1HQRD

Crystal structure of a superantigen bound to the high-affinity, zinc-dependent site on mhc class ii
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
205
structure length
205
Chain Sequence
KDISNVKSDLLYAYTITPYDYKDCRVNFSTTHTLNIDTQKYRGKDYYISSEMSYEASQKFKRDDHVDVFGLFYILNSHTGEYIYGGITPAQNNKVNHKLLGNLFISGESQQNLNNKIILEKDIVTFQEIDFKIRKYLMDNYKIYDATSPYVSGRIEIGTKDGKHEQIDLFDSPNEGTRSDIFAKYKDNRIINMKNFSHFDIYLEK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HLA-DR ALPHA CHAIN
publication title Crystal structure of a superantigen bound to the high-affinity, zinc-dependent site on MHC class II.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 52
structure length 205
sequence length 205
ec nomenclature
pdb deposition date 2000-12-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF01123 Stap_Strp_toxin Staphylococcal/Streptococcal toxin, OB-fold domain
D PF02876 Stap_Strp_tox_C Staphylococcal/Streptococcal toxin, beta-grasp domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.110 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1hqrD02
3.10.20.120 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1hqrD01
1PTOC 1QILA 2AQ1B 1HTLD 1DYQA 2XNAC 3SEBA 1I4XA 3DWAA 1M4VA 1FD7D 1PRTD 3W2DA 1LTID 1L0XB 1PZKD 1EWCA 1LT5D 3DWPA 1HQRD 4RGNA 1ET6A 2XN9C 2Z8LA 5ELDA 1CHPD 1G8ZD 1LT6D 1UUPA 1PTOD 2AQ2B 3GP7A 1UNSA 1HA5A 1JR0D 1SE2A 1PZID 1S5FD 3OWEB 1BXTA 1BCPF 4RHSA 1CT1D 1LO5D 1CHQD 1RD9D 3R8BA 1RCVD 1SE3A 1MD2D 1SE4A 1AN8A 4O1NA 1B44D 4K6LA 1FNUA 1ESFA 1YN5A 1TS5A 2CHBD 1B1ZA 4Z9CB 1TS3A 1LTRD 3CHBD 4RH6A 3BVMA 4DXFA 1DJRD 1I4PA 1LTSD 3BZDB 5I4DA 1PRTF 5FK9C 1RF2D 2RDGA 1PRTB 1RDPD 1SXTA 3O13A 1FNWA 2XRQD 4ZYSA 4OHJA 1LT3D 4NZLB 1V1PA 3BVZA 3URYA 1PTOF 1S5DD 1EU3A 4RCOA 2TSSA 4L6TB 4RGMA 1ET9A 2XRSD 1LT4D 1BCPB 1LTAD 4C56C 4L63B 1S5ED 1T5XD 1D5MC 1F77A 4BWGB 5ELCA 1S5CD 1I4GA 1D6EC 1XTCD 1EFID 1BCPC 1STEA 1EEFD 2QEJC 1YN4A 1GOZA 3BYTB 1D5XC 1PYWD 1TY2A 2O2LD 1JQYD 1TS4A 1JWSD 1LLRD 5D3IB 3TSSA 4RFBA 1SJED 1S5BD 1PTOB 3BVGA 2WV6D 1PTOH 3DWQA 1I4QA 2J4XA 1PRTC 1YN3A 1AW7A 2NTSA 2SEBD 1CQVA 1KLGD 1TS2A 1JCKB 1SJHD 1LTTD 5ELEA 4RGOS 2AQ3B 1FNVA 1EU4A 4UDUC 2QILA 2G9HD 3BYYB 3V05A 1LTGD 3MC0B 4TSSA 1I4HA 1EEID 2RDHA 1HXYD 2NTTA 5TSSA 3EFXD 1CK1A 1SBBB 1V1OA 1FGBD 1LTBD 5ELBA 2IPKD 5D3DA 2ICIA 1D5ZC 2R61A 5ELFA 1I4RA 4RGTA 1SEBD 3KLSX 1KLUD 3MFGA 1BCPD 1KTKA 3R2TA 1V1PB 3R2IA 5FKAC 4DXGA 1XXGA 1PZJD 1TY0A 1JWMD 2IJ0A 4RHRA 1JWUD 1ENFA 3EA6A 1L0YB
chains in the Genus database with same CATH superfamily
3T51B 1VS0A 4EZJA 5LXIB 1YHQA 3VR6A 2Z0SA 4A3MH 1MG8A 2LJ5A 1LTID 4YCUA 5ELNA 4QF4A 5IY0A 4L5RC 1TWHB 2XK5B 1L2NA 1HQRD 3L2PA 4CBVA 3WAOA 1V1QA 2X6GA 2INPE 2ZPYA 4H44C 5ELDA 5IGCA 1G8ZD 2F0EA 1PYSB 3GP7A 2BYFA 4EEWA 1A3VA 5M3MG 1Z6HA 2D3AA 4HCSA 4NQKE 2UUAQ 5IKCM 2OEOA 4NAWA 3RCZA 3OIPA 3U9SA 5CC4A 5LMNW 2UUAL 3KF8A 1RL2A 1Q81C 2AHOB 1E8ZA 2BQQA 3GDEA 3NS8A 3D0FA 1FRDA 5FO7B 3EUB2 1AN8A 1Q46A 3DBHB 4K6LA 4XTCS 5DNFA 3PRZA 3P1HA 1X1MA 3KDFA 2R7ZB 1WTXA 3B1LX 1J7AA 4K5XA 1Y1WH 3KWVA 4IW0A 2L76A 3E0JA 4IUTA 4FVMA 4S17A 1JB3A 1NTGA 2I5LX 3V60A 3CQZB 3GTPH 4K2LA 3Q22A 3VR9B 4ZYSA 2EJFC 4DA2A 1CTMA 2JZZA 5E6PA 2N1VA 3D4RA 2PZWA 2CWPA 1YJNA 1ZXIA 4P2CB 1Z9FA 1FL0A 3Q8CA 1VMPA 1FMAD 1C3TA 2LXCA 4A3LG 4IWQA 1VQEA 5J18A 2XRSD 2GVAA 3NK9A 1X9NA 4KY5A 2NBVB 2K25A 2QSDA 4QCLA 1V81A 3FILA 5AUKA 4CGYB 4V190 5LHY1 2KCTA 2F0KA 1CKNB 1UE7A 1Q8IA 1UE1A 4LW1A 1EEFD 3AEVA 2KN5A 1J8CA 2EQSA 2PVGC 4KJNA 1YNNC 1FD6A 1W3SA 4IURA 2B2UC 1VQAA 3KOJA 4DK0A 4EKUA 3JAMc 1R4PB 2AMCB 3PO3H 3SK5A 4OXPA 1WZ3A 2UUBQ 4JI8L 2KDIA 1SMXA 2WB1E 4NMZA 2FBWB 3TEXA 2VB3X 2B2UA 3OJ4B 5JEAJ 2KWVB 5AUIA 1EF5A 4P16A 1CKNA 4CDEC 1WM3A 1DXMA 3AE3B 4IC7B 2IW3A 2WXRA 3KK7A 2D0OA 3NVZA 4XQNA 4JV5Q 4Y52H 4C2MH 3PZDA 3U50C 4JV5L 4TQUS 2N88A 2OTJA 1YQ3B 1FNVA 3BDLA 3T53B 1B3QA 1C48A 5DLQE 1SFOH 4IWOA 3LGJA 4CKCA 1E5WA 5C4JB 2AUJD 4TSSA 1Z2MA 3KLSA 4URKA 1K8AC 4HK2A 1P7EA 2M0XA 2MBHA 2DBYA 1LV9A 4HJKA 1HPCA 4C3HH 4BXXG 3CRLC 2JA8H 1NE3A 2BYEA 3GTGB 3NHEB 3RD4A 4GDLA 4IUMB 3SR6A 4KKSA 3AI5A 4TRDA 3KUPA 4XXEA 2A5HA 5GMVA 1SEBD 5KYIA 3L08A 2KC1A 3FPPA 5ELOA 4EGVA 1NAPA 4KHPQ 2KMMA 4EVOA 1VDVA 4KHPL 3WAPA 3HHMA 1IBML 2GOWA 4KIKA 1IW7C 3D8GA 1TR5A 3HG9A 3TEZA 2AWTA 3Q8AA 1D7QA 3K59A 3H15A 3M4QA 2N3SA 4RF1A 4Q5VA 2WP9B 1N5XA 1EWCA 5K36H 2VH1A 2EY6A 2QKIC 5JPMC 1UH6A 2GBKA 4JW0A 4DWFA 5IE8A 3R7RA 5D14A 2JRHA 3ML8A 1V2YA 1ZDXA 2K6QA 1BVSA 2FCSA 2QW7A 1CHQD 4LMQD 3FC4A 3AB5A 1PV4A 2HIXA 2WIIB 2BE5C 3RD2A 2F0HA 2JPHA 3MHZA 4WWNA 4I65A 3VTUA 2BBCA 4KV2A 3FVQA 2H5XA 3ZJUA 3AU4A 5C23A 1V86A 1YN5A 1STBA 2E75C 1GHKA 2INCC 1MIUA 3ABVB 4M0WA 2V1CC 4YSYB 3ZGZA 5FLMH 3J80i 4P1CC 2XTIA 1LABA 1BUVT 4GN4B 4A3JG 5IT9E 4IUUA 5GAEC 1VQ7A 5EKKA 4AP4C 4L5SA 1R4MI 2Q2HA 4J8QA 3RZOB 4WJNA 2QDLA 1F52A 4C3IH 4POGA 3HOWH 4A3DB 1ZPSA 2WHIA 1YZ6A 3TEHB 3L0WB 2WXQA 1QOGA 4RM9A 1PMRA 1E0BA 3AN1A 2LGYA 5IGBA 2Q2UA 2N7EA 5HKHA 2GRIA 1VQGA 1EIYB 1L0WA 1F77A 2V3SA 2HQEA 2DAJA 3KWLA 2F0FA 3NVWA 3DHHC 5IGEA 4A93G 2A68D 4MNOA 5IT9L 4AJWA 3H09A 4DNRB 1G6PA 2BA0A 2KK8A 4AJYB 1Y1VG 5T8IA 3C1FA 3D32A 1UELA 1XX8A 3J9CA 