1NDDA

Structure of nedd8
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
74
structure length
74
Chain Sequence
MLIKVKTLTGKEIEIDIEPTDKVERIKERVEEKEGIPPQQQRLIYSGKQMNDEKTAADYKILGGSVLHLVLALR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Signaling protein
molecule keywords PROTEIN (UBIQUITIN-LIKE PROTEIN NEDD8)
publication title Crystal structure of the human ubiquitin-like protein NEDD8 and interactions with ubiquitin pathway enzymes.
pubmed doi rcsb
source organism Homo sapiens
total genus 20
structure length 74
sequence length 74
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 1998-08-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00240 ubiquitin Ubiquitin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 1nddA00
2KFKA 1EO6A 4FULA 2MBEA 3RYTA 4ZYNA 3DDCB 2K6QA 1WXAA 3ONSA 4KSKC 1YX6B 2M0XA 1WI0A 3TL5A 2CS4A 2O6VB 4OVVA 3DBSA 1UELA 3I3TB 3VTWA 3W1YA 2D3GA 3A9JB 3KUZA 1RRBA 3IG3A 4E71A 2ZJDA 2DYOA 4JIOU 4MGKE 5DPTA 2MRPA 2DZKA 2WDTB 3KVFB 4G3XB 4HJKA 4KDIC 5J18A 2WYQA 1BT0A 2C9WB 3ECIA 2AL6A 3PV1A 4BKSD 4GDLA 4DHJB 2N9PC 4W9KA 1Q0WB 3PVLA 2HE7A 5C23A 2R2OA 4EOYA 1SE9A 2J0MA 1E8YA 2LGDA 2LASA 3OLMD 1J8CA 3KH0A 1WX9A 1WR1A 2PPHA 2N9EB 3QX1A 3RZWC 3UQBA 2LGXA 1J0GA 1E90A 3MTNB 4MM3A 2BWES 4FADA 3ZNID 3QJZA 2G4DB 2A5UA 2LUEA 2QHOA 1LFDA 1YD8U 2I1KA 2JZ3B 1NDDA 3ZDTA 1EUVB 2CKHB 2KK8A 5CHWA 3EECA 4GDKA 4W9CA 2KDBA 3M3JA 3TJPA 3HK0A 4B9KA 3GZNI 1V49A 2MX2A 2NPTA 3M95A 4K1RB 4X57B 4WJPA 4A20A 2GBMA 2NVUI 5G55A 2BPSA 3T9LA 2XEWA 4JQWC 3PLUA 4WJOA 2DZJA 1RLFA 4BOZB 5IA7A 4W9DA 4IWQA 5CX3A 4WJQA 1S3SG 3V61A 2FIFA 4DHZE 2N1WA 2JVCA 2DHZA 4ANUA 4F7ZA 3JW0X 5D94A 4K81A 3ZTCA 3ZRCA 2YVCA 5CHFA 5DPWA 3KYDD 4CYEA 2KNBA 4W9LA 1ZW7A 3MHSD 4K7WA 3WAPA 4IM3A 4AUQC 4BKSA 3KYCD 4BBNF 4FA6A 1YQBA 4JGHB 1V6EA 4KIKA 1WMHA 5JHAA 4WQOB 3VTUA 3PHWB 3PTFC 4RM8A 2MP2B 2GBRA 1EF1A 2DYBA 4G50A 2GBNA 3RD2A 4KV2A 1GNUA 3QARA 2FIDA 2XK5A 4AOFA 4NQKE 4NAWB 3QHTA 3HM6X 5AZGA 3TCAA 3TMPB 3APFA 3P2BA 1SIFA 1WGHA 2KX0A 3ZKJC 4BFRA 2NBWB 1I42A 2V1YA 1LQBA 1WZ0A 1IYFA 1MG8A 4FBJB 4EEWA 2KDEB 2XBBC 3K9OB 3L13A 3ML9A 1WX7A 2KMCA 4MGYE 2M1MA 2KLCA 2PE9A 4W9IA 3SHQA 2CU1A 1UBIA 3QWZB 1P98A 4N9F4 2IO3B 2PEAA 1M94A 3A9KA 2L00B 3L08A 5HKHA 2EKEC 1G6JA 2AL3A 2RSUA 3AI5A 4XZ4A 1EF5A 3PRZA 3U8ZA 3X23A 4LCDE 4M0WB 2KFJA 2O6VD 3DPDA 2NS5A 3Q3FA 4ZRJA 3RULA 1KM7A 3U7DA 5JZEB 4G0NB 2KQ7A 2CHZA 2ZCCA 2G4SA 1E7UA 3WAOA 3CSFA 4DHJD 1VD2A 3PRMB 3KW5B 2EMSA 1OQYA 1AARA 2DYMA 3ZTDA 3BINA 2LXAA 2KX3A 2ZPYA 3ZNHB 2LWPA 3VTVA 1XQQA 5DPRA 2HTHA 2AEHA 4TKNA 2G3QB 4TUUA 4F8CB 2MCNB 1V9JA 1P3QU 2OOBB 3AXCA 4M8NA 5CHVC 4B6WA 2O2VB 2REXA 4LDTB 4LJPB 4HCPB 4GDLB 1E8WA 2K1FA 1ZKHA 3PHXB 2GMIC 1GJZA 4IG7B 1NI2A 2A4ZA 2KLGA 1ISNA 4TQ1A 1J19A 2N9XA 4FJVB 3SDLC 2IO0B 2LVPA 3PLVA 1H4RA 2FCSA 3UGBB 4FJYA 1YJ1A 1WGRA 4AP4C 1LXDA 2FCMA 3A4SC 3ZNZB 2MWSB 3NZSA 2KD0A 2KDIA 3VDZA 4BVUC 3DVNU 3U30A 4MELA 2IY0B 1X1MA 4PYZA 2K8HA 3LDZE 2KDFB 1WX8A 3DOWA 4M8MA 4F1SA 3L54A 3NS8A 1SGHA 4IM0A 4W9HA 3H1UA 3KUCB 2O6VA 4A3PA 2Z59B 2DZMA 2K8CA 2KZRA 3A9JA 4RMAA 1UGMA 2NPTB 4KZ0A 4BOSC 2LVQA 2IO2B 2C7MB 2MBQA 2N7EA 2MW5A 2JY6A 1V81A 2KC2A 1Q1OA 1WH3A 2HD5B 3A1QB 1YX5B 2LZ6A 3DVGY 2IYDB 4MJSA 1A5RA 1OEYA 4ANVA 2LVOA 4KZCA 1Y8RC 3L17A 2FCQA 3TIXA 3AULA 2PE6B 3V60A 4HPLB 3T8MA 3ZDMC 3OJ4B 3JSVA 4MDKE 3UIPB 5IAAC 1HE8A 1WR6E 4DHZB 2IBIB 4I6LB 5E6OA 4WAAA 3VVWB 3OJ3A 3WA0A 2Z0EB 4LJOB 2DAJA 2L3ZA 1XD3B 1WYWB 4NJ6A 2G45B 1KOTA 1WMHB 2KTRA 2BKRB 2BGFA 4MSQB 3BY4B 3ZW3A 5JHBA 1WZ3A 1XT9B 3ZLZA 2MBOA 3R66C 1E5WA 4WWOA 2KN5A 2L0FA 4EZJA 2WX0A 4HWIB 2DAFA 2KWUB 1QZEA 4WWNA 1TBEA 2N1VA 4GMVA 3PT2B 2LXCA 3Q3JA 2C5LC 4GB9A 4JL9A 2UWQA 2J0JA 5L95C 2JRIB 4IUMB 5J17A 1V5OA 3L0WB 4IM2A 4NQLB 2M17A 4A3OA 4ZRKA 2C7HA 2JF5A 4J6IA 4DXAB 3N30A 4EKUA 2R2QA 3SU8X 3UF8A 3JYUA 3S2AA 3H7SA 4WJNA 4II2B 2ZNVC 3QCAA 1IP9A 4NY0A 1LM8B 1TZ1A 3ALBA 1WRDB 2AYOB 3PPAA 3R7QA 1R4MI 3ZVVA 4ANWA 2JPHA 3A9KB 3VAWA 2K39A 3NOBA 1E8XA 3QA8A 1IPGA 2CHXA 1P1AA 2NCNA 4GSWA 2DX5B 2KJHB 3M62B 4HCNB 1E7VA 3IVFA 4AJYB 4PS8A 5GMVA 3QC8B 4GN1A 4HK2A 3UQAA 5D6JB 2IO1B 3ZNGC 2IZVB 2J0KA 3DVGX 2DENB 2ZZPB 1GC7A 4LDTD 4CHKA 1Q5WB 2JXXA 1P0RA 2FCNA 1Z2MA 2GBKA 4BKTA 4W9FA 1WIAA 4KVGB 1WM2A 1C3TA 1WY8A 3MJWA 2FNJB 3K9PB 3AU5A 2KFKB 3PGEA 2AWTA 3H7PA 3UINB 1D3ZA 1ZGUB 3ZO5B 2BF8B 2FAZA 2N4FA 2K8BA 4HDQA 3UIOB 2OJRA 1TTNA 2Z0DB 2KJRA 2LRWA 2YLMA 4FHKA 1WJNA 2C60A 1CMXB 1K8RB 1GG3A 2M8SA 1GC6A 1L7YA 2KWCA 3EFUA 3ZRFA 2M4NA 3B0AA 5DPSA 4EFOA 4W9JA 3WAMA 2JWZA 4URKA 2CR5A 2KXJA 3JVZX 3PSEB 4GU2A 2WX1A 1U4AA 3NY5A 2D07B 2EMTA 3ENEA 2KQSA 1R4NI 4MEMA 5AZHA 3TBLD 3SD5A 1PQSA 5AEKB 3NZUA 3L10B 4AWJA 2KTFA 2KHWB 2L7RA 3DQVA 3DVNV 3PREA 4ICVA 4IW0A 4DDID 4KDLB 4ZRIA 3R7RA 5DCNA 2ASQA 2KMAA 1H8CA 3APCA 3RCZA 4DBGA 3B08A 3IHPC 2B3AA 1OGWA 3GOEA 4GGQA 5TR5A 4E74A 3VUYA 4GDKB 3N32A 3CMMB 2O2VA 2UYZB 5D2MB 2JRHA 3C0RB 5KHQA 3H9DA 3WANA 1V5TA 3VFKA 3ZUNA 2GOWA 2C7NB 2D2QA 3H6NA 2L8JA 4GOCA 2ZVOA 4MH0E 5L83A 1WE6A 4MJSB 5G2NA 1UBQA 1WGYA 1RFAA 2ZPNA 3AU4A 3RZFA 3VUWA 3PZDA 3PRPB 2RGFA 2KJ6A 3V6CB 2LI5A 2BYEA 4TQ0A 3JSVB 4OVUA 3VH4B 3B1LX 3EC8A 4W9EA 2L76A 1E8ZA 2NBVB 1KLVA 3VXWA 3OAWA 1YIWA 3HM3A 1V80A 1WGDA 2KANA 4MSMB 1F9JA 4YL8A 3PS6A 2NBUA 1S1QB 5CTRC 2KTRB 4XC2A 4WWPA 5LXHA 1WE7A 4FJZA 5EDSA 3N3KB 3HHMA 2BYVE 4BBNC 2LJ5A 5C1ZA 4KIKB 4IWPA 2BKFA 3VQIA 4HDOA 3RT3B 3R3MA 2ZCBA 3ZIMA 3QAQA 2KOXA 4I6NB 3A1QA 4HPMB 2ZNVB 1P9DU 2XK5B 2I1JA 3D32A 4KSLC 2MSED 1VCBA 2RPQA 3NHEB 1JRUA 3QQ8B 4G11A 5J2RA 3IFWB 4PS3A 1WM3A 3DBLI 3DBHI 1WGGA 2ZEQA 4NNJB 4K7UA 2RD0A 2LD9A 2MQJA 3M63B 4B95A 2L0TA 2RR9A 2HJ8A 3HIZA 1KJTA 3W1SA 2J7QB 2V3SA 2D10A 1L2NA 2KKCA 4P7IA 1WXSA 3A33B 4MGIE 3VHTC 3V6EB 2LRUA 3VUXA 1FXTB 1NBFC 2MA9B 2WWZA 4NJ7A 4EZKA 1WXMA 4DDGD 3O65B 1OEYJ 5LLIA 3QK0A 1WJUA 4FLHA 5FR6A 2FUHB 3V62A 5D7GA 3W1SC 4ASWC 3RUIB 2Y5BB 3IBEA 4NPNA 4JLCA 3WALA 2MP2A 4TV3A 1WJ6A 2K6DB 4PS7A 4ZDVA 4I6PA 2PJHA 4GXBA 4DK5A 4NAWA 2K25A 4PYUA 2MBHA 2JT4B 2IY1B 5BO4B 4BKGA 1T0YA 2JZZA 3CF6E 1Z5SB 1V2YA 2GBJA 1C1YB 1UH6A 3VH3B 1I35A 1RAXA 5E6NA 2W9NA 3L16A 4EUTA 4RM9A 3WIMA 4E3CA 2MBBB 4CO7A 4HVBA 5JH5C 2D11A 1V86A 3H7PB 2ZVNA 1WXVA 2KWVB 2DZIA 2KO3A 4FHJA 4HLEA 1WF9A 3EHVA 3CSTA 2MLBA 5KHOA 1WFYA 1UD7A 3DBRI 3ML8A 4AJWA 4FN2A 4W9GA 1UZXB 2BWFA 3X0WA 2JUOA 4IWOA 1OTRB 4HXDA 3DCGA 4ICUA 2V4LA 3QIJA 4EZLA 1TGZB 2NR2A 2LGYA 3LJ3A 4II3B 2BYFA 3APDA 4XX5A 5E6PA 4DWFA 4K7SA 2N7DA 1WJ4A 4IC7B 2L05A 3KUDB 4ANXA 5LXIB 4GIVA 1GUAB 3A4RA 2VRRB 4MGZE 5AZFA 2KC1A 2KVRA 2CHWA
chains in the Genus database with same CATH superfamily
