2ASQA

Solution structure of sumo-1 in complex with a sumo-binding motif (sbm)
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
77
structure length
77
Chain Sequence
YIKLKVIGQDSSEIHFKVKMTTHLKKLKESYCQRQGVPMNSLRFLFEGQRIADNHTPKELGMEEEDVIEVYQEQTGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Small Ubiquitin-like Modifier (SUMO) Recognition of a SUMO Binding Motif: A reversal of the bound orientation
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein binding
molecule keywords Small ubiquitin-related modifier 1
total genus 13
structure length 77
sequence length 77
ec nomenclature
pdb deposition date 2005-08-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF11976 Rad60-SLD Ubiquitin-2 like Rad60 SUMO-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 2asqA00
1OGWA 2IO3B 2LASA 2NBVB 1WF9A 2R2QA 2DZKA 1PQSA 1VD2A 2JRHA 3L08A 3ZNHB 3PRZA 4BKSD 2LJ5A 4KDIC 3KUDB 5D7GA 3TL5A 2IO2B 2KDFB 3PVLA 3ZDTA 3SU8X 5HKHA 4IM2A 1HE8A 1Q0WB 1UBQA 4XC2A 1LXDA 4G50A 2ZZPB 4WAAA 4BKTA 4ZRKA 4EZKA 2HE7A 4JIOU 2BWES 3OJ3A 4HPMB 3DVGX 3KYCD 3PSEB 2QHOA 2K6DB 3R7RA 3ML9A 3A9JA 5CHFA 5C23A 1X1MA 2KTRB 2PJHA 4MGYE 2FCSA 2JY6A 2KFJA 4HDOA 3OLMD 4LJPB 4HK2A 2N9PC 2BKFA 2ZPNA 3ZVVA 1Y8RC 2N7DA 1AARA 2MP2B 4EZLA 5CHVC 4HPLB 3B1LX 2D3GA 2LGYA 3AI5A 3LJ3A 4AP4C 3DCGA 2JXXA 4GDKA 4BBNF 2KK8A 4MJSB 4ANXA 2KXJA 2LRUA 2KX0A 3EFUA 3AU5A 3AULA 3T8MA 1RAXA 5LXHA 3K9PB 3W1SA 3GOEA 4MGIE 2WX0A 4E74A 5TR5A 2KC1A 4DDGD 1WX9A 2KNBA 5JHBA 4AOFA 3R7QA 4BVUC 3PHWB 3CMMB 3L54A 1WXMA 4FJYA 4KIKB 4MDKE 4W9KA 2CHXA 2KANA 5JZEB 2AL3A 1UGMA 4NPNA 2D10A 5D6JB 4W9HA 1J8CA 3UINB 3DOWA 4WWPA 2ZVNA 1WMHA 2K6QA 4FHKA 4FLHA 2FCMA 4FBJB 1OQYA 3QX1A 3A9JB 1JRUA 1V49A 4WJNA 4MJSA 1P1AA 1KJTA 4I6PA 4W9GA 4BKSA 2DZIA 1V6EA 1H4RA 3BY4B 4MM3A 3X0WA 3H7SA 3A4SC 3ZRFA 2DHZA 2C7NB 3OAWA 2IBIB 3PV1A 4RM9A 4DHZB 4DHJD 1GUAB 1EO6A 4PYUA 3ECIA 3QC8B 3PHXB 3TCAA 3RD2A 1WE7A 3UF8A 2GBRA 3DVNV 4LCDE 3QIJA 3SHQA 3UQAA 3PREA 1WH3A 4ZYNA 1YX6B 2O2VB 4FJZA 1R4MI 2FAZA 2L3ZA 1UELA 3PRMB 4MH0E 4ANWA 3KVFB 2KN5A 3P2BA 3R66C 2ZCCA 4I6LB 2GBKA 3U7DA 3ZTDA 3QK0A 1E8ZA 2JUOA 1WM3A 2NBWB 2KJ6A 2MBBB 4B9KA 4GDLB 4KZCA 3QWZB 2PPHA 2RSUA 1J19A 2N1VA 2DYMA 4G3XB 4WJPA 3ALBA 3B0AA 5KHOA 5LLIA 2KDIA 5L83A 4HVBA 4GU2A 2LXAA 2BYEA 4DHZE 1GC6A 4MEMA 2KD0A 4MGKE 4RM8A 2RR9A 1NDDA 2Y5BB 2ZCBA 1GC7A 2K1FA 4II2B 5CHWA 5IAAC 5BO4B 2L76A 3PS6A 2BKRB 2LZ6A 4PS8A 4ZRIA 3WALA 3ZUNA 4AJYB 2MBHA 2M0XA 2CHZA 5CTRC 4NAWB 2V3SA 1E5WA 4KVGB 4IWOA 3MTNB 2KWCA 2VRRB 1LM8B 4II3B 2FIDA 2LGXA 3H9DA 4GSWA 4NNJB 2DX5B 4XZ4A 5JH5C 4ZDVA 1YIWA 3A33B 3JSVB 3OJ4B 2MBQA 4HWIB 1V5TA 2FIFA 1RRBA 2Z59B 3PGEA 2ASQA 3APDA 2XBBC 1YJ1A 3NZUA 3HM3A 3V60A 4HCNB 2BPSA 1BT0A 3K9OB 4EEWA 2L0TA 3QHTA 2LGDA 3UIOB 4MELA 4YL8A 4B6WA 3CSTA 1D3ZA 3VTWA 2BYVE 5GMVA 1IPGA 2W9NA 2B3AA 2KJRA 1ZKHA 3AXCA 3WAMA 5DPRA 2IYDB 1EF5A 4G0NB 2J0JA 3WAOA 5DPWA 2JT4B 4F7ZA 3W1SC 2KOXA 2KC2A 3A9KB 1P3QU 2KLCA 2CHWA 3ZDMC 3UQBA 3U30A 3WA0A 2G4DB 1V86A 3AU4A 1C3TA 4TUUA 1TTNA 4WWNA 2L8JA 3H6NA 2LD9A 2LXCA 2EMTA 2ZNVC 4M8NA 4DWFA 1P98A 4BOZB 4LDTD 3TJPA 4E71A 1P0RA 4CO7A 2LRWA 2ZEQA 4DDID 3ZLZA 3VUXA 4TKNA 1S1QB 2M17A 5E6NA 1WM2A 4WJQA 2GBJA 3A1QB 2M8SA 3RYTA 2BGFA 4GB9A 2G3QB 1Z5SB 4K81A 1EF1A 3D32A 4FADA 1MG8A 4IG7B 1SGHA 2MBEA 4PYZA 2XEWA 1WYWB 1V2YA 3DVNU 2JRIB 1RFAA 2FCNA 2Z0EB 3R3MA 2MW5A 2KLGA 3N32A 3RCZA 3L13A 4NY0A 4M0WB 1YD8U 4JGHB 2WDTB 2PEAA 2K39A 4F1SA 1KM7A 3S2AA 3ZO5B 1XD3B 1V9JA 1WZ0A 4LDTB 4EOYA 2DYBA 3Q3JA 4DXAB 3M63B 4TQ0A 2D11A 2REXA 2G4SA 3VXWA 3IHPC 3QQ8B 1WGRA 2KHWB 3M62B 1SIFA 1V5OA 2M4NA 5J2RA 2JF5A 2LUEA 3Q3FA 1WJ4A 3DVGY 2KWVB 4W9DA 4W9FA 4G11A 5CX3A 3L10B 3ONSA 2NBUA 5J18A 2HTHA 5DPSA 2K25A 3ZNID 2ZNVB 2AL6A 2MP2A 2K8BA 2L7RA 2R2OA 4IC7B 1WR1A 3NZSA 2AEHA 2WX1A 2N7EA 2NVUI 5IA7A 2KMAA 2CR5A 3NS8A 3ZIMA 1E7UA 2MRPA 1C1YB 4KSLC 5E6PA 4GOCA 4W9CA 4KZ0A 2NPTA 3TMPB 2J0MA 2A4ZA 1NBFC 2MLBA 2DENB 2M1MA 3JYUA 4FN2A 4NQKE 5AZGA 3RZFA 4BKGA 2KDBA 2PE6B 2L00B 3DBLI 4AWJA 3X23A 3O65B 2KX3A 1GJZA 1V80A 2JVCA 2GMIC 1WX8A 2EMSA 2ZJDA 4FHJA 3PT2B 3VHTC 4KV2A 3TIXA 2L05A 1V81A 2GBNA 2RGFA 2O6VB 1Z2MA 5DCNA 4ASWC 2LVQA 4EZJA 3VFKA 2C9WB 3CSFA 5D94A 5C1ZA 1I42A 4JL9A 3RUIB 3KH0A 3KYDD 2FCQA 4WQOB 2N9EB 4AJWA 1WXAA 1KOTA 2I1JA 4GMVA 1R4NI 2N1WA 2UWQA 1WX7A 3PLUA 4IUMB 4WJOA 3RZWC 3APCA 2A5UA 4K7WA 4HDQA 4ZRJA 2XK5A 5L95C 2MA9B 4FA6A 3VH4B 3WIMA 1NI2A 5G55A 4OVUA 2BF8B 4GXBA 4HLEA 3QARA 4W9LA 2J0KA 3ZW3A 4HXDA 4PS7A 4RMAA 1OTRB 3PTFC 3V6CB 2KFKB 3NY5A 1SE9A 1ISNA 3CF6E 4OVVA 3TBLD 3M3JA 3ZTCA 1FXTB 2IZVB 2FUHB 3EECA 4KDLB 3EC8A 4TQ1A 5FR6A 2LVOA 4CYEA 3B08A 4HCPB 1WJUA 3A4RA 4ICVA 2LWPA 2HD5B 2K8CA 2OOBB 2RPQA 3HM6X 1IYFA 2CS4A 4F8CB 4GN1A 3HHMA 2GBMA 4DBGA 1WE6A 4FULA 3VH3B 2PE9A 1VCBA 4AUQC 3ZNGC 2V4LA 2AYOB 3VAWA 4URKA 1WXSA 2KJHB 3IBEA 2O6VA 5JHAA 4MSMB 3UGBB 2HJ8A 4XX5A 2KDEB 2NPTB 3MHSD 3WANA 1TGZB 4A3PA 1WMHB 1E8YA 1OEYA 1YX5B 2KWUB 3VQIA 2WWZA 2NCNA 1YQBA 2C7MB 2KKCA 3V6EB 3WAPA 2LVPA 3ENEA 1KLVA 2YVCA 4NAWA 3L17A 4KIKA 4EUTA 2D2QA 2XK5B 4NQLB 4B95A 2KQ7A 3JSVA 1U4AA 1XT9B 1LFDA 3A1QA 2Z0DB 2KTFA 4K7SA 3SDLC 3VTVA 4ICUA 2UYZB 2ZVOA 4W9EA 5AZHA 2WYQA 1WIAA 1CMXB 2RD0A 2N4FA 2NR2A 2O2VA 2KFKA 3VTUA 3M95A 1WRDB 3V62A 3KW5B 2KZRA 1UD7A 1UZXB 4DHJB 5EDSA 2MX2A 3N3KB 4NJ6A 1L2NA 3LDZE 1WGGA 1E7VA 1QZEA 2C7HA 4TV3A 3UIPB 2BYFA 3T9LA 2LI5A 1GNUA 2DAJA 4ANUA 4NJ7A 4HJKA 1WJNA 1XQQA 4PS3A 4JQWC 4X57B 2DZMA 1E8XA 2D07B 5E6OA 1RLFA 2IO1B 2KQSA 1K8RB 1WI0A 2IY1B 4A20A 2NS5A 4P7IA 3H7PA 3IFWB 1E90A 5AEKB 4IM3A 3PZDA 2CKHB 3PPAA 4JLCA 1J0GA 2K8HA 3VVWB 5J17A 3HIZA 3RT3B 3DBSA 4DK5A 3ML8A 3IG3A 4IWPA 1IP9A 1P9DU 2IO0B 4EFOA 2J7QB 2MWSB 3KUCB 2DZJA 3W1YA 2O6VD 2C60A 2L0FA 4MSQB 1TBEA 3IVFA 5DPTA 3EHVA 1G6JA 1E8WA 3BINA 2C5LC 2KTRA 1OEYJ 1TZ1A 1A5RA 5KHQA 1WR6E 2G45B 3SD5A 3U8ZA 4CHKA 1I35A 2GOWA 3N30A 2EKEC 4EKUA 3DPDA 3I3TB 2JZ3B 1Q5WB 3DBHI 4FJVB 1L7YA 2FNJB 1T0YA 3VDZA 3VUYA 4BBNC 2MBOA 3A9KA 1F9JA 1WGYA 3KUZA 2V1YA 4BFRA 3H7PB 4GIVA 2N9XA 4KSKC 3APFA 4IW0A 1H8CA 2AWTA 1EUVB 1WFYA 1M94A 4I6NB 5LXIB 1LQBA 1ZW7A 1WGDA 2DYOA 2JZZA 2KO3A 2OJRA 2DAFA 3JW0X 4K7UA 4W9JA 3ZRCA 4E3CA 2CU1A 4ANVA 2I1KA 3VUWA 4K1RB 1WZ3A 2KVRA 3GZNI 4GDLA 2JPHA 1WJ6A 3NHEB 3MJWA 1WXVA 2IY0B 3ZNZB 4N9F4 2JWZA 3NOBA 3L0WB 4J6IA 5D2MB 3QCAA 4W9IA 1Q1OA 1WY8A 1UH6A 3L16A 3JVZX 4WWOA 3H1UA 3DQVA 2MCNB 4M8MA 3PRPB 1ZGUB 4IM0A 4LJOB 1WGHA 1UBIA 3QA8A 4GDKB 3QJZA 4A3OA 2YLMA 2MQJA 5G2NA 3PLVA 5AZFA 2KMCA 3QAQA 2BWFA 3C0RB 4IWQA 4MGZE 1GG3A 3ZKJC 3DBRI 3HK0A 3RULA 4BOSC 3DDCB 2ZPYA 3V61A 1S3SG 2MSED 4GGQA
