2KC1A

Nmr structure of the f0 domain (residues 0-85) of the talin ferm domain
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
91
structure length
91
Chain Sequence
GIDPFTMVALSLKISIGNVVKTMQFEPSTMVYDACRMIRERIPEALAGPPNDFGLFLSDDDPKKGIWLEAGKALDYYMLRNGDTMEYRKKQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MKIAA1027 protein
publication title Structure of a double ubiquitin-like domain in the talin head: a role in integrin activation.
pubmed doi rcsb
source organism Mus musculus
molecule tags Structural protein
total genus 22
structure length 91
sequence length 91
ec nomenclature
pdb deposition date 2008-12-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16511 FERM_f0 N-terminal or F0 domain of Talin-head FERM
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 2kc1A00
2NBWB 4FHJA 4HPMB 4NQLB 2WWZA 1V9JA 2FIDA 2UYZB 2EMSA 2AEHA 4TV3A 4A20A 3UQBA 2KJRA 4WWOA 3A1QA 3UF8A 1UZXB 3ZTDA 4II2B 1WGHA 4EZLA 1Q5WB 2KHWB 3Q3FA 2XBBC 3B1LX 5J17A 4NQKE 1TZ1A 2C7NB 2PJHA 4W9IA 3K9OB 2KK8A 5CTRC 4IWPA 4RMAA 3T8MA 4HJKA 3DVGX 4I6NB 5D7GA 1WJ4A 5AZFA 3A4SC 3H6NA 5CHFA 5JZEB 4E71A 1WE6A 4MM3A 4ZRIA 3ML8A 4HXDA 3RD2A 3EECA 2KMCA 4PS7A 2O2VA 4EFOA 2IBIB 1U4AA 2N1VA 1E7UA 1J0GA 4PYZA 3H1UA 3PT2B 4MH0E 4HPLB 1WIAA 3GZNI 4AWJA 3BY4B 3M62B 1WF9A 2DAJA 3H7SA 5J18A 2LD9A 3KYCD 1Z5SB 2GBNA 4G11A 2D07B 3ZO5B 3U30A 4A3OA 4FHKA 4AOFA 5JHBA 4PS8A 4LDTD 2PE9A 4ANXA 5LXHA 2N4FA 3ZNGC 2O6VD 1WH3A 2GOWA 3VTVA 3VAWA 2MX2A 2MCNB 2O2VB 2FNJB 2JT4B 2KN5A 2A5UA 2WX0A 4WWNA 2K25A 4OVUA 2KDFB 4XC2A 3UIPB 1WFYA 4FULA 1ZW7A 2N9XA 2DZIA 4EZJA 3KUDB 4LJPB 2KLCA 2RGFA 2C9WB 2MBOA 2JRIB 1RFAA 3CSFA 4GOCA 4GMVA 1V80A 4CHKA 4WWPA 2BYEA 1MG8A 1WYWB 1V86A 4HLEA 3NHEB 4HDOA 3QX1A 3LDZE 2NPTB 3VUWA 3WAMA 3ZW3A 3VUYA 2M4NA 2KC2A 4G0NB 1SIFA 1WXMA 4OVVA 3I3TB 1IP9A 2D2QA 2L8JA 4KZCA 4G50A 3M95A 2R2QA 2AWTA 4ANUA 1OTRB 1EF1A 2W9NA 2FCNA 4MSQB 2JWZA 3ZRFA 1KOTA 4K81A 1YIWA 2KJ6A 3DVNV 3HM3A 1GJZA 1WE7A 2J0KA 2MSED 1OEYJ 1RAXA 1UGMA 5G55A 4K7WA 4GDKA 2ZVNA 2BF8B 3L0WB 3W1SC 3APDA 2MWSB 2K1FA 4BBNF 4II3B 3DDCB 4GDLA 1KJTA 3PS6A 5L95C 3CSTA 1YD8U 2CHZA 4GGQA 3VVWB 4NAWB 2K6QA 3UINB 4CO7A 4IG7B 2IO2B 1OEYA 4F8CB 2OJRA 2KC1A 4I6LB 1C3TA 1PQSA 3L08A 1WJUA 1P1AA 3U7DA 4W9FA 2LI5A 1WXAA 2D11A 2DYOA 4GDKB 2Z0EB 4W9LA 1WGRA 2KTFA 4DHZE 2GBMA 4ANWA 1H4RA 1WM2A 5J2RA 3VHTC 4MJSA 2DZMA 2K8BA 4GDLB 5DPSA 2NBVB 3N30A 3ML9A 1WJ6A 3OLMD 2L0FA 1WXSA 2N1WA 1NI2A 2IY1B 1BT0A 1V5TA 2I1KA 4MGKE 3RZFA 4IM2A 3PTFC 4ZYNA 4P7IA 4DBGA 4E74A 1GC6A 1UD7A 2PPHA 2BKRB 3SD5A 2RR9A 1KLVA 4NY0A 4LJOB 2XK5A 2CHWA 3PSEB 2D10A 3HK0A 4MGYE 4ZRJA 3V60A 1X1MA 5BO4B 5LXIB 3DPDA 2A4ZA 3A9KB 3PRPB 3R3MA 5C23A 3UGBB 4BKSD 2N7EA 4JIOU 3ZTCA 2FUHB 3X23A 3QQ8B 3IBEA 3QWZB 2BWES 2MLBA 2O6VA 4WJNA 3U8ZA 1WZ3A 2L76A 3IVFA 4KDLB 3RCZA 3VTWA 4DXAB 2QHOA 3QC8B 2ZEQA 1A5RA 3TIXA 3NY5A 3WALA 2K39A 3RUIB 4WQOB 4W9HA 4NJ7A 2G3QB 3QA8A 4YL8A 3KVFB 1NDDA 1R4MI 3A1QB 4GU2A 4W9DA 2JVCA 4W9KA 3ZLZA 4MDKE 2CU1A 2G45B 2XK5B 4TQ0A 3DBLI 5IAAC 1AARA 1WX7A 2FAZA 4MGZE 4BVUC 1C1YB 3PLUA 4WAAA 3ECIA 1E7VA 1EUVB 1ZKHA 2KWUB 3AXCA 2LVPA 3UIOB 3ZNHB 4IW0A 5IA7A 2KDEB 1UBIA 3R66C 4EOYA 2HTHA 2BYFA 3ZDMC 4F1SA 4WJOA 2O6VB 4N9F4 1E5WA 1E8WA 1LQBA 2JUOA 3EHVA 3L10B 2KTRA 4W9EA 2IZVB 3X0WA 2KLGA 2L00B 2CS4A 1V49A 1WR6E 3PVLA 4IUMB 1E8ZA 2NS5A 2J7QB 1S3SG 3RZWC 3NOBA 2LWPA 2DYBA 3QAQA 3RYTA 3AULA 3UQAA 1EF5A 5CHWA 2FIFA 3ZNZB 3O65B 2MP2A 3OJ3A 3MTNB 1TTNA 2KX3A 3TL5A 2ASQA 1ZGUB 4BFRA 2MBQA 1GUAB 1WGGA 2FCSA 1V6EA 3JW0X 4B95A 4NJ6A 1S1QB 5DPRA 1D3ZA 1Q1OA 2RPQA 3CF6E 2J0MA 2MBEA 2RSUA 4WJPA 2JXXA 3MHSD 4ZRKA 2IO3B 2M17A 2I1JA 2R2OA 4DHJD 5E6OA 2KTRB 1WX8A 4B9KA 4K1RB 1WR1A 4BBNC 2LVQA 2EMTA 2DAFA 2MBBB 4KDIC 4GN1A 1SGHA 1VD2A 4PS3A 1UH6A 5TR5A 3S2AA 4BOZB 3L13A 4WJQA 4JGHB 5GMVA 2MP2B 1V5OA 5EDSA 4E3CA 4RM8A 3V62A 5CX3A 2G4SA 3PRMB 2KWVB 4FJVB 5D94A 1ISNA 2V3SA 4AJYB 5KHQA 3VTUA 2M0XA 1XQQA 1WM3A 2JPHA 3V6EB 4AJWA 1OQYA 3QIJA 4XZ4A 5L83A 3KW5B 3L16A 3DBRI 1Z2MA 2JZ3B 2Y5BB 4BOSC 2UWQA 4K7SA 2M8SA 2JRHA 4W9CA 2FCQA 3QHTA 1LM8B 1K8RB 2K6DB 2ZCBA 3IHPC 4GXBA 1JRUA 4FN2A 3WANA 2NVUI 3M3JA 2D3GA 2HJ8A 1YJ1A 3D32A 1P0RA 1P98A 1WXVA 3AI5A 3ALBA 5AZHA 3TBLD 2KOXA 1TBEA 3Q3JA 3C0RB 1TGZB 3SHQA 3PZDA 4GIVA 3ZDTA 2KJHB 2C60A 4GSWA 1T0YA 2LGXA 2LVOA 2ZJDA 3VH3B 4KSLC 2GBKA 2JZZA 3PRZA 2EKEC 3HHMA 3V61A 2LZ6A 2HE7A 2MQJA 5C1ZA 2LXAA 1L7YA 2MW5A 4IWOA 3HM6X 3QCAA 2KMAA 4TKNA 1LXDA 1SE9A 1UELA 3LJ3A 2L7RA 4DK5A 3P2BA 1YX5B 2BKFA 1NBFC 2YVCA 1WZ0A 2BWFA 3AU4A 2KANA 2ZNVB 4NNJB 2IYDB 2DZJA 3R7RA 1GG3A 2GBJA 4BKGA 4FADA 2NR2A 3VUXA 3PHWB 3QJZA 1FXTB 3NZSA 4RM9A 1XT9B 2KFKA 2LJ5A 2XEWA 4IM0A 1WY8A 2WDTB 2GMIC 1G6JA 3L54A 1I42A 1J19A 2AL6A 3ZUNA 1GNUA 3DQVA 5DPWA 1OGWA 4IM3A 4MJSB 2KWCA 3A9JA 3DCGA 2KO3A 1P3QU 2DYMA 5LLIA 2CKHB 2B3AA 2BYVE 2WX1A 5AZGA 4W9GA 3APCA 4ICUA 3OAWA 3ZKJC 1IPGA 4JL9A 2IO1B 2KXJA 3ZVVA 4DHZB 4IC7B 5DPTA 1V81A 2DZKA 4MGIE 2K8CA 3WAPA 4AP4C 2Z0DB 4HCNB 5HKHA 3L17A 4W9JA 3VXWA 5DCNA 2V4LA 3ZRCA 2KFKB 3EC8A 2KNBA 2KQSA 4B6WA 2LGYA 5JH5C 2REXA 5KHOA 3TJPA 1F9JA 2BPSA 4LDTB 2WYQA 1R4NI 2AL3A 4ZDVA 2L05A 1WMHA 2CR5A 1Q0WB 2J0JA 3A9JB 1J8CA 5D2MB 1RLFA 4JLCA 2IO0B 4LCDE 1XD3B 3PV1A 4G3XB 3M63B 2KD0A 3WAOA 4DWFA 3NS8A 1M94A 2CHXA 3VDZA 3IG3A 1I35A 4URKA 3GOEA 3NZUA 4K7UA 3JVZX 2N9EB 4CYEA 4GB9A 2V1YA 2LGDA 3OJ4B 4ANVA 2ZPYA 3SU8X 4HDQA 2G4DB 2OOBB 1LFDA 3QARA 2KFJA 3ZNID 5FR6A 3TMPB 3DBSA 2LRWA 2C7MB 4DHJB 4EKUA 2KX0A 2ZVOA 2LASA 3VH4B 2L3ZA 3PPAA 3V6CB 3PREA 1YX6B 1WMHB 5E6NA 3EFUA 1Y8RC 3KYDD 3IFWB 2MA9B 2DENB 3KH0A 3ONSA 4KSKC 1GC7A 1QZEA 2NBUA 4ICVA 1UBQA 2BGFA 2NPTA 1WGYA 1VCBA 2K8HA 3R7QA 2JY6A 2ZNVC 3PHXB 2VRRB 3BINA 2PEAA 3CMMB 1L2NA 4J6IA 3DVGY 4MSMB 2MBHA 4EZKA 4IWQA 3HIZA 5D6JB 4ASWC 2C5LC 2JF5A 2M1MA 2NCNA 3A33B 5E6PA 3T9LA 5G2NA 2IY0B 4DDGD 3VQIA 2ZZPB 3TCAA 4TQ1A 4X57B 1IYFA 3APFA 3B08A 4MELA 2LXCA 1WRDB 2DHZA 3VFKA 4NAWA 2KQ7A 3K9PB 4KVGB 2GBRA 4TUUA 1CMXB 1E8YA 3AU5A 3DVNU 3A4RA 4KIKA 5JHAA 3RT3B 1V2YA 4F7ZA 3ZIMA 2AYOB 2YLMA 2HD5B 3H9DA 3JSVA 3H7PA 4HCPB 4M0WB 3DBHI 3WIMA 4FLHA 4BKSA 1KM7A 1WI0A 1E90A 2KDIA 3PGEA 2LRUA 2LUEA 1P9DU 4HK2A 4MEMA 4AUQC 4FBJB 4HWIB 3SDLC 1WX9A 1H8CA 2KZRA 3N3KB 4NPNA 4FA6A 2PE6B 4BKTA 3KUCB 5AEKB 4M8NA 2DX5B 4M8MA 3PLVA 4EEWA 1WJNA 3RULA 1WGDA 2FCMA 4DDID 4FJYA 2C7HA 4KIKB 2N9PC 4KZ0A 3ENEA 4EUTA 3N32A 2L0TA 1YQBA 1EO6A 4I6PA 4PYUA 3QK0A 2ZCCA 4A3PA 3B0AA 4HVBA 3JSVB 3H7PB 2Z59B 3A9KA 4FJZA 2N7DA 3DOWA 3JYUA 1E8XA 3W1YA 2KDBA 2MRPA 4KV2A 3W1SA 2RD0A 3MJWA 2KKCA 5CHVC 3KUZA 1HE8A 2KVRA 2ZPNA 4JQWC 3WA0A 1RRBA 4XX5A
chains in the Genus database with same CATH superfamily
