1PQSA

Solution structure of the c-terminal opca domain of ycdc24p
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
77
structure length
77
Chain Sequence
SEIFTLLVEKVWNFDDLIMAINSKISNTHNNNISPITKIKYQDEDGDFVVLGSDEDWNVAKEMLAENNEKFLNIRLY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Cell cycle
molecule keywords Cell division control protein 24
publication title The solution structure of an N-terminally truncated version of the yeast CDC24p PB1 domain shows a different beta-sheet topology.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
total genus 15
structure length 77
sequence length 77
ec nomenclature
pdb deposition date 2003-06-19
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 1pqsA00
2O6VA 1SE9A 3JSVB 3DVNU 2K25A 1E7VA 1RAXA 1WM2A 3AI5A 3VTUA 4TQ0A 1WR6E 3M63B 2G4DB 4HK2A 3ZUNA 2BYEA 4XZ4A 3QARA 2KANA 4HCNB 2KTFA 3O65B 1V81A 1HE8A 4HPMB 4W9HA 2XK5B 3APCA 3UINB 1QZEA 2I1KA 5C1ZA 1R4NI 2MBHA 3IFWB 2DENB 2J7QB 4IM0A 2RD0A 2LI5A 3B08A 4GXBA 1EF5A 1WH3A 3CF6E 3DVGY 2KJRA 1L7YA 4W9FA 4ZRIA 3L10B 4M8NA 3TJPA 3VUYA 2ZPNA 4LDTD 1A5RA 4MEMA 2RGFA 2G3QB 2N7EA 2GMIC 5G2NA 3V61A 4HCPB 2KD0A 1V80A 3K9PB 2N9PC 4GMVA 2N4FA 1P3QU 2AWTA 1YQBA 2JT4B 4I6PA 3EECA 5D7GA 3A9KA 3N30A 2PE9A 3VTWA 3N3KB 5AEKB 2NBVB 1GJZA 3VUXA 3DBRI 2AEHA 1NBFC 4BKGA 1YD8U 3AULA 3H7PB 3PREA 4E74A 1EF1A 3IHPC 4IC7B 1V5TA 4MDKE 1E5WA 1UELA 1ZGUB 2L76A 1YX6B 3WANA 2HTHA 2PEAA 2V1YA 2KC2A 4TV3A 4B6WA 1E8XA 2JZ3B 4WWOA 2KZRA 3D32A 2BKRB 2Z0DB 1E8ZA 3OJ4B 3R7QA 3VFKA 2KX0A 3B0AA 3MTNB 4AOFA 3DDCB 4RMAA 2N9XA 3P2BA 1WFYA 1YX5B 2DZMA 2WX0A 4IM3A 5J17A 3ZVVA 1FXTB 4KZ0A 1TTNA 2G4SA 3RZWC 4WWNA 2W9NA 3RT3B 1I35A 3GZNI 1L2NA 3A1QB 3UF8A 2R2QA 4GIVA 2AL3A 1S3SG 4MGKE 3OJ3A 3PVLA 4FN2A 4K7WA 4RM9A 2KFKB 2O2VA 3ZDMC 4NQLB 4PS7A 1V6EA 4WAAA 3ZNHB 2PPHA 3VAWA 1GG3A 4FHJA 2CKHB 2KDFB 2MSED 4TUUA 3UIPB 2JRHA 4DK5A 3MJWA 4EZJA 5KHQA 2A4ZA 3VUWA 4IG7B 5G55A 2XEWA 4ANWA 4BBNC 2Y5BB 3EFUA 3QCAA 1H4RA 4HXDA 5E6NA 3ZNZB 4FADA 2KLGA 3LJ3A 4IWOA 3BINA 2NBUA 2KJHB 4FLHA 1IYFA 3TMPB 2CHZA 4BKTA 2A5UA 3CMMB 2LZ6A 5E6OA 3S2AA 1Q5WB 3KH0A 2KHWB 3PZDA 3JSVA 1GNUA 2FIDA 5DPWA 4KIKB 2FCQA 5JHBA 2GBRA 1UZXB 2LGDA 2NS5A 3M95A 4ICUA 1WY8A 5IA7A 2DAJA 3ENEA 3DVNV 2MX2A 3Q3FA 1RLFA 2KK8A 2LRUA 4ICVA 4HDQA 4WJPA 2KOXA 1WZ0A 2MBEA 2MBQA 3ONSA 4WJOA 4X57B 5AZGA 4KSLC 1WGGA 1WX9A 2J0JA 3L13A 4WJQA 4XX5A 2JF5A 2M1MA 2MRPA 2HE7A 2KDBA 3ZRFA 3UQAA 1H8CA 3ZTDA 3TBLD 1G6JA 2KX3A 1V5OA 4FBJB 1GC6A 2ZNVC 3QWZB 4B9KA 4ASWC 4BBNF 2RR9A 4CYEA 4GB9A 3W1SA 4URKA 4FJYA 4IWPA 5CHWA 4WWPA 3SU8X 2BGFA 2JXXA 3H7SA 2KQSA 4G3XB 2C7NB 4II2B 1VCBA 1P0RA 1E8YA 1EO6A 2FAZA 2GBMA 3QQ8B 4GGQA 3VH4B 3JW0X 5JZEB 4WQOB 3QAQA 2L0TA 3A33B 3KUCB 4W9LA 2PJHA 4W9DA 1WX8A 2KQ7A 4K81A 3K9OB 4DHZE 2D2QA 5LXHA 1WJ6A 1WMHA 5BO4B 2IO1B 4BVUC 5L83A 1XT9B 2BYVE 2NBWB 3PTFC 3VDZA 3DBLI 2LVPA 2J0MA 3H1UA 2MLBA 3IVFA 4LJPB 4NY0A 1WE6A 3ECIA 2D11A 3CSTA 1WGDA 1IP9A 3ZDTA 2I1JA 1Q1OA 1E90A 1NDDA 1S1QB 2IO0B 4LCDE 2QHOA 3HM6X 3ML9A 4PYZA 2MW5A 1KLVA 3A9JB 4KV2A 4GDKB 4RM8A 2MP2B 1ZW7A 4E3CA 2K8CA 2CS4A 3DQVA 3PPAA 2WYQA 3PSEB 5E6PA 5LLIA 4BOSC 2D3GA 2FUHB 2UYZB 2XBBC 3H6NA 2C7HA 4XC2A 3ZO5B 1X1MA 1I42A 2JY6A 4MSQB 3HIZA 1UH6A 2GBJA 2OJRA 5AZFA 4GN1A 3ZRCA 2K39A 5CX3A 1XD3B 5AZHA 1LXDA 3WALA 1GC7A 2KC1A 4NJ6A 2KWUB 5L95C 3EHVA 2NVUI 2IY0B 3T8MA 2M17A 1R4MI 2K1FA 1KM7A 2L7RA 2NPTB 3KUDB 3L54A 1J8CA 3A1QA 1V2YA 2D07B 3RZFA 1WR1A 3QC8B 4B95A 4HJKA 4MELA 2KFKA 2C60A 4MJSB 2N1VA 4DWFA 3R3MA 2M4NA 4M8MA 3BY4B 4BKSD 1OEYJ 5D94A 2BWFA 3ZTCA 4HWIB 1WE7A 2K6DB 2FCSA 4MGZE 4G0NB 4NAWA 2FCMA 3DPDA 3L08A 1MG8A 1ISNA 2KJ6A 4ZRKA 2JRIB 2MA9B 2KO3A 2KKCA 3RULA 4LDTB 3JVZX 1SGHA 3PRMB 2IY1B 4ZYNA 5JH5C 3V6EB 4GDLA 3RUIB 4AUQC 1WJUA 2L3ZA 3NOBA 4EZLA 4K1RB 4NJ7A 2LXCA 5JHAA 1OEYA 3ZNID 2LXAA 3KYCD 2KWCA 3PRPB 3SHQA 4W9JA 3X23A 4F1SA 4IWQA 3TCAA 3U30A 4JGHB 1OQYA 4NPNA 2BYFA 1PQSA 2IZVB 3KUZA 2ASQA 5GMVA 4KDLB 4KZCA 2LVQA 4J6IA 2LASA 4G11A 2V3SA 1WXVA 2DYBA 2L8JA 4MGYE 1F9JA 1C1YB 5FR6A 4NQKE 3W1SC 4CHKA 1TZ1A 4HDOA 3ZW3A 5DPRA 3I3TB 3WAPA 1RRBA 2ZPYA 4OVUA 2BPSA 2L05A 3AU5A 2WWZA 4W9IA 2DZKA 1V49A 3ZNGC 1VD2A 2L0FA 2R2OA 3AXCA 4FULA 5C23A 4P7IA 4MSMB 2MWSB 2NCNA 2DX5B 4HPLB 4A3OA 3KW5B 3PHXB 3B1LX 4CO7A 3OLMD 4N9F4 4EZKA 3QJZA 2XK5A 3L16A 3PS6A 3L17A 4EEWA 1Q0WB 2DZJA 2LGXA 4GOCA 4JQWC 3W1YA 3HK0A 3OAWA 4AP4C 2K6QA 1WRDB 3A9JA 1RFAA 5J2RA 4GDKA 1E7UA 1Z5SB 4EOYA 3A4RA 2AL6A 1BT0A 2IO3B 4DHZB 5DPTA 1Y8RC 2GBKA 5TR5A 3M62B 4GU2A 2FNJB 2KTRB 5HKHA 3Q3JA 3IG3A 5DCNA 4I6NB 2WDTB 3R66C 1J0GA 2CHWA 2ZZPB 1P9DU 2PE6B 4DDID 1CMXB 1KJTA 5KHOA 2KDIA 4IM2A 3VQIA 4KSKC 4W9GA 1U4AA 3IBEA 2O6VD 2IO2B 2M0XA 3NZUA 4K7SA 1WXSA 3QA8A 2N1WA 2DYMA 3CSFA 2CR5A 3H7PA 1YIWA 3DVGX 4MH0E 2WX1A 4DXAB 4ANXA 4AJYB 3KVFB 2V4LA 1AARA 4E71A 4W9CA 2VRRB 2G45B 3N32A 4JLCA 2EMSA 3U7DA 2DYOA 3PLUA 4I6LB 1WM3A 2UWQA 4IW0A 3NHEB 3PT2B 4DHJD 2C7MB 2ZVNA 4AJWA 3V6CB 4TKNA 3VVWB 2KMAA 3DCGA 4OVVA 4ZDVA 1JRUA 3VHTC 3VXWA 2KN5A 2KDEB 4W9KA 3PGEA 3T9LA 3NS8A 1D3ZA 1WGYA 2GBNA 2NR2A 2YLMA 2KVRA 2IYDB 2ZVOA 3L0WB 2CHXA 2GOWA 1V9JA 1WJ4A 2B3AA 1SIFA 2O6VB 3ZKJC 4HLEA 2KNBA 3JYUA 2CU1A 2HJ8A 2FIFA 1P1AA 1K8RB 2KLCA 3RYTA 2AYOB 4EKUA 1OTRB 1WMHB 4KDIC 2MBBB 2IBIB 4FJVB 3DOWA 3ALBA 3X0WA 4FJZA 4BKSA 3QHTA 2KWVB 2D10A 1WX7A 2ZNVB 3MHSD 4EFOA 4W9EA 4DBGA 1OGWA 1UBIA 1WI0A 2C5LC 2LGYA 1YJ1A 4DHJB 2LVOA 2MQJA 4KIKA 4K7UA 4F8CB 4HVBA 1GUAB 3QIJA 3ZLZA 2ZEQA 5D2MB 4GSWA 2LRWA 3R7RA 3V60A 4A3PA 3HM3A 1WYWB 2DZIA 3WAOA 3PHWB 4YL8A 3SD5A 5CTRC 4JIOU 2KFJA 2ZCCA 3EC8A 3NZSA 1LFDA 3PRZA 1C3TA 2MBOA 3A9KB 2JPHA 2ZCBA 3U8ZA 2JVCA 4IUMB 4FHKA 2BKFA 4PS3A 3QX1A 1ZKHA 3UIOB 2KMCA 4A20A 3UQBA 1T0YA 3KYDD 3LDZE 3ML8A 1NI2A 1LQBA 4WJNA 2K8HA 5IAAC 4MM3A 3SDLC 1E8WA 2DAFA 3PLVA 4BOZB 1WXMA 3M3JA 1WGHA 3TL5A 2EKEC 2JWZA 3DBSA 1WZ3A 4F7ZA 3RCZA 2MCNB 2KTRA 1IPGA 3VH3B 1XQQA 4MGIE 2LD9A 2BF8B 3H9DA 1WXAA 5DPSA 4EUTA 3WIMA 2REXA 1UD7A 3HHMA 4NAWB 3WA0A 1TBEA 1Z2MA 2LJ5A 2N9EB 5CHFA 1TGZB 1KOTA 3DBHI 3WAMA 4ANVA 2OOBB 3AU4A 1LM8B 4AWJA 1WGRA 3GOEA 4KVGB 4BFRA 2FCNA 3V62A 3TIXA 1EUVB 2EMTA 1J19A 2HD5B 2MP2A 4GDLB 3ZIMA 4TQ1A 1WJNA 4JL9A 2JZZA 2LUEA 2M8SA 2Z0EB 3QK0A 4G50A 2J0KA 5D6JB 2K8BA 2O2VB 2BWES 3PV1A 1WF9A 4II3B 2N7DA 2Z59B 4PS8A 4FA6A 4M0WB 3A4SC 2ZJDA 5CHVC 2KXJA 3C0RB 2C9WB 5LXIB 5EDSA 3VTVA 1UBQA 2YVCA 3NY5A 4PYUA 1UGMA 3RD2A 2JUOA 1M94A 2RSUA 1P98A 4ZRJA 1WIAA 2NPTA 3UGBB 3APDA 4LJOB 2RPQA 5J18A 2DHZA 4ANUA 4DDGD 1V86A 2L00B 2LWPA 3APFA 4MJSA 4NNJB
chains in the Genus database with same CATH superfamily
