2KC1A

Nmr structure of the f0 domain (residues 0-85) of the talin ferm domain
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
91
structure length
91
Chain Sequence
b'GIDPFTMVALSLKISIGNVVKTMQFEPSTMVYDACRMIRERIPEALAGPPNDFGLFLSDDDPKKGIWLEAGKALDYYMLRNGDTMEYRKKQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MKIAA1027 protein
molecule tags Structural protein
source organism Mus musculus
publication title Structure of a double ubiquitin-like domain in the talin head: a role in integrin activation.
pubmed doi rcsb
total genus 22
structure length 91
sequence length 91
ec nomenclature
pdb deposition date 2008-12-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16511 FERM_f0 N-terminal or F0 domain of Talin-head FERM
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 2kc1A00
2K6QA 4G50A 4PS8A 2K1FA 5JH5C 3L13A 3ONSA 4RM8A 3ZTCA 2C7MB 3DOWA 2LXCA 4E74A 4E3CA 3A33B 2KX0A 4NNJB 2HD5B 4PS7A 4ZYNA 2KWUB 4IWOA 2LJ5A 4TV3A 2KJRA 2WDTB 1I42A 3MTNB 1WIAA 3QARA 2IO0B 4AJYB 4PS3A 2L0FA 2LVOA 2NPTB 3VUXA 2MBOA 4HXDA 3ENEA 2FCQA 5GMVA 2G4SA 3L08A 3WALA 2KX3A 3JW0X 2K39A 2Y5BB 3OLMD 1SGHA 2L05A 4EFOA 2MBBB 1Q5WB 5AZGA 3EECA 4WJQA 2ZPNA 4MGKE 1NI2A 3KUCB 3KYDD 5D7GA 3VTUA 5AEKB 3ZO5B 1E8YA 2DZKA 1RAXA 1RLFA 2KZRA 4WJPA 5J2RA 2RGFA 1GC6A 1UD7A 1F9JA 2GBNA 2I1KA 2N7DA 3DBHI 2NBUA 2O6VA 1WF9A 3WANA 3UQBA 2DAFA 1UZXB 2LGYA 2YVCA 3ZVVA 2IO3B 1LQBA 3M95A 4AP4C 2PJHA 4IM0A 1QZEA 3IVFA 2N7EA 3TJPA 1V6EA 2L0TA 2CHWA 4G11A 3UIPB 1WGDA 4RMAA 2AL3A 4E71A 4G0NB 4MSMB 2BWES 2MP2B 5AZHA 3DBLI 4CO7A 1JRUA 1WE7A 2N4FA 3TL5A 3AU5A 4DHZB 1C1YB 2KDBA 3ZRCA 3UF8A 3U30A 5CHWA 3QA8A 1PQSA 4MGIE 2DX5B 3NZUA 3PS6A 1XD3B 3DVGX 2LXAA 2L76A 2MA9B 4MGZE 1ZKHA 5EDSA 5DCNA 4NQKE 3NS8A 1SIFA 1WJ4A 4YL8A 3TCAA 1IPGA 5CX3A 1WFYA 1WY8A 2JT4B 4FN2A 3PHWB 3EC8A 3H7PB 3Q3JA 2J7QB 3D32A 3VH4B 2ZCCA 3PV1A 2ZZPB 2MBHA 3VUYA 1WE6A 1V81A 4BVUC 1SE9A 4GGQA 5D2MB 4XC2A 5DPRA 1XQQA 1WX7A 3ALBA 5HKHA 1YQBA 4MJSA 4FULA 4GIVA 3U7DA 4HJKA 1TGZB 3V62A 4AWJA 1EUVB 3DVGY 2L7RA 4ANUA 2FAZA 4KZ0A 4GDLB 5CTRC 2JF5A 3ZTDA 4EZKA 4CHKA 2A4ZA 2ZVNA 2UYZB 2D2QA 3T8MA 1V2YA 4FJZA 2D10A 4LCDE 3RZFA 1KM7A 3PHXB 4GSWA 4MH0E 2KFJA 5G55A 1OTRB 3N30A 2J0MA 3QAQA 4I6LB 4FLHA 2C7HA 5JZEB 1M94A 4GU2A 1AARA 4P7IA 2KWCA 4BBNC 2D11A 2CHZA 3IFWB 4GXBA 4IM2A 2N1WA 3KYCD 2KTRB 3H9DA 3V61A 2Z0EB 3L17A 2V3SA 4IM3A 3H1UA 3L54A 2JZZA 1V80A 3APDA 2GBJA 3VH3B 3UINB 1WXSA 3JSVA 1G6JA 3GZNI 2KVRA 2D07B 4WQOB 2HTHA 3SDLC 3RCZA 5BO4B 4JGHB 1BT0A 2MQJA 3RD2A 1V49A 3ZDTA 2VRRB 2LASA 3PRPB 2GMIC 2KDEB 3EHVA 1Z2MA 2KFKA 3EFUA 2L00B 4WWOA 1C3TA 2EKEC 3VAWA 3UGBB 2KTRA 1WJNA 4HCPB 5CHFA 1RRBA 1KJTA 2MX2A 3IBEA 4OVVA 1WR6E 1WMHB 2DZIA 4EEWA 3KUDB 2K25A 4M8MA 1WM3A 1R4NI 1EO6A 1K8RB 1WGYA 3B0AA 2QHOA 4EOYA 3NY5A 4B95A 1V5OA 2DHZA 3K9OB 3V6EB 4CYEA 4NQLB 2Z0DB 3RUIB 3X0WA 4LDTD 2NVUI 2IY0B 3Q3FA 4MGYE 3R7RA 4IG7B 3DCGA 4XX5A 3C0RB 4KZCA 4W9KA 3H6NA 3H7PA 3JSVB 1L2NA 2KOXA 3QK0A 1WH3A 1P3QU 4IUMB 3OJ3A 2N9XA 4DK5A 4J6IA 5C1ZA 2ZJDA 1WX8A 2ASQA 3RT3B 2CU1A 1X1MA 2PE6B 2R2QA 3QJZA 2ZCBA 2CKHB 2O2VA 3KH0A 4NAWA 1IYFA 3QWZB 4KSLC 1D3ZA 2C9WB 3WAMA 3DPDA 3PSEB 3VTVA 2Z59B 1E8WA 3WAOA 3PZDA 4BKTA 1TBEA 3V6CB 3DQVA 4I6NB 2C7NB 3L10B 2HJ8A 1YJ1A 1UGMA 5E6OA 3W1SC 4NAWB 2FIDA 2C60A 1YX5B 3SHQA 4BOSC 3PLVA 4BKSD 2RSUA 2M0XA 3ML8A 1A5RA 3PT2B 2WYQA 3I3TB 2K8HA 3TMPB 2JXXA 2LI5A 4EZLA 4ICUA 2J0KA 2K8CA 4FJVB 1P0RA 5IA7A 3NZSA 2M4NA 2MCNB 1E7VA 1WM2A 2CHXA 3GOEA 2UWQA 4II2B 4F1SA 2DZJA 1Q1OA 5TR5A 2IO1B 4B9KA 1YD8U 3A9KB 1YIWA 4W9CA 1S3SG 4DDGD 4DWFA 3K9PB 1WI0A 4IW0A 1XT9B 4W9IA 1S1QB 2KANA 5CHVC 4ANWA 1J0GA 4W9JA 4KIKB 5C23A 2KHWB 3P2BA 3ZNZB 2JPHA 3DVNU 3PVLA 1WYWB 3PRZA 2FNJB 4DBGA 2O6VD 4FBJB 2I1JA 4A3PA 2PPHA 1GNUA 2JRHA 2KKCA 1YX6B 1J8CA 1P9DU 1WR1A 2LWPA 2NS5A 3DBRI 1ISNA 4KDIC 3A1QB 1GUAB 3B1LX 4DHJB 3U8ZA 2BGFA 4DHZE 4HDOA 4JL9A 4HWIB 4W9DA 2N9PC 3S2AA 2REXA 4KDLB 4TUUA 1WXAA 2IBIB 1LM8B 4K7UA 1OEYJ 4BBNF 2C5LC 4LJOB 2K8BA 2LGXA 2BKRB 3RYTA 2XK5B 3N32A 1H4RA 1ZW7A 3NHEB 4F7ZA 2GBMA 1WGRA 4BKGA 1WZ3A 2EMTA 5D94A 1H8CA 3AXCA 1GC7A 3ZRFA 2V1YA 3MJWA 2KTFA 1Q0WB 2KQSA 2MRPA 2RD0A 1HE8A 4MSQB 4HPLB 1FXTB 2CS4A 3A1QA 2MSED 4B6WA 3APCA 2DYMA 4HPMB 5L83A 2KXJA 5E6PA 2LGDA 3IG3A 2ZPYA 3QIJA 4JLCA 2FIFA 2L3ZA 1UELA 3PRMB 1NDDA 2LRUA 3CF6E 3WAPA 1LFDA 3A4SC 3VQIA 1KOTA 3KUZA 2B3AA 2LUEA 5L95C 1T0YA 3IHPC 2KO3A 4ANXA 2BWFA 2DYBA 5AZFA 2GBKA 2N1VA 5LXIB 2LVPA 2BYEA 2KLGA 4X57B 2KDFB 3ZUNA 3RZWC 4MJSB 2KMCA 2D3GA 3AULA 3QX1A 3ZDMC 4NPNA 4URKA 2K6DB 2WX0A 2N9EB 3HK0A 4A3OA 2JRIB 4NJ6A 5DPSA 1V5TA 1I35A 4MDKE 1KLVA 2BF8B 4HVBA 4BOZB 1VCBA 3WA0A 2WWZA 3QQ8B 3TIXA 3JYUA 1L7YA 4K1RB 2HE7A 4GN1A 4GDKA 2BYFA 4NJ7A 4AJWA 2PEAA 4TKNA 4GMVA 5LLIA 2NR2A 2MP2A 1LXDA 4LDTB 3ZLZA 1RFAA 2FCNA 2NBWB 4IC7B 2LZ6A 3VTWA 3VXWA 3ZIMA 4OVUA 1WGGA 4HK2A 4ZDVA 2W9NA 5LXHA 4K7WA 4TQ1A 2IY1B 3HIZA 4MEMA 3KVFB 2KK8A 2KC2A 3R7QA 2XBBC 3W1SA 2J0JA 3T9LA 3ZKJC 1E90A 1OGWA 2GOWA 2KNBA 4ICVA 5DPWA 5FR6A 1V9JA 2KC1A 3H7SA 3DVNV 4KVGB 1Y8RC 4HLEA 3UQAA 4IWQA 3V60A 1UBQA 3ECIA 4GOCA 3ML9A 3PLUA 2OJRA 1WGHA 2LRWA 2MBQA 2BYVE 1WJ6A 4ZRKA 2AWTA 2JVCA 3SU8X 1IP9A 2MLBA 3QCAA 4TQ0A 4EZJA 2GBRA 3LDZE 2JY6A 4FJYA 2JUOA 4HCNB 4MELA 3VDZA 4BKSA 1TTNA 2O6VB 3HM6X 3ZNGC 3VUWA 1P98A 4HDQA 4AUQC 2A5UA 1ZGUB 1UH6A 4KSKC 4K81A 2R2OA 4PYUA 2DAJA 2ZEQA 4MM3A 3VFKA 3W1YA 3CSFA 3OAWA 4W9FA 2KN5A 2KMAA 3SD5A 1WXMA 3CMMB 3HHMA 2NBVB 1NBFC 3B08A 4W9GA 1GJZA 1WZ0A 2M8SA 3X23A 5JHBA 1E8ZA 2G3QB 3LJ3A 1OEYA 1UBIA 1U4AA 2AYOB 3PTFC 3ZNHB 2BKFA 2O2VB 4NY0A 1OQYA 4II3B 3UIOB 1EF1A 2OOBB 3A9JA 4ANVA 2IYDB 2ZNVB 2FCSA 2V4LA 3AI5A 2MBEA 4DDID 1GG3A 2DYOA 2M1MA 1TZ1A 1P1AA 2NPTA 5DPTA 1VD2A 2KQ7A 4BFRA 4LJPB 4AOFA 1WMHA 2CR5A 4JIOU 3PREA 4WAAA 1EF5A 3VVWB 4DHJD 1E7UA 3VHTC 2XEWA 2FUHB 5G2NA 5IAAC 4M8NA 4PYZA 3N3KB 2PE9A 2JWZA 2KJ6A 3A9JB 4ZRIA 3KW5B 2IZVB 3AU4A 4FHKA 4F8CB 5JHAA 1MG8A 4WWPA 3ZNID 2AEHA 5KHQA 4JQWC 5J18A 3A4RA 1J19A 2MWSB 4FHJA 4FA6A 2AL6A 2M17A 3A9KA 2KDIA 3NOBA 4N9F4 2L8JA 3HM3A 4EKUA 3DDCB 2EMSA 3QHTA 4I6PA 1WX9A 2LVQA 2ZVOA 2RR9A 4KIKA 4W9EA 4W9LA 4KV2A 4K7SA 2WX1A 3M63B 5J17A 2JZ3B 2BPSA 5D6JB 1CMXB 3RULA 4W9HA 4WWNA 2IO2B 1Z5SB 2YLMA 3PGEA 4DXAB 1WXVA 3O65B 4A20A 4ZRJA 4M0WB 3M3JA 3MHSD 3ZW3A 4ASWC 3WIMA 2DZMA 4FADA 3JVZX 3PPAA 3M62B 3TBLD 1WJUA 3L16A 4GDKB 4WJNA 4XZ4A 5E6NA 2DENB 2KLCA 3L0WB 1V86A 4WJOA 2ZNVC 3QC8B 3R3MA 2RPQA 5KHOA 2MW5A 4EUTA 1E5WA 1E8XA 2KJHB 2G45B 2KWVB 3OJ4B 1R4MI 2KD0A 2NCNA 3BY4B 4IWPA 2G4DB 1WRDB 2KFKB 3DBSA 4GB9A 3BINA 3APFA 4G3XB 2FCMA 4RM9A 3R66C 4GDLA 2XK5A 3CSTA 2LD9A
chains in the Genus database with same CATH superfamily
