3AH7A

Crystal structure of the isc-like [2fe-2s] ferredoxin (fdxb) from pseudomonas putida jcm 20004
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
109
structure length
109
Chain Sequence
MPLVTFLPHEKFCPEGLTVEVKPGTNILELAHDHHIEMESACGGVKACTTCHCIVRKGFDSLEEADELEEDMLDKAWGLEAQSRLGCQVFVADEDLTIEIPKYSLNHAA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords [2Fe-2S]ferredoxin
publication title Crystal structure of the ISC-like [2Fe-2S] ferredoxin (FdxB) from Pseudomonas putida JCM 20004
rcsb
source organism Pseudomonas putida
molecule tags Metal binding protein
total genus 27
structure length 109
sequence length 109
ec nomenclature
pdb deposition date 2010-04-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00111 Fer2 2Fe-2S iron-sulfur cluster binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 3ah7A00
1PDXA 3AV8A 1DGJA 1V8CA 1WYGA 2DBYA 1CJEA 3P63A 2H89B 3AMZA 2AX5A 1KF6B 3FAHA 1T3QA 1OQRA 1E10A 1GAQB 1WXQA 3CWIA 1N61A 2G1EA 3AE3B 4YTNB 5H8YE 3WCQA 1E9MA 4JWSC 4C7ZA 1ZP0B 2MJ3A 1GPXA 1RM6C 2WP9B 1FRDA 1ROEA 1I7HA 2W3RA 3NVZA 4YSYB 5EE9A 5C2TB 1E6EB 1SB3C 1WGKA 2DWQA 3L4PA 1V97A 1E0ZA 1QOGA 1ZUD2 1FFVA 3AH7A 2PKOA 3VR8B 3FC4A 4N59A 1QOFA 2CU3A 3AE4B 3AM9A 1N60A 1RFKA 3LXFA 4YT0B 1SF0A 1TJEA 2FBWB 3KWLA 4KX6B 1VJKA 5EE0A 4WQMA 3VR9B 1B9RA 1YJJA 3AEAB 1QOAA 4FXCA 3NVYA 4P6VF 3ETRA 1F0ZA 1NEKB 2W55A 3DWMA 2H88B 1N62A 1YQ3B 2W54A 3PO0A 3B2FA 3SFDB 3VRAB 2E3TA 1DOYA 1VLBA 1E7PB 1WWTA 1XLQA 2MJDA 2WS3B 1JALA 4LTUA 1L5PA 1J7BA 1FXIA 1JROA 3NVVA 2WDVB 4C7YA 2W3SA 3EUB2 3P4RB 1JW9D 1NI3A 2B76B 4HROA 4N58A 1FM0D 5EE3A 1PUTA 2KMMA 1L6UA 4US9A 2WLBA 3RPFC 4C80A 3LB8C 1QLBB 2WQYB 2L52A 1AWDA 2CJNA 1YQ4B 4ZHPA 3BIID 5MPOA 4JWUC 4ITKA 1L6VA 2EKIA 4WWMA 1JQ4A 1UWMA 3B9JA 1XLPA 2K5PA 3SR6A 1TYGB 3W5UB 1DOXA 3ABVB 2K9XA 1JRPA 1NYQA 1FMAD 1A70A 1TKEA 1OFFA 3AE1B 2Y5CA 2WU5B 3AEEB 3P1MA 3SFEB 2LEKA 1JWBD 1YJIA 3W9CB 3AEGB 1CZPA 2MH7A 2BS4B 1ZXIA 2BS2B 1NYRA 5EE1A 2M56B 1KFYB 1RYJA 1N63A 4HRSA 2PVGC 1WRIA 3P4QB 1L0VB 1J7AA 2QJLA 3VRBB 1VDVA 5AUKA 5H92C 4US8A 1J7CA 1FRRA 2BT6A 4N6EB 3NS1A 1XLOA 1PFDA 2JQRB 3ZYYX 2KAJA 3B2GA 4A9AA 3AN1A 1OQQA 1RWSA 2JX5A 2Q5WD 3NVWA 1QF6A 1NENB 2WDQB 3AE9B 1KRHA 4YTPB 1FIQA 2OHFA 4YTMB 3AB5A 3AEFB 3AE7B 2M19A 3W5VB 5C3JB 2ACZB 1FO4A 4IDIA 2PVOD 3AEDB 3HRDD 4JX1C 1N5XA 1R7SA 2BS3B 1SIJA 1QT9A 4YXDB 2HTME 1AYFA 2WU2B 1XLNA 2CJOA 3NRZA 4YSZB 3HUIA 5G5GA 2WDRB 1TKYA 4USAA 3P4SB 5GXGB 2L83A 5AUIA 2N0SB 3AE5B 2MJEA 4ZHOA 1QOBA 3P4PB 1FXAA 1TKGA 2PIAA 3AE8B 1N5WA 3AE6B 3AE2B 3HVZA 1IUEA 1JWAD 1EWYC 1NVID 2K22A 3DWGC 4ZOHC 1XO3A 1ZOYB 2QIEB 4YSXB 3AEBB 5G5HA 3CIRB 1FFUA 3AECB 1DOIA
chains in the Genus database with same CATH superfamily
3I3TB 2IY1B 4MT5A 1ET6A 2D5GA 3FAHA 1OQRA 4WJPA 1GAQB 2RR9A 1FRDA 2J53A 1WR6E 3ZTDA 3L4PA 1WZ0A 3GZNI 3L10B 2C60A 3U4EG 1K51A 2QILA 1RFKA 4DBGA 5EE0A 2LJ5A 1RAXA 4NQLB 3NVYA 2K6DB 1WY8A 1YQ3B 2BKRB 1L0YB 3KUCB 4EKUA 1AN8A 2D2QA 1J7BA 3PRMB 1BMLC 4N58A 4HDOA 2LZ6A 4AUQC 2D07B 3RZWC 4KSLC 2N9PC 4XC2A 4NJ7A 2CJNA 2KDEB 4WWMA 2FIFA 4GB9A 2JPHA 2WXNA 3A33B 4MJSA 1YJIA 1UGJA 4OZCA 4ZRIA 1ZXIA 2GBNA 5TR5A 3BVZA 5FR3A 1IBXA 2L1AA 4RGTA 1I4QA 4TSSA 4M0WB 2V0GA 3Q8EA 3ZXVA 5E6JA 2JX5A 2QC8A 5J2RA 5KHQA 4FHJA 3JSVB 1WJNA 3UGBB 4RH6A 3VTVA 2LGIA 1V6EA 3NOBA 5DPTA 2WDRB 2RPQA 3Q3JA 2LXCA 2V3NA 4H2AA 2KZRA 5FK9C 2I2YA 1P7FA 1WH3A 5G2NA 1ZOYB 1HQRD 4C4VB 1JCKB 2KMAA 3A9JA 2KJHB 4E71A 1E8WA 3PSEB 1UWXA 1GB4A 2KWUB 4I6NB 4Q2JA 3MHZA 4HEA1 3NHEB 4L23A 1SIFA 1VZ6A 1ET9A 1K52A 5E6PA 1L4ZB 1UZXB 2WXHA 1WGKA 3N1YC 3W1YA 4URKA 2KVRA 3T8MA 3I5JC 4WWPA 2K6QA 1HXYD 1WGRA 1WMHA 3ZTCA 4XDCA 4KGSA 2JRHA 1F52A 2JYTA 2D3CA 1ACCA 2KLGA 4C7YA 1WZ3A 1EU4A 1PGAA 3QC8B 2LVPA 4FJYA 1BUIC 3LYYA 1IP9A 5BMHA 2KDMA 3DBSA 3DCGA 3PS6A 1N6ZA 2Y3AA 3AE1B 1TKEA 1K8RB 3GZNB 4UDUC 1JWBD 4HK2A 4NAWA 3EFCA 4AJWA 4WAFA 4REZA 3Q8BA 1Q0WB 3RI7C 1TZOA 5D2MB 2LVQA 5D3IB 4YTMB 4JE3B 1N5XA 2BB6A 1C4PA 3VH3B 1EF1A 1H4RA 3TSSA 1P3QU 2M17A 1L0XB 3Q6BA 2AYOB 4FN2A 2C7MB 1CK1A 4S0RA 2OOBB 4I6PA 2V9HA 4O1NA 3QQ8B 2MCNB 5HHDG 2KTFA 1V5TA 4P16A 2I1JA 2GOWA 4HXDA 1UBQA 2XN9C 4ZRPA 3OJ3A 2AL3A 3AE4B 1E8YA 3DVNU 1C1YB 1TTNA 1VJKA 2IGDA 3MC8A 1B9RA 4P1CC 5HFYA 3PV1A 2KKCA 1HTQA 1N62A 5LNK1 2LI5A 1IPGA 2O6VD 1Y8RC 2JT4B 1JW9D 2MBHA 1FM0D 4J6IA 1L6UA 3ZNHB 3IVFA 3DVGX 2WWZA 4LNIA 2VZKD 4A8XC 2EKIA 3RN9C 4NNJB 3ABVB 1EUVB 2LGSA 1TS3A 2LGYA 5AZHA 2NBUA 3R2IA 1PGXA 3BK2A 4BKTA 4KZCA 1ZKHA 3RYTA 2UYZB 5HI1A 3IT6B 4K7WA 4IWQA 4DXGA 1F1HA 3CSFA 4IM2A 4NJ6A 4EZLA 3AN1A 2LVOA 1QF6A 3H6NA 3A1QA 2BVCA 4ASWC 4MELA 5I4DA 4K81A 2VRRB 4HLEA 1FO4A 3S2AA 2INPE 2LD9A 3R2TA 2I38A 2REXA 1MVKA 4ANVA 4XWWA 1F2RC 1F9JA 3AE8B 1T6BX 5BYSA 1F2RI 4HCPB 2R2QA 4AWJA 2RPVA 1E7UA 3EHVA 4J3OD 4KIKA 3R3MA 3NUHB 1SJHD 4HPLB 2MA9B 4IOIE 4GGQA 4C56C 2L00B 2L32A 4KSKC 1YX6B 4WJOA 4A90A 1KOTA 3NVZA 2UWQA 2DYBA 3W1SC 1V97A 4DDGD 4TKNA 2PKOA 2KACA 1TGZB 1EM7A 3RNBC 1VRAB 2MWSB 2RGFA 4JL9A 3ETRA 3SFDB 5DPWA 2WS3B 3NG0A 5IN7A 5LXIB 2ZW0A 2QEJC 4HKZE 3ZIMA 2FCNA 2WLBA 1I4GA 1LFDA 1V49A 4AJYB 5MPOA 3ML8A 2K3UA 1A5RA 4WJNA 2HDEA 2V4LA 1FXTB 5E6NA 4YXDB 2IO2B 1GOZA 2G3QB 4JGHB 2MP2B 2NMQA 1D5XC 3I57A 4DXFA 2C9WB 2PW9A 2CU1A 3EGRA 1XD3B 2PVGC 3APFA 3WAPA 3VUWA 1KTKA 3PGEA 3V62A 2X8XX 2FUHB 1LGRA 4YTPB 2V3PA 3KUZA 3AEFB 5CHWA 3PZ7A 1R7SA 3FILA 4YWGG 4GLSC 3MJ5A 3H7PB 5JHAA 3KW5B 2KXJA 3PRPB 1WFYA 1C3TA 2KN4A 4XYCA 1T0SC 3RCZA 4HVBA 3ZO5B 3I9V1 5GMVA 4KDLB 1SXTA 1WI0A 1TS4A 2AX5A 2ZVOA 1T3QA 4GDKB 3Q8FA 1WIAA 1WR1A 1E9MA 1UD7A 1V9JA 3ZJUA 2D3AA 2JU6X 4MEMA 2M4NA 2W3RA 4IW0A 2BWFA 3K9OB 1SB3C 1FNVA 4KX6B 2FUG1 2J0MA 4ZYSA 