1KJT A;  2DYB A;  2G4D B;  2GBJ A;  2RSU A;  3KVF B;  3SD5 A;  2V4L A;  2J0K A;  1WJ4 A;  3WAM A;  4MSM B;  4EFO A;  3VTV A;  4URK A;  3TMP B;  1S3S G;  1Q1O A;  4W9I A;  2K39 A;  3LDZ E;  3QAR A;  4MEL A;  4MH0 E;  2KQ7 A;  3T9L A;  3ZIM A;  4DXA B;  1GC6 A;  1RLF A;  2MBO A;  1WY8 A;  2HTH A;  4EZK A;  2DZJ A;  2LI5 A;  4LJP B;  2KWU B;  3D32 A;  2AWT A;  3RZW C;  1ISN A;  3ZDT A;  4II2 B;  5CX3 A;  4FJY A;  3B08 A;  3U8Z A;  4K7U A;  3A33 B;  3UIO B;  1V2Y A;  3PRP B;  4WQO B;  3O65 B;  4JL9 A;  1R4M I;  5E6P A;  3TJP A;  2BKR B;  1V80 A;  3WAP A;  4K7W A;  3DVG X;  3H1U A;  4GSW A;  4IWO A;  5DCN A;  4AJW A;  3WIM A;  3ML8 A;  1TZ1 A;  3CST A;  1NI2 A;  1V86 A;  5JH5 C;  3PS6 A;  1GC7 A;  1UEL A;  5J18 A;  1Q5W B;  2M1M A;  3ALB A;  2KXJ A;  1J8C A;  3PTF C;  3DVN U;  3IG3 A;  4GIV A;  4J6I A;  1Z5S B;  4I6L B;  1WZ3 A;  2G3Q B;  3K9O B;  4JGH B;  4M0W B;  3IVF A;  4M8M A;  3PLU A;  4HXD A;  4AP4 C;  3WAN A;  2PE6 B;  4W9H A;  1IYF A;  2KC2 A;  3DCG A;  2MP2 A;  4A3O A;  4BVU C;  3M63 B;  2D11 A;  3EEC A;  2KFK A;  4IM0 A;  3IFW B;  3C0R B;  4KVG B;  2J7Q B;  2BYE A;  2JUO A;  3BY4 B;  2KC1 A;  2CU1 A;  2L8J A;  2MP2 B;  1YD8 U;  2WWZ A;  3QK0 A;  2FAZ A;  3HM3 A;  3KYC D;  4GMV A;  3WAL A;  3ZO5 B;  2LVO A;  2BGF A;  2DZI A;  5FR6 A;  2Z0D B;  2GBR A;  5DPR A;  2I1K A;  1V5O A;  1C1Y B;  4KZ0 A;  4M8N A;  4DDI D;  3SHQ A;  3GZN I;  2O2V A;  3ZTC A;  5KHQ A;  2MBQ A;  1WE7 A;  4BKG A;  3DOW A;  2ZZP B;  2LGD A;  2L76 A;  2CR5 A;  1WM3 A;  2N4F A;  4HWI B;  2C7N B;  2O6V D;  4TV3 A;  2BKF A;  2IO0 B;  2CHZ A;  3PLV A;  2GBN A;  4RMA A;  4MGY E;  4IW0 A;  4MEM A;  1A5R A;  3VQI A;  2BWF A;  1UBQ A;  1G6J A;  3X23 A;  4LDT B;  1GG3 A;  2KQS A;  5E6O A;  3H7P A;  2KD0 A;  2BPS A;  1Q0W B;  2GBM A;  3A9K A;  3ZLZ A;  4A3P A;  3NS8 A;  4RM9 A;  4NAW A;  4NJ7 A;  2M0X A;  2KJR A;  2NPT A;  3L10 B;  2RD0 A;  3M3J A;  3R7R A;  3A9K B;  4KDI C;  3R66 C;  1E7U A;  3X0W A;  1LXD A;  1NDD A;  3APD A;  4NAW B;  4AOF A;  1EF5 A;  2JXX A;  4MGZ E;  4PYU A;  3DQV A;  2L0F A;  4TQ0 