1EF5A

Solution structure of the ras-binding domain of rgl
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
88
structure length
88
Chain Sequence
EDTCIIRISVEDNNGNMYKSIMLTSQDKTPAVIQRAMSKHNLESDPAEEYELVQVISEDKELVIPDSANVFYAMNSQVNFDFILRKKN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Solution structure of the Ras-binding domain of RGL.
pubmed doi rcsb
source organism Mus musculus
molecule tags Signaling protein
molecule keywords RGL
total genus 11
structure length 88
sequence length 88
ec nomenclature
pdb deposition date 2000-02-07
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 1ef5A00
4JL9A 4EOYA 2MLBA 2JPHA 3DBHI 2IY0B 4N9F4 2ZEQA 3L0WB 4B6WA 1ZKHA 2XBBC 2O6VA 3ZIMA 1V2YA 3RCZA 3A4RA 4ANWA 1S3SG 4WJOA 3JSVA 3A4SC 4PS7A 4HPLB 4OVVA 4F7ZA 4A20A 3L17A 5KHQA 1EF1A 2BWES 4W9DA 2M8SA 4AJYB 5AZGA 4MJSB 2CHWA 3BINA 3WANA 1XD3B 4AP4C 4KDLB 3AI5A 4YL8A 2K8HA 4J6IA 4II2B 3PLVA 2LD9A 3RUIB 4HCPB 2ZNVB 1WY8A 2LVPA 3HK0A 3L08A 4GSWA 1HE8A 2RD0A 4IM2A 3V61A 1WJUA 1R4MI 4G3XB 4K7UA 4WQOB 2MCNB 4NJ7A 5AEKB 2N7DA 2XK5A 3KUCB 2PEAA 2Z59B 1V5OA 3U7DA 2A5UA 1TTNA 2BF8B 2KTFA 2FCSA 4ZRKA 5JHAA 2C7MB 2L7RA 1WE7A 3VUWA 4BKTA 4KSLC 4M0WB 3SU8X 4DWFA 4TQ0A 4GXBA 1CMXB 3APCA 3QAQA 2FIFA 2LRUA 2KX0A 2XK5B 2JZ3B 3APFA 2GMIC 3QK0A 3ZO5B 3WAMA 3LDZE 2KJ6A 3P2BA 3ONSA 3Q3JA 2KWUB 3SHQA 3A33B 4LJOB 1PQSA 2FUHB 3VDZA 3UINB 4P7IA 2NR2A 1V80A 2BWFA 1C3TA 2L0TA 4MGIE 2KC1A 3H6NA 2CS4A 4W9HA 3VUXA 2JUOA 2DZJA 4FLHA 3TJPA 4NY0A 4CYEA 1H8CA 4GB9A 5JHBA 4W9JA 5C23A 2BYVE 3ZTCA 3N3KB 1T0YA 1I42A 3DVNV 3ZNID 4ZDVA 3WALA 1WX7A 1WYWB 3KVFB 1K8RB 2MA9B 2KXJA 2KK8A 4K1RB 2EMSA 3NZSA 2KQSA 1QZEA 1SE9A 2O6VD 4EKUA 2ZPNA 4MELA 4XX5A 1NBFC 2LGDA 4FJYA 4EZJA 3AXCA 4W9LA 4IWPA 4GDKA 4E74A 1GJZA 2GBJA 1J0GA 3VTVA 3A9JA 5BO4B 2JF5A 3PS6A 3TL5A 1WR1A 2DENB 3DBSA 3MTNB 4E3CA 2KANA 1P9DU 3UQAA 2OJRA 3KH0A 1I35A 4M8NA 3JW0X 3WAPA 1WIAA 5E6OA 3NY5A 2DZKA 1A5RA 4PYUA 1OTRB 3A9JB 4PS3A 2N9XA 2LXCA 1KJTA 2B3AA 2KC2A 2V4LA 4AOFA 3APDA 1Q5WB 1NI2A 4GDLB 2KJRA 3W1SA 2CR5A 2GOWA 2RGFA 4DBGA 2MBEA 4KSKC 1SGHA 2KDIA 1EO6A 3ZNHB 2OOBB 2D07B 2KO3A 3DVNU 5GMVA 2HE7A 4GOCA 5D6JB 1M94A 1VD2A 2N1VA 4MEMA 4EFOA 4NQKE 3V62A 2KVRA 3ENEA 4MM3A 3OJ3A 4BVUC 4DHZB 2DYBA 2D3GA 2K6DB 3RD2A 2N9EB 1C1YB 4HDOA 4K7WA 4GDLA 2Z0DB 4HWIB 2IBIB 2CU1A 2KNBA 2MBHA 4IWQA 3ZVVA 1E8YA 4JIOU 3PHWB 2KFKA 4BKSA 2KDEB 4KV2A 3AU4A 5EDSA 4FBJB 3PREA 2N9PC 4FULA 2LXAA 1WJ6A 2CHZA 5JH5C 4W9CA 5DPTA 2ZVOA 2KWVB 2O2VA 1E7VA 1V5TA 1WXSA 1ZW7A 4EZLA 3ZNZB 3VXWA 2A4ZA 4IUMB 2IO2B 2MBBB 3ECIA 3TCAA 1G6JA 3WIMA 1D3ZA 4MJSA 2JRHA 2FCMA 2N1WA 3IG3A 2CHXA 3PT2B 2M0XA 3H7PA 3UGBB 1LFDA 3V6CB 3NZUA 4ANUA 3R7RA 4GN1A 2KHWB 2I1KA 2QHOA 4NPNA 2J7QB 3BY4B 2ZNVC 2AL3A 2RSUA 2O2VB 1YX5B 4AWJA 1RFAA 3HM3A 3PTFC 3TMPB 1E8WA 2KTRB 2WX1A 2RPQA 2K8BA 3UIPB 1WE6A 3PRPB 4EEWA 2FCQA 1H4RA 3KYDD 5D94A 4G11A 2GBMA 2ZPYA 4W9EA 3T9LA 2HTHA 3RYTA 4IC7B 1UGMA 1Y8RC 3IHPC 3M63B 1WGDA 5DPRA 4IWOA 3S2AA 3PLUA 2I1JA 2G4DB 4MGKE 1WR6E 2MW5A 3I3TB 2MWSB 2ASQA 1IP9A 4GIVA 3ZW3A 3KUDB 1ZGUB 2C5LC 1GG3A 3EC8A 1WM2A 5J2RA 3HIZA 3KUZA 2MQJA 2DYOA 3PGEA 2JZZA 2NBVB 3OJ4B 4W9KA 1RRBA 2NBUA 2R2OA 4W9FA 2J0JA 3CF6E 1SIFA 1WGGA 4ICVA 3M62B 3QJZA 2C9WB 4PS8A 2ZJDA 4CO7A 4W9GA 1LM8B 2DZMA 3RZFA 4DHZE 2L76A 2FAZA 4II3B 2DYMA 3AULA 3VTWA 1UZXB 2CKHB 2M17A 4TV3A 2AEHA 2MSED 3W1YA 1V49A 4BKSD 1Z2MA 3OLMD 1WZ0A 3GOEA 4HCNB 4IW0A 5LLIA 2IZVB 1YD8U 1P3QU 1YQBA 3NS8A 1E5WA 1TZ1A 2LZ6A 2FIDA 3ML8A 3QWZB 4MSMB 1R4NI 1BT0A 2G45B 2G3QB 1YX6B 3QQ8B 3L16A 1FXTB 3VFKA 1UELA 3WAOA 1E8ZA 4MH0E 4OVUA 3R7QA 5L95C 4WJQA 3ZKJC 2LI5A 3RZWC 4MGYE 1J19A 4TKNA 2UYZB 4EUTA 2IO0B 3ZNGC 1RAXA 2L00B 3K9PB 5J18A 2FNJB 3VVWB 2JRIB 4BBNC 2BGFA 1P98A 3EFUA 1WGRA 1S1QB 1VCBA 2ZZPB 4KIKB 4KZ0A 2N7EA 4LCDE 1P0RA 3V6EB 2IO3B 3VTUA 4HDQA 3ML9A 3UIOB 2LVQA 1WMHB 3CSFA 2JWZA 4NNJB 3DVGX 2MP2A 1E8XA 3DBRI 5CHWA 2NPTB 2REXA 5AZFA 4WJPA 1OEYA 2KDFB 4FJZA 4ZRIA 3TIXA 3SDLC 4M8MA 2KWCA 1V9JA 3PPAA 4RM9A 5L83A 2BKFA 2K8CA 1GC6A 2L05A 3QC8B 3R3MA 3A1QA 4IG7B 2GBNA 1V6EA 2VRRB 5DPWA 2ZVNA 5CHVC 3MHSD 1TBEA 1WGYA 3LJ3A 2NPTA 4HXDA 4B9KA 3DPDA 1Q1OA 1X1MA 1JRUA 1WRDB 1L2NA 2K25A 2IY1B 2JT4B 5G55A 3VUYA 2IO1B 5HKHA 5J17A 4ZRJA 5DCNA 2IYDB 3A1QB 1NDDA 1WJ4A 2MBOA 2WYQA 1WX9A 3PRZA 1Z5SB 3T8MA 4AJWA 3PVLA 4BOSC 2O6VB 2DAJA 3PZDA 4WJNA 4JLCA 3VHTC 1U4AA 3DVGY 3NHEB 3ZRFA 3PRMB 4TUUA 2RR9A 5KHOA 2D11A 3DCGA 4TQ1A 2KLCA 4MGZE 3H9DA 3IBEA 4BKGA 5E6PA 1YJ1A 2PE6B 1OEYJ 4ASWC 4B95A 1MG8A 4A3PA 4F8CB 3C0RB 2ZCBA 4K81A 5IA7A 2GBKA 3X23A 4FN2A 4MSQB 3ZUNA 1WXVA 3RULA 4ZYNA 2WDTB 3KW5B 1WF9A 4GMVA 4LJPB 2BYEA 1F9JA 5G2NA 2KX3A 4BBNF 3H7PB 2NCNA 1OGWA 1KLVA 1UH6A 2JY6A 4K7SA 3UQBA 2EMTA 4FJVB 2KJHB 3L13A 3ZRCA 4GGQA 3RT3B 2KFJA 1WXAA 2MRPA 2LGXA 2LJ5A 4G0NB 3H1UA 4WWNA 4BFRA 1XQQA 2KTRA 2N4FA 2R2QA 3N32A 2KMCA 4HK2A 5AZHA 4DDID 4DK5A 4CHKA 2XEWA 2W9NA 3JVZX 4XZ4A 4ANVA 2GBRA 1WI0A 4W9IA 4DXAB 2KLGA 4WWPA 1GNUA 2DX5B 5DPSA 4KVGB 3VH4B 5IAAC 4KZCA 1XT9B 2YLMA 2Z0EB 3DQVA 2J0KA 3U30A 2G4SA 2LRWA 3X0WA 1P1AA 2L8JA 3SD5A 2KMAA 3QIJA 1J8CA 3EECA 1RLFA 2J0MA 4IM0A 1UD7A 1V81A 2HD5B 2LUEA 2LVOA 4ICUA 5FR6A 3VAWA 4HVBA 2K39A 2LGYA 2KZRA 2PE9A 3IFWB 1GUAB 2M4NA 2K1FA 2JVCA 3M95A 1LQBA 3GZNI 1WXMA 2UWQA 4DDGD 4URKA 3N30A 2AYOB 4WWOA 3WA0A 3ZLZA 1E90A 4FADA 3O65B 1WJNA 3A9KB 3QA8A 4JGHB 2MX2A 3CSTA 3ZDMC 2KN5A 3AU5A 2NS5A 4I6PA 3IVFA 5D7GA 2LASA 2LWPA 4I6NB 4GU2A 4I6LB 2M1MA 2PPHA 3D32A 4X57B 3A9KA 4LDTB 2PJHA 2K6QA 3DBLI 1UBQA 4WAAA 4F1SA 3L10B 1TGZB 5D2MB 2C7HA 2KKCA 3TBLD 4ANXA 4MDKE 3V60A 2ZCCA 3CMMB 1GC7A 3B1LX 2D10A 4RM8A 4NAWB 3PHXB 4GDKB 3VQIA 4XC2A 2NVUI 2WWZA 3U8ZA 2V1YA 3M3JA 2BYFA 2KQ7A 3DOWA 4NJ6A 2KOXA 5CX3A 1WGHA 1WH3A 1V86A 2BKRB 2FCNA 2WX0A 2MBQA 3Q3FA 3QX1A 1IPGA 1WX8A 3ZDTA 5LXIB 1IYFA 2D2QA 4A3OA 2C7NB 3K9OB 3ALBA 3PSEB 3H7SA 4PYZA 1EF5A 4DHJB 2AWTA 2YVCA 4NAWA 3UF8A 3JYUA 4JQWC 4RMAA 4KIKA 2HJ8A 2NBWB 3NOBA 4HPMB 3OAWA 1WFYA 3HHMA 1KM7A 2L3ZA 3B08A 3QARA 3QHTA 5CTRC 1WMHA 1E7UA 2C60A 4BOZB 1EUVB 4NQLB 2DHZA 2MP2B 4HLEA 4FA6A 5JZEB 1WM3A 5LXHA 4G50A 2L0FA 2JXXA 3DDCB 4EZKA 3R66C 3HM6X 4IM3A 1KOTA 1OQYA 2Y5BB 4DHJD 1Q0WB 1AARA 4KDIC 2AL6A 4HJKA 1WZ3A 5E6NA 2BPSA 3MJWA 5TR5A 4FHKA 3W1SC 4E71A 1LXDA 4FHJA 5C1ZA 2EKEC 1YIWA 1ISNA 3EHVA 3VH3B 3QCAA 2KDBA 3L54A 2V3SA 2KD0A 1L7YA 2DZIA 3JSVB 3ZTDA 3KYCD 4LDTD 3PV1A 4AUQC 5CHFA 3B0AA 2DAFA 1UBIA 2KFKB
chains in the Genus database with same CATH superfamily
