1PQSA

Solution structure of the c-terminal opca domain of ycdc24p
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
77
structure length
77
Chain Sequence
SEIFTLLVEKVWNFDDLIMAINSKISNTHNNNISPITKIKYQDEDGDFVVLGSDEDWNVAKEMLAENNEKFLNIRLY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title The solution structure of an N-terminally truncated version of the yeast CDC24p PB1 domain shows a different beta-sheet topology.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Cell cycle
molecule keywords Cell division control protein 24
total genus 15
structure length 77
sequence length 77
ec nomenclature
pdb deposition date 2003-06-19
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 1pqsA00
2IY1B 4II3B 4BKTA 2NPTB 1E90A 5C23A 4NQLB 4EKUA 3B0AA 2KO3A 2ZVNA 4DDID 4AUQC 3ZO5B 5CHVC 3TCAA 3Q3FA 2KXJA 2A5UA 3V61A 4CYEA 4I6LB 1V5OA 1VD2A 4URKA 4B6WA 1RRBA 2KLGA 1KM7A 2MA9B 3TL5A 2EKEC 3JW0X 3W1YA 1U4AA 1QZEA 1LXDA 3UINB 2FCNA 3NOBA 2M4NA 3ZLZA 4G11A 2KJ6A 4IG7B 3DVNU 4HPMB 2WDTB 1TZ1A 3BINA 4KV2A 4MJSB 1Q5WB 4IM0A 2KJHB 2KFKB 4F1SA 3UGBB 3H7PA 2L0TA 2JF5A 2HJ8A 4AJYB 2K8CA 4HDOA 5D7GA 3A1QB 4GIVA 3APFA 4ANVA 2MSED 1WX7A 2D11A 3GZNI 3CF6E 1WXMA 3QA8A 1NDDA 2GBMA 3SHQA 3ENEA 3CMMB 5JH5C 2LJ5A 3DCGA 2BYFA 3ONSA 2L0FA 4MH0E 3B1LX 4FJYA 3A9KB 3KUDB 4ASWC 2LVQA 3QIJA 4W9EA 4WJQA 3TIXA 2OJRA 3R7RA 2PJHA 1WFYA 2DZIA 3L10B 4FULA 2A4ZA 3HHMA 4WJNA 2KHWB 2MX2A 4IUMB 3R7QA 4A20A 3VH3B 4DK5A 4MSMB 4BKSD 3QAQA 3PRPB 5JHBA 4JIOU 2LASA 3IHPC 3LDZE 2D10A 4W9JA 5JZEB 4BBNC 3VUXA 1IPGA 1R4MI 2QHOA 2Z0DB 5L95C 1OEYJ 1E7UA 3M95A 1UELA 4ANUA 1WR1A 1WGGA 3HM3A 4FLHA 5AZHA 2KMCA 2K39A 3VH4B 5G2NA 4E3CA 5DPWA 2AWTA 3UIOB 1V6EA 3ZIMA 2JVCA 3SD5A 3PT2B 2L76A 2CS4A 3EC8A 2NBVB 2KDFB 1RLFA 4EUTA 5D2MB 2DYOA 3L0WB 2Z59B 2ZPNA 2RD0A 5IAAC 3ZW3A 3PTFC 1J19A 2J0MA 3UQBA 3OJ3A 4AP4C 2IZVB 3RZFA 4K1RB 3A4RA 2PEAA 1L7YA 4B9KA 1WZ0A 2L00B 4MEMA 4DHZB 2MQJA 4ANXA 2M17A 2KWVB 4DHJD 2JXXA 3QK0A 2LVOA 4K7SA 4ANWA 3H9DA 4GGQA 3MHSD 5E6OA 4E71A 4TKNA 4GDKB 1SE9A 3H1UA 4EEWA 3U7DA 3VUWA 2L3ZA 1WMHB 2KVRA 4IW0A 1MG8A 4BKSA 2K8HA 2Y5BB 3EHVA 1WGRA 2KQ7A 3U8ZA 3M3JA 2O6VD 2C60A 5KHOA 2PE6B 3KVFB 4PS3A 3DOWA 3DQVA 4GDLA 3ZVVA 3V62A 1FXTB 3QJZA 2IO3B 3RUIB 1WM3A 3RYTA 3VXWA 3B08A 4W9GA 2FCSA 5DCNA 2V4LA 4KSKC 3APCA 5G55A 4WWPA 1YIWA 2DAFA 5D94A 5JHAA 2GOWA 3WALA 2GBRA 3EFUA 4EZJA 2FIFA 1WE7A 3H6NA 1RAXA 3PRMB 2CKHB 3EECA 1WGDA 3DBHI 3HIZA 2LRWA 2XK5A 4ICVA 5AZGA 4HXDA 4TQ1A 2DENB 4ZYNA 2PPHA 2KTRB 1P1AA 1SIFA 4KDIC 3H7PB 3C0RB 2KKCA 2JZ3B 2KJRA 4BBNF 1WJNA 2FNJB 4DWFA 4FN2A 4PYZA 1WM2A 2O2VA 1EUVB 2KK8A 3IBEA 3N3KB 4M8MA 1S3SG 2UYZB 2YLMA 4WWNA 2C7NB 3MTNB 4KZ0A 1ISNA 2KX0A 2NCNA 2D07B 1PQSA 3DVNV 4FJVB 4RM8A 4P7IA 3ZTCA 1J0GA 1GJZA 3DBRI 2N4FA 2FIDA 3TJPA 3VVWB 2L8JA 3A9JB 3A9KA 1WY8A 3DBSA 2DZKA 3JSVA 3PS6A 4HCPB 4LCDE 1T0YA 1Y8RC 1GC7A 2Z0EB 3K9OB 1WJ6A 3WA0A 3AI5A 2MP2A 3AU4A 4DHJB 2O6VA 3L17A 1YQBA 5KHQA 2EMSA 1LM8B 3PPAA 1V81A 3RULA 4G3XB 1R4NI 1SGHA 2MW5A 2KOXA 1EF5A 3MJWA 4IC7B 3AU5A 4BOSC 5LLIA 4NJ6A 4FA6A 1E8XA 1V86A 3JYUA 1LQBA 1GUAB 2K6QA 4CO7A 5FR6A 5C1ZA 3AULA 4N9F4 2N9EB 4PYUA 1C3TA 5J17A 3OLMD 4PS7A 1P3QU 5IA7A 2R2QA 1GNUA 3L16A 2G4DB 1ZGUB 4GN1A 4KDLB 1WE6A 1V2YA 3PHWB 5CHWA 3L54A 4EZLA 3ZNGC 2WX1A 3DDCB 2DAJA 2GBKA 4XC2A 1KJTA 2BWES 4A3OA 4K7WA 2HE7A 2J0JA 2LGXA 2IO2B 3PRZA 3ZNHB 4DBGA 2L05A 4TV3A 1WX8A 1WJ4A 2R2OA 4FBJB 4FHJA 4MGKE 2BKRB 5DPTA 1UZXB 1KLVA 4KZCA 3QWZB 1NBFC 2RGFA 2YVCA 2RPQA 1EO6A 4DDGD 4B95A 4DHZE 4LDTB 4MDKE 4CHKA 1I35A 2CHWA 5BO4B 4IM2A 2DHZA 3VAWA 3D32A 1AARA 1D3ZA 3IVFA 4NNJB 5TR5A 2I1JA 3TMPB 1G6JA 1WR6E 2HD5B 2VRRB 4W9CA 4NQKE 2JT4B 2C9WB 4AOFA 2FAZA 4WAAA 2KWUB 2KQSA 2N7DA 4G0NB 3LJ3A 4LJPB 2ZNVB 4MSQB 4WJOA 4XX5A 3V6CB 4WQOB 3L08A 1NI2A 4PS8A 3A33B 3SU8X 1WZ3A 2ZJDA 5LXIB 2FCMA 3RZWC 2KC2A 3V6EB 1H8CA 4MGYE 3PZDA 3QHTA 3W1SC 2CU1A 1VCBA 5HKHA 1YD8U 3PLVA 1I42A 4JL9A 4KIKA 2ZCCA 1TGZB 3DVGX 2CR5A 3QCAA 4NAWA 2JWZA 4MELA 4JLCA 1OQYA 2K6DB 3KYCD 2DYMA 1S1QB 1EF1A 2WWZA 2IO1B 2JPHA 2KDEB 1XQQA 3W1SA 1WYWB 4HCNB 3IG3A 2HTHA 1E8ZA 1P98A 1XD3B 1ZW7A 2OOBB 2LI5A 1IYFA 1TBEA 5CX3A 1WJUA 2KN5A 2LVPA 1E5WA 2FUHB 2MLBA 4LDTD 4WWOA 1KOTA 4I6PA 3ML9A 2JRHA 2KTFA 2G45B 2KANA 4IWOA 4BKGA 5E6PA 2NPTA 2ZZPB 3SDLC 1GC6A 3APDA 1A5RA 3L13A 2AEHA 2NBWB 2D3GA 3ML8A 2KD0A 5L83A 4W9IA 2NS5A 3VFKA 3N32A 2C7HA 4W9DA 5LXHA 2G4SA 4BFRA 5AEKB 2MBHA 3PVLA 4IM3A 1ZKHA 4GXBA 2N9XA 3JVZX 2RR9A 5AZFA 3A4SC 3V60A 3VTWA 4AWJA 4BVUC 4W9KA 3RCZA 2I1KA 3ZKJC 2BPSA 3ZDMC 3UQAA 2EMTA 1TTNA 5CHFA 1X1MA 1Q0WB 2BKFA 2JRIB 2NBUA 4F7ZA 2W9NA 3UF8A 1V49A 4J6IA 2MBBB 4KIKB 1JRUA 1UGMA 4EOYA 2PE9A 4W9HA 4HPLB 2NVUI 2AL3A 3ZDTA 4GDLB 4NAWB 3DPDA 2B3AA 2KDIA 2ZCBA 1OGWA 1WIAA 1BT0A 2ZNVC 2IBIB 2LXCA 3QARA 2KNBA 2BYEA 2KC1A 2M0XA 4TQ0A 1C1YB 3OAWA 4F8CB 3NHEB 2BWFA 1P0RA 2DX5B 3ZUNA 3PREA 2BGFA 2KDBA 2GBJA 3ZNZB 5EDSA 4JGHB 3ZNID 3GOEA 4M0WB 1L2NA 1XT9B 1OEYA 3R66C 1V9JA 3VTVA 2KLCA 2WYQA 4A3PA 3PV1A 2MBOA 3KYDD 3A9JA 4HWIB 2IY0B 3VUYA 4AJWA 4ZRIA 2V1YA 3PSEB 4ZRJA 4RM9A 3VQIA 2BF8B 1WMHA 3KUCB 4KVGB 3KUZA 1E8YA 1UBIA 3PLUA 3WAOA 2IO0B 4RMAA 1UBQA 2BYVE 3M63B 2MBQA 4NY0A 2MWSB 1K8RB 1UH6A 4GSWA 4IWPA 4MGIE 4JQWC 4XZ4A 1HE8A 2KX3A 3OJ4B 2L7RA 3HK0A 4K81A 2LWPA 4GOCA 4OVVA 3WANA 3X23A 2O6VB 1YX5B 3WAMA 1WRDB 1RFAA 1WF9A 3T8MA 5DPSA 2V3SA 3VHTC 1J8CA 3UIPB 4GMVA 1Z5SB 2C5LC 1UD7A 4LJOB 1WGYA 3QX1A 1E7VA 2CHZA 2LXAA 3O65B 3NZUA 3PHXB 4NJ7A 4BOZB 2DYBA 1P9DU 1YJ1A 1WGHA 3A1QA 4EFOA 1Z2MA 2K1FA 1WX9A 2CHXA 2N9PC 4M8NA 3VTUA 2MP2B 2LZ6A 2C7MB 2LRUA 2AL6A 2RSUA 4TUUA 2KFJA 2M8SA 1H4RA 4G50A 1WI0A 4ICUA 3IFWB 3X0WA 3ZRFA 5E6NA 1LFDA 3CSTA 4W9LA 2ZVOA 4HLEA 4I6NB 2JUOA 1V80A 2MCNB 3QQ8B 3HM6X 2ZPYA 4EZKA 4II2B 3P2BA 2GBNA 4FHKA 2JZZA 2XK5B 3DBLI 3K9PB 3NS8A 1IP9A 2JY6A 2K8BA 2DZMA 2MRPA 3N30A 2UWQA 3Q3JA 1YX6B 3H7SA 3I3TB 2J7QB 1WXSA 2DZJA 3CSFA 2KWCA 3KH0A 3WIMA 4GDKA 1OTRB 2XBBC 3R3MA 4W9FA 3TBLD 3U30A 2K25A 2G3QB 5J18A 4HDQA 1WXAA 4HK2A 2KTRA 1WXVA 1Q1OA 1V5TA 2XEWA 2LGDA 2LUEA 4GB9A 2FCQA 2M1MA 3ECIA 4FADA 4ZDVA 3RT3B 2KMAA 5J2RA 1E8WA 4IWQA 4DXAB 3PGEA 5GMVA 4ZRKA 3ALBA 1F9JA 4HVBA 4MM3A 2NR2A 2LGYA 2N1VA 3DVGY 2N7EA 3QC8B 3BY4B 2IYDB 2MBEA 2KZRA 3NY5A 2ASQA 2D2QA 3KW5B 1CMXB 3ZRCA 3JSVB 4GU2A 3RD2A 3AXCA 3WAPA 2WX0A 4WJPA 4X57B 3M62B 3S2AA 4FJZA 4KSLC 2LD9A 3NZSA 2AYOB 4MGZE 5CTRC 5D6JB 3ZTDA 1GG3A 1WH3A 4YL8A 3T9LA 2KFKA 2REXA 4NPNA 2ZEQA 5DPRA 2O2VB 4OVUA 2J0KA 4MJSA 4E74A 4K7UA 1M94A 2N1WA 4HJKA 3VDZA 2GMIC
chains in the Genus database with same CATH superfamily