A;  1UH6 A;  4IWQ A;  2KVR A;  1J19 A;  2GBK A;  2JF5 A;  2N1W A;  4GB9 A;  4HCP B;  4PS3 A;  2K8C A;  5CTR C;  5AZF A;  1XT9 B;  3NY5 A;  4TUU A;  4MGK E;  1WH3 A;  3Q3J A;  4W9G A;  2JPH A;  3VTW A;  4AUQ C;  4XC2 A;  3HIZ A;  1PQS A;  3VDZ A;  2KJH B;  1WGR A;  2JRH A;  2K6Q A;  3OJ3 A;  4HDO A;  4FN2 A;  1UD7 A;  4FLH A;  3JW0 X;  4P7I A;  2ZCB A;  3VTU A;  2MBB B;  2DAJ A;  2JWZ A;  4W9L A;  3SDL C;  1M94 A;  2KDF B;  3MTN B;  2FNJ B;  2N9P C;  1WZ0 A;  1LFD A;  2K6D B;  1WE6 A;  2KMA A;  3NZS A;  4KZC A;  4NJ6 A;  2KAN A;  5DPS A;  2M4N A;  2NVU I;  3QAQ A;  2OOB B;  4FHJ A;  5JZE B;  1IPG A;  1H8C A;  3DDC B;  3PHX B;  3L0W B;  3JYU A;  1OEY A;  2LVQ A;  3QWZ B;  3L13 A;  2A5U A;  2KO3 A;  2M8S A;  3V6C B;  4B9K A;  1GJZ A;  2ZPY A;  1LM8 B;  1GNU A;  2DX5 B;  2KMC A;  4KSL C;  4MJS A;  5AZG A;  4FJV B;  1P98 A;  4II3 B;  1RAX A;  3PGE A;  2XEW A;  1ZW7 A;  3VXW A;  5IAA C;  1P9D U;  4HCN B;  4WWO A;  2MBH A;  3MHS D;  3OLM D;  4WWP A;  1V49 A;  2KDE B;  3HK0 A;  3B1L X;  4G3X B;  4NPN A;  3W1Y A;  3ZW3 A;  2CHW A;  2K8B A;  2KN5 A;  4ICU A;  4PS8 A;  1WX9 A;  2RPQ A;  1RRB A;  3ZKJ C;  3OJ4 B;  4AJY B;  3A9J A;  3JSV A;  4ZRI A;  4K7S A;  1WGD A;  2BWE S;  2IY1 B;  4W9C A;  1HE8 A;  2MRP A;  3EHV A;  2D2Q A;  3PT2 B;  3RUL A;  3JSV B;  3PZD A;  4KSK C;  2XK5 A;  3DBH I;  2LAS A;  2Y5B B;  2DHZ A;  3UQA A;  1TBE A;  2DYM A;  3L08 A;  4A20 A;  1D3Z A;  2KHW B;  2BYF A;  4ICV A;  3IHP C;  3L16 A;  2LRU A;  1KLV A;  2KWC A;  2CHX A;  2LGX A;  2WDT B;  2KX0 A;  1TGZ B;  1NBF C;  3KH0 A;  1WJ6 A;  1K8R B;  2N9X A;  2ZNV C;  4W9D A;  4HLE A;  4MM3 A;  3RYT A;  3KYD D;  2R2O A;  3ZRF A;  3TL5 A;  5G2N A;  2V3S A;  4JLC A;  3TIX A;  1WFY A;  1ZKH A;  2PPH A;  4DHJ D;  3EFU A;  3PPA A;  1LQB A;  1WR1 A;  4BKS D;  1OEY J;  1YIW A;  2B3A A;  4IG7 B;  3VFK A;  4TQ1 A;  3V61 A;  3UF8 A;  2K25 A;  3AU4 A;  4GDL A;  4DDG D;  1WXS A;  2D07 B;  4XX5 A;  2G45 B;  3KW5 B;  2ZEQ A;  4ANX A;  3TBL D;  4E71 A;  1WMH A;  2KFK B;  1VD2 A;  5D2M B;  1WR6 E;  3ENE A;  1WMH B;  3AU5 A;  