1I42A

Nmr structure of the ubx domain from p47
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
89
structure length
89
Chain Sequence
KASSSILINEAEPTTNIQIRLADGGRLVQKFNHSHRISDIRLFIVDARPAMAATSFVLMTTFPNKELADENQTLKEANLLNAVIVQRLT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Protein binding
molecule keywords P47
publication title Solution structure and interaction surface of the C-terminal domain from p47: a major p97-cofactor involved in SNARE disassembly.
pubmed doi rcsb
source organism Rattus norvegicus
total genus 12
structure length 89
sequence length 89
ec nomenclature
pdb deposition date 2001-02-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00789 UBX UBX domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 1i42A00
3QC8B 1WX9A 4NAWA 3W1SA 2AWTA 2K6QA 4II2B 4GGQA 1OTRB 1TBEA 2K8BA 3DBHI 4URKA 2DYOA 3A4SC 4GMVA 3X23A 3CSFA 4W9GA 2C7MB 2KFJA 3V6EB 2KK8A 2JWZA 3SHQA 4EFOA 2C5LC 2RR9A 4HDQA 2M17A 5D94A 5LXHA 3HIZA 4GDKA 4K1RB 4ANXA 2ZEQA 5FR6A 3CF6E 3WANA 4RMAA 1WF9A 3PLVA 5E6PA 1EO6A 4W9DA 3DDCB 1WZ3A 1X1MA 4LDTD 4ZYNA 2DX5B 5J2RA 2FIDA 3PS6A 1FXTB 3VDZA 3A9KB 3HM6X 3QARA 1TZ1A 4GDLA 3EC8A 3U8ZA 1V2YA 3UF8A 3ALBA 4XZ4A 1LXDA 2I1KA 1WRDB 1WXVA 3TJPA 5AZHA 2LGXA 2V1YA 3A9JA 3DVNU 4WWNA 3QQ8B 3QX1A 4NQKE 3ZNID 2BWES 5KHQA 3QIJA 2PE9A 2NCNA 5AZGA 4MEMA 1WGGA 5E6NA 1WMHB 3ML8A 4RM9A 3V6CB 3ZTCA 1H8CA 3VFKA 4MGIE 2XK5A 2LJ5A 3RULA 2MWSB 3QJZA 1TGZB 1VCBA 2N9EB 2C7HA 1UELA 1V81A 2BKFA 4MSQB 2WYQA 2I1JA 4W9JA 2KFKA 1ISNA 1SGHA 4W9KA 4WJNA 3V60A 2ASQA 1GUAB 2FCQA 3MJWA 2LGYA 2ZNVC 2JY6A 5D7GA 2BYEA 3VVWB 2LD9A 4BFRA 4NPNA 2HTHA 2PPHA 2C9WB 2O6VB 4K7UA 2M4NA 2PJHA 3KW5B 3A1QA 4GB9A 2KVRA 1WM3A 1PQSA 4ZRKA 2ZZPB 2MBBB 1GC7A 2AYOB 5HKHA 1WH3A 3TIXA 4HXDA 2N9PC 2BYFA 3X0WA 3DCGA 3EECA 1WY8A 2NPTB 4MSMB 1OGWA 3L08A 3L54A 2EKEC 1LFDA 3BINA 3Q3JA 1KM7A 3U30A 1WGDA 1IP9A 2IYDB 2Z0EB 2V3SA 1LQBA 3VTUA 5DCNA 4MH0E 3L10B 3H6NA 1V5TA 3H9DA 2KKCA 4EZKA 2UYZB 4ZDVA 3IHPC 2M1MA 4OVVA 4MJSB 2MP2B 2K8CA 1P0RA 2KD0A 2MW5A 5CHWA 4CHKA 5CTRC 1RAXA 2N7DA 1I35A 2FNJB 3AXCA 3KYDD 4PYZA 3ZUNA 3QCAA 2L05A 2ZCCA 3T8MA 4ASWC 1M94A 5LXIB 4GU2A 4AP4C 2MBOA 4N9F4 1OEYA 2K6DB 1D3ZA 3SDLC 2K25A 5DPTA 5BO4B 5J18A 1UGMA 3L16A 3CSTA 5CHVC 4G11A 2LASA 3N3KB 2KQ7A 4HJKA 1WJUA 2IO3B 4XX5A 4GIVA 4IWQA 3EHVA 3PREA 2RGFA 3ZNHB 5C23A 2KZRA 4IWOA 2GBRA 2PEAA 4GDKB 2DHZA 3L0WB 2OOBB 2ZVOA 2V4LA 5D2MB 3TCAA 2KJHB 2ZPNA 4I6LB 4MDKE 4WJPA 3ZDMC 3KVFB 2B3AA 4BOSC 2KXJA 3M63B 4HCNB 2FCSA 1E8ZA 2L3ZA 1Z5SB 1R4NI 3R7RA 4M8NA 2LVQA 1I42A 2DZKA 2MA9B 3APFA 4OVUA 3TMPB 2L0FA 4GDLB 2R2OA 3PRPB 2LZ6A 2K39A 3OJ3A 2KLCA 4IC7B 4M8MA 2MCNB 2NBVB 3SD5A 3H1UA 2WWZA 4FJVB 1WX8A 3QAQA 3A9JB 3JSVA 2MLBA 3H7SA 2DZJA 3K9OB 2ZPYA 3PHXB 2KMCA 1E5WA 1UBIA 2KDIA 1IYFA 2XBBC 2HE7A 3PRZA 2ZCBA 2GBMA 3O65B 3P2BA 2KC1A 4MM3A 2XK5B 1MG8A 4PS3A 2KDBA 3OJ4B 3W1YA 2ZVNA 3ZDTA 2L76A 2J0KA 4IM0A 4FLHA 1KJTA 2CS4A 2KFKB 3LDZE 5GMVA 2HD5B 1WXSA 2GBJA 3AU5A 3DQVA 4MGYE 4TQ1A 2BYVE 3TBLD 3ZRCA 2A5UA 1V5OA 4EKUA 1SIFA 1P9DU 2C60A 1Q0WB 1WR1A 2IO2B 4BKGA 2GBNA 4HDOA 5JHBA 5DPSA 3AULA 2IZVB 4FA6A 1S3SG 2FAZA 3ZVVA 2KOXA 4KIKA 3S2AA 2QHOA 3PHWB 1GC6A 4DXAB 3D32A 3L17A 1S1QB 2GMIC 3GZNI 2LXAA 2CKHB 4K81A 1L7YA 4IM3A 4GXBA 1Q5WB 5IA7A 2JZ3B 3R7QA 1OQYA 2KLGA 3RCZA 4W9HA 3M3JA 1WZ0A 4BOZB 3NOBA 4KVGB 2GOWA 3WALA 5DPRA 3ML9A 2O2VB 2N9XA 2DZMA 4ICVA 1WJNA 3NS8A 4FN2A 3ZKJC 1P1AA 2J7QB 3OLMD 3PGEA 4JLCA 2O6VD 3IG3A 4LJOB 1RFAA 5KHOA 2EMSA 3CMMB 5L83A 1Y8RC 2LVPA 2VRRB 3PV1A 4W9CA 4DBGA 4FHKA 1WR6E 2DZIA 3AU4A 3AI5A 4II3B 5JHAA 2IBIB 2MBQA 2KWUB 4B9KA 2FCNA 2LRUA 2ZNVB 2DAFA 2KX3A 3R3MA 4KSLC 4W9IA 1AARA 2NBUA 3ZIMA 1XT9B 2MQJA 2KANA 2KTFA 3B1LX 4X57B 1A5RA 2JT4B 3A4RA 2NBWB 3H7PA 5JH5C 1YX5B 2EMTA 2IO1B 1YJ1A 1TTNA 2DENB 3VTWA 4E71A 4NJ6A 4AJWA 1LM8B 1ZW7A 2CHZA 2DYMA 2M8SA 4I6PA 4KDLB 3HK0A 3KUCB 4GOCA 3RYTA 4ANWA 1K8RB 1WE7A 1YX6B 3PLUA 3HHMA 3PTFC 1RLFA 3B08A 4DDGD 3VUXA 4E3CA 3WAPA 3PSEB 3RZWC 5AEKB 2L7RA 4F8CB 1IPGA 3SU8X 4G0NB 5D6JB 3MTNB 3L13A 1WXMA 3JW0X 4AUQC 4DDID 4TV3A 3PRMB 3NZSA 4F1SA 4IWPA 3DBRI 4PS8A 2MSED 3NY5A 2LWPA 1NBFC 4NAWB 3VUYA 3A33B 4WJOA 1JRUA 2RPQA 2NR2A 2UWQA 5J17A 4CYEA 2MBEA 3DPDA 3PPAA 1E8XA 1U4AA 2RSUA 2KDFB 2RD0A 4XC2A 5CX3A 2OJRA 2AL6A 3ZLZA 3I3TB 4AWJA 4DHJD 3JSVB 3VAWA 3N30A 1NI2A 2ZJDA 3VH4B 2KTRA 1YIWA 1Z2MA 2WDTB 1GG3A 3V61A 1RRBA 1KOTA 4G50A 4G3XB 3IFWB 3UINB 1GJZA 1WFYA 2J0MA 3DVNV 1F9JA 2LI5A 4DHZB 3LJ3A 2JXXA 3PVLA 4BBNF 1P3QU 1Q1OA 4KDIC 2IO0B 3DVGX 4FADA 1V9JA 4MELA 2MX2A 3WAMA 4HLEA 2YLMA 3RUIB 4F7ZA 4NY0A 2D11A 4KSKC 1XD3B 4BVUC 2BGFA 2CHWA 2KN5A 4TKNA 4EZLA 4W9EA 2BWFA 1V6EA 5G2NA 4KIKB 3TL5A 4CO7A 2AL3A 1WGRA 2KWVB 4JL9A 4JQWC 4DK5A 4EUTA 2WX0A 2REXA 3ONSA 1E7VA 1KLVA 1WXAA 1G6JA 2L8JA 2A4ZA 2J0JA 4WAAA 4NQLB 1UBQA 4WWOA 4BKSD 2CU1A 2HJ8A 4IW0A 3ZNGC 4J6IA 4IM2A 4ICUA 4ANVA 2IY1B 3WAOA 1EUVB 2G4SA 2XEWA 2JPHA 4JIOU 1WJ6A 3ZTDA 2KHWB 1H4RA 3M62B 3A1QB 2KWCA 1WE6A 1QZEA 4P7IA 3M95A 4BBNC 2KC2A 4LDTB 4W9FA 4TQ0A 4FJYA 1ZGUB 1R4MI 3MHSD 1OEYJ 2D2QA 2L00B 2NS5A 2FIFA 3ECIA 2D07B 1UD7A 5L95C 4ANUA 2MBHA 1J0GA 3KYCD 3UIPB 2LVOA 4WWPA 2C7NB 2KMAA 4A20A 2JZZA 2G45B 3JVZX 3Q3FA 4RM8A 5AZFA 1V49A 1UZXB 3QWZB 2PE6B 3QK0A 5TR5A 3VHTC 3H7PB 4EEWA 4M0WB 3UQBA 3VXWA 3B0AA 4PYUA 1L2NA 3ZO5B 2BPSA 3HM3A 4KV2A 4ZRJA 1CMXB 2N4FA 3UGBB 4DWFA 3T9LA 5CHFA 3WIMA 4HPMB 2N1VA 1SE9A 1V86A 1GNUA 4FJZA 4NJ7A 2Z0DB 2W9NA 4AOFA 2JVCA 1J8CA 1NDDA 4BKSA 2LUEA 3A9KA 3C0RB 4NNJB 1E7UA 2WX1A 3GOEA 3DVGY 3QHTA 1WX7A 2BKRB 2JRHA 1WGYA 4HPLB 2FUHB 4MGKE 3U7DA 4K7WA 4B6WA 5EDSA 3RD2A 2AEHA 1BT0A 2CR5A 4WQOB 5JZEB 2DAJA 5LLIA 2LGDA 3RT3B 1WMHA 5E6OA 2KQSA 2Z59B 2NVUI 4E74A 3KUDB 1WI0A 2JRIB 1XQQA 1C3TA 2KTRB 4B95A 2D3GA 1E90A 4EZJA 4WJQA 4AJYB 3DOWA 3PT2B 1V80A 1YD8U 3V62A 4KZCA 3NHEB 2Y5BB 2JUOA 4HK2A 4JGHB 3OAWA 4LJPB 1HE8A 4EOYA 1VD2A 3NZUA 2KJRA 4PS7A 5C1ZA 4BKTA 2O2VA 4IUMB 2GBKA 2KX0A 4W9LA 3IVFA 5DPWA 2O6VA 4GSWA 2N1WA 4HWIB 4KZ0A 3ZRFA 3W1SC 3QA8A 3ZW3A 2K8HA 3IBEA 2FCMA 3EFUA 3APDA 3DBLI 4MGZE 4TUUA 4FBJB 3WA0A 2NPTA 3JYUA 4HVBA 2K1FA 3KH0A 3VUWA 3N32A 2KDEB 4FHJA 3UIOB 3VH3B 1T0YA 4YL8A 2CHXA 1EF5A 3VQIA 3VTVA 2YVCA 2KO3A 5G55A 1WM2A 1ZKHA 2N7EA 1UH6A 3RZFA 5IAAC 1C1YB 2KJ6A 4IG7B 3UQAA 4GN1A 4MJSA 2MP2A 4DHJB 4HCPB 2D10A 3K9PB 4A3OA 3R66C 1EF1A 3ENEA 2JF5A 4DHZE 2KNBA 1J19A 1E8WA 2BF8B 2M0XA 2MRPA 3BY4B 2LRWA 1YQBA 3APCA 1P98A 2L0TA 4I6NB 2R2QA 4K7SA 4LCDE 1WYWB 2IY0B 3PZDA 4ZRIA 4FULA 1E8YA 1WJ4A 3DBSA 4A3PA 2G3QB 2LXCA 3ZNZB 1WIAA 1WGHA 2DYBA 3KUZA 2G4DB
chains in the Genus database with same CATH superfamily