3N20C 3DVNU 1E7VA 5HFYA 2IJ0A 1WM2A 3AI5A 1AWDA 4TQ0A 4HK2A 2G4DB 4XZ4A 2KANA 4HCNB 2W82A 3GS2A 4JWUC 4W9HA 2MJEA 2DENB 2J7QB 2RD0A 1JQ4A 4GXBA 3CF6E 3DVGY 3NVWA 4W9FA 1C78A 2RGFA 4WQMA 1QKZA 1KF6B 1RYJA 1V80A 2N9PC 1FNVA 2N4FA 2E6XA 2JT4B 2PKOA 3AE1B 5AEKB 3N30A 2TSSA 1MPEA 2N7JA 1NBFC 4BKGA 2Z8LA 3PREA 5EE1A 1ZDXA 1UELA 2L32A 1F1HA 4RGNA 1ZGUB 2HTHA 2PEAA 4WWMA 4B6WA 4WWOA 2KZRA 3SFDB 2WXNA 1E8ZA 3OJ4B 4LNOA 1V8CA 3B0AA 3RNBC 1ESFA 3DDCB 1YX5B 2DZMA 1QF6A 4IM3A 5J17A 1FXTB 2KQ4X 3NVZA 1D4BA 2G4SA 1QQRA 1I35A 3FAHA 4XYCA 4GIVA 4JX1C 3Q3NC 1QOFA 1S3SG 4FN2A 3PVLA 1IGCA 4RM9A 3ZDMC 4WAAA 4WIPA 3VAWA 1GG3A 2CKHB 4TUUA 1HXYD 3UIPB 2JRHA 3NRZA 1T0SC 4XDCA 5G55A 3QCAA 5E6NA 2KLGA 4IWOA 2KJHB 3EA6A 4M00A 4C7ZA 2A5UA 1SIJA 2LZ6A 5E6OA 1PGXA 3AE6B 4KIKB 2ACZB 2I38A 5IA7A 3Q3FA 4HDQA 3ONSA 1A70A 4X57B 3L13A 4WJQA 2MRPA 3ZRFA 1H8CA 1R4MB 1V5OA 4B9KA 2PIAA 4FJYA 2W3RA 4P6VF 2JXXA 1T5XD 2WXQA 2C7NB 2FAZA 1EO6A 2GBMA 4S17A 2WXFA 2PJHA 1WX8A 4K81A 2D2QA 5AUKA 5L83A 3Q8EA 5HG2A 2NBWB 3H1UA 4LJPB 1WE6A 1T6BX 1WGDA 3Q3OC 1ZDVA 2I1JA 1E90A 2IO0B 3A9JB 4Q2JA 4RGMA 3LB8C 2K8CA 3DQVA 5LLIA 1JWUD 2XBBC 1I42A 2N9LA 3HIZA 3Q69A 4MACA 1XD3B 2L52A 1LXDA 1RWSA 4XWWA 5L95C 1IBXB 2L7RA 3A1QA 3AEBB 1V2YA 1WR1A 4HJKA 3CIRB 4MJSB 1E10A 4M8MA 2M19A 1I4RA 5D94A 1DOXA 2FE8A 4HWIB 2IGDA 2K6DB 1D5XC 4MGZE 4NAWA 3DPDA 2KJ6A 3NS1A 3URYA 1NVID 3BVMA 3V6EB 4KGRA 1BUIC 2L3ZA 1QT9A 3EUB2 1LO5D 1FRRA 1EM7A 2NMQA 4F1SA 3TCAA 3AV8A 4NPNA 2BYFA 5GMVA 3L4PA 4KZCA 3O13A 2JQRB 4J6IA 3FC4A 2DYBA 1FPYA 4NQKE 4CHKA 4HDOA 5DPRA 3ZJTA 1L0VB 4OVUA 2WWZA 4W9IA 3ZNGC 2R2OA 2L0FA 5C23A 3Q8FA 2GRIA 2XK5A 4LLGM 2ONQA 3L17A 1Q0WB 3W1YA 4AP4C 3C8YA 3TEZA 1NYQA 2WU5B 1E7UA 1Z5SB 4EOYA 3A4RA 2GBKA 2IGGA 3B2FA 3M62B 4GU2A 1V1OA 2FNJB 1J0GA 1V97A 2ZZPB 2PE6B 3W9CB 1KJTA 3VQIA 2K0PA 1CJEA 2VH2A 3IBEA 2O6VD 3U4EG 4OHJA 3H7PA 3DVGX 4MH0E 5D3DA 1TT5B 2WX1A 1AN8A 2VRRB 3NG0A 3N32A 2K5PA 1XXGA 2DYOA 1Q10A 3PT2B 3AEAB 3EGRA 4AJWA 1KH0A 4OVVA 4ZDVA 2DLBA 4M02A 4MH8A 2GBNA 2KVRA 3J9CA 2IYDB 4NZLB 2GOWA 4DQOC 3ZKJC 1WJ4A 1SIFA 2CU1A 2KLCA 3IT4B 1C4PA 3R2IA 2WLBA 1ENFA 1XF5L 2IBIB 2ICIA 4FJVB 3ALBA 4KX6B 3Q3MC 2NTTA 2D10A 4YXDB 1XLQA 4HVBA 3QIJA 3ZLZA 4A90A 1WYWB 4JIOU 2Y5CA 1LFDA 3GE8C 3A9KB 2ZCBA 4P1BC 3NJTA 2JVCA 2BKFA 3UIOB 4ZRPA 1XCTL 1NI2A 2D3CA 2SEBD 1E8WA 4BOZB 1WXMA 3M3JA 1WGHA 1NENB 2CU3A 2LGSA 1YQ3B 3VH3B 1XQQA 5DPSA 1J7CA 1WXAA 3WIMA 5IKCM 4NAWB 2LJ5A 5CHFA 3OWEB 1MHXA 3DBHI 4B0EA 2J4XA 2OOBB 4AWJA 2FCNA 1EUVB 2HD5B 2MP2A 1HZ5A 3AB5A 2Z0EB 1GB1A 2J0KA 2O2VB 2BWES 4HKZE 4II3B 2N7DA 1ROEA 1YQ4B 3A4SC 2ZJDA 1JW9D 1JALA 1I4PA 3VR8B 1GOZA 1M94A 1VJKA 2RPQA 5J18A 4ANUA 3Q14C 4WURA 1K53A 1OFFA 2O6VA 1SE9A 2WXIA 4C56C 3P4QB 2JXTA 1MI0A 2BYEA 2WQYB 3ETRA 1HE8A 1I4HA 2DWQA 2K9XA 4HPMB 2XK5B 3APCA 1D5ZC 5C3JB 3B08A 4AS1A 2INNE 1SF0A 3GZNB 3KQ4A 2ZPNA 4MEMA 2VZKB 4JE3B 2QILA 5G2NA 2KD0A 3K9PB 4GMVA 1P3QU 2AWTA 3EECA 2WXMA 5D7GA 1GPXA 3VTWA 2D3AA 2NBVB 3Q8CA 3VUXA 3DBRI 1YD8U 3RNCC 5FK9C 3H7PB 4E74A 5BMHA 3IHPC 1C4CA 1FD6A 3WANA 1E8XA 4KGTA 1ZXIA 2WXGA 2BKRB 4HEA1 3R7QA 1SXTA 3KWVA 3VFKA 1MHHE 2KX0A 1N61A 3MTNB 4AOFA 2RMMA 4DXFA 3V05A 4WH4A 1TTNA 2WXHA 3RT3B 2IDYA 4N58A 3U7ZA 3UF8A 2R2QA 3OJ3A 1SB3C 2QMTA 2PPHA 3VUWA 2MJDA 2JYTA 2Y5BB 4HXDA 1H4RA 2K3UA 2NBUA 1IYFA 3TMPB 2CHZA 4BKTA 1HTQA 3KH0A 3PZDA 3JSVA 5JHBA 1UZXB 2LGDA 4ICUA 5HHDG 5BMGA 1WY8A 2DAJA 3ENEA 3DVNV 1RLFA 4ICVA 2MBQA 2J52A 4WJOA 4KSLC 4XX5A 2KDBA 1HA5A 3ZTDA 1G6JA 3QWZB 4ASWC 4BBNF 2BGFA 1UWXA 3MFGA 3H7SA 2KQSA 4YWGG 3R2TA 5JZEB 4GGQA 1F2RC 3A33B 2J53A 1D5MC 1TS5A 3K9OB 5LXHA 1RM6C 1WMHA 2FBWB 5BO4B 4YTNB 2IO1B 4IKGA 3DBLI 1B9RA 2J0MA 2ZW0A 4NY0A 3ECIA 4QAYA 2D11A 4JWSC 1ACCA 1NDDA 1S1QB 4LCDE 4BZAA 3ML9A 3MC9A 2MW5A 4KV2A 4RM8A 2MP2B 2I2YA 3PPAA 2V3PA 2D3GA 1N60A 2AQ2B 3B2GA 5I4DA 3MP9A 1ET6A 2JY6A 4MSQB 1UUPA 1UH6A 2GBJA 4GN1A 3W5VB 1C4AA 2PVGC 4D2KA 2KC1A 2WXJA 2NVUI 3T8MA 2K1FA 1KM7A 1J8CA 3KUDB 2PVOD 2LHDA 4B95A 4XE0A 2KFKA 3P4PB 4A8XC 1EWCA 2EKIA 1KTKA 3FILB 2KN4A 2FCSA 3L08A 1ISNA 2JRIB 1PFDA 2KKCA 3RULA 4LDTB 5JH5C 2LGIA 4AUQC 3CWIA 2WP9B 4RCOA 3NOBA 4NJ7A 2WXKA 5JHAA 1OEYA 3RI7C 2LXAA 3KYCD 2Q5WD 3BK1A 1JWAD 3U30A 4JGHB 3N1ZC 1VZ6A 2ASQA 3GE3C 4KDLB 4ZYSA 4MGYE 1F9JA 1C1YB 5FR6A 1TZ1A 1VZ8A 3I3TB 1N63A 2L05A 2RDHA 4P1CC 3AXCA 4RH6A 2MWSB 2NCNA 2DX5B 4HPLB 3PHXB 3BYYB 3B1LX 4CO7A 2BB5A 3PS6A 2LGXA 4GOCA 3HK0A 3OAWA 1WRDB 4GDKA 1VZ7A 3B9JA 2IO3B 2W54A 4DHZB 1Y8RC 2D5GA 5H8YE 1JWSD 2JZPA 1HQRD 2KTRB 1PGAA 3Q3JA 5HKHA 5DCNA 1P9DU 4DDID 3PZ7A 2INDC 2ON8A 1CMXB 3P4RB 1WSPA 1WRIA 3MHZA 1VLBA 3TEWA 2M0XA 5E6JA 1YIWA 1NYRA 4ANXA 4KKIA 1TS3A 3TEYA 2QSDA 2G45B 1ZP0B 4JLCA 4LNNA 4IW0A 1JRPA 1TKYA 1L0YB 1YOVB 1C76A 1BMLC 1QOGA 4XDDA 3DCGA 5BMIA 2WXRA 3AN1A 2WDRB 3PGEA 1D3ZA 1WGYA 2ZVOA 2CHXA 2J42A 1PYWD 2B3AA 4DXGA 4R3DA 3JYUA 2HJ8A 2FIFA 1P1AA 3KWLA 2JSVX 2HJ1A 1WMHB 3C19A 2MBBB 1XLPA 3IT6B 4FJZA 3QHTA 4W9EA 2C5LC 1ZE3D 1OQRA 4DHJB 2MQJA 4K7UA 1GUAB 3PHWB 2BYTA 1T3QA 2ZCCA 3EC8A 4ARCA 2JX5A 1FFUA 4IUMB 4FHKA 4A55A 4PS3A 4N6EB 2YEPF 2KMCA 3LDZE 3ML8A 4WJNA 1VR9A 2K8HA 5IAAC 4MM3A 3T3NA 4OVZA 3PLVA 1SBBB 2EKEC 4F7ZA 2KT7A 2MCNB 1IPGA 1XO3A 2REXA 2M0AA 3WA0A 3BVGA 2K22A 1TBEA 1Z2MA 2RPVA 1TGZB 3AE7B 5LNK1 4FXCA 1SE3A 2EELA 1TS4A 1YJIA 4TQ1A 1OQQA 2LUEA 2M8SA 2K8BA 4IOIE 4USAA 3PV1A 2Z59B 4FA6A 4C4VA 3AE9B 1UBQA 2YVCA 3NY5A 4PYUA 3RD2A 1MJDA 1N5XA 1WIAA 2NPTA 1L5PA 4DDGD 1V86A 2LWPA 4NNJB 2KYWA 3QARA 2V3NA 3O65B 1V81A 5C1ZA 2I1KA 3RFZB 1CQVA 1R4NI 3P63A 4K3CA 1EWYC 1EF5A 1NI3A 2KJRA 1L7YA 4ZRIA 3L10B 4ZHPA 4M8NA 3TJPA 3VUYA 3ZJUA 4LDTD 1A5RA 2G3QB 1CK1A 2GMIC 1I7HA 4HCPB 3BWUD 4PT5A 1TYGB 4I6PA 2PE9A 3N3KB 1GJZA 3AEEB 2PMVA 1EF1A 1HZ6A 1T0RC 3HVDA 4IC7B 2KACA 3MC8A 2V1YA 2KC2A 4TV3A 2W3SA 2DNFA 2JZ3B 1KLUD 4LTUA 2BB6A 4CQNA 3SFEB 4RMAA 2N9XA 2AQ3B 4WWNA 1MVKA 2RDBC 3A1QB 2AL3A 3MC0B 1K50A 3AECB 5G5GA 4NQLB 4PS7A 1V6EA 1GAQB 2CJOA 4M0WA 2KDFB 1KRHA 3MJWA 5KHQA 2A4ZA 4IG7B 3RN9C 4BBNC 3EFUA 3PZ8A 4K3BA 4FADA 2QEJC 3I57A 1R7SA 2JU6X 4RGTA 5DPWA 2BT6A 5G5HA 2NS5A 3M95A 1YN3A 2MX2A 2KK8A 2LRUA 1HEZE 2KOXA 2KAJA 1WZ0A 1N5WA 5H92C 3WCQA 5AZGA 3U7DA 1WX9A 2J0JA 3UQAA 3TBLD 2KX3A 4FBJB 1GC6A 2X8XX 4RGOS 4CYEA 4GB9A 3W1SA 4URKA 2PLPA 5CHWA 1TS2A 4G3XB 4II2B 1VCBA 4B0MA 1E8YA 4NJCA 3VH4B 3JW0X 1UGJA 2L0TA 2KQ7A 1I4QA 1BXTA 2BYVE 4IDIA 3PTFC 2LVPA 1TZOA 3DHIC 2V9HA 3CSTA 5C2TB 3ZDTA 3HM6X 1KLVA 3IAM1 3GB1A 1ZW7A 2CS4A 3PSEB 3H6NA 2MH7A 2C7HA 1XLNA 1X1MA 2LMCA 4RF1A 3AEFB 3RNGC 2OJRA 5AZFA 4C7YA 2K39A 5AZHA 1D6EC 1GC7A 3I9V1 3NUHB 2IY0B 5FR3A 2M17A 1R4MI 2NPTB 3L54A 4MELA 2C60A 3VRBB 2N1VA 4J3OD 4DWFA 3R3MA 3T3OA 3BY4B 2BWFA 2RDGA 1WE7A 1FIQA 1ET9A 3P42A 4ZRKA 3TUOA 3UI3A 3PRMB 2Y5PA 4EZLA 4K1RB 2LXCA 4YSYB 1E9MA 1TY2A 1WWTA 1YMHE 4C80A 4PK1A 3PRPB 4W9JA 4WAFA 4IWQA 2LEKA 5EE0A 2IZVB 3KUZA 1L4ZB 2XN9C 4NAMA 5GXGB 2LVQA 2LASA 1WXVA 1FNUA 2L8JA 2WXPA 3DWMA 3RNFC 4H2AA 2N9KA 3WAPA 3ZXVA 2PTLA 2ZPYA 1ZXHA 2DZKA 1V49A 1VD2A 4LK0M 4MSMB 3OLMD 4N9F4 4EZKA 1DOYA 3L16A 2PW9A 4EEWA 4JQWC 4YSXB 2OJWA 3AE3B 3A9JA 3NVYA 2AL6A 1BT0A 2WXLA 4OZBA 3AE2B 2KMMA 1WGKA 2KVZA 4I6NB 1L6VA 2WDTB 3H8HA 4IM2A 2KDIA 1SJHD 1T0QC 1XLOA 1VRAB 2BBCA 4K7SA 1WXSA 4AQ7A 3CSFA 2CR5A 4C00A 1TY0A 4YTPB 4DXAB 1ZUD2 4AJYB 1J7BA 1TIFA 3KVFB 2V4LA 1AARA 3HUIA 2EMSA 4ZOHC 1YNTE 4I6LB 4YTMB 3NHEB 2C7MB 2WHIA 2ZVNA 3V6CB 4TKNA 1PGBA 2KMAA 1ZOYB 4UDUC 1JWMD 2KDEB 3T9LA 3NS8A 2NR2A 3L0WB 2O6VB 4HLEA 2BTEA 1QLBB 3DWGC 2AYOB 1OTRB 4ZRQA 4KDIC 2CJNA 3DBHB 1AYFA 3AE8B 3X0WA 4EFOA 4DBGA 1MFWA 1OGWA 2BQQA 1UBIA 3AEGB 3FKYA 2LGYA 1YJ1A 2BS3B 2GB1A 1SE4A 4LNKA 2ZEQA 5D2MB 4GSWA 2LRWA 4A3PA 2JWUA 2DZIA 3WAOA 2KFJA 3NZSA 5IOIA 1SJED 2MBOA 3U8ZA 2FUG1 3IAS1 3QX1A 1ZKHA 2KWDA 2DBYA 3KYDD 3RPFC 1LQBA 1EU4A 3SDLC 2DAFA 2KDMA 3TL5A 3RCZA 3RNEC 3N1XC 2INPE 4MGIE 2BF8B 1K51A 4EUTA 4LNIA 