1EF5A

Solution structure of the ras-binding domain of rgl
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
88
structure length
88
Chain Sequence
EDTCIIRISVEDNNGNMYKSIMLTSQDKTPAVIQRAMSKHNLESDPAEEYELVQVISEDKELVIPDSANVFYAMNSQVNFDFILRKKN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Signaling protein
molecule keywords RGL
publication title Solution structure of the Ras-binding domain of RGL.
pubmed doi rcsb
source organism Mus musculus
total genus 11
structure length 88
sequence length 88
ec nomenclature
pdb deposition date 2000-02-07
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 1ef5A00
4F1SA 5JH5C 2MP2A 2L8JA 3ZDTA 4II2B 1WGRA 1G6JA 2N7DA 4DHZE 3ZDMC 2KWCA 4EFOA 3JVZX 3C0RB 4ZDVA 4G11A 1WZ0A 5LXHA 2Y5BB 2C7HA 2N1VA 3DVGX 3LDZE 4PS7A 1FXTB 2B3AA 4MELA 5LLIA 2UYZB 5JHAA 3EFUA 2BYVE 2KLCA 2KDBA 3AU5A 4MGZE 4G50A 2N9XA 4OVUA 3VTUA 5J2RA 1BT0A 2NS5A 4HLEA 4LJOB 5E6PA 4BBNF 4MJSB 4HJKA 4B6WA 4DHZB 4X57B 1LFDA 4M8NA 4NJ7A 2AWTA 1WGHA 3V6EB 3ZTCA 2PJHA 4EZJA 2KZRA 1NI2A 2WX1A 2ZEQA 1YX6B 3SU8X 1WGGA 5D2MB 2CS4A 5L95C 1NDDA 4RM8A 3BINA 1Q1OA 4FADA 2XBBC 4A20A 1Z2MA 4CHKA 3OAWA 1ISNA 3VXWA 3APCA 4TQ1A 1S3SG 1TBEA 5D7GA 3SD5A 2G3QB 2FCMA 4MGIE 3H7PB 3ZNZB 4HWIB 4MSMB 4LDTD 4G3XB 1WGYA 2ZVNA 2MLBA 1WYWB 1XT9B 4MDKE 2MBOA 1I42A 2LGYA 2JVCA 2KFKB 5CHVC 4XC2A 4BOSC 3NY5A 5CX3A 1L7YA 4ANXA 2N7EA 1V86A 1SE9A 3R3MA 4IC7B 5AEKB 2KMCA 2PE6B 4DBGA 2KLGA 1CMXB 3SHQA 4HDQA 1U4AA 4AWJA 1QZEA 1V5TA 3DVGY 1WX9A 3A9JB 1WGDA 3A33B 4K81A 4W9DA 3W1SA 1GJZA 2NR2A 1UZXB 4LCDE 3QARA 2KC1A 1YD8U 2G4DB 3IFWB 3TCAA 1J0GA 2QHOA 4IG7B 2REXA 4TQ0A 1M94A 1GG3A 4GDKA 4EZLA 3P2BA 2LGXA 3VTWA 2LXAA 3DDCB 5C1ZA 3V62A 1C3TA 4CYEA 3L0WB 4DDID 3UIPB 1GC7A 2CU1A 3HIZA 4HK2A 3T9LA 5L83A 1KLVA 2EKEC 4W9EA 3QA8A 3ZNHB 3DVNU 3PREA 4MGYE 2IBIB 1LQBA 2G45B 3EC8A 1WMHB 4K7UA 4MM3A 2KDFB 4PS3A 2ZPNA 1EUVB 2JXXA 1WJ4A 2LVQA 3APFA 3LJ3A 4NNJB 1KOTA 1WX7A 4B95A 3PSEB 1H8CA 2MCNB 4ZYNA 2MRPA 1WJUA 1WF9A 4EEWA 1J19A 5KHQA 1LXDA 3D32A 3RZFA 3IG3A 5CHFA 4ASWC 2GBKA 4P7IA 2GMIC 2KQ7A 3ZRFA 3UQBA 4NAWB 1WXMA 4MH0E 1RRBA 2DZMA 4FJYA 4KDIC 2KTRB 4BVUC 1XD3B 2RPQA 3HM6X 3HHMA 3ZNID 3H7PA 2JRIB 4E74A 4FJZA 2AYOB 1WY8A 3L54A 2RGFA 1L2NA 3M95A 2AEHA 5EDSA 1WJNA 3ZIMA 3R66C 4NJ6A 2CHWA 2KK8A 3VUXA 4E3CA 5DPRA 2KFKA 3DBHI 2BYEA 3QIJA 1OTRB 1WR6E 2O6VB 3WIMA 1WXSA 2K1FA 2KJHB 4BKGA 2Z59B 3MJWA 2CR5A 3ML9A 1RFAA 4TKNA 1KJTA 5AZHA 4ZRIA 4FULA 4NY0A 4FN2A 2O2VB 4GDLB 2J0MA 4ICVA 3A9JA 2OJRA 2D2QA 2WX0A 3CSFA 3PHWB 4EOYA 3H7SA 2LRUA 4FHJA 4IWPA 2LXCA 4K1RB 1GC6A 4K7WA 3H6NA 4IM3A 4W9JA 2BWFA 3UINB 1WH3A 3WAOA 3L08A 4W9CA 2DHZA 1S1QB 4N9F4 3B08A 4PS8A 4M8MA 3PV1A 2V3SA 4WJOA 2MQJA 2CHZA 2M0XA 2NCNA 1V80A 3ALBA 3KUCB 3PRPB 4GB9A 2N9PC 1SIFA 3A1QA 5DPWA 4KIKB 3KH0A 4TV3A 3QK0A 2IYDB 4YL8A 4BFRA 4EUTA 3QX1A 3R7QA 4AP4C 2LUEA 1WMHA 2RD0A 4IWQA 1OEYA 3ZW3A 2K8HA 1RAXA 3NZSA 5GMVA 3IHPC 4DK5A 3KYCD 3PPAA 4F7ZA 1V2YA 3UGBB 1EF5A 3RUIB 2D10A 2K39A 4LJPB 2ZZPB 2LASA 4I6PA 3VFKA 4ANUA 4DHJD 2BYFA 1E8YA 1GNUA 2L0TA 3PGEA 3KW5B 2N1WA 3JW0X 4MSQB 2NBVB 3DCGA 2BF8B 3V61A 2NBWB 1YQBA 2JT4B 2L0FA 3PTFC 3PZDA 4NAWA 3W1YA 1WX8A 2KTRA 2KVRA 5CTRC 2HTHA 2NBUA 3CSTA 2DENB 4FHKA 2XK5B 3SDLC 1LM8B 3RULA 3UF8A 1IP9A 1YIWA 2FCQA 4RM9A 5JHBA 2PE9A 2KDEB 2ASQA 2JY6A 3KVFB 2LD9A 2W9NA 2LJ5A 3VH4B 4GU2A 2K6DB 2C7NB 2KOXA 2JRHA 4M0WB 4GMVA 3CMMB 3ZUNA 3VTVA 2O2VA 1IYFA 2EMSA 4WJPA 2KX0A 3IBEA 4AJWA 1WJ6A 3QAQA 3QHTA 3T8MA 3WA0A 4B9KA 2J0KA 4DHJB 3GOEA 4G0NB 2AL3A 3HK0A 3X0WA 2KX3A 1TZ1A 2D07B 4EKUA 1P0RA 3IVFA 2K25A 4KV2A 4ZRKA 4WWPA 3VDZA 2M1MA 4EZKA 2JZZA 5TR5A 1WXVA 2L7RA 3L13A 4MJSA 2O6VD 2C5LC 2HE7A 1WE6A 2KXJA 4PYZA 1IPGA 1WIAA 2YLMA 4IM2A 5LXIB 2FNJB 2GBRA 2ZCCA 2KFJA 4A3PA 3VAWA 2C60A 2FCNA 2KKCA 3PRZA 2KQSA 3R7RA 3UIOB 2A4ZA 5DCNA 1E8WA 2FIDA 4AOFA 3DQVA 4J6IA 2L05A 5E6NA 4HVBA 3I3TB 1YX5B 2IO1B 2MSED 5IAAC 1UBQA 2M17A 3RT3B 3ECIA 3QJZA 1TGZB 3ZNGC 1YJ1A 1KM7A 3VUYA 3AU4A 4OVVA 4CO7A 1RLFA 1V49A 4KSLC 3WAMA 4BKSD 2HJ8A 5C23A 4ANWA 2WWZA 1D3ZA 2MWSB 3VHTC 4HCPB 4AJYB 4JQWC 5D6JB 1XQQA 5AZFA 1TTNA 4W9HA 1X1MA 3DOWA 2BKRB 3X23A 3PLUA 2OOBB 2M4NA 5CHWA 1UELA 1E7VA 3B0AA 2R2QA 1E8ZA 3M3JA 2M8SA 3HM3A 2MBBB 4FJVB 4TUUA 3QWZB 4BKTA 2K6QA 1HE8A 4GOCA 2JWZA 2V1YA 3CF6E 3DBSA 4BBNC 3DVNV 2J0JA 2MW5A 2YVCA 3MHSD 3PS6A 1UBIA 4XZ4A 3JYUA 2WDTB 2GBMA 3U30A 4URKA 2DZJA 4K7SA 3W1SC 1K8RB 3PLVA 3TBLD 2I1JA 3TJPA 1ZKHA 4IM0A 2KJ6A 2CKHB 3U7DA 1WE7A 1OEYJ 1H4RA 3OJ4B 3OLMD 1OGWA 2J7QB 4W9KA 5J17A 1WM2A 3A4RA 3RCZA 4GDKB 1VD2A 3GZNI 2KNBA 5FR6A 2ZCBA 4KSKC 2GBNA 3DBRI 3VUWA 3L17A 3Q3JA 1Z5SB 1WM3A 4AUQC 1WXAA 4GIVA 2DAJA 2LGDA 5G55A 3ZRCA 5D94A 2RSUA 4ANVA 3NHEB 2KMAA 1WFYA 3KUDB 4FBJB 4W9IA 2PPHA 3ZTDA 2FUHB 3N30A 2NPTB 1V6EA 1Y8RC 4W9GA 4MGKE 5HKHA 3L10B 2L3ZA 1E7UA 4WJNA 1WI0A 3PVLA 2FAZA 1E90A 4I6NB 2KN5A 4GXBA 1MG8A 1ZW7A 2JPHA 3DBLI 2VRRB 4NQKE 1J8CA 2KANA 2KO3A 3ONSA 1I35A 1F9JA 2IY0B 3BY4B 5DPTA 4DXAB 1WR1A 2IY1B 4HDOA 4E71A 4ICUA 4BOZB 4W9FA 3PHXB 2HD5B 3M63B 3Q3FA 2LVPA 2Z0EB 4PYUA 3L16A 2O6VA 2JF5A 2JUOA 4II3B 2LWPA 4F8CB 2N9EB 4GGQA 1V5OA 3JSVB 1P98A 3A9KB 2CHXA 2KTFA 5AZGA 3EECA 2L00B 2BPSA 4GDLA 5BO4B 2C9WB 3RYTA 1ZGUB 3ZVVA 1P1AA 2BGFA 1R4NI 3K9OB 2MBEA 4DWFA 1WRDB 3TMPB 2XEWA 2KWVB 2KDIA 4W9LA 3QCAA 3ML8A 1AARA 4HXDA 2ZJDA 3M62B 3ENEA 2JZ3B 2LZ6A 4HPMB 3QQ8B 1WZ3A 3DPDA 3PT2B 4IWOA 2MP2B 2FIFA 2IO2B 3RZWC 4KZCA 4NQLB 4A3OA 3B1LX 4BKSA 2RR9A 2DZKA 4JGHB 2EMTA 1A5RA 1E5WA 3QC8B 2ZPYA 2NVUI 5E6OA 2D3GA 4KDLB 3ZO5B 4KIKA 2K8BA 5KHOA 2WYQA 2KJRA 3MTNB 1E8XA 1C1YB 4GN1A 2DAFA 3KUZA 4JL9A 4I6LB 3VVWB 4LDTB 3UQAA 3TIXA 2LRWA 4HCNB 1V9JA 3WAPA 3ZKJC 2MA9B 1PQSA 2N4FA 3EHVA 4DDGD 3AXCA 1UGMA 3A1QB 2ZNVC 3RD2A 1P3QU 2BKFA 2DX5B 2ZNVB 2MBHA 3TL5A 2IO0B 2LVOA 1SGHA 2G4SA 4WAAA 2GBJA 3VH3B 1UH6A 2NPTA 3N3KB 2L76A 4WWNA 3V6CB 3NS8A 3V60A 1R4MI 4IUMB 4NPNA 2DYBA 2KD0A 2KHWB 4GSWA 2V4LA 3H1UA 1GUAB 3VQIA 3AI5A 2I1KA 4RMAA 4JLCA 3S2AA 5DPSA 2IZVB 2MBQA 4KZ0A 5JZEB 1P9DU 2ZVOA 2DYMA 4WWOA 4WJQA 2KC2A 2XK5A 3PRMB 4FLHA 5G2NA 3ZLZA 2LI5A 1NBFC 1Q5WB 4JIOU 2DYOA 3NOBA 4XX5A 2KWUB 3KYDD 5J18A 1VCBA 1EO6A 3N32A 4HPLB 1V81A 2C7MB 3H9DA 4KVGB 3APDA 2GOWA 3U8ZA 3AULA 2BWES 1EF1A 3JSVA 3K9PB 3A9KA 1Q0WB 4IW0A 3WANA 5IA7A 1OQYA 2PEAA 1JRUA 2FCSA 2Z0DB 2R2OA 3O65B 1UD7A 3A4SC 2DZIA 4WQOB 1T0YA 2IO3B 2UWQA 2MX2A 2AL6A 4MEMA 3NZUA 4ZRJA 3WALA 3OJ3A 2K8CA 2D11A 4FA6A 2A5UA
chains in the Genus database with same CATH superfamily
