3AH7A

Crystal structure of the isc-like [2fe-2s] ferredoxin (fdxb) from pseudomonas putida jcm 20004
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
109
structure length
109
Chain Sequence
MPLVTFLPHEKFCPEGLTVEVKPGTNILELAHDHHIEMESACGGVKACTTCHCIVRKGFDSLEEADELEEDMLDKAWGLEAQSRLGCQVFVADEDLTIEIPKYSLNHAA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords [2Fe-2S]ferredoxin
publication title Crystal structure of the ISC-like [2Fe-2S] ferredoxin (FdxB) from Pseudomonas putida JCM 20004
rcsb
source organism Pseudomonas putida
molecule tags Metal binding protein
total genus 27
structure length 109
sequence length 109
ec nomenclature
pdb deposition date 2010-04-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00111 Fer2 2Fe-2S iron-sulfur cluster binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 3ah7A00
1TKEA 2MJ3A 4US8A 2CJOA 3P4RB 1F0ZA 1XLOA 4N59A 1QOBA 3P4PB 4JWSC 2H89B 4WQMA 1IUEA 3P1MA 1L6VA 2WLBA 3ZYYX 1TJEA 3HVZA 5H8YE 1WGKA 1RFKA 3CWIA 3SR6A 2DBYA 4KX6B 3ABVB 1JROA 1L6UA 1QT9A 2WDRB 4IDIA 1N61A 2DWQA 4YTNB 3HUIA 2W3RA 1XLQA 2BS2B 1FM0D 3DWMA 3FC4A 1QOAA 1ZP0B 2MJDA 1JQ4A 4YXDB 3B2FA 1NYQA 5C3JB 1WYGA 3VR9B 1E0ZA 3NVWA 1QF6A 5GXGB 4A9AA 1FFUA 4ZHOA 1YJJA 3HRDD 3AEEB 1AYFA 1SIJA 1V8CA 3BIID 3SFDB 4ZHPA 3KWLA 3NRZA 1ZXIA 2WU2B 4HRSA 1RM6C 1NYRA 2WU5B 3P4SB 1TKGA 1PDXA 1UWMA 2PKOA 3B2GA 4JX1C 1CZPA 1N62A 2ACZB 2WDQB 1SB3C 3B9JA 5EE0A 5H92C 1NI3A 2K9XA 1N5XA 1GPXA 1YQ3B 2QIEB 3AE5B 1FRDA 3ETRA 1JRPA 1GAQB 3NVZA 1KF6B 4ZOHC 2Q5WD 1VJKA 3AMZA 2K5PA 2PVGC 1RWSA 1FXAA 3W5VB 4YTMB 4LTUA 1OQQA 2W55A 1L0VB 2PVOD 1T3QA 2H88B 3AECB 1DGJA 2WDVB 2BT6A 1PFDA 4USAA 2QJLA 3AEGB 1E7PB 1QOGA 1RYJA 2E3TA 5AUKA 2PIAA 3PO0A 2L83A 1FMAD 2M19A 1N63A 3DWGC 4N6EB 5AUIA 1FXIA 5EE9A 1DOYA 1JWAD 4YSZB 1FFVA 3W9CB 2BS3B 2MJEA 4C80A 1E6EB 1E9MA 1XO3A 4C7YA 2KAJA 1V97A 1JWBD 3AE6B 1TYGB 3FAHA 2G1EA 4YT0B 4YSYB 2JQRB 2LEKA 1OQRA 1WWTA 4HROA 3W5UB 3LXFA 4JWUC 3AE9B 1AWDA 2K22A 4N58A 1PUTA 1ROEA 3VR8B 1A70A 1ZOYB 3LB8C 3P63A 4FXCA 3AE2B 3AH7A 3AM9A 1R7SA 1JW9D 3AB5A 1VLBA 3CIRB 3L4PA 4C7ZA 1J7AA 5C2TB 3AE3B 2W54A 1ZUD2 2OHFA 1FRRA 1N60A 2CU3A 2N0SB 3AEBB 1EWYC 1NVID 2EKIA 2MH7A 5MPOA 1B9RA 4P6VF 1J7CA 4WWMA 1NEKB 5EE1A 1KRHA 1QLBB 1YJIA 3NS1A 2L52A 3AEDB 4YSXB 3AEAB 2WS3B 4ITKA 3EUB2 2B76B 1DOXA 1KFYB 1FO4A 2BS4B 2WP9B 1VDVA 2Y5CA 4US9A 2CJNA 1WXQA 3SFEB 3AE4B 1SF0A 3AV8A 3WCQA 1E10A 1WRIA 1NENB 2FBWB 2W3SA 3AE1B 3AE7B 3NVYA 1JALA 2AX5A 3P4QB 1YQ4B 3VRAB 5G5HA 3AN1A 2KMMA 5G5GA 3NVVA 2WQYB 1TKYA 2HTME 2JX5A 1FIQA 3AEFB 1N5WA 1QOFA 3AE8B 5EE3A 1OFFA 1XLPA 1XLNA 4YTPB 3RPFC 3VRBB 1CJEA 1J7BA 2M56B 1DOIA 1I7HA 1L5PA
chains in the Genus database with same CATH superfamily
3PRMB 3W1SC 1MG4A 1QOBA 1STEA 3DHGC 1SIFA 4M01A 2G4SA 3EA6A 5AZGA 1IPGA 2DWQA 3AU4A 4S0RA 4WQOB 1R4MB 3PPAA 3QWZB 3PVLA 2KKCA 1SE4A 2K8CA 4Q2JA 4TQ0A 4OVUA 3IT6B 3BIID 2N1WA 2LVOA 2WU2B 1Q5WB 2Z0DB 3BZDB 3P4SB 4JGHB 5EE0A 4W9FA 1P7EA 2W82A 3ZW3A 2DYMA 2HJ8A 1KF6B 2Y5BB 2C5LC 2QCZA 1C4CA 1T3QA 2ONQA 3MC0B 3NY5A 1GC6A 2UYZB 1P7FA 1E7PB 2UWQA 4A6QA 4MACA 1L2NA 1SE2A 4HPMB 2LD9A 1PGBA 2CHWA 3U4EG 2TSSA 3QX1A 5HI1A 3N1YC 2JZZA 1WWTA 2L32A 2KZRA 1Z5SB 4DDGD 3P42A 1MJDA 3Q69A 1A70A 1YMHE 2ZEQA 2MA9B 1WH3A 2GBRA 2X8XX 2ON8A 4RMAA 2EKIA 3VXWA 2ZCBA 4II2B 4RFBA 2G9HD 1E90A 1HE8A 4OHJA 1ZDVA 3AXCA 1LGRA 1A5RA 1VDVA 1C78A 4TMAB 3R8BA 3VRAB 2R2QA 1MI0A 2KNBA 2E6XA 2M56B 1WRDB 3NG0A 3K9PB 2C7HA 2KQ7A 4NAWB 3RNFC 3ZYYX 1TJEA 5G55A 4MT5A 4LDTD 4W9LA 1GC7A 3M3JA 5BYQA 2O2VB 2MWSB 1F2RC 2WX1A 4GU2A 4WWNA 2JSVX 4XZ4A 1CZPA 1OEYA 2IJ0A 1C79A 5BYSA 1WE7A 2I1KA 4CO7A 2NS5A 1EWCA 1RWSA 4YTMB 1QILA 3C19A 2INCC 5JZEB 5E6JA 4REZA 1F52A 4PT5A 4IW0A 1FXIA 1DOYA 2N9LA 4C80A 1PQSA 1D5XC 2O2VA 4ASWC 3HVDA 1TS5A 1V97A 2JT4B 3WIMA 3BVMA 1V6EA 2CHXA 2WXFA 2LGXA 4NPNA 1ROEA 4MJSB 1MHXA 1Q1OA 4N9F4 1GG3A 1ET9A 1FEHA 1FRRA 3DOWA 3ZUNA 4P6VF 1F2RI 2JUOA 2DZMA 1NEKB 4MDKE 5EE1A 3AEDB 4LLGM 1KFYB 4K81A 4XC2A 3ZNGC 4XGAB 1XD3B 2FBWB 4NQLB 5L83A 4LJOB 2AX5A 1YQ4B 1UF0A 2L0TA 2AYOB 2WQYB 2KMAA 3ML8A 1WJUA 3AE8B 2R61A 5FKAC 4A3OA 4JPSA 4N59A 1IUEA 1YOVB 2DBYA 2NMQA 4BBNF 5IKCM 2WXLA 4PS3A 1V81A 4WAAA 3U8ZA 3IXSA 3ZRCA 4PS8A 2D10A 4XE0A 4TUUA 2LHEA 1RM6C 4ZYSA 2GBKA 1L4DB 1PDXA 4DDID 1SB3C 3U30A 4FN2A 3PRPB 3BYTB 1JRPA 2ZVNA 1FXAA 4USAA 1IBXB 1JCKB 4C4VB 2QMTA 4HXDA 4GDLB 4AS1A 2JXTA 3PZ7A 2XBBC 1FFVA 3IAS1 1Y8RC 3PLVA 4W9EA 3KLSX 4BZAA 2K6QA 1XQQA 2K0PA 2QEJC 2WXPA 4L1BA 1WI0A 1PUTA 3DDCB 2QILA 4IG7B 3FILB 3Q3MC 4IKGA 3BK2A 2FIDA 1ZGUB 3SEBA 4MGKE 1UBIA 5D94A 1IP9A 1IBXA 1R4NI 1WXAA 2LJ5A 4KZCA 4C4VA 3RMKC 3QQ8B 1KM7A 1T0YA 1XEEA 2NBUA 4GDLA 1PGAA 3UQBA 3DBHB 3UI3A 4LNIA 4IWPA 1FNVA 1WGYA 1LXDA 1XLPA 2FCNA 2KX3A 5BMIA 4F1SA 2M8SA 3DBRB 1RFAA 4K1RB 1TS3A 4HPLB 5DPTA 4HCNB 2JPHA 1L6VA 2L1AA 5H8YE 5LXHA 3DBHI 5EDSA 1V80A 1CQVA 3U7ZA 1XLQA 4FJYA 2AQ3B 4B95A 1P1AA 3FILA 1JQ4A 4C00A 3R2IA 3IT4B 1M94A 4GB9A 4A9AA 1YJJA 4DHJD 3HRDD 3ZDTA 3S2AA 4OVZA 1WR1A 1NI2A 4JX1C 3IG3A 2KFKB 3Q8CA 1GPXA 3KW5B 1C3TA 1VJKA 4A55A 2K5PA 2ICIA 2RPVA 2WDVB 3Q3FA 2GMIC 3L08A 3ZDMC 2E3TA 2LHDA 2L83A 2L0FA 1V49A 3KUCB 3A4SC 4N6EB 2G3QB 2PEAA 4JE3B 1T0QC 4IM0A 2KDFB 2D3GA 4M02A 2KWDA 2J42A 2AL6A 3AE9B 4B6WA 3AULA 1G6JA 4TKNA 4ANVA 1JW9D 3N32A 1WJ6A 3EFUA 3N9YC 2KFKA 2M0AA 5D7GA 4CHKA 3D32A 4BOZB 4ZRJA 1I4XA 2LWPA 4G11A 1DOXA 4IOIE 3SFEB 2JRHA 2N1VA 2G4DB 1JALA 3OG5A 1E5WA 3DPDA 2REXA 2IZVB 3IBEA 1I4QA 2WNMA 2CR5A 5FR3A 3AEFB 5AEKB 1K53A 3ZIMA 4WJNA 4ZYNA 1F0ZA 3MFGA 3DCGA 2AEHA 1XT9B 2ZNVB 2D11A 3SR6A 1C77A 5JH5C 2LRWA 3Q3JA 1WXVA 1NYQA 1E0ZA 3NVWA 5G2NA 1Z2MA 3N1ZC 5DPWA 2V3SA 