1SF0A

Backbone solution structure of mixed alpha/beta protein pf1061
Total Genus 4
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
4
sequence length
68
structure length
68
Chain Sequence
KMIKVKVIGRNIEKEIEWREGMKVRDILRAVGFNTESAIAKVNGKVVLEDDEVKDGDFVEVIPVVSGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords hypothetical protein PF1061
publication title Backbone solution structures of proteins using residual dipolar couplings: Application to a novel structural genomics target.
pubmed doi rcsb
source organism Pyrococcus furiosus
molecule tags Structural genomics, unknown function
total genus 4
structure length 68
sequence length 68
ec nomenclature
pdb deposition date 2004-02-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02597 ThiS ThiS family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1sf0A00
3B2GA 3AE1B 4N59A 1PUTA 4C7ZA 4JWSC 2WDVB 1A70A 1TKGA 4IDIA 4KX6B 3AEFB 2MJ3A 3SFEB 2JX5A 1YQ4B 2H88B 2E3TA 4ZOHC 1N60A 4US8A 1QF6A 1N5XA 1WYGA 1N63A 2WU5B 4A9AA 4YSYB 2BT6A 2CU3A 1RM6C 1ZP0B 2FBWB 3AE4B 3AEDB 3DWGC 3PO0A 1IUEA 3AEAB 2JQRB 5G5GA 1JWBD 1R7SA 1ROEA 5AUIA 1XO3A 1E10A 1RYJA 1XLOA 1QOAA 1J7BA 2MJEA 2PKOA 2Q5WD 2PVGC 4YTNB 1DOYA 3LXFA 3HVZA 3AEBB 1E0ZA 3B9JA 4US9A 1E9MA 1FIQA 1OQRA 1L0VB 2HTME 2WDQB 4P6VF 2BS2B 1F0ZA 1J7AA 4C80A 1OQQA 1FXAA 3P1MA 3WCQA 5GXGB 3L4PA 1NYQA 4HRSA 1WRIA 2DBYA 3CWIA 1B9RA 2BS3B 3AN1A 1FFUA 3VRAB 2WQYB 1PFDA 1YJIA 1TKEA 2PVOD 1ZUD2 2W3RA 3AE9B 2KAJA 3AE5B 3P4RB 4WQMA 5C2TB 1KF6B 1TJEA 1VDVA 5C3JB 1NVID 3RPFC 1CZPA 2WU2B 1FRRA 1AWDA 3AE7B 4FXCA 1NI3A 3FAHA 2KMMA 3AEEB 3SFDB 2L52A 3NVWA 2CJOA 1SB3C 1FM0D 1XLNA 1E7PB 2MH7A 3AM9A 4HROA 3FC4A 3AE8B 4JWUC 3LB8C 2Y5CA 1JQ4A 1QOGA 2WDRB 3AE3B 1QOFA 1AYFA 1SIJA 3BIID 2WS3B 1GPXA 1CJEA 1TYGB 1ZOYB 3AE6B 3AECB 4ITKA 3P4PB 1N5WA 2BS4B 5EE3A 3HRDD 1VJKA 5EE0A 1FMAD 2ACZB 2H89B 3AB5A 4N58A 3W5VB 3W9CB 5MPOA 4USAA 3AV8A 1QT9A 1FXIA 1QLBB 2K5PA 2M56B 4LTUA 3P63A 1JRPA 3SR6A 4ZHPA 2M19A 2N0SB 1NYRA 4JX1C 1T3QA 3KWLA 1N61A 2CJNA 1XLQA 1JWAD 2K9XA 1YQ3B 3NRZA 4YSXB 4ZHOA 2EKIA 2PIAA 2W55A 3VR9B 2W54A 1WXQA 4YTPB 4C7YA 2L83A 3ABVB 1YJJA 4YSZB 1DOIA 3NS1A 1JALA 1TKYA 4YT0B 1FO4A 4N6EB 5G5HA 1RWSA 3VR8B 3W5UB 1OFFA 1UWMA 1VLBA 3AE2B 3ETRA 4YXDB 2MJDA 1E6EB 1L6UA 1RFKA 1GAQB 1KFYB 2K22A 3ZYYX 3P4SB 2G1EA 1DGJA 1N62A 1NENB 2WLBA 3CIRB 1NEKB 1WGKA 2DWQA 3DWMA 3NVYA 3P4QB 1QOBA 2B76B 4YTMB 1DOXA 3AMZA 2AX5A 3B2FA 3NVVA 1J7CA 2OHFA 3AEGB 1JROA 1SF0A 1V8CA 5EE9A 5H92C 4WWMA 1ZXIA 1XLPA 1JW9D 2QIEB 5H8YE 3VRBB 1KRHA 1L5PA 5AUKA 2W3SA 1FFVA 1EWYC 3AH7A 3NVZA 1L6VA 1V97A 2LEKA 1I7HA 2WP9B 2QJLA 3HUIA 5EE1A 1FRDA 1WWTA 1PDXA 3EUB2
chains in the Genus database with same CATH superfamily
1V5OA 3B2GA 3QK0A 3IXSA 2M0AA 1T5XD 4C7ZA 1A70A 3EA6A 3N9YC 1YIWA 4DXGA 4M0WA 2H88B 2WU5B 2GBMA 3FILB 1F2RI 1TT5B 4RCOA 5HG2A 1V1PB 1KLUD 1KM7A 1XLOA 4XC2A 3PHXB 1WR6E 1E0ZA 5FK9C 3UQAA 1L0VB 4PS8A 4FULA 3ZNZB 1L7YA 2XEWA 1WGRA 3DHIC 3GS2A 5JXVA 3QA8A 1I4GA 1WX8A 4MEMA 4MT5A 4S0RA 2IGGA 2QC8A 3DQVA 4AJWA 3DCGA 1E90A 1GUAB 2M0XA 2IO1B 1C3TA 1JRUA 4MGZE 2SAKA 1BUIC 1B1ZA 2MEKA 5BMHA 2ZEQA 4IM3A 2ON8A 5CX3A 1RFAA 1LGRA 4N58A 3W5VB 3L17A 5BMGA 1T3QA 1T6BX 1WYWB 1VZ6A 2Y5PA 3KWLA 2EKIA 1YN4A 3BVZA 2W55A 2CR5A 1GB1A 2LJ5A 3W1SC 4K7SA 5D6JB 1WJNA 4CQNA 1P7EA 2JT4B 3Q3NC 4ARIA 3MHZA 4WJOA 1TY2A 1C77A 1DGJA 2ZPYA 3TEWA 2LWPA 3NVVA 2KKCA 4K7UA 2EKEC 2REXA 1V97A 3A1QA 1HE8A 1I7HA 3JYUA 5DPSA 4TQ1A 1CQVA 2JVCA 4L2YA 2MJ3A 4RFBA 1JWUD 2C60A 4J3OD 3AXCA 1P1AA 2QCZA 3KW5B 4DQOC 1ZP0B 4CYEA 2B3AA 1UWXA 1XO3A 1WXSA 4GDKA 2MJEA 2DHZA 4WJPA 2KWUB 4WAFA 4D2KA 3GB1A 2KX3A 4OVZA 1FIQA 3M63B 3MP9A 2MCNB 3DVGX 4I6LB 3P1MA 4XDCA 4KDLB 1NYQA 1LQBA 2QSDA 3A9JB 5BMIA 4UDUC 4LNOA 4ZRPA 3VRAB 2MHJA 2YLMA 3JSVA 5C3JB 4BOSC 2N9KA 1FRRA 4G11A 3NG0A 3NS8A 1UBIA 2KQ4X 3EFCA 3ZVVA 3PHWB 4F1SA 3B0AA 1FM0D 1GNUA 1ZDVA 3GE8C 1I4HA 1TTNA 3GZNB 2K25A 3WAMA 2WHIA 2KANA 3QCAA 2UWQA 4NZLB 3OAWA 1GJZA 1YOVB 5J2RA 2PJHA 1YX5B 1N61A 1C76A 2AL3A 4GXBA 2LUMA 2AL6A 2PTLA 3LYYA 4EEWA 1WXQA 2R2QA 2KMCA 3RD2A 1TKYA 4GGQA 4N6EB 3VR8B 2NTSA 1WGYA 3ETRA 1WY8A 3ZUNA 1YNTE 3ONSA 1GAQB 2AYOB 3BWUD 3CIRB 4E71A 4PT5A 1QOBA 4ICUA 2KXJA 1L4ZB 3VTUA 2BB6A 3FKYA 3TUOA 1KRHA 4TQ0A 2UU7A 2BBCA 2WXGA 5KHOA 2OEDA 3P2BA 2LEKA 3AE1B 1VZ7A 4G50A 2DLBA 2EMTA 3ZJTA 1YQ4B 3RI7C 2L8JA 3WALA 1X1MA 2O6VD 2JZ3B 5AUIA 3HK0A 2YEPB 1QOAA 3M95A 3ZJUA 3LXFA 2JZPA 2JSVX 3V61A 1J7AA 3L4PA 4HRSA 3PSEB 2MSED 1FFUA 3N3KB 1TKEA 2LASA 4AP4C 1WM2A 4S17A 1CZPA 3TEXA 3CMMB 3W2DA 4BAXA 1F2RC 1WE7A 1JWSD 4ANUA 5IOIA 3UINB 1T0RC 4HCNB 3T3NA 1ET6A 3A4RA 4EKUA 4WWOA 3BIID 4KZCA 1KOTA 4WWNA 3Q6BA 3TL5A 1SBBB 4NAWB 1WZ3A 2KZRA 2LI5A 5KHQA 3NRZA 4ZHOA 2KFKB 3RNCC 1XCTL 2MBHA 2Z8LA 4KIKB 1UNSA 2K22A 4PYUA 3NJTA 3ZW3A 1A5RA 4HCPB 3N20C 1D5ZC 1YMHE 1ZGUB 1UBQA 1E5WA 2KVRA 4YWGG 2BTEA 2DENB 2LVPA 5EE1A 1E7UA 4A90A 2AWTA 3EUB2 1KLVA 4N59A 3SFEB 3GE3C 2EELA 4MSQB 4MGYE 4TSSA 3KLSX 3N30A 2BT6A 2JWZA 2FBWB 5G5GA 3AU5A 2HTHA 3ZXVA 4IWPA 3K9OB 4W9LA 4P6VF 2WXKA 3N1YC 2WDTB 3EGRA 4C80A 1OQQA 3SD5A 4ZYSA 4FJZA 3ZLZA 2I1KA 3CWIA 2KK8A 1ZUD2 1J19A 2W3RA 1T0QC 4II2B 1NVID 1MVKA 1VZ8A 3AEEB 3IVFA 5J17A 1JMLA 1XLNA 2RSUA 2IDYA 5G55A 4RGMA 3AULA 1CK1A 3E56A 1TYGB 2BPSA 1KTKA 3KUDB 3W9CB 5MPOA 1R4MI 3UF8A 2X38A 1E8WA 4ZYNA 1JRPA 2K8CA 1CMXB 2XK5B 2RMMA 2K9XA 2W54A 4C4VB 3KWVA 2LVQA 4KGSA 3W1YA 2DWQA 3RN9C 4P1BC 2KWDA 2GB1A 3Q8FA 4AUQC 4HK2A 4FA6A 5IN7A 3HM3A 2DYOA 2ZZPB 3I3TB 2AEHA 3CSTA 5FR6A 3WAOA 1L5PA 2KQSA 3NZ3A 5D2MB 2J53A 2NMQA 2INDC 5D7GA 1EU3A 3N32A 3H8HA 5T8IA 2GBJA 4X57B 3IAM1 2KWCA 1E8ZA 4US8A 2KOXA 3UGBB 4NQLB 