2KC1A

Nmr structure of the f0 domain (residues 0-85) of the talin ferm domain
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
91
structure length
91
Chain Sequence
GIDPFTMVALSLKISIGNVVKTMQFEPSTMVYDACRMIRERIPEALAGPPNDFGLFLSDDDPKKGIWLEAGKALDYYMLRNGDTMEYRKKQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MKIAA1027 protein
publication title Structure of a double ubiquitin-like domain in the talin head: a role in integrin activation.
pubmed doi rcsb
source organism Mus musculus
molecule tags Structural protein
total genus 22
structure length 91
sequence length 91
ec nomenclature
pdb deposition date 2008-12-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16511 FERM_f0 N-terminal or F0 domain of Talin-head FERM
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 2kc1A00
2N1WA 3A4SC 3PS6A 2LI5A 1GUAB 5DPRA 3N3KB 1S3SG 3L08A 4K7SA 4I6NB 4AUQC 1V9JA 3W1SC 1V81A 1R4MI 2K8BA 5LXHA 2C7NB 4JL9A 1RAXA 1U4AA 1WM3A 2KWVB 1KOTA 2GBMA 5E6OA 2HTHA 5JHBA 2GMIC 3L17A 4GB9A 2BKFA 3AI5A 1WGDA 4EUTA 4K7UA 2KX0A 1C3TA 2WX1A 3A33B 3NZUA 4KDIC 2ZEQA 4NJ7A 1GJZA 4BFRA 2KZRA 4JQWC 4W9HA 3NHEB 3VFKA 2KK8A 3ZLZA 3TIXA 5D6JB 1G6JA 3SU8X 3H7SA 4BOSC 3DVNV 2V3SA 4MJSA 4IWOA 2A4ZA 3KYCD 2KC1A 1E8ZA 2FUHB 3EFUA 2C60A 4DWFA 4W9FA 5JZEB 1WYWB 3QA8A 2KWCA 2N7EA 4GU2A 1D3ZA 2KXJA 3M63B 4XC2A 4KSKC 4WWPA 2L0TA 3X23A 4IM0A 2MRPA 1WJNA 1P3QU 4MDKE 3ZNGC 2M4NA 1NDDA 1P9DU 1RFAA 2K6QA 1H8CA 2KJHB 2KD0A 2JWZA 2FIFA 2J0JA 2NCNA 3KVFB 3OAWA 1WE7A 1E8YA 3DOWA 4GMVA 2O6VA 3AULA 4JGHB 4HLEA 1V86A 1XD3B 2UYZB 1RRBA 3UGBB 5AZGA 3PT2B 2XBBC 2KTRB 4W9CA 3ALBA 3OLMD 3R3MA 4URKA 1EF5A 4MELA 4ICVA 4BBNC 1WXMA 4FULA 2FCNA 2W9NA 2KNBA 3QWZB 3VXWA 2ZPNA 3LDZE 2K1FA 3VTVA 2KVRA 2IBIB 2L8JA 3SDLC 5D2MB 4A20A 3EC8A 4W9DA 3CMMB 2MX2A 3WALA 4GDLA 3OJ4B 4MM3A 4ICUA 4XZ4A 2G45B 2BKRB 3KH0A 3N30A 1UBQA 4J6IA 2ZZPB 4B95A 3JVZX 3ZIMA 1V6EA 3RZWC 1F9JA 4CHKA 1Y8RC 4GXBA 1ZGUB 3LJ3A 2L76A 2XK5B 1TZ1A 3QQ8B 2D07B 2KKCA 3ML8A 2B3AA 1SIFA 3QARA 1Q5WB 1YX5B 1WR6E 3PHXB 2LJ5A 4YL8A 1WGHA 4ANXA 1OGWA 2JUOA 2KDFB 3HM6X 2ASQA 3R66C 4MSQB 3UINB 3WIMA 3PPAA 3PTFC 4GSWA 1PQSA 3V60A 2EMSA 3AU5A 4FHJA 4RMAA 3VDZA 3ZVVA 1A5RA 4WAAA 4W9LA 4DHZB 3WAPA 2MBOA 4W9KA 3IFWB 5EDSA 1KLVA 1KJTA 3A9KA 2DZJA 2JF5A 2KMCA 5CHVC 4FBJB 4K1RB 3M3JA 1H4RA 1EF1A 4M0WB 3ZKJC 3DVNU 4WJPA 1K8RB 1Q1OA 2V1YA 3MHSD 5AZHA 4IM2A 3WAMA 2ZVNA 3KUDB 2LUEA 4KZ0A 1J8CA 5C1ZA 1WGGA 3ZW3A 1ZW7A 1R4NI 3UQBA 5D94A 2R2QA 2AEHA 3PRZA 2G3QB 2BWES 2I1KA 4AOFA 4E71A 4TV3A 4TQ0A 2N9PC 1UH6A 2K8HA 4FHKA 2KJ6A 3A1QB 3ZDMC 4G11A 5JH5C 1OTRB 2LRUA 4FJVB 1P0RA 3K9PB 1T0YA 3VTWA 2WWZA 2DZKA 1ISNA 2A5UA 1WI0A 4BVUC 2K39A 2PE9A 2BWFA 2NR2A 3SD5A 2UWQA 5J2RA 3ZDTA 3JW0X 5C23A 5CX3A 4GN1A 1I42A 3H1UA 2MP2B 4LJPB 4RM8A 5AZFA 3B08A 2N9XA 3D32A 3I3TB 4W9JA 3W1YA 3NOBA 3QK0A 4M8NA 2MP2A 2JY6A 2ZNVB 2JVCA 4BOZB 1WJ4A 2KQSA 1WE6A 3ZTDA 3HM3A 4EEWA 2M0XA 4A3OA 4DHJB 1YIWA 1ZKHA 3ML9A 1HE8A 1WX9A 4IG7B 4IM3A 2GBNA 3V6CB 2NVUI 3VUYA 2PEAA 2IY1B 3RUIB 3L54A 1IP9A 3Q3JA 2KQ7A 4GDKB 1UGMA 4HPLB 3JYUA 4NPNA 4AP4C 2CKHB 1WX7A 3DQVA 4HXDA 1YQBA 4PS7A 2JXXA 5G2NA 1TBEA 1TGZB 1GNUA 1S1QB 4IW0A 3A9JB 4KIKB 4TKNA 2PPHA 2L05A 2OJRA 4PYUA 3ZNHB 1E8XA 2KO3A 3VTUA 4BKSA 4WJOA 2BYVE 1FXTB 2HD5B 4XX5A 2JZZA 4NAWB 3H9DA 4II3B 2MBBB 1WJUA 4E3CA 1E7UA 2FIDA 1EUVB 3MTNB 4ANUA 2N9EB 2EKEC 1WZ0A 4KSLC 3O65B 2IY0B 4HCNB 2DYBA 3U8ZA 3V62A 2NPTB 4W9IA 2MQJA 1J19A 2ZPYA 3EECA 2D3GA 2RD0A 4MSMB 1MG8A 4NQLB 2Z0DB 5G55A 4FA6A 5IAAC 4EZKA 4DK5A 3DPDA 3DBSA 2AL3A 1NBFC 2OOBB 1E7VA 4GGQA 4KZCA 4FADA 1P98A 3RYTA 4WWNA 2LXAA 2DAFA 2BF8B 1CMXB 4JIOU 3UQAA 1XT9B 2KTRA 1GG3A 1OEYA 2MBQA 1GC7A 4CO7A 4A3PA 2JPHA 3HHMA 4WJNA 4KVGB 4AJYB 5KHOA 4WWOA 2M17A 2KLGA 4GIVA 2LXCA 1E8WA 2L0FA 2CHZA 2KOXA 4G3XB 3PRPB 4HK2A 2KFJA 3VAWA 3QHTA 2FCQA 4F8CB 2FAZA 3ZO5B 4HVBA 1JRUA 4BBNF 2K8CA 2IO1B 3PVLA 1WF9A 2VRRB 1BT0A 3K9OB 2CHXA 2M1MA 4I6PA 4IWQA 4M8MA 3ZTCA 3ZRCA 5KHQA 1YX6B 3UF8A 2XK5A 3R7QA 3NS8A 4NJ6A 2IO2B 5J17A 2RGFA 3U7DA 3H6NA 2ZCCA 2G4SA 3ENEA 3QAQA 3R7RA 2C7HA 4B6WA 5CHWA 2KX3A 2K6DB 2XEWA 2NBUA 1M94A 2LD9A 1UELA 2Z59B 2AL6A 4MGIE 2KMAA 4DHJD 1LFDA 3OJ3A 3V61A 4OVUA 3VVWB 2L7RA 3ZRFA 5AEKB 3UIOB 1XQQA 5E6PA 3L13A 4I6LB 3S2AA 3CF6E 1WRDB 2N4FA 5J18A 3RD2A 4EZLA 3PLVA 3A4RA 1SE9A 1TTNA 4DDGD 3ZUNA 2KTFA 3DCGA 2LGYA 3GZNI 2JZ3B 2DZIA 4HJKA 5BO4B 4MH0E 4IWPA 3QX1A 5FR6A 4HDQA 2KDIA 2DZMA 3TMPB 4MGYE 2AYOB 3PREA 2V4LA 4G50A 3CSTA 3H7PB 1WJ6A 3A1QA 1UBIA 4DDID 2IO0B 3AU4A 4MGKE 2IZVB 4BKTA 1GC6A 2LVPA 4KDLB 3ECIA 2N1VA 2EMTA 2QHOA 5LXIB 4ZRIA 3L10B 3N32A 2MSED 3T8MA 5HKHA 3PRMB 2K25A 2PE6B 3TJPA 1OQYA 2L3ZA 2BYFA 2GBKA 2JRIB 3UIPB 2ZCBA 2ZJDA 2CS4A 2I1JA 1IYFA 1P1AA 2WX0A 4WQOB 1OEYJ 1V80A 2DX5B 2HJ8A 5IA7A 3QJZA 3IBEA 1C1YB 2RR9A 3Q3FA 2D2QA 3VUXA 3V6EB 1IPGA 2BPSA 2BYEA 1YJ1A 1LM8B 3PGEA 2KC2A 1WGRA 1WXAA 1WZ3A 4LJOB 3PZDA 2KN5A 4IUMB 3B1LX 2D11A 3DDCB 4GDKA 4LDTB 2DYOA 2LVOA 2O6VD 4OVVA 3VHTC 4DXAB 4F1SA 3JSVB 4N9F4 3MJWA 2DENB 3VH4B 4AJWA 5D7GA 4AWJA 1V5TA 4GOCA 1L2NA 2GBRA 3WAOA 2N7DA 3JSVA 2DAJA 4ZRKA 2LRWA 1NI2A 3L0WB 4IC7B 4K81A 4KIKA 3TCAA 3A9JA 4BKGA 3BY4B 4ANWA 2J7QB 2MWSB 1V49A 2MW5A 1QZEA 4NQKE 4NAWA 2MLBA 4MJSB 1VD2A 1WXSA 2LVQA 2IO3B 3CSFA 2NBVB 2IYDB 3DBHI 1WM2A 3HK0A 3DVGX 3IHPC 3M62B 4NNJB 3ONSA 3BINA 4LCDE 2Z0EB 2ZVOA 3KUZA 2WDTB 2NPTA 4WJQA 4NY0A 4EKUA 2KWUB 5L95C 3NY5A 2KDEB 4FJZA 1E90A 1AARA 3M95A 3SHQA 2AWTA 4PS8A 3KYDD 3IG3A 4TQ1A 2GOWA 3X0WA 2YVCA 3APDA 1J0GA 3WANA 3QCAA 3RZFA 2BGFA 2MBHA 5GMVA 1I35A 1WMHB 3P2BA 2G4DB 2C7MB 3W1SA 2KHWB 2KJRA 3QC8B 4PYZA 2NS5A 2R2OA 4FN2A 1WMHA 2LGXA 1L7YA 1UD7A 3DVGY 1V2YA 5TR5A 2FNJB 3EHVA 2O6VB 3WA0A 2WYQA 2FCSA 4EOYA 3PV1A 4TUUA 5CHFA 2NBWB 3PSEB 2O2VB 2CR5A 4MGZE 4F7ZA 2C9WB 3KUCB 1RLFA 4II2B 4PS3A 5DPSA 3IVFA 2J0MA 2KDBA 2O2VA 3PLUA 2HE7A 4ZRJA 3RULA 4HDOA 5DPTA 2ZNVC 1WIAA 2GBJA 5JHAA 4HCPB 4X57B 3KW5B 1X1MA 4DBGA 4ASWC 2KFKB 3NZSA 4HWIB 4KV2A 1WH3A 4E74A 2L00B 4W9GA 1EO6A 2JRHA 4GDLB 3VH3B 2Y5BB 3HIZA 4HPMB 2KFKA 5E6NA 3APFA 1UZXB 4P7IA 3RT3B 1YD8U 3L16A 1WFYA 2MBEA 3DBLI 3ZNZB 2J0KA 4ZDVA 1SGHA 3QIJA 2MA9B 1Z5SB 3ZNID 4RM9A 5LLIA 3GOEA 1Z2MA 1V5OA 3C0RB 2FCMA 5CTRC 4ANVA 3TL5A 2LASA 3VQIA 4EZJA 1WGYA 2REXA 2PJHA 2KLCA 2DYMA 4FLHA 1LQBA 4LDTD 1Q0WB 3DBRI 4B9KA 4FJYA 2LZ6A 2LWPA 5DCNA 2CU1A 3TBLD 2DHZA 4CYEA 2MCNB 2CHWA 5L83A 4K7WA 4EFOA 1WR1A 3VUWA 3A9KB 1VCBA 1WXVA 1WY8A 1E5WA 1KM7A 2M8SA 3H7PA 4MEMA 4W9EA 2D10A 2RPQA 3APCA 5DPWA 4JLCA 3RCZA 4DHZE 1WX8A 3B0AA 1LXDA 4G0NB 4BKSD 3AXCA 2YLMA 2JT4B 3PHWB 2C5LC 3T9LA 4ZYNA 3U30A 2RSUA 2KANA 2LGDA
chains in the Genus database with same CATH superfamily