2IY0B 2ZEQA 2XBBC 1V2YA 3KLSX 3A4RA 4P1CC 3MP9A 4WJOA 1N6ZA 4HPLB 4OVVA 2SAKA 4LK0M 5KHQA 3AEGB 3RI7C 2M8SA 2K22A 4MJSB 2WDRB 2V0GA 2LD9A 1FXIA 2DLBA 2ZNVB 3L08A 4A90A 1R4MI 2MCNB 4K7UA 4WQOB 4NJ7A 1XEEA 3Q3MC 2FCSA 5JHAA 2C7MB 1C78A 3SU8X 4DWFA 3GE8C 4TSSA 3ZO5B 3WAMA 5IO9A 1AN8A 2CJNA 3Q3JA 1C4PA 1J7AA 1PQSA 3VDZA 4RFBA 3V05A 4MGIE 3H6NA 4FLHA 4KGSA 4NY0A 4P6VF 3DVNV 1SE3A 4B0EA 1FO4A 4K1RB 2EMSA 2K5PA 3BIID 2VZKB 4C7ZA 4UDUC 4XWTA 4FJYA 2WXMA 2XN9C 3KWLA 4N58A 4AQ7A 4GDKA 4E74A 2Q5WD 3AE9B 1HQRD 1L5PA 1L4DB 3HVZA 1HZ5A 3DBSA 1VJKA 3UQAA 1I35A 3WAPA 2W82A 5I4DA 1E10A 2WXJA 5E6OA 4A8XC 3A9JB 4AOFA 5BMHA 4C4VA 4DBGA 1SGHA 2LFIA 2KDIA 3DVNU 3T3NA 1M94A 4EFOA 2B76B 5BYRA 4BVUC 3LXFA 1DOIA 3HRDD 2N9EB 4K7WA 4GDLA 4HWIB 2LEKA 3ZVVA 4BKSA 2KFKA 3IT4B 1OQQA 4KV2A 2WHIA 5EDSA 1BMLC 2W3SA 3Q14C 2LXAA 4OZCA 5DPTA 1V5TA 3ZNZB 2J53A 2A4ZA 1FIQA 2Z8LA 2FCMA 2N1WA 3IG3A 3PT2B 2WXGA 1GB4A 3R7RA 4GN1A 2KHWB 2QHOA 2J7QB 1YX5B 4AWJA 1RFAA 1FFVA 1VLBA 4HKZE 3TMPB 1D5XC 1UGJA 2KTRB 2WX1A 3Q69A 3UIPB 4EEWA 3BWUD 1HTOA 1RFKA 3EGRA 5DPRA 4IWOA 3S2AA 3PLUA 4MGKE 1WR6E 2MW5A 3L4PA 3KUDB 4RF1A 3UI3A 4OVZA 2DYOA 4D2KA 2NBVB 2WDQB 3CF6E 3DBHB 2INNE 2C9WB 4NJCA 1FNVA 2QCZA 2FAZA 2DYMA 3KQ4A 1UZXB 2M17A 3NVZA 2DWQA 2D3BA 3P42A 5LLIA 2IZVB 1SF0A 1V1PA 3NS8A 4RGNA 2FBWB 3ZYYX 1E7PB 2LZ6A 2FIDA 3ML8A 2G45B 2G3QB 3L16A 4TKNA 2UYZB 4DQOC 4EUTA 2JU6X 3FILB 4BBNC 1FD6A 1S1QB 3AE6B 4BAXA 2N7EA 1P0RA 1SXTA 3ML9A 3Q8BA 2LVQA 3ZXVA 3CSFA 1F2RC 2NPTB 2RMMA 3EA6A 4HJGE 2L83A 4M8MA 5L83A 1IUEA 5DPWA 2WNMA 1TBEA 1WGYA 4HXDA 3NRZA 2K25A 2IY1B 2JT4B 1D4BA 1ET6A 4K3CA 4JPSA 3PRZA 3T8MA 2WS3B 1GAQB 3TEYA 4P1BC 3LYYA 3DVGY 2WP9B 5AUIA 1TS2A 2D11A 3H9DA 1MG8A 4A3PA 4YXDB 4C80A 3ZUNA 2WDTB 2IJ0A 1JW9D 4PK1A 1TS5A 2QILA 4K3BA 5LNK1 1I4HA 2AQ2B 1OGWA 1VZ7A 4FJVB 2KJHB 3B2GA 4YWGG 2LGXA 3IT6B 4BFRA 4OW0A 4EE2A 4HK2A 2R2QA 2KMCA 4US9A 3RNGC 4W9IA 4DXAB 1GNUA 2DX5B 1YJJA 3W2DA 4IOIE 3U4EG 4DXGA 1YJIA 2J0KA 2G4SA 2LRWA 1I4QA 3QIJA 1KLUD 1J8CA 3EECA 2J0MA 4IM0A 1UD7A 1V81A 5FR6A 3VAWA 1MFWA 2H88B 2WXIA 2K39A 1E9MA 3BVGA 2M4NA 2K1FA 2RDHA 4DDGD 1LQBA 3Q6BA 3N30A 2AYOB 4C56C 2V3NA 3TEWA 1MJDA 3QA8A 4C7YA 4JGHB 1CK1A 3CSTA 3FC4A 2TSSA 2NMQA 3IVFA 2LASA 2LWPA 4I6NB 2WDVB 4X57B 3A9KA 4LNKA 3DBLI 3L10B 1TGZB 2KKCA 4MDKE 2KWDA 1D6EC 4GDKB 4XC2A 2NVUI 2WWZA 4RF0A 1I4XA 3M3JA 5IN7A 4NJ6A 2FUG1 2BT6A 3Q3FA 2BKRB 1IPGA 4A3OA 5IP4D 2M56B 4NAMA 3AE2B 3H7SA 4DHJB 4RGMA 2YVCA 4A55A 2IPKD 3JYUA 3NOBA 2NBWB 1ZUD2 3BYYB 1KM7A 2L3ZA 5CTRC 2INPE 1SEBD 2DHZA 5JZEB 4C4VB 1XF5L 2Y5BB 2AL6A 4HJKA 1JQ4A 5E6NA 5TR5A 3H8HA 4FHKA 3W1SC 2EKEC 1YIWA 3EHVA 1L7YA 1PYWD 1YN3A 3KYCD 3PV1A 1UBIA 2KFKB 4JL9A 2MLBA 3DBHI 3L0WB 2JYTA 2O6VA 4ANWA 1S3SG 1K51A 3AN1A 4R3DA 2BWES 1SE4A 3IXSA 4AJYB 3BINA 1XD3B 4KDLB 3AI5A 4YL8A 2JX5A 2M19A 4YT0B 4YTMB 4J6IA 1KRHA 1OFFA 4TMAB 4HCPB 2MJEA 1WJUA 1YQ4B 5AEKB 3HVDA 4KKJA 2XK5A 1C77A 2PEAA 5IKCM 1RWSA 1JRPA 4WQMA 4ZRKA 4HKQA 1FRDA 4L2YA 4KSLC 4M0WB 5D3DA 5TSSA 2W55A 4GXBA 4HPPA 1CMXB 1I7HA 2LRUA 2JZ3B 1XCTL 3APFA 2GMIC 2Y5PA 3LDZE 2N9LA 5D3IB 4WAFA 2KWUB 1KLGD 2FUHB 1V80A 2E3TA 3EFCA 3AEBB 1TKEA 2CS4A 3VUXA 2JUOA 2DZJA 4CYEA 1H8CA 4US8A 4W9JA 3N9YC 2BYVE 3OG5A 4JX1C 3N3KB 1N5WA 1T0YA 3U2SC 4ZDVA 3WALA 1HZ6A 1WX7A 3KVFB 1BUIC 4LNFA 2MA9B 1N5XA 2PLPA 4M01A 2BS4B 1SE9A 2O6VD 2ZPNA 4GLSC 3NVWA 3U52E 1L6VA 3N1YC 3FILA 4W9LA 4IWPA 2LUMA 3VTVA 5MPOA 5BO4B 2JF5A 3PS6A 1T0SC 1WR1A 1FCLA 2KANA 1TKYA 3NY5A 3DHGC 1K50A 1DYQA 1OTRB 3C8YA 4PYUA 4PS3A 1KJTA 1LGRA 1T0QC 2WU5B 1NI2A 2MBEA 4XDCA 2JXTA 4YTNB 2LJIA 2D07B 3URYA 2Y3AA 4MEMA 4NQKE 3AB5A 2KVRA 4DHZB 2D3GA 3RD2A 2Z0DB 2CU1A 2KNBA 3R2TA 3RNCC 2WGSA 4JIOU 3PHWB 2M0AA 3AU4A 5HFYA 2VH2A 2CHZA 4W9CA 3C19A 2KWVB 2O2VA 1ZW7A 4IUMB 1G6JA 2JRHA 3SFEB 1L0VB 3I9V1 4ZYSA 2M0XA 3UGBB 1SB3C 3V6CB 2I1KA 5BYSA 3DBLB 2ZNVC 4LLGM 2PVGC 3HM3A 1TZOA 1D5ZC 1E8WA 2RPQA 3KYDD 2ZPYA 2VZKD 1R4NB 4IC7B 3IHPC 3NUHB 2G4DB 4FXCA 3I3TB 2MWSB 4GIVA 1JMLA 5J2RA 4MACA 3HIZA 2NTTA 1XLOA 1RRBA 2R2OA 1VDVA 3BVMA 1SIFA 1WGGA 4ICVA 3QJZA 2ZJDA 4CO7A 2DZMA 3RZFA 2L76A 4OZBA 3VTWA 3AULA 2CKHB 2MSED 2QIEB 1C4CA 1V49A 1AW7A 3LB8C 2W54A 4KGTA 3BK2A 3MFGA 4B0MA 1TZ1A 2WLBA 3QQ8B 2YEPF 1FXTB 3VFKA 1E8ZA 4MH0E 2EELA 4WJQA 2LI5A 4MGYE 3AE7B 3NVYA 1J19A 1V1PB 1QF6A 2IO0B 4ZHOA 3P4SB 2JRIB 3PO0A 1FXAA 1PUTA 1P98A 3EFUA 1WGRA 4KZ0A 2N7JA 3ZJTA 1VRAB 3J9CA 4HDQA 3UIOB 3ZJUA 4NNJB 3DBRI 5CHWA 2LMCA 2PVOD 2REXA 5AZFA 4FJZA 2OHFA 5GXGB 2KWCA 3PPAA 3TEXA 1TS3A 2L1AA 2K8CA 4L1BA 2L05A 3QC8B 3R3MA 4CQNA 3A1QA 1CJEA 2PW9A 2NPTA 2ON8A 1YN5A 1WRDB 5G55A 4ZRJA 3B9JA 3RN9C 5DCNA 2IYDB 4AJWA 4YSZB 2O6VB 3PZDA 3TEZA 3VHTC 4TUUA 1ACCA 2RR9A 5KHOA 3DCGA 2L32A 4MGZE 3IBEA 5E6PA 4B95A 2QDFA 2ZCBA 4K81A 2GBKA 4MSQB 2GB1A 1F9JA 5G2NA 2KX3A 5HG2A 4K7SA 3UQBA 3T3OA 2KFJA 2MRPA 3H1UA 4DDID 3N32A 5AZHA 3MC8A 4CHKA 2XEWA 2W9NA 3JVZX 2GBRA 1WI0A 4M0WA 3W5UB 2KLGA 4WWPA 3IAS1 2JZPA 3OWEB 1F1HA 2YLMA 2Z0EB 3DQVA 3RMKC 1ZDVA 4S0RA 3SD5A 2J52A 2HD5B 4ICUA 1RM6C 2LGYA 2KZRA 1ZXHA 1YN4A 1J7BA 4HRSA 3O65B 2BW2A 4WIPA 1C9FA 5EE3A 2MX2A 3ZDMC 3AU5A 2ZW1A 5H92C 2J42A 5D7GA 1QOAA 4RH6A 1GB1A 1QILA 4YSXB 2C7HA 2ZCCA 1GC7A 2D10A 2XNAC 3NG0A 2JYEA 2QSDA 1PFDA 2FCNA 1V86A 5AUKA 2MBQA 1WX8A 4PYZA 1FCCC 1EF5A 3AEEB 2K0PA 2BVCA 4JQWC 4KIKA 2QMTA 3HHMA 3QHTA 1E0ZA 1WMHA 1E7UA 2C60A 4BOZB 3NJTA 2MP2B 4HLEA 5LXHA 4G50A 3DDCB 4EZKA 1ZP0B 1KOTA 4YSYB 1OQYA 2KAJA 1Q0WB 1AARA 4KDIC 1WZ3A 5BYQA 3MJWA 2ZW0A 4FHJA 5C1ZA 1KTKA 2KDBA 3RNEC 1T6BX 3JSVB 3ZTDA 1LO5D 4LDTD 3B0AA 4OZAA 2DAFA 4EOYA 2JPHA 1XLPA 4N9F4 1JCKB 1ZKHA 3ZIMA 3RCZA 2GRIA 3GB1A 2PMVA 4PS7A 2WXHA 4A20A 2WXOA 3L17A 3W9CB 4N6EB 4W9DA 3GS2A 5C3JB 3SFDB 3MJ5A 2IGDA 1JWMD 4PT5A 1TT5B 1MHXA 2K8HA 3RUIB 3V61A 4GSWA 2RD0A 1HTQA 4G3XB 4H2AA 2GLSA 1ESFA 1EWCA 2N7DA 1QLBB 3SR6A 3MC9A 1TTNA 1UWXA 1FMAD 4BKTA 2RPVA 3APCA 3QAQA 2XK5B 1WYGA 3QK0A 1MG4A 1UUPA 4A6QA 1WRIA 1PGXA 3TSSA 3ONSA 3SHQA 2WXRA 2BYTA 5E6JA 2X8XX 1FEHA 2KQ4X 4W9HA 1XCQL 1MHHE 4LNIA 3W5VB 2WU2B 3V3XA 1I42A 3ZNID 1IGCA 1WYWB 3DBRB 1K8RB 1OQRA 1BXTA 2JWUA 2DNFA 3B2FA 4ACFA 2KK8A 1V97A 3NZSA 1V8CA 2KQSA 1NENB 1NBFC 4HROA 3AXCA 4WH4A 3GE3C 1FFUA 3BK1A 2WXPA 1QOFA 3ZQ4A 3RNFC 1T5XD 3MTNB 4USAA 1P9DU 2PIAA 1YOVB 3JW0X 5BMGA 1WWTA 2DZKA 3Q8CA 2N9XA 1T3QA 2K3UA 4M00A 4J3OD 3CWIA 2BS2B 1XLQA 1P7EA 3APDA 3HUIA 1Q5WB 1B9RA 1FNWA 2RGFA 2GOWA 4KSKC 1EO6A 2PKOA 4XYCA 5GMVA 2KO3A 2HE7A 4GOCA 4IKGA 1VD2A 2N1VA 3ZGZA 2IDYA 3V62A 4MM3A 3ENEA 3OJ3A 1STEA 2DYBA 1C1YB 3CIRB 4IWQA 2BQQA 1E8YA 2LGSA 2KDEB 1FM0D 4XGAB 1L4ZB 3P4QB 2ZVOA 2OEDA 1E7VA 1SIJA 1WXSA 3VXWA 2IO2B 3TCAA 3ECIA 3WCQA 3WIMA 2CHXA 3NZUA 3GP7A 2KN4A 3BY4B 5EE1A 1ROEA 2AX5A 2AL3A 2RSUA 2O2VB 3PTFC 2K8BA 3PRPB 4JWSC 1AWDA 2FCQA 2QEJC 5D94A 5C2TB 4YTPB 3T9LA 1UGMA 1Y8RC 4KX6B 1C4AA 2I1JA 1PGAA 2INCC 1GG3A 1WM2A 2SEBD 2OJWA 2JZZA 3OJ4B 2MJDA 2NBUA 3ETRA 3ZXRA 3M62B 2WXFA 4PS8A 3RNAC 4LNOA 1LM8B 4TV3A 3W1YA 2R61A 1Z2MA 1NVID 3OLMD 4HCNB 3Q8AA 1P3QU 1YQBA 3ZJVA 1XLNA 3IAM1 3QWZB 1UELA 3WAOA 4OVUA 5L95C 3R7QA 3RZWC 3BYTB 2AQ1B 3VRAB 3K9PB 5J18A 2FNJB 4N59A 1WSPA 2D3CA 2BGFA 1R4MB 2ZZPB 3VR9B 4KIKB 4LCDE 3VTUA 2IO3B 1WMHB 2AQ3B 2MP2A 1OEYA 3SDLC 4RM9A 1KFYB 2D3AA 2BKFA 2Y5CA 3Q8EA 2H89B 2GBNA 1V6EA 2VRRB 2BB5A 4WWMA 5CHVC 3MHSD 1EWYC 3LJ3A 4NZLB 4XE0A 1TY2A 3DPDA 1Q1OA 2WXNA 1X1MA 2ONQA 1L2NA 5J17A 5HKHA 2IO1B 3AV8A 3A1QB 1WJ4A 2V9HA 1WX9A 1Z5SB 4BOSC 4JLCA 1XO3A 1U4AA 3NHEB 2K9XA 1JWBD 1A70A 2NTSA 2WXLA 4BKGA 2PE6B 2IGGA 2G1EA 5BMIA 1VZ8A 3PZ7A 3C0RB 1NYRA 2RDGA 3X23A 2J4XA 1WXVA 3RULA 4ZYNA 4GMVA 4LJPB 1ZE3D 2BTEA 4RNAA 1PDXA 4BBNF 3E56A 3H7PB 2KACA 2MEKA 1UH6A 1N63A 4ZOHC 3L13A 4GGQA 3N20C 3RT3B 1QKZA 4G0NB 4RGOS 4WWNA 1XQQA 1F52A 2GI9A 2N4FA 4DK5A 4XZ4A 1SE2A 1JWAD 2X38A 5DPSA 2N9KA 4KVGB 3VH4B 4KZCA 1M4VA 1ZPSA 3U30A 1P1AA 2L8JA 1L0XB 2KMAA 2LUEA 1GUAB 1IGDA 1SJHD 2JVCA 3M95A 2UWQA 4WWOA 3WA0A 2D5GA 4FADA 1KH0A 1WJNA 2QJLA 