1NDDA

Structure of nedd8
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
74
structure length
74
Chain Sequence
b'MLIKVKTLTGKEIEIDIEPTDKVERIKERVEEKEGIPPQQQRLIYSGKQMNDEKTAADYKILGGSVLHLVLALR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN (UBIQUITIN-LIKE PROTEIN NEDD8)
publication title Crystal structure of the human ubiquitin-like protein NEDD8 and interactions with ubiquitin pathway enzymes.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein
total genus 20
structure length 74
sequence length 74
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 1998-08-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00240 ubiquitin Ubiquitin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 1nddA00
4ZRJA 2NBWB 2OOBB 3NOBA 2KWCA 1V9JA 2N4FA 2DENB 4GN1A 3L54A 3BY4B 2KTRB 4W9DA 4HCNB 2MA9B 2EMSA 2NS5A 2MLBA 4F1SA 1J8CA 3A9JB 3PLUA 4HLEA 2O6VB 5DPWA 3WALA 2JUOA 3JVZX 4NJ6A 5BO4B 3R7QA 2L7RA 1H8CA 3DVNV 2BWFA 2DAFA 1TZ1A 2LASA 3PRZA 4RM8A 1WJUA 4E3CA 3PSEB 3P2BA 1R4NI 2LGDA 1Q1OA 2M4NA 4HDQA 4BOZB 2GMIC 1L7YA 2EKEC 3IG3A 4OVUA 3C0RB 3ZLZA 3QK0A 2XBBC 1IPGA 3H6NA 3VFKA 3PV1A 1PQSA 3I3TB 1EUVB 2YLMA 3AI5A 4GDLB 4E71A 5L83A 3TBLD 5D94A 2Z0DB 3QHTA 3APFA 2A5UA 2KN5A 2L0TA 4LDTB 4MM3A 4W9LA 2ZPNA 4E74A 3DVNU 2DZIA 5KHOA 3WIMA 2KFJA 3ZTCA 1RAXA 5IAAC 1S1QB 2KVRA 2GOWA 3N32A 2L3ZA 2KQSA 1EO6A 4N9F4 2ZCCA 2KO3A 2KC2A 4ICVA 2MCNB 1WY8A 5EDSA 3ENEA 2BPSA 2O6VD 4AOFA 3O65B 4WWOA 3GZNI 3WAPA 4NAWB 4IM2A 2C7NB 1H4RA 2N9PC 3RYTA 2MBOA 2ZCBA 3UF8A 3APDA 3A4SC 5LLIA 3TIXA 1LFDA 1I42A 4EKUA 2ZNVC 3EFUA 3W1YA 3DBRI 5GMVA 4DDID 3N30A 5AEKB 2KANA 2CKHB 2BKFA 3T9LA 2N7DA 1WI0A 2C5LC 2DZMA 2KDBA 4MEMA 5G2NA 2LZ6A 4GXBA 2C60A 2NVUI 2Y5BB 1UBQA 2JWZA 2G45B 4JQWC 3EECA 3H9DA 2K1FA 3DCGA 3VVWB 5E6OA 3PS6A 3AXCA 4TKNA 5JZEB 3QARA 3ZDMC 4J6IA 3H7PA 2O2VB 3KH0A 2LRWA 2D2QA 2AL3A 2K8HA 2LVPA 2IO0B 1WR6E 4I6PA 4B6WA 2ZZPB 2KX3A 5CTRC 4LDTD 2MBQA 4EOYA 2AEHA 1IYFA 4HXDA 3DBSA 4KDLB 5C23A 2KTFA 4KVGB 1WM2A 2ZPYA 3OAWA 2RGFA 3KUCB 2J0KA 2L0FA 3N3KB 1GC7A 2RR9A 4DBGA 3AU5A 3QQ8B 3ZUNA 4BKTA 1SIFA 4IW0A 1ZGUB 1NI2A 4HJKA 2CHWA 4OVVA 1LQBA 3K9OB 4HPLB 1E8ZA 1WZ3A 3ZO5B 3A9KA 3DQVA 3DVGX 3PREA 2MP2B 2KJ6A 3PRPB 4BKGA 5DCNA 3VH4B 4JL9A 4HCPB 2K6QA 4A3PA 3UQAA 4HPMB 3M63B 4PS8A 3ZNHB 2IO3B 1RRBA 1WGHA 1S3SG 2JZ3B 3RT3B 1G6JA 4CO7A 3EHVA 4G3XB 2BGFA 1JRUA 3DVGY 4BFRA 3PRMB 2LVQA 2KJRA 3KW5B 2ZNVB 3VAWA 2LXAA 4GOCA 1TGZB 2HTHA 2XEWA 4KSLC 4BKSA 5JH5C 1P0RA 2RSUA 2KQ7A 4PS7A 3ZTDA 3NZUA 4FBJB 3PGEA 4M8NA 1E8WA 3T8MA 3L10B 4EZJA 3IVFA 3QCAA 2M8SA 4AP4C 4DHZB 2XK5B 5D7GA 1WGDA 3PHXB 1LM8B 2CS4A 3AU4A 2MBEA 2ASQA 2DYOA 2VRRB 1WRDB 3LDZE 1OQYA 1UH6A 4IM0A 5DPTA 5DPRA 2KMCA 2Z59B 2KOXA 3U30A 4ZRKA 5CHFA 4GSWA 2KFKB 3QIJA 2GBKA 3KVFB 2KJHB 3WAMA 1UBIA 3VHTC 2NPTB 3KYDD 1UELA 1YJ1A 4M0WB 4FN2A 3AULA 1M94A 2L05A 3ML9A 3PTFC 4ANWA 2LD9A 2PE9A 5JHAA 4DK5A 2I1JA 4XX5A 1UD7A 1SGHA 4EZKA 1OEYA 1I35A 2GBJA 4NPNA 4MH0E 2LXCA 3B0AA 3H1UA 2G3QB 2IY0B 2ZJDA 1OEYJ 1UZXB 2DAJA 1EF1A 2M17A 2W9NA 4TUUA 3HIZA 4W9FA 2O2VA 2B3AA 4MGKE 4PYZA 3JSVA 1GC6A 4W9HA 2FCMA 4HK2A 4ICUA 2D3GA 1HE8A 2R2OA 3QA8A 2MBBB 2OJRA 4KDIC 4WJOA 5AZGA 1WJ6A 2IBIB 3QAQA 4GGQA 4GDKA 4K1RB 3SD5A 2DYMA 4DWFA 5J2RA 3QX1A 1D3ZA 4IG7B 5TR5A 1WXVA 1ZW7A 2KWVB 3L08A 3TJPA 2J0MA 4MJSA 5AZFA 1WR1A 1E5WA 1WX9A 4GU2A 4X57B 2C7MB 2L00B 1E8YA 4YL8A 2WX0A 4JGHB 2KLGA 3VUYA 1YX6B 1WXMA 1J19A 4KIKB 2JRHA 4I6LB 4KSKC 1WJ4A 2FIFA 2JRIB 2M1MA 4F7ZA 3APCA 4ZYNA 1WX8A 3VTUA 1C3TA 4PYUA 3NZSA 3R3MA 3D32A 3NS8A 2J0JA 2C7HA 2KDEB 3PT2B 2JY6A 1P1AA 4W9JA 2LI5A 4JIOU 3MJWA 3VUXA 4DHZE 2IO1B 1Q0WB 1WXAA 2IO2B 2N1VA 4MSQB 2KK8A 2PPHA 2REXA 5KHQA 3HM6X 5LXHA 4I6NB 4W9KA 1VD2A 4F8CB 3U7DA 1GG3A 1V6EA 2KTRA 4GB9A 4ZRIA 4AJYB 4URKA 5J18A 1V80A 3HM3A 3A9JA 2KFKA 2O6VA 3DPDA 2NPTA 4II2B 2M0XA 1WE7A 1KLVA 2JT4B 1V5OA 2CHXA 2I1KA 4IWPA 3UIPB 3W1SA 1BT0A 1P98A 2K8CA 2CHZA 3VH3B 4IWOA 3R7RA 4P7IA 1E7UA 4FULA 1FXTB 3H7SA 3ZIMA 4W9EA 3TMPB 4MGYE 2AYOB 3V61A 3OJ4B 1OTRB 2N9XA 4DDGD 3SDLC 2KC1A 2QHOA 4XC2A 5C1ZA 3VDZA 1UGMA 3UIOB 2CR5A 4PS3A 3SU8X 2JVCA 2NBUA 2LUEA 4GDLA 4KZCA 3VTVA 3L16A 1XT9B 2MW5A 2KKCA 5DPSA 3KYCD 2MQJA 4LJPB 1OGWA 5CHWA 1CMXB 1XQQA 3A33B 3TCAA 3ZDTA 2NCNA 2FNJB 3CMMB 3ZKJC 4K81A 1QZEA 2CU1A 4NQKE 1WZ0A 2BYVE 3QC8B 5CX3A 1L2NA 1K8RB 4WJPA 1WXSA 4K7SA 5D6JB 4EEWA 1WIAA 1F9JA 3M95A 4FJYA 2KHWB 4HWIB 1ZKHA 2FCNA 4IUMB 4A3OA 1T0YA 2ZVOA 4BVUC 4NAWA 3RZFA 4EFOA 3V6CB 1WGGA 1TTNA 2GBRA 4MELA 4XZ4A 1LXDA 4K7WA 4FA6A 2IYDB 2WX1A 4W9CA 3H7PB 3M3JA 2HJ8A 4FLHA 2YVCA 2V4LA 3MHSD 4BOSC 2K8BA 1MG8A 1KJTA 2BF8B 4FHJA 4IC7B 2KDIA 3ZNID 2NR2A 2LWPA 2FIDA 1J0GA 3UGBB 4II3B 2KXJA 4KV2A 3V62A 3JW0X 3UINB 2Z0EB 3MTNB 3DOWA 4ANVA 4G0NB 5HKHA 2J7QB 2G4SA 2V1YA 2MRPA 1YX5B 2ZVNA 1WH3A 1Y8RC 3A9KB 3RULA 4AJWA 2KLCA 4CHKA 3GOEA 3R66C 3PVLA 2KD0A 5E6PA 3DDCB 3ZRCA 1Z2MA 3VUWA 3A1QB 2UYZB 3B08A 1WGRA 1C1YB 1E7VA 4BBNC 4DXAB 4LJOB 4FHKA 5FR6A 4B9KA 3PHWB 4EZLA 2NBVB 3EC8A 2MWSB 1R4MI 1AARA 3L17A 3ZNZB 1VCBA 2KDFB 2N9EB 2IY1B 2IZVB 3WANA 2DX5B 3KUDB 1RFAA 2DZJA 2MP2A 4A20A 1V2YA 4DHJB 2JXXA 3RD2A 3V6EB 4ANXA 1WMHB 3IFWB 3NY5A 3DBHI 4ANUA 4TV3A 4HVBA 2AL6A 4IM3A 4TQ1A 2BKRB 4JLCA 2D11A 2WYQA 5D2MB 2C9WB 2N7EA 2LJ5A 2KZRA 1TBEA 1E90A 2GBMA 3BINA 3VXWA 2KMAA 2BYEA 2GBNA 3ZVVA 1NBFC 4AWJA 1WJNA 3NHEB 3DBLI 1WGYA 3ML8A 4FJZA 3IBEA 1WFYA 2EMTA 2K6DB 2A4ZA 1WYWB 3PLVA 1GJZA 3M62B 1P3QU 4NNJB 2XK5A 2D07B 2RD0A 3VTWA 4WWNA 1WX7A 3WA0A 2KWUB 2D10A 4NQLB 3PPAA 3ZW3A 3L0WB 2V3SA 2ZEQA 2DYBA 2KNBA 3B1LX 4CYEA 1GUAB 2DZKA 4RMAA 2BYFA 3ZNGC 4B95A 4RM9A 3CSTA 1NDDA 4WJNA 3TL5A 2WWZA 2JF5A 2MBHA 4HDOA 5CHVC 4ASWC 1ISNA 4AUQC 3QWZB 3A4RA 5IA7A 2UWQA 1V86A 2FCSA 4M8MA 3K9PB 3JYUA 1YD8U 3PZDA 4DHJD 4WJQA 4BKSD 3JSVB 4W9GA 1KM7A 1GNUA 3LJ3A 4MGIE 3RZWC 2PE6B 3CF6E 1U4AA 3IHPC 1P9DU 3V60A 4WAAA 1Z5SB 2R2QA 3X0WA 1X1MA 4WQOB 2JPHA 2BWES 5LXIB 4FADA 2FUHB 3KUZA 3W1SC 4GDKB 2HD5B 1SE9A 3ZRFA 2PJHA 4BBNF 1WE6A 2AWTA 3Q3FA 1V49A 2FAZA 2FCQA 4KZ0A 3S2AA 5JHBA 4K7UA 2RPQA 4GIVA 3HK0A 1V5TA 4MJSB 2K39A 4LCDE 4FJVB 1EF5A 2LRUA 4IWQA 5AZHA 4EUTA 3UQBA 2DHZA 3CSFA 3ALBA 1V81A 4W9IA 3SHQA 3U8ZA 3VQIA 1A5RA 3ONSA 2L8JA 3A1QA 3RCZA 2JZZA 2K25A 3OJ3A 2WDTB 3OLMD 2KX0A 2N1WA 4GMVA 4NY0A 5E6NA 1RLFA 2MX2A 5L95C 4G50A 4MDKE 1YIWA 2HE7A 1YQBA 4G11A 3ECIA 1KOTA 5G55A 4WWPA 4MGZE 2LGYA 2G4DB 3RUIB 2LVOA 1XD3B 4ZDVA 1E8XA 2PEAA 1WMHA 4NJ7A 1IP9A 4TQ0A 1Q5WB 3HHMA 1WF9A 1WM3A 2L76A 3L13A 4MSMB 3WAOA 3X23A 5J17A 3QJZA 2LGXA 2MSED 4KIKA 3Q3JA
chains in the Genus database with same CATH superfamily