3PS6A 5DPRA 3N3KB 3L08A 4ITKA 1R4MI 2K8BA 3AE9B 1NYRA 5FKAC 2JWUA 1KOTA 2GBMA 2JQRB 4YSXB 5JHBA 2WXOA 2GMIC 1XLQA 3L17A 1WGDA 2LGSA 3URYA 3HVZA 1C3TA 2WX1A 3NZUA 2GRIA 4YTNB 2W54A 1ET9A 4KDIC 4NJ7A 1GJZA 2KZRA 4BAXA 3H7SA 4BOSC 2V3SA 1VR9A 4A6QA 4OHJA 2VH1A 3U7ZA 3KYCD 2V3NA 3IAM1 2FUHB 4DWFA 5JZEB 3QA8A 1YJJA 3AM9A 3M63B 2WU5B 2L0TA 3X23A 1YJIA 3AMZA 1N6ZA 1NDDA 1P9DU 1FXIA 1TIFA 2M56B 2K6QA 3N1XC 1H8CA 2X8XX 2FIFA 4ZRPA 1YQ3B 3KVFB 3OAWA 1E8YA 3RNFC 4HLEA 1XD3B 1RRBA 1TT5B 1L6VA 1XLOA 3OLMD 3R3MA 1EF5A 4ICVA 4BBNC 1WXMA 4IOIE 2GB1A 2KNBA 3QWZB 5C3JB 1JALA 3VTVA 1D4BA 2BB6A 1E0ZA 4MM3A 1OQQA 3TEXA 1A70A 4XDCA 3KH0A 2AQ2B 2LFIA 4B95A 3JVZX 1SE3A 1V6EA 3RZWC 1F9JA 1ZGUB 2WLBA 3Q14C 2CJNA 4C7YA 3ML8A 3QARA 4YWGG 2LJ5A 2KWDA 1OGWA 2ASQA 4MSQB 4AQ7A 1AWDA 3PPAA 3PTFC 2BYTA 2RMMA 4DHZB 3IFWB 1KJTA 4JPSA 4M0WB 3ZKJC 5AZHA 3WAMA 1IBXB 3MHSD 2ZVNA 2LUEA 1CZPA 5C1ZA 4HROA 4ZOHC 3UQBA 4REZA 2I1KA 1JWSD 2K8HA 3ZDMC 5JH5C 1V1PA 2LRUA 1P0RA 4KGSA 2DZKA 1C4AA 2PE9A 1N63A 3ZDTA 4MT5A 1I42A 2MH7A 4W9JA 2N9XA 2W3RA 3I3TB 2MP2A 2JVCA 4BOZB 5C2TB 1WJ4A 1WE6A 3Q8AA 2EKIA 3HM3A 2M0XA 4IM3A 1WX9A 2GBNA 3VUYA 2PEAA 1T0RC 4BZAA 1QF6A 1I4GA 2AX5A 1E10A 3JYUA 4XGAB 2JXXA 1TGZB 2QMTA 4TKNA 2L05A 3T3OA 1P7EA 3ZNHB 1E8XA 4LNFA 4BKSA 1FXTB 1QOFA 4XX5A 4NAWB 2BS3B 2WXMA 4E3CA 1YN3A 2EKEC 4KSLC 2DYBA 1MG8A 2Z0DB 1E6EB 4FA6A 4HRSA 5IAAC 4LNOA 2WGSA 4DK5A 3AE2B 1NBFC 2OOBB 1UNSA 1E7VA 1RFKA 4WWNA 2DAFA 1XT9B 1GG3A 1FFVA 4GLSC 4WJNA 2WU2B 5KHOA 5T8IA 3P63A 1ET6A 2WHIA 4GIVA 4DQOC 2KOXA 3NG0A 3PRPB 4HK2A 2KFJA 2FCQA 3RN9C 4F8CB 2MHJA 4BBNF 1FO4A 1WF9A 1BT0A 1HA5A 2WXQA 4EE2A 2PKOA 3DHHC 4IWQA 1YX6B 3UF8A 3W9CB 3U7DA 3H6NA 2ZCCA 2G4SA 3ENEA 3QAQA 4B6WA 1J7CA 4RF1A 2KX3A 2AL6A 4KKJA 5AEKB 3UIOB 1XQQA 3AEFB 3L13A 3S2AA 1WRDB 2WXIA 3B2FA 3RD2A 4EZLA 3A4RA 4DDGD 1J7AA 3ZUNA 3GZNI 1QOBA 1J7BA 3AEBB 1F52A 2M0AA 1SEBD 4D2KA 4C7ZA 4MGYE 2V4LA 3CSTA 3H7PB 3A1QA 1UBIA 2WP9B 2IO0B 1GC6A 1ZDVA 2QHOA 5LXIB 1C4PA 4JWUC 1ZOYB 2WXHA 3N32A 3T8MA 2L3ZA 2GBKA 2ZJDA 2CS4A 4HKZE 1P1AA 1QOAA 2DX5B 3OWEB 3NJTA 4XYCA 1FIQA 4WH4A 3Q3FA 3V6EB 1IPGA 3GP7A 4A8XC 1WZ3A 2KN5A 3B1LX 4GDKA 1EWCA 4DXAB 4OVVA 3VHTC 1V5TA 4GOCA 1L2NA 2LRWA 1NI2A 4K81A 2KVZA 3AE8B 4YTPB 2MLBA 3EFCA 4MJSB 1VD2A 1GB4A 3MP9A 4NQLB 2IYDB 2L83A 1L0XB 4LCDE 4WJQA 2WDTB 3E9SA 2KDEB 1EWYC 1SJHD 3IG3A 3ZQ4A 3X0WA 2YVCA 3IT4B 2BGFA 1D5MC 5GMVA 2C7MB 2KHWB 2DLBA 2VZKD 2K5PA 1WMHA 1UD7A 3DVGY 5TR5A 3EHVA 2G1EA 1VLBA 2PMVA 2NBWB 4MGZE 4II2B 3PLUA 2O2VA 1ZUD2 3AEAB 3VR8B 2ZNVC 1GOZA 3KW5B 3NZSA 2VH2A 2JRHA 3HIZA 3AECB 4P7IA 3L16A 1WFYA 2MBEA 2GLSA 1TY2A 4ZDVA 3QIJA 4WAFA 1Z5SB 4P1CC 3GOEA 1V5OA 4KGRA 4YXDB 4RNAA 3TL5A 2REXA 1SXTA 4FLHA 2W82A 2KDMA 4B9KA 3Q3NC 2HTME 3FILA 2CHWA 3DBLB 1MVKA 3A9KB 1WY8A 5D3DA 1NVID 1LGRA 4JLCA 5IO9A 1WX8A 3B0AA 2YLMA 2C5LC 2D3BA 3W1SC 2LGDA 2LI5A 4N59A 1S3SG 3GS2A 4K7SA 4I6NB 1V81A 5LXHA 4JL9A 1U4AA 1WM3A 2WXJA 1XXGA 5E6OA 2INNE 2BKFA 4K7UA 3A33B 3ZYYX 1TJEA 3N1ZC 4W9HA 3NHEB 3VFKA 1R4MB 1YN4A 5D6JB 1G6JA 2E6XA 2KC1A 3EUB2 2C60A 4C80A 4W9FA 3U52E 3AE3B 1ZDXA 2KWCA 1D3ZA 2MJ3A 1MFWA 3VRAB 2ON8A 1WJNA 4P16A 4RGMA 1PFDA 2KD0A 1DYQA 4TSSA 2R61A 3IXSA 1FPYA 2NCNA 2O6VA 3HVDA 5EE9A 3N20C 1ACCA 4XDDA 3ALBA 1FMAD 4KX6B 3I63C 3ZJUA 2W9NA 2ZPNA 2Y5CA 2K1FA 3LDZE 2L8JA 2IBIB 5D2MB 1KRHA 4A20A 3EC8A 3CMMB 1D5ZC 3BVZA 2MX2A 3NVVA 3WALA 1TY0A 2BBCA 4ICUA 4XZ4A 5EE1A 1JWBD 2G45B 2BKRB 2TSSA 3N30A 3RFZB 1Y8RC 3LJ3A 1NEKB 1MI0A 2B3AA 3L4PA 3P4RB 1E9MA 1GPXA 1YX5B 1WR6E 4LNNA 4ANXA 2JUOA 1K52A 2QJLA 3WIMA 1NI3A 4YTMB 4GSWA 1C4CA 4L1BA 3V60A 1QT9A 2DZJA 2JF5A 4NZLB 4K1RB 1H4RA 1EF1A 1OFFA 1VRAB 4A9AA 3DVNU 4WJPA 2V1YA 1WGGA 1ZW7A 2R2QA 2AEHA 2BWES 2H89B 1YQ4B 4TV3A 4TQ0A 2DWQA 1UH6A 1L4ZB 2KJ6A 1ENFA 1L5PA 1I4QA 4FJVB 3K9PB 3OG5A 2WWZA 3ZGZA 1ISNA 1WI0A 3SD5A 2BWFA 2UWQA 4DXFA 3H1UA 4LJPB 4RM8A 5AZFA 1KFYB 1AN8A 2LHEA 2JY6A 2ZNVB 4PT5A 1XCQL 4EEWA 2LHDA 4DHJB 1V1OA 3ML9A 2INDC 3MHZA 2CU3A 2IY1B 1KLUD 4HPPA 1UGMA 4HPLB 4NPNA 4AP4C 4AS1A 3DQVA 1YQBA 4PS7A 5G2NA 4KGTA 1S1QB 2HD5B 3H9DA 1E7UA 2FIDA 1HZ5A 5E6JA 3MTNB 2N9EB 3U8ZA 4HCNB 2MQJA 4YT0B 2ZPYA 2RD0A 3DHIC 2INCC 4R3DA 4EZKA 2FUG1 4GGQA 3RYTA 4S0RA 1XLPA 2I38A 3UQAA 4IKGA 2KTRA 1GC7A 2JPHA 3HHMA 4AJYB 4WWOA 2KLGA 5EE3A 2LXCA 2L0FA 2PW9A 4G3XB 2J53A 2JXTA 3QHTA 1HQRD 1K53A 3RNCC 3ZO5B 3GE3C 2IO1B 4OVZA 3K9OB 2CHXA 4I6PA 5KHQA 2LMCA 2XK5A 3E56A 3NS8A 4NJ6A 5CHWA 2KMAA 3OJ3A 1DGJA 3V61A 1B1ZA 2L7RA 3ZRFA 4I6LB 2N4FA 1HEZE 3DCGA 1WRIA 1F0ZA 1F2RI 5AUKA 2DZIA 5BO4B 4NJCA 3RNGC 4HDQA 2DZMA 2CJOA 5HI1A 4G50A 3GE8C 4P1BC 2IZVB 2N1VA 3MFGA 1SBBB 3AE5B 4ZRIA 3Q6BA 3KWLA 1DOXA 3AH7A 2PE6B 3GZNB 3TJPA 3KLSX 3UI3A 5HFYA 2JRIB 3Q3MC 1PGAA 2RDGA 4WQOB 1AW7A 1C1YB 2RR9A 3J9CA 2BYEA 3PGEA 1LM8B 4ARCA 1TS2A 3PZDA 3DDCB 2DYOA 1FM0D 4N6EB 3JSVB 4N9F4 2DENB 3VH4B 3W5UB 4AJWA 1R7SA 3Q8CA 4LK0M 4KIKA 3TCAA 3A9JA 4ANWA 2J7QB 2MWSB 4LNKA 1QZEA 4ZYSA 1WM2A 3HK0A 3IHPC 3M62B 3BINA 4OZCA 2Z0EB 2ZVOA 1N60A 2NPTA 3NY5A 2ZW1A 3BK1A 1I4PA 1CQVA 1AARA 3M95A 4PS8A 3KYDD 1PDXA 1C78A 1NYQA 3QCAA 3WANA 3RZFA 3W5VB 3RMKC 3P2BA 2G4DB 2KJRA 4PYZA 2NS5A 2R2OA 1C77A 1EU4A 2KMMA 5TSSA 1V2YA 2FNJB 2QIEB 2WYQA 2FCSA 4WURA 3PV1A 4TUUA 3AE4B 4F7ZA 1RLFA 3RULA 2KDBA 4C4VB 5DPTA 3RPFC 2GBJA 1X1MA 4ASWC 2KFKB 3R2IA 5BYQA 4HWIB 4W9GA 4MM3B 3VH3B 3RT3B 4J3OD 2OJWA 4RM9A 4FXCA 1T0QC 2FCMA 2LUMA 5G5HA 2DYMA 1FNVA 4A55A 2NTSA 1F1HA 1YMHE 2BVCA 3DBRI 2JX5A 2LWPA 4Q2JA 5HG2A 4K7WA 1UWMA 3VUWA 3RNEC 1VCBA 1PUTA 3AB5A 5IKCM 2V0GA 4W9EA 4ARIA 1FFUA 3BYTB 2I2YA 3AE7B 3RCZA 1ZXHA 2W3SA 1LXDA 4ZRQA 4BKSD 1V1PB 3PHWB 3V3XA 2RSUA 2FBWB 1VDVA 2N1WA 3A4SC 5J17A 1GUAB 4AUQC 1L6UA 3I9V1 2C7NB 1RAXA 2E3TA 2X38A 4M01A 1I4XA 3I57A 1I7HA 4C00A 2ZEQA 4BFRA 1C76A 1JMLA 2KK8A 3ZLZA 3DHGC 3Q8BA 2KYWA 2A4ZA 3EFUA 5EE0A 4TMAB 1WYWB 2WDVB 2N7EA 4GU2A 4KSKC 4WWPA 1RYJA 1XO3A 3Q69A 4LLGM 4IM0A 3RI7C 2Z8LA 2JYTA 1RFAA 3ZXRA 1Y56A 3FAHA 2K0PA 1B9RA 4C56C 2J0JA 2WQYB 4GMVA 1WE7A 1ZE3D 3DOWA 3AULA 4JGHB 3UGBB 3PT2B 2XBBC 1F2RC 2N7JA 2IGHA 4MELA 2FCNA 2KVRA 1V97A 3I5JC 4A90A 4GDLA 3MC0B 2WXNA 1UBQA 1TS5A 2ZZPB 1T6BX 1JQ4A 1TZ1A 3QQ8B 1ZPSA 1Q5WB 4YL8A 3VR9B 2KDFB 3HM6X 3R66C 3UINB 2EMSA 3AU5A 3VDZA 1JRPA 2MBOA 4W9KA 1K50A 5CHVC 3BZDB 5FK9C 1K8RB 1Q1OA 2BS2B 2JYEA 1J8CA 4KZ0A 2L1AA 3ZW3A 1R4NI 2G3QB 2N9PC 2FE8A 4FHKA 2WXGA 3A1QB 1OTRB 2JZPA 2WXLA 2A5UA 4BVUC 2NR2A 4S17A 3JW0X 5C23A 3HRDD 1A5RA 3W1YA 4O1NA 1KH0A 4M8NA 3TEWA 1PGBA 5H92C 4B0EA 2RDHA 2KQSA 4OZBA 3ZTDA 4A3OA 1YIWA 1ZKHA 4PK1A 1CJEA 1HE8A 3V6CB 1XLNA 1T3QA 2NVUI 3L54A 3Q3JA 3NZ3A 4GDKB 2QDFA 3BIID 1TBEA 3BWUD 2OJRA 4PYUA 4US8A 2HDEA 4WJOA 2BYVE 2JZZA 3AEDB 2INPE 2MBBB 3C19A 1EUVB 1ROEA 4ANUA 1SJED 4NAMA 1WZ0A 2OEDA 3O65B 2IY0B 3V62A 4W9IA 1J19A 3EECA 1EM7A 5G55A 3PO0A 3Q3OC 2UU7A 4WIPA 1WWTA 3DBSA 3B9JA 1N61A 2AL3A 2N9KA 1K51A 2XNAC 4FADA 1VZ6A 4OW0A 2LXAA 1OEYA 2N9LA 3B2GA 3KWVA 3SR6A 1P7FA 3VAWA 1KLGD 4HVBA 1JRUA 2K8CA 4USAA 2NTTA 3P4QB 4M8MA 3ZRCA 1DOIA 1VJKA 3R7QA 1L4DB 2IO2B 2ONQA 2PVOD 3BYYB 2XEWA 3NVWA 2LD9A 1UELA 2Z59B 3N9YC 4DHJD 2PLPA 4JE3B 3VVWB 5E6PA 1NENB 3CF6E 5BMHA 5J18A 1HXYD 3V05A 2IPKD 2KT7A 2MEKA 4M0WA 3FILB 4MH0E 1IBXA 1QKZA 1F77A 2KACA 3TMPB 1T0SC 2AYOB 3AEEB 2QSDA 3U2SC 1TKGA 3AU4A 4MGKE 4BKTA 5IN7A 2LVPA 4KDLB 2EMTA 3EA6A 5HKHA 3PRMB 2K25A 1MHHE 2ZW0A 3UIPB 4LTUA 2I1JA 3SFDB 3PZ8A 2WX0A 1V80A 2WNMA 3ETRA 3QJZA 2D2QA 2BPSA 2BW2A 1WGRA 2KC2A 4LJOB 3BVMA 1N5WA 4LDTB 2LVOA 2O6VD 3MJWA 1HTOA 5I4DA 5D7GA 4AWJA 4B0MA 1SE4A 2GBRA 2N7DA 2BQQA 3JSVA 4ZRKA 4IC7B 2D5GA 3NVYA 1GAQB 1CK1A 4NQKE 4NAWA 5D3IB 5BYRA 1WXSA 2LVQA 2IO3B 2NBVB 4XWTA 4H2AA 1N62A 3HUIA 1AYFA 3KUZA 4EKUA 5L95C 3U4EG 3CIRB 4NY0A 1I4RA 2PVGC 1C79A 1OQRA 4M00A 4FJZA 1FCLA 1EU3A 1TS3A 4N58A 4TQ1A 2GOWA 4L2YA 3AEGB 1I35A 