3B2FA 4DHJD 4MSMB 2MBOA 2C7HA 3MTNB 2NPTB 4MGIE 4MDKE 3ZNID 1TT5B 2KC2A 3U7DA 2ZNVC 3M95A 4PS7A 2K1FA 1UF0A 1DOXA 2DYOA 2Y5CA 1KH0A 2WU5B 3PLUA 3P1MA 3AXCA 2NBWB 1QKZA 4W9CA 1IGDA 4JPSA 1Q1OA 3NZSA 3RD2A 3VH4B 4ARIA 1FRRA 2YVCA 4LNOA 4N9F4 5E6OA 4IWOA 3EECA 1FIQA 2PEAA 3HK0A 1WGGA 1SIJA 2K8HA 4RGNA 2WU2B 4GMVA 3SU8X 2RMMA 2QDFA 2WXLA 3UI3A 3N1ZC 4KVGB 2D11A 3AE5B 4C00A 4ZHOA 1T0RC 2XEWA 3U8ZA 4FA6A 5BYRA 3P2BA 1EWYC 2CR5A 4KGRA 3AEBB 4IKGA 2J4XA 3L17A 1YQBA 4IG7B 2DBYA 2VH1A 3C8YA 3H8HA 1G6JA 1IYFA 1WXQA 1ZGUB 4YTNB 3OAWA 3V3XA 2K8CA 4HKQA 1WXSA 2WP9B 2PLPA 5EE9A 3WALA 2I1KA 3MJWA 1MJDA 4DHZB 1WF9A 2KD0A 4M0WA 1WJ6A 2MBEA 1WXAA 2INDC 1WXMA 4G11A 3U30A 3QK0A 5CX3A 3A9KB 3RNCC 3JSVA 4B0EA 3R7RA 3VQIA 2N9XA 2XNAC 4HWIB 3N20C 1VLBA 3DHHC 2Z0DB 3TCAA 4EEWA 2WXRA 2WDVB 3AI5A 3DHIC 5EE3A 4C80A 1E8XA 1FNUA 4C4VA 1LO5D 1PYWD 3PZ8A 3GOEA 1IGCA 2K9XA 2TSSA 1WGDA 2BYFA 4K7SA 3L16A 1SE3A 2MQJA 3ZVVA 2KX0A 2GBKA 3RNFC 3PHXB 1NYRA 3B0AA 5DCNA 1Y56A 3EFUA 5D94A 4LDTD 1WRIA 3RNGC 1XLOA 3KVFB 3TBLD 2PTLA 4A9AA 1OQQA 3N32A 2D10A 3ZLZA 2OHFA 2N9EB 3AE7B 1UNSA 4RNAA 1NDDA 2BF8B 3Q8AA 2KTRB 1JWMD 4CYEA 2ZNVB 2ON8A 1SGHA 2JZPA 2MJEA 3X0WA 1S1QB 2KFKB 3P4PB 4LNFA 1TY2A 2Y5PA 3U7ZA 2RD0A 2M1MA 3H7SA 3Q3FA 1WJUA 3DWGC 3AU4A 5JZEB 2N1VA 4WAAA 5BMIA 3VTWA 3C19A 2NCNA 1FD6A 4A3OA 4S17A 4IWPA 2XK5B 1GUAB 1R4NB 2UU7A 4DDID 1GPXA 1V1OA 4X57B 1E6EB 2MBBB 2IPKD 3EC8A 3VR8B 1WGHA 3ZDTA 2IYDB 4OW0A 3KWLA 1LM8B 3SDLC 2EMSA 3QA8A 1QQRA 2EKEC 2KK8A 1C76A 3WAMA 1E7PB 3N3KB 3L0WB 2WGSA 3PTFC 2W3SA 3Q2AC 2KQ7A 3DDCB 2N9LA 4R3DA 5DPSA 4PYUA 2FCSA 2WXPA 3ZGZA 3QWZB 1K50A 1J0GA 2IO0B 3VDZA 1UWMA 2M0XA 3U52E 4TUUA 4GU2A 2PE9A 3ZJVA 3PT2B 2WXIA 1YD8U 3RZFA 5LLIA 1DYQA 1C9FA 3H1UA 4B95A 4US8A 2JQRB 3ZXRA 4W9KA 2GBRA 1JMLA 4W9GA 2JZZA 2L05A 4USAA 1YOVB 4W9FA 2HJ8A 5EDSA 1WE6A 3IT4B 5J17A 1JWAD 2V3SA 3R7QA 2WX0A 3UIPB 2N4FA 4OVVA 2JXTA 3KYDD 2WXMA 4JLCA 3CIRB 1J19A 5LXHA 3WA0A 3SEBA 5H8YE 3AE3B 4ICUA 3RNEC 1Q10A 2MJ3A 3UINB 1UH6A 1JWUD 4BBNF 2N1WA 1ZUD2 2WXGA 2L76A 3BYTB 2R61A 1MG8A 4WWOA 1BXTA 4ZDVA 4ANWA 1QOFA 3DHGC 4A55A 1V81A 2VZKB 1AARA 4FXCA 4BVUC 3BINA 3NJTA 2O2VB 3PO0A 5L83A 3A4RA 1XLQA 1L2NA 1VCBA 2Y5BB 3QCAA 4BBNC 1FCCC 2JVCA 3A4SC 3P4RB 5IA7A 3LJ3A 4ACFA 4II2B 2BQQA 1GB1A 4ZHPA 3TEWA 2AWTA 3QAQA 2MX2A 4ITKA 3T3OA 2ZCBA 4W9LA 4FHKA 1ESFA 1Z5SB 3HHMA 1NI2A 2KLCA 5EE1A 2L3ZA 2QHOA 2LGDA 2LMCA 5H92C 1PFDA 3UQAA 1ENFA 3VXWA 3NVWA 1RWSA 3VUYA 2IY0B 3DBHI 2DAFA 4ZRKA 4P7IA 3PRZA 2KMCA 1WM2A 4D2KA 4B9KA 4RFBA 4HCNB 1IUEA 2DX5B 2V4IB 2ZPYA 4OVUA 3AV8A 2GRIA 5IO9A 2MP2A 3CMMB 4BKSA 1N61A 2IDYA 5BMGA 3B08A 4HPMB 3VFKA 3IFWB 1CMXB 5HG2A 1E5WA 2NVUI 4A6QA 2BBCA 3R66C 3K9PB 1I4XA 1L4DB 2AQ1B 1STEA 2KVZA 3H7PA 5TSSA 2INNE 4BOZB 4RF1A 3AULA 1FXIA 1OEYJ 1VZ8A 2KMMA 4NPNA 1D5MC 2EMTA 2PE6B 2J7QB 2WQYB 4LJPB 3APCA 4JQWC 2HE7A 5JH5C 5BYQA 4F8CB 2N7JA 1XLPA 3QHTA 2K5PA 2G4SA 3TEZA 1P7EA 1C79A 3ZDMC 4GDKA 1S3SG 4LK0M 2KX3A 5AZGA 4ZYNA 3M62B 4WJQA 4MGZE 1HZ6A 1FPYA 1RYJA 4M00A 4WWNA 2N9KA 3R8BA 2AQ2B 2QJLA 4WURA 3WAOA 5AUKA 1OQYA 1E0ZA 5DPRA 2XBBC 1WX8A 3B1LX 3KQ4A 4NY0A 2Z8LA 4GIVA 3VAWA 2YLMA 4OVZA 4ZRQA 2PVOD 2BS3B 1QT9A 2FAZA 3MP9A 2NPTA 3P4SB 1FXAA 3NZUA 3AE2B 4PT5A 1R4MI 1NBFC 2RDGA 5CHVC 2IGHA 2CHXA 3W1SA 4RCOA 1SE4A 3ZKJC 2PJHA 3O13A 1Z2MA 3WCQA 1ZW7A 3DBHB 3N9YC 2DNFA 3UF8A 3BYYB 4YSYB 2GB1A 5BO4B 3BZDB 4DHJB 3M63B 4AQ7A 3I63C 1WGYA 3PREA 1RLFA 4FJZA 1WYWB 4GDLB 4PYZA 4MGYE 1H8CA 1SSNA 1YJJA 2INCC 1SBBB 5L95C 2E3TA 1DOYA 2MJDA 4PK1A 2E6XA 2DZMA 1JALA 2GBMA 5JXVA 2FCMA 4II3B 2B76B 2ZVNA 4B6WA 4PS3A 4EUTA 2K25A 2YEPF 3LB8C 2DZJA 1TS2A 3WIMA 1JQ4A 3B9JA 1TYGB 2FE8A 3ZRFA 3E56A 1A70A 1XCQL 5AZFA 2LJIA 4LJOB 1P1AA 4KKJA 2BS4B 4WH4A 4E74A 4MM3B 1T0QC 4FBJB 3P4QB 3VHTC 2V1YA 2NTTA 1J7CA 2IJ0A 3EA6A 2BYTA 3A9KA 2L8JA 4MGKE 2KO3A 2NTSA 3AB5A 2RDHA 3ZNGC 3HRDD 5IP4D 5FKAC 2JWZA 3NRZA 1AYFA 1XLNA 4FLHA 3HUIA 1WRDB 2AL6A 2N0SB 2IO3B 2PIAA 4DXAB 3Q3NC 3ENEA 2BKFA 1ZXHA 3HVZA 1P0RA 2NS5A 4ZOHC 2QIEB 1V1PB 5J18A 1GC7A 2IO1B 4XDDA 1WYGA 1CJEA 2H89B 3AMZA 1GC6A 3GE3C 3V60A 2IZVB 4RMAA 3IHPC 1E8ZA 1E90A 1RM6C 1ROEA 4DK5A 1KLGD 4QAYA 4FULA 3DVNV 4W9DA 5IOIA 3V61A 1LXDA 4A20A 2LHEA 3AH7A 3DBLI 2D3GA 4N59A 3DPDA 4IM0A 1PGBA 4BFRA 1HEZE 2KTRA 5IAAC 2DLBA 2PMVA 2W55A 3DWMA 2W54A 2SEBD 1YIWA 3AU5A 1L5PA 2KFKA 1JROA 5D7GA 1WM3A 4HROA 4KZ0A 4LDTB 1V2YA 1D6EC 1YQ4B 3PVLA 3BIID 5JHBA 4K3BA 3Q14C 4W9JA 4P1BC 3RNAC 4RF0A 1U4AA 2QSDA 2D3BA 1KLVA 3W9CB 4BZAA 2KDIA 2XK5A 2MSED 1VD2A 2KANA 3ZUNA 1MG4A 2M56B 1Q5WB 2CHWA 3VRBB 2IBIB 3N30A 1CQVA 1V5OA 2AQ3B 3B2GA 2W9NA 2ZPNA 4RM9A 1FNWA 2WDQB 3RUIB 1XEEA 1SEBD 4GXBA 1WXVA 1ISNA 2C7NB 3PPAA 1VZ7A 3M3JA 2PPHA 3N1XC 5AUIA 2AEHA 1QOBA 3UQBA 2K8BA 4GN1A 1TIFA 3VTUA 4E3CA 1NVID 2LGXA 2LXAA 5G5HA 3AECB 1PDXA 4JIOU 4NQKE 1I35A 2L7RA 4WQOB 1UUPA 4K3CA 2YEPB 1FCLA 1KF6B 2ZCCA 3GS2A 2DAJA 2G1EA 1EU3A 1T0YA 1VR9A 3HM6X 3RT3B 4L2YA 1ZP0B 3BWUD 1QILA 2WXOA 2FCQA 3ZRCA 3SFEB 1N60A 3IG3A 1D3ZA 2FBWB 3E9SA 4GSWA 4XE0A 1YN3A 1QOAA 1XT9B 4P6VF 1F0ZA 2KFJA 4RGOS 4PS8A 4F1SA 5D6JB 2G9HD 3TEXA 2ZEQA 2CKHB 3VVWB 2L0TA 2C5LC 3Q3MC 4ANXA 1TY0A 1MFWA 1X1MA 2RSUA 1TZ1A 4JWUC 2BPSA 3IAM1 4ARCA 3DBLB 1CZPA 2VH2A 3O65B 1C78A 2JWUA 2O6VA 1ZDVA 4HRSA 1UELA 4KKIA 1D5ZC 2Z0EB 2HD5B 1KJTA 3TJPA 1KM7A 2BGFA 4RM8A 2GI9A 1XQQA 2L0FA 3KUDB 2M19A 2LFIA 4I6LB 4HPPA 2O2VA 2LWPA 3DVGY 1QZEA 5CTRC 2FIDA 4KGTA 3TMPB 4TMAB 4FJVB 4DQOC 4YL8A 3SD5A 2K22A 2BYEA 2KQSA 4LLGM 1SE9A 4YSXB 4AP4C 1WX7A 1M4VA 3V6CB 1DGJA 2ASQA 2GLSA 4MJSB 1E10A 1V80A 1OGWA 4XWTA 3L54A 4G3XB 1IBXB 3TEYA 1FFVA 1MPEA 2CU3A 2DZKA 2OJRA 1TJEA 5IKCM 1XXGA 3D32A 3V05A 