4HRSA 4KDIC 4PS7A 2JU6X 5JXVA 2IGGA 1M4VA 2K25A 1N62A 3X0WA 2KO3A 4IWOA 3SU8X 3WAOA 4B0EA 3DHHC 1YQ3B 1FRDA 1LQBA 4IUMB 4AJYB 5IP4D 3V62A 1YJ1A 2D3CA 3ZTCA 1E7UA 3M63B 4JQWC 5AUIA 2DZKA 5AZFA 3W9CB 1K52A 5CHFA 2GLSA 2QSDA 3L54A 3ZTDA 2EKEC 2MLBA 2GBMA 1LM8B 1MVKA 2C7NB 4LNOA 1S1QB 3P2BA 3R2TA 3JSVB 3ZKJC 2LGDA 2OHFA 3GP7A 4MELA 4WWMA 3ONSA 3T9LA 2FCMA 1KRHA 4NJ6A 2BKRB 2WWZA 3PREA 2LVPA 4KZ0A 3UF8A 4NJ7A 3AE4B 4BKSD 4DXAB 3AE7B 5G5HA 1WY8A 4NY0A 1HTQA 1EUVB 4IWQA 4FLHA 3VRBB 3U7DA 2ZW1A 1H4RA 2BVCA 4KIKB 3ABVB 3JSVA 1VZ6A 1FM0D 4URKA 2MJDA 3NS8A 3MJWA 5FR6A 5IN7A 4M00A 4BAXA 3I63C 2NBVB 3AEEB 1V8CA 3APFA 2WU5B 4MH0E 1UWMA 3B2GA 3EECA 2KXJA 4O1NA 4EZKA 2MX2A 3L13A 2KN4A 1E7VA 2C60A 4A90A 5AZHA 3VFKA 2XN9C 2KWUB 3PO0A 4DK5A 1MFWA 4HKZE 4DHZE 2IO3B 1ZDXA 4TV3A 2BS3B 4LJPB 2D5GA 4A20A 2J52A 3N20C 3DBSA 2HJ1A 5JHAA 1OTRB 5CTRC 4DXGA 2ZPYA 3TUOA 2KLGA 2JXXA 4LNFA 2MP2B 1WSPA 2L7RA 4K3CA 2JRIB 4AOFA 2JYEA 5TSSA 4WAFA 4DHJB 1BT0A 1QLBB 4DBGA 1MPEA 3Q6BA 3VDZA 3TEYA 2BWES 1C76A 4AJWA 3P4QB 3VTVA 2KD0A 3ZGZA 3ZJUA 3RNCC 3APCA 1WYWB 4W9GA 3IVFA 1CJEA 2NVUI 2OJWA 1TKEA 2KQ4X 1XLOA 3DQVA 1HZ6A 3P4PB 4ARCA 1YN3A 3K9OB 3R3MA 2RSUA 2JVCA 1PYWD 3ZO5B 2NPTB 2WDRB 2MP2A 2BB5A 3W1SA 3FC4A 2J0MA 1MG8A 1T0SC 2LZ6A 4ZHOA 4FA6A 3SFDB 4UDUC 3UIPB 3LDZE 2PE9A 2NTSA 3EGRA 2KJHB 4EFOA 2NCNA 3N3KB 3AE5B 3NVZA 4ZOHC 4E3CA 4YWGG 3U2SC 5J18A 3B0AA 1ZE3D 3AECB 3X23A 5CX3A 4HLEA 2LFIA 2V4LA 2KACA 2V1YA 2NPTA 3GOEA 3KQ4A 4W9JA 1JWAD 4MM3B 4A3PA 2MJEA 2BGFA 1XO3A 3O13A 1WJ4A 4MEMA 3HIZA 2G1EA 1OQRA 1ZXHA 1GUAB 2GI9A 3KYCD 5E6OA 4XDCA 4NAWA 1JWUD 1J7AA 4I6NB 2V9HA 4JIOU 2KTRB 1KOTA 3ZNID 1HZ5A 2IY0B 3ZJTA 2WXRA 3NS1A 5IA7A 2KK8A 1TY0A 1C4PA 3U52E 3TBLD 1L7YA 2BS4B 4US9A 1OEYJ 1RRBA 3AV8A 4FADA 1WR6E 1XCTL 2BF8B 3NVYA 4MM3A 3MHZA 2I1JA 3UIOB 2LMCA 1UZXB 4EKUA 3MJ5A 1HEZE 1QOFA 1YQBA 1KH0A 1V9JA 2FE8A 1J7BA 1WMHB 2WXHA 1OGWA 3AB5A 1V2YA 1I4HA 4WJOA 2KANA 4A8XC 2PE6B 1WGRA 3V05A 1WGKA 3CWIA 1I35A 2JZPA 3LJ3A 3PHWB 1QQRA 3J9CA 1WZ0A 5I4DA 3RZWC 2YLMA 3NRZA 1NYRA 2RDBC 4XDDA 3WAPA 2INNE 4MJSA 4AP4C 2RDHA 1WMHA 2PVOD 4MGYE 2BT6A 2SEBD 3H6NA 1QOGA 4HKQA 4FJZA 5C1ZA 3VTUA 1FMAD 2IPKD 3M62B 5EE9A 2LXCA 4RGNA 4I6PA 4NJCA 2C9WB 2D2QA 3QCAA 2VH1A 4S17A 2K22A 3SDLC 3AM9A 3ZRFA 3N1XC 5C2TB 3AE3B 1SJHD 4ACFA 2W54A 4G3XB 1IGDA 2C7MB 1J7CA 1YX5B 2MHJA 2FUHB 4P1CC 3RCZA 1MHHE 4GDKB 1KLGD 2QHOA 3ZLZA 4BKSA 4WURA 3FKYA 2NR2A 1X1MA 3Q14C 3A4RA 2D3AA 1R4NB 2KWCA 1VR9A 2BKFA 1SEBD 4AUQC 2PLPA 2JYTA 5LLIA 1JROA 5D3IB 5KHOA 3H7SA 3R7RA 2A5UA 3AI5A 5BO4B 1QOAA 5FK9C 3WA0A 4FULA 1FFUA 1JWSD 4MH8A 3KWLA 2WXOA 1U4AA 2QDFA 2XEWA 2I38A 2IO1B 4M8NA 2LRUA 1GB4A 3T8MA 5TR5A 5LNK1 4LNKA 2IO0B 2O6VB 3BYYB 1FCCC 2W55A 2DZJA 3N30A 2Z59B 4EZJA 3OWEB 3RNAC 2KC2A 2YEPB 2MCNB 1WXSA 1LO5D 1EF5A 3RULA 3TMPB 3JVZX 3DBLI 4II3B 3DVNV 3NJTA 2YVCA 3VR8B 3V60A 1WZ3A 1R7SA 4C7ZA 1FPYA 5IO9A 2BYVE 1KTKA 1PGXA 3CSFA 2N0SB 1FNUA 2O6VA 2DYOA 4OZCA 2MBEA 2VZKB 3AEAB 1GJZA 1CK1A 2KDBA 4IC7B 2CJNA 4BOSC 3L17A 1SJED 3GZNI 1WM3A 2N9XA 1TY2A 3BVZA 3RYTA 2HTME 2JX5A 2LGSA 5D2MB 3URYA 4TSSA 2IGHA 4OW0A 2DZIA 2MSED 3ZVVA 1UNSA 1GOZA 2FCQA 1I7HA 1WM2A 1EU3A 2KYWA 2BWFA 4ZRKA 2K8HA 1WGDA 3R7QA 1L6UA 2KX0A 1N61A 2BS2B 5HFYA 3V61A 3DWMA 2IO2B 1TS2A 2KT7A 1BXTA 1BMLC 2KDMA 4HK2A 2JWZA 3VR9B 2KOXA 1AYFA 3Q8EA 3CF6E 2WDQB 4MGIE 2LGYA 5IOIA 1DYQA 2QIEB 2KTFA 2GRIA 5D3DA 3W5VB 2DLBA 4FHJA 3HM3A 4B0MA 1PFDA 2BBCA 3BWUD 5AUKA 2V3PA 1N63A 4LNNA 3DWGC 4KSKC 4JLCA 3TL5A 2WXGA 3PRZA 3JYUA 1E6EB 1JRUA 1JWBD 3OLMD 2N9PC 1FNWA 3H7PB 2BB6A 4ZRIA 3Q3NC 1KJTA 2K6DB 3TCAA 3BVGA 3HHMA 3KYDD 2MQJA 1SGHA 3WAMA 4H2AA 3H1UA 1NBFC 2PTLA 5MPOA 1NVID 3B1LX 1YJIA 4ITKA 3GE8C 2Y3AA 3NZ3A 2K8BA 2VRRB 3PV1A 1VD2A 1E10A 4GN1A 4ANWA 3AN1A 5G5GA 3RD2A 3RI7C 2K39A 2IBIB 2GBJA 3OAWA 3E56A 1OFFA 2HDEA 3RPFC 3ENEA 4PYUA 2CS4A 3H7PA 1ISNA 4KX6B 1V86A 4YTNB 4F8CB 5J17A 1SBBB 4FBJB 4C56C 1ZP0B 4W9KA 1WE6A 3RNEC 3H8HA 1WYGA 1WX8A 3RT3B 3KH0A 1ZXIA 3APDA 1UWXA 3A1QB 3EHVA 3SHQA 3SD5A 1T0RC 1NI3A 5E6PA 3T3OA 3VHTC 3HK0A 1P0RA 1QZEA 1ENFA 3V6CB 1S3SG 1E8XA 3GS2A 3OJ3A 1V1PB 2I2YA 1QKZA 1YNTE 4GLSC 3VH3B 1IGCA 3I57A 1DGJA 4BVUC 4W9IA 1Q0WB 2J0KA 1WGGA 4ANXA 1TIFA 2ZZPB 1TT5B 3MP9A 4XWTA 3KVFB 3BY4B 5HKHA 2Y5PA 4P16A 3B08A 3AU5A 1KLUD 4MSMB 3ZNHB 5C23A 2KC1A 1UBQA 2LGIA 1OQYA 2HE7A 4K7WA 4E74A 4KGSA 4F7ZA 3AH7A 2MRPA 2G45B 3MC9A 2WXNA 4KIKA 2L05A 4KGRA 1V1PA 3TEZA 4DQOC 2WS3B 1HTOA 1N6ZA 4EOYA 2B76B 1KLVA 1WXQA 4BKTA 3RFZB 3WCQA 2J7QB 1TBEA 1TZOA 1NENB 2DHZA 4LK0M 3VH4B 1JWMD 4ARIA 2WXIA 1VZ7A 1SSNA 2K3UA 3QHTA 1R4MI 2HTHA 2KHWB 2PW9A 3ZQ4A 1L5PA 3ZJVA 3RNGC 3ZXRA 1P3QU 2CU1A 3P1MA 2O6VD 1HA5A 4HPPA 3C0RB 1QT9A 4IDIA 1I4RA 2GBNA 4KV2A 1C4AA 2JY6A 5D6JB 4GSWA 4YXDB 3HM6X 5GXGB 4HCPB 4XYCA 3UQAA 2FNJB 1RLFA 2ASQA 2ZVOA 4WH4A 2ACZB 2V4IB 2MEKA 2J4XA 1XCQL 1FCLA 2EMTA 1N5XA 4I6LB 3RN9C 3ETRA 2DX5B 4WJPA 2MW5A 3PZ8A 1T5XD 4EUTA 2H88B 4KVGB 1XXGA 2INDC 2LI5A 3KWVA 4AQ7A 3MTNB 3I9V1 2DYBA 2VZKD 1WFYA 4JL9A 4AWJA 2KAJA 2OOBB 3T3NA 3Q8AA 1TYGB 1ESFA 4YSYB 2Z0EB 4HROA 4JWUC 1VRAB 2WXMA 3NZSA 2RMMA 3A9JB 4FXCA 3CIRB 1VLBA 2BYEA 3KUDB 4WWPA 1ZUD2 3VVWB 1N60A 2CU3A 3AEBB 1EWYC 2MH7A 3PTFC 1WF9A 4TQ1A 4KDLB 1K8RB 2RGFA 2J53A 3Q8FA 3QIJA 5E6NA 2N4FA 3VUYA 2D3BA 4PYZA 2BTEA 1YN4A 3VAWA 2WXKA 4OVVA 4ANUA 4G50A 4WWOA 4R3DA 4NZLB 2KDEB 1B1ZA 1XLNA 2D07B 1DOIA 2Y5CA 4HVBA 4US8A 5BMGA 2H89B 4FJVB 2N7DA 3A9JA 3ECIA 3L0WB 4RM8A 5GMVA 4DWFA 1WX7A 4HEA1 2IGDA 3TEXA 2OEDA 3B2FA 2EELA 3O65B 4RGTA 1C9FA 3PHXB 1D3ZA 2WGSA 3ALBA 3TJPA 4HJKA 2GOWA 4KKJA 2LUMA 4RGOS 4KKIA 1J19A 3MC8A 4NNJB 1K50A 2KMCA 4G0NB 3PZDA 2BYTA 2Q5WD 3TIXA 