1SF0A

Backbone solution structure of mixed alpha/beta protein pf1061
Total Genus 4
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
4
sequence length
68
structure length
68
Chain Sequence
KMIKVKVIGRNIEKEIEWREGMKVRDILRAVGFNTESAIAKVNGKVVLEDDEVKDGDFVEVIPVVSGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural genomics, unknown function
molecule keywords hypothetical protein PF1061
publication title Backbone solution structures of proteins using residual dipolar couplings: Application to a novel structural genomics target.
pubmed doi rcsb
source organism Pyrococcus furiosus
total genus 4
structure length 68
sequence length 68
ec nomenclature
pdb deposition date 2004-02-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02597 ThiS ThiS family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1sf0A00
1YJIA 1TKYA 2W55A 3NVVA 1XLNA 1DOYA 2MJ3A 3AH7A 3CWIA 1YQ4B 1NYRA 1XO3A 4US8A 2WS3B 1DOIA 3AEGB 1RM6C 3DWGC 3FAHA 1WWTA 5G5GA 2L52A 1RWSA 2MJDA 1E10A 2CU3A 2PKOA 3FC4A 3VR8B 1FXAA 1SF0A 2JX5A 3AE3B 3DWMA 1L6VA 3P4SB 3W9CB 3VR9B 1V8CA 3B9JA 2W3RA 2EKIA 4YTPB 1VLBA 1L6UA 3AN1A 3AE8B 1R7SA 4WWMA 1ZXIA 3SFDB 3AEDB 4WQMA 2WDRB 1N5XA 4JWSC 5EE9A 1FO4A 1J7BA 3NVWA 1L5PA 3ZYYX 4ZHOA 1PUTA 3RPFC 3AEEB 2K22A 3B2GA 3AE9B 1KF6B 2E3TA 2Y5CA 1J7CA 1QLBB 1YJJA 2PIAA 4FXCA 1TKGA 1JQ4A 1JALA 3SFEB 2BT6A 3HVZA 1VJKA 2N0SB 3KWLA 5AUIA 3P63A 3LXFA 3L4PA 3NVZA 4YTMB 1NYQA 4YSXB 1B9RA 5H8YE 1DOXA 3AEAB 2QJLA 2PVGC 1SB3C 3AECB 1CJEA 2DWQA 4YT0B 2ACZB 2H89B 1ZP0B 3AE7B 1I7HA 1V97A 3AM9A 4KX6B 4N6EB 1JWAD 1KRHA 1NI3A 1E0ZA 1WGKA 2L83A 1WRIA 1TYGB 4P6VF 1N60A 1ROEA 4YXDB 2BS2B 2KMMA 1N62A 4C7YA 4YSZB 3P4QB 1FIQA 5EE0A 1JWBD 4A9AA 1N5WA 2WU5B 1AYFA 4USAA 1E7PB 1OQRA 1AWDA 1OQQA 3AE5B 1FXIA 1GAQB 2WQYB 1FRDA 1RFKA 2KAJA 2HTME 3HUIA 4LTUA 3AE6B 5MPOA 1FFVA 3NS1A 1JROA 1QOFA 3HRDD 2M19A 1E9MA 5G5HA 1J7AA 2QIEB 3NVYA 5H92C 1QOAA 2BS3B 4JWUC 3AEFB 2B76B 4YTNB 1ZUD2 4YSYB 1IUEA 2M56B 1DGJA 5C2TB 2BS4B 2W3SA 1WXQA 3ABVB 4C7ZA 1JW9D 1EWYC 1VDVA 1FM0D 2OHFA 4HROA 4N58A 2K9XA 2CJOA 5EE1A 1QT9A 1SIJA 1ZOYB 3EUB2 3VRAB 3W5UB 2PVOD 3BIID 1N63A 1WYGA 4ITKA 3P4PB 4IDIA 3AE2B 3ETRA 4ZHPA 3AMZA 1KFYB 1QOGA 1XLOA 2DBYA 1NENB 2WLBA 4HRSA 3WCQA 1NEKB 1PFDA 1QF6A 1T3QA 4N59A 3AEBB 3AV8A 1FFUA 3AE4B 3AB5A 1A70A 1QOBA 3NRZA 4US9A 2G1EA 3CIRB 1FRRA 3PO0A 5C3JB 1PDXA 1E6EB 2K5PA 2MJEA 1CZPA 5EE3A 5AUKA 2FBWB 2Q5WD 1F0ZA 1N61A 1UWMA 2MH7A 1NVID 1TKEA 3P1MA 3VRBB 5GXGB 2WDVB 1OFFA 3W5VB 4C80A 3P4RB 1TJEA 1YQ3B 2WP9B 1XLPA 2H88B 2CJNA 2AX5A 4ZOHC 3SR6A 1RYJA 1L0VB 1JRPA 1FMAD 2JQRB 2W54A 2WU2B 1XLQA 3AE1B 4JX1C 3B2FA 3LB8C 1GPXA 2LEKA 2WDQB
chains in the Genus database with same CATH superfamily
3NVVA 1SE3A 1LM8B 4YWGG 4US8A 4ASWC 1EWCA 3RD2A 1JWUD 1XQQA 1HQRD 1R7SA 4XE0A 2RSUA 4MM3A 1J7BA 1S1QB 3ZNGC 4CO7A 2RPQA 3UGBB 3QCAA 1P98A 2LUMA 1I4PA 5LXHA 3ZJUA 3LYYA 2H89B 2KD0A 1FEHA 1NI3A 3TIXA 2L83A 4L1BA 4BOZB 2Z0DB 2KTFA 4MJSB 3TEXA 2KNBA 1AWDA 3R2TA 3WIMA 2KAJA 4LTUA 5MPOA 1KOTA 2JZPA 3M95A 2I1JA 1JWMD 3MFGA 3APDA 3GZNI 3PS6A 1TGZB 1SJHD 1KTKA 1XF5L 2JRIB 4YTNB 1DGJA 2VH1A 4EKUA 2KFJA 3DBLB 3QWZB 4W9GA 3N1YC 2KDIA 4JGHB 4W9JA 1E8WA 1Z5SB 2JSVX 2KHWB 4WJQA 5BMGA 2BQQA 1CMXB 4HDQA 1ZXHA 5AUKA 3JW0X 3KQ4A 3R3MA 2MH7A 2ZNVC 4LJOB 1OFFA 3H1UA 4AQ7A 2L32A 3L0WB 2KZRA 3LJ3A 3QK0A 4W9HA 2N7JA 1DOYA 2D11A 2OOBB 4WAAA 1SE2A 1ACCA 3A4SC 3DWMA 3FILB 4GIVA 2AQ3B 4G50A 2R2QA 2W3RA 3BYTB 2BWES 4ARIA 3B1LX 2MP2A 4JWSC 1FNWA 4PT5A 1WH3A 2MRPA 3Q69A 1FPYA 4S0RA 3UF8A 4NAWB 2NMQA 4EEWA 2KVRA 2FE8A 2ZPNA 4WWNA 2ZW1A 1STEA 2DWQA 3ZDTA 1SBBB 4EFOA 4HXDA 4GDKB 1HXYD 1N60A 1Y8RC 4YXDB 3OWEB 4C00A 4GLSC 4WJOA 1WGDA 3DBHB 4B6WA 4LNKA 4RMAA 1T6BX 1SE4A 2LRWA 3Q2AC 4KGTA 2GI9A 2B76B 2G45B 3V6CB 1SIJA 2XN9C 1YN4A 4FULA 3BIID 3RFZB 2PJHA 2IPKD 3AMZA 2K8CA 2BBCA 4M0WA 3GE8C 5DPTA 3DBHI 2D5GA 2KN4A 2G1EA 3CIRB 4OVUA 5FR6A 3ENEA 5C3JB 4W9DA 1EUVB 2KLGA 3H7PB 2C7HA 1I4XA 1J19A 1WJ6A 1WIAA 3NS8A 5G55A 2UWQA 1L7YA 2KJHB 3KWVA 1R4MB 4RF1A 4HCPB 1D5MC 2G4SA 3MTNB 4XWTA 2KANA 3CWIA 3VUXA 1OEYA 1UWXA 2CR5A 3FAHA 2J7QB 1C4PA 1IGDA 2EKIA 2FCMA 1WRDB 1YD8U 4AJYB 1X1MA 5AEKB 3ZQ4A 4P1BC 3RPFC 2KWVB 2LGDA 3AXCA 4M01A 2HTHA 2E3TA 1J7CA 5BMIA 5HI1A 3V6EB 3A9KB 3VHTC 4YSXB 3WA0A 2X8XX 1CK1A 2O6VB 4FLHA 3RNFC 5BMHA 2XK5B 1YOVB 5IP4D 1C79A 2RDBC 3WAPA 1JWAD 3OLMD 2NCNA 4XDCA 3BZDB 2KWCA 1I4QA 2TSSA 1OQQA 2MA9B 5IN7A 3ECIA 4ARCA 1XCTL 1V1PA 4BFRA 2D3CA 5G5HA 5JXVA 3NVYA 2M0AA 1P0RA 1OEYJ 4YSYB 4KSLC 3ZXVA 1VZ7A 4HPPA 3L54A 1SSNA 2OHFA 4IC7B 1L0YB 5L83A 4IG7B 2AQ1B 1F1HA 3H6NA 2CS4A 2KXJA 3DCGA 2KC2A 3JSVA 2V0GA 3AE4B 5IA7A 3QC8B 1OTRB 2DHZA 2JPHA 3ML8A 3Q8AA 1DYQA 1VCBA 4BKGA 1LQBA 4DHJD 2H88B 2MBOA 3J9CA 3WAOA 3IXSA 4MGKE 2QCZA 3RZWC 3VH4B 1TKYA 4HPLB 1WM2A 1UF0A 1V80A 4E74A 1F77A 3K9PB 3ZTDA 1XO3A 3DBRB 4MGYE 1KH0A 4AOFA 4EOYA 3DVNV 4EZJA 3OJ3A 2M1MA 2MJDA 2PKOA 4KIKA 3U8ZA 1UBIA 1VLBA 1GG3A 3AE8B 2LJ5A 3AEDB 1N5XA 2LVQA 1HTQA 1L5PA 2CHWA 2L3ZA 2JYEA 4OVVA 3TCAA 2LVPA 3X0WA 1JALA 3BK1A 4DXFA 1GC6A 1V9JA 2L1AA 3KWLA 2DAFA 2FAZA 3WANA 1B9RA 5H8YE 3RNBC 3AEAB 3AE7B 5LLIA 1EO6A 2KQSA 1WXMA 4HPMB 2JUOA 2KOXA 3DVGY 1WGGA 2KACA 2ZVNA 2KTRB 2RGFA 4IM2A 4O1NA 1TY0A 2KN5A 4K81A 5J2RA 2K39A 4HJKA 3RUIB 4LDTB 4ZRIA 2JVCA 4C56C 1ZDVA 1FXTB 4LK0M 5HKHA 1F2RC 5IOIA 1JW9D 3JVZX 2K8HA 2GOWA 2AWTA 4I6NB 2FIDA 2M8SA 3VH3B 2BYVE 2DBYA 1XT9B 4HRSA 1SEBD 3WCQA 1ZGUB 2DYOA 2J0KA 3NRZA 3P42A 3CSTA 2MJEA 2WHIA 3N1ZC 4HK2A 2K0PA 1K52A 1V86A 4FBJB 2BKRB 1WXAA 1YN3A 3EA6A 3PZ8A 4MH8A 2YVCA 1ZKHA 3LB8C 4MM3B 2WXKA 3DBSA 1GB1A 3AEGB 3BVMA 1UZXB 3Q3OC 1YQBA 4NZLB 1E10A 3ZRCA 4K7SA 