4II3B 4BKTA 2NPTB 2G1EA 2KO3A 4OW0A 3NS1A 3ZO5B 4CYEA 4B6WA 3E9SA 1KM7A 3JW0X 1QZEA 1LXDA 2KJ6A 4IG7B 3KWVA 3BINA 3MC0B 4XGAB 3H7PA 4PK1A 2L0TA 4KX6B 1SF0A 2CJNA 4HDOA 3PZ8A 1IBXA 3QA8A 1NDDA 3SHQA 3ENEA 3N1YC 3DHGC 3A9KB 2WU5B 4A55A 3IT6B 2PJHA 2DZIA 4WJNA 2BQQA 1P7FA 4BKSD 2KDMA 2AQ1B 3N20C 2JWUA 4BBNC 2IGHA 1JWUD 1UELA 2YEPF 5AZHA 3VH4B 4E3CA 3LYYA 2GB1A 2AQ2B 2CS4A 1FIQA 3EUB2 3L0WB 2WXIA 2WXNA 1J19A 5EE1A 3Q2AC 4K1RB 4OZBA 2PEAA 1FNUA 2M17A 2KWVB 1K50A 3NVWA 3ZYYX 2PTLA 4GGQA 5E6OA 2WXFA 2EELA 1C77A 1V1PB 4BKSA 3PO0A 1LO5D 5D3DA 1DOIA 3IXSA 3ZVVA 2KVZA 4N58A 3QJZA 2IO3B 3VXWA 4KSKC 2OEDA 1C4PA 1YIWA 2ON8A 1YN4A 3N1XC 2CKHB 3EECA 3DBHI 3HIZA 2BS4B 2DENB 3KWLA 3T3OA 4IKGA 3AE8B 3C0RB 1RYJA 4LNKA 1F77A 3AE4B 1EUVB 2KK8A 3N3KB 4WWNA 4KZ0A 1SBBB 2KX0A 4FJVB 4RM8A 3DVNV 1GJZA 1TYGB 4P7IA 3TJPA 4C00A 4RF0A 3DBSA 2DZKA 3JSVA 4HCPB 1N60A 3EA6A 2G9HD 3K9OB 2MP2A 1WXQA 2INCC 1V81A 3RULA 4G3XB 1R4NI 4HKZE 2N9LA 3AU5A 1WGKA 3RNCC 5LLIA 1V86A 2BT6A 2I2YA 2V9HA 4PS7A 4ZRPA 4KDLB 1V2YA 3L54A 2DAJA 1KJTA 2J0JA 2N7JA 1I4PA 2JYTA 1WX8A 1FFUA 4FBJB 2WS3B 5DPTA 1XCQL 1UZXB 4YWGG 3NG0A 4DDGD 1MHXA 1I35A 3AE2B 1KTKA 1AARA 2WU2B 4ZRQA 5TR5A 4K3BA 3Q3OC 2JT4B 2C9WB 3N1ZC 4HROA 4AOFA 2FAZA 1C9FA 5IKCM 1TKEA 2KQSA 3V6CB 1A5RA 1FCCC 2ZNVB 3A33B 1DYQA 1WZ3A 2LEKA 5LXIB 2KC2A 3V6EB 3QHTA 2CU1A 4JE3B 1UUPA 3QCAA 4NAWA 1OQYA 3MHZA 1ZUD2 1V1PA 1HTOA 1F2RC 4WQMA 1ZOYB 3W1SA 4HCNB 2HTHA 1XD3B 2J4XA 1TY2A 1TBEA 2SEBD 5CX3A 2LVPA 2FUHB 2MLBA 4I6PA 2HJ1A 3ML9A 2JRHA 2KTFA 2G45B 4IWOA 4BKGA 2IPKD 5E6PA 1YQ3B 2VH2A 2ZZPB 3SDLC 3APDA 4ARCA 2NS5A 4W9DA 4XE0A 4BFRA 1SXTA 2MBHA 4S0RA 1TKYA 3PVLA 3RNBC 3JVZX 2RR9A 4D2KA 3A4SC 3V60A 3VTWA 2PVGC 3FKYA 3UQAA 1TTNA 2LJIA 1X1MA 2NBUA 4KIKB 1ET9A 1TIFA 3BYTB 2AL3A 1L0VB 3DPDA 2ZCBA 3I63C 1OGWA 2ZNVC 2IBIB 2KNBA 2BYEA 2M0XA 4L2YA 5H92C 2Z8LA 1P0RA 2DX5B 4EE2A 3Q6BA 2GBJA 3ZNID 4M0WB 5IOIA 2WXQA 1AYFA 4B0MA 3ETRA 3KYDD 4YXDB 1OFFA 2IY0B 4RNAA 2JXTA 3PSEB 5BMIA 3P4RB 2BF8B 3KUZA 4KGRA 1UBQA 2IDYA 3M63B 1ZXIA 3P4PB 3OJ4B 5C3JB 4K81A 5H8YE 4OVVA 2TSSA 1WRDB 1WF9A 2V3SA 1J8CA 4GMVA 2PW9A 2C5LC 4K3CA 1TS5A 2LXAA 3O65B 3NZUA 4NJ7A 1MG4A 4L23A 1VZ7A 1Z2MA 4OHJA 2K1FA 5G5HA 2C7MB 4AS1A 2KFJA 3X0WA 4H2AA 3CSTA 4KKIA 5BYRA 2JUOA 2MCNB 3VRAB 4II2B 3P2BA 2JZZA 1TS2A 1IP9A 1EM7A 3H7SA 4GDKA 1OTRB 2XBBC 2W54A 2CU3A 2K25A 2G3QB 4J3OD 1ZDXA 1JMLA 4HK2A 1Q1OA 1C4AA 2BB6A 1CZPA 3ECIA 3RT3B 1J7BA 5GMVA 1PFDA 3KLSX 4LK0M 2N1VA 2KWDA 3C19A 3BY4B 4ZYSA 2KYWA 2MBEA 2FE8A 2D2QA 3KW5B 3ZRCA 3AXCA 1NENB 3NRZA 4FJZA 3ZTDA 2AYOB 1GG3A 1MI0A 2KFKA 2M56B 2V3PA 4MJSA 1P3QU 2D5GA 2GMIC 2W55A 5C23A 4AUQC 5CHVC 1V5OA 3AEAB 1HTQA 1SE4A 1U4AA 3NOBA 2WXKA 1R7SA 4HPMB 4MJSB 1TZ1A 2SAKA 4P16A 2KJHB 2JF5A 2HJ8A 3A1QB 3APFA 4ANVA 3CF6E 3J9CA 3CMMB 5JH5C 1QT9A 2L0FA 2QC8A 2LVQA 3GP7A 5BYQA 3QIJA 3TIXA 2J42A 3HVZA 2OJRA 1AW7A 2DLBA 3URYA 2W82A 3V3XA 2BTEA 3L10B 3BYYB 2A4ZA 3HHMA 3MJ5A 2KHWB 1RFKA 2J52A 1V97A 2MX2A 4A20A 4MSMB 1JWAD 3PRPB 1JRPA 2D10A 2N0SB 3VUXA 2QHOA 3ZXVA 1ZXHA 1CQVA 4FLHA 1WGGA 4C4VB 3ZIMA 4USAA 3TSSA 1YN3A 3SD5A 5E6JA 5IP4D 2Z59B 1F2RI 2RD0A 2ZPNA 1FNVA 2J0MA 1D5ZC 4MM3B 4AP4C 3RZFA 4B9KA 1WZ0A 4MEMA 1MPEA 3U52E 4C80A 2E3TA 1T6BX 1L6VA 4BZAA 3H9DA 2IGGA 4GDKB 2QIEB 3U7DA 1BMLC 2L3ZA 1WMHB 2INNE 3EHVA 2KQ7A 3M3JA 2O6VD 5KHOA 1Q10A 3RUIB 3IAS1 1WM3A 2AQ3B 3DWGC 5BMGA 2FCSA 5DCNA 4TMAB 3APCA 4ACFA 4WWPA 1HA5A 3AECB 2LHEA 5D94A 1SJED 3ZJVA 2L32A 2GBRA 4YSYB 4HRSA 5AZGA 2KTRB 4US9A 1P1AA 3ZJTA 1FO4A 1GAQB 1XEEA 3TEXA 1JW9D 2UYZB 2C7NB 2D07B 4JX1C 1E6EB 1J0GA 2RDBC 1WY8A 1QF6A 3PS6A 2XNAC 1WJ6A 3AI5A 4M01A 2EMSA 4WWMA 3PPAA 3EFCA 2KOXA 3HRDD 3AE5B 4NJ6A 4FA6A 5C1ZA 4CO7A 1LQBA 1GUAB 1VLBA 2K6QA 1ROEA 1N63A 4PYUA 3RN9C 2QMTA 5IA7A 1GNUA 4GN1A 3FILB 3RNFC 1XLNA 2QSDA 4KKJA 3ZQ4A 3DDCB 2GBKA 3RNAC 2HE7A 1P7EA 3DHIC 2JU6X 1JWMD 1AWDA 2GLSA 4MGKE 2BKRB 2KT7A 4DXGA 3QWZB 1NBFC 2YVCA 2ACZB 1EO6A 4B95A 4DHZE 4MDKE 1HXYD 1TS4A 4IM2A 2DHZA 3VAWA 3D32A 1D3ZA 2HD5B 2MH7A 1IUEA 2W3SA 3AB5A 4WAAA 1L0YB 4MSQB 3P4SB 4RGMA 4WQOB 3SU8X 2ZJDA 2FCMA 3RZWC 4QAYA 1H8CA 4MGYE 1RWSA 3RFZB 5HKHA 2E6XA 2KACA 1TGZB 4MELA 4JLCA 2WXJA 1EF1A 2INPE 2WLBA 1OQQA 2IO1B 2JPHA 2KDEB 3BVGA 1FRRA 3IG3A 3P42A 1D4BA 2OOBB 1IYFA 3DBRB 4WWOA 1E5WA 4LDTD 2PKOA 4HJGE 1KOTA 3AMZA 2WNMA 4JWSC 2NPTA 1NEKB 1YJJA 1GC6A 2NBWB 2D3GA 2KD0A 2C7HA 5LXHA 5AEKB 1FRDA 2KN4A 2N9XA 2V3NA 3NVZA 1JWSD 2LMCA 3W5UB 4W9KA 3RCZA 1NYQA 3TUOA 5CHFA 2BKFA 2JRIB 4F7ZA 1V49A 4EOYA 1JRUA 1XLQA 4HPLB 2NVUI 3ZDTA 1WIAA 3QARA 2LXCA 5FKAC 2KC1A 3OAWA 3ZUNA 2BGFA 2FUG1 5G5GA 3B2FA 5EDSA 5HG2A 1L2NA 1XT9B 1SIJA 3R66C 1V9JA 4KGSA 2KLCA 2WYQA 1N62A 3SFDB 3A9JA 4AJWA 1D5XC 1F0ZA 3KUCB 1WMHA 1E8YA 2ZW0A 2MWSB 1K8RB 1UH6A 4GSWA 4IWPA 4MGIE 3FILA 1UWXA 3HK0A 4GOCA 4N6EB 1YX5B 3BZDB 3T8MA 3VHTC 3UIPB 3MFGA 1UGJA 1UD7A 4LJOB 1WGYA 3QX1A 2CHZA 1YJ1A 3AE9B 3LXFA 3A1QA 1WX9A 2N9PC 3AE3B 1J7AA 4G50A 1FXIA 3I57A 4LLGM 4HLEA 1FMAD 1MFWA 1N5WA 2ZPYA 4AQ7A 4O1NA 4FHKA 1J7CA 1XCTL 3K9PB 2DZMA 1JALA 2MRPA 1TT5B 2UWQA 5HI1A 1YX6B 2J7QB 3KH0A 4RGTA 4W9FA 1E9MA 3AE7B 1F1HA 1WXVA 2Y3AA 5AUKA 4GB9A 3PZ7A 2AX5A 2FCQA 2M1MA 4ZDVA 5J2RA 4DXAB 1CJEA 1HZ6A 3GE8C 3PGEA 2LFIA 1RM6C 2VZKD 3I5JC 4MM3A 4CQNA 2LGYA 2WXRA 2N7EA 1L4DB 2IYDB 4RFBA 1PDXA 2FBWB 1CMXB 4IOIE 2KQ4X 4X57B 3S2AA 2LD9A 5D6JB 2JZPA 3T9LA 4HPPA 5DPRA 3NVYA 1ZP0B 4K7UA 1M94A 3VDZA 3VR9B 4A8XC 2IY1B 2R61A 4NQLB 4EKUA 3B0AA 3H8HA 1PGBA 3TCAA 2KXJA 2A5UA 3V61A 4URKA 1VD2A 2KLGA 2MA9B 3TL5A 2EKEC 1B9RA 1QLBB 3UINB 2M4NA 3DVNU 1KF6B 1YMHE 4KV2A 2ONQA 4IDIA 2JYEA 4IM0A 1VRAB 2K8CA 4HKQA 1ZDVA 2K9XA 4GIVA 4P6VF 1WX7A 1L0XB 3GZNI 2BS3B 2GBMA 3DCGA 2BYFA 3ONSA 2WP9B 4MH0E 1FXAA 3Q8EA 3AEFB 2VZKB 3KUDB 3W2DA 4WJQA 1JWBD 2DBYA 1WFYA 4FULA 3R7QA 3VH3B 4DK5A 1VDVA 3QAQA 1IGDA 2LASA 1T5XD 3CIRB 3LDZE 4W9JA 5L95C 1E7UA 4ANUA 1IBXB 2K3UA 3I9V1 1WR1A 1MHHE 2KMCA 3RNGC 2AWTA 2L76A 3EC8A 3IT4B 2NBVB 1XO3A 2WHIA 5D2MB 2DYOA 4TSSA 1WRIA 5IAAC 4YSZB 1T0QC 3ZW3A 3PTFC 3UQBA 3OJ3A 1ENFA 1L7YA 2L00B 3AH7A 2QEJC 4DHZB 2MQJA 4LNOA 2KMMA 4MACA 2JXXA 3QK0A 2LVOA 4K7SA 2X38A 4EEWA 1SE9A 3VUWA 2KVRA 2LGIA 4IW0A 2K8HA 2LGSA 2Y5CA 1WGRA 2OJWA 3U8ZA 2C60A 2PE6B 1MVKA 1PGAA 3V62A 1UF0A 1FXTB 3E56A 2V4IB 1T0SC 2V4LA 2WQYB 2WXHA 4JPSA 5G55A 2DAFA 2H89B 5JHAA 1I4HA 4EZJA 1WE7A 2QJLA 3PRMB 4HXDA 4TQ1A 2PPHA 3H7PB 4US8A 2FNJB 4DWFA 4FN2A 4PYZA 4C4VA 4M8MA 2QCZA 3UI3A 1ISNA 2NCNA 3MP9A 1PQSA 3DBRI 4MT5A 3VVWB 2L8JA 1QQRA 1GC7A 3WA0A 2Q5WD 3AU4A 3U2SC 2O6VA 3L17A 1LM8B 1A70A 2CJOA 2MW5A 1EF5A 1R4MB 1E8XA 4RGOS 1VZ8A 5FR6A 3DBLB 5J17A 1N61A 2R2QA 3L16A 1KLGD 1ZE3D 2G4DB 1ZGUB 2W3RA 1WE6A 1GB4A 2HDEA 3PHWB 2LHDA 3W9CB 2WX1A 3ZNGC 4XC2A 4A3OA 4XYCA 2DNFA 3DWMA 2IO2B 3NJTA 3PRZA 1JCKB 2L05A 4LNIA 2R2OA 4FHJA 3TEYA 1KLVA 2BW2A 5IN7A 1GOZA 1DOYA 1XLOA 1YN5A 3IVFA 4NNJB 3TMPB 2MJDA 1FD6A 1WR6E 4W9CA 5T8IA 4NQKE 4RF1A 5GXGB 2MJEA 1FM0D 2WXOA 2KWUB 2N7DA 4WJOA 2QDFA 3L08A 3MC9A 1VCBA 1TS3A 3PLVA 4JL9A 5C2TB 4KIKA 2ZCCA 3DVGX 1QOAA 3P1MA 3KYCD 1VR9A 2WWZA 1C78A 1B1ZA 1WYWB 1E10A 2L1AA 1E8ZA 1QKZA 1P98A 1ZW7A 4YTNB 2JX5A 4M0WA 1WJUA 3OWEB 1TJEA 1QOFA 2WDQB 3BK2A 1HQRD 4REZA 4UDUC 2AEHA 1XLPA 3C8YA 3Q3NC 5L83A 3N32A 1ZKHA 4GXBA 2K5PA 4M00A 2I1KA 2BPSA 2WXPA 3ZDMC 1Q0WB 2W9NA 2MBBB 2PE9A 3AN1A 4NAWB 1F52A 3AE6B 4A6QA 3AEEB 2KDIA 1BT0A 4TQ0A 1C1YB 3R2IA 1KH0A 2BWFA 3NHEB 3RI7C 4P1CC 3ZNZB 4JGHB 3GOEA 2L52A 3NUHB 1FCLA 1EWYC 1OEYA 3SR6A 3VTVA 4A90A 4WAFA 3PV1A 4YT0B 4ZRIA 4RM9A 1VZ6A 3B9JA 3VQIA 5BYSA 1YQ4B 3WAOA 2IO0B 2MBQA 4NY0A 4ARIA 2N9KA 4JQWC 2KX3A 1DGJA 3X23A 1EU3A 2O6VB 3WAMA 1BUIC 1Z5SB 1FPYA 4N59A 1E7VA 2H88B 3PHXB 1FEHA 4BOZB 2DYBA 3GZNB 2V0GA 3V05A 1IGCA 4EFOA 2CHXA 3N9YC 4M8NA 3VTUA 2LZ6A 2LRUA 3BIID 2AL6A 4TUUA 4S17A 4PT5A 1H4RA 4C56C 4OZAA 1WI0A 4ICUA 3ZRFA 1NI3A 1C4CA 4ZHOA 4R3DA 2WDVB 2XK5B 1T0RC 3DBLI 