3W1SA 1DOIA 4GGQA 4URKA 2DYOA 3A4SC 3BVMA 3U52E 3X23A 2C7MB 2DWQA 2KK8A 2JWZA 2L1AA 1OQRA 2LHEA 3WANA 5BMHA 1WF9A 1EO6A 3N1XC 4W9DA 1KTKA 3Q6BA 1WZ3A 4LDTD 4ZYNA 3TEWA 1L0YB 2DX5B 3I9V1 3PS6A 3A9KB 1TZ1A 1SF0A 3ABVB 1LXDA 2I1KA 2L83A 5AZHA 2LGXA 5FK9C 3QX1A 3FAHA 3ZNID 5KHQA 1R4MB 3Q3MC 3ML8A 4MGIE 2XK5A 2K0PA 2C7HA 1V81A 2BKFA 4R3DA 1F77A 2WYQA 4W9JA 2KFKA 1SGHA 4W9KA 2FCQA 4L2YA 2ZNVC 2QEJC 3N1YC 1TS5A 4L23A 4BFRA 2CJOA 2M4NA 3KW5B 2LFIA 4ZRKA 5HKHA 2N9PC 1FPYA 3DHIC 2PTLA 3MC8A 3P4SB 4LK0M 3ZQ4A 3BINA 1C77A 1QLBB 3L10B 3H9DA 4YWGG 3IHPC 4OVVA 4MJSB 5CHWA 2K8CA 1JWMD 4CHKA 4J3OD 2N7DA 2D3CA 2EELA 2FNJB 2WHIA 3KYDD 4IDIA 1E0ZA 2ZCCA 1EWCA 3Q69A 1BMLC 2D3BA 4ASWC 5LXIB 4GU2A 4AP4C 2JYTA 4N9F4 2AQ2B 1N5WA 1TY0A 3KLSX 1NVID 1F2RC 4YSYB 2KQ7A 1D4BA 4XX5A 4WAFA 1ZOYB 5TSSA 3PREA 3ZNHB 1JRPA 5C23A 2KZRA 5E6JA 4P1BC 2OOBB 2KJHB 4LNOA 1JWAD 1E8ZA 3R7RA 3Q8FA 3AE8B 2IGDA 3PRPB 3AEDB 2MCNB 3H1UA 2WWZA 1IGCA 3QAQA 3JSVA 4A8XC 2MLBA 2QIEB 3RNCC 3W5VB 2DZJA 2ZPYA 2KMCA 1IYFA 1T0SC 2KC1A 3P2BA 4MM3A 2XK5B 3W1YA 1F0ZA 1KJTA 2SAKA 3TEYA 2KFKB 5GMVA 2HD5B 2GBJA 3AU5A 1I7HA 4MGYE 3V05A 1Q0WB 1TS4A 1SIJA 4ACFA 5DPSA 1ET6A 3ZVVA 3S2AA 4JPSA 4REZA 1FNVA 1QOBA 3GE3C 3GZNI 2M56B 2V3NA 1IBXA 2JZ3B 1NYQA 5C2TB 2GI9A 2GOWA 3WALA 5DPRA 3AV8A 1VZ6A 3IAS1 3ZKJC 3OLMD 4JLCA 5GXGB 3IG3A 2EMSA 5L83A 4YTNB 1Y8RC 2VRRB 3SFDB 3AU4A 5JHAA 2PMVA 3N20C 1ZUD2 2DAFA 3R3MA 2NBUA 1XT9B 2MQJA 2INDC 4M01A 4RH6A 4X57B 2WXMA 1UGJA 2EMTA 2IO1B 1YJ1A 1TTNA 4ZOHC 4NJ6A 4AJWA 1LM8B 1ZW7A 2FUG1 3PLUA 3PTFC 1RLFA 2WU2B 3WAPA 1PDXA 3PSEB 1I4GA 4F8CB 3MTNB 4USAA 1ZPSA 3NZSA 2N7JA 1B9RA 3NY5A 1FD6A 2BW2A 1JRUA 2RPQA 2UWQA 2E6XA 3DPDA 3PPAA 2RSUA 4AWJA 4DHJD 3JSVB 3VAWA 1BXTA 3DBRB 1YIWA 1QILA 1GG3A 1DOXA 1F52A 1D6EC 4G50A 3H8HA 3IFWB 1WFYA 3T3NA 2WLBA 4MELA 3WAMA 1FMAD 2KAJA 2IPKD 2KN5A 2ON8A 2BWFA 2QC8A 4JE3B 3I57A 2DBYA 5G2NA 1R4NB 1WGRA 5G5GA 5IOIA 1E7VA 2J0JA 1IBXB 4WAAA 1ZXIA 1UBQA 4K3BA 1FFUA 4ZHPA 4J6IA 3EGRA 4ICUA 1SE4A 4MT5A 2G4SA 4ZRPA 1H4RA 3M62B 3A1QB 3NRZA 3AEFB 1I4XA 1VJKA 5HFYA 4W9FA 4TQ0A 1R4MI 3MHSD 1OEYJ 2L00B 2LVOA 2C7NB 2KMAA 4A20A 2G45B 2LEKA 1V49A 3QWZB 2PE6B 4DXGA 3B0AA 1JCKB 4KV2A 4ZRJA 4JX1C 4TMAB 3T9LA 2SEBD 2JXTA 2N1VA 4FJZA 1GNUA 1NDDA 3FC4A 3IXSA 4NNJB 3C0RB 2WGSA 4HJGE 2WXLA 2WQYB 3SR6A 5BYQA 4HROA 2BVCA 4B6WA 1JWUD 2LGSA 5EDSA 2CR5A 1BT0A 1UWXA 5LLIA 4S0RA 3RT3B 5E6OA 5AUIA 4KKJA 2KQSA 2UU7A 4E74A 1WI0A 4RCOA 2D3GA 1UUPA 1E90A 3PT2B 4OZAA 1K51A 1WYGA 3NHEB 4US8A 1L4ZB 4HK2A 1RM6C 2JUOA 3AEEB 3OAWA 4EOYA 5C1ZA 1L2NA 2O2VA 2AQ3B 4HWIB 4KZ0A 3ZRFA 3W1SC 1FXIA 1P7EA 1VLBA 3ZW3A 3IBEA 3AM9A 2H89B 3EFUA 1EU4A 3DBLI 4FBJB 1Y56A 3RMKC 4HVBA 3P63A 1XF5L 3HRDD 1KLGD 2WXHA 1L0XB 1JALA 3HVDA 1WSPA 3Q8CA 3RZFA 3N9YC 4GN1A 2MP2A 3AMZA 3APCA 4I6NB 2R2QA 3AEBB 1E8YA 1MG4A 2LXCA 1SE2A 1WIAA 5JXVA 2DYBA 4NJCA 2AWTA 3I5JC 1OTRB 2K8BA 1L6VA 2RDBC 1V97A 3SHQA 3TUOA 2RR9A 1FCLA 4K1RB 2RDHA 5D3DA 5E6PA 2GLSA 3DDCB 3DBHB 2I2YA 5J2RA 1AWDA 1KLUD 3W9CB 1FNWA 3QARA 4GDLA 3U8ZA 3UF8A 1V2YA 1I4QA 4MACA 3DVNU 3QQ8B 1NI3A 2JQRB 3Q14C 2PE9A 2G1EA 3DWMA 3ZJTA 1FM0D 1H8CA 2MHJA 2D5GA 4S17A 2K3UA 2LJ5A 3RULA 2MWSB 3EFCA 1K52A 3V60A 4WJNA 2JY6A 1E6EB 2KMMA 2BYEA 2LD9A 2PPHA 3Q8EA 4C4VA 4GB9A 2KVRA 2WXPA 2GB1A 1PQSA 3W5UB 2MBBB 4K3CA 2AYOB 1WH3A 4HXDA 2BYFA 4KX6B 3L54A 2EKEC 2Y5PA 2E3TA 1LFDA 3Q3JA 1TY2A 1KM7A 1IP9A 2LUMA 1ENFA 2V3SA 5DCNA 1MJDA 1SJHD 2YEPF 4MH0E 3VRBB 4PK1A 2KYWA 1V5TA 5MPOA 4EZKA 4ZDVA 5FR3A 2MP2B 1P0RA 1L5PA 5CTRC 5BMIA 4PYZA 3ZUNA 4EE2A 2L05A 3T8MA 3SEBA 2MBOA 1C78A 2NTSA 5DPTA 5J18A 1UGMA 3CSTA 2N9LA 5CHVC 4G11A 2IO3B 1SE3A 1JWSD 4US9A 5LNK1 2RGFA 2JYEA 4IWOA 1ACCA 2BT6A 2IGHA 2WDVB 2DHZA 3R2IA 3RI7C 3L0WB 2ZVOA 5D2MB 4I6LB 2W82A 2KXJA 4HCNB 2FCSA 4C80A 2L3ZA 1R4NI 1CJEA 2LVQA 1I42A 2DZKA 1XLPA 1EU3A 4OVUA 2L0FA 4GDLB 2MEKA 3VR8B 1SB3C 1QT9A 4FJVB 1JROA 3KWLA 3K9OB 4WWMA 2QMTA 2XBBC 2HE7A 2KWDA 2GBMA 4DQOC 4LNKA 1CK1A 2ZVNA 2ZW1A 2L76A 3NVVA 1FXAA 3HUIA 1XLQA 1WXSA 3DQVA 3T3OA 3U2SC 3ZRCA 4EKUA 1UF0A 1UNSA 2IO2B 2GBNA 5JHBA 1JWBD 2FAZA 4LLGM 1C76A 3P1MA 2ONQA 1FRDA 4DXAB 3L17A 1S1QB 4JWUC 2LXAA 2CKHB 1A70A 1L7YA 4IM3A 3R7QA 4C7YA 2KLGA 3NS1A 3ZXRA 3RCZA 2PIAA 3M3JA 1WZ0A 4BOZB 3EUB2 2HDEA 3NZ3A 2DZMA 4FN2A 1Q10A 3VRAB 2RMMA 2WXIA 4OVZA 4DBGA 4II3B 2MBQA 3PO0A 3TEXA 3AECB 4B9KA 3KQ4A 2LRUA 4KSLC 1AARA 1HZ5A 4P6VF 4HKZE 3B1LX 2KANA 2KTFA 1A5RA 2JT4B 4NZLB 5JH5C 3H7PA 3VTWA 2CHZA 2DYMA 4I6PA 3KUCB 3RYTA 1K8RB 1YX6B 3VUXA 3SU8X 1M4VA 1TS3A 3JW0X 4AUQC 4F1SA 2WXQA 1F2RI 3A33B 2K22A 4ARIA 4CYEA 2BTEA 2H88B 2W3SA 4IOIE 1E8XA 1U4AA 2RD0A 5CX3A 2OJRA 2AL6A 3ZLZA 3B2FA 2INCC 4QAYA 1MHHE 2WDTB 3LYYA 3V61A 1RRBA 3RPFC 1FCCC 1GB4A 1KOTA 3P4PB 3MJ5A 4XDCA 3GS2A 5FKAC 1F9JA 1MFWA 1D5XC 3PVLA 4BBNF 1VZ8A 4KDIC 2DNFA 2YLMA 4XWWA 4NY0A 4W9EA 2BS4B 1J7CA 1DYQA 3AB5A 4CO7A 2WP9B 4DK5A 3L4PA 3PZ8A 2VZKB 1PYWD 3ONSA 1PGBA 1FEHA 2A4ZA 4NQLB 2L52A 4BZAA 2HJ8A 3IAM1 2IY1B 2V3PA 1PGAA 1T3QA 3WAOA 2JPHA 4JIOU 1WJ6A 2MJEA 2KHWB 2X8XX 4P7IA 3M95A 4BBNC 2KC2A 3BWUD 1ZGUB 2D2QA 3ECIA 2D07B 5L95C 3ZJUA 4ANUA 1J0GA 3KYCD 2PKOA 2JZZA 5AZFA 3QK0A 5H8YE 3H7PB 3NJTA 3VXWA 1L6UA 3AEAB 1VZ7A 1CMXB 1GOZA 4DWFA 3WIMA 4HPMB 1SJED 1SE9A 3NVWA 1C4PA 3P42A 4AOFA 4YXDB 1J8CA 2N9KA 4BKSA 2LUEA 2Q5WD 3DVGY 2JRHA 4P1CC 1WGYA 2FUHB 3U7DA 1OFFA 2AEHA 4WQOB 1NENB 2FE8A 3P4RB 1HQRD 2NVUI 3KUDB 2JRIB 1C3TA 4B95A 1L4DB 1F1HA 1QOFA 4EZJA 4WJQA 1V80A 4KZCA 4LJPB 4JGHB 3N1ZC 4BKTA 2B76B 2BS2B 2GBKA 5DPWA 2O6VA 2QILA 4GSWA 5IO9A 1PUTA 3APDA 4MGZE 4TUUA 2GRIA 2K1FA 1ET9A 3KH0A 1IUEA 3N32A 4FHJA 1T0YA 4YL8A 1DGJA 4MM3B 3AEGB 2KACA 4KGRA 2N7EA 2BS3B 4XDDA 2KJ6A 4IG7B 1PFDA 3DHHC 3R66C 2YEPB 2JU6X 2LRWA 1P98A 2L0TA 3ETRA 1JW9D 1WYWB 2IY0B 5EE0A 4FULA 2G3QB 1SSNA 3ZNZB 1WGHA 1WRIA 3QC8B 2VZKD 4NAWA 2K6QA 4C00A 4II2B 4GMVA 4W9GA 2RDGA 2KFJA 3RNEC 3V6EB 2AX5A 2C5LC 4HDQA 2M17A 1HEZE 1GAQB 3AE3B 3HIZA 2J4XA 5D3IB 3AE4B 5H92C 3Q8BA 4ANXA 2ZEQA 5FR6A 4YTPB 4RMAA 3PLVA 3OG5A 3CWIA 1AYFA 2FIDA 1FXTB 2I38A 1QQRA 3VDZA 3EC8A 4FXCA 1N6ZA 4KGTA 1KH0A 1N63A 3TJPA 2V1YA 3Q2AC 1NEKB 3BIID 2LMCA 1WXQA 2NCNA 4MEMA 1WGGA 4P16A 4RM9A 3ZTCA 3DHGC 3QJZA 1TGZB 1K50A 2I1JA 2ASQA 3KWVA 1GUAB 2VH2A 1UWMA 1D5MC 2LGYA 3MJWA 1TKGA 2J52A 1E9MA 2HTHA 4A90A 2O6VB 2PJHA 4RGTA 2ZZPB 1KRHA 1GC7A 3R2TA 3TIXA 3X0WA 4GLSC 3DCGA 1WY8A 4MSMB 4RF1A 1OGWA 4WURA 4RF0A 4RGNA 1WGDA 2Z0EB 2FBWB 1LQBA 1RFKA 3H6NA 2KKCA 2M1MA 2X38A 2KD0A 2MW5A 1T6BX 1SXTA 1M94A 3GB1A 4KKIA 1D3ZA 3SDLC 2K25A 2WDRB 3MFGA 2BQQA 2LASA 4HJKA 1WJUA 4DXFA 4IWQA 3EHVA 1TIFA 2GBRA 2PEAA 1V1PA 2JWUA 3BVGA 3ZDMC 4MDKE 2ZPNA 4WJPA 1R7SA 1YOVB 3KVFB 2B3AA 3MP9A 2WXJA 4B0EA 3GP7A 4WQMA 1Z5SB 4M8NA 2MA9B 3APFA 3TMPB 3Q8AA 2LZ6A 3OJ3A 2WXOA 1TKEA 4IC7B 2NBVB 3RNAC 1XXGA 4TSSA 4KGSA 4HPPA 1UBIA 3ZDTA 4PS3A 2J0KA 2CS4A 4ZRQA 3NG0A 4TQ1A 1T0QC 2A5UA 1V5OA 1SIFA 2C60A 1WR1A 4BKGA 4HDOA 1S3SG 2KOXA 4KIKA 2QHOA 1YN5A 4ITKA 3PHWB 3MC9A 1YMHE 2IGGA 3D32A 4K81A 1HTOA 4YSXB 1D5ZC 1Q5WB 1AN8A 2V0GA 1DOYA 1YJIA 3NOBA 4KVGB 2CJNA 3ML9A 2O2VB 4ICVA 3NS8A 1P1AA 2J7QB 2OEDA 2O6VD 2KVZA 4LJOB 1RFAA 3CMMB 3GZNB 4RGOS 4FHKA 1WR6E 2DZIA 2INPE 3AI5A 3GE8C 5BYSA 3ZXVA 3AE6B 2KWUB 1N61A 2KT7A 2KX3A 4W9IA 3ZIMA 3E56A 4E71A 2R61A 2PVOD 4ANWA 1WE7A 3B08A 4YSZB 1T5XD 4DDGD 4E3CA 2XN9C 3RZWC 5AEKB 2NMQA 4OZBA 1V1PB 4G0NB 4C7ZA 2M19A 3L13A 1WXMA 1N60A 4DDID 2QSDA 3PRMB 1KFYB 4TV3A 3DBRI 2LWPA 1EM7A 4LNNA 4OHJA 3VUYA 3RNFC 4RGMA 5BYRA 5J17A 3R8BA 2MBEA 4XC2A 2KDFB 1RWSA 3AN1A 3I3TB 4MH8A 1HTQA 1NI2A 5IP4D 2ZJDA 3W2DA 3UINB 5HI1A 2LI5A 3BK1A 3CIRB 4DHZB 3LJ3A 2JXXA 1P3QU 1Q1OA 4FADA 2IO0B 3DVGX 4HLEA 3RUIB 4KSKC 1B1ZA 2J53A 4BVUC 4EZLA 1V6EA 2LHDA 4KIKB 2KWVB 4JL9A 1GPXA 4EUTA 3I63C 1KLVA 1G6JA 2L8JA 3BVZA 1MHXA 2WXFA 2KQ4X 4CQNA 4D2KA 4IW0A 4ANVA 5I4DA 4C4VB 4N58A 4OZCA 