4EZKA 3H9DA 3QARA 3NVVA 3ZQ4A 4HJKA 1NI3A 2WDTB 1PUTA 2EELA 2O6VB 2JY6A 1QLBB 3C0RB 3W2DA 2RDBC 1ZPSA 3U2SC 3DQVA 3A9JB 4RGMA 2DHZA 1JRPA 3AEEB 3L13A 1I4HA 1V86A 2MH7A 1YX5B 4XGAB 1HE8A 2M0AA 5C23A 4AS1A 2MBQA 1WE7A 1C4AA 1KFYB 4OZAA 1N63A 3T9LA 2NR2A 3JYUA 1E7VA 1I42A 3NS1A 2KAJA 3UIOB 1T5XD 2MW5A 1RFAA 2KJRA 4AOFA 3W5VB 2LHDA 2ACZB 1EWCA 3OJ4B 1WMHB 4IDIA 1D4BA 2ZZPB 3BK1A 2K39A 2ONQA 5GXGB 4DWFA 1FEHA 3NS8A 3KWVA 2WX1A 3AE6B 4NAMA 2BWES 1SJED 3MFGA 2KOXA 4DHZE 2M8SA 4ZRJA 3TUOA 3RFZB 2KHWB 3P63A 3MHSD 4M02A 5HKHA 2J52A 3KYCD 3CWIA 2MLBA 2HJ1A 2WXQA 3ZJTA 1YJ1A 1I7HA 5C2TB 4NAWB 2G4DB 1HTOA 1K53A 1AW7A 2K0PA 2KJ6A 2DZIA 2BYVE 4TQ1A 3ML9A 4HDQA 3ALBA 1NEKB 1YNTE 3VRAB 1WWTA 1GJZA 2KDFB 2CHZA 4LTUA 3V6EB 4EZJA 4A3PA 3Q8CA 4US9A 3DBRI 4HJGE 3RPFC 2KDBA 4TQ0A 2L52A 5G55A 1AWDA 2DYMA 5AEKB 2KWVB 2WHIA 1GNUA 1L6VA 4MSQB 3W5UB 2GMIC 2KNBA 4CHKA 2J0KA 1F77A 1OFFA 4TV3A 4F7ZA 3PZDA 2JXXA 2BS2B 5CHFA 3FKYA 1J8CA 3NY5A 4CO7A 4GDLA 2BT6A 4N6EB 4W9EA 2LASA 3QX1A 3CF6E 1GG3A 3Q3OC 1MHHE 4EFOA 2KWCA 3AEDB 2WXJA 2LRWA 3DOWA 1HA5A 2LRUA 3OLMD 1M94A 2LUMA 2L83A 2G45B 4L1BA 5D3DA 1TKGA 3RMKC 3WANA 1N5WA 3IXSA 2KC1A 2QCZA 2B3AA 4G50A 3TL5A 1V8CA 4BKGA 4XX5A 4GOCA 3APDA 2OJWA 3BY4B 1WX9A 4MM3A 4C7ZA 3GP7A 4NJCA 1JWSD 2KN5A 2X38A 1MHXA 2SAKA 2BW2A 2DWQA 1YMHE 2JSVX 3ONSA 4KDIC 4K7UA 3TIXA 2N7DA 4G0NB 3MC0B 2A4ZA 2A5UA 2JZ3B 3RULA 1P98A 1ZDXA 2KQ4X 3A1QB 3AEAB 3QIJA 3PLVA 1KLUD 3X23A 4EE2A 3EUB2 4B0MA 2WYQA 3VUXA 1OEYA 1LQBA 3MC9A 4M8NA 1V1PA 3ECIA 4IUMB 3JW0X 4MACA 4KIKB 1HZ5A 3P42A 1B1ZA 4IC7B 2LEKA 2W82A 4WIPA 2N7EA 1I4PA 1UBIA 2IGGA 2ZW1A 2JRIB 1OTRB 1TBEA 3IBEA 1VDVA 3BVGA 2WXFA 3QJZA 2Q5WD 3HM3A 1KRHA 2HTHA 4OZBA 1MI0A 3DBRB 4LCDE 3CSTA 3LDZE 4BKSD 4JX1C 4FADA 5KHOA 3IAS1 2HTME 3ZNZB 2CJOA 1WJ4A 1PQSA 1TKYA 4EOYA 4LNKA 1P9DU 5C1ZA 3NZ3A 4NZLB 2OEDA 2GBJA 1WSPA 2KYWA 4KV2A 2QMTA 3BVMA 1DOIA 3URYA 4CQNA 1YN4A 2ZJDA 2WXKA 2R2OA 1BT0A 2KWDA 4W9HA 4JWSC 4XZ4A 3KH0A 2NBVB 1EF5A 2MHJA 2MEKA 1I4RA 4IM3A 1YN5A 1QOGA 1ZE3D 1L7YA 2LUEA 2BTEA 1TS5A 3FC4A 4K1RB 4OHJA 1C4CA 3LXFA 3AM9A 5FR6A 2ICIA 4YT0B 4BAXA 1SF0A 3VR9B 4WQMA 2KT7A 1SE2A 3HVDA 4MH8A 2H88B 3FILB 2J42A 3SHQA 3T3NA 3GB1A 4MH0E 2WNMA 4W9IA 1XF5L 3Q69A 3JVZX 1XCTL 2JF5A 1RRBA 1R4NI 3HIZA 4LNNA 4BOSC 3SR6A 1NYQA 1FMAD 3GE8C 1UGMA 2MRPA 3ZW3A 3AEGB 1R4MB 4M8MA 3PHWB 2FNJB 2CS4A 1EO6A 1JRUA 1L0VB 1J7AA 3J9CA 3OG5A 3ZYYX 2JUOA 1NENB 2Z59B 3AE9B 4ANUA 5C3JB 4M01A 3L08A 3KLSX 5T8IA 4YSZB 5G5GA 4ICVA 1C77A 2BB5A 2JYEA 1XO3A 2DENB 2J0JA 1FFUA 3OWEB
chains in the Genus database with same CATH topology
3AV8A 1M4VA 2GRIA 1SXTA 1DGJA 4MT5A 1TS4A 2AX5A 1ET6A 2D5GA 3FAHA 1T3QA 4GDKB 1OQRA 1E10A 3Q8FA 1GAQB 1N61A 2IDYA 1E9MA 5BMGA 3ZJUA 2JU6X 4XWTA 1FRDA 2W3RA 2J53A 1SB3C 5HG2A 1IBXB 3TEYA 3L4PA 1FFVA 4A6QA 1FNVA 3U4EG 2BBCA 1MPEA 1K51A 2QILA 2CU3A 1RFKA 5EE0A 1TJEA 4KX6B 1XXGA 1I4XA 2FUG1 3NVYA 3V05A 1L4DB 1YQ3B 2AQ1B 4ZYSA 1STEA 1L0YB 3B2FA 1AN8A 2INNE 5TSSA 4RF1A 1J7BA 1FXIA 3NVVA 3ZQ4A 1BMLC 1NI3A 1VZ8A 4N58A 1PUTA 2KMMA 1D5MC 2EELA 1QLBB 2WQYB 2CJNA 3W2DA 5BYQA 4WWMA 2N7JA 1XLPA 1ZPSA 3U2SC 2K5PA 3TEZA 4RGMA 1P7EA 2DYOA 1C79A 1DOXA 1JRPA 2WXNA 1KH0A 2WU5B 2Y5CA 3AEEB 3P1MA 1I4HA 1YJIA 1UGJA 4LK0M 4OZCA 2MH7A 1QKZA 1ZXIA 1HZ6A 1IGDA 2M0AA 4JPSA 4AS1A 1C4AA 3BVZA 1KFYB 4OZAA 1RYJA 1N63A 5FR3A 1IBXA 2N9KA 2L1AA 2AQ2B 2QJLA 4RGTA 4WURA 5AUKA 3R8BA 4ARIA 1E0ZA 1FRRA 1I4QA 4TSSA 3NS1A 2V0GA 3Q8EA 2KAJA 1T5XD 2JX5A 5E6JA 3KQ4A 1FIQA 2Z8LA 3W5VB 2LHDA 2ACZB 1EWCA 4OVZA 4IDIA 4ZRQA 2PVOD 4RH6A 1D4BA 2BS3B 2LGIA 1SIJA 1QT9A 3BK1A 4RGNA 2WU2B 2WDRB 3MP9A 2RMMA 2ONQA 3P4SB 5GXGB 2WXLA 3UI3A 1FEHA 2V3NA 3AE5B 4ZHOA 1FXAA 3KWVA 4H2AA 3AE6B 5BYRA 3AE2B 4NAMA 4PT5A 5FK9C 1EWYC 1SJED 1P7FA 3MFGA 4KGRA 2I2YA 1ZOYB 1HQRD 2RDGA 3AEBB 1JCKB 4IKGA 2J4XA 2IGHA 3TUOA 3RFZB 2DBYA 3W1SA 3P63A 4RCOA 3C8YA 1SE4A 3H8HA 2J52A 1UWXA 3CWIA 1WXQA 3O13A 1GB4A 4YTNB 3V3XA 3WCQA 4Q2JA 4HKQA 3MHZA 3N9YC 2WXQA 4HEA1 3ZJTA 3BYYB 2WP9B 4YSYB 1I7HA 2GB1A 2PLPA 4NAWB 4L23A 3BZDB 5EE9A 5C2TB 1VZ6A 1ET9A 1K52A 4AQ7A 1L4ZB 2WXHA 1WGKA 4M0WA 1K53A 1AW7A 2K0PA 4GDLB 4B0EA 1HXYD 1SSNA 1YJJA 4TQ1A 3VQIA 1SBBB 1NEKB 4XDCA 1YNTE 4KGSA 2XNAC 3VRAB 2E3TA 2JYTA 1DOYA 1VLBA 1WWTA 2MJDA 2E6XA 1ACCA 1JALA 2WXRA 4LTUA 5JXVA 2WDVB 4C7YA 1EU4A 2B76B 5EE3A 1PGAA 3Q8CA 4US9A 4HJGE 3RPFC 4C80A 1BUIC 2YEPF 1FNUA 3LB8C 3LYYA 4TQ0A 2L52A 1LO5D 1AWDA 2DYMA 1PYWD 5BMHA 2KDMA 1TS2A 1L6VA 1JQ4A 3PZ8A 3B9JA 1IGCA 1TYGB 3W5UB 2FE8A 2Y3AA 2K9XA 1TKEA 1F77A 3AE1B 1A70A 2TSSA 1OFFA 1XCQL 3E56A 4UDUC 1JWBD 2LJIA 1SE3A 4KKJA 2BS4B 4WH4A 2BS2B 4MM3B 1NYRA 4WAFA 4REZA 1Y56A 3Q8BA 1WRIA 3P4QB 2NTTA 1J7CA 2BT6A 2IJ0A 3EA6A 4N6EB 1XLOA 2BYTA 1TZOA 2PTLA 4A9AA 1OQQA 5D3IB 1MHHE 2NTSA 2OHFA 4YTMB 3AB5A 3AE7B 1UNSA 2RDHA 4RNAA 4JE3B 3AEDB 3HRDD 3Q8AA 1N5XA 2WXJA 2BB6A 5FKAC 3NRZA 1AYFA 1XLNA 1C4PA 1HA5A 3HUIA 1JWMD 2LUMA 3TSSA 2ON8A 2L83A 1L0XB 2JZPA 2N0SB 4L1BA 2MJEA 3P4PB 5D3DA 1TY2A 1TKGA 2Y5PA 3U7ZA 2PIAA 1CK1A 1N5WA 1ZXHA 3HVZA 3DWGC 3IXSA 4ZOHC 2QIEB 1V1PB 4O1NA 4XDDA 5BMIA 1V8CA 1WYGA 1CJEA 2H89B 3AMZA 5HHDG 1FD6A 4P16A 4C7ZA 3GP7A 4NJCA 1GPXA 1JWSD 1RM6C 1V1OA 1ROEA 1KLGD 2X38A 1MHXA 2XN9C 2SAKA 4ZRPA 2BW2A 1E6EB 2DWQA 1YMHE 2JSVX 2IPKD 2LHEA 3AH7A 3VR8B 4N59A 3MC0B 3AE4B 1ZDXA 4OW0A 2KQ4X 3KWLA 1PGBA 1VJKA 2IGDA 3AEAB 1B9RA 1HEZE 5HFYA 2DLBA 1QQRA 2PMVA 2W55A 3DWMA 2W54A 1N62A 1C76A 5LNK1 1E7PB 1KLUD 2SEBD 1L5PA 1JROA 5D7GA 4EE2A 2W3SA 3EUB2 1JW9D 4HROA 4B0MA 1FM0D 1L6UA 4R3DA 2N9LA 2WXPA 3ZGZA 1V1PA 2VZKD 1D6EC 1YQ4B 1K50A 4MACA 4A8XC 3BIID 2EKIA 1UWMA 4RF0A 1HZ5A 3P42A 3U52E 1B1ZA 3ABVB 2QSDA 1TS3A 