1XO3A 2MP2A 3GP7A 2KWCA 1AN8A 3JVZX 4K3BA 4G11A 4BZAA 2Y5BB 5JHAA 4B0MA 4JWSC 3EFUA 1YJIA 2KDBA 3AU5A 4MGZE 1AW7A 4G50A 4OVUA 4FXCA 5E6PA 4MJSB 1RM6C 4DHZB 4XGAB 3DBLB 1LFDA 3BK2A 3EA6A 2PKOA 4RGOS 1NDDA 4RM8A 4FADA 1Z2MA 4CHKA 5TSSA 1HZ6A 3APCA 4TQ1A 1TBEA 3ZGZA 2I38A 3SD5A 2FCMA 1R4NB 2DWQA 3AV8A 2RDGA 2ZVNA 1TKEA 1I42A 2NTSA 4ANXA 5CX3A 1L7YA 4IC7B 5AEKB 2KMCA 4C00A 1L0VB 2KLGA 3SHQA 4HDQA 3DVGY 3A9JB 3A33B 4K81A 4KGRA 2NR2A 2W3SA 3ZXRA 4LCDE 3QARA 2KC1A 2G4DB 3IFWB 4TQ0A 1M94A 4EZLA 3TEYA 3FC4A 5C1ZA 3HIZA 2CU1A 3T9LA 1TT5B 3HUIA 3ZNHB 3PREA 4MGYE 1LQBA 2G45B 2BVCA 1ZDVA 1SIJA 1SE4A 4ZYNA 2KN4A 1WJUA 1WF9A 1J19A 3IG3A 1KLUD 1WXMA 2DZMA 4KDIC 3HM6X 4FJZA 2HTME 4WIPA 1F2RC 1CZPA 2AEHA 5EDSA 3R66C 4NJ6A 1SSNA 3AE5B 1TKGA 5BMHA 2KFKA 2BYEA 1OTRB 1WR6E 2Y5PA 3WIMA 4JWUC 1QOAA 4BKGA 1XXGA 2WXOA 4ZHPA 1KJTA 1MI0A 2O2VB 2J0MA 4ICVA 2OJRA 2N9LA 2WX0A 4M00A 3NVZA 2AQ1B 1VJKA 4K1RB 3U52E 4W9JA 2D3CA 3I57A 3TSSA 1WH3A 3UINB 2LGIA 4XE0A 3P4SB 4PS8A 2CHZA 1FPYA 1NYQA 4KIKB 4MT5A 3QK0A 1FMAD 4IWQA 4US8A 2K8HA 2WGSA 1DOIA 3KYCD 1SF0A 1MPEA 4N6EB 1XLQA 1T0QC 2BYFA 3PGEA 2L0TA 5H92C 2FE8A 3PZDA 3B2GA 3W1YA 2IJ0A 4Q2JA 3CSTA 1JWMD 1QT9A 3RULA 3WCQA 4GLSC 2QMTA 2LD9A 2WNMA 2BS2B 2Y3AA 4GU2A 4AS1A 2C7NB 1C76A 1OQQA 4M0WB 4GMVA 3ZUNA 1IYFA 3R8BA 2IGDA 2FBWB 1WJ6A 3T8MA 4B9KA 3WA0A 4DHJB 2J0KA 5IO9A 3P1MA 4HKQA 1TZ1A 2M1MA 5TR5A 3L13A 4MJSA 4OHJA 2C5LC 2KFJA 1RFKA 1J7AA 2QIEB 3UIOB 1E8WA 4AOFA 2L05A 3I3TB 1UBQA 2M17A 1QOFA 3ZNGC 3HRDD 2JYTA 3AM9A 4CO7A 4KSLC 3WAMA 2HJ8A 5FK9C 5C23A 1IBXA 4KGSA 5D6JB 1TTNA 4RGNA 4M01A 2M4NA 1UELA 2JYEA 2PTLA 3B0AA 1E8ZA 3QWZB 1VZ7A 2MHJA 1TS2A 4LTUA 3DBSA 3DVNV 2YVCA 3MHSD 3JYUA 2GBMA 4URKA 2DZJA 4K7SA 3TEWA 3TBLD 4IM0A 2KJ6A 1WM2A 1UUPA 3RCZA 4GDKB 1T6BX 1VD2A 4LNOA 3GZNI 1VZ8A 2ZCBA 1Y56A 4LNIA 3BVMA 2GRIA 5D94A 2RSUA 1WFYA 3KUDB 4W9IA 1EU4A 1Y8RC 4W9GA 5HKHA 3L10B 4I6NB 4GXBA 1KH0A 2CJOA 3DWGC 2VRRB 4NQKE 1UWMA 1VZ6A 5DPTA 2XNAC 1RWSA 3Q3FA 1TIFA 2LVPA 1NI3A 2JUOA 4F8CB 3EECA 2L00B 5BO4B 3TMPB 4TMAB 3QCAA 3ML8A 1VLBA 1D5ZC 4PT5A 2LZ6A 4HPMB 2MP2B 1PUTA 3BVZA 3IT4B 4ARIA 3OWEB 4BKSA 2RR9A 1B1ZA 2DZKA 4JGHB 1JWUD 1A5RA 3QC8B 2LGSA 2BS4B 3ZO5B 4KIKA 2KJRA 1SJED 4I6LB 3VVWB 1V9JA 2MA9B 1PQSA 1XCQL 3A1QB 1PFDA 2INPE 1ZOYB 1QILA 2K5PA 2G4SA 5G5GA 1K52A 1UH6A 2NPTA 1D6EC 4WWNA 3AEFB 2KD0A 2KHWB 4GSWA 1GUAB 4JLCA 2MBQA 2SAKA 4KZ0A 5JZEB 1NBFC 1C4AA 3NOBA 1VRAB 1V81A 3H9DA 4KVGB 3FKYA 2E6XA 2BWES 1J7CA 3W2DA 3JSVA 4M0WA 1PGAA 3O65B 2DZIA 4WQOB 1N62A 2UWQA 3Q8AA 4FA6A 3AE3B 4II2B 2V0GA 2E3TA 4DHZE 2PVOD 4EFOA 3C0RB 1KF6B 3N20C 3NJTA 3LDZE 2Y5CA 4PS7A 2UYZB 1WRIA 3MC9A 2BYVE 5J2RA 2N9XA 1GPXA 1I4PA 2V4IB 4HJKA 4B6WA 5BYSA 4M8NA 4NJ7A 2AWTA 1L4ZB 3ZTCA 1XLPA 2PJHA 2WX1A 2WQYB 2CS4A 5L95C 4A20A 4N59A 4OZBA 1S3SG 1DOYA 1SE3A 4NJCA 4RF0A 3ZNZB 4LDTD 3BIID 2MLBA 3R2IA 1JWSD 2G1EA 5BMGA 2JVCA 2KFKB 5CHVC 3RNEC 3RNAC 1C77A 4PK1A 1CMXB 1D5MC 4AWJA 1U4AA 1QZEA 5MPOA 1WX9A 2KMMA 1GJZA 2BT6A 4DQOC 1YD8U 3RPFC 2LEKA 4GDKA 4XDCA 3P2BA 3DDCB 1C3TA 4CYEA 3L0WB 1YN5A 1GC7A 2MJDA 3UIPB 3LB8C 1KLVA 4W9EA 3QA8A 3C8YA 2IBIB 1JALA 3EC8A 2H88B 1AWDA 3IXSA 1ESFA 3FILB 3EFCA 2JXXA 1UF0A 3ZJTA 3APFA 1KOTA 4ITKA 1MG4A 5KHQA 2WXJA 1LXDA 3NVVA 1E9MA 2XN9C 2GBKA 2GMIC 3ZRFA 2VH1A 3UQBA 3AE1B 4BVUC 5LNK1 3RNBC 5G5HA 1XD3B 2RPQA 3ZNID 2JRIB 2INDC 5BYQA 1WJNA 2KVZA 1DGJA 3VUXA 1FCLA 4KX6B 3DBHI 3QIJA 1FXIA 2KJHB 3AE2B 2CU3A 3AEAB 2LUMA 4FULA 3RMKC 4FN2A 3P63A 2SEBD 1KTKA 1PGBA 3MC8A 4WWMA 1C4PA 4IKGA 3NZ3A 3AH7A 3OG5A 4W9CA 2DHZA 3GE8C 1S1QB 4M8MA 2V3SA 2MQJA 3URYA 3ALBA 2L32A 3P4QB 2N9PC 2TSSA 1SIFA 3A1QA 3KH0A 4YL8A 3QX1A 3R7QA 1WMHA 2RD0A 1N60A 4KGTA 1TS4A 1RAXA 3NZSA 3PPAA 3U4EG 4F7ZA 1EF5A 2K39A 2LASA 4ANUA 4ZRPA 3N1XC 1IBXB 2BF8B 3VR8B 2JT4B 4NAWA 2KTRA 1K51A 5CTRC 1F0ZA 2HTHA 1F1HA 2XK5B 3RN9C 1LM8B 2WXGA 1D5XC 5IN7A 3UF8A 4BAXA 1IP9A 1YIWA 2FCQA 3RNGC 2KDEB 2WXMA 2BW2A 3KVFB 2W9NA 3TUOA 1SB3C 3CMMB 1GB1A 3VTVA 2BTEA 3IBEA 3QAQA 1T0SC 3QHTA 3NVWA 1I4QA 1P0RA 2K25A 5GXGB 5HG2A 4KV2A 2Z8LA 1VR9A 1WXVA 2L7RA 2FNJB 3BYTB 4NAMA 1YQ3B 2DNFA 2KQSA 3PRZA 3R7RA 2FIDA 3Q8CA 4HVBA 5E6NA 2MSED 3QJZA 2GB1A 1YJ1A 1KM7A 2BBCA 3Q8EA 3VUYA 3AU4A 1IGDA 1PDXA 5IKCM 1V49A 2JZPA 3VRBB 1HZ5A 1D3ZA 3VHTC 4AJYB 1XQQA 4W9HA 2RDBC 2G9HD 2KQ4X 2OOBB 1E7VA 1JWBD 3E56A 5C2TB 2MBBB 4FJVB 2R61A 4BKTA 2JWZA 2V1YA 1I4GA 2KACA 1B9RA 5HFYA 2J0JA 2MW5A 2PVGC 2BYTA 4XZ4A 3U30A 1MHXA 1ZKHA 3W9CB 1I7HA 1OEYJ 3OJ4B 3OLMD 1QQRA 4W9KA 3A4RA 2AX5A 1DYQA 3N1YC 2GBNA 3DBRI 3FILA 2DLBA 4AUQC 3ZRCA 3BWUD 3NHEB 1WXQA 2PPHA 1N6ZA 4MM3B 2NPTB 2QJLA 3R2TA 4UDUC 4MGKE 2HJ1A 1MVKA 4WJNA 1E90A 2W3RA 5EE3A 1L0XB 3DBLI 2W54A 5AUIA 1YN4A 1I35A 1F9JA 2IY0B 3BY4B 3BYYB 2IY1B 4E71A 4ICUA 4BOZB 3T3NA 3PHXB 3UI3A 3I9V1 3M63B 3L16A 2JF5A 2X8XX 1C79A 5D3IB 3TEZA 4GGQA 1V5OA 2WXRA 3JSVB 1HTQA 4YSXB 5HI1A 3RYTA 2C9WB 1ZGUB 2K3UA 1XCTL 2WXIA 1R4NI 2MBEA 4DWFA 1WRDB 4XDDA 1AARA 4HXDA 3M62B 4IWOA 1WZ3A 2Q5WD 5BYRA 2JU6X 3B1LX 1E5WA 1T0RC 2NVUI 1QKZA 2D3GA 4DXGA 4C4VA 3MTNB 1E8XA 1C1YB 4HEA1 4LDTB 3TIXA 1WYGA 3ABVB 2VZKD 3AECB 2ZNVB 3TL5A 2LVOA 4WAAA 2GBJA 2ZW1A 3VH3B 1EU3A 2VH2A 2L83A 3NS8A 1A70A 1ZXIA 1R4MI 4IUMB 4NPNA 4YTPB 2I1KA 4C56C 3S2AA 5DPSA 2ZVOA 4WWOA 2XK5A 3PRMB 4FLHA 3V05A 5G2NA 2MEKA 3KYDD 5J18A 3I5JC 4HPLB 4YXDB 5IP4D 3APDA 2GOWA 4IW0A 3A9KA 1Q0WB 1CK1A 3WANA 5IA7A 1JRUA 2FCSA 3W5VB 3A4SC 2ACZB 2I2YA 4OZCA 4LNNA 4YSZB 2JXTA 2JSVX 3EUB2 4F1SA 5JH5C 1WGRA 2V3NA 1FEHA 2N7DA 2WXNA 1XF5L 1KRHA 2J4XA 5LXHA 3Q14C 1HEZE 1NEKB 4L2YA 1FRRA 3DVGX 1F77A 2B3AA 5LLIA 3VTUA 2KLCA 4YT0B 2NS5A 4HLEA 4BBNF 4CQNA 2RPVA 4HROA 3J9CA 3V6EB 2D5GA 4EZJA 1UGJA 1I4HA 1NI2A 1KLGD 5D2MB 1V8CA 4A55A 3BINA 1Q1OA 1ISNA 1ZXHA 3VXWA 1GB4A 4HPPA 2WXLA 1XLNA 1JROA 2G3QB 3KQ4A 3MHZA 5D3DA 4HWIB 1BMLC 4MSMB 5I4DA 1WGYA 4REZA 4MDKE 2MBOA 4N58A 1T5XD 2LGYA 4XC2A 3NY5A 3NUHB 4TSSA 1V86A 1SE9A 3R3MA 2AQ2B 1V5TA 4W9DA 3W1SA 1XLOA 1V1PB 4O1NA 1J0GA 2PMVA 4LNFA 1GG3A 2IGGA 2QCZA 1L5PA 2LGXA 2LXAA 1ET9A 4XYCA 2WXQA 4DDID 2AQ3B 2RDHA 2MH7A 5HHDG 1LGRA 1NVID 4NZLB 1WMHB 4K7UA 4MM3A 4PS3A 1V97A 1ACCA 1EUVB 2BQQA 2WDVB 3NS1A 3T3OA 1E10A 2V3PA 3LJ3A 5EE9A 1WX7A 4B95A 1XEEA 3PSEB 1IGCA 1SJHD 1H8CA 2MCNB 2OJWA 3FAHA 1EWYC 2L1AA 1FD6A 1CQVA 1VDVA 3D32A 3RZFA 1QOBA 4ASWC 4P7IA 1TYGB 4NAWB 1RRBA 4FJYA 2KTRB 3NG0A 3H7PA 1WY8A 1NYRA 2KK8A 2K1FA 2CR5A 1F2RI 3ML9A 1RFAA 2OHFA 3GB1A 4TKNA 5AZHA 4ZRIA 4NY0A 2JX5A 4GDLB 3O13A 2D2QA 4YSYB 2EKIA 2QSDA 4OZAA 3PHWB 3H7SA 2KDMA 2LRUA 4FHJA 4IWPA 2LXCA 1GC6A 4K7WA 3H6NA 4IM3A 2BWFA 4RH6A 1J7BA 3WAOA 3L08A 4N9F4 2M0AA 1STEA 3EGRA 2M0XA 2X38A 1TJEA 3KUCB 4GB9A 4HKZE 2K9XA 2K0PA 2N9KA 4RNAA 5DPWA 4TV3A 2IYDB 2WHIA 4EUTA 4AP4C 1N63A 1I4RA 3AE8B 3IHPC 5GMVA 4ZOHC 2D10A 1FRDA 4LJPB 2ZZPB 4DHJD 3AN1A 1N5XA 1GNUA 5T8IA 4MSQB 1RYJA 2D3BA 3DCGA 1FXAA 3VRAB 1WX8A 2KVRA 3AEEB 1P7FA 2NBUA 1PYWD 3SDLC 2DBYA 4EE2A 4LK0M 3ZJUA 5JHBA 4RGMA 2LJIA 2JY6A 1D4BA 3IT6B 2JRHA 2EMSA 3RI7C 2KX0A 2INCC 2W55A 3CWIA 3GOEA 4G0NB 4LLGM 2AL3A 2HDEA 1ZUD2 2KX3A 4EKUA 3SFEB 4RF1A 4ZRKA 3HVDA 4QAYA 1KFYB 3Q8BA 4WURA 2JZZA 2ONQA 2O6VD 2HE7A 4JPSA 1WE6A 2KXJA 4PYZA 1WIAA 2MJ3A 4IM2A 2ZCCA 1FNUA 2C60A 1AYFA 2J53A 3AE4B 1YX5B 2IO1B 5IAAC 3RT3B 1E6EB 2M19A 3B9JA 1K50A 3ZXVA 2N7JA 1RLFA 2WU2B 4XWWA 4HCPB 4JQWC 5AZFA 3NVYA 4XWTA 2BKRB 3PLUA 5CHWA 3M3JA 3PZ7A 1WWTA 3AEGB 4TUUA 3ZQ4A 4GOCA 3L4PA 4C7ZA 1V1PA 2VZKB 4BBNC 3PS6A 4RGTA 1C78A 3W1SC 4WH4A 1HXYD 2I1JA 3TJPA 2CKHB 3Q3MC 1H4RA 3DBRB 2J7QB 5J17A 3AEBB 4C4VB 2KNBA 5FR6A 1GOZA 3VUWA 1FNWA 3L17A 1Z5SB 3IAM1 1WM3A 4AQ7A 1WXAA 4GIVA 2DAJA 2LGDA 5G55A 5EE1A 4ANVA 2KYWA 4FBJB 3AE6B 3ZTDA 2WDQB 1WI0A 3PVLA 2FAZA 2KN5A 2PIAA 1V1OA 1MG8A 3AMZA 2JPHA 2L52A 2KO3A 3ONSA 1HA5A 1WR1A 4HDOA 2KWDA 1YMHE 4W9FA 4YTMB 2HD5B 2WS3B 4P1CC 4PYUA 2Z0EB 3LYYA 1L6VA 4L1BA 4A90A 2CJNA 4MACA 1FO4A 1T3QA 3A9KB 2KTFA 1TY2A 4GDLA 3ZVVA 4S0RA 2BGFA 3K9OB 2MJEA 4W9LA 1TS3A 2ZJDA 