1HQRD

Crystal structure of a superantigen bound to the high-affinity, zinc-dependent site on mhc class ii
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
205
structure length
205
Chain Sequence
b'KDISNVKSDLLYAYTITPYDYKDCRVNFSTTHTLNIDTQKYRGKDYYISSEMSYEASQKFKRDDHVDVFGLFYILNSHTGEYIYGGITPAQNNKVNHKLLGNLFISGESQQNLNNKIILEKDIVTFQEIDFKIRKYLMDNYKIYDATSPYVSGRIEIGTKDGKHEQIDLFDSPNEGTRSDIFAKYKDNRIINMKNFSHFDIYLEK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HLA-DR ALPHA CHAIN
publication title Crystal structure of a superantigen bound to the high-affinity, zinc-dependent site on MHC class II.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 52
structure length 205
sequence length 205
ec nomenclature
pdb deposition date 2000-12-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF01123 Stap_Strp_toxin Staphylococcal/Streptococcal toxin, OB-fold domain
D PF02876 Stap_Strp_tox_C Staphylococcal/Streptococcal toxin, beta-grasp domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.110 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1hqrD02
3.10.20.120 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1hqrD01
1LTGD 1HTLD 1SBBB 1JCKB 1XTCD 2AQ2B 3DWPA 1YN3A 2AQ1B 1TY0A 1EU3A 1HXYD 5D3IB 1FNVA 1TY2A 3O13A 1LT4D 1G8ZD 1RF2D 1L0YB 1YN4A 5FKAC 1JWSD 1XXGA 1LTRD 5ELBA 2J4XA 1B44D 3MFGA 1LLRD 1LO5D 5D3DA 1EEID 1RCVD 4K6LA 1CHQD 1LTTD 1S5CD 3BZDB 1JR0D 3DWAA 1TS3A 1PTOB 3MC0B 3GP7A 4BWGB 1S5BD 4RGTA 5ELCA 2G9HD 1QILA 1JWUD 5FK9C 1CQVA 1LT3D 1D5MC 1FNUA 1PYWD 1LT6D 2XN9C 3CHBD 4UDUC 5ELEA 3W2DA 2O2LD 1TS4A 1B1ZA 1STEA 4RGMA 5ELFA 1RD9D 1SE4A 1V1PB 1BXTA 4RCOA 2IPKD 2NTTA 1ESFA 4RHRA 1D5XC 1PZKD 4C56C 4O1NA 2CHBD 1ET6A 1I4QA 3BVZA 1SXTA 1ET9A 4L6TB 1AN8A 1KLGD 1HQRD 1RDPD 2XNAC 1S5DD 2XRQD 2ICIA 1DJRD 1SE2A 4RGNA 5ELDA 4ZYSA 4RHSA 1UUPA 2QILA 1D6EC 1GOZA 1T5XD 3BVGA 3URYA 1PTOH 1PRTF 1BCPF 1L0XB 3BYYB 4RFBA 1JQYD 2RDGA 3KLSX 3SEBA 1KLUD 1BCPD 1PRTD 1S5ED 1LTID 4RGOS 1CHPD 1I4HA 1I4RA 4DXGA 2NTSA 2IJ0A 1PRTC 1BCPC 3EA6A 1JWMD 2QEJC 1PTOF 5TSSA 1AW7A 1FGBD 3R8BA 4RH6A 1M4VA 1PTOD 4TSSA 1SEBD 4Z9CB 1CK1A 2AQ3B 1V1OA 1LT5D 2XRSD 4L63B 1TS5A 1PTOC 1ENFA 1D5ZC 3EFXD 1LTBD 1EEFD 1S5FD 1CT1D 1PZID 1PZJD 1EFID 1TS2A 2TSSA 4OHJA 3TSSA 1I4GA 1HA5A 1EU4A 1PRTB 1BCPB 2WV6D 1SJED 4DXFA 1KTKA 2R61A 3BYTB 1SJHD 3OWEB 2RDHA 2SEBD 1I4XA 1LTAD 1EWCA 3R2TA 1DYQA 1LTSD 1MD2D 1V1PA 3DWQA 3R2IA 3V05A 2Z8LA 1FD7D 5I4DA 1I4PA 1YN5A 1SE3A 1FNWA 4NZLB 1UNSA 3BVMA 1F77A
chains in the Genus database with same CATH superfamily
3IFTA 1JMCA 4C3HG 2RVLA 3RN2A 2GB1A 1W6JA 2DNCA 1GNUA 3J7A5 3EECA 2JVCA 3TP8A 1JJCB 4N8FA 1JWSD 4ODGA 2D0OA 4BBSG 2KHSA 2BQQA 3AE6B 4A3FG 1D1KA 3AE1B 5BO4B 4JE3B 1TXYA 4X64Q 4A3MH 3NPPA 1NR2A 1LLRD 4KY5A 4JI3Q 3QK0A 1HFGA 3JC66 4EZKA 3NUHB 4ZCKA 3GTMB 2NMQA 1W6KA 2C7MB 4RAUC 3ZNID 3H0GH 1W2BA 1E6EB 1HTQA 4N9PA 1EF1A 4IOCA 1PH1A 3LNNA 5BN4A 2LHEA 2G9HD 2FCQA 5E6OA 5GQOA 1I3QH 4DR1Q 1CKOA 4OX9Q 3PGZA 5AJ3Q 3KJPA 3H3VC 2O2LD 4LK1C 3KBXA 5LHY1 4LF4L 2AMCB 1E1OA 1I7HA 4IW0A 3HFZB 1A3UA 2ZJQA 2OJRA 5C3EB 4BVUC 2XVSA 1J5EL 2L5TA 2K32A 5JEAG 1VJKA 2I2YA 4UP7A 1PH7A 1J6QA 1XLQA 2K8CA 2B3GA 4L6TB 1XLOA 2K04A 1S5DD 1A0IA 3S16B 1EQRA 1ZUD2 1SE2A 2YU9B 3WCQA 2HD5B 4W9HA 1UF0A 5M3FG 3N9YC 3VUYA 2R93B 1IBKL 2FMCA 3N3KB 3VA5A 2F0MA 2KLGA 1K83B 4NAMA 2KACA 4QUFA 2L00B 3Q22A 3C46A 3KLSX 3HOYB 1ASZA 3E56A 4A55A 3ND8A 2F0EA 2CH4A 4C4VA 4DN4M 2IJ0A 1BCPC 3HOXG 2ASQA 1GVPA 2JN4A 4CKEA 5CORA 5C44G 2CWAA 2LRUA 4IM2A 1TWCB 3J80c 5MPOA 4P1BC 1T0RC 5KHQA 1GXDC 3AE2B 1M4VA 5M5WB 2WB1B 4A3BG 3Q3NC 5GADC 4PG3A 3M4YA 3B2FA 4W9FA 1PGBA 3U4VA 2B63H 1I42A 5E4WC 2VUMG 1DM0B 1U0LA 1Q5WB 1ENFA 3MXUA 1PLFA 3EFXD 4JVZA 1LFDA 3I8ZA 2BS3B 2KJHB 4YTNB 1IZ6A 3KJOA 4DNIA 1WXQA 2VQEL 1PH5A 1QOGA 3PQIA 1YQ4B 1F9SA 2L7RA 2AL6A 1B7YB 5F2DA 4A3MB 1C78A 4HAEA 4FXKC 1ZXTA 1A70A 1SGHA 1HPCA 2WXHA 5EE1A 2H89B 4XYCA 2GI9A 2VB2X 3I3CA 1UWMA 3FAHA 4L23A 4MH8A 4DHJD 4E74A 3P4PB 1KFYB 2OEDA 2N8NA 3EVQA 1IYVA 4MN3A 1K3BC 3H0GB 1J0GA 1U4PA 1TVXA 1LTSD 2W9NA 5LNK1 2VS1A 4LFAL 3WANA 1VQIA 3W1BA 4BY7G 1FFVA 1I3QB 1H95A 4LNNA 3K5LA 3L0WB 3H7PA 1VQJA 2OHFA 4AOFA 3TJPA 2WHIA 3AN1A 4CKBA 5EBDA 4A3OA 2MCNB 4GLVB 4MTKA 4NY0A 3K5OA 4IN3A 4FF1A 1YEZA 4GKJL 2N3SA 4HIKA 1JALA 1XT9B 2JZ3B 1LT4D 4GSWA 1G8ZD 4TQ1A 4DV1Q 4PMBA 4DV6L 5BN5A 2FUG1 5CBAE 1E7UA 1Z47A 3VYRA 1VQ6A 1FL0A 4KKTA 1DOLA 1KL9A 3Q3JA 1SLJA 1JOQA 2LHDA 5EPKA 5BR8Q 1QCBD 2V4DA 4P73A 3PCOB 3N20C 4A3KG 4FXGC 3AU7A 1E22A 2WINB 4X3UA 1C0AA 3BZDB 1QE6A 4YTMB 3I4MG 3A7AB 4H7BA 3CCUA 4B9WA 3S1QH 1EIYB 2V9HA 3A1QA 1OQYA 2DZIA 5FK9C 5J39A 2CHWA 4N59A 1DGJA 4WJ3M 1C48A 3HGBA 4LF8Q 1H9SA 3CD6A 2MGSA 5C3WA 2A69D 1QVFA 4P75A 4G7OC 2IO3B 2YEPF 3RI7C 2F1MA 5J2RA 1VQFA 1E2VA 1VQ4A 1RRBA 5K36G 3V61A 1AP0A 4MHEA 1WFYA 2L52A 2KQ3A 1IL2A 4JI3L 1BKBA 1AEXA 2UXCQ 1AE2A 4F1SA 4EEWA 3K0YA 4GKKQ 3QCAA 4MGYE 2B63B 1XTDA 4DR6Q 2QDLA 4REZA 2ICIA 3WA0A 2OTLA 3Q6BA 2KUMA 4BY1H 3E6ZX 2WXOA 3SFDB 2EVBA 2KO3A 2ZNVC 3PT2B 3NVYA 2CW0C 4A3JH 2Q2UA 4NP5A 2K75A 1PH2A 4OX9L 4PS7A 2FCMA 2BB5A 4GXBA 3S1MH 1DXMA 1Q0WB 1ZKHA 5COYA 4JPSA 4OONA 1NY4A 4ME3A 4LF6Q 