2KC1A

Nmr structure of the f0 domain (residues 0-85) of the talin ferm domain
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
91
structure length
91
Chain Sequence
GIDPFTMVALSLKISIGNVVKTMQFEPSTMVYDACRMIRERIPEALAGPPNDFGLFLSDDDPKKGIWLEAGKALDYYMLRNGDTMEYRKKQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural protein
molecule keywords MKIAA1027 protein
publication title Structure of a double ubiquitin-like domain in the talin head: a role in integrin activation.
pubmed doi rcsb
source organism Mus musculus
total genus 22
structure length 91
sequence length 91
ec nomenclature
pdb deposition date 2008-12-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16511 FERM_f0 N-terminal or F0 domain of Talin-head FERM
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 2kc1A00
1A5RA 4EZKA 4KDIC 4NY0A 4W9JA 3VTWA 4EZLA 1YQBA 3PLVA 3PHXB 2L0FA 4I6NB 2FCMA 3VDZA 2OOBB 1WR1A 2KO3A 2XBBC 1V2YA 3JSVB 4WJQA 3AXCA 2JUOA 1X1MA 4ANUA 2FUHB 3DVGY 3PPAA 4GGQA 3ENEA 3NZSA 3PRPB 4FA6A 4W9GA 1J19A 3ZIMA 2V1YA 2NBWB 1CMXB 2KTFA 3L17A 3RCZA 3UQBA 5J18A 4M8NA 4I6LB 1WGGA 4PYZA 1GJZA 2MLBA 3ZLZA 5EDSA 1P9DU 1YIWA 2KNBA 2LUEA 3O65B 3V6EB 1E7UA 4DWFA 4J6IA 2JRHA 4EZJA 4NNJB 1LM8B 2K6QA 3ZTDA 3WAPA 3UF8A 1WJUA 3WANA 2CHZA 2LWPA 4JGHB 3Q3JA 4MDKE 2HD5B 3X23A 2ASQA 4EOYA 2KWUB 1WXVA 2DAJA 2MP2B 1OTRB 4NQKE 3PGEA 5CHFA 3A33B 2JVCA 2MA9B 3QA8A 2GBMA 2KWVB 2NPTB 1J0GA 3UINB 2N1WA 2IZVB 4K7SA 4BOSC 4RM8A 2AL6A 2AL3A 2FIDA 3R7RA 2JXXA 3B0AA 2DZKA 1P1AA 2LGYA 4KDLB 2KJHB 2CR5A 1OEYJ 2LI5A 2NBVB 4FHJA 3CMMB 2RD0A 3OJ3A 3Q3FA 4GN1A 2QHOA 1RFAA 4W9LA 3A9JB 4E3CA 3A9KB 3R3MA 3LJ3A 2ZNVB 4LJPB 1WGRA 1Z5SB 3NZUA 2C7HA 3PS6A 4W9CA 3QK0A 4HCNB 3DQVA 4KV2A 2IY1B 2UYZB 4HDOA 3RT3B 3RZWC 2Y5BB 2Z0EB 2ZPYA 3W1SC 2KTRB 4MGIE 1Y8RC 1OQYA 2L05A 3PLUA 3VUXA 5CX3A 4GXBA 2KD0A 4DDID 3APDA 2ZVOA 2ZZPB 3ECIA 3HIZA 4MGZE 2LGXA 2BWFA 3QJZA 3U7DA 1RLFA 4JLCA 4A20A 1WGHA 1NI2A 2KC2A 4OVUA 3ZNGC 5D94A 4G3XB 2MBHA 3WIMA 2ZCCA 4LCDE 3ZO5B 5AZHA 2V3SA 3PV1A 3VQIA 3A1QA 1Z2MA 3H7PB 3QHTA 2KDEB 3VH4B 3SHQA 4E74A 4TV3A 3DBLI 2ZPNA 3NOBA 3CSTA 3M63B 4M8MA 2WYQA 5GMVA 3W1SA 3JSVA 1E8WA 4MEMA 3NHEB 2KFKB 3BINA 4FJZA 1VD2A 1WRDB 1MG8A 2VRRB 4FADA 4LDTB 5CHVC 4BKSA 3UIOB 3DVNV 1WJNA 2L76A 3KUCB 4G11A 5CHWA 3TMPB 1EF5A 2DENB 1ZKHA 2DYBA 3HM6X 3M62B 4KIKB 4X57B 4GDLB 1TZ1A 3TBLD 5JH5C 4DBGA 2WWZA 1WGDA 2O2VB 2HE7A 3ZTCA 1WE7A 1WR6E 3QIJA 2GBKA 2JY6A 2FAZA 4PS3A 4MSMB 2HTHA 2KXJA 1K8RB 3VUWA 4WJPA 2MBEA 2FCNA 3DCGA 2FCQA 2G45B 3HM3A 3JW0X 3ML8A 3PT2B 3R7QA 2ZNVC 4A3PA 4IWOA 3ZVVA 2L0TA 2DAFA 4KSKC 5C1ZA 4DXAB 4EKUA 2NPTA 1YD8U 2MQJA 5JHAA 4B9KA 4CO7A 5AZFA 4IW0A 1LFDA 2ZJDA 4GIVA 3SU8X 4ASWC 3ZKJC 1PQSA 2PPHA 3TIXA 2LRUA 2CS4A 1L2NA 2LXCA 3K9OB 3C0RB 1LXDA 2IBIB 2I1JA 3W1YA 3K9PB 4AP4C 3GOEA 2BGFA 3L10B 5KHOA 4ZDVA 2GBNA 4E71A 1P3QU 1WM2A 2AEHA 2BWES 2OJRA 3A9JA 4EEWA 1Q1OA 1V80A 3VHTC 2R2OA 4ICVA 3VXWA 1WY8A 2IO2B 2ZCBA 5J17A 3B1LX 3APCA 4NPNA 2B3AA 4IWQA 1F9JA 4GSWA 4FLHA 1ZGUB 4W9KA 1YX5B 2KX0A 2WX0A 4MM3A 1KLVA 2JT4B 5C23A 5TR5A 2Z59B 2LVPA 4WAAA 2CHWA 4F8CB 5IA7A 1GNUA 2KTRA 3PRMB 2KVRA 3M3JA 3AI5A 3PREA 2C7NB 2MSED 3N30A 4ANVA 3HHMA 3V6CB 4AOFA 3KVFB 2GBJA 3S2AA 3NS8A 4ICUA 2RPQA 2K39A 2LGDA 1Q0WB 2KDBA 3DVGX 2JPHA 2M1MA 3ZW3A 2MRPA 3RYTA 2KJRA 4HPLB 4GDKB 1WZ3A 1WX7A 4W9IA 3KUDB 4BVUC 5KHQA 3WAOA 4F1SA 5E6NA 4DDGD 2K8BA 3CF6E 3PTFC 2XK5B 1R4NI 2WDTB 2AWTA 5G2NA 2KN5A 5DPSA 4NJ6A 3ZDMC 1OEYA 1E8XA 3L13A 3H7PA 1NDDA 5E6PA 4GOCA 2LRWA 2IO0B 5AEKB 4F7ZA 1S1QB 1J8CA 3V60A 2BYVE 1U4AA 3V62A 3UQAA 2DHZA 2LJ5A 3QCAA 4K1RB 3N32A 1WGYA 1E90A 1TTNA 1WH3A 1WFYA 1XQQA 2G4SA 2JWZA 3ZRCA 2K25A 2KANA 5JZEB 5LXIB 5IAAC 2KOXA 2DZMA 2KK8A 4II3B 3H7SA 1ZW7A 2BYEA 2R2QA 4DHJD 2FIFA 4GDLA 5CTRC 3IFWB 1WX8A 2J0KA 3A4SC 3EFUA 2O2VA 3APFA 4GMVA 1D3ZA 3ZDTA 3L54A 4EFOA 4A3OA 2MX2A 2JZ3B 3JYUA 2GBRA 1WE6A 2KKCA 2LVQA 2KX3A 3SD5A 2O6VA 4IM3A 1FXTB 2DZIA 2NCNA 3DBSA 4HCPB 1C1YB 5G55A 1XT9B 3D32A 4ZYNA 3EHVA 1QZEA 4WJOA 2RSUA 3B08A 4HJKA 4IM2A 2KWCA 1WXAA 3QQ8B 4WJNA 3WAMA 4ANWA 3PVLA 4XC2A 2M0XA 1UBQA 2YLMA 3OLMD 2A4ZA 4IUMB 1WMHB 2J0JA 4B95A 4JIOU 3RD2A 4DHZB 5LLIA 1HE8A 2LXAA 3DPDA 4ANXA 3L16A 2BKFA 4FULA 4W9EA 4PS8A 1AARA 2G3QB 4HWIB 4MJSB 1SGHA 4JQWC 3UIPB 4ZRIA 3I3TB 4NQLB 5D2MB 2KQ7A 3EECA 2Z0DB 3TL5A 3EC8A 4BKTA 3ALBA 4LJOB 1H4RA 3L0WB 2PJHA 2L3ZA 3TJPA 1EUVB 1XD3B 2KLGA 3V61A 2XEWA 1V5OA 2C5LC 3ZRFA 5DPTA 3T9LA 2N7DA 1V49A 4N9F4 3VTUA 2MP2A 4FJYA 4BOZB 1C3TA 4BKGA 1WXMA 2MCNB 1JRUA 2FCSA 3OJ4B 4AJWA 4NAWB 3X0WA 1UGMA 2KLCA 2D07B 2RR9A 2JZZA 3PZDA 2AYOB 2C60A 1VCBA 2LVOA 2YVCA 1P98A 2ZEQA 4B6WA 3H1UA 5DCNA 2MW5A 5DPWA 1WIAA 4I6PA 1S3SG 1TBEA 3IBEA 4DHZE 2IY0B 4JL9A 4G0NB 2KC1A 4IC7B 1SE9A 1WI0A 2EMSA 4MELA 3VH3B 3OAWA 3L08A 3A9KA 3ML9A 2REXA 4HK2A 1WM3A 4OVVA 4CHKA 4K7UA 3BY4B 5JHBA 1WF9A 4HLEA 1ISNA 4MSQB 3WALA 2L00B 1M94A 3AULA 2N7EA 1H8CA 4CYEA 3UGBB 1BT0A 1IYFA 3KYDD 1GC6A 2M17A 4WQOB 2W9NA 3IG3A 4ZRKA 3U30A 2MBQA 3MHSD 1UBIA 3VTVA 2WX1A 4RM9A 4WWPA 4XZ4A 2D3GA 3U8ZA 4AJYB 2IYDB 2KZRA 4GU2A 4M0WB 4ZRJA 2KMAA 1WYWB 2NS5A 3IVFA 3QC8B 1I35A 1RAXA 1UZXB 2KDFB 4GB9A 2PEAA 2EMTA 1GC7A 1E8ZA 2KJ6A 1R4MI 3NY5A 4BBNC 1V81A 1WJ4A 2MWSB 3KW5B 4NJ7A 3DOWA 2M8SA 2HJ8A 4AUQC 2ZVNA 1UD7A 1V86A 3AU4A 3PSEB 1E7VA 3PRZA 5L83A 2D10A 2LZ6A 3VFKA 4K81A 1V5TA 1E8YA 3JVZX 1KJTA 1WZ0A 5AZGA 1T0YA 3DDCB 2K1FA 3KYCD 4YL8A 1GUAB 4WWOA 2IO1B 2KFKA 4HDQA 1KOTA 2CHXA 4XX5A 2BF8B 2GMIC 4AWJA 1WMHA 3GZNI 2BPSA 5E6OA 1NBFC 2A5UA 2LASA 4MH0E 4MGKE 3RZFA 4FHKA 2DYMA 4KIKA 2DYOA 4BBNF 4KVGB 1KM7A 4MJSA 4TQ1A 1YJ1A 2G4DB 3SDLC 2C9WB 2BYFA 2EKEC 3H9DA 5D7GA 3N3KB 1EF1A 1WX9A 2L7RA 3CSFA 3VVWB 2K8HA 2KMCA 5DPRA 1G6JA 4IG7B 2NR2A 3ZNHB 4BFRA 2PE9A 2RGFA 2PE6B 2N9PC 3QX1A 2N9XA 2GOWA 2K8CA 4TKNA 3A4RA 2KQSA 3RUIB 4LDTD 1OGWA 3KUZA 2DX5B 4TUUA 5J2RA 3RULA 4DHJB 4NAWA 2CU1A 4DK5A 4W9FA 3VAWA 2C7MB 2J7QB 1P0RA 2CKHB 1TGZB 3HK0A 4W9HA 2N1VA 4FJVB 1YX6B 4RMAA 5LXHA 2KHWB 3M95A 3ZNZB 3MTNB 2K6DB 4II2B 4PS7A 3AU5A 2N9EB 1UELA 2I1KA 2L8JA 1V9JA 2M4NA 3DBRI 4HPMB 3VUYA 2V4LA 2O6VD 4K7WA 1GG3A 4KZ0A 3ZUNA 4TQ0A 3ONSA 2BKRB 2N4FA 2JRIB 1SIFA 3DVNU 3H6NA 5FR6A 2NVUI 4PYUA 4WWNA 4EUTA 2KDIA 2DZJA 4KZCA 4P7IA 1IPGA 3T8MA 4W9DA 3ZNID 5HKHA 2J0MA 4URKA 3R66C 4KSLC 3QAQA 2MBOA 1V6EA 3TCAA 1IP9A 1L7YA 3QWZB 4IWPA 5BO4B 1I42A 3LDZE 4FBJB 1LQBA 5L95C 2IO3B 4BKSD 5D6JB 4HVBA 2JF5A 4IM0A 3KH0A 1E5WA 4HXDA 1UH6A 1WJ6A 2KFJA 2UWQA 4FN2A 4GDKA 1WXSA 2O6VB 2MBBB 1RRBA 3IHPC 3PHWB 1Q5WB 2D2QA 3DBHI 2NBUA 3MJWA 3P2BA 3A1QB 4G50A 4MGYE 2FNJB 2XK5A 3WA0A 2D11A 1EO6A 3QARA 2LD9A
chains in the Genus database with same CATH superfamily