2OOBB 2PLPA 1C4CA 4US9A 1J8CA 3NUHB 1I4HA 4HLEA 2WDRB 3P4QB 2JUOA 4NJ6A 2L7RA 4Q2JA 3RNFC 3PRZA 4RM8A 3GZNB 3V05A 2FUG1 4USAA 3NVZA 2K9XA 1FEHA 1ZPSA 4OVUA 3C0RB 1RM6C 4H2AA 3HRDD 4EE2A 3T3OA 1T5XD 1DOYA 3VRAB 4GDLB 5L83A 5D94A 2A5UA 4MM3A 3DVNU 1TS2A 1YMHE 2MEKA 3WIMA 1S1QB 2KVRA 2WXOA 2L3ZA 3BZDB 2J52A 1TJEA 2MCNB 1JCKB 1TS4A 2BPSA 3AE8B 3ENEA 3ETRA 4AOFA 3O65B 3GZNI 1MHXA 4P6VF 3RNCC 2N9PC 1F1HA 2MBOA 1C79A 3APDA 5JXVA 1I42A 5GMVA 4RGTA 1R7SA 3T9LA 1XLQA 2DZMA 2OHFA 2Y5BB 2JWZA 1KF6B 5E6OA 3PS6A 4XGAB 1D5MC 1NEKB 2HTME 5JHAA 2D2QA 2AL3A 2LVPA 1OFFA 4LDTD 5CTRC 2VH2A 5C23A 2ZPYA 3OAWA 4DQOC 3N3KB 4DBGA 3ZUNA 1IBXA 4HJKA 3AE1B 4OVVA 5IOIA 4HPLB 2TSSA 2MP2B 3PRPB 5DCNA 2K6QA 1J7CA 4C00A 2D3AA 3M63B 4PS8A 3ZNHB 1T0SC 4CO7A 1A70A 1VZ8A 3BVMA 2BGFA 3DVGY 1KLUD 3PRMB 3U4EG 3NS1A 1JRPA 2KQ7A 4TSSA 4M8NA 2IGDA 4EZJA 3QCAA 2M8SA 3BIID 2MBEA 1WRDB 3LDZE 3O13A 2K3UA 2KMCA 2Z59B 2KOXA 3U30A 1K50A 2WU2B 5CHFA 5H8YE 4GSWA 2NPTB 1UELA 1DYQA 2L05A 1C4PA 1SGHA 1I35A 4MH0E 2LXCA 3PZ7A 1TS3A 3H1UA 1AWDA 5BYQA 3DHHC 1OEYJ 3U52E 1VDVA 3AE6B 1EF1A 2FCMA 4GLSC 1JMLA 1HEZE 2BS3B 1HE8A 2Y5CA 2IBIB 3QAQA 4GDKA 1EU4A 1NVID 3KQ4A 2J0MA 4MJSA 1B9RA 1MG4A 4OVZA 2KLGA 3VUYA 3AEDB 1HTQA 1J19A 2L83A 2MJDA 2JRHA 2M56B 4C7ZA 3APCA 2QIEB 4DXFA 3R3MA 2C7HA 1P1AA 4DHZE 2N1VA 4MSQB 5EE0A 1PYWD 2REXA 4L23A 4F8CB 2J53A 1GG3A 4AJYB 1JALA 4RGMA 3DPDA 4ZHOA 1V5OA 2I1KA 5AUKA 2CHZA 3R7RA 1N60A 5I4DA 2RDGA 1LGRA 5H92C 3I5JC 3NVVA 2R61A 3VDZA 1UGMA 2CR5A 3SU8X 2JVCA 4GDLA 1XT9B 2GB1A 2KKCA 2MW5A 3AV8A 1DOIA 2WHIA 5EE3A 3CMMB 2FNJB 3ZKJC 1QZEA 2K0PA 2CU1A 1C4AA 2WLBA 3BVGA 1K8RB 1WIAA 2OJWA 2PIAA 1F9JA 2KHWB 4HWIB 4EFOA 1T0YA 4BVUC 3RZFA 1XLPA 2GBRA 4XZ4A 5G5HA 4FA6A 2LHDA 2WX1A 1QOBA 1WRIA 1FMAD 2V3PA 1KJTA 1MG8A 4IC7B 4FHJA 3ZNID 5EE9A 3DBHB 1D4BA 2JZPA 3C19A 4ITKA 3JW0X 3KWLA 5HKHA 2V1YA 2G4SA 5BMHA 4RGNA 2KLCA 4CHKA 1EWYC 2ICIA 3DDCB 1FIQA 3ZRCA 1QLBB 3AE7B 1WGRA 4DXAB 4LJOB 2I2YA 3PHWB 2MWSB 3GE8C 2IY1B 2IZVB 3WANA 2DX5B 1RFAA 2DZJA 2MP2A 1V2YA 4YSZB 1ZXHA 1WMHB 3IFWB 1CZPA 3DBHI 4CQNA 1EU3A 2BYEA 2GBNA 3B2GA 1GOZA 5IP4D 4FJZA 3IBEA 3BWUD 1E7PB 2EMTA 2K6DB 1GJZA 1P3QU 2RD0A 2PTLA 3ZQ4A 4M01A 2KWUB 3ZW3A 2ZEQA 2KNBA 5FKAC 2BYFA 1MI0A 4B95A 1YN3A 2WWZA 3NRZA 2MBHA 4ASWC 3A4RA 4WAFA 4M8MA 3PZDA 3R2IA 2PE6B 3V60A 2WU5B 2PVOD 3W1SC 4NZLB 1SSNA 1SE9A 2AWTA 1KRHA 3S2AA 3SFEB 5JHBA 2RPQA 4HKQA 4S0RA 2OEDA 4LCDE 1EF5A 4EUTA 3UQBA 4ZRQA 1PDXA 3SHQA 2BW2A 2YEPB 2L8JA 3A1QA 2JZZA 1F0ZA 2K25A 2WDTB 2WXLA 5E6NA 2MX2A 4HKZE 1R4NB 4J3OD 2KN4A 1YQBA 1VZ6A 2KT7A 3ECIA 3Q69A 2YEPF 1FXAA 2K22A 3RUIB 3AH7A 2PEAA 1IP9A 3HHMA 2L76A 3WAOA 3X23A 3QC8B 3CF6E 3ZXVA 4AS1A 2NBWB 3N1YC 3NOBA 2KWCA 2DENB 3L54A 2EELA 4W9DA 3W2DA 2NS5A 2MLBA 4F1SA 2LFIA 3R7QA 2W3SA 3GS2A 3RNAC 1TZ1A 2KVZA 4JE3B 3PSEB 1R4NI 2W82A 2IJ0A 2M4NA 4BOZB 2GMIC 1L7YA 1AYFA 2V4IB 3ZLZA 2XBBC 3DBRB 3V3XA 3R8BA 2WXNA 1PQSA 1EUVB 2XN9C 3P4SB 4W9LA 4LDTB 1RYJA 1J7AA 2KFJA 3ZTCA 5IAAC 3DHGC 1EO6A 1ET9A 2G9HD 5C3JB 2KC2A 3VR8B 3E9SA 2WXJA 5EDSA 3P1MA 4YTPB 4WWOA 2C7NB 2QC8A 3RYTA 3TIXA 3W1YA 3DBRI 4DDID 3B9JA 2KANA 2BKFA 2N7DA 4MEMA 2LZ6A 4GXBA 2C60A 1AW7A 2G45B 3Q8CA 3H9DA 3AXCA 2ON8A 4TKNA 3QARA 4WIPA 4J6IA 2RDBC 2LRWA 4A55A 3E56A 1WR6E 4B6WA 2ZZPB 2MBQA 2BBCA 2BVCA 4REZA 4HXDA 3W9CB 1I4GA 4XWWA 1YJJA 4ZYSA 2L1AA 2RR9A 3QQ8B 1SIFA 1ZGUB 3RI7C 1NI2A 3DQVA 1C76A 3DVGX 2WGSA 4YWGG 1I4QA 4K3CA 2V0GA 1RRBA 1S3SG 1CJEA 3EHVA 3FAHA 1MJDA 4BFRA 2LVQA 3VAWA 2M19A 2IDYA 4GOCA 2HTHA 5JH5C 3J9CA 4BKSA 1P0RA 2RSUA 3I9V1 5TSSA 4FBJB 4DHZB 3SR6A 2XK5B 5D7GA 1WGDA 5IKCM 2CS4A 3AU4A 4C56C 3LXFA 4LK0M 2RDHA 2N9LA 1SBBB 2LHEA 1UBIA 3VHTC 3AULA 2W54A 1SF0A 2PE9A 4C7YA 1FRDA 2I1JA 1N62A 1UD7A 4EZKA 4N6EB 1JWUD 5C2TB 4KKIA 2ZJDA 2M17A 2PMVA 2O2VA 4PYZA 4W9HA 2FBWB 2WXPA 1VZ7A 1GAQB 4HK2A 2D3GA 2R2OA 3QA8A 4RNAA 4WJOA 2B76B 5J2RA 1UGJA 1JWBD 3AMZA 2KWVB 1BMLC 1E5WA 3GB1A 1WX9A 2C7MB 1ROEA 1L6VA 2E6XA 1K52A 2LJIA 1WXMA 2QEJC 3SEBA 4I6LB 1OQQA 1WJ4A 4B0MA 2D3CA 4ZYNA 3VTUA 4PYUA 4YTNB 2J0JA 4W9JA 2LI5A 4JIOU 4RF0A 1L4DB 2IO2B 3AEFB 3HM6X 3BK1A 5LXHA 4W9KA 4OHJA 1V6EA 1UUPA 4GB9A 3NG0A 2JYEA 1XLOA 2WXIA 1ESFA 1KLVA 3UIPB 3W1SA 1E7UA 2IGHA 1FXTB 2WP9B 2DWQA 4DDGD 2G1EA 3Q8BA 3SDLC 1V1PA 3GP7A 3UIOB 1CK1A 3VTVA 5DPSA 3KYCD 4JWSC 5HI1A 3NZ3A 3TCAA 3ZDTA 3W5VB 2WDQB 3AEBB 4NQKE 1WZ0A 2KMMA 5CX3A 4EEWA 1VJKA 2HJ1A 2KAJA 2Y3AA 4IUMB 2ZVOA 1JW9D 3BYTB 3V6CB 1TTNA 3RNEC 4MELA 4AQ7A 2IYDB 1YJIA 2HJ8A 3ZJUA 3MHSD 2K8BA 1WSPA 1QOAA 2H89B 1J0GA 2WXKA 2N9KA 4II3B 2JSVX 1PGXA 1V97A 1YOVB 1EM7A 3DOWA 4ANVA 4G0NB 1YX5B 4JPSA 3RULA 4AJWA 1UF0A 2CU3A 4LNOA 3GOEA 3R66C 3UI3A 3PVLA 3URYA 1Z2MA 3A1QB 2BTEA 2INNE 1E7VA 2N7JA 1FNUA 4EZLA 2NBVB 3EC8A 3DHIC 1VCBA 2KDFB 2N9EB 4A20A 2ACZB 2JXXA 3V6EB 1WYGA 5FR3A 4HVBA 4TMAB 4IM3A 2BKRB 2WYQA 5D2MB 2GBMA 3DWGC 2ZW0A 2GLSA 3VXWA 2SEBD 3ZVVA 2WXFA 3NHEB 1MPEA 1WGYA 3Q8EA 2MH7A 3PLVA 4ARCA 4NNJB 2XK5A 2D07B 3VTWA 3WA0A 1D6EC 2D10A 4NQLB 4C4VB 4PK1A 3L0WB 1ENFA 1KFYB 3HUIA 3AEGB 4L1BA 2E3TA 3CSTA 4WJNA 3TL5A 3AM9A 3QWZB 5IA7A 2UWQA 1ZDXA 3L4PA 3JYUA 1YD8U 3JSVB 3LJ3A 1TKEA 4A6QA 3IHPC 3OWEB 1D5XC 3Q3MC 2JPHA 3KLSX 3AB5A 4FADA 5LXIB 3KUZA 2FCQA 2FAZA 4HEA1 2PKOA 3PZ8A 2LRUA 4IWQA 5HFYA 3U8ZA 2LGIA 4GMVA 4NY0A 4RH6A 5L95C 3MC0B 4G50A 4MDKE 5FK9C 4G11A 1SJED 2LGYA 2G4DB 3AE5B 4XWTA 2LVOA 4ZDVA 2BS4B 4TQ0A 4MSMB 1L0YB 1PUTA 2HDEA 4YXDB 2LGXA 3GE3C 2MSED 4DWFA 1ZXIA 4XE0A 1FCLA 1NI3A 5BYRA 3BY4B 3VR9B 2MA9B 3C8YA 2GRIA 2XNAC 3A9JB 3PLUA 1GPXA 1BXTA 1IGCA 5DPWA 3JVZX 1H8CA 3DVNV 2Q5WD 2LASA 1MFWA 4E3CA 3Q3NC 4FXCA 3P2BA 3TEZA 2LGDA 3IG3A 1IPGA 3VFKA 3I3TB 3Q8AA 2YLMA 1QT9A 1WWTA 4E71A 1HZ6A 3TBLD 2Z0DB 3QHTA 3APFA 2AQ2B 4E74A 1TYGB 4RF1A 2DZIA 1FNWA 1RAXA 4N9F4 3N32A 2BQQA 2KQSA 1SE4A 2ZCCA 2KO3A 4ICVA 3U7ZA 2O6VD 3MHZA 3WAPA 3W5UB 1ZUD2 1H4RA 3N1XC 1N63A 3UF8A 3EA6A 3AECB 3A4SC 4ACFA 1UNSA 3N30A 4S17A 1JWAD 3Q6BA 1FRRA 5G2NA 4MH8A 3ABVB 4JQWC 2K1FA 3VVWB 1T0QC 3ZDMC 3BVZA 3AEAB 2O2VB 1WXQA 4I6PA 1FM0D 1YQ3B 2KX3A 1T3QA 2AEHA 3DBSA 2KTFA 2MHJA 2VZKD 1WM2A 3KUCB 1ET6A 1LO5D 3AU5A 2J42A 2WDVB 4IW0A 2CHWA 4UDUC 2PVGC 3RPFC 2CJNA 1WZ3A 2BT6A 1XCTL 4HJGE 3VH4B 1PGBA 4HCPB 1HZ5A 4A3PA 3T3NA 1F2RC 1TKGA 2IO3B 1G6JA 3MC8A 3P42A 2J4XA 4O1NA 2ONQA 2W55A 4LNFA 2KJRA 3KW5B 1TGZB 2XEWA 4KSLC 3RMKC 4PS7A 1PGAA 3PGEA 3P4RB 3T8MA 3IVFA 1MHHE 4ZRPA 3BYYB 1T0RC 3H8HA 2VRRB 4IM0A 1OQYA 1UH6A 1C9FA 2WXGA 5DPRA 1JROA 3QIJA 2KJHB 3WAMA 2AQ3B 2WS3B 1YJ1A 1J7BA 3N9YC 1VR9A 3ML9A 4C4VA 4ANWA 4MACA 2LD9A 4XX5A 2LMCA 2M0AA 2GBJA 4NPNA 5EE1A 3OG5A 2UU7A 1UWMA 1V1PB 2IY0B 3I63C 1UZXB 2DAJA 4TUUA 3HIZA 3I57A 4MGKE 3JSVA 2MBBB 2OJRA 4KDIC 1WJ6A 4GGQA 3SD5A 2DYMA 3QX1A 4ZHPA 1D3ZA 1WXVA 1CQVA 1D5ZC 3ZGZA 5AZFA 1WR1A 2INDC 4X57B 4XYCA 1C77A 4IKGA 2L00B 1Y56A 2WX0A 4JGHB 1YX6B 1C78A 4ARIA 1YN5A 1M4VA 4KSKC 3KWVA 3RN9C 3TUOA 2FIFA 1JWSD 1F2RI 4BZAA 1DOXA 2NTTA 3NS8A 3PT2B 3MJWA 2IO1B 2RMMA 5IO9A 1TZOA 4I6NB 1VD2A 2CJOA 3U7DA 1RFKA 5J18A 1V80A 1HTOA 1WGKA 1GB1A 3HM3A 3A9JA 2KFKA 2K5PA 1V8CA 1WE7A 2JT4B 1SE2A 4IWPA 1BT0A 1P98A 2K8CA 4KGSA 2DBYA 4FULA 5BMIA 1Q10A 1VRAB 3H7SA 3IT4B 3TMPB 4MGYE 2AYOB 1TKYA 3V61A 1OTRB 2N9XA 2KWDA 3BK2A 2KC1A 2QHOA 3N1ZC 2JU6X 4WH4A 4PS3A 1L6UA 2NBUA 2LUEA 5D3IB 3Q3OC 2L52A 2MQJA 1OGWA 5CHWA 1SIJA 1L0VB 1CMXB 1XQQA 2V3NA 4K81A 1L2NA 4JWUC 1WXSA 5D6JB 3M95A 2H88B 1TY2A 4FJYA 1ZKHA 3CIRB 4A3OA 5GXGB 3FC4A 1E9MA 4PT5A 1LXDA 4XDDA 3ZYYX 1PFDA 4RCOA 3H7PB 4FLHA 2KACA 2YVCA 2V4LA 2BF8B 2KDIA 2FIDA 1XCQL 2X8XX 2KXJA 4N58A 2D5GA 3V62A 4OZAA 3UINB 5AUIA 2Z0EB 3MTNB 2V9HA 3DBLB 2J7QB 2MRPA 1SEBD 3A9KB 1I4XA 2JXTA 1I4RA 3VUWA 2UYZB 1E6EB 4BBNC 4FHKA 4B9KA 4KGTA 1QILA 3L17A 3ZNZB 2PW9A 3HVZA 1QF6A 4ANXA 2AL6A 3AE2B 4TQ1A 2Y5PA 2C9WB 4US8A 3R2TA 1TBEA 1NBFC 4AWJA 1WJNA 3DBLI 3ML8A 3RNBC 3MFGA 1WFYA 3M62B 1BUIC 1FNVA 2V3SA 