1UH6A 1ROEA 4DWFA 1E9MA 2LXCA 5J18A 5BYSA 2VZKB 2TSSA 2L3ZA 4P16A 4FJYA 5BYRA 2AQ2B 4ACFA 2Z0EB 4XGAB 4BVUC 3P4RB 2MLBA 1TJEA 4FADA 1ZXHA 2KC2A 4FHJA 2PEAA 2N1VA 1STEA 4OVUA 2KHWB 1ZKHA 2WXQA 1WXVA 2R2OA 1D4BA 1V49A 2FUHB 1IPGA 1UGMA 1CJEA 1ZOYB 4CHKA 2L0TA 3IFWB 2O6VB 3HRDD 2FCQA 4F7ZA 4HLEA 2XBBC 3TCAA 3R7RA 2ICIA 3AV8A 2K5PA 2K1FA 2WX1A 3DHHC 3OJ4B 3O65B 3Q2AC 2ZCCA 1DOIA 5D94A 2DAJA 3KUZA 4KGRA 1P98A 1L6UA 3DBHB 4BBNF 4IOIE 4N9F4 2WWZA 4ANWA 2DYMA 3MJWA 2AQ3B 2IO3B 2K3UA 2O2VB 1BT0A 3VTVA 2OHFA 1F9JA 4XDDA 3PREA 3UI3A 4HDQA 2N9PC 1KJTA 1L6VA 2KACA 2CHWA 3IBEA 4IDIA 3AEFB 4OHJA 2RDGA 1XQQA 3DBHI 5I4DA 3H6NA 2QMTA 1WJ4A 4ARCA 2ZNVC 5E6PA 1XEEA 2DZJA 1TZOA 3C19A 1HXYD 2IBIB 3DBSA 1ZE3D 4GB9A 4KSLC 2V4LA 1TS5A 3DHGC 4A55A 2DAFA 2DZKA 1F77A 2Z59B 4M0WB 2WU2B 2WNMA 2KYWA 1YX6B 2NR2A 4IG7B 4JGHB 3SHQA 5EDSA 4GN1A 2BWFA 5L95C 2NPTA 2NBUA 1UD7A 1WMHA 2Y5CA 2KN4A 1J8CA 3TBLD 4WJNA 1Z5SB 5LLIA 3TJPA 3HIZA 2LVOA 4HVBA 3PV1A 1WZ0A 1C1YB 2V3SA 3P63A 2QILA 4ZHPA 4LLGM 2HD5B 2KC1A 2NVUI 3H7SA 3AU4A 3ZNID 4DHJD 1YQ3B 2ZW0A 1FNVA 3EECA 5JZEB 4YSZB 2FUG1 4YT0B 4WWPA 1E6EB 3IG3A 3VAWA 1KFYB 2AQ1B 5HHDG 1WJUA 2V3NA 2CHXA 3N1ZC 1YQBA 2WXRA 1XXGA 1ZDXA 4RGTA 4DHZE 2G4DB 3DDCB 1JROA 2BWES 4IW0A 1WR1A 5IAAC 3KVFB 2I1JA 3H9DA 3S2AA 1QKZA 3NVZA 4L1BA 3JVZX 1T0SC 4RGOS 1WRDB 2M1MA 2KDFB 4W9EA 4FHKA 4WAAA 3MC0B 3VH4B 2OJWA 1WYGA 2G4SA 2RPVA 2DX5B 2KFJA 2JXXA 1WH3A 3UIOB 4ZRKA 3C8YA 2LFIA 4KV2A 3T8MA 2BVCA 3U8ZA 1F0ZA 3A1QB 2J7QB 3LJ3A 1JWMD 5FR3A 3N1XC 1TS4A 3PZDA 4WQMA 1MPEA 1KF6B 2J0MA 4WQOB 2N7DA 2C5LC 2J52A 2VH2A 1PGAA 4JE3B 4WJQA 2CKHB 4LNIA 4GDKB 4JWUC 2MX2A 3B08A 3AE3B 2BYVE 4QAYA 3BYTB 3AE6B 3OG5A 1EO6A 2V1YA 2INNE 4KVGB 1HTQA 2KNBA 4K7WA 3QQ8B 3IAS1 4JPSA 3NOBA 4GSWA 1I4XA 3JSVB 3DVNV 3ZTCA 1LXDA 2KQ7A 5LXHA 1HTOA 1RWSA 2E6XA 4E3CA 3AE2B 1I4PA 2K6QA 3SU8X 3VTWA 3ALBA 2L00B 1RFKA 1Q5WB 4GOCA 4KKIA 1NEKB 2NS5A 1E7VA 3JW0X 2C7HA 2KLCA 2L7RA 2GBKA 2LMCA 2K0PA 2LRUA 3MHSD 3EC8A 2M8SA 2FIDA 2KJRA 2BQQA 3RZWC 2DZIA 2KDBA 2N7JA 4C7YA 3I5JC 4JWSC 2SEBD 2Y5BB 4ZOHC 5CHFA 1HQRD 3BK1A 5G2NA 3AE4B 2L1AA 1JWBD 2RD0A 1TY0A 3O13A 4OVVA 2BGFA 4YTNB 3UQBA 3PRPB 4EUTA 1GG3A 2QDFA 2QEJC 3PZ7A 4TUUA 3PS6A 1NDDA 1EM7A 1EF1A 4RNAA 3VUWA 3ZNGC 4XE0A 3GOEA 3DBRI 2LHEA 1I4RA 1R4NB 5C2TB 1LFDA 2MBBB 2GLSA 4H2AA 4A8XC 4RMAA 3L13A 1S1QB 1PQSA 3RNGC 2N4FA 3RZFA 2KMMA 4DDGD 1K53A 4XZ4A 3RNAC 1F1HA 2CS4A 1C4PA 4I6NB 4B9KA 1UZXB 3QIJA 3H7PA 5JHAA 4KDIC 5E6NA 1WI0A 4M01A 1OEYA 4RF1A 4USAA 1XT9B 3SR6A 2CU1A 4OZBA 1SJED 4LDTB 4YSXB 1R4NI 3PVLA 1AN8A 2LZ6A 4XWWA 2PE6B 2WYQA 2L83A 1S3SG 4HEA1 1OEYJ 4NJCA 3BINA 4YXDB 3BVGA 3VXWA 1SIFA 4HXDA 1TZ1A 1H4RA 3E9SA 2OJRA 1SF0A 2VH1A 1I4QA 1V8CA 1IGCA 1JW9D 4HPPA 3J9CA 2IGDA 3U52E 1MFWA 2D3AA 1TBEA 4GDLA 1F52A 1D5XC 3ZXRA 1G6JA 2BB5A 1C4CA 1FRDA 3V60A 3UIPB 2KTRA 4NQKE 3Q3FA 2KDIA 3MC8A 1QF6A 2BW2A 4GLSC 4A9AA 1BMLC 4W9KA 4WH4A 4FLHA 1WF9A 1ZW7A 1J0GA 3MTNB 4MDKE 2RDBC 1MJDA 4P7IA 3VUXA 4B95A 3OLMD 4ANXA 5DPTA 3BZDB 3RMKC 4BKSA 2IPKD 5C1ZA 2KAJA 3AE5B 4A20A 4M8MA 3CSFA 4O1NA 3KYCD 5BO4B 3VQIA 3L16A 1N6ZA 2LGXA 3V05A 1QOGA 1R4MB 2KJ6A 1SIJA 4ITKA 3K9PB 4NY0A 1QT9A 2HJ1A 1LO5D 2JWUA 2W9NA 4MH0E 1JCKB 4B6WA 2D3CA 5E6OA 3PZ8A 1GB4A 2PIAA 5AZHA 5TSSA 4BZAA 1FO4A 1OGWA 1VLBA 2V3PA 4W9FA 1ISNA 2JY6A 4W9GA 3W1SA 2JYEA 4J6IA 4EFOA 3QHTA 4PS3A 1EWCA 3RNFC 5IO9A 2NTTA 1QZEA 2PLPA 1V81A 1M94A 2QIEB 1IBXA 4RF0A 3DBLB 4MM3A 2GBNA 1EWYC 4EZJA 3M62B 4C56C 4B0MA 3KH0A 4PS7A 4ZRIA 2RDHA 3MC9A 1C79A 1N63A 3AEDB 3PO0A 2KDEB 1RAXA 2MA9B 1L2NA 3V3XA 4C00A 1DOYA 3HVZA 3A9KA 3PTFC 4DXFA 1WGGA 3DBLI 4WURA 2KJHB 2ZCBA 2ZVNA 2MBOA 3R2TA 1L0XB 4NJ7A 4FBJB 1GOZA 4I6PA 3A33B 1YN5A 4A3PA 3Q3JA 2KN5A 1EU4A 1WIAA 3APDA 1WGDA 4MJSA 5TR5A 3PRMB 1FXTB 1E7PB 4LNNA 1HZ6A 1AYFA 3RCZA 2WS3B 2WXOA 2WXLA 4MACA 1FMAD 2LD9A 3VHTC 1NI2A 2WXJA 1VCBA 5DCNA 1QLBB 4IC7B 3WANA 1XD3B 2BYTA 2N0SB 4M02A 3L0WB 2PE9A 1WX7A 2K6DB 2VRRB 3TEYA 2IY1B 4YTPB 3NS1A 1OFFA 2FE8A 4AS1A 3TSSA 2Z0DB 1HEZE 1WGKA 4E74A 4YTMB 4AJYB 4RM9A 3AMZA 2AX5A 4EE2A 2FNJB 2BYEA 4IM0A 3QARA 1FPYA 2XNAC 1PDXA 2LRWA 4K1RB 1ACCA 2ZW1A 2MBQA 4OW0A 1N60A 1K51A 2HJ8A 2C7NB 1XF5L 5JHBA 4HJKA 4DXAB 1R7SA 2PW9A 3PLVA 1RYJA 4Q2JA 2IZVB 4K3CA 1L0YB 1V9JA 2JPHA 1FNWA 1OQRA 3APCA 1SE2A 2MP2A 4ASWC 4M8NA 3A4SC 4LJOB 3WCQA 4OZAA 3ZRFA 4JLCA 2GOWA 4IKGA 1TS2A 4TKNA 1WRIA 1UGJA 3AN1A 1MG8A 3Q14C 2LJIA 3IT4B 2X8XX 1V5TA 4BKTA 5GMVA 1TS3A 2L52A 3NVWA 4NNJB 3NUHB 4HWIB 3IHPC 2GMIC 2INPE 1H8CA 1IP9A 4HROA 1KH0A 3IT6B 3AE8B 1MI0A 1GPXA 2JXTA 3KUCB 5EE3A 2MBEA 2IGHA 1YJ1A 4BBNC 4LNKA 4GMVA 4DHZB 1MG4A 1K50A 3VR9B 3BVMA 2K8HA 2JZZA 1KLGD 3QAQA 3X23A 3MFGA 3RT3B 2NPTB 3ZRCA 1XCQL 1K8RB 2G9HD 3FILA 1WMHB 1N62A 3NVYA 2JF5A 2IO0B 4IWQA 1V1PA 3B2FA 3DVGY 1SSNA 4WWMA 3DVNU 5H8YE 3VRBB 2IYDB 5DPRA 2WXFA 2CHZA 1OTRB 2QJLA 3HM6X 3VH3B 4AWJA 1EUVB 1YN3A 2MWSB 1TKGA 2M17A 3MJ5A 2N9XA 3VUYA 4F8CB 3Q8EA 3VFKA 2KTFA 2L0FA 2WXPA 5DPWA 3AEAB 1PGBA 1C9FA 1MHXA 2BKRB 3U30A 4BKSD 2PVGC 5AEKB 2ONQA 5HI1A 4US9A 2DZMA 1UF0A 2N9EB 5HFYA 2EMSA 2FCMA 4EZKA 4G0NB 1HZ5A 2YVCA 1I42A 5GXGB 1WSPA 4GIVA 1Y8RC 2KT7A 2WX0A 2PVOD 1RRBA 4XYCA 3RULA 1NBFC 1V1OA 3T9LA 3FAHA 3BK2A 1VD2A 1SXTA 5AZGA 2BF8B 3PT2B 1IGDA 2WXHA 3ZKJC 4HJGE 4AOFA 2BS4B 3C0RB 2ACZB 1WXMA 2IJ0A 1FXIA 4XX5A 1C4AA 4ZRQA 3WIMA 3ZDMC 3EHVA 5CHVC 3RNEC 4JX1C 1WE6A 4KGTA 3V62A 2RGFA 3OWEB 3U2SC 4DK5A 3U4EG 4MGIE 2ASQA 3Q69A 5G5HA 3VDZA 5L83A 2GBRA 5FKAC 1P3QU 3P4SB 1NENB 2JRIB 1J7CA 3V6EB 2GI9A 4ICVA 4DBGA 2W3SA 3AH7A 1WJ6A 3NHEB 4BOZB 4GU2A 3A9JA 2WXMA 3R3MA 1I35A 3TMPB 4FN2A 3Q8AA 2KWVB 4R3DA 1ET9A 1TGZB 2V0GA 3KQ4A 4IUMB 3DWGC 4NPNA 