1I42A

Nmr structure of the ubx domain from p47
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
89
structure length
89
Chain Sequence
KASSSILINEAEPTTNIQIRLADGGRLVQKFNHSHRISDIRLFIVDARPAMAATSFVLMTTFPNKELADENQTLKEANLLNAVIVQRLT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords P47
publication title Solution structure and interaction surface of the C-terminal domain from p47: a major p97-cofactor involved in SNARE disassembly.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Protein binding
total genus 12
structure length 89
sequence length 89
ec nomenclature
pdb deposition date 2001-02-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00789 UBX UBX domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 1i42A00
2J0MA 2RSUA 3APDA 3SDLC 2RR9A 5TR5A 4FBJB 3ECIA 5J17A 3H1UA 1XQQA 4XC2A 2LD9A 1E7VA 2BWFA 2IY0B 3OLMD 4OVUA 3VUYA 2YVCA 1GJZA 2M0XA 4LJPB 5J18A 1SGHA 4I6PA 2B3AA 2NBUA 2UYZB 5LXHA 2IZVB 2N7EA 1H4RA 4IC7B 2KQ7A 2Z0DB 2C60A 1IP9A 3DOWA 3RULA 3X23A 1TZ1A 2FIDA 1GNUA 2KJRA 2LVQA 2MBQA 4G3XB 4OVVA 3RD2A 2FAZA 3PS6A 2KWCA 1D3ZA 2NR2A 2XK5B 3L54A 5EDSA 2IO2B 4GSWA 3QK0A 2CHZA 3ZKJC 4WAAA 2LASA 5E6PA 4GGQA 1OQYA 4II3B 4CO7A 1XT9B 2KJHB 3X0WA 3B0AA 3MTNB 4ZYNA 1WF9A 2XK5A 3IVFA 5JZEB 1E8WA 4K7SA 5CHFA 3ZW3A 2CKHB 2EMSA 3QC8B 2LVOA 3ZRCA 3N30A 3PGEA 3JYUA 3CF6E 3KH0A 3NY5A 4NQKE 2DZKA 4BKGA 2RGFA 2IO0B 3CSTA 3RCZA 1WJ4A 2RD0A 2M4NA 4BVUC 2L76A 3RYTA 1ZW7A 3TBLD 4DHJD 2O2VB 2KDFB 4W9GA 2KD0A 2N7DA 4AOFA 2AWTA 1E8YA 1V49A 1HE8A 3HHMA 3PHXB 4LJOB 4KZCA 2MW5A 3GZNI 4IM0A 1WYWB 2KDIA 2KC1A 2KLCA 2VRRB 3KYCD 3OAWA 5G2NA 2M17A 2NCNA 3PSEB 2D2QA 3ZNHB 2FCNA 2AYOB 3VFKA 4BKSD 1EF1A 3HM6X 4RM9A 4DHZE 2CHWA 1WJ6A 2J7QB 1YX5B 2LGDA 2N1WA 3AU5A 1LXDA 4ICUA 1UZXB 4EZJA 2M8SA 3V6EB 4AP4C 3ZTDA 2LRUA 4E3CA 4BFRA 1WZ0A 1WX7A 5CX3A 5DPWA 3NOBA 3PZDA 1FXTB 3NZSA 5D7GA 4EOYA 3ZVVA 2FCMA 2JZ3B 4N9F4 2WWZA 2BF8B 2L0FA 1AARA 1A5RA 5DPRA 4I6LB 2O6VD 4IM3A 3EHVA 2KZRA 3A4SC 4BKTA 4NQLB 4NAWB 3ZLZA 2KTRB 1Q1OA 3PRZA 4GDKB 2WX1A 1UD7A 4ZRJA 1L7YA 4NJ7A 2C7HA 3TMPB 4DBGA 3V62A 1WM3A 3GOEA 3JVZX 4ANVA 3DBHI 2LZ6A 3M62B 3RZFA 4IWOA 1PQSA 2KDBA 4FADA 2GMIC 3PRMB 4WJPA 3DVGX 4BOZB 2KTFA 4HLEA 3M3JA 1F9JA 4BKSA 4F8CB 5L83A 2MQJA 3B08A 3IHPC 4FJYA 2MP2A 2ZVOA 2XBBC 4KSKC 4NAWA 2DX5B 2KVRA 1M94A 3EECA 4GDKA 4P7IA 1WGRA 5CTRC 4CYEA 3AU4A 2V4LA 4PS7A 1WE6A 4IW0A 2V1YA 1KLVA 3PVLA 4WJQA 2O6VA 1V5TA 1Z5SB 3OJ4B 3QARA 5LXIB 2HJ8A 2WX0A 5AEKB 4B6WA 2JPHA 3VUWA 3W1SA 4KIKB 3LJ3A 3ZO5B 3JSVB 1SE9A 2KANA 4M0WB 3KVFB 1G6JA 3A9JB 4FJVB 5D94A 1I35A 3UGBB 2LVPA 4FULA 1ZKHA 2KX0A 1KM7A 4F7ZA 2L00B 4JL9A 1P1AA 4MM3A 3L08A 3C0RB 1WY8A 2D11A 2MBOA 1WJNA 5AZHA 2N4FA 4KZ0A 2K1FA 2BPSA 4KIKA 4B95A 5HKHA 1J0GA 3JSVA 1WMHB 3DBSA 1TGZB 4W9FA 2GBNA 3UIOB 4JLCA 1V9JA 2KWUB 3VTUA 3A9JA 2WYQA 1WJUA 2KQSA 2CU1A 2K39A 1WR6E 4DWFA 1RLFA 5KHOA 2KNBA 3QHTA 2ZNVC 3AI5A 3H7SA 4DHZB 5JHBA 1ISNA 2LXAA 1P0RA 1V5OA 4FN2A 3HIZA 1WX9A 1R4NI 2D07B 1J19A 4ZRKA 4YL8A 4DXAB 1P98A 2KWVB 1WMHA 2C7NB 1WI0A 1WXMA 2ZJDA 2ZZPB 3DDCB 4DDGD 5JHAA 4ZRIA 4WJNA 1CMXB 4FA6A 3PREA 2PE6B 2KDEB 4HCPB 5DPTA 3UQAA 3KYDD 3DVGY 4G0NB 2NBWB 4PS3A 5BO4B 1WGDA 4HK2A 1OEYA 5DPSA 1NDDA 1WXAA 3PHWB 3QIJA 2AL6A 1Y8RC 3NZUA 2MSED 2GBKA 4IG7B 3UQBA 1OGWA 2MA9B 4W9LA 4PS8A 4W9CA 2KHWB 3KUCB 3Q3JA 4A3PA 4BBNF 2QHOA 4CHKA 2JF5A 2KN5A 1IYFA 4G11A 4HDQA 1JRUA 2JUOA 2DHZA 1WR1A 1V2YA 3H6NA 2DAFA 2KKCA 1P9DU 4MDKE 4MJSB 2WDTB 4K7UA 2JVCA 2JXXA 4AJWA 4MH0E 1TBEA 1EUVB 3O65B 4GN1A 4F1SA 2C7MB 2MBEA 3V60A 3R66C 4X57B 1E7UA 1WZ3A 4HPLB 3TIXA 1WGHA 4MELA 2V3SA 3L16A 2O2VA 4GDLB 3RT3B 4WJOA 4LDTB 1WXSA 3ZNGC 2HTHA 2KK8A 4MJSA 1UBQA 3EFUA 3R7RA 3MJWA 1WFYA 4FHJA 1K8RB 3DVNU 4RM8A 2L3ZA 3DCGA 1U4AA 4ANXA 2JWZA 5GMVA 3UIPB 1YD8U 3K9OB 3UF8A 1IPGA 5IA7A 3DBRI 4JIOU 4GXBA 3PV1A 3WA0A 2ZPNA 3VQIA 2DENB 2LI5A 1GUAB 4EUTA 1UELA 2MCNB 3WAMA 2G3QB 3ZNZB 4MEMA 1E8ZA 2LWPA 3QQ8B 1E8XA 4GMVA 4IM2A 2KMCA 3QCAA 2MRPA 4E74A 2KJ6A 2K8BA 3DVNV 2OOBB 3BINA 4URKA 4GOCA 4NJ6A 1YJ1A 3D32A 2KTRA 2OJRA 3A1QB 4MSQB 3QJZA 4J6IA 3ZRFA 3A4RA 1OTRB 2FCSA 2KFKB 3ZNID 3H9DA 4TV3A 2BWES 4W9EA 4EZKA 4LCDE 3VAWA 3H7PB 1SIFA 2LGXA 4MGYE 5E6NA 2G45B 2BYEA 2C5LC 4IWQA 3ALBA 1V80A 4EZLA 2BYVE 4W9IA 1GC6A 3VH4B 2DYOA 2FUHB 2K6DB 4FJZA 4W9HA 2W9NA 2KFKA 1WM2A 2KC2A 3ENEA 1NI2A 4HCNB 1C3TA 4IUMB 2D10A 2DZIA 1VD2A 2CR5A 2ASQA 1YX6B 3IBEA 2Z0EB 4EKUA 3QA8A 4WQOB 3Q3FA 4EFOA 2ZVNA 1WGGA 4JGHB 1Z2MA 3AXCA 2LGYA 3AULA 3TCAA 2JT4B 3ZDMC 5J2RA 3VHTC 4GU2A 3ZDTA 3U30A 2GOWA 2MX2A 3M63B 2IO3B 1BT0A 3HM3A 3UINB 3K9PB 4K1RB 5CHWA 3SHQA 1EF5A 4K7WA 4G50A 3CMMB 1Q5WB 2DYBA 2L8JA 2M1MA 4A3OA 3PRPB 3QAQA 2KOXA 2I1JA 3L10B 1V86A 2BGFA 2KFJA 3B1LX 3R3MA 1YIWA 4W9DA 2EMTA 5D6JB 2ZCCA 3VDZA 5LLIA 3V61A 2AEHA 4NPNA 2KLGA 1MG8A 2LXCA 5DCNA 1I42A 3N32A 5FR6A 4W9KA 2J0KA 4E71A 2HE7A 1WRDB 3ML9A 3R7QA 4HPMB 2D3GA 2N9PC 4IWPA 4WWNA 4AUQC 2BYFA 3T9LA 3KW5B 4XX5A 1GC7A 3PLUA 2ZEQA 4I6NB 3ZIMA 2KX3A 4KDLB 3I3TB 1UH6A 4GIVA 5E6OA 4HWIB 4KSLC 4MGIE 2PJHA 1LFDA 1Q0WB 2KO3A 4ANWA 2R2OA 1GG3A 2L05A 2DAJA 1OEYJ 3QX1A 4JQWC 3RZWC 4MGKE 3M95A 4NNJB 2IYDB 4LDTD 2MLBA 3WAPA 3ZTCA 4RMAA 1VCBA 1WIAA 4ICVA 3A33B 1V81A 2GBJA 2I1KA 3WIMA 1EO6A 3U7DA 1T0YA 3DPDA 4XZ4A 2L0TA 2ZNVB 1V6EA 5KHQA 3V6CB 2C9WB 3VTWA 4KVGB 3A9KB 2JY6A 3S2AA 3WANA 2PPHA 4EEWA 1J8CA 2N1VA 3PLVA 4TQ0A 1LM8B 2LJ5A 1UBIA 3ZUNA 1NBFC 4BBNC 1UGMA 2MWSB 4WWOA 1ZGUB 4HJKA 3T8MA 5C23A 4MGZE 4DK5A 4ZDVA 2IY1B 2CS4A 3W1SC 1WGYA 2EKEC 3A9KA 4MSMB 1L2NA 4GDLA 2FIFA 2DYMA 2GBMA 3VTVA 2XEWA 4FLHA 2KXJA 2JZZA 2NVUI 2BKFA 1P3QU 2K25A 2UWQA 3MHSD 3QWZB 3VH3B 4DHJB 4A20A 2FNJB 3APFA 2ZPYA 2PEAA 4K81A 2DZJA 2R2QA 3KUDB 3NS8A 3PTFC 2MBBB 4M8NA 3SD5A 3VVWB 4HXDA 3L0WB 2Y5BB 4ANUA 4KDIC 3TJPA 5AZFA 2MBHA 1X1MA 2BKRB 1YQBA 5G55A 3LDZE 2A5UA 5C1ZA 5D2MB 3TL5A 1WX8A 1H8CA 2DZMA 2LUEA 5IAAC 4TQ1A 2G4SA 2MP2B 2JRIB 4TKNA 1TTNA 4HDOA 2GBRA 4II2B 4PYZA 4TUUA 4W9JA 2REXA 3P2BA 3PT2B 3EC8A 2NPTB 1RAXA 2Z59B 2PE9A 3ONSA 2LRWA 3IG3A 3U8ZA 3NHEB 2ZCBA 1C1YB 1WXVA 3A1QA 2YLMA 5L95C 2O6VB 2G4DB 1RFAA 3RUIB 4B9KA 1R4MI 2K8CA 3DQVA 4BOSC 2IO1B 3WALA 2IBIB 3N3KB 3ML8A 4AWJA 2K8HA 3BY4B 3H7PA 2K6QA 1E5WA 1S3SG 4NY0A 1RRBA 3IFWB 2NS5A 3APCA 4AJYB 2NPTA 1KOTA 5JH5C 3DBLI 3JW0X 3L17A 4WWPA 1LQBA 4KV2A 1KJTA 3WAOA 2A4ZA 3VXWA 4M8MA 5CHVC 4ASWC 3L13A 1WE7A 1XD3B 2KMAA 1E90A 2RPQA 1S1QB 3CSFA 2L7RA 2J0JA 2HD5B 3W1YA 1WH3A 2FCQA 3OJ3A 5AZGA 3VUXA 2NBVB 3KUZA 4PYUA 4DDID 2CHXA 3PPAA 3SU8X 4HVBA 2AL3A 2JRHA 1QZEA 4GB9A 4FHKA 2N9XA 3HK0A 2N9EB
chains in the Genus database with same CATH superfamily