5G5HA 1MPEA 1WGKA 2FIFA 1UD7A 3UIPB 3Q3FA 3JVZX 4RM8A 1UZXB 3BYYB 4EEWA 3UQBA 5EE9A 4PYUA 4LNIA 3FILA 3ZO5B 1YQ3B 4AQ7A 2W54A 2N4FA 5CHFA 3ZGZA 1TYGB 1V86A 4NJ7A 2W9NA 1VRAB 1E7UA 2WX1A 4M00A 3GOEA 1XLOA 3QHTA 2BKRB 5IKCM 4HPLB 2OHFA 4O1NA 1XEEA 4K7WA 1I4PA 4N6EB 5AUKA 5BMGA 3RD2A 3DWGC 4N59A 5JZEB 2LGDA 1WMHA 2Z59B 1FRRA 3MC0B 2BBCA 2WXRA 4AJYB 2CU3A 1JQ4A 1ZE3D 1YD8U 3V62A 1EWYC 2VH1A 4PS7A 2LJIA 3WCQA 2KX0A 2PW9A 3IVFA 2WXKA 2N1WA 1HA5A 1SBBB 2K8HA 5EE3A 4WIPA 4A55A 3WA0A 2K5PA 3LB8C 2NPTA 3JYUA 1V8CA 1QKZA 3UIOB 3RN9C 2ZW0A 2CHXA 4HRSA 2KO3A 5G55A 1ZKHA 5HG2A 1UH6A 4UDUC 3DBLB 1TZOA 5IAAC 1AW7A 3UQAA 4DHJB 2D10A 3K9PB 4A3OA 4DHZE 1EF1A 2JF5A 2WXGA 1E8WA 2MRPA 3UI3A 1YQBA 4ZRIA 1WJ4A 1YN4A 4Q2JA 2G4DB 1WX9A 4ZHOA 1TBEA 3RNGC 3DBHI 2LGIA 3CSFA 4EFOA 3EA6A 5D94A 5LXHA 4GDKA 4JWSC 2K9XA 3FILB 1E10A 2JX5A 3CF6E 1X1MA 4L1BA 1V1OA 3B9JA 3HM6X 4B0MA 3B2GA 5IN7A 3ALBA 4XZ4A 1WRDB 1WXVA 3A9JA 4WWNA 4XYCA 1FNUA 4NQKE 1C4AA 2BWES 3QIJA 5AZGA 1YNTE 1JMLA 5E6NA 1WMHB 3U4EG 3V6CB 4IKGA 3AE7B 3VFKA 3NVYA 1VCBA 2KDMA 2N9EB 1UELA 4MSQB 1ISNA 4HKQA 2DLBA 5D7GA 3AE1B 3VVWB 1C79A 4NPNA 2C9WB 4K7UA 3A1QA 1FFVA 1WM3A 2JZPA 3IT4B 4ZYSA 1VR9A 1OQQA 3EECA 3AH7A 2NPTB 3L08A 3Q3NC 2WU5B 3U30A 2IYDB 3FKYA 3VTUA 1LGRA 1J7AA 3PZ7A 2UYZB 1SEBD 4NAMA 2AQ1B 1RAXA 1I35A 3AXCA 2G9HD 3QCAA 2PLPA 1OEYA 1HZ6A 2K6DB 5BO4B 3L16A 3N3KB 2J42A 4GIVA 4XWTA 1XO3A 4OW0A 4GDKB 2RPVA 2V4LA 3TCAA 1QOAA 4BOSC 3M63B 1CZPA 1WWTA 1I4RA 2R2OA 2K39A 1RYJA 2Y5CA 2KLCA 4M8MA 3SD5A 2XNAC 4A6QA 1WX8A 3A9JB 4RNAA 3H7SA 3PHXB 1E5WA 2Z8LA 2KDIA 3C8YA 3PRZA 3ZYYX 1QOGA 2ZCBA 3O65B 2W55A 1MG8A 2KDBA 3OJ4B 4IM0A 1MVKA 4FLHA 3LDZE 1ZDXA 2BYVE 3TBLD 4WH4A 4RFBA 1P9DU 3AULA 2IZVB 4FA6A 2V4IB 1GC6A 2GMIC 1N5XA 1BUIC 4GXBA 5IA7A 1OQYA 3P4QB 4W9HA 3IT6B 1C4CA 2N9XA 1WJNA 3PGEA 2MJ3A 5KHOA 1STEA 2LVPA 3PV1A 4W9CA 5EE1A 3RFZB 2IBIB 2FCNA 2WNMA 2ZNVB 5T8IA 3A4RA 2NBWB 1YX5B 2DENB 4M0WA 2M8SA 4KDLB 3E9SA 3HK0A 4GOCA 3HHMA 4BAXA 2BYTA 2ICIA 1N62A 2L7RA 1IPGA 2WDQB 5D6JB 4IWPA 1VDVA 4PS8A 5C3JB 2MSED 3U7ZA 2NTTA 3BYTB 1NBFC 4NAWB 4WJOA 1T0RC 4ARCA 2NR2A 2BB6A 3MHZA 2L32A 1XCTL 3N30A 1K53A 1TJEA 3VH4B 2KTRA 1Z2MA 4HEA1 1FO4A 3Q3OC 2JSVX 4G3XB 2WXNA 3NUHB 1GJZA 2J0MA 3HVZA 3DVNV 1HXYD 3AE2B 4M02A 3AE5B 1ZDVA 1V9JA 2MX2A 4F7ZA 4H2AA 2D11A 1XD3B 2BGFA 2CHWA 4TKNA 4C56C 2Y3AA 1ESFA 2N0SB 2TSSA 3TL5A 1FIQA 1C9FA 2AL3A 4JQWC 4LTUA 2WX0A 1XCQL 2REXA 1WXAA 2HTME 2KN4A 3NVZA 1E7PB 4WWOA 1ROEA 3OWEB 4BKSD 2CU1A 3TEZA 3ZNGC 4IM2A 4LNFA 1EUVB 4PT5A 2XEWA 1YN3A 3RNBC 1NYRA 3BZDB 1KF6B 3ZTDA 3BK2A 2EKIA 2KWCA 1WE6A 1QZEA 2IJ0A 4LDTB 2WS3B 4FJYA 3ZJVA 2NS5A 2QCZA 4YT0B 2MBHA 1LO5D 4WWPA 3LXFA 1QF6A 3VHTC 5TR5A 4M0WB 1TT5B 2W3RA 1L0VB 1PGXA 2MJDA 1YJJA 2BPSA 3HM3A 2OJWA 5HHDG 3UGBB 3J9CA 2Z0DB 2JVCA 1XLNA 1YQ4B 3A9KA 1J7BA 1WX7A 2ACZB 2INNE 2PVGC 3O13A 4MGKE 2IDYA 1P7FA 4XE0A 2DAJA 2QJLA 1CQVA 3SFEB 1XQQA 1TS2A 2KTRB 3AE9B 3DOWA 2Y5BB 1MI0A 2HJ1A 1HE8A 1VD2A 3NZUA 2KJRA 4IUMB 4W9LA 4A9AA 3QA8A 4XGAB 2FCMA 2D3AA 1GB1A 3TSSA 3VUWA 4AS1A 2KDEB 1IGDA 4YTMB 3VH3B 1EF5A 3VQIA 2M0AA 3URYA 3VTVA 2YVCA 1WM2A 1ZP0B 1ZXHA 1C1YB 1I4HA 4MJSA 3V3XA 4HCPB 2QDFA 3ENEA 2KNBA 1J19A 2BB5A 2BF8B 2M0XA 3BY4B 3VR9B 4K7SA 4LCDE 3C19A 1TKYA 3PZDA 3DBSA 4A3PA 2MH7A 3KUZA 2V9HA
chains in the Genus database with same CATH topology
3QC8B 1WX9A 4NAWA 3W1SA 2AWTA 2K6QA 4II2B 4GGQA 1OTRB 1TBEA 2K8BA 3DBHI 4URKA 2DYOA 3A4SC 4GMVA 3X23A 3CSFA 4W9GA 2C7MB 2KFJA 3V6EB 2KK8A 2JWZA 3SHQA 4EFOA 2C5LC 2RR9A 4HDQA 2M17A 5D94A 5LXHA 3HIZA 4GDKA 4K1RB 4ANXA 2ZEQA 5FR6A 3CF6E 3WANA 4RMAA 1WF9A 3PLVA 5E6PA 1EO6A 4W9DA 3DDCB 1WZ3A 1X1MA 4LDTD 4ZYNA 2DX5B 5J2RA 2FIDA 3PS6A 1FXTB 3VDZA 3A9KB 3HM6X 3QARA 1TZ1A 4GDLA 3EC8A 3U8ZA 1V2YA 3UF8A 3ALBA 4XZ4A 1LXDA 2I1KA 1WRDB 1WXVA 3TJPA 5AZHA 2LGXA 2V1YA 3A9JA 3DVNU 4WWNA 3QQ8B 3QX1A 4NQKE 3ZNID 2BWES 5KHQA 3QIJA 2PE9A 2NCNA 5AZGA 4MEMA 1WGGA 5E6NA 1WMHB 3ML8A 4RM9A 3V6CB 3ZTCA 1H8CA 3VFKA 4MGIE 2XK5A 2LJ5A 3RULA 2MWSB 3QJZA 1TGZB 1VCBA 2N9EB 2C7HA 1UELA 1V81A 2BKFA 4MSQB 2WYQA 2I1JA 4W9JA 2KFKA 1ISNA 1SGHA 4W9KA 4WJNA 3V60A 2ASQA 1GUAB 2FCQA 3MJWA 2LGYA 2ZNVC 2JY6A 5D7GA 2BYEA 3VVWB 2LD9A 4BFRA 4NPNA 2HTHA 2PPHA 2C9WB 2O6VB 4K7UA 2M4NA 2PJHA 3KW5B 3A1QA 4GB9A 2KVRA 1WM3A 1PQSA 4ZRKA 2ZZPB 2MBBB 1GC7A 2AYOB 5HKHA 1WH3A 3TIXA 4HXDA 2N9PC 2BYFA 3X0WA 3DCGA 3EECA 1WY8A 2NPTB 4MSMB 1OGWA 3L08A 3L54A 2EKEC 1LFDA 3BINA 3Q3JA 1KM7A 3U30A 1WGDA 1IP9A 2IYDB 2Z0EB 2V3SA 1LQBA 3VTUA 5DCNA 4MH0E 3L10B 3H6NA 1V5TA 3H9DA 2KKCA 4EZKA 2UYZB 4ZDVA 3IHPC 2M1MA 4OVVA 4MJSB 2MP2B 2K8CA 1P0RA 2KD0A 2MW5A 5CHWA 4CHKA 5CTRC 1RAXA 2N7DA 1I35A 2FNJB 3AXCA 3KYDD 4PYZA 3ZUNA 3QCAA 2L05A 2ZCCA 3T8MA 4ASWC 1M94A 5LXIB 4GU2A 4AP4C 2MBOA 4N9F4 1OEYA 2K6DB 1D3ZA 3SDLC 2K25A 5DPTA 5BO4B 5J18A 1UGMA 3L16A 3CSTA 5CHVC 4G11A 2LASA 3N3KB 2KQ7A 4HJKA 1WJUA 2IO3B 4XX5A 4GIVA 4IWQA 3EHVA 3PREA 2RGFA 3ZNHB 5C23A 2KZRA 4IWOA 2GBRA 2PEAA 4GDKB 2DHZA 3L0WB 2OOBB 2ZVOA 2V4LA 5D2MB 3TCAA 2KJHB 2ZPNA 4I6LB 4MDKE 4WJPA 3ZDMC 3KVFB 2B3AA 4BOSC 2KXJA 3M63B 4HCNB 2FCSA 1E8ZA 2L3ZA 1Z5SB 1R4NI 3R7RA 4M8NA 2LVQA 1I42A 2DZKA 2MA9B 3APFA 4OVUA 3TMPB 2L0FA 4GDLB 2R2OA 3PRPB 2LZ6A 2K39A 3OJ3A 2KLCA 4IC7B 4M8MA 2MCNB 2NBVB 3SD5A 3H1UA 2WWZA 4FJVB 1WX8A 3QAQA 3A9JB 3JSVA 2MLBA 3H7SA 2DZJA 3K9OB 2ZPYA 3PHXB 2KMCA 1E5WA 1UBIA 2KDIA 1IYFA 2XBBC 2HE7A 3PRZA 2ZCBA 2GBMA 3O65B 3P2BA 2KC1A 4MM3A 2XK5B 1MG8A 4PS3A 2KDBA 3OJ4B 3W1YA 2ZVNA 3ZDTA 2L76A 2J0KA 4IM0A 4FLHA 1KJTA 2CS4A 2KFKB 3LDZE 5GMVA 2HD5B 1WXSA 2GBJA 3AU5A 3DQVA 4MGYE 4TQ1A 2BYVE 3TBLD 3ZRCA 2A5UA 1V5OA 4EKUA 1SIFA 1P9DU 2C60A 1Q0WB 1WR1A 2IO2B 4BKGA 2GBNA 4HDOA 5JHBA 5DPSA 3AULA 2IZVB 4FA6A 1S3SG 2FAZA 3ZVVA 2KOXA 4KIKA 3S2AA 2QHOA 3PHWB 1GC6A 4DXAB 3D32A 3L17A 1S1QB 2GMIC 3GZNI 2LXAA 2CKHB 4K81A 1L7YA 4IM3A 4GXBA 1Q5WB 5IA7A 2JZ3B 3R7QA 1OQYA 2KLGA 3RCZA 4W9HA 3M3JA 1WZ0A 4BOZB 3NOBA 4KVGB 2GOWA 3WALA 5DPRA 3ML9A 2O2VB 2N9XA 2DZMA 4ICVA 1WJNA 3NS8A 4FN2A 3ZKJC 1P1AA 2J7QB 3OLMD 3PGEA 4JLCA 2O6VD 3IG3A 4LJOB 1RFAA 5KHOA 2EMSA 3CMMB 5L83A 1Y8RC 2LVPA 2VRRB 3PV1A 4W9CA 4DBGA 4FHKA 1WR6E 2DZIA 3AU4A 3AI5A 4II3B 5JHAA 2IBIB 2MBQA 2KWUB 4B9KA 2FCNA 2LRUA 2ZNVB 2DAFA 2KX3A 3R3MA 4KSLC 4W9IA 1AARA 2NBUA 3ZIMA 1XT9B 2MQJA 2KANA 2KTFA 3B1LX 4X57B 1A5RA 2JT4B 3A4RA 2NBWB 3H7PA 5JH5C 1YX5B 2EMTA 2IO1B 1YJ1A 1TTNA 2DENB 3VTWA 4E71A 4NJ6A 4AJWA 1LM8B 1ZW7A 2CHZA 2DYMA 2M8SA 4I6PA 4KDLB 3HK0A 3KUCB 4GOCA 3RYTA 4ANWA 1K8RB 1WE7A 1YX6B 3PLUA 3HHMA 3PTFC 1RLFA 3B08A 4DDGD 3VUXA 4E3CA 3WAPA 3PSEB 3RZWC 5AEKB 2L7RA 4F8CB 1IPGA 3SU8X 4G0NB 5D6JB 3MTNB 3L13A 1WXMA 3JW0X 4AUQC 4DDID 4TV3A 3PRMB 3NZSA 4F1SA 4IWPA 3DBRI 4PS8A 2MSED 3NY5A 2LWPA 1NBFC 4NAWB 3VUYA 3A33B 4WJOA 1JRUA 2RPQA 2NR2A 2UWQA 5J17A 4CYEA 2MBEA 3DPDA 3PPAA 1E8XA 1U4AA 2RSUA 2KDFB 2RD0A 4XC2A 5CX3A 2OJRA 2AL6A 3ZLZA 3I3TB 4AWJA 4DHJD 3JSVB 3VAWA 3N30A 1NI2A 2ZJDA 3VH4B 2KTRA 1YIWA 1Z2MA 2WDTB 1GG3A 3V61A 1RRBA 1KOTA 4G50A 4G3XB 3IFWB 3UINB 1GJZA 1WFYA 2J0MA 3DVNV 1F9JA 2LI5A 4DHZB 3LJ3A 2JXXA 3PVLA 4BBNF 1P3QU 1Q1OA 4KDIC 2IO0B 3DVGX 4FADA 1V9JA 4MELA 2MX2A 3WAMA 4HLEA 2YLMA 3RUIB 4F7ZA 4NY0A 2D11A 4KSKC 1XD3B 4BVUC 2BGFA 2CHWA 2KN5A 4TKNA 4EZLA 4W9EA 2BWFA 