1FO4A 4KDIC 1FRRA 4ZHOA 3TEXA 3Q8FA 2OOBB 2KO3A 2WXHA 1V2YA 4ANUA 1ET9A 3AXCA 3AM9A 3B9JA 4GGQA 4ZYSA 3ENEA 4W9GA 1E10A 2V1YA 4PT5A 2KTFA 3L17A 1WGGA 4PYZA 1GJZA 2MLBA 5EDSA 1YIWA 1T0SC 1VZ7A 4K3CA 1F77A 4MDKE 3X23A 2IGGA 4AQ7A 4WAFA 3QA8A 1YQ4B 2KWVB 2NPTB 2H89B 1J7BA 3T3NA 2N1WA 2IZVB 4S17A 2CU3A 2AL6A 2AL3A 1MPEA 2D3AA 2KJHB 1QOBA 1HZ5A 1YN4A 1RFAA 1SF0A 3A9JB 4HROA 3A9KB 4YWGG 3NZ3A 2ZNVB 5G5HA 4HDOA 3RMKC 2V4IB 1TKEA 2W82A 1ZE3D 4MGIE 2L05A 2R61A 3PLUA 3VUXA 4ARIA 4DDID 2QMTA 2ZZPB 4N58A 1C78A 4RF1A 3QJZA 1WGHA 1XLQA 2KC2A 4P6VF 2MEKA 3N9YC 4LCDE 5AZHA 3PV1A 1UF0A 4TV3A 3M63B 3N1XC 2V9HA 2DNFA 3NVZA 2WLBA 1E8WA 4MEMA 2ZW1A 3NHEB 2KFKB 2WXOA 4FJZA 3ZXVA 1Y56A 1QLBB 5CHWA 3M62B 2DYBA 1BMLC 3HM6X 3DHIC 1TZ1A 1FM0D 1WGDA 1JQ4A 4C4VB 2KXJA 1K8RB 1VZ6A 2RDGA 4WJPA 2FCNA 2FCQA 3ML8A 3ZJTA 5MPOA 1IGDA 4OW0A 2MHJA 1A70A 3TEYA 2NPTA 3E56A 3IXSA 1T6BX 4GIVA 1GB1A 1LXDA 3K9PB 3L10B 5KHOA 4EEWA 1P3QU 2BWES 2OJRA 3A9JA 1Q1OA 3VHTC 2IO2B 2WU2B 2VH1A 4IWQA 3KLSX 4W9KA 4FLHA 1ZGUB 1UWXA 2RDHA 2JT4B 5C23A 4GLSC 2CHWA 2I2YA 4M01A 3PREA 2LHEA 3VR9B 3N30A 4R3DA 4ANVA 1EU3A 2RPQA 1BXTA 2BQQA 4YSXB 3ZW3A 4OVZA 4N6EB 3Q2AC 4F1SA 5E6NA 2GRIA 4HJGE 2AWTA 3Q14C 2QC8A 1DOYA 3R8BA 3IAS1 3R2TA 4GOCA 2LRWA 2IO0B 1J8CA 1U4AA 3V62A 3MFGA 1KLUD 2K25A 2KANA 5IAAC 1GB4A 4II3B 3N20C 1DGJA 5CTRC 2VH2A 3GE3C 1WX8A 1N62A 1WXQA 3L54A 2MX2A 2JZ3B 2KKCA 2XNAC 3N1ZC 3SD5A 4C4VA 1YQ3B 2LMCA 3Q8EA 1WGKA 3HUIA 2M56B 1IBXA 3BYTB 3B08A 4IM2A 2Q5WD 4ANWA 5TSSA 2M0XA 3FILB 1UBQA 2A4ZA 4JIOU 5LLIA 2LXAA 4ANXA 4ITKA 4B0EA 5C2TB 1KTKA 4JQWC 2KQ7A 3ALBA 2PTLA 3BYYB 1EUVB 1XD3B 2VZKB 2XEWA 2IPKD 2C5LC 3ZRFA 5DPTA 3T9LA 1V49A 4N9F4 1SIJA 3VTUA 1YMHE 4ZRPA 4BKGA 3KWVA 2L52A 1WXMA 2MCNB 3OJ4B 4NAWB 2KLCA 2AYOB 2C60A 4LNFA 1P98A 3H1UA 2QEJC 5DCNA 5BYRA 3LYYA 2GI9A 3Q69A 1ENFA 4IC7B 1SE9A 4A6QA 1C77A 2NTSA 1WM3A 4OVVA 4REZA 2PW9A 4YTNB 3BY4B 2L00B 3AULA 2WXPA 1H8CA 4CYEA 1TIFA 3KYDD 2M17A 2W9NA 3IG3A 3VTVA 3MHSD 3ZXRA 2WX1A 4XZ4A 2BBCA 4GU2A 1FNWA 1FXAA 3U2SC 3QC8B 1F1HA 1RAXA 1UZXB 2BW2A 4K3BA 2PEAA 4RGNA 2KJ6A 4BBNC 1V81A 2MWSB 3KW5B 3DOWA 2M8SA 1I4QA 2D10A 3AECB 1V5TA 2WNMA 1KJTA 1I4GA 2WXLA 5IOIA 4LNOA 2KN4A 5AZGA 1T0YA 4HDQA 2BF8B 2PVOD 1VZ8A 2BPSA 4MH0E 4MGKE 2BTEA 3AE1B 2DYMA 4KIKA 4BBNF 3AEFB 1KM7A 1SXTA 4TQ1A 1XO3A 1YJ1A 3DWGC 3AE4B 2L7RA 2B76B 3VVWB 3ZNHB 4BFRA 2PE9A 1K51A 3RUIB 4LDTD 3KUZA 4LTUA 4NAWA 2CU1A 2CKHB 1YX6B 2KHWB 4II2B 3AU5A 1UELA 4HPPA 4IKGA 4KZ0A 3DBLB 5H92C 1XCTL 2KDIA 3DHGC 4W9DA 4C7YA 2J0MA 4URKA 3TCAA 1FEHA 3BK2A 3URYA 4L2YA 3QWZB 3FKYA 5BO4B 3LDZE 4FBJB 2IO3B 4HVBA 2JF5A 4IM0A 1E5WA 4HXDA 5E6JA 1CZPA 1SB3C 4GDKA 1MHHE 3PHWB 3ZJUA 2FNJB 4KKIA 2XK5A 2MJ3A 1X1MA 3VDZA 2LD9A 1PYWD 4EZKA 1QQRA 1NENB 4W9JA 3VTWA 3AEEB 1C4CA 3PLVA 3R7RA 1WR1A 3JSVB 2M0AA 2MH7A 3PPAA 3NZSA 3PRPB 4FA6A 2EKIA 4M8NA 2LGIA 3MP9A 3ZLZA 2LUEA 3RI7C 2AX5A 1LGRA 4XDDA 4J6IA 4EZJA 2KACA 1LM8B 2K6QA 3ZTDA 1WJUA 4DXGA 2LWPA 2HD5B 1D5XC 4EOYA 1F2RC 1WXVA 2MP2B 3PGEA 2L32A 1JALA 2GBMA 3H8HA 1J0GA 4BOSC 4K7SA 3ZYYX 1C79A 2DWQA 4HKQA 2LGYA 4RH6A 2CR5A 4FHJA 4L1BA 4W9LA 4E3CA 1J7CA 3DWMA 1VRAB 3P4QB 3R3MA 1GPXA 2V3NA 1WGRA 1Z5SB 1NI3A 3DQVA 3Q6BA 4MM3B 3RT3B 2ZPYA 1I4XA 2KTRB 5BMGA 1OQYA 5CX3A 3PZ7A 4GXBA 3IT4B 4MGZE 2LGXA 1KF6B 2KYWA 1XF5L 5D94A 2RPVA 3WIMA 3ZO5B 2PIAA 3EFCA 2KDEB 3QHTA 4E74A 4EE2A 3CSTA 4M8MA 5GMVA 3W1SA 1MG4A 4YSYB 3JSVA 1QOAA 1VD2A 2MJDA 2VRRB 4G11A 3HVDA 2DENB 1AW7A 2V0GA 3QIJA 4PS3A 4MSMB 2HTHA 3VUWA 2MBEA 2G45B 3PT2B 4A3PA 3P63A 3PO0A 2DAFA 1JW9D 2D3BA 2J4XA 2Y5PA 2N9LA 2BVCA 2QSDA 3N1YC 2MQJA 5JHAA 4KGSA 4CO7A 5AZFA 4IW0A 1LFDA 2ZJDA 4ASWC 1TS4A 1L2NA 2LXCA 3C0RB 2I1JA 2KVZA 3W1YA 3GOEA 2BGFA 4E71A 1WM2A 2AEHA 1V80A 2HJ1A 3AE9B 1V1OA 4ICVA 3VXWA 3APCA 1E9MA 1KRHA 4NPNA 1F9JA 1WWTA 1YX5B 1ZXIA 1L5PA 2KX0A 4MM3A 1KLVA 5TR5A 2LVPA 5IA7A 2KTRA 3PRMB 3M3JA 2INCC 2G9HD 1GAQB 4P16A 1EM7A 3HHMA 3V6CB 3KVFB 2GBJA 4ICUA 2K39A 2RMMA 1PDXA 2JPHA 2M1MA 2MRPA 2BS3B 3RYTA 2KJRA 3RNFC 4W9IA 2QCZA 4DDGD 3CF6E 1DYQA 5G2NA 2J52A 5FK9C 1OEYA 2LHDA 1NDDA 3AV8A 5E6PA 1VLBA 5AEKB 4JE3B 3AEDB 2NMQA 2LJ5A 1E0ZA 4A8XC 1E90A 1TTNA 3ZRCA 4FXCA 4H2AA 1F52A 3W5VB 2DZMA 3H7SA 1QILA 1PGAA 4TMAB 4RGMA 2RDBC 1IUEA 1HA5A 1NVID 3DBSA 1XT9B 3D32A 1QZEA 4WJOA 1ZP0B 4LK0M 4HJKA 1HZ6A 2I38A 2N0SB 2YLMA 4IUMB 2J0JA 1RM6C 1N5XA 1YN3A 4DHZB 5G5GA 4ZRQA 1VJKA 2Y5CA 4HWIB 3GP7A 4MJSB 4ZRIA 1UNSA 5D2MB 3EUB2 3NUHB 3RPFC 4YTMB 4LJOB 1H4RA 3BZDB 2ZW0A 2L3ZA 2KLGA 3V61A 3AEAB 1P7EA 1AYFA 1FCLA 1JWMD 5HFYA 2L83A 3GB1A 4FJYA 4HKZE 2MJEA 1Q10A 1JRUA 2FCSA 4AJWA 2WXRA 4TSSA 2RR9A 4A9AA 2OHFA 2AQ3B 2W3SA 2UU7A 5DPWA 1WIAA 4I6PA 1S3SG 3AH7A 2IY0B 1TY2A 1WI0A 3VH3B 4RCOA 2PMVA 3A9KA 3ML9A 4CHKA 2ACZB 3WALA 3UGBB 2OEDA 1IYFA 2DBYA 1GOZA 4WQOB 2JX5A 1TJEA 3U30A 2FBWB 1UBIA 4RM9A 1C76A 3U8ZA 2KMAA 1MFWA 1I35A 2GB1A 2IGHA 3NY5A 4NJ7A 1B1ZA 1UD7A 1E7VA 1CJEA 3VFKA 1FNVA 1E8YA 3JVZX 2QJLA 2M19A 5GXGB 2X38A 1TS5A 1YN5A 5EE9A 3DHHC 4YL8A 1GUAB 2IO1B 2KFKA 2CHXA 1D4BA 1ZDXA 1CQVA 3NG0A 3GZNI 1BUIC 1TKYA 1NBFC 4JPSA 3RZFA 3GZNB 1ROEA 4KVGB 3RFZB 4MJSA 2INPE 2G4DB 2LUMA 3SDLC 2EKEC 1KH0A 2HTME 3H9DA 5D7GA 4A55A 3P4PB 4DQOC 3W5UB 3CSFA 2WDRB 2WXJA 2WXQA 1G6JA 2NR2A 1EO6A 2K3UA 2IGDA 2RGFA 3SFEB 2N9XA 3A4RA 2D3CA 1OGWA 2DX5B 4TUUA 5J2RA 4HEA1 3Q3OC 3VAWA 2J7QB 4W9HA 3O13A 4FJVB 3CWIA 4PS7A 3AE6B 2L8JA 2M4NA 3DBRI 2V4LA 2O6VD 4K7WA 2E3TA 1PGXA 3DBRB 3TUOA 2FUG1 1N60A 4TQ0A 1EWYC 2BKRB 1SIFA 5FR6A 4NAMA 4MH8A 3T8MA 2DLBA 3R66C 3QAQA 1IP9A 1V6EA 1L7YA 2J42A 1I42A 2K5PA 1OQQA 2FE8A 1I4RA 1UH6A 5AUKA 4FN2A 2O6VB 2MBBB 5D3DA 3P2BA 2NBUA 4G50A 1TT5B 2Y3AA 3U7ZA 3ETRA 4NY0A 4ACFA 3PHXB 2L0FA 2LEKA 3EA6A 2FCMA 4WJQA 2XBBC 3SEBA 3DVGY 3RNEC 1PUTA 1FXIA 2BYTA 1J19A 1CMXB 1HEZE 3UQBA 5J18A 4I6LB 5AUIA 1P9DU 3O65B 3V6EB 1TZOA 2JRHA 3WAPA 3UF8A 3I5JC 3WANA 2CHZA 4JGHB 3Q8BA 2KWUB 1I4PA 2DAJA 2LGSA 4NQKE 3TEWA 3A33B 3RNCC 4RM8A 4JWSC 3RNBC 3GS2A 3B0AA 3FILA 1ESFA 2LI5A 2QDFA 3CMMB 3OJ3A 3Q3FA 3KWLA 4GN1A 2QHOA 1YOVB 3BVZA 3I63C 1IGCA 4C00A 3AE3B 4LJPB 2C7HA 4W9CA 4KV2A 4HCNB 2UYZB 2Y5BB 2Z0EB 1Y8RC 2KD0A 1YJIA 3W9CB 2ZVOA 3ECIA 4D2KA 3U7DA 1RLFA 2BT6A 4OVUA 3V3XA 4N59A 1AN8A 3ZNGC 3P42A 4G3XB 2MBHA 3HRDD 3VQIA 2IDYA 1Z2MA 3H7PB 3VH4B 3SHQA 3AMZA 3DBLI 2ZPNA 3NOBA 4C56C 1SBBB 2JYEA 1WRDB 4A90A 4FADA 1N5WA 4LDTB 5EE1A 5CHVC 3UIOB 3DVNV 1WJNA 2L76A 3KUCB 5JXVA 1C4AA 1EF5A 4KKJA 3TBLD 4DBGA 2WWZA 2O2VB 3ZTCA 2W54A 5FKAC 1WR6E 1MHXA 2FAZA 3I57A 3PZ8A 2JSVX 3DCGA 3HM3A 1A5RA 3R7QA 1MJDA 1HTOA 2ZNVC 3ZVVA 5IN7A 1L6VA 4KSKC 5C1ZA 4EKUA 2WS3B 4YSZB 4RNAA 1L0XB 2KAJA 4B9KA 1XLOA 3SU8X 5BYQA 3ZKJC 1PQSA 3TIXA 1TS3A 4YT0B 5BYSA 2CS4A 3FAHA 5IP4D 4M02A 4ZDVA 2GBNA 2AQ1B 2R2OA 1KFYB 1WY8A 2ZCBA 1JMLA 3B1LX 3MC0B 2WX0A 3AE7B 3Q8CA 1VDVA 4WH4A 5H8YE 4F8CB 3BIID 3AI5A 2C7NB 2MSED 1YJJA 3S2AA 3NS8A 2LGDA 1Q0WB 2KDBA 3C19A 3DVGX 1HTQA 4BVUC 5KHQA 5D3IB 2L1AA 2K8BA 3PTFC 1ZUD2 1R4NI 2K9XA 1TS2A 1R4NB 1F0ZA 3ZDMC 3L13A 3H7PA 4RGTA 4OZCA 4US8A 4AS1A 2IJ0A 4OZBA 2BYVE 2QIEB 4JWUC 1WGYA 2G4SA 1XQQA 2WU5B 5JZEB 5LXIB 2INDC 2KOXA 3NJTA 4DHJD 1J7AA 3IFWB 1FMAD 3MC8A 4RGOS 1D3ZA 2YEPF 2O2VA 1QOFA 4S0RA 3JYUA 2LVQA 1WE6A 3AEGB 2LFIA 2DZIA 4UDUC 1I7HA 2NCNA 4HCPB 5G55A 1OFFA 1K53A 2BB6A 1L4ZB 2KWCA 3WAMA 3PVLA 1FD6A 3OLMD 2E6XA 1E7PB 4B95A 3WCQA 1HE8A 2BKFA 4FULA 2LJIA 4PS8A 3Q3NC 3UIPB 2CJNA 2WXNA 3I3TB 4NQLB 2Z0DB 3TL5A 3EC8A 4BKTA 1R7SA 4NZLB 1V8CA 1T0QC 3IT6B 2PJHA 2MP2A 3P1MA 3VRBB 4BOZB 1C3TA 1FIQA 3BVGA 1D5ZC 3X0WA 2CJOA 2D07B 2JZZA 3PZDA 1VCBA 2LVOA 3RNGC 4C7ZA 4BZAA 3P4RB 1FCCC 1ZOYB 2MW5A 4LNIA 4DHZE 4JL9A 3SFDB 2KC1A 3NVWA 4HK2A 4PK1A 3NRZA 1WF9A 4HLEA 1QF6A 3ABVB 1ISNA 5BMHA 1M94A 2N7EA 1BT0A 1GC6A 4ZRKA 2MBQA 4M00A 4WWPA 1SJED 2D3GA 2KZRA 3P4SB 4ZRJA 4C80A 1WYWB 2NS5A 3IVFA 