3ENEA 2JZ3B 1R7SA 2GI9A 3DPDA 1PGXA 2FIFA 3DWMA 3RZWC 4A6QA 3Q6BA 4NQLB 1M4VA 1QF6A 4KDLB 3RNCC 5KHOA 1SXTA 3AE9B 4GN1A 4JL9A 2J52A 1FNVA 3PO0A 2LRWA 4HCNB 3WAPA 2N4FA 3EHVA 3AXCA 1UGMA 2WLBA 2ZNVC 3RD2A 1P3QU 2W82A 2BKFA 2DX5B 2MBHA 1R4MB 1SGHA 3GE3C 3N3KB 3V6CB 3V60A 2WXHA 2DYBA 2V4LA 4RMAA 1E0ZA 1P9DU 2KC2A 1VCBA 1FIQA 2C7MB 4B0EA 1EWCA 2BB6A 3U8ZA 3AULA 3K9PB 1WSPA 2PEAA 2R2OA 1UD7A 2QEJC 4MH8A 3NZUA 5AUKA 4ZRJA 3WALA 3OJ3A 3GZNB 2K8CA 2D11A 3E9SA 5H8YE 1C4CA 2L8JA 3ZDTA 1G6JA 3ZDMC 4KKIA 3Q2AC 2WDRB 4ZDVA 2WXKA 1WZ0A 3Q8FA 2C7HA 2N1VA 1YQ4B 3PZ8A 1FXTB 4MELA 1C9FA 4DXFA 1BT0A 4LJOB 4K3CA 4R3DA 2B76B 4X57B 4KKJA 1WGHA 2INNE 3P42A 2KZRA 2ZEQA 1YX6B 3SU8X 1WGGA 4A8XC 1JQ4A 2XBBC 3OAWA 4IOIE 1EM7A 4M02A 5D7GA 3MFGA 2BB5A 4MGIE 3H7PB 4G3XB 3ZJVA 1OFFA 1WYWB 1XT9B 1BXTA 3MP9A 1SBBB 4BOSC 2N7EA 2QILA 1OQRA 2PE6B 4DBGA 4A9AA 1WGDA 3C19A 3CIRB 1UZXB 2IGHA 3ZYYX 2KT7A 3TCAA 2QHOA 1ROEA 4IG7B 1N61A 2REXA 3P4PB 2J42A 3BK1A 2LMCA 3VTWA 1HTOA 3V62A 1SEBD 2WXFA 4HK2A 5L83A 4ZRQA 4P6VF 2EKEC 1Q10A 4P1BC 3LXFA 1BUIC 3DVNU 3HVZA 2UU7A 2ZW0A 1FFVA 2KDFB 3VR9B 4WQMA 2ZPNA 1WJ4A 1TKYA 2LVQA 4NNJB 1YN3A 2MRPA 2V9HA 4EEWA 4D2KA 5CHFA 4JE3B 2KQ7A 2JWUA 4MH0E 1FM0D 4ZHOA 1L0YB 2JQRB 3Q3OC 3HHMA 4E74A 3MJ5A 2AYOB 3L54A 2RGFA 1L2NA 3M95A 2FUG1 3BVGA 3ZIMA 2CHWA 4E3CA 5DPRA 2O6VB 1WXSA 2Z59B 3MJWA 3SFDB 2PW9A 4IDIA 2D3AA 3B2FA 2QDFA 3A9JA 5E6JA 3CSFA 4EOYA 2IDYA 1JCKB 1DOXA 2H89B 1YJJA 3Q3NC 3B08A 1JW9D 2ON8A 3PV1A 1E7PB 4WJOA 2NCNA 1V80A 3PRPB 1UWXA 3ETRA 4BFRA 3SR6A 2LUEA 1OEYA 3ZW3A 4RFBA 4DK5A 1TZOA 1V2YA 3UGBB 3RUIB 2K22A 2LFIA 1ET6A 1ZP0B 4I6PA 3VFKA 1MFWA 1E8YA 3KW5B 2N1WA 3JW0X 2NBVB 3V61A 2NBWB 1ENFA 1YQBA 2L0FA 3PTFC 3N9YC 5FKAC 2DENB 4FHKA 3W5UB 4OVZA 4RM9A 2PE9A 3DHGC 2ASQA 4YTNB 2LJ5A 3VH4B 2K6DB 2KOXA 2O2VA 4WJPA 1IUEA 2M56B 2RMMA 4AJWA 3HK0A 3KWVA 3X0WA 2D07B 3IVFA 2BS3B 4WWPA 3U7ZA 3VDZA 2IPKD 4EZKA 4ARCA 1IPGA 2YLMA 5LXIB 2LHEA 2GBRA 2ICIA 4LNKA 4A3PA 3VAWA 2FCNA 2KKCA 2QC8A 2A4ZA 5DCNA 3H8HA 3DQVA 3MC0B 4J6IA 1FFUA 3RNFC 3ECIA 1ZE3D 1TGZB 4C7YA 2PLPA 4OVVA 4BKSD 3DBHB 5IOIA 5C3JB 4ANWA 2WWZA 2MWSB 1JRPA 2YEPB 3TEXA 1MHHE 3RFZB 1P7EA 1X1MA 3DOWA 3X23A 4USAA 2R2QA 2M8SA 3HM3A 3N1ZC 4L23A 2K6QA 1HE8A 2WU5B 1QLBB 1YOVB 3CF6E 1JMLA 1I4XA 2EELA 1QOGA 4H2AA 1UBIA 1L6UA 2WDTB 3U2SC 4HRSA 1K8RB 5FR3A 3PLVA 4J3OD 3KWLA 1LO5D 4OW0A 3U7DA 1WE7A 2LHDA 2WP9B 1OGWA 2KAJA 4KSKC 3AE7B 1F52A 3Q3JA 1ZPSA 3SEBA 4WAFA 2KMAA 2FUHB 3N30A 1V6EA 1WGKA 2L3ZA 1E7UA 1UNSA 1TS5A 1ZW7A 3IAS1 2GLSA 1J8CA 2KANA 4DXAB 2O6VA 4II3B 2LWPA 1JWAD 2WXPA 4P16A 2N9EB 1NENB 1P98A 1N5WA 2CHXA 5AZGA 2BPSA 3AEDB 1P1AA 1SE2A 1ZDXA 2XEWA 2KWVB 3DHIC 2KDIA 3KLSX 1TY0A 3QQ8B 4C80A 1CJEA 3PT2B 2IO2B 4KZCA 4A3OA 5BMIA 2N0SB 4ACFA 1L4DB 2EMTA 4S17A 4YWGG 2ZPYA 5E6OA 1FCCC 2K8BA 2WYQA 2DAFA 3KUZA 3NRZA 4ZYSA 3UQAA 3ZKJC 4DDGD 3P4RB 2IO0B 4JX1C 1K53A 5JXVA 2L76A 4RCOA 1YNTE 3V3XA 3H1UA 3VQIA 3AI5A 2IZVB 2DYMA 4WJQA 2OEDA 1GAQB 1HQRD 3ZLZA 2LI5A 1Q5WB 4JIOU 2DYOA 4XX5A 1MJDA 2KWUB 3I63C 5EE0A 1EO6A 3N32A 2NTTA 1EF1A 3GS2A 1OQYA 3AB5A 2Z0DB 4US9A 1T0YA 2IO3B 4HJGE 3DHHC 3Q69A 2MX2A 2AL6A 2NMQA 3BZDB 4MEMA 2YEPF 2A5UA
chains in the Genus database with same CATH topology
4F1SA 5JH5C 2MP2A 2L8JA 3ZDTA 4II2B 1WGRA 1G6JA 2N7DA 4DHZE 3ZDMC 2KWCA 4EFOA 3JVZX 3C0RB 4ZDVA 4G11A 1WZ0A 5LXHA 2Y5BB 2C7HA 2N1VA 3DVGX 3LDZE 4PS7A 1FXTB 2B3AA 4MELA 5LLIA 2UYZB 5JHAA 3EFUA 2BYVE 2KLCA 2KDBA 3AU5A 4MGZE 4G50A 2N9XA 4OVUA 3VTUA 5J2RA 1BT0A 2NS5A 4HLEA 4LJOB 5E6PA 4BBNF 4MJSB 4HJKA 4B6WA 4DHZB 4X57B 1LFDA 4M8NA 4NJ7A 2AWTA 1WGHA 3V6EB 3ZTCA 2PJHA 4EZJA 2KZRA 1NI2A 2WX1A 2ZEQA 1YX6B 3SU8X 1WGGA 5D2MB 2CS4A 5L95C 1NDDA 4RM8A 3BINA 1Q1OA 4FADA 2XBBC 4A20A 1Z2MA 4CHKA 3OAWA 1ISNA 3VXWA 3APCA 4TQ1A 1S3SG 1TBEA 5D7GA 3SD5A 2G3QB 2FCMA 4MGIE 3H7PB 3ZNZB 4HWIB 4MSMB 4LDTD 4G3XB 1WGYA 2ZVNA 2MLBA 1WYWB 1XT9B 4MDKE 2MBOA 1I42A 2LGYA 2JVCA 2KFKB 5CHVC 4XC2A 4BOSC 3NY5A 5CX3A 1L7YA 4ANXA 2N7EA 1V86A 1SE9A 3R3MA 4IC7B 5AEKB 2KMCA 2PE6B 4DBGA 2KLGA 1CMXB 3SHQA 4HDQA 1U4AA 4AWJA 1QZEA 1V5TA 3DVGY 1WX9A 3A9JB 1WGDA 3A33B 4K81A 4W9DA 3W1SA 1GJZA 2NR2A 1UZXB 4LCDE 3QARA 2KC1A 1YD8U 2G4DB 3IFWB 3TCAA 1J0GA 2QHOA 4IG7B 2REXA 4TQ0A 1M94A 1GG3A 4GDKA 4EZLA 3P2BA 2LGXA 3VTWA 2LXAA 3DDCB 5C1ZA 3V62A 1C3TA 4CYEA 3L0WB 4DDID 3UIPB 1GC7A 2CU1A 3HIZA 4HK2A 3T9LA 5L83A 1KLVA 2EKEC 4W9EA 3QA8A 3ZNHB 3DVNU 3PREA 4MGYE 2IBIB 1LQBA 2G45B 3EC8A 1WMHB 4K7UA 4MM3A 2KDFB 4PS3A 2ZPNA 1EUVB 2JXXA 1WJ4A 2LVQA 3APFA 3LJ3A 4NNJB 1KOTA 1WX7A 4B95A 3PSEB 1H8CA 2MCNB 4ZYNA 2MRPA 1WJUA 1WF9A 4EEWA 1J19A 5KHQA 1LXDA 3D32A 3RZFA 3IG3A 5CHFA 4ASWC 2GBKA 4P7IA 2GMIC 2KQ7A 3ZRFA 3UQBA 4NAWB 1WXMA 4MH0E 1RRBA 2DZMA 4FJYA 4KDIC 2KTRB 4BVUC 1XD3B 2RPQA 3HM6X 3HHMA 3ZNID 3H7PA 2JRIB 4E74A 4FJZA 2AYOB 1WY8A 3L54A 2RGFA 1L2NA 3M95A 2AEHA 5EDSA 1WJNA 3ZIMA 3R66C 4NJ6A 2CHWA 2KK8A 3VUXA 4E3CA 5DPRA 2KFKA 3DBHI 2BYEA 3QIJA 1OTRB 1WR6E 2O6VB 3WIMA 1WXSA 2K1FA 2KJHB 4BKGA 2Z59B 3MJWA 2CR5A 3ML9A 1RFAA 4TKNA 1KJTA 5AZHA 4ZRIA 4FULA 4NY0A 4FN2A 2O2VB 4GDLB 2J0MA 4ICVA 3A9JA 2OJRA 2D2QA 2WX0A 3CSFA 3PHWB 4EOYA 3H7SA 2LRUA 4FHJA 4IWPA 2LXCA 4K1RB 1GC6A 4K7WA 3H6NA 4IM3A 4W9JA 2BWFA 3UINB 1WH3A 3WAOA 3L08A 4W9CA 2DHZA 1S1QB 4N9F4 3B08A 4PS8A 4M8MA 3PV1A 2V3SA 4WJOA 2MQJA 2CHZA 2M0XA 2NCNA 1V80A 3ALBA 3KUCB 3PRPB 4GB9A 2N9PC 1SIFA 3A1QA 5DPWA 4KIKB 3KH0A 4TV3A 3QK0A 2IYDB 4YL8A 4BFRA 4EUTA 3QX1A 3R7QA 4AP4C 2LUEA 1WMHA 2RD0A 4IWQA 1OEYA 3ZW3A 2K8HA 1RAXA 3NZSA 5GMVA 3IHPC 4DK5A 3KYCD 3PPAA 4F7ZA 1V2YA 3UGBB 1EF5A 3RUIB 2D10A 2K39A 4LJPB 2ZZPB 2LASA 4I6PA 3VFKA 4ANUA 4DHJD 2BYFA 1E8YA 1GNUA 2L0TA 3PGEA 3KW5B 2N1WA 3JW0X 4MSQB 2NBVB 3DCGA 2BF8B 3V61A 2NBWB 1YQBA 2JT4B 2L0FA 3PTFC 3PZDA 4NAWA 3W1YA 1WX8A 2KTRA 2KVRA 5CTRC 2HTHA 2NBUA 3CSTA 2DENB 4FHKA 2XK5B 3SDLC 1LM8B 3RULA 3UF8A 1IP9A 1YIWA 2FCQA 4RM9A 5JHBA 2PE9A 2KDEB 2ASQA 2JY6A 3KVFB 2LD9A 2W9NA 2LJ5A 3VH4B 4GU2A 2K6DB 2C7NB 2KOXA 2JRHA 4M0WB 4GMVA 3CMMB 3ZUNA 3VTVA 2O2VA 1IYFA 2EMSA 4WJPA 2KX0A 3IBEA 4AJWA 1WJ6A 3QAQA 3QHTA 3T8MA 3WA0A 4B9KA 2J0KA 4DHJB 3GOEA 4G0NB 2AL3A 3HK0A 3X0WA 2KX3A 1TZ1A 2D07B 4EKUA 1P0RA 3IVFA 2K25A 4KV2A 4ZRKA 4WWPA 3VDZA 2M1MA 4EZKA 2JZZA 5TR5A 1WXVA 2L7RA 3L13A 4MJSA 2O6VD 2C5LC 2HE7A 1WE6A 2KXJA 4PYZA 1IPGA 1WIAA 2YLMA 4IM2A 5LXIB 2FNJB 2GBRA 2ZCCA 2KFJA 4A3PA 3VAWA 2C60A 2FCNA 2KKCA 3PRZA 2KQSA 3R7RA 3UIOB 2A4ZA 5DCNA 1E8WA 2FIDA 4AOFA 3DQVA 4J6IA 2L05A 5E6NA 4HVBA 3I3TB 1YX5B 2IO1B 2MSED 5IAAC 1UBQA 2M17A 3RT3B 3ECIA 3QJZA 1TGZB 3ZNGC 1YJ1A 1KM7A 3VUYA 3AU4A 4OVVA 4CO7A 1RLFA 1V49A 4KSLC 3WAMA 4BKSD 2HJ8A 5C23A 4ANWA 2WWZA 1D3ZA 2MWSB 3VHTC 4HCPB 4AJYB 4JQWC 5D6JB 1XQQA 5AZFA 1TTNA 4W9HA 1X1MA 3DOWA 2BKRB 3X23A 3PLUA 2OOBB 2M4NA 5CHWA 1UELA 1E7VA 3B0AA 2R2QA 1E8ZA 3M3JA 2M8SA 3HM3A 2MBBB 4FJVB 4TUUA 3QWZB 4BKTA 2K6QA 1HE8A 4GOCA 2JWZA 2V1YA 3CF6E 3DBSA 4BBNC 3DVNV 2J0JA 2MW5A 2YVCA 3MHSD 3PS6A 1UBIA 4XZ4A 3JYUA 2WDTB 2GBMA 3U30A 4URKA 2DZJA 4K7SA 3W1SC 1K8RB 3PLVA 3TBLD 2I1JA 3TJPA 1ZKHA 4IM0A 2KJ6A 2CKHB 3U7DA 1WE7A 1OEYJ 1H4RA 3OJ4B 3OLMD 1OGWA 2J7QB 4W9KA 5J17A 1WM2A 3A4RA 3RCZA 4GDKB 1VD2A 3GZNI 2KNBA 5FR6A 2ZCBA 4KSKC 2GBNA 3DBRI 3VUWA 3L17A 