1IUEA 2LGXA 4DXGA 4RGNA 4XE0A 2O6VB 3WA0A 4EOYA 3AN1A 4RFBA 1QLBB 1RWSA 3PSEB 3KUCB 3IVFA 2IDYA 2DBYA 2J0MA 4HDOA 1WIAA 4X57B 2PTLA 4C4VA 4E74A 3ZJVA 1PYWD 2WDRB 1L0VB 4HPMB 2KFKA 3R8BA 3APFA 5AUIA 1YD8U 1MG4A 1FRDA 1SF0A 3ZNZB 2J0KA 1SGHA 3ZNID 5LLIA 1SE2A 4L23A 2LASA 1TYGB 2JU6X 1Q0WB 3NVZA 1XF5L 2BT6A 1KTKA 4FJYA 1SSNA 2OHFA 2MCNB 1VZ8A 1FD6A 1TS4A 1E5WA 2M8SA 3H7PA 3MC9A 4MEMA 3CWIA 2RPQA 4IDIA 4DHZE 3AXCA 3DBRB 5H8YE 2JT4B 3EGRA 3T9LA 1KF6B 4ZYNA 1DOYA 1GB1A 4OZAA 1TKEA 1V9JA 4QAYA 1XEEA 3ZXVA 1WXQA 3AV8A 3NRZA 2KWVB 3MJ5A 5BMIA 4WQMA 2B76B 4HJGE 2HTHA 4GB9A 3AI5A 4EUTA 3WCQA 2KX0A 4US9A 1LO5D 4JQWC 2JSVX 2AQ3B 3TIXA 5IP4D 3C8YA 3SU8X 3TEYA 3DWMA 3DVNV 4MJSA 3BK2A 1MHXA 4IWOA 2V4IB 1E8ZA 1ZXIA 2M19A 2KXJA 4ZHOA 2V9HA 4XC2A 5LNK1 1L0YB 1T5XD 1Q10A 2MRPA 1P3QU 4MDKE 3ZNGC 2M4NA 5JXVA 3P42A 3O13A 1JWUD 3LB8C 2KJHB 2JWZA 1JWMD 2LJIA 1V86A 1M4VA 2UYZB 4RH6A 5AZGA 1TZOA 2KTRB 2LGIA 4W9CA 5BYSA 4URKA 1BUIC 4FULA 3ZJTA 2IGDA 3VXWA 2WXFA 1HZ6A 3W2DA 3SDLC 4W9DA 1WYGA 3Q8EA 2K9XA 3OJ4B 1ZP0B 3T3NA 1BXTA 1JROA 4J6IA 3FKYA 3ZIMA 2BS4B 4CHKA 2QCZA 4GXBA 2L76A 2XK5B 5BMGA 1MPEA 1UWXA 1TKYA 2D07B 2KKCA 1SIFA 3PHXB 1WGHA 1FEHA 3PZ7A 1V8CA 2WXRA 1QILA 1PQSA 1JCKB 4FHJA 4RMAA 3ZVVA 4WAAA 4W9LA 3WAPA 5EDSA 1KLVA 3A9KA 1STEA 4FBJB 2KMCA 3M3JA 2KQ4X 1WSPA 1RM6C 4MH8A 4IM2A 3KUDB 2D3CA 1VZ7A 5G5GA 5D94A 1HTQA 3P4SB 3PRZA 1YOVB 4E71A 4AOFA 4RGTA 3TEZA 1QOGA 3VRBB 4M02A 4G11A 2K3UA 1T0YA 3VTWA 2K39A 5J2RA 5CX3A 4GN1A 3AE1B 1E7PB 2MP2B 3B08A 3D32A 3SEBA 3NOBA 3QK0A 5MPOA 1R4NB 4KKIA 3TUOA 1JW9D 2BTEA 4IG7B 2SAKA 2J52A 3RUIB 1IP9A 4K3BA 3RNAC 1XCTL 2KQ7A 5HHDG 2CKHB 1WX7A 4HXDA 2NMQA 1GNUA 4IW0A 4KIKB 3A9JB 4RGOS 2PPHA 5IOIA 2V3PA 3VTUA 2KO3A 4P6VF 3GB1A 4II3B 1WJUA 1UUPA 3RNBC 2NPTB 2D3GA 4MSMB 2MJDA 2IJ0A 3N1YC 2Y3AA 2WS3B 3DPDA 2KAJA 4KZCA 1P98A 2L32A 2BF8B 1CMXB 4JIOU 2MBQA 4CO7A 2PIAA 4A3PA 5FR3A 3DBHB 4KVGB 2M17A 4JWSC 1E8WA 1N5XA 2CHZA 2YEPF 1IGDA 2RDBC 3P4PB 2WXKA 2FAZA 3PVLA 2VRRB 1C9FA 2M1MA 3ZTCA 4YSZB 2Q5WD 1D6EC 2RGFA 1YNTE 3R7RA 2C7HA 1FCCC 1ESFA 2K6DB 2NBUA 1M94A 4MGIE 1LFDA 4OVUA 1FNWA 1SB3C 2GI9A 3PLVA 1SE9A 1TTNA 2KTFA 2LGYA 1I4HA 1UGJA 2JZ3B 2VZKB 4HJKA 4IWPA 3QX1A 4K3CA 2H88B 5FR6A 2KDIA 3PREA 3ABVB 3LXFA 1WJ6A 4DDID 4YSYB 3FC4A 4UDUC 3ECIA 2YEPB 3L10B 2MSED 4CQNA 1OQYA 1YN5A 1UF0A 2BYFA 2ZCBA 4XWWA 2IGGA 4WWMA 1IYFA 1OEYJ 1D5XC 2HJ8A 4MACA 3P1MA 2XN9C 5IA7A 3IBEA 3VUXA 1YJ1A 3LYYA 1WXAA 3BVGA 3H8HA 1FXAA 4IUMB 2D11A 4F1SA 2MJEA 2N0SB 3WAOA 3IT6B 3MC8A 2DAJA 3L0WB 4BKGA 3BY4B 4HEA1 3AE6B 1V49A 2MW5A 3IAS1 3DBHI 3CSFA 4LNIA 2J4XA 3DVGX 4NNJB 3ONSA 1JWAD 2KWUB 2EELA 1E90A 2WDQB 3SHQA 2AWTA 4JX1C 2ACZB 3APDA 1J0GA 4HKQA 4ZHPA 2MBHA 1WMHB 3W1SA 3QC8B 4FN2A 4RCOA 2BB5A 1L7YA 5CHFA 2O2VB 3SFEB 2CR5A 2C9WB 3NS1A 4PS3A 5DPSA 2HE7A 4ZRJA 5JHAA 1BMLC 2ICIA 4HCPB 2Y5PA 4DBGA 2KN4A 4KV2A 1WH3A 2L00B 1EO6A 4GDLB 2Y5BB 5E6NA 2QEJC 1UZXB 3KQ4A 3DBLI 2W55A 1PGXA 1IGCA 4ACFA 2MA9B 2G9HD 2WXPA 1Z2MA 2DNFA 1WGKA 5CTRC 2RPVA 3C0RB 4ANVA 1FNUA 3VQIA 4EZJA 1WGYA 2PJHA 2KLCA 1FRRA 2LEKA 5GXGB 1LQBA 4LDTD 2LZ6A 2HJ1A 5DCNA 2SEBD 1QQRA 2CU1A 3TBLD 2DHZA 4CYEA 5L83A 4EFOA 1WR1A 2L52A 1WXVA 2QILA 3TSSA 2K22A 3R2TA 1KM7A 2D3AA 2J42A 2QC8A 3Q2AC 2D10A 1SIJA 3APCA 5DPWA 3Q8FA 3NUHB 2AQ1B 4G0NB 1MJDA 4RF0A 3DWGC 3U30A 2KANA
chains in the Genus database with same CATH topology
2N1WA 3A4SC 3PS6A 2LI5A 1GUAB 5DPRA 3N3KB 1S3SG 3L08A 4K7SA 4I6NB 4AUQC 1V9JA 3W1SC 1V81A 1R4MI 2K8BA 5LXHA 2C7NB 4JL9A 1RAXA 1U4AA 1WM3A 2KWVB 1KOTA 2GBMA 5E6OA 2HTHA 5JHBA 2GMIC 3L17A 4GB9A 2BKFA 3AI5A 1WGDA 4EUTA 4K7UA 2KX0A 1C3TA 2WX1A 3A33B 3NZUA 4KDIC 2ZEQA 4NJ7A 1GJZA 4BFRA 2KZRA 4JQWC 4W9HA 3NHEB 3VFKA 2KK8A 3ZLZA 3TIXA 5D6JB 1G6JA 3SU8X 3H7SA 4BOSC 3DVNV 2V3SA 4MJSA 4IWOA 2A4ZA 3KYCD 2KC1A 1E8ZA 2FUHB 3EFUA 2C60A 4DWFA 4W9FA 5JZEB 1WYWB 3QA8A 2KWCA 2N7EA 4GU2A 1D3ZA 2KXJA 3M63B 4XC2A 4KSKC 4WWPA 2L0TA 3X23A 4IM0A 2MRPA 1WJNA 1P3QU 4MDKE 3ZNGC 2M4NA 1NDDA 1P9DU 1RFAA 2K6QA 1H8CA 2KJHB 2KD0A 2JWZA 2FIFA 2J0JA 2NCNA 3KVFB 3OAWA 1WE7A 1E8YA 3DOWA 4GMVA 2O6VA 3AULA 4JGHB 4HLEA 1V86A 1XD3B 2UYZB 1RRBA 3UGBB 5AZGA 3PT2B 2XBBC 2KTRB 4W9CA 3ALBA 3OLMD 3R3MA 4URKA 1EF5A 4MELA 4ICVA 4BBNC 1WXMA 4FULA 2FCNA 2W9NA 2KNBA 3QWZB 3VXWA 2ZPNA 3LDZE 2K1FA 3VTVA 2KVRA 2IBIB 2L8JA 3SDLC 5D2MB 4A20A 3EC8A 4W9DA 3CMMB 2MX2A 3WALA 4GDLA 3OJ4B 4MM3A 4ICUA 4XZ4A 2G45B 2BKRB 3KH0A 3N30A 1UBQA 4J6IA 2ZZPB 4B95A 3JVZX 3ZIMA 1V6EA 3RZWC 1F9JA 4CHKA 1Y8RC 4GXBA 1ZGUB 3LJ3A 2L76A 2XK5B 1TZ1A 3QQ8B 2D07B 2KKCA 3ML8A 2B3AA 1SIFA 3QARA 1Q5WB 1YX5B 1WR6E 3PHXB 2LJ5A 4YL8A 1WGHA 4ANXA 1OGWA 2JUOA 2KDFB 3HM6X 2ASQA 3R66C 4MSQB 3UINB 3WIMA 3PPAA 3PTFC 4GSWA 1PQSA 3V60A 2EMSA 3AU5A 4FHJA 4RMAA 3VDZA 3ZVVA 1A5RA 4WAAA 4W9LA 4DHZB 3WAPA 2MBOA 4W9KA 3IFWB 5EDSA 1KLVA 1KJTA 3A9KA 2DZJA 2JF5A 2KMCA 5CHVC 4FBJB 4K1RB 3M3JA 1H4RA 1EF1A 4M0WB 3ZKJC 3DVNU 4WJPA 1K8RB 1Q1OA 2V1YA 3MHSD 5AZHA 4IM2A 3WAMA 2ZVNA 3KUDB 2LUEA 4KZ0A 1J8CA 5C1ZA 1WGGA 3ZW3A 1ZW7A 1R4NI 3UQBA 5D94A 2R2QA 2AEHA 3PRZA 2G3QB 2BWES 2I1KA 4AOFA 4E71A 4TV3A 4TQ0A 2N9PC 1UH6A 2K8HA 4FHKA 2KJ6A 3A1QB 3ZDMC 4G11A 5JH5C 1OTRB 2LRUA 4FJVB 1P0RA 3K9PB 1T0YA 3VTWA 2WWZA 2DZKA 1ISNA 2A5UA 1WI0A 4BVUC 2K39A 2PE9A 2BWFA 2NR2A 3SD5A 2UWQA 5J2RA 3ZDTA 3JW0X 5C23A 5CX3A 4GN1A 1I42A 3H1UA 2MP2B 4LJPB 4RM8A 5AZFA 3B08A 2N9XA 3D32A 3I3TB 4W9JA 3W1YA 3NOBA 3QK0A 4M8NA 2MP2A 2JY6A 2ZNVB 2JVCA 4BOZB 1WJ4A 2KQSA 1WE6A 3ZTDA 3HM3A 4EEWA 2M0XA 4A3OA 4DHJB 1YIWA 1ZKHA 3ML9A 1HE8A 1WX9A 4IG7B 4IM3A 2GBNA 3V6CB 2NVUI 3VUYA 2PEAA 2IY1B 3RUIB 3L54A 1IP9A 3Q3JA 2KQ7A 4GDKB 1UGMA 4HPLB 3JYUA 4NPNA 4AP4C 2CKHB 1WX7A 3DQVA 4HXDA 1YQBA 4PS7A 2JXXA 5G2NA 1TBEA 1TGZB 1GNUA 1S1QB 4IW0A 3A9JB 4KIKB 4TKNA 2PPHA 2L05A 2OJRA 4PYUA 3ZNHB 1E8XA 2KO3A 3VTUA 4BKSA 4WJOA 2BYVE 1FXTB 2HD5B 4XX5A 2JZZA 4NAWB 3H9DA 4II3B 2MBBB 1WJUA 4E3CA 1E7UA 2FIDA 1EUVB 3MTNB 4ANUA 2N9EB 2EKEC 1WZ0A 4KSLC 3O65B 2IY0B 4HCNB 2DYBA 3U8ZA 3V62A 2NPTB 4W9IA 2MQJA 1J19A 2ZPYA 3EECA 2D3GA 2RD0A 4MSMB 1MG8A 4NQLB 2Z0DB 5G55A 4FA6A 5IAAC 4EZKA 4DK5A 3DPDA 3DBSA 2AL3A 1NBFC 2OOBB 1E7VA 4GGQA 4KZCA 4FADA 1P98A 3RYTA 4WWNA 2LXAA 2DAFA 2BF8B 1CMXB 4JIOU 3UQAA 1XT9B 2KTRA 1GG3A 1OEYA 2MBQA 1GC7A 4CO7A 4A3PA 2JPHA 3HHMA 4WJNA 4KVGB 4AJYB 5KHOA 4WWOA 2M17A 2KLGA 4GIVA 2LXCA 1E8WA 2L0FA 2CHZA 2KOXA 4G3XB 3PRPB 4HK2A 2KFJA 3VAWA 3QHTA 2FCQA 4F8CB 2FAZA 3ZO5B 4HVBA 1JRUA 4BBNF 2K8CA 2IO1B 3PVLA 1WF9A 2VRRB 1BT0A 3K9OB 2CHXA 2M1MA 4I6PA 4IWQA 4M8MA 3ZTCA 3ZRCA 5KHQA 1YX6B 3UF8A 2XK5A 3R7QA 3NS8A 4NJ6A 2IO2B 5J17A 2RGFA 3U7DA 3H6NA 2ZCCA 2G4SA 3ENEA 3QAQA 3R7RA 2C7HA 4B6WA 5CHWA 2KX3A 2K6DB 2XEWA 2NBUA 1M94A 2LD9A 1UELA 2Z59B 2AL6A 4MGIE 2KMAA 4DHJD 1LFDA 3OJ3A 3V61A 4OVUA 3VVWB 2L7RA 3ZRFA 5AEKB 3UIOB 1XQQA 5E6PA 3L13A 4I6LB 3S2AA 3CF6E 1WRDB 2N4FA 5J18A 3RD2A 4EZLA 3PLVA 3A4RA 1SE9A 1TTNA 4DDGD 3ZUNA 2KTFA 3DCGA 2LGYA 3GZNI 2JZ3B 2DZIA 4HJKA 5BO4B 4MH0E 4IWPA 3QX1A 5FR6A 4HDQA 2KDIA 2DZMA 3TMPB 4MGYE 2AYOB 3PREA 2V4LA 4G50A 3CSTA 3H7PB 1WJ6A 3A1QA 1UBIA 4DDID 2IO0B 3AU4A 4MGKE 2IZVB 4BKTA 1GC6A 2LVPA 4KDLB 3ECIA 2N1VA 2EMTA 2QHOA 5LXIB 4ZRIA 3L10B 3N32A 2MSED 3T8MA 5HKHA 3PRMB 2K25A 2PE6B 3TJPA 1OQYA 2L3ZA 2BYFA 2GBKA 