3ZGZA 1P7FA 2JQRB 4BFRA 1E10A 2NCNA 1J7BA 1PYWD 2LUEA 2C7MB 4PK1A 2HTME 1YD8U 2WDQB 1AARA 5D3DA 1RLFA 3DBRB 4W9DA 2JRHA 3TEZA 3ECIA 4CO7A 1B9RA 1WXAA 2BS3B 3R2IA 3SEBA 3AE9B 1WX9A 3H1UA 3RPFC 4M00A 4FJVB 4A6QA 1NI3A 1FCCC 3PPAA 2CJOA 3WAPA 2MRPA 4NAMA 3DOWA 3FC4A 2D3BA 2WDRB 2VZKD 3L10B 1V86A 3RUIB 1Z2MA 1VJKA 3EFUA 1BXTA 2H89B 3AI5A 3GZNI 4RH6A 1V6EA 3ZQ4A 4PYZA 4LCDE 2A5UA 1NYRA 1JWAD 4HKZE 1E8YA 1YJJA 2KDMA 5E6JA 1JALA 4ZDVA 2R61A 3Q8BA 4LJPB 2G1EA 4HKQA 2J4XA 2DNFA 3H7PB 1DOXA 2B76B 4K81A 4ANVA 4W9IA 1UUPA 4NJ6A 3AEGB 5H92C 1FEHA 1ZXIA 1XLPA 3P42A 2UYZB 2NBWB 3HUIA 3QJZA 1WWTA 1T0YA 2J0JA 5C23A 2KVZA 3R66C 4EZLA 4RGNA 4P1CC 4YSYB 3RNBC 1SEBD 2QHOA 1OQYA 3QX1A 4XWTA 2J42A 3ZO5B 2G45B 4HDOA 4GDLB 4HPLB 2ZNVB 2FAZA 4NAWA 2KTRB 1HA5A 2KFKA 4JL9A 4DHJB 5CTRC 2WXNA 1SJHD 4URKA 3Q3MC 3CF6E 4KIKA 2BKFA 4A3OA 2IO2B 3R7QA 3LB8C 3APFA 1JQ4A 1QOFA 2M4NA 1Q1OA 2HE7A 2G3QB 1EF5A 3ZIMA 2RPQA 3AB5A 2N9LA 4LTUA 3ZJVA 4ZRJA 2WGSA 2M19A 3V6CB 1K52A 2CJNA 1XLQA 2FCSA 2KO3A 2HDEA 3VVWB 4L23A 4KKJA 3W5UB 2D10A 1UWMA 2MJDA 4HPMB 4MGKE 3ZYYX 1FD6A 3Q3OC 1UELA 2WLBA 5IP4D 1D6EC 3ML9A 3P4QB 4IWOA 1V80A 5CHWA 2D5GA 1D3ZA 2ZJDA 2FIFA 1E8XA 3RYTA 2JU6X 1GC7A 2PMVA 5AUKA 3I9V1 3T3OA 1FFVA 4W9HA 3I57A 2WP9B 2KD0A 3I63C 3M3JA 3ZNHB 1PUTA 4DDID 4KX6B 2WDVB 3OJ3A 5D3IB 3ZTDA 5LXIB 2JYTA 3NY5A 2JX5A 2KLGA 2LHDA 2CU3A 1RM6C 1V2YA 3WA0A 1IUEA 1MHHE 2PKOA 2Q5WD 1P9DU 3AEBB 3B9JA 2MQJA 3PRZA 1IBXB 4MM3B 4MSMB 3R8BA 1LM8B 1FXAA 2D2QA 3ML8A 1ZPSA 2DBYA 1SGHA 3PGEA 1PFDA 2XK5A 1DYQA 5IKCM 4TV3A 2L32A 1VDVA 1QILA 3TIXA 1AWDA 4MH8A 4C4VA 4KZ0A 2GRIA 3AM9A 4OZCA 2KMAA 3A9KB 2N7EA 1TIFA 2RR9A 1IYFA 1SE4A 1N5WA 5LNK1 2C9WB 1L4DB 2MW5A 5BYQA 4II3B 2A4ZA 3RFZB 2INCC 4MELA 1WM3A 3ABVB 1SE3A 2K39A 4MJSB 1FNUA 1GC6A 2NBVB 3L54A 5HKHA 2W82A 3Q8CA 3NZUA 2LGDA 2LXAA 2PPHA 2KX0A 3BYYB 4YL8A 2I38A 2V9HA 2LGYA 3HVDA 3LDZE 1Y56A 1AW7A 4TMAB 2WXIA 2YEPF 3KYDD 3GP7A 3X0WA 2V4IB 2E3TA 4LNFA 4G3XB 3ZDTA 1N5XA 3PLUA 2D07B 2K8BA 3D32A 2LGSA 4K3BA 2BS2B 2O6VA 1C78A 2N1WA 3B1LX 1D5MC 2WQYB 1VR9A 1YJIA 3U7ZA 4B0EA 2FCNA 4JIOU 1PGXA 3AE7B 4FXCA 1U4AA 3SFDB 1WGHA 3NZSA 2OOBB 1SB3C 2Y3AA 4REZA 4EOYA 3QC8B 4RM8A 2MH7A 2DYBA 3URYA 2XN9C 4AQ7A 1VRAB 2O2VA 4WIPA 2LGIA 4BKGA 1Q0WB 1ESFA 2MP2B 3AECB 4W9JA 1ENFA 2L76A 3P4PB 5JH5C 5EE0A 5AZFA 2JUOA 2M56B 3ENEA 4KSKC 3U7DA 1SE9A 1P0RA 2ZVOA 2I2YA 3L08A 2D11A 3QWZB 5IA7A 1Q10A 1QQRA 3DWMA 4LK0M 4IM2A 3BY4B 4JQWC 2D3GA 5EE9A 2BYFA 4W9CA 1M4VA 2L05A 2J0KA 3DPDA 4LDTD 3SDLC 1FCLA 1WFYA 2ZPNA 3HHMA 2IY0B
chains in the Genus database with same CATH topology
3B2GA 3IXSA 2WXMA 2M0AA 1T5XD 4C7ZA 1A70A 3EA6A 3N9YC 3IAM1 4DXGA 3Q8AA 2H88B 4M0WA 4R3DA 4US8A 1QF6A 1ET9A 2BW2A 4GLSC 2V0GA 2WU5B 4A9AA 1BMLC 3FILB 1F2RI 3KQ4A 3DWGC 3ZGZA 4RCOA 1P7FA 5HG2A 2JQRB 1ROEA 1KLUD 1V1PB 1E10A 4WH4A 1XLOA 1J7BA 1PYWD 1E0ZA 1E9MA 5FK9C 1L0VB 2HTME 2WDQB 5BYSA 2VZKB 2TSSA 5D3DA 4P16A 5BYRA 2AQ2B 3TEZA 3BZDB 3GS2A 1B9RA 5JXVA 2BS3B 2IPKD 3R2IA 1I4GA 3SEBA 4MT5A 3AE9B 2IGGA 2KAJA 3AE5B 3P4RB 1TJEA 1ZXHA 3RPFC 4A6QA 4O1NA 1NI3A 3VQIA 1FCCC 2CJOA 1STEA 4NAMA 3FC4A 3V05A 2WXQA 2SAKA 1D4BA 1BUIC 1B1ZA 2MEKA 1QOGA 2WDRB 2VZKD 1SIJA 5BMHA 2ON8A 1CJEA 4ITKA 1ZOYB 3HRDD 1VJKA 1BXTA 2H89B 4N58A 3W5VB 2ICIA 3AV8A 1QT9A 4RH6A 3ZQ4A 2K5PA 1LO5D 2JWUA 5BMGA 1JCKB 1NYRA 1T3QA 1T6BX 2Y5PA 1VZ6A 3KWLA 1JWAD 3PZ8A 4HKZE 2EKIA 1YN4A 3BVZA 1GB4A 2PIAA 2W55A 5TSSA 1GB1A 1YJJA 2KDMA 5E6JA 1DOIA 1JALA 1FO4A 1VLBA 2V3PA 1P7EA 4ARIA 4CQNA 3W1SA 3MHZA 4KGRA 2R61A 1L6UA 1TY2A 1C77A 3Q8BA 4IOIE 2JYEA 2G1EA 1DGJA 4HKQA 2DYMA 2J4XA 2AQ3B 2K3UA 3TEWA 1DOXA 2B76B 3NVVA 2OHFA 1EWCA 4XDDA 1UUPA 2NTTA 3AEGB 2PLPA 5H92C 1FEHA 1ZXIA 1XLPA 2QIEB 3UI3A 1IBXA 3P42A 4RF0A 1EWYC 1L6VA 1V97A 2KACA 1I7HA 3HUIA 1WWTA 4TQ1A 1CQVA 4C56C 4B0MA 4IDIA 3AEFB 4OHJA 4L2YA 2MJ3A 2RDHA 4RFBA 1JWUD 4RGNA 2RDGA 4J3OD 1C79A 1N63A 4YSYB 4DQOC 1ZP0B 3AEDB 3PO0A 1UWXA 1SEBD 3V3XA 5I4DA 1XO3A 2QMTA 2MJEA 4XWTA 2J42A 4D2KA 4WAFA 1DOYA 3HVZA 3GB1A 4ARCA 4OVZA 1FIQA 3MP9A 4DXFA 1XEEA 4WURA 4GDLB 1TZOA 3P1MA 4XDCA 1HXYD 1NYQA 3R2TA 2QSDA 1ZE3D 5BMIA 1L0XB 4UDUC 1GOZA 1TS5A 4ZRPA 3VRAB 4A55A 1YN5A 1F77A 1HA5A 1EU4A 5C3JB 2N9KA 2WXNA 1SJHD 2WU2B 2WNMA 1FRRA 2KQ4X 1FM0D 1ZDVA 1E7PB 1I4HA 3LB8C 2Y5CA 1JQ4A 2KN4A 1HZ6A 1QOFA 1AYFA 2WS3B 2WXOA 2WXLA 4MACA 1FMAD 3AB5A 2WXJA 4NZLB 2N9LA 1QLBB 4LTUA 3ZJVA 3P63A 2QILA 4ZHPA 4LLGM 2M19A 2BYTA 2N0SB 1K52A 1N61A 1C76A 1XLQA 2CJNA 1YQ3B 2ZW0A 1FNVA 2LUMA 2PTLA 3LYYA 3TEYA 1WXQA 4YTPB 2HDEA 4YSZB 3NS1A 4L23A 1TKYA 2FUG1 4KKJA 4YT0B 4N6EB 3W5UB 3VR8B 1OFFA 1UWMA 2NTSA 3ETRA 2MJDA 2FE8A 1E6EB 1YNTE 4AS1A 1GAQB 1KFYB 2AQ1B 3BWUD 5HHDG 2V3NA 3TSSA 3ZYYX 1FD6A 1HEZE 3CIRB 2WLBA 4PT5A 1WGKA 1D6EC 3P4QB 2WXRA 1XXGA 1QOBA 1ZDXA 4YTMB 3AMZA 2AX5A 4RGTA 2D5GA 1L4ZB 2BB6A 1JROA 3TUOA 2JU6X 4EE2A 1KRHA 2PMVA 4TQ0A 5AUKA 3I9V1 2BBCA 2WXGA 3T3OA 1FFVA 1QKZA 3NVZA 2OEDA 4L1BA 3I57A 2LEKA 2XNAC 2WP9B 4RGOS 1PDXA 3AE1B 1PUTA 4KX6B 2WDVB 5D3IB 1VZ7A 1ACCA 3MC0B 2DLBA 2JYTA 2JX5A 2ZW1A 3ZJTA 1YQ4B 4OW0A 1N60A 2LHDA 1K51A 1WYGA 2RPVA 1XF5L 2CU3A 1RM6C 1IUEA 1R7SA 5AUIA 1MHHE 2PW9A 3C8YA 1RYJA 4Q2JA 2YEPB 1QOAA 2PKOA 2LFIA 2Q5WD 3ZJUA 3LXFA 3AEBB 3B9JA 1L0YB 1IBXB 1FNWA 1OQRA 1SE2A 4MM3B 2JZPA 2JSVX 3R8BA 1F0ZA 1J7AA 1FXAA 3WCQA 4OZAA 3L4PA 4HRSA 1ZPSA 4IKGA 1JWMD 1TS2A 1WRIA 2DBYA 5FR3A 1UGJA 3AN1A 1FFUA 1PFDA 1DYQA 1TKEA 1TS4A 2LJIA 3IT4B 1MPEA 4WQMA 2L32A 1KF6B 1VDVA 1CZPA 1QILA 3TEXA 1AWDA 1TS3A 2J52A 3W2DA 1F2RC 4MH8A 1PGAA 4JE3B 2L52A 3NVWA 3NUHB 1JWSD 2GRIA 4GDKB 2INPE 3AM9A 4OZCA 4HROA 1KH0A 3IT6B 4JWUC 3AE8B 3T3NA 1MI0A 1ET6A 3AE3B 3BIID 1GPXA 