2D5DA 4G0NB 1JWSD 5G3LF 3TZUA 2BGFA 2D07B 3MHBA 1S5BD 5HURA 3HOZG 3I8ZA 4IOIE 4C4VB 3B9JA 2WXGA 5IYBG 2VQFQ 1V80A 1K8OA 3QOLA 2KHSA 2VQFL 3QJZA 3U52E 4NNJB 3VHTC 1X3PA 3C3LA 3AEBB 1EYDA 3N1ZC 4WURA 1DOYA 2HJ1A 3ITPA 4YY3Q 4EQPA 1GM5A 4KZCA 4JBMA 4MACA 4YY3L 3J80L 3H1UA 3ER0A 1EQRA 2D0PA 2Z59B 3TJPA 4RG1A 2IHFA 1WXMA 3KF6B 3CMMB 2ZJQA 2C7HA 2NVUI 2BS3B 2X38A 2PIAA 5LXHA 4Y7NB 1DOLA 4DHZE 3O65B 1WWTA 3B6YA 3NBIA 3EIVA 2MPMA 3BK1A 3W1BA 3DOWA 4GN5A 1E1TA 1BCPD 3VAWA 3NTHA 2NPTA 3AECB 1R9TH 2J0TD 2WXMA 4QJFA 2W3SA 4BBSH 1GJXA 5IWAQ 5IYCG 5IWAL 1WXSA 3VR8B 3DVGX 2GB1A 1I7HA 4R9WA 4K7WA 1K52A 2F0TA 3N6RA 1OEYJ 2NMQA 3E6ZX 4HCNB 3VUXA 4US8A 2DYMA 1A8VA 5EPKA 1I4XA 1MBYA 5LMNQ 4JCVE 2LUMA 5C5LA 5CV8A 5LMNL 3A4RA 2F0PA 1QF6A 2KHIA 1PGBA 3C0RB 5L83A 4A76A 2O4XA 2LXJA 1TWGB 1PTOD 1EY5A 5C4HA 5ISRA 1C77A 5HHDG 3W1YA 4F8CB 3BWUD 4E74A 4RHSA 4TUUA 4XT3B 1N61A 1E7UA 5AZGA 3U30A 2QDFA 3R8BA 3JYUA 2LFIA 1NMGA 3KLRA 3ZRCA 4WJOA 3EVQA 4JPBW 3AE2B 1XPRA 3HFZB 1TZOA 1WD0A 3HOYH 2EY1A 2G1EA 2L32A 4YTPB 2A19A 1SNCA 5C4XG 1KL9A 4Q0FA 4Z9CB 5LNK1 3A8JE 3CHBD 4DXFA 2ZT9C 2F4VQ 4QY7A 2CKHB 1OQRA 3ZJTA 3RZFA 2HJ8A 3H0GG 1WJNA 3CSTA 1Y69U 1RDPD 1EY6A 3PUZA 1TU2B 4IUNA 2KD0A 1CSPA 2KYWA 2RR9A 3Q3MC 2PNHA 5G55A 1QOFA 3QCAA 2DJFC 3M85A 4XGAB 3VH3B 1Q1OA 1GPXA 4XE0A 3AE4B 1L1OC 1TJEA 4YWMA 2LD9A 1J9OA 1UBQA 1K8GA 3X23A 4ZRQA 3A5UA 3H3VC 3RZDH 4HR7B 4GLVB 1L6VA 4IDIA 3X3NA 3QQ8B 2F0MA 1L1OA 2WKDA 1D5MC 1BOSA 3U4VA 1E6EB 5BN3A 3P42A 2O6VD 2KJ6A 2I1JA 2IGDA 2O2VA 3TN2A 3LXFA 3Q8BA 5HY6A 2KAJA 1N5WA 1J6QA 4A3BH 4MSMB 1ILQA 2HIVA 2VXWA 1YVCA 5CTRC 5EE0A 2YLMA 1SNPA 3Q3NC 4I7ZC 2F0VA 4JI2Q 3VYUA 4JI2L 1N32Q 2OWOA 4US9A 4DDID 3V2TA 4FYDA 1N32L 2DWQA 3DVGY 3CC2A 4XDXA 2WNMA 4BZAA 1JJGA 2PW9A 3SDLC 4WJ4A 1CQVA 1Y8RC 1SMYC 4GOCA 4WJWA 4LFCQ 4A3OA 4RGOS 3IAYA 1FCCC 4LFCL 2NVYH 2JF5A 2D62A 2ZW0A 4F7XA 3HOUB 2VB2X 3A9KB 5KGUA 3EROA 1PFSA 5CV9A 4JOIC 2JSVX 4I6NB 3K5MA 1D1KA 1TWHH 2F0NA 3Q69A 3VR3A 2XVSA 5JXVA 5CORA 1V1OA 3L9AX 1FEHA 4QQBX 1PDXA 3RUIB 4LF7L 2IPKD 4DPGA 2QF7A 4X65Q 4HSPA 1N6ZA 3HIZA 4W9EA 3WAMA 4JOIA 1NENB 4R3DA 4LJPB 2CHXA 4IFDI 1IGCA 5T1IA 2N1WA 3A9KA 1SYEA 3IFWB 1MJEA 4TV3A 4IKGA 3PUVA 1M90C 3VUYA 4O42A 1I94Q 5IGGA 4XIGS 3ML9A 1I3QB 3CCLA 3ULLA 2KANA 1QILA 2V0GA 2B2YC 4X62Q 3VDZA 4A9AA 1TT2A 4A6QA 1UEAB 1EQVA 1IBKL 4X62L 5JAVA 3BIID 3Q2AC 3I70A 1DYQA 1H9SB 4DAYA 1HTOA 1UGJA 1E24A 2KEEA 4J6HA 2DNFA 2Z0DB 1EY8A 2C35B 2B2YA 1DGJA 3PREA 3I91A 4GDKB 3EFUA 2R7ZG 4LNOA 4EUTA 3MEFA 3MAQA 2JXXA 3KYDD 1VQKA 3B2FA 3Q8DA 4G11A 1VQ9A 2NBWB 5FJ8G 3G4SA 2LKVA 4A3FH 1V8CA 3BS1A 3HS0C 1HZBA 4RA8A 3W1GA 2HCCA 2IGGA 4N8FA 4C3JB 1SE4A 5E4WC 3MC9A 3QR8A 4HTHA 4DV2Q 2K39A 4ZHPA 3TIXA 4PZ7A 1HE8A 2A73B 4RH6A 4DV2L 2PLPA 3MVVA 2K33A 3QWNA 1OXXK 2LHEA 3AEDB 4I6LB 3EQLC 4FHJA 1MFWA 3E9HA 3ENEA 1UD7A 2L8JA 4YIJA 2MJ8A 1XJVA 4JWSC 4N59A 3H7PA 4AOFA 2BYTA 1BO0A 1SYBA 3T9LA 4BAXA 1P98A 4IFDG 4MZ9A 4OONA 3KYCD 4KSLC 1VQFA 2F3IA 3HOXG 1I6HB 1E8XA 3E5SA 4ODGA 1E9MA 3G48A 2KKCA 5LLIA 4POFA 2N78A 4IZ8A 3RUZA 3UDFA 3QO2A 4QUFA 2H89B 3I7FA 4YT0B 1C4PA 1LYLA 5KEEA 1LGRA 1KF6B 2YTYA 1NR4A 1C0AA 5D7GA 3ZLZA 2FFKB 2J0JA 4BWGB 5KIXA 1BBWA 1D6EC 2BKRB 2IX1A 2I1KA 3DQVA 3DPDA 1EFID 3S1RB 2B63B 2QEJC 1M94A 4LDTB 4DXAB 5C4JH 5CV6A 1LTLA 5IOIA 4GNXB 1HZAA 2B8GA 2EY2A 2D11A 1S3SG 1YNXA 2LVQA 1EYGA 4JI4Q 1J7BA 1EOTA 1YHAA 3IKJA 1WZ0A 2MLBA 4HKQA 4JI4L 1WM2A 5NUCA 3GTGH 2EY5A 3PIPA 4K8JA 3BG3A 4HJ7A 4DV6Q 1V9PA 4GNXC 4HCEA 5D6JB 1I42A 2M4NA 5I2XA 4DV6L 4KN7C 4A3CH 2EYJA 3CC4A 1T6BX 3UI3A 1IP9A 1PRTC 1K53A 1QZHA 2HDLA 3VYSA 2UWQA 5IIFA 4WJPA 4XZ4A 1JCKB 4PMCA 3GQBA 1N36Q 3QWZB 1NI3A 1FO4A 1D2BA 3M3YB 1N36L 4NQLB 1Z47A 4OVVA 1VLBA 1WX7A 1L5PA 4ZKCB 2ZW1A 4W9IA 4IJLA 1ZGUB 4ZYNA 4A3KG 1C78A 4UP9A 5IP7G 5GADC 5FLXE 1UBIA 3VYRA 4B9KA 3AQQA 1E8WA 5M3FH 2F52A 4BBRH 5K5PA 4HIMA 2M8SA 5EKIA 3JAML 3I9V1 4Q2JA 5G2NA 3VXWA 4EQNA 5HFYA 4LFBQ 4WWOA 1PXUA 2KDEB 2KWCA 3SHQA 5D3DA 4LFBL 3A54A 3ZXRA 1JALA 1I4RA 5IGDA 4KHZA 1EM7A 3KLSX 3MXNA 2HTME 2PKOA 4BBNF 2K4KA 4K5WA 4U68A 2RVLA 5M5WB 4ARCA 3HKZG 1YNND 2K52A 3GV6A 4JI5L 4HJ9A 1Q10A 1PZJD 2WQYB 2IJ0A 1Y1VB 1WD1A 2KTRA 4MM3B 2EVBA 1PTOC 5G5HA 4HJAA 1F9SA 4LF4Q 3KW5B 2JWUA 1AFPA 4WWMA 1KFYB 4LF4L 2DY8A 3ICEA 2EIFA 3M4OB 5EDSA 2L11A 2F0LA 3I4MB 3PIO3 1YOVB 4KGSA 3W2DA 1J8IA 1L0XB 2VUMG 4F8MA 2K75A 4PMBA 4RGNA 4DK3C 4USAA 1WJ6A 1ZUD2 3SXHA 3CU7A 4CKEA 1O7ZA 2LVPA 4KLKA 4GOPB 2LGSA 5I2YA 1E1OA 2RKSA 1G51A 1R4MB 4NJ7A 2Z6KC 1W6JA 5AFWA 3OAWA 2FE8A 2JA7H 1KAAA 1VCBA 1JRPA 4FF4A 3HOVH 1FNUA 4KZ0A 4GOPC 4OVUA 2N9XA 1OFFA 2PNRC 4LWCA 3P4SB 3RNGC 2ZNVB 1ILPA 3BVMA 4ULLA 1DJRD 1LM0A 1JICA 2QGQA 2Z6KA 4DQOC 1SSNA 2H88B 4HVBA 1E2WA 3AB9A 3CCJA 1N34Q 2MJEA 2AL3A 1SN8A 1N34L 2UUCQ 1YEZA 5C6AA 2ASBA 4BY7B 4LNIA 2UUCL 3AEGB 1ONLA 5JEAG 4IUQA 3B08A 4ASWC 2MBQA 1IW7D 4JGHB 2YTVA 3WOEA 5H1SE 3J81j 1PYBA 4EQ5A 4H2AA 3TEWA 4A4IA 4K1RB 1A2TA 2KQ3A 1IKMA 4LCDE 2O6VA 1IBXA 1A3TA 2V3PA 1D4BA 1N63A 2RSNA 1C9OA 1T5XD 2NB0A 3P4QB 3V96A 5GQOA 1I4GA 1XTCD 2CW0C 3PCOB 2MQHA 4LNQA 1K8RB 5KHOA 4OZCA 2KN4A 1YN4A 1K83H 3VDYA 4JI7Q 3QHTA 4KKJA 3HRZC 4NW2A 2EKIA 2NBFA 4JI7L 5DPRA 