2KDFB 1CK1A 1E8ZA 3TEZA 2HJ8A 2SEBD 2ZVNA 1N63A 4YTPB 4AUQC 1V86A 3AU4A 4WQMA 3PSEB 3AB5A 5L83A 3PRZA 2LZ6A 1WYGA 3AE5B 4K81A 1V1PB 1WZ0A 3DDCB 2K1FA 3KYCD 1KOTA 1SE4A 2GMIC 4US9A 2ICIA 2A5UA 4FHKA 2V3PA 3FC4A 2DYOA 3C8YA 1JCKB 1XEEA 3U52E 1ET6A 3ZJVA 1WX9A 4KGTA 1WSPA 2KMCA 5DPRA 1L4DB 4DXFA 3QX1A 2K8CA 4WIPA 1QKZA 3RULA 1I4HA 4DK5A 4W9FA 2C7MB 3HK0A 1TGZB 1UGJA 2TSSA 2D5GA 2AQ2B 4RMAA 3HVZA 1VR9A 2K6DB 2N9EB 2I1KA 4L23A 2PVGC 4HPMB 5I4DA 1B9RA 1F2RI 1ZXHA 3ONSA 1DOIA 2JRIB 3H6NA 3DVNU 3KQ4A 2KT7A 4OHJA 4WWNA 4KZCA 4P7IA 3ZNID 1OQRA 3J9CA 1MVKA 3LXFA 2MBOA 5L95C 1LQBA 4BKSD 3KH0A 5IKCM 2YEPB 1XLPA 1JWAD 1RRBA 2WXMA 3IHPC 1Q5WB 2D2QA 1JRPA 1TYGB 3A1QB 4MGYE 3WA0A 1JROA 3QARA 1IBXB 4EZLA 1YQBA 5C3JB 4I6NB 3LB8C 2JUOA 2FUHB 1V1PA 4XGAB 1V97A 3ZIMA 2NBWB 3RCZA 1DOXA 1FFUA 2INNE 4RFBA 4Q2JA 2KNBA 1E7UA 4DWFA 4NNJB 4CQNA 2WGSA 3Q3JA 2ASQA 3ZGZA 3AEBB 1OTRB 3NVVA 5CHFA 2JVCA 2MA9B 3UINB 4O1NA 3RN9C 2FIDA 2JXXA 1SEBD 2KWDA 2DZKA 4XWTA 1ACCA 1P1AA 1AWDA 1FRDA 4KDLB 1OEYJ 2NBVB 1TKGA 2RD0A 5FR3A 1NYQA 3LJ3A 2K22A 3BVMA 3NZUA 3PS6A 4P1BC 3QK0A 3VRAB 2IY1B 3RZWC 3W1SC 3OWEB 1WRIA 4XWWA 4NJCA 4XDCA 1RFKA 2KMMA 4KGRA 1T5XD 1JWUD 3APDA 2W3RA 3HIZA 1N61A 2BWFA 4JLCA 4A20A 1NI2A 2G1EA 4JX1C 5BMIA 2KDMA 3ZQ4A 2ZCCA 1RWSA 2V3SA 3A1QA 2JXTA 3AN1A 1M4VA 2BS4B 2W55A 2WYQA 2VZKD 2XN9C 3BINA 1SSNA 1QT9A 3BWUD 1MG8A 4BKSA 3TMPB 5IO9A 4X57B 1ZKHA 4KIKB 4GDLB 5JH5C 2QILA 2HE7A 2JZPA 1WE7A 2GBKA 2JY6A 4IDIA 4RF0A 1FFVA 4OZAA 3JW0X 4IWOA 2L0TA 5EE0A 4DXAB 3IAM1 5T8IA 2WDQB 5HI1A 1YD8U 1TY0A 2N9KA 1L6UA 2PPHA 1JWSD 2LRUA 3K9OB 2IBIB 4AP4C 1K52A 3E9SA 5EE3A 3UI3A 1N6ZA 5J17A 2B3AA 3AE2B 1D5MC 4GSWA 1T3QA 2ONQA 1D6EC 4QAYA 2Z59B 3R2IA 4WAAA 1GNUA 1PGBA 3OG5A 2KVRA 5HG2A 4AOFA 3NVYA 3SR6A 3BK1A 4HPLB 4GDKB 1WZ3A 1WX7A 3KUDB 1K50A 3GE8C 3WAOA 2WDVB 2XK5B 2WDTB 2KN5A 5DPSA 4NJ6A 1E8XA 1RYJA 2OJWA 4F7ZA 1S1QB 3V60A 3UQAA 2DHZA 3QCAA 4K1RB 3N32A 1WFYA 1WH3A 2JWZA 2KK8A 1ZW7A 2BYEA 2R2QA 2FIFA 4GDLA 3NS1A 4MACA 4KX6B 2J0KA 3VR8B 1EWCA 3A4SC 3APFA 3EFUA 4GMVA 3ZDTA 5LNK1 4EFOA 4A3OA 2GBRA 1UUPA 2KX3A 3W2DA 2O6VA 4IM3A 1FXTB 4WWMA 1C1YB 4B0MA 1ZDVA 4ZYNA 3EHVA 2JQRB 2RSUA 2Z8LA 3QQ8B 1WXAA 4WJNA 4XC2A 3EGRA 1QOGA 1WMHB 3RD2A 3DPDA 3L16A 4W9EA 1AARA 2JYTA 2G3QB 1C4PA 1SGHA 3EECA 4P1CC 3L0WB 3TJPA 1KLGD 1V5OA 1FNUA 3CIRB 2N7DA 4IOIE 2WXKA 3V05A 3U4EG 1UGMA 3B2FA 2WP9B 2YVCA 2ZEQA 4B6WA 4BAXA 1P7FA 2BB5A 1TBEA 3IBEA 1XCQL 4J3OD 4G0NB 2EMSA 4MELA 3OAWA 3L08A 2REXA 2WXIA 3T3OA 4K7UA 3MC9A 5JHBA 1UWMA 1NYRA 4MSQB 2WHIA 4ZHPA 2X8XX 4AJYB 2IYDB 2SAKA 2J53A 4M0WB 1MI0A 4GB9A 2EMTA 1GC7A 1R4MI 2EELA 1WJ4A 1R4MB 2JWUA 1ZPSA 2ON8A 1EU4A 1HXYD 4WWOA 4AWJA 4XX5A 4HRSA 1WMHA 5E6OA 2KQ4X 2LASA 3MHZA 2H88B 2JU6X 1JWBD 3TSSA 1L0VB 4WURA 2C9WB 2BYFA 4ARCA 3B2GA 2NTTA 1SE3A 3N3KB 1EF1A 1PFDA 2K8HA 4MT5A 4IG7B 1T0RC 2WXFA 2PE6B 2N9PC 3RNAC 2GOWA 3AE8B 4TKNA 2GLSA 3Q3MC 2KQSA 1E6EB 1LO5D 1XXGA 1L0YB 4DHJB 1YNTE 1XLNA 2K0PA 1P0RA 2WQYB 4USAA 1HQRD 1SE2A 2N1VA 2PLPA 5LXHA 2BS2B 3M95A 3ZNZB 3MTNB 3MJ5A 4XE0A 2HDEA 1V9JA 3VUYA 4LNNA 1GG3A 1NEKB 3L4PA 3ZUNA 2N4FA 4LNKA 2NVUI 3I9V1 4PYUA 4EUTA 2DZJA 2N7JA 1SJHD 1IPGA 5HKHA 4KSLC 4IWPA 1STEA 4ZOHC 2WXGA 5D6JB 4M0WA 1WJ6A 2KFJA 2PKOA 2UWQA 4YXDB 3Q8AA 1WXSA 4XYCA 1C9FA 5HHDG 1FPYA 3DBHI 3MJWA 4LLGM 2D11A 3DBHB
chains in the Genus database with same CATH topology
1A5RA 4EZKA 4KDIC 4NY0A 4W9JA 3VTWA 4EZLA 1YQBA 3PLVA 3PHXB 2L0FA 4I6NB 2FCMA 3VDZA 2OOBB 1WR1A 2KO3A 2XBBC 1V2YA 3JSVB 4WJQA 3AXCA 2JUOA 1X1MA 4ANUA 2FUHB 3DVGY 3PPAA 4GGQA 3ENEA 3NZSA 3PRPB 4FA6A 4W9GA 1J19A 3ZIMA 2V1YA 2NBWB 1CMXB 2KTFA 3L17A 3RCZA 3UQBA 5J18A 4M8NA 4I6LB 1WGGA 4PYZA 1GJZA 2MLBA 3ZLZA 5EDSA 1P9DU 1YIWA 2KNBA 2LUEA 3O65B 3V6EB 1E7UA 4DWFA 4J6IA 2JRHA 4EZJA 4NNJB 1LM8B 2K6QA 3ZTDA 3WAPA 3UF8A 1WJUA 3WANA 2CHZA 2LWPA 4JGHB 3Q3JA 4MDKE 2HD5B 3X23A 2ASQA 4EOYA 2KWUB 1WXVA 2DAJA 2MP2B 1OTRB 4NQKE 3PGEA 5CHFA 3A33B 2JVCA 2MA9B 3QA8A 2GBMA 2KWVB 2NPTB 1J0GA 3UINB 2N1WA 2IZVB 4K7SA 4BOSC 4RM8A 2AL6A 2AL3A 2FIDA 3R7RA 2JXXA 3B0AA 2DZKA 1P1AA 2LGYA 4KDLB 2KJHB 2CR5A 1OEYJ 2LI5A 2NBVB 4FHJA 3CMMB 2RD0A 3OJ3A 3Q3FA 4GN1A 2QHOA 1RFAA 4W9LA 3A9JB 4E3CA 3A9KB 3R3MA 3LJ3A 2ZNVB 4LJPB 1WGRA 1Z5SB 3NZUA 2C7HA 3PS6A 4W9CA 3QK0A 4HCNB 3DQVA 4KV2A 2IY1B 2UYZB 4HDOA 3RT3B 3RZWC 2Y5BB 2Z0EB 2ZPYA 3W1SC 2KTRB 4MGIE 1Y8RC 1OQYA 2L05A 3PLUA 3VUXA 5CX3A 4GXBA 2KD0A 4DDID 3APDA 2ZVOA 2ZZPB 3ECIA 3HIZA 4MGZE 2LGXA 2BWFA 3QJZA 3U7DA 1RLFA 4JLCA 4A20A 1WGHA 1NI2A 2KC2A 4OVUA 3ZNGC 5D94A 4G3XB 2MBHA 3WIMA 2ZCCA 4LCDE 3ZO5B 5AZHA 2V3SA 3PV1A 3VQIA 3A1QA 1Z2MA 3H7PB 3QHTA 2KDEB 3VH4B 3SHQA 4E74A 4TV3A 3DBLI 2ZPNA 3NOBA 3CSTA 3M63B 4M8MA 2WYQA 5GMVA 3W1SA 3JSVA 1E8WA 4MEMA 3NHEB 2KFKB 3BINA 4FJZA 1VD2A 1WRDB 1MG8A 2VRRB 4FADA 4LDTB 5CHVC 4BKSA 3UIOB 3DVNV 1WJNA 2L76A 3KUCB 4G11A 5CHWA 3TMPB 1EF5A 2DENB 1ZKHA 2DYBA 3HM6X 3M62B 4KIKB 4X57B 4GDLB 1TZ1A 3TBLD 5JH5C 4DBGA 2WWZA 1WGDA 2O2VB 2HE7A 3ZTCA 1WE7A 1WR6E 3QIJA 2GBKA 2JY6A 2FAZA 4PS3A 4MSMB 2HTHA 2KXJA 1K8RB 3VUWA 4WJPA 2MBEA 2FCNA 3DCGA 2FCQA 2G45B 3HM3A 3JW0X 3ML8A 3PT2B 3R7QA 2ZNVC 4A3PA 4IWOA 3ZVVA 2L0TA 2DAFA 4KSKC 5C1ZA 4DXAB 4EKUA 2NPTA 1YD8U 2MQJA 5JHAA 4B9KA 4CO7A 5AZFA 4IW0A 1LFDA 2ZJDA 4GIVA 3SU8X 4ASWC 3ZKJC 1PQSA 2PPHA 3TIXA 2LRUA 2CS4A 1L2NA 2LXCA 3K9OB 3C0RB 1LXDA 2IBIB 2I1JA 3W1YA 3K9PB 4AP4C 3GOEA 2BGFA 3L10B 5KHOA 4ZDVA 2GBNA 4E71A 1P3QU 1WM2A 2AEHA 2BWES 2OJRA 3A9JA 4EEWA 1Q1OA 1V80A 3VHTC 2R2OA 4ICVA 3VXWA 1WY8A 2IO2B 2ZCBA 5J17A 3B1LX 3APCA 4NPNA 2B3AA 4IWQA 1F9JA 4GSWA 4FLHA 1ZGUB 4W9KA 1YX5B 2KX0A 2WX0A 4MM3A 1KLVA 2JT4B 5C23A 5TR5A 2Z59B 2LVPA 4WAAA 2CHWA 4F8CB 5IA7A 1GNUA 2KTRA 3PRMB 2KVRA 3M3JA 3AI5A 3PREA 2C7NB 2MSED 3N30A 4ANVA 3HHMA 3V6CB 4AOFA 3KVFB 2GBJA 3S2AA 3NS8A 4ICUA 2RPQA 2K39A 2LGDA 1Q0WB 2KDBA 3DVGX 2JPHA 2M1MA 3ZW3A 2MRPA 3RYTA 2KJRA 4HPLB 4GDKB 1WZ3A 1WX7A 4W9IA 3KUDB 4BVUC 5KHQA 3WAOA 4F1SA 5E6NA 4DDGD 2K8BA 3CF6E 3PTFC 2XK5B 1R4NI 2WDTB 2AWTA 5G2NA 2KN5A 5DPSA 4NJ6A 3ZDMC 1OEYA 1E8XA 3L13A 3H7PA 1NDDA 5E6PA 4GOCA 2LRWA 2IO0B 5AEKB 4F7ZA 1S1QB 1J8CA 3V60A 2BYVE 1U4AA 3V62A 3UQAA 2DHZA 2LJ5A 3QCAA 4K1RB 3N32A 1WGYA 1E90A 1TTNA 1WH3A 1WFYA 1XQQA 2G4SA 2JWZA 3ZRCA 2K25A 2KANA 5JZEB 5LXIB 5IAAC 2KOXA 2DZMA 2KK8A 4II3B 3H7SA 1ZW7A 2BYEA 2R2QA 4DHJD 2FIFA 4GDLA 5CTRC 3IFWB 1WX8A 2J0KA 3A4SC 3EFUA 2O2VA 3APFA 4GMVA 1D3ZA 3ZDTA 3L54A 4EFOA 4A3OA 2MX2A 2JZ3B 3JYUA 2GBRA 1WE6A 2KKCA 2LVQA 2KX3A 3SD5A 2O6VA 4IM3A 1FXTB 2DZIA 2NCNA 3DBSA 4HCPB 1C1YB 5G55A 1XT9B 3D32A 4ZYNA 3EHVA 1QZEA 4WJOA 2RSUA 3B08A 4HJKA 4IM2A 2KWCA 1WXAA 3QQ8B 4WJNA 3WAMA 4ANWA 3PVLA 4XC2A 2M0XA 1UBQA 2YLMA 3OLMD 2A4ZA 4IUMB 1WMHB 2J0JA 4B95A 4JIOU 3RD2A 4DHZB 5LLIA 1HE8A 2LXAA 3DPDA 4ANXA 3L16A 2BKFA 4FULA 4W9EA 4PS8A 1AARA 2G3QB 4HWIB 4MJSB 1SGHA 4JQWC 3UIPB 4ZRIA 3I3TB 4NQLB 5D2MB 2KQ7A 3EECA 2Z0DB 3TL5A 3EC8A 4BKTA 3ALBA 4LJOB 1H4RA 3L0WB 2PJHA 2L3ZA 3TJPA 1EUVB 1XD3B 2KLGA 3V61A 2XEWA 1V5OA 2C5LC 3ZRFA 5DPTA 3T9LA 2N7DA 1V49A 4N9F4 3VTUA 2MP2A 4FJYA 4BOZB 1C3TA 4BKGA 1WXMA 2MCNB 1JRUA 2FCSA 3OJ4B 4AJWA 4NAWB 3X0WA 1UGMA 2KLCA 2D07B 2RR9A 2JZZA 3PZDA 2AYOB 2C60A 1VCBA 2LVOA 2YVCA 1P98A 2ZEQA 4B6WA 3H1UA 5DCNA 2MW5A 5DPWA 1WIAA 