2DNFA 1EO6A 4ZRPA 1EWYC 2MBEA 3DHHC 3DDCB 3IT6B 3TL5A 2CS4A 1FNWA 2RDBC 1PDXA 3A9JB 1RRBA 2ZJDA 5DPTA 2INDC 1AYFA 2WYQA 5T8IA 4DHJB 4GDLA 2HE7A 1MHHE 3NVVA 1SE9A 2J0MA 2LGDA 2JYTA 3Q8EA 1D5MC 4MM3A 3AE5B 2A5UA 3IAM1 2K5PA 2IGDA 2I1KA 5EE3A 2JZ3B 3M3JA 1FM0D 3BVZA 4NJCA 1YJIA 2MX2A 2NVUI 2BPSA 1XF5L 3T9LA 4JQWC 1T0SC 3PLUA 5IKCM 4BOZB 1MVKA 2ACZB 3V61A 2N1WA 4ANUA 1F2RC 4K3CA 3ZTCA 3ZRCA 3ZJUA 3KYDD 2KNBA 1ZW7A 1L5PA 4AUQC 4L23A 4A55A 1JQ4A 1N62A 1V6EA 4KIKA 1WMHA 3VTUA 3PHWB 3PTFC 4KV2A 1F52A 3QARA 2FIDA 3RNFC 5EE1A 4NQKE 3HM6X 2XNAC 1AN8A 5AZGA 3P2BA 2NBWB 3AE9B 2W3SA 4WURA 2XBBC 3BYTB 3K9OB 4RNAA 4RGMA 3U4EG 2IO3B 3A9KA 3OWEB 5HKHA 2AL3A 1E6EB 2RSUA 3GE3C 1EF5A 2WGSA 3VR8B 2KFJA 3Q3FA 1SBBB 3P1MA 2WXPA 4ZRJA 1KM7A 2QC8A 2KQ7A 3HUIA 2M19A 2WXNA 1C77A 1XO3A 3ZTDA 2M56B 3BINA 2KX3A 2LWPA 3EUB2 5DPRA 2HTHA 2AEHA 4TUUA 5CHVC 1JRPA 2REXA 4HCPB 4ZHPA 2GMIC 1GJZA 2A4ZA 5AUKA 2N9XA 3SDLC 2LVPA 2FCSA 5BYSA 4AP4C 1UUPA 2FCMA 3A4SC 3ZNZB 2MWSB 2KD0A 1R4NB 1SJED 3DVNU 3LDZE 4ARIA 3DOWA 1GOZA 4J3OD 3RNBC 4IM0A 1M4VA 2Z59B 2KVZA 2DZMA 2J4XA 3A9JA 2D3AA 2MW5A 1V81A 2HD5B 3NG0A 2IYDB 1UF0A 4ANVA 3TIXA 3AULA 3V60A 4HPLB 3ZDMC 3OJ4B 5GXGB 5IAAC 1HE8A 1N6ZA 4I6LB 3WA0A 1GB1A 3OJ3A 2DAJA 2L3ZA 2G45B 5AUIA 2X8XX 4XDCA 1C4CA 1SE3A 2MBOA 4MGZE 1EU3A 2OEDA 3HRDD 4D2KA 2SEBD 1F0ZA 1BUIC 2KWUB 1TBEA 3C19A 3RNAC 3PT2B 2ICIA 5L95C 4A3OA 2V0GA 2WLBA 3N30A 3SU8X 4YT0B 3JYUA 5G5HA 1XCQL 3S2AA 4S17A 4RGNA 4WJNA 3QCAA 4P1BC 1DOIA 3B2GA 2AYOB 3R7QA 4ANWA 2IGHA 2K39A 1TKYA 2WXOA 3ZJVA 2ONQA 4TMAB 1P1AA 2WXIA 2KJHB 2H88B 3GE8C 1ESFA 4PS8A 5GMVA 3QC8B 2WXRA 3UQAA 2IO1B 3ZNGC 1GC7A 3V3XA 2GBKA 3NVYA 4BKTA 4GLSC 4C4VA 4KVGB 1C3TA 1WM2A 3MJWA 3TSSA 3FKYA 1TYGB 2D5GA 2DWQA 3FAHA 2N4FA 3CIRB 1TTNA 2KJRA 1WJNA 2DBYA 1GG3A 1ET6A 2WXQA 1QOAA 1ZDXA 4WAFA 3I5JC 1SB3C 1T3QA 1U4AA 5H92C 4RF0A 3SD5A 3L10B 4A8XC 4AWJA 2KTFA 3LYYA 3BYYB 3O13A 4ICVA 4DDID 3R7RA 2HJ1A 2ASQA 5EE9A 4ZHOA 1KLUD 4JX1C 3APCA 3Q8CA 3RCZA 4DBGA 3B08A 2B3AA 1VLBA 3GOEA 4B0MA 3AE6B 2JRHA 3ZUNA 1TKGA 3AE4B 1IGCA 3AU4A 1WSPA 3OG5A 2BS4B 1FIQA 3B1LX 4W9EA 2L76A 2QDFA 2NBVB 3Q14C 1V80A 1WGDA 4ITKA 1F9JA 2I2YA 3E56A 3GP7A 3VRAB 3U7ZA 5EDSA 3N3KB 3U2SC 4BBNC 2INNE 3ZQ4A 2BKFA 1RYJA 3RNEC 3R3MA 2ZCBA 1TJEA 2KOXA 3W2DA 4YSXB 2MSED 1VCBA 2RPQA 3KQ4A 1WM3A 3DBLI 3AEEB 3NZ3A 2RD0A 2MQJA 2HJ8A 3W1SA 2D10A 1L2NA 4MGIE 3VHTC 2N7JA 1HQRD 2MA9B 1I4RA 1FXIA 1JWMD 4LNOA 2INCC 4C80A 3AH7A 4FLHA 3WALA 3IBEA 1LGRA 2WP9B 4KKJA 1BMLC 4PS7A 4DK5A 2K25A 2WS3B 5BO4B 4BKGA 1T0YA 3CF6E 1Z5SB 2GBJA 3VH3B 1RAXA 5E6NA 2W9NA 3L16A 5JH5C 2MBBB 4CO7A 2D11A 2LMCA 1V86A 2KO3A 4FHJA 4PK1A 3CSTA 2MLBA 5KHOA 2LGIA 2CU3A 4HXDA 1JMLA 2KWDA 2V4LA 3QIJA 3BVGA 2BYFA 3APDA 1I4PA 5E6PA 3MHZA 2N7DA 4IC7B 2L05A 3EGRA 1GPXA 3A4RA 2VRRB 5AZFA 2KVRA 4FULA 2WXJA 3RYTA 2K6QA 3ONSA 1TS3A 1F2RI 1XXGA 3DBSA 3Q6BA 1UELA 4LNKA 3W1YA 1DOYA 1QILA 3EA6A 3IG3A 4DXGA 2W3RA 2DZKA 4G3XB 4KDIC 3PV1A 1CQVA 2N9PC 4ARCA 3PVLA 5C23A 4RCOA 2V3PA 2LASA 3KH0A 1WX9A 2N9EB 1IBXB 4XE0A 3ZNID 1NI3A 4KGRA 5BMGA 2GLSA 1LFDA 1D6EC 3BWUD 3ZDTA 1UGJA 1EM7A 2CKHB 3TJPA 3HK0A 3NVZA 4B9KA 4NZLB 1V49A 2HTME 4K1RB 1JWBD 2GBMA 4P6VF 5G55A 3RNGC 4Q2JA 2XEWA 1NVID 4WJOA 2NTSA 1RLFA 5IA7A 1FXAA 1K51A 1TS4A 3AM9A 1P7EA 4WJQA 2FIFA 4DHZE 2BS2B 2DHZA 4F7ZA 5D94A 2YVCA 1HXYD 4N6EB 4CYEA 4W9LA 1VZ6A 4K7WA 1DGJA 4IM3A 4BBNF 2NMQA 3PO0A 4RH6A 4KGTA 4RM8A 3ETRA 2GBRA 2DYBA 2GBNA 3GS2A 3QHTA 4ZRQA 3TCAA 1V97A 1TS5A 1XLQA 4BFRA 1FNUA 2JWUA 4REZA 1I42A 3MP9A 4BAXA 1MG8A 4S0RA 3L13A 4NAMA 5IP4D 2CJOA 1WX7A 2M1MA 2PE9A 3SHQA 2CU1A 3ZYYX 3QWZB 4OZBA 2RPVA 1G6JA 4AS1A 4XZ4A 2DLBA 1JROA 3BK2A 4M0WB 3DPDA 4L2YA 2K22A 1UWXA 3BIID 4WH4A 1UNSA 2G4SA 3WAOA 1FD6A 2GI9A 3PRMB 4QAYA 4XWTA 2ZW1A 3KW5B 3WCQA 1OFFA 2DYMA 1HA5A 3ZNHB 2JZPA 3VTVA 1B9RA 3DBRB 4DXFA 4F8CB 2OOBB 3MC8A 2O2VB 1FPYA 3PHXB 3AEGB 4FJVB 1LO5D 4RGOS 4FJYA 1YJ1A 3MJ5A 3MFGA 2J52A 3NZSA 4BVUC 3TUOA 3U30A 4PYZA 3NS8A 1SGHA 3KUCB 3N20C 2IDYA 1QQRA 2NPTB 4KZ0A 2LVQA 3C8YA 2IO2B 2MBQA 2N7EA 4O1NA 1Q1OA 3A1QB 3CWIA 1KF6B 4HPPA 1OEYA 2LVOA 1EWCA 1Y8RC 3L17A 2BTEA 2YEPF 2EELA 2L52A 3JSVA 1GB4A 3UIPB 1I4XA 1YQ3B 5E6OA 1IBXA 1TS2A 1OQRA 1WYWB 1FEHA 1KOTA 1VZ7A 2L1AA 2KTRA 5LNK1 2BGFA 2WDRB 3BY4B 4MSQB 3ZW3A 1WZ3A 3R66C 2BQQA 1XLOA 2WX0A 3SEBA 4HWIB 1I4HA 2WNMA 1QZEA 2N1VA 4JL9A 2UWQA 3I57A 2J0JA 1FRDA 4IUMB 3BK1A 1V5OA 1V1PA 3DBLB 3VRBB 4ZRKA 2GRIA 1FMAD 2R2QA 3AV8A 4L1BA 2XN9C 3BZDB 1IGDA 3MC9A 1WRDB 2IGGA 3PPAA 3ZVVA 2OJWA 2JPHA 3VAWA 4H2AA 3NOBA 3AE8B 2CHXA 4GSWA 1KH0A 3M62B 4RF1A 4HCNB 1MI0A 4LK0M 2LHDA 3DVGX 2DENB 1NEKB 3HVDA 4LDTD 4CHKA 2JXXA 1P0RA 4W9FA 4PT5A 1PGBA 3TEXA 1WY8A 1WWTA 2AWTA 2D3BA 3H7PA 3UINB 1L4DB 1ZGUB 3LXFA 2FAZA 4HDQA 3UIOB 2OJRA 2LRWA 2C60A 2QILA 1GC6A 2KWCA 3ZRFA 1I4GA 4JE3B 2M4NA 1VR9A 5DPSA 1MJDA 4URKA 4BZAA 2KXJA 5HHDG 2H89B 3PSEB 5C3JB 3ENEA 4MEMA 3TBLD 2KMMA 1PQSA 2PLPA 5TR5A 1N5XA 3CMMB 2O2VA 2UYZB 1YN4A 5D2MB 1ENFA 1J0GA 4GOCA 2C7NB 2D2QA 2ZVOA 1WE6A 4MJSB 1UBQA 3Q8AA 1RFAA 3VUWA 1FO4A 3PZDA 3V6CB 2LI5A 2VZKD 2R61A 1AWDA 3AEAB 4P16A 3V05A 1RWSA 3DHIC 2JU6X 3AMZA 3HM3A 4YL8A 2IPKD 1F77A 4WWPA 2BYVE 2LJ5A 5C1ZA 1C4PA 2OHFA 2WHIA 3RT3B 4LNFA 3AEBB 4YWGG 3A1QA 4HPMB 1P9DU 2XK5B 3D32A 5G5GA 1JRUA 1CJEA 1BXTA 1WGGA 4NNJB 3DWGC 1YN3A 2L0TA 2RR9A 3HIZA 2J7QB 4WWMA 4HJGE 4KKIA 4N59A 1WXMA 4DDGD 3O65B 1OEYJ 5FR6A 3V62A 2LHEA 1TZOA 2Y5BB 4TV3A 2WDVB 1NYQA 2K6DB 1PUTA 2PJHA 2QCZA 4GXBA 4HKZE 1DOXA 2AQ3B 3N1ZC 2M0AA 1JWAD 4B0EA 5TSSA 1ACCA 3KLSX 3U52E 4EUTA 4RM9A 5MPOA 1PFDA 2DZIA 1WF9A 2LEKA 3EHVA 3DBRI 1HTOA 4FN2A 4W9GA 1J7BA 1YQ4B 4XWWA 2JUOA 4IWOA 4ICUA 3DCGA 1TGZB 2JXTA 3LJ3A 2MHJA 4DWFA 3KUDB 4ANXA 5LXIB 1GUAB 1HEZE 2CHWA 1ROEA 1WXAA 4KSKC 1WI0A 1ZPSA 4OVVA 1HTQA 3KWVA 1K53A 1ZE3D 3KUZA 1QKZA 2DYOA 4JIOU 4UDUC 3KVFB 4HJKA 2MH7A 3RN9C 2C9WB 3ECIA 4BKSD 3R2TA 4W9KA 1D4BA 2CJNA 2R2OA 4EOYA 3GB1A 1E8YA 2LUMA 1J8CA 2LGXA 1VZ8A 1E90A 3MTNB 3B9JA 2BWES 4FADA 3QJZA 2G4DB 1KFYB 1ZUD2 3I9V1 2VH2A 2KK8A 2Q5WD 1Y56A 3GZNI 1SJHD 2W55A 4X57B 4A20A 1T0QC 5BMIA 2DZJA 4W9DA 4LLGM 4IWQA 1S3SG 1V1OA 1J7CA 3SFEB 4K81A 1C4AA 5CHFA 2BVCA 2KYWA 1L6UA 4A90A 1IUEA 3WAPA 2J53A 5JHAA 2SAKA 2MP2B 1EF1A 2PVOD 1TIFA 1FFUA 4MACA 1GNUA 2XK5A 4NAWB 3TEWA 3APFA 2WU5B 1SIFA 3ZKJC 2KX0A 3TEZA 2WDQB 4YTMB 1JALA 1LQBA 1IYFA 4FBJB 4EEWA 3E9SA 4IKGA 2V3NA 2KLCA 4W9IA 3TEYA 1UBIA 2WXHA 1SEBD 1ET9A 3L08A 1M94A 3W9CB 2EKEC 3AI5A 3X23A 3U8ZA 2O6VD 4JWSC 3Q3OC 2MJ3A 1K50A 4ZYSA 3RULA 3U7DA 5JZEB 2CHZA 1E7UA 1SE4A 3CSFA 1VD2A 3H8HA 1OQYA 1AARA 2MEKA 3FILB 3RMKC 4YSYB 2EKIA 3B2FA 1N61A 4KX6B 4TKNA 4OW0A 2MCNB 1V9JA 4M8NA 4C56C 4LDTB 4LJPB 4GDLB 1E8WA 2K1FA 4LNNA 4IG7B 1NI2A 2KLGA 1ISNA 3PLVA 4TSSA 1E0ZA 4LNIA 1LXDA 1V8CA 2QEJC 2IY0B 2TSSA 4OZCA 3L54A 3J9CA 3NVWA 3BVMA 4A3PA 2D3CA 2K8CA 2KZRA 4RMAA 2C7MB 1RFKA 1FCCC 2LZ6A 3DVGY 1GAQB 1A5RA 4YTNB 4KZCA 2FCQA 2Z8LA 3T8MA 4MDKE 1WR6E 3VVWB 1WRIA 4LJOB 3MC0B 1XD3B 3IXSA 4NJ6A 1WMHB 3W5VB 1XT9B 3ZLZA 2VZKB 2L83A 3ZXVA 2L0FA 1TT5B 3R2IA 3R8BA 3AN1A 1VDVA 4C7ZA 4WWNA 2J42A 1P7FA 2KDMA 3Q3JA 4GB9A 2JRIB 5J17A 3L0WB 4NQLB 1L6VA 2M17A 4YTPB 2C7HA 3Q8FA 4J6IA 4DXAB 3UF8A 2WXMA 3H7SA 2ZNVC 1LM8B 3ALBA 2KQ4X 1QOFA 1R4MI 3A9KB 1E8XA 1EU4A 3AE3B 3L4PA 3AE2B 4P1CC 1E7VA 3Q2AC 4LTUA 4GN1A 4HK2A 2KACA 2BB5A 2ZZPB 3NS1A 1Q5WB 4JWUC 4KGSA 1YN5A 3AU5A 2KFKB 2BF8B 2QIEB 1HZ5A 2BT6A 2GB1A 1E10A 2Z0DB 2YLMA 2YEPB 4FHKA 1I7HA 3EFUA 1T6BX 4W9JA 2JWZA 4GU2A 2WX1A 4US8A 3AECB 3NY5A 4OVZA 2EMTA 2KQSA 2LFIA 2FBWB 1JWSD 1JCKB 5AEKB 3NZUA 5BYQA 4XGAB 2L7RA 3DQVA 3DVNV 3FILA 3PREA 4ZRIA 5DCNA 1QT9A 1H8CA 4ZOHC 3IHPC 4E74A 3VUYA 4GDKB 1MHXA 3H9DA 3WANA 1CK1A 5L83A 4MH0E 1YOVB 3RZFA 2RGFA 2KJ6A 4TQ0A 4M02A 4IOIE 4OVUA 3P4QB 5BYRA 3EC8A 1KLVA 3VXWA 3OAWA 1YIWA 4MSMB 3Q3MC 2Y5CA 3PS6A 3UI3A 1WE7A 1SF0A 