4DDID 4YTPB 1TIFA 5IKCM 3BINA 3TL5A 4ZHOA 1G6JA 4B0EA 3OJ4B 4CQNA 2AYOB 4DQOC 1YJJA 2JWZA 4XX5A 5BYQA 1AW7A 2HE7A 2L0TA 5KHQA 4PS3A 3LXFA 2WXHA 3QQ8B 1DOXA 1P7FA 4KX6B 4A55A 2DYMA 2L0FA 3M3JA 2RMMA 4C7YA 3MHSD 5FK9C 3IT6B 2M4NA 2FCQA 5CHFA 2L76A 2N9LA 2V3PA 5KHOA 5H92C 4JQWC 4IM0A 3MC0B 1TZ1A 2V1YA 2CJOA 3VRAB 3K9OB 2N7EA 4RCOA 5D94A 4ZDVA 5EDSA 1CQVA 2BWFA 1V49A 4LNFA 3Q3JA 1FRRA 1KLVA 3O65B 2DZKA 2J52A 2CU1A 3Q14C 5D3DA 2GBMA 2INNE 1TS5A 1WYWB 4LNNA 1YQ3B 4N9F4 1RYJA 1FMAD 4TV3A 2WU2B 4TQ0A 1GPXA 2MP2B 2W55A 1PGXA 2EELA 2NPTA 4GOCA 2NTTA 4II2B 1RWSA 1D5ZC 3P4SB 3KUDB 4W9LA 1T0YA 2V3NA 1A5RA 3DHIC 3V61A 1ZXIA 4M8MA 2L7RA 4GU2A 3PV1A 1TBEA 2WYQA 1UD7A 1JQ4A 3MJ5A 1VJKA 2L8JA 2FUHB 2FIFA 2M17A 3AM9A 2WXRA 3BVZA 3W1SC 1XEEA 2LUEA 4G3XB 2PE9A 4J3OD 3U7ZA 4P1CC 2WU5B 1OQRA 4TMAB 3APFA 1IGCA 2AQ2B 4MGZE 2D10A 2GBNA 2QIEB 2JXTA 1JRUA 3IT4B 4FHKA 4M0WB 2NR2A 1SGHA 2QSDA 2NS5A 4HROA 3S2AA 4OZAA 4ACFA 2IO1B 2K9XA 1ZOYB 2INDC 3V05A 1WYGA 4A20A 2LHEA 2QHOA 2WLBA 2KDMA 2N1VA 4GGQA 1F9JA 2VZKB 3ZGZA 4K3CA 2KDFB 2ASQA 4WWPA 1T0QC 3RT3B 4E71A 3PGEA 3TJPA 2QC8A 5LXIB 4MELA 3Q8FA 5EE3A 4HKZE 5DCNA 1PGAA 1NDDA 4LNIA 4BKSA 4WQOB 4MACA 3W5VB 2N1WA 1YIWA 2BYFA 1C4CA 2CJNA 2Y5BB 4PYUA 4A90A 1JRPA 1KLGD 4C4VA 3VTUA 4JX1C 2IGHA 4KV2A 1SIFA 2EMTA 4REZA 2IDYA 3AH7A 2IO2B 3BK2A 2MLBA 4B0MA 2WXLA 3IAM1 2BYEA 4KKJA 3NZ3A 1B1ZA 5I4DA 3N32A 3IG3A 3NVWA 3ZVVA 1GB4A 1RAXA 2OJRA 2DX5B 2KFKA 1EF5A 3DBLI 4FXCA 3HIZA 3A33B 3VAWA 2Z8LA 2UYZB 4ANXA 3Q8BA 1MVKA 3M62B 3R66C 3JYUA 1UUPA 2WDTB 1V1PB 4N6EB 1KRHA 3NY5A 3QJZA 1E0ZA 1WRIA 3KUCB 2N9PC 4A3PA 3URYA 3A4RA 2MSED 3DQVA 2DENB 1JROA 3UQAA 1QOFA 4JIOU 2PMVA 3GB1A 1TS4A 3JSVB 4WJNA 3ZXRA 1GC7A 1IUEA 5D3IB 3ABVB 1VDVA 4TSSA 2PEAA 4XWWA 1QT9A 3EUB2 4BBNF 3AE2B 1GOZA 1IYFA 2V4IB 3TEYA 4HVBA 1BXTA 1K51A 4NJ7A 2KC1A 2FBWB 2NBWB 3PRZA 4EUTA 1E90A 3U7DA 2WXPA 1WR1A 4RM8A 4KIKB 4EE2A 5G2NA 3ZUNA 1P3QU 2DAJA 1WX9A 3PHWB 2IO3B 1XLNA 1YJ1A 1UBQA 4RNAA 4ICUA 2REXA 3PZDA 3P2BA 4AUQC 2N9KA 1PGBA 2JXXA 2L00B 3VR9B 3QA8A 3OG5A 1KM7A 1FO4A 3U30A 2K22A 2AL6A 1FNUA 3GS2A 1K8RB 4ZYSA 2LXAA 3L4PA 3DVNU 1AARA 4YT0B 1ZP0B 1V97A 3ONSA 1WR6E 1S3SG 5JZEB 2I2YA 2BS2B 2EMSA 4IWQA 3DDCB 3ZW3A 2A5UA 1R4MI 2N7DA 3MC9A 1ZPSA 1E8ZA 3EFCA 3B08A 2R2OA 1H4RA 2BS3B 2WX0A 1WX8A 1WGRA 1HEZE 4I6PA 2BS4B 2KDEB 2J53A 3VQIA 1EWYC 4KKIA 3P4PB 3QHTA 2KMAA 4XC2A 3NUHB 4BBNC 4TQ1A 3N9YC 4RGNA 1TS3A 2MBEA 2SAKA 3SU8X 3KUZA 1PDXA 3NHEB 2V9HA 5GMVA 1CZPA 4MT5A 1LGRA 2BB6A 2MHJA 3EFUA 4WURA 1HE8A 1WFYA 4BKTA 2QMTA 3A1QA 1NBFC 2AX5A 1XLQA 2WDQB 4H2AA 3QARA 5JH5C 3HM3A 1WXSA 1QQRA 3FILA 1ZDXA 2WS3B 3I57A 5CHWA 4OVZA 4BKSD 1TTNA 1L6VA 3PLVA 3RNEC 4NAMA 2RPVA 1WE7A 2OJWA 4A6QA 2WGSA 1SJED 4ANUA 3ALBA 1D6EC 2XEWA 2D3AA 3N1XC 4GDKA 1XXGA 2HJ1A 2RDHA 3CSFA 4OZBA 3R2IA 2PPHA 2ACZB 2J0MA 3QAQA 2BYTA 2KX3A 5DPRA 2GBJA 4QAYA 3RNCC 4USAA 3Q3FA 4ZRQA 3CF6E 4WAFA 3AE5B 2YEPB 3AE6B 2DLBA 1H8CA 3Q8EA 1E9MA 2KDBA 4AWJA 2RD0A 3DBRI 2ZNVB 2MWSB 2BF8B 2J42A 4DXAB 4KDIC 2O2VA 1L2NA 5EE1A 3W5UB 3ZJTA 4ITKA 1WGYA 3A9JB 4IDIA 4RGMA 2FUG1 2D3BA 1V2YA 1T0RC 3H7PA 2KJRA 3AV8A 4PS7A 3PO0A 3DHGC 2K8BA 2NPTB 1HA5A 1OQYA 2I1KA 1K53A 3P1MA 1MJDA 5JHAA 1IPGA 4C80A 5BYSA 1XLPA 2Z0EB 4WJPA 2W9NA 2WXGA 1V5TA 5HG2A 3AU5A 4M00A 3V3XA 4G11A 2LASA 2MBQA 4R3DA 4MH0E 4RF0A 1WJUA 3PPAA 2LJIA 3VTWA 1I35A 2BW2A 2WXIA 1MFWA 1JWSD 2KQ4X 3AE9B 1L4ZB 1KF6B 1QLBB 4HDOA 3NG0A 3W1SA 2XK5A 4NJ6A 4F1SA 4F7ZA 1C9FA 1WF9A 2LI5A 2QJLA 2L05A 4TKNA 4K7WA 5HFYA 2WNMA 2SEBD 2FNJB 1TYGB 4NNJB 3R7RA 5EE0A 1JWBD 2XBBC 1E7PB 3VVWB 4D2KA 4WWOA 4DWFA 2DZJA 2M19A 4FJZA 4DXGA 1MPEA 4KGSA 1FNVA 3M63B 4XZ4A 3L13A 1C4AA 2DNFA 2JZZA 4N58A 4F8CB 3DOWA 2LFIA 2PVOD 4KSKC 4LJPB 1JMLA 3E9SA 3PT2B 1ZE3D 1T3QA 4IWOA 1Y56A 2ZCBA 4DHJB 2WXFA 1WGHA 3TSSA 1I4RA 2PE6B 1NVID 1WZ3A 3VRBB 3MJWA 1M4VA 1L0VB 1EM7A 4LNOA 4W9KA 3AE1B 2GBRA 1UNSA 4W9FA 4GDLA 4IOIE 2HD5B 2KFKB 2IY0B 1WWTA 3L16A 1VZ6A 3W9CB 3MC8A 2D3GA 2INCC 4CHKA 4MSMB 1E7UA 1WSPA 5EE9A 4RGTA 2C5LC 1AN8A 1YN5A 1PUTA 5E6PA 1GJZA 4ANVA 1HTOA 3T8MA 1WMHA 1TKGA 5FKAC 1ENFA 3R7QA 1E8XA 3PVLA 5AZFA 1PQSA 2FCSA 2KX0A 5CX3A 4KZ0A 4DHZE 3N30A 1RLFA 2MCNB 4XYCA 3DVGX 4I6LB 2LZ6A 1ROEA 3RNAC 1N5WA 3PTFC 4OZCA 2CHXA 4P7IA 3HUIA 2N4FA 3NS1A 2LGSA 1D3ZA 4XDDA 1HZ6A 1E8YA 3SD5A 2C60A 1BUIC 1EU3A 3BYYB 5J17A 2KMCA 1P7EA 3I9V1 1MHHE 3GOEA 3ETRA 1Q5WB 4HEA1 3RNGC 2BTEA 5JHBA 2JZ3B 1QF6A 3ZO5B 1E7VA 1FFUA 1HZ5A 4US9A 4BOSC 2NTSA 3H8HA 4LLGM 1WJNA 2PLPA 1UWMA 1EU4A 2MBHA 1GUAB 3RZFA 2HDEA 3P4RB 2LGXA 2E6XA 3QIJA 5E6JA 3VDZA 4ZOHC 2PW9A 1UELA 4K1RB 2BPSA 1WM3A 3N3KB 4B95A 1M94A 3RYTA 3NJTA 4W9CA 3GZNB 2INPE 2L52A 3FC4A 1FXAA 1SF0A 3ZLZA 2K1FA 1Q10A 1V8CA 4L2YA 3DHHC 1L6UA 3KVFB 4WWMA 4HCNB 3SFDB 4JL9A 5E6NA 4JE3B 3KW5B 3PHXB 2WXMA 1YNTE 2WXQA 2HJ8A 2JY6A 4JPSA 4XGAB 2N0SB 1MG8A 2ZW0A 1NYQA 3QX1A 4NY0A 1IBXA 3O13A 3Q3MC 3AECB 1EF1A 3VUWA 2JU6X 5DPWA 3I5JC 4P6VF 3IVFA 2PTLA 2J0JA 2KMMA 2O6VD 4HLEA 2IYDB 5T8IA 4PS8A 3IFWB 3HK0A 4II3B 2G9HD 2ZJDA 1FXIA 4HJGE 3I3TB 3T3NA 2UU7A 2C7MB 2KO3A 1QOAA 1V6EA 1WE6A 3AEFB 1F2RI 2WX1A 4IUMB 5C2TB 2I38A 1QKZA 2LGIA 2WXOA 2JYTA 1ESFA 3PRMB 3ZKJC 1K50A 1WJ4A 4RM9A 4FN2A 4ANWA 1YMHE 3VXWA 2QILA 1NENB 2KQ7A 3A1QB 4MSQB 4N59A 3AB5A 1E6EB 1LO5D 2K5PA 4X57B 2Q5WD 3TEZA 3UIPB 5D6JB 1F52A 1WXVA 2IGDA 1P9DU 3IAS1 4WH4A 2W54A 4KVGB 3PREA 2OEDA 4A8XC 1YJIA 2MJ3A 4K3BA 2V3SA 2CHZA 1VZ8A 1YQ4B 3ML9A 1PYWD 3GE3C 3W2DA 3AE3B 4BAXA 1TS2A 4GXBA 3SHQA 4ZYNA 3RMKC 2AL3A 3MHZA 2G3QB 4KZCA 5E6OA 1IP9A 3T3OA 3B2GA 1L0XB 2PIAA 1N6ZA 3D32A 4RGOS 4DHZB 5C1ZA 1BMLC 3L17A 2BT6A 4URKA 3HVZA 1JCKB 3P63A 1OGWA 1FCCC 4GMVA 2PVGC 2Z59B 