4I6PA 1S3SG 1TBEA 3IBEA 4DHZE 2IY0B 4JL9A 4G0NB 2KC1A 4IC7B 1SE9A 1WI0A 2EMSA 4MELA 3VH3B 3OAWA 3L08A 3A9KA 3ML9A 2REXA 4HK2A 1WM3A 4OVVA 4CHKA 4K7UA 3BY4B 5JHBA 1WF9A 4HLEA 1ISNA 4MSQB 3WALA 2L00B 1M94A 3AULA 2N7EA 1H8CA 4CYEA 3UGBB 1BT0A 1IYFA 3KYDD 1GC6A 2M17A 4WQOB 2W9NA 3IG3A 4ZRKA 3U30A 2MBQA 3MHSD 1UBIA 3VTVA 2WX1A 4RM9A 4WWPA 4XZ4A 2D3GA 3U8ZA 4AJYB 2IYDB 2KZRA 4GU2A 4M0WB 4ZRJA 2KMAA 1WYWB 2NS5A 3IVFA 3QC8B 1I35A 1RAXA 1UZXB 2KDFB 4GB9A 2PEAA 2EMTA 1GC7A 1E8ZA 2KJ6A 1R4MI 3NY5A 4BBNC 1V81A 1WJ4A 2MWSB 3KW5B 4NJ7A 3DOWA 2M8SA 2HJ8A 4AUQC 2ZVNA 1UD7A 1V86A 3AU4A 3PSEB 1E7VA 3PRZA 5L83A 2D10A 2LZ6A 3VFKA 4K81A 1V5TA 1E8YA 3JVZX 1KJTA 1WZ0A 5AZGA 1T0YA 3DDCB 2K1FA 3KYCD 4YL8A 1GUAB 4WWOA 2IO1B 2KFKA 4HDQA 1KOTA 2CHXA 4XX5A 2BF8B 2GMIC 4AWJA 1WMHA 3GZNI 2BPSA 5E6OA 1NBFC 2A5UA 2LASA 4MH0E 4MGKE 3RZFA 4FHKA 2DYMA 4KIKA 2DYOA 4BBNF 4KVGB 1KM7A 4MJSA 4TQ1A 1YJ1A 2G4DB 3SDLC 2C9WB 2BYFA 2EKEC 3H9DA 5D7GA 3N3KB 1EF1A 1WX9A 2L7RA 3CSFA 3VVWB 2K8HA 2KMCA 5DPRA 1G6JA 4IG7B 2NR2A 3ZNHB 4BFRA 2PE9A 2RGFA 2PE6B 2N9PC 3QX1A 2N9XA 2GOWA 2K8CA 4TKNA 3A4RA 2KQSA 3RUIB 4LDTD 1OGWA 3KUZA 2DX5B 4TUUA 5J2RA 3RULA 4DHJB 4NAWA 2CU1A 4DK5A 4W9FA 3VAWA 2C7MB 2J7QB 1P0RA 2CKHB 1TGZB 3HK0A 4W9HA 2N1VA 4FJVB 1YX6B 4RMAA 5LXHA 2KHWB 3M95A 3ZNZB 3MTNB 2K6DB 4II2B 4PS7A 3AU5A 2N9EB 1UELA 2I1KA 2L8JA 1V9JA 2M4NA 3DBRI 4HPMB 3VUYA 2V4LA 2O6VD 4K7WA 1GG3A 4KZ0A 3ZUNA 4TQ0A 3ONSA 2BKRB 2N4FA 2JRIB 1SIFA 3DVNU 3H6NA 5FR6A 2NVUI 4PYUA 4WWNA 4EUTA 2KDIA 2DZJA 4KZCA 4P7IA 1IPGA 3T8MA 4W9DA 3ZNID 5HKHA 2J0MA 4URKA 3R66C 4KSLC 3QAQA 2MBOA 1V6EA 3TCAA 1IP9A 1L7YA 3QWZB 4IWPA 5BO4B 1I42A 3LDZE 4FBJB 1LQBA 5L95C 2IO3B 4BKSD 5D6JB 4HVBA 2JF5A 4IM0A 3KH0A 1E5WA 4HXDA 1UH6A 1WJ6A 2KFJA 2UWQA 4FN2A 4GDKA 1WXSA 2O6VB 2MBBB 1RRBA 3IHPC 3PHWB 1Q5WB 2D2QA 3DBHI 2NBUA 3MJWA 3P2BA 3A1QB 4G50A 4MGYE 2FNJB 2XK5A 3WA0A 2D11A 1EO6A 3QARA 2LD9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1A5R A;  4EZK A;  4KDI C;  4NY0 A;  4W9J A;  3VTW A;  4EZL A;  1YQB A;  3PLV A;  3PHX B;  2L0F A;  4I6N B;  2FCM A;  3VDZ A;  2OOB B;  1WR1 A;  2KO3 A;  2XBB C;  1V2Y A;  3JSV B;  4WJQ A;  3AXC A;  2JUO A;  1X1M A;  4ANU A;  2FUH B;  3DVG Y;  3PPA A;  4GGQ A;  3ENE A;  3NZS A;  3PRP B;  4FA6 A;  4W9G A;  1J19 A;  3ZIM A;  2V1Y A;  2NBW B;  1CMX B;  2KTF A;  3L17 A;  3RCZ A;  3UQB A;  5J18 A;  4M8N A;  4I6L B;  1WGG A;  4PYZ A;  1GJZ A;  2MLB A;  3ZLZ A;  5EDS A;  1P9D U;  1YIW A;  2KNB A;  2LUE A;  3O65 B;  3V6E B;  1E7U A;  4DWF A;  4J6I A;  2JRH A;  4EZJ A;  4NNJ B;  1LM8 B;  2K6Q A;  3ZTD A;  3WAP A;  3UF8 A;  1WJU A;  3WAN A;  2CHZ A;  2LWP A;  4JGH B;  3Q3J A;  4MDK E;  2HD5 B;  3X23 A;  2ASQ A;  4EOY A;  2KWU B;  1WXV A;  2DAJ A;  2MP2 B;  1OTR B;  4NQK E;  3PGE A;  5CHF A;  3A33 B;  2JVC A;  2MA9 B;  3QA8 A;  2GBM A;  2KWV B;  2NPT B;  1J0G A;  3UIN B;  2N1W A;  2IZV B;  4K7S A;  4BOS C;  4RM8 A;  2AL6 A;  2AL3 A;  2FID A;  3R7R A;  2JXX A;  3B0A A;  2DZK A;  1P1A A;  2LGY A;  4KDL B;  2KJH B;  2CR5 A;  1OEY J;  2LI5 A;  2NBV B;  4FHJ A;  3CMM B;  2RD0 A;  3OJ3 A;  3Q3F A;  4GN1 A;  2QHO A;  1RFA A;  4W9L A;  3A9J B;  4E3C A;  3A9K B;  3R3M A;  3LJ3 A;  2ZNV B;  4LJP B;  1WGR A;  1Z5S B;  3NZU A;  2C7H A;  3PS6 A;  4W9C A;  3QK0 A;  4HCN B;  3DQV A;  4KV2 A;  2IY1 B;  2UYZ B;  4HDO A;  3RT3 B;  3RZW C;  2Y5B B;  2Z0E B;  2ZPY A;  3W1S C;  2KTR B;  4MGI E;  1Y8R C;  1OQY A;  2L05 A;  3PLU A;  3VUX A;  5CX3 A;  4GXB A;  2KD0 A;  4DDI D;  3APD A;  2ZVO A;  2ZZP B;  3ECI A;  3HIZ A;  4MGZ E;  2LGX A;  2BWF A;  3QJZ A;  3U7D A;  1RLF A;  4JLC A;  4A20 A;  1WGH A;  1NI2 A;  2KC2 A;  4OVU A;  3ZNG C;  5D94 A;  4G3X B;  2MBH A;  3WIM A;  2ZCC A;  4LCD E;  3ZO5 B;  5AZH A;  2V3S A;  3PV1 A;  3VQI A;  3A1Q A;  1Z2M A;  3H7P B;  3QHT A;  2KDE B;  3VH4 B;  3SHQ A;  4E74 A;  4TV3 A;  3DBL I;  2ZPN A;  3NOB A;  3CST A;  3M63 B;  4M8M A;  2WYQ A;  5GMV A;  3W1S A;  3JSV A;  1E8W A;  4MEM A;  3NHE B;  2KFK B;  3BIN A;  4FJZ A;  1VD2 A;  1WRD B;  1MG8 A;  2VRR B;  4FAD A;  4LDT B;  5CHV C;  4BKS A;  3UIO B;  3DVN V;  1WJN A;  2L76 A;  3KUC B;  4G11 A;  5CHW A;  3TMP B;  1EF5 A;  2DEN B;  1ZKH A;  2DYB A;  3HM6 X;  3M62 B;  4KIK B;  4X57 B;  4GDL B;  1TZ1 A;  3TBL D;  5JH5 C;  4DBG A;  2WWZ A;  1WGD A;  2O2V B;  2HE7 A;  3ZTC A;  1WE7 A;  1WR6 E;  3QIJ A;  2GBK A;  2JY6 A;  2FAZ A;  4PS3 A;  4MSM B;  2HTH A;  2KXJ A;  1K8R B;  3VUW A;  4WJP A;  2MBE A;  2FCN A;  3DCG A;  2FCQ A;  2G45 B;  3HM3 A;  3JW0 X;  3ML8 A;  3PT2 B;  3R7Q A;  2ZNV C;  4A3P A;  4IWO A;  3ZVV A;  2L0T A;  2DAF A;  4KSK C;  5C1Z A;  4DXA B;  4EKU A;  2NPT A;  1YD8 U;  2MQJ A;  5JHA A;  4B9K A;  4CO7 A;  5AZF A;  4IW0 A;  1LFD A;  2ZJD A;  4GIV A;  3SU8 X;  4ASW C;  3ZKJ C;  1PQS A;  2PPH A;  3TIX A;  2LRU A;  2CS4 A;  1L2N A;  2LXC A;  3K9O B;  3C0R B;  1LXD A;  2IBI B;  2I1J A;  3W1Y A;  3K9P B;  4AP4 C;  3GOE A;  2BGF A;  3L10 B;  5KHO A;  4ZDV A;  2GBN A;  4E71 A;  1P3Q U;  1WM2 A;  2AEH A;  2BWE S;  2OJR A;  3A9J A;  4EEW A;  1Q1O A;  1V80 A;  3VHT C;  2R2O A;  4ICV A;  3VXW A;  1WY8 A;  2IO2 B;  2ZCB A;  5J17 A;  3B1L X;  3APC A;  4NPN A;  2B3A A;  4IWQ A;  1F9J A;  4GSW A;  4FLH A;  1ZGU B;  4W9K A;  1YX5 B;  2KX0 A;  2WX0 A;  4MM3 A;  1KLV A;  2JT4 B;  5C23 A;  5TR5 A;  2Z59 B;  2LVP A;  4WAA A;  2CHW A;  4F8C B;  5IA7 A;  1GNU A;  2KTR A;  3PRM B;  2KVR A;  3M3J A;  3AI5 A;  3PRE A;  2C7N B;  2MSE D;  3N30 A;  4ANV A;  3HHM A;  3V6C B;  4AOF A;  3KVF B;  2GBJ A;  3S2A A;  3NS8 A;  4ICU A;  2RPQ A;  2K39 A;  2LGD A;  1Q0W B;  2KDB A;  3DVG X;  2JPH A;  2M1M A;  3ZW3 A;  2MRP A;  3RYT A;  2KJR A;  4HPL B;  4GDK B;  1WZ3 A;  1WX7 A;  4W9I A;  3KUD B;  4BVU C;  5KHQ A;  3WAO A;  4F1S A;  5E6N A;  4DDG D;  2K8B A;  3CF6 E;  3PTF C;  2XK5 B;  1R4N I;  2WDT B;  2AWT A;  5G2N A;  2KN5 A;  5DPS A;  4NJ6 A;  3ZDM C;  1OEY A;  1E8X A;  3L13 A;  3H7P A;  1NDD A;  5E6P A;  4GOC A;  2LRW A;  2IO0 B;  5AEK B;  4F7Z A;  1S1Q B;  1J8C A;  3V60 A;  2BYV E;  1U4A A;  3V62 A;  3UQA A;  2DHZ A;  2LJ5 A;  3QCA A;  4K1R B;  3N32 A;  1WGY A;  1E90 A;  1TTN A;  1WH3 A;  1WFY A;  1XQQ A;  2G4S A;  2JWZ A;  3ZRC A;  2K25 A;  2KAN A;  5JZE B;  5LXI B;  5IAA C;  2KOX A;  2DZM A;  2KK8 A;  4II3 B;  3H7S A;  1ZW7 A;  2BYE A;  2R2Q A;  4DHJ D;  2FIF A;  4GDL A;  5CTR C;  3IFW B;  1WX8 A;  2J0K A;  3A4S C;  3EFU A;  2O2V A;  3APF A;  4GMV A;  1D3Z A;  3ZDT A;  3L54 A;  4EFO A;  4A3O A;  2MX2 A;  2JZ3 B;  3JYU A;  2GBR A;  1WE6 A;  2KKC A;  2LVQ A;  2KX3 A;  3SD5 A;  2O6V A;  4IM3 A;  1FXT B;  2DZI A;  2NCN A;  3DBS A;  4HCP B;  1C1Y B;  5G55 A;  1XT9 B;  3D32 A;  4ZYN A;  3EHV A;  1QZE A;  4WJO A;  2RSU A;  3B08 A;  4HJK A;  4IM2 A;  2KWC A;  1WXA A;  3QQ8 B;  4WJN A;  3WAM A;  4ANW A;  3PVL A;  4XC2 A;  2M0X A;  1UBQ A;  2YLM A;  3OLM D;  2A4Z A;  4IUM B;  1WMH B;  2J0J A;  4B95 A;  4JIO U;  3RD2 A;  4DHZ B;  5LLI A;  1HE8 A;  2LXA A;  3DPD A;  4ANX A;  3L16 A;  2BKF A;  4FUL A;  4W9E A;  4PS8 A;  1AAR A;  2G3Q B;  4HWI B;  4MJS B;  1SGH A;  4JQW C;  3UIP B;  4ZRI A;  3I3T B;  4NQL B;  5D2M B;  2KQ7 A;  3EEC A;  2Z0D B;  3TL5 A;  3EC8 