3Q3OC 2DNFA 2KTRA 1OQQA 2AQ2B 4CYEA 4NQKE 4RF1A 1E8YA 3LYYA 5T8IA 4KGTA 2NBWB 1L0YB 1IYFA 4WJQA 2M0XA 2AWTA 2PJHA 3AE6B 1D5MC 4YT0B 2JQRB 4E71A 2LEKA 2X38A 4N58A 1E8ZA 3P63A 5DPRA 2XNAC 2JZ3B 3JW0X 5BYRA 3PLUA 5IAAC 1K51A 3RNBC 2KJRA 2V3NA 4YSXB 1XF5L 2KVRA 2WP9B 4BFRA 2AQ1B 2OJRA 3PGEA 1E8WA 2RDGA 3NUHB 3NVVA 3QAQA 3TEWA 1VCBA 2YEPF 4NAMA 2MBOA 3AE1B 4YL8A 2WHIA 4PK1A 2CJOA 3P4RB 4WQMA 3QA8A 2WLBA 3I3TB 1RFKA 5JHBA 1D6EC 4EEWA 4ZRQA 2FAZA 3HUIA 2W3RA 3NHEB 3NZUA 2CHZA 1ZKHA 4ZDVA 2AL3A 2IDYA 4BBNC 4RM9A 2B3AA 4ZHPA 2DAFA 1Q10A 3CMMB 2KN5A 4RNAA 2PKOA 2MBQA 2LJIA 4LCDE 1WGHA 2PPHA 1C1YB 3NOBA 1BUIC 2K9XA 1T6BX 1GAQB 2FUG1 2LVQA 4J3OD 2IYDB 3QK0A 3QARA 4LTUA 1AW7A 1NDDA 2BYFA 4RGMA 4XWWA 2PIAA 2M19A 4GDKA 2FCSA 4XX5A 2DENB 3QJZA 4C7YA 2R2OA 5BMHA 1Y56A 3FAHA 3KUZA 2V0GA 1TGZB 3W5UB 2INPE 3L10B 3LXFA 1ZW7A 1AWDA 3UGBB 1ZOYB 2BW2A 2KQSA 2RR9A 3IFWB 4EZLA 3VUXA 3GE3C 1EU4A 4K7SA 1V5TA 4RH6A 2L8JA 3DBLB 1B9RA 1F77A 3ML9A 2W9NA 3PSEB 4GMVA 3EUB2 2JWUA 2EMSA 4IM2A 3M95A 3VQIA 1SF0A 3DBRI 2ZCCA 1WRIA 2KDIA 2BQQA 2KMMA 2J0JA 4HWIB 1TKYA 1N5WA 5LXIB 4YTPB 2MJ3A 3GZNB 4GGQA 4JWSC 1SXTA 1SE3A 4J6IA 1TS4A 1UUPA 5J2RA 2NTTA 3W2DA 3WANA 1HXYD 1YX6B 2GB1A 3WALA 2CKHB 1GNUA 3DVGY 4K3BA 1HQRD 1L0XB 1SIJA 2SAKA 1UGMA 1TTNA 3Q8BA 5DCNA 3UINB 2JF5A 2WX0A 1SE9A 3B9JA 2KFJA 5H92C 4L23A 4BKGA 4HDOA 2ZNVC 2ZW0A 3AMZA 4ICVA 3BINA 4MSQB 4LDTB 2M1MA 2QJLA 3AEGB 3DVGX 1RYJA 1D4BA 2VH2A 1AN8A 2LASA 4YSZB 3GB1A 3H9DA 4X57B 1E9MA 3W1YA 1J0GA 1TZ1A 1WJNA 3MHSD 4OZBA 4D2KA 4ZRPA 2N7JA 1FXTB 2WDTB 3V3XA 3DVNU 2WXJA 3C8YA 2Z8LA 1YN5A 4KSLC 4M8MA 3DHIC 1WXMA 1EF1A 4EE2A 3CSTA 4GOCA 2M17A 2DAJA 2L52A 2ZJDA 1EM7A 4HDQA 3RZFA 1LFDA 2KWVB 3RUIB 1ET6A 1I4GA 3BK1A 4GIVA 3IAM1 3A9KB 4MGZE 1ACCA 4W9HA 2MBBB 2ZPNA 1V1OA 3HVZA 4RF0A 2L00B 4RCOA 5HG2A 2L3ZA 2A4ZA 1YD8U 3PS6A 3PT2B 1UD7A 4P7IA 5C3JB 2KJ6A 1QF6A 4CQNA 4WIPA 2PMVA 1J8CA 1P98A 4GXBA 2K1FA 3V6EB 4ICUA 1TKGA 2N9EB 5CHVC 3VTWA 1AARA 1F9JA 4M0WB 2RD0A 4DHZB 2KVZA 2XK5B 4OZAA 5HHDG 2PVGC 3A9KA 2BPSA 2RPQA 1UGJA 5DPSA 5CHWA 1L0VB 2LUEA 3Q2AC 2UU7A 4DXFA 5KHQA 2QC8A 2WXQA 3QC8B 1YIWA 5L95C 2WYQA 3ZXVA 2HD5B 1CMXB 4QAYA 4FHKA 4L2YA 1I42A 1F1HA 4K7UA 2M4NA 3VUWA 4W9CA 2N7EA 2IY1B 1RAXA 3OJ4B 2FIFA 4B9KA 3LB8C 3AE2B 4M0WA 3L4PA 1WX9A 3L16A 3EFCA 1EO6A 1I4PA 3R66C 2XK5A 1D5ZC 1FD6A 1L4ZB 3A33B 1JMLA 4W9DA 1GB1A 1FO4A 3EC8A 3TSSA 1V5OA 1WIAA 4HJGE 2W3SA 3A1QA 2N9KA 4IM3A 1UH6A 1VZ8A 2L76A 4P1BC 1UELA 1ZPSA 3E9SA 1H8CA 2MBHA 3IHPC 1FIQA 5EE3A 1P9DU 3ZNZB 3I5JC 2KLCA 2LXAA
chains in the Genus database with same CATH topology
4US8A 1VR9A 1F0ZA 1QOBA 5BMGA 1STEA 2H89B 3MFGA 1SEBD 2PLPA 2JYTA 3EA6A 3SR6A 1C77A 1JROA 5D3IB 2DWQA 4HEA1 2IGDA 1QOAA 5FK9C 3TEXA 2OEDA 3B2FA 2EELA 1NYQA 4RGTA 1SE4A 1C9FA 1E0ZA 3NVWA 4Q2JA 4TQ0A 1FFUA 1JWSD 3IT6B 3BIID 4MH8A 3KWLA 4HRSA 2WU2B 2WXOA 2I38A 3BZDB 3P4SB 2JU6X 5JXVA 2IGGA 1M4VA 4KKJA 2LUMA 1N62A 4KKIA 4RGOS 5EE0A 1P7EA 2W82A 2DYMA 1K50A 1GB4A 4B0EA 1YQ3B 1FRDA 1KF6B 5LNK1 2BYTA 2Q5WD 3BYYB 1C4CA 1FCCC 1OQQA 2AQ2B 2W55A 1T3QA 2ONQA 3MC0B 4RF1A 1P7FA 1E7PB 3LYYA 3OWEB 5T8IA 4KGTA 4A6QA 4MACA 5AUIA 1L0YB 2YEPB 1SE2A 3W9CB 1LO5D 1K52A 1PGBA 3U4EG 2TSSA 3AE6B 2QSDA 5HI1A 1D5MC 4YT0B 2JQRB 2LEKA 1WWTA 2L32A 2X38A 3P42A 4N58A 3Q69A 1MVKA 3VR8B 1A70A 3P63A 1YMHE 2XNAC 1R7SA 3R2TA 4C7ZA 1KTKA 2ON8A 1PGXA 5BYRA 2OHFA 3GP7A 2N0SB 2EKIA 1FNUA 4WWMA 1K51A 1KRHA 2DYOA 4OZCA 4RFBA 2G9HD 4OHJA 1ZDVA 2V3NA 4YSXB 2VZKB 3AEAB 1XF5L 1CK1A 2WP9B 1VDVA 1C78A 2CJNA 4TMAB 3R8BA 1SJED 3AE4B 2AQ1B 3VRAB 3BVZA 1TY2A 3AE7B 5G5HA 2RDGA 3NUHB 3NVVA 2HTME 2JX5A 1MI0A 3TEWA 3URYA 4TSSA 2IGHA 4OW0A 2YEPF 4NAMA 1UNSA 2E6XA 3VRBB 1GOZA 2M56B 1I7HA 3AE1B 1EU3A 2CJOA 3P4RB 2ZW1A 4WQMA 4NAWB 2WLBA 3ZYYX 1TJEA 1RFKA 4MT5A 1D6EC 1L6UA 3ABVB 4ZRQA 1N61A 3HUIA 2W3RA 2BS2B 1VZ6A 5HFYA 5BYQA 1FM0D 3DWMA 1TS2A 2MJDA 1BXTA 1BMLC 2KDMA 2IDYA 3VR9B 1F2RC 3AEEB 1AYFA 1V8CA 3Q8EA 4ZHPA 1Q10A 2JSVX 2WU5B 4RNAA 1UWMA 2PKOA 3B2GA 2LJIA 1CZPA 2WDQB 2IJ0A 4O1NA 1C79A 5BYSA 1BUIC 2K9XA 1DYQA 2KN4A 2QIEB 1T6BX 1GAQB 2FUG1 1EWCA 2GRIA 1RWSA 4J3OD 5D3DA 3W5VB 4LTUA 4YTMB 4A90A 1QILA 2DLBA 1AW7A 4B0MA 1PFDA 2BBCA 3BWUD 4RGMA 2XN9C 5AUKA 4XWWA 2PIAA 3PO0A 5E6JA 4REZA 2M19A 2V3PA 1N63A 3DWGC 4PT5A 1FXIA 4HKZE 1DOYA 2WXGA 2N9LA 1ZDXA 2BS3B 4C80A 1E6EB 1D5XC 4C7YA 2D5GA 5BMHA 3HVDA 1TS5A 1V97A 1JWBD 2J52A 1Y56A 3FAHA 2V0GA 1FNWA 3W5UB 2INPE 3LXFA 3BVMA 2BB6A 4DXGA 1AWDA 2WXFA 1ROEA 3TUOA 1ZOYB 3BVGA 2BW2A 1MHXA 1EU4A 1WSPA 4H2AA 1ET9A 1FEHA 1FRRA 4RH6A 2PTLA 2JYEA 1NVID 5MPOA 1F77A 1B9RA 4P6VF 1F2RI 1NEKB 5TSSA 4WAFA 5EE1A 1QLBB 1YJIA 1MPEA 3AEDB 4ITKA 2Y3AA 4LLGM 3EUB2 3TEYA 1KFYB 2JWUA 3NZ3A 3VQIA 1C76A 1SF0A 1E10A 1WRIA 3P4QB 2FBWB 3ZGZA 2AX5A 1YQ4B 3ZJUA 3AN1A 2KMMA 5G5GA 2WQYB 1TKYA 1N5WA 3E56A 3AE8B 2HDEA 1OFFA 4YTPB 2R61A 3RPFC 1CJEA 5FKAC 1TKEA 2KQ4X 2MJ3A 4JPSA 1XLOA 4N59A 1HZ6A 3P4PB 4JWSC 4ARCA 1IUEA 1SE3A 1SXTA 1YN3A 1TS4A 1PYWD 1UUPA 2DBYA 2NMQA 4KX6B 2WDRB 2NTTA 3W2DA 1HXYD 4YTNB 2BB5A 3W1SA 1SBBB 2GB1A 2WXLA 3FC4A 4C56C 1ZP0B 1HQRD 1L0XB 3H8HA 1WYGA 3IXSA 4ZHOA 4XE0A 1SIJA 3SFDB 4UDUC 2SAKA 3Q8BA 1ZXIA 2LHEA 1UWXA 1RM6C 4ZYSA 2NTSA 3EGRA 1L4DB 1PDXA 1SB3C 3B9JA 5H92C 4L23A 1NI3A 3T3OA 3AE5B 3BYTB 1ENFA 1JRPA 3NVZA 4ZOHC 3GS2A 2ZW0A 2I2YA 1V1PB 3AMZA 4YWGG 3U2SC 1QKZA 1ZE3D 1FXAA 1YNTE 4GLSC 1IGCA 3AECB 3I57A 1DGJA 2LFIA 4USAA 2QJLA 3AEGB 1RYJA 1D4BA 1JCKB 2KACA 1IBXB 1AN8A 2QMTA 3KQ4A 4AS1A 4GDLB 3MP9A 2JXTA 3PZ7A 4XWTA 1JWAD 4MM3B 4YSZB 1FFVA 3GB1A 3IAS1 2MJEA 2Y5PA 1E9MA 1XO3A 3O13A 3KLSX 4P16A 4OZBA 4D2KA 1KLUD 4ZRPA 2G1EA 2K0PA 2QEJC 2WXPA 2N7JA 1OQRA 1ZXHA 