2K6QA 2LGSA 2CJNA 4YXDB 5JH5C 3ONSA 2LXCA 3AE9B 4E3CA 2CJOA 5IKCM 2KX0A 2KWUB 2MJ3A 1UNSA 2DBYA 1QOAA 4MACA 1FRRA 1YJIA 3QARA 4AJYB 1T6BX 4HXDA 1DYQA 4ARCA 3Q2AC 3WALA 1XLOA 2KX3A 2WHIA 2BBCA 2NMQA 2L05A 2L52A 1HTOA 2ZPNA 1E8YA 3BWUD 2G1EA 1RLFA 1VJKA 5J2RA 4WJPA 2GBNA 3WANA 4ZOHC 1WF9A 3MC0B 1LQBA 1GPXA 4JWSC 1KFYB 2LFIA 4RMAA 4ZRQA 3FC4A 4G0NB 3P4QB 4CO7A 1LGRA 1UWMA 3UF8A 3U30A 2WXNA 3NZUA 3DVGX 2LXAA 1F2RI 1ZKHA 5DCNA 3R2IA 4RH6A 1SEBD 3Q3JA 3D32A 3VH4B 1ZE3D 3NVZA 1IGCA 3AMZA 1V81A 4NJCA 4WAFA 3T3NA 5D2MB 4XC2A 3ALBA 1YQBA 4MJSA 5BMHA 1AWDA 4GIVA 4HJKA 3NJTA 1JWSD 4AWJA 3DVGY 4ANUA 4KZ0A 2MH7A 5IN7A 5CTRC 4CHKA 2A4ZA 5FK9C 1TKYA 2RPVA 3N20C 1KM7A 5G55A 4I6LB 1YMHE 2J0MA 1C9FA 3N9YC 5HFYA 1AARA 2KWCA 3IFWB 3AE6B 3NVWA 2N1WA 2KTRB 3H9DA 3V61A 3L17A 3L54A 1WXSA 1XCQL 2D07B 4WQOB 2K9XA 2K0PA 1MFWA 1F2RC 3AECB 1C3TA 1Z2MA 2EKEC 4PT5A 1WJNA 4HCPB 1RRBA 1KJTA 1WM3A 1R4NI 1K8RB 2BB5A 2QHOA 1V5OA 4CYEA 4XDCA 4BAXA 3Q69A 4KZCA 3H6NA 3JSVB 1YN3A 2WXOA 3OJ3A 2N9XA 4DK5A 2ZJDA 1X1MA 2R2QA 3QJZA 4LNKA 4NAWA 2QIEB 3DBRB 1PUTA 1F77A 4KSLC 4XYCA 1NYRA 3RPFC 3PSEB 2SAKA 3WAOA 3CWIA 3PZDA 1TBEA 1XLNA 4WQMA 3LYYA 5E6OA 4C4VB 4NAWB 1ZXHA 4US8A 1EU4A 1YX5B 1FRDA 4WURA 3PLVA 2RSUA 2M0XA 2WYQA 3I3TB 3TMPB 2JXXA 2QCZA 2BS3B 4ICUA 5EE0A 2M4NA 1WM2A 4F1SA 2DZJA 1T0QC 2WDVB 4W9CA 4DWFA 4S0RA 3K9PB 1WI0A 1XT9B 5D3IB 3N1ZC 2KANA 5CHVC 4ANWA 1XLQA 1HA5A 2M0AA 4FBJB 2O6VD 1VDVA 2RDBC 1IBXA 2PTLA 2PIAA 3DWGC 3MC9A 4KDIC 1WYGA 1GUAB 4DHJB 4MH8A 4HDOA 4JL9A 2REXA 4KDLB 1WXAA 4K7UA 2GRIA 3HVDA 1TIFA 2BKRB 4F7ZA 1WGRA 1XCTL 5EE1A 4KGSA 1H8CA 1GC7A 2V1YA 3NG0A 2IGGA 1Q10A 2KTFA 1Q0WB 2W3RA 4HPLB 1FXTB 2MSED 3DHIC 1P7FA 4RF0A 1ZP0B 2WDQB 3AE8B 3PRMB 1E7PB 1NVID 3VQIA 1KOTA 1EU3A 1GB1A 2GLSA 3AH7A 2DYBA 1SXTA 2N1VA 4WH4A 2LVPA 2KLGA 4ZHPA 2WXPA 4URKA 4JX1C 2JRIB 5DPSA 3ZGZA 1V5TA 2IJ0A 2BF8B 1SSNA 4BOZB 1VCBA 3WA0A 4HVBA 1J7AA 3TIXA 2KWDA 2HE7A 4AJWA 2PEAA 5LLIA 4IC7B 5BMGA 1YOVB 4ZDVA 1N5WA 5LXHA 2Q5WD 4P1CC 3W1SA 1E90A 2WU2B 2GOWA 1V1PB 2N0SB 4ICVA 1CQVA 1SE4A 3H7SA 3UQAA 3ML9A 2OJRA 1JWAD 1HQRD 2KMMA 2MLBA 2M56B 3LDZE 2N7JA 1L4ZB 3GS2A 5JXVA 4HCNB 4BKSA 1TTNA 2O6VB 3VUWA 4RGNA 1TJEA 1QKZA 2ZEQA 4MM3A 5C2TB 2BS2B 2KN5A 4USAA 1P7EA 1DGJA 4W9GA 1WZ0A 3X23A 1N61A 2XN9C 2JXTA 1B1ZA 3GE3C 2BKFA 2O2VB 1OQYA 1EF1A 2DYOA 5EE3A 4YSZB 1TZ1A 4N6EB 3AEBB 4AOFA 1WMHA 2CR5A 3PZ7A 4WAAA 4DHJD 2FUHB 1ACCA 2RMMA 3N3KB 1TYGB 2PE9A 1KF6B 5J18A 3A4RA 4N9F4 3B2GA 3QHTA 2LVQA 2ZVOA 4W9LA 4K7SA 1JW9D 2WX1A 4ZHOA 4GLSC 5D6JB 1T0RC 1VZ8A 1Z5SB 4IOIE 2YLMA 4WWMA 1WXVA 1UWXA 1I7HA 3DBLB 4ITKA 3ZW3A 3EA6A 3WIMA 3JVZX 4FXCA 1FCCC 1WJUA 3NVYA 2KLCA 3L0WB 2QMTA 3ZJUA 4EUTA 1E5WA 1R4MI 1WRDB 3BZDB 3Q8AA 3BINA 2FCMA 4GDLA 3OWEB 2HJ8A 1FEHA 3U7ZA 3DOWA 4E74A 3AE2B 1QOFA 4PS7A 4YT0B 4ZYNA 2KJRA 2LVOA 4DXFA 3GZNB 3ENEA 5G5GA 1TS5A 3NZ3A 2K39A 1Q5WB 3EECA 1NI2A 3KUCB 4XDDA 2D5GA 3ZO5B 1ZUD2 2DZKA 2KZRA 2BVCA 2RGFA 1GC6A 1UD7A 2I1KA 2H89B 2NBUA 3UQBA 2DAFA 1UZXB 2LGYA 2YVCA 3M95A 4IM0A 3TJPA 2L0TA 4G11A 2BWES 3HVZA 2MP2B 5AZHA 1C78A 1WE7A 1K52A 3TL5A 1C1YB 5CHWA 2BW2A 1WXQA 4XWTA 1N63A 1XD3B 2V3PA 4NQKE 1WJ4A 2WXMA 2EELA 3I63C 3KLSX 1WY8A 2DWQA 3EC8A 3H7PB 3Q8BA 2ZZPB 2MBHA 3V3XA 4BVUC 2IPKD 1SE9A 2B76B 1JALA 2IDYA 1XQQA 5DPRA 4FULA 2K3UA 1STEA 2FAZA 2WXHA 3P63A 2JF5A 4EZKA 3AM9A 2D3CA 4JE3B 3PZ8A 4Q2JA 3PHXB 4GSWA 3H8HA 4MH0E 2KFJA 3N30A 4FLHA 4RGOS 2IGDA 2CHZA 4GXBA 4IM2A 3FAHA 2Z0EB 4IM3A 3H1UA 1V80A 3I5JC 2K5PA 3GZNI 3TEWA 1YQ4B 5BO4B 1BT0A 2MQJA 1V49A 3RNGC 3PRPB 2L00B 3ABVB 2KTRA 4OVVA 4EEWA 1WR6E 2DZIA 2ZW1A 1BMLC 1WGYA 2WLBA 2PKOA 1SB3C 2DHZA 1C79A 3Q3OC 3RFZB 1PGAA 5D3DA 1C4CA 3X0WA 4LDTD 3W2DA 2IY0B 4IG7B 3DCGA 3C0RB 3TSSA 2MJDA 2KOXA 1WH3A 1D5MC 3RNEC 1WX8A 2K22A 1WWTA 2ZCBA 2CKHB 1TS4A 1D3ZA 3WAMA 4LLGM 4OHJA 1E10A 1QOBA 4OZCA 4BKTA 3O13A 3SFDB 3DQVA 1YJ1A 1UGMA 2C60A 3IT6B 3R8BA 4C00A 4BKSD 3ML8A 3PT2B 2LI5A 4FJVB 1P0RA 1PGBA 5IA7A 1RM6C 1QLBB 1AW7A 1E7VA 2FUG1 3Q8FA 4II2B 1B9RA 5TR5A 1YD8U 1HEZE 3FKYA 3AE1B 1S1QB 1J0GA 3TUOA 4W9JA 3LXFA 5C23A 3LB8C 3P2BA 3ZNZB 3P42A 2FNJB 1RFKA 2I1JA 4A3PA 3Q14C 2PPHA 1YX6B 2BYTA 1J8CA 3SFEB 1K51A 1P9DU 1WR1A 3UI3A 3MHZA 5FR3A 3B1LX 2N9PC 3S2AA 4R3DA 1OFFA 2IBIB 4BBNF 2K8BA 3RYTA 2XK5B 2GBMA 4BKGA 1WZ3A 2KQSA 4RNAA 4MSQB 4UDUC 3EFCA 4L2YA 3A1QA 4B6WA 5L83A 1SE2A 3BVMA 3IG3A 2VZKB 2ZPYA 1FNVA 2L1AA 1NDDA 3CF6E 1SIJA 1I4GA 1T3QA 1T0YA 2KACA 3Q8EA 3IHPC 4US9A 2BWFA 3OG5A 5AZFA 5IP4D 4X57B 1EWYC 3RZWC 4MJSB 3AULA 4NPNA 2K6DB 2WX0A 2N9EB 4A3OA 4L23A 1I35A 1KLVA 4K3CA 1A70A 2WWZA 2JU6X 3JYUA 2BYFA 4NJ7A 2NR2A 2MP2A 3ZLZA 2PVOD 2FCNA 1N62A 3VTWA 3VXWA 2W9NA 1F52A 4K7WA 1NYQA 2GB1A 3VR8B 2RDHA 2XBBC 2J0JA 3ZKJC 3EUB2 1OGWA 2KNBA 5FR6A 1IUEA 1V9JA 3W5UB 3Q8CA 2KC1A 4KVGB 3V60A 3ECIA 1DOXA 1JMLA 2MBQA 2BYVE 2JVCA 4TQ0A 4JWUC 2GBRA 5I4DA 2BT6A 2JUOA 3VDZA 4M0WA 4C7ZA 4AUQC 2A5UA 2WXGA 4IDIA 1UH6A 2ACZB 1J7BA 2MEKA 3CSFA 4W9FA 3SD5A 3CMMB 2NBVB 1GJZA 4C80A 1E8ZA 1PDXA 3LJ3A 1UBIA 1U4AA 1CK1A 2WXFA 4II3B 3UIOB 3AEAB 2ZNVB 1E9MA 2FCSA 4DDID 1GG3A 1I4HA 2AX5A 5DPTA 1VD2A 3U4EG 4LJPB 1I4RA 1YJJA 1EF5A 1E7UA 3VHTC 3NS1A 4M8NA 1T5XD 3MFGA 4PYZA 2JWZA 2KJ6A 5HG2A 5IOIA 4F8CB 2RDGA 4FHJA 2MWSB 2M17A 1T0SC 1VLBA 3C19A 1FO4A 1D4BA 2EMSA 2AQ3B 1FM0D 4I6PA 4LNOA 2RR9A 1MPEA 1C4PA 1D5ZC 3M63B 2JZ3B 2X38A 2VZKD 2WXIA 4M00A 2KVZA 2IO2B 3PGEA 4DXAB 1RYJA 3O65B 1TS3A 2YEPB 5AUKA 3MHSD 3PPAA 4WJNA 2DENB 4WJOA 3BVZA 5KHOA 2MW5A 2KJHB 2G45B 2KWVB 1JWMD 2NCNA 3BY4B 2ON8A 3P4RB 3RNFC 2W82A 5AUIA 3CSTA 1R4NB 1FXAA 5HHDG 3L13A 3ZTCA 2C7MB 3A33B 3EGRA 2HD5B 4NNJB 4IWOA 2LJ5A 1WIAA 3N1XC 2KDMA 2V4IB 4PS3A 2NPTB 2MBOA 2FCQA 3L08A 4TMAB 1J7CA 3OLMD 4EFOA 2WU5B 3AEFB 2MBBB 4AQ7A 5AZGA 4MGKE 2WXJA 3AEDB 2N7DA 2O6VA 3ZVVA 2Y5CA 4AP4C 4YTNB 3P4SB 3SEBA 4HKZE 1WGDA 4E71A 2AL3A 3MC8A 1ROEA 3DBLI 1ZPSA 1GOZA 3PO0A 3AU5A 4HJGE 3ZRCA 5H92C 4P16A 4H2AA 3W9CB 2KYWA 1PQSA 4MGIE 2W55A 3PS6A 3BVGA 2L76A 1R4MB 3BIID 1SIFA 4YL8A 5MPOA 3TCAA 5CX3A 4EE2A 4FN2A 4N58A 3PV1A 2KAJA 4KKIA 1WE6A 3VUYA 1JWBD 1AYFA 5HKHA 3ZQ4A 1V97A 3AV8A 1TGZB 3V62A 1MHHE 4LTUA 4RGMA 2KQ4X 2UYZB 3T8MA 3AE3B 4FJZA 2WGSA 4B0MA 3RI7C 4HEA1 1OTRB 4HKQA 2LUMA 2C7HA 5JZEB 4GU2A 4P7IA 4N59A 1TKEA 3TEYA 2JZZA 2GBJA 1E6EB 3JSVA 2KVRA 3RCZA 4REZA 4JGHB 1FIQA 2LASA 2GMIC 2KDEB 3EHVA 2KFKA 3EFUA 2WXKA 3VAWA 3UGBB 3IBEA 4O1NA 3KUDB 4RCOA 1MHXA 4M8MA 5TSSA 2M19A 1EO6A 3VRBB 3B0AA 4EOYA 3NY5A 3K9OB 2WXRA 3V6EB 4YSYB 1TY0A 2INNE 4XX5A 3H7PA 3QK0A 4IUMB 1L0YB 1MVKA 2ICIA 2YEPF 4J6IA 4L1BA 2PE6B 3KH0A 2O2VA 1EWCA 1JWUD 4NZLB 3QWZB 3IT4B 2I38A 3DPDA 3U52E 1QT9A 2Z59B 2SEBD 2MJEA 3L10B 2INDC 4CQNA 3SHQA 2WP9B 2VH2A 1A5RA 1HZ5A 4IKGA 2K8HA 1HTQA 3NZSA 1Q1OA 4B9KA 2IO1B 1S3SG 4DDGD 1YN4A 3IAS1 2QILA 4OVZA 5T8IA 2KHWB 2OEDA 1WYWB 3PRZA 5BYRA 4DBGA 1GNUA 2JRHA 2KKCA 1K53A 1RWSA 2LWPA 2V9HA 3A1QB 3HUIA 2BGFA 4DHZE 1SJHD 4HWIB 1N5XA 2QEJC 4W9DA 1DOYA 2C5LC 3RNAC 2LGXA 1D6EC 2FE8A 4HRSA 5G5HA 1CZPA 3NHEB 1QILA 5D94A 3MJWA 2RD0A 2KT7A 2D3AA 1DOIA 1HZ6A 2DNFA 2CS4A 3FILA 1L5PA 1KRHA 4HPMB 1NEKB 3QIJA 2FIFA 1N6ZA 2L3ZA 1UELA 3WAPA 1L0XB 1LFDA 3A4SC 4P1BC 1FD6A 1VZ7A 1JCKB 2B3AA 2LUEA 5L95C 2IGHA 1VR9A 1PFDA 1WRIA 2KDFB 3DWMA 3HK0A 2JQRB 2X8XX 4NJ6A 2QSDA 1FNUA 4MDKE 3AEEB 3I9V1 3QQ8B 4LDTB 1LXDA 1RFAA 2NBWB 2LZ6A 3ZIMA 1WGGA 4ZRPA 4TQ1A 2IY1B 4MEMA 2KC2A 1XO3A 2AQ1B 1OQQA 4HLEA 1K50A 4GOCA 3PLUA 2PLPA 3Q3NC 1WGHA 2LJIA 1NENB 1WJ6A 4ZRKA 3SU8X 3VRAB 1IP9A 4TSSA 2D3BA 2INPE 4ZYSA 4FJYA 1Y56A 4MELA 2NTTA 3HM6X 3AE5B 4HDQA 1KLUD 3ZXRA 2BS4B 2W3SA 3WCQA 1C4AA 4KSKC 2R2OA 4PYUA 2E3TA 3VFKA 1FPYA 1TY2A 3OAWA 2KMAA 1WXMA 1NBFC 3B08A 2M8SA 5JHBA 3W5VB 1OEYA 2AYOB 3PTFC 3ZNHB 4NY0A 3R2TA 2IYDB 1PYWD 2V4LA 4D2KA 4A6QA 1YNTE 1VZ6A 5LNK1 3MJ5A 2KQ7A 4BFRA 1MG4A 1TS2A 2J52A 