3Q3JA 1Z5SB 1WM3A 4AUQC 1WXAA 4GIVA 2DAJA 2LGDA 5G55A 3ZRCA 5D94A 2RSUA 4ANVA 3NHEB 2KMAA 1WFYA 3KUDB 4FBJB 4W9IA 2PPHA 3ZTDA 2FUHB 3N30A 2NPTB 1V6EA 1Y8RC 4W9GA 4MGKE 5HKHA 3L10B 2L3ZA 1E7UA 4WJNA 1WI0A 3PVLA 2FAZA 1E90A 4I6NB 2KN5A 4GXBA 1MG8A 1ZW7A 2JPHA 3DBLI 2VRRB 4NQKE 1J8CA 2KANA 2KO3A 3ONSA 1I35A 1F9JA 2IY0B 3BY4B 5DPTA 4DXAB 1WR1A 2IY1B 4HDOA 4E71A 4ICUA 4BOZB 4W9FA 3PHXB 2HD5B 3M63B 3Q3FA 2LVPA 2Z0EB 4PYUA 3L16A 2O6VA 2JF5A 2JUOA 4II3B 2LWPA 4F8CB 2N9EB 4GGQA 1V5OA 3JSVB 1P98A 3A9KB 2CHXA 2KTFA 5AZGA 3EECA 2L00B 2BPSA 4GDLA 5BO4B 2C9WB 3RYTA 1ZGUB 3ZVVA 1P1AA 2BGFA 1R4NI 3K9OB 2MBEA 4DWFA 1WRDB 3TMPB 2XEWA 2KWVB 2KDIA 4W9LA 3QCAA 3ML8A 1AARA 4HXDA 2ZJDA 3M62B 3ENEA 2JZ3B 2LZ6A 4HPMB 3QQ8B 1WZ3A 3DPDA 3PT2B 4IWOA 2MP2B 2FIFA 2IO2B 3RZWC 4KZCA 4NQLB 4A3OA 3B1LX 4BKSA 2RR9A 2DZKA 4JGHB 2EMTA 1A5RA 1E5WA 3QC8B 2ZPYA 2NVUI 5E6OA 2D3GA 4KDLB 3ZO5B 4KIKA 2K8BA 5KHOA 2WYQA 2KJRA 3MTNB 1E8XA 1C1YB 4GN1A 2DAFA 3KUZA 4JL9A 4I6LB 3VVWB 4LDTB 3UQAA 3TIXA 2LRWA 4HCNB 1V9JA 3WAPA 3ZKJC 2MA9B 1PQSA 2N4FA 3EHVA 4DDGD 3AXCA 1UGMA 3A1QB 2ZNVC 3RD2A 1P3QU 2BKFA 2DX5B 2ZNVB 2MBHA 3TL5A 2IO0B 2LVOA 1SGHA 2G4SA 4WAAA 2GBJA 3VH3B 1UH6A 2NPTA 3N3KB 2L76A 4WWNA 3V6CB 3NS8A 3V60A 1R4MI 4IUMB 4NPNA 2DYBA 2KD0A 2KHWB 4GSWA 2V4LA 3H1UA 1GUAB 3VQIA 3AI5A 2I1KA 4RMAA 4JLCA 3S2AA 5DPSA 2IZVB 2MBQA 4KZ0A 5JZEB 1P9DU 2ZVOA 2DYMA 4WWOA 4WJQA 2KC2A 2XK5A 3PRMB 4FLHA 5G2NA 3ZLZA 2LI5A 1NBFC 1Q5WB 4JIOU 2DYOA 3NOBA 4XX5A 2KWUB 3KYDD 5J18A 1VCBA 1EO6A 3N32A 4HPLB 1V81A 2C7MB 3H9DA 4KVGB 3APDA 2GOWA 3U8ZA 3AULA 2BWES 1EF1A 3JSVA 3K9PB 3A9KA 1Q0WB 4IW0A 3WANA 5IA7A 1OQYA 2PEAA 1JRUA 2FCSA 2Z0DB 2R2OA 3O65B 1UD7A 3A4SC 2DZIA 4WQOB 1T0YA 2IO3B 2UWQA 2MX2A 2AL6A 4MEMA 3NZUA 4ZRJA 3WALA 3OJ3A 2K8CA 2D11A 4FA6A 2A5UA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4F1S A;  5JH5 C;  2MP2 A;  2L8J A;  3ZDT A;  4II2 B;  1WGR A;  1G6J A;  2N7D A;  4DHZ E;  3ZDM C;  2KWC A;  4EFO A;  3JVZ X;  3C0R B;  4ZDV A;  4G11 A;  1WZ0 A;  5LXH A;  2Y5B B;  2C7H A;  2N1V A;  3DVG X;  3LDZ E;  4PS7 A;  1FXT B;  2B3A A;  4MEL A;  5LLI A;  2UYZ B;  5JHA A;  3EFU A;  2BYV E;  2KLC A;  2KDB A;  3AU5 A;  4MGZ E;  4G50 A;  2N9X A;  4OVU A;  3VTU A;  5J2R A;  1BT0 A;  2NS5 A;  4HLE A;  4LJO B;  5E6P A;  4BBN F;  4MJS B;  4HJK A;  4B6W A;  4DHZ B;  4X57 B;  1LFD A;  4M8N A;  4NJ7 A;  2AWT A;  1WGH A;  3V6E B;  3ZTC A;  2PJH A;  4EZJ A;  2KZR A;  1NI2 A;  2WX1 A;  2ZEQ A;  1YX6 B;  3SU8 X;  1WGG A;  5D2M B;  2CS4 A;  5L95 C;  1NDD A;  4RM8 A;  3BIN A;  1Q1O A;  4FAD A;  2XBB C;  4A20 A;  1Z2M A;  4CHK A;  3OAW A;  1ISN A;  3VXW A;  3APC A;  4TQ1 A;  1S3S G;  1TBE A;  5D7G A;  3SD5 A;  2G3Q B;  2FCM A;  4MGI E;  3H7P B;  3ZNZ B;  4HWI B;  4MSM B;  4LDT D;  4G3X B;  1WGY A;  2ZVN A;  2MLB A;  1WYW B;  1XT9 B;  4MDK E;  2MBO A;  1I42 A;  2LGY A;  2JVC A;  2KFK B;  5CHV C;  4XC2 A;  4BOS C;  3NY5 A;  5CX3 A;  1L7Y A;  4ANX A;  2N7E A;  1V86 A;  1SE9 A;  3R3M A;  4IC7 B;  5AEK B;  2KMC A;  2PE6 B;  4DBG A;  2KLG A;  1CMX B;  3SHQ A;  4HDQ A;  1U4A A;  4AWJ A;  1QZE A;  1V5T A;  3DVG Y;  1WX9 A;  3A9J B;  1WGD A;  3A33 B;  4K81 A;  4W9D A;  3W1S A;  1GJZ A;  2NR2 A;  1UZX B;  4LCD E;  3QAR A;  2KC1 A;  1YD8 U;  2G4D B;  3IFW B;  3TCA A;  1J0G A;  2QHO A;  4IG7 B;  2REX A;  4TQ0 A;  1M94 A;  1GG3 A;  4GDK A;  4EZL A;  3P2B A;  2LGX A;  3VTW A;  2LXA A;  3DDC B;  5C1Z A;  3V62 A;  1C3T A;  4CYE A;  3L0W B;  4DDI D;  3UIP B;  1GC7 A;  2CU1 A;  3HIZ A;  4HK2 A;  3T9L A;  5L83 A;  1KLV A;  2EKE C;  4W9E A;  3QA8 A;  3ZNH B;  3DVN U;  3PRE A;  4MGY E;  2IBI B;  1LQB A;  2G45 B;  3EC8 A;  1WMH B;  4K7U A;  4MM3 A;  2KDF B;  4PS3 A;  2ZPN A;  1EUV B;  2JXX A;  1WJ4 A;  2LVQ A;  3APF A;  3LJ3 A;  4NNJ B;  1KOT A;  1WX7 A;  4B95 A;  3PSE B;  1H8C A;  2MCN B;  4ZYN A;  2MRP A;  1WJU A;  1WF9 A;  4EEW A;  1J19 A;  5KHQ A;  1LXD A;  3D32 A;  3RZF A;  3IG3 A;  5CHF A;  4ASW C;  2GBK A;  4P7I A;  2GMI C;  2KQ7 A;  3ZRF A;  3UQB A;  4NAW B;  1WXM A;  4MH0 E;  1RRB A;  2DZM A;  4FJY A;  4KDI C;  2KTR B;  4BVU C;  1XD3 B;  2RPQ A;  3HM6 X;  3HHM A;  3ZNI D;  3H7P A;  2JRI B;  4E74 A;  4FJZ A;  2AYO B;  1WY8 A;  3L54 A;  2RGF A;  1L2N A;  3M95 A;  2AEH A;  5EDS A;  1WJN A;  3ZIM A;  3R66 C;  4NJ6 A;  2CHW A;  2KK8 A;  3VUX A;  4E3C A;  5DPR A;  2KFK A;  3DBH I;  2BYE A;  3QIJ A;  1OTR B;  1WR6 E;  2O6V B;  3WIM A;  1WXS A;  2K1F A;  2KJH B;  4BKG A;  2Z59 B;  3MJW A;  2CR5 A;  3ML9 A;  1RFA A;  4TKN A;  1KJT A;  5AZH A;  4ZRI A;  4FUL A;  4NY0 A;  4FN2 A;  2O2V B;  4GDL B;  2J0M A;  4ICV A;  3A9J A;  2OJR A;  2D2Q A;  2WX0 A;  3CSF A;  3PHW B;  4EOY A;  3H7S A;  2LRU A;  4FHJ A;  4IWP A;  2LXC A;  4K1R B;  1GC6 A;  4K7W A;  3H6N A;  4IM3 A;  4W9J A;  2BWF A;  3UIN B;  1WH3 A;  3WAO A;  3L08 A;  4W9C A;  2DHZ A;  1S1Q B;  4N9F 4;  3B08 A;  4PS8 A;  4M8M A;  3PV1 A;  2V3S A;  4WJO A;  2MQJ A;  2CHZ A;  2M0X A;  2NCN A;  1V80 A;  3ALB A;  3KUC B;  3PRP B;  4GB9 A;  2N9P C;  1SIF A;  3A1Q A;  5DPW A;  4KIK B;  3KH0 A;  4TV3 A;  3QK0 A;  2IYD B;  4YL8 A;  4BFR A;  4EUT A;  3QX1 A;  3R7Q A;  4AP4 C;  2LUE A;  1WMH A;  2RD0 A;  4IWQ A;  1OEY A;  3ZW3 A;  2K8H A;  1RAX A;  3NZS A;  5GMV A;  3IHP C;  4DK5 A;  3KYC D;  3PPA A;  4F7Z A;  1V2Y A;  3UGB B;  1EF5 A;  3RUI B;  2D10 A;  2K39 A;  4LJP B;  2ZZP B;  2LAS A;  4I6P A;  3VFK A;  4ANU A;  4DHJ D;  2BYF A;  1E8Y A;  1GNU A;  2L0T A;  3PGE A;  3KW5 B;  2N1W A;  3JW0 X;  4MSQ B;  2NBV B;  3DCG A;  2BF8 B;  3V61 A;  2NBW B;  1YQB A;  2JT4 B;  2L0F A;  3PTF C;  3PZD A;  4NAW A;  3W1Y A;  1WX8 A;  2KTR A;  2KVR A;  5CTR C;  2HTH A;  2NBU A;  3CST A;  2DEN B;  4FHK A;  2XK5 B;  3SDL C;  1LM8 B;  3RUL A;  3UF8 A;  1IP9 A;  1YIW A;  2FCQ A;  4RM9 A;  5JHB A;  2PE9 A;  2KDE B;  2ASQ A;  2JY6 A;  3KVF B;  2LD9 A;  2W9N A;  2LJ5 A;  3VH4 B;  4GU2 A;  2K6D B;  2C7N B;  2KOX A;  2JRH A;  4M0W B;  4GMV A;  3CMM B;  3ZUN A;  3VTV A;  2O2V A;  1IYF A;  2EMS A;  4WJP A;  2KX0 A;  3IBE A;  4AJW A;  1WJ6 A;  3QAQ A;  3QHT A;  3T8M A;  3WA0 A;  4B9K A;  2J0K A;  4DHJ B;  3GOE A;  4G0N B;  2AL3 A;  3HK0 A;  3X0W A;  2KX3 A;  1TZ1 A;  2D07 B;  4EKU A;  1P0R A;  3IVF A;  2K25 A;  4KV2 A;  4ZRK A;  4WWP A;  3VDZ A;  2M1M A;  4EZK A;  2JZZ A;  5TR5 A;  1WXV A;  2L7R A;  3L13 A;  4MJS A;  2O6V D;  2C5L C;  2HE7 A;  1WE6 A;  2KXJ A;  4PYZ A;  1IPG A;  1WIA A;  2YLM A;  4IM2 A;  5LXI B;  2FNJ B;  2GBR A;  2ZCC A;  2KFJ A;  4A3P A;  3VAW A;  2C60 A;  2FCN A;  2KKC A;  3PRZ A;  2KQS A;  3R7R A;  3UIO B;  2A4Z A;  5DCN A;  1E8W A;  2FID A;  4AOF A;  3DQV A;  4J6I A;  2L05 A;  5E6N A;  4HVB A;  3I3T B;  1YX5 B;  2IO1 B;  2MSE D;  5IAA C;  1UBQ A;  2M17 A;  3RT3 B;  3ECI A;  3QJZ A;  1TGZ B;  3ZNG C;  1YJ1 A;  1KM7 A;  3VUY A;  3AU4 A;  4OVV A;  4CO7 A;  1RLF A;  1V49 A;  4KSL C;  3WAM A;  4BKS D;  2HJ8 A;  5C23 A;  4ANW A;  2WWZ A;  1D3Z A;  2MWS B;  3VHT C;  4HCP B;  4AJY B;  4JQW C;  5D6J B;  1XQQ A;  5AZF A;  1TTN A;  4W9H A;  1X1M A;  3DOW A;  2BKR B;  3X23 A;  3PLU A;  2OOB B;  2M4N A;  5CHW A;  1UEL A;  1E7V A;  3B0A A;  2R2Q A;  1E8Z A;  3M3J A;  2M8S A;  