2LEKA 2W82A 3W9CB 4WIPA 3R2IA 1PGXA 3BK2A 1I4PA 3ZJVA 2IGGA 2WXIA 2M56B 2ZW1A 5HI1A 3IT6B 1DYQA 1C9FA 3VRBB 1VDVA 4DXGA 4US8A 3BVGA 1CQVA 2JQRB 2AQ3B 3B2GA 2WXFA 3AN1A 2Q5WD 1FNWA 1QF6A 2WDQB 1KRHA 4OZBA 1MI0A 5I4DA 1XEEA 1SEBD 1FO4A 4JX1C 3IAS1 1VZ7A 2INPE 2HTME 1JMLA 2CJOA 3R2TA 2I38A 1TKYA 4USAA 1MVKA 5AUIA 4XWWA 1QOBA 3NZ3A 1F2RC 4NZLB 2OEDA 3IT4B 3AE8B 1T6BX 5BYSA 1WSPA 1NVID 1JWAD 1F2RI 2RPVA 2JXTA 4J3OD 2WXMA 5G5HA 3CIRB 2QMTA 3AECB 1DOIA 1PDXA 3BVMA 3URYA 1YN4A 4CQNA 3NUHB 1SJHD 1UUPA 2WXKA 2YEPB 4IOIE 1KF6B 1FCLA 3GS2A 3SEBA 2KWDA 5H8YE 4C56C 2G1EA 2L32A 3AE3B 1EU3A 1VR9A 4JWSC 4L2YA 1ZP0B 3BWUD 4A90A 1Q10A 2MJ3A 3NVZA 1QILA 1JWUD 2MEKA 1I4RA 1YN5A 1V97A 1QOGA 1ZUD2 2WXGA 1ZE3D 3BYTB 2R61A 2BTEA 2PKOA 1BXTA 1TS5A 2KACA 2WXOA 3FC4A 4OHJA 1C4CA 1QOFA 3LXFA 3AM9A 1EM7A 1N60A 2ICIA 4YT0B 3SFEB 1SF0A 2FBWB 3E9SA 2VZKB 3VR9B 4A55A 4WQMA 4XE0A 1VRAB 1YN3A 1QOAA 4FXCA 4P6VF 3ETRA 1F0ZA 4RGOS 1SE2A 3HVDA 4MH8A 2H88B 3PO0A 3SFDB 3FILB 1XLQA 2J42A 2WS3B 3T3NA 3GB1A 2G9HD 1FCCC 3P4RB 3TEXA 2ZW0A 2WNMA 2QEJC 1XF5L 4HKZE 3Q69A 2WLBA 1I4GA 1GB1A 1XCTL 1TY0A 4ZHPA 3TEWA 5MPOA 4JWUC 4ITKA 2K3UA 3T3OA 3IAM1 2HDEA 3SR6A 1NYQA 1FMAD 4YXDB 4ARCA 1GOZA 3AEGB 1ESFA 1CZPA 2NMQA 1D5XC 3I57A 4DXFA 1C78A 2PW9A 2JWUA 5EE1A 3EGRA 1ZDVA 4HRSA 2PVGC 1L0VB 1D5ZC 1J7AA 2LMCA 1KTKA 4KKIA 3J9CA 5H92C 3ZYYX 1PFDA 1ENFA 3NVWA 1RWSA 2GI9A 1NENB 3AE9B 4YTPB 2V3PA 3AEFB 2M19A 5C3JB 2LFIA 3PZ7A 1R7SA 3FILA 4YWGG 4GLSC 4YSZB 3KLSX 4KGTA 5T8IA 5G5GA 3MJ5A 4TMAB 4D2KA 1C77A 4DQOC 2BB5A 4RFBA 2KN4A 2JYEA 1IUEA 2K22A 2V4IB 1XO3A 3I9V1 4LLGM 4YSXB 1FFUA 3OWEB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1PDX A;  3AV8 A;  1DGJ A;  1V8C A;  1WYG A;  2DBY A;  1CJE A;  3P63 A;  2H89 B;  3AMZ A;  2AX5 A;  1KF6 B;  3FAH A;  1T3Q A;  1OQR A;  1E10 A;  1GAQ B;  1WXQ A;  3CWI A;  1N61 A;  2G1E A;  3AE3 B;  4YTN B;  5H8Y E;  3WCQ A;  1E9M A;  4JWS C;  4C7Z A;  1ZP0 B;  2MJ3 A;  1GPX A;  1RM6 C;  2WP9 B;  1FRD A;  1ROE A;  1I7H A;  2W3R A;  3NVZ A;  4YSY B;  5EE9 A;  5C2T B;  1E6E B;  1SB3 C;  1WGK A;  2DWQ A;  3L4P A;  1V97 A;  1E0Z A;  1QOG A;  1ZUD 2;  1FFV A;  3AH7 A;  2PKO A;  3VR8 B;  3FC4 A;  4N59 A;  1QOF A;  2CU3 A;  3AE4 B;  3AM9 A;  1N60 A;  1RFK A;  3LXF A;  4YT0 B;  1SF0 A;  1TJE A;  2FBW B;  3KWL A;  4KX6 B;  1VJK A;  5EE0 A;  4WQM A;  3VR9 B;  1B9R A;  1YJJ A;  3AEA B;  1QOA A;  4FXC A;  3NVY A;  4P6V F;  3ETR A;  1F0Z A;  1NEK B;  2W55 A;  3DWM A;  2H88 B;  1N62 A;  1YQ3 B;  2W54 A;  3PO0 A;  3B2F A;  3SFD B;  3VRA B;  2E3T A;  1DOY A;  1VLB A;  1E7P B;  1WWT A;  1XLQ A;  2MJD A;  2WS3 B;  1JAL A;  4LTU A;  1L5P A;  1J7B A;  1FXI A;  1JRO A;  3NVV A;  2WDV B;  4C7Y A;  2W3S A;  3EUB 2;  3P4R B;  1JW9 D;  1NI3 A;  2B76 B;  4HRO A;  4N58 A;  1FM0 D;  5EE3 A;  1PUT A;  2KMM A;  1L6U A;  4US9 A;  2WLB A;  3RPF C;  4C80 A;  3LB8 C;  1QLB B;  2WQY B;  2L52 A;  1AWD A;  2CJN A;  1YQ4 B;  4ZHP A;  3BII D;  5MPO A;  4JWU C;  4ITK A;  1L6V A;  2EKI A;  4WWM A;  1JQ4 A;  1UWM A;  3B9J A;  1XLP A;  2K5P A;  3SR6 A;  1TYG B;  3W5U B;  1DOX A;  3ABV B;  2K9X A;  1JRP A;  1NYQ A;  1FMA D;  1A70 A;  1TKE A;  1OFF A;  3AE1 B;  2Y5C A;  2WU5 B;  3AEE B;  3P1M A;  3SFE B;  2LEK A;  1JWB D;  1YJI A;  3W9C B;  3AEG B;  1CZP A;  2MH7 A;  2BS4 B;  1ZXI A;  2BS2 B;  1NYR A;  5EE1 A;  2M56 B;  1KFY B;  1RYJ A;  1N63 A;  4HRS A;  2PVG C;  1WRI A;  3P4Q B;  1L0V B;  1J7A A;  2QJL A;  3VRB B;  1VDV A;  5AUK A;  5H92 C;  4US8 A;  1J7C A;  1FRR A;  2BT6 A;  4N6E B;  3NS1 A;  1XLO A;  1PFD A;  2JQR B;  3ZYY X;  2KAJ A;  3B2G A;  4A9A A;  3AN1 A;  1OQQ A;  1RWS A;  2JX5 A;  2Q5W D;  3NVW A;  1QF6 A;  1NEN B;  2WDQ B;  3AE9 B;  1KRH A;  4YTP B;  1FIQ A;  2OHF A;  4YTM B;  3AB5 A;  3AEF B;  3AE7 B;  2M19 A;  3W5V B;  5C3J B;  2ACZ B;  1FO4 A;  4IDI A;  2PVO D;  3AED B;  3HRD D;  4JX1 C;  1N5X A;  1R7S A;  2BS3 B;  1SIJ A;  1QT9 A;  4YXD B;  2HTM E;  1AYF A;  2WU2 B;  1XLN A;  2CJO A;  3NRZ A;  4YSZ B;  3HUI A;  5G5G A;  2WDR B;  1TKY A;  4USA A;  3P4S B;  5GXG B;  2L83 A;  5AUI A;  2N0S B;  3AE5 B;  2MJE A;  4ZHO A;  1QOB A;  3P4P B;  1FXA A;  1TKG A;  2PIA A;  3AE8 B;  1N5W A;  3AE6 B;  3AE2 B;  3HVZ A;  1IUE A;  1JWA D;  1EWY C;  1NVI D;  2K22 A;  3DWG C;  4ZOH C;  1XO3 A;  1ZOY B;  2QIE B;  4YSX B;  3AEB B;  5G5H A;  3CIR B;  1FFU A;  3AEC B;  1DOI A; 
#chains in the Genus database with same CATH topology
 3I3T B;  2IY1 B;  4MT5 A;  1ET6 A;  2D5G A;  3FAH A;  1OQR A;  4WJP A;  1GAQ B;  2RR9 A;  1FRD A;  2J53 A;  1WR6 E;  3ZTD A;  3L4P A;  1WZ0 A;  3GZN I;  3L10 B;  2C60 A;  3U4E G;  1K51 A;  2QIL A;  1RFK A;  4DBG A;  5EE0 A;  2LJ5 A;  1RAX A;  4NQL B;  3NVY A;  2K6D B;  1WY8 A;  1YQ3 B;  2BKR B;  1L0Y B;  3KUC B;  4EKU A;  1AN8 A;  2D2Q A;  1J7B A;  3PRM B;  1BML C;  4N58 A;  4HDO A;  2LZ6 A;  4AUQ C;  2D07 B;  3RZW C;  4KSL C;  2N9P C;  4XC2 A;  4NJ7 A;  2CJN A;  2KDE B;  4WWM A;  2FIF A;  4GB9 A;  2JPH A;  2WXN A;  3A33 B;  4MJS A;  1YJI A;  1UGJ A;  4OZC A;  4ZRI A;  1ZXI A;  2GBN A;  5TR5 A;  3BVZ A;  5FR3 A;  1IBX A;  2L1A A;  4RGT A;  1I4Q A;  4TSS A;  4M0W B;  2V0G A;  3Q8E A;  3ZXV A;  5E6J A;  2JX5 A;  2QC8 A;  5J2R A;  5KHQ A;  4FHJ A;  3JSV B;  1WJN A;  3UGB B;  4RH6 A;  3VTV A;  2LGI A;  1V6E A;  3NOB A;  5DPT A;  2WDR B;  2RPQ A;  3Q3J A;  2LXC A;  2V3N A;  4H2A A;  2KZR A;  5FK9 C;  2I2Y A;  1P7F A;  1WH3 A;  5G2N A;  1ZOY B;  1HQR D;  4C4V B;  1JCK B;  2KMA A;  3A9J A;  2KJH B;  4E71 A;  1E8W A;  3PSE B;  1UWX A;  1GB4 A;  2KWU B;  4I6N B;  4Q2J A;  3MHZ A;  4HEA 1;  3NHE B;  4L23 A;  1SIF A;  