1HEZE 2CJNA 2WXRA 4RNAA 4ARCA 1FXIA 4FHJA 1F2RI 4TV3A 3UQBA 2KJRA 3A1QA 1UZXB 2JYEA 3U2SC 1Q5WB 2WDRB 5IKCM 1ET9A 2C7NB 4W9IA 1FD6A 1YJIA 2FBWB 2KK8A 1MVKA 4IWPA 4HJKA 2I38A 5AZFA 1D5ZC 5CHFA 4E71A 1LO5D 4ZRIA 4AS1A 4HXDA 3EECA 4PS7A 3H8HA 1J0GA 4PYZA 1SSNA 3H1UA 3PT2B 1QKZA 3GZNI 4AWJA 2EELA 1AN8A 2JX5A 2KVZA 3EUB2 1SB3C 3TEYA 2LD9A 1TIFA 3AE7B 4PS8A 4LDTD 2PE9A 2N4FA 1WH3A 2GOWA 3N1ZC 2MX2A 3DWGC 2FNJB 3N9YC 3RNAC 1NI3A 1K52A 2WXHA 4OW0A 4FULA 2N9XA 3AH7A 4LJPB 4OZBA 1JCKB 1RFAA 4JX1C 4GOCA 3NRZA 1PGBA 1V80A 5D3IB 4MH8A 3Q8EA 2N9LA 1V86A 1QLBB 3BVGA 1ZDVA 3LDZE 3QX1A 3NZ3A 1GPXA 2L8JA 2PVGC 1EF1A 2FCNA 2KJ6A 3HM3A 1WE7A 1OEYJ 1UGMA 5BMGA 3AN1A 4K7WA 5BMIA 3Q6BA 2MWSB 2K22A 1XLOA 2CHZA 4NAWB 3UINB 4IG7B 4JWUC 3GB1A 2IO2B 3FC4A 2KC1A 1C4AA 3AE6B 3BVMA 2LI5A 1PYWD 2DYOA 1UGJA 2PTLA 2FE8A 4YTNB 3VHTC 3MJ5A 2DZMA 3OLMD 4C4VB 2I1KA 2YEPB 4ZYNA 1UD7A 2BKRB 2MJDA 3NJTA 1KLVA 4NY0A 2XK5A 5BYQA 2CHWA 5BO4B 3RNFC 4KX6B 3UGBB 2JYTA 2MLBA 2O6VA 1L0VB 2L76A 3HVZA 2V9HA 4KDLB 1SJHD 4L23A 4P1CC 3WALA 2K39A 3RUIB 4WQOB 2WXKA 4NJ7A 2G3QB 2XNAC 4YL8A 3KVFB 1P7FA 4GU2A 4W9DA 4W9KA 2XK5B 1AARA 1WX7A 1N61A 2FAZA 1FEHA 3AXCA 3AM9A 3R66C 2HTHA 3ZDMC 3DBRB 2O6VB 3EHVA 4HRSA 4CQNA 2IZVB 2CS4A 4ARIA 3VR9B 1UNSA 3RZWC 1HXYD 2DYBA 5CHWA 2WGSA 3OJ3A 4ACFA 1TTNA 3Q69A 2KX3A 2V4IB 1T0QC 2ASQA 4BFRA 2FCSA 1V6EA 1S1QB 2WXNA 3AB5A 1DGJA 4NJCA 1IBXA 1WR1A 2EMTA 2DAFA 2MBBB 4PS3A 3OG5A 1TYGB 2IGDA 3ZXRA 4FJVB 2V3SA 1T0SC 2LGSA 3P4QB 4KGTA 3QIJA 4XZ4A 5L83A 3KW5B 4LNNA 1Z2MA 2J42A 2X38A 1OQRA 1VZ8A 2FCQA 1L0XB 3QHTA 2K6DB 1IBXB 4GXBA 1MHXA 4FN2A 3AE9B 3D32A 4YTPB 5TSSA 2HJ1A 2MEKA 1JWAD 4GSWA 2ZJDA 2OJWA 4KSLC 3PRZA 2NTTA 1SIJA 5C1ZA 2MW5A 1SE9A 2XN9C 2YVCA 1WZ0A 2KANA 4YSXB 2IYDB 2DZJA 3R7RA 1FNUA 4BKGA 4OZAA 3E9SA 4RM9A 1JWMD 1J7AA 4JPSA 1JROA 4IM0A 2WDTB 4KGSA 1G6JA 1I42A 2DWQA 5DPWA 2BQQA 3AE2B 2KWCA 3A9JA 4ZYSA 1P3QU 5LLIA 1YQ3B 3U4EG 1T6BX 1L5PA 2IO1B 4LNKA 1V81A 3ZXVA 4MGIE 2K8CA 3WAPA 2K0PA 5HKHA 1KFYB 3L17A 5FK9C 3VXWA 2KNBA 2LGYA 4KKJA 1I4GA 2BPSA 1R4NI 2AL3A 2L05A 2CR5A 1CQVA 3A9JB 2IO0B 4LCDE 3WAOA 3AEFB 3NS8A 1SXTA 3NZUA 4K7UA 4CYEA 1C4PA 2LGDA 5BYRA 3SU8X 2G4DB 3QARA 3CIRB 4RGNA 3TMPB 1C4CA 4DHJB 2D3CA 2W82A 4EKUA 3PPAA 5E6NA 3EFUA 1Y8RC 1PDXA 3R8BA 1RFKA 3Q8AA 1V1PA 4ICVA 2HTME 2NPTA 2K8HA 3R7QA 1TS3A 4RGMA 2MBHA 2KACA 2JF5A 4M0WA 3A33B 5E6PA 1GB4A 5G2NA 1XLNA 3R2TA 2QMTA 1K51A 4TQ1A 1IYFA 1D6EC 1C78A 3I9V1 4KVGB 4TUUA 1E8YA 3ZYYX 3RT3B 2R61A 2YLMA 4M0WB 3WCQA 4BKSA 2H89B 1WI0A 1E90A 2KDIA 3PGEA 4HK2A 4AUQC 3IT4B 1SEBD 4HWIB 3MFGA 1ZDXA 1NEKB 3TUOA 4M8NA 1OFFA 2WXMA 3PLVA 1NYQA 1CK1A 4YTMB 2FCMA 1N63A 4FJYA 3ZJVA 2BTEA 2L0TA 1YQBA 3KQ4A 4OVZA 3AECB 3DOWA 3VRAB 1E8XA 1RWSA 4TSSA 2PVOD 2KN4A 2KVRA 2ZPNA 3NUHB 1I4RA 4XX5A 2Y3AA 1GOZA 4NQLB 2WWZA 4R3DA 2AEHA 4A20A 1DOYA 3Q3OC 3ZTDA 1FO4A 1T5XD 4EZLA 2KHWB 5J17A 4NQKE 1TZ1A 3UI3A 2J53A 3K9OB 1EM7A 5CTRC 4RFBA 4H2AA 3T8MA 2BYTA 3DVGX 4I6NB 2W54A 2VZKB 4YSYB 2KMCA 4EFOA 3GS2A 2MH7A 4HPLB 1WIAA 1OQQA 5C2TB 1HQRD 1WF9A 3H7SA 5J18A 3KYCD 4A55A 3ZO5B 3FILA 4AOFA 4IOIE 5JHBA 1YN4A 3BVZA 2LUMA 3VAWA 4N6EB 1BMLC 3AE4B 3AMZA 3TEZA 2KN5A 2A5UA 4WWNA 2K25A 1AWDA 4HKZE 3UIPB 2M0AA 2DZIA 5IO9A 2JQRB 2AX5A 2C9WB 2MBOA 4P1BC 1Q10A 4HLEA 2KQ4X 3VUWA 2M4NA 1ZE3D 1IP9A 1J7CA 4G50A 3M95A 3R2IA 2R2QA 2AWTA 2W9NA 3ZRFA 1XF5L 4K81A 1QOAA 1GJZA 2K5PA 1ACCA 2J0KA 4NZLB 2HDEA 1PGXA 2BF8B 5L95C 3AEBB 1YD8U 4GGQA 2K6QA 3RNCC 1OEYA 4F8CB 2IDYA 1WJUA 1B1ZA 4W9LA 1WGRA 4ANWA 1H4RA 1WM2A 4MJSA 2K8BA 2NBVB 1VJKA 4XE0A 4IM2A 4P7IA 1YNTE 2PKOA 2RR9A 4MGYE 3A9KB 2SAKA 5C23A 1CZPA 1P7EA 2N7EA 4JIOU 2FUHB 3QQ8B 4WIPA 1SF0A 3QWZB 2BWES 2JSVX 3VTWA 3RNBC 4DXAB 1NENB 3TIXA 2ZW1A 3IT6B 3NY5A 2IGGA 1N6ZA 4W9HA 1EU3A 3A1QB 2JVCA 2CU1A 3DBLI 1SJED 4YXDB 1JALA 4MGZE 1XO3A 3PLUA 4WAAA 3MC9A 1EUVB 1ZKHA 2KWUB 3UIOB 5IA7A 4W9EA 3L10B 3PVLA 1V49A 2LJIA 1E8ZA 4WQMA 3QAQA 3UQAA 1EF5A 3O65B 2MP2A 1FNWA 1XCQL 1I4XA 1YOVB 2TSSA 2INCC 3HUIA 3Q14C 3JW0X 4B95A 4NJ6A 5DPRA 1D3ZA 1JRPA 2RPQA 1KLUD 4WJPA 2RSUA 2Z8LA 1N62A 3MHSD 3DHHC 4ZRKA 2IO3B 2R2OA 5E6OA 1WX8A 3MC0B 5TR5A 3S2AA 2WS3B 4JGHB 5GMVA 2MP2B 1V5OA 5EDSA 4E3CA 4RM8A 3RMKC 5CX3A 2JZPA 1N60A 3V62A 1M4VA 5D94A 3PRMB 1ISNA 1ZOYB 2JPHA 4AJWA 2L32A 1OQYA 4US9A 3BWUD 3L16A 2JZ3B 2Y5BB 2M8SA 3BYYB 1K8RB 3VRBB 1DOXA 3WANA 1HTQA 2HJ8A 1YJ1A 3BIID 3ALBA 5AZHA 3TBLD 1TBEA 2WXLA 3SHQA 2C60A 1T0YA 1V8CA 3VH3B 4TMAB 2EKEC 2HE7A 3CWIA 1STEA 4LNIA 4ZHPA 3HM6X 3QCAA 3C19A 4TKNA 1LXDA 3LJ3A 2BKFA 4M00A 2BWFA 3AU4A 2WXIA 3P63A 1GG3A 2GBJA 4N58A 4FADA 2NR2A 2WHIA 3RI7C 5GXGB 3DQVA 4IM3A 2OEDA 2VH2A 3DCGA 1TKEA 2B3AA 4NAMA 5AZGA 1IPGA 4JL9A 3ZVVA 4GLSC 2V3NA 1RYJA 2DZKA 3HRDD 4AP4C 1PGAA 2V4LA 2KQSA 1J7BA 1L6VA 2V0GA 2REXA 2GB1A 1WMHA 3GE3C 1SE2A 4OZCA 1XD3B 1I7HA 3M63B 1VLBA 2RDBC 4DWFA 1I35A 3GOEA 2WQYB 2N9EB 3Q3MC 2V1YA 3PZ8A 4ANVA 1QOBA 2MJ3A 5FKAC 3P4SB 3V6CB 1WMHB 4XWTA 2DENB 4EE2A 4WWMA 4O1NA 1GC7A 4PK1A 2B76B 1UBQA 1VCBA 2RDHA 1V1OA 2BB5A 2ZNVC 5AUKA 4A9AA 2LEKA 4XGAB 1K53A 4ASWC 2M1MA 5HHDG 3VQIA 3MC8A 4L1BA 4LNFA 1E9MA 1HZ6A 3I63C 1UWXA 2W55A 4MELA 1XLPA 2LXCA 2DHZA 2I2YA 2AQ3B 2IJ0A 3LB8C 3ABVB 2WXJA 4KIKA 5JHAA 4FXCA 4F7ZA 1E7PB 3ZIMA 4ZHOA 1LGRA 1SBBB 3H9DA 3H7PA 4HEA1 1D5MC 3DBHI 2LRUA 2LUEA 4FBJB 1HTOA 1N5XA 1L4ZB 3N3KB 1ESFA 4EEWA 1UWMA 1UUPA 4OHJA 5E6JA 2DBYA 4KIKB 4LTUA 2BS2B 4KZ0A 4EUTA 1EO6A 3AE5B 2ZCCA 2PW9A 3B0AA 3H7PB 1MG4A 3JYUA 3GZNB 4KV2A 1BUIC 5CHVC 4JQWC 1KF6B 3WA0A 4HJGE 2NBWB 1ROEA 2UYZB 2EMSA 3UF8A 4II2B 4RGOS 2XBBC 3B1LX 2PJHA 1NVID 1EU4A 2LFIA 4Q2JA 3P4RB 4RMAA 1UF0A 3KLSX 5D7GA 5JXVA 1WJ4A 2QIEB 3A4SC 5JZEB 4MM3A 3RD2A 2M56B 2IBIB 1E7UA 1PFDA 3N1XC 4JE3B 1FFVA 3PO0A 3BY4B 2L83A 3M62B 5C3JB 2DAJA 1XCTL 2RPVA 2EKIA 4RF0A 4G11A 4FHKA 3NVZA 4MM3B 3VTVA 5IP4D 1QF6A 3W5VB 2JT4B 4B0EA 4XDDA 2N9KA 2WX0A 4OVUA 2KDFB 4XC2A 1ZW7A 4EZJA 3KUDB 2JRIB 3CSFA 2KT7A 4CHKA 1MG8A 1TS4A 5HI1A 2BBCA 1V1PB 1YQ4B 3NHEB 2NPTB 3WAMA 3ZW3A 2KC2A 2KMMA 1SIFA 4G0NB 1WXMA 4OVVA 4A6QA 3I3TB 1IGCA 4ANUA 1WWTA 1L0YB 4MSQB 2JWZA 2DLBA 4IDIA 1R7SA 2MSED 3SEBA 5G55A 4YSZB 4GDKA 2ZVNA 3L0WB 3W1SC 1QT9A 4BBNF 2W3RA 4II3B 3OWEB 1KJTA 3PS6A 2J52A 3CSTA 2YEPF 3VVWB 3B2FA 4CO7A 3MP9A 3Q8BA 4I6LB 2QC8A 1PQSA 2BT6A 3B9JA 3L08A 1P1AA 3U7DA 1VR9A 2D11A 4REZA 5EE3A 4GDKB 2Z0EB 2DNFA 1ZP0B 2GBMA 2WP9B 5DPSA 1WJ6A 2MJEA 2N1WA 2IY1B 1BT0A 1V5TA 4MGKE 3PTFC 4E74A 2ACZB 2WXGA 3VR8B 3SD5A 3PSEB 2D10A 3V60A 5LXIB 3DPDA 4BKSD 2QJLA 3ZTCA 3X23A 4WJNA 4XYCA 3IVFA 3RCZA 1I4QA 5BYSA 4C7YA 2GI9A 1A5RA 3QA8A 1NDDA 3ZLZA 1FFUA 4MDKE 4TQ0A 1C1YB 1C77A 3RFZB 1E7VA 2LVPA 1T0RC 2KDEB 5AUIA 4EOYA 4F1SA 1XXGA 1E5WA 1LQBA 3ZDTA 3X0WA 2KLGA 2L00B 1WR6E 1BXTA 2N7JA 2J7QB 1WRIA 3L4PA 2LWPA 2VZKD 3RYTA 3ZNZB 3EA6A 4YWGG 3URYA 3MTNB 3V3XA 3P1MA 1ENFA 2PMVA 3ZGZA 1GUAB 1WGGA 4L2YA 4PT5A 3IAS1 1Q1OA 3CF6E 3DBHB 2J0MA 4HROA 1QQRA 2I1JA 3FILB 4WURA 4B9KA 4K1RB 1RM6C 3I57A 2IGHA 2SEBD 5EE9A 1TS5A 4BOZB 1UH6A 3RPFC 3SFDB 4USAA 2ON8A 5KHQA 2M0XA 1B9RA 3AE1B 3V6EB 3DBRI 2QDFA 4BOSC 2JRHA 4W9CA 1ZPSA 1LM8B 1WGKA 2INDC 4LK0M 2E3TA 3IHPC 3M3JA 2D3GA 2KAJA 3N20C 1P0RA 3DWMA 1FPYA 3EGRA 2WU2B 2KOXA 1FRDA 3Q3JA 3GE8C 1TGZB 3PZDA 4GIVA 2KJHB 3BK1A 2LGXA 1V97A 4UDUC 2GBKA 1KTKA 2JZZA 3HHMA 3V61A 2MQJA 5HG2A 3U7ZA 2LXAA 1L7YA 3AEGB 4IWOA 1UELA 1I4HA 3P2BA 1R4NB 1NBFC 3BYTB 2ZNVB 4NNJB 3V05A 2OHFA 3VUXA 3QJZA 1FXTB 3NZSA 3TSSA 3NVYA 4QAYA 5H92C 1XT9B 2IPKD 2LJ5A 4D2KA 5H8YE 2XEWA 1WY8A 2BW2A 1JW9D 1FNVA 3ZUNA 1GNUA 2D3AA 1DYQA 4MJSB 2KO3A 4P16A 2CKHB 2BYVE 2WX1A 3ZKJC 3APCA 4ICUA 3OAWA 4DHZB 4IC7B 1A70A 5DPTA 2Y5PA 2N0SB 2WNMA 3KWVA 4W9JA 3ZRCA 5JH5C 1HA5A 3SFEB 3AEEB 3FAHA 1F9JA 4LDTB 2WYQA 4ZDVA 4RGTA 1Q0WB 1J8CA 5D2MB 1RLFA 4JLCA 3PV1A 4G3XB 2KD0A 1WYGA 2QEJC 2CHXA 2GRIA 1VRAB 3IG3A 