chains in the Genus database with same CATH superfamily
2L32A 1XLQA 5LNK1 3ZNHB 2RDGA 3PRZA 4BKSD 3KUDB 3TL5A 2KDFB 3AE2B 1WRIA 1L6UA 4XC2A 4G50A 2PLPA 4BKTA 2ACZB 2HE7A 4JIOU 2BWES 4ITKA 1LO5D 4JWUC 5CHFA 4HDOA 4LJPB 4HK2A 2N9PC 2BKFA 2DNFA 2MP2B 2D3GA 2LGYA 1XXGA 1JROA 3DCGA 4MJSB 4ANXA 2KXJA 3AU5A 2PIAA 2CU3A 3AULA 1MG4A 3K9PB 3ZJUA 2KC1A 5JHBA 1V8CA 2PKOA 3PHWB 4MDKE 4W9KA 2CHXA 2N9LA 1UGMA 4NPNA 1XCQL 1KRHA 5D6JB 4L1BA 1OQQA 1XO3A 4FLHA 1P1AA 1ZXIA 1H4RA 3BY4B 3X0WA 1HZ6A 3Q2AC 4RGMA 4M00A 3OAWA 4RM9A 2IBIB 4PYUA 3ECIA 2GBRA 3QIJA 3PO0A 1WH3A 2O2VB 5BYSA 1I4XA 4B0EA 1C4AA 1JWBD 3U7DA 3R66C 2ZCCA 3ZTDA 2GBKA 1C4PA 1FFUA 4RCOA 3CIRB 1BUIC 1UNSA 4O1NA 2N1VA 3R8BA 2I38A 3R2TA 3ALBA 5LLIA 1GPXA 3AE6B 5L83A 1SSNA 4OVZA 1T5XD 4GU2A 2LXAA 1KH0A 1F77A 3BWUD 5IAAC 4II2B 3PS6A 2BKRB 4ZRIA 3ZUNA 2X38A 4MACA 3B2FA 3ZXRA 4KVGB 2V3PA 4IWOA 3MTNB 2KWCA 1LM8B 1WSPA 3H9DA 4GSWA 2WXPA 4NNJB 1OFFA 5JH5C 3AH7A 1V5TA 2FIFA 2Z59B 4M02A 4WH4A 3HM3A 2D3CA 3V60A 4EEWA 2BPSA 2L0TA 3NUHB 2KMMA 2W54A 2AQ3B 5AUKA 4B6WA 3VTWA 2BYVE 5GMVA 4A90A 1VR9A 1FNVA 3V05A 3AXCA 2WXKA 2KT7A 2VH1A 2J0JA 2KOXA 2OJWA 3A9KB 4JE3B 1KLGD 5D3IB 2LD9A 4M8NA 2ZNVC 4BOZB 3T3NA 4BAXA 4XWWA 3NRZA 2QMTA 2QCZA 1WM2A 1IGDA 4USAA 3MJ5A 5JXVA 3Q6BA 3D32A 4FADA 1N5WA 1TT5B 4DXGA 1SGHA 1YMHE 2MBEA 5HHDG 1I7HA 2WXHA 1V2YA 1I4QA 1RFAA 3ZXVA 2FCNA 2Z0EB 1MJDA 3L13A 4NY0A 1L5PA 1YD8U 2PEAA 2K39A 4F1SA 3W5UB 1ET9A 1JWMD 1VZ6A 3ZO5B 1V9JA 3Q3JA 1NYRA 2L1AA 2D11A 2G4SA 2KACA 2KHWB 3M62B 1SIFA 4C56C 1RYJA 3Q3FA 4G11A 1WGKA 3ONSA 2M0AA 1C76A 2W3RA 4LNOA 4MT5A 2K25A 2K8BA 2L7RA 4ARCA 1ENFA 2AEHA 2WX1A 1T0QC 2KMAA 4IOIE 4OZAA 1MPEA 4GOCA 4W9CA 1NBFC 2DENB 3BIID 2PE6B 3OWEB 2KX3A 4N59A 2JVCA 1XCTL 4KV2A 2L05A 2KVZA 3AMZA 5HFYA 2LVQA 4EZJA 2C9WB 4JL9A 3KH0A 2FCQA 4WQOB 1KOTA 2I1JA 4WJOA 3BYYB 4IUMB 5FKAC 3APCA 2A5UA 1MI0A 5BYQA 4ZOHC 4K3BA 3GZNB 4FXCA 1RWSA 5HI1A 2NTTA 4RMAA 1OTRB 3PTFC 4ACFA 3CF6E 2IZVB 2FUHB 3EECA 4KDLB 4TQ1A 3EFCA 3FKYA 1TKGA 2J53A 2LWPA 3AN1A 2Q5WD 1ZXHA 3NS1A 3FAHA 3HHMA 4P16A 3VH3B 1B9RA 3ZNGC 3VAWA 1SBBB 5H92C 2HJ8A 4C7YA 2KDEB 2NPTB 2BQQA 3MHSD 4A3PA 1AW7A 2W82A 2NCNA 2KKCA 3WAPA 1ZDXA 3ENEA 1KLVA 4NAWA 3L17A 4EUTA 1ET6A 4NQLB 4B95A 3DWGC 1LFDA 3SDLC 1C79A 2ZVOA 1CMXB 2VZKB 2N4FA 2KFKA 3BK2A 5G5HA 3KW5B 3FC4A 4L2YA 5EDSA 4NJ6A 1WGGA 4HJGE 4P6VF 3IAM1 1HTQA 2MH7A 1GNUA 2DAJA 2GLSA 1XQQA 4JQWC 2D07B 1RLFA 3CWIA 2IY1B 5C3JB 1E10A 1C78A 3IFWB 3TSSA 1JCKB 4JLCA 4YTMB 3I5JC 2WU5B 3Q69A 4IWPA 1P9DU 1NI3A 2J7QB 3KUCB 2O6VD 4CQNA 1IGCA 5DPTA 2OEDA 3BINA 2JU6X 1OEYJ 2HJ1A 5KHQA 2WXJA 2XNAC 2EKEC 1TS3A 2JZ3B 2MHJA 3BK1A 2OHFA 3A9KA 1WGYA 2V1YA 4IW0A 1EUVB 5LXIB 2PW9A 2CU1A 3ZGZA 4GLSC 4K1RB 1FNWA 1WZ3A 3GZNI 2JPHA 3MJWA 1WXVA 2WU2B 4N9F4 1E6EB 3QCAA 3HVZA 2EKIA 3H1UA 3KWVA 3AEBB 4LJOB 2BT6A 1E0ZA 4GDKB 3QJZA 3TUOA 2J42A 1ZUD2 2YLMA 2MQJA 5G2NA 3FILA 5AZFA 3QAQA 3C0RB 3RMKC 1T3QA 3AB5A 1YNTE 2LASA 1EM7A 1K50A 2JRHA 3L08A 3Q8FA 2LJ5A 4XDCA 4C80A 2IO2B 3SU8X 3AE5B 1TY2A 3NVZA 1HE8A 1UBQA 2HTME 2ZZPB 1L0XB 3AEAB 3OJ3A 1F0ZA 3KYCD 1PUTA 2K6DB 3ML9A 5C23A 1X1MA 2PJHA 2FCSA 1SE4A 3ZVVA 1AARA 3TEWA 5E6JA 5CHVC 4HPLB 4LTUA 4BBNF 2JXXA 3U7ZA 2KK8A 1DOXA 1WWTA 1YJIA 1RAXA 2GB1A 3LXFA 4MGIE 1NYQA 1WX9A 4S17A 4AOFA 3Q3MC 3L54A 1J7AA 2AL3A 3AE3B 2WDVB 4W9HA 1QF6A 2K6QA 2FCMA 1IUEA 3A9JB 1V49A 1T6BX 4I6PA 4MM3A 3ZRFA 2DHZA 2C7NB 1QILA 4LLGM 2WXFA 3AEEB 2Y5PA 3SHQA 3UQAA 5H8YE 2VZKD 1KTKA 2LEKA 4ZYNA 4RGTA 3IT6B 1UELA 4MH0E 3KVFB 1NEKB 4I6LB 1MFWA 2JUOA 1WM3A 2NBWB 2MBBB 4B9KA 4GDLB 3QWZB 2WGSA 3GE3C 1VLBA 4WAFA 2INNE 4XYCA 1L6VA 2KDIA 2M56B 2LGSA 1FRRA 2JWUA 4HVBA 4YSZB 3AE8B 1GC6A 2V4IB 1IBXA 2ZCBA 3HVDA 5BO4B 1XLNA 2L76A 1V1PB 4AJYB 3WALA 1YQ3B 1AYFA 1PGXA 5CTRC 1ACCA 4II3B 4US8A 2LGXA 3E56A 2WLBA 3VR9B 3JSVB 1RRBA 2ASQA 2QILA 3APDA 1HTOA 4HCNB 2GI9A 3C8YA 1FMAD 1F52A 3UIOB 1D3ZA 1F2RI 1IPGA 2KJRA 2WNMA 5DPRA 1EF5A 2JT4B 3W1SC 2KC2A 3RPFC 2DWQA 3ZDMC 3UQBA 1D6EC 4MH8A 3N1ZC 4TUUA 4WWNA 3H6NA 4DWFA 2LUMA 1P98A 1M4VA 2LRWA 3VUXA 4M0WA 4KGRA 4WJQA 4LNIA 3RYTA 1EU4A 2BGFA 5MPOA 4XDDA 4DXFA 4K81A 1EF1A 1JALA 1VZ7A 4JWSC 4PYZA 2XEWA 3NVVA 3RFZB 1A70A 1SIJA 2MW5A 2KLGA 3N32A 4A9AA 1VRAB 2Y5CA 4M0WB 2WDTB 1FEHA 3NJTA 5TSSA 4LDTB 2DYBA 1TKEA 2LUEA 1WJ4A 1TJEA 2D3BA 2KQ4X 1SJHD 3UI3A 3LYYA 1HA5A 1PYWD 5DPSA 3SFDB 2N7EA 3NS8A 5GXGB 3DBRB 1I4HA 2JSVX 2PVGC 4KZ0A 3TMPB 5EE9A 2A4ZA 2MLBA 2WXNA 1Y56A 3JYUA 1TY0A 2EELA 5AZGA 2KDBA 2QEJC 3DBLI 2CJNA 2WDQB 1L4DB 2ZJDA 3AECB 3KYDD 1DGJA 3EUB2 3ZYYX 3PLUA 3GP7A 4HDQA 2XK5A 5L95C 2MA9B 4FA6A 4WURA 3VH4B 5G55A 4OVUA 4HLEA 4HXDA 4PS7A 3V6CB 2N7JA 2QJLA 3EC8A 5FR6A 2LVOA 4CYEA 4JPSA 4ICVA 2OOBB 1QOBA 3HM6X 4PK1A 2CS4A 3ETRA 1HZ5A 4DBGA 2IGGA 4FULA 4KKJA 1VCBA 1TZOA 2V4LA 2L52A 1FRDA 4URKA 2O6VA 2M19A 4C7ZA 2WHIA 1TGZB 1WMHB 1OEYA 2KWUB 3IXSA 3VQIA 1YQBA 1PFDA 2LVPA 2YVCA 2K5PA 3JSVA 3RNAC 2Z0DB 2KTFA 3VTVA 2UYZB 4P1BC 4W9EA 3VR8B 1WIAA 1STEA 4RF1A 2NR2A 1J7BA 3VTUA 3M95A 1Q10A 3AM9A 2BB5A 1JWAD 1UD7A 1UZXB 1CQVA 1E7VA 2C7HA 3UIPB 3T9LA 1XEEA 1SXTA 2BW2A 4X57B 4PS3A 1SJED 2DZMA 2NTSA 2KQSA 1K8RB 2E3TA 4A20A 1QOGA 3DBHB 1YQ4B 2NS5A 4P7IA 1E90A 5AEKB 3PZDA 