3T3OA 1XCTL 3KWLA 4IWPA 4HDOA 3ZIMA 1YMHE 2RDGA 2ZNVB 2I1JA 3GZNB 3QQ8B 3IFWB 5C2TB 4K3BA 1C76A 2K0PA 2JYEA 2LD9A 3M63B 1KJTA 2V3SA 2KKCA 4P7IA 1WXSA 3NJTA 3DHGC 1R7SA 1NBFC 4NJ7A 3HVZA 1XLPA 2B76B 5LLIA 1ZOYB 1WJUA 1HZ6A 3QK0A 4A6QA 2FUHB 1PGAA 4ASWC 3W1SC 4NPNA 4ACFA 2W82A 1C78A 4I6PA 2PW9A 5I4DA 2JZZA 1C1YB 1T0RC 1D5XC 1ZP0B 4C4VB 5IO9A 2FE8A 3WIMA 2ZVNA 2KWVB 1FRRA 1VJKA 4M01A 1J7AA 1WFYA 1RM6C 3ML8A 4AJWA 2BWFA 4CQNA 3X0WA 2LGYA 2N9KA 4M0WA 4K7SA 5IOIA 1WJ4A 4GIVA 3RPFC 3P42A 1AW7A 2Z0EB 2KFKA 2INPE 1TKEA 4ZYNA 3PZ7A 1ZXIA 3N9YC 1YX6B 2M0XA 1N5WA 2O6VB 3PZ8A 5EE0A 3I3TB 3VTWA 4E71A 2D3GA 4MGKE 2MRPA 4WQMA 2WDTB 5J18A 1BT0A 2ON8A 2AL6A 1QF6A 2WXFA 1Q0WB 1N60A 1QOBA 3P4RB 3OLMD 2V4IB 1ZXHA 1K52A 1WR1A 2PPHA 3QX1A 3RZWC 3UQBA 2N9LA 4N58A 2E6XA 1NYRA 2LUEA 3AEFB 2QHOA 1YD8U 3AE7B 1NDDA 1SE2A 1EUVB 2K9XA 5CHWA 3EECA 4GDKA 4W9CA 2KDBA 2NPTA 3M95A 4WJPA 3ZGZA 1SSNA 2G9HD 4JPSA 3I63C 3AB5A 1WXQA 5CX3A 1MFWA 4HEA1 3LB8C 1YNTE 3N1XC 2JVCA 2NTTA 1YJJA 3JW0X 5DPWA 1FNVA 2N0SB 3MHSD 4BKSA 3KYCD 4FA6A 5IN7A 1YQBA 3P4SB 4JGHB 1KRHA 1L0YB 4WQOB 2AQ2B 3RD2A 3ZXRA 4G50A 2IJ0A 3N1YC 4EE2A 2L32A 2W54A 3P4PB 4AOFA 3TMPB 1WGHA 3DBHB 3NRZA 2V1YA 3AEDB 2PMVA 1WZ0A 3IAS1 2KDEB 4R3DA 1JW9D 2VH1A 3ML9A 2KMCA 4MGYE 4XDDA 3RFZB 1A70A 1P98A 4N9F4 2PEAA 2L00B 1R4MB 3PRZA 4LCDE 4A9AA 2NS5A 2PVGC 1XLNA 3Q3NC 4G0NB 1STEA 2ZCCA 1UWMA 4DHJD 1XEEA 1L0VB 2E3TA 2EMSA 2LXAA 2ZPYA 1XQQA 4HKQA 2G3QB 2PTLA 1P3QU 3AXCA 2WU2B 4B6WA 1ZKHA 4RFBA 4FXCA 2AX5A 4TQ1A 1J19A 3T3NA 2IO0B 1H4RA 3UGBB 2KDIA 1WYGA 3VDZA 2AQ1B 4MELA 1X1MA 2K8HA 4M8MA 2KDFB 1WX8A 4F1SA 2WXKA 4W9HA 3H1UA 2O6VA 1TY0A 1UGMA 4BOSC 2JY6A 2KC2A 1WH3A 2JX5A 3Q8BA 1YX5B 4MJSA 1FFVA 2PE6B 2QJLA 2FUG1 2BYTA 4MT5A 3P63A 4DHZB 2IBIB 4WAAA 4C00A 4YSZB 1KTKA 1MG4A 3ZJTA 2BKRB 1E9MA 5JHBA 1E5WA 4WWOA 2UU7A 2KN5A 4EZJA 4HROA 2DAFA 2ZW0A 2LJIA 4GMVA 2LXCA 2C5LC 1Q10A 5JXVA 2JSVX 4IM2A 1L4ZB 1WGKA 2KT7A 3ABVB 2JF5A 1SXTA 4EKUA 1JWUD 4II2B 1T5XD 3AE1B 1IP9A 4NY0A 2WQYB 1TZ1A 2K3UA 2LGSA 3RNCC 1MPEA 2Y3AA 5E6JA 5HFYA 3QA8A 1IPGA 2NCNA 4YXDB 2DX5B 3IT4B 3IVFA 4OZAA 4AJYB 2PKOA 4MH8A 1B1ZA 3FC4A 5D6JB 2IZVB 2J0KA 5FR3A 2WXGA 2FCNA 1I4QA 1Z2MA 1NENB 1WIAA 2KN4A 2FNJB 3K9PB 3PGEA 5HI1A 1D3ZA 3ZO5B 2K8BA 4OHJA 1CMXB 1K8RB 2M8SA 1L7YA 2PIAA 1VRAB 1QLBB 3B0AA 3URYA 4EFOA 3WAMA 2CR5A 3JVZX 1ZDVA 2D07B 1R4NI 5AZHA 4US9A 1E7PB 2G1EA 4MM3B 2KHWB 4IW0A 2V9HA 5BMHA 5H8YE 3RI7C 4KDLB 2WXLA 1QOGA 2KMAA 5HG2A 2Y5PA 1OGWA 4GGQA 3N32A 4IDIA 3C0RB 5KHQA 2BW2A 1V5TA 3VFKA 2GOWA 2MJEA 3H6NA 2L8JA 5G2NA 1WGYA 2ZPNA 2RDHA 3NUHB 3PRPB 3SFDB 2BYEA 3JSVB 2JQRB 3VH4B 1TY2A 1E8ZA 1DYQA 2KANA 1L0XB 2NBUA 1S1QB 4WIPA 5CTRC 2KTRB 4XC2A 5LXHA 1C9FA 4FJZA 2KAJA 1D5ZC 3HHMA 1PGXA 4KIKB 3VQIA 3W5UB 2BB6A 4XYCA 3DWMA 5FKAC 3QAQA 4I6NB 1F1HA 4KSLC 2QSDA 3NHEB 4G11A 3VR9B 5J2RA 4PS3A 1V1PB 3DBHI 1FCLA 2ZEQA 2QMTA 2HDEA 4K7UA 4DQOC 2BBCA 4B95A 1PYWD 4HRSA 4RGTA 4AQ7A 5D3IB 3A33B 3SR6A 3V6EB 2LRUA 3VUXA 1FXTB 2WWZA 4EZKA 1SIJA 2I38A 5D3DA 5D7GA 3RUIB 4JLCA 2MP2A 1WJ6A 4ZDVA 4NAWA 4PYUA 4M00A 2MBHA 3Q69A 2JT4B 2X38A 2IY1B 1I35A 1V2YA 1UH6A 1N63A 4E3CA 4HVBA 3H7PB 1WXVA 3EFCA 1OQQA 4HLEA 1KLGD 5FK9C 1CZPA 2MJDA 1UD7A 1UZXB 1C79A 1OTRB 4EZLA 2NR2A 4II3B 4XX5A 4C7YA 2RMMA 2BS3B 2KC1A 1WGRA 4USAA
chains in the Genus database with same CATH topology
2KFKA 1EO6A 4FULA 2MBEA 3RYTA 4ZYNA 3DDCB 2K6QA 1WXAA 3ONSA 4KSKC 1YX6B 2M0XA 1WI0A 3TL5A 2CS4A 2O6VB 4OVVA 3DBSA 1UELA 3I3TB 3VTWA 3W1YA 2D3GA 3A9JB 3KUZA 1RRBA 3IG3A 4E71A 2ZJDA 2DYOA 4JIOU 4MGKE 5DPTA 2MRPA 2DZKA 2WDTB 3KVFB 4G3XB 4HJKA 4KDIC 5J18A 2WYQA 1BT0A 2C9WB 3ECIA 2AL6A 3PV1A 4BKSD 4GDLA 4DHJB 2N9PC 4W9KA 1Q0WB 3PVLA 2HE7A 5C23A 2R2OA 4EOYA 1SE9A 2J0MA 1E8YA 2LGDA 2LASA 3OLMD 1J8CA 3KH0A 1WX9A 1WR1A 2PPHA 2N9EB 3QX1A 3RZWC 3UQBA 2LGXA 1J0GA 1E90A 3MTNB 4MM3A 2BWES 4FADA 3ZNID 3QJZA 2G4DB 2A5UA 2LUEA 2QHOA 1LFDA 1YD8U 2I1KA 2JZ3B 1NDDA 3ZDTA 1EUVB 2CKHB 2KK8A 5CHWA 3EECA 4GDKA 4W9CA 2KDBA 3M3JA 3TJPA 3HK0A 4B9KA 3GZNI 1V49A 2MX2A 2NPTA 3M95A 4K1RB 4X57B 4WJPA 4A20A 2GBMA 2NVUI 5G55A 2BPSA 3T9LA 2XEWA 4JQWC 3PLUA 4WJOA 2DZJA 1RLFA 4BOZB 5IA7A 4W9DA 4IWQA 5CX3A 4WJQA 1S3SG 3V61A 2FIFA 4DHZE 2N1WA 2JVCA 2DHZA 4ANUA 4F7ZA 3JW0X 5D94A 4K81A 3ZTCA 3ZRCA 2YVCA 5CHFA 5DPWA 3KYDD 4CYEA 2KNBA 4W9LA 1ZW7A 3MHSD 4K7WA 3WAPA 4IM3A 4AUQC 4BKSA 3KYCD 4BBNF 4FA6A 1YQBA 4JGHB 1V6EA 4KIKA 1WMHA 5JHAA 4WQOB 3VTUA 3PHWB 3PTFC 4RM8A 2MP2B 2GBRA 1EF1A 2DYBA 4G50A 2GBNA 3RD2A 4KV2A 1GNUA 3QARA 2FIDA 2XK5A 4AOFA 4NQKE 4NAWB 3QHTA 3HM6X 5AZGA 3TCAA 3TMPB 3APFA 3P2BA 1SIFA 1WGHA 2KX0A 3ZKJC 4BFRA 2NBWB 1I42A 2V1YA 1LQBA 1WZ0A 1IYFA 1MG8A 4FBJB 4EEWA 2KDEB 2XBBC 3K9OB 3L13A 3ML9A 1WX7A 2KMCA 4MGYE 2M1MA 2KLCA 2PE9A 4W9IA 3SHQA 2CU1A 1UBIA 3QWZB 1P98A 4N9F4 2IO3B 2PEAA 1M94A 3A9KA 2L00B 3L08A 5HKHA 2EKEC 1G6JA 2AL3A 2RSUA 3AI5A 4XZ4A 1EF5A 3PRZA 3U8ZA 3X23A 4LCDE 4M0WB 2KFJA 2O6VD 3DPDA 2NS5A 3Q3FA 4ZRJA 3RULA 1KM7A 3U7DA 5JZEB 4G0NB 2KQ7A 2CHZA 2ZCCA 2G4SA 1E7UA 3WAOA 3CSFA 4DHJD 1VD2A 3PRMB 3KW5B 2EMSA 1OQYA 1AARA 2DYMA 3ZTDA 3BINA 2LXAA 2KX3A 2ZPYA 3ZNHB 2LWPA 3VTVA 1XQQA 5DPRA 2HTHA 2AEHA 4TKNA 2G3QB 4TUUA 4F8CB 2MCNB 1V9JA 1P3QU 2OOBB 3AXCA 4M8NA 5CHVC 4B6WA 2O2VB 2REXA 4LDTB 4LJPB 4HCPB 4GDLB 1E8WA 2K1FA 1ZKHA 3PHXB 2GMIC 1GJZA 4IG7B 1NI2A 2A4ZA 2KLGA 1ISNA 4TQ1A 1J19A 2N9XA 4FJVB 3SDLC 2IO0B 2LVPA 3PLVA 1H4RA 2FCSA 3UGBB 4FJYA 1YJ1A 1WGRA 4AP4C 1LXDA 2FCMA 3A4SC 3ZNZB 2MWSB 3NZSA 2KD0A 2KDIA 3VDZA 4BVUC 3DVNU 3U30A 4MELA 2IY0B 1X1MA 4PYZA 2K8HA 3LDZE 2KDFB 1WX8A 3DOWA 4M8MA 4F1SA 3L54A 3NS8A 1SGHA 4IM0A 4W9HA 3H1UA 3KUCB 2O6VA 4A3PA 2Z59B 2DZMA 2K8CA 2KZRA 3A9JA 4RMAA 1UGMA 2NPTB 4KZ0A 4BOSC 2LVQA 2IO2B 2C7MB 2MBQA 2N7EA 2MW5A 2JY6A 1V81A 2KC2A 1Q1OA 1WH3A 2HD5B 3A1QB 1YX5B 2LZ6A 3DVGY 2IYDB 4MJSA 1A5RA 1OEYA 4ANVA 2LVOA 4KZCA 1Y8RC 3L17A 2FCQA 3TIXA 3AULA 2PE6B 3V60A 4HPLB 3T8MA 3ZDMC 3OJ4B 3JSVA 4MDKE 3UIPB 5IAAC 1HE8A 1WR6E 4DHZB 2IBIB 4I6LB 5E6OA 4WAAA 3VVWB 3OJ3A 3WA0A 2Z0EB 4LJOB 2DAJA 2L3ZA 1XD3B 1WYWB 4NJ6A 2G45B 1KOTA 1WMHB 2KTRA 2BKRB 2BGFA 4MSQB 3BY4B 3ZW3A 5JHBA 1WZ3A 1XT9B 3ZLZA 2MBOA 3R66C 1E5WA 4WWOA 2KN5A 2L0FA 4EZJA 2WX0A 4HWIB 2DAFA 2KWUB 1QZEA 4WWNA 1TBEA 2N1VA 4GMVA 3PT2B 2LXCA 3Q3JA 2C5LC 4GB9A 4JL9A 2UWQA 2J0JA 5L95C 2JRIB 4IUMB 5J17A 1V5OA 3L0WB 4IM2A 4NQLB 2M17A 4A3OA 4ZRKA 2C7HA 2JF5A 4J6IA 4DXAB 3N30A 4EKUA 2R2QA 3SU8X 3UF8A 3JYUA 3S2AA 3H7SA 4WJNA 4II2B 2ZNVC 3QCAA 1IP9A 4NY0A 1LM8B 1TZ1A 3ALBA 1WRDB 2AYOB 3PPAA 3R7QA 1R4MI 3ZVVA 4ANWA 2JPHA 3A9KB 3VAWA 2K39A 3NOBA 1E8XA 3QA8A 1IPGA 2CHXA 1P1AA 2NCNA 4GSWA 2DX5B 2KJHB 3M62B 4HCNB 1E7VA 3IVFA 4AJYB 4PS8A 5GMVA 3QC8B 4GN1A 4HK2A 3UQAA 5D6JB 2IO1B 3ZNGC 2IZVB 2J0KA 3DVGX 2DENB 2ZZPB 1GC7A 4LDTD 4CHKA 1Q5WB 2JXXA 1P0RA 2FCNA 1Z2MA 2GBKA 4BKTA 4W9FA 1WIAA 4KVGB 1WM2A 1C3TA 1WY8A 3MJWA 2FNJB 3K9PB 3AU5A 2KFKB 3PGEA 2AWTA 3H7PA 3UINB 1D3ZA 1ZGUB 3ZO5B 2BF8B 2FAZA 2N4FA 2K8BA 4HDQA 3UIOB 2OJRA 1TTNA 2Z0DB 2KJRA 2LRWA 2YLMA 4FHKA 1WJNA 2C60A 1CMXB 1K8RB 1GG3A 2M8SA 1GC6A 1L7YA 2KWCA 3EFUA 3ZRFA 2M4NA 3B0AA 5DPSA 4EFOA 4W9JA 3WAMA 2JWZA 4URKA 2CR5A 2KXJA 3JVZX 3PSEB 4GU2A 2WX1A 1U4AA 3NY5A 2D07B 2EMTA 3ENEA 2KQSA 1R4NI 4MEMA 5AZHA 3TBLD 3SD5A 