3AH7A

Crystal structure of the isc-like [2fe-2s] ferredoxin (fdxb) from pseudomonas putida jcm 20004
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
109
structure length
109
Chain Sequence
MPLVTFLPHEKFCPEGLTVEVKPGTNILELAHDHHIEMESACGGVKACTTCHCIVRKGFDSLEEADELEEDMLDKAWGLEAQSRLGCQVFVADEDLTIEIPKYSLNHAA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of the ISC-like [2Fe-2S] ferredoxin (FdxB) from Pseudomonas putida JCM 20004
rcsb
source organism Pseudomonas putida
molecule tags Metal binding protein
molecule keywords [2Fe-2S]ferredoxin
total genus 27
structure length 109
sequence length 109
ec nomenclature
pdb deposition date 2010-04-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00111 Fer2 2Fe-2S iron-sulfur cluster binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 3ah7A00
2W54A 2FBWB 1V8CA 1CZPA 1NVID 1WWTA 1JROA 1L6UA 3NVYA 4N59A 3VR9B 1EWYC 1N61A 2KMMA 3PO0A 1FFUA 2QIEB 5EE0A 4YTNB 2H88B 2E3TA 3AMZA 1QOAA 3AE6B 5H8YE 3P4RB 2HTME 2M56B 1RWSA 2WDRB 1XO3A 1TKGA 1V97A 4N58A 4YSXB 4YXDB 2DWQA 2OHFA 3HVZA 4USAA 2WLBA 4US9A 3NVZA 3DWMA 2WDQB 1YJIA 3CWIA 1E7PB 1VDVA 2PVOD 3AEDB 2BT6A 1KFYB 1E10A 1JQ4A 1AYFA 2PKOA 1FRRA 1KF6B 2L83A 1SB3C 3LXFA 3ZYYX 3VR8B 1JWBD 1QOGA 3SFDB 4US8A 2MJ3A 3SR6A 2K5PA 3DWGC 2H89B 5EE9A 3CIRB 3B9JA 2KAJA 1DOIA 5GXGB 2WU5B 3AE9B 3AH7A 2MH7A 5EE3A 5C2TB 1NI3A 1OQRA 1WRIA 1XLNA 2G1EA 1WYGA 3AV8A 3P4QB 4YTMB 2B76B 2ACZB 1QT9A 1WGKA 2K9XA 3B2GA 1ZP0B 4IDIA 1N62A 1XLPA 3AE2B 5AUKA 1B9RA 1GPXA 1FRDA 1ZXIA 2MJEA 3AE3B 2Y5CA 3WCQA 5MPOA 2CJOA 2BS4B 2W3RA 4YSZB 1E9MA 4YSYB 3KWLA 5G5HA 3HUIA 3B2FA 1NEKB 4FXCA 3VRAB 2MJDA 3L4PA 3AM9A 3W5VB 1J7CA 4P6VF 1T3QA 3FAHA 1E6EB 3AE4B 4WQMA 1XLOA 2K22A 1RFKA 3RPFC 1JWAD 1FXAA 2LEKA 2WU2B 1TJEA 2M19A 4ZOHC 4C7ZA 3LB8C 4C80A 3NRZA 1FFVA 3P63A 4ZHPA 3HRDD 1CJEA 1FIQA 1RYJA 3AN1A 1OFFA 1YQ4B 1JALA 2JQRB 1J7BA 1FXIA 1QOBA 1ZOYB 1N5WA 4YTPB 4C7YA 1PUTA 1R7SA 1N5XA 2DBYA 2W55A 3AEBB 3AE7B 1NENB 1L5PA 3ETRA 4HRSA 3AE1B 5AUIA 3NS1A 3AECB 4ZHOA 1N63A 1DGJA 2BS2B 3AEEB 2WQYB 3W5UB 2N0SB 4LTUA 1FMAD 3AEFB 1XLQA 1ZUD2 1L0VB 3NVVA 1QOFA 3SFEB 1JW9D 2WDVB 1A70A 1QLBB 2BS3B 2JX5A 1L6VA 1KRHA 1ROEA 1UWMA 2Q5WD 4JWUC 5H92C 1TKEA 2CJNA 5C3JB 3VRBB 3EUB2 1N60A 2EKIA 1TKYA 2AX5A 3AE8B 3AE5B 1F0ZA 4JWSC 1J7AA 4ITKA 1AWDA 4HROA 4A9AA 1YQ3B 5G5GA 5EE1A 1IUEA 1GAQB 3AEAB 4WWMA 2CU3A 3ABVB 1I7HA 1FO4A 3P1MA 1SF0A 2W3SA 2WS3B 2PIAA 4KX6B 3P4SB 4JX1C 3FC4A 1NYQA 3AEGB 1PFDA 1WXQA 2PVGC 3P4PB 1VLBA 2QJLA 1QF6A 3NVWA 4YT0B 1OQQA 1RM6C 1SIJA 2WP9B 3BIID 3AB5A 1TYGB 1FM0D 3W9CB 1E0ZA 1VJKA 1DOYA 1YJJA 2L52A 4N6EB 1NYRA 1JRPA 1DOXA 1PDXA
chains in the Genus database with same CATH superfamily
4RH6A 3OJ4B 1MJDA 3V05A 2L76A 3PO0A 3C19A 2D3BA 2L3ZA 4WWNA 1FD6A 3PRZA 1V97A 3H8HA 3V60A 1VCBA 3A4RA 1R4NB 1YJIA 3APFA 2X38A 2WHIA 1V1OA 1P98A 1WR1A 2HE7A 3LXFA 4ZYSA 2RMMA 5T8IA 1SJHD 2GBMA 3AE9B 1OQRA 1JWUD 1T6BX 2KZRA 4AUQC 3H6NA 2XK5B 2AL3A 1WJ6A 2CJOA 1ACCA 3GZNI 2INNE 3TUOA 1HTQA 2UYZB 1FNWA 1C78A 1KTKA 2LEKA 2WU2B 4RMAA 5FKAC 4C7ZA 3LB8C 2WXQA 1J7BA 5BYRA 3RNBC 2WXKA 1SE4A 4CO7A 3MHZA 2O6VB 1EUVB 4S17A 3W5UB 4URKA 4KVGB 2WNMA 2IO2B 3L0WB 5FR6A 3L17A 2N7JA 4JIOU 4LNNA 2LUEA 1V49A 3EUB2 3ZIMA 2JT4B 3WIMA 4UDUC 1YN4A 3GZNB 4DK5A 2W3SA 4E3CA 1PFDA 2GMIC 1RM6C 2DYMA 1HTOA 4WURA 1X1MA 3W1SA 1F2RI 3U30A 1TIFA 5J17A 4WIPA 3NVYA 3LYYA 1YN5A 5G2NA 1N61A 4OVVA 4YTNB 2E3TA 5JH5C 2JZZA 1ZW7A 4YSXB 4LNOA 1JWSD 1WFYA 2KACA 2BWES 2XN9C 3H7PA 1KF6B 3A33B 3AU5A 3VH4B 1Y8RC 1FCCC 5BMGA 2H89B 5EE9A 2JXXA 2WXHA 5GXGB 1FNUA 1NI3A 2LASA 4ANVA 2DLBA 4N9F4 1D4BA 1N62A 3MJWA 2WXPA 2BQQA 4YSYB 3EC8A 3IT6B 5IP4D 3I57A 3PSEB 2QMTA 1H8CA 4DXAB 1S1QB 4P16A 3RFZB 1WJ4A 1LXDA 4B6WA 1RYJA 4DHZE 3QIJA 4E71A 2CHWA 2VZKD 3DBLB 2G4DB 5DPWA 3E56A 1L0VB 1WM3A 2N9PC 5H92C 2DX5B 3UQBA 1TS4A 2K0PA 4JWSC 1TY0A 3KW5B 1GAQB 4ZRQA 2PE6B 3H7SA 2DZMA 3R8BA 4XYCA 1MPEA 3QX1A 3IG3A 3L16A 1TZOA 4W9CA 2M0XA 1QKZA 1BMLC 1FXIA 2RDGA 4EUTA 5HI1A 3QA8A 3T8MA 2G4SA 2WXIA 4MGKE 3ZTCA 3VHTC 4KGSA 3SEBA 4P1CC 1VD2A 2ZJDA 2FE8A 3VQIA 1VDVA 4IWOA 4C56C 4DHJD 5JXVA 1K51A 4M01A 3MJ5A 2LXAA 2K25A 4OVUA 5HHDG 4LLGM 5LNK1 2QEJC 3DVNV 3C0RB 1E7VA 4BKTA 4IKGA 4RGMA 2G1EA 2VH1A 3AV8A 3BZDB 2K9XA 4ZDVA 3JYUA 1P7EA 1D5XC 1MG4A 3PZ8A 2JWZA 1E9MA 2LGSA 3NOBA 2X8XX 3OG5A 2HD5B 3L4PA 3NG0A 2L0FA 2XK5A 1V5TA 4TUUA 2IGHA 1UZXB 1MVKA 2HDEA 1ZDXA 2KFKB 1TJEA 1OQYA 2LWPA 2L7RA 1YX6B 2JRIB 2W55A 1F77A 2WYQA 3ZW3A 3AXCA 3X0WA 4HKZE 5L95C 4XWTA 2WQYB 1SBBB 3HM6X 3NVVA 1UF0A 4FJYA 3RUIB 1K52A 1C4CA 1TKEA 2EELA 4C00A 2EKIA 1TKYA 2ZCBA 4GDKA 2D10A 1MHXA 2HTHA 4TV3A 4EZLA 2CS4A 2I1KA 4A9AA 3ABVB 1I7HA 3V61A 1PGBA 2LGDA 4ANWA 4LNFA 3UF8A 2L52A 1FNVA 1KH0A 4MH0E 4CHKA 4NAWA 1JROA 2ZEQA 2ASQA 3SHQA 2H88B 2BVCA 3U7ZA 4E74A 4IWQA 3E9SA 3SDLC 2LRUA 1WE6A 4IG7B 3RNCC 3OJ3A 4USAA 4US9A 3VXWA 3DWMA 2PVOD 2MWSB 1C4AA 5E6JA 1WZ3A 3IVFA 1TS3A 2KHWB 4RF1A 4P1BC 2QHOA 4K7SA 4W9JA 4AP4C 3WCQA 2MBQA 3DBHB 3O65B 2KX0A 3KWVA 2PPHA 2R2OA 2NS5A 2LGIA 2ZCCA 4WQMA 1UUPA 2IBIB 4GGQA 1CJEA 4HJKA 3VTWA 2OJWA 4KKJA 2K6QA 2MBEA 1NENB 1WF9A 1WGHA 3DHIC 4KZ0A 1D6EC 2KVZA 4LTUA 2C5LC 1A70A 2BS3B 2KXJA 4ZRKA 5DCNA 4RF0A 1R4MI 4WJQA 1VRAB 4HXDA 3HM3A 1IUEA 3AEAB 4AJYB 3PV1A 1WXQA 2L8JA 2KMCA 2C7MB 4D2KA 1L7YA 1T0YA 4L1BA 2LXCA 1UNSA 4ZRIA 1PDXA 2YLMA 1SE9A 1WYWB 2AL6A 1AW7A 2GRIA 1EWYC 2KMMA 1V86A 1DYQA 4KSLC 2I1JA 2M56B 4W9EA 4PS7A 1JWMD 2K8BA 3NVZA 4QAYA 3O13A 3DVGX 4MGIE 3V3XA 3VR8B 3EFCA 4M00A 2V4LA 3DVGY 2KAJA 2KDMA 4RCOA 2J53A 3P4QB 2KTRB 3Q2AC 4GIVA 3PHXB 1WXAA 3BWUD 2YVCA 2ZW1A 1XLPA 4HK2A 3N1ZC 2DZIA 3HHMA 1TT5B 4FLHA 1CK1A 