3VVWB 2PW9A 1R7SA 1TKGA 4FHKA 1JQ4A 5JHAA 1MG8A 3KWVA 1NI3A 3L4PA 4JPSA 3A9KA 2KDIA 2L8JA 4EKUA 1IGDA 3DDCB 1WX9A 2L83A 4KIKA 1D5XC 1UGJA 2J42A 3BK1A 2BPSA 4W9HA 4WWNA 5GXGB 4A20A 4M0WB 3P4PB 3NVVA 4RGTA 2DZMA 5E6NA 1L0VB 2RPQA 1SE3A 1E8XA 2Y5PA 1SF0A 3N1YC 3OJ4B 1PGXA 2KFKB 3DBSA 4GB9A 1WGKA 1FCLA 4RM9A 4G3XB 3I57A 2LD9A 1QOGA 4G50A 4PS8A 3ZYYX 2K1FA 2BTEA 2DLBA 4RM8A 5FKAC 4C56C 4YSXB 3B9JA 4TV3A 1GAQB 3RNCC 2JYTA 2WDTB 2W54A 4KX6B 1I42A 1ESFA 3MTNB 1KH0A 1N60A 1ZDVA 2EKIA 2IO0B 2L0FA 2FBWB 3VUXA 5GMVA 2G4SA 3JW0X 2Y5BB 1SGHA 4WJQA 4YTMB 3KYDD 5D7GA 3VTUA 5AEKB 1RAXA 2ONQA 3HRDD 1L2NA 1F9JA 3DBHI 4XGAB 1LO5D 2LGIA 1L4DB 2IO3B 2PJHA 1QZEA 1UUPA 3IVFA 2N7EA 1TZOA 1V6EA 3TEXA 2CHWA 5E6JA 3UIPB 4MSMB 4HROA 1FFUA 1JRUA 2N4FA 4DHZB 1ET6A 3RNBC 2KDBA 2MHJA 3QA8A 4KGRA 2DX5B 4OZBA 4ARIA 3URYA 5EDSA 2MA9B 3Q3MC 4MGZE 3NS8A 1ZOYB 1IPGA 1WFYA 2JT4B 3PHWB 2J7QB 2ZCCA 1V1OA 1V1PA 3KWLA 4GGQA 5H8YE 2G9HD 1CJEA 1WX7A 3J9CA 3U7DA 2WS3B 1EUVB 2L7RA 2PVGC 2E6XA 1F1HA 4GDLB 3ZTDA 2ZVNA 1UF0A 2D2QA 1V2YA 2D10A 4LCDE 3RZFA 4DXGA 1SBBB 4MT5A 1E0ZA 3DBHB 3QAQA 4DQOC 2LMCA 2NTSA 1M94A 4BBNC 2D11A 1F0ZA 3KYCD 3ETRA 3MP9A 2V3SA 4M02A 3APDA 2AQ2B 3UINB 3VH3B 1G6JA 3V05A 4LK0M 2H88B 2HTHA 2JWUA 4LNNA 3SDLC 2WNMA 3RD2A 3ZDTA 4P6VF 2VRRB 3NUHB 5BYSA 4WWOA 4QAYA 5CHFA 2MX2A 1WMHB 2OJWA 2K25A 4B95A 1IBXB 3RN9C 4NQLB 2Z0DB 3RUIB 4B0EA 2NVUI 3Q3FA 4MGYE 3R7RA 4W9KA 3AB5A 3RMKC 5HI1A 1P3QU 2HTME 1XLPA 5C1ZA 2ASQA 3RT3B 2CU1A 5BMIA 2J4XA 1IYFA 2C9WB 1FXIA 2WQYB 3DHHC 1XF5L 3VTVA 1E8WA 1JROA 3GP7A 2LEKA 3V6CB 4I6NB 2C7NB 1QF6A 3AE4B 3W1SC 2FIDA 2N9LA 3Q6BA 4A90A 4BOSC 1MI0A 4WIPA 1SJED 5BYQA 4EZLA 2J0KA 2K8CA 2MCNB 2CHXA 1I4PA 3GOEA 2UWQA 2WXLA 1BUIC 1KTKA 3A9KB 1YIWA 3IAM1 1MJDA 4IW0A 4W9IA 2LHDA 4C4VA 4ACFA 3T3OA 3BYYB 4KIKB 3TEZA 2JPHA 3DVNU 1AN8A 2VH1A 3PVLA 4S17A 3U2SC 5C3JB 2NS5A 3DBRI 1ISNA 3E9SA 3AN1A 3FILB 3U8ZA 2OHFA 2QC8A 1ZXIA 4TUUA 1FNWA 1LM8B 2Z8LA 1OEYJ 4LJOB 3N32A 1H4RA 1ZW7A 2EMTA 4A9AA 3AXCA 2J53A 3ZRFA 2BB6A 2MRPA 1HE8A 2INCC 2R61A 5IO9A 4K3BA 2V3NA 3APCA 4RFBA 2DYMA 2KXJA 5E6PA 2LGDA 1OQRA 2WXQA 1FFVA 2CU3A 4JLCA 1C76A 3NRZA 2LRUA 2WDRB 4MM3B 3GE8C 4KGTA 3KUZA 4C7YA 1XXGA 2KO3A 4ANXA 1XEEA 4YWGG 3CIRB 1GB4A 2GBKA 4A8XC 2PMVA 3C8YA 5LXIB 1ZDXA 4OW0A 2BYEA 3VR9B 1ENFA 2XNAC 3ZUNA 3ZJVA 2KMCA 2D3GA 3QX1A 3E56A 3ZDMC 2UU7A 4NAMA 4LNFA 3BK2A 4KKJA 1L6VA 1L7YA 4K1RB 4GN1A 4GDKA 4TKNA 4GMVA 1C77A 1JRPA 2ZW0A 3GB1A 4OZAA 2I2YA 4OVUA 1KLGD 4HK2A 4LNIA 3HIZA 1VRAB 1HXYD 2KK8A 3KVFB 3R7QA 4HPPA 3T9LA 4AS1A 5DPWA 3P1MA 1L6UA 3ZJTA 3DVNV 1Y8RC 4IWQA 1UBQA 2HDEA 3BYTB 2LRWA 2AWTA 4EZJA 3QCAA 2JY6A 4A55A 4J3OD 3ZNGC 1YN5A 1YQ3B 2V0GA 1P98A 3ZXVA 1EM7A 1ZGUB 1M4VA 4K81A 2DAJA 3W1YA 4M01A 2N9KA 3IXSA 3HHMA 1TT5B 2G3QB 2L32A 4YTPB 1WSPA 2OOBB 3A9JA 4ANVA 3AI5A 2MBEA 1I4QA 2M1MA 1P1AA 2Y3AA 4PK1A 2NPTA 1ET9A 4JIOU 3PREA 5EE9A 2QJLA 3KQ4A 1V8CA 2XEWA 5G2NA 5IAAC 2KN4A 3A9JB 4ZRIA 3KW5B 2IZVB 3AU4A 4WWPA 3ZNID 2AEHA 5KHQA 4JQWC 2TSSA 4FA6A 1J19A 4XWWA 2AL6A 1I4XA 3NOBA 3HM3A 4BZAA 2BQQA 2JYEA 4W9EA 4KV2A 2HJ1A 3DHGC 2GI9A 5J17A 1CMXB 3SR6A 3RULA 3AE7B 3AEGB 4ZRJA 3M3JA 4ASWC 4FADA 3M62B 4XE0A 3TBLD 2JZPA 3L16A 4GDKB 4XZ4A 4RF1A 1FMAD 1V86A 2ZNVC 3QC8B 3R3MA 1BXTA 2KD0A 4IWPA 2G4DB 2LHEA 1QQRA 3APFA 2JX5A 3R66C 2XK5A 3B2FA 2QDFA 2JSVX
chains in the Genus database with same CATH topology
2K6QA 4G50A 4PS8A 2K1FA 5JH5C 3L13A 3ONSA 4RM8A 3ZTCA 2C7MB 3DOWA 2LXCA 4E74A 4E3CA 3A33B 2KX0A 4NNJB 2HD5B 4PS7A 4ZYNA 2KWUB 4IWOA 2LJ5A 4TV3A 2KJRA 2WDTB 1I42A 3MTNB 1WIAA 3QARA 2IO0B 4AJYB 4PS3A 2L0FA 2LVOA 2NPTB 3VUXA 2MBOA 4HXDA 3ENEA 2FCQA 5GMVA 2G4SA 3L08A 3WALA 2KX3A 3JW0X 2K39A 2Y5BB 3OLMD 1SGHA 2L05A 4EFOA 2MBBB 1Q5WB 5AZGA 3EECA 4WJQA 2ZPNA 4MGKE 1NI2A 3KUCB 3KYDD 5D7GA 3VTUA 5AEKB 3ZO5B 1E8YA 2DZKA 1RAXA 1RLFA 2KZRA 4WJPA 5J2RA 2RGFA 1GC6A 1UD7A 1F9JA 2GBNA 2I1KA 2N7DA 3DBHI 2NBUA 2O6VA 1WF9A 3WANA 3UQBA 2DAFA 1UZXB 2LGYA 2YVCA 3ZVVA 2IO3B 1LQBA 3M95A 4AP4C 2PJHA 4IM0A 1QZEA 3IVFA 2N7EA 3TJPA 1V6EA 2L0TA 2CHWA 4G11A 3UIPB 1WGDA 4RMAA 2AL3A 4E71A 4G0NB 4MSMB 2BWES 2MP2B 5AZHA 3DBLI 4CO7A 1JRUA 1WE7A 2N4FA 3TL5A 3AU5A 4DHZB 1C1YB 2KDBA 3ZRCA 3UF8A 3U30A 5CHWA 3QA8A 1PQSA 4MGIE 2DX5B 3NZUA 3PS6A 1XD3B 3DVGX 2LXAA 2L76A 2MA9B 4MGZE 1ZKHA 5EDSA 5DCNA 4NQKE 3NS8A 1SIFA 1WJ4A 4YL8A 3TCAA 1IPGA 5CX3A 1WFYA 1WY8A 2JT4B 4FN2A 3PHWB 3EC8A 3H7PB 3Q3JA 2J7QB 3D32A 3VH4B 2ZCCA 3PV1A 2ZZPB 2MBHA 3VUYA 1WE6A 1V81A 4BVUC 1SE9A 4GGQA 5D2MB 4XC2A 5DPRA 1XQQA 1WX7A 3ALBA 5HKHA 1YQBA 4MJSA 4FULA 4GIVA 3U7DA 4HJKA 1TGZB 3V62A 4AWJA 1EUVB 3DVGY 2L7RA 4ANUA 2FAZA 4KZ0A 4GDLB 5CTRC 2JF5A 3ZTDA 4EZKA 4CHKA 2A4ZA 2ZVNA 2UYZB 2D2QA 3T8MA 1V2YA 4FJZA 2D10A 4LCDE 3RZFA 1KM7A 3PHXB 4GSWA 4MH0E 2KFJA 5G55A 1OTRB 3N30A 2J0MA 3QAQA 4I6LB 4FLHA 2C7HA 5JZEB 1M94A 4GU2A 1AARA 4P7IA 2KWCA 4BBNC 2D11A 2CHZA 3IFWB 4GXBA 4IM2A 2N1WA 3KYCD 2KTRB 3H9DA 3V61A 2Z0EB 3L17A 2V3SA 4IM3A 3H1UA 3L54A 2JZZA 1V80A 3APDA 2GBJA 3VH3B 3UINB 1WXSA 3JSVA 1G6JA 3GZNI 2KVRA 2D07B 4WQOB 2HTHA 3SDLC 3RCZA 5BO4B 4JGHB 1BT0A 2MQJA 3RD2A 1V49A 3ZDTA 2VRRB 2LASA 3PRPB 2GMIC 2KDEB 3EHVA 1Z2MA 2KFKA 3EFUA 2L00B 4WWOA 1C3TA 2EKEC 3VAWA 3UGBB 2KTRA 1WJNA 4HCPB 5CHFA 1RRBA 1KJTA 2MX2A 3IBEA 4OVVA 1WR6E 1WMHB 2DZIA 4EEWA 3KUDB 2K25A 4M8MA 1WM3A 1R4NI 1EO6A 1K8RB 1WGYA 3B0AA 2QHOA 4EOYA 3NY5A 4B95A 1V5OA 2DHZA 3K9OB 3V6EB 4CYEA 4NQLB 2Z0DB 3RUIB 3X0WA 4LDTD 2NVUI 2IY0B 3Q3FA 4MGYE 3R7RA 4IG7B 3DCGA 4XX5A 3C0RB 4KZCA 4W9KA 3H6NA 3H7PA 3JSVB 1L2NA 2KOXA 3QK0A 1WH3A 1P3QU 4IUMB 3OJ3A 2N9XA 4DK5A 4J6IA 5C1ZA 2ZJDA 1WX8A 2ASQA 3RT3B 2CU1A 1X1MA 2PE6B 2R2QA 3QJZA 2ZCBA 2CKHB 2O2VA 3KH0A 4NAWA 1IYFA 3QWZB 4KSLC 1D3ZA 2C9WB 3WAMA 3DPDA 3PSEB 3VTVA 2Z59B 1E8WA 3WAOA 3PZDA 4BKTA 1TBEA 3V6CB 3DQVA 4I6NB 2C7NB 3L10B 2HJ8A 1YJ1A 1UGMA 5E6OA 3W1SC 4NAWB 2FIDA 2C60A 1YX5B 3SHQA 4BOSC 3PLVA 4BKSD 2RSUA 2M0XA 3ML8A 1A5RA 3PT2B 2WYQA 3I3TB 2K8HA 3TMPB 2JXXA 2LI5A 4EZLA 4ICUA 2J0KA 2K8CA 4FJVB 1P0RA 5IA7A 3NZSA 2M4NA 2MCNB 1E7VA 1WM2A 2CHXA 3GOEA 2UWQA 4II2B 4F1SA 2DZJA 1Q1OA 5TR5A 2IO1B 4B9KA 1YD8U 3A9KB 1YIWA 4W9CA 1S3SG 4DDGD 4DWFA 3K9PB 1WI0A 4IW0A 1XT9B 4W9IA 1S1QB 2KANA 5CHVC 4ANWA 1J0GA 4W9JA 4KIKB 5C23A 2KHWB 3P2BA 3ZNZB 2JPHA 3DVNU 3PVLA 1WYWB 3PRZA 2FNJB 4DBGA 2O6VD 4FBJB 2I1JA 4A3PA 2PPHA 1GNUA 2JRHA 2KKCA 1YX6B 1J8CA 1P9DU 1WR1A 2LWPA 2NS5A 3DBRI 1ISNA 4KDIC 3A1QB 1GUAB 3B1LX 4DHJB 3U8ZA 2BGFA 4DHZE 4HDOA 4JL9A 4HWIB 4W9DA 2N9PC 3S2AA 2REXA 4KDLB 4TUUA 1WXAA 2IBIB 1LM8B 4K7UA 1OEYJ 4BBNF 2C5LC 4LJOB 2K8BA 2LGXA 2BKRB 3RYTA 2XK5B 3N32A 1H4RA 1ZW7A 3NHEB 4F7ZA 2GBMA 1WGRA 4BKGA 1WZ3A 2EMTA 5D94A 1H8CA 3AXCA 1GC7A 3ZRFA 2V1YA 3MJWA 2KTFA 1Q0WB 2KQSA 2MRPA 2RD0A 1HE8A 4MSQB 4HPLB 1FXTB 2CS4A 3A1QA 2MSED 4B6WA 3APCA 2DYMA 4HPMB 5L83A 2KXJA 5E6PA 2LGDA 3IG3A 2ZPYA 3QIJA 4JLCA 2FIFA 2L3ZA 1UELA 3PRMB 1NDDA 2LRUA 3CF6E 3WAPA 1LFDA 3A4SC 3VQIA 1KOTA 3KUZA 2B3AA 2LUEA 5L95C 1T0YA 3IHPC 2KO3A 4ANXA 2BWFA 2DYBA 5AZFA 2GBKA 2N1VA 5LXIB 2LVPA 2BYEA 2KLGA 4X57B 2KDFB 3ZUNA 3RZWC 4MJSB 2KMCA 2D3GA 3AULA 3QX1A 3ZDMC 4NPNA 4URKA 2K6DB 2WX0A 2N9EB 3HK0A 4A3OA 2JRIB 4NJ6A 5DPSA 1V5TA 1I35A 4MDKE 1KLVA 2BF8B 4HVBA 4BOZB 1VCBA 3WA0A 2WWZA 3QQ8B 3TIXA 3JYUA 