3I63C 3HHMA 2N9EB 2LHEA 1WGRA 3GOEA 4KVGB 3V62A 3TIXA 4O1NA 1KLGD 2JZZA 1TKEA 2LUMA 1XCQL 1WF9A 4PS8A 1V1PA 2VZKD 5CHVC 3C0RB 3DBRB 4LNFA 3VTVA 2JUOA 4L23A 1P98A 1F77A 1FRDA 4A9AA 4LJOB 3JSVB 2K25A 1TJEA 1RAXA 3VTUA 1WR6E 3M63B 3ZUNA 2X38A 3U52E 2KTFA 1B1ZA 4TMAB 3UINB 1QZEA 2MBHA 3IFWB 4IM0A 2LI5A 4OW0A 2WU2B 1WH3A 1FEHA 2GLSA 1C9FA 3I5JC 4P16A 2L83A 2N7EA 1F0ZA 1K52A 2MJ3A 3V61A 4XGAB 5IP4D 1SEBD 1WXQA 1YQBA 3A9KA 1DOIA 2AEHA 3AULA 3AMZA 3HVZA 1N6ZA 2AX5A 1V5TA 3TEXA 2HDEA 4MDKE 1E5WA 1WYGA 2L76A 1YX6B 1FCCC 3D32A 1FXIA 2Z0DB 4S0RA 1FM0D 3V3XA 1L4DB 3P2BA 2SAKA 1WFYA 2WX0A 3LYYA 2BW2A 3ZVVA 4KZ0A 5BYRA 3IXSA 4HPPA 3RZWC 2V4IB 2W9NA 3RMKC 2G1EA 3GZNI 1L2NA 2H89B 1DYQA 1SSNA 4MGKE 4K7WA 2KFKB 2O2VA 1L0XB 3ZNHB 4FHJA 3AE5B 2MSED 3DBLB 4DK5A 4EZJA 4ANWA 2XEWA 3U2SC 3ZNZB 2D3BA 4US9A 3LJ3A 3BINA 1I4XA 4FLHA 3CMMB 3S2AA 1Q5WB 3NZ3A 2KHWB 3LXFA 1GNUA 2FIDA 5IO9A 2FCQA 2GBRA 2BVCA 3R8BA 3HRDD 1UNSA 4WJPA 3P1MA 2MBEA 1WGGA 4M01A 2JF5A 2M1MA 2YEPB 2HE7A 4N59A 2XNAC 2ZNVC 1FXAA 1NEKB 2RR9A 1IGDA 3ZYYX 4IWPA 3SU8X 3GP7A 4WWPA 4A6QA 1P0RA 3QQ8B 1SE2A 4WQOB 3QAQA 3BIID 3KUCB 4W9LA 4W9DA 4DHZE 1WJ6A 4ITKA 4BVUC 1XT9B 3VDZA 2NTSA 3IVFA 2MLBA 4KGSA 1YJJA 1E0ZA 2Y3AA 1IP9A 1Q1OA 2QHOA 4PYZA 2E3TA 1YN5A 2R61A 4GDKB 1L6UA 4E3CA 2OHFA 2WYQA 5E6PA 4BOSC 2UYZB 2FUHB 4XC2A 3ZO5B 2ZW1A 5AUIA 1V1PB 2G9HD 2QJLA 3ZRCA 5CX3A 3WALA 4NJ6A 2IPKD 2KWUB 2QCZA 3EHVA 2IGHA 3SR6A 1FMAD 1ZPSA 3AM9A 4US8A 2D07B 3ABVB 3QC8B 3RZFA 1FO4A 4HROA 2M4NA 1QILA 2GI9A 2INCC 4KKJA 4BKSD 1OEYJ 4YSZB 3ZTCA 4G0NB 2BS2B 4JPSA 2FCMA 1UWMA 1MG8A 2MA9B 2KO3A 3BZDB 3JVZX 1SGHA 2IY1B 4ZYNA 3Q8BA 4GDLA 3RUIB 1WJUA 1EU3A 3SEBA 1P7EA 3ZNID 3KLSX 2KWCA 3SHQA 3X23A 2LJIA 1OQYA 1FNWA 1PQSA 3AE4B 1FCLA 1M4VA 1KFYB 1JROA 1JWBD 1PUTA 4RNAA 1STEA 1P7FA 4G11A 2V3SA 1C79A 3Q2AC 2AQ1B 3W1SC 5EE3A 4YT0B 3ZW3A 1RRBA 2BPSA 3AU5A 4FULA 2L1AA 4P7IA 4HRSA 1MG4A 2BS4B 1E6EB 3E9SA 3KW5B 4A3OA 2WDVB 3QJZA 2WGSA 3N9YC 1FFVA 2WDQB 2DZJA 5TSSA 1RFKA 2K6QA 1RFAA 5J2RA 3DHGC 2MEKA 4MM3B 5DPTA 2OEDA 5TR5A 1IUEA 4ARIA 1TKGA 3IG3A 3R66C 2CHWA 2WNMA 3BK2A 5KHOA 4KSKC 4W9GA 3RNAC 1U4AA 1C77A 2IO2B 3VR9B 3NZUA 3QA8A 2N1WA 2DYMA 2N0SB 1VDVA 4RFBA 4ZHOA 1QOBA 3BYTB 1DGJA 4E71A 4W9CA 2B76B 3FILA 2QC8A 2WXOA 3PLUA 1I4GA 1WM3A 2UWQA 3EFCA 4DHJD 4C4VB 2VH1A 4OZCA 3VVWB 4ACFA 1JRUA 3N1YC 3VHTC 3VXWA 2UU7A 2KN5A 4W9KA 4HJGE 1YN4A 2YLMA 3Q6BA 1V9JA 4L1BA 2KNBA 1GB4A 3RYTA 1K8RB 4EKUA 3P4SB 5JXVA 3AH7A 3ZXRA 5FKAC 1HTOA 1UF0A 3DOWA 1JCKB 4XWTA 4BKSA 2KWVB 1WX7A 2ZNVB 3MHSD 3DHHC 1WI0A 2JYEA 1PDXA 2LVOA 4KIKA 4F8CB 1E7PB 2H88B 3TSSA 2M56B 3R7RA 3V60A 3HM3A 5HI1A 4YL8A 1J7AA 5CTRC 3SD5A 3W2DA 5T8IA 3ZGZA 3ZQ4A 3PRZA 1C3TA 2JPHA 4L2YA 4A20A 3UQBA 1AW7A 1T0YA 3Q8AA 2V0GA 2LFIA 4REZA 3OG5A 5EE9A 4HKQA 3W5UB 2JWZA 3DBSA 1WZ3A 1JMLA 3MJ5A 2KTRA 2LD9A 3H9DA 5MPOA 5D3IB 1R4NB 1UD7A 1CZPA 2QIEB 1KOTA 1Y56A 2WS3B 4EE2A 2W55A 3WAMA 4ANVA 3AU4A 1LM8B 3VRAB 4BFRA 1N62A 2EMTA 1J19A 3BVZA 5BYQA 4GDLB 3ZIMA 1LGRA 2MHJA 1WJNA 4JL9A 3QK0A 2QDFA 4G50A 5D6JB 3NVVA 4TSSA 2HTME 3PO0A 4M0WB 1F52A 5IN7A 1F2RI 2KXJA 2C9WB 5LXIB 5EDSA 5BYSA 4RF0A 4MT5A 1IBXA 1UGMA 3E56A 3AEDB 2RSUA 1XEEA 4ZRJA 4GLSC 3ZJVA 4BAXA 3UGBB 3APDA 2DHZA 4OZAA 2L00B 1QOAA 3APFA 4MJSA
chains in the Genus database with same CATH topology
2O6VA 1SE9A 3JSVB 3DVNU 2K25A 1E7VA 1RAXA 1WM2A 3AI5A 3VTUA 4TQ0A 1WR6E 3M63B 2G4DB 4HK2A 3ZUNA 2BYEA 4XZ4A 3QARA 2KANA 4HCNB 2KTFA 3O65B 1V81A 1HE8A 4HPMB 4W9HA 2XK5B 3APCA 3UINB 1QZEA 2I1KA 5C1ZA 1R4NI 2MBHA 3IFWB 2DENB 2J7QB 4IM0A 2RD0A 2LI5A 3B08A 4GXBA 1EF5A 1WH3A 3CF6E 3DVGY 2KJRA 1L7YA 4W9FA 4ZRIA 3L10B 4M8NA 3TJPA 3VUYA 2ZPNA 4LDTD 1A5RA 4MEMA 2RGFA 2G3QB 2N7EA 2GMIC 5G2NA 3V61A 4HCPB 2KD0A 1V80A 3K9PB 2N9PC 4GMVA 2N4FA 1P3QU 2AWTA 1YQBA 2JT4B 4I6PA 3EECA 5D7GA 3A9KA 3N30A 2PE9A 3VTWA 3N3KB 5AEKB 2NBVB 1GJZA 3VUXA 3DBRI 2AEHA 1NBFC 4BKGA 1YD8U 3AULA 3H7PB 3PREA 4E74A 1EF1A 3IHPC 4IC7B 1V5TA 4MDKE 1E5WA 1UELA 1ZGUB 2L76A 1YX6B 3WANA 2HTHA 2PEAA 2V1YA 2KC2A 4TV3A 4B6WA 1E8XA 2JZ3B 4WWOA 2KZRA 3D32A 2BKRB 2Z0DB 1E8ZA 3OJ4B 3R7QA 3VFKA 2KX0A 3B0AA 3MTNB 4AOFA 3DDCB 4RMAA 2N9XA 3P2BA 1WFYA 1YX5B 2DZMA 2WX0A 4IM3A 5J17A 3ZVVA 1FXTB 4KZ0A 1TTNA 2G4SA 3RZWC 4WWNA 2W9NA 3RT3B 1I35A 3GZNI 1L2NA 3A1QB 3UF8A 2R2QA 4GIVA 2AL3A 1S3SG 4MGKE 3OJ3A 3PVLA 4FN2A 4K7WA 4RM9A 2KFKB 2O2VA 3ZDMC 4NQLB 4PS7A 1V6EA 4WAAA 3ZNHB 2PPHA 3VAWA 1GG3A 4FHJA 2CKHB 2KDFB 2MSED 4TUUA 3UIPB 2JRHA 4DK5A 3MJWA 4EZJA 5KHQA 2A4ZA 3VUWA 4IG7B 5G55A 2XEWA 4ANWA 4BBNC 2Y5BB 3EFUA 3QCAA 1H4RA 4HXDA 5E6NA 3ZNZB 4FADA 2KLGA 3LJ3A 4IWOA 3BINA 2NBUA 2KJHB 4FLHA 1IYFA 3TMPB 2CHZA 4BKTA 2A5UA 3CMMB 2LZ6A 5E6OA 3S2AA 1Q5WB 3KH0A 2KHWB 3PZDA 3JSVA 1GNUA 2FIDA 5DPWA 4KIKB 2FCQA 5JHBA 2GBRA 1UZXB 2LGDA 2NS5A 3M95A 4ICUA 1WY8A 5IA7A 2DAJA 3ENEA 3DVNV 2MX2A 3Q3FA 1RLFA 2KK8A 2LRUA 4ICVA 4HDQA 4WJPA 2KOXA 1WZ0A 2MBEA 2MBQA 3ONSA 4WJOA 4X57B 5AZGA 4KSLC 1WGGA 1WX9A 2J0JA 3L13A 4WJQA 4XX5A 2JF5A 2M1MA 2MRPA 2HE7A 2KDBA 3ZRFA 3UQAA 1H8CA 3ZTDA 3TBLD 1G6JA 2KX3A 1V5OA 4FBJB 1GC6A 2ZNVC 3QWZB 4B9KA 4ASWC 4BBNF 2RR9A 4CYEA 4GB9A 3W1SA 4URKA 4FJYA 4IWPA 5CHWA 4WWPA 3SU8X 2BGFA 2JXXA 3H7SA 2KQSA 4G3XB 2C7NB 4II2B 1VCBA 1P0RA 1E8YA 1EO6A 2FAZA 2GBMA 3QQ8B 4GGQA 3VH4B 3JW0X 5JZEB 4WQOB 3QAQA 2L0TA 3A33B 3KUCB 4W9LA 2PJHA 4W9DA 1WX8A 2KQ7A 4K81A 3K9OB 4DHZE 2D2QA 5LXHA 1WJ6A 1WMHA 5BO4B 2IO1B 4BVUC 5L83A 1XT9B 2BYVE 2NBWB 3PTFC 3VDZA 3DBLI 2LVPA 2J0MA 3H1UA 2MLBA 3IVFA 4LJPB 4NY0A 1WE6A 3ECIA 2D11A 3CSTA 1WGDA 1IP9A 3ZDTA 2I1JA 1Q1OA 1E90A 1NDDA 1S1QB 2IO0B 4LCDE 2QHOA 3HM6X 3ML9A 4PYZA 2MW5A 1KLVA 3A9JB 4KV2A 4GDKB 4RM8A 2MP2B 1ZW7A 4E3CA 2K8CA 2CS4A 3DQVA 3PPAA 2WYQA 3PSEB 5E6PA 5LLIA 4BOSC 2D3GA 2FUHB 2UYZB 2XBBC 3H6NA 2C7HA 4XC2A 3ZO5B 1X1MA 1I42A 2JY6A 4MSQB 3HIZA 1UH6A 2GBJA 2OJRA 5AZFA 4GN1A 3ZRCA 2K39A 5CX3A 1XD3B 5AZHA 1LXDA 3WALA 1GC7A 2KC1A 4NJ6A 2KWUB 5L95C 3EHVA 2NVUI 2IY0B 3T8MA 2M17A 1R4MI 2K1FA 1KM7A 2L7RA 2NPTB 3KUDB 3L54A 1J8CA 3A1QA 1V2YA 2D07B 3RZFA 1WR1A 3QC8B 4B95A 4HJKA 4MELA 2KFKA 2C60A 4MJSB 2N1VA 4DWFA 3R3MA 2M4NA 4M8MA 3BY4B 4BKSD 1OEYJ 5D94A 2BWFA 3ZTCA 4HWIB 1WE7A 2K6DB 2FCSA 4MGZE 4G0NB 4NAWA 2FCMA 3DPDA 3L08A 1MG8A 1ISNA 2KJ6A 4ZRKA 2JRIB 2MA9B 2KO3A 2KKCA 3RULA 4LDTB 3JVZX 1SGHA 3PRMB 2IY1B 4ZYNA 5JH5C 3V6EB 4GDLA 3RUIB 4AUQC 1WJUA 2L3ZA 3NOBA 4EZLA 4K1RB 4NJ7A 2LXCA 5JHAA 1OEYA 3ZNID 2LXAA 3KYCD 2KWCA 3PRPB 3SHQA 4W9JA 3X23A 4F1SA 4IWQA 3TCAA 3U30A 4JGHB 1OQYA 4NPNA 2BYFA 1PQSA 2IZVB 3KUZA 2ASQA 5GMVA 4KDLB 4KZCA 2LVQA 4J6IA 2LASA 4G11A 2V3SA 1WXVA 2DYBA 2L8JA 4MGYE 1F9JA 1C1YB 5FR6A 4NQKE 3W1SC 4CHKA 1TZ1A 4HDOA 3ZW3A 5DPRA 3I3TB 3WAPA 1RRBA 2ZPYA 4OVUA 2BPSA 2L05A 3AU5A 2WWZA 4W9IA 2DZKA 1V49A 3ZNGC 1VD2A 2L0FA 2R2OA 3AXCA 4FULA 5C23A 4P7IA 4MSMB 2MWSB 2NCNA 2DX5B 4HPLB 4A3OA 3KW5B 3PHXB 3B1LX 4CO7A 3OLMD 4N9F4 4EZKA 3QJZA 2XK5A 3L16A 3PS6A 3L17A 4EEWA 1Q0WB 2DZJA 2LGXA 4GOCA 4JQWC 3W1YA 3HK0A 3OAWA 4AP4C 2K6QA 1WRDB 3A9JA 1RFAA 5J2RA 4GDKA 1E7UA 1Z5SB 4EOYA 3A4RA 2AL6A 1BT0A 2IO3B 4DHZB 5DPTA 1Y8RC 2GBKA 5TR5A 3M62B 4GU2A 2FNJB 2KTRB 5HKHA 3Q3JA 3IG3A 5DCNA 4I6NB 2WDTB 3R66C 1J0GA 2CHWA 2ZZPB 1P9DU 2PE6B 4DDID 1CMXB 1KJTA 5KHOA 2KDIA 4IM2A 