3PPAA 3I63C 4DK5A 2IO0B 3W1YA 2C60A 3EHVA 5BYRA 1G6JA 1SEBD 2MSED 4L23A 1A5RA 2GOWA 3DPDA 4D2KA 4RF0A 1T0YA 4BBNC 3KUZA 4BFRA 3H7PB 4AS1A 5IO9A 1TS4A 2V3NA 1WFYA 1M94A 1SF0A 2QDFA 1FXAA 1LQBA 1WGDA 1FIQA 1ZW7A 2JZZA 2OJRA 2DAFA 3ZRCA 3VUWA 4GDLA 1WJ6A 1OQRA 2IY0B 5BMIA 3DHIC 3NOBA 2W3SA 4HEA1 1WY8A 4A8XC 3L16A 4HKQA 1ZGUB 3VRAB 3U4EG 4A3OA 4C00A 2JYTA 3PLVA 2WXGA 3DBRI 4BOSC 1D4BA 1YJJA 3B9JA 4LNKA 4GGQA 1OGWA 2IO3B 4HROA 1WF9A 1PQSA 1YN3A 4KDIC 4ZYSA 1PGBA 3PVLA 5HKHA 1MVKA 1Q0WB 1EU3A 2NMQA 4YXDB 1L0VB 4EZKA 4HPMB 3DVGX 2WXQA 1VZ8A 2R61A 2FE8A 3A9JA 1E7PB 2KTRB 1TKYA 4MGYE 2JY6A 2WXRA 2ZPNA 1BMLC 3B1LX 1HQRD 3LJ3A 3AI5A 1D5ZC 3PZ8A 1UUPA 1I4PA 2KX0A 4LNNA 1N63A 1QQRA 3T8MA 3GOEA 2WX0A 5TR5A 2INCC 2KNBA 4FJYA 1WXMA 3P1MA 4KIKB 4H2AA 5JZEB 2K22A 3UINB 2ZVNA 1WMHA 4FBJB 4REZA 3AV8A 4MJSA 2J52A 1KJTA 3TEZA 2RPVA 4ZHPA 4DHZB 1N62A 1GUAB 1EO6A 3QC8B 3PHXB 3GB1A 3RD2A 5I4DA 3DVNV 4LCDE 2B76B 3PREA 1R4MI 2FAZA 3PRMB 4AQ7A 1L0YB 2BS3B 3P2BA 4OZCA 2VH2A 3QK0A 1E8ZA 4DQOC 1YOVB 1EWCA 2QIEB 4PT5A 2RSUA 1J19A 3W2DA 4C4VB 3Q8EA 3N9YC 4YSYB 1GB1A 1P7EA 3MC8A 4DHZE 1GOZA 4MEMA 4NAMA 2RR9A 4XGAB 1NDDA 1GC7A 1QT9A 2MBHA 2M0XA 2CHZA 1I4GA 4NAWB 1FPYA 2V3SA 2VRRB 2FIDA 2DX5B 1FCCC 4ZDVA 4A55A 1YIWA 3A33B 4HWIB 3OJ4B 2MBQA 3PGEA 3OG5A 3URYA 2XBBC 3NZUA 1GB4A 2CJOA 1BT0A 4YWGG 3QHTA 4MM3B 1FM0D 1PGAA 3CSTA 5G5GA 1R4NB 2W9NA 1JWUD 1ZKHA 3ZJVA 4G0NB 5DPWA 4F7ZA 2LGIA 2CHWA 1UF0A 3WA0A 1SB3C 1V86A 3AU4A 1C3TA 2L8JA 2LXCA 2J4XA 2BBCA 4E71A 1P0RA 4DDID 3ZLZA 5C2TB 1YN5A 2M17A 3H8HA 5E6NA 2GBJA 2M8SA 3RI7C 4GB9A 5EE1A 1WYWB 2DBYA 2JRIB 3DVNU 3NVWA 2QC8A 2KWDA 3R3MA 4JX1C 1K51A 4ZHOA 4JGHB 4A6QA 3S2AA 2JQRB 3AEDB 1T0SC 1ZPSA 1WZ0A 1KFYB 4DXAB 2REXA 2N0SB 3QQ8B 1V5OA 1MHXA 2M4NA 2JF5A 1C4CA 2PMVA 3DVGY 2KWVB 4W9DA 3SEBA 5CX3A 2BYTA 2NBUA 5J18A 3ZNID 2ZNVB 3P4RB 2AL6A 2MP2A 2E6XA 4QAYA 3NZSA 5IOIA 5IA7A 2NVUI 3ZIMA 4OW0A 4KSLC 5E6PA 1XLOA 2BTEA 3MC0B 2J0MA 4FN2A 3BZDB 4NQKE 3DHGC 3RZFA 2L00B 4EE2A 3O65B 1GJZA 1V80A 2GMIC 1WX8A 4FHJA 3PT2B 3VHTC 3I9V1 4ARIA 1V81A 1Z2MA 5DCNA 4ASWC 3PZ7A 2Z8LA 3VFKA 1I42A 3RUIB 1N61A 4HPPA 2N1WA 2UWQA 1P7FA 1WX7A 2WXLA 2D3AA 4K7WA 4IKGA 1AWDA 1NI2A 2BF8B 3J9CA 4GXBA 4W9LA 2J0KA 4HKZE 2KFKB 1KF6B 3I57A 3EGRA 1T0RC 1FXTB 2LHEA 2WS3B 1NENB 3B08A 1WJUA 2HD5B 2K8CA 1MHHE 2RPQA 2LJIA 1QOAA 4RNAA 3R2IA 4AUQC 2AYOB 1WXSA 3IBEA 5JHAA 1ROEA 4Q2JA 4MSMB 3ZJTA 2ONQA 4XX5A 2GRIA 1DOYA 2HDEA 2AQ1B 2FUG1 2INDC 3IAS1 1D5MC 2D2QA 3U2SC 1U4AA 1XT9B 1UWMA 4K7SA 1C77A 4ICUA 3AE1B 1NVID 2RD0A 2WYQA 2MJEA 1HEZE 4C4VA 2LFIA 2I2YA 2WQYB 4DHJB 2KZRA 3N3KB 3LDZE 4OHJA 3MHZA 5FR3A 4TV3A 2BYFA 2IGDA 4ANUA 2IPKD 5AUIA 1WI0A 1WYGA 2L83A 3DBLB 4R3DA 4IM3A 1J0GA 3RT3B 3ML8A 3IG3A 3GS2A 4OZBA 3ABVB 2DZJA 1LGRA 2L0FA 2K3UA 3TEXA 1E8WA 5FK9C 2C5LC 1V97A 1FCLA 3U8ZA 3P63A 1FD6A 4CHKA 2IJ0A 1I35A 3N30A 1Q5WB 3DBHI 3NZ3A 4FJVB 3KLSX 3VUYA 2MJDA 1F9JA 4GIVA 4KSKC 2N9XA 1J7CA 1CZPA 3W9CB 2V0GA 3ZQ4A 4I6NB 3Q8AA 2KO3A 3JW0X 1TIFA 2G9HD 2KYWA 2KN4A 3NHEB 2W55A 2JWZA 3L0WB 4J6IA 5D2MB 4WWMA 3JVZX 2MCNB 3DQVA 3PRPB 3N20C 4IM0A 2SAKA 1K52A 3DHHC 2KMCA 2BWFA 3Q14C 4MGZE 1GG3A 3ZKJC 1R7SA 4YSXB 2WXIA 4N58A 3HUIA 2ICIA 2NBVB 2R2QA 2DZKA 1VD2A 5D7GA 3ZDTA 1IBXB 2TSSA 4IM2A 1V1OA 3Q3NC 1LXDA 4WAAA 1ZP0B 4ZRKA 3BVGA 4US9A 4UDUC 3PSEB 1HXYD 2QHOA 3R7RA 3MC9A 4RFBA 3T3OA 1AN8A 2KFJA 3OLMD 1Y8RC 2N7DA 4EZLA 3AE4B 3P42A 2IGHA 4AP4C 4GDKA 2LRUA 3EFUA 2H89B 5LXHA 2PTLA 3W1SA 1UWXA 4KX6B 4E74A 2IDYA 4DDGD 1ZE3D 3R7QA 4BVUC 5IKCM 3CMMB 2KANA 2D10A 4WQMA 1J8CA 3DOWA 4WWPA 4FHKA 3B2GA 4N6EB 1OQYA 3HRDD 3QX1A 1JRUA 1SE2A 4WJNA 4W9GA 1CK1A 2DZIA 1V6EA 2INPE 4BKSA 1F2RC 3H7SA 3A4SC 3PV1A 2PVOD 4DHJD 3TCAA 2AQ2B 1WE7A 3UF8A 3RNEC 1WXQA 1YX6B 4FJZA 2ZW0A 2L3ZA 4ANWA 2KN5A 2JZPA 4K3CA 1XF5L 2BB6A 2JXTA 2KJ6A 1TS5A 4KZCA 3IT4B 2UU7A 2PPHA 2RMMA 2DYMA 4G3XB 2WXOA 4WJPA 3SR6A 3B0AA 5KHOA 3Q8CA 4LK0M 3V3XA 1D5XC 4XE0A 1KLUD 2BYEA 4RM8A 2KD0A 4MGKE 5IN7A 2Y5BB 1SE3A 2K1FA 5CHWA 1N60A 3RNFC 4YT0B 2LZ6A 3Q3OC 4PS8A 4NZLB 3U52E 2XN9C 1L4ZB 1E5WA 2MJ3A 2K9XA 2WP9B 5EE0A 2H88B 3N1YC 4XZ4A 2KDMA 2ON8A 4XWTA 1YJ1A 3AE9B 3K9OB 2BVCA 5HG2A 4ZRPA 2LGDA 4MELA 4YL8A 1V1PA 2B3AA 2QSDA 3WAMA 2IYDB 3WAOA 1P3QU 2KLCA 3FILB 3U30A 2G4DB 1TTNA 1DOIA 3TEYA 2EMTA 4TMAB 3E9SA 4LDTD 3TJPA 4YTNB 4CO7A 3RNBC 2ZEQA 4TKNA 1JW9D 2N9KA 1S1QB 3A1QB 3BYTB 2G3QB 1Z5SB 2JYEA 1MG8A 4M01A 4IG7B 4YTPB 3L4PA 3C19A 1ZOYB 1JMLA 4B0MA 3LB8C 3RCZA 3EA6A 3AEGB 1F1HA 1KM7A 1ESFA 1XD3B 4EOYA 3P4PB 4TQ0A 3M63B 3VXWA 3IHPC 1WGRA 5J2RA 4W9FA 4ZRQA 3L10B 5IP4D 2HTHA 2R2OA 4IC7B 1WR1A 4TSSA 2CR5A 1E7UA 3BVZA 3N1XC 2MRPA 1C1YB 4WIPA 2K0PA 1B1ZA 2NPTA 2MEKA 2M1MA 3NG0A 1TYGB 4BKGA 3Q8BA 1JQ4A 2DLBA 3X23A 4AWJA 1E9MA 2EMSA 1CJEA 4S0RA 3TIXA 2GBNA 2RGFA 1YN4A 2O6VB 5C1ZA 3CSFA 5D94A 2V9HA 1R4MB 2N9EB 4AJWA 1WXAA 4GMVA 1R4NI 2RDHA 3RZWC 1QOFA 1GAQB 4ZRJA 1K53A 2Y3AA 4KGTA 3WIMA 2AX5A 3KQ4A 1QKZA 3QARA 2BS2B 5T8IA 3ZW3A 1VDVA 3AE7B 5D3DA 3NY5A 1SE9A 1ISNA 4OVVA 3AEFB 5BMGA 3TBLD 3M3JA 3ZTCA 1ZDVA 1RM6C 4IDIA 3DWMA 3W5VB 2X8XX 1N6ZA 1JRPA 2YEPB 4HCPB 3A4RA 2KAJA 1FNUA 1IYFA 3VRBB 4F8CB 3BVMA 4GN1A 2GBMA 1WE6A 2PE9A 1FFVA 2KJHB 2ZW1A 2RDBC 3UGBB 3WANA 1E8YA 1YX5B 2SEBD 2WWZA 2C7MB 3V6EB 4KIKA 2XK5B 2KQ7A 3A1QA 3RN9C 5AZHA 1TS2A 2O2VA 1VJKA 1UGJA 2LMCA 1WRDB 4RGOS 3WCQA 3V62A 1QLBB 3MP9A 1L2NA 2MX2A 3SFEB 1QZEA 3KWLA 3NVYA 2LI5A 5BMHA 4NJ7A 1EWYC 1WJNA 4HJKA 1E8XA 3O13A 5E6OA 4RH6A 2IO1B 1PDXA 1FXIA 1RFKA 3H7PA 2CKHB 2K8HA 3VVWB 4LNFA 3HIZA 5J17A 4KKIA 3DBSA 2G1EA 3RNGC 4HRSA 1IP9A 2FBWB 2YEPF 4EFOA 1C9FA 2BS4B 2MWSB 2WXMA 4MSQB 1TBEA 3IVFA 2WDRB 1FO4A 1TZ1A 1WR6E 2G45B 3SD5A 1DYQA 4EKUA 3I3TB 1L7YA 4RGNA 2FNJB 3RNCC 3VDZA 3P4QB 2MBOA 2D5GA 4P1CC 3APFA 1H8CA 2AWTA 4KGSA 2DYOA 4W9JA 4K7UA 3MFGA 4E3CA 1N5XA 4ANVA 2I1KA 4J3OD 2KVRA 2LHDA 3GE8C 3ZNZB 2JX5A 1Q1OA 4W9IA 1XLPA 4BZAA 1BXTA 1UH6A 4WWOA 1JWSD 4M8MA 4NJCA 1WGHA 1UBIA 3QA8A 1I4RA 3P4SB 4IWQA 5EE3A 3HK0A 3RULA 3DDCB 2ZPYA 3V61A 1S3SG 2KTRA
