3AH7A

Crystal structure of the isc-like [2fe-2s] ferredoxin (fdxb) from pseudomonas putida jcm 20004
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
109
structure length
109
Chain Sequence
MPLVTFLPHEKFCPEGLTVEVKPGTNILELAHDHHIEMESACGGVKACTTCHCIVRKGFDSLEEADELEEDMLDKAWGLEAQSRLGCQVFVADEDLTIEIPKYSLNHAA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Metal binding protein
molecule keywords [2Fe-2S]ferredoxin
publication title Crystal structure of the ISC-like [2Fe-2S] ferredoxin (FdxB) from Pseudomonas putida JCM 20004
rcsb
source organism Pseudomonas putida
total genus 27
structure length 109
sequence length 109
ec nomenclature
pdb deposition date 2010-04-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00111 Fer2 2Fe-2S iron-sulfur cluster binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 3ah7A00
3VR8B 3AEEB 1RYJA 1YQ3B 3ABVB 3AEFB 1V8CA 3NVYA 1FXAA 3SFEB 1WXQA 4YT0B 2N0SB 3CWIA 1ZOYB 2WDQB 4WQMA 2HTME 1A70A 1CZPA 1FIQA 2B76B 2L52A 3AE1B 1E6EB 2KAJA 2K5PA 2BS3B 3B2GA 1ZXIA 3P4QB 2MH7A 1FRDA 1N63A 2K22A 1J7CA 3W5UB 1E10A 2K9XA 1JROA 1KRHA 1XLQA 1WYGA 1NI3A 2QJLA 4YTNB 4YSZB 5EE0A 1V97A 1N61A 3AEBB 3L4PA 2CU3A 1PFDA 1WGKA 3EUB2 4YTPB 3NVZA 1JWAD 1J7AA 4JWSC 1CJEA 2PIAA 2G1EA 3ETRA 4JWUC 4HROA 1UWMA 1FFVA 1B9RA 3WCQA 1F0ZA 1NEKB 1VJKA 4P6VF 1QF6A 5EE9A 4N6EB 3PO0A 3VRAB 4US8A 3HUIA 3HRDD 1AYFA 4WWMA 3AEDB 2H89B 4JX1C 1DOYA 2JX5A 2KMMA 5GXGB 3AB5A 2BT6A 4ZHPA 1DOXA 5G5HA 2CJNA 2WU2B 4IDIA 1NENB 3AN1A 3P4RB 1QOBA 2WP9B 4N59A 1XO3A 3P63A 2M19A 1YJJA 1TKEA 2BS4B 3AE5B 2WLBA 1ROEA 3AECB 1JRPA 3HVZA 3W9CB 2ACZB 2WDVB 1JWBD 3NVVA 1JW9D 2DWQA 3AE7B 1TJEA 1JQ4A 3AE8B 3BIID 3CIRB 1L6VA 1TKYA 1N62A 1YQ4B 3B2FA 1E0ZA 1RWSA 2MJEA 1QOAA 1WRIA 1FM0D 3SFDB 1L6UA 1GAQB 3RPFC 1XLNA 4HRSA 1FXIA 1OFFA 1VDVA 2EKIA 2PVOD 2W3RA 1KFYB 2WS3B 1PUTA 1YJIA 1DGJA 2CJOA 1XLOA 2E3TA 3LXFA 3AM9A 2AX5A 1QOFA 2BS2B 5AUIA 2H88B 3VR9B 1J7BA 1TKGA 3W5VB 3LB8C 2WU5B 4ZHOA 4ZOHC 2W54A 3KWLA 1I7HA 2MJ3A 3AH7A 1TYGB 3SR6A 5EE1A 5C3JB 3P4SB 1PDXA 4YSYB 5H92C 2PKOA 3VRBB 3B9JA 4YTMB 3AV8A 1NYRA 2JQRB 3AE6B 1NYQA 2W55A 4LTUA 1L5PA 2WDRB 1L0VB 4A9AA 1T3QA 1QLBB 1QT9A 1OQQA 1FMAD 1VLBA 2DBYA 1GPXA 1WWTA 2OHFA 1DOIA 4FXCA 1JALA 2L83A 3AMZA 1E9MA 1OQRA 4KX6B 3AEGB 4USAA 2FBWB 4N58A 4C7YA 2W3SA 2MJDA 4YXDB 5C2TB 2QIEB 1IUEA 3FAHA 1SIJA 1XLPA 1E7PB 1EWYC 1RM6C 3NVWA 4US9A 2M56B 3P4PB 3ZYYX 5G5GA 2PVGC 3DWMA 2WQYB 1KF6B 3FC4A 4YSXB 1SB3C 1N60A 2LEKA 4C7ZA 3AEAB 3NRZA 5EE3A 3AE3B 5MPOA 4C80A 1AWDA 1ZP0B 2Q5WD 3P1MA 1N5WA 1FO4A 1R7SA 1SF0A 3NS1A 5AUKA 1FRRA 3AE9B 1NVID 3DWGC 4ITKA 1RFKA 1N5XA 3AE2B 5H8YE 1FFUA 2Y5CA 1ZUD2 1QOGA 3AE4B
chains in the Genus database with same CATH superfamily
3VR8B 3AEEB 5IAAC 3JYUA 3RNCC 2GI9A 1WIAA 1HE8A 1XLQA 2M4NA 1NI3A 1WGDA 4YTPB 2FE8A 2D3CA 2BYEA 2PIAA 2AEHA 4M0WA 4P6VF 1WXAA 1I4PA 3GE3C 1P7FA 2LGSA 2KNBA 2RR9A 4JX1C 1JCKB 3PLUA 1F2RI 4ZDVA 3RMKC 2N9EB 4FJYA 4AUQC 3HM3A 4WWOA 3ZW3A 2GLSA 3L16A 2WLBA 4G3XB 2BF8B 3E9SA 5AZGA 2KWUB 3KLSX 4N9F4 4MH0E 2ZNVC 4LNFA 3A9JB 2L0FA 2PVOD 5J17A 3FKYA 4P7IA 1TT5B 5AUIA 4CHKA 2BGFA 1K53A 2BWFA 2ZVOA 2LVQA 3N20C 1XD3B 2KLCA 2EKEC 2N9PC 1T3QA 3V6CB 2OHFA 3K9OB 2IO3B 1WGYA 3AEGB 4EOYA 4HK2A 2NBVB 3H7PA 3AU4A 2LD9A 2PE6B 3W1YA 4OHJA 2V0GA 5J18A 2MBOA 3NS1A 3IT6B 1FFUA 4IM0A 3KYCD 4BOSC 2LWPA 1TBEA 4KGRA 3Q3OC 1WXQA 3VTVA 4WQMA 4C4VA 2LFIA 2XN9C 1RAXA 2L52A 2O6VB 2WXJA 2OEDA 4K3BA 1STEA 1UZXB 3ZJUA 2K9XA 3MHZA 1TY0A 2CR5A 2R61A 3PSEB 3NVZA 2NS5A 4UDUC 3WA0A 2ON8A 1WGHA 3GZNB 4EE2A 1VJKA 2B3AA 4M8MA 2YLMA 3AEDB 4XYCA 3PHWB 1FCLA 1A5RA 4HVBA 5GXGB 4FJZA 5G5HA 4P16A 1QOBA 5E6PA 2KTRB 2WP9B 4A8XC 4P1BC 4BVUC 2KX3A 3R7QA 1XEEA 3NUHB 2BYVE 2WDVB 4RF1A 3BY4B 2NPTA 4HDQA 4K7UA 2KJHB 2KWCA 5I4DA 1Q5WB 2RD0A 1FXIA 1OFFA 3LYYA 3LXFA 3RD2A 2E3TA 4IC7B 4XC2A 1SSNA 3AH7A 3DBHI 1NYRA 1HQRD 4BAXA 1WH3A 4L1BA 1WWTA 3IAS1 1UWXA 2R2QA 1YMHE 3KQ4A 4Q2JA 4W9GA 2CHZA 4HJGE 3L54A 3B08A 2D5GA 2KQSA 2X8XX 4NPNA 4KKJA 2K8CA 4K7SA 2O2VB 4GMVA 3VUYA 1SF0A 1FO4A 4RMAA 1FEHA 1NVID 3W1SA 5H8YE 4E3CA 2Y5CA 1I35A 3AE4B 4PS7A 2MHJA 1YQ3B 3ABVB 3UQBA 3HM6X 2B76B 4AOFA 2KK8A 1GOZA 1HEZE 5E6JA 2RDHA 2QJLA 1K51A 5DPTA 3AEBB 2ZNVB 3KW5B 2LZ6A 3RI7C 3RNGC 5D3IB 2KOXA 4EZJA 4W9CA 3T3NA 3PZDA 2KDMA 4ANUA 2LJ5A 4ANWA 4PS8A 3ZJVA 4NNJB 1IBXB 1ZW7A 2L00B 2NTTA 2BS4B 3AE5B 3RNFC 3CSTA 2MLBA 4MGIE 1MHHE 1VZ6A 3S2AA 3AE7B 1JQ4A 2BB6A 3A4SC 2MBEA 1V6EA 4WWNA 2I1KA 4ARCA 3RT3B 2ZW0A 2WS3B 2LXAA 2JY6A 2AX5A 3VR9B 4ZHOA 1GG3A 4KIKA 1BUIC 4KSKC 2ONQA 3DOWA 2ASQA 4HKZE 3EFCA 3A4RA 1WMHB 4DBGA 1HZ5A 1L0XB 1MG4A 1Z5SB 2BBCA 2Z0DB 1YOVB 1GC6A 2IPKD 3ML9A 2KWDA 4FBJB 4LNIA 4FULA 3ZTDA 3FAHA 4US9A 3KWVA 1PQSA 1HTOA 3PRMB 1V5TA 3BYTB 3NZ3A 3PVLA 5CTRC 5IN7A 2QILA 1KLGD 4G11A 2GB1A 4WH4A 2WXPA 1CQVA 3AE2B 3UGBB 4KKIA 1V8CA 2A5UA 1C1YB 1HXYD 1C4AA 1WJNA 2N1VA 2KQ4X 3PLVA 4TUUA 4II3B 1EUVB 2MP2A 2MH7A 2XNAC 1WXMA 3TSSA 2PTLA 2MEKA 1KTKA 4YSZB 5EE0A 2KVRA 1GC7A 1MPEA 4JWSC 5LLIA 5HKHA 1UWMA 1F0ZA 2LVPA 1QF6A 2D11A 2BPSA 3IG3A 2MBHA 2MWSB 5LXIB 2WNMA 4P1CC 2WXOA 3W1SC 3L10B 3KYDD 4DK5A 1U4AA 1YX5B 4HEA1 2AL6A 1OEYJ 2WGSA 3K9PB 3N1XC 1H8CA 1ZPSA 3BIID 3B2FA 1WJ4A 3Q3MC 2MJEA 3DCGA 4WJPA 5DCNA 4JIOU 1TKGA 2JWUA 1UBIA 5D3DA 2W54A 4EFOA 4K3CA 4YSYB 3UF8A 5H92C 2K25A 3ZNHB 4YTMB 1FNVA 1Y8RC 2RPQA 3M95A 3VUWA 1GPXA 3JW0X 4PK1A 3OWEB 4A90A 1PGAA 4GLSC 2NBWB 2M17A 2QHOA 4DHJD 1SIJA 2L76A 3DPDA 3VTUA 3H7PB 3H8HA 2DAJA 2OJWA 3ONSA 4W9EA 2YVCA 1WM3A 1ET6A 4BBNF 3ZLZA 1N5WA 2GOWA 4AP4C 4DWFA 5EDSA 3IXSA 4F8CB 4XWTA 2N0SB 1ZOYB 4JQWC 1RRBA 4MACA 1E6EB 4C4VB 1RFAA 3GB1A 2KLGA 2NMQA 3WIMA 3IFWB 1V97A 