1V6EA 5G2NA 4KIKB 3TL5A 4CO7A 2AL3A 1WGRA 2KWVB 4JL9A 4JQWC 4DK5A 4EUTA 2WX0A 2REXA 3ONSA 1E7VA 1KLVA 1WXAA 1G6JA 2L8JA 2A4ZA 2J0JA 4WAAA 4NQLB 1UBQA 4WWOA 4BKSD 2CU1A 2HJ8A 4IW0A 3ZNGC 4J6IA 4IM2A 4ICUA 4ANVA 2IY1B 3WAOA 1EUVB 2G4SA 2XEWA 2JPHA 4JIOU 1WJ6A 3ZTDA 2KHWB 1H4RA 3M62B 3A1QB 2KWCA 1WE6A 1QZEA 4P7IA 3M95A 4BBNC 2KC2A 4LDTB 4W9FA 4TQ0A 4FJYA 1ZGUB 1R4MI 3MHSD 1OEYJ 2D2QA 2L00B 2NS5A 2FIFA 3ECIA 2D07B 1UD7A 5L95C 4ANUA 2MBHA 1J0GA 3KYCD 3UIPB 2LVOA 4WWPA 2C7NB 2KMAA 4A20A 2JZZA 2G45B 3JVZX 3Q3FA 4RM8A 5AZFA 1V49A 1UZXB 3QWZB 2PE6B 3QK0A 5TR5A 3VHTC 3H7PB 4EEWA 4M0WB 3UQBA 3VXWA 3B0AA 4PYUA 1L2NA 3ZO5B 2BPSA 3HM3A 4KV2A 4ZRJA 1CMXB 2N4FA 3UGBB 4DWFA 3T9LA 5CHFA 3WIMA 4HPMB 2N1VA 1SE9A 1V86A 1GNUA 4FJZA 4NJ7A 2Z0DB 2W9NA 4AOFA 2JVCA 1J8CA 1NDDA 4BKSA 2LUEA 3A9KA 3C0RB 4NNJB 1E7UA 2WX1A 3GOEA 3DVGY 3QHTA 1WX7A 2BKRB 2JRHA 1WGYA 4HPLB 2FUHB 4MGKE 3U7DA 4K7WA 4B6WA 5EDSA 3RD2A 2AEHA 1BT0A 2CR5A 4WQOB 5JZEB 2DAJA 5LLIA 2LGDA 3RT3B 1WMHA 5E6OA 2KQSA 2Z59B 2NVUI 4E74A 3KUDB 1WI0A 2JRIB 1XQQA 1C3TA 2KTRB 4B95A 2D3GA 1E90A 4EZJA 4WJQA 4AJYB 3DOWA 3PT2B 1V80A 1YD8U 3V62A 4KZCA 3NHEB 2Y5BB 2JUOA 4HK2A 4JGHB 3OAWA 4LJPB 1HE8A 4EOYA 1VD2A 3NZUA 2KJRA 4PS7A 5C1ZA 4BKTA 2O2VA 4IUMB 2GBKA 2KX0A 4W9LA 3IVFA 5DPWA 2O6VA 4GSWA 2N1WA 4HWIB 4KZ0A 3ZRFA 3W1SC 3QA8A 3ZW3A 2K8HA 3IBEA 2FCMA 3EFUA 3APDA 3DBLI 4MGZE 4TUUA 4FBJB 3WA0A 2NPTA 3JYUA 4HVBA 2K1FA 3KH0A 3VUWA 3N32A 2KDEB 4FHJA 3UIOB 3VH3B 1T0YA 4YL8A 2CHXA 1EF5A 3VQIA 3VTVA 2YVCA 2KO3A 5G55A 1WM2A 1ZKHA 2N7EA 1UH6A 3RZFA 5IAAC 1C1YB 2KJ6A 4IG7B 3UQAA 4GN1A 4MJSA 2MP2A 4DHJB 4HCPB 2D10A 3K9PB 4A3OA 3R66C 1EF1A 3ENEA 2JF5A 4DHZE 2KNBA 1J19A 1E8WA 2BF8B 2M0XA 2MRPA 3BY4B 2LRWA 1YQBA 3APCA 1P98A 2L0TA 4I6NB 2R2QA 4K7SA 4LCDE 1WYWB 2IY0B 3PZDA 4ZRIA 4FULA 1E8YA 1WJ4A 3DBSA 4A3PA 2G3QB 2LXCA 3ZNZB 1WIAA 1WGHA 2DYBA 3KUZA 2G4DB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3QC8 B;  1WX9 A;  4NAW A;  3W1S A;  2AWT A;  2K6Q A;  4II2 B;  4GGQ A;  1OTR B;  1TBE A;  2K8B A;  3DBH I;  4URK A;  2DYO A;  3A4S C;  4GMV A;  3X23 A;  3CSF A;  4W9G A;  2C7M B;  2KFJ A;  3V6E B;  2KK8 A;  2JWZ A;  3SHQ A;  4EFO A;  2C5L C;  2RR9 A;  4HDQ A;  2M17 A;  5D94 A;  5LXH A;  3HIZ A;  4GDK A;  4K1R B;  4ANX A;  2ZEQ A;  5FR6 A;  3CF6 E;  3WAN A;  4RMA A;  1WF9 A;  3PLV A;  5E6P A;  1EO6 A;  4W9D A;  3DDC B;  1WZ3 A;  1X1M A;  4LDT D;  4ZYN A;  2DX5 B;  5J2R A;  2FID A;  3PS6 A;  1FXT B;  3VDZ A;  3A9K B;  3HM6 X;  3QAR A;  1TZ1 A;  4GDL A;  3EC8 A;  3U8Z A;  1V2Y A;  3UF8 A;  3ALB A;  4XZ4 A;  1LXD A;  2I1K A;  1WRD B;  1WXV A;  3TJP A;  5AZH A;  2LGX A;  2V1Y A;  3A9J A;  3DVN U;  4WWN A;  3QQ8 B;  3QX1 A;  4NQK E;  3ZNI D;  2BWE S;  5KHQ A;  3QIJ A;  2PE9 A;  2NCN A;  5AZG A;  4MEM A;  1WGG A;  5E6N A;  1WMH B;  3ML8 A;  4RM9 A;  3V6C B;  3ZTC A;  1H8C A;  3VFK A;  4MGI E;  2XK5 A;  2LJ5 A;  3RUL A;  2MWS B;  3QJZ A;  1TGZ B;  1VCB A;  2N9E B;  2C7H A;  1UEL A;  1V81 A;  2BKF A;  4MSQ B;  2WYQ A;  2I1J A;  4W9J A;  2KFK A;  1ISN A;  1SGH A;  4W9K A;  4WJN A;  3V60 A;  2ASQ A;  1GUA B;  2FCQ A;  3MJW A;  2LGY A;  2ZNV C;  2JY6 A;  5D7G A;  2BYE A;  3VVW B;  2LD9 A;  4BFR A;  4NPN A;  2HTH A;  2PPH A;  2C9W B;  2O6V B;  4K7U A;  2M4N A;  2PJH A;  3KW5 B;  3A1Q A;  4GB9 A;  2KVR A;  1WM3 A;  1PQS A;  4ZRK A;  2ZZP B;  2MBB B;  1GC7 A;  2AYO B;  5HKH A;  1WH3 A;  3TIX A;  4HXD A;  2N9P C;  2BYF A;  3X0W A;  3DCG A;  3EEC A;  1WY8 A;  2NPT B;  4MSM B;  1OGW A;  3L08 A;  3L54 A;  2EKE C;  1LFD A;  3BIN A;  3Q3J A;  1KM7 A;  3U30 A;  1WGD A;  1IP9 A;  2IYD B;  2Z0E B;  2V3S A;  1LQB A;  3VTU A;  5DCN A;  4MH0 E;  3L10 B;  3H6N A;  1V5T A;  3H9D A;  2KKC A;  4EZK A;  2UYZ B;  4ZDV A;  3IHP C;  2M1M A;  4OVV A;  4MJS B;  2MP2 B;  2K8C A;  1P0R A;  2KD0 A;  2MW5 A;  5CHW A;  4CHK A;  5CTR C;  1RAX A;  2N7D A;  1I35 A;  2FNJ B;  3AXC A;  3KYD D;  4PYZ A;  3ZUN A;  3QCA A;  2L05 A;  2ZCC A;  3T8M A;  4ASW C;  1M94 A;  5LXI B;  4GU2 A;  4AP4 C;  2MBO A;  4N9F 4;  1OEY A;  2K6D B;  1D3Z A;  3SDL C;  2K25 A;  5DPT A;  5BO4 B;  5J18 A;  1UGM A;  3L16 A;  3CST A;  5CHV C;  4G11 A;  2LAS A;  3N3K B;  2KQ7 A;  4HJK A;  1WJU A;  2IO3 B;  4XX5 A;  4GIV A;  4IWQ A;  3EHV A;  3PRE A;  2RGF A;  3ZNH B;  5C23 A;  2KZR A;  4IWO A;  2GBR A;  2PEA A;  4GDK B;  2DHZ A;  3L0W B;  2OOB B;  2ZVO A;  2V4L A;  5D2M B;  3TCA A;  2KJH B;  2ZPN A;  4I6L B;  4MDK E;  4WJP A;  3ZDM C;  3KVF B;  2B3A A;  4BOS C;  2KXJ A;  3M63 B;  4HCN B;  2FCS A;  1E8Z A;  2L3Z A;  1Z5S B;  1R4N I;  3R7R A;  4M8N A;  2LVQ A;  1I42 A;  2DZK A;  2MA9 B;  3APF A;  4OVU A;  3TMP B;  2L0F A;  4GDL B;  2R2O A;  3PRP B;  2LZ6 A;  2K39 A;  3OJ3 A;  2KLC A;  4IC7 B;  4M8M A;  2MCN B;  2NBV B;  3SD5 A;  3H1U A;  2WWZ A;  4FJV B;  1WX8 A;  3QAQ A;  3A9J B;  3JSV A;  2MLB A;  3H7S A;  2DZJ A;  3K9O B;  2ZPY A;  3PHX B;  2KMC A;  1E5W A;  1UBI A;  2KDI A;  1IYF A;  2XBB C;  2HE7 A;  3PRZ A;  2ZCB A;  2GBM A;  3O65 B;  3P2B A;  2KC1 A;  4MM3 A;  2XK5 B;  1MG8 A;  4PS3 A;  2KDB A;  3OJ4 B;  3W1Y A;  2ZVN A;  3ZDT A;  2L76 A;  2J0K A;  4IM0 A;  4FLH A;  1KJT A;  2CS4 A;  2KFK B;  3LDZ E;  5GMV A;  2HD5 B;  1WXS A;  2GBJ A;  3AU5 A;  3DQV A;  4MGY E;  4TQ1 A;  2BYV E;  3TBL D;  3ZRC A;  2A5U A;  1V5O A;  4EKU A;  1SIF A;  1P9D U;  2C60 A;  1Q0W B;  1WR1 A;  2IO2 B;  4BKG A;  2GBN A;  4HDO A;  5JHB A;  5DPS A;  3AUL A;  2IZV B;  4FA6 A;  1S3S G;  2FAZ A;  3ZVV A;  2KOX A;  4KIK A;  3S2A A;  2QHO A;  3PHW B;  1GC6 A;  4DXA B;  3D32 A;  3L17 A;  1S1Q B;  2GMI C;  3GZN I;  2LXA A;  2CKH B;  4K81 A;  1L7Y A;  4IM3 A;  4GXB A;  1Q5W B;  5IA7 A;  2JZ3 B;  3R7Q A;  1OQY A;  2KLG A;  3RCZ A;  4W9H A;  3M3J A;  1WZ0 A;  4BOZ B;  3NOB A;  4KVG B;  2GOW A;  3WAL A;  5DPR A;  3ML9 A;  2O2V B;  2N9X A;  2DZM A;  4ICV A;  1WJN A;  3NS8 A;  4FN2 A;  3ZKJ C;  1P1A A;  2J7Q B;  3OLM D;  3PGE A;  4JLC A;  2O6V D;  3IG3 A;  4LJO B;  1RFA A;  5KHO A;  2EMS A;  3CMM B;  5L83 A;  1Y8R C;  2LVP A;  2VRR B;  3PV1 A;  4W9C A;  4DBG A;  4FHK A;  1WR6 E;  2DZI A;  3AU4 A;  3AI5 A;  4II3 B;  5JHA A;  2IBI B;  2MBQ A;  2KWU B;  4B9K A;  2FCN A;  2LRU A;  2ZNV B;  2DAF A;  2KX3 A;  3R3M A;  4KSL C;  4W9I A;  1AAR A;  2NBU A;  3ZIM A;  1XT9 B;  2MQJ A;  2KAN A;  2KTF A;  3B1L X;  4X57 B;  1A5R A;  2JT4 B;  3A4R A;  2NBW B;  3H7P A;  5JH5 C;  1YX5 B;  2EMT A;  2IO1 B;  1YJ1 A;  1TTN A;  2DEN B;  3VTW A;  4E71 A;  4NJ6 A;  4AJW A;  1LM8 B;  1ZW7 A;  2CHZ A;  2DYM A;  2M8S A;  4I6P A;  4KDL B;  3HK0 A;  3KUC B;  4GOC A;  3RYT A;  4ANW A;  1K8R B;  1WE7 A;  1YX6 B;  3PLU A;  3HHM A;  3PTF C;  1RLF A;  3B08 A;  4DDG D;  3VUX A;  4E3C A;  3WAP A;  3PSE B;  3RZW C;  5AEK B;  2L7R A;  4F8C B;  1IPG A;  3SU8 X;  4G0N B;  5D6J B;  3MTN B;  3L13 A;  1WXM A;  3JW0 X;  4AUQ C;  4DDI D;  4TV3 A;  3PRM B;  3NZS A;  4F1S A;  4IWP A;  3DBR I;  4PS8 A;  2MSE D;  3NY5 A;  2LWP A;  1NBF C;  4NAW B;  3VUY A;  3A33 B;  4WJO A;  1JRU A;  2RPQ A;  2NR2 A;  2UWQ A;  5J17 A;  4CYE A;  2MBE A;  3DPD A;  3PPA A;  1E8X A;  1U4A A;  2RSU A;  2KDF B;  2RD0 A;  4XC2 A;  5CX3 A;  2OJR A;  2AL6 A;  3ZLZ A;  3I3T B;  