1VZ6 A;  1ET9 A;  1K52 A;  5E6P A;  1L4Z B;  1UZX B;  2WXH A;  1WGK A;  3N1Y C;  3W1Y A;  4URK A;  2KVR A;  3T8M A;  3I5J C;  4WWP A;  2K6Q A;  1HXY D;  1WGR A;  1WMH A;  3ZTC A;  4XDC A;  4KGS A;  2JRH A;  1F52 A;  2JYT A;  2D3C A;  1ACC A;  2KLG A;  4C7Y A;  1WZ3 A;  1EU4 A;  1PGA A;  3QC8 B;  2LVP A;  4FJY A;  1BUI C;  3LYY A;  1IP9 A;  5BMH A;  2KDM A;  3DBS A;  3DCG A;  3PS6 A;  1N6Z A;  2Y3A A;  3AE1 B;  1TKE A;  1K8R B;  3GZN B;  4UDU C;  1JWB D;  4HK2 A;  4NAW A;  3EFC A;  4AJW A;  4WAF A;  4REZ A;  3Q8B A;  1Q0W B;  3RI7 C;  1TZO A;  5D2M B;  2LVQ A;  5D3I B;  4YTM B;  4JE3 B;  1N5X A;  2BB6 A;  1C4P A;  3VH3 B;  1EF1 A;  1H4R A;  3TSS A;  1P3Q U;  2M17 A;  1L0X B;  3Q6B A;  2AYO B;  4FN2 A;  2C7M B;  1CK1 A;  4S0R A;  2OOB B;  4I6P A;  2V9H A;  4O1N A;  3QQ8 B;  2MCN B;  5HHD G;  2KTF A;  1V5T A;  4P16 A;  2I1J A;  2GOW A;  4HXD A;  1UBQ A;  2XN9 C;  4ZRP A;  3OJ3 A;  2AL3 A;  3AE4 B;  1E8Y A;  3DVN U;  1C1Y B;  1TTN A;  1VJK A;  2IGD A;  3MC8 A;  1B9R A;  4P1C C;  5HFY A;  3PV1 A;  2KKC A;  1HTQ A;  1N62 A;  5LNK 1;  2LI5 A;  1IPG A;  2O6V D;  1Y8R C;  2JT4 B;  1JW9 D;  2MBH A;  1FM0 D;  4J6I A;  1L6U A;  3ZNH B;  3IVF A;  3DVG X;  2WWZ A;  4LNI A;  2VZK D;  4A8X C;  2EKI A;  3RN9 C;  4NNJ B;  3ABV B;  1EUV B;  2LGS A;  1TS3 A;  2LGY A;  5AZH A;  2NBU A;  3R2I A;  1PGX A;  3BK2 A;  4BKT A;  4KZC A;  1ZKH A;  3RYT A;  2UYZ B;  5HI1 A;  3IT6 B;  4K7W A;  4IWQ A;  4DXG A;  1F1H A;  3CSF A;  4IM2 A;  4NJ6 A;  4EZL A;  3AN1 A;  2LVO A;  1QF6 A;  3H6N A;  3A1Q A;  2BVC A;  4ASW C;  4MEL A;  5I4D A;  4K81 A;  2VRR B;  4HLE A;  1FO4 A;  3S2A A;  2INP E;  2LD9 A;  3R2T A;  2I38 A;  2REX A;  1MVK A;  4ANV A;  4XWW A;  1F2R C;  1F9J A;  3AE8 B;  1T6B X;  5BYS A;  1F2R I;  4HCP B;  2R2Q A;  4AWJ A;  2RPV A;  1E7U A;  3EHV A;  4J3O D;  4KIK A;  3R3M A;  3NUH B;  1SJH D;  4HPL B;  2MA9 B;  4IOI E;  4GGQ A;  4C56 C;  2L00 B;  2L32 A;  4KSK C;  1YX6 B;  4WJO A;  4A90 A;  1KOT A;  3NVZ A;  2UWQ A;  2DYB A;  3W1S C;  1V97 A;  4DDG D;  4TKN A;  2PKO A;  2KAC A;  1TGZ B;  1EM7 A;  3RNB C;  1VRA B;  2MWS B;  2RGF A;  4JL9 A;  3ETR A;  3SFD B;  5DPW A;  2WS3 B;  3NG0 A;  5IN7 A;  5LXI B;  2ZW0 A;  2QEJ C;  4HKZ E;  3ZIM A;  2FCN A;  2WLB A;  1I4G A;  1LFD A;  1V49 A;  4AJY B;  5MPO A;  3ML8 A;  2K3U A;  1A5R A;  4WJN A;  2HDE A;  2V4L A;  1FXT B;  5E6N A;  4YXD B;  2IO2 B;  1GOZ A;  2G3Q B;  4JGH B;  2MP2 B;  2NMQ A;  1D5X C;  3I57 A;  4DXF A;  2C9W B;  2PW9 A;  2CU1 A;  3EGR A;  1XD3 B;  2PVG C;  3APF A;  3WAP A;  3VUW A;  1KTK A;  3PGE A;  3V62 A;  2X8X X;  2FUH B;  1LGR A;  4YTP B;  2V3P A;  3KUZ A;  3AEF B;  5CHW A;  3PZ7 A;  1R7S A;  3FIL A;  4YWG G;  4GLS C;  3MJ5 A;  3H7P B;  5JHA A;  3KW5 B;  2KXJ A;  3PRP B;  1WFY A;  1C3T A;  2KN4 A;  4XYC A;  1T0S C;  3RCZ A;  4HVB A;  3ZO5 B;  3I9V 1;  5GMV A;  4KDL B;  1SXT A;  1WI0 A;  1TS4 A;  2AX5 A;  2ZVO A;  1T3Q A;  4GDK B;  3Q8F A;  1WIA A;  1WR1 A;  1E9M A;  1UD7 A;  1V9J A;  3ZJU A;  2D3A A;  2JU6 X;  4MEM A;  2M4N A;  2W3R A;  4IW0 A;  2BWF A;  3K9O B;  1SB3 C;  1FNV A;  4KX6 B;  2FUG 1;  2J0M A;  4ZYS A;  3B2F A;  4DHJ D;  4MSM B;  2MBO A;  2C7H A;  3MTN B;  2NPT B;  4MGI E;  4MDK E;  3ZNI D;  1TT5 B;  2KC2 A;  3U7D A;  2ZNV C;  3M95 A;  4PS7 A;  2K1F A;  1UF0 A;  1DOX A;  2DYO A;  2Y5C A;  1KH0 A;  2WU5 B;  3PLU A;  3P1M A;  3AXC A;  2NBW B;  1QKZ A;  4W9C A;  1IGD A;  4JPS A;  1Q1O A;  3NZS A;  3RD2 A;  3VH4 B;  4ARI A;  1FRR A;  2YVC A;  4LNO A;  4N9F 4;  5E6O A;  4IWO A;  3EEC A;  1FIQ A;  2PEA A;  3HK0 A;  1WGG A;  1SIJ A;  2K8H A;  4RGN A;  2WU2 B;  4GMV A;  3SU8 X;  2RMM A;  2QDF A;  2WXL A;  3UI3 A;  3N1Z C;  4KVG B;  2D11 A;  3AE5 B;  4C00 A;  4ZHO A;  1T0R C;  2XEW A;  3U8Z A;  4FA6 A;  5BYR A;  3P2B A;  1EWY C;  2CR5 A;  4KGR A;  3AEB B;  4IKG A;  2J4X A;  3L17 A;  1YQB A;  4IG7 B;  2DBY A;  2VH1 A;  3C8Y A;  3H8H A;  1G6J A;  1IYF A;  1WXQ A;  1ZGU B;  4YTN B;  3OAW A;  3V3X A;  2K8C A;  4HKQ A;  1WXS A;  2WP9 B;  2PLP A;  5EE9 A;  3WAL A;  2I1K A;  3MJW A;  1MJD A;  4DHZ B;  1WF9 A;  2KD0 A;  4M0W A;  1WJ6 A;  2MBE A;  1WXA A;  2IND C;  1WXM A;  4G11 A;  3U30 A;  3QK0 A;  5CX3 A;  3A9K B;  3RNC C;  3JSV A;  4B0E A;  3R7R A;  3VQI A;  2N9X A;  2XNA C;  4HWI B;  3N20 C;  1VLB A;  3DHH C;  2Z0D B;  3TCA A;  4EEW A;  2WXR A;  2WDV B;  3AI5 A;  3DHI C;  5EE3 A;  4C80 A;  1E8X A;  1FNU A;  4C4V A;  1LO5 D;  1PYW D;  3PZ8 A;  3GOE A;  1IGC A;  2K9X A;  2TSS A;  1WGD A;  2BYF A;  4K7S A;  3L16 A;  1SE3 A;  2MQJ A;  3ZVV A;  2KX0 A;  2GBK A;  3RNF C;  3PHX B;  1NYR A;  3B0A A;  5DCN A;  1Y56 A;  3EFU A;  5D94 A;  4LDT D;  1WRI A;  3RNG C;  1XLO A;  3KVF B;  3TBL D;  2PTL A;  4A9A A;  1OQQ A;  3N32 A;  2D10 A;  3ZLZ A;  2OHF A;  2N9E B;  3AE7 B;  1UNS A;  4RNA A;  1NDD A;  2BF8 B;  3Q8A A;  2KTR B;  1JWM D;  4CYE A;  2ZNV B;  2ON8 A;  1SGH A;  2JZP A;  2MJE A;  3X0W A;  1S1Q B;  2KFK B;  3P4P B;  4LNF A;  1TY2 A;  2Y5P A;  3U7Z A;  2RD0 A;  2M1M A;  3H7S A;  3Q3F A;  1WJU A;  3DWG C;  3AU4 A;  5JZE B;  2N1V A;  4WAA A;  5BMI A;  3VTW A;  3C19 A;  2NCN A;  1FD6 A;  4A3O A;  4S17 A;  4IWP A;  2XK5 B;  1GUA B;  1R4N B;  2UU7 A;  4DDI D;  1GPX A;  1V1O A;  4X57 B;  1E6E B;  2MBB B;  2IPK D;  3EC8 A;  3VR8 B;  1WGH A;  3ZDT A;  2IYD B;  4OW0 A;  3KWL A;  1LM8 B;  3SDL C;  2EMS A;  3QA8 A;  1QQR A;  2EKE C;  2KK8 A;  1C76 A;  3WAM A;  1E7P B;  3N3K B;  3L0W B;  2WGS A;  3PTF C;  2W3S A;  3Q2A C;  2KQ7 A;  3DDC B;  2N9L A;  4R3D A;  5DPS A;  4PYU A;  2FCS A;  2WXP A;  3ZGZ A;  3QWZ B;  1K50 A;  1J0G A;  2IO0 B;  