3APDA 4FBJB 2ON8A 3H1UA 3NRZA 4OVUA 3VUYA 3AE6B 2M0XA 5LXHA 2B3AA 2NBUA 1IP9A 3FC4A 4WAFA 5FK9C 2LVQA 3OG5A 3Q6BA 2XK5B 3L54A 3C19A 2W54A 2LASA 4GGQA 1OQYA 2MEKA 3MTNB 1WF9A 2XK5A 3IVFA 4K7SA 4C4VB 3PGEA 3CF6E 1FFVA 2QJLA 2DZKA 2MJDA 2BT6A 3CSTA 3TEWA 1TZOA 1SJED 4DHJD 4W9GA 4C7ZA 4AOFA 1V49A 4C4VA 4IKGA 4P16A 1L0YB 2KDIA 1DOIA 2R61A 2BBCA 3AE8B 3W5VB 5G2NA 1R4NB 2FCNA 3VFKA 4BAXA 1V1PA 1V97A 1LXDA 3V6EB 3BWUD 4BFRA 3PZDA 1FXTB 2QMTA 3NZSA 2WQYB 3BK2A 1FRDA 4N9F4 3EHVA 4NAWB 4OW0A 2WX1A 1L7YA 2C7HA 1FFUA 1WM3A 1RM6C 3M62B 3RZFA 1FD6A 2BB6A 3PRMB 4TMAB 4WJPA 2KDMA 3M3JA 2LUMA 2MHJA 4F8CB 1QOBA 5BYQA 3B9JA 4FJYA 4NAWA 2XBBC 4KSKC 4YXDB 5BYSA 1WE6A 4IW0A 3RPFC 4WJQA 2O6VA 3P4RB 4B6WA 2JPHA 3JSVB 1MG4A 3DBRB 3UGBB 2MJ3A 2KX0A 2L00B 2KYWA 2OJWA 3TUOA 3L08A 2INPE 4B95A 1WWTA 1L4ZB 5HKHA 1FMAD 3JSVA 3DBSA 1GPXA 2BYTA 2V3PA 5GXGB 2KAJA 1RLFA 3N1YC 4DHZB 1ISNA 1P0RA 4FN2A 3AEGB 3HIZA 1R4NI 4MT5A 1J19A 4YSYB 1NVID 5H8YE 4ZRKA 2FUG1 4D2KA 3ZJVA 2KWVB 2C7NB 4Q2JA 5JHAA 4ZRIA 4HCPB 5DPTA 3KYDD 3NVYA 4YWGG 2NBWB 3TEXA 4PS3A 1WGDA 5DPSA 1WYGA 1NDDA 2G1EA 2LHEA 3PHWB 3QIJA 2AL6A 1AWDA 2GBKA 4IG7B 1D6EC 1OGWA 4W9LA 3N9YC 3KUCB 4BBNF 2QHOA 4CHKA 2JF5A 5I4DA 4G11A 3BVGA 1KF6B 4HDQA 5JXVA 1QOFA 1SBBB 2KKCA 4USAA 3RNFC 2OEDA 4C80A 4AJWA 2BS3B 1TBEA 3O65B 2C7MB 1IUEA 2BTEA 3R66C 1WZ3A 2V3SA 1SE4A 2WNMA 2O2VA 3L16A 2LJIA 4WJOA 3EFUA 3R7RA 1WFYA 2QC8A 2L3ZA 3DCGA 2NTTA 1IPGA 1K50A 3DBRI 4R3DA 3ETRA 4FXCA 3WA0A 5BMGA 1UF0A 4M01A 3WAMA 3RNEC 1NYRA 1B9RA 1E8XA 3BK1A 4E74A 2KJ6A 2K8BA 3DVNV 1YJ1A 2HDEA 3D32A 2KTRA 2OJRA 4J6IA 1OTRB 2FCSA 1STEA 4W9EA 2BQQA 2WXMA 4MGYE 3VAWA 1ET9A 1BUIC 2C5LC 3ALBA 1GC6A 5H92C 3VH4B 1I4XA 1UNSA 3OWEB 1ZP0B 4W9HA 1MFWA 2HTME 2RPVA 1XCTL 2KC2A 3ENEA 4HCNB 4IUMB 1KLUD 2JWUA 1WXQA 2ASQA 1YJJA 3IBEA 1BMLC 5FR3A 2Z0EB 3I5JC 5HI1A 3Q3FA 2H89B 1WGGA 2LGYA 3ZDMC 4GU2A 3U30A 3M63B 1I7HA 3CMMB 1Q5WB 2WDQB 3PRPB 1AYFA 4WH4A 2I1JA 2BGFA 1IGDA 1YIWA 3VDZA 3NUHB 2AEHA 3NG0A 2J0KA 1K52A 2HE7A 1WRDB 3ML9A 4JE3B 4HPMB 2D3GA 1F2RI 2RDHA 3R7QA 4WWNA 5D3IB 4AUQC 4XX5A 1GC7A 2IGDA 2IDYA 3ZIMA 1KLGD 2K5PA 1PGBA 3EUB2 1Q0WB 4ANWA 2FE8A 4JQWC 4NNJB 1F2RC 4NAMA 4ZHOA 4RMAA 2PIAA 3GS2A 1EU3A 2JYTA 3A33B 1V81A 2I1KA 3U7DA 1M4VA 2Z8LA 1TY2A 3VTWA 3A9KB 2JY6A 2YEPB 5HG2A 1C9FA 3PLVA 3PZ7A 5IOIA 1UBIA 3PO0A 4TSSA 1MI0A 4BBNC 2MWSB 4DK5A 4MGZE 3A9KA 4MSMB 1L2NA 2GBMA 3VTVA 4MH0E 3DHIC 2BKFA 2UWQA 3APFA 4K81A 3SD5A 2Y5BB 3TJPA 2MBHA 1YQBA 5G55A 2PMVA 3LDZE 3O13A 2A5UA 5D2MB 4ARIA 3AE3B 2DZMA 5FKAC 2MP2B 4YTMB 3FAHA 4TKNA 4TUUA 4II2B 4W9JA 2REXA 3NS1A 3P2BA 4A55A 2NPTB 2RDGA 2PE9A 4DXFA 2V9HA 2ZCBA 1C1YB 1ROEA 2YLMA 3GZNB 2IGHA 1YQ3B 3PZ8A 4BOSC 3H8HA 3Q8BA 3WALA 2X8XX 4AQ7A 1XLQA 4AWJA 1T6BX 3BY4B 2LHDA 1S3SG 4NY0A 3RNAC 4AJYB 2NPTA 4WWPA 1WSPA 3VXWA 3GE8C 3L13A 1XD3B 2KMAA 1FRRA 3VUXA 2AL3A 2KWDA 1QZEA 4LNIA 3KWLA 3HK0A 1IBXB 3Q3MC 3I9V1 3SDLC 4XC2A 1JALA 4N59A 1E7VA 5G5GA 2BWFA 2IY0B 1KH0A 2YVCA 1GJZA 1N6ZA 1UUPA 4GLSC 2N7EA 3AECB 2KQ7A 2C60A 3X23A 1TZ1A 4G3XB 1A70A 2NR2A 4LNOA 5EDSA 1GB4A 1DOXA 1FNWA 1SSNA 1VZ8A 1CQVA 1N60A 1E6EB 1SB3C 1SEBD 4N58A 2XNAC 4CO7A 2WXKA 2N9KA 1XT9B 1HTOA 3B0AA 4ZYNA 2RMMA 1YJIA 5IO9A 3GE3C 5JZEB 1YNTE 3LYYA 3ZW3A 2CKHB 4M02A 1N63A 3KH0A 3NY5A 4BKGA 1SE3A 1QKZA 5C3JB 4BVUC 2M4NA 3RYTA 1ZW7A 3TBLD 3EFCA 1EM7A 3GZNI 2KLCA 3IAS1 4HKQA 2D2QA 3ZNHB 1XCQL 4DHZE 2LGDA 2N1WA 1N5XA 3AU5A 4ICUA 4RFBA 3ZTDA 2LRUA 2ICIA 4E3CA 1PYWD 1UGJA 3TEYA 3ZVVA 5AUIA 2WWZA 2BF8B 2L0FA 2WXIA 4I6LB 2O6VD 4BKTA 4NQLB 4ZYSA 2K0PA 4HEA1 2D3AA 3RNBC 3ABVB 3V62A 4FADA 3DBHI 2LZ6A 4IWOA 1PQSA 1P7EA 1F9JA 3IHPC 1E7PB 3DHGC 1UWXA 2KMMA 2DX5B 2KVRA 4P7IA 3UI3A 2V4LA 3W5UB 4A8XC 2LMCA 2V1YA 1L0XB 3OJ4B 3W1SA 3VUWA 1ZE3D 3LJ3A 2VH1A 2WHIA 3A9JB 4F7ZA 1VZ7A 1WY8A 1ZXIA 3NVZA 2SEBD 2N4FA 1TT5B 1PDXA 2RDBC 1BXTA 1WMHB 3UIOB 4JLCA 2I38A 2J4XA 1YQ4B 2KWUB 3A9JA 2WYQA 1WR6E 1TS5A 2KNBA 3QHTA 2ZNVC 3AI5A 1EU4A 3H7SA 4O1NA 2LGIA 2D07B 4OHJA 3W2DA 1JCKB 1WMHA 1WI0A 1T5XD 1WXMA 4WJNA 1CMXB 3BYYB 2EELA 1VLBA 1YN3A 4RGMA 3SFEB 1D5ZC 1OEYA 1WXAA 1R4MB 4YSZB 2MSED 3UQBA 1NENB 1F1HA 4XDDA 2KHWB 2INDC 2KN4A 1EWYC 3VR8B 4RNAA 3H6NA 1XO3A 4MDKE 1YN5A 2JXXA 4XGAB 1R7SA 4CQNA 4F1SA 2AQ2B 1WGHA 4MELA 2IPKD 4LLGM 3WCQA 3RT3B 2QCZA 4NZLB 2D3CA 2BS4B 1HXYD 1WXSA 1FXAA 2HTHA 4UDUC 2KK8A 3I57A 1FIQA 2W3SA 3MJWA 4KGRA 1XEEA 3AE7B 3AEFB 1D5MC 3UIPB 1XLNA 3NVWA 2N9LA 4QAYA 5IA7A 4GXBA 2QIEB 2WXPA 2ZPNA 2DENB 2LI5A 1GUAB 1YMHE 2MCNB 1SXTA 3AE4B 4XWWA 1C4CA 2OOBB 3BINA 4GOCA 4NJ6A 2DBYA 1JQ4A 1FO4A 1ZOYB 4EE2A 2MH7A 1LGRA 1ZXHA 1SIFA 4RF0A 4W9IA 2K6DB 1XLOA 1VRAB 2ACZB 1D5XC 4FJZA 3R2IA 1QILA 4OZAA 2DZIA 2CR5A 5BMIA 1YX6B 4EKUA 3IT4B 3N20C 4JGHB 2WU5B 2PVGC 3AE5B 2JT4B 1JWSD 5J2RA 1VJKA 1ZDXA 3BYTB 2GOWA 2MX2A 3P42A 1BT0A 2HJ1A 1PFDA 5CHWA 2QEJC 3TSSA 2DYBA 2M1MA 2KOXA 1V86A 3B1LX 2EMTA 1TIFA 2IJ0A 3BZDB 5LLIA 4NPNA 2WS3B 2WXJA 2BVCA 1N62A 3E9SA 1QF6A 1L5PA 1OQQA 3AEDB 1V1OA 2KX3A 2QILA 4MGIE 4MH8A 1K53A 3P1MA 1L6UA 4C7YA 3RZWC 4MGKE 2IYDB 4LDTD 1VCBA 2CJOA 3Q3NC 3IXSA 3T3NA 2J42A 3MP9A 1T0YA 3AEBB 5KHQA 3V6CB 2C9WB 4KVGB 2UU7A 3S2AA 3WANA 2M0AA 3T3OA 2LJ5A 1QOGA 2BW2A 4HJKA 4ZDVA 1NYQA 3Q8CA 2FIFA 4HPPA 1C77A 2L83A 2XEWA 1L0VB 1DGJA 2JZZA 2NVUI 1P3QU 1ZDVA 3MHSD 3VH3B 4DHJB 4A20A 3B2FA 1FCCC 2VZKB 2DZJA 2D3BA 1MVKA 1T0SC 3KUDB 2MBBB 4HXDA 2V3NA 5C1ZA 2D5GA 4OZCA 1WX8A 1H8CA 5IAAC 1T0QC 2JRIB 2V4IB 3URYA 2VH2A 4HDOA 3L4PA 1DYQA 3EC8A 3RMKC 1KTKA 2Z59B 3MFGA 2LRWA 3NHEB 1ESFA 3ZXRA 3RUIB 3E56A 2IO1B 3TEZA 3IT6B 1I4QA 3ZXVA 3U4EG 1RRBA 3IFWB 1KOTA 3APCA 1C78A 4JWSC 3JW0X 3L17A 2V0GA 1LQBA 4KV2A 1KJTA 2A4ZA 4M8MA 3Q8AA 1VR9A 4MM3B 1E90A 2RPQA 1S1QB 2BB5A 2L7RA 2J0JA 3W1YA 1WH3A 1XF5L 3LXFA 1JWAD 2NBVB 4DDID 2CHXA 3SU8X 1N5WA 1RYJA 1XXGA 2J0MA 2RSUA 4B0EA 5TR5A 1TKGA 4ZRPA 5J17A 3SEBA 2LD9A 3AM9A 3OLMD 4REZA 1MHHE 3AN1A 5J18A 1I4HA 1SGHA 1F52A 2IZVB 4IC7B 3DOWA 3RULA 1J7CA 2FIDA 1GNUA 3RD2A 3AH7A 2KWCA 3HRDD 3P63A 1ACCA 2IO2B 3QK0A 2CHZA 2I2YA 3ZKJC 2W3RA 1JWBD 1RWSA 1B1ZA 5EE3A 2KJHB 3X0WA 4HROA 2IGGA 2JQRB 4ZRQA 2EMSA 2LVOA 3ZRCA 4S17A 2RGFA 2IO0B 3RCZA 2RD0A 4XDCA 3GP7A 1YN4A 2KDFB 1JROA 1I4RA 1PGXA 2KD0A 2N7DA 2AWTA 1E8YA 4WWMA 4LJOB 1HE8A 3HHMA 2MW5A 4IM0A 2KC1A 3OAWA 2WXHA 2GI9A 3VRBB 1EF1A 3HM6X 4RM9A 2J7QB 4RCOA 1YX5B 4EZJA 2M8SA 4AP4C 5BMHA 1WX7A 5CX3A 5DPWA 2K22A 4EOYA 2JZ3B 2Q5WD 1A5RA 3EA6A 1TS4A 2KZRA 2CJNA 3ZLZA 1UD7A 4ZRJA 4NJ7A 4AS1A 3GOEA 4ANVA 2JXTA 2KDBA 3DVGX 1CJEA 2WP9B 4BKSA 5L83A 2MQJA 2MP2A 2ZVOA 3EECA 1E10A 5CTRC 4CYEA 3J9CA 3AU4A 2DLBA 2QSDA 4J3OD 1V5TA 1Z5SB 4KGTA 5LXIB 2WLBA 2Y5CA 4KIKB 1E9MA 4PT5A 3KVFB 3Q69A 1F0ZA 4IDIA 5D94A 1I35A 4MACA 2LVPA 4FULA 4YTNB 1RFKA 4JL9A 4RGOS 3MC9A 3C0RB 2MBOA 5LNK1 1WJNA 4KZ0A 1J0GA 4KIKA 2N0SB 4W9FA 2L32A 1TGZB 3RN9C 2GBNA 3NZ3A 4LNFA 1HZ6A 2CU1A 4DWFA 5JHBA 2LXAA 1IBXA 2J52A 2QDFA 1DOYA 4YL8A 4DXAB 2WDVB 4DDGD 2ZZPB 2WXQA 3DDCB 3GB1A 1JWUD 1OFFA 4US9A 2PE6B 4P1CC 2WXGA 4P6VF 1C79A 5BO4B 3NZUA 4K3CA 2INNE 4PS8A 4W9CA 2TSSA 3Q3JA 4A3PA 3Q2AC 3DBLB 4C00A 1TYGB 1JRUA 2JUOA 3N1ZC 1WR1A 1V2YA 4MJSB 2WDTB 4K7UA 3AB5A 3V60A 4HPLB 4GDLB 3U52E 4JPSA 2INCC 4MJSA 4FHJA 4PK1A 4RM8A 2WU2B 4ANXA 5GMVA 3UF8A 1L6VA 2XN9C 3R8BA 1CZPA 3HVZA 3ZNZB 1D4BA 1FM0D 2W82A 3QCAA 2MRPA 2H88B 3AMZA 4WURA 3AEEB 4URKA 4LNKA 3Q14C 3A1QB 3QJZA 4JWUC 1HZ5A 3A4RA 4S0RA 4HJGE 1YOVB 3ZNID 3H9DA 3NVVA 2BWES 4LCDE 3H7PB 5E6NA 1EWCA 2G45B 2KQ4X 4IWQA 4EZLA 3CWIA 1PGAA 2DYOA 2FUHB 5AUKA 4IOIE 1FPYA 2W9NA 1WM2A 5EE9A 1NI2A 2D10A 3QA8A 3AE1B 4EFOA 4KX6B 4YT0B 3FILB 3UINB 4LNNA 4LK0M 3K9PB 3VR9B 1EF5A 4G50A 3B2GA 4JX1C 3ZGZA 2L8JA 4A3OA 4ARCA 3QAQA 1SIJA 3R3MA 3V05A 2AQ3B 3V61A 1I42A 5FR6A 4W9KA 1GAQB 4E71A 2N9PC 4IWPA 3T9LA 4KKIA 4ACFA 3PLUA 2WXNA 4I6NB 4KDLB 3I3TB 1JWMD 5E6OA 4HWIB 4XWTA 1LFDA 2KO3A 2L05A 2DAJA 1OEYJ 3QX1A 