1EF5A

Solution structure of the ras-binding domain of rgl
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
88
structure length
88
Chain Sequence
EDTCIIRISVEDNNGNMYKSIMLTSQDKTPAVIQRAMSKHNLESDPAEEYELVQVISEDKELVIPDSANVFYAMNSQVNFDFILRKKN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Solution structure of the Ras-binding domain of RGL.
pubmed doi rcsb
source organism Mus musculus
molecule tags Signaling protein
molecule keywords RGL
total genus 11
structure length 88
sequence length 88
ec nomenclature
pdb deposition date 2000-02-07
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 1ef5A00
4EEWA 1GC6A 2XK5A 3TIXA 4ZRIA 3VUXA 2KWCA 1NDDA 1J0GA 2KLCA 5G55A 2I1KA 3SHQA 3RD2A 1VCBA 4BKSA 2A4ZA 2N1VA 2NR2A 4WAAA 4DHZB 1WR6E 2CU1A 1WR1A 4DDID 1SE9A 2O6VD 3A9KA 1V9JA 2LI5A 5LXHA 2HD5B 1RAXA 3CSFA 4I6NB 4XZ4A 1WGDA 3RUIB 2DZJA 2LVQA 4GOCA 4IM0A 4IM3A 1WZ3A 4AP4C 2JY6A 5AZGA 4E3CA 4GIVA 1ZKHA 4CHKA 2NBWB 4P7IA 2YVCA 3KYDD 1LFDA 2IY1B 2V4LA 1EF1A 3PRMB 2KDIA 2KZRA 3DBLI 5CHVC 3AXCA 2NS5A 2MQJA 4B95A 3V6EB 2LWPA 2ZVOA 5JHBA 3W1SA 4W9CA 2RGFA 2KDFB 1WI0A 2KFJA 2L76A 1D3ZA 2FCNA 4PS3A 1WIAA 2Z0DB 1QZEA 2UWQA 3NOBA 2DZIA 4G50A 3K9OB 4MGKE 3A4SC 2PE6B 5LLIA 4A3OA 3PHWB 3PPAA 1UBIA 4HVBA 2LXAA 3R7RA 1AARA 5KHQA 2AL3A 2KTRA 1HE8A 2D10A 1WXSA 4ZDVA 2LD9A 4WJOA 4M8NA 2AYOB 2LRUA 4WQOB 2LUEA 1E8XA 2KMAA 1EUVB 2MLBA 5C23A 3WIMA 4X57B 4HCPB 5BO4B 2G3QB 4IWOA 4LJPB 4DHZE 2KJ6A 2OOBB 3M62B 4F1SA 1WGHA 5C1ZA 4HLEA 4AWJA 2CHXA 4B9KA 1KLVA 2D3GA 3PT2B 3K9PB 2WDTB 4CYEA 4IWQA 2DYOA 4K81A 4FN2A 3ZLZA 1WXMA 3HM6X 1XQQA 2DAJA 2AEHA 2KD0A 4KDIC 5D6JB 1IPGA 3CSTA 3UQBA 4GGQA 3V6CB 3KW5B 2DYBA 2M4NA 3I3TB 3AULA 3EC8A 2IO2B 1GNUA 1WGRA 3QJZA 1VD2A 4IUMB 4KSLC 4ICVA 1J19A 1PQSA 1P9DU 3VFKA 1WGGA 3L13A 2MA9B 1WF9A 2ZNVC 3V62A 2BKRB 2KVRA 5DPTA 1XD3B 2MCNB 1V86A 1V6EA 3JW0X 2N9PC 3AU4A 3VDZA 2KOXA 2MBHA 2G4SA 3DBHI 1EF5A 2K25A 4DHJD 2KHWB 3ZNHB 3AI5A 4DHJB 4WWOA 3SDLC 2MP2B 4KVGB 1WX7A 2BKFA 4G3XB 4GMVA 2NBUA 3B08A 4E71A 3A9JA 2KX0A 4HDOA 3W1SC 3DVGY 2RD0A 2EKEC 3V61A 3KH0A 1WFYA 3L08A 2GBRA 3ZKJC 4JIOU 4ASWC 2KXJA 1CMXB 3R66C 5KHOA 2CKHB 3EHVA 4FJZA 1WGYA 2C5LC 4TV3A 3ML8A 3APDA 3PRPB 2MBEA 4IC7B 4TUUA 2JXXA 4WJNA 2DYMA 2KMCA 3UIPB 2BYVE 3IG3A 2M0XA 2FCSA 2I1JA 4FULA 2KFKB 2KTRB 2BWFA 2BWES 2ASQA 2ZZPB 4K1RB 2K8HA 1UD7A 2KJRA 3Q3JA 3ZDTA 1UELA 4MJSA 2IO3B 3L17A 4HDQA 4WWNA 1LQBA 2VRRB 3QAQA 4XX5A 1E8WA 1I35A 2IBIB 5D7GA 4JGHB 4YL8A 4K7SA 4GDKB 4IM2A 1V49A 1V81A 4AOFA 3AU5A 4W9JA 1R4MI 5CTRC 1GG3A 3DOWA 4BKGA 1LXDA 1YQBA 4NPNA 3H1UA 1YD8U 3VVWB 2WYQA 4G11A 4K7UA 4EKUA 4W9FA 2K39A 4ZRKA 1WJ4A 3RULA 3NZSA 1F9JA 1E7UA 3WA0A 4W9LA 4NJ7A 3A33B 4FHJA 2LVOA 1P0RA 2DHZA 2L8JA 4M0WB 4PS8A 1GC7A 2CR5A 3A9KB 3DBSA 4NJ6A 3PRZA 4DDGD 2LRWA 5HKHA 3VH3B 2K1FA 2L7RA 2ZCCA 4MDKE 3ONSA 3ZRFA 2KTFA 1YJ1A 2L0TA 3P2BA 2KLGA 2ZVNA 1GUAB 2KWVB 4FJVB 2J0KA 2IO1B 2KN5A 4HJKA 3TL5A 5L83A 3H7PA 2KJHB 1P98A 5JHAA 2M1MA 1TZ1A 1WY8A 3ZRCA 3M95A 2MP2A 1E90A 2BYEA 3OJ3A 3ZO5B 2NBVB 2IZVB 2L05A 2BYFA 4K7WA 5E6OA 3KUDB 5DPSA 3KYCD 3QX1A 2CHWA 3OJ4B 4RM9A 2DAFA 4MEMA 2REXA 5EDSA 4MSMB 4A3PA 3VUWA 1TBEA 4J6IA 2KNBA 3QA8A 1OTRB 4WWPA 4ZRJA 3VQIA 3H6NA 3H9DA 2XEWA 1NBFC 2HJ8A 4HCNB 2FIDA 4FLHA 1JRUA 2O2VA 4KV2A 3VHTC 2NCNA 3KUZA 3ZUNA 3KVFB 2K6QA 3HIZA 4F7ZA 1SGHA 2L00B 2MBQA 2MX2A 4WJQA 3ZTDA 1UGMA 3JVZX 1ZGUB 5CX3A 3JSVB 2HE7A 4LJOB 4GN1A 4II2B 2G45B 1RFAA 4AJYB 3NZUA 2KDEB 3PTFC 3MTNB 5CHFA 2D11A 4BKTA 4MM3A 2EMSA 2LGDA 2RPQA 4JQWC 3APFA 2JRHA 1T0YA 4MGYE 2DZKA 3DQVA 3UQAA 3ZDMC 1WXVA 2K8CA 5J17A 5E6NA 3ZNGC 2R2OA 3U8ZA 4ANVA 2J0MA 2M17A 4MGIE 4XC2A 2JPHA 3ENEA 2NPTA 2C7HA 4URKA 3RYTA 2DENB 2RSUA 3UINB 3WALA 2JF5A 4BFRA 2KKCA 1UBQA 1LM8B 2Z0EB 4HPMB 1NI2A 2C9WB 3SU8X 4F8CB 1Q1OA 1WM3A 2MRPA 2IYDB 4HK2A 5J2RA 1C1YB 1A5RA 2KANA 3R7QA 2D2QA 2O2VB 4EZKA 2ZPYA 5JZEB 1WE7A 5DPWA 2A5UA 2KX3A 3Q3FA 1WE6A 2GMIC 3D32A 4FBJB 2MSED 5L95C 4JLCA 4G0NB 1S3SG 1E5WA 4PYZA 4DXAB 1TTNA 2JT4B 3LJ3A 3RT3B 3H7SA 3VAWA 3UIOB 4JL9A 1UH6A 1E7VA 1RLFA 2G4DB 5LXIB 2PE9A 5AZFA 1OEYJ 1SIFA 3DPDA 3LDZE 4MELA 2M8SA 4W9DA 4CO7A 3EFUA 3RZWC 3U7DA 2IO0B 5JH5C 1WX9A 1WRDB 3ZNZB 2KK8A 3OLMD 1WJUA 2JWZA 4HWIB 3ZTCA 2N7EA 2EMTA 1E8ZA 1WYWB 3S2AA 4AUQC 2LASA 3ZVVA 4GSWA 2GOWA 1YIWA 2MWSB 3TBLD 3VH4B 2ZEQA 3TJPA 3VXWA 2N9XA 1UZXB 1WMHA 4GB9A 1G6JA 3NHEB 2J7QB 2FAZA 2KC2A 3B1LX 2JVCA 2K6DB 1RRBA 2Z59B 5D2MB 3W1YA 1MG8A 2DZMA 3MJWA 2XK5B 2KWUB 1WM2A 1Z5SB 2KFKA 3B0AA 2ZNVB 4FJYA 4NY0A 1P3QU 3OAWA 4KZCA 1E8YA 1WX8A 2LZ6A 2O6VA 4OVVA 3T8MA 2CS4A 4DK5A 2GBMA 4MJSB 4ZYNA 3QARA 1V80A 2D07B 3V60A 4W9GA 1Q5WB 4RM8A 3CMMB 3EECA 3ZW3A 1XT9B 2N1WA 3ZIMA 3UF8A 2KC1A 3VTUA 2PPHA 3IVFA 5DCNA 3VUYA 2W9NA 5D94A 3T9LA 1WJ6A 2JZZA 1K8RB 4IG7B 2N9EB 2PJHA 3HHMA 3VTVA 2CHZA 1OGWA 4GDLB 4TQ0A 3L16A 2ZJDA 4KIKB 1BT0A 5IAAC 1I42A 4EUTA 2KDBA 4KIKA 4NAWA 2KQ7A 3GZNI 4BBNF 4KDLB 1L2NA 3NS8A 1IP9A 2DX5B 2LXCA 4KSKC 1V5TA 2MBBB 2BF8B 2WX1A 3DDCB 4FHKA 1R4NI 2V1YA 3HM3A 3GOEA 2LGYA 2RR9A 3O65B 1YX5B 5DPRA 3PSEB 4MSQB 3TMPB 2JUOA 3L10B 4EFOA 1YX6B 2GBJA 3JSVA 4M8MA 1V2YA 3PLVA 3DVNV 4DBGA 3A1QB 4W9IA 3QC8B 5GMVA 3L0WB 4LCDE 2V3SA 4PS7A 3PLUA 1GJZA 3WAPA 4EZJA 2WWZA 1Z2MA 2OJRA 4GU2A 3QWZB 3PHXB 2K8BA 3QHTA 2FCMA 1Y8RC 2B3AA 4II3B 3R3MA 1Q0WB 3X0WA 5AEKB 2LVPA 1H8CA 4NQKE 1WMHB 4BOSC 2IY0B 3NY5A 1P1AA 2GBKA 3SD5A 4DWFA 2XBBC 5E6PA 4NNJB 5CHWA 4OVUA 4TKNA 3RZFA 3DCGA 1IYFA 1KM7A 1M94A 3C0RB 2FUHB 3DVNU 3APCA 3IBEA 5G2NA 3PREA 1U4AA 4I6PA 2JZ3B 3M3JA 1WH3A 3H7PB 3RCZA 3MHSD 2BGFA 3L54A 2LJ5A 4MGZE 2O6VB 5IA7A 3N30A 4BKSD 2NVUI 4ANWA 4EZLA 2R2QA 2BPSA 3N3KB 3PS6A 2PEAA 3UGBB 1H4RA 3ECIA 4KZ0A 3N32A 4GDKA 1OEYA 2HTHA 2NPTB 4W9HA 3CF6E 2YLMA 3BY4B 2LGXA 4EOYA 3U30A 2QHOA 1OQYA 3QQ8B 1WXAA 4N9F4 3ML9A 4BOZB 4TQ1A 3PGEA 2JRIB 2ZCBA 2C7NB 1S1QB 3IFWB 4BVUC 3TCAA 2J0JA 1FXTB 2L0FA 3ZNID 4E74A 4RMAA 2FCQA 5J18A 4LDTD 4A20A 2WX0A 1EO6A 5AZHA 5FR6A 3A4RA 1V5OA 2N7DA 4W9KA 1C3TA 4ICUA 4WJPA 3KUCB 4GXBA 3WANA 2FNJB 2GBNA 2L3ZA 4I6LB 4FADA 2UYZB 4FA6A 1WZ0A 4ANXA 3M63B 3WAMA 1TGZB 3VTWA 3QIJA 3DBRI 4IWPA 2MBOA 3BINA 2C60A 2AL6A 4HXDA 4IW0A 2N4FA 4ANUA 4B6WA 3WAOA 1J8CA 4AJWA 2ZPNA 4BBNC 3JYUA 4GDLA 2Y5BB 4LDTB 1X1MA 4PYUA 3QK0A 3A1QA 1KOTA 1WJNA 1ZW7A 2C7MB 2KQSA 2AWTA 2MW5A 3ALBA 3DVGX 3PV1A 3PZDA 3QCAA 4MH0E 3A9JB 3HK0A 3PVLA 4NAWB 5TR5A 4HPLB 4NQLB 1ISNA 1KJTA 3IHPC 2FIFA 3X23A 2KO3A 1L7YA 4W9EA
chains in the Genus database with same CATH superfamily