chains in the Genus database with same CATH topology
1OGWA 2IO3B 2LASA 2NBVB 1WF9A 2R2QA 2DZKA 1PQSA 1VD2A 2JRHA 3L08A 3ZNHB 3PRZA 4BKSD 2LJ5A 4KDIC 3KUDB 5D7GA 3TL5A 2IO2B 2KDFB 3PVLA 3ZDTA 3SU8X 5HKHA 4IM2A 1HE8A 1Q0WB 1UBQA 4XC2A 1LXDA 4G50A 2ZZPB 4WAAA 4BKTA 4ZRKA 4EZKA 2HE7A 4JIOU 2BWES 3OJ3A 4HPMB 3DVGX 3KYCD 3PSEB 2QHOA 2K6DB 3R7RA 3ML9A 3A9JA 5CHFA 5C23A 1X1MA 2KTRB 2PJHA 4MGYE 2FCSA 2JY6A 2KFJA 4HDOA 3OLMD 4LJPB 4HK2A 2N9PC 2BKFA 2ZPNA 3ZVVA 1Y8RC 2N7DA 1AARA 2MP2B 4EZLA 5CHVC 4HPLB 3B1LX 2D3GA 2LGYA 3AI5A 3LJ3A 4AP4C 3DCGA 2JXXA 4GDKA 4BBNF 2KK8A 4MJSB 4ANXA 2KXJA 2LRUA 2KX0A 3EFUA 3AU5A 3AULA 3T8MA 1RAXA 5LXHA 3K9PB 3W1SA 3GOEA 4MGIE 2WX0A 4E74A 5TR5A 2KC1A 4DDGD 1WX9A 2KNBA 5JHBA 4AOFA 3R7QA 4BVUC 3PHWB 3CMMB 3L54A 1WXMA 4FJYA 4KIKB 4MDKE 4W9KA 2CHXA 2KANA 5JZEB 2AL3A 1UGMA 4NPNA 2D10A 5D6JB 4W9HA 1J8CA 3UINB 3DOWA 4WWPA 2ZVNA 1WMHA 2K6QA 4FHKA 4FLHA 2FCMA 4FBJB 1OQYA 3QX1A 3A9JB 1JRUA 1V49A 4WJNA 4MJSA 1P1AA 1KJTA 4I6PA 4W9GA 4BKSA 2DZIA 1V6EA 1H4RA 3BY4B 4MM3A 3X0WA 3H7SA 3A4SC 3ZRFA 2DHZA 2C7NB 3OAWA 2IBIB 3PV1A 4RM9A 4DHZB 4DHJD 1GUAB 1EO6A 4PYUA 3ECIA 3QC8B 3PHXB 3TCAA 3RD2A 1WE7A 3UF8A 2GBRA 3DVNV 4LCDE 3QIJA 3SHQA 3UQAA 3PREA 1WH3A 4ZYNA 1YX6B 2O2VB 4FJZA 1R4MI 2FAZA 2L3ZA 1UELA 3PRMB 4MH0E 4ANWA 3KVFB 2KN5A 3P2BA 3R66C 2ZCCA 4I6LB 2GBKA 3U7DA 3ZTDA 3QK0A 1E8ZA 2JUOA 1WM3A 2NBWB 2KJ6A 2MBBB 4B9KA 4GDLB 4KZCA 3QWZB 2PPHA 2RSUA 1J19A 2N1VA 2DYMA 4G3XB 4WJPA 3ALBA 3B0AA 5KHOA 5LLIA 2KDIA 5L83A 4HVBA 4GU2A 2LXAA 2BYEA 4DHZE 1GC6A 4MEMA 2KD0A 4MGKE 4RM8A 2RR9A 1NDDA 2Y5BB 2ZCBA 1GC7A 2K1FA 4II2B 5CHWA 5IAAC 5BO4B 2L76A 3PS6A 2BKRB 2LZ6A 4PS8A 4ZRIA 3WALA 3ZUNA 4AJYB 2MBHA 2M0XA 2CHZA 5CTRC 4NAWB 2V3SA 1E5WA 4KVGB 4IWOA 3MTNB 2KWCA 2VRRB 1LM8B 4II3B 2FIDA 2LGXA 3H9DA 4GSWA 4NNJB 2DX5B 4XZ4A 5JH5C 4ZDVA 1YIWA 3A33B 3JSVB 3OJ4B 2MBQA 4HWIB 1V5TA 2FIFA 1RRBA 2Z59B 3PGEA 2ASQA 3APDA 2XBBC 1YJ1A 3NZUA 3HM3A 3V60A 4HCNB 2BPSA 1BT0A 3K9OB 4EEWA 2L0TA 3QHTA 2LGDA 3UIOB 4MELA 4YL8A 4B6WA 3CSTA 1D3ZA 3VTWA 2BYVE 5GMVA 1IPGA 2W9NA 2B3AA 2KJRA 1ZKHA 3AXCA 3WAMA 5DPRA 2IYDB 1EF5A 4G0NB 2J0JA 3WAOA 5DPWA 2JT4B 4F7ZA 3W1SC 2KOXA 2KC2A 3A9KB 1P3QU 2KLCA 2CHWA 3ZDMC 3UQBA 3U30A 3WA0A 2G4DB 1V86A 3AU4A 1C3TA 4TUUA 1TTNA 4WWNA 2L8JA 3H6NA 2LD9A 2LXCA 2EMTA 2ZNVC 4M8NA 4DWFA 1P98A 4BOZB 4LDTD 3TJPA 4E71A 1P0RA 4CO7A 2LRWA 2ZEQA 4DDID 3ZLZA 3VUXA 4TKNA 1S1QB 2M17A 5E6NA 1WM2A 4WJQA 2GBJA 3A1QB 2M8SA 3RYTA 2BGFA 4GB9A 2G3QB 1Z5SB 4K81A 1EF1A 3D32A 4FADA 1MG8A 4IG7B 1SGHA 2MBEA 4PYZA 2XEWA 1WYWB 1V2YA 3DVNU 2JRIB 1RFAA 2FCNA 2Z0EB 3R3MA 2MW5A 2KLGA 3N32A 3RCZA 3L13A 4NY0A 4M0WB 1YD8U 4JGHB 2WDTB 2PEAA 2K39A 4F1SA 1KM7A 3S2AA 3ZO5B 1XD3B 1V9JA 1WZ0A 4LDTB 4EOYA 2DYBA 3Q3JA 4DXAB 3M63B 4TQ0A 2D11A 2REXA 2G4SA 3VXWA 3IHPC 3QQ8B 1WGRA 2KHWB 3M62B 1SIFA 1V5OA 2M4NA 5J2RA 2JF5A 2LUEA 3Q3FA 1WJ4A 3DVGY 2KWVB 4W9DA 4W9FA 4G11A 5CX3A 3L10B 3ONSA 2NBUA 5J18A 2HTHA 5DPSA 2K25A 3ZNID 2ZNVB 2AL6A 2MP2A 2K8BA 2L7RA 2R2OA 4IC7B 1WR1A 3NZSA 2AEHA 2WX1A 2N7EA 2NVUI 5IA7A 2KMAA 2CR5A 3NS8A 3ZIMA 1E7UA 2MRPA 1C1YB 4KSLC 5E6PA 4GOCA 4W9CA 4KZ0A 2NPTA 3TMPB 2J0MA 2A4ZA 1NBFC 2MLBA 2DENB 2M1MA 3JYUA 4FN2A 4NQKE 5AZGA 3RZFA 4BKGA 2KDBA 2PE6B 2L00B 3DBLI 4AWJA 3X23A 3O65B 2KX3A 1GJZA 1V80A 2JVCA 2GMIC 1WX8A 2EMSA 2ZJDA 4FHJA 3PT2B 3VHTC 4KV2A 3TIXA 2L05A 1V81A 2GBNA 2RGFA 2O6VB 1Z2MA 5DCNA 4ASWC 2LVQA 4EZJA 3VFKA 2C9WB 3CSFA 5D94A 5C1ZA 1I42A 4JL9A 3RUIB 3KH0A 3KYDD 2FCQA 4WQOB 2N9EB 4AJWA 1WXAA 1KOTA 2I1JA 4GMVA 1R4NI 2N1WA 2UWQA 1WX7A 3PLUA 4IUMB 4WJOA 3RZWC 3APCA 2A5UA 4K7WA 4HDQA 4ZRJA 2XK5A 5L95C 2MA9B 4FA6A 3VH4B 3WIMA 1NI2A 5G55A 4OVUA 2BF8B 4GXBA 4HLEA 3QARA 4W9LA 2J0KA 3ZW3A 4HXDA 4PS7A 4RMAA 1OTRB 3PTFC 3V6CB 2KFKB 3NY5A 1SE9A 1ISNA 3CF6E 4OVVA 3TBLD 3M3JA 3ZTCA 1FXTB 2IZVB 2FUHB 3EECA 4KDLB 3EC8A 4TQ1A 5FR6A 2LVOA 4CYEA 3B08A 4HCPB 1WJUA 3A4RA 4ICVA 2LWPA 2HD5B 2K8CA 2OOBB 2RPQA 3HM6X 1IYFA 2CS4A 4F8CB 4GN1A 3HHMA 2GBMA 4DBGA 1WE6A 4FULA 3VH3B 2PE9A 1VCBA 4AUQC 3ZNGC 2V4LA 2AYOB 3VAWA 4URKA 1WXSA 2KJHB 3IBEA 2O6VA 5JHAA 4MSMB 3UGBB 2HJ8A 4XX5A 2KDEB 2NPTB 3MHSD 3WANA 1TGZB 4A3PA 1WMHB 1E8YA 1OEYA 1YX5B 2KWUB 3VQIA 2WWZA 2NCNA 1YQBA 2C7MB 2KKCA 3V6EB 3WAPA 2LVPA 3ENEA 1KLVA 2YVCA 4NAWA 3L17A 4KIKA 4EUTA 2D2QA 2XK5B 4NQLB 4B95A 2KQ7A 3JSVA 1U4AA 1XT9B 1LFDA 3A1QA 2Z0DB 2KTFA 4K7SA 3SDLC 3VTVA 4ICUA 2UYZB 2ZVOA 4W9EA 5AZHA 2WYQA 1WIAA 1CMXB 2RD0A 2N4FA 2NR2A 2O2VA 2KFKA 3VTUA 3M95A 1WRDB 3V62A 3KW5B 2KZRA 1UD7A 1UZXB 4DHJB 5EDSA 2MX2A 3N3KB 4NJ6A 1L2NA 3LDZE 1WGGA 1E7VA 1QZEA 2C7HA 4TV3A 3UIPB 2BYFA 3T9LA 2LI5A 1GNUA 2DAJA 4ANUA 4NJ7A 4HJKA 1WJNA 1XQQA 4PS3A 4JQWC 4X57B 2DZMA 1E8XA 2D07B 5E6OA 1RLFA 2IO1B 2KQSA 1K8RB 1WI0A 2IY1B 4A20A 2NS5A 4P7IA 3H7PA 3IFWB 1E90A 5AEKB 4IM3A 3PZDA 2CKHB 3PPAA 4JLCA 1J0GA 2K8HA 3VVWB 5J17A 3HIZA 3RT3B 3DBSA 4DK5A 3ML8A 3IG3A 4IWPA 1IP9A 1P9DU 2IO0B 4EFOA 2J7QB 2MWSB 3KUCB 2DZJA 3W1YA 2O6VD 2C60A 2L0FA 4MSQB 1TBEA 3IVFA 5DPTA 3EHVA 1G6JA 1E8WA 3BINA 2C5LC 2KTRA 1OEYJ 1TZ1A 1A5RA 5KHQA 1WR6E 2G45B 3SD5A 3U8ZA 4CHKA 1I35A 2GOWA 3N30A 2EKEC 4EKUA 3DPDA 3I3TB 2JZ3B 1Q5WB 3DBHI 4FJVB 1L7YA 2FNJB 1T0YA 3VDZA 3VUYA 4BBNC 2MBOA 3A9KA 1F9JA 1WGYA 3KUZA 2V1YA 4BFRA 3H7PB 4GIVA 2N9XA 4KSKC 3APFA 4IW0A 1H8CA 2AWTA 1EUVB 1WFYA 1M94A 4I6NB 5LXIB 1LQBA 1ZW7A 1WGDA 2DYOA 2JZZA 2KO3A 2OJRA 2DAFA 3JW0X 4K7UA 4W9JA 3ZRCA 4E3CA 2CU1A 4ANVA 2I1KA 3VUWA 4K1RB 1WZ3A 2KVRA 3GZNI 4GDLA 2JPHA 1WJ6A 3NHEB 3MJWA 1WXVA 2IY0B 3ZNZB 4N9F4 2JWZA 3NOBA 3L0WB 4J6IA 5D2MB 3QCAA 4W9IA 1Q1OA 1WY8A 1UH6A 3L16A 3JVZX 4WWOA 3H1UA 3DQVA 2MCNB 4M8MA 3PRPB 1ZGUB 4IM0A 4LJOB 1WGHA 1UBIA 3QA8A 4GDKB 3QJZA 4A3OA 2YLMA 2MQJA 5G2NA 3PLVA 5AZFA 2KMCA 3QAQA 2BWFA 3C0RB 4IWQA 4MGZE 1GG3A 3ZKJC 3DBRI 3HK0A 3RULA 