2WWZA 1PFDA 5IOIA 3R2IA 3PHXB 2IGHA 4CQNA 1C76A 1OEYA 3IT4B 2N1WA 3BK2A 4YL8A 1DOYA 2CKHB 2QEJC 5C1ZA 1WE7A 2KTFA 2L8JA 2AQ2B 1LO5D 3B1LX 1SJED 3AECB 3TEYA 3D32A 1EU4A 2J4XA 1J19A 1IPGA 3AE8B 4TQ0A 1YQ4B 4JPSA 2NPTB 2PJHA 4FJVB 1TIFA 3ZYYX 2Z8LA 1DYQA 1N6ZA 1XLOA 1QOFA 5LNK1 1I42A 3Q6BA 4GDLA 4RF0A 2EMTA 5C3JB 3P4SB 1PDXA 2KDFB 4HCNB 3EECA 3AV8A 2D3AA 1M4VA 1L0VB 1QT9A 3DHGC 5IKCM 1XCTL 2KFKA 1SBBB 4HPMB 1TTNA 2RMMA 3L08A 4WJOA 2LHEA 5BMIA 2WDTB 2MJDA 2N7JA 2KC2A 1WJUA 4ARIA 3V62A 1KM7A 1E7PB 4QAYA 1Q10A 1WX8A 2KO3A 4OVUA 3FC4A 5D2MB 3QCAA 4TKNA 2KVZA 2LGDA 3P1MA 2ICIA 4II2B 1K50A 1SJHD 2V3PA 4KSLC 5AUKA 1FXTB 1GJZA 1RFKA 2FCMA 2C7HA 2BQQA 1G6JA 1F77A 1AN8A 1D3ZA 4MDKE 1SE4A 4NAMA 2AL3A 2BWES 2AQ1B 1ET9A 1WX7A 3DBRI 2EMSA 4HPPA 1E8ZA 1V80A 2K8BA 3EUB2 2G4DB 1KJTA 4DHZB 4IG7B 3Q8FA 4LLGM 4ASWC 3VAWA 4FA6A 3QK0A 2J0MA 1UBQA 4JL9A 4IM3A 3P4RB 1BT0A 2DAFA 3SDLC 1GUAB 2PMVA 2QMTA 3QARA 2ACZB 4PYZA 4BZAA 1WYWB 3CIRB 3MTNB 2IZVB 3RYTA 2Y5PA 2M0XA 1VDVA 1YJIA 3L13A 3PS6A 3PRZA 2RDBC 2ZJDA 3KWLA 1P3QU 4B95A 4EZLA 2L7RA 3AXCA 4S0RA 1X1MA 1FMAD 2JYTA 3SHQA 1WJ6A 4C7YA 3T9LA 2W3SA 1M94A 4AQ7A 2MSED 3MJ5A 1KF6B 4YSXB 1WRDB 1SB3C 3VFKA 4PS3A 3I5JC 1AWDA 3A1QA 3CSFA 4ITKA 4B0EA 3QIJA 2FCNA 3O65B 3NVYA 3CWIA 4GDKB 2M0AA 4OZAA 3TEZA 4ZYSA 3DHHC 1FRDA 3APFA 1R4MI 2LGXA 4JGHB 2MP2B 2RDGA 3X23A 2GBJA 1IGDA 3BVMA 1SIFA 3VHTC 3C19A 1NI2A 1EF1A 4A3PA 3HRDD 2HJ1A 1CMXB 3DDCB 1E8XA 2VH1A 2JPHA 5LXHA 2JWZA 1ZDXA 1C79A 3P63A 1WGRA 2REXA 1UNSA 2FCSA 3U7ZA 1L0YB 1FNWA 2VZKB 2LUMA 3RFZB 2KN4A 1QOAA 3BWUD 1D5MC 1FM0D 3JSVA 4HRSA 3Q2AC 3ZNGC 2CS4A 2A4ZA 2FUHB 4KDLB 1IP9A 1UELA 2WHIA 2DYBA 1C4CA 4MJSA 5D94A 1V2YA 2DYMA 2AWTA 3VH3B 3VRBB 2ZCBA 4M8NA 3ZDTA 4MGKE 2INDC 2KZRA 3RN9C 4URKA 4LTUA 1L5PA 3H9DA 1EWCA 2DBYA 2L83A 1OQRA 5JXVA 3DBLI 1LQBA 3DVGY 2QIEB 1EWYC 3RNEC 1VR9A 2PEAA 2RPVA 4BFRA 4C7ZA 5EE3A 1ZKHA 2JXTA 1VRAB 1ZP0B 4C80A 2GMIC 1TZOA 1R7SA 5CX3A 1FRRA 3AE9B 4RFBA 1Q0WB 4F7ZA 4A55A 2AQ3B 4NQKE 3UIOB 1PGBA 3X0WA 1A70A 1YX6B 4EEWA 5C23A 1J0GA 2BW2A 1D5ZC 3I63C 5DPSA 1E10A 1LM8B 4WJQA 2IY1B 3DVGX 4LJOB 5D7GA 2L1AA 4GGQA 1HTQA 2RGFA 3ZNZB 1WYGA 2KX0A 4YTNB 3MFGA 2DNFA 4ZRKA 2DLBA 4MM3A 1ZGUB 1B9RA 4WWPA 1UH6A 2KMAA 4WWMA 3P2BA 2Y5BB 1ZDVA 4LCDE 2J52A 1S3SG 2OOBB 1V86A 1R4NB 2VRRB 1C77A 1ISNA 2I38A 1TGZB 1I4RA 2JXXA 3PTFC 3TCAA 2BYFA 5T8IA 3A9KA 3RPFC 1WXSA 2WYQA 3W2DA 3NY5A 4KGSA 3PREA 2WU5B 3SEBA 3ZUNA 4ANXA 4GDLB 3GE8C 3UIPB 3RNAC 3VUXA 1F52A 4LNOA 1P0RA 4WJNA 3AMZA 3L17A 4NJ7A 2FBWB 3A33B 2KXJA 1JWMD 1ACCA 1P9DU 1OTRB 3MP9A 4NAWB 1SE9A 3AE3B 4MGYE 5BMHA 2Q5WD 5GMVA 3ZDMC 2WXIA 3RUIB 1GNUA 2NBUA 2K1FA 1QOGA 4GOCA 4OW0A 5KHQA 3ENEA 1RYJA 2D3BA 4K81A 3SFEB 4BKSD 1MJDA 3EA6A 2WX0A 1CZPA 1HA5A 4IUMB 3BVGA 4DDID 1J7CA 2HTHA 2KDIA 1MVKA 2JF5A 1OQYA 1C3TA 4F1SA 2G1EA 4GB9A 2DZJA 3WCQA 1NEKB 2W9NA 4RCOA 3HUIA 3FILA 2N7EA 1TS3A 3DBHB 4W9JA 3U8ZA 1D4BA 2N9KA 3M3JA 2CJNA 3QJZA 4HCPB 5KHOA 4OZCA 2JRHA 3ZXRA 1E7VA 1P1AA 3TEXA 1TJEA 5J2RA 2NTSA 4XDDA 3IHPC 3VVWB 4W9KA 2DHZA 1E0ZA 2DZKA 1WI0A 2E6XA 4LNNA 4M0WB 1PUTA 3AULA 1QZEA 4C56C 4L2YA 4HJKA 3TL5A 4ZOHC 4WAAA 3MHSD 2MJ3A 3OJ4B 1SGHA 2LI5A 2WXFA 1SEBD 5BYRA 4A6QA 3KUCB 1C78A 4USAA 2JZPA 1SXTA 4HDOA 4MT5A 4MEMA 1FCCC 1XLPA 1YD8U 3Q14C 1F9JA 3C8YA 3AI5A 3OG5A 4X57B 3QA8A 1WZ3A 2IBIB 1N60A 2LEKA 4REZA 3C0RB 4FN2A 4I6LB 4A20A 3N32A 1QKZA 2Z59B 3OLMD 2ZPNA 3A1QB 4IWPA 1KLVA 5HFYA 5E6NA 3NZSA 3U7DA 1XF5L 1Z2MA 3ZRFA 1IYFA 1T0RC 4JLCA 2HTME 2KTRA 3ALBA 2K22A 3PPAA 2MW5A 1N61A 3HVDA 3N30A 4KDIC 1EU3A 2KYWA 3ZNID 3UQAA 1YN5A 3PO0A 3VRAB 4US8A 4O1NA 1UD7A 1AYFA 1H4RA 1JMLA 2BYTA 2JX5A 1KH0A 2WXNA 3MJWA 3V05A 1QQRA 4KV2A 3AN1A 4ICVA 2PE9A 4N59A 1YJJA 1ROEA 1SE3A 3W9CB 4RH6A 1AARA 2N9LA 3RZWC 1JW9D 5G55A 1N62A 4K7WA 4RGTA 1RWSA 3SFDB 1GAQB 1XLNA 2UU7A 4MELA 3VDZA 2BS2B 1LXDA 2C5LC 3KVFB 2KFJA 2M8SA 2O2VA 3O13A 3QWZB 2MRPA 2PKOA 4MJSB 4RGMA 3B9JA 4ZRJA 3ZGZA 1NYQA 2KJRA 2CU1A 1OQQA 2ZZPB 1XCQL 3ZQ4A 4FXCA 2DYOA 2D2QA 3WANA 1V1OA 3V60A 4B0MA 4NQLB 3N1YC 4AJYB 3IAM1 3DVNU 3DWMA 4WQOB 5TSSA 2C60A 1UUPA 1Q1OA 3WALA 5IP4D 1P98A 4IOIE 3MC8A 4LK0M 2L0TA 4ZYNA 2UYZB 2V3NA 3AEFB 3NZUA 2QDFA 4LDTB 1PYWD 4W9LA 2K3UA 1AW7A 1WX9A 2BS3B 2OJRA 2IDYA 3P4QB 3VXWA 1L4DB 1BXTA 2GBNA 3W5UB 2Z0EB 4BOZB 1L2NA 4E71A 1KRHA 1KOTA 3Q3JA 2CU3A 1J7AA 3CF6E 2O6VD 2XK5A 3RCZA 4FLHA 2KDEB 3I9V1 4N6EB 4MM3B 2GRIA 2H89B 3QQ8B 1WXVA 2DX5B 3M63B 3ZJTA 1WMHA 4W9DA 1E7UA 2MQJA 2INCC 1WSPA 2IYDB 2CHWA 3KH0A 3IVFA 5E6OA 2GBKA 3GOEA 3A9KB 1QILA 2C7MB 1J8CA 3GZNI 1J7BA 4TQ1A 5FKAC 1F2RC 4OVZA 4TMAB 1UF0A 2KDBA 3SR6A 5DPWA 4ACFA 4IWQA 2JQRB 2UWQA 2V4IB 2ZEQA 4DHJB 1GB1A 2NCNA 1VCBA 2LUEA 1WM2A 1F1HA 1DOIA 4YWGG 4KX6B 3I57A 4PYUA 4ZRPA 1EO6A 3IBEA 3RZFA 2M56B 5G5GA 2G45B 3ZIMA 1D6EC 2JT4B 2WQYB 4KIKB 2ZVNA 3CMMB 2FIFA 3U52E 2N7DA 4MSMB 2GBRA 1T0YA 2LASA 1YNTE 4DDGD 3AE1B 3OJ3A 4AWJA 2KAJA 5CHVC 4XWWA 3B2GA 1MG8A 2C9WB 3U4EG 2HE7A 2I1JA 4W9HA 2L32A 1V1PA 4G0NB 3V3XA 4G50A 2K8HA 3T3OA 2V1YA 3BK1A 5HG2A 1FFVA 4AJWA 2IO1B 1OGWA 3N1ZC 1T0QC 5EE9A 5TR5A 1L7YA 3NHEB 3GS2A 2KMMA 2C7NB 3FILB 3KUDB 2I2YA 2WXLA 1TS2A 3HK0A 2WXQA 2M19A 4E74A 1ZE3D 2YEPB 4EKUA 3BYYB 3TUOA 2KANA 3QHTA 2X38A 2FNJB 1R4NI 3LDZE 2LRWA 4EUTA 4XGAB 1B1ZA 2W3RA 1T6BX 4I6PA 3TMPB 3N9YC 3W5VB 2WX1A 5AEKB 1JWUD 2VH2A 3RNBC 1NBFC 3R66C 2W55A 3PRPB 3VTWA 2IO2B 5HI1A 4WIPA 2WXGA 1KLUD 4J6IA 3DBRB 4EZKA 4HPLB 3PZ8A 4ICUA 2PVGC 2D07B 4BKSA 3V61A 3R2TA 4ZRQA 4NZLB 3NRZA 4BKTA 4H2AA 3DVNV 3WAOA 3Q69A 1LFDA 3PV1A 2IGGA 2XEWA 1FD6A 2IGDA 3DWGC 1IGCA 4BBNC 4MSQB 2HD5B 3Q8AA 4GIVA 5FR3A 1ESFA 5BYSA 2N4FA 1TZ1A 4NJCA 2K6QA 3DQVA 3H6NA 2JSVX 1VD2A 