4EEWA 3VUXA 1D4BA 1J0GA 5G55A 1NYRA 2LMCA 2NR2A 3AE6B 4WAAA 2RMMA 3AV8A 1WR6E 2CU1A 1SE9A 4P6VF 5LXHA 2HD5B 2D3AA 4I6NB 2DZJA 4IM3A 2JY6A 4E3CA 1ZKHA 4CHKA 4P7IA 4B95A 3AXCA 2MQJA 2KFJA 1QOBA 4PS3A 1DGJA 4TMAB 3AEFB 3BWUD 4MGKE 2E3TA 2PE6B 4A3OA 2JQRB 1UBIA 4Q2JA 2LXAA 1DYQA 4HVBA 5KHQA 3B9JA 2KTRA 3AECB 1WXSA 4ZDVA 5BYQA 2K0PA 2LUEA 1NI3A 1WYGA 3MFGA 5BO4B 4LJPB 5C1ZA 4AWJA 2CHXA 3K9PB 5EE0A 2WDTB 4CYEA 1FNVA 3Q8EA 2WXKA 4FN2A 3ZLZA 3HM6X 1XQQA 2DAJA 4C7YA 1STEA 2H88B 5D6JB 3BVZA 4RH6A 2LGSA 1DOIA 3UQBA 3BIID 2BYTA 2EKIA 1GNUA 1FNUA 1VD2A 3VFKA 1J19A 1AWDA 1JMLA 2BKRB 5DPTA 3JW0X 2H89B 3LB8C 2G4SA 1EF5A 1B1ZA 1SXTA 1D6EC 3NVWA 2JYTA 3ZQ4A 3LYYA 4GMVA 1TS3A 2KX0A 4HDOA 2GBRA 3HVZA 4MT5A 4JIOU 2K5PA 1C79A 1MHXA 2WXOA 4ZOHC 4FJZA 2C5LC 3ML8A 2KWDA 3PRPB 2KT7A 2VZKD 5HFYA 1N6ZA 2WS3B 4KKJA 1QOAA 1I4QA 2ASQA 4BAXA 3AE5B 3QAQA 4XX5A 2KQ4X 2PVOD 1V49A 4WH4A 3ETRA 3AU5A 1R4MI 3VRBB 4BKGA 3H1UA 3RULA 1SEBD 1ZOYB 4W9LA 4FHJA 4B0MA 2LVOA 2DHZA 2L8JA 4M0WB 3TEYA 4PS8A 3DBSA 1J7BA 3PRZA 2L7RA 3P2BA 4HROA 3BVMA 2KWVB 3AE8B 4FJVB 3TL5A 2WXFA 3MP9A 2ACZB 1QQRA 1Y56A 4P1BC 2MP2A 3ZO5B 2NBVB 3RI7C 2IZVB 5E6OA 3KYCD 3BYYB 1YQ3B 2CHWA 3OJ4B 4RM9A 2KYWA 1XLPA 2REXA 1IBXA 5D3IB 1TBEA 3QA8A 4WWPA 3P4SB 1QKZA 3GP7A 2XEWA 4DXGA 2JZPA 2O2VA 1KLGD 2NCNA 4RCOA 3VHTC 3TSSA 3ZUNA 4F7ZA 3AH7A 4WAFA 2MX2A 5LNK1 2ZW0A 4RGOS 1TIFA 2G45B 3RNCC 4AJYB 2KDEB 5CHFA 1FCCC 1QLBB 2D11A 4BKTA 2LGDA 4JQWC 1T0YA 3DQVA 2LGIA 2JWUA 3UQAA 5E6NA 4ANVA 2J0MA 1DOYA 4YTMB 2KKCA 1WRIA 2BS2B 2C9WB 3SU8X 3W2DA 2BBCA 1C1YB 4NAMA 1A5RA 2KANA 4ZHOA 2D2QA 4EZKA 2XN9C 2A5UA 2KX3A 1M4VA 5D3DA 2GMIC 4OVZA 4PYZA 1R7SA 1OEYJ 1V1PB 1GPXA 4AS1A 3BZDB 2IO0B 2VZKB 5AUIA 1WRDB 1JCKB 2RDGA 3OLMD 1BUIC 2N7EA 2EMTA 4H2AA 3S2AA 3N1XC 4FXCA 2GOWA 5HG2A 2WXNA 3TBLD 3TJPA 2N9XA 1UZXB 3NHEB 1SE3A 2K6DB 4C4VB 3DHIC 3B0AA 3FILA 5G5GA 2ZNVB 1P3QU 4KZCA 4DK5A 2GBMA 4MJSB 2D07B 4GLSC 3V60A 2WU2B 4IDIA 2NTSA 2KC1A 3VUYA 3SFEB 2W9NA 4XWTA 4IG7B 1D5XC 4GDLB 3L16A 3E56A 1BT0A 3IXSA 1FFUA 1UWMA 2BB6A 3NS8A 2DX5B 1ZXIA 2MHJA 1V5TA 3GB1A 2ON8A 3DDCB 4FHKA 2N9KA 4R3DA 2ZW1A 3HM3A 2RR9A 3PSEB 1R4NB 3TEZA 3GE8C 3DVNV 3QC8B 3L0WB 4ARCA 1FPYA 3WAPA 3I9V1 4DXFA 4EZJA 1MG4A 2WXGA 2OJRA 3QWZB 1MHHE 3QHTA 1Q10A 1ZE3D 3AB5A 4JWUC 1IYFA 3DVNU 3PREA 1U4AA 2QILA 3MHSD 3L54A 2LJ5A 1VZ6A 2O6VB 1YMHE 2MH7A 3N30A 5EE9A 2PVGC 4EZLA 3NZ3A 3N3KB 2PEAA 1N5WA 3NUHB 4KZ0A 4GDKA 3CF6E 4EOYA 3U30A 4YSZB 1OQYA 1L6UA 2I38A 4J3OD 4TQ1A 3ZXRA 1S1QB 4RMAA 1MVKA 1VJKA 4ICUA 2RDBC 1C4CA 2FNJB 3WANA 3E9SA 1N61A 4XDCA 4NJCA 3DBRI 3BINA 2C60A 1PYWD 3WAOA 4D2KA 2Y5BB 4PYUA 3A1QA 1KOTA 1ZW7A 3QCAA 3UF8A 3PV1A 3A9JB 2PMVA 4A55A 4NAWB 5TR5A 3IHPC 4DHZE 3I5JC 2KO3A 4W9EA 3IAS1 3MC0B 1GC6A 1E7PB 3W5VB 4ZRIA 1ESFA 1NDDA 1JROA 2VH1A 3SHQA 3RD2A 1VCBA 4BKSA 2INCC 2W82A 3NS1A 2LI5A 2FE8A 3RUIB 1K50A 4GOCA 4AP4C 5AZGA 4YSYB 3C8YA 1F2RI 2NBWB 2QJLA 3TEWA 2YVCA 2IY1B 2V4LA 1EF1A 3PRMB 2KDIA 2KZRA 3P4PB 5CHVC 2RDHA 2LWPA 2RGFA 2KDFB 1WI0A 2L76A 1YNTE 1WIAA 1QZEA 2TSSA 5EE1A 5LLIA 3PHWB 2AL3A 1HE8A 1FIQA 4WJOA 1K51A 2LRUA 1E8XA 1EUVB 1F77A 5C23A 4HCPB 1OFFA 2ONQA 2KJ6A 3M62B 3ZXVA 1F0ZA 1AW7A 1F52A 1IBXB 1WXQA 4KDIC 2G9HD 3CSTA 1UWXA 3V6CB 4O1NA 2M4NA 3I3TB 4IUMB 1PQSA 1P9DU 2DWQA 1SSNA 3L13A 1WF9A 4C4VA 2MJ3A 2V9HA 2WGSA 1V86A 2WXLA 2N9PC 1XO3A 5FK9C 2IGGA 5BMHA 2GI9A 3ZNHB 3J9CA 2WU5B 3SDLC 2BKFA 2JU6X 1AYFA 2Y5PA 4DQOC 4E71A 2RD0A 2EKEC 2PIAA 3L08A 3RNAC 1WSPA 4ASWC 3MC8A 2KXJA 1CMXB 4MACA 3PO0A 1KFYB 1E9MA 2WLBA 3AEGB 4HKZE 3URYA 1I4RA 2JXXA 4WJNA 2KMCA 3UIPB 2FCSA 4FULA 2KTRB 2BWES 2KJRA 3ZDTA 1UELA 1TS5A 2IO3B 1PFDA 2VRRB 1SF0A 1I35A 2Y5CA 3NVZA 5D7GA 4GDKB 4LNIA 4W9JA 3Q2AC 1GG3A 1LXDA 1YQBA 3SR6A 4WURA 1YD8U 3VVWB 2GB1A 4G11A 1D5ZC 4W9FA 4ZRKA 3T3NA 1F9JA 1VLBA 2L83A 4KGRA 4YT0B 1P0RA 1SE2A 3NVYA 1GC7A 2CR5A 4NJ6A 4DDGD 2LRWA 2K1FA 2ZCCA 1TYGB 1GUAB 2J0KA 5L83A 1P98A 2R61A 5JHAA 1TZ1A 3ZRCA 3OJ3A 2GLSA 3T3OA 1FM0D 2BYFA 3QX1A 4KGSA 1P7FA 4MEMA 4A3PA 1OTRB 4ZRJA 3VQIA 3KLSX 3H9DA 1ACCA 4HCNB 5EE3A 3KUZA 3KVFB 4XWWA 3DWGC 4A6QA 2MBQA 2L00B 1UGMA 3JVZX 1ZGUB 2HE7A 4LJOB 2INPE 2EELA 3P42A 3PTFC 1NEKB 2KN4A 2EMSA 3APFA 2JRHA 1YN3A 3ZDMC 1E0ZA 2R2OA 1TKGA 2OHFA 4MGIE 2C7HA 4URKA 1F2RC 2DENB 2RSUA 3WALA 1LM8B 4A90A 1VR9A 4JPSA 2Z0EB 3BVGA 1FD6A 1EU4A 1NI2A 1Q1OA 3R7QA 2E6XA 2O2VB 2ZPYA 3RNFC 5JZEB 1WE6A 2MSED 5L95C 2J42A 4G0NB 1S3SG 4DXAB 1TTNA 3RT3B 4NZLB 3UIOB 1YJJA 2G4DB 5IN7A 5LXIB 5AZFA 3LDZE 4MELA 1FCLA 5JH5C 1WX9A 4HWIB 1TS2A 1GAQB 4HRSA 1JQ4A 1YIWA 3VH4B 3VXWA 1WMHA 4GB9A 2FAZA 2KC2A 2M56B 1RRBA 2Z59B 4WIPA 1I4XA 4NY0A 1E8YA 1WX8A 5HHDG 1GB4A 3DHGC 4OVVA 3T8MA 2FBWB 3QARA 1V80A 4US8A 1RFKA 2BTEA 3ZW3A 1XT9B 2N1WA 3ZIMA 3L4PA 1QILA 4LK0M 2M19A 5DCNA 3U7ZA 1JWSD 5D94A 1WJ6A 2JZZA 1XF5L 5H92C 3VR9B 3Q6BA 5IAAC 2KQ7A 3GZNI 4BBNF 2CJNA 5I4DA 2AX5A 1TKEA 1QOGA 5IKCM 3PZ7A 2HDEA 2N7JA 4LLGM 3O65B 3UI3A 2Y3AA 5DPRA 3RPFC 2BW2A 4PK1A 1FXIA 3BYTB 3PZ8A 4EFOA 1K53A 2GBJA 3JSVA 1JALA 1V2YA 3PLVA 1NYQA 3V3XA 3WCQA 4LCDE 2I2YA 3HRDD 2VH2A 2WWZA 4WQMA 1Z2MA 3BK1A 2K8BA 1Y8RC 1Q0WB 3R8BA 5HI1A 3I57A 1ZPSA 2LVPA 5AEKB 4P1CC 3NY5A 4DWFA 2XBBC 4LTUA 5CHWA 4OVUA 5G5HA 1HZ6A 1KM7A 1M94A 3C0RB 4M0WA 2JZ3B 1XLOA 1WH3A 3B2FA 4XE0A 4BKSD 1ZDVA 2QMTA 3ECIA 2HTHA 2YLMA 3BY4B 1JWMD 2SAKA 3QQ8B 1WXAA 1I4HA 3U2SC 3IFWB 4BVUC 3TCAA 1FXTB 1N5XA 4E74A 4A20A 1R4MB 3A4RA 1F1HA 3KUCB 3Q3NC 1LGRA 2OEDA 2BQQA 2M0AA 4ANXA 3AE2B 1T0QC 1TGZB 3VTWA 3WAMA 3QIJA 1J8CA 2ZPNA 1MPEA 3JYUA 2KAJA 4GDLA 4LDTB 3QK0A 4LNOA 1PUTA 2KQSA 1QF6A 2AWTA 1NVID 4L2YA 3MJ5A 5FKAC 1PGXA 4NQLB 4GU2A 3W5UB 3TIXA 4K3BA 2KWCA 5JXVA 3MC9A 2A4ZA 1T5XD 4DHZB 1WR1A 4DDID 2O6VD 3A9KA 1CQVA 3AEAB 2LVQA 2N0SB 1WZ3A 4GIVA 2BB5A 4MM3B 1LFDA 1OQRA 1JWBD 2ICIA 2UU7A 3DBLI 3HVDA 5AUKA 2J52A 3DHHC 5JHBA 4W9CA 1YOVB 2LHDA 2FCNA 2Z0DB 2UWQA 3NOBA 1YN5A 2DZIA 2PLPA 3SEBA 2QEJC 3A4SC 3VR8B 3R7RA 2IGDA 3Q8BA 2D10A 4M8NA 4N6EB 2WNMA 1L5PA 5IOIA 1TS4A 3EFCA 3AE3B 3WIMA 4X57B 5GXGB 4F1SA 1WGHA 4HLEA 1TKYA 2WXQA 1ZP0B 3VRAB 2D3GA 4PT5A 4IWQA 2DYOA 3OWEB 3OG5A 2KD0A 4TSSA 1C76A 1IGDA 2D5GA 4A8XC 2QCZA 3EUB2 2DYBA 1FXAA 1XLNA 3AULA 3RFZB 1HZ5A 4KSLC 1WGRA 3ZJVA 4ICVA 4RNAA 3FKYA 2ZNVC 2BS4B 3IT6B 4RGNA 2MCNB 3VDZA 3AU4A 3H8HA 2KOXA 3SFDB 3DBHI 2K25A 4DHJD 2KHWB 1N62A 3AI5A 5IP4D 1XLQA 4DHJB 4WWOA 5C2TB 4G3XB 2NBUA 3A9JA 3KWVA 3DVGY 3V61A 1B9RA 1HEZE 1HTQA 1MI0A 2X38A 4CQNA 3R66C 1VRAB 1WGYA 3APDA 4C56C 4IC7B 2IJ0A 1WGKA 3RNBC 4TUUA 1E10A 2QSDA 2BYVE 3IG3A 2I1JA 4P16A 2KFKB 1FMAD 1VZ7A 2K8HA 3FAHA 3Q3JA 3KWLA 3L17A 4HDQA 3ZJUA 1LQBA 4KX6B 2RPVA 4LNNA 1TZOA 2Z8LA 3RNGC 4K7SA 4IM2A 2N9LA 1V81A 2W3RA 4AOFA 1RM6C 3AE4B 1ET9A 4ZRPA 1SB3C 4NPNA 2WYQA 4K7UA 2K39A 1WJ4A 3NZSA 2KVZA 3WA0A 1I4PA 3A33B 3AE1B 3U52E 3VH3B 3ONSA 3ZRFA 1YJ1A 2K3UA 2L0TA 1XXGA 3P63A 3Q69A 1CJEA 1C4AA 4HJKA 1VZ8A 2M1MA 1WY8A 3M95A 1E90A 3AM9A 2L05A 1EWCA 3KUDB 1AN8A 5DPSA 4KGTA 2DAFA 1MFWA 5EDSA 2PKOA 3AEEB 1UUPA 3VUWA 2MJDA 3U4EG 2HJ1A 2V3NA 3H6NA 2WXMA 4KV2A 1NBFC 2HJ8A 4B0EA 1JRUA 3RNEC 1V97A 4S0RA 1IGCA 2K6QA 2QIEB 1ZXHA 2AQ2B 2MEKA 4RGMA 4WJQA 1FRRA 2KDMA 2QC8A 5CX3A 3JSVB 4GN1A 2WXJA 3MTNB 4MM3A 2WP9B 2RPQA 2DZKA 3Q14C 5J17A 3ZNGC 3U8ZA 1HQRD 2M17A 1KRHA 3N20C 4XC2A 3ENEA 3HUIA 5BYSA 2JF5A 4BFRA 3DBHB 1RWSA 1JWAD 2PW9A 4F8CB 1V8CA 1WM3A 2MRPA 1PDXA 3N1YC 5E6JA 5J2RA 1WE7A 3DBRB 1V1OA 3D32A 4JLCA 2JT4B 3H7SA 3AN1A 4HPPA 2G1EA 2PE9A 3NVVA 1SIFA 3DPDA 4ITKA 4CO7A 1L4DB 3EFUA 3RZWC 2L1AA 2KK8A 2NTTA 1QT9A 3AEDB 2K9XA 1E8ZA 1WYWB 3NG0A 3ZVVA 2MWSB 2ZEQA 4L1BA 3Q8CA 1G6JA 2J7QB 2L32A 2JVCA 2W3SA 2OJWA 1MG8A 3FILB 3MJWA 2XK5B 2KWUB 1WM2A 1L4ZB 1XCTL 2LZ6A 4N59A 1SIJA 2CS4A 1TJEA 4W9GA 1L0VB 3CMMB 3DBLB 4US9A 4LNFA 2LUMA 2PPHA 3IVFA 3T9LA 2PJHA 3VTVA 1L6VA 1OGWA 1T0RC 1J7AA 5BMIA 2KDBA 4KIKA 4NAWA 4LNKA 1L2NA 2BVCA 1IP9A 1UF0A 2LXCA 4KSKC 2MBBB 2BF8B 2KMMA 1R4NI 2LGYA 2IDYA 4RF1A 1YX5B 4BZAA 1YX6B 4M8MA 2JXTA 3CWIA 4DBGA 