2LGIA 2GI9A 4L1BA 3V3XA 2WXJA 1PUTA 4KGSA 3C8YA 3AH7A 2Z8LA 1YN5A 2QILA 4XDCA 1JWUD 1J7AA 2WXNA 4EE2A 3FILB 4KGRA 4IKGA 3BK2A 1V1PA 3TEZA 1HZ5A 4DQOC 3SEBA 3ZJTA 2WXRA 3NS1A 2L52A 1EM7A 2WS3B 1TY0A 1C4PA 2B76B 3U52E 2BS4B 4US9A 1IBXA 1WXQA 3RFZB 3AV8A 3WCQA 1TZOA 1XCTL 1NENB 4LK0M 1XEEA 3NVYA 1PGAA 3MHZA 1ET6A 1JWMD 4ARIA 1I4GA 2LMCA 3UI3A 3MJ5A 1HEZE 1VZ7A 1SSNA 2K3UA 1FNVA 1QOFA 2WXIA 3BK1A 1KH0A 1XLPA 3IAM1 2FE8A 2PW9A 3ZQ4A 1J7BA 5BMIA 2WXHA 1ACCA 3AB5A 1L5PA 3ZJVA 1I4HA 1TS3A 4A8XC 3P1MA 1L6VA 1V1OA 2L1AA 3HVZA 4RF0A 5H8YE 3V05A 1HA5A 1WGKA 3CWIA 4RCOA 2JZPA 1QT9A 4IDIA 5HG2A 1CQVA 1I4RA 3U7ZA 1XLQA 2AQ3B 1QQRA 1C4AA 3J9CA 3FILA 1JQ4A 4YXDB 3R2IA 5I4DA 3IT4B 5C3JB 1QF6A 5GXGB 4A9AA 1YJJA 4WIPA 4CQNA 2PMVA 3HRDD 4OVZA 3NRZA 1NYRA 1TKGA 4JX1C 4WH4A 2ACZB 4XDDA 2V4IB 2MEKA 2J4XA 1XCQL 1FCLA 3Q8CA 1N5XA 2INNE 1GPXA 3ETRA 4OZAA 1VJKA 2RDHA 5HHDG 4A55A 2K5PA 2PVGC 1UGJA 2ICIA 3PZ8A 1T5XD 1L0VB 2PVOD 2H88B 2RPVA 2WDVB 4DXFA 1XXGA 2BT6A 2SEBD 1QOGA 2E3TA 4HKQA 2LHDA 2L83A 1FMAD 2WXQA 3KWVA 2IPKD 4AQ7A 3I9V1 4N6EB 4JE3B 5EE9A 2VZKD 4L2YA 4RGNA 2KAJA 3T3NA 2KWDA 3Q8AA 1TYGB 4NJCA 1ESFA 4YSYB 2J42A 4HROA 4JWUC 1VRAB 2WXMA 3AE9B 2K22A 2RMMA 4FXCA 3LB8C 3AE2B 3AM9A 4M0WA 1JW9D 3CIRB 1VLBA 3L4PA 3N9YC 5C2TB 2M0AA 1SJHD 3AE3B 5D7GA 2W54A 1ZUD2 1N60A 1I4PA 2CU3A 3AEBB 1EWYC 1D5ZC 2MH7A 1IGDA 1J7CA 4TQ1A 1FD6A 1L4ZB 1I4XA 1MHHE 2J53A 1GB1A 1JMLA 3Q8FA 4GDKB 1DOXA 1FO4A 1KLGD 3TSSA 4WURA 4IOIE 3SFEB 2BTEA 1YN4A 4HJGE 2WXKA 2W3SA 1JALA 2N9KA 1VZ8A 4R3DA 4NZLB 1ZPSA 3E9SA 1I4QA 2WNMA 5FR3A 1B1ZA 1FIQA 3AEFB 5EE3A 1K53A 1XLNA 1DOIA 2Y5CA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1TKE A;  2MJ3 A;  4US8 A;  2CJO A;  3P4R B;  1F0Z A;  1XLO A;  4N59 A;  1QOB A;  3P4P B;  4JWS C;  2H89 B;  4WQM A;  1IUE A;  3P1M A;  1L6V A;  2WLB A;  3ZYY X;  1TJE A;  3HVZ A;  5H8Y E;  1WGK A;  1RFK A;  3CWI A;  3SR6 A;  2DBY A;  4KX6 B;  3ABV B;  1JRO A;  1L6U A;  1QT9 A;  2WDR B;  4IDI A;  1N61 A;  2DWQ A;  4YTN B;  3HUI A;  2W3R A;  1XLQ A;  2BS2 B;  1FM0 D;  3DWM A;  3FC4 A;  1QOA A;  1ZP0 B;  2MJD A;  1JQ4 A;  4YXD B;  3B2F A;  1NYQ A;  5C3J B;  1WYG A;  3VR9 B;  1E0Z A;  3NVW A;  1QF6 A;  5GXG B;  4A9A A;  1FFU A;  4ZHO A;  1YJJ A;  3HRD D;  3AEE B;  1AYF A;  1SIJ A;  1V8C A;  3BII D;  3SFD B;  4ZHP A;  3KWL A;  3NRZ A;  1ZXI A;  2WU2 B;  4HRS A;  1RM6 C;  1NYR A;  2WU5 B;  3P4S B;  1TKG A;  1PDX A;  1UWM A;  2PKO A;  3B2G A;  4JX1 C;  1CZP A;  1N62 A;  2ACZ B;  2WDQ B;  1SB3 C;  3B9J A;  5EE0 A;  5H92 C;  1NI3 A;  2K9X A;  1N5X A;  1GPX A;  1YQ3 B;  2QIE B;  3AE5 B;  1FRD A;  3ETR A;  1JRP A;  1GAQ B;  3NVZ A;  1KF6 B;  4ZOH C;  2Q5W D;  1VJK A;  3AMZ A;  2K5P A;  2PVG C;  1RWS A;  1FXA A;  3W5V B;  4YTM B;  4LTU A;  1OQQ A;  2W55 A;  1L0V B;  2PVO D;  1T3Q A;  2H88 B;  3AEC B;  1DGJ A;  2WDV B;  2BT6 A;  1PFD A;  4USA A;  2QJL A;  3AEG B;  1E7P B;  1QOG A;  1RYJ A;  2E3T A;  5AUK A;  2PIA A;  3PO0 A;  2L83 A;  1FMA D;  2M19 A;  1N63 A;  3DWG C;  4N6E B;  5AUI A;  1FXI A;  5EE9 A;  1DOY A;  1JWA D;  4YSZ B;  1FFV A;  3W9C B;  2BS3 B;  2MJE A;  4C80 A;  1E6E B;  1E9M A;  1XO3 A;  4C7Y A;  2KAJ A;  1V97 A;  1JWB D;  3AE6 B;  1TYG B;  3FAH A;  2G1E A;  4YT0 B;  4YSY B;  2JQR B;  2LEK A;  1OQR A;  1WWT A;  4HRO A;  3W5U B;  3LXF A;  4JWU C;  3AE9 B;  1AWD A;  2K22 A;  4N58 A;  1PUT A;  1ROE A;  3VR8 B;  1A70 A;  1ZOY B;  3LB8 C;  3P63 A;  4FXC A;  3AE2 B;  3AH7 A;  3AM9 A;  1R7S A;  1JW9 D;  3AB5 A;  1VLB A;  3CIR B;  3L4P A;  4C7Z A;  1J7A A;  5C2T B;  3AE3 B;  2W54 A;  1ZUD 2;  2OHF A;  1FRR A;  1N60 A;  2CU3 A;  2N0S B;  3AEB B;  1EWY C;  1NVI D;  2EKI A;  2MH7 A;  5MPO A;  1B9R A;  4P6V F;  1J7C A;  4WWM A;  1NEK B;  5EE1 A;  1KRH A;  1QLB B;  1YJI A;  3NS1 A;  2L52 A;  3AED B;  4YSX B;  3AEA B;  2WS3 B;  4ITK A;  3EUB 2;  2B76 B;  1DOX A;  1KFY B;  1FO4 A;  2BS4 B;  2WP9 B;  1VDV A;  2Y5C A;  4US9 A;  2CJN A;  1WXQ A;  3SFE B;  3AE4 B;  1SF0 A;  3AV8 A;  3WCQ A;  1E10 A;  1WRI A;  1NEN B;  2FBW B;  2W3S A;  3AE1 B;  3AE7 B;  3NVY A;  1JAL A;  2AX5 A;  3P4Q B;  1YQ4 B;  3VRA B;  5G5H A;  3AN1 A;  2KMM A;  5G5G A;  3NVV A;  2WQY B;  1TKY A;  2HTM E;  2JX5 A;  1FIQ A;  3AEF B;  1N5W A;  1QOF A;  3AE8 B;  5EE3 A;  1OFF A;  1XLP A;  1XLN A;  4YTP B;  3RPF C;  3VRB B;  1CJE A;  1J7B A;  2M56 B;  1DOI A;  1I7H A;  1L5P A; 
#chains in the Genus database with same CATH topology
 3PRM B;  3W1S C;  1MG4 A;  1QOB A;  1STE A;  3DHG C;  1SIF A;  4M01 A;  2G4S A;  3EA6 A;  5AZG A;  1IPG A;  2DWQ A;  3AU4 A;  4S0R A;  4WQO B;  1R4M B;  3PPA A;  3QWZ B;  3PVL A;  2KKC A;  1SE4 A;  2K8C A;  4Q2J A;  4TQ0 A;  4OVU A;  3IT6 B;  3BII D;  2N1W A;  2LVO A;  2WU2 B;  1Q5W B;  2Z0D B;  3BZD B;  3P4S B;  4JGH B;  5EE0 A;  4W9F A;  1P7E A;  2W82 A;  3ZW3 A;  2DYM A;  2HJ8 A;  1KF6 B;  2Y5B B;  2C5L C;  2QCZ A;  1C4C A;  1T3Q A;  2ONQ A;  3MC0 B;  3NY5 A;  1GC6 A;  2UYZ B;  1P7F A;  1E7P B;  2UWQ A;  4A6Q A;  4MAC A;  1L2N A;  1SE2 A;  4HPM B;  2LD9 A;  1PGB A;  2CHW A;  3U4E G;  2TSS A;  3QX1 A;  5HI1 A;  3N1Y C;  2JZZ A;  1WWT A;  2L32 A;  2KZR A;  1Z5S B;  4DDG D;  3P42 A;  1MJD A;  3Q69 A;  1A70 A;  1YMH E;  2ZEQ A;  2MA9 B;  1WH3 A;  2GBR A;  2X8X X;  2ON8 A;  4RMA A;  2EKI A;  3VXW A;  2ZCB A;  4II2 B;  4RFB A;  2G9H D;  1E90 A;  1HE8 A;  4OHJ A;  1ZDV A;  3AXC A;  1LGR A;  1A5R A;  1VDV A;  1C78 A;  4TMA B;  3R8B A;  3VRA B;  2R2Q A;  1MI0 A;  2KNB A;  2E6X A;  2M56 B;  1WRD B;  3NG0 A;  3K9P B;  2C7H A;  2KQ7 A;  4NAW B;  3RNF C;  3ZYY X;  1TJE A;  5G55 A;  4MT5 A;  4LDT D;  4W9L A;  1GC7 A;  