1HQRD

Crystal structure of a superantigen bound to the high-affinity, zinc-dependent site on mhc class ii
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
205
structure length
205
Chain Sequence
KDISNVKSDLLYAYTITPYDYKDCRVNFSTTHTLNIDTQKYRGKDYYISSEMSYEASQKFKRDDHVDVFGLFYILNSHTGEYIYGGITPAQNNKVNHKLLGNLFISGESQQNLNNKIILEKDIVTFQEIDFKIRKYLMDNYKIYDATSPYVSGRIEIGTKDGKHEQIDLFDSPNEGTRSDIFAKYKDNRIINMKNFSHFDIYLEK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HLA-DR ALPHA CHAIN
publication title Crystal structure of a superantigen bound to the high-affinity, zinc-dependent site on MHC class II.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 52
structure length 205
sequence length 205
ec nomenclature
pdb deposition date 2000-12-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF01123 Stap_Strp_toxin Staphylococcal/Streptococcal toxin, OB-fold domain
D PF02876 Stap_Strp_tox_C Staphylococcal/Streptococcal toxin, beta-grasp domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.110 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1hqrD02
3.10.20.120 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1hqrD01
1GOZA 1PZKD 1PTOF 5ELDA 1KTKA 3MC0B 2IJ0A 5D3IB 4DXGA 1SJHD 3BVGA 1YN3A 1LTID 1HXYD 1LTSD 1TY2A 2QILA 3GP7A 5D3DA 1D5ZC 5FK9C 2RDHA 3EA6A 4RH6A 5ELFA 3BYTB 1CT1D 1JCKB 1I4HA 1AW7A 1LTGD 3R2IA 1EEFD 2TSSA 1B44D 4RHSA 4L6TB 4RHRA 1PTOH 2XNAC 3BVMA 2Z8LA 5I4DA 5ELBA 1AN8A 1L0XB 1YN5A 1M4VA 1KLGD 1EEID 1PTOD 1XTCD 1DJRD 1FGBD 1STEA 1PTOB 1S5CD 1PYWD 1MD2D 1RF2D 1V1OA 3DWPA 3W2DA 4RGMA 4Z9CB 1HQRD 3TSSA 1LTTD 1ET9A 1D6EC 2ICIA 1PRTC 2G9HD 2WV6D 1BCPC 1SEBD 2XRQD 1PZJD 2QEJC 1LT4D 1JR0D 1CQVA 1KLUD 1EFID 2R61A 1SBBB 1RDPD 1JWMD 1RCVD 1SJED 1ESFA 1CK1A 1LTBD 1PRTF 4NZLB 1BCPF 1SXTA 1EU4A 2XRSD 2NTTA 3CHBD 3O13A 1TS5A 1SE4A 3BVZA 1ET6A 3BYYB 1LT5D 3URYA 1YN4A 1S5DD 2NTSA 1FNUA 4ZYSA 3R8BA 1TY0A 1ENFA 3EFXD 1TS3A 5TSSA 1PZID 1XXGA 3DWAA 1TS2A 1I4PA 1SE2A 2AQ2B 1EU3A 1LTRD 1L0YB 2IPKD 1PRTD 1DYQA 3V05A 3KLSX 3DWQA 1CHPD 1LT6D 1PRTB 2O2LD 4DXFA 1I4XA 1S5BD 1SE3A 1TS4A 1EWCA 4RGTA 4BWGB 2J4XA 4K6LA 1BXTA 1LT3D 1V1PA 1QILA 1F77A 1JWUD 1LTAD 1FNVA 1LLRD 4RGOS 2SEBD 4TSSA 1I4RA 2CHBD 4RGNA 2XN9C 1FD7D 1B1ZA 5ELCA 4O1NA 1HA5A 4RFBA 1T5XD 1S5ED 5FKAC 1JQYD 4C56C 2AQ1B 2RDGA 1RD9D 4L63B 1UUPA 4RCOA 1I4GA 3SEBA 1UNSA 3MFGA 1CHQD 1G8ZD 1D5XC 3BZDB 1HTLD 1BCPD 1S5FD 1LO5D 3OWEB 1FNWA 1PTOC 2AQ3B 1BCPB 4UDUC 5ELEA 1D5MC 3R2TA 1I4QA 1V1PB 1JWSD 4OHJA
chains in the Genus database with same CATH superfamily
1EYDA 4GOPB 2D0PA 2XIWA 4GOPA 3TDQA 3OLMD 5KHOA 2IJ0A 1K8GA 2MO0A 4X62L 3TP7A 2NCNA 1A62A 2KN5A 5HGTA 1PH7A 4HJ5A 5TR5A 1AYFA 5FK9C 1L1OC 3EA6A 3VAWA 4IZ8A 2RSNA 4C3HH 4B3SL 3TEHB 2X8XX 1K9MC 2KLGA 4N8X1 4KGRA 2IL8A 2TSSA 3PV0A 2KEEA 4IQZA 3I63C 2WDRB 1R9TH 1TU2B 2HCIA 1UEAB 3I4NG 4A20A 3SFDB 4XDCA 4IWQA 4KV2A 1X9NA 1KLGD 2KWVB 4HLEA 1PHJA 4LF4L 5H1SE 3QIJA 4WAFA 5C44H 1CKOA 2X6LA 2JQOA 1S5CD 3RNEC 3Q2AC 2K01A 4Z9CB 2LVQA 1MSGA 3KH0A 5C3EH 3HKZE 4ALPA 1E7UA 2FE8A 3DQVA 1VQHA 1HZ5A 4A3DB 1D6EC 1PA6A 3PO2B 2WXQA 2N9LA 4DUYL 3LJ3A 3FKIB 3KUCB 3RNUA 3WOEA 1R4PB 1JE5A 2AEHA 3JC66 4R1JA 1CQVA 2KT7A 1H9KA 3L9AX 1X32A 1CA5A 2D2QA 3K8AA 2LGDA 3GTGB 5E6PA 3T9LA 1VQ7A 2MEKA 3M4PA 3GTKH 2A5HA 4I7AA 5IYDH 1O7YA 1WR6E 3P4RB 2CVRA 3QB3A 2CKZB 4CJ2C 1V43A 2KHWB 1AZPA 2BS2B 2B2TC 3Q14C 3K7AH 2JRHA 5EBDA 4A3JH 1N36Q 2B63B 4B3RL 5ELOA 5C4XG 3SD5A 2PE6B 5C5LA 5F2DA 4RNAA 1LM0A 4TQ0A 3HKZG 2AHOB 1HA6A 2UUAQ 4DV6Q 2ON8A 4A93G 3R8BA 1TY0A 2I07B 2AUJD 3L2PA 2WAQB 2ES2A 2JA8G 1WE6A 4RWSC 2GBRA 1D3ZA 3MTSA 2DBYA 2E8GA 4YT0B 5C5MA 3NY5A 3J7AF 5IA7A 4IPDA 1MFWA 4FDBA 3WANA 1UWVA 1OQRA 1GPXA 2MA9B 1PRTD 2LKVA 2V1CC 5FO9B 3FILB 1Q8KA 3A4SC 5G3LD 1TWGB 1X55A 3BS1A 4FO2A 4A3MB 3PLUA 1GUOA 1ENCA 1S5BD 4QUCA 2JXXA 2WXKA 3VDZA 5IN7A 2F0KA 4R8IA 4RGTA 3V60A 1IW7D 2DNEA 3JAMi 1LT3D 4N8FA 1I94Q 2IDYA 3ZJUA 3VR6A 4TVAB 1E9MA 5JEAH 1PDXA 2L3ZA 2ZM6Q 3N20C 2Q5WD 1N8RC 1I4RA 3NZSA 5HKHA 2XN9C 1U4LA 3W5OA 3MWYW 1WTXA 4CKEA 5FOBB 4R9WA 5FKAC 3S1RH 5HG2A 1RD9D 1XD3B 2A8VA 4XDXA 2BH2A 1IL2A 1I4GA 2LASA 4GSWA 1IXRA 1UNSA 2KHJA 4IUUA 3K5OA 5LMNL 2IX1A 1IBXB 1DXMA 5JAVA 2G4SA 1TGZB 4FHKA 5D7GA 4NXML 4B9WA 1AWDA 2PW9A 1K51A 2B39A 5JZEB 5LMUQ 1KABA 2JVCA 3TEYA 1UEBA 1EY0A 4V190 3D6WA 2OQ0A 4Q2JA 1QNKA 1QNUA 3PUVA 3N32A 4L1BA 1DOYA 4LUVA 1XPRA 1EL0A 1WXQA 1IGCA 3IAS1 5CR3A 4C1NI 4QUFA 5J3BA 4JI7L 5CV5A 1TY2A 1EF1A 3MJ5A 3Q3MC 1B70B 1D5ZC 2BH8A 3HVDA 4GLVB 3QOJA 1AP0A 2E2HB 1B3QA 3SFEB 3P2BA 4NXNL 1YI2A 2UXBL 1PFDA 3KUDB 5AZFA 4AOFA 1PFMA 5EE3A 2FUHB 4L6TB 3B2GA 3P4QB 3PZ7A 1IL8A 3D31A 4X3KA 1KHIA 2F0PA 5I4DA 4DR2L 4ZLTF 4LFCL 5DCNA 3UDXA 5C0XG 5E6NA 3I4MH 1UBIA 3PIPA 1K8OA 1IKMA 3VQIA 1WX9A 2KTRA 4OXPA 4GDLA 1FL0A 1WMHA 1DJRD 1MHHE 1EWYC 3SXHA 4A3OA 2BA0A 4H0LC 4JI4Q 1YX6B 2BE5C 2MLBA 1OQQA 4EQ5A 1EY5A 1F2MA 4F7XA 1Q0WB 2M0XA 1EY9A 4LWCA 2VRRB 4A3DG 1E2VA 1N33L 2B2VA 3PO2G 2W54A 2WAQE 2WV6D 4JBJA 1A6XA 2KKCA 4RAUC 2D62A 2XRQD 3FKIG 1VQOA 1ZE3D 3CMEA 3PGEA 2NVTH 3PHWB 1WM3A 1ISNA 1I50B 3UDFA 3RN2A 1PV4A 2BS4B 3ULJA 3RD4A 4DR7L 2KX0A 4FF2A 1HR0Q 3BINA 3E0EA 4LF8Q 1A63A 