3VQIA 4KSKC 4W9GA 1U4AA 3IBEA 2O6VD 2IO2B 2M0XA 3NZUA 4K7SA 1WXSA 3QA8A 2N1WA 2DYMA 3CSFA 2CR5A 3H7PA 1YIWA 3DVGX 4MH0E 2WX1A 4DXAB 4ANXA 4AJYB 3KVFB 2V4LA 1AARA 4E71A 4W9CA 2VRRB 2G45B 3N32A 4JLCA 2EMSA 3U7DA 2DYOA 3PLUA 4I6LB 1WM3A 2UWQA 4IW0A 3NHEB 3PT2B 4DHJD 2C7MB 2ZVNA 4AJWA 3V6CB 4TKNA 3VVWB 2KMAA 3DCGA 4OVVA 4ZDVA 1JRUA 3VHTC 3VXWA 2KN5A 2KDEB 4W9KA 3PGEA 3T9LA 3NS8A 1D3ZA 1WGYA 2GBNA 2NR2A 2YLMA 2KVRA 2IYDB 2ZVOA 3L0WB 2CHXA 2GOWA 1V9JA 1WJ4A 2B3AA 1SIFA 2O6VB 3ZKJC 4HLEA 2KNBA 3JYUA 2CU1A 2HJ8A 2FIFA 1P1AA 1K8RB 2KLCA 3RYTA 2AYOB 4EKUA 1OTRB 1WMHB 4KDIC 2MBBB 2IBIB 4FJVB 3DOWA 3ALBA 3X0WA 4FJZA 4BKSA 3QHTA 2KWVB 2D10A 1WX7A 2ZNVB 3MHSD 4EFOA 4W9EA 4DBGA 1OGWA 1UBIA 1WI0A 2C5LC 2LGYA 1YJ1A 4DHJB 2LVOA 2MQJA 4KIKA 4K7UA 4F8CB 4HVBA 1GUAB 3QIJA 3ZLZA 2ZEQA 5D2MB 4GSWA 2LRWA 3R7RA 3V60A 4A3PA 3HM3A 1WYWB 2DZIA 3WAOA 3PHWB 4YL8A 3SD5A 5CTRC 4JIOU 2KFJA 2ZCCA 3EC8A 3NZSA 1LFDA 3PRZA 1C3TA 2MBOA 3A9KB 2JPHA 2ZCBA 3U8ZA 2JVCA 4IUMB 4FHKA 2BKFA 4PS3A 3QX1A 1ZKHA 3UIOB 2KMCA 4A20A 3UQBA 1T0YA 3KYDD 3LDZE 3ML8A 1NI2A 1LQBA 4WJNA 2K8HA 5IAAC 4MM3A 3SDLC 1E8WA 2DAFA 3PLVA 4BOZB 1WXMA 3M3JA 1WGHA 3TL5A 2EKEC 2JWZA 3DBSA 1WZ3A 4F7ZA 3RCZA 2MCNB 2KTRA 1IPGA 3VH3B 1XQQA 4MGIE 2LD9A 2BF8B 3H9DA 1WXAA 5DPSA 4EUTA 3WIMA 2REXA 1UD7A 3HHMA 4NAWB 3WA0A 1TBEA 1Z2MA 2LJ5A 2N9EB 5CHFA 1TGZB 1KOTA 3DBHI 3WAMA 4ANVA 2OOBB 3AU4A 1LM8B 4AWJA 1WGRA 3GOEA 4KVGB 4BFRA 2FCNA 3V62A 3TIXA 1EUVB 2EMTA 1J19A 2HD5B 2MP2A 4GDLB 3ZIMA 4TQ1A 1WJNA 4JL9A 2JZZA 2LUEA 2M8SA 2Z0EB 3QK0A 4G50A 2J0KA 5D6JB 2K8BA 2O2VB 2BWES 3PV1A 1WF9A 4II3B 2N7DA 2Z59B 4PS8A 4FA6A 4M0WB 3A4SC 2ZJDA 5CHVC 2KXJA 3C0RB 2C9WB 5LXIB 5EDSA 3VTVA 1UBQA 2YVCA 3NY5A 4PYUA 1UGMA 3RD2A 2JUOA 1M94A 2RSUA 1P98A 4ZRJA 1WIAA 2NPTA 3UGBB 3APDA 4LJOB 2RPQA 5J18A 2DHZA 4ANUA 4DDGD 1V86A 2L00B 2LWPA 3APFA 4MJSA 4NNJB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2O6V A;  1SE9 A;  3JSV B;  3DVN U;  2K25 A;  1E7V A;  1RAX A;  1WM2 A;  3AI5 A;  3VTU A;  4TQ0 A;  1WR6 E;  3M63 B;  2G4D B;  4HK2 A;  3ZUN A;  2BYE A;  4XZ4 A;  3QAR A;  2KAN A;  4HCN B;  2KTF A;  3O65 B;  1V81 A;  1HE8 A;  4HPM B;  4W9H A;  2XK5 B;  3APC A;  3UIN B;  1QZE A;  2I1K A;  5C1Z A;  1R4N I;  2MBH A;  3IFW B;  2DEN B;  2J7Q B;  4IM0 A;  2RD0 A;  2LI5 A;  3B08 A;  4GXB A;  1EF5 A;  1WH3 A;  3CF6 E;  3DVG Y;  2KJR A;  1L7Y A;  4W9F A;  4ZRI A;  3L10 B;  4M8N A;  3TJP A;  3VUY A;  2ZPN A;  4LDT D;  1A5R A;  4MEM A;  2RGF A;  2G3Q B;  2N7E A;  2GMI C;  5G2N A;  3V61 A;  4HCP B;  2KD0 A;  1V80 A;  3K9P B;  2N9P C;  4GMV A;  2N4F A;  1P3Q U;  2AWT A;  1YQB A;  2JT4 B;  4I6P A;  3EEC A;  5D7G A;  3A9K A;  3N30 A;  2PE9 A;  3VTW A;  3N3K B;  5AEK B;  2NBV B;  1GJZ A;  3VUX A;  3DBR I;  2AEH A;  1NBF C;  4BKG A;  1YD8 U;  3AUL A;  3H7P B;  3PRE A;  4E74 A;  1EF1 A;  3IHP C;  4IC7 B;  1V5T A;  4MDK E;  1E5W A;  1UEL A;  1ZGU B;  2L76 A;  1YX6 B;  3WAN A;  2HTH A;  2PEA A;  2V1Y A;  2KC2 A;  4TV3 A;  4B6W A;  1E8X A;  2JZ3 B;  4WWO A;  2KZR A;  3D32 A;  2BKR B;  2Z0D B;  1E8Z A;  3OJ4 B;  3R7Q A;  3VFK A;  2KX0 A;  3B0A A;  3MTN B;  4AOF A;  3DDC B;  4RMA A;  2N9X A;  3P2B A;  1WFY A;  1YX5 B;  2DZM A;  2WX0 A;  4IM3 A;  5J17 A;  3ZVV A;  1FXT B;  4KZ0 A;  1TTN A;  2G4S A;  3RZW C;  4WWN A;  2W9N A;  3RT3 B;  1I35 A;  3GZN I;  1L2N A;  3A1Q B;  3UF8 A;  2R2Q A;  4GIV A;  2AL3 A;  1S3S G;  4MGK E;  3OJ3 A;  3PVL A;  4FN2 A;  4K7W A;  4RM9 A;  2KFK B;  2O2V A;  3ZDM C;  4NQL B;  4PS7 A;  1V6E A;  4WAA A;  3ZNH B;  2PPH A;  3VAW A;  1GG3 A;  4FHJ A;  2CKH B;  2KDF B;  2MSE D;  4TUU A;  3UIP B;  2JRH A;  4DK5 A;  3MJW A;  4EZJ A;  5KHQ A;  2A4Z A;  3VUW A;  4IG7 B;  5G55 A;  2XEW A;  4ANW A;  4BBN C;  2Y5B B;  3EFU A;  3QCA A;  1H4R A;  4HXD A;  5E6N A;  3ZNZ B;  4FAD A;  2KLG A;  3LJ3 A;  4IWO A;  3BIN A;  2NBU A;  2KJH B;  4FLH A;  1IYF A;  3TMP B;  2CHZ A;  4BKT A;  2A5U A;  3CMM B;  2LZ6 A;  5E6O A;  3S2A A;  1Q5W B;  3KH0 A;  2KHW B;  3PZD A;  3JSV A;  1GNU A;  2FID A;  5DPW A;  4KIK B;  2FCQ A;  5JHB A;  2GBR A;  1UZX B;  2LGD A;  2NS5 A;  3M95 A;  4ICU A;  1WY8 A;  5IA7 A;  2DAJ A;  3ENE A;  3DVN V;  2MX2 A;  3Q3F A;  1RLF A;  2KK8 A;  2LRU A;  4ICV A;  4HDQ A;  4WJP A;  2KOX A;  1WZ0 A;  2MBE A;  2MBQ A;  3ONS A;  4WJO A;  4X57 B;  5AZG A;  4KSL C;  1WGG A;  1WX9 A;  2J0J A;  3L13 A;  4WJQ A;  4XX5 A;  2JF5 A;  2M1M A;  2MRP A;  2HE7 A;  2KDB A;  3ZRF A;  3UQA A;  1H8C A;  3ZTD A;  3TBL D;  1G6J A;  2KX3 A;  1V5O A;  4FBJ B;  1GC6 A;  2ZNV C;  3QWZ B;  4B9K A;  4ASW C;  4BBN F;  2RR9 A;  4CYE A;  4GB9 A;  3W1S A;  4URK A;  4FJY A;  4IWP A;  5CHW A;  4WWP A;  3SU8 X;  2BGF A;  2JXX A;  3H7S A;  2KQS A;  4G3X B;  2C7N B;  4II2 B;  1VCB A;  1P0R A;  1E8Y A;  1EO6 A;  2FAZ A;  2GBM A;  3QQ8 B;  4GGQ A;  3VH4 B;  3JW0 X;  5JZE B;  4WQO B;  3QAQ A;  2L0T A;  3A33 B;  3KUC B;  4W9L A;  2PJH A;  4W9D A;  1WX8 A;  2KQ7 A;  4K81 A;  3K9O B;  4DHZ E;  2D2Q A;  5LXH A;  1WJ6 A;  1WMH A;  5BO4 B;  2IO1 B;  4BVU C;  5L83 A;  1XT9 B;  2BYV E;  2NBW B;  3PTF C;  3VDZ A;  3DBL I;  2LVP A;  2J0M A;  3H1U A;  2MLB A;  3IVF A;  4LJP B;  4NY0 A;  1WE6 A;  3ECI A;  2D11 A;  3CST A;  1WGD A;  1IP9 A;  3ZDT A;  2I1J A;  1Q1O A;  1E90 A;  1NDD A;  1S1Q B;  2IO0 B;  4LCD E;  2QHO A;  3HM6 X;  3ML9 A;  4PYZ A;  2MW5 A;  1KLV A;  3A9J B;  4KV2 A;  4GDK B;  4RM8 A;  2MP2 B;  1ZW7 A;  4E3C A;  2K8C A;  2CS4 A;  3DQV A;  3PPA A;  2WYQ A;  3PSE B;  5E6P A;  5LLI A;  4BOS C;  2D3G A;  2FUH B;  2UYZ B;  2XBB C;  3H6N A;  2C7H A;  4XC2 A;  3ZO5 B;  1X1M A;  1I42 A;  2JY6 A;  4MSQ B;  3HIZ A;  1UH6 A;  2GBJ A;  2OJR A;  5AZF A;  4GN1 A;  3ZRC A;  2K39 A;  5CX3 A;  1XD3 B;  5AZH A;  1LXD A;  3WAL A;  1GC7 A;  2KC1 A;  4NJ6 A;  2KWU B;  5L95 C;  3EHV A;  2NVU I;  2IY0 B;  3T8M A;  2M17 A;  1R4M I;  2K1F A;  1KM7 A;  2L7R A;  2NPT B;  3KUD B;  3L54 A;  1J8C A;  3A1Q A;  1V2Y A;  2D07 B;  3RZF A;  1WR1 A;  3QC8 B;  4B95 A;  4HJK A;  4MEL A;  2KFK A;  2C60 A;  4MJS B;  2N1V A;  4DWF A;  3R3M A;  2M4N A;  4M8M A;  3BY4 B;  4BKS D;  1OEY J;  5D94 A;  2BWF A;  3ZTC A;  4HWI B;  1WE7 A;  2K6D B;  2FCS A;  4MGZ E;  4G0N B;  4NAW A;  2FCM A;  3DPD A;  3L08 A;  1MG8 A;  1ISN A;  2KJ6 A;  4ZRK A;  2JRI B;  2MA9 B;  2KO3 A;  2KKC A;  3RUL A;  4LDT B;  3JVZ X;  1SGH A;  3PRM B;  2IY1 B;  4ZYN A;  5JH5 C;  3V6E B;  4GDL A;  3RUI B;  4AUQ C;  1WJU A;  2L3Z A;  3NOB A;  4EZL A;  4K1R B;  4NJ7 A;  2LXC A;  5JHA A;  1OEY A;  3ZNI D;  2LXA A;  3KYC D;  2KWC A;  3PRP B;  3SHQ A;  4W9J A;  3X23 A;  4F1S A;  4IWQ A;  3TCA A;  3U30 A;  4JGH B;  1OQY A;  4NPN A;  2BYF A;  1PQS A;  2IZV B;  3KUZ A;  2ASQ A;  5GMV A;  4KDL B;  4KZC A;  2LVQ A;  4J6I A;  2LAS A;  4G11 A;  2V3S A;  1WXV A;  2DYB A;  2L8J A;  4MGY E;  1F9J A;  1C1Y B;  5FR6 A;  4NQK E;  3W1S C;  4CHK A;  1TZ1 A;  4HDO A;  3ZW3 A;  5DPR A;  3I3T B;  3WAP A;  1RRB A;  2ZPY A;  4OVU A;  2BPS A;  2L05 A;  3AU5 A;  2WWZ A;  4W9I A;  2DZK A;  1V49 A;  3ZNG C;  1VD2 A;  2L0F A;  2R2O A;  3AXC A;  4FUL A;  5C23 A;  4P7I A;  4MSM B;  2MWS B;  2NCN A;  2DX5 B;  4HPL B;  4A3O A;  3KW5 B;  3PHX B;  3B1L X;  4CO7 A;  