4C56C 2W55A 3NJTA 1TY0A 3WAPA 1WIAA 1WRIA 3Q8EA 4BZAA 4XZ4A 2L0TA 1ZPSA 3RNGC 2PPHA 2N1VA 3ZUNA 2G9HD 2X38A 1NBFC 1SE2A 1V1PB 2VZKD 4WWOA 2PVOD 3R2TA 1FNVA 3W1SC 1WGYA 4YSXB 1J7AA 4FLHA 1CK1A 1KFYB 2K9XA 3LB8C 3QWZB 1VZ6A 2ZPYA 3ZJTA 3RNCC 3NS8A 3VVWB 4ANUA 4KDIC 5AZFA 1X1MA 1JRPA 2BKRB 2JSVX 4A90A 4HRSA 3TL5A 4TQ1A 2G4SA 3VRAB 1NEKB 2GBRA 5IKCM 4RF1A 2B76B 1E0ZA 3U8ZA 5L95C 2O6VB 1HQRD 4B9KA 2KT7A 1R4MI 2K8CA 2IBIB 3N3KB 3ML8A 2K8HA 2KACA 2K6QA 2K3UA 2NS5A 5JH5C 3MJ5A 3WAOA 4L2YA 4ASWC 4XE0A 2E3TA 2FCQA 3OJ3A 5G5HA 5AZGA 3KUZA 2JRHA 4GB9A 4FHKA 4P1BC 2DNFA 4X57B 2N9EB 2RR9A 3ECIA 2M19A 1XQQA 4LJPB 1HTQA 4I6PA 2UYZB 1H4RA 2Z0DB 1TJEA 2KJRA 2MBQA 4OVVA 2FAZA 3PS6A 1D3ZA 4GSWA 1TKEA 4WAAA 4RH6A 5E6PA 4II3B 4H2AA 1TS3A 2EKIA 1E8WA 5CHFA 1QLBB 1T3QA 3QC8B 2L52A 3N30A 3JYUA 1J7BA 4NQKE 2WXFA 1WJ4A 2L76A 1MHXA 2O2VB 4KZCA 3PHXB 3C8YA 1WYWB 2VRRB 3KYCD 2M17A 2NCNA 1ZUD2 3PSEB 2AYOB 1MJDA 4BKSD 2CHWA 1WJ6A 1T0RC 1FNUA 2L1AA 1UZXB 5D3DA 3U7ZA 1ET6A 1WZ0A 3NOBA 3P4SB 5D7GA 2FCMA 1GOZA 1AARA 4IM3A 3A4SC 2KTRB 1Q1OA 2N7JA 3PRZA 3DHHC 4GDKB 4WQMA 3TMPB 4DBGA 3JVZX 2GMIC 4BOZB 2Y5PA 4HLEA 2KTFA 1WGKA 4WIPA 1Y56A 3B08A 3AE9B 2WXLA 4B0MA 5DPRA 1M94A 4GDKA 2LEKA 1WGRA 1QQRA 2JX5A 1Q10A 4PS7A 1I4PA 1I4GA 1KLVA 3PVLA 5T8IA 1LO5D 3QARA 2M56B 2HJ8A 2WX0A 5AEKB 1KRHA 1SF0A 3ZO5B 1SE9A 2KANA 4M0WB 2YEPF 3AEAB 4FJVB 2CU3A 1ZKHA 1KM7A 1P1AA 4MM3A 2D11A 5AZHA 2K1FA 2BPSA 3AE2B 4M0WA 1V9JA 5TSSA 3KQ4A 3N1XC 3VTUA 1WJUA 2KQSA 2K39A 3HUIA 5KHOA 1V5OA 3KLSX 1WX9A 3MHZA 1IGCA 1P98A 2ZJDA 1C4PA 4FA6A 3PREA 2KDEB 3UQAA 3DVGY 4G0NB 4HK2A 4KGSA 4ITKA 4A9AA 1Y8RC 2JZPA 2MA9B 1C4AA 1QOAA 3DWGC 3V3XA 4US8A 2LFIA 1QT9A 2KN5A 1IYFA 1FCLA 5IP4D 2DHZA 2DAFA 1P9DU 4M00A 2JVCA 3U2SC 1EUVB 1SJHD 4GN1A 1PUTA 2MBEA 3FKYA 3SR6A 1E7UA 3TIXA 3IAM1 4LDTB 3ZNGC 1UBQA 4DXGA 1K8RB 1JMLA 3DVNU 3ZYYX 1U4AA 3W9CB 2JWZA 1GB1A 1YD8U 3K9OB 4ZHPA 4JIOU 3PV1A 1OQRA 3VQIA 4YTPB 4EUTA 1UELA 3AV8A 2G3QB 1F77A 2ZW1A 1E8ZA 3QQ8B 1NI3A 2LWPA 2WXOA 4GMVA 4IM2A 4MEMA 5EE0A 2GB1A 2KMCA 1V8CA 3Q3OC 3DWMA 2JYEA 1HA5A 4MSQB 3ZRFA 2KFKB 2PKOA 5HFYA 2GRIA 3RI7C 4TV3A 3SFDB 4EZKA 2LGXA 2BYEA 1V80A 2BYVE 4HKZE 1UWMA 2KFKA 1XLPA 1C3TA 2AX5A 2LGSA 1VD2A 5BYRA 4WQOB 2ZVNA 1Z2MA 3AXCA 3TCAA 3AULA 1JW9D 1N61A 1VDVA 3VHTC 3ZDTA 1TS2A 5C2TB 5E6JA 2IO3B 3HM3A 4OZBA 4K1RB 4RGTA 3SHQA 4K7WA 2E6XA 4K3BA 1K51A 2PTLA 3P4PB 2PW9A 3L10B 2KFJA 4L1BA 3EGRA 4W9DA 3I63C 5D6JB 2ZCCA 3P4QB 2ZW0A 4L23A 3DBHB 4LTUA 2KLGA 1MG8A 2LXCA 5DCNA 2NMQA 3N32A 3HVDA 2SAKA 2Y3AA 2NTSA 3CIRB 2OHFA 2BYFA 3ZJUA 3KW5B 5HHDG 2ZEQA 2GLSA 4OVZA 1UH6A 4GIVA 4KSLC 2PJHA 4NJCA 2R2OA 1GG3A 2MJEA 3M95A 2MLBA 3ZTCA 1FXIA 2FBWB 4ICVA 2GBJA 3WIMA 1EO6A 2PLPA 3DPDA 3RFZB 2ZNVB 1V6EA 3BVZA 1J8CA 4EEWA 3MC0B 4TQ0A 1LM8B 5EE1A 1UGMA 3BVMA 1ZGUB 3T8MA 1TKYA 5C23A 2DWQA 2IY1B 2CS4A 2EKEC 1AN8A 4GDLA 2DYMA 2WXRA 2KXJA 1G6JA 2K25A 5IN7A 2FNJB 3MC8A 2PEAA 1HEZE 2R2QA 3PTFC 4M8NA 3L0WB 2WGSA 3BIID 3ZQ4A 4XYCA 1MPEA 1P7FA 2LUEA 2ONQA 2JU6X 4DQOC 1TTNA 4PYZA 2BS2B 3PT2B 1RAXA 3ONSA 4N6EB 3IG3A 1WXVA 3A1QA 2G4DB 1RFAA 4KKJA 3DQVA 5MPOA 4RGNA 1L4DB 2AQ1B 2J53A 3KWVA 3H7PA 1E5WA 3DBLI 3Q8FA 2KVZA 5CHVC 1C76A 1ENFA 1FEHA 1WE7A 3CSFA 1AW7A 2HD5B 2WDRB 4HVBA 4PYUA 3PPAA 4A6QA 3FILA 2N9XA 4ZOHC
chains in the Genus database with same CATH topology
2J0MA 2RSUA 3APDA 3SDLC 2RR9A 5TR5A 4FBJB 3ECIA 5J17A 3H1UA 1XQQA 4XC2A 2LD9A 1E7VA 2BWFA 2IY0B 3OLMD 4OVUA 3VUYA 2YVCA 1GJZA 2M0XA 4LJPB 5J18A 1SGHA 4I6PA 2B3AA 2NBUA 2UYZB 5LXHA 2IZVB 2N7EA 1H4RA 4IC7B 2KQ7A 2Z0DB 2C60A 1IP9A 3DOWA 3RULA 3X23A 1TZ1A 2FIDA 1GNUA 2KJRA 2LVQA 2MBQA 4G3XB 4OVVA 3RD2A 2FAZA 3PS6A 2KWCA 1D3ZA 2NR2A 2XK5B 3L54A 5EDSA 2IO2B 4GSWA 3QK0A 2CHZA 3ZKJC 4WAAA 2LASA 5E6PA 4GGQA 1OQYA 4II3B 4CO7A 1XT9B 2KJHB 3X0WA 3B0AA 3MTNB 4ZYNA 1WF9A 2XK5A 3IVFA 5JZEB 1E8WA 4K7SA 5CHFA 3ZW3A 2CKHB 2EMSA 3QC8B 2LVOA 3ZRCA 3N30A 3PGEA 3JYUA 3CF6E 3KH0A 3NY5A 4NQKE 2DZKA 4BKGA 2RGFA 2IO0B 3CSTA 3RCZA 1WJ4A 2RD0A 2M4NA 4BVUC 2L76A 3RYTA 1ZW7A 3TBLD 4DHJD 2O2VB 2KDFB 4W9GA 2KD0A 2N7DA 4AOFA 2AWTA 1E8YA 1V49A 1HE8A 3HHMA 3PHXB 4LJOB 4KZCA 2MW5A 3GZNI 4IM0A 1WYWB 2KDIA 2KC1A 2KLCA 2VRRB 3KYCD 3OAWA 5G2NA 2M17A 2NCNA 3PSEB 2D2QA 3ZNHB 2FCNA 2AYOB 3VFKA 4BKSD 1EF1A 3HM6X 4RM9A 4DHZE 2CHWA 1WJ6A 2J7QB 1YX5B 2LGDA 2N1WA 3AU5A 1LXDA 4ICUA 1UZXB 4EZJA 2M8SA 3V6EB 4AP4C 3ZTDA 2LRUA 4E3CA 4BFRA 1WZ0A 1WX7A 5CX3A 5DPWA 3NOBA 3PZDA 1FXTB 3NZSA 5D7GA 4EOYA 3ZVVA 2FCMA 2JZ3B 4N9F4 2WWZA 2BF8B 2L0FA 1AARA 1A5RA 5DPRA 4I6LB 2O6VD 4IM3A 3EHVA 2KZRA 3A4SC 4BKTA 4NQLB 4NAWB 3ZLZA 2KTRB 1Q1OA 3PRZA 4GDKB 2WX1A 1UD7A 4ZRJA 1L7YA 4NJ7A 2C7HA 3TMPB 4DBGA 3V62A 1WM3A 3GOEA 3JVZX 4ANVA 3DBHI 2LZ6A 3M62B 3RZFA 4IWOA 1PQSA 2KDBA 4FADA 2GMIC 3PRMB 4WJPA 3DVGX 4BOZB 2KTFA 4HLEA 3M3JA 1F9JA 4BKSA 4F8CB 5L83A 2MQJA 3B08A 3IHPC 4FJYA 2MP2A 2ZVOA 2XBBC 4KSKC 4NAWA 2DX5B 2KVRA 1M94A 3EECA 4GDKA 4P7IA 1WGRA 5CTRC 4CYEA 3AU4A 2V4LA 4PS7A 1WE6A 4IW0A 2V1YA 1KLVA 3PVLA 4WJQA 2O6VA 1V5TA 1Z5SB 3OJ4B 3QARA 5LXIB 2HJ8A 2WX0A 5AEKB 4B6WA 2JPHA 3VUWA 3W1SA 4KIKB 3LJ3A 3ZO5B 3JSVB 1SE9A 2KANA 4M0WB 3KVFB 1G6JA 3A9JB 4FJVB 5D94A 1I35A 3UGBB 2LVPA 4FULA 1ZKHA 2KX0A 1KM7A 4F7ZA 2L00B 4JL9A 1P1AA 4MM3A 3L08A 3C0RB 1WY8A 2D11A 2MBOA 1WJNA 5AZHA 2N4FA 4KZ0A 2K1FA 2BPSA 4KIKA 4B95A 5HKHA 1J0GA 3JSVA 1WMHB 3DBSA 1TGZB 4W9FA 2GBNA 3UIOB 4JLCA 1V9JA 2KWUB 3VTUA 3A9JA 2WYQA 1WJUA 2KQSA 2CU1A 2K39A 1WR6E 4DWFA 1RLFA 5KHOA 2KNBA 3QHTA 2ZNVC 3AI5A 3H7SA 4DHZB 5JHBA 1ISNA 2LXAA 1P0RA 1V5OA 4FN2A 3HIZA 1WX9A 1R4NI 2D07B 1J19A 4ZRKA 4YL8A 4DXAB 1P98A 2KWVB 1WMHA 2C7NB 1WI0A 1WXMA 2ZJDA 2ZZPB 3DDCB 4DDGD 5JHAA 4ZRIA 4WJNA 1CMXB 4FA6A 3PREA 2PE6B 2KDEB 4HCPB 5DPTA 3UQAA 3KYDD 3DVGY 4G0NB 2NBWB 4PS3A 5BO4B 1WGDA 4HK2A 1OEYA 5DPSA 1NDDA 1WXAA 3PHWB 3QIJA 2AL6A 1Y8RC 3NZUA 2MSED 2GBKA 4IG7B 3UQBA 1OGWA 2MA9B 4W9LA 4PS8A 4W9CA 2KHWB 3KUCB 3Q3JA 4A3PA 4BBNF 2QHOA 4CHKA 2JF5A 2KN5A 1IYFA 4G11A 4HDQA 1JRUA 2JUOA 2DHZA 1WR1A 1V2YA 3H6NA 2DAFA 2KKCA 1P9DU 4MDKE 4MJSB 2WDTB 4K7UA 2JVCA 2JXXA 4AJWA 4MH0E 1TBEA 1EUVB 3O65B 4GN1A 4F1SA 2C7MB 2MBEA 3V60A 3R66C 4X57B 1E7UA 1WZ3A 4HPLB 3TIXA 1WGHA 4MELA 2V3SA 3L16A 2O2VA 4GDLB 3RT3B 4WJOA 4LDTB 1WXSA 3ZNGC 2HTHA 2KK8A 4MJSA 1UBQA 3EFUA 3R7RA 3MJWA 1WFYA 4FHJA 1K8RB 3DVNU 4RM8A 2L3ZA 3DCGA 1U4AA 4ANXA 2JWZA 5GMVA 3UIPB 1YD8U 3K9OB 3UF8A 1IPGA 5IA7A 3DBRI 4JIOU 4GXBA 3PV1A 3WA0A 2ZPNA 3VQIA 2DENB 2LI5A 1GUAB 4EUTA 1UELA 2MCNB 3WAMA 2G3QB 3ZNZB 4MEMA 1E8ZA 2LWPA 3QQ8B 1E8XA 4GMVA 4IM2A 2KMCA 3QCAA 2MRPA 4E74A 2KJ6A 2K8BA 3DVNV 2OOBB 3BINA 4URKA 4GOCA 4NJ6A 1YJ1A 3D32A 2KTRA 2OJRA 3A1QB 4MSQB 3QJZA 4J6IA 3ZRFA 3A4RA 1OTRB 2FCSA 2KFKB 3ZNID 3H9DA 4TV3A 2BWES 4W9EA 4EZKA 4LCDE 3VAWA 3H7PB 1SIFA 2LGXA 4MGYE 5E6NA 2G45B 2BYEA 2C5LC 4IWQA 3ALBA 1V80A 4EZLA 2BYVE 4W9IA 1GC6A 3VH4B 2DYOA 2FUHB 2K6DB 4FJZA 4W9HA 2W9NA 2KFKA 1WM2A 2KC2A 3ENEA 1NI2A 4HCNB 1C3TA 4IUMB 2D10A 2DZIA 1VD2A 2CR5A 2ASQA 1YX6B 3IBEA 2Z0EB 4EKUA 3QA8A 4WQOB 3Q3FA 4EFOA 2ZVNA 1WGGA 4JGHB 1Z2MA 3AXCA 2LGYA 3AULA 3TCAA 2JT4B 3ZDMC 5J2RA 3VHTC 4GU2A 3ZDTA 3U30A 2GOWA 2MX2A 3M63B 2IO3B 1BT0A 3HM3A 3UINB 3K9PB 4K1RB 5CHWA 3SHQA 1EF5A 4K7WA 4G50A 3CMMB 1Q5WB 2DYBA 2L8JA 2M1MA 