2MX2A 3I3TB 2DENB 4M00A 2FAZA 2LHDA 3EC8A 2IO0B 3TBLD 4GXBA 2JUOA 2J53A 4RNAA 4GSWA 2FIDA 3PGEA 3R8BA 1T0SC 1WR1A 4IKGA 2V9HA 3AB5A 4HXDA 4IDIA 4TSSA 1TKEA 2MCNB 2SEBD 3ECIA 2YEPF 1JWBD 2J0JA 2TSSA 2LGYA 3NVVA 3HHMA 2GBMA 1YJ1A 2V4LA 1YN3A 3TIXA 1XT9B 3VH4B 1XXGA 2EKIA 2WXHA 4MH8A 1DGJA 2INPE 2EELA 4XX5A 4RGNA 2RSUA 2PLPA 1VLBA 1YN4A 4IW0A 2LMCA 3PZ7A 3KUZA 1R4MB 4N58A 3APDA 5C2TB 2IY0B 2G9HD 1VZ7A 1WZ0A 1LGRA 2JVCA 4AS1A 2IJ0A 4RGOS 1I4XA 3OAWA 2HJ8A 3QX1A 4KVGB 1L4ZB 2JRIB 1ENFA 1WR6E 2SAKA 1JWSD 2KFKB 4I6NB 1CK1A 5AZFA 4W9IA 5JHAA 3N3KB 3NG0A 1FIQA 1EM7A 2K39A 2K5PA 2LGIA 5BYQA 3ZKJC 2BTEA 2FCQA 3R3MA 4IWOA 3Q8CA 2R2OA 1E8YA 1GB4A 4HROA 3Q3NC 3DHIC 4IM2A 3EHVA 3V6EB 2XK5B 3PT2B 4OVVA 4M02A 3GP7A 1MFWA 2G4SA 4DXAB 1V5OA 4RM8A 1V49A 4TV3A 4RM9A 2BT6A 4ZHPA 5L95C 2WU2B 1NENB 2KHWB 4ANVA 1FPYA 1XO3A 1V81A 5BO4B 3HVZA 4BKGA 3H7SA 3DBLB 2BB5A 3U2SC 3VQIA 1D5XC 3A9JA 4NJ6A 1TY2A 4FADA 3NJTA 2CJOA 2MA9B 3ML8A 2H88B 2KWVB 1MHXA 2KJ6A 3AU5A 2KC1A 3B0AA 3M62B 4NY0A 3J9CA 2DZIA 3TJPA 2PW9A 1E90A 2KT7A 5AZHA 2D3GA 3QAQA 4A9AA 2WDRB 2ZPYA 2LJIA 4GN1A 5D6JB 5CHWA 2INNE 4GDKA 3RULA 1E9MA 3ZXVA 1IUEA 2CHXA 2KN5A 1EF5A 3NVWA 2PPHA 4LDTD 4KGTA 2ZW1A 4JE3B 1C4PA 4L23A 4GU2A 3BINA 2LVOA 1VZ8A 2Y3AA 4D2KA 2O6VA 1UGJA 1ZXIA 1N63A 1JROA 2J42A 1WE6A 4CO7A 3NOBA 3URYA 3T8MA 1JWAD 4XE0A 3UI3A 1V1PB 1CJEA 4JWUC 1JRUA 5JH5C 4HKQA 4XDCA 1WFYA 3Q3FA 3ZRCA 2JYEA 1FNUA 2WXRA 1DOXA 1I4QA 1K52A 4HWIB 2LRUA 2NVUI 5BMGA 3BVZA 1L6VA 1TKYA 3BZDB 3APCA 5G2NA 2J7QB 1WRIA 3QC8B 3U30A 1L6UA 2WXMA 2BVCA 5IA7A 4XZ4A 2BKFA 3LJ3A 1I7HA 1TYGB 3DBSA 3P42A 4KZ0A 1YIWA 3AE6B 1I4HA 1QLBB 3UINB 2LXCA 4KZCA 4R3DA 2D10A 5FR6A 1JALA 2NR2A 4LJPB 2KQ7A 5CHFA 4YXDB 3EGRA 2JU6X 1RLFA 3ZO5B 3JSVB 4DXFA 1RM6C 1T5XD 2QC8A 4MGZE 3R7RA 4B9KA 2XBBC 1BMLC 1SE2A 2L3ZA 2L05A 3AEAB 3JVZX 1XQQA 1NDDA 2QSDA 1Y56A 2K6DB 2QCZA 1N5XA 4WURA 2HDEA 4ZRIA 2KD0A 4C00A 2JZ3B 1I4GA 1FXAA 3TEWA 4YT0B 2WDQB 4DHZE 1WF9A 1HZ6A 2WXKA 4W9FA 4M01A 2KACA 4B6WA 3L4PA 1WGKA 3MC0B 1ZXHA 5FK9C 1K8RB 4OZBA 4K1RB 2KKCA 3ETRA 2J0KA 2V3SA 1V9JA 4J3OD 3SD5A 2MBQA 1IBXA 2DZMA 4S17A 3HIZA 5L83A 2G3QB 2JZZA 1WY8A 3L0WB 4PT5A 5DPRA 1JRPA 4DQOC 3ZVVA 1TS4A 2DWQA 3WAMA 4FHKA 2FUG1 1UGMA 2N9XA 3MC9A 3Q8EA 1MI0A 3E56A 4DXGA 1YQBA 1KFYB 5HHDG 1C9FA 3AM9A 3NS8A 3LB8C 4WAFA 4NAWA 2VZKD 5EE1A 3WAPA 2ZCCA 1P7EA 3EFUA 1TS5A 4HLEA 5JHBA 2K0PA 2AYOB 4CYEA 4A3OA 1E5WA 4LNKA 3P4PB 1S1QB 5JZEB 5IO9A 1WGGA 2MBBB 5MPOA 3SU8X 1E8WA 2KMCA 1PGXA 4FHJA 2M1MA 1ZUD2 3H1UA 2BKRB 3Q8BA 3ZTCA 2W82A
chains in the Genus database with same CATH topology
3VR8B 3AEEB 1RYJA 3IXSA 3Q8AA 4XWTA 3SFEB 5FR3A 1ESFA 2N0SB 1ZOYB 5BYSA 3EA6A 1CZPA 4MACA 4NJCA 1E6EB 1HA5A 3GB1A 2JSVX 3BVGA 2GI9A 1J7CA 2NMQA 1XLQA 1MVKA 1NI3A 1V97A 2LHDA 1PFDA 3R2IA 4YTPB 2FE8A 2IGHA 4CQNA 1C76A 2PIAA 2G1EA 2J53A 3WCQA 1NEKB 3IT4B 4M0WA 4P6VF 4RCOA 4RNAA 1I4PA 3R8BA 1P7FA 3BK2A 3HUIA 3FILA 4JX1C 4IKGA 1DOYA 1TS3A 1JCKB 2QEJC 3AB5A 1F2RI 1D4BA 2N9KA 2CJNA 4IDIA 2AQ2B 1LO5D 4TSSA 1TKEA 2WLBA 2SEBD 1SJED 3AECB 4OZCA 3TEYA 2YEPF 1JWBD 1EU4A 2TSSA 2J4XA 3E9SA 3NVVA 3TEXA 1TJEA 2NTSA 3AE8B 4XDDA 4TQ0A 1YQ4B 4JPSA 3KLSX 1YN3A 1E0ZA 2E6XA 1XXGA 3ZYYX 2EKIA 2PVOD 1DYQA 2Z8LA 2WXHA 1PUTA 4MH8A 1DGJA 1XLOA 1QOFA 5LNK1 5AUIA 4C56C 4L2YA 4ZOHC 2INPE 2EELA 1K53A 2MJ3A 4RGNA 4RF0A 5C3JB 3P4SB 1PDXA 2WXFA 3AV8A 1M4VA 1L0VB 1T3QA 1QT9A 1SEBD 2PLPA 1VLBA 1XCTL 1YN4A 1SBBB 2OHFA 5BYRA 2LMCA 2RMMA 4A6QA 3PZ7A 2LHEA 5BMIA 1C78A 3AEGB 4N58A 4USAA 2JZPA 1SXTA 2MJDA 5C2TB 2N7JA 4ARIA 4MT5A 2G9HD 1FCCC 1E7PB 1VZ7A 1XLPA 3C8YA 1Q10A 4AS1A 3FC4A 1N60A 2IJ0A 2LEKA 4REZA 4OHJA 4RGOS 1I4XA 3P1MA 2ICIA 2V0GA 1K50A 1SJHD 1QKZA 2V3PA 3NS1A 5AUKA 3IT6B 1RFKA 1FFUA 5HFYA 1L4ZB 1ENFA 1F77A 1AN8A 4KGRA 1WXQA 1XF5L 1JWSD 2SAKA 4WQMA 1SE4A 1CK1A 2LFIA 2HTME 4NAMA 2XN9C 1FIQA 2L52A 1EM7A 2WXJA 2K5PA 2LGIA 2OEDA 2AQ1B 1STEA 5BYQA 2K22A 1ET9A 3ZJUA 2K9XA 2BTEA 3MHZA 1TY0A 2R61A 1N61A 3HVDA 3Q8CA 3EUB2 3NVZA 4UDUC 1GB4A 1EU3A 2ON8A 4HROA 1YN5A 3Q8FA 1VJKA 4EE2A 3PO0A 3VRAB 4US8A 4O1NA 3GP7A 1AYFA 4LLGM 3AEDB 1JMLA 2BYTA 1FCLA 2JX5A 1KH0A 2WXNA 5GXGB 3V05A 2BT6A 4ZHPA 5G5HA 1QQRA 4P16A 2WU2B 1NENB 3AN1A 3P4RB 1QOBA 2WP9B 4A8XC 4N59A 1XO3A 1YJJA 1ROEA 2PMVA 2QMTA 1SE3A 3HVZA 4RH6A 1XEEA 2ACZB 2WDVB 3NUHB 3W9CB 4RF1A 2N9LA 1JW9D 2BB5A 3U2SC 3VQIA 1D5XC 3CIRB 1N62A 2Y5PA 4RGTA 1RWSA 1TY2A 3SFDB 5I4DA 1GAQB 1XLNA 1FXIA 1OFFA 1VDVA 3LYYA 3LXFA 2E3TA 1YJIA 2CJOA 2BS2B 2H88B 1MHXA 3KWLA 1SSNA 3AH7A 3O13A 3J9CA 2PKOA 4RGMA 3B9JA 3ZGZA 1NYRA 1HQRD 2PW9A 1NYQA 4A9AA 2WDRB 4L1BA 1OQQA 1FMAD 1XCQL 2LJIA 3ZQ4A 2JYTA 1WWTA 4FXCA 2DYOA 2INNE 1V1OA 4B0MA 1E9MA 3IAS1 1UWXA 1YMHE 4C7YA 3KQ4A 2W3SA 4Q2JA 1IUEA 4AQ7A 3MJ5A 4HJGE 3NVWA 3IAM1 3DWMA 5TSSA 1KF6B 2D5GA 4YSXB 1SB3C 4KKJA 1UUPA 4KGTA 2ZW1A 1AWDA 4JE3B 1FO4A 1SF0A 1C4PA 1FEHA 1NVID 4IOIE 4ITKA 5H8YE 3W1SA 4L23A 2Y5CA 4B0EA 4LK0M 3AE4B 2V3NA 1YQ3B 3ABVB 1VZ8A 3AEFB 3NVYA 2Y3AA 4D2KA 1PYWD 3CWIA 4GDKB 2M0AA 4OZAA 2K3UA 1AW7A 2B76B 3TEZA 1UGJA 4ZYSA 2BS3B 1GOZA 1HEZE 1ZXIA 2IDYA 3P4QB 1FRDA 1N63A 5E6JA 1L4DB 1BXTA 3W5UB 1JROA 2RDGA 2J42A 2RDHA 1KRHA 2QJLA 1K51A 3AEBB 1IGDA 2CU3A 3URYA 3BVMA 1JWAD 4XE0A 5D3IB 3UI3A 1J7AA 1V1PB 1CJEA 4JWUC 4HKQA 4XDCA 3T3NA 3I9V1 4N6EB 4MM3B 2GRIA 3HRDD 2KDMA 2H89B 2JYEA 1FNUA 2WXRA 1DOXA 1I4QA 1K52A 3ZJVA 1IBXB 3ZJTA 1ZDXA 1C79A 3P63A 2NTTA 2BS4B 3AE5B 1UNSA 3U7ZA 5BMGA 1MHHE 1VZ6A 1WSPA 1L0YB 3AE7B 1JQ4A 1FNWA 3BVZA 1L6VA 1TKYA 3BZDB 2VZKB 2LUMA 3RFZB 2BB6A 2KN4A 1QOAA 1WRIA 1D5MC 1FM0D 1L6UA 3BWUD 4ARCA 2ZW0A 4HRSA 2WXMA 2WS3B 1QILA 2AX5A 3VR9B 1J7BA 4TQ1A 4ZHOA 5FKAC 1F2RC 1C4CA 