1HQRD

Crystal structure of a superantigen bound to the high-affinity, zinc-dependent site on mhc class ii
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
205
structure length
205
Chain Sequence
KDISNVKSDLLYAYTITPYDYKDCRVNFSTTHTLNIDTQKYRGKDYYISSEMSYEASQKFKRDDHVDVFGLFYILNSHTGEYIYGGITPAQNNKVNHKLLGNLFISGESQQNLNNKIILEKDIVTFQEIDFKIRKYLMDNYKIYDATSPYVSGRIEIGTKDGKHEQIDLFDSPNEGTRSDIFAKYKDNRIINMKNFSHFDIYLEK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords HLA-DR ALPHA CHAIN
publication title Crystal structure of a superantigen bound to the high-affinity, zinc-dependent site on MHC class II.
pubmed doi rcsb
source organism Homo sapiens
total genus 52
structure length 205
sequence length 205
ec nomenclature
pdb deposition date 2000-12-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF01123 Stap_Strp_toxin Staphylococcal/Streptococcal toxin, OB-fold domain
D PF02876 Stap_Strp_tox_C Staphylococcal/Streptococcal toxin, beta-grasp domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.110 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1hqrD02
3.10.20.120 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1hqrD01
2IPKD 1PRTB 1FNUA 1TY0A 5FKAC 2RDGA 5D3DA 1LTRD 1LTSD 1PZID 3BYYB 2IJ0A 1CT1D 3DWAA 3EFXD 4Z9CB 5ELFA 1UUPA 1SBBB 1TY2A 2XN9C 1BCPB 1ESFA 1I4PA 3DWPA 3R2TA 4BWGB 2ICIA 1SJED 1B44D 1LTID 1LLRD 2AQ2B 1YN3A 3BVMA 3BVZA 1KLGD 2NTTA 2G9HD 3SEBA 1SEBD 1PTOB 4RGTA 3GP7A 1EFID 2CHBD 3OWEB 4DXGA 1FNWA 1FD7D 4ZYSA 1FNVA 1I4GA 1F77A 1EEFD 1RCVD 1V1OA 3O13A 1LTBD 1SXTA 1KTKA 1PTOH 1FGBD 1ENFA 3EA6A 1SE2A 3R2IA 1LO5D 1YN4A 1EWCA 3KLSX 3W2DA 1RD9D 1SE3A 2NTSA 1I4RA 4RFBA 2WV6D 1JR0D 1JWMD 5TSSA 1D5MC 1ET9A 1TS3A 1JCKB 5I4DA 1I4XA 2QEJC 1CHPD 1LT3D 4RH6A 3URYA 1LTAD 4DXFA 4RGOS 4OHJA 1PZJD 1G8ZD 1S5BD 1PRTD 5ELDA 2XRQD 1EEID 1LT6D 1LT4D 1AN8A 1CQVA 1V1PA 1PYWD 2R61A 1M4VA 1DYQA 3DWQA 1PRTF 1TS2A 1BCPD 4UDUC 1RF2D 1D5ZC 1HTLD 1KLUD 5ELCA 1BCPF 1L0XB 5D3IB 1PZKD 1S5ED 1PTOD 1V1PB 1XTCD 2AQ1B 2RDHA 4L6TB 1L0YB 1TS4A 5ELBA 1YN5A 5FK9C 1ET6A 3BVGA 1PTOF 1XXGA 4C56C 2O2LD 1HQRD 1JQYD 1D6EC 3V05A 1S5FD 1GOZA 2SEBD 4O1NA 3MFGA 4L63B 1LTTD 1I4QA 1JWSD 4RGMA 2AQ3B 1CHQD 1S5DD 1CK1A 1QILA 4K6LA 1PRTC 1JWUD 3BZDB 1I4HA 1B1ZA 3CHBD 1S5CD 1LT5D 1DJRD 1EU3A 5ELEA 2QILA 1SJHD 1BXTA 2XRSD 4NZLB 1BCPC 1D5XC 2TSSA 1MD2D 1T5XD 4RHSA 1UNSA 1HXYD 1TS5A 2XNAC 2Z8LA 4RGNA 4TSSA 3BYTB 1PTOC 1SE4A 1AW7A 2J4XA 1STEA 3MC0B 3R8BA 4RCOA 1RDPD 4RHRA 1LTGD 1EU4A 3TSSA 1HA5A
chains in the Genus database with same CATH superfamily
4US8A 2IPKD 4MGZE 2XGTA 5FKAC 4A90A 3AE9B 2EYFA 1UD7A 4BA2I 3VUWA 3DUZA 3DWAA 1D8LA 2N9EB 1IP9A 2K8HA 2KWVB 5DPTA 1BCPB 3HKZB 4DK6C 3J9CA 2HDEA 2ICIA 3VDYA 2MJ3A 2LKVA 4HDOA 2F4VL 1WRDB 3A7LA 1MBYA 1U9RA 2DJFC 2YTYA 3SE0A 1WJUA 1WTOA 1WTPA 2UUBQ 5L83A 4QF4A 1IL8A 1GUWA 1OEYA 1E0BA 2GN5A 2VQFQ 2CJOA 3MHBA 3MXNA 1EF5A 5C5MA 3VHTC 1MG8A 1A2TA 3OHXC 1FD7D 3MWYW 2IGDA 3VA5A 2HJ1A 4E6IA 3DQVA 4IZ8A 1F77A 3DVGY 3P4PB 4QB4A 4NXML 4MELA 5C3EG 1BR9A 2KZRA 2W3SA 1ENFA 1VQ7A 2JEAI 4JPBW 3IL8A 3SDZA 2F4VQ 3CF5A 1X65A 2F0KA 2DGYA 3KOJA 4OXPA 4DV6L 1YHQA 1KRTA 3S15H 1A6XA 1U4PA 2JA5G 3VQIA 1LXDA 4WFN3 3LDZE 5T1IA 2OJWA 3N1ZC 3VTUA 5LHY1 3AE1B 5M3MH 1SSOA 2N8NA 1WXSA 2RCFA 3X3MA 4AYBG 2K0PA 2PEAA 1F9QA 1QUQB 2E74C 1XLQA 2N3SA 3KDFA 4X3UA 2AEHA 4BY7H 2VS1A 1GUGA 3DHIC 3PUZA 3NQTA 4NXMQ 1WH3A 1HQMC 2GRIA 3SFEB 4IJLA 4KZ0A 4KHVA 3DDCB 4YL8A 5C4XH 2ZPNA 2R61A 3VUXA 3J7ZC 2EZVA 4MGYE 1QZEA 1EY4A 4MHEA 3PHXB 1B9NA 3AI5A 4DV6Q 1V81A 2B3AA 1D5ZC 2IBIB 4DPGA 2AYOB 3GOEA 2VZAA 3P2BA 4BBRH 5CHWA 1L0XB 1M90C 3OAWA 4W9EA 2RDHA 5IP9G 1GHJA 3Q8AA 4IW0A 3HOWH 3S2AA 4PMBA 4ZOHC 5FK9C 1IYUA 1H9SA 4C56C 2ZEQA 3BY4B 3Q6BA 3DBSA 1EY9A 2RHQB 4KSKC 3BS1A 2XEWA 2OF1A 2WXGA 2NVTH 1O7LA 2NR2A 3U7ZA 1TWFH 1N33L 3RZFA 1UAPA 1IBML 2WDRB 4QIWB 1WJ6A 3PREA 4LMQD 5CBAE 5KYIA 1PRTC 1ZKHA 4EE2A 1SRUA 3NBHA 3GTJB 5JZEB 5ELEA 4DNIA 3TCAA 3NK9A 1GG3A 4N58A 4WWPA 2CQAA 3S1NH 2DZMA 3J7AF 5BR8L 3KFUA 1VCIA 2N78A 2JYOA 1HZBA 4R1JA 3CC2A 3TJPA 4B3ML 2QSDA 2WQYB 3M3JA 3NJTA 4EZLA 4DGZA 3A9JA 1PTOC 1IBMQ 2KFJA 3ZNHB 5IGCA 3CMAA 4P2CB 2PTLA 3PO3G 4YCVA 1QJOA 2J7QB 3AMUA 3RZOB 4LF5Q 5JEAH 1BMLC 4YWGG 1EU4A 4J8QA 1HA5A 4BY1B 1L5PA 5JVG3 1TY0A 1ZPSA 5LL6X 2ZNVB 1E8ZA 1C77A 1GC6A 4GGQA 4TMAB 5C1ZA 1WIAA 1SBBB 3ETRA 4M02A 4HIMA 2KX0A 4P6VF 4CHKA 1B44D 3A0JA 4B3MQ 3HOWG 1FCCC 4YWKA 1K8OA 2XVSA 3DVGX 3MTNB 4M0WB 1LM0A 1L1OC 3BVZA 3PF5A 1N9WA 5GADC 2WXIA 5FR3A 1A3TA 5GROA 4DV0L 1XLPA 2K5WA 3I72A 2EELA 3OWEB 3TP8A 1X9NA 2ZJQA 3L4PA 3OG5A 3TP6A 3SHQA 4RAUC 4HJGE 1TWCH 1A15A 1MFWA 3L13A 3TEXA 2WGSA 1L6UA 2FUHB 2FMMA 4FNFA 2WYQA 2KAJA 1C4QA 4AQYQ 1KL9A 4PMCA 1V8QA 4RMAA 5EKKA 4JI6L 2PW9A 1SE2A 5E7NA 2WP9B 5D14A 1OFFA 4B3TL 2L52A 4NAWB 1GKHA 4NJCA 5IWAL 4X65L 4DV7Q 2MFIA 4C3JB 1GB1A 5FJ8G 4DV0Q 1MIUA 3RUZA 2NB0A 1QVGA 3APCA 1JCKB 4QL5A 1TKYA 2G9DA 1FRRA 2BYVE 4JCVE 1S1QB 1V9PA 2ZXOA 5CBEE 2BPSA 2L12A 4LCDE 2A74C 1XQQA 4XIGS 4EKUA 3NTIA 4K5VA 4DU9A 3F2CA 1QZHA 2LRWA 1DONA 1LT4D 1XTDA 4FJZA 3QAQA 4IM2A 3JAML 1FD6A 3OLMD 3M4PA 1BUVT 1PFBA 2AHOB 2NPTB 3BINA 1JJCB 4B3TQ 5IP7G 1YJJA 