3HM3 A;  2MBB B;  4FJV B;  4TUU A;  3QWZ B;  4BKT A;  2K6Q A;  1HE8 A;  4GOC A;  2JWZ A;  2V1Y A;  3CF6 E;  3DBS A;  4BBN C;  3DVN V;  2J0J A;  2MW5 A;  2YVC A;  3MHS D;  3PS6 A;  1UBI A;  4XZ4 A;  3JYU A;  2WDT B;  2GBM A;  3U30 A;  4URK A;  2DZJ A;  4K7S A;  3W1S C;  1K8R B;  3PLV A;  3TBL D;  2I1J A;  3TJP A;  1ZKH A;  4IM0 A;  2KJ6 A;  2CKH B;  3U7D A;  1WE7 A;  1OEY J;  1H4R A;  3OJ4 B;  3OLM D;  1OGW A;  2J7Q B;  4W9K A;  5J17 A;  1WM2 A;  3A4R A;  3RCZ A;  4GDK B;  1VD2 A;  3GZN I;  2KNB A;  5FR6 A;  2ZCB A;  4KSK C;  2GBN A;  3DBR I;  3VUW A;  3L17 A;  3Q3J A;  1Z5S B;  1WM3 A;  4AUQ C;  1WXA A;  4GIV A;  2DAJ A;  2LGD A;  5G55 A;  3ZRC A;  5D94 A;  2RSU A;  4ANV A;  3NHE B;  2KMA A;  1WFY A;  3KUD B;  4FBJ B;  4W9I A;  2PPH A;  3ZTD A;  2FUH B;  3N30 A;  2NPT B;  1V6E A;  1Y8R C;  4W9G A;  4MGK E;  5HKH A;  3L10 B;  2L3Z A;  1E7U A;  4WJN A;  1WI0 A;  3PVL A;  2FAZ A;  1E90 A;  4I6N B;  2KN5 A;  4GXB A;  1MG8 A;  1ZW7 A;  2JPH A;  3DBL I;  2VRR B;  4NQK E;  1J8C A;  2KAN A;  2KO3 A;  3ONS A;  1I35 A;  1F9J A;  2IY0 B;  3BY4 B;  5DPT A;  4DXA B;  1WR1 A;  2IY1 B;  4HDO A;  4E71 A;  4ICU A;  4BOZ B;  4W9F A;  3PHX B;  2HD5 B;  3M63 B;  3Q3F A;  2LVP A;  2Z0E B;  4PYU A;  3L16 A;  2O6V A;  2JF5 A;  2JUO A;  4II3 B;  2LWP A;  4F8C B;  2N9E B;  4GGQ A;  1V5O A;  3JSV B;  1P98 A;  3A9K B;  2CHX A;  2KTF A;  5AZG A;  3EEC A;  2L00 B;  2BPS A;  4GDL A;  5BO4 B;  2C9W B;  3RYT A;  1ZGU B;  3ZVV A;  1P1A A;  2BGF A;  1R4N I;  3K9O B;  2MBE A;  4DWF A;  1WRD B;  3TMP B;  2XEW A;  2KWV B;  2KDI A;  4W9L A;  3QCA A;  3ML8 A;  1AAR A;  4HXD A;  2ZJD A;  3M62 B;  3ENE A;  2JZ3 B;  2LZ6 A;  4HPM B;  3QQ8 B;  1WZ3 A;  3DPD A;  3PT2 B;  4IWO A;  2MP2 B;  2FIF A;  2IO2 B;  3RZW C;  4KZC A;  4NQL B;  4A3O A;  3B1L X;  4BKS A;  2RR9 A;  2DZK A;  4JGH B;  2EMT A;  1A5R A;  1E5W A;  3QC8 B;  2ZPY A;  2NVU I;  5E6O A;  2D3G A;  4KDL B;  3ZO5 B;  4KIK A;  2K8B A;  5KHO A;  2WYQ A;  2KJR A;  3MTN B;  1E8X A;  1C1Y B;  4GN1 A;  2DAF A;  3KUZ A;  4JL9 A;  4I6L B;  3VVW B;  4LDT B;  3UQA A;  3TIX A;  2LRW A;  4HCN B;  1V9J A;  3WAP A;  3ZKJ C;  2MA9 B;  1PQS A;  2N4F A;  3EHV A;  4DDG D;  3AXC A;  1UGM A;  3A1Q B;  2ZNV C;  3RD2 A;  1P3Q U;  2BKF A;  2DX5 B;  2ZNV B;  2MBH A;  3TL5 A;  2IO0 B;  2LVO A;  1SGH A;  2G4S A;  4WAA A;  2GBJ A;  3VH3 B;  1UH6 A;  2NPT A;  3N3K B;  2L76 A;  4WWN A;  3V6C B;  3NS8 A;  3V60 A;  1R4M I;  4IUM B;  4NPN A;  2DYB A;  2KD0 A;  2KHW B;  4GSW A;  2V4L A;  3H1U A;  1GUA B;  3VQI A;  3AI5 A;  2I1K A;  4RMA A;  4JLC A;  3S2A A;  5DPS A;  2IZV B;  2MBQ A;  4KZ0 A;  5JZE B;  1P9D U;  2ZVO A;  2DYM A;  4WWO A;  4WJQ A;  2KC2 A;  2XK5 A;  3PRM B;  4FLH A;  5G2N A;  3ZLZ A;  2LI5 A;  1NBF C;  1Q5W B;  4JIO U;  2DYO A;  3NOB A;  4XX5 A;  2KWU B;  3KYD D;  5J18 A;  1VCB A;  1EO6 A;  3N32 A;  4HPL B;  1V81 A;  2C7M B;  3H9D A;  4KVG B;  3APD A;  2GOW A;  3U8Z A;  3AUL A;  2BWE S;  1EF1 A;  3JSV A;  3K9P B;  3A9K A;  1Q0W B;  4IW0 A;  3WAN A;  5IA7 A;  1OQY A;  2PEA A;  1JRU A;  2FCS A;  2Z0D B;  2R2O A;  3O65 B;  1UD7 A;  3A4S C;  2DZI A;  4WQO B;  1T0Y A;  2IO3 B;  2UWQ A;  2MX2 A;  2AL6 A;  4MEM A;  3NZU A;  4ZRJ A;  3WAL A;  3OJ3 A;  2K8C A;  2D11 A;  4FA6 A;  2A5U A; 
#chains in the Genus database with same CATH topology
 1XO3 A;  2MP2 A;  3GP7 A;  2KWC A;  1AN8 A;  3JVZ X;  4K3B A;  4G11 A;  4BZA A;  2Y5B B;  5JHA A;  4B0M A;  4JWS C;  3EFU A;  1YJI A;  2KDB A;  3AU5 A;  4MGZ E;  1AW7 A;  4G50 A;  4OVU A;  4FXC A;  5E6P A;  4MJS B;  1RM6 C;  4DHZ B;  4XGA B;  3DBL B;  1LFD A;  3BK2 A;  3EA6 A;  2PKO A;  4RGO S;  1NDD A;  4RM8 A;  4FAD A;  1Z2M A;  4CHK A;  5TSS A;  1HZ6 A;  3APC A;  4TQ1 A;  1TBE A;  3ZGZ A;  2I38 A;  3SD5 A;  2FCM A;  1R4N B;  2DWQ A;  3AV8 A;  2RDG A;  2ZVN A;  1TKE A;  1I42 A;  2NTS A;  4ANX A;  5CX3 A;  1L7Y A;  4IC7 B;  5AEK B;  2KMC A;  4C00 A;  1L0V B;  2KLG A;  3SHQ A;  4HDQ A;  3DVG Y;  3A9J B;  3A33 B;  4K81 A;  4KGR A;  2NR2 A;  2W3S A;  3ZXR A;  4LCD E;  3QAR A;  2KC1 A;  2G4D B;  3IFW B;  4TQ0 A;  1M94 A;  4EZL A;  3TEY A;  3FC4 A;  5C1Z A;  3HIZ A;  2CU1 A;  3T9L A;  1TT5 B;  3HUI A;  3ZNH B;  3PRE A;  4MGY E;  1LQB A;  2G45 B;  2BVC A;  1ZDV A;  1SIJ A;  1SE4 A;  4ZYN A;  2KN4 A;  1WJU A;  1WF9 A;  1J19 A;  3IG3 A;  1KLU D;  1WXM A;  2DZM A;  4KDI C;  3HM6 X;  4FJZ A;  2HTM E;  4WIP A;  1F2R C;  1CZP A;  2AEH A;  5EDS A;  3R66 C;  4NJ6 A;  1SSN A;  3AE5 B;  1TKG A;  5BMH A;  2KFK A;  2BYE A;  1OTR B;  1WR6 E;  2Y5P A;  3WIM A;  4JWU C;  1QOA A;  4BKG A;  1XXG A;  2WXO A;  4ZHP A;  1KJT A;  1MI0 A;  2O2V B;  2J0M A;  4ICV A;  2OJR A;  2N9L A;  2WX0 A;  4M00 A;  3NVZ A;  2AQ1 B;  1VJK A;  4K1R B;  3U52 E;  4W9J A;  2D3C A;  3I57 A;  3TSS A;  1WH3 A;  3UIN B;  2LGI A;  4XE0 A;  3P4S B;  4PS8 A;  2CHZ A;  1FPY A;  1NYQ A;  4KIK B;  4MT5 A;  3QK0 A;  1FMA D;  4IWQ A;  4US8 A;  2K8H A;  2WGS A;  1DOI A;  3KYC D;  1SF0 A;  1MPE A;  4N6E B;  1XLQ A;  1T0Q C;  2BYF A;  3PGE A;  2L0T A;  5H92 C;  2FE8 A;  3PZD A;  3B2G A;  3W1Y A;  2IJ0 A;  4Q2J A;  3CST A;  1JWM D;  1QT9 A;  3RUL A;  3WCQ A;  4GLS C;  2QMT A;  2LD9 A;  2WNM A;  2BS2 B;  2Y3A A;  4GU2 A;  4AS1 A;  2C7N B;  1C76 A;  1OQQ A;  4M0W B;  4GMV A;  3ZUN A;  1IYF A;  3R8B A;  2IGD A;  2FBW B;  1WJ6 A;  3T8M A;  4B9K A;  3WA0 A;  4DHJ B;  2J0K A;  5IO9 A;  3P1M A;  4HKQ A;  1TZ1 A;  2M1M A;  5TR5 A;  3L13 A;  4MJS A;  4OHJ A;  2C5L C;  2KFJ A;  1RFK A;  1J7A A;  2QIE B;  3UIO B;  1E8W A;  4AOF A;  2L05 A;  3I3T B;  1UBQ A;  2M17 A;  1QOF A;  3ZNG C;  3HRD D;  2JYT A;  3AM9 A;  4CO7 A;  4KSL C;  3WAM A;  2HJ8 A;  5FK9 C;  5C23 A;  1IBX A;  4KGS A;  5D6J B;  1TTN A;  4RGN A;  4M01 A;  2M4N A;  1UEL A;  2JYE A;  2PTL A;  3B0A A;  1E8Z A;  3QWZ B;  1VZ7 A;  2MHJ A;  1TS2 A;  4LTU A;  3DBS A;  3DVN V;  2YVC A;  3MHS D;  3JYU A;  2GBM A;  4URK A;  2DZJ A;  4K7S A;  3TEW A;  3TBL D;  4IM0 A;  2KJ6 A;  1WM2 A;  1UUP A;  3RCZ A;  4GDK B;  1T6B X;  1VD2 A;  4LNO A;  3GZN I;  1VZ8 A;  2ZCB A;  1Y56 A;  4LNI A;  3BVM A;  2GRI A;  5D94 A;  2RSU A;  1WFY A;  3KUD B;  4W9I A;  1EU4 A;  1Y8R C;  4W9G A;  5HKH A;  3L10 B;  4I6N B;  4GXB A;  1KH0 A;  2CJO A;  3DWG C;  2VRR B;  4NQK E;  1UWM A;  1VZ6 A;  5DPT A;  2XNA C;  1RWS A;  3Q3F A;  1TIF A;  2LVP A;  1NI3 A;  2JUO A;  4F8C B;  3EEC A;  2L00 B;  5BO4 B;  3TMP B;  4TMA B;  3QCA A;  3ML8 A;  1VLB A;  1D5Z C;  4PT5 A;  2LZ6 A;  4HPM B;  2MP2 B;  1PUT A;  3BVZ A;  3IT4 B;  4ARI A;  3OWE B;  4BKS A;  2RR9 A;  1B1Z A;  2DZK A;  4JGH B;  1JWU D;  1A5R A;  3QC8 B;  2LGS A;  2BS4 B;  3ZO5 B;  4KIK A;  2KJR A;  1SJE D;  4I6L B;  3VVW B;  1V9J A;  2MA9 B;  1PQS A;  1XCQ L;  3A1Q B;  1PFD A;  2INP E;  1ZOY B;  1QIL A;  2K5P A;  2G4S A;  5G5G A;  1K52 A;  1UH6 A;  2NPT A;  1D6E C;  4WWN A;  3AEF B;  2KD0 A;  2KHW B;  4GSW A;  1GUA B;  4JLC A;  2MBQ A;  2SAK A;  4KZ0 A;  5JZE B;  1NBF C;  1C4A A;  3NOB A;  1VRA B;  1V81 A;  3H9D A;  4KVG B;  3FKY A;  2E6X A;  2BWE S;  1J7C A;  3W2D A;  3JSV A;  4M0W A;  1PGA A;  3O65 B;  2DZI A;  4WQO B;  1N62 A;  2UWQ A;  3Q8A A;  4FA6 A;  3AE3 