2MNAA 4BBRH 2DYMA 3R3MA 2HDLA 2ZEQA 3OYYA 1JJCB 4IUPA 3H3VH 1M1KC 4MH8A 3H8HA 1E6EB 5COYA 3B6YA 3BYYB 2F0NA 3M7GA 3GTOH 5DAUA 4ZYNA 1T0SC 1SYGA 2WAQG 4A3KH 1TIFA 2LGYA 3WAOA 2MBEA 2MP2B 5IP4D 1OTCA 5I2XA 2H5XA 4YCVA 3U30A 2B2UC 3H91A 4Q0FA 3S2HB 1PH5A 2NZ1D 2KX3A 3HOXG 2F0DA 3CPWA 2VB3X 4OX9L 1WTRA 2X69A 2MQHA 4R8NA 3OMCA 4K8IA 2MJ3A 5IGGA 4WORA 4A3MG 4J1MA 2LHEA 5HFYA 3U4VA 1TIID 3OIPA 3RZDH 2N49A 4XGAB 3KLSA 2KVMA 3I3CA 1QILA 4IOCA 2OXPA 4ZDVA 1VQDA 1WD0A 4BAXA 5FLMH 2WGSA 1J7BA 1Q12A 1K53A 2SEBD 2CHBD 4RGNA 1H4RA 1KH0A 2K0PA 2A6HC 2MHVA 4OWTB 1HA5A 4RFBA 4EX5A 2ATWA 3AU4A 1F0ZA 2R7DA 1B53A 3PIO3 2XK5B 2K8BA 4CHTB 2GVBA 3GTMB 4HIMA 1C1YB 4OIJA 2D3CA 5AEKB 1IYJB 3BZDB 2ZTDA 3Q6SA 4PMWA 1E7PB 3GB1A 1ZDXA 3B2FA 1PTOC 4LF6L 4NJ6A 4KSLC 1OGWA 3ER0A 4KKJA 3NOBA 3K0YA 2KHIA 3HHMA 2LXJA 3AEDB 1TWCB 4G57A 3I9V1 1WD1A 3P42A 4GGQA 2IT1A 3T56B 1VQ4A 4LFBQ 3MC0B 5M3MH 1I6HB 3MC9A 3Q3FA 2PW7A 3W1GA 3ONSA 4PS8A 2F0LA 5D14A 5D3DA 2IX0A 2RDHA 1GJZA 3L0WB 1Y8NB 2KQ7A 3WOFA 1PLFA 4OEMB 4ILWA 4XYOA 4DV3L 1KIXA 3MJWA 2QDBA 3HFZB 3HOYH 2I38A 4W9DA 5FO7B 2IO2B 4DBGA 2Q2UA 5BYSA 1WFYA 3TP6A 5HURA 3HOWH 1UD7A 4PS7A 1GB1A 2FCSA 4PZ6A 4OVUA 3A0JA 4HMIA 1ZP0B 3TUOA 1I6VC 2IWHA 4OW0A 1PH1A 1EEID 1XLPA 4LNIA 2B2YA 4AH6A 5EBCA 2MP1A 1FXAA 2MW5A 1HQRD 4B9KA 3KF8A 2PI2E 4K1RB 5C23A 4RMAA 3DHIC 4JCVE 4YXDB 1UGJA 2JA6B 4C3IG 2EKEC 2W3RA 2ASQA 4GXBA 5C44B 1MHXA 1JR0D 5CBAE 2MWSB 2NPTA 3A7LA 2IY5B 1U4MA 2IHEA 2RD0A 4OGQC 2FBWB 1SBBB 3PZDA 4BVUC 1RCVD 5C3EB 1IP9A 3IT4B 2K5HA 1AZQA 4X3TA 1V2YA 3KBGA 3CHBD 3E6ZX 3HM6X 3QJZA 3VRBB 3AI5A 1FRRA 4ITKA 2QW7A 2QSDA 4P74A 5CV7A 4FN2A 2A1AA 4X66Q 1QUQB 3LGJA 1L4DB 3BIID 4ANVA 4ZYSA 1YITA 2CHWA 2I1KA 3L7ZC 2PZWA 2UYZB 2C60A 5BYRA 2G5DA 2AWOA 4A3JB 3V62A 2WXNA 4C4VB 3T16A 2KFKB 1STAA 2W3SA 1D1KA 1HTPA 3G71A 1N36L 3CXCA 4L5RC 4A3PA 3PT2B 4LLGM 1J5EQ 2N3SA 2OTJA 1SSNA 2UUAL 1CHPD 5IYCG 4DV6L 2F0HA 3AU5A 2KK8A 4MELA 1J0GA 5EPLA 1F52A 1C79A 5CV4A 1TS4A 3PUZA 1KC8C 4K7UA 2J4XA 3EVQA 3FRPB 2NYZD 1S72A 4K81A 2PVGC 3ZTCA 4LJOB 4YCUA 2NMQA 4QAYA 4DR5Q 1NBWA 1SNOA 1HTOA 2ONQA 3U4EG 1X3QA 1LLRD 2DHZA 3CSFA 3AULA 3JAMc 4D2KA 4G50A 1JWBD 3DVGX 3M9BA 1WJJA 4C7ZA 1T5XD 4QB4A 4PT5A 3VUYA 5EKLA 2RDGA 1VQNA 3OG5A 1S1QB 4L63B 3ZXRA 3STBD 1AE2A 1I94L 4N9PA 2KJHB 4N59A 3V3XA 3W5UB 5C3XA 2BOSA 4A3FB 3OW7A 4YWLA 3SGIA 3WAPA 1LTLA 1YMHE 5BR8Q 2FJ2A 4HTHA 2ZM6L 1V5TA 1H8CA 3PMFA 1U4PA 4WJ3M 1TKWB 4OONA 3N6RA 4DK6C 1YX5B 3BDLA 1VQCA 1X6OA 1PTOF 3V2TA 2ZW0A 2KCNA 3FDTA 1YZ6A 4ME5A 4OELB 4QY7A 2SOBA 1S40A 3VTVA 3U7ZA 1KQSA 2UWQA 3ZNGC 3FEWX 3E56A 5AUIA 4YCWA 2NVUI 2W9NA 1J8IA 5LMUL 4OIKA 3VHTC 1IW7C 1NR2A 2BWES 1JQ4A 1L5PA 1EWIA 4XWWA 4X62Q 3V6CB 2LXCA 1VF5C 4W9KA 1HE8A 2VNUD 1IGDA 2N7EA 3P1MA 4C3HG 3LB8C 2XWJB 3CCMA 3AV8A 4JVZA 5JJZA 3ND8A 1HUNA 3A4RA 2V4IB 1RFKA 3G6JB 1XTCD 1WF9A 1WCMH 4IUVA 4A90A 5J2RA 1O80A 1HZCA 4DNIA 3VUXA 1RIPA 1VQ5A 2IHFA 2PPBC 4KY5A 2I1JA 2REXA 1VCIA 4RA8A 5C44G 1BR9A 5JEAJ 4Y52H 3DOWA 4YIJA 3IFTA 5IE8A 4HK2A 1H9SA 3AEEB 5C3EG 1YEZA 4PYUA 1U9RA 1Q1BA 2BYEA 4ANXA 3ECIA 3P20A 4XXEA 2BF8B 1Z7TA 5ELNA 4JI4L 4BKTA 1VQIA 2L83A 2N9XA 4YTNB 2QHOA 1N9WA 2R7FA 4DUYQ 2JA5H 4K8JA 2WX0A 4FLHA 4W9HA 2K05A 3VRAB 3H7PB 1PGBA 2N0SB 4R4TA 3UDGA 2WQYB 4BFRA 1GUSA 2NUCA 3H7SA 5NUCA 5IYDG 4FXCA 3QA8A 4DR3Q 4HVBA 2PLPA 4BBRB 4DR6Q 3ZRFA 1B3AA 4ZKCB 1HR0L 1DZ1A 1EZ8A 3CKIB 4A3JG 1RODA 5A35A 4LF8L 2UXDQ 2KJXA 4MEMA 4W9CA 2GBNA 2KQSA 3H0GH 5L37A 3TS2A 1AE3A 4L5SA 1SE8A 5H92C 3RN5A 1X3EA 3I4OA 4A3BB 1K52A 5BMIA 3BK1A 4W9JA 4GOPC 2JXMB 4QGUA 1WGYA 4NAMA 1WZ0A 3AE6B 1B2TA 3S15B 2E2JH 3AE9B 3MHSD 1CZWA 2CWPA 3I8ZA 3IL8A 2KZRA 2AUKA 4IM0A 1F9RA 2KCTA 1NBFC 1QE6A 2ZJDA 1VRAB 1CSQA 1E24A 3S14H 1FPYA 2MH7A 5IOIA 1FNVA 1PQSA 3MFYA 2OTLA 4TQUS 4AYBB 3RFZB 1X3PA 3VYSA 5KNCA 3QARA 4BKSA 1IYUA 2MBBB 1S5ED 4TRDA 2LEKA 3EIVA 3QR8A 5HGQA 5JEAG 4QJFA 4KTAA 2AX5A 3HRDD 1C9OA 3SK4A 3OWEB 1HTLD 4M0WA 1GNUA 3RNBC 1PDQA 3D0FA 3H3VI 3AN1A 4NAWA 3ZYYX 1WXVA 2BYVE 1SGHA 4RM8A 2WLBA 3DBSA 2LMCA 2L9HA 4YWMA 2WXMA 3A9KB 2KNBA 4NQLB 3VA7A 4CGYB 4DXGA 1VQKA 1YN3A 1QVGA 3H1UA 2Z4IA 3B08A 3UQAA 2RSUA 1FR3A 3GP7A 1YVCA 2KEDA 3J81L 2C9OA 2I5MX 1EEFD 2GOWA 1HRJA 5M3MB 1NR4A 2CQOA 2WP9B 3G6EA 3KUPA 2ZPNA 4CDEC 4LFBL 4ANWA 3V96A 5G3LF 4XT1B 5JOBA 2K5WA 4LUOA 4YTPB 5ELBA 1SYEA 1VQGA 2KENA 3S1NH 1VQ6A 3KF6A 5JJIA 2PKOA 4RF0A 3NVVA 3V6EB 3I56A 2WINB 2LZ6A 2LWPA 1NYRA 3TEXA 1QWYA 3AXCA 1J7CA 2OT2A 1RJTA 4OVZA 1SNCA 1NVID 1EOVA 2H89B 1Y1WH 2Q2HA 1SB3C 2PYKA 4LFCQ 3Q23A 3T1HQ 1ZYRD 3K6OA 3NENA 3CQZB 1GVPA 3IT6B 3RUZA 1ILPA 4EQNA 2X6GA 1UBQA 1E8ZA 4K2KA 3L17A 2F4VQ 3J7ZC 5GAHC 3TN2A 2NVXH 4KVGB 2JZPA 3CSTA 2LXAA 3J9CA 4JI5Q 4IFDI 2ZXPA 4QIWB 1RLFA 1XO3A 5CYUA 1UGMA 3I4NB 1SNMA 2ID0A 4HDOA 4YSXB 3T3OA 2K5PA 5CGKA 1EIGA 2K14A 1VLBA 4DK5A 1V81A 2A74C 4JPBW 2IYDB 2B3GA 1QVFA 1FFVA 3IBEA 3PVLA 3GTJH 1LT5D 2KOXA 4LJZC 3P63A 3T51B 2A73B 5M5YB 4IUNA 1WXSA 1KDCA 4IFDJ 1YJWA 4BBRG 4CO7A 4JGHB 2LUEA 2X38A 3FAHA 1XXGA 1UH6A 4DK1A 4NP5A 4HJKA 4AYBE 3RZOB 4QQBX 1IYFA 3LYYA 2C7HA 3N30A 1GC7A 1Y8OB 3OJ3A 2IPKD 4A3KG 1STYA 1DYQA 4ZCKA 1F2ZA 3I55A 4PZ7A 2ENBA 4X66L 1A0IA 1PRTB 3DWMA 2JSVX 2KQ4X 2LVOA 5HY6A 2ZNVB 5C4XB 3I3TB 4ZHOA 3KWLA 1PFBA 1WGHA 3C3LA 2BVCA 1MI0A 3OHXC 4YSYB 2EJMA 2ACZB 1J5EL 3JW0X 3M4YA 3NUCA 1UELA 3D4WA 1B1ZA 2JXTA 4DHZB 2KXJA 5EE1A 3GDEA 2YU9B 1WGRA 3UGBB 2JX5A 1J6QA 2R3ZA 5A2QL 3PF5A 3S24A 2IO3B 3WAMA 3AEAB 4DAYB 4JI0Q 3NS8A 2AWNA 3ZQ4A 4M8NA 1S5FD 5J22A 3PQIA 4R3DA 1FNWA 2BYTA 2MO1A 1VR9A 4LJPB 4JI1L 4HIOA 1SDFA 5G55A 2OF1A 1BUVT 4IUTA 2K9XA 5GQOA 3E9SA 1VZ7A 3Q8EA 4GB9A 2K4KA 4M8AA 1Q8IA 1PZKD 4M02A 3A8IE 3BZKA 5M9OA 3UIPB 3B9JA 1LM8B 1G91A 1LTID 3MC8A 3OTOQ 4X57B 4BKSD 4LTUA 1LTSD 2D9UA 3ERQA 2WX1A 5BR8L 2E2IH 1E7ZA 4G7HC 2Y5BB 2V1YA 3J80L 3NBHA 1B50A 5IT9L 5M3MG 4ODGA 3PPAA 3LDZE 1HUMA 3WDNA 4YWKA 3LNNA 1E2WA 1STNA 1EYCA 2LY7A 4K7WA 2OJWA 5E4XA 3PREA 2EQSA 3GOEA 3TQYA 2Q8IB 2KN4A 2PJHA 3A1QB 4B9XA 2PQAA 3H6MA 5JVH3 3A1QA 4KV6A 5KEEA 1XCQL 4GN4B 4FULA 4GOCA 4TUUA 4KKSA 4H13C 2I5HA 4QIWE 2FHTA 1YNJD 5EQ0A 1Z6HA 3HOYG 1RKNA 4IM3A 3U9OA 2KVRA 2CW0D 4XQQA 5EAYA 4HR7B 4F87A 1XMOQ 4WJ4A 1N6ZA 4WJQA 3RYTA 3HOWG 2WWZA 1WI0A 3GTPB 1WTOA 2K39A 4LF5Q 4A3GH 3NPPA 5E1FA 1EYGA 2M2LA 1C4CA 2XBBC 1HZ6A 1SEBD 2J0KA 2ZPYA 4LCDE 2F3IA 4UHVA 2A19A 2KJRA 2MSED 1WCMB 2HIVA 1TYGB 1HTQA 2RDFA 2IO0B 1SJED 2Q8TA 1WTWA 1CK1A 2JA7H 3DEPA 2JJQA 1YNND 2SAKA 2H1EA 4A3EH 4XDDA 3GS2A 4EKUA 3OJ4B 3CC7A 3N1XC 4GN3B 2K6QA 4UAIA 1IBLQ 2K50A 3ZJVA 2KC1A 1YJ9A 4GLSC 1DM0B 4DAPA 4G7ZC 1DGSA 5IT9E 4US9A 3BU2A 2Z4HA 2C7MB 1PZID 1DOXA 1RTNA 3SDLC 3T8MA 2JA5B 1P16A 3AEBB 1F2RI 3D32A 4DHZE 1GXDC 3Q6BA 3D6CA 4C3JH 2ZCCA 4LF7Q 5CHFA 2C5LC 4KSKC 1MG4A 3CIRB 2YYZA 2OEDA 4EE2A 1L2NA 5M5XB 2TMPA 4DR3L 2RPVA 2ICEC 4DR6L 2HJ8A 1QOHA 4DFAA 2OWOA 2CKHB 4EZJA 1G51A 2UXDL 3OOCA 1ICFB 3M85A 3WALA 4QL5A 2WXPA 4B3MQ 1BBUA 4PMBA 2HTME 1HEZE 1CSPA 1E5WA 3A5UA 3P75A 1FD7D 2LJIA 2E2JB 2WACA 4OVVA 2Z0EB 4C56C 1M90C 1OXSC 1Y56A 1QVCA 1ZXTA 4RCOA 1XF5L 1E7VA 5DPWA 3S14B 1JRPA 4CJ0B 1WJNA 3IXSA 3HOXB 1SAPA 3NG0A 1QOFA 2WNMA 4GNXA 5AZHA 4KJOA 1BCPD 4IW0A 1W2BA 1V1QA 1ZXIA 1NNXA 2D5DA 3RLNA 3CWIA 1WY8A 1W6KA 1K73C 4A3LH 2AYOB 4DHJD 3PO3H 5IWAQ 2QIEB 2KCMA 4OHJA 5LL6S 4DXFA 3GTQH 1XNQL 2BT6A 3L16A 3N9YC 1X54A 5EKKA 2MHJA 4F88A 2A69D 1ZUD2 3W1SC 1I3QH 2RDBC 2MQJA 3ENEA 1M94A 2YTYA 2KMAA 5G5GA 1U5KA 5CMDA 3EBEA 3KDFA 4RH6A 4RF1A 4LNKA 2Y5PA 3R7RA 1SIFA 5FR6A 2KLCA 2KMMA 2MPMA 1GUWA 4ZRIA 3PTFC 1TQOA 3AQQA 4LAAA 1K83B 3CCJA 3M4OH 2K28A 3G7LA 4ZRZA 2UU7A 1AN8A 2PPHA 3AM9A 1JT8A 3PGZA 1QZHA 2Y3AA 3C19A 2NVYH 3RR5A 4YHHQ 1KDAA 1V9JA 1STEA 2YEPF 3NHHA 1GG3A 2NBVB 1KRTA 1M8AA 1WFQA 1A3TA 1MI2A 2QEXA 3S1NB 1AARA 2KBNA 3KK7A 2J0JA 4ZAIA 2L0FA 1YIJA 1DOMA 2R6GA 2JEAI 2V4DA 4ACFA 1VQEA 4KY6A 3RNGC 1WCMG 2DYBA 1II3A 4IO9A 5BMGA 3H6NA 3H94A 3Q8DA 5C4JH 3VA5A 2WDQB 4NZLB 2EY2A 1SYFA 4FYDA 4B6WA 1S3SG 4Q5VA 4ASWC 5C3JB 5JJKA 2DZIA 3T1HL 1DOLA 5M3FH 1MJCA 4XYQA 2NVXB 1N61A 2MFIA 5KHQA 2KTRB 4ZKBB 4GDLB 1WMHB 2ZJPA 3MVVA 2F4VL 3AFQA 1O7ZA 2F0UA 4P73A 5LMNW 4HROA 4JOIA 4DDID 2OCEA 2HJ1A 4JI5L 4DF7A 2ALYB 2JA5G 1TWAH 2BW2A 1C77A 4C3IB 1J9OA 1PH6A 3NVYA 1L0YB 4LDTD 1C76A 4FP5D 1KXLA 3Q3OC 2DYOA 4JI6Q 4UP7A 1I4XA 4KJNA 4KHVA 1NEKB 3H0GG 2NN6H 1ML0D 2NS5A 3ZO5B 5GAGC 1EUVB 1FXTB 3G4SA 1JOQA 2AWTA 3IKJA 3UI3A 4CBVA 2JT4B 1KNAA 1WTQA 2BQQA 3UI2A 5JH5C 2YEPB 2EMSA 5LXIB 1E10A 4WQOB 4C2MH 2L0CA 3DBRB 2NZOA 5LL6X 2E3TA 1UUPA 1YJ1A 4YY3Q 4W9IA 2M00A 4HJAA 3KUZA 1Q7YC 1VDVA 1TWFB 2DLBA 4MTKA 2F0WA 3C1EA 3GTLB 4M1UB 4TMAB 3MEFA 5FLXL 1YQ3B 5IGEA 4A3IH 2KFJA 4BY1H 1FRDA 4N9F4 5BN5A 1SE9A 2N9KA 1R4NB 1Q5WB 1SFOH 3NTIA 2K5NA 4G4KA 1JWSD 4HPMB 1JOKA 4JL9A 4W9FA 1HFGA 1KDBA 2IY0B 2WXGA 2YV5A 4JI0L 1N5XA 2GI9A 5IP7H 3RN9C 3CCSA 4ID6A 3E9IA 4KD3A 4HCSA 3TBIB 4HJ7A 3L4PA 2VW9A 1PVOA 4EGVA 3Q8CA 3MHZA 4XC2A 4KN4C 3K5NA 3K0XA 3NVWA 5DPSA 4IPCA 1OXTA 1QT9A 3SR1A 1GUAB 4GN1A 4JX1C 4S0RA 1ZEQX 1L1OA 2QC8A 2DNFA 1XYIA 1FGUA 4RG1A 4IFDH 1T0YA 1XLOA 3DBRI 3OTOL 1B7YB 4K3BA 4JI8Q 4KIKA 3H3VC 4K0KQ 1VMPA 4OZCA 3DBLI 4FBJB 5I6YA 3IRBA 4DKAC 1PH2A 4E74A 1WJ4A 3EFCA 3J7AV 3BJUA 3T53B 4PYZA 3AMZA 1R4NI 5FLXE 3D4RA 4NJ7A 1EY4A 4Y7NB 5IYBH 2VUMH 1QG7A 4FNFA 2UUCQ 4OL7A 3OPOA 2M9VA 1JWMD 2CH4A 1QJOA 1Y1WG 3ND9A 1TBEA 4X3UA 3A33B 1XMOL 4BY7H 3EUB2 4A3GB 1Q82C 3MTNB 2INDC 1A3VA 2QCZA 3CRKC 4G3XB 2F0EA 3U8ZA 4LF5L 4C3HB 4WURA 1YNXA 3FVQA 5C3WA 2Z0DB 4PG3A 3FPPA 1QOBA 2EYHA 1A3UA 5FJ8H 3OW2A 2L7RA 2MBOA 1J19A 1R9TB 3I2ZA 1IBML 5L95C 4E6IA 3KF8B 2PIAA 3M62B 2DN8A 1G291 5DEHA 3D4DA 2KDFB 1P98A 1C4AA 2EYMA 2EY1A 1JICA 2F0IA 4APVA 3Q8BA 2NPTB 3UE1A 3MXNB 3J7A5 1OXUA 3MXNA 2Y5CA 1ACCA 1IBLL 1YNJC 3CMAA 1SNQA 1LT6D 1VQFA 2FINB 2O4XA 1OEYA 1WE7A 4OZBA 4G11A 3VFKA 2CCZA 2O6VA 1EWCA 3IG3A 3QQ8B 4K6LA 4WWOA 2WDTB 5I6WA 4CYEA 4C3JB 4KGSA 5J39A 3AE4B 5IAAC 4DV4L 1JALA 3VXWA 1FD6A 1PH4A 3GTKB 4TSSA 4LF7L 4HJGE 4IUQA 4R4QA 3RMHA 3F2UA 4O1NA 1JJGA 2DGYA 3K7AB 2GBJA 2L32A 3NZUA 3P4PB 1JQYD 1SYDA 1VS0A 3A8KE 4DK0A 1K8RB 4WJNA 1C4PA 1HFNA 1U4AA 2LGSA 2DAFA 3LX0A 2XTIA 1LFDA 1XEEA 2KACA 3AECB 2KUMA 1D5XC 2B2WA 4B3ML 4PNYA 1EIFA 2LD9A 1QOAA 1XQQA 2AQ3B 4K5VA 1V6EA 1CTMA 3NWTA 2FMCA 1WGKA 2F0MA 2OEOA 4MGIE 4YL8A 4HIDA 5EE0A 1OQYA 2EYPA 5AJ3Q 3CF6E 3TL5A 2BKRB 3SK6A 2R93H 2GBMA 2XSCA 2RCNA 4WJWA 2INNE 2PTLA 