1CKMA 1YQ3B 3A5UA 1T0YA 2F0QA 1ZDVA 2EY1A 2IHFA 3J80L 5IYDH 2NTSA 1OTRB 2K8HA 3N32A 3VVWB 1IBXB 5FO8B 3TIXA 3NEMA 2WXQA 2QEJC 5TSSA 1NJIC 3GTOH 1X3PA 2MHVA 1V81A 4J8QA 2QF7A 4KGTA 3RULA 4ID6A 1ML0D 5I6WA 2WYQA 3OIQA 3T56B 2VZKB 2NZOA 3EJIA 2DZKA 4X3SA 3Q3FA 4LDTB 1KAWA 3S14H 1WR6E 1LTBD 1MI2A 1EEFD 5CV9A 2R2QA 3J9CA 4GNXC 1YI2A 3H3VH 2FCSA 2I1KA 1LM0A 2MEKA 1UGJA 2RSUA 1KOTA 5T1IA 1HA5A 3L17A 3Q8EA 3UQBA 1K9MC 1QB5D 1MG4A 3X3MA 4YT0B 5IP9G 4NQKE 2DUDA 1TKGA 3ZRCA 1XCQL 1X3GA 2V3PA 2SEBD 3M85A 2WXLA 3Q8DA 3A9JB 4L2YA 2RHQB 3L54A 2IY5B 4IUQA 2K5NA 4IPGA 3S1QB 2PVGC 2ES2A 3GTJB 2KN4A 3AEGB 2JP1A 2KC1A 2NZHA 4LTUA 2RQXA 2UUAQ 3VDZA 1SNOA 3L2PA 1UNSA 4ZK9B 4FYDA 3KF6A 3DVGY 1K53A 4OVUA 4WRDA 4N9F4 3VR5A 2BT6A 3PF4A 1SNMA 5JZEB 3DQVA 4OELB 2EJMA 2KT7A 3ZVVA 1OXTA 1BMLC 3NWTA 4IOAA 1X3QA 1K50A 3MA2B 2A69C 4JI7L 4EE2A 2AKWB 2JWZA 2MSED 1WX8A 3UINB 4BY1B 4UPAA 5TR5A 3B9JA 1WX7A 2N49A 1PH4A 4A3JB 1S5CD 4L1BA 1A2UA 1D2BA 2LUMA 2E76C 1TS3A 5E3FA 4QIWE 4AYBE 3V60A 3R7QA 4LW1A 3GP7A 4BWGB 1YNNC 3S1MB 2LKVA 5C4ZA 3A9JA 1MJEA 3M7GA 1C9FA 3JSVB 3S2AA 5ELEA 2AEHA 4CYEA 3A5ZB 2MQHA 2NBVB 4CQNA 4DHZB 2NVQH 2F4VQ 1X3EA 2M17A 5C5MA 5CR3A 1LXDA 4FF4A 3SVMA 1HEZE 2LI5A 5D7GA 1XLNA 4KD4A 3BVZA 3NBHA 3M4OH 1RFAA 2KDMA 3HVZA 3PVLA 3AE4B 2DZMA 3CCVA 1IYFA 4G50A 3APDA 1FJGQ 3NVZA 1KLGD 4A3LH 3VTVA 1J8CA 1DJRD 1PHJA 5JVG3 3S14B 3ZNZB 2KWVB 4DA2A 2EKIA 4ULLA 2I5LX 2HE7A 2JRIB 4ZRQA 3KUZA 4X6AH 2I46A 5IP7G 4N58A 3KYCD 4A3GB 1K0RA 4YCVA 1B9RA 5GAHC 1HZ6A 4B9KA 1A3TA 1F2YA 1PRTD 2MJ3A 1S5ED 2SAKA 2WU5B 3GZNB 4RMAA 1EYAA 4A6QA 4RKBA 2K5PA 1V86A 4HK2A 3ULPA 1V9JA 1KIXA 3P75A 4W9CA 1WTPA 2G4DB 4TQUS 4EOYA 2WXFA 2MWSB 4HCSA 1FRDA 3I3TB 3CF6E 2N4FA 2RKSA 2V1YA 1HNZQ 1WSPA 4WJOA 3WALA 3DBRI 1WR1A 3PREA 4DUYL 2F0WA 4OO1H 3K8AA 1FIQA 4RG1A 1VQCA 3T8MA 1WXMA 1OXUA 2Z59B 1E7VA 1EFID 1C3TA 4POGA 4HLEA 2IL8A 1Q82C 3NVVA 2G45B 1BCPB 2EXDA 3QQ8B 1KRTA 4DXFA 1KNEA 2K6QA 3TMPB 1EYCA 1EY8A 2JA7G 5DPWA 2ALYB 2PJHA 3SU8X 3M3YB 3QG1A 2HTME 5AZHA 3TEXA 4M00A 4PZ6A 1EY9A 1T3QA 2YV5A 4X62Q 4X66Q 1WXAA 2A68D 2B2VC 4ZUJA 4OZAA 3M62B 2MRPA 3ZGZA 2M8SA 3B1LX 1WJUA 1HR0W 5D94A 3I9V1 2BYEA 4DGZA 2NVQB 2A8VA 1VF5C 4JWUC 1EM7A 2HJ1A 1OQQA 1EY0A 4DV2Q 3KLSA 4BBSH 2AQ1B 2VL6A 1VLBA 2X69A 3M4OB 2PI2A 1E9MA 1XQQA 2K1FA 5AUIA 5IGCA 1WX9A 1WMHB 4A3IG 2L0FA 4HPMB 3CAMA 4ZOHC 2DGYA 2DYBA 2GVAA 3HM3A 1WGGA 3A9KB 2I38A 3PLUA 3W5OA 3A8KE 4P6VF 1IW7C 2R6GA 5BN3A 5D3DA 3M3JA 3D8GA 3N1YC 1QUQA 2NUCA 4JQWC 2BW2A 4DWFA 4NAWB 1KNAA 1CQFA 3MZ5A 2WB1E 4QAYA 4PYZA 1U9RA 4RGTA 4UY8C 3AEEB 4K7SA 3NJTA 5JAVA 5FR6A 2Z4HA 2E2JH 1JWUD 4POFA 2D11A 4YWMA 2M2LA 1FNUA 5LL6S 3M7NA 5HGQA 2K52A 2UXBQ 1MHHE 3ZLZA 1F9RA 1KXLA 1MFWA 2Q8TA 2KLCA 1B1ZA 4JBJA 5H92C 2WQYB 5JEAH 4IJHA 3SR1A 4GGQA 1V9PA 5DEHA 2ZXPA 2MNAA 4DK6C 5E6JA 1MSGA 3NWSA 3AEDB 1WCMH 3HK0A 3J81c 5IO9A 2CH4W 1HZCA 4X65Q 1UD7A 3DVNU 1R4PB 2EJFC 1ZOYB 5M3FH 3OIPA 1WXSA 2LXCA 4G11A 1HQRD 2BWFA 1L2FA 3NTKA 4IWPA 4YWGG 2H88B 3A9KA 1F0ZA 1STNA 2AUKA 3HOZG 5G55A 3STBC 2L0CA 5IP4D 4R8NA 2RPQA 3AE5B 4NB3A 1HJPA 1T5XD 1E1TA 3VTWA 1PRTF 1L0XB 3MHZA 3NSWA 4NAWA 2HIXA 1WM3A 4HJGE 3U4EG 3G6JB 2PQAB 1DOIA 2W54A 2KECA 3SEBA 2KAJA 4A4IA 1A3VA 5L37A 2BB6A 1LTID 4RGOS 4DUZQ 4V190 2RBMA 2ZT9C 5J1ZA 3ERQA 1FJGL 1IGCA 2UYZB 3VTUA 1L1OC 1AW7A 4R4IA 1QQRA 1YVCA 3AMUA 2DJGC 4XXEA 4C3HB 1TWGH 5CV6A 3BZKA 2IW3A 1O7YA 2VUMH 1PDQA 4KDIC 3SK5A 4R4OA 2ZEQA 2LEKA 2QDFA 1STBA 1TZOA 3CRKC 2MBEA 4BBSB 1O80A 4A3FB 4PMWA 4BBNC 3B2GA 4MH0E 4W9EA 4JL9A 2DNFA 5CHWA 2KX0A 2A6HD 4DV3L 2NS5A 1PH9A 1EY7A 1V43A 5G5GA 1EQTA 2NWGA 3DEOA 2EKEC 3J7YW 4WJPA 1Q46A 1GUNA 2R92H 1G51A 1R4NB 3UDFA 3RUIB 4FJYA 1HUMA 3KF8A 5T8IA 1STYA 2V3NA 4BY7H 2PQAA 1WYDA 3DBLB 3CMMB 2WAQB 1FCCC 3AU5A 3TP6A 4MGKE 3MEFA 1WYWB 4GLSC 2JA8G 3H8HA 2I07B 2KTRB 4TKOB 2Z8LA 1HNZL 2E2JB 4DV0L 2WXKA 1E8YA 2CR5A 1VDZA 4DR7L 1P3QU 1YN5A 1EIFA 1JOKA 1FNWA 4OWXB 3IVFA 4GNXB 2VW9A 1Q86C 4MJSB 2LJ5A 3OMCA 4LFBQ 3E9SA 3U50C 3NS1A 5H8YE 4ANXA 2SDFA 3S15H 2A6ED 3DWPA 2BA0A 3VH4B 3U9SA 4J15A 4W9JA 1WCMB 4IC7B 1B4OA 4F7ZA 1LTRD 5M3FB 3MJ5A 4AJYB 3EC8A 2INDC 3DOWA 1ZPSA 2UXDQ 3QWZB 3T9LA 2EDGA 3I4MH 4BXXG 4NXML 4WAAA 2K22A 4X66L 1Y69U 3AE9B 3CCLA 2K8BA 5IN7A 2Y0SG 2INPE 4FJZA 3HKZG 4BFRA 2D2CC 3V3XA 4URKA 3VQIA 2CCZA 1WRDB 4W9DA 3OLMD 5NUCA 1TWFH 2MBOA 4NW2A 5GMVA 3TCAA 2Q8RE 4C1NI 3HOXB 1WWTA 3RFZB 3GTPH 1QWYA 1K8OA 2F0KA 1SNQA 1Y8NB 4DK0A 1XNRL 1HTOA 1QOFA 2UU7A 1V1QA 1RODA 2DYMA 3MEHA 2K5VA 2HHHL 4ZLTF 1YNJC 1BXTA 1PXUA 4RCOA 4A3BB 4DR4L 1WY8A 4BAXA 4HN7A 4YCWA 1UWVA 1N6ZA 4LCDE 1IL8A 3K80C 2CKHB 3A74A 4TKNA 2VUMB 1WGRA 1II3A 1OO9B 2V3SA 3F8TA 3LJ3A 5M9OA 1NYQA 3E9HA 2J52A 2WACA 2JA6H 1OQRA 2EYLA 2YTXA 4X3KA 2JRHA 3GE8C 2GBKA 3FILB 3CXCA 1XYIA 3I55A 3P1HA 3SK4A 1CM9A 2PZUA 3OYYA 4HIMA 2J0MA 3NQIA 4F8CB 3LXFA 3Q8BA 1C7YA 3A4SC 2QDBA 3BVGA 4JI8Q 4HEA1 2JSOA 4JI6Q 2R92B 4C3IG 2I1JA 4RFBA 1MGSA 2F03A 4WAFA 4BY7B 4K81A 4JI1Q 4HJAA 1HZBA 4JI4Q 1E8ZA 2ZW0A 3TREA 3K0XA 4P7IA 4IOIE 3NRZA 4ZDVA 3EQLC 3HP3A 3SE0A 2DHZA 4BKSA 3OOCA 2EYJA 1Q90A 4RH6A 4FF2A 3IAYA 2C9OA 2HDMA 5KNDA 1WGYA 1VQ5A 1KRSA 4LF9L 1FMAD 3MC9A 4AS1A 3S15B 3CF5A 1D7QA 2XRSD 3RZOH 2LVQA 4HIDA 1PTOC 3M63B 2WIIB 1DOKA 5IYBG 2O6VB 2GMIC 1S5FD 2B29A 2KBNA 1SE9A 2O5IC 1Q8KA 5CV5A 1WE7A 4A3KB 1O7LA 2E5LQ 2IZVB 1NMFA 2B2YA 3PUXA 3PO2G 5BYQA 4DHZE 2TMPA 2V4LA 3I4MB 2IO2B 2Y3AA 3PMFA 4RNAA 1V6EA 3DHQA 2KFKB 4DNRB 3GTKH 3NG0A 3RLNA 2D3GA 3J80i 2BBCA 1Q81C 4BS9A 1V1PA 3GTQH 3BG3A 3H7SA 2KCCA 4C1NK 5GAGC 2WP9B 4M0WA 4LLGM 1I6HH 2ZJRA 1TWFB 4NMZA 3AEVA 1TBEA 3E9IA 1HHVA 2KJRA 4ZHOA 1DCZA 3W1SC 4LJZC 3GTPB 4E6IA 2R7ZG 4YWLA 1K3RA 2KC2A 4LWCA 4WFN3 1N5WA 1EF5A 4N9TA 3AH7A 1P0RA 1JICA 2FHTA 3EUB2 4FBJB 1BUVT 2YYZA 1NEKB 3PPAA 5DPRA 1TT2A 5FKAC 2B39A 3JAMc 3KWLA 2JA6B 3F2DA 2O6VA 3QJZA 3UDGA 1H8CA 1YBYA 4XDXA 5FO9B 2DBYA 2BYVE 5HY6A 2DJFC 4KV6A 5IODA 4CJ0B 2F0SA 2BE5D 5EQ0A 1H9MA 4IO9A 2VY3A 5M3MH 4WQOB 1S3OA 2VB3X 5I2YA 2WGSA 2ACZB 3MC0B 2M0AA 3U52E 4WORA 3VRBB 4LFBL 5AFWA 1QZEA 3NXWA 4CHTB 3L13A 3PIPA 3MTSA 2XN9C 3AYHB 3FEWX 4R4CA 4JI5Q 3DHIC 4JC0A 2CS4A 3P20A 3VYUA 3Q8AA 2UUBL 1P16A 3NVWA 1STHA 1Y1VH 3I4OA 4C56C 1YJJA 2CHBD 2UXDL 2N7DA 1Q10A 1SMYC 2ZVNA 2JA5G 4YY3L 1FR3A 2NVYH 5EGTA 3K5MA 2V0GA 4NXNQ 3RZOB 1FVIA 2XWJB 3H6NA 1CZWA 3PZ8A 4DR2Q 2F0DA 5IP7H 4ZUIA 1MIUA 3BJUA 3G7LA 1G6PA 2INCC 1WJJA 2SOBA 2O4XA 5LL6X 5JOBA 2JU6X 5IAAC 2I0QA 5IKCM 2A5UA 3NHHA 1TZ1A 3TS2A 3VA7A 1JQ4A 1PFMA 2JQOA 3GTKB 2MX2A 4RM8A 4Q0FA 3ZTDA 2OQ0A 1K8AC 4IWQA 2RF4A 4A8XC 3P42A 1UE1A 4A3EG 2ZXOA 2L32A 3GTQB 2MA9B 5DPTA 2VQFQ 1YJNA 1R9TH 1I6HB 2FCNA 4I6LB 1X32A 4CKCA 4XQJA 2G1EA 1F9PA 4EKUA 1CKNB 4B0EA 2UWQA 1XX8A 3T13A 5I2XA 1JC7A 4HEDA 2K5DA 1SEBD 4B08A 2ZM6Q 4KGSA 2LUEA 4B3TQ 3L4PA 1ZEQX 3I4NG 1YZ6A 2JYTA 1BOSA 5A2QE 3RZFA 5IT9E 3UGBB 1DOMA 3H6MA 3DLLA 4LFCQ 3S1RB 4JI6L 1GD7A 1CSPA 3T1HQ 4JK1C 1PZJD 1WVLA 2WXMA 1PDXA 5J18A 3QC8B 5JH5C 1BUIC 1SJED 4JI4L 3TEWA 1L1OB 3KK7A 1I6VC 1YNXA 5M3MB 1WRIA 2Z1CA 1WZ0A 1G291 1LTAD 1SE8A 1JT8A 2OF1A 1RFKA 1ICWA 3DWQA 3ALBA 3C19A 1Q1BA 3CCQA 1ZP0B 4FHJA 1DONA 3EN2A 1LTLA 1MG8A 2C35B 4CJ2C 4NZLB 3TEYA 3BVMA 2PMVA 1HA6A 4KZ0A 4KIKB 4A75A 4WWNA 3A4RA 3T53B 1SBBB 4A3IH 2AQ2B 1Y1VB 4MIUA 4WJWA 3JAML 2PLPA 4W9IA 5AZFA 3A7LA 1HH2P 4JG2A 2HD3A 1TY2A 1VD2A 2K33A 3U58A 2MH7A 3QAQA 2EE1A 2NVYB 4ME5A 1WTWA 4IKGA 1KABA 3QARA 3VH3B 3BDOA 4JYAL 2B2TC 5AUKA 5A2QL 1T0SC 5IT9L 3S17H 1WGHA 3FKIG 3FPPA 1MJCA 1XNQL 5D2MB 1SR3A 1K28A 4K6LA 4HJ8A 2KFJA 1H4RA 1C8CA 5KHOA 5FLMG 1PH6A 4LF5Q 4GOPB 1Q7YC 2YLMA 2N9XA 2KXJA 4I7ZC 3C2PA 3CHBD 4UDUC 2JY6A 2IY1B 3VUXA 5CYUA 4RGMA 2B8FA 3I5JC 3WIMA 1LYLA 1WTXA 1SE4A 1E2ZA 1RLFA 1R9TB 1TKWB 2F0FA 3PIP3 4B3SL 1F2LA 4MM3B 2JK8A 4GLXA 4RHRA 5AZGA 3HS0C 3BDLA 4IURA 3SFEB 3V6CB 5KNCA 1VQ7A 1YMHE 1LM8B 1WIAA 2R2OA 3Q69A 4ARCA 4ZRJA 1ET9A 2MPMA 1PYBA 3HOZH 2LZ6A 2M19A 3AULA 4US8A 4WURA 2EJGC 4KSKC 2WAQE 2JXMB 4XIGS 1UE5A 5GAEC 1Y1WG 5C4HA 2B2WC 2VXWA 2NCNA 3A8JE 1HTPA 3S24A 3HOWG 4P2CB 3J80E 3GTJH 4DR2L 2W3SA 2PPHA 1ISNA 4K8JA 2GBNA 2OCEA 2N9EB 1PV4A 4JI5L 2EXZA 2MP2B 4A3CG 1EQQA 4A93G 4IJLA 4PT5A 2PE6B 2KDFB 2IX1A 4W9KA 1A5RA 4JOIA 1HUNA 2ZZPB 2KWCA 4LUZA 1L6UA 3KYHC 1T9HA 4F88A 3QB3A 2MJ8A 4X64L 2IY0B 1YITA 3DPDA 5CTRC 4MGZE 1Z7TA 4NXNL 1KDAA 2DWQA 2LSSA 1B70B 4WWOA 1HNXQ 2JEAI 2N9LA 1WJNA 2FE8A 4ZRIA 2Q2IA 4A3IB 2CVRA 3DHHC 4B95A 3E0JA 5JPNC 2FBWB 1WF9A 3CSTA 1N8RC 2LFIA 2M00A 5JJKA 3O65B 3MVVA 4DR1L 4R3DA 4IFDJ 2BKRB 5DCNA 5AJ3L 2L11A 2IO1B 3MC8A 1J7BA 4AYBG 1DGSA 1GJXA 3W1YA 1WTOA 3NQTA 5LMUQ 3S17B 4BKSD 2JYOA 3MXPA 3QX1A 3VYTA 1KTKA 5JVH3 3LWUA 2N1WA 4HSVA 2DY7A 2V4IB 1G2TA 1O7IA 1OEYA 1E24A 2K3UA 3QWNA 2WKCA 1EWCA 3R93A 3K9PB 1QJOA 4LUVA 4DV7Q 2ZM6L 5I4DA 1K73C 2C7NB 4ZHPA 2KEDA 4KKUA 4PMCA 1XMOQ 1L0WA 1JRUA 2GBMA 3TEZA 1EWIA 2L0TA 4AQ7A 4JCVE 5IGEA 5BYRA 1VQMA 3ZO5B 4LFCL 2R7FA 1NMGA 3T1HL 4JBMA 1XTCD 1JCKB 2NPTB 1YN3A 2BGFA 2JWUA 3I70A 1VZ7A 3C3LA 3R3MA 2B2UC 1MSHA 4XDCA 1JRPA 2M56B 4DK3C 4OIKA 3HOZB 2WNMA 2WX1A 3A33B 4HJ5A 3DXJC 2JJQA 1IBLQ 4A3GH 3QA8A 1SNDA 4KHPQ 1E7ZA 4TUUA 3TP5A 5FLXc 5IYCH 2F4IA 3TZDA 2KQ7A 1EEID 2QKIC 4FN2A 2PZTA 1ZXHA 3OPOA 2XWBB 1EY6A 2WP8J 1I50H 2K28A 1IBXA 4KV2A 4J6HA 2BS2B 1K8RB 1XJVA 1PMRA 2O6VD 1CQVA 3E5SA 4WWPA 2LGYA 1GUOA 3W2DA 4DV5Q 4MELA 4IZ8A 2KTFA 4ZRPA 3L16A 2KHIA 2ON8A 3H1UA 5LMNQ 1CJEA 1RKNA 4HCPB 4IG7B 1BT0A 2F3VA 5DAUA 3GZNI 2PMZB 4AQYQ 5EPLA 4O1NA 2IHEA 4CDCC 2IYDB 2UU9Q 2NPTA 3L0OA 5C0XJ 3P1MA 4IUTA 2WS3B 5EPJA 3A54A 3L9AX 2F0VA 1C9OA 2B8GA 2QHOA 3T51B 2D62A 1JORA 4ITKA 5ELDA 3PUVA 1N33Q 4P74A 1TYGB 2CU3A 3M3YH 4C3IH 1AH9A 5JHBA 4XQNA 1HZ5A 2NN6I 3U4ZA 4EQNA 4AWJA 2F0JA 3HUIA 3URYA 1B50A 2N9PC 3UE0A 2L8JA 1OTCA 1NBWA 3OG5A 3ZDMC 1VQGA 4DAVA 1WD1A 2JA8B 4R4TA 2E8GA 1VQAA 2QA4A 4DV1L 1HRJA 3NTHA 5FJ8G 1U5KA 3H09A 4LF7Q 1P7FA 2WXIA 2GOWA 2JQRB 2JX5A 4BOZB 4BZAA 4RF0A 5BR8L 1BDOA 1V8CA 1FGBD 3R8BA 2NBFA 2ZTDA 3NELA 1N32Q 5IYBH 2KVZA 4QGUA 3U8ZA 3X23A 4YTPB 3ULJA 4JGHB 3PO2H 2EZVA 4K3CA 1LABA 5CV8A 3H9DA 4QF4A 2FIDA 2D3CA 2LS01 4LF8L 5AEKB 1X6OA 2W55A 4JV5Q 2Y0SB 1EU4A 4QCLA 1IUEA 2K9XA 4FO2A 5C3XA 2WDTB 1SJHD 2M9VA 3TMEA 1OFFA 3JSVA 3VR4A 4HCEA 3ZTCA 3CRLC 4DV4Q 2UXCL 1YOVB 4GKKL 1I50B 1MD2D 2R7ZH 4A3MG 4DR6L 1HNXL 1F52A 2O2VB 3PHXB 1Y56A 2HJ8A 3BK1A 5C4XG 2BYTA 1WGDA 2JE6I 4ILWA 1WD0A 4LJPB 4CDEC 4K5VA 2EMSA 2R3ZA 