4AWJ A;  4DHJ D;  3JSV B;  3VAW A;  3N30 A;  1NI2 A;  2ZJD A;  3VH4 B;  2KTR A;  1YIW A;  1Z2M A;  2WDT B;  1GG3 A;  3V61 A;  1RRB A;  1KOT A;  4G50 A;  4G3X B;  3IFW B;  3UIN B;  1GJZ A;  1WFY A;  2J0M A;  3DVN V;  1F9J A;  2LI5 A;  4DHZ B;  3LJ3 A;  2JXX A;  3PVL A;  4BBN F;  1P3Q U;  1Q1O A;  4KDI C;  2IO0 B;  3DVG X;  4FAD A;  1V9J A;  4MEL A;  2MX2 A;  3WAM A;  4HLE A;  2YLM A;  3RUI B;  4F7Z A;  4NY0 A;  2D11 A;  4KSK C;  1XD3 B;  4BVU C;  2BGF A;  2CHW A;  2KN5 A;  4TKN A;  4EZL A;  4W9E A;  2BWF A;  1V6E A;  5G2N A;  4KIK B;  3TL5 A;  4CO7 A;  2AL3 A;  1WGR A;  2KWV B;  4JL9 A;  4JQW C;  4DK5 A;  4EUT A;  2WX0 A;  2REX A;  3ONS A;  1E7V A;  1KLV A;  1WXA A;  1G6J A;  2L8J A;  2A4Z A;  2J0J A;  4WAA A;  4NQL B;  1UBQ A;  4WWO A;  4BKS D;  2CU1 A;  2HJ8 A;  4IW0 A;  3ZNG C;  4J6I A;  4IM2 A;  4ICU A;  4ANV A;  2IY1 B;  3WAO A;  1EUV B;  2G4S A;  2XEW A;  2JPH A;  4JIO U;  1WJ6 A;  3ZTD A;  2KHW B;  1H4R A;  3M62 B;  3A1Q B;  2KWC A;  1WE6 A;  1QZE A;  4P7I A;  3M95 A;  4BBN C;  2KC2 A;  4LDT B;  4W9F A;  4TQ0 A;  4FJY A;  1ZGU B;  1R4M I;  3MHS D;  1OEY J;  2D2Q A;  2L00 B;  2NS5 A;  2FIF A;  3ECI A;  2D07 B;  1UD7 A;  5L95 C;  4ANU A;  2MBH A;  1J0G A;  3KYC D;  3UIP B;  2LVO A;  4WWP A;  2C7N B;  2KMA A;  4A20 A;  2JZZ A;  2G45 B;  3JVZ X;  3Q3F A;  4RM8 A;  5AZF A;  1V49 A;  1UZX B;  3QWZ B;  2PE6 B;  3QK0 A;  5TR5 A;  3VHT C;  3H7P B;  4EEW A;  4M0W B;  3UQB A;  3VXW A;  3B0A A;  4PYU A;  1L2N A;  3ZO5 B;  2BPS A;  3HM3 A;  4KV2 A;  4ZRJ A;  1CMX B;  2N4F A;  3UGB B;  4DWF A;  3T9L A;  5CHF A;  3WIM A;  4HPM B;  2N1V A;  1SE9 A;  1V86 A;  1GNU A;  4FJZ A;  4NJ7 A;  2Z0D B;  2W9N A;  4AOF A;  2JVC A;  1J8C A;  1NDD A;  4BKS A;  2LUE A;  3A9K A;  3C0R B;  4NNJ B;  1E7U A;  2WX1 A;  3GOE A;  3DVG Y;  3QHT A;  1WX7 A;  2BKR B;  2JRH A;  1WGY A;  4HPL B;  2FUH B;  4MGK E;  3U7D A;  4K7W A;  4B6W A;  5EDS A;  3RD2 A;  2AEH A;  1BT0 A;  2CR5 A;  4WQO B;  5JZE B;  2DAJ A;  5LLI A;  2LGD A;  3RT3 B;  1WMH A;  5E6O A;  2KQS A;  2Z59 B;  2NVU I;  4E74 A;  3KUD B;  1WI0 A;  2JRI B;  1XQQ A;  1C3T A;  2KTR B;  4B95 A;  2D3G A;  1E90 A;  4EZJ A;  4WJQ A;  4AJY B;  3DOW A;  3PT2 B;  1V80 A;  1YD8 U;  3V62 A;  4KZC A;  3NHE B;  2Y5B B;  2JUO A;  4HK2 A;  4JGH B;  3OAW A;  4LJP B;  1HE8 A;  4EOY A;  1VD2 A;  3NZU A;  2KJR A;  4PS7 A;  5C1Z A;  4BKT A;  2O2V A;  4IUM B;  2GBK A;  2KX0 A;  4W9L A;  3IVF A;  5DPW A;  2O6V A;  4GSW A;  2N1W A;  4HWI B;  4KZ0 A;  3ZRF A;  3W1S C;  3QA8 A;  3ZW3 A;  2K8H A;  3IBE A;  2FCM A;  3EFU A;  3APD A;  3DBL I;  4MGZ E;  4TUU A;  4FBJ B;  3WA0 A;  2NPT A;  3JYU A;  4HVB A;  2K1F A;  3KH0 A;  3VUW A;  3N32 A;  2KDE B;  4FHJ A;  3UIO B;  3VH3 B;  1T0Y A;  4YL8 A;  2CHX A;  1EF5 A;  3VQI A;  3VTV A;  2YVC A;  2KO3 A;  5G55 A;  1WM2 A;  1ZKH A;  2N7E A;  1UH6 A;  3RZF A;  5IAA C;  1C1Y B;  2KJ6 A;  4IG7 B;  3UQA A;  4GN1 A;  4MJS A;  2MP2 A;  4DHJ B;  4HCP B;  2D10 A;  3K9P B;  4A3O A;  3R66 C;  1EF1 A;  3ENE A;  2JF5 A;  4DHZ E;  2KNB A;  1J19 A;  1E8W A;  2BF8 B;  2M0X A;  2MRP A;  3BY4 B;  2LRW A;  1YQB A;  3APC A;  1P98 A;  2L0T A;  4I6N B;  2R2Q A;  4K7S A;  4LCD E;  1WYW B;  2IY0 B;  3PZD A;  4ZRI A;  4FUL A;  1E8Y A;  1WJ4 A;  3DBS A;  4A3P A;  2G3Q B;  2LXC A;  3ZNZ B;  1WIA A;  1WGH A;  2DYB A;  3KUZ A;  2G4D B; 
#chains in the Genus database with same CATH topology
 3W1S A;  1DOI A;  4GGQ A;  4URK A;  2DYO A;  3A4S C;  3BVM A;  3U52 E;  3X23 A;  2C7M B;  2DWQ A;  2KK8 A;  2JWZ A;  2L1A A;  1OQR A;  2LHE A;  3WAN A;  5BMH A;  1WF9 A;  1EO6 A;  3N1X C;  4W9D A;  1KTK A;  3Q6B A;  1WZ3 A;  4LDT D;  4ZYN A;  3TEW A;  1L0Y B;  2DX5 B;  3I9V 1;  3PS6 A;  3A9K B;  1TZ1 A;  1SF0 A;  3ABV B;  1LXD A;  2I1K A;  2L83 A;  5AZH A;  2LGX A;  5FK9 C;  3QX1 A;  3FAH A;  3ZNI D;  5KHQ A;  1R4M B;  3Q3M C;  3ML8 A;  4MGI E;  2XK5 A;  2K0P A;  2C7H A;  1V81 A;  2BKF A;  4R3D A;  1F77 A;  2WYQ A;  4W9J A;  2KFK A;  1SGH A;  4W9K A;  2FCQ A;  4L2Y A;  2ZNV C;  2QEJ C;  3N1Y C;  1TS5 A;  4L23 A;  4BFR A;  2CJO A;  2M4N A;  3KW5 B;  2LFI A;  4ZRK A;  5HKH A;  2N9P C;  1FPY A;  3DHI C;  2PTL A;  3MC8 A;  3P4S B;  4LK0 M;  3ZQ4 A;  3BIN A;  1C77 A;  1QLB B;  3L10 B;  3H9D A;  4YWG G;  3IHP C;  4OVV A;  4MJS B;  5CHW A;  2K8C A;  1JWM D;  4CHK A;  4J3O D;  2N7D A;  2D3C A;  2EEL A;  2FNJ B;  2WHI A;  3KYD D;  4IDI A;  1E0Z A;  2ZCC A;  1EWC A;  3Q69 A;  1BML C;  2D3B A;  4ASW C;  5LXI B;  4GU2 A;  4AP4 C;  2JYT A;  4N9F 4;  2AQ2 B;  1N5W A;  1TY0 A;  3KLS X;  1NVI D;  1F2R C;  4YSY B;  2KQ7 A;  1D4B A;  4XX5 A;  4WAF A;  1ZOY B;  5TSS A;  3PRE A;  3ZNH B;  1JRP A;  5C23 A;  2KZR A;  5E6J A;  4P1B C;  2OOB B;  2KJH B;  4LNO A;  1JWA D;  1E8Z A;  3R7R A;  3Q8F A;  3AE8 B;  2IGD A;  3PRP B;  3AED B;  2MCN B;  3H1U A;  2WWZ A;  1IGC A;  3QAQ A;  3JSV A;  4A8X C;  2MLB A;  2QIE B;  3RNC C;  3W5V B;  2DZJ A;  2ZPY A;  2KMC A;  1IYF A;  1T0S C;  2KC1 A;  3P2B A;  4MM3 A;  2XK5 B;  3W1Y A;  1F0Z A;  1KJT A;  2SAK A;  3TEY A;  2KFK B;  5GMV A;  2HD5 B;  2GBJ A;  3AU5 A;  1I7H A;  4MGY E;  3V05 A;  1Q0W B;  1TS4 A;  1SIJ A;  4ACF A;  5DPS A;  1ET6 A;  3ZVV A;  3S2A A;  4JPS A;  4REZ A;  1FNV A;  1QOB A;  3GE3 C;  3GZN I;  2M56 B;  2V3N A;  1IBX A;  2JZ3 B;  1NYQ A;  5C2T B;  2GI9 A;  2GOW A;  3WAL A;  5DPR A;  3AV8 A;  1VZ6 A;  3IAS 1;  3ZKJ C;  3OLM D;  4JLC A;  5GXG B;  3IG3 A;  2EMS A;  5L83 A;  4YTN B;  1Y8R C;  2VRR B;  3SFD B;  3AU4 A;  5JHA A;  2PMV A;  3N20 C;  1ZUD 2;  2DAF A;  3R3M A;  2NBU A;  1XT9 B;  2MQJ A;  2IND C;  4M01 A;  4RH6 A;  4X57 B;  2WXM A;  1UGJ A;  2EMT A;  2IO1 B;  1YJ1 A;  1TTN A;  4ZOH C;  4NJ6 A;  4AJW A;  1LM8 B;  1ZW7 A;  2FUG 1;  3PLU A;  3PTF C;  1RLF A;  2WU2 B;  3WAP A;  1PDX A;  3PSE B;  1I4G A;  4F8C B;  3MTN B;  4USA A;  1ZPS A;  3NZS A;  2N7J A;  1B9R A;  3NY5 A;  1FD6 A;  2BW2 A;  1JRU A;  2RPQ A;  2UWQ A;  2E6X A;  3DPD A;  3PPA A;  2RSU A;  4AWJ A;  4DHJ D;  3JSV B;  3VAW A;  1BXT A;  3DBR B;  1YIW A;  1QIL A;  1GG3 A;  1DOX A;  1F52 A;  1D6E C;  4G50 A;  3H8H A;  3IFW B;  1WFY A;  3T3N A;  2WLB A;  4MEL A;  3WAM A;  1FMA D;  2KAJ A;  2IPK D;  2KN5 A;  2ON8 A;  2BWF A;  2QC8 A;  4JE3 B;  3I57 A;  2DBY A;  5G2N A;  1R4N B;  1WGR A;  5G5G A;  5IOI A;  1E7V A;  2J0J A;  1IBX B;  4WAA A;  1ZXI A;  1UBQ A;  4K3B A;  1FFU A;  4ZHP A;  4J6I A;  3EGR A;  4ICU A;  1SE4 A;  4MT5 A;  2G4S A;  4ZRP A;  1H4R A;  3M62 B;  3A1Q B;  3NRZ A;  3AEF B;  1I4X A;  1VJK A;  5HFY A;  4W9F A;  4TQ0 A;  1R4M I;  3MHS D;  1OEY J;  2L00 B;  2LVO A;  2C7N B;  2KMA A;  4A20 A;  2G45 B;  2LEK A;  1V49 A;  3QWZ B;  2PE6 B;  4DXG A;  3B0A A;  1JCK B;  4KV2 A;  4ZRJ A;  4JX1 C;  4TMA B;  3T9L A;  2SEB D;  2JXT A;  2N1V A;  4FJZ A;  1GNU A;  1NDD A;  3FC4 A;  3IXS A;  4NNJ B;  3C0R B;  2WGS A;  4HJG E;  2WXL A;  2WQY B;  3SR6 A;  5BYQ A;  4HRO A;  2BVC A;  4B6W A;  1JWU D;  2LGS A;  5EDS A;  2CR5 A;  1BT0 A;  1UWX A;  5LLI A;  4S0R A;  3RT3 B;  5E6O A;  5AUI A;  4KKJ A;  2KQS A;  2UU7 A;  4E74 A;  1WI0 A;  4RCO A;  2D3G A;  1UUP A;  1E90 A;  3PT2 B;  4OZA A;  1K51 A;  1WYG A;  3NHE B;  4US8 A;  1L4Z