1YIWA 2Z0EB 2BB5A 3ZNHB 3K9PB 4ZOHC 4NNJB 3Q3MC 1E8WA 3PREA 1TTNA 4G3XB 4BOSC 4BOZB 3M63B 4XZ4A 2ZNVC 3L13A 2J42A 1NBFC 4HDQA 4BBNC 4GMVA 3UIOB 4YWGG 2DYBA 2CR5A 2WXOA 4I6LB 2N0SB 1ZUD2 1QOFA 2WDTB 4S0RA 2RR9A 3L08A 2AWTA 2BPSA 3N30A 1AWDA 4HROA 3DBLI 2ZW0A 1WZ0A 1BT0A 3KUCB 2BWFA 4LNKA 1FO4A 4II2B 3ZNZB 1OEYJ 3MC9A 3P4PB 1E8YA 4FBJB 4M0WB 3ZQ4A 3BIID 1TYGB 1J8CA 4JLCA 2W54A 4WJPA 4HEA1 4NJ7A 4NAWB 1EU3A 2C7HA 4TSSA 4DBGA 3IT4B 2INPE 1P1AA 1XO3A 4OVZA 1L4DB 3H7PB 3Q8FA 2K8HA 3MHSD 2M4NA 3CWIA 2V4IB 1JQ4A 4W9DA 3PS6A 2FNJB 2M1MA 2MRPA 2L83A 3ZYYX 1KLVA 1F52A 3ZRFA 2FAZA 2WXLA 3NUHB 4XX5A 2BF8B 2WU5B 4OHJA 1WX8A 3BVGA 3L54A 4GU2A 3GE8C 1GPXA 3BY4B 3ZDMC 3RD2A 3Q8BA 2O2VB 4KDLB 2JRHA 2MJDA 3AM9A 1MG8A 5AZGA 2K22A 4AOFA 4B0MA 1SGHA 1QQRA 2PW9A 4C80A 4IWPA 2WXRA 2IYDB 3T3OA 4KIKA 1N5WA 1R7SA 4AS1A 5J18A 2KLCA 2JWUA 2MA9B 2KC1A 4TQ1A 1Z5SB 4FHKA 3DHGC 4PK1A 2LGXA 1JW9D 1PGAA 2WDVB 1GUAB 2DZKA 2CJNA 3N20C 1WR6E 2BTEA 1LGRA 3AE5B 4RM9A 4ITKA 1XEEA 1YQ3B 2BYTA 5HFYA 4RGTA 2KN5A 3PTFC 3TMPB 1I4PA 1VR9A 2KWUB 3MFGA 4DDID 1F1HA 4M0WA 3UGBB 5L83A 5C1ZA 3WAPA 2KMAA 3I3TB 1E0ZA 1SEBD 2SAKA 1ET6A 2IPKD 3H1UA 4FN2A 5C3JB 4M8NA 1L6UA 3BYTB 1QOAA 2RGFA 2KFJA 4FA6A 5LXIB 1RWSA 1LO5D 1GNUA 2G45B 3TCAA 2BT6A 4ZRPA 2R61A 1T0RC 1SB3C 1Q10A 3TEXA 2MJ3A 4XGAB 4M02A 2JZ3B 3TSSA 4AQ7A 5C2TB 4BZAA 2ACZB 2KANA 5E6NA 3AE2B 1B9RA 1WSPA 5I4DA 2L0TA 4JQWC 5D2MB 1WXMA 4GDLB 2K39A 3VDZA 2ON8A 2IY0B 2Z8LA 2V9HA 2C60A 3NRZA 3FILA 4GDKB 2JY6A 2LD9A 1WH3A 2XNAC 2JU6X 1KM7A 1UGJA 1QILA 4XDDA 4KGTA 3B08A 1JCKB 2LJ5A 4I6NB 2LVQA 1UWMA 4L2YA 5EDSA 4ZRJA 3ZJTA 5GMVA 3ALBA 1C4PA 3PVLA 2WXGA 1GC6A 1L2NA 1C77A 5AZHA 4KX6B 3H9DA 4HDOA 2YEPB 4A3OA 3ZLZA 2IO1B 1E5WA 5TSSA 1WJUA 2J4XA 4JPSA 5CTRC 2KJHB 1R4NI 2NBVB 3Q3FA 1FEHA 2CU1A 3TIXA 5IO9A 2J7QB 1EF1A 2QIEB 4J3OD 3VFKA 4B0EA 1N6ZA 4W9HA 3MC8A 3DOWA 3R2TA 3JSVA 1TKGA 4MT5A 4BKSD 2FIDA 2KDFB 2BW2A 3BINA 3DCGA 2BKRB 2QILA 2D2QA 2KNBA 4ANUA 3WAMA 3EFUA 4PYZA 2LVPA 1QOGA 2IY1B 2KQ4X 3SR6A 4HVBA 1DOIA 1GOZA 2A4ZA 2MH7A 1IBXA 2Z59B 4EOYA 1EO6A 5CX3A 5AUKA 2MJEA 2Y5CA 4II3B 5D94A 1ET9A 4A90A 2BGFA 5J2RA 3B2FA 4FXCA 2BYEA 1SSNA 4KV2A 3QAQA 1XLOA 3RPFC 2MBHA 3FILB 1V6EA 3P63A 1YOVB 3AN1A 3Q3OC 4IW0A 3A9JA 5JZEB 1YQ4B 2JVCA 2K8CA 2MEKA 1PUTA 4ANXA 2LVOA 3QHTA 2ZVNA 1P9DU 3VUYA 1TZ1A 1FMAD 1XLQA 1SIFA 2JX5A 2DAFA 3KUZA 4MJSB 4I6PA 3VUXA 4WWPA 1WE7A 2M8SA 2J52A 3OWEB 3HK0A 4REZA 2K1FA 4HPLB 4P7IA 4NQLB 3PPAA 4J6IA 3APDA 4JGHB 4HKQA 2GBJA 3W9CB 1YN3A 2KKCA 4N6EB 4HLEA 1ZPSA 3IAM1 1GB4A 3N32A 4GSWA 2HTME 2JYTA 3PGEA 2PE9A 2O6VD 2WLBA 1ZDVA 3EECA 1VZ8A 2MCNB 1P3QU 2QSDA 1F9JA 5D6JB 1I4QA 3SFDB 3A9KB 3BK1A 3HVDA 1V5OA 2N7DA 3B2GA 4W9KA 3RNEC 5C23A 1WM2A 1FRDA 2G9HD 2NCNA 1QZEA 3HUIA 3Q3JA 2IJ0A 4PYUA 3ZNID 2RDHA 1E6EB 4KDIC 3ML8A 3T9LA 2NTTA 3V62A 4AWJA 2JUOA 3W2DA 1FIQA 2L32A 2LHEA 2N9KA 2Z0DB 3QQ8B 2MHJA 1L5PA 1YJ1A 3AE1B 1EU4A 1T5XD 2MQJA 1N63A 2CHXA 1I42A 3W1SC 2NBWB 1I4RA 1QLBB 1L6VA 2V3PA 4GDLA 1D5ZC 3NZ3A 2FUG1 2IO0B 4RGOS 2D07B 1N60A 3A4SC 2B3AA 3SD5A 2KJRA 5KHQA 3V6EB 2IGGA 1EWCA 2NMQA 3J9CA 4RNAA 4BAXA 1SF0A 2KYWA 1NYQA 4DHJB 3PLUA 3ONSA 3NVWA 3PHWB 1YJJA 1SJED 1LM8B 1ENFA 1FPYA 2G3QB 4RGNA 3PRPB 4FJZA 1EM7A 2JYEA 1V9JA 2WDRB 2Y5BB 3AULA 2E6XA 2JSVX 2OEDA 1WGDA 3M95A 4LK0M 4GLSC 4MELA 4XC2A 4K7WA 2MX2A 5LXHA 1WRIA 3LDZE 2B76B 1IGCA 1WGKA 2K6DB 5JHBA 2EKEC 1L0YB 4H2AA 2W3RA 4YSZB 4IC7B 3Q8CA 3RYTA 1NEKB 5FR3A 4XDCA 2LJIA 2BYFA 3RMKC 4F7ZA 4ZHPA 2RDBC 4TQ0A 2KWVB 2QCZA 3R66C 3U52E 4Q2JA 4DXFA 1UELA 2J0MA 2QC8A 3VUWA 4K81A 4HRSA 2FCQA 1GG3A 1HQRD 4WWOA 5JHAA 3AEEB 4GOCA 4IDIA 1KLGD 1ROEA 4L23A 4JWUC 4RFBA 3RI7C 3VRBB 2D5GA 1PGXA 2AX5A 4TKNA 2JPHA 3I63C 2FUHB 2V0GA 4MJSA 3MC0B 1C3TA 4XE0A 5BO4B 4FJVB 4BKSA 2NTSA 3P2BA 3AEGB 1Z2MA 2RD0A 1G6JA 1QF6A 2AQ1B 1JRUA 3URYA 4DHZB 1VJKA 2DAJA 4PT5A 2CKHB 1WWTA 2XEWA 3QK0A 4ACFA 2VH2A 3VVWB 1RFAA 3P4RB 1RLFA 3RNFC 2FCSA 2KC2A 3NZSA 4YXDB 4A3PA 5BYSA 4EFOA 1E10A 2I2YA 4G0NB 3ZVVA 3DBHI 5CHWA 1WGRA 2ZNVB 2K5PA 5TR5A 5D3IB 3DDCB 1XLNA 1SXTA 3IAS1 2KDBA 3I5JC 2GOWA 1M4VA 1UH6A 3BK2A 1T0SC 4ASWC 4K7UA 5IOIA 4C4VB 3KYDD 1VZ6A 3ZDTA 1V1PA 4MGYE 1FFVA 3PT2B 3U4EG 4KGRA 4BBNF 2SEBD 4HPPA 5CHVC 3U7DA 4BKGA 2KLGA 4C7YA 2NBUA 4KIKB 5BMHA 1EF5A 1DGJA 4RM8A 1OEYA 1H4RA 1BXTA 1FXTB 3AEFB 5D3DA 1KRHA 3JW0X 2RPQA 4OZCA 3RNAC 1XT9B 1PQSA 4X57B 4F8CB 4WWMA 2CU3A 2WS3B 3P4SB 2YEPF 4HJGE 2W9NA 2M17A 3EA6A 2WP9B 3AB5A 4HWIB 1FM0D 4YL8A 4KKIA 1D3ZA 1FFUA 3ZUNA 3X23A 3AE6B 3VTVA 4LJPB 2LGYA 2LI5A 4MEMA 2LUMA 2D3CA 4N58A 4B95A 2DWQA 2OHFA 2ONQA 3TJPA 3M62B 3N1YC 2KD0A 2BBCA 1I4HA 2WDQB 4DQOC 1E7PB 2KVRA 2W82A 2ZPYA 2WWZA 4W9LA 3Q8EA 4NPNA 3AI5A 1RRBA 1M94A 1AN8A 2KO3A 2WXJA 5EE3A 1QT9A 1E90A 1CMXB 4DXGA 2DNFA 2FCNA 2KDEB 1U4AA 1WX9A 5MPOA 2KDIA 2BS4B 1WMHA 3GS2A 3KWLA 3NJTA 1WJNA 2DYOA 3A9KA 3OLMD 3QCAA 3W5VB 1T3QA 3S2AA 4GN1A 3HIZA 1JWAD 1L0XB 2KJ6A 4HCNB 1V1PB 2LRWA 2WX0A 2M19A 2KFKA 3Q14C 3DPDA 4YTPB 2VRRB 2KK8A 3GB1A 5E6PA 1WGYA 4MGZE 2MP2A 3IHPC 5AUIA 2BS2B 3WALA 4AJWA 3N9YC 1GJZA 2WXFA 3DHHC 3ZNGC 4EEWA 3N3KB 3R2IA 2LMCA 4W9IA 2K3UA 4MM3A 4IUMB 4LDTD 5EE1A 3PZ7A 1TBEA 2ZPNA 1KLUD 1YNTE 2WX1A 4JX1C 1WXVA 1B1ZA 2D3GA 2KT7A 2PVGC 2V1YA 4YT0B 3B0AA 2MLBA 2LFIA 2GBRA 3JVZX 2KX3A 2XBBC 4LNIA 1NVID 1WIAA 2UU7A 3I9V1 1CQVA 2KTRA 3Q69A 5BMIA 4CQNA 1XXGA 1V2YA 3PZDA 2N4FA 3UQAA 4F1SA 4WH4A 2IDYA 1F2RC 4B9KA 5CHFA 3AEDB 2JXTA 3D32A 1UD7A 1GB1A 1ZGUB 2EMTA 3GP7A 1I4GA 1ZE3D 3DBSA 1HZ5A 4A20A 4NZLB 3CMMB 1MFWA 3Q8AA 5IKCM 1WXSA 2KQSA 1XD3B 1ZP0B 1K50A 2J0JA 4ICUA 2ICIA 2O2VA 3U2SC 3Q6BA 5G5HA 5DPRA 3VRAB 4NQKE 3WAOA 5KHOA 2N7EA 4IM0A 1RFKA 3DBRB 3RNGC 