4A3OA 3PRPB 3QAQA 2KOXA 2I1JA 3L10B 1V86A 2BGFA 2KFJA 3B1LX 3R3MA 1YIWA 4W9DA 2EMTA 5D6JB 2ZCCA 3VDZA 5LLIA 3V61A 2AEHA 4NPNA 2KLGA 1MG8A 2LXCA 5DCNA 1I42A 3N32A 5FR6A 4W9KA 2J0KA 4E71A 2HE7A 1WRDB 3ML9A 3R7QA 4HPMB 2D3GA 2N9PC 4IWPA 4WWNA 4AUQC 2BYFA 3T9LA 3KW5B 4XX5A 1GC7A 3PLUA 2ZEQA 4I6NB 3ZIMA 2KX3A 4KDLB 3I3TB 1UH6A 4GIVA 5E6OA 4HWIB 4KSLC 4MGIE 2PJHA 1LFDA 1Q0WB 2KO3A 4ANWA 2R2OA 1GG3A 2L05A 2DAJA 1OEYJ 3QX1A 4JQWC 3RZWC 4MGKE 3M95A 4NNJB 2IYDB 4LDTD 2MLBA 3WAPA 3ZTCA 4RMAA 1VCBA 1WIAA 4ICVA 3A33B 1V81A 2GBJA 2I1KA 3WIMA 1EO6A 3U7DA 1T0YA 3DPDA 4XZ4A 2L0TA 2ZNVB 1V6EA 5KHQA 3V6CB 2C9WB 3VTWA 4KVGB 3A9KB 2JY6A 3S2AA 3WANA 2PPHA 4EEWA 1J8CA 2N1VA 3PLVA 4TQ0A 1LM8B 2LJ5A 1UBIA 3ZUNA 1NBFC 4BBNC 1UGMA 2MWSB 4WWOA 1ZGUB 4HJKA 3T8MA 5C23A 4MGZE 4DK5A 4ZDVA 2IY1B 2CS4A 3W1SC 1WGYA 2EKEC 3A9KA 4MSMB 1L2NA 4GDLA 2FIFA 2DYMA 2GBMA 3VTVA 2XEWA 4FLHA 2KXJA 2JZZA 2NVUI 2BKFA 1P3QU 2K25A 2UWQA 3MHSD 3QWZB 3VH3B 4DHJB 4A20A 2FNJB 3APFA 2ZPYA 2PEAA 4K81A 2DZJA 2R2QA 3KUDB 3NS8A 3PTFC 2MBBB 4M8NA 3SD5A 3VVWB 4HXDA 3L0WB 2Y5BB 4ANUA 4KDIC 3TJPA 5AZFA 2MBHA 1X1MA 2BKRB 1YQBA 5G55A 3LDZE 2A5UA 5C1ZA 5D2MB 3TL5A 1WX8A 1H8CA 2DZMA 2LUEA 5IAAC 4TQ1A 2G4SA 2MP2B 2JRIB 4TKNA 1TTNA 4HDOA 2GBRA 4II2B 4PYZA 4TUUA 4W9JA 2REXA 3P2BA 3PT2B 3EC8A 2NPTB 1RAXA 2Z59B 2PE9A 3ONSA 2LRWA 3IG3A 3U8ZA 3NHEB 2ZCBA 1C1YB 1WXVA 3A1QA 2YLMA 5L95C 2O6VB 2G4DB 1RFAA 3RUIB 4B9KA 1R4MI 2K8CA 3DQVA 4BOSC 2IO1B 3WALA 2IBIB 3N3KB 3ML8A 4AWJA 2K8HA 3BY4B 3H7PA 2K6QA 1E5WA 1S3SG 4NY0A 1RRBA 3IFWB 2NS5A 3APCA 4AJYB 2NPTA 1KOTA 5JH5C 3DBLI 3JW0X 3L17A 4WWPA 1LQBA 4KV2A 1KJTA 3WAOA 2A4ZA 3VXWA 4M8MA 5CHVC 4ASWC 3L13A 1WE7A 1XD3B 2KMAA 1E90A 2RPQA 1S1QB 3CSFA 2L7RA 2J0JA 2HD5B 3W1YA 1WH3A 2FCQA 3OJ3A 5AZGA 3VUXA 2NBVB 3KUZA 4PYUA 4DDID 2CHXA 3PPAA 3SU8X 4HVBA 2AL3A 2JRHA 1QZEA 4GB9A 4FHKA 2N9XA 3HK0A 2N9EB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2J0M A;  2RSU A;  3APD A;  3SDL C;  2RR9 A;  5TR5 A;  4FBJ B;  3ECI A;  5J17 A;  3H1U A;  1XQQ A;  4XC2 A;  2LD9 A;  1E7V A;  2BWF A;  2IY0 B;  3OLM D;  4OVU A;  3VUY A;  2YVC A;  1GJZ A;  2M0X A;  4LJP B;  5J18 A;  1SGH A;  4I6P A;  2B3A A;  2NBU A;  2UYZ B;  5LXH A;  2IZV B;  2N7E A;  1H4R A;  4IC7 B;  2KQ7 A;  2Z0D B;  2C60 A;  1IP9 A;  3DOW A;  3RUL A;  3X23 A;  1TZ1 A;  2FID A;  1GNU A;  2KJR A;  2LVQ A;  2MBQ A;  4G3X B;  4OVV A;  3RD2 A;  2FAZ A;  3PS6 A;  2KWC A;  1D3Z A;  2NR2 A;  2XK5 B;  3L54 A;  5EDS A;  2IO2 B;  4GSW A;  3QK0 A;  2CHZ A;  3ZKJ C;  4WAA A;  2LAS A;  5E6P A;  4GGQ A;  1OQY A;  4II3 B;  4CO7 A;  1XT9 B;  2KJH B;  3X0W A;  3B0A A;  3MTN B;  4ZYN A;  1WF9 A;  2XK5 A;  3IVF A;  5JZE B;  1E8W A;  4K7S A;  5CHF A;  3ZW3 A;  2CKH B;  2EMS A;  3QC8 B;  2LVO A;  3ZRC A;  3N30 A;  3PGE A;  3JYU A;  3CF6 E;  3KH0 A;  3NY5 A;  4NQK E;  2DZK A;  4BKG A;  2RGF A;  2IO0 B;  3CST A;  3RCZ A;  1WJ4 A;  2RD0 A;  2M4N A;  4BVU C;  2L76 A;  3RYT A;  1ZW7 A;  3TBL D;  4DHJ D;  2O2V B;  2KDF B;  4W9G A;  2KD0 A;  2N7D A;  4AOF A;  2AWT A;  1E8Y A;  1V49 A;  1HE8 A;  3HHM A;  3PHX B;  4LJO B;  4KZC A;  2MW5 A;  3GZN I;  4IM0 A;  1WYW B;  2KDI A;  2KC1 A;  2KLC A;  2VRR B;  3KYC D;  3OAW A;  5G2N A;  2M17 A;  2NCN A;  3PSE B;  2D2Q A;  3ZNH B;  2FCN A;  2AYO B;  3VFK A;  4BKS D;  1EF1 A;  3HM6 X;  4RM9 A;  4DHZ E;  2CHW A;  1WJ6 A;  2J7Q B;  1YX5 B;  2LGD A;  2N1W A;  3AU5 A;  1LXD A;  4ICU A;  1UZX B;  4EZJ A;  2M8S A;  3V6E B;  4AP4 C;  3ZTD A;  2LRU A;  4E3C A;  4BFR A;  1WZ0 A;  1WX7 A;  5CX3 A;  5DPW A;  3NOB A;  3PZD A;  1FXT B;  3NZS A;  5D7G A;  4EOY A;  3ZVV A;  2FCM A;  2JZ3 B;  4N9F 4;  2WWZ A;  2BF8 B;  2L0F A;  1AAR A;  1A5R A;  5DPR A;  4I6L B;  2O6V D;  4IM3 A;  3EHV A;  2KZR A;  3A4S C;  4BKT A;  4NQL B;  4NAW B;  3ZLZ A;  2KTR B;  1Q1O A;  3PRZ A;  4GDK B;  2WX1 A;  1UD7 A;  4ZRJ A;  1L7Y A;  4NJ7 A;  2C7H A;  3TMP B;  4DBG A;  3V62 A;  1WM3 A;  3GOE A;  3JVZ X;  4ANV A;  3DBH I;  2LZ6 A;  3M62 B;  3RZF A;  4IWO A;  1PQS A;  2KDB A;  4FAD A;  2GMI C;  3PRM B;  4WJP A;  3DVG X;  4BOZ B;  2KTF A;  4HLE A;  3M3J A;  1F9J A;  4BKS A;  4F8C B;  5L83 A;  2MQJ A;  3B08 A;  3IHP C;  4FJY A;  2MP2 A;  2ZVO A;  2XBB C;  4KSK C;  4NAW A;  2DX5 B;  2KVR A;  1M94 A;  3EEC A;  4GDK A;  4P7I A;  1WGR A;  5CTR C;  4CYE A;  3AU4 A;  2V4L A;  4PS7 A;  1WE6 A;  4IW0 A;  2V1Y A;  1KLV A;  3PVL A;  4WJQ A;  2O6V A;  1V5T A;  1Z5S B;  3OJ4 B;  3QAR A;  5LXI B;  2HJ8 A;  2WX0 A;  5AEK B;  4B6W A;  2JPH A;  3VUW A;  3W1S A;  4KIK B;  3LJ3 A;  3ZO5 B;  3JSV B;  1SE9 A;  2KAN A;  4M0W B;  3KVF B;  1G6J A;  3A9J B;  4FJV B;  5D94 A;  1I35 A;  3UGB B;  2LVP A;  4FUL A;  1ZKH A;  2KX0 A;  1KM7 A;  4F7Z A;  2L00 B;  4JL9 A;  1P1A A;  4MM3 A;  3L08 A;  3C0R B;  1WY8 A;  2D11 A;  2MBO A;  1WJN A;  5AZH A;  2N4F A;  4KZ0 A;  2K1F A;  2BPS A;  4KIK A;  4B95 A;  5HKH A;  1J0G A;  3JSV A;  1WMH B;  3DBS A;  1TGZ B;  4W9F A;  2GBN A;  3UIO B;  4JLC A;  1V9J A;  2KWU B;  3VTU A;  3A9J A;  2WYQ A;  1WJU A;  2KQS A;  2CU1 A;  2K39 A;  1WR6 E;  4DWF A;  1RLF A;  5KHO A;  2KNB A;  3QHT A;  2ZNV C;  3AI5 A;  3H7S A;  4DHZ B;  5JHB A;  1ISN A;  2LXA A;  1P0R A;  1V5O A;  4FN2 A;  3HIZ A;  1WX9 A;  1R4N I;  2D07 B;  1J19 A;  4ZRK A;  4YL8 A;  4DXA B;  1P98 A;  2KWV B;  1WMH A;  2C7N B;  1WI0 A;  1WXM A;  2ZJD A;  2ZZP B;  3DDC B;  4DDG D;  5JHA A;  4ZRI A;  4WJN A;  1CMX B;  4FA6 A;  3PRE A;  2PE6 B;  2KDE B;  4HCP B;  5DPT A;  3UQA A;  3KYD D;  3DVG Y;  4G0N B;  2NBW B;  4PS3 A;  5BO4 B;  1WGD A;  4HK2 A;  1OEY A;  5DPS A;  1NDD A;  1WXA A;  3PHW B;  3QIJ A;  2AL6 A;  1Y8R C;  3NZU A;  2MSE D;  2GBK A;  4IG7 B;  3UQB A;  1OGW A;  2MA9 B;  4W9L A;  4PS8 A;  4W9C A;  2KHW B;  3KUC B;  3Q3J A;  4A3P A;  4BBN F;  2QHO A;  4CHK A;  2JF5 A;  2KN5 A;  1IYF A;  4G11 A;  4HDQ A;  1JRU A;  2JUO A;  2DHZ A;  1WR1 A;  1V2Y A;  3H6N A;  2DAF A;  2KKC A;  1P9D U;  4MDK E;  4MJS B;  2WDT B;  4K7U A;  2JVC A;  2JXX A;  4AJW A;  4MH0 E;  1TBE A;  1EUV B;  3O65 B;  4GN1 A;  4F1S A;  2C7M B;  2MBE A;  3V60 A;  3R66 C;  4X57 B;  1E7U A;  1WZ3 A;  4HPL B;  3TIX A;  1WGH A;  4MEL A;  2V3S A;  3L16 A;  2O2V A;  4GDL B;  3RT3 B;  4WJO A;  4LDT B;  1WXS A;  3ZNG C;  2HTH A;  2KK8 A;  4MJS A;  1UBQ A;  3EFU A;  3R7R A;  3MJW A;  1WFY A;  4FHJ A;  1K8R B;  3DVN U;  4RM8 A;  2L3Z A;  3DCG A;  1U4A A;  4ANX A;  2JWZ A;  5GMV A;  3UIP B;  1YD8 U;  3K9O B;  3UF8 A;  1IPG A;  5IA7 A;  3DBR I;  4JIO U;  4GXB A;  3PV1 A;  3WA0 A;  2ZPN A;  3VQI A;  2DEN B;  2LI5 A;  1GUA B;  4EUT A;  1UEL A;  2MCN B;  3WAM A;  2G3Q B;  3ZNZ B;  4MEM A;  1E8Z A;  2LWP A;  3QQ8 B;  1E8X A;  4GMV A;  4IM2 A;  2KMC A;  3QCA A;  2MRP A;  4E74 A;  2KJ6 A;  2K8B A;  3DVN V;  2OOB B;  3BIN A;  4URK A;  4GOC A;  4NJ6 A;  1YJ1 A;  3D32 A;  2KTR A;  2OJR A;  3A1Q B;  4MSQ B;  3QJZ A;  4J6I A;  3ZRF A;  3A4R A;  1OTR B;  2FCS A;  2KFK B;  3ZNI D;  3H9D A;  4TV3 A;  2BWE S;  4W9E A;  4EZK A;  4LCD E;  3VAW A;  3H7P B;  1SIF A;  2LGX A;  4MGY E;  5E6N A;  2G45 B;  2BYE A;  2C5L C;  4IWQ A;  3ALB A;  1V80 A;  4EZL A;  2BYV E;  4W9I A;  1GC6 A;  3VH4 B;  2DYO A;  2FUH B;  2K6D B;  4FJZ A;  