B;  4HK2 A;  1RM6 C;  2JUO A;  3AEE B;  3OAW A;  4EOY A;  5C1Z A;  1L2N A;  2O2V A;  2AQ3 B;  4HWI B;  4KZ0 A;  3ZRF A;  3W1S C;  1FXI A;  1P7E A;  1VLB A;  3ZW3 A;  3IBE A;  3AM9 A;  2H89 B;  3EFU A;  1EU4 A;  3DBL I;  4FBJ B;  1Y56 A;  3RMK C;  4HVB A;  3P63 A;  1XF5 L;  3HRD D;  1KLG D;  2WXH A;  1L0X B;  1JAL A;  3HVD A;  1WSP A;  3Q8C A;  3RZF A;  3N9Y C;  4GN1 A;  2MP2 A;  3AMZ A;  3APC A;  4I6N B;  2R2Q A;  3AEB B;  1E8Y A;  1MG4 A;  2LXC A;  1SE2 A;  1WIA A;  5JXV A;  2DYB A;  4NJC A;  2AWT A;  3I5J C;  1OTR B;  2K8B A;  1L6V A;  2RDB C;  1V97 A;  3SHQ A;  3TUO A;  2RR9 A;  1FCL A;  4K1R B;  2RDH A;  5D3D A;  5E6P A;  2GLS A;  3DDC B;  3DBH B;  2I2Y A;  5J2R A;  1AWD A;  1KLU D;  3W9C B;  1FNW A;  3QAR A;  4GDL A;  3U8Z A;  3UF8 A;  1V2Y A;  1I4Q A;  4MAC A;  3DVN U;  3QQ8 B;  1NI3 A;  2JQR B;  3Q14 C;  2PE9 A;  2G1E A;  3DWM A;  3ZJT A;  1FM0 D;  1H8C A;  2MHJ A;  2D5G A;  4S17 A;  2K3U A;  2LJ5 A;  3RUL A;  2MWS B;  3EFC A;  1K52 A;  3V60 A;  4WJN A;  2JY6 A;  1E6E B;  2KMM A;  2BYE A;  2LD9 A;  2PPH A;  3Q8E A;  4C4V A;  4GB9 A;  2KVR A;  2WXP A;  2GB1 A;  1PQS A;  3W5U B;  2MBB B;  4K3C A;  2AYO B;  1WH3 A;  4HXD A;  2BYF A;  4KX6 B;  3L54 A;  2EKE C;  2Y5P A;  2E3T A;  1LFD A;  3Q3J A;  1TY2 A;  1KM7 A;  1IP9 A;  2LUM A;  1ENF A;  2V3S A;  5DCN A;  1MJD A;  1SJH D;  2YEP F;  4MH0 E;  3VRB B;  4PK1 A;  2KYW A;  1V5T A;  5MPO A;  4EZK A;  4ZDV A;  5FR3 A;  2MP2 B;  1P0R A;  1L5P A;  5CTR C;  5BMI A;  4PYZ A;  3ZUN A;  4EE2 A;  2L05 A;  3T8M A;  3SEB A;  2MBO A;  1C78 A;  2NTS A;  5DPT A;  5J18 A;  1UGM A;  3CST A;  2N9L A;  5CHV C;  4G11 A;  2IO3 B;  1SE3 A;  1JWS D;  4US9 A;  5LNK 1;  2RGF A;  2JYE A;  4IWO A;  1ACC A;  2BT6 A;  2IGH A;  2WDV B;  2DHZ A;  3R2I A;  3RI7 C;  3L0W B;  2ZVO A;  5D2M B;  4I6L B;  2W82 A;  2KXJ A;  4HCN B;  2FCS A;  4C80 A;  2L3Z A;  1R4N I;  1CJE A;  2LVQ A;  1I42 A;  2DZK A;  1XLP A;  1EU3 A;  4OVU A;  2L0F A;  4GDL B;  2MEK A;  3VR8 B;  1SB3 C;  1QT9 A;  4FJV B;  1JRO A;  3KWL A;  3K9O B;  4WWM A;  2QMT A;  2XBB C;  2HE7 A;  2KWD A;  2GBM A;  4DQO C;  4LNK A;  1CK1 A;  2ZVN A;  2ZW1 A;  2L76 A;  3NVV A;  1FXA A;  3HUI A;  1XLQ A;  1WXS A;  3DQV A;  3T3O A;  3U2S C;  3ZRC A;  4EKU A;  1UF0 A;  1UNS A;  2IO2 B;  2GBN A;  5JHB A;  1JWB D;  2FAZ A;  4LLG M;  1C76 A;  3P1M A;  2ONQ A;  1FRD A;  4DXA B;  3L17 A;  1S1Q B;  4JWU C;  2LXA A;  2CKH B;  1A70 A;  1L7Y A;  4IM3 A;  3R7Q A;  4C7Y A;  2KLG A;  3NS1 A;  3ZXR A;  3RCZ A;  2PIA A;  3M3J A;  1WZ0 A;  4BOZ B;  3EUB 2;  2HDE A;  3NZ3 A;  2DZM A;  4FN2 A;  1Q10 A;  3VRA B;  2RMM A;  2WXI A;  4OVZ A;  4DBG A;  4II3 B;  2MBQ A;  3PO0 A;  3TEX A;  3AEC B;  4B9K A;  3KQ4 A;  2LRU A;  4KSL C;  1AAR A;  1HZ5 A;  4P6V F;  4HKZ E;  3B1L X;  2KAN A;  2KTF A;  1A5R A;  2JT4 B;  4NZL B;  5JH5 C;  3H7P A;  3VTW A;  2CHZ A;  2DYM A;  4I6P A;  3KUC B;  3RYT A;  1K8R B;  1YX6 B;  3VUX A;  3SU8 X;  1M4V A;  1TS3 A;  3JW0 X;  4AUQ C;  4F1S A;  2WXQ A;  1F2R I;  3A33 B;  2K22 A;  4ARI A;  4CYE A;  2BTE A;  2H88 B;  2W3S A;  4IOI E;  1E8X A;  1U4A A;  2RD0 A;  5CX3 A;  2OJR A;  2AL6 A;  3ZLZ A;  3B2F A;  2INC C;  4QAY A;  1MHH E;  2WDT B;  3LYY A;  3V61 A;  1RRB A;  3RPF C;  1FCC C;  1GB4 A;  1KOT A;  3P4P B;  3MJ5 A;  4XDC A;  3GS2 A;  5FKA C;  1F9J A;  1MFW A;  1D5X C;  3PVL A;  4BBN F;  1VZ8 A;  4KDI C;  2DNF A;  2YLM A;  4XWW A;  4NY0 A;  4W9E A;  2BS4 B;  1J7C A;  1DYQ A;  3AB5 A;  4CO7 A;  2WP9 B;  4DK5 A;  3L4P A;  3PZ8 A;  2VZK B;  1PYW D;  3ONS A;  1PGB A;  1FEH A;  2A4Z A;  4NQL B;  2L52 A;  4BZA A;  2HJ8 A;  3IAM 1;  2IY1 B;  2V3P A;  1PGA A;  1T3Q A;  3WAO A;  2JPH A;  4JIO U;  1WJ6 A;  2MJE A;  2KHW B;  2X8X X;  4P7I A;  3M95 A;  4BBN C;  2KC2 A;  3BWU D;  1ZGU B;  2D2Q A;  3ECI A;  2D07 B;  5L95 C;  3ZJU A;  4ANU A;  1J0G A;  3KYC D;  2PKO A;  2JZZ A;  5AZF A;  3QK0 A;  5H8Y E;  3H7P B;  3NJT A;  3VXW A;  1L6U A;  3AEA B;  1VZ7 A;  1CMX B;  1GOZ A;  4DWF A;  3WIM A;  4HPM B;  1SJE D;  1SE9 A;  3NVW A;  1C4P A;  3P42 A;  4AOF A;  4YXD B;  1J8C A;  2N9K A;  4BKS A;  2LUE A;  2Q5W D;  3DVG Y;  2JRH A;  4P1C C;  1WGY A;  2FUH B;  3U7D A;  1OFF A;  2AEH A;  4WQO B;  1NEN B;  2FE8 A;  3P4R B;  1HQR D;  2NVU I;  3KUD B;  2JRI B;  1C3T A;  4B95 A;  1L4D B;  1F1H A;  1QOF A;  4EZJ A;  4WJQ A;  1V80 A;  4KZC A;  4LJP B;  4JGH B;  3N1Z C;  4BKT A;  2B76 B;  2BS2 B;  2GBK A;  5DPW A;  2O6V A;  2QIL A;  4GSW A;  5IO9 A;  1PUT A;  3APD A;  4MGZ E;  4TUU A;  2GRI A;  2K1F A;  1ET9 A;  3KH0 A;  1IUE A;  3N32 A;  4FHJ A;  1T0Y A;  4YL8 A;  1DGJ A;  4MM3 B;  3AEG B;  2KAC A;  4KGR A;  2N7E A;  2BS3 B;  4XDD A;  2KJ6 A;  4IG7 B;  1PFD A;  3DHH C;  3R66 C;  2YEP B;  2JU6 X;  2LRW A;  1P98 A;  2L0T A;  3ETR A;  1JW9 D;  1WYW B;  2IY0 B;  5EE0 A;  4FUL A;  2G3Q B;  1SSN A;  3ZNZ B;  1WGH A;  1WRI A;  3QC8 B;  2VZK D;  4NAW A;  2K6Q A;  4C00 A;  4II2 B;  4GMV A;  4W9G A;  2RDG A;  2KFJ A;  3RNE C;  3V6E B;  2AX5 A;  2C5L C;  4HDQ A;  2M17 A;  1HEZ E;  1GAQ B;  3AE3 B;  3HIZ A;  2J4X A;  5D3I B;  3AE4 B;  5H92 C;  3Q8B A;  4ANX A;  2ZEQ A;  5FR6 A;  4YTP B;  4RMA A;  3PLV A;  3OG5 A;  3CWI A;  1AYF A;  2FID A;  1FXT B;  2I38 A;  1QQR A;  3VDZ A;  3EC8 A;  4FXC A;  1N6Z A;  4KGT A;  1KH0 A;  1N63 A;  3TJP A;  2V1Y A;  3Q2A C;  1NEK B;  3BII D;  2LMC A;  1WXQ A;  2NCN A;  4MEM A;  1WGG A;  4P16 A;  4RM9 A;  3ZTC A;  3DHG C;  3QJZ A;  1TGZ B;  1K50 A;  2I1J A;  2ASQ A;  3KWV A;  1GUA B;  2VH2 A;  1UWM A;  1D5M C;  2LGY A;  3MJW A;  1TKG A;  2J52 A;  1E9M A;  2HTH A;  4A90 A;  2O6V B;  2PJH A;  4RGT A;  2ZZP B;  1KRH A;  1GC7 A;  3R2T A;  3TIX A;  3X0W A;  4GLS C;  3DCG A;  1WY8 A;  4MSM B;  4RF1 A;  1OGW A;  4WUR A;  4RF0 A;  4RGN A;  1WGD A;  2Z0E B;  2FBW B;  1LQB A;  1RFK A;  3H6N A;  2KKC A;  2M1M A;  2X38 A;  2KD0 A;  2MW5 A;  1T6B X;  1SXT A;  1M94 A;  3GB1 A;  4KKI A;  1D3Z A;  3SDL C;  2K25 A;  2WDR B;  3MFG A;  2BQQ A;  2LAS A;  4HJK A;  1WJU A;  4DXF A;  4IWQ A;  3EHV A;  1TIF A;  2GBR A;  2PEA A;  1V1P A;  2JWU A;  3BVG A;  3ZDM C;  4MDK E;  2ZPN A;  4WJP A;  1R7S A;  1YOV B;  3KVF B;  2B3A A;  3MP9 A;  2WXJ A;  4B0E A;  3GP7 A;  4WQM A;  1Z5S B;  4M8N A;  2MA9 B;  3APF A;  3TMP B;  3Q8A A;  2LZ6 A;  3OJ3 A;  2WXO A;  1TKE A;  4IC7 B;  2NBV B;  3RNA C;  1XXG A;  4TSS A;  4KGS A;  4HPP A;  1UBI A;  3ZDT A;  4PS3 A;  2J0K A;  2CS4 A;  4ZRQ A;  3NG0 A;  4TQ1 A;  1T0Q C;  2A5U A;  1V5O A;  1SIF A;  2C60 A;  1WR1 A;  4BKG A;  4HDO A;  1S3S G;  2KOX A;  4KIK A;  2QHO A;  1YN5 A;  4ITK A;  3PHW B;  3MC9 A;  1YMH E;  2IGG A;  3D32 A;  4K81 A;  1HTO A;  4YSX B;  1D5Z C;  1Q5W B;  1AN8 A;  2V0G A;  1DOY A;  1YJI A;  3NOB A;  4KVG B;  2CJN A;  3ML9 A;  2O2V B;  4ICV A;  3NS8 A;  1P1A A;  2J7Q B;  2OED A;  2O6V D;  2KVZ A;  4LJO B;  1RFA A;  3CMM B;  3GZN B;  4RGO S;  4FHK A;  1WR6 E;  2DZI A;  2INP E;  3AI5 A;  3GE8 C;  5BYS A;  3ZXV A;  3AE6 B;  2KWU B;  1N61 A;  2KT7 A;  2KX3 A;  4W9I A;  3ZIM A;  3E56 A;  4E71 A;  2R61 A;  2PVO D;  4ANW A;  1WE7 A;  3B08 A;  4YSZ B;  1T5X D;  4DDG D;  4E3C A;  2XN9 C;  3RZW C;  5AEK B;  2NMQ A;  4OZB A;  1V1P B;  