4OVZA 4TMAB 1BUIC 1I7HA 2ONQA 1TYGB 3SR6A 2DYMA 3P42A 3VRBB 4HKZE 2JQRB 2V4IB 3AE6B 1HZ5A 1L0XB 1GB1A 4LTUA 1L5PA 1I4HA 1EWCA 1QLBB 2DBYA 4R3DA 1DOIA 4YWGG 2BBCA 1JALA 2L83A 1OQRA 4KX6B 2IPKD 2KWDA 5JXVA 3I57A 4ZRPA 4YXDB 3EGRA 2QIEB 2JU6X 3FAHA 4DXFA 4US9A 1EWYC 1RM6C 1T5XD 1VR9A 2M56B 3KWVA 5G5GA 1BMLC 1D6EC 2RPVA 1SE2A 2WQYB 3BYTB 4C7ZA 3AEAB 3NZ3A 5EE3A 2JXTA 1VRAB 1ZP0B 4C80A 2QILA 1TZOA 2QSDA 1Y56A 1KLGD 3U52E 1R7SA 2GB1A 4WH4A 2WXPA 1FRRA 3AE9B 1N5XA 1CQVA 3AE2B 4RFBA 4WURA 4A55A 2HDEA 2AQ3B 4KKIA 1I4GA 1PGBA 1V8CA 1FXAA 3TEWA 4YT0B 1YNTE 1HXYD 2WDQB 1C4AA 1A70A 2KQ4X 3AE1B 2KAJA 4XWWA 3B2GA 2MH7A 2BW2A 2XNAC 1HZ6A 1D5ZC 2WXKA 1E10A 3TSSA 3U4EG 2KACA 2PTLA 2L1AA 5D7GA 2MEKA 1KTKA 4YSZB 1WYGA 4YTNB 5EE0A 2L32A 1V1PA 3MFGA 3L4PA 1WGKA 3MC0B 3V3XA 1ZXHA 3T3OA 5FK9C 1MPEA 4JWSC 4OZBA 3BK1A 3ETRA 2DLBA 5HG2A 1UWMA 1FFVA 1B9RA 1F0ZA 1QF6A 5EE9A 4J3OD 4WWMA 3GS2A 2KMMA 1IBXA 1ZDVA 2WNMA 3FILB 2J52A 2WXOA 2I2YA 2WXLA 1TS2A 2WXQA 4HEA1 2M19A 1C77A 1ZE3D 2I38A 2YEPB 4PT5A 4DQOC 1JRPA 3BYYB 3TUOA 2X38A 1I4RA 1TS4A 2DWQA 1ZPSA 2FUG1 3BIID 3B2FA 5T8IA 2MJEA 3Q8EA 3RPFC 1MI0A 1B1ZA 3E56A 2W3RA 5HHDG 1KFYB 4DXGA 1C9FA 3W2DA 1T6BX 3AM9A 1TKGA 3N9YC 3W5VB 3LB8C 4KGSA 4WAFA 2JWUA 5D3DA 2WU5B 1JWUD 2W54A 3SEBA 2VZKD 5EE1A 4YSYB 5H92C 4GDLB 4YTMB 2W55A 1P7EA 1FNVA 1TS5A 5HI1A 1GPXA 4WIPA 2WXGA 2K0PA 3OWEB 1KLUD 1PGAA 3AMZA 4GLSC 4A90A 2FBWB 1JWMD 1SIJA 3PZ8A 3P4PB 2PVGC 3H8HA 1ACCA 3MP9A 3R2TA 4NZLB 4ZRQA 3NRZA 4H2AA 4NAWB 3AE3B 3Q69A 5BMHA 5MPOA 1ET6A 2Q5WD 2IGGA 1N5WA 2WXIA 1FD6A 2IGDA 3DWGC 1PGXA 1IGCA 1ZUD2 3Q8BA 1QOGA 4OW0A 2W82A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3VR8 B;  3AEE B;  1RYJ A;  1YQ3 B;  3ABV B;  3AEF B;  1V8C A;  3NVY A;  1FXA A;  3SFE B;  1WXQ A;  4YT0 B;  2N0S B;  3CWI A;  1ZOY B;  2WDQ B;  4WQM A;  2HTM E;  1A70 A;  1CZP A;  1FIQ A;  2B76 B;  2L52 A;  3AE1 B;  1E6E B;  2KAJ A;  2K5P A;  2BS3 B;  3B2G A;  1ZXI A;  3P4Q B;  2MH7 A;  1FRD A;  1N63 A;  2K22 A;  1J7C A;  3W5U B;  1E10 A;  2K9X A;  1JRO A;  1KRH A;  1XLQ A;  1WYG A;  1NI3 A;  2QJL A;  4YTN B;  4YSZ B;  5EE0 A;  1V97 A;  1N61 A;  3AEB B;  3L4P A;  2CU3 A;  1PFD A;  1WGK A;  3EUB 2;  4YTP B;  3NVZ A;  1JWA D;  1J7A A;  4JWS C;  1CJE A;  2PIA A;  2G1E A;  3ETR A;  4JWU C;  4HRO A;  1UWM A;  1FFV A;  1B9R A;  3WCQ A;  1F0Z A;  1NEK B;  1VJK A;  4P6V F;  1QF6 A;  5EE9 A;  4N6E B;  3PO0 A;  3VRA B;  4US8 A;  3HUI A;  3HRD D;  1AYF A;  4WWM A;  3AED B;  2H89 B;  4JX1 C;  1DOY A;  2JX5 A;  2KMM A;  5GXG B;  3AB5 A;  2BT6 A;  4ZHP A;  1DOX A;  5G5H A;  2CJN A;  2WU2 B;  4IDI A;  1NEN B;  3AN1 A;  3P4R B;  1QOB A;  2WP9 B;  4N59 A;  1XO3 A;  3P63 A;  2M19 A;  1YJJ A;  1TKE A;  2BS4 B;  3AE5 B;  2WLB A;  1ROE A;  3AEC B;  1JRP A;  3HVZ A;  3W9C B;  2ACZ B;  2WDV B;  1JWB D;  3NVV A;  1JW9 D;  2DWQ A;  3AE7 B;  1TJE A;  1JQ4 A;  3AE8 B;  3BII D;  3CIR B;  1L6V A;  1TKY A;  1N62 A;  1YQ4 B;  3B2F A;  1E0Z A;  1RWS A;  2MJE A;  1QOA A;  1WRI A;  1FM0 D;  3SFD B;  1L6U A;  1GAQ B;  3RPF C;  1XLN A;  4HRS A;  1FXI A;  1OFF A;  1VDV A;  2EKI A;  2PVO D;  2W3R A;  1KFY B;  2WS3 B;  1PUT A;  1YJI A;  1DGJ A;  2CJO A;  1XLO A;  2E3T A;  3LXF A;  3AM9 A;  2AX5 A;  1QOF A;  2BS2 B;  5AUI A;  2H88 B;  3VR9 B;  1J7B A;  1TKG A;  3W5V B;  3LB8 C;  2WU5 B;  4ZHO A;  4ZOH C;  2W54 A;  3KWL A;  1I7H A;  2MJ3 A;  3AH7 A;  1TYG B;  3SR6 A;  5EE1 A;  5C3J B;  3P4S B;  1PDX A;  4YSY B;  5H92 C;  2PKO A;  3VRB B;  3B9J A;  4YTM B;  3AV8 A;  1NYR A;  2JQR B;  3AE6 B;  1NYQ A;  2W55 A;  4LTU A;  1L5P A;  2WDR B;  1L0V B;  4A9A A;  1T3Q A;  1QLB B;  1QT9 A;  1OQQ A;  1FMA D;  1VLB A;  2DBY A;  1GPX A;  1WWT A;  2OHF A;  1DOI A;  4FXC A;  1JAL A;  2L83 A;  3AMZ A;  1E9M A;  1OQR A;  4KX6 B;  3AEG B;  4USA A;  2FBW B;  4N58 A;  4C7Y A;  2W3S A;  2MJD A;  4YXD B;  5C2T B;  2QIE B;  1IUE A;  3FAH A;  1SIJ A;  1XLP A;  1E7P B;  1EWY C;  1RM6 C;  3NVW A;  4US9 A;  2M56 B;  3P4P B;  3ZYY X;  5G5G A;  2PVG C;  3DWM A;  2WQY B;  1KF6 B;  3FC4 A;  4YSX B;  1SB3 C;  1N60 A;  2LEK A;  4C7Z A;  3AEA B;  3NRZ A;  5EE3 A;  3AE3 B;  5MPO A;  4C80 A;  1AWD A;  1ZP0 B;  2Q5W D;  3P1M A;  1N5W A;  1FO4 A;  1R7S A;  1SF0 A;  3NS1 A;  5AUK A;  1FRR A;  3AE9 B;  1NVI D;  3DWG C;  4ITK A;  1RFK A;  1N5X A;  3AE2 B;  5H8Y E;  1FFU A;  2Y5C A;  1ZUD 2;  1QOG A;  3AE4 B; 
#chains in the Genus database with same CATH topology
 3VR8 B;  3AEE B;  5IAA C;  3JYU A;  3RNC C;  2GI9 A;  1WIA A;  1HE8 A;  1XLQ A;  2M4N A;  1NI3 A;  1WGD A;  4YTP B;  2FE8 A;  2D3C A;  2BYE A;  2PIA A;  2AEH A;  4M0W A;  4P6V F;  1WXA A;  1I4P A;  3GE3 C;  1P7F A;  2LGS A;  2KNB A;  2RR9 A;  4JX1 C;  1JCK B;  3PLU A;  1F2R I;  4ZDV A;  3RMK C;  2N9E B;  4FJY A;  4AUQ C;  3HM3 A;  4WWO A;  3ZW3 A;  2GLS A;  3L16 A;  2WLB A;  4G3X B;  2BF8 B;  3E9S A;  5AZG A;  2KWU B;  3KLS X;  4N9F 4;  4MH0 E;  2ZNV C;  4LNF A;  3A9J B;  2L0F A;  2PVO D;  5J17 A;  3FKY A;  4P7I A;  1TT5 B;  5AUI A;  4CHK A;  2BGF A;  1K53 A;  2BWF A;  2ZVO A;  2LVQ A;  3N20 C;  1XD3 B;  2KLC A;  2EKE C;  2N9P C;  1T3Q A;  3V6C B;  2OHF A;  3K9O B;  2IO3 B;  1WGY A;  3AEG B;  4EOY A;  4HK2 A;  2NBV B;  3H7P A;  3AU4 A;  2LD9 A;  2PE6 B;  3W1Y A;  4OHJ A;  2V0G A;  5J18 A;  2MBO A;  3NS1 A;  3IT6 B;  1FFU A;  4IM0 A;  3KYC D;  4BOS C;  2LWP A;  1TBE A;  4KGR A;  3Q3O C;  1WXQ A;  3VTV A;  4WQM A;  4C4V A;  2LFI A;  2XN9 C;  1RAX A;  2L52 A;  2O6V B;  2WXJ A;  2OED A;  4K3B A;  1STE A;  1UZX B;  3ZJU A;  2K9X A;  3MHZ A;  1TY0 A;  2CR5 A;  2R61 A;  3PSE B;  3NVZ A;  2NS5 A;  4UDU C;  3WA0 A;  