1L7YA 4K1RB 2HE7A 4GN1A 4GDKA 2BYFA 4NJ7A 4AJWA 2PEAA 4TKNA 4GMVA 5LLIA 2NR2A 2MP2A 1LXDA 4LDTB 3ZLZA 1RFAA 2FCNA 2NBWB 4IC7B 2LZ6A 3VTWA 3VXWA 3ZIMA 4OVUA 1WGGA 4HK2A 4ZDVA 2W9NA 5LXHA 4K7WA 4TQ1A 2IY1B 3HIZA 4MEMA 3KVFB 2KK8A 2KC2A 3R7QA 2XBBC 3W1SA 2J0JA 3T9LA 3ZKJC 1E90A 1OGWA 2GOWA 2KNBA 4ICVA 5DPWA 5FR6A 1V9JA 2KC1A 3H7SA 3DVNV 4KVGB 1Y8RC 4HLEA 3UQAA 4IWQA 3V60A 1UBQA 3ECIA 4GOCA 3ML9A 3PLUA 2OJRA 1WGHA 2LRWA 2MBQA 2BYVE 1WJ6A 4ZRKA 2AWTA 2JVCA 3SU8X 1IP9A 2MLBA 3QCAA 4TQ0A 4EZJA 2GBRA 3LDZE 2JY6A 4FJYA 2JUOA 4HCNB 4MELA 3VDZA 4BKSA 1TTNA 2O6VB 3HM6X 3ZNGC 3VUWA 1P98A 4HDQA 4AUQC 2A5UA 1ZGUB 1UH6A 4KSKC 4K81A 2R2OA 4PYUA 2DAJA 2ZEQA 4MM3A 3VFKA 3W1YA 3CSFA 3OAWA 4W9FA 2KN5A 2KMAA 3SD5A 1WXMA 3CMMB 3HHMA 2NBVB 1NBFC 3B08A 4W9GA 1GJZA 1WZ0A 2M8SA 3X23A 5JHBA 1E8ZA 2G3QB 3LJ3A 1OEYA 1UBIA 1U4AA 2AYOB 3PTFC 3ZNHB 2BKFA 2O2VB 4NY0A 1OQYA 4II3B 3UIOB 1EF1A 2OOBB 3A9JA 4ANVA 2IYDB 2ZNVB 2FCSA 2V4LA 3AI5A 2MBEA 4DDID 1GG3A 2DYOA 2M1MA 1TZ1A 1P1AA 2NPTA 5DPTA 1VD2A 2KQ7A 4BFRA 4LJPB 4AOFA 1WMHA 2CR5A 4JIOU 3PREA 4WAAA 1EF5A 3VVWB 4DHJD 1E7UA 3VHTC 2XEWA 2FUHB 5G2NA 5IAAC 4M8NA 4PYZA 3N3KB 2PE9A 2JWZA 2KJ6A 3A9JB 4ZRIA 3KW5B 2IZVB 3AU4A 4FHKA 4F8CB 5JHAA 1MG8A 4WWPA 3ZNID 2AEHA 5KHQA 4JQWC 5J18A 3A4RA 1J19A 2MWSB 4FHJA 4FA6A 2AL6A 2M17A 3A9KA 2KDIA 3NOBA 4N9F4 2L8JA 3HM3A 4EKUA 3DDCB 2EMSA 3QHTA 4I6PA 1WX9A 2LVQA 2ZVOA 2RR9A 4KIKA 4W9EA 4W9LA 4KV2A 4K7SA 2WX1A 3M63B 5J17A 2JZ3B 2BPSA 5D6JB 1CMXB 3RULA 4W9HA 4WWNA 2IO2B 1Z5SB 2YLMA 3PGEA 4DXAB 1WXVA 3O65B 4A20A 4ZRJA 4M0WB 3M3JA 3MHSD 3ZW3A 4ASWC 3WIMA 2DZMA 4FADA 3JVZX 3PPAA 3M62B 3TBLD 1WJUA 3L16A 4GDKB 4WJNA 4XZ4A 5E6NA 2DENB 2KLCA 3L0WB 1V86A 4WJOA 2ZNVC 3QC8B 3R3MA 2RPQA 5KHOA 2MW5A 4EUTA 1E5WA 1E8XA 2KJHB 2G45B 2KWVB 3OJ4B 1R4MI 2KD0A 2NCNA 3BY4B 4IWPA 2G4DB 1WRDB 2KFKB 3DBSA 4GB9A 3BINA 3APFA 4G3XB 2FCMA 4RM9A 3R66C 4GDLA 2XK5A 3CSTA 2LD9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2K6Q A;  4G50 A;  4PS8 A;  2K1F A;  5JH5 C;  3L13 A;  3ONS A;  4RM8 A;  3ZTC A;  2C7M B;  3DOW A;  2LXC A;  4E74 A;  4E3C A;  3A33 B;  2KX0 A;  4NNJ B;  2HD5 B;  4PS7 A;  4ZYN A;  2KWU B;  4IWO A;  2LJ5 A;  4TV3 A;  2KJR A;  2WDT B;  1I42 A;  3MTN B;  1WIA A;  3QAR A;  2IO0 B;  4AJY B;  4PS3 A;  2L0F A;  2LVO A;  2NPT B;  3VUX A;  2MBO A;  4HXD A;  3ENE A;  2FCQ A;  5GMV A;  2G4S A;  3L08 A;  3WAL A;  2KX3 A;  3JW0 X;  2K39 A;  2Y5B B;  3OLM D;  1SGH A;  2L05 A;  4EFO A;  2MBB B;  1Q5W B;  5AZG A;  3EEC A;  4WJQ A;  2ZPN A;  4MGK E;  1NI2 A;  3KUC B;  3KYD D;  5D7G A;  3VTU A;  5AEK B;  3ZO5 B;  1E8Y A;  2DZK A;  1RAX A;  1RLF A;  2KZR A;  4WJP A;  5J2R A;  2RGF A;  1GC6 A;  1UD7 A;  1F9J A;  2GBN A;  2I1K A;  2N7D A;  3DBH I;  2NBU A;  2O6V A;  1WF9 A;  3WAN A;  3UQB A;  2DAF A;  1UZX B;  2LGY A;  2YVC A;  3ZVV A;  2IO3 B;  1LQB A;  3M95 A;  4AP4 C;  2PJH A;  4IM0 A;  1QZE A;  3IVF A;  2N7E A;  3TJP A;  1V6E A;  2L0T A;  2CHW A;  4G11 A;  3UIP B;  1WGD A;  4RMA A;  2AL3 A;  4E71 A;  4G0N B;  4MSM B;  2BWE S;  2MP2 B;  5AZH A;  3DBL I;  4CO7 A;  1JRU A;  1WE7 A;  2N4F A;  3TL5 A;  3AU5 A;  4DHZ B;  1C1Y B;  2KDB A;  3ZRC A;  3UF8 A;  3U30 A;  5CHW A;  3QA8 A;  1PQS A;  4MGI E;  2DX5 B;  3NZU A;  3PS6 A;  1XD3 B;  3DVG X;  2LXA A;  2L76 A;  2MA9 B;  4MGZ E;  1ZKH A;  5EDS A;  5DCN A;  4NQK E;  3NS8 A;  1SIF A;  1WJ4 A;  4YL8 A;  3TCA A;  1IPG A;  5CX3 A;  1WFY A;  1WY8 A;  2JT4 B;  4FN2 A;  3PHW B;  3EC8 A;  3H7P B;  3Q3J A;  2J7Q B;  3D32 A;  3VH4 B;  2ZCC A;  3PV1 A;  2ZZP B;  2MBH A;  3VUY A;  1WE6 A;  1V81 A;  4BVU C;  1SE9 A;  4GGQ A;  5D2M B;  4XC2 A;  5DPR A;  1XQQ A;  1WX7 A;  3ALB A;  5HKH A;  1YQB A;  4MJS A;  4FUL A;  4GIV A;  3U7D A;  4HJK A;  1TGZ B;  3V62 A;  4AWJ A;  1EUV B;  3DVG Y;  2L7R A;  4ANU A;  2FAZ A;  4KZ0 A;  4GDL B;  5CTR C;  2JF5 A;  3ZTD A;  4EZK A;  4CHK A;  2A4Z A;  2ZVN A;  2UYZ B;  2D2Q A;  3T8M A;  1V2Y A;  4FJZ A;  2D10 A;  4LCD E;  3RZF A;  1KM7 A;  3PHX B;  4GSW A;  4MH0 E;  2KFJ A;  5G55 A;  1OTR B;  3N30 A;  2J0M A;  3QAQ A;  4I6L B;  4FLH A;  2C7H A;  5JZE B;  1M94 A;  4GU2 A;  1AAR A;  4P7I A;  2KWC A;  4BBN C;  2D11 A;  2CHZ A;  3IFW B;  4GXB A;  4IM2 A;  2N1W A;  3KYC D;  2KTR B;  3H9D A;  3V61 A;  2Z0E B;  3L17 A;  2V3S A;  4IM3 A;  3H1U A;  3L54 A;  2JZZ A;  1V80 A;  3APD A;  2GBJ A;  3VH3 B;  3UIN B;  1WXS A;  3JSV A;  1G6J A;  3GZN I;  2KVR A;  2D07 B;  4WQO B;  2HTH A;  3SDL C;  3RCZ A;  5BO4 B;  4JGH B;  1BT0 A;  2MQJ A;  3RD2 A;  1V49 A;  3ZDT A;  2VRR B;  2LAS A;  3PRP B;  2GMI C;  2KDE B;  3EHV A;  1Z2M A;  2KFK A;  3EFU A;  2L00 B;  4WWO A;  1C3T A;  2EKE C;  3VAW A;  3UGB B;  2KTR A;  1WJN A;  4HCP B;  5CHF A;  1RRB A;  1KJT A;  2MX2 A;  3IBE A;  4OVV A;  1WR6 E;  1WMH B;  2DZI A;  4EEW A;  3KUD B;  2K25 A;  4M8M A;  1WM3 A;  1R4N I;  1EO6 A;  1K8R B;  1WGY A;  3B0A A;  2QHO A;  4EOY A;  3NY5 A;  4B95 A;  1V5O A;  2DHZ A;  3K9O B;  3V6E B;  4CYE A;  4NQL B;  2Z0D B;  3RUI B;  3X0W A;  4LDT D;  2NVU I;  2IY0 B;  3Q3F A;  4MGY E;  3R7R A;  4IG7 B;  3DCG A;  4XX5 A;  3C0R B;  4KZC A;  4W9K A;  3H6N A;  3H7P A;  3JSV B;  1L2N A;  2KOX A;  3QK0 A;  1WH3 A;  1P3Q U;  4IUM B;  3OJ3 A;  2N9X A;  4DK5 A;  4J6I A;  5C1Z A;  2ZJD A;  1WX8 A;  2ASQ A;  3RT3 B;  2CU1 A;  1X1M A;  2PE6 B;  2R2Q A;  3QJZ A;  2ZCB A;  2CKH B;  2O2V A;  3KH0 A;  4NAW A;  1IYF A;  3QWZ B;  4KSL C;  1D3Z A;  2C9W B;  3WAM A;  3DPD A;  3PSE B;  3VTV A;  2Z59 B;  1E8W A;  3WAO A;  3PZD A;  4BKT A;  1TBE A;  3V6C B;  3DQV A;  4I6N B;  2C7N B;  3L10 B;  2HJ8 A;  1YJ1 A;  1UGM A;  5E6O A;  3W1S C;  4NAW B;  2FID A;  2C60 A;  1YX5 B;  3SHQ A;  4BOS C;  3PLV A;  4BKS D;  2RSU A;  2M0X A;  3ML8 A;  1A5R A;  3PT2 B;  2WYQ A;  3I3T B;  2K8H A;  3TMP B;  2JXX A;  2LI5 A;  4EZL A;  4ICU A;  2J0K A;  2K8C A;  4FJV B;  1P0R A;  5IA7 A;  3NZS A;  2M4N A;  2MCN B;  1E7V A;  1WM2 A;  2CHX A;  3GOE A;  2UWQ A;  4II2 B;  4F1S A;  2DZJ A;  1Q1O A;  5TR5 A;  2IO1 B;  4B9K A;  1YD8 U;  3A9K B;  1YIW A;  4W9C A;  1S3S G;  4DDG D;  4DWF A;  3K9P B;  1WI0 A;  4IW0 A;  1XT9 B;  4W9I A;  1S1Q B;  2KAN A;  5CHV C;  4ANW A;  1J0G A;  4W9J A;  4KIK B;  5C23 A;  2KHW B;  3P2B A;  3ZNZ B;  2JPH A;  3DVN U;  3PVL A;  1WYW B;  3PRZ A;  2FNJ B;  4DBG A;  2O6V D;  4FBJ B;  2I1J A;  4A3P A;  2PPH A;  1GNU A;  2JRH A;  2KKC A;  1YX6 B;  1J8C A;  1P9D U;  1WR1 A;  2LWP A;  2NS5 A;  3DBR I;  1ISN A;  4KDI C;  3A1Q B;  1GUA B;  3B1L X;  4DHJ B;  3U8Z A;  2BGF A;  4DHZ E;  4HDO A;  4JL9 A;  4HWI B;  4W9D A;  2N9P C;  3S2A A;  2REX A;  4KDL B;  4TUU A;  1WXA A;  2IBI B;  1LM8 B;  4K7U A;  1OEY J;  4BBN F;  2C5L C;  4LJO B;  2K8B A;  2LGX A;  2BKR B;  3RYT A;  2XK5 B;  3N32 A;  1H4R A;  1ZW7 A;  3NHE B;  4F7Z A;  2GBM A;  1WGR A;  4BKG A;  1WZ3 A;  2EMT A;  5D94 A;  1H8C A;  3AXC A;  1GC7 A;  3ZRF A;  2V1Y A;  3MJW A;  2KTF A;  1Q0W B;  2KQS A;  2MRP A;  2RD0 A;  1HE8 A;  4MSQ B;  4HPL B;  1FXT B;  2CS4 A;  3A1Q A;  2MSE D;  4B6W A;  3APC A;  2DYM A;  4HPM B;  5L83 A;  2KXJ A;  5E6P A;  2LGD A;  3IG3 A;  2ZPY A;  3QIJ A;  4JLC A;  2FIF A;  2L3Z A;  1UEL A;  3PRM B;  1NDD A;  2LRU A;  3CF6 E;  3WAP