1RLFA 3RR5A 1AZQA 4ZK9B 2PW7A 2JSOA 2OT2A 3QOJA 2BE5D 4DR1Q 3QAQA 2RA4A 4DR1L 2BA1A 3MP9A 2KQ4X 3BZCA 3D6WA 4RFBA 3JW0X 2HD5B 5L37A 3PO2B 2WXIA 4MH8A 2DYOA 3H8HA 1GAQB 3NXWA 4TQ1A 1B50A 5J39A 3PZ7A 2K8BA 1LTTD 4E3CA 2PQAA 3APFA 3H0GB 4IPHA 3K5LA 1CZGA 2JA6G 5BYQA 1JJCB 3I4NH 2E2DC 1N8RC 1F2RC 2LMCA 2Q5WD 3ZIMA 2MBBB 1JMLA 3PUWA 4IN3A 1MSGA 3AMZA 3I56A 1X6OA 4EOYA 1TIID 2MFIA 3E9SA 5E6NA 3EFXD 1PH9A 3ONSA 3RMKC 3S16B 2M56B 3DEPA 1ACCA 1DZ1A 3NWTA 2R61A 4L1BA 1S40A 2P5ZX 4IWPA 2F0JA 1L2FA 3EC8A 4LUZA 4LNFA 2L3ZA 2F1MA 3R2TA 3DHGC 3IG3A 4LFAL 4M8NA 2GMIC 1Q1EA 2PMZB 2KEDA 1ESRA 5FR3A 3M63B 3OWFA 4EQOA 5C3WA 3N52A 5J2RA 4A3IG 4N9F4 1EY9A 4JI3Q 4LTUA 1ENAA 1RJTA 1E10A 2R93B 4JI3L 1S4ZA 2JA5B 3RMHA 2J0KA 2I5MX 4X57B 4QAYA 4OO1H 1M1KC 3ZNHB 1Q90A 4WORA 3H3VH 4LNKA 2WLBA 1P16A 4ACFA 1V9JA 2XGTA 2ZXRA 2WDRB 3KQ4A 3G6JB 2CJNA 3D3RA 3MFYA 2KHWB 3ETRA 4C7ZA 1GNUA 4GLSC 3D6CA 3TBLD 1BXTA 1BCPF 2L00B 5C44B 2N9EB 1S72A 4I7AA 3TS2A 1TKEA 3L0OA 3TCAA 3NZSA 3U4EG 1WMHA 4ZDVA 4CYEA 3DWGC 2B2WC 2RQXA 4UHVA 5IGFA 3CIRB 1QWYA 1HNXQ 3A9JA 4ILWA 3C1EA 2NVTB 1TT5B 2FAZA 1HNXL 3NOBA 1KQSA 1I4PA 5COYA 4LAAA 3HVZA 1F2MA 1CZPA 2B2WA 4IPGA 4ZAIA 5M3MH 1HZ6A 1WXAA 2QJLA 2XWBB 2RDGA 3OG5A 4KGTA 2NVQH 1FRRA 1WRIA 3PRPB 2MGSA 4MTKA 1GUNA 3TP7A 3VTVA 2BDNA 4KMUC 5I6WA 2C7NB 4NZLB 1NYQA 1T5EA 3BVZA 1WY8A 1PTOF 3PO0A 3MJ5A 3SFEB 2NZHA 2LRWA 5CV5A 1AE2A 1RFKA 4BFRA 1L7YA 2VZAA 5JH5C 4KK7A 1C1YB 1KRTA 1G291 3RNFC 3CF6E 1I5FA 1PH3A 2JA9A 4DF7A 2RHQB 2B2TC 3PUXA 3LX0A 4DDGD 3PHWB 2NBUA 2MBEA 2GBMA 4P72A 1TWAH 2XK5A 1FGUA 1WCMG 5AEKB 3K6OA 4DK1A 1EYAA 1U0LA 2B2TA 5M5XH 2CR5A 3CMEA 2E2JB 5GXGB 3AULA 4ID6A 3S1QB 4A3LH 2KBNA 1QZEA 3HOUG 1E2VA 2BWES 3TSSA 2WDQB 1ASZA 1TVXA 2KENA 3F2UA 3KUZA 2FHTA 2EJMA 2NCNA 1EIFA 2Z0EB 3P2BA 1YN3A 1E0ZA 1YX5B 2KTFA 2NTSA 3PSIA 1K3RA 2B2VC 2WINB 2Y0SG 4DN4M 4JBWA 2H4OA 4NB3A 1I3QH 1FM0D 4KVGB 2JYEA 5EGTA 4DNIA 1GUAB 4UDUC 3A56A 1JWBD 2IT1A 2B2VA 2KC2A 3GE8C 3QX1A 1KDAA 4JYAQ 2MUYA 3HOXB 1I4HA 1KH0A 1S1QB 2BB6A 3W5OA 1I50B 3ZJYC 4JYAL 2GBJA 2MEKA 2ZVOA 3MC8A 2NTTA 1KRHA 2MW5A 2KCMA 1STYA 1N9WA 1UAPA 1UZXB 4DV4Q 2NYZD 4DV4L 1S3OA 2KECA 2UUBL 3GTLH 3GTMB 4M8AA 4CDFC 3QC8B 5IN7A 1YBYA 1GUSA 1KLUD 3FEWX 3SD5A 4ARIA 1O80A 1XPOA 3HEJA 3GTJB 3R2IA 1WGRA 3GD7A 3NENA 4DBGA 4NJCA 4EZKA 1XWEA 1VQJA 2JZPA 1QUQB 3S17H 5EJWA 4B3TQ 1QQRA 1WX8A 1BBUA 4CHTB 2FCMA 2KFJA 1XO3A 1GB1A 4B3TL 4WAAA 1H95A 1OO9B 3N32A 1BKBA 4R4TA 2LJIA 1CKMA 2ZVNA 4AYBG 3TP6A 4B08A 5FLXc 4C3JG 2KJXA 2IO3B 3HK0A 2RCNA 5JJIA 1D3ZA 2PJHA 5CBEE 1ET6A 1SMYD 1GUGA 2IY0B 2EPBA 5C3EH 1CHPD 4G7HC 1UUPA 1ZXHA 2AQ2B 1SNMA 4FADA 3GV3A 1HHVA 1VZ8A 3OWEB 1H9KA 4DAPA 1WVLA 4GLXA 1F9QA 3H6MA 2AEHA 4XT1B 1ZE3D 1A15A 2F0WA 2RF4A 4R1JA 1ZKHA 4A3KB 2WDVB 5BYSA 2D3GA 1A0IA 1B44D 4DV0Q 1TS5A 2INDC 4DV0L 1Q82C 2NVXB 1GKHA 4FA6A 5E7NA 1BQQT 1GHJA 4YSXB 5KYLA 3R93A 1TIFA 4WJ3M 1V43A 4TKOB 1WYGA 2L52A 3RN9C 4JIOU 2L0FA 1QVGA 1R4QB 1SIJA 4OW0A 2W9NA 4OIKA 1JB7A 3HKZB 2B63G 3NUHB 1F2ZA 2WKCA 3P20A 2FIDA 1IYFA 3KBGA 5LL6S 4K7UA 1U5KA 3NEMA 2F3WA 4ZUIA 4C3HG 4BKSD 3ZNZB 4A3JH 5C3JB 2N7JA 1T3QA 3OW2A 2G4SA 3I72A 2JN4A 4G57A 1B4OA 5EBDA 2VUMB 4UAIA 1C7YA 2N7DA 3ZO5B 4XQJA 2MP2B 2K5PA 4YHHQ 2DY7A 3AE5B 5CX3A 4YHHL 1ASYA 1WGGA 5C0XJ 3L4PA 4NP5A 3R7QA 1FIQA 3AMUA 4ZRIA 5JJZA 4IOCA 2YEPF 1SROA 5CV4A 3GTQB 4YCVA 3LWEA 3DMUA 4GLAC 3CPWA 3EGRA 3NY5A 1MI2A 3FDTA 4PV1C 1MJCA 5I9PA 4G4KA 4HEA1 4WQMA 3VYTA 2HUGA 1PTOH 2WV6D 3DWQA 3G71A 5K36G 4HDQA 2Z9HA 1AW7A 2WS3B 4C1NI 4A93H 3WANA 1SNQA 4E6IA 1GB4A 1Y1VH 4ME5A 1OXSC 3TP8A 1SE9A 1QZGA 1EY0A 1SE8A 2EYFA 1AZPA 2OEDA 1X3EA 2YU9B 3S2DH 3S2HH 5BMHA 1E3PA 1B9NA 4L5QA 4X3TA 4DV3Q 3LJ3A 3GTOB 4DV3L 3HOZH 1STGA 1E7VA 4ICVA 3V6EB 3OPOA 1HUNA 1H4RA 4IALA 3VQIA 4EFOA 2B76B 1LTBD 1MPEA 4DUZQ 2BH8A 4K5VA 2Q8IB 3I4MG 3IXSA 3MFGA 4KTAA 1WGDA 2K50A 4C3IG 3LYYA 3HKSA 5E3FA 4N6EB 2A5UA 1Q5WB 2ZXPA 3D31A 3M4YA 1RTOA 2ICEC 3GTKB 1WH3A 4LDTD 4W9KA 2V1YA 2AQ1B 4QMGA 4D2KA 2EELA 2L1BA 3T3OA 3QK0A 3F2BA 2VL6A 4FF3A 1M4VA 1FD7D 1PRTD 2E6XA 4HSVA 2KQSA 3S1MH 1HZCA 1TWFB 4C4VA 3NJTA 3P63A 4ME3A 3IVFA 2A4ZA 5IYCH 1VJKA 2SNMA 1K0SA 4MT5A 3L3OC 1UWMA 1HA5A 2ID0A 4XX5A 2EKEC 3AXCA 3FKIH 2JA6B 3BY4B 3N1XC 2E2IB 4GN1A 4BY7G 2WAQB 2QCPX 1X65A 4P71A 5M5YH 1YD8U 2K7VA 2NZ1D 2CU3A 1HTQA 3P1MA 3KF6A 5D2MB 1B2TA 3J7YW 5JHAA 2EJGC 4DV1Q 4II2B 2KLGA 3FHWA 1V8QA 2L55A 4DV1L 2K0PA 4AH6A 3ZDTA 1WJUA 4A3EH 3TRZA 1WFYA 1KRSA 1EZ6A 2XSCA 1LT3D 2KJHB 5EAYA 4XDDA 3URYA 3PHXB 2K5VA 2VNUD 4BY1G 3UDXA 1CKOA 1WTWA 5C4XH 2C5LC 2OQKA 2PPHA 3OMGA 4A3IB 2KFKB 4LF6Q 1Y8NB 3RN2A 2RSOA 1KDBA 3Q14C 4LF6L 3PS6A 1IKLA 2D3CA 4DR6Q 1EWIA 4R4IA 4P6VF 4DR6L 2IO2B 4YCWA 5EQ0A 3PO2G 1MKHA 3DDCB 2WDTB 2QIEB 1T0YA 4BBSG 1CFMA 4APVA 3A1QB 3C19A 1OQYA 4FXKC 1PHJA 2K9XA 4KSKC 2F4VL 2HCIA 4EZLA 1MHHE 5JHBA 3F2CA 3KUDB 2M17A 1HRJA 2E2HB 3BDCA 1RKNA 2K5DA 2SAKA 4NKLA 2DJGC 4DR2Q 4IM3A 4YWGG 5FOBB 4BOZB 2K5WA 1JWAD 4DR2L 2Y5PA 2N49A 3IHPC 4I6PA 1DD2A 2JUOA 2MCNB 1OXUA 2RPQA 1HUMA 1B70B 3K9OB 2AQ3B 1AP0A 3UQAA 1LACA 1TWCB 3CF5A 2WACA 1E90A 2A74C 2INNE 2PW5A 4BVUC 1V97A 4F7ZA 3OLMD 2IZVB 1IZ6A 3I4LA 2DLBA 4KJOA 3TMPB 5FO9B 5GAGC 