3OLM D;  4N9F 4;  4EZK A;  3QJZ A;  2XK5 A;  3L16 A;  3PS6 A;  3L17 A;  4EEW A;  1Q0W B;  2DZJ A;  2LGX A;  4GOC A;  4JQW C;  3W1Y A;  3HK0 A;  3OAW A;  4AP4 C;  2K6Q A;  1WRD B;  3A9J A;  1RFA A;  5J2R A;  4GDK A;  1E7U A;  1Z5S B;  4EOY A;  3A4R A;  2AL6 A;  1BT0 A;  2IO3 B;  4DHZ B;  5DPT A;  1Y8R C;  2GBK A;  5TR5 A;  3M62 B;  4GU2 A;  2FNJ B;  2KTR B;  5HKH A;  3Q3J A;  3IG3 A;  5DCN A;  4I6N B;  2WDT B;  3R66 C;  1J0G A;  2CHW A;  2ZZP B;  1P9D U;  2PE6 B;  4DDI D;  1CMX B;  1KJT A;  5KHO A;  2KDI A;  4IM2 A;  3VQI A;  4KSK C;  4W9G A;  1U4A A;  3IBE A;  2O6V D;  2IO2 B;  2M0X A;  3NZU A;  4K7S A;  1WXS A;  3QA8 A;  2N1W A;  2DYM A;  3CSF A;  2CR5 A;  3H7P A;  1YIW A;  3DVG X;  4MH0 E;  2WX1 A;  4DXA B;  4ANX A;  4AJY B;  3KVF B;  2V4L A;  1AAR A;  4E71 A;  4W9C A;  2VRR B;  2G45 B;  3N32 A;  4JLC A;  2EMS A;  3U7D A;  2DYO A;  3PLU A;  4I6L B;  1WM3 A;  2UWQ A;  4IW0 A;  3NHE B;  3PT2 B;  4DHJ D;  2C7M B;  2ZVN A;  4AJW A;  3V6C B;  4TKN A;  3VVW B;  2KMA A;  3DCG A;  4OVV A;  4ZDV A;  1JRU A;  3VHT C;  3VXW A;  2KN5 A;  2KDE B;  4W9K A;  3PGE A;  3T9L A;  3NS8 A;  1D3Z A;  1WGY A;  2GBN A;  2NR2 A;  2YLM A;  2KVR A;  2IYD B;  2ZVO A;  3L0W B;  2CHX A;  2GOW A;  1V9J A;  1WJ4 A;  2B3A A;  1SIF A;  2O6V B;  3ZKJ C;  4HLE A;  2KNB A;  3JYU A;  2CU1 A;  2HJ8 A;  2FIF A;  1P1A A;  1K8R B;  2KLC A;  3RYT A;  2AYO B;  4EKU A;  1OTR B;  1WMH B;  4KDI C;  2MBB B;  2IBI B;  4FJV B;  3DOW A;  3ALB A;  3X0W A;  4FJZ A;  4BKS A;  3QHT A;  2KWV B;  2D10 A;  1WX7 A;  2ZNV B;  3MHS D;  4EFO A;  4W9E A;  4DBG A;  1OGW A;  1UBI A;  1WI0 A;  2C5L C;  2LGY A;  1YJ1 A;  4DHJ B;  2LVO A;  2MQJ A;  4KIK A;  4K7U A;  4F8C B;  4HVB A;  1GUA B;  3QIJ A;  3ZLZ A;  2ZEQ A;  5D2M B;  4GSW A;  2LRW A;  3R7R A;  3V60 A;  4A3P A;  3HM3 A;  1WYW B;  2DZI A;  3WAO A;  3PHW B;  4YL8 A;  3SD5 A;  5CTR C;  4JIO U;  2KFJ A;  2ZCC A;  3EC8 A;  3NZS A;  1LFD A;  3PRZ A;  1C3T A;  2MBO A;  3A9K B;  2JPH A;  2ZCB A;  3U8Z A;  2JVC A;  4IUM B;  4FHK A;  2BKF A;  4PS3 A;  3QX1 A;  1ZKH A;  3UIO B;  2KMC A;  4A20 A;  3UQB A;  1T0Y A;  3KYD D;  3LDZ E;  3ML8 A;  1NI2 A;  1LQB A;  4WJN A;  2K8H A;  5IAA C;  4MM3 A;  3SDL C;  1E8W A;  2DAF A;  3PLV A;  4BOZ B;  1WXM A;  3M3J A;  1WGH A;  3TL5 A;  2EKE C;  2JWZ A;  3DBS A;  1WZ3 A;  4F7Z A;  3RCZ A;  2MCN B;  2KTR A;  1IPG A;  3VH3 B;  1XQQ A;  4MGI E;  2LD9 A;  2BF8 B;  3H9D A;  1WXA A;  5DPS A;  4EUT A;  3WIM A;  2REX A;  1UD7 A;  3HHM A;  4NAW B;  3WA0 A;  1TBE A;  1Z2M A;  2LJ5 A;  2N9E B;  5CHF A;  1TGZ B;  1KOT A;  3DBH I;  3WAM A;  4ANV A;  2OOB B;  3AU4 A;  1LM8 B;  4AWJ A;  1WGR A;  3GOE A;  4KVG B;  4BFR A;  2FCN A;  3V62 A;  3TIX A;  1EUV B;  2EMT A;  1J19 A;  2HD5 B;  2MP2 A;  4GDL B;  3ZIM A;  4TQ1 A;  1WJN A;  4JL9 A;  2JZZ A;  2LUE A;  2M8S A;  2Z0E B;  3QK0 A;  4G50 A;  2J0K A;  5D6J B;  2K8B A;  2O2V B;  2BWE S;  3PV1 A;  1WF9 A;  4II3 B;  2N7D A;  2Z59 B;  4PS8 A;  4FA6 A;  4M0W B;  3A4S C;  2ZJD A;  5CHV C;  2KXJ A;  3C0R B;  2C9W B;  5LXI B;  5EDS A;  3VTV A;  1UBQ A;  2YVC A;  3NY5 A;  4PYU A;  1UGM A;  3RD2 A;  2JUO A;  1M94 A;  2RSU A;  1P98 A;  4ZRJ A;  1WIA A;  2NPT A;  3UGB B;  3APD A;  4LJO B;  2RPQ A;  5J18 A;  2DHZ A;  4ANU A;  4DDG D;  1V86 A;  2L00 B;  2LWP A;  3APF A;  4MJS A;  4NNJ B; 
#chains in the Genus database with same CATH topology
 3N20 C;  3DVN U;  1E7V A;  5HFY A;  2IJ0 A;  1WM2 A;  3AI5 A;  1AWD A;  4TQ0 A;  4HK2 A;  2G4D B;  4XZ4 A;  2KAN A;  4HCN B;  2W82 A;  3GS2 A;  4JWU C;  4W9H A;  2MJE A;  2DEN B;  2J7Q B;  2RD0 A;  1JQ4 A;  4GXB A;  3CF6 E;  3DVG Y;  3NVW A;  4W9F A;  1C78 A;  2RGF A;  4WQM A;  1QKZ A;  1KF6 B;  1RYJ A;  1V80 A;  2N9P C;  1FNV A;  2N4F A;  2E6X A;  2JT4 B;  2PKO A;  3AE1 B;  5AEK B;  3N30 A;  2TSS A;  1MPE A;  2N7J A;  1NBF C;  4BKG A;  2Z8L A;  3PRE A;  5EE1 A;  1ZDX A;  1UEL A;  2L32 A;  1F1H A;  4RGN A;  1ZGU B;  2HTH A;  2PEA A;  4WWM A;  4B6W A;  4WWO A;  2KZR A;  3SFD B;  2WXN A;  1E8Z A;  3OJ4 B;  4LNO A;  1V8C A;  3B0A A;  3RNB C;  1ESF A;  3DDC B;  1YX5 B;  2DZM A;  1QF6 A;  4IM3 A;  5J17 A;  1FXT B;  2KQ4 X;  3NVZ A;  1D4B A;  2G4S A;  1QQR A;  1I35 A;  3FAH A;  4XYC A;  4GIV A;  4JX1 C;  3Q3N C;  1QOF A;  1S3S G;  4FN2 A;  3PVL A;  1IGC A;  4RM9 A;  3ZDM C;  4WAA A;  4WIP A;  3VAW A;  1GG3 A;  2CKH B;  4TUU A;  1HXY D;  3UIP B;  2JRH A;  3NRZ A;  1T0S C;  4XDC A;  5G55 A;  3QCA A;  5E6N A;  2KLG A;  4IWO A;  2KJH B;  3EA6 A;  4M00 A;  4C7Z A;  2A5U A;  1SIJ A;  2LZ6 A;  5E6O A;  1PGX A;  3AE6 B;  4KIK B;  2ACZ B;  2I38 A;  5IA7 A;  3Q3F A;  4HDQ A;  3ONS A;  1A70 A;  4X57 B;  3L13 A;  4WJQ A;  2MRP A;  3ZRF A;  1H8C A;  1R4M B;  1V5O A;  4B9K A;  2PIA A;  4FJY A;  2W3R A;  4P6V F;  2JXX A;  1T5X D;  2WXQ A;  2C7N B;  2FAZ A;  1EO6 A;  2GBM A;  4S17 A;  2WXF A;  2PJH A;  1WX8 A;  4K81 A;  2D2Q A;  5AUK A;  5L83 A;  3Q8E A;  5HG2 A;  2NBW B;  3H1U A;  4LJP B;  1WE6 A;  1T6B X;  1WGD A;  3Q3O C;  1ZDV A;  2I1J A;  1E90 A;  2IO0 B;  3A9J B;  4Q2J A;  4RGM A;  3LB8 C;  2K8C A;  3DQV A;  5LLI A;  1JWU D;  2XBB C;  1I42 A;  2N9L A;  3HIZ A;  3Q69 A;  4MAC A;  1XD3 B;  2L52 A;  1LXD A;  1RWS A;  4XWW A;  5L95 C;  1IBX B;  2L7R A;  3A1Q A;  3AEB B;  1V2Y A;  1WR1 A;  4HJK A;  3CIR B;  4MJS B;  1E10 A;  4M8M A;  2M19 A;  1I4R A;  5D94 A;  1DOX A;  2FE8 A;  4HWI B;  2IGD A;  2K6D B;  1D5X C;  4MGZ E;  4NAW A;  3DPD A;  2KJ6 A;  3NS1 A;  3URY A;  1NVI D;  3BVM A;  3V6E B;  4KGR A;  1BUI C;  2L3Z A;  1QT9 A;  3EUB 2;  1LO5 D;  1FRR A;  1EM7 A;  2NMQ A;  4F1S A;  3TCA A;  3AV8 A;  4NPN A;  2BYF A;  5GMV A;  3L4P A;  4KZC A;  3O13 A;  2JQR B;  4J6I A;  3FC4 A;  2DYB A;  1FPY A;  4NQK E;  4CHK A;  4HDO A;  5DPR A;  3ZJT A;  1L0V B;  4OVU A;  2WWZ A;  4W9I A;  3ZNG C;  2R2O A;  2L0F A;  5C23 A;  3Q8F A;  2GRI A;  2XK5 A;  4LLG M;  2ONQ A;  3L17 A;  1Q0W B;  3W1Y A;  4AP4 C;  3C8Y A;  3TEZ A;  1NYQ A;  2WU5 B;  1E7U A;  1Z5S B;  4EOY A;  3A4R A;  2GBK A;  2IGG A;  3B2F A;  3M62 B;  4GU2 A;  1V1O A;  2FNJ B;  1J0G A;  1V97 A;  2ZZP B;  2PE6 B;  3W9C B;  1KJT A;  3VQI A;  2K0P A;  1CJE A;  2VH2 A;  3IBE A;  2O6V D;  3U4E G;  4OHJ A;  3H7P A;  3DVG X;  4MH0 E;  5D3D A;  1TT5 B;  2WX1 A;  1AN8 A;  2VRR B;  3NG0 A;  3N32 A;  2K5P A;  1XXG A;  2DYO A;  1Q10 A;  3PT2 B;  3AEA B;  3EGR A;  4AJW A;  1KH0 A;  4OVV A;  4ZDV A;  2DLB A;  4M02 A;  4MH8 A;  2GBN A;  2KVR A;  3J9C A;  2IYD B;  4NZL B;  2GOW A;  4DQO C;  3ZKJ C;  1WJ4 A;  1SIF A;  2CU1 A;  2KLC A;  3IT4 B;  1C4P A;  3R2I A;  2WLB A;  1ENF A;  1XF5 L;  2IBI B;  2ICI A;  4FJV B;  3ALB A;  4KX6 B;  3Q3M C;  2NTT A;  2D10 A;  4YXD B;  1XLQ A;  4HVB A;  3QIJ A;  3ZLZ A;  4A90 A;  1WYW B;  4JIO U;  2Y5C A;  1LFD A;  3GE8 C;  3A9K B;  2ZCB A;  4P1B C;  3NJT A;  2JVC A;  2BKF A;  3UIO B;  4ZRP A;  1XCT L;  1NI2 A;  2D3C A;  2SEB D;  1E8W A;  4BOZ B;  1WXM A;  3M3J A;  1WGH A;  1NEN B;  2CU3 A;  2LGS A;  1YQ3 B;  3VH3 B;  1XQQ A;  5DPS A;  1J7C A;  1WXA A;  3WIM A;  5IKC M;  4NAW B;  2LJ5 A;  5CHF A;  3OWE B;  1MHX A;  3DBH I;  4B0E A;  2J4X A;  2OOB B;  4AWJ A;  2FCN A;  1EUV B;  2HD5 B;  