B;  4II2 B;  2V0G A;  2E3T A;  4DHZ E;  2PVO D;  4EFO A;  3C0R B;  1KF6 B;  3N20 C;  3NJT A;  3LDZ E;  2Y5C A;  4PS7 A;  2UYZ B;  1WRI A;  3MC9 A;  2BYV E;  5J2R A;  2N9X A;  1GPX A;  1I4P A;  2V4I B;  4HJK A;  4B6W A;  5BYS A;  4M8N A;  4NJ7 A;  2AWT A;  1L4Z B;  3ZTC A;  1XLP A;  2PJH A;  2WX1 A;  2WQY B;  2CS4 A;  5L95 C;  4A20 A;  4N59 A;  4OZB A;  1S3S G;  1DOY A;  1SE3 A;  4NJC A;  4RF0 A;  3ZNZ B;  4LDT D;  3BII D;  2MLB A;  3R2I A;  1JWS D;  2G1E A;  5BMG A;  2JVC A;  2KFK B;  5CHV C;  3RNE C;  3RNA C;  1C77 A;  4PK1 A;  1CMX B;  1D5M C;  4AWJ A;  1U4A A;  1QZE A;  5MPO A;  1WX9 A;  2KMM A;  1GJZ A;  2BT6 A;  4DQO C;  1YD8 U;  3RPF C;  2LEK A;  4GDK A;  4XDC A;  3P2B A;  3DDC B;  1C3T A;  4CYE A;  3L0W B;  1YN5 A;  1GC7 A;  2MJD A;  3UIP B;  3LB8 C;  1KLV A;  4W9E A;  3QA8 A;  3C8Y A;  2IBI B;  1JAL A;  3EC8 A;  2H88 B;  1AWD A;  3IXS A;  1ESF A;  3FIL B;  3EFC A;  2JXX A;  1UF0 A;  3ZJT A;  3APF A;  1KOT A;  4ITK A;  1MG4 A;  5KHQ A;  2WXJ A;  1LXD A;  3NVV A;  1E9M A;  2XN9 C;  2GBK A;  2GMI C;  3ZRF A;  2VH1 A;  3UQB A;  3AE1 B;  4BVU C;  5LNK 1;  3RNB C;  5G5H A;  1XD3 B;  2RPQ A;  3ZNI D;  2JRI B;  2IND C;  5BYQ A;  1WJN A;  2KVZ A;  1DGJ A;  3VUX A;  1FCL A;  4KX6 B;  3DBH I;  3QIJ A;  1FXI A;  2KJH B;  3AE2 B;  2CU3 A;  3AEA B;  2LUM A;  4FUL A;  3RMK C;  4FN2 A;  3P63 A;  2SEB D;  1KTK A;  1PGB A;  3MC8 A;  4WWM A;  1C4P A;  4IKG A;  3NZ3 A;  3AH7 A;  3OG5 A;  4W9C A;  2DHZ A;  3GE8 C;  1S1Q B;  4M8M A;  2V3S A;  2MQJ A;  3URY A;  3ALB A;  2L32 A;  3P4Q B;  2N9P C;  2TSS A;  1SIF A;  3A1Q A;  3KH0 A;  4YL8 A;  3QX1 A;  3R7Q A;  1WMH A;  2RD0 A;  1N60 A;  4KGT A;  1TS4 A;  1RAX A;  3NZS A;  3PPA A;  3U4E G;  4F7Z A;  1EF5 A;  2K39 A;  2LAS A;  4ANU A;  4ZRP A;  3N1X C;  1IBX B;  2BF8 B;  3VR8 B;  2JT4 B;  4NAW A;  2KTR A;  1K51 A;  5CTR C;  1F0Z A;  2HTH A;  1F1H A;  2XK5 B;  3RN9 C;  1LM8 B;  2WXG A;  1D5X C;  5IN7 A;  3UF8 A;  4BAX A;  1IP9 A;  1YIW A;  2FCQ A;  3RNG C;  2KDE B;  2WXM A;  2BW2 A;  3KVF B;  2W9N A;  3TUO A;  1SB3 C;  3CMM B;  1GB1 A;  3VTV A;  2BTE A;  3IBE A;  3QAQ A;  1T0S C;  3QHT A;  3NVW A;  1I4Q A;  1P0R A;  2K25 A;  5GXG B;  5HG2 A;  4KV2 A;  2Z8L A;  1VR9 A;  1WXV A;  2L7R A;  2FNJ B;  3BYT B;  4NAM A;  1YQ3 B;  2DNF A;  2KQS A;  3PRZ A;  3R7R A;  2FID A;  3Q8C A;  4HVB A;  5E6N A;  2MSE D;  3QJZ A;  2GB1 A;  1YJ1 A;  1KM7 A;  2BBC A;  3Q8E A;  3VUY A;  3AU4 A;  1IGD A;  1PDX A;  5IKC M;  1V49 A;  2JZP A;  3VRB B;  1HZ5 A;  1D3Z A;  3VHT C;  4AJY B;  1XQQ A;  4W9H A;  2RDB C;  2G9H D;  2KQ4 X;  2OOB B;  1E7V A;  1JWB D;  3E56 A;  5C2T B;  2MBB B;  4FJV B;  2R61 A;  4BKT A;  2JWZ A;  2V1Y A;  1I4G A;  2KAC A;  1B9R A;  5HFY A;  2J0J A;  2MW5 A;  2PVG C;  2BYT A;  4XZ4 A;  3U30 A;  1MHX A;  1ZKH A;  3W9C B;  1I7H A;  1OEY J;  3OJ4 B;  3OLM D;  1QQR A;  4W9K A;  3A4R A;  2AX5 A;  1DYQ A;  3N1Y C;  2GBN A;  3DBR I;  3FIL A;  2DLB A;  4AUQ C;  3ZRC A;  3BWU D;  3NHE B;  1WXQ A;  2PPH A;  1N6Z A;  4MM3 B;  2NPT B;  2QJL A;  3R2T A;  4UDU C;  4MGK E;  2HJ1 A;  1MVK A;  4WJN A;  1E90 A;  2W3R A;  5EE3 A;  1L0X B;  3DBL I;  2W54 A;  5AUI A;  1YN4 A;  1I35 A;  1F9J A;  2IY0 B;  3BY4 B;  3BYY B;  2IY1 B;  4E71 A;  4ICU A;  4BOZ B;  3T3N A;  3PHX B;  3UI3 A;  3I9V 1;  3M63 B;  3L16 A;  2JF5 A;  2X8X X;  1C79 A;  5D3I B;  3TEZ A;  4GGQ A;  1V5O A;  2WXR A;  3JSV B;  1HTQ A;  4YSX B;  5HI1 A;  3RYT A;  2C9W B;  1ZGU B;  2K3U A;  1XCT L;  2WXI A;  1R4N I;  2MBE A;  4DWF A;  1WRD B;  4XDD A;  1AAR A;  4HXD A;  3M62 B;  4IWO A;  1WZ3 A;  2Q5W D;  5BYR A;  2JU6 X;  3B1L X;  1E5W A;  1T0R C;  2NVU I;  1QKZ A;  2D3G A;  4DXG A;  4C4V A;  3MTN B;  1E8X A;  1C1Y B;  4HEA 1;  4LDT B;  3TIX A;  1WYG A;  3ABV B;  2VZK D;  3AEC B;  2ZNV B;  3TL5 A;  2LVO A;  4WAA A;  2GBJ A;  2ZW1 A;  3VH3 B;  1EU3 A;  2VH2 A;  2L83 A;  3NS8 A;  1A70 A;  1ZXI A;  1R4M I;  4IUM B;  4NPN A;  4YTP B;  2I1K A;  4C56 C;  3S2A A;  5DPS A;  2ZVO A;  4WWO A;  2XK5 A;  3PRM B;  4FLH A;  3V05 A;  5G2N A;  2MEK A;  3KYD D;  5J18 A;  3I5J C;  4HPL B;  4YXD B;  5IP4 D;  3APD A;  2GOW A;  4IW0 A;  3A9K A;  1Q0W B;  1CK1 A;  3WAN A;  5IA7 A;  1JRU A;  2FCS A;  3W5V B;  3A4S C;  2ACZ B;  2I2Y A;  4OZC A;  4LNN A;  4YSZ B;  2JXT A;  2JSV X;  3EUB 2;  4F1S A;  5JH5 C;  1WGR A;  2V3N A;  1FEH A;  2N7D A;  2WXN A;  1XF5 L;  1KRH A;  2J4X A;  5LXH A;  3Q14 C;  1HEZ E;  1NEK B;  4L2Y A;  1FRR A;  3DVG X;  1F77 A;  2B3A A;  5LLI A;  3VTU A;  2KLC A;  4YT0 B;  2NS5 A;  4HLE A;  4BBN F;  4CQN A;  2RPV A;  4HRO A;  3J9C A;  3V6E B;  2D5G A;  4EZJ A;  1UGJ A;  1I4H A;  1NI2 A;  1KLG D;  5D2M B;  1V8C A;  4A55 A;  3BIN A;  1Q1O A;  1ISN A;  1ZXH A;  3VXW A;  1GB4 A;  4HPP A;  2WXL A;  1XLN A;  1JRO A;  2G3Q B;  3KQ4 A;  3MHZ A;  5D3D A;  4HWI B;  1BML C;  4MSM B;  5I4D A;  1WGY A;  4REZ A;  4MDK E;  2MBO A;  4N58 A;  1T5X D;  2LGY A;  4XC2 A;  3NY5 A;  3NUH B;  4TSS A;  1V86 A;  1SE9 A;  3R3M A;  2AQ2 B;  1V5T A;  4W9D A;  3W1S A;  1XLO A;  1V1P B;  4O1N A;  1J0G A;  2PMV A;  4LNF A;  1GG3 A;  2IGG A;  2QCZ A;  1L5P A;  2LGX A;  2LXA A;  1ET9 A;  4XYC A;  2WXQ A;  4DDI D;  2AQ3 B;  2RDH A;  2MH7 A;  5HHD G;  1LGR A;  1NVI D;  4NZL B;  1WMH B;  4K7U A;  4MM3 A;  4PS3 A;  1V97 A;  1ACC A;  1EUV B;  2BQQ A;  2WDV B;  3NS1 A;  3T3O A;  1E10 A;  2V3P A;  3LJ3 A;  5EE9 A;  1WX7 A;  4B95 A;  1XEE A;  3PSE B;  1IGC A;  1SJH D;  1H8C A;  2MCN B;  2OJW A;  3FAH A;  1EWY C;  2L1A A;  1FD6 A;  1CQV A;  1VDV A;  3D32 A;  3RZF A;  1QOB A;  4ASW C;  4P7I A;  1TYG B;  4NAW B;  1RRB A;  4FJY A;  2KTR B;  3NG0 A;  3H7P A;  1WY8 A;  1NYR A;  2KK8 A;  2K1F A;  2CR5 A;  1F2R I;  3ML9 A;  1RFA A;  2OHF A;  3GB1 A;  4TKN A;  5AZH A;  4ZRI A;  4NY0 A;  2JX5 A;  4GDL B;  3O13 A;  2D2Q A;  4YSY B;  2EKI A;  2QSD A;  4OZA A;  3PHW B;  3H7S A;  2KDM A;  2LRU A;  4FHJ A;  4IWP A;  2LXC A;  1GC6 A;  4K7W A;  3H6N A;  4IM3 A;  2BWF A;  4RH6 A;  1J7B A;  3WAO A;  3L08 A;  4N9F 4;  2M0A A;  1STE A;  3EGR A;  2M0X A;  2X38 A;  1TJE A;  3KUC B;  4GB9 A;  4HKZ E;  2K9X A;  2K0P A;  2N9K A;  4RNA A;  5DPW A;  4TV3 A;  2IYD B;  2WHI A;  4EUT A;  4AP4 C;  1N63 A;  1I4R A;  3AE8 B;  3IHP C;  5GMV A;  4ZOH C;  2D10 A;  1FRD A;  4LJP B;  2ZZP B;  4DHJ D;  3AN1 A;  1N5X A;  1GNU A;  5T8I A;  4MSQ B;  1RYJ A;  2D3B A;  3DCG A;  1FXA A;  3VRA B;  1WX8 A;  2KVR A;  3AEE B;  1P7F A;  2NBU A;  1PYW D;  3SDL C;  2DBY A;  4EE2 A;  4LK0 M;  3ZJU A;  5JHB A;  4RGM A;  2LJI A;  2JY6 A;  1D4B A;  3IT6 B;  2JRH A;  2EMS A;  3RI7 C;  2KX0 A;  2INC C;  2W55 A;  3CWI A;  3GOE A;  4G0N B;  4LLG M;  2AL3 A;  2HDE A;  1ZUD 2;  2KX3 A;  4EKU A;  3SFE B;  4RF1 A;  4ZRK A;  3HVD A;  4QAY A;  1KFY B;  3Q8B A;  4WUR A;  2JZZ A;  2ONQ A;  2O6V D;  2HE7 A;  4JPS A;  1WE6 A;  2KXJ A;  4PYZ A;  1WIA A;  2MJ3 A;  4IM2 A;  2ZCC A;  1FNU A;  2C60 A;  1AYF A;  2J53 A;  3AE4 B;  1YX5 B;  2IO1 B;  5IAA C;  3RT3 B;  1E6E B;  2M19 A;  3B9J A;  1K50 A;  3ZXV A;  2N7J A;  1RLF A;  2WU2 B;  4XWW A;  4HCP B;  4JQW C;  5AZF A;  3NVY A;  4XWT A;  2BKR B;  3PLU A;  5CHW A;  3M3J A;  3PZ7 A;  1WWT A;  