1I4PA 5T8IA 4URKA 3OJ4B 2ZPYA 4HDQA 1VDVA 2OOBB 2KFJA 1YN5A 3ZNID 3DBSA 1E0ZA 3AE8B 3VH4B 3PREA 1YX6B 3KYDD 5BMHA 3KH0A 3DHGC 2NBUA 1QZEA 2BGFA 2JY6A 2VRRB 2FUG1 3BINA 1GAQB 3CMMB 3DVGY 2PLPA 1E6EB 4EZKA 4IWQA 3HIZA 1MJDA 5D6JB 4S0RA 2M19A 2IY0B 1IGDA 2ONQA 2QCZA 1XEEA 2ZZPB 4WAFA 3B08A 1ZXIA 5FR3A 1KH0A 3T3OA 3VFKA 4NAWA 2KQ7A 2NMQA 3KWLA 1CMXB 3DVNU 1V2YA 4HCPB 3JSVA 3RN9C 3WIMA 4FLHA 1KM7A 1HZ5A 1H8CA 2AQ2B 4FA6A 3KUCB 4C4VA 2DX5B 4M8MA 1TT5B 1L4DB 3RULA 2H88B 3U52E 4M02A 2C7HA 2N9PC 1FM0D 3ENEA 2QSDA 3N32A 1YJJA 2G9HD 2ZW0A 1EWCA 4PYUA 3QK0A 1T3QA 4HVBA 3JSVB 2N7DA 1FCCC 1FRRA 2MRPA 1ZUD2 3W1SA 2RD0A 2RMMA 2KYWA 1FCLA 3KUZA 3N1YC 3Q2AC 4RF1A 4HPMB 1V9JA 2FIDA 4WWOA 5HFYA 2QILA 1WGHA 1JWUD 3Q3FA 2JWUA 1C79A 2D5GA 3H6NA 1TKYA 1WE6A 3ML8A 4C7ZA 2O2VA 2N1VA 1U4AA 1SE3A 4MH0E 3RNGC 2V3PA 4A8XC 4A90A 1Z5SB 3TEXA 2GBNA 4DXGA 4A3OA 2D07B 2BS4B 3U30A 3AEDB 4ANXA 5LXHA 4YT0B 2WXOA 3ZNGC 2O6VD 2WLBA 2MCNB 3O13A 1ZXHA 2O2VB 2AQ1B 2INNE 1K50A 2GLSA 1WFYA 1TJEA 4ZRPA 3NS1A 1F52A 4HKQA 2KLCA 2RGFA 4JWSC 1FXAA 4GMVA 1VZ7A 4WWPA 2BYEA 1WYWB 5I4DA 4ZOHC 2JXTA 4HDOA 3VUYA 3PZ7A 4ZRQA 3ETRA 1WXQA 2D2QA 4KZCA 2K9XA 2LMCA 1OTRB 4US8A 2WU5B 1KOTA 1YIWA 3DVNV 1RAXA 4C80A 3APDA 1NYRA 2K1FA 3C8YA 3DDCB 4GDLA 4ITKA 1ET6A 1VZ6A 1SE4A 4WH4A 4KGRA 1KRHA 3BZDB 2OJRA 2MHJA 1C3TA 2UU7A 3NG0A 3DBLB 4W9FA 1WXAA 4C00A 3NVWA 2KTFA 4DHZE 2LHEA 5J2RA 1YN3A 4MACA 2Y5CA 4GDLB 1TY2A 3B2GA 3N30A 3ML9A 1JWBD 2L0FA 3Q3NC 1WXSA 3FKYA 1NI2A 3RZFA 4DBGA 1GC6A 2PPHA 3AEAB 1D5XC 1EWYC 4LJOB 1TY0A 3HK0A 4MT5A 4ZRJA 1X1MA 2A4ZA 3PRPB 1DOIA 3R3MA 5IOIA 1C76A 3ZQ4A 3IBEA 3P42A 1L6UA 3U8ZA 1WZ3A 2QHOA 3QC8B 2ZEQA 5G5GA 3E56A 2VH1A 1R4MI 2PIAA 2G45B 5IAAC 4BVUC 3ECIA 3ZNHB 4IW0A 1TZOA 1UBIA 2BYFA 4WJOA 4N9F4 1E8WA 2JUOA 4HPPA 2KTRA 1FMAD 4IUMB 1AYFA 2NS5A 4DQOC 1S3SG 4K3BA 3NOBA 2BS3B 4S17A 5MPOA 3RNEC 3AULA 2FIFA 4XDCA 3TL5A 1ZGUB 1GB1A 2MBQA 1MHHE 1F77A 1KLGD 1MI0A 2MBEA 2JXXA 2M17A 4DHJD 2KTRB 1Y56A 4BBNC 3TEWA 2LVQA 4KDIC 4GN1A 1SGHA 1VD2A 3L13A 4WJQA 1F0ZA 3LXFA 2G4SA 2BVCA 2KWVB 4AJYB 3VTUA 2KWDA 1XQQA 1TS2A 1WM3A 2WXQA 2X8XX 2BB6A 2UWQA 1TKGA 4K7SA 2KDMA 4BZAA 4XWWA 3NVVA 2L52A 2ZCBA 1AW7A 1JRUA 2JU6X 2NVUI 1P98A 1WXVA 3AI5A 3C0RB 5LNK1 1WSPA 5IN7A 2LVOA 5EE0A 2G1EA 3Q8FA 2LZ6A 3Q8CA 3ZJUA 4C56C 2KMAA 2L7RA 4DK5A 1YX5B 1C9FA 3AE3B 3I5JC 1MPEA 3DHIC 3J9CA 3PHWB 3W2DA 4DXFA 2J4XA 2WXPA 2CU3A 5D3DA 2KFKA 5EE1A 2GMIC 3L54A 3P4PB 1J19A 2AL6A 1F1HA 1OGWA 2DYMA 4W9GA 3HVDA 1JWSD 2KXJA 3IXSA 2Z0DB 4HCNB 3W9CB 5DCNA 2KFKB 3EC8A 4B6WA 4AQ7A 3T3NA 1FIQA 2K3UA 5KHOA 3TJPA 3MHZA 2J0JA 2LGIA 4RCOA 4BAXA 2WDQB 1XLQA 3VDZA 1M94A 4J3OD 3JVZX 3ZJTA 2NTSA 3IAM1 4GB9A 1F2RC 2WDVB 4P6VF 1LFDA 2LHDA 5FR6A 2LRWA 2C7MB 2ICIA 2Q5WD 2KX0A 2ZVOA 2LASA 2L3ZA 1D4BA 1QOFA 3IFWB 2MA9B 2RDGA 3ONSA 4KSKC 2W3SA 1WGYA 1CJEA 1YMHE 3PHXB 2PEAA 2WXFA 1E10A 1L2NA 4J6IA 4MSMB 4LNOA 2C5LC 4DDGD 2NCNA 3T9LA 2INPE 4N59A 3TCAA 4X57B 3APFA 1IUEA 1JQ4A 2E6XA 4B0MA 1WRDB 4K3CA 1QILA 4RH6A 3K9PB 2GBRA 3AU5A 3A4RA 3EFCA 4IKGA 2AYOB 3AV8A 2D3BA 3SR6A 2HD5B 4MEMA 1P9DU 3LYYA 3SDLC 1QOGA 2L1AA 1WX9A 2KZRA 4LLGM 4NPNA 1PUTA 2PE6B 4BKTA 5AEKB 4KKIA 1WJNA 1WGDA 2CJOA 4DDID 3BK2A 1JMLA 4I6PA 4A3PA 1R4MB 4M01A 5G5HA 2Z59B 3GP7A 3A9KA 4FJZA 1MFWA 3W1YA 2KDBA 3MJWA 2KKCA 1HE8A 1RRBA 3W5UB 1N5WA
chains in the Genus database with same CATH topology
2NBWB 4FHJA 4HPMB 4NQLB 2WWZA 1V9JA 2FIDA 2UYZB 2EMSA 2AEHA 4TV3A 4A20A 3UQBA 2KJRA 4WWOA 3A1QA 3UF8A 1UZXB 3ZTDA 4II2B 1WGHA 4EZLA 1Q5WB 2KHWB 3Q3FA 2XBBC 3B1LX 5J17A 4NQKE 1TZ1A 2C7NB 2PJHA 4W9IA 3K9OB 2KK8A 5CTRC 4IWPA 4RMAA 3T8MA 4HJKA 3DVGX 4I6NB 5D7GA 1WJ4A 5AZFA 3A4SC 3H6NA 5CHFA 5JZEB 4E71A 1WE6A 4MM3A 4ZRIA 3ML8A 4HXDA 3RD2A 3EECA 2KMCA 4PS7A 2O2VA 4EFOA 2IBIB 1U4AA 2N1VA 1E7UA 1J0GA 4PYZA 3H1UA 3PT2B 4MH0E 4HPLB 1WIAA 3GZNI 4AWJA 3BY4B 3M62B 1WF9A 2DAJA 3H7SA 5J18A 2LD9A 3KYCD 1Z5SB 2GBNA 4G11A 2D07B 3ZO5B 3U30A 4A3OA 4FHKA 4AOFA 5JHBA 4PS8A 4LDTD 2PE9A 4ANXA 5LXHA 2N4FA 3ZNGC 2O6VD 1WH3A 2GOWA 3VTVA 3VAWA 2MX2A 2MCNB 2O2VB 2FNJB 2JT4B 2KN5A 2A5UA 2WX0A 4WWNA 2K25A 4OVUA 2KDFB 4XC2A 3UIPB 1WFYA 4FULA 1ZW7A 2N9XA 2DZIA 4EZJA 3KUDB 4LJPB 2KLCA 2RGFA 2C9WB 2MBOA 2JRIB 1RFAA 3CSFA 4GOCA 4GMVA 1V80A 4CHKA 4WWPA 2BYEA 1MG8A 1WYWB 1V86A 4HLEA 3NHEB 4HDOA 3QX1A 3LDZE 2NPTB 3VUWA 3WAMA 3ZW3A 3VUYA 2M4NA 2KC2A 4G0NB 1SIFA 1WXMA 4OVVA 3I3TB 1IP9A 2D2QA 2L8JA 4KZCA 4G50A 3M95A 2R2QA 2AWTA 4ANUA 1OTRB 1EF1A 2W9NA 2FCNA 4MSQB 2JWZA 3ZRFA 1KOTA 4K81A 1YIWA 2KJ6A 3DVNV 3HM3A 1GJZA 1WE7A 2J0KA 2MSED 1OEYJ 1RAXA 1UGMA 5G55A 4K7WA 4GDKA 2ZVNA 2BF8B 3L0WB 3W1SC 3APDA 2MWSB 2K1FA 4BBNF 4II3B 3DDCB 4GDLA 1KJTA 3PS6A 5L95C 3CSTA 1YD8U 2CHZA 4GGQA 3VVWB 4NAWB 2K6QA 3UINB 4CO7A 4IG7B 2IO2B 1OEYA 4F8CB 2OJRA 2KC1A 4I6LB 1C3TA 1PQSA 3L08A 1WJUA 1P1AA 3U7DA 4W9FA 2LI5A 1WXAA 2D11A 2DYOA 4GDKB 2Z0EB 4W9LA 1WGRA 2KTFA 4DHZE 2GBMA 4ANWA 1H4RA 1WM2A 5J2RA 3VHTC 4MJSA 2DZMA 2K8BA 4GDLB 5DPSA 2NBVB 3N30A 3ML9A 1WJ6A 3OLMD 2L0FA 1WXSA 2N1WA 1NI2A 2IY1B 1BT0A 1V5TA 2I1KA 4MGKE 3RZFA 4IM2A 3PTFC 4ZYNA 4P7IA 4DBGA 4E74A 1GC6A 1UD7A 2PPHA 2BKRB 3SD5A 2RR9A 1KLVA 4NY0A 4LJOB 2XK5A 2CHWA 3PSEB 2D10A 3HK0A 4MGYE 4ZRJA 3V60A 1X1MA 5BO4B 5LXIB 3DPDA 2A4ZA 3A9KB 3PRPB 3R3MA 5C23A 3UGBB 4BKSD 2N7EA 4JIOU 3ZTCA 2FUHB 3X23A 3QQ8B 3IBEA 3QWZB 2BWES 2MLBA 2O6VA 4WJNA 3U8ZA 1WZ3A 2L76A 3IVFA 4KDLB 3RCZA 3VTWA 4DXAB 2QHOA 3QC8B 2ZEQA 1A5RA 3TIXA 3NY5A 3WALA 2K39A 3RUIB 4WQOB 4W9HA 4NJ7A 2G3QB 3QA8A 4YL8A 3KVFB 1NDDA 1R4MI 3A1QB 4GU2A 4W9DA 2JVCA 4W9KA 3ZLZA 4MDKE 2CU1A 2G45B 2XK5B 4TQ0A 3DBLI 5IAAC 1AARA 1WX7A 2FAZA 4MGZE 4BVUC 1C1YB 3PLUA 4WAAA 3ECIA 1E7VA 1EUVB 1ZKHA 2KWUB 3AXCA 2LVPA 3UIOB 3ZNHB 4IW0A 5IA7A 2KDEB 1UBIA 3R66C 4EOYA 2HTHA 2BYFA 3ZDMC 4F1SA 4WJOA 2O6VB 4N9F4 1E5WA 1E8WA 1LQBA 2JUOA 3EHVA 3L10B 2KTRA 4W9EA 2IZVB 3X0WA 2KLGA 2L00B 2CS4A 1V49A 1WR6E 3PVLA 4IUMB 1E8ZA 2NS5A 2J7QB 1S3SG 3RZWC 3NOBA 2LWPA 2DYBA 3QAQA 3RYTA 3AULA 3UQAA 1EF5A 5CHWA 2FIFA 3ZNZB 3O65B 2MP2A 3OJ3A 3MTNB 1TTNA 2KX3A 3TL5A 2ASQA 1ZGUB 4BFRA 2MBQA 1GUAB 1WGGA 2FCSA 1V6EA 3JW0X 4B95A 4NJ6A 1S1QB 5DPRA 1D3ZA 1Q1OA 2RPQA 3CF6E 2J0MA 2MBEA 2RSUA 4WJPA 2JXXA 3MHSD 4ZRKA 2IO3B 2M17A 2I1JA 2R2OA 4DHJD 5E6OA 2KTRB 1WX8A 4B9KA 4K1RB 1WR1A 4BBNC 2LVQA 2EMTA 2DAFA 2MBBB 4KDIC 4GN1A 1SGHA 1VD2A 4PS3A 1UH6A 5TR5A 3S2AA 4BOZB 3L13A 4WJQA 4JGHB 5GMVA 2MP2B 1V5OA 5EDSA 4E3CA 4RM8A 3V62A 5CX3A 2G4SA 3PRMB 2KWVB 4FJVB 5D94A 1ISNA 2V3SA 4AJYB 5KHQA 3VTUA 2M0XA 1XQQA 1WM3A 2JPHA 3V6EB 4AJWA 1OQYA 3QIJA 4XZ4A 5L83A 3KW5B 3L16A 3DBRI 1Z2MA 2JZ3B 2Y5BB 4BOSC 2UWQA 4K7SA 2M8SA 2JRHA 4W9CA 2FCQA 3QHTA 1LM8B 1K8RB 2K6DB 2ZCBA 3IHPC 4GXBA 1JRUA 4FN2A 3WANA 2NVUI 3M3JA 2D3GA 2HJ8A 1YJ1A 3D32A 1P0RA 1P98A 1WXVA 3AI5A 3ALBA 5AZHA 3TBLD 2KOXA 1TBEA 3Q3JA 3C0RB 1TGZB 3SHQA 3PZDA 4GIVA 3ZDTA 2KJHB 2C60A 4GSWA 1T0YA 2LGXA 2LVOA 2ZJDA 3VH3B 4KSLC 2GBKA 2JZZA 3PRZA 2EKEC 3HHMA 3V61A 2LZ6A 2HE7A 2MQJA 5C1ZA 2LXAA 1L7YA 2MW5A 4IWOA 3HM6X 3QCAA 2KMAA 4TKNA 1LXDA 1SE9A 1UELA 3LJ3A 2L7RA 4DK5A 3P2BA 1YX5B 2BKFA 1NBFC 2YVCA 1WZ0A 2BWFA 3AU4A 2KANA 2ZNVB 4NNJB 2IYDB 2DZJA 3R7RA 1GG3A 2GBJA 4BKGA 4FADA 2NR2A 3VUXA 3PHWB 3QJZA 1FXTB 3NZSA 4RM9A 1XT9B 2KFKA 2LJ5A 2XEWA 