3M3J A;  5BYQ A;  2O2V B;  2MWS B;  1F2R C;  2WX1 A;  4GU2 A;  4WWN A;  2JSV X;  4XZ4 A;  1CZP A;  1OEY A;  2IJ0 A;  1C79 A;  5BYS A;  1WE7 A;  2I1K A;  4CO7 A;  2NS5 A;  1EWC A;  1RWS A;  4YTM B;  1QIL A;  3C19 A;  2INC C;  5JZE B;  5E6J A;  4REZ A;  1F52 A;  4PT5 A;  4IW0 A;  1FXI A;  1DOY A;  2N9L A;  4C80 A;  1PQS A;  1D5X C;  2O2V A;  4ASW C;  3HVD A;  1TS5 A;  1V97 A;  2JT4 B;  3WIM A;  3BVM A;  1V6E A;  2CHX A;  2WXF A;  2LGX A;  4NPN A;  1ROE A;  4MJS B;  1MHX A;  1Q1O A;  4N9F 4;  1GG3 A;  1ET9 A;  1FEH A;  1FRR A;  3DOW A;  3ZUN A;  4P6V F;  1F2R I;  2JUO A;  2DZM A;  1NEK B;  4MDK E;  5EE1 A;  3AED B;  4LLG M;  1KFY B;  4K81 A;  4XC2 A;  3ZNG C;  4XGA B;  1XD3 B;  2FBW B;  4NQL B;  5L83 A;  4LJO B;  2AX5 A;  1YQ4 B;  1UF0 A;  2L0T A;  2AYO B;  2WQY B;  2KMA A;  3ML8 A;  1WJU A;  3AE8 B;  2R61 A;  5FKA C;  4A3O A;  4JPS A;  4N59 A;  1IUE A;  1YOV B;  2DBY A;  2NMQ A;  4BBN F;  5IKC M;  2WXL A;  4PS3 A;  1V81 A;  4WAA A;  3U8Z A;  3IXS A;  3ZRC A;  4PS8 A;  2D10 A;  4XE0 A;  4TUU A;  2LHE A;  1RM6 C;  4ZYS A;  2GBK A;  1L4D B;  1PDX A;  4DDI D;  1SB3 C;  3U30 A;  4FN2 A;  3PRP B;  3BYT B;  1JRP A;  2ZVN A;  1FXA A;  4USA A;  1IBX B;  1JCK B;  4C4V B;  2QMT A;  4HXD A;  4GDL B;  4AS1 A;  2JXT A;  3PZ7 A;  2XBB C;  1FFV A;  3IAS 1;  1Y8R C;  3PLV A;  4W9E A;  3KLS X;  4BZA A;  2K6Q A;  1XQQ A;  2K0P A;  2QEJ C;  2WXP A;  4L1B A;  1WI0 A;  1PUT A;  3DDC B;  2QIL A;  4IG7 B;  3FIL B;  3Q3M C;  4IKG A;  3BK2 A;  2FID A;  1ZGU B;  3SEB A;  4MGK E;  1UBI A;  5D94 A;  1IP9 A;  1IBX A;  1R4N I;  1WXA A;  2LJ5 A;  4KZC A;  4C4V A;  3RMK C;  3QQ8 B;  1KM7 A;  1T0Y A;  1XEE A;  2NBU A;  4GDL A;  1PGA A;  3UQB A;  3DBH B;  3UI3 A;  4LNI A;  4IWP A;  1FNV A;  1WGY A;  1LXD A;  1XLP A;  2FCN A;  2KX3 A;  5BMI A;  4F1S A;  2M8S A;  3DBR B;  1RFA A;  4K1R B;  1TS3 A;  4HPL B;  5DPT A;  4HCN B;  2JPH A;  1L6V A;  2L1A A;  5H8Y E;  5LXH A;  3DBH I;  5EDS A;  1V80 A;  1CQV A;  3U7Z A;  1XLQ A;  4FJY A;  2AQ3 B;  4B95 A;  1P1A A;  3FIL A;  1JQ4 A;  4C00 A;  3R2I A;  3IT4 B;  1M94 A;  4GB9 A;  4A9A A;  1YJJ A;  4DHJ D;  3HRD D;  3ZDT A;  3S2A A;  4OVZ A;  1WR1 A;  1NI2 A;  4JX1 C;  3IG3 A;  2KFK B;  3Q8C A;  1GPX A;  3KW5 B;  1C3T A;  1VJK A;  4A55 A;  2K5P A;  2ICI A;  2RPV A;  2WDV B;  3Q3F A;  2GMI C;  3L08 A;  3ZDM C;  2E3T A;  2LHD A;  2L83 A;  2L0F A;  1V49 A;  3KUC B;  3A4S C;  4N6E B;  2G3Q B;  2PEA A;  4JE3 B;  1T0Q C;  4IM0 A;  2KDF B;  2D3G A;  4M02 A;  2KWD A;  2J42 A;  2AL6 A;  3AE9 B;  4B6W A;  3AUL A;  1G6J A;  4TKN A;  4ANV A;  1JW9 D;  3N32 A;  1WJ6 A;  3EFU A;  3N9Y C;  2KFK A;  2M0A A;  5D7G A;  4CHK A;  3D32 A;  4BOZ B;  4ZRJ A;  1I4X A;  2LWP A;  4G11 A;  1DOX A;  4IOI E;  3SFE B;  2JRH A;  2N1V A;  2G4D B;  1JAL A;  3OG5 A;  1E5W A;  3DPD A;  2REX A;  2IZV B;  3IBE A;  1I4Q A;  2WNM A;  2CR5 A;  5FR3 A;  3AEF B;  5AEK B;  1K53 A;  3ZIM A;  4WJN A;  4ZYN A;  1F0Z A;  3MFG A;  3DCG A;  2AEH A;  1XT9 B;  2ZNV B;  2D11 A;  3SR6 A;  1C77 A;  5JH5 C;  2LRW A;  3Q3J A;  1WXV A;  1NYQ A;  1E0Z A;  3NVW A;  5G2N A;  1Z2M A;  3N1Z C;  5DPW A;  2V3S A;  4HRS A;  4KDI C;  4PS7 A;  2JU6 X;  5JXV A;  2IGG A;  1M4V A;  2K25 A;  1N62 A;  3X0W A;  2KO3 A;  4IWO A;  3SU8 X;  3WAO A;  4B0E A;  3DHH C;  1YQ3 B;  1FRD A;  1LQB A;  4IUM B;  4AJY B;  5IP4 D;  3V62 A;  1YJ1 A;  2D3C A;  3ZTC A;  1E7U A;  3M63 B;  4JQW C;  5AUI A;  2DZK A;  5AZF A;  3W9C B;  1K52 A;  5CHF A;  2GLS A;  2QSD A;  3L54 A;  3ZTD A;  2EKE C;  2MLB A;  2GBM A;  1LM8 B;  1MVK A;  2C7N B;  4LNO A;  1S1Q B;  3P2B A;  3R2T A;  3JSV B;  3ZKJ C;  2LGD A;  2OHF A;  3GP7 A;  4MEL A;  4WWM A;  3ONS A;  3T9L A;  2FCM A;  1KRH A;  4NJ6 A;  2BKR B;  2WWZ A;  3PRE A;  2LVP A;  4KZ0 A;  3UF8 A;  4NJ7 A;  3AE4 B;  4BKS D;  4DXA B;  3AE7 B;  5G5H A;  1WY8 A;  4NY0 A;  1HTQ A;  1EUV B;  4IWQ A;  4FLH A;  3VRB B;  3U7D A;  2ZW1 A;  1H4R A;  2BVC A;  4KIK B;  3ABV B;  3JSV A;  1VZ6 A;  1FM0 D;  4URK A;  2MJD A;  3NS8 A;  3MJW A;  5FR6 A;  5IN7 A;  4M00 A;  4BAX A;  3I63 C;  2NBV B;  3AEE B;  1V8C A;  3APF A;  2WU5 B;  4MH0 E;  1UWM A;  3B2G A;  3EEC A;  2KXJ A;  4O1N A;  4EZK A;  2MX2 A;  3L13 A;  2KN4 A;  1E7V A;  2C60 A;  4A90 A;  5AZH A;  3VFK A;  2XN9 C;  2KWU B;  3PO0 A;  4DK5 A;  1MFW A;  4HKZ E;  4DHZ E;  2IO3 B;  1ZDX A;  4TV3 A;  2BS3 B;  4LJP B;  2D5G A;  4A20 A;  2J52 A;  3N20 C;  3DBS A;  2HJ1 A;  5JHA A;  1OTR B;  5CTR C;  4DXG A;  2ZPY A;  3TUO A;  2KLG A;  2JXX A;  4LNF A;  2MP2 B;  1WSP A;  2L7R A;  4K3C A;  2JRI B;  4AOF A;  2JYE A;  5TSS A;  4WAF A;  4DHJ B;  1BT0 A;  1QLB B;  4DBG A;  1MPE A;  3Q6B A;  3VDZ A;  3TEY A;  2BWE S;  1C76 A;  4AJW A;  3P4Q B;  3VTV A;  2KD0 A;  3ZGZ A;  3ZJU A;  3RNC C;  3APC A;  1WYW B;  4W9G A;  3IVF A;  1CJE A;  2NVU I;  2OJW A;  1TKE A;  2KQ4 X;  1XLO A;  3DQV A;  1HZ6 A;  3P4P B;  4ARC A;  1YN3 A;  3K9O B;  3R3M A;  2RSU A;  2JVC A;  1PYW D;  3ZO5 B;  2NPT B;  2WDR B;  2MP2 A;  2BB5 A;  3W1S A;  3FC4 A;  2J0M A;  1MG8 A;  1T0S C;  2LZ6 A;  4ZHO A;  4FA6 A;  3SFD B;  4UDU C;  3UIP B;  3LDZ E;  2PE9 A;  2NTS A;  3EGR A;  2KJH B;  4EFO A;  2NCN A;  3N3K B;  3AE5 B;  3NVZ A;  4ZOH C;  4E3C A;  4YWG G;  3U2S C;  5J18 A;  3B0A A;  1ZE3 D;  3AEC B;  3X23 A;  5CX3 A;  4HLE A;  2LFI A;  2V4L A;  2KAC A;  2V1Y A;  2NPT A;  3GOE A;  3KQ4 A;  4W9J A;  1JWA D;  4MM3 B;  4A3P A;  2MJE A;  2BGF A;  1XO3 A;  3O13 A;  1WJ4 A;  4MEM A;  3HIZ A;  2G1E A;  1OQR A;  1ZXH A;  1GUA B;  2GI9 A;  3KYC D;  5E6O A;  4XDC A;  4NAW A;  1JWU D;  1J7A A;  4I6N B;  2V9H A;  4JIO U;  2KTR B;  