1UBIA 4W9FA 1WMHB 4A8XC 3KQ4A 1OFFA 3IFWB 5D7GA 1QOBA 2N9LA 1P0RA 1HXYD 1N5XA 3AEBB 1NDDA 3PLVA 2JF5A 3QARA 1WY8A 1WRDB 1LQBA 4NAMA 3KH0A 2FCMA 4IOIE 5BYQA 2JZPA 2C7NB 1K8RB 2GB1A 2MBBB 4C4VA 3MP9A 1J19A 1C9FA 4O1NA 3VAWA 3AE8B 3RT3B 3A1QB 4A55A 1Q0WB 1J0GA 4KSKC 1KOTA 2Y5PA 3BVZA 2NR2A 1C76A 1HA5A 1UBQA 3BVMA 4WJOA 1SIJA 5FK9C 2KQ7A 4MSMB 5E6OA 1E8XA 3VTUA 3WANA 1VZ7A 2FBWB 1TGZB 1CZPA 1V8CA 1ZKHA 2A5UA 4JE3B 3T3NA 2IO3B 1FCLA 1IP9A 5EE0A 2KN4A 3AMZA 4WAFA 5H8YE 3VH3B 3ML9A 4FHJA 5IAAC 1XQQA 3HVZA 3Q3NC 2LZ6A 5HKHA 3TEYA 2AQ2B 3R7RA 3EHVA 2V3SA 2RSUA 1BUIC 4G50A 3CIRB 2BB6A 3B9JA 1GC7A 3B1LX 5G55A 1WYGA 4ZYNA 5AZFA 3C8YA 5DPTA 4MDKE 4MACA 5DPSA 1PYWD 1YD8U 2GBKA 1STEA 1J7CA 1TS2A 4LJOB 3ZJVA 3AE4B 4MSQB 4K1RB 4OW0A 3GE3C 3L10B 4MM3B 2DHZA 3HRDD 3RZFA 3U8ZA 2R2QA 4PS8A 2L00B 1ZXHA 2BKFA 3ENEA 1ISNA 3AE7B 3ETRA 3AECB 2I38A 4ARCA 3AU4A 1WX7A 3OAWA 1XF5L 2HJ1A 2Q5WD 2NPTB 2N1VA 3TEZA 3TL5A 3KLSX 2MBOA 3SU8X 5HG2A 1F0ZA 1J7AA 2LHDA 2TSSA 2KOXA 4JL9A 4EE2A 2N1WA 2PIAA 3FC4A 3UI3A 2WXMA 1C1YB 2PEAA 1KJTA 4FADA 2J0KA 4KZCA 2UWQA 1OGWA 1DOXA 1VLBA 4NJ6A 3ZXRA 4DDGD 2OJRA 1MHHE 3FKYA 2AQ3B 4N59A 4TMAB 2MW5A 1IYFA 3RULA 4K3CA 3DVNU 3QC8B 3ZJUA 4R3DA 1JMLA 3N1XC 1IGDA 2IZVB 2INDC 2N9EB 1MI0A 4EZJA 3NZUA 1R4MB 2FIFA 4PS3A 1XCTL 2DENB 2PKOA 1FRRA 5IN7A 3ZKJC 1JWBD 1OTRB 4LCDE 2RPVA 1UWXA 3JSVB 2OOBB 3R7QA 4G11A 3KUDB 1C79A 1HZ6A 2VZKB 4WQOB 4NY0A 1RAXA 1XCQL 3IBEA 4P6VF 1TS5A 1WI0A 2L1AA 1FXAA 3CSFA 2BYVE 4GB9A 3RZWC 1D5MC 1SE2A 4NJCA 2PMVA 3ZO5B 1E8ZA 1ZOYB 1Q5WB 3UIPB 2NVUI 4HCPB 3TBLD 1SE3A 1NI2A 3NS1A 4BVUC 4HPMB 3ECIA 2MP2B 4XWWA 2PLPA 4CYEA 2PTLA 3SFEB 2QDFA 4OZAA 4OZBA 2HJ8A 3NHEB 4MH8A 5AEKB 5LLIA 4ARIA 2M0AA 1IPGA 1P7FA 3P1MA 2KWCA 1V81A 3UINB 3TEWA 2V3NA 2MSED 2N9XA 1LFDA 1OQQA 2WGSA 3BYYB 3KVFB 3LJ3A 3DQVA 1NYRA 1JRPA 3AE3B 1L4ZB 4ICVA 3APCA 3VR9B 3K9OB 3NS8A 2IGDA 1WGGA 3GOEA 1Q1OA 1K53A 1TY2A 4A6QA 1KFYB 1AYFA 2KTFA 3W1YA 3QJZA 5IA7A 2D3AA 3ZRCA 1I35A 2INCC 4US8A 3DWGC 3CSTA 4LDTB 3AH7A 3RN9C 4YTMB 3ZXVA 1YQBA 3PRMB 2Y3AA 4WAAA 1HE8A 1ZXIA 4BFRA 2GBNA 2AEHA 2L05A 1Y56A 3WA0A 2GI9A 4DWFA 1T0QC 2WXNA 4GXBA 3FAHA 2O6VA 2NPTA 3ZGZA 3R3MA 4M8MA 2PJHA 4EZKA 1UGMA 2AYOB 2JQRB 1JALA 1IBXB 2ZVOA 4K3BA 2DBYA 3EGRA 3MTNB 2REXA 3P42A 3A9JB 4ZHOA 3ZTDA 3IXSA 1AARA 3DBRI 3M3JA 1S3SG 1V80A 2D11A 3CF6E 4IM2A 2DZJA 4FULA 2KWDA 1E7UA 1YMHE 3QWZB 5G5GA 3V6CB 3RCZA 1YX5B 2GLSA 3KYCD 1I4XA 2CHZA 4WJNA 3NY5A 1A5RA 2QJLA 2ZZPB 4EKUA 2C9WB 4IM3A 1ESFA 3A1QA 4W9GA 1HEZE 2EMSA 1DOYA
chains in the Genus database with same CATH topology
4RH6A 1AW7A 1ZPSA 1NVID 2GRIA 3V05A 1EWYC 2KMMA 3IAM1 3I9V1 3PO0A 1CQVA 1GB4A 3Q69A 1DYQA 5BMIA 4CQNA 1XXGA 2HTME 2M56B 2JYTA 1FD6A 1JWMD 1V97A 3H8HA 4WH4A 2WLBA 2IDYA 1ZDVA 1F2RC 3NVZA 1VZ8A 1YJIA 3AEDB 3O13A 2JXTA 2QSDA 2X38A 3V3XA 1GB1A 1I4QA 1V1OA 3LXFA 3GP7A 3VR8B 4ZYSA 2RMMA 1I4GA 3SFDB 1ZE3D 5T8IA 1SJHD 1HZ5A 2KAJA 4NZLB 2KDMA 3Q8AA 3AE9B 3BK1A 3HVDA 4RCOA 1OQRA 2J53A 3P4QB 1JWUD 3B2GA 1T6BX 1ZP0B 1K50A 3BWUD 2ZW1A 1XLPA 2ICIA 1FRDA 2G9HD 3U2SC 2CJOA 1ACCA 5G5HA 3HUIA 2IJ0A 3VRAB 2INNE 1CK1A 3TUOA 2RDHA 1E6EB 1RFKA 2BB5A 1FNWA 1C78A 1KTKA 2LEKA 2NTTA 2WU2B 4ZOHC 5FKAC 4C7ZA 3LB8C 3W2DA 2WXQA 1FIQA 2L32A 4A8XC 2LHEA 2N9KA 3KQ4A 1OFFA 1J7BA 5D7GA 1QOBA 2N9LA 5BYRA 1HXYD 2WXKA 1N5XA 1SE4A 2J42A 3AEBB 3MHZA 1L5PA 3AE1B 1EU4A 1T5XD 1N63A 4YWGG 2WXOA 3W5UB 2N0SB 2WNMA 1ZUD2 4NAMA 1QOFA 4IOIE 5BYQA 2JZPA 1I4RA 1QLBB 1L6VA 2GB1A 2V3PA 2N7JA 1D5ZC 3MP9A 3NZ3A 2FUG1 1C9FA 3EUB2 4O1NA 4RGOS 1N60A 3AE8B 1AWDA 4HROA 4A55A 4UDUC 2IGGA 1EWCA 1YN4A 2NMQA 2ZW0A 3J9CA 4RNAA 1FO4A 1SF0A 2W3SA 2Y5PA 3BVZA 1NYQA 1PFDA 1C76A 3P4PB 1HA5A 3BVMA 3NVWA 1RM6C 2DYMA 1SIJA 3ZQ4A 3BIID 5FK9C 1TYGB 4WURA 3W1SA 1F2RI 1YJJA 1SJED 4WIPA 1VZ7A 2W54A 2FBWB 1V8CA 1CZPA 1ENFA 3LYYA 3NVYA 1YN5A 4JE3B 3T3NA 1FCLA 1N61A 4HEA1 4RGNA 5EE0A 4YTNB 2E3TA 2KN4A 1EM7A 3AMZA 4NAWB 2JYEA 1EU3A 4WAFA 5H8YE 4TSSA 3IT4B 2INPE 2WDRB 1XO3A 4OVZA 1L4DB 4YSXB 2E6XA 3HVZA 3Q8FA 2JSVX 1JWSD 3CWIA 2KACA 2OEDA 2V4IB 2XN9C 1JQ4A 4LK0M 4GLSC 3TEYA 1KF6B 2AQ2B 2L83A 3ZYYX 2WXLA 3NUHB 1FCCC 1BUIC 5BMGA 2H89B 5EE9A 3CIRB 2BB6A 3B9JA 2WXHA 2WU5B 5GXGB 4OHJA 1FNUA 1NI3A 1WRIA 1WYGA 3BVGA 2DLBA 2B76B 1IGCA 1WGKA 1D4BA 1N62A 1GPXA 3C8YA 1L0YB 3Q8BA 2W3RA 2WXPA 4H2AA 4YSZB 4YSYB 3Q8CA 4MACA 1NEKB 3IT6B 1PYWD 2MJDA 1STEA 3AM9A 1J7CA 1TS2A 4XDCA 5FR3A 2LJIA 3ZJVA 3AE4B 2K22A 3I57A 2QMTA 4B0MA 1QQRA 4OW0A 4P16A 3RFZB 2PW9A 4C80A 4MM3B 4ZHPA 3HRDD 2WXRA 1RYJA 4TQ0A 3T3OA 1N5WA 3U52E 1R7SA 1ZXHA 4Q2JA 4DXFA 4AS1A 3AE7B 3ETRA 2JWUA 4HRSA 2VZKD 3AECB 2I38A 1HQRD 4ARCA 4TQ1A 3AEEB 3E56A 1L0VB 1JW9D 1PGAA 2WDVB 4IDIA 1XF5L 2Q5WD 1KLGD 5H92C 1ROEA 4L23A 4JWUC 4RFBA 2CJNA 1TS4A 3VRBB 3TEZA 2D5GA 1PGXA 3KLSX 2AX5A 2BTEA 3AE5B 2K0PA 4JWSC 1J7AA 2LHDA 4ITKA 5HG2A 2V0GA 1F0ZA 2TSSA 1TY0A 3MC0B 1XEEA 1YQ3B 2BYTA 5HFYA 4XE0A 1GAQB 4RGTA 4ZRQA 4EE2A 3R8BA 1I4PA 1VR9A 2NTSA 2PIAA 3MFGA 3FC4A 3AEGB 3UI3A 4M0WA 2WXMA 1MPEA 1QF6A 2AQ1B 1TZOA 3URYA 1E0ZA 1VJKA 4PT5A 1QKZA 1SEBD 1BMLC 1FXIA 2SAKA 1ET6A 2IPKD 1DOXA 1VLBA 5C3JB 1WWTA 1MHHE 2RDGA 1L6UA 2AQ3B 4N59A 4TMAB 5HI1A 3BYTB 1QOAA 3P4RB 2WXIA 3ZJUA 4R3DA 1RWSA 1JMLA 1LO5D 4KGSA 4YXDB 3SEBA 1IGDA 2FE8A 3VQIA 1MI0A 5BYSA 1VDVA 1E10A 2BT6A 1XCTL 2I2YA 4ZRPA 4C56C 2PKOA 1FRRA 1K51A 2R61A 5JXVA 3MJ5A 1SB3C 1Q10A 1JWBD 3TEXA 5HHDG 2MJ3A 2K5PA 2RPVA 4LLGM 5LNK1 1UWXA 5D3IB 2QEJC 3TSSA 4AQ7A 5C2TB 4IKGA 4RGMA 1XLNA 2G1EA 3AV8A 1SXTA 3BZDB 3IAS1 2ACZB 2K9XA 1C79A 1HZ6A 1P7EA 3AE2B 1D5XC 1WSPA 2VZKB 1B9RA 1M4VA 3BK2A 3PZ8A 1E9MA 5I4DA 3L4PA 1XCQL 4P6VF 2IGHA 1TS5A 4GDLB 1MVKA 2L1AA 2HDEA 