1IBXB 1R7SA 2UU7A 2LHEA 2NS5A 2WQYB 4I6PA 1L0YB 2KDMA 1CZPA 4GU2A 4I6LB 2M1MA 1CQVA 3D32A 4F1SA 3PZ8A 4S17A 3N1XC 1NEKB 2LHDA 4JE3B 1TYGB 3V60A 1RYJA 1VZ6A 4RM8A 1EU3A 4NAWB 3PHXB 3VQIA 3AE8B 2V1YA 5EE0A 1YQ3B 1UNSA 2BYFA 1P7FA 1WH3A 3ZDTA 5LXIB 2C7NB 1N61A 3PSEB 3RNBC 2AWTA 1ZXIA 3UF8A 4KGRA 1QQRA 3OAWA 1WFYA 1EM7A 5IOIA 3QARA 3B08A 1EUVB 4NQLB 3I63C 1B1ZA 1WM3A 2L0FA 4L23A 4JWUC 3HM6X 4IM3A 2VH1A 2BPSA 3QCAA 1EU4A 1ET9A 2V3SA 2DBYA 1YMHE 2DZIA 4AUQC 1PGBA 5CHFA 1JROA 2LGIA 4B6WA 4A9AA 3AE4B 3P4RB 3JSVA 3A4SC 4F7ZA 1TS4A 1EF1A 4C00A 5AZGA 2CHWA 3WANA 4AP4C 1ENFA 4II2B 3PLVA 2I38A 1WY8A 2LVPA 3HK0A 1HE8A 4IM2A 3Q8FA 3KUCB 2Z59B 1V5OA 3U7DA 4Q2JA 2A5UA 2BF8B 2KTFA 1I4RA 2YEPB 2L7RA 1WE7A 3VUWA 1NYQA 4TQ0A 3O13A 2FIFA 3AE5B 2KX0A 1D5MC 1TKGA 3RPFC 5FR3A 2HJ1A 2KJ6A 3P2BA 3A33B 4LJOB 3AH7A 3UINB 4P7IA 2NR2A 4MH8A 2BWFA 1C3TA 4LTUA 2L0TA 2KC1A 4ARCA 3VRBB 1N60A 3TJPA 4GB9A 5JHBA 5C23A 3ZTCA 2KXJA 3R2IA 1QT9A 1QZEA 1WXQA 4EKUA 1QOBA 4MELA 4XX5A 2LGDA 1ZOYB 4EZJA 3N1ZC 1XXGA 1GJZA 2GBJA 1J0GA 3E9SA 3A9JA 3TL5A 2DENB 4E3CA 1FPYA 2W3RA 2OJRA 3KH0A 4M8NA 1WIAA 1UF0A 1A5RA 4RGTA 2LXCA 5JXVA 2B3AA 4QAYA 4XWWA 2KC2A 2V4LA 3DWMA 1HXYD 4P16A 4GDLB 2KJRA 3W1SA 2CR5A 3DHHC 2QC8A 3ZNHB 2OOBB 5G5GA 5D6JB 3ABVB 3BZDB 4ARIA 2K6DB 4HDOA 1C76A 2IBIB 2BBCA 2MBHA 4AS1A 4MM3B 4FBJB 3PREA 3Q2AC 2N9PC 4MT5A 4FULA 3VR8B 3AE1B 1WJ6A 5JH5C 4EZLA 2MBBB 1D3ZA 4MJSA 2ACZB 4ANUA 3H7PA 3KWVA 1LFDA 1VR9A 4NPNA 2JQRB 3AMZA 3RFZB 1HA5A 1WE6A 1H4RA 1GOZA 4G11A 2GBMA 4W9EA 3AM9A 2HTHA 3RYTA 1DOYA 3M63B 2BB6A 1WGDA 4HEA1 2KVZA 1K53A 2ASQA 1IP9A 3ZW3A 2IGHA 1ZGUB 2C5LC 2WXQA 3EC8A 3KUZA 2MQJA 3PGEA 4W9KA 4LNNA 4W9FA 2J0JA 1I4PA 1MVKA 1E6EB 2EKIA 4W9GA 4DHZE 4II3B 1IBXA 2CU3A 2AEHA 3AEDB 4BKSD 2FE8A 3BVZA 1ZDXA 4BZAA 1WZ0A 3GOEA 4IW0A 1YD8U 2V4IB 1E5WA 4ITKA 4MSMB 1R4NI 1BT0A 1FNUA 1YX6B 3AE3B 5FKAC 2KT7A 3ZKJC 1NI3A 3R8BA 1N62A 1TJEA 3ZNGC 1RAXA 2L00B 3VVWB 2MJ3A 2KMMA 2BS3B 1FRRA 1SSNA 1GPXA 1VCBA 3SEBA 5EE9A 3V6EB 2CJOA 1TY0A 3EUB2 2JWZA 3DVGX 3GZNB 2PTLA 1E8XA 1L6UA 4M02A 4WJPA 5T8IA 2KDFB 4ZHPA 4ZRIA 3TIXA 1V9JA 1GC6A 2L52A 4IG7B 2INDC 1J7CA 1WGKA 1QOGA 3U7ZA 1SBBB 2ZVNA 4B9KA 1JRUA 3VUYA 4RCOA 3FKYA 5HI1A 1YNTE 1NDDA 2MBOA 2WYQA 4ZRPA 1I4GA 1MI0A 1T0RC 2HTME 3PVLA 4DXFA 2DAJA 4WJNA 2MH7A 2N0SB 2ICIA 3ZRFA 3MC0B 3PRMB 4TQ1A 2KLCA 1YJ1A 1OEYJ 4ASWC 2E6XA 1F77A 4F8CB 1UWMA 5IA7A 4FN2A 3AECB 3KW5B 1WF9A 2BYEA 1JALA 2NCNA 1KLVA 2JY6A 1AYFA 2EMTA 3ZRCA 5FK9C 1WXAA 2LJ5A 4KKIA 2KTRA 3Q3OC 4ANVA 2KYWA 1KF6B 2HDEA 1C79A 5IAAC 1V1OA 4XDDA 1XT9B 1JWSD 3NZ3A 1SJED 3X0WA 1RLFA 2LVOA 4HVBA 2PE9A 3IFWB 3GZNI 1WXMA 4URKA 1DGJA 4REZA 1E90A 3MHZA 4IDIA 3ZLZA 3A9KB 1JWUD 2KN5A 2WXKA 3P1MA 1HEZE 2PPHA 2V3PA 4LDTB 2PJHA 2K6QA 4WAAA 1UBQA 3DWGC 2JSVX 3Q3NC 5D2MB 3TBLD 4WURA 4ANXA 1DOXA 3CMMB 5G5HA 5H8YE 3AEAB 3B1LX 3AEFB 3U8ZA 2KQ7A 3DOWA 2KOXA 5CX3A 1WGHA 1F0ZA 3P63A 2G9HD 2WX0A 3DHIC 3NS1A 3QX1A 1IYFA 2D2QA 3K9OB 3P4PB 1Y56A 3ALBA 3I57A 1Q10A 4NAWA 2RDBC 4RMAA 1F2RI 4HPMB 1MPEA 2HJ8A 3TUOA 3I5JC 5HHDG 4OHJA 4FA6A 2JXXA 3R66C 4DHJD 4O1NA 4E71A 1LXDA 1ISNA 4ZRQA 3VH3B 3L54A 2MHJA 2KD0A 3NVVA 3FAHA 1K52A 2I2YA 1TIFA
chains in the Genus database with same CATH topology
4JL9A 4EOYA 2MLBA 2JPHA 3DBHI 2IY0B 4N9F4 2ZEQA 3L0WB 4B6WA 1ZKHA 2XBBC 2O6VA 3ZIMA 1V2YA 3RCZA 3A4RA 4ANWA 1S3SG 4WJOA 3JSVA 3A4SC 4PS7A 4HPLB 4OVVA 4F7ZA 4A20A 3L17A 5KHQA 1EF1A 2BWES 4W9DA 2M8SA 4AJYB 5AZGA 4MJSB 2CHWA 3BINA 3WANA 1XD3B 4AP4C 4KDLB 3AI5A 4YL8A 2K8HA 4J6IA 4II2B 3PLVA 2LD9A 3RUIB 4HCPB 2ZNVB 1WY8A 2LVPA 3HK0A 3L08A 4GSWA 1HE8A 2RD0A 4IM2A 3V61A 1WJUA 1R4MI 4G3XB 4K7UA 4WQOB 2MCNB 4NJ7A 5AEKB 2N7DA 2XK5A 3KUCB 2PEAA 2Z59B 1V5OA 3U7DA 2A5UA 1TTNA 2BF8B 2KTFA 2FCSA 4ZRKA 5JHAA 2C7MB 2L7RA 1WE7A 3VUWA 4BKTA 4KSLC 4M0WB 3SU8X 4DWFA 4TQ0A 4GXBA 1CMXB 3APCA 3QAQA 2FIFA 2LRUA 2KX0A 2XK5B 2JZ3B 3APFA 2GMIC 3QK0A 3ZO5B 3WAMA 3LDZE 2KJ6A 3P2BA 3ONSA 3Q3JA 2KWUB 3SHQA 3A33B 4LJOB 1PQSA 2FUHB 3VDZA 3UINB 4P7IA 2NR2A 1V80A 2BWFA 1C3TA 2L0TA 4MGIE 2KC1A 3H6NA 2CS4A 4W9HA 3VUXA 2JUOA 2DZJA 4FLHA 3TJPA 4NY0A 4CYEA 1H8CA 4GB9A 5JHBA 4W9JA 5C23A 2BYVE 3ZTCA 3N3KB 1T0YA 1I42A 3DVNV 3ZNID 4ZDVA 3WALA 1WX7A 1WYWB 3KVFB 1K8RB 2MA9B 2KXJA 2KK8A 4K1RB 2EMSA 3NZSA 2KQSA 1QZEA 1SE9A 2O6VD 4EKUA 2ZPNA 4MELA 4XX5A 1NBFC 2LGDA 4FJYA 4EZJA 3AXCA 4W9LA 4IWPA 4GDKA 4E74A 1GJZA 2GBJA 1J0GA 3VTVA 3A9JA 5BO4B 2JF5A 3PS6A 3TL5A 1WR1A 2DENB 3DBSA 3MTNB 4E3CA 2KANA 1P9DU 3UQAA 2OJRA 3KH0A 1I35A 4M8NA 3JW0X 3WAPA 1WIAA 5E6OA 3NY5A 2DZKA 1A5RA 4PYUA 1OTRB 3A9JB 4PS3A 2N9XA 2LXCA 1KJTA 2B3AA 2KC2A 2V4LA 4AOFA 3APDA 1Q5WB 1NI2A 4GDLB 2KJRA 3W1SA 2CR5A 2GOWA 2RGFA 4DBGA 2MBEA 4KSKC 1SGHA 2KDIA 1EO6A 3ZNHB 2OOBB 2D07B 2KO3A 3DVNU 5GMVA 2HE7A 4GOCA 5D6JB 1M94A 1VD2A 2N1VA 4MEMA 4EFOA 4NQKE 3V62A 2KVRA 3ENEA 4MM3A 3OJ3A 4BVUC 4DHZB 2DYBA 2D3GA 2K6DB 3RD2A 2N9EB 1C1YB 4HDOA 4K7WA 4GDLA 2Z0DB 4HWIB 2IBIB 2CU1A 2KNBA 2MBHA 4IWQA 3ZVVA 1E8YA 4JIOU 3PHWB 2KFKA 4BKSA 2KDEB 4KV2A 3AU4A 5EDSA 4FBJB 3PREA 2N9PC 4FULA 2LXAA 1WJ6A 2CHZA 5JH5C 4W9CA 5DPTA 2ZVOA 2KWVB 2O2VA 1E7VA 1V5TA 1WXSA 1ZW7A 4EZLA 3ZNZB 3VXWA 2A4ZA 4IUMB 2IO2B 2MBBB 3ECIA 3TCAA 1G6JA 3WIMA 1D3ZA 4MJSA 2JRHA 2FCMA 2N1WA 3IG3A 2CHXA 3PT2B 2M0XA 3H7PA 3UGBB 1LFDA 3V6CB 3NZUA 4ANUA 3R7RA 4GN1A 2KHWB 2I1KA 2QHOA 4NPNA 2J7QB 3BY4B 2ZNVC 2AL3A 2RSUA 2O2VB 1YX5B 4AWJA 1RFAA 3HM3A 3PTFC 3TMPB 1E8WA 2KTRB 2WX1A 2RPQA 2K8BA 3UIPB 1WE6A 3PRPB 4EEWA 2FCQA 1H4RA 3KYDD 5D94A 4G11A 2GBMA 2ZPYA 4W9EA 3T9LA 2HTHA 3RYTA 4IC7B 1UGMA 1Y8RC 3IHPC 3M63B 1WGDA 5DPRA 4IWOA 3S2AA 3PLUA 2I1JA 2G4DB 4MGKE 1WR6E 2MW5A 3I3TB 2MWSB 2ASQA 1IP9A 4GIVA 3ZW3A 3KUDB 1ZGUB 2C5LC 1GG3A 3EC8A 1WM2A 5J2RA 3HIZA 3KUZA 2MQJA 2DYOA 3PGEA 2JZZA 2NBVB 3OJ4B 4W9KA 1RRBA 2NBUA 2R2OA 4W9FA 2J0JA 3CF6E 1SIFA 1WGGA 4ICVA 3M62B 3QJZA 2C9WB 4PS8A 2ZJDA 4CO7A 4W9GA 1LM8B 2DZMA 3RZFA 4DHZE 2L76A 2FAZA 4II3B 2DYMA 3AULA 3VTWA 1UZXB 2CKHB 2M17A 4TV3A 2AEHA 2MSED 3W1YA 1V49A 4BKSD 1Z2MA 3OLMD 1WZ0A 3GOEA 4HCNB 4IW0A 5LLIA 2IZVB 1YD8U 1P3QU 1YQBA 3NS8A 1E5WA 1TZ1A 2LZ6A 2FIDA 3ML8A 3QWZB 4MSMB 1R4NI 1BT0A 2G45B 2G3QB 1YX6B 3QQ8B 3L16A 1FXTB 3VFKA 1UELA 3WAOA 1E8ZA 4MH0E 4OVUA 3R7QA 5L95C 4WJQA 3ZKJC 2LI5A 3RZWC 4MGYE 1J19A 4TKNA 2UYZB 4EUTA 2IO0B 3ZNGC 1RAXA 2L00B 3K9PB 5J18A 2FNJB 3VVWB 2JRIB 4BBNC 2BGFA 1P98A 3EFUA 1WGRA 1S1QB 1VCBA 2ZZPB 4KIKB 4KZ0A 2N7EA 4LCDE 1P0RA 3V6EB 2IO3B 3VTUA 4HDQA 3ML9A 3UIOB 2LVQA 1WMHB 3CSFA 2JWZA 4NNJB 3DVGX 2MP2A 1E8XA 3DBRI 5CHWA 2NPTB 2REXA 5AZFA 4WJPA 1OEYA 2KDFB 4FJZA 4ZRIA 3TIXA 3SDLC 4M8MA 2KWCA 1V9JA 3PPAA 4RM9A 5L83A 2BKFA 2K8CA 1GC6A 2L05A 3QC8B 3R3MA 3A1QA 4IG7B 2GBNA 1V6EA 2VRRB 5DPWA 2ZVNA 5CHVC 3MHSD 1TBEA 1WGYA 3LJ3A 2NPTA 4HXDA 4B9KA 3DPDA 1Q1OA 1X1MA 1JRUA 1WRDB 1L2NA 2K25A 2IY1B 2JT4B 5G55A 3VUYA 2IO1B 5HKHA 5J17A 4ZRJA 5DCNA 2IYDB 3A1QB 1NDDA 1WJ4A 2MBOA 2WYQA 1WX9A 3PRZA 1Z5SB 3T8MA 4AJWA 3PVLA 4BOSC 2O6VB 2DAJA 3PZDA 4WJNA 4JLCA 3VHTC 1U4AA 3DVGY 3NHEB 3ZRFA 3PRMB 4TUUA 2RR9A 5KHOA 2D11A 3DCGA 4TQ1A 2KLCA 4MGZE 3H9DA 3IBEA 4BKGA 5E6PA 1YJ1A 2PE6B 1OEYJ 4ASWC 4B95A 1MG8A 4A3PA 4F8CB 3C0RB 2ZCBA 4K81A 5IA7A 2GBKA 3X23A 4FN2A 4MSQB 3ZUNA 1WXVA 3RULA 4ZYNA 