4DK5A 2FJ2A 1UAPA 1GPXA 1NENB 3H0GG 4I6PA 3VR9B 1MJDA 3CPWA 1V80A 5J17A 1K8GA 3QJYA 1V2YA 1XPRA 4J3OD 1PQSA 1KC8C 3KUCB 4X3TA 2CHZA 1HXYD 4LUOA 5LMUL 2XK5B 1TWHH 4HRSA 1SNCA 3GTLH 1OGWA 3FP9A 1RF2D 1BNZA 3I91A 3PV1A 3X0WA 4LF6L 4IUMB 5FLXL 4HJ7A 1D4BA 1TWAH 1P9DU 3L10B 4IUUA 2VH2A 4ICVA 3OWFA 2J7QB 1EQVA 2J53A 3BWUD 4OWTB 1VZ8A 4OO1I 4FP5D 4C3IB 2AWOA 3RR5A 3CC7A 2E2HH 4LNOA 2B3AA 3R3OA 1N5XA 1ZDXA 4UP9A 1WTVA 2IGDA 1EFWA 1K52A 5DPSA 4DAPA 4LJOB 1XD3B 3UI2A 1HZAA 4C3HH 5BMIA 4ASWC 1B9NA 2HQLA 2QGQA 1CTMA 4OXPA 4C3JG 4CO7A 4A9AA 2JA9A 4DF7A 1TS4A 1ZKOA 2FUHB 4A3FH 1U4MA 1SSNA 1E0ZA 3OW7A 2JA5H 1PFNA 1BBUA 5G5HA 5C4JH 4EQ5A 3S1NB 4IFDI 3S2HH 3NY5A 4KHPL 1D1IA 2PZWA 1ZGUB 1X56A 5I9PA 1C79A 4JI0Q 4KKIA 5BMGA 3ZKJC 4MSMB 4KTAA 2EYFA 1X65A 4QB4A 4AUQC 3BU2A 3KLRA 3PO2B 2F0LA 1NDDA 3IKJA 4H0LC 1ASYA 2PE9A 4QJFA 3I4LA 2UUAL 3DBHB 2QCPX 4AP4C 2LXKA 3T16A 4DDID 2HUGA 2N9KA 1GOZA 1FEHA 4HSPA 2B63G 4JBWA 5KYLA 3BK2A 4HKQA 4DV5L 1G6JA 1PFBA 4A3EH 4ZKCB 4Y7NH 5LMNL 1WOCA 1L0VB 4KJNA 2E2DC 2NBWB 4GIVA 4AQYL 3DVGX 1CHPD 1N34Q 3IBEA 2R7ZB 2I5HA 1ROEA 3MWYW 2YEPB 1PRTC 3TRZA 3ICEA 2FXQA 3DBLI 4K7WA 3RZWC 3PO0A 4FLHA 3E3XA 3Q8CA 1E3PA 3I4NH 4I65A 1WMHA 4DAYB 1N33L 2JF5A 1V97A 2X38A 3DBRB 3L08A 4KSLC 4Z9CB 1CK1A 2DAJA 1BQQT 2LWPA 4XDDA 1TWHB 5I6YA 1TIID 3GTLB 2KEEA 1L4ZB 1L5PA 2KDEB 2GBRA 2VNUD 1TWAB 4MT5A 4KD3A 1UEBA 1Q1EA 1X55A 2KVMA 4QQBX 2F4VL 1QOAA 2MP1A 2KCMA 4LF7L 4BA2I 4JX1C 5E6PA 1SYCA 3HOXH 3T3OA 4XT1B 5C44H 4F87A 3PIOA 1UH6A 3LB8C 4HDOA 2MBBB 3K9OB 2E2HB 2MJDA 4M8NA 2K14A 4C7ZA 4A3BH 2KNBA 1I5FA 1SSOA 3P4SB 3F2UA 2GRIA 3TN2A 1H9JA 2ZNVB 3QIAA 2IX3A 3SR6A 1WM2A 3A56A 5C0XI 1XMQQ 2AUJD 3PO3G 1GAQB 3PZDA 2BWES 2A68C 3CMEA 5D65A 2CJOA 3RNUA 1HTLD 1S40A 4XT3B 3PUZA 2JA5B 1GG3A 1SNPA 4ICUA 1TY0A 5C4JB 3R7RA 4B3MQ 3VRAB 3S2HB 3O13A 3VYSA 3HOVG 4P1CC 4NPNA 3FKIH 1L0YB 4O42A 4OZBA 2Y5PA 5G2NA 1RYJA 4JI2Q 4EGVA 2LVOA 2INNE 3WWVA 4DHJB 4ZQ3A 2RMMA 1VMPA 4BA1I 3N1XC 3MFGA 1ZYRD 1I94Q 1UBQA 3DDCB 4U673 1WXVA 3ZNGC 1WJ6A 4L5QA 2LXJA 2PTLA 1PGAA 3J81E 1SN8A 2L55A 3TBLD 1O7ZA 1CSQA 3Q3MC 4A3PA 4A3EB 4Y7NB 4GDKB 4G7ZC 4IALA 4EZJA 5IGDA 3HOUG 1OXXK 1D5MC 1CMXB 2LGXA 3KQ4A 1E2WA 4II2B 4USAA 3NENA 4A3JG 3T1YQ 1FPYA 1SRUA 2C7HA 4GN4B 1C4QA 3ECIA 1SF0A 2MJEA 2IO0B 3PUYA 3EHVA 3KYDD 3VXWA 3CCEA 3RT3B 1NCVA 4KMUC 3I4NB 3IG3A 4N6EB 4GN3B 4PQXA 4A3KH 4B3RQ 3Q3OC 4K3BA 4KK7A 1EWHA 1EYDA 2H1EA 4KZCA 1GKHA 1JJGA 1ICFB 5IYDG 1T5EA 2HTHA 3AFPA 1EOTA 1RDPD 5JXVA 2G5DA 3HOWH 3KLWA 1ILQA 4X62L 2HCCA 2N0SB 2RHSB 1FO4A 1EY4A 2PO4A 5CBEE 2VZKD 3EBEA 2ZPYA 1OXSC 4U68A 4A3CH 3L7ZC 5G3LD 4LDTD 4R4QA 2QILA 5FR3A 1NUCA 4JOIC 3BIID 2KTRA 4DV2L 5C44B 2L3ZA 2OOBB 2BH8A 2RDGA 5K36H 2MO1A 1GB1A 3F2BA 3VR3A 3J81L 1SROA 2QW7A 3FVQA 4GNXA 3PHWB 4MJSA 2BOSA 4K0KQ 4M8MA 1GO3E 4JI0L 4DAMA 1C77A 2NR2A 1BR9A 2SNMA 3R66C 1CZGA 3NP8A 4HCNB 2ZXRA 2IDYA 3K5NA 3M4QA 5T1GA 4NJ7A 3GV3A 1OEYJ 1F2MA 2AQ3B 4XX5A 3ONSA 1WTRA 3ZUNA 4L8JA 2IGGA 4L63B 2XTIA 2BTEA 3IL8A 3FKIB 2X6GA 1SIJA 3ONAB 2DNEA 3D6WA 1A2TA 2JEBI 4GS3A 3I56A 2UXBL 3B0AA 1VQLA 1FXIA 3NHEB 4LF4Q 5E1FA 1E5WA 2VRRB 3MJWA 2A6HC 2V1CC 4HPLB 2CHXA 1KHIA 2NN6G 2PMZE 4CGYB 1LACA 4IUPA 2ICEC 1YHQA 3PF5A 4X65L 2NVXH 3ITPA 5J22A 3PIO3 2RDBC 2G9DA 1R4MB 4US9A 4OVVA 3VUWA 3PRPB 3UF8A 1EY5A 3D4WA 4OL7A 1B8AA 3KFUA 3RMHA 4JIOU 4RKLA 4H2AA 1IBKQ 1Z5SB 2RA4A 1QZGA 3BY4B 2ZJDA 3V2TA 1J8IA 1VQPA 1Y8PB 4K2KA 3DWMA 1SB3C 3FILA 1IHZA 1IBMQ 5CX3A 5IP9H 2L05A 3Q0AA 3QO2A 1UGMA 2A6EC 1Y1WB 5DNFA 1RTOA 3UQAA 5EE9A 4HXDA 4DUZL 3HOWB 2WKDA 1KH0A 2EYHA 2MQJA 4V0BA 3SXHA 3GV6A 1QZHA 1PUTA 3K7UC 1CHQD 4JW0A 1E8XA 2DLBA 2ZJPA 1YJ1A 2DY8A 1J9OA 4OIJA 4A3LG 1S5BD 4A3DG 2LGSA 3IAS1 4FHKA 1P98A 1A8VA 1FRRA 3DVNV 1JOOA 4TMAB 1LT3D 2MW5A 4MTNA 2VQEQ 3W1GA 4B3ML 2JXXA 2WX0A 2K1BA 4UP8A 3BDCA 2BS4B 3C1EA 1GHJA 1C4PA 2LD9A 2IPKD 4JI2L 4ANUA 2O5JC 1Z2MA 1RJTA 3S1RH 2Y0SE 3DUZA 1D5XC 2KMCA 4CDDC 3KDFB 1EO6A 4XWWA 4OZCA 2WWZA 1YIWA 1I94L 1OXVA 1SXTA 1F1HA 2YTVA 1AN8A 4GOCA 3ER0A 4YSYB 3VR8B 2KDBA 1IKLA 4WQMA 2MFIA 2N88A 2I5MX 5G3LF 1CI3M 4RGNA 4LFAQ 4HROA 2ASBA 4GB9A 3IT4B 2Y5CA 1QOHA 2KFKA 4LK0M 4ALPA 1UUPA 1WI0A 3DBSA 2FAZA 2P5ZX 3Q24A 4R1JA 1E10A 1QNKA 3BYYB 5FJ8H 4OO1G 3D6CA 1JB7A 1KJTA 1IGDA 4GKJQ 1JQYD 5CMDA 2WXJA 4NJCA 1JJ2A 1GUGA 2UUCQ 1BCPD 2NVXB 4KY6A 4FXCA 4DXGA 2KX3A 2L15A 4B3RL 2ATWA 5IY0A 5EKIA 1TTNA 4HJ9A 4PK1A 1JWMD 1TR5A 2BYFA 4F7XA 2ZPNA 4PYUA 1DZ1A 1GC7A 4WWMA 3VDYA 2IT1A 3KDFA 4K5XA 4TSSA 3S9WA 4YWKA 1E90A 3ZJVA 4IFDG 2YVCA 5H1SE 4F8MA 2BF8B 4B9XA 1U4AA 2B2VA 4K2LA 1AZPA 3UI3A 2F0UA 2XSCA 1VQNA 2K4KA 2ZTEA 1CZPA 4TQ0A 3RNGC 1I4GA 4O2DA 4R9WA 1PRTB 3DMUA 2OXPA 4K0KL 1AWDA 4HR7B 2EMTA 4JWSC 2EOTA 3RNBC 1FXAA 1VQKA 5C4XH 4KJOA 2N78A 1YNTE 1Q3LA 2EPBA 2HT1A 3JAME 3RLFA 5CC4A 3NS8A 1I4PA 3KBGA 1QNUA 4DK1A 4GMVA 2AL3A 1SAPA 5HFYA 1XLPA 4C4VB 1BBWA 5BYSA 1F77A 3APFA 2J7ZA 2WAQG 3PUWA 3EROA 4JI8L 2G4SA 3MHSD 4KDLB 4RCNA 1VCIA 4G57A 2IWHA 1GUWA 2E75C 4OVZA 1G2SA 3AQQA 4I7AA 3RLOA 4BBRG 2HDLA 3M9BA 4Q5VA 2JA7H 3NOBA 2KOLA 3A55A 4JI1L 1B3AA 3Q23A 3M4PA 2L1AA 3C1FA 3J81j 4HDQA 1S72A 1VCBA 3ZDTA 4AH6A 1VS0A 2BCOA 3LWEA 3U2SC 2AHOB 3J7AF 1KQSA 2H4OA 