1FXAA 1ZDXA 1TJEA 2ON8A 2Z8LA 1VZ6A 3NRZA 1V1PA 3FILA 1FFVA 1D5MC 4GDKB 4KGRA 3U4EG 1SE2A 2SEBD 4NJCA 2PMVA 1ZOYB 4C7YA 2XNAC 2JU6X 2W55A 1UGJA 1F77A 5BMHA 1SE3A 1QILA 3NS1A 4XDDA 1DGJA 4HKZE 4XWTA 4KGTA 4XWWA 2PLPA 2WQYB 1SBBB 1JCKB 2PTLA 1BXTA 3AEFB 3SFEB 3NVVA 5D3DA 4OZAA 1K52A 1KRHA 1C4CA 1UWMA 4L2YA 1TKEA 4OZBA 2EELA 4OZCA 4MH8A 3ZJTA 2EKIA 1TKYA 4ARIA 1MHXA 2M0AA 1C4PA 2WXGA 4A9AA 4WWMA 1C77A 2CU3A 3ABVB 1I7HA 1P7FA 3P1MA 2WS3B 4KX6B 3P4SB 2YEPF 3TEWA 4HJGE 2YEPB 2V3NA 1PGBA 1OQQA 3EA6A 2WP9B 3AB5A 1FM0D 5TSSA 2J4XA 3BYYB 4JPSA 2L52A 1FNVA 1KH0A 1NYRA 1JRPA 3AE3B 4KKIA 1L4ZB 1FEHA 3VR9B 1JROA 1FFUA 2QIEB 2IGDA 2H88B 4J3OD 3AE6B 4B0EA 3U7ZA 2LUMA 1K53A 1TY2A 3E9SA 3R2TA 1TKGA 4N58A 2DWQA 2OHFA 2ONQA 4USAA 4US9A 4MT5A 2BBCA 1I4HA 3DWMA 2BW2A 2WDQB 4A6QA 1E7PB 4DQOC 2PVOD 2W82A 1KFYB 2QILA 1AYFA 1C4AA 5E6JA 1QOGA 2KQ4X 3Q8EA 1TS3A 4US8A 3SR6A 3DWGC 1AN8A 1DOIA 1GOZA 4RF1A 3AH7A 2WXJA 2MH7A 5EE3A 4YTMB 1IBXA 1QT9A 2Y3AA 4DXGA 5AUKA 1ZXIA 2MJEA 3WCQA 2Y5CA 5MPOA 2BS4B 1ET9A 3GS2A 4A90A 1Y56A 3KWLA 2GI9A 3B2FA 2DYOA 4FXCA 2WXNA 3KWVA 1SSNA 3W5VB 1T3QA 3FAHA 2LGIA 4WQMA 1UUPA 1XLOA 3RPFC 1JWAD 1L0XB 3ZGZA 1V1PB 3FILB 2M19A 3P63A 1CJEA 3AN1A 4YTPB 1YQ4B 1JALA 2JQRB 1IBXB 4KKJA 2MEKA 1PUTA 2DBYA 3GB1A 3EGRA 1NENB 5AUIA 3P42A 4ZHOA 3IXSA 1D6EC 2BS2B 4LTUA 1FMAD 3N9YC 1XLQA 2BS3B 2JX5A 1A70A 2WXFA 4RF0A 3R2IA 2LMCA 1VRAB 2K3UA 2KWDA 1YMHE 2J52A 3OWEB 5G5GA 5EE1A 1IUEA 3PZ7A 3AEAB 4REZA 1KLUD 1YNTE 4JX1C 1I4XA 1B1ZA 1WXQA 2PVGC 2QJLA 4YT0B 4HKQA 3W9CB 1YN3A 4D2KA 1ESFA 2LFIA 4L1BA 4N6EB 1HEZE 1UNSA 1DOYA 1PDXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2W54 A;  2FBW B;  1V8C A;  1CZP A;  1NVI D;  1WWT A;  1JRO A;  1L6U A;  3NVY A;  4N59 A;  3VR9 B;  1EWY C;  1N61 A;  2KMM A;  3PO0 A;  1FFU A;  2QIE B;  5EE0 A;  4YTN B;  2H88 B;  2E3T A;  3AMZ A;  1QOA A;  3AE6 B;  5H8Y E;  3P4R B;  2HTM E;  2M56 B;  1RWS A;  2WDR B;  1XO3 A;  1TKG A;  1V97 A;  4N58 A;  4YSX B;  4YXD B;  2DWQ A;  2OHF A;  3HVZ A;  4USA A;  2WLB A;  4US9 A;  3NVZ A;  3DWM A;  2WDQ B;  1YJI A;  3CWI A;  1E7P B;  1VDV A;  2PVO D;  3AED B;  2BT6 A;  1KFY B;  1E10 A;  1JQ4 A;  1AYF A;  2PKO A;  1FRR A;  1KF6 B;  2L83 A;  1SB3 C;  3LXF A;  3ZYY X;  3VR8 B;  1JWB D;  1QOG A;  3SFD B;  4US8 A;  2MJ3 A;  3SR6 A;  2K5P A;  3DWG C;  2H89 B;  5EE9 A;  3CIR B;  3B9J A;  2KAJ A;  1DOI A;  5GXG B;  2WU5 B;  3AE9 B;  3AH7 A;  2MH7 A;  5EE3 A;  5C2T B;  1NI3 A;  1OQR A;  1WRI A;  1XLN A;  2G1E A;  1WYG A;  3AV8 A;  3P4Q B;  4YTM B;  2B76 B;  2ACZ B;  1QT9 A;  1WGK A;  2K9X A;  3B2G A;  1ZP0 B;  4IDI A;  1N62 A;  1XLP A;  3AE2 B;  5AUK A;  1B9R A;  1GPX A;  1FRD A;  1ZXI A;  2MJE A;  3AE3 B;  2Y5C A;  3WCQ A;  5MPO A;  2CJO A;  2BS4 B;  2W3R A;  4YSZ B;  1E9M A;  4YSY B;  3KWL A;  5G5H A;  3HUI A;  3B2F A;  1NEK B;  4FXC A;  3VRA B;  2MJD A;  3L4P A;  3AM9 A;  3W5V B;  1J7C A;  4P6V F;  1T3Q A;  3FAH A;  1E6E B;  3AE4 B;  4WQM A;  1XLO A;  2K22 A;  1RFK A;  3RPF C;  1JWA D;  1FXA A;  2LEK A;  2WU2 B;  1TJE A;  2M19 A;  4ZOH C;  4C7Z A;  3LB8 C;  4C80 A;  3NRZ A;  1FFV A;  3P63 A;  4ZHP A;  3HRD D;  1CJE A;  1FIQ A;  1RYJ A;  3AN1 A;  1OFF A;  1YQ4 B;  1JAL A;  2JQR B;  1J7B A;  1FXI A;  1QOB A;  1ZOY B;  1N5W A;  4YTP B;  4C7Y A;  1PUT A;  1R7S A;  1N5X A;  2DBY A;  2W55 A;  3AEB B;  3AE7 B;  1NEN B;  1L5P A;  3ETR A;  4HRS A;  3AE1 B;  5AUI A;  3NS1 A;  3AEC B;  4ZHO A;  1N63 A;  1DGJ A;  2BS2 B;  3AEE B;  2WQY B;  3W5U B;  2N0S B;  4LTU A;  1FMA D;  3AEF B;  1XLQ A;  1ZUD 2;  1L0V B;  3NVV A;  1QOF A;  3SFE B;  1JW9 D;  2WDV B;  1A70 A;  1QLB B;  2BS3 B;  2JX5 A;  1L6V A;  1KRH A;  1ROE A;  1UWM A;  2Q5W D;  4JWU C;  5H92 C;  1TKE A;  2CJN A;  5C3J B;  3VRB B;  3EUB 2;  1N60 A;  2EKI A;  1TKY A;  2AX5 A;  3AE8 B;  3AE5 B;  1F0Z A;  4JWS C;  1J7A A;  4ITK A;  1AWD A;  4HRO A;  4A9A A;  1YQ3 B;  5G5G A;  5EE1 A;  1IUE A;  1GAQ B;  3AEA B;  4WWM A;  2CU3 A;  3ABV B;  1I7H A;  1FO4 A;  3P1M A;  1SF0 A;  2W3S A;  2WS3 B;  2PIA A;  4KX6 B;  3P4S B;  4JX1 C;  3FC4 A;  1NYQ A;  3AEG B;  1PFD A;  1WXQ A;  2PVG C;  3P4P B;  1VLB A;  2QJL A;  1QF6 A;  3NVW A;  4YT0 B;  1OQQ A;  1RM6 C;  1SIJ A;  2WP9 B;  3BII D;  3AB5 A;  1TYG B;  1FM0 D;  3W9C B;  1E0Z A;  1VJK A;  1DOY A;  1YJJ A;  2L52 A;  4N6E B;  1NYR A;  1JRP A;  1DOX A;  1PDX A; 
#chains in the Genus database with same CATH topology
 4RH6 A;  3OJ4 B;  1MJD A;  3V05 A;  2L76 A;  3PO0 A;  3C19 A;  2D3B A;  2L3Z A;  4WWN A;  1FD6 A;  3PRZ A;  1V97 A;  3H8H A;  3V60 A;  1VCB A;  3A4R A;  1R4N B;  1YJI A;  3APF A;  2X38 A;  2WHI A;  1V1O A;  1P98 A;  1WR1 A;  2HE7 A;  3LXF A;  4ZYS A;  2RMM A;  5T8I A;  1SJH D;  2GBM A;  3AE9 B;  1OQR A;  1JWU D;  1T6B X;  2KZR A;  4AUQ C;  3H6N A;  2XK5 B;  2AL3 A;  1WJ6 A;  2CJO A;  1ACC A;  3GZN I;  2INN E;  3TUO A;  1HTQ A;  2UYZ B;  1FNW A;  1C78 A;  1KTK A;  2LEK A;  2WU2 B;  4RMA A;  5FKA C;  4C7Z A;  3LB8 C;  2WXQ A;  1J7B A;  5BYR A;  3RNB C;  2WXK A;  1SE4 A;  4CO7 A;  3MHZ A;  2O6V B;  1EUV B;  4S17 A;  3W5U B;  4URK A;  4KVG B;  2WNM A;  2IO2 B;  3L0W B;  5FR6 A;  3L17 A;  2N7J A;  4JIO U;  4LNN A;  2LUE A;  1V49 A;  3EUB 2;  3ZIM A;  2JT4 B;  3WIM A;  4UDU C;  1YN4 A;  3GZN B;  4DK5 A;  2W3S A;  4E3C A;  1PFD A;  2GMI C;  1RM6 C;  2DYM A;  1HTO A;  4WUR A;  1X1M A;  3W1S A;  1F2R I;  3U30 A;  1TIF A;  5J17 A;  4WIP A;  3NVY A;  3LYY A;  1YN5 A;  5G2N A;  1N61 A;  4OVV A;  4YTN B;  2E3T A;  5JH5 C;  2JZZ A;  1ZW7 A;  4YSX B;  4LNO A;  1JWS D;  1WFY A;  2KAC A;  2BWE S;  2XN9 C;  3H7P A;  1KF6 B;  3A33 B;  