2WDTB 3KW5B 1WF9A 4GMVA 4LJPB 2BYEA 1F9JA 5G2NA 2KX3A 4BBNF 3H7PB 2NCNA 1OGWA 1KLVA 1UH6A 2JY6A 4K7SA 3UQBA 2EMTA 4FJVB 2KJHB 3L13A 3ZRCA 4GGQA 3RT3B 2KFJA 1WXAA 2MRPA 2LGXA 2LJ5A 4G0NB 3H1UA 4WWNA 4BFRA 1XQQA 2KTRA 2N4FA 2R2QA 3N32A 2KMCA 4HK2A 5AZHA 4DDID 4DK5A 4CHKA 2XEWA 2W9NA 3JVZX 4XZ4A 4ANVA 2GBRA 1WI0A 4W9IA 4DXAB 2KLGA 4WWPA 1GNUA 2DX5B 5DPSA 4KVGB 3VH4B 5IAAC 4KZCA 1XT9B 2YLMA 2Z0EB 3DQVA 2J0KA 3U30A 2G4SA 2LRWA 3X0WA 1P1AA 2L8JA 3SD5A 2KMAA 3QIJA 1J8CA 3EECA 1RLFA 2J0MA 4IM0A 1UD7A 1V81A 2HD5B 2LUEA 2LVOA 4ICUA 5FR6A 3VAWA 4HVBA 2K39A 2LGYA 2KZRA 2PE9A 3IFWB 1GUAB 2M4NA 2K1FA 2JVCA 3M95A 1LQBA 3GZNI 1WXMA 2UWQA 4DDGD 4URKA 3N30A 2AYOB 4WWOA 3WA0A 3ZLZA 1E90A 4FADA 3O65B 1WJNA 3A9KB 3QA8A 4JGHB 2MX2A 3CSTA 3ZDMC 2KN5A 3AU5A 2NS5A 4I6PA 3IVFA 5D7GA 2LASA 2LWPA 4I6NB 4GU2A 4I6LB 2M1MA 2PPHA 3D32A 4X57B 3A9KA 4LDTB 2PJHA 2K6QA 3DBLI 1UBQA 4WAAA 4F1SA 3L10B 1TGZB 5D2MB 2C7HA 2KKCA 3TBLD 4ANXA 4MDKE 3V60A 2ZCCA 3CMMB 1GC7A 3B1LX 2D10A 4RM8A 4NAWB 3PHXB 4GDKB 3VQIA 4XC2A 2NVUI 2WWZA 3U8ZA 2V1YA 3M3JA 2BYFA 2KQ7A 3DOWA 4NJ6A 2KOXA 5CX3A 1WGHA 1WH3A 1V86A 2BKRB 2FCNA 2WX0A 2MBQA 3Q3FA 3QX1A 1IPGA 1WX8A 3ZDTA 5LXIB 1IYFA 2D2QA 4A3OA 2C7NB 3K9OB 3ALBA 3PSEB 3H7SA 4PYZA 1EF5A 4DHJB 2AWTA 2YVCA 4NAWA 3UF8A 3JYUA 4JQWC 4RMAA 4KIKA 2HJ8A 2NBWB 3NOBA 4HPMB 3OAWA 1WFYA 3HHMA 1KM7A 2L3ZA 3B08A 3QARA 3QHTA 5CTRC 1WMHA 1E7UA 2C60A 4BOZB 1EUVB 4NQLB 2DHZA 2MP2B 4HLEA 4FA6A 5JZEB 1WM3A 5LXHA 4G50A 2L0FA 2JXXA 3DDCB 4EZKA 3R66C 3HM6X 4IM3A 1KOTA 1OQYA 2Y5BB 4DHJD 1Q0WB 1AARA 4KDIC 2AL6A 4HJKA 1WZ3A 5E6NA 2BPSA 3MJWA 5TR5A 4FHKA 3W1SC 4E71A 1LXDA 4FHJA 5C1ZA 2EKEC 1YIWA 1ISNA 3EHVA 3VH3B 3QCAA 2KDBA 3L54A 2V3SA 2KD0A 1L7YA 2DZIA 3JSVB 3ZTDA 3KYCD 4LDTD 3PV1A 4AUQC 5CHFA 3B0AA 2DAFA 1UBIA 2KFKB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4JL9 A;  4EOY A;  2MLB A;  2JPH A;  3DBH I;  2IY0 B;  4N9F 4;  2ZEQ A;  3L0W B;  4B6W A;  1ZKH A;  2XBB C;  2O6V A;  3ZIM A;  1V2Y A;  3RCZ A;  3A4R A;  4ANW A;  1S3S G;  4WJO A;  3JSV A;  3A4S C;  4PS7 A;  4HPL B;  4OVV A;  4F7Z A;  4A20 A;  3L17 A;  5KHQ A;  1EF1 A;  2BWE S;  4W9D A;  2M8S A;  4AJY B;  5AZG A;  4MJS B;  2CHW A;  3BIN A;  3WAN A;  1XD3 B;  4AP4 C;  4KDL B;  3AI5 A;  4YL8 A;  2K8H A;  4J6I A;  4II2 B;  3PLV A;  2LD9 A;  3RUI B;  4HCP B;  2ZNV B;  1WY8 A;  2LVP A;  3HK0 A;  3L08 A;  4GSW A;  1HE8 A;  2RD0 A;  4IM2 A;  3V61 A;  1WJU A;  1R4M I;  4G3X B;  4K7U A;  4WQO B;  2MCN B;  4NJ7 A;  5AEK B;  2N7D A;  2XK5 A;  3KUC B;  2PEA A;  2Z59 B;  1V5O A;  3U7D A;  2A5U A;  1TTN A;  2BF8 B;  2KTF A;  2FCS A;  4ZRK A;  5JHA A;  2C7M B;  2L7R A;  1WE7 A;  3VUW A;  4BKT A;  4KSL C;  4M0W B;  3SU8 X;  4DWF A;  4TQ0 A;  4GXB A;  1CMX B;  3APC A;  3QAQ A;  2FIF A;  2LRU A;  2KX0 A;  2XK5 B;  2JZ3 B;  3APF A;  2GMI C;  3QK0 A;  3ZO5 B;  3WAM A;  3LDZ E;  2KJ6 A;  3P2B A;  3ONS A;  3Q3J A;  2KWU B;  3SHQ A;  3A33 B;  4LJO B;  1PQS A;  2FUH B;  3VDZ A;  3UIN B;  4P7I A;  2NR2 A;  1V80 A;  2BWF A;  1C3T A;  2L0T A;  4MGI E;  2KC1 A;  3H6N A;  2CS4 A;  4W9H A;  3VUX A;  2JUO A;  2DZJ A;  4FLH A;  3TJP A;  4NY0 A;  4CYE A;  1H8C A;  4GB9 A;  5JHB A;  4W9J A;  5C23 A;  2BYV E;  3ZTC A;  3N3K B;  1T0Y A;  1I42 A;  3DVN V;  3ZNI D;  4ZDV A;  3WAL A;  1WX7 A;  1WYW B;  3KVF B;  1K8R B;  2MA9 B;  2KXJ A;  2KK8 A;  4K1R B;  2EMS A;  3NZS A;  2KQS A;  1QZE A;  1SE9 A;  2O6V D;  4EKU A;  2ZPN A;  4MEL A;  4XX5 A;  1NBF C;  2LGD A;  4FJY A;  4EZJ A;  3AXC A;  4W9L A;  4IWP A;  4GDK A;  4E74 A;  1GJZ A;  2GBJ A;  1J0G A;  3VTV A;  3A9J A;  5BO4 B;  2JF5 A;  3PS6 A;  3TL5 A;  1WR1 A;  2DEN B;  3DBS A;  3MTN B;  4E3C A;  2KAN A;  1P9D U;  3UQA A;  2OJR A;  3KH0 A;  1I35 A;  4M8N A;  3JW0 X;  3WAP A;  1WIA A;  5E6O A;  3NY5 A;  2DZK A;  1A5R A;  4PYU A;  1OTR B;  3A9J B;  4PS3 A;  2N9X A;  2LXC A;  1KJT A;  2B3A A;  2KC2 A;  2V4L A;  4AOF A;  3APD A;  1Q5W B;  1NI2 A;  4GDL B;  2KJR A;  3W1S A;  2CR5 A;  2GOW A;  2RGF A;  4DBG A;  2MBE A;  4KSK C;  1SGH A;  2KDI A;  1EO6 A;  3ZNH B;  2OOB B;  2D07 B;  2KO3 A;  3DVN U;  5GMV A;  2HE7 A;  4GOC A;  5D6J B;  1M94 A;  1VD2 A;  2N1V A;  4MEM A;  4EFO A;  4NQK E;  3V62 A;  2KVR A;  3ENE A;  4MM3 A;  3OJ3 A;  4BVU C;  4DHZ B;  2DYB A;  2D3G A;  2K6D B;  3RD2 A;  2N9E B;  1C1Y B;  4HDO A;  4K7W A;  4GDL A;  2Z0D B;  4HWI B;  2IBI B;  2CU1 A;  2KNB A;  2MBH A;  4IWQ A;  3ZVV A;  1E8Y A;  4JIO U;  3PHW B;  2KFK A;  4BKS A;  2KDE B;  4KV2 A;  3AU4 A;  5EDS A;  4FBJ B;  3PRE A;  2N9P C;  4FUL A;  2LXA A;  1WJ6 A;  2CHZ A;  5JH5 C;  4W9C A;  5DPT A;  2ZVO A;  2KWV B;  2O2V A;  1E7V A;  1V5T A;  1WXS A;  1ZW7 A;  4EZL A;  3ZNZ B;  3VXW A;  2A4Z A;  4IUM B;  2IO2 B;  2MBB B;  3ECI A;  3TCA A;  1G6J A;  3WIM A;  1D3Z A;  4MJS A;  2JRH A;  2FCM A;  2N1W A;  3IG3 A;  2CHX A;  3PT2 B;  2M0X A;  3H7P A;  3UGB B;  1LFD A;  3V6C B;  3NZU A;  4ANU A;  3R7R A;  4GN1 A;  2KHW B;  2I1K A;  2QHO A;  4NPN A;  2J7Q B;  3BY4 B;  2ZNV C;  2AL3 A;  2RSU A;  2O2V B;  1YX5 B;  4AWJ A;  1RFA A;  3HM3 A;  3PTF C;  3TMP B;  1E8W A;  2KTR B;  2WX1 A;  2RPQ A;  2K8B A;  3UIP B;  1WE6 A;  3PRP B;  4EEW A;  2FCQ A;  1H4R A;  3KYD D;  5D94 A;  4G11 A;  2GBM A;  2ZPY A;  4W9E A;  3T9L A;  2HTH A;  3RYT A;  4IC7 B;  1UGM A;  1Y8R C;  3IHP C;  3M63 B;  1WGD A;  5DPR A;  4IWO A;  3S2A A;  3PLU A;  2I1J A;  2G4D B;  4MGK E;  1WR6 E;  2MW5 A;  3I3T B;  2MWS B;  2ASQ A;  1IP9 A;  4GIV A;  3ZW3 A;  3KUD B;  1ZGU B;  2C5L C;  1GG3 A;  3EC8 A;  1WM2 A;  5J2R A;  3HIZ A;  3KUZ A;  2MQJ A;  2DYO A;  3PGE A;  2JZZ A;  2NBV B;  3OJ4 B;  4W9K A;  1RRB A;  2NBU A;  2R2O A;  4W9F A;  2J0J A;  3CF6 E;  1SIF A;  1WGG A;  4ICV A;  3M62 B;  3QJZ A;  2C9W B;  4PS8 A;  2ZJD A;  4CO7 A;  4W9G A;  1LM8 B;  2DZM A;  3RZF A;  4DHZ E;  2L76 A;  2FAZ A;  4II3 B;  2DYM A;  3AUL A;  3VTW A;  1UZX B;  2CKH B;  2M17 A;  4TV3 A;  2AEH A;  2MSE D;  3W1Y A;  1V49 A;  4BKS D;  1Z2M A;  3OLM D;  1WZ0 A;  3GOE A;  4HCN B;  4IW0 A;  5LLI A;  2IZV B;  1YD8 U;  1P3Q U;  1YQB A;  3NS8 A;  1E5W A;  1TZ1 A;  2LZ6 A;  2FID A;  3ML8 A;  3QWZ B;  4MSM B;  1R4N I;  1BT0 A;  2G45 B;  2G3Q B;  1YX6 B;  3QQ8 B;  3L16 A;  1FXT B;  3VFK A;  1UEL A;  3WAO A;  1E8Z A;  4MH0 E;  4OVU A;  3R7Q A;  5L95 C;  4WJQ A;  3ZKJ C;  2LI5 A;  3RZW C;  4MGY E;  1J19 A;  4TKN A;  2UYZ B;  4EUT A;  2IO0 B;  3ZNG C;  1RAX A;  2L00 B;  3K9P B;  5J18 A;  2FNJ B;  3VVW B;  2JRI B;  4BBN C;  2BGF A;  1P98 A;  3EFU A;  1WGR A;  1S1Q B;  1VCB A;  2ZZP B;  4KIK B;  4KZ0 A;  2N7E A;  4LCD E;  1P0R A;  3V6E B;  2IO3 B;  3VTU A;  4HDQ A;  3ML9 A;  3UIO B;  2LVQ A;  1WMH B;  3CSF A;  2JWZ A;  4NNJ B;  3DVG X;  2MP2 A;  1E8X A;  3DBR I;  5CHW A;  2NPT B;  2REX A;  5AZF A;  4WJP A;  1OEY A;  2KDF B;  4FJZ A;  4ZRI A;  3TIX A;  3SDL C;  4M8M A;  2KWC A;  1V9J A;  3PPA A;  4RM9 A;  5L83 A;  2BKF A;  2K8C A;  1GC6 A;  2L05 A;  3QC8 B;  3R3M A;  3A1Q A;  4IG7 B;  2GBN A;  1V6E A;  2VRR B;  5DPW A;  2ZVN A;  5CHV C;  3MHS D;  1TBE A;  1WGY A;  3LJ3 A;  2NPT A;  4HXD A;  4B9K A;  3DPD A;  1Q1O A;  1X1M A;  1JRU A;  1WRD B;  1L2N A;  2K25 A;  2IY1 B;  2JT4 B;  