1WGH A;  2KTR A;  4ANU A;  1FXT B;  2LXC A;  4BOZ B;  1WXA A;  2PE9 A;  4JIO U;  3ZDM C;  1WX8 A;  3QIJ A;  3VVW B;  4JQW C;  1MG8 A;  4GGQ A;  2IO2 B;  5LLI A;  2RR9 A;  1X1M A;  2IBI B;  2LRW A;  3JVZ X;  2MCN B;  4DWF A;  1C3T A;  2EMT A;  2QHO A;  1P0R A;  3KUC B;  3QQ8 B;  4PYZ A;  3UIN B;  4X57 B;  3QCA A;  2REX A;  3ZNZ B;  2O2V B;  2UYZ B;  3ZNG C;  1SE9 A;  3A4R A;  4FJZ A;  3Q3F A;  1TTN A;  2CKH B;  4IC7 B;  4B95 A;  1ZGU B;  3PRM B;  2KJ6 A;  2NS5 A;  4F8C B;  4E74 A;  1WM2 A;  3U7D A;  4LJO B;  4W9F A;  3NOB A;  3DBR I;  4DBG A;  2KLG A;  4KDL B;  1KOT A;  1P1A A;  2IY0 B;  2XBB C;  3APF A;  3H6N A;  3H7P B;  2MLB A;  2MWS B;  2LJ5 A;  4YL8 A;  3A1Q A;  1EO6 A;  4FAD A;  2BYV E;  2FCM A;  2PJH A;  3MJW A;  2NPT B;  1IP9 A;  3BIN A;  5AZH A;  2L0T A;  2R2Q A;  1E90 A;  2DZK A;  1E8X A;  2D3G A;  2WYQ A;  2ZCC A;  2Z59 B;  3V60 A;  4MSQ B;  4G50 A;  1WX7 A;  2GOW A;  2Z0E B;  4I6P A;  2FCS A;  3B0A A;  3HHM A;  3W1S C;  4HPM B;  3RUI B;  3DVN V;  3WAO A;  5DPW A;  3N30 A;  2IO3 B;  2ZNV B;  3ECI A;  4IM3 A;  4OVV A;  3TCA A;  1VCB A;  2DZM A;  2L05 A;  2JVC A;  4MGI E;  4F7Z A;  3H9D A;  3VAW A;  5G55 A;  1L7Y A;  1Z2M A;  3QX1 A;  2ZJD A;  2KWV B;  2K1F A;  3L17 A;  4W9K A;  3AUL A;  4DK5 A;  2ZVO A;  3OAW A;  4EKU A;  4B6W A;  2C60 A;  3M95 A;  4FA6 A;  2JZZ A;  4WJQ A;  4EUT A;  2O6V A;  2C9W B;  1WXV A;  5E6N A;  3NZU A;  1JRU A;  2JY6 A;  3PHW B;  2NCN A;  4IM2 A;  1WGY A;  5EDS A;  3RCZ A;  2O6V B;  5D7G A;  4CO7 A;  2FID A;  1WIA A;  4FHK A;  2AL3 A;  4WAA A;  3AI5 A;  5C1Z A;  2IYD B;  2KK8 A;  3N32 A;  2FUH B;  5TR5 A;  3VHT C;  4MJS B;  3L54 A;  2IZV B;  3EC8 A;  2JZ3 B;  4ZDV A;  3UQB A;  2KDB A;  3PV1 A;  3KUD B;  4EEW A;  1CMX B;  2J0J A;  1WGG A;  4HJK A;  1WF9 A;  4ZYN A;  2DEN B;  1EF1 A;  2AEH A;  2KDI A;  1WYW B;  2EMS A;  3UGB B;  3NHE B;  5HKH A;  3PVL A;  1UBI A;  2K8H A;  2C5L C;  1E8W A;  1E8Y A;  2YLM A;  2KFJ A;  2FCQ A;  3VUX A;  2RGF A;  3R3M A;  4E3C A;  3I3T B;  4BKT A;  3VH4 B;  4TKN A;  3DBS A;  1L2N A;  3A9J B;  1H4R A;  