4IM0A 1WY8A 2WDTB 2GMIC 1G6JA 3L54A 1I42A 1J19A 2AL6A 3ZUNA 1GNUA 3DQVA 5DPWA 1OGWA 4IM3A 4MJSB 2KWCA 3A9JA 3DCGA 2KO3A 1P3QU 2DYMA 5LLIA 2CKHB 2B3AA 2BYVE 2WX1A 5AZGA 4W9GA 3APCA 4ICUA 3OAWA 3ZKJC 1IPGA 4JL9A 2IO1B 2KXJA 3ZVVA 4DHZB 4IC7B 5DPTA 1V81A 2DZKA 4MGIE 2K8CA 3WAPA 4AP4C 2Z0DB 4HCNB 5HKHA 3L17A 4W9JA 3VXWA 5DCNA 2V4LA 3ZRCA 2KFKB 3EC8A 2KNBA 2KQSA 4B6WA 2LGYA 5JH5C 2REXA 5KHOA 3TJPA 1F9JA 2BPSA 4LDTB 2WYQA 1R4NI 2AL3A 4ZDVA 2L05A 1WMHA 2CR5A 1Q0WB 2J0JA 3A9JB 1J8CA 5D2MB 1RLFA 4JLCA 2IO0B 4LCDE 1XD3B 3PV1A 4G3XB 3M63B 2KD0A 3WAOA 4DWFA 3NS8A 1M94A 2CHXA 3VDZA 3IG3A 1I35A 4URKA 3GOEA 3NZUA 4K7UA 3JVZX 2N9EB 4CYEA 4GB9A 2V1YA 2LGDA 3OJ4B 4ANVA 2ZPYA 3SU8X 4HDQA 2G4DB 2OOBB 1LFDA 3QARA 2KFJA 3ZNID 5FR6A 3TMPB 3DBSA 2LRWA 2C7MB 4DHJB 4EKUA 2KX0A 2ZVOA 2LASA 3VH4B 2L3ZA 3PPAA 3V6CB 3PREA 1YX6B 1WMHB 5E6NA 3EFUA 1Y8RC 3KYDD 3IFWB 2MA9B 2DENB 3KH0A 3ONSA 4KSKC 1GC7A 1QZEA 2NBUA 4ICVA 1UBQA 2BGFA 2NPTA 1WGYA 1VCBA 2K8HA 3R7QA 2JY6A 2ZNVC 3PHXB 2VRRB 3BINA 2PEAA 3CMMB 1L2NA 4J6IA 3DVGY 4MSMB 2MBHA 4EZKA 4IWQA 3HIZA 5D6JB 4ASWC 2C5LC 2JF5A 2M1MA 2NCNA 3A33B 5E6PA 3T9LA 5G2NA 2IY0B 4DDGD 3VQIA 2ZZPB 3TCAA 4TQ1A 4X57B 1IYFA 3APFA 3B08A 4MELA 2LXCA 1WRDB 2DHZA 3VFKA 4NAWA 2KQ7A 3K9PB 4KVGB 2GBRA 4TUUA 1CMXB 1E8YA 3AU5A 3DVNU 3A4RA 4KIKA 5JHAA 3RT3B 1V2YA 4F7ZA 3ZIMA 2AYOB 2YLMA 2HD5B 3H9DA 3JSVA 3H7PA 4HCPB 4M0WB 3DBHI 3WIMA 4FLHA 4BKSA 1KM7A 1WI0A 1E90A 2KDIA 3PGEA 2LRUA 2LUEA 1P9DU 4HK2A 4MEMA 4AUQC 4FBJB 4HWIB 3SDLC 1WX9A 1H8CA 2KZRA 3N3KB 4NPNA 4FA6A 2PE6B 4BKTA 3KUCB 5AEKB 4M8NA 2DX5B 4M8MA 3PLVA 4EEWA 1WJNA 3RULA 1WGDA 2FCMA 4DDID 4FJYA 2C7HA 4KIKB 2N9PC 4KZ0A 3ENEA 4EUTA 3N32A 2L0TA 1YQBA 1EO6A 4I6PA 4PYUA 3QK0A 2ZCCA 4A3PA 3B0AA 4HVBA 3JSVB 3H7PB 2Z59B 3A9KA 4FJZA 2N7DA 3DOWA 3JYUA 1E8XA 3W1YA 2KDBA 2MRPA 4KV2A 3W1SA 2RD0A 3MJWA 2KKCA 5CHVC 3KUZA 1HE8A 2KVRA 2ZPNA 4JQWC 3WA0A 1RRBA 4XX5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2NBW B;  4FHJ A;  4HPM B;  4NQL B;  2WWZ A;  1V9J A;  2FID A;  2UYZ B;  2EMS A;  2AEH A;  4TV3 A;  4A20 A;  3UQB A;  2KJR A;  4WWO A;  3A1Q A;  3UF8 A;  1UZX B;  3ZTD A;  4II2 B;  1WGH A;  4EZL A;  1Q5W B;  2KHW B;  3Q3F A;  2XBB C;  3B1L X;  5J17 A;  4NQK E;  1TZ1 A;  2C7N B;  2PJH A;  4W9I A;  3K9O B;  2KK8 A;  5CTR C;  4IWP A;  4RMA A;  3T8M A;  4HJK A;  3DVG X;  4I6N B;  5D7G A;  1WJ4 A;  5AZF A;  3A4S C;  3H6N A;  5CHF A;  5JZE B;  4E71 A;  1WE6 A;  4MM3 A;  4ZRI A;  3ML8 A;  4HXD A;  3RD2 A;  3EEC A;  2KMC A;  4PS7 A;  2O2V A;  4EFO A;  2IBI B;  1U4A A;  2N1V A;  1E7U A;  1J0G A;  4PYZ A;  3H1U A;  3PT2 B;  4MH0 E;  4HPL B;  1WIA A;  3GZN I;  4AWJ A;  3BY4 B;  3M62 B;  1WF9 A;  2DAJ A;  3H7S A;  5J18 A;  2LD9 A;  3KYC D;  1Z5S B;  2GBN A;  4G11 A;  2D07 B;  3ZO5 B;  3U30 A;  4A3O A;  4FHK A;  4AOF A;  5JHB A;  4PS8 A;  4LDT D;  2PE9 A;  4ANX A;  5LXH A;  2N4F A;  3ZNG C;  2O6V D;  1WH3 A;  2GOW A;  3VTV A;  3VAW A;  2MX2 A;  2MCN B;  2O2V B;  2FNJ B;  2JT4 B;  2KN5 A;  2A5U A;  2WX0 A;  4WWN A;  2K25 A;  4OVU A;  2KDF B;  4XC2 A;  3UIP B;  1WFY A;  4FUL A;  1ZW7 A;  2N9X A;  2DZI A;  4EZJ A;  3KUD B;  4LJP B;  2KLC A;  2RGF A;  2C9W B;  2MBO A;  2JRI B;  1RFA A;  3CSF A;  4GOC A;  4GMV A;  1V80 A;  4CHK A;  4WWP A;  2BYE A;  1MG8 A;  1WYW B;  1V86 A;  4HLE A;  3NHE B;  4HDO A;  3QX1 A;  3LDZ E;  2NPT B;  3VUW A;  3WAM A;  3ZW3 A;  3VUY A;  2M4N A;  2KC2 A;  4G0N B;  1SIF A;  1WXM A;  4OVV A;  3I3T B;  1IP9 A;  2D2Q A;  2L8J A;  4KZC A;  4G50 A;  3M95 A;  2R2Q A;  2AWT A;  4ANU A;  1OTR B;  1EF1 A;  2W9N A;  2FCN A;  4MSQ B;  2JWZ A;  3ZRF A;  1KOT A;  4K81 A;  1YIW A;  2KJ6 A;  3DVN V;  3HM3 A;  1GJZ A;  1WE7 A;  2J0K A;  2MSE D;  1OEY J;  1RAX A;  1UGM A;  5G55 A;  4K7W A;  4GDK A;  2ZVN A;  2BF8 B;  3L0W B;  3W1S C;  3APD A;  2MWS B;  2K1F A;  4BBN F;  4II3 B;  3DDC B;  4GDL A;  1KJT A;  3PS6 A;  5L95 C;  3CST A;  1YD8 U;  2CHZ A;  4GGQ A;  3VVW B;  4NAW B;  2K6Q A;  3UIN B;  4CO7 A;  4IG7 B;  2IO2 B;  1OEY A;  4F8C B;  2OJR A;  2KC1 A;  4I6L B;  1C3T A;  1PQS A;  3L08 A;  1WJU A;  1P1A A;  3U7D A;  4W9F A;  2LI5 A;  1WXA A;  2D11 A;  2DYO A;  4GDK B;  2Z0E B;  4W9L A;  1WGR A;  2KTF A;  4DHZ E;  2GBM A;  4ANW A;  1H4R A;  1WM2 A;  5J2R A;  3VHT C;  4MJS A;  2DZM A;  2K8B A;  4GDL B;  5DPS A;  2NBV B;  3N30 A;  3ML9 A;  1WJ6 A;  3OLM D;  2L0F A;  1WXS A;  2N1W A;  1NI2 A;  2IY1 B;  1BT0 A;  1V5T A;  2I1K A;  4MGK E;  3RZF A;  4IM2 A;  3PTF C;  4ZYN A;  4P7I A;  4DBG A;  4E74 A;  1GC6 A;  1UD7 A;  2PPH A;  2BKR B;  3SD5 A;  2RR9 A;  1KLV A;  4NY0 A;  4LJO B;  2XK5 A;  2CHW A;  3PSE B;  2D10 A;  3HK0 A;  4MGY E;  4ZRJ A;  3V60 A;  1X1M A;  5BO4 B;  5LXI B;  3DPD A;  2A4Z A;  3A9K B;  3PRP B;  3R3M A;  5C23 A;  3UGB B;  4BKS D;  2N7E A;  4JIO U;  3ZTC A;  2FUH B;  3X23 A;  3QQ8 B;  3IBE A;  3QWZ B;  2BWE S;  2MLB A;  2O6V A;  4WJN A;  3U8Z A;  1WZ3 A;  2L76 A;  3IVF A;  4KDL B;  3RCZ A;  3VTW A;  4DXA B;  2QHO A;  3QC8 B;  2ZEQ A;  1A5R A;  3TIX A;  3NY5 A;  3WAL A;  2K39 A;  3RUI B;  4WQO B;  4W9H A;  4NJ7 A;  2G3Q B;  3QA8 A;  4YL8 A;  3KVF B;  1NDD A;  1R4M I;  3A1Q B;  4GU2 A;  4W9D A;  2JVC A;  4W9K A;  3ZLZ A;  4MDK E;  2CU1 A;  2G45 B;  2XK5 B;  4TQ0 A;  3DBL I;  5IAA C;  1AAR A;  1WX7 A;  2FAZ A;  4MGZ E;  4BVU C;  1C1Y B;  3PLU A;  4WAA A;  3ECI A;  1E7V A;  1EUV B;  1ZKH A;  2KWU B;  3AXC A;  2LVP A;  3UIO B;  3ZNH B;  4IW0 A;  5IA7 A;  2KDE B;  1UBI A;  3R66 C;  4EOY A;  2HTH A;  2BYF A;  3ZDM C;  4F1S A;  4WJO A;  2O6V B;  4N9F 4;  1E5W A;  1E8W A;  1LQB A;  2JUO A;  3EHV A;  3L10 B;  2KTR A;  4W9E A;  2IZV B;  3X0W A;  2KLG A;  2L00 B;  2CS4 A;  1V49 A;  1WR6 E;  3PVL A;  4IUM B;  1E8Z A;  2NS5 A;  2J7Q B;  1S3S G;  3RZW C;  3NOB A;  2LWP A;  2DYB A;  3QAQ A;  3RYT A;  3AUL A;  3UQA A;  1EF5 A;  5CHW A;  2FIF A;  3ZNZ B;  3O65 B;  2MP2 A;  3OJ3 A;  3MTN B;  1TTN A;  2KX3 A;  3TL5 A;  2ASQ A;  1ZGU B;  4BFR A;  2MBQ A;  1GUA B;  1WGG A;  2FCS A;  1V6E A;  3JW0 X;  4B95 A;  4NJ6 A;  1S1Q B;  5DPR A;  1D3Z A;  1Q1O A;  2RPQ A;  3CF6 E;  2J0M A;  2MBE A;  2RSU A;  4WJP A;  2JXX A;  3MHS D;  4ZRK A;  2IO3 B;  2M17 A;  2I1J A;  2R2O A;  4DHJ D;  5E6O A;  2KTR B;  1WX8 A;  4B9K A;  4K1R B;  1WR1 A;  4BBN C;  2LVQ A;  2EMT A;  2DAF A;  2MBB B;  4KDI C;  4GN1 A;  1SGH A;  1VD2 A;  4PS3 A;  1UH6 A;  5TR5 A;  3S2A A;  4BOZ B;  3L13 A;  4WJQ A;  4JGH B;  5GMV A;  2MP2 B;  1V5O A;  5EDS A;  4E3C A;  4RM8 A;  3V62 A;  5CX3 A;  2G4S A;  3PRM B;  2KWV B;  4FJV B;  5D94 A;  1ISN A;  2V3S A;  4AJY B;  5KHQ A;  3VTU A;  2M0X A;  1XQQ A;  1WM3 A;  2JPH A;  3V6E B;  4AJW A;  1OQY A;  3QIJ A;  4XZ4 A;  5L83 A;  3KW5 B;  3L16 A;  3DBR I;  1Z2M A;  2JZ3 B;  2Y5B B;  4BOS C;  2UWQ A;  4K7S A;  2M8S A;  2JRH A;  4W9C A;  2FCQ A;  3QHT A;  1LM8 B;  1K8R B;  2K6D B;  2ZCB A;  3IHP C;  4GXB A;  1JRU A;  4FN2 A;  3WAN A;  2NVU I;  3M3J A;  2D3G A;  2HJ8 A;  1YJ1 A;  3D32 A;  1P0R A;  1P98 A;  1WXV A;  3AI5 A;  3ALB A;  5AZH A;  3TBL D;  2KOX A;  1TBE A;  3Q3J A;  3C0R B;  1TGZ B;  3SHQ A;  3PZD A;  4GIV A;  3ZDT A;  2KJH B;  2C60 A;  4GSW A;  1T0Y A;  2LGX A;  2LVO A;  2ZJD A;  3VH3 