4UDUC 2MQJA 4BZAA 4NPNA 1FD6A 4WIPA 1UH6A 4KDLB 4HWIB 4TUUA 4YSZB 2KJ6A 2O2VB 2HTME 5D7GA 1FFVA 3HRDD 2QEJC 2QDFA 2N9XA 2R61A 3AULA 1E5WA 2LMCA 2Y5PA 1VR9A 2M56B 1C77A 2NBUA 4MJSA 4ZRKA 1FM0D 4LDTD 3HM6X 2ONQA 4DDGD 4FJYA 3W1YA 2JWUA 4A3OA 1QOGA 3BVGA 3TMPB 2GLSA 2V4LA 5IO9A 4IKGA 3Q3NC 1QOBA 3ZRFA 3ZDMC 3PZ7A 1P1AA 1MHXA 2VH2A 3KH0A 5GXGB 1WX7A 2LVOA 1TJEA 2ICIA 2AEHA 2WP9B 1QILA 3VUYA 4W9EA 2RDGA 2B3AA 5LNK1 2A4ZA 4S17A 2J4XA 4NQLB 1DOIA 1RM6C 2DYBA 2LD9A 3ZNZB 1KJTA 3MP9A 5CHVC 3SEBA 3C8YA 2CU3A 1YX6B 4PYZA 4RFBA 2JRHA 3AN1A 4WQMA 1V1OA 2KYWA 2WDRB 2JT4B 4IWPA 4G0NB 2NVUI 4CYEA 4AP4C 2LWPA 5TSSA 5L95C 2LRUA 2MEKA 2K6QA 3KYDD 1C1YB 3NVZA 4GN1A 5D2MB 2KK8A 1CJEA 3UI3A 3N20C 2ZZPB 3SDLC 2WXJA 4NAWA 3RN9C 1N62A 1LFDA 2IJ0A 4A9AA 3EC8A 2NBVB 3WALA 1FRDA 4AJWA 3RULA 4GSWA 1I4HA 3L08A 4OHJA 3T9LA 4JWUC 5J18A 3L10B 2KKCA 4B9KA 4J6IA 2LXCA 2LHDA 2RR9A 5FR3A 3Q6BA 4W9IA 2BVCA 1WY8A 2D2QA 4AS1A 1C76A 1YX5B 1Q0WB 2M0XA 4NQKE 3NOBA 4GDLB 1U4AA 3LDZE 1XCQL 2FCNA 2DZIA 4DK5A 1FCLA 3R8BA 3PRPB 2VRRB 1VD2A 2GB1A 2ZEQA 3U2SC 1QZEA 3UIOB 2LEKA 5IAAC 3C0RB 2IZVB 3HHMA 1V5OA 1NYRA 1WMHB 2MW5A 3EHVA 5CTRC 1J8CA 2JX5A 2WXNA 1SXTA 3KYCD 3NZUA 2ZVOA 1ISNA 2KWDA 3TBLD 3B0AA 3AEEB 2KT7A 4M8NA 5TR5A 3H9DA 4FHJA 4JLCA 2EKEC 2BGFA 2XNAC 3HVDA 4OW0A 2G4DB 4YTMB 5C23A 1R4NB 5AZGA 4EZLA 3ZIMA 2IGGA 1I7HA 1Z2MA 4E3CA 2IO0B 3OAWA 3RCZA 2K6DB 2MX2A 3P4QB 1FIQA 3ZTCA 1UGMA 3A9KA 1J0GA 4HKQA 4ZRPA 1GAQB 2O6VA 2GMIC 4PK1A 2X38A 1XD3B 1J7AA 1ET9A 1R4NI 3E56A 4MEMA 3GP7A 3UINB 2W3SA 4EZKA 1WXQA 4C7ZA 1I4GA 2ZPYA 3DPDA 3V60A 4L23A 3ZNID 1VRAB 4DBGA 1TT5B 1N63A 3NZSA 2D07B 4ZHPA 4YL8A 1KFYB 4BVUC 1D4BA 3EECA 1UGJA 1ZW7A 3IBEA 1NEKB 1PFDA 2ZCCA 3TUOA 3AEBB 1BT0A 1LXDA 1MG4A 1TY2A 2GRIA 2DZMA 1F0ZA 3WAMA 1N61A 4P16A 5AZHA 4M02A 3APCA 3ZJVA 1TKEA 2VZKD 3AU4A 2K3UA 4ICVA 1WZ0A 1WI0A 3V62A 2ON8A 3B2FA 4IM3A 3AI5A 4C4VB 1T0SC 3DWGC 3KLSX 5G5GA 2WWZA 3UQBA 2IY1B 3RI7C 4MDKE 1NI2A 4LCDE 3VR8B 2IBIB 3B9JA 3VFKA 1IBXB 3U52E 3BWUD 3PLUA 3Q8CA 1D5XC 3ZYYX 2K25A 3U4EG 4FADA 3CMMB 2Y5CA 3C19A 3SFEB 4IW0A 5AUIA 2C9WB 2MBBB 1GNUA 4FJVB 4Q2JA 2W82A 4ZRJA 1SB3C 3I63C 2YLMA 2KVZA 2C7NB 4MGIE 3IHPC 1KLUD 4KGRA 1WGKA 2BKFA 1AYFA 3BY4B 2BB5A 3FKYA 1V81A 4GB9A 2WQYB 3EGRA 2Y3AA 1RFKA 1MI0A 3H7SA 1T5XD 1I42A 3TEWA 2N9EB 5DPSA 1ZUD2 1Q1OA 3A9JA 4RH6A 2KLCA 1L4DB 2KTRA 3VTVA 2LGYA 5HHDG 3X23A 1SE9A 3PSEB 1RFAA 2YEPF 1C3TA 1XLOA 2GBKA 1ET6A 2KWUB 2CKHB 5BYRA 4NJCA 4K7UA 1A70A 3ZNHB 1C78A 2JF5A 1RRBA 5BO4B 1TZOA 2WDVB 4FA6A 3SR6A 2JQRB
chains in the Genus database with same CATH topology
1YJIA 3NVVA 1QQRA 2MJ3A 1SE3A 3FILA 1VZ8A 2WXKA 1YQ4B 1ZDXA 4YWGG 4US8A 1GB1A 2WS3B 3AEGB 3BVMA 3I57A 1EWCA 4OVZA 1PYWD 4NZLB 1E10A 3W2DA 1JWUD 3AE3B 1L6VA 1TS2A 4YTPB 4NAMA 2RPVA 1HQRD 1R7SA 4XE0A 4A6QA 3MHZA 1SJED 1J7BA 4ZHOA 4B0EA 3T3OA 3B2GA 1L0XB 4CQNA 4DQOC 1YJJA 1D6EC 2PIAA 4RGOS 2LUMA 1BMLC 1I4PA 5BYQA 2BT6A 1AW7A 3ZJUA 3HVZA 1JCKB 3P63A 3LXFA 1FCCC 1XXGA 2WXHA 3LYYA 2RDHA 1DOXA 4OZBA 2PVGC 3R2IA 4A8XC 1P7FA 2ACZB 2H89B 4UDUC 4KX6B 4A55A 2DYMA 1FEHA 1NI3A 2L83A 4L1BA 1FD6A 4WIPA 2BYTA 2RMMA 4C7YA 4YSZB 3TEXA 5FK9C 4USAA 3IT6B 4ZRQA 1AWDA 4WAFA 3R2TA 3AE5B 2YEPB 2KAJA 2HTME 4LTUA 5MPOA 3AE6B 2JZPA 5D7GA 1FFVA 2DLBA 3Q8EA 3HRDD 2N9LA 1E9MA 2QEJC 2V3PA 1JWMD 3MFGA 5H92C 2R61A 2LMCA 2Y5PA 1KTKA 1SJHD 1XF5L 3MC0B 4YTNB 2J42A 1VR9A 2M56B 1DGJA 1C77A 1FM0D 2CJOA 5EE1A 3VRAB 3W5UB 3ZJTA 2ONQA 4RCOA 4ITKA 4IDIA 4RGMA 2JWUA 2FUG1 1QOGA 1CQVA 3BVGA 2JSVX 4IKGA 3AV8A 1QOBA 3PO0A 1FRRA 5BMGA 3PZ7A 2J52A 1ZXHA 5AUKA 1HA5A 1MHXA 3KQ4A 2MH7A 5D3DA 2INNE 1K53A 3P1MA 5GXGB 1TS5A 1OFFA 4C80A 5BYSA 1TJEA 1YQ3B 2ICIA 2WP9B 1XLPA 4AQ7A 1QILA 1RYJA 1FMAD 2L32A 2RDGA 2WU2B 2WXGA 4TQ0A 5HG2A 1GPXA 5LNK1 2N7JA 2W55A 1PGXA 3V3XA 2EELA 1DOYA 2J4XA 1DOIA 1RM6C 2NTTA 3MP9A 4R3DA 4RF0A 1SE2A 1ACCA 3SEBA 3C8YA 1RWSA 2CU3A 1D5ZC 2LJIA 3DWMA 3FILB 3P4SB 2AQ3B 4RFBA 2W3RA 2V3NA 3BYTB 3AN1A 4ARIA 1ZXIA 2BW2A 2WXIA 4WQMA 1V1OA 2WDRB 1FNWA 4JWSC 4PT5A 1JWSD 2KQ4X 3Q69A 3AE9B 1L4ZB 1KF6B 1QLBB 5TSSA 2MEKA 1JQ4A 4NAWB 3W1SA 2NMQA 3MJ5A 1VJKA 1C9FA 2FE8A 3NVZA 2QJLA 2ZW1A 1STEA 1CJEA 2DWQA 1SBBB 3AM9A 2WXRA 3BVZA 5HFYA 2WNMA 2SEBD 3UI3A 4GDKB 1XEEA 1TYGB 2WXJA 1HXYD 1N60A 4J3OD 3U7ZA 4YXDB 3OWEB 1N62A 5EE0A 1JWBD 2IJ0A 4A9AA 2WU5B 1E7PB 1OQRA 4TMAB 4D2KA 4GLSC 1IGCA 1FRDA 2AQ2B 1T6BX 1SE4A 2M19A 1I4HA 2QIEB 2JXTA 4DXGA 4OHJA 1MPEA 4JWUC 4KGSA 3IT4B 4KGTA 1FNVA 2B76B 2GI9A 2QSDA 1C4AA 2LHDA 4HROA 4OZAA 4N58A 5FR3A 2K9XA 1SIJA 1ZOYB 2LFIA 2XN9C 2PVOD 1YN4A 3BIID 3V05A 1WYGA 3RFZB 2IPKD 2LHEA 4AS1A 1C76A 1JMLA 3AMZA 3E9SA 1ZE3D 2WLBA 2BBCA 2KDMA 2VZKB 4M0WA 3ZGZA 1T3QA 2D5GA 2KN4A 1Y56A 2G1EA 3CIRB 5C3JB 2WXFA 4GDLB 1XCQL 3Q8FA 5EE3A 3TSSA 4HKZE 1I4RA 1PGAA 1NVID 1I4XA 3VRBB 4MACA 1FCLA 3R8BA 3W5VB 1C4CA 2CJNA 1M4VA 2GB1A 1L0VB 1EM7A 1JRPA 1KLGD 3KWVA 3AE1B 4RF1A 3U2SC 4A90A 4JX1C 2IGHA 1D5MC 1UNSA 2LEKA 4XWTA 4REZA 2IDYA 3AH7A 4IOIE 3CWIA 1NYRA 3BK2A 4B0MA 1UWXA 2WXLA 3FAHA 1WWTA 3IAM1 4KKJA 3NZ3A 1VZ6A 3W9CB 1C4PA 2JX5A 2WXNA 1IGDA 1SXTA 1B1ZA 2EKIA 5I4DA 1WSPA 2KWDA 5EE9A 4RGTA 3ZQ4A 1AN8A 3NVWA 1YN5A 1PUTA 3RPFC 3AEEB 1GB4A 4FXCA 2E3TA 1J7CA 1TKGA 5BMIA 5FKAC 5HI1A 1ENFA 2Z8LA 2XNAC 3HVDA 4OW0A 4YTMB 3Q8BA 1MVKA 4YSXB 1CK1A 1UUPA 5BMHA 1V1PB 2IGGA 1I7HA 1C79A 4N6EB 1JWAD 1KRHA 1E0ZA 1WRIA 1ROEA 4XDCA 3BZDB 3URYA 1I4QA 1FIQA 3P4QB 1N5WA 4HKQA 4ZRPA 2TSSA 1OQQA 4OZCA 1GAQB 4ARCA 3HUIA 3NS1A 1XCTL 1V1PA 1JROA 1QOFA 2X38A 2PMVA 3GB1A 4XDDA 5G5HA 1TS4A 1J7AA 5JXVA 1HZ6A 3NVYA 2M0AA 1ET9A 3E56A 1BUIC 1EU3A 3BYYB 4YSYB 3GP7A 1IUEA 1P7EA 2W3SA 1VZ7A 1WXQA 1I4GA 3ABVB 5D3IB 