3BYTB 1SE4A 3AE6B 2JXTA 2INNE 1N5WA 5EE3A 5LNK1 1L4DB 2IGHA 3IAS1 4JPSA 5BYQA 1SBBB 4NAWB 1I4XA 3NRZA 4ZHOA 3RFZB 1FRDA 1K50A 3VR9B 3BVMA 1KLGD 3ABVB 1SE3A 1XCTL 2Z8LA 1RWSA 2E6XA 3MFGA 3AE2B 1I4PA 1UNSA 1FNUA 1RFKA 2K22A 1XCQL 2G9HD 3FILA 4KKIA 1N62A 3NVYA 2W82A 3Q8CA 1NEKB 1V1PA 3B2FA 1SSNA 3BYYB 1D5ZC 4WWMA 2I38A 2LMCA 2K0PA 5H8YE 1YMHE 3VRBB 3HVDA 4YWGG 2BTEA 1Y56A 2WXFA 1AW7A 2QJLA 4TMAB 5EE1A 4A90A 2N7JA 2WXIA 2YEPF 3EUB2 4C7YA 4N59A 1YN3A 4JWSC 3GP7A 1TKGA 2V4IB 3SFEB 3MJ5A 2EELA 2E3TA 2SEBD 4ZOHC 1N5XA 3Q8EA 4TSSA 3KLSX 1HQRD 3BK1A 2BT6A 2WXPA 2FBWB 3AE4B 3AEAB 2L1AA 5G5GA 1JWBD 1PGBA 1TY0A 1C9FA 1MHXA 3O13A 2PVGC 4YTNB 2ONQA 5HI1A 4US9A 2QEJC 3PZ7A 5HFYA 4P6VF 2BS2B 1EM7A 1HZ5A 2WXKA 4C80A 3EGRA 4RNAA 1OQQA 4ZYSA 5GXGB 1C78A 1WSPA 4XE0A 3CWIA 2LHEA 1I4RA 1D5MC 2WQYB 1VR9A 1YJIA 2PVOD 3U7ZA 1ZUD2 2W3RA 5C2TB 4B0EA 4H2AA 4A8XC 1NVID 1V1OA 1PGXA 1MVKA 3AE7B 4FXCA 1VZ8A 3FAHA 2KMMA 3AEEB 3SFDB 1K53A 3BK2A 1SB3C 1SXTA 2Y3AA 4REZA 1JMLA 1XLNA 2IDYA 2MH7A 3URYA 1C4PA 2XN9C 4AQ7A 1IGDA 2WXHA 4RGMA 1VRAB 4WIPA 1CK1A 2LGIA 3E56A 1ESFA 4HJGE 1TYGB 3AECB 1ENFA 3P4PB 2BS4B 1KTKA 5EE0A 2ACZB 3W9CB 5MPOA 4RF1A 4USAA 2IJ0A 1FXIA 2M56B 1C4AA 2X38A 3SR6A 1JRPA 4OZBA 1SJED 4ZRQA 4JX1C 2RMMA 4KGTA 2K9XA 4YSXB 1AN8A 4XWWA 3OWEB 3U2SC 2W54A 2L83A 3U4EG 4HEA1 2I2YA 3Q69A 5G5HA 4NJCA 4YXDB 3BVGA 3KWVA 5FKAC 3P4SB 4KGSA 1Q10A 1NENB 1QQRA 3DWMA 4LK0M 2DWQA 2KWDA 2GB1A 3Q8FA 1J7CA 3E9SA 1SF0A 1I4QA 1V8CA 2GI9A 5EE9A 1IGCA 1M4VA 2DYOA 1JW9D 3J9CA 1L5PA 2IGDA 2W3SA 3U52E 3AH7A 3NZ3A 1FCLA 2J53A 1D5XC 2NMQA 5D7GA 2BB5A 1EU3A 1C4CA 3H8HA 5T8IA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3B2G A;  3AE1 B;  4N59 A;  1PUT A;  4C7Z A;  4JWS C;  2WDV B;  1A70 A;  1TKG A;  4IDI A;  4KX6 B;  3AEF B;  2MJ3 A;  3SFE B;  2JX5 A;  1YQ4 B;  2H88 B;  2E3T A;  4ZOH C;  1N60 A;  4US8 A;  1QF6 A;  1N5X A;  1WYG A;  1N63 A;  2WU5 B;  4A9A A;  4YSY B;  2BT6 A;  2CU3 A;  1RM6 C;  1ZP0 B;  2FBW B;  3AE4 B;  3AED B;  3DWG C;  3PO0 A;  1IUE A;  3AEA B;  2JQR B;  5G5G A;  1JWB D;  1R7S A;  1ROE A;  5AUI A;  1XO3 A;  1E10 A;  1RYJ A;  1XLO A;  1QOA A;  1J7B A;  2MJE A;  2PKO A;  2Q5W D;  2PVG C;  4YTN B;  1DOY A;  3LXF A;  3HVZ A;  3AEB B;  1E0Z A;  3B9J A;  4US9 A;  1E9M A;  1FIQ A;  1OQR A;  1L0V B;  2HTM E;  2WDQ B;  4P6V F;  2BS2 B;  1F0Z A;  1J7A A;  4C80 A;  1OQQ A;  1FXA A;  3P1M A;  3WCQ A;  5GXG B;  3L4P A;  1NYQ A;  4HRS A;  1WRI A;  2DBY A;  3CWI A;  1B9R A;  2BS3 B;  3AN1 A;  1FFU A;  3VRA B;  2WQY B;  1PFD A;  1YJI A;  1TKE A;  2PVO D;  1ZUD 2;  2W3R A;  3AE9 B;  2KAJ A;  3AE5 B;  3P4R B;  4WQM A;  5C2T B;  1KF6 B;  1TJE A;  1VDV A;  5C3J B;  1NVI D;  3RPF C;  1CZP A;  2WU2 B;  1FRR A;  1AWD A;  3AE7 B;  4FXC A;  1NI3 A;  3FAH A;  2KMM A;  3AEE B;  3SFD B;  2L52 A;  3NVW A;  2CJO A;  1SB3 C;  1FM0 D;  1XLN A;  1E7P B;  2MH7 A;  3AM9 A;  4HRO A;  3FC4 A;  3AE8 B;  4JWU C;  3LB8 C;  2Y5C A;  1JQ4 A;  1QOG A;  2WDR B;  3AE3 B;  1QOF A;  1AYF A;  1SIJ A;  3BII D;  2WS3 B;  1GPX A;  1CJE A;  1TYG B;  1ZOY B;  3AE6 B;  3AEC B;  4ITK A;  3P4P B;  1N5W A;  2BS4 B;  5EE3 A;  3HRD D;  1VJK A;  5EE0 A;  1FMA D;  2ACZ B;  2H89 B;  3AB5 A;  4N58 A;  3W5V B;  3W9C B;  5MPO A;  4USA A;  3AV8 A;  1QT9 A;  1FXI A;  1QLB B;  2K5P A;  2M56 B;  4LTU A;  3P63 A;  1JRP A;  3SR6 A;  4ZHP A;  2M19 A;  2N0S B;  1NYR A;  4JX1 C;  1T3Q A;  3KWL A;  1N61 A;  2CJN A;  1XLQ A;  1JWA D;  2K9X A;  1YQ3 B;  3NRZ A;  4YSX B;  4ZHO A;  2EKI A;  2PIA A;  2W55 A;  3VR9 B;  2W54 A;  1WXQ A;  4YTP B;  4C7Y A;  2L83 A;  3ABV B;  1YJJ A;  4YSZ B;  1DOI A;  3NS1 A;  1JAL A;  1TKY A;  4YT0 B;  1FO4 A;  4N6E B;  5G5H A;  1RWS A;  3VR8 B;  3W5U B;  1OFF A;  1UWM A;  1VLB A;  3AE2 B;  3ETR A;  4YXD B;  2MJD A;  1E6E B;  1L6U A;  1RFK A;  1GAQ B;  1KFY B;  2K22 A;  3ZYY X;  3P4S B;  2G1E A;  1DGJ A;  1N62 A;  1NEN B;  2WLB A;  3CIR B;  1NEK B;  1WGK A;  2DWQ A;  3DWM A;  3NVY A;  3P4Q B;  1QOB A;  2B76 B;  4YTM B;  1DOX A;  3AMZ A;  2AX5 A;  3B2F A;  3NVV A;  1J7C A;  2OHF A;  3AEG B;  1JRO A;  1SF0 A;  1V8C A;  5EE9 A;  5H92 C;  4WWM A;  1ZXI A;  1XLP A;  1JW9 D;  2QIE B;  5H8Y E;  3VRB B;  1KRH A;  1L5P A;  5AUK A;  2W3S A;  1FFV A;  1EWY C;  3AH7 A;  3NVZ A;  1L6V A;  1V97 A;  2LEK A;  1I7H A;  2WP9 B;  2QJL A;  3HUI A;  5EE1 A;  1FRD A;  1WWT A;  1PDX A;  3EUB 2; 
#chains in the Genus database with same CATH topology
 1V5O A;  3B2G A;  3QK0 A;  3IXS A;  2M0A A;  1T5X D;  4C7Z A;  1A70 A;  3EA6 A;  3N9Y C;  1YIW A;  4DXG A;  4M0W A;  2H88 B;  2WU5 B;  2GBM A;  3FIL B;  1F2R I;  1TT5 B;  4RCO A;  5HG2 A;  1V1P B;  1KLU D;  1KM7 A;  1XLO A;  4XC2 A;  3PHX B;  1WR6 E;  1E0Z A;  5FK9 C;  3UQA A;  1L0V B;  4PS8 A;  4FUL A;  3ZNZ B;  1L7Y A;  2XEW A;  1WGR A;  3DHI C;  3GS2 A;  5JXV A;  3QA8 A;  1I4G A;  1WX8 A;  4MEM A;  4MT5 A;  4S0R A;  2IGG A;  2QC8 A;  3DQV A;  4AJW A;  3DCG A;  1E90 A;  1GUA B;  2M0X A;  2IO1 B;  1C3T A;  1JRU A;  4MGZ E;  2SAK A;  1BUI C;  1B1Z A;  2MEK A;  5BMH A;  2ZEQ A;  4IM3 A;  2ON8 A;  5CX3 A;  1RFA A;  1LGR A;  4N58 A;  3W5V B;  3L17 A;  5BMG A;  1T3Q A;  1T6B X;  1WYW B;  1VZ6 A;  2Y5P A;  3KWL A;  2EKI A;  1YN4 A;  3BVZ A;  2W55 A;  2CR5 A;  1GB1 A;  2LJ5 A;  3W1S C;  4K7S A;  5D6J B;  1WJN A;  4CQN A;  1P7E A;  2JT4 B;  3Q3N C;  4ARI A;  3MHZ A;  4WJO A;  1TY2 A;  1C77 A;  1DGJ A;  2ZPY A;  3TEW A;  2LWP A;  3NVV A;  2KKC A;  4K7U A;  2EKE C;  2REX A;  1V97 A;  3A1Q A;  1HE8 A;  1I7H A;  3JYU A;  5DPS A;  4TQ1 A;  1CQV A;  2JVC A;  4L2Y A;  2MJ3 A;  4RFB A;  1JWU D;  2C60 A;  4J3O D;  3AXC A;  