4W9IA 5GMVA 2V3SA 2Q5WD 3Q8FA 3PLUA 3R2IA 1GJZA 4YWGG 3N1ZC 3EA6A 3PHXB 2FCMA 2B3AA 4II3B 3X0WA 4HEA1 4NQKE 1WMHB 4BOSC 2IY0B 1P1AA 2GBKA 3SD5A 1A70A 2DNFA 4YXDB 1BMLC 2BT6A 2FUHB 3APCA 1HTOA 3M3JA 4UDUC 4ZHPA 3ZGZA 3H7PB 4MGZE 5IA7A 2NVUI 2YEPF 2BPSA 1N60A 2AQ3B 3N32A 1PGBA 1OEYA 2L52A 3C19A 4N9F4 3ML9A 1YQ4B 4USAA 3PGEA 2JRIB 2ZCBA 2C7NB 1C9FA 2J0JA 2LFIA 2JX5A 2L0FA 3P1MA 3ZNID 2FCQA 5J18A 5H8YE 1I7HA 4LDTD 2WX0A 1EO6A 1V5OA 2N7DA 4KKIA 4WJPA 2WDVB 5T8IA 2L3ZA 2LEKA 4FADA 2UYZB 1EU3A 4S17A 2AL6A 4ANUA 4B6WA 3IT4B 4AJWA 4OZCA 2AQ1B 1X1MA 1L0XB 2C7MB 3DVGX 3PZDA 2K22A 3P4RB 5FR3A 3HK0A 3PVLA 4HPLB 1ISNA 1KJTA 1L7YA 3AEBB 1L0YB 2XK5A 4HJGE 1PGAA 1OQQA 2KLCA 2I1KA 2PTLA 2N1VA 2DLBA 1V9JA 1RAXA 3CSFA 4XZ4A 1WGDA 1KF6B 1YN4A 3AE9B 4IM0A 1JWUD 3KYDD 4ZRQA 2NS5A 3V6EB 2ZVOA 3W1SA 1D3ZA 3LXFA 5MPOA 4G50A 3K9OB 3PPAA 1AARA 1KTKA 2LD9A 2AYOB 3RMKC 4C00A 2V4IB 3GS2A 4WQOB 2KMAA 2MLBA 2G3QB 4IWOA 2OOBB 4B9KA 1KLVA 2WDQB 3PT2B 4K81A 1WXMA 2LHEA 2AEHA 2V0GA 1IPGA 4GGQA 1EM7A 3KW5B 3EC8A 2IO2B 3QJZA 1WGGA 2MA9B 1MJDA 3V62A 2KVRA 1FO4A 1XD3B 1N63A 1V6EA 4M00A 3MHZA 2MBHA 1JW9D 2MP2B 4KVGB 4OZBA 1WX7A 1LO5D 2WHIA 3B08A 1EWYC 3W1SC 1V1PA 3KH0A 1WFYA 3ZKJC 4JE3B 5KHOA 4OHJA 2WXPA 2CKHB 3EHVA 2INDC 4TV3A 2MBEA 1I4GA 1K52A 3KQ4A 2DYMA 2QDFA 1SJED 1UGJA 2M0XA 1T0SC 2B76B 1BXTA 2IGHA 2BWFA 2WXRA 2ZZPB 4K1RB 4QAYA 1UD7A 4MJSA 4WWNA 4YTNB 1E6EB 1E8WA 3GZNB 4L23A 2IBIB 3NRZA 4A9AA 1NENB 2WQYB 1SE4A 4JGHB 4YL8A 1C4PA 1WWTA 2WXIA 3Q3OC 2NMQA 5CTRC 3DOWA 1ENFA 4OW0A 4ARIA 1FNWA 4EKUA 2JSVX 3Q8AA 1E7UA 5IO9A 4NJ7A 5HKHA 3A9KB 2CJOA 3B2GA 4M01A 4MH8A 4MDKE 5TSSA 1HXYD 2KTFA 2KLGA 2ZVNA 1QOFA 2KN5A 2IO1B 3I63C 3H7PA 2WXHA 2KJHB 1CK1A 2BYEA 1DOXA 4XGAB 4K7WA 1T6BX 4MSMB 4J6IA 2KNBA 1ZUD2 2FIDA 4FLHA 3HIZA 3FC4A 1SGHA 3ZTDA 1CZPA 2SEBD 4II2B 1RFAA 3NZUA 2HTME 4MGYE 1WXVA 2K8CA 3N9YC 2JPHA 5C3JB 2NPTA 3RYTA 3ZYYX 3UINB 1UBQA 4HPMB 3V05A 4YSXB 2J4XA 2IYDB 4HK2A 3DWMA 1TY0A 5DPWA 4K3CA 3Q3FA 3AE7B 2BS3B 4FBJB 2DBYA 1E5WA 3LJ3A 3VAWA 2IPKD 4JL9A 1UH6A 1E7VA 1RLFA 1FRDA 2INNE 2GRIA 1UNSA 4W9DA 2M8SA 3NJTA 3Q3MC 3U7DA 3ZNZB 4RF0A 1WJUA 2JWZA 1GB1A 3ZTCA 4AUQC 1KH0A 2LASA 4N58A 4GSWA 2CU3A 3TUOA 3B1LX 5D2MB 3W1YA 1XCQL 2DZMA 4RFBA 1Z5SB 3AMZA 2KFKA 4FJYA 3OAWA 3CIRB 2O6VA 1P7EA 4ZYNA 1Q5WB 2X8XX 4RM8A 3EECA 3ZJTA 3W9CB 4OZAA 3VTUA 1VDVA 4XYCA 1K8RB 2KACA 3TEXA 1SJHD 2N9EB 3HHMA 3BK2A 2CHZA 2WDRB 4TQ0A 2ZJDA 1JRPA 4KIKB 2FUG1 1I42A 4C7ZA 4EUTA 2JYEA 3RN9C 4KDLB 4C80A 3GE3C 1YJIA 2WX1A 2V1YA 1ET6A 3EGRA 3GOEA 2W55A 3TMPB 4MSQB 2JUOA 3L10B 4ACFA 5BMGA 4JX1C 2XNAC 3A1QB 4JWSC 1TT5B 2MJEA 4PS7A 4IKGA 2W54A 1FEHA 1RYJA 1XEEA 3R3MA 4YTPB 1ROEA 1H8CA 3IAM1 3P4QB 2D3CA 1HA5A 4AQ7A 5E6PA 4NNJB 1GOZA 4TKNA 1IUEA 1T3QA 3RZFA 3DCGA 3IBEA 5G2NA 4I6PA 3RCZA 2BGFA 4ANWA 1FFVA 2R2QA 3PS6A 4IOIE 3UGBB 1H4RA 2LJIA 1C78A 2NPTB 4W9HA 2LGXA 1TY2A 2QHOA 4BOZB 1SBBB 4XDDA 1KLUD 1J7CA 3O13A 4REZA 5AZHA 5FR6A 4M02A 2YEPB 4W9KA 1C3TA 3R2TA 4GXBA 2GBNA 3ABVB 4I6LB 2V3PA 4FA6A 4ZYSA 2D3BA 1WZ0A 5BYRA 3M63B 4IWPA 2MBOA 4EE2A 4HXDA 4RGTA 4IW0A 2N4FA 1C77A 4BBNC 1ZDXA 1WJNA 4HKQA 2MW5A 3ALBA 4MH0E 2J53A 4WWMA 3X23A 2FIFA 1D5MC
chains in the Genus database with same CATH topology
4EEWA 1GC6A 2XK5A 3TIXA 4ZRIA 3VUXA 2KWCA 1NDDA 1J0GA 2KLCA 5G55A 2I1KA 3SHQA 3RD2A 1VCBA 4BKSA 2A4ZA 2N1VA 2NR2A 4WAAA 4DHZB 1WR6E 2CU1A 1WR1A 4DDID 1SE9A 2O6VD 3A9KA 1V9JA 2LI5A 5LXHA 2HD5B 1RAXA 3CSFA 4I6NB 4XZ4A 1WGDA 3RUIB 2DZJA 2LVQA 4GOCA 4IM0A 4IM3A 1WZ3A 4AP4C 2JY6A 5AZGA 4E3CA 4GIVA 1ZKHA 4CHKA 2NBWB 4P7IA 2YVCA 3KYDD 1LFDA 2IY1B 2V4LA 1EF1A 3PRMB 2KDIA 2KZRA 3DBLI 5CHVC 3AXCA 2NS5A 2MQJA 4B95A 3V6EB 2LWPA 2ZVOA 5JHBA 3W1SA 4W9CA 2RGFA 2KDFB 1WI0A 2KFJA 2L76A 1D3ZA 2FCNA 4PS3A 1WIAA 2Z0DB 1QZEA 2UWQA 3NOBA 2DZIA 4G50A 3K9OB 4MGKE 3A4SC 2PE6B 5LLIA 4A3OA 3PHWB 3PPAA 1UBIA 4HVBA 2LXAA 3R7RA 1AARA 5KHQA 2AL3A 2KTRA 1HE8A 2D10A 1WXSA 4ZDVA 2LD9A 4WJOA 4M8NA 2AYOB 2LRUA 4WQOB 2LUEA 1E8XA 2KMAA 1EUVB 2MLBA 5C23A 3WIMA 4X57B 4HCPB 5BO4B 2G3QB 4IWOA 4LJPB 4DHZE 2KJ6A 2OOBB 3M62B 4F1SA 1WGHA 5C1ZA 4HLEA 4AWJA 2CHXA 4B9KA 1KLVA 2D3GA 3PT2B 3K9PB 2WDTB 4CYEA 4IWQA 2DYOA 4K81A 4FN2A 3ZLZA 1WXMA 3HM6X 1XQQA 2DAJA 2AEHA 2KD0A 4KDIC 5D6JB 1IPGA 3CSTA 3UQBA 4GGQA 3V6CB 3KW5B 2DYBA 2M4NA 3I3TB 3AULA 3EC8A 2IO2B 1GNUA 1WGRA 3QJZA 1VD2A 4IUMB 4KSLC 4ICVA 1J19A 1PQSA 1P9DU 3VFKA 1WGGA 3L13A 2MA9B 1WF9A 2ZNVC 3V62A 2BKRB 2KVRA 5DPTA 1XD3B 2MCNB 1V86A 1V6EA 3JW0X 2N9PC 3AU4A 3VDZA 2KOXA 2MBHA 2G4SA 3DBHI 1EF5A 2K25A 4DHJD 2KHWB 3ZNHB 3AI5A 4DHJB 4WWOA 3SDLC 2MP2B 4KVGB 1WX7A 2BKFA 4G3XB 4GMVA 2NBUA 3B08A 4E71A 3A9JA 2KX0A 4HDOA 3W1SC 3DVGY 2RD0A 2EKEC 3V61A 3KH0A 1WFYA 3L08A 2GBRA 3ZKJC 4JIOU 4ASWC 2KXJA 1CMXB 3R66C 5KHOA 2CKHB 3EHVA 4FJZA 1WGYA 2C5LC 4TV3A 3ML8A 3APDA 3PRPB 2MBEA 4IC7B 4TUUA 2JXXA 4WJNA 2DYMA 2KMCA 3UIPB 2BYVE 3IG3A 2M0XA 2FCSA 2I1JA 4FULA 2KFKB 2KTRB 2BWFA 2BWES 2ASQA 2ZZPB 4K1RB 2K8HA 1UD7A 2KJRA 3Q3JA 3ZDTA 1UELA 4MJSA 2IO3B 3L17A 4HDQA 4WWNA 1LQBA 2VRRB 3QAQA 4XX5A 1E8WA 1I35A 2IBIB 5D7GA 4JGHB 4YL8A 4K7SA 4GDKB 4IM2A 1V49A 1V81A 4AOFA 3AU5A 4W9JA 1R4MI 5CTRC 1GG3A 3DOWA 4BKGA 1LXDA 1YQBA 4NPNA 3H1UA 1YD8U 3VVWB 2WYQA 4G11A 4K7UA 4EKUA 4W9FA 2K39A 4ZRKA 1WJ4A 3RULA 3NZSA 1F9JA 1E7UA 3WA0A 4W9LA 4NJ7A 3A33B 4FHJA 2LVOA 1P0RA 2DHZA 2L8JA 4M0WB 4PS8A 1GC7A 2CR5A 3A9KB 3DBSA 4NJ6A 3PRZA 4DDGD 2LRWA 5HKHA 3VH3B 2K1FA 2L7RA 2ZCCA 4MDKE 3ONSA 3ZRFA 2KTFA 1YJ1A 2L0TA 3P2BA 2KLGA 2ZVNA 1GUAB 2KWVB 4FJVB 2J0KA 2IO1B 2KN5A 4HJKA 3TL5A 5L83A 3H7PA 2KJHB 1P98A 5JHAA 2M1MA 1TZ1A 1WY8A 3ZRCA 3M95A 2MP2A 1E90A 2BYEA 3OJ3A 3ZO5B 2NBVB 2IZVB 2L05A 2BYFA 4K7WA 5E6OA 3KUDB 5DPSA 3KYCD 3QX1A 2CHWA 3OJ4B 4RM9A 2DAFA 4MEMA 2REXA 5EDSA 4MSMB 4A3PA 3VUWA 1TBEA 4J6IA 2KNBA 3QA8A 1OTRB 4WWPA 4ZRJA 3VQIA 3H6NA 3H9DA 2XEWA 1NBFC 2HJ8A 4HCNB 2FIDA 4FLHA 1JRUA 2O2VA 4KV2A 3VHTC 2NCNA 3KUZA 3ZUNA 3KVFB 2K6QA 3HIZA 4F7ZA 1SGHA 2L00B 2MBQA 2MX2A 4WJQA 3ZTDA 1UGMA 3JVZX 1ZGUB 5CX3A 3JSVB 2HE7A 4LJOB 4GN1A 4II2B 2G45B 1RFAA 4AJYB 3NZUA 2KDEB 3PTFC 3MTNB 5CHFA 2D11A 4BKTA 4MM3A 2EMSA 2LGDA 2RPQA 4JQWC 3APFA 2JRHA 1T0YA 4MGYE 2DZKA 3DQVA 3UQAA 3ZDMC 1WXVA 2K8CA 5J17A 5E6NA 3ZNGC 2R2OA 3U8ZA 4ANVA 2J0MA 2M17A 4MGIE 4XC2A 2JPHA 3ENEA 2NPTA 2C7HA 4URKA 3RYTA 2DENB 2RSUA 3UINB 3WALA 2JF5A 4BFRA 2KKCA 1UBQA 1LM8B 2Z0EB 4HPMB 1NI2A 2C9WB 3SU8X 4F8CB 1Q1OA 1WM3A 2MRPA 2IYDB 4HK2A 5J2RA 1C1YB 1A5RA 2KANA 3R7QA 2D2QA 2O2VB 4EZKA 2ZPYA 5JZEB 1WE7A 5DPWA 2A5UA 2KX3A 3Q3FA 1WE6A 2GMIC 3D32A 4FBJB 2MSED 5L95C 4JLCA 4G0NB 1S3SG 1E5WA 4PYZA 4DXAB 1TTNA 2JT4B 3LJ3A 3RT3B 3H7SA 3VAWA 3UIOB 4JL9A 1UH6A 1E7VA 1RLFA 2G4DB 5LXIB 2PE9A 5AZFA 1OEYJ 1SIFA 3DPDA 3LDZE 4MELA 2M8SA 4W9DA 4CO7A 3EFUA 3RZWC 3U7DA 2IO0B 5JH5C 1WX9A 1WRDB 3ZNZB 2KK8A 3OLMD 1WJUA 2JWZA 4HWIB 3ZTCA 2N7EA 2EMTA 1E8ZA 1WYWB 3S2AA 4AUQC 2LASA 3ZVVA 4GSWA 2GOWA 1YIWA 2MWSB 3TBLD 3VH4B 2ZEQA 3TJPA 3VXWA 2N9XA 1UZXB 1WMHA 4GB9A 1G6JA 3NHEB 2J7QB 2FAZA 2KC2A 3B1LX 2JVCA 2K6DB 1RRBA 2Z59B 5D2MB 3W1YA 1MG8A 2DZMA 3MJWA 2XK5B 2KWUB 1WM2A 1Z5SB 2KFKA 3B0AA 2ZNVB 4FJYA 4NY0A 1P3QU 3OAWA 4KZCA 1E8YA 1WX8A 2LZ6A 2O6VA 4OVVA 3T8MA 2CS4A 4DK5A 2GBMA 4MJSB 4ZYNA 3QARA 1V80A 