2V0GA 2LGIA 4L2YA 3M63B 2EY6A 3G48A 2F0OA 4JI1Q 3VR2A 2R92H 1TTNA 2QILA 5IGDA 3NBIA 5KRUA 2JYOA 1A70A 1K50A 3CMMB 3KJOA 3DXJC 3GTQB 1JCKB 1V8CA 3NQIA 2VZKD 3C8YA 3L3OC 1LABA 3IFWB 3KYDD 3LXFA 4KGTA 4MM3A 1OEYJ 5IWAL 1I3QB 2HHHQ 4MACA 3TMPB 5IKCM 4NPSA 2IGGA 2WXHA 2LRWA 5E3FA 3ETRA 1E2ZA 3HEJA 1J8CA 1E8WA 1YN5A 3S1RB 1C48A 5H8YE 1E0ZA 3ONAB 2YVCA 2INPE 4NPNA 2VB2X 3EROA 3DBHB 4DU9A 2Z9HA 3M4OB 1BBWA 1GUGA 4KN7C 4XTCS 2KDBA 1LTTD 4K14A 3AB5A 3DCGA 4FF4A 2KO3A 1PRTC 1WRDB 3AE7B 1BCPC 1B9MA 2AKWB 4AIMA 2BDOA 4LF9Q 3TZUA 2D07B 3TEZA 2ZNVC 4YHHL 1CA6A 3MXPA 5BO4B 3GV6A 4DK3C 3VDYA 4DR4Q 2KHSA 4A3GG 2XEWA 1NSNS 2Y0SB 1K28A 3VYUA 1IHZA 4MSQB 4HCNB 3T3NA 2RSOA 1U0LA 2HQLA 4W9EA 4PQXA 5FR3A 1D4BA 4GN5A 1KJTA 2KAJA 2NTSA 3EJIA 1UWMA 4GDKA 1VZ6A 2JA7G 5G5HA 3CF5A 2CHXA 1ENFA 2K04A 1TS3A 5EPKA 3CCUA 4A3EG 2F03A 2LGXA 4WQMA 4AS1A 4CJ1B 2Q8RE 3I4MB 3GE8C 4KX6B 2ZTCA 3E0JA 1HJPA 1Q90A 4NW2A 5GADC 3HOZH 1QLBB 2DENB 3Q8FA 1C3TA 5DM73 1GB4A 3LWEA 4JI3Q 5DPTA 3A54A 3DBHI 4BOZB 1PFNA 1N5WA 1RHPA 4C1NK 4A75A 1LGRA 3BK2A 1H9SB 1EZ6A 3HK0A 1YBYA 4F7ZA 3IAYA 3R7QA 2I5LX 5IT9c 2JU6X 5EE9A 4BS9A 2LRUA 1PH8A 1TZ1A 2QDLA 2K8HA 1O7IA 4FADA 1GJXA 2NVTB 1BOSA 1V1PA 4C3JG 5BN4A 2KWUB 3TMEA 1HHVA 2Z6BA 3HKSA 2PE9A 3PRPB 3ZGZA 3AE3B 2JK8A 4JK1C 5D6JB 5T8IA 4I6LB 4IWPA 3KQ4A 4JI6L 3QHTA 3IVFA 2XGTA 2D2CC 3S2AA 5C1ZA 3NVZA 4NMZA 3DVGY 1XNRQ 3N52A 1TKYA 3UIOB 2KWDA 2ZXRA 1JB3A 4AP4C 1UE1A 3GTOB 1F2RC 2BCOA 3MFGA 4J8QA 1TZOA 1G8ZD 2KA7A 4A3KB 1I7HA 4XX5A 3ZUNA 1YHAA 4LW1A 1G6PA 1Y8PB 4ZK9B 2O6VD 2G1EA 2UUBQ 4A3DH 5ELEA 4IALA 4CHKA 4BA2I 5GXGB 3W9CB 1VDZA 3R2TA 3FKIH 3CC2A 3S17H 3H09A 1SN8A 4DWFA 4O0AA 3R93A 4KLKA 2FUG1 2I2YA 3RLFA 5ELDA 4YY3L 2E5LQ 3GTGH 4K5XA 3CU7A 3J81j 1F1HA 1GC6A 3L10B 4US8A 2LXKA 1ENAA 4A8XC 2NWGA 3APDA 4A3IB 1GAQB 3B0AA 4BY1B 5CBEE 2F4IA 2JP1A 3RZDB 1I42A 1SLJA 1SFOB 2B63H 3F1ZA 2Z6KA 3PO3G 4UP8A 4MSMB 1EQVA 1LTGD 1Q81C 4I6NB 1XNQQ 3AE1B 1CKMA 1XLQA 2D5GA 3U50C 2K25A 3WIMA 2IBIB 2D3AA 2NN6I 4M0WB 1C8CA 2C35B 1TKGA 1HR0W 4I7ZC 4NAWB 5EGTA 3PUWA 4H2AA 2INCC 2R7ZH 2Y0SE 3PIP3 2LMCB 2NBUA 4HEA1 1NMGA 3PF4A 3ABVB 3DWPA 4HJ8A 1Q86C 2BYFA 2M0AA 3SU8X 3A8JE 1N60A 4JWUC 1G6JA 1WTHA 2QEJC 1LT4D 4IPGA 1YOVB 4P1CC 4DNTB 2N1VA 2PMZB 5GMVA 2GB1A 4JI8L 3P1HA 5T1IA 4M00A 4K0KL 2JSOA 3A55A 3V61A 1LTBD 4LK0M 1PRTF 4ZUJA 1V80A 1A15A 5ISRA 1BCPF 1SXTA 2J7QB 4N58A 3RULA 4JC0A 3EC8A 2Y0SG 2EY5A 4MIUA 4KKIA 4DQOC 3KF6B 2C9WB 3U4ZA 2UXCQ 1V5OA 1MJDA 2JQRB 1PMRA 1IKLA 2EJGC 2WYQA 4C80A 3MHBA 1VQMA 1N63A 3HOYB 2MRPA 1HNWQ 2F0QA 1FNUA 2B3AA 5IOCA 2UUCL 4BY7B 3VTWA 2VXWA 3UE0A 2CFMA 4ICUA 2F3VA 3HOWB 3R66C 1WI5A 3PRZA 1UAPA 3I4MG 3F2CA 4LNNA 5M3FG 4MGZE 1DCZA 3W5VB 1H9JA 4XWTA 3ULLA 1X56A 4PV1C 2ZJRA 4MJSA 1WM2A 5LLIA 1MVKA 3KLSX 5LHY1 3MXUA 2EXZA 2O2LD 4KHZA 2K22A 2JUOA 4ZQ3A 3X3NA 4TV3A 4B95A 3PUXA 4BWGB 1XWEA 3O65B 4ARIA 2ASBA 1EQRA 4BBNC 4MTNA 4U68A 2HE7A 3J81E 4IUMB 3TEWA 2FXQA 3C1FA 3MAQA 2VY3A 1NJIC 2P5ZX 2NN6G 3RMKC 1Q46A 5JPNC 3PIOA 1P9DU 3I73A 2BB5A 3L54A 1EOTA 1D2BA 5CC4A 3NZ3A 1B4OA 1XMQQ 2EYOA 1BF4A 1VQLA 3NSWA 3RI7C 3EQLC 4BZAA 1E22A 3APFA 3UDIA 1ZDVA 2G4DB 2KMCA 5KYIA 1YJJA 2K1FA 3LWUA 1BCPB 1P8LA 2OHFA 1D5MC 1Q1OA 4H02A 2KTFA 3ERSX 4XQJA 2RGFA 3NJTA 3JAML 2IX3A 2PNHA 1VQBA 1RTOA 1QZGA 1I50H 2LI5A 1TWHH 4DHJB 1BUIC 3S2DH 3A7AB 2J52A 1SJHD 2E6XA 4A3IG 1RM6C 4BY1G 2HTHA 1FJGQ 1STHA 2KDIA 4EQPA 3DUZA 1KNEA 5I9PA 2RHQB 5IP9H 3N1YC 2ZT9C 3BYTB 3EFUA 5HHDG 5EJWA 4DV1Q 2RBMA 1D8LA 3RNCC 2E2DC 1VQAA 5AJ3L 4CQNA 1B44D 1Z9FA 2HUGA 5FLMG 3S1MH 4LNOA 5DNFA 1ICWA 1SNPA 4RHRA 2PMZE 4A76A 5IP7G 2R92B 2XNAC 4P6VF 4WJPA 4L23A 1HNXQ 3ZDTA 3OMGA 1JRUA 1Y1VH 2DJFC 1Z5SB 4FVMA 2HD5B 3S2HH 1D1IA 1ASZA 2B2VC 5JHAA 1PTOD 1KRSA 2XVSA 2EYFA 3MZ5A 4DV2Q 2SNMA 3H15A 4RGMA 5G2NA 2MCNB 1T0RC 3TJPA 1GM5A 2HHHL 4NDXA 4IFDG 3ALBA 4GIVA 1YHBA 4FXDA 4ZOHC 1JOOA 1L7YA 1PZJD 4JLCA 4JPSA 4NQKE 1S4ZA 1C0AA 3NBHB 2L1BA 2M56B 2G3QB 2M8SA 3I4LA 2WXIA 3DVNU 4HXDA 4IDIA 3VVWB 2O2VA 2B76B 1ZOYB 4KDIC 2K3UA 4GS3A 3U52E 4PMCA 3CD6A 3DM3A 2KANA 1F9QA 2NTTA 3O13A 2PQAB 2KC2A 5BYQA 4BXXH 2O5JC 3UQBA 5IYBG 1EF5A 1P7FA 4H7BA 1CKNB 5FLXc 3GTMH 4IWOA 1CKNA 1VJKA 3PSEB 1R4MI 3A9JA 4LF9L 4X65L 2UU9Q 3RD2A 4BY7G 1G2SA 2D11A 4RCNA 4GLXA 1KM7A 5CV8A 3SHLA 4J3OD 3EFXD 3HG9A 5A2QE 3STBC 5IIFA 1YJIA 4DN4M 4DR4L 3ML8A 1N32Q 2BA1A 2YTXA 4I65A 4P72A 3RLOA 3CC4A 5FJ8G 4FJZA 4M01A 1K3BC 2K33A 3JSVA 2NVQH 4HWIB 1E90A 1I6HH 1RFAA 1IBMQ 2RHSB 2PZUA 4LDTB 2G45B 3MA2B 1X1MA 4ULLA 1O7LA 2KYWA 4P1BC 3HOZB 2Z0SA 3CAMA 2N9PC 3X3MA 1V97A 2JWZA 3K9OB 4F8MA 4AUQC 2CJNA 5CORA 1LTAD 2K1BA 1XX8A 4JG2A 5K5PA 2L55A 3HRZC 5CV6A 4IJHA 1LYLA 5IGFA 3APCA 5C2TB 4JI3L 4EFOA 3J80E 1N34Q 4IOAA 1E1TA 1PFSA 3RNFC 4BBNF 3J81i 4IURA 2EYLA 1OXXK 2MGSA 2RR9A 1TVXA 3PCOB 2AQ1B 4I6PA 3SE0A 2IW3A 1R4QB 4ZUIA 1YQBA 4E3CA 1HZ9A 4DV4Q 2WXJA 2RQXA 3Q22A 2K5VA 2WU2B 1ONLA 3SEBA 2FCNA 1MIUA 1CHQD 1UZXB 4F1SA 4KMUC 4XQNA 2L12A 2VL6A 4UY8C 3U58A 3CP0A 4X64Q 4FF3A 2JA6H 3F8TA 5J18A 3H0GB 3KWVA 1X3GA 4ARCA 1I4QA 1XNRL 1KTKA 1JB7A 2M19A 2A5UA 1F9SA 1E8YA 2JY6A 1VQPA 1HXYD 3VR4A 4UPAA 3RZFA 4HSVA 2UUBL 3S17B 3K5LA 2LFIA 1CT1D 2R93G 1I4HA 2WXFA 