4W9H A;  2W9N A;  2KFK A;  1WM2 A;  2KC2 A;  3ENE A;  1NI2 A;  4HCN B;  1C3T A;  4IUM B;  2D10 A;  2DZI A;  1VD2 A;  2CR5 A;  2ASQ A;  1YX6 B;  3IBE A;  2Z0E B;  4EKU A;  3QA8 A;  4WQO B;  3Q3F A;  4EFO A;  2ZVN A;  1WGG A;  4JGH B;  1Z2M A;  3AXC A;  2LGY A;  3AUL A;  3TCA A;  2JT4 B;  3ZDM C;  5J2R A;  3VHT C;  4GU2 A;  3ZDT A;  3U30 A;  2GOW A;  2MX2 A;  3M63 B;  2IO3 B;  1BT0 A;  3HM3 A;  3UIN B;  3K9P B;  4K1R B;  5CHW A;  3SHQ A;  1EF5 A;  4K7W A;  4G50 A;  3CMM B;  1Q5W B;  2DYB A;  2L8J A;  2M1M A;  4A3O A;  3PRP B;  3QAQ A;  2KOX A;  2I1J A;  3L10 B;  1V86 A;  2BGF A;  2KFJ A;  3B1L X;  3R3M A;  1YIW A;  4W9D A;  2EMT A;  5D6J B;  2ZCC A;  3VDZ A;  5LLI A;  3V61 A;  2AEH A;  4NPN A;  2KLG A;  1MG8 A;  2LXC A;  5DCN A;  1I42 A;  3N32 A;  5FR6 A;  4W9K A;  2J0K A;  4E71 A;  2HE7 A;  1WRD B;  3ML9 A;  3R7Q A;  4HPM B;  2D3G A;  2N9P C;  4IWP A;  4WWN A;  4AUQ C;  2BYF A;  3T9L A;  3KW5 B;  4XX5 A;  1GC7 A;  3PLU A;  2ZEQ A;  4I6N B;  3ZIM A;  2KX3 A;  4KDL B;  3I3T B;  1UH6 A;  4GIV A;  5E6O A;  4HWI B;  4KSL C;  4MGI E;  2PJH A;  1LFD A;  1Q0W B;  2KO3 A;  4ANW A;  2R2O A;  1GG3 A;  2L05 A;  2DAJ A;  1OEY J;  3QX1 A;  4JQW C;  3RZW C;  4MGK E;  3M95 A;  4NNJ B;  2IYD B;  4LDT D;  2MLB A;  3WAP A;  3ZTC A;  4RMA A;  1VCB A;  1WIA A;  4ICV A;  3A33 B;  1V81 A;  2GBJ A;  2I1K A;  3WIM A;  1EO6 A;  3U7D A;  1T0Y A;  3DPD A;  4XZ4 A;  2L0T A;  2ZNV B;  1V6E A;  5KHQ A;  3V6C B;  2C9W B;  3VTW A;  4KVG B;  3A9K B;  2JY6 A;  3S2A A;  3WAN A;  2PPH A;  4EEW A;  1J8C A;  2N1V A;  3PLV A;  4TQ0 A;  1LM8 B;  2LJ5 A;  1UBI A;  3ZUN A;  1NBF C;  4BBN C;  1UGM A;  2MWS B;  4WWO A;  1ZGU B;  4HJK A;  3T8M A;  5C23 A;  4MGZ E;  4DK5 A;  4ZDV A;  2IY1 B;  2CS4 A;  3W1S C;  1WGY A;  2EKE C;  3A9K A;  4MSM B;  1L2N A;  4GDL A;  2FIF A;  2DYM A;  2GBM A;  3VTV A;  2XEW A;  4FLH A;  2KXJ A;  2JZZ A;  2NVU I;  2BKF A;  1P3Q U;  2K25 A;  2UWQ A;  3MHS D;  3QWZ B;  3VH3 B;  4DHJ B;  4A20 A;  2FNJ B;  3APF A;  2ZPY A;  2PEA A;  4K81 A;  2DZJ A;  2R2Q A;  3KUD B;  3NS8 A;  3PTF C;  2MBB B;  4M8N A;  3SD5 A;  3VVW B;  4HXD A;  3L0W B;  2Y5B B;  4ANU A;  4KDI C;  3TJP A;  5AZF A;  2MBH A;  1X1M A;  2BKR B;  1YQB A;  5G55 A;  3LDZ E;  2A5U A;  5C1Z A;  5D2M B;  3TL5 A;  1WX8 A;  1H8C A;  2DZM A;  2LUE A;  5IAA C;  4TQ1 A;  2G4S A;  2MP2 B;  2JRI B;  4TKN A;  1TTN A;  4HDO A;  2GBR A;  4II2 B;  4PYZ A;  4TUU A;  4W9J A;  2REX A;  3P2B A;  3PT2 B;  3EC8 A;  2NPT B;  1RAX A;  2Z59 B;  2PE9 A;  3ONS A;  2LRW A;  3IG3 A;  3U8Z A;  3NHE B;  2ZCB A;  1C1Y B;  1WXV A;  3A1Q A;  2YLM A;  5L95 C;  2O6V B;  2G4D B;  1RFA A;  3RUI B;  4B9K A;  1R4M I;  2K8C A;  3DQV A;  4BOS C;  2IO1 B;  3WAL A;  2IBI B;  3N3K B;  3ML8 A;  4AWJ A;  2K8H A;  3BY4 B;  3H7P A;  2K6Q A;  1E5W A;  1S3S G;  4NY0 A;  1RRB A;  3IFW B;  2NS5 A;  3APC A;  4AJY B;  2NPT A;  1KOT A;  5JH5 C;  3DBL I;  3JW0 X;  3L17 A;  4WWP A;  1LQB A;  4KV2 A;  1KJT A;  3WAO A;  2A4Z A;  3VXW A;  4M8M A;  5CHV C;  4ASW C;  3L13 A;  1WE7 A;  1XD3 B;  2KMA A;  1E90 A;  2RPQ A;  1S1Q B;  3CSF A;  2L7R A;  2J0J A;  2HD5 B;  3W1Y A;  1WH3 A;  2FCQ A;  3OJ3 A;  5AZG A;  3VUX A;  2NBV B;  3KUZ A;  4PYU A;  4DDI D;  2CHX A;  3PPA A;  3SU8 X;  4HVB A;  2AL3 A;  2JRH A;  1QZE A;  4GB9 A;  4FHK A;  2N9X A;  3HK0 A;  2N9E B; 
#chains in the Genus database with same CATH topology
 3APD A;  4FBJ B;  2ON8 A;  3H1U A;  3NRZ A;  4OVU A;  3VUY A;  3AE6 B;  2M0X A;  5LXH A;  2B3A A;  2NBU A;  1IP9 A;  3FC4 A;  4WAF A;  5FK9 C;  2LVQ A;  3OG5 A;  3Q6B A;  2XK5 B;  3L54 A;  3C19 A;  2W54 A;  2LAS A;  4GGQ A;  1OQY A;  2MEK A;  3MTN B;  1WF9 A;  2XK5 A;  3IVF A;  4K7S A;  4C4V B;  3PGE A;  3CF6 E;  1FFV A;  2QJL A;  2DZK A;  2MJD A;  2BT6 A;  3CST A;  3TEW A;  1TZO A;  1SJE D;  4DHJ D;  4W9G A;  4C7Z A;  4AOF A;  1V49 A;  4C4V A;  4IKG A;  4P16 A;  1L0Y B;  2KDI A;  1DOI A;  2R61 A;  2BBC A;  3AE8 B;  3W5V B;  5G2N A;  1R4N B;  2FCN A;  3VFK A;  4BAX A;  1V1P A;  1V97 A;  1LXD A;  3V6E B;  3BWU D;  4BFR A;  3PZD A;  1FXT B;  2QMT A;  3NZS A;  2WQY B;  3BK2 A;  1FRD A;  4N9F 4;  3EHV A;  4NAW B;  4OW0 A;  2WX1 A;  1L7Y A;  2C7H A;  1FFU A;  1WM3 A;  1RM6 C;  3M62 B;  3RZF A;  1FD6 A;  2BB6 A;  3PRM B;  4TMA B;  4WJP A;  2KDM A;  3M3J A;  2LUM A;  2MHJ A;  4F8C B;  1QOB A;  5BYQ A;  3B9J A;  4FJY A;  4NAW A;  2XBB C;  4KSK C;  4YXD B;  5BYS A;  1WE6 A;  4IW0 A;  3RPF C;  4WJQ A;  2O6V A;  3P4R B;  4B6W A;  2JPH A;  3JSV B;  1MG4 A;  3DBR B;  3UGB B;  2MJ3 A;  2KX0 A;  2L00 B;  2KYW A;  2OJW A;  3TUO A;  3L08 A;  2INP E;  4B95 A;  1WWT A;  1L4Z B;  5HKH A;  1FMA D;  3JSV A;  3DBS A;  1GPX A;  2BYT A;  2V3P A;  5GXG B;  2KAJ A;  1RLF A;  3N1Y C;  4DHZ B;  1ISN A;  1P0R A;  4FN2 A;  3AEG B;  3HIZ A;  1R4N I;  4MT5 A;  1J19 A;  4YSY B;  1NVI D;  5H8Y E;  4ZRK A;  2FUG 1;  4D2K A;  3ZJV A;  2KWV B;  2C7N B;  4Q2J A;  5JHA A;  4ZRI A;  4HCP B;  5DPT A;  3KYD D;  3NVY A;  4YWG G;  2NBW B;  3TEX A;  4PS3 A;  1WGD A;  5DPS A;  1WYG A;  1NDD A;  2G1E A;  2LHE A;  3PHW B;  3QIJ A;  2AL6 A;  1AWD A;  2GBK A;  4IG7 B;  1D6E C;  1OGW A;  4W9L A;  3N9Y C;  3KUC B;  4BBN F;  2QHO A;  4CHK A;  2JF5 A;  5I4D A;  4G11 A;  3BVG A;  1KF6 B;  4HDQ A;  5JXV A;  1QOF A;  1SBB B;  2KKC A;  4USA A;  3RNF C;  2OED A;  4C80 A;  4AJW A;  2BS3 B;  1TBE A;  3O65 B;  2C7M B;  1IUE A;  2BTE A;  3R66 C;  1WZ3 A;  2V3S A;  1SE4 A;  2WNM A;  2O2V A;  3L16 A;  2LJI A;  4WJO A;  3EFU A;  3R7R A;  1WFY A;  2QC8 A;  2L3Z A;  3DCG A;  2NTT A;  1IPG A;  1K50 A;  3DBR I;  4R3D A;  3ETR A;  4FXC A;  3WA0 A;  5BMG A;  1UF0 A;  4M01 A;  3WAM A;  3RNE C;  1NYR A;  1B9R A;  1E8X A;  3BK1 A;  4E74 A;  2KJ6 A;  2K8B A;  3DVN V;  1YJ1 A;  2HDE A;  3D32 A;  2KTR A;  2OJR A;  4J6I A;  1OTR B;  2FCS A;  1STE A;  4W9E A;  2BQQ A;  2WXM A;  4MGY E;  3VAW A;  1ET9 A;  1BUI C;  2C5L C;  3ALB A;  1GC6 A;  5H92 C;  3VH4 B;  1I4X A;  1UNS A;  3OWE B;  1ZP0 B;  4W9H A;  1MFW A;  2HTM E;  2RPV A;  1XCT L;  2KC2 A;  3ENE A;  4HCN B;  4IUM B;  1KLU D;  2JWU A;  1WXQ A;  2ASQ A;  1YJJ A;  3IBE A;  1BML C;  5FR3 A;  2Z0E B;  3I5J C;  5HI1 A;  3Q3F A;  2H89 B;  1WGG A;  2LGY A;  3ZDM C;  4GU2 A;  3U30 A;  3M63 B;  1I7H A;  3CMM B;  1Q5W B;  2WDQ B;  3PRP B;  1AYF A;  4WH4 A;  2I1J A;  2BGF A;  1IGD A;  1YIW A;  3VDZ A;  3NUH B;  2AEH A;  3NG0 A;  2J0K A;  1K52 A;  2HE7 A;  1WRD B;  3ML9 A;  4JE3 B;  4HPM B;  2D3G A;  1F2R I;  2RDH A;  3R7Q A;  4WWN A;  5D3I B;  4AUQ C;  4XX5 A;  1GC7 A;  2IGD A;  2IDY A;  3ZIM A;  1KLG D;  2K5P A;  1PGB A;  3EUB 2;  1Q0W B;  4ANW A;  2FE8 A;  4JQW C;  4NNJ B;  1F2R C;  4NAM A;  4ZHO A;  4RMA A;  2PIA A;  3GS2 A;  1EU3 A;  2JYT A;  3A33 B;  1V81 A;  2I1K A;  3U7D A;  1M4V A;  2Z8L A;  1TY2 A;  3VTW A;  3A9K B;  2JY6 A;  2YEP B;  5HG2 A;  1C9F A;  3PLV A;  3PZ7 A;  5IOI A;  1UBI A;  3PO0 A;  4TSS A;  1MI0 A;  4BBN C;  2MWS B;  4DK5 A;  4MGZ E;  3A9K A;  4MSM B;  1L2N A;  2GBM A;  3VTV A;  4MH0 E;  3DHI C;  2BKF A;  2UWQ A;  3APF A;  4K81 A;  3SD5 A;  2Y5B B;  3TJP A;  2MBH A;  1YQB A;  5G55 A;  2PMV A;  3LDZ E;  3O13 A;  2A5U A;  5D2M B;  