5J22A 2JWZA 2ZTDA 1P3QU 3DWMA 2C60A 3S9WA 4QUCA 3NS1A 5ELBA 2R93G 3UI2A 2JA5G 1SB3C 2CW0D 2RD0A 4PS7A 1AH9A 4IG7B 2WWZA 1PGXA 2MRPA 1WE6A 2NWGA 1Q3LA 1V1PB 2K1BA 1WCMB 3KUCB 4KI0A 1FPYA 4HJ5A 2K8HA 3K81C 5EKLA 3S2AA 1HR0Q 3S15B 1QLBB 2N9LA 2L05A 5BMIA 2H1EA 1C4CA 1EWHA 3H91A 5C44G 1P7FA 3WWVA 3PF4A 1YHBA 3AFQA 2V9HA 4QGUA 4EE2A 4FXDA 2ZPNA 4RCNA 1U4AA 2FJ2A 2VW9A 2PE9A 4KY6A 3WALA 2KVMA 4H0LC 1SIFA 3DBRI 3V61A 4KDLB 4ZRZA 1A3UA 3GS2A 2R92G 3EFCA 4IPCA 2Y0SB 4A3BG 4PS8A 4HIKA 2VY3A 1GC7A 1S5FD 4X65L 1MGSA 3KVFB 2LHDA 2LRUA 3PIOA 2ZJRA 1VZ7A 3CCRA 2A8VA 1W2BA 4GN3B 4JPSA 1PH7A 2KO3A 3BINA 1VQPA 1UEBA 3SGIA 1I94L 1LFDA 2KNBA 1BR9A 3AFPA 2B39A 3I4OA 1EF1A 4DR4Q 1HA6A 1LTSD 3APDA 2R7ZH 4LF5Q 1Y1WB 4DR4L 4LF5L 1IHZA 4IPDA 5I4DA 4DHJB 5FK9C 1VQDA 5BO4B 1JOKA 3GTPB 2UXBQ 5FJ8H 2GVBA 3CQZH 2UXBL 2FCNA 1LQBA 2ES2A 2FINB 4BKSA 2N0SB 2FXQA 2PYKA 2PI2E 2WX0A 1VQ5A 3L16A 1UWVA 2ZEQA 4RCOA 1CQFA 4L6TB 1ZP0B 2Z4IA 2VS1A 4OWWB 1K50A 1UE5A 4B6WA 4BOSC 1WFQA 2KJRA 3PZ8A 2HDEA 1PH8A 4AYBB 4J15A 1H9SA 3B0AA 3IAS1 4K0KQ 4XC2A 2DZMA 5HI1A 1STEA 5JZEB 2HHHQ 1K8MA 1OXVA 4K0KL 3I55A 1LM8B 4DV5Q 4GDKA 2HHHL 4DGZA 4P1BC 1I50H 4DV5L 4NXMQ 1K0RA 2EYOA 2LS01 1D5XC 4NXML 1HTPA 1RHPA 1B53A 3PO3B 1TQOA 2EE1A 3OIQA 5IYDH 3SE0A 3L7ZC 5A2QE 2KDBA 3DUZA 3L13A 1MG4A 4PZ6A 5IP9H 3ERQA 2GI9A 1I4QA 2J4XA 2KVRA 3PVLA 2IX3A 4C2MB 1SJHD 4IJHA 3J7AV 1V5TA 2L83A 2L5TA 5BMGA 3X0WA 3T16A 2RHSB 3ZYYX 1SFOB 2F0OA 1XCQL 2PMZE 4IQZA 4AUQC 2LUEA 3RLNA 2EMSA 4HXDA 1EUJA 3L17A 2BH2A 4C3HB 4X66Q 4YSZB 3UDIA 2JJQA 1IBLQ 4X66L 1A70A 3ONAB 2UXDQ 3P4RB 5D94A 1IBLL 1WSPA 2Y3AA 2UXDL 4OGQC 3SFDB 2MO0A 3A8IE 4M1UB 4R4OA 3J7AF 1IL2A 4YL8A 1RTNA 5CHWA 4B3MQ 1PH6A 3S14B 1KTKA 4X64Q 5DM63 4LNNA 4MGZE 3TS0A 4B3ML 3VA5A 1DONA 2DGYA 2Y5CA 1TKWB 2V4DA 2JXMB 5IP7H 1FFVA 3AV8A 2MQJA 4GNXA 1TS2A 2D9UA 2IY1B 3EA6A 1A63A 3H7SA 4FJVB 2D2CC 1ZYRC 5HGQA 4B3RQ 1OXTA 4W9GA 4BKTA 1X3GA 1X55A 1KIXA 5BN5A 4B3RL 3RFZB 5H92C 1CJEA 3P4PB 2MO1A 4AWJA 5C1ZA 1LT5D 2CU1A 2OCEA 3OTOQ 3QARA 2D3BA 2JEBI 5E4XA 3OTOL 1AYFA 2BW2A 1KABA 2NR2A 2IWHA 4C1NK 5D65A 5C5MA 5E6JA 2JVCA 1SYDA 4H7BA 1HNWQ 3CSFA 4FLHA 3A5ZB 1CA6A 1HNWL 1YJIA 3E0EA 2ZCBA 1CMXB 3U2SC 1YQ4B 4KD3A 4LK0M 4MHEA 4IM2A 1NDDA 4PYZA 2CHBD 1K73C 3ALBA 1LTRD 1YJJA 1OGWA 2K28A 3AH7A 4OZBA 2K14A 3NPPA 1PH4A 3ZTCA 2J0MA 1WI0A 5FLXL 3MXUA 4N8X1 3AM9A 3QIJA 3PUYA 2G3QB 3RZOH 2AX5A 4OHJA 4C3IB 3HOWB 5GROA 4A3DH 1O7LA 4J3OD 4KGRA 1R4NI 1NR2A 2TSSA 5M3FG 1EOVA 1T9HA 3CWIA 2J7ZA 4FNFA 1NSNS 5LL6X 4MM3A 4YTNB 3IT4B 3ZW3A 2IX0A 4C56C 4GB9A 1Q1BA 3NE5B 4KKTA 4HIDA 3ZXVA 1N62A 3EN2A 2IDYA 1KXLA 4MSQB 4CJ1B 4R4CA 1C76A 1GO3E 2J42A 4P73A 3DBLI 4RM8A 2ZXOA 1VQIA 1NEKB 3K80C 3S1NB 3PQIA 1NUCA 4NDXA 3NRZA 3SK6A 2MHJA 2KOLA 3BDOA 3BYTB 4GKJQ 4PS3A 5IO9A 1YNJC 3WIMA 4GOPA 1EY7A 3STBC 1XPUA 3Q3FA 1DM0B 3PF5A 2ZNVC 1TS4A 1C9FA 5L95C 1O7YA 1Y8OB 3DHQA 2MA9B 3VR5A 3NVYA 1T0RC 1P0RA 3JSVB 3LB8C 1J19A 4IM0A 2MNAA 1RAXA 1HZ5A 3ND9A 3I73A 1KLGD 2UXCQ 2UXCL 1Y8PB 2KMAA 1K3BC 4PNYA 4GKKQ 3LNNA 2R7FA 2MWSB 4HPLB 1HH2P 2R3ZA 3D4DA 4GKKL 1BUIC 3R66C 1DGSA 3K0YA 4ZQ3A 3TMEA 2G9HD 2JA7G 1Q7YC 4DUYQ 1P9DU 1VQMA 2V3NA 2HDMA 3BU2A 1ZXTA 4DUYL 4BY1B 3HOVG 2WGSA 4K8IA 3AE8B 4DFAA 3RYTA 3PLVA 4MJSB 2ZM6Q 2ZCCA 5C0XI 2E8GA 4Y7NH 2ZM6L 1ZW7A 5BN4A 2E74C 4A3GG 2WXFA 2PQEA 3RNEC 1QKZA 2KOXA 1R9TB 1X3FA 2L15A 2LXKA 2LXAA 4G3XB 4BBSB 4RKLA 1ENCA 2L0TA 4GU2A 1RFAA 2OOBB 4KX6B 4FULA 1QG7A 1TXYA 2N8NA 2EDGA 2DZIA 2NN6H 3UINB 2PZTA 2PI2A 3QG1A 4A90A 1ISNA 2WAQG 3UDGA 2XNAC 1KD1C 3SEBA 1WR1A 4OIJA 2BPSA 2FNJB 2BKFA 1PZKD 5KNBA 5G5GA 2XN9C 4F1SA 1GXDC 4B0EA 4XYCA 1Q8KA 2K05A 4CHKA 1EQTA 1TWGH 1UNSA 1ICWA 1JR0D 3Q8FA 3HKZE 1FVIA 1RD9D 1QOAA 3IFDA 1GUOA 4YWLA 1DOMA 3AU5A 1QVFA 3HOYB 1WJJA 2EXDA 4MN3A 2QHOA 3X3MA 4ZUJA 3CCEA 1BMLC 3I57A 1WXVA 1WR6E 3FAHA 1FXAA 5F2DA 1KJTA 1IYVA 3NBHB 1HJPA 4JG2A 5C0XG 4BA2I 3JC66 1VQOA 1PRTF 3LDZE 2KWDA 1PFMA 1ZOYB 4OZAA 4HROA 4M00A 2XRQD 5CR3A 5CHVC 4YWKA 3ZUNA 2MJ3A 3B2GA 2HD3A 4C00A 2GN5A 2FCQA 4HLEA 3PGZA 3C2PA 3KH0A 2WB1G 1CA5A 5JJKA 1IUEA 3RZDB 3MJWA 2DZKA 2W3RA 3QA8A 3S24A 2LSSA 2EMTA 1BDOA 2IO0B 4X3UA 4A3PA 4WIPA 1CUKA 1SNOA 2Q2TA 3OW7A 3PRMB 4ITKA 5H8YE 2KHJA 4DR3Q 2JYTA 1F2YA 2R92B 2WFWA 4DR3L 4DR5Q 4A3BB 4JX1C 4AQ7A 1GOZA 2EYLA 4LUVA 2M00A 3U58A 3AU7A 4EX5A 4DR5L 1PH1A 2MBOA 5IOCA 1EY4A 1PYWD 4ANUA 3RNAC 3NHHA 3TP5A 2WXJA 3NWSA 2I5HA 2WX1A 1XMOQ 3Q0AA 3BVGA 1XMOL 1QVCA 2GLSA 2K5NA 4HRSA 1WCMH 4JVZA 4DU9A 1OTRB 2JYOA 3TUOA 4L23A 2K04A 2M19A 3VVWB 1G2TA 2NVYB 4B3SQ 1XCTL 1YJ1A 4NAWB 1EWYC 1U4MA 4AS1A 1IYUA 3K7AB 4B3SL 3KF8B 1G2SA 2V4LA 3HOUH 2CQAA 5CHFA 1UE6A 4LJZC 3V05A 1SYGA 3SK4A 2E76C 3U4ZA 1HZ9A 3KDFB 2A6EC 2F0SA 4HPPA 1GG3A 1SBBB 4ZCKA 4A75A 2KWUB 3HZXA 4A3MG 1NY4A 1QE6A 2LASA 4CO7A 5KRUA 1JROA 2I2YA 1Q0WB 1C8CA 3CW2C 5DM73 1U4PA 2J52A 4G7OC 3DBRB 2KX0A 3IBEA 4DXGA 3MTNB 1G6JA 1RRBA 4PK1A 3N20C 1N33Q 1SSOA 2WAQE 4TVAB 1N33L 2BS4B 2GBRA 3TL5A 3FILB 4FN2A 1UWXA 1PA6A 1TKYA 1DCZA 3NUCA 3RNUA 1F9RA 3E56A 1WI5A 3Q3JA 1ZDVA 2IBIB 1JC7A 2OJRA 1QJOA 1AEXA 3N30A 2LY7A 2CH4A 3ZKJC 2AL6A 1Y1WG 4GS3A 1O7IA 4PT5A 1GC6A 1JRUA 2AYOB 5CYUA 2M1MA 3VTWA 1CT1D 5LMUQ 