1PQSA 5AEKB 3NZUA 3L10B 4AWJA 2KTFA 2KHWB 2L7RA 3DQVA 3DVNV 3PREA 4ICVA 4IW0A 4DDID 4KDLB 4ZRIA 3R7RA 5DCNA 2ASQA 2KMAA 1H8CA 3APCA 3RCZA 4DBGA 3B08A 3IHPC 2B3AA 1OGWA 3GOEA 4GGQA 5TR5A 4E74A 3VUYA 4GDKB 3N32A 3CMMB 2O2VA 2UYZB 5D2MB 2JRHA 3C0RB 5KHQA 3H9DA 3WANA 1V5TA 3VFKA 3ZUNA 2GOWA 2C7NB 2D2QA 3H6NA 2L8JA 4GOCA 2ZVOA 4MH0E 5L83A 1WE6A 4MJSB 5G2NA 1UBQA 1WGYA 1RFAA 2ZPNA 3AU4A 3RZFA 3VUWA 3PZDA 3PRPB 2RGFA 2KJ6A 3V6CB 2LI5A 2BYEA 4TQ0A 3JSVB 4OVUA 3VH4B 3B1LX 3EC8A 4W9EA 2L76A 1E8ZA 2NBVB 1KLVA 3VXWA 3OAWA 1YIWA 3HM3A 1V80A 1WGDA 2KANA 4MSMB 1F9JA 4YL8A 3PS6A 2NBUA 1S1QB 5CTRC 2KTRB 4XC2A 4WWPA 5LXHA 1WE7A 4FJZA 5EDSA 3N3KB 3HHMA 2BYVE 4BBNC 2LJ5A 5C1ZA 4KIKB 4IWPA 2BKFA 3VQIA 4HDOA 3RT3B 3R3MA 2ZCBA 3ZIMA 3QAQA 2KOXA 4I6NB 3A1QA 4HPMB 2ZNVB 1P9DU 2XK5B 2I1JA 3D32A 4KSLC 2MSED 1VCBA 2RPQA 3NHEB 1JRUA 3QQ8B 4G11A 5J2RA 3IFWB 4PS3A 1WM3A 3DBLI 3DBHI 1WGGA 2ZEQA 4NNJB 4K7UA 2RD0A 2LD9A 2MQJA 3M63B 4B95A 2L0TA 2RR9A 2HJ8A 3HIZA 1KJTA 3W1SA 2J7QB 2V3SA 2D10A 1L2NA 2KKCA 4P7IA 1WXSA 3A33B 4MGIE 3VHTC 3V6EB 2LRUA 3VUXA 1FXTB 1NBFC 2MA9B 2WWZA 4NJ7A 4EZKA 1WXMA 4DDGD 3O65B 1OEYJ 5LLIA 3QK0A 1WJUA 4FLHA 5FR6A 2FUHB 3V62A 5D7GA 3W1SC 4ASWC 3RUIB 2Y5BB 3IBEA 4NPNA 4JLCA 3WALA 2MP2A 4TV3A 1WJ6A 2K6DB 4PS7A 4ZDVA 4I6PA 2PJHA 4GXBA 4DK5A 4NAWA 2K25A 4PYUA 2MBHA 2JT4B 2IY1B 5BO4B 4BKGA 1T0YA 2JZZA 3CF6E 1Z5SB 1V2YA 2GBJA 1C1YB 1UH6A 3VH3B 1I35A 1RAXA 5E6NA 2W9NA 3L16A 4EUTA 4RM9A 3WIMA 4E3CA 2MBBB 4CO7A 4HVBA 5JH5C 2D11A 1V86A 3H7PB 2ZVNA 1WXVA 2KWVB 2DZIA 2KO3A 4FHJA 4HLEA 1WF9A 3EHVA 3CSTA 2MLBA 5KHOA 1WFYA 1UD7A 3DBRI 3ML8A 4AJWA 4FN2A 4W9GA 1UZXB 2BWFA 3X0WA 2JUOA 4IWOA 1OTRB 4HXDA 3DCGA 4ICUA 2V4LA 3QIJA 4EZLA 1TGZB 2NR2A 2LGYA 3LJ3A 4II3B 2BYFA 3APDA 4XX5A 5E6PA 4DWFA 4K7SA 2N7DA 1WJ4A 4IC7B 2L05A 3KUDB 4ANXA 5LXIB 4GIVA 1GUAB 3A4RA 2VRRB 4MGZE 5AZFA 2KC1A 2KVRA 2CHWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KFK A;  1EO6 A;  4FUL A;  2MBE A;  3RYT A;  4ZYN A;  3DDC B;  2K6Q A;  1WXA A;  3ONS A;  4KSK C;  1YX6 B;  2M0X A;  1WI0 A;  3TL5 A;  2CS4 A;  2O6V B;  4OVV A;  3DBS A;  1UEL A;  3I3T B;  3VTW A;  3W1Y A;  2D3G A;  3A9J B;  3KUZ A;  1RRB A;  3IG3 A;  4E71 A;  2ZJD A;  2DYO A;  4JIO U;  4MGK E;  5DPT A;  2MRP A;  2DZK A;  2WDT B;  3KVF B;  4G3X B;  4HJK A;  4KDI C;  5J18 A;  2WYQ A;  1BT0 A;  2C9W B;  3ECI A;  2AL6 A;  3PV1 A;  4BKS D;  4GDL A;  4DHJ B;  2N9P C;  4W9K A;  1Q0W B;  3PVL A;  2HE7 A;  5C23 A;  2R2O A;  4EOY A;  1SE9 A;  2J0M A;  1E8Y A;  2LGD A;  2LAS A;  3OLM D;  1J8C A;  3KH0 A;  1WX9 A;  1WR1 A;  2PPH A;  2N9E B;  3QX1 A;  3RZW C;  3UQB A;  2LGX A;  1J0G A;  1E90 A;  3MTN B;  4MM3 A;  2BWE S;  4FAD A;  3ZNI D;  3QJZ A;  2G4D B;  2A5U A;  2LUE A;  2QHO A;  1LFD A;  1YD8 U;  2I1K A;  2JZ3 B;  1NDD A;  3ZDT A;  1EUV B;  2CKH B;  2KK8 A;  5CHW A;  3EEC A;  4GDK A;  4W9C A;  2KDB A;  3M3J A;  3TJP A;  3HK0 A;  4B9K A;  3GZN I;  1V49 A;  2MX2 A;  2NPT A;  3M95 A;  4K1R B;  4X57 B;  4WJP A;  4A20 A;  2GBM A;  2NVU I;  5G55 A;  2BPS A;  3T9L A;  2XEW A;  4JQW C;  3PLU A;  4WJO A;  2DZJ A;  1RLF A;  4BOZ B;  5IA7 A;  4W9D A;  4IWQ A;  5CX3 A;  4WJQ A;  1S3S G;  3V61 A;  2FIF A;  4DHZ E;  2N1W A;  2JVC A;  2DHZ A;  4ANU A;  4F7Z A;  3JW0 X;  5D94 A;  4K81 A;  3ZTC A;  3ZRC A;  2YVC A;  5CHF A;  5DPW A;  3KYD D;  4CYE A;  2KNB A;  4W9L A;  1ZW7 A;  3MHS D;  4K7W A;  3WAP A;  4IM3 A;  4AUQ C;  4BKS A;  3KYC D;  4BBN F;  4FA6 A;  1YQB A;  4JGH B;  1V6E A;  4KIK A;  1WMH A;  5JHA A;  4WQO B;  3VTU A;  3PHW B;  3PTF C;  4RM8 A;  2MP2 B;  2GBR A;  1EF1 A;  2DYB A;  4G50 A;  2GBN A;  3RD2 A;  4KV2 A;  1GNU A;  3QAR A;  2FID A;  2XK5 A;  4AOF A;  4NQK E;  4NAW B;  3QHT A;  3HM6 X;  5AZG A;  3TCA A;  3TMP B;  3APF A;  3P2B A;  1SIF A;  1WGH A;  2KX0 A;  3ZKJ C;  4BFR A;  2NBW B;  1I42 A;  2V1Y A;  1LQB A;  1WZ0 A;  1IYF A;  1MG8 A;  4FBJ B;  4EEW A;  2KDE B;  2XBB C;  3K9O B;  3L13 A;  3ML9 A;  1WX7 A;  2KMC A;  4MGY E;  2M1M A;  2KLC A;  2PE9 A;  4W9I A;  3SHQ A;  2CU1 A;  1UBI A;  3QWZ B;  1P98 A;  4N9F 4;  2IO3 B;  2PEA A;  1M94 A;  3A9K A;  2L00 B;  3L08 A;  5HKH A;  2EKE C;  1G6J A;  2AL3 A;  2RSU A;  3AI5 A;  4XZ4 A;  1EF5 A;  3PRZ A;  3U8Z A;  3X23 A;  4LCD E;  4M0W B;  2KFJ A;  2O6V D;  3DPD A;  2NS5 A;  3Q3F A;  4ZRJ A;  3RUL A;  1KM7 A;  3U7D A;  5JZE B;  4G0N B;  2KQ7 A;  2CHZ A;  2ZCC A;  2G4S A;  1E7U A;  3WAO A;  3CSF A;  4DHJ D;  1VD2 A;  3PRM B;  3KW5 B;  2EMS A;  1OQY A;  1AAR A;  2DYM A;  3ZTD A;  3BIN A;  2LXA A;  2KX3 A;  2ZPY A;  3ZNH B;  2LWP A;  3VTV A;  1XQQ A;  5DPR A;  2HTH A;  2AEH A;  4TKN A;  2G3Q B;  4TUU A;  4F8C B;  2MCN B;  1V9J A;  1P3Q U;  2OOB B;  3AXC A;  4M8N A;  5CHV C;  4B6W A;  2O2V B;  2REX A;  4LDT B;  4LJP B;  4HCP B;  4GDL B;  1E8W A;  2K1F A;  1ZKH A;  3PHX B;  2GMI C;  1GJZ A;  4IG7 B;  1NI2 A;  2A4Z A;  2KLG A;  1ISN A;  4TQ1 A;  1J19 A;  2N9X A;  4FJV B;  3SDL C;  2IO0 B;  2LVP A;  3PLV A;  1H4R A;  2FCS A;  3UGB B;  4FJY A;  1YJ1 A;  1WGR A;  4AP4 C;  1LXD A;  2FCM A;  3A4S C;  3ZNZ B;  2MWS B;  3NZS A;  2KD0 A;  2KDI A;  3VDZ A;  4BVU C;  3DVN U;  3U30 A;  4MEL A;  2IY0 B;  1X1M A;  4PYZ A;  2K8H A;  3LDZ E;  2KDF B;  1WX8 A;  3DOW A;  4M8M A;  4F1S A;  3L54 A;  3NS8 A;  1SGH A;  4IM0 A;  4W9H A;  3H1U A;  3KUC B;  2O6V A;  4A3P A;  2Z59 B;  2DZM A;  2K8C A;  2KZR A;  3A9J A;  4RMA A;  1UGM A;  2NPT B;  4KZ0 A;  4BOS C;  2LVQ A;  2IO2 B;  2C7M B;  2MBQ A;  2N7E A;  2MW5 A;  2JY6 A;  1V81 A;  2KC2 A;  1Q1O A;  1WH3 A;  2HD5 B;  3A1Q B;  1YX5 B;  2LZ6 A;  3DVG Y;  2IYD B;  4MJS A;  1A5R A;  1OEY A;  4ANV A;  2LVO A;  4KZC A;  1Y8R C;  3L17 A;  2FCQ A;  3TIX A;  3AUL A;  2PE6 B;  3V60 A;  4HPL B;  3T8M A;  3ZDM C;  3OJ4 B;  3JSV A;  4MDK E;  3UIP B;  5IAA C;  1HE8 A;  1WR6 E;  4DHZ B;  2IBI B;  4I6L B;  5E6O A;  4WAA A;  3VVW B;  3OJ3 A;  3WA0 A;  2Z0E B;  4LJO B;  2DAJ A;  2L3Z A;  1XD3 B;  1WYW B;  4NJ6 A;  2G45 B;  1KOT A;  1WMH B;  2KTR A;  2BKR B;  2BGF A;  4MSQ B;  3BY4 B;  3ZW3 A;  5JHB A;  1WZ3 A;  1XT9 B;  3ZLZ A;  2MBO A;  3R66 C;  1E5W A;  4WWO A;  2KN5 A;  2L0F A;  4EZJ A;  2WX0 A;  4HWI B;  2DAF A;  2KWU B;  1QZE A;  4WWN A;  1TBE A;  2N1V A;  4GMV A;  3PT2 B;  2LXC A;  3Q3J A;  2C5L C;  4GB9 A;  4JL9 A;  2UWQ A;  2J0J A;  5L95 C;  2JRI B;  4IUM B;  5J17 A;  1V5O A;  3L0W B;  4IM2 A;  4NQL B;  2M17 A;  4A3O A;  4ZRK A;  2C7H A;  2JF5 A;  4J6I A;  4DXA B;  3N30 A;  4EKU A;  2R2Q A;  3SU8 X;  3UF8 A;  3JYU A;  3S2A A;  3H7S A;  4WJN A;  4II2 B;  2ZNV C;  3QCA A;  1IP9 A;  4NY0 A;  1LM8 B;  1TZ1 A;  3ALB A;  1WRD B;  2AYO B;  3PPA A;  3R7Q A;  1R4M I;  3ZVV A;  4ANW A;  2JPH A;  3A9K B;  3VAW A;  2K39 A;  3NOB A;  1E8X A;  3QA8 A;  1IPG A;  2CHX A;  1P1A A;  2NCN A;  4GSW A;  2DX5 B;  2KJH B;  3M62 B;  4HCN B;  1E7V A;  3IVF A;  4AJY B;  4PS8 A;  5GMV A;  3QC8 B;  4GN1 A;  4HK2 A;  3UQA A;  5D6J B;  2IO1 B;  3ZNG C;  2IZV B;  2J0K A;  3DVG X;  2DEN B;  2ZZP B;  1GC7 A;  4LDT D;  4CHK A;  1Q5W B;  2JXX A;  1P0R A;  2FCN A;  1Z2M A;  2GBK A;  4BKT A;  4W9F A;  1WIA A;  4KVG B;  1WM2 A;  1C3T A;  1WY8 A;  3MJW A;  2FNJ B;  3K9P B;  3AU5 A;  