2D07B 3V60A 4W9GA 1Q5WB 4RM8A 3CMMB 3EECA 3ZW3A 1XT9B 2N1WA 3ZIMA 3UF8A 2KC1A 3VTUA 2PPHA 3IVFA 5DCNA 3VUYA 2W9NA 5D94A 3T9LA 1WJ6A 2JZZA 1K8RB 4IG7B 2N9EB 2PJHA 3HHMA 3VTVA 2CHZA 1OGWA 4GDLB 4TQ0A 3L16A 2ZJDA 4KIKB 1BT0A 5IAAC 1I42A 4EUTA 2KDBA 4KIKA 4NAWA 2KQ7A 3GZNI 4BBNF 4KDLB 1L2NA 3NS8A 1IP9A 2DX5B 2LXCA 4KSKC 1V5TA 2MBBB 2BF8B 2WX1A 3DDCB 4FHKA 1R4NI 2V1YA 3HM3A 3GOEA 2LGYA 2RR9A 3O65B 1YX5B 5DPRA 3PSEB 4MSQB 3TMPB 2JUOA 3L10B 4EFOA 1YX6B 2GBJA 3JSVA 4M8MA 1V2YA 3PLVA 3DVNV 4DBGA 3A1QB 4W9IA 3QC8B 5GMVA 3L0WB 4LCDE 2V3SA 4PS7A 3PLUA 1GJZA 3WAPA 4EZJA 2WWZA 1Z2MA 2OJRA 4GU2A 3QWZB 3PHXB 2K8BA 3QHTA 2FCMA 1Y8RC 2B3AA 4II3B 3R3MA 1Q0WB 3X0WA 5AEKB 2LVPA 1H8CA 4NQKE 1WMHB 4BOSC 2IY0B 3NY5A 1P1AA 2GBKA 3SD5A 4DWFA 2XBBC 5E6PA 4NNJB 5CHWA 4OVUA 4TKNA 3RZFA 3DCGA 1IYFA 1KM7A 1M94A 3C0RB 2FUHB 3DVNU 3APCA 3IBEA 5G2NA 3PREA 1U4AA 4I6PA 2JZ3B 3M3JA 1WH3A 3H7PB 3RCZA 3MHSD 2BGFA 3L54A 2LJ5A 4MGZE 2O6VB 5IA7A 3N30A 4BKSD 2NVUI 4ANWA 4EZLA 2R2QA 2BPSA 3N3KB 3PS6A 2PEAA 3UGBB 1H4RA 3ECIA 4KZ0A 3N32A 4GDKA 1OEYA 2HTHA 2NPTB 4W9HA 3CF6E 2YLMA 3BY4B 2LGXA 4EOYA 3U30A 2QHOA 1OQYA 3QQ8B 1WXAA 4N9F4 3ML9A 4BOZB 4TQ1A 3PGEA 2JRIB 2ZCBA 2C7NB 1S1QB 3IFWB 4BVUC 3TCAA 2J0JA 1FXTB 2L0FA 3ZNID 4E74A 4RMAA 2FCQA 5J18A 4LDTD 4A20A 2WX0A 1EO6A 5AZHA 5FR6A 3A4RA 1V5OA 2N7DA 4W9KA 1C3TA 4ICUA 4WJPA 3KUCB 4GXBA 3WANA 2FNJB 2GBNA 2L3ZA 4I6LB 4FADA 2UYZB 4FA6A 1WZ0A 4ANXA 3M63B 3WAMA 1TGZB 3VTWA 3QIJA 3DBRI 4IWPA 2MBOA 3BINA 2C60A 2AL6A 4HXDA 4IW0A 2N4FA 4ANUA 4B6WA 3WAOA 1J8CA 4AJWA 2ZPNA 4BBNC 3JYUA 4GDLA 2Y5BB 4LDTB 1X1MA 4PYUA 3QK0A 3A1QA 1KOTA 1WJNA 1ZW7A 2C7MB 2KQSA 2AWTA 2MW5A 3ALBA 3DVGX 3PV1A 3PZDA 3QCAA 4MH0E 3A9JB 3HK0A 3PVLA 4NAWB 5TR5A 4HPLB 4NQLB 1ISNA 1KJTA 3IHPC 2FIFA 3X23A 2KO3A 1L7YA 4W9EA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4EEW A;  1GC6 A;  2XK5 A;  3TIX A;  4ZRI A;  3VUX A;  2KWC A;  1NDD A;  1J0G A;  2KLC A;  5G55 A;  2I1K A;  3SHQ A;  3RD2 A;  1VCB A;  4BKS A;  2A4Z A;  2N1V A;  2NR2 A;  4WAA A;  4DHZ B;  1WR6 E;  2CU1 A;  1WR1 A;  4DDI D;  1SE9 A;  2O6V D;  3A9K A;  1V9J A;  2LI5 A;  5LXH A;  2HD5 B;  1RAX A;  3CSF A;  4I6N B;  4XZ4 A;  1WGD A;  3RUI B;  2DZJ A;  2LVQ A;  4GOC A;  4IM0 A;  4IM3 A;  1WZ3 A;  4AP4 C;  2JY6 A;  5AZG A;  4E3C A;  4GIV A;  1ZKH A;  4CHK A;  2NBW B;  4P7I A;  2YVC A;  3KYD D;  1LFD A;  2IY1 B;  2V4L A;  1EF1 A;  3PRM B;  2KDI A;  2KZR A;  3DBL I;  5CHV C;  3AXC A;  2NS5 A;  2MQJ A;  4B95 A;  3V6E B;  2LWP A;  2ZVO A;  5JHB A;  3W1S A;  4W9C A;  2RGF A;  2KDF B;  1WI0 A;  2KFJ A;  2L76 A;  1D3Z A;  2FCN A;  4PS3 A;  1WIA A;  2Z0D B;  1QZE A;  2UWQ A;  3NOB A;  2DZI A;  4G50 A;  3K9O B;  4MGK E;  3A4S C;  2PE6 B;  5LLI A;  4A3O A;  3PHW B;  3PPA A;  1UBI A;  4HVB A;  2LXA A;  3R7R A;  1AAR A;  5KHQ A;  2AL3 A;  2KTR A;  1HE8 A;  2D10 A;  1WXS A;  4ZDV A;  2LD9 A;  4WJO A;  4M8N A;  2AYO B;  2LRU A;  4WQO B;  2LUE A;  1E8X A;  2KMA A;  1EUV B;  2MLB A;  5C23 A;  3WIM A;  4X57 B;  4HCP B;  5BO4 B;  2G3Q B;  4IWO A;  4LJP B;  4DHZ E;  2KJ6 A;  2OOB B;  3M62 B;  4F1S A;  1WGH A;  5C1Z A;  4HLE A;  4AWJ A;  2CHX A;  4B9K A;  1KLV A;  2D3G A;  3PT2 B;  3K9P B;  2WDT B;  4CYE A;  4IWQ A;  2DYO A;  4K81 A;  4FN2 A;  3ZLZ A;  1WXM A;  3HM6 X;  1XQQ A;  2DAJ A;  2AEH A;  2KD0 A;  4KDI C;  5D6J B;  1IPG A;  3CST A;  3UQB A;  4GGQ A;  3V6C B;  3KW5 B;  2DYB A;  2M4N A;  3I3T B;  3AUL A;  3EC8 A;  2IO2 B;  1GNU A;  1WGR A;  3QJZ A;  1VD2 A;  4IUM B;  4KSL C;  4ICV A;  1J19 A;  1PQS A;  1P9D U;  3VFK A;  1WGG A;  3L13 A;  2MA9 B;  1WF9 A;  2ZNV C;  3V62 A;  2BKR B;  2KVR A;  5DPT A;  1XD3 B;  2MCN B;  1V86 A;  1V6E A;  3JW0 X;  2N9P C;  3AU4 A;  3VDZ A;  2KOX A;  2MBH A;  2G4S A;  3DBH I;  1EF5 A;  2K25 A;  4DHJ D;  2KHW B;  3ZNH B;  3AI5 A;  4DHJ B;  4WWO A;  3SDL C;  2MP2 B;  4KVG B;  1WX7 A;  2BKF A;  4G3X B;  4GMV A;  2NBU A;  3B08 A;  4E71 A;  3A9J A;  2KX0 A;  4HDO A;  3W1S C;  3DVG Y;  2RD0 A;  2EKE C;  3V61 A;  3KH0 A;  1WFY A;  3L08 A;  2GBR A;  3ZKJ C;  4JIO U;  4ASW C;  2KXJ A;  1CMX B;  3R66 C;  5KHO A;  2CKH B;  3EHV A;  4FJZ A;  1WGY A;  2C5L C;  4TV3 A;  3ML8 A;  3APD A;  3PRP B;  2MBE A;  4IC7 B;  4TUU A;  2JXX A;  4WJN A;  2DYM A;  2KMC A;  3UIP B;  2BYV E;  3IG3 A;  2M0X A;  2FCS A;  2I1J A;  4FUL A;  2KFK B;  2KTR B;  2BWF A;  2BWE S;  2ASQ A;  2ZZP B;  4K1R B;  2K8H A;  1UD7 A;  2KJR A;  3Q3J A;  3ZDT A;  1UEL A;  4MJS A;  2IO3 B;  3L17 A;  4HDQ A;  4WWN A;  1LQB A;  2VRR B;  3QAQ A;  4XX5 A;  1E8W A;  1I35 A;  2IBI B;  5D7G A;  4JGH B;  4YL8 A;  4K7S A;  4GDK B;  4IM2 A;  1V49 A;  1V81 A;  4AOF A;  3AU5 A;  4W9J A;  1R4M I;  5CTR C;  1GG3 A;  3DOW A;  4BKG A;  1LXD A;  1YQB A;  4NPN A;  3H1U A;  1YD8 U;  3VVW B;  2WYQ A;  4G11 A;  4K7U A;  4EKU A;  4W9F A;  2K39 A;  4ZRK A;  1WJ4 A;  3RUL A;  3NZS A;  1F9J A;  1E7U A;  3WA0 A;  4W9L A;  4NJ7 A;  3A33 B;  4FHJ A;  2LVO A;  1P0R A;  2DHZ A;  2L8J A;  4M0W B;  4PS8 A;  1GC7 A;  2CR5 A;  3A9K B;  3DBS A;  4NJ6 A;  3PRZ A;  4DDG D;  2LRW A;  5HKH A;  3VH3 B;  2K1F A;  2L7R A;  2ZCC A;  4MDK E;  3ONS A;  3ZRF A;  2KTF A;  1YJ1 A;  2L0T A;  3P2B A;  2KLG A;  2ZVN A;  1GUA B;  2KWV B;  4FJV B;  2J0K A;  2IO1 B;  2KN5 A;  4HJK A;  3TL5 A;  5L83 A;  3H7P A;  2KJH B;  1P98 A;  5JHA A;  2M1M A;  1TZ1 A;  1WY8 A;  3ZRC A;  3M95 A;  2MP2 A;  1E90 A;  2BYE A;  3OJ3 A;  3ZO5 B;  2NBV B;  2IZV B;  2L05 A;  2BYF A;  4K7W A;  5E6O A;  3KUD B;  5DPS A;  3KYC D;  3QX1 A;  2CHW A;  3OJ4 B;  4RM9 A;  2DAF A;  4MEM A;  2REX A;  5EDS A;  4MSM B;  4A3P A;  3VUW A;  1TBE A;  4J6I A;  2KNB A;  3QA8 A;  1OTR B;  4WWP A;  4ZRJ A;  3VQI A;  3H6N A;  3H9D A;  2XEW A;  1NBF C;  2HJ8 A;  4HCN B;  2FID A;  4FLH A;  1JRU A;  2O2V A;  4KV2 A;  3VHT C;  2NCN A;  3KUZ A;  3ZUN A;  3KVF B;  2K6Q A;  3HIZ A;  4F7Z A;  1SGH A;  2L00 B;  2MBQ A;  2MX2 A;  4WJQ A;  3ZTD A;  1UGM A;  3JVZ X;  1ZGU B;  5CX3 A;  3JSV B;  2HE7 A;  4LJO B;  4GN1 A;  4II2 B;  2G45 B;  1RFA A;  4AJY B;  3NZU A;  2KDE B;  3PTF C;  3MTN B;  5CHF A;  2D11 A;  4BKT A;  4MM3 A;  2EMS A;  2LGD A;  2RPQ A;  4JQW C;  3APF A;  2JRH A;  1T0Y A;  4MGY E;  2DZK A;  3DQV A;  3UQA A;  3ZDM C;  1WXV A;  2K8C A;  5J17 A;  5E6N A;  3ZNG C;  2R2O A;  3U8Z A;  4ANV A;  2J0M A;  2M17 A;  4MGI E;  4XC2 A;  2JPH A;  3ENE A;  2NPT A;  2C7H A;  4URK A;  3RYT A;  2DEN B;  2RSU A;  3UIN B;  3WAL A;  2JF5 A;  4BFR A;  2KKC A;  1UBQ A;  1LM8 B;  2Z0E B;  4HPM B;  1NI2 A;  2C9W B;  3SU8 X;  4F8C B;  1Q1O A;  1WM3 A;  2MRP A;  2IYD B;  4HK2 A;  5J2R A;  1C1Y B;  1A5R A;  2KAN A;  3R7Q A;  2D2Q A;  2O2V B;  4EZK A;  2ZPY A;  5JZE B;  1WE7 A;  5DPW A;  2A5U A;  2KX3 A;  3Q3F A;  1WE6 A;  2GMI C;  3D32 A;  4FBJ B;  2MSE D;  5L95 C;  4JLC A;  4G0N B;  1S3S G;  1E5W A;  4PYZ A;  4DXA B;  1TTN A;  2JT4 B;  3LJ3 A;  3RT3 B;  3H7S A;  3VAW A;  3UIO B;  4JL9 A;  1UH6 A;  1E7V A;  1RLF A;  2G4D B;  5LXI B;  2PE9 A;  5AZF A;  1OEY J;  1SIF A;  3DPD A;  3LDZ E;  4MEL A;  2M8S A;  4W9D A;  4CO7 A;  3EFU A;  3RZW C;  3U7D A;  2IO0 B;  5JH5 C;  1WX9 A;  1WRD B;  3ZNZ B;  2KK8 A;  3OLM D;  1WJU A;  2JWZ A;  