B;  4KSL C;  2GBK A;  2JZZ A;  3PRZ A;  2EKE C;  3HHM A;  3V61 A;  2LZ6 A;  2HE7 A;  2MQJ A;  5C1Z A;  2LXA A;  1L7Y A;  2MW5 A;  4IWO A;  3HM6 X;  3QCA A;  2KMA A;  4TKN A;  1LXD A;  1SE9 A;  1UEL A;  3LJ3 A;  2L7R A;  4DK5 A;  3P2B A;  1YX5 B;  2BKF A;  1NBF C;  2YVC A;  1WZ0 A;  2BWF A;  3AU4 A;  2KAN A;  2ZNV B;  4NNJ B;  2IYD B;  2DZJ A;  3R7R A;  1GG3 A;  2GBJ A;  4BKG A;  4FAD A;  2NR2 A;  3VUX A;  3PHW B;  3QJZ A;  1FXT B;  3NZS A;  4RM9 A;  1XT9 B;  2KFK A;  2LJ5 A;  2XEW A;  4IM0 A;  1WY8 A;  2WDT B;  2GMI C;  1G6J A;  3L54 A;  1I42 A;  1J19 A;  2AL6 A;  3ZUN A;  1GNU A;  3DQV A;  5DPW A;  1OGW A;  4IM3 A;  4MJS B;  2KWC A;  3A9J A;  3DCG A;  2KO3 A;  1P3Q U;  2DYM A;  5LLI A;  2CKH B;  2B3A A;  2BYV E;  2WX1 A;  5AZG A;  4W9G A;  3APC A;  4ICU A;  3OAW A;  3ZKJ C;  1IPG A;  4JL9 A;  2IO1 B;  2KXJ A;  3ZVV A;  4DHZ B;  4IC7 B;  5DPT A;  1V81 A;  2DZK A;  4MGI E;  2K8C A;  3WAP A;  4AP4 C;  2Z0D B;  4HCN B;  5HKH A;  3L17 A;  4W9J A;  3VXW A;  5DCN A;  2V4L A;  3ZRC A;  2KFK B;  3EC8 A;  2KNB A;  2KQS A;  4B6W A;  2LGY A;  5JH5 C;  2REX A;  5KHO A;  3TJP A;  1F9J A;  2BPS A;  4LDT B;  2WYQ A;  1R4N I;  2AL3 A;  4ZDV A;  2L05 A;  1WMH A;  2CR5 A;  1Q0W B;  2J0J A;  3A9J B;  1J8C A;  5D2M B;  1RLF A;  4JLC A;  2IO0 B;  4LCD E;  1XD3 B;  3PV1 A;  4G3X B;  3M63 B;  2KD0 A;  3WAO A;  4DWF A;  3NS8 A;  1M94 A;  2CHX A;  3VDZ A;  3IG3 A;  1I35 A;  4URK A;  3GOE A;  3NZU A;  4K7U A;  3JVZ X;  2N9E B;  4CYE A;  4GB9 A;  2V1Y A;  2LGD A;  3OJ4 B;  4ANV A;  2ZPY A;  3SU8 X;  4HDQ A;  2G4D B;  2OOB B;  1LFD A;  3QAR A;  2KFJ A;  3ZNI D;  5FR6 A;  3TMP B;  3DBS A;  2LRW A;  2C7M B;  4DHJ B;  4EKU A;  2KX0 A;  2ZVO A;  2LAS A;  3VH4 B;  2L3Z A;  3PPA A;  3V6C B;  3PRE A;  1YX6 B;  1WMH B;  5E6N A;  3EFU A;  1Y8R C;  3KYD D;  3IFW B;  2MA9 B;  2DEN B;  3KH0 A;  3ONS A;  4KSK C;  1GC7 A;  1QZE A;  2NBU A;  4ICV A;  1UBQ A;  2BGF A;  2NPT A;  1WGY A;  1VCB A;  2K8H A;  3R7Q A;  2JY6 A;  2ZNV C;  3PHX B;  2VRR B;  3BIN A;  2PEA A;  3CMM B;  1L2N A;  4J6I A;  3DVG Y;  4MSM B;  2MBH A;  4EZK A;  4IWQ A;  3HIZ A;  5D6J B;  4ASW C;  2C5L C;  2JF5 A;  2M1M A;  2NCN A;  3A33 B;  5E6P A;  3T9L A;  5G2N A;  2IY0 B;  4DDG D;  3VQI A;  2ZZP B;  3TCA A;  4TQ1 A;  4X57 B;  1IYF A;  3APF A;  3B08 A;  4MEL A;  2LXC A;  1WRD B;  2DHZ A;  3VFK A;  4NAW A;  2KQ7 A;  3K9P B;  4KVG B;  2GBR A;  4TUU A;  1CMX B;  1E8Y A;  3AU5 A;  3DVN U;  3A4R A;  4KIK A;  5JHA A;  3RT3 B;  1V2Y A;  4F7Z A;  3ZIM A;  2AYO B;  2YLM A;  2HD5 B;  3H9D A;  3JSV A;  3H7P A;  4HCP B;  4M0W B;  3DBH I;  3WIM A;  4FLH A;  4BKS A;  1KM7 A;  1WI0 A;  1E90 A;  2KDI A;  3PGE A;  2LRU A;  2LUE A;  1P9D U;  4HK2 A;  4MEM A;  4AUQ C;  4FBJ B;  4HWI B;  3SDL C;  1WX9 A;  1H8C A;  2KZR A;  3N3K B;  4NPN A;  4FA6 A;  2PE6 B;  4BKT A;  3KUC B;  5AEK B;  4M8N A;  2DX5 B;  4M8M A;  3PLV A;  4EEW A;  1WJN A;  3RUL A;  1WGD A;  2FCM A;  4DDI D;  4FJY A;  2C7H A;  4KIK B;  2N9P C;  4KZ0 A;  3ENE A;  4EUT A;  3N32 A;  2L0T A;  1YQB A;  1EO6 A;  4I6P A;  4PYU A;  3QK0 A;  2ZCC A;  4A3P A;  3B0A A;  4HVB A;  3JSV B;  3H7P B;  2Z59 B;  3A9K A;  4FJZ A;  2N7D A;  3DOW A;  3JYU A;  1E8X A;  3W1Y A;  2KDB A;  2MRP A;  4KV2 A;  3W1S A;  2RD0 A;  3MJW A;  2KKC A;  5CHV C;  3KUZ A;  1HE8 A;  2KVR A;  2ZPN A;  4JQW C;  3WA0 A;  1RRB A;  4XX5 A; 
#chains in the Genus database with same CATH topology
 1HEZ E;  2CJN A;  2WXR A;  4RNA A;  4ARC A;  1FXI A;  4FHJ A;  1F2R I;  4TV3 A;  3UQB A;  2KJR A;  3A1Q A;  1UZX B;  2JYE A;  3U2S C;  1Q5W B;  2WDR B;  5IKC M;  1ET9 A;  2C7N B;  4W9I A;  1FD6 A;  1YJI A;  2FBW B;  2KK8 A;  1MVK A;  4IWP A;  4HJK A;  2I38 A;  5AZF A;  1D5Z C;  5CHF A;  4E71 A;  1LO5 D;  4ZRI A;  4AS1 A;  4HXD A;  3EEC A;  4PS7 A;  3H8H A;  1J0G A;  4PYZ A;  1SSN A;  3H1U A;  3PT2 B;  1QKZ A;  3GZN I;  4AWJ A;  2EEL A;  1AN8 A;  2JX5 A;  2KVZ A;  3EUB 2;  1SB3 C;  3TEY A;  2LD9 A;  1TIF A;  3AE7 B;  4PS8 A;  4LDT D;  2PE9 A;  2N4F A;  1WH3 A;  2GOW A;  3N1Z C;  2MX2 A;  3DWG C;  2FNJ B;  3N9Y C;  3RNA C;  1NI3 A;  1K52 A;  2WXH A;  4OW0 A;  4FUL A;  2N9X A;  3AH7 A;  4LJP B;  4OZB A;  1JCK B;  1RFA A;  4JX1 C;  4GOC A;  3NRZ A;  1PGB A;  1V80 A;  5D3I B;  4MH8 A;  3Q8E A;  2N9L A;  1V86 A;  1QLB B;  3BVG A;  1ZDV A;  3LDZ E;  3QX1 A;  3NZ3 A;  1GPX A;  2L8J A;  2PVG C;  1EF1 A;  2FCN A;  2KJ6 A;  3HM3 A;  1WE7 A;  1OEY J;  1UGM A;  5BMG A;  3AN1 A;  4K7W A;  5BMI A;  3Q6B A;  2MWS B;  2K22 A;  1XLO A;  2CHZ A;  4NAW B;  3UIN B;  4IG7 B;  4JWU C;  3GB1 A;  2IO2 B;  3FC4 A;  2KC1 A;  1C4A A;  3AE6 B;  3BVM A;  2LI5 A;  1PYW D;  2DYO A;  1UGJ A;  2PTL A;  2FE8 A;  4YTN B;  3VHT C;  3MJ5 A;  2DZM A;  3OLM D;  4C4V B;  2I1K A;  2YEP B;  4ZYN A;  1UD7 A;  2BKR B;  2MJD A;  3NJT A;  1KLV A;  4NY0 A;  2XK5 A;  5BYQ A;  2CHW A;  5BO4 B;  3RNF C;  4KX6 B;  3UGB B;  2JYT A;  2MLB A;  2O6V A;  1L0V B;  2L76 A;  3HVZ A;  2V9H A;  4KDL B;  1SJH D;  4L23 A;  4P1C C;  3WAL A;  2K39 A;  3RUI B;  4WQO B;  2WXK A;  4NJ7 A;  2G3Q B;  2XNA C;  4YL8 A;  3KVF B;  1P7F A;  4GU2 A;  4W9D A;  4W9K A;  2XK5 B;  1AAR A;  1WX7 A;  1N61 A;  2FAZ A;  1FEH A;  3AXC A;  3AM9 A;  3R66 C;  2HTH A;  3ZDM C;  3DBR B;  2O6V B;  3EHV A;  4HRS A;  4CQN A;  2IZV B;  2CS4 A;  4ARI A;  3VR9 B;  1UNS A;  3RZW C;  1HXY D;  2DYB A;  5CHW A;  2WGS A;  3OJ3 A;  4ACF A;  1TTN A;  3Q69 A;  2KX3 A;  2V4I B;  1T0Q C;  2ASQ A;  4BFR A;  2FCS A;  1V6E A;  1S1Q B;  2WXN A;  3AB5 A;  1DGJ A;  4NJC A;  1IBX A;  1WR1 A;  2EMT A;  2DAF A;  2MBB B;  4PS3 A;  3OG5 A;  1TYG B;  2IGD A;  3ZXR A;  4FJV B;  2V3S A;  1T0S C;  2LGS A;  3P4Q B;  4KGT A;  3QIJ A;  4XZ4 A;  5L83 A;  3KW5 B;  4LNN A;  1Z2M A;  2J42 A;  2X38 A;  1OQR A;  1VZ8 A;  2FCQ A;  1L0X B;  3QHT A;  2K6D B;  1IBX B;  4GXB A;  1MHX A;  4FN2 A;  3AE9 B;  3D32 A;  4YTP B;  5TSS A;  2HJ1 A;  2MEK A;  1JWA D;  4GSW A;  2ZJD A;  2OJW A;  4KSL C;  3PRZ A;  2NTT A;  1SIJ A;  5C1Z A;  2MW5 A;  1SE9 A;  2XN9 C;  2YVC A;  1WZ0 A;  2KAN A;  4YSX B;  2IYD B;  2DZJ A;  3R7R A;  1FNU A;  4BKG A;  4OZA A;  3E9S A;  4RM9 A;  1JWM D;  1J7A A;  4JPS A;  1JRO A;  4IM0 A;  2WDT B;  4KGS A;  1G6J A;  1I42 A;  2DWQ A;  5DPW A;  2BQQ A;  3AE2 B;  2KWC A;  3A9J A;  4ZYS A;  1P3Q U;  5LLI A;  1YQ3 B;  3U4E G;  1T6B X;  1L5P A;  2IO1 B;  4LNK A;  1V81 A;  3ZXV A;  4MGI E;  2K8C A;  3WAP A;  2K0P A;  5HKH A;  1KFY B;  3L17 A;  5FK9 C;  3VXW A;  2KNB A;  2LGY A;  4KKJ A;  1I4G A;  2BPS A;  1R4N I;  2AL3 A;  2L05 A;  2CR5 A;  1CQV A;  3A9J B;  2IO0 B;  4LCD E;  3WAO A;  3AEF B;  3NS8 A;  1SXT A;  3NZU A;  4K7U A;  4CYE A;  1C4P A;  2LGD A;  5BYR A;  3SU8 X;  2G4D B;  3QAR A;  3CIR B;  4RGN A;  3TMP B;  1C4C A;  4DHJ B;  2D3C A;  2W82 A;  4EKU A;  3PPA A;  5E6N A;  3EFU A;  1Y8R C;  1PDX A;  3R8B A;  1RFK A;  3Q8A A;  1V1P A;  4ICV A;  2HTM E;  2NPT A;  2K8H A;  3R7Q A;  1TS3 A;  4RGM A;  2MBH A;  2KAC A;  2JF5 A;  4M0W A;  3A33 B;  5E6P A;  1GB4 A;  5G2N A;  1XLN A;  3R2T A;  2QMT A;  1K51 A;  4TQ1 A;  1IYF A;  1D6E C;  1C78 A;  3I9V 1;  4KVG B;  4TUU A;  1E8Y A;  3ZYY X;  3RT3 B;  2R61 A;  2YLM A;  4M0W