2JRIB 3UIPB 2ZCBA 2ZJDA 2CS4A 2I1JA 1IYFA 1P1AA 2WX0A 4WQOB 1OEYJ 1V80A 2DX5B 2HJ8A 5IA7A 3QJZA 3IBEA 1C1YB 2RR9A 3Q3FA 2D2QA 3VUXA 3V6EB 1IPGA 2BPSA 2BYEA 1YJ1A 1LM8B 3PGEA 2KC2A 1WGRA 1WXAA 1WZ3A 4LJOB 3PZDA 2KN5A 4IUMB 3B1LX 2D11A 3DDCB 4GDKA 4LDTB 2DYOA 2LVOA 2O6VD 4OVVA 3VHTC 4DXAB 4F1SA 3JSVB 4N9F4 3MJWA 2DENB 3VH4B 4AJWA 5D7GA 4AWJA 1V5TA 4GOCA 1L2NA 2GBRA 3WAOA 2N7DA 3JSVA 2DAJA 4ZRKA 2LRWA 1NI2A 3L0WB 4IC7B 4K81A 4KIKA 3TCAA 3A9JA 4BKGA 3BY4B 4ANWA 2J7QB 2MWSB 1V49A 2MW5A 1QZEA 4NQKE 4NAWA 2MLBA 4MJSB 1VD2A 1WXSA 2LVQA 2IO3B 3CSFA 2NBVB 2IYDB 3DBHI 1WM2A 3HK0A 3DVGX 3IHPC 3M62B 4NNJB 3ONSA 3BINA 4LCDE 2Z0EB 2ZVOA 3KUZA 2WDTB 2NPTA 4WJQA 4NY0A 4EKUA 2KWUB 5L95C 3NY5A 2KDEB 4FJZA 1E90A 1AARA 3M95A 3SHQA 2AWTA 4PS8A 3KYDD 3IG3A 4TQ1A 2GOWA 3X0WA 2YVCA 3APDA 1J0GA 3WANA 3QCAA 3RZFA 2BGFA 2MBHA 5GMVA 1I35A 1WMHB 3P2BA 2G4DB 2C7MB 3W1SA 2KHWB 2KJRA 3QC8B 4PYZA 2NS5A 2R2OA 4FN2A 1WMHA 2LGXA 1L7YA 1UD7A 3DVGY 1V2YA 5TR5A 2FNJB 3EHVA 2O6VB 3WA0A 2WYQA 2FCSA 4EOYA 3PV1A 4TUUA 5CHFA 2NBWB 3PSEB 2O2VB 2CR5A 4MGZE 4F7ZA 2C9WB 3KUCB 1RLFA 4II2B 4PS3A 5DPSA 3IVFA 2J0MA 2KDBA 2O2VA 3PLUA 2HE7A 4ZRJA 3RULA 4HDOA 5DPTA 2ZNVC 1WIAA 2GBJA 5JHAA 4HCPB 4X57B 3KW5B 1X1MA 4DBGA 4ASWC 2KFKB 3NZSA 4HWIB 4KV2A 1WH3A 4E74A 2L00B 4W9GA 1EO6A 2JRHA 4GDLB 3VH3B 2Y5BB 3HIZA 4HPMB 2KFKA 5E6NA 3APFA 1UZXB 4P7IA 3RT3B 1YD8U 3L16A 1WFYA 2MBEA 3DBLI 3ZNZB 2J0KA 4ZDVA 1SGHA 3QIJA 2MA9B 1Z5SB 3ZNID 4RM9A 5LLIA 3GOEA 1Z2MA 1V5OA 3C0RB 2FCMA 5CTRC 4ANVA 3TL5A 2LASA 3VQIA 4EZJA 1WGYA 2REXA 2PJHA 2KLCA 2DYMA 4FLHA 1LQBA 4LDTD 1Q0WB 3DBRI 4B9KA 4FJYA 2LZ6A 2LWPA 5DCNA 2CU1A 3TBLD 2DHZA 4CYEA 2MCNB 2CHWA 5L83A 4K7WA 4EFOA 1WR1A 3VUWA 3A9KB 1VCBA 1WXVA 1WY8A 1E5WA 1KM7A 2M8SA 3H7PA 4MEMA 4W9EA 2D10A 2RPQA 3APCA 5DPWA 4JLCA 3RCZA 4DHZE 1WX8A 3B0AA 1LXDA 4G0NB 4BKSD 3AXCA 2YLMA 2JT4B 3PHWB 2C5LC 3T9LA 4ZYNA 3U30A 2RSUA 2KANA 2LGDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2N1W A;  3A4S C;  3PS6 A;  2LI5 A;  1GUA B;  5DPR A;  3N3K B;  1S3S G;  3L08 A;  4K7S A;  4I6N B;  4AUQ C;  1V9J A;  3W1S C;  1V81 A;  1R4M I;  2K8B A;  5LXH A;  2C7N B;  4JL9 A;  1RAX A;  1U4A A;  1WM3 A;  2KWV B;  1KOT A;  2GBM A;  5E6O A;  2HTH A;  5JHB A;  2GMI C;  3L17 A;  4GB9 A;  2BKF A;  3AI5 A;  1WGD A;  4EUT A;  4K7U A;  2KX0 A;  1C3T A;  2WX1 A;  3A33 B;  3NZU A;  4KDI C;  2ZEQ A;  4NJ7 A;  1GJZ A;  4BFR A;  2KZR A;  4JQW C;  4W9H A;  3NHE B;  3VFK A;  2KK8 A;  3ZLZ A;  3TIX A;  5D6J B;  1G6J A;  3SU8 X;  3H7S A;  4BOS C;  3DVN V;  2V3S A;  4MJS A;  4IWO A;  2A4Z A;  3KYC D;  2KC1 A;  1E8Z A;  2FUH B;  3EFU A;  2C60 A;  4DWF A;  4W9F A;  5JZE B;  1WYW B;  3QA8 A;  2KWC A;  2N7E A;  4GU2 A;  1D3Z A;  2KXJ A;  3M63 B;  4XC2 A;  4KSK C;  4WWP A;  2L0T A;  3X23 A;  4IM0 A;  2MRP A;  1WJN A;  1P3Q U;  4MDK E;  3ZNG C;  2M4N A;  1NDD A;  1P9D U;  1RFA A;  2K6Q A;  1H8C A;  2KJH B;  2KD0 A;  2JWZ A;  2FIF A;  2J0J A;  2NCN A;  3KVF B;  3OAW A;  1WE7 A;  1E8Y A;  3DOW A;  4GMV A;  2O6V A;  3AUL A;  4JGH B;  4HLE A;  1V86 A;  1XD3 B;  2UYZ B;  1RRB A;  3UGB B;  5AZG A;  3PT2 B;  2XBB C;  2KTR B;  4W9C A;  3ALB A;  3OLM D;  3R3M A;  4URK A;  1EF5 A;  4MEL A;  4ICV A;  4BBN C;  1WXM A;  4FUL A;  2FCN A;  2W9N A;  2KNB A;  3QWZ B;  3VXW A;  2ZPN A;  3LDZ E;  2K1F A;  3VTV A;  2KVR A;  2IBI B;  2L8J A;  3SDL C;  5D2M B;  4A20 A;  3EC8 A;  4W9D A;  3CMM B;  2MX2 A;  3WAL A;  4GDL A;  3OJ4 B;  4MM3 A;  4ICU A;  4XZ4 A;  2G45 B;  2BKR B;  3KH0 A;  3N30 A;  1UBQ A;  4J6I A;  2ZZP B;  4B95 A;  3JVZ X;  3ZIM A;  1V6E A;  3RZW C;  1F9J A;  4CHK A;  1Y8R C;  4GXB A;  1ZGU B;  3LJ3 A;  2L76 A;  2XK5 B;  1TZ1 A;  3QQ8 B;  2D07 B;  2KKC A;  3ML8 A;  2B3A A;  1SIF A;  3QAR A;  1Q5W B;  1YX5 B;  1WR6 E;  3PHX B;  2LJ5 A;  4YL8 A;  1WGH A;  4ANX A;  1OGW A;  2JUO A;  2KDF B;  3HM6 X;  2ASQ A;  3R66 C;  4MSQ B;  3UIN B;  3WIM A;  3PPA A;  3PTF C;  4GSW A;  1PQS A;  3V60 A;  2EMS A;  3AU5 A;  4FHJ A;  4RMA A;  3VDZ A;  3ZVV A;  1A5R A;  4WAA A;  4W9L A;  4DHZ B;  3WAP A;  2MBO A;  4W9K A;  3IFW B;  5EDS A;  1KLV A;  1KJT A;  3A9K A;  2DZJ A;  2JF5 A;  2KMC A;  5CHV C;  4FBJ B;  4K1R B;  3M3J A;  1H4R A;  1EF1 A;  4M0W B;  3ZKJ C;  3DVN U;  4WJP A;  1K8R B;  1Q1O A;  2V1Y A;  3MHS D;  5AZH A;  4IM2 A;  3WAM A;  2ZVN A;  3KUD B;  2LUE A;  4KZ0 A;  1J8C A;  5C1Z A;  1WGG A;  3ZW3 A;  1ZW7 A;  1R4N I;  3UQB A;  5D94 A;  2R2Q A;  2AEH A;  3PRZ A;  2G3Q B;  2BWE S;  2I1K A;  4AOF A;  4E71 A;  4TV3 A;  4TQ0 A;  2N9P C;  1UH6 A;  2K8H A;  4FHK A;  2KJ6 A;  3A1Q B;  3ZDM C;  4G11 A;  5JH5 C;  1OTR B;  2LRU A;  4FJV B;  1P0R A;  3K9P B;  1T0Y A;  3VTW A;  2WWZ A;  2DZK A;  1ISN A;  2A5U A;  1WI0 A;  4BVU C;  2K39 A;  2PE9 A;  2BWF A;  2NR2 A;  3SD5 A;  2UWQ A;  5J2R A;  3ZDT A;  3JW0 X;  5C23 A;  5CX3 A;  4GN1 A;  1I42 A;  3H1U A;  2MP2 B;  4LJP B;  4RM8 A;  5AZF A;  3B08 A;  2N9X A;  3D32 A;  3I3T B;  4W9J A;  3W1Y A;  3NOB A;  3QK0 A;  4M8N A;  2MP2 A;  2JY6 A;  2ZNV B;  2JVC A;  4BOZ B;  1WJ4 A;  2KQS A;  1WE6 A;  3ZTD A;  3HM3 A;  4EEW A;  2M0X A;  4A3O A;  4DHJ B;  1YIW A;  1ZKH A;  3ML9 A;  1HE8 A;  1WX9 A;  4IG7 B;  4IM3 A;  2GBN A;  3V6C B;  2NVU I;  3VUY A;  2PEA A;  2IY1 B;  3RUI B;  3L54 A;  1IP9 A;  3Q3J A;  2KQ7 A;  4GDK B;  1UGM A;  4HPL B;  3JYU A;  4NPN A;  4AP4 C;  2CKH B;  1WX7 A;  3DQV A;  4HXD A;  1YQB A;  4PS7 A;  2JXX A;  5G2N A;  1TBE A;  1TGZ B;  1GNU A;  1S1Q B;  4IW0 A;  3A9J B;  4KIK B;  4TKN A;  2PPH A;  2L05 A;  2OJR A;  4PYU A;  3ZNH B;  1E8X A;  2KO3 A;  3VTU A;  4BKS A;  4WJO A;  2BYV E;  1FXT B;  2HD5 B;  4XX5 A;  2JZZ A;  4NAW B;  3H9D A;  4II3 B;  2MBB B;  1WJU A;  4E3C A;  1E7U A;  2FID A;  1EUV B;  3MTN B;  4ANU A;  2N9E B;  2EKE C;  1WZ0 A;  4KSL C;  3O65 B;  2IY0 B;  4HCN B;  2DYB A;  3U8Z A;  3V62 A;  2NPT B;  4W9I A;  2MQJ A;  1J19 A;  2ZPY A;  3EEC A;  2D3G A;  2RD0 A;  4MSM B;  1MG8 A;  4NQL B;  2Z0D B;  5G55 A;  4FA6 A;  5IAA C;  4EZK A;  4DK5 A;  3DPD A;  3DBS A;  2AL3 A;  1NBF C;  2OOB B;  1E7V A;  4GGQ A;  4KZC A;  4FAD A;  1P98 A;  3RYT A;  4WWN A;  2LXA A;  2DAF A;  2BF8 B;  1CMX B;  4JIO U;  3UQA A;  1XT9 B;  2KTR A;  1GG3 A;  1OEY A;  2MBQ A;  1GC7 A;  4CO7 A;  4A3P A;  2JPH A;  3HHM A;  4WJN A;  4KVG B;  4AJY B;  5KHO A;  4WWO A;  2M17 A;  2KLG A;  4GIV A;  2LXC A;  1E8W A;  2L0F A;  2CHZ A;  2KOX A;  4G3X B;  3PRP B;  4HK2 A;  2KFJ A;  3VAW A;  3QHT A;  2FCQ A;  4F8C B;  2FAZ A;  3ZO5 B;  4HVB A;  1JRU A;  4BBN F;  2K8C A;  2IO1 B;  3PVL A;  1WF9 A;  2VRR B;  1BT0 A;  3K9O B;  2CHX A;  2M1M A;  4I6P A;  4IWQ A;  4M8M A;  3ZTC A;  3ZRC A;  5KHQ A;  1YX6 B;  3UF8 A;  2XK5 A;  3R7Q A;  3NS8 A;  4NJ6 A;  2IO2 B;  5J17 A;  2RGF A;  3U7D A;  3H6N A;  2ZCC A;  2G4S A;  3ENE A;  3QAQ A;  3R7R A;  2C7H A;  4B6W A;  5CHW A;  2KX3 A;  2K6D B;  2XEW A;  2NBU A;  1M94 A;  2LD9 A;  1UEL A;  2Z59 B;  2AL6 A;  4MGI E;  2KMA A;  4DHJ D;  1LFD A;  3OJ3 A;  3V61 A;  4OVU A;  3VVW B;  2L7R A;  3ZRF A;  5AEK B;  3UIO B;  1XQQ A;  5E6P A;  3L13 A;  4I6L B;  3S2A A;  3CF6 E;  1WRD B;  2N4F A;  5J18 A;  3RD2 A;  4EZL A;  3PLV A;  3A4R A;  1SE9 A;  1TTN A;  4DDG D;  3ZUN