1Q46A 5IWAQ 3K8AA 4X65Q 1V49A 4X3KA 2YEPB 4H7BA 1KLUD 4KI0A 4GSWA 1CJEA 2F0HA 2XTIA 3A8KE 4K14A 5D2MB 4G0NB 3CCLA 5ISRA 4DAYB 1C7YA 4A3GB 2AQ1B 4JI8Q 1XTCD 3C3LA 4A3CH 5IYBG 4YXDB 2CVRA 4G4KA 5ELBA 4G7ZC 1F9RA 4UAIA 5BYQA 1WX9A 1PV4A 2WKDA 3C1EA 5CV5A 3SK8A 4MJSB 2SAKA 3N6RA 3QG1A 3VR2A 3ECIA 2L76A 3KJPA 1XWEA 3B9JA 3PV0A 2BWFA 4N59A 3E0EA 1I42A 3A8JE 4DR3L 3D3RA 3KJOA 1C9OA 3GTLH 1XCTL 4LLGM 2DY8A 1OEYJ 4ARIA 4EQNA 1S40A 3BZDB 5CYUA 2F0NA 4LUVA 2KQ4X 3P75A 2BB6A 4KDLB 2HTME 1ZYRD 3VYRA 5M5XB 4ZUIA 4ICUA 1BT0A 1I50H 1SIFA 5C0XH 3S16B 1R4QB 3N30A 1QE6A 2V0GA 3AU4A 1QT9A 2MBQA 2XWBB 1VQKA 3CMMB 1MD2D 4RWSC 4A55A 1BF4A 5DM73 3L16A 4WJQA 4DV2L 5M5YB 1F52A 2Q2TA 2K1FA 4F8MA 1N34Q 2LGDA 3DBHB 3NG0A 2M8SA 1YMHE 3K57A 4EZJA 3NS8A 1ZDVA 1Y8NB 1Q3LA 1PQSA 1P98A 3I63C 3MVVA 1E7ZA 4R8IA 1EIFA 4UP7A 5JHAA 1I7HA 1MSHA 2KJRA 3AEGB 3S1QB 1PRTB 2A5HA 3MEFA 3OOCA 4CQNA 1C1YB 4PQXA 3KLWA 2W55A 2DAJA 2HT1A 4IFDI 4BWGB 4A3MH 1RTNA 1ESFA 3BWUD 4DV2Q 3FKIB 3NRZA 3I4MB 1GJZA 4WJWA 4OGQC 2PIAA 3ZDMC 4NXNL 2AWNA 3OW2A 1QOBA 3AU5A 4A76A 2EKEC 4KZCA 1PTOB 5EPJA 2L1AA 2LHDA 2Z0SA 2J53A 3AYHB 3PV1A 1YJ1A 3RT3B 3SU8X 1PGXA 5CV4A 2WXPA 1GAQB 1I4GA 3P4QB 2IX0A 1Y1WB 4LWCA 4JBWA 4KGSA 5BMGA 1U4AA 3E5SA 4L5TA 2WXLA 3PLVA 4GN4B 1QUQA 5EAYA 3SFDB 2KO3A 1O78A 4ANWA 2JE6I 1F9SA 2B2YA 2K01A 2BS2B 3U4ZA 4GU2A 1RWSA 1L1OB 5EDSA 4KN4C 4W9LA 1YEZA 1ACCA 2KDMA 4A93H 1KNEA 2C5CA 1YHBA 1UBQA 4K81A 3R7QA 3URYA 3WWVA 1JB3A 2KVRA 1ZUD2 3AE7B 2WFWA 3NHHA 4C4VB 1PGAA 5EE9A 1H95A 1EEID 2NN6G 4BBSB 4JV5Q 4XWWA 2LGSA 3N52A 3S9WA 1HRJA 4OO1I 3HS0C 1HNWL 1D4BA 4N9TA 2YV5A 2KN5A 3DWMA 2VZKD 1J8IA 1EL0A 3ONAB 1HZCA 3K0YA 2UU9L 4LFAL 5DPWA 3EFUA 4L6TB 2JZZA 2DN8A 2NUCA 1K3BC 1ISNA 4PZ6A 2FIFA 4DV1L 5AEKB 2CKZB 1NAPA 1ET6A 1C4CA 1WGGA 1K8AC 2KMAA 1PH4A 1HQRD 3S17B 2UUAQ 5EKLA 1HNWQ 4O1NA 4HWIB 1E0ZA 4H13C 1LGRA 1VZ8A 1OQQA 5C3JB 1CHQD 3SK6A 4A3GG 3ULJA 3HOZB 3AEEB 2K75A 4OL7A 1PH8A 2GBMA 1FL0A 1HHVA 4QUFA 3VYUA 1RRBA 3ZTDA 4ULLA 2KJ6A 4LFAQ 2M9VA 3QIAA 4ALPA 2BT6A 4NAMA 1B8AA 2YLMA 3U9OA 2PMZE 4WAAA 4XQNA 3AE6B 3J80E 5BMIA 1LACA 4LFBL 2JXTA 2QW7A 4CHTB 2TSSA 1VMCA 4L2YA 2QCPX 3W5OA 2AWTA 2VQEL 1AH9A 2N55A 4JI5L 2K32A 4YWMA 3NTKA 5HGQA 2VH1A 4RGNA 2Y5CA 4KMUC 3K5LA 2XBBC 1EUJA 3I4LA 4PNYA 2A4ZA 4KKTA 1B50A 3LXFA 1JMCA 2UUCL 5FO8B 1AW7A 1NJIC 1VQLA 1STYA 5JJLA 1W6JA 2EJMA 4BXXG 1WI0A 1FM0D 4A3JG 5JHBA 3MZ5A 4LW1A 1WX8A 5G3LD 2INCC 4M0WA 5L37A 3S1RH 1BBXC 3K5OA 1FYCA 2DYBA 2F0IA 1ML0D 1FR3A 2FMCA 1E2VA 2WXKA 2JK8A 3QOJA 1JW9D 2DX5B 2WXNA 4I6LB 4ANXA 4GOPC 4IALA 4UHVA 5ELFA 1WYWB 2VQEQ 3EQLC 4K8IA 4B0EA 1HTOA 2OTJA 1Y14B 3L3OC 2K5QA 3TS0A 4A3LH 1UELA 2ZZPB 4HVBA 1I6HH 2UXDL 3VR4A 1KLGD 3CC7A 2F0JA 1HNXL 2PQEA 2O4XA 4RGTA 5E6PA 2AWOA 1EYGA 1P0RA 3HIZA 4JC0A 4POFA 2M0AA 3HOUH 5J2RA 3MXUA 1M8AA 4A3DB 2RMMA 3KUDB 4NAWA 3RULA 1DD2A 1K3RA 4K5XA 3FKIG 4BKTA 4IPCA 3EN2A 5HGTA 1LTBD 1C78A 1FPYA 1QVFA 1QOHA 3DWGC 4S0RA 4IG7B 3DHGC 3W3AA 3J80c 1I94L 3PO0A 5CR3A 1E7PB 2BW2A 3PRMB 4GS3A 3AB9A 3DLLA 2YU9H 1VQHA 3RZDH 2LXJA 4A3FB 3STBD 2KHIA 2E2IH 1V2YA 2L55A 2NPTA 1IUEA 4HSVA 4M8MA 4QMGA 1LTAD 4XYQA 2IO3B 3QJZA 2DZKA 4DV5Q 3DHQA 4IPGA 4HKZE 3S24A 3PPAA 2KENA 3FHWA 4WRDA 3L7ZC 2K25A 4DAYA 2MWSB 2L3ZA 2CU1A 1DCZA 2Y0SG 1EWYC 4MH8A 4R9WA 1TS2A 2NVXH 4EEWA 1JRUA 2ZJRA 2KCMA 2ZXRA 4X66Q 3K81C 4MJSA 1VQMA 2ZCCA 2K04A 3V61A 2DNEA 2K5NA 2KKCA 1SF0A 3J80i 3PVLA 3APDA 4C2MH 4A3LG 4YCWA 2LGYA 2CHZA 2KEEA 4U673 2VUMB 2JUOA 3A54A 3NZUA 2RDFA 3B0AA 2MLBA 4XWTA 2O2LD 3V05A 4CJ1B 2FBWB 1GOZA 2M17A 1YHAA 2ACZB 3O65B 5C44H 1BVSA 2WACA 2Q8RE 2KDIA 4U68A 3VR6A 2EIFA 3JC66 4G7OC 1I3QH 2RR9A 3CU7A 3ML8A 2OOBB 3GV3A 1GVPA 2CQOA 3CHBD 4HKQA 2PCFB 1S5CD 1YJIA 1TGZB 1EQTA 1P3QU 2R7ZG 3B6YA 1AZQA 3NUCA 3Q8CA 1LQBA 3A9KB 1WJJA 4XDDA 5AZFA 5CC4A 3K0XA 2E6XA 1IBXB 3M4YA 2EYLA 1UNSA 1BKBA 5KRUA 2A69D 1JB7A 1KC8C 2JX5A 3ND9A 4K5WA 4CO7A 3I56A 4CYEA 4DA2A 2F0VA 5LMUQ 2MP2B 4IOCA 5BN3A 3AXCA 1ZGUB 4DAPA 3KK7A 4DR1Q 4MACA 3S14B 4E71A 4FLHA 2NVUI 4A75A 1QNUA 3AEFB 2JA8H 1MKHA 3NOBA 1K0RA 3ZXRA 5JJZA 2YVCA 2NWGA 3SXHA 3FILB 2K1BA 5FR6A 1JOKA 1PZID 1J8CA 2IX1A 1EY0A 1NBWA 2L8JA 2LXAA 5F2DA 5IGBA 2WKCA 4FXCA 4HPPA 4IUTA 1JT8A 1K8MA 1XEEA 2LRUA 1SLJA 2XWJB 2K8BA 1MI2A 1ZYRC 5CV7A 3KH0A 3BJUA 5IA7A 4HJ7A 2KA7A 1YD8U 2WWZA 2IGGA 1ILPA 3VH4B 2BYEA 5EJWA 4RKLA 4P71A 1X54A 2MO0A 4D2KA 4JYAL 3WANA 1TIID 3TZDA 3P7JA 1Z2MA 4OVZA 1WSPA 4HRSA 1K83B 1NVID 1EWHA 4PMWA 2N88A 3CD6A 3ERSX 3EUB2 4MGIE 4EOYA 1T9HA 2A19A 1IZ6A 3EBEA 1L1OA 3K7AH 1MHHE 2P5ZX 1X1MA 3N1YC 3K58A 4OX9L 2RVLA 2CCZA 1XNQQ 1TWGB 2IL8A 5T1GA 1L0WA 1WZ3A 2QDFA 4JI4L 1L7YA 4GOPB 1R9TH 4X64L 2VW9A 4MM3B 4C4VA 1XMQQ 4AQ7A 2JEBI 5EE3A 2EXZA 2XIWA 4A3DG 3GTKH 4Q5VA 2W82A 1VLBA 4IDIA 4AH6A 3ZQ4A 4A3IB 4JYAQ 4YTNB 2F0SA 3C8YA 2OCEA 4LNFA 5C3EB 1Y56A 4X3SA 2OJRA 4DKAC 1WGYA 4OX9Q 1FMAD 1LT6D 5DAUA 1I6VC 1CA5A 4C1NK 1LABA 4A3FG 1QVCA 1V43A 4OEMB 4PYZA 1KH0A 1CZGA 4Q0FA 1J0GA 4LF8Q 1F2LA 3AE2B 4DK5A 3W5VB 1A62A 1HTLD 1G6PA 4IPDA 1O7ZA 3A1QA 1STHA 2K50A 1ZDXA 1KNAA 5H8YE 1BCPF 4DUZL 3GS2A 2BH2A 2I46A 3AN1A 5T8IA 4N8X1 4DR7L 2K8CA 2E2JB 4JPSA 4PV1C 4OZAA 3A74A 1EZ6A 1WMHB 1VZ7A 