2ON8 A;  1WGH A;  3GZN B;  4EE2 A;  1VJK A;  2B3A A;  4M8M A;  2YLM A;  3AED B;  4XYC A;  3PHW B;  1FCL A;  1A5R A;  4HVB A;  5GXG B;  4FJZ A;  5G5H A;  4P16 A;  1QOB A;  5E6P A;  2KTR B;  2WP9 B;  4A8X C;  4P1B C;  4BVU C;  2KX3 A;  3R7Q A;  1XEE A;  3NUH B;  2BYV E;  2WDV B;  4RF1 A;  3BY4 B;  2NPT A;  4HDQ A;  4K7U A;  2KJH B;  2KWC A;  5I4D A;  1Q5W B;  2RD0 A;  1FXI A;  1OFF A;  3LYY A;  3LXF A;  3RD2 A;  2E3T A;  4IC7 B;  4XC2 A;  1SSN A;  3AH7 A;  3DBH I;  1NYR A;  1HQR D;  4BAX A;  1WH3 A;  4L1B A;  1WWT A;  3IAS 1;  1UWX A;  2R2Q A;  1YMH E;  3KQ4 A;  4Q2J A;  4W9G A;  2CHZ A;  4HJG E;  3L54 A;  3B08 A;  2D5G A;  2KQS A;  2X8X X;  4NPN A;  4KKJ A;  2K8C A;  4K7S A;  2O2V B;  4GMV A;  3VUY A;  1SF0 A;  1FO4 A;  4RMA A;  1FEH A;  1NVI D;  3W1S A;  5H8Y E;  4E3C A;  2Y5C A;  1I35 A;  3AE4 B;  4PS7 A;  2MHJ A;  1YQ3 B;  3ABV B;  3UQB A;  3HM6 X;  2B76 B;  4AOF A;  2KK8 A;  1GOZ A;  1HEZ E;  5E6J A;  2RDH A;  2QJL A;  1K51 A;  5DPT A;  3AEB B;  2ZNV B;  3KW5 B;  2LZ6 A;  3RI7 C;  3RNG C;  5D3I B;  2KOX A;  4EZJ A;  4W9C A;  3T3N A;  3PZD A;  2KDM A;  4ANU A;  2LJ5 A;  4ANW A;  4PS8 A;  3ZJV A;  4NNJ B;  1IBX B;  1ZW7 A;  2L00 B;  2NTT A;  2BS4 B;  3AE5 B;  3RNF C;  3CST A;  2MLB A;  4MGI E;  1MHH E;  1VZ6 A;  3S2A A;  3AE7 B;  1JQ4 A;  2BB6 A;  3A4S C;  2MBE A;  1V6E A;  4WWN A;  2I1K A;  4ARC A;  3RT3 B;  2ZW0 A;  2WS3 B;  2LXA A;  2JY6 A;  2AX5 A;  3VR9 B;  4ZHO A;  1GG3 A;  4KIK A;  1BUI C;  4KSK C;  2ONQ A;  3DOW A;  2ASQ A;  4HKZ E;  3EFC A;  3A4R A;  1WMH B;  4DBG A;  1HZ5 A;  1L0X B;  1MG4 A;  1Z5S B;  2BBC A;  2Z0D B;  1YOV B;  1GC6 A;  2IPK D;  3ML9 A;  2KWD A;  4FBJ B;  4LNI A;  4FUL A;  3ZTD A;  3FAH A;  4US9 A;  3KWV A;  1PQS A;  1HTO A;  3PRM B;  1V5T A;  3BYT B;  3NZ3 A;  3PVL A;  5CTR C;  5IN7 A;  2QIL A;  1KLG D;  4G11 A;  2GB1 A;  4WH4 A;  2WXP A;  1CQV A;  3AE2 B;  3UGB B;  4KKI A;  1V8C A;  2A5U A;  1C1Y B;  1HXY D;  1C4A A;  1WJN A;  2N1V A;  2KQ4 X;  3PLV A;  4TUU A;  4II3 B;  1EUV B;  2MP2 A;  2MH7 A;  2XNA C;  1WXM A;  3TSS A;  2PTL A;  2MEK A;  1KTK A;  4YSZ B;  5EE0 A;  2KVR A;  1GC7 A;  1MPE A;  4JWS C;  5LLI A;  5HKH A;  1UWM A;  1F0Z A;  2LVP A;  1QF6 A;  2D11 A;  2BPS A;  3IG3 A;  2MBH A;  2MWS B;  5LXI B;  2WNM A;  4P1C C;  2WXO A;  3W1S C;  3L10 B;  3KYD D;  4DK5 A;  1U4A A;  1YX5 B;  4HEA 1;  2AL6 A;  1OEY J;  2WGS A;  3K9P B;  3N1X C;  1H8C A;  1ZPS A;  3BII D;  3B2F A;  1WJ4 A;  3Q3M C;  2MJE A;  3DCG A;  4WJP A;  5DCN A;  4JIO U;  1TKG A;  2JWU A;  1UBI A;  5D3D A;  2W54 A;  4EFO A;  4K3C A;  4YSY B;  3UF8 A;  5H92 C;  2K25 A;  3ZNH B;  4YTM B;  1FNV A;  1Y8R C;  2RPQ A;  3M95 A;  3VUW A;  1GPX A;  3JW0 X;  4PK1 A;  3OWE B;  4A90 A;  1PGA A;  4GLS C;  2NBW B;  2M17 A;  2QHO A;  4DHJ D;  1SIJ A;  2L76 A;  3DPD A;  3VTU A;  3H7P B;  3H8H A;  2DAJ A;  2OJW A;  3ONS A;  4W9E A;  2YVC A;  1WM3 A;  1ET6 A;  4BBN F;  3ZLZ A;  1N5W A;  2GOW A;  4AP4 C;  4DWF A;  5EDS A;  3IXS A;  4F8C B;  4XWT A;  2N0S B;  1ZOY B;  4JQW C;  1RRB A;  4MAC A;  1E6E B;  4C4V B;  1RFA A;  3GB1 A;  2KLG A;  2NMQ A;  3WIM A;  3IFW B;  1V97 A;  2WWZ A;  1PFD A;  5IOI A;  3R2I A;  3PHX B;  2IGH A;  4CQN A;  1C76 A;  1OEY A;  3IT4 B;  2N1W A;  3BK2 A;  4YL8 A;  1DOY A;  2CKH B;  2QEJ C;  5C1Z A;  1WE7 A;  2KTF A;  2L8J A;  2AQ2 B;  1LO5 D;  3B1L X;  1SJE D;  3AEC B;  3TEY A;  3D32 A;  1EU4 A;  2J4X A;  1J19 A;  1IPG A;  3AE8 B;  4TQ0 A;  1YQ4 B;  4JPS A;  2NPT B;  2PJH A;  4FJV B;  1TIF A;  3ZYY X;  2Z8L A;  1DYQ A;  1N6Z A;  1XLO A;  1QOF A;  5LNK 1;  1I42 A;  3Q6B A;  4GDL A;  4RF0 A;  2EMT A;  5C3J B;  3P4S B;  1PDX A;  2KDF B;  4HCN B;  3EEC A;  3AV8 A;  2D3A A;  1M4V A;  1L0V B;  1QT9 A;  3DHG C;  5IKC M;  1XCT L;  2KFK A;  1SBB B;  4HPM B;  1TTN A;  2RMM A;  3L08 A;  4WJO A;  2LHE A;  5BMI A;  2WDT B;  2MJD A;  2N7J A;  2KC2 A;  1WJU A;  4ARI A;  3V62 A;  1KM7 A;  1E7P B;  4QAY A;  1Q10 A;  1WX8 A;  2KO3 A;  4OVU A;  3FC4 A;  5D2M B;  3QCA A;  4TKN A;  2KVZ A;  2LGD A;  3P1M A;  2ICI A;  4II2 B;  1K50 A;  1SJH D;  2V3P A;  4KSL C;  5AUK A;  1FXT B;  1GJZ A;  1RFK A;  2FCM A;  2C7H A;  2BQQ A;  1G6J A;  1F77 A;  1AN8 A;  1D3Z A;  4MDK E;  1SE4 A;  4NAM A;  2AL3 A;  2BWE S;  2AQ1 B;  1ET9 A;  1WX7 A;  3DBR I;  2EMS A;  4HPP A;  1E8Z A;  1V80 A;  2K8B A;  3EUB 2;  2G4D B;  1KJT A;  4DHZ B;  4IG7 B;  3Q8F A;  4LLG M;  4ASW C;  3VAW A;  4FA6 A;  3QK0 A;  2J0M A;  1UBQ A;  4JL9 A;  4IM3 A;  3P4R B;  1BT0 A;  2DAF A;  3SDL C;  1GUA B;  2PMV A;  2QMT A;  3QAR A;  2ACZ B;  4PYZ A;  4BZA A;  1WYW B;  3CIR B;  3MTN B;  2IZV B;  3RYT A;  2Y5P A;  2M0X A;  1VDV A;  1YJI A;  3L13 A;  3PS6 A;  3PRZ A;  2RDB C;  2ZJD A;  3KWL A;  1P3Q U;  4B95 A;  4EZL A;  2L7R A;  3AXC A;  4S0R A;  1X1M A;  1FMA D;  2JYT A;  3SHQ A;  1WJ6 A;  4C7Y A;  3T9L A;  2W3S A;  1M94 A;  4AQ7 A;  2MSE D;  3MJ5 A;  1KF6 B;  4YSX B;  1WRD B;  1SB3 C;  3VFK A;  4PS3 A;  3I5J C;  1AWD A;  3A1Q A;  3CSF A;  4ITK A;  4B0E A;  3QIJ A;  2FCN A;  3O65 B;  3NVY A;  3CWI A;  4GDK B;  2M0A A;  4OZA A;  3TEZ A;  4ZYS A;  3DHH C;  1FRD A;  3APF A;  1R4M I;  2LGX A;  4JGH B;  2MP2 B;  2RDG A;  3X23 A;  2GBJ A;  1IGD A;  3BVM A;  1SIF A;  3VHT C;  3C19 A;  1NI2 A;  1EF1 A;  4A3P A;  3HRD D;  2HJ1 A;  1CMX B;  3DDC B;  1E8X A;  2VH1 A;  2JPH A;  5LXH A;  2JWZ A;  1ZDX A;  1C79 A;  3P63 A;  1WGR A;  2REX A;  1UNS A;  2FCS A;  3U7Z A;  1L0Y B;  1FNW A;  2VZK B;  2LUM A;  3RFZ B;  2KN4 A;  1QOA A;  3BWU D;  1D5M C;  1FM0 D;  3JSV A;  4HRS A;  3Q2A C;  3ZNG C;  2CS4 A;  2A4Z A;  2FUH B;  4KDL B;  1IP9 