1WCMG 3MXGA 4G4KA 5KEEA 5LXIB 4C00A 2A19A 3MP9A 1PFSA 3N6RA 1SMXA 1SYFA 1Z9FA 1R7SA 3PZ7A 4FNFA 1LV9A 1RTNA 4MZ9A 2BE5C 4C3JH 3IT6B 2BA1A 2EY5A 1IPGA 4RWSC 2D5GA 4OGQC 3K6OA 2FFKB 1VQOA 4NDXA 2KMMA 1CKNA 1LT6D 4IPHA 2EYPA 1IBML 3AMZA 4DR5Q 3IRBA 1F2ZA 2E5LL 1MI0A 4XE0A 3ZXRA 1RD9D 3ZNHB 1N60A 5C0XG 2IBIB 4APVA 3TUOA 1L6VA 2JSVX 3SK6A 3EFCA 1EZ8A 4M02A 2F0IA 4JBKA 1B9MA 1EUVB 4K7UA 1IYJB 2CFMA 3H7PB 3E0EA 4HMJA 2D10A 2K6DB 1YHAA 3OJ4B 2L76A 2CW0D 4CBVA 3TQYA 2RD0A 1MHWC 1L1OA 2A73B 3W5VB 3SD5A 1L2NA 2RCNA 4RHSA 2KQSA 4A20A 4OWWB 2M1MA 1SDFA 5JHAA 1K0SA 1F9JA 3QHTA 1PTOH 3ZYYX 1BCPF 2PIAA 2GN5A 4XZ4A 2Z4IA 2IGHA 5E7NA 5C4XB 3CC2A 2K01A 5IE8A 1LQBA 2MLBA 2JT4B 5C2TB 3H94A 4KIKA 3I90A 5IGGA 1YQBA 2FMMA 4KY7A 4JI7Q 1JROA 1XEEA 3VR6A 3P63A 2NZ1D 4FJVB 1I35A 1P8LA 2BH2A 2R92G 2KDIA 4MDKE 4J6IA 3A1QB 3ERSX 1M94A 5GXGB 3I63C 4ZKBB 2MBHA 1CUKA 2GBJA 3P2BA 1H9SB 2K03A 2C60A 2DX5B 2YTYA 4TV3A 2JZZA 3V6EB 4YSXB 5LXHA 3ZRFA 3UIOB 1PA6A 2JA7B 3EGRA 2F0HA 1PZID 1LGRA 1SIFA 3Q14C 1NE3A 1P1AA 1HZ9A 3AE8B 2K50A 2UUCL 2F0PA 2ZW1A 3IHPC 5KIXA 4ANVA 1VQ8A 2WV6D 3W3AA 2KN5A 4GOPA 1BO0A 5KRUA 2D3AA 1NTGA 1GB4A 3DM1A 1I4XA 2F3IA 3Q6SA 4E71A 3CMAA 2CJNA 4G3XB 4C3JB 4MM3A 3AFQA 3PO3H 2Z6KA 1VF7A 3CCJA 2K5WA 1N36Q 4YCUA 2MP2A 3DHGC 5DLQE 1N63A 4ZAIA 4QL5A 5HG2A 1CA5A 1NI2A 3M95A 3HOVH 4DBGA 2GLSA 4DFAA 3SGIA 4FVMA 4NPSA 3ZIMA 2M0XA 1EU3A 2ZCBA 2XIWA 5GROA 2N1VA 2LY7A 1QT9A 2QJLA 5EJWA 1N9WA 2PW7A 1FGUA 2QCZA 4QMGA 1XWEA 2L9HA 2VQFL 1PH8A 1FFUA 2J4XA 4RA8A 2JA8H 3OMGA 3F1ZA 2KYWA 1N62A 3CWIA 4GN1A 4MSQB 5EAYA 3I73A 2E6XA 1A6XA 1YNND 2Q8IB 1ACCA 3K7AH 5M5YH 1RCVD 3I72A 3CCRA 1F2RI 2M4NA 4ZYNA 3OHXC 3D4RA 3DWAA 2JA6G 2RPVA 3HOUH 1PTOB 1G6ZA 1YX6B 4DUYQ 4TVAB 4B3TL 4A90A 1K51A 1HR0Q 2PCFB 1PFDA 1UBIA 1ESRA 4MGIE 4EFOA 4UHVA 1KM7A 1QILA 1Q8IA 3VR2A 1T0QC 1D3ZA 4PS3A 1WGKA 2RDFA 3AV8A 1PYWD 4J1MA 2DYOA 4NJ6A 3OJ3A 4EX5A 3ZJUA 1STEA 1S1QB 4TRDA 4KVGB 4K6DA 1GUAB 2R7DA 4BKGA 4BXXH 5E4XA 3IAM1 3HM6X 2OTJA 2EIFA 4KI0A 2J0TD 3SDZA 3KF6B 1VQ9A 3AE7B 2CKZB 3NK9A 4PZ8A 1YJWA 4WJ4A 4LNFA 3RNEC 2XRQD 4NQLB 3HRZC 4S17A 5JEAJ 3CW2C 5M5WH 3GB1A 2ZTCA 4KN4C 4W9LA 1X1MA 4H13C 3H3VI 3SHQA 2CQOA 5D6JB 2NB0A 1GJZA 3OW2A 3CU7A 1EIGA 5D14A 4DR5L 3NZUA 2KJXA 2BDNA 4XWTA 1PH3A 2CU1A 1Q12A 3GDEA 3MXNB 2FINB 3LDZE 1KLUD 3FHWA 2LRWA 2EQSA 2K5HA 3J7AV 4DXAB 3JW0X 4WJNA 2J0KA 3K59A 3K57A 3PO3B 4GZYC 5KGUA 4WJQA 2CQAA 5J3BA 5EDSA 3BS1A 1RAXA 2A4ZA 1JWAD 1XF5L 3N30A 4EQOA 1J7AA 4K5WA 3PSEB 1M8AA 3HOVB 1JE4A 1MVKA 4NKLA 5C3EG 1MPEA 2W82A 2KJ6A 4LF5L 5I9OA 1TS5A 4FXDA 3TBIB 1D5ZC 1R4QB 3G48A 3NBHB 3I57A 3KUPA 3W1SA 4AIMA 1IKMA 1TKYA 1KF6B 3VHTC 2NN6H 2X6LA 1TS2A 2TSSA 2F0GA 3JYUA 2L4NA 1WH3A 2LVPA 2XBBC 1S4ZA 4JLCA 3ML8A 1GC6A 3F2CA 2R93G 2KK8A 3GOEA 3BYTB 4Y52H 3D4DA 4H02A 3OWEB 5K5PA 2RDHA 1MBYA 3K7AB 3J81i 2F3WA 1STGA 5M5YB 1G91A 5M5XH 1TIFA 4HMIA 4M1UB 1X54A 2ID0A 1IYUA 3MXNA 4M8AA 3HOUB 1B3QA 4KKJA 1PVOA 3S1NH 1CFMA 3FDTA 1XPUA 3HOYG 3CSFA 4YHHQ 1BVSA 3BINA 3H91A 4XTCS 3CP0A 5FLXE 1JW9D 3PGEA 1E8WA 4L5TA 5M3MG 4R8IA 5IWAQ 1MHXA 2NBUA 3ZXVA 3DEPA 2B2YC 4AJWA 1EYGA 1YJIA 5C6AA 3ABVB 3PRZA 5EE3A 2MO0A 3GE3C 1IXRA 4ACFA 1FNVA 2WB1G 1QVGA 1BF4A 1AFPA 2J0JA 2KCNA 5CHFA 2Z0DB 3GTOB 3RMKC 1XXGA 2N55A 3HKZB 5EBCA 1IW7D 5L83A 4IQZA 1TT5B 4GLAC 3U7DA 2J42A 4K14A 1Y1VG 5HGTA 1WJ4A 2A5HA 1PGXA 2Q2TA 4A3DH 4W9GA 1JE5A 4XC2A 5EE0A 3OTOQ 1N36L 2WLBA 3IXSA 1TKEA 1VQEA 1JR0D 1E0BA 3HIZA 2LXAA 4P71A 3DBHI 3NTIA 4EQPA 1HE8A 2REXA 4YXDB 1RWSA 4G0NB 2BVCA 4DV3Q 1O78A 4PZ7A 4A76A 1P7EA 3CKIB 1KD1C 3LX0A 3MAQA 2NTTA 1V5TA 3CIRB 2PVOD 2K0PA 3FC4A 3H15A 1I4QA 3LGJA 1HCZA 2OEOA 3TP7A 4LMQD 5FO7B 3WAMA 3RZDH 3STBD 3KW5B 3AB9A 2XNAC 1PYSB 1Z6HA 5ELNA 5ISRA 4DV7L 4DV0Q 1WTQA 1D8LA 4ZYSA 3NE5B 1XMOL 4DR7Q 1HR0L 3BZCA 2WXPA 3HHMA 2RCFA 4KLKA 3WDNA 1E7PB 2QMTA 1D6EC 4LNIA 2LJIA 4KX6B 4RM9A 3NZ3A 1XO3A 3OAWA 2O2VA 1S3SG 3B6YA 4GN5A 3U7ZA 4MEMA 1C4AA 3Q8FA 4FDBA 3UDIA 4XYQA 1UWXA 4RF1A 3LYYA 1H9RA 1ONLA 4GDLB 4PV1C 5M5XB 1QUQB 1TGZB 5LLIA 3P4QB 2Z0EB 2E2IH 2RR9A 2RSNA 4IM3A 1IBLL 1QF6A 1K8MA 3APCA 3EA6A 1A62A 3A0JA 2MHJA 2MBQA 3RYTA 4HPPA 4H44C 2Y5BB 2OQKA 1CA6A 1X3FA 4NXMQ 2EYMA 2MUYA 4XQQA 4IFDH 2XK5A 3KUDB 1MKHA 3CQZH 2NVTH 1HFNA 3SHLA 5HURA 2WXRA 1C4CA 1C1YB 2K05A 1V1OA 4KGRA 4GU2A 4HIOA 1NR4A 3IFWB 3ETRA 1WE6A 4QY7A 1YJ9A 1ENAA 2JPHA 1XNRQ 3TSSA 4OHJA 2SNSA 3QOLA 3CCMA 1KRHA 2XEWA 2HHHQ 3DM3A 3FPUB 3FRPB 2F0TA 5C5LA 3U9OA 4DR4Q 1UE7A 3RUZA 2KENA 2PQEA 1R4NI 4A3DB 2UU9L 2HDEA 5EKLA 3TEHB 2DN8A 1YHBA 2KD0A 4EVOA 4GDLA 2B2TA 3CC4A 3V05A 2Z6BA 1A63A 2C9WB 1FD7D 5HKHA 3SK8A 2NVUI 1YIJA 1VQHA 4CJ1B 2PKOA 4DPGA 2KZRA 4KHZA 4BBRH 4YSZB 1LTGD 1TJEA 3EFUA 4HJKA 1FD6A 3TS0A 2RGFA 1Y8RC 2BPSA 1J19A 3RCZA 5D3IB 5LMNW 1F9QA 1HNWQ 1YN4A 1RHPA 1QOBA 1EIHA 2D5DA 3RZDB 2QSDA 3AU4A 4OW0A 1SYGA 5JPMC 4OEMB 5ELBA 1Q1OA 4IM0A 1B44D 4XYOA 1SFOH 1DOYA 2PNRC 4K8IA 1HQMC 1LO5D 5JJLA 4NNJB 3MTNB 4WH4A 1NNXA 3I7FA 3UE1A 4YHHL 2BKFA 2JZPA 1AARA 5DM73 1N32L 1NAPA 1QVCA 2Q2HA 2OWOA 3JVZX 4LF9Q 3RN9C 1Y14B 3GO5A 3GS2A 5IWAL 4II3B 4KN7C 5ELCA 1KLVA 2G3QB 4MNOA 1KDBA 1V5OA 5C0XH 2A1AA 1YNJD 2B2WA 3KF8B 3RPFC 2QEXA 4DAYA 