2LFIA 4JLCA 3DM1A 2ZJPA 3EGRA 3ERQA 5L95C 5C0XI 2VB2X 3DBLI 4HMIA 4KKJA 3R7RA 2KC1A 1Y8OB 3UINB 1A5RA 1DOYA 4DHJB 3M9BA 1S5FD 1WXVA 2M56B 3WOEA 5IKCM 4FHKA 4RGMA 5CGKA 1STAA 2E75C 4EQOA 3VAWA 5JVH3 4HMJA 2MX2A 5HURA 2MQJA 4ZRKA 1C4PA 1V9JA 5H1SE 3CCMA 1OXSC 4DUZQ 3J7YW 4DV4Q 3CPWA 1B1ZA 4B3SL 4FJVB 3TMEA 4DR7Q 2RKSA 1QZGA 1SJHD 2FCSA 5I9OA 2XRSD 1TU2B 3H7PA 5IGDA 4QY7A 2UXBL 3WCQA 3RCZA 2PPBC 1LTLA 1KFYB 2A5UA 2O6VB 3PTFC 3GE3C 3D4DA 1HXYD 5TR5A 2FCMA 2PI2E 4QUCA 3ABVB 2NVQH 1PGBA 2GBRA 3S15B 5BO4B 3H0GH 3FVQA 3MC0B 2EY2A 3G71A 5LNK1 1LTGD 1DXMA 4XT1B 5M3MB 4JI3Q 1T3QA 2G4SA 2PNHA 3T51B 3NVYA 2V3SA 2A6ED 1EY6A 3R93A 3HOYH 3IFWB 3MA2B 1SYDA 3MC9A 2L5TA 1JWAD 3GTGH 4JIOU 3PO3B 3DWPA 1YNTE 1EY7A 1SJED 3Q22A 1QLBB 2BTEA 5C4XB 3UDGA 4CDFC 3SR1A 2F0QA 2JA6H 3MHZA 4USAA 4PK1A 3OMGA 1XD3B 3ZJYC 5IYCG 2I38A 4BBRB 1NY4A 3GTMB 1R4MB 4IUQA 2G3QB 3H9DA 3J7A5 1NR2A 4N9PA 5NUCA 3HOWB 4LNNA 2JJQA 1PH7A 2DBYA 2PYKA 4XQQA 1PDXA 2CS4A 3DXJC 3CP0A 2MJEA 4PS7A 4CBVA 1QWYA 1HR0W 1L4DB 5H92C 2KVMA 1YX6B 2WNMA 2UWQA 2V4IB 3ALBA 1JICA 1JOOA 3J80L 1TWFB 1HR0L 1A0IA 5C4JH 1SE3A 3VTWA 1SSNA 2BE5D 4IUNA 1B3AA 4LF9Q 1WYGA 2V1YA 1ENCA 4HPMB 1DOLA 1RFKA 4GIVA 5I4DA 5D6JB 2ZM6Q 1XMOL 2K9XA 1I4XA 4FULA 4IJHA 3KUCB 1P7FA 2L11A 4TRDA 3M4QA 3G48A 4OO1G 4IOIE 4WQMA 3AE4B 5IO9A 1NUCA 1KM7A 1JE5A 4B9XA 1YQ3B 1CKMA 3H0GG 4HJKA 4DDID 2EJFC 5E4WC 3AU7A 1D1KA 5K5PA 3Q14C 4DUYL 3EROA 4R4TA 1CKOA 1AEXA 4CJ2C 4A3IG 1WCMG 2EJGC 3M3YH 3A5ZB 3HOYG 5HY6A 4MSQB 2F03A 1WTHA 4GOCA 4OIKA 1RODA 3VFKA 4WAFA 5FLMH 2L4NA 1V1PB 3C46A 2HDLA 1YZ6A 1TS4A 1YN5A 1EQVA 1XXGA 2ON8A 3EFCA 4P72A 4RCNA 3CPFA 4DUYQ 2KMMA 3STBC 1JWBD 1GD7A 1GUAB 1XNRL 1WTRA 4L63B 2KQSA 4YWLA 1YNXA 4QGUA 3A9KA 3AULA 2X6LA 3Q69A 2FCQA 3P20A 2K39A 2YTVA 1N5XA 1IBXA 1C76A 4TKOB 1SFOH 1SE9A 3DHHC 3U7DA 3PO2H 2R93H 1EFWA 1WGRA 4HCNB 4DR2L 2MP2A 5D65A 4WJPA 5E6NA 4AP4C 1BXTA 3ZJVA 4EX5A 2K5VA 4NZLB 3K9OB 1BQQT 1OXVA 2EYPA 3PMFA 2ZW0A 4IN3A 3TRZA 1J5EL 4F7XA 2L0CA 1QKZA 3IAS1 2WXOA 4MGKE 1XNRQ 2NS5A 2Z8LA 1FJGL 3FILA 2Q5WD 3Q8DA 4XTCS 2IYDB 3CAMA 2K14A 2H4OA 3QJYA 3KYHC 5A2QE 1WTQA 2FUG1 2HE7A 4K7WA 4OIJA 1XT9B 2ZJDA 3AEAB 3CW2C 1M1KC 1FGUA 4RHRA 2EYMA 1SMYD 3QWZB 2KDBA 1UWMA 2LASA 4DR2Q 2Y3AA 1KF6B 2R6GA 2K3UA 4KHZA 2B3GA 3BU2A 3M85A 3V6CB 2RDGA 2YEPF 1QNKA 1C8CA 1XPRA 1JE4A 1VF5C 5J3BA 1TKWB 3AECB 1UUPA 5K36H 5FLMG 4BZAA 4J6IA 2ID0A 4KY5A 3T4AC 2VZKB 3ZXVA 1ZXIA 1QG7A 5GXGB 2QF7A 4RA8A 1FJGQ 2WDQB 3P1MA 5M3MG 1HH2P 1GXDC 4IM0A 3AQQA 1TWAH 3CMEA 2GVAA 3MP9A 1N33Q 2Y0SE 5E3FA 1WJNA 1L6VA 4BY7G 4EGVA 4GOPA 4NY0A 5J39A 1IYVA 4MM3A 4L5QA 2A69C 1J6QA 4HSPA 3ZRFA 3B1LX 1YITA 2K6AA 3DOWA 5C4XG 5KHOA 2K5PA 5CORA 1LV9A 1G6ZA 3VR3A 1JC7A 4KSLC 1Z9FA 3OTOL 2CU3A 3UGBB 3G4SA 3HG9A 3IFTA 3JW0X 5BR8Q 1Q12A 4BBRG 1IGDA 2ZVOA 1WTVA 2Q2HA 2ZT9C 1RAXA 4KGTA 1EOTA 3TBLD 4KIKB 4P7IA 2SNSA 1SYGA 4ZYNA 2UXCL 2MJDA 3QO2A 1TS3A 4ZRQA 4DHJD 2H88B 2FNJB 2J52A 3IXSA 1LT3D 4UPAA 3C2PA 3ZNGC 3QWNA 4RF1A 1TTNA 2M4NA 1F1HA 3IHPC 4LNQA 1I50B 1HFNA 3OYYA 5G55A 3LGJA 3J81E 2XRQD 3NELA 4K8JA 2PZUA 2QHOA 1II3A 4PZ7A 1TVXA 4CKBA 1Q5WB 2KFKB 3N1XC 1WVLA 3OTOQ 1VS0A 1PRTF 4RNAA 3IBEA 1WMHA 4TKNA 3IKJA 3PSEB 1WXMA 4OWTB 2V3PA 1G291 4H0LC 4ZKBB 5C6AA 1E8YA 1CSQA 1PLFA 3PIPA 2UXCQ 3X0WA 2D0PA 5K36G 4PG3A 2O6VD 3G6EA 2SNMA 5DEHA 1PZKD 3QR8A 2LD9A 3A4SC 3KW5B 3PZDA 5JAVA 1WYDA 2K33A 3LB8C 2IHFA 3KBGA 5DNFA 3WDNA 3ZW3A 1GHKA 1KAWA 3HRDD 1PTOF 1X32A 1K53A 1SYEA 2DZIA 1X56A 1MPEA 5EBDA 2PPHA 1D3ZA 1DOIA 3QCAA 1XYIA 4ZLTF 3VR8B 5IODA 1XJVA 2D5DA 5JEAG 3CCRA 4MN3A 3EC8A 4V0BA 3ZRCA 4JI6Q 1XCQL 5DCNA 4JBKA 1UE7A 4NQKE 1R7SA 2VB3X 2O6VA 3ZIMA 5JH5C 1DJRD 3P1HA 3Q0AA 1CZPA 1DM0B 2G1EA 3VTVA 2F0TA 4G57A 1Z7TA 2BF8B 3RUIB 2IO1B 3GZNI 3NZSA 2JZPA 4ZRZA 3ZKJC 5M5WB 2F0UA 3T53B 2LJ5A 2NBWB 2LGIA 1TS5A 2DENB 2LXKA 4DDGD 3J81c 2VRRB 2O5IC 4IUVA 3KBXA 5M9OA 4C7ZA 1VMPA 2NZOA 3M7GA 4DBGA 4LUZA 1UEAB 3D4WA 3UDIA 3SHLA 2KDFB 1B53A 1MG4A 1OGWA 1R4NI 2Y5BB 3FRPB 3S2HB 2JY6A 4MEMA 1H9RA 2KCNA 2L1BA 2WB1E 1IBLL 2WX0A 3WIMA 4ZDVA 2IJ0A 1CT1D 2GVBA 5AFWA 1EQQA 4K2KA 1CMXB 1FEHA 5EE1A 3RZOH 2BGFA 1I4PA 5LXIB 2I2YA 1YNND 3TP7A 3L08A 2BYFA 4A3JB 4G3XB 4BY1H 1QQRA 2D2QA 3H6NA 3BVMA 2CKHB 1PA6A 3FC4A 4V190 5E6JA 4M1UB 2F3WA 1NNXA 2DZJA 1PH6A 2HCCA 1VQ8A 2L32A 4ZHOA 1N36L 3ER0A 1TKGA 3J81j 3TP5A 2C60A 2M1MA 2K52A 2WP8J 1CFMA 3A56A 3D8GA 4DR3Q 4JBMA 2ASBA 3IG3A 2JWUA 4KK7A 5GAHC 4JI7L 4QCLA 2F0LA 1XO3A 3TEZA 2F52A 3J81i 2LUMA 2PMVA 2WXQA 1TBEA 3QARA 2VL6A 4OZCA 2JU6X 1PUTA 1KTKA 3VR5A 4HIOA 2M19A 4K1RB 4DHZE 1GUNA 1KIXA 1YN4A 2BS3B 5M3FH 1B9MA 1F9PA 3KLSX 2KQ3A 2A6EC 2KC2A 4W9KA 4ZQ3A 4A3CG 1N36Q 1AYFA 2JXXA 2CJNA 2IDYA 4QJFA 1SB3C 1K0SA 1EY5A 1PDQA 2TMPA 4JI7Q 5D94A 3F1ZA 3BDOA 4CKEA 2K7VA 5IGFA 4R4QA 1PH3A 1WJ4A 4HJ9A 2E76C 1WOCA 2KHJA 1HPCA 2MUYA 3W1BA 1A8VA 5ELDA 4C3JH 2HHHL 1TYGB 1SR3A 3AM9A 4NJ6A 4YSXB 3T3OA 1V1PA 2EMTA 3RMKC 1YNJD 2EMSA 3HOXH 2BYTA 5CX3A 1E2ZA 4WWMA 1RF2D 1CUKA 3FPPA 5GQOA 2JXMB 1Z47A 2V9HA 4BBNF 4DK3C 4LAAA 3VUYA 1JMLA 2R92H 5C0XG 4B3RL 4NXNQ 4YIJA 3L17A 4M01A 1L0YB 4X6AH 2ZTCA 3PT2B 1UWXA 2F1MA 3FDTA 3S1RB 4CJ0B 2Y0SB 1QOFA 2INNE 1X3GA 5I9PA 1FFUA 