4HWI B;  3ZTC A;  2N7E A;  2EMT A;  1E8Z A;  1WYW B;  3S2A A;  4AUQ C;  2LAS A;  3ZVV A;  4GSW A;  2GOW A;  1YIW A;  2MWS B;  3TBL D;  3VH4 B;  2ZEQ A;  3TJP A;  3VXW A;  2N9X A;  1UZX B;  1WMH A;  4GB9 A;  1G6J A;  3NHE B;  2J7Q B;  2FAZ A;  2KC2 A;  3B1L X;  2JVC A;  2K6D B;  1RRB A;  2Z59 B;  5D2M B;  3W1Y A;  1MG8 A;  2DZM A;  3MJW A;  2XK5 B;  2KWU B;  1WM2 A;  1Z5S B;  2KFK A;  3B0A A;  2ZNV B;  4FJY A;  4NY0 A;  1P3Q U;  3OAW A;  4KZC A;  1E8Y A;  1WX8 A;  2LZ6 A;  2O6V A;  4OVV A;  3T8M A;  2CS4 A;  4DK5 A;  2GBM A;  4MJS B;  4ZYN A;  3QAR A;  1V80 A;  2D07 B;  3V60 A;  4W9G A;  1Q5W B;  4RM8 A;  3CMM B;  3EEC A;  3ZW3 A;  1XT9 B;  2N1W A;  3ZIM A;  3UF8 A;  2KC1 A;  3VTU A;  2PPH A;  3IVF A;  5DCN A;  3VUY A;  2W9N A;  5D94 A;  3T9L A;  1WJ6 A;  2JZZ A;  1K8R B;  4IG7 B;  2N9E B;  2PJH A;  3HHM A;  3VTV A;  2CHZ A;  1OGW A;  4GDL B;  4TQ0 A;  3L16 A;  2ZJD A;  4KIK B;  1BT0 A;  5IAA C;  1I42 A;  4EUT A;  2KDB A;  4KIK A;  4NAW A;  2KQ7 A;  3GZN I;  4BBN F;  4KDL B;  1L2N A;  3NS8 A;  1IP9 A;  2DX5 B;  2LXC A;  4KSK C;  1V5T A;  2MBB B;  2BF8 B;  2WX1 A;  3DDC B;  4FHK A;  1R4N I;  2V1Y A;  3HM3 A;  3GOE A;  2LGY A;  2RR9 A;  3O65 B;  1YX5 B;  5DPR A;  3PSE B;  4MSQ B;  3TMP B;  2JUO A;  3L10 B;  4EFO A;  1YX6 B;  2GBJ A;  3JSV A;  4M8M A;  1V2Y A;  3PLV A;  3DVN V;  4DBG A;  3A1Q B;  4W9I A;  3QC8 B;  5GMV A;  3L0W B;  4LCD E;  2V3S A;  4PS7 A;  3PLU A;  1GJZ A;  3WAP A;  4EZJ A;  2WWZ A;  1Z2M A;  2OJR A;  4GU2 A;  3QWZ B;  3PHX B;  2K8B A;  3QHT A;  2FCM A;  1Y8R C;  2B3A A;  4II3 B;  3R3M A;  1Q0W B;  3X0W A;  5AEK B;  2LVP A;  1H8C A;  4NQK E;  1WMH B;  4BOS C;  2IY0 B;  3NY5 A;  1P1A A;  2GBK A;  3SD5 A;  4DWF A;  2XBB C;  5E6P A;  4NNJ B;  5CHW A;  4OVU A;  4TKN A;  3RZF A;  3DCG A;  1IYF A;  1KM7 A;  1M94 A;  3C0R B;  2FUH B;  3DVN U;  3APC A;  3IBE A;  5G2N A;  3PRE A;  1U4A A;  4I6P A;  2JZ3 B;  3M3J A;  1WH3 A;  3H7P B;  3RCZ A;  3MHS D;  2BGF A;  3L54 A;  2LJ5 A;  4MGZ E;  2O6V B;  5IA7 A;  3N30 A;  4BKS D;  2NVU I;  4ANW A;  4EZL A;  2R2Q A;  2BPS A;  3N3K B;  3PS6 A;  2PEA A;  3UGB B;  1H4R A;  3ECI A;  4KZ0 A;  3N32 A;  4GDK A;  1OEY A;  2HTH A;  2NPT B;  4W9H A;  3CF6 E;  2YLM A;  3BY4 B;  2LGX A;  4EOY A;  3U30 A;  2QHO A;  1OQY A;  3QQ8 B;  1WXA A;  4N9F 4;  3ML9 A;  4BOZ B;  4TQ1 A;  3PGE A;  2JRI B;  2ZCB A;  2C7N B;  1S1Q B;  3IFW B;  4BVU C;  3TCA A;  2J0J A;  1FXT B;  2L0F A;  3ZNI D;  4E74 A;  4RMA A;  2FCQ A;  5J18 A;  4LDT D;  4A20 A;  2WX0 A;  1EO6 A;  5AZH A;  5FR6 A;  3A4R A;  1V5O A;  2N7D A;  4W9K A;  1C3T A;  4ICU A;  4WJP A;  3KUC B;  4GXB A;  3WAN A;  2FNJ B;  2GBN A;  2L3Z A;  4I6L B;  4FAD A;  2UYZ B;  4FA6 A;  1WZ0 A;  4ANX A;  3M63 B;  3WAM A;  1TGZ B;  3VTW A;  3QIJ A;  3DBR I;  4IWP A;  2MBO A;  3BIN A;  2C60 A;  2AL6 A;  4HXD A;  4IW0 A;  2N4F A;  4ANU A;  4B6W A;  3WAO A;  1J8C A;  4AJW A;  2ZPN A;  4BBN C;  3JYU A;  4GDL A;  2Y5B B;  4LDT B;  1X1M A;  4PYU A;  3QK0 A;  3A1Q A;  1KOT A;  1WJN A;  1ZW7 A;  2C7M B;  2KQS A;  2AWT A;  2MW5 A;  3ALB A;  3DVG X;  3PV1 A;  3PZD A;  3QCA A;  4MH0 E;  3A9J B;  3HK0 A;  3PVL A;  4NAW B;  5TR5 A;  4HPL B;  4NQL B;  1ISN A;  1KJT A;  3IHP C;  2FIF A;  3X23 A;  2KO3 A;  1L7Y A;  4W9E A; 
#chains in the Genus database with same CATH topology
 4EEW A;  3VUX A;  1D4B A;  1J0G A;  5G55 A;  1NYR A;  2LMC A;  2NR2 A;  3AE6 B;  4WAA A;  2RMM A;  3AV8 A;  1WR6 E;  2CU1 A;  1SE9 A;  4P6V F;  5LXH A;  2HD5 B;  2D3A A;  4I6N B;  2DZJ A;  4IM3 A;  2JY6 A;  4E3C A;  1ZKH A;  4CHK A;  4P7I A;  4B95 A;  3AXC A;  2MQJ A;  2KFJ A;  1QOB A;  4PS3 A;  1DGJ A;  4TMA B;  3AEF B;  3BWU D;  4MGK E;  2E3T A;  2PE6 B;  4A3O A;  2JQR B;  1UBI A;  4Q2J A;  2LXA A;  1DYQ A;  4HVB A;  5KHQ A;  3B9J A;  2KTR A;  3AEC B;  1WXS A;  4ZDV A;  5BYQ A;  2K0P A;  2LUE A;  1NI3 A;  1WYG A;  3MFG A;  5BO4 B;  4LJP B;  5C1Z A;  4AWJ A;  2CHX A;  3K9P B;  5EE0 A;  2WDT B;  4CYE A;  1FNV A;  3Q8E A;  2WXK A;  4FN2 A;  3ZLZ A;  3HM6 X;  1XQQ A;  2DAJ A;  4C7Y A;  1STE A;  2H88 B;  5D6J B;  3BVZ A;  4RH6 A;  2LGS A;  1DOI A;  3UQB A;  3BII D;  2BYT A;  2EKI A;  1GNU A;  1FNU A;  1VD2 A;  3VFK A;  1J19 A;  1AWD A;  1JML A;  2BKR B;  5DPT A;  3JW0 X;  2H89 B;  3LB8 C;  2G4S A;  1EF5 A;  1B1Z A;  1SXT A;  1D6E C;  3NVW A;  2JYT A;  3ZQ4 A;  3LYY A;  4GMV A;  1TS3 A;  2KX0 A;  4HDO A;  2GBR A;  3HVZ A;  4MT5 A;  4JIO U;  2K5P A;  1C79 A;  1MHX A;  2WXO A;  4ZOH C;  4FJZ A;  2C5L C;  3ML8 A;  2KWD A;  3PRP B;  2KT7 A;  2VZK D;  5HFY A;  1N6Z A;  2WS3 B;  4KKJ A;  1QOA A;  1I4Q A;  2ASQ A;  4BAX A;  3AE5 B;  3QAQ A;  4XX5 A;  2KQ4 X;  2PVO D;  1V49 A;  4WH4 A;  3ETR A;  3AU5 A;  1R4M I;  3VRB B;  4BKG A;  3H1U A;  3RUL A;  1SEB D;  1ZOY B;  4W9L A;  4FHJ A;  4B0M A;  2LVO A;  2DHZ A;  2L8J A;  4M0W B;  3TEY A;  4PS8 A;  3DBS A;  1J7B A;  3PRZ A;  2L7R A;  3P2B A;  4HRO A;  3BVM A;  2KWV B;  3AE8 B;  4FJV B;  3TL5 A;  2WXF A;  3MP9 A;  2ACZ B;  1QQR A;  1Y56 A;  4P1B C;  2MP2 A;  3ZO5 B;  2NBV B;  3RI7 C;  2IZV B;  5E6O A;  3KYC D;  3BYY B;  1YQ3 B;  2CHW A;  3OJ4 B;  4RM9 A;  2KYW A;  1XLP A;  2REX A;  1IBX A;  5D3I B;  1TBE A;  3QA8 A;  4WWP A;  3P4S B;  1QKZ A;  3GP7 A;  2XEW A;  4DXG A;  2JZP A;  2O2V A;  1KLG D;  2NCN A;  4RCO A;  3VHT C;  3TSS A;  3ZUN A;  4F7Z A;  3AH7 A;  4WAF A;  2MX2 A;  5LNK 1;  2ZW0 A;  4RGO S;  1TIF A;  2G45 B;  3RNC C;  4AJY B;  2KDE B;  5CHF A;  1FCC C;  1QLB B;  2D11 A;  4BKT A;  2LGD A;  4JQW C;  1T0Y A;  3DQV A;  2LGI A;  2JWU A;  3UQA A;  5E6N A;  4ANV A;  2J0M A;  1DOY A;  4YTM B;  2KKC A;  1WRI A;  2BS2 B;  2C9W B;  3SU8 X;  3W2D A;  2BBC A;  1C1Y B;  4NAM A;  1A5R A;  2KAN A;  4ZHO A;  2D2Q A;  4EZK A;  2XN9 C;  2A5U A;  2KX3 A;  1M4V A;  5D3D A;  2GMI C;  4OVZ A;  4PYZ A;  1R7S A;  1OEY J;  1V1P B;  1GPX A;  4AS1 A;  3BZD B;  2IO0 B;  2VZK B;  5AUI A;  1WRD B;  1JCK B;  2RDG A;  3OLM D;  1BUI C;  2N7E A;  2EMT A;  4H2A A;  3S2A A;  3N1X C;  4FXC A;  2GOW A;  5HG2 A;  2WXN A;  3TBL D;  3TJP A;  2N9X A;  1UZX B;  3NHE B;  1SE3 A;  2K6D B;  4C4V B;  3DHI C;  3B0A A;  3FIL A;  5G5G A;  2ZNV B;  1P3Q U;  4KZC A;  4DK5 A;  2GBM A;  4MJS B;  2D07 B;  4GLS C;  3V60 A;  2WU2 B;  4IDI A;  2NTS A;  2KC1 A;  3VUY A;  3SFE B;  2W9N A;  4XWT A;  4IG7 B;  1D5X C;  4GDL B;  3L16 A;  3E56 A;  1BT0 A;  3IXS A;  1FFU A;  1UWM A;  2BB6 A;  3NS8 A;  2DX5 B;  1ZXI A;  2MHJ A;  1V5T A;  3GB1 A;  2ON8 A;  3DDC B;  4FHK A;  2N9K A;  4R3D A;  2ZW1 A;  3HM3 A;  2RR9 A;  3PSE B;  1R4N B;  3TEZ A;  3GE8 C;  3DVN V;  3QC8 B;  3L0W B;  4ARC A;  1FPY A;  3WAP A;  3I9V 1;  4DXF A;  4EZJ A;  1MG4 A;  2WXG A;  2OJR A;  3QWZ B;  1MHH E;  3QHT A;  1Q10 A;  1ZE3 D;  3AB5 A;  4JWU C;  1IYF A;  3DVN U;  3PRE A;  1U4A A;  2QIL A;  3MHS D;  3L54 A;  2LJ5 A;  1VZ6 A;  2O6V B;  1YMH E;  2MH7 A;  3N30 A;  5EE9 A;  2PVG C;  4EZL A;  3NZ3 A;  3N3K B;  2PEA A;  1N5W A;  3NUH B;  4KZ0 A;  4GDK A;  3CF6 E;  4EOY A;  3U30 A;  4YSZ B;  1OQY A;  1L6U A;  2I38 A;  4J3O D;  4TQ1 A;  3ZXR A;  1S1Q B;  4RMA A;  1MVK A;  1VJK A;  4ICU A;  2RDB C;  1C4C A;  2FNJ B;  3WAN