2VZAA 2E2IB 1XCTL 5CHVC 4C2MH 2XGTA 5IIFA 4JV5L 1TQOA 4IPCA 2WU2B 3AEFB 3A8IE 3G4SA 1ESFA 5IOCA 3KWVA 5L95C 3AE3B 1W3SA 2IX0A 1V8QA 3I2ZA 4IDIA 3CQZB 1GM5A 1B2TA 3D32A 3RNCC 2NVTB 2L12A 2EY2A 4DV4L 1YD8U 3CCSA 2CWPA 3K81C 2N7JA 3OTOL 3GD7A 5FLMH 2K5QA 1ZW7A 2KHWB 4ARIA 2KHJA 3GQBA 4ANWA 1VZ6A 4QUCA 3GTGH 5DM63 3CPFA 4YIJA 4ZRKA 1N61A 4BY1G 4DKAC 4DNTB 4P16A 2AX5A 3KVFB 2H5XA 4FF3A 4DR3Q 4YL8A 2LFNA 4B6WA 3AEAB 3JAMi 3MHBA 2B76B 1SYBA 4KHVA 1I4RA 2PNHA 4S0RA 5BMHA 4LAAA 3PS6A 3RNAC 1FYCA 4BBNF 2PYKA 3PV0A 3B08A 1Y1WH 1R4MI 2KQ4X 5E6NA 1EWYC 2KMAA 5CV4A 3N1ZC 2D0PA 2ZCCA 3HKSA 5JJIA 4BOSC 4BBRB 2DENB 2ZVOA 1PTOD 1T6BX 4CHKA 4O0AA 1VQBA 4BKTA 1QG7A 4IUNA 3G71A 4Q2JA 2RSOA 5HI1A 2WFWA 2EYOA 4A93H 2JUOA 3AECB 1VDVA 4MACA 3UIPB 1CT1D 4LNKA 4GOPC 1TU2B 3OSOA 3NZSA 1ILPA 2W3RA 2UUBQ 1NYRA 3FMCA 2FNJB 1L7YA 4DDGD 1VQDA 1SFOB 3ZJYC 3U30A 3QIJA 1EUJA 2R61A 4GDKA 3SDLC 3VAWA 2B2UA 2Z6KC 2N7EA 4M01A 4N8X1 2D9UA 4YY3Q 1UELA 4JPBW 2WXNA 1EZ6A 3ML9A 4A3GG 3VFKA 2WDVB 1DYQA 2EELA 3R2IA 1VRAB 1KAAA 1EL0A 3L3OC 5IYCG 1NVID 4C7YA 3PLVA 1Y8OB 2HIVA 2K6AA 4C2MB 4IUVA 2L83A 2JYEA 2VH1A 2X8XX 2WDRB 2QC8A 2Z0SA 1A15A 4HVBA 1BBXC 2D3BA 3PRMB 3RNFC 1FCLA 2E74C 2Q5WD 5EKKA 3HEJA 3AEBB 5FOBB 4UAIA 3C0RB 1XPOA 1STAA 2KANA 1TWGB 1N34L 1RIPA 2AWNA 1GHKA 1J5EQ 3D0FA 3S2DH 3RD2A 2DAFA 1SYEA 3TZUA 3ULLA 1DD2A 2GA4B 1M90C 3QR8A 1WI5A 3GTGB 1WTHA 4DQOC 4X57B 2DZJA 1LTTD 3W9CB 4IWOA 1ZYRC 3HRDD 1U4RA 1U4LA 4WIPA 1M1KC 1AYFA 3ZJTA 4HTHA 1KDCA 3NUCA 2KOXA 1X9NA 3AB5A 3QOJA 4L5RC 2F0OA 3FKYA 3Q2AC 5A35A 3UDXA 2KWDA 3KH0A 4K1RB 3IFDA 2KVRA 4RMFA 5C3JB 5ELFA 3AI5A 1HNWL 2LGIA 4S3SA 1V1PB 1ZE3D 2JXTA 2LGDA 2PW5A 4M0WB 1SMYD 3DWGC 3EIVA 2EY6A 1PZKD 4ABNA 2AWTA 4I6NB 1VMCA 4HWIB 1ET6A 4E3CA 4PS8A 2D07B 2HQEA 2NYZD 1JMLA 3DCGA 1RL2A 1B53A 3G6EA 3J7ZC 1RM6C 4LNQA 2A74C 4L5SA 3C8YA 2PW9A 2Z9HA 2ONQA 3P4RB 3TL5A 3T3NA 4FULA 1FXTB 4HKZE 5IGFA 4A93B 4G7HC 1XMQL 2LMCB 4C80A 4DU9A 3P7JA 3D3RA 1QKZA 2HCIA 3GTMH 1QLBB 2KWUB 2C5LC 3ND9A 3ZW3A 1WZ3A 3AM9A 1H9KA 3T4AC 5IA7A 3W5UB 4FA6A 5ELOA 1JB3A 2WDQB 5CV7A 2AYOB 4FADA 1SYDA 5KNBA 1I4HA 2GVBA 1AE3A 5IGBA 4JYAQ 3HKZE 1YX5B 2FIFA 1IP9A 1JWBD 2ENBA 3KOJA 3TDQA 1FM0D 2D2QA 3WOFA 1PTOF 5JJZA 5C3EH 1NSNS 1XNQQ 2PEAA 4ZRZA 3MFYA 3X3NA 4AYBB 4QIWB 2K25A 3HVDA 3WAPA 4B0MA 4KKSA 4EZLA 1UE6A 1V49A 2E3TA 1DOXA 2K7VA 1J7CA 4P72A 4D2KA 3N52A 1LT5D 3S16H 1AZQA 2C5CA 1WFQA 5KYIA 2L1BA 2K39A 2YU9H 1GUSA 1WYGA 4CDFC 4EUTA 2LASA 3K58A 2R93H 1VR9A 3PSIA 4DR3L 3RD4A 1NI3A 2WXGA 3T1YL 1UZXB 2LMCA 2KKCA 3WOEA 1K83H 4B3SQ 3S2DB 3WAOA 2F52A 4DV6Q 3ENEA 1UEAB 4IPDA 3HOYH 1ZXIA 1GUTA 3ZQ4A 5IOIA 2BDOA 3HG9A 2QIEB 3V62A 3D31A 5CGKA 2OT2A 3R2TA 3AXCA 1EOVA 5HHDG 5C23A 1NBFC 5IT9c 3PTFC 4PNYA 4XGAB 5C1ZA 3V96A 3RN5A 2KA7A 2KCTA 1ENCA 3HZXA 1C76A 1SE3A 1TWCH 2F0NA 1F2RC 1L4DB 2PI2E 3NBIA 1LUZA 2OJWA 2PPBC
chains in the Genus database with same CATH topology
3IFTA 4C3HG 2RVLA 2GB1A 1W6JA 2DNCA 3TP8A 1JWSD 4ODGA 3AE6B 2KHSA 3AE1B 1D1KA 4JE3B 3NPPA 1NR2A 1LLRD 4KY5A 1HFGA 3NUHB 3GTMB 2NMQA 1W6KA 4RAUC 1E6EB 4N9PA 3LNNA 5BN4A 2LHEA 2G9HD 3H3VC 2O2LD 4LK1C 3KBXA 5LHY1 1I7HA 1A3UA 5C3EB 2XVSA 2L5TA 2K32A 5JEAG 1VJKA 2I2YA 1XLQA 4L6TB 1XLOA 2K04A 1S5DD 3S16B 1ZUD2 1SE2A 2YU9B 3WCQA 3N9YC 2R93B 2FMCA 3VA5A 2F0MA 1K83B 4NAMA 2KACA 4QUFA 3Q22A 3C46A 3KLSX 3HOYB 3E56A 4A55A 3ND8A 2F0EA 4DN4M 2IJ0A 1BCPC 4CKEA 5CORA 1TWCB 5MPOA 1GXDC 3AE2B 1M4VA 5M5WB 2WB1B 3M4YA 3B2FA 1PGBA 5E4WC 1DM0B 1ENFA 3MXUA 1PLFA 3EFXD 3I8ZA 2BS3B 4YTNB 1WXQA 1QOGA 1YQ4B 1F9SA 5F2DA 4A3MB 1C78A 4HAEA 4FXKC 1ZXTA 1A70A 1HPCA 2WXHA 5EE1A 2H89B 2GI9A 2VB2X 3I3CA 1UWMA 3FAHA 4L23A 4MH8A 3P4PB 1KFYB 2OEDA 3EVQA 1IYVA 4MN3A 3H0GB 1U4PA 1TVXA 1LTSD 5LNK1 1FFVA 1I3QB 3K5LA 2OHFA 3AN1A 4CKBA 5EBDA 3K5OA 4IN3A 4FF1A 1JALA 4TQ1A 1LT4D 1G8ZD 4PMBA 5BN5A 2FUG1 5CBAE 1Z47A 3VYRA 4KKTA 1DOLA 1JOQA 2LHDA 5EPKA 1QCBD 2V4DA 4FXGC 3AU7A 2WINB 4X3UA 3BZDB 1QE6A 4YTMB 3A7AB 4H7BA 4B9WA 5FK9C 5J39A 4N59A 1DGJA 1C48A 3HGBA 1H9SA 4G7OC 2MGSA 5C3WA 2A69D 2YEPF 2F1MA 1E2VA 5K36G 1AP0A 4MHEA 2L52A 2KQ3A 1AEXA 3K0YA 2B63B 4REZA 2ICIA 2KUMA 3E6ZX 2WXOA 3SFDB 2EVBA 3NVYA 2CW0C 4NP5A 2BB5A 1DXMA 5COYA 4JPSA 1YQ3B 1ZDVA 2F0QA 2EY1A 3J80L 2NTSA 1IBXB 5FO8B 2WXQA 2QEJC 5TSSA 1X3PA 2MHVA 4J8QA 2QF7A 4KGTA 4ID6A 5I6WA 1ML0D 3OIQA 3T56B 2VZKB 3EJIA 4X3SA 1LTBD 1MI2A 1EEFD 5CV9A 3J9CA 2MEKA 1UGJA 5T1IA 1HA5A 3Q8EA 1QB5D 4YT0B 3X3MA 1TKGA 1XCQL 2V3PA 2SEBD 3M85A 2WXLA 4L2YA 4IUQA 3S1QB 2PVGC 3GTJB 2KN4A 3AEGB 2JP1A 4LTUA 2RQXA 1SNOA 1UNSA 4ZK9B 4FYDA 1K53A 4WRDA 3VR5A 2BT6A 1SNMA 2EJMA 1OXTA 1BMLC 3NWTA 1X3QA 1K50A 3MA2B 2A69C 4EE2A 4BY1B 3B9JA 4A3JB 1S5CD 4L1BA 1A2UA 1D2BA 2LUMA 2E76C 1TS3A 5E3FA 3GP7A 4BWGB 1YNNC 3S1MB 2LKVA 5C4ZA 3M7GA 1C9FA 5ELEA 4CQNA 5C5MA 5CR3A 4FF4A 3SVMA 1HEZE 5D7GA 1XLNA 4KD4A 3BVZA 3NBHA 2KDMA 3HVZA 3AE4B 3NVZA 1KLGD 1DJRD 5JVG3 3S14B 4DA2A 2EKIA 4ULLA 4ZRQA 2I46A 4N58A 4A3GB 1B9RA 1HZ6A 1A3TA 1F2YA 1PRTD 2MJ3A 1S5ED 2SAKA 2WU5B 4A6QA 1EYAA 4RKBA 2K5PA 3P75A 1WTPA 4TQUS 2WXFA 4HCSA 1FRDA 2RKSA 1WSPA 2F0WA 4OO1H 1FIQA 1OXUA 1EFID 2IL8A 3NVVA 1BCPB 4DXFA 1KNEA 1EYCA 1EY8A 3TEXA 3M3YB 3QG1A 