1JRPA 2NBVB 2PLPA 1FO4A 4JBJA 5KIXA 2E2HH 3I3TB 1ZW7A 1RYJA 3NWTA 4WQOB 2BE5C 3D32A 4AUQC 2GMIC 2X8XX 3M7NA 1WD0A 2IO2B 4KD4A 1GB4A 1NMGA 3GB1A 4XQJA 3CQZH 5IE8A 3K5MA 5J1ZA 4TQ1A 4YSZB 3GDEA 3NQIA 4H44C 3VH3B 2KHSA 3HOUB 3QA8A 5CHVC 2BA0A 1IL2A 4A3MG 4BKGA 2CR5A 4KJNA 4RKBA 2KACA 2YYZA 4RHSA 2E2DC 1O7IA 3CCJA 3VYTA 1YIJA 1K73C 2B2TA 3SK4A 5BN4A 5HG2A 2ZVNA 1EWIA 4DNRB 1PXUA 1CSPA 5M5XH 1WFYA 3A1QB 4A3PA 2R7ZB 3S16H 3L9AX 2FJ2A 3RZDB 3GTQH 2KX3A 1RLFA 3NENA 2BH8A 4BAXA 4J15A 1E2WA 2E2IB 1OXXK 4LNOA 3HOXG 4A6QA 5M5YH 3AEDB 4K7UA 5E4XA 2Z0EB 2UU9Q 4XYOA 1WTXA 4DV3L 2R92G 2BCOA 4WIPA 2X6GA 2WHIA 4DV1Q 3QOLA 3R2TA 1E7VA 5COYA 3KYCD 4IWOA 4FA6A 3AEVA 1Q81C 2MHVA 1TKEA 2KMCA 1WFQA 3NXWA 4DF7A 1NE3A 2FHTA 3LWEA 4A93G 3BG3A 2NVXB 2LUEA 5C4HA 4MH0E 1RHPA 4DR6L 3GP7A 3I4OA 2LVPA 3WAMA 1Q8IA 1EIHA 1SROA 4L5RC 1NEKB 3RNEC 4JI1L 4OWXB 4ZYSA 3H7PB 1V1QA 1IPGA 4KKSA 1KRHA 4B9WA 4KIKA 2ES2A 4DV3Q 1V1OA 2ALYB 2PI2A 1SXTA 1KHIA 1PTOH 2PW5A 3L10B 2HJ8A 1DOXA 4LFBQ 2I1KA 3ZJUA 1SMYC 2D62A 2N49A 4IM3A 2Z6KA 2R2OA 2NZHA 3LWUA 2EVBA 3RLFA 2WXJA 4DNTB 2HD5B 4JI5Q 1AP0A 4DR6Q 1Y1WH 4RFBA 1JWMD 3UE1A 2KCTA 1ET9A 1I3QB 2KFKA 3RNBC 5KNCA 3TIXA 2ASQA 1F2RI 2N9PC 3N32A 4YTMB 4JI1Q 2UUCQ 5IYDH 4M8NA 1TWHB 1H8CA 3A7AB 5A2QL 4IOAA 1EYCA 5DPRA 5LLIA 2WINB 1TIFA 1JORA 2L15A 4HAEA 2JWZA 1SNOA 1ZXHA 2QCZA 4C3IH 4S3SA 5E6OA 4IQZA 2K05A 1PYWD 2DNCA 3DWQA 1FXAA 1K8GA 2AL6A 3FKYA 2K4KA 5IOIA 1NMFA 1STNA 3L2PA 1NYRA 3ZNID 2ZPYA 2LHEA 3JSVA 4ARCA 2KLGA 1LM8B 4BBSH 2UXDQ 1IGCA 3C19A 4MDKE 5FO7B 3QQ8B 1HNXQ 1VQCA 4A9AA 3BVGA 3AB5A 3PZ7A 4RM8A 3T3NA 4L23A 1B70B 2MGSA 4P73A 4P74A 2JYEA 2X38A 1SGHA 4FYDA 3U30A 3V2TA 5AJ3L 1HEZE 1SNDA 3HGBA 2N9LA 5FO9B 4NPSA 4PS3A 5CTRC 1DGJA 1I94Q 3HOVH 3G6JB 3BIID 5I2YA 1EY8A 3HHMA 4NNJB 1HTPA 4GN3B 5KYLA 3I5JC 3RNAC 2QILA 1R4NB 3QK0A 2RGFA 4HLEA 3HOZH 2NVYH 4C3HH 3IT4B 3DPDA 3K7AB 2IY1B 2D0OA 1STGA 3GTPH 2CH4W 4K2LA 1J19A 3NPPA 3K80C 4JK1C 1R9TB 3E56A 3N3KB 2WAQE 2LI5A 4W9IA 3TL5A 3A33B 2DJGC 3QB3A 3J81L 3HOUG 4K3CA 1Q1OA 2WDTB 1X3PA 3GTKB 4EZKA 1CQFA 4HPLB 2BWES 4IURA 1UE6A 1T6BX 3RD4A 4TUUA 2RF4A 5JPMC 4L1BA 2GOWA 1FNUA 2KQ7A 1E6EB 4YCUA 4YTPB 5D3DA 3CC4A 4MNOA 4GKJL 1JJGA 5GAGC 2PW7A 4FO2A 3TS2A 1D1IA 1Y1VH 2D07B 2LWPA 4ACFA 4FADA 3I90A 1PFNA 2ICEC 1E22A 2F0GA 2XN9C 3ZLZA 1P8LA 4IPHA 3OMCA 2GB1A 2PE9A 4NPNA 2WS3B 3NBIA 4WURA 2RHSB 2EXDA 3VA7A 1ZOYB 3MJ5A 4X3TA 4FF3A 1W6KA 4K0KL 1LYLA 3A8IE 3QHTA 2ONQA 4L8JA 3SK5A 1K9MC 1B4OA 3GE8C 1EFID 4DAMA 4JWUC 2QGQA 2EPBA 4O42A 3OJ3A 4LNKA 1VQBA 2QEXA 3UIPB 4GKJQ 2OXPA 1PH9A 4FF1A 1IKLA 4A3KH 2HIVA 1EIGA 3M4OH 3HOVG 2WXHA 2CHWA 2M0XA 4BKSD 3HUIA 2F0FA 1U4RA 2KBNA 3F2UA 5ELOA 1YQBA 3R2IA 4OVVA 4R4OA 4F8CB 4ZCKA 2RPQA 2WV6D 3RN2A 4E74A 1D5MC 2J0MA 3Q3NC 1V97A 4AJWA 3T8MA 3HM6X 2FFKB 3KF8B 2G4DB 1DGSA 4A4IA 2PE6B 3APFA 3K9PB 1CHPD 2EY1A 3KWVA 1AARA 3LNNA 2N9KA 1EOVA 1YNNC 4RGOS 1G8ZD 4J6HA 1N8RC 3RN9C 2BBCA 1S5BD 3NEMA 3BZKA 2KNBA 2IT1A 5C44G 2B2VC 4ZRPA 3T16A 2F0DA 5BN5A 1SDFA 1DYQA 4XXEA 1Y8PB 4PT5A 1T0RC 5DPSA 3NVZA 4JI2L 4CDEC 2PMZB 4F87A 2JA7H 2OEDA 3Q2AC 2RSNA 1F0ZA 3UI2A 1WE6A 3H0GB 2A6HD 2K03A 3DEPA 1S5ED 3OJ4B 5CV9A 1U5KA 2LGXA 4IUUA 4LNIA 4I7ZC 1Z6HA 4KKUA 4X57B 2WB1G 1Z5SB 1WCMB 3HOYB 2Z4IA 3BDCA 1T0QC 3L0WB 4KDIC 3TBIB 1X3FA 3TZUA 1RL2A 2N7JA 5HI1A 4G7HC 3GTGB 4A8XC 1HNZL 3M63B 3Q3FA 3PIOA 4CDCC 1LTTD 4ZUJA 4JI2Q 3JAME 4S17A 4XDXA 2R3ZA 1IBKL 2DYMA 4CGYB 1PH2A 1CK1A 2SDFA 4GN5A 2JA8G 4KV2A 4JI4Q 2IY5B 4X64Q 1IYJB 4ITKA 2F3VA 2OWOA 1K8RB 2LVOA 3J7AV 1C9FA 1YNJC 2KJXA 4YHHL 3KQ4A 2MJ8A 3VVWB 2J42A 1FRDA 4FXDA 3UDFA 2M2LA 1HNZQ 4ANUA 4NP5A 1BO0A 3OIQA 1A70A 4O0AA 1C79A 1KDAA 4HJAA 4G11A 5BYSA 4RMFA 2E5LL 2MBBB 3Q23A 3T1HL 4A3EH 5MPOA 1VQAA 5KNBA 1RTOA 3H3VH 4OELB 5C4JB 3A5UA 4C00A 3B08A 3CKIB 4NMZA 4LF4L 1VQGA 3TMPB 3UI3A 2MP1A 4ILWA 3DVNU 4QIWE 2B2TC 4I7AA 1WXAA 2J0TD 4YHHQ 3H1UA 1LTSD 2GA4B 2EDGA 4DR5L 1ASYA 1F9JA 4DQOC 4ID6A 3T1YL 3S14H 5LXHA 2F0OA 1LTID 1PH5A 3S2DH 1T5EA 1LFDA 1QCBD 2BDOA 3SEBA 1MGSA 1Q90A 2H1EA 3W9CB 5IOCA 5EKIA 3JAMc 4A3BH 5JJKA 1XF5L 2LSSA 2R7FA 4LF4Q 3ZDTA 4YT0B 2Z9HA 3B2GA 3V96A 2AUKA 4B3SQ 3U9SA 2F0PA 1KAAA 3VRBB 3T1YQ 3LYYA 3P4SB 2BA1A 2V3NA 3CSFA 4YY3L 2JP1A 4IC7B 3NE5B 2UXBQ 4BY7B 2O2VB 3W2DA 3RI7C 4JOIC 5EBCA 2QIEB 1NYQA 1JR0D 3AFPA 2JQRB 3I57A 4FXKC 4L5SA 2PZTA 4PS8A 3S1MH 4R8NA 3PO2B 2R93B 1UGMA 3D0FA 1VZ6A 5EE0A 1Q10A 4A3EG 2KTRB 2ATWA 2Y5PA 1UGJA 1YOVB 4AWJA 1KLVA 2Z6KC 2K5HA 3C1FA 1ASZA 1WD1A 1KDBA 1UE5A 5EGTA 3RMHA 3L0OA 4BS9A 2LY7A 5C3XA 1XPOA 4QQBX 3JAMi 1M4VA 1MJEA 4YY3Q 1VD2A 4FJYA 3DBRI 1VR9A 4UDUC 3HZXA 2DNFA 3U8ZA 3G7LA 3MXGA 4GDLB 3RNCC 3NWSA 4HR7B 3NVWA 1XLOA 3RNUA 3ZJTA 2JA5H 3IFDA 2NVTB 1E8XA 3LJ3A 4N6EB 4HXDA 4HCEA 4AIMA 2G45B 2NZ1D 1GNUA 3BZCA 2W3RA 3H09A 4R4CA 4AJYB 1JQYD 1V80A 2JZ3B 1K52A 3F2DA 2EY6A 2SEBD 2UUBL 1GC7A 4A3OA 1PVOA 2K22A 2VQFL 1CZWA 5IIFA 2D3CA 3RYTA 1IKMA 3S1NB 1Q82C 2PZWA 2DYOA 1UBIA 3LX0A 1QILA 1IHZA 1E5WA 3QIJA 4TVAB 1I4HA 1TWAB 4I6NB 1HR0Q 4JW0A 2MH7A 1EF1A 2H5XA 1JALA 2KD0A 5IP9H 2HUGA 1XMOQ 3DBHI 1Q0WB 3VR9B 4LF7L 1CM9A 1ZEQX 1NI3A 2MW5A 2JA6G 4W9CA 1N6ZA 1EM7A 2YTXA 3UF8A 2OEOA 5ELNA 2KOXA 1SE4A 