2DYBA 3B1LX 4CYEA 1GUAB 4WWMA 3Q2AC 3DWMA 1N6ZA 1NDDA 1ZOYB 3RNGC 4LNIA 4LTUA 2W3RA 1ISNA 1HXYD 1SJHD 4KKJA 1V86A 2FCSA 4DHJD 3K9PB 2LEKA 3Q8FA 1KM7A 4MGIE 1U4AA 1XO3A 1P9DU 2R2QA 3X0WA 1X1MA 2BWES 4A9AA 1QQRA 2FUHB 2HD5B 4BBNF 1WE6A 1V49A 4HROA 4L2YA 4K7UA 4GIVA 1V5TA 2K39A 2DHZA 1V81A 4W9IA 1A5RA 1AN8A 3RCZA 3OJ3A 2KX0A 2N1WA 1B1ZA 1XF5L 1KOTA 4MGZE 2QDFA 4P16A 1XD3B 4NJ7A 4LNKA 3L13A 3P63A 4ZRJA 1V9JA 2N4FA 4GN1A 1ZDVA 2KTRB 4HCNB 2EMSA 1ACCA 2O6VB 3WALA 5BO4B 2QILA 1VLBA 2BWFA 2DAFA 2ZW1A 5MPOA 1WJUA 1MVKA 3RFZB 1YNTE 4QAYA 4YSYB 3U2SC 1Q1OA 4HDQA 1HA5A 2EKEC 3QK0A 3H6NA 1HQRD 3PV1A 2MJ3A 1EWCA 1FCCC 1YN4A 3AI5A 1F77A 5IN7A 2KN5A 2L0TA 2ZPNA 4M00A 5KHOA 1XLNA 2VZKB 2GOWA 3AE9B 2NMQA 4WQMA 2JQRB 4NAMA 1WY8A 4NAWB 4IM2A 4N59A 2ZCBA 1QKZA 5LLIA 1LFDA 4EKUA 2ZNVC 3EFUA 1N5XA 3Q14C 1P7EA 5AEKB 2WXQA 2CKHB 4OW0A 1WI0A 2C5LC 2KDBA 4B0EA 2NVUI 3TEYA 3ZJVA 1UBQA 3EECA 3DCGA 5JZEB 3H7PA 3KH0A 3B2FA 2K8HA 2IO0B 5T8IA 2INPE 1ZP0B 4EOYA 1STEA 2IPKD 3IAS1 2BS2B 1IYFA 4KDLB 2LGSA 4KVGB 2INCC 2RGFA 4IOIE 1QOGA 2J0KA 3EFCA 2L0FA 1GC7A 4BKTA 3EUB2 1LQBA 3FILB 3K9OB 1E8ZA 3ZO5B 3A9KA 1NYRA 3PREA 2KJ6A 4BKGA 1E10A 4JL9A 4P1CC 1TT5B 3UQAA 4HPMB 4ZOHC 1YQ4B 1WGHA 2JZ3B 3RT3B 3TEWA 1N61A 1NENB 4G3XB 2RPVA 1JRUA 3AE3B 2SAKA 2ZNVB 2LXAA 4WURA 3ZTDA 3NZUA 1L0XB 1E8WA 3L10B 2JWUA 4AP4C 2BB6A 1FPYA 2EKIA 3PHXB 1LM8B 2ASQA 2DYOA 5DPTA 1RWSA 2X38A 2Z8LA 4ZRKA 2KFKB 2GBKA 3KVFB 3IAM1 2N0SB 1K53A 4YT0B 3KYDD 4M0WB 4OZCA 4FN2A 1ZE3D 1M94A 3PTFC 1GB4A 3LB8C 4DK5A 2JX5A 1OEYA 2QJLA 1L4ZB 2NTSA 3B0AA 3TEXA 3NVYA 1N5WA 2G3QB 1P7FA 3AE4B 2DLBA 4W9FA 2W9NA 2B3AA 4HPPA 3SFDB 1GC6A 3IXSA 2KYWA 1K51A 3N20C 4ICUA 5AZGA 1L5PA 2KDMA 3EGRA 4K1RB 1TY0A 4IG7B 5TR5A 1ZW7A 3TJPA 3L08A 2WXHA 4RFBA 4M02A 4R3DA 4GU2A 2L32A 4YSXB 1E8YA 4YL8A 1JWMD 1I7HA 1KH0A 1E0ZA 1SXTA 3LYYA 1IGDA 4KIKB 1XXGA 4XDCA 2JRIB 2M1MA 4F7ZA 1WX8A 3NVWA 1C3TA 2KQ4X 2BYTA 3NZSA 3D32A 2KDEB 3CWIA 2JY6A 3VUXA 1Q0WB 1WXAA 2KK8A 1KTKA 2PPHA 5KHQA 2WXRA 2D3BA 2KTRA 4ZRIA 2JYTA 4URKA 1FXIA 4A8XC 2O6VA 4OZBA 2NPTA 4II2B 2M0XA 2AQ1B 2CHXA 1UWXA 2LUMA 1JQ4A 5BMGA 3VH3B 4IWOA 4LNNA 4P7IA 2BB5A 1V1OA 3ZIMA 4W9EA 4MM3B 2MJEA 3OJ4B 2WQYB 4XC2A 5C1ZA 4YTMB 3WCQA 1DGJA 4KZCA 3L16A 4NJCA 4LJPB 2VH1A 3A33B 1FFUA 2NCNA 1F52A 4MT5A 2BYVE 4WJPA 4K7SA 2FCNA 3AEEB 1NYQA 1T6BX 4NAWA 1WGGA 2IGGA 3IT6B 1R4MB 4K7WA 4W9CA 3M3JA 4BOSC 2QCZA 4KGRA 1FFVA 2QMTA 2NR2A 2LWPA 3UGBB 3ZJTA 4KV2A 1IBXB 3ZXRA 2ZVNA 1WH3A 1Y8RC 3TSSA 3AN1A 2WNMA 5E6PA 2KD0A 3B08A 5E6JA 1C1YB 3VRBB 3P4PB 5FR6A 1TIFA 4DXGA 3FILA 1R4MI 1AARA 4C80A 4BAXA 4DHJB 3KUDB 1KLGD 1TS5A 3RD2A 3MC9A 3NY5A 4ANUA 4TV3A 4JLCA 2D11A 2N7EA 2LJ5A 5HHDG 2KZRA 1E90A 3BINA 2KMAA 4HRSA 4RGOS 2AX5A 3NJTA 4D2KA 4A90A 4JX1C 4P1BC 2A4ZA 1WYWB 1OQRA 1FO4A 3MJ5A 4WWNA 1WX7A 2FE8A 1XEEA 3PPAA 3PO0A 2DZKA 4RMAA 2DNFA 3ZNGC 4KX6B 4RM9A 4LLGM 4M0WA 2JF5A 4HDOA 3FKYA 1I4PA 5CHVC 4AUQC 1SB3C 2QSDA 4WJQA 4BKSD 4W9GA 3RZWC 1GNUA 2WXMA 2GI9A 4WAAA 1FD6A 1Z5SB 4WQOB 4GDKB 3ZRFA 2PJHA 3Q3FA 4KZ0A 1IUEA 3HVDA 5BYSA 3MP9A 3HK0A 4IDIA 4MJSB 4FJVB 2I38A 5AZHA 3CSFA 3ALBA 3VQIA 5HG2A 3ONSA 5D3DA 3OLMD 1QOFA 1RLFA 1YIWA 2HE7A 5G5GA 5G55A 4WWPA 5LNK1 1SE3A 1E8XA 1WMHA 1Q5WB 1WF9A 1WM3A 4K3BA 5J17A 3QJZA 4KIKA 3Q3JA
chains in the Genus database with same CATH topology
4ZRJA 2NBWB 2OOBB 3NOBA 2KWCA 1V9JA 2N4FA 2DENB 4GN1A 3L54A 3BY4B 2KTRB 4W9DA 4HCNB 2MA9B 2EMSA 2NS5A 2MLBA 4F1SA 1J8CA 3A9JB 3PLUA 4HLEA 2O6VB 5DPWA 3WALA 2JUOA 3JVZX 4NJ6A 5BO4B 3R7QA 2L7RA 1H8CA 3DVNV 2BWFA 2DAFA 1TZ1A 2LASA 3PRZA 4RM8A 1WJUA 4E3CA 3PSEB 3P2BA 1R4NI 2LGDA 1Q1OA 2M4NA 4HDQA 4BOZB 2GMIC 1L7YA 2EKEC 3IG3A 4OVUA 3C0RB 3ZLZA 3QK0A 2XBBC 1IPGA 3H6NA 3VFKA 3PV1A 1PQSA 3I3TB 1EUVB 2YLMA 3AI5A 4GDLB 4E71A 5L83A 3TBLD 5D94A 2Z0DB 3QHTA 3APFA 2A5UA 2KN5A 2L0TA 4LDTB 4MM3A 4W9LA 2ZPNA 4E74A 3DVNU 2DZIA 5KHOA 3WIMA 2KFJA 3ZTCA 1RAXA 5IAAC 1S1QB 2KVRA 2GOWA 3N32A 2L3ZA 2KQSA 1EO6A 4N9F4 2ZCCA 2KO3A 2KC2A 4ICVA 2MCNB 1WY8A 5EDSA 3ENEA 2BPSA 2O6VD 4AOFA 3O65B 4WWOA 3GZNI 3WAPA 4NAWB 4IM2A 2C7NB 1H4RA 2N9PC 3RYTA 2MBOA 2ZCBA 3UF8A 3APDA 3A4SC 5LLIA 3TIXA 1LFDA 1I42A 4EKUA 2ZNVC 3EFUA 3W1YA 3DBRI 5GMVA 4DDID 3N30A 5AEKB 2KANA 2CKHB 2BKFA 3T9LA 2N7DA 1WI0A 2C5LC 2DZMA 2KDBA 4MEMA 5G2NA 2LZ6A 4GXBA 2C60A 2NVUI 2Y5BB 1UBQA 2JWZA 2G45B 4JQWC 3EECA 3H9DA 2K1FA 3DCGA 3VVWB 5E6OA 3PS6A 3AXCA 4TKNA 5JZEB 3QARA 3ZDMC 4J6IA 3H7PA 2O2VB 3KH0A 2LRWA 2D2QA 2AL3A 2K8HA 2LVPA 2IO0B 1WR6E 4I6PA 4B6WA 2ZZPB 2KX3A 5CTRC 4LDTD 2MBQA 4EOYA 2AEHA 1IYFA 4HXDA 3DBSA 4KDLB 5C23A 2KTFA 4KVGB 1WM2A 2ZPYA 3OAWA 2RGFA 3KUCB 2J0KA 2L0FA 3N3KB 1GC7A 2RR9A 4DBGA 3AU5A 3QQ8B 3ZUNA 4BKTA 1SIFA 4IW0A 1ZGUB 1NI2A 4HJKA 2CHWA 4OVVA 1LQBA 3K9OB 4HPLB 1E8ZA 1WZ3A 3ZO5B 3A9KA 3DQVA 3DVGX 3PREA 2MP2B 2KJ6A 3PRPB 4BKGA 5DCNA 3VH4B 4JL9A 4HCPB 2K6QA 4A3PA 3UQAA 4HPMB 3M63B 4PS8A 3ZNHB 2IO3B 1RRBA 1WGHA 1S3SG 2JZ3B 3RT3B 1G6JA 4CO7A 3EHVA 4G3XB 2BGFA 1JRUA 3DVGY 4BFRA 3PRMB 2LVQA 2KJRA 3KW5B 2ZNVB 3VAWA 2LXAA 4GOCA 1TGZB 2HTHA 2XEWA 4KSLC 4BKSA 5JH5C 1P0RA 2RSUA 2KQ7A 4PS7A 3ZTDA 3NZUA 4FBJB 3PGEA 4M8NA 1E8WA 3T8MA 3L10B 4EZJA 3IVFA 3QCAA 2M8SA 4AP4C 4DHZB 2XK5B 5D7GA 1WGDA 3PHXB 1LM8B 2CS4A 3AU4A 2MBEA 2ASQA 2DYOA 2VRRB 1WRDB 3LDZE 1OQYA 1UH6A 4IM0A 5DPTA 5DPRA 2KMCA 2Z59B 2KOXA 3U30A 4ZRKA 5CHFA 4GSWA 2KFKB 3QIJA 2GBKA 3KVFB 2KJHB 3WAMA 1UBIA 3VHTC 2NPTB 3KYDD 1UELA 1YJ1A 4M0WB 4FN2A 3AULA 1M94A 2L05A 3ML9A 3PTFC 4ANWA 2LD9A 2PE9A 5JHAA 4DK5A 2I1JA 4XX5A 1UD7A 1SGHA 4EZKA 1OEYA 1I35A 2GBJA 4NPNA 4MH0E 2LXCA 3B0AA 3H1UA 2G3QB 2IY0B 2ZJDA 1OEYJ 1UZXB 2DAJA 1EF1A 2M17A 2W9NA 4TUUA 3HIZA 4W9FA 2O2VA 2B3AA 4MGKE 4PYZA 3JSVA 1GC6A 4W9HA 2FCMA 4HK2A 4ICUA 2D3GA 1HE8A 2R2OA 3QA8A 2MBBB 2OJRA 4KDIC 4WJOA 5AZGA 1WJ6A 2IBIB 3QAQA 4GGQA 4GDKA 4K1RB 3SD5A 2DYMA 4DWFA 5J2RA 3QX1A 1D3ZA 4IG7B 5TR5A 1WXVA 1ZW7A 2KWVB 3L08A 3TJPA 2J0MA 4MJSA 5AZFA 1WR1A 1E5WA 1WX9A 4GU2A 4X57B 2C7MB 2L00B 1E8YA 4YL8A 2WX0A 4JGHB 2KLGA 3VUYA 1YX6B 1WXMA 1J19A 4KIKB 2JRHA 4I6LB 4KSKC 1WJ4A 2FIFA 2JRIB 2M1MA 4F7ZA 3APCA 4ZYNA 1WX8A 3VTUA 1C3TA 4PYUA 3NZSA 3R3MA 3D32A 3NS8A 2J0JA 2C7HA 2KDEB 3PT2B 2JY6A 1P1AA 4W9JA 2LI5A 4JIOU 3MJWA 3VUXA 4DHZE 2IO1B 1Q0WB 1WXAA 2IO2B 2N1VA 4MSQB 2KK8A 2PPHA 2REXA 5KHQA 3HM6X 5LXHA 4I6NB 4W9KA 1VD2A 4F8CB 3U7DA 1GG3A 1V6EA 2KTRA 4GB9A 4ZRIA 4AJYB 4URKA 5J18A 1V80A 3HM3A 3A9JA 2KFKA 2O6VA 3DPDA 2NPTA 4II2B 2M0XA 1WE7A 1KLVA 2JT4B 1V5OA 2CHXA 2I1KA 4IWPA 3UIPB 3W1SA 1BT0A 1P98A 2K8CA 2CHZA 3VH3B 4IWOA 3R7RA 4P7IA 1E7UA 4FULA 1FXTB 3H7SA 3ZIMA 4W9EA 3TMPB 4MGYE 2AYOB 3V61A 3OJ4B 1OTRB 2N9XA 4DDGD 3SDLC 2KC1A 2QHOA 4XC2A 5C1ZA 3VDZA 1UGMA 3UIOB 2CR5A 4PS3A 3SU8X 2JVCA 2NBUA 2LUEA 4GDLA 4KZCA 3VTVA 3L16A 1XT9B 2MW5A 2KKCA 5DPSA 3KYCD 2MQJA 4LJPB 1OGWA 5CHWA 1CMXB 1XQQA 3A33B 3TCAA 3ZDTA 2NCNA 2FNJB 3CMMB 3ZKJC 4K81A 1QZEA 2CU1A 4NQKE 1WZ0A 2BYVE 3QC8B 5CX3A 1L2NA 1K8RB 4WJPA 1WXSA 4K7SA 5D6JB 4EEWA 1WIAA 1F9JA 3M95A 4FJYA 2KHWB 4HWIB 1ZKHA 2FCNA 4IUMB 4A3OA 1T0YA 2ZVOA 4BVUC 4NAWA 3RZFA 4EFOA 3V6CB 1WGGA 1TTNA 2GBRA 4MELA 4XZ4A 1LXDA 4K7WA 4FA6A 2IYDB 2WX1A 4W9CA 3H7PB 3M3JA 2HJ8A 4FLHA 2YVCA 2V4LA 3MHSD 4BOSC 2K8BA 1MG8A 1KJTA 2BF8B 4FHJA 4IC7B 2KDIA 3ZNID 2NR2A 