2HTME 1EY9A 1T3QA 2A68D 2B2VC 4ZUJA 4OZAA 3ZGZA 3I9V1 4DGZA 2NVQB 1VF5C 4JWUC 1EM7A 1OQQA 1EY0A 3KLSA 2AQ1B 1VLBA 2X69A 3M4OB 1E9MA 5AUIA 5IGCA 4ZOHC 2I38A 3A8KE 4P6VF 1IW7C 2R6GA 5BN3A 5D3DA 3D8GA 2NUCA 2BW2A 4NAWB 1KNAA 1CQFA 3MZ5A 1U9RA 4RGTA 3AEEB 5JAVA 2Z4HA 1JWUD 2M2LA 1FNUA 5LL6S 3M7NA 1MHHE 1F9RA 2Q8TA 1B1ZA 5H92C 2WQYB 5JEAH 3SR1A 5DEHA 5E6JA 2ZXPA 1MSGA 3NWSA 3AEDB 1R4PB 2EJFC 1ZOYB 3OIPA 1HQRD 3NTKA 4YWGG 2H88B 1F0ZA 1STNA 2AUKA 2L0CA 4R8NA 3AE5B 1T5XD 1PRTF 1L0XB 3MHZA 3NSWA 4HJGE 3U4EG 3G6JB 2W54A 1DOIA 2KECA 3SEBA 2KAJA 1A3VA 2BB6A 1LTID 4RGOS 4V190 2RBMA 2ZT9C 5J1ZA 3ERQA 1IGCA 1AW7A 1QQRA 3AMUA 4XXEA 4C3HB 5CV6A 2IW3A 1O7YA 1PDQA 3SK5A 2LEKA 1STBA 1TZOA 3CRKC 4BBSB 1O80A 4A3FB 4PMWA 3B2GA 2A6HD 1EY7A 1V43A 5G5GA 1EQTA 2NWGA 3DEOA 3J7YW 1GUNA 1HUMA 3KF8A 5T8IA 1STYA 2V3NA 2WAQB 1FCCC 3TP6A 4GLSC 3H8HA 2I07B 4TKOB 2Z8LA 2WXKA 2E2JB 1VDZA 1YN5A 1JOKA 1FNWA 3OMCA 3E9SA 3NS1A 5H8YE 2SDFA 2A6ED 3DWPA 2BA0A 3U9SA 1WCMB 1B4OA 1LTRD 5M3FB 3MJ5A 1ZPSA 2EDGA 2K22A 3AE9B 1Y69U 2INPE 2D2CC 3V3XA 3VQIA 5NUCA 4NW2A 2Q8RE 4C1NI 3HOXB 1WWTA 3RFZB 1QWYA 1K8OA 2F0KA 1SNQA 1Y8NB 4DK0A 1QOFA 2DYMA 1RODA 3MEHA 4ZLTF 1YNJC 1BXTA 1PXUA 4RCOA 4A3BB 4HN7A 1IL8A 2VUMB 1II3A 1OO9B 5M9OA 1NYQA 2J52A 2WACA 1OQRA 2EYLA 4X3KA 3FILB 1XYIA 3P1HA 3SK4A 1CM9A 2PZUA 3NQIA 3LXFA 3Q8BA 2QDBA 3BVGA 4HEA1 2JSOA 2R92B 4C3IG 4RFBA 1MGSA 2F03A 4WAFA 4BY7B 2ZW0A 4IOIE 3NRZA 3EQLC 3HP3A 3SE0A 3OOCA 2EYJA 1Q90A 4RH6A 4FF2A 3IAYA 2C9OA 2HDMA 5KNDA 4AS1A 1FMAD 3S15B 2XRSD 1PTOC 2WIIB 1DOKA 1S5FD 2O5IC 5CV5A 4A3KB 1O7LA 2B2YA 3PUXA 5BYQA 2TMPA 3I4MB 2Y3AA 3PMFA 4RNAA 3DHQA 4DNRB 2BBCA 4BS9A 1V1PA 3BG3A 2KCCA 4C1NK 2WP9B 4M0WA 4LLGM 1TWFB 4NMZA 1HHVA 4ZHOA 1DCZA 4LJZC 3GTPB 4E6IA 4WFN3 1N5WA 4N9TA 3AH7A 1JICA 2FHTA 3EUB2 1BUVT 2YYZA 1NEKB 1TT2A 5FKAC 2B39A 3KWLA 2JA6B 4XDXA 5FO9B 2DBYA 4KV6A 5IODA 4CJ0B 2F0SA 2BE5D 5EQ0A 1H9MA 2VB3X 5I2YA 2ACZB 3MC0B 2M0AA 3U52E 4WORA 3VRBB 5AFWA 3NXWA 4CHTB 3MTSA 2XN9C 3FEWX 3P20A 3VYUA 3Q8AA 3NVWA 1STHA 4C56C 1YJJA 2CHBD 1Q10A 1SMYC 1FR3A 5EGTA 3K5MA 2V0GA 3RZOB 2XWJB 1CZWA 3PZ8A 2F0DA 4ZUIA 3G7LA 2SOBA 2O4XA 5LL6X 5JOBA 2JU6X 3NHHA 3VA7A 1JQ4A 1PFMA 3GTKB 4Q0FA 4A8XC 3P42A 2L32A 2ZXOA 3GTQB 1I6HB 1X32A 4CKCA 4XQJA 2G1EA 1F9PA 4B0EA 1XX8A 3T13A 5I2XA 1JC7A 4HEDA 2K5DA 1SEBD 4B08A 4KGSA 3L4PA 1ZEQX 2JYTA 1BOSA 5A2QE 5IT9E 1DOMA 3H6MA 3S1RB 4JK1C 1PZJD 1WVLA 2WXMA 1PDXA 1BUIC 1SJED 3TEWA 3KK7A 1I6VC 5M3MB 1WRIA 2Z1CA 1G291 1LTAD 2OF1A 1RFKA 1ICWA 3DWQA 1Q1BA 1ZP0B 1DONA 4CJ2C 4NZLB 3TEYA 3BVMA 2PMVA 1HA6A 3T53B 1SBBB 2PLPA 2AQ2B 1Y1VB 4MIUA 4WJWA 3JAML 3A7LA 1TY2A 2K33A 2MH7A 2EE1A 2NVYB 4ME5A 1WTWA 4IKGA 1KABA 3BDOA 2B2TC 5AUKA 5A2QL 5IT9L 3FPPA 4K6LA 1C8CA 4I7ZC 3C2PA 3CHBD 4UDUC 5CYUA 4RGMA 2B8FA 1WTXA 1SE4A 1E2ZA 4MM3B 1R9TB 1TKWB 2F0FA 3PIP3 1F2LA 4RHRA 3HS0C 3BDLA 4IURA 3SFEB 5KNCA 1YMHE 3Q69A 4ARCA 1ET9A 2MPMA 4US8A 2M19A 4WURA 2EJGC 2JXMB 4XIGS 5C4HA 2B2WC 2VXWA 3A8JE 1HTPA 4P2CB 3J80E 2W3SA 4K8JA 2EXZA 4PT5A 2IX1A 1HUNA 1L6UA 4F88A 3QB3A 2MJ8A 1Z7TA 1KDAA 2DWQA 2JEAI 2N9LA 2FE8A 4A3IB 2CVRA 3E0JA 5JPNC 2FBWB 2LFIA 2M00A 3MVVA 4R3DA 4IFDJ 2L11A 1J7BA 1GJXA 1WTOA 3NQTA 3S17B 2JYOA 3MXPA 3VYTA 1KTKA 5JVH3 3LWUA 4HSVA 2DY7A 2V4IB 1G2TA 2K3UA 3QWNA 2WKCA 1EWCA 3R93A 1QJOA 5I4DA 4ZHPA 2KEDA 4KKUA 4PMCA 3TEZA 4AQ7A 5IGEA 5BYRA 1XTCD 1JCKB 1YN3A 2JWUA 3I70A 1VZ7A 3C3LA 2B2UC 1MSHA 4XDCA 1JRPA 2M56B 4OIKA 3HOZB 2WNMA 3DXJC 1SNDA 3TP5A 2F4IA 3TZDA 1EEID 2QKIC 2PZTA 1ZXHA 3OPOA 1EY6A 2XWBB 2WP8J 2K28A 1IBXA 4J6HA 2BS2B 1PMRA 1CQVA 3E5SA 1GUOA 3W2DA 4IZ8A 4ZRPA 2ON8A 1CJEA 1RKNA 2F3VA 5DAUA 2PMZB 5EPLA 4O1NA 5C0XJ 3P1MA 4IUTA 2WS3B 5EPJA 3A54A 3L9AX 2F0VA 2B8GA 3T51B 2D62A 1JORA 4ITKA 5ELDA 3PUVA 1TYGB 2CU3A 4XQNA 1HZ5A 2NN6I 4EQNA 2F0JA 3HUIA 3URYA 1B50A 4DAVA 1WD1A 2JA8B 1HRJA 3NTHA 2WXIA 3H09A 1P7FA 2JQRB 2JX5A 4RF0A 1BDOA 1V8CA 1FGBD 3R8BA 2NBFA 4YTPB 2EZVA 1LABA 5CV8A 4QF4A 2LS01 2W55A 2Y0SB 1EU4A 4QCLA 1IUEA 2K9XA 4FO2A 5C3XA 1SJHD 2M9VA 3TMEA 1OFFA 3VR4A 4HCEA 3CRLC 1I50B 1MD2D 1Y56A 3BK1A 2BYTA 2JE6I 4ILWA 1WD0A 4K5VA 2R3ZA 2FJ2A 1UAPA 1GPXA 1NENB 3VR9B 3QJYA 4J3OD 4X3TA 4HRSA 1HXYD 1SNCA 1BNZA 1RF2D 3I91A 1D4BA 5FLXL 4IUUA 3OWFA 1EQVA 2J53A 3BWUD 1VZ8A 4OO1I 4FP5D 4C3IB 2AWOA 3R3OA 1N5XA 1ZDXA 1WTVA 2IGDA 1K52A 4DAPA 3UI2A 5BMIA 1B9NA 1CTMA 4C3JG 4A9AA 4DF7A 1TS4A 1ZKOA 1U4MA 1SSNA 1E0ZA 3OW7A 1PFNA 5G5HA 4IFDI 3S1NB 1D1IA 2PZWA 5I9PA 1C79A 4KKIA 5BMGA 4KTAA 2EYFA 4QB4A 3KLRA 3PO2B 2F0LA 3IKJA 4H0LC 3I4LA 2QCPX 3T16A 2HUGA 2N9KA 1GOZA 1FEHA 4HSPA 4JBWA 5KYLA 3BK2A 4HKQA 1PFBA 4ZKCB 1L0VB 4KJNA 2E2DC 1CHPD 2R7ZB 1ROEA 3MWYW 2YEPB 1PRTC 3PO0A 3Q8CA 4I65A 1V97A 2X38A 4Z9CB 1CK1A 1BQQT 4XDDA 1TWHB 5I6YA 1TIID 3GTLB 2KEEA 1L4ZB 1L5PA 2VNUD 1TWAB 4MT5A 4KD3A 1Q1EA 2KVMA 1QOAA 2MP1A 4BA2I 4JX1C 3T3OA 1SYCA 4XT1B 4F87A 3LB8C 2E2HB 2MJDA 4C7ZA 3P4SB 1SSOA 3F2UA 2GRIA 3TN2A 1H9JA 3QIAA 2IX3A 3SR6A 3A56A 5C0XI 2AUJD 1GAQB 2A68C 5D65A 2CJOA 1HTLD 2JA5B 4XT3B 3PUZA 1SNPA 1TY0A 5C4JB 3VRAB 3S2HB 3O13A 3VYSA 1L0YB 4O42A 4OZBA 2Y5PA 1RYJA 4EGVA 2INNE 4ZQ3A 2RMMA 1VMPA 4BA1I 3MFGA 1ZYRD 4U673 2PTLA 1PGAA 3J81E 2L55A 