A;  2KTF A;  3DCG A;  2LGY A;  3GZN I;  2JZ3 B;  2DZI A;  4HJK A;  5BO4 B;  4MH0 E;  4IWP A;  3QX1 A;  5FR6 A;  4HDQ A;  2KDI A;  2DZM A;  3TMP B;  4MGY E;  2AYO B;  3PRE A;  2V4L A;  4G50 A;  3CST A;  3H7P B;  1WJ6 A;  3A1Q A;  1UBI A;  4DDI D;  2IO0 B;  3AU4 A;  4MGK E;  2IZV B;  4BKT A;  1GC6 A;  2LVP A;  4KDL B;  3ECI A;  2N1V A;  2EMT A;  2QHO A;  5LXI B;  4ZRI A;  3L10 B;  3N32 A;  2MSE D;  3T8M A;  5HKH A;  3PRM B;  2K25 A;  2PE6 B;  3TJP A;  1OQY A;  2L3Z A;  2BYF A;  2GBK A;  2JRI B;  3UIP B;  2ZCB A;  2ZJD A;  2CS4 A;  2I1J A;  1IYF A;  1P1A A;  2WX0 A;  4WQO B;  1OEY J;  1V80 A;  2DX5 B;  2HJ8 A;  5IA7 A;  3QJZ A;  3IBE A;  1C1Y B;  2RR9 A;  3Q3F A;  2D2Q A;  3VUX A;  3V6E B;  1IPG A;  2BPS A;  2BYE A;  1YJ1 A;  1LM8 B;  3PGE A;  2KC2 A;  1WGR A;  1WXA A;  1WZ3 A;  4LJO B;  3PZD A;  2KN5 A;  4IUM B;  3B1L X;  2D11 A;  3DDC B;  4GDK A;  4LDT B;  2DYO A;  2LVO A;  2O6V D;  4OVV A;  3VHT C;  4DXA B;  4F1S A;  3JSV B;  4N9F 4;  3MJW A;  2DEN B;  3VH4 B;  4AJW A;  5D7G A;  4AWJ A;  1V5T A;  4GOC A;  1L2N A;  2GBR A;  3WAO A;  2N7D A;  3JSV A;  2DAJ A;  4ZRK A;  2LRW A;  1NI2 A;  3L0W B;  4IC7 B;  4K81 A;  4KIK A;  3TCA A;  3A9J A;  4BKG A;  3BY4 B;  4ANW A;  2J7Q B;  2MWS B;  1V49 A;  2MW5 A;  1QZE A;  4NQK E;  4NAW A;  2MLB A;  4MJS B;  1VD2 A;  1WXS A;  2LVQ A;  2IO3 B;  3CSF A;  2NBV B;  2IYD B;  3DBH I;  1WM2 A;  3HK0 A;  3DVG X;  3IHP C;  3M62 B;  4NNJ B;  3ONS A;  3BIN A;  4LCD E;  2Z0E B;  2ZVO A;  3KUZ A;  2WDT B;  2NPT A;  4WJQ A;  4NY0 A;  4EKU A;  2KWU B;  5L95 C;  3NY5 A;  2KDE B;  4FJZ A;  1E90 A;  1AAR A;  3M95 A;  3SHQ A;  2AWT A;  4PS8 A;  3KYD D;  3IG3 A;  4TQ1 A;  2GOW A;  3X0W A;  2YVC A;  3APD A;  1J0G A;  3WAN A;  3QCA A;  3RZF A;  2BGF A;  2MBH A;  5GMV A;  1I35 A;  1WMH B;  3P2B A;  2G4D B;  2C7M B;  3W1S A;  2KHW B;  2KJR A;  3QC8 B;  4PYZ A;  2NS5 A;  2R2O A;  4FN2 A;  1WMH A;  2LGX A;  1L7Y A;  1UD7 A;  3DVG Y;  1V2Y A;  5TR5 A;  2FNJ B;  3EHV A;  2O6V B;  3WA0 A;  2WYQ A;  2FCS A;  4EOY A;  3PV1 A;  4TUU A;  5CHF A;  2NBW B;  3PSE B;  2O2V B;  2CR5 A;  4MGZ E;  4F7Z A;  2C9W B;  3KUC B;  1RLF A;  4II2 B;  4PS3 A;  5DPS A;  3IVF A;  2J0M A;  2KDB A;  2O2V A;  3PLU A;  2HE7 A;  4ZRJ A;  3RUL A;  4HDO A;  5DPT A;  2ZNV C;  1WIA A;  2GBJ A;  5JHA A;  4HCP B;  4X57 B;  3KW5 B;  1X1M A;  4DBG A;  4ASW C;  2KFK B;  3NZS A;  4HWI B;  4KV2 A;  1WH3 A;  4E74 A;  2L00 B;  4W9G A;  1EO6 A;  2JRH A;  4GDL B;  3VH3 B;  2Y5B B;  3HIZ A;  4HPM B;  2KFK A;  5E6N A;  3APF A;  1UZX B;  4P7I A;  3RT3 B;  1YD8 U;  3L16 A;  1WFY A;  2MBE A;  3DBL I;  3ZNZ B;  2J0K A;  4ZDV A;  1SGH A;  3QIJ A;  2MA9 B;  1Z5S B;  3ZNI D;  4RM9 A;  5LLI A;  3GOE A;  1Z2M A;  1V5O A;  3C0R B;  2FCM A;  5CTR C;  4ANV A;  3TL5 A;  2LAS A;  3VQI A;  4EZJ A;  1WGY A;  2REX A;  2PJH A;  2KLC A;  2DYM A;  4FLH A;  1LQB A;  4LDT D;  1Q0W B;  3DBR I;  4B9K A;  4FJY A;  2LZ6 A;  2LWP A;  5DCN A;  2CU1 A;  3TBL D;  2DHZ A;  4CYE A;  2MCN B;  2CHW A;  5L83 A;  4K7W A;  4EFO A;  1WR1 A;  3VUW A;  3A9K B;  1VCB A;  1WXV A;  1WY8 A;  1E5W A;  1KM7 A;  2M8S A;  3H7P A;  4MEM A;  4W9E A;  2D10 A;  2RPQ A;  3APC A;  5DPW A;  4JLC A;  3RCZ A;  4DHZ E;  1WX8 A;  3B0A A;  1LXD A;  4G0N B;  4BKS D;  3AXC A;  2YLM A;  2JT4 B;  3PHW B;  2C5L C;  3T9L A;  4ZYN A;  3U30 A;  2RSU A;  2KAN A;  2LGD A; 
#chains in the Genus database with same CATH topology
 3PS6 A;  5DPR A;  3N3K B;  3L08 A;  4ITK A;  1R4M I;  2K8B A;  3AE9 B;  1NYR A;  5FKA C;  2JWU A;  1KOT A;  2GBM A;  2JQR B;  4YSX B;  5JHB A;  2WXO A;  2GMI C;  1XLQ A;  3L17 A;  1WGD A;  2LGS A;  3URY A;  3HVZ A;  1C3T A;  2WX1 A;  3NZU A;  2GRI A;  4YTN B;  2W54 A;  1ET9 A;  4KDI C;  4NJ7 A;  1GJZ A;  2KZR A;  4BAX A;  3H7S A;  4BOS C;  2V3S A;  1VR9 A;  4A6Q A;  4OHJ A;  2VH1 A;  3U7Z A;  3KYC D;  2V3N A;  3IAM 1;  2FUH B;  4DWF A;  5JZE B;  3QA8 A;  1YJJ A;  3AM9 A;  3M63 B;  2WU5 B;  2L0T A;  3X23 A;  1YJI A;  3AMZ A;  1N6Z A;  1NDD A;  1P9D U;  1FXI A;  1TIF A;  2M56 B;  2K6Q A;  3N1X C;  1H8C A;  2X8X X;  2FIF A;  4ZRP A;  1YQ3 B;  3KVF B;  3OAW A;  1E8Y A;  3RNF C;  4HLE A;  1XD3 B;  1RRB A;  1TT5 B;  1L6V A;  1XLO A;  3OLM D;  3R3M A;  1EF5 A;  4ICV A;  4BBN C;  1WXM A;  4IOI E;  2GB1 A;  2KNB A;  3QWZ B;  5C3J B;  1JAL A;  3VTV A;  1D4B A;  2BB6 A;  1E0Z A;  4MM3 A;  1OQQ A;  3TEX A;  1A70 A;  4XDC A;  3KH0 A;  2AQ2 B;  2LFI A;  4B95 A;  3JVZ X;  1SE3 A;  1V6E A;  3RZW C;  1F9J A;  1ZGU B;  2WLB A;  3Q14 C;  2CJN A;  4C7Y A;  3ML8 A;  3QAR A;  4YWG G;  2LJ5 A;  2KWD A;  1OGW A;  2ASQ A;  4MSQ B;  4AQ7 A;  1AWD A;  3PPA A;  3PTF C;  2BYT A;  2RMM A;  4DHZ B;  3IFW B;  1KJT A;  4JPS A;  4M0W B;  3ZKJ C;  5AZH A;  3WAM A;  1IBX B;  3MHS D;  2ZVN A;  2LUE A;  1CZP A;  5C1Z A;  4HRO A;  4ZOH C;  3UQB A;  4REZ A;  2I1K A;  1JWS D;  2K8H A;  3ZDM C;  5JH5 C;  1V1P A;  2LRU A;  1P0R A;  4KGS A;  2DZK A;  1C4A A;  2PE9 A;  1N63 A;  3ZDT A;  4MT5 A;  1I42 A;  2MH7 A;  4W9J A;  2N9X A;  2W3R A;  3I3T B;  2MP2 A;  2JVC A;  4BOZ B;  5C2T B;  1WJ4 A;  1WE6 A;  3Q8A A;  2EKI A;  3HM3 A;  2M0X A;  4IM3 A;  1WX9 A;  2GBN A;  3VUY A;  2PEA A;  1T0R C;  4BZA A;  1QF6 A;  1I4G A;  2AX5 A;  1E10 A;  3JYU A;  4XGA B;  2JXX A;  1TGZ B;  2QMT A;  4TKN A;  2L05 A;  3T3O A;  1P7E A;  3ZNH B;  1E8X A;  4LNF A;  4BKS A;  1FXT B;  1QOF A;  4XX5 A;  4NAW B;  2BS3 B;  2WXM A;  4E3C A;  1YN3 A;  2EKE C;  4KSL C;  2DYB A;  1MG8 A;  2Z0D B;  1E6E B;  4FA6 A;  4HRS A;  5IAA C;  4LNO A;  2WGS A;  4DK5 A;  3AE2 B;  1NBF C;  2OOB B;  1UNS A;  1E7V A;  1RFK A;  4WWN A;  2DAF A;  1XT9 B;  1GG3 A;  1FFV A;  4GLS C;  4WJN A;  2WU2 B;  5KHO A;  5T8I A;  3P63 A;  1ET6 A;  2WHI A;  4GIV A;  4DQO C;  2KOX A;  3NG0 A;  3PRP B;  4HK2 A;  2KFJ A;  2FCQ A;  3RN9 C;  4F8C B;  2MHJ A;  4BBN F;  1FO4 A;  1WF9 A;  1BT0 A;  1HA5 A;  2WXQ A;  4EE2 A;  2PKO A;  3DHH C;  4IWQ A;  1YX6 B;  3UF8 A;  3W9C B;  3U7D A;  3H6N A;  2ZCC A;  2G4S A;  3ENE A;  3QAQ A;  4B6W A;  1J7C A;  4RF1 A;  2KX3 A;  2AL6 A;  4KKJ A;  5AEK B;  3UIO B;  1XQQ A;  3AEF B;  3L13 A;  3S2A A;  1WRD B;  2WXI A;  3B2F A;  3RD2 A;  4EZL A;  3A4R A;  4DDG D;  1J7A A;  3ZUN A;  3GZN I;  1QOB A;  1J7B A;  3AEB B;  1F52 A;  2M0A A;  1SEB D;  4D2K A;  4C7Z A;  4MGY E;  2V4L A;  3CST A;  3H7P B;  3A1Q A;  1UBI A;  2WP9 B;  2IO0 B;  1GC6 A;  1ZDV A;  2QHO A;  5LXI B;  1C4P A;  4JWU C;  1ZOY B;  2WXH A;  3N32 A;  3T8M A;  2L3Z A;  2GBK A;  2ZJD A;  2CS4 A;  4HKZ E;  1P1A A;  1QOA A;  2DX5 B;  3OWE B;  3NJT A;  4XYC A;  1FIQ A;  4WH4 A;  3Q3F A;  3V6E B;  1IPG A;  3GP7 A;  4A8X C;  1WZ3 A;  2KN5 A;  3B1L X;  4GDK A;  1EWC A;  4DXA B;  4OVV A;  3VHT C;  1V5T A;  4GOC A;  1L2N A;  2LRW A;  1NI2 A;  4K81 A;  2KVZ A;  3AE8 B;  4YTP B;  2MLB A;  3EFC A;  4MJS B;  1VD2 A;  1GB4 A;  3MP9 A;  4NQL B;  2IYD B;  2L83 A;  1L0X B;  4LCD E;  4WJQ A;  2WDT B;  3E9S A;  2KDE B;  1EWY C;  1SJH D;  3IG3 A;  3ZQ4 A;  3X0W A;  2YVC A;  3IT4 B;  2BGF A;  1D5M C;  5GMV A;  2C7M B;  2KHW B;  2DLB A;  2VZK D;  2K5P A;  1WMH A;  1UD7 A;  3DVG Y;  5TR5 A;  3EHV A;  2G1E A;  1VLB A;  2PMV A;  2NBW B;  4MGZ E;  4II2 B;  3PLU A;  2O2V A;  1ZUD 2;  3AEA B;  3VR8 B;  2ZNV C;  1GOZ A;  3KW5 B;  3NZS A;  2VH2 A;  2JRH A;  3HIZ A;  3AEC B;  4P7I A;  3L16 A;  1WFY A;  2MBE A;  2GLS A;  1TY2 A;  4ZDV A;  3QIJ A;  4WAF A;  1Z5S B;  4P1C C;  3GOE A;  1V5O A;  4KGR A;  4YXD B;  4RNA A;  3TL5 A;  2REX A;  1SXT A;  4FLH A;  2W82 A;  2KDM A;  4B9K A;  3Q3N C;  2HTM E;  3FIL A;  2CHW A;  3DBL B;  1MVK A;  3A9K B;  1WY8 A;  5D3D A;  1NVI D;  1LGR A;  4JLC A;  5IO9 A;  1WX8 A;  3B0A A;  2YLM A;  2C5L C;  2D3B A;  3W1S C;  2LGD A;  2LI5 A;  4N59 A;  1S3S G;  3GS2 A;  4K7S A;  4I6N B;  1V81 A;  5LXH A;  4JL9 A;  1U4A A;  1WM3 A;  2WXJ A;  1XXG A;  5E6O A;  2INN E;  2BKF A;  4K7U A;  3A33 B;  3ZYY X;  1TJE A;  3N1Z C;  4W9H A;  3NHE B;  3VFK A;  1R4M B;  1YN4 A;  5D6J B;  1G6J A;  2E6X A;  2KC1 A;  3EUB 2;  2C60 A;  4C80 A;  4W9F A;  3U52 E;  3AE3 B;  1ZDX A;  2KWC A;  1D3Z A;  2MJ3 A;  1MFW A;  3VRA B;  2ON8 A;  1WJN A;  4P16 A;  4RGM A;  1PFD A;  2KD0 A;  1DYQ A;  4TSS A;  2R61 A;  3IXS A;  1FPY A;  2NCN A;  2O6V A;  3HVD A;  5EE9 A;  3N20 C;  1ACC A;  4XDD A;  3ALB A;  1FMA D;  4KX6 B;  3I63 C;  3ZJU A;  2W9N A;  2ZPN A;  2Y5C A;  2K1F A;  3LDZ E;  2L8J A;  2IBI B;  5D2M B;  1KRH A;  4A20 A;  3EC8 A;  3CMM B;  1D5Z C;  3BVZ A;  2MX2 A;  3NVV A;  3WAL A;  1TY0 A;  2BBC A;  4ICU A;  4XZ4 A;  5EE1 A;  1JWB D;  2G45 B;  2BKR B;  2TSS A;  3N30 A;  3RFZ B;  1Y8R C;  3LJ3 A;  1NEK B;  1MI0 A;  2B3A A;  3L4P A;  3P4R B;  1E9M A;  1GPX A;  1YX5 B;  1WR6 E;  4LNN A;  4ANX A;  2JUO A;  1K52 A;  2QJL A;  3WIM A;  1NI3 A;  4YTM B;  4GSW A;  1C4C A;  4L1B A;  3V60 A;  1QT9 A;  2DZJ A;  2JF5 A;  4NZL B;  4K1R B;  1H4R A;  1EF1 A;  1OFF A;  1VRA B;  4A9A A;  3DVN U;  4WJP A;  2V1Y A;  1WGG A;  1ZW7 A;  2R2Q A;  2AEH A;  2BWE S;  2H89 B;  1YQ4 B;  4TV3 A;  4TQ0 A;  2DWQ A;  1UH6 A;  1L4Z B;  2KJ6 A;  1ENF A;  1L5P A;  1I4Q A;  4FJV B;  3K9P B;  3OG5 A;  2WWZ A;  3ZGZ A;  1ISN A;  1WI0 A;  3SD5 A;  2BWF A;  2UWQ A;  4DXF A;  3H1U A;  4LJP B;  4RM8 A;  5AZF A;  1KFY B;  1AN8 A;  2LHE A;  2JY6 A;  2ZNV B;  4PT5 A;  1XCQ L;  4EEW A;  2LHD A;  4DHJ B;  1V1O A;  3ML9 A;  2IND C;  3MHZ A;  2CU3 A;  2IY1 B;  1KLU D;  4HPP A;  1UGM A;  4HPL B;  4NPN A;  4AP4 C;  4AS1 A;  3DQV A;  1YQB A;  4PS7 A;  5G2N A;  4KGT A;  1S1Q B;  2HD5 B;  3H9D A;  1E7U A;  2FID A;  1HZ5 A;  5E6J A;  3MTN B;  2N9E B;  3U8Z A;  4HCN B;  2MQJ A;  4YT0 B;  2ZPY A;  2RD0 A;  3DHI C;  2INC C;  4R3D A;  4EZK A;  2FUG 1;  4GGQ A;  3RYT A;  4S0R A;  1XLP A;  2I38 A;  3UQA A;  4IKG A;  2KTR A;  1GC7 A;  2JPH A;  3HHM A;  4AJY B;  4WWO A;  2KLG A;  5EE3 A;  2LXC A;  2L0F A;  2PW9 A;  4G3X B;  2J53 A;  2JXT A;  3QHT A;  1HQR D;  1K53 A;  3RNC C;  3ZO5 B;  3GE3 C;  2IO1 B;  4OVZ A;  3K9O B;  2CHX A;  4I6P A;  5KHQ A;  2LMC A;  2XK5 A;  3E56 A;  3NS8 A;  4NJ6 A;  5CHW A;  2KMA A;  3OJ3 A;  1DGJ A;  3V61 A;  1B1Z A;  2L7R A;  3ZRF A;  4I6L B;  2N4F A;  1HEZ E;  3DCG A;  1WRI A;  1F0Z A;  1F2R I;  5AUK A;  2DZI A;  5BO4 B;  4NJC A;  3RNG C;  4HDQ A;  2DZM A;  2CJO A;  5HI1 A;  4G50 A;  3GE8 C;  4P1B C;  2IZV B;  2N1V A;  3MFG A;  1SBB B;  3AE5 B;  4ZRI A;  3Q6B A;  3KWL A;  1DOX A;  3AH7 A;  2PE6 B;  3GZN B;  3TJP A;  3KLS X;  3UI3 A;  5HFY A;  2JRI B;  3Q3M C;  1PGA A;  2RDG A;  4WQO B;  1AW7 A;  1C1Y B;  2RR9 A;  3J9C A;  2BYE A;  3PGE A;  1LM8 B;  4ARC A;  1TS2 A;  3PZD A;  3DDC B;  2DYO A;  1FM0 D;  4N6E B;  3JSV B;  4N9F 4;  2DEN B;  3VH4 B;  3W5U B;  4AJW A;  1R7S A;  3Q8C A;  4LK0 M;  4KIK A;  3TCA A;  3A9J A;  4ANW A;  2J7Q B;  2MWS B;  4LNK A;  1QZE A;  4ZYS A;  1WM2 A;  3HK0 A;  3IHP C;  3M62 B;  3BIN A;  4OZC A;  2Z0E B;  2ZVO A;  1N60 A;  2NPT A;  3NY5 A;  2ZW1 A;  3BK1 A;  1I4P A;  1CQV A;  1AAR A;  3M95 A;  4PS8 A;  3KYD D;  1PDX A;  1C78 A;  1NYQ A;  3QCA A;  3WAN A;  3RZF A;  3W5V B;  3RMK C;  3P2B A;  2G4D B;  2KJR A;  4PYZ A;  2NS5 A;  2R2O A;  1C77 A;  1EU4 A;  2KMM A;  5TSS A;  1V2Y A;  2FNJ B;  2QIE B;  2WYQ A;  2FCS A;  4WUR A;  3PV1 A;  4TUU A;  3AE4 B;  4F7Z A;  1RLF A;  3RUL A;  2KDB A;  4C4V B;  5DPT A;  3RPF C;  2GBJ A;  1X1M A;  4ASW C;  2KFK B;  3R2I A;  5BYQ A;  4HWI B;  4W9G A;  4MM3 B;  3VH3 B;  3RT3 B;  4J3O D;  2OJW A;  4RM9 A;  4FXC A;  1T0Q C;  2FCM A;  2LUM A;  5G5H A;  2DYM A;  1FNV A;  4A55 A;  2NTS A;  1F1H A;  1YMH E;  2BVC A;  3DBR I;  2JX5 A;  2LWP A;  4Q2J A;  5HG2 A;  4K7W A;  1UWM A;  3VUW A;  3RNE C;  1VCB A;  1PUT A;  3AB5 A;  5IKC M;  2V0G A;  4W9E A;  4ARI A;  1FFU A;  3BYT B;  2I2Y A;  3AE7 B;  3RCZ A;  1ZXH A;  2W3S A;  1LXD A;  4ZRQ A;  4BKS D;  1V1P B;  3PHW B;  3V3X A;  2RSU A;  2FBW B;  1VDV A;  2N1W A;  3A4S C;  5J17 A;  1GUA B;  4AUQ C;  1L6U A;  3I9V 1;  2C7N B;  1RAX A;  2E3T A;  2X38 A;  4M01 A;  1I4X A;  3I57 A;  1I7H A;  4C00 A;  2ZEQ A;  4BFR A;  1C76 A;  1JML A;  2KK8 A;  3ZLZ A;  3DHG C;  3Q8B A;  2KYW A;  2A4Z A;  3EFU A;  5EE0 A;  4TMA B;  1WYW B;  2WDV B;  2N7E A;  4GU2 A;  4KSK C;  4WWP A;  1RYJ A;  1XO3 A;  3Q69 A;  4LLG M;  4IM0 A;  3RI7 C;  2Z8L A;  2JYT A;  1RFA A;  3ZXR A;  1Y56 A;  3FAH A;  2K0P A;  1B9R A;  4C56 C;  2J0J A;  2WQY B;  4GMV A;  1WE7 A;  1ZE3 D;  3DOW A;  3AUL A;  4JGH B;  3UGB B;  3PT2 B;  2XBB C;  1F2R C;  2N7J A;  2IGH A;  4MEL A;  2FCN A;  2KVR A;  1V97 A;  3I5J C;  4A90 A;  4GDL A;  3MC0 B;  2WXN A;  1UBQ A;  1TS5 A;  2ZZP B;  1T6B X;  1JQ4 A;  1TZ1 A;  3QQ8 B;  1ZPS A;  1Q5W B;  4YL8 A;  3VR9 B;  2KDF B;  3HM6 X;  3R66 C;  3UIN B;  2EMS A;  3AU5 A;  3VDZ A;  1JRP A;  2MBO A;  4W9K A;  1K50 A;  5CHV C;  3BZD B;  5FK9 C;  1K8R B;  1Q1O A;  2BS2 B;  2JYE A;  1J8C A;  4KZ0 A;  2L1A A;  3ZW3 A;  1R4N I;  2G3Q B;  2N9P C;  2FE8 A;  4FHK A;  2WXG A;  3A1Q B;  1OTR B;  2JZP A;  2WXL A;  2A5U A;  4BVU C;  2NR2 A;  4S17 A;  3JW0 X;  5C23 A;  3HRD D;  1A5R A;  3W1Y A;  4O1N A;  1KH0 A;  4M8N A;  3TEW A;  1PGB A;  5H92 C;  4B0E A;  2RDH A;  2KQS A;  4OZB A;  3ZTD A;  4A3O A;  1YIW A;  1ZKH A;  4PK1 A;  1CJE A;  1HE8 A;  3V6C B;  1XLN A;  1T3Q A;  2NVU I;  3L54 A;  3Q3J A;  3NZ3 A;  4GDK B;  2QDF A;  3BII D;  1TBE A;  3BWU D;  2OJR A;  4PYU A;  4US8 A;  2HDE A;  4WJO A;  2BYV E;  2JZZ A;  3AED B;  2INP E;  2MBB B;  3C19 A;  1EUV B;  1ROE A;  4ANU A;  1SJE D;  4NAM A;  1WZ0 A;  2OED A;  3O65 B;  2IY0 B;  3V62 A;  4W9I A;  1J19 A;  3EEC A;  1EM7 A;  5G55 A;  3PO0 A;  3Q3O C;  2UU7 A;  4WIP A;  1WWT A;  3DBS A;  3B9J A;  1N61 A;  2AL3 A;  2N9K A;  1K51 A;  2XNA C;  4FAD A;  1VZ6 A;  4OW0 A;  2LXA A;  1OEY A;  2N9L A;  3B2G A;  3KWV A;  3SR6 A;  1P7F A;  3VAW A;  1KLG D;  4HVB A;  1JRU A;  2K8C A;  4USA A;  2NTT A;  3P4Q B;  4M8M A;  3ZRC A;  1DOI A;  1VJK A;  3R7Q A;  1L4D B;  2IO2 B;  2ONQ A;  2PVO D;  3BYY B;  2XEW A;  3NVW A;  2LD9 A;  1UEL A;  2Z59 B;  3N9Y C;  4DHJ D;  2PLP A;  4JE3 B;  3VVW B;  5E6P A;  1NEN B;  3CF6 E;  5BMH A;  5J18 A;  1HXY D;  3V05 A;  2IPK D;  2KT7 A;  2MEK A;  4M0W A;  3FIL B;  4MH0 E;  1IBX A;  1QKZ A;  1F77 A;  2KAC A;  3TMP B;  1T0S C;  2AYO B;  3AEE B;  2QSD A;  3U2S C;  1TKG A;  3AU4 A;  4MGK E;  4BKT A;  5IN7 A;  2LVP A;  4KDL B;  2EMT A;  3EA6 A;  5HKH A;  3PRM B;  2K25 A;  1MHH