2JY6A 4A3FB 1OQQA 4MELA 3UF8A 5LMUL 2JQRB 2NS5A 3CCVA 4TMAB 4DAVA 1MD2D 1OTCA 1Y56A 4XWTA 1J0GA 1V49A 4O1NA 4C3JH 2DZJA 3AYHB 1WYDA 1WGHA 4KD4A 1SYCA 3TEYA 4DK6C 4BXXH 4ZLTF 2X6LA 3CMAA 1YJWA 3T56B 1JOQA 3IAM1 3I3TB 1KOTA 2JP1A 3H9DA 4JI8Q 2R7DA 3OHXC 1RWSA 2R2OA 2JT4B 1HR0W 3AEFB 1B8AA 3BK2A 3PLUA 4FXGC 1VQLA 1I6HH 1A5RA 3KBXA 1W6KA 1YIJA 1QUQA 4MEMA 3AE1B 3GE3C 1VD2A 4GDLB 4R4QA 3PO3G 1SDFA 2HTHA 5CV7A 3QB3A 2LVOA 2WXPA 2ALYB 1QOBA 1B7YB 1E2ZA 1P1AA 4XYQA 5EPJA 1FCLA 2A6HC 1MHXA 3S1RH 2B63H 1JOOA 2F4IA 4J1MA 1DOIA 2KZRA 3NG0A 4KIKB 1X56A 3PTFC 3ERSX 1IGDA 5KHQA 4WRDA 2PTLA 1TKGA 1XNQQ 4OWXB 4HKZE 1TZ1A 3FKYA 1XMQQ 1XNQL 1EL0A 2KLCA 1LLRD 5D3IB 4X3KA 1XMQL 4GZYC 3MXGA 2DHZA 2E3TA 4FJZA 1SJED 3ZQ4A 1D8LA 5IODA 1VMCA 4JBJA 5AZHA 3VR2A 3A55A 3S14H 2VQEQ 1IBMQ 1KHIA 3HM6X 4WFN3 2JA8G 5C3EG 2VQEL 1JMCA 2XBBC 4ZHOA 2L12A 2JEAI 2B3AA 4R8IA 3NVVA 5ELEA 2PMVA 4AIMA 2K22A 3M3YH 1WTRA 3N9YC 2KA7A 2Q8RE 2L9HA 1PGAA 2LZ6A 1D1IA 2CHWA 1XNRQ 3EHVA 2WYQA 1NI2A 4DHJD 3KLWA 4NXNQ 1XNRL 1MI0A 1TTNA 2OHFA 2WXNA 4M0WB 4NXNL 5M3FB 2UYZB 4BBRB 4NAMA 4DV7Q 3Q24A 1BNZA 4DV7L 4ALPA 1VQCA 4W9CA 1FGBD 5JVH3 3DVNU 2ICIA 4TQ0A 3P7JA 5ELFA 3UE0A 2D5GA 2K3UA 3E9IA 4ANXA 1XTDA 2Y0SE 4V0BA 5M5WH 1ROEA 2MP2A 3MWYW 2B8FA 1MSHA 4PZ8A 2V4IB 3C8YA 4ANVA 1RODA 2NUCA 1WGYA 3PV1A 2CVRA 5IAAC 3FP9A 2OXPA 3I2ZA 1IL8A 3M4OH 1QT9A 2UU9Q 2GBNA 5MPOA 3I4MH 4OEMB 3ND8A 4U673 4IUPA 4KV6A 2UU9L 1VR9A 2N9KA 4ICUA 4JLCA 4G50A 3Q6BA 2K6AA 5IYBH 5FLMG 1CZWA 3RLOA 5CGKA 2FMMA 2A69D 3T1HQ 3FMCA 1H9JA 3VFKA 1SE2A 4G7ZC 3T1HL 2XEWA 4QIWB 2LFNA 3GZNI 4LLGM 3RI7C 4B0MA 4A55A 4DUZL 5CBAE 3DLLA 2MH7A 1VQ8A 4JI0Q 1JW9D 3K58A 1WYWB 2ONQA 4OWTB 3HOWG 2JA7B 4JI0L 5FO8B 5C3XA 2BCOA 3UQBA 5DPSA 1NCVA 2L0CA 3ULJA 3HOVB 1JQ4A 2DNCA 1ESFA 4FBJB 3GOEA 3HRDD 1R4NB 1T0SC 2K6DB 2Y5BB 2KXJA 4X3SA 4L2YA 1B9RA 1EYCA 2EXZA 4AYBE 3J80E 3S1NH 4HJGE 4J6IA 4A3GB 2IL8A 3W5VB 2AUKA 3CCMA 2KDMA 2VZKB 2FMCA 3VUWA 2WXLA 2E5LQ 3BZKA 3DEOA 3KFUA 2OF1A 2I46A 1FNWA 3Q3OC 2E5LL 4BA1I 3CXCA 4BY7H 1C4QA 3DBLB 1RYJA 2IHEA 1IYJB 1QNKA 2J7QB 1PDQA 4KHVA 2K5HA 1HFGA 1ZYRD 1FJGQ 1H9MA 3NTIA 1B9MA 1ET9A 2RBMA 3Q23A 2ZZPB 1FJGL 4K7SA 4B9XA 1JJ2A 4JI6Q 1U4LA 4BKGA 1S5ED 3IT6B 4JI6L 3DBSA 1BT0A 2NPTB 5DPTA 1NNXA 3IFTA 1K83B 4L5TA 2C9WB 4JQWC 5DAUA 4BY1H 3GB1A 1F2RI 1HEZE 2JU6X 1M8AA 4JWUC 2EYPA 3I90A 1YIWA 1JQYD 1PUTA 4LF9Q 4KY7A 1LUZA 3J7ZC 2KACA 4K81A 1A2UA 4LF9L 4WJQA 1SAPA 2CKZB 1EFWA 2N9PC 3PO2H 2R6GA 3OJ3A 3C46A 1F1HA 1VQNA 1J5EQ 3H6NA 1STNA 2K5QA 5FR6A 1SF0A 1TYGB 3M3JA 3K8AA 1J5EL 1WTVA 1F9JA 3FKIG 3H0GH 3PSEB 2R2QA 1SYFA 3I4NB 5GAHC 1YNTE 4F88A 3HGBA 3BJUA 2LGXA 4FDBA 3TREA 2CCZA 2QILA 4WH4A 2KCCA 2ON8A 1HNZQ 2WB1B 3SHLA 1TGZB 2C7MB 1FR3A 4F87A 3TDQA 2MX2A 1HNZL 3DCGA 4W9HA 5I6YA 4UPAA 1AARA 1CK1A 2BS2B 3I5JC 4DNTB 4N9PA 2WP8J 3M7NA 2KFKA 3U7DA 3S16H 1XLNA 3WCQA 2EYHA 1D5ZC 4A3EG 3A4SC 3HVDA 3V62A 1GJZA 1XYIA 1XF5L 3CP0A 2WU5B 4N9TA 5JVG3 1H8CA 3RULA 3A1QA 1EQQA 1TY0A 4ZRPA 1PFBA 4ZOHC 1YNJD 5TSSA 5IP4D 3D4WA 4CJ0B 4RF0A 3STBD 4E71A 3E3XA 5E1FA 1I35A 3A7AB 2HT1A 1WGKA 2JXTA 3W3AA 2D2QA 4A8XC 3EJIA 1ICFB 1WE7A 2PZUA 1HTLD 2R93H 1MVKA 1L1OB 4MGYE 3MA2B 2JA5H 3DWAA 3HOYG 1GUWA 4PYUA 2L7RA 1SR3A 4HEDA 2CH4W 2EOTA 2AWNA 2O2VB 4QB4A 3W5UB 1L0VB 5IA7A 2DN8A 3CCSA 2O5JC 4K2KA 2BYVE 1PZID 4FF2A 1LO5D 4K3CA 3RN5A 5C44H 5HG2A 1CM9A 1PFDA 2OQ0A 2QA4A 2EYMA 1H9RA 2IGHA 2BB5A 3L10B 3ULPA 4X6AH 2JRIB 3AE7B 5TR5A 3RPFC 4YXDB 4M8MA 4P75A 1HR0L 3ZNGC 5J3BA 4HIOA 2NVTH 1WRDB 2R92H 2ATWA 4KKIA 4BBNC 4DK5A 5EPLA 1KLVA 5M3MB 4A3MB 4RMFA 4ZRKA 3J81i 1RF2D 2NVQB 2F0UA 3CRKC 3O13A 3CCQA 1KM7A 3K9PB 3PT2B 2CJOA 1CI3M 1V1PA 3DBHI 3AE6B 3NQTA 3CC7A 3DVNV 1VF7A 2RCFA 2CHZA 5EE9A 4RGMA 5AJ3Q 1A6XA 5DEHA 2LEKA 4WAFA 2DNEA 3V3XA 4MTNA 2RDFA 5AJ3L 1L6UA 2KCNA 3RZWC 1VQHA 2Q2IA 3ZTDA 1Z5SB 4LF8Q 1U4RA 3DM3A 1ZEQX 3RLFA 4JK1C 4LF8L 5AZFA 5KNCA 3K7AH 4OVZA 2BTEA 1TWAB 4CDDC 1MJDA 3A0JA 5J1ZA 1STAA 3MZ5A 2G5DA 4XQQA 4PQXA 2G9DA 5M5XB 1X32A 2YTXA 2RDBC 2KDFB 1ZKOA 4K14A 5JOBA 2E2JH 3MXPA 1EZ8A 3J81E 2XIWA 3CPFA 4OELB 4LF7Q 3S1QH 1OEYA 3VH4B 1RIPA 2O5IC 4RMAA 3HUIA 4DAYB 4B9WA 1SGHA 1NBFC 4CDCC 3A8KE 1F2LA 1QNUA 2WXKA 1XLOA 2W82A 1NYRA 3UIOB 3MTSA 1YX6B 5J17A 3A74A 5BYRA 2C9OA 1KAWA 4LK1C 5DPWA 4HAEA 2L4NA 2CQOA 1IBKQ 1HFNA 1L4ZB 3A7LA 4AQYQ 4MDKE 4JC0A 3MEHA 2LI5A 2LGDA 4AQYL 3NQIA 4GXBA 2ACZB 2FIFA 3M4PA 4H02A 1XLPA 1PFNA 3F2DA 1KDCA 1LTGD 3MC0B 4IFDH 2C5CA 1PLFA 2F0GA 3HOXH 2K01A 3J81L 4KKUA 2RDHA 1VCIA 2RMMA 2AKWB 4H13C 4FF1A 3HM3A 3QIAA 1JT8A 4S3SA 4O2DA 2SDFA 3GTLB 1NVID 1WJ4A 2KUMA 3H7PB 3GTMH 4W9FA 1YJ9A 4MGKE 3CCUA 4ZRJA 4DR7Q 2YV5A 1WTOA 4DR7L 4W9JA 1EO6A 1V5OA 3PGEA 3GTJH 2M9VA 3T3NA 3N3KB 3U8ZA 3S17B 4WQOB 3AEAB 1JWUD 5C4ZA 3M7GA 3W1SC 1L0YB 2A69C 1DOKA 1WTHA 1ML0D 2HQLA 5CMDA 3TQYA 1BBXC 1YQBA 2MJDA 4A3FG 2RSUA 1STHA 3N1YC 3VRBB 4DHZB 1Q12A 3SDZA 3SR1A 3K0XA 3JAMi 3W1SA 5I9OA 2N55A 3RNBC 3DWPA 3OYYA 1EUVB 3DHIC 2IO1B 2JA8B 5C3EB 3I3CA 3NP8A 3R3OA 2A68C 1WIAA 4K6DA 5A2QL 3P75A 4ZKBB 3RNCC 5C2TB 1RCVD 1PVOA 2MHVA 2XWJB 5KNDA 2A1AA 5IYDG 3WDNA 4MH0E 4FO2A 4DAMA 2KX3A 4X64L 4A3KH 4PMWA 1SLJA 2NZOA 3DM1A 4ABNA 5IP9G 2M0AA 