B;  3WCQ A;  4BKS A;  2H89 B;  1WI0 A;  1E90 A;  2KDI A;  3PGE A;  4HK2 A;  4AUQ C;  3IT4 B;  1SEB D;  4HWI B;  3MFG A;  1ZDX A;  1NEK B;  3TUO A;  4M8N A;  1OFF A;  2WXM A;  3PLV A;  1NYQ A;  1CK1 A;  4YTM B;  2FCM A;  1N63 A;  4FJY A;  3ZJV A;  2BTE A;  2L0T A;  1YQB A;  3KQ4 A;  4OVZ A;  3AEC B;  3DOW A;  3VRA B;  1E8X A;  1RWS A;  4TSS A;  2PVO D;  2KN4 A;  2KVR A;  2ZPN A;  3NUH B;  1I4R A;  4XX5 A;  2Y3A A;  1GOZ A;  4NQL B;  2WWZ A;  4R3D A;  2AEH A;  4A20 A;  1DOY A;  3Q3O C;  3ZTD A;  1FO4 A;  1T5X D;  4EZL A;  2KHW B;  5J17 A;  4NQK E;  1TZ1 A;  3UI3 A;  2J53 A;  3K9O B;  1EM7 A;  5CTR C;  4RFB A;  4H2A A;  3T8M A;  2BYT A;  3DVG X;  4I6N B;  2W54 A;  2VZK B;  4YSY B;  2KMC A;  4EFO A;  3GS2 A;  2MH7 A;  4HPL B;  1WIA A;  1OQQ A;  5C2T B;  1HQR D;  1WF9 A;  3H7S A;  5J18 A;  3KYC D;  4A55 A;  3ZO5 B;  3FIL A;  4AOF A;  4IOI E;  5JHB A;  1YN4 A;  3BVZ A;  2LUM A;  3VAW A;  4N6E B;  1BML C;  3AE4 B;  3AMZ A;  3TEZ A;  2KN5 A;  2A5U A;  4WWN A;  2K25 A;  1AWD A;  4HKZ E;  3UIP B;  2M0A A;  2DZI A;  5IO9 A;  2JQR B;  2AX5 A;  2C9W B;  2MBO A;  4P1B C;  1Q10 A;  4HLE A;  2KQ4 X;  3VUW A;  2M4N A;  1ZE3 D;  1IP9 A;  1J7C A;  4G50 A;  3M95 A;  3R2I A;  2R2Q A;  2AWT A;  2W9N A;  3ZRF A;  1XF5 L;  4K81 A;  1QOA A;  1GJZ A;  2K5P A;  1ACC A;  2J0K A;  4NZL B;  2HDE A;  1PGX A;  2BF8 B;  5L95 C;  3AEB B;  1YD8 U;  4GGQ A;  2K6Q A;  3RNC C;  1OEY A;  4F8C B;  2IDY A;  1WJU A;  1B1Z A;  4W9L A;  1WGR A;  4ANW A;  1H4R A;  1WM2 A;  4MJS A;  2K8B A;  2NBV B;  1VJK A;  4XE0 A;  4IM2 A;  4P7I A;  1YNT E;  2PKO A;  2RR9 A;  4MGY E;  3A9K B;  2SAK A;  5C23 A;  1CZP A;  1P7E A;  2N7E A;  4JIO U;  2FUH B;  3QQ8 B;  4WIP A;  1SF0 A;  3QWZ B;  2BWE S;  2JSV X;  3VTW A;  3RNB C;  4DXA B;  1NEN B;  3TIX A;  2ZW1 A;  3IT6 B;  3NY5 A;  2IGG A;  1N6Z A;  4W9H A;  1EU3 A;  3A1Q B;  2JVC A;  2CU1 A;  3DBL I;  1SJE D;  4YXD B;  1JAL A;  4MGZ E;  1XO3 A;  3PLU A;  4WAA A;  3MC9 A;  1EUV B;  1ZKH A;  2KWU B;  3UIO B;  5IA7 A;  4W9E A;  3L10 B;  3PVL A;  1V49 A;  2LJI A;  1E8Z A;  4WQM A;  3QAQ A;  3UQA A;  1EF5 A;  3O65 B;  2MP2 A;  1FNW A;  1XCQ L;  1I4X A;  1YOV B;  2TSS A;  2INC C;  3HUI A;  3Q14 C;  3JW0 X;  4B95 A;  4NJ6 A;  5DPR A;  1D3Z A;  1JRP A;  2RPQ A;  1KLU D;  4WJP A;  2RSU A;  2Z8L A;  1N62 A;  3MHS D;  3DHH C;  4ZRK A;  2IO3 B;  2R2O A;  5E6O A;  1WX8 A;  3MC0 B;  5TR5 A;  3S2A A;  2WS3 B;  4JGH B;  5GMV A;  2MP2 B;  1V5O A;  5EDS A;  4E3C A;  4RM8 A;  3RMK C;  5CX3 A;  2JZP A;  1N60 A;  3V62 A;  1M4V A;  5D94 A;  3PRM B;  1ISN A;  1ZOY B;  2JPH A;  4AJW A;  2L32 A;  1OQY A;  4US9 A;  3BWU D;  3L16 A;  2JZ3 B;  2Y5B B;  2M8S A;  3BYY B;  1K8R B;  3VRB B;  1DOX A;  3WAN A;  1HTQ A;  2HJ8 A;  1YJ1 A;  3BII D;  3ALB A;  5AZH A;  3TBL D;  1TBE A;  2WXL A;  3SHQ A;  2C60 A;  1T0Y A;  1V8C A;  3VH3 B;  4TMA B;  2EKE C;  2HE7 A;  3CWI A;  1STE A;  4LNI A;  4ZHP A;  3HM6 X;  3QCA A;  3C19 A;  4TKN A;  1LXD A;  3LJ3 A;  2BKF A;  4M00 A;  2BWF A;  3AU4 A;  2WXI A;  3P63 A;  1GG3 A;  2GBJ A;  4N58 A;  4FAD A;  2NR2 A;  2WHI A;  3RI7 C;  5GXG B;  3DQV A;  4IM3 A;  2OED A;  2VH2 A;  3DCG A;  1TKE A;  2B3A A;  4NAM A;  5AZG A;  1IPG A;  4JL9 A;  3ZVV A;  4GLS C;  2V3N A;  1RYJ A;  2DZK A;  3HRD D;  4AP4 C;  1PGA A;  2V4L A;  2KQS A;  1J7B A;  1L6V A;  2V0G A;  2REX A;  2GB1 A;  1WMH A;  3GE3 C;  1SE2 A;  4OZC A;  1XD3 B;  1I7H A;  3M63 B;  1VLB A;  2RDB C;  4DWF A;  1I35 A;  3GOE A;  2WQY B;  2N9E B;  3Q3M C;  2V1Y A;  3PZ8 A;  4ANV A;  1QOB A;  2MJ3 A;  5FKA C;  3P4S B;  3V6C B;  1WMH B;  4XWT A;  2DEN B;  4EE2 A;  4WWM A;  4O1N A;  1GC7 A;  4PK1 A;  2B76 B;  1UBQ A;  1VCB A;  2RDH A;  1V1O A;  2BB5 A;  2ZNV C;  5AUK A;  4A9A A;  2LEK A;  4XGA B;  1K53 A;  4ASW C;  2M1M A;  5HHD G;  3VQI A;  3MC8 A;  4L1B A;  4LNF A;  1E9M A;  1HZ6 A;  3I63 C;  1UWX A;  2W55 A;  4MEL A;  1XLP A;  2LXC A;  2DHZ A;  2I2Y A;  2AQ3 B;  2IJ0 A;  3LB8 C;  3ABV B;  2WXJ A;  4KIK A;  5JHA A;  4FXC A;  4F7Z A;  1E7P B;  3ZIM A;  4ZHO A;  1LGR A;  1SBB B;  3H9D A;  3H7P A;  4HEA 1;  1D5M C;  3DBH I;  2LRU A;  2LUE A;  4FBJ B;  1HTO A;  1N5X A;  1L4Z B;  3N3K B;  1ESF A;  4EEW A;  1UWM A;  1UUP A;  4OHJ A;  5E6J A;  2DBY A;  4KIK B;  4LTU A;  2BS2 B;  4KZ0 A;  4EUT A;  1EO6 A;  3AE5 B;  2ZCC A;  2PW9 A;  3B0A A;  3H7P B;  1MG4 A;  3JYU A;  3GZN B;  4KV2 A;  1BUI C;  5CHV C;  4JQW C;  1KF6 B;  3WA0 A;  4HJG E;  2NBW B;  1ROE A;  2UYZ B;  2EMS A;  3UF8 A;  4II2 B;  4RGO S;  2XBB C;  3B1L X;  2PJH A;  1NVI D;  1EU4 A;  2LFI A;  4Q2J A;  3P4R B;  4RMA A;  1UF0 A;  3KLS X;  5D7G A;  5JXV A;  1WJ4 A;  2QIE B;  3A4S C;  5JZE B;  4MM3 A;  3RD2 A;  2M56 B;  2IBI B;  1E7U A;  1PFD A;  3N1X C;  4JE3 B;  1FFV A;  3PO0 A;  3BY4 B;  2L83 A;  3M62 B;  5C3J B;  2DAJ A;  1XCT L;  2RPV A;  2EKI A;  4RF0 A;  4G11 A;  4FHK A;  3NVZ A;  4MM3 B;  3VTV A;  5IP4 D;  1QF6 A;  3W5V B;  2JT4 B;  4B0E A;  4XDD A;  2N9K A;  2WX0 A;  4OVU A;  2KDF B;  4XC2 A;  1ZW7 A;  4EZJ A;  3KUD B;  2JRI B;  3CSF A;  2KT7 A;  4CHK A;  1MG8 A;  1TS4 A;  5HI1 A;  2BBC A;  1V1P B;  1YQ4 B;  3NHE B;  2NPT B;  3WAM A;  3ZW3 A;  2KC2 A;  2KMM A;  1SIF A;  4G0N B;  1WXM A;  4OVV A;  4A6Q A;  3I3T B;  1IGC A;  4ANU A;  1WWT A;  1L0Y B;  4MSQ B;  2JWZ A;  2DLB A;  4IDI A;  1R7S A;  2MSE D;  3SEB A;  5G55 A;  4YSZ B;  4GDK A;  2ZVN A;  3L0W B;  3W1S C;  1QT9 A;  4BBN F;  2W3R A;  4II3 B;  3OWE B;  1KJT A;  3PS6 A;  2J52 A;  3CST A;  2YEP F;  3VVW B;  3B2F A;  4CO7 A;  3MP9 A;  3Q8B A;  4I6L B;  2QC8 A;  1PQS A;  2BT6 A;  3B9J A;  3L08 A;  1P1A A;  3U7D A;  1VR9 A;  2D11 A;  4REZ A;  5EE3 A;  4GDK B;  2Z0E B;  2DNF A;  1ZP0 B;  2GBM A;  2WP9 B;  5DPS A;  1WJ6 A;  2MJE A;  2N1W A;  2IY1 B;  1BT0 A;  1V5T A;  4MGK E;  3PTF C;  4E74 A;  2ACZ B;  2WXG A;  3VR8 B;  3SD5 A;  3PSE B;  2D10 A;  3V60 A;  5LXI B;  3DPD A;  4BKS D;  2QJL A;  3ZTC A;  3X23 A;  4WJN A;  4XYC A;  3IVF A;  3RCZ A;  1I4Q A;  5BYS A;  4C7Y A;  2GI9 A;  1A5R A;  3QA8 A;  1NDD A;  3ZLZ A;  1FFU A;  4MDK E;  4TQ0 A;  1C1Y B;  1C77 A;  3RFZ B;  1E7V A;  2LVP A;  1T0R C;  2KDE B;  5AUI A;  4EOY A;  4F1S A;  1XXG A;  1E5W A;  1LQB A;  3ZDT A;  3X0W A;  2KLG A;  2L00 B;  1WR6 E;  1BXT A;  2N7J A;  2J7Q B;  1WRI A;  3L4P A;  2LWP A;  2VZK D;  3RYT A;  3ZNZ B;  3EA6 A;  4YWG G;  3URY A;  3MTN B;  3V3X A;  3P1M A;  1ENF A;  2PMV A;  3ZGZ A;  1GUA B;  1WGG A;  4L2Y A;  4PT5 A;  3IAS 1;  1Q1O A;  3CF6 E;  3DBH B;  2J0M A;  4HRO A;  1QQR A;  2I1J A;  3FIL B;  4WUR A;  4B9K A;  4K1R B;  1RM6 C;  3I57 A;  2IGH A;  2SEB D;  5EE9 A;  1TS5 A;  4BOZ B;  1UH6 A;  3RPF C;  3SFD B;  4USA A;  2ON8 A;  5KHQ A;  2M0X A;  1B9R A;  3AE1 B;  3V6E B;  3DBR I;  2QDF A;  4BOS C;  2JRH A;  4W9C A;  1ZPS A;  1LM8 B;  1WGK A;  2IND C;  4LK0 M;  2E3T A;  3IHP C;  3M3J A;  2D3G A;  2KAJ A;  3N20 C;  1P0R A;  3DWM A;  1FPY A;  3EGR A;  2WU2 B;  2KOX A;  1FRD A;  3Q3J A;  3GE8 C;  1TGZ B;  3PZD A;  4GIV A;  2KJH B;  3BK1 A;  2LGX A;  1V97 A;  4UDU C;  2GBK A;  1KTK A;  2JZZ A;  3HHM A;  3V61 A;  2MQJ A;  5HG2 A;  3U7Z A;  2LXA A;  1L7Y A;  3AEG B;  4IWO A;  1UEL A;  1I4H A;  3P2B