2MP2 A;  1HZ5 A;  3AB5 A;  2Z0E B;  1GB1 A;  2J0K A;  2O2V B;  2BWE S;  4HKZ E;  4II3 B;  2N7D A;  1ROE A;  1YQ4 B;  3A4S C;  2ZJD A;  1JW9 D;  1JAL A;  1I4P A;  3VR8 B;  1GOZ A;  1M94 A;  1VJK A;  2RPQ A;  5J18 A;  4ANU A;  3Q14 C;  4WUR A;  1K53 A;  1OFF A;  2O6V A;  1SE9 A;  2WXI A;  4C56 C;  3P4Q B;  2JXT A;  1MI0 A;  2BYE A;  2WQY B;  3ETR A;  1HE8 A;  1I4H A;  2DWQ A;  2K9X A;  4HPM B;  2XK5 B;  3APC A;  1D5Z C;  5C3J B;  3B08 A;  4AS1 A;  2INN E;  1SF0 A;  3GZN B;  3KQ4 A;  2ZPN A;  4MEM A;  2VZK B;  4JE3 B;  2QIL A;  5G2N A;  2KD0 A;  3K9P B;  4GMV A;  1P3Q U;  2AWT A;  3EEC A;  2WXM A;  5D7G A;  1GPX A;  3VTW A;  2D3A A;  2NBV B;  3Q8C A;  3VUX A;  3DBR I;  1YD8 U;  3RNC C;  5FK9 C;  3H7P B;  4E74 A;  5BMH A;  3IHP C;  1C4C A;  1FD6 A;  3WAN A;  1E8X A;  4KGT A;  1ZXI A;  2WXG A;  2BKR B;  4HEA 1;  3R7Q A;  1SXT A;  3KWV A;  3VFK A;  1MHH E;  2KX0 A;  1N61 A;  3MTN B;  4AOF A;  2RMM A;  4DXF A;  3V05 A;  4WH4 A;  1TTN A;  2WXH A;  3RT3 B;  2IDY A;  4N58 A;  3U7Z A;  3UF8 A;  2R2Q A;  3OJ3 A;  1SB3 C;  2QMT A;  2PPH A;  3VUW A;  2MJD A;  2JYT A;  2Y5B B;  4HXD A;  1H4R A;  2K3U A;  2NBU A;  1IYF A;  3TMP B;  2CHZ A;  4BKT A;  1HTQ A;  3KH0 A;  3PZD A;  3JSV A;  5JHB A;  1UZX B;  2LGD A;  4ICU A;  5HHD G;  5BMG A;  1WY8 A;  2DAJ A;  3ENE A;  3DVN V;  1RLF A;  4ICV A;  2MBQ A;  2J52 A;  4WJO A;  4KSL C;  4XX5 A;  2KDB A;  1HA5 A;  3ZTD A;  1G6J A;  3QWZ B;  4ASW C;  4BBN F;  2BGF A;  1UWX A;  3MFG A;  3H7S A;  2KQS A;  4YWG G;  3R2T A;  5JZE B;  4GGQ A;  1F2R C;  3A33 B;  2J53 A;  1D5M C;  1TS5 A;  3K9O B;  5LXH A;  1RM6 C;  1WMH A;  2FBW B;  5BO4 B;  4YTN B;  2IO1 B;  4IKG A;  3DBL I;  1B9R A;  2J0M A;  2ZW0 A;  4NY0 A;  3ECI A;  4QAY A;  2D11 A;  4JWS C;  1ACC A;  1NDD A;  1S1Q B;  4LCD E;  4BZA A;  3ML9 A;  3MC9 A;  2MW5 A;  4KV2 A;  4RM8 A;  2MP2 B;  2I2Y A;  3PPA A;  2V3P A;  2D3G A;  1N60 A;  2AQ2 B;  3B2G A;  5I4D A;  3MP9 A;  1ET6 A;  2JY6 A;  4MSQ B;  1UUP A;  1UH6 A;  2GBJ A;  4GN1 A;  3W5V B;  1C4A A;  2PVG C;  4D2K A;  2KC1 A;  2WXJ A;  2NVU I;  3T8M A;  2K1F A;  1KM7 A;  1J8C A;  3KUD B;  2PVO D;  2LHD A;  4B95 A;  4XE0 A;  2KFK A;  3P4P B;  4A8X C;  1EWC A;  2EKI A;  1KTK A;  3FIL B;  2KN4 A;  2FCS A;  3L08 A;  1ISN A;  2JRI B;  1PFD A;  2KKC A;  3RUL A;  4LDT B;  5JH5 C;  2LGI A;  4AUQ C;  3CWI A;  2WP9 B;  4RCO A;  3NOB A;  4NJ7 A;  2WXK A;  5JHA A;  1OEY A;  3RI7 C;  2LXA A;  3KYC D;  2Q5W D;  3BK1 A;  1JWA D;  3U30 A;  4JGH B;  3N1Z C;  1VZ6 A;  2ASQ A;  3GE3 C;  4KDL B;  4ZYS A;  4MGY E;  1F9J A;  1C1Y B;  5FR6 A;  1TZ1 A;  1VZ8 A;  3I3T B;  1N63 A;  2L05 A;  2RDH A;  4P1C C;  3AXC A;  4RH6 A;  2MWS B;  2NCN A;  2DX5 B;  4HPL B;  3PHX B;  3BYY B;  3B1L X;  4CO7 A;  2BB5 A;  3PS6 A;  2LGX A;  4GOC A;  3HK0 A;  3OAW A;  1WRD B;  4GDK A;  1VZ7 A;  3B9J A;  2IO3 B;  2W54 A;  4DHZ B;  1Y8R C;  2D5G A;  5H8Y E;  1JWS D;  2JZP A;  1HQR D;  2KTR B;  1PGA A;  3Q3J A;  5HKH A;  5DCN A;  1P9D U;  4DDI D;  3PZ7 A;  2IND C;  2ON8 A;  1CMX B;  3P4R B;  1WSP A;  1WRI A;  3MHZ A;  1VLB A;  3TEW A;  2M0X A;  5E6J A;  1YIW A;  1NYR A;  4ANX A;  4KKI A;  1TS3 A;  3TEY A;  2QSD A;  2G45 B;  1ZP0 B;  4JLC A;  4LNN A;  4IW0 A;  1JRP A;  1TKY A;  1L0Y B;  1YOV B;  1C76 A;  1BML C;  1QOG A;  4XDD A;  3DCG A;  5BMI A;  2WXR A;  3AN1 A;  2WDR B;  3PGE A;  1D3Z A;  1WGY A;  2ZVO A;  2CHX A;  2J42 A;  1PYW D;  2B3A A;  4DXG A;  4R3D A;  3JYU A;  2HJ8 A;  2FIF A;  1P1A A;  3KWL A;  2JSV X;  2HJ1 A;  1WMH B;  3C19 A;  2MBB B;  1XLP A;  3IT6 B;  4FJZ A;  3QHT A;  4W9E A;  2C5L C;  1ZE3 D;  1OQR A;  4DHJ B;  2MQJ A;  4K7U A;  1GUA B;  3PHW B;  2BYT A;  1T3Q A;  2ZCC A;  3EC8 A;  4ARC A;  2JX5 A;  1FFU A;  4IUM B;  4FHK A;  4A55 A;  4PS3 A;  4N6E B;  2YEP F;  2KMC A;  3LDZ E;  3ML8 A;  4WJN A;  1VR9 A;  2K8H A;  5IAA C;  4MM3 A;  3T3N A;  4OVZ A;  3PLV A;  1SBB B;  2EKE C;  4F7Z A;  2KT7 A;  2MCN B;  1IPG A;  1XO3 A;  2REX A;  2M0A A;  3WA0 A;  3BVG A;  2K22 A;  1TBE A;  1Z2M A;  2RPV A;  1TGZ B;  3AE7 B;  5LNK 1;  4FXC A;  1SE3 A;  2EEL A;  1TS4 A;  1YJI A;  4TQ1 A;  1OQQ A;  2LUE A;  2M8S A;  2K8B A;  4IOI E;  4USA A;  3PV1 A;  2Z59 B;  4FA6 A;  4C4V A;  3AE9 B;  1UBQ A;  2YVC A;  3NY5 A;  4PYU A;  3RD2 A;  1MJD A;  1N5X A;  1WIA A;  2NPT A;  1L5P A;  4DDG D;  1V86 A;  2LWP A;  4NNJ B;  2KYW A;  3QAR A;  2V3N A;  3O65 B;  1V81 A;  5C1Z A;  2I1K A;  3RFZ B;  1CQV A;  1R4N I;  3P63 A;  4K3C A;  1EWY C;  1EF5 A;  1NI3 A;  2KJR A;  1L7Y A;  4ZRI A;  3L10 B;  4ZHP A;  4M8N A;  3TJP A;  3VUY A;  3ZJU A;  4LDT D;  1A5R A;  2G3Q B;  1CK1 A;  2GMI C;  1I7H A;  4HCP B;  3BWU D;  4PT5 A;  1TYG B;  4I6P A;  2PE9 A;  3N3K B;  1GJZ A;  3AEE B;  2PMV A;  1EF1 A;  1HZ6 A;  1T0R C;  3HVD A;  4IC7 B;  2KAC A;  3MC8 A;  2V1Y A;  2KC2 A;  4TV3 A;  2W3S A;  2DNF A;  2JZ3 B;  1KLU D;  4LTU A;  2BB6 A;  4CQN A;  3SFE B;  4RMA A;  2N9X A;  2AQ3 B;  4WWN A;  1MVK A;  2RDB C;  3A1Q B;  2AL3 A;  3MC0 B;  1K50 A;  3AEC B;  5G5G A;  4NQL B;  4PS7 A;  1V6E A;  1GAQ B;  2CJO A;  4M0W A;  2KDF B;  1KRH A;  3MJW A;  5KHQ A;  2A4Z A;  4IG7 B;  3RN9 C;  4BBN C;  3EFU A;  3PZ8 A;  4K3B A;  4FAD A;  2QEJ C;  3I57 A;  1R7S A;  2JU6 X;  4RGT A;  5DPW A;  2BT6 A;  5G5H A;  2NS5 A;  3M95 A;  1YN3 A;  2MX2 A;  2KK8 A;  2LRU A;  1HEZ E;  2KOX A;  2KAJ A;  1WZ0 A;  1N5W A;  5H92 C;  3WCQ A;  5AZG A;  3U7D A;  1WX9 A;  2J0J A;  3UQA A;  3TBL D;  2KX3 A;  4FBJ B;  1GC6 A;  2X8X X;  4RGO S;  4CYE A;  4GB9 A;  3W1S A;  4URK A;  2PLP A;  5CHW A;  1TS2 A;  4G3X B;  4II2 B;  1VCB A;  4B0M A;  1E8Y A;  4NJC A;  3VH4 B;  3JW0 X;  1UGJ A;  2L0T A;  2KQ7 A;  1I4Q A;  1BXT A;  2BYV E;  4IDI A;  3PTF C;  2LVP A;  1TZO A;  3DHI C;  2V9H A;  3CST A;  5C2T B;  3ZDT A;  3HM6 X;  1KLV A;  3IAM 1;  3GB1 A;  1ZW7 A;  2CS4 A;  3PSE B;  3H6N A;  2MH7 A;  2C7H A;  1XLN A;  1X1M A;  2LMC A;  4RF1 A;  3AEF B;  3RNG C;  2OJR A;  5AZF A;  4C7Y A;  2K39 A;  5AZH A;  1D6E C;  1GC7 A;  3I9V 1;  3NUH B;  2IY0 B;  5FR3 A;  2M17 A;  1R4M I;  2NPT B;  3L54 A;  4MEL A;  2C60 A;  3VRB B;  2N1V A;  4J3O D;  4DWF A;  3R3M A;  3T3O A;  3BY4 B;  2BWF A;  2RDG A;  1WE7 A;  1FIQ A;  1ET9 A;  3P42 A;  4ZRK A;  3TUO A;  3UI3 A;  3PRM B;  2Y5P A;  4EZL A;  4K1R B;  2LXC A;  4YSY B;  1E9M A;  1TY2 A;  1WWT A;  1YMH E;  4C80 A;  4PK1 A;  3PRP B;  4W9J A;  4WAF A;  4IWQ A;  2LEK A;  5EE0 A;  2IZV B;  3KUZ A;  1L4Z B;  2XN9 C;  4NAM A;  5GXG B;  2LVQ A;  2LAS A;  1WXV A;  1FNU A;  2L8J A;  2WXP A;  3DWM A;  3RNF C;  4H2A A;  2N9K A;  3WAP A;  3ZXV A;  2PTL A;  2ZPY A;  1ZXH A;  2DZK A;  1V49 A;  1VD2 A;  4LK0 M;  4MSM B;  3OLM D;  4N9F 4;  4EZK A;  1DOY A;  3L16 A;  2PW9 A;  4EEW A;  4JQW C;  4YSX B;  2OJW A;  3AE3 B;  3A9J A;  3NVY A;  2AL6 A;  1BT0 A;  2WXL A;  4OZB A;  3AE2 B;  2KMM A;  1WGK A;  2KVZ A;  4I6N B;  1L6V A;  2WDT B;  3H8H A;  4IM2 A;  2KDI A;  1SJH D;  1T0Q C;  1XLO A;  1VRA B;  2BBC A;  4K7S A;  1WXS A;  4AQ7 A;  3CSF A;  2CR5 A;  4C00 A;  1TY0 A;  4YTP B;  4DXA B;  1ZUD 2;  4AJY B;  1J7B A;  1TIF A;  3KVF B;  2V4L A;  1AAR A;  3HUI A;  2EMS A;  4ZOH C;  1YNT E;  4I6L B;  4YTM B;  