A;  4BKT A;  3ALB A;  4LJO B;  1H4R A;  3L0W B;  2PJH A;  2L3Z A;  3TJP A;  1EUV B;  1XD3 B;  2KLG A;  3V61 A;  2XEW A;  1V5O A;  2C5L C;  3ZRF A;  5DPT A;  3T9L A;  2N7D A;  1V49 A;  4N9F 4;  3VTU A;  2MP2 A;  4FJY A;  4BOZ B;  1C3T A;  4BKG A;  1WXM A;  2MCN B;  1JRU A;  2FCS A;  3OJ4 B;  4AJW A;  4NAW B;  3X0W A;  1UGM A;  2KLC A;  2D07 B;  2RR9 A;  2JZZ A;  3PZD A;  2AYO B;  2C60 A;  1VCB A;  2LVO A;  2YVC A;  1P98 A;  2ZEQ A;  4B6W A;  3H1U A;  5DCN A;  2MW5 A;  5DPW A;  1WIA A;  4I6P A;  1S3S G;  1TBE A;  3IBE A;  4DHZ E;  2IY0 B;  4JL9 A;  4G0N B;  2KC1 A;  4IC7 B;  1SE9 A;  1WI0 A;  2EMS A;  4MEL A;  3VH3 B;  3OAW A;  3L08 A;  3A9K A;  3ML9 A;  2REX A;  4HK2 A;  1WM3 A;  4OVV A;  4CHK A;  4K7U A;  3BY4 B;  5JHB A;  1WF9 A;  4HLE A;  1ISN A;  4MSQ B;  3WAL A;  2L00 B;  1M94 A;  3AUL A;  2N7E A;  1H8C A;  4CYE A;  3UGB B;  1BT0 A;  1IYF A;  3KYD D;  1GC6 A;  2M17 A;  4WQO B;  2W9N A;  3IG3 A;  4ZRK A;  3U30 A;  2MBQ A;  3MHS D;  1UBI A;  3VTV A;  2WX1 A;  4RM9 A;  4WWP A;  4XZ4 A;  2D3G A;  3U8Z A;  4AJY B;  2IYD B;  2KZR A;  4GU2 A;  4M0W B;  4ZRJ A;  2KMA A;  1WYW B;  2NS5 A;  3IVF A;  3QC8 B;  1I35 A;  1RAX A;  1UZX B;  2KDF B;  4GB9 A;  2PEA A;  2EMT A;  1GC7 A;  1E8Z A;  2KJ6 A;  1R4M I;  3NY5 A;  4BBN C;  1V81 A;  1WJ4 A;  2MWS B;  3KW5 B;  4NJ7 A;  3DOW A;  2M8S A;  2HJ8 A;  4AUQ C;  2ZVN A;  1UD7 A;  1V86 A;  3AU4 A;  3PSE B;  1E7V A;  3PRZ A;  5L83 A;  2D10 A;  2LZ6 A;  3VFK A;  4K81 A;  1V5T A;  1E8Y A;  3JVZ X;  1KJT A;  1WZ0 A;  5AZG A;  1T0Y A;  3DDC B;  2K1F A;  3KYC D;  4YL8 A;  1GUA B;  4WWO A;  2IO1 B;  2KFK A;  4HDQ A;  1KOT A;  2CHX A;  4XX5 A;  2BF8 B;  2GMI C;  4AWJ A;  1WMH A;  3GZN I;  2BPS A;  5E6O A;  1NBF C;  2A5U A;  2LAS A;  4MH0 E;  4MGK E;  3RZF A;  4FHK A;  2DYM A;  4KIK A;  2DYO A;  4BBN F;  4KVG B;  1KM7 A;  4MJS A;  4TQ1 A;  1YJ1 A;  2G4D B;  3SDL C;  2C9W B;  2BYF A;  2EKE C;  3H9D A;  5D7G A;  3N3K B;  1EF1 A;  1WX9 A;  2L7R A;  3CSF A;  3VVW B;  2K8H A;  2KMC A;  5DPR A;  1G6J A;  4IG7 B;  2NR2 A;  3ZNH B;  4BFR A;  2PE9 A;  2RGF A;  2PE6 B;  2N9P C;  3QX1 A;  2N9X A;  2GOW A;  2K8C A;  4TKN A;  3A4R A;  2KQS A;  3RUI B;  4LDT D;  1OGW A;  3KUZ A;  2DX5 B;  4TUU A;  5J2R A;  3RUL A;  4DHJ B;  4NAW A;  2CU1 A;  4DK5 A;  4W9F A;  3VAW A;  2C7M B;  2J7Q B;  1P0R A;  2CKH B;  1TGZ B;  3HK0 A;  4W9H A;  2N1V A;  4FJV B;  1YX6 B;  4RMA A;  5LXH A;  2KHW B;  3M95 A;  3ZNZ B;  3MTN B;  2K6D B;  4II2 B;  4PS7 A;  3AU5 A;  2N9E B;  1UEL A;  2I1K A;  2L8J A;  1V9J A;  2M4N A;  3DBR I;  4HPM B;  3VUY A;  2V4L A;  2O6V D;  4K7W A;  1GG3 A;  4KZ0 A;  3ZUN A;  4TQ0 A;  3ONS A;  2BKR B;  2N4F A;  2JRI B;  1SIF A;  3DVN U;  3H6N A;  5FR6 A;  2NVU I;  4PYU A;  4WWN A;  4EUT A;  2KDI A;  2DZJ A;  4KZC A;  4P7I A;  1IPG A;  3T8M A;  4W9D A;  3ZNI D;  5HKH A;  2J0M A;  4URK A;  3R66 C;  4KSL C;  3QAQ A;  2MBO A;  1V6E A;  3TCA A;  1IP9 A;  1L7Y A;  3QWZ B;  4IWP A;  5BO4 B;  1I42 A;  3LDZ E;  4FBJ B;  1LQB A;  5L95 C;  2IO3 B;  4BKS D;  5D6J B;  4HVB A;  2JF5 A;  4IM0 A;  3KH0 A;  1E5W A;  4HXD A;  1UH6 A;  1WJ6 A;  2KFJ A;  2UWQ A;  4FN2 A;  4GDK A;  1WXS A;  2O6V B;  2MBB B;  1RRB A;  3IHP C;  3PHW B;  1Q5W B;  2D2Q A;  3DBH I;  2NBU A;  3MJW A;  3P2B A;  3A1Q B;  4G50 A;  4MGY E;  2FNJ B;  2XK5 A;  3WA0 A;  2D11 A;  1EO6 A;  3QAR A;  2LD9 A; 
#chains in the Genus database with same CATH topology
 1FO4 A;  4KDI C;  1FRR A;  4ZHO A;  3TEX A;  3Q8F A;  2OOB B;  2KO3 A;  2WXH A;  1V2Y A;  4ANU A;  1ET9 A;  3AXC A;  3AM9 A;  3B9J A;  4GGQ A;  4ZYS A;  3ENE A;  4W9G A;  1E10 A;  2V1Y A;  4PT5 A;  2KTF A;  3L17 A;  1WGG A;  4PYZ A;  1GJZ A;  2MLB A;  5EDS A;  1YIW A;  1T0S C;  1VZ7 A;  4K3C A;  1F77 A;  4MDK E;  3X23 A;  2IGG A;  4AQ7 A;  4WAF A;  3QA8 A;  1YQ4 B;  2KWV B;  2NPT B;  2H89 B;  1J7B A;  3T3N A;  2N1W A;  2IZV B;  4S17 A;  2CU3 A;  2AL6 A;  2AL3 A;  1MPE A;  2D3A A;  2KJH B;  1QOB A;  1HZ5 A;  1YN4 A;  1RFA A;  1SF0 A;  3A9J B;  4HRO A;  3A9K B;  4YWG G;  3NZ3 A;  2ZNV B;  5G5H A;  4HDO A;  3RMK C;  2V4I B;  1TKE A;  2W82 A;  1ZE3 D;  4MGI E;  2L05 A;  2R61 A;  3PLU A;  3VUX A;  4ARI A;  4DDI D;  2QMT A;  2ZZP B;  4N58 A;  1C78 A;  4RF1 A;  3QJZ A;  1WGH A;  1XLQ A;  2KC2 A;  4P6V F;  2MEK A;  3N9Y C;  4LCD E;  5AZH A;  3PV1 A;  1UF0 A;  4TV3 A;  3M63 B;  3N1X C;  2V9H A;  2DNF A;  3NVZ A;  2WLB A;  1E8W A;  4MEM A;  2ZW1 A;  3NHE B;  2KFK B;  2WXO A;  4FJZ A;  3ZXV A;  1Y56 A;  1QLB B;  5CHW A;  3M62 B;  2DYB A;  1BML C;  3HM6 X;  3DHI C;  1TZ1 A;  1FM0 D;  1WGD A;  1JQ4 A;  4C4V B;  2KXJ A;  1K8R B;  1VZ6 A;  2RDG A;  4WJP A;  2FCN A;  2FCQ A;  3ML8 A;  3ZJT A;  5MPO A;  1IGD A;  4OW0 A;  2MHJ A;  1A70 A;  3TEY A;  2NPT A;  3E56 A;  3IXS A;  1T6B X;  4GIV A;  1GB1 A;  1LXD A;  3K9P B;  3L10 B;  5KHO A;  4EEW A;  1P3Q U;  2BWE S;  2OJR A;  3A9J A;  1Q1O A;  3VHT C;  2IO2 B;  2WU2 B;  2VH1 A;  4IWQ A;  3KLS X;  4W9K A;  4FLH A;  1ZGU B;  1UWX A;  2RDH A;  2JT4 B;  5C23 A;  4GLS C;  2CHW A;  2I2Y A;  4M01 A;  3PRE A;  2LHE A;  3VR9 B;  3N30 A;  4R3D A;  4ANV A;  1EU3 A;  2RPQ A;  1BXT A;  2BQQ A;  4YSX B;  3ZW3 A;  4OVZ A;  4N6E B;  3Q2A C;  4F1S A;  5E6N A;  2GRI A;  4HJG E;  2AWT A;  3Q14 C;  2QC8 A;  1DOY A;  3R8B A;  3IAS 1;  3R2T A;  4GOC A;  2LRW A;  2IO0 B;  1J8C A;  1U4A A;  3V62 A;  3MFG A;  1KLU D;  2K25 A;  2KAN A;  5IAA C;  1GB4 A;  4II3 B;  3N20 C;  1DGJ A;  5CTR C;  2VH2 A;  3GE3 C;  1WX8 A;  1N62 A;  1WXQ A;  3L54 A;  2MX2 A;  2JZ3 B;  2KKC A;  2XNA C;  3N1Z C;  3SD5 A;  4C4V A;  1YQ3 B;  2LMC A;  3Q8E A;  1WGK A;  3HUI A;  2M56 B;  1IBX A;  3BYT B;  3B08 A;  4IM2 A;  2Q5W D;  4ANW A;  5TSS A;  2M0X A;  3FIL B;  1UBQ A;  2A4Z A;  4JIO U;  5LLI A;  2LXA A;  4ANX A;  4ITK A;  4B0E A;  5C2T B;  1KTK A;  4JQW C;  2KQ7 A;  3ALB A;  2PTL A;  3BYY B;  1EUV B;  1XD3 B;  2VZK B;  2XEW A;  2IPK D;  2C5L C;  3ZRF A;  5DPT A;  3T9L A;  1V49 A;  4N9F 4;  1SIJ A;  3VTU A;  1YMH E;  4ZRP A;  4BKG A;  3KWV A;  2L52 A;  1WXM A;  2MCN B;  3OJ4 B;  4NAW B;  2KLC A;  2AYO B;  2C60 A;  4LNF A;  1P98 A;  3H1U A;  2QEJ C;  5DCN A;  5BYR A;  3LYY A;  2GI9 A;  3Q69 A;  1ENF A;  4IC7 B;  1SE9 A;  4A6Q A;  1C77 A;  2NTS A;  1WM3 A;  4OVV A;  4REZ A;  2PW9 A;  4YTN B;  3BY4 B;  2L00 B;  3AUL A;  2WXP A;  1H8C A;  4CYE A;  1TIF A;  3KYD D;  2M17 A;  2W9N A;  3IG3 A;  3VTV A;  3MHS D;  3ZXR A;  2WX1 A;  4XZ4 A;  2BBC A;  4GU2 A;  1FNW A;  1FXA A;  3U2S C;  3QC8 B;  1F1H A;  1RAX A;  1UZX B;  2BW2 A;  4K3B A;  2PEA A;  4RGN A;  2KJ6 A;  4BBN C;  1V81 A;  2MWS B;  3KW5 B;  3DOW A;  2M8S A;  1I4Q A;  2D10 A;  3AEC B;  1V5T A;  2WNM A;  1KJT A;  1I4G A;  2WXL A;  5IOI A;  4LNO A;  2KN4 A;  5AZG A;  1T0Y A;  4HDQ A;  2BF8 B;  2PVO D;  1VZ8 A;  2BPS A;  4MH0 E;  4MGK E;  2BTE A;  3AE1 B;  2DYM A;  4KIK A;  4BBN F;  3AEF B;  1KM7 A;  1SXT A;  4TQ1 A;  1XO3 A;  1YJ1 A;  3DWG C;  3AE4 B;  2L7R A;  2B76 B;  3VVW B;  3ZNH B;  4BFR A;  2PE9 A;  1K51 A;  3RUI B;  4LDT D;  3KUZ A;  4LTU A;  4NAW A;  2CU1 A;  2CKH B;  1YX6 B;  2KHW B;  4II2 B;  3AU5 A;  1UEL A;  4HPP A;  4IKG A;  4KZ0 A;  3DBL B;  5H92 C;  1XCT