E;  2ZW0 A;  3UIP B;  4LTU A;  2I1J A;  3SFD B;  3PZ8 A;  2WX0 A;  1V80 A;  2WNM A;  3ETR A;  3QJZ A;  2D2Q A;  2BPS A;  2BW2 A;  1WGR A;  2KC2 A;  4LJO B;  3BVM A;  1N5W A;  4LDT B;  2LVO A;  2O6V D;  3MJW A;  1HTO A;  5I4D A;  5D7G A;  4AWJ A;  4B0M A;  1SE4 A;  2GBR A;  2N7D A;  2BQQ A;  3JSV A;  4ZRK A;  4IC7 B;  2D5G A;  3NVY A;  1GAQ B;  1CK1 A;  4NQK E;  4NAW A;  5D3I B;  5BYR A;  1WXS A;  2LVQ A;  2IO3 B;  2NBV B;  4XWT A;  4H2A A;  1N62 A;  3HUI A;  1AYF A;  3KUZ A;  4EKU A;  5L95 C;  3U4E G;  3CIR B;  4NY0 A;  1I4R A;  2PVG C;  1C79 A;  1OQR A;  4M00 A;  4FJZ A;  1FCL A;  1EU3 A;  1TS3 A;  4N58 A;  4TQ1 A;  2GOW A;  4L2Y A;  3AEG B;  1I35 A;  1IUE A;  2LGX A;  4DXG A;  4RGN A;  4XE0 A;  2O6V B;  3WA0 A;  4EOY A;  3AN1 A;  4RFB A;  1QLB B;  1RWS A;  3PSE B;  3KUC B;  3IVF A;  2IDY A;  2DBY A;  2J0M A;  4HDO A;  1WIA A;  4X57 B;  2PTL A;  4C4V A;  4E74 A;  3ZJV A;  1PYW D;  2WDR B;  1L0V B;  4HPM B;  2KFK A;  3R8B A;  3APF A;  5AUI A;  1YD8 U;  1MG4 A;  1FRD A;  1SF0 A;  3ZNZ B;  2J0K A;  1SGH A;  3ZNI D;  5LLI A;  1SE2 A;  4L23 A;  2LAS A;  1TYG B;  2JU6 X;  1Q0W B;  3NVZ A;  1XF5 L;  2BT6 A;  1KTK A;  4FJY A;  1SSN A;  2OHF A;  2MCN B;  1VZ8 A;  1FD6 A;  1TS4 A;  1E5W A;  2M8S A;  3H7P A;  3MC9 A;  4MEM A;  3CWI A;  2RPQ A;  4IDI A;  4DHZ E;  3AXC A;  3DBR B;  5H8Y E;  2JT4 B;  3EGR A;  3T9L A;  1KF6 B;  4ZYN A;  1DOY A;  1GB1 A;  4OZA A;  1TKE A;  1V9J A;  4QAY A;  1XEE A;  3ZXV A;  1WXQ A;  3AV8 A;  3NRZ A;  2KWV B;  3MJ5 A;  5BMI A;  4WQM A;  2B76 B;  4HJG E;  2HTH A;  4GB9 A;  3AI5 A;  4EUT A;  3WCQ A;  2KX0 A;  4US9 A;  1LO5 D;  4JQW C;  2JSV X;  2AQ3 B;  3TIX A;  5IP4 D;  3C8Y A;  3SU8 X;  3TEY A;  3DWM A;  3DVN V;  4MJS A;  3BK2 A;  1MHX A;  4IWO A;  2V4I B;  1E8Z A;  1ZXI A;  2M19 A;  2KXJ A;  4ZHO A;  2V9H A;  4XC2 A;  5LNK 1;  1L0Y B;  1T5X D;  1Q10 A;  2MRP A;  1P3Q U;  4MDK E;  3ZNG C;  2M4N A;  5JXV A;  3P42 A;  3O13 A;  1JWU D;  3LB8 C;  2KJH B;  2JWZ A;  1JWM D;  2LJI A;  1V86 A;  1M4V A;  2UYZ B;  4RH6 A;  5AZG A;  1TZO A;  2KTR B;  2LGI A;  4W9C A;  5BYS A;  4URK A;  1BUI C;  4FUL A;  3ZJT A;  2IGD A;  3VXW A;  2WXF A;  1HZ6 A;  3W2D A;  3SDL C;  4W9D A;  1WYG A;  3Q8E A;  2K9X A;  3OJ4 B;  1ZP0 B;  3T3N A;  1BXT A;  1JRO A;  4J6I A;  3FKY A;  3ZIM A;  2BS4 B;  4CHK A;  2QCZ A;  4GXB A;  2L76 A;  2XK5 B;  5BMG A;  1MPE A;  1UWX A;  1TKY A;  2D07 B;  2KKC A;  1SIF A;  3PHX B;  1WGH A;  1FEH A;  3PZ7 A;  1V8C A;  2WXR A;  1QIL A;  1PQS A;  1JCK B;  4FHJ A;  4RMA A;  3ZVV A;  4WAA A;  4W9L A;  3WAP A;  5EDS A;  1KLV A;  3A9K A;  1STE A;  4FBJ B;  2KMC A;  3M3J A;  2KQ4 X;  1WSP A;  1RM6 C;  4MH8 A;  4IM2 A;  3KUD B;  2D3C A;  1VZ7 A;  5G5G A;  5D94 A;  1HTQ A;  3P4S B;  3PRZ A;  1YOV B;  4E71 A;  4AOF A;  4RGT A;  3TEZ A;  1QOG A;  3VRB B;  4M02 A;  4G11 A;  2K3U A;  1T0Y A;  3VTW A;  2K39 A;  5J2R A;  5CX3 A;  4GN1 A;  3AE1 B;  1E7P B;  2MP2 B;  3B08 A;  3D32 A;  3SEB A;  3NOB A;  3QK0 A;  5MPO A;  1R4N B;  4KKI A;  3TUO A;  1JW9 D;  2BTE A;  4IG7 B;  2SAK A;  2J52 A;  3RUI B;  1IP9 A;  4K3B A;  3RNA C;  1XCT L;  2KQ7 A;  5HHD G;  2CKH B;  1WX7 A;  4HXD A;  2NMQ A;  1GNU A;  4IW0 A;  4KIK B;  3A9J B;  4RGO S;  2PPH A;  5IOI A;  2V3P A;  3VTU A;  2KO3 A;  4P6V F;  3GB1 A;  4II3 B;  1WJU A;  1UUP A;  3RNB C;  2NPT B;  2D3G A;  4MSM B;  2MJD A;  2IJ0 A;  3N1Y C;  2Y3A A;  2WS3 B;  3DPD A;  2KAJ A;  4KZC A;  1P98 A;  2L32 A;  2BF8 B;  1CMX B;  4JIO U;  2MBQ A;  4CO7 A;  2PIA A;  4A3P A;  5FR3 A;  3DBH B;  4KVG B;  2M17 A;  4JWS C;  1E8W A;  1N5X A;  2CHZ A;  2YEP F;  1IGD A;  2RDB C;  3P4P B;  2WXK A;  2FAZ A;  3PVL A;  2VRR B;  1C9F A;  2M1M A;  3ZTC A;  4YSZ B;  2Q5W D;  1D6E C;  2RGF A;  1YNT E;  3R7R A;  2C7H A;  1FCC C;  1ESF A;  2K6D B;  2NBU A;  1M94 A;  4MGI E;  1LFD A;  4OVU A;  1FNW A;  1SB3 C;  2GI9 A;  3PLV A;  1SE9 A;  1TTN A;  2KTF A;  2LGY A;  1I4H A;  1UGJ A;  2JZ3 B;  2VZK B;  4HJK A;  4IWP A;  3QX1 A;  4K3C A;  2H88 B;  5FR6 A;  2KDI A;  3PRE A;  3ABV B;  3LXF A;  1WJ6 A;  4DDI D;  4YSY B;  3FC4 A;  4UDU C;  3ECI A;  2YEP B;  3L10 B;  2MSE D;  4CQN A;  1OQY A;  1YN5 A;  1UF0 A;  2BYF A;  2ZCB A;  4XWW A;  2IGG A;  4WWM A;  1IYF A;  1OEY J;  1D5X C;  2HJ8 A;  4MAC A;  3P1M A;  2XN9 C;  5IA7 A;  3IBE A;  3VUX A;  1YJ1 A;  3LYY A;  1WXA A;  3BVG A;  3H8H A;  1FXA A;  4IUM B;  2D11 A;  4F1S A;  2MJE A;  2N0S B;  3WAO A;  3IT6 B;  3MC8 A;  2DAJ A;  3L0W B;  4BKG A;  3BY4 B;  4HEA 1;  3AE6 B;  1V49 A;  2MW5 A;  3IAS 1;  3DBH I;  3CSF A;  4LNI A;  2J4X A;  3DVG X;  4NNJ B;  3ONS A;  1JWA D;  2KWU B;  2EEL A;  1E90 A;  2WDQ B;  3SHQ A;  2AWT A;  4JX1 C;  2ACZ B;  3APD A;  1J0G A;  4HKQ A;  4ZHP A;  2MBH A;  1WMH B;  3W1S A;  3QC8 B;  4FN2 A;  4RCO A;  2BB5 A;  1L7Y A;  5CHF A;  2O2V B;  3SFE B;  2CR5 A;  2C9W B;  3NS1 A;  4PS3 A;  5DPS A;  2HE7 A;  4ZRJ A;  5JHA A;  1BML C;  2ICI A;  4HCP B;  2Y5P A;  4DBG A;  2KN4 A;  4KV2 A;  1WH3 A;  2L00 B;  1EO6 A;  4GDL B;  2Y5B B;  5E6N A;  2QEJ C;  1UZX B;  3KQ4 A;  3DBL I;  2W55 A;  1PGX A;  1IGC A;  4ACF A;  2MA9 B;  2G9H D;  2WXP A;  1Z2M A;  2DNF A;  1WGK A;  5CTR C;  2RPV A;  3C0R B;  4ANV A;  1FNU A;  3VQI A;  4EZJ A;  1WGY A;  2PJH A;  2KLC A;  1FRR A;  2LEK A;  5GXG B;  1LQB A;  4LDT D;  2LZ6 A;  2HJ1 A;  5DCN A;  2SEB D;  1QQR A;  2CU1 A;  3TBL D;  2DHZ A;  4CYE A;  5L83 A;  4EFO A;  1WR1 A;  2L52 A;  1WXV A;  2QIL A;  3TSS A;  2K22 A;  3R2T A;  1KM7 A;  2D3A A;  2J42 A;  2QC8 A;  3Q2A C;  2D10 A;  1SIJ A;  3APC A;  5DPW A;  3Q8F A;  3NUH B;  2AQ1 B;  4G0N B;  1MJD A;  4RF0 A;  3DWG C;  3U30 A;  2KAN A; 
#chains in the Genus database with same CATH homology
 2N1W A;  3A4S C;  3PS6 A;  2LI5 A;  1GUA B;  5DPR A;  3N3K B;  1S3S G;  3L08 A;  4K7S A;  4I6N B;  4AUQ C;  1V9J A;  3W1S C;  1V81 A;  1R4M I;  2K8B A;  5LXH A;  2C7N B;  4JL9 A;  1RAX A;  1U4A A;  1WM3 A;  2KWV B;  1KOT A;  2GBM A;  5E6O A;  2HTH A;  5JHB A;  2GMI C;  3L17 A;  4GB9 A;  2BKF A;  3AI5 A;  1WGD A;  4EUT A;  4K7U A;  2KX0 A;  1C3T A;  2WX1 A;  3A33 B;  3NZU A;  4KDI C;  2ZEQ A;  4NJ7 A;  1GJZ A;  4BFR A;  2KZR A;  4JQW C;  4W9H A;  3NHE B;  3VFK A;  2KK8 A;  3ZLZ A;  3TIX A;  5D6J B;  1G6J A;  3SU8 X;  3H7S A;  4BOS C;  3DVN V;  2V3S A;  4MJS A;  4IWO A;  2A4Z A;  3KYC D;  2KC1 A;  1E8Z A;  2FUH B;  3EFU A;  2C60 A;  4DWF A;  4W9F A;  5JZE B;  1WYW B;  3QA8 A;  2KWC A;  2N7E A;  4GU2 A;  1D3Z A;  2KXJ A;  3M63 B;  4XC2 A;  4KSK C;  4WWP A;  2L0T A;  3X23 A;  4IM0 A;  2MRP A;  1WJN A;  1P3Q U;  4MDK E;  3ZNG C;  2M4N A;  1NDD A;  1P9D U;  1RFA A;  2K6Q A;  1H8C A;  2KJH B;  2KD0 A;  2JWZ A;  2FIF A;  2J0J A;  2NCN A;  3KVF B;  3OAW A;  1WE7 A;  1E8Y A;  3DOW A;  4GMV A;  2O6V A;  3AUL A;  4JGH B;  4HLE A;  1V86 A;  1XD3 B;  2UYZ B;  1RRB A;  3UGB B;  5AZG A;  3PT2 B;  2XBB C;  2KTR B;  4W9C A;  3ALB A;  3OLM D;  3R3M A;  4URK A;  1EF5 A;  4MEL A;  4ICV A;  4BBN C;  1WXM A;  4FUL A;  2FCN A;  2W9N A;  2KNB A;  3QWZ B;  3VXW A;  2ZPN A;  3LDZ E;  2K1F A;  3VTV A;  2KVR A;  2IBI B;  2L8J A;  3SDL C;  5D2M B;  4A20 A;  3EC8 A;  4W9D A;  3CMM B;  2MX2 A;  3WAL A;  4GDL