2JY6A 1I4QA 2K8BA 3AV8A 2WDRB 3RPFC 1WXSA 1YNTE 2KWCA 3WIMA 1AN8A 3TBLD 3U30A 5J18A 1WXAA 2KTRA 1V5TA 2LGDA 5FR3A 1KRHA 2BS2B 1E8WA 1ACCA 2WGSA 4ZRKA 1F9JA 2VH1A 1TZOA 2DWQA 3DVGY 3QC8B 3U7ZA 1XXGA 4HEA1 3NY5A 4LNFA 2KZRA 2OHFA 2PMVA 4GU2A 3RD2A 2WX0A 2WXLA 2X8XX 3AEGB 3W5VB 3M62B 4KSLC 1XF5L 4MGZE 4YTPB 3FAHA 1WSPA 4YL8A 3ABVB 1GB1A 4NPNA 1DOXA 2O2VB 4E74A 1NVID 5BMHA 3R8BA 1E90A 2ZVNA 1VJKA 4DDID 3Q3FA 4I6LB 1RRBA 3W1YA 1D6EC 2FCNA 4XWTA 3ZLZA 3OG5A 4G11A 4ITKA 1K51A 2WDTB 1Q5WB 2KFKB 4F1SA 3UGBB 2INDC 1NYRA 4AJYB 3R2TA 5D7GA 4NJCA 2D11A 2MSED 1WXMA 2LJ5A 3BVZA 4JWUC 3B1LX 4FJYA 5LNK1 4ASWC 2YEPB 4W9EA 3R7RA 1R4NB 3AM9A 2I38A 4IUMB 2M19A 5JHBA 4JIOU 4RH6A 5JZEB 4NZLB 1IPGA 1R4MI 3AEBB 1I4RA 4XDCA 2Z0DB 1OEYJ 3M95A 1OQRA 2RDGA 3HM3A 3RNEC 2K39A 3Q14C 5G2NA 5DPWA 3UIOB 1V6EA 4YSXB 2JVCA 3PT2B 2KDFB 1RLFA 4EUTA 5HFYA 3NZ3A 3VRBB 3MC8A 2IZVB 3A4RA 3EGRA 3ZXRA 4LNNA 4B0EA 4ANXA 4DHJD 1K52A 1PGXA 4ANWA 3MHSD 2MEKA 3Q69A 4ZOHC 4E71A 4TKNA 3H1UA 3WCQA 1WWTA 1SE2A 4MH8A 1C76A 1MG8A 2Y5BB 2ZW1A 3U4EG 3L4PA 3KVFB 4PS3A 3DOWA 3DQVA 4GDLA 3RYTA 3B08A 1SEBD 4W9GA 3ZGZA 4ZHPA 4RGNA 3Q8AA 2GOWA 3WALA 3EFUA 2RDHA 2FIFA 3H6NA 1RAXA 1WGDA 3BVMA 2LRWA 2XK5A 4ICVA 4ZYNA 1SIFA 4KDIC 2KKCA 2JZ3B 2KJRA 4M02A 1WJNA 5EE0A 1CK1A 4BBNF 3SFEB 1WM2A 2O2VA 3IBEA 1S3SG 2YLMA 3MTNB 3ZTCA 2N4FA 2FIDA 1SSNA 5IO9A 3A9JB 2J53A 3A9KA 1FFVA 5TSSA 4LCDE 3Q8FA 2K22A 1T0YA 1Y8RC 2Z0EB 4DHJB 1YQBA 5KHQA 4YTMB 2GI9A 1KFYB 1SGHA 3MJWA 4IC7B 4DXFA 1UNSA 4BOSC 3JYUA 3AULA 4N9F4 3Q8BA 2N9EB 4DQOC 1C3TA 3OLMD 2RPVA 4KGTA 2BB5A 5D3IB 4EZLA 5CHWA 3GS2A 2BWES 4XWWA 2D3CA 1N6ZA 4K7WA 2LGXA 3ZNHB 1FNWA 4DBGA 1QOGA 1C79A 4TV3A 1WJ4A 3GB1A 3HVDA 1EU4A 1ZPSA 4KZCA 2XN9C 2RGFA 1HZ5A 2IGDA 1E7PB 2RPQA 1E0ZA 4LDTB 4CHKA 3BK1A 2CHWA 5BO4B 1KLUD 2I1JA 1G6JA 4LTUA 2VRRB 1UWMA 2UU7A 1T3QA 1K53A 1SE3A 4XX5A 4G0NB 3LJ3A 4LJPB 4BAXA 1NI2A 4PS8A 5AUIA 2D3AA 4OVZA 1V8CA 2L83A 4XDDA 3PZDA 1D5MC 3KQ4A 3AEDB 3W1SC 1STEA 1YD8U 4L1BA 1I42A 1M4VA 4C7YA 3DHHC 2CR5A 3CWIA 2JWZA 2WXMA 2K6DB 2JQRB 2DYMA 2PVOD 1S1QB 1PUTA 1XQQA 2QILA 5EE3A 1TKGA 2LI5A 1Y56A 2JSVX 2KN5A 3BWUD 2KANA 1ESFA 2KAJA 3L13A 3ML8A 4WURA 1HEZE 1EWCA 4W9IA 1I7HA 3VFKA 2G4SA 1I4XA 1QILA 4IM3A 3AE1B 5AZFA 1QOBA 4AWJA 4BVUC 5MPOA 3ZKJC 2EMTA 3UF8A 3P63A 4J6IA 1UGMA 4W9HA 4GDLB 2B3AA 1WYGA 4WH4A 4F8CB 1JROA 1L4ZB 1TY0A 1MJDA 2NTSA 3PREA 2PIAA 2KDBA 3B2GA 2B76B 1LGRA 2EKIA 4A3PA 2MBOA 4C7ZA 4Q2JA 4HWIB 2NTTA 3GE3C 3VUYA 2BBCA 2V1YA 4ZRJA 4KVGB 1L5PA 3HUIA 1UBIA 3PLUA 4RMAA 2BYVE 1L6UA 3Q3MC 1YOVB 4XZ4A 1HE8A 2L7RA 2LWPA 4WIPA 3WANA 3FC4A 1PYWD 1RFAA 5DPSA 1BXTA 3LB8C 3VR8B 3T3NA 5JXVA 2GRIA 3DBHB 2WXGA 3IAM1 2ICIA 1P9DU 1WGHA 4RCOA 2HTME 4P1BC 2MP2B 2RSUA 5EE9A 1N5XA 2M8SA 3IFWB 5E6NA 1LFDA 4W9LA 2ZVOA 4I6NB 1V80A 2K0PA 3QQ8B 3HM6X 4EZKA 5HHDG 4A9AA 3SEBA 2GBNA 3NS8A 3RMKC 1SJHD 1SB3C 3N30A 3Q3JA 3I3TB 3CSFA 2DZJA 2IJ0A 3R3MA 1JQ4A 2D3BA 3P4QB 4HDQA 3TEZA 2LUMA 2XEWA 2LUEA 2MJ3A 4FADA 2KMAA 4IWQA 2RMMA 4NAMA 1V1OA 3ALBA 1I4GA 4HVBA 2BYTA 2Y5PA 2NR2A 5FK9C 2BVCA 2NMQA 4GLSC 1GPXA 3Q8CA 2ASQA 3ZJUA 4OZCA 1YJIA 4FXCA 3NVVA 3JSVB 2PLPA 3WAPA 4WJPA 5CTRC 3NZSA 3TEWA 1WH3A 2REXA 2ZEQA 5I4DA 4OVUA 1ET6A 2J0KA 3O13A 2MHJA 2N1WA 4HJKA 2M0AA 3IHPC
chains in the Genus database with same CATH topology
2IY1B 4II3B 4BKTA 2NPTB 1E90A 5C23A 4NQLB 4EKUA 3B0AA 2KO3A 2ZVNA 4DDID 4AUQC 3ZO5B 5CHVC 3TCAA 3Q3FA 2KXJA 2A5UA 3V61A 4CYEA 4I6LB 1V5OA 1VD2A 4URKA 4B6WA 1RRBA 2KLGA 1KM7A 2MA9B 3TL5A 2EKEC 3JW0X 3W1YA 1U4AA 1QZEA 1LXDA 3UINB 2FCNA 3NOBA 2M4NA 3ZLZA 4G11A 2KJ6A 4IG7B 3DVNU 4HPMB 2WDTB 1TZ1A 3BINA 4KV2A 4MJSB 1Q5WB 4IM0A 2KJHB 2KFKB 4F1SA 3UGBB 3H7PA 2L0TA 2JF5A 2HJ8A 4AJYB 2K8CA 4HDOA 5D7GA 3A1QB 4GIVA 3APFA 4ANVA 2MSED 1WX7A 2D11A 3GZNI 3CF6E 1WXMA 3QA8A 1NDDA 2GBMA 3SHQA 3ENEA 3CMMB 5JH5C 2LJ5A 3DCGA 2BYFA 3ONSA 2L0FA 4MH0E 3B1LX 4FJYA 3A9KB 3KUDB 4ASWC 2LVQA 3QIJA 4W9EA 4WJQA 3TIXA 2OJRA 3R7RA 2PJHA 1WFYA 2DZIA 3L10B 4FULA 2A4ZA 3HHMA 4WJNA 2KHWB 2MX2A 4IUMB 3R7QA 4A20A 3VH3B 4DK5A 4MSMB 4BKSD 3QAQA 3PRPB 5JHBA 4JIOU 2LASA 3IHPC 3LDZE 2D10A 4W9JA 5JZEB 4BBNC 3VUXA 1IPGA 1R4MI 2QHOA 2Z0DB 5L95C 1OEYJ 1E7UA 3M95A 1UELA 4ANUA 1WR1A 1WGGA 3HM3A 4FLHA 5AZHA 2KMCA 2K39A 3VH4B 5G2NA 4E3CA 5DPWA 2AWTA 3UIOB 1V6EA 3ZIMA 2JVCA 3SD5A 3PT2B 2L76A 2CS4A 3EC8A 2NBVB 2KDFB 1RLFA 4EUTA 5D2MB 2DYOA 3L0WB 2Z59B 2ZPNA 2RD0A 5IAAC 3ZW3A 3PTFC 1J19A 2J0MA 3UQBA 3OJ3A 4AP4C 2IZVB 3RZFA 4K1RB 3A4RA 2PEAA 1L7YA 4B9KA 1WZ0A 2L00B 4MEMA 4DHZB 2MQJA 4ANXA 2M17A 2KWVB 4DHJD 2JXXA 3QK0A 2LVOA 4K7SA 4ANWA 3H9DA 4GGQA 3MHSD 5E6OA 4E71A 4TKNA 4GDKB 1SE9A 3H1UA 4EEWA 3U7DA 3VUWA 2L3ZA 1WMHB 2KVRA 4IW0A 1MG8A 4BKSA 2K8HA 2Y5BB 3EHVA 1WGRA 2KQ7A 3U8ZA 3M3JA 2O6VD 2C60A 5KHOA 2PE6B 3KVFB 4PS3A 3DOWA 3DQVA 4GDLA 3ZVVA 3V62A 1FXTB 3QJZA 2IO3B 3RUIB 1WM3A 3RYTA 3VXWA 3B08A 4W9GA 2FCSA 5DCNA 2V4LA 4KSKC 3APCA 5G55A 4WWPA 1YIWA 2DAFA 5D94A 5JHAA 2GOWA 3WALA 2GBRA 3EFUA 4EZJA 2FIFA 1WE7A 3H6NA 1RAXA 3PRMB 2CKHB 3EECA 1WGDA 3DBHI 3HIZA 2LRWA 2XK5A 4ICVA 5AZGA 4HXDA 4TQ1A 2DENB 4ZYNA 2PPHA 2KTRB 1P1AA 1SIFA 4KDIC 3H7PB 3C0RB 2KKCA 2JZ3B 2KJRA 4BBNF 1WJNA 2FNJB 4DWFA 4FN2A 4PYZA 1WM2A 2O2VA 1EUVB 2KK8A 3IBEA 3N3KB 4M8MA 1S3SG 2UYZB 2YLMA 4WWNA 2C7NB 3MTNB 4KZ0A 1ISNA 2KX0A 2NCNA 2D07B 1PQSA 3DVNV 4FJVB 4RM8A 4P7IA 3ZTCA 1J0GA 1GJZA 3DBRI 2N4FA 2FIDA 3TJPA 3VVWB 2L8JA 3A9JB 3A9KA 1WY8A 3DBSA 2DZKA 3JSVA 3PS6A 4HCPB 4LCDE 1T0YA 1Y8RC 1GC7A 2Z0EB 3K9OB 1WJ6A 3WA0A 3AI5A 2MP2A 3AU4A 4DHJB 2O6VA 3L17A 1YQBA 5KHQA 2EMSA 1LM8B 3PPAA 1V81A 3RULA 4G3XB 1R4NI 1SGHA 2MW5A 2KOXA 1EF5A 3MJWA 4IC7B 3AU5A 4BOSC 5LLIA 4NJ6A 4FA6A 1E8XA 1V86A 3JYUA 1LQBA 1GUAB 2K6QA 4CO7A 5FR6A 5C1ZA 3AULA 4N9F4 2N9EB 4PYUA 1C3TA 5J17A 3OLMD 4PS7A 1P3QU 5IA7A 2R2QA 1GNUA 3L16A 2G4DB 1ZGUB 4GN1A 4KDLB 1WE6A 1V2YA 3PHWB 5CHWA 3L54A 4EZLA 3ZNGC 2WX1A 3DDCB 2DAJA 2GBKA 4XC2A 1KJTA 2BWES 4A3OA 4K7WA 2HE7A 2J0JA 2LGXA 2IO2B 3PRZA 3ZNHB 4DBGA 2L05A 4TV3A 1WX8A 1WJ4A 2R2OA 4FBJB 4FHJA 4MGKE 2BKRB 5DPTA 1UZXB 1KLVA 4KZCA 3QWZB 1NBFC 2RGFA 2YVCA 2RPQA 1EO6A 4DDGD 4B95A 4DHZE 4LDTB 4MDKE 4CHKA 1I35A 2CHWA 5BO4B 4IM2A 2DHZA 3VAWA 3D32A 1AARA 1D3ZA 3IVFA 4NNJB 5TR5A 2I1JA 3TMPB 1G6JA 1WR6E 2HD5B 2VRRB 4W9CA 4NQKE 2JT4B 2C9WB 4AOFA 2FAZA 4WAAA 2KWUB 2KQSA 2N7DA 4G0NB 3LJ3A 4LJPB 2ZNVB 4MSQB 4WJOA 4XX5A 3V6CB 4WQOB 3L08A 1NI2A 4PS8A 3A33B 3SU8X 1WZ3A 2ZJDA 5LXIB 2FCMA 3RZWC 2KC2A 3V6EB 1H8CA 4MGYE 3PZDA 3QHTA 3W1SC 2CU1A 1VCBA 5HKHA 1YD8U 3PLVA 1I42A 4JL9A 4KIKA 2ZCCA 1TGZB 3DVGX 2CR5A 3QCAA 4NAWA 2JWZA 4MELA 4JLCA 1OQYA 2K6DB 3KYCD 2DYMA 1S1QB 1EF1A 2WWZA 2IO1B 2JPHA 2KDEB 1XQQA 3W1SA 1WYWB 4HCNB 3IG3A 2HTHA 1E8ZA 1P98A 1XD3B 1ZW7A 2OOBB 2LI5A 1IYFA 1TBEA 5CX3A 1WJUA 2KN5A 2LVPA 1E5WA 2FUHB 2MLBA 4LDTD 4WWOA 1KOTA 4I6PA 3ML9A 2JRHA 2KTFA 2G45B 2KANA 4IWOA 4BKGA 5E6PA 2NPTA 2ZZPB 3SDLC 1GC6A 3APDA 1A5RA 3L13A 2AEHA 2NBWB 2D3GA 3ML8A 2KD0A 5L83A 4W9IA 2NS5A 3VFKA 3N32A 2C7HA 4W9DA 5LXHA 2G4SA 4BFRA 5AEKB 2MBHA 3PVLA 4IM3A 1ZKHA 4GXBA 2N9XA 3JVZX 2RR9A 5AZFA 3A4SC 3V60A 3VTWA 4AWJA 4BVUC 4W9KA 3RCZA 2I1KA 3ZKJC 2BPSA 3ZDMC 3UQAA 2EMTA 1TTNA 5CHFA 1X1MA 1Q0WB 2BKFA 2JRIB 2NBUA 4F7ZA 2W9NA 3UF8A 1V49A 4J6IA 2MBBB 4KIKB 