3AU5 A;  3VH4 B;  1Y8R C;  1FCC C;  5BMG A;  2H89 B;  5EE9 A;  2JXX A;  2WXH A;  5GXG B;  1FNU A;  1NI3 A;  2LAS A;  4ANV A;  2DLB A;  4N9F 4;  1D4B A;  1N62 A;  3MJW A;  2WXP A;  2BQQ A;  4YSY B;  3EC8 A;  3IT6 B;  5IP4 D;  3I57 A;  3PSE B;  2QMT A;  1H8C A;  4DXA B;  1S1Q B;  4P16 A;  3RFZ B;  1WJ4 A;  1LXD A;  4B6W A;  1RYJ A;  4DHZ E;  3QIJ A;  4E71 A;  2CHW A;  2VZK D;  3DBL B;  2G4D B;  5DPW A;  3E56 A;  1L0V B;  1WM3 A;  2N9P C;  5H92 C;  2DX5 B;  3UQB A;  1TS4 A;  2K0P A;  4JWS C;  1TY0 A;  3KW5 B;  1GAQ B;  4ZRQ A;  2PE6 B;  3H7S A;  2DZM A;  3R8B A;  4XYC A;  1MPE A;  3QX1 A;  3IG3 A;  3L16 A;  1TZO A;  4W9C A;  2M0X A;  1QKZ A;  1BML C;  1FXI A;  2RDG A;  4EUT A;  5HI1 A;  3QA8 A;  3T8M A;  2G4S A;  2WXI A;  4MGK E;  3ZTC A;  3VHT C;  4KGS A;  3SEB A;  4P1C C;  1VD2 A;  2ZJD A;  2FE8 A;  3VQI A;  1VDV A;  4IWO A;  4C56 C;  4DHJ D;  5JXV A;  1K51 A;  4M01 A;  3MJ5 A;  2LXA A;  2K25 A;  4OVU A;  5HHD G;  4LLG M;  5LNK 1;  2QEJ C;  3DVN V;  3C0R B;  1E7V A;  4BKT A;  4IKG A;  4RGM A;  2G1E A;  2VH1 A;  3AV8 A;  3BZD B;  2K9X A;  4ZDV A;  3JYU A;  1P7E A;  1D5X C;  1MG4 A;  3PZ8 A;  2JWZ A;  1E9M A;  2LGS A;  3NOB A;  2X8X X;  3OG5 A;  2HD5 B;  3L4P A;  3NG0 A;  2L0F A;  2XK5 A;  1V5T A;  4TUU A;  2IGH A;  1UZX B;  1MVK A;  2HDE A;  1ZDX A;  2KFK B;  1TJE A;  1OQY A;  2LWP A;  2L7R A;  1YX6 B;  2JRI B;  2W55 A;  1F77 A;  2WYQ A;  3ZW3 A;  3AXC A;  3X0W A;  4HKZ E;  5L95 C;  4XWT A;  2WQY B;  1SBB B;  3HM6 X;  3NVV A;  1UF0 A;  4FJY A;  3RUI B;  1K52 A;  1C4C A;  1TKE A;  2EEL A;  4C00 A;  2EKI A;  1TKY A;  2ZCB A;  4GDK A;  2D10 A;  1MHX A;  2HTH A;  4TV3 A;  4EZL A;  2CS4 A;  2I1K A;  4A9A A;  3ABV B;  1I7H A;  3V61 A;  1PGB A;  2LGD A;  4ANW A;  4LNF A;  3UF8 A;  2L52 A;  1FNV A;  1KH0 A;  4MH0 E;  4CHK A;  4NAW A;  1JRO A;  2ZEQ A;  2ASQ A;  3SHQ A;  2H88 B;  2BVC A;  3U7Z A;  4E74 A;  4IWQ A;  3E9S A;  3SDL C;  2LRU A;  1WE6 A;  4IG7 B;  3RNC C;  3OJ3 A;  4USA A;  4US9 A;  3VXW A;  3DWM A;  2PVO D;  2MWS B;  1C4A A;  5E6J A;  1WZ3 A;  3IVF A;  1TS3 A;  2KHW B;  4RF1 A;  4P1B C;  2QHO A;  4K7S A;  4W9J A;  4AP4 C;  3WCQ A;  2MBQ A;  3DBH B;  3O65 B;  2KX0 A;  3KWV A;  2PPH A;  2R2O A;  2NS5 A;  2LGI A;  2ZCC A;  4WQM A;  1UUP A;  2IBI B;  4GGQ A;  1CJE A;  4HJK A;  3VTW A;  2OJW A;  4KKJ A;  2K6Q A;  2MBE A;  1NEN B;  1WF9 A;  1WGH A;  3DHI C;  4KZ0 A;  1D6E C;  2KVZ A;  4LTU A;  2C5L C;  1A70 A;  2BS3 B;  2KXJ A;  4ZRK A;  5DCN A;  4RF0 A;  1R4M I;  4WJQ A;  1VRA B;  4HXD A;  3HM3 A;  1IUE A;  3AEA B;  4AJY B;  3PV1 A;  1WXQ A;  2L8J A;  2KMC A;  2C7M B;  4D2K A;  1L7Y A;  1T0Y A;  4L1B A;  2LXC A;  1UNS A;  4ZRI A;  1PDX A;  2YLM A;  1SE9 A;  1WYW B;  2AL6 A;  1AW7 A;  2GRI A;  1EWY C;  2KMM A;  1V86 A;  1DYQ A;  4KSL C;  2I1J A;  2M56 B;  4W9E A;  4PS7 A;  1JWM D;  2K8B A;  3NVZ A;  4QAY A;  3O13 A;  3DVG X;  4MGI E;  3V3X A;  3VR8 B;  3EFC A;  4M00 A;  2V4L A;  3DVG Y;  2KAJ A;  2KDM A;  4RCO A;  2J53 A;  3P4Q B;  2KTR B;  3Q2A C;  4GIV A;  3PHX B;  1WXA A;  3BWU D;  2YVC A;  2ZW1 A;  1XLP A;  4HK2 A;  3N1Z C;  2DZI A;  3HHM A;  1TT5 B;  4FLH A;  1CK1 A;  1YIW A;  2Z0E B;  2BB5 A;  3ZNH B;  3K9P B;  4ZOH C;  4NNJ B;  3Q3M C;  1E8W A;  3PRE A;  1TTN A;  4G3X B;  4BOS C;  4BOZ B;  3M63 B;  4XZ4 A;  2ZNV C;  3L13 A;  2J42 A;  1NBF C;  4HDQ A;  4BBN C;  4GMV A;  3UIO B;  4YWG G;  2DYB A;  2CR5 A;  2WXO A;  4I6L B;  2N0S B;  1ZUD 2;  1QOF A;  2WDT B;  4S0R A;  2RR9 A;  3L08 A;  2AWT A;  2BPS A;  3N30 A;  1AWD A;  4HRO A;  3DBL I;  2ZW0 A;  1WZ0 A;  1BT0 A;  3KUC B;  2BWF A;  4LNK A;  1FO4 A;  4II2 B;  3ZNZ B;  1OEY J;  3MC9 A;  3P4P B;  1E8Y A;  4FBJ B;  4M0W B;  3ZQ4 A;  3BII D;  1TYG B;  1J8C A;  4JLC A;  2W54 A;  4WJP A;  4HEA 1;  4NJ7 A;  4NAW B;  1EU3 A;  2C7H A;  4TSS A;  4DBG A;  3IT4 B;  2INP E;  1P1A A;  1XO3 A;  4OVZ A;  1L4D B;  3H7P B;  3Q8F A;  2K8H A;  3MHS D;  2M4N A;  3CWI A;  2V4I B;  1JQ4 A;  4W9D A;  3PS6 A;  2FNJ B;  2M1M A;  2MRP A;  2L83 A;  3ZYY X;  1KLV A;  1F52 A;  3ZRF A;  2FAZ A;  2WXL A;  3NUH B;  4XX5 A;  2BF8 B;  2WU5 B;  4OHJ A;  1WX8 A;  3BVG A;  3L54 A;  4GU2 A;  3GE8 C;  1GPX A;  3BY4 B;  3ZDM C;  3RD2 A;  3Q8B A;  2O2V B;  4KDL B;  2JRH A;  2MJD A;  3AM9 A;  1MG8 A;  5AZG A;  2K22 A;  4AOF A;  4B0M A;  1SGH A;  1QQR A;  2PW9 A;  4C80 A;  4IWP A;  2WXR A;  2IYD B;  3T3O A;  4KIK A;  1N5W A;  1R7S A;  4AS1 A;  5J18 A;  2KLC A;  2JWU A;  2MA9 B;  2KC1 A;  4TQ1 A;  1Z5S B;  4FHK A;  3DHG C;  4PK1 A;  2LGX A;  1JW9 D;  1PGA A;  2WDV B;  1GUA B;  2DZK A;  2CJN A;  3N20 C;  1WR6 E;  2BTE A;  1LGR A;  3AE5 B;  4RM9 A;  4ITK A;  1XEE A;  1YQ3 B;  2BYT A;  5HFY A;  4RGT A;  2KN5 A;  3PTF C;  3TMP B;  1I4P A;  1VR9 A;  2KWU B;  3MFG A;  4DDI D;  1F1H A;  4M0W A;  3UGB B;  5L83 A;  5C1Z A;  3WAP A;  2KMA A;  3I3T B;  1E0Z A;  1SEB D;  2SAK A;  1ET6 A;  2IPK D;  3H1U A;  4FN2 A;  5C3J B;  4M8N A;  1L6U A;  3BYT B;  1QOA A;  2RGF A;  2KFJ A;  4FA6 A;  5LXI B;  1RWS A;  1LO5 D;  1GNU A;  2G45 B;  3TCA A;  2BT6 A;  4ZRP A;  2R61 A;  1T0R C;  1SB3 C;  1Q10 A;  3TEX A;  2MJ3 A;  4XGA B;  4M02 A;  2JZ3 B;  3TSS A;  4AQ7 A;  5C2T B;  4BZA A;  2ACZ B;  2KAN A;  5E6N A;  3AE2 B;  1B9R A;  1WSP A;  5I4D A;  2L0T A;  4JQW C;  5D2M B;  1WXM A;  4GDL B;  2K39 A;  3VDZ A;  2ON8 A;  2IY0 B;  2Z8L A;  2V9H A;  2C60 A;  3NRZ A;  3FIL A;  4GDK B;  2JY6 A;  2LD9 A;  1WH3 A;  2XNA C;  2JU6 X;  1KM7 A;  1UGJ A;  1QIL A;  4XDD A;  4KGT A;  3B08 A;  1JCK B;  2LJ5 A;  4I6N B;  2LVQ A;  1UWM A;  4L2Y A;  5EDS A;  4ZRJ A;  3ZJT A;  5GMV A;  3ALB