2KFK B;  3PGE A;  2AWT A;  3H7P A;  3UIN B;  1D3Z A;  1ZGU B;  3ZO5 B;  2BF8 B;  2FAZ A;  2N4F A;  2K8B A;  4HDQ A;  3UIO B;  2OJR A;  1TTN A;  2Z0D B;  2KJR A;  2LRW A;  2YLM A;  4FHK A;  1WJN A;  2C60 A;  1CMX B;  1K8R B;  1GG3 A;  2M8S A;  1GC6 A;  1L7Y A;  2KWC A;  3EFU A;  3ZRF A;  2M4N A;  3B0A A;  5DPS A;  4EFO A;  4W9J A;  3WAM A;  2JWZ A;  4URK A;  2CR5 A;  2KXJ A;  3JVZ X;  3PSE B;  4GU2 A;  2WX1 A;  1U4A A;  3NY5 A;  2D07 B;  2EMT A;  3ENE A;  2KQS A;  1R4N I;  4MEM A;  5AZH A;  3TBL D;  3SD5 A;  1PQS A;  5AEK B;  3NZU A;  3L10 B;  4AWJ A;  2KTF A;  2KHW B;  2L7R A;  3DQV A;  3DVN V;  3PRE A;  4ICV A;  4IW0 A;  4DDI D;  4KDL B;  4ZRI A;  3R7R A;  5DCN A;  2ASQ A;  2KMA A;  1H8C A;  3APC A;  3RCZ A;  4DBG A;  3B08 A;  3IHP C;  2B3A A;  1OGW A;  3GOE A;  4GGQ A;  5TR5 A;  4E74 A;  3VUY A;  4GDK B;  3N32 A;  3CMM B;  2O2V A;  2UYZ B;  5D2M B;  2JRH A;  3C0R B;  5KHQ A;  3H9D A;  3WAN A;  1V5T A;  3VFK A;  3ZUN A;  2GOW A;  2C7N B;  2D2Q A;  3H6N A;  2L8J A;  4GOC A;  2ZVO A;  4MH0 E;  5L83 A;  1WE6 A;  4MJS B;  5G2N A;  1UBQ A;  1WGY A;  1RFA A;  2ZPN A;  3AU4 A;  3RZF A;  3VUW A;  3PZD A;  3PRP B;  2RGF A;  2KJ6 A;  3V6C B;  2LI5 A;  2BYE A;  4TQ0 A;  3JSV B;  4OVU A;  3VH4 B;  3B1L X;  3EC8 A;  4W9E A;  2L76 A;  1E8Z A;  2NBV B;  1KLV A;  3VXW A;  3OAW A;  1YIW A;  3HM3 A;  1V80 A;  1WGD A;  2KAN A;  4MSM B;  1F9J A;  4YL8 A;  3PS6 A;  2NBU A;  1S1Q B;  5CTR C;  2KTR B;  4XC2 A;  4WWP A;  5LXH A;  1WE7 A;  4FJZ A;  5EDS A;  3N3K B;  3HHM A;  2BYV E;  4BBN C;  2LJ5 A;  5C1Z A;  4KIK B;  4IWP A;  2BKF A;  3VQI A;  4HDO A;  3RT3 B;  3R3M A;  2ZCB A;  3ZIM A;  3QAQ A;  2KOX A;  4I6N B;  3A1Q A;  4HPM B;  2ZNV B;  1P9D U;  2XK5 B;  2I1J A;  3D32 A;  4KSL C;  2MSE D;  1VCB A;  2RPQ A;  3NHE B;  1JRU A;  3QQ8 B;  4G11 A;  5J2R A;  3IFW B;  4PS3 A;  1WM3 A;  3DBL I;  3DBH I;  1WGG A;  2ZEQ A;  4NNJ B;  4K7U A;  2RD0 A;  2LD9 A;  2MQJ A;  3M63 B;  4B95 A;  2L0T A;  2RR9 A;  2HJ8 A;  3HIZ A;  1KJT A;  3W1S A;  2J7Q B;  2V3S A;  2D10 A;  1L2N A;  2KKC A;  4P7I A;  1WXS A;  3A33 B;  4MGI E;  3VHT C;  3V6E B;  2LRU A;  3VUX A;  1FXT B;  1NBF C;  2MA9 B;  2WWZ A;  4NJ7 A;  4EZK A;  1WXM A;  4DDG D;  3O65 B;  1OEY J;  5LLI A;  3QK0 A;  1WJU A;  4FLH A;  5FR6 A;  2FUH B;  3V62 A;  5D7G A;  3W1S C;  4ASW C;  3RUI B;  2Y5B B;  3IBE A;  4NPN A;  4JLC A;  3WAL A;  2MP2 A;  4TV3 A;  1WJ6 A;  2K6D B;  4PS7 A;  4ZDV A;  4I6P A;  2PJH A;  4GXB A;  4DK5 A;  4NAW A;  2K25 A;  4PYU A;  2MBH A;  2JT4 B;  2IY1 B;  5BO4 B;  4BKG A;  1T0Y A;  2JZZ A;  3CF6 E;  1Z5S B;  1V2Y A;  2GBJ A;  1C1Y B;  1UH6 A;  3VH3 B;  1I35 A;  1RAX A;  5E6N A;  2W9N A;  3L16 A;  4EUT A;  4RM9 A;  3WIM A;  4E3C A;  2MBB B;  4CO7 A;  4HVB A;  5JH5 C;  2D11 A;  1V86 A;  3H7P B;  2ZVN A;  1WXV A;  2KWV B;  2DZI A;  2KO3 A;  4FHJ A;  4HLE A;  1WF9 A;  3EHV A;  3CST A;  2MLB A;  5KHO A;  1WFY A;  1UD7 A;  3DBR I;  3ML8 A;  4AJW A;  4FN2 A;  4W9G A;  1UZX B;  2BWF A;  3X0W A;  2JUO A;  4IWO A;  1OTR B;  4HXD A;  3DCG A;  4ICU A;  2V4L A;  3QIJ A;  4EZL A;  1TGZ B;  2NR2 A;  2LGY A;  3LJ3 A;  4II3 B;  2BYF A;  3APD A;  4XX5 A;  5E6P A;  4DWF A;  4K7S A;  2N7D A;  1WJ4 A;  4IC7 B;  2L05 A;  3KUD B;  4ANX A;  5LXI B;  4GIV A;  1GUA B;  3A4R A;  2VRR B;  4MGZ E;  5AZF A;  2KC1 A;  2KVR A;  2CHW A; 
#chains in the Genus database with same CATH topology
 2DNF A;  1EO6 A;  4ZRP A;  1EWY C;  2MBE A;  3DHH C;  3DDC B;  3IT6 B;  3TL5 A;  2CS4 A;  1FNW A;  2RDB C;  1PDX A;  3A9J B;  1RRB A;  2ZJD A;  5DPT A;  2IND C;  1AYF A;  2WYQ A;  5T8I A;  4DHJ B;  4GDL A;  2HE7 A;  1MHH E;  3NVV A;  1SE9 A;  2J0M A;  2LGD A;  2JYT A;  3Q8E A;  1D5M C;  4MM3 A;  3AE5 B;  2A5U A;  3IAM 1;  2K5P A;  2IGD A;  2I1K A;  5EE3 A;  2JZ3 B;  3M3J A;  1FM0 D;  3BVZ A;  4NJC A;  1YJI A;  2MX2 A;  2NVU I;  2BPS A;  1XF5 L;  3T9L A;  4JQW C;  1T0S C;  3PLU A;  5IKC M;  4BOZ B;  1MVK A;  2ACZ B;  3V61 A;  2N1W A;  4ANU A;  1F2R C;  4K3C A;  3ZTC A;  3ZRC A;  3ZJU A;  3KYD D;  2KNB A;  1ZW7 A;  1L5P A;  4AUQ C;  4L23 A;  4A55 A;  1JQ4 A;  1N62 A;  1V6E A;  4KIK A;  1WMH A;  3VTU A;  3PHW B;  3PTF C;  4KV2 A;  1F52 A;  3QAR A;  2FID A;  3RNF C;  5EE1 A;  4NQK E;  3HM6 X;  2XNA C;  1AN8 A;  5AZG A;  3P2B A;  2NBW B;  3AE9 B;  2W3S A;  4WUR A;  2XBB C;  3BYT B;  3K9O B;  4RNA A;  4RGM A;  3U4E G;  2IO3 B;  3A9K A;  3OWE B;  5HKH A;  2AL3 A;  1E6E B;  2RSU A;  3GE3 C;  1EF5 A;  2WGS A;  3VR8 B;  2KFJ A;  3Q3F A;  1SBB B;  3P1M A;  2WXP A;  4ZRJ A;  1KM7 A;  2QC8 A;  2KQ7 A;  3HUI A;  2M19 A;  2WXN A;  1C77 A;  1XO3 A;  3ZTD A;  2M56 B;  3BIN A;  2KX3 A;  2LWP A;  3EUB 2;  5DPR A;  2HTH A;  2AEH A;  4TUU A;  5CHV C;  1JRP A;  2REX A;  4HCP B;  4ZHP A;  2GMI C;  1GJZ A;  2A4Z A;  5AUK A;  2N9X A;  3SDL C;  2LVP A;  2FCS A;  5BYS A;  4AP4 C;  1UUP A;  2FCM A;  3A4S C;  3ZNZ B;  2MWS B;  2KD0 A;  1R4N B;  1SJE D;  3DVN U;  3LDZ E;  4ARI A;  3DOW A;  1GOZ A;  4J3O D;  3RNB C;  4IM0 A;  1M4V A;  2Z59 B;  2KVZ A;  2DZM A;  2J4X A;  3A9J A;  2D3A A;  2MW5 A;  1V81 A;  2HD5 B;  3NG0 A;  2IYD B;  1UF0 A;  4ANV A;  3TIX A;  3AUL A;  3V60 A;  4HPL B;  3ZDM C;  3OJ4 B;  5GXG B;  5IAA C;  1HE8 A;  1N6Z A;  4I6L B;  3WA0 A;  1GB1 A;  3OJ3 A;  2DAJ A;  2L3Z A;  2G45 B;  5AUI A;  2X8X X;  4XDC A;  1C4C A;  1SE3 A;  2MBO A;  4MGZ E;  1EU3 A;  2OED A;  3HRD D;  4D2K A;  2SEB D;  1F0Z A;  1BUI C;  2KWU B;  1TBE A;  3C19 A;  3RNA C;  3PT2 B;  2ICI A;  5L95 C;  4A3O A;  2V0G A;  2WLB A;  3N30 A;  3SU8 X;  4YT0 B;  3JYU A;  5G5H A;  1XCQ L;  3S2A A;  4S17 A;  4RGN A;  4WJN A;  3QCA A;  4P1B C;  1DOI A;  3B2G A;  2AYO B;  3R7Q A;  4ANW A;  2IGH A;  2K39 A;  1TKY A;  2WXO A;  3ZJV A;  2ONQ A;  4TMA B;  1P1A A;  2WXI A;  2KJH B;  2H88 B;  3GE8 C;  1ESF A;  4PS8 A;  5GMV A;  3QC8 B;  2WXR A;  3UQA A;  2IO1 B;  3ZNG C;  1GC7 A;  3V3X A;  2GBK A;  3NVY A;  4BKT A;  4GLS C;  4C4V A;  4KVG B;  1C3T A;  1WM2 A;  3MJW A;  3TSS A;  3FKY A;  1TYG B;  2D5G A;  2DWQ A;  3FAH A;  2N4F A;  3CIR B;  1TTN A;  2KJR A;  1WJN A;  2DBY A;  1GG3 A;  1ET6 A;  2WXQ A;  1QOA A;  1ZDX A;  4WAF A;  3I5J C;  1SB3 C;  1T3Q A;  1U4A A;  5H92 C;  4RF0 A;  3SD5 A;  3L10 B;  4A8X C;  4AWJ A;  2KTF A;  3LYY A;  3BYY B;  3O13 A;  4ICV A;  4DDI D;  3R7R A;  2HJ1 A;  2ASQ A;  5EE9 A;  4ZHO A;  1KLU D;  4JX1 C;  3APC A;  3Q8C A;  3RCZ A;  4DBG A;  3B08 A;  2B3A A;  1VLB A;  3GOE A;  4B0M A;  3AE6 B;  2JRH A;  3ZUN A;  1TKG A;  3AE4 B;  1IGC A;  3AU4 A;  1WSP A;  3OG5 A;  2BS4 B;  1FIQ A;  3B1L X;  4W9E A;  2L76 A;  2QDF A;  2NBV B;  3Q14 C;  1V80 A;  1WGD A;  4ITK A;  1F9J A;  2I2Y A;  3E56 A;  3GP7 A;  3VRA B;  3U7Z A;  5EDS A;  3N3K B;  3U2S C;  4BBN C;  2INN E;  3ZQ4 A;  2BKF A;  1RYJ A;  3RNE C;  3R3M A;  2ZCB A;  1TJE A;  2KOX A;  3W2D A;  4YSX B;  2MSE D;  1VCB A;  2RPQ A;  3KQ4 A;  1WM3 A;  3DBL I;  3AEE B;  3NZ3 A;  2RD0 A;  2MQJ A;  2HJ8 A;  3W1S A;  2D10 A;  1L2N A;  4MGI E;  3VHT C;  2N7J A;  1HQR D;  2MA9 B;  1I4R A;  1FXI A;  1JWM D;  4LNO A;  2INC C;  4C80 A;  3AH7 A;  4FLH A;  3WAL A;  3IBE A;  1LGR A;  2WP9 B;  4KKJ A;  1BML C;  4PS7 A;  4DK5 