5G55 A;  3VUY A;  2IO1 B;  5HKH A;  5J17 A;  4ZRJ A;  5DCN A;  2IYD B;  3A1Q B;  1NDD A;  1WJ4 A;  2MBO A;  2WYQ A;  1WX9 A;  3PRZ A;  1Z5S B;  3T8M A;  4AJW A;  3PVL A;  4BOS C;  2O6V B;  2DAJ A;  3PZD A;  4WJN A;  4JLC A;  3VHT C;  1U4A A;  3DVG Y;  3NHE B;  3ZRF A;  3PRM B;  4TUU A;  2RR9 A;  5KHO A;  2D11 A;  3DCG A;  4TQ1 A;  2KLC A;  4MGZ E;  3H9D A;  3IBE A;  4BKG A;  5E6P A;  1YJ1 A;  2PE6 B;  1OEY J;  4ASW C;  4B95 A;  1MG8 A;  4A3P A;  4F8C B;  3C0R B;  2ZCB A;  4K81 A;  5IA7 A;  2GBK A;  3X23 A;  4FN2 A;  4MSQ B;  3ZUN A;  1WXV A;  3RUL A;  4ZYN A;  2WDT B;  3KW5 B;  1WF9 A;  4GMV A;  4LJP B;  2BYE A;  1F9J A;  5G2N A;  2KX3 A;  4BBN F;  3H7P B;  2NCN A;  1OGW A;  1KLV A;  1UH6 A;  2JY6 A;  4K7S A;  3UQB A;  2EMT A;  4FJV B;  2KJH B;  3L13 A;  3ZRC A;  4GGQ A;  3RT3 B;  2KFJ A;  1WXA A;  2MRP A;  2LGX A;  2LJ5 A;  4G0N B;  3H1U A;  4WWN A;  4BFR A;  1XQQ A;  2KTR A;  2N4F A;  2R2Q A;  3N32 A;  2KMC A;  4HK2 A;  5AZH A;  4DDI D;  4DK5 A;  4CHK A;  2XEW A;  2W9N A;  3JVZ X;  4XZ4 A;  4ANV A;  2GBR A;  1WI0 A;  4W9I A;  4DXA B;  2KLG A;  4WWP A;  1GNU A;  2DX5 B;  5DPS A;  4KVG B;  3VH4 B;  5IAA C;  4KZC A;  1XT9 B;  2YLM A;  2Z0E B;  3DQV A;  2J0K A;  3U30 A;  2G4S A;  2LRW A;  3X0W A;  1P1A A;  2L8J A;  3SD5 A;  2KMA A;  3QIJ A;  1J8C A;  3EEC A;  1RLF A;  2J0M A;  4IM0 A;  1UD7 A;  1V81 A;  2HD5 B;  2LUE A;  2LVO A;  4ICU A;  5FR6 A;  3VAW A;  4HVB A;  2K39 A;  2LGY A;  2KZR A;  2PE9 A;  3IFW B;  1GUA B;  2M4N A;  2K1F A;  2JVC A;  3M95 A;  1LQB A;  3GZN I;  1WXM A;  2UWQ A;  4DDG D;  4URK A;  3N30 A;  2AYO B;  4WWO A;  3WA0 A;  3ZLZ A;  1E90 A;  4FAD A;  3O65 B;  1WJN A;  3A9K B;  3QA8 A;  4JGH B;  2MX2 A;  3CST A;  3ZDM C;  2KN5 A;  3AU5 A;  2NS5 A;  4I6P A;  3IVF A;  5D7G A;  2LAS A;  2LWP A;  4I6N B;  4GU2 A;  4I6L B;  2M1M A;  2PPH A;  3D32 A;  4X57 B;  3A9K A;  4LDT B;  2PJH A;  2K6Q A;  3DBL I;  1UBQ A;  4WAA A;  4F1S A;  3L10 B;  1TGZ B;  5D2M B;  2C7H A;  2KKC A;  3TBL D;  4ANX A;  4MDK E;  3V60 A;  2ZCC A;  3CMM B;  1GC7 A;  3B1L X;  2D10 A;  4RM8 A;  4NAW B;  3PHX B;  4GDK B;  3VQI A;  4XC2 A;  2NVU I;  2WWZ A;  3U8Z A;  2V1Y A;  3M3J A;  2BYF A;  2KQ7 A;  3DOW A;  4NJ6 A;  2KOX A;  5CX3 A;  1WGH A;  1WH3 A;  1V86 A;  2BKR B;  2FCN A;  2WX0 A;  2MBQ A;  3Q3F A;  3QX1 A;  1IPG A;  1WX8 A;  3ZDT A;  5LXI B;  1IYF A;  2D2Q A;  4A3O A;  2C7N B;  3K9O B;  3ALB A;  3PSE B;  3H7S A;  4PYZ A;  1EF5 A;  4DHJ B;  2AWT A;  2YVC A;  4NAW A;  3UF8 A;  3JYU A;  4JQW C;  4RMA A;  4KIK A;  2HJ8 A;  2NBW B;  3NOB A;  4HPM B;  3OAW A;  1WFY A;  3HHM A;  1KM7 A;  2L3Z A;  3B08 A;  3QAR A;  3QHT A;  5CTR C;  1WMH A;  1E7U A;  2C60 A;  4BOZ B;  1EUV B;  4NQL B;  2DHZ A;  2MP2 B;  4HLE A;  4FA6 A;  5JZE B;  1WM3 A;  5LXH A;  4G50 A;  2L0F A;  2JXX A;  3DDC B;  4EZK A;  3R66 C;  3HM6 X;  4IM3 A;  1KOT A;  1OQY A;  2Y5B B;  4DHJ D;  1Q0W B;  1AAR A;  4KDI C;  2AL6 A;  4HJK A;  1WZ3 A;  5E6N A;  2BPS A;  3MJW A;  5TR5 A;  4FHK A;  3W1S C;  4E71 A;  1LXD A;  4FHJ A;  5C1Z A;  2EKE C;  1YIW A;  1ISN A;  3EHV A;  3VH3 B;  3QCA A;  2KDB A;  3L54 A;  2V3S A;  2KD0 A;  1L7Y A;  2DZI A;  3JSV B;  3ZTD A;  3KYC D;  4LDT D;  3PV1 A;  4AUQ C;  5CHF A;  3B0A A;  2DAF A;  1UBI A;  2KFK B; 
#chains in the Genus database with same CATH topology
 2IY0 B;  2ZEQ A;  2XBB C;  1V2Y A;  3KLS X;  3A4R A;  4P1C C;  3MP9 A;  4WJO A;  1N6Z A;  4HPL B;  4OVV A;  2SAK A;  4LK0 M;  5KHQ A;  3AEG B;  3RI7 C;  2M8S A;  2K22 A;  4MJS B;  2WDR B;  2V0G A;  2LD9 A;  1FXI A;  2DLB A;  2ZNV B;  3L08 A;  4A90 A;  1R4M I;  2MCN B;  4K7U A;  4WQO B;  4NJ7 A;  1XEE A;  3Q3M C;  2FCS A;  5JHA A;  2C7M B;  1C78 A;  3SU8 X;  4DWF A;  3GE8 C;  4TSS A;  3ZO5 B;  3WAM A;  5IO9 A;  1AN8 A;  2CJN A;  3Q3J A;  1C4P A;  1J7A A;  1PQS A;  3VDZ A;  4RFB A;  3V05 A;  4MGI E;  3H6N A;  4FLH A;  4KGS A;  4NY0 A;  4P6V F;  3DVN V;  1SE3 A;  4B0E A;  1FO4 A;  4K1R B;  2EMS A;  2K5P A;  3BII D;  2VZK B;  4C7Z A;  4UDU C;  4XWT A;  4FJY A;  2WXM A;  2XN9 C;  3KWL A;  4N58 A;  4AQ7 A;  4GDK A;  4E74 A;  2Q5W D;  3AE9 B;  1HQR D;  1L5P A;  1L4D B;  3HVZ A;  1HZ5 A;  3DBS A;  1VJK A;  3UQA A;  1I35 A;  3WAP A;  2W82 A;  5I4D A;  1E10 A;  2WXJ A;  5E6O A;  4A8X C;  3A9J B;  4AOF A;  5BMH A;  4C4V A;  4DBG A;  1SGH A;  2LFI A;  2KDI A;  3DVN U;  3T3N A;  1M94 A;  4EFO A;  2B76 B;  5BYR A;  4BVU C;  3LXF A;  1DOI A;  3HRD D;  2N9E B;  4K7W A;  4GDL A;  4HWI B;  2LEK A;  3ZVV A;  4BKS A;  2KFK A;  3IT4 B;  1OQQ A;  4KV2 A;  2WHI A;  5EDS A;  1BML C;  2W3S A;  3Q14 C;  2LXA A;  4OZC A;  5DPT A;  1V5T A;  3ZNZ B;  2J53 A;  2A4Z A;  1FIQ A;  2Z8L A;  2FCM A;  2N1W A;  3IG3 A;  3PT2 B;  2WXG A;  1GB4 A;  3R7R A;  4GN1 A;  2KHW B;  2QHO A;  2J7Q B;  1YX5 B;  4AWJ A;  1RFA A;  1FFV A;  1VLB A;  4HKZ E;  3TMP B;  1D5X C;  1UGJ A;  2KTR B;  2WX1 A;  3Q69 A;  3UIP B;  4EEW A;  3BWU D;  1HTO A;  1RFK A;  3EGR A;  5DPR A;  4IWO A;  3S2A A;  3PLU A;  4MGK E;  1WR6 E;  2MW5 A;  3L4P A;  3KUD B;  4RF1 A;  3UI3 A;  4OVZ A;  2DYO A;  4D2K A;  2NBV B;  2WDQ B;  3CF6 E;  3DBH B;  2INN E;  2C9W B;  4NJC A;  1FNV A;  2QCZ A;  2FAZ A;  2DYM A;  3KQ4 A;  1UZX B;  2M17 A;  3NVZ A;  2DWQ A;  2D3B A;  3P42 A;  5LLI A;  2IZV B;  1SF0 A;  1V1P A;  3NS8 A;  4RGN A;  2FBW B;  3ZYY X;  1E7P B;  2LZ6 A;  2FID A;  3ML8 A;  2G45 B;  2G3Q B;  3L16 A;  4TKN A;  2UYZ B;  4DQO C;  4EUT A;  2JU6 X;  3FIL B;  4BBN C;  1FD6 A;  1S1Q B;  3AE6 B;  4BAX A;  2N7E A;  1P0R A;  1SXT A;  3ML9 A;  3Q8B A;  2LVQ A;  3ZXV A;  3CSF A;  1F2R C;  2NPT B;  2RMM A;  3EA6 A;  4HJG E;  2L83 A;  4M8M A;  5L83 A;  1IUE A;  5DPW A;  2WNM A;  1TBE A;  1WGY A;  4HXD A;  3NRZ A;  2K25 A;  2IY1 B;  2JT4 B;  1D4B A;  1ET6 A;  4K3C A;  4JPS A;  3PRZ A;  3T8M A;  2WS3 B;  1GAQ B;  3TEY A;  4P1B C;  3LYY A;  3DVG Y;  2WP9 B;  5AUI A;  1TS2 A;  2D11 A;  3H9D A;  1MG8 A;  4A3P A;  4YXD B;  4C80 A;  3ZUN A;  2WDT B;  2IJ0 A;  1JW9 D;  4PK1 A;  1TS5 A;  2QIL A;  4K3B A;  5LNK 1;  1I4H A;  2AQ2 B;  1OGW A;  1VZ7 A;  4FJV B;  2KJH B;  3B2G A;  4YWG G;  2LGX A;  3IT6 B;  4BFR A;  4OW0 A;  4EE2 A;  4HK2 A;  2R2Q A;  2KMC A;  4US9 A;  3RNG C;  4W9I A;  4DXA B;  1GNU A;  2DX5 B;  1YJJ A;  3W2D A;  4IOI E;  3U4E G;  4DXG A;  1YJI A;  2J0K A;  2G4S A;  2LRW A;  1I4Q A;  3QIJ A;  1KLU D;  1J8C A;  3EEC A;  2J0M A;  4IM0 A;  1UD7 A;  1V81 A;  5FR6 A;  3VAW A;  1MFW A;  2H88 B;  2WXI A;  2K39 A;  1E9M A;  3BVG A;  2M4N A;  2K1F A;  2RDH A;  4DDG D;  1LQB A;  3Q6B A;  3N30 A;  2AYO B;  4C56 C;  2V3N A;  3TEW A;  1MJD A;  3QA8 A;  4C7Y A;  4JGH B;  1CK1 A;  3CST A;  3FC4 A;  2TSS A;  2NMQ A;  3IVF A;  2LAS A;  2LWP A;  4I6N B;  2WDV B;  4X57 B;  3A9K A;  4LNK A;  3DBL I;  3L10 B;  1TGZ B;  2KKC A;  4MDK E;  2KWD A;  1D6E C;  4GDK B;  4XC2 A;  2NVU I;  2WWZ A;  4RF0 A;  1I4X A;  3M3J A;  5IN7 A;  4NJ6 A;  2FUG 1;  2BT6 A;  3Q3F A;  2BKR B;  1IPG A;  4A3O A;  5IP4 D;  2M56 B;  4NAM A;  3AE2 B;  3H7S A;  4DHJ B;  4RGM A;  2YVC A;  4A55 A;  2IPK D;  3JYU A;  3NOB A;  2NBW B;  1ZUD 2;  3BYY B;  1KM7 A;  2L3Z A;  5CTR C;  2INP E;  1SEB D;  2DHZ A;  5JZE B;  4C4V B;  1XF5 L;  2Y5B B;  2AL6 A;  4HJK A;  1JQ4 A;  5E6N A;  5TR5 A;  3H8H A;  4FHK A;  3W1S C;  2EKE C;  1YIW A;  3EHV A;  1L7Y A;  1PYW D;  1YN3 A;  3KYC D;  3PV1 A;  1UBI A;  2KFK B;  4JL9 A;  2MLB A;  3DBH I;  3L0W B;  2JYT A;  2O6V A;  4ANW A;  1S3S G;  1K51 A;  3AN1 A;  4R3D A;  2BWE S;  1SE4 A;  3IXS A;  4AJY B;  3BIN A;  1XD3 B;  4KDL B;  3AI5 A;  4YL8 A;  2JX5 A;  2M19 A;  4YT0 B;  4YTM B;  4J6I A;  1KRH A;  1OFF A;  4TMA B;  4HCP B;  2MJE A;  1WJU A;  1YQ4 B;  5AEK B;  3HVD A;  4KKJ A;  2XK5 A;  1C77 A;  2PEA A;  5IKC M;  1RWS A;  1JRP A;  4WQM A;  4ZRK A;  4HKQ A;  1FRD A;  4L2Y A;  4KSL C;  4M0W B;  5D3D A;  5TSS A;  2W55 A;  4GXB A;  4HPP A;  1CMX B;  1I7H A;  2LRU A;  2JZ3 B;  1XCT L;  3APF A;  2GMI C;  2Y5P A;  3LDZ E;  2N9L A;  5D3I B;  4WAF A;  2KWU B;  1KLG D;  2FUH B;  1V80 A;  2E3T A;  3EFC A;  3AEB B;  1TKE A;  2CS4 A;  3VUX A;  2JUO A;  2DZJ A;  4CYE A;  1H8C A;  4US8 A;  4W9J A;  3N9Y C;  2BYV E;  3OG5 A;  4JX1 C;  3N3K B;  1N5W A;  1T0Y A;  3U2S C;  4ZDV A;  3WAL A;  1HZ6 A;  1WX7 A;  3KVF B;  1BUI C;  4LNF A;  2MA9 B;  1N5X A;  2PLP A;  4M01 A;  2BS4 B;  1SE9 A;  2O6V D;  2ZPN A;  4GLS C;  3NVW A;  3U52 E;  1L6V A;  3N1Y C;  3FIL A;  4W9L A;  4IWP A;  2LUM A;  3VTV A;  5MPO A;  5BO4 B;  2JF5 A;  3PS6 A;  1T0S C;  1WR1 A;  1FCL A;  2KAN A;  1TKY A;  3NY5 A;  3DHG C;  1K50 A;  1DYQ A;  1OTR B;  3C8Y A;  4PYU A;  4PS3 A;  1KJT A;  1LGR A;  1T0Q C;  2WU5 B;  1NI2 A;  2MBE A;  4XDC A;  2JXT A;  4YTN B;  2LJI A;  2D07 B;  3URY A;  2Y3A A;  4MEM A;  4NQK E;  3AB5 A;  2KVR A;  4DHZ B;  2D3G A;  3RD2 A;  2Z0D B;  2CU1 A;  2KNB A;  3R2T A;  3RNC C;  2WGS A;  4JIO U;  3PHW B;  2M0A A;  3AU4 A;  5HFY A;  2VH2 A;  2CHZ A;  4W9C A;  3C19 A;  2KWV B;  2O2V A;  1ZW7 A;  4IUM B;  1G6J A;  2JRH A;  3SFE B;  1L0V B;  3I9V 1;  4ZYS A;  2M0X A;  3UGB B;  1SB3 C;  3V6C B;  2I1K A;  5BYS A;  3DBL B;  2ZNV C;  4LLG M;  2PVG C;  3HM3 A;  1TZO A;  1D5Z C;  1E8W A;  2RPQ A;  3KYD D;  2ZPY A;  2VZK D;  1R4N B;  4IC7 B;  3IHP C;  3NUH B;  2G4D B;  4FXC A;  3I3T B;  2MWS B;  4GIV A;  1JML A;  5J2R A;  4MAC A;  3HIZ A;  2NTT A;  1XLO A;  1RRB A;  2R2O A;  1VDV A;  3BVM A;  1SIF A;  1WGG A;  4ICV A;  3QJZ A;  2ZJD A;  4CO7 A;  2DZM A;  3RZF A;  2L76 A;  4OZB A;  3VTW A;  3AUL A;  2CKH B;  2MSE D;  2QIE B;  1C4C A;  1V49 A;  1AW7 A;  3LB8 C;  2W54 A;  4KGT A;  3BK2 A;  3MFG A;  4B0M A;  1TZ1 A;  2WLB A;  3QQ8 B;  2YEP F;  1FXT B;  3VFK A;  1E8Z A;  4MH0 E;  2EEL A;  4WJQ A;  2LI5 A;  4MGY E;  3AE7 B;  3NVY A;  1J19 A;  1V1P B;  1QF6 A;  2IO0 B;  4ZHO A;  3P4S B;  2JRI B;  3PO0 A;  1FXA A;  1PUT A;  1P98 A;  3EFU A;  1WGR A;  4KZ0 A;  2N7J A;  3ZJT A;  1VRA B;  3J9C A;  4HDQ A;  3UIO B;  3ZJU A;  4NNJ B;  3DBR I;  5CHW A;  2LMC A;  2PVO D;  2REX A;  5AZF A;  4FJZ A;  2OHF A;  5GXG B;  2KWC A;  3PPA A;  3TEX A;  1TS3 A;  2L1A A;  2K8C A;  4L1B A;  2L05 A;  3QC8 B;  3R3M A;  4CQN A;  3A1Q A;  1CJE A;  2PW9 A;  2NPT A;  2ON8 A;  1YN5 A;  1WRD B;  5G55 A;  4ZRJ A;  3B9J A;  3RN9 C;  5DCN A;  2IYD B;  4AJW A;  4YSZ B;  2O6V B;  3PZD A;  3TEZ A;  3VHT C;  4TUU A;  1ACC A;  2RR9 A;  5KHO A;  3DCG A;  2L32 A;  4MGZ E;  3IBE A;  5E6P A;  4B95 A;  2QDF A;  2ZCB A;  4K81 A;  2GBK A;  4MSQ B;  2GB1 A;  1F9J A;  5G2N A;  2KX3 A;  5HG2 A;  4K7S A;  3UQB A;  3T3O A;  2KFJ A;  2MRP A;  3H1U A;  4DDI D;  3N32 A;  5AZH A;  3MC8 A;  4CHK A;  2XEW A;  2W9N A;  3JVZ X;  2GBR A;  1WI0 A;  4M0W A;  3W5U B;  2KLG A;  4WWP A;  3IAS 1;  2JZP A;  3OWE B;  1F1H A;  2YLM A;  2Z0E B;  3DQV A;  3RMK C;  1ZDV A;  4S0R A;  3SD5 A;  2J52 A;  2HD5 B;  4ICU A;  1RM6 C;  2LGY A;  2KZR A;  1ZXH A;  1YN4 A;  1J7B A;  4HRS A;  3O65 B;  2BW2 A;  4WIP A;  1C9F A;  5EE3 A;  2MX2 A;  3ZDM C;  3AU5 A;  2ZW1 A;  5H92 C;  2J42 A;  5D7G A;  1QOA A;  4RH6 A;  1GB1 A;  1QIL A;  4YSX B;  2C7H A;  2ZCC A;  1GC7 A;  2D10 A;  2XNA C;  3NG0 A;  2JYE A;  2QSD A;  1PFD A;  2FCN A;  1V86 A;  5AUK A;  2MBQ A;  1WX8 A;  4PYZ A;  1FCC C;  1EF5 A;  3AEE B;  2K0P A;  2BVC A;  4JQW C;  4KIK A;  2QMT A;  3HHM A;  3QHT A;  1E0Z A;  1WMH A;  1E7U A;  2C60 A;  4BOZ B;  3NJT A;  2MP2 B;  4HLE A;  5LXH A;  4G50 A;  3DDC B;  4EZK A;  1ZP0 B;  1KOT A;  4YSY B;  1OQY A;  2KAJ A;  1Q0W B;  1AAR A;  4KDI C;  1WZ3 A;  5BYQ A;  3MJW A;  2ZW0 A;  4FHJ A;  5C1Z A;  1KTK A;  2KDB A;  3RNE C;  1T6B X;  3JSV B;  3ZTD A;  1LO5 D;  4LDT D;  3B0A A;  4OZA A;  2DAF A;  4EOY A;  2JPH A;  1XLP A;  4N9F 4;  1JCK B;  1ZKH A;  3ZIM A;  3RCZ A;  2GRI A;  3GB1 A;  2PMV A;  4PS7 A;  2WXH A;  4A20 A;  2WXO A;  3L17 A;  3W9C B;  4N6E B;  4W9D A;  3GS2 A;  5C3J B;  3SFD B;  3MJ5 A;  2IGD A;  1JWM D;  4PT5 A;  1TT5 B;  1MHX A;  2K8H A;  3RUI B;  3V61 A;  4GSW A;  2RD0 A;  1HTQ A;  4G3X B;  4H2A A;  2GLS A;  1ESF A;  1EWC A;  2N7D A;  1QLB B;  3SR6 A;  3MC9 A;  1TTN A;  1UWX A;  1FMA D;  4BKT A;  2RPV A;  3APC A;  3QAQ A;  2XK5 B;  1WYG A;  3QK0 A;  1MG4 A;  1UUP A;  4A6Q A;  1WRI A;  1PGX A;  3TSS A;  3ONS A;  3SHQ A;  2WXR A;  2BYT A;  5E6J A;  2X8X X;  1FEH A;  2KQ4 X;  4W9H A;  1XCQ L;  1MHH E;  4LNI A;  3W5V B;  2WU2 B;  3V3X A;  1I42 A;  3ZNI D;  1IGC A;  1WYW B;  3DBR B;  1K8R B;  1OQR A;  1BXT A;  2JWU A;  2DNF A;  3B2F A;  4ACF A;  2KK8 A;  1V97 A;  3NZS A;  1V8C A;  2KQS A;  1NEN B;  1NBF C;  4HRO A;  3AXC A;  4WH4 A;  3GE3 C;  1FFU A;  3BK1 A;  2WXP A;  1QOF A;  3ZQ4 A;  3RNF C;  1T5X D;  3MTN B;  4USA A;  1P9D U;  2PIA A;  1YOV B;  3JW0 X;  5BMG A;  1WWT A;  2DZK A;  3Q8C A;  2N9X A;  1T3Q A;  2K3U A;  4M00 A;  4J3O D;  3CWI A;  2BS2 B;  1XLQ A;  1P7E A;  3APD A;  3HUI A;  1Q5W B;  1B9R A;  1FNW A;  2RGF A;  2GOW A;  4KSK C;  1EO6 A;  2PKO A;  4XYC A;  5GMV A;  2KO3 A;  2HE7 A;  4GOC A;  4IKG A;  1VD2 A;  2N1V A;  3ZGZ A;  2IDY A;  3V62 A;  4MM3 A;  3ENE A;  3OJ3 A;  1STE A;  2DYB A;  1C1Y B;  3CIR B;  4IWQ A;  2BQQ A;  1E8Y A;  2LGS A;  2KDE B;  1FM0 D;  4XGA B;  1L4Z B;  3P4Q B;  2ZVO A;  2OED A;  1E7V A;  1SIJ A;  1WXS A;  3VXW A;  2IO2 B;  3TCA A;  3ECI A;  3WCQ A;  3WIM A;  2CHX A;  3NZU A;  3GP7 A;  2KN4 A;  3BY4 B;  5EE1 A;  1ROE A;  2AX5 A;  2AL3 A;  2RSU A;  2O2V B;  3PTF C;  2K8B A;  3PRP B;  4JWS C;  1AWD A;  2FCQ A;  2QEJ C;  5D94 A;  5C2T B;  4YTP B;  3T9L A;  1UGM A;  1Y8R C;  4KX6 B;  1C4A A;  2I1J A;  1PGA A;  2INC C;  1GG3 A;  1WM2 A;  2SEB D;  2OJW A;  2JZZ A;  3OJ4 B;  2MJD A;  2NBU A;  3ETR A;  3ZXR A;  3M62 B;  2WXF A;  4PS8 A;  3RNA C;  4LNO A;  1LM8 B;  4TV3 A;  3W1Y A;  2R61 A;  1Z2M A;  1NVI D;  3OLM D;  4HCN B;  3Q8A A;  1P3Q U;  1YQB A;  3ZJV A;  1XLN A;  3IAM 1;  3QWZ B;  1UEL A;  3WAO A;  4OVU A;  5L95 C;  3R7Q A;  3RZW C;  3BYT B;  2AQ1 B;  3VRA B;  3K9P B;  5J18 A;  2FNJ B;  4N59 A;  1WSP A;  2D3C A;  2BGF A;  1R4M B;  2ZZP B;  3VR9 B;  4KIK B;  4LCD E;  3VTU A;  2IO3 B;  1WMH B;  2AQ3 B;  2MP2 A;  1OEY A;  3SDL C;  4RM9 A;  1KFY B;  2D3A A;  2BKF A;  2Y5C A;  3Q8E A;  2H89 B;  2GBN A;  1V6E A;  2VRR B;  2BB5 A;  4WWM A;  5CHV C;  3MHS D;  1EWY C;  3LJ3 A;  4NZL B;  4XE0 A;  1TY2 A;  3DPD A;  1Q1O A;  2WXN A;  1X1M A;  2ONQ A;  1L2N A;  