4BOSC 3DDCB 2ZPYA 3V61A 1S3SG 2MSED 4GGQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1OGW A;  2IO3 B;  2LAS A;  2NBV B;  1WF9 A;  2R2Q A;  2DZK A;  1PQS A;  1VD2 A;  2JRH A;  3L08 A;  3ZNH B;  3PRZ A;  4BKS D;  2LJ5 A;  4KDI C;  3KUD B;  5D7G A;  3TL5 A;  2IO2 B;  2KDF B;  3PVL A;  3ZDT A;  3SU8 X;  5HKH A;  4IM2 A;  1HE8 A;  1Q0W B;  1UBQ A;  4XC2 A;  1LXD A;  4G50 A;  2ZZP B;  4WAA A;  4BKT A;  4ZRK A;  4EZK A;  2HE7 A;  4JIO U;  2BWE S;  3OJ3 A;  4HPM B;  3DVG X;  3KYC D;  3PSE B;  2QHO A;  2K6D B;  3R7R A;  3ML9 A;  3A9J A;  5CHF A;  5C23 A;  1X1M A;  2KTR B;  2PJH A;  4MGY E;  2FCS A;  2JY6 A;  2KFJ A;  4HDO A;  3OLM D;  4LJP B;  4HK2 A;  2N9P C;  2BKF A;  2ZPN A;  3ZVV A;  1Y8R C;  2N7D A;  1AAR A;  2MP2 B;  4EZL A;  5CHV C;  4HPL B;  3B1L X;  2D3G A;  2LGY A;  3AI5 A;  3LJ3 A;  4AP4 C;  3DCG A;  2JXX A;  4GDK A;  4BBN F;  2KK8 A;  4MJS B;  4ANX A;  2KXJ A;  2LRU A;  2KX0 A;  3EFU A;  3AU5 A;  3AUL A;  3T8M A;  1RAX A;  5LXH A;  3K9P B;  3W1S A;  3GOE A;  4MGI E;  2WX0 A;  4E74 A;  5TR5 A;  2KC1 A;  4DDG D;  1WX9 A;  2KNB A;  5JHB A;  4AOF A;  3R7Q A;  4BVU C;  3PHW B;  3CMM B;  3L54 A;  1WXM A;  4FJY A;  4KIK B;  4MDK E;  4W9K A;  2CHX A;  2KAN A;  5JZE B;  2AL3 A;  1UGM A;  4NPN A;  2D10 A;  5D6J B;  4W9H A;  1J8C A;  3UIN B;  3DOW A;  4WWP A;  2ZVN A;  1WMH A;  2K6Q A;  4FHK A;  4FLH A;  2FCM A;  4FBJ B;  1OQY A;  3QX1 A;  3A9J B;  1JRU A;  1V49 A;  4WJN A;  4MJS A;  1P1A A;  1KJT A;  4I6P A;  4W9G A;  4BKS A;  2DZI A;  1V6E A;  1H4R A;  3BY4 B;  4MM3 A;  3X0W A;  3H7S A;  3A4S C;  3ZRF A;  2DHZ A;  2C7N B;  3OAW A;  2IBI B;  3PV1 A;  4RM9 A;  4DHZ B;  4DHJ D;  1GUA B;  1EO6 A;  4PYU A;  3ECI A;  3QC8 B;  3PHX B;  3TCA A;  3RD2 A;  1WE7 A;  3UF8 A;  2GBR A;  3DVN V;  4LCD E;  3QIJ A;  3SHQ A;  3UQA A;  3PRE A;  1WH3 A;  4ZYN A;  1YX6 B;  2O2V B;  4FJZ A;  1R4M I;  2FAZ A;  2L3Z A;  1UEL A;  3PRM B;  4MH0 E;  4ANW A;  3KVF B;  2KN5 A;  3P2B A;  3R66 C;  2ZCC A;  4I6L B;  2GBK A;  3U7D A;  3ZTD A;  3QK0 A;  1E8Z A;  2JUO A;  1WM3 A;  2NBW B;  2KJ6 A;  2MBB B;  4B9K A;  4GDL B;  4KZC A;  3QWZ B;  2PPH A;  2RSU A;  1J19 A;  2N1V A;  2DYM A;  4G3X B;  4WJP A;  3ALB A;  3B0A A;  5KHO A;  5LLI A;  2KDI A;  5L83 A;  4HVB A;  4GU2 A;  2LXA A;  2BYE A;  4DHZ E;  1GC6 A;  4MEM A;  2KD0 A;  4MGK E;  4RM8 A;  2RR9 A;  1NDD A;  2Y5B B;  2ZCB A;  1GC7 A;  2K1F A;  4II2 B;  5CHW A;  5IAA C;  5BO4 B;  2L76 A;  3PS6 A;  2BKR B;  2LZ6 A;  4PS8 A;  4ZRI A;  3WAL A;  3ZUN A;  4AJY B;  2MBH A;  2M0X A;  2CHZ A;  5CTR C;  4NAW B;  2V3S A;  1E5W A;  4KVG B;  4IWO A;  3MTN B;  2KWC A;  2VRR B;  1LM8 B;  4II3 B;  2FID A;  2LGX A;  3H9D A;  4GSW A;  4NNJ B;  2DX5 B;  4XZ4 A;  5JH5 C;  4ZDV A;  1YIW A;  3A33 B;  3JSV B;  3OJ4 B;  2MBQ A;  4HWI B;  1V5T A;  2FIF A;  1RRB A;  2Z59 B;  3PGE A;  2ASQ A;  3APD A;  2XBB C;  1YJ1 A;  3NZU A;  3HM3 A;  3V60 A;  4HCN B;  2BPS A;  1BT0 A;  3K9O B;  4EEW A;  2L0T A;  3QHT A;  2LGD A;  3UIO B;  4MEL A;  4YL8 A;  4B6W A;  3CST A;  1D3Z A;  3VTW A;  2BYV E;  5GMV A;  1IPG A;  2W9N A;  2B3A A;  2KJR A;  1ZKH A;  3AXC A;  3WAM A;  5DPR A;  2IYD B;  1EF5 A;  4G0N B;  2J0J A;  3WAO A;  5DPW A;  2JT4 B;  4F7Z A;  3W1S C;  2KOX A;  2KC2 A;  3A9K B;  1P3Q U;  2KLC A;  2CHW A;  3ZDM C;  3UQB A;  3U30 A;  3WA0 A;  2G4D B;  1V86 A;  3AU4 A;  1C3T A;  4TUU A;  1TTN A;  4WWN A;  2L8J A;  3H6N A;  2LD9 A;  2LXC A;  2EMT A;  2ZNV C;  4M8N A;  4DWF A;  1P98 A;  4BOZ B;  4LDT D;  3TJP A;  4E71 A;  1P0R A;  4CO7 A;  2LRW A;  2ZEQ A;  4DDI D;  3ZLZ A;  3VUX A;  4TKN A;  1S1Q B;  2M17 A;  5E6N A;  1WM2 A;  4WJQ A;  2GBJ A;  3A1Q B;  2M8S A;  3RYT A;  2BGF A;  4GB9 A;  2G3Q B;  1Z5S B;  4K81 A;  1EF1 A;  3D32 A;  4FAD A;  1MG8 A;  4IG7 B;  1SGH A;  2MBE A;  4PYZ A;  2XEW A;  1WYW B;  1V2Y A;  3DVN U;  2JRI B;  1RFA A;  2FCN A;  2Z0E B;  3R3M A;  2MW5 A;  2KLG A;  3N32 A;  3RCZ A;  3L13 A;  4NY0 A;  4M0W B;  1YD8 U;  4JGH B;  2WDT B;  2PEA A;  2K39 A;  4F1S A;  1KM7 A;  3S2A A;  3ZO5 B;  1XD3 B;  1V9J A;  1WZ0 A;  4LDT B;  4EOY A;  2DYB A;  3Q3J A;  4DXA B;  3M63 B;  4TQ0 A;  2D11 A;  2REX A;  2G4S A;  3VXW A;  3IHP C;  3QQ8 B;  1WGR A;  2KHW B;  3M62 B;  1SIF A;  1V5O A;  2M4N A;  5J2R A;  2JF5 A;  2LUE A;  3Q3F A;  1WJ4 A;  3DVG Y;  2KWV B;  4W9D A;  4W9F A;  4G11 A;  5CX3 A;  3L10 B;  3ONS A;  2NBU A;  5J18 A;  2HTH A;  5DPS A;  2K25 A;  3ZNI D;  2ZNV B;  2AL6 A;  2MP2 A;  2K8B A;  2L7R A;  2R2O A;  4IC7 B;  1WR1 A;  3NZS A;  2AEH A;  2WX1 A;  2N7E A;  2NVU I;  5IA7 A;  2KMA A;  2CR5 A;  3NS8 A;  3ZIM A;  1E7U A;  2MRP A;  1C1Y B;  4KSL C;  5E6P A;  4GOC A;  4W9C A;  4KZ0 A;  2NPT A;  3TMP B;  2J0M A;  2A4Z A;  1NBF C;  2MLB A;  2DEN B;  2M1M A;  3JYU A;  4FN2 A;  4NQK E;  5AZG A;  3RZF A;  4BKG A;  2KDB A;  2PE6 B;  2L00 B;  3DBL I;  4AWJ A;  3X23 A;  3O65 B;  2KX3 A;  1GJZ A;  1V80 A;  2JVC A;  2GMI C;  1WX8 A;  2EMS A;  2ZJD A;  4FHJ A;  3PT2 B;  3VHT C;  4KV2 A;  3TIX A;  2L05 A;  1V81 A;  2GBN A;  2RGF A;  2O6V B;  1Z2M A;  5DCN A;  4ASW C;  2LVQ A;  4EZJ A;  3VFK A;  2C9W B;  3CSF A;  5D94 A;  5C1Z A;  1I42 A;  4JL9 A;  3RUI B;  3KH0 A;  3KYD D;  2FCQ A;  4WQO B;  2N9E B;  4AJW A;  1WXA A;  1KOT A;  2I1J A;  4GMV A;  1R4N I;  2N1W A;  2UWQ A;  1WX7 A;  3PLU A;  4IUM B;  4WJO A;  3RZW C;  3APC A;  2A5U A;  4K7W A;  4HDQ A;  4ZRJ A;  2XK5 A;  5L95 C;  2MA9 B;  4FA6 A;  3VH4 B;  3WIM A;  1NI2 A;  5G55 A;  4OVU A;  2BF8 B;  4GXB A;  4HLE A;  3QAR A;  4W9L A;  2J0K A;  3ZW3 A;  4HXD A;  4PS7 A;  4RMA A;  1OTR B;  3PTF C;  3V6C B;  2KFK B;  3NY5 A;  1SE9 A;  1ISN A;  3CF6 E;  4OVV A;  3TBL D;  3M3J A;  3ZTC A;  1FXT B;  2IZV B;  2FUH B;  3EEC A;  4KDL B;  3EC8 A;  4TQ1 A;  5FR6 A;  2LVO A;  4CYE A;  3B08 A;  4HCP B;  1WJU A;  3A4R A;  4ICV A;  2LWP A;  2HD5 