3NHE B;  2C7M B;  2WHI A;  2ZVN A;  3V6C B;  4TKN A;  1PGB A;  2KMA A;  1ZOY B;  4UDU C;  1JWM D;  2KDE B;  3T9L A;  3NS8 A;  2NR2 A;  3L0W B;  2O6V B;  4HLE A;  2BTE A;  1QLB B;  3DWG C;  2AYO B;  1OTR B;  4ZRQ A;  4KDI C;  2CJN A;  3DBH B;  1AYF A;  3AE8 B;  3X0W A;  4EFO A;  4DBG A;  1MFW A;  1OGW A;  2BQQ A;  1UBI A;  3AEG B;  3FKY A;  2LGY A;  1YJ1 A;  2BS3 B;  2GB1 A;  1SE4 A;  4LNK A;  2ZEQ A;  5D2M B;  4GSW A;  2LRW A;  4A3P A;  2JWU A;  2DZI A;  3WAO A;  2KFJ A;  3NZS A;  5IOI A;  1SJE D;  2MBO A;  3U8Z A;  2FUG 1;  3IAS 1;  3QX1 A;  1ZKH A;  2KWD A;  2DBY A;  3KYD D;  3RPF C;  1LQB A;  1EU4 A;  3SDL C;  2DAF A;  2KDM A;  3TL5 A;  3RCZ A;  3RNE C;  3N1X C;  2INP E;  4MGI E;  2BF8 B;  1K51 A;  4EUT A;  4LNI A;  3I63 C;  3HHM A;  2N9E B;  2LHE A;  1WGR A;  3GOE A;  4KVG B;  3V62 A;  3TIX A;  4O1N A;  1KLG D;  2JZZ A;  1TKE A;  2LUM A;  1XCQ L;  1WF9 A;  4PS8 A;  1V1P A;  2VZK D;  5CHV C;  3C0R B;  3DBR B;  4LNF A;  3VTV A;  2JUO A;  4L23 A;  1P98 A;  1F77 A;  1FRD A;  4A9A A;  4LJO B;  3JSV B;  2K25 A;  1TJE A;  1RAX A;  3VTU A;  1WR6 E;  3M63 B;  3ZUN A;  2X38 A;  3U52 E;  2KTF A;  1B1Z A;  4TMA B;  3UIN B;  1QZE A;  2MBH A;  3IFW B;  4IM0 A;  2LI5 A;  4OW0 A;  2WU2 B;  1WH3 A;  1FEH A;  2GLS A;  1C9F A;  3I5J C;  4P16 A;  2L83 A;  2N7E A;  1F0Z A;  1K52 A;  2MJ3 A;  3V61 A;  4XGA B;  5IP4 D;  1SEB D;  1WXQ A;  1YQB A;  3A9K A;  1DOI A;  2AEH A;  3AUL A;  3AMZ A;  3HVZ A;  1N6Z A;  2AX5 A;  1V5T A;  3TEX A;  2HDE A;  4MDK E;  1E5W A;  1WYG A;  2L76 A;  1YX6 B;  1FCC C;  3D32 A;  1FXI A;  2Z0D B;  4S0R A;  1FM0 D;  3V3X A;  1L4D B;  3P2B A;  2SAK A;  1WFY A;  2WX0 A;  3LYY A;  2BW2 A;  3ZVV A;  4KZ0 A;  5BYR A;  3IXS A;  4HPP A;  3RZW C;  2V4I B;  2W9N A;  3RMK C;  2G1E A;  3GZN I;  1L2N A;  2H89 B;  1DYQ A;  1SSN A;  4MGK E;  4K7W A;  2KFK B;  2O2V A;  1L0X B;  3ZNH B;  4FHJ A;  3AE5 B;  2MSE D;  3DBL B;  4DK5 A;  4EZJ A;  4ANW A;  2XEW A;  3U2S C;  3ZNZ B;  2D3B A;  4US9 A;  3LJ3 A;  3BIN A;  1I4X A;  4FLH A;  3CMM B;  3S2A A;  1Q5W B;  3NZ3 A;  2KHW B;  3LXF A;  1GNU A;  2FID A;  5IO9 A;  2FCQ A;  2GBR A;  2BVC A;  3R8B A;  3HRD D;  1UNS A;  4WJP A;  3P1M A;  2MBE A;  1WGG A;  4M01 A;  2JF5 A;  2M1M A;  2YEP B;  2HE7 A;  4N59 A;  2XNA C;  2ZNV C;  1FXA A;  1NEK B;  2RR9 A;  1IGD A;  3ZYY X;  4IWP A;  3SU8 X;  3GP7 A;  4WWP A;  4A6Q A;  1P0R A;  3QQ8 B;  1SE2 A;  4WQO B;  3QAQ A;  3BII D;  3KUC B;  4W9L A;  4W9D A;  4DHZ E;  1WJ6 A;  4ITK A;  4BVU C;  1XT9 B;  3VDZ A;  2NTS A;  3IVF A;  2MLB A;  4KGS A;  1YJJ A;  1E0Z A;  2Y3A A;  1IP9 A;  1Q1O A;  2QHO A;  4PYZ A;  2E3T A;  1YN5 A;  2R61 A;  4GDK B;  1L6U A;  4E3C A;  2OHF A;  2WYQ A;  5E6P A;  4BOS C;  2UYZ B;  2FUH B;  4XC2 A;  3ZO5 B;  2ZW1 A;  5AUI A;  1V1P B;  2G9H D;  2QJL A;  3ZRC A;  5CX3 A;  3WAL A;  4NJ6 A;  2IPK D;  2KWU B;  2QCZ A;  3EHV A;  2IGH A;  3SR6 A;  1FMA D;  1ZPS A;  3AM9 A;  4US8 A;  2D07 B;  3ABV B;  3QC8 B;  3RZF A;  1FO4 A;  4HRO A;  2M4N A;  1QIL A;  2GI9 A;  2INC C;  4KKJ A;  4BKS D;  1OEY J;  4YSZ B;  3ZTC A;  4G0N B;  2BS2 B;  4JPS A;  2FCM A;  1UWM A;  1MG8 A;  2MA9 B;  2KO3 A;  3BZD B;  3JVZ X;  1SGH A;  2IY1 B;  4ZYN A;  3Q8B A;  4GDL A;  3RUI B;  1WJU A;  1EU3 A;  3SEB A;  1P7E A;  3ZNI D;  3KLS X;  2KWC A;  3SHQ A;  3X23 A;  2LJI A;  1OQY A;  1FNW A;  1PQS A;  3AE4 B;  1FCL A;  1M4V A;  1KFY B;  1JRO A;  1JWB D;  1PUT A;  4RNA A;  1STE A;  1P7F A;  4G11 A;  2V3S A;  1C79 A;  3Q2A C;  2AQ1 B;  3W1S C;  5EE3 A;  4YT0 B;  3ZW3 A;  1RRB A;  2BPS A;  3AU5 A;  4FUL A;  2L1A A;  4P7I A;  4HRS A;  1MG4 A;  2BS4 B;  1E6E B;  3E9S A;  3KW5 B;  4A3O A;  2WDV B;  3QJZ A;  2WGS A;  3N9Y C;  1FFV A;  2WDQ B;  2DZJ A;  5TSS A;  1RFK A;  2K6Q A;  1RFA A;  5J2R A;  3DHG C;  2MEK A;  4MM3 B;  5DPT A;  2OED A;  5TR5 A;  1IUE A;  4ARI A;  1TKG A;  3IG3 A;  3R66 C;  2CHW A;  2WNM A;  3BK2 A;  5KHO A;  4KSK C;  4W9G A;  3RNA C;  1U4A A;  1C77 A;  2IO2 B;  3VR9 B;  3NZU A;  3QA8 A;  2N1W A;  2DYM A;  2N0S B;  1VDV A;  4RFB A;  4ZHO A;  1QOB A;  3BYT B;  1DGJ A;  4E71 A;  4W9C A;  2B76 B;  3FIL A;  2QC8 A;  2WXO A;  3PLU A;  1I4G A;  1WM3 A;  2UWQ A;  3EFC A;  4DHJ D;  4C4V B;  2VH1 A;  4OZC A;  3VVW B;  4ACF A;  1JRU A;  3N1Y C;  3VHT C;  3VXW A;  2UU7 A;  2KN5 A;  4W9K A;  4HJG E;  1YN4 A;  2YLM A;  3Q6B A;  1V9J A;  4L1B A;  2KNB A;  1GB4 A;  3RYT A;  1K8R B;  4EKU A;  3P4S B;  5JXV A;  3AH7 A;  3ZXR A;  5FKA C;  1HTO A;  1UF0 A;  3DOW A;  1JCK B;  4XWT A;  4BKS A;  2KWV B;  1WX7 A;  2ZNV B;  3MHS D;  3DHH C;  1WI0 A;  2JYE A;  1PDX A;  2LVO A;  4KIK A;  4F8C B;  1E7P B;  2H88 B;  3TSS A;  2M56 B;  3R7R A;  3V60 A;  3HM3 A;  5HI1 A;  4YL8 A;  1J7A A;  5CTR C;  3SD5 A;  3W2D A;  5T8I A;  3ZGZ A;  3ZQ4 A;  3PRZ A;  1C3T A;  2JPH A;  4L2Y A;  4A20 A;  3UQB A;  1AW7 A;  1T0Y A;  3Q8A A;  2V0G A;  2LFI A;  4REZ A;  3OG5 A;  5EE9 A;  4HKQ A;  3W5U B;  2JWZ A;  3DBS A;  1WZ3 A;  1JML A;  3MJ5 A;  2KTR A;  2LD9 A;  3H9D A;  5MPO A;  5D3I B;  1R4N B;  1UD7 A;  1CZP A;  2QIE B;  1KOT A;  1Y56 A;  2WS3 B;  4EE2 A;  2W55 A;  3WAM A;  4ANV A;  3AU4 A;  1LM8 B;  3VRA B;  4BFR A;  1N62 A;  2EMT A;  1J19 A;  3BVZ A;  5BYQ A;  4GDL B;  3ZIM A;  1LGR A;  2MHJ A;  1WJN A;  4JL9 A;  3QK0 A;  2QDF A;  4G50 A;  5D6J B;  3NVV A;  4TSS A;  2HTM E;  3PO0 A;  4M0W B;  1F52 A;  5IN7 A;  1F2R I;  2KXJ A;  2C9W B;  5LXI B;  5EDS A;  5BYS A;  4RF0 A;  4MT5 A;  1IBX A;  1UGM A;  3E56 A;  3AED B;  2RSU A;  1XEE A;  4ZRJ A;  4GLS C;  3ZJV A;  4BAX A;  3UGB B;  3APD A;  2DHZ A;  4OZA A;  2L00 B;  1QOA A;  3APF A;  4MJS A; 
#chains in the Genus database with same CATH homology
 2O6V A;  1SE9 A;  3JSV B;  3DVN U;  2K25 A;  1E7V A;  1RAX A;  1WM2 A;  3AI5 A;  3VTU A;  4TQ0 A;  1WR6 E;  3M63 B;  2G4D B;  4HK2 A;  3ZUN A;  2BYE A;  4XZ4 A;  3QAR A;  2KAN A;  4HCN B;  2KTF A;  3O65 B;  1V81 A;  1HE8 A;  4HPM B;  4W9H A;  2XK5 B;  3APC A;  3UIN B;  1QZE A;  2I1K A;  5C1Z A;  1R4N I;  2MBH A;  3IFW B;  2DEN B;  2J7Q B;  4IM0 A;  2RD0 A;  2LI5 A;  3B08 A;  4GXB A;  1EF5 A;  1WH3 A;  3CF6 E;  3DVG Y;  2KJR A;  1L7Y A;  4W9F A;  4ZRI A;  3L10 B;  4M8N A;  3TJP A;  3VUY A;  2ZPN A;  4LDT D;  1A5R A;  4MEM A;  2RGF A;  2G3Q B;  2N7E A;  2GMI C;  5G2N A;  3V61 A;  4HCP B;  2KD0 A;  1V80 A;  3K9P B;  2N9P C;  4GMV A;  2N4F A;  1P3Q U;  2AWT A;  1YQB A;  2JT4 B;  4I6P A;  3EEC A;  5D7G A;  3A9K A;  3N30 A;  2PE9 A;  3VTW A;  3N3K B;  5AEK B;  2NBV B;  1GJZ A;  3VUX A;  3DBR I;  2AEH A;  1NBF C;  4BKG A;  1YD8 U;  3AUL A;  3H7P B;  3PRE A;  4E74 A;  1EF1 A;  3IHP C;  4IC7 B;  1V5T A;  4MDK E;  1E5W A;  1UEL A;  1ZGU B;  2L76 A;  1YX6 B;  3WAN A;  2HTH A;  2PEA A;  2V1Y A;  2KC2 A;  4TV3 A;  4B6W A;  1E8X A;  2JZ3 B;  4WWO A;  2KZR A;  3D32 A;  2BKR B;  2Z0D B;  1E8Z A;  3OJ4 B;  3R7Q A;  3VFK A;  2KX0 A;  3B0A A;  3MTN B;  4AOF A;  3DDC B;  4RMA A;  2N9X A;  3P2B A;  1WFY A;  1YX5 B;  2DZM A;  2WX0 A;  4IM3 A;  5J17 A;  3ZVV A;  1FXT B;  4KZ0 A;  1TTN A;  2G4S A;  3RZW C;  4WWN A;  2W9N A;  3RT3 B;  1I35 A;  3GZN I;  1L2N A;  3A1Q B;  3UF8 A;  2R2Q A;  4GIV A;  2AL3 A;  1S3S G;  