A;  2K25 A;  2WS3 B;  5BO4 B;  4BKG A;  1T0Y A;  3CF6 E;  1Z5S B;  2GBJ A;  3VH3 B;  1RAX A;  5E6N A;  2W9N A;  3L16 A;  5JH5 C;  2MBB B;  4CO7 A;  2D11 A;  2LMC A;  1V86 A;  2KO3 A;  4FHJ A;  4PK1 A;  3CST A;  2MLB A;  5KHO A;  2LGI A;  2CU3 A;  4HXD A;  1JML A;  2KWD A;  2V4L A;  3QIJ A;  3BVG A;  2BYF A;  3APD A;  1I4P A;  5E6P A;  3MHZ A;  2N7D A;  4IC7 B;  2L05 A;  3EGR A;  1GPX A;  3A4R A;  2VRR B;  5AZF A;  2KVR A;  4FUL A;  2WXJ A;  3RYT A;  2K6Q A;  3ONS A;  1TS3 A;  1F2R I;  1XXG A;  3DBS A;  3Q6B A;  1UEL A;  4LNK A;  3W1Y A;  1DOY A;  1QIL A;  3EA6 A;  3IG3 A;  4DXG A;  2W3R A;  2DZK A;  4G3X B;  4KDI C;  3PV1 A;  1CQV A;  2N9P C;  4ARC A;  3PVL A;  5C23 A;  4RCO A;  2V3P A;  2LAS A;  3KH0 A;  1WX9 A;  2N9E B;  1IBX B;  4XE0 A;  3ZNI D;  1NI3 A;  4KGR A;  5BMG A;  2GLS A;  1LFD A;  1D6E C;  3BWU D;  3ZDT A;  1UGJ A;  1EM7 A;  2CKH B;  3TJP A;  3HK0 A;  3NVZ A;  4B9K A;  4NZL B;  1V49 A;  2HTM E;  4K1R B;  1JWB D;  2GBM A;  4P6V F;  5G55 A;  3RNG C;  4Q2J A;  2XEW A;  1NVI D;  4WJO A;  2NTS A;  1RLF A;  5IA7 A;  1FXA A;  1K51 A;  1TS4 A;  3AM9 A;  1P7E A;  4WJQ A;  2FIF A;  4DHZ E;  2BS2 B;  2DHZ A;  4F7Z A;  5D94 A;  2YVC A;  1HXY D;  4N6E B;  4CYE A;  4W9L A;  1VZ6 A;  4K7W A;  1DGJ A;  4IM3 A;  4BBN F;  2NMQ A;  3PO0 A;  4RH6 A;  4KGT A;  4RM8 A;  3ETR A;  2GBR A;  2DYB A;  2GBN A;  3GS2 A;  3QHT A;  4ZRQ A;  3TCA A;  1V97 A;  1TS5 A;  1XLQ A;  4BFR A;  1FNU A;  2JWU A;  4REZ A;  1I42 A;  3MP9 A;  4BAX A;  1MG8 A;  4S0R A;  3L13 A;  4NAM A;  5IP4 D;  2CJO A;  1WX7 A;  2M1M A;  2PE9 A;  3SHQ A;  2CU1 A;  3ZYY X;  3QWZ B;  4OZB A;  2RPV A;  1G6J A;  4AS1 A;  4XZ4 A;  2DLB A;  1JRO A;  3BK2 A;  4M0W B;  3DPD A;  4L2Y A;  2K22 A;  1UWX A;  3BII D;  4WH4 A;  1UNS A;  2G4S A;  3WAO A;  1FD6 A;  2GI9 A;  3PRM B;  4QAY A;  4XWT A;  2ZW1 A;  3KW5 B;  3WCQ A;  1OFF A;  2DYM A;  1HA5 A;  3ZNH B;  2JZP A;  3VTV A;  1B9R A;  3DBR B;  4DXF A;  4F8C B;  2OOB B;  3MC8 A;  2O2V B;  1FPY A;  3PHX B;  3AEG B;  4FJV B;  1LO5 D;  4RGO S;  4FJY A;  1YJ1 A;  3MJ5 A;  3MFG A;  2J52 A;  3NZS A;  4BVU C;  3TUO A;  3U30 A;  4PYZ A;  3NS8 A;  1SGH A;  3KUC B;  3N20 C;  2IDY A;  1QQR A;  2NPT B;  4KZ0 A;  2LVQ A;  3C8Y A;  2IO2 B;  2MBQ A;  2N7E A;  4O1N A;  1Q1O A;  3A1Q B;  3CWI A;  1KF6 B;  4HPP A;  1OEY A;  2LVO A;  1EWC A;  1Y8R C;  3L17 A;  2BTE A;  2YEP F;  2EEL A;  2L52 A;  3JSV A;  1GB4 A;  3UIP B;  1I4X A;  1YQ3 B;  5E6O A;  1IBX A;  1TS2 A;  1OQR A;  1WYW B;  1FEH A;  1KOT A;  1VZ7 A;  2L1A A;  2KTR A;  5LNK 1;  2BGF A;  2WDR B;  3BY4 B;  4MSQ B;  3ZW3 A;  1WZ3 A;  3R66 C;  2BQQ A;  1XLO A;  2WX0 A;  3SEB A;  4HWI B;  1I4H A;  2WNM A;  1QZE A;  2N1V A;  4JL9 A;  2UWQ A;  3I57 A;  2J0J A;  1FRD A;  4IUM B;  3BK1 A;  1V5O A;  1V1P A;  3DBL B;  3VRB B;  4ZRK A;  2GRI A;  1FMA D;  2R2Q A;  3AV8 A;  4L1B A;  2XN9 C;  3BZD B;  1IGD A;  3MC9 A;  1WRD B;  2IGG A;  3PPA A;  3ZVV A;  2OJW A;  2JPH A;  3VAW A;  4H2A A;  3NOB A;  3AE8 B;  2CHX A;  4GSW A;  1KH0 A;  3M62 B;  4RF1 A;  4HCN B;  1MI0 A;  4LK0 M;  2LHD A;  3DVG X;  2DEN B;  1NEK B;  3HVD A;  4LDT D;  4CHK A;  2JXX A;  1P0R A;  4W9F A;  4PT5 A;  1PGB A;  3TEX A;  1WY8 A;  1WWT A;  2AWT A;  2D3B A;  3H7P A;  3UIN B;  1L4D B;  1ZGU B;  3LXF A;  2FAZ A;  4HDQ A;  3UIO B;  2OJR A;  2LRW A;  2C60 A;  2QIL A;  1GC6 A;  2KWC A;  3ZRF A;  1I4G A;  4JE3 B;  2M4N A;  1VR9 A;  5DPS A;  1MJD A;  4URK A;  4BZA A;  2KXJ A;  5HHD G;  2H89 B;  3PSE B;  5C3J B;  3ENE A;  4MEM A;  3TBL D;  2KMM A;  1PQS A;  2PLP A;  5TR5 A;  1N5X A;  3CMM B;  2O2V A;  2UYZ B;  1YN4 A;  5D2M B;  1ENF A;  1J0G A;  4GOC A;  2C7N B;  2D2Q A;  2ZVO A;  1WE6 A;  4MJS B;  1UBQ A;  3Q8A A;  1RFA A;  3VUW A;  1FO4 A;  3PZD A;  3V6C B;  2LI5 A;  2VZK D;  2R61 A;  1AWD A;  3AEA B;  4P16 A;  3V05 A;  1RWS A;  3DHI C;  2JU6 X;  3AMZ A;  3HM3 A;  4YL8 A;  2IPK D;  1F77 A;  4WWP A;  2BYV E;  2LJ5 A;  5C1Z A;  1C4P A;  2OHF A;  2WHI A;  3RT3 B;  4LNF A;  3AEB B;  4YWG G;  3A1Q A;  4HPM B;  1P9D U;  2XK5 B;  3D32 A;  5G5G A;  1JRU A;  1CJE A;  1BXT A;  1WGG A;  4NNJ B;  3DWG C;  1YN3 A;  2L0T A;  2RR9 A;  3HIZ A;  2J7Q B;  4WWM A;  4HJG E;  4KKI A;  4N59 A;  1WXM A;  4DDG D;  3O65 B;  1OEY J;  5FR6 A;  3V62 A;  2LHE A;  1TZO A;  2Y5B B;  4TV3 A;  2WDV B;  1NYQ A;  2K6D B;  1PUT A;  2PJH A;  2QCZ A;  4GXB A;  4HKZ E;  1DOX A;  2AQ3 B;  3N1Z C;  2M0A A;  1JWA D;  4B0E A;  5TSS A;  1ACC A;  3KLS X;  3U52 E;  4EUT A;  4RM9 A;  5MPO A;  1PFD A;  2DZI A;  1WF9 A;  2LEK A;  3EHV A;  3DBR I;  1HTO A;  4FN2 A;  4W9G A;  1J7B A;  1YQ4 B;  4XWW A;  2JUO A;  4IWO A;  4ICU A;  3DCG A;  1TGZ B;  2JXT A;  3LJ3 A;  2MHJ A;  4DWF A;  3KUD B;  4ANX A;  5LXI B;  1GUA B;  1HEZ E;  2CHW A;  1ROE A;  1WXA A;  4KSK C;  1WI0 A;  1ZPS A;  4OVV A;  1HTQ A;  3KWV A;  1K53 A;  1ZE3 D;  3KUZ A;  1QKZ A;  2DYO A;  4JIO U;  4UDU C;  3KVF B;  4HJK A;  2MH7 A;  3RN9 C;  2C9W B;  3ECI A;  4BKS D;  3R2T A;  4W9K A;  1D4B A;  2CJN A;  2R2O A;  4EOY A;  3GB1 A;  1E8Y A;  2LUM A;  1J8C A;  2LGX A;  1VZ8 A;  1E90 A;  3MTN B;  3B9J A;  2BWE S;  4FAD A;  3QJZ A;  2G4D B;  1KFY B;  1ZUD 2;  3I9V 1;  2VH2 A;  2KK8 A;  2Q5W D;  1Y56 A;  3GZN I;  1SJH D;  2W55 A;  4X57 B;  4A20 A;  1T0Q C;  5BMI A;  2DZJ A;  4W9D A;  4LLG M;  4IWQ A;  1S3S G;  1V1O A;  1J7C A;  3SFE B;  4K81 A;  1C4A A;  5CHF A;  2BVC A;  2KYW A;  1L6U A;  4A90 A;  1IUE A;  3WAP A;  2J53 A;  5JHA A;  2SAK A;  2MP2 B;  1EF1 A;  2PVO D;  1TIF A;  1FFU A;  4MAC A;  1GNU A;  2XK5 A;  4NAW B;  3TEW A;  3APF A;  2WU5 B;  1SIF A;  3ZKJ C;  2KX0 A;  3TEZ A;  2WDQ B;  4YTM B;  1JAL A;  1LQB A;  1IYF A;  4FBJ B;  4EEW A;  3E9S A;  4IKG A;  2V3N A;  2KLC A;  4W9I A;  3TEY A;  1UBI A;  2WXH A;  1SEB D;  1ET9 A;  3L08 A;  1M94 A;  3W9C B;  2EKE C;  3AI5 A;  3X23 A;  3U8Z A;  2O6V D;  4JWS C;  3Q3O C;  2MJ3 A;  1K50 A;  4ZYS A;  3RUL A;  3U7D A;  5JZE B;  2CHZ A;  1E7U A;  1SE4 A;  3CSF A;  1VD2 A;  3H8H A;  1OQY A;  1AAR A;  2MEK A;  3FIL B;  3RMK C;  4YSY B;  2EKI A;  3B2F A;  1N61 A;  4KX6 B;  4TKN A;  4OW0 A;  2MCN B;  1V9J A;  4M8N A;  4C56 C;  4LDT B;  4LJP B;  4GDL B;  1E8W A;  2K1F A;  4LNN A;  4IG7 B;  1NI2 A;  2KLG A;  1ISN A;  3PLV A;  4TSS A;  1E0Z A;  4LNI A;  1LXD A;  1V8C A;  2QEJ C;  2IY0 B;  2TSS A;  4OZC A;  3L54 A;  3J9C A;  3NVW A;  3BVM A;  4A3P A;  2D3C A;  2K8C A;  2KZR A;  4RMA A;  2C7M B;  1RFK A;  1FCC C;  2LZ6 A;  3DVG Y;  1GAQ B;  1A5R A;  4YTN B;  4KZC A;  2FCQ A;  2Z8L A;  3T8M A;  4MDK E;  1WR6 E;  3VVW B;  1WRI A;  4LJO B;  3MC0 B;  1XD3 B;  3IXS A;  4NJ6 A;  1WMH B;  3W5V B;  1XT9 B;  3ZLZ A;  2VZK B;  2L83 A;  3ZXV A;  2L0F A;  1TT5 B;  3R2I A;  3R8B A;  3AN1 A;  1VDV A;  4C7Z A;  4WWN A;  2J42 A;  1P7F A;  2KDM A;  3Q3J A;  4GB9 A;  2JRI B;  5J17 A;  3L0W B;  4NQL B;  1L6V A;  2M17 A;  4YTP B;  2C7H A;  3Q8F A;  4J6I A;  4DXA B;  3UF8 A;  2WXM A;  3H7S A;  2ZNV C;  1LM8 B;  3ALB A;  2KQ4 X;  1QOF A;  1R4M I;  3A9K B;  1E8X A;  1EU4 A;  3AE3 B;  3L4P A;  3AE2 B;  4P1C C;  1E7V A;  3Q2A C;  4LTU A;  4GN1 A;  4HK2 A;  2KAC A;  2BB5 A;  2ZZP B;  3NS1 A;  1Q5W B;  4JWU C;  