B;  2K8C A;  2OOB B;  2RPQ A;  3HM6 X;  1IYF A;  2CS4 A;  4F8C B;  4GN1 A;  3HHM A;  2GBM A;  4DBG A;  1WE6 A;  4FUL A;  3VH3 B;  2PE9 A;  1VCB A;  4AUQ C;  3ZNG C;  2V4L A;  2AYO B;  3VAW A;  4URK A;  1WXS A;  2KJH B;  3IBE A;  2O6V A;  5JHA A;  4MSM B;  3UGB B;  2HJ8 A;  4XX5 A;  2KDE B;  2NPT B;  3MHS D;  3WAN A;  1TGZ B;  4A3P A;  1WMH B;  1E8Y A;  1OEY A;  1YX5 B;  2KWU B;  3VQI A;  2WWZ A;  2NCN A;  1YQB A;  2C7M B;  2KKC A;  3V6E B;  3WAP A;  2LVP A;  3ENE A;  1KLV A;  2YVC A;  4NAW A;  3L17 A;  4KIK A;  4EUT A;  2D2Q A;  2XK5 B;  4NQL B;  4B95 A;  2KQ7 A;  3JSV A;  1U4A A;  1XT9 B;  1LFD A;  3A1Q A;  2Z0D B;  2KTF A;  4K7S A;  3SDL C;  3VTV A;  4ICU A;  2UYZ B;  2ZVO A;  4W9E A;  5AZH A;  2WYQ A;  1WIA A;  1CMX B;  2RD0 A;  2N4F A;  2NR2 A;  2O2V A;  2KFK A;  3VTU A;  3M95 A;  1WRD B;  3V62 A;  3KW5 B;  2KZR A;  1UD7 A;  1UZX B;  4DHJ B;  5EDS A;  2MX2 A;  3N3K B;  4NJ6 A;  1L2N A;  3LDZ E;  1WGG A;  1E7V A;  1QZE A;  2C7H A;  4TV3 A;  3UIP B;  2BYF A;  3T9L A;  2LI5 A;  1GNU A;  2DAJ A;  4ANU A;  4NJ7 A;  4HJK A;  1WJN A;  1XQQ A;  4PS3 A;  4JQW C;  4X57 B;  2DZM A;  1E8X A;  2D07 B;  5E6O A;  1RLF A;  2IO1 B;  2KQS A;  1K8R B;  1WI0 A;  2IY1 B;  4A20 A;  2NS5 A;  4P7I A;  3H7P A;  3IFW B;  1E90 A;  5AEK B;  4IM3 A;  3PZD A;  2CKH B;  3PPA A;  4JLC A;  1J0G A;  2K8H A;  3VVW B;  5J17 A;  3HIZ A;  3RT3 B;  3DBS A;  4DK5 A;  3ML8 A;  3IG3 A;  4IWP A;  1IP9 A;  1P9D U;  2IO0 B;  4EFO A;  2J7Q B;  2MWS B;  3KUC B;  2DZJ A;  3W1Y A;  2O6V D;  2C60 A;  2L0F A;  4MSQ B;  1TBE A;  3IVF A;  5DPT A;  3EHV A;  1G6J A;  1E8W A;  3BIN A;  2C5L C;  2KTR A;  1OEY J;  1TZ1 A;  1A5R A;  5KHQ A;  1WR6 E;  2G45 B;  3SD5 A;  3U8Z A;  4CHK A;  1I35 A;  2GOW A;  3N30 A;  2EKE C;  4EKU A;  3DPD A;  3I3T B;  2JZ3 B;  1Q5W B;  3DBH I;  4FJV B;  1L7Y A;  2FNJ B;  1T0Y A;  3VDZ A;  3VUY A;  4BBN C;  2MBO A;  3A9K A;  1F9J A;  1WGY A;  3KUZ A;  2V1Y A;  4BFR A;  3H7P B;  4GIV A;  2N9X A;  4KSK C;  3APF A;  4IW0 A;  1H8C A;  2AWT A;  1EUV B;  1WFY A;  1M94 A;  4I6N B;  5LXI B;  1LQB A;  1ZW7 A;  1WGD A;  2DYO A;  2JZZ A;  2KO3 A;  2OJR A;  2DAF A;  3JW0 X;  4K7U A;  4W9J A;  3ZRC A;  4E3C A;  2CU1 A;  4ANV A;  2I1K A;  3VUW A;  4K1R B;  1WZ3 A;  2KVR A;  3GZN I;  4GDL A;  2JPH A;  1WJ6 A;  3NHE B;  3MJW A;  1WXV A;  2IY0 B;  3ZNZ B;  4N9F 4;  2JWZ A;  3NOB A;  3L0W B;  4J6I A;  5D2M B;  3QCA A;  4W9I A;  1Q1O A;  1WY8 A;  1UH6 A;  3L16 A;  3JVZ X;  4WWO A;  3H1U A;  3DQV A;  2MCN B;  4M8M A;  3PRP B;  1ZGU B;  4IM0 A;  4LJO B;  1WGH A;  1UBI A;  3QA8 A;  4GDK B;  3QJZ A;  4A3O A;  2YLM A;  2MQJ A;  5G2N A;  3PLV A;  5AZF A;  2KMC A;  3QAQ A;  2BWF A;  3C0R B;  4IWQ A;  4MGZ E;  1GG3 A;  3ZKJ C;  3DBR I;  3HK0 A;  3RUL A;  4BOS C;  3DDC B;  2ZPY A;  3V61 A;  1S3S G;  2MSE D;  4GGQ A; 
#chains in the Genus database with same CATH topology
 2L32 A;  1XLQ A;  5LNK 1;  3ZNH B;  2RDG A;  3PRZ A;  4BKS D;  3KUD B;  3TL5 A;  2KDF B;  3AE2 B;  1WRI A;  1L6U A;  4XC2 A;  4G50 A;  2PLP A;  4BKT A;  2ACZ B;  2HE7 A;  4JIO U;  2BWE S;  4ITK A;  1LO5 D;  4JWU C;  5CHF A;  4HDO A;  4LJP B;  4HK2 A;  2N9P C;  2BKF A;  2DNF A;  2MP2 B;  2D3G A;  2LGY A;  1XXG A;  1JRO A;  3DCG A;  4MJS B;  4ANX A;  2KXJ A;  3AU5 A;  2PIA A;  2CU3 A;  3AUL A;  1MG4 A;  3K9P B;  3ZJU A;  2KC1 A;  5JHB A;  1V8C A;  2PKO A;  3PHW B;  4MDK E;  4W9K A;  2CHX A;  2N9L A;  1UGM A;  4NPN A;  1XCQ L;  1KRH A;  5D6J B;  4L1B A;  1OQQ A;  1XO3 A;  4FLH A;  1P1A A;  1ZXI A;  1H4R A;  3BY4 B;  3X0W A;  1HZ6 A;  3Q2A C;  4RGM A;  4M00 A;  3OAW A;  4RM9 A;  2IBI B;  4PYU A;  3ECI A;  2GBR A;  3QIJ A;  3PO0 A;  1WH3 A;  2O2V B;  5BYS A;  1I4X A;  4B0E A;  1C4A A;  1JWB D;  3U7D A;  3R66 C;  2ZCC A;  3ZTD A;  2GBK A;  1C4P A;  1FFU A;  4RCO A;  3CIR B;  1BUI C;  1UNS A;  4O1N A;  2N1V A;  3R8B A;  2I38 A;  3R2T A;  3ALB A;  5LLI A;  1GPX A;  3AE6 B;  5L83 A;  1SSN A;  4OVZ A;  1T5X D;  4GU2 A;  2LXA A;  1KH0 A;  1F77 A;  3BWU D;  5IAA C;  4II2 B;  3PS6 A;  2BKR B;  4ZRI A;  3ZUN A;  2X38 A;  4MAC A;  3B2F A;  3ZXR A;  4KVG B;  2V3P A;  4IWO A;  3MTN B;  2KWC A;  1LM8 B;  1WSP A;  3H9D A;  4GSW A;  2WXP A;  4NNJ B;  1OFF A;  5JH5 C;  3AH7 A;  1V5T A;  2FIF A;  2Z59 B;  4M02 A;  4WH4 A;  3HM3 A;  2D3C A;  3V60 A;  4EEW A;  2BPS A;  2L0T A;  3NUH B;  2KMM A;  2W54 A;  2AQ3 B;  5AUK A;  4B6W A;  3VTW A;  2BYV E;  5GMV A;  4A90 A;  1VR9 A;  1FNV A;  3V05 A;  3AXC A;  2WXK A;  2KT7 A;  2VH1 A;  2J0J A;  2KOX A;  2OJW A;  3A9K B;  4JE3 B;  1KLG D;  5D3I B;  2LD9 A;  4M8N A;  2ZNV C;  4BOZ B;  3T3N A;  4BAX A;  4XWW A;  3NRZ A;  2QMT A;  2QCZ A;  1WM2 A;  1IGD A;  4USA A;  3MJ5 A;  5JXV A;  3Q6B A;  3D32 A;  4FAD A;  1N5W A;  1TT5 B;  4DXG A;  1SGH A;  1YMH E;  2MBE A;  5HHD G;  1I7H A;  2WXH A;  1V2Y A;  1I4Q A;  1RFA A;  3ZXV A;  2FCN A;  2Z0E B;  1MJD A;  3L13 A;  4NY0 A;  1L5P A;  1YD8 U;  2PEA A;  2K39 A;  4F1S A;  3W5U B;  1ET9 A;  1JWM D;  1VZ6 A;  3ZO5 B;  1V9J A;  3Q3J A;  1NYR A;  2L1A A;  2D11 A;  2G4S A;  2KAC A;  2KHW B;  3M62 B;  1SIF A;  4C56 C;  1RYJ A;  3Q3F A;  4G11 A;  1WGK A;  3ONS A;  2M0A A;  1C76 A;  2W3R A;  4LNO A;  4MT5 A;  2K25 A;  2K8B A;  2L7R A;  4ARC A;  1ENF A;  2AEH A;  2WX1 A;  1T0Q C;  2KMA A;  4IOI E;  4OZA A;  1MPE A;  4GOC A;  4W9C A;  1NBF C;  2DEN B;  3BII D;  2PE6 B;  3OWE B;  2KX3 A;  4N59 A;  2JVC A;  1XCT L;  4KV2 A;  2L05 A;  2KVZ A;  3AMZ A;  5HFY A;  2LVQ A;  4EZJ A;  2C9W B;  4JL9 A;  3KH0 A;  2FCQ A;  4WQO B;  1KOT A;  2I1J A;  4WJO A;  3BYY B;  4IUM B;  5FKA C;  3APC A;  2A5U A;  1MI0 A;  5BYQ A;  4ZOH C;  4K3B A;  3GZN B;  4FXC A;  1RWS A;  5HI1 A;  2NTT A;  4RMA A;  1OTR B;  3PTF C;  4ACF A;  3CF6 E;  2IZV B;  2FUH B;  3EEC A;  4KDL B;  4TQ1 A;  3EFC A;  3FKY A;  1TKG A;  2J53 A;  2LWP A;  3AN1 A;  