2D11A 1E1OA 5CMDA 4CDDC 3OPOA 1STEA 1KD1C 1RFAA 2C7NB 4GN1A 4GMVA 4LDTD 1FCLA 1GM5A 3D6WA 2LEKA 1DOKA 1P7EA 1B9RA 1VRAB 1RIPA 4NB3A 2I07B 3IAYA 2B63H 4WORA 2D3AA 2D5GA 3EVQA 4Y7NH 3CCQA 3FMCA 2C7HA 3PGZA 5G3LF 2QA4A 3CRKC 1L2NA 2RDBC 4LF7Q 1E90A 2AUJD 2A73B 4BVUC 3K5NA 1GUOA 2KYWA 1TWCB 2QC8A 3WALA 2GBJA 1YN3A 2L05A 3I4NH 4B95A 3WAOA 1S4ZA 3PRPB 3BDLA 4HIDA 3HP3A 2MHJA 4PYUA 3PO3H 4FP5D 2F0EA 2EY5A 2IZVB 1YIWA 4KGRA 5BYRA 3Q6SA 3AE5B 1ZE3D 2WDVB 1EO6A 3V3XA 3RLOA 2B2WA 3PS6A 1VQIA 3KF8A 3GTOH 3TEYA 1EYAA 1VQFA 2PNRC 2EQSA 4KY7A 1F2YA 3SVMA 3GTMH 1N32L 2FIDA 4GLSC 1J5EQ 1BBUA 3HFZB 1SIJA 3KF6B 1M94A 1F2ZA 5E1FA 1HZ5A 4XC2A 4OZBA 4K7SA 4YSYB 4H2AA 4US9A 1XPUA 4JX1C 2RA4A 2JT4B 3ZNZB 5IN7A 4HIKA 2M00A 2MPMA 4APVA 4IWQA 3AMZA 1V8CA 3X23A 3PUVA 2WIIB 3TN2A 1CQVA 1W2BA 3TEWA 3K59A 1H9MA 2B63G 2BS4B 4LF5L 3Q8BA 1PFSA 2WAQG 1N32Q 1K51A 1WE7A 1SE8A 5IGEA 3FEWX 3PO2G 4IKGA 1STBA 1VQ4A 2R93G 5HHDG 1WZ0A 3I8ZA 1TT2A 2RQXA 1NI2A 3MXPA 3PQIA 3RR5A 3PIO3 2INPE 1QB5D 5FJ8H 3MC8A 2C35B 3Q3MC 4O2DA 3PHWB 2VXWA 1WWTA 3I70A 3I4NG 1Q7YC 3GTLB 1FIQA 1L0VB 2N7EA 2LXCA 4X62L 4IWPA 3RZWC 2MSED 5G5HA 2Z0DB 3UDXA 1UF0A 4EUTA 4W9FA 2KECA 3PSIA 4DFAA 1TT5B 3NP8A 1GUSA 3DBLB 4ZK9B 1PMRA 2LZ6A 1J7BA 3A4RA 3ITPA 2ZTDA 1GJXA 3KLSA 5IP7H 4B9KA 1HTQA 2UYZB 4BOSC 2RSUA 2WXMA 3W1SC 2ZTEA 4AQYL 1EU3A 1VDZA 4LJPB 4X62Q 5IYBH 4KY6A 3M62B 2D9UA 3CCVA 1MVKA 2KVZA 4OVUA 1T5XD 3D4RA 4DV7L 1VQOA 1WY8A 2RSOA 2KJHB 3L54A 4OWWB 2GLSA 2AKWB 4K6DA 3MJWA 3ENEA 3W1YA 1G2SA 1J9OA 3NS1A 2A6HC 4TSSA 2HCIA 1MHWC 2I5HA 3CSTA 3VDZA 2DY7A 3PF4A 1E7UA 3HVZA 2MBHA 2Z4HA 1VQ5A 3JSVB 1NDDA 5M3FB 3HKZG 3Q8EA 4A3MB 1PYSB 1EUVB 2PKOA 2HDMA 4JE3B 2A68D 1WM3A 5IAAC 4GNXC 1C48A 2REXA 3TREA 3EFXD 2GI9A 3I73A 3KUPA 4GXBA 4QAYA 1OO9B 4HTHA 4IO9A 3R3MA 1IW7D 2PJHA 2W9NA 3MFYA 4JI8L 1OTCA 3HOXB 2N4FA 5FLXE 2G9HD 4ZRJA 4ABNA 2D3BA 3GTJH 3PUXA 2PQAB 2Z1CA 4ANVA 1BBWA 2R92B 5EPLA 5HFYA 3SGIA 2O2VA 5AZGA 2DUDA 5EPKA 4GLAC 3U50C 4MTNA 1EEFD 1RCVD 3H6MA 1OQRA 4ICVA 4A93B 1PFMA 1ZKOA 2E2HB 3DEOA 4RG1A 1MSGA 5FOBB 1SNCA 4DN4M 2ZCBA 3DBRB 3ONSA 1LO5D 5AZHA 2KTRA 2RD0A 1CKNB 1TQOA 1UH6A 4EQ5A 2F0WA 4XGAB 3Q3OC 2JVCA 1XX8A 1SNQA 1VQ9A 3HK0A 1NBFC 4ZAIA 3CQZB 3TEHB 3IVFA 1DOMA 2KANA 1JOQA 4RH6A 4WJOA 2I1JA 1NR4A 3DM3A 5IGGA 4OHJA 1JQ4A 4GDLA 2JRHA 1SYFA 1N34L 1L4ZB 2JYTA 1X3EA 3K6OA 2NBUA 4N8FA 5JXVA 1IXRA 1AN8A 1RJTA 1WF9A 5AUKA 1A3VA 1Q1BA 4EQPA 1D2BA 2KT7A 4HJ8A 1IBLQ 2OQKA 5JPNC 2D10A 4F7ZA 1BCPD 3RD2A 3SDLC 3W5UB 4GB9A 3FP9A 4JI0L 2INDC 1OTRB 2KEDA 3H91A 1TXYA 1BOSA 2V4LA 4NW2A 3I55A 3GTQB 2FE8A 4WJ4A 2B2VA 5C3WA 3HEJA 5FLXc 1C3TA 4IFDJ 2MEKA 5KGUA 4H02A 2WU2B 4B0MA 3X3NA 3EHVA 1KQSA 2H89B 2KWCA 3P63A 1E8WA 3ZGZA 5IT9E 1H4RA 1X6OA 3MFGA 2N1VA 2NN6H 1I4QA 5IP4D 3DCGA 1JJ2A 2DHZA 4JI0Q 2ZW1A 4II2B 2E8GA 1YX5B 1S5DD 2X69A 3Q24A 1J7AA 3H94A 2D2CC 3H3VI 4KN7C 2L0FA 5HKHA 1UEBA 2C5LC 1MJDA 2WLBA 4R3DA 2OQ0A 3E9IA 2FXQA 1N60A 3OWFA 3RLNA 2EYHA 2C9WB 4BY1G 5CV8A 1QOGA 3ZTCA 1OXUA 1G6JA 1TZOA 2XNAC 4XT3B 2HHHQ 2JPHA 2JA9A 3BYTB 3KYDD 4JGHB 1OXTA 4EFOA 2BVCA 1WR6E 2LJIA 4W9DA 1AE2A 2HD3A 4J1MA 1U4MA 4LK1C 3E0JA 4A3GH 3H7SA 2MQHA 2KDEB 2GBKA 3NZ3A 1HUMA 4HDQA 5M5WH 3MEHA 1XLNA 2CW0D 1I6HB 1F2MA 4JV5L 1KJTA 1LTRD 3AFQA 4FBJB 4B3RQ 1I5FA 3NUHB 5AUIA 2L0TA 3EIVA 3UQAA 3CXCA 5M3FG 4C3IB 2J7ZA 2N0SB 3RFZB 1ILQA 1LLRD 1W3SA 4UY8C 1O80A 2KK8A 3KLRA 2E3TA 1RM6C 5DLQE 5IT9c 3S2HH 2HQLA 1P16A 3C0RB 1WGHA 4FXGC 5DM63 2SOBA 2J0KA 2Q8IB 2B2UA 4ZKCB 2YU9B 1SYCA 2HQEA 2KOLA 4C3JG 1H9KA 4BXXH 4GDKB 1FNVA 4A3JH 2UUAL 4WJ3M 1SAPA 4JWSC 4TV3A 3RNGC 1TZ1A 3KF6A 1RKNA 2NMQA 1CA6A 3M95A 4G50A 4HCPB 2JSVX 4OW0A 3V60A 4C1NI 4GNXB 4JQWC 4P75A 2LFNA 4FVMA 2B29A 1Q8KA 3OW7A 2IHEA 2J0JA 1E24A 1WGDA 4NJ7A 3V6EB 4DAVA 3H3VC 2KXJA 1I35A 1G2TA 4TQ0A 2NTSA 3A55A 1A63A 4K3BA 3N9YC 4PZ8A 2IWHA 3AH7A 3HOVB 3HM3A 3S1QH 4HN7A 4UP9A 2B2WC 4HEDA 4TQUS 1ROEA 1S3SG 2JRIB 3UIOB 4M8AA 4DXFA 1PZJD 1WTWA 4BFRA 4GLXA 3I7FA 1X55A 2LMCB 3VYSA 1E3PA 3CCEA 1E1TA 2C9OA 4JOIA 3FKIH 2NVYB 4C3HB 2I5LX 5EQ0A 4ME3A 3I4MH 4C2MB 5KEEA 2JF5A 2F4IA 2Z59B 3GO5A 3GTPB 2K6DB 2R7DA 4JVZA 3OSOA 3R3OA 2AL3A 1B2TA 1B3QA 1PHJA 4KTAA 3RNFC 1SMXA 2G5DA 2L7RA 5ELCA 5G5GA 3SR6A 1E10A 3T56B 5GAEC 4M00A 1L2FA 5C44B 2JQOA 3MAQA 3TQYA 1ESRA 1NENB 4FF4A 1UWVA 3D6CA 4EVOA 4MIUA 3EECA 3ML9A 3T13A 1D6EC 1Y1VB 2BDNA 3NSWA 2RCNA 4GKKL 4DR4L 3ZUNA 2KWDA 2LVQA 2R2QA 5KNDA 1DZ1A 3PIP3 5LMNW 3Q8FA 5LMNL 2A8VA 1ENAA 2XK5B 4XE0A 2WB1B 1B7YB 2CWPA 2N1WA 4URKA 4A20A 2MBOA 1SNPA 4AYBE 1VCBA 2RPVA 2FINB 2KLCA 1IYFA 2W54A 1D5XC 3M4OB 4A3KB 2MBEA 3U58A 1AFPA 4GKKQ 1FVIA 4DR4Q 4MSMB 4UP8A 2JA8B 2N9XA 3U4EG 4NDXA 3GZNB 1X3QA 4DK1A 1YI2A 4W9HA 4HEA1 5LMNQ 1U0LA 4NKLA 4N9F4 4DV5L 3I4MG 1GPXA 4ME5A 2QKIC 4DHZB 4REZA 2EYOA 4BOZB 4IUMB 2PQAA 3BYYB 2R7ZH 3S17H 3KWLA 2MA9B 1TY2A 4X66L 2MRPA 3Q3JA 1Y1WG 4BBNC 3ZVVA 1R4MI 1MI0A 2ZXPA 1KABA 3H15A 4B6WA 1PFDA 5IYDG 5AJ3Q 1V5OA 2JA7B 2L9HA 1BUIC 2PO4A 1FNWA 3VXWA 2V1CC 2NBFA 2CHXA 1WGKA 1CKNA 1F2RC 3EJIA 4C3IG 3FAHA 3I9V1 5C2TB 1NSNS 1PYBA 3E3XA 3E9SA 2KN4A 3AE3B 2B8GA 1V86A 3JVZX 1SN8A 1YJNA 2IO0B 1VQDA 3WA0A 2L00B 3DMUA 1FXIA 1FGBD 2I0QA 3EA6A 3MXNB 