5J17 A;  5HKH A;  2IO1 B;  3AV8 A;  3A1Q B;  1WJ4 A;  2V9H A;  1WX9 A;  1Z5S B;  4BOS C;  4JLC A;  1XO3 A;  1U4A A;  3NHE B;  2K9X A;  1JWB D;  1A70 A;  2NTS A;  2WXL A;  4BKG A;  2PE6 B;  2IGG A;  2G1E A;  5BMI A;  1VZ8 A;  3PZ7 A;  3C0R B;  1NYR A;  2RDG A;  3X23 A;  2J4X A;  1WXV A;  3RUL A;  4ZYN A;  4GMV A;  4LJP B;  1ZE3 D;  2BTE A;  4RNA A;  1PDX A;  4BBN F;  3E56 A;  3H7P B;  2KAC A;  2MEK A;  1UH6 A;  1N63 A;  4ZOH C;  3L13 A;  4GGQ A;  3N20 C;  3RT3 B;  1QKZ A;  4G0N B;  4RGO S;  4WWN A;  1XQQ A;  1F52 A;  2GI9 A;  2N4F A;  4DK5 A;  4XZ4 A;  1SE2 A;  1JWA D;  2X38 A;  5DPS A;  2N9K A;  4KVG B;  3VH4 B;  4KZC A;  1M4V A;  1ZPS A;  3U30 A;  1P1A A;  2L8J A;  1L0X B;  2KMA A;  2LUE A;  1GUA B;  1IGD A;  1SJH D;  2JVC A;  3M95 A;  2UWQ A;  4WWO A;  3WA0 A;  2D5G A;  4FAD A;  1KH0 A;  1WJN A;  2QJL A;  1IBX B;  1R7S A;  2UU7 A;  2LHE A;  2NS5 A;  2WQY B;  4I6P A;  1L0Y B;  2KDM A;  1CZP A;  4GU2 A;  4I6L B;  2M1M A;  1CQV A;  3D32 A;  4F1S A;  3PZ8 A;  4S17 A;  3N1X C;  1NEK B;  2LHD A;  4JE3 B;  1TYG B;  3V60 A;  1RYJ A;  1VZ6 A;  4RM8 A;  1EU3 A;  4NAW B;  3PHX B;  3VQI A;  3AE8 B;  2V1Y A;  5EE0 A;  1YQ3 B;  1UNS A;  2BYF A;  1P7F A;  1WH3 A;  3ZDT A;  5LXI B;  2C7N B;  1N61 A;  3PSE B;  3RNB C;  2AWT A;  1ZXI A;  3UF8 A;  4KGR A;  1QQR A;  3OAW A;  1WFY A;  1EM7 A;  5IOI A;  3QAR A;  3B08 A;  1EUV B;  4NQL B;  3I63 C;  1B1Z A;  1WM3 A;  2L0F A;  4L23 A;  4JWU C;  3HM6 X;  4IM3 A;  2VH1 A;  2BPS A;  3QCA A;  1EU4 A;  1ET9 A;  2V3S A;  2DBY A;  1YMH E;  2DZI A;  4AUQ C;  1PGB A;  5CHF A;  1JRO A;  2LGI A;  4B6W A;  4A9A A;  3AE4 B;  3P4R B;  3JSV A;  3A4S C;  4F7Z A;  1TS4 A;  1EF1 A;  4C00 A;  5AZG A;  2CHW A;  3WAN A;  4AP4 C;  1ENF A;  4II2 B;  3PLV A;  2I38 A;  1WY8 A;  2LVP A;  3HK0 A;  1HE8 A;  4IM2 A;  3Q8F A;  3KUC B;  2Z59 B;  1V5O A;  3U7D A;  4Q2J A;  2A5U A;  2BF8 B;  2KTF A;  1I4R A;  2YEP B;  2L7R A;  1WE7 A;  3VUW A;  1NYQ A;  4TQ0 A;  3O13 A;  2FIF A;  3AE5 B;  2KX0 A;  1D5M C;  1TKG A;  3RPF C;  5FR3 A;  2HJ1 A;  2KJ6 A;  3P2B A;  3A33 B;  4LJO B;  3AH7 A;  3UIN B;  4P7I A;  2NR2 A;  4MH8 A;  2BWF A;  1C3T A;  4LTU A;  2L0T A;  2KC1 A;  4ARC A;  3VRB B;  1N60 A;  3TJP A;  4GB9 A;  5JHB A;  5C23 A;  3ZTC A;  2KXJ A;  3R2I A;  1QT9 A;  1QZE A;  1WXQ A;  4EKU A;  1QOB A;  4MEL A;  4XX5 A;  2LGD A;  1ZOY B;  4EZJ A;  3N1Z C;  1XXG A;  1GJZ A;  2GBJ A;  1J0G A;  3E9S A;  3A9J A;  3TL5 A;  2DEN B;  4E3C A;  1FPY A;  2W3R A;  2OJR A;  3KH0 A;  4M8N A;  1WIA A;  1UF0 A;  1A5R A;  4RGT A;  2LXC A;  5JXV A;  2B3A A;  4QAY A;  4XWW A;  2KC2 A;  2V4L A;  3DWM A;  1HXY D;  4P16 A;  4GDL B;  2KJR A;  3W1S A;  2CR5 A;  3DHH C;  2QC8 A;  3ZNH B;  2OOB B;  5G5G A;  5D6J B;  3ABV B;  3BZD B;  4ARI A;  2K6D B;  4HDO A;  1C76 A;  2IBI B;  2BBC A;  2MBH A;  4AS1 A;  4MM3 B;  4FBJ B;  3PRE A;  3Q2A C;  2N9P C;  4MT5 A;  4FUL A;  3VR8 B;  3AE1 B;  1WJ6 A;  5JH5 C;  4EZL A;  2MBB B;  1D3Z A;  4MJS A;  2ACZ B;  4ANU A;  3H7P A;  3KWV A;  1LFD A;  1VR9 A;  4NPN A;  2JQR B;  3AMZ A;  3RFZ B;  1HA5 A;  1WE6 A;  1H4R A;  1GOZ A;  4G11 A;  2GBM A;  4W9E A;  3AM9 A;  2HTH A;  3RYT A;  1DOY A;  3M63 B;  2BB6 A;  1WGD A;  4HEA 1;  2KVZ A;  1K53 A;  2ASQ A;  1IP9 A;  3ZW3 A;  2IGH A;  1ZGU B;  2C5L C;  2WXQ A;  3EC8 A;  3KUZ A;  2MQJ A;  3PGE A;  4W9K A;  4LNN A;  4W9F A;  2J0J A;  1I4P A;  1MVK A;  1E6E B;  2EKI A;  4W9G A;  4DHZ E;  4II3 B;  1IBX A;  2CU3 A;  2AEH A;  3AED B;  4BKS D;  2FE8 A;  3BVZ A;  1ZDX A;  4BZA A;  1WZ0 A;  3GOE A;  4IW0 A;  1YD8 U;  2V4I B;  1E5W A;  4ITK A;  4MSM B;  1R4N I;  1BT0 A;  1FNU A;  1YX6 B;  3AE3 B;  5FKA C;  2KT7 A;  3ZKJ C;  1NI3 A;  3R8B A;  1N62 A;  1TJE A;  3ZNG C;  1RAX A;  2L00 B;  3VVW B;  2MJ3 A;  2KMM A;  2BS3 B;  1FRR A;  1SSN A;  1GPX A;  1VCB A;  3SEB A;  5EE9 A;  3V6E B;  2CJO A;  1TY0 A;  3EUB 2;  2JWZ A;  3DVG X;  3GZN B;  2PTL A;  1E8X A;  1L6U A;  4M02 A;  4WJP A;  5T8I A;  2KDF B;  4ZHP A;  4ZRI A;  3TIX A;  1V9J A;  1GC6 A;  2L52 A;  4IG7 B;  2IND C;  1J7C A;  1WGK A;  1QOG A;  3U7Z A;  1SBB B;  2ZVN A;  4B9K A;  1JRU A;  3VUY A;  4RCO A;  3FKY A;  5HI1 A;  1YNT E;  1NDD A;  2MBO A;  2WYQ A;  4ZRP A;  1I4G A;  1MI0 A;  1T0R C;  2HTM E;  3PVL A;  4DXF A;  2DAJ A;  4WJN A;  2MH7 A;  2N0S B;  2ICI A;  3ZRF A;  3MC0 B;  3PRM B;  4TQ1 A;  2KLC A;  1YJ1 A;  1OEY J;  4ASW C;  2E6X A;  1F77 A;  4F8C B;  1UWM A;  5IA7 A;  4FN2 A;  3AEC B;  3KW5 B;  1WF9 A;  2BYE A;  1JAL A;  2NCN A;  1KLV A;  2JY6 A;  1AYF A;  2EMT A;  3ZRC A;  5FK9 C;  1WXA A;  2LJ5 A;  4KKI A;  2KTR A;  3Q3O C;  4ANV A;  2KYW A;  1KF6 B;  2HDE A;  1C79 A;  5IAA C;  1V1O A;  4XDD A;  1XT9 B;  1JWS D;  3NZ3 A;  1SJE D;  3X0W A;  1RLF A;  2LVO A;  4HVB A;  2PE9 A;  3IFW B;  3GZN I;  1WXM A;  4URK A;  1DGJ A;  4REZ A;  1E90 A;  3MHZ A;  4IDI A;  3ZLZ A;  3A9K B;  1JWU D;  2KN5 A;  2WXK A;  3P1M A;  1HEZ E;  2PPH A;  2V3P A;  4LDT B;  2PJH A;  2K6Q A;  4WAA A;  1UBQ A;  3DWG C;  2JSV X;  3Q3N C;  5D2M B;  3TBL D;  4WUR A;  4ANX A;  1DOX A;  3CMM B;  5G5H A;  5H8Y E;  3AEA B;  3B1L X;  3AEF B;  3U8Z A;  2KQ7 A;  3DOW A;  2KOX A;  5CX3 A;  1WGH A;  1F0Z A;  3P63 A;  2G9H D;  2WX0 A;  3DHI C;  3NS1 A;  3QX1 A;  1IYF A;  2D2Q A;  3K9O B;  3P4P B;  1Y56 A;  3ALB A;  3I57 A;  1Q10 A;  4NAW A;  2RDB C;  4RMA A;  1F2R I;  4HPM B;  1MPE A;  2HJ8 A;  3TUO A;  3I5J C;  5HHD G;  4OHJ A;  4FA6 A;  2JXX A;  3R66 C;  4DHJ D;  4O1N A;  4E71 A;  1LXD A;  1ISN A;  4ZRQ A;  3VH3 B;  3L54 A;  2MHJ A;  2KD0 A;  3NVV A;  3FAH A;  1K52 A;  2I2Y A;  1TIF A; 
#chains in the Genus database with same CATH homology
 4JL9 A;  4EOY A;  2MLB A;  2JPH A;  3DBH I;  2IY0 B;  4N9F 4;  2ZEQ A;  3L0W B;  4B6W A;  1ZKH A;  2XBB C;  2O6V A;  3ZIM A;  1V2Y A;  3RCZ A;  3A4R A;  4ANW A;  1S3S G;  4WJO A;  3JSV A;  3A4S C;  4PS7 A;  4HPL B;  4OVV A;  4F7Z A;  4A20 A;  3L17 A;  5KHQ A;  1EF1 A;  2BWE S;  4W9D A;  2M8S A;  4AJY B;  5AZG A;  4MJS B;  2CHW A;  3BIN A;  3WAN A;  1XD3 B;  4AP4 C;  4KDL B;  3AI5 A;  4YL8 A;  2K8H A;  4J6I A;  4II2 B;  3PLV A;  2LD9 A;  3RUI B;  4HCP B;  2ZNV B;  1WY8 A;  2LVP A;  3HK0 A;  3L08 A;  4GSW A;  1HE8 A;  2RD0 A;  4IM2 A;  3V61 A;  1WJU A;  1R4M I;  4G3X B;  4K7U A;  4WQO B;  2MCN B;  4NJ7 A;  5AEK B;  2N7D A;  2XK5 A;  3KUC B;  2PEA A;  2Z59 B;  1V5O A;  3U7D A;  2A5U A;  1TTN A;  2BF8 B;  2KTF A;  2FCS A;  4ZRK A;  5JHA A;  2C7M B;  2L7R A;  1WE7 A;  3VUW A;  4BKT A;  4KSL C;  4M0W B;  3SU8 X;  4DWF A;  4TQ0 A;  4GXB A;  1CMX B;  3APC A;  3QAQ A;  2FIF A;  2LRU A;  2KX0 A;  2XK5 B;  2JZ3 B;  3APF A;  2GMI C;  3QK0 A;  3ZO5 B;  3WAM A;  3LDZ E;  2KJ6 A;  3P2B A;  3ONS A;  3Q3J A;  2KWU B;  3SHQ A;  3A33 B;  4LJO B;  1PQS A;  2FUH B;  3VDZ A;  3UIN B;  4P7I A;  2NR2 A;  1V80 A;  2BWF A;  1C3T A;  2L0T A;  4MGI E;  2KC1 A;  3H6N A;  2CS4 A;  4W9H A;  3VUX A;  2JUO A;  2DZJ A;  4FLH A;  3TJP A;  4NY0 A;  4CYE A;  1H8C A;  4GB9 A;  5JHB A;  4W9J A;  5C23 A;  2BYV E;  3ZTC A;  3N3K B;  1T0Y A;  1I42 A;  3DVN V;  3ZNI D;  4ZDV A;  3WAL A;  1WX7 A;  1WYW B;  3KVF B;  1K8R B;  2MA9 B;  2KXJ A;  2KK8 