1P1A A;  2QCZ A;  3KW5 B;  4DQO C;  1ZP0 B;  4CYE A;  2B3A A;  1UWX A;  1XO3 A;  1WXS A;  4GDK A;  2MJE A;  2DHZ A;  4WJP A;  2KWU B;  4WAF A;  4D2K A;  3GB1 A;  2KX3 A;  4OVZ A;  1FIQ A;  3M63 B;  3MP9 A;  2MCN B;  3DVG X;  4I6L B;  3P1M A;  4XDC A;  4KDL B;  1NYQ A;  1LQB A;  2QSD A;  3A9J B;  5BMI A;  4UDU C;  4LNO A;  4ZRP A;  3VRA B;  2MHJ A;  2YLM A;  3JSV A;  5C3J B;  4BOS C;  2N9K A;  1FRR A;  4G11 A;  3NG0 A;  3NS8 A;  1UBI A;  2KQ4 X;  3EFC A;  3ZVV A;  3PHW B;  4F1S A;  3B0A A;  1FM0 D;  1GNU A;  1ZDV A;  3GE8 C;  1I4H A;  1TTN A;  3GZN B;  2K25 A;  3WAM A;  2WHI A;  2KAN A;  3QCA A;  2UWQ A;  4NZL B;  3OAW A;  1GJZ A;  1YOV B;  5J2R A;  2PJH A;  1YX5 B;  1N61 A;  1C76 A;  2AL3 A;  4GXB A;  2LUM A;  2AL6 A;  2PTL A;  3LYY A;  4EEW A;  1WXQ A;  2R2Q A;  2KMC A;  3RD2 A;  1TKY A;  4GGQ A;  4N6E B;  3VR8 B;  2NTS A;  1WGY A;  3ETR A;  1WY8 A;  3ZUN A;  1YNT E;  3ONS A;  1GAQ B;  2AYO B;  3BWU D;  3CIR B;  4E71 A;  4PT5 A;  1QOB A;  4ICU A;  2KXJ A;  1L4Z B;  3VTU A;  2BB6 A;  3FKY A;  3TUO A;  1KRH A;  4TQ0 A;  2UU7 A;  2BBC A;  2WXG A;  5KHO A;  2OED A;  3P2B A;  2LEK A;  3AE1 B;  1VZ7 A;  4G50 A;  2DLB A;  2EMT A;  3ZJT A;  1YQ4 B;  3RI7 C;  2L8J A;  3WAL A;  1X1M A;  2O6V D;  2JZ3 B;  5AUI A;  3HK0 A;  2YEP B;  1QOA A;  3M95 A;  3ZJU A;  3LXF A;  2JZP A;  2JSV X;  3V61 A;  1J7A A;  3L4P A;  4HRS A;  3PSE B;  2MSE D;  1FFU A;  3N3K B;  1TKE A;  2LAS A;  4AP4 C;  1WM2 A;  4S17 A;  1CZP A;  3TEX A;  3CMM B;  3W2D A;  4BAX A;  1F2R C;  1WE7 A;  1JWS D;  4ANU A;  5IOI A;  3UIN B;  1T0R C;  4HCN B;  3T3N A;  1ET6 A;  3A4R A;  4EKU A;  4WWO A;  3BII D;  4KZC A;  1KOT A;  4WWN A;  3Q6B A;  3TL5 A;  1SBB B;  4NAW B;  1WZ3 A;  2KZR A;  2LI5 A;  5KHQ A;  3NRZ A;  4ZHO A;  2KFK B;  3RNC C;  1XCT L;  2MBH A;  2Z8L A;  4KIK B;  1UNS A;  2K22 A;  4PYU A;  3NJT A;  3ZW3 A;  1A5R A;  4HCP B;  3N20 C;  1D5Z C;  1YMH E;  1ZGU B;  1UBQ A;  1E5W A;  2KVR A;  4YWG G;  2BTE A;  2DEN B;  2LVP A;  5EE1 A;  1E7U A;  4A90 A;  2AWT A;  3EUB 2;  1KLV A;  4N59 A;  3SFE B;  3GE3 C;  2EEL A;  4MSQ B;  4MGY E;  4TSS A;  3KLS X;  3N30 A;  2BT6 A;  2JWZ A;  2FBW B;  5G5G A;  3AU5 A;  2HTH A;  3ZXV A;  4IWP A;  3K9O B;  4W9L A;  4P6V F;  2WXK A;  3N1Y C;  2WDT B;  3EGR A;  4C80 A;  1OQQ A;  3SD5 A;  4ZYS A;  4FJZ A;  3ZLZ A;  2I1K A;  3CWI A;  2KK8 A;  1ZUD 2;  1J19 A;  2W3R A;  1T0Q C;  4II2 B;  1NVI D;  1MVK A;  1VZ8 A;  3AEE B;  3IVF A;  5J17 A;  1JML A;  1XLN A;  2RSU A;  2IDY A;  5G55 A;  4RGM A;  3AUL A;  1CK1 A;  3E56 A;  1TYG B;  2BPS A;  1KTK A;  3KUD B;  3W9C B;  5MPO A;  1R4M I;  3UF8 A;  2X38 A;  1E8W A;  4ZYN A;  1JRP A;  2K8C A;  1CMX B;  2XK5 B;  2RMM A;  2K9X A;  2W54 A;  4C4V B;  3KWV A;  2LVQ A;  4KGS A;  3W1Y A;  2DWQ A;  3RN9 C;  4P1B C;  2KWD A;  2GB1 A;  3Q8F A;  4AUQ C;  4HK2 A;  4FA6 A;  5IN7 A;  3HM3 A;  2DYO A;  2ZZP B;  3I3T B;  2AEH A;  3CST A;  5FR6 A;  3WAO A;  1L5P A;  2KQS A;  3NZ3 A;  5D2M B;  2J53 A;  2NMQ A;  2IND C;  5D7G A;  1EU3 A;  3N32 A;  3H8H A;  5T8I A;  2GBJ A;  4X57 B;  3IAM 1;  2KWC A;  1E8Z A;  4US8 A;  2KOX A;  3UGB B;  4NQL B;  1UH6 A;  1ROE A;  4DWF A;  1E9M A;  2LXC A;  5J18 A;  5BYS A;  2VZK B;  2TSS A;  2L3Z A;  4P16 A;  4FJY A;  5BYR A;  2AQ2 B;  4ACF A;  2Z0E B;  4XGA B;  4BVU C;  3P4R B;  2MLB A;  1TJE A;  4FAD A;  1ZXH A;  2KC2 A;  4FHJ A;  2PEA A;  2N1V A;  1STE A;  4OVU A;  2KHW B;  1ZKH A;  2WXQ A;  1WXV A;  2R2O A;  1D4B A;  1V49 A;  2FUH B;  1IPG A;  1UGM A;  1CJE A;  1ZOY B;  4CHK A;  2L0T A;  3IFW B;  2O6V B;  3HRD D;  2FCQ A;  4F7Z A;  4HLE A;  2XBB C;  3TCA A;  3R7R A;  2ICI A;  3AV8 A;  2K5P A;  2K1F A;  2WX1 A;  3DHH C;  3OJ4 B;  3O65 B;  3Q2A C;  2ZCC A;  1DOI A;  5D94 A;  2DAJ A;  3KUZ A;  4KGR A;  1P98 A;  1L6U A;  3DBH B;  4BBN F;  4IOI E;  4N9F 4;  2WWZ A;  4ANW A;  2DYM A;  3MJW A;  2AQ3 B;  2IO3 B;  2K3U A;  2O2V B;  1BT0 A;  3VTV A;  2OHF A;  1F9J A;  4XDD A;  3PRE A;  3UI3 A;  4HDQ A;  2N9P C;  1KJT A;  1L6V A;  2KAC A;  2CHW A;  3IBE A;  4IDI A;  3AEF B;  4OHJ A;  2RDG A;  1XQQ A;  3DBH I;  5I4D A;  3H6N A;  2QMT A;  1WJ4 A;  4ARC A;  2ZNV C;  5E6P A;  1XEE A;  2DZJ A;  1TZO A;  3C19 A;  1HXY D;  2IBI B;  3DBS A;  1ZE3 D;  4GB9 A;  4KSL C;  2V4L A;  1TS5 A;  3DHG C;  4A55 A;  2DAF A;  2DZK A;  1F77 A;  2Z59 B;  4M0W B;  2WU2 B;  2WNM A;  2KYW A;  1YX6 B;  2NR2 A;  4IG7 B;  4JGH B;  3SHQ A;  5EDS A;  4GN1 A;  2BWF A;  5L95 C;  2NPT A;  2NBU A;  1UD7 A;  1WMH A;  2Y5C A;  2KN4 A;  1J8C A;  3TBL D;  4WJN A;  1Z5S B;  5LLI A;  3TJP A;  3HIZ A;  2LVO A;  4HVB A;  3PV1 A;  1WZ0 A;  1C1Y B;  2V3S A;  3P63 A;  2QIL A;  4ZHP A;  4LLG M;  2HD5 B;  2KC1 A;  2NVU I;  3H7S A;  3AU4 A;  3ZNI D;  4DHJ D;  1YQ3 B;  2ZW0 A;  1FNV A;  3EEC A;  5JZE B;  4YSZ B;  2FUG 1;  4YT0 B;  4WWP A;  1E6E B;  3IG3 A;  3VAW A;  1KFY B;  2AQ1 B;  5HHD G;  1WJU A;  2V3N A;  2CHX A;  3N1Z C;  1YQB A;  2WXR A;  1XXG A;  1ZDX A;  4RGT A;  4DHZ E;  2G4D B;  3DDC B;  1JRO A;  2BWE S;  4IW0 A;  1WR1 A;  5IAA C;  3KVF B;  2I1J A;  3H9D A;  3S2A A;  1QKZ A;  3NVZ A;  4L1B A;  3JVZ X;  1T0S C;  4RGO S;  1WRD B;  2M1M A;  2KDF B;  4W9E A;  4FHK A;  4WAA A;  3MC0 B;  3VH4 B;  2OJW A;  1WYG A;  2G4S A;  2RPV A;  2DX5 B;  2KFJ A;  2JXX A;  1WH3 A;  3UIO B;  4ZRK A;  3C8Y A;  2LFI A;  4KV2 A;  3T8M A;  2BVC A;  3U8Z A;  1F0Z A;  3A1Q B;  2J7Q B;  3LJ3 A;  1JWM D;  5FR3 A;  3N1X C;  1TS4 A;  3PZD A;  4WQM A;  1MPE A;  1KF6 B;  2J0M A;  4WQO B;  2N7D A;  2C5L C;  2J52 A;  2VH2 A;  1PGA A;  4JE3 B;  4WJQ A;  2CKH B;  4LNI A;  4GDK B;  4JWU C;  2MX2 