1JRUA 1UGMA 4EOYA 2PE9A 4W9HA 4HPLB 2NVUI 2AL3A 3ZDTA 4GDLB 4NAWB 3DPDA 2B3AA 2KDIA 2ZCBA 1OGWA 1WIAA 1BT0A 2ZNVC 2IBIB 2LXCA 3QARA 2KNBA 2BYEA 2KC1A 2M0XA 4TQ0A 1C1YB 3OAWA 4F8CB 3NHEB 2BWFA 1P0RA 2DX5B 3ZUNA 3PREA 2BGFA 2KDBA 2GBJA 3ZNZB 5EDSA 4JGHB 3ZNID 3GOEA 4M0WB 1L2NA 1XT9B 1OEYA 3R66C 1V9JA 3VTVA 2KLCA 2WYQA 4A3PA 3PV1A 2MBOA 3KYDD 3A9JA 4HWIB 2IY0B 3VUYA 4AJWA 4ZRIA 2V1YA 3PSEB 4ZRJA 4RM9A 3VQIA 2BF8B 1WMHA 3KUCB 4KVGB 3KUZA 1E8YA 1UBIA 3PLUA 3WAOA 2IO0B 4RMAA 1UBQA 2BYVE 3M63B 2MBQA 4NY0A 2MWSB 1K8RB 1UH6A 4GSWA 4IWPA 4MGIE 4JQWC 4XZ4A 1HE8A 2KX3A 3OJ4B 2L7RA 3HK0A 4K81A 2LWPA 4GOCA 4OVVA 3WANA 3X23A 2O6VB 1YX5B 3WAMA 1WRDB 1RFAA 1WF9A 3T8MA 5DPSA 2V3SA 3VHTC 1J8CA 3UIPB 4GMVA 1Z5SB 2C5LC 1UD7A 4LJOB 1WGYA 3QX1A 1E7VA 2CHZA 2LXAA 3O65B 3NZUA 3PHXB 4NJ7A 4BOZB 2DYBA 1P9DU 1YJ1A 1WGHA 3A1QA 4EFOA 1Z2MA 2K1FA 1WX9A 2CHXA 2N9PC 4M8NA 3VTUA 2MP2B 2LZ6A 2C7MB 2LRUA 2AL6A 2RSUA 4TUUA 2KFJA 2M8SA 1H4RA 4G50A 1WI0A 4ICUA 3IFWB 3X0WA 3ZRFA 5E6NA 1LFDA 3CSTA 4W9LA 2ZVOA 4HLEA 4I6NB 2JUOA 1V80A 2MCNB 3QQ8B 3HM6X 2ZPYA 4EZKA 4II2B 3P2BA 2GBNA 4FHKA 2JZZA 2XK5B 3DBLI 3K9PB 3NS8A 1IP9A 2JY6A 2K8BA 2DZMA 2MRPA 3N30A 2UWQA 3Q3JA 1YX6B 3H7SA 3I3TB 2J7QB 1WXSA 2DZJA 3CSFA 2KWCA 3KH0A 3WIMA 4GDKA 1OTRB 2XBBC 3R3MA 4W9FA 3TBLD 3U30A 2K25A 2G3QB 5J18A 4HDQA 1WXAA 4HK2A 2KTRA 1WXVA 1Q1OA 1V5TA 2XEWA 2LGDA 2LUEA 4GB9A 2FCQA 2M1MA 3ECIA 4FADA 4ZDVA 3RT3B 2KMAA 5J2RA 1E8WA 4IWQA 4DXAB 3PGEA 5GMVA 4ZRKA 3ALBA 1F9JA 4HVBA 4MM3A 2NR2A 2LGYA 2N1VA 3DVGY 2N7EA 3QC8B 3BY4B 2IYDB 2MBEA 2KZRA 3NY5A 2ASQA 2D2QA 3KW5B 1CMXB 3ZRCA 3JSVB 4GU2A 3RD2A 3AXCA 3WAPA 2WX0A 4WJPA 4X57B 3M62B 3S2AA 4FJZA 4KSLC 2LD9A 3NZSA 2AYOB 4MGZE 5CTRC 5D6JB 3ZTDA 1GG3A 1WH3A 4YL8A 3T9LA 2KFKA 2REXA 4NPNA 2ZEQA 5DPRA 2O2VB 4OVUA 2J0KA 4MJSA 4E74A 4K7UA 1M94A 2N1WA 4HJKA 3VDZA 2GMIC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2IY1 B;  4II3 B;  4BKT A;  2NPT B;  1E90 A;  5C23 A;  4NQL B;  4EKU A;  3B0A A;  2KO3 A;  2ZVN A;  4DDI D;  4AUQ C;  3ZO5 B;  5CHV C;  3TCA A;  3Q3F A;  2KXJ A;  2A5U A;  3V61 A;  4CYE A;  4I6L B;  1V5O A;  1VD2 A;  4URK A;  4B6W A;  1RRB A;  2KLG A;  1KM7 A;  2MA9 B;  3TL5 A;  2EKE C;  3JW0 X;  3W1Y A;  1U4A A;  1QZE A;  1LXD A;  3UIN B;  2FCN A;  3NOB A;  2M4N A;  3ZLZ A;  4G11 A;  2KJ6 A;  4IG7 B;  3DVN U;  4HPM B;  2WDT B;  1TZ1 A;  3BIN A;  4KV2 A;  4MJS B;  1Q5W B;  4IM0 A;  2KJH B;  2KFK B;  4F1S A;  3UGB B;  3H7P A;  2L0T A;  2JF5 A;  2HJ8 A;  4AJY B;  2K8C A;  4HDO A;  5D7G A;  3A1Q B;  4GIV A;  3APF A;  4ANV A;  2MSE D;  1WX7 A;  2D11 A;  3GZN I;  3CF6 E;  1WXM A;  3QA8 A;  1NDD A;  2GBM A;  3SHQ A;  3ENE A;  3CMM B;  5JH5 C;  2LJ5 A;  3DCG A;  2BYF A;  3ONS A;  2L0F A;  4MH0 E;  3B1L X;  4FJY A;  3A9K B;  3KUD B;  4ASW C;  2LVQ A;  3QIJ A;  4W9E A;  4WJQ A;  3TIX A;  2OJR A;  3R7R A;  2PJH A;  1WFY A;  2DZI A;  3L10 B;  4FUL A;  2A4Z A;  3HHM A;  4WJN A;  2KHW B;  2MX2 A;  4IUM B;  3R7Q A;  4A20 A;  3VH3 B;  4DK5 A;  4MSM B;  4BKS D;  3QAQ A;  3PRP B;  5JHB A;  4JIO U;  2LAS A;  3IHP C;  3LDZ E;  2D10 A;  4W9J A;  5JZE B;  4BBN C;  3VUX A;  1IPG A;  1R4M I;  2QHO A;  2Z0D B;  5L95 C;  1OEY J;  1E7U A;  3M95 A;  1UEL A;  4ANU A;  1WR1 A;  1WGG A;  3HM3 A;  4FLH A;  5AZH A;  2KMC A;  2K39 A;  3VH4 B;  5G2N A;  4E3C A;  5DPW A;  2AWT A;  3UIO B;  1V6E A;  3ZIM A;  2JVC A;  3SD5 A;  3PT2 B;  2L76 A;  2CS4 A;  3EC8 A;  2NBV B;  2KDF B;  1RLF A;  4EUT A;  5D2M B;  2DYO A;  3L0W B;  2Z59 B;  2ZPN A;  2RD0 A;  5IAA C;  3ZW3 A;  3PTF C;  1J19 A;  2J0M A;  3UQB A;  3OJ3 A;  4AP4 C;  2IZV B;  3RZF A;  4K1R B;  3A4R A;  2PEA A;  1L7Y A;  4B9K A;  1WZ0 A;  2L00 B;  4MEM A;  4DHZ B;  2MQJ A;  4ANX A;  2M17 A;  2KWV B;  4DHJ D;  2JXX A;  3QK0 A;  2LVO A;  4K7S A;  4ANW A;  3H9D A;  4GGQ A;  3MHS D;  5E6O A;  4E71 A;  4TKN A;  4GDK B;  1SE9 A;  3H1U A;  4EEW A;  3U7D A;  3VUW A;  2L3Z A;  1WMH B;  2KVR A;  4IW0 A;  1MG8 A;  4BKS A;  2K8H A;  2Y5B B;  3EHV A;  1WGR A;  2KQ7 A;  3U8Z A;  3M3J A;  2O6V D;  2C60 A;  5KHO A;  2PE6 B;  3KVF B;  4PS3 A;  3DOW A;  3DQV A;  4GDL A;  3ZVV A;  3V62 A;  1FXT B;  3QJZ A;  2IO3 B;  3RUI B;  1WM3 A;  3RYT A;  3VXW A;  3B08 A;  4W9G A;  2FCS A;  5DCN A;  2V4L A;  4KSK C;  3APC A;  5G55 A;  4WWP A;  1YIW A;  2DAF A;  5D94 A;  5JHA A;  2GOW A;  3WAL A;  2GBR A;  3EFU A;  4EZJ A;  2FIF A;  1WE7 A;  3H6N A;  1RAX A;  3PRM B;  2CKH B;  3EEC A;  1WGD A;  3DBH I;  3HIZ A;  2LRW A;  2XK5 A;  4ICV A;  5AZG A;  4HXD A;  4TQ1 A;  2DEN B;  4ZYN A;  2PPH A;  2KTR B;  1P1A A;  1SIF A;  4KDI C;  3H7P B;  3C0R B;  2KKC A;  2JZ3 B;  2KJR A;  4BBN F;  1WJN A;  2FNJ B;  4DWF A;  4FN2 A;  4PYZ A;  1WM2 A;  2O2V A;  1EUV B;  2KK8 A;  3IBE A;  3N3K B;  4M8M A;  1S3S G;  2UYZ B;  2YLM A;  4WWN A;  2C7N B;  3MTN B;  4KZ0 A;  1ISN A;  2KX0 A;  2NCN A;  2D07 B;  1PQS A;  3DVN V;  4FJV B;  4RM8 A;  4P7I A;  3ZTC A;  1J0G A;  1GJZ A;  3DBR I;  2N4F A;  2FID A;  3TJP A;  3VVW B;  2L8J A;  3A9J B;  3A9K A;  1WY8 A;  3DBS A;  2DZK A;  3JSV A;  3PS6 A;  4HCP B;  4LCD E;  1T0Y A;  1Y8R C;  1GC7 A;  2Z0E B;  3K9O B;  1WJ6 A;  3WA0 A;  3AI5 A;  2MP2 A;  3AU4 A;  4DHJ B;  2O6V A;  3L17 A;  1YQB A;  5KHQ A;  2EMS A;  1LM8 B;  3PPA A;  1V81 A;  3RUL A;  4G3X B;  1R4N I;  1SGH A;  2MW5 A;  2KOX A;  1EF5 A;  3MJW A;  4IC7 B;  3AU5 A;  4BOS C;  5LLI A;  4NJ6 A;  4FA6 A;  1E8X A;  1V86 A;  3JYU A;  1LQB A;  1GUA B;  2K6Q A;  4CO7 A;  5FR6 A;  5C1Z A;  3AUL A;  4N9F 4;  2N9E B;  4PYU A;  1C3T A;  5J17 A;  3OLM D;  4PS7 A;  1P3Q U;  5IA7 A;  2R2Q A;  1GNU A;  3L16 A;  2G4D B;  1ZGU B;  4GN1 A;  4KDL B;  1WE6 A;  1V2Y A;  3PHW B;  5CHW A;  3L54 A;  4EZL A;  3ZNG C;  2WX1 A;  3DDC B;  2DAJ A;  2GBK A;  4XC2 A;  1KJT A;  2BWE S;  4A3O A;  4K7W A;  2HE7 A;  2J0J A;  2LGX A;  2IO2 B;  3PRZ A;  3ZNH B;  4DBG A;  2L05 A;  4TV3 A;  1WX8 A;  1WJ4 A;  2R2O A;  4FBJ B;  4FHJ A;  4MGK E;  2BKR B;  5DPT A;  1UZX B;  1KLV A;  4KZC A;  3QWZ B;  1NBF C;  2RGF A;  2YVC A;  2RPQ A;  1EO6 A;  4DDG D;  4B95 A;  4DHZ E;  4LDT B;  4MDK E;  4CHK A;  1I35 A;  2CHW A;  5BO4 B;  4IM2 A;  2DHZ A;  3VAW A;  3D32 A;  1AAR A;  1D3Z A;  3IVF A;  4NNJ B;  5TR5 A;  2I1J A;  3TMP B;  1G6J A;  1WR6 E;  2HD5 B;  2VRR B;  4W9C A;  4NQK E;  2JT4 B;  2C9W B;  4AOF A;  2FAZ A;  4WAA A;  2KWU B;  2KQS A;  2N7D A;  4G0N B;  3LJ3 A;  4LJP B;  2ZNV B;  4MSQ B;  4WJO A;  4XX5 A;  3V6C B;  4WQO B;  3L08 A;  1NI2 A;  4PS8 A;  3A33 B;  3SU8 X;  1WZ3 A;  2ZJD A;  5LXI B;  2FCM A;  3RZW C;  2KC2 A;  3V6E B;  1H8C A;  4MGY E;  3PZD A;  3QHT A;  3W1S C;  2CU1 A;  1VCB A;  5HKH A;  1YD8 U;  3PLV A;  1I42 A;  4JL9 A;  4KIK A;  2ZCC A;  1TGZ B;  3DVG X;  2CR5 A;  3QCA A;  4NAW A;  2JWZ A;  4MEL A;  4JLC A;  1OQY A;  2K6D B;  3KYC D;  2DYM A;  1S1Q B;  1EF1 A;  2WWZ A;  2IO1 B;  2JPH A;  2KDE B;  1XQQ A;  3W1S A;  1WYW B;  4HCN B;  3IG3 A;  2HTH A;  1E8Z A;  1P98 A;  1XD3 B;  1ZW7 A;  2OOB B;  2LI5 A;  1IYF A;  1TBE A;  5CX3 A;  1WJU A;  2KN5 A;  2LVP A;  1E5W A;  2FUH B;  2MLB A;  4LDT D;  4WWO A;  1KOT A;  4I6P A;  3ML9 A;  2JRH A;  2KTF A;  2G45 B;  2KAN A;  4IWO A;  4BKG A;  5E6P