2LWPA 2FIDA 1J0GA 3UGBB 4II3B 2KXJA 4KV2A 3V62A 3JW0X 3UINB 2Z0EB 3MTNB 3DOWA 4ANVA 4G0NB 5HKHA 2J7QB 2G4SA 2V1YA 2MRPA 1YX5B 2ZVNA 1WH3A 1Y8RC 3A9KB 3RULA 4AJWA 2KLCA 4CHKA 3GOEA 3R66C 3PVLA 2KD0A 5E6PA 3DDCB 3ZRCA 1Z2MA 3VUWA 3A1QB 2UYZB 3B08A 1WGRA 1C1YB 1E7VA 4BBNC 4DXAB 4LJOB 4FHKA 5FR6A 4B9KA 3PHWB 4EZLA 2NBVB 3EC8A 2MWSB 1R4MI 1AARA 3L17A 3ZNZB 1VCBA 2KDFB 2N9EB 2IY1B 2IZVB 3WANA 2DX5B 3KUDB 1RFAA 2DZJA 2MP2A 4A20A 1V2YA 4DHJB 2JXXA 3RD2A 3V6EB 4ANXA 1WMHB 3IFWB 3NY5A 3DBHI 4ANUA 4TV3A 4HVBA 2AL6A 4IM3A 4TQ1A 2BKRB 4JLCA 2D11A 2WYQA 5D2MB 2C9WB 2N7EA 2LJ5A 2KZRA 1TBEA 1E90A 2GBMA 3BINA 3VXWA 2KMAA 2BYEA 2GBNA 3ZVVA 1NBFC 4AWJA 1WJNA 3NHEB 3DBLI 1WGYA 3ML8A 4FJZA 3IBEA 1WFYA 2EMTA 2K6DB 2A4ZA 1WYWB 3PLVA 1GJZA 3M62B 1P3QU 4NNJB 2XK5A 2D07B 2RD0A 3VTWA 4WWNA 1WX7A 3WA0A 2KWUB 2D10A 4NQLB 3PPAA 3ZW3A 3L0WB 2V3SA 2ZEQA 2DYBA 2KNBA 3B1LX 4CYEA 1GUAB 2DZKA 4RMAA 2BYFA 3ZNGC 4B95A 4RM9A 3CSTA 1NDDA 4WJNA 3TL5A 2WWZA 2JF5A 2MBHA 4HDOA 5CHVC 4ASWC 1ISNA 4AUQC 3QWZB 3A4RA 5IA7A 2UWQA 1V86A 2FCSA 4M8MA 3K9PB 3JYUA 1YD8U 3PZDA 4DHJD 4WJQA 4BKSD 3JSVB 4W9GA 1KM7A 1GNUA 3LJ3A 4MGIE 3RZWC 2PE6B 3CF6E 1U4AA 3IHPC 1P9DU 3V60A 4WAAA 1Z5SB 2R2QA 3X0WA 1X1MA 4WQOB 2JPHA 2BWES 5LXIB 4FADA 2FUHB 3KUZA 3W1SC 4GDKB 2HD5B 1SE9A 3ZRFA 2PJHA 4BBNF 1WE6A 2AWTA 3Q3FA 1V49A 2FAZA 2FCQA 4KZ0A 3S2AA 5JHBA 4K7UA 2RPQA 4GIVA 3HK0A 1V5TA 4MJSB 2K39A 4LCDE 4FJVB 1EF5A 2LRUA 4IWQA 5AZHA 4EUTA 3UQBA 2DHZA 3CSFA 3ALBA 1V81A 4W9IA 3SHQA 3U8ZA 3VQIA 1A5RA 3ONSA 2L8JA 3A1QA 3RCZA 2JZZA 2K25A 3OJ3A 2WDTB 3OLMD 2KX0A 2N1WA 4GMVA 4NY0A 5E6NA 1RLFA 2MX2A 5L95C 4G50A 4MDKE 1YIWA 2HE7A 1YQBA 4G11A 3ECIA 1KOTA 5G55A 4WWPA 4MGZE 2LGYA 2G4DB 3RUIB 2LVOA 1XD3B 4ZDVA 1E8XA 2PEAA 1WMHA 4NJ7A 1IP9A 4TQ0A 1Q5WB 3HHMA 1WF9A 1WM3A 2L76A 3L13A 4MSMB 3WAOA 3X23A 5J17A 3QJZA 2LGXA 2MSED 4KIKA 3Q3JA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4ZRJ A;  2NBW B;  2OOB B;  3NOB A;  2KWC A;  1V9J A;  2N4F A;  2DEN B;  4GN1 A;  3L54 A;  3BY4 B;  2KTR B;  4W9D A;  4HCN B;  2MA9 B;  2EMS A;  2NS5 A;  2MLB A;  4F1S A;  1J8C A;  3A9J B;  3PLU A;  4HLE A;  2O6V B;  5DPW A;  3WAL A;  2JUO A;  3JVZ X;  4NJ6 A;  5BO4 B;  3R7Q A;  2L7R A;  1H8C A;  3DVN V;  2BWF A;  2DAF A;  1TZ1 A;  2LAS A;  3PRZ A;  4RM8 A;  1WJU A;  4E3C A;  3PSE B;  3P2B A;  1R4N I;  2LGD A;  1Q1O A;  2M4N A;  4HDQ A;  4BOZ B;  2GMI C;  1L7Y A;  2EKE C;  3IG3 A;  4OVU A;  3C0R B;  3ZLZ A;  3QK0 A;  2XBB C;  1IPG A;  3H6N A;  3VFK A;  3PV1 A;  1PQS A;  3I3T B;  1EUV B;  2YLM A;  3AI5 A;  4GDL B;  4E71 A;  5L83 A;  3TBL D;  5D94 A;  2Z0D B;  3QHT A;  3APF A;  2A5U A;  2KN5 A;  2L0T A;  4LDT B;  4MM3 A;  4W9L A;  2ZPN A;  4E74 A;  3DVN U;  2DZI A;  5KHO A;  3WIM A;  2KFJ A;  3ZTC A;  1RAX A;  5IAA C;  1S1Q B;  2KVR A;  2GOW A;  3N32 A;  2L3Z A;  2KQS A;  1EO6 A;  4N9F 4;  2ZCC A;  2KO3 A;  2KC2 A;  4ICV A;  2MCN B;  1WY8 A;  5EDS A;  3ENE A;  2BPS A;  2O6V D;  4AOF A;  3O65 B;  4WWO A;  3GZN I;  3WAP A;  4NAW B;  4IM2 A;  2C7N B;  1H4R A;  2N9P C;  3RYT A;  2MBO A;  2ZCB A;  3UF8 A;  3APD A;  3A4S C;  5LLI A;  3TIX A;  1LFD A;  1I42 A;  4EKU A;  2ZNV C;  3EFU A;  3W1Y A;  3DBR I;  5GMV A;  4DDI D;  3N30 A;  5AEK B;  2KAN A;  2CKH B;  2BKF A;  3T9L A;  2N7D A;  1WI0 A;  2C5L C;  2DZM A;  2KDB A;  4MEM A;  5G2N A;  2LZ6 A;  4GXB A;  2C60 A;  2NVU I;  2Y5B B;  1UBQ A;  2JWZ A;  2G45 B;  4JQW C;  3EEC A;  3H9D A;  2K1F A;  3DCG A;  3VVW B;  5E6O A;  3PS6 A;  3AXC A;  4TKN A;  5JZE B;  3QAR A;  3ZDM C;  4J6I A;  3H7P A;  2O2V B;  3KH0 A;  2LRW A;  2D2Q A;  2AL3 A;  2K8H A;  2LVP A;  2IO0 B;  1WR6 E;  4I6P A;  4B6W A;  2ZZP B;  2KX3 A;  5CTR C;  4LDT D;  2MBQ A;  4EOY A;  2AEH A;  1IYF A;  4HXD A;  3DBS A;  4KDL B;  5C23 A;  2KTF A;  4KVG B;  1WM2 A;  2ZPY A;  3OAW A;  2RGF A;  3KUC B;  2J0K A;  2L0F A;  3N3K B;  1GC7 A;  2RR9 A;  4DBG A;  3AU5 A;  3QQ8 B;  3ZUN A;  4BKT A;  1SIF A;  4IW0 A;  1ZGU B;  1NI2 A;  4HJK A;  2CHW A;  4OVV A;  1LQB A;  3K9O B;  4HPL B;  1E8Z A;  1WZ3 A;  3ZO5 B;  3A9K A;  3DQV A;  3DVG X;  3PRE A;  2MP2 B;  2KJ6 A;  3PRP B;  4BKG A;  5DCN A;  3VH4 B;  4JL9 A;  4HCP B;  2K6Q A;  4A3P A;  3UQA A;  4HPM B;  3M63 B;  4PS8 A;  3ZNH B;  2IO3 B;  1RRB A;  1WGH A;  1S3S G;  2JZ3 B;  3RT3 B;  1G6J A;  4CO7 A;  3EHV A;  4G3X B;  2BGF A;  1JRU A;  3DVG Y;  4BFR A;  3PRM B;  2LVQ A;  2KJR A;  3KW5 B;  2ZNV B;  3VAW A;  2LXA A;  4GOC A;  1TGZ B;  2HTH A;  2XEW A;  4KSL C;  4BKS A;  5JH5 C;  1P0R A;  2RSU A;  2KQ7 A;  4PS7 A;  3ZTD A;  3NZU A;  4FBJ B;  3PGE A;  4M8N A;  1E8W A;  3T8M A;  3L10 B;  4EZJ A;  3IVF A;  3QCA A;  2M8S A;  4AP4 C;  4DHZ B;  2XK5 B;  5D7G A;  1WGD A;  3PHX B;  1LM8 B;  2CS4 A;  3AU4 A;  2MBE A;  2ASQ A;  2DYO A;  2VRR B;  1WRD B;  3LDZ E;  1OQY A;  1UH6 A;  4IM0 A;  5DPT A;  5DPR A;  2KMC A;  2Z59 B;  2KOX A;  3U30 A;  4ZRK A;  5CHF A;  4GSW A;  2KFK B;  3QIJ A;  2GBK A;  3KVF B;  2KJH B;  3WAM A;  1UBI A;  3VHT C;  2NPT B;  3KYD D;  1UEL A;  1YJ1 A;  4M0W B;  4FN2 A;  3AUL A;  1M94 A;  2L05 A;  3ML9 A;  3PTF C;  4ANW A;  2LD9 A;  2PE9 A;  5JHA A;  4DK5 A;  2I1J A;  4XX5 A;  1UD7 A;  1SGH A;  4EZK A;  1OEY A;  1I35 A;  2GBJ A;  4NPN A;  4MH0 E;  2LXC A;  3B0A A;  3H1U A;  2G3Q B;  2IY0 B;  2ZJD A;  1OEY J;  1UZX B;  2DAJ A;  1EF1 A;  2M17 A;  2W9N A;  4TUU A;  3HIZ A;  4W9F A;  2O2V A;  2B3A A;  4MGK E;  4PYZ A;  3JSV A;  1GC6 A;  4W9H A;  2FCM A;  4HK2 A;  4ICU A;  2D3G A;  1HE8 A;  2R2O A;  3QA8 A;  2MBB B;  2OJR A;  4KDI C;  4WJO A;  5AZG A;  1WJ6 A;  2IBI B;  3QAQ A;  4GGQ A;  4GDK A;  4K1R B;  3SD5 A;  2DYM A;  4DWF A;  5J2R A;  3QX1 A;  1D3Z A;  4IG7 B;  5TR5 A;  1WXV A;  1ZW7 A;  2KWV B;  3L08 A;  3TJP A;  2J0M A;  4MJS A;  5AZF A;  1WR1 A;  1E5W A;  1WX9 A;  4GU2 A;  4X57 B;  2C7M B;  2L00 B;  1E8Y A;  4YL8 A;  2WX0 A;  4JGH B;  2KLG A;  3VUY A;  1YX6 B;  1WXM A;  1J19 A;  4KIK B;  2JRH A;  4I6L B;  4KSK C;  1WJ4 A;  2FIF A;  2JRI B;  2M1M A;  4F7Z A;  3APC A;  4ZYN A;  1WX8 A;  3VTU A;  1C3T A;  4PYU A;  3NZS A;  3R3M A;  3D32 A;  3NS8 A;  2J0J A;  2C7H A;  2KDE B;  3PT2 B;  2JY6 A;  1P1A A;  4W9J A;  2LI5 A;  4JIO U;  3MJW A;  3VUX A;  4DHZ E;  2IO1 B;  1Q0W B;  1WXA A;  2IO2 B;  2N1V A;  4MSQ B;  2KK8 A;  2PPH A;  2REX A;  5KHQ A;  3HM6 X;  5LXH A;  4I6N B;  4W9K A;  1VD2 A;  4F8C B;  3U7D A;  1GG3 A;  1V6E A;  2KTR A;  4GB9 A;  4ZRI A;  4AJY B;  4URK A;  5J18 A;  1V80 A;  3HM3 A;  3A9J A;  2KFK A;  2O6V A;  3DPD A;  2NPT A;  4II2 B;  2M0X A;  1WE7 A;  1KLV A;  2JT4 B;  1V5O A;  2CHX A;  2I1K A;  4IWP A;  3UIP B;  3W1S A;  1BT0 A;  1P98 A;  2K8C A;  2CHZ A;  3VH3 B;  4IWO A;  3R7R A;  4P7I A;  1E7U A;  4FUL A;  1FXT B;  3H7S A;  3ZIM A;  4W9E A;  3TMP B;  4MGY E;  2AYO B;  3V61 A;  3OJ4 B;  1OTR B;  2N9X A;  4DDG D;  3SDL C;  2KC1 A;  2QHO A;  4XC2 A;  5C1Z A;  3VDZ A;  1UGM A;  3UIO B;  2CR5 A;  4PS3 A;  3SU8 X;  2JVC A;  2NBU A;  2LUE A;  4GDL A;  4KZC A;  3VTV A;  3L16 A;  1XT9 B;  2MW5 A;  2KKC A;  5DPS A;  3KYC D;  2MQJ A;  4LJP B;  1OGW A;  5CHW A;  1CMX B;  1XQQ A;  3A33 B;  3TCA A;  3ZDT A;  2NCN A;  2FNJ B;  3CMM B;  3ZKJ C;  4K81 A;  1QZE A;  