A;  1C4P A;  3PVL A;  2WXG A;  1GC6 A;  1L2N A;  1C77 A;  5AZH A;  4KX6 B;  3H9D A;  4HDO A;  2YEP B;  4A3O A;  3ZLZ A;  2IO1 B;  1E5W A;  5TSS A;  1WJU A;  2J4X A;  4JPS A;  5CTR C;  2KJH B;  1R4N I;  2NBV B;  3Q3F A;  1FEH A;  2CU1 A;  3TIX A;  5IO9 A;  2J7Q B;  1EF1 A;  2QIE B;  4J3O D;  3VFK A;  4B0E A;  1N6Z A;  4W9H A;  3MC8 A;  3DOW A;  3R2T A;  3JSV A;  1TKG A;  4MT5 A;  4BKS D;  2FID A;  2KDF B;  2BW2 A;  3BIN A;  3DCG A;  2BKR B;  2QIL A;  2D2Q A;  2KNB A;  4ANU A;  3WAM A;  3EFU A;  4PYZ A;  2LVP A;  1QOG A;  2IY1 B;  2KQ4 X;  3SR6 A;  4HVB A;  1DOI A;  1GOZ A;  2A4Z A;  2MH7 A;  1IBX A;  2Z59 B;  4EOY A;  1EO6 A;  5CX3 A;  5AUK A;  2MJE A;  2Y5C A;  4II3 B;  5D94 A;  1ET9 A;  4A90 A;  2BGF A;  5J2R A;  3B2F A;  4FXC A;  2BYE A;  1SSN A;  4KV2 A;  3QAQ A;  1XLO A;  3RPF C;  2MBH A;  3FIL B;  1V6E A;  3P63 A;  1YOV B;  3AN1 A;  3Q3O C;  4IW0 A;  3A9J A;  5JZE B;  1YQ4 B;  2JVC A;  2K8C A;  2MEK A;  1PUT A;  4ANX A;  2LVO A;  3QHT A;  2ZVN A;  1P9D U;  3VUY A;  1TZ1 A;  1FMA D;  1XLQ A;  1SIF A;  2JX5 A;  2DAF A;  3KUZ A;  4MJS B;  4I6P A;  3VUX A;  4WWP A;  1WE7 A;  2M8S A;  2J52 A;  3OWE B;  3HK0 A;  4REZ A;  2K1F A;  4HPL B;  4P7I A;  4NQL B;  3PPA A;  4J6I A;  3APD A;  4JGH B;  4HKQ A;  2GBJ A;  3W9C B;  1YN3 A;  2KKC A;  4N6E B;  4HLE A;  1ZPS A;  3IAM 1;  1GB4 A;  3N32 A;  4GSW A;  2HTM E;  2JYT A;  3PGE A;  2PE9 A;  2O6V D;  2WLB A;  1ZDV A;  3EEC A;  1VZ8 A;  2MCN B;  1P3Q U;  2QSD A;  1F9J A;  5D6J B;  1I4Q A;  3SFD B;  3A9K B;  3BK1 A;  3HVD A;  1V5O A;  2N7D A;  3B2G A;  4W9K A;  3RNE C;  5C23 A;  1WM2 A;  1FRD A;  2G9H D;  2NCN A;  1QZE A;  3HUI A;  3Q3J A;  2IJ0 A;  4PYU A;  3ZNI D;  2RDH A;  1E6E B;  4KDI C;  3ML8 A;  3T9L A;  2NTT A;  3V62 A;  4AWJ A;  2JUO A;  3W2D A;  1FIQ A;  2L32 A;  2LHE A;  2N9K A;  2Z0D B;  3QQ8 B;  2MHJ A;  1L5P A;  1YJ1 A;  3AE1 B;  1EU4 A;  1T5X D;  2MQJ A;  1N63 A;  2CHX A;  1I42 A;  3W1S C;  2NBW B;  1I4R A;  1QLB B;  1L6V A;  2V3P A;  4GDL A;  1D5Z C;  3NZ3 A;  2FUG 1;  2IO0 B;  4RGO S;  2D07 B;  1N60 A;  3A4S C;  2B3A A;  3SD5 A;  2KJR A;  5KHQ A;  3V6E B;  2IGG A;  1EWC A;  2NMQ A;  3J9C A;  4RNA A;  4BAX A;  1SF0 A;  2KYW A;  1NYQ A;  4DHJ B;  3PLU A;  3ONS A;  3NVW A;  3PHW B;  1YJJ A;  1SJE D;  1LM8 B;  1ENF A;  1FPY A;  2G3Q B;  4RGN A;  3PRP B;  4FJZ A;  1EM7 A;  2JYE A;  1V9J A;  2WDR B;  2Y5B B;  3AUL A;  2E6X A;  2JSV X;  2OED A;  1WGD A;  3M95 A;  4LK0 M;  4GLS C;  4MEL A;  4XC2 A;  4K7W A;  2MX2 A;  5LXH A;  1WRI A;  3LDZ E;  2B76 B;  1IGC A;  1WGK A;  2K6D B;  5JHB A;  2EKE C;  1L0Y B;  4H2A A;  2W3R A;  4YSZ B;  4IC7 B;  3Q8C A;  3RYT A;  1NEK B;  5FR3 A;  4XDC A;  2LJI A;  2BYF A;  3RMK C;  4F7Z A;  4ZHP A;  2RDB C;  4TQ0 A;  2KWV B;  2QCZ A;  3R66 C;  3U52 E;  4Q2J A;  4DXF A;  1UEL A;  2J0M A;  2QC8 A;  3VUW A;  4K81 A;  4HRS A;  2FCQ A;  1GG3 A;  1HQR D;  4WWO A;  5JHA A;  3AEE B;  4GOC A;  4IDI A;  1KLG D;  1ROE A;  4L23 A;  4JWU C;  4RFB A;  3RI7 C;  3VRB B;  2D5G A;  1PGX A;  2AX5 A;  4TKN A;  2JPH A;  3I63 C;  2FUH B;  2V0G A;  4MJS A;  3MC0 B;  1C3T A;  4XE0 A;  5BO4 B;  4FJV B;  4BKS A;  2NTS A;  3P2B A;  3AEG B;  1Z2M A;  2RD0 A;  1G6J A;  1QF6 A;  2AQ1 B;  1JRU A;  3URY A;  4DHZ B;  1VJK A;  2DAJ A;  4PT5 A;  2CKH B;  1WWT A;  2XEW A;  3QK0 A;  4ACF A;  2VH2 A;  3VVW B;  1RFA A;  3P4R B;  1RLF A;  3RNF C;  2FCS A;  2KC2 A;  3NZS A;  4YXD B;  4A3P A;  5BYS A;  4EFO A;  1E10 A;  2I2Y A;  4G0N B;  3ZVV A;  3DBH I;  5CHW A;  1WGR A;  2ZNV B;  2K5P A;  5TR5 A;  5D3I B;  3DDC B;  1XLN A;  1SXT A;  3IAS 1;  2KDB A;  3I5J C;  2GOW A;  1M4V A;  1UH6 A;  3BK2 A;  1T0S C;  4ASW C;  4K7U A;  5IOI A;  4C4V B;  3KYD D;  1VZ6 A;  3ZDT A;  1V1P A;  4MGY E;  1FFV A;  3PT2 B;  3U4E G;  4KGR A;  4BBN F;  2SEB D;  4HPP A;  5CHV C;  3U7D A;  4BKG A;  2KLG A;  4C7Y A;  2NBU A;  4KIK B;  5BMH A;  1EF5 A;  1DGJ A;  4RM8 A;  1OEY A;  1H4R A;  1BXT A;  1FXT B;  3AEF B;  5D3D A;  1KRH A;  3JW0 X;  2RPQ A;  4OZC A;  3RNA C;  1XT9 B;  1PQS A;  4X57 B;  4F8C B;  4WWM A;  2CU3 A;  2WS3 B;  3P4S B;  2YEP F;  4HJG E;  2W9N A;  2M17 A;  3EA6 A;  2WP9 B;  3AB5 A;  4HWI B;  1FM0 D;  4YL8 A;  4KKI A;  1D3Z A;  1FFU A;  3ZUN A;  3X23 A;  3AE6 B;  3VTV A;  4LJP B;  2LGY A;  2LI5 A;  4MEM A;  2LUM A;  2D3C A;  4N58 A;  4B95 A;  2DWQ A;  2OHF A;  2ONQ A;  3TJP A;  3M62 B;  3N1Y C;  2KD0 A;  2BBC A;  1I4H A;  2WDQ B;  4DQO C;  1E7P B;  2KVR A;  2W82 A;  2ZPY A;  2WWZ A;  4W9L A;  3Q8E A;  4NPN A;  3AI5 A;  1RRB A;  1M94 A;  1AN8 A;  2KO3 A;  2WXJ A;  5EE3 A;  1QT9 A;  1E90 A;  1CMX B;  4DXG A;  2DNF A;  2FCN A;  2KDE B;  1U4A A;  1WX9 A;  5MPO A;  2KDI A;  2BS4 B;  1WMH A;  3GS2 A;  3KWL A;  3NJT A;  1WJN A;  2DYO A;  3A9K A;  3OLM D;  3QCA A;  3W5V B;  1T3Q A;  3S2A A;  4GN1 A;  3HIZ A;  1JWA D;  1L0X B;  2KJ6 A;  4HCN B;  1V1P B;  2LRW A;  2WX0 A;  2M19 A;  2KFK A;  3Q14 C;  3DPD A;  4YTP B;  2VRR B;  2KK8 A;  3GB1 A;  5E6P A;  1WGY A;  4MGZ E;  2MP2 A;  3IHP C;  5AUI A;  2BS2 B;  3WAL A;  4AJW A;  3N9Y C;  1GJZ A;  2WXF A;  3DHH C;  3ZNG C;  4EEW A;  3N3K B;  3R2I A;  2LMC A;  4W9I A;  2K3U A;  4MM3 A;  4IUM B;  4LDT D;  5EE1 A;  3PZ7 A;  1TBE A;  2ZPN A;  1KLU D;  1YNT E;  2WX1 A;  4JX1 C;  1WXV A;  1B1Z A;  2D3G A;  2KT7 A;  2PVG C;  2V1Y A;  4YT0 B;  3B0A A;  2MLB A;  2LFI A;  2GBR A;  3JVZ X;  2KX3 A;  2XBB C;  4LNI A;  1NVI D;  1WIA A;  2UU7 A;  3I9V 1;  1CQV A;  2KTR A;  3Q69 A;  5BMI A;  4CQN A;  1XXG A;  1V2Y A;  3PZD A;  2N4F A;  3UQA A;  4F1S A;  4WH4 A;  2IDY A;  1F2R C;  4B9K A;  5CHF A;  3AED B;  