4KGS A;  1YN5 A;  3AU5 A;  2KFK B;  2BF8 B;  2QIE B;  1HZ5 A;  2BT6 A;  2GB1 A;  1E10 A;  2Z0D B;  2YLM A;  2YEP B;  4FHK A;  1I7H A;  3EFU A;  1T6B X;  4W9J A;  2JWZ A;  4GU2 A;  2WX1 A;  4US8 A;  3AEC B;  3NY5 A;  4OVZ A;  2EMT A;  2KQS A;  2LFI A;  2FBW B;  1JWS D;  1JCK B;  5AEK B;  3NZU A;  5BYQ A;  4XGA B;  2L7R A;  3DQV A;  3DVN V;  3FIL A;  3PRE A;  4ZRI A;  5DCN A;  1QT9 A;  1H8C A;  4ZOH C;  3IHP C;  4E74 A;  3VUY A;  4GDK B;  1MHX A;  3H9D A;  3WAN A;  1CK1 A;  5L83 A;  4MH0 E;  1YOV B;  3RZF A;  2RGF A;  2KJ6 A;  4TQ0 A;  4M02 A;  4IOI E;  4OVU A;  3P4Q B;  5BYR A;  3EC8 A;  1KLV A;  3VXW A;  3OAW A;  1YIW A;  4MSM B;  3Q3M C;  2Y5C A;  3PS6 A;  3UI3 A;  1WE7 A;  1SF0 A;  3T3O A;  1XCT L;  3KWL A;  4IWP A;  4HDO A;  3ZIM A;  1YMH E;  2RDG A;  2ZNV B;  2I1J A;  3GZN B;  3QQ8 B;  3IFW B;  5C2T B;  4K3B A;  1C76 A;  2K0P A;  2JYE A;  2LD9 A;  3M63 B;  1KJT A;  2V3S A;  2KKC A;  4P7I A;  1WXS A;  3NJT A;  3DHG C;  1R7S A;  1NBF C;  4NJ7 A;  3HVZ A;  1XLP A;  2B76 B;  5LLI A;  1ZOY B;  1WJU A;  1HZ6 A;  3QK0 A;  4A6Q A;  2FUH B;  1PGA A;  4ASW C;  3W1S C;  4NPN A;  4ACF A;  2W82 A;  1C78 A;  4I6P A;  2PW9 A;  5I4D A;  2JZZ A;  1C1Y B;  1T0R C;  1D5X C;  1ZP0 B;  4C4V B;  5IO9 A;  2FE8 A;  3WIM A;  2ZVN A;  2KWV B;  1FRR A;  1VJK A;  4M01 A;  1J7A A;  1WFY A;  1RM6 C;  3ML8 A;  4AJW A;  2BWF A;  4CQN A;  3X0W A;  2LGY A;  2N9K A;  4M0W A;  4K7S A;  5IOI A;  1WJ4 A;  4GIV A;  3RPF C;  3P42 A;  1AW7 A;  2Z0E B;  2KFK A;  2INP E;  1TKE A;  4ZYN A;  3PZ7 A;  1ZXI A;  3N9Y C;  1YX6 B;  2M0X A;  1N5W A;  2O6V B;  3PZ8 A;  5EE0 A;  3I3T B;  3VTW A;  4E71 A;  2D3G A;  4MGK E;  2MRP A;  4WQM A;  2WDT B;  5J18 A;  1BT0 A;  2ON8 A;  2AL6 A;  1QF6 A;  2WXF A;  1Q0W B;  1N60 A;  1QOB A;  3P4R B;  3OLM D;  2V4I B;  1ZXH A;  1K52 A;  1WR1 A;  2PPH A;  3QX1 A;  3RZW C;  3UQB A;  2N9L A;  4N58 A;  2E6X A;  1NYR A;  2LUE A;  3AEF B;  2QHO A;  1YD8 U;  3AE7 B;  1NDD A;  1SE2 A;  1EUV B;  2K9X A;  5CHW A;  3EEC A;  4GDK A;  4W9C A;  2KDB A;  2NPT A;  3M95 A;  4WJP A;  3ZGZ A;  1SSN A;  2G9H D;  4JPS A;  3I63 C;  3AB5 A;  1WXQ A;  5CX3 A;  1MFW A;  4HEA 1;  3LB8 C;  1YNT E;  3N1X C;  2JVC A;  2NTT A;  1YJJ A;  3JW0 X;  5DPW A;  1FNV A;  2N0S B;  3MHS D;  4BKS A;  3KYC D;  4FA6 A;  5IN7 A;  1YQB A;  3P4S B;  4JGH B;  1KRH A;  1L0Y B;  4WQO B;  2AQ2 B;  3RD2 A;  3ZXR A;  4G50 A;  2IJ0 A;  3N1Y C;  4EE2 A;  2L32 A;  2W54 A;  3P4P B;  4AOF A;  3TMP B;  1WGH A;  3DBH B;  3NRZ A;  2V1Y A;  3AED B;  2PMV A;  1WZ0 A;  3IAS 1;  2KDE B;  4R3D A;  1JW9 D;  2VH1 A;  3ML9 A;  2KMC A;  4MGY E;  4XDD A;  3RFZ B;  1A70 A;  1P98 A;  4N9F 4;  2PEA A;  2L00 B;  1R4M B;  3PRZ A;  4LCD E;  4A9A A;  2NS5 A;  2PVG C;  1XLN A;  3Q3N C;  4G0N B;  1STE A;  2ZCC A;  1UWM A;  4DHJ D;  1XEE A;  1L0V B;  2E3T A;  2EMS A;  2LXA A;  2ZPY A;  1XQQ A;  4HKQ A;  2G3Q B;  2PTL A;  1P3Q U;  3AXC A;  2WU2 B;  4B6W A;  1ZKH A;  4RFB A;  4FXC A;  2AX5 A;  4TQ1 A;  1J19 A;  3T3N A;  2IO0 B;  1H4R A;  3UGB B;  2KDI A;  1WYG A;  3VDZ A;  2AQ1 B;  4MEL A;  1X1M A;  2K8H A;  4M8M A;  2KDF B;  1WX8 A;  4F1S A;  2WXK A;  4W9H A;  3H1U A;  2O6V A;  1TY0 A;  1UGM A;  4BOS C;  2JY6 A;  2KC2 A;  1WH3 A;  2JX5 A;  3Q8B A;  1YX5 B;  4MJS A;  1FFV A;  2PE6 B;  2QJL A;  2FUG 1;  2BYT A;  4MT5 A;  3P63 A;  4DHZ B;  2IBI B;  4WAA A;  4C00 A;  4YSZ B;  1KTK A;  1MG4 A;  3ZJT A;  2BKR B;  1E9M A;  5JHB A;  1E5W A;  4WWO A;  2UU7 A;  2KN5 A;  4EZJ A;  4HRO A;  2DAF A;  2ZW0 A;  2LJI A;  4GMV A;  2LXC A;  2C5L C;  1Q10 A;  5JXV A;  2JSV X;  4IM2 A;  1L4Z B;  1WGK A;  2KT7 A;  3ABV B;  2JF5 A;  1SXT A;  4EKU A;  1JWU D;  4II2 B;  1T5X D;  3AE1 B;  1IP9 A;  4NY0 A;  2WQY B;  1TZ1 A;  2K3U A;  2LGS A;  3RNC C;  1MPE A;  2Y3A A;  5E6J A;  5HFY A;  3QA8 A;  1IPG A;  2NCN A;  4YXD B;  2DX5 B;  3IT4 B;  3IVF A;  4OZA A;  4AJY B;  2PKO A;  4MH8 A;  1B1Z A;  3FC4 A;  5D6J B;  2IZV B;  2J0K A;  5FR3 A;  2WXG A;  2FCN A;  1I4Q A;  1Z2M A;  1NEN B;  1WIA A;  2KN4 A;  2FNJ B;  3K9P B;  3PGE A;  5HI1 A;  1D3Z A;  3ZO5 B;  2K8B A;  4OHJ A;  1CMX B;  1K8R B;  2M8S A;  1L7Y A;  2PIA A;  1VRA B;  1QLB B;  3B0A A;  3URY A;  4EFO A;  3WAM A;  2CR5 A;  3JVZ X;  1ZDV A;  2D07 B;  1R4N I;  5AZH A;  4US9 A;  1E7P B;  2G1E A;  4MM3 B;  2KHW B;  4IW0 A;  2V9H A;  5BMH A;  5H8Y E;  3RI7 C;  4KDL B;  2WXL A;  1QOG A;  2KMA A;  5HG2 A;  2Y5P A;  1OGW A;  4GGQ A;  3N32 A;  4IDI A;  3C0R B;  5KHQ A;  2BW2 A;  1V5T A;  3VFK A;  2GOW A;  2MJE A;  3H6N A;  2L8J A;  5G2N A;  1WGY A;  2ZPN A;  2RDH A;  3NUH B;  3PRP B;  3SFD B;  2BYE A;  3JSV B;  2JQR B;  3VH4 B;  1TY2 A;  1E8Z A;  1DYQ A;  2KAN A;  1L0X B;  2NBU A;  1S1Q B;  4WIP A;  5CTR C;  2KTR B;  4XC2 A;  5LXH A;  1C9F A;  4FJZ A;  2KAJ A;  1D5Z C;  3HHM A;  1PGX A;  4KIK B;  3VQI A;  3W5U B;  2BB6 A;  4XYC A;  3DWM A;  5FKA C;  3QAQ A;  4I6N B;  1F1H A;  4KSL C;  2QSD A;  3NHE B;  4G11 A;  3VR9 B;  5J2R A;  4PS3 A;  1V1P B;  3DBH I;  1FCL A;  2ZEQ A;  2QMT A;  2HDE A;  4K7U A;  4DQO C;  2BBC A;  4B95 A;  1PYW D;  4HRS A;  4RGT A;  4AQ7 A;  5D3I B;  3A33 B;  3SR6 A;  3V6E B;  2LRU A;  3VUX A;  1FXT B;  2WWZ A;  4EZK A;  1SIJ A;  2I38 A;  5D3D A;  5D7G A;  3RUI B;  4JLC A;  2MP2 A;  1WJ6 A;  4ZDV A;  4NAW A;  4PYU A;  4M00 A;  2MBH A;  3Q69 A;  2JT4 B;  2X38 A;  2IY1 B;  1I35 A;  1V2Y A;  1UH6 A;  1N63 A;  4E3C A;  4HVB A;  3H7P B;  1WXV A;  3EFC A;  1OQQ A;  4HLE A;  1KLG D;  5FK9 C;  1CZP A;  2MJD A;  1UD7 A;  1UZX B;  1C79 A;  1OTR B;  4EZL A;  2NR2 A;  4II3 B;  4XX5 A;  4C7Y A;  2RMM A;  2BS3 B;  2KC1 A;  1WGR A;  4USA A; 
#chains in the Genus database with same CATH homology
 2KFK A;  1EO6 A;  4FUL A;  2MBE A;  3RYT A;  4ZYN A;  3DDC B;  2K6Q A;  1WXA A;  3ONS A;  4KSK C;  1YX6 B;  2M0X A;  1WI0 A;  3TL5 A;  2CS4 A;  2O6V B;  4OVV A;  3DBS A;  1UEL A;  3I3T B;  3VTW A;  3W1Y A;  2D3G A;  3A9J B;  3KUZ A;  1RRB A;  3IG3 A;  4E71 A;  2ZJD A;  2DYO A;  4JIO U;  4MGK E;  5DPT A;  2MRP A;  2DZK A;  2WDT B;  3KVF B;  4G3X B;  4HJK A;  4KDI C;  5J18 A;  2WYQ A;  1BT0 A;  2C9W B;  3ECI A;  2AL6 A;  3PV1 A;  4BKS D;  4GDL A;  4DHJ B;  2N9P C;  4W9K A;  1Q0W B;  3PVL A;  2HE7 A;  5C23 A;  2R2O A;  4EOY A;  1SE9 A;  2J0M A;  1E8Y A;  2LGD A;  2LAS A;  3OLM D;  1J8C A;  3KH0 A;  1WX9 A;  1WR1 A;  2PPH A;  2N9E B;  3QX1 A;  3RZW C;  3UQB A;  2LGX A;  1J0G A;  1E90 A;  3MTN B;  4MM3 A;  2BWE S;  4FAD A;  3ZNI D;  3QJZ A;  2G4D B;  2A5U A;  2LUE A;  2QHO A;  1LFD A;  1YD8 U;  2I1K A;  2JZ3 B;  1NDD A;  3ZDT A;  1EUV B;  2CKH B;  2KK8 A;  5CHW A;  3EEC A;  4GDK A;  4W9C A;  2KDB A;  3M3J A;  3TJP A;  3HK0 A;  4B9K A;  3GZN I;  1V49 A;  2MX2 A;  2NPT A;  3M95 A;  4K1R B;  4X57 B;  4WJP A;  4A20 A;  2GBM A;  2NVU I;  5G55 A;  2BPS A;  3T9L A;  2XEW A;  4JQW C;  3PLU A;  4WJO A;  2DZJ A;  1RLF A;  4BOZ B;  5IA7 A;  4W9D A;  4IWQ A;  5CX3 A;  4WJQ A;  1S3S G;  3V61 A;  2FIF A;  4DHZ E;  2N1W A;  2JVC A;  2DHZ A;  4ANU A;  4F7Z A;  3JW0 X;  5D94 A;  4K81 A;  3ZTC A;  3ZRC A;  2YVC A;  5CHF A;  5DPW A;  3KYD D;  4CYE A;  2KNB A;  4W9L A;  1ZW7 A;  3MHS D;  4K7W A;  3WAP A;  