2CU1 A;  4NQK E;  1WZ0 A;  2BYV E;  3QC8 B;  5CX3 A;  1L2N A;  1K8R B;  4WJP A;  1WXS A;  4K7S A;  5D6J B;  4EEW A;  1WIA A;  1F9J A;  3M95 A;  4FJY A;  2KHW B;  4HWI B;  1ZKH A;  2FCN A;  4IUM B;  4A3O A;  1T0Y A;  2ZVO A;  4BVU C;  4NAW A;  3RZF A;  4EFO A;  3V6C B;  1WGG A;  1TTN A;  2GBR A;  4MEL A;  4XZ4 A;  1LXD A;  4K7W A;  4FA6 A;  2IYD B;  2WX1 A;  4W9C A;  3H7P B;  3M3J A;  2HJ8 A;  4FLH A;  2YVC A;  2V4L A;  3MHS D;  4BOS C;  2K8B A;  1MG8 A;  1KJT A;  2BF8 B;  4FHJ A;  4IC7 B;  2KDI A;  3ZNI D;  2NR2 A;  2LWP A;  2FID A;  1J0G A;  3UGB B;  4II3 B;  2KXJ A;  4KV2 A;  3V62 A;  3JW0 X;  3UIN B;  2Z0E B;  3MTN B;  3DOW A;  4ANV A;  4G0N B;  5HKH A;  2J7Q B;  2G4S A;  2V1Y A;  2MRP A;  1YX5 B;  2ZVN A;  1WH3 A;  1Y8R C;  3A9K B;  3RUL A;  4AJW A;  2KLC A;  4CHK A;  3GOE A;  3R66 C;  3PVL A;  2KD0 A;  5E6P A;  3DDC B;  3ZRC A;  1Z2M A;  3VUW A;  3A1Q B;  2UYZ B;  3B08 A;  1WGR A;  1C1Y B;  1E7V A;  4BBN C;  4DXA B;  4LJO B;  4FHK A;  5FR6 A;  4B9K A;  3PHW B;  4EZL A;  2NBV B;  3EC8 A;  2MWS B;  1R4M I;  1AAR A;  3L17 A;  3ZNZ B;  1VCB A;  2KDF B;  2N9E B;  2IY1 B;  2IZV B;  3WAN A;  2DX5 B;  3KUD B;  1RFA A;  2DZJ A;  2MP2 A;  4A20 A;  1V2Y A;  4DHJ B;  2JXX A;  3RD2 A;  3V6E B;  4ANX A;  1WMH B;  3IFW B;  3NY5 A;  3DBH I;  4ANU A;  4TV3 A;  4HVB A;  2AL6 A;  4IM3 A;  4TQ1 A;  2BKR B;  4JLC A;  2D11 A;  2WYQ A;  5D2M B;  2C9W B;  2N7E A;  2LJ5 A;  2KZR A;  1TBE A;  1E90 A;  2GBM A;  3BIN A;  3VXW A;  2KMA A;  2BYE A;  2GBN A;  3ZVV A;  1NBF C;  4AWJ A;  1WJN A;  3NHE B;  3DBL I;  1WGY A;  3ML8 A;  4FJZ A;  3IBE A;  1WFY A;  2EMT A;  2K6D B;  2A4Z A;  1WYW B;  3PLV A;  1GJZ A;  3M62 B;  1P3Q U;  4NNJ B;  2XK5 A;  2D07 B;  2RD0 A;  3VTW A;  4WWN A;  1WX7 A;  3WA0 A;  2KWU B;  2D10 A;  4NQL B;  3PPA A;  3ZW3 A;  3L0W B;  2V3S A;  2ZEQ A;  2DYB A;  2KNB A;  3B1L X;  4CYE A;  1GUA B;  2DZK A;  4RMA A;  2BYF A;  3ZNG C;  4B95 A;  4RM9 A;  3CST A;  1NDD A;  4WJN A;  3TL5 A;  2WWZ A;  2JF5 A;  2MBH A;  4HDO A;  5CHV C;  4ASW C;  1ISN A;  4AUQ C;  3QWZ B;  3A4R A;  5IA7 A;  2UWQ A;  1V86 A;  2FCS A;  4M8M A;  3K9P B;  3JYU A;  1YD8 U;  3PZD A;  4DHJ D;  4WJQ A;  4BKS D;  3JSV B;  4W9G A;  1KM7 A;  1GNU A;  3LJ3 A;  4MGI E;  3RZW C;  2PE6 B;  3CF6 E;  1U4A A;  3IHP C;  1P9D U;  3V60 A;  4WAA A;  1Z5S B;  2R2Q A;  3X0W A;  1X1M A;  4WQO B;  2JPH A;  2BWE S;  5LXI B;  4FAD A;  2FUH B;  3KUZ A;  3W1S C;  4GDK B;  2HD5 B;  1SE9 A;  3ZRF A;  2PJH A;  4BBN F;  1WE6 A;  2AWT A;  3Q3F A;  1V49 A;  2FAZ A;  2FCQ A;  4KZ0 A;  3S2A A;  5JHB A;  4K7U A;  2RPQ A;  4GIV A;  3HK0 A;  1V5T A;  4MJS B;  2K39 A;  4LCD E;  4FJV B;  1EF5 A;  2LRU A;  4IWQ A;  5AZH A;  4EUT A;  3UQB A;  2DHZ A;  3CSF A;  3ALB A;  1V81 A;  4W9I A;  3SHQ A;  3U8Z A;  3VQI A;  1A5R A;  3ONS A;  2L8J A;  3A1Q A;  3RCZ A;  2JZZ A;  2K25 A;  3OJ3 A;  2WDT B;  3OLM D;  2KX0 A;  2N1W A;  4GMV A;  4NY0 A;  5E6N A;  1RLF A;  2MX2 A;  5L95 C;  4G50 A;  4MDK E;  1YIW A;  2HE7 A;  1YQB A;  4G11 A;  3ECI A;  1KOT A;  5G55 A;  4WWP A;  4MGZ E;  2LGY A;  2G4D B;  3RUI B;  2LVO A;  1XD3 B;  4ZDV A;  1E8X A;  2PEA A;  1WMH A;  4NJ7 A;  1IP9 A;  4TQ0 A;  1Q5W B;  3HHM A;  1WF9 A;  1WM3 A;  2L76 A;  3L13 A;  4MSM B;  3WAO A;  3X23 A;  5J17 A;  3QJZ A;  2LGX A;  2MSE D;  4KIK A;  3Q3J A; 
#chains in the Genus database with same CATH topology
 2OOB B;  2PLP A;  1C4C A;  4US9 A;  1J8C A;  3NUH B;  1I4H A;  4HLE A;  2WDR B;  3P4Q B;  2JUO A;  4NJ6 A;  2L7R A;  4Q2J A;  3RNF C;  3PRZ A;  4RM8 A;  3GZN B;  3V05 A;  2FUG 1;  4USA A;  3NVZ A;  2K9X A;  1FEH A;  1ZPS A;  4OVU A;  3C0R B;  1RM6 C;  4H2A A;  3HRD D;  4EE2 A;  3T3O A;  1T5X D;  1DOY A;  3VRA B;  4GDL B;  5L83 A;  5D94 A;  2A5U A;  4MM3 A;  3DVN U;  1TS2 A;  1YMH E;  2MEK A;  3WIM A;  1S1Q B;  2KVR A;  2WXO A;  2L3Z A;  3BZD B;  2J52 A;  1TJE A;  2MCN B;  1JCK B;  1TS4 A;  2BPS A;  3AE8 B;  3ENE A;  3ETR A;  4AOF A;  3O65 B;  3GZN I;  1MHX A;  4P6V F;  3RNC C;  2N9P C;  1F1H A;  2MBO A;  1C79 A;  3APD A;  5JXV A;  1I42 A;  5GMV A;  4RGT A;  1R7S A;  3T9L A;  1XLQ A;  2DZM A;  2OHF A;  2Y5B B;  2JWZ A;  1KF6 B;  5E6O A;  3PS6 A;  4XGA B;  1D5M C;  1NEK B;  2HTM E;  5JHA A;  2D2Q A;  2AL3 A;  2LVP A;  1OFF A;  4LDT D;  5CTR C;  2VH2 A;  5C23 A;  2ZPY A;  3OAW A;  4DQO C;  3N3K B;  4DBG A;  3ZUN A;  1IBX A;  4HJK A;  3AE1 B;  4OVV A;  5IOI A;  4HPL B;  2TSS A;  2MP2 B;  3PRP B;  5DCN A;  2K6Q A;  1J7C A;  4C00 A;  2D3A A;  3M63 B;  4PS8 A;  3ZNH B;  1T0S C;  4CO7 A;  1A70 A;  1VZ8 A;  3BVM A;  2BGF A;  3DVG Y;  1KLU D;  3PRM B;  3U4E G;  3NS1 A;  1JRP A;  2KQ7 A;  4TSS A;  4M8N A;  2IGD A;  4EZJ A;  3QCA A;  2M8S A;  3BII D;  2MBE A;  1WRD B;  3LDZ E;  3O13 A;  2K3U A;  2KMC A;  2Z59 B;  2KOX A;  3U30 A;  1K50 A;  2WU2 B;  5CHF A;  5H8Y E;  4GSW A;  2NPT B;  1UEL A;  1DYQ A;  2L05 A;  1C4P A;  1SGH A;  1I35 A;  4MH0 E;  2LXC A;  3PZ7 A;  1TS3 A;  3H1U A;  1AWD A;  5BYQ A;  3DHH C;  1OEY J;  3U52 E;  1VDV A;  3AE6 B;  1EF1 A;  2FCM A;  4GLS C;  1JML A;  1HEZ E;  2BS3 B;  1HE8 A;  2Y5C A;  2IBI B;  3QAQ A;  4GDK A;  1EU4 A;  1NVI D;  3KQ4 A;  2J0M A;  4MJS A;  1B9R A;  1MG4 A;  4OVZ A;  2KLG A;  3VUY A;  3AED B;  1HTQ A;  1J19 A;  2L83 A;  2MJD A;  2JRH A;  2M56 B;  4C7Z A;  3APC A;  2QIE B;  4DXF A;  3R3M A;  2C7H A;  1P1A A;  4DHZ E;  2N1V A;  4MSQ B;  5EE0 A;  1PYW D;  2REX A;  4L23 A;  4F8C B;  2J53 A;  1GG3 A;  4AJY B;  1JAL A;  4RGM A;  3DPD A;  4ZHO A;  1V5O A;  2I1K A;  5AUK A;  2CHZ A;  3R7R A;  1N60 A;  5I4D A;  2RDG A;  1LGR A;  5H92 C;  3I5J C;  3NVV A;  2R61 A;  3VDZ A;  1UGM A;  2CR5 A;  3SU8 X;  2JVC A;  4GDL A;  1XT9 B;  2GB1 A;  2KKC A;  2MW5 A;  3AV8 A;  1DOI A;  2WHI A;  5EE3 A;  3CMM B;  2FNJ B;  3ZKJ C;  1QZE A;  2K0P A;  2CU1 A;  1C4A A;  2WLB A;  3BVG A;  1K8R B;  1WIA A;  2OJW A;  2PIA A;  1F9J A;  2KHW B;  4HWI B;  4EFO A;  1T0Y A;  4BVU C;  3RZF A;  1XLP A;  2GBR A;  4XZ4 A;  5G5H A;  4FA6 A;  2LHD A;  2WX1 A;  1QOB A;  1WRI A;  1FMA D;  2V3P A;  1KJT A;  1MG8 A;  4IC7 B;  4FHJ A;  3ZNI D;  5EE9 A;  3DBH B;  1D4B A;  2JZP A;  3C19 A;  4ITK A;  3JW0 X;  3KWL A;  5HKH A;  2V1Y A;  2G4S A;  5BMH A;  4RGN A;  2KLC A;  4CHK A;  1EWY C;  2ICI A;  3DDC B;  1FIQ A;  3ZRC A;  1QLB B;  3AE7 B;  1WGR A;  4DXA B;  4LJO B;  2I2Y A;  3PHW B;  2MWS B;  3GE8 C;  2IY1 B;  2IZV B;  3WAN A;  2DX5 B;  1RFA A;  2DZJ A;  2MP2 A;  1V2Y A;  4YSZ B;  1ZXH A;  1WMH B;  3IFW B;  1CZP A;  3DBH I;  4CQN A;  1EU3 A;  2BYE A;  2GBN A;  3B2G A;  1GOZ A;  5IP4 D;  4FJZ A;  3IBE A;  3BWU D;  1E7P B;  2EMT A;  2K6D B;  1GJZ A;  1P3Q U;  2RD0 A;  2PTL A;  3ZQ4 A;  4M01 A;  2KWU B;  3ZW3 A;  2ZEQ A;  2KNB A;  5FKA C;  2BYF A;  1MI0 A;  4B95 A;  1YN3 A;  2WWZ A;  3NRZ A;  2MBH A;  4ASW C;  3A4R A;  4WAF A;  4M8M A;  3PZD A;  3R2I A;  2PE6 B;  3V60 A;  2WU5 B;  2PVO D;  3W1S C;  4NZL B;  1SSN A;  1SE9 A;  2AWT A;  1KRH A;  3S2A A;  3SFE B;  5JHB A;  2RPQ A;  4HKQ A;  4S0R A;  2OED A;  4LCD E;  1EF5 A;  4EUT A;  3UQB A;  4ZRQ A;  1PDX A;  3SHQ A;  2BW2 A;  2YEP B;  2L8J A;  3A1Q A;  2JZZ A;  1F0Z A;  2K25 A;  2WDT B;  2WXL A;  