1KOT A;  3ZNI D;  1HZ5 A;  2IY0 B;  3ZJT A;  2WXR A;  3NS1 A;  5IA7 A;  2KK8 A;  1TY0 A;  1C4P A;  3U52 E;  3TBL D;  1L7Y A;  2BS4 B;  4US9 A;  1OEY J;  1RRB A;  3AV8 A;  4FAD A;  1WR6 E;  1XCT L;  2BF8 B;  3NVY A;  4MM3 A;  3MHZ A;  2I1J A;  3UIO B;  2LMC A;  1UZX B;  4EKU A;  3MJ5 A;  1HEZ E;  1QOF A;  1YQB A;  1KH0 A;  1V9J A;  2FE8 A;  1J7B A;  1WMH B;  2WXH A;  1OGW A;  3AB5 A;  1V2Y A;  1I4H A;  4WJO A;  2KAN A;  4A8X C;  2PE6 B;  1WGR A;  3V05 A;  1WGK A;  3CWI A;  1I35 A;  2JZP A;  3LJ3 A;  3PHW B;  1QQR A;  3J9C A;  1WZ0 A;  5I4D A;  3RZW C;  2YLM A;  3NRZ A;  1NYR A;  2RDB C;  4XDD A;  3WAP A;  2INN E;  4MJS A;  4AP4 C;  2RDH A;  1WMH A;  2PVO D;  4MGY E;  2BT6 A;  2SEB D;  3H6N A;  1QOG A;  4HKQ A;  4FJZ A;  5C1Z A;  3VTU A;  1FMA D;  2IPK D;  3M62 B;  5EE9 A;  2LXC A;  4RGN A;  4I6P A;  4NJC A;  2C9W B;  2D2Q A;  3QCA A;  2VH1 A;  4S17 A;  2K22 A;  3SDL C;  3AM9 A;  3ZRF A;  3N1X C;  5C2T B;  3AE3 B;  1SJH D;  4ACF A;  2W54 A;  4G3X B;  1IGD A;  2C7M B;  1J7C A;  1YX5 B;  2MHJ A;  2FUH B;  4P1C C;  3RCZ A;  1MHH E;  4GDK B;  1KLG D;  2QHO A;  3ZLZ A;  4BKS A;  4WUR A;  3FKY A;  2NR2 A;  1X1M A;  3Q14 C;  3A4R A;  2D3A A;  1R4N B;  2KWC A;  1VR9 A;  2BKF A;  1SEB D;  4AUQ C;  2PLP A;  2JYT A;  5LLI A;  1JRO A;  5D3I B;  5KHO A;  3H7S A;  3R7R A;  2A5U A;  3AI5 A;  5BO4 B;  1QOA A;  5FK9 C;  3WA0 A;  4FUL A;  1FFU A;  1JWS D;  4MH8 A;  3KWL A;  2WXO A;  1U4A A;  2QDF A;  2XEW A;  2I38 A;  2IO1 B;  4M8N A;  2LRU A;  1GB4 A;  3T8M A;  5TR5 A;  5LNK 1;  4LNK A;  2IO0 B;  2O6V B;  3BYY B;  1FCC C;  2W55 A;  2DZJ A;  3N30 A;  2Z59 B;  4EZJ A;  3OWE B;  3RNA C;  2KC2 A;  2YEP B;  2MCN B;  1WXS A;  1LO5 D;  1EF5 A;  3RUL A;  3TMP B;  3JVZ X;  3DBL I;  4II3 B;  3DVN V;  3NJT A;  2YVC A;  3VR8 B;  3V60 A;  1WZ3 A;  1R7S A;  4C7Z A;  1FPY A;  5IO9 A;  2BYV E;  1KTK A;  1PGX A;  3CSF A;  2N0S B;  1FNU A;  2O6V A;  2DYO A;  4OZC A;  2MBE A;  2VZK B;  3AEA B;  1GJZ A;  1CK1 A;  2KDB A;  4IC7 B;  2CJN A;  4BOS C;  3L17 A;  1SJE D;  3GZN I;  1WM3 A;  2N9X A;  1TY2 A;  3BVZ A;  3RYT A;  2HTM E;  2JX5 A;  2LGS A;  5D2M B;  3URY A;  4TSS A;  2IGH A;  4OW0 A;  2DZI A;  2MSE D;  3ZVV A;  1UNS A;  1GOZ A;  2FCQ A;  1I7H A;  1WM2 A;  1EU3 A;  2KYW A;  2BWF A;  4ZRK A;  2K8H A;  1WGD A;  3R7Q A;  1L6U A;  2KX0 A;  1N61 A;  2BS2 B;  5HFY A;  3V61 A;  3DWM A;  2IO2 B;  1TS2 A;  2KT7 A;  1BXT A;  1BML C;  2KDM A;  4HK2 A;  2JWZ A;  3VR9 B;  2KOX A;  1AYF A;  3Q8E A;  3CF6 E;  2WDQ B;  4MGI E;  2LGY A;  5IOI A;  1DYQ A;  2QIE B;  2KTF A;  2GRI A;  5D3D A;  3W5V B;  2DLB A;  4FHJ A;  3HM3 A;  4B0M A;  1PFD A;  2BBC A;  3BWU D;  5AUK A;  2V3P A;  1N63 A;  4LNN A;  3DWG C;  4KSK C;  4JLC A;  3TL5 A;  2WXG A;  3PRZ A;  3JYU A;  1E6E B;  1JRU A;  1JWB D;  3OLM D;  2N9P C;  1FNW A;  3H7P B;  2BB6 A;  4ZRI A;  3Q3N C;  1KJT A;  2K6D B;  3TCA A;  3BVG A;  3HHM A;  3KYD D;  2MQJ A;  1SGH A;  3WAM A;  4H2A A;  3H1U A;  1NBF C;  2PTL A;  5MPO A;  1NVI D;  3B1L X;  1YJI A;  4ITK A;  3GE8 C;  2Y3A A;  3NZ3 A;  2K8B A;  2VRR B;  3PV1 A;  1VD2 A;  1E10 A;  4GN1 A;  4ANW A;  3AN1 A;  5G5G A;  3RD2 A;  3RI7 C;  2K39 A;  2IBI B;  2GBJ A;  3OAW A;  3E56 A;  1OFF A;  2HDE A;  3RPF C;  3ENE A;  4PYU A;  2CS4 A;  3H7P A;  1ISN A;  4KX6 B;  1V86 A;  4YTN B;  4F8C B;  5J17 A;  1SBB B;  4FBJ B;  4C56 C;  1ZP0 B;  4W9K A;  1WE6 A;  3RNE C;  3H8H A;  1WYG A;  1WX8 A;  3RT3 B;  3KH0 A;  1ZXI A;  3APD A;  1UWX A;  3A1Q B;  3EHV A;  3SHQ A;  3SD5 A;  1T0R C;  1NI3 A;  5E6P A;  3T3O A;  3VHT C;  3HK0 A;  1P0R A;  1QZE A;  1ENF A;  3V6C B;  1S3S G;  1E8X A;  3GS2 A;  3OJ3 A;  1V1P B;  2I2Y A;  1QKZ A;  1YNT E;  4GLS C;  3VH3 B;  1IGC A;  3I57 A;  1DGJ A;  4BVU C;  4W9I A;  1Q0W B;  2J0K A;  1WGG A;  4ANX A;  1TIF A;  2ZZP B;  1TT5 B;  3MP9 A;  4XWT A;  3KVF B;  3BY4 B;  5HKH A;  2Y5P A;  4P16 A;  3B08 A;  3AU5 A;  1KLU D;  4MSM B;  3ZNH B;  5C23 A;  2KC1 A;  1UBQ A;  2LGI A;  1OQY A;  2HE7 A;  4K7W A;  4E74 A;  4KGS A;  4F7Z A;  3AH7 A;  2MRP A;  2G45 B;  3MC9 A;  2WXN A;  4KIK A;  2L05 A;  4KGR A;  1V1P A;  3TEZ A;  4DQO C;  2WS3 B;  1HTO A;  1N6Z A;  4EOY A;  2B76 B;  1KLV A;  1WXQ A;  4BKT A;  3RFZ B;  3WCQ A;  2J7Q B;  1TBE A;  1TZO A;  1NEN B;  2DHZ A;  4LK0 M;  3VH4 B;  1JWM D;  4ARI A;  2WXI A;  1VZ7 A;  1SSN A;  2K3U A;  3QHT A;  1R4M I;  2HTH A;  2KHW B;  2PW9 A;  3ZQ4 A;  1L5P A;  3ZJV A;  3RNG C;  3ZXR A;  1P3Q U;  2CU1 A;  3P1M A;  2O6V D;  1HA5 A;  4HPP A;  3C0R B;  1QT9 A;  4IDI A;  1I4R A;  2GBN A;  4KV2 A;  1C4A A;  2JY6 A;  5D6J B;  4GSW A;  4YXD B;  3HM6 X;  5GXG B;  4HCP B;  4XYC A;  3UQA A;  2FNJ B;  1RLF A;  2ASQ A;  2ZVO A;  4WH4 A;  2ACZ B;  2V4I B;  2MEK A;  2J4X A;  1XCQ L;  1FCL A;  2EMT A;  1N5X A;  4I6L B;  3RN9 C;  3ETR A;  2DX5 B;  4WJP A;  2MW5 A;  3PZ8 A;  1T5X D;  4EUT A;  2H88 B;  4KVG B;  1XXG A;  2IND C;  2LI5 A;  3KWV A;  4AQ7 A;  3MTN B;  3I9V 1;  2DYB A;  2VZK D;  1WFY A;  4JL9 A;  4AWJ A;  2KAJ A;  2OOB B;  3T3N A;  3Q8A A;  1TYG B;  1ESF A;  4YSY B;  2Z0E B;  4HRO A;  4JWU C;  1VRA B;  2WXM A;  3NZS A;  2RMM A;  3A9J B;  4FXC A;  3CIR B;  1VLB A;  2BYE A;  3KUD B;  4WWP A;  1ZUD 2;  3VVW B;  1N60 A;  2CU3 A;  3AEB B;  1EWY C;  2MH7 A;  3PTF C;  1WF9 A;  4TQ1 A;  4KDL B;  1K8R B;  2RGF A;  2J53 A;  3Q8F A;  3QIJ A;  5E6N A;  2N4F A;  3VUY A;  2D3B A;  4PYZ A;  2BTE A;  1YN4 A;  3VAW A;  2WXK A;  4OVV A;  4ANU A;  4G50 A;  4WWO A;  4R3D A;  4NZL B;  2KDE B;  1B1Z A;  1XLN A;  2D07 B;  1DOI A;  2Y5C A;  4HVB A;  4US8 A;  5BMG A;  2H89 B;  4FJV B;  2N7D A;  3A9J