4ARI A;  3AE3 B;  2DZM A;  5FKA C;  2MP2 B;  4YTM B;  3FAH A;  4TKN A;  4TUU A;  4II2 B;  4W9J A;  2REX A;  3NS1 A;  3P2B A;  4A55 A;  2NPT B;  2RDG A;  2PE9 A;  4DXF A;  2V9H A;  2ZCB A;  1C1Y B;  1ROE A;  2YLM A;  3GZN B;  2IGH A;  1YQ3 B;  3PZ8 A;  4BOS C;  3H8H A;  3Q8B A;  3WAL A;  2X8X X;  4AQ7 A;  1XLQ A;  4AWJ A;  1T6B X;  3BY4 B;  2LHD A;  1S3S G;  4NY0 A;  3RNA C;  4AJY B;  2NPT A;  4WWP A;  1WSP A;  3VXW A;  3GE8 C;  3L13 A;  1XD3 B;  2KMA A;  1FRR A;  3VUX A;  2AL3 A;  2KWD A;  1QZE A;  4LNI A;  3KWL A;  3HK0 A;  1IBX B;  3Q3M C;  3I9V 1;  3SDL C;  4XC2 A;  1JAL A;  4N59 A;  1E7V A;  5G5G A;  2BWF A;  2IY0 B;  1KH0 A;  2YVC A;  1GJZ A;  1N6Z A;  1UUP A;  4GLS C;  2N7E A;  3AEC B;  2KQ7 A;  2C60 A;  3X23 A;  1TZ1 A;  4G3X B;  1A70 A;  2NR2 A;  4LNO A;  5EDS A;  1GB4 A;  1DOX A;  1FNW A;  1SSN A;  1VZ8 A;  1CQV A;  1N60 A;  1E6E B;  1SB3 C;  1SEB D;  4N58 A;  2XNA C;  4CO7 A;  2WXK A;  2N9K A;  1XT9 B;  1HTO A;  3B0A A;  4ZYN A;  2RMM A;  1YJI A;  5IO9 A;  3GE3 C;  5JZE B;  1YNT E;  3LYY A;  3ZW3 A;  2CKH B;  4M02 A;  1N63 A;  3KH0 A;  3NY5 A;  4BKG A;  1SE3 A;  1QKZ A;  5C3J B;  4BVU C;  2M4N A;  3RYT A;  1ZW7 A;  3TBL D;  3EFC A;  1EM7 A;  3GZN I;  2KLC A;  3IAS 1;  4HKQ A;  2D2Q A;  3ZNH B;  1XCQ L;  4DHZ E;  2LGD A;  2N1W A;  1N5X A;  3AU5 A;  4ICU A;  4RFB A;  3ZTD A;  2LRU A;  2ICI A;  4E3C A;  1PYW D;  1UGJ A;  3TEY A;  3ZVV A;  5AUI A;  2WWZ A;  2BF8 B;  2L0F A;  2WXI A;  4I6L B;  2O6V D;  4BKT A;  4NQL B;  4ZYS A;  2K0P A;  4HEA 1;  2D3A A;  3RNB C;  3ABV B;  3V62 A;  4FAD A;  3DBH I;  2LZ6 A;  4IWO A;  1PQS A;  1P7E A;  1F9J A;  3IHP C;  1E7P B;  3DHG C;  1UWX A;  2KMM A;  2DX5 B;  2KVR A;  4P7I A;  3UI3 A;  2V4L A;  3W5U B;  4A8X C;  2LMC A;  2V1Y A;  1L0X B;  3OJ4 B;  3W1S A;  3VUW A;  1ZE3 D;  3LJ3 A;  2VH1 A;  2WHI A;  3A9J B;  4F7Z A;  1VZ7 A;  1WY8 A;  1ZXI A;  3NVZ A;  2SEB D;  2N4F A;  1TT5 B;  1PDX A;  2RDB C;  1BXT A;  1WMH B;  3UIO B;  4JLC A;  2I38 A;  2J4X A;  1YQ4 B;  2KWU B;  3A9J A;  2WYQ A;  1WR6 E;  1TS5 A;  2KNB A;  3QHT A;  2ZNV C;  3AI5 A;  1EU4 A;  3H7S A;  4O1N A;  2LGI A;  2D07 B;  4OHJ A;  3W2D A;  1JCK B;  1WMH A;  1WI0 A;  1T5X D;  1WXM A;  4WJN A;  1CMX B;  3BYY B;  2EEL A;  1VLB A;  1YN3 A;  4RGM A;  3SFE B;  1D5Z C;  1OEY A;  1WXA A;  1R4M B;  4YSZ B;  2MSE D;  3UQB A;  1NEN B;  1F1H A;  4XDD A;  2KHW B;  2IND C;  2KN4 A;  1EWY C;  3VR8 B;  4RNA A;  3H6N A;  1XO3 A;  4MDK E;  1YN5 A;  2JXX A;  4XGA B;  1R7S A;  4CQN A;  4F1S A;  2AQ2 B;  1WGH A;  4MEL A;  2IPK D;  4LLG M;  3WCQ A;  3RT3 B;  2QCZ A;  4NZL B;  2D3C A;  2BS4 B;  1HXY D;  1WXS A;  1FXA A;  2HTH A;  4UDU C;  2KK8 A;  3I57 A;  1FIQ A;  2W3S A;  3MJW A;  4KGR A;  1XEE A;  3AE7 B;  3AEF B;  1D5M C;  3UIP B;  1XLN A;  3NVW A;  2N9L A;  4QAY A;  5IA7 A;  4GXB A;  2QIE B;  2WXP A;  2ZPN A;  2DEN B;  2LI5 A;  1GUA B;  1YMH E;  2MCN B;  1SXT A;  3AE4 B;  4XWW A;  1C4C A;  2OOB B;  3BIN A;  4GOC A;  4NJ6 A;  2DBY A;  1JQ4 A;  1FO4 A;  1ZOY B;  4EE2 A;  2MH7 A;  1LGR A;  1ZXH A;  1SIF A;  4RF0 A;  4W9I A;  2K6D B;  1XLO A;  1VRA B;  2ACZ B;  1D5X C;  4FJZ A;  3R2I A;  1QIL A;  4OZA A;  2DZI A;  2CR5 A;  5BMI A;  1YX6 B;  4EKU A;  3IT4 B;  3N20 C;  4JGH B;  2WU5 B;  2PVG C;  3AE5 B;  2JT4 B;  1JWS D;  5J2R A;  1VJK A;  1ZDX A;  3BYT B;  2GOW A;  2MX2 A;  3P42 A;  1BT0 A;  2HJ1 A;  1PFD A;  5CHW A;  2QEJ C;  3TSS A;  2DYB A;  2M1M A;  2KOX A;  1V86 A;  3B1L X;  2EMT A;  1TIF A;  2IJ0 A;  3BZD B;  5LLI A;  4NPN A;  2WS3 B;  2WXJ A;  2BVC A;  1N62 A;  3E9S A;  1QF6 A;  1L5P A;  1OQQ A;  3AED B;  1V1O A;  2KX3 A;  2QIL A;  4MGI E;  4MH8 A;  1K53 A;  3P1M A;  1L6U A;  4C7Y A;  3RZW C;  4MGK E;  2IYD B;  4LDT D;  1VCB A;  2CJO A;  3Q3N C;  3IXS A;  3T3N A;  2J42 A;  3MP9 A;  1T0Y A;  3AEB B;  5KHQ A;  3V6C B;  2C9W B;  4KVG B;  2UU7 A;  3S2A A;  3WAN A;  2M0A A;  3T3O A;  2LJ5 A;  1QOG A;  2BW2 A;  4HJK A;  4ZDV A;  1NYQ A;  3Q8C A;  2FIF A;  4HPP A;  1C77 A;  2L83 A;  2XEW A;  1L0V B;  1DGJ A;  2JZZ A;  2NVU I;  1P3Q U;  1ZDV A;  3MHS D;  3VH3 B;  4DHJ B;  4A20 A;  3B2F A;  1FCC C;  2VZK B;  2DZJ A;  2D3B A;  1MVK A;  1T0S C;  3KUD B;  2MBB B;  4HXD A;  2V3N A;  5C1Z A;  2D5G A;  4OZC A;  1WX8 A;  1H8C A;  5IAA C;  1T0Q C;  2JRI B;  2V4I B;  3URY A;  2VH2 A;  4HDO A;  3L4P A;  1DYQ A;  3EC8 A;  3RMK C;  1KTK A;  2Z59 B;  3MFG A;  2LRW A;  3NHE B;  1ESF A;  3ZXR A;  3RUI B;  3E56 A;  2IO1 B;  3TEZ A;  3IT6 B;  1I4Q A;  3ZXV A;  3U4E G;  1RRB A;  3IFW B;  1KOT A;  3APC A;  1C78 A;  4JWS C;  3JW0 X;  3L17 A;  2V0G A;  1LQB A;  4KV2 A;  1KJT A;  2A4Z A;  4M8M A;  3Q8A A;  1VR9 A;  4MM3 B;  1E90 A;  2RPQ A;  1S1Q B;  2BB5 A;  2L7R A;  2J0J A;  3W1Y A;  1WH3 A;  1XF5 L;  3LXF A;  1JWA D;  2NBV B;  4DDI D;  2CHX A;  3SU8 X;  1N5W A;  1RYJ A;  1XXG A;  2J0M A;  2RSU A;  4B0E A;  5TR5 A;  1TKG A;  4ZRP A;  5J17 A;  3SEB A;  2LD9 A;  3AM9 A;  3OLM D;  4REZ A;  1MHH E;  3AN1 A;  5J18 A;  1I4H A;  1SGH A;  1F52 A;  2IZV B;  4IC7 B;  3DOW A;  3RUL A;  1J7C A;  2FID A;  1GNU A;  3RD2 A;  3AH7 A;  2KWC A;  3HRD D;  3P63 A;  1ACC A;  2IO2 B;  3QK0 A;  2CHZ A;  2I2Y A;  3ZKJ C;  2W3R A;  1JWB D;  1RWS A;  1B1Z A;  5EE3 A;  2KJH B;  3X0W A;  4HRO A;  2IGG A;  2JQR B;  4ZRQ A;  2EMS A;  2LVO A;  3ZRC A;  4S17 A;  2RGF A;  2IO0 B;  3RCZ A;  2RD0 A;  4XDC A;  3GP7 A;  1YN4 A;  2KDF B;  1JRO A;  1I4R A;  1PGX A;  2KD0 A;  2N7D A;  2AWT A;  1E8Y A;  4WWM A;  4LJO B;  1HE8 A;  3HHM A;  2MW5 A;  4IM0 A;  2KC1 A;  3OAW A;  2WXH A;  2GI9 A;  3VRB B;  1EF1 A;  3HM6 X;  4RM9 A;  2J7Q B;  4RCO A;  1YX5 B;  4EZJ A;  2M8S A;  4AP4 C;  5BMH A;  1WX7 A;  5CX3 A;  5DPW A;  2K22 A;  4EOY A;  2JZ3 B;  2Q5W D;  1A5R A;  3EA6 A;  1TS4 A;  2KZR A;  2CJN A;  3ZLZ A;  1UD7 A;  4ZRJ A;  4NJ7 A;  4AS1 A;  3GOE A;  4ANV A;  2JXT A;  2KDB A;  3DVG X;  1CJE A;  2WP9 B;  4BKS A;  5L83 A;  2MQJ A;  2MP2 A;  2ZVO A;  3EEC A;  1E10 A;  5CTR C;  4CYE A;  3J9C A;  3AU4 A;  2DLB A;  2QSD A;  4J3O D;  1V5T A;  1Z5S B;  4KGT A;  5LXI B;  2WLB A;  2Y5C A;  4KIK B;  1E9M A;  4PT5 A;  3KVF B;  3Q69 A;  1F0Z A;  4IDI A;  5D94 A;  1I35 A;  4MAC A;  2LVP A;  4FUL A;  4YTN B;  1RFK A;  4JL9 A;  4RGO S;  3MC9 A;  3C0R B;  2MBO A;  5LNK 1;  1WJN A;  4KZ0 A;  1J0G A;  4KIK A;  2N0S B;  4W9F A;  2L32 A;  1TGZ B;  3RN9 C;  2GBN A;  3NZ3 A;  4LNF A;  1HZ6 A;  2CU1 A;  4DWF A;  5JHB A;  2LXA A;  1IBX A;  2J52 A;  2QDF A;  1DOY A;  4YL8 A;  4DXA B;  2WDV B;  4DDG D;  2ZZP B;  2WXQ A;  3DDC B;  3GB1 A;  1JWU D;  1OFF A;  4US9 A;  2PE6 B;  4P1C C;  2WXG A;  4P6V F;  1C79 A;  5BO4 B;  3NZU A;  4K3C A;  2INN E;  4PS8 A;  4W9C A;  2TSS A;  3Q3J A;  4A3P A;  3Q2A C;  3DBL B;  4C00 A;  1TYG B;  1JRU A;  2JUO A;  3N1Z C;  1WR1 A;  1V2Y A;  4MJS B;  2WDT B;  4K7U A;  3AB5 A;  3V60 A;  4HPL B;  4GDL B;  3U52 E;  4JPS A;  2INC C;  4MJS A;  4FHJ A;  4PK1 A;  4RM8 A;  2WU2 B;  4ANX A;  5GMV A;  3UF8 A;  1L6V A;  2XN9 C;  3R8B A;  1CZP A;  3HVZ A;  3ZNZ B;  1D4B A;  1FM0 D;  2W82 A;  3QCA A;  2MRP A;  2H88 B;  3AMZ A;  4WUR A;  3AEE B;  4URK A;  4LNK A;  3Q14 C;  3A1Q B;  3QJZ A;  4JWU C;  1HZ5 