4DNRB 1I35A 3HOUH 1Z2MA 3KOJA 1RYJA 2DY7A 3N3KB 4GNXB 1EO6A 1WX8A 2B2YC 2E5LL 2R92G 5KIXA 2MJ8A 3TCAA 5LNK1 1HNZQ 2BBCA 3QX1A 2Z8LA 1EY8A 2IY1B 2QJLA 5LXHA 1M4VA 1XPUA 1OFFA 1U4RA 1FGBD 1WH3A 3W2DA 1HQMC 2JZ3B 3NTKA 2M17A 3EHVA 3KYCD 4DAVA 1BBXC 1BNZA 4II2B 2RMMA 5C0XI 2VH2A 2LJ5A 2G9HD 1WYWB 4GMVA 2R7ZB 1L2FA 3KDFB 2MX2A 5FO8B 4TKOB 1GUNA 5IGBA 3HM3A 3Q3JA 1EFID 3CCRA 1JJ2A 3FILA 4KK7A 4BA1I 2M1MA 2C5CA 1CI3M 2H4OA 4ZRQA 3X23A 5C0XJ 4WWPA 2G9DA 2SNSA 2XRSD 4DV5Q 5JPMC 2FAZA 2FFKB 2JA9A 4O42A 2L4NA 4WWNA 1TS5A 3AFPA 2EDGA 3NEMA 4QMGA 1P1AA 3BVZA 1AEXA 2K6DB 4IC7B 1NMFA 2YTVA 3OWFA 4JI2Q 4OO1H 1A8VA 2KDMA 4A3FH 1W6JA 2EVBA 4HJ9A 4AQYQ 2RF4A 2B2WC 3Q3NC 2V4LA 5JHBA 4ABNA 1WWTA 1L0VB 1C78A 4P75A 2Z59B 3CCLA 3HP3A 2WXOA 4MH0E 2UXCL 4K2LA 3AE5B 3V05A 1IBXA 3AEGB 1BT0A 2I0QA 3DWQA 5T1GA 1HNWL 1Y1WB 3ZIMA 2HCCA 3NRZA 3U9SA 3HOZG 2JWUA 4NNJB 3K5MA 2KCCA 2GMIC 3M3YH 5DM63 4QF4A 1AH9A 2HT1A 1OXVA 2N7JA 4MDKE 3TS0A 4JV5Q 2NBWB 1NENB 3ZLZA 3HZXA 2QMTA 2VZAA 3L13A 2ZZPB 2DWQA 3BZCA 3GO5A 2Z1CA 3KLRA 3TIXA 5CX3A 1VQ8A 3RT3B 3J80i 2JPHA 4EEWA 3GTJB 1FCCC 3ZRCA 4LFAQ 3JYUA 1IBKQ 1EIHA 2E76C 4LNQA 2LVPA 4XZ4A 3AYHB 1LO5D 4JW0A 4JBKA 3ICEA 2B8GA 1FCLA 2B8FA 2LSSA 4LK1C 4UDUC 4M8MA 5KYLA 1NDDA 3UINB 1YD8U 3OIQA 2PCFB 1JMCA 2F3WA 1WXMA 3KFUA 1UE5A 1WYDA 1ZYRC 3W1BA 2KJ6A 2RVLA 3S1QH 5D3IB 1XMQL 1GHKA 4FJYA 1CQFA 3BVGA 4OZAA 3ZNID 5E6JA 2O5IC 1W3SA 4CDDC 2L15A 1GD7A 4HPPA 4A6QA 1JMLA 1RRBA 1TWHB 1E3PA 1JROA 5KNDA 3BDCA 3S2DB 4G7OC 2VZKB 3DBLB 5KGUA 3M3JA 4HKQA 1PTOH 4YWGG 2M4NA 2R2OA 5DPRA 3ZVVA 3ULPA 1K8MA 2EIFA 4S3SA 1K0SA 1FO4A 2B63G 4DUZQ 2WIIB 1FJGL 4PZ8A 1DONA 4LNFA 1F9JA 1QCBD 2CQAA 3TREA 4KHPQ 3VYRA 4KI0A 1K8AC 2CJOA 2VH1A 2BB6A 2PI2A 3S1MB 2ZTEA 4DV1L 4MN3A 4A3BH 1PYWD 1MD2D 1V1OA 4N9TA 1ZKHA 1E8XA 2GRIA 4MT5A 2MJEA 2JN4A 1WRIA 1YQ4B 4YTMB 2MP2A 4CKBA 1KAAA 1PH9A 1Y1VB 2CHZA 2R7ZG 2PMVA 1E1OA 1HNXL 3S15H 3WCQA 2JE6I 4JWSC 2CU1A 3I5JC 1H9MA 1STGA 1T9HA 3D3RA 2WXLA 4HPLB 3MEHA 1QF6A 4GKKQ 5C6AA 4BBSH 1WJUA 2R61A 1SYCA 1ZXHA 4YSZB 3VR9B 2RCFA 4DV2L 1ESFA 3T1YQ 4WWMA 2YLMA 3ZJTA 1L1OB 1J7AA 4J6IA 1XLNA 2VS1A 1FMAD 2F0TA 2E2IB 3FKYA 3FPUB 4ZRPA 4IM2A 4W9LA 1UE6A 2L5TA 4KIKB 3GZNB 1YN4A 1PGXA 4IJLA 2WDVB 3QK0A 3K81C 2QCPX 2JYTA 1TKEA 3L0OA 2QDFA 2PEAA 2N78A 5IGCA 2BKFA 4WJOA 1VMCA 2F0FA 2DAJA 1KFYB 3E3XA 1TJEA 2FMMA 2WKDA 3S16H 1HCZA 1V49A 2XK5A 2GN5A 2VQFQ 4EUTA 3CCVA 4PS3A 2F1MA 2N1WA 2CWAA 5CTRC 1T3QA 1CFMA 5KNBA 5K36H 1WR1A 2N4FA 3RUIB 2EXDA 4POFA 2UU9L 4JBMA 5EKIA 1SE3A 3RPFC 4URKA 4P16A 4DAMA 5L83A 3EN2A 1QB5D 4HMJA 1FFUA 4JIOU 1N32L 3DMUA 2QKIC 3MXGA 1K3RA 1F77A 1XTDA 1JWUD 3HOVH 2NVQB 2Z6KC 2DZJA 4USAA 5J17A 1OO9B 1MBYA 3WWVA 4RGOS 3QWZB 3PSIA 1YNTE 1KOTA 2JA7B 2B2TA 2PW5A 1SMYD 2OQKA 2FCQA 4A3CH 2J42A 4DPGA 2V3PA 4TQ1A 4A3EB 2HQEA 2CU3A 2I46A 4AJYB 4KKTA 4JQWC 4AQ7A 1JC7A 3GZNI 4K3CA 4REZA 2LS01 3PO0A 1XPOA 2N9EB 3VR3A 1SF0A 4MGKE 1VQ9A 2A6ED 4KY7A 3J81c 2RPQA 1UE7A 2L8JA 3M95A 1C7YA 2CW0C 1N34L 3CQZH 2O6VB 3DHGC 2XWBB 3PLVA 4C7YA 1NTGA 2N8NA 1F9PA 3ZNHB 2A68D 1X65A 1WZ3A 1V9PA 2HDEA 4EQOA 3ZJYC 3VUWA 3ZKJC 1LV9A 3DVNV 3I4NH 3CW2C 2QA4A 5ELFA 4X64L 5MPOA 3W1SA 1YNNC 2DZKA 5M5YH 1UF0A 2IGHA 1LXDA 5E6OA 4DV7Q 2WKCA 4CDFC 1STBA 2VQEQ 2OJRA 3ZDMC 3CRLC 2N55A 4B3TQ 1MG8A 1A2TA 2PQEA 2EELA 2K8CA 3KYHC 3TP8A 3VYTA 5IP9G 5D94A 1S3OA 2NR2A 1A2UA 3RZOH 4O2DA 3HOUB 3GD7A 3NHEB 5C4HA 1QUQA 2L0TA 4DR1Q 2K6AA 3P7JA 5IO9A 2EZVA 1T5EA 2K52A 3AB9A 1ROEA 4P2CB 2IO1B 3H9DA 4MHEA 3KJPA 1D7QA 2GLSA 5I9OA 1Y1VG 2IZVB 2ICIA 5HI1A 3T13A 1HNZL 3BY4B 4C4VA 2KFKA 3UF8A 3GQBA 5C4XH 5GAEC 2Q2TA 2FNJB 3PO3B 4LUZA 3I70A 4BKGA 3I91A 4MM3B 3K7UC 1WTPA 3IAM1 1RDPD 1KAWA 4KD4A 2KOLA 1LQBA 4A93H 4DDGD 2CH4W 1WGDA 4EZLA 2JA8H 4OWXB 1EU4A 3T4AC 1UWXA 5BN3A 2V9HA 3NS1A 2YU9H 2N88A 2LUMA 1PH3A 1ET6A 2BPSA 4IG7B 1S5DD 2F0GA 3K58A 1F2LA 5EDSA 4RKBA 4J6HA 4DV0Q 1L4ZB 1LUZA 2K75A 1MJEA 3AEVA 1BMLC 1TT5B 4WIPA 4E71A 5TSSA 3ZW3A 1CUKA 4X6AH 5JVG3 4BXXG 1JE4A 1KLVA 3AU7A 2F52A 1I4PA 4FXGC 4DV5L 4GKJQ 2AQ2B 1EU3A 2NVYB 3VH4B 4HIKA 3B1LX 1LTRD 4P71A 4X65Q 2JF5A 3DEOA 2L76A 2QGQA 4JI2L 1NCVA 2SDFA 4ANUA 3Q69A 3DLLA 1EY6A 2QF7A 4K6DA 4MGYE 4DGZA 1IYVA 5M5WH 4AQYL 1XT9B 1OTRB 4HKZE 1SSOA 2A69C 2KQ3A 1X3FA 3AE2B 5I2YA 4R4OA 1QQRA 2WS3B 5J1ZA 3DWGC 3VTUA 4GDKB 4HAEA 4B0MA 5C4JB 3NWSA 3NTHA 1EIYB 1KF6B 4JYAQ 1P0RA 2FCMA 1MGSA 3NUHB 3SDZA 3M3YB 1EQTA 3NP8A 5M3FB 5BMHA 2WXRA 3WA0A 3CPFA 1BQQT 3PZ8A 3QCAA 4UP9A 4K7SA 1VD2A 2J7ZA 2H88B 4JV5L 1KRHA 2CR5A 3GTPH 1WX7A 4L5TA 2B2UA 3J80c 1NYQA 1TWAB 4B3SQ 1P7EA 1SRUA 2BWFA 1TT2A 2AMCB 1BDOA 1V1PB 4OO1I 2JZZA 2ZW1A 1GOZA 4JBWA 1SROA 3M7NA 1KD1C 4RM9A 4EVOA 4LFAL 1G6ZA 1N62A 3QAQA 4IOIE 3Q24A 1IBKL 2JA6G 2AL3A 3NXWA 3FMCA 1ESRA 4LF4Q 4GLAC 2K5DA 1FXIA 4XIGS 3BWUD 5C0XH 5AUKA 3RCZA 3OAWA 1B9NA 3QOLA 2KD0A 3S1QB 4RHSA 1R7SA 4EOYA 2NB0A 1HPCA 1KL9A 5D65A 2DX5B 3I57A 1MKHA 5AZGA 1CZGA 3BVMA 2J0MA 2KDEB 4C2MB 1L0XB 2LHDA 1ZGUB 3PRMB 3W3AA 3PO2H 2WP8J 3RNAC 3S9WA 3HOUG 4S17A 1F2YA 2J0TD 3H7PA 4NJCA 1B9RA 4HN7A 4K5WA 1BKBA 1PTOB 1FEHA 3NELA 3ZXVA 4GU2A 5DLQE 5AFWA 4HEDA 3TSSA 1ET9A 5M5XH 1GHJA 1EFWA 1IUEA 1SIJA 2L00B 2F0SA 2E75C 