A;  3B08 A;  3AE3 B;  2BYV E;  4QAY A;  3BYT B;  3AE6 B;  3OG5 A;  1EO6 A;  2V1Y A;  2INN E;  4KVG B;  1HTQ A;  2KNB A;  4K7W A;  3QQ8 B;  3IAS 1;  4JPS A;  3NOB A;  4GSW A;  1I4X A;  3JSV B;  3DVN V;  3ZTC A;  1LXD A;  2KQ7 A;  5LXH A;  1HTO A;  1RWS A;  2E6X A;  4E3C A;  3AE2 B;  1I4P A;  2K6Q A;  3SU8 X;  3VTW A;  3ALB A;  2L00 B;  1RFK A;  1Q5W B;  4GOC A;  4KKI A;  1NEK B;  2NS5 A;  1E7V A;  3JW0 X;  2C7H A;  2KLC A;  2L7R A;  2GBK A;  2LMC A;  2K0P A;  2LRU A;  3MHS D;  3EC8 A;  2M8S A;  2FID A;  2KJR A;  2BQQ A;  3RZW C;  2DZI A;  2KDB A;  2N7J A;  4C7Y A;  3I5J C;  4JWS C;  2SEB D;  2Y5B B;  4ZOH C;  5CHF A;  1HQR D;  3BK1 A;  5G2N A;  3AE4 B;  2L1A A;  1JWB D;  2RD0 A;  1TY0 A;  3O13 A;  4OVV A;  2BGF A;  4YTN B;  3UQB A;  3PRP B;  4EUT A;  1GG3 A;  2QDF A;  2QEJ C;  3PZ7 A;  4TUU A;  3PS6 A;  1NDD A;  1EM7 A;  1EF1 A;  4RNA A;  3VUW A;  3ZNG C;  4XE0 A;  3GOE A;  3DBR I;  2LHE A;  1I4R A;  1R4N B;  5C2T B;  1LFD A;  2MBB B;  2GLS A;  4H2A A;  4A8X C;  4RMA A;  3L13 A;  1S1Q B;  1PQS A;  3RNG C;  2N4F A;  3RZF A;  2KMM A;  4DDG D;  1K53 A;  4XZ4 A;  3RNA C;  1F1H A;  2CS4 A;  1C4P A;  4I6N B;  4B9K A;  1UZX B;  3QIJ A;  3H7P A;  5JHA A;  4KDI C;  5E6N A;  1WI0 A;  4M01 A;  1OEY A;  4RF1 A;  4USA A;  1XT9 B;  3SR6 A;  2CU1 A;  4OZB A;  1SJE D;  4LDT B;  4YSX B;  1R4N I;  3PVL A;  1AN8 A;  2LZ6 A;  4XWW A;  2PE6 B;  2WYQ A;  2L83 A;  1S3S G;  4HEA 1;  1OEY J;  4NJC A;  3BIN A;  4YXD B;  3BVG A;  3VXW A;  1SIF A;  4HXD A;  1TZ1 A;  1H4R A;  3E9S A;  2OJR A;  1SF0 A;  2VH1 A;  1I4Q A;  1V8C A;  1IGC A;  1JW9 D;  4HPP A;  3J9C A;  2IGD A;  3U52 E;  1MFW A;  2D3A A;  1TBE A;  4GDL A;  1F52 A;  1D5X C;  3ZXR A;  1G6J A;  2BB5 A;  1C4C A;  1FRD A;  3V60 A;  3UIP B;  2KTR A;  4NQK E;  3Q3F A;  2KDI A;  3MC8 A;  1QF6 A;  2BW2 A;  4GLS C;  4A9A A;  1BML C;  4W9K A;  4WH4 A;  4FLH A;  1WF9 A;  1ZW7 A;  1J0G A;  3MTN B;  4MDK E;  2RDB C;  1MJD A;  4P7I A;  3VUX A;  4B95 A;  3OLM D;  4ANX A;  5DPT A;  3BZD B;  3RMK C;  4BKS A;  2IPK D;  5C1Z A;  2KAJ A;  3AE5 B;  4A20 A;  4M8M A;  3CSF A;  4O1N A;  3KYC D;  5BO4 B;  3VQI A;  3L16 A;  1N6Z A;  2LGX A;  3V05 A;  1QOG A;  1R4M B;  2KJ6 A;  1SIJ A;  4ITK A;  3K9P B;  4NY0 A;  1QT9 A;  2HJ1 A;  1LO5 D;  2JWU A;  2W9N A;  4MH0 E;  1JCK B;  4B6W A;  2D3C A;  5E6O A;  3PZ8 A;  1GB4 A;  2PIA A;  5AZH A;  5TSS A;  4BZA A;  1FO4 A;  1OGW A;  1VLB A;  2V3P A;  4W9F A;  1ISN A;  2JY6 A;  4W9G A;  3W1S A;  2JYE A;  4J6I A;  4EFO A;  3QHT A;  4PS3 A;  1EWC A;  3RNF C;  5IO9 A;  2NTT A;  1QZE A;  2PLP A;  1V81 A;  1M94 A;  2QIE B;  1IBX A;  4RF0 A;  3DBL B;  4MM3 A;  2GBN A;  1EWY C;  4EZJ A;  3M62 B;  4C56 C;  4B0M A;  3KH0 A;  4PS7 A;  4ZRI A;  2RDH A;  3MC9 A;  1C79 A;  1N63 A;  3AED B;  3PO0 A;  2KDE B;  1RAX A;  2MA9 B;  1L2N A;  3V3X A;  4C00 A;  1DOY A;  3HVZ A;  3A9K A;  3PTF C;  4DXF A;  1WGG A;  3DBL I;  4WUR A;  2KJH B;  2ZCB A;  2ZVN A;  2MBO A;  3R2T A;  1L0X B;  4NJ7 A;  4FBJ B;  1GOZ A;  4I6P A;  3A33 B;  1YN5 A;  4A3P A;  3Q3J A;  2KN5 A;  1EU4 A;  1WIA A;  3APD A;  1WGD A;  4MJS A;  5TR5 A;  3PRM B;  1FXT B;  1E7P B;  4LNN A;  1HZ6 A;  1AYF A;  3RCZ A;  2WS3 B;  2WXO A;  2WXL A;  4MAC A;  1FMA D;  2LD9 A;  3VHT C;  1NI2 A;  2WXJ A;  1VCB A;  5DCN A;  1QLB B;  4IC7 B;  3WAN A;  1XD3 B;  2BYT A;  2N0S B;  4M02 A;  3L0W B;  2PE9 A;  1WX7 A;  2K6D B;  2VRR B;  3TEY A;  2IY1 B;  4YTP B;  3NS1 A;  1OFF A;  2FE8 A;  4AS1 A;  3TSS A;  2Z0D B;  1HEZ E;  1WGK A;  4E74 A;  4YTM B;  4AJY B;  4RM9 A;  3AMZ A;  2AX5 A;  4EE2 A;  2FNJ B;  2BYE A;  4IM0 A;  3QAR A;  1FPY A;  2XNA C;  1PDX A;  2LRW A;  4K1R B;  1ACC A;  2ZW1 A;  2MBQ A;  4OW0 A;  1N60 A;  1K51 A;  2HJ8 A;  2C7N B;  1XF5 L;  5JHB A;  4HJK A;  4DXA B;  1R7S A;  2PW9 A;  3PLV A;  1RYJ A;  4Q2J A;  2IZV B;  4K3C A;  1L0Y B;  1V9J A;  2JPH A;  1FNW A;  1OQR A;  3APC A;  1SE2 A;  2MP2 A;  4ASW C;  4M8N A;  3A4S C;  4LJO B;  3WCQ A;  4OZA A;  3ZRF A;  4JLC A;  2GOW A;  4IKG A;  1TS2 A;  4TKN A;  1WRI A;  1UGJ A;  3AN1 A;  1MG8 A;  3Q14 C;  2LJI A;  3IT4 B;  2X8X X;  1V5T A;  4BKT A;  5GMV A;  1TS3 A;  2L52 A;  3NVW A;  4NNJ B;  3NUH B;  4HWI B;  3IHP C;  2GMI C;  2INP E;  1H8C A;  1IP9 A;  4HRO A;  1KH0 A;  3IT6 B;  3AE8 B;  1MI0 A;  1GPX A;  2JXT A;  3KUC B;  5EE3 A;  2MBE A;  2IGH A;  1YJ1 A;  4BBN C;  4LNK A;  4GMV A;  4DHZ B;  1MG4 A;  1K50 A;  3VR9 B;  3BVM A;  2K8H A;  2JZZ A;  1KLG D;  3QAQ A;  3X23 A;  3MFG A;  3RT3 B;  2NPT B;  3ZRC A;  1XCQ L;  1K8R B;  2G9H D;  3FIL A;  1WMH B;  1N62 A;  3NVY A;  2JF5 A;  2IO0 B;  4IWQ A;  1V1P A;  3B2F A;  3DVG Y;  1SSN A;  4WWM A;  3DVN U;  5H8Y E;  3VRB B;  2IYD B;  5DPR A;  2WXF A;  2CHZ A;  1OTR B;  2QJL A;  3HM6 X;  3VH3 B;  4AWJ A;  1EUV B;  1YN3 A;  2MWS B;  1TKG A;  2M17 A;  3MJ5 A;  2N9X A;  3VUY A;  4F8C B;  3Q8E A;  3VFK A;  2KTF A;  2L0F A;  2WXP A;  5DPW A;  3AEA B;  1PGB A;  1C9F A;  1MHX A;  2BKR B;  3U30 A;  4BKS D;  2PVG C;  5AEK B;  2ONQ A;  5HI1 A;  4US9 A;  2DZM A;  1UF0 A;  2N9E B;  5HFY A;  2EMS A;  2FCM A;  4EZK A;  4G0N B;  1HZ5 A;  2YVC A;  1I42 A;  5GXG B;  1WSP A;  4GIV A;  1Y8R C;  2KT7 A;  2WX0 A;  2PVO D;  1RRB A;  4XYC A;  3RUL A;  1NBF C;  1V1O A;  3T9L A;  3FAH A;  3BK2 A;  1VD2 A;  1SXT A;  5AZG A;  2BF8 B;  3PT2 B;  1IGD A;  2WXH A;  3ZKJ C;  4HJG E;  4AOF A;  2BS4 B;  3C0R B;  2ACZ B;  1WXM A;  2IJ0 A;  1FXI A;  4XX5 A;  1C4A A;  4ZRQ A;  3WIM A;  3ZDM C;  3EHV A;  5CHV C;  3RNE C;  4JX1 C;  1WE6 A;  4KGT A;  3V62 A;  2RGF A;  3OWE B;  3U2S C;  4DK5 A;  3U4E G;  4MGI E;  2ASQ A;  3Q69 