A;  3E9S A;  1N61 A;  4XDC A;  4NJC A;  3DBR I;  3BIN A;  2C60 A;  1PYW D;  3WAO A;  4D2K A;  2Y5B B;  4PYU A;  3A1Q A;  1KOT A;  1ZW7 A;  3QCA A;  3UF8 A;  3PV1 A;  3A9J B;  2PMV A;  4A55 A;  4NAW B;  5TR5 A;  3IHP C;  4DHZ E;  3I5J C;  2KO3 A;  4W9E A;  3IAS 1;  3MC0 B;  1GC6 A;  1E7P B;  3W5V B;  4ZRI A;  1ESF A;  1NDD A;  1JRO A;  2VH1 A;  3SHQ A;  3RD2 A;  1VCB A;  4BKS A;  2INC C;  2W82 A;  3NS1 A;  2LI5 A;  2FE8 A;  3RUI B;  1K50 A;  4GOC A;  4AP4 C;  5AZG A;  4YSY B;  3C8Y A;  1F2R I;  2NBW B;  2QJL A;  3TEW A;  2YVC A;  2IY1 B;  2V4L A;  1EF1 A;  3PRM B;  2KDI A;  2KZR A;  3P4P B;  5CHV C;  2RDH A;  2LWP A;  2RGF A;  2KDF B;  1WI0 A;  2L76 A;  1YNT E;  1WIA A;  1QZE A;  2TSS A;  5EE1 A;  5LLI A;  3PHW B;  2AL3 A;  1HE8 A;  1FIQ A;  4WJO A;  1K51 A;  2LRU A;  1E8X A;  1EUV B;  1F77 A;  5C23 A;  4HCP B;  1OFF A;  2ONQ A;  2KJ6 A;  3M62 B;  3ZXV A;  1F0Z A;  1AW7 A;  1F52 A;  1IBX B;  1WXQ A;  4KDI C;  2G9H D;  3CST A;  1UWX A;  3V6C B;  4O1N A;  2M4N A;  3I3T B;  4IUM B;  1PQS A;  1P9D U;  2DWQ A;  1SSN A;  3L13 A;  1WF9 A;  4C4V A;  2MJ3 A;  2V9H A;  2WGS A;  1V86 A;  2WXL A;  2N9P C;  1XO3 A;  5FK9 C;  2IGG A;  5BMH A;  2GI9 A;  3ZNH B;  3J9C A;  2WU5 B;  3SDL C;  2BKF A;  2JU6 X;  1AYF A;  2Y5P A;  4DQO C;  4E71 A;  2RD0 A;  2EKE C;  2PIA A;  3L08 A;  3RNA C;  1WSP A;  4ASW C;  3MC8 A;  2KXJ A;  1CMX B;  4MAC A;  3PO0 A;  1KFY B;  1E9M A;  2WLB A;  3AEG B;  4HKZ E;  3URY A;  1I4R A;  2JXX A;  4WJN A;  2KMC A;  3UIP B;  2FCS A;  4FUL A;  2KTR B;  2BWE S;  2KJR A;  3ZDT A;  1UEL A;  1TS5 A;  2IO3 B;  1PFD A;  2VRR B;  1SF0 A;  1I35 A;  2Y5C A;  3NVZ A;  5D7G A;  4GDK B;  4LNI A;  4W9J A;  3Q2A C;  1GG3 A;  1LXD A;  1YQB A;  3SR6 A;  4WUR A;  1YD8 U;  3VVW B;  2GB1 A;  4G11 A;  1D5Z C;  4W9F A;  4ZRK A;  3T3N A;  1F9J A;  1VLB A;  2L83 A;  4KGR A;  4YT0 B;  1P0R A;  1SE2 A;  3NVY A;  1GC7 A;  2CR5 A;  4NJ6 A;  4DDG D;  2LRW A;  2K1F A;  2ZCC A;  1TYG B;  1GUA B;  2J0K A;  5L83 A;  1P98 A;  2R61 A;  5JHA A;  1TZ1 A;  3ZRC A;  3OJ3 A;  2GLS A;  3T3O A;  1FM0 D;  2BYF A;  3QX1 A;  4KGS A;  1P7F A;  4MEM A;  4A3P A;  1OTR B;  4ZRJ A;  3VQI A;  3KLS X;  3H9D A;  1ACC A;  4HCN B;  5EE3 A;  3KUZ A;  3KVF B;  4XWW A;  3DWG C;  4A6Q A;  2MBQ A;  2L00 B;  1UGM A;  3JVZ X;  1ZGU B;  2HE7 A;  4LJO B;  2INP E;  2EEL A;  3P42 A;  3PTF C;  1NEK B;  2KN4 A;  2EMS A;  3APF A;  2JRH A;  1YN3 A;  3ZDM C;  1E0Z A;  2R2O A;  1TKG A;  2OHF A;  4MGI E;  2C7H A;  4URK A;  1F2R C;  2DEN B;  2RSU A;  3WAL A;  1LM8 B;  4A90 A;  1VR9 A;  4JPS A;  2Z0E B;  3BVG A;  1FD6 A;  1EU4 A;  1NI2 A;  1Q1O A;  3R7Q A;  2E6X A;  2O2V B;  2ZPY A;  3RNF C;  5JZE B;  1WE6 A;  2MSE D;  5L95 C;  2J42 A;  4G0N B;  1S3S G;  4DXA B;  1TTN A;  3RT3 B;  4NZL B;  3UIO B;  1YJJ A;  2G4D B;  5IN7 A;  5LXI B;  5AZF A;  3LDZ E;  4MEL A;  1FCL A;  5JH5 C;  1WX9 A;  4HWI B;  1TS2 A;  1GAQ B;  4HRS A;  1JQ4 A;  1YIW A;  3VH4 B;  3VXW A;  1WMH A;  4GB9 A;  2FAZ A;  2KC2 A;  2M56 B;  1RRB A;  2Z59 B;  4WIP A;  1I4X A;  4NY0 A;  1E8Y A;  1WX8 A;  5HHD G;  1GB4 A;  3DHG C;  4OVV A;  3T8M A;  2FBW B;  3QAR A;  1V80 A;  4US8 A;  1RFK A;  2BTE A;  3ZW3 A;  1XT9 B;  2N1W A;  3ZIM A;  3L4P A;  1QIL A;  4LK0 M;  2M19 A;  5DCN A;  3U7Z A;  1JWS D;  5D94 A;  1WJ6 A;  2JZZ A;  1XF5 L;  5H92 C;  3VR9 B;  3Q6B A;  5IAA C;  2KQ7 A;  3GZN I;  4BBN F;  2CJN A;  5I4D A;  2AX5 A;  1TKE A;  1QOG A;  5IKC M;  3PZ7 A;  2HDE A;  2N7J A;  4LLG M;  3O65 B;  3UI3 A;  2Y3A A;  5DPR A;  3RPF C;  2BW2 A;  4PK1 A;  1FXI A;  3BYT B;  3PZ8 A;  4EFO A;  1K53 A;  2GBJ A;  3JSV A;  1JAL A;  1V2Y A;  3PLV A;  1NYQ A;  3V3X A;  3WCQ A;  4LCD E;  2I2Y A;  3HRD D;  2VH2 A;  2WWZ A;  4WQM A;  1Z2M A;  3BK1 A;  2K8B A;  1Y8R C;  1Q0W B;  3R8B A;  5HI1 A;  3I57 A;  1ZPS A;  2LVP A;  5AEK B;  4P1C C;  3NY5 A;  4DWF A;  2XBB C;  4LTU A;  5CHW A;  4OVU A;  5G5H A;  1HZ6 A;  1KM7 A;  1M94 A;  3C0R B;  4M0W A;  2JZ3 B;  1XLO A;  1WH3 A;  3B2F A;  4XE0 A;  4BKS D;  1ZDV A;  2QMT A;  3ECI A;  2HTH A;  2YLM A;  3BY4 B;  1JWM D;  2SAK A;  3QQ8 B;  1WXA A;  1I4H A;  3U2S C;  3IFW B;  4BVU C;  3TCA A;  1FXT B;  1N5X A;  4E74 A;  4A20 A;  1R4M B;  3A4R A;  1F1H A;  3KUC B;  3Q3N C;  1LGR A;  2OED A;  2BQQ A;  2M0A A;  4ANX A;  3AE2 B;  1T0Q C;  1TGZ B;  3VTW A;  3WAM A;  3QIJ A;  1J8C A;  2ZPN A;  1MPE A;  3JYU A;  2KAJ A;  4GDL A;  4LDT B;  3QK0 A;  4LNO A;  1PUT A;  2KQS A;  1QF6 A;  2AWT A;  1NVI D;  4L2Y A;  3MJ5 A;  5FKA C;  1PGX A;  4NQL B;  4GU2 A;  3W5U B;  3TIX A;  4K3B A;  2KWC A;  5JXV A;  3MC9 A;  2A4Z A;  1T5X D;  4DHZ B;  1WR1 A;  4DDI D;  2O6V D;  3A9K A;  1CQV A;  3AEA B;  2LVQ A;  2N0S B;  1WZ3 A;  4GIV A;  2BB5 A;  4MM3 B;  1LFD A;  1OQR A;  1JWB D;  2ICI A;  2UU7 A;  3DBL I;  3HVD A;  5AUK A;  2J52 A;  3DHH C;  5JHB A;  4W9C A;  1YOV B;  2LHD A;  2FCN A;  2Z0D B;  2UWQ A;  3NOB A;  1YN5 A;  2DZI A;  2PLP A;  3SEB A;  2QEJ C;  3A4S C;  3VR8 B;  3R7R A;  2IGD A;  3Q8B A;  2D10 A;  4M8N A;  4N6E B;  2WNM A;  1L5P A;  5IOI A;  1TS4 A;  3EFC A;  3AE3 B;  3WIM A;  4X57 B;  5GXG B;  4F1S A;  1WGH A;  4HLE A;  1TKY A;  2WXQ A;  1ZP0 B;  3VRA B;  2D3G A;  4PT5 A;  4IWQ A;  2DYO A;  3OWE B;  3OG5 A;  2KD0 A;  4TSS A;  1C76 A;  1IGD A;  2D5G A;  4A8X C;  2QCZ A;  3EUB 2;  2DYB A;  1FXA A;  1XLN A;  3AUL A;  3RFZ B;  1HZ5 A;  4KSL C;  1WGR A;  3ZJV A;  4ICV A;  4RNA A;  3FKY A;  2ZNV C;  2BS4 B;  3IT6 B;  4RGN A;  2MCN B;  3VDZ A;  3AU4 A;  3H8H A;  2KOX A;  3SFD B;  3DBH I;  2K25 A;  4DHJ D;  2KHW B;  1N62 A;  3AI5 A;  5IP4 D;  1XLQ A;  4DHJ B;  4WWO A;  5C2T B;  4G3X B;  2NBU A;  3A9J A;  3KWV A;  3DVG Y;  3V61 A;  1B9R A;  1HEZ E;  1HTQ A;  1MI0 A;  2X38 A;  4CQN A;  3R66 C;  1VRA B;  1WGY A;  3APD A;  4C56 C;  4IC7 B;  2IJ0 A;  1WGK A;  3RNB C;  4TUU A;  1E10 A;  2QSD A;  2BYV E;  3IG3 A;  2I1J A;  4P16 A;  2KFK B;  1FMA D;  1VZ7 A;  2K8H A;  3FAH A;  3Q3J A;  3KWL A;  3L17 A;  4HDQ A;  3ZJU A;  1LQB A;  4KX6 B;  2RPV A;  4LNN A;  1TZO A;  2Z8L A;  3RNG C;  4K7S A;  4IM2 A;  2N9L A;  1V81 A;  2W3R A;  4AOF A;  1RM6 C;  3AE4 B;  1ET9 A;  4ZRP A;  1SB3 C;  4NPN A;  2WYQ A;  4K7U A;  2K39 A;  1WJ4 A;  3NZS A;  2KVZ A;  3WA0 A;  1I4P A;  3A33 B;  3AE1 B;  3U52 E;  3VH3 B;  3ONS A;  3ZRF A;  1YJ1 A;  2K3U A;  2L0T A;  1XXG A;  3P63 A;  3Q69 A;  1CJE A;  1C4A A;  4HJK A;  1VZ8 A;  2M1M A;  1WY8 A;  3M95 A;  1E90 A;  3AM9 A;  2L05 A;  1EWC A;  3KUD B;  1AN8 A;  5DPS A;  4KGT A;  2DAF A;  1MFW A;  5EDS A;  2PKO A;  3AEE B;  1UUP A;  3VUW A;  2MJD A;  3U4E G;  2HJ1 A;  2V3N A;  3H6N A;  2WXM A;  4KV2 A;  1NBF C;  2HJ8 A;  4B0E A;  1JRU A;  3RNE C;  1V97 A;  4S0R A;  1IGC A;  2K6Q A;  2QIE B;  1ZXH A;  2AQ2 B;  2MEK A;  4RGM A;  4WJQ A;  1FRR A;  2KDM A;  2QC8 A;  5CX3 A;  3JSV B;  4GN1 A;  2WXJ A;  3MTN B;  4MM3 A;  2WP9 B;  2RPQ A;  2DZK A;  3Q14 C;  5J17 A;  3ZNG C;  3U8Z A;  1HQR D;  2M17 A;  1KRH A;  3N20 C;  4XC2 A;  3ENE A;  3HUI A;  5BYS A;  2JF5 A;  4BFR A;  3DBH B;  1RWS A;  1JWA D;  2PW9 A;  4F8C B;  1V8C A;  1WM3 A;  2MRP A;  1PDX A;  3N1Y C;  5E6J A;  5J2R A;  1WE7 A;  3DBR B;  