3AEG B;  4TUU A;  3ZQ4 A;  4GOC A;  3L4P A;  4C7Z A;  1V1P A;  2VZK B;  4BBN C;  3PS6 A;  4RGT A;  1C78 A;  3W1S C;  4WH4 A;  1HXY D;  2I1J A;  3TJP A;  2CKH B;  3Q3M C;  1H4R A;  3DBR B;  2J7Q B;  5J17 A;  3AEB B;  4C4V B;  2KNB A;  5FR6 A;  1GOZ A;  3VUW A;  1FNW A;  3L17 A;  1Z5S B;  3IAM 1;  1WM3 A;  4AQ7 A;  1WXA A;  4GIV A;  2DAJ A;  2LGD A;  5G55 A;  5EE1 A;  4ANV A;  2KYW A;  4FBJ B;  3AE6 B;  3ZTD A;  2WDQ B;  1WI0 A;  3PVL A;  2FAZ A;  2KN5 A;  2PIA A;  1V1O A;  1MG8 A;  3AMZ A;  2JPH A;  2L52 A;  2KO3 A;  3ONS A;  1HA5 A;  1WR1 A;  4HDO A;  2KWD A;  1YMH E;  4W9F A;  4YTM B;  2HD5 B;  2WS3 B;  4P1C C;  4PYU A;  2Z0E B;  3LYY A;  1L6V A;  4L1B A;  4A90 A;  2CJN A;  4MAC A;  1FO4 A;  1T3Q A;  3A9K B;  2KTF A;  1TY2 A;  4GDL A;  3ZVV A;  4S0R A;  2BGF A;  3K9O B;  2MJE A;  4W9L A;  1TS3 A;  2ZJD A;  3ENE A;  2JZ3 B;  1R7S A;  2GI9 A;  3DPD A;  1PGX A;  2FIF A;  3DWM A;  3RZW C;  4A6Q A;  3Q6B A;  4NQL B;  1M4V A;  1QF6 A;  4KDL B;  3RNC C;  5KHO A;  1SXT A;  3AE9 B;  4GN1 A;  4JL9 A;  2J52 A;  1FNV A;  3PO0 A;  2LRW A;  4HCN B;  3WAP A;  2N4F A;  3EHV A;  3AXC A;  1UGM A;  2WLB A;  2ZNV C;  3RD2 A;  1P3Q U;  2W82 A;  2BKF A;  2DX5 B;  2MBH A;  1R4M B;  1SGH A;  3GE3 C;  3N3K B;  3V6C B;  3V60 A;  2WXH A;  2DYB A;  2V4L A;  4RMA A;  1E0Z A;  1P9D U;  2KC2 A;  1VCB A;  1FIQ A;  2C7M B;  4B0E A;  1EWC A;  2BB6 A;  3U8Z A;  3AUL A;  3K9P B;  1WSP A;  2PEA A;  2R2O A;  1UD7 A;  2QEJ C;  4MH8 A;  3NZU A;  5AUK A;  4ZRJ A;  3WAL A;  3OJ3 A;  3GZN B;  2K8C A;  2D11 A;  3E9S A;  5H8Y E;  1C4C A;  2L8J A;  3ZDT A;  1G6J A;  3ZDM C;  4KKI A;  3Q2A C;  2WDR B;  4ZDV A;  2WXK A;  1WZ0 A;  3Q8F A;  2C7H A;  2N1V A;  1YQ4 B;  3PZ8 A;  1FXT B;  4MEL A;  1C9F A;  4DXF A;  1BT0 A;  4LJO B;  4K3C A;  4R3D A;  2B76 B;  4X57 B;  4KKJ A;  1WGH A;  2INN E;  3P42 A;  2KZR A;  2ZEQ A;  1YX6 B;  3SU8 X;  1WGG A;  4A8X C;  1JQ4 A;  2XBB C;  3OAW A;  4IOI E;  1EM7 A;  4M02 A;  5D7G A;  3MFG A;  2BB5 A;  4MGI E;  3H7P B;  4G3X B;  3ZJV A;  1OFF A;  1WYW B;  1XT9 B;  1BXT A;  3MP9 A;  1SBB B;  4BOS C;  2N7E A;  2QIL A;  1OQR A;  2PE6 B;  4DBG A;  4A9A A;  1WGD A;  3C19 A;  3CIR B;  1UZX B;  2IGH A;  3ZYY X;  2KT7 A;  3TCA A;  2QHO A;  1ROE A;  4IG7 B;  1N61 A;  2REX A;  3P4P B;  2J42 A;  3BK1 A;  2LMC A;  3VTW A;  1HTO A;  3V62 A;  1SEB D;  2WXF A;  4HK2 A;  5L83 A;  4ZRQ A;  4P6V F;  2EKE C;  1Q10 A;  4P1B C;  3LXF A;  1BUI C;  3DVN U;  3HVZ A;  2UU7 A;  2ZW0 A;  1FFV A;  2KDF B;  3VR9 B;  4WQM A;  2ZPN A;  1WJ4 A;  1TKY A;  2LVQ A;  4NNJ B;  1YN3 A;  2MRP A;  2V9H A;  4EEW A;  4D2K A;  5CHF A;  4JE3 B;  2KQ7 A;  2JWU A;  4MH0 E;  1FM0 D;  4ZHO A;  1L0Y B;  2JQR B;  3Q3O C;  3HHM A;  4E74 A;  3MJ5 A;  2AYO B;  3L54 A;  2RGF A;  1L2N A;  3M95 A;  2FUG 1;  3BVG A;  3ZIM A;  2CHW A;  4E3C A;  5DPR A;  2O6V B;  1WXS A;  2Z59 B;  3MJW A;  3SFD B;  2PW9 A;  4IDI A;  2D3A A;  3B2F A;  2QDF A;  3A9J A;  5E6J A;  3CSF A;  4EOY A;  2IDY A;  1JCK B;  1DOX A;  2H89 B;  1YJJ A;  3Q3N C;  3B08 A;  1JW9 D;  2ON8 A;  3PV1 A;  1E7P B;  4WJO A;  2NCN A;  1V80 A;  3PRP B;  1UWX A;  3ETR A;  4BFR A;  3SR6 A;  2LUE A;  1OEY A;  3ZW3 A;  4RFB A;  4DK5 A;  1TZO A;  1V2Y A;  3UGB B;  3RUI B;  2K22 A;  2LFI A;  1ET6 A;  1ZP0 B;  4I6P A;  3VFK A;  1MFW A;  1E8Y A;  3KW5 B;  2N1W A;  3JW0 X;  2NBV B;  3V61 A;  2NBW B;  1ENF A;  1YQB A;  2L0F A;  3PTF C;  3N9Y C;  5FKA C;  2DEN B;  4FHK A;  3W5U B;  4OVZ A;  4RM9 A;  2PE9 A;  3DHG C;  2ASQ A;  4YTN B;  2LJ5 A;  3VH4 B;  2K6D B;  2KOX A;  2O2V A;  4WJP A;  1IUE A;  2M56 B;  2RMM A;  4AJW A;  3HK0 A;  3KWV A;  3X0W A;  2D07 B;  3IVF A;  2BS3 B;  4WWP A;  3U7Z A;  3VDZ A;  2IPK D;  4EZK A;  4ARC A;  1IPG A;  2YLM A;  5LXI B;  2LHE A;  2GBR A;  2ICI A;  4LNK A;  4A3P A;  3VAW A;  2FCN A;  2KKC A;  2QC8 A;  2A4Z A;  5DCN A;  3H8H A;  3DQV A;  3MC0 B;  4J6I A;  1FFU A;  3RNF C;  3ECI A;  1ZE3 D;  1TGZ B;  4C7Y A;  2PLP A;  4OVV A;  4BKS D;  3DBH B;  5IOI A;  5C3J B;  4ANW A;  2WWZ A;  2MWS B;  1JRP A;  2YEP B;  3TEX A;  1MHH E;  3RFZ B;  1P7E A;  1X1M A;  3DOW A;  3X23 A;  4USA A;  2R2Q A;  2M8S A;  3HM3 A;  3N1Z C;  4L23 A;  2K6Q A;  1HE8 A;  2WU5 B;  1QLB B;  1YOV B;  3CF6 E;  1JML A;  1I4X A;  2EEL A;  1QOG A;  4H2A A;  1UBI A;  1L6U A;  2WDT B;  3U2S C;  4HRS A;  1K8R B;  5FR3 A;  3PLV A;  4J3O D;  3KWL A;  1LO5 D;  4OW0 A;  3U7D A;  1WE7 A;  2LHD A;  2WP9 B;  1OGW A;  2KAJ A;  4KSK C;  3AE7 B;  1F52 A;  3Q3J A;  1ZPS A;  3SEB A;  4WAF A;  2KMA A;  2FUH B;  3N30 A;  1V6E A;  1WGK A;  2L3Z A;  1E7U A;  1UNS A;  1TS5 A;  1ZW7 A;  3IAS 1;  2GLS A;  1J8C A;  2KAN A;  4DXA B;  2O6V A;  4II3 B;  2LWP A;  1JWA D;  2WXP A;  4P16 A;  2N9E B;  1NEN B;  1P98 A;  1N5W A;  2CHX A;  5AZG A;  2BPS A;  3AED B;  1P1A A;  1SE2 A;  1ZDX A;  2XEW A;  2KWV B;  3DHI C;  2KDI A;  3KLS X;  1TY0 A;  3QQ8 B;  4C80 A;  1CJE A;  3PT2 B;  2IO2 B;  4KZC A;  4A3O A;  5BMI A;  2N0S B;  4ACF A;  1L4D B;  2EMT A;  4S17 A;  4YWG G;  2ZPY A;  5E6O A;  1FCC C;  2K8B A;  2WYQ A;  2DAF A;  3KUZ A;  3NRZ A;  4ZYS A;  3UQA A;  3ZKJ C;  4DDG D;  3P4R B;  2IO0 B;  4JX1 C;  1K53 A;  5JXV A;  2L76 A;  4RCO A;  1YNT E;  3V3X A;  3H1U A;  3VQI A;  3AI5 A;  2IZV B;  2DYM A;  4WJQ A;  2OED A;  1GAQ B;  1HQR D;  3ZLZ A;  2LI5 A;  1Q5W B;  4JIO U;  2DYO A;  4XX5 A;  1MJD A;  2KWU B;  3I63 C;  5EE0 A;  1EO6 A;  3N32 A;  2NTT A;  1EF1 A;  3GS2 A;  1OQY A;  3AB5 A;  2Z0D B;  4US9 A;  1T0Y A;  2IO3 B;  4HJG E;  3DHH C;  3Q69 A;  2MX2 A;  2AL6 A;  2NMQ A;  3BZD B;  4MEM A;  2YEP F;  2A5U A; 
#chains in the Genus database with same CATH homology
 4F1S A;  5JH5 C;  2MP2 A;  2L8J A;  3ZDT A;  4II2 B;  1WGR A;  1G6J A;  2N7D A;  4DHZ E;  3ZDM C;  2KWC A;  4EFO A;  3JVZ X;  3C0R B;  4ZDV A;  4G11 A;  1WZ0 A;  5LXH A;  2Y5B B;  2C7H A;  2N1V A;  3DVG X;  3LDZ E;  4PS7 A;  1FXT B;  2B3A A;  4MEL A;  5LLI A;  2UYZ B;  5JHA A;  3EFU A;  2BYV E;  2KLC A;  2KDB A;  3AU5 A;  4MGZ E;  4G50 A;  2N9X A;  4OVU A;  3VTU A;  5J2R A;  1BT0 A;  2NS5 A;  4HLE A;  4LJO B;  5E6P A;  4BBN F;  4MJS B;  4HJK A;  4B6W A;  4DHZ B;  4X57 B;  1LFD A;  4M8N A;  4NJ7 A;  2AWT A;  1WGH A;  3V6E B;  3ZTC A;  2PJH A;  4EZJ A;  2KZR A;  1NI2 A;  2WX1 A;  2ZEQ A;  1YX6 B;  3SU8 X;  1WGG A;  5D2M B;  2CS4 A;  5L95 C;  1NDD A;  4RM8 A;  3BIN A;  1Q1O A;  4FAD A;  2XBB C;  4A20 A;  1Z2M A;  4CHK A;  3OAW A;  1ISN A;  3VXW A;  3APC A;  4TQ1 A;  1S3S G;  1TBE A;  5D7G A;  3SD5 A;  2G3Q B;  2FCM A;  4MGI E;  3H7P B;  3ZNZ B;  4HWI B;  4MSM B;  4LDT D;  4G3X B;  1WGY A;  2ZVN A;  2MLB A;  1WYW B;  1XT9 B;  4MDK E;  2MBO A;  1I42 A;  2LGY A;  2JVC A;  2KFK B;  5CHV C;  4XC2 A;  4BOS C;  3NY5 A;  5CX3 A;  1L7Y A;  4ANX A;  2N7E A;  1V86 A;  1SE9 A;  3R3M A;  4IC7 B;  5AEK B;  2KMC A;  2PE6 B;  4DBG A;  2KLG A;  1CMX B;  3SHQ A;  4HDQ A;  1U4A A;  4AWJ A;  1QZE A;  1V5T A;  3DVG Y;  1WX9 A;  3A9J B;  1WGD A;  3A33 B;  4K81 A;  4W9D A;  3W1S A;  1GJZ A;  2NR2 A;  1UZX B;  4LCD E;  3QAR A;  2KC1 A;  1YD8 U;  2G4D B;  3IFW B;  3TCA A;  1J0G A;  2QHO A;  4IG7 B;  2REX A;  4TQ0 A;  1M94 A;  1GG3 