1IPGA 4B3RQ 2MBQA 3KVFB 1MPEA 4IN3A 2A4ZA 3X0WA 1PYSB 2DY8A 2DZMA 4ZRJA 4DUZL 2PZTA 4A3LG 2RKSA 1WSPA 3A5ZB 4ICVA 3HGBA 5EPJA 4WRDA 3HVZA 3C0RB 4KHPL 2NZHA 2D3BA 4HSPA 3P4SB 4FJVB 4A9AA 3TBLD 2BTEA 4KKUA 3Q0AA 2CS4A 2V3SA 3SK8A 3SR6A 4QCLA 3VR5A 1SNDA 1B8AA 2FIDA 4II3B 3VH3B 2BS3B 4FHJA 2JEBI 2W55A 2OOBB 1XJVA 3ML9A 4XE0A 1C4QA 1SR3A 1NUCA 2ZXOA 1ASYA 1SE4A 2E74C 3M4QA 4BBSB 3CCQA 2WU5B 1H95A 3HOXH 2N7DA 4GKKL 4MZ9A 1VZ8A 3U7DA 1TWGH 3QIAA 1EY7A 3T1YL 4A3MH 1VQJA 1L6VA 4KZCA 5CV9A 2K32A 1Q10A 1I5FA 3DDCB 1YJNA 4N6EB 3D8GA 2WHIA 4OO1G 2FIFA 3FP9A 1WVLA 4A3FG 1E0BA 4LMQD 1C9FA 3C2PA 4F8CB 2DJGC 3N1ZC 5IY0A 3HS0C 3SK5A 2ZJQA 3S16B 1FM0D 3JVZX 2K7VA 1P3QU 1DOKA 1BXTA 3QO2A 1EUJA 2VUMB 5LMNQ 3MP9A 3NK9A 3IFDA 3A9KA 1NY4A 2K03A 1XCTL 2VQFL 2AL6A 1WOCA 4BOSC 1ZPSA 2HD3A 4NXMQ 3Q8AA 2WFWA 4EZKA 1K83H 2WB1B 1V86A 4TKNA 3ZTDA 2MUYA 1AFPA 1PUTA 4HDQA 3KBXA 4GNXC 5ELCA 5E4WC 1FIQA 4W9GA 4FA6A 2GBKA 1IZ6A 4ZRKA 3ZNZB 2BE5D 3DHQA 3HOVB 2C7NB 3EGRA 1BO0A 2MBHA 4DA2A 4MJSB 1ZKOA 1NI3A 2BGFA 1WYGA 1SMXA 4XYCA 5CHWA 4JI7Q 1PGAA 3HUIA 1K0RA 1Y8RC 3AEFB 2NBFA 3DPDA 1CZPA 1CJEA 2EPBA 3SVMA 1L6UA 4HRSA 4NXNQ 2UXBQ 2D3GA 3SHQA 1HH2P 4CDCC 3QWNA 1TXYA 2IGDA 2E2HH 4G0NB 5JXVA 1V8QA 5E7NA 1YIWA 1FYCA 3TP5A 4OWWB 3OSOA 1CMXB 3DHHC 4P7IA 1EWHA 3BG3A 4WFN3 4DR2Q 1ILQA 3ITPA 3TRZA 1T0QC 4IPHA 3TZDA 3F2DA 1WGGA 2LFNA 3U2SC 1SYBA 3A56A 3R2IA 1AW7A 2ZVNA 3CCEA 4XT3B 1RL2A 4V0BA 4A4IA 3F2BA 4X3SA 1N33Q 3K80C 3I72A 3PHXB 4KDLB 2D10A 1VF7A 4HCEA 1EYAA 1TR5A 1SMYC 4C3IH 1GO3E 4DR7Q 4H44C 1DD2A 3A74A 1RF2D 1GKHA 3DM1A 4U673 3HIZA 2HIXA 4NY0A 4AJWA 2EKIA 4DV7L 3AMUA 3QC8B 2VQEL 3PS6A 4PK1A 4B3TL 3I7FA 1EQQA 2A6EC 2F0VA 2Q2IA 3RZWC 1NE3A 3BDOA 3PUYA 4A3BG 1Y14B 2R93B 4NKLA 1KLUD 1QOGA 2EOTA 2A6HD 4WAAA 5JJLA 3R3OA 2L1AA 1R4MB 2PO4A 2RA4A 4DR1L 1YHQA 1WIAA 4WH4A 3NQTA 5C4ZA 3GV3A 3FHWA 3E5SA 5D2MB 2A68C 2DNCA 1EM7A 4JOIC 3KW5B 1JORA 3PV1A 3AH7A 4C00A 3K57A 4OX9Q 3L08A 4BBSG 3NE5B 2W82A 3URYA 1ZW7A 4MNOA 3HKZB 4FF1A 1GUTA 2PVOD 4A93B 1TWFH 4R4IA 4AYBG 2KECA 2PNRC 2JRIB 1BVSA 1NAPA 3GTLH 3J7YW 2JA8B 3GE3C 3W1YA 3K59A 2DUDA 5IYCH 3DWAA 4GZYC 3EECA 3QG1A 1WTVA 4KZ0A 5CHVC 1JW9D 2GA4B 2WB1E 1TS2A 1SE2A 3C46A 2L11A 4POGA 2KVZA 4DR5L 4DAYA 1L0WA 2O2VB 3JAME 2L52A 3VR8B 1Z47A 1WJ6A 1NI2A 1HZBA 2KWCA 4HCPB 1DGJA 4DV0L 3FC4A 1RWSA 1QKZA 2D0OA 4J15A 4L8JA 1O78A 4FXKC 1PXUA 3AE8B 2EE1A 3E9HA 1JWAD 2J53A 2VUMG 2MJDA 4JE3B 2ZVOA 1WXAA 4GKJL 4B08A 5K36G 4IKGA 2R2QA 3A9JB 1A5RA 4ZHPA 2K5QA 2F0JA 5GROA 4LF6Q 1HZAA 1G2TA 2JYEA 1PYBA 2WB1G 2V3NA 2BDNA 4A55A 5M5WB 2EYJA 2GVAA 4CKCA 1QZEA 1T6BX 1Q3LA 4AWJA 4R4CA 1DOIA 1Y69U 3I90A 1MHWC 3HOVG 5IODA 1H9RA 4B0EA 3KLWA 4ME3A 1TWCH 2ZCBA 1LACA 2B29A 1FVIA 1VCBA 3QJYA 3JSVB 1Q1EA 4A3CG 1CM9A 1RAXA 2EMTA 4DXAB 2L05A 3IHPC 4JYAL 4RKLA 4L5QA 2EJFC 4NB3A 4DV3Q 1MSHA 4Y7NH 2HDMA 3K9PB 4RMFA
chains in the Genus database with same CATH topology
1EYDA 2XIWA 3TDQA 2IJ0A 3TP7A 5HGTA 1AYFA 5FK9C 3EA6A 4IZ8A 2RSNA 4KGRA 2IL8A 2TSSA 3PV0A 2KEEA 4IQZA 2WDRB 1TU2B 2HCIA 1UEAB 3SFDB 4XDCA 1KLGD 4WAFA 2X6LA 1S5CD 2K01A 4Z9CB 1MSGA 2FE8A 1HZ5A 4A3DB 1D6EC 3PO2B 2WXQA 2N9LA 3FKIB 3WOEA 1R4PB 1CQVA 1H9KA 3L9AX 1X32A 1CA5A 3GTGB 2MEKA 2A5HA 1O7YA 3P4RB 2CVRA 3QB3A 4CJ2C 1V43A 1AZPA 2BS2B 2B2TC 4A55A 5EBDA 2B63B 5C5LA 5F2DA 4RNAA 4TQ0A 1HA6A 2ON8A 3R8BA 1TY0A 2I07B 2AUJD 2WAQB 4RWSC 3MTSA 2DBYA 4YT0B 5C5MA 3J7AF 1OQRA 1GPXA 1PRTD 2LKVA 5FO9B 3FILB 5G3LD 1TWGB 3BS1A 4A3MB 4FO2A 1GUOA 1ENCA 1S5BD 4QUCA 2WXKA 2F0KA 4R8IA 4RGTA 1IW7D 2DNEA 1LT3D 2IDYA 3ZJUA 3VR6A 1E9MA 5JEAH 1PDXA 2Q5WD 1I4RA 2XN9C 1U4LA 3MWYW 1WTXA 4CKEA 5FOBB 4R9WA 5FKAC 5HG2A 1RD9D 4XDXA 1I4GA 1UNSA 4IUUA 3K5OA 2IX1A 1IBXB 1DXMA 5JAVA 5D7GA 4B9WA 1AWDA 2PW9A 1K51A 2B39A 1KABA 3TEYA 1EY0A 4V190 3D6WA 4Q2JA 1QNKA 1QNUA 3PUVA 4L1BA 1DOYA 1EL0A 1WXQA 1IGCA 3IAS1 5CR3A 4C1NI 4QUFA 5CV5A 1TY2A 3MJ5A 1D5ZC 3HVDA 3QOJA 1AP0A 2E2HB 3SFEB 1PFDA 1PFMA 5EE3A 4L6TB 3B2GA 3P4QB 3PZ7A 1IL8A 3D31A 4X3KA 2F0PA 5I4DA 4ZLTF 5C0XG 1K8OA 1IKMA 3VQIA 1DJRD 1MHHE 1EWYC 3SXHA 2BA0A 4H0LC 2BE5C 1OQQA 4F7XA 1EY5A 1F2MA 1EY9A 2W54A 1E2VA 2B2VA 2WV6D 1A6XA 3RPFC 4RAUC 2D62A 2XRQD 1ZE3D 1I50B 2BS4B 3RD4A 4FF2A 2DYMA 2HDLA 4IUPA 4MH8A 3H8HA 1E6EB 5COYA 3BYYB 2F0NA 3M7GA 5DAUA 1SYGA 5I2XA 2B2UC 3H91A 4Q0FA 3S2HB 2NZ1D 2F0DA 2VB3X 1WTRA 2X69A 4R8NA 3OMCA 4K8IA 2MJ3A 5IGGA 4WORA 2LHEA 4J1MA 5HFYA 1TIID 3OIPA 3KLSA 2KVMA 3I3CA 1QILA 2OXPA 1WD0A 1J7BA 1Q12A 1K53A 2SEBD 2CHBD 4RGNA 1KH0A 2K0PA 2A6HC 2MHVA 1HA5A 4RFBA 1F0ZA 1B53A 3PIO3 4CHTB 3GTMB 4OIJA 4PMWA 3BZDB 1E7PB 3Q6SA 3GB1A 1ZDXA 3B2FA 1PTOC 4KKJA 3K0YA 3AEDB 1TWCB 4G57A 3I9V1 1WD1A 3P42A 2IT1A 3T56B 3MC0B 1I6HB 2PW7A 2F0LA 5D14A 5D3DA 2IX0A 2RDHA 1Y8NB 3WOFA 1PLFA 4XYOA 4ILWA 2QDBA 2I38A 5FO7B 5BYSA 3TP6A 5HURA 1GB1A 4HMIA 1ZP0B 3TUOA 1I6VC 2IWHA 4OW0A 1EEID 1XLPA 2B2YA 5EBCA 2MP1A 1FXAA 1HQRD 3KF8A 4YXDB 1UGJA 2JA6B 4C3IG 2W3RA 5C44B 1MHXA 1JR0D 5CBAE 3A7LA 1U4MA 4OGQC 2FBWB 1SBBB 1RCVD 5C3EB 3IT4B 1AZQA 4X3TA 3KBGA 3CHBD 3E6ZX 3VRBB 1FRRA 4ITKA 2QSDA 5CV7A 1L4DB 3BIID 4ZYSA 3L7ZC 2PZWA 5BYRA 2AWOA 4A3JB 2WXNA 3T16A 1STAA 2W3SA 1D1KA 1HTPA 4LLGM 1SSNA 