2WX1A 5KHQA 1KDCA 5A35A 3U4VA 2A68C 3FPUB 5JEAJ 1PH1A 4BBSG 1YQ4B 1I4RA 5TSSA 1Y69U 1Q86C 3AV8A 4IUPA 4KLKA 3UQBA 3F8TA 4J3OD 3WAPA 5C4ZA 4POGA 3ULLA 1P1AA 5D7GA 1C4AA 1PRTD 2WXRA 5C23A 1IW7C 5LMUL 1GO3E 3PLUA 2I5MX 4P16A 4DR1L 4GZYC 3QX1A 2LS01 3KVFB 2A1AA 1YBYA 2JSOA 1E9MA 1WXQA 1TWHH 3KDFB 4LDTB 3ZYYX 3ND8A 5C5LA 4A3EB 3E9HA 2Q2UA 2XSCA 1O7YA 3B2FA 4A3DH 1CI3M 4RF0A 4II3B 4LFCL 3ZO5B 1VQNA 1PTOD 2D3GA 1HZ9A 4K0KQ 3HOZG 2BB5A 1MJCA 4CKCA 4C3HG 1LUZA 1WM2A 4XDCA 4DXAB 3HKZE 3PUYA 2IW3A 5FLXL 3W1GA 2OT2A 1HCZA 3NTHA 2L83A 2PVGC 4FN2A 4BA1I 3SD5A 2VNUD 2NYZD 4BKSA 2AQ3B 2VH2A 4A3FH 4LK0M 1KXLA 3S2DB 3JYUA 1Y8RC 1EYDA 2AMCB 2EKIA 3K7UC 4K6LA 1H9SB 2BKFA 2K6QA 3PUWA 4LFCQ 3KUZA 1LT5D 1VQEA 1BDOA 2O5JC 4Q2JA 4A3BB 1XNQL 2N7DA 1Y1VG 1HUNA 2Q8TA 5I2XA 2NVQB 4NQLB 5J17A 5JJIA 4FF2A 1BCPC 1TR5A 4Y52H 1YVCA 4FDBA 1JROA 4WJNA 3TUOA 3U2SC 1XMQL 4ODGA 3GV6A 1ZXTA 3TDQA 1ICWA 1N63A 3NBHB 4LF6L 3I3CA 3W1SA 5I6YA 1U4LA 1WI5A 3N20C 1UE1A 2GBNA 4XX5A 3RN5A 1N5WA 1EQRA 3PZ8A 4RM9A 1RDPD 2KUMA 2OHFA 3CF6E 3MHSD 4A3KG 1NCVA 2VUMH 1P9DU 4B08A 2C7MB 2K5DA 2JA6B 3S1MB 4KVGB 4C7YA 4DK0A 3A9JB 4KX6B 1FFVA 2CH4A 2QDLA 2EYJA 3NY5A 3IAM1 4Z9CB 1H9JA 4LF8L 1SNMA 1EZ8A 2FAZA 2CWAA 4R4IA 3D31A 4GDKA 4LF6Q 4XYCA 2EE1A 2AQ2B 2KHWB 4KD3A 3HRZC 4JG2A 2OTLA 1WRIA 2NTTA 1ICFB 4GNXA 3RPFC 2Q2IA 1SEBD 4F88A 5J18A 2CHBD 5IT9L 3PCOB 3ULPA 4DXGA 2WXFA 1NTGA 4HCSA 5C0XJ 4LJOB 5G2NA 3MTSA 1IBKQ 2JA5B 2B2YC 1FXTB 5BMHA 4FHJA 2VY3A 2HTHA 1C0AA 2PVOD 3IT6B 1A2UA 2B8FA 4KJOA 3WOFA 4DWFA 4IFDH 3O13A 3NVVA 3OIPA 4AYBB 3QC8B 1A3UA 1YJWA 2QMTA 1HZAA 3F2BA 1KRSA 3P4RB 4WH4A 2RBMA 4E3CA 2JA7G 1V6EA 4I6PA 2BQQA 3T9LA 1T0SC 4DV4L 1WX7A 2B2UC 2Z6BA 1EWCA 2DLBA 3ICEA 2CW0C 1RD9D 2LMCA 2BKRB 4KHPL 3V62A 1AWDA 2E5LQ 2QEJC 2WU5B 3M3YB 3T1HQ 4W9JA 2NCNA 5CV6A 3PGEA 4P1BC 4GLVB 5IYCH 3AEBB 1R4PB 2QDBA 3AE8B 3U52E 2JN4A 4AOFA 4WWNA 3P42A 1VQJA 3VRAB 1VF7A 4HROA 3NHEB 2FCNA 3PRZA 3R66C 5LL6S 2MNAA 1N61A 2HIXA 4MTKA 2VUMG 1T0YA 4DR5Q 1BNZA 4OONA 5JOBA 1HZ6A 4JI3L 1G51A 2NN6I 4JL9A 1HJPA 3E6ZX 1S72A 4HK2A 4KHPQ 4HJ5A 2IGHA 1K83H 5D3IB 3CCUA 1G91A 1SYBA 2CFMA 3DVNV 1VQ6A 5IY0A 5I6WA 4ZRIA 1QF6A 4W9GA 3GD7A 2B63B 3I2ZA 1HE8A 1VJKA 2XK5A 1Q1EA 1AE3A 3IRBA 4Y7NB 3BK2A 2WAQB 1TWGH 1SFOB 4LTUA 4LUOA 4MZ9A 1GUTA 4OO1H 5CHFA 2K28A 3CRLC 2F3IA 4LJZC 1QOAA 3GQBA 3I91A 2BOSA 1JWSD 1VDVA 1AZPA 1D7QA 3BK1A 2KWUB 4IFDG 3UE0A 4A3IH 3CIRB 1WCMH 1S3OA 2IX3A 1ONLA 5J22A 3I4NB 1TJEA 1JWUD 4KV6A 5C3EH 3H8HA 2ZNVC 1K28A 2F0MA 2MCNB 1CTMA 4XZ4A 2B76B 3HKSA 4ZHPA 2AX5A 2DAFA 3HVDA 2KCCA 3CWIA 1ZP0B 4F1SA 2EOTA 1N62A 3GTOB 3CCSA 1UZXB 4LF9L 1YJ9A 1HA6A 2IY0B 2B39A 4AS1A 2MO1A 1EIYB 1K50A 1WR1A 2UU7A 4KKIA 2ZM6L 4MT5A 2ENBA 4C80A 1VQPA 4A3BG 1KOTA 1J7CA 1HFGA 4WWOA 2J4XA 4I65A 1MHXA 3R8BA 1V5TA 5GMVA 4RCOA 2KTFA 3TSSA 2E2JH 1OQYA 2V4DA 4P1CC 2DWQA 2QJLA 4ASWC
chains in the Genus database with same CATH topology
4US8A 2IPKD 5FKAC 4A90A 3AE9B 2EYFA 4BA2I 3DUZA 3DWAA 1BCPB 3HKZB 3J9CA 2HDEA 2ICIA 2MJ3A 2LKVA 3A7LA 1MBYA 1U9RA 3SE0A 1WTOA 1WTPA 4QF4A 1IL8A 1GUWA 1E0BA 2CJOA 3MHBA 3MXNA 5C5MA 1A2TA 3OHXC 1FD7D 3MWYW 2IGDA 3VA5A 4E6IA 4IZ8A 1F77A 3P4PB 4QB4A 1BR9A 2W3SA 1ENFA 2JEAI 3SDZA 3IL8A 2F0KA 1A6XA 3VQIA 1U4PA 4WFN3 5T1IA 5LHY1 3AE1B 1SSOA 3X3MA 2K0PA 1F9QA 2E74C 1XLQA 4X3UA 1GUGA 3PUZA 3NQTA 2GRIA 1HQMC 3SFEB 4KHVA 2R61A 2EZVA 1EY4A 4MHEA 1B9NA 1D5ZC 1L0XB 2RDHA 1GHJA 3Q8AA 4PMBA 4ZOHC 5FK9C 1IYUA 1H9SA 4C56C 1EY9A 3BS1A 2OF1A 2WXGA 1O7LA 3U7ZA 1UAPA 2WDRB 4QIWB 4LMQD 5CBAE 5KYIA 1PRTC 4EE2A 3NBHA 3GTJB 5ELEA 3NK9A 4N58A 2CQAA 3J7AF 1VCIA 2JYOA 2QSDA 2WQYB 4DGZA 1PTOC 5IGCA 4P2CB 2PTLA 1QJOA 3AMUA 3RZOB 5JEAH 1BMLC 4YWGG 1EU4A 4J8QA 1HA5A 4BY1B 1L5PA 5JVG3 1TY0A 1ZPSA 5LL6X 1C77A 4TMAB 1SBBB 3ETRA 4P6VF 1B44D 1FCCC 1K8OA 2XVSA 3BVZA 2WXIA 5FR3A 1A3TA 1XLPA 2K5WA 3I72A 2EELA 3OWEB 3TP8A 3L4PA 3TP6A 4RAUC 4HJGE 1A15A 3TEXA 1L6UA 2FMMA 4FNFA 2KAJA 1C4QA 4PMCA 1V8QA 5EKKA 2PW9A 1SE2A 2WP9B 5D14A 1OFFA 2L52A 4NAWB 4NJCA 4C3JB 1GB1A 3RUZA 2NB0A 1JCKB 1TKYA 2G9DA 1FRRA 2ZXOA 5CBEE 2L12A 2A74C 4XIGS 3NTIA 4K5VA 4DU9A 1DONA 1LT4D 1FD6A 3JAML 1BUVT 1PFBA 1YJJA 4X3KA 2YEPB 4H7BA 1KLUD 4KI0A 1CJEA 2F0HA 3A8KE 4K14A 5ISRA 4A3GB 2AQ1B 3C3LA 1XTCD 4YXDB 2CVRA 4G4KA 5ELBA 4G7ZC 1F9RA 4UAIA 5BYQA 2WKDA 3C1EA 5CV5A 3SK8A 2SAKA 3N6RA 3QG1A 3VR2A 1XWEA 3B9JA 3PV0A 4N59A 3A8JE 4LLGM 3D3RA 1XCTL 2DY8A 4ARIA 4EQNA 3BZDB 5CYUA 2F0NA 2KQ4X 3P75A 2BB6A 2HTME 1ZYRD 3VYRA 5M5XB 4ZUIA 2V0GA 5C0XH 3S16B 1R4QB 1QE6A 1QT9A 2XWBB 1MD2D 4RWSC 4A55A 1BF4A 5DM73 5M5YB 4F8MA 1YMHE 3K57A 1ZDVA 1Y8NB 1Q3LA 3MVVA 4R8IA 1I7HA 1MSHA 3AEGB 3S1QB 1PRTB 2A5HA 3OOCA 4CQNA 4PQXA 2W55A 4IFDI 4BWGB 3BWUD 1RTNA 1ESFA 3FKIB 3NRZA 3I4MB 4WJWA 4OGQC 2PIAA 2AWNA 1QOBA 1PTOB 5EPJA 2L1AA 2LHDA 2J53A 1PGXA 5CV4A 2WXPA 1GAQB 1I4GA 3P4QB 2IX0A 1Y1WB 4JBWA 4KGSA 5BMGA 3E5SA 2WXLA 3SFDB 1O78A 2JE6I 1F9SA 2B2YA 2K01A 2BS2B 1RWSA 4KN4C 2KDMA 1ACCA 1KNEA 2C5CA 3URYA 1JB3A 1ZUD2 3NHHA 1PGAA 5EE9A 1EEID 2NN6G 4BBSB 4XWWA 3N52A 3S9WA 1HRJA 4OO1I 3HS0C 1D4BA 4N9TA 3DWMA 2VZKD 1J8IA 1EL0A 3ONAB 3K0YA 4L6TB 2DN8A 2NUCA 1NAPA 1ET6A 1C4CA 1HQRD 3S17B 5EKLA 4O1NA 