A;  1UEL A;  2WHI A;  2DYB A;  1C4C A;  4MJS A;  5D94 A;  1V2Y A;  2DYM A;  2AWT A;  3VH3 B;  3VRB B;  2ZCB A;  4M8N A;  3ZDT A;  4MGK E;  2IND C;  2KZR A;  3RN9 C;  4URK A;  4LTU A;  1L5P A;  3H9D A;  1EWC A;  2DBY A;  2L83 A;  1OQR A;  5JXV A;  3DBL I;  1LQB A;  3DVG Y;  2QIE B;  1EWY C;  3RNE C;  1VR9 A;  2PEA A;  2RPV A;  4BFR A;  4C7Z A;  5EE3 A;  1ZKH A;  2JXT A;  1VRA B;  1ZP0 B;  4C80 A;  2GMI C;  1TZO A;  1R7S A;  5CX3 A;  1FRR A;  3AE9 B;  4RFB A;  1Q0W B;  4F7Z A;  4A55 A;  2AQ3 B;  4NQK E;  3UIO B;  1PGB A;  3X0W A;  1A70 A;  1YX6 B;  4EEW A;  5C23 A;  1J0G A;  2BW2 A;  1D5Z C;  3I63 C;  5DPS A;  1E10 A;  1LM8 B;  4WJQ A;  2IY1 B;  3DVG X;  4LJO B;  5D7G A;  2L1A A;  4GGQ A;  1HTQ A;  2RGF A;  3ZNZ B;  1WYG A;  2KX0 A;  4YTN B;  3MFG A;  2DNF A;  4ZRK A;  2DLB A;  4MM3 A;  1ZGU B;  1B9R A;  4WWP A;  1UH6 A;  2KMA A;  4WWM A;  3P2B A;  2Y5B B;  1ZDV A;  4LCD E;  2J52 A;  1S3S G;  2OOB B;  1V86 A;  1R4N B;  2VRR B;  1C77 A;  1ISN A;  2I38 A;  1TGZ B;  1I4R A;  2JXX A;  3PTF C;  3TCA A;  2BYF A;  5T8I A;  3A9K A;  3RPF C;  1WXS A;  2WYQ A;  3W2D A;  3NY5 A;  4KGS A;  3PRE A;  2WU5 B;  3SEB A;  3ZUN A;  4ANX A;  4GDL B;  3GE8 C;  3UIP B;  3RNA C;  3VUX A;  1F52 A;  4LNO A;  1P0R A;  4WJN A;  3AMZ A;  3L17 A;  4NJ7 A;  2FBW B;  3A33 B;  2KXJ A;  1JWM D;  1ACC A;  1P9D U;  1OTR B;  3MP9 A;  4NAW B;  1SE9 A;  3AE3 B;  4MGY E;  5BMH A;  2Q5W D;  5GMV A;  3ZDM C;  2WXI A;  3RUI B;  1GNU A;  2NBU A;  2K1F A;  1QOG A;  4GOC A;  4OW0 A;  5KHQ A;  3ENE A;  1RYJ A;  2D3B A;  4K81 A;  3SFE B;  4BKS D;  1MJD A;  3EA6 A;  2WX0 A;  1CZP A;  1HA5 A;  4IUM B;  3BVG A;  4DDI D;  1J7C A;  2HTH A;  2KDI A;  1MVK A;  2JF5 A;  1OQY A;  1C3T A;  4F1S A;  2G1E A;  4GB9 A;  2DZJ A;  3WCQ A;  1NEK B;  2W9N A;  4RCO A;  3HUI A;  3FIL A;  2N7E A;  1TS3 A;  3DBH B;  4W9J A;  3U8Z A;  1D4B A;  2N9K A;  3M3J A;  2CJN A;  3QJZ A;  4HCP B;  5KHO A;  4OZC A;  2JRH A;  3ZXR A;  1E7V A;  1P1A A;  3TEX A;  1TJE A;  5J2R A;  2NTS A;  4XDD A;  3IHP C;  3VVW B;  4W9K A;  2DHZ A;  1E0Z A;  2DZK A;  1WI0 A;  2E6X A;  4LNN A;  4M0W B;  1PUT A;  3AUL A;  1QZE A;  4C56 C;  4L2Y A;  4HJK A;  3TL5 A;  4ZOH C;  4WAA A;  3MHS D;  2MJ3 A;  3OJ4 B;  1SGH A;  2LI5 A;  2WXF A;  1SEB D;  5BYR A;  4A6Q A;  3KUC B;  1C78 A;  4USA A;  2JZP A;  1SXT A;  4HDO A;  4MT5 A;  4MEM A;  1FCC C;  1XLP A;  1YD8 U;  3Q14 C;  1F9J A;  3C8Y A;  3AI5 A;  3OG5 A;  4X57 B;  3QA8 A;  1WZ3 A;  2IBI B;  1N60 A;  2LEK A;  4REZ A;  3C0R B;  4FN2 A;  4I6L B;  4A20 A;  3N32 A;  1QKZ A;  2Z59 B;  3OLM D;  2ZPN A;  3A1Q B;  4IWP A;  1KLV A;  5HFY A;  5E6N A;  3NZS A;  3U7D A;  1XF5 L;  1Z2M A;  3ZRF A;  1IYF A;  1T0R C;  4JLC A;  2HTM E;  2KTR A;  3ALB A;  2K22 A;  3PPA A;  2MW5 A;  1N61 A;  3HVD A;  3N30 A;  4KDI C;  1EU3 A;  2KYW A;  3ZNI D;  3UQA A;  1YN5 A;  3PO0 A;  3VRA B;  4US8 A;  4O1N A;  1UD7 A;  1AYF A;  1H4R A;  1JML A;  2BYT A;  2JX5 A;  1KH0 A;  2WXN A;  3MJW A;  3V05 A;  1QQR A;  4KV2 A;  3AN1 A;  4ICV A;  2PE9 A;  4N59 A;  1YJJ A;  1ROE A;  1SE3 A;  3W9C B;  4RH6 A;  1AAR A;  2N9L A;  3RZW C;  1JW9 D;  5G55 A;  1N62 A;  4K7W A;  4RGT A;  1RWS A;  3SFD B;  1GAQ B;  1XLN A;  2UU7 A;  4MEL A;  3VDZ A;  2BS2 B;  1LXD A;  2C5L C;  3KVF B;  2KFJ A;  2M8S A;  2O2V A;  3O13 A;  3QWZ B;  2MRP A;  2PKO A;  4MJS B;  4RGM A;  3B9J A;  4ZRJ A;  3ZGZ A;  1NYQ A;  2KJR A;  2CU1 A;  1OQQ A;  2ZZP B;  1XCQ L;  3ZQ4 A;  4FXC A;  2DYO A;  2D2Q A;  3WAN A;  1V1O A;  3V60 A;  4B0M A;  4NQL B;  3N1Y C;  4AJY B;  3IAM 1;  3DVN U;  3DWM A;  4WQO B;  5TSS A;  2C60 A;  1UUP A;  1Q1O A;  3WAL A;  5IP4 D;  1P98 A;  4IOI E;  3MC8 A;  4LK0 M;  2L0T A;  4ZYN A;  2UYZ B;  2V3N A;  3AEF B;  3NZU A;  2QDF A;  4LDT B;  1PYW D;  4W9L A;  2K3U A;  1AW7 A;  1WX9 A;  2BS3 B;  2OJR A;  2IDY A;  3P4Q B;  3VXW A;  1L4D B;  1BXT A;  2GBN A;  3W5U B;  2Z0E B;  4BOZ B;  1L2N A;  4E71 A;  1KRH A;  1KOT A;  3Q3J A;  2CU3 A;  1J7A A;  3CF6 E;  2O6V D;  2XK5 A;  3RCZ A;  4FLH A;  2KDE B;  3I9V 1;  4N6E B;  4MM3 B;  2GRI A;  2H89 B;  3QQ8 B;  1WXV A;  2DX5 B;  3M63 B;  3ZJT A;  1WMH A;  4W9D A;  1E7U A;  2MQJ A;  2INC C;  1WSP A;  2IYD B;  2CHW A;  3KH0 A;  3IVF A;  5E6O A;  2GBK A;  3GOE A;  3A9K B;  1QIL A;  2C7M B;  1J8C A;  3GZN I;  1J7B A;  4TQ1 A;  5FKA C;  1F2R C;  4OVZ A;  4TMA B;  1UF0 A;  2KDB A;  3SR6 A;  5DPW A;  4ACF A;  4IWQ A;  2JQR B;  2UWQ A;  2V4I B;  2ZEQ A;  4DHJ B;  1GB1 A;  2NCN A;  1VCB A;  2LUE A;  1WM2 A;  1F1H A;  1DOI A;  4YWG G;  4KX6 B;  3I57 A;  4PYU A;  4ZRP A;  1EO6 A;  3IBE A;  3RZF A;  2M56 B;  5G5G A;  2G45 B;  3ZIM A;  1D6E C;  2JT4 B;  2WQY B;  4KIK B;  2ZVN A;  3CMM B;  2FIF A;  3U52 E;  2N7D A;  4MSM B;  2GBR A;  1T0Y A;  2LAS A;  1YNT E;  4DDG D;  3AE1 B;  3OJ3 A;  4AWJ A;  2KAJ A;  5CHV C;  4XWW A;  3B2G A;  1MG8 A;  2C9W B;  3U4E G;  2HE7 A;  2I1J A;  4W9H A;  2L32 A;  1V1P A;  4G0N B;  3V3X A;  4G50 A;  2K8H A;  3T3O A;  2V1Y A;  3BK1 A;  5HG2 A;  1FFV A;  4AJW A;  2IO1 B;  1OGW A;  3N1Z C;  1T0Q C;  5EE9 A;  5TR5 A;  1L7Y A;  3NHE B;  3GS2 A;  2KMM A;  2C7N B;  3FIL B;  3KUD B;  2I2Y A;  2WXL A;  1TS2 A;  3HK0 A;  2WXQ A;  2M19 A;  4E74 A;  1ZE3 D;  2YEP B;  4EKU A;  3BYY B;  3TUO A;  2KAN A;  3QHT A;  2X38 A;  2FNJ B;  1R4N I;  3LDZ E;  2LRW A;  4EUT A;  4XGA B;  1B1Z A;  2W3R A;  1T6B X;  4I6P A;  3TMP B;  3N9Y C;  3W5V B;  2WX1 A;  5AEK B;  1JWU D;  2VH2 A;  3RNB C;  1NBF C;  3R66 C;  2W55 A;  3PRP B;  3VTW A;  2IO2 B;  5HI1 A;  4WIP A;  2WXG A;  1KLU D;  4J6I A;  3DBR B;  4EZK A;  4HPL B;  3PZ8 A;  4ICU A;  2PVG