4IM3 A;  4AUQ C;  4BKS A;  3KYC D;  4BBN F;  4FA6 A;  1YQB A;  4JGH B;  1V6E A;  4KIK A;  1WMH A;  5JHA A;  4WQO B;  3VTU A;  3PHW B;  3PTF C;  4RM8 A;  2MP2 B;  2GBR A;  1EF1 A;  2DYB A;  4G50 A;  2GBN A;  3RD2 A;  4KV2 A;  1GNU A;  3QAR A;  2FID A;  2XK5 A;  4AOF A;  4NQK E;  4NAW B;  3QHT A;  3HM6 X;  5AZG A;  3TCA A;  3TMP B;  3APF A;  3P2B A;  1SIF A;  1WGH A;  2KX0 A;  3ZKJ C;  4BFR A;  2NBW B;  1I42 A;  2V1Y A;  1LQB A;  1WZ0 A;  1IYF A;  1MG8 A;  4FBJ B;  4EEW A;  2KDE B;  2XBB C;  3K9O B;  3L13 A;  3ML9 A;  1WX7 A;  2KMC A;  4MGY E;  2M1M A;  2KLC A;  2PE9 A;  4W9I A;  3SHQ A;  2CU1 A;  1UBI A;  3QWZ B;  1P98 A;  4N9F 4;  2IO3 B;  2PEA A;  1M94 A;  3A9K A;  2L00 B;  3L08 A;  5HKH A;  2EKE C;  1G6J A;  2AL3 A;  2RSU A;  3AI5 A;  4XZ4 A;  1EF5 A;  3PRZ A;  3U8Z A;  3X23 A;  4LCD E;  4M0W B;  2KFJ A;  2O6V D;  3DPD A;  2NS5 A;  3Q3F A;  4ZRJ A;  3RUL A;  1KM7 A;  3U7D A;  5JZE B;  4G0N B;  2KQ7 A;  2CHZ A;  2ZCC A;  2G4S A;  1E7U A;  3WAO A;  3CSF A;  4DHJ D;  1VD2 A;  3PRM B;  3KW5 B;  2EMS A;  1OQY A;  1AAR A;  2DYM A;  3ZTD A;  3BIN A;  2LXA A;  2KX3 A;  2ZPY A;  3ZNH B;  2LWP A;  3VTV A;  1XQQ A;  5DPR A;  2HTH A;  2AEH A;  4TKN A;  2G3Q B;  4TUU A;  4F8C B;  2MCN B;  1V9J A;  1P3Q U;  2OOB B;  3AXC A;  4M8N A;  5CHV C;  4B6W A;  2O2V B;  2REX A;  4LDT B;  4LJP B;  4HCP B;  4GDL B;  1E8W A;  2K1F A;  1ZKH A;  3PHX B;  2GMI C;  1GJZ A;  4IG7 B;  1NI2 A;  2A4Z A;  2KLG A;  1ISN A;  4TQ1 A;  1J19 A;  2N9X A;  4FJV B;  3SDL C;  2IO0 B;  2LVP A;  3PLV A;  1H4R A;  2FCS A;  3UGB B;  4FJY A;  1YJ1 A;  1WGR A;  4AP4 C;  1LXD A;  2FCM A;  3A4S C;  3ZNZ B;  2MWS B;  3NZS A;  2KD0 A;  2KDI A;  3VDZ A;  4BVU C;  3DVN U;  3U30 A;  4MEL A;  2IY0 B;  1X1M A;  4PYZ A;  2K8H A;  3LDZ E;  2KDF B;  1WX8 A;  3DOW A;  4M8M A;  4F1S A;  3L54 A;  3NS8 A;  1SGH A;  4IM0 A;  4W9H A;  3H1U A;  3KUC B;  2O6V A;  4A3P A;  2Z59 B;  2DZM A;  2K8C A;  2KZR A;  3A9J A;  4RMA A;  1UGM A;  2NPT B;  4KZ0 A;  4BOS C;  2LVQ A;  2IO2 B;  2C7M B;  2MBQ A;  2N7E A;  2MW5 A;  2JY6 A;  1V81 A;  2KC2 A;  1Q1O A;  1WH3 A;  2HD5 B;  3A1Q B;  1YX5 B;  2LZ6 A;  3DVG Y;  2IYD B;  4MJS A;  1A5R A;  1OEY A;  4ANV A;  2LVO A;  4KZC A;  1Y8R C;  3L17 A;  2FCQ A;  3TIX A;  3AUL A;  2PE6 B;  3V60 A;  4HPL B;  3T8M A;  3ZDM C;  3OJ4 B;  3JSV A;  4MDK E;  3UIP B;  5IAA C;  1HE8 A;  1WR6 E;  4DHZ B;  2IBI B;  4I6L B;  5E6O A;  4WAA A;  3VVW B;  3OJ3 A;  3WA0 A;  2Z0E B;  4LJO B;  2DAJ A;  2L3Z A;  1XD3 B;  1WYW B;  4NJ6 A;  2G45 B;  1KOT A;  1WMH B;  2KTR A;  2BKR B;  2BGF A;  4MSQ B;  3BY4 B;  3ZW3 A;  5JHB A;  1WZ3 A;  1XT9 B;  3ZLZ A;  2MBO A;  3R66 C;  1E5W A;  4WWO A;  2KN5 A;  2L0F A;  4EZJ A;  2WX0 A;  4HWI B;  2DAF A;  2KWU B;  1QZE A;  4WWN A;  1TBE A;  2N1V A;  4GMV A;  3PT2 B;  2LXC A;  3Q3J A;  2C5L C;  4GB9 A;  4JL9 A;  2UWQ A;  2J0J A;  5L95 C;  2JRI B;  4IUM B;  5J17 A;  1V5O A;  3L0W B;  4IM2 A;  4NQL B;  2M17 A;  4A3O A;  4ZRK A;  2C7H A;  2JF5 A;  4J6I A;  4DXA B;  3N30 A;  4EKU A;  2R2Q A;  3SU8 X;  3UF8 A;  3JYU A;  3S2A A;  3H7S A;  4WJN A;  4II2 B;  2ZNV C;  3QCA A;  1IP9 A;  4NY0 A;  1LM8 B;  1TZ1 A;  3ALB A;  1WRD B;  2AYO B;  3PPA A;  3R7Q A;  1R4M I;  3ZVV A;  4ANW A;  2JPH A;  3A9K B;  3VAW A;  2K39 A;  3NOB A;  1E8X A;  3QA8 A;  1IPG A;  2CHX A;  1P1A A;  2NCN A;  4GSW A;  2DX5 B;  2KJH B;  3M62 B;  4HCN B;  1E7V A;  3IVF A;  4AJY B;  4PS8 A;  5GMV A;  3QC8 B;  4GN1 A;  4HK2 A;  3UQA A;  5D6J B;  2IO1 B;  3ZNG C;  2IZV B;  2J0K A;  3DVG X;  2DEN B;  2ZZP B;  1GC7 A;  4LDT D;  4CHK A;  1Q5W B;  2JXX A;  1P0R A;  2FCN A;  1Z2M A;  2GBK A;  4BKT A;  4W9F A;  1WIA A;  4KVG B;  1WM2 A;  1C3T A;  1WY8 A;  3MJW A;  2FNJ B;  3K9P B;  3AU5 A;  2KFK B;  3PGE A;  2AWT A;  3H7P A;  3UIN B;  1D3Z A;  1ZGU B;  3ZO5 B;  2BF8 B;  2FAZ A;  2N4F A;  2K8B A;  4HDQ A;  3UIO B;  2OJR A;  1TTN A;  2Z0D B;  2KJR A;  2LRW A;  2YLM A;  4FHK A;  1WJN A;  2C60 A;  1CMX B;  1K8R B;  1GG3 A;  2M8S A;  1GC6 A;  1L7Y A;  2KWC A;  3EFU A;  3ZRF A;  2M4N A;  3B0A A;  5DPS A;  4EFO A;  4W9J A;  3WAM A;  2JWZ A;  4URK A;  2CR5 A;  2KXJ A;  3JVZ X;  3PSE B;  4GU2 A;  2WX1 A;  1U4A A;  3NY5 A;  2D07 B;  2EMT A;  3ENE A;  2KQS A;  1R4N I;  4MEM A;  5AZH A;  3TBL D;  3SD5 A;  1PQS A;  5AEK B;  3NZU A;  3L10 B;  4AWJ A;  2KTF A;  2KHW B;  2L7R A;  3DQV A;  3DVN V;  3PRE A;  4ICV A;  4IW0 A;  4DDI D;  4KDL B;  4ZRI A;  3R7R A;  5DCN A;  2ASQ A;  2KMA A;  1H8C A;  3APC A;  3RCZ A;  4DBG A;  3B08 A;  3IHP C;  2B3A A;  1OGW A;  3GOE A;  4GGQ A;  5TR5 A;  4E74 A;  3VUY A;  4GDK B;  3N32 A;  3CMM B;  2O2V A;  2UYZ B;  5D2M B;  2JRH A;  3C0R B;  5KHQ A;  3H9D A;  3WAN A;  1V5T A;  3VFK A;  3ZUN A;  2GOW A;  2C7N B;  2D2Q A;  3H6N A;  2L8J A;  4GOC A;  2ZVO A;  4MH0 E;  5L83 A;  1WE6 A;  4MJS B;  5G2N A;  1UBQ A;  1WGY A;  1RFA A;  2ZPN A;  3AU4 A;  3RZF A;  3VUW A;  3PZD A;  3PRP B;  2RGF A;  2KJ6 A;  3V6C B;  2LI5 A;  2BYE A;  4TQ0 A;  3JSV B;  4OVU A;  3VH4 B;  3B1L X;  3EC8 A;  4W9E A;  2L76 A;  1E8Z A;  2NBV B;  1KLV A;  3VXW A;  3OAW A;  1YIW A;  3HM3 A;  1V80 A;  1WGD A;  2KAN A;  4MSM B;  1F9J A;  4YL8 A;  3PS6 A;  2NBU A;  1S1Q B;  5CTR C;  2KTR B;  4XC2 A;  4WWP A;  5LXH A;  1WE7 A;  4FJZ A;  5EDS A;  3N3K B;  3HHM A;  2BYV E;  4BBN C;  2LJ5 A;  5C1Z A;  4KIK B;  4IWP A;  2BKF A;  3VQI A;  4HDO A;  3RT3 B;  3R3M A;  2ZCB A;  3ZIM A;  3QAQ A;  2KOX A;  4I6N B;  3A1Q A;  4HPM B;  2ZNV B;  1P9D U;  2XK5 B;  2I1J A;  3D32 A;  4KSL C;  2MSE D;  1VCB A;  2RPQ A;  3NHE B;  1JRU A;  3QQ8 B;  4G11 A;  5J2R A;  3IFW B;  4PS3 A;  1WM3 A;  3DBL I;  3DBH I;  1WGG A;  2ZEQ A;  4NNJ B;  4K7U A;  2RD0 A;  2LD9 A;  2MQJ A;  3M63 B;  4B95 A;  2L0T A;  2RR9 A;  2HJ8 A;  3HIZ A;  1KJT A;  3W1S A;  2J7Q B;  2V3S A;  2D10 A;  1L2N A;  2KKC A;  4P7I A;  1WXS A;  3A33 B;  4MGI E;  3VHT C;  3V6E B;  2LRU A;  3VUX A;  1FXT B;  1NBF C;  2MA9 B;  2WWZ A;  4NJ7 A;  4EZK A;  1WXM A;  4DDG D;  3O65 B;  1OEY J;  5LLI A;  3QK0 A;  1WJU A;  4FLH A;  5FR6 A;  2FUH B;  3V62 A;  5D7G A;  3W1S C;  4ASW C;  3RUI B;  2Y5B B;  3IBE A;  4NPN A;  4JLC A;  3WAL A;  2MP2 A;  4TV3 A;  1WJ6 A;  2K6D B;  4PS7 A;  4ZDV A;  4I6P A;  2PJH A;  4GXB A;  4DK5 A;  4NAW A;  2K25 A;  4PYU A;  2MBH A;  2JT4 B;  2IY1 B;  5BO4 B;  4BKG A;  1T0Y A;  2JZZ A;  3CF6 E;  1Z5S B;  1V2Y A;  2GBJ A;  1C1Y B;  1UH6 A;  3VH3 B;  1I35 A;  1RAX A;  5E6N A;  2W9N A;  3L16 A;  4EUT A;  4RM9 A;  3WIM A;  4E3C A;  2MBB B;  4CO7 A;  4HVB A;  5JH5 C;  2D11 A;  1V86 A;  3H7P B;  2ZVN A;  1WXV A;  2KWV B;  2DZI A;  2KO3 A;  4FHJ A;  4HLE A;  1WF9 A;  3EHV A;  3CST A;  2MLB A;  5KHO A;  1WFY A;  1UD7 A;  3DBR I;  3ML8 A;  4AJW A;  4FN2 A;  4W9G A;  1UZX B;  2BWF A;  3X0W A;  2JUO A;  4IWO A;  1OTR B;  4HXD A;  3DCG A;  4ICU A;  2V4L A;  3QIJ A;  4EZL A;  1TGZ B;  2NR2 A;  2LGY A;  3LJ3 A;  4II3 B;  2BYF A;  3APD A;  4XX5 A;  5E6P A;  4DWF A;  4K7S A;  2N7D A;  1WJ4 A;  4IC7 B;  2L05 A;  3KUD B;  4ANX A;  5LXI B;  4GIV A;  1GUA B;  3A4R A;  2VRR B;  4MGZ E;  5AZF A;  2KC1 A;  2KVR A;  2CHW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...