4GGQA 3G6EA 2A6ED 3UGBB 1TS3A 2BOSA 1HCZA 2G45B 2NVXH 2YVCA 1X3QA 5IT9c 1XD3B 3OOCA 2KT7A 3ZNID 4KDIC 3BZDB 1WTQA 3QJYA 2F0DA 5T1GA 3UE1A 1K51A 1PRTB 1WOCA 1SXTA 3KYHC 5DCNA 3JAME 1F0ZA 4CJ2C 1WF9A 1K28A 1S5DD 5G3LD 3CAMA 2KQ7A 4IOAA 3TZDA 1KNEA 2ZTCA 3G7LA 1JE4A 3F8TA 2ENBA 4L8JA 1BF4A 1YMHE 1LT4D 1BCPB 1LTAD 1LXDA 4A3JB 3K7UC 4PG3A 1C79A 1YI2A 1FYCA 2BVCA 4P7IA 1DOXA 2SNSA 3MHSD 1P8LA 4JE3B 3MXNB 4UP7A 5ELCA 4A3CG 1XLQA 2PEAA 3V6CB 5JPNC 3ECIA 2VUMH 2PPBC 1BCPC 3J80c 1CSQA 3SK8A 2SOBA 3L54A 3F1ZA 1FXTB 2KTRB 1T0QC 3ZRFA 3NZUA 2JQOA 1KC8C 2UU7A 4B95A 2KVZA 4CQNA 1KNAA 1GUTA 2O2LD 3EECA 3GTQH 3OMCA 3UIPB 1Q86C 1E7ZA 2JX5A 1PTOB 4JI5Q 2JZ3B 4BBRG 2J53A 3J7A5 4A93B 1RM6C 1QCBD 3WA0A 4HMJA 2DAFA 3DXJC 4NY0A 1TBEA 2X69A 1GD7A 1O78A 2M2LA 2QMTA 3OSOA 1QB5D 1XT9B 1VF5C 2I0QA 3S2DB 3S2HB 2IYDB 2YU9H 1G91A 1R7SA 2CWAA 3KJPA 3BYYB 5JEAH 1L4DB 3HOZB 1J7CA 2B29A 3GTOH 1AWDA 2ASQA 4M02A 2Z4HA 1HXYD 4N58A 3K5OA 2YYZA 1A62A 1WX9A 2ZJDA 1SNDA 4HWIB 1GVPA 4GKJL 2PVOD 4JL9A 5HGTA 3U7ZA 3EBEA 2DENB 3CD6A 4P74A 3ZVVA 1HQMC 2A6HD 2Z6BA 1IXRA 1NJIC 2K03A 1WXQA 2BT6A 4NPSA 1F9PA 4XWWA 4A3DG 2JK8A 1XXGA 3IL8A 3APCA 3SVMA 3U9OA 2KMCA 4RHRA 2RGFA 1YITA 1EIGA 1PH5A 2BF8B 2DYBA 2LGIA 3M62B 2LWPA 3GTKH 2AWOA 2Q8TA 2O6VB 4MIUA 2MSED 3GZNB 4RKBA 1IBXB 2QDBA 2ZTEA 4A3GH 4FXCA 4JI1Q 1UGMA 3T8MA 1E22A 3FRPB 4JI1L 2QEXA 2OTLA 3S1MB 3WOFA 1JORA 4HCPB 2G4DB 2B3GA 3JSVA 1TWFH 3H94A 2WXHA 2HE7A 1B3AA 2Z8LA 2NN6I 2CFMA 4JBKA 2QCZA 1WTPA 3AEEB 1LT6D 2VH2A 1IPGA 1FFUA 5EBCA 4K3BA 4IO9A 3FKIB 3T1YQ 4UP8A 1VRAB 2N4FA 2REXA 2JA6H 3T1YL 2K32A 1QOHA 4MGIE 1SE3A 2E2IH 2BDOA 4TKNA 4ANWA 5M5YB 2I38A 3RT3B 1NBWA 3Q8EA 3AE9B 4R8NA 3I63C 2QC8A 2Z1CA 2VRRB 3M9BA 1B1ZA 1VQ4A 2IY5B 4MJSA 4GIVA 4IUVA 3PPAA 4BS9A 2PQAB 1K9MC 2OJWA 4M01A 3A33B 4A3EB 5A35A 2FUHB 2PE6B 4FHKA 1JE5A 2F03A 3PV0A 2LMCB 3PMFA 4UY8C 2W54A 2ZJPA 4FJYA 3ZJVA 4HJ8A 3NSWA 4RWSC 1EU3A 4XYOA 2WU2B 4C7YA 5C4XB 3GO5A 1N60A 4YTMB 1U9RA 2K8CA 1G6ZA 4A20A 4KN4C 4HN7A 3VA7A 3TBIB 4A3IH 1AE3A 1Z7TA 1PH2A 1VQ6A 4OX9Q 2JE6I 4O0AA 5BR8Q 5C0XH 3NZ3A 4II3B 3KJOA 4S0RA 4W9LA 4OX9L 5BR8L 4OO1I 4L63B 3VR4A 1Y14B 3H3VI 2CS4A 2FUG1 1S5CD 2MP1A 3PIP3 4WWPA 4C80A 2GA4B 3JVZX 3ZDMC 2F0QA 1PQSA 4LUOA 5JJLA 4DKAC 3K5NA 1XQQA 3VRAB 2NN6G 3Q6SA 1II3A 1I6VC 1VQBA 1VDZA 4HDOA 1SRUA 1XEEA 2PCFB 3T13A 2EZVA 1EIHA 1TY2A 3I4NG 3SU8X 3T4AC 1V6EA 5EE1A 1MHWC 2F3VA 4HMIA 3FPUB 4HPMB 2E2HH 2BWFA 2DUDA 1NMFA 2TMPA 4IFDJ 4LFAQ 3IRBA 4FP5D 1E7PB 2D10A 1VZ6A 5E6OA 4NJ6A 2SEBD 3K57A 3CKIB 4W9DA 3NBHA 5M9OA 3M95A 1TWCH 5EE3A 1FXIA 2F0IA 1EU4A 3NTKA 1WMHB 2K1FA 4REZA 2VZKD 2X8XX 2PO4A 1E8YA 1EEID 4GMVA 3J81c 3A9JB 2DX5B 1X54A 2I07B 3R3MA 4GSWA 4NPNA 4CKBA 3HP3A 4RNAA 1UF0A 3NELA 2YEPB 4RAUC 3LWUA 4RGTA 4OO1G 1C4AA 4QL5A 4LJOB 3W9CB 4XDCA 2W55A 2L1AA 5FKAC 2WXOA 4QIWE 1JWMD 4OL7A 3S15H 1ENFA 2RPVA
chains in the Genus database with same CATH topology
3T51B 3VR6A 1LTID 4QF4A 1TWHB 1HQRD 4CBVA 2X6GA 2INPE 4H44C 5ELDA 5IGCA 1G8ZD 2F0EA 3GP7A 1A3VA 1Z6HA 4HCSA 2OEOA 3OIPA 3U9SA 5CC4A 3KF8A 1FRDA 5FO7B 3EUB2 1AN8A 4K6LA 4XTCS 5DNFA 3P1HA 2R7ZB 1WTXA 1J7AA 4K5XA 3KWVA 3E0JA 4IUTA 4FVMA 1JB3A 3VR9B 3CQZB 4K2LA 3Q22A 4ZYSA 2EJFC 4DA2A 1CTMA 3D4RA 2PZWA 1ZXIA 4P2CB 3Q8CA 1VMPA 1FMAD 2XRSD 3NK9A 4KY5A 2QSDA 4QCLA 5AUKA 3FILA 4CGYB 4V190 5LHY1 2F0KA 1Q8IA 1EEFD 2PVGC 4KJNA 1YNNC 1FD6A 4IURA 2B2UC 4DK0A 1R4PB 3SK5A 4NMZA 2FBWB 3TEXA 2VB3X 2B2UA 5JEAJ 5AUIA 4P16A 1DXMA 3AE3B 2IW3A 2WXRA 3KK7A 3NVZA 4XQNA 1YQ3B 4TQUS 2N88A 1FNVA 3BDLA 3T53B 1C48A 4CKCA 5C4JB 2AUJD 4TSSA 3KLSA 1P7EA 2DBYA 1LV9A 1HPCA 3CRLC 3SR6A 3GTGB 3RD4A 4KKSA 4TRDA 3KUPA 4XXEA 2A5HA 1SEBD 5KYIA 2KMMA 3FPPA 4EGVA 1NAPA 4EVOA 1VDVA 1IW7C 3D8GA 1TR5A 3HG9A 3TEZA 3Q8AA 3K59A 4RF1A 4Q5VA 2WP9B 1N5XA 1EWCA 5K36H 2EY6A 2QKIC 5JPMC 5D14A 1ZDXA 1CHQD 4LMQD 3FC4A 3AB5A 2WIIB 2BE5C 2F0HA 3MHZA 4I65A 2BBCA 3ZJUA 3FVQA 1YN5A 1STBA 2E75C 1GHKA 3ABVB 4M0WA 4YSYB 3ZGZA 1LABA 1BUVT 5IT9E 4IUUA 5EKKA 4J8QA 3RZOB 4A3DB 1ZPSA 2WXQA 1QOGA 1PMRA 1E0BA 3AN1A 5IGBA 2GRIA 1F77A 2HQEA 3KWLA 2F0FA 3NVWA 5IGEA 2A68D 5IT9L 3H09A 4DNRB 2BA0A 5T8IA 3C1FA 1XX8A 3J9CA 2D5DA 1JWSD 5G3LF 3TZUA 3MHBA 1S5BD 5HURA 3I8ZA 4IOIE 3B9JA 2WXGA 1K8OA 3QOLA 2KHSA 1X3PA 3C3LA 3AEBB 1EYDA 4WURA 1DOYA 3ITPA 4EQPA 4MACA 3J80L 2BS3B 2X38A 2PIAA 4Y7NB 1DOLA 1WWTA 3NBIA 2MPMA 3BK1A 1BCPD 3NTHA 3AECB 2J0TD 2WXMA 2W3SA 1GJXA 3VR8B 2GB1A 1I7HA 4R9WA 1K52A 2F0TA 3N6RA 2NMQA 3E6ZX 4US8A 2DYMA 5EPKA 1I4XA 1MBYA 2LUMA 5C5LA 5CV8A 2F0PA 1QF6A 1PGBA 2O4XA 1TWGB 1PTOD 1EY5A 5C4HA 5ISRA 1C77A 5HHDG 3BWUD 4RHSA 4XT3B 1N61A 3R8BA 2LFIA 3KLRA 3EVQA 3AE2B 1TZOA 1WD0A 2EY1A 2G1EA 2L32A 4YTPB 1SNCA 4Z9CB 4Q0FA 5LNK1 3A8JE 3CHBD 4DXFA 2ZT9C 3ZJTA 1OQRA 1Y69U 1RDPD 1EY6A 3PUZA 1TU2B 4IUNA 1QOFA 3M85A 1GPXA 4XE0A 3AE4B 1TJEA 1J9OA 4ZRQA 3H3VC 4HR7B 1L6VA 4IDIA 3X3NA 2F0MA 2WKDA 1D5MC 1BOSA 1E6EB 3P42A 5BN3A 2IGDA 3Q8BA 3TN2A 3LXFA 2KAJA 1N5WA 1ILQA 2VXWA 5EE0A 1SNPA 4I7ZC 2F0VA 3VYUA 4US9A 3V2TA 4FYDA 2DWQA 4XDXA 2WNMA 2PW9A 1CQVA 1SMYC 4WJWA 4RGOS 3IAYA 1FCCC 2D62A 2ZW0A 4F7XA 3HOUB 2VB2X 5KGUA 3EROA 5CV9A 2JSVX 3K5MA 1D1KA 2F0NA 3Q69A 3VR3A 2XVSA 