4OVU A;  2DAF A;  1WXM A;  2LZ6 A;  1BT0 A;  2BF8 B;  5KHO A;  3V6E B;  3RZF A;  2MX2 A;  4HDQ A;  2M17 A;  2N1V A;  2YVC A;  2XK5 B;  1XD3 B;  3CMM B;  4BOS C;  3QC8 B;  2GMI C;  3M62 B;  5BO4 B;  4MDK E;  2NR2 A;  1E7V A;  5J17 A;  3ONS A;  5JHB A;  2KOX A;  2HJ8 A;  3W1S A;  4GOC A;  2IO1 B;  3DPD A;  3CF6 E;  3PSE B;  2C7H A;  1E8Z A;  2G4S A;  2LD9 A;  2UWQ A;  4LDT D;  3T8M A;  2N9E B;  2LXA A;  2LVP A;  3QJZ A;  2AYO B;  2KKC A;  4GDK A;  4RM8 A;  2L7R A;  3QHT A;  5J2R A;  1T0Y A;  4FUL A;  4BBN F;  5CHW A;  2FCN A;  4G11 A;  5CHF A;  4N9F 4;  4GDK B;  5C23 A;  3ZRC A;  5AEK B;  2FIF A;  1RFA A;  3GOE A;  4GDL B;  3ZNH B;  2N7D A;  3U30 A;  3A4S C;  2JT4 B;  3VUW A;  2I1J A;  4IUM B;  1WI0 A;  1EUV B;  4ASW C;  4CHK A;  4ZRK A;  2OJR A;  3ML9 A;  5L83 A;  3WA0 A;  1QZE A;  2ZPN A;  3S2A A;  5LXH A;  4KIK A;  2KTR B;  2VRR B;  2L00 B;  3VUY A;  3V62 A;  3ZTD A;  4EOY A;  3KUZ A;  2HD5 B;  3UIP B;  4HPL B;  4EZL A;  4KIK B;  1OTR B;  5D6J B;  4DHZ B;  4K81 A;  4HVB A;  3SU8 X;  2MSE D;  1V6E A;  4I6N B;  1YX5 B;  2ZVN A;  1AAR A;  4IWP A;  3CSF A;  4ANW A;  2EKE C;  4AWJ A;  4W9J A;  3RT3 B;  4CYE A;  4NNJ B;  1UZX B;  1V5T A;  2HE7 A;  4WJO A;  2WX0 A;  3P2B A;  2MA9 B;  1YQB A;  3HM6 X;  5DPT A;  2MW5 A;  3LJ3 A;  4WJN A;  2JRI B;  4BFR A;  4NQK E;  3IBE A;  2KZR A;  5GMV A;  4EZJ A;  2AL6 A;  1OGW A;  2KTF A;  2W9N A;  3R7Q A;  4BKS A;  3A1Q B;  1WJN A;  3H7S A;  2PEA A;  4GXB A;  4DHZ E;  1S1Q B;  2NBW B;  5L95 C;  2D10 A;  1SIF A;  2NBU A;  5CHV C;  1GUA B;  5IA7 A;  1KM7 A;  2LUE A;  2LWP A;  4DHJ B;  1I42 A;  2LGY A;  1V9J A;  1SGH A;  3ZNI D;  2A4Z A;  3DBL I;  3PRZ A;  2J0M A;  2MBE A;  1I35 A;  4PS7 A;  4G0N B;  1P3Q U;  3ZVV A;  2NBV B;  4W9E A;  1F9J A;  1YX6 B;  2C7M B;  3ZUN A;  1E5W A;  3VH3 B;  4WJP A;  2CS4 A;  2MQJ A;  2KLC A;  1WRD B;  2KNB A;  1Y8R C;  5D94 A;  2DYO A;  3APC A;  1UGM A;  4ANV A;  4BBN C;  4K1R B;  2KX3 A;  2WX1 A;  3AXC A;  1YJ1 A;  1R4N I;  5JHA A;  2V1Y A;  4GN1 A;  4GU2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...