A;  1LFD A;  3A4S C;  3VQI A;  1KOT A;  3KUZ A;  2B3A A;  2LUE A;  5L95 C;  1T0Y A;  3IHP C;  2KO3 A;  4ANX A;  2BWF A;  2DYB A;  5AZF A;  2GBK A;  2N1V A;  5LXI B;  2LVP A;  2BYE A;  2KLG A;  4X57 B;  2KDF B;  3ZUN A;  3RZW C;  4MJS B;  2KMC A;  2D3G A;  3AUL A;  3QX1 A;  3ZDM C;  4NPN A;  4URK A;  2K6D B;  2WX0 A;  2N9E B;  3HK0 A;  4A3O A;  2JRI B;  4NJ6 A;  5DPS A;  1V5T A;  1I35 A;  4MDK E;  1KLV A;  2BF8 B;  4HVB A;  4BOZ B;  1VCB A;  3WA0 A;  2WWZ A;  3QQ8 B;  3TIX A;  3JYU A;  1L7Y A;  4K1R B;  2HE7 A;  4GN1 A;  4GDK A;  2BYF A;  4NJ7 A;  4AJW A;  2PEA A;  4TKN A;  4GMV A;  5LLI A;  2NR2 A;  2MP2 A;  1LXD A;  4LDT B;  3ZLZ A;  1RFA A;  2FCN A;  2NBW B;  4IC7 B;  2LZ6 A;  3VTW A;  3VXW A;  3ZIM A;  4OVU A;  1WGG A;  4HK2 A;  4ZDV A;  2W9N A;  5LXH A;  4K7W A;  4TQ1 A;  2IY1 B;  3HIZ A;  4MEM A;  3KVF B;  2KK8 A;  2KC2 A;  3R7Q A;  2XBB C;  3W1S A;  2J0J A;  3T9L A;  3ZKJ C;  1E90 A;  1OGW A;  2GOW A;  2KNB A;  4ICV A;  5DPW A;  5FR6 A;  1V9J A;  2KC1 A;  3H7S A;  3DVN V;  4KVG B;  1Y8R C;  4HLE A;  3UQA A;  4IWQ A;  3V60 A;  1UBQ A;  3ECI A;  4GOC A;  3ML9 A;  3PLU A;  2OJR A;  1WGH A;  2LRW A;  2MBQ A;  2BYV E;  1WJ6 A;  4ZRK A;  2AWT A;  2JVC A;  3SU8 X;  1IP9 A;  2MLB A;  3QCA A;  4TQ0 A;  4EZJ A;  2GBR A;  3LDZ E;  2JY6 A;  4FJY A;  2JUO A;  4HCN B;  4MEL A;  3VDZ A;  4BKS A;  1TTN A;  2O6V B;  3HM6 X;  3ZNG C;  3VUW A;  1P98 A;  4HDQ A;  4AUQ C;  2A5U A;  1ZGU B;  1UH6 A;  4KSK C;  4K81 A;  2R2O A;  4PYU A;  2DAJ A;  2ZEQ A;  4MM3 A;  3VFK A;  3W1Y A;  3CSF A;  3OAW A;  4W9F A;  2KN5 A;  2KMA A;  3SD5 A;  1WXM A;  3CMM B;  3HHM A;  2NBV B;  1NBF C;  3B08 A;  4W9G A;  1GJZ A;  1WZ0 A;  2M8S A;  3X23 A;  5JHB A;  1E8Z A;  2G3Q B;  3LJ3 A;  1OEY A;  1UBI A;  1U4A A;  2AYO B;  3PTF C;  3ZNH B;  2BKF A;  2O2V B;  4NY0 A;  1OQY A;  4II3 B;  3UIO B;  1EF1 A;  2OOB B;  3A9J A;  4ANV A;  2IYD B;  2ZNV B;  2FCS A;  2V4L A;  3AI5 A;  2MBE A;  4DDI D;  1GG3 A;  2DYO A;  2M1M A;  1TZ1 A;  1P1A A;  2NPT A;  5DPT A;  1VD2 A;  2KQ7 A;  4BFR A;  4LJP B;  4AOF A;  1WMH A;  2CR5 A;  4JIO U;  3PRE A;  4WAA A;  1EF5 A;  3VVW B;  4DHJ D;  1E7U A;  3VHT C;  2XEW A;  2FUH B;  5G2N A;  5IAA C;  4M8N A;  4PYZ A;  3N3K B;  2PE9 A;  2JWZ A;  2KJ6 A;  3A9J B;  4ZRI A;  3KW5 B;  2IZV B;  3AU4 A;  4FHK A;  4F8C B;  5JHA A;  1MG8 A;  4WWP A;  3ZNI D;  2AEH A;  5KHQ A;  4JQW C;  5J18 A;  3A4R A;  1J19 A;  2MWS B;  4FHJ A;  4FA6 A;  2AL6 A;  2M17 A;  3A9K A;  2KDI A;  3NOB A;  4N9F 4;  2L8J A;  3HM3 A;  4EKU A;  3DDC B;  2EMS A;  3QHT A;  4I6P A;  1WX9 A;  2LVQ A;  2ZVO A;  2RR9 A;  4KIK A;  4W9E A;  4W9L A;  4KV2 A;  4K7S A;  2WX1 A;  3M63 B;  5J17 A;  2JZ3 B;  2BPS A;  5D6J B;  1CMX B;  3RUL A;  4W9H A;  4WWN A;  2IO2 B;  1Z5S B;  2YLM A;  3PGE A;  4DXA B;  1WXV A;  3O65 B;  4A20 A;  4ZRJ A;  4M0W B;  3M3J A;  3MHS D;  3ZW3 A;  4ASW C;  3WIM A;  2DZM A;  4FAD A;  3JVZ X;  3PPA A;  3M62 B;  3TBL D;  1WJU A;  3L16 A;  4GDK B;  4WJN A;  4XZ4 A;  5E6N A;  2DEN B;  2KLC A;  3L0W B;  1V86 A;  4WJO A;  2ZNV C;  3QC8 B;  3R3M A;  2RPQ A;  5KHO A;  2MW5 A;  4EUT A;  1E5W A;  1E8X A;  2KJH B;  2G45 B;  2KWV B;  3OJ4 B;  1R4M I;  2KD0 A;  2NCN A;  3BY4 B;  4IWP A;  2G4D B;  1WRD B;  2KFK B;  3DBS A;  4GB9 A;  3BIN A;  3APF A;  4G3X B;  2FCM A;  4RM9 A;  3R66 C;  4GDL A;  2XK5 A;  3CST A;  2LD9 A; 
#chains in the Genus database with same CATH topology
 2K6Q A;  2LGS A;  2CJN A;  4YXD B;  5JH5 C;  3ONS A;  2LXC A;  3AE9 B;  4E3C A;  2CJO A;  5IKC M;  2KX0 A;  2KWU B;  2MJ3 A;  1UNS A;  2DBY A;  1QOA A;  4MAC A;  1FRR A;  1YJI A;  3QAR A;  4AJY B;  1T6B X;  4HXD A;  1DYQ A;  4ARC A;  3Q2A C;  3WAL A;  1XLO A;  2KX3 A;  2WHI A;  2BBC A;  2NMQ A;  2L05 A;  2L52 A;  1HTO A;  2ZPN A;  1E8Y A;  3BWU D;  2G1E A;  1RLF A;  1VJK A;  5J2R A;  4WJP A;  2GBN A;  3WAN A;  4ZOH C;  1WF9 A;  3MC0 B;  1LQB A;  1GPX A;  4JWS C;  1KFY B;  2LFI A;  4RMA A;  4ZRQ A;  3FC4 A;  4G0N B;  3P4Q B;  4CO7 A;  1LGR A;  1UWM A;  3UF8 A;  3U30 A;  2WXN A;  3NZU A;  3DVG X;  2LXA A;  1F2R I;  1ZKH A;  5DCN A;  3R2I A;  4RH6 A;  1SEB D;  3Q3J A;  3D32 A;  3VH4 B;  1ZE3 D;  3NVZ A;  1IGC A;  3AMZ A;  1V81 A;  4NJC A;  4WAF A;  3T3N A;  5D2M B;  4XC2 A;  3ALB A;  1YQB A;  4MJS A;  5BMH A;  1AWD A;  4GIV A;  4HJK A;  3NJT A;  1JWS D;  4AWJ A;  3DVG Y;  4ANU A;  4KZ0 A;  2MH7 A;  5IN7 A;  5CTR C;  4CHK A;  2A4Z A;  5FK9 C;  1TKY A;  2RPV A;  3N20 C;  1KM7 A;  5G55 A;  4I6L B;  1YMH E;  2J0M A;  1C9F A;  3N9Y C;  5HFY A;  1AAR A;  2KWC A;  3IFW B;  3AE6 B;  3NVW A;  2N1W A;  2KTR B;  3H9D A;  3V61 A;  3L17 A;  3L54 A;  1WXS A;  1XCQ L;  2D07 B;  4WQO B;  2K9X A;  2K0P A;  1MFW A;  1F2R C;  3AEC B;  1C3T A;  1Z2M A;  2EKE C;  4PT5 A;  1WJN A;  4HCP B;  1RRB A;  1KJT A;  1WM3 A;  1R4N I;  1K8R B;  2BB5 A;  2QHO A;  1V5O A;  4CYE A;  4XDC A;  4BAX A;  3Q69 A;  4KZC A;  3H6N A;  3JSV B;  1YN3 A;  2WXO A;  3OJ3 A;  2N9X A;  4DK5 A;  2ZJD A;  1X1M A;  2R2Q A;  3QJZ A;  4LNK A;  4NAW A;  2QIE B;  3DBR B;  1PUT A;  1F77 A;  4KSL C;  4XYC A;  1NYR A;  3RPF C;  3PSE B;  2SAK A;  3WAO A;  3CWI A;  3PZD A;  1TBE A;  1XLN A;  4WQM A;  3LYY A;  5E6O A;  4C4V B;  4NAW B;  1ZXH A;  4US8 A;  1EU4 A;  1YX5 B;  1FRD A;  4WUR A;  3PLV A;  2RSU A;  2M0X A;  2WYQ A;  3I3T B;  3TMP B;  2JXX A;  2QCZ A;  2BS3 B;  4ICU A;  5EE0 A;  2M4N A;  1WM2 A;  4F1S A;  2DZJ A;  1T0Q C;  2WDV B;  4W9C A;  4DWF A;  4S0R A;  3K9P B;  1WI0 A;  1XT9 B;  5D3I B;  3N1Z C;  2KAN A;  5CHV C;  4ANW A;  1XLQ A;  1HA5 A;  2M0A A;  4FBJ B;  2O6V D;  1VDV A;  2RDB C;  1IBX A;  2PTL A;  2PIA A;  3DWG C;  3MC9 A;  4KDI C;  1WYG A;  1GUA B;  4DHJ B;  4MH8 A;  4HDO A;  4JL9 A;  2REX A;  4KDL B;  1WXA A;  4K7U A;  2GRI A;  3HVD A;  1TIF A;  2BKR B;  4F7Z A;  1WGR A;  1XCT L;  5EE1 A;  4KGS A;  1H8C A;  1GC7 A;  2V1Y A;  3NG0 A;  2IGG A;  1Q10 A;  2KTF A;  1Q0W B;  2W3R A;  4HPL B;  1FXT B;  2MSE D;  3DHI C;  1P7F A;  4RF0 A;  1ZP0 B;  2WDQ B;  3AE8 B;  3PRM B;  1E7P B;  1NVI D;  3VQI A;  1KOT A;  1EU3 A;  1GB1 A;  2GLS A;  3AH7 A;  2DYB A;  1SXT A;  2N1V A;  4WH4 A;  2LVP A;  2KLG A;  4ZHP A;  2WXP A;  4URK A;  4JX1 C;  2JRI B;  5DPS A;  3ZGZ A;  1V5T A;  2IJ0 A;  2BF8 B;  1SSN A;  4BOZ B;  1VCB A;  3WA0 A;  4HVB A;  1J7A A;  3TIX A;  2KWD A;  2HE7 A;  4AJW A;  2PEA A;  5LLI A;  4IC7 B;  5BMG A;  1YOV B;  4ZDV A;  1N5W A;  5LXH A;  2Q5W D;  4P1C C;  3W1S A;  1E90 A;  2WU2 B;  2GOW A;  1V1P B;  2N0S B;  4ICV A;  1CQV A;  1SE4 A;  3H7S A;  3UQA A;  3ML9 A;  2OJR A;  1JWA D;  1HQR D;  2KMM A;  2MLB A;  2M56 B;  3LDZ E;  2N7J A;  1L4Z B;  3GS2 A;  5JXV A;  4HCN B;  4BKS A;  1TTN A;  2O6V B;  3VUW A;  4RGN A;  1TJE A;  1QKZ A;  2ZEQ A;  4MM3 A;  5C2T B;  2BS2 B;  2KN5 A;  4USA A;  1P7E A;  1DGJ A;  4W9G A;  1WZ0 A;  3X23 A;  1N61 A;  2XN9 C;  2JXT A;  1B1Z A;  3GE3 C;  2BKF A;  2O2V B;  1OQY A;  1EF1 A;  2DYO A;  5EE3 A;  4YSZ B;  1TZ1 A;  4N6E B;  3AEB B;  4AOF A;  1WMH A;  2CR5 A;  3PZ7 A;  4WAA A;  4DHJ D;  2FUH B;  1ACC A;  2RMM A;  3N3K B;  1TYG B;  2PE9 A;  1KF6 B;  5J18 A;  3A4R A;  4N9F 4;  3B2G A;  3QHT A;  2LVQ A;  2ZVO A;  4W9L