4MGK E;  3OJ3 A;  3PVL A;  4FN2 A;  4K7W A;  4RM9 A;  2KFK B;  2O2V A;  3ZDM C;  4NQL B;  4PS7 A;  1V6E A;  4WAA A;  3ZNH B;  2PPH A;  3VAW A;  1GG3 A;  4FHJ A;  2CKH B;  2KDF B;  2MSE D;  4TUU A;  3UIP B;  2JRH A;  4DK5 A;  3MJW A;  4EZJ A;  5KHQ A;  2A4Z A;  3VUW A;  4IG7 B;  5G55 A;  2XEW A;  4ANW A;  4BBN C;  2Y5B B;  3EFU A;  3QCA A;  1H4R A;  4HXD A;  5E6N A;  3ZNZ B;  4FAD A;  2KLG A;  3LJ3 A;  4IWO A;  3BIN A;  2NBU A;  2KJH B;  4FLH A;  1IYF A;  3TMP B;  2CHZ A;  4BKT A;  2A5U A;  3CMM B;  2LZ6 A;  5E6O A;  3S2A A;  1Q5W B;  3KH0 A;  2KHW B;  3PZD A;  3JSV A;  1GNU A;  2FID A;  5DPW A;  4KIK B;  2FCQ A;  5JHB A;  2GBR A;  1UZX B;  2LGD A;  2NS5 A;  3M95 A;  4ICU A;  1WY8 A;  5IA7 A;  2DAJ A;  3ENE A;  3DVN V;  2MX2 A;  3Q3F A;  1RLF A;  2KK8 A;  2LRU A;  4ICV A;  4HDQ A;  4WJP A;  2KOX A;  1WZ0 A;  2MBE A;  2MBQ A;  3ONS A;  4WJO A;  4X57 B;  5AZG A;  4KSL C;  1WGG A;  1WX9 A;  2J0J A;  3L13 A;  4WJQ A;  4XX5 A;  2JF5 A;  2M1M A;  2MRP A;  2HE7 A;  2KDB A;  3ZRF A;  3UQA A;  1H8C A;  3ZTD A;  3TBL D;  1G6J A;  2KX3 A;  1V5O A;  4FBJ B;  1GC6 A;  2ZNV C;  3QWZ B;  4B9K A;  4ASW C;  4BBN F;  2RR9 A;  4CYE A;  4GB9 A;  3W1S A;  4URK A;  4FJY A;  4IWP A;  5CHW A;  4WWP A;  3SU8 X;  2BGF A;  2JXX A;  3H7S A;  2KQS A;  4G3X B;  2C7N B;  4II2 B;  1VCB A;  1P0R A;  1E8Y A;  1EO6 A;  2FAZ A;  2GBM A;  3QQ8 B;  4GGQ A;  3VH4 B;  3JW0 X;  5JZE B;  4WQO B;  3QAQ A;  2L0T A;  3A33 B;  3KUC B;  4W9L A;  2PJH A;  4W9D A;  1WX8 A;  2KQ7 A;  4K81 A;  3K9O B;  4DHZ E;  2D2Q A;  5LXH A;  1WJ6 A;  1WMH A;  5BO4 B;  2IO1 B;  4BVU C;  5L83 A;  1XT9 B;  2BYV E;  2NBW B;  3PTF C;  3VDZ A;  3DBL I;  2LVP A;  2J0M A;  3H1U A;  2MLB A;  3IVF A;  4LJP B;  4NY0 A;  1WE6 A;  3ECI A;  2D11 A;  3CST A;  1WGD A;  1IP9 A;  3ZDT A;  2I1J A;  1Q1O A;  1E90 A;  1NDD A;  1S1Q B;  2IO0 B;  4LCD E;  2QHO A;  3HM6 X;  3ML9 A;  4PYZ A;  2MW5 A;  1KLV A;  3A9J B;  4KV2 A;  4GDK B;  4RM8 A;  2MP2 B;  1ZW7 A;  4E3C A;  2K8C A;  2CS4 A;  3DQV A;  3PPA A;  2WYQ A;  3PSE B;  5E6P A;  5LLI A;  4BOS C;  2D3G A;  2FUH B;  2UYZ B;  2XBB C;  3H6N A;  2C7H A;  4XC2 A;  3ZO5 B;  1X1M A;  1I42 A;  2JY6 A;  4MSQ B;  3HIZ A;  1UH6 A;  2GBJ A;  2OJR A;  5AZF A;  4GN1 A;  3ZRC A;  2K39 A;  5CX3 A;  1XD3 B;  5AZH A;  1LXD A;  3WAL A;  1GC7 A;  2KC1 A;  4NJ6 A;  2KWU B;  5L95 C;  3EHV A;  2NVU I;  2IY0 B;  3T8M A;  2M17 A;  1R4M I;  2K1F A;  1KM7 A;  2L7R A;  2NPT B;  3KUD B;  3L54 A;  1J8C A;  3A1Q A;  1V2Y A;  2D07 B;  3RZF A;  1WR1 A;  3QC8 B;  4B95 A;  4HJK A;  4MEL A;  2KFK A;  2C60 A;  4MJS B;  2N1V A;  4DWF A;  3R3M A;  2M4N A;  4M8M A;  3BY4 B;  4BKS D;  1OEY J;  5D94 A;  2BWF A;  3ZTC A;  4HWI B;  1WE7 A;  2K6D B;  2FCS A;  4MGZ E;  4G0N B;  4NAW A;  2FCM A;  3DPD A;  3L08 A;  1MG8 A;  1ISN A;  2KJ6 A;  4ZRK A;  2JRI B;  2MA9 B;  2KO3 A;  2KKC A;  3RUL A;  4LDT B;  3JVZ X;  1SGH A;  3PRM B;  2IY1 B;  4ZYN A;  5JH5 C;  3V6E B;  4GDL A;  3RUI B;  4AUQ C;  1WJU A;  2L3Z A;  3NOB A;  4EZL A;  4K1R B;  4NJ7 A;  2LXC A;  5JHA A;  1OEY A;  3ZNI D;  2LXA A;  3KYC D;  2KWC A;  3PRP B;  3SHQ A;  4W9J A;  3X23 A;  4F1S A;  4IWQ A;  3TCA A;  3U30 A;  4JGH B;  1OQY A;  4NPN A;  2BYF A;  1PQS A;  2IZV B;  3KUZ A;  2ASQ A;  5GMV A;  4KDL B;  4KZC A;  2LVQ A;  4J6I A;  2LAS A;  4G11 A;  2V3S A;  1WXV A;  2DYB A;  2L8J A;  4MGY E;  1F9J A;  1C1Y B;  5FR6 A;  4NQK E;  3W1S C;  4CHK A;  1TZ1 A;  4HDO A;  3ZW3 A;  5DPR A;  3I3T B;  3WAP A;  1RRB A;  2ZPY A;  4OVU A;  2BPS A;  2L05 A;  3AU5 A;  2WWZ A;  4W9I A;  2DZK A;  1V49 A;  3ZNG C;  1VD2 A;  2L0F A;  2R2O A;  3AXC A;  4FUL A;  5C23 A;  4P7I A;  4MSM B;  2MWS B;  2NCN A;  2DX5 B;  4HPL B;  4A3O A;  3KW5 B;  3PHX B;  3B1L X;  4CO7 A;  3OLM D;  4N9F 4;  4EZK A;  3QJZ A;  2XK5 A;  3L16 A;  3PS6 A;  3L17 A;  4EEW A;  1Q0W B;  2DZJ A;  2LGX A;  4GOC A;  4JQW C;  3W1Y A;  3HK0 A;  3OAW A;  4AP4 C;  2K6Q A;  1WRD B;  3A9J A;  1RFA A;  5J2R A;  4GDK A;  1E7U A;  1Z5S B;  4EOY A;  3A4R A;  2AL6 A;  1BT0 A;  2IO3 B;  4DHZ B;  5DPT A;  1Y8R C;  2GBK A;  5TR5 A;  3M62 B;  4GU2 A;  2FNJ B;  2KTR B;  5HKH A;  3Q3J A;  3IG3 A;  5DCN A;  4I6N B;  2WDT B;  3R66 C;  1J0G A;  2CHW A;  2ZZP B;  1P9D U;  2PE6 B;  4DDI D;  1CMX B;  1KJT A;  5KHO A;  2KDI A;  4IM2 A;  3VQI A;  4KSK C;  4W9G A;  1U4A A;  3IBE A;  2O6V D;  2IO2 B;  2M0X A;  3NZU A;  4K7S A;  1WXS A;  3QA8 A;  2N1W A;  2DYM A;  3CSF A;  2CR5 A;  3H7P A;  1YIW A;  3DVG X;  4MH0 E;  2WX1 A;  4DXA B;  4ANX A;  4AJY B;  3KVF B;  2V4L A;  1AAR A;  4E71 A;  4W9C A;  2VRR B;  2G45 B;  3N32 A;  4JLC A;  2EMS A;  3U7D A;  2DYO A;  3PLU A;  4I6L B;  1WM3 A;  2UWQ A;  4IW0 A;  3NHE B;  3PT2 B;  4DHJ D;  2C7M B;  2ZVN A;  4AJW A;  3V6C B;  4TKN A;  3VVW B;  2KMA A;  3DCG A;  4OVV A;  4ZDV A;  1JRU A;  3VHT C;  3VXW A;  2KN5 A;  2KDE B;  4W9K A;  3PGE A;  3T9L A;  3NS8 A;  1D3Z A;  1WGY A;  2GBN A;  2NR2 A;  2YLM A;  2KVR A;  2IYD B;  2ZVO A;  3L0W B;  2CHX A;  2GOW A;  1V9J A;  1WJ4 A;  2B3A A;  1SIF A;  2O6V B;  3ZKJ C;  4HLE A;  2KNB A;  3JYU A;  2CU1 A;  2HJ8 A;  2FIF A;  1P1A A;  1K8R B;  2KLC A;  3RYT A;  2AYO B;  4EKU A;  1OTR B;  1WMH B;  4KDI C;  2MBB B;  2IBI B;  4FJV B;  3DOW A;  3ALB A;  3X0W A;  4FJZ A;  4BKS A;  3QHT A;  2KWV B;  2D10 A;  1WX7 A;  2ZNV B;  3MHS D;  4EFO A;  4W9E A;  4DBG A;  1OGW A;  1UBI A;  1WI0 A;  2C5L C;  2LGY A;  1YJ1 A;  4DHJ B;  2LVO A;  2MQJ A;  4KIK A;  4K7U A;  4F8C B;  4HVB A;  1GUA B;  3QIJ A;  3ZLZ A;  2ZEQ A;  5D2M B;  4GSW A;  2LRW A;  3R7R A;  3V60 A;  4A3P A;  3HM3 A;  1WYW B;  2DZI A;  3WAO A;  3PHW B;  4YL8 A;  3SD5 A;  5CTR C;  4JIO U;  2KFJ A;  2ZCC A;  3EC8 A;  3NZS A;  1LFD A;  3PRZ A;  1C3T A;  2MBO A;  3A9K B;  2JPH A;  2ZCB A;  3U8Z A;  2JVC A;  4IUM B;  4FHK A;  2BKF A;  4PS3 A;  3QX1 A;  1ZKH A;  3UIO B;  2KMC A;  4A20 A;  3UQB A;  1T0Y A;  3KYD D;  3LDZ E;  3ML8 A;  1NI2 A;  1LQB A;  4WJN A;  2K8H A;  5IAA C;  4MM3 A;  3SDL C;  1E8W A;  2DAF A;  3PLV A;  4BOZ B;  1WXM A;  3M3J A;  1WGH A;  3TL5 A;  2EKE C;  2JWZ A;  3DBS A;  1WZ3 A;  4F7Z A;  3RCZ A;  2MCN B;  2KTR A;  1IPG A;  3VH3 B;  1XQQ A;  4MGI E;  2LD9 A;  2BF8 B;  3H9D A;  1WXA A;  5DPS A;  4EUT A;  3WIM A;  2REX A;  1UD7 A;  3HHM A;  4NAW B;  3WA0 A;  1TBE A;  1Z2M A;  2LJ5 A;  2N9E B;  5CHF A;  1TGZ B;  1KOT A;  3DBH I;  3WAM A;  4ANV A;  2OOB B;  3AU4 A;  1LM8 B;  4AWJ A;  1WGR A;  3GOE A;  4KVG B;  4BFR A;  2FCN A;  3V62 A;  3TIX A;  1EUV B;  2EMT A;  1J19 A;  2HD5 B;  2MP2 A;  4GDL B;  3ZIM A;  4TQ1 A;  1WJN A;  4JL9 A;  2JZZ A;  2LUE A;  2M8S A;  2Z0E B;  3QK0 A;  4G50 A;  2J0K A;  5D6J B;  2K8B A;  2O2V B;  2BWE S;  3PV1 A;  1WF9 A;  4II3 B;  2N7D A;  2Z59 B;  4PS8 A;  4FA6 A;  4M0W B;  3A4S C;  2ZJD A;  5CHV C;  2KXJ A;  3C0R B;  2C9W B;  5LXI B;  5EDS A;  3VTV A;  1UBQ A;  2YVC A;  3NY5 A;  4PYU A;  1UGM A;  3RD2 A;  2JUO A;  1M94 A;  2RSU A;  1P98 A;  4ZRJ A;  1WIA A;  2NPT A;  3UGB B;  3APD A;  4LJO B;  2RPQ A;  5J18 A;  2DHZ A;  4ANU A;  4DDG D;  1V86 A;  2L00 B;  2LWP A;  3APF A;  4MJS A;  4NNJ B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...