2JXT A;  3D32 A;  1UD7 A;  1GB1 A;  1ZGU B;  2EMT A;  3GP7 A;  1I4G A;  1ZE3 D;  3DBS A;  1HZ5 A;  4A20 A;  4NZL B;  3CMM B;  1MFW A;  3Q8A A;  5IKC M;  1WXS A;  2KQS A;  1XD3 B;  1ZP0 B;  1K50 A;  2J0J A;  4ICU A;  2ICI A;  2O2V A;  3U2S C;  3Q6B A;  5G5H A;  5DPR A;  3VRA B;  4NQK E;  3WAO A;  5KHO A;  2N7E A;  4IM0 A;  1RFK A;  3DBR B;  3RNG C;  1UBI A;  4W9F A;  1WMH B;  4A8X C;  3KQ4 A;  1OFF A;  3IFW B;  5D7G A;  1QOB A;  2N9L A;  1P0R A;  1HXY D;  1N5X A;  3AEB B;  1NDD A;  3PLV A;  2JF5 A;  3QAR A;  1WY8 A;  1WRD B;  1LQB A;  4NAM A;  3KH0 A;  2FCM A;  4IOI E;  5BYQ A;  2JZP A;  2C7N B;  1K8R B;  2GB1 A;  2MBB B;  4C4V A;  3MP9 A;  1J19 A;  1C9F A;  4O1N A;  3VAW A;  3AE8 B;  3RT3 B;  3A1Q B;  4A55 A;  1Q0W B;  1J0G A;  4KSK C;  1KOT A;  2Y5P A;  3BVZ A;  2NR2 A;  1C76 A;  1HA5 A;  1UBQ A;  3BVM A;  4WJO A;  1SIJ A;  5FK9 C;  2KQ7 A;  4MSM B;  5E6O A;  1E8X A;  3VTU A;  3WAN A;  1VZ7 A;  2FBW B;  1TGZ B;  1CZP A;  1V8C A;  1ZKH A;  2A5U A;  4JE3 B;  3T3N A;  2IO3 B;  1FCL A;  1IP9 A;  5EE0 A;  2KN4 A;  3AMZ A;  4WAF A;  5H8Y E;  3VH3 B;  3ML9 A;  4FHJ A;  5IAA C;  1XQQ A;  3HVZ A;  3Q3N C;  2LZ6 A;  5HKH A;  3TEY A;  2AQ2 B;  3R7R A;  3EHV A;  2V3S A;  2RSU A;  1BUI C;  4G50 A;  3CIR B;  2BB6 A;  3B9J A;  1GC7 A;  3B1L X;  5G55 A;  1WYG A;  4ZYN A;  5AZF A;  3C8Y A;  5DPT A;  4MDK E;  4MAC A;  5DPS A;  1PYW D;  1YD8 U;  2GBK A;  1STE A;  1J7C A;  1TS2 A;  4LJO B;  3ZJV A;  3AE4 B;  4MSQ B;  4K1R B;  4OW0 A;  3GE3 C;  3L10 B;  4MM3 B;  2DHZ A;  3HRD D;  3RZF A;  3U8Z A;  2R2Q A;  4PS8 A;  2L00 B;  1ZXH A;  2BKF A;  3ENE A;  1ISN A;  3AE7 B;  3ETR A;  3AEC B;  2I38 A;  4ARC A;  3AU4 A;  1WX7 A;  3OAW A;  1XF5 L;  2HJ1 A;  2Q5W D;  2NPT B;  2N1V A;  3TEZ A;  3TL5 A;  3KLS X;  2MBO A;  3SU8 X;  5HG2 A;  1F0Z A;  1J7A A;  2LHD A;  2TSS A;  2KOX A;  4JL9 A;  4EE2 A;  2N1W A;  2PIA A;  3FC4 A;  3UI3 A;  2WXM A;  1C1Y B;  2PEA A;  1KJT A;  4FAD A;  2J0K A;  4KZC A;  2UWQ A;  1OGW A;  1DOX A;  1VLB A;  4NJ6 A;  3ZXR A;  4DDG D;  2OJR A;  1MHH E;  3FKY A;  2AQ3 B;  4N59 A;  4TMA B;  2MW5 A;  1IYF A;  3RUL A;  4K3C A;  3DVN U;  3QC8 B;  3ZJU A;  4R3D A;  1JML A;  3N1X C;  1IGD A;  2IZV B;  2IND C;  2N9E B;  1MI0 A;  4EZJ A;  3NZU A;  1R4M B;  2FIF A;  4PS3 A;  1XCT L;  2DEN B;  2PKO A;  1FRR A;  5IN7 A;  3ZKJ C;  1JWB D;  1OTR B;  4LCD E;  2RPV A;  1UWX A;  3JSV B;  2OOB B;  3R7Q A;  4G11 A;  3KUD B;  1C79 A;  1HZ6 A;  2VZK B;  4WQO B;  4NY0 A;  1RAX A;  1XCQ L;  3IBE A;  4P6V F;  1TS5 A;  1WI0 A;  2L1A A;  1FXA A;  3CSF A;  2BYV E;  4GB9 A;  3RZW C;  1D5M C;  1SE2 A;  4NJC A;  2PMV A;  3ZO5 B;  1E8Z A;  1ZOY B;  1Q5W B;  3UIP B;  2NVU I;  4HCP B;  3TBL D;  1SE3 A;  1NI2 A;  3NS1 A;  4BVU C;  4HPM B;  3ECI A;  2MP2 B;  4XWW A;  2PLP A;  4CYE A;  2PTL A;  3SFE B;  2QDF A;  4OZA A;  4OZB A;  2HJ8 A;  3NHE B;  4MH8 A;  5AEK B;  5LLI A;  4ARI A;  2M0A A;  1IPG A;  1P7F A;  3P1M A;  2KWC A;  1V81 A;  3UIN B;  3TEW A;  2V3N A;  2MSE D;  2N9X A;  1LFD A;  1OQQ A;  2WGS A;  3BYY B;  3KVF B;  3LJ3 A;  3DQV A;  1NYR A;  1JRP A;  3AE3 B;  1L4Z B;  4ICV A;  3APC A;  3VR9 B;  3K9O B;  3NS8 A;  2IGD A;  1WGG A;  3GOE A;  1Q1O A;  1K53 A;  1TY2 A;  4A6Q A;  1KFY B;  1AYF A;  2KTF A;  3W1Y A;  3QJZ A;  5IA7 A;  2D3A A;  3ZRC A;  1I35 A;  2INC C;  4US8 A;  3DWG C;  3CST A;  4LDT B;  3AH7 A;  3RN9 C;  4YTM B;  3ZXV A;  1YQB A;  3PRM B;  2Y3A A;  4WAA A;  1HE8 A;  1ZXI A;  4BFR A;  2GBN A;  2AEH A;  2L05 A;  1Y56 A;  3WA0 A;  2GI9 A;  4DWF A;  1T0Q C;  2WXN A;  4GXB A;  3FAH A;  2O6V A;  2NPT A;  3ZGZ A;  3R3M A;  4M8M A;  2PJH A;  4EZK A;  1UGM A;  2AYO B;  2JQR B;  1JAL A;  1IBX B;  2ZVO A;  4K3B A;  2DBY A;  3EGR A;  3MTN B;  2REX A;  3P42 A;  3A9J B;  4ZHO A;  3ZTD A;  3IXS A;  1AAR A;  3DBR I;  3M3J A;  1S3S G;  1V80 A;  2D11 A;  3CF6 E;  4IM2 A;  2DZJ A;  4FUL A;  2KWD A;  1E7U A;  1YMH E;  3QWZ B;  5G5G A;  3V6C B;  3RCZ A;  1YX5 B;  2GLS A;  3KYC D;  1I4X A;  2CHZ A;  4WJN A;  3NY5 A;  1A5R A;  2QJL A;  2ZZP B;  4EKU A;  2C9W B;  4IM3 A;  1ESF A;  3A1Q A;  4W9G A;  1HEZ E;  2EMS A;  1DOY A; 
#chains in the Genus database with same CATH homology
 4RH6 A;  1AW7 A;  1ZPS A;  1NVI D;  2GRI A;  3V05 A;  1EWY C;  2KMM A;  3IAM 1;  3I9V 1;  3PO0 A;  1CQV A;  1GB4 A;  3Q69 A;  1DYQ A;  5BMI A;  4CQN A;  1XXG A;  2HTM E;  2M56 B;  2JYT A;  1FD6 A;  1JWM D;  1V97 A;  3H8H A;  4WH4 A;  2WLB A;  2IDY A;  1ZDV A;  1F2R C;  3NVZ A;  1VZ8 A;  1YJI A;  3AED B;  3O13 A;  2JXT A;  2QSD A;  2X38 A;  3V3X A;  1GB1 A;  1I4Q A;  1V1O A;  3LXF A;  3GP7 A;  3VR8 B;  4ZYS A;  2RMM A;  1I4G A;  3SFD B;  1ZE3 D;  5T8I A;  1SJH D;  1HZ5 A;  2KAJ A;  4NZL B;  2KDM A;  3Q8A A;  3AE9 B;  3BK1 A;  3HVD A;  4RCO A;  1OQR A;  2J53 A;  3P4Q B;  1JWU D;  3B2G A;  1T6B X;  1ZP0 B;  1K50 A;  3BWU D;  2ZW1 A;  1XLP A;  2ICI A;  1FRD A;  2G9H D;  3U2S C;  2CJO A;  1ACC A;  5G5H A;  3HUI A;  2IJ0 A;  3VRA B;  2INN E;  1CK1 A;  3TUO A;  2RDH A;  1E6E B;  1RFK A;  2BB5 A;  1FNW A;  1C78 A;  1KTK A;  2LEK A;  2NTT A;  2WU2 B;  4ZOH C;  5FKA C;  4C7Z A;  3LB8 C;  3W2D A;  2WXQ A;  1FIQ A;  2L32 A;  4A8X C;  2LHE A;  2N9K A;  3KQ4 A;  1OFF A;  1J7B A;  5D7G A;  1QOB A;  2N9L A;  5BYR A;  1HXY D;  2WXK A;  1N5X A;  1SE4 A;  2J42 A;  3AEB B;  3MHZ A;  1L5P A;  3AE1 B;  1EU4 A;  1T5X D;  1N63 A;  4YWG G;  2WXO A;  3W5U B;  2N0S B;  2WNM A;  1ZUD 2;  4NAM A;  1QOF A;  4IOI E;  5BYQ A;  2JZP A;  1I4R A;  1QLB B;  1L6V A;  2GB1 A;  2V3P A;  2N7J A;  1D5Z C;  3MP9 A;  3NZ3 A;  2FUG 1;  1C9F A;  3EUB 2;  4O1N A;  4RGO