5E6N A;  2MX2 A;  4HKZ E;  1R4N B;  4J3O D;  2KN4 A;  1YQB A;  1VZ6 A;  2KT7 A;  3ECI A;  3Q69 A;  2YEP F;  1FXA A;  2K22 A;  3RUI B;  3AH7 A;  2PEA A;  1IP9 A;  3HHM A;  2L76 A;  3WAO A;  3X23 A;  3QC8 B;  3CF6 E;  3ZXV A;  4AS1 A;  2NBW B;  3N1Y C;  3NOB A;  2KWC A;  2DEN B;  3L54 A;  2EEL A;  4W9D A;  3W2D A;  2NS5 A;  2MLB A;  4F1S A;  2LFI A;  3R7Q A;  2W3S A;  3GS2 A;  3RNA C;  1TZ1 A;  2KVZ A;  4JE3 B;  3PSE B;  1R4N I;  2W82 A;  2IJ0 A;  2M4N A;  4BOZ B;  2GMI C;  1L7Y A;  1AYF A;  2V4I B;  3ZLZ A;  2XBB C;  3DBR B;  3V3X A;  3R8B A;  2WXN A;  1PQS A;  1EUV B;  2XN9 C;  3P4S B;  4W9L A;  4LDT B;  1RYJ A;  1J7A A;  2KFJ A;  3ZTC A;  5IAA C;  3DHG C;  1EO6 A;  1ET9 A;  2G9H D;  5C3J B;  2KC2 A;  3VR8 B;  3E9S A;  2WXJ A;  5EDS A;  3P1M A;  4YTP B;  4WWO A;  2C7N B;  2QC8 A;  3RYT A;  3TIX A;  3W1Y A;  3DBR I;  4DDI D;  3B9J A;  2KAN A;  2BKF A;  2N7D A;  4MEM A;  2LZ6 A;  4GXB A;  2C60 A;  1AW7 A;  2G45 B;  3Q8C A;  3H9D A;  3AXC A;  2ON8 A;  4TKN A;  3QAR A;  4WIP A;  4J6I A;  2RDB C;  2LRW A;  4A55 A;  3E56 A;  1WR6 E;  4B6W A;  2ZZP B;  2MBQ A;  2BBC A;  2BVC A;  4REZ A;  4HXD A;  3W9C B;  1I4G A;  4XWW A;  1YJJ A;  4ZYS A;  2L1A A;  2RR9 A;  3QQ8 B;  1SIF A;  1ZGU B;  3RI7 C;  1NI2 A;  3DQV A;  1C76 A;  3DVG X;  2WGS A;  4YWG G;  1I4Q A;  4K3C A;  2V0G A;  1RRB A;  1S3S G;  1CJE A;  3EHV A;  3FAH A;  1MJD A;  4BFR A;  2LVQ A;  3VAW A;  2M19 A;  2IDY A;  4GOC A;  2HTH A;  5JH5 C;  3J9C A;  4BKS A;  1P0R A;  2RSU A;  3I9V 1;  5TSS A;  4FBJ B;  4DHZ B;  3SR6 A;  2XK5 B;  5D7G A;  1WGD A;  5IKC M;  2CS4 A;  3AU4 A;  4C56 C;  3LXF A;  4LK0 M;  2RDH A;  2N9L A;  1SBB B;  2LHE A;  1UBI A;  3VHT C;  3AUL A;  2W54 A;  1SF0 A;  2PE9 A;  4C7Y A;  1FRD A;  2I1J A;  1N62 A;  1UD7 A;  4EZK A;  4N6E B;  1JWU D;  5C2T B;  4KKI A;  2ZJD A;  2M17 A;  2PMV A;  2O2V A;  4PYZ A;  4W9H A;  2FBW B;  2WXP A;  1VZ7 A;  1GAQ B;  4HK2 A;  2D3G A;  2R2O A;  3QA8 A;  4RNA A;  4WJO A;  2B76 B;  5J2R A;  1UGJ A;  1JWB D;  3AMZ A;  2KWV B;  1BML C;  1E5W A;  3GB1 A;  1WX9 A;  2C7M B;  1ROE A;  1L6V A;  2E6X A;  1K52 A;  2LJI A;  1WXM A;  2QEJ C;  3SEB A;  4I6L B;  1OQQ A;  1WJ4 A;  4B0M A;  2D3C A;  4ZYN A;  3VTU A;  4PYU A;  4YTN B;  2J0J A;  4W9J A;  2LI5 A;  4JIO U;  4RF0 A;  1L4D B;  2IO2 B;  3AEF B;  3HM6 X;  3BK1 A;  5LXH A;  4W9K A;  4OHJ A;  1V6E A;  1UUP A;  4GB9 A;  3NG0 A;  2JYE A;  1XLO A;  2WXI A;  1ESF A;  1KLV A;  3UIP B;  3W1S A;  1E7U A;  2IGH A;  1FXT B;  2WP9 B;  2DWQ A;  4DDG D;  2G1E A;  3Q8B A;  3SDL C;  1V1P A;  3GP7 A;  3UIO B;  1CK1 A;  3VTV A;  5DPS A;  3KYC D;  4JWS C;  5HI1 A;  3NZ3 A;  3TCA A;  3ZDT A;  3W5V B;  2WDQ B;  3AEB B;  4NQK E;  1WZ0 A;  2KMM A;  5CX3 A;  4EEW A;  1VJK A;  2HJ1 A;  2KAJ A;  2Y3A A;  4IUM B;  2ZVO A;  1JW9 D;  3BYT B;  3V6C B;  1TTN A;  3RNE C;  4MEL A;  4AQ7 A;  2IYD B;  1YJI A;  2HJ8 A;  3ZJU A;  3MHS D;  2K8B A;  1WSP A;  1QOA A;  2H89 B;  1J0G A;  2WXK A;  2N9K A;  4II3 B;  2JSV X;  1PGX A;  1V97 A;  1YOV B;  1EM7 A;  3DOW A;  4ANV A;  4G0N B;  1YX5 B;  4JPS A;  3RUL A;  4AJW A;  1UF0 A;  2CU3 A;  4LNO A;  3GOE A;  3R66 C;  3UI3 A;  3PVL A;  3URY A;  1Z2M A;  3A1Q B;  2BTE A;  2INN E;  1E7V A;  2N7J A;  1FNU A;  4EZL A;  2NBV B;  3EC8 A;  3DHI C;  1VCB A;  2KDF B;  2N9E B;  4A20 A;  2ACZ B;  2JXX A;  3V6E B;  1WYG A;  5FR3 A;  4HVB A;  4TMA B;  4IM3 A;  2BKR B;  2WYQ A;  5D2M B;  2GBM A;  3DWG C;  2ZW0 A;  2GLS A;  3VXW A;  2SEB D;  3ZVV A;  2WXF A;  3NHE B;  1MPE A;  1WGY A;  3Q8E A;  2MH7 A;  3PLV A;  4ARC A;  4NNJ B;  2XK5 A;  2D07 B;  3VTW A;  3WA0 A;  1D6E C;  2D10 A;  4NQL B;  4C4V B;  4PK1 A;  3L0W B;  1ENF A;  1KFY B;  3HUI A;  3AEG B;  4L1B A;  2E3T A;  3CST A;  4WJN A;  3TL5 A;  3AM9 A;  3QWZ B;  5IA7 A;  2UWQ A;  1ZDX A;  3L4P A;  3JYU A;  1YD8 U;  3JSV B;  3LJ3 A;  1TKE A;  4A6Q A;  3IHP C;  3OWE B;  1D5X C;  3Q3M C;  2JPH A;  3KLS X;  3AB5 A;  4FAD A;  5LXI B;  3KUZ A;  2FCQ A;  2FAZ A;  4HEA 1;  2PKO A;  3PZ8 A;  2LRU A;  4IWQ A;  5HFY A;  3U8Z A;  2LGI A;  4GMV A;  4NY0 A;  4RH6 A;  5L95 C;  3MC0 B;  4G50 A;  4MDK E;  5FK9 C;  4G11 A;  1SJE D;  2LGY A;  2G4D B;  3AE5 B;  4XWT A;  2LVO A;  4ZDV A;  2BS4 B;  4TQ0 A;  4MSM B;  1L0Y B;  1PUT A;  2HDE A;  4YXD B;  2LGX A;  3GE3 C;  2MSE D;  4DWF A;  1ZXI A;  4XE0 A;  1FCL A;  1NI3 A;  5BYR A;  3BY4 B;  3VR9 B;  2MA9 B;  3C8Y A;  2GRI A;  2XNA C;  3A9J B;  3PLU A;  1GPX A;  1BXT A;  1IGC A;  5DPW A;  3JVZ X;  1H8C A;  3DVN V;  2Q5W D;  2LAS A;  1MFW A;  4E3C A;  3Q3N C;  4FXC A;  3P2B A;  3TEZ A;  2LGD A;  3IG3 A;  1IPG A;  3VFK A;  3I3T B;  3Q8A A;  2YLM A;  1QT9 A;  1WWT A;  4E71 A;  1HZ6 A;  3TBL D;  2Z0D B;  3QHT A;  3APF A;  2AQ2 B;  4E74 A;  1TYG B;  4RF1 A;  2DZI A;  1FNW A;  1RAX A;  4N9F 4;  3N32 A;  2BQQ A;  2KQS A;  1SE4 A;  2ZCC A;  2KO3 A;  4ICV A;  3U7Z A;  2O6V D;  3MHZ A;  3WAP A;  3W5U B;  1ZUD 2;  1H4R A;  3N1X C;  1N63 A;  3UF8 A;  3EA6 A;  3AEC B;  3A4S C;  4ACF A;  1UNS A;  3N30 A;  4S17 A;  1JWA D;  3Q6B A;  1FRR A;  5G2N A;  4MH8 A;  3ABV B;  4JQW C;  2K1F A;  3VVW B;  1T0Q C;  3ZDM C;  3BVZ A;  3AEA B;  2O2V B;  1WXQ A;  4I6P A;  1FM0 D;  1YQ3 B;  2KX3 A;  1T3Q A;  2AEH A;  3DBS A;  2KTF A;  2MHJ A;  2VZK D;  1WM2 A;  3KUC B;  1ET6 A;  1LO5 D;  3AU5 A;  2J42 A;  2WDV B;  4IW0 A;  2CHW A;  4UDU C;  2PVG C;  3RPF C;  2CJN A;  1WZ3 A;  2BT6 A;  1XCT L;  4HJG E;  3VH4 B;  1PGB A;  4HCP B;  1HZ5 A;  4A3P A;  3T3N A;  1F2R C;  1TKG A;  2IO3 B;  1G6J A;  3MC8 A;  3P42 A;  2J4X A;  4O1N A;  2ONQ A;  2W55 A;  4LNF A;  2KJR A;  3KW5 B;  1TGZ B;  2XEW A;  4KSL C;  3RMK C;  4PS7 A;  1PGA A;  3PGE A;  3P4R B;  3T8M A;  3IVF A;  1MHH E;  4ZRP A;  3BYY B;  1T0R C;  3H8H A;  2VRR B;  4IM0 A;  1OQY A;  1UH6 A;  1C9F A;  2WXG A;  5DPR A;  1JRO A;  3QIJ A;  2KJH B;  3WAM A;  2AQ3 B;  2WS3 B;  1YJ1 A;  1J7B A;  3N9Y C;  1VR9 A;  3ML9 A;  4C4V A;  4ANW A;  4MAC A;  2LD9 A;  4XX5 A;  2LMC A;  2M0A A;  2GBJ A;  4NPN A;  5EE1 A;  3OG5 A;  2UU7 A;  1UWM A;  1V1P B;  2IY0 B;  3I63 C;  1UZX B;  2DAJ A;  4TUU A;  3HIZ A;  3I57 A;  4MGK E;  3JSV A;  2MBB B;  2OJR A;  4KDI C;  1WJ6 A;  4GGQ A;  3SD5 A;  2DYM A;  3QX1 A;  4ZHP A;  1D3Z A;  1WXV A;  1CQV A;  1D5Z C;  3ZGZ A;  5AZF A;  1WR1 A;  2IND C;  4X57 B;  4XYC A;  1C77 A;  4IKG A;  2L00 B;  1Y56 A;  2WX0 A;  4JGH B;  1YX6 B;  1C78 A;  4ARI A;  1YN5 A;  1M4V A;  4KSK C;  3KWV A;  3RN9 C;  3TUO A;  2FIF A;  1JWS D;  1F2R I;  4BZA A;  1DOX A;  2NTT A;  3NS8 A;  3PT2 B;  3MJW A;  2IO1 B;  2RMM A;  5IO9 A;  1TZO A;  4I6N B;  1VD2 A;  2CJO A;  3U7D A;  1RFK A;  5J18 A;  1V80 A;  1HTO A;  1WGK A;  1GB1 A;  3HM3 A;  3A9J A;  2KFK A;  2K5P A;  1V8C A;  1WE7 A;  2JT4 B;  1SE2 A;  4IWP A;  1BT0 A;  1P98 A;  2K8C A;  4KGS A;  2DBY A;  4FUL A;  5BMI A;  1Q10 A;  1VRA B;  3H7S A;  3IT4 B;  3TMP B;  4MGY E;  2AYO B;  1TKY A;  3V61 A;  1OTR B;  2N9X A;  2KWD A;  3BK2 A;  2KC1 A;  2QHO A;  3N1Z C;  2JU6 X;  4WH4 A;  4PS3 A;  1L6U A;  2NBU A;  2LUE A;  5D3I B;  3Q3O C;  2L52 A;  2MQJ A;  1OGW A;  5CHW A;  1SIJ A;  1L0V B;  1CMX B;  1XQQ A;  2V3N A;  4K81 A;  1L2N A;  4JWU C;  