3I9V1 4C7ZA 1MHHE 1SSNA 1VDVA 4TSSA 2OHFA 1L0YB 4L23A 2AQ1B 4XWWA 1VRAB 1QT9A 3EUB2 1N63A 3AE2B 1GOZA 3ETRA 4ZHPA 1KFYB 1D4BA 4HEA1 2V4IB 3TEYA 2BTEA 1UGJA 2V0GA 1NEKB 1PFDA 1QF6A 3TUOA 1BXTA 3AEBB 1FFUA 3AE4B 1HZ5A 1K51A 4US9A 2NTSA 1TY2A 2GRIA 3H8HA 4LLGM 3Q8AA 1F0ZA 1DYQA 2FBWB 2PLPA 1N61A 1UWMA 4P16A 1EU4A 3ZJVA 1TKEA 2VZKD 2K3UA 2WXPA 2HDEA 3P4RB 2E6XA 2H88B 4EE2A 5E6JA 4ZOHC 2PW9A 3J9CA 2ON8A 3B2FA 3IXSA 1TKYA 1XLNA 1F77A 4RNAA 1XO3A 1KH0A 3DWGC 3KLSX 5G5GA 2INPE 2L52A 2MJDA 2PKOA 3FC4A 3VR8B 1FXAA 1SF0A 2N9KA 1PGBA 1Q10A 3VR9B 1V8CA 3B9JA 4L2YA 1VLBA 1L6UA 1IBXB 3AE8B 4WWMA 3SFDB 3U52E 3AEDB 3BWUD 1N5XA 1FO4A 3Q8CA 1D5XC 1L5PA 3ZYYX 4JE3B 3U4EG 2K22A 2JYEA 1FNUA 2WXMA 2Y5CA 1YNTE 3GS2A 1JALA 2WXQA 3BK1A 4JPSA 3SFEB 4DXFA 4ZYSA 5AUIA 2L1AA 2N0SB 3KWLA 2ZW0A 3L4PA 1NYQA 4Q2JA 1B9RA 5H8YE 3O13A 1IBXA 2W82A 3AEAB 1SB3C 3AECB 4YT0B 1ZP0B 3AE7B 1V97A 2JU6X 1KLUD 4KGRA 1WGKA 2I2YA 4P6VF 2BS2B 2KMMA 2PTLA 2KACA 5T8IA 1AYFA 2G9HD 2BB5A 1FXIA 4O1NA 2WQYB 4HJGE 1TY0A 2Y3AA 3EGRA 3T3NA 1RFKA 1MI0A 1ZPSA 1T5XD 1QOAA 2BS3B 3AEFB 4C56C 1ZDVA 1F2RI 3TEWA 1ZUD2 4LK0M 1HEZE 1F2RC 2BS4B 5C2TB 4RH6A 2I38A 1JW9D 1QKZA 2J53A 1L4DB 2LGIA 1EWYC 2WXOA 3VQIA 2JYTA 1ESFA 4KKIA 5HHDG 1K50A 3P4PB 1YMHE 2YEPF 3NUHB 1XLOA 2QILA 2DBYA 1NENB 1ET6A 3N9YC 4HRSA 1SEBD 4TQ1A 5BYRA 3WCQA 4RGNA 1TS3A 4N59A 4NJCA 2DYOA 2SAKA 3AB5A 1A70A 3NRZA 3P42A 1PDXA 1E6EB 1LO5D 2K5PA 1CZPA 2MJEA 2Q5WD 1C78A 3TEZA 2K0PA 1TZOA 2BB6A 4MT5A 1K52A 4WURA 2WDVB 2QMTA 2IGDA 3IAS1 1YN3A 2AX5A 3EA6A 3PZ8A 4MH8A 3SR6A 4WH4A 2JQRB 2W54A 1XLQA 3LB8C 2OEDA 2WDQB 4H2AA 4MM3B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1YJI A;  1TKY A;  2W55 A;  3NVV A;  1XLN A;  1DOY A;  2MJ3 A;  3AH7 A;  3CWI A;  1YQ4 B;  1NYR A;  1XO3 A;  4US8 A;  2WS3 B;  1DOI A;  3AEG B;  1RM6 C;  3DWG C;  3FAH A;  1WWT A;  5G5G A;  2L52 A;  1RWS A;  2MJD A;  1E10 A;  2CU3 A;  2PKO A;  3FC4 A;  3VR8 B;  1FXA A;  1SF0 A;  2JX5 A;  3AE3 B;  3DWM A;  1L6V A;  3P4S B;  3W9C B;  3VR9 B;  1V8C A;  3B9J A;  2W3R A;  2EKI A;  4YTP B;  1VLB A;  1L6U A;  3AN1 A;  3AE8 B;  1R7S A;  4WWM A;  1ZXI A;  3SFD B;  3AED B;  4WQM A;  2WDR B;  1N5X A;  4JWS C;  5EE9 A;  1FO4 A;  1J7B A;  3NVW A;  1L5P A;  3ZYY X;  4ZHO A;  1PUT A;  3RPF C;  3AEE B;  2K22 A;  3B2G A;  3AE9 B;  1KF6 B;  2E3T A;  2Y5C A;  1J7C A;  1QLB B;  1YJJ A;  2PIA A;  4FXC A;  1TKG A;  1JQ4 A;  1JAL A;  3SFE B;  2BT6 A;  3HVZ A;  1VJK A;  2N0S B;  3KWL A;  5AUI A;  3P63 A;  3LXF A;  3L4P A;  3NVZ A;  4YTM B;  1NYQ A;  4YSX B;  1B9R A;  5H8Y E;  1DOX A;  3AEA B;  2QJL A;  2PVG C;  1SB3 C;  3AEC B;  1CJE A;  2DWQ A;  4YT0 B;  2ACZ B;  2H89 B;  1ZP0 B;  3AE7 B;  1I7H A;  1V97 A;  3AM9 A;  4KX6 B;  4N6E B;  1JWA D;  1KRH A;  1NI3 A;  1E0Z A;  1WGK A;  2L83 A;  1WRI A;  1TYG B;  4P6V F;  1N60 A;  1ROE A;  4YXD B;  2BS2 B;  2KMM A;  1N62 A;  4C7Y A;  4YSZ B;  3P4Q B;  1FIQ A;  5EE0 A;  1JWB D;  4A9A A;  1N5W A;  2WU5 B;  1AYF A;  4USA A;  1E7P B;  1OQR A;  1AWD A;  1OQQ A;  3AE5 B;  1FXI A;  1GAQ B;  2WQY B;  1FRD A;  1RFK A;  2KAJ A;  2HTM E;  3HUI A;  4LTU A;  3AE6 B;  5MPO A;  1FFV A;  3NS1 A;  1JRO A;  1QOF A;  3HRD D;  2M19 A;  1E9M A;  5G5H A;  1J7A A;  2QIE B;  3NVY A;  5H92 C;  1QOA A;  2BS3 B;  4JWU C;  3AEF B;  2B76 B;  4YTN B;  1ZUD 2;  4YSY B;  1IUE A;  2M56 B;  1DGJ A;  5C2T B;  2BS4 B;  2W3S A;  1WXQ A;  3ABV B;  4C7Z A;  1JW9 D;  1EWY C;  1VDV A;  1FM0 D;  2OHF A;  4HRO A;  4N58 A;  2K9X A;  2CJO A;  5EE1 A;  1QT9 A;  1SIJ A;  1ZOY B;  3EUB 2;  3VRA B;  3W5U B;  2PVO D;  3BII D;  1N63 A;  1WYG A;  4ITK A;  3P4P B;  4IDI A;  3AE2 B;  3ETR A;  4ZHP A;  3AMZ A;  1KFY B;  1QOG A;  1XLO A;  2DBY A;  1NEN B;  2WLB A;  4HRS A;  3WCQ A;  1NEK B;  1PFD A;  1QF6 A;  1T3Q A;  4N59 A;  3AEB B;  3AV8 A;  1FFU A;  3AE4 B;  3AB5 A;  1A70 A;  1QOB A;  3NRZ A;  4US9 A;  2G1E A;  3CIR B;  1FRR A;  3PO0 A;  5C3J B;  1PDX A;  1E6E B;  2K5P A;  2MJE A;  1CZP A;  5EE3 A;  5AUK A;  2FBW B;  2Q5W D;  1F0Z A;  1N61 A;  1UWM A;  2MH7 A;  1NVI D;  1TKE A;  3P1M A;  3VRB B;  5GXG B;  2WDV B;  1OFF A;  3W5V B;  4C80 A;  3P4R B;  1TJE A;  1YQ3 B;  2WP9 B;  1XLP A;  2H88 B;  2CJN A;  2AX5 A;  4ZOH C;  3SR6 A;  1RYJ A;  1L0V B;  1JRP A;  1FMA D;  2JQR B;  2W54 A;  2WU2 B;  1XLQ A;  3AE1 B;  4JX1 C;  3B2F A;  3LB8 C;  1GPX A;  2LEK A;  2WDQ B; 
#chains in the Genus database with same CATH topology
 3NVV A;  1SE3 A;  1LM8 B;  4YWG G;  4US8 A;  4ASW C;  1EWC A;  3RD2 A;  1JWU D;  1XQQ A;  1HQR D;  1R7S A;  4XE0 A;  2RSU A;  4MM3 A;  1J7B A;  1S1Q B;  3ZNG C;  4CO7 A;  2RPQ A;  3UGB B;  3QCA A;  1P98 A;  2LUM A;  1I4P A;  5LXH A;  3ZJU A;  3LYY A;  2H89 B;  2KD0 A;  1FEH A;  1NI3 A;  3TIX A;  2L83 A;  4L1B A;  4BOZ B;  2Z0D B;  2KTF A;  4MJS B;  3TEX A;  2KNB A;  1AWD A;  3R2T A;  3WIM A;  2KAJ A;  4LTU A;  5MPO A;  1KOT A;  2JZP A;  3M95 A;  2I1J A;  1JWM D;  3MFG A;  3APD A;  3GZN I;  3PS6 A;  1TGZ B;  1SJH D;  1KTK A;  1XF5 L;  2JRI B;  4YTN B;  1DGJ A;  2VH1 A;  4EKU A;  2KFJ A;  3DBL B;  3QWZ B;  4W9G A;  3N1Y C;  2KDI A;  4JGH B;  4W9J A;  1E8W A;  1Z5S B;  2JSV X;  2KHW B;  4WJQ A;  5BMG A;  2BQQ A;  1CMX B;  4HDQ A;  1ZXH A;  5AUK A;  3JW0 X;  3KQ4 A;  3R3M A;  2MH7 A;  2ZNV C;  4LJO B;  1OFF A;  3H1U A;  4AQ7 A;  2L32 A;  3L0W B;  2KZR A;  3LJ3 A;  3QK0 A;  4W9H A;  2N7J A;  1DOY A;  2D11 A;  2OOB B;  4WAA A;  1SE2 A;  1ACC A;  3A4S C;  3DWM A;  3FIL B;  4GIV A;  2AQ3 B;  4G50 A;  2R2Q A;  2W3R A;  3BYT B;  2BWE S;  4ARI A;  3B1L X;  2MP2 A;  4JWS C;  1FNW A;  4PT5 A;  1WH3 A;  2MRP A;  3Q69 A;  1FPY