A;  4K7S A;  1JW9 D;  2WX1 A;  4ZHO A;  4GLS C;  5D6J B;  1T0R C;  1VZ8 A;  1Z5S B;  4IOI E;  2YLM A;  4WWM A;  1WXV A;  1UWX A;  1I7H A;  3DBL B;  4ITK A;  3ZW3 A;  3EA6 A;  3WIM A;  3JVZ X;  4FXC A;  1FCC C;  1WJU A;  3NVY A;  2KLC A;  3L0W B;  2QMT A;  3ZJU A;  4EUT A;  1E5W A;  1R4M I;  1WRD B;  3BZD B;  3Q8A A;  3BIN A;  2FCM A;  4GDL A;  3OWE B;  2HJ8 A;  1FEH A;  3U7Z A;  3DOW A;  4E74 A;  3AE2 B;  1QOF A;  4PS7 A;  4YT0 B;  4ZYN A;  2KJR A;  2LVO A;  4DXF A;  3GZN B;  3ENE A;  5G5G A;  1TS5 A;  3NZ3 A;  2K39 A;  1Q5W B;  3EEC A;  1NI2 A;  3KUC B;  4XDD A;  2D5G A;  3ZO5 B;  1ZUD 2;  2DZK A;  2KZR A;  2BVC A;  2RGF A;  1GC6 A;  1UD7 A;  2I1K A;  2H89 B;  2NBU A;  3UQB A;  2DAF A;  1UZX B;  2LGY A;  2YVC A;  3M95 A;  4IM0 A;  3TJP A;  2L0T A;  4G11 A;  2BWE S;  3HVZ A;  2MP2 B;  5AZH A;  1C78 A;  1WE7 A;  1K52 A;  3TL5 A;  1C1Y B;  5CHW A;  2BW2 A;  1WXQ A;  4XWT A;  1N63 A;  1XD3 B;  2V3P A;  4NQK E;  1WJ4 A;  2WXM A;  2EEL A;  3I63 C;  3KLS X;  1WY8 A;  2DWQ A;  3EC8 A;  3H7P B;  3Q8B A;  2ZZP B;  2MBH A;  3V3X A;  4BVU C;  2IPK D;  1SE9 A;  2B76 B;  1JAL A;  2IDY A;  1XQQ A;  5DPR A;  4FUL A;  2K3U A;  1STE A;  2FAZ A;  2WXH A;  3P63 A;  2JF5 A;  4EZK A;  3AM9 A;  2D3C A;  4JE3 B;  3PZ8 A;  4Q2J A;  3PHX B;  4GSW A;  3H8H A;  4MH0 E;  2KFJ A;  3N30 A;  4FLH A;  4RGO S;  2IGD A;  2CHZ A;  4GXB A;  4IM2 A;  3FAH A;  2Z0E B;  4IM3 A;  3H1U A;  1V80 A;  3I5J C;  2K5P A;  3GZN I;  3TEW A;  1YQ4 B;  5BO4 B;  1BT0 A;  2MQJ A;  1V49 A;  3RNG C;  3PRP B;  2L00 B;  3ABV B;  2KTR A;  4OVV A;  4EEW A;  1WR6 E;  2DZI A;  2ZW1 A;  1BML C;  1WGY A;  2WLB A;  2PKO A;  1SB3 C;  2DHZ A;  1C79 A;  3Q3O C;  3RFZ B;  1PGA A;  5D3D A;  1C4C A;  3X0W A;  4LDT D;  3W2D A;  2IY0 B;  4IG7 B;  3DCG A;  3C0R B;  3TSS A;  2MJD A;  2KOX A;  1WH3 A;  1D5M C;  3RNE C;  1WX8 A;  2K22 A;  1WWT A;  2ZCB A;  2CKH B;  1TS4 A;  1D3Z A;  3WAM A;  4LLG M;  4OHJ A;  1E10 A;  1QOB A;  4OZC A;  4BKT A;  3O13 A;  3SFD B;  3DQV A;  1YJ1 A;  1UGM A;  2C60 A;  3IT6 B;  3R8B A;  4C00 A;  4BKS D;  3ML8 A;  3PT2 B;  2LI5 A;  4FJV B;  1P0R A;  1PGB A;  5IA7 A;  1RM6 C;  1QLB B;  1AW7 A;  1E7V A;  2FUG 1;  3Q8F A;  4II2 B;  1B9R A;  5TR5 A;  1YD8 U;  1HEZ E;  3FKY A;  3AE1 B;  1S1Q B;  1J0G A;  3TUO A;  4W9J A;  3LXF A;  5C23 A;  3LB8 C;  3P2B A;  3ZNZ B;  3P42 A;  2FNJ B;  1RFK A;  2I1J A;  4A3P A;  3Q14 C;  2PPH A;  1YX6 B;  2BYT A;  1J8C A;  3SFE B;  1K51 A;  1P9D U;  1WR1 A;  3UI3 A;  3MHZ A;  5FR3 A;  3B1L X;  2N9P C;  3S2A A;  4R3D A;  1OFF A;  2IBI B;  4BBN F;  2K8B A;  3RYT A;  2XK5 B;  2GBM A;  4BKG A;  1WZ3 A;  2KQS A;  4RNA A;  4MSQ B;  4UDU C;  3EFC A;  4L2Y A;  3A1Q A;  4B6W A;  5L83 A;  1SE2 A;  3BVM A;  3IG3 A;  2VZK B;  2ZPY A;  1FNV A;  2L1A A;  1NDD A;  3CF6 E;  1SIJ A;  1I4G A;  1T3Q A;  1T0Y A;  2KAC A;  3Q8E A;  3IHP C;  4US9 A;  2BWF A;  3OG5 A;  5AZF A;  5IP4 D;  4X57 B;  1EWY C;  3RZW C;  4MJS B;  3AUL A;  4NPN A;  2K6D B;  2WX0 A;  2N9E B;  4A3O A;  4L23 A;  1I35 A;  1KLV A;  4K3C A;  1A70 A;  2WWZ A;  2JU6 X;  3JYU A;  2BYF A;  4NJ7 A;  2NR2 A;  2MP2 A;  3ZLZ A;  2PVO D;  2FCN A;  1N62 A;  3VTW A;  3VXW A;  2W9N A;  1F52 A;  4K7W A;  1NYQ A;  2GB1 A;  3VR8 B;  2RDH A;  2XBB C;  2J0J A;  3ZKJ C;  3EUB 2;  1OGW A;  2KNB A;  5FR6 A;  1IUE A;  1V9J A;  3W5U B;  3Q8C A;  2KC1 A;  4KVG B;  3V60 A;  3ECI A;  1DOX A;  1JML A;  2MBQ A;  2BYV E;  2JVC A;  4TQ0 A;  4JWU C;  2GBR A;  5I4D A;  2BT6 A;  2JUO A;  3VDZ A;  4M0W A;  4C7Z A;  4AUQ C;  2A5U A;  2WXG A;  4IDI A;  1UH6 A;  2ACZ B;  1J7B A;  2MEK A;  3CSF A;  4W9F A;  3SD5 A;  3CMM B;  2NBV B;  1GJZ A;  4C80 A;  1E8Z A;  1PDX A;  3LJ3 A;  1UBI A;  1U4A A;  1CK1 A;  2WXF A;  4II3 B;  3UIO B;  3AEA B;  2ZNV B;  1E9M A;  2FCS A;  4DDI D;  1GG3 A;  1I4H A;  2AX5 A;  5DPT A;  1VD2 A;  3U4E G;  4LJP B;  1I4R A;  1YJJ A;  1EF5 A;  1E7U A;  3VHT C;  3NS1 A;  4M8N A;  1T5X D;  3MFG A;  4PYZ A;  2JWZ A;  2KJ6 A;  5HG2 A;  5IOI A;  4F8C B;  2RDG A;  4FHJ A;  2MWS B;  2M17 A;  1T0S C;  1VLB A;  3C19 A;  1FO4 A;  1D4B A;  2EMS A;  2AQ3 B;  1FM0 D;  4I6P A;  4LNO A;  2RR9 A;  1MPE A;  1C4P A;  1D5Z C;  3M63 B;  2JZ3 B;  2X38 A;  2VZK D;  2WXI A;  4M00 A;  2KVZ A;  2IO2 B;  3PGE A;  4DXA B;  1RYJ A;  3O65 B;  1TS3 A;  2YEP B;  5AUK A;  3MHS D;  3PPA A;  4WJN A;  2DEN B;  4WJO A;  3BVZ A;  5KHO A;  2MW5 A;  2KJH B;  2G45 B;  2KWV B;  1JWM D;  2NCN A;  3BY4 B;  2ON8 A;  3P4R B;  3RNF C;  2W82 A;  5AUI A;  3CST A;  1R4N B;  1FXA A;  5HHD G;  3L13 A;  3ZTC A;  2C7M B;  3A33 B;  3EGR A;  2HD5 B;  4NNJ B;  4IWO A;  2LJ5 A;  1WIA A;  3N1X C;  2KDM A;  2V4I B;  4PS3 A;  2NPT B;  2MBO A;  2FCQ A;  3L08 A;  4TMA B;  1J7C A;  3OLM D;  4EFO A;  2WU5 B;  3AEF B;  2MBB B;  4AQ7 A;  5AZG A;  4MGK E;  2WXJ A;  3AED B;  2N7D A;  2O6V A;  3ZVV A;  2Y5C A;  4AP4 C;  4YTN B;  3P4S B;  3SEB A;  4HKZ E;  1WGD A;  4E71 A;  2AL3 A;  3MC8 A;  1ROE A;  3DBL I;  1ZPS A;  1GOZ A;  3PO0 A;  3AU5 A;  4HJG E;  3ZRC A;  5H92 C;  4P16 A;  4H2A A;  3W9C B;  2KYW A;  1PQS A;  4MGI E;  2W55 A;  3PS6 A;  3BVG A;  2L76 A;  1R4M B;  3BII D;  1SIF A;  4YL8 A;  5MPO A;  3TCA A;  5CX3 A;  4EE2 A;  4FN2 A;  4N58 A;  3PV1 A;  2KAJ A;  4KKI A;  1WE6 A;  3VUY A;  1JWB D;  1AYF A;  5HKH A;  3ZQ4 A;  1V97 A;  3AV8 A;  1TGZ B;  3V62 A;  1MHH E;  4LTU A;  4RGM A;  2KQ4 X;  2UYZ B;  3T8M A;  3AE3 B;  4FJZ A;  2WGS A;  4B0M A;  3RI7 C;  4HEA 1;  1OTR B;  4HKQ A;  2LUM A;  2C7H A;  5JZE B;  4GU2 A;  4P7I A;  4N59 A;  1TKE A;  3TEY A;  2JZZ A;  2GBJ A;  1E6E B;  3JSV A;  2KVR A;  3RCZ A;  4REZ A;  4JGH B;  1FIQ A;  2LAS A;  2GMI C;  2KDE B;  3EHV A;  2KFK A;  3EFU A;  2WXK A;  3VAW A;  3UGB B;  3IBE A;  4O1N A;  3KUD B;  4RCO A;  1MHX A;  4M8M A;  5TSS A;  2M19 A;  1EO6 A;  3VRB B;  3B0A A;  4EOY A;  3NY5 A;  3K9O B;  2WXR A;  3V6E B;  4YSY B;  1TY0 A;  2INN E;  4XX5 A;  3H7P A;  3QK0 A;  4IUM B;  1L0Y B;  1MVK A;  2ICI A;  2YEP F;  4J6I A;  4L1B A;  2PE6 B;  3KH0 A;  2O2V A;  1EWC A;  1JWU D;  4NZL B;  3QWZ B;  3IT4 B;  2I38 A;  3DPD A;  3U52 E;  1QT9 A;  2Z59 B;  2SEB D;  2MJE A;  3L10 B;  2IND C;  4CQN A;  3SHQ A;  2WP9 B;  2VH2 A;  1A5R A;  1HZ5 A;  4IKG A;  2K8H A;  1HTQ A;  3NZS A;  1Q1O A;  4B9K A;  2IO1 B;  1S3S G;  4DDG D;  1YN4 A;  3IAS 1;  2QIL A;  4OVZ A;  5T8I A;  2KHW B;  2OED A;  1WYW B;  3PRZ A;  5BYR A;  4DBG A;  1GNU A;  2JRH A;  2KKC A;  1K53 A;  1RWS A;  2LWP A;  2V9H A;  3A1Q B;  3HUI A;  2BGF A;  4DHZ E;  1SJH D;  4HWI B;  1N5X A;  2QEJ C;  4W9D A;  1DOY A;  2C5L C;  3RNA C;  2LGX A;  1D6E C;  2FE8 A;  4HRS A;  5G5H A;  1CZP A;  3NHE B;  1QIL A;  5D94 A;  3MJW A;  2RD0 A;  2KT7 A;  2D3A A;  1DOI A;  1HZ6 A;  2DNF A;  2CS4 A;  3FIL A;  1L5P A;  1KRH A;  4HPM B;  1NEK B;  3QIJ A;  2FIF A;  1N6Z A;  2L3Z A;  1UEL A;  3WAP A;  1L0X B;  1LFD A;  3A4S C;  4P1B C;  1FD6 A;  1VZ7 A;  1JCK B;  2B3A A;  2LUE A;  5L95 C;  2IGH A;  1VR9 A;  1PFD A;  1WRI A;  2KDF B;  3DWM A;  3HK0 A;  2JQR B;  2X8X X;  4NJ6 A;  2QSD A;  1FNU A;  4MDK E;  3AEE B;  3I9V 1;  3QQ8 B;  4LDT B;  1LXD A;  1RFA A;  2NBW B;  2LZ6 A;  3ZIM A;  1WGG A;  4ZRP A;  4TQ1 