A;  3A4R A;  4S0R A;  4HJG E;  1YOV B;  3ZNI D;  3H9D A;  3NVV A;  2BWE S;  4LCD E;  3H7P B;  5E6N A;  1EWC A;  2G45 B;  2KQ4 X;  4IWQ A;  4EZL A;  3CWI A;  1PGA A;  2DYO A;  2FUH B;  5AUK A;  4IOI E;  1FPY A;  2W9N A;  1WM2 A;  5EE9 A;  1NI2 A;  2D10 A;  3QA8 A;  3AE1 B;  4EFO A;  4KX6 B;  4YT0 B;  3FIL B;  3UIN B;  4LNN A;  4LK0 M;  3K9P B;  3VR9 B;  1EF5 A;  4G50 A;  3B2G A;  4JX1 C;  3ZGZ A;  2L8J A;  4A3O A;  4ARC A;  3QAQ A;  1SIJ A;  3R3M A;  3V05 A;  2AQ3 B;  3V61 A;  1I42 A;  5FR6 A;  4W9K A;  1GAQ B;  4E71 A;  2N9P C;  4IWP A;  3T9L A;  4KKI A;  4ACF A;  3PLU A;  2WXN A;  4I6N B;  4KDL B;  3I3T B;  1JWM D;  5E6O A;  4HWI B;  4XWT A;  1LFD A;  2KO3 A;  2L05 A;  2DAJ A;  1OEY J;  3QX1 A;  4C56 C;  2W55 A;  3NJT A;  1TY0 A;  3WAP A;  1WIA A;  1WRI A;  3Q8E A;  4BZA A;  4XZ4 A;  2L0T A;  1ZPS A;  3RNG C;  2PPH A;  2N1V A;  3ZUN A;  2G9H D;  2X38 A;  1NBF C;  1SE2 A;  1V1P B;  2VZK D;  4WWO A;  2PVO D;  3R2T A;  1FNV A;  3W1S C;  1WGY A;  4YSX B;  1J7A A;  4FLH A;  1CK1 A;  1KFY B;  2K9X A;  3LB8 C;  3QWZ B;  1VZ6 A;  2ZPY A;  3ZJT A;  3RNC C;  3NS8 A;  3VVW B;  4ANU A;  4KDI C;  5AZF A;  1X1M A;  1JRP A;  2BKR B;  2JSV X;  4A90 A;  4HRS A;  3TL5 A;  4TQ1 A;  2G4S A;  3VRA B;  1NEK B;  2GBR A;  5IKC M;  4RF1 A;  2B76 B;  1E0Z A;  3U8Z A;  5L95 C;  2O6V B;  1HQR D;  4B9K A;  2KT7 A;  1R4M I;  2K8C A;  2IBI B;  3N3K B;  3ML8 A;  2K8H A;  2KAC A;  2K6Q A;  2K3U A;  2NS5 A;  5JH5 C;  3MJ5 A;  3WAO A;  4L2Y A;  4ASW C;  4XE0 A;  2E3T A;  2FCQ A;  3OJ3 A;  5G5H A;  5AZG A;  3KUZ A;  2JRH A;  4GB9 A;  4FHK A;  4P1B C;  2DNF A;  4X57 B;  2N9E B;  2RR9 A;  3ECI A;  2M19 A;  1XQQ A;  4LJP B;  1HTQ A;  4I6P A;  2UYZ B;  1H4R A;  2Z0D B;  1TJE A;  2KJR A;  2MBQ A;  4OVV A;  2FAZ A;  3PS6 A;  1D3Z A;  4GSW A;  1TKE A;  4WAA A;  4RH6 A;  5E6P A;  4II3 B;  4H2A A;  1TS3 A;  2EKI A;  1E8W A;  5CHF A;  1QLB B;  1T3Q A;  3QC8 B;  2L52 A;  3N30 A;  3JYU A;  1J7B A;  4NQK E;  2WXF A;  1WJ4 A;  2L76 A;  1MHX A;  2O2V B;  4KZC A;  3PHX B;  3C8Y A;  1WYW B;  2VRR B;  3KYC D;  2M17 A;  2NCN A;  1ZUD 2;  3PSE B;  2AYO B;  1MJD A;  4BKS D;  2CHW A;  1WJ6 A;  1T0R C;  1FNU A;  2L1A A;  1UZX B;  5D3D A;  3U7Z A;  1ET6 A;  1WZ0 A;  3NOB A;  3P4S B;  5D7G A;  2FCM A;  1GOZ A;  1AAR A;  4IM3 A;  3A4S C;  2KTR B;  1Q1O A;  2N7J A;  3PRZ A;  3DHH C;  4GDK B;  4WQM A;  3TMP B;  4DBG A;  3JVZ X;  2GMI C;  4BOZ B;  2Y5P A;  4HLE A;  2KTF A;  1WGK A;  4WIP A;  1Y56 A;  3B08 A;  3AE9 B;  2WXL A;  4B0M A;  5DPR A;  1M94 A;  4GDK A;  2LEK A;  1WGR A;  1QQR A;  2JX5 A;  1Q10 A;  4PS7 A;  1I4P A;  1I4G A;  1KLV A;  3PVL A;  5T8I A;  1LO5 D;  3QAR A;  2M56 B;  2HJ8 A;  2WX0 A;  5AEK B;  1KRH A;  1SF0 A;  3ZO5 B;  1SE9 A;  2KAN A;  4M0W B;  2YEP F;  3AEA B;  4FJV B;  2CU3 A;  1ZKH A;  1KM7 A;  1P1A A;  4MM3 A;  2D11 A;  5AZH A;  2K1F A;  2BPS A;  3AE2 B;  4M0W A;  1V9J A;  5TSS A;  3KQ4 A;  3N1X C;  3VTU A;  1WJU A;  2KQS A;  2K39 A;  3HUI A;  5KHO A;  1V5O A;  3KLS X;  1WX9 A;  3MHZ A;  1IGC A;  1P98 A;  2ZJD A;  1C4P A;  4FA6 A;  3PRE A;  2KDE B;  3UQA A;  3DVG Y;  4G0N B;  4HK2 A;  4KGS A;  4ITK A;  4A9A A;  1Y8R C;  2JZP A;  2MA9 B;  1C4A A;  1QOA A;  3DWG C;  3V3X A;  4US8 A;  2LFI A;  1QT9 A;  2KN5 A;  1IYF A;  1FCL A;  5IP4 D;  2DHZ A;  2DAF A;  1P9D U;  4M00 A;  2JVC A;  3U2S C;  1EUV B;  1SJH D;  4GN1 A;  1PUT A;  2MBE A;  3FKY A;  3SR6 A;  1E7U A;  3TIX A;  3IAM 1;  4LDT B;  3ZNG C;  1UBQ A;  4DXG A;  1K8R B;  1JML A;  3DVN U;  3ZYY X;  1U4A A;  3W9C B;  2JWZ A;  1GB1 A;  1YD8 U;  3K9O B;  4ZHP A;  4JIO U;  3PV1 A;  1OQR A;  3VQI A;  4YTP B;  4EUT A;  1UEL A;  3AV8 A;  2G3Q B;  1F77 A;  2ZW1 A;  1E8Z A;  3QQ8 B;  1NI3 A;  2LWP A;  2WXO A;  4GMV A;  4IM2 A;  4MEM A;  5EE0 A;  2GB1 A;  2KMC A;  1V8C A;  3Q3O C;  3DWM A;  2JYE A;  1HA5 A;  4MSQ B;  3ZRF A;  2KFK B;  2PKO A;  5HFY A;  2GRI A;  3RI7 C;  4TV3 A;  3SFD B;  4EZK A;  2LGX A;  2BYE A;  1V80 A;  2BYV E;  4HKZ E;  1UWM A;  2KFK A;  1XLP A;  1C3T A;  2AX5 A;  2LGS A;  1VD2 A;  5BYR A;  4WQO B;  2ZVN A;  1Z2M A;  3AXC A;  3TCA A;  3AUL A;  1JW9 D;  1N61 A;  1VDV A;  3VHT C;  3ZDT A;  1TS2 A;  5C2T B;  5E6J A;  2IO3 B;  3HM3 A;  4OZB A;  4K1R B;  4RGT A;  3SHQ A;  4K7W A;  2E6X A;  4K3B A;  1K51 A;  2PTL A;  3P4P B;  2PW9 A;  3L10 B;  2KFJ A;  4L1B A;  3EGR A;  4W9D A;  3I63 C;  5D6J B;  2ZCC A;  3P4Q B;  2ZW0 A;  4L23 A;  3DBH B;  4LTU A;  2KLG A;  1MG8 A;  2LXC A;  5DCN A;  2NMQ A;  3N32 A;  3HVD A;  2SAK A;  2Y3A A;  2NTS A;  3CIR B;  2OHF A;  2BYF A;  3ZJU A;  3KW5 B;  5HHD G;  2ZEQ A;  2GLS A;  4OVZ A;  1UH6 A;  4GIV A;  4KSL C;  2PJH A;  4NJC A;  2R2O A;  1GG3 A;  2MJE A;  3M95 A;  2MLB A;  3ZTC A;  1FXI A;  2FBW B;  4ICV A;  2GBJ A;  3WIM A;  1EO6 A;  2PLP A;  3DPD A;  3RFZ B;  2ZNV B;  1V6E A;  3BVZ A;  1J8C A;  4EEW A;  3MC0 B;  4TQ0 A;  1LM8 B;  5EE1 A;  1UGM A;  3BVM A;  1ZGU B;  3T8M A;  1TKY A;  5C23 A;  2DWQ A;  2IY1 B;  2CS4 A;  2EKE C;  1AN8 A;  4GDL A;  2DYM A;  2WXR A;  2KXJ A;  1G6J A;  2K25 A;  5IN7 A;  2FNJ B;  3MC8 A;  2PEA A;  1HEZ E;  2R2Q A;  3PTF C;  4M8N A;  3L0W B;  2WGS A;  3BII D;  3ZQ4 A;  4XYC A;  1MPE A;  1P7F A;  2LUE A;  2ONQ A;  2JU6 X;  4DQO C;  1TTN A;  4PYZ A;  2BS2 B;  3PT2 B;  1RAX A;  3ONS A;  4N6E B;  3IG3 A;  1WXV A;  3A1Q A;  2G4D B;  1RFA A;  4KKJ A;  3DQV A;  5MPO A;  4RGN A;  1L4D B;  2AQ1 B;  2J53 A;  3KWV A;  3H7P A;  1E5W A;  3DBL I;  3Q8F A;  2KVZ A;  5CHV C;  1C76 A;  1ENF A;  1FEH A;  1WE7 A;  3CSF A;  1AW7 A;  2HD5 B;  2WDR B;  4HVB A;  4PYU A;  3PPA A;  4A6Q A;  3FIL A;  2N9X A;  4ZOH C; 
#chains in the Genus database with same CATH homology
 2J0M A;  2RSU A;  3APD A;  3SDL C;  2RR9 A;  5TR5 A;  4FBJ B;  3ECI A;  5J17 A;  3H1U A;  1XQQ A;  4XC2 A;  2LD9 A;  1E7V A;  2BWF A;  2IY0 B;  3OLM D;  4OVU A;  3VUY A;  2YVC A;  1GJZ A;  2M0X A;  4LJP B;  5J18 A;  1SGH A;  4I6P A;  2B3A A;  2NBU A;  2UYZ B;  5LXH A;  2IZV B;  2N7E A;  1H4R A;  4IC7 B;  2KQ7 A;  2Z0D B;  2C60 A;  1IP9 A;  3DOW A;  3RUL A;  3X23 A;  1TZ1 A;  2FID A;  1GNU A;  2KJR A;  2LVQ A;  2MBQ A;  4G3X B;  4OVV A;  3RD2 A;  2FAZ A;  3PS6 A;  2KWC A;  1D3Z A;  2NR2 A;  2XK5 B;  3L54 A;  5EDS A;  2IO2 B;  4GSW A;  3QK0 A;  2CHZ A;  3ZKJ C;  4WAA A;  2LAS A;  5E6P A;  4GGQ A;  1OQY A;  4II3 B;  4CO7 A;  1XT9 B;  2KJH B;  3X0W A;  3B0A A;  3MTN B;  4ZYN A;  1WF9 A;  2XK5 A;  3IVF A;  5JZE B;  1E8W A;  4K7S A;  5CHF A;  3ZW3 A;  2CKH B;  2EMS A;  3QC8 B;  2LVO A;  3ZRC A;  3N30 A;  3PGE A;  3JYU A;  3CF6 E;  3KH0 A;  3NY5 A;  4NQK E;  2DZK A;  4BKG A;  2RGF A;  2IO0 B;  3CST A;  3RCZ A;  1WJ4 A;  2RD0 A;  2M4N A;  4BVU C;  2L76 A;  3RYT A;  1ZW7 A;  3TBL D;  4DHJ D;  2O2V B;  2KDF B;  4W9G A;  2KD0 A;  2N7D A;  4AOF A;  2AWT A;  1E8Y A;  1V49 A;  1HE8 A;  3HHM A;  3PHX B;  4LJO B;  4KZC A;  2MW5 A;  3GZN I;  4IM0 A;  1WYW B;  2KDI A;  2KC1 A;  2KLC A;  2VRR B;  3KYC D;  3OAW A;  5G2N A;  2M17 A;  2NCN A;  3PSE B;  2D2Q A;  3ZNH B;  2FCN A;  2AYO B;  3VFK A;  4BKS D;  1EF1 A;  3HM6 X;  4RM9 A;  4DHZ E;  2CHW A;  1WJ6 A;  2J7Q B;  1YX5 B;  2LGD A;  2N1W A;  3AU5 A;  1LXD