C;  2D07 B;  4BKS A;  3V61 A;  3R2T A;  4ZRQ A;  4NZL B;  3NRZ A;  4BKT A;  4H2A A;  3DVN V;  3WAO A;  3Q69 A;  1LFD A;  3PV1 A;  2IGG A;  2XEW A;  1FD6 A;  2IGD A;  3DWG C;  1IGC A;  4BBN C;  4MSQ B;  2HD5 B;  3Q8A A;  4GIV A;  5FR3 A;  1ESF A;  5BYS A;  2N4F A;  1TZ1 A;  4NJC A;  2K6Q A;  3DQV A;  3H6N A;  2JSV X;  1VD2 A;  2MX2 A;  3I3T B;  2DEN B;  4M00 A;  2FAZ A;  2LHD A;  3EC8 A;  2IO0 B;  3TBL D;  4GXB A;  2JUO A;  2J53 A;  4RNA A;  4GSW A;  2FID A;  3PGE A;  3R8B A;  1T0S C;  1WR1 A;  4IKG A;  2V9H A;  3AB5 A;  4HXD A;  4IDI A;  4TSS A;  1TKE A;  2MCN B;  2SEB D;  3ECI A;  2YEP F;  1JWB D;  2J0J A;  2TSS A;  2LGY A;  3NVV A;  3HHM A;  2GBM A;  1YJ1 A;  2V4L A;  1YN3 A;  3TIX A;  1XT9 B;  3VH4 B;  1XXG A;  2EKI A;  2WXH A;  4MH8 A;  1DGJ A;  2INP E;  2EEL A;  4XX5 A;  4RGN A;  2RSU A;  2PLP A;  1VLB A;  1YN4 A;  4IW0 A;  2LMC A;  3PZ7 A;  3KUZ A;  1R4M B;  4N58 A;  3APD A;  5C2T B;  2IY0 B;  2G9H D;  1VZ7 A;  1WZ0 A;  1LGR A;  2JVC A;  4AS1 A;  2IJ0 A;  4RGO S;  1I4X A;  3OAW A;  2HJ8 A;  3QX1 A;  4KVG B;  1L4Z B;  2JRI B;  1ENF A;  1WR6 E;  2SAK A;  1JWS D;  2KFK B;  4I6N B;  1CK1 A;  5AZF A;  4W9I A;  5JHA A;  3N3K B;  3NG0 A;  1FIQ A;  1EM7 A;  2K39 A;  2K5P A;  2LGI A;  5BYQ A;  3ZKJ C;  2BTE A;  2FCQ A;  3R3M A;  4IWO A;  3Q8C A;  2R2O A;  1E8Y A;  1GB4 A;  4HRO A;  3Q3N C;  3DHI C;  4IM2 A;  3EHV A;  3V6E B;  2XK5 B;  3PT2 B;  4OVV A;  4M02 A;  3GP7 A;  1MFW A;  2G4S A;  4DXA B;  1V5O A;  4RM8 A;  1V49 A;  4TV3 A;  4RM9 A;  2BT6 A;  4ZHP A;  5L95 C;  2WU2 B;  1NEN B;  2KHW B;  4ANV A;  1FPY A;  1XO3 A;  1V81 A;  5BO4 B;  3HVZ A;  4BKG A;  3H7S A;  3DBL B;  2BB5 A;  3U2S C;  3VQI A;  1D5X C;  3A9J A;  4NJ6 A;  1TY2 A;  4FAD A;  3NJT A;  2CJO A;  2MA9 B;  3ML8 A;  2H88 B;  2KWV B;  1MHX A;  2KJ6 A;  3AU5 A;  2KC1 A;  3B0A A;  3M62 B;  4NY0 A;  3J9C A;  2DZI A;  3TJP A;  2PW9 A;  1E90 A;  2KT7 A;  5AZH A;  2D3G A;  3QAQ A;  4A9A A;  2WDR B;  2ZPY A;  2LJI A;  4GN1 A;  5D6J B;  5CHW A;  2INN E;  4GDK A;  3RUL A;  1E9M A;  3ZXV A;  1IUE A;  2CHX A;  2KN5 A;  1EF5 A;  3NVW A;  2PPH A;  4LDT D;  4KGT A;  2ZW1 A;  4JE3 B;  1C4P A;  4L23 A;  4GU2 A;  3BIN A;  2LVO A;  1VZ8 A;  2Y3A A;  4D2K A;  2O6V A;  1UGJ A;  1ZXI A;  1N63 A;  1JRO A;  2J42 A;  1WE6 A;  4CO7 A;  3NOB A;  3URY A;  3T8M A;  1JWA D;  4XE0 A;  3UI3 A;  1V1P B;  1CJE A;  4JWU C;  1JRU A;  5JH5 C;  4HKQ A;  4XDC A;  1WFY A;  3Q3F A;  3ZRC A;  2JYE A;  1FNU A;  2WXR A;  1DOX A;  1I4Q A;  1K52 A;  4HWI B;  2LRU A;  2NVU I;  5BMG A;  3BVZ A;  1L6V A;  1TKY A;  3BZD B;  3APC A;  5G2N A;  2J7Q B;  1WRI A;  3QC8 B;  3U30 A;  1L6U A;  2WXM A;  2BVC A;  5IA7 A;  4XZ4 A;  2BKF A;  3LJ3 A;  1I7H A;  1TYG B;  3DBS A;  3P42 A;  4KZ0 A;  1YIW A;  3AE6 B;  1I4H A;  1QLB B;  3UIN B;  2LXC A;  4KZC A;  4R3D A;  2D10 A;  5FR6 A;  1JAL A;  2NR2 A;  4LJP B;  2KQ7 A;  5CHF A;  4YXD B;  3EGR A;  2JU6 X;  1RLF A;  3ZO5 B;  3JSV B;  4DXF A;  1RM6 C;  1T5X D;  2QC8 A;  4MGZ E;  3R7R A;  4B9K A;  2XBB C;  1BML C;  1SE2 A;  2L3Z A;  2L05 A;  3AEA B;  3JVZ X;  1XQQ A;  1NDD A;  2QSD A;  1Y56 A;  2K6D B;  2QCZ A;  1N5X A;  4WUR A;  2HDE A;  4ZRI A;  2KD0 A;  4C00 A;  2JZ3 B;  1I4G A;  1FXA A;  3TEW A;  4YT0 B;  2WDQ B;  4DHZ E;  1WF9 A;  1HZ6 A;  2WXK A;  4W9F A;  4M01 A;  2KAC A;  4B6W A;  3L4P A;  1WGK A;  3MC0 B;  1ZXH A;  5FK9 C;  1K8R B;  4OZB A;  4K1R B;  2KKC A;  3ETR A;  2J0K A;  2V3S A;  1V9J A;  4J3O D;  3SD5 A;  2MBQ A;  1IBX A;  2DZM A;  4S17 A;  3HIZ A;  5L83 A;  2G3Q B;  2JZZ A;  1WY8 A;  3L0W B;  4PT5 A;  5DPR A;  1JRP A;  4DQO C;  3ZVV A;  1TS4 A;  2DWQ A;  3WAM A;  4FHK A;  2FUG 1;  1UGM A;  2N9X A;  3MC9 A;  3Q8E A;  1MI0 A;  3E56 A;  4DXG A;  1YQB A;  1KFY B;  5HHD G;  1C9F A;  3AM9 A;  3NS8 A;  3LB8 C;  4WAF A;  4NAW A;  2VZK D;  5EE1 A;  3WAP A;  2ZCC A;  1P7E A;  3EFU A;  1TS5 A;  4HLE A;  5JHB A;  2K0P A;  2AYO B;  4CYE A;  4A3O A;  1E5W A;  4LNK A;  3P4P B;  1S1Q B;  5JZE B;  5IO9 A;  1WGG A;  2MBB B;  5MPO A;  3SU8 X;  1E8W A;  2KMC A;  1PGX A;  4FHJ A;  2M1M A;  1ZUD 2;  3H1U A;  2BKR B;  3Q8B A;  3ZTC A;  2W82 A; 
#chains in the Genus database with same CATH homology
 3VR8 B;  3AEE B;  1RYJ A;  3IXS A;  3Q8A A;  4XWT A;  3SFE B;  5FR3 A;  1ESF A;  2N0S B;  1ZOY B;  5BYS A;  3EA6 A;  1CZP A;  4MAC A;  4NJC A;  1E6E B;  1HA5 A;  3GB1 A;  2JSV X;  3BVG A;  2GI9 A;  1J7C A;  2NMQ A;  1XLQ A;  1MVK A;  1NI3 A;  1V97 A;  2LHD A;  1PFD A;  3R2I A;  4YTP B;  2FE8 A;  2IGH A;  4CQN A;  1C76 A;  2PIA A;  2G1E A;  2J53 A;  3WCQ A;  1NEK B;  3IT4 B;  4M0W A;  4P6V F;  4RCO A;  4RNA A;  1I4P A;  3R8B A;  1P7F A;  3BK2 A;  3HUI A;  3FIL A;  4JX1 C;  4IKG A;  1DOY A;  1TS3 A;  1JCK B;  2QEJ C;  3AB5 A;  1F2R I;  1D4B A;  2N9K A;  2CJN A;  4IDI A;  2AQ2 B;  1LO5 D;  4TSS A;  1TKE A;  2WLB A;  2SEB D;  1SJE D;  3AEC B;  4OZC A;  3TEY A;  2YEP F;  1JWB D;  1EU4 A;  2TSS A;  2J4X A;  3E9S A;  3NVV A;  3TEX A;  1TJE A;  2NTS A;  3AE8 B;  4XDD A;  4TQ0 A;  1YQ4 B;  4JPS A;  3KLS X;  1YN3 A;  1E0Z A;  2E6X A;  1XXG A;  3ZYY X;  2EKI A;  2PVO D;  1DYQ A;  2Z8L A;  2WXH A;  1PUT A;  4MH8 A;  1DGJ A;  1XLO A;  1QOF A;  5LNK 1;  5AUI A;  4C56 C;  4L2Y A;  4ZOH C;  2INP E;  2EEL A;  1K53 A;  2MJ3 A;  4RGN A;  4RF0 A;  5C3J B;  3P4S B;  1PDX A;  2WXF A;  3AV8 A;  1M4V A;  1L0V B;  1T3Q A;  1QT9 A;  1SEB D;  2PLP A;  1VLB A;  1XCT L;  1YN4 A;  1SBB B;  2OHF A;  5BYR A;  2LMC A;  2RMM A;  4A6Q A;  3PZ7 A;  2LHE A;  5BMI A;  1C78 A;  3AEG B;  4N58 A;  4USA A;  2JZP A;  1SXT A;  2MJD A;  5C2T B;  2N7J A;  4ARI A;  