1CHPD 2F0HA 5EPLA 1C79A 5CV4A 1TS4A 3PUZA 2J4XA 3EVQA 3FRPB 2NYZD 2PVGC 2NMQA 1SNOA 2ONQA 3U4EG 1X3QA 1LLRD 4D2KA 1JWBD 4C7ZA 1T5XD 4QB4A 4PT5A 5EKLA 2RDGA 4L63B 3W5UB 3V3XA 4N9PA 4N59A 5C3XA 2BOSA 4A3FB 3OW7A 1YMHE 2FJ2A 4HTHA 3PMFA 1U4PA 1TKWB 3N6RA 3BDLA 1PTOF 3V2TA 2ZW0A 2KCNA 3FDTA 4ME5A 2SOBA 3U7ZA 3FEWX 3E56A 5AUIA 1J8IA 4OIKA 1IW7C 1NR2A 1JQ4A 1L5PA 4XWWA 1VF5C 2VNUD 1IGDA 3P1MA 4C3HG 3LB8C 2XWJB 3AV8A 5JJZA 3ND8A 1HUNA 2V4IB 1RFKA 3G6JB 1XTCD 4IUVA 4A90A 1O80A 2PPBC 4KY5A 1VCIA 4RA8A 1BR9A 5JEAJ 4YIJA 3IFTA 1H9SA 3AEEB 1U9RA 1Q1BA 3P20A 4XXEA 1Z7TA 2L83A 4YTNB 4K8JA 3VRAB 2K05A 1PGBA 2N0SB 2WQYB 1GUSA 2NUCA 4FXCA 5NUCA 2PLPA 4BBRB 1B3AA 4ZKCB 1DZ1A 1EZ8A 3CKIB 1RODA 5A35A 2KJXA 5H92C 4A3BB 1K52A 5BMIA 3BK1A 2JXMB 4NAMA 3AE6B 1B2TA 3S15B 3AE9B 1CZWA 3I8ZA 3IL8A 2AUKA 1F9RA 1QE6A 1VRAB 2MH7A 1FNVA 3MFYA 4TQUS 4AYBB 3RFZB 1X3PA 3VYSA 5KNCA 1IYUA 1S5ED 4TRDA 2LEKA 5JEAG 4KTAA 2AX5A 3HRDD 3SK4A 3OWEB 1HTLD 4M0WA 1PDQA 3AN1A 3ZYYX 2WLBA 2LMCA 2L9HA 2WXMA 3VA7A 4CGYB 4DXGA 1YN3A 2Z4IA 1FR3A 3GP7A 2KEDA 3J81L 2C9OA 1EEFD 1HRJA 5M3MB 1NR4A 2WP9B 3KUPA 3V96A 5G3LF 4XT1B 5JOBA 2K5WA 4YTPB 5ELBA 1SYEA 2PKOA 4RF0A 3NVVA 2WINB 1NYRA 3TEXA 1QWYA 1J7CA 2OT2A 1RJTA 4OVZA 1SNCA 1NVID 2H89B 1SB3C 2PYKA 3Q23A 1ZYRD 3K6OA 3CQZB 3IT6B 3RUZA 1ILPA 4EQNA 2X6GA 4K2KA 3TN2A 2JZPA 3J9CA 4IFDI 2ZXPA 4QIWB 1XO3A 5CYUA 3I4NB 1SNMA 2ID0A 3T3OA 4YSXB 2K5PA 5CGKA 1EIGA 1VLBA 2A74C 1FFVA 1LT5D 3P63A 4LJZC 3T51B 2A73B 5M5YB 4IUNA 1KDCA 4IFDJ 2X38A 3FAHA 1XXGA 4DK1A 4NP5A 3RZOB 3LYYA 1Y8OB 2IPKD 1STYA 1DYQA 1F2ZA 2ENBA 1PRTB 3DWMA 2JSVX 2KQ4X 5C4XB 4ZHOA 3KWLA 1PFBA 3C3LA 1MI0A 3OHXC 4YSYB 2EJMA 2ACZB 3M4YA 3NUCA 3D4WA 1B1ZA 2JXTA 5EE1A 2YU9B 2JX5A 2R3ZA 5A2QL 3AEAB 2AWNA 3ZQ4A 1S5FD 5J22A 4R3DA 1FNWA 2BYTA 1VR9A 1SDFA 2OF1A 1BUVT 4IUTA 2K9XA 3E9SA 1VZ7A 3Q8EA 4M8AA 1Q8IA 1PZKD 3A8IE 5M9OA 3B9JA 1G91A 1LTID 4LTUA 1LTSD 2D9UA 3ERQA 4G7HC 3J80L 3NBHA 1B50A 5IT9L 4ODGA 1HUMA 3WDNA 3LNNA 1E2WA 1STNA 1EYCA 2LY7A 5E4XA 2Q8IB 2KN4A 4B9XA 3H6MA 5JVH3 4KV6A 5KEEA 1XCQL 4KKSA 4H13C 5EQ0A 2FHTA 1YNJD 1Z6HA 1RKNA 3U9OA 2CW0D 4XQQA 4F87A 4HR7B 3GTPB 1WTOA 3NPPA 5E1FA 1C4CA 2M2LA 1HZ6A 1SEBD 1WCMB 1TYGB 2RDFA 1SJED 2Q8TA 1WTWA 1CK1A 3DEPA 1YNND 2SAKA 2H1EA 4XDDA 3GS2A 4UAIA 3ZJVA 4GLSC 1DM0B 4DAPA 4G7ZC 5IT9E 4US9A 2Z4HA 1PZID 1DOXA 1RTNA 2JA5B 3AEBB 1F2RI 1GXDC 3D6CA 3CIRB 2YYZA 2OEDA 4EE2A 5M5XB 2TMPA 2RPVA 2ICEC 1QOHA 4DFAA 3OOCA 3M85A 2WXPA 4PMBA 2HTME 1HEZE 3P75A 1FD7D 2LJIA 2E2JB 2WACA 4C56C 1OXSC 1Y56A 1ZXTA 4RCOA 1XF5L 3S14B 1JRPA 4CJ0B 3IXSA 3HOXB 1SAPA 1QOFA 2WNMA 4KJOA 1BCPD 1ZXIA 2D5DA 3CWIA 1W6KA 2QIEB 4OHJA 5LL6S 4DXFA 2BT6A 3N9YC 5EKKA 4F88A 2A69D 1ZUD2 5G5GA 5CMDA 4RH6A 4RF1A 2Y5PA 2KMMA 2MPMA 1GUWA 1TQOA 4LAAA 1K83B 2K28A 3G7LA 4ZRZA 1AN8A 3AM9A 2Y3AA 1KDAA 1STEA 2YEPF 3NHHA 1M8AA 1A3TA 1MI2A 3S1NB 3KK7A 4ZAIA 1DOMA 2R6GA 2JEAI 2V4DA 4KY6A 5BMGA 1II3A 3H94A 3VA5A 4NZLB 2EY2A 1SYFA 4FYDA 4Q5VA 5C3JB 1DOLA 4XYQA 2NVXB 1N61A 4ZKBB 4GDLB 3MVVA 4HROA 1O7ZA 2F0UA 4DF7A 2BW2A 1C77A 4C3IB 1J9OA 3NVYA 1L0YB 1C76A 4FP5D 2DYOA 1I4XA 4KJNA 4KHVA 1NEKB 2NN6H 1ML0D 1JOQA 3IKJA 3UI3A 4CBVA 1KNAA 1WTQA 3UI2A 2YEPB 1E10A 2L0CA 5LL6X 2E3TA 1UUPA 2M00A 1VDVA 1TWFB 2DLBA 2F0WA 3C1EA 3GTLB 4M1UB 4TMAB 5FLXL 1YQ3B 5IGEA 1FRDA 5BN5A 2N9KA 3NTIA 4G4KA 1JWSD 1JOKA 1HFGA 1KDBA 2WXGA 1N5XA 2GI9A 4ID6A 4KD3A 4HCSA 3TBIB 3L4PA 4EGVA 3Q8CA 3MHZA 4KN4C 3K5NA 3NVWA 1OXTA 1QT9A 3SR1A 4JX1C 1ZEQX 1XYIA 1XLOA 4IFDH 3H3VC 4OZCA 1VMPA 5I6YA 3J7AV 3T53B 3AMZA 5FLXE 3D4RA 1EY4A 4Y7NB 1QG7A 4FNFA 4OL7A 3OPOA 2M9VA 1JWMD 1QJOA 3EUB2 3ND9A 4B0MA 4X3UA 4A3GB 1A3VA 3CRKC 2F0EA 4C3HB 4WURA 3FVQA 5C3WA 3FPPA 1QOBA 2EYHA 1A3UA 1R9TB 4E6IA 2PIAA 2DN8A 1G291 5DEHA 3D4DA 1C4AA 2EYMA 2EY1A 1JICA 2F0IA 3Q8BA 1OXUA 3MXNA 2Y5CA 1ACCA 1YNJC 1SNQA 1LT6D 2O4XA 2FINB 4OZBA 1EWCA 4K6LA 5I6WA 4C3JB 4KGSA 5J39A 3AE4B 1FD6A 1JALA 3GTKB 4TSSA 4HJGE 4IUQA 3RMHA 3F2UA 4O1NA 2L32A 3K7AB 3P4PB 1JQYD 1SYDA 3A8KE 4DK0A 1C4PA 1HFNA 3AECB 3LX0A 2KACA 1XEEA 2KUMA 1D5XC 2B2WA 4PNYA 1QOAA 2AQ3B 4K5VA 1CTMA 3NWTA 2FMCA 1WGKA 2F0MA 2OEOA 5EE0A 2EYPA 3SK6A 2XSCA 4WJWA 2INNE 2PTLA 2V0GA 2LGIA 4L2YA 2EY6A 3VR2A 2F0OA 2QILA 5IGDA 3NBIA 5KRUA 2JYOA 1A70A 1K50A 3DXJC 3GTQB 1JCKB 1V8CA 3NQIA 2VZKD 3C8YA 3L3OC 1LABA 3LXFA 4KGTA 1I3QB 4MACA 2IGGA 2WXHA 5E3FA 3ETRA 1E2ZA 3HEJA 1YN5A 3S1RB 1C48A 5H8YE 1E0ZA 3ONAB 2INPE 2VB2X 3EROA 4DU9A 3M4OB 1GUGA 4KN7C 4XTCS 1LTTD 4K14A 3AB5A 4FF4A 1PRTC 3AE7B 1BCPC 1B9MA 2BDOA 3TZUA 3TEZA 1CA6A 3MXPA 3GV6A 2KHSA 1NSNS 2Y0SB 3VYUA 1IHZA 3T3NA 2RSOA 4PQXA 5FR3A 1D4BA 2KAJA 2NTSA 3EJIA 1UWMA 1VZ6A 5G5HA 1ENFA 2K04A 1TS3A 5EPKA 2F03A 4AS1A 4WQMA 4CJ1B 2Q8RE 3I4MB 4KX6B 3E0JA 4NW2A 1QLBB 1Q90A 3Q8FA 5DM73 1GB4A 3LWEA 3A54A 1PFNA 1N5WA 1RHPA 4C1NK 3BK2A 1H9SB 1EZ6A 3IAYA 2JU6X 5EE9A 4BS9A 1GJXA 2NVTB 1BOSA 1V1PA 4C3JG 5BN4A 3TMEA 1HHVA 3ZGZA 3AE3B 4JK1C 5T8IA 3KQ4A 2D2CC 3NVZA 4NMZA 3N52A 1TKYA 2KWDA 2ZXRA 1JB3A 3GTOB 1F2RC 2BCOA 3MFGA 4J8QA 1TZOA 1G8ZD 2KA7A 4A3KB 1I7HA 1Y8PB 4ZK9B 2G1EA 5ELEA 4IALA 4BA2I 5GXGB 3W9CB 1VDZA 3R2TA 3H09A 3R93A 2FUG1 2I2YA 3RLFA 5ELDA 4K5XA 3CU7A 4US8A 