2Q5W D;  1ZXH A;  3NS1 A;  3FAH A;  3HHM A;  4P16 A;  3VH3 B;  1B9R A;  3ZNG C;  3VAW A;  1SBB B;  5H92 C;  2HJ8 A;  4C7Y A;  2KDE B;  2NPT B;  2BQQ A;  3MHS D;  4A3P A;  1AW7 A;  2W82 A;  2NCN A;  2KKC A;  3WAP A;  1ZDX A;  3ENE A;  1KLV A;  4NAW A;  3L17 A;  4EUT A;  1ET6 A;  4NQL B;  4B95 A;  3DWG C;  1LFD A;  3SDL C;  1C79 A;  2ZVO A;  1CMX B;  2VZK B;  2N4F A;  2KFK A;  3BK2 A;  5G5H A;  3KW5 B;  3FC4 A;  4L2Y A;  5EDS A;  4NJ6 A;  1WGG A;  4HJG E;  4P6V F;  3IAM 1;  1HTQ A;  2MH7 A;  1GNU A;  2DAJ A;  2GLS A;  1XQQ A;  4JQW C;  2D07 B;  1RLF A;  3CWI A;  2IY1 B;  5C3J B;  1E10 A;  1C78 A;  3IFW B;  3TSS A;  1JCK B;  4JLC A;  4YTM B;  3I5J C;  2WU5 B;  3Q69 A;  4IWP A;  1P9D U;  1NI3 A;  2J7Q B;  3KUC B;  2O6V D;  4CQN A;  1IGC A;  5DPT A;  2OED A;  3BIN A;  2JU6 X;  1OEY J;  2HJ1 A;  5KHQ A;  2WXJ A;  2XNA C;  2EKE C;  1TS3 A;  2JZ3 B;  2MHJ A;  3BK1 A;  2OHF A;  3A9K A;  1WGY A;  2V1Y A;  4IW0 A;  1EUV B;  5LXI B;  2PW9 A;  2CU1 A;  3ZGZ A;  4GLS C;  4K1R B;  1FNW A;  1WZ3 A;  3GZN I;  2JPH A;  3MJW A;  1WXV A;  2WU2 B;  4N9F 4;  1E6E B;  3QCA A;  3HVZ A;  2EKI A;  3H1U A;  3KWV A;  3AEB B;  4LJO B;  2BT6 A;  1E0Z A;  4GDK B;  3QJZ A;  3TUO A;  2J42 A;  1ZUD 2;  2YLM A;  2MQJ A;  5G2N A;  3FIL A;  5AZF A;  3QAQ A;  3C0R B;  3RMK C;  1T3Q A;  3AB5 A;  1YNT E;  2LAS A;  1EM7 A;  1K50 A;  2JRH A;  3L08 A;  3Q8F A;  2LJ5 A;  4XDC A;  4C80 A;  2IO2 B;  3SU8 X;  3AE5 B;  1TY2 A;  3NVZ A;  1HE8 A;  1UBQ A;  2HTM E;  2ZZP B;  1L0X B;  3AEA B;  3OJ3 A;  1F0Z A;  3KYC D;  1PUT A;  2K6D B;  3ML9 A;  5C23 A;  1X1M A;  2PJH A;  2FCS A;  1SE4 A;  3ZVV A;  1AAR A;  3TEW A;  5E6J A;  5CHV C;  4HPL B;  4LTU A;  4BBN F;  2JXX A;  3U7Z A;  2KK8 A;  1DOX A;  1WWT A;  1YJI A;  1RAX A;  2GB1 A;  3LXF A;  4MGI E;  1NYQ A;  1WX9 A;  4S17 A;  4AOF A;  3Q3M C;  3L54 A;  1J7A A;  2AL3 A;  3AE3 B;  2WDV B;  4W9H A;  1QF6 A;  2K6Q A;  2FCM A;  1IUE A;  3A9J B;  1V49 A;  1T6B X;  4I6P A;  4MM3 A;  3ZRF A;  2DHZ A;  2C7N B;  1QIL A;  4LLG M;  2WXF A;  3AEE B;  2Y5P A;  3SHQ A;  3UQA A;  5H8Y E;  2VZK D;  1KTK A;  2LEK A;  4ZYN A;  4RGT A;  3IT6 B;  1UEL A;  4MH0 E;  3KVF B;  1NEK B;  4I6L B;  1MFW A;  2JUO A;  1WM3 A;  2NBW B;  2MBB B;  4B9K A;  4GDL B;  3QWZ B;  2WGS A;  3GE3 C;  1VLB A;  4WAF A;  2INN E;  4XYC A;  1L6V A;  2KDI A;  2M56 B;  2LGS A;  1FRR A;  2JWU A;  4HVB A;  4YSZ B;  3AE8 B;  1GC6 A;  2V4I B;  1IBX A;  2ZCB A;  3HVD A;  5BO4 B;  1XLN A;  2L76 A;  1V1P B;  4AJY B;  3WAL A;  1YQ3 B;  1AYF A;  1PGX A;  5CTR C;  1ACC A;  4II3 B;  4US8 A;  2LGX A;  3E56 A;  2WLB A;  3VR9 B;  3JSV B;  1RRB A;  2ASQ A;  2QIL A;  3APD A;  1HTO A;  4HCN B;  2GI9 A;  3C8Y A;  1FMA D;  1F52 A;  3UIO B;  1D3Z A;  1F2R I;  1IPG A;  2KJR A;  2WNM A;  5DPR A;  1EF5 A;  2JT4 B;  3W1S C;  2KC2 A;  3RPF C;  2DWQ A;  3ZDM C;  3UQB A;  1D6E C;  4MH8 A;  3N1Z C;  4TUU A;  4WWN A;  3H6N A;  4DWF A;  2LUM A;  1P98 A;  1M4V A;  2LRW A;  3VUX A;  4M0W A;  4KGR A;  4WJQ A;  4LNI A;  3RYT A;  1EU4 A;  2BGF A;  5MPO A;  4XDD A;  4DXF A;  4K81 A;  1EF1 A;  1JAL A;  1VZ7 A;  4JWS C;  4PYZ A;  2XEW A;  3NVV A;  3RFZ B;  1A70 A;  1SIJ A;  2MW5 A;  2KLG A;  3N32 A;  4A9A A;  1VRA B;  2Y5C A;  4M0W B;  2WDT B;  1FEH A;  3NJT A;  5TSS A;  4LDT B;  2DYB A;  1TKE A;  2LUE A;  1WJ4 A;  1TJE A;  2D3B A;  2KQ4 X;  1SJH D;  3UI3 A;  3LYY A;  1HA5 A;  1PYW D;  5DPS A;  3SFD B;  2N7E A;  3NS8 A;  5GXG B;  3DBR B;  1I4H A;  2JSV X;  2PVG C;  4KZ0 A;  3TMP B;  5EE9 A;  2A4Z A;  2MLB A;  2WXN A;  1Y56 A;  3JYU A;  1TY0 A;  2EEL A;  5AZG A;  2KDB A;  2QEJ C;  3DBL I;  2CJN A;  2WDQ B;  1L4D B;  2ZJD A;  3AEC B;  3KYD D;  1DGJ A;  3EUB 2;  3ZYY X;  3PLU A;  3GP7 A;  4HDQ A;  2XK5 A;  5L95 C;  2MA9 B;  4FA6 A;  4WUR A;  3VH4 B;  5G55 A;  4OVU A;  4HLE A;  4HXD A;  4PS7 A;  3V6C B;  2N7J A;  2QJL A;  3EC8 A;  5FR6 A;  2LVO A;  4CYE A;  4JPS A;  4ICV A;  2OOB B;  1QOB A;  3HM6 X;  4PK1 A;  2CS4 A;  3ETR A;  1HZ5 A;  4DBG A;  2IGG A;  4FUL A;  4KKJ A;  1VCB A;  1TZO A;  2V4L A;  2L52 A;  1FRD A;  4URK A;  2O6V A;  2M19 A;  4C7Z A;  2WHI A;  1TGZ B;  1WMH B;  1OEY A;  2KWU B;  3IXS A;  3VQI A;  1YQB A;  1PFD A;  2LVP A;  2YVC A;  2K5P A;  3JSV A;  3RNA C;  2Z0D B;  2KTF A;  3VTV A;  2UYZ B;  4P1B C;  4W9E A;  3VR8 B;  1WIA A;  1STE A;  4RF1 A;  2NR2 A;  1J7B A;  3VTU A;  3M95 A;  1Q10 A;  3AM9 A;  2BB5 A;  1JWA D;  1UD7 A;  1UZX B;  1CQV A;  1E7V A;  2C7H A;  3UIP B;  3T9L A;  1XEE A;  1SXT A;  2BW2 A;  4X57 B;  4PS3 A;  1SJE D;  2DZM A;  2NTS A;  2KQS A;  1K8R B;  2E3T A;  4A20 A;  1QOG A;  3DBH B;  1YQ4 B;  2NS5 A;  4P7I A;  1E90 A;  5AEK B;  3PZD A;  3PPA A;  3I63 C;  4DK5 A;  2IO0 B;  3W1Y A;  2C60 A;  3EHV A;  5BYR A;  1G6J A;  1SEB D;  2MSE D;  4L23 A;  1A5R A;  2GOW A;  3DPD A;  4D2K A;  4RF0 A;  1T0Y A;  4BBN C;  3KUZ A;  4BFR A;  3H7P B;  4AS1 A;  5IO9 A;  1TS4 A;  2V3N A;  1WFY A;  1M94 A;  1SF0 A;  2QDF A;  1FXA A;  1LQB A;  1WGD A;  1FIQ A;  1ZW7 A;  2JZZ A;  2OJR A;  2DAF A;  3ZRC A;  3VUW A;  4GDL A;  1WJ6 A;  1OQR A;  2IY0 B;  5BMI A;  3DHI C;  3NOB A;  2W3S A;  4HEA 1;  1WY8 A;  4A8X C;  3L16 A;  4HKQ A;  1ZGU B;  3VRA B;  3U4E G;  4A3O A;  4C00 A;  2JYT A;  3PLV A;  2WXG A;  3DBR I;  4BOS C;  1D4B A;  1YJJ A;  3B9J A;  4LNK A;  4GGQ A;  1OGW A;  2IO3 B;  4HRO A;  1WF9 A;  1PQS A;  1YN3 A;  4KDI C;  4ZYS A;  1PGB A;  3PVL A;  5HKH A;  1MVK A;  1Q0W B;  1EU3 A;  2NMQ A;  4YXD B;  1L0V B;  4EZK A;  4HPM B;  3DVG X;  2WXQ A;  1VZ8 A;  2R61 A;  2FE8 A;  3A9J A;  1E7P B;  2KTR B;  1TKY A;  4MGY E;  2JY6 A;  2WXR A;  2ZPN A;  1BML C;  3B1L X;  1HQR D;  3LJ3 A;  3AI5 A;  1D5Z C;  3PZ8 A;  1UUP A;  1I4P A;  2KX0 A;  4LNN A;  1N63 A;  1QQR A;  3T8M A;  3GOE A;  2WX0 A;  5TR5 A;  2INC C;  2KNB A;  4FJY A;  1WXM A;  3P1M A;  4KIK B;  