A;  4S0R A;  3UF8 A;  4NAW B;  2NMQ A;  4EEW A;  2KVR A;  2FE8 A;  2ZPN A;  4WWN A;  2ZW1 A;  1STE A;  2DWQ A;  3ZDT A;  1SBB B;  4EFO A;  4HXD A;  4GDK B;  1HXY D;  1N60 A;  1Y8R C;  4YXD B;  3OWE B;  4C00 A;  4GLS C;  4WJO A;  1WGD A;  3DBH B;  4B6W A;  4LNK A;  4RMA A;  1T6B X;  1SE4 A;  2LRW A;  3Q2A C;  4KGT A;  2GI9 A;  2B76 B;  2G45 B;  3V6C B;  1SIJ A;  2XN9 C;  1YN4 A;  4FUL A;  3BII D;  3RFZ B;  2PJH A;  2IPK D;  3AMZ A;  2K8C A;  2BBC A;  4M0W A;  3GE8 C;  5DPT A;  3DBH I;  2D5G A;  2KN4 A;  2G1E A;  3CIR B;  4OVU A;  5FR6 A;  3ENE A;  5C3J B;  4W9D A;  1EUV B;  2KLG A;  3H7P B;  2C7H A;  1I4X A;  1J19 A;  1WJ6 A;  1WIA A;  3NS8 A;  5G55 A;  2UWQ A;  1L7Y A;  2KJH B;  3KWV A;  1R4M B;  4RF1 A;  4HCP B;  1D5M C;  2G4S A;  3MTN B;  4XWT A;  2KAN A;  3CWI A;  3VUX A;  1OEY A;  1UWX A;  2CR5 A;  3FAH A;  2J7Q B;  1C4P A;  1IGD A;  2EKI A;  2FCM A;  1WRD B;  1YD8 U;  4AJY B;  1X1M A;  5AEK B;  3ZQ4 A;  4P1B C;  3RPF C;  2KWV B;  2LGD A;  3AXC A;  4M01 A;  2HTH A;  2E3T A;  1J7C A;  5BMI A;  5HI1 A;  3V6E B;  3A9K B;  3VHT C;  4YSX B;  3WA0 A;  2X8X X;  1CK1 A;  2O6V B;  4FLH A;  3RNF C;  5BMH A;  2XK5 B;  1YOV B;  5IP4 D;  1C79 A;  2RDB C;  3WAP A;  1JWA D;  3OLM D;  2NCN A;  4XDC A;  3BZD B;  2KWC A;  1I4Q A;  2TSS A;  1OQQ A;  2MA9 B;  5IN7 A;  3ECI A;  4ARC A;  1XCT L;  1V1P A;  4BFR A;  2D3C A;  5G5H A;  5JXV A;  3NVY A;  2M0A A;  1P0R A;  1OEY J;  4YSY B;  4KSL C;  3ZXV A;  1VZ7 A;  4HPP A;  3L54 A;  1SSN A;  2OHF A;  4IC7 B;  1L0Y B;  5L83 A;  4IG7 B;  2AQ1 B;  1F1H A;  3H6N A;  2CS4 A;  2KXJ A;  3DCG A;  2KC2 A;  3JSV A;  2V0G A;  3AE4 B;  5IA7 A;  3QC8 B;  1OTR B;  2DHZ A;  2JPH A;  3ML8 A;  3Q8A A;  1DYQ A;  1VCB A;  4BKG A;  1LQB A;  4DHJ D;  2H88 B;  2MBO A;  3J9C A;  3WAO A;  3IXS A;  4MGK E;  2QCZ A;  3RZW C;  3VH4 B;  1TKY A;  4HPL B;  1WM2 A;  1UF0 A;  1V80 A;  4E74 A;  1F77 A;  3K9P B;  3ZTD A;  1XO3 A;  3DBR B;  4MGY E;  1KH0 A;  4AOF A;  4EOY A;  3DVN V;  4EZJ A;  3OJ3 A;  2M1M A;  2MJD A;  2PKO A;  4KIK A;  3U8Z A;  1UBI A;  1VLB A;  1GG3 A;  3AE8 B;  2LJ5 A;  3AED B;  1N5X A;  2LVQ A;  1HTQ A;  1L5P A;  2CHW A;  2L3Z A;  2JYE A;  4OVV A;  3TCA A;  2LVP A;  3X0W A;  1JAL A;  3BK1 A;  4DXF A;  1GC6 A;  1V9J A;  2L1A A;  3KWL A;  2DAF A;  2FAZ A;  3WAN A;  1B9R A;  5H8Y E;  3RNB C;  3AEA B;  3AE7 B;  5LLI A;  1EO6 A;  2KQS A;  1WXM A;  4HPM B;  2JUO A;  2KOX A;  3DVG Y;  1WGG A;  2KAC A;  2ZVN A;  2KTR B;  2RGF A;  4IM2 A;  4O1N A;  1TY0 A;  2KN5 A;  4K81 A;  5J2R A;  2K39 A;  4HJK A;  3RUI B;  4LDT B;  4ZRI A;  2JVC A;  4C56 C;  1ZDV A;  1FXT B;  4LK0 M;  5HKH A;  1F2R C;  5IOI A;  1JW9 D;  3JVZ X;  2K8H A;  2GOW A;  2AWT A;  4I6N B;  2FID A;  2M8S A;  3VH3 B;  2BYV E;  2DBY A;  1XT9 B;  4HRS A;  1SEB D;  3WCQ A;  1ZGU B;  2DYO A;  2J0K A;  3NRZ A;  3P42 A;  3CST A;  2MJE A;  2WHI A;  3N1Z C;  4HK2 A;  2K0P A;  1K52 A;  1V86 A;  4FBJ B;  2BKR B;  1WXA A;  1YN3 A;  3EA6 A;  3PZ8 A;  4MH8 A;  2YVC A;  1ZKH A;  3LB8 C;  4MM3 B;  2WXK A;  3DBS A;  1GB1 A;  3AEG B;  3BVM A;  1UZX B;  3Q3O C;  1YQB A;  4NZL B;  1E10 A;  3ZRC A;  4K7S A;  4DDI D;  4YTP B;  1TIF A;  5IKC M;  3BIN A;  3TL5 A;  4ZHO A;  1G6J A;  4B0E A;  3OJ4 B;  4CQN A;  2AYO B;  4DQO C;  1YJJ A;  2JWZ A;  4XX5 A;  5BYQ A;  1AW7 A;  2HE7 A;  2L0T A;  5KHQ A;  4PS3 A;  3LXF A;  2WXH A;  3QQ8 B;  1DOX A;  1P7F A;  4KX6 B;  4A55 A;  2DYM A;  2L0F A;  3M3J A;  2RMM A;  4C7Y A;  3MHS D;  5FK9 C;  3IT6 B;  2M4N A;  2FCQ A;  5CHF A;  2L76 A;  2N9L A;  2V3P A;  5KHO A;  5H92 C;  4JQW C;  4IM0 A;  3MC0 B;  1TZ1 A;  2V1Y A;  2CJO A;  3VRA B;  3K9O B;  2N7E A;  4RCO A;  5D94 A;  4ZDV A;  5EDS A;  1CQV A;  2BWF A;  1V49 A;  4LNF A;  3Q3J A;  1FRR A;  1KLV A;  3O65 B;  2DZK A;  2J52 A;  2CU1 A;  3Q14 C;  5D3D A;  2GBM A;  2INN E;  1TS5 A;  1WYW B;  4LNN A;  1YQ3 B;  4N9F 4;  1RYJ A;  1FMA D;  4TV3 A;  2WU2 B;  4TQ0 A;  1GPX A;  2MP2 B;  2W55 A;  1PGX A;  2EEL A;  2NPT A;  4GOC A;  2NTT A;  4II2 B;  1RWS A;  1D5Z C;  3P4S B;  3KUD B;  4W9L A;  1T0Y A;  2V3N A;  1A5R A;  3DHI C;  3V61 A;  1ZXI A;  4M8M A;  2L7R A;  4GU2 A;  3PV1 A;  1TBE A;  2WYQ A;  1UD7 A;  1JQ4 A;  3MJ5 A;  1VJK A;  2L8J A;  2FUH B;  2FIF A;  2M17 A;  3AM9 A;  2WXR A;  3BVZ A;  3W1S C;  1XEE A;  2LUE A;  4G3X B;  2PE9 A;  4J3O D;  3U7Z A;  4P1C C;  2WU5 B;  1OQR A;  4TMA B;  3APF A;  1IGC A;  2AQ2 B;  4MGZ E;  2D10 A;  2GBN A;  2QIE B;  2JXT A;  1JRU A;  3IT4 B;  4FHK A;  4M0W B;  2NR2 A;  1SGH A;  2QSD A;  2NS5 A;  4HRO A;  3S2A A;  4OZA A;  4ACF A;  2IO1 B;  2K9X A;  1ZOY B;  2IND C;  3V05 A;  1WYG A;  4A20 A;  2LHE A;  2QHO A;  2WLB A;  2KDM A;  2N1V A;  4GGQ A;  1F9J A;  2VZK B;  3ZGZ A;  4K3C A;  2KDF B;  2ASQ A;  4WWP A;  1T0Q C;  3RT3 B;  4E71 A;  3PGE A;  3TJP A;  2QC8 A;  5LXI B;  4MEL A;  3Q8F A;  5EE3 A;  4HKZ E;  5DCN A;  1PGA A;  1NDD A;  4LNI A;  4BKS A;  4WQO B;  4MAC A;  3W5V B;  2N1W A;  1YIW A;  2BYF A;  1C4C A;  2CJN A;  2Y5B B;  4PYU A;  4A90 A;  1JRP A;  1KLG D;  4C4V A;  3VTU A;  4JX1 C;  2IGH A;  4KV2 A;  1SIF A;  2EMT A;  4REZ A;  2IDY A;  3AH7 A;  2IO2 B;  3BK2 A;  2MLB A;  4B0M A;  2WXL A;  3IAM 1;  2BYE A;  4KKJ A;  3NZ3 A;  1B1Z A;  5I4D A;  3N32 A;  3IG3 A;  3NVW A;  3ZVV A;  1GB4 A;  1RAX A;  2OJR A;  2DX5 B;  2KFK A;  1EF5 A;  3DBL I;  4FXC A;  3HIZ A;  3A33 B;  3VAW A;  2Z8L A;  2UYZ B;  4ANX A;  3Q8B A;  1MVK A;  3M62 B;  3R66 C;  3JYU A;  1UUP A;  2WDT B;  1V1P B;  4N6E B;  1KRH A;  3NY5 A;  3QJZ A;  1E0Z A;  1WRI A;  3KUC B;  2N9P C;  4A3P A;  3URY A;  3A4R A;  2MSE D;  3DQV A;  