4A8XC 1ENAA 2NWGA 4A3IB 1GAQB 4BY1B 5CBEE 2F4IA 2JP1A 3RZDB 1SFOB 1EQVA 1LTGD 3AE1B 1XLQA 2D5GA 2NN6I 1C8CA 1TKGA 4I7ZC 4NAWB 5EGTA 3PUWA 4H2AA 3PIP3 2LMCB 4HEA1 3ABVB 3DWPA 2M0AA 3A8JE 1N60A 4JWUC 2QEJC 1LT4D 4DNTB 2PMZB 2GB1A 3P1HA 5T1IA 2JSOA 3A55A 1LTBD 4LK0M 1PRTF 4ZUJA 1A15A 5ISRA 1BCPF 1SXTA 4N58A 4KKIA 2EY5A 4MIUA 4DQOC 2JQRB 1PMRA 1IKLA 2EJGC 4C80A 3MHBA 1N63A 3HOYB 2F0QA 1FNUA 5IOCA 4BY7B 2VXWA 2F3VA 3HOWB 1UAPA 1DCZA 3W5VB 1H9JA 4XWTA 4PV1C 1MVKA 3KLSX 5LHY1 3MXUA 2EXZA 2O2LD 4KHZA 2K22A 4ZQ3A 3X3NA 3PUXA 4BWGB 1XWEA 4ARIA 4U68A 3J81E 3TEWA 3C1FA 3MAQA 2NN6G 5JPNC 3I73A 2BB5A 1EOTA 1D2BA 5CC4A 3NZ3A 1B4OA 1BF4A 2EYOA 3NSWA 3EQLC 1ZDVA 2OHFA 5KYIA 1YJJA 3LWUA 1BCPB 1D5MC 4XQJA 3JAML 2IX3A 1RTOA 1BUIC 3A7AB 2J52A 1SJHD 2E6XA 1RM6C 1STHA 4EQPA 3DUZA 1KNEA 5I9PA 2ZT9C 3BYTB 5HHDG 5EJWA 2RBMA 2E2DC 4CQNA 1B44D 2HUGA 5DNFA 1ICWA 1SNPA 4RHRA 2R92B 4P6VF 2XNAC 4L23A 3OMGA 4FVMA 1D1IA 2B2VC 1PTOD 2XVSA 2EYFA 3MZ5A 2SNMA 4RGMA 4NDXA 4IFDG 4FXDA 4ZOHC 1JOOA 1PZJD 4JPSA 1S4ZA 2L1BA 2M56B 2WXIA 3I4LA 4IDIA 2B76B 1ZOYB 2K3UA 3U52E 4PMCA 1F9QA 2NTTA 3O13A 5BYQA 2O5JC 1P7FA 4H7BA 1VJKA 1G2SA 4RCNA 4J3OD 5CV8A 3SHLA 3EFXD 3HG9A 5A2QE 5IIFA 1YJIA 4DN4M 2BA1A 4I65A 2K33A 2PZUA 3MA2B 4ULLA 1O7LA 3HOZB 3X3MA 1V97A 4F8MA 2CJNA 5CORA 1LTAD 2K1BA 1XX8A 5K5PA 2L55A 3HRZC 5CV6A 5IGFA 5C2TB 3J80E 4IURA 2EYLA 1OXXK 2MGSA 1TVXA 2AQ1B 3SE0A 2IW3A 1R4QB 4ZUIA 2WXJA 2RQXA 3Q22A 2WU2B 1ONLA 3SEBA 1CHQD 4KMUC 4XQNA 2L12A 4FF3A 3H0GB 3KWVA 1I4QA 1KTKA 2M19A 1F9SA 1HXYD 3VR4A 4HSVA 3S17B 3K5LA 2LFIA 1CT1D 1I4HA 2WXFA 4DNRB 1RYJA 2DY7A 2B2YC 5KIXA 2MJ8A 5LNK1 2BBCA 2Z8LA 1EY8A 2QJLA 1M4VA 1OFFA 1U4RA 1FGBD 3W2DA 1HQMC 3NTKA 4DAVA 1BBXC 1BNZA 2RMMA 5C0XI 2G9HD 2R7ZB 5FO8B 4TKOB 1GUNA 5IGBA 1EFID 3FILA 4KK7A 4BA1I 2C5CA 1CI3M 2H4OA 4ZRQA 5C0XJ 2G9DA 2SNSA 2XRSD 5JPMC 2FFKB 4O42A 2L4NA 1TS5A 4QMGA 2EDGA 3BVZA 1AEXA 3OWFA 4OO1H 2KDMA 1W6JA 2EVBA 2B2WC 4ABNA 1WWTA 1L0VB 1C78A 3HP3A 2WXOA 4K2LA 3AE5B 3V05A 1IBXA 3AEGB 3DWQA 5T1GA 1Y1WB 2HCCA 3NRZA 3U9SA 2JWUA 3K5MA 2KCCA 5DM63 4QF4A 1OXVA 2N7JA 1NENB 3HZXA 2QMTA 2DWQA 3GO5A 2Z1CA 3KLRA 3GTJB 1FCCC 1EIHA 2E76C 1FCLA 1LO5D 2B8GA 2B8FA 4LK1C 4UDUC 5KYLA 3OIQA 2PCFB 2F3WA 1ZYRC 2RVLA 4OZAA 5D3IB 4ARCA 1GHKA 1CQFA 3BVGA 5E6JA 2O5IC 4A6QA 1JMLA 1TWHB 1JROA 5KNDA 3BDCA 3S2DB 4G7OC 2VZKB 5KGUA 4HKQA 1PTOH 4YWGG 1K8MA 4S3SA 1FO4A 2WIIB 1DONA 1QCBD 2CQAA 3VYRA 4KI0A 2CJOA 2BB6A 3S1MB 4MN3A 2GRIA 1PYWD 1MD2D 1V1OA 4N9TA 4MT5A 4YTMB 2MJEA 1WRIA 1YQ4B 4CKBA 1KAAA 1Y1VB 2PMVA 3WCQA 2JE6I 4JWSC 1H9MA 1STGA 3D3RA 2WXLA 3MEHA 1QF6A 5C6AA 2R61A 1SYCA 1ZXHA 4YSZB 3VR9B 4WWMA 1ESFA 3ZJTA 1J7AA 1XLNA 1FMAD 2F0TA 2E2IB 3FPUB 4ZRPA 2L5TA 1YN4A 1PGXA 2WDVB 2QCPX 2JYTA 1TKEA 5IGCA 1VMCA 2F0FA 1KFYB 1TJEA 2FMMA 2WKDA 1HCZA 2F1MA 1T3QA 1CFMA 5KNBA 5K36H 5EKIA 1SE3A 4P16A 1QB5D 4HMJA 1FFUA 3DMUA 2QKIC 3MXGA 1F77A 2NVQB 1JWUD 4USAA 1OO9B 1MBYA 4RGOS 1YNTE 2JA7B 2B2TA 2PW5A 1SMYD 2J42A 2V3PA 4TQ1A 4A3EB 2HQEA 2CU3A 2I46A 4KKTA 4AQ7A 1JC7A 4REZA 2LS01 3PO0A 3VR3A 1SF0A 2A6ED 4KY7A 2CW0C 2XWBB 4C7YA 1F9PA 2A68D 2HDEA 4EQOA 1LV9A 5ELFA 5MPOA 3W1SA 1YNNC 2IGHA 2WKCA 1STBA 3CRLC 2N55A 1A2TA 2PQEA 2EELA 3TP8A 3VYTA 1A2UA 3HOUB 3GD7A 5C4HA 2K6AA 3P7JA 2EZVA 1T5EA 3AB9A 1ROEA 4P2CB 4MHEA 5I9OA 2ICIA 5HI1A 3T13A 3GQBA 3PO3B 3I70A 3I91A 4MM3B 1WTPA 3IAM1 1RDPD 4KD4A 2KOLA 1EU4A 3T4AC 1UWXA 5BN3A 3NS1A 2LUMA 2N88A 1ET6A 1S5DD 2F0GA 3K58A 1F2LA 4RKBA 4J6HA 1L4ZB 1BMLC 4WIPA 5TSSA 5JVG3 1JE4A 3AU7A 1I4PA 4FXGC 2AQ2B 1EU3A 2NVYB 1LTRD 3DEOA 1NCVA 2SDFA 3Q69A 1EY6A 2QF7A 4K6DA 4DGZA 1IYVA 4HKZE 1SSOA 2A69C 2KQ3A 3AE2B 5I2YA 1QQRA 2WS3B 5J1ZA 3DWGC 4GDKB 4HAEA 5C4JB 3NWSA 3NTHA 1KF6B 1MGSA 3NUHB 3SDZA 3M3YB 1EQTA 3NP8A 5M3FB 5BMHA 2WXRA 1BQQT 3PZ8A 2J7ZA 2H88B 1KRHA 2B2UA 1NYQA 1TWAB 1P7EA 1TT2A 1BDOA 1V1PB 4OO1I 2ZW1A 1GOZA 4JBWA 3M7NA 4EVOA 1G6ZA 1N62A 4IOIE 3Q24A 3NXWA 3FMCA 1ESRA 2K5DA 1FXIA 4XIGS 3BWUD 5C0XH 5AUKA 1B9NA 3QOLA 3S1QB 4RHSA 1R7SA 2NB0A 1HPCA 5D65A 3I57A 1CZGA 3BVMA 4C2MB 1L0XB 2LHDA 3W3AA 2WP8J 3S9WA 1F2YA 2J0TD 4NJCA 1B9RA 4HN7A 4K5WA 1PTOB 1FEHA 5AFWA 4HEDA 3TSSA 1ET9A 1IUEA 1GHJA 1SIJA 2WDQB 2F0SA 2E75C 1MPEA 4IN3A 2DY8A 2PZTA 2RKSA 1WSPA 4JE3B 3HGBA 5EPJA 4WRDA 3HVZA 4HSPA 3P4SB 2BTEA 4A9AA 4KKUA 3Q0AA 3SK8A 3SR6A 4QCLA 3VR5A 1SNDA 2BS3B 2JEBI 2W55A 4XE0A 1C4QA 2ZXOA 1NUCA 1SE4A 2E74C 4BBSB 2WU5B 1VZ8A 3QIAA 1L6VA 1EY7A 5CV9A 2K32A 1Q10A 4N6EB 3D8GA 4OO1G 1WVLA 1E0BA 4LMQD 1C9FA 3C2PA 3HS0C 3SK5A 3S16B 1FM0D 2K7VA 1DOKA 1BXTA 3QO2A 2VUMB 3MP9A 3NK9A 3IFDA 2K03A 1XCTL 1ZPSA 3Q8AA 2WB1B 2MUYA 1AFPA 1PUTA 3KBXA 5ELCA 5E4WC 1FIQA 2BE5D 3DHQA 3HOVB 3EGRA 1BO0A 4DA2A 1ZKOA 1NI3A 1WYGA 1PGAA 3HUIA 3AEFB 2NBFA 1CZPA 1CJEA 2EPBA 3SVMA 1L6UA 4HRSA 3QWNA 2IGDA 5JXVA 1V8QA 1FYCA 3TP5A 3OSOA 1EWHA 3BG3A 4WFN3 1ILQA 3ITPA 3TZDA 2LFNA 3U2SC 1SYBA 3A56A 3R2IA 1AW7A 4XT3B 4V0BA 4X3SA 3I72A 1VF7A 4HCEA 1EYAA 1TR5A 1SMYC 4H44C 1DD2A 1RF2D 3DM1A 4U673 2EKIA 3AMUA 2A6EC 2F0VA 3BDOA 3PUYA 2R93B 4NKLA 1KLUD 1QOGA 2EOTA 2A6HD 3R3OA 2L1AA 2PO4A 2RA4A 4WH4A 3NQTA 5C4ZA 3GV3A 3E5SA 2A68C 2DNCA 1EM7A 1JORA 3AH7A 3K57A 3NE5B 2W82A 3URYA