L;  2KDI A;  3DHG C;  4W9D A;  4C7Y A;  2J0M A;  4URK A;  3TCA A;  1FEH A;  3BK2 A;  3URY A;  4L2Y A;  3QWZ B;  3FKY A;  5BO4 B;  3LDZ E;  4FBJ B;  2IO3 B;  4HVB A;  2JF5 A;  4IM0 A;  1E5W A;  4HXD A;  5E6J A;  1CZP A;  1SB3 C;  4GDK A;  1MHH E;  3PHW B;  3ZJU A;  2FNJ B;  4KKI A;  2XK5 A;  2MJ3 A;  1X1M A;  3VDZ A;  2LD9 A;  1PYW D;  4EZK A;  1QQR A;  1NEN B;  4W9J A;  3VTW A;  3AEE B;  1C4C A;  3PLV A;  3R7R A;  1WR1 A;  3JSV B;  2M0A A;  2MH7 A;  3PPA A;  3NZS A;  3PRP B;  4FA6 A;  2EKI A;  4M8N A;  2LGI A;  3MP9 A;  3ZLZ A;  2LUE A;  3RI7 C;  2AX5 A;  1LGR A;  4XDD A;  4J6I A;  4EZJ A;  2KAC A;  1LM8 B;  2K6Q A;  3ZTD A;  1WJU A;  4DXG A;  2LWP A;  2HD5 B;  1D5X C;  4EOY A;  1F2R C;  1WXV A;  2MP2 B;  3PGE A;  2L32 A;  1JAL A;  2GBM A;  3H8H A;  1J0G A;  4BOS C;  4K7S A;  3ZYY X;  1C79 A;  2DWQ A;  4HKQ A;  2LGY A;  4RH6 A;  2CR5 A;  4FHJ A;  4L1B A;  4W9L A;  4E3C A;  1J7C A;  3DWM A;  1VRA B;  3P4Q B;  3R3M A;  1GPX A;  2V3N A;  1WGR A;  1Z5S B;  1NI3 A;  3DQV A;  3Q6B A;  4MM3 B;  3RT3 B;  2ZPY A;  1I4X A;  2KTR B;  5BMG A;  1OQY A;  5CX3 A;  3PZ7 A;  4GXB A;  3IT4 B;  4MGZ E;  2LGX A;  1KF6 B;  2KYW A;  1XF5 L;  5D94 A;  2RPV A;  3WIM A;  3ZO5 B;  2PIA A;  3EFC A;  2KDE B;  3QHT A;  4E74 A;  4EE2 A;  3CST A;  4M8M A;  5GMV A;  3W1S A;  1MG4 A;  4YSY B;  3JSV A;  1QOA A;  1VD2 A;  2MJD A;  2VRR B;  4G11 A;  3HVD A;  2DEN B;  1AW7 A;  2V0G A;  3QIJ A;  4PS3 A;  4MSM B;  2HTH A;  3VUW A;  2MBE A;  2G45 B;  3PT2 B;  4A3P A;  3P63 A;  3PO0 A;  2DAF A;  1JW9 D;  2D3B A;  2J4X A;  2Y5P A;  2N9L A;  2BVC A;  2QSD A;  3N1Y C;  2MQJ A;  5JHA A;  4KGS A;  4CO7 A;  5AZF A;  4IW0 A;  1LFD A;  2ZJD A;  4ASW C;  1TS4 A;  1L2N A;  2LXC A;  3C0R B;  2I1J A;  2KVZ A;  3W1Y A;  3GOE A;  2BGF A;  4E71 A;  1WM2 A;  2AEH A;  1V80 A;  2HJ1 A;  3AE9 B;  1V1O A;  4ICV A;  3VXW A;  3APC A;  1E9M A;  1KRH A;  4NPN A;  1F9J A;  1WWT A;  1YX5 B;  1ZXI A;  1L5P A;  2KX0 A;  4MM3 A;  1KLV A;  5TR5 A;  2LVP A;  5IA7 A;  2KTR A;  3PRM B;  3M3J A;  2INC C;  2G9H D;  1GAQ B;  4P16 A;  1EM7 A;  3HHM A;  3V6C B;  3KVF B;  2GBJ A;  4ICU A;  2K39 A;  2RMM A;  1PDX A;  2JPH A;  2M1M A;  2MRP A;  2BS3 B;  3RYT A;  2KJR A;  3RNF C;  4W9I A;  2QCZ A;  4DDG D;  3CF6 E;  1DYQ A;  5G2N A;  2J52 A;  5FK9 C;  1OEY A;  2LHD A;  1NDD A;  3AV8 A;  5E6P A;  1VLB A;  5AEK B;  4JE3 B;  3AED B;  2NMQ A;  2LJ5 A;  1E0Z A;  4A8X C;  1E90 A;  1TTN A;  3ZRC A;  4FXC A;  4H2A A;  1F52 A;  3W5V B;  2DZM A;  3H7S A;  1QIL A;  1PGA A;  4TMA B;  4RGM A;  2RDB C;  1IUE A;  1HA5 A;  1NVI D;  3DBS A;  1XT9 B;  3D32 A;  1QZE A;  4WJO A;  1ZP0 B;  4LK0 M;  4HJK A;  1HZ6 A;  2I38 A;  2N0S B;  2YLM A;  4IUM B;  2J0J A;  1RM6 C;  1N5X A;  1YN3 A;  4DHZ B;  5G5G A;  4ZRQ A;  1VJK A;  2Y5C A;  4HWI B;  3GP7 A;  4MJS B;  4ZRI A;  1UNS A;  5D2M B;  3EUB 2;  3NUH B;  3RPF C;  4YTM B;  4LJO B;  1H4R A;  3BZD B;  2ZW0 A;  2L3Z A;  2KLG A;  3V61 A;  3AEA B;  1P7E A;  1AYF A;  1FCL A;  1JWM D;  5HFY A;  2L83 A;  3GB1 A;  4FJY A;  4HKZ E;  2MJE A;  1Q10 A;  1JRU A;  2FCS A;  4AJW A;  2WXR A;  4TSS A;  2RR9 A;  4A9A A;  2OHF A;  2AQ3 B;  2W3S A;  2UU7 A;  5DPW A;  1WIA A;  4I6P A;  1S3S G;  3AH7 A;  2IY0 B;  1TY2 A;  1WI0 A;  3VH3 B;  4RCO A;  2PMV A;  3A9K A;  3ML9 A;  4CHK A;  2ACZ B;  3WAL A;  3UGB B;  2OED A;  1IYF A;  2DBY A;  1GOZ A;  4WQO B;  2JX5 A;  1TJE A;  3U30 A;  2FBW B;  1UBI A;  4RM9 A;  1C76 A;  3U8Z A;  2KMA A;  1MFW A;  1I35 A;  2GB1 A;  2IGH A;  3NY5 A;  4NJ7 A;  1B1Z A;  1UD7 A;  1E7V A;  1CJE A;  3VFK A;  1FNV A;  1E8Y A;  3JVZ X;  2QJL A;  2M19 A;  5GXG B;  2X38 A;  1TS5 A;  1YN5 A;  5EE9 A;  3DHH C;  4YL8 A;  1GUA B;  2IO1 B;  2KFK A;  2CHX A;  1D4B A;  1ZDX A;  1CQV A;  3NG0 A;  3GZN I;  1BUI C;  1TKY A;  1NBF C;  4JPS A;  3RZF A;  3GZN B;  1ROE A;  4KVG B;  3RFZ B;  4MJS A;  2INP E;  2G4D B;  2LUM A;  3SDL C;  2EKE C;  1KH0 A;  2HTM E;  3H9D A;  5D7G A;  4A55 A;  3P4P B;  4DQO C;  3W5U B;  3CSF A;  2WDR B;  2WXJ A;  2WXQ A;  1G6J A;  2NR2 A;  1EO6 A;  2K3U A;  2IGD A;  2RGF A;  3SFE B;  2N9X A;  3A4R A;  2D3C A;  1OGW A;  2DX5 B;  4TUU A;  5J2R A;  4HEA 1;  3Q3O C;  3VAW A;  2J7Q B;  4W9H A;  3O13 A;  4FJV B;  3CWI A;  4PS7 A;  3AE6 B;  2L8J A;  2M4N A;  3DBR I;  2V4L A;  2O6V D;  4K7W A;  2E3T A;  1PGX A;  3DBR B;  3TUO A;  2FUG 1;  1N60 A;  4TQ0 A;  1EWY C;  2BKR B;  1SIF A;  5FR6 A;  4NAM A;  4MH8 A;  3T8M A;  2DLB A;  3R66 C;  3QAQ A;  1IP9 A;  1V6E A;  1L7Y A;  2J42 A;  1I42 A;  2K5P A;  1OQQ A;  2FE8 A;  1I4R A;  1UH6 A;  5AUK A;  4FN2 A;  2O6V B;  2MBB B;  5D3D A;  3P2B A;  2NBU A;  4G50 A;  1TT5 B;  2Y3A A;  3U7Z A;  3ETR A;  4NY0 A;  4ACF A;  3PHX B;  2L0F A;  2LEK A;  3EA6 A;  2FCM A;  4WJQ A;  2XBB C;  3SEB A;  3DVG Y;  3RNE C;  1PUT A;  1FXI A;  2BYT A;  1J19 A;  1CMX B;  1HEZ E;  3UQB A;  5J18 A;  4I6L B;  5AUI A;  1P9D U;  3O65 B;  3V6E B;  1TZO A;  2JRH A;  3WAP A;  3UF8 A;  3I5J C;  3WAN A;  2CHZ A;  4JGH B;  3Q8B A;  2KWU B;  1I4P A;  2DAJ A;  2LGS A;  4NQK E;  3TEW A;  3A33 B;  3RNC C;  4RM8 A;  4JWS C;  3RNB C;  3GS2 A;  3B0A A;  3FIL A;  1ESF A;  2LI5 A;  2QDF A;  3CMM B;  3OJ3 A;  3Q3F A;  3KWL A;  4GN1 A;  2QHO A;  1YOV B;  3BVZ A;  3I63 C;  1IGC A;  4C00 A;  3AE3 B;  4LJP B;  2C7H A;  4W9C A;  4KV2 A;  4HCN B;  2UYZ B;  2Y5B B;  2Z0E B;  1Y8R C;  2KD0 A;  1YJI A;  3W9C B;  2ZVO A;  3ECI A;  4D2K A;  3U7D A;  1RLF A;  2BT6 A;  4OVU A;  3V3X A;  4N59 A;  1AN8 A;  3ZNG C;  3P42 A;  4G3X B;  2MBH A;  3HRD D;  3VQI A;  2IDY A;  1Z2M A;  3H7P B;  3VH4 B;  3SHQ A;  3AMZ A;  3DBL I;  2ZPN A;  3NOB A;  4C56 C;  1SBB B;  2JYE A;  1WRD B;  4A90 A;  4FAD A;  1N5W A;  4LDT B;  5EE1 A;  5CHV C;  3UIO B;  3DVN V;  1WJN A;  2L76 A;  3KUC B;  5JXV A;  1C4A A;  1EF5 A;  4KKJ A;  3TBL D;  4DBG A;  2WWZ A;  2O2V B;  3ZTC A;  2W54 A;  5FKA C;  1WR6 E;  1MHX A;  2FAZ A;  3I57 A;  3PZ8 A;  2JSV X;  3DCG A;  3HM3 A;  1A5R A;  3R7Q A;  1MJD A;  1HTO A;  2ZNV C;  3ZVV A;  5IN7 A;  1L6V A;  4KSK C;  5C1Z A;  4EKU A;  2WS3 B;  4YSZ B;  4RNA A;  1L0X B;  2KAJ A;  4B9K A;  1XLO A;  3SU8 X;  5BYQ A;  3ZKJ C;  1PQS A;  3TIX A;  1TS3 A;  4YT0 B;  5BYS A;  2CS4 A;  3FAH A;  5IP4 D;  4M02 A;  4ZDV A;  2GBN A;  2AQ1 B;  2R2O A;  1KFY B;  1WY8 A;  2ZCB A;  1JML A;  3B1L X;  3MC0 B;  2WX0 A;  3AE7 B;  3Q8C A;  1VDV A;  4WH4 A;  5H8Y E;  4F8C B;  3BII D;  3AI5 A;  2C7N B;  2MSE D;  1YJJ A;  3S2A A;  3NS8 A;  2LGD A;  1Q0W B;  2KDB A;  3C19 A;  3DVG X;  1HTQ A;  4BVU C;  5KHQ A;  5D3I B;  2L1A A;  2K8B A;  3PTF C;  1ZUD 2;  1R4N I;  2K9X A;  1TS2 A;  1R4N B;  1F0Z A;  3ZDM C;  3L13 A;  3H7P A;  4RGT A;  4OZC A;  4US8 A;  4AS1 A;  2IJ0 A;  4OZB A;  2BYV E;  2QIE B;  4JWU C;  1WGY A;  2G4S A;  1XQQ A;  2WU5 B;  5JZE B;  5LXI B;  2IND C;  2KOX A;  3NJT A;  4DHJ D;  1J7A A;  3IFW B;  1FMA D;  3MC8 A;  4RGO S;  1D3Z A;  2YEP F;  2O2V A;  1QOF A;  4S0R A;  3JYU A;  2LVQ A;  1WE6 A;  3AEG B;  2LFI A;  2DZI A;  4UDU C;  1I7H A;  2NCN A;  4HCP B;  5G55 A;  1OFF A;  1K53 A;  2BB6 A;  1L4Z B;  2KWC A;  3WAM A;  3PVL A;  1FD6 A;  3OLM D;  2E6X A;  1E7P B;  4B95 A;  3WCQ A;  1HE8 A;  2BKF