A;  3ECI A;  3L0W B;  4RM8 A;  5GMV A;  4DWF A;  1WX7 A;  4HEA 1;  2IGD A;  3TEX A;  2OED A;  3B2F A;  2EEL A;  3O65 B;  4RGT A;  1C9F A;  3PHX B;  1D3Z A;  2WGS A;  3ALB A;  3TJP A;  4HJK A;  2GOW A;  4KKJ A;  2LUM A;  4RGO S;  4KKI A;  1J19 A;  3MC8 A;  4NNJ B;  1K50 A;  2KMC A;  4G0N B;  3PZD A;  2BYT A;  2Q5W D;  3TIX A;  3Q3O C;  2DNF A;  2KTR A;  1OQQ A;  2AQ2 B;  4CYE A;  4NQK E;  4RF1 A;  1E8Y A;  3LYY A;  5T8I A;  4KGT A;  2NBW B;  1L0Y B;  1IYF A;  4WJQ A;  2M0X A;  2AWT A;  2PJH A;  3AE6 B;  1D5M C;  4YT0 B;  2JQR B;  4E71 A;  2LEK A;  2X38 A;  4N58 A;  1E8Z A;  3P63 A;  5DPR A;  2XNA C;  2JZ3 B;  3JW0 X;  5BYR A;  3PLU A;  5IAA C;  1K51 A;  3RNB C;  2KJR A;  2V3N A;  4YSX B;  1XF5 L;  2KVR A;  2WP9 B;  4BFR A;  2AQ1 B;  2OJR A;  3PGE A;  1E8W A;  2RDG A;  3NUH B;  3NVV A;  3QAQ A;  3TEW A;  1VCB A;  2YEP F;  4NAM A;  2MBO A;  3AE1 B;  4YL8 A;  2WHI A;  4PK1 A;  2CJO A;  3P4R B;  4WQM A;  3QA8 A;  2WLB A;  3I3T B;  1RFK A;  5JHB A;  1D6E C;  4EEW A;  4ZRQ A;  2FAZ A;  3HUI A;  2W3R A;  3NHE B;  3NZU A;  2CHZ A;  1ZKH A;  4ZDV A;  2AL3 A;  2IDY A;  4BBN C;  4RM9 A;  2B3A A;  4ZHP A;  2DAF A;  1Q10 A;  3CMM B;  2KN5 A;  4RNA A;  2PKO A;  2MBQ A;  2LJI A;  4LCD E;  1WGH A;  2PPH A;  1C1Y B;  3NOB A;  1BUI C;  2K9X A;  1T6B X;  1GAQ B;  2FUG 1;  2LVQ A;  4J3O D;  2IYD B;  3QK0 A;  3QAR A;  4LTU A;  1AW7 A;  1NDD A;  2BYF A;  4RGM A;  4XWW A;  2PIA A;  2M19 A;  4GDK A;  2FCS A;  4XX5 A;  2DEN B;  3QJZ A;  4C7Y A;  2R2O A;  5BMH A;  1Y56 A;  3FAH A;  3KUZ A;  2V0G A;  1TGZ B;  3W5U B;  2INP E;  3L10 B;  3LXF A;  1ZW7 A;  1AWD A;  3UGB B;  1ZOY B;  2BW2 A;  2KQS A;  2RR9 A;  3IFW B;  4EZL A;  3VUX A;  3GE3 C;  1EU4 A;  4K7S A;  1V5T A;  4RH6 A;  2L8J A;  3DBL B;  1B9R A;  1F77 A;  3ML9 A;  2W9N A;  3PSE B;  4GMV A;  3EUB 2;  2JWU A;  2EMS A;  4IM2 A;  3M95 A;  3VQI A;  1SF0 A;  3DBR I;  2ZCC A;  1WRI A;  2KDI A;  2BQQ A;  2KMM A;  2J0J A;  4HWI B;  1TKY A;  1N5W A;  5LXI B;  4YTP B;  2MJ3 A;  3GZN B;  4GGQ A;  4JWS C;  1SXT A;  1SE3 A;  4J6I A;  1TS4 A;  1UUP A;  5J2R A;  2NTT A;  3W2D A;  3WAN A;  1HXY D;  1YX6 B;  2GB1 A;  3WAL A;  2CKH B;  1GNU A;  3DVG Y;  4K3B A;  1HQR D;  1L0X B;  1SIJ A;  2SAK A;  1UGM A;  1TTN A;  3Q8B A;  5DCN A;  3UIN B;  2JF5 A;  2WX0 A;  1SE9 A;  3B9J A;  2KFJ A;  5H92 C;  4L23 A;  4BKG A;  4HDO A;  2ZNV C;  2ZW0 A;  3AMZ A;  4ICV A;  3BIN A;  4MSQ B;  4LDT B;  2M1M A;  2QJL A;  3AEG B;  3DVG X;  1RYJ A;  1D4B A;  2VH2 A;  1AN8 A;  2LAS A;  4YSZ B;  3GB1 A;  3H9D A;  4X57 B;  1E9M A;  3W1Y A;  1J0G A;  1TZ1 A;  1WJN A;  3MHS D;  4OZB A;  4D2K A;  4ZRP A;  2N7J A;  1FXT B;  2WDT B;  3V3X A;  3DVN U;  2WXJ A;  3C8Y A;  2Z8L A;  1YN5 A;  4KSL C;  4M8M A;  3DHI C;  1WXM A;  1EF1 A;  4EE2 A;  3CST A;  4GOC A;  2M17 A;  2DAJ A;  2L52 A;  2ZJD A;  1EM7 A;  4HDQ A;  3RZF A;  1LFD A;  2KWV B;  3RUI B;  1ET6 A;  1I4G A;  3BK1 A;  4GIV A;  3IAM 1;  3A9K B;  4MGZ E;  1ACC A;  4W9H A;  2MBB B;  2ZPN A;  1V1O A;  3HVZ A;  4RF0 A;  2L00 B;  4RCO A;  5HG2 A;  2L3Z A;  2A4Z A;  1YD8 U;  3PS6 A;  3PT2 B;  1UD7 A;  4P7I A;  5C3J B;  2KJ6 A;  1QF6 A;  4CQN A;  4WIP A;  2PMV A;  1J8C A;  1P98 A;  4GXB A;  2K1F A;  3V6E B;  4ICU A;  1TKG A;  2N9E B;  5CHV C;  3VTW A;  1AAR A;  1F9J A;  4M0W B;  2RD0 A;  4DHZ B;  2KVZ A;  2XK5 B;  4OZA A;  5HHD G;  2PVG C;  3A9K A;  2BPS A;  2RPQ A;  1UGJ A;  5DPS A;  5CHW A;  1L0V B;  2LUE A;  3Q2A C;  2UU7 A;  4DXF A;  5KHQ A;  2QC8 A;  2WXQ A;  3QC8 B;  1YIW A;  5L95 C;  2WYQ A;  3ZXV A;  2HD5 B;  1CMX B;  4QAY A;  4FHK A;  4L2Y A;  1I42 A;  1F1H A;  4K7U A;  2M4N A;  3VUW A;  4W9C A;  2N7E A;  2IY1 B;  1RAX A;  3OJ4 B;  2FIF A;  4B9K A;  3LB8 C;  3AE2 B;  4M0W A;  3L4P A;  1WX9 A;  3L16 A;  3EFC A;  1EO6 A;  1I4P A;  3R66 C;  2XK5 A;  1D5Z C;  1FD6 A;  1L4Z B;  3A33 B;  1JML A;  4W9D A;  1GB1 A;  1FO4 A;  3EC8 A;  3TSS A;  1V5O A;  1WIA A;  4HJG E;  2W3S A;  3A1Q A;  2N9K A;  4IM3 A;  1UH6 A;  1VZ8 A;  2L76 A;  4P1B C;  1UEL A;  1ZPS A;  3E9S A;  1H8C A;  2MBH A;  3IHP C;  1FIQ A;  5EE3 A;  1P9D U;  3ZNZ B;  3I5J C;  2KLC A;  2LXA A; 
#chains in the Genus database with same CATH homology
 4US8 A;  1VR9 A;  1F0Z A;  1QOB A;  5BMG A;  1STE A;  2H89 B;  3MFG A;  1SEB D;  2PLP A;  2JYT A;  3EA6 A;  3SR6 A;  1C77 A;  1JRO A;  5D3I B;  2DWQ A;  4HEA 1;  2IGD A;  1QOA A;  5FK9 C;  3TEX A;  2OED A;  3B2F A;  2EEL A;  1NYQ A;  4RGT A;  1SE4 A;  1C9F A;  1E0Z A;  3NVW A;  4Q2J A;  4TQ0 A;  1FFU A;  1JWS D;  3IT6 B;  3BII D;  4MH8 A;  3KWL A;  4HRS A;  2WU2 B;  2WXO A;  2I38 A;  3BZD B;  3P4S B;  2JU6 X;  5JXV A;  2IGG A;  1M4V A;  4KKJ A;  2LUM A;  1N62 A;  4KKI A;  4RGO S;  5EE0 A;  1P7E A;  2W82 A;  2DYM A;  1K50 A;  1GB4 A;  4B0E A;  1YQ3 B;  1FRD A;  1KF6 B;  5LNK 1;  2BYT A;  2Q5W D;  3BYY B;  1C4C A;  1FCC C;  1OQQ A;  2AQ2 B;  2W55 A;  1T3Q A;  2ONQ A;  3MC0 B;  4RF1 A;  1P7F A;  1E7P B;  3LYY A;  3OWE B;  5T8I A;  4KGT A;  4A6Q A;  4MAC A;  5AUI A;  1L0Y B;  2YEP B;  1SE2 A;  3W9C B;  1LO5 D;  1K52 A;  1PGB A;  3U4E G;  2TSS A;  3AE6 B;  2QSD A;  5HI1 A;  1D5M C;  4YT0 B;  2JQR B;  2LEK A;  1WWT A;  2L32 A;  2X38 A;  3P42 A;  4N58 A;  3Q69 A;  1MVK A;  3VR8 B;  1A70 A;  3P63 A;  1YMH E;  2XNA C;  1R7S A;  3R2T A;  4C7Z A;  1KTK A;  2ON8 A;  1PGX A;  5BYR A;  2OHF A;  3GP7 A;  2N0S B;  2EKI A;  1FNU A;  4WWM A;  1K51 A;  1KRH A;  2DYO A;  4OZC A;  4RFB A;  2G9H D;  4OHJ A;  1ZDV A;  2V3N A;  4YSX B;  2VZK B;  3AEA B;  1XF5 L;  1CK1 A;  2WP9 B;  1VDV A;  1C78 A;  2CJN A;  4TMA B;  3R8B A;  1SJE D;  3AE4 B;  