A;  5G5H A;  3VDZ A;  5L83 A;  2GBR A;  5FKA C;  1P3Q U;  3P4S B;  1NEN B;  2JRI B;  1J7C A;  3V6E B;  2GI9 A;  4ICV A;  4DBG A;  2W3S A;  3AH7 A;  1WJ6 A;  3NHE B;  4BOZ B;  4GU2 A;  3A9J A;  2WXM A;  3R3M A;  1I35 A;  3TMP B;  4FN2 A;  3Q8A A;  2KWV B;  4R3D A;  1ET9 A;  1TGZ B;  2V0G A;  3KQ4 A;  4IUM B;  3DWG C;  4NPN A;  3ZGZ A;  1P7F A;  2JQR B;  4BFR A;  1E10 A;  2NCN A;  1J7B A;  1PYW D;  2LUE A;  2C7M B;  4PK1 A;  2HTM E;  1YD8 U;  2WDQ B;  1AAR A;  5D3D A;  1RLF A;  3DBR B;  4W9D A;  2JRH A;  3TEZ A;  3ECI A;  4CO7 A;  1B9R A;  1WXA A;  2BS3 B;  3R2I A;  3SEB A;  3AE9 B;  1WX9 A;  3H1U A;  3RPF C;  4M00 A;  4FJV B;  4A6Q A;  1NI3 A;  1FCC C;  3PPA A;  2CJO A;  3WAP A;  2MRP A;  4NAM A;  3DOW A;  3FC4 A;  2D3B A;  2WDR B;  2VZK D;  3L10 B;  1V86 A;  3RUI B;  1Z2M A;  1VJK A;  3EFU A;  1BXT A;  2H89 B;  3AI5 A;  3GZN I;  4RH6 A;  1V6E A;  3ZQ4 A;  4PYZ A;  4LCD E;  2A5U A;  1NYR A;  1JWA D;  4HKZ E;  1E8Y A;  1YJJ A;  2KDM A;  5E6J A;  1JAL A;  4ZDV A;  2R61 A;  3Q8B A;  4LJP B;  2G1E A;  4HKQ A;  2J4X A;  2DNF A;  3H7P B;  1DOX A;  2B76 B;  4K81 A;  4ANV A;  4W9I A;  1UUP A;  4NJ6 A;  3AEG B;  5H92 C;  1FEH A;  1ZXI A;  1XLP A;  3P42 A;  2UYZ B;  2NBW B;  3HUI A;  3QJZ A;  1WWT A;  1T0Y A;  2J0J A;  5C23 A;  2KVZ A;  3R66 C;  4EZL A;  4RGN A;  4P1C C;  4YSY B;  3RNB C;  1SEB D;  2QHO A;  1OQY A;  3QX1 A;  4XWT A;  2J42 A;  3ZO5 B;  2G45 B;  4HDO A;  4GDL B;  4HPL B;  2ZNV B;  2FAZ A;  4NAW A;  2KTR B;  1HA5 A;  2KFK A;  4JL9 A;  4DHJ B;  5CTR C;  2WXN A;  1SJH D;  4URK A;  3Q3M C;  3CF6 E;  4KIK A;  2BKF A;  4A3O A;  2IO2 B;  3R7Q A;  3LB8 C;  3APF A;  1JQ4 A;  1QOF A;  2M4N A;  1Q1O A;  2HE7 A;  2G3Q B;  1EF5 A;  3ZIM A;  2RPQ A;  3AB5 A;  2N9L A;  4LTU A;  3ZJV A;  4ZRJ A;  2WGS A;  2M19 A;  3V6C B;  1K52 A;  2CJN A;  1XLQ A;  2FCS A;  2KO3 A;  2HDE A;  3VVW B;  4L23 A;  4KKJ A;  3W5U B;  2D10 A;  1UWM A;  2MJD A;  4HPM B;  4MGK E;  3ZYY X;  1FD6 A;  3Q3O C;  1UEL A;  2WLB A;  5IP4 D;  1D6E C;  3ML9 A;  3P4Q B;  4IWO A;  1V80 A;  5CHW A;  2D5G A;  1D3Z A;  2ZJD A;  2FIF A;  1E8X A;  3RYT A;  2JU6 X;  1GC7 A;  2PMV A;  5AUK A;  3I9V 1;  3T3O A;  1FFV A;  4W9H A;  3I57 A;  2WP9 B;  2KD0 A;  3I63 C;  3M3J A;  3ZNH B;  1PUT A;  4DDI D;  4KX6 B;  2WDV B;  3OJ3 A;  5D3I B;  3ZTD A;  5LXI B;  2JYT A;  3NY5 A;  2JX5 A;  2KLG A;  2LHD A;  2CU3 A;  1RM6 C;  1V2Y A;  3WA0 A;  1IUE A;  1MHH E;  2PKO A;  2Q5W D;  1P9D U;  3AEB B;  3B9J A;  2MQJ A;  3PRZ A;  1IBX B;  4MM3 B;  4MSM B;  3R8B A;  1LM8 B;  1FXA A;  2D2Q A;  3ML8 A;  1ZPS A;  2DBY A;  1SGH A;  3PGE A;  1PFD A;  2XK5 A;  1DYQ A;  5IKC M;  4TV3 A;  2L32 A;  1VDV A;  1QIL A;  3TIX A;  1AWD A;  4MH8 A;  4C4V A;  4KZ0 A;  2GRI A;  3AM9 A;  4OZC A;  2KMA A;  3A9K B;  2N7E A;  1TIF A;  2RR9 A;  1IYF A;  1SE4 A;  1N5W A;  5LNK 1;  2C9W B;  1L4D B;  2MW5 A;  5BYQ A;  4II3 B;  2A4Z A;  3RFZ B;  2INC C;  4MEL A;  1WM3 A;  3ABV B;  1SE3 A;  2K39 A;  4MJS B;  1FNU A;  1GC6 A;  2NBV B;  3L54 A;  5HKH A;  2W82 A;  3Q8C A;  3NZU A;  2LGD A;  2LXA A;  2PPH A;  2KX0 A;  3BYY B;  4YL8 A;  2I38 A;  2V9H A;  2LGY A;  3HVD A;  3LDZ E;  1Y56 A;  1AW7 A;  4TMA B;  2WXI A;  2YEP F;  3KYD D;  3GP7 A;  3X0W A;  2V4I B;  2E3T A;  4LNF A;  4G3X B;  3ZDT A;  1N5X A;  3PLU A;  2D07 B;  2K8B A;  3D32 A;  2LGS A;  4K3B A;  2BS2 B;  2O6V A;  1C78 A;  2N1W A;  3B1L X;  1D5M C;  2WQY B;  1VR9 A;  1YJI A;  3U7Z A;  4B0E A;  2FCN A;  4JIO U;  1PGX A;  3AE7 B;  4FXC A;  1U4A A;  3SFD B;  1WGH A;  3NZS A;  2OOB B;  1SB3 C;  2Y3A A;  4REZ A;  4EOY A;  3QC8 B;  4RM8 A;  2MH7 A;  2DYB A;  3URY A;  2XN9 C;  4AQ7 A;  1VRA B;  2O2V A;  4WIP A;  2LGI A;  4BKG A;  1Q0W B;  1ESF A;  2MP2 B;  3AEC B;  4W9J A;  1ENF A;  2L76 A;  3P4P B;  5JH5 C;  5EE0 A;  5AZF A;  2JUO A;  2M56 B;  3ENE A;  4KSK C;  3U7D A;  1SE9 A;  1P0R A;  2ZVO A;  2I2Y A;  3L08 A;  2D11 A;  3QWZ B;  5IA7 A;  1Q10 A;  1QQR A;  3DWM A;  4LK0 M;  4IM2 A;  3BY4 B;  4JQW C;  2D3G A;  5EE9 A;  2BYF A;  4W9C A;  1M4V A;  2L05 A;  2J0K A;  3DPD A;  4LDT D;  3SDL C;  1FCL A;  1WFY A;  2ZPN A;  3HHM A;  2IY0 B; 
#chains in the Genus database with same CATH homology
 3B2G A;  3IXS A;  2WXM A;  2M0A A;  1T5X D;  4C7Z A;  1A70 A;  3EA6 A;  3N9Y C;  3IAM 1;  4DXG A;  3Q8A A;  2H88 B;  4M0W A;  4R3D A;  4US8 A;  1QF6 A;  1ET9 A;  2BW2 A;  4GLS C;  2V0G A;  2WU5 B;  4A9A A;  1BML C;  3FIL B;  1F2R I;  3KQ4 A;  3DWG C;  3ZGZ A;  4RCO A;  1P7F A;  5HG2 A;  2JQR B;  1ROE A;  1KLU D;  1V1P B;  1E10 A;  4WH4 A;  1XLO A;  1J7B A;  1PYW D;  1E0Z A;  1E9M A;  5FK9 C;  1L0V B;  2HTM E;  2WDQ B;  5BYS A;  2VZK B;  2TSS A;  5D3D A;  4P16 A;  5BYR A;  2AQ2 B;  3TEZ A;  3BZD B;  3GS2 A;  1B9R A;  5JXV A;  2BS3 B;  2IPK D;  3R2I A;  1I4G A;  3SEB A;  4MT5 A;  3AE9 B;  2IGG A;  2KAJ A;  3AE5 B;  3P4R B;  1TJE A;  1ZXH A;  3RPF C;  4A6Q A;  4O1N A;  1NI3 A;  3VQI A;  1FCC C;  2CJO A;  1STE A;  4NAM A;  3FC4 A;  3V05 A;  2WXQ A;  2SAK A;  1D4B A;  1BUI C;  1B1Z A;  2MEK A;  1QOG A;  2WDR B;  2VZK D;  1SIJ A;  5BMH A;  2ON8 A;  1CJE A;  4ITK A;  1ZOY B;  3HRD D;  1VJK A;  1BXT A;  2H89 B;  4N58 A;  3W5V B;  2ICI A;  3AV8 A;  1QT9 A;  4RH6 A;  3ZQ4 A;  2K5P A;  1LO5 D;  2JWU A;  5BMG A;  1JCK B;  1NYR A;  1T3Q A;  1T6B X;  2Y5P A;  1VZ6 A;  3KWL A;  1JWA D;  3PZ8 A;  4HKZ E;  2EKI A;  1YN4 A;  3BVZ A;  1GB4 A;  2PIA A;  2W55 A;  5TSS A;  1GB1 A;  1YJJ A;  2KDM A;  5E6J A;  1DOI A;  1JAL A;  1FO4 A;  1VLB A;  2V3P A;  1P7E A;  4ARI A;  4CQN A;  3W1S A;  3MHZ A;  4KGR A;  2R61 A;  1L6U A;  1TY2 A;  1C77 A;  