A;  2NPT A;  2ZZP B;  3SDL C;  1GC6 A;  3APD A;  1A5R A;  3L13 A;  2AEH A;  2NBW B;  2D3G A;  3ML8 A;  2KD0 A;  5L83 A;  4W9I A;  2NS5 A;  3VFK A;  3N32 A;  2C7H A;  4W9D A;  5LXH A;  2G4S A;  4BFR A;  5AEK B;  2MBH A;  3PVL A;  4IM3 A;  1ZKH A;  4GXB A;  2N9X A;  3JVZ X;  2RR9 A;  5AZF A;  3A4S C;  3V60 A;  3VTW A;  4AWJ A;  4BVU C;  4W9K A;  3RCZ A;  2I1K A;  3ZKJ C;  2BPS A;  3ZDM C;  3UQA A;  2EMT A;  1TTN A;  5CHF A;  1X1M A;  1Q0W B;  2BKF A;  2JRI B;  2NBU A;  4F7Z A;  2W9N A;  3UF8 A;  1V49 A;  4J6I A;  2MBB B;  4KIK B;  1JRU A;  1UGM A;  4EOY A;  2PE9 A;  4W9H A;  4HPL B;  2NVU I;  2AL3 A;  3ZDT A;  4GDL B;  4NAW B;  3DPD A;  2B3A A;  2KDI A;  2ZCB A;  1OGW A;  1WIA A;  1BT0 A;  2ZNV C;  2IBI B;  2LXC A;  3QAR A;  2KNB A;  2BYE A;  2KC1 A;  2M0X A;  4TQ0 A;  1C1Y B;  3OAW A;  4F8C B;  3NHE B;  2BWF A;  1P0R A;  2DX5 B;  3ZUN A;  3PRE A;  2BGF A;  2KDB A;  2GBJ A;  3ZNZ B;  5EDS A;  4JGH B;  3ZNI D;  3GOE A;  4M0W B;  1L2N A;  1XT9 B;  1OEY A;  3R66 C;  1V9J A;  3VTV A;  2KLC A;  2WYQ A;  4A3P A;  3PV1 A;  2MBO A;  3KYD D;  3A9J A;  4HWI B;  2IY0 B;  3VUY A;  4AJW A;  4ZRI A;  2V1Y A;  3PSE B;  4ZRJ A;  4RM9 A;  3VQI A;  2BF8 B;  1WMH A;  3KUC B;  4KVG B;  3KUZ A;  1E8Y A;  1UBI A;  3PLU A;  3WAO A;  2IO0 B;  4RMA A;  1UBQ A;  2BYV E;  3M63 B;  2MBQ A;  4NY0 A;  2MWS B;  1K8R B;  1UH6 A;  4GSW A;  4IWP A;  4MGI E;  4JQW C;  4XZ4 A;  1HE8 A;  2KX3 A;  3OJ4 B;  2L7R A;  3HK0 A;  4K81 A;  2LWP A;  4GOC A;  4OVV A;  3WAN A;  3X23 A;  2O6V B;  1YX5 B;  3WAM A;  1WRD B;  1RFA A;  1WF9 A;  3T8M A;  5DPS A;  2V3S A;  3VHT C;  1J8C A;  3UIP B;  4GMV A;  1Z5S B;  2C5L C;  1UD7 A;  4LJO B;  1WGY A;  3QX1 A;  1E7V A;  2CHZ A;  2LXA A;  3O65 B;  3NZU A;  3PHX B;  4NJ7 A;  4BOZ B;  2DYB A;  1P9D U;  1YJ1 A;  1WGH A;  3A1Q A;  4EFO A;  1Z2M A;  2K1F A;  1WX9 A;  2CHX A;  2N9P C;  4M8N A;  3VTU A;  2MP2 B;  2LZ6 A;  2C7M B;  2LRU A;  2AL6 A;  2RSU A;  4TUU A;  2KFJ A;  2M8S A;  1H4R A;  4G50 A;  1WI0 A;  4ICU A;  3IFW B;  3X0W A;  3ZRF A;  5E6N A;  1LFD A;  3CST A;  4W9L A;  2ZVO A;  4HLE A;  4I6N B;  2JUO A;  1V80 A;  2MCN B;  3QQ8 B;  3HM6 X;  2ZPY A;  4EZK A;  4II2 B;  3P2B A;  2GBN A;  4FHK A;  2JZZ A;  2XK5 B;  3DBL I;  3K9P B;  3NS8 A;  1IP9 A;  2JY6 A;  2K8B A;  2DZM A;  2MRP A;  3N30 A;  2UWQ A;  3Q3J A;  1YX6 B;  3H7S A;  3I3T B;  2J7Q B;  1WXS A;  2DZJ A;  3CSF A;  2KWC A;  3KH0 A;  3WIM A;  4GDK A;  1OTR B;  2XBB C;  3R3M A;  4W9F A;  3TBL D;  3U30 A;  2K25 A;  2G3Q B;  5J18 A;  4HDQ A;  1WXA A;  4HK2 A;  2KTR A;  1WXV A;  1Q1O A;  1V5T A;  2XEW A;  2LGD A;  2LUE A;  4GB9 A;  2FCQ A;  2M1M A;  3ECI A;  4FAD A;  4ZDV A;  3RT3 B;  2KMA A;  5J2R A;  1E8W A;  4IWQ A;  4DXA B;  3PGE A;  5GMV A;  4ZRK A;  3ALB A;  1F9J A;  4HVB A;  4MM3 A;  2NR2 A;  2LGY A;  2N1V A;  3DVG Y;  2N7E A;  3QC8 B;  3BY4 B;  2IYD B;  2MBE A;  2KZR A;  3NY5 A;  2ASQ A;  2D2Q A;  3KW5 B;  1CMX B;  3ZRC A;  3JSV B;  4GU2 A;  3RD2 A;  3AXC A;  3WAP A;  2WX0 A;  4WJP A;  4X57 B;  3M62 B;  3S2A A;  4FJZ A;  4KSL C;  2LD9 A;  3NZS A;  2AYO B;  4MGZ E;  5CTR C;  5D6J B;  3ZTD A;  1GG3 A;  1WH3 A;  4YL8 A;  3T9L A;  2KFK A;  2REX A;  4NPN A;  2ZEQ A;  5DPR A;  2O2V B;  4OVU A;  2J0K A;  4MJS A;  4E74 A;  4K7U A;  1M94 A;  2N1W A;  4HJK A;  3VDZ A;  2GMI C; 
#chains in the Genus database with same CATH topology
 4II3 B;  4BKT A;  2NPT B;  2G1E A;  2KO3 A;  4OW0 A;  3NS1 A;  3ZO5 B;  4CYE A;  4B6W A;  3E9S A;  1KM7 A;  3JW0 X;  1QZE A;  1LXD A;  2KJ6 A;  4IG7 B;  3KWV A;  3BIN A;  3MC0 B;  4XGA B;  3H7P A;  4PK1 A;  2L0T A;  4KX6 B;  1SF0 A;  2CJN A;  4HDO A;  3PZ8 A;  1IBX A;  3QA8 A;  1NDD A;  3SHQ A;  3ENE A;  3N1Y C;  3DHG C;  3A9K B;  2WU5 B;  4A55 A;  3IT6 B;  2PJH A;  2DZI A;  4WJN A;  2BQQ A;  1P7F A;  4BKS D;  2KDM A;  2AQ1 B;  3N20 C;  2JWU A;  4BBN C;  2IGH A;  1JWU D;  1UEL A;  2YEP F;  5AZH A;  3VH4 B;  4E3C A;  3LYY A;  2GB1 A;  2AQ2 B;  2CS4 A;  1FIQ A;  3EUB 2;  3L0W B;  2WXI A;  2WXN A;  1J19 A;  5EE1 A;  3Q2A C;  4K1R B;  4OZB A;  2PEA A;  1FNU A;  2M17 A;  2KWV B;  1K50 A;  3NVW A;  3ZYY X;  2PTL A;  4GGQ A;  5E6O A;  2WXF A;  2EEL A;  1C77 A;  1V1P B;  4BKS A;  3PO0 A;  1LO5 D;  5D3D A;  1DOI A;  3IXS A;  3ZVV A;  2KVZ A;  4N58 A;  3QJZ A;  2IO3 B;  3VXW A;  4KSK C;  2OED A;  1C4P A;  1YIW A;  2ON8 A;  1YN4 A;  3N1X C;  2CKH B;  3EEC A;  3DBH I;  3HIZ A;  2BS4 B;  2DEN B;  3KWL A;  3T3O A;  4IKG A;  3AE8 B;  3C0R B;  1RYJ A;  4LNK A;  1F77 A;  3AE4 B;  1EUV B;  2KK8 A;  3N3K B;  4WWN A;  4KZ0 A;  1SBB B;  2KX0 A;  4FJV B;  4RM8 A;  3DVN V;  1GJZ A;  1TYG B;  4P7I A;  3TJP A;  4C00 A;  4RF0 A;  3DBS A;  2DZK A;  3JSV A;  4HCP B;  1N60 A;  3EA6 A;  2G9H D;  3K9O B;  2MP2 A;  1WXQ A;  2INC C;  1V81 A;  3RUL A;  4G3X B;  1R4N I;  4HKZ E;  2N9L A;  3AU5 A;  1WGK A;  3RNC C;  5LLI A;  1V86 A;  2BT6 A;  2I2Y A;  2V9H A;  4PS7 A;  4ZRP A;  4KDL B;  1V2Y A;  3L54 A;  2DAJ A;  1KJT A;  2J0J A;  2N7J A;  1I4P A;  2JYT A;  1WX8 A;  1FFU A;  4FBJ B;  2WS3 B;  5DPT A;  1XCQ L;  1UZX B;  4YWG G;  3NG0 A;  4DDG D;  1MHX A;  1I35 A;  3AE2 B;  1KTK A;  1AAR A;  2WU2 B;  4ZRQ A;  5TR5 A;  4K3B A;  3Q3O C;  2JT4 B;  2C9W B;  3N1Z C;  4HRO A;  4AOF A;  2FAZ A;  1C9F A;  5IKC M;  1TKE A;  2KQS A;  3V6C B;  1A5R A;  1FCC C;  2ZNV B;  3A33 B;  1DYQ A;  1WZ3 A;  2LEK A;  5LXI B;  2KC2 A;  3V6E B;  3QHT A;  2CU1 A;  4JE3 B;  1UUP A;  3QCA A;  4NAW A;  1OQY A;  3MHZ A;  1ZUD 2;  1V1P A;  1HTO A;  1F2R C;  4WQM A;  1ZOY B;  3W1S A;  4HCN B;  2HTH A;  1XD3 B;  2J4X A;  1TY2 A;  1TBE A;  2SEB D;  5CX3 A;  2LVP A;  2FUH B;  2MLB A;  4I6P A;  2HJ1 A;  3ML9 A;  2JRH A;  2KTF A;  2G45 B;  4IWO A;  4BKG A;  2IPK D;  5E6P A;  1YQ3 B;  2VH2 A;  2ZZP B;  3SDL C;  3APD A;  4ARC A;  2NS5 A;  4W9D A;  4XE0 A;  4BFR A;  1SXT A;  2MBH A;  4S0R A;  1TKY A;  3PVL A;  3RNB C;  3JVZ X;  2RR9 A;  4D2K A;  3A4S C;  3V60 A;  3VTW A;  2PVG C;  3FKY A;  3UQA A;  1TTN A;  2LJI A;  1X1M A;  2NBU A;  4KIK B;  1ET9 A;  1TIF A;  3BYT B;  2AL3 A;  1L0V B;  3DPD A;  2ZCB A;  3I63 C;  1OGW A;  2ZNV C;  2IBI B;  2KNB A;  2BYE A;  2M0X A;  4L2Y A;  5H92 C;  2Z8L A;  1P0R A;  2DX5 B;  4EE2 A;  3Q6B A;  2GBJ A;  3ZNI D;  4M0W B;  5IOI A;  2WXQ A;  1AYF A;  4B0M A;  3ETR A;  3KYD D;  4YXD B;  1OFF A;  2IY0 B;  4RNA A;  2JXT A;  3PSE B;  5BMI A;  3P4R B;  2BF8 B;  3KUZ A;  4KGR A;  1UBQ A;  2IDY A;  3M63 B;  1ZXI A;  3P4P B;  3OJ4 B;  5C3J B;  4K81 A;  5H8Y E;  4OVV A;  2TSS A;  1WRD B;  1WF9 A;  2V3S A;  1J8C A;  4GMV A;  2PW9 A;  2C5L C;  4K3C A;  1TS5 A;  2LXA A;  3O65 B;  3NZU A;  4NJ7 A;  1MG4 A;  4L23 A;  1VZ7 A;  1Z2M A;  4OHJ A;  2K1F A;  5G5H A;  2C7M B;  4AS1 A;  2KFJ A;  3X0W A;  4H2A A;  3CST A;  4KKI A;  5BYR A;  2JUO A;  2MCN B;  3VRA B;  4II2 B;  3P2B A;  2JZZ A;  1TS2 A;  1IP9 A;  1EM7 A;  3H7S A;  4GDK A;  1OTR B;  2XBB C;  2W54 A;  2CU3 A;  2K25 A;  2G3Q B;  4J3O D;  1ZDX A;  1JML A;  4HK2 A;  1Q1O A;  1C4A A;  2BB6 A;  1CZP A;  3ECI A;  3RT3 B;  1J7B A;  5GMV A;  1PFD A;  3KLS X;  4LK0 M;  2N1V A;  2KWD A;  3C19 A;  3BY4 B;  4ZYS A;  2KYW A;  2MBE A;  2FE8 A;  2D2Q