3VDZ A;  1UWM A;  2M0X A;  3U52 E;  4TUU A;  4GU2 A;  2PE9 A;  3ZJV A;  3PT2 B;  2WXI A;  1YD8 U;  3RZF A;  5LLI A;  1DYQ A;  1C9F A;  3H1U A;  4B95 A;  4US8 A;  2JQR B;  3ZXR A;  4W9K A;  2GBR A;  1JML A;  4W9G A;  2JZZ A;  2L05 A;  4USA A;  1YOV B;  4W9F A;  2HJ8 A;  5EDS A;  1WE6 A;  3IT4 B;  5J17 A;  1JWA D;  2V3S A;  3R7Q A;  2WX0 A;  3UIP B;  2N4F A;  4OVV A;  2JXT A;  3KYD D;  2WXM A;  4JLC A;  3CIR B;  1J19 A;  5LXH A;  3WA0 A;  3SEB A;  5H8Y E;  3AE3 B;  4ICU A;  3RNE C;  1Q10 A;  2MJ3 A;  3UIN B;  1UH6 A;  1JWU D;  4BBN F;  2N1W A;  1ZUD 2;  2WXG A;  2L76 A;  3BYT B;  2R61 A;  1MG8 A;  4WWO A;  1BXT A;  4ZDV A;  4ANW A;  1QOF A;  3DHG C;  4A55 A;  1V81 A;  2VZK B;  1AAR A;  4FXC A;  4BVU C;  3BIN A;  3NJT A;  2O2V B;  3PO0 A;  5L83 A;  3A4R A;  1XLQ A;  1L2N A;  1VCB A;  2Y5B B;  3QCA A;  4BBN C;  1FCC C;  2JVC A;  3A4S C;  3P4R B;  5IA7 A;  3LJ3 A;  4ACF A;  4II2 B;  2BQQ A;  1GB1 A;  4ZHP A;  3TEW A;  2AWT A;  3QAQ A;  2MX2 A;  4ITK A;  3T3O A;  2ZCB A;  4W9L A;  4FHK A;  1ESF A;  1Z5S B;  3HHM A;  1NI2 A;  2KLC A;  5EE1 A;  2L3Z A;  2QHO A;  2LGD A;  2LMC A;  5H92 C;  1PFD A;  3UQA A;  1ENF A;  3VXW A;  3NVW A;  1RWS A;  3VUY A;  2IY0 B;  3DBH I;  2DAF A;  4ZRK A;  4P7I A;  3PRZ A;  2KMC A;  1WM2 A;  4D2K A;  4B9K A;  4RFB A;  4HCN B;  1IUE A;  2DX5 B;  2V4I B;  2ZPY A;  4OVU A;  3AV8 A;  2GRI A;  5IO9 A;  2MP2 A;  3CMM B;  4BKS A;  1N61 A;  2IDY A;  5BMG A;  3B08 A;  4HPM B;  3VFK A;  3IFW B;  1CMX B;  5HG2 A;  1E5W A;  2NVU I;  4A6Q A;  2BBC A;  3R66 C;  3K9P B;  1I4X A;  1L4D B;  2AQ1 B;  1STE A;  2KVZ A;  3H7P A;  5TSS A;  2INN E;  4BOZ B;  4RF1 A;  3AUL A;  1FXI A;  1OEY J;  1VZ8 A;  2KMM A;  4NPN A;  1D5M C;  2EMT A;  2PE6 B;  2J7Q B;  2WQY B;  4LJP B;  3APC A;  4JQW C;  2HE7 A;  5JH5 C;  5BYQ A;  4F8C B;  2N7J A;  1XLP A;  3QHT A;  2K5P A;  2G4S A;  3TEZ A;  1P7E A;  1C79 A;  3ZDM C;  4GDK A;  1S3S G;  4LK0 M;  2KX3 A;  5AZG A;  4ZYN A;  3M62 B;  4WJQ A;  4MGZ E;  1HZ6 A;  1FPY A;  1RYJ A;  4M00 A;  4WWN A;  2N9K A;  3R8B A;  2AQ2 B;  2QJL A;  4WUR A;  3WAO A;  5AUK A;  1OQY A;  1E0Z A;  5DPR A;  2XBB C;  1WX8 A;  3B1L X;  3KQ4 A;  4NY0 A;  2Z8L A;  4GIV A;  3VAW A;  2YLM A;  4OVZ A;  4ZRQ A;  2PVO D;  2BS3 B;  1QT9 A;  2FAZ A;  3MP9 A;  2NPT A;  3P4S B;  1FXA A;  3NZU A;  3AE2 B;  4PT5 A;  1R4M I;  1NBF C;  2RDG A;  5CHV C;  2IGH A;  2CHX A;  3W1S A;  4RCO A;  1SE4 A;  3ZKJ C;  2PJH A;  3O13 A;  1Z2M A;  3WCQ A;  1ZW7 A;  3DBH B;  3N9Y C;  2DNF A;  3UF8 A;  3BYY B;  4YSY B;  2GB1 A;  5BO4 B;  3BZD B;  4DHJ B;  3M63 B;  4AQ7 A;  3I63 C;  1WGY A;  3PRE A;  1RLF A;  4FJZ A;  1WYW B;  4GDL B;  4PYZ A;  4MGY E;  1H8C A;  1SSN A;  1YJJ A;  2INC C;  1SBB B;  5L95 C;  2E3T A;  1DOY A;  2MJD A;  4PK1 A;  2E6X A;  2DZM A;  1JAL A;  2GBM A;  5JXV A;  2FCM A;  4II3 B;  2B76 B;  2ZVN A;  4B6W A;  4PS3 A;  4EUT A;  2K25 A;  2YEP F;  3LB8 C;  2DZJ A;  1TS2 A;  3WIM A;  1JQ4 A;  3B9J A;  1TYG B;  2FE8 A;  3ZRF A;  3E56 A;  1A70 A;  1XCQ L;  5AZF A;  2LJI A;  4LJO B;  1P1A A;  4KKJ A;  2BS4 B;  4WH4 A;  4E74 A;  4MM3 B;  1T0Q C;  4FBJ B;  3P4Q B;  3VHT C;  2V1Y A;  2NTT A;  1J7C A;  2IJ0 A;  3EA6 A;  2BYT A;  3A9K A;  2L8J A;  4MGK E;  2KO3 A;  2NTS A;  3AB5 A;  2RDH A;  3ZNG C;  3HRD D;  5IP4 D;  5FKA C;  2JWZ A;  3NRZ A;  1AYF A;  1XLN A;  4FLH A;  3HUI A;  1WRD B;  2AL6 A;  2N0S B;  2IO3 B;  2PIA A;  4DXA B;  3Q3N C;  3ENE A;  2BKF A;  1ZXH A;  3HVZ A;  1P0R A;  2NS5 A;  4ZOH C;  2QIE B;  1V1P B;  5J18 A;  1GC7 A;  2IO1 B;  4XDD A;  1WYG A;  1CJE A;  2H89 B;  3AMZ A;  1GC6 A;  3GE3 C;  3V60 A;  2IZV B;  4RMA A;  3IHP C;  1E8Z A;  1E90 A;  1RM6 C;  1ROE A;  4DK5 A;  1KLG D;  4QAY A;  4FUL A;  3DVN V;  4W9D A;  5IOI A;  3V61 A;  1LXD A;  4A20 A;  2LHE A;  3AH7 A;  3DBL I;  2D3G A;  4N59 A;  3DPD A;  4IM0 A;  1PGB A;  4BFR A;  1HEZ E;  2KTR A;  5IAA C;  2DLB A;  2PMV A;  2W55 A;  3DWM A;  2W54 A;  2SEB D;  1YIW A;  3AU5 A;  1L5P A;  2KFK A;  1JRO A;  5D7G A;  1WM3 A;  4HRO A;  4KZ0 A;  4LDT B;  1V2Y A;  1D6E C;  1YQ4 B;  3PVL A;  3BII D;  5JHB A;  4K3B A;  3Q14 C;  4W9J A;  4P1B C;  3RNA C;  4RF0 A;  1U4A A;  2QSD A;  2D3B A;  1KLV A;  3W9C B;  4BZA A;  2KDI A;  2XK5 A;  2MSE D;  1VD2 A;  2KAN A;  3ZUN A;  1MG4 A;  2M56 B;  1Q5W B;  2CHW A;  3VRB B;  2IBI B;  3N30 A;  1CQV A;  1V5O A;  2AQ3 B;  3B2G A;  2W9N A;  2ZPN A;  4RM9 A;  1FNW A;  2WDQ B;  3RUI B;  1XEE A;  1SEB D;  4GXB A;  1WXV A;  1ISN A;  2C7N B;  3PPA A;  1VZ7 A;  3M3J A;  2PPH A;  3N1X C;  5AUI A;  2AEH A;  1QOB A;  3UQB A;  2K8B A;  4GN1 A;  1TIF A;  3VTU A;  4E3C A;  1NVI D;  2LGX A;  2LXA A;  5G5H A;  3AEC B;  1PDX A;  4JIO U;  4NQK E;  1I35 A;  2L7R A;  4WQO B;  1UUP A;  4K3C A;  2YEP B;  1FCL A;  1KF6 B;  2ZCC A;  3GS2 A;  2DAJ A;  2G1E A;  1EU3 A;  1T0Y A;  1VR9 A;  3HM6 X;  3RT3 B;  4L2Y A;  1ZP0 B;  3BWU D;  1QIL A;  2WXO A;  2FCQ A;  3ZRC A;  3SFE B;  1N60 A;  3IG3 A;  1D3Z A;  2FBW B;  3E9S A;  4GSW A;  4XE0 A;  1YN3 A;  1QOA A;  1XT9 B;  4P6V F;  1F0Z A;  2KFJ A;  4RGO S;  4PS8 A;  4F1S A;  5D6J B;  2G9H D;  3TEX A;  2ZEQ A;  2CKH B;  3VVW B;  2L0T A;  2C5L C;  3Q3M C;  4ANX A;  1TY0 A;  1MFW A;  1X1M A;  2RSU A;  1TZ1 A;  4JWU C;  2BPS A;  3IAM 1;  4ARC A;  3DBL B;  1CZP A;  2VH2 A;  3O65 B;  1C78 A;  2JWU A;  2O6V A;  1ZDV A;  4HRS A;  1UEL A;  4KKI A;  1D5Z C;  2Z0E B;  2HD5 B;  1KJT A;  3TJP A;  1KM7 A;  2BGF A;  4RM8 A;  2GI9 A;  1XQQ A;  2L0F A;  3KUD B;  2M19 A;  2LFI A;  4I6L B;  4HPP A;  2O2V A;  2LWP A;  3DVG Y;  1QZE A;  5CTR C;  2FID A;  4KGT A;  3TMP B;  4TMA