S;  1N60 A;  3AE8 B;  1AWD A;  4HRO A;  4A55 A;  4UDU C;  2IGG A;  1EWC A;  1YN4 A;  2NMQ A;  2ZW0 A;  3J9C A;  4RNA A;  1FO4 A;  1SF0 A;  2W3S A;  2Y5P A;  3BVZ A;  1NYQ A;  1PFD A;  1C76 A;  3P4P B;  1HA5 A;  3BVM A;  3NVW A;  1RM6 C;  2DYM A;  1SIJ A;  3ZQ4 A;  3BII D;  5FK9 C;  1TYG B;  4WUR A;  3W1S A;  1F2R I;  1YJJ A;  1SJE D;  4WIP A;  1VZ7 A;  2W54 A;  2FBW B;  1V8C A;  1CZP A;  1ENF A;  3LYY A;  3NVY A;  1YN5 A;  4JE3 B;  3T3N A;  1FCL A;  1N61 A;  4HEA 1;  4RGN A;  5EE0 A;  4YTN B;  2E3T A;  2KN4 A;  1EM7 A;  3AMZ A;  4NAW B;  2JYE A;  1EU3 A;  4WAF A;  5H8Y E;  4TSS A;  3IT4 B;  2INP E;  2WDR B;  1XO3 A;  4OVZ A;  1L4D B;  4YSX B;  2E6X A;  3HVZ A;  3Q8F A;  2JSV X;  1JWS D;  3CWI A;  2KAC A;  2OED A;  2V4I B;  2XN9 C;  1JQ4 A;  4LK0 M;  4GLS C;  3TEY A;  1KF6 B;  2AQ2 B;  2L83 A;  3ZYY X;  2WXL A;  3NUH B;  1FCC C;  1BUI C;  5BMG A;  2H89 B;  5EE9 A;  3CIR B;  2BB6 A;  3B9J A;  2WXH A;  2WU5 B;  5GXG B;  4OHJ A;  1FNU A;  1NI3 A;  1WRI A;  1WYG A;  3BVG A;  2DLB A;  2B76 B;  1IGC A;  1WGK A;  1D4B A;  1N62 A;  1GPX A;  3C8Y A;  1L0Y B;  3Q8B A;  2W3R A;  2WXP A;  4H2A A;  4YSZ B;  4YSY B;  3Q8C A;  4MAC A;  1NEK B;  3IT6 B;  1PYW D;  2MJD A;  1STE A;  3AM9 A;  1J7C A;  1TS2 A;  4XDC A;  5FR3 A;  2LJI A;  3ZJV A;  3AE4 B;  2K22 A;  3I57 A;  2QMT A;  4B0M A;  1QQR A;  4OW0 A;  4P16 A;  3RFZ B;  2PW9 A;  4C80 A;  4MM3 B;  4ZHP A;  3HRD D;  2WXR A;  1RYJ A;  4TQ0 A;  3T3O A;  1N5W A;  3U52 E;  1R7S A;  1ZXH A;  4Q2J A;  4DXF A;  4AS1 A;  3AE7 B;  3ETR A;  2JWU A;  4HRS A;  2VZK D;  3AEC B;  2I38 A;  1HQR D;  4ARC A;  4TQ1 A;  3AEE B;  3E56 A;  1L0V B;  1JW9 D;  1PGA A;  2WDV B;  4IDI A;  1XF5 L;  2Q5W D;  1KLG D;  5H92 C;  1ROE A;  4L23 A;  4JWU C;  4RFB A;  2CJN A;  1TS4 A;  3VRB B;  3TEZ A;  2D5G A;  1PGX A;  3KLS X;  2AX5 A;  2BTE A;  3AE5 B;  2K0P A;  4JWS C;  1J7A A;  2LHD A;  4ITK A;  5HG2 A;  2V0G A;  1F0Z A;  2TSS A;  1TY0 A;  3MC0 B;  1XEE A;  1YQ3 B;  2BYT A;  5HFY A;  4XE0 A;  1GAQ B;  4RGT A;  4ZRQ A;  4EE2 A;  3R8B A;  1I4P A;  1VR9 A;  2NTS A;  2PIA A;  3MFG A;  3FC4 A;  3AEG B;  3UI3 A;  4M0W A;  2WXM A;  1MPE A;  1QF6 A;  2AQ1 B;  1TZO A;  3URY A;  1E0Z A;  1VJK A;  4PT5 A;  1QKZ A;  1SEB D;  1BML C;  1FXI A;  2SAK A;  1ET6 A;  2IPK D;  1DOX A;  1VLB A;  5C3J B;  1WWT A;  1MHH E;  2RDG A;  1L6U A;  2AQ3 B;  4N59 A;  4TMA B;  5HI1 A;  3BYT B;  1QOA A;  3P4R B;  2WXI A;  3ZJU A;  4R3D A;  1RWS A;  1JML A;  1LO5 D;  4KGS A;  4YXD B;  3SEB A;  1IGD A;  2FE8 A;  3VQI A;  1MI0 A;  5BYS A;  1VDV A;  1E10 A;  2BT6 A;  1XCT L;  2I2Y A;  4ZRP A;  4C56 C;  2PKO A;  1FRR A;  1K51 A;  2R61 A;  5JXV A;  3MJ5 A;  1SB3 C;  1Q10 A;  1JWB D;  3TEX A;  5HHD G;  2MJ3 A;  2K5P A;  2RPV A;  4LLG M;  5LNK 1;  1UWX A;  5D3I B;  2QEJ C;  3TSS A;  4AQ7 A;  5C2T B;  4IKG A;  4RGM A;  1XLN A;  2G1E A;  3AV8 A;  1SXT A;  3BZD B;  3IAS 1;  2ACZ B;  2K9X A;  1C79 A;  1HZ6 A;  1P7E A;  3AE2 B;  1D5X C;  1WSP A;  2VZK B;  1B9R A;  1M4V A;  3BK2 A;  3PZ8 A;  1E9M A;  5I4D A;  3L4P A;  1XCQ L;  4P6V F;  2IGH A;  1TS5 A;  4GDL B;  1MVK A;  2L1A A;  2HDE A;  1FXA A;  1ZDX A;  1TJE A;  2ON8 A;  2Z8L A;  1VZ6 A;  3NRZ A;  1V1P A;  3FIL A;  1FFV A;  1D5M C;  4GDK B;  4KGR A;  3U4E G;  1SE2 A;  2SEB D;  4NJC A;  2PMV A;  1ZOY B;  4C7Y A;  2XNA C;  2JU6 X;  2W55 A;  1UGJ A;  1F77 A;  5BMH A;  1SE3 A;  1QIL A;  3NS1 A;  4XDD A;  1DGJ A;  4HKZ E;  4XWT A;  4KGT A;  4XWW A;  2PLP A;  2WQY B;  1SBB B;  1JCK B;  2PTL A;  1BXT A;  3AEF B;  3SFE B;  3NVV A;  5D3D A;  4OZA A;  1K52 A;  1KRH A;  1C4C A;  1UWM A;  4L2Y A;  1TKE A;  4OZB A;  2EEL A;  4OZC A;  4MH8 A;  3ZJT A;  2EKI A;  1TKY A;  4ARI A;  1MHX A;  2M0A A;  1C4P A;  2WXG A;  4A9A A;  4WWM A;  1C77 A;  2CU3 A;  3ABV B;  1I7H A;  1P7F A;  3P1M A;  2WS3 B;  4KX6 B;  3P4S B;  2YEP F;  3TEW A;  4HJG E;  2YEP B;  2V3N A;  1PGB A;  1OQQ A;  3EA6 A;  2WP9 B;  3AB5 A;  1FM0 D;  5TSS A;  2J4X A;  3BYY B;  4JPS A;  2L52 A;  1FNV A;  1KH0 A;  1NYR A;  1JRP A;  3AE3 B;  4KKI A;  1L4Z B;  1FEH A;  3VR9 B;  1JRO A;  1FFU A;  2QIE B;  2IGD A;  2H88 B;  4J3O D;  3AE6 B;  4B0E A;  3U7Z A;  2LUM A;  1K53 A;  1TY2 A;  3E9S A;  3R2T A;  1TKG A;  4N58 A;  2DWQ A;  2OHF A;  2ONQ A;  4USA A;  4US9 A;  4MT5 A;  2BBC A;  1I4H A;  3DWM A;  2BW2 A;  2WDQ B;  4A6Q A;  1E7P B;  4DQO C;  2PVO D;  2W82 A;  1KFY B;  2QIL A;  1AYF A;  1C4A A;  5E6J A;  1QOG A;  2KQ4 X;  3Q8E A;  1TS3 A;  4US8 A;  3SR6 A;  3DWG C;  1AN8 A;  1DOI A;  1GOZ A;  4RF1 A;  3AH7 A;  2WXJ A;  2MH7 A;  5EE3 A;  4YTM B;  1IBX A;  1QT9 A;  2Y3A A;  4DXG A;  5AUK A;  1ZXI A;  2MJE A;  3WCQ A;  2Y5C A;  5MPO A;  2BS4 B;  1ET9 A;  3GS2 A;  4A90 A;  1Y56 A;  3KWL A;  2GI9 A;  3B2F A;  2DYO A;  4FXC A;  2WXN A;  3KWV A;  1SSN A;  3W5V B;  1T3Q A;  3FAH A;  2LGI A;  4WQM A;  1UUP A;  1XLO A;  3RPF C;  1JWA D;  1L0X B;  3ZGZ A;  1V1P B;  3FIL B;  2M19 A;  3P63 A;  1CJE A;  3AN1 A;  4YTP B;  1YQ4 B;  1JAL A;  2JQR B;  1IBX B;  4KKJ A;  2MEK A;  1PUT A;  2DBY A;  3GB1 A;  3EGR A;  1NEN B;  5AUI A;  3P42 A;  4ZHO A;  3IXS A;  1D6E C;  2BS2 B;  4LTU A;  1FMA D;  3N9Y C;  1XLQ A;  2BS3 B;  2JX5 A;  1A70 A;  2WXF A;  4RF0 A;  3R2I A;  2LMC A;  1VRA B;  2K3U A;  2KWD A;  1YMH E;  2J52 A;  3OWE B;  5G5G A;  5EE1 A;  1IUE A;  3PZ7 A;  3AEA B;  4REZ A;  1KLU D;  1YNT E;  4JX1 C;  1I4X A;  1B1Z A;  1WXQ A;  2PVG C;  2QJL A;  4YT0 B;  4HKQ A;  3W9C B;  1YN3 A;  4D2K A;  1ESF A;  2LFI A;  4L1B A;  4N6E B;  1HEZ E;  1UNS A;  1DOY A;  1PDX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...