5JXVA 5CORA 1V1OA 3L9AX 1FEHA 1PDXA 2IPKD 2QF7A 4HSPA 4R3DA 1NENB 4IFDI 1IGCA 5T1IA 1SYEA 4IKGA 3PUVA 4O42A 5IGGA 4XIGS 1I3QB 1QILA 2V0GA 2B2YC 4A9AA 1TT2A 4A6QA 1UEAB 1EQVA 3BIID 5JAVA 3I70A 1DYQA 1H9SB 4DAYA 1UGJA 2KEEA 4J6HA 1EY8A 1DGJA 2B2YA 3I91A 4GDKB 3MAQA 3B2FA 2LKVA 1V8CA 3BS1A 3HS0C 4RA8A 2IGGA 2HCCA 4C3JB 1SE4A 5E4WC 4HTHA 4ZHPA 2PLPA 2A73B 4RH6A 3MVVA 2K33A 3QWNA 1OXXK 2LHEA 3AEDB 3EQLC 4JWSC 4N59A 4YIJA 2MJ8A 2BYTA 1BO0A 1SYBA 4IFDG 1I6HB 3E5SA 4ODGA 1E9MA 3RUZA 4IZ8A 3QO2A 4QUFA 2H89B 4YT0B 1C4PA 5KEEA 1KF6B 1NR4A 5D7GA 2FFKB 4BWGB 5KIXA 1D6EC 2IX1A 1EFID 3S1RB 2B63B 2QEJC 5CV6A 2EY2A 2B8GA 1J7BA 1EOTA 3IKJA 4HKQA 5NUCA 2EY5A 4K8JA 3BG3A 4HCEA 5I2XA 4KN7C 2EYJA 1T6BX 3UI3A 1PRTC 1K53A 2HDLA 3VYSA 5IIFA 1JCKB 4PMCA 3GQBA 1NI3A 1FO4A 1D2BA 3M3YB 1Z47A 1VLBA 1L5PA 4ZKCB 2ZW1A 1C78A 5FLXE 3VYRA 5K5PA 3W5VB 3I9V1 5EKIA 3JAML 4Q2JA 4EQNA 5HFYA 1PXUA 5D3DA 3A54A 1JALA 1I4RA 5IGDA 4KHZA 1EM7A 3KLSX 3MXNA 2HTME 2PKOA 4K5WA 4U68A 2RVLA 5M5WB 4ARCA 1YNND 3GV6A 1Q10A 1PZJD 2WQYB 2IJ0A 1Y1VB 1WD1A 4MM3B 2EVBA 1PTOC 5G5HA 1F9SA 2JWUA 1AFPA 4WWMA 1KFYB 2DY8A 3M4OB 2L11A 2F0LA 3I4MB 3PIO3 4KGSA 3W2DA 1J8IA 1L0XB 4F8MA 4RGNA 4PMBA 4USAA 1ZUD2 3SXHA 3CU7A 4CKEA 1O7ZA 5I2YA 2RKSA 1W6JA 5AFWA 2FE8A 1KAAA 1JRPA 4FF4A 1FNUA 1OFFA 2PNRC 3P4SB 1ILPA 3BVMA 4ULLA 1DJRD 1JICA 4DQOC 1SSNA 2H88B 1E2WA 3AB9A 2MJEA 5C6AA 4BY7B 3AEGB 1ONLA 5JEAG 4IUQA 1IW7D 3WOEA 4H2AA 3TEWA 1A2TA 2KQ3A 1IKMA 1IBXA 1A3TA 2V3PA 1D4BA 1N63A 2RSNA 1T5XD 2NB0A 3P4QB 3V96A 1I4GA 1XTCD 2CW0C 4OZCA 2KN4A 1YN4A 4KKJA 3HRZC 4NW2A 2EKIA 2NBFA 1AZQA 4ZK9B 2PW7A 2JSOA 2OT2A 3QOJA 2BE5D 2RA4A 2BA1A 3MP9A 2KQ4X 3D6WA 4RFBA 3PO2B 2WXIA 4MH8A 2DYOA 3H8HA 1GAQB 3NXWA 4TQ1A 1B50A 5J39A 3PZ7A 1LTTD 3H0GB 3K5LA 1CZGA 5BYQA 2E2DC 1F2RC 2LMCA 2Q5WD 1JMLA 3PUWA 4IN3A 1MSGA 3AMZA 1TIID 3E9SA 3EFXD 3S16B 2M56B 3DEPA 1ACCA 1DZ1A 3NWTA 2R61A 4L1BA 2F0JA 2F1MA 3R2TA 1Q1EA 2PMZB 2KEDA 1ESRA 5FR3A 3OWFA 4EQOA 5C3WA 3N52A 1EY9A 4LTUA 1ENAA 1RJTA 1E10A 2R93B 1S4ZA 2JA5B 3RMHA 4OO1H 1Q90A 4WORA 2WLBA 2ZXRA 2WDRB 3KQ4A 3G6JB 2CJNA 3D3RA 3MFYA 3ETRA 4C7ZA 4GLSC 3D6CA 1BXTA 1BCPF 5C44B 1TKEA 3DWGC 2B2WC 2RQXA 5IGFA 3CIRB 1QWYA 4ILWA 3C1EA 2NVTB 1I4PA 5COYA 4LAAA 3HVZA 1F2MA 1CZPA 2B2WA 4ZAIA 1HZ6A 2QJLA 4KGTA 3U52E 2XWBB 2RDGA 1FRRA 1WRIA 2MGSA 1GUNA 3TP7A 2BDNA 4KMUC 5I6WA 4NZLB 1NYQA 1T5EA 3BVZA 1PTOF 3PO0A 3MJ5A 3SFEB 5CV5A 1RFKA 4KK7A 1G291 4DF7A 2B2TC 3PUXA 3LX0A 3K6OA 4DK1A 1EYAA 2B2TA 5GXGB 2E2JB 4ID6A 3S1QB 1E2VA 2WDQB 3TSSA 1TVXA 3F2UA 2FHTA 2EJMA 1YN3A 1E0ZA 2NTSA 2WINB 2B2VC 4DN4M 4JBWA 2H4OA 1FM0D 2JYEA 5EGTA 4UDUC 3A56A 1JWBD 2IT1A 2B2VA 1KDAA 2MUYA 3HOXB 1I4HA 1KH0A 2BB6A 3U4EG 2MEKA 1I50B 2NTTA 1KRHA 1STYA 1UAPA 2NYZD 3GTMB 2KECA 4M8AA 4ARIA 1GUSA 1KLUD 3FEWX 1O80A 3HEJA 3GTJB 3R2IA 3GD7A 4NJCA 1XWEA 2JZPA 5EJWA 1QQRA 4CHTB 1XO3A 1GB1A 1OO9B 2LJIA 3TP6A 4B08A 4C3JG 2KJXA 5CBEE 1ET6A 1SMYD 1GUGA 2EPBA 1ZXHA 1CHPD 4G7HC 1UUPA 2AQ2B 1SNMA 3GV3A 1HHVA 1VZ8A 3OWEB 1H9KA 4DAPA 1WVLA 1F9QA 3H6MA 4XT1B 1ZE3D 1A15A 2F0WA 2WDVB 5BYSA 4A3KB 1B44D 1TS5A 2NVXB 1BQQT 1GHJA 4YSXB 5KYLA 3R93A 1V43A 4TKOB 1WYGA 2L52A 1R4QB 1SIJA 4OW0A 3NUHB 4OIKA 3HKZB 1F2ZA 2WKCA 3P20A 3KBGA 5LL6S 2F3WA 4ZUIA 4C3HG 5C3JB 2N7JA 1T3QA 3I72A 4G57A 1B4OA 5EBDA 2VUMB 4UAIA 4XQJA 2K5PA 3AE5B 2DY7A 5C0XJ 3L4PA 4NP5A 1FIQA 3AMUA 5JJZA 2YEPF 5CV4A 3GTQB 3LWEA 3DMUA 3EGRA 1MI2A 3FDTA 4PV1C 5I9PA 4G4KA 4HEA1 4WQMA 3VYTA 2HUGA 1PTOH 2WV6D 3DWQA 5K36G 1AW7A 2WS3B 4C1NI 1SNQA 4E6IA 1GB4A 4ME5A 3TP8A 1OXSC 1EY0A 2EYFA 1AZPA 2OEDA 2YU9B 5BMHA 1B9NA 4X3TA 3GTOB 1STGA 3OPOA 1HUNA 3VQIA 4IALA 2B76B 1LTBD 1MPEA 4K5VA 2Q8IB 3IXSA 3MFGA 4KTAA 4C3IG 3LYYA 5E3FA 4N6EB 2ZXPA 3D31A 3M4YA 1RTOA 2ICEC 3GTKB 2AQ1B 4QMGA 4D2KA 2EELA 2L1BA 3T3OA 4FF3A 1M4VA 1FD7D 1PRTD 2E6XA 4HSVA 1TWFB 3P63A 1VJKA 2SNMA 4MT5A 3L3OC 1UWMA 1HA5A 2ID0A 2JA6B 2E2IB 2WAQB 2QCPX 2K7VA 2NZ1D 2CU3A 3P1MA 1B2TA 3J7YW 2EJGC 1V8QA 2L55A 2K0PA 2XSCA 1EZ6A 1LT3D 4XDDA 3URYA 2VNUD 1WTWA 3OMGA 4A3IB 1Y8NB 2RSOA 1KDBA 1IKLA 4P6VF 5EQ0A 2QIEB 1CFMA 4FXKC 2K9XA 2HCIA 1MHHE 1HRJA 2E2HB 3BDCA 1RKNA 2K5DA 2SAKA 4NKLA 4YWGG 5FOBB 2K5WA 1JWAD 2Y5PA 1DD2A 1OXUA 1HUMA 2AQ3B 1AP0A 1LACA 1TWCB 2WACA 2A74C 2INNE 2PW5A 1V97A 3I4LA 2DLBA 4KJOA 5FO9B 5J22A 3DWMA 3S9WA 4QUCA 3NS1A 5ELBA 3UI2A 1SB3C 2CW0D 1PGXA 2NWGA 1Q3LA 1V1PB 2K1BA 1WCMB 4KI0A 5EKLA 3S15B 1QLBB 2N9LA 5BMIA 2H1EA 1C4CA 1EWHA 3H91A 1P7FA 4EE2A 4FXDA 4RCNA 2FJ2A 4KY6A 2KVMA 4H0LC 4ZRZA 1A3UA 3GS2A 2Y0SB 1S5FD 1MGSA 2LHDA 1VZ7A 4JPSA 1BR9A 2B39A 1HA6A 1LTSD 1Y1WB 1IHZA 5I4DA 5FK9C 1JOKA 3GTPB 2FINB 2N0SB 2PYKA 4RCOA 1CQFA 4L6TB 1ZP0B 2Z4IA 1K50A 3PZ8A 2HDEA 4AYBB 1H9SA 3IAS1 5HI1A 1STEA 1K8MA 1OXVA 4DGZA 2EYOA 2LS01 1D5XC 1HTPA 1RHPA 1B53A 3PO3B 1TQOA 2EE1A 3OIQA 3SE0A 3L7ZC 5A2QE 3DUZA 2GI9A 3ERQA 1I4QA 2J4XA 2IX3A 4C2MB 1SJHD 3J7AV 2L83A 2L5TA 5BMGA 3T16A 3ZYYX 1SFOB 2F0OA 1XCQL 4IQZA 4C3HB 4YSZB 1A70A 3P4RB 3ONAB 2Y3AA 1WSPA 4OGQC 3SFDB 4M1UB 3A8IE 3J7AF 1RTNA 3S14B 1KTKA 5DM63 1DONA 3VA5A 2Y5CA 1TKWB 2V4DA 2JXMB 1FFVA 3AV8A 1TS2A 2D9UA 3EA6A 2D2CC 1ZYRC 1OXTA 5BN5A 3RFZB 5H92C 1CJEA 3P4PB 1LT5D 2JEBI 