A;  4FUL A;  2LJI A;  4PS8 A;  3Q3N C;  3UIP B;  2CJN A;  2WXN A;  3I3T B;  4NQL B;  2Z0D B;  3TL5 A;  3EC8 A;  4BKT A;  1R7S A;  4NZL B;  1V8C A;  1T0Q C;  3IT6 B;  2PJH A;  2MP2 A;  3P1M A;  3VRB B;  4BOZ B;  1C3T A;  1FIQ A;  3BVG A;  1D5Z C;  3X0W A;  2CJO A;  2D07 B;  2JZZ A;  3PZD A;  1VCB A;  2LVO A;  3RNG C;  4C7Z A;  4BZA A;  3P4R B;  1FCC C;  1ZOY B;  2MW5 A;  4LNI A;  4DHZ E;  4JL9 A;  3SFD B;  2KC1 A;  3NVW A;  4HK2 A;  4PK1 A;  3NRZ A;  1WF9 A;  4HLE A;  1QF6 A;  3ABV B;  1ISN A;  5BMH A;  1M94 A;  2N7E A;  1BT0 A;  1GC6 A;  4ZRK A;  2MBQ A;  4M00 A;  4WWP A;  1SJE D;  2D3G A;  2KZR A;  3P4S B;  4ZRJ A;  4C80 A;  1WYW B;  2NS5 A;  3IVF A;  2KDF B;  1CK1 A;  1E8Z A;  3TEZ A;  2HJ8 A;  2SEB D;  2ZVN A;  1N63 A;  4YTP B;  4AUQ C;  1V86 A;  3AU4 A;  4WQM A;  3PSE B;  3AB5 A;  5L83 A;  3PRZ A;  2LZ6 A;  1WYG A;  3AE5 B;  4K81 A;  1V1P B;  1WZ0 A;  3DDC B;  2K1F A;  3KYC D;  1KOT A;  1SE4 A;  2GMI C;  4US9 A;  2ICI A;  2A5U A;  4FHK A;  2V3P A;  3FC4 A;  2DYO A;  3C8Y A;  1JCK B;  1XEE A;  3U52 E;  1ET6 A;  3ZJV A;  1WX9 A;  4KGT A;  1WSP A;  2KMC A;  5DPR A;  1L4D B;  4DXF A;  3QX1 A;  2K8C A;  4WIP A;  1QKZ A;  3RUL A;  1I4H A;  4DK5 A;  4W9F A;  2C7M B;  3HK0 A;  1TGZ B;  1UGJ A;  2TSS A;  2D5G A;  2AQ2 B;  4RMA A;  3HVZ A;  1VR9 A;  2K6D B;  2N9E B;  2I1K A;  4L23 A;  2PVG C;  4HPM B;  5I4D A;  1B9R A;  1F2R I;  1ZXH A;  3ONS A;  1DOI A;  2JRI B;  3H6N A;  3DVN U;  3KQ4 A;  2KT7 A;  4OHJ A;  4WWN A;  4KZC A;  4P7I A;  3ZNI D;  1OQR A;  3J9C A;  1MVK A;  3LXF A;  2MBO A;  5L95 C;  1LQB A;  4BKS D;  3KH0 A;  5IKC M;  2YEP B;  1XLP A;  1JWA D;  1RRB A;  2WXM A;  3IHP C;  1Q5W B;  2D2Q A;  1JRP A;  1TYG B;  3A1Q B;  4MGY E;  3WA0 A;  1JRO A;  3QAR A;  1IBX B;  4EZL A;  1YQB A;  5C3J B;  4I6N B;  3LB8 C;  2JUO A;  2FUH B;  1V1P A;  4XGA B;  1V97 A;  3ZIM A;  2NBW B;  3RCZ A;  1DOX A;  1FFU A;  2INN E;  4RFB A;  4Q2J A;  2KNB A;  1E7U A;  4DWF A;  4NNJ B;  4CQN A;  2WGS A;  3Q3J A;  2ASQ A;  3ZGZ A;  3AEB B;  1OTR B;  3NVV A;  5CHF A;  2JVC A;  2MA9 B;  3UIN B;  4O1N A;  3RN9 C;  2FID A;  2JXX A;  1SEB D;  2KWD A;  2DZK A;  4XWT A;  1ACC A;  1P1A A;  1AWD A;  1FRD A;  4KDL B;  1OEY J;  2NBV B;  1TKG A;  2RD0 A;  5FR3 A;  1NYQ A;  3LJ3 A;  2K22 A;  3BVM A;  3NZU A;  3PS6 A;  4P1B C;  3QK0 A;  3VRA B;  2IY1 B;  3RZW C;  3W1S C;  3OWE B;  1WRI A;  4XWW A;  4NJC A;  4XDC A;  1RFK A;  2KMM A;  4KGR A;  1T5X D;  1JWU D;  3APD A;  2W3R A;  3HIZ A;  1N61 A;  2BWF A;  4JLC A;  4A20 A;  1NI2 A;  2G1E A;  4JX1 C;  5BMI A;  2KDM A;  3ZQ4 A;  2ZCC A;  1RWS A;  2V3S A;  3A1Q A;  2JXT A;  3AN1 A;  1M4V A;  2BS4 B;  2W55 A;  2WYQ A;  2VZK D;  2XN9 C;  3BIN A;  1SSN A;  1QT9 A;  3BWU D;  1MG8 A;  4BKS A;  3TMP B;  5IO9 A;  4X57 B;  1ZKH A;  4KIK B;  4GDL B;  5JH5 C;  2QIL A;  2HE7 A;  2JZP A;  1WE7 A;  2GBK A;  2JY6 A;  4IDI A;  4RF0 A;  1FFV A;  4OZA A;  3JW0 X;  4IWO A;  2L0T A;  5EE0 A;  4DXA B;  3IAM 1;  5T8I A;  2WDQ B;  5HI1 A;  1YD8 U;  1TY0 A;  2N9K A;  1L6U A;  2PPH A;  1JWS D;  2LRU A;  3K9O B;  2IBI B;  4AP4 C;  1K52 A;  3E9S A;  5EE3 A;  3UI3 A;  1N6Z A;  5J17 A;  2B3A A;  3AE2 B;  1D5M C;  4GSW A;  1T3Q A;  2ONQ A;  1D6E C;  4QAY A;  2Z59 B;  3R2I A;  4WAA A;  1GNU A;  1PGB A;  3OG5 A;  2KVR A;  5HG2 A;  4AOF A;  3NVY A;  3SR6 A;  3BK1 A;  4HPL B;  4GDK B;  1WZ3 A;  1WX7 A;  3KUD B;  1K50 A;  3GE8 C;  3WAO A;  2WDV B;  2XK5 B;  2WDT B;  2KN5 A;  5DPS A;  4NJ6 A;  1E8X A;  1RYJ A;  2OJW A;  4F7Z A;  1S1Q B;  3V60 A;  3UQA A;  2DHZ A;  3QCA A;  4K1R B;  3N32 A;  1WFY A;  1WH3 A;  2JWZ A;  2KK8 A;  1ZW7 A;  2BYE A;  2R2Q A;  2FIF A;  4GDL A;  3NS1 A;  4MAC A;  4KX6 B;  2J0K A;  3VR8 B;  1EWC A;  3A4S C;  3APF A;  3EFU A;  4GMV A;  3ZDT A;  5LNK 1;  4EFO A;  4A3O A;  2GBR A;  1UUP A;  2KX3 A;  3W2D A;  2O6V A;  4IM3 A;  1FXT B;  4WWM A;  1C1Y B;  4B0M A;  1ZDV A;  4ZYN A;  3EHV A;  2JQR B;  2RSU A;  2Z8L A;  3QQ8 B;  1WXA A;  4WJN A;  4XC2 A;  3EGR A;  1QOG A;  1WMH B;  3RD2 A;  3DPD A;  3L16 A;  4W9E A;  1AAR A;  2JYT A;  2G3Q B;  1C4P A;  1SGH A;  3EEC A;  4P1C C;  3L0W B;  3TJP A;  1KLG D;  1V5O A;  1FNU A;  3CIR B;  2N7D A;  4IOI E;  2WXK A;  3V05 A;  3U4E G;  1UGM A;  3B2F A;  2WP9 B;  2YVC A;  2ZEQ A;  4B6W A;  4BAX A;  1P7F A;  2BB5 A;  1TBE A;  3IBE A;  1XCQ L;  4J3O D;  4G0N B;  2EMS A;  4MEL A;  3OAW A;  3L08 A;  2REX A;  2WXI A;  3T3O A;  4K7U A;  3MC9 A;  5JHB A;  1UWM A;  1NYR A;  4MSQ B;  2WHI A;  4ZHP A;  2X8X X;  4AJY B;  2IYD B;  2SAK A;  2J53 A;  4M0W B;  1MI0 A;  4GB9 A;  2EMT A;  1GC7 A;  1R4M I;  2EEL A;  1WJ4 A;  1R4M B;  2JWU A;  1ZPS A;  2ON8 A;  1EU4 A;  1HXY D;  4WWO A;  4AWJ A;  4XX5 A;  4HRS A;  1WMH A;  5E6O A;  2KQ4 X;  2LAS A;  3MHZ A;  2H88 B;  2JU6 X;  1JWB D;  3TSS A;  1L0V B;  4WUR A;  2C9W B;  2BYF A;  4ARC A;  3B2G A;  2NTT A;  1SE3 A;  3N3K B;  1EF1 A;  1PFD A;  2K8H A;  4MT5 A;  4IG7 B;  1T0R C;  2WXF A;  2PE6 B;  2N9P C;  3RNA C;  2GOW A;  3AE8 B;  4TKN A;  2GLS A;  3Q3M C;  2KQS A;  1E6E B;  1LO5 D;  1XXG A;  1L0Y B;  4DHJ B;  1YNT E;  1XLN A;  2K0P A;  1P0R A;  2WQY B;  4USA A;  1HQR D;  1SE2 A;  2N1V A;  2PLP A;  5LXH A;  2BS2 B;  3M95 A;  3ZNZ B;  3MTN B;  3MJ5 A;  4XE0 A;  2HDE A;  1V9J A;  3VUY A;  4LNN A;  1GG3 A;  1NEK B;  3L4P A;  3ZUN A;  2N4F A;  4LNK A;  2NVU I;  3I9V 1;  4PYU A;  4EUT A;  2DZJ A;  2N7J A;  1SJH D;  1IPG A;  5HKH A;  4KSL C;  4IWP A;  1STE A;  4ZOH C;  2WXG A;  5D6J B;  4M0W A;  1WJ6 A;  2KFJ A;  2PKO A;  2UWQ A;  4YXD B;  3Q8A A;  1WXS A;  4XYC A;  1C9F A;  5HHD G;  1FPY A;  3DBH I;  3MJW A;  4LLG M;  2D11 A;  3DBH B; 
#chains in the Genus database with same CATH homology
 1A5R A;  4EZK A;  4KDI C;  4NY0 A;  4W9J A;  3VTW A;  4EZL A;  1YQB A;  3PLV A;  3PHX B;  2L0F A;  4I6N B;  2FCM A;  3VDZ A;  2OOB B;  1WR1 A;  2KO3 A;  2XBB C;  1V2Y A;  3JSV B;  4WJQ A;  3AXC A;  2JUO A;  1X1M A;  4ANU A;  2FUH B;  3DVG Y;  3PPA A;  4GGQ A;  3ENE A;  3NZS A;  3PRP B;  4FA6 A;  4W9G A;  1J19 A;  3ZIM A;  2V1Y A;  2NBW B;  1CMX B;  2KTF A;  3L17 A;  3RCZ A;  3UQB A;  5J18 A;  4M8N A;  4I6L B;  1WGG A;  4PYZ A;  1GJZ A;  2MLB A;  3ZLZ A;  5EDS A;  1P9D U;  1YIW A;  2KNB A;  2LUE A;  3O65 B;  3V6E B;  1E7U A;  4DWF A;  4J6I A;  2JRH A;  4EZJ A;  4NNJ B;  1LM8 B;  2K6Q A;  3ZTD A;  3WAP A;  3UF8 A;  1WJU A;  3WAN A;  2CHZ A;  2LWP A;  4JGH B;  3Q3J A;  4MDK E;  2HD5 B;  3X23 A;  2ASQ A;  4EOY A;  2KWU B;  1WXV A;  2DAJ A;  2MP2 B;  1OTR B;  4NQK E;  3PGE A;  5CHF A;  3A33 B;  2JVC A;  2MA9 B;  3QA8 A;  2GBM A;  2KWV B;  2NPT B;  1J0G A;  3UIN B;  2N1W A;  2IZV B;  4K7S A;  4BOS C;  4RM8 A;  2AL6 A;  2AL3 A;  2FID A;  3R7R A;  2JXX A;  3B0A A;  2DZK A;  1P1A A;  2LGY A;  4KDL B;  2KJH B;  2CR5 A;  1OEY J;  2LI5 A;  2NBV B;  4FHJ A;  3CMM B;  2RD0 A;  3OJ3 A;  3Q3F A;  4GN1 A;  2QHO A;  1RFA A;  4W9L A;  3A9J B;  4E3C A;  3A9K B;  3R3M A;  3LJ3 A;  2ZNV B;  4LJP B;  1WGR A;  1Z5S B;  3NZU A;  2C7H A;  3PS6 A;  4W9C A;  3QK0 A;  4HCN B;  3DQV A;  4KV2 A;  2IY1 B;  2UYZ B;  4HDO A;  3RT3 B;  3RZW C;  2Y5B B;  2Z0E B;  2ZPY A;  3W1S C;  2KTR B;  4MGI E;  1Y8R C;  1OQY