A;  3KW5 B;  3ZRC A;  3AXC A;  1NEN B;  3NRZ A;  4FJZ A;  3ZTD A;  2AYO B;  1GG3 A;  1MI0 A;  2KFK A;  2M56 B;  2V3P A;  4MJS A;  1P3Q U;  2D5G A;  2GMI C;  2W55 A;  5C23 A;  4AUQ C;  5CHV C;  1V5O A;  3AEA B;  1HTQ A;  1SE4 A;  1U4A A;  3NOB A;  2WXK A;  1R7S A;  4HPM B;  4MJS B;  1TZ1 A;  2SAK A;  4P16 A;  2KJH B;  2JF5 A;  2HJ8 A;  3A1Q B;  3APF A;  4ANV A;  3CF6 E;  3J9C A;  3CMM B;  5JH5 C;  1QT9 A;  2L0F A;  2QC8 A;  2LVQ A;  3GP7 A;  5BYQ A;  3QIJ A;  3TIX A;  2J42 A;  3HVZ A;  2OJR A;  1AW7 A;  2DLB A;  3URY A;  2W82 A;  3V3X A;  2BTE A;  3L10 B;  3BYY B;  2A4Z A;  3HHM A;  3MJ5 A;  2KHW B;  1RFK A;  2J52 A;  1V97 A;  2MX2 A;  4A20 A;  4MSM B;  1JWA D;  3PRP B;  1JRP A;  2D10 A;  2N0S B;  3VUX A;  2QHO A;  3ZXV A;  1ZXH A;  1CQV A;  4FLH A;  1WGG A;  4C4V B;  3ZIM A;  4USA A;  3TSS A;  1YN3 A;  3SD5 A;  5E6J A;  5IP4 D;  2Z59 B;  1F2R I;  2RD0 A;  2ZPN A;  1FNV A;  2J0M A;  1D5Z C;  4MM3 B;  4AP4 C;  3RZF A;  4B9K A;  1WZ0 A;  4MEM A;  1MPE A;  3U52 E;  4C80 A;  2E3T A;  1T6B X;  1L6V A;  4BZA A;  3H9D A;  2IGG A;  4GDK B;  2QIE B;  3U7D A;  1BML C;  2L3Z A;  1WMH B;  2INN E;  3EHV A;  2KQ7 A;  3M3J A;  2O6V D;  5KHO A;  1Q10 A;  3RUI B;  3IAS 1;  1WM3 A;  2AQ3 B;  3DWG C;  5BMG A;  2FCS A;  5DCN A;  4TMA B;  3APC A;  4ACF A;  4WWP A;  1HA5 A;  3AEC B;  2LHE A;  5D94 A;  1SJE D;  3ZJV A;  2L32 A;  2GBR A;  4YSY B;  4HRS A;  5AZG A;  2KTR B;  4US9 A;  1P1A A;  3ZJT A;  1FO4 A;  1GAQ B;  1XEE A;  3TEX A;  1JW9 D;  2UYZ B;  2C7N B;  2D07 B;  4JX1 C;  1E6E B;  1J0G A;  2RDB C;  1WY8 A;  1QF6 A;  3PS6 A;  2XNA C;  1WJ6 A;  3AI5 A;  4M01 A;  2EMS A;  4WWM A;  3PPA A;  3EFC A;  2KOX A;  3HRD D;  3AE5 B;  4NJ6 A;  4FA6 A;  5C1Z A;  4CO7 A;  1LQB A;  1GUA B;  1VLB A;  2K6Q A;  1ROE A;  1N63 A;  4PYU A;  3RN9 C;  2QMT A;  5IA7 A;  1GNU A;  4GN1 A;  3FIL B;  3RNF C;  1XLN A;  2QSD A;  4KKJ A;  3ZQ4 A;  3DDC B;  2GBK A;  3RNA C;  2HE7 A;  1P7E A;  3DHI C;  2JU6 X;  1JWM D;  1AWD A;  2GLS A;  4MGK E;  2BKR B;  2KT7 A;  4DXG A;  3QWZ B;  1NBF C;  2YVC A;  2ACZ B;  1EO6 A;  4B95 A;  4DHZ E;  4MDK E;  1HXY D;  1TS4 A;  4IM2 A;  2DHZ A;  3VAW A;  3D32 A;  1D3Z A;  2HD5 B;  2MH7 A;  1IUE A;  2W3S A;  3AB5 A;  4WAA A;  1L0Y B;  4MSQ B;  3P4S B;  4RGM A;  4WQO B;  3SU8 X;  2ZJD A;  2FCM A;  3RZW C;  4QAY A;  1H8C A;  4MGY E;  1RWS A;  3RFZ B;  5HKH A;  2E6X A;  2KAC A;  1TGZ B;  4MEL A;  4JLC A;  2WXJ A;  1EF1 A;  2INP E;  2WLB A;  1OQQ A;  2IO1 B;  2JPH A;  2KDE B;  3BVG A;  1FRR A;  3IG3 A;  3P42 A;  1D4B A;  2OOB B;  1IYF A;  3DBR B;  4WWO A;  1E5W A;  4LDT D;  2PKO A;  4HJG E;  1KOT A;  3AMZ A;  2WNM A;  4JWS C;  2NPT A;  1NEK B;  1YJJ A;  1GC6 A;  2NBW B;  2D3G A;  2KD0 A;  2C7H A;  5LXH A;  5AEK B;  1FRD A;  2KN4 A;  2N9X A;  2V3N A;  3NVZ A;  1JWS D;  2LMC A;  3W5U B;  4W9K A;  3RCZ A;  1NYQ A;  3TUO A;  5CHF A;  2BKF A;  2JRI B;  4F7Z A;  1V49 A;  4EOY A;  1JRU A;  1XLQ A;  4HPL B;  2NVU I;  3ZDT A;  1WIA A;  3QAR A;  2LXC A;  5FKA C;  2KC1 A;  3OAW A;  3ZUN A;  2BGF A;  2FUG 1;  5G5G A;  3B2F A;  5EDS A;  5HG2 A;  1L2N A;  1XT9 B;  1SIJ A;  3R66 C;  1V9J A;  4KGS A;  2KLC A;  2WYQ A;  1N62 A;  3SFD B;  3A9J A;  4AJW A;  1D5X C;  1F0Z A;  3KUC B;  1WMH A;  1E8Y A;  2ZW0 A;  2MWS B;  1K8R B;  1UH6 A;  4GSW A;  4IWP A;  4MGI E;  3FIL A;  1UWX A;  3HK0 A;  4GOC A;  4N6E B;  1YX5 B;  3BZD B;  3T8M A;  3VHT C;  3UIP B;  3MFG A;  1UGJ A;  1UD7 A;  4LJO B;  1WGY A;  3QX1 A;  2CHZ A;  1YJ1 A;  3AE9 B;  3LXF A;  3A1Q A;  1WX9 A;  2N9P C;  3AE3 B;  1J7A A;  4G50 A;  1FXI A;  3I57 A;  4LLG M;  4HLE A;  1FMA D;  1MFW A;  1N5W A;  2ZPY A;  4AQ7 A;  4O1N A;  4FHK A;  1J7C A;  1XCT L;  3K9P B;  2DZM A;  1JAL A;  2MRP A;  1TT5 B;  2UWQ A;  5HI1 A;  1YX6 B;  2J7Q B;  3KH0 A;  4RGT A;  4W9F A;  1E9M A;  3AE7 B;  1F1H A;  1WXV A;  2Y3A A;  5AUK A;  4GB9 A;  3PZ7 A;  2AX5 A;  2FCQ A;  2M1M A;  4ZDV A;  5J2R A;  4DXA B;  1CJE A;  1HZ6 A;  3GE8 C;  3PGE A;  2LFI A;  1RM6 C;  2VZK D;  3I5J C;  4MM3 A;  4CQN A;  2LGY A;  2WXR A;  2N7E A;  1L4D B;  2IYD B;  4RFB A;  1PDX A;  2FBW B;  1CMX B;  4IOI E;  2KQ4 X;  4X57 B;  3S2A A;  2LD9 A;  5D6J B;  2JZP A;  3T9L A;  4HPP A;  5DPR A;  3NVY A;  1ZP0 B;  4K7U A;  1M94 A;  3VDZ A;  3VR9 B;  4A8X C;  2IY1 B;  2R61 A;  4NQL B;  4EKU A;  3B0A A;  3H8H A;  1PGB A;  3TCA A;  2KXJ A;  2A5U A;  3V61 A;  4URK A;  1VD2 A;  2KLG A;  2MA9 B;  3TL5 A;  2EKE C;  1B9R A;  1QLB B;  3UIN B;  2M4N A;  3DVN U;  1KF6 B;  1YMH E;  4KV2 A;  2ONQ A;  4IDI A;  2JYE A;  4IM0 A;  1VRA B;  2K8C A;  4HKQ A;  1ZDV A;  2K9X A;  4GIV A;  4P6V F;  1WX7 A;  1L0X B;  3GZN I;  2BS3 B;  2GBM A;  3DCG A;  2BYF A;  3ONS A;  2WP9 B;  4MH0 E;  1FXA A;  3Q8E A;  3AEF B;  2VZK B;  3KUD B;  3W2D A;  4WJQ A;  1JWB D;  2DBY A;  1WFY A;  4FUL A;  3R7Q A;  3VH3 B;  4DK5 A;  1VDV A;  3QAQ A;  1IGD A;  2LAS A;  1T5X D;  3CIR B;  3LDZ E;  4W9J A;  5L95 C;  1E7U A;  4ANU A;  1IBX B;  2K3U A;  3I9V 1;  1WR1 A;  1MHH E;  2KMC A;  3RNG C;  2AWT A;  2L76 A;  3EC8 A;  3IT4 B;  2NBV B;  1XO3 A;  2WHI A;  5D2M B;  2DYO A;  4TSS A;  1WRI A;  5IAA C;  4YSZ B;  1T0Q C;  3ZW3 A;  3PTF C;  3UQB A;  3OJ3 A;  1ENF A;  1L7Y A;  2L00 B;  3AH7 A;  2QEJ C;  4DHZ B;  2MQJ A;  4LNO A;  2KMM A;  4MAC A;  2JXX A;  3QK0 A;  2LVO A;  4K7S A;  2X38 A;  4EEW A;  1SE9 A;  3VUW A;  2KVR A;  2LGI A;  4IW0 A;  2K8H A;  2LGS A;  2Y5C A;  1WGR A;  2OJW A;  3U8Z A;  2C60 A;  2PE6 B;  1MVK A;  1PGA A;  3V62 A;  1UF0 A;  1FXT B;  3E56 A;  2V4I B;  1T0S C;  2V4L A;  2WQY B;  2WXH A;  4JPS A;  5G55 A;  2DAF A;  2H89 B;  5JHA A;  1I4H A;  4EZJ A;  1WE7 A;  2QJL A;  3PRM B;  4HXD A;  4TQ1 A;  2PPH A;  3H7P B;  4US8 A;  2FNJ B;  4DWF A;  4FN2 A;  4PYZ A;  4C4V A;  4M8M A;  2QCZ A;  3UI3 A;  1ISN A;  2NCN A;  3MP9 A;  1PQS A;  3DBR I;  4MT5 A;  3VVW B;  2L8J A;  1QQR A;  1GC7 A;  3WA0 A;  2Q5W D;  3AU4 A;  3U2S C;  2O6V A;  3L17 A;  1LM8 B;  1A70 A;  2CJO A;  2MW5 A;  1EF5 A;  1R4M B;  1E8X A;  4RGO S;  1VZ8 A;  5FR6 A;  3DBL B;  5J17 A;  1N61 A;  2R2Q A;  3L16 A;  1KLG D;  1ZE3 D;  2G4D B;  1ZGU B;  2W3R A;  1WE6 A;  1GB4 A;  2HDE A;  3PHW B;  2LHD A;  3W9C B;  2WX1 A;  3ZNG C;  4XC2 A;  4A3O A;  4XYC A;  2DNF A;  3DWM A;  2IO2 B;  3NJT A;  3PRZ A;  1JCK B;  2L05 A;  4LNI A;  2R2O A;  4FHJ A;  3TEY A;  1KLV A;  2BW2 A;  5IN7 A;  1GOZ A;  1DOY A;  1XLO A;  1YN5 A;  3IVF A;  4NNJ B;  3TMP B;  2MJD A;  1FD6 A;  1WR6 E;  4W9C A;  5T8I A;  4NQK E;  4RF1 A;  5GXG B;  2MJE A;  1FM0 D;  2WXO A;  2KWU B;  2N7D A;  4WJO A;  2QDF A;  3L08 A;  3MC9 A;  1VCB A;  1TS3 A;  3PLV A;  4JL9 A;  5C2T B;  4KIK A;  2ZCC A;  3DVG X;  1QOA A;  3P1M A;  3KYC D;  1VR9 A;  2WWZ A;  1C78 A;  1B1Z A;  1WYW B;  1E10 A;  2L1A A;  1E8Z A;  1QKZ A;  1P98 A;  1ZW7 A;  4YTN B;  2JX5 A;  4M0W A;  1WJU A;  3OWE B;  1TJE A;  1QOF A;  2WDQ B;  3BK2 A;  1HQR D;  4REZ A;  4UDU C;  2AEH A;  1XLP A;  3C8Y A;  3Q3N C;  5L83 A;  3N32 A;  1ZKH A;  4GXB A;  2K5P A;  4M00 A;  2I1K A;  2BPS A;  2WXP A;  3ZDM C;  1Q0W B;  2W9N A;  2MBB B;  2PE9 A;  3AN1 A;  4NAW B;  1F52 A;  3AE6 B;  4A6Q A;  3AEE B;  2KDI A;  1BT0 A;  4TQ0 