A;  4K1R B;  2EMS A;  3NZS A;  2KQS A;  1QZE A;  1SE9 A;  2O6V D;  4EKU A;  2ZPN A;  4MEL A;  4XX5 A;  1NBF C;  2LGD A;  4FJY A;  4EZJ A;  3AXC A;  4W9L A;  4IWP A;  4GDK A;  4E74 A;  1GJZ A;  2GBJ A;  1J0G A;  3VTV A;  3A9J A;  5BO4 B;  2JF5 A;  3PS6 A;  3TL5 A;  1WR1 A;  2DEN B;  3DBS A;  3MTN B;  4E3C A;  2KAN A;  1P9D U;  3UQA A;  2OJR A;  3KH0 A;  1I35 A;  4M8N A;  3JW0 X;  3WAP A;  1WIA A;  5E6O A;  3NY5 A;  2DZK A;  1A5R A;  4PYU A;  1OTR B;  3A9J B;  4PS3 A;  2N9X A;  2LXC A;  1KJT A;  2B3A A;  2KC2 A;  2V4L A;  4AOF A;  3APD A;  1Q5W B;  1NI2 A;  4GDL B;  2KJR A;  3W1S A;  2CR5 A;  2GOW A;  2RGF A;  4DBG A;  2MBE A;  4KSK C;  1SGH A;  2KDI A;  1EO6 A;  3ZNH B;  2OOB B;  2D07 B;  2KO3 A;  3DVN U;  5GMV A;  2HE7 A;  4GOC A;  5D6J B;  1M94 A;  1VD2 A;  2N1V A;  4MEM A;  4EFO A;  4NQK E;  3V62 A;  2KVR A;  3ENE A;  4MM3 A;  3OJ3 A;  4BVU C;  4DHZ B;  2DYB A;  2D3G A;  2K6D B;  3RD2 A;  2N9E B;  1C1Y B;  4HDO A;  4K7W A;  4GDL A;  2Z0D B;  4HWI B;  2IBI B;  2CU1 A;  2KNB A;  2MBH A;  4IWQ A;  3ZVV A;  1E8Y A;  4JIO U;  3PHW B;  2KFK A;  4BKS A;  2KDE B;  4KV2 A;  3AU4 A;  5EDS A;  4FBJ B;  3PRE A;  2N9P C;  4FUL A;  2LXA A;  1WJ6 A;  2CHZ A;  5JH5 C;  4W9C A;  5DPT A;  2ZVO A;  2KWV B;  2O2V A;  1E7V A;  1V5T A;  1WXS A;  1ZW7 A;  4EZL A;  3ZNZ B;  3VXW A;  2A4Z A;  4IUM B;  2IO2 B;  2MBB B;  3ECI A;  3TCA A;  1G6J A;  3WIM A;  1D3Z A;  4MJS A;  2JRH A;  2FCM A;  2N1W A;  3IG3 A;  2CHX A;  3PT2 B;  2M0X A;  3H7P A;  3UGB B;  1LFD A;  3V6C B;  3NZU A;  4ANU A;  3R7R A;  4GN1 A;  2KHW B;  2I1K A;  2QHO A;  4NPN A;  2J7Q B;  3BY4 B;  2ZNV C;  2AL3 A;  2RSU A;  2O2V B;  1YX5 B;  4AWJ A;  1RFA A;  3HM3 A;  3PTF C;  3TMP B;  1E8W A;  2KTR B;  2WX1 A;  2RPQ A;  2K8B A;  3UIP B;  1WE6 A;  3PRP B;  4EEW A;  2FCQ A;  1H4R A;  3KYD D;  5D94 A;  4G11 A;  2GBM A;  2ZPY A;  4W9E A;  3T9L A;  2HTH A;  3RYT A;  4IC7 B;  1UGM A;  1Y8R C;  3IHP C;  3M63 B;  1WGD A;  5DPR A;  4IWO A;  3S2A A;  3PLU A;  2I1J A;  2G4D B;  4MGK E;  1WR6 E;  2MW5 A;  3I3T B;  2MWS B;  2ASQ A;  1IP9 A;  4GIV A;  3ZW3 A;  3KUD B;  1ZGU B;  2C5L C;  1GG3 A;  3EC8 A;  1WM2 A;  5J2R A;  3HIZ A;  3KUZ A;  2MQJ A;  2DYO A;  3PGE A;  2JZZ A;  2NBV B;  3OJ4 B;  4W9K A;  1RRB A;  2NBU A;  2R2O A;  4W9F A;  2J0J A;  3CF6 E;  1SIF A;  1WGG A;  4ICV A;  3M62 B;  3QJZ A;  2C9W B;  4PS8 A;  2ZJD A;  4CO7 A;  4W9G A;  1LM8 B;  2DZM A;  3RZF A;  4DHZ E;  2L76 A;  2FAZ A;  4II3 B;  2DYM A;  3AUL A;  3VTW A;  1UZX B;  2CKH B;  2M17 A;  4TV3 A;  2AEH A;  2MSE D;  3W1Y A;  1V49 A;  4BKS D;  1Z2M A;  3OLM D;  1WZ0 A;  3GOE A;  4HCN B;  4IW0 A;  5LLI A;  2IZV B;  1YD8 U;  1P3Q U;  1YQB A;  3NS8 A;  1E5W A;  1TZ1 A;  2LZ6 A;  2FID A;  3ML8 A;  3QWZ B;  4MSM B;  1R4N I;  1BT0 A;  2G45 B;  2G3Q B;  1YX6 B;  3QQ8 B;  3L16 A;  1FXT B;  3VFK A;  1UEL A;  3WAO A;  1E8Z A;  4MH0 E;  4OVU A;  3R7Q A;  5L95 C;  4WJQ A;  3ZKJ C;  2LI5 A;  3RZW C;  4MGY E;  1J19 A;  4TKN A;  2UYZ B;  4EUT A;  2IO0 B;  3ZNG C;  1RAX A;  2L00 B;  3K9P B;  5J18 A;  2FNJ B;  3VVW B;  2JRI B;  4BBN C;  2BGF A;  1P98 A;  3EFU A;  1WGR A;  1S1Q B;  1VCB A;  2ZZP B;  4KIK B;  4KZ0 A;  2N7E A;  4LCD E;  1P0R A;  3V6E B;  2IO3 B;  3VTU A;  4HDQ A;  3ML9 A;  3UIO B;  2LVQ A;  1WMH B;  3CSF A;  2JWZ A;  4NNJ B;  3DVG X;  2MP2 A;  1E8X A;  3DBR I;  5CHW A;  2NPT B;  2REX A;  5AZF A;  4WJP A;  1OEY A;  2KDF B;  4FJZ A;  4ZRI A;  3TIX A;  3SDL C;  4M8M A;  2KWC A;  1V9J A;  3PPA A;  4RM9 A;  5L83 A;  2BKF A;  2K8C A;  1GC6 A;  2L05 A;  3QC8 B;  3R3M A;  3A1Q A;  4IG7 B;  2GBN A;  1V6E A;  2VRR B;  5DPW A;  2ZVN A;  5CHV C;  3MHS D;  1TBE A;  1WGY A;  3LJ3 A;  2NPT A;  4HXD A;  4B9K A;  3DPD A;  1Q1O A;  1X1M A;  1JRU A;  1WRD B;  1L2N A;  2K25 A;  2IY1 B;  2JT4 B;  5G55 A;  3VUY A;  2IO1 B;  5HKH A;  5J17 A;  4ZRJ A;  5DCN A;  2IYD B;  3A1Q B;  1NDD A;  1WJ4 A;  2MBO A;  2WYQ A;  1WX9 A;  3PRZ A;  1Z5S B;  3T8M A;  4AJW A;  3PVL A;  4BOS C;  2O6V B;  2DAJ A;  3PZD A;  4WJN A;  4JLC A;  3VHT C;  1U4A A;  3DVG Y;  3NHE B;  3ZRF A;  3PRM B;  4TUU A;  2RR9 A;  5KHO A;  2D11 A;  3DCG A;  4TQ1 A;  2KLC A;  4MGZ E;  3H9D A;  3IBE A;  4BKG A;  5E6P A;  1YJ1 A;  2PE6 B;  1OEY J;  4ASW C;  4B95 A;  1MG8 A;  4A3P A;  4F8C B;  3C0R B;  2ZCB A;  4K81 A;  5IA7 A;  2GBK A;  3X23 A;  4FN2 A;  4MSQ B;  3ZUN A;  1WXV A;  3RUL A;  4ZYN A;  2WDT B;  3KW5 B;  1WF9 A;  4GMV A;  4LJP B;  2BYE A;  1F9J A;  5G2N A;  2KX3 A;  4BBN F;  3H7P B;  2NCN A;  1OGW A;  1KLV A;  1UH6 A;  2JY6 A;  4K7S A;  3UQB A;  2EMT A;  4FJV B;  2KJH B;  3L13 A;  3ZRC A;  4GGQ A;  3RT3 B;  2KFJ A;  1WXA A;  2MRP A;  2LGX A;  2LJ5 A;  4G0N B;  3H1U A;  4WWN A;  4BFR A;  1XQQ A;  2KTR A;  2N4F A;  2R2Q A;  3N32 A;  2KMC A;  4HK2 A;  5AZH A;  4DDI D;  4DK5 A;  4CHK A;  2XEW A;  2W9N A;  3JVZ X;  4XZ4 A;  4ANV A;  2GBR A;  1WI0 A;  4W9I A;  4DXA B;  2KLG A;  4WWP A;  1GNU A;  2DX5 B;  5DPS A;  4KVG B;  3VH4 B;  5IAA C;  4KZC A;  1XT9 B;  2YLM A;  2Z0E B;  3DQV A;  2J0K A;  3U30 A;  2G4S A;  2LRW A;  3X0W A;  1P1A A;  2L8J A;  3SD5 A;  2KMA A;  3QIJ A;  1J8C A;  3EEC A;  1RLF A;  2J0M A;  4IM0 A;  1UD7 A;  1V81 A;  2HD5 B;  2LUE A;  2LVO A;  4ICU A;  5FR6 A;  3VAW A;  4HVB A;  2K39 A;  2LGY A;  2KZR A;  2PE9 A;  3IFW B;  1GUA B;  2M4N A;  2K1F A;  2JVC A;  3M95 A;  1LQB A;  3GZN I;  1WXM A;  2UWQ A;  4DDG D;  4URK A;  3N30 A;  2AYO B;  4WWO A;  3WA0 A;  3ZLZ A;  1E90 A;  4FAD A;  3O65 B;  1WJN A;  3A9K B;  3QA8 A;  4JGH B;  2MX2 A;  3CST A;  3ZDM C;  2KN5 A;  3AU5 A;  2NS5 A;  4I6P A;  3IVF A;  5D7G A;  2LAS A;  2LWP A;  4I6N B;  4GU2 A;  4I6L B;  2M1M A;  2PPH A;  3D32 A;  4X57 B;  3A9K A;  4LDT B;  2PJH A;  2K6Q A;  3DBL I;  1UBQ A;  4WAA A;  4F1S A;  3L10 B;  1TGZ B;  5D2M B;  2C7H A;  2KKC A;  3TBL D;  4ANX A;  4MDK E;  3V60 A;  2ZCC A;  3CMM B;  1GC7 A;  3B1L X;  2D10 A;  4RM8 A;  4NAW B;  3PHX B;  4GDK B;  3VQI A;  4XC2 A;  2NVU I;  2WWZ A;  3U8Z A;  2V1Y A;  3M3J A;  2BYF A;  2KQ7 A;  3DOW A;  4NJ6 A;  2KOX A;  5CX3 A;  1WGH A;  1WH3 A;  1V86 A;  2BKR B;  2FCN A;  2WX0 A;  2MBQ A;  3Q3F A;  3QX1 A;  1IPG A;  1WX8 A;  3ZDT A;  5LXI B;  1IYF A;  2D2Q A;  4A3O A;  2C7N B;  3K9O B;  3ALB A;  3PSE B;  3H7S A;  4PYZ A;  1EF5 A;  4DHJ B;  2AWT A;  2YVC A;  4NAW A;  3UF8 A;  3JYU A;  4JQW C;  4RMA A;  4KIK A;  2HJ8 A;  2NBW B;  3NOB A;  4HPM B;  3OAW A;  1WFY A;  3HHM A;  1KM7 A;  2L3Z A;  3B08 A;  3QAR A;  3QHT A;  5CTR C;  1WMH A;  1E7U A;  2C60 A;  4BOZ B;  1EUV B;  4NQL B;  2DHZ A;  2MP2 B;  4HLE A;  4FA6 A;  5JZE B;  1WM3 A;  5LXH A;  4G50 A;  2L0F A;  2JXX A;  3DDC B;  4EZK A;  3R66 C;  3HM6 X;  4IM3 A;  1KOT A;  1OQY A;  2Y5B B;  4DHJ D;  1Q0W B;  1AAR A;  4KDI C;  2AL6 A;  4HJK A;  1WZ3 A;  5E6N A;  2BPS A;  3MJW A;  5TR5 A;  4FHK A;  3W1S C;  4E71 A;  1LXD A;  4FHJ A;  5C1Z A;  2EKE C;  1YIW A;  1ISN A;  3EHV A;  3VH3 B;  3QCA A;  2KDB A;  3L54 A;  2V3S A;  2KD0 A;  1L7Y A;  2DZI A;  3JSV B;  3ZTD A;  3KYC D;  4LDT D;  3PV1 A;  4AUQ C;  5CHF A;  3B0A A;  2DAF A;  1UBI A;  2KFK B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...