A;  2IY1 B;  4MEM A;  2KC2 A;  1XO3 A;  2AQ1 B;  1OQQ A;  4HLE A;  1K50 A;  4GOC A;  3PLU A;  2PLP A;  3Q3N C;  1WGH A;  2LJI A;  1NEN B;  1WJ6 A;  4ZRK A;  3SU8 X;  3VRA B;  1IP9 A;  4TSS A;  2D3B A;  2INP E;  4ZYS A;  4FJY A;  1Y56 A;  4MEL A;  2NTT A;  3HM6 X;  3AE5 B;  4HDQ A;  1KLU D;  3ZXR A;  2BS4 B;  2W3S A;  3WCQ A;  1C4A A;  4KSK C;  2R2O A;  4PYU A;  2E3T A;  3VFK A;  1FPY A;  1TY2 A;  3OAW A;  2KMA A;  1WXM A;  1NBF C;  3B08 A;  2M8S A;  5JHB A;  3W5V B;  1OEY A;  2AYO B;  3PTF C;  3ZNH B;  4NY0 A;  3R2T A;  2IYD B;  1PYW D;  2V4L A;  4D2K A;  4A6Q A;  1YNT E;  1VZ6 A;  5LNK 1;  3MJ5 A;  2KQ7 A;  4BFR A;  1MG4 A;  1TS2 A;  2J52 A;  3VVW B;  2PW9 A;  1R7S A;  1TKG A;  4FHK A;  1JQ4 A;  5JHA A;  1MG8 A;  3KWV A;  1NI3 A;  3L4P A;  4JPS A;  3A9K A;  2KDI A;  2L8J A;  4EKU A;  1IGD A;  3DDC B;  1WX9 A;  2L83 A;  4KIK A;  1D5X C;  1UGJ A;  2J42 A;  3BK1 A;  2BPS A;  4W9H A;  4WWN A;  5GXG B;  4A20 A;  4M0W B;  3P4P B;  3NVV A;  4RGT A;  2DZM A;  5E6N A;  1L0V B;  2RPQ A;  1SE3 A;  1E8X A;  2Y5P A;  1SF0 A;  3N1Y C;  3OJ4 B;  1PGX A;  2KFK B;  3DBS A;  4GB9 A;  1WGK A;  1FCL A;  4RM9 A;  4G3X B;  3I57 A;  2LD9 A;  1QOG A;  4G50 A;  4PS8 A;  3ZYY X;  2K1F A;  2BTE A;  2DLB A;  4RM8 A;  5FKA C;  4C56 C;  4YSX B;  3B9J A;  4TV3 A;  1GAQ B;  3RNC C;  2JYT A;  2WDT B;  2W54 A;  4KX6 B;  1I42 A;  1ESF A;  3MTN B;  1KH0 A;  1N60 A;  1ZDV A;  2EKI A;  2IO0 B;  2L0F A;  2FBW B;  3VUX A;  5GMV A;  2G4S A;  3JW0 X;  2Y5B B;  1SGH A;  4WJQ A;  4YTM B;  3KYD D;  5D7G A;  3VTU A;  5AEK B;  1RAX A;  2ONQ A;  3HRD D;  1L2N A;  1F9J A;  3DBH I;  4XGA B;  1LO5 D;  2LGI A;  1L4D B;  2IO3 B;  2PJH A;  1QZE A;  1UUP A;  3IVF A;  2N7E A;  1TZO A;  1V6E A;  3TEX A;  2CHW A;  5E6J A;  3UIP B;  4MSM B;  4HRO A;  1FFU A;  1JRU A;  2N4F A;  4DHZ B;  1ET6 A;  3RNB C;  2KDB A;  2MHJ A;  3QA8 A;  4KGR A;  2DX5 B;  4OZB A;  4ARI A;  3URY A;  5EDS A;  2MA9 B;  3Q3M C;  4MGZ E;  3NS8 A;  1ZOY B;  1IPG A;  1WFY A;  2JT4 B;  3PHW B;  2J7Q B;  2ZCC A;  1V1O A;  1V1P A;  3KWL A;  4GGQ A;  5H8Y E;  2G9H D;  1CJE A;  1WX7 A;  3J9C A;  3U7D A;  2WS3 B;  1EUV B;  2L7R A;  2PVG C;  2E6X A;  1F1H A;  4GDL B;  3ZTD A;  2ZVN A;  1UF0 A;  2D2Q A;  1V2Y A;  2D10 A;  4LCD E;  3RZF A;  4DXG A;  1SBB B;  4MT5 A;  1E0Z A;  3DBH B;  3QAQ A;  4DQO C;  2LMC A;  2NTS A;  1M94 A;  4BBN C;  2D11 A;  1F0Z A;  3KYC D;  3ETR A;  3MP9 A;  2V3S A;  4M02 A;  3APD A;  2AQ2 B;  3UIN B;  3VH3 B;  1G6J A;  3V05 A;  4LK0 M;  2H88 B;  2HTH A;  2JWU A;  4LNN A;  3SDL C;  2WNM A;  3RD2 A;  3ZDT A;  4P6V F;  2VRR B;  3NUH B;  5BYS A;  4WWO A;  4QAY A;  5CHF A;  2MX2 A;  1WMH B;  2OJW A;  2K25 A;  4B95 A;  1IBX B;  3RN9 C;  4NQL B;  2Z0D B;  3RUI B;  4B0E A;  2NVU I;  3Q3F A;  4MGY E;  3R7R A;  4W9K A;  3AB5 A;  3RMK C;  5HI1 A;  1P3Q U;  2HTM E;  1XLP A;  5C1Z A;  2ASQ A;  3RT3 B;  2CU1 A;  5BMI A;  2J4X A;  1IYF A;  2C9W B;  1FXI A;  2WQY B;  3DHH C;  1XF5 L;  3VTV A;  1E8W A;  1JRO A;  3GP7 A;  2LEK A;  3V6C B;  4I6N B;  2C7N B;  1QF6 A;  3AE4 B;  3W1S C;  2FID A;  2N9L A;  3Q6B A;  4A90 A;  4BOS C;  1MI0 A;  4WIP A;  1SJE D;  5BYQ A;  4EZL A;  2J0K A;  2K8C A;  2MCN B;  2CHX A;  1I4P A;  3GOE A;  2UWQ A;  2WXL A;  1BUI C;  1KTK A;  3A9K B;  1YIW A;  3IAM 1;  1MJD A;  4IW0 A;  4W9I A;  2LHD A;  4C4V A;  4ACF A;  3T3O A;  3BYY B;  4KIK B;  3TEZ A;  2JPH A;  3DVN U;  1AN8 A;  2VH1 A;  3PVL A;  4S17 A;  3U2S C;  5C3J B;  2NS5 A;  3DBR I;  1ISN A;  3E9S A;  3AN1 A;  3FIL B;  3U8Z A;  2OHF A;  2QC8 A;  1ZXI A;  4TUU A;  1FNW A;  1LM8 B;  2Z8L A;  1OEY J;  4LJO B;  3N32 A;  1H4R A;  1ZW7 A;  2EMT A;  4A9A A;  3AXC A;  2J53 A;  3ZRF A;  2BB6 A;  2MRP A;  1HE8 A;  2INC C;  2R61 A;  5IO9 A;  4K3B A;  2V3N A;  3APC A;  4RFB A;  2DYM A;  2KXJ A;  5E6P A;  2LGD A;  1OQR A;  2WXQ A;  1FFV A;  2CU3 A;  4JLC A;  1C76 A;  3NRZ A;  2LRU A;  2WDR B;  4MM3 B;  3GE8 C;  4KGT A;  3KUZ A;  4C7Y A;  1XXG A;  2KO3 A;  4ANX A;  1XEE A;  4YWG G;  3CIR B;  1GB4 A;  2GBK A;  4A8X C;  2PMV A;  3C8Y A;  5LXI B;  1ZDX A;  4OW0 A;  2BYE A;  3VR9 B;  1ENF A;  2XNA C;  3ZUN A;  3ZJV A;  2KMC A;  2D3G A;  3QX1 A;  3E56 A;  3ZDM C;  2UU7 A;  4NAM A;  4LNF A;  3BK2 A;  4KKJ A;  1L6V A;  1L7Y A;  4K1R B;  4GN1 A;  4GDK A;  4TKN A;  4GMV A;  1C77 A;  1JRP A;  2ZW0 A;  3GB1 A;  4OZA A;  2I2Y A;  4OVU A;  1KLG D;  4HK2 A;  4LNI A;  3HIZ A;  1VRA B;  1HXY D;  2KK8 A;  3KVF B;  3R7Q A;  4HPP A;  3T9L A;  4AS1 A;  5DPW A;  3P1M A;  1L6U A;  3ZJT A;  3DVN V;  1Y8R C;  4IWQ A;  1UBQ A;  2HDE A;  3BYT B;  2LRW A;  2AWT A;  4EZJ A;  3QCA A;  2JY6 A;  4A55 A;  4J3O D;  3ZNG C;  1YN5 A;  1YQ3 B;  2V0G A;  1P98 A;  3ZXV A;  1EM7 A;  1ZGU B;  1M4V A;  4K81 A;  2DAJ A;  3W1Y A;  4M01 A;  2N9K A;  3IXS A;  3HHM A;  1TT5 B;  2G3Q B;  2L32 A;  4YTP B;  1WSP A;  2OOB B;  3A9J A;  4ANV A;  3AI5 A;  2MBE A;  1I4Q A;  2M1M A;  1P1A A;  2Y3A A;  4PK1 A;  2NPT A;  1ET9 A;  4JIO U;  3PRE A;  5EE9 A;  2QJL A;  3KQ4 A;  1V8C A;  2XEW A;  5G2N A;  5IAA C;  2KN4 A;  3A9J B;  4ZRI A;  3KW5 B;  2IZV B;  3AU4 A;  4WWP A;  3ZNI D;  2AEH A;  5KHQ A;  4JQW C;  2TSS A;  4FA6 A;  1J19 A;  4XWW A;  2AL6 A;  1I4X A;  3NOB A;  3HM3 A;  4BZA A;  2BQQ A;  2JYE A;  4W9E A;  4KV2 A;  2HJ1 A;  3DHG C;  2GI9 A;  5J17 A;  1CMX B;  3SR6 A;  3RUL A;  3AE7 B;  3AEG B;  4ZRJ A;  3M3J A;  4ASW C;  4FAD A;  3M62 B;  4XE0 A;  3TBL D;  2JZP A;  3L16 A;  4GDK B;  4XZ4 A;  4RF1 A;  1FMA D;  1V86 A;  2ZNV C;  3QC8 B;  3R3M A;  1BXT A;  2KD0 A;  4IWP A;  2G4D B;  2LHE A;  1QQR A;  3APF A;  2JX5 A;  3R66 C;  2XK5 A;  3B2F A;  2QDF A;  2JSV X; 
#chains in the Genus database with same CATH homology
 2K6Q A;  4G50 A;  4PS8 A;  2K1F A;  5JH5 C;  3L13 A;  3ONS A;  4RM8 A;  3ZTC A;  2C7M B;  3DOW A;  2LXC A;  4E74 A;  4E3C A;  3A33 B;  2KX0 A;  4NNJ B;  2HD5 B;  4PS7 A;  4ZYN A;  2KWU B;  4IWO A;  2LJ5 A;  4TV3 A;  2KJR A;  2WDT B;  1I42 A;  3MTN B;  1WIA A;  3QAR A;  2IO0 B;  4AJY B;  4PS3 A;  2L0F A;  2LVO A;  2NPT B;  3VUX A;  2MBO A;  4HXD A;  3ENE A;  2FCQ A;  5GMV A;  2G4S A;  3L08 A;  3WAL A;  2KX3 A;  3JW0 X;  2K39 A;  2Y5B B;  3OLM D;  1SGH A;  2L05 A;  4EFO A;  2MBB B;  1Q5W B;  5AZG A;  3EEC A;  4WJQ A;  2ZPN A;  4MGK E;  1NI2 A;  3KUC B;  3KYD D;  5D7G A;  3VTU A;  5AEK B;  3ZO5 B;  1E8Y A;  2DZK A;  1RAX A;  1RLF A;  2KZR A;  4WJP A;  5J2R A;  2RGF A;  1GC6 A;  1UD7 A;  1F9J A;  2GBN A;  2I1K A;  2N7D A;  3DBH I;  2NBU A;  2O6V A;  1WF9 A;  3WAN A;  3UQB A;  2DAF A;  1UZX B;  2LGY A;  2YVC A;  3ZVV A;  2IO3 B;  1LQB A;  3M95 A;  4AP4 C;  2PJH A;  4IM0 A;  1QZE A;  3IVF A;  2N7E A;  3TJP A;  1V6E A;  2L0T A;  2CHW A;  4G11 A;  3UIP B;  1WGD A;  4RMA A;  2AL3 A;  4E71 A;  4G0N B;  4MSM B;  2BWE S;  2MP2 B;  5AZH A;  3DBL I;  4CO7 A;  1JRU A;  1WE7 A;  2N4F A;  3TL5 A;  3AU5 A;  4DHZ B;  1C1Y B;  2KDB A;  3ZRC A;  3UF8 A;  3U30 A;  5CHW A;  3QA8 A;  1PQS A;  4MGI E;  2DX5 B;  3NZU A;  3PS6 A;  1XD3 B;  3DVG X;  2LXA A;  2L76 A;  2MA9 B;  4MGZ E;  1ZKH A;  5EDS A;  5DCN A;  4NQK E;  3NS8 A;  1SIF A;  1WJ4 A;  4YL8 A;  3TCA A;  1IPG A;  5CX3 A;  1WFY A;  1WY8 A;  2JT4 