2AQ1 B;  3VRA B;  3BVZ A;  1TY2 A;  3AE7 B;  5G5H A;  2RDG A;  3NUH B;  3NVV A;  2HTM E;  2JX5 A;  1MI0 A;  3TEW A;  3URY A;  4TSS A;  2IGH A;  4OW0 A;  2YEP F;  4NAM A;  1UNS A;  2E6X A;  3VRB B;  1GOZ A;  2M56 B;  1I7H A;  3AE1 B;  1EU3 A;  2CJO A;  3P4R B;  2ZW1 A;  4WQM A;  4NAW B;  2WLB A;  3ZYY X;  1TJE A;  1RFK A;  4MT5 A;  1D6E C;  1L6U A;  3ABV B;  4ZRQ A;  1N61 A;  3HUI A;  2W3R A;  2BS2 B;  1VZ6 A;  5HFY A;  5BYQ A;  1FM0 D;  3DWM A;  1TS2 A;  2MJD A;  1BXT A;  1BML C;  2KDM A;  2IDY A;  3VR9 B;  1F2R C;  3AEE B;  1AYF A;  1V8C A;  3Q8E A;  4ZHP A;  1Q10 A;  2JSV X;  2WU5 B;  4RNA A;  1UWM A;  2PKO A;  3B2G A;  2LJI A;  1CZP A;  2WDQ B;  2IJ0 A;  4O1N A;  1C79 A;  5BYS A;  1BUI C;  2K9X A;  1DYQ A;  2KN4 A;  2QIE B;  1T6B X;  1GAQ B;  2FUG 1;  1EWC A;  2GRI A;  1RWS A;  4J3O D;  5D3D A;  3W5V B;  4LTU A;  4YTM B;  4A90 A;  1QIL A;  2DLB A;  1AW7 A;  4B0M A;  1PFD A;  2BBC A;  3BWU D;  4RGM A;  2XN9 C;  5AUK A;  4XWW A;  2PIA A;  3PO0 A;  5E6J A;  4REZ A;  2M19 A;  2V3P A;  1N63 A;  3DWG C;  4PT5 A;  1FXI A;  4HKZ E;  1DOY A;  2WXG A;  2N9L A;  1ZDX A;  2BS3 B;  4C80 A;  1E6E B;  1D5X C;  4C7Y A;  2D5G A;  5BMH A;  3HVD A;  1TS5 A;  1V97 A;  1JWB D;  2J52 A;  1Y56 A;  3FAH A;  2V0G A;  1FNW A;  3W5U B;  2INP E;  3LXF A;  3BVM A;  2BB6 A;  4DXG A;  1AWD A;  2WXF A;  1ROE A;  3TUO A;  1ZOY B;  3BVG A;  2BW2 A;  1MHX A;  1EU4 A;  1WSP A;  4H2A A;  1ET9 A;  1FEH A;  1FRR A;  4RH6 A;  2PTL A;  2JYE A;  1NVI D;  5MPO A;  1F77 A;  1B9R A;  4P6V F;  1F2R I;  1NEK B;  5TSS A;  4WAF A;  5EE1 A;  1QLB B;  1YJI A;  1MPE A;  3AED B;  4ITK A;  2Y3A A;  4LLG M;  3EUB 2;  3TEY A;  1KFY B;  2JWU A;  3NZ3 A;  3VQI A;  1C76 A;  1SF0 A;  1E10 A;  1WRI A;  3P4Q B;  2FBW B;  3ZGZ A;  2AX5 A;  1YQ4 B;  3ZJU A;  3AN1 A;  2KMM A;  5G5G A;  2WQY B;  1TKY A;  1N5W A;  3E56 A;  3AE8 B;  2HDE A;  1OFF A;  4YTP B;  2R61 A;  3RPF C;  1CJE A;  5FKA C;  1TKE A;  2KQ4 X;  2MJ3 A;  4JPS A;  1XLO A;  4N59 A;  1HZ6 A;  3P4P B;  4JWS C;  4ARC A;  1IUE A;  1SE3 A;  1SXT A;  1YN3 A;  1TS4 A;  1PYW D;  1UUP A;  2DBY A;  2NMQ A;  4KX6 B;  2WDR B;  2NTT A;  3W2D A;  1HXY D;  4YTN B;  2BB5 A;  3W1S A;  1SBB B;  2GB1 A;  2WXL A;  3FC4 A;  4C56 C;  1ZP0 B;  1HQR D;  1L0X B;  3H8H A;  1WYG A;  3IXS A;  4ZHO A;  4XE0 A;  1SIJ A;  3SFD B;  4UDU C;  2SAK A;  3Q8B A;  1ZXI A;  2LHE A;  1UWX A;  1RM6 C;  4ZYS A;  2NTS A;  3EGR A;  1L4D B;  1PDX A;  1SB3 C;  3B9J A;  5H92 C;  4L23 A;  1NI3 A;  3T3O A;  3AE5 B;  3BYT B;  1ENF A;  1JRP A;  3NVZ A;  4ZOH C;  3GS2 A;  2ZW0 A;  2I2Y A;  1V1P B;  3AMZ A;  4YWG G;  3U2S C;  1QKZ A;  1ZE3 D;  1FXA A;  1YNT E;  4GLS C;  1IGC A;  3AEC B;  3I57 A;  1DGJ A;  2LFI A;  4USA A;  2QJL A;  3AEG B;  1RYJ A;  1D4B A;  1JCK B;  2KAC A;  1IBX B;  1AN8 A;  2QMT A;  3KQ4 A;  4AS1 A;  4GDL B;  3MP9 A;  2JXT A;  3PZ7 A;  4XWT A;  1JWA D;  4MM3 B;  4YSZ B;  1FFV A;  3GB1 A;  3IAS 1;  2MJE A;  2Y5P A;  1E9M A;  1XO3 A;  3O13 A;  3KLS X;  4P16 A;  4OZB A;  4D2K A;  1KLU D;  4ZRP A;  2G1E A;  2K0P A;  2QEJ C;  2WXP A;  2N7J A;  1OQR A;  1ZXH A;  2LGI A;  2GI9 A;  4L1B A;  3V3X A;  2WXJ A;  1PUT A;  4KGS A;  3C8Y A;  3AH7 A;  2Z8L A;  1YN5 A;  2QIL A;  4XDC A;  1JWU D;  1J7A A;  2WXN A;  4EE2 A;  3FIL B;  4KGR A;  4IKG A;  3BK2 A;  1V1P A;  3TEZ A;  1HZ5 A;  4DQO C;  3SEB A;  3ZJT A;  2WXR A;  3NS1 A;  2L52 A;  1EM7 A;  2WS3 B;  1TY0 A;  1C4P A;  2B76 B;  3U52 E;  2BS4 B;  4US9 A;  1IBX A;  1WXQ A;  3RFZ B;  3AV8 A;  3WCQ A;  1TZO A;  1XCT L;  1NEN B;  4LK0 M;  1XEE A;  3NVY A;  1PGA A;  3MHZ A;  1ET6 A;  1JWM D;  4ARI A;  1I4G A;  2LMC A;  3UI3 A;  3MJ5 A;  1HEZ E;  1VZ7 A;  1SSN A;  2K3U A;  1FNV A;  1QOF A;  2WXI A;  3BK1 A;  1KH0 A;  1XLP A;  3IAM 1;  2FE8 A;  2PW9 A;  3ZQ4 A;  1J7B A;  5BMI A;  2WXH A;  1ACC A;  3AB5 A;  1L5P A;  3ZJV A;  1I4H A;  1TS3 A;  4A8X C;  3P1M A;  1L6V A;  1V1O A;  2L1A A;  3HVZ A;  4RF0 A;  5H8Y E;  3V05 A;  1HA5 A;  1WGK A;  3CWI A;  4RCO A;  2JZP A;  1QT9 A;  4IDI A;  5HG2 A;  1CQV A;  1I4R A;  3U7Z A;  1XLQ A;  2AQ3 B;  1QQR A;  1C4A A;  3J9C A;  3FIL A;  1JQ4 A;  4YXD B;  3R2I A;  5I4D A;  3IT4 B;  5C3J B;  1QF6 A;  5GXG B;  4A9A A;  1YJJ A;  4WIP A;  4CQN A;  2PMV A;  3HRD D;  4OVZ A;  3NRZ A;  1NYR A;  1TKG A;  4JX1 C;  4WH4 A;  2ACZ B;  4XDD A;  2V4I B;  2MEK A;  2J4X A;  1XCQ L;  1FCL A;  3Q8C A;  1N5X A;  2INN E;  1GPX A;  3ETR A;  4OZA A;  1VJK A;  2RDH A;  5HHD G;  4A55 A;  2K5P A;  2PVG C;  1UGJ A;  2ICI A;  3PZ8 A;  1T5X D;  1L0V B;  2PVO D;  2H88 B;  2RPV A;  2WDV B;  4DXF A;  1XXG A;  2BT6 A;  2SEB D;  1QOG A;  2E3T A;  4HKQ A;  2LHD A;  2L83 A;  1FMA D;  2WXQ A;  3KWV A;  2IPK D;  4AQ7 A;  3I9V 1;  4N6E B;  4JE3 B;  5EE9 A;  2VZK D;  4L2Y A;  4RGN A;  2KAJ A;  3T3N A;  2KWD A;  3Q8A A;  1TYG B;  4NJC A;  1ESF A;  4YSY B;  2J42 A;  4HRO A;  4JWU C;  1VRA B;  2WXM A;  3AE9 B;  2K22 A;  2RMM A;  4FXC A;  3LB8 C;  3AE2 B;  3AM9 A;  4M0W A;  1JW9 D;  3CIR B;  1VLB A;  3L4P A;  3N9Y C;  5C2T B;  2M0A A;  1SJH D;  3AE3 B;  5D7G A;  2W54 A;  1ZUD 2;  1N60 A;  1I4P A;  2CU3 A;  3AEB B;  1EWY C;  1D5Z C;  2MH7 A;  1IGD A;  1J7C A;  4TQ1 A;  1FD6 A;  1L4Z B;  1I4X A;  1MHH E;  2J53 A;  1GB1 A;  1JML A;  3Q8F A;  4GDK B;  1DOX A;  1FO4 A;  1KLG D;  3TSS A;  4WUR A;  4IOI E;  3SFE B;  2BTE A;  1YN4 A;  4HJG E;  2WXK A;  2W3S A;  1JAL A;  2N9K A;  1VZ8 A;  4R3D A;  4NZL B;  1ZPS A;  3E9S A;  1I4Q A;  2WNM A;  5FR3 A;  1B1Z A;  1FIQ A;  3AEF B;  5EE3 A;  1K53 A;  1XLN A;  1DOI A;  2Y5C A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...