1WXS A;  5D6J B;  3M95 A;  2H88 B;  1TY2 A;  4FJY A;  1ZKH A;  3CIR B;  4A3O A;  5GXG B;  3FC4 A;  1E9M A;  4PT5 A;  1LXD A;  4XDD A;  3ZYY X;  1PFD A;  4RCO A;  3H7P B;  4FLH A;  2KAC A;  2YVC A;  2V4L A;  2BF8 B;  2KDI A;  2FID A;  1XCQ L;  2X8X X;  2KXJ A;  4N58 A;  2D5G A;  3V62 A;  4OZA A;  3UIN B;  5AUI A;  2Z0E B;  3MTN B;  2V9H A;  3DBL B;  2J7Q B;  2MRP A;  1SEB D;  3A9K B;  1I4X A;  2JXT A;  1I4R A;  3VUW A;  2UYZ B;  1E6E B;  4BBN C;  4FHK A;  4B9K A;  4KGT A;  1QIL A;  3L17 A;  3ZNZ B;  2PW9 A;  3HVZ A;  1QF6 A;  4ANX A;  2AL6 A;  3AE2 B;  4TQ1 A;  2Y5P A;  2C9W B;  4US8 A;  3R2T A;  1TBE A;  1NBF C;  4AWJ A;  1WJN A;  3DBL I;  3ML8 A;  3RNB C;  3MFG A;  1WFY A;  3M62 B;  1BUI C;  1FNV A;  2V3S A;  2DYB A;  3B1L X;  4CYE A;  1GUA B;  4WWM A;  3Q2A C;  3DWM A;  1N6Z A;  1NDD A;  1ZOY B;  3RNG C;  4LNI A;  4LTU A;  2W3R A;  1ISN A;  1HXY D;  1SJH D;  4KKJ A;  1V86 A;  2FCS A;  4DHJ D;  3K9P B;  2LEK A;  3Q8F A;  1KM7 A;  4MGI E;  1U4A A;  1XO3 A;  1P9D U;  2R2Q A;  3X0W A;  1X1M A;  2BWE S;  4A9A A;  1QQR A;  2FUH B;  2HD5 B;  4BBN F;  1WE6 A;  1V49 A;  4HRO A;  4L2Y A;  4K7U A;  4GIV A;  1V5T A;  2K39 A;  2DHZ A;  1V81 A;  4W9I A;  1A5R A;  1AN8 A;  3RCZ A;  3OJ3 A;  2KX0 A;  2N1W A;  1B1Z A;  1XF5 L;  1KOT A;  4MGZ E;  2QDF A;  4P16 A;  1XD3 B;  4NJ7 A;  4LNK A;  3L13 A;  3P63 A;  4ZRJ A;  1V9J A;  2N4F A;  4GN1 A;  1ZDV A;  2KTR B;  4HCN B;  2EMS A;  1ACC A;  2O6V B;  3WAL A;  5BO4 B;  2QIL A;  1VLB A;  2BWF A;  2DAF A;  2ZW1 A;  5MPO A;  1WJU A;  1MVK A;  3RFZ B;  1YNT E;  4QAY A;  4YSY B;  3U2S C;  1Q1O A;  4HDQ A;  1HA5 A;  2EKE C;  3QK0 A;  3H6N A;  1HQR D;  3PV1 A;  2MJ3 A;  1EWC A;  1FCC C;  1YN4 A;  3AI5 A;  1F77 A;  5IN7 A;  2KN5 A;  2L0T A;  2ZPN A;  4M00 A;  5KHO A;  1XLN A;  2VZK B;  2GOW A;  3AE9 B;  2NMQ A;  4WQM A;  2JQR B;  4NAM A;  1WY8 A;  4NAW B;  4IM2 A;  4N59 A;  2ZCB A;  1QKZ A;  5LLI A;  1LFD A;  4EKU A;  2ZNV C;  3EFU A;  1N5X A;  3Q14 C;  1P7E A;  5AEK B;  2WXQ A;  2CKH B;  4OW0 A;  1WI0 A;  2C5L C;  2KDB A;  4B0E A;  2NVU I;  3TEY A;  3ZJV A;  1UBQ A;  3EEC A;  3DCG A;  5JZE B;  3H7P A;  3KH0 A;  3B2F A;  2K8H A;  2IO0 B;  5T8I A;  2INP E;  1ZP0 B;  4EOY A;  1STE A;  2IPK D;  3IAS 1;  2BS2 B;  1IYF A;  4KDL B;  2LGS A;  4KVG B;  2INC C;  2RGF A;  4IOI E;  1QOG A;  2J0K A;  3EFC A;  2L0F A;  1GC7 A;  4BKT A;  3EUB 2;  1LQB A;  3FIL B;  3K9O B;  1E8Z A;  3ZO5 B;  3A9K A;  1NYR A;  3PRE A;  2KJ6 A;  4BKG A;  1E10 A;  4JL9 A;  4P1C C;  1TT5 B;  3UQA A;  4HPM B;  4ZOH C;  1YQ4 B;  1WGH A;  2JZ3 B;  3RT3 B;  3TEW A;  1N61 A;  1NEN B;  4G3X B;  2RPV A;  1JRU A;  3AE3 B;  2SAK A;  2ZNV B;  2LXA A;  4WUR A;  3ZTD A;  3NZU A;  1L0X B;  1E8W A;  3L10 B;  2JWU A;  4AP4 C;  2BB6 A;  1FPY A;  2EKI A;  3PHX B;  1LM8 B;  2ASQ A;  2DYO A;  5DPT A;  1RWS A;  2X38 A;  2Z8L A;  4ZRK A;  2KFK B;  2GBK A;  3KVF B;  3IAM 1;  2N0S B;  1K53 A;  4YT0 B;  3KYD D;  4M0W B;  4OZC A;  4FN2 A;  1ZE3 D;  1M94 A;  3PTF C;  1GB4 A;  3LB8 C;  4DK5 A;  2JX5 A;  1OEY A;  2QJL A;  1L4Z B;  2NTS A;  3B0A A;  3TEX A;  3NVY A;  1N5W A;  2G3Q B;  1P7F A;  3AE4 B;  2DLB A;  4W9F A;  2W9N A;  2B3A A;  4HPP A;  3SFD B;  1GC6 A;  3IXS A;  2KYW A;  1K51 A;  3N20 C;  4ICU A;  5AZG A;  1L5P A;  2KDM A;  3EGR A;  4K1R B;  1TY0 A;  4IG7 B;  5TR5 A;  1ZW7 A;  3TJP A;  3L08 A;  2WXH A;  4RFB A;  4M02 A;  4R3D A;  4GU2 A;  2L32 A;  4YSX B;  1E8Y A;  4YL8 A;  1JWM D;  1I7H A;  1KH0 A;  1E0Z A;  1SXT A;  3LYY A;  1IGD A;  4KIK B;  1XXG A;  4XDC A;  2JRI B;  2M1M A;  4F7Z A;  1WX8 A;  3NVW A;  1C3T A;  2KQ4 X;  2BYT A;  3NZS A;  3D32 A;  2KDE B;  3CWI A;  2JY6 A;  3VUX A;  1Q0W B;  1WXA A;  2KK8 A;  1KTK A;  2PPH A;  5KHQ A;  2WXR A;  2D3B A;  2KTR A;  4ZRI A;  2JYT A;  4URK A;  1FXI A;  4A8X C;  2O6V A;  4OZB A;  2NPT A;  4II2 B;  2M0X A;  2AQ1 B;  2CHX A;  1UWX A;  2LUM A;  1JQ4 A;  5BMG A;  3VH3 B;  4IWO A;  4LNN A;  4P7I A;  2BB5 A;  1V1O A;  3ZIM A;  4W9E A;  4MM3 B;  2MJE A;  3OJ4 B;  2WQY B;  4XC2 A;  5C1Z A;  4YTM B;  3WCQ A;  1DGJ A;  4KZC A;  3L16 A;  4NJC A;  4LJP B;  2VH1 A;  3A33 B;  1FFU A;  2NCN A;  1F52 A;  4MT5 A;  2BYV E;  4WJP A;  4K7S A;  2FCN A;  3AEE B;  1NYQ A;  1T6B X;  4NAW A;  1WGG A;  2IGG A;  3IT6 B;  1R4M B;  4K7W A;  4W9C A;  3M3J A;  4BOS C;  2QCZ A;  4KGR A;  1FFV A;  2QMT A;  2NR2 A;  2LWP A;  3UGB B;  3ZJT A;  4KV2 A;  1IBX B;  3ZXR A;  2ZVN A;  1WH3 A;  1Y8R C;  3TSS A;  3AN1 A;  2WNM A;  5E6P A;  2KD0 A;  3B08 A;  5E6J A;  1C1Y B;  3VRB B;  3P4P B;  5FR6 A;  1TIF A;  4DXG A;  3FIL A;  1R4M I;  1AAR A;  4C80 A;  4BAX A;  4DHJ B;  3KUD B;  1KLG D;  1TS5 A;  3RD2 A;  3MC9 A;  3NY5 A;  4ANU A;  4TV3 A;  4JLC A;  2D11 A;  2N7E A;  2LJ5 A;  5HHD G;  2KZR A;  1E90 A;  3BIN A;  2KMA A;  4HRS A;  4RGO S;  2AX5 A;  3NJT A;  4D2K A;  4A90 A;  4JX1 C;  4P1B C;  2A4Z A;  1WYW B;  1OQR A;  1FO4 A;  3MJ5 A;  4WWN A;  1WX7 A;  2FE8 A;  1XEE A;  3PPA A;  3PO0 A;  2DZK A;  4RMA A;  2DNF A;  3ZNG C;  4KX6 B;  4RM9 A;  4LLG M;  4M0W A;  2JF5 A;  4HDO A;  3FKY A;  1I4P A;  5CHV C;  4AUQ C;  1SB3 C;  2QSD A;  4WJQ A;  4BKS D;  4W9G A;  3RZW C;  1GNU A;  2WXM A;  2GI9 A;  4WAA A;  1FD6 A;  1Z5S B;  4WQO B;  4GDK B;  3ZRF A;  2PJH A;  3Q3F A;  4KZ0 A;  1IUE A;  3HVD A;  5BYS A;  3MP9 A;  3HK0 A;  4IDI A;  4MJS B;  4FJV B;  2I38 A;  5AZH A;  3CSF A;  3ALB A;  3VQI A;  5HG2 A;  3ONS A;  5D3D A;  3OLM D;  1QOF A;  1RLF A;  1YIW A;  2HE7 A;  5G5G A;  5G55 A;  4WWP A;  5LNK 1;  1SE3 A;  1E8X A;  1WMH A;  1Q5W B;  1WF9 A;  1WM3 A;  4K3B A;  5J17 A;  3QJZ A;  4KIK A;  3Q3J A; 
#chains in the Genus database with same CATH homology
 4ZRJ A;  2NBW B;  2OOB B;  3NOB A;  2KWC A;  1V9J A;  2N4F A;  2DEN B;  4GN1 A;  3L54 A;  3BY4 B;  2KTR B;  4W9D A;  4HCN B;  2MA9 B;  2EMS A;  2NS5 A;  2MLB A;  4F1S A;  1J8C A;  3A9J B;  3PLU A;  4HLE A;  2O6V B;  5DPW A;  3WAL A;  2JUO A;  3JVZ X;  4NJ6 A;  5BO4 B;  3R7Q A;  2L7R A;  1H8C A;  3DVN V;  2BWF A;  2DAF A;  1TZ1 A;  2LAS A;  3PRZ A;  4RM8 A;  1WJU A;  4E3C A;  3PSE B;  3P2B A;  1R4N I;  2LGD A;  1Q1O A;  2M4N A;  4HDQ A;  4BOZ B;  2GMI C;  1L7Y A;  2EKE C;  3IG3 A;  4OVU A;  3C0R B;  3ZLZ A;  3QK0 A;  2XBB C;  1IPG A;  3H6N A;  3VFK A;  3PV1 A;  1PQS A;  3I3T B;  1EUV B;  2YLM A;  3AI5 A;  4GDL B;  4E71 A;  5L83 A;  3TBL D;  5D94 A;  2Z0D B;  3QHT A;  3APF A;  2A5U A;  2KN5 A;  2L0T A;  4LDT B;  4MM3 A;  4W9L A;  2ZPN A;  4E74 A;  3DVN U;  2DZI A;  5KHO A;  3WIM A;  2KFJ A;  3ZTC A;  1RAX A;  5IAA C;  1S1Q B;  2KVR A;  2GOW A;  3N32 A;  2L3Z A;  2KQS A;  1EO6 A;  4N9F 4;  2ZCC A;  2KO3 A;  2KC2 A;  4ICV A;  2MCN B;  1WY8 A;  5EDS A;  3ENE A;  2BPS A;  2O6V D;  4AOF A;  3O65 B;  4WWO A;  3GZN I;  3WAP A;  4NAW B;  4IM2 A;  2C7N B;  1H4R A;  2N9P C;  3RYT A;  2MBO A;  2ZCB A;  3UF8 A;  3APD A;  3A4S C;  5LLI A;  3TIX A;  1LFD A;  1I42 A;  4EKU A;  2ZNV C;  3EFU A;  3W1Y A;  3DBR I;  5GMV A;  4DDI D;  3N30 A;  5AEK B;  2KAN A;  2CKH B;  2BKF A;  3T9L A;  2N7D A;  1WI0 A;  2C5L C;  2DZM A;  2KDB A;  4MEM A;  5G2N A;  2LZ6 A;  4GXB A;  2C60 A;  2NVU I;  2Y5B B;  1UBQ A;  2JWZ A;  