B;  4FJV B;  4DQO C;  4YL8 A;  3SD5 A;  2K22 A;  2BYE A;  2KQS A;  4LLG M;  1SE9 A;  4YSX B;  4AP4 C;  1WX7 A;  1M4V A;  3V6C B;  1DGJ A;  2ASQ A;  2GLS A;  4MJS B;  1E10 A;  1V80 A;  1OGW A;  4XWT A;  3L54 A;  4G3X B;  1IBX B;  3TEY A;  1FFV A;  1MPE A;  2CU3 A;  2DZK A;  2OJR A;  1TJE A;  5IKC M;  1XXG A;  3D32 A;  3V05 A;  4EZK A;  3H9D A;  3QAR A;  3NVV A;  3ZQ4 A;  4HJK A;  1NI3 A;  2WDT B;  1PUT A;  2EEL A;  2O6V B;  2JY6 A;  1QLB B;  3C0R B;  3W2D A;  2RDB C;  1ZPS A;  3U2S C;  3DQV A;  3A9J B;  4RGM A;  2DHZ A;  1JRP A;  3AEE B;  3L13 A;  1I4H A;  1V86 A;  2MH7 A;  1YX5 B;  4XGA B;  1HE8 A;  2M0A A;  5C23 A;  4AS1 A;  2MBQ A;  1WE7 A;  1C4A A;  1KFY B;  4OZA A;  1N63 A;  3T9L A;  2NR2 A;  3JYU A;  1E7V A;  1I42 A;  3NS1 A;  2KAJ A;  3UIO B;  1T5X D;  2MW5 A;  1RFA A;  2KJR A;  4AOF A;  3W5V B;  2LHD A;  2ACZ B;  1EWC A;  3OJ4 B;  1WMH B;  4IDI A;  1D4B A;  2ZZP B;  3BK1 A;  2K39 A;  2ONQ A;  5GXG B;  4DWF A;  1FEH A;  3NS8 A;  3KWV A;  2WX1 A;  3AE6 B;  4NAM A;  2BWE S;  1SJE D;  3MFG A;  2KOX A;  4DHZ E;  2M8S A;  4ZRJ A;  3TUO A;  3RFZ B;  2KHW B;  3P63 A;  3MHS D;  4M02 A;  5HKH A;  2J52 A;  3KYC D;  3CWI A;  2MLB A;  2HJ1 A;  2WXQ A;  3ZJT A;  1YJ1 A;  1I7H A;  5C2T B;  4NAW B;  2G4D B;  1HTO A;  1K53 A;  1AW7 A;  2K0P A;  2KJ6 A;  2DZI A;  2BYV E;  4TQ1 A;  3ML9 A;  4HDQ A;  3ALB A;  1NEK B;  1YNT E;  3VRA B;  1WWT A;  1GJZ A;  2KDF B;  2CHZ A;  4LTU A;  3V6E B;  4EZJ A;  4A3P A;  3Q8C A;  4US9 A;  3DBR I;  4HJG E;  3RPF C;  2KDB A;  4TQ0 A;  2L52 A;  5G55 A;  1AWD A;  2DYM A;  5AEK B;  2KWV B;  2WHI A;  1GNU A;  1L6V A;  4MSQ B;  3W5U B;  2GMI C;  2KNB A;  4CHK A;  2J0K A;  1F77 A;  1OFF A;  4TV3 A;  4F7Z A;  3PZD A;  2JXX A;  2BS2 B;  5CHF A;  3FKY A;  1J8C A;  3NY5 A;  4CO7 A;  4GDL A;  2BT6 A;  4N6E B;  4W9E A;  2LAS A;  3QX1 A;  3CF6 E;  1GG3 A;  3Q3O C;  1MHH E;  4EFO A;  2KWC A;  3AED B;  2WXJ A;  2LRW A;  3DOW A;  1HA5 A;  2LRU A;  3OLM D;  1M94 A;  2LUM A;  2L83 A;  2G45 B;  4L1B A;  5D3D A;  1TKG A;  3RMK C;  3WAN A;  1N5W A;  3IXS A;  2KC1 A;  2QCZ A;  2B3A A;  4G50 A;  3TL5 A;  1V8C A;  4BKG A;  4XX5 A;  4GOC A;  3APD A;  2OJW A;  3BY4 B;  1WX9 A;  4MM3 A;  4C7Z A;  3GP7 A;  4NJC A;  1JWS D;  2KN5 A;  2X38 A;  1MHX A;  2SAK A;  2BW2 A;  2DWQ A;  1YMH E;  2JSV X;  3ONS A;  4KDI C;  4K7U A;  3TIX A;  2N7D A;  4G0N B;  3MC0 B;  2A4Z A;  2A5U A;  2JZ3 B;  3RUL A;  1P98 A;  1ZDX A;  2KQ4 X;  3A1Q B;  3AEA B;  3QIJ A;  3PLV A;  1KLU D;  3X23 A;  4EE2 A;  3EUB 2;  4B0M A;  2WYQ A;  3VUX A;  1OEY A;  1LQB A;  3MC9 A;  4M8N A;  1V1P A;  3ECI A;  4IUM B;  3JW0 X;  4MAC A;  4KIK B;  1HZ5 A;  3P42 A;  1B1Z A;  4IC7 B;  2LEK A;  2W82 A;  4WIP A;  2N7E A;  1I4P A;  1UBI A;  2IGG A;  2ZW1 A;  2JRI B;  1OTR B;  1TBE A;  3IBE A;  1VDV A;  3BVG A;  2WXF A;  3QJZ A;  2Q5W D;  3HM3 A;  1KRH A;  2HTH A;  4OZB A;  1MI0 A;  3DBR B;  4LCD E;  3CST A;  3LDZ E;  4BKS D;  4JX1 C;  4FAD A;  5KHO A;  3IAS 1;  2HTM E;  3ZNZ B;  2CJO A;  1WJ4 A;  1PQS A;  1TKY A;  4EOY A;  4LNK A;  1P9D U;  5C1Z A;  3NZ3 A;  4NZL B;  2OED A;  2GBJ A;  1WSP A;  2KYW A;  4KV2 A;  2QMT A;  3BVM A;  1DOI A;  3URY A;  4CQN A;  1YN4 A;  2ZJD A;  2WXK A;  2R2O A;  1BT0 A;  2KWD A;  4W9H A;  4JWS C;  4XZ4 A;  3KH0 A;  2NBV B;  1EF5 A;  2MHJ A;  2MEK A;  1I4R A;  4IM3 A;  1YN5 A;  1QOG A;  1ZE3 D;  1L7Y A;  2LUE A;  2BTE A;  1TS5 A;  3FC4 A;  4K1R B;  4OHJ A;  1C4C A;  3LXF A;  3AM9 A;  5FR6 A;  2ICI A;  4YT0 B;  4BAX A;  1SF0 A;  3VR9 B;  4WQM A;  2KT7 A;  1SE2 A;  3HVD A;  4MH8 A;  2H88 B;  3FIL B;  2J42 A;  3SHQ A;  3T3N A;  3GB1 A;  4MH0 E;  2WNM A;  4W9I A;  1XF5 L;  3Q69 A;  3JVZ X;  1XCT L;  2JF5 A;  1RRB A;  1R4N I;  3HIZ A;  4LNN A;  4BOS C;  3SR6 A;  1NYQ A;  1FMA D;  3GE8 C;  1UGM A;  2MRP A;  3ZW3 A;  3AEG B;  1R4M B;  4M8M A;  3PHW B;  2FNJ B;  2CS4 A;  1EO6 A;  1JRU A;  1L0V B;  1J7A A;  3J9C A;  3OG5 A;  3ZYY X;  2JUO A;  1NEN B;  2Z59 B;  3AE9 B;  4ANU A;  5C3J B;  4M01 A;  3L08 A;  3KLS X;  5T8I A;  4YSZ B;  5G5G A;  4ICV A;  1C77 A;  2BB5 A;  2JYE A;  1XO3 A;  2DEN B;  2J0J A;  1FFU A;  3OWE B; 
#chains in the Genus database with same CATH homology
 3AV8 A;  1M4V A;  2GRI A;  1SXT A;  1DGJ A;  4MT5 A;  1TS4 A;  2AX5 A;  1ET6 A;  2D5G A;  3FAH A;  1T3Q A;  4GDK B;  1OQR A;  1E10 A;  3Q8F A;  1GAQ B;  1N61 A;  2IDY A;  1E9M A;  5BMG A;  3ZJU A;  2JU6 X;  4XWT A;  1FRD A;  2W3R A;  2J53 A;  1SB3 C;  5HG2 A;  1IBX B;  3TEY A;  3L4P A;  1FFV A;  4A6Q A;  1FNV A;  3U4E G;  2BBC A;  1MPE A;  1K51 A;  2QIL A;  2CU3 A;  1RFK A;  5EE0 A;  1TJE A;  4KX6 B;  1XXG A;  1I4X A;  2FUG 1;  3NVY A;  3V05 A;  1L4D B;  1YQ3 B;  2AQ1 B;  4ZYS A;  1STE A;  1L0Y B;  3B2F A;  1AN8 A;  2INN E;  5TSS A;  4RF1 A;  1J7B A;  1FXI A;  3NVV A;  3ZQ4 A;  1BML C;  1NI3 A;  1VZ8 A;  4N58 A;  1PUT A;  2KMM A;  1D5M C;  2EEL A;  1QLB B;  2WQY B;  2CJN A;  3W2D A;  5BYQ A;  4WWM A;  2N7J A;  1XLP A;  1ZPS A;  3U2S C;  2K5P A;  3TEZ A;  4RGM A;  1P7E A;  2DYO A;  1C79 A;  1DOX A;  1JRP A;  2WXN A;  1KH0 A;  2WU5 B;  2Y5C A;  3AEE B;  3P1M A;  1I4H A;  1YJI A;  1UGJ A;  4LK0 M;  4OZC A;  2MH7 A;  1QKZ A;  1ZXI A;  1HZ6 A;  1IGD A;  2M0A A;  4JPS A;  4AS1 A;  1C4A A;  3BVZ A;  1KFY B;  4OZA A;  1RYJ A;  1N63 A;  5FR3 A;  1IBX A;  2N9K A;  2L1A A;  2AQ2 B;  2QJL A;  4RGT A;  4WUR A;  5AUK A;  3R8B A;  4ARI A;  1E0Z A;  1FRR A;  1I4Q A;  4TSS A;  3NS1 A;  2V0G A;  3Q8E A;  2KAJ A;  1T5X D;  2JX5 A;  5E6J A;  3KQ4 A;  1FIQ A;  2Z8L A;  3W5V B;  2LHD A;  2ACZ B;  1EWC A;  4OVZ A;  4IDI A;  4ZRQ A;  2PVO D;  