5E4XA 1AYFA 2BW2A 1KABA 2IWHA 4C1NK 5D65A 5C5MA 5E6JA 1SYDA 4H7BA 1CA6A 1YJIA 3U2SC 1YQ4B 4KD3A 4LK0M 4MHEA 2CHBD 1LTRD 1YJJA 2K28A 3AH7A 4OZBA 3NPPA 5FLXL 3MXUA 3AM9A 3PUYA 2AX5A 4OHJA 4C3IB 3HOWB 1O7LA 4J3OD 4KGRA 3CWIA 1NR2A 2TSSA 2J7ZA 4FNFA 1NSNS 5LL6X 4YTNB 3IT4B 2IX0A 4C56C 1Q1BA 3NE5B 4KKTA 1N62A 2IDYA 4CJ1B 1C76A 2J42A 2ZXOA 1NEKB 3S1NB 1NUCA 4NDXA 3NRZA 3SK6A 2KOLA 3BDOA 3BYTB 1YNJC 1EY7A 1DM0B 1C9FA 1TS4A 1O7YA 1Y8OB 3DHQA 3NVYA 3VR5A 3LB8C 1HZ5A 3ND9A 3I73A 1KLGD 1Y8PB 4PNYA 3LNNA 2R3ZA 3D4DA 1BUIC 3K0YA 3TMEA 4ZQ3A 2G9HD 2V3NA 2HDMA 1ZXTA 4BY1B 4K8IA 3AE8B 4DFAA 5C0XI 5BN4A 2E74C 2WXFA 2PQEA 1QKZA 1R9TB 4BBSB 4RKLA 1ENCA 4KX6B 1QG7A 2EDGA 2NN6H 2PZTA 3QG1A 4A90A 2XNAC 3SEBA 4OIJA 1PZKD 5KNBA 5G5GA 2XN9C 1GXDC 4B0EA 2K05A 1EQTA 1UNSA 1ICWA 1JR0D 3Q8FA 1RD9D 1QOAA 3IFDA 1GUOA 1DOMA 3HOYB 4MN3A 3X3MA 4ZUJA 1BMLC 3I57A 3FAHA 1FXAA 5F2DA 1IYVA 5C0XG 4BA2I 1PRTF 2KWDA 1PFMA 1ZOYB 4OZAA 4HROA 2XRQD 5CR3A 2MJ3A 3B2GA 3C2PA 1CA5A 1IUEA 3RZDB 2W3RA 1BDOA 4X3UA 4WIPA 1SNOA 3OW7A 4ITKA 5H8YE 2JYTA 1F2YA 2R92B 4A3BB 4JX1C 4AQ7A 1GOZA 2EYLA 2M00A 3AU7A 5IOCA 1EY4A 1PYWD 3NHHA 3TP5A 2WXJA 3NWSA 3Q0AA 3BVGA 4HRSA 4DU9A 2JYOA 3TUOA 4L23A 2K04A 2M19A 1G2TA 2NVYB 1XCTL 4NAWB 1EWYC 1U4MA 4AS1A 1IYUA 3K7AB 1G2SA 2CQAA 4LJZC 3V05A 1SYGA 3SK4A 2E76C 2A6EC 2F0SA 1SBBB 3HZXA 1QE6A 5KRUA 1JROA 2I2YA 1C8CA 5DM73 1U4PA 2J52A 4G7OC 4DXGA 1SSOA 2BS4B 3FILB 1UWXA 1TKYA 1DCZA 3NUCA 1F9RA 3E56A 1ZDVA 1JC7A 1QJOA 1AEXA 2LY7A 4PT5A 5CYUA 1CT1D 4A3FB 1OQQA 2JQRB 4TMAB 4DAVA 1MD2D 1Y56A 4XWTA 4O1NA 4KD4A 1SYCA 3TEYA 4ZLTF 2X6LA 3T56B 1JOQA 3IAM1 2JP1A 3OHXC 1RWSA 3AEFB 3BK2A 4FXGC 3KBXA 1W6KA 3AE1B 4GDLB 1SDFA 5CV7A 3QB3A 2WXPA 1QOBA 1E2ZA 4XYQA 5EPJA 1FCLA 2A6HC 1MHXA 1JOOA 2F4IA 4J1MA 1DOIA 1IGDA 4WRDA 2PTLA 1TKGA 4HKZE 1EL0A 1LLRD 5D3IB 4X3KA 4GZYC 2E3TA 3MXGA 3ZQ4A 1SJED 5IODA 1VMCA 3VR2A 3A55A 4WFN3 4ZHOA 2L12A 2JEAI 4R8IA 3NVVA 5ELEA 2PMVA 2K22A 1WTRA 3N9YC 2KA7A 2Q8RE 2L9HA 1PGAA 1D1IA 1MI0A 2OHFA 2WXNA 5M3FB 4BBRB 4NAMA 3Q24A 1BNZA 1FGBD 5JVH3 2ICIA 4TQ0A 3P7JA 5ELFA 2D5GA 2K3UA 4V0BA 1ROEA 3MWYW 2B8FA 1MSHA 2V4IB 3C8YA 1RODA 2NUCA 2CVRA 2OXPA 1IL8A 1QT9A 5MPOA 3ND8A 4U673 4IUPA 4KV6A 1VR9A 2N9KA 2K6AA 1CZWA 5CGKA 2FMMA 2A69D 3FMCA 1H9JA 1SE2A 4G7ZC 4LLGM 4QIWB 2LFNA 4B0MA 4A55A 5CBAE 2ONQA 2MH7A 1JW9D 3K58A 2JA7B 5FO8B 5C3XA 2BCOA 1NCVA 2L0CA 3HOVB 1JQ4A 2DNCA 1ESFA 3HRDD 1B9RA 4L2YA 4X3SA 1EYCA 2EXZA 3J80E 4HJGE 4A3GB 2IL8A 2AUKA 2KDMA 2VZKB 2FMCA 2WXLA 3DEOA 2OF1A 2I46A 1FNWA 4BA1I 1C4QA 1RYJA 1QNKA 1PDQA 4KHVA 1HFGA 1ZYRD 1H9MA 3NTIA 1B9MA 1ET9A 2RBMA 3Q23A 4B9XA 1U4LA 1S5ED 3IT6B 3IFTA 1K83B 5DAUA 3GB1A 1F2RI 1HEZE 2JU6X 1M8AA 4JWUC 2EYPA 3I90A 1JQYD 1PUTA 4KY7A 2KACA 1A2UA 1SAPA 2R6GA 3C46A 1STNA 2K5QA 1SF0A 1TYGB 1WTVA 1SYFA 3I4NB 1YNTE 4F88A 3HGBA 2QILA 4WH4A 2KCCA 2ON8A 2WB1B 3SHLA 1FR3A 4F87A 3TDQA 5I6YA 1CK1A 2BS2B 4DNTB 4N9PA 2WP8J 3M7NA 1XLNA 3WCQA 2EYHA 1D5ZC 3HVDA 1XYIA 1XF5L 2WU5B 4N9TA 5JVG3 1TY0A 4ZRPA 1PFBA 4ZOHC 5TSSA 1YNJD 4CJ0B 3D4WA 4RF0A 5E1FA 3A7AB 1WGKA 2JXTA 3W3AA 4A8XC 3EJIA 2PZUA 1HTLD 1MVKA 3MA2B 3DWAA 1GUWA 4HEDA 2EOTA 2AWNA 3W5UB 4QB4A 1L0VB 2DN8A 2O5JC 4K2KA 1PZID 4FF2A 1LO5D 5HG2A 1CM9A 1PFDA 2EYMA 1H9RA 2IGHA 2BB5A 3AE7B 3RPFC 4YXDB 4KKIA 5EPLA 5M3MB 4A3MB 1RF2D 2NVQB 2F0UA 3CRKC 3O13A 2CJOA 1CI3M 1V1PA 3AE6B 3NQTA 1VF7A 5EE9A 4RGMA 1A6XA 4WAFA 5DEHA 2LEKA 3V3XA 2DNEA 2RDFA 1L6UA 2KCNA 1U4RA 1ZEQX 3RLFA 4JK1C 5KNCA 4OVZA 2BTEA 1TWAB 5J1ZA 1STAA 3MZ5A 4XQQA 4PQXA 2G9DA 5M5XB 1X32A 1ZKOA 4K14A 5JOBA 3MXPA 1EZ8A 3J81E 2XIWA 2O5IC 3HUIA 4B9WA 3A8KE 1F2LA 1QNUA 2WXKA 1XLOA 2W82A 1NYRA 3MTSA 5BYRA 2C9OA 4LK1C 4HAEA 2L4NA 1L4ZB 1HFNA 3A7LA 3MEHA 3NQIA 2ACZB 1XLPA 1PFNA 1KDCA 1LTGD 3MC0B 4IFDH 2C5CA 1PLFA 2F0GA 2K01A 3J81L 4KKUA 2RDHA 1VCIA 2RMMA 4H13C 4FF1A 3QIAA 4S3SA 1NVID 2SDFA 3GTLB 2KUMA 1WTOA 2M9VA 3T3NA 3S17B 3AEAB 1JWUD 5C4ZA 3M7GA 1L0YB 2A69C 1DOKA 1ML0D 5CMDA 1BBXC 2MJDA 1STHA 3VRBB 1Q12A 3SDZA 3SR1A 3W1SA 5I9OA 2N55A 3DWPA 2JA8B 5C3EB 3NP8A 3I3CA 3R3OA 2A68C 4K6DA 5A2QL 3P75A 4ZKBB 5C2TB 1RCVD 2MHVA 2XWJB 5KNDA 3WDNA 4FO2A 4PMWA 3DM1A 4ABNA 2M0AA 2A6ED 1TS3A 2BOSA 1HCZA 1X3QA 3OOCA 3BZDB 1WTQA 3QJYA 2F0DA 5T1GA 1K51A 1PRTB 1SXTA 3JAME 1F0ZA 4CJ2C 1S5DD 5G3LD 3TZDA 1KNEA 3G7LA 1JE4A 2ENBA 4L8JA 1BF4A 1YMHE 1LT4D 1BCPB 1LTAD 4A3JB 1C79A 1FYCA 1DOXA 2SNSA 4JE3B 5ELCA 1XLQA 5JPNC 2PPBC 1BCPC 3SK8A 2SOBA 4CQNA 1KNAA 1GUTA 2O2LD 3OMCA 2JX5A 1PTOB 2J53A 4A93B 1RM6C 1QCBD 4HMJA 3DXJC 2X69A 1O78A 2M2LA 2QMTA 3OSOA 1QB5D 1VF5C 3S2DB 3S2HB 1G91A 1R7SA 3BYYB 5JEAH 1L4DB 3HOZB 1J7CA 1AWDA 1HXYD 2Z4HA 4N58A 3K5OA 2YYZA 1SNDA 2PVOD 3U7ZA 5HGTA 1HQMC 2A6HD 2BT6A 1WXQA 2K03A 1F9PA 4XWWA 1XXGA 3IL8A 3SVMA 3U9OA 4RHRA 1EIGA 2LGIA 2AWOA 2Q8TA 4MIUA 4RKBA 1IBXB 2QDBA 4FXCA 3FRPB 3S1MB 3WOFA 1JORA 2WXHA 3H94A 1B3AA 2Z8LA 2NN6I 3AEEB 1WTPA 1LT6D 1FFUA 5EBCA 3FKIB 1VRAB 2K32A 1QOHA 1SE3A 2BDOA 5M5YB 2I38A 3Q8EA 3AE9B 4R8NA 2Z1CA 1B1ZA 4IUVA 4BS9A 4A3EB 5A35A 2F03A 3PV0A 2LMCB 3PMFA 2W54A 3ZJVA 3NSWA 4RWSC 1EU3A 4XYOA 2WU2B 4C7YA 5C4XB 3GO5A 1N60A 4YTMB 1U9RA 1G6ZA 4KN4C 4HN7A 3VA7A 3TBIB 1Z7TA 2JE6I 5C0XH