1O7ZA 4A3EB 4Y7NB 4GDKB 4G7ZC 4IALA 5IGDA 1OXXK 1D5MC 3KQ4A 1E2WA 4USAA 1C4QA 1SF0A 2MJEA 3PUYA 1NCVA 4KMUC 3I4NB 4N6EB 4PQXA 4KK7A 1EWHA 1EYDA 2H1EA 1T5EA 1EOTA 1RDPD 5JXVA 1ILQA 2HCCA 2N0SB 1FO4A 1EY4A 2PO4A 5CBEE 2VZKD 1OXSC 4U68A 3L7ZC 5G3LD 2QILA 5FR3A 1NUCA 3BIID 5C44B 2RDGA 5K36H 1GB1A 3VR3A 3J81L 3FVQA 2BOSA 1C77A 1BR9A 2SNMA 1CZGA 3NP8A 2ZXRA 2IDYA 3K5NA 5T1GA 3GV3A 1F2MA 2AQ3B 1WTRA 4L8JA 2IGGA 4L63B 2BTEA 3IL8A 3FKIB 2X6GA 1SIJA 3ONAB 2DNEA 3D6WA 1A2TA 2JEBI 1FXIA 5E1FA 2A6HC 2NN6G 4CGYB 1LACA 4IUPA 2ICEC 3ITPA 5J22A 3PIO3 2G9DA 4US9A 1EY5A 3D4WA 4OL7A 3RMHA 4RKLA 4H2AA 2RA4A 3V2TA 1J8IA 1Y8PB 4K2KA 3DWMA 1SB3C 3FILA 1IHZA 3Q0AA 3QO2A 2A6EC 1Y1WB 5DNFA 1RTOA 5EE9A 3HOWB 2WKDA 1KH0A 2EYHA 4V0BA 3SXHA 3GV6A 1PUTA 1CHQD 2DLBA 2DY8A 1J9OA 4OIJA 1S5BD 3IAS1 1FRRA 1JOOA 4TMAB 1LT3D 2K1BA 3BDCA 2BS4B 3C1EA 1GHJA 1C4PA 2IPKD 2O5JC 1RJTA 3DUZA 1D5XC 4XWWA 4OZCA 1OXVA 1SXTA 1AN8A 4YSYB 3VR8B 1IKLA 4WQMA 2N88A 5G3LF 4HROA 1CI3M 4RGNA 3IT4B 2Y5CA 1QOHA 4LK0M 1UUPA 3Q24A 1E10A 1QNKA 3BYYB 4OO1G 3D6CA 1IGDA 4NJCA 1JQYD 5CMDA 2WXJA 1GUGA 1BCPD 2NVXB 4KY6A 4FXCA 4DXGA 5EKIA 1JWMD 1TR5A 4F7XA 1DZ1A 4WWMA 2IT1A 4K5XA 4TSSA 3S9WA 3ZJVA 4IFDG 4F8MA 4B9XA 2B2VA 4K2LA 1AZPA 3UI3A 2F0UA 2XSCA 1CZPA 4TQ0A 1I4GA 4R9WA 1PRTB 3DMUA 2OXPA 1AWDA 4HR7B 4JWSC 2EOTA 1FXAA 4KJOA 1YNTE 1Q3LA 2EPBA 3JAME 3RLFA 5CC4A 1I4PA 3KBGA 1QNUA 4DK1A 1SAPA 5HFYA 1XLPA 5BYSA 1F77A 2J7ZA 3PUWA 3EROA 4RCNA 1VCIA 4G57A 2IWHA 1GUWA 2E75C 4OVZA 1G2SA 2HDLA 4Q5VA 2KOLA 3A55A 1B3AA 3Q23A 2L1AA 3C1FA 2BCOA 3LWEA 3U2SC 3J7AF 2H4OA 3MXGA 4G4KA 5KEEA 3MP9A 3N6RA 1R7SA 1SYFA 3PZ7A 4FNFA 1LV9A 1RTNA 2BE5C 3IT6B 2BA1A 2EY5A 4RWSC 2D5GA 4OGQC 3K6OA 2FFKB 4NDXA 2KMMA 1LT6D 2EYPA 3AMZA 1F2ZA 1MI0A 4XE0A 1RD9D 1N60A 5C0XG 3TUOA 1L6VA 2JSVX 3SK6A 1EZ8A 2F0IA 1B9MA 4HMJA 2CW0D 4CBVA 2A73B 3W5VB 4RHSA 1SDFA 1PTOH 3ZYYX 1BCPF 2PIAA 2Z4IA 2IGHA 5C4XB 2K01A 5C2TB 3H94A 3I90A 5IGGA 3P63A 2FMMA 4KY7A 1JROA 1XEEA 3VR6A 2NZ1D 5GXGB 4ZKBB 1H9SB 2K03A 4YSXB 2JA7B 3EGRA 2F0HA 1PZID 3AE8B 2F0PA 2ZW1A 5KIXA 2WV6D 3W3AA 1BO0A 5KRUA 1GB4A 3DM1A 1I4XA 3Q6SA 2CJNA 4C3JB 1VF7A 2K5WA 1N63A 4ZAIA 5HG2A 1CA5A 4DFAA 4FVMA 1EU3A 2XIWA 2LY7A 1QT9A 2QJLA 5EJWA 2PW7A 4QMGA 1XWEA 2L9HA 1FFUA 2J4XA 4RA8A 3OMGA 3CWIA 1N62A 3I73A 2E6XA 1A6XA 1YNND 2Q8IB 1ACCA 1F2RI 1RCVD 3I72A 3OHXC 3D4RA 3DWAA 2RPVA 1PTOB 1G6ZA 4A90A 1K51A 1PFDA 2PCFB 1ESRA 1QILA 1Q8IA 3VR2A 1WGKA 2RDFA 3AV8A 1PYWD 4J1MA 2DYOA 3ZJUA 1STEA 4TRDA 4K6DA 5E4XA 3IAM1 4KI0A 2J0TD 3SDZA 3AE7B 3NK9A 2XRQD 3HRZC 5JEAJ 3GB1A 4KN4C 4H13C 2NB0A 3CU7A 1EIGA 5D14A 2KJXA 2BDNA 4XWTA 1Q12A 2FINB 1KLUD 3J7AV 3K59A 3K57A 3PO3B 4GZYC 5KGUA 2CQAA 3BS1A 1JWAD 1XF5L 4EQOA 1J7AA 4K5WA 1M8AA 3HOVB 1JE4A 1MVKA 4NKLA 1MPEA 2W82A 5I9OA 1TS5A 4FXDA 3TBIB 1D5ZC 1R4QB 3I57A 3KUPA 3W1SA 1IKMA 1TKYA 1KF6B 2NN6H 2X6LA 1TS2A 2TSSA 2F0GA 2L4NA 1S4ZA 3BYTB 3D4DA 3OWEB 5K5PA 2RDHA 1MBYA 3K7AB 5M5YB 2F3WA 1STGA 1G91A 4HMIA 4M1UB 2ID0A 1IYUA 3MXNA 4M8AA 3HOUB 4KKJA 1CFMA 3FDTA 3H91A 4XTCS 5FLXE 1JW9D 4R8IA 1MHXA 3DEPA 2B2YC 1YJIA 5C6AA 3ABVB 5EE3A 1FNVA 1BF4A 1AFPA 2KCNA 3GTOB 1XXGA 2N55A 3HKZB 5EBCA 1IW7D 4IQZA 2J42A 4K14A 5HGTA 2A5HA 1PGXA 5EE0A 2WLBA 3IXSA 1TKEA 1JR0D 1E0BA 3NTIA 4EQPA 4YXDB 1RWSA 1O78A 1P7EA 3CKIB 3LX0A 3MAQA 2NTTA 3CIRB 2PVOD 2K0PA 3FC4A 1I4QA 1HCZA 2OEOA 3TP7A 4LMQD 5FO7B 3AB9A 2XNAC 1Z6HA 5ISRA 1WTQA 4ZYSA 3NE5B 2WXPA 3WDNA 1E7PB 2QMTA 1D6EC 2LJIA 4KX6B 3NZ3A 1XO3A 3U7ZA 1C4AA 3Q8FA 1UWXA 4XYQA 4RF1A 3LYYA 1H9RA 1ONLA 4GDLB 4PV1C 5M5XB 3P4QB 2RSNA 1QF6A 1K8MA 3EA6A 4H44C 1CA6A 4IFDH 2EYMA 4XQQA 2MUYA 1HFNA 3SHLA 5HURA 2WXRA 1C4CA 2K05A 1V1OA 4KGRA 1NR4A 3ETRA 1ENAA 3TSSA 4OHJA 2SNSA 3QOLA 1KRHA 3FRPB 3FPUB 5C5LA 2F0TA 3U9OA 3RUZA 2PQEA 4A3DB 2HDEA 5EKLA 2DN8A 4EVOA 2B2TA 3V05A 1FD7D 3SK8A 4CJ1B 2PKOA 4KHZA 4YSZB 1LTGD 1TJEA 1FD6A 5D3IB 1F9QA 1YN4A 1RHPA 1QOBA 1EIHA 2D5DA 3RZDB 2QSDA 4OW0A 1SYGA 5JPMC 5ELBA 1B44D 4XYOA 1DOYA 2PNRC 4K8IA 1HQMC 1LO5D 4WH4A 2JZPA 5DM73 1NAPA 3GO5A 3GS2A 4KN7C 5ELCA 1KDBA 5C0XH 1YNJD 2B2WA 3RPFC 1XCTL 4DAYA 2E2IB 5IIFA 1TQOA 2WU2B 3AEFB 3A8IE 1ESFA 5IOCA 3KWVA 3AE3B 2IX0A 1V8QA 4IDIA 3CQZB 1B2TA 2NVTB 2L12A 2EY2A 2N7JA 3GD7A 2K5QA 4ARIA 3GQBA 1VZ6A 4QUCA 5DM63 4YIJA 1N61A 4DNTB 4P16A 2AX5A 4FF3A 2LFNA 3AEAB 3MHBA 2B76B 1SYBA 4KHVA 1I4RA 5BMHA 4LAAA 1FYCA 2PYKA 3PV0A 2KQ4X 1EWYC 5CV4A 4BBRB 1PTOD 1T6BX 1QG7A 4IUNA 4Q2JA 2RSOA 5HI1A 2EYOA 3AECB 1VDVA 4MACA 1CT1D 1TU2B 3OSOA 1ILPA 2W3RA 1NYRA 3FMCA 1SFOB 2R61A 2B2UA 2D9UA 2WXNA 1EZ6A 2WDVB 1DYQA 2EELA 3R2IA 1VRAB 1KAAA 1EL0A 3L3OC 1NVID 4C7YA 1Y8OB 2K6AA 4C2MB 4IUVA 2L83A 2JYEA 2WDRB 1A15A 1FCLA 1BBXC 2E74C 2Q5WD 5EKKA 3HEJA 3AEBB 5FOBB 4UAIA 1STAA 1TWGB 2AWNA 1GHKA 1SYEA 3TZUA 1DD2A 2GA4B 3GTGB 4DQOC 1LTTD 3W9CB 4WIPA 1ZYRC 3HRDD 1U4RA 1U4LA 3ZJTA 1AYFA 4HTHA 1KDCA 3NUCA 3AB5A 3QOJA 2F0OA 5A35A 2KWDA 3IFDA 5C3JB 5ELFA 2LGIA 4S3SA 1V1PB 1ZE3D 2JXTA 2PW5A 1SMYD 3DWGC 2EY6A 4ABNA 1PZKD 1VMCA 1ET6A 2HQEA 2NYZD 1JMLA 1B53A 1RM6C 2A74C 3C8YA 2PW9A 2ONQA 3P4RB 3T3NA 4HKZE 5IGFA 4A93B 4G7HC 2LMCB 4C80A 4DU9A 3P7JA 3D3RA 1QKZA 2HCIA 1QLBB 3ND9A 3AM9A 1H9KA 3T4AC 3W5UB