2G45 B;  4JQW C;  3EEC A;  3H9D A;  2K1F A;  3DCG A;  3VVW B;  5E6O A;  3PS6 A;  3AXC A;  4TKN A;  5JZE B;  3QAR A;  3ZDM C;  4J6I A;  3H7P A;  2O2V B;  3KH0 A;  2LRW A;  2D2Q A;  2AL3 A;  2K8H A;  2LVP A;  2IO0 B;  1WR6 E;  4I6P A;  4B6W A;  2ZZP B;  2KX3 A;  5CTR C;  4LDT D;  2MBQ A;  4EOY A;  2AEH A;  1IYF A;  4HXD A;  3DBS A;  4KDL B;  5C23 A;  2KTF A;  4KVG B;  1WM2 A;  2ZPY A;  3OAW A;  2RGF A;  3KUC B;  2J0K A;  2L0F A;  3N3K B;  1GC7 A;  2RR9 A;  4DBG A;  3AU5 A;  3QQ8 B;  3ZUN A;  4BKT A;  1SIF A;  4IW0 A;  1ZGU B;  1NI2 A;  4HJK A;  2CHW A;  4OVV A;  1LQB A;  3K9O B;  4HPL B;  1E8Z A;  1WZ3 A;  3ZO5 B;  3A9K A;  3DQV A;  3DVG X;  3PRE A;  2MP2 B;  2KJ6 A;  3PRP B;  4BKG A;  5DCN A;  3VH4 B;  4JL9 A;  4HCP B;  2K6Q A;  4A3P A;  3UQA A;  4HPM B;  3M63 B;  4PS8 A;  3ZNH B;  2IO3 B;  1RRB A;  1WGH A;  1S3S G;  2JZ3 B;  3RT3 B;  1G6J A;  4CO7 A;  3EHV A;  4G3X B;  2BGF A;  1JRU A;  3DVG Y;  4BFR A;  3PRM B;  2LVQ A;  2KJR A;  3KW5 B;  2ZNV B;  3VAW A;  2LXA A;  4GOC A;  1TGZ B;  2HTH A;  2XEW A;  4KSL C;  4BKS A;  5JH5 C;  1P0R A;  2RSU A;  2KQ7 A;  4PS7 A;  3ZTD A;  3NZU A;  4FBJ B;  3PGE A;  4M8N A;  1E8W A;  3T8M A;  3L10 B;  4EZJ A;  3IVF A;  3QCA A;  2M8S A;  4AP4 C;  4DHZ B;  2XK5 B;  5D7G A;  1WGD A;  3PHX B;  1LM8 B;  2CS4 A;  3AU4 A;  2MBE A;  2ASQ A;  2DYO A;  2VRR B;  1WRD B;  3LDZ E;  1OQY A;  1UH6 A;  4IM0 A;  5DPT A;  5DPR A;  2KMC A;  2Z59 B;  2KOX A;  3U30 A;  4ZRK A;  5CHF A;  4GSW A;  2KFK B;  3QIJ A;  2GBK A;  3KVF B;  2KJH B;  3WAM A;  1UBI A;  3VHT C;  2NPT B;  3KYD D;  1UEL A;  1YJ1 A;  4M0W B;  4FN2 A;  3AUL A;  1M94 A;  2L05 A;  3ML9 A;  3PTF C;  4ANW A;  2LD9 A;  2PE9 A;  5JHA A;  4DK5 A;  2I1J A;  4XX5 A;  1UD7 A;  1SGH A;  4EZK A;  1OEY A;  1I35 A;  2GBJ A;  4NPN A;  4MH0 E;  2LXC A;  3B0A A;  3H1U A;  2G3Q B;  2IY0 B;  2ZJD A;  1OEY J;  1UZX B;  2DAJ A;  1EF1 A;  2M17 A;  2W9N A;  4TUU A;  3HIZ A;  4W9F A;  2O2V A;  2B3A A;  4MGK E;  4PYZ A;  3JSV A;  1GC6 A;  4W9H A;  2FCM A;  4HK2 A;  4ICU A;  2D3G A;  1HE8 A;  2R2O A;  3QA8 A;  2MBB B;  2OJR A;  4KDI C;  4WJO A;  5AZG A;  1WJ6 A;  2IBI B;  3QAQ A;  4GGQ A;  4GDK A;  4K1R B;  3SD5 A;  2DYM A;  4DWF A;  5J2R A;  3QX1 A;  1D3Z A;  4IG7 B;  5TR5 A;  1WXV A;  1ZW7 A;  2KWV B;  3L08 A;  3TJP A;  2J0M A;  4MJS A;  5AZF A;  1WR1 A;  1E5W A;  1WX9 A;  4GU2 A;  4X57 B;  2C7M B;  2L00 B;  1E8Y A;  4YL8 A;  2WX0 A;  4JGH B;  2KLG A;  3VUY A;  1YX6 B;  1WXM A;  1J19 A;  4KIK B;  2JRH A;  4I6L B;  4KSK C;  1WJ4 A;  2FIF A;  2JRI B;  2M1M A;  4F7Z A;  3APC A;  4ZYN A;  1WX8 A;  3VTU A;  1C3T A;  4PYU A;  3NZS A;  3R3M A;  3D32 A;  3NS8 A;  2J0J A;  2C7H A;  2KDE B;  3PT2 B;  2JY6 A;  1P1A A;  4W9J A;  2LI5 A;  4JIO U;  3MJW A;  3VUX A;  4DHZ E;  2IO1 B;  1Q0W B;  1WXA A;  2IO2 B;  2N1V A;  4MSQ B;  2KK8 A;  2PPH A;  2REX A;  5KHQ A;  3HM6 X;  5LXH A;  4I6N B;  4W9K A;  1VD2 A;  4F8C B;  3U7D A;  1GG3 A;  1V6E A;  2KTR A;  4GB9 A;  4ZRI A;  4AJY B;  4URK A;  5J18 A;  1V80 A;  3HM3 A;  3A9J A;  2KFK A;  2O6V A;  3DPD A;  2NPT A;  4II2 B;  2M0X A;  1WE7 A;  1KLV A;  2JT4 B;  1V5O A;  2CHX A;  2I1K A;  4IWP A;  3UIP B;  3W1S A;  1BT0 A;  1P98 A;  2K8C A;  2CHZ A;  3VH3 B;  4IWO A;  3R7R A;  4P7I A;  1E7U A;  4FUL A;  1FXT B;  3H7S A;  3ZIM A;  4W9E A;  3TMP B;  4MGY E;  2AYO B;  3V61 A;  3OJ4 B;  1OTR B;  2N9X A;  4DDG D;  3SDL C;  2KC1 A;  2QHO A;  4XC2 A;  5C1Z A;  3VDZ A;  1UGM A;  3UIO B;  2CR5 A;  4PS3 A;  3SU8 X;  2JVC A;  2NBU A;  2LUE A;  4GDL A;  4KZC A;  3VTV A;  3L16 A;  1XT9 B;  2MW5 A;  2KKC A;  5DPS A;  3KYC D;  2MQJ A;  4LJP B;  1OGW A;  5CHW A;  1CMX B;  1XQQ A;  3A33 B;  3TCA A;  3ZDT A;  2NCN A;  2FNJ B;  3CMM B;  3ZKJ C;  4K81 A;  1QZE A;  2CU1 A;  4NQK E;  1WZ0 A;  2BYV E;  3QC8 B;  5CX3 A;  1L2N A;  1K8R B;  4WJP A;  1WXS A;  4K7S A;  5D6J B;  4EEW A;  1WIA A;  1F9J A;  3M95 A;  4FJY A;  2KHW B;  4HWI B;  1ZKH A;  2FCN A;  4IUM B;  4A3O A;  1T0Y A;  2ZVO A;  4BVU C;  4NAW A;  3RZF A;  4EFO A;  3V6C B;  1WGG A;  1TTN A;  2GBR A;  4MEL A;  4XZ4 A;  1LXD A;  4K7W A;  4FA6 A;  2IYD B;  2WX1 A;  4W9C A;  3H7P B;  3M3J A;  2HJ8 A;  4FLH A;  2YVC A;  2V4L A;  3MHS D;  4BOS C;  2K8B A;  1MG8 A;  1KJT A;  2BF8 B;  4FHJ A;  4IC7 B;  2KDI A;  3ZNI D;  2NR2 A;  2LWP A;  2FID A;  1J0G A;  3UGB B;  4II3 B;  2KXJ A;  4KV2 A;  3V62 A;  3JW0 X;  3UIN B;  2Z0E B;  3MTN B;  3DOW A;  4ANV A;  4G0N B;  5HKH A;  2J7Q B;  2G4S A;  2V1Y A;  2MRP A;  1YX5 B;  2ZVN A;  1WH3 A;  1Y8R C;  3A9K B;  3RUL A;  4AJW A;  2KLC A;  4CHK A;  3GOE A;  3R66 C;  3PVL A;  2KD0 A;  5E6P A;  3DDC B;  3ZRC A;  1Z2M A;  3VUW A;  3A1Q B;  2UYZ B;  3B08 A;  1WGR A;  1C1Y B;  1E7V A;  4BBN C;  4DXA B;  4LJO B;  4FHK A;  5FR6 A;  4B9K A;  3PHW B;  4EZL A;  2NBV B;  3EC8 A;  2MWS B;  1R4M I;  1AAR A;  3L17 A;  3ZNZ B;  1VCB A;  2KDF B;  2N9E B;  2IY1 B;  2IZV B;  3WAN A;  2DX5 B;  3KUD B;  1RFA A;  2DZJ A;  2MP2 A;  4A20 A;  1V2Y A;  4DHJ B;  2JXX A;  3RD2 A;  3V6E B;  4ANX A;  1WMH B;  3IFW B;  3NY5 A;  3DBH I;  4ANU A;  4TV3 A;  4HVB A;  2AL6 A;  4IM3 A;  4TQ1 A;  2BKR B;  4JLC A;  2D11 A;  2WYQ A;  5D2M B;  2C9W B;  2N7E A;  2LJ5 A;  2KZR A;  1TBE A;  1E90 A;  2GBM A;  3BIN A;  3VXW A;  2KMA A;  2BYE A;  2GBN A;  3ZVV A;  1NBF C;  4AWJ A;  1WJN A;  3NHE B;  3DBL I;  1WGY A;  3ML8 A;  4FJZ A;  3IBE A;  1WFY A;  2EMT A;  2K6D B;  2A4Z A;  1WYW B;  3PLV A;  1GJZ A;  3M62 B;  1P3Q U;  4NNJ B;  2XK5 A;  2D07 B;  2RD0 A;  3VTW A;  4WWN A;  1WX7 A;  3WA0 A;  2KWU B;  2D10 A;  4NQL B;  3PPA A;  3ZW3 A;  3L0W B;  2V3S A;  2ZEQ A;  2DYB A;  2KNB A;  3B1L X;  4CYE A;  1GUA B;  2DZK A;  4RMA A;  2BYF A;  3ZNG C;  4B95 A;  4RM9 A;  3CST A;  1NDD A;  4WJN A;  3TL5 A;  2WWZ A;  2JF5 A;  2MBH A;  4HDO A;  5CHV C;  4ASW C;  1ISN A;  4AUQ C;  3QWZ B;  3A4R A;  5IA7 A;  2UWQ A;  1V86 A;  2FCS A;  4M8M A;  3K9P B;  3JYU A;  1YD8 U;  3PZD A;  4DHJ D;  4WJQ A;  4BKS D;  3JSV B;  4W9G A;  1KM7 A;  1GNU A;  3LJ3 A;  4MGI E;  3RZW C;  2PE6 B;  3CF6 E;  1U4A A;  3IHP C;  1P9D U;  3V60 A;  4WAA A;  1Z5S B;  2R2Q A;  3X0W A;  1X1M A;  4WQO B;  2JPH A;  2BWE S;  5LXI B;  4FAD A;  2FUH B;  3KUZ A;  3W1S C;  4GDK B;  2HD5 B;  1SE9 A;  3ZRF A;  2PJH A;  4BBN F;  1WE6 A;  2AWT A;  3Q3F A;  1V49 A;  2FAZ A;  2FCQ A;  4KZ0 A;  3S2A A;  5JHB A;  4K7U A;  2RPQ A;  4GIV A;  3HK0 A;  1V5T A;  4MJS B;  2K39 A;  4LCD E;  4FJV B;  1EF5 A;  2LRU A;  4IWQ A;  5AZH A;  4EUT A;  3UQB A;  2DHZ A;  3CSF A;  3ALB A;  1V81 A;  4W9I A;  3SHQ A;  3U8Z A;  3VQI A;  1A5R A;  3ONS A;  2L8J A;  3A1Q A;  3RCZ A;  2JZZ A;  2K25 A;  3OJ3 A;  2WDT B;  3OLM D;  2KX0 A;  2N1W A;  4GMV A;  4NY0 A;  5E6N A;  1RLF A;  2MX2 A;  5L95 C;  4G50 A;  4MDK E;  1YIW A;  2HE7 A;  1YQB A;  4G11 A;  3ECI A;  1KOT A;  5G55 A;  4WWP A;  4MGZ E;  2LGY A;  2G4D B;  3RUI B;  2LVO A;  1XD3 B;  4ZDV A;  1E8X A;  2PEA A;  1WMH A;  4NJ7 A;  1IP9 A;  4TQ0 A;  1Q5W B;  3HHM A;  1WF9 A;  1WM3 A;  2L76 A;  3L13 A;  4MSM B;  3WAO A;  3X23 A;  5J17 A;  3QJZ A;  2LGX A;  2MSE D;  4KIK A;  3Q3J A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...