A;  1R4N B;  1NBF C;  3BYT B;  2ZNV B;  4NNJ B;  3V05 A;  2OHF A;  3VUX A;  3QJZ A;  1FXT B;  3NZS A;  3TSS A;  3NVY A;  4QAY A;  5H92 C;  1XT9 B;  2IPK D;  2LJ5 A;  4D2K A;  5H8Y E;  2XEW A;  1WY8 A;  2BW2 A;  1JW9 D;  1FNV A;  3ZUN A;  1GNU A;  2D3A A;  1DYQ A;  4MJS B;  2KO3 A;  4P16 A;  2CKH B;  2BYV E;  2WX1 A;  3ZKJ C;  3APC A;  4ICU A;  3OAW A;  4DHZ B;  4IC7 B;  1A70 A;  5DPT A;  2Y5P A;  2N0S B;  2WNM A;  3KWV A;  4W9J A;  3ZRC A;  5JH5 C;  1HA5 A;  3SFE B;  3AEE B;  3FAH A;  1F9J A;  4LDT B;  2WYQ A;  4ZDV A;  4RGT A;  1Q0W B;  1J8C A;  5D2M B;  1RLF A;  4JLC A;  3PV1 A;  4G3X B;  2KD0 A;  1WYG A;  2QEJ C;  2CHX A;  2GRI A;  1VRA B;  3IG3 A;  1I4P A;  5T8I A;  4URK A;  3OJ4 B;  2ZPY A;  4HDQ A;  1VDV A;  2OOB B;  2KFJ A;  1YN5 A;  3ZNI D;  3DBS A;  1E0Z A;  3AE8 B;  3VH4 B;  3PRE A;  1YX6 B;  3KYD D;  5BMH A;  3KH0 A;  3DHG C;  2NBU A;  1QZE A;  2BGF A;  2JY6 A;  2VRR B;  2FUG 1;  3BIN A;  1GAQ B;  3CMM B;  3DVG Y;  2PLP A;  1E6E B;  4EZK A;  4IWQ A;  3HIZ A;  1MJD A;  5D6J B;  4S0R A;  2M19 A;  2IY0 B;  1IGD A;  2ONQ A;  2QCZ A;  1XEE A;  2ZZP B;  4WAF A;  3B08 A;  1ZXI A;  5FR3 A;  1KH0 A;  3T3O A;  3VFK A;  4NAW A;  2KQ7 A;  2NMQ A;  3KWL A;  1CMX B;  3DVN U;  1V2Y A;  4HCP B;  3JSV A;  3RN9 C;  3WIM A;  4FLH A;  1KM7 A;  1HZ5 A;  1H8C A;  2AQ2 B;  4FA6 A;  3KUC B;  4C4V A;  2DX5 B;  4M8M A;  1TT5 B;  1L4D B;  3RUL A;  2H88 B;  3U52 E;  4M02 A;  2C7H A;  2N9P C;  1FM0 D;  3ENE A;  2QSD A;  3N32 A;  1YJJ A;  2G9H D;  2ZW0 A;  1EWC A;  4PYU A;  3QK0 A;  1T3Q A;  4HVB A;  3JSV B;  2N7D A;  1FCC C;  1FRR A;  2MRP A;  1ZUD 2;  3W1S A;  2RD0 A;  2RMM A;  2KYW A;  1FCL A;  3KUZ A;  3N1Y C;  3Q2A C;  4RF1 A;  4HPM B;  1V9J A;  2FID A;  4WWO A;  5HFY A;  2QIL A;  1WGH A;  1JWU D;  3Q3F A;  2JWU A;  1C79 A;  2D5G A;  3H6N A;  1TKY A;  1WE6 A;  3ML8 A;  4C7Z A;  2O2V A;  2N1V A;  1U4A A;  1SE3 A;  4MH0 E;  3RNG C;  2V3P A;  4A8X C;  4A90 A;  1Z5S B;  3TEX A;  2GBN A;  4DXG A;  4A3O A;  2D07 B;  2BS4 B;  3U30 A;  3AED B;  4ANX A;  5LXH A;  4YT0 B;  2WXO A;  3ZNG C;  2O6V D;  2WLB A;  2MCN B;  3O13 A;  1ZXH A;  2O2V B;  2AQ1 B;  2INN E;  1K50 A;  2GLS A;  1WFY A;  1TJE A;  4ZRP A;  3NS1 A;  1F52 A;  4HKQ A;  2KLC A;  2RGF A;  4JWS C;  1FXA A;  4GMV A;  1VZ7 A;  4WWP A;  2BYE A;  1WYW B;  5I4D A;  4ZOH C;  2JXT A;  4HDO A;  3VUY A;  3PZ7 A;  4ZRQ A;  3ETR A;  1WXQ A;  2D2Q A;  4KZC A;  2K9X A;  2LMC A;  1OTR B;  4US8 A;  2WU5 B;  1KOT A;  1YIW A;  3DVN V;  1RAX A;  4C80 A;  3APD A;  1NYR A;  2K1F A;  3C8Y A;  3DDC B;  4GDL A;  4ITK A;  1ET6 A;  1VZ6 A;  1SE4 A;  4WH4 A;  4KGR A;  1KRH A;  3BZD B;  2OJR A;  2MHJ A;  1C3T A;  2UU7 A;  3NG0 A;  3DBL B;  4W9F A;  1WXA A;  4C00 A;  3NVW A;  2KTF A;  4DHZ E;  2LHE A;  5J2R A;  1YN3 A;  4MAC A;  2Y5C A;  4GDL B;  1TY2 A;  3B2G A;  3N30 A;  3ML9 A;  1JWB D;  2L0F A;  3Q3N C;  1WXS A;  3FKY A;  1NI2 A;  3RZF A;  4DBG A;  1GC6 A;  2PPH A;  3AEA B;  1D5X C;  1EWY C;  4LJO B;  1TY0 A;  3HK0 A;  4MT5 A;  4ZRJ A;  1X1M A;  2A4Z A;  3PRP B;  1DOI A;  3R3M A;  5IOI A;  1C76 A;  3ZQ4 A;  3IBE A;  3P42 A;  1L6U A;  3U8Z A;  1WZ3 A;  2QHO A;  3QC8 B;  2ZEQ A;  5G5G A;  3E56 A;  2VH1 A;  1R4M I;  2PIA A;  2G45 B;  5IAA C;  4BVU C;  3ECI A;  3ZNH B;  4IW0 A;  1TZO A;  1UBI A;  2BYF A;  4WJO A;  4N9F 4;  1E8W A;  2JUO A;  4HPP A;  2KTR A;  1FMA D;  4IUM B;  1AYF A;  2NS5 A;  4DQO C;  1S3S G;  4K3B A;  3NOB A;  2BS3 B;  4S17 A;  5MPO A;  3RNE C;  3AUL A;  2FIF A;  4XDC A;  3TL5 A;  1ZGU B;  1GB1 A;  2MBQ A;  1MHH E;  1F77 A;  1KLG D;  1MI0 A;  2MBE A;  2JXX A;  2M17 A;  4DHJ D;  2KTR B;  1Y56 A;  4BBN C;  3TEW A;  2LVQ A;  4KDI C;  4GN1 A;  1SGH A;  1VD2 A;  3L13 A;  4WJQ A;  1F0Z A;  3LXF A;  2G4S A;  2BVC A;  2KWV B;  4AJY B;  3VTU A;  2KWD A;  1XQQ A;  1TS2 A;  1WM3 A;  2WXQ A;  2X8X X;  2BB6 A;  2UWQ A;  1TKG A;  4K7S A;  2KDM A;  4BZA A;  4XWW A;  3NVV A;  2L52 A;  2ZCB A;  1AW7 A;  1JRU A;  2JU6 X;  2NVU I;  1P98 A;  1WXV A;  3AI5 A;  3C0R B;  5LNK 1;  1WSP A;  5IN7 A;  2LVO A;  5EE0 A;  2G1E A;  3Q8F A;  2LZ6 A;  3Q8C A;  3ZJU A;  4C56 C;  2KMA A;  2L7R A;  4DK5 A;  1YX5 B;  1C9F A;  3AE3 B;  3I5J C;  1MPE A;  3DHI C;  3J9C A;  3PHW B;  3W2D A;  4DXF A;  2J4X A;  2WXP A;  2CU3 A;  5D3D A;  2KFK A;  5EE1 A;  2GMI C;  3L54 A;  3P4P B;  1J19 A;  2AL6 A;  1F1H A;  1OGW A;  2DYM A;  4W9G A;  3HVD A;  1JWS D;  2KXJ A;  3IXS A;  2Z0D B;  4HCN B;  3W9C B;  5DCN A;  2KFK B;  3EC8 A;  4B6W A;  4AQ7 A;  3T3N A;  1FIQ A;  2K3U A;  5KHO A;  3TJP A;  3MHZ A;  2J0J A;  2LGI A;  4RCO A;  4BAX A;  2WDQ B;  1XLQ A;  3VDZ A;  1M94 A;  4J3O D;  3JVZ X;  3ZJT A;  2NTS A;  3IAM 1;  4GB9 A;  1F2R C;  2WDV B;  4P6V F;  1LFD A;  2LHD A;  5FR6 A;  2LRW A;  2C7M B;  2ICI A;  2Q5W D;  2KX0 A;  2ZVO A;  2LAS A;  2L3Z A;  1D4B A;  1QOF A;  3IFW B;  2MA9 B;  2RDG A;  3ONS A;  4KSK C;  2W3S A;  1WGY A;  1CJE A;  1YMH E;  3PHX B;  2PEA A;  2WXF A;  1E10 A;  1L2N A;  4J6I A;  4MSM B;  4LNO A;  2C5L C;  4DDG D;  2NCN A;  3T9L A;  2INP E;  4N59 A;  3TCA A;  4X57 B;  3APF A;  1IUE A;  1JQ4 A;  2E6X A;  4B0M A;  1WRD B;  4K3C A;  1QIL A;  4RH6 A;  3K9P B;  2GBR A;  3AU5 A;  3A4R A;  3EFC A;  4IKG A;  2AYO B;  3AV8 A;  2D3B A;  3SR6 A;  2HD5 B;  4MEM A;  1P9D U;  3LYY A;  3SDL C;  1QOG A;  2L1A A;  1WX9 A;  2KZR A;  4LLG M;  4NPN A;  1PUT A;  2PE6 B;  4BKT A;  5AEK B;  4KKI A;  1WJN A;  1WGD A;  2CJO A;  4DDI D;  3BK2 A;  1JML A;  4I6P A;  4A3P A;  1R4M B;  4M01 A;  5G5H A;  2Z59 B;  3GP7 A;  3A9K A;  4FJZ A;  1MFW A;  3W1Y A;  2KDB A;  3MJW A;  2KKC A;  1HE8 A;  1RRB A;  3W5U B;  1N5W A; 
#chains in the Genus database with same CATH homology
 2NBW B;  4FHJ A;  4HPM B;  4NQL B;  2WWZ A;  1V9J A;  2FID A;  2UYZ B;  2EMS A;  2AEH A;  4TV3 A;  4A20 A;  3UQB A;  2KJR A;  4WWO A;  3A1Q A;  3UF8 A;  1UZX B;  3ZTD A;  4II2 B;  1WGH A;  4EZL A;  1Q5W B;  2KHW B;  3Q3F A;  2XBB C;  3B1L X;  5J17 A;  4NQK E;  1TZ1 A;  2C7N B;  2PJH A;  4W9I A;  3K9O B;  2KK8 A;  5CTR C;  4IWP A;  4RMA A;  3T8M A;  4HJK A;  3DVG X;  4I6N B;  5D7G A;  1WJ4 A;  5AZF A;  3A4S C;  3H6N A;  5CHF A;  5JZE B;  4E71 A;  1WE6 A;  4MM3 A;  4ZRI A;  3ML8 A;  4HXD A;  3RD2 A;  3EEC A;  2KMC A;  4PS7 A;  2O2V A;  4EFO A;  2IBI B;  1U4A A;  2N1V A;  1E7U A;  1J0G A;  4PYZ A;  3H1U A;  3PT2 B;  4MH0 E;  4HPL B;  1WIA A;  3GZN I;  4AWJ A;  3BY4 B;  3M62 B;  1WF9 A;  2DAJ A;  3H7S A;  5J18 A;  2LD9 A;  3KYC D;  1Z5S B;  2GBN A;  4G11 A;  2D07 B;  3ZO5 B;  3U30 A;  4A3O A;  4FHK A;  4AOF A;  5JHB A;  4PS8 A;  4LDT D;  2PE9 A;  4ANX A;  5LXH A;  2N4F A;  3ZNG C;  2O6V D;  1WH3 A;  2GOW A;  3VTV A;  3VAW A;  2MX2 A;  2MCN B;  2O2V B;  2FNJ B;  2JT4 B;  2KN5 A;  2A5U A;  2WX0 A;  4WWN A;  2K25 A;  4OVU A;  2KDF B;  4XC2 A;  3UIP B;  1WFY A;  4FUL A;  1ZW7 A;  2N9X A;  2DZI A;  4EZJ A;  3KUD B;  4LJP B;  2KLC A;  2RGF A;  2C9W B;  2MBO A;  2JRI B;  1RFA A;  3CSF A;  4GOC A;  4GMV A;  1V80 A;  4CHK A;  4WWP A;  2BYE A;  1MG8 A;  1WYW B;  1V86 A;  4HLE A;  3NHE B;  4HDO A;  3QX1 A;  3LDZ E;  2NPT B;  3VUW A;  3WAM A;  3ZW3 A;  3VUY A;  2M4N A;  2KC2 A;  4G0N B;  1SIF