4MT5 A;  2G9H D;  1FCC C;  1E7P B;  1VZ7 A;  1XLP A;  3C8Y A;  1Q10 A;  4AS1 A;  3FC4 A;  1N60 A;  2IJ0 A;  2LEK A;  4REZ A;  4OHJ A;  4RGO S;  1I4X A;  3P1M A;  2ICI A;  2V0G A;  1K50 A;  1SJH D;  1QKZ A;  2V3P A;  3NS1 A;  5AUK A;  3IT6 B;  1RFK A;  1FFU A;  5HFY A;  1L4Z B;  1ENF A;  1F77 A;  1AN8 A;  4KGR A;  1WXQ A;  1XF5 L;  1JWS D;  2SAK A;  4WQM A;  1SE4 A;  1CK1 A;  2LFI A;  2HTM E;  4NAM A;  2XN9 C;  1FIQ A;  2L52 A;  1EM7 A;  2WXJ A;  2K5P A;  2LGI A;  2OED A;  2AQ1 B;  1STE A;  5BYQ A;  2K22 A;  1ET9 A;  3ZJU A;  2K9X A;  2BTE A;  3MHZ A;  1TY0 A;  2R61 A;  1N61 A;  3HVD A;  3Q8C A;  3EUB 2;  3NVZ A;  4UDU C;  1GB4 A;  1EU3 A;  2ON8 A;  4HRO A;  1YN5 A;  3Q8F A;  1VJK A;  4EE2 A;  3PO0 A;  3VRA B;  4US8 A;  4O1N A;  3GP7 A;  1AYF A;  4LLG M;  3AED B;  1JML A;  2BYT A;  1FCL A;  2JX5 A;  1KH0 A;  2WXN A;  5GXG B;  3V05 A;  2BT6 A;  4ZHP A;  5G5H A;  1QQR A;  4P16 A;  2WU2 B;  1NEN B;  3AN1 A;  3P4R B;  1QOB A;  2WP9 B;  4A8X C;  4N59 A;  1XO3 A;  1YJJ A;  1ROE A;  2PMV A;  2QMT A;  1SE3 A;  3HVZ A;  4RH6 A;  1XEE A;  2ACZ B;  2WDV B;  3NUH B;  3W9C B;  4RF1 A;  2N9L A;  1JW9 D;  2BB5 A;  3U2S C;  3VQI A;  1D5X C;  3CIR B;  1N62 A;  2Y5P A;  4RGT A;  1RWS A;  1TY2 A;  3SFD B;  5I4D A;  1GAQ B;  1XLN A;  1FXI A;  1OFF A;  1VDV A;  3LYY A;  3LXF A;  2E3T A;  1YJI A;  2CJO A;  2BS2 B;  2H88 B;  1MHX A;  3KWL A;  1SSN A;  3AH7 A;  3O13 A;  3J9C A;  2PKO A;  4RGM A;  3B9J A;  3ZGZ A;  1NYR A;  1HQR D;  2PW9 A;  1NYQ A;  4A9A A;  2WDR B;  4L1B A;  1OQQ A;  1FMA D;  1XCQ L;  2LJI A;  3ZQ4 A;  2JYT A;  1WWT A;  4FXC A;  2DYO A;  2INN E;  1V1O A;  4B0M A;  1E9M A;  3IAS 1;  1UWX A;  1YMH E;  4C7Y A;  3KQ4 A;  2W3S A;  4Q2J A;  1IUE A;  4AQ7 A;  3MJ5 A;  4HJG E;  3NVW A;  3IAM 1;  3DWM A;  5TSS A;  1KF6 B;  2D5G A;  4YSX B;  1SB3 C;  4KKJ A;  1UUP A;  4KGT A;  2ZW1 A;  1AWD A;  4JE3 B;  1FO4 A;  1SF0 A;  1C4P A;  1FEH A;  1NVI D;  4IOI E;  4ITK A;  5H8Y E;  3W1S A;  4L23 A;  2Y5C A;  4B0E A;  4LK0 M;  3AE4 B;  2V3N A;  1YQ3 B;  3ABV B;  1VZ8 A;  3AEF B;  3NVY A;  2Y3A A;  4D2K A;  1PYW D;  3CWI A;  4GDK B;  2M0A A;  4OZA A;  2K3U A;  1AW7 A;  2B76 B;  3TEZ A;  1UGJ A;  4ZYS A;  2BS3 B;  1GOZ A;  1HEZ E;  1ZXI A;  2IDY A;  3P4Q B;  1FRD A;  1N63 A;  5E6J A;  1L4D B;  1BXT A;  3W5U B;  1JRO A;  2RDG A;  2J42 A;  2RDH A;  1KRH A;  2QJL A;  1K51 A;  3AEB B;  1IGD A;  2CU3 A;  3URY A;  3BVM A;  1JWA D;  4XE0 A;  5D3I B;  3UI3 A;  1J7A A;  1V1P B;  1CJE A;  4JWU C;  4HKQ A;  4XDC A;  3T3N A;  3I9V 1;  4N6E B;  4MM3 B;  2GRI A;  3HRD D;  2KDM A;  2H89 B;  2JYE A;  1FNU A;  2WXR A;  1DOX A;  1I4Q A;  1K52 A;  3ZJV A;  1IBX B;  3ZJT A;  1ZDX A;  1C79 A;  3P63 A;  2NTT A;  2BS4 B;  3AE5 B;  1UNS A;  3U7Z A;  5BMG A;  1MHH E;  1VZ6 A;  1WSP A;  1L0Y B;  3AE7 B;  1JQ4 A;  1FNW A;  3BVZ A;  1L6V A;  1TKY A;  3BZD B;  2VZK B;  2LUM A;  3RFZ B;  2BB6 A;  2KN4 A;  1QOA A;  1WRI A;  1D5M C;  1FM0 D;  1L6U A;  3BWU D;  4ARC A;  2ZW0 A;  4HRS A;  2WXM A;  2WS3 B;  1QIL A;  2AX5 A;  3VR9 B;  1J7B A;  4TQ1 A;  4ZHO A;  5FKA C;  1F2R C;  1C4C A;  4OVZ A;  4TMA B;  1BUI C;  1I7H A;  2ONQ A;  1TYG B;  3SR6 A;  2DYM A;  3P42 A;  3VRB B;  4HKZ E;  2JQR B;  2V4I B;  3AE6 B;  1HZ5 A;  1L0X B;  1GB1 A;  4LTU A;  1L5P A;  1I4H A;  1EWC A;  1QLB B;  2DBY A;  4R3D A;  1DOI A;  4YWG G;  2BBC A;  1JAL A;  2L83 A;  1OQR A;  4KX6 B;  2IPK D;  2KWD A;  5JXV A;  3I57 A;  4ZRP A;  4YXD B;  3EGR A;  2QIE B;  2JU6 X;  3FAH A;  4DXF A;  4US9 A;  1EWY C;  1RM6 C;  1T5X D;  1VR9 A;  2M56 B;  3KWV A;  5G5G A;  1BML C;  1D6E C;  2RPV A;  1SE2 A;  2WQY B;  3BYT B;  4C7Z A;  3AEA B;  3NZ3 A;  5EE3 A;  2JXT A;  1VRA B;  1ZP0 B;  4C80 A;  2QIL A;  1TZO A;  2QSD A;  1Y56 A;  1KLG D;  3U52 E;  1R7S A;  2GB1 A;  4WH4 A;  2WXP A;  1FRR A;  3AE9 B;  1N5X A;  1CQV A;  3AE2 B;  4RFB A;  4WUR A;  4A55 A;  2HDE A;  2AQ3 B;  4KKI A;  1I4G A;  1PGB A;  1V8C A;  1FXA A;  3TEW A;  4YT0 B;  1YNT E;  1HXY D;  2WDQ B;  1C4A A;  1A70 A;  2KQ4 X;  3AE1 B;  2KAJ A;  4XWW A;  3B2G A;  2MH7 A;  2BW2 A;  2XNA C;  1HZ6 A;  1D5Z C;  2WXK A;  1E10 A;  3TSS A;  3U4E G;  2KAC A;  2PTL A;  2L1A A;  5D7G A;  2MEK A;  1KTK A;  4YSZ B;  1WYG A;  4YTN B;  5EE0 A;  2L32 A;  1V1P A;  3MFG A;  3L4P A;  1WGK A;  3MC0 B;  3V3X A;  1ZXH A;  3T3O A;  5FK9 C;  1MPE A;  4JWS C;  4OZB A;  3BK1 A;  3ETR A;  2DLB A;  5HG2 A;  1UWM A;  1FFV A;  1B9R A;  1F0Z A;  1QF6 A;  5EE9 A;  4J3O D;  4WWM A;  3GS2 A;  2KMM A;  1IBX A;  1ZDV A;  2WNM A;  3FIL B;  2J52 A;  2WXO A;  2I2Y A;  2WXL A;  1TS2 A;  2WXQ A;  4HEA 1;  2M19 A;  1C77 A;  1ZE3 D;  2I38 A;  2YEP B;  4PT5 A;  4DQO C;  1JRP A;  3BYY B;  3TUO A;  2X38 A;  1I4R A;  1TS4 A;  2DWQ A;  1ZPS A;  2FUG 1;  3BII D;  3B2F A;  5T8I A;  2MJE A;  3Q8E A;  3RPF C;  1MI0 A;  1B1Z A;  3E56 A;  2W3R A;  5HHD G;  1KFY B;  4DXG A;  1C9F A;  3W2D A;  1T6B X;  3AM9 A;  1TKG A;  3N9Y C;  3W5V B;  3LB8 C;  4KGS A;  4WAF A;  2JWU A;  5D3D A;  2WU5 B;  1JWU D;  2W54 A;  3SEB A;  2VZK D;  5EE1 A;  4YSY B;  5H92 C;  4GDL B;  4YTM B;  2W55 A;  1P7E A;  1FNV A;  1TS5 A;  5HI1 A;  1GPX A;  4WIP A;  2WXG A;  2K0P A;  3OWE B;  1KLU D;  1PGA A;  3AMZ A;  4GLS C;  4A90 A;  2FBW B;  1JWM D;  1SIJ A;  3PZ8 A;  3P4P B;  2PVG C;  3H8H A;  1ACC A;  3MP9 A;  3R2T A;  4NZL B;  4ZRQ A;  3NRZ A;  4H2A A;  4NAW B;  3AE3 B;  3Q69 A;  5BMH A;  5MPO A;  1ET6 A;  2Q5W D;  2IGG A;  1N5W A;  2WXI A;  1FD6 A;  2IGD A;  3DWG C;  1PGX A;  1IGC A;  1ZUD 2;  3Q8B A;  1QOG A;  4OW0 A;  2W82 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...