A;  3OJ4 B;  4MM3 A;  4ICU A;  4XZ4 A;  2G45 B;  2BKR B;  3KH0 A;  3N30 A;  1UBQ A;  4J6I A;  2ZZP B;  4B95 A;  3JVZ X;  3ZIM A;  1V6E A;  3RZW C;  1F9J A;  4CHK A;  1Y8R C;  4GXB A;  1ZGU B;  3LJ3 A;  2L76 A;  2XK5 B;  1TZ1 A;  3QQ8 B;  2D07 B;  2KKC A;  3ML8 A;  2B3A A;  1SIF A;  3QAR A;  1Q5W B;  1YX5 B;  1WR6 E;  3PHX B;  2LJ5 A;  4YL8 A;  1WGH A;  4ANX A;  1OGW A;  2JUO A;  2KDF B;  3HM6 X;  2ASQ A;  3R66 C;  4MSQ B;  3UIN B;  3WIM A;  3PPA A;  3PTF C;  4GSW A;  1PQS A;  3V60 A;  2EMS A;  3AU5 A;  4FHJ A;  4RMA A;  3VDZ A;  3ZVV A;  1A5R A;  4WAA A;  4W9L A;  4DHZ B;  3WAP A;  2MBO A;  4W9K A;  3IFW B;  5EDS A;  1KLV A;  1KJT A;  3A9K A;  2DZJ A;  2JF5 A;  2KMC A;  5CHV C;  4FBJ B;  4K1R B;  3M3J A;  1H4R A;  1EF1 A;  4M0W B;  3ZKJ C;  3DVN U;  4WJP A;  1K8R B;  1Q1O A;  2V1Y A;  3MHS D;  5AZH A;  4IM2 A;  3WAM A;  2ZVN A;  3KUD B;  2LUE A;  4KZ0 A;  1J8C A;  5C1Z A;  1WGG A;  3ZW3 A;  1ZW7 A;  1R4N I;  3UQB A;  5D94 A;  2R2Q A;  2AEH A;  3PRZ A;  2G3Q B;  2BWE S;  2I1K A;  4AOF A;  4E71 A;  4TV3 A;  4TQ0 A;  2N9P C;  1UH6 A;  2K8H A;  4FHK A;  2KJ6 A;  3A1Q B;  3ZDM C;  4G11 A;  5JH5 C;  1OTR B;  2LRU A;  4FJV B;  1P0R A;  3K9P B;  1T0Y A;  3VTW A;  2WWZ A;  2DZK A;  1ISN A;  2A5U A;  1WI0 A;  4BVU C;  2K39 A;  2PE9 A;  2BWF A;  2NR2 A;  3SD5 A;  2UWQ A;  5J2R A;  3ZDT A;  3JW0 X;  5C23 A;  5CX3 A;  4GN1 A;  1I42 A;  3H1U A;  2MP2 B;  4LJP B;  4RM8 A;  5AZF A;  3B08 A;  2N9X A;  3D32 A;  3I3T B;  4W9J A;  3W1Y A;  3NOB A;  3QK0 A;  4M8N A;  2MP2 A;  2JY6 A;  2ZNV B;  2JVC A;  4BOZ B;  1WJ4 A;  2KQS A;  1WE6 A;  3ZTD A;  3HM3 A;  4EEW A;  2M0X A;  4A3O A;  4DHJ B;  1YIW A;  1ZKH A;  3ML9 A;  1HE8 A;  1WX9 A;  4IG7 B;  4IM3 A;  2GBN A;  3V6C B;  2NVU I;  3VUY A;  2PEA A;  2IY1 B;  3RUI B;  3L54 A;  1IP9 A;  3Q3J A;  2KQ7 A;  4GDK B;  1UGM A;  4HPL B;  3JYU A;  4NPN A;  4AP4 C;  2CKH B;  1WX7 A;  3DQV A;  4HXD A;  1YQB A;  4PS7 A;  2JXX A;  5G2N A;  1TBE A;  1TGZ B;  1GNU A;  1S1Q B;  4IW0 A;  3A9J B;  4KIK B;  4TKN A;  2PPH A;  2L05 A;  2OJR A;  4PYU A;  3ZNH B;  1E8X A;  2KO3 A;  3VTU A;  4BKS A;  4WJO A;  2BYV E;  1FXT B;  2HD5 B;  4XX5 A;  2JZZ A;  4NAW B;  3H9D A;  4II3 B;  2MBB B;  1WJU A;  4E3C A;  1E7U A;  2FID A;  1EUV B;  3MTN B;  4ANU A;  2N9E B;  2EKE C;  1WZ0 A;  4KSL C;  3O65 B;  2IY0 B;  4HCN B;  2DYB A;  3U8Z A;  3V62 A;  2NPT B;  4W9I A;  2MQJ A;  1J19 A;  2ZPY A;  3EEC A;  2D3G A;  2RD0 A;  4MSM B;  1MG8 A;  4NQL B;  2Z0D B;  5G55 A;  4FA6 A;  5IAA C;  4EZK A;  4DK5 A;  3DPD A;  3DBS A;  2AL3 A;  1NBF C;  2OOB B;  1E7V A;  4GGQ A;  4KZC A;  4FAD A;  1P98 A;  3RYT A;  4WWN A;  2LXA A;  2DAF A;  2BF8 B;  1CMX B;  4JIO U;  3UQA A;  1XT9 B;  2KTR A;  1GG3 A;  1OEY A;  2MBQ A;  1GC7 A;  4CO7 A;  4A3P A;  2JPH A;  3HHM A;  4WJN A;  4KVG B;  4AJY B;  5KHO A;  4WWO A;  2M17 A;  2KLG A;  4GIV A;  2LXC A;  1E8W A;  2L0F A;  2CHZ A;  2KOX A;  4G3X B;  3PRP B;  4HK2 A;  2KFJ A;  3VAW A;  3QHT A;  2FCQ A;  4F8C B;  2FAZ A;  3ZO5 B;  4HVB A;  1JRU A;  4BBN F;  2K8C A;  2IO1 B;  3PVL A;  1WF9 A;  2VRR B;  1BT0 A;  3K9O B;  2CHX A;  2M1M A;  4I6P A;  4IWQ A;  4M8M A;  3ZTC A;  3ZRC A;  5KHQ A;  1YX6 B;  3UF8 A;  2XK5 A;  3R7Q A;  3NS8 A;  4NJ6 A;  2IO2 B;  5J17 A;  2RGF A;  3U7D A;  3H6N A;  2ZCC A;  2G4S A;  3ENE A;  3QAQ A;  3R7R A;  2C7H A;  4B6W A;  5CHW A;  2KX3 A;  2K6D B;  2XEW A;  2NBU A;  1M94 A;  2LD9 A;  1UEL A;  2Z59 B;  2AL6 A;  4MGI E;  2KMA A;  4DHJ D;  1LFD A;  3OJ3 A;  3V61 A;  4OVU A;  3VVW B;  2L7R A;  3ZRF A;  5AEK B;  3UIO B;  1XQQ A;  5E6P A;  3L13 A;  4I6L B;  3S2A A;  3CF6 E;  1WRD B;  2N4F A;  5J18 A;  3RD2 A;  4EZL A;  3PLV A;  3A4R A;  1SE9 A;  1TTN A;  4DDG D;  3ZUN A;  2KTF A;  3DCG A;  2LGY A;  3GZN I;  2JZ3 B;  2DZI A;  4HJK A;  5BO4 B;  4MH0 E;  4IWP A;  3QX1 A;  5FR6 A;  4HDQ A;  2KDI A;  2DZM A;  3TMP B;  4MGY E;  2AYO B;  3PRE A;  2V4L A;  4G50 A;  3CST A;  3H7P B;  1WJ6 A;  3A1Q A;  1UBI A;  4DDI D;  2IO0 B;  3AU4 A;  4MGK E;  2IZV B;  4BKT A;  1GC6 A;  2LVP A;  4KDL B;  3ECI A;  2N1V A;  2EMT A;  2QHO A;  5LXI B;  4ZRI A;  3L10 B;  3N32 A;  2MSE D;  3T8M A;  5HKH A;  3PRM B;  2K25 A;  2PE6 B;  3TJP A;  1OQY A;  2L3Z A;  2BYF A;  2GBK A;  2JRI B;  3UIP B;  2ZCB A;  2ZJD A;  2CS4 A;  2I1J A;  1IYF A;  1P1A A;  2WX0 A;  4WQO B;  1OEY J;  1V80 A;  2DX5 B;  2HJ8 A;  5IA7 A;  3QJZ A;  3IBE A;  1C1Y B;  2RR9 A;  3Q3F A;  2D2Q A;  3VUX A;  3V6E B;  1IPG A;  2BPS A;  2BYE A;  1YJ1 A;  1LM8 B;  3PGE A;  2KC2 A;  1WGR A;  1WXA A;  1WZ3 A;  4LJO B;  3PZD A;  2KN5 A;  4IUM B;  3B1L X;  2D11 A;  3DDC B;  4GDK A;  4LDT B;  2DYO A;  2LVO A;  2O6V D;  4OVV A;  3VHT C;  4DXA B;  4F1S A;  3JSV B;  4N9F 4;  3MJW A;  2DEN B;  3VH4 B;  4AJW A;  5D7G A;  4AWJ A;  1V5T A;  4GOC A;  1L2N A;  2GBR A;  3WAO A;  2N7D A;  3JSV A;  2DAJ A;  4ZRK A;  2LRW A;  1NI2 A;  3L0W B;  4IC7 B;  4K81 A;  4KIK A;  3TCA A;  3A9J A;  4BKG A;  3BY4 B;  4ANW A;  2J7Q B;  2MWS B;  1V49 A;  2MW5 A;  1QZE A;  4NQK E;  4NAW A;  2MLB A;  4MJS B;  1VD2 A;  1WXS A;  2LVQ A;  2IO3 B;  3CSF A;  2NBV B;  2IYD B;  3DBH I;  1WM2 A;  3HK0 A;  3DVG X;  3IHP C;  3M62 B;  4NNJ B;  3ONS A;  3BIN A;  4LCD E;  2Z0E B;  2ZVO A;  3KUZ A;  2WDT B;  2NPT A;  4WJQ A;  4NY0 A;  4EKU A;  2KWU B;  5L95 C;  3NY5 A;  2KDE B;  4FJZ A;  1E90 A;  1AAR A;  3M95 A;  3SHQ A;  2AWT A;  4PS8 A;  3KYD D;  3IG3 A;  4TQ1 A;  2GOW A;  3X0W A;  2YVC A;  3APD A;  1J0G A;  3WAN A;  3QCA A;  3RZF A;  2BGF A;  2MBH A;  5GMV A;  1I35 A;  1WMH B;  3P2B A;  2G4D B;  2C7M B;  3W1S A;  2KHW B;  2KJR A;  3QC8 B;  4PYZ A;  2NS5 A;  2R2O A;  4FN2 A;  1WMH A;  2LGX A;  1L7Y A;  1UD7 A;  3DVG Y;  1V2Y A;  5TR5 A;  2FNJ B;  3EHV A;  2O6V B;  3WA0 A;  2WYQ A;  2FCS A;  4EOY A;  3PV1 A;  4TUU A;  5CHF A;  2NBW B;  3PSE B;  2O2V B;  2CR5 A;  4MGZ E;  4F7Z A;  2C9W B;  3KUC B;  1RLF A;  4II2 B;  4PS3 A;  5DPS A;  3IVF A;  2J0M A;  2KDB A;  2O2V A;  3PLU A;  2HE7 A;  4ZRJ A;  3RUL A;  4HDO A;  5DPT A;  2ZNV C;  1WIA A;  2GBJ A;  5JHA A;  4HCP B;  4X57 B;  3KW5 B;  1X1M A;  4DBG A;  4ASW C;  2KFK B;  3NZS A;  4HWI B;  4KV2 A;  1WH3 A;  4E74 A;  2L00 B;  4W9G A;  1EO6 A;  2JRH A;  4GDL B;  3VH3 B;  2Y5B B;  3HIZ A;  4HPM B;  2KFK A;  5E6N A;  3APF A;  1UZX B;  4P7I A;  3RT3 B;  1YD8 U;  3L16 A;  1WFY A;  2MBE A;  3DBL I;  3ZNZ B;  2J0K A;  4ZDV A;  1SGH A;  3QIJ A;  2MA9 B;  1Z5S B;  3ZNI D;  4RM9 A;  5LLI A;  3GOE A;  1Z2M A;  1V5O A;  3C0R B;  2FCM A;  5CTR C;  4ANV A;  3TL5 A;  2LAS A;  3VQI A;  4EZJ A;  1WGY A;  2REX A;  2PJH A;  2KLC A;  2DYM A;  4FLH A;  1LQB A;  4LDT D;  1Q0W B;  3DBR I;  4B9K A;  4FJY A;  2LZ6 A;  2LWP A;  5DCN A;  2CU1 A;  3TBL D;  2DHZ A;  4CYE A;  2MCN B;  2CHW A;  5L83 A;  4K7W A;  4EFO A;  1WR1 A;  3VUW A;  3A9K B;  1VCB A;  1WXV A;  1WY8 A;  1E5W A;  1KM7 A;  2M8S A;  3H7P A;  4MEM A;  4W9E A;  2D10 A;  2RPQ A;  3APC A;  5DPW A;  4JLC A;  3RCZ A;  4DHZ E;  1WX8 A;  3B0A A;  1LXD A;  4G0N B;  4BKS D;  3AXC A;  2YLM A;  2JT4 B;  3PHW B;  2C5L C;  3T9L A;  4ZYN A;  3U30 A;  2RSU A;  2KAN A;  2LGD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...