4G0N B;  4C7Z A;  2M19 A;  3L13 A;  1WXM A;  1N60 A;  4DDI D;  2QSD A;  3PRM B;  1KFY B;  4TV3 A;  3DBR I;  2LWP A;  1EM7 A;  4LNN A;  4OHJ A;  3VUY A;  3RNF C;  4RGM A;  5BYR A;  5J17 A;  3R8B A;  2MBE A;  4XC2 A;  2KDF B;  1RWS A;  3AN1 A;  3I3T B;  4MH8 A;  1HTQ A;  1NI2 A;  5IP4 D;  2ZJD A;  3W2D A;  3UIN B;  5HI1 A;  2LI5 A;  3BK1 A;  3CIR B;  4DHZ B;  3LJ3 A;  2JXX A;  1P3Q U;  1Q1O A;  4FAD A;  2IO0 B;  3DVG X;  4HLE A;  3RUI B;  4KSK C;  1B1Z A;  2J53 A;  4BVU C;  4EZL A;  1V6E A;  2LHD A;  4KIK B;  2KWV B;  4JL9 A;  1GPX A;  4EUT A;  3I63 C;  1KLV A;  1G6J A;  2L8J A;  3BVZ A;  1MHX A;  2WXF A;  2KQ4 X;  4CQN A;  4D2K A;  4IW0 A;  4ANV A;  5I4D A;  4C4V B;  4N58 A;  4OZC A;  5G5H A;  1MPE A;  1WGK A;  2FIF A;  1UD7 A;  3UIP B;  3Q3F A;  3JVZ X;  4RM8 A;  1UZX B;  3BYY B;  4EEW A;  3UQB A;  5EE9 A;  4PYU A;  4LNI A;  3FIL A;  3ZO5 B;  1YQ3 B;  4AQ7 A;  2W54 A;  2N4F A;  5CHF A;  3ZGZ A;  1TYG B;  1V86 A;  4NJ7 A;  2W9N A;  1VRA B;  1E7U A;  2WX1 A;  4M00 A;  3GOE A;  1XLO A;  3QHT A;  2BKR B;  5IKC M;  4HPL B;  2OHF A;  4O1N A;  1XEE A;  4K7W A;  1I4P A;  4N6E B;  5AUK A;  5BMG A;  3RD2 A;  3DWG C;  4N59 A;  5JZE B;  2LGD A;  1WMH A;  2Z59 B;  1FRR A;  3MC0 B;  2BBC A;  2WXR A;  4AJY B;  2CU3 A;  1JQ4 A;  1ZE3 D;  1YD8 U;  3V62 A;  1EWY C;  2VH1 A;  4PS7 A;  2LJI A;  3WCQ A;  2KX0 A;  2PW9 A;  3IVF A;  2WXK A;  2N1W A;  1HA5 A;  1SBB B;  2K8H A;  5EE3 A;  4WIP A;  4A55 A;  3WA0 A;  2K5P A;  3LB8 C;  2NPT A;  3JYU A;  1V8C A;  1QKZ A;  3UIO B;  3RN9 C;  2ZW0 A;  2CHX A;  4HRS A;  2KO3 A;  5G55 A;  1ZKH A;  5HG2 A;  1UH6 A;  4UDU C;  3DBL B;  1TZO A;  5IAA C;  1AW7 A;  3UQA A;  4DHJ B;  2D10 A;  3K9P B;  4A3O A;  4DHZ E;  1EF1 A;  2JF5 A;  2WXG A;  1E8W A;  2MRP A;  3UI3 A;  1YQB A;  4ZRI A;  1WJ4 A;  1YN4 A;  4Q2J A;  2G4D B;  1WX9 A;  4ZHO A;  1TBE A;  3RNG C;  3DBH I;  2LGI A;  3CSF A;  4EFO A;  3EA6 A;  5D94 A;  5LXH A;  4GDK A;  4JWS C;  2K9X A;  3FIL B;  1E10 A;  2JX5 A;  3CF6 E;  1X1M A;  4L1B A;  1V1O A;  3B9J A;  3HM6 X;  4B0M A;  3B2G A;  5IN7 A;  3ALB A;  4XZ4 A;  1WRD B;  1WXV A;  3A9J A;  4WWN A;  4XYC A;  1FNU A;  4NQK E;  1C4A A;  2BWE S;  3QIJ A;  5AZG A;  1YNT E;  1JML A;  5E6N A;  1WMH B;  3U4E G;  3V6C B;  4IKG A;  3AE7 B;  3VFK A;  3NVY A;  1VCB A;  2KDM A;  2N9E B;  1UEL A;  4MSQ B;  1ISN A;  4HKQ A;  2DLB A;  5D7G A;  3AE1 B;  3VVW B;  1C79 A;  4NPN A;  2C9W B;  4K7U A;  3A1Q A;  1FFV A;  1WM3 A;  2JZP A;  3IT4 B;  4ZYS A;  1VR9 A;  1OQQ A;  3EEC A;  3AH7 A;  2NPT B;  3L08 A;  3Q3N C;  2WU5 B;  3U30 A;  2IYD B;  3FKY A;  3VTU A;  1LGR A;  1J7A A;  3PZ7 A;  2UYZ B;  1SEB D;  4NAM A;  2AQ1 B;  1RAX A;  1I35 A;  3AXC A;  2G9H D;  3QCA A;  2PLP A;  1OEY A;  1HZ6 A;  2K6D B;  5BO4 B;  3L16 A;  3N3K B;  2J42 A;  4GIV A;  4XWT A;  1XO3 A;  4OW0 A;  4GDK B;  2RPV A;  2V4L A;  3TCA A;  1QOA A;  4BOS C;  3M63 B;  1CZP A;  1WWT A;  1I4R A;  2R2O A;  2K39 A;  1RYJ A;  2Y5C A;  2KLC A;  4M8M A;  3SD5 A;  2XNA C;  4A6Q A;  1WX8 A;  3A9J B;  4RNA A;  3H7S A;  3PHX B;  1E5W A;  2Z8L A;  2KDI A;  3C8Y A;  3PRZ A;  3ZYY X;  1QOG A;  2ZCB A;  3O65 B;  2W55 A;  1MG8 A;  2KDB A;  3OJ4 B;  4IM0 A;  1MVK A;  4FLH A;  3LDZ E;  1ZDX A;  2BYV E;  3TBL D;  4WH4 A;  4RFB A;  1P9D U;  3AUL A;  2IZV B;  4FA6 A;  2V4I B;  1GC6 A;  2GMI C;  1N5X A;  1BUI C;  4GXB A;  5IA7 A;  1OQY A;  3P4Q B;  4W9H A;  3IT6 B;  1C4C A;  2N9X A;  1WJN A;  3PGE A;  2MJ3 A;  5KHO A;  1STE A;  2LVP A;  3PV1 A;  4W9C A;  5EE1 A;  3RFZ B;  2IBI B;  2FCN A;  2WNM A;  2ZNV B;  5T8I A;  3A4R A;  2NBW B;  1YX5 B;  2DEN B;  4M0W A;  2M8S A;  4KDL B;  3E9S A;  3HK0 A;  4GOC A;  3HHM A;  4BAX A;  2BYT A;  2ICI A;  1N62 A;  2L7R A;  1IPG A;  2WDQ B;  5D6J B;  4IWP A;  1VDV A;  4PS8 A;  5C3J B;  2MSE D;  3U7Z A;  2NTT A;  3BYT B;  1NBF C;  4NAW B;  4WJO A;  1T0R C;  4ARC A;  2NR2 A;  2BB6 A;  3MHZ A;  2L32 A;  1XCT L;  3N30 A;  1K53 A;  1TJE A;  3VH4 B;  2KTR A;  1Z2M A;  4HEA 1;  1FO4 A;  3Q3O C;  2JSV X;  4G3X B;  2WXN A;  3NUH B;  1GJZ A;  2J0M A;  3HVZ A;  3DVN V;  1HXY D;  3AE2 B;  4M02 A;  3AE5 B;  1ZDV A;  1V9J A;  2MX2 A;  4F7Z A;  4H2A A;  2D11 A;  1XD3 B;  2BGF A;  2CHW A;  4TKN A;  4C56 C;  2Y3A A;  1ESF A;  2N0S B;  2TSS A;  3TL5 A;  1FIQ A;  1C9F A;  2AL3 A;  4JQW C;  4LTU A;  2WX0 A;  1XCQ L;  2REX A;  1WXA A;  2HTM E;  2KN4 A;  3NVZ A;  1E7P B;  4WWO A;  1ROE A;  3OWE B;  4BKS D;  2CU1 A;  3TEZ A;  3ZNG C;  4IM2 A;  4LNF A;  1EUV B;  4PT5 A;  2XEW A;  1YN3 A;  3RNB C;  1NYR A;  3BZD B;  1KF6 B;  3ZTD A;  3BK2 A;  2EKI A;  2KWC A;  1WE6 A;  1QZE A;  2IJ0 A;  4LDT B;  2WS3 B;  4FJY A;  3ZJV A;  2NS5 A;  2QCZ A;  4YT0 B;  2MBH A;  1LO5 D;  4WWP A;  3LXF A;  1QF6 A;  3VHT C;  5TR5 A;  4M0W B;  1TT5 B;  2W3R A;  1L0V B;  1PGX A;  2MJD A;  1YJJ A;  2BPS A;  3HM3 A;  2OJW A;  5HHD G;  3UGB B;  3J9C A;  2Z0D B;  2JVC A;  1XLN A;  1YQ4 B;  3A9K A;  1J7B A;  1WX7 A;  2ACZ B;  2INN E;  2PVG C;  3O13 A;  4MGK E;  2IDY A;  1P7F A;  4XE0 A;  2DAJ A;  2QJL A;  1CQV A;  3SFE B;  1XQQ A;  1TS2 A;  2KTR B;  3AE9 B;  3DOW A;  2Y5B B;  1MI0 A;  2HJ1 A;  1HE8 A;  1VD2 A;  3NZU A;  2KJR A;  4IUM B;  4W9L A;  4A9A A;  3QA8 A;  4XGA B;  2FCM A;  2D3A A;  1GB1 A;  3TSS A;  3VUW A;  4AS1 A;  2KDE B;  1IGD A;  4YTM B;  3VH3 B;  1EF5 A;  3VQI A;  2M0A A;  3URY A;  3VTV A;  2YVC A;  1WM2 A;  1ZP0 B;  1ZXH A;  1C1Y B;  1I4H A;  4MJS A;  3V3X A;  4HCP B;  2QDF A;  3ENE A;  2KNB A;  1J19 A;  2BB5 A;  2BF8 B;  2M0X A;  3BY4 B;  3VR9 B;  4K7S A;  4LCD E;  3C19 A;  1TKY A;  3PZD A;  3DBS A;  4A3P A;  2MH7 A;  3KUZ A;  2V9H A; 
#chains in the Genus database with same CATH homology
 3QC8 B;  1WX9 A;  4NAW A;  3W1S A;  2AWT A;  2K6Q A;  4II2 B;  4GGQ A;  1OTR B;  1TBE A;  2K8B A;  3DBH I;  4URK A;  2DYO A;  3A4S C;  4GMV A;  3X23 A;  3CSF A;  4W9G A;  2C7M B;  2KFJ A;  3V6E B;  2KK8 A;  2JWZ A;  3SHQ A;  4EFO A;  2C5L C;  2RR9 A;  4HDQ A;  2M17 A;  5D94 A;  5LXH A;  3HIZ A;  4GDK A;  4K1R B;  4ANX A;  2ZEQ A;  5FR6 A;  3CF6 E;  3WAN A;  4RMA A;  1WF9 A;  3PLV A;  5E6P A;  1EO6 A;  4W9D A;  3DDC B;  1WZ3 A;  1X1M A;  4LDT D;  4ZYN A;  2DX5 B;  5J2R A;  2FID A;  3PS6 A;  1FXT B;  3VDZ A;  3A9K B;  3HM6 X;  3QAR A;  1TZ1 A;  4GDL A;  3EC8 A;  3U8Z A;  1V2Y A;  3UF8 A;  3ALB A;  4XZ4 A;  1LXD A;  2I1K A;  1WRD B;  1WXV A;  3TJP A;  5AZH A;  2LGX A;  2V1Y A;  3A9J A;  3DVN U;  4WWN A;  3QQ8 B;  3QX1 A;  4NQK E;  3ZNI D;  2BWE S;  5KHQ A;  3QIJ A;  2PE9 A;  2NCN A;  5AZG A;  4MEM A;  1WGG A;  5E6N A;  1WMH B;  3ML8 A;  4RM9 A;  3V6C B;  3ZTC A;  1H8C A;  3VFK A;  4MGI E;  2XK5 A;  2LJ5 A;  3RUL A;  2MWS B;  3QJZ A;  1TGZ B;  1VCB A;  2N9E B;  2C7H A;  1UEL A;  1V81 A;  2BKF A;  4MSQ B;  2WYQ A;  2I1J A;  4W9J A;  2KFK A;  1ISN A;  1SGH A;  4W9K A;  4WJN A;  3V60 A;  2ASQ A;  1GUA B;  2FCQ A;  3MJW A;  2LGY A;  2ZNV C;  2JY6 A;  5D7G A;  2BYE A;  3VVW B;  2LD9 A;  4BFR A;  4NPN A;  2HTH A;  2PPH A;  2C9W B;  2O6V B;  4K7U A;  2M4N A;  2PJH A;  3KW5 B;  3A1Q A;  4GB9 A;  2KVR A;  1WM3 A;  1PQS A;  4ZRK A;  2ZZP B;  2MBB B;  1GC7 A;  2AYO B;  5HKH A;  1WH3 A;  3TIX A;  4HXD