1E0ZA 4H13C 1VZ8A 1OQQA 5C3JB 1CHQD 3SK6A 3HOZB 3AEEB 4OL7A 1HHVA 4QUFA 3VYUA 4ULLA 2M9VA 3QIAA 4NAMA 2BT6A 3U9OA 5BMIA 4XQNA 3AE6B 3J80E 1LACA 2JXTA 4CHTB 2TSSA 1VMCA 4L2YA 2QCPX 2N55A 2K32A 3NTKA 4RGNA 2Y5CA 4KMUC 3K5LA 3I4LA 4PNYA 4KKTA 1B50A 3LXFA 5FO8B 1AW7A 1STYA 1W6JA 2EJMA 1FM0D 3MZ5A 5G3LD 4M0WA 1BBXC 3K5OA 1FYCA 2F0IA 1ML0D 1FR3A 2FMCA 1E2VA 2WXKA 3QOJA 1JW9D 2WXNA 4IALA 5ELFA 3EQLC 4K8IA 4B0EA 3L3OC 2K5QA 3VR4A 1KLGD 2F0JA 2PQEA 2O4XA 4RGTA 2AWOA 2M0AA 3MXUA 1M8AA 4A3DB 2RMMA 1DD2A 4K5XA 5HGTA 1LTBD 1C78A 1QOHA 3DWGC 3W3AA 3PO0A 5CR3A 1E7PB 2BW2A 3AB9A 4A3FB 2L55A 1IUEA 4HSVA 4QMGA 1LTAD 4XYQA 3DHQA 4HKZE 4WRDA 3L7ZC 4DAYA 1DCZA 4MH8A 1EWYC 4R9WA 1TS2A 2ZXRA 2K04A 2DNEA 1SF0A 2KEEA 4U673 2VUMB 3A54A 2RDFA 4XWTA 2O2LD 3V05A 4CJ1B 2FBWB 1GOZA 2ACZB 2WACA 2Q8RE 4U68A 3VR6A 4G7OC 3CU7A 3GV3A 3CHBD 4HKQA 2PCFB 1S5CD 1YJIA 1EQTA 1AZQA 3NUCA 3Q8CA 4XDDA 5CC4A 2E6XA 1IBXB 3M4YA 2EYLA 1UNSA 5KRUA 2A69D 2JX5A 3ND9A 4K5WA 4DA2A 2F0VA 5BN3A 4DAPA 3KK7A 4MACA 3S14B 1QNUA 3AEFB 5JJZA 2NWGA 3SXHA 3FILB 2K1BA 1JOKA 1PZID 2IX1A 1EY0A 4FXCA 5F2DA 5IGBA 2WKCA 4IUTA 1K8MA 1XEEA 2XWJB 1MI2A 1ZYRC 5CV7A 2KA7A 2IGGA 1ILPA 5EJWA 4RKLA 4D2KA 1TIID 3TZDA 3P7JA 4OVZA 1WSPA 4HRSA 1K83B 1NVID 1EWHA 4PMWA 2N88A 3EUB2 1MHHE 3K58A 2RVLA 1TWGB 2IL8A 5T1GA 4MM3B 4AQ7A 2JEBI 5EE3A 2EXZA 2XIWA 4Q5VA 2W82A 1VLBA 4IDIA 3ZQ4A 4A3IB 4YTNB 2F0SA 3C8YA 5C3EB 1Y56A 4X3SA 1FMAD 1LT6D 5DAUA 1I6VC 1CA5A 4C1NK 1LABA 1V43A 1KH0A 1CZGA 4Q0FA 1F2LA 3AE2B 3W5VB 1HTLD 1O7ZA 1STHA 1ZDXA 1KNAA 5H8YE 1BCPF 3GS2A 2I46A 3AN1A 5T8IA 2E2JB 4JPSA 4PV1C 4OZAA 1EZ6A 1VZ7A 2LFIA 3DM1A 3EGRA 3ERQA 5C0XI 2VB2X 4KKJA 4HMIA 1Y8OB 1DOYA 1S5FD 2M56B 3WOEA 4RGMA 5CGKA 1STAA 2E75C 4EQOA 5JVH3 4HMJA 5HURA 1C4PA 1OXSC 3J7YW 1B1ZA 3TMEA 2RKSA 1SJHD 5I9OA 2XRSD 1TU2B 5IGDA 3WCQA 2PPBC 1KFYB 3D4DA 1HXYD 4QUCA 3ABVB 1PGBA 3S15B 3FVQA 3MC0B 2EY2A 5LNK1 1LTGD 1DXMA 4XT1B 5M3MB 1T3QA 3NVYA 3T51B 2A6ED 1EY6A 3R93A 3MA2B 1SYDA 2L5TA 1JWAD 3PO3B 3DWPA 1YNTE 1EY7A 1SJED 3Q22A 1QLBB 2BTEA 5C4XB 3SR1A 2F0QA 3MHZA 4USAA 3OMGA 2I38A 4BBRB 3GTMB 4IUQA 1NR2A 4N9PA 5NUCA 3HOWB 2DBYA 2PYKA 4XQQA 1PDXA 3DXJC 2MJEA 4CBVA 1QWYA 1L4DB 5H92C 2KVMA 2WNMA 2V4IB 1JICA 1JOOA 3J80L 1TWFB 1SE3A 1SSNA 2BE5D 4IUNA 1B3AA 1WYGA 1ENCA 1DOLA 1RFKA 5I4DA 2K9XA 1I4XA 1P7FA 2L11A 4TRDA 4IOIE 4OO1G 4WQMA 3AE4B 1NUCA 1YQ3B 4B9XA 2EJFC 5E4WC 1D1KA 3AU7A 5K5PA 3EROA 1AEXA 4CJ2C 2EJGC 2F03A 4OIKA 1RODA 4WAFA 2L4NA 1V1PB 3C46A 2HDLA 1TS4A 1YN5A 1EQVA 1XXGA 2ON8A 4RCNA 2KMMA 1JWBD 1WTRA 4L63B 3Q69A 2X6LA 3P20A 1N5XA 1IBXA 1C76A 4TKOB 5D65A 1BXTA 4NZLB 1BQQT 1OXVA 2EYPA 3PMFA 2ZW0A 4IN3A 4F7XA 2L0CA 1QKZA 3IAS1 2WXOA 2Z8LA 3FILA 2Q5WD 4XTCS 5A2QE 2H4OA 3QJYA 1WTQA 2FUG1 4OIJA 3AEAB 4RHRA 2EYMA 1SMYD 1UWMA 2Y3AA 1KF6B 2R6GA 2K3UA 4KHZA 3M85A 2RDGA 2YEPF 1QNKA 1C8CA 1JE4A 1VF5C 1TKWB 3AECB 1UUPA 5K36H 2ID0A 4KY5A 3T4AC 2VZKB 1ZXIA 1QG7A 5GXGB 2QF7A 4RA8A 2WDQB 3P1MA 1GXDC 3MP9A 5E3FA 1L6VA 4EGVA 5J39A 1IYVA 2A69C 4HSPA 2K6AA 2K5PA 5CORA 1LV9A 1G6ZA 3VR3A 1JC7A 2CU3A 3HG9A 3IFTA 1Q12A 1IGDA 1WTVA 2ZT9C 4KGTA 1EOTA 2SNSA 1SYGA 2MJDA 3QO2A 1TS3A 4ZRQA 2H88B 2J52A 3IXSA 1LT3D 3C2PA 3QWNA 4RF1A 1I50B 1HFNA 3J81E 2XRQD 4K8JA 2PZUA 1II3A 1TVXA 4CKBA 1WVLA 1PRTF 4RNAA 3IKJA 2V3PA 1G291 4H0LC 4ZKBB 5C6AA 1PLFA 5K36G 2SNMA 5DEHA 1PZKD 5JAVA 2K33A 3LB8C 3KBGA 5DNFA 3WDNA 1GHKA 3HRDD 1PTOF 1X32A 1K53A 1SYEA 1MPEA 5EBDA 1DOIA 1XYIA 4ZLTF 3VR8B 5IODA 2D5DA 5JEAG 4MN3A 4V0BA 1XCQL 1R7SA 2VB3X 1DJRD 3P1HA 3Q0AA 1CZPA 1DM0B 2G1EA 2F0TA 4G57A 1Z7TA 2JZPA 4ZRZA 5M5WB 2F0UA 3T53B 2LGIA 1TS5A 2O5IC 4IUVA 3KBXA 5M9OA 4C7ZA 1VMPA 3M7GA 1UEAB 3D4WA 3SHLA 1B53A 3FRPB 3S2HB 1H9RA 2KCNA 2L1BA 2IJ0A 1CT1D 5AFWA 5EE1A 4K2KA 1FEHA 1I4PA 2I2YA 1YNND 3TP7A 4A3JB 1QQRA 3BVMA 3FC4A 4V190 5E6JA 4M1UB 2F3WA 2L32A 2HCCA 4ZHOA 1TKGA 3TP5A 2WP8J 1CFMA 3A56A 3D8GA 2JWUA 4KK7A 1XO3A 4QCLA 3TEZA 2F0LA 2LUMA 2PMVA 2WXQA 4OZCA 2JU6X 1PUTA 1KTKA 3VR5A 2M19A 1GUNA 1YN4A 2BS3B 1B9MA 1F9PA 3KLSX 2KQ3A 2A6EC 4ZQ3A 1AYFA 2CJNA 2IDYA 1SB3C 1EY5A 1PDQA 2TMPA 3BDOA 4CKEA 2K7VA 5IGFA 2E76C 3AE7B 1HPCA 2MUYA 1TYGB 5ELDA 4YSXB 3AM9A 3T3OA 1V1PA 1YNJD 2BYTA 1E2ZA 4WWMA 1RF2D 3FPPA 2JXMB 1Z47A 4LAAA 1JMLA 5C0XG 4YIJA 1L0YB 1UWXA 2F1MA 3FDTA 3S1RB 4CJ0B 2Y0SB 1QOFA 2INNE 5I9PA 1FFUA 1JRPA 2PLPA 1FO4A 5KIXA 1RYJA 3NWTA 2BE5C 3M7NA 1WD0A 4KD4A 1GB4A 3GB1A 4XQJA 3K5MA 5J1ZA 4TQ1A 4YSZB 3NQIA 4H44C 2KHSA 3HOUB 2BA0A 4KJNA 4RKBA 2KACA 2YYZA 4RHSA 2E2DC 3VYTA 2B2TA 3SK4A 5BN4A 5HG2A 4DNRB 1PXUA 2R7ZB 3L9AX 2FJ2A 3RZDB 1E2WA 2E2IB 1OXXK 4A6QA 3AEDB 5E4XA 4XYOA 1WTXA 2BCOA 4WIPA 2X6GA 3QOLA 3R2TA 5COYA 2MHVA 1TKEA 3NXWA 4DF7A 2FHTA 3LWEA 3BG3A 2NVXB 5C4HA 1RHPA 3GP7A 1Q8IA 1EIHA 1NEKB 4ZYSA 4KKSA 1KRHA 4B9WA 1V1OA 1SXTA 1PTOH 2PW5A 1DOXA 3ZJUA 1SMYC 2D62A 3RLFA 3LWUA 2EVBA 2WXJA 4DNTB 1AP0A 4RFBA 1JWMD 1ET9A 1I3QB 5KNCA 1F2RI 4YTMB 1TWHB 3A7AB 5A2QL 1EYCA 2WINB 1JORA 4HAEA 1SNOA 1ZXHA 4S3SA 4IQZA 2K05A 1PYWD 2DNCA 3DWQA 1FXAA 1STNA 1NYRA 4ARCA 2LHEA 1IGCA 5FO7B 4A9AA 3BVGA 3AB5A 3PZ7A 3T3NA 4L23A 2MGSA 2JYEA 2X38A 4FYDA 3V2TA 1HEZE 1SNDA 3HGBA 2N9LA 5FO9B 1DGJA 3G6JB 3BIID 5I2YA 