2DEN B;  1JRO A;  3UQA A;  1QOF A;  4JIO U;  2PMV A;  3GB1 A;  1TS4 A;  3JSV B;  4WJN A;  3ZXR A;  1GC7 A;  1IUE A;  5D3I B;  3ABV B;  1VDV A;  4TSS A;  2PEA A;  4XWW A;  1QT9 A;  3EUB 2;  4BBN F;  3AE2 B;  1GOZ A;  1IYF A;  2V4I B;  3TEY A;  4HVB A;  1BXT A;  1K51 A;  4NJ7 A;  2KC1 A;  2FBW B;  2NBW B;  3PRZ A;  4EUT A;  1E90 A;  3U7D A;  2WXP A;  1WR1 A;  4RM8 A;  4KIK B;  4EE2 A;  5G2N A;  3ZUN A;  1P3Q U;  2DAJ A;  1WX9 A;  3PHW B;  2IO3 B;  1XLN A;  1YJ1 A;  1UBQ A;  4RNA A;  4ICU A;  2REX A;  3PZD A;  3P2B A;  4AUQ C;  2N9K A;  1PGB A;  2JXX A;  2L00 B;  3VR9 B;  3QA8 A;  3OG5 A;  1KM7 A;  1FO4 A;  3U30 A;  2K22 A;  2AL6 A;  1FNU A;  3GS2 A;  1K8R B;  4ZYS A;  2LXA A;  3L4P A;  3DVN U;  1AAR A;  4YT0 B;  1ZP0 B;  1V97 A;  3ONS A;  1WR6 E;  1S3S G;  5JZE B;  2I2Y A;  2BS2 B;  2EMS A;  4IWQ A;  3DDC B;  3ZW3 A;  2A5U A;  1R4M I;  2N7D A;  3MC9 A;  1ZPS A;  1E8Z A;  3EFC A;  3B08 A;  2R2O A;  1H4R A;  2BS3 B;  2WX0 A;  1WX8 A;  1WGR A;  1HEZ E;  4I6P A;  2BS4 B;  2KDE B;  2J53 A;  3VQI A;  1EWY C;  4KKI A;  3P4P B;  3QHT A;  2KMA A;  4XC2 A;  3NUH B;  4BBN C;  4TQ1 A;  3N9Y C;  4RGN A;  1TS3 A;  2MBE A;  2SAK A;  3SU8 X;  3KUZ A;  1PDX A;  3NHE B;  2V9H A;  5GMV A;  1CZP A;  4MT5 A;  1LGR A;  2BB6 A;  2MHJ A;  3EFU A;  4WUR A;  1HE8 A;  1WFY A;  4BKT A;  2QMT A;  3A1Q A;  1NBF C;  2AX5 A;  1XLQ A;  2WDQ B;  4H2A A;  3QAR A;  5JH5 C;  3HM3 A;  1WXS A;  1QQR A;  3FIL A;  1ZDX A;  2WS3 B;  3I57 A;  5CHW A;  4OVZ A;  4BKS D;  1TTN A;  1L6V A;  3PLV A;  3RNE C;  4NAM A;  2RPV A;  1WE7 A;  2OJW A;  4A6Q A;  2WGS A;  1SJE D;  4ANU A;  3ALB A;  1D6E C;  2XEW A;  2D3A A;  3N1X C;  4GDK A;  1XXG A;  2HJ1 A;  2RDH A;  3CSF A;  4OZB A;  3R2I A;  2PPH A;  2ACZ B;  2J0M A;  3QAQ A;  2BYT A;  2KX3 A;  5DPR A;  2GBJ A;  4QAY A;  3RNC C;  4USA A;  3Q3F A;  4ZRQ A;  3CF6 E;  4WAF A;  3AE5 B;  2YEP B;  3AE6 B;  2DLB A;  1H8C A;  3Q8E A;  1E9M A;  2KDB A;  4AWJ A;  2RD0 A;  3DBR I;  2ZNV B;  2MWS B;  2BF8 B;  2J42 A;  4DXA B;  4KDI C;  2O2V A;  1L2N A;  5EE1 A;  3W5U B;  3ZJT A;  4ITK A;  1WGY A;  3A9J B;  4IDI A;  4RGM A;  2FUG 1;  2D3B A;  1V2Y A;  1T0R C;  3H7P A;  2KJR A;  3AV8 A;  4PS7 A;  3PO0 A;  3DHG C;  2K8B A;  2NPT B;  1HA5 A;  1OQY A;  2I1K A;  1K53 A;  3P1M A;  1MJD A;  5JHA A;  1IPG A;  4C80 A;  5BYS A;  1XLP A;  2Z0E B;  4WJP A;  2W9N A;  2WXG A;  1V5T A;  5HG2 A;  3AU5 A;  4M00 A;  3V3X A;  4G11 A;  2LAS A;  2MBQ A;  4R3D A;  4MH0 E;  4RF0 A;  1WJU A;  3PPA A;  2LJI A;  3VTW A;  1I35 A;  2BW2 A;  2WXI A;  1MFW A;  1JWS D;  2KQ4 X;  3AE9 B;  1L4Z B;  1KF6 B;  1QLB B;  4HDO A;  3NG0 A;  3W1S A;  2XK5 A;  4NJ6 A;  4F1S A;  4F7Z A;  1C9F A;  1WF9 A;  2LI5 A;  2QJL A;  2L05 A;  4TKN A;  4K7W A;  5HFY A;  2WNM A;  2SEB D;  2FNJ B;  1TYG B;  4NNJ B;  3R7R A;  5EE0 A;  1JWB D;  2XBB C;  1E7P B;  3VVW B;  4D2K A;  4WWO A;  4DWF A;  2DZJ A;  2M19 A;  4FJZ A;  4DXG A;  1MPE A;  4KGS A;  1FNV A;  3M63 B;  4XZ4 A;  3L13 A;  1C4A A;  2DNF A;  2JZZ A;  4N58 A;  4F8C B;  3DOW A;  2LFI A;  2PVO D;  4KSK C;  4LJP B;  1JML A;  3E9S A;  3PT2 B;  1ZE3 D;  1T3Q A;  4IWO A;  1Y56 A;  2ZCB A;  4DHJ B;  2WXF A;  1WGH A;  3TSS A;  1I4R A;  2PE6 B;  1NVI D;  1WZ3 A;  3VRB B;  3MJW A;  1M4V A;  1L0V B;  1EM7 A;  4LNO A;  4W9K A;  3AE1 B;  2GBR A;  1UNS A;  4W9F A;  4GDL A;  4IOI E;  2HD5 B;  2KFK B;  2IY0 B;  1WWT A;  3L16 A;  1VZ6 A;  3W9C B;  3MC8 A;  2D3G A;  2INC C;  4CHK A;  4MSM B;  1E7U A;  1WSP A;  5EE9 A;  4RGT A;  2C5L C;  1AN8 A;  1YN5 A;  1PUT A;  5E6P A;  1GJZ A;  4ANV A;  1HTO A;  3T8M A;  1WMH A;  1TKG A;  5FKA C;  1ENF A;  3R7Q A;  1E8X A;  3PVL A;  5AZF A;  1PQS A;  2FCS A;  2KX0 A;  5CX3 A;  4KZ0 A;  4DHZ E;  3N30 A;  1RLF A;  2MCN B;  4XYC A;  3DVG X;  4I6L B;  2LZ6 A;  1ROE A;  3RNA C;  1N5W A;  3PTF C;  4OZC A;  2CHX A;  4P7I A;  3HUI A;  2N4F A;  3NS1 A;  2LGS A;  1D3Z A;  4XDD A;  1HZ6 A;  1E8Y A;  3SD5 A;  2C60 A;  1BUI C;  1EU3 A;  3BYY B;  5J17 A;  2KMC A;  1P7E A;  3I9V 1;  1MHH E;  3GOE A;  3ETR A;  1Q5W B;  4HEA 1;  3RNG C;  2BTE A;  5JHB A;  2JZ3 B;  1QF6 A;  3ZO5 B;  1E7V A;  1FFU A;  1HZ5 A;  4US9 A;  4BOS C;  2NTS A;  3H8H A;  4LLG M;  1WJN A;  2PLP A;  1UWM A;  1EU4 A;  2MBH A;  1GUA B;  3RZF A;  2HDE A;  3P4R B;  2LGX A;  2E6X A;  3QIJ A;  5E6J A;  3VDZ A;  4ZOH C;  2PW9 A;  1UEL A;  4K1R B;  2BPS A;  1WM3 A;  3N3K B;  4B95 A;  1M94 A;  3RYT A;  3NJT A;  4W9C A;  3GZN B;  2INP E;  2L52 A;  3FC4 A;  1FXA A;  1SF0 A;  3ZLZ A;  2K1F A;  1Q10 A;  1V8C A;  4L2Y A;  3DHH C;  1L6U A;  3KVF B;  4WWM A;  4HCN B;  3SFD B;  4JL9 A;  5E6N A;  4JE3 B;  3KW5 B;  3PHX B;  2WXM A;  1YNT E;  2WXQ A;  2HJ8 A;  2JY6 A;  4JPS A;  4XGA B;  2N0S B;  1MG8 A;  2ZW0 A;  1NYQ A;  3QX1 A;  4NY0 A;  1IBX A;  3O13 A;  3Q3M C;  3AEC B;  1EF1 A;  3VUW A;  2JU6 X;  5DPW A;  3I5J C;  4P6V F;  3IVF A;  2PTL A;  2J0J A;  2KMM A;  2O6V D;  4HLE A;  2IYD B;  5T8I A;  4PS8 A;  3IFW B;  3HK0 A;  4II3 B;  2G9H D;  2ZJD A;  1FXI A;  4HJG E;  3I3T B;  3T3N A;  2UU7 A;  2C7M B;  2KO3 A;  1QOA A;  1V6E A;  1WE6 A;  3AEF B;  1F2R I;  2WX1 A;  4IUM B;  5C2T B;  2I38 A;  1QKZ A;  2LGI A;  2WXO A;  2JYT A;  1ESF A;  3PRM B;  3ZKJ C;  1K50 A;  1WJ4 A;  4RM9 A;  4FN2 A;  4ANW A;  1YMH E;  3VXW A;  2QIL A;  1NEN B;  2KQ7 A;  3A1Q B;  4MSQ B;  4N59 A;  3AB5 A;  1E6E B;  1LO5 D;  2K5P A;  4X57 B;  2Q5W D;  3TEZ A;  3UIP B;  5D6J B;  1F52 A;  1WXV A;  2IGD A;  1P9D U;  3IAS 1;  4WH4 A;  2W54 A;  4KVG B;  3PRE A;  2OED A;  4A8X C;  1YJI A;  2MJ3 A;  4K3B A;  2V3S A;  2CHZ A;  1VZ8 A;  1YQ4 B;  3ML9 