A;  1WXM A;  4OVV A;  3I3T B;  1IP9 A;  2D2Q A;  2L8J A;  4KZC A;  4G50 A;  3M95 A;  2R2Q A;  2AWT A;  4ANU A;  1OTR B;  1EF1 A;  2W9N A;  2FCN A;  4MSQ B;  2JWZ A;  3ZRF A;  1KOT A;  4K81 A;  1YIW A;  2KJ6 A;  3DVN V;  3HM3 A;  1GJZ A;  1WE7 A;  2J0K A;  2MSE D;  1OEY J;  1RAX A;  1UGM A;  5G55 A;  4K7W A;  4GDK A;  2ZVN A;  2BF8 B;  3L0W B;  3W1S C;  3APD A;  2MWS B;  2K1F A;  4BBN F;  4II3 B;  3DDC B;  4GDL A;  1KJT A;  3PS6 A;  5L95 C;  3CST A;  1YD8 U;  2CHZ A;  4GGQ A;  3VVW B;  4NAW B;  2K6Q A;  3UIN B;  4CO7 A;  4IG7 B;  2IO2 B;  1OEY A;  4F8C B;  2OJR A;  2KC1 A;  4I6L B;  1C3T A;  1PQS A;  3L08 A;  1WJU A;  1P1A A;  3U7D A;  4W9F A;  2LI5 A;  1WXA A;  2D11 A;  2DYO A;  4GDK B;  2Z0E B;  4W9L A;  1WGR A;  2KTF A;  4DHZ E;  2GBM A;  4ANW A;  1H4R A;  1WM2 A;  5J2R A;  3VHT C;  4MJS A;  2DZM A;  2K8B A;  4GDL B;  5DPS A;  2NBV B;  3N30 A;  3ML9 A;  1WJ6 A;  3OLM D;  2L0F A;  1WXS A;  2N1W A;  1NI2 A;  2IY1 B;  1BT0 A;  1V5T A;  2I1K A;  4MGK E;  3RZF A;  4IM2 A;  3PTF C;  4ZYN A;  4P7I A;  4DBG A;  4E74 A;  1GC6 A;  1UD7 A;  2PPH A;  2BKR B;  3SD5 A;  2RR9 A;  1KLV A;  4NY0 A;  4LJO B;  2XK5 A;  2CHW A;  3PSE B;  2D10 A;  3HK0 A;  4MGY E;  4ZRJ A;  3V60 A;  1X1M A;  5BO4 B;  5LXI B;  3DPD A;  2A4Z A;  3A9K B;  3PRP B;  3R3M A;  5C23 A;  3UGB B;  4BKS D;  2N7E A;  4JIO U;  3ZTC A;  2FUH B;  3X23 A;  3QQ8 B;  3IBE A;  3QWZ B;  2BWE S;  2MLB A;  2O6V A;  4WJN A;  3U8Z A;  1WZ3 A;  2L76 A;  3IVF A;  4KDL B;  3RCZ A;  3VTW A;  4DXA B;  2QHO A;  3QC8 B;  2ZEQ A;  1A5R A;  3TIX A;  3NY5 A;  3WAL A;  2K39 A;  3RUI B;  4WQO B;  4W9H A;  4NJ7 A;  2G3Q B;  3QA8 A;  4YL8 A;  3KVF B;  1NDD A;  1R4M I;  3A1Q B;  4GU2 A;  4W9D A;  2JVC A;  4W9K A;  3ZLZ A;  4MDK E;  2CU1 A;  2G45 B;  2XK5 B;  4TQ0 A;  3DBL I;  5IAA C;  1AAR A;  1WX7 A;  2FAZ A;  4MGZ E;  4BVU C;  1C1Y B;  3PLU A;  4WAA A;  3ECI A;  1E7V A;  1EUV B;  1ZKH A;  2KWU B;  3AXC A;  2LVP A;  3UIO B;  3ZNH B;  4IW0 A;  5IA7 A;  2KDE B;  1UBI A;  3R66 C;  4EOY A;  2HTH A;  2BYF A;  3ZDM C;  4F1S A;  4WJO A;  2O6V B;  4N9F 4;  1E5W A;  1E8W A;  1LQB A;  2JUO A;  3EHV A;  3L10 B;  2KTR A;  4W9E A;  2IZV B;  3X0W A;  2KLG A;  2L00 B;  2CS4 A;  1V49 A;  1WR6 E;  3PVL A;  4IUM B;  1E8Z A;  2NS5 A;  2J7Q B;  1S3S G;  3RZW C;  3NOB A;  2LWP A;  2DYB A;  3QAQ A;  3RYT A;  3AUL A;  3UQA A;  1EF5 A;  5CHW A;  2FIF A;  3ZNZ B;  3O65 B;  2MP2 A;  3OJ3 A;  3MTN B;  1TTN A;  2KX3 A;  3TL5 A;  2ASQ A;  1ZGU B;  4BFR A;  2MBQ A;  1GUA B;  1WGG A;  2FCS A;  1V6E A;  3JW0 X;  4B95 A;  4NJ6 A;  1S1Q B;  5DPR A;  1D3Z A;  1Q1O A;  2RPQ A;  3CF6 E;  2J0M A;  2MBE A;  2RSU A;  4WJP A;  2JXX A;  3MHS D;  4ZRK A;  2IO3 B;  2M17 A;  2I1J A;  2R2O A;  4DHJ D;  5E6O A;  2KTR B;  1WX8 A;  4B9K A;  4K1R B;  1WR1 A;  4BBN C;  2LVQ A;  2EMT A;  2DAF A;  2MBB B;  4KDI C;  4GN1 A;  1SGH A;  1VD2 A;  4PS3 A;  1UH6 A;  5TR5 A;  3S2A A;  4BOZ B;  3L13 A;  4WJQ A;  4JGH B;  5GMV A;  2MP2 B;  1V5O A;  5EDS A;  4E3C A;  4RM8 A;  3V62 A;  5CX3 A;  2G4S A;  3PRM B;  2KWV B;  4FJV B;  5D94 A;  1ISN A;  2V3S A;  4AJY B;  5KHQ A;  3VTU A;  2M0X A;  1XQQ A;  1WM3 A;  2JPH A;  3V6E B;  4AJW A;  1OQY A;  3QIJ A;  4XZ4 A;  5L83 A;  3KW5 B;  3L16 A;  3DBR I;  1Z2M A;  2JZ3 B;  2Y5B B;  4BOS C;  2UWQ A;  4K7S A;  2M8S A;  2JRH A;  4W9C A;  2FCQ A;  3QHT A;  1LM8 B;  1K8R B;  2K6D B;  2ZCB A;  3IHP C;  4GXB A;  1JRU A;  4FN2 A;  3WAN A;  2NVU I;  3M3J A;  2D3G A;  2HJ8 A;  1YJ1 A;  3D32 A;  1P0R A;  1P98 A;  1WXV A;  3AI5 A;  3ALB A;  5AZH A;  3TBL D;  2KOX A;  1TBE A;  3Q3J A;  3C0R B;  1TGZ B;  3SHQ A;  3PZD A;  4GIV A;  3ZDT A;  2KJH B;  2C60 A;  4GSW A;  1T0Y A;  2LGX A;  2LVO A;  2ZJD A;  3VH3 B;  4KSL C;  2GBK A;  2JZZ A;  3PRZ A;  2EKE C;  3HHM A;  3V61 A;  2LZ6 A;  2HE7 A;  2MQJ A;  5C1Z A;  2LXA A;  1L7Y A;  2MW5 A;  4IWO A;  3HM6 X;  3QCA A;  2KMA A;  4TKN A;  1LXD A;  1SE9 A;  1UEL A;  3LJ3 A;  2L7R A;  4DK5 A;  3P2B A;  1YX5 B;  2BKF A;  1NBF C;  2YVC A;  1WZ0 A;  2BWF A;  3AU4 A;  2KAN A;  2ZNV B;  4NNJ B;  2IYD B;  2DZJ A;  3R7R A;  1GG3 A;  2GBJ A;  4BKG A;  4FAD A;  2NR2 A;  3VUX A;  3PHW B;  3QJZ A;  1FXT B;  3NZS A;  4RM9 A;  1XT9 B;  2KFK A;  2LJ5 A;  2XEW A;  4IM0 A;  1WY8 A;  2WDT B;  2GMI C;  1G6J A;  3L54 A;  1I42 A;  1J19 A;  2AL6 A;  3ZUN A;  1GNU A;  3DQV A;  5DPW A;  1OGW A;  4IM3 A;  4MJS B;  2KWC A;  3A9J A;  3DCG A;  2KO3 A;  1P3Q U;  2DYM A;  5LLI A;  2CKH B;  2B3A A;  2BYV E;  2WX1 A;  5AZG A;  4W9G A;  3APC A;  4ICU A;  3OAW A;  3ZKJ C;  1IPG A;  4JL9 A;  2IO1 B;  2KXJ A;  3ZVV A;  4DHZ B;  4IC7 B;  5DPT A;  1V81 A;  2DZK A;  4MGI E;  2K8C A;  3WAP A;  4AP4 C;  2Z0D B;  4HCN B;  5HKH A;  3L17 A;  4W9J A;  3VXW A;  5DCN A;  2V4L A;  3ZRC A;  2KFK B;  3EC8 A;  2KNB A;  2KQS A;  4B6W A;  2LGY A;  5JH5 C;  2REX A;  5KHO A;  3TJP A;  1F9J A;  2BPS A;  4LDT B;  2WYQ A;  1R4N I;  2AL3 A;  4ZDV A;  2L05 A;  1WMH A;  2CR5 A;  1Q0W B;  2J0J A;  3A9J B;  1J8C A;  5D2M B;  1RLF A;  4JLC A;  2IO0 B;  4LCD E;  1XD3 B;  3PV1 A;  4G3X B;  3M63 B;  2KD0 A;  3WAO A;  4DWF A;  3NS8 A;  1M94 A;  2CHX A;  3VDZ A;  3IG3 A;  1I35 A;  4URK A;  3GOE A;  3NZU A;  4K7U A;  3JVZ X;  2N9E B;  4CYE A;  4GB9 A;  2V1Y A;  2LGD A;  3OJ4 B;  4ANV A;  2ZPY A;  3SU8 X;  4HDQ A;  2G4D B;  2OOB B;  1LFD A;  3QAR A;  2KFJ A;  3ZNI D;  5FR6 A;  3TMP B;  3DBS A;  2LRW A;  2C7M B;  4DHJ B;  4EKU A;  2KX0 A;  2ZVO A;  2LAS A;  3VH4 B;  2L3Z A;  3PPA A;  3V6C B;  3PRE A;  1YX6 B;  1WMH B;  5E6N A;  3EFU A;  1Y8R C;  3KYD D;  3IFW B;  2MA9 B;  2DEN B;  3KH0 A;  3ONS A;  4KSK C;  1GC7 A;  1QZE A;  2NBU A;  4ICV A;  1UBQ A;  2BGF A;  2NPT A;  1WGY A;  1VCB A;  2K8H A;  3R7Q A;  2JY6 A;  2ZNV C;  3PHX B;  2VRR B;  3BIN A;  2PEA A;  3CMM B;  1L2N A;  4J6I A;  3DVG Y;  4MSM B;  2MBH A;  4EZK A;  4IWQ A;  3HIZ A;  5D6J B;  4ASW C;  2C5L C;  2JF5 A;  2M1M A;  2NCN A;  3A33 B;  5E6P A;  3T9L A;  5G2N A;  2IY0 B;  4DDG D;  3VQI A;  2ZZP B;  3TCA A;  4TQ1 A;  4X57 B;  1IYF A;  3APF A;  3B08 A;  4MEL A;  2LXC A;  1WRD B;  2DHZ A;  3VFK A;  4NAW A;  2KQ7 A;  3K9P B;  4KVG B;  2GBR A;  4TUU A;  1CMX B;  1E8Y A;  3AU5 A;  3DVN U;  3A4R A;  4KIK A;  5JHA A;  3RT3 B;  1V2Y A;  4F7Z A;  3ZIM A;  2AYO B;  2YLM A;  2HD5 B;  3H9D A;  3JSV A;  3H7P A;  4HCP B;  4M0W B;  3DBH I;  3WIM A;  4FLH A;  4BKS A;  1KM7 A;  1WI0 A;  1E90 A;  2KDI A;  3PGE A;  2LRU A;  2LUE A;  1P9D U;  4HK2 A;  4MEM A;  4AUQ C;  4FBJ B;  4HWI B;  3SDL C;  1WX9 A;  1H8C A;  2KZR A;  3N3K B;  4NPN A;  4FA6 A;  2PE6 B;  4BKT A;  3KUC B;  5AEK B;  4M8N A;  2DX5 B;  4M8M A;  3PLV A;  4EEW A;  1WJN A;  3RUL A;  1WGD A;  2FCM A;  4DDI D;  4FJY A;  2C7H A;  4KIK B;  2N9P C;  4KZ0 A;  3ENE A;  4EUT A;  3N32 A;  2L0T A;  1YQB A;  1EO6 A;  4I6P A;  4PYU A;  3QK0 A;  2ZCC A;  4A3P A;  3B0A A;  4HVB A;  3JSV B;  3H7P B;  2Z59 B;  3A9K A;  4FJZ A;  2N7D A;  3DOW A;  3JYU A;  1E8X A;  3W1Y A;  2KDB A;  2MRP A;  4KV2 A;  3W1S A;  2RD0 A;  3MJW A;  2KKC A;  5CHV C;  3KUZ A;  1HE8 A;  2KVR A;  2ZPN A;  4JQW C;  3WA0 A;  1RRB A;  4XX5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...