3Q8B A;  4IOI E;  2JYE A;  2G1E A;  1DGJ A;  4HKQ A;  2DYM A;  2J4X A;  2AQ3 B;  2K3U A;  3TEW A;  1DOX A;  2B76 B;  3NVV A;  2OHF A;  1EWC A;  4XDD A;  1UUP A;  2NTT A;  3AEG B;  2PLP A;  5H92 C;  1FEH A;  1ZXI A;  1XLP A;  2QIE B;  3UI3 A;  1IBX A;  3P42 A;  4RF0 A;  1EWY C;  1L6V A;  1V97 A;  2KAC A;  1I7H A;  3HUI A;  1WWT A;  4TQ1 A;  1CQV A;  4C56 C;  4B0M A;  4IDI A;  3AEF B;  4OHJ A;  4L2Y A;  2MJ3 A;  2RDH A;  4RFB A;  1JWU D;  4RGN A;  2RDG A;  4J3O D;  1C79 A;  1N63 A;  4YSY B;  4DQO C;  1ZP0 B;  3AED B;  3PO0 A;  1UWX A;  1SEB D;  3V3X A;  5I4D A;  1XO3 A;  2QMT A;  2MJE A;  4XWT A;  2J42 A;  4D2K A;  4WAF A;  1DOY A;  3HVZ A;  3GB1 A;  4ARC A;  4OVZ A;  1FIQ A;  3MP9 A;  4DXF A;  1XEE A;  4WUR A;  4GDL B;  1TZO A;  3P1M A;  4XDC A;  1HXY D;  1NYQ A;  3R2T A;  2QSD A;  1ZE3 D;  5BMI A;  1L0X B;  4UDU C;  1GOZ A;  1TS5 A;  4ZRP A;  3VRA B;  4A55 A;  1YN5 A;  1F77 A;  1HA5 A;  1EU4 A;  5C3J B;  2N9K A;  2WXN A;  1SJH D;  2WU2 B;  2WNM A;  1FRR A;  2KQ4 X;  1FM0 D;  1ZDV A;  1E7P B;  1I4H A;  3LB8 C;  2Y5C A;  1JQ4 A;  2KN4 A;  1HZ6 A;  1QOF A;  1AYF A;  2WS3 B;  2WXO A;  2WXL A;  4MAC A;  1FMA D;  3AB5 A;  2WXJ A;  4NZL B;  2N9L A;  1QLB B;  4LTU A;  3ZJV A;  3P63 A;  2QIL A;  4ZHP A;  4LLG M;  2M19 A;  2BYT A;  2N0S B;  1K52 A;  1N61 A;  1C76 A;  1XLQ A;  2CJN A;  1YQ3 B;  2ZW0 A;  1FNV A;  2LUM A;  2PTL A;  3LYY A;  3TEY A;  1WXQ A;  4YTP B;  2HDE A;  4YSZ B;  3NS1 A;  4L23 A;  1TKY A;  2FUG 1;  4KKJ A;  4YT0 B;  4N6E B;  3W5U B;  3VR8 B;  1OFF A;  1UWM A;  2NTS A;  3ETR A;  2MJD A;  2FE8 A;  1E6E B;  1YNT E;  4AS1 A;  1GAQ B;  1KFY B;  2AQ1 B;  3BWU D;  5HHD G;  2V3N A;  3TSS A;  3ZYY X;  1FD6 A;  1HEZ E;  3CIR B;  2WLB A;  4PT5 A;  1WGK A;  1D6E C;  3P4Q B;  2WXR A;  1XXG A;  1QOB A;  1ZDX A;  4YTM B;  3AMZ A;  2AX5 A;  4RGT A;  2D5G A;  1L4Z B;  2BB6 A;  1JRO A;  3TUO A;  2JU6 X;  4EE2 A;  1KRH A;  2PMV A;  4TQ0 A;  5AUK A;  3I9V 1;  2BBC A;  2WXG A;  3T3O A;  1FFV A;  1QKZ A;  3NVZ A;  2OED A;  4L1B A;  3I57 A;  2LEK A;  2XNA C;  2WP9 B;  4RGO S;  1PDX A;  3AE1 B;  1PUT A;  4KX6 B;  2WDV B;  5D3I B;  1VZ7 A;  1ACC A;  3MC0 B;  2DLB A;  2JYT A;  2JX5 A;  2ZW1 A;  3ZJT A;  1YQ4 B;  4OW0 A;  1N60 A;  2LHD A;  1K51 A;  1WYG A;  2RPV A;  1XF5 L;  2CU3 A;  1RM6 C;  1IUE A;  1R7S A;  5AUI A;  1MHH E;  2PW9 A;  3C8Y A;  1RYJ A;  4Q2J A;  2YEP B;  1QOA A;  2PKO A;  2LFI A;  2Q5W D;  3ZJU A;  3LXF A;  3AEB B;  3B9J A;  1L0Y B;  1IBX B;  1FNW A;  1OQR A;  1SE2 A;  4MM3 B;  2JZP A;  2JSV X;  3R8B A;  1F0Z A;  1J7A A;  1FXA A;  3WCQ A;  4OZA A;  3L4P A;  4HRS A;  1ZPS A;  4IKG A;  1JWM D;  1TS2 A;  1WRI A;  2DBY A;  5FR3 A;  1UGJ A;  3AN1 A;  1FFU A;  1PFD A;  1DYQ A;  1TKE A;  1TS4 A;  2LJI A;  3IT4 B;  1MPE A;  4WQM A;  2L32 A;  1KF6 B;  1VDV A;  1CZP A;  1QIL A;  3TEX A;  1AWD A;  1TS3 A;  2J52 A;  3W2D A;  1F2R C;  4MH8 A;  1PGA A;  4JE3 B;  2L52 A;  3NVW A;  3NUH B;  1JWS D;  2GRI A;  4GDK B;  2INP E;  3AM9 A;  4OZC A;  4HRO A;  1KH0 A;  3IT6 B;  4JWU C;  3AE8 B;  3T3N A;  1MI0 A;  1ET6 A;  3AE3 B;  3BII D;  1GPX A;  3BYT B;  1SE4 A;  3AE6 B;  2JXT A;  2INN E;  1N5W A;  5EE3 A;  5LNK 1;  1L4D B;  2IGH A;  3IAS 1;  4JPS A;  5BYQ A;  1SBB B;  4NAW B;  1I4X A;  3NRZ A;  4ZHO A;  3RFZ B;  1FRD A;  1K50 A;  3VR9 B;  3BVM A;  1KLG D;  3ABV B;  1SE3 A;  1XCT L;  2Z8L A;  1RWS A;  2E6X A;  3MFG A;  3AE2 B;  1I4P A;  1UNS A;  1FNU A;  1RFK A;  2K22 A;  1XCQ L;  2G9H D;  3FIL A;  4KKI A;  1N62 A;  3NVY A;  2W82 A;  3Q8C A;  1NEK B;  1V1P A;  3B2F A;  1SSN A;  3BYY B;  1D5Z C;  4WWM A;  2I38 A;  2LMC A;  2K0P A;  5H8Y E;  1YMH E;  3VRB B;  3HVD A;  4YWG G;  2BTE A;  1Y56 A;  2WXF A;  1AW7 A;  2QJL A;  4TMA B;  5EE1 A;  4A90 A;  2N7J A;  2WXI A;  2YEP F;  3EUB 2;  4C7Y A;  4N59 A;  1YN3 A;  4JWS C;  3GP7 A;  1TKG A;  2V4I B;  3SFE B;  3MJ5 A;  2EEL A;  2E3T A;  2SEB D;  4ZOH C;  1N5X A;  3Q8E A;  4TSS A;  3KLS X;  1HQR D;  3BK1 A;  2BT6 A;  2WXP A;  2FBW B;  3AE4 B;  3AEA B;  2L1A A;  5G5G A;  1JWB D;  1PGB A;  1TY0 A;  1C9F A;  1MHX A;  3O13 A;  2PVG C;  4YTN B;  2ONQ A;  5HI1 A;  4US9 A;  2QEJ C;  3PZ7 A;  5HFY A;  4P6V F;  2BS2 B;  1EM7 A;  1HZ5 A;  2WXK A;  4C80 A;  3EGR A;  4RNA A;  1OQQ A;  4ZYS A;  5GXG B;  1C78 A;  1WSP A;  4XE0 A;  3CWI A;  2LHE A;  1I4R A;  1D5M C;  2WQY B;  1VR9 A;  1YJI A;  2PVO D;  3U7Z A;  1ZUD 2;  2W3R A;  5C2T B;  4B0E A;  4H2A A;  4A8X C;  1NVI D;  1V1O A;  1PGX A;  1MVK A;  3AE7 B;  4FXC A;  1VZ8 A;  3FAH A;  2KMM A;  3AEE B;  3SFD B;  1K53 A;  3BK2 A;  1SB3 C;  1SXT A;  2Y3A A;  4REZ A;  1JML A;  1XLN A;  2IDY A;  2MH7 A;  3URY A;  1C4P A;  2XN9 C;  4AQ7 A;  1IGD A;  2WXH A;  4RGM A;  1VRA B;  4WIP A;  1CK1 A;  2LGI A;  3E56 A;  1ESF A;  4HJG E;  1TYG B;  3AEC B;  1ENF A;  3P4P B;  2BS4 B;  1KTK A;  5EE0 A;  2ACZ B;  3W9C B;  5MPO A;  4RF1 A;  4USA A;  2IJ0 A;  1FXI A;  2M56 B;  1C4A A;  2X38 A;  3SR6 A;  1JRP A;  4OZB A;  1SJE D;  4ZRQ A;  4JX1 C;  2RMM A;  4KGT A;  2K9X A;  4YSX B;  1AN8 A;  4XWW A;  3OWE B;  3U2S C;  2W54 A;  2L83 A;  3U4E G;  4HEA 1;  2I2Y A;  3Q69 A;  5G5H A;  4NJC A;  4YXD B;  3BVG A;  3KWV A;  5FKA C;  3P4S B;  4KGS A;  1Q10 A;  1NEN B;  1QQR A;  3DWM A;  4LK0 M;  2DWQ A;  2KWD A;  2GB1 A;  3Q8F A;  1J7C A;  3E9S A;  1SF0 A;  1I4Q A;  1V8C A;  2GI9 A;  5EE9 A;  1IGC A;  1M4V A;  2DYO A;  1JW9 D;  3J9C A;  1L5P A;  2IGD A;  2W3S A;  3U52 E;  3AH7 A;  3NZ3 A;  1FCL A;  2J53 A;  1D5X C;  2NMQ A;  5D7G A;  2BB5 A;  1EU3 A;  1C4C A;  3H8H A;  5T8I A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...