A;  1PYW D;  3GE3 C;  3W2D A;  3AE3 B;  4BAX A;  1TS2 A;  4GXB A;  3SHQ A;  4ZYN A;  3RMK C;  2AL3 A;  3MHZ A;  2G3Q B;  4KZC A;  5E6O A;  1IP9 A;  3T3O A;  3B2G A;  1L0X B;  2PIA A;  1N6Z A;  3D32 A;  4RGO S;  4DHZ B;  5C1Z A;  1BML C;  3L17 A;  2BT6 A;  4URK A;  3HVZ A;  1JCK B;  3P63 A;  1OGW A;  1FCC C;  4GMV A;  2PVG C;  2Z59 B;  4UDU C;  2MQJ A;  4BZA A;  4NPN A;  1FD6 A;  4WIP A;  1UH6 A;  4KDL B;  4HWI B;  4TUU A;  4YSZ B;  2KJ6 A;  2O2V B;  2HTM E;  5D7G A;  1FFV A;  3HRD D;  2QEJ C;  2QDF A;  2N9X A;  2R61 A;  3AUL A;  1E5W A;  2LMC A;  2Y5P A;  1VR9 A;  2M56 B;  1C77 A;  2NBU A;  4MJS A;  4ZRK A;  1FM0 D;  4LDT D;  3HM6 X;  2ONQ A;  4DDG D;  4FJY A;  3W1Y A;  2JWU A;  4A3O A;  1QOG A;  3BVG A;  3TMP B;  2GLS A;  2V4L A;  5IO9 A;  4IKG A;  3Q3N C;  1QOB A;  3ZRF A;  3ZDM C;  3PZ7 A;  1P1A A;  1MHX A;  2VH2 A;  3KH0 A;  5GXG B;  1WX7 A;  2LVO A;  1TJE A;  2ICI A;  2AEH A;  2WP9 B;  1QIL A;  3VUY A;  4W9E A;  2RDG A;  2B3A A;  5LNK 1;  2A4Z A;  4S17 A;  2J4X A;  4NQL B;  1DOI A;  1RM6 C;  2DYB A;  2LD9 A;  3ZNZ B;  1KJT A;  3MP9 A;  5CHV C;  3SEB A;  3C8Y A;  2CU3 A;  1YX6 B;  4PYZ A;  4RFB A;  2JRH A;  3AN1 A;  4WQM A;  1V1O A;  2KYW A;  2WDR B;  2JT4 B;  4IWP A;  4G0N B;  2NVU I;  4CYE A;  4AP4 C;  2LWP A;  5TSS A;  5L95 C;  2LRU A;  2MEK A;  2K6Q A;  3KYD D;  1C1Y B;  3NVZ A;  4GN1 A;  5D2M B;  2KK8 A;  1CJE A;  3UI3 A;  3N20 C;  2ZZP B;  3SDL C;  2WXJ A;  4NAW A;  3RN9 C;  1N62 A;  1LFD A;  2IJ0 A;  4A9A A;  3EC8 A;  2NBV B;  3WAL A;  1FRD A;  4AJW A;  3RUL A;  4GSW A;  1I4H A;  3L08 A;  4OHJ A;  3T9L A;  4JWU C;  5J18 A;  3L10 B;  2KKC A;  4B9K A;  4J6I A;  2LXC A;  2LHD A;  2RR9 A;  5FR3 A;  3Q6B A;  4W9I A;  2BVC A;  1WY8 A;  2D2Q A;  4AS1 A;  1C76 A;  1YX5 B;  1Q0W B;  2M0X A;  4NQK E;  3NOB A;  4GDL B;  1U4A A;  3LDZ E;  1XCQ L;  2FCN A;  2DZI A;  4DK5 A;  1FCL A;  3R8B A;  3PRP B;  2VRR B;  1VD2 A;  2GB1 A;  2ZEQ A;  3U2S C;  1QZE A;  3UIO B;  2LEK A;  5IAA C;  3C0R B;  2IZV B;  3HHM A;  1V5O A;  1NYR A;  1WMH B;  2MW5 A;  3EHV A;  5CTR C;  1J8C A;  2JX5 A;  2WXN A;  1SXT A;  3KYC D;  3NZU A;  2ZVO A;  1ISN A;  2KWD A;  3TBL D;  3B0A A;  3AEE B;  2KT7 A;  4M8N A;  5TR5 A;  3H9D A;  4FHJ A;  4JLC A;  2EKE C;  2BGF A;  2XNA C;  3HVD A;  4OW0 A;  2G4D B;  4YTM B;  5C23 A;  1R4N B;  5AZG A;  4EZL A;  3ZIM A;  2IGG A;  1I7H A;  1Z2M A;  4E3C A;  2IO0 B;  3OAW A;  3RCZ A;  2K6D B;  2MX2 A;  3P4Q B;  1FIQ A;  3ZTC A;  1UGM A;  3A9K A;  1J0G A;  4HKQ A;  4ZRP A;  1GAQ B;  2O6V A;  2GMI C;  4PK1 A;  2X38 A;  1XD3 B;  1J7A A;  1ET9 A;  1R4N I;  3E56 A;  4MEM A;  3GP7 A;  3UIN B;  2W3S A;  4EZK A;  1WXQ A;  4C7Z A;  1I4G A;  2ZPY A;  3DPD A;  3V60 A;  4L23 A;  3ZNI D;  1VRA B;  4DBG A;  1TT5 B;  1N63 A;  3NZS A;  2D07 B;  4ZHP A;  4YL8 A;  1KFY B;  4BVU C;  1D4B A;  3EEC A;  1UGJ A;  1ZW7 A;  3IBE A;  1NEK B;  1PFD A;  2ZCC A;  3TUO A;  3AEB B;  1BT0 A;  1LXD A;  1MG4 A;  1TY2 A;  2GRI A;  2DZM A;  1F0Z A;  3WAM A;  1N61 A;  4P16 A;  5AZH A;  4M02 A;  3APC A;  3ZJV A;  1TKE A;  2VZK D;  3AU4 A;  2K3U A;  4ICV A;  1WZ0 A;  1WI0 A;  3V62 A;  2ON8 A;  3B2F A;  4IM3 A;  3AI5 A;  4C4V B;  1T0S C;  3DWG C;  3KLS X;  5G5G A;  2WWZ A;  3UQB A;  2IY1 B;  3RI7 C;  4MDK E;  1NI2 A;  4LCD E;  3VR8 B;  2IBI B;  3B9J A;  3VFK A;  1IBX B;  3U52 E;  3BWU D;  3PLU A;  3Q8C A;  1D5X C;  3ZYY X;  2K25 A;  3U4E G;  4FAD A;  3CMM B;  2Y5C A;  3C19 A;  3SFE B;  4IW0 A;  5AUI A;  2C9W B;  2MBB B;  1GNU A;  4FJV B;  4Q2J A;  2W82 A;  4ZRJ A;  1SB3 C;  3I63 C;  2YLM A;  2KVZ A;  2C7N B;  4MGI E;  3IHP C;  1KLU D;  4KGR A;  1WGK A;  2BKF A;  1AYF A;  3BY4 B;  2BB5 A;  3FKY A;  1V81 A;  4GB9 A;  2WQY B;  3EGR A;  2Y3A A;  1RFK A;  1MI0 A;  3H7S A;  1T5X D;  1I42 A;  3TEW A;  2N9E B;  5DPS A;  1ZUD 2;  1Q1O A;  3A9J A;  4RH6 A;  2KLC A;  1L4D B;  2KTR A;  3VTV A;  2LGY A;  5HHD G;  3X23 A;  1SE9 A;  3PSE B;  1RFA A;  2YEP F;  1C3T A;  1XLO A;  2GBK A;  1ET6 A;  2KWU B;  2CKH B;  5BYR A;  4NJC A;  4K7U A;  1A70 A;  3ZNH B;  1C78 A;  2JF5 A;  1RRB A;  5BO4 B;  1TZO A;  2WDV B;  4FA6 A;  3SR6 A;  2JQR B; 
#chains in the Genus database with same CATH homology
 1YJI A;  3NVV A;  1QQR A;  2MJ3 A;  1SE3 A;  3FIL A;  1VZ8 A;  2WXK A;  1YQ4 B;  1ZDX A;  4YWG G;  4US8 A;  1GB1 A;  2WS3 B;  3AEG B;  3BVM A;  3I57 A;  1EWC A;  4OVZ A;  1PYW D;  4NZL B;  1E10 A;  3W2D A;  1JWU D;  3AE3 B;  1L6V A;  1TS2 A;  4YTP B;  4NAM A;  2RPV A;  1HQR D;  1R7S A;  4XE0 A;  4A6Q A;  3MHZ A;  1SJE D;  1J7B A;  4ZHO A;  4B0E A;  3T3O A;  3B2G A;  1L0X B;  4CQN A;  4DQO C;  1YJJ A;  1D6E C;  2PIA A;  4RGO S;  2LUM A;  1BML C;  1I4P A;  5BYQ A;  2BT6 A;  1AW7 A;  3ZJU A;  3HVZ A;  1JCK B;  3P63 A;  3LXF A;  1FCC C;  1XXG A;  2WXH A;  3LYY A;  2RDH A;  1DOX A;  4OZB A;  2PVG C;  3R2I A;  4A8X C;  1P7F A;  2ACZ B;  2H89 B;  4UDU C;  4KX6 B;  4A55 A;  2DYM A;  1FEH A;  1NI3 A;  2L83 A;  4L1B A;  1FD6 A;  4WIP A;  2BYT A;  2RMM A;  4C7Y A;  4YSZ B;  3TEX A;  5FK9 C;  4USA A;  3IT6 B;  4ZRQ A;  1AWD A;  4WAF A;  3R2T A;  3AE5 B;  2YEP B;  2KAJ A;  2HTM E;  4LTU A;  5MPO A;  3AE6 B;  2JZP A;  5D7G A;  1FFV A;  2DLB A;  3Q8E A;  3HRD D;  2N9L A;  1E9M A;  2QEJ C;  2V3P A;  1JWM D;  3MFG A;  5H92 C;  2R61 A;  2LMC A;  2Y5P A;  1KTK A;  1SJH D;  1XF5 L;  3MC0 B;  4YTN B;  2J42 A;  1VR9 A;  2M56 B;  1DGJ A;  1C77 A;  1FM0 D;  2CJO A;  5EE1 A;  3VRA B;  3W5U B;  3ZJT A;  2ONQ A;  4RCO A;  4ITK A;  4IDI A;  4RGM A;  2JWU A;  2FUG 1;  1QOG A;  1CQV A;  3BVG A;  2JSV X;  4IKG A;  3AV8 A;  1QOB A;  3PO0 A;  1FRR A;  