B;  4FN2 A;  3PHW B;  3EC8 A;  3H7P B;  3Q3J A;  2J7Q B;  3D32 A;  3VH4 B;  2ZCC A;  3PV1 A;  2ZZP B;  2MBH A;  3VUY A;  1WE6 A;  1V81 A;  4BVU C;  1SE9 A;  4GGQ A;  5D2M B;  4XC2 A;  5DPR A;  1XQQ A;  1WX7 A;  3ALB A;  5HKH A;  1YQB A;  4MJS A;  4FUL A;  4GIV A;  3U7D A;  4HJK A;  1TGZ B;  3V62 A;  4AWJ A;  1EUV B;  3DVG Y;  2L7R A;  4ANU A;  2FAZ A;  4KZ0 A;  4GDL B;  5CTR C;  2JF5 A;  3ZTD A;  4EZK A;  4CHK A;  2A4Z A;  2ZVN A;  2UYZ B;  2D2Q A;  3T8M A;  1V2Y A;  4FJZ A;  2D10 A;  4LCD E;  3RZF A;  1KM7 A;  3PHX B;  4GSW A;  4MH0 E;  2KFJ A;  5G55 A;  1OTR B;  3N30 A;  2J0M A;  3QAQ A;  4I6L B;  4FLH A;  2C7H A;  5JZE B;  1M94 A;  4GU2 A;  1AAR A;  4P7I A;  2KWC A;  4BBN C;  2D11 A;  2CHZ A;  3IFW B;  4GXB A;  4IM2 A;  2N1W A;  3KYC D;  2KTR B;  3H9D A;  3V61 A;  2Z0E B;  3L17 A;  2V3S A;  4IM3 A;  3H1U A;  3L54 A;  2JZZ A;  1V80 A;  3APD A;  2GBJ A;  3VH3 B;  3UIN B;  1WXS A;  3JSV A;  1G6J A;  3GZN I;  2KVR A;  2D07 B;  4WQO B;  2HTH A;  3SDL C;  3RCZ A;  5BO4 B;  4JGH B;  1BT0 A;  2MQJ A;  3RD2 A;  1V49 A;  3ZDT A;  2VRR B;  2LAS A;  3PRP B;  2GMI C;  2KDE B;  3EHV A;  1Z2M A;  2KFK A;  3EFU A;  2L00 B;  4WWO A;  1C3T A;  2EKE C;  3VAW A;  3UGB B;  2KTR A;  1WJN A;  4HCP B;  5CHF A;  1RRB A;  1KJT A;  2MX2 A;  3IBE A;  4OVV A;  1WR6 E;  1WMH B;  2DZI A;  4EEW A;  3KUD B;  2K25 A;  4M8M A;  1WM3 A;  1R4N I;  1EO6 A;  1K8R B;  1WGY A;  3B0A A;  2QHO A;  4EOY A;  3NY5 A;  4B95 A;  1V5O A;  2DHZ A;  3K9O B;  3V6E B;  4CYE A;  4NQL B;  2Z0D B;  3RUI B;  3X0W A;  4LDT D;  2NVU I;  2IY0 B;  3Q3F A;  4MGY E;  3R7R A;  4IG7 B;  3DCG A;  4XX5 A;  3C0R B;  4KZC A;  4W9K A;  3H6N A;  3H7P A;  3JSV B;  1L2N A;  2KOX A;  3QK0 A;  1WH3 A;  1P3Q U;  4IUM B;  3OJ3 A;  2N9X A;  4DK5 A;  4J6I A;  5C1Z A;  2ZJD A;  1WX8 A;  2ASQ A;  3RT3 B;  2CU1 A;  1X1M A;  2PE6 B;  2R2Q A;  3QJZ A;  2ZCB A;  2CKH B;  2O2V A;  3KH0 A;  4NAW A;  1IYF A;  3QWZ B;  4KSL C;  1D3Z A;  2C9W B;  3WAM A;  3DPD A;  3PSE B;  3VTV A;  2Z59 B;  1E8W A;  3WAO A;  3PZD A;  4BKT A;  1TBE A;  3V6C B;  3DQV A;  4I6N B;  2C7N B;  3L10 B;  2HJ8 A;  1YJ1 A;  1UGM A;  5E6O A;  3W1S C;  4NAW B;  2FID A;  2C60 A;  1YX5 B;  3SHQ A;  4BOS C;  3PLV A;  4BKS D;  2RSU A;  2M0X A;  3ML8 A;  1A5R A;  3PT2 B;  2WYQ A;  3I3T B;  2K8H A;  3TMP B;  2JXX A;  2LI5 A;  4EZL A;  4ICU A;  2J0K A;  2K8C A;  4FJV B;  1P0R A;  5IA7 A;  3NZS A;  2M4N A;  2MCN B;  1E7V A;  1WM2 A;  2CHX A;  3GOE A;  2UWQ A;  4II2 B;  4F1S A;  2DZJ A;  1Q1O A;  5TR5 A;  2IO1 B;  4B9K A;  1YD8 U;  3A9K B;  1YIW A;  4W9C A;  1S3S G;  4DDG D;  4DWF A;  3K9P B;  1WI0 A;  4IW0 A;  1XT9 B;  4W9I A;  1S1Q B;  2KAN A;  5CHV C;  4ANW A;  1J0G A;  4W9J A;  4KIK B;  5C23 A;  2KHW B;  3P2B A;  3ZNZ B;  2JPH A;  3DVN U;  3PVL A;  1WYW B;  3PRZ A;  2FNJ B;  4DBG A;  2O6V D;  4FBJ B;  2I1J A;  4A3P A;  2PPH A;  1GNU A;  2JRH A;  2KKC A;  1YX6 B;  1J8C A;  1P9D U;  1WR1 A;  2LWP A;  2NS5 A;  3DBR I;  1ISN A;  4KDI C;  3A1Q B;  1GUA B;  3B1L X;  4DHJ B;  3U8Z A;  2BGF A;  4DHZ E;  4HDO A;  4JL9 A;  4HWI B;  4W9D A;  2N9P C;  3S2A A;  2REX A;  4KDL B;  4TUU A;  1WXA A;  2IBI B;  1LM8 B;  4K7U A;  1OEY J;  4BBN F;  2C5L C;  4LJO B;  2K8B A;  2LGX A;  2BKR B;  3RYT A;  2XK5 B;  3N32 A;  1H4R A;  1ZW7 A;  3NHE B;  4F7Z A;  2GBM A;  1WGR A;  4BKG A;  1WZ3 A;  2EMT A;  5D94 A;  1H8C A;  3AXC A;  1GC7 A;  3ZRF A;  2V1Y A;  3MJW A;  2KTF A;  1Q0W B;  2KQS A;  2MRP A;  2RD0 A;  1HE8 A;  4MSQ B;  4HPL B;  1FXT B;  2CS4 A;  3A1Q A;  2MSE D;  4B6W A;  3APC A;  2DYM A;  4HPM B;  5L83 A;  2KXJ A;  5E6P A;  2LGD A;  3IG3 A;  2ZPY A;  3QIJ A;  4JLC A;  2FIF A;  2L3Z A;  1UEL A;  3PRM B;  1NDD A;  2LRU A;  3CF6 E;  3WAP A;  1LFD A;  3A4S C;  3VQI A;  1KOT A;  3KUZ A;  2B3A A;  2LUE A;  5L95 C;  1T0Y A;  3IHP C;  2KO3 A;  4ANX A;  2BWF A;  2DYB A;  5AZF A;  2GBK A;  2N1V A;  5LXI B;  2LVP A;  2BYE A;  2KLG A;  4X57 B;  2KDF B;  3ZUN A;  3RZW C;  4MJS B;  2KMC A;  2D3G A;  3AUL A;  3QX1 A;  3ZDM C;  4NPN A;  4URK A;  2K6D B;  2WX0 A;  2N9E B;  3HK0 A;  4A3O A;  2JRI B;  4NJ6 A;  5DPS A;  1V5T A;  1I35 A;  4MDK E;  1KLV A;  2BF8 B;  4HVB A;  4BOZ B;  1VCB A;  3WA0 A;  2WWZ A;  3QQ8 B;  3TIX A;  3JYU A;  1L7Y A;  4K1R B;  2HE7 A;  4GN1 A;  4GDK A;  2BYF A;  4NJ7 A;  4AJW A;  2PEA A;  4TKN A;  4GMV A;  5LLI A;  2NR2 A;  2MP2 A;  1LXD A;  4LDT B;  3ZLZ A;  1RFA A;  2FCN A;  2NBW B;  4IC7 B;  2LZ6 A;  3VTW A;  3VXW A;  3ZIM A;  4OVU A;  1WGG A;  4HK2 A;  4ZDV A;  2W9N A;  5LXH A;  4K7W A;  4TQ1 A;  2IY1 B;  3HIZ A;  4MEM A;  3KVF B;  2KK8 A;  2KC2 A;  3R7Q A;  2XBB C;  3W1S A;  2J0J A;  3T9L A;  3ZKJ C;  1E90 A;  1OGW A;  2GOW A;  2KNB A;  4ICV A;  5DPW A;  5FR6 A;  1V9J A;  2KC1 A;  3H7S A;  3DVN V;  4KVG B;  1Y8R C;  4HLE A;  3UQA A;  4IWQ A;  3V60 A;  1UBQ A;  3ECI A;  4GOC A;  3ML9 A;  3PLU A;  2OJR A;  1WGH A;  2LRW A;  2MBQ A;  2BYV E;  1WJ6 A;  4ZRK A;  2AWT A;  2JVC A;  3SU8 X;  1IP9 A;  2MLB A;  3QCA A;  4TQ0 A;  4EZJ A;  2GBR A;  3LDZ E;  2JY6 A;  4FJY A;  2JUO A;  4HCN B;  4MEL A;  3VDZ A;  4BKS A;  1TTN A;  2O6V B;  3HM6 X;  3ZNG C;  3VUW A;  1P98 A;  4HDQ A;  4AUQ C;  2A5U A;  1ZGU B;  1UH6 A;  4KSK C;  4K81 A;  2R2O A;  4PYU A;  2DAJ A;  2ZEQ A;  4MM3 A;  3VFK A;  3W1Y A;  3CSF A;  3OAW A;  4W9F A;  2KN5 A;  2KMA A;  3SD5 A;  1WXM A;  3CMM B;  3HHM A;  2NBV B;  1NBF C;  3B08 A;  4W9G A;  1GJZ A;  1WZ0 A;  2M8S A;  3X23 A;  5JHB A;  1E8Z A;  2G3Q B;  3LJ3 A;  1OEY A;  1UBI A;  1U4A A;  2AYO B;  3PTF C;  3ZNH B;  2BKF A;  2O2V B;  4NY0 A;  1OQY A;  4II3 B;  3UIO B;  1EF1 A;  2OOB B;  3A9J A;  4ANV A;  2IYD B;  2ZNV B;  2FCS A;  2V4L A;  3AI5 A;  2MBE A;  4DDI D;  1GG3 A;  2DYO A;  2M1M A;  1TZ1 A;  1P1A A;  2NPT A;  5DPT A;  1VD2 A;  2KQ7 A;  4BFR A;  4LJP B;  4AOF A;  1WMH A;  2CR5 A;  4JIO U;  3PRE A;  4WAA A;  1EF5 A;  3VVW B;  4DHJ D;  1E7U A;  3VHT C;  2XEW A;  2FUH B;  5G2N A;  5IAA C;  4M8N A;  4PYZ A;  3N3K B;  2PE9 A;  2JWZ A;  2KJ6 A;  3A9J B;  4ZRI A;  3KW5 B;  2IZV B;  3AU4 A;  4FHK A;  4F8C B;  5JHA A;  1MG8 A;  4WWP A;  3ZNI D;  2AEH A;  5KHQ A;  4JQW C;  5J18 A;  3A4R A;  1J19 A;  2MWS B;  4FHJ A;  4FA6 A;  2AL6 A;  2M17 A;  3A9K A;  2KDI A;  3NOB A;  4N9F 4;  2L8J A;  3HM3 A;  4EKU A;  3DDC B;  2EMS A;  3QHT A;  4I6P A;  1WX9 A;  2LVQ A;  2ZVO A;  2RR9 A;  4KIK A;  4W9E A;  4W9L A;  4KV2 A;  4K7S A;  2WX1 A;  3M63 B;  5J17 A;  2JZ3 B;  2BPS A;  5D6J B;  1CMX B;  3RUL A;  4W9H A;  4WWN A;  2IO2 B;  1Z5S B;  2YLM A;  3PGE A;  4DXA B;  1WXV A;  3O65 B;  4A20 A;  4ZRJ A;  4M0W B;  3M3J A;  3MHS D;  3ZW3 A;  4ASW C;  3WIM A;  2DZM A;  4FAD A;  3JVZ X;  3PPA A;  3M62 B;  3TBL D;  1WJU A;  3L16 A;  4GDK B;  4WJN A;  4XZ4 A;  5E6N A;  2DEN B;  2KLC A;  3L0W B;  1V86 A;  4WJO A;  2ZNV C;  3QC8 B;  3R3M A;  2RPQ A;  5KHO A;  2MW5 A;  4EUT A;  1E5W A;  1E8X A;  2KJH B;  2G45 B;  2KWV B;  3OJ4 B;  1R4M I;  2KD0 A;  2NCN A;  3BY4 B;  4IWP A;  2G4D B;  1WRD B;  2KFK B;  3DBS A;  4GB9 A;  3BIN A;  3APF A;  4G3X B;  2FCM A;  4RM9 A;  3R66 C;  4GDL A;  2XK5 A;  3CST A;  2LD9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...