A;  4ICU A;  1UZX B;  4EZJ A;  2M8S A;  3V6E B;  4AP4 C;  3ZTD A;  2LRU A;  4E3C A;  4BFR A;  1WZ0 A;  1WX7 A;  5CX3 A;  5DPW A;  3NOB A;  3PZD A;  1FXT B;  3NZS A;  5D7G A;  4EOY A;  3ZVV A;  2FCM A;  2JZ3 B;  4N9F 4;  2WWZ A;  2BF8 B;  2L0F A;  1AAR A;  1A5R A;  5DPR A;  4I6L B;  2O6V D;  4IM3 A;  3EHV A;  2KZR A;  3A4S C;  4BKT A;  4NQL B;  4NAW B;  3ZLZ A;  2KTR B;  1Q1O A;  3PRZ A;  4GDK B;  2WX1 A;  1UD7 A;  4ZRJ A;  1L7Y A;  4NJ7 A;  2C7H A;  3TMP B;  4DBG A;  3V62 A;  1WM3 A;  3GOE A;  3JVZ X;  4ANV A;  3DBH I;  2LZ6 A;  3M62 B;  3RZF A;  4IWO A;  1PQS A;  2KDB A;  4FAD A;  2GMI C;  3PRM B;  4WJP A;  3DVG X;  4BOZ B;  2KTF A;  4HLE A;  3M3J A;  1F9J A;  4BKS A;  4F8C B;  5L83 A;  2MQJ A;  3B08 A;  3IHP C;  4FJY A;  2MP2 A;  2ZVO A;  2XBB C;  4KSK C;  4NAW A;  2DX5 B;  2KVR A;  1M94 A;  3EEC A;  4GDK A;  4P7I A;  1WGR A;  5CTR C;  4CYE A;  3AU4 A;  2V4L A;  4PS7 A;  1WE6 A;  4IW0 A;  2V1Y A;  1KLV A;  3PVL A;  4WJQ A;  2O6V A;  1V5T A;  1Z5S B;  3OJ4 B;  3QAR A;  5LXI B;  2HJ8 A;  2WX0 A;  5AEK B;  4B6W A;  2JPH A;  3VUW A;  3W1S A;  4KIK B;  3LJ3 A;  3ZO5 B;  3JSV B;  1SE9 A;  2KAN A;  4M0W B;  3KVF B;  1G6J A;  3A9J B;  4FJV B;  5D94 A;  1I35 A;  3UGB B;  2LVP A;  4FUL A;  1ZKH A;  2KX0 A;  1KM7 A;  4F7Z A;  2L00 B;  4JL9 A;  1P1A A;  4MM3 A;  3L08 A;  3C0R B;  1WY8 A;  2D11 A;  2MBO A;  1WJN A;  5AZH A;  2N4F A;  4KZ0 A;  2K1F A;  2BPS A;  4KIK A;  4B95 A;  5HKH A;  1J0G A;  3JSV A;  1WMH B;  3DBS A;  1TGZ B;  4W9F A;  2GBN A;  3UIO B;  4JLC A;  1V9J A;  2KWU B;  3VTU A;  3A9J A;  2WYQ A;  1WJU A;  2KQS A;  2CU1 A;  2K39 A;  1WR6 E;  4DWF A;  1RLF A;  5KHO A;  2KNB A;  3QHT A;  2ZNV C;  3AI5 A;  3H7S A;  4DHZ B;  5JHB A;  1ISN A;  2LXA A;  1P0R A;  1V5O A;  4FN2 A;  3HIZ A;  1WX9 A;  1R4N I;  2D07 B;  1J19 A;  4ZRK A;  4YL8 A;  4DXA B;  1P98 A;  2KWV B;  1WMH A;  2C7N B;  1WI0 A;  1WXM A;  2ZJD A;  2ZZP B;  3DDC B;  4DDG D;  5JHA A;  4ZRI A;  4WJN A;  1CMX B;  4FA6 A;  3PRE A;  2PE6 B;  2KDE B;  4HCP B;  5DPT A;  3UQA A;  3KYD D;  3DVG Y;  4G0N B;  2NBW B;  4PS3 A;  5BO4 B;  1WGD A;  4HK2 A;  1OEY A;  5DPS A;  1NDD A;  1WXA A;  3PHW B;  3QIJ A;  2AL6 A;  1Y8R C;  3NZU A;  2MSE D;  2GBK A;  4IG7 B;  3UQB A;  1OGW A;  2MA9 B;  4W9L A;  4PS8 A;  4W9C A;  2KHW B;  3KUC B;  3Q3J A;  4A3P A;  4BBN F;  2QHO A;  4CHK A;  2JF5 A;  2KN5 A;  1IYF A;  4G11 A;  4HDQ A;  1JRU A;  2JUO A;  2DHZ A;  1WR1 A;  1V2Y A;  3H6N A;  2DAF A;  2KKC A;  1P9D U;  4MDK E;  4MJS B;  2WDT B;  4K7U A;  2JVC A;  2JXX A;  4AJW A;  4MH0 E;  1TBE A;  1EUV B;  3O65 B;  4GN1 A;  4F1S A;  2C7M B;  2MBE A;  3V60 A;  3R66 C;  4X57 B;  1E7U A;  1WZ3 A;  4HPL B;  3TIX A;  1WGH A;  4MEL A;  2V3S A;  3L16 A;  2O2V A;  4GDL B;  3RT3 B;  4WJO A;  4LDT B;  1WXS A;  3ZNG C;  2HTH A;  2KK8 A;  4MJS A;  1UBQ A;  3EFU A;  3R7R A;  3MJW A;  1WFY A;  4FHJ A;  1K8R B;  3DVN U;  4RM8 A;  2L3Z A;  3DCG A;  1U4A A;  4ANX A;  2JWZ A;  5GMV A;  3UIP B;  1YD8 U;  3K9O B;  3UF8 A;  1IPG A;  5IA7 A;  3DBR I;  4JIO U;  4GXB A;  3PV1 A;  3WA0 A;  2ZPN A;  3VQI A;  2DEN B;  2LI5 A;  1GUA B;  4EUT A;  1UEL A;  2MCN B;  3WAM A;  2G3Q B;  3ZNZ B;  4MEM A;  1E8Z A;  2LWP A;  3QQ8 B;  1E8X A;  4GMV A;  4IM2 A;  2KMC A;  3QCA A;  2MRP A;  4E74 A;  2KJ6 A;  2K8B A;  3DVN V;  2OOB B;  3BIN A;  4URK A;  4GOC A;  4NJ6 A;  1YJ1 A;  3D32 A;  2KTR A;  2OJR A;  3A1Q B;  4MSQ B;  3QJZ A;  4J6I A;  3ZRF A;  3A4R A;  1OTR B;  2FCS A;  2KFK B;  3ZNI D;  3H9D A;  4TV3 A;  2BWE S;  4W9E A;  4EZK A;  4LCD E;  3VAW A;  3H7P B;  1SIF A;  2LGX A;  4MGY E;  5E6N A;  2G45 B;  2BYE A;  2C5L C;  4IWQ A;  3ALB A;  1V80 A;  4EZL A;  2BYV E;  4W9I A;  1GC6 A;  3VH4 B;  2DYO A;  2FUH B;  2K6D B;  4FJZ A;  4W9H A;  2W9N A;  2KFK A;  1WM2 A;  2KC2 A;  3ENE A;  1NI2 A;  4HCN B;  1C3T A;  4IUM B;  2D10 A;  2DZI A;  1VD2 A;  2CR5 A;  2ASQ A;  1YX6 B;  3IBE A;  2Z0E B;  4EKU A;  3QA8 A;  4WQO B;  3Q3F A;  4EFO A;  2ZVN A;  1WGG A;  4JGH B;  1Z2M A;  3AXC A;  2LGY A;  3AUL A;  3TCA A;  2JT4 B;  3ZDM C;  5J2R A;  3VHT C;  4GU2 A;  3ZDT A;  3U30 A;  2GOW A;  2MX2 A;  3M63 B;  2IO3 B;  1BT0 A;  3HM3 A;  3UIN B;  3K9P B;  4K1R B;  5CHW A;  3SHQ A;  1EF5 A;  4K7W A;  4G50 A;  3CMM B;  1Q5W B;  2DYB A;  2L8J A;  2M1M A;  4A3O A;  3PRP B;  3QAQ A;  2KOX A;  2I1J A;  3L10 B;  1V86 A;  2BGF A;  2KFJ A;  3B1L X;  3R3M A;  1YIW A;  4W9D A;  2EMT A;  5D6J B;  2ZCC A;  3VDZ A;  5LLI A;  3V61 A;  2AEH A;  4NPN A;  2KLG A;  1MG8 A;  2LXC A;  5DCN A;  1I42 A;  3N32 A;  5FR6 A;  4W9K A;  2J0K A;  4E71 A;  2HE7 A;  1WRD B;  3ML9 A;  3R7Q A;  4HPM B;  2D3G A;  2N9P C;  4IWP A;  4WWN A;  4AUQ C;  2BYF A;  3T9L A;  3KW5 B;  4XX5 A;  1GC7 A;  3PLU A;  2ZEQ A;  4I6N B;  3ZIM A;  2KX3 A;  4KDL B;  3I3T B;  1UH6 A;  4GIV A;  5E6O A;  4HWI B;  4KSL C;  4MGI E;  2PJH A;  1LFD A;  1Q0W B;  2KO3 A;  4ANW A;  2R2O A;  1GG3 A;  2L05 A;  2DAJ A;  1OEY J;  3QX1 A;  4JQW C;  3RZW C;  4MGK E;  3M95 A;  4NNJ B;  2IYD B;  4LDT D;  2MLB A;  3WAP A;  3ZTC A;  4RMA A;  1VCB A;  1WIA A;  4ICV A;  3A33 B;  1V81 A;  2GBJ A;  2I1K A;  3WIM A;  1EO6 A;  3U7D A;  1T0Y A;  3DPD A;  4XZ4 A;  2L0T A;  2ZNV B;  1V6E A;  5KHQ A;  3V6C B;  2C9W B;  3VTW A;  4KVG B;  3A9K B;  2JY6 A;  3S2A A;  3WAN A;  2PPH A;  4EEW A;  1J8C A;  2N1V A;  3PLV A;  4TQ0 A;  1LM8 B;  2LJ5 A;  1UBI A;  3ZUN A;  1NBF C;  4BBN C;  1UGM A;  2MWS B;  4WWO A;  1ZGU B;  4HJK A;  3T8M A;  5C23 A;  4MGZ E;  4DK5 A;  4ZDV A;  2IY1 B;  2CS4 A;  3W1S C;  1WGY A;  2EKE C;  3A9K A;  4MSM B;  1L2N A;  4GDL A;  2FIF A;  2DYM A;  2GBM A;  3VTV A;  2XEW A;  4FLH A;  2KXJ A;  2JZZ A;  2NVU I;  2BKF A;  1P3Q U;  2K25 A;  2UWQ A;  3MHS D;  3QWZ B;  3VH3 B;  4DHJ B;  4A20 A;  2FNJ B;  3APF A;  2ZPY A;  2PEA A;  4K81 A;  2DZJ A;  2R2Q A;  3KUD B;  3NS8 A;  3PTF C;  2MBB B;  4M8N A;  3SD5 A;  3VVW B;  4HXD A;  3L0W B;  2Y5B B;  4ANU A;  4KDI C;  3TJP A;  5AZF A;  2MBH A;  1X1M A;  2BKR B;  1YQB A;  5G55 A;  3LDZ E;  2A5U A;  5C1Z A;  5D2M B;  3TL5 A;  1WX8 A;  1H8C A;  2DZM A;  2LUE A;  5IAA C;  4TQ1 A;  2G4S A;  2MP2 B;  2JRI B;  4TKN A;  1TTN A;  4HDO A;  2GBR A;  4II2 B;  4PYZ A;  4TUU A;  4W9J A;  2REX A;  3P2B A;  3PT2 B;  3EC8 A;  2NPT B;  1RAX A;  2Z59 B;  2PE9 A;  3ONS A;  2LRW A;  3IG3 A;  3U8Z A;  3NHE B;  2ZCB A;  1C1Y B;  1WXV A;  3A1Q A;  2YLM A;  5L95 C;  2O6V B;  2G4D B;  1RFA A;  3RUI B;  4B9K A;  1R4M I;  2K8C A;  3DQV A;  4BOS C;  2IO1 B;  3WAL A;  2IBI B;  3N3K B;  3ML8 A;  4AWJ A;  2K8H A;  3BY4 B;  3H7P A;  2K6Q A;  1E5W A;  1S3S G;  4NY0 A;  1RRB A;  3IFW B;  2NS5 A;  3APC A;  4AJY B;  2NPT A;  1KOT A;  5JH5 C;  3DBL I;  3JW0 X;  3L17 A;  4WWP A;  1LQB A;  4KV2 A;  1KJT A;  3WAO A;  2A4Z A;  3VXW A;  4M8M A;  5CHV C;  4ASW C;  3L13 A;  1WE7 A;  1XD3 B;  2KMA A;  1E90 A;  2RPQ A;  1S1Q B;  3CSF A;  2L7R A;  2J0J A;  2HD5 B;  3W1Y A;  1WH3 A;  2FCQ A;  3OJ3 A;  5AZG A;  3VUX A;  2NBV B;  3KUZ A;  4PYU A;  4DDI D;  2CHX A;  3PPA A;  3SU8 X;  4HVB A;  2AL3 A;  2JRH A;  1QZE A;  4GB9 A;  4FHK A;  2N9X A;  3HK0 A;  2N9E B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...