A;  1C1Y B;  3R2I A;  1KH0 A;  2BWF A;  3NHE B;  3RI7 C;  4P1C C;  3ZNZ B;  4JGH B;  3GOE A;  2L52 A;  3NUH B;  1FCL A;  1EWY C;  1OEY A;  3SR6 A;  3VTV A;  4A90 A;  4WAF A;  3PV1 A;  4YT0 B;  4ZRI A;  4RM9 A;  1VZ6 A;  3B9J A;  3VQI A;  5BYS A;  1YQ4 B;  3WAO A;  2IO0 B;  2MBQ A;  4NY0 A;  4ARI A;  2N9K A;  4JQW C;  2KX3 A;  1DGJ A;  3X23 A;  1EU3 A;  2O6V B;  3WAM A;  1BUI C;  1Z5S B;  1FPY A;  4N59 A;  1E7V A;  2H88 B;  3PHX B;  1FEH A;  4BOZ B;  2DYB A;  3GZN B;  2V0G A;  3V05 A;  1IGC A;  4EFO A;  2CHX A;  3N9Y C;  4M8N A;  3VTU A;  2LZ6 A;  2LRU A;  3BII D;  2AL6 A;  4TUU A;  4S17 A;  4PT5 A;  1H4R A;  4C56 C;  4OZA A;  1WI0 A;  4ICU A;  3ZRF A;  1NI3 A;  1C4C A;  4ZHO A;  4R3D A;  2WDV B;  2XK5 B;  1T0R C;  3DBL I;  2JY6 A;  1I4Q A;  2K8B A;  3AV8 A;  2WDR B;  3RPF C;  1WXS A;  1YNT E;  2KWC A;  3WIM A;  1AN8 A;  3TBL D;  3U30 A;  5J18 A;  1WXA A;  2KTR A;  1V5T A;  2LGD A;  5FR3 A;  1KRH A;  2BS2 B;  1E8W A;  1ACC A;  2WGS A;  4ZRK A;  1F9J A;  2VH1 A;  1TZO A;  2DWQ A;  3DVG Y;  3QC8 B;  3U7Z A;  1XXG A;  4HEA 1;  3NY5 A;  4LNF A;  2KZR A;  2OHF A;  2PMV A;  4GU2 A;  3RD2 A;  2WX0 A;  2WXL A;  2X8X X;  3AEG B;  3W5V B;  3M62 B;  4KSL C;  1XF5 L;  4MGZ E;  4YTP B;  3FAH A;  1WSP A;  4YL8 A;  3ABV B;  1GB1 A;  4NPN A;  1DOX A;  2O2V B;  4E74 A;  1NVI D;  5BMH A;  3R8B A;  1E90 A;  2ZVN A;  1VJK A;  4DDI D;  3Q3F A;  4I6L B;  1RRB A;  3W1Y A;  1D6E C;  2FCN A;  4XWT A;  3ZLZ A;  3OG5 A;  4G11 A;  4ITK A;  1K51 A;  2WDT B;  1Q5W B;  2KFK B;  4F1S A;  3UGB B;  2IND C;  1NYR A;  4AJY B;  3R2T A;  5D7G A;  4NJC A;  2D11 A;  2MSE D;  1WXM A;  2LJ5 A;  3BVZ A;  4JWU C;  3B1L X;  4FJY A;  5LNK 1;  4ASW C;  2YEP B;  4W9E A;  3R7R A;  1R4N B;  3AM9 A;  2I38 A;  4IUM B;  2M19 A;  5JHB A;  4JIO U;  4RH6 A;  5JZE B;  4NZL B;  1IPG A;  1R4M I;  3AEB B;  1I4R A;  4XDC A;  2Z0D B;  1OEY J;  3M95 A;  1OQR A;  2RDG A;  3HM3 A;  3RNE C;  2K39 A;  3Q14 C;  5G2N A;  5DPW A;  3UIO B;  1V6E A;  4YSX B;  2JVC A;  3PT2 B;  2KDF B;  1RLF A;  4EUT A;  5HFY A;  3NZ3 A;  3VRB B;  3MC8 A;  2IZV B;  3A4R A;  3EGR A;  3ZXR A;  4LNN A;  4B0E A;  4ANX A;  4DHJ D;  1K52 A;  1PGX A;  4ANW A;  3MHS D;  2MEK A;  3Q69 A;  4ZOH C;  4E71 A;  4TKN A;  3H1U A;  3WCQ A;  1WWT A;  1SE2 A;  4MH8 A;  1C76 A;  1MG8 A;  2Y5B B;  2ZW1 A;  3U4E G;  3L4P A;  3KVF B;  4PS3 A;  3DOW A;  3DQV A;  4GDL A;  3RYT A;  3B08 A;  1SEB D;  4W9G A;  3ZGZ A;  4ZHP A;  4RGN A;  3Q8A A;  2GOW A;  3WAL A;  3EFU A;  2RDH A;  2FIF A;  3H6N A;  1RAX A;  1WGD A;  3BVM A;  2LRW A;  2XK5 A;  4ICV A;  4ZYN A;  1SIF A;  4KDI C;  2KKC A;  2JZ3 B;  2KJR A;  4M02 A;  1WJN A;  5EE0 A;  1CK1 A;  4BBN F;  3SFE B;  1WM2 A;  2O2V A;  3IBE A;  1S3S G;  2YLM A;  3MTN B;  3ZTC A;  2N4F A;  2FID A;  1SSN A;  5IO9 A;  3A9J B;  2J53 A;  3A9K A;  1FFV A;  5TSS A;  4LCD E;  3Q8F A;  2K22 A;  1T0Y A;  1Y8R C;  2Z0E B;  4DHJ B;  1YQB A;  5KHQ A;  4YTM B;  2GI9 A;  1KFY B;  1SGH A;  3MJW A;  4IC7 B;  4DXF A;  1UNS A;  4BOS C;  3JYU A;  3AUL A;  4N9F 4;  3Q8B A;  2N9E B;  4DQO C;  1C3T A;  3OLM D;  2RPV A;  4KGT A;  2BB5 A;  5D3I B;  4EZL A;  5CHW A;  3GS2 A;  2BWE S;  4XWW A;  2D3C A;  1N6Z A;  4K7W A;  2LGX A;  3ZNH B;  1FNW A;  4DBG A;  1QOG A;  1C79 A;  4TV3 A;  1WJ4 A;  3GB1 A;  3HVD A;  1EU4 A;  1ZPS A;  4KZC A;  2XN9 C;  2RGF A;  1HZ5 A;  2IGD A;  1E7P B;  2RPQ A;  1E0Z A;  4LDT B;  4CHK A;  3BK1 A;  2CHW A;  5BO4 B;  1KLU D;  2I1J A;  1G6J A;  4LTU A;  2VRR B;  1UWM A;  2UU7 A;  1T3Q A;  1K53 A;  1SE3 A;  4XX5 A;  4G0N B;  3LJ3 A;  4LJP B;  4BAX A;  1NI2 A;  4PS8 A;  5AUI A;  2D3A A;  4OVZ A;  1V8C A;  2L83 A;  4XDD A;  3PZD A;  1D5M C;  3KQ4 A;  3AED B;  3W1S C;  1STE A;  1YD8 U;  4L1B A;  1I42 A;  1M4V A;  4C7Y A;  3DHH C;  2CR5 A;  3CWI A;  2JWZ A;  2WXM A;  2K6D B;  2JQR B;  2DYM A;  2PVO D;  1S1Q B;  1PUT A;  1XQQ A;  2QIL A;  5EE3 A;  1TKG A;  2LI5 A;  1Y56 A;  2JSV X;  2KN5 A;  3BWU D;  2KAN A;  1ESF A;  2KAJ A;  3L13 A;  3ML8 A;  4WUR A;  1HEZ E;  1EWC A;  4W9I A;  1I7H A;  3VFK A;  2G4S A;  1I4X A;  1QIL A;  4IM3 A;  3AE1 B;  5AZF A;  1QOB A;  4AWJ A;  4BVU C;  5MPO A;  3ZKJ C;  2EMT A;  3UF8 A;  3P63 A;  4J6I A;  1UGM A;  4W9H A;  4GDL B;  2B3A A;  1WYG A;  4WH4 A;  4F8C B;  1JRO A;  1L4Z B;  1TY0 A;  1MJD A;  2NTS A;  3PRE A;  2PIA A;  2KDB A;  3B2G A;  2B76 B;  1LGR A;  2EKI A;  4A3P A;  2MBO A;  4C7Z A;  4Q2J A;  4HWI B;  2NTT A;  3GE3 C;  3VUY A;  2BBC A;  2V1Y A;  4ZRJ A;  4KVG B;  1L5P A;  3HUI A;  1UBI A;  3PLU A;  4RMA A;  2BYV E;  1L6U A;  3Q3M C;  1YOV B;  4XZ4 A;  1HE8 A;  2L7R A;  2LWP A;  4WIP A;  3WAN A;  3FC4 A;  1PYW D;  1RFA A;  5DPS A;  1BXT A;  3LB8 C;  3VR8 B;  3T3N A;  5JXV A;  2GRI A;  3DBH B;  2WXG A;  3IAM 1;  2ICI A;  1P9D U;  1WGH A;  4RCO A;  2HTM E;  4P1B C;  2MP2 B;  2RSU A;  5EE9 A;  1N5X A;  2M8S A;  3IFW B;  5E6N A;  1LFD A;  4W9L A;  2ZVO A;  4I6N B;  1V80 A;  2K0P A;  3QQ8 B;  3HM6 X;  4EZK A;  5HHD G;  4A9A A;  3SEB A;  2GBN A;  3NS8 A;  3RMK C;  1SJH D;  1SB3 C;  3N30 A;  3Q3J A;  3I3T B;  3CSF A;  2DZJ A;  2IJ0 A;  3R3M A;  1JQ4 A;  2D3B A;  3P4Q B;  4HDQ A;  3TEZ A;  2LUM A;  2XEW A;  2LUE A;  2MJ3 A;  4FAD A;  2KMA A;  4IWQ A;  2RMM A;  4NAM A;  1V1O A;  3ALB A;  1I4G A;  4HVB A;  2BYT A;  2Y5P A;  2NR2 A;  5FK9 C;  2BVC A;  2NMQ A;  4GLS C;  1GPX A;  3Q8C A;  2ASQ A;  3ZJU A;  4OZC A;  1YJI A;  4FXC A;  3NVV A;  3JSV B;  2PLP A;  3WAP A;  4WJP A;  5CTR C;  3NZS A;  3TEW A;  1WH3 A;  2REX A;  2ZEQ A;  5I4D A;  4OVU A;  1ET6 A;  2J0K A;  3O13 A;  2MHJ A;  2N1W A;  4HJK A;  2M0A A;  3IHP C; 
#chains in the Genus database with same CATH homology
 2IY1 B;  4II3 B;  4BKT A;  2NPT B;  1E90 A;  5C23 A;  4NQL B;  4EKU A;  3B0A A;  2KO3 A;  2ZVN A;  4DDI D;  4AUQ C;  3ZO5 B;  5CHV C;  3TCA A;  3Q3F A;  2KXJ A;  2A5U A;  3V61 A;  4CYE A;  4I6L B;  1V5O A;  1VD2 A;  4URK A;  4B6W A;  1RRB A;  2KLG A;  1KM7 A;  2MA9 B;  3TL5 A;  2EKE C;  3JW0 X;  3W1Y A;  1U4A A;  1QZE A;  1LXD A;  3UIN B;  2FCN A;  3NOB A;  2M4N A;  3ZLZ A;  4G11 A;  2KJ6 A;  4IG7 B;  3DVN U;  4HPM B;  2WDT B;  1TZ1 A;  3BIN A;  4KV2 A;  4MJS B;  1Q5W B;  4IM0 A;  2KJH B;  2KFK B;  4F1S A;  3UGB B;  3H7P A;  2L0T A;  2JF5 A;  2HJ8 A;  4AJY B;  2K8C A;  4HDO A;  5D7G A;  3A1Q B;  4GIV A;  3APF A;  4ANV A;  2MSE D;  1WX7 A;  2D11 A;  3GZN I;  3CF6 E;  1WXM A;  3QA8 A;  1NDD A;  2GBM A;  3SHQ A;  3ENE A;  3CMM B;  5JH5 C;  2LJ5 A;  3DCG A;  2BYF A;  3ONS A;  2L0F A;  4MH0 E;  3B1L X;  4FJY A;  3A9K B;  3KUD B;  4ASW C;  2LVQ A;  3QIJ A;  4W9E A;  4WJQ A;  3TIX A;  2OJR A;  3R7R A;  2PJH A;  1WFY A;  2DZI A;  3L10 B;  4FUL A;  2A4Z A;  3HHM A;  4WJN A;  2KHW B;  2MX2 A;  4IUM B;  3R7Q A;  4A20 A;  3VH3 B;  4DK5 A;  4MSM B;  4BKS D;  3QAQ A;  3PRP B;  5JHB A;  4JIO U;  2LAS A;  3IHP C;  3LDZ E;  2D10 A;  4W9J A;  5JZE B;  4BBN C;  3VUX A;  1IPG A;  1R4M I;  2QHO A;  2Z0D B;  5L95 C;  1OEY J;  1E7U A;  3M95 A;  1UEL A;  4ANU A;  1WR1 A;  1WGG A;  3HM3 A;  4FLH A;  5AZH A;  2KMC A;  2K39 A;  3VH4 B;  5G2N A;  4E3C A;  5DPW A;  2AWT A;  3UIO B;  1V6E A;  3ZIM A;  2JVC A;  3SD5 A;  