1V1O A;  3D32 A;  4JLC A;  2JT4 B;  3H7S A;  3AN1 A;  4HPP A;  2G1E A;  2PE9 A;  3NVV A;  1SIF A;  3DPD A;  4ITK A;  4CO7 A;  1L4D B;  3EFU A;  3RZW C;  2L1A A;  2KK8 A;  2NTT A;  1QT9 A;  3AED B;  2K9X A;  1E8Z A;  1WYW B;  3NG0 A;  3ZVV A;  2MWS B;  2ZEQ A;  4L1B A;  3Q8C A;  1G6J A;  2J7Q B;  2L32 A;  2JVC A;  2W3S A;  2OJW A;  1MG8 A;  3FIL B;  3MJW A;  2XK5 B;  2KWU B;  1WM2 A;  1L4Z B;  1XCT L;  2LZ6 A;  4N59 A;  1SIJ A;  2CS4 A;  1TJE A;  4W9G A;  1L0V B;  3CMM B;  3DBL B;  4US9 A;  4LNF A;  2LUM A;  2PPH A;  3IVF A;  3T9L A;  2PJH A;  3VTV A;  1L6V A;  1OGW A;  1T0R C;  1J7A A;  5BMI A;  2KDB A;  4KIK A;  4NAW A;  4LNK A;  1L2N A;  2BVC A;  1IP9 A;  1UF0 A;  2LXC A;  4KSK C;  2MBB B;  2BF8 B;  2KMM A;  1R4N I;  2LGY A;  2IDY A;  4RF1 A;  1YX5 B;  4BZA A;  1YX6 B;  4M8M A;  2JXT A;  3CWI A;  4DBG A;  4W9I A;  5GMV A;  2V3S A;  2Q5W D;  3Q8F A;  3PLU A;  3R2I A;  1GJZ A;  4YWG G;  3N1Z C;  3EA6 A;  3PHX B;  2FCM A;  2B3A A;  4II3 B;  3X0W A;  4HEA 1;  4NQK E;  1WMH B;  4BOS C;  2IY0 B;  1P1A A;  2GBK A;  3SD5 A;  1A70 A;  2DNF A;  4YXD B;  1BML C;  2BT6 A;  2FUH B;  3APC A;  1HTO A;  3M3J A;  4UDU C;  4ZHP A;  3ZGZ A;  3H7P B;  4MGZ E;  5IA7 A;  2NVU I;  2YEP F;  2BPS A;  1N60 A;  2AQ3 B;  3N32 A;  1PGB A;  1OEY A;  2L52 A;  3C19 A;  4N9F 4;  3ML9 A;  1YQ4 B;  4USA A;  3PGE A;  2JRI B;  2ZCB A;  2C7N B;  1C9F A;  2J0J A;  2LFI A;  2JX5 A;  2L0F A;  3P1M A;  3ZNI D;  2FCQ A;  5J18 A;  5H8Y E;  1I7H A;  4LDT D;  2WX0 A;  1EO6 A;  1V5O A;  2N7D A;  4KKI A;  4WJP A;  2WDV B;  5T8I A;  2L3Z A;  2LEK A;  4FAD A;  2UYZ B;  1EU3 A;  4S17 A;  2AL6 A;  4ANU A;  4B6W A;  3IT4 B;  4AJW A;  4OZC A;  2AQ1 B;  1X1M A;  1L0X B;  2C7M B;  3DVG X;  3PZD A;  2K22 A;  3P4R B;  5FR3 A;  3HK0 A;  3PVL A;  4HPL B;  1ISN A;  1KJT A;  1L7Y A;  3AEB B;  1L0Y B;  2XK5 A;  4HJG E;  1PGA A;  1OQQ A;  2KLC A;  2I1K A;  2PTL A;  2N1V A;  2DLB A;  1V9J A;  1RAX A;  3CSF A;  4XZ4 A;  1WGD A;  1KF6 B;  1YN4 A;  3AE9 B;  4IM0 A;  1JWU D;  3KYD D;  4ZRQ A;  2NS5 A;  3V6E B;  2ZVO A;  3W1S A;  1D3Z A;  3LXF A;  5MPO A;  4G50 A;  3K9O B;  3PPA A;  1AAR A;  1KTK A;  2LD9 A;  2AYO B;  3RMK C;  4C00 A;  2V4I B;  3GS2 A;  4WQO B;  2KMA A;  2MLB A;  2G3Q B;  4IWO A;  2OOB B;  4B9K A;  1KLV A;  2WDQ B;  3PT2 B;  4K81 A;  1WXM A;  2LHE A;  2AEH A;  2V0G A;  1IPG A;  4GGQ A;  1EM7 A;  3KW5 B;  3EC8 A;  2IO2 B;  3QJZ A;  1WGG A;  2MA9 B;  1MJD A;  3V62 A;  2KVR A;  1FO4 A;  1XD3 B;  1N63 A;  1V6E A;  4M00 A;  3MHZ A;  2MBH A;  1JW9 D;  2MP2 B;  4KVG B;  4OZB A;  1WX7 A;  1LO5 D;  2WHI A;  3B08 A;  1EWY C;  3W1S C;  1V1P A;  3KH0 A;  1WFY A;  3ZKJ C;  4JE3 B;  5KHO A;  4OHJ A;  2WXP A;  2CKH B;  3EHV A;  2IND C;  4TV3 A;  2MBE A;  1I4G A;  1K52 A;  3KQ4 A;  2DYM A;  2QDF A;  1SJE D;  1UGJ A;  2M0X A;  1T0S C;  2B76 B;  1BXT A;  2IGH A;  2BWF A;  2WXR A;  2ZZP B;  4K1R B;  4QAY A;  1UD7 A;  4MJS A;  4WWN A;  4YTN B;  1E6E B;  1E8W A;  3GZN B;  4L23 A;  2IBI B;  3NRZ A;  4A9A A;  1NEN B;  2WQY B;  1SE4 A;  4JGH B;  4YL8 A;  1C4P A;  1WWT A;  2WXI A;  3Q3O C;  2NMQ A;  5CTR C;  3DOW A;  1ENF A;  4OW0 A;  4ARI A;  1FNW A;  4EKU A;  2JSV X;  3Q8A A;  1E7U A;  5IO9 A;  4NJ7 A;  5HKH A;  3A9K B;  2CJO A;  3B2G A;  4M01 A;  4MH8 A;  4MDK E;  5TSS A;  1HXY D;  2KTF A;  2KLG A;  2ZVN A;  1QOF A;  2KN5 A;  2IO1 B;  3I63 C;  3H7P A;  2WXH A;  2KJH B;  1CK1 A;  2BYE A;  1DOX A;  4XGA B;  4K7W A;  1T6B X;  4MSM B;  4J6I A;  2KNB A;  1ZUD 2;  2FID A;  4FLH A;  3HIZ A;  3FC4 A;  1SGH A;  3ZTD A;  1CZP A;  2SEB D;  4II2 B;  1RFA A;  3NZU A;  2HTM E;  4MGY E;  1WXV A;  2K8C A;  3N9Y C;  2JPH A;  5C3J B;  2NPT A;  3RYT A;  3ZYY X;  3UIN B;  1UBQ A;  4HPM B;  3V05 A;  4YSX B;  2J4X A;  2IYD B;  4HK2 A;  3DWM A;  1TY0 A;  5DPW A;  4K3C A;  3Q3F A;  3AE7 B;  2BS3 B;  4FBJ B;  2DBY A;  1E5W A;  3LJ3 A;  3VAW A;  2IPK D;  4JL9 A;  1UH6 A;  1E7V A;  1RLF A;  1FRD A;  2INN E;  2GRI A;  1UNS A;  4W9D A;  2M8S A;  3NJT A;  3Q3M C;  3U7D A;  3ZNZ B;  4RF0 A;  1WJU A;  2JWZ A;  1GB1 A;  3ZTC A;  4AUQ C;  1KH0 A;  2LAS A;  4N58 A;  4GSW A;  2CU3 A;  3TUO A;  3B1L X;  5D2M B;  3W1Y A;  1XCQ L;  2DZM A;  4RFB A;  1Z5S B;  3AMZ A;  2KFK A;  4FJY A;  3OAW A;  3CIR B;  2O6V A;  1P7E A;  4ZYN A;  1Q5W B;  2X8X X;  4RM8 A;  3EEC A;  3ZJT A;  3W9C B;  4OZA A;  3VTU A;  1VDV A;  4XYC A;  1K8R B;  2KAC A;  3TEX A;  1SJH D;  2N9E B;  3HHM A;  3BK2 A;  2CHZ A;  2WDR B;  4TQ0 A;  2ZJD A;  1JRP A;  4KIK B;  2FUG 1;  1I42 A;  4C7Z A;  4EUT A;  2JYE A;  3RN9 C;  4KDL B;  4C80 A;  3GE3 C;  1YJI A;  2WX1 A;  2V1Y A;  1ET6 A;  3EGR A;  3GOE A;  2W55 A;  3TMP B;  4MSQ B;  2JUO A;  3L10 B;  4ACF A;  5BMG A;  4JX1 C;  2XNA C;  3A1Q B;  4JWS C;  1TT5 B;  2MJE A;  4PS7 A;  4IKG A;  2W54 A;  1FEH A;  1RYJ A;  1XEE A;  3R3M A;  4YTP B;  1ROE A;  1H8C A;  3IAM 1;  3P4Q B;  2D3C A;  1HA5 A;  4AQ7 A;  5E6P A;  4NNJ B;  1GOZ A;  4TKN A;  1IUE A;  1T3Q A;  3RZF A;  3DCG A;  3IBE A;  5G2N A;  4I6P A;  3RCZ A;  2BGF A;  4ANW A;  1FFV A;  2R2Q A;  3PS6 A;  4IOI E;  3UGB B;  1H4R A;  2LJI A;  1C78 A;  2NPT B;  4W9H A;  2LGX A;  1TY2 A;  2QHO A;  4BOZ B;  1SBB B;  4XDD A;  1KLU D;  1J7C A;  3O13 A;  4REZ A;  5AZH A;  5FR6 A;  4M02 A;  2YEP B;  4W9K A;  1C3T A;  3R2T A;  4GXB A;  2GBN A;  3ABV B;  4I6L B;  2V3P A;  4FA6 A;  4ZYS A;  2D3B A;  1WZ0 A;  5BYR A;  3M63 B;  4IWP A;  2MBO A;  4EE2 A;  4HXD A;  4RGT A;  4IW0 A;  2N4F A;  1C77 A;  4BBN C;  1ZDX A;  1WJN A;  4HKQ A;  2MW5 A;  3ALB A;  4MH0 E;  2J53 A;  4WWM A;  3X23 A;  2FIF A;  1D5M C; 
#chains in the Genus database with same CATH homology
 4EEW A;  1GC6 A;  2XK5 A;  3TIX A;  4ZRI A;  3VUX A;  2KWC A;  1NDD A;  1J0G A;  2KLC A;  5G55 A;  2I1K A;  3SHQ A;  3RD2 A;  1VCB A;  4BKS A;  2A4Z A;  2N1V A;  2NR2 A;  4WAA A;  4DHZ B;  1WR6 E;  2CU1 A;  1WR1 A;  4DDI D;  1SE9 A;  2O6V D;  3A9K A;  1V9J A;  2LI5 A;  5LXH A;  2HD5 B;  1RAX A;  3CSF A;  4I6N B;  4XZ4 A;  1WGD A;  3RUI B;  2DZJ A;  2LVQ A;  4GOC A;  4IM0 A;  4IM3 A;  1WZ3 A;  4AP4 C;  2JY6 A;  5AZG A;  4E3C A;  4GIV A;  1ZKH A;  4CHK A;  2NBW B;  4P7I A;  2YVC A;  3KYD D;  1LFD A;  2IY1 B;  2V4L A;  1EF1 A;  3PRM B;  2KDI A;  2KZR A;  3DBL I;  5CHV C;  3AXC A;  2NS5 A;  2MQJ A;  4B95 A;  3V6E B;  2LWP A;  2ZVO A;  5JHB A;  3W1S A;  4W9C A;  2RGF A;  2KDF B;  1WI0 A;  2KFJ A;  2L76 A;  1D3Z A;  2FCN A;  4PS3 A;  1WIA A;  2Z0D B;  1QZE A;  2UWQ A;  3NOB A;  2DZI A;  4G50 A;  3K9O B;  4MGK E;  3A4S C;  2PE6 B;  5LLI A;  4A3O A;  3PHW B;  3PPA A;  1UBI A;  4HVB A;  2LXA A;  3R7R A;  1AAR A;  5KHQ A;  2AL3 A;  2KTR A;  1HE8 A;  2D10 A;  1WXS A;  4ZDV A;  2LD9 A;  4WJO A;  4M8N A;  2AYO B;  2LRU A;  4WQO B;  2LUE A;  1E8X A;  2KMA A;  1EUV B;  2MLB A;  5C23 A;  3WIM A;  4X57 B;  4HCP B;  5BO4 B;  2G3Q B;  4IWO A;  4LJP B;  4DHZ E;  2KJ6 A;  2OOB B;  3M62 B;  4F1S A;  1WGH A;  5C1Z A;  4HLE A;  4AWJ A;  2CHX A;  4B9K A;  1KLV A;  2D3G A;  3PT2 B;  3K9P B;  2WDT B;  4CYE A;  4IWQ A;  2DYO A;  4K81 A;  4FN2 A;  3ZLZ A;  1WXM A;  3HM6 X;  1XQQ A;  2DAJ A;  2AEH A;  2KD0 A;  4KDI C;  5D6J B;  1IPG