A;  2N9P C;  2BYF A;  3X0W A;  3DCG A;  3EEC A;  1WY8 A;  2NPT B;  4MSM B;  1OGW A;  3L08 A;  3L54 A;  2EKE C;  1LFD A;  3BIN A;  3Q3J A;  1KM7 A;  3U30 A;  1WGD A;  1IP9 A;  2IYD B;  2Z0E B;  2V3S A;  1LQB A;  3VTU A;  5DCN A;  4MH0 E;  3L10 B;  3H6N A;  1V5T A;  3H9D A;  2KKC A;  4EZK A;  2UYZ B;  4ZDV A;  3IHP C;  2M1M A;  4OVV A;  4MJS B;  2MP2 B;  2K8C A;  1P0R A;  2KD0 A;  2MW5 A;  5CHW A;  4CHK A;  5CTR C;  1RAX A;  2N7D A;  1I35 A;  2FNJ B;  3AXC A;  3KYD D;  4PYZ A;  3ZUN A;  3QCA A;  2L05 A;  2ZCC A;  3T8M A;  4ASW C;  1M94 A;  5LXI B;  4GU2 A;  4AP4 C;  2MBO A;  4N9F 4;  1OEY A;  2K6D B;  1D3Z A;  3SDL C;  2K25 A;  5DPT A;  5BO4 B;  5J18 A;  1UGM A;  3L16 A;  3CST A;  5CHV C;  4G11 A;  2LAS A;  3N3K B;  2KQ7 A;  4HJK A;  1WJU A;  2IO3 B;  4XX5 A;  4GIV A;  4IWQ A;  3EHV A;  3PRE A;  2RGF A;  3ZNH B;  5C23 A;  2KZR A;  4IWO A;  2GBR A;  2PEA A;  4GDK B;  2DHZ A;  3L0W B;  2OOB B;  2ZVO A;  2V4L A;  5D2M B;  3TCA A;  2KJH B;  2ZPN A;  4I6L B;  4MDK E;  4WJP A;  3ZDM C;  3KVF B;  2B3A A;  4BOS C;  2KXJ A;  3M63 B;  4HCN B;  2FCS A;  1E8Z A;  2L3Z A;  1Z5S B;  1R4N I;  3R7R A;  4M8N A;  2LVQ A;  1I42 A;  2DZK A;  2MA9 B;  3APF A;  4OVU A;  3TMP B;  2L0F A;  4GDL B;  2R2O A;  3PRP B;  2LZ6 A;  2K39 A;  3OJ3 A;  2KLC A;  4IC7 B;  4M8M A;  2MCN B;  2NBV B;  3SD5 A;  3H1U A;  2WWZ A;  4FJV B;  1WX8 A;  3QAQ A;  3A9J B;  3JSV A;  2MLB A;  3H7S A;  2DZJ A;  3K9O B;  2ZPY A;  3PHX B;  2KMC A;  1E5W A;  1UBI A;  2KDI A;  1IYF A;  2XBB C;  2HE7 A;  3PRZ A;  2ZCB A;  2GBM A;  3O65 B;  3P2B A;  2KC1 A;  4MM3 A;  2XK5 B;  1MG8 A;  4PS3 A;  2KDB A;  3OJ4 B;  3W1Y A;  2ZVN A;  3ZDT A;  2L76 A;  2J0K A;  4IM0 A;  4FLH A;  1KJT A;  2CS4 A;  2KFK B;  3LDZ E;  5GMV A;  2HD5 B;  1WXS A;  2GBJ A;  3AU5 A;  3DQV A;  4MGY E;  4TQ1 A;  2BYV E;  3TBL D;  3ZRC A;  2A5U A;  1V5O A;  4EKU A;  1SIF A;  1P9D U;  2C60 A;  1Q0W B;  1WR1 A;  2IO2 B;  4BKG A;  2GBN A;  4HDO A;  5JHB A;  5DPS A;  3AUL A;  2IZV B;  4FA6 A;  1S3S G;  2FAZ A;  3ZVV A;  2KOX A;  4KIK A;  3S2A A;  2QHO A;  3PHW B;  1GC6 A;  4DXA B;  3D32 A;  3L17 A;  1S1Q B;  2GMI C;  3GZN I;  2LXA A;  2CKH B;  4K81 A;  1L7Y A;  4IM3 A;  4GXB A;  1Q5W B;  5IA7 A;  2JZ3 B;  3R7Q A;  1OQY A;  2KLG A;  3RCZ A;  4W9H A;  3M3J A;  1WZ0 A;  4BOZ B;  3NOB A;  4KVG B;  2GOW A;  3WAL A;  5DPR A;  3ML9 A;  2O2V B;  2N9X A;  2DZM A;  4ICV A;  1WJN A;  3NS8 A;  4FN2 A;  3ZKJ C;  1P1A A;  2J7Q B;  3OLM D;  3PGE A;  4JLC A;  2O6V D;  3IG3 A;  4LJO B;  1RFA A;  5KHO A;  2EMS A;  3CMM B;  5L83 A;  1Y8R C;  2LVP A;  2VRR B;  3PV1 A;  4W9C A;  4DBG A;  4FHK A;  1WR6 E;  2DZI A;  3AU4 A;  3AI5 A;  4II3 B;  5JHA A;  2IBI B;  2MBQ A;  2KWU B;  4B9K A;  2FCN A;  2LRU A;  2ZNV B;  2DAF A;  2KX3 A;  3R3M A;  4KSL C;  4W9I A;  1AAR A;  2NBU A;  3ZIM A;  1XT9 B;  2MQJ A;  2KAN A;  2KTF A;  3B1L X;  4X57 B;  1A5R A;  2JT4 B;  3A4R A;  2NBW B;  3H7P A;  5JH5 C;  1YX5 B;  2EMT A;  2IO1 B;  1YJ1 A;  1TTN A;  2DEN B;  3VTW A;  4E71 A;  4NJ6 A;  4AJW A;  1LM8 B;  1ZW7 A;  2CHZ A;  2DYM A;  2M8S A;  4I6P A;  4KDL B;  3HK0 A;  3KUC B;  4GOC A;  3RYT A;  4ANW A;  1K8R B;  1WE7 A;  1YX6 B;  3PLU A;  3HHM A;  3PTF C;  1RLF A;  3B08 A;  4DDG D;  3VUX A;  4E3C A;  3WAP A;  3PSE B;  3RZW C;  5AEK B;  2L7R A;  4F8C B;  1IPG A;  3SU8 X;  4G0N B;  5D6J B;  3MTN B;  3L13 A;  1WXM A;  3JW0 X;  4AUQ C;  4DDI D;  4TV3 A;  3PRM B;  3NZS A;  4F1S A;  4IWP A;  3DBR I;  4PS8 A;  2MSE D;  3NY5 A;  2LWP A;  1NBF C;  4NAW B;  3VUY A;  3A33 B;  4WJO A;  1JRU A;  2RPQ A;  2NR2 A;  2UWQ A;  5J17 A;  4CYE A;  2MBE A;  3DPD A;  3PPA A;  1E8X A;  1U4A A;  2RSU A;  2KDF B;  2RD0 A;  4XC2 A;  5CX3 A;  2OJR A;  2AL6 A;  3ZLZ A;  3I3T B;  4AWJ A;  4DHJ D;  3JSV B;  3VAW A;  3N30 A;  1NI2 A;  2ZJD A;  3VH4 B;  2KTR A;  1YIW A;  1Z2M A;  2WDT B;  1GG3 A;  3V61 A;  1RRB A;  1KOT A;  4G50 A;  4G3X B;  3IFW B;  3UIN B;  1GJZ A;  1WFY A;  2J0M A;  3DVN V;  1F9J A;  2LI5 A;  4DHZ B;  3LJ3 A;  2JXX A;  3PVL A;  4BBN F;  1P3Q U;  1Q1O A;  4KDI C;  2IO0 B;  3DVG X;  4FAD A;  1V9J A;  4MEL A;  2MX2 A;  3WAM A;  4HLE A;  2YLM A;  3RUI B;  4F7Z A;  4NY0 A;  2D11 A;  4KSK C;  1XD3 B;  4BVU C;  2BGF A;  2CHW A;  2KN5 A;  4TKN A;  4EZL A;  4W9E A;  2BWF A;  1V6E A;  5G2N A;  4KIK B;  3TL5 A;  4CO7 A;  2AL3 A;  1WGR A;  2KWV B;  4JL9 A;  4JQW C;  4DK5 A;  4EUT A;  2WX0 A;  2REX A;  3ONS A;  1E7V A;  1KLV A;  1WXA A;  1G6J A;  2L8J A;  2A4Z A;  2J0J A;  4WAA A;  4NQL B;  1UBQ A;  4WWO A;  4BKS D;  2CU1 A;  2HJ8 A;  4IW0 A;  3ZNG C;  4J6I A;  4IM2 A;  4ICU A;  4ANV A;  2IY1 B;  3WAO A;  1EUV B;  2G4S A;  2XEW A;  2JPH A;  4JIO U;  1WJ6 A;  3ZTD A;  2KHW B;  1H4R A;  3M62 B;  3A1Q B;  2KWC A;  1WE6 A;  1QZE A;  4P7I A;  3M95 A;  4BBN C;  2KC2 A;  4LDT B;  4W9F A;  4TQ0 A;  4FJY A;  1ZGU B;  1R4M I;  3MHS D;  1OEY J;  2D2Q A;  2L00 B;  2NS5 A;  2FIF A;  3ECI A;  2D07 B;  1UD7 A;  5L95 C;  4ANU A;  2MBH A;  1J0G A;  3KYC D;  3UIP B;  2LVO A;  4WWP A;  2C7N B;  2KMA A;  4A20 A;  2JZZ A;  2G45 B;  3JVZ X;  3Q3F A;  4RM8 A;  5AZF A;  1V49 A;  1UZX B;  3QWZ B;  2PE6 B;  3QK0 A;  5TR5 A;  3VHT C;  3H7P B;  4EEW A;  4M0W B;  3UQB A;  3VXW A;  3B0A A;  4PYU A;  1L2N A;  3ZO5 B;  2BPS A;  3HM3 A;  4KV2 A;  4ZRJ A;  1CMX B;  2N4F A;  3UGB B;  4DWF A;  3T9L A;  5CHF A;  3WIM A;  4HPM B;  2N1V A;  1SE9 A;  1V86 A;  1GNU A;  4FJZ A;  4NJ7 A;  2Z0D B;  2W9N A;  4AOF A;  2JVC A;  1J8C A;  1NDD A;  4BKS A;  2LUE A;  3A9K A;  3C0R B;  4NNJ B;  1E7U A;  2WX1 A;  3GOE A;  3DVG Y;  3QHT A;  1WX7 A;  2BKR B;  2JRH A;  1WGY A;  4HPL B;  2FUH B;  4MGK E;  3U7D A;  4K7W A;  4B6W A;  5EDS A;  3RD2 A;  2AEH A;  1BT0 A;  2CR5 A;  4WQO B;  5JZE B;  2DAJ A;  5LLI A;  2LGD A;  3RT3 B;  1WMH A;  5E6O A;  2KQS A;  2Z59 B;  2NVU I;  4E74 A;  3KUD B;  1WI0 A;  2JRI B;  1XQQ A;  1C3T A;  2KTR B;  4B95 A;  2D3G A;  1E90 A;  4EZJ A;  4WJQ A;  4AJY B;  3DOW A;  3PT2 B;  1V80 A;  1YD8 U;  3V62 A;  4KZC A;  3NHE B;  2Y5B B;  2JUO A;  4HK2 A;  4JGH B;  3OAW A;  4LJP B;  1HE8 A;  4EOY A;  1VD2 A;  3NZU A;  2KJR A;  4PS7 A;  5C1Z A;  4BKT A;  2O2V A;  4IUM B;  2GBK A;  2KX0 A;  4W9L A;  3IVF A;  5DPW A;  2O6V A;  4GSW A;  2N1W A;  4HWI B;  4KZ0 A;  3ZRF A;  3W1S C;  3QA8 A;  3ZW3 A;  2K8H A;  3IBE A;  2FCM A;  3EFU A;  3APD A;  3DBL I;  4MGZ E;  4TUU A;  4FBJ B;  3WA0 A;  2NPT A;  3JYU A;  4HVB A;  2K1F A;  3KH0 A;  3VUW A;  3N32 A;  2KDE B;  4FHJ A;  3UIO B;  3VH3 B;  1T0Y A;  4YL8 A;  2CHX A;  1EF5 A;  3VQI A;  3VTV A;  2YVC A;  2KO3 A;  5G55 A;  1WM2 A;  1ZKH A;  2N7E A;  1UH6 A;  3RZF A;  5IAA C;  1C1Y B;  2KJ6 A;  4IG7 B;  3UQA A;  4GN1 A;  4MJS A;  2MP2 A;  4DHJ B;  4HCP B;  2D10 A;  3K9P B;  4A3O A;  3R66 C;  1EF1 A;  3ENE A;  2JF5 A;  4DHZ E;  2KNB A;  1J19 A;  1E8W A;  2BF8 B;  2M0X A;  2MRP A;  3BY4 B;  2LRW A;  1YQB A;  3APC A;  1P98 A;  2L0T A;  4I6N B;  2R2Q A;  4K7S A;  4LCD E;  1WYW B;  2IY0 B;  3PZD A;  4ZRI A;  4FUL A;  1E8Y A;  1WJ4 A;  3DBS A;  4A3P A;  2G3Q B;  2LXC A;  3ZNZ B;  1WIA A;  1WGH A;  2DYB A;  3KUZ A;  2G4D B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...