A;  4GDK A;  4EZL A;  3P2B A;  2LGX A;  3VTW A;  2LXA A;  3DDC B;  5C1Z A;  3V62 A;  1C3T A;  4CYE A;  3L0W B;  4DDI D;  3UIP B;  1GC7 A;  2CU1 A;  3HIZ A;  4HK2 A;  3T9L A;  5L83 A;  1KLV A;  2EKE C;  4W9E A;  3QA8 A;  3ZNH B;  3DVN U;  3PRE A;  4MGY E;  2IBI B;  1LQB A;  2G45 B;  3EC8 A;  1WMH B;  4K7U A;  4MM3 A;  2KDF B;  4PS3 A;  2ZPN A;  1EUV B;  2JXX A;  1WJ4 A;  2LVQ A;  3APF A;  3LJ3 A;  4NNJ B;  1KOT A;  1WX7 A;  4B95 A;  3PSE B;  1H8C A;  2MCN B;  4ZYN A;  2MRP A;  1WJU A;  1WF9 A;  4EEW A;  1J19 A;  5KHQ A;  1LXD A;  3D32 A;  3RZF A;  3IG3 A;  5CHF A;  4ASW C;  2GBK A;  4P7I A;  2GMI C;  2KQ7 A;  3ZRF A;  3UQB A;  4NAW B;  1WXM A;  4MH0 E;  1RRB A;  2DZM A;  4FJY A;  4KDI C;  2KTR B;  4BVU C;  1XD3 B;  2RPQ A;  3HM6 X;  3HHM A;  3ZNI D;  3H7P A;  2JRI B;  4E74 A;  4FJZ A;  2AYO B;  1WY8 A;  3L54 A;  2RGF A;  1L2N A;  3M95 A;  2AEH A;  5EDS A;  1WJN A;  3ZIM A;  3R66 C;  4NJ6 A;  2CHW A;  2KK8 A;  3VUX A;  4E3C A;  5DPR A;  2KFK A;  3DBH I;  2BYE A;  3QIJ A;  1OTR B;  1WR6 E;  2O6V B;  3WIM A;  1WXS A;  2K1F A;  2KJH B;  4BKG A;  2Z59 B;  3MJW A;  2CR5 A;  3ML9 A;  1RFA A;  4TKN A;  1KJT A;  5AZH A;  4ZRI A;  4FUL A;  4NY0 A;  4FN2 A;  2O2V B;  4GDL B;  2J0M A;  4ICV A;  3A9J A;  2OJR A;  2D2Q A;  2WX0 A;  3CSF A;  3PHW B;  4EOY A;  3H7S A;  2LRU A;  4FHJ A;  4IWP A;  2LXC A;  4K1R B;  1GC6 A;  4K7W A;  3H6N A;  4IM3 A;  4W9J A;  2BWF A;  3UIN B;  1WH3 A;  3WAO A;  3L08 A;  4W9C A;  2DHZ A;  1S1Q B;  4N9F 4;  3B08 A;  4PS8 A;  4M8M A;  3PV1 A;  2V3S A;  4WJO A;  2MQJ A;  2CHZ A;  2M0X A;  2NCN A;  1V80 A;  3ALB A;  3KUC B;  3PRP B;  4GB9 A;  2N9P C;  1SIF A;  3A1Q A;  5DPW A;  4KIK B;  3KH0 A;  4TV3 A;  3QK0 A;  2IYD B;  4YL8 A;  4BFR A;  4EUT A;  3QX1 A;  3R7Q A;  4AP4 C;  2LUE A;  1WMH A;  2RD0 A;  4IWQ A;  1OEY A;  3ZW3 A;  2K8H A;  1RAX A;  3NZS A;  5GMV A;  3IHP C;  4DK5 A;  3KYC D;  3PPA A;  4F7Z A;  1V2Y A;  3UGB B;  1EF5 A;  3RUI B;  2D10 A;  2K39 A;  4LJP B;  2ZZP B;  2LAS A;  4I6P A;  3VFK A;  4ANU A;  4DHJ D;  2BYF A;  1E8Y A;  1GNU A;  2L0T A;  3PGE A;  3KW5 B;  2N1W A;  3JW0 X;  4MSQ B;  2NBV B;  3DCG A;  2BF8 B;  3V61 A;  2NBW B;  1YQB A;  2JT4 B;  2L0F A;  3PTF C;  3PZD A;  4NAW A;  3W1Y A;  1WX8 A;  2KTR A;  2KVR A;  5CTR C;  2HTH A;  2NBU A;  3CST A;  2DEN B;  4FHK A;  2XK5 B;  3SDL C;  1LM8 B;  3RUL A;  3UF8 A;  1IP9 A;  1YIW A;  2FCQ A;  4RM9 A;  5JHB A;  2PE9 A;  2KDE B;  2ASQ A;  2JY6 A;  3KVF B;  2LD9 A;  2W9N A;  2LJ5 A;  3VH4 B;  4GU2 A;  2K6D B;  2C7N B;  2KOX A;  2JRH A;  4M0W B;  4GMV A;  3CMM B;  3ZUN A;  3VTV A;  2O2V A;  1IYF A;  2EMS A;  4WJP A;  2KX0 A;  3IBE A;  4AJW A;  1WJ6 A;  3QAQ A;  3QHT A;  3T8M A;  3WA0 A;  4B9K A;  2J0K A;  4DHJ B;  3GOE A;  4G0N B;  2AL3 A;  3HK0 A;  3X0W A;  2KX3 A;  1TZ1 A;  2D07 B;  4EKU A;  1P0R A;  3IVF A;  2K25 A;  4KV2 A;  4ZRK A;  4WWP A;  3VDZ A;  2M1M A;  4EZK A;  2JZZ A;  5TR5 A;  1WXV A;  2L7R A;  3L13 A;  4MJS A;  2O6V D;  2C5L C;  2HE7 A;  1WE6 A;  2KXJ A;  4PYZ A;  1IPG A;  1WIA A;  2YLM A;  4IM2 A;  5LXI B;  2FNJ B;  2GBR A;  2ZCC A;  2KFJ A;  4A3P A;  3VAW A;  2C60 A;  2FCN A;  2KKC A;  3PRZ A;  2KQS A;  3R7R A;  3UIO B;  2A4Z A;  5DCN A;  1E8W A;  2FID A;  4AOF A;  3DQV A;  4J6I A;  2L05 A;  5E6N A;  4HVB A;  3I3T B;  1YX5 B;  2IO1 B;  2MSE D;  5IAA C;  1UBQ A;  2M17 A;  3RT3 B;  3ECI A;  3QJZ A;  1TGZ B;  3ZNG C;  1YJ1 A;  1KM7 A;  3VUY A;  3AU4 A;  4OVV A;  4CO7 A;  1RLF A;  1V49 A;  4KSL C;  3WAM A;  4BKS D;  2HJ8 A;  5C23 A;  4ANW A;  2WWZ A;  1D3Z A;  2MWS B;  3VHT C;  4HCP B;  4AJY B;  4JQW C;  5D6J B;  1XQQ A;  5AZF A;  1TTN A;  4W9H A;  1X1M A;  3DOW A;  2BKR B;  3X23 A;  3PLU A;  2OOB B;  2M4N A;  5CHW A;  1UEL A;  1E7V A;  3B0A A;  2R2Q A;  1E8Z A;  3M3J A;  2M8S A;  3HM3 A;  2MBB B;  4FJV B;  4TUU A;  3QWZ B;  4BKT A;  2K6Q A;  1HE8 A;  4GOC A;  2JWZ A;  2V1Y A;  3CF6 E;  3DBS A;  4BBN C;  3DVN V;  2J0J A;  2MW5 A;  2YVC A;  3MHS D;  3PS6 A;  1UBI A;  4XZ4 A;  3JYU A;  2WDT B;  2GBM A;  3U30 A;  4URK A;  2DZJ A;  4K7S A;  3W1S C;  1K8R B;  3PLV A;  3TBL D;  2I1J A;  3TJP A;  1ZKH A;  4IM0 A;  2KJ6 A;  2CKH B;  3U7D A;  1WE7 A;  1OEY J;  1H4R A;  3OJ4 B;  3OLM D;  1OGW A;  2J7Q B;  4W9K A;  5J17 A;  1WM2 A;  3A4R A;  3RCZ A;  4GDK B;  1VD2 A;  3GZN I;  2KNB A;  5FR6 A;  2ZCB A;  4KSK C;  2GBN A;  3DBR I;  3VUW A;  3L17 A;  3Q3J A;  1Z5S B;  1WM3 A;  4AUQ C;  1WXA A;  4GIV A;  2DAJ A;  2LGD A;  5G55 A;  3ZRC A;  5D94 A;  2RSU A;  4ANV A;  3NHE B;  2KMA A;  1WFY A;  3KUD B;  4FBJ B;  4W9I A;  2PPH A;  3ZTD A;  2FUH B;  3N30 A;  2NPT B;  1V6E A;  1Y8R C;  4W9G A;  4MGK E;  5HKH A;  3L10 B;  2L3Z A;  1E7U A;  4WJN A;  1WI0 A;  3PVL A;  2FAZ A;  1E90 A;  4I6N B;  2KN5 A;  4GXB A;  1MG8 A;  1ZW7 A;  2JPH A;  3DBL I;  2VRR B;  4NQK E;  1J8C A;  2KAN A;  2KO3 A;  3ONS A;  1I35 A;  1F9J A;  2IY0 B;  3BY4 B;  5DPT A;  4DXA B;  1WR1 A;  2IY1 B;  4HDO A;  4E71 A;  4ICU A;  4BOZ B;  4W9F A;  3PHX B;  2HD5 B;  3M63 B;  3Q3F A;  2LVP A;  2Z0E B;  4PYU A;  3L16 A;  2O6V A;  2JF5 A;  2JUO A;  4II3 B;  2LWP A;  4F8C B;  2N9E B;  4GGQ A;  1V5O A;  3JSV B;  1P98 A;  3A9K B;  2CHX A;  2KTF A;  5AZG A;  3EEC A;  2L00 B;  2BPS A;  4GDL A;  5BO4 B;  2C9W B;  3RYT A;  1ZGU B;  3ZVV A;  1P1A A;  2BGF A;  1R4N I;  3K9O B;  2MBE A;  4DWF A;  1WRD B;  3TMP B;  2XEW A;  2KWV B;  2KDI A;  4W9L A;  3QCA A;  3ML8 A;  1AAR A;  4HXD A;  2ZJD A;  3M62 B;  3ENE A;  2JZ3 B;  2LZ6 A;  4HPM B;  3QQ8 B;  1WZ3 A;  3DPD A;  3PT2 B;  4IWO A;  2MP2 B;  2FIF A;  2IO2 B;  3RZW C;  4KZC A;  4NQL B;  4A3O A;  3B1L X;  4BKS A;  2RR9 A;  2DZK A;  4JGH B;  2EMT A;  1A5R A;  1E5W A;  3QC8 B;  2ZPY A;  2NVU I;  5E6O A;  2D3G A;  4KDL B;  3ZO5 B;  4KIK A;  2K8B A;  5KHO A;  2WYQ A;  2KJR A;  3MTN B;  1E8X A;  1C1Y B;  4GN1 A;  2DAF A;  3KUZ A;  4JL9 A;  4I6L B;  3VVW B;  4LDT B;  3UQA A;  3TIX A;  2LRW A;  4HCN B;  1V9J A;  3WAP A;  3ZKJ C;  2MA9 B;  1PQS A;  2N4F A;  3EHV A;  4DDG D;  3AXC A;  1UGM A;  3A1Q B;  2ZNV C;  3RD2 A;  1P3Q U;  2BKF A;  2DX5 B;  2ZNV B;  2MBH A;  3TL5 A;  2IO0 B;  2LVO A;  1SGH A;  2G4S A;  4WAA A;  2GBJ A;  3VH3 B;  1UH6 A;  2NPT A;  3N3K B;  2L76 A;  4WWN A;  3V6C B;  3NS8 A;  3V60 A;  1R4M I;  4IUM B;  4NPN A;  2DYB A;  2KD0 A;  2KHW B;  4GSW A;  2V4L A;  3H1U A;  1GUA B;  3VQI A;  3AI5 A;  2I1K A;  4RMA A;  4JLC A;  3S2A A;  5DPS A;  2IZV B;  2MBQ A;  4KZ0 A;  5JZE B;  1P9D U;  2ZVO A;  2DYM A;  4WWO A;  4WJQ A;  2KC2 A;  2XK5 A;  3PRM B;  4FLH A;  5G2N A;  3ZLZ A;  2LI5 A;  1NBF C;  1Q5W B;  4JIO U;  2DYO A;  3NOB A;  4XX5 A;  2KWU B;  3KYD D;  5J18 A;  1VCB A;  1EO6 A;  3N32 A;  4HPL B;  1V81 A;  2C7M B;  3H9D A;  4KVG B;  3APD A;  2GOW A;  3U8Z A;  3AUL A;  2BWE S;  1EF1 A;  3JSV A;  3K9P B;  3A9K A;  1Q0W B;  4IW0 A;  3WAN A;  5IA7 A;  1OQY A;  2PEA A;  1JRU A;  2FCS A;  2Z0D B;  2R2O A;  3O65 B;  1UD7 A;  3A4S C;  2DZI A;  4WQO B;  1T0Y A;  2IO3 B;  2UWQ A;  2MX2 A;  2AL6 A;  4MEM A;  3NZU A;  4ZRJ A;  3WAL A;  3OJ3 A;  2K8C A;  2D11 A;  4FA6 A;  2A5U A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...