A;  3CST A;  3UQB A;  4GGQ A;  3V6C B;  3KW5 B;  2DYB A;  2M4N A;  3I3T B;  3AUL A;  3EC8 A;  2IO2 B;  1GNU A;  1WGR A;  3QJZ A;  1VD2 A;  4IUM B;  4KSL C;  4ICV A;  1J19 A;  1PQS A;  1P9D U;  3VFK A;  1WGG A;  3L13 A;  2MA9 B;  1WF9 A;  2ZNV C;  3V62 A;  2BKR B;  2KVR A;  5DPT A;  1XD3 B;  2MCN B;  1V86 A;  1V6E A;  3JW0 X;  2N9P C;  3AU4 A;  3VDZ A;  2KOX A;  2MBH A;  2G4S A;  3DBH I;  1EF5 A;  2K25 A;  4DHJ D;  2KHW B;  3ZNH B;  3AI5 A;  4DHJ B;  4WWO A;  3SDL C;  2MP2 B;  4KVG B;  1WX7 A;  2BKF A;  4G3X B;  4GMV A;  2NBU A;  3B08 A;  4E71 A;  3A9J A;  2KX0 A;  4HDO A;  3W1S C;  3DVG Y;  2RD0 A;  2EKE C;  3V61 A;  3KH0 A;  1WFY A;  3L08 A;  2GBR A;  3ZKJ C;  4JIO U;  4ASW C;  2KXJ A;  1CMX B;  3R66 C;  5KHO A;  2CKH B;  3EHV A;  4FJZ A;  1WGY A;  2C5L C;  4TV3 A;  3ML8 A;  3APD A;  3PRP B;  2MBE A;  4IC7 B;  4TUU A;  2JXX A;  4WJN A;  2DYM A;  2KMC A;  3UIP B;  2BYV E;  3IG3 A;  2M0X A;  2FCS A;  2I1J A;  4FUL A;  2KFK B;  2KTR B;  2BWF A;  2BWE S;  2ASQ A;  2ZZP B;  4K1R B;  2K8H A;  1UD7 A;  2KJR A;  3Q3J A;  3ZDT A;  1UEL A;  4MJS A;  2IO3 B;  3L17 A;  4HDQ A;  4WWN A;  1LQB A;  2VRR B;  3QAQ A;  4XX5 A;  1E8W A;  1I35 A;  2IBI B;  5D7G A;  4JGH B;  4YL8 A;  4K7S A;  4GDK B;  4IM2 A;  1V49 A;  1V81 A;  4AOF A;  3AU5 A;  4W9J A;  1R4M I;  5CTR C;  1GG3 A;  3DOW A;  4BKG A;  1LXD A;  1YQB A;  4NPN A;  3H1U A;  1YD8 U;  3VVW B;  2WYQ A;  4G11 A;  4K7U A;  4EKU A;  4W9F A;  2K39 A;  4ZRK A;  1WJ4 A;  3RUL A;  3NZS A;  1F9J A;  1E7U A;  3WA0 A;  4W9L A;  4NJ7 A;  3A33 B;  4FHJ A;  2LVO A;  1P0R A;  2DHZ A;  2L8J A;  4M0W B;  4PS8 A;  1GC7 A;  2CR5 A;  3A9K B;  3DBS A;  4NJ6 A;  3PRZ A;  4DDG D;  2LRW A;  5HKH A;  3VH3 B;  2K1F A;  2L7R A;  2ZCC A;  4MDK E;  3ONS A;  3ZRF A;  2KTF A;  1YJ1 A;  2L0T A;  3P2B A;  2KLG A;  2ZVN A;  1GUA B;  2KWV B;  4FJV B;  2J0K A;  2IO1 B;  2KN5 A;  4HJK A;  3TL5 A;  5L83 A;  3H7P A;  2KJH B;  1P98 A;  5JHA A;  2M1M A;  1TZ1 A;  1WY8 A;  3ZRC A;  3M95 A;  2MP2 A;  1E90 A;  2BYE A;  3OJ3 A;  3ZO5 B;  2NBV B;  2IZV B;  2L05 A;  2BYF A;  4K7W A;  5E6O A;  3KUD B;  5DPS A;  3KYC D;  3QX1 A;  2CHW A;  3OJ4 B;  4RM9 A;  2DAF A;  4MEM A;  2REX A;  5EDS A;  4MSM B;  4A3P A;  3VUW A;  1TBE A;  4J6I A;  2KNB A;  3QA8 A;  1OTR B;  4WWP A;  4ZRJ A;  3VQI A;  3H6N A;  3H9D A;  2XEW A;  1NBF C;  2HJ8 A;  4HCN B;  2FID A;  4FLH A;  1JRU A;  2O2V A;  4KV2 A;  3VHT C;  2NCN A;  3KUZ A;  3ZUN A;  3KVF B;  2K6Q A;  3HIZ A;  4F7Z A;  1SGH A;  2L00 B;  2MBQ A;  2MX2 A;  4WJQ A;  3ZTD A;  1UGM A;  3JVZ X;  1ZGU B;  5CX3 A;  3JSV B;  2HE7 A;  4LJO B;  4GN1 A;  4II2 B;  2G45 B;  1RFA A;  4AJY B;  3NZU A;  2KDE B;  3PTF C;  3MTN B;  5CHF A;  2D11 A;  4BKT A;  4MM3 A;  2EMS A;  2LGD A;  2RPQ A;  4JQW C;  3APF A;  2JRH A;  1T0Y A;  4MGY E;  2DZK A;  3DQV A;  3UQA A;  3ZDM C;  1WXV A;  2K8C A;  5J17 A;  5E6N A;  3ZNG C;  2R2O A;  3U8Z A;  4ANV A;  2J0M A;  2M17 A;  4MGI E;  4XC2 A;  2JPH A;  3ENE A;  2NPT A;  2C7H A;  4URK A;  3RYT A;  2DEN B;  2RSU A;  3UIN B;  3WAL A;  2JF5 A;  4BFR A;  2KKC A;  1UBQ A;  1LM8 B;  2Z0E B;  4HPM B;  1NI2 A;  2C9W B;  3SU8 X;  4F8C B;  1Q1O A;  1WM3 A;  2MRP A;  2IYD B;  4HK2 A;  5J2R A;  1C1Y B;  1A5R A;  2KAN A;  3R7Q A;  2D2Q A;  2O2V B;  4EZK A;  2ZPY A;  5JZE B;  1WE7 A;  5DPW A;  2A5U A;  2KX3 A;  3Q3F A;  1WE6 A;  2GMI C;  3D32 A;  4FBJ B;  2MSE D;  5L95 C;  4JLC A;  4G0N B;  1S3S G;  1E5W A;  4PYZ A;  4DXA B;  1TTN A;  2JT4 B;  3LJ3 A;  3RT3 B;  3H7S A;  3VAW A;  3UIO B;  4JL9 A;  1UH6 A;  1E7V A;  1RLF A;  2G4D B;  5LXI B;  2PE9 A;  5AZF A;  1OEY J;  1SIF A;  3DPD A;  3LDZ E;  4MEL A;  2M8S A;  4W9D A;  4CO7 A;  3EFU A;  3RZW C;  3U7D A;  2IO0 B;  5JH5 C;  1WX9 A;  1WRD B;  3ZNZ B;  2KK8 A;  3OLM D;  1WJU A;  2JWZ A;  4HWI B;  3ZTC A;  2N7E A;  2EMT A;  1E8Z A;  1WYW B;  3S2A A;  4AUQ C;  2LAS A;  3ZVV A;  4GSW A;  2GOW A;  1YIW A;  2MWS B;  3TBL D;  3VH4 B;  2ZEQ A;  3TJP A;  3VXW A;  2N9X A;  1UZX B;  1WMH A;  4GB9 A;  1G6J A;  3NHE B;  2J7Q B;  2FAZ A;  2KC2 A;  3B1L X;  2JVC A;  2K6D B;  1RRB A;  2Z59 B;  5D2M B;  3W1Y A;  1MG8 A;  2DZM A;  3MJW A;  2XK5 B;  2KWU B;  1WM2 A;  1Z5S B;  2KFK A;  3B0A A;  2ZNV B;  4FJY A;  4NY0 A;  1P3Q U;  3OAW A;  4KZC A;  1E8Y A;  1WX8 A;  2LZ6 A;  2O6V A;  4OVV A;  3T8M A;  2CS4 A;  4DK5 A;  2GBM A;  4MJS B;  4ZYN A;  3QAR A;  1V80 A;  2D07 B;  3V60 A;  4W9G A;  1Q5W B;  4RM8 A;  3CMM B;  3EEC A;  3ZW3 A;  1XT9 B;  2N1W A;  3ZIM A;  3UF8 A;  2KC1 A;  3VTU A;  2PPH A;  3IVF A;  5DCN A;  3VUY A;  2W9N A;  5D94 A;  3T9L A;  1WJ6 A;  2JZZ A;  1K8R B;  4IG7 B;  2N9E B;  2PJH A;  3HHM A;  3VTV A;  2CHZ A;  1OGW A;  4GDL B;  4TQ0 A;  3L16 A;  2ZJD A;  4KIK B;  1BT0 A;  5IAA C;  1I42 A;  4EUT A;  2KDB A;  4KIK A;  4NAW A;  2KQ7 A;  3GZN I;  4BBN F;  4KDL B;  1L2N A;  3NS8 A;  1IP9 A;  2DX5 B;  2LXC A;  4KSK C;  1V5T A;  2MBB B;  2BF8 B;  2WX1 A;  3DDC B;  4FHK A;  1R4N I;  2V1Y A;  3HM3 A;  3GOE A;  2LGY A;  2RR9 A;  3O65 B;  1YX5 B;  5DPR A;  3PSE B;  4MSQ B;  3TMP B;  2JUO A;  3L10 B;  4EFO A;  1YX6 B;  2GBJ A;  3JSV A;  4M8M A;  1V2Y A;  3PLV A;  3DVN V;  4DBG A;  3A1Q B;  4W9I A;  3QC8 B;  5GMV A;  3L0W B;  4LCD E;  2V3S A;  4PS7 A;  3PLU A;  1GJZ A;  3WAP A;  4EZJ A;  2WWZ A;  1Z2M A;  2OJR A;  4GU2 A;  3QWZ B;  3PHX B;  2K8B A;  3QHT A;  2FCM A;  1Y8R C;  2B3A A;  4II3 B;  3R3M A;  1Q0W B;  3X0W A;  5AEK B;  2LVP A;  1H8C A;  4NQK E;  1WMH B;  4BOS C;  2IY0 B;  3NY5 A;  1P1A A;  2GBK A;  3SD5 A;  4DWF A;  2XBB C;  5E6P A;  4NNJ B;  5CHW A;  4OVU A;  4TKN A;  3RZF A;  3DCG A;  1IYF A;  1KM7 A;  1M94 A;  3C0R B;  2FUH B;  3DVN U;  3APC A;  3IBE A;  5G2N A;  3PRE A;  1U4A A;  4I6P A;  2JZ3 B;  3M3J A;  1WH3 A;  3H7P B;  3RCZ A;  3MHS D;  2BGF A;  3L54 A;  2LJ5 A;  4MGZ E;  2O6V B;  5IA7 A;  3N30 A;  4BKS D;  2NVU I;  4ANW A;  4EZL A;  2R2Q A;  2BPS A;  3N3K B;  3PS6 A;  2PEA A;  3UGB B;  1H4R A;  3ECI A;  4KZ0 A;  3N32 A;  4GDK A;  1OEY A;  2HTH A;  2NPT B;  4W9H A;  3CF6 E;  2YLM A;  3BY4 B;  2LGX A;  4EOY A;  3U30 A;  2QHO A;  1OQY A;  3QQ8 B;  1WXA A;  4N9F 4;  3ML9 A;  4BOZ B;  4TQ1 A;  3PGE A;  2JRI B;  2ZCB A;  2C7N B;  1S1Q B;  3IFW B;  4BVU C;  3TCA A;  2J0J A;  1FXT B;  2L0F A;  3ZNI D;  4E74 A;  4RMA A;  2FCQ A;  5J18 A;  4LDT D;  4A20 A;  2WX0 A;  1EO6 A;  5AZH A;  5FR6 A;  3A4R A;  1V5O A;  2N7D A;  4W9K A;  1C3T A;  4ICU A;  4WJP A;  3KUC B;  4GXB A;  3WAN A;  2FNJ B;  2GBN A;  2L3Z A;  4I6L B;  4FAD A;  2UYZ B;  4FA6 A;  1WZ0 A;  4ANX A;  3M63 B;  3WAM A;  1TGZ B;  3VTW A;  3QIJ A;  3DBR I;  4IWP A;  2MBO A;  3BIN A;  2C60 A;  2AL6 A;  4HXD A;  4IW0 A;  2N4F A;  4ANU A;  4B6W A;  3WAO A;  1J8C A;  4AJW A;  2ZPN A;  4BBN C;  3JYU A;  4GDL A;  2Y5B B;  4LDT B;  1X1M A;  4PYU A;  3QK0 A;  3A1Q A;  1KOT A;  1WJN A;  1ZW7 A;  2C7M B;  2KQS A;  2AWT A;  2MW5 A;  3ALB A;  3DVG X;  3PV1 A;  3PZD A;  3QCA A;  4MH0 E;  3A9J B;  3HK0 A;  3PVL A;  4NAW B;  5TR5 A;  4HPL B;  4NQL B;  1ISN A;  1KJT A;  3IHP C;  2FIF A;  3X23 A;  2KO3 A;  1L7Y A;  4W9E A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...