1EY8A 1HTPA 5KYLA 2QILA 3IT4B 3K7AB 1STGA 4K2LA 3NPPA 4JK1C 3E56A 1R9TB 3QB3A 3J81L 1X3PA 3GTKB 1CQFA 4IURA 1T6BX 3RD4A 5JPMC 4L1BA 4YTPB 1FNUA 1E6EB 5D3DA 2PW7A 4FO2A 1D1IA 3I90A 1PFNA 2ICEC 2F0GA 2XN9C 3OMCA 2GB1A 2WS3B 3NBIA 4WURA 1ZOYB 3VA7A 3MJ5A 4X3TA 4FF3A 1W6KA 3A8IE 2ONQA 4L8JA 3SK5A 1B4OA 1EFID 4JWUC 2EPBA 4O42A 2OXPA 4FF1A 3P42A 1IKLA 1EIGA 2WXHA 3HUIA 2F0FA 1U4RA 3F2UA 3R2IA 2WV6D 1D5MC 1V97A 2FFKB 1CHPD 2EY1A 3KWVA 3LNNA 2N9KA 1YNNC 4RGOS 1G8ZD 4J6HA 2BBCA 1S5BD 2IT1A 2B2VC 4ZRPA 3T16A 2F0DA 5BN5A 1SDFA 1DYQA 4XXEA 1Y8PB 4PT5A 3NVZA 2PMZB 4F87A 2OEDA 2RSNA 1F0ZA 3UI2A 3H0GB 2A6HD 2K03A 3DEPA 1S5ED 5CV9A 4IUUA 4I7ZC 1Z6HA 4KKUA 1WCMB 3HOYB 2Z4IA 3BDCA 3TBIB 2N7JA 3TZUA 5HI1A 4G7HC 3GTGB 4A8XC 1LTTD 4ZUJA 3JAME 4XDXA 2R3ZA 2DYMA 4CGYB 1CK1A 2SDFA 4ITKA 2F3VA 3J7AV 1C9FA 1YNJC 2KJXA 3KQ4A 2MJ8A 2J42A 1FRDA 4FXDA 2M2LA 4NP5A 1BO0A 3OIQA 1A70A 1C79A 1KDAA 5BYSA 3Q23A 5MPOA 5KNBA 1RTOA 5C4JB 3CKIB 4NMZA 3UI3A 2MP1A 4ILWA 2B2TC 2J0TD 1LTSD 2GA4B 2EDGA 4DQOC 4ID6A 2F0OA 1LTID 1T5EA 1QCBD 2BDOA 3SEBA 1MGSA 1Q90A 2H1EA 3W9CB 5IOCA 5EKIA 1XF5L 4YT0B 3B2GA 3V96A 2AUKA 3U9SA 2F0PA 1KAAA 3VRBB 3LYYA 3P4SB 2BA1A 2V3NA 2JP1A 3NE5B 4BY7B 3W2DA 5EBCA 2QIEB 1NYQA 1JR0D 2JQRB 3I57A 4FXKC 2PZTA 4R8NA 3PO2B 2R93B 1VZ6A 5EE0A 1Q10A 2Y5PA 1UGJA 3C1FA 1WD1A 1KDBA 5EGTA 3RMHA 4BS9A 2LY7A 5C3XA 1M4VA 1VR9A 4UDUC 3HZXA 3G7LA 3MXGA 4GDLB 3NWSA 4HR7B 3NVWA 1XLOA 3ZJTA 3IFDA 2NVTB 4N6EB 4HCEA 2NZ1D 2W3RA 3H09A 1JQYD 1K52A 2EY6A 2SEBD 2K22A 1CZWA 5IIFA 1IKMA 3S1NB 2PZWA 2DYOA 3LX0A 1QILA 1IHZA 1I4HA 1TWAB 2MH7A 1JALA 2HUGA 3VR9B 1CM9A 1ZEQX 1NI3A 1EM7A 2OEOA 1SE4A 5CMDA 3OPOA 1STEA 1FCLA 3D6WA 2LEKA 1DOKA 1P7EA 1B9RA 1VRAB 2I07B 3IAYA 4WORA 2D5GA 3EVQA 3FMCA 5G3LF 3CRKC 2AUJD 2A73B 3K5NA 1GUOA 1TWCB 1YN3A 1S4ZA 3BDLA 3HP3A 4FP5D 2F0EA 2EY5A 4KGRA 5BYRA 3Q6SA 3AE5B 1ZE3D 2WDVB 3V3XA 2B2WA 3TEYA 3KF8A 1EYAA 2PNRC 4KY7A 1F2YA 3SVMA 4GLSC 1SIJA 1F2ZA 5E1FA 1HZ5A 4OZBA 4YSYB 4H2AA 4US9A 4JX1C 2RA4A 2M00A 2MPMA 3AMZA 1V8CA 3PUVA 2WIIB 3TN2A 1CQVA 3TEWA 3K59A 1H9MA 2BS4B 3Q8BA 1K51A 5IGEA 3FEWX 4IKGA 1STBA 5HHDG 3I8ZA 1TT2A 2RQXA 3MXPA 3PIO3 2INPE 1QB5D 2VXWA 1WWTA 3I70A 1FIQA 3GTLB 1L0VB 5G5HA 2KECA 4DFAA 3NP8A 1GUSA 4ZK9B 1PMRA 1J7BA 3ITPA 1GJXA 3KLSA 2WXMA 1EU3A 1VDZA 4KY6A 2D9UA 1MVKA 1T5XD 3D4RA 2RSOA 4K6DA 3ZJVA 1G2SA 1J9OA 3NS1A 2A6HC 4TSSA 2HCIA 2DY7A 3HVZA 2Z4HA 3Q8EA 5M3FB 4A3MB 2PKOA 2HDMA 4JE3B 2A68D 1C48A 3EFXD 2GI9A 3I73A 3KUPA 1OO9B 4HTHA 1IW7D 3MFYA 3HOXB 5FLXE 2G9HD 4ABNA 3PUXA 2Z1CA 2R92B 5EPLA 5HFYA 5EPKA 1EEFD 1RCVD 3H6MA 1OQRA 4A93B 1PFMA 1ZKOA 2E2HB 3DEOA 1MSGA 5FOBB 1SNCA 4DN4M 1LO5D 1TQOA 2F0WA 1XX8A 1SNQA 4ZAIA 3CQZB 1DOMA 1JOQA 4RH6A 1NR4A 5IGGA 4OHJA 1JQ4A 1SYFA 1L4ZB 2JYTA 3K6OA 5JXVA 1AN8A 1RJTA 5AUKA 1A3VA 1Q1BA 4EQPA 1D2BA 5JPNC 1BCPD 3W5UB 2KEDA 3H91A 1BOSA 4NW2A 3GTQB 2FE8A 2B2VA 5C3WA 3HEJA 4IFDJ 2MEKA 5KGUA 4B0MA 2WU2B 3X3NA 2H89B 3P63A 3ZGZA 5IT9E 3MFGA 2NN6H 1I4QA 2ZW1A 1S5DD 2X69A 3Q24A 1J7AA 3H94A 2D2CC 4KN7C 2WLBA 4R3DA 1N60A 3OWFA 2EYHA 5CV8A 1QOGA 1OXUA 1TZOA 2XNAC 4XT3B 3BYTB 1OXTA 2LJIA 4LK1C 4J1MA 1U4MA 3E0JA 3NZ3A 1HUMA 3MEHA 1XLNA 2CW0D 1I6HB 1F2MA 1LTRD 3NUHB 5AUIA 4C3IB 2J7ZA 2N0SB 3RFZB 1ILQA 1LLRD 1O80A 3KLRA 2E3TA 1RM6C 4FXGC 5DM63 2SOBA 2Q8IB 2B2UA 4ZKCB 2YU9B 1SYCA 2HQEA 2KOLA 4C3JG 1H9KA 4GDKB 1FNVA 4JWSC 1SAPA 2NMQA 1RKNA 4OW0A 1CA6A 2JSVX 4C1NI 2LFNA 4FVMA 3OW7A 4DAVA 3H3VC 1G2TA 4TQ0A 2NTSA 3A55A 3N9YC 3AH7A 2IWHA 3HOVB 4HN7A 2B2WC 4HEDA 4TQUS 1ROEA 4M8AA 4DXFA 1PZJD 1WTWA 2LMCB 3VYSA 2C9OA 2NVYB 4C3HB 5EQ0A 4C2MB 5KEEA 2F4IA 3GO5A 3GTPB 3OSOA 3R3OA 1B2TA 4KTAA 5ELCA 5G5GA 3SR6A 1E10A 3T56B 5C44B 3MAQA 1ESRA 1NENB 4FF4A 3D6CA 4EVOA 4MIUA 3T13A 1D6EC 1Y1VB 2BDNA 3NSWA 2KWDA 5KNDA 1DZ1A 3PIP3 3Q8FA 4XE0A 1ENAA 2WB1B 1SNPA 2RPVA 2FINB 2W54A 1D5XC 3M4OB 4A3KB 1AFPA 2JA8B 3U4EG 4NDXA 1X3QA 4DK1A 4HEA1 4NKLA 1GPXA 4ME5A 2QKIC 4REZA 2EYOA 3BYYB 3KWLA 1TY2A 1MI0A 2ZXPA 1KABA 1PFDA 2JA7B 2L9HA 1BUIC 2PO4A 1FNWA 2NBFA 1WGKA 1F2RC 3EJIA 4C3IG 3FAHA 3I9V1 5C2TB 1NSNS 3E9SA 2KN4A 3AE3B 2B8GA 3DMUA 1FXIA 1FGBD 3EA6A 1KDCA 5A35A 2A68C 3FPUB 5JEAJ 1YQ4B 1I4RA 5TSSA 1Y69U 3AV8A 4IUPA 4J3OD 5C4ZA 5D7GA 1C4AA 1PRTD 2WXRA 1IW7C 4P16A 4GZYC 2LS01 2JSOA 1E9MA 1WXQA 3ZYYX 3ND8A 5C5LA 4A3EB 2XSCA 1O7YA 3B2FA 4RF0A 1CI3M 1PTOD 2BB5A 4CKCA 4C3HG 4XDCA 3PUYA 2IW3A 5FLXL 2OT2A 1HCZA 3NTHA 2L83A 2PVGC 4BA1I 2VNUD 2NYZD 2AQ3B 4LK0M 3S2DB 1EYDA 2EKIA 4K6LA 1H9SB 3PUWA 4Q2JA 1LT5D 2O5JC 1BDOA 4A3BB 1HUNA 2Q8TA 5I2XA 2NVQB 4FF2A 1BCPC 1TR5A 1JROA 3TUOA 3U2SC 4ODGA 3GV6A 1ZXTA 3TDQA 1ICWA 1N63A 3I3CA 3W1SA 5I6YA 1U4LA 1N5WA 3PZ8A 1RDPD 2KUMA 2OHFA 1NCVA 4B08A 2K5DA 2JA6B 3S1MB 4C7YA 4DK0A 4KX6B 1FFVA 2EYJA 3IAM1 4Z9CB 1H9JA 1SNMA 1EZ8A 3D31A 2EE1A 2AQ2B 4KD3A 3HRZC 1WRIA 2NTTA 3RPFC 1SEBD 4F88A 2CHBD 5IT9L 2WXFA 4DXGA 4HCSA 5C0XJ 3MTSA 2JA5B 2B2YC 5BMHA 2PVOD 3IT6B 1A2UA 2B8FA 4KJOA 3WOFA 4IFDH 3O13A 3NVVA 3OIPA 4AYBB 1A3UA 2QMTA 3P4RB 4WH4A 2RBMA 2B2UC 1EWCA 2DLBA 2LMCA 2CW0C 1RD9D 1AWDA 2WU5B 2QEJC 3M3YB 5CV6A 3AEBB 3U52E 1R4PB 2QDBA 3AE8B 3VRAB 1VF7A 4HROA 5LL6S 1N61A 1BNZA 5JOBA 1HZ6A 2NN6I 3E6ZX 2IGHA