5BMG A;  3PZ7 A;  2J52 A;  1ZXH A;  5AUK A;  1HA5 A;  1MHX A;  3KQ4 A;  2MH7 A;  5D3D A;  2INN E;  1K53 A;  3P1M A;  5GXG B;  1TS5 A;  1OFF A;  4C80 A;  5BYS A;  1TJE A;  1YQ3 B;  2ICI A;  2WP9 B;  1XLP A;  4AQ7 A;  1QIL A;  1RYJ A;  1FMA D;  2L32 A;  2RDG A;  2WU2 B;  2WXG A;  4TQ0 A;  5HG2 A;  1GPX A;  5LNK 1;  2N7J A;  2W55 A;  1PGX A;  3V3X A;  2EEL A;  1DOY A;  2J4X A;  1DOI A;  1RM6 C;  2NTT A;  3MP9 A;  4R3D A;  4RF0 A;  1SE2 A;  1ACC A;  3SEB A;  3C8Y A;  1RWS A;  2CU3 A;  1D5Z C;  2LJI A;  3DWM A;  3FIL B;  3P4S B;  2AQ3 B;  4RFB A;  2W3R A;  2V3N A;  3BYT B;  3AN1 A;  4ARI A;  1ZXI A;  2BW2 A;  2WXI A;  4WQM A;  1V1O A;  2WDR B;  1FNW A;  4JWS C;  4PT5 A;  1JWS D;  2KQ4 X;  3Q69 A;  3AE9 B;  1L4Z B;  1KF6 B;  1QLB B;  5TSS A;  2MEK A;  1JQ4 A;  4NAW B;  3W1S A;  2NMQ A;  3MJ5 A;  1VJK A;  1C9F A;  2FE8 A;  3NVZ A;  2QJL A;  2ZW1 A;  1STE A;  1CJE A;  2DWQ A;  1SBB B;  3AM9 A;  2WXR A;  3BVZ A;  5HFY A;  2WNM A;  2SEB D;  3UI3 A;  4GDK B;  1XEE A;  1TYG B;  2WXJ A;  1HXY D;  1N60 A;  4J3O D;  3U7Z A;  4YXD B;  3OWE B;  1N62 A;  5EE0 A;  1JWB D;  2IJ0 A;  4A9A A;  2WU5 B;  1E7P B;  1OQR A;  4TMA B;  4D2K A;  4GLS C;  1IGC A;  1FRD A;  2AQ2 B;  1T6B X;  1SE4 A;  2M19 A;  1I4H A;  2QIE B;  2JXT A;  4DXG A;  4OHJ A;  1MPE A;  4JWU C;  4KGS A;  3IT4 B;  4KGT A;  1FNV A;  2B76 B;  2GI9 A;  2QSD A;  1C4A A;  2LHD A;  4HRO A;  4OZA A;  4N58 A;  5FR3 A;  2K9X A;  1SIJ A;  1ZOY B;  2LFI A;  2XN9 C;  2PVO D;  1YN4 A;  3BII D;  3V05 A;  1WYG A;  3RFZ B;  2IPK D;  2LHE A;  4AS1 A;  1C76 A;  1JML A;  3AMZ A;  3E9S A;  1ZE3 D;  2WLB A;  2BBC A;  2KDM A;  2VZK B;  4M0W A;  3ZGZ A;  1T3Q A;  2D5G A;  2KN4 A;  1Y56 A;  2G1E A;  3CIR B;  5C3J B;  2WXF A;  4GDL B;  1XCQ L;  3Q8F A;  5EE3 A;  3TSS A;  4HKZ E;  1I4R A;  1PGA A;  1NVI D;  1I4X A;  3VRB B;  4MAC A;  1FCL A;  3R8B A;  3W5V B;  1C4C A;  2CJN A;  1M4V A;  2GB1 A;  1L0V B;  1EM7 A;  1JRP A;  1KLG D;  3KWV A;  3AE1 B;  4RF1 A;  3U2S C;  4A90 A;  4JX1 C;  2IGH A;  1D5M C;  1UNS A;  2LEK A;  4XWT A;  4REZ A;  2IDY A;  3AH7 A;  4IOI E;  3CWI A;  1NYR A;  3BK2 A;  4B0M A;  1UWX A;  2WXL A;  3FAH A;  1WWT A;  3IAM 1;  4KKJ A;  3NZ3 A;  1VZ6 A;  3W9C B;  1C4P A;  2JX5 A;  2WXN A;  1IGD A;  1SXT A;  1B1Z A;  2EKI A;  5I4D A;  1WSP A;  2KWD A;  5EE9 A;  4RGT A;  3ZQ4 A;  1AN8 A;  3NVW A;  1YN5 A;  1PUT A;  3RPF C;  3AEE B;  1GB4 A;  4FXC A;  2E3T A;  1J7C A;  1TKG A;  5BMI A;  5FKA C;  5HI1 A;  1ENF A;  2Z8L A;  2XNA C;  3HVD A;  4OW0 A;  4YTM B;  3Q8B A;  1MVK A;  4YSX B;  1CK1 A;  1UUP A;  5BMH A;  1V1P B;  2IGG A;  1I7H A;  1C79 A;  4N6E B;  1JWA D;  1KRH A;  1E0Z A;  1WRI A;  1ROE A;  4XDC A;  3BZD B;  3URY A;  1I4Q A;  1FIQ A;  3P4Q B;  1N5W A;  4HKQ A;  4ZRP A;  2TSS A;  1OQQ A;  4OZC A;  1GAQ B;  4ARC A;  3HUI A;  3NS1 A;  1XCT L;  1V1P A;  1JRO A;  1QOF A;  2X38 A;  2PMV A;  3GB1 A;  4XDD A;  5G5H A;  1TS4 A;  1J7A A;  5JXV A;  1HZ6 A;  3NVY A;  2M0A A;  1ET9 A;  3E56 A;  1BUI C;  1EU3 A;  3BYY B;  4YSY B;  3GP7 A;  1IUE A;  1P7E A;  2W3S A;  1VZ7 A;  1WXQ A;  1I4G A;  3ABV B;  5D3I B;  3I9V 1;  4C7Z A;  1MHH E;  1SSN A;  1VDV A;  4TSS A;  2OHF A;  1L0Y B;  4L23 A;  2AQ1 B;  4XWW A;  1VRA B;  1QT9 A;  3EUB 2;  1N63 A;  3AE2 B;  1GOZ A;  3ETR A;  4ZHP A;  1KFY B;  1D4B A;  4HEA 1;  2V4I B;  3TEY A;  2BTE A;  1UGJ A;  2V0G A;  1NEK B;  1PFD A;  1QF6 A;  3TUO A;  1BXT A;  3AEB B;  1FFU A;  3AE4 B;  1HZ5 A;  1K51 A;  4US9 A;  2NTS A;  1TY2 A;  2GRI A;  3H8H A;  4LLG M;  3Q8A A;  1F0Z A;  1DYQ A;  2FBW B;  2PLP A;  1N61 A;  1UWM A;  4P16 A;  1EU4 A;  3ZJV A;  1TKE A;  2VZK D;  2K3U A;  2WXP A;  2HDE A;  3P4R B;  2E6X A;  2H88 B;  4EE2 A;  5E6J A;  4ZOH C;  2PW9 A;  3J9C A;  2ON8 A;  3B2F A;  3IXS A;  1TKY A;  1XLN A;  1F77 A;  4RNA A;  1XO3 A;  1KH0 A;  3DWG C;  3KLS X;  5G5G A;  2INP E;  2L52 A;  2MJD A;  2PKO A;  3FC4 A;  3VR8 B;  1FXA A;  1SF0 A;  2N9K A;  1PGB A;  1Q10 A;  3VR9 B;  1V8C A;  3B9J A;  4L2Y A;  1VLB A;  1L6U A;  1IBX B;  3AE8 B;  4WWM A;  3SFD B;  3U52 E;  3AED B;  3BWU D;  1N5X A;  1FO4 A;  3Q8C A;  1D5X C;  1L5P A;  3ZYY X;  4JE3 B;  3U4E G;  2K22 A;  2JYE A;  1FNU A;  2WXM A;  2Y5C A;  1YNT E;  3GS2 A;  1JAL A;  2WXQ A;  3BK1 A;  4JPS A;  3SFE B;  4DXF A;  4ZYS A;  5AUI A;  2L1A A;  2N0S B;  3KWL A;  2ZW0 A;  3L4P A;  1NYQ A;  4Q2J A;  1B9R A;  5H8Y E;  3O13 A;  1IBX A;  2W82 A;  3AEA B;  1SB3 C;  3AEC B;  4YT0 B;  1ZP0 B;  3AE7 B;  1V97 A;  2JU6 X;  1KLU D;  4KGR A;  1WGK A;  2I2Y A;  4P6V F;  2BS2 B;  2KMM A;  2PTL A;  2KAC A;  5T8I A;  1AYF A;  2G9H D;  2BB5 A;  1FXI A;  4O1N A;  2WQY B;  4HJG E;  1TY0 A;  2Y3A A;  3EGR A;  3T3N A;  1RFK A;  1MI0 A;  1ZPS A;  1T5X D;  1QOA A;  2BS3 B;  3AEF B;  4C56 C;  1ZDV A;  1F2R I;  3TEW A;  1ZUD 2;  4LK0 M;  1HEZ E;  1F2R C;  2BS4 B;  5C2T B;  4RH6 A;  2I38 A;  1JW9 D;  1QKZ A;  2J53 A;  1L4D B;  2LGI A;  1EWY C;  2WXO A;  3VQI A;  2JYT A;  1ESF A;  4KKI A;  5HHD G;  1K50 A;  3P4P B;  1YMH E;  2YEP F;  3NUH B;  1XLO A;  2QIL A;  2DBY A;  1NEN B;  1ET6 A;  3N9Y C;  4HRS A;  1SEB D;  4TQ1 A;  5BYR A;  3WCQ A;  4RGN A;  1TS3 A;  4N59 A;  4NJC A;  2DYO A;  2SAK A;  3AB5 A;  1A70 A;  3NRZ A;  3P42 A;  1PDX A;  1E6E B;  1LO5 D;  2K5P A;  1CZP A;  2MJE A;  2Q5W D;  1C78 A;  3TEZ A;  2K0P A;  1TZO A;  2BB6 A;  4MT5 A;  1K52 A;  4WUR A;  2WDV B;  2QMT A;  2IGD A;  3IAS 1;  1YN3 A;  2AX5 A;  3EA6 A;  3PZ8 A;  4MH8 A;  3SR6 A;  4WH4 A;  2JQR B;  2W54 A;  1XLQ A;  3LB8 C;  2OED A;  2WDQ B;  4H2A A;  4MM3 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...