4RH6 A;  1D4B A;  2BS3 B;  2LGI A;  1SIJ A;  1QT9 A;  3BK1 A;  4RGN A;  2WU2 B;  2WDR B;  3MP9 A;  2RMM A;  2ONQ A;  3P4S B;  5GXG B;  2WXL A;  3UI3 A;  1FEH A;  2V3N A;  3AE5 B;  4ZHO A;  1FXA A;  3KWV A;  4H2A A;  3AE6 B;  5BYR A;  3AE2 B;  4NAM A;  4PT5 A;  5FK9 C;  1EWY C;  1SJE D;  1P7F A;  3MFG A;  4KGR A;  2I2Y A;  1ZOY B;  1HQR D;  2RDG A;  3AEB B;  1JCK B;  4IKG A;  2J4X A;  2IGH A;  3TUO A;  3RFZ B;  2DBY A;  3W1S A;  3P63 A;  4RCO A;  3C8Y A;  1SE4 A;  3H8H A;  2J52 A;  1UWX A;  3CWI A;  1WXQ A;  3O13 A;  1GB4 A;  4YTN B;  3V3X A;  3WCQ A;  4Q2J A;  4HKQ A;  3MHZ A;  3N9Y C;  2WXQ A;  4HEA 1;  3ZJT A;  3BYY B;  2WP9 B;  4YSY B;  1I7H A;  2GB1 A;  2PLP A;  4NAW B;  4L23 A;  3BZD B;  5EE9 A;  5C2T B;  1VZ6 A;  1ET9 A;  1K52 A;  4AQ7 A;  1L4Z B;  2WXH A;  1WGK A;  4M0W A;  1K53 A;  1AW7 A;  2K0P A;  4GDL B;  4B0E A;  1HXY D;  1SSN A;  1YJJ A;  4TQ1 A;  3VQI A;  1SBB B;  1NEK B;  4XDC A;  1YNT E;  4KGS A;  2XNA C;  3VRA B;  2E3T A;  2JYT A;  1DOY A;  1VLB A;  1WWT A;  2MJD A;  2E6X A;  1ACC A;  1JAL A;  2WXR A;  4LTU A;  5JXV A;  2WDV B;  4C7Y A;  1EU4 A;  2B76 B;  5EE3 A;  1PGA A;  3Q8C A;  4US9 A;  4HJG E;  3RPF C;  4C80 A;  1BUI C;  2YEP F;  1FNU A;  3LB8 C;  3LYY A;  4TQ0 A;  2L52 A;  1LO5 D;  1AWD A;  2DYM A;  1PYW D;  5BMH A;  2KDM A;  1TS2 A;  1L6V A;  1JQ4 A;  3PZ8 A;  3B9J A;  1IGC A;  1TYG B;  3W5U B;  2FE8 A;  2Y3A A;  2K9X A;  1TKE A;  1F77 A;  3AE1 B;  1A70 A;  2TSS A;  1OFF A;  1XCQ L;  3E56 A;  4UDU C;  1JWB D;  2LJI A;  1SE3 A;  4KKJ A;  2BS4 B;  4WH4 A;  2BS2 B;  4MM3 B;  1NYR A;  4WAF A;  4REZ A;  1Y56 A;  3Q8B A;  1WRI A;  3P4Q B;  2NTT A;  1J7C A;  2BT6 A;  2IJ0 A;  3EA6 A;  4N6E B;  1XLO A;  2BYT A;  1TZO A;  2PTL A;  4A9A A;  1OQQ A;  5D3I B;  1MHH E;  2NTS A;  2OHF A;  4YTM B;  3AB5 A;  3AE7 B;  1UNS A;  2RDH A;  4RNA A;  4JE3 B;  3AED B;  3HRD D;  3Q8A A;  1N5X A;  2WXJ A;  2BB6 A;  5FKA C;  3NRZ A;  1AYF A;  1XLN A;  1C4P A;  1HA5 A;  3HUI A;  1JWM D;  2LUM A;  3TSS A;  2ON8 A;  2L83 A;  1L0X B;  2JZP A;  2N0S B;  4L1B A;  2MJE A;  3P4P B;  5D3D A;  1TY2 A;  1TKG A;  2Y5P A;  3U7Z A;  2PIA A;  1CK1 A;  1N5W A;  1ZXH A;  3HVZ A;  3DWG C;  3IXS A;  4ZOH C;  2QIE B;  1V1P B;  4O1N A;  4XDD A;  5BMI A;  1V8C A;  1WYG A;  1CJE A;  2H89 B;  3AMZ A;  5HHD G;  1FD6 A;  4P16 A;  4C7Z A;  3GP7 A;  4NJC A;  1GPX A;  1JWS D;  1RM6 C;  1V1O A;  1ROE A;  1KLG D;  2X38 A;  1MHX A;  2XN9 C;  2SAK A;  4ZRP A;  2BW2 A;  1E6E B;  2DWQ A;  1YMH E;  2JSV X;  2IPK D;  2LHE A;  3AH7 A;  3VR8 B;  4N59 A;  3MC0 B;  3AE4 B;  1ZDX A;  4OW0 A;  2KQ4 X;  3KWL A;  1PGB A;  1VJK A;  2IGD A;  3AEA B;  1B9R A;  1HEZ E;  5HFY A;  2DLB A;  1QQR A;  2PMV A;  2W55 A;  3DWM A;  2W54 A;  1N62 A;  1C76 A;  5LNK 1;  1E7P B;  1KLU D;  2SEB D;  1L5P A;  1JRO A;  5D7G A;  4EE2 A;  2W3S A;  3EUB 2;  1JW9 D;  4HRO A;  4B0M A;  1FM0 D;  1L6U A;  4R3D A;  2N9L A;  2WXP A;  3ZGZ A;  1V1P A;  2VZK D;  1D6E C;  1YQ4 B;  1K50 A;  4MAC A;  4A8X C;  3BII D;  2EKI A;  1UWM A;  4RF0 A;  1HZ5 A;  3P42 A;  3U52 E;  1B1Z A;  3ABV B;  2QSD A;  1TS3 A;  2LEK A;  2W82 A;  3W9C B;  4WIP A;  3R2I A;  1PGX A;  3BK2 A;  1I4P A;  3ZJV A;  2IGG A;  2WXI A;  2M56 B;  2ZW1 A;  5HI1 A;  3IT6 B;  1DYQ A;  1C9F A;  3VRB B;  1VDV A;  4DXG A;  4US8 A;  3BVG A;  1CQV A;  2JQR B;  2AQ3 B;  3B2G A;  2WXF A;  3AN1 A;  2Q5W D;  1FNW A;  1QF6 A;  2WDQ B;  1KRH A;  4OZB A;  1MI0 A;  5I4D A;  1XEE A;  1SEB D;  1FO4 A;  4JX1 C;  3IAS 1;  1VZ7 A;  2INP E;  2HTM E;  1JML A;  2CJO A;  3R2T A;  2I38 A;  1TKY A;  4USA A;  1MVK A;  5AUI A;  4XWW A;  1QOB A;  3NZ3 A;  1F2R C;  4NZL B;  2OED A;  3IT4 B;  3AE8 B;  1T6B X;  5BYS A;  1WSP A;  1NVI D;  1JWA D;  1F2R I;  2RPV A;  2JXT A;  4J3O D;  2WXM A;  5G5H A;  3CIR B;  2QMT A;  3AEC B;  1DOI A;  1PDX A;  3BVM A;  3URY A;  1YN4 A;  4CQN A;  3NUH B;  1SJH D;  1UUP A;  2WXK A;  2YEP B;  4IOI E;  1KF6 B;  1FCL A;  3GS2 A;  3SEB A;  2KWD A;  5H8Y E;  4C56 C;  2G1E A;  2L32 A;  3AE3 B;  1EU3 A;  1VR9 A;  4JWS C;  4L2Y A;  1ZP0 B;  3BWU D;  4A90 A;  1Q10 A;  2MJ3 A;  3NVZ A;  1QIL A;  1JWU D;  2MEK A;  1I4R A;  1YN5 A;  1V97 A;  1QOG A;  1ZUD 2;  2WXG A;  1ZE3 D;  3BYT B;  2R61 A;  2BTE A;  2PKO A;  1BXT A;  1TS5 A;  2KAC A;  2WXO A;  3FC4 A;  4OHJ A;  1C4C A;  1QOF A;  3LXF A;  3AM9 A;  1EM7 A;  1N60 A;  2ICI A;  4YT0 B;  3SFE B;  1SF0 A;  2FBW B;  3E9S A;  2VZK B;  3VR9 B;  4A55 A;  4WQM A;  4XE0 A;  1VRA B;  1YN3 A;  1QOA A;  4FXC A;  4P6V F;  3ETR A;  1F0Z A;  4RGO S;  1SE2 A;  3HVD A;  4MH8 A;  2H88 B;  3PO0 A;  3SFD B;  3FIL B;  1XLQ A;  2J42 A;  2WS3 B;  3T3N A;  3GB1 A;  2G9H D;  1FCC C;  3P4R B;  3TEX A;  2ZW0 A;  2WNM A;  2QEJ C;  1XF5 L;  4HKZ E;  3Q69 A;  2WLB A;  1I4G A;  1GB1 A;  1XCT L;  1TY0 A;  4ZHP A;  3TEW A;  5MPO A;  4JWU C;  4ITK A;  2K3U A;  3T3O A;  3IAM 1;  2HDE A;  3SR6 A;  1NYQ A;  1FMA D;  4YXD B;  4ARC A;  1GOZ A;  3AEG B;  1ESF A;  1CZP A;  2NMQ A;  1D5X C;  3I57 A;  4DXF A;  1C78 A;  2PW9 A;  2JWU A;  5EE1 A;  3EGR A;  1ZDV A;  4HRS A;  2PVG C;  1L0V B;  1D5Z C;  1J7A A;  2LMC A;  1KTK A;  4KKI A;  3J9C A;  5H92 C;  3ZYY X;  1PFD A;  1ENF A;  3NVW A;  1RWS A;  2GI9 A;  1NEN B;  3AE9 B;  4YTP B;  2V3P A;  3AEF B;  2M19 A;  5C3J B;  2LFI A;  3PZ7 A;  1R7S A;  3FIL A;  4YWG G;  4GLS C;  4YSZ B;  3KLS X;  4KGT A;  5T8I A;  5G5G A;  3MJ5 A;  4TMA B;  4D2K A;  1C77 A;  4DQO C;  2BB5 A;  4RFB A;  2KN4 A;  2JYE A;  1IUE A;  2K22 A;  2V4I B;  1XO3 A;  3I9V 1;  4LLG M;  4YSX B;  1FFU A;  3OWE B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...