A;  2L05 A;  3PLU A;  3VUX A;  5CX3 A;  4GXB A;  2KD0 A;  4DDI D;  3APD A;  2ZVO A;  2ZZP B;  3ECI A;  3HIZ A;  4MGZ E;  2LGX A;  2BWF A;  3QJZ A;  3U7D A;  1RLF A;  4JLC A;  4A20 A;  1WGH A;  1NI2 A;  2KC2 A;  4OVU A;  3ZNG C;  5D94 A;  4G3X B;  2MBH A;  3WIM A;  2ZCC A;  4LCD E;  3ZO5 B;  5AZH A;  2V3S A;  3PV1 A;  3VQI A;  3A1Q A;  1Z2M A;  3H7P B;  3QHT A;  2KDE B;  3VH4 B;  3SHQ A;  4E74 A;  4TV3 A;  3DBL I;  2ZPN A;  3NOB A;  3CST A;  3M63 B;  4M8M A;  2WYQ A;  5GMV A;  3W1S A;  3JSV A;  1E8W A;  4MEM A;  3NHE B;  2KFK B;  3BIN A;  4FJZ A;  1VD2 A;  1WRD B;  1MG8 A;  2VRR B;  4FAD A;  4LDT B;  5CHV C;  4BKS A;  3UIO B;  3DVN V;  1WJN A;  2L76 A;  3KUC B;  4G11 A;  5CHW A;  3TMP B;  1EF5 A;  2DEN B;  1ZKH A;  2DYB A;  3HM6 X;  3M62 B;  4KIK B;  4X57 B;  4GDL B;  1TZ1 A;  3TBL D;  5JH5 C;  4DBG A;  2WWZ A;  1WGD A;  2O2V B;  2HE7 A;  3ZTC A;  1WE7 A;  1WR6 E;  3QIJ A;  2GBK A;  2JY6 A;  2FAZ A;  4PS3 A;  4MSM B;  2HTH A;  2KXJ A;  1K8R B;  3VUW A;  4WJP A;  2MBE A;  2FCN A;  3DCG A;  2FCQ A;  2G45 B;  3HM3 A;  3JW0 X;  3ML8 A;  3PT2 B;  3R7Q A;  2ZNV C;  4A3P A;  4IWO A;  3ZVV A;  2L0T A;  2DAF A;  4KSK C;  5C1Z A;  4DXA B;  4EKU A;  2NPT A;  1YD8 U;  2MQJ A;  5JHA A;  4B9K A;  4CO7 A;  5AZF A;  4IW0 A;  1LFD A;  2ZJD A;  4GIV A;  3SU8 X;  4ASW C;  3ZKJ C;  1PQS A;  2PPH A;  3TIX A;  2LRU A;  2CS4 A;  1L2N A;  2LXC A;  3K9O B;  3C0R B;  1LXD A;  2IBI B;  2I1J A;  3W1Y A;  3K9P B;  4AP4 C;  3GOE A;  2BGF A;  3L10 B;  5KHO A;  4ZDV A;  2GBN A;  4E71 A;  1P3Q U;  1WM2 A;  2AEH A;  2BWE S;  2OJR A;  3A9J A;  4EEW A;  1Q1O A;  1V80 A;  3VHT C;  2R2O A;  4ICV A;  3VXW A;  1WY8 A;  2IO2 B;  2ZCB A;  5J17 A;  3B1L X;  3APC A;  4NPN A;  2B3A A;  4IWQ A;  1F9J A;  4GSW A;  4FLH A;  1ZGU B;  4W9K A;  1YX5 B;  2KX0 A;  2WX0 A;  4MM3 A;  1KLV A;  2JT4 B;  5C23 A;  5TR5 A;  2Z59 B;  2LVP A;  4WAA A;  2CHW A;  4F8C B;  5IA7 A;  1GNU A;  2KTR A;  3PRM B;  2KVR A;  3M3J A;  3AI5 A;  3PRE A;  2C7N B;  2MSE D;  3N30 A;  4ANV A;  3HHM A;  3V6C B;  4AOF A;  3KVF B;  2GBJ A;  3S2A A;  3NS8 A;  4ICU A;  2RPQ A;  2K39 A;  2LGD A;  1Q0W B;  2KDB A;  3DVG X;  2JPH A;  2M1M A;  3ZW3 A;  2MRP A;  3RYT A;  2KJR A;  4HPL B;  4GDK B;  1WZ3 A;  1WX7 A;  4W9I A;  3KUD B;  4BVU C;  5KHQ A;  3WAO A;  4F1S A;  5E6N A;  4DDG D;  2K8B A;  3CF6 E;  3PTF C;  2XK5 B;  1R4N I;  2WDT B;  2AWT A;  5G2N A;  2KN5 A;  5DPS A;  4NJ6 A;  3ZDM C;  1OEY A;  1E8X A;  3L13 A;  3H7P A;  1NDD A;  5E6P A;  4GOC A;  2LRW A;  2IO0 B;  5AEK B;  4F7Z A;  1S1Q B;  1J8C A;  3V60 A;  2BYV E;  1U4A A;  3V62 A;  3UQA A;  2DHZ A;  2LJ5 A;  3QCA A;  4K1R B;  3N32 A;  1WGY A;  1E90 A;  1TTN A;  1WH3 A;  1WFY A;  1XQQ A;  2G4S A;  2JWZ A;  3ZRC A;  2K25 A;  2KAN A;  5JZE B;  5LXI B;  5IAA C;  2KOX A;  2DZM A;  2KK8 A;  4II3 B;  3H7S A;  1ZW7 A;  2BYE A;  2R2Q A;  4DHJ D;  2FIF A;  4GDL A;  5CTR C;  3IFW B;  1WX8 A;  2J0K A;  3A4S C;  3EFU A;  2O2V A;  3APF A;  4GMV A;  1D3Z A;  3ZDT A;  3L54 A;  4EFO A;  4A3O A;  2MX2 A;  2JZ3 B;  3JYU A;  2GBR A;  1WE6 A;  2KKC A;  2LVQ A;  2KX3 A;  3SD5 A;  2O6V A;  4IM3 A;  1FXT B;  2DZI A;  2NCN A;  3DBS A;  4HCP B;  1C1Y B;  5G55 A;  1XT9 B;  3D32 A;  4ZYN A;  3EHV A;  1QZE A;  4WJO A;  2RSU A;  3B08 A;  4HJK A;  4IM2 A;  2KWC A;  1WXA A;  3QQ8 B;  4WJN A;  3WAM A;  4ANW A;  3PVL A;  4XC2 A;  2M0X A;  1UBQ A;  2YLM A;  3OLM D;  2A4Z A;  4IUM B;  1WMH B;  2J0J A;  4B95 A;  4JIO U;  3RD2 A;  4DHZ B;  5LLI A;  1HE8 A;  2LXA A;  3DPD A;  4ANX A;  3L16 A;  2BKF A;  4FUL A;  4W9E A;  4PS8 A;  1AAR A;  2G3Q B;  4HWI B;  4MJS B;  1SGH A;  4JQW C;  3UIP B;  4ZRI A;  3I3T B;  4NQL B;  5D2M B;  2KQ7 A;  3EEC A;  2Z0D B;  3TL5 A;  3EC8 A;  4BKT A;  3ALB A;  4LJO B;  1H4R A;  3L0W B;  2PJH A;  2L3Z A;  3TJP A;  1EUV B;  1XD3 B;  2KLG A;  3V61 A;  2XEW A;  1V5O A;  2C5L C;  3ZRF A;  5DPT A;  3T9L A;  2N7D A;  1V49 A;  4N9F 4;  3VTU A;  2MP2 A;  4FJY A;  4BOZ B;  1C3T A;  4BKG A;  1WXM A;  2MCN B;  1JRU A;  2FCS A;  3OJ4 B;  4AJW A;  4NAW B;  3X0W A;  1UGM A;  2KLC A;  2D07 B;  2RR9 A;  2JZZ A;  3PZD A;  2AYO B;  2C60 A;  1VCB A;  2LVO A;  2YVC A;  1P98 A;  2ZEQ A;  4B6W A;  3H1U A;  5DCN A;  2MW5 A;  5DPW A;  1WIA A;  4I6P A;  1S3S G;  1TBE A;  3IBE A;  4DHZ E;  2IY0 B;  4JL9 A;  4G0N B;  2KC1 A;  4IC7 B;  1SE9 A;  1WI0 A;  2EMS A;  4MEL A;  3VH3 B;  3OAW A;  3L08 A;  3A9K A;  3ML9 A;  2REX A;  4HK2 A;  1WM3 A;  4OVV A;  4CHK A;  4K7U A;  3BY4 B;  5JHB A;  1WF9 A;  4HLE A;  1ISN A;  4MSQ B;  3WAL A;  2L00 B;  1M94 A;  3AUL A;  2N7E A;  1H8C A;  4CYE A;  3UGB B;  1BT0 A;  1IYF A;  3KYD D;  1GC6 A;  2M17 A;  4WQO B;  2W9N A;  3IG3 A;  4ZRK A;  3U30 A;  2MBQ A;  3MHS D;  1UBI A;  3VTV A;  2WX1 A;  4RM9 A;  4WWP A;  4XZ4 A;  2D3G A;  3U8Z A;  4AJY B;  2IYD B;  2KZR A;  4GU2 A;  4M0W B;  4ZRJ A;  2KMA A;  1WYW B;  2NS5 A;  3IVF A;  3QC8 B;  1I35 A;  1RAX A;  1UZX B;  2KDF B;  4GB9 A;  2PEA A;  2EMT A;  1GC7 A;  1E8Z A;  2KJ6 A;  1R4M I;  3NY5 A;  4BBN C;  1V81 A;  1WJ4 A;  2MWS B;  3KW5 B;  4NJ7 A;  3DOW A;  2M8S A;  2HJ8 A;  4AUQ C;  2ZVN A;  1UD7 A;  1V86 A;  3AU4 A;  3PSE B;  1E7V A;  3PRZ A;  5L83 A;  2D10 A;  2LZ6 A;  3VFK A;  4K81 A;  1V5T A;  1E8Y A;  3JVZ X;  1KJT A;  1WZ0 A;  5AZG A;  1T0Y A;  3DDC B;  2K1F A;  3KYC D;  4YL8 A;  1GUA B;  4WWO A;  2IO1 B;  2KFK A;  4HDQ A;  1KOT A;  2CHX A;  4XX5 A;  2BF8 B;  2GMI C;  4AWJ A;  1WMH A;  3GZN I;  2BPS A;  5E6O A;  1NBF C;  2A5U A;  2LAS A;  4MH0 E;  4MGK E;  3RZF A;  4FHK A;  2DYM A;  4KIK A;  2DYO A;  4BBN F;  4KVG B;  1KM7 A;  4MJS A;  4TQ1 A;  1YJ1 A;  2G4D B;  3SDL C;  2C9W B;  2BYF A;  2EKE C;  3H9D A;  5D7G A;  3N3K B;  1EF1 A;  1WX9 A;  2L7R A;  3CSF A;  3VVW B;  2K8H A;  2KMC A;  5DPR A;  1G6J A;  4IG7 B;  2NR2 A;  3ZNH B;  4BFR A;  2PE9 A;  2RGF A;  2PE6 B;  2N9P C;  3QX1 A;  2N9X A;  2GOW A;  2K8C A;  4TKN A;  3A4R A;  2KQS A;  3RUI B;  4LDT D;  1OGW A;  3KUZ A;  2DX5 B;  4TUU A;  5J2R A;  3RUL A;  4DHJ B;  4NAW A;  2CU1 A;  4DK5 A;  4W9F A;  3VAW A;  2C7M B;  2J7Q B;  1P0R A;  2CKH B;  1TGZ B;  3HK0 A;  4W9H A;  2N1V A;  4FJV B;  1YX6 B;  4RMA A;  5LXH A;  2KHW B;  3M95 A;  3ZNZ B;  3MTN B;  2K6D B;  4II2 B;  4PS7 A;  3AU5 A;  2N9E B;  1UEL A;  2I1K A;  2L8J A;  1V9J A;  2M4N A;  3DBR I;  4HPM B;  3VUY A;  2V4L A;  2O6V D;  4K7W A;  1GG3 A;  4KZ0 A;  3ZUN A;  4TQ0 A;  3ONS A;  2BKR B;  2N4F A;  2JRI B;  1SIF A;  3DVN U;  3H6N A;  5FR6 A;  2NVU I;  4PYU A;  4WWN A;  4EUT A;  2KDI A;  2DZJ A;  4KZC A;  4P7I A;  1IPG A;  3T8M A;  4W9D A;  3ZNI D;  5HKH A;  2J0M A;  4URK A;  3R66 C;  4KSL C;  3QAQ A;  2MBO A;  1V6E A;  3TCA A;  1IP9 A;  1L7Y A;  3QWZ B;  4IWP A;  5BO4 B;  1I42 A;  3LDZ E;  4FBJ B;  1LQB A;  5L95 C;  2IO3 B;  4BKS D;  5D6J B;  4HVB A;  2JF5 A;  4IM0 A;  3KH0 A;  1E5W A;  4HXD A;  1UH6 A;  1WJ6 A;  2KFJ A;  2UWQ A;  4FN2 A;  4GDK A;  1WXS A;  2O6V B;  2MBB B;  1RRB A;  3IHP C;  3PHW B;  1Q5W B;  2D2Q A;  3DBH I;  2NBU A;  3MJW A;  3P2B A;  3A1Q B;  4G50 A;  4MGY E;  2FNJ B;  2XK5 A;  3WA0 A;  2D11 A;  1EO6 A;  3QAR A;  2LD9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...