3PT2 B;  2L76 A;  2CS4 A;  3EC8 A;  2NBV B;  2KDF B;  1RLF A;  4EUT A;  5D2M B;  2DYO A;  3L0W B;  2Z59 B;  2ZPN A;  2RD0 A;  5IAA C;  3ZW3 A;  3PTF C;  1J19 A;  2J0M A;  3UQB A;  3OJ3 A;  4AP4 C;  2IZV B;  3RZF A;  4K1R B;  3A4R A;  2PEA A;  1L7Y A;  4B9K A;  1WZ0 A;  2L00 B;  4MEM A;  4DHZ B;  2MQJ A;  4ANX A;  2M17 A;  2KWV B;  4DHJ D;  2JXX A;  3QK0 A;  2LVO A;  4K7S A;  4ANW A;  3H9D A;  4GGQ A;  3MHS D;  5E6O A;  4E71 A;  4TKN A;  4GDK B;  1SE9 A;  3H1U A;  4EEW A;  3U7D A;  3VUW A;  2L3Z A;  1WMH B;  2KVR A;  4IW0 A;  1MG8 A;  4BKS A;  2K8H A;  2Y5B B;  3EHV A;  1WGR A;  2KQ7 A;  3U8Z A;  3M3J A;  2O6V D;  2C60 A;  5KHO A;  2PE6 B;  3KVF B;  4PS3 A;  3DOW A;  3DQV A;  4GDL A;  3ZVV A;  3V62 A;  1FXT B;  3QJZ A;  2IO3 B;  3RUI B;  1WM3 A;  3RYT A;  3VXW A;  3B08 A;  4W9G A;  2FCS A;  5DCN A;  2V4L A;  4KSK C;  3APC A;  5G55 A;  4WWP A;  1YIW A;  2DAF A;  5D94 A;  5JHA A;  2GOW A;  3WAL A;  2GBR A;  3EFU A;  4EZJ A;  2FIF A;  1WE7 A;  3H6N A;  1RAX A;  3PRM B;  2CKH B;  3EEC A;  1WGD A;  3DBH I;  3HIZ A;  2LRW A;  2XK5 A;  4ICV A;  5AZG A;  4HXD A;  4TQ1 A;  2DEN B;  4ZYN A;  2PPH A;  2KTR B;  1P1A A;  1SIF A;  4KDI C;  3H7P B;  3C0R B;  2KKC A;  2JZ3 B;  2KJR A;  4BBN F;  1WJN A;  2FNJ B;  4DWF A;  4FN2 A;  4PYZ A;  1WM2 A;  2O2V A;  1EUV B;  2KK8 A;  3IBE A;  3N3K B;  4M8M A;  1S3S G;  2UYZ B;  2YLM A;  4WWN A;  2C7N B;  3MTN B;  4KZ0 A;  1ISN A;  2KX0 A;  2NCN A;  2D07 B;  1PQS A;  3DVN V;  4FJV B;  4RM8 A;  4P7I A;  3ZTC A;  1J0G A;  1GJZ A;  3DBR I;  2N4F A;  2FID A;  3TJP A;  3VVW B;  2L8J A;  3A9J B;  3A9K A;  1WY8 A;  3DBS A;  2DZK A;  3JSV A;  3PS6 A;  4HCP B;  4LCD E;  1T0Y A;  1Y8R C;  1GC7 A;  2Z0E B;  3K9O B;  1WJ6 A;  3WA0 A;  3AI5 A;  2MP2 A;  3AU4 A;  4DHJ B;  2O6V A;  3L17 A;  1YQB A;  5KHQ A;  2EMS A;  1LM8 B;  3PPA A;  1V81 A;  3RUL A;  4G3X B;  1R4N I;  1SGH A;  2MW5 A;  2KOX A;  1EF5 A;  3MJW A;  4IC7 B;  3AU5 A;  4BOS C;  5LLI A;  4NJ6 A;  4FA6 A;  1E8X A;  1V86 A;  3JYU A;  1LQB A;  1GUA B;  2K6Q A;  4CO7 A;  5FR6 A;  5C1Z A;  3AUL A;  4N9F 4;  2N9E B;  4PYU A;  1C3T A;  5J17 A;  3OLM D;  4PS7 A;  1P3Q U;  5IA7 A;  2R2Q A;  1GNU A;  3L16 A;  2G4D B;  1ZGU B;  4GN1 A;  4KDL B;  1WE6 A;  1V2Y A;  3PHW B;  5CHW A;  3L54 A;  4EZL A;  3ZNG C;  2WX1 A;  3DDC B;  2DAJ A;  2GBK A;  4XC2 A;  1KJT A;  2BWE S;  4A3O A;  4K7W A;  2HE7 A;  2J0J A;  2LGX A;  2IO2 B;  3PRZ A;  3ZNH B;  4DBG A;  2L05 A;  4TV3 A;  1WX8 A;  1WJ4 A;  2R2O A;  4FBJ B;  4FHJ A;  4MGK E;  2BKR B;  5DPT A;  1UZX B;  1KLV A;  4KZC A;  3QWZ B;  1NBF C;  2RGF A;  2YVC A;  2RPQ A;  1EO6 A;  4DDG D;  4B95 A;  4DHZ E;  4LDT B;  4MDK E;  4CHK A;  1I35 A;  2CHW A;  5BO4 B;  4IM2 A;  2DHZ A;  3VAW A;  3D32 A;  1AAR A;  1D3Z A;  3IVF A;  4NNJ B;  5TR5 A;  2I1J A;  3TMP B;  1G6J A;  1WR6 E;  2HD5 B;  2VRR B;  4W9C A;  4NQK E;  2JT4 B;  2C9W B;  4AOF A;  2FAZ A;  4WAA A;  2KWU B;  2KQS A;  2N7D A;  4G0N B;  3LJ3 A;  4LJP B;  2ZNV B;  4MSQ B;  4WJO A;  4XX5 A;  3V6C B;  4WQO B;  3L08 A;  1NI2 A;  4PS8 A;  3A33 B;  3SU8 X;  1WZ3 A;  2ZJD A;  5LXI B;  2FCM A;  3RZW C;  2KC2 A;  3V6E B;  1H8C A;  4MGY E;  3PZD A;  3QHT A;  3W1S C;  2CU1 A;  1VCB A;  5HKH A;  1YD8 U;  3PLV A;  1I42 A;  4JL9 A;  4KIK A;  2ZCC A;  1TGZ B;  3DVG X;  2CR5 A;  3QCA A;  4NAW A;  2JWZ A;  4MEL A;  4JLC A;  1OQY A;  2K6D B;  3KYC D;  2DYM A;  1S1Q B;  1EF1 A;  2WWZ A;  2IO1 B;  2JPH A;  2KDE B;  1XQQ A;  3W1S A;  1WYW B;  4HCN B;  3IG3 A;  2HTH A;  1E8Z A;  1P98 A;  1XD3 B;  1ZW7 A;  2OOB B;  2LI5 A;  1IYF A;  1TBE A;  5CX3 A;  1WJU A;  2KN5 A;  2LVP A;  1E5W A;  2FUH B;  2MLB A;  4LDT D;  4WWO A;  1KOT A;  4I6P A;  3ML9 A;  2JRH A;  2KTF A;  2G45 B;  2KAN A;  4IWO A;  4BKG A;  5E6P A;  2NPT A;  2ZZP B;  3SDL C;  1GC6 A;  3APD A;  1A5R A;  3L13 A;  2AEH A;  2NBW B;  2D3G A;  3ML8 A;  2KD0 A;  5L83 A;  4W9I A;  2NS5 A;  3VFK A;  3N32 A;  2C7H A;  4W9D A;  5LXH A;  2G4S A;  4BFR A;  5AEK B;  2MBH A;  3PVL A;  4IM3 A;  1ZKH A;  4GXB A;  2N9X A;  3JVZ X;  2RR9 A;  5AZF A;  3A4S C;  3V60 A;  3VTW A;  4AWJ A;  4BVU C;  4W9K A;  3RCZ A;  2I1K A;  3ZKJ C;  2BPS A;  3ZDM C;  3UQA A;  2EMT A;  1TTN A;  5CHF A;  1X1M A;  1Q0W B;  2BKF A;  2JRI B;  2NBU A;  4F7Z A;  2W9N A;  3UF8 A;  1V49 A;  4J6I A;  2MBB B;  4KIK B;  1JRU A;  1UGM A;  4EOY A;  2PE9 A;  4W9H A;  4HPL B;  2NVU I;  2AL3 A;  3ZDT A;  4GDL B;  4NAW B;  3DPD A;  2B3A A;  2KDI A;  2ZCB A;  1OGW A;  1WIA A;  1BT0 A;  2ZNV C;  2IBI B;  2LXC A;  3QAR A;  2KNB A;  2BYE A;  2KC1 A;  2M0X A;  4TQ0 A;  1C1Y B;  3OAW A;  4F8C B;  3NHE B;  2BWF A;  1P0R A;  2DX5 B;  3ZUN A;  3PRE A;  2BGF A;  2KDB A;  2GBJ A;  3ZNZ B;  5EDS A;  4JGH B;  3ZNI D;  3GOE A;  4M0W B;  1L2N A;  1XT9 B;  1OEY A;  3R66 C;  1V9J A;  3VTV A;  2KLC A;  2WYQ A;  4A3P A;  3PV1 A;  2MBO A;  3KYD D;  3A9J A;  4HWI B;  2IY0 B;  3VUY A;  4AJW A;  4ZRI A;  2V1Y A;  3PSE B;  4ZRJ A;  4RM9 A;  3VQI A;  2BF8 B;  1WMH A;  3KUC B;  4KVG B;  3KUZ A;  1E8Y A;  1UBI A;  3PLU A;  3WAO A;  2IO0 B;  4RMA A;  1UBQ A;  2BYV E;  3M63 B;  2MBQ A;  4NY0 A;  2MWS B;  1K8R B;  1UH6 A;  4GSW A;  4IWP A;  4MGI E;  4JQW C;  4XZ4 A;  1HE8 A;  2KX3 A;  3OJ4 B;  2L7R A;  3HK0 A;  4K81 A;  2LWP A;  4GOC A;  4OVV A;  3WAN A;  3X23 A;  2O6V B;  1YX5 B;  3WAM A;  1WRD B;  1RFA A;  1WF9 A;  3T8M A;  5DPS A;  2V3S A;  3VHT C;  1J8C A;  3UIP B;  4GMV A;  1Z5S B;  2C5L C;  1UD7 A;  4LJO B;  1WGY A;  3QX1 A;  1E7V A;  2CHZ A;  2LXA A;  3O65 B;  3NZU A;  3PHX B;  4NJ7 A;  4BOZ B;  2DYB A;  1P9D U;  1YJ1 A;  1WGH A;  3A1Q A;  4EFO A;  1Z2M A;  2K1F A;  1WX9 A;  2CHX A;  2N9P C;  4M8N A;  3VTU A;  2MP2 B;  2LZ6 A;  2C7M B;  2LRU A;  2AL6 A;  2RSU A;  4TUU A;  2KFJ A;  2M8S A;  1H4R A;  4G50 A;  1WI0 A;  4ICU A;  3IFW B;  3X0W A;  3ZRF A;  5E6N A;  1LFD A;  3CST A;  4W9L A;  2ZVO A;  4HLE A;  4I6N B;  2JUO A;  1V80 A;  2MCN B;  3QQ8 B;  3HM6 X;  2ZPY A;  4EZK A;  4II2 B;  3P2B A;  2GBN A;  4FHK A;  2JZZ A;  2XK5 B;  3DBL I;  3K9P B;  3NS8 A;  1IP9 A;  2JY6 A;  2K8B A;  2DZM A;  2MRP A;  3N30 A;  2UWQ A;  3Q3J A;  1YX6 B;  3H7S A;  3I3T B;  2J7Q B;  1WXS A;  2DZJ A;  3CSF A;  2KWC A;  3KH0 A;  3WIM A;  4GDK A;  1OTR B;  2XBB C;  3R3M A;  4W9F A;  3TBL D;  3U30 A;  2K25 A;  2G3Q B;  5J18 A;  4HDQ A;  1WXA A;  4HK2 A;  2KTR A;  1WXV A;  1Q1O A;  1V5T A;  2XEW A;  2LGD A;  2LUE A;  4GB9 A;  2FCQ A;  2M1M A;  3ECI A;  4FAD A;  4ZDV A;  3RT3 B;  2KMA A;  5J2R A;  1E8W A;  4IWQ A;  4DXA B;  3PGE A;  5GMV A;  4ZRK A;  3ALB A;  1F9J A;  4HVB A;  4MM3 A;  2NR2 A;  2LGY A;  2N1V A;  3DVG Y;  2N7E A;  3QC8 B;  3BY4 B;  2IYD B;  2MBE A;  2KZR A;  3NY5 A;  2ASQ A;  2D2Q A;  3KW5 B;  1CMX B;  3ZRC A;  3JSV B;  4GU2 A;  3RD2 A;  3AXC A;  3WAP A;  2WX0 A;  4WJP A;  4X57 B;  3M62 B;  3S2A A;  4FJZ A;  4KSL C;  2LD9 A;  3NZS A;  2AYO B;  4MGZ E;  5CTR C;  5D6J B;  3ZTD A;  1GG3 A;  1WH3 A;  4YL8 A;  3T9L A;  2KFK A;  2REX A;  4NPN A;  2ZEQ A;  5DPR A;  2O2V B;  4OVU A;  2J0K A;  4MJS A;  4E74 A;  4K7U A;  1M94 A;  2N1W A;  4HJK A;  3VDZ A;  2GMI C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...