4H2A A;  5JZE B;  2K22 A;  3UIN B;  2ZVN A;  1WMH A;  4FBJ B;  4REZ A;  3AV8 A;  4MJS A;  2J52 A;  1KJT A;  3TEZ A;  2RPV A;  4ZHP A;  4DHZ B;  1N62 A;  1GUA B;  1EO6 A;  3QC8 B;  3PHX B;  3GB1 A;  3RD2 A;  5I4D A;  3DVN V;  4LCD E;  2B76 B;  3PRE A;  1R4M I;  2FAZ A;  3PRM B;  4AQ7 A;  1L0Y B;  2BS3 B;  3P2B A;  4OZC A;  2VH2 A;  3QK0 A;  1E8Z A;  4DQO C;  1YOV B;  1EWC A;  2QIE B;  4PT5 A;  2RSU A;  1J19 A;  3W2D A;  4C4V B;  3Q8E A;  3N9Y C;  4YSY B;  1GB1 A;  1P7E A;  3MC8 A;  4DHZ E;  1GOZ A;  4MEM A;  4NAM A;  2RR9 A;  4XGA B;  1NDD A;  1GC7 A;  1QT9 A;  2MBH A;  2M0X A;  2CHZ A;  1I4G A;  4NAW B;  1FPY A;  2V3S A;  2VRR B;  2FID A;  2DX5 B;  1FCC C;  4ZDV A;  4A55 A;  1YIW A;  3A33 B;  4HWI B;  3OJ4 B;  2MBQ A;  3PGE A;  3OG5 A;  3URY A;  2XBB C;  3NZU A;  1GB4 A;  2CJO A;  1BT0 A;  4YWG G;  3QHT A;  4MM3 B;  1FM0 D;  1PGA A;  3CST A;  5G5G A;  1R4N B;  2W9N A;  1JWU D;  1ZKH A;  3ZJV A;  4G0N B;  5DPW A;  4F7Z A;  2LGI A;  2CHW A;  1UF0 A;  3WA0 A;  1SB3 C;  1V86 A;  3AU4 A;  1C3T A;  2L8J A;  2LXC A;  2J4X A;  2BBC A;  4E71 A;  1P0R A;  4DDI D;  3ZLZ A;  5C2T B;  1YN5 A;  2M17 A;  3H8H A;  5E6N A;  2GBJ A;  2M8S A;  3RI7 C;  4GB9 A;  5EE1 A;  1WYW B;  2DBY A;  2JRI B;  3DVN U;  3NVW A;  2QC8 A;  2KWD A;  3R3M A;  4JX1 C;  1K51 A;  4ZHO A;  4JGH B;  4A6Q A;  3S2A A;  2JQR B;  3AED B;  1T0S C;  1ZPS A;  1WZ0 A;  1KFY B;  4DXA B;  2REX A;  2N0S B;  3QQ8 B;  1V5O A;  1MHX A;  2M4N A;  2JF5 A;  1C4C A;  2PMV A;  3DVG Y;  2KWV B;  4W9D A;  3SEB A;  5CX3 A;  2BYT A;  2NBU A;  5J18 A;  3ZNI D;  2ZNV B;  3P4R B;  2AL6 A;  2MP2 A;  2E6X A;  4QAY A;  3NZS A;  5IOI A;  5IA7 A;  2NVU I;  3ZIM A;  4OW0 A;  4KSL C;  5E6P A;  1XLO A;  2BTE A;  3MC0 B;  2J0M A;  4FN2 A;  3BZD B;  4NQK E;  3DHG C;  3RZF A;  2L00 B;  4EE2 A;  3O65 B;  1GJZ A;  1V80 A;  2GMI C;  1WX8 A;  4FHJ A;  3PT2 B;  3VHT C;  3I9V 1;  4ARI A;  1V81 A;  1Z2M A;  5DCN A;  4ASW C;  3PZ7 A;  2Z8L A;  3VFK A;  1I42 A;  3RUI B;  1N61 A;  4HPP A;  2N1W A;  2UWQ A;  1P7F A;  1WX7 A;  2WXL A;  2D3A A;  4K7W A;  4IKG A;  1AWD A;  1NI2 A;  2BF8 B;  3J9C A;  4GXB A;  4W9L A;  2J0K A;  4HKZ E;  2KFK B;  1KF6 B;  3I57 A;  3EGR A;  1T0R C;  1FXT B;  2LHE A;  2WS3 B;  1NEN B;  3B08 A;  1WJU A;  2HD5 B;  2K8C A;  1MHH E;  2RPQ A;  2LJI A;  1QOA A;  4RNA A;  3R2I A;  4AUQ C;  2AYO B;  1WXS A;  3IBE A;  5JHA A;  1ROE A;  4Q2J A;  4MSM B;  3ZJT A;  2ONQ A;  4XX5 A;  2GRI A;  1DOY A;  2HDE A;  2AQ1 B;  2FUG 1;  2IND C;  3IAS 1;  1D5M C;  2D2Q A;  3U2S C;  1U4A A;  1XT9 B;  1UWM A;  4K7S A;  1C77 A;  4ICU A;  3AE1 B;  1NVI D;  2RD0 A;  2WYQ A;  2MJE A;  1HEZ E;  4C4V A;  2LFI A;  2I2Y A;  2WQY B;  4DHJ B;  2KZR A;  3N3K B;  3LDZ E;  4OHJ A;  3MHZ A;  5FR3 A;  4TV3 A;  2BYF A;  2IGD A;  4ANU A;  2IPK D;  5AUI A;  1WI0 A;  1WYG A;  2L83 A;  3DBL B;  4R3D A;  4IM3 A;  1J0G A;  3RT3 B;  3ML8 A;  3IG3 A;  3GS2 A;  4OZB A;  3ABV B;  2DZJ A;  1LGR A;  2L0F A;  2K3U A;  3TEX A;  1E8W A;  5FK9 C;  2C5L C;  1V97 A;  1FCL A;  3U8Z A;  3P63 A;  1FD6 A;  4CHK A;  2IJ0 A;  1I35 A;  3N30 A;  1Q5W B;  3DBH I;  3NZ3 A;  4FJV B;  3KLS X;  3VUY A;  2MJD A;  1F9J A;  4GIV A;  4KSK C;  2N9X A;  1J7C A;  1CZP A;  3W9C B;  2V0G A;  3ZQ4 A;  4I6N B;  3Q8A A;  2KO3 A;  3JW0 X;  1TIF A;  2G9H D;  2KYW A;  2KN4 A;  3NHE B;  2W55 A;  2JWZ A;  3L0W B;  4J6I A;  5D2M B;  4WWM A;  3JVZ X;  2MCN B;  3DQV A;  3PRP B;  3N20 C;  4IM0 A;  2SAK A;  1K52 A;  3DHH C;  2KMC A;  2BWF A;  3Q14 C;  4MGZ E;  1GG3 A;  3ZKJ C;  1R7S A;  4YSX B;  2WXI A;  4N58 A;  3HUI A;  2ICI A;  2NBV B;  2R2Q A;  2DZK A;  1VD2 A;  5D7G A;  3ZDT A;  1IBX B;  2TSS A;  4IM2 A;  1V1O A;  3Q3N C;  1LXD A;  4WAA A;  1ZP0 B;  4ZRK A;  3BVG A;  4US9 A;  4UDU C;  3PSE B;  1HXY D;  2QHO A;  3R7R A;  3MC9 A;  4RFB A;  3T3O A;  1AN8 A;  2KFJ A;  3OLM D;  1Y8R C;  2N7D A;  4EZL A;  3AE4 B;  3P42 A;  2IGH A;  4AP4 C;  4GDK A;  2LRU A;  3EFU A;  2H89 B;  5LXH A;  2PTL A;  3W1S A;  1UWX A;  4KX6 B;  4E74 A;  2IDY A;  4DDG D;  1ZE3 D;  3R7Q A;  4BVU C;  5IKC M;  3CMM B;  2KAN A;  2D10 A;  4WQM A;  1J8C A;  3DOW A;  4WWP A;  4FHK A;  3B2G A;  4N6E B;  1OQY A;  3HRD D;  3QX1 A;  1JRU A;  1SE2 A;  4WJN A;  4W9G A;  1CK1 A;  2DZI A;  1V6E A;  2INP E;  4BKS A;  1F2R C;  3H7S A;  3A4S C;  3PV1 A;  2PVO D;  4DHJ D;  3TCA A;  2AQ2 B;  1WE7 A;  3UF8 A;  3RNE C;  1WXQ A;  1YX6 B;  4FJZ A;  2ZW0 A;  2L3Z A;  4ANW A;  2KN5 A;  2JZP A;  4K3C A;  1XF5 L;  2BB6 A;  2JXT A;  2KJ6 A;  1TS5 A;  4KZC A;  3IT4 B;  2UU7 A;  2PPH A;  2RMM A;  2DYM A;  4G3X B;  2WXO A;  4WJP A;  3SR6 A;  3B0A A;  5KHO A;  3Q8C A;  4LK0 M;  3V3X A;  1D5X C;  4XE0 A;  1KLU D;  2BYE A;  4RM8 A;  2KD0 A;  4MGK E;  5IN7 A;  2Y5B B;  1SE3 A;  2K1F A;  5CHW A;  1N60 A;  3RNF C;  4YT0 B;  2LZ6 A;  3Q3O C;  4PS8 A;  4NZL B;  3U52 E;  2XN9 C;  1L4Z B;  1E5W A;  2MJ3 A;  2K9X A;  2WP9 B;  5EE0 A;  2H88 B;  3N1Y C;  4XZ4 A;  2KDM A;  2ON8 A;  4XWT A;  1YJ1 A;  3AE9 B;  3K9O B;  2BVC A;  5HG2 A;  4ZRP A;  2LGD A;  4MEL A;  4YL8 A;  1V1P A;  2B3A A;  2QSD A;  3WAM A;  2IYD B;  3WAO A;  1P3Q U;  2KLC A;  3FIL B;  3U30 A;  2G4D B;  1TTN A;  1DOI A;  3TEY A;  2EMT A;  4TMA B;  3E9S A;  4LDT D;  3TJP A;  4YTN B;  4CO7 A;  3RNB C;  2ZEQ A;  4TKN A;  1JW9 D;  2N9K A;  1S1Q B;  3A1Q B;  3BYT B;  2G3Q B;  1Z5S B;  2JYE A;  1MG8 A;  4M01 A;  4IG7 B;  4YTP B;  3L4P A;  3C19 A;  1ZOY B;  1JML A;  4B0M A;  3LB8 C;  3RCZ A;  3EA6 A;  3AEG B;  1F1H A;  1KM7 A;  1ESF A;  1XD3 B;  4EOY A;  3P4P B;  4TQ0 A;  3M63 B;  3VXW A;  3IHP C;  1WGR A;  5J2R A;  4W9F A;  4ZRQ A;  3L10 B;  5IP4 D;  2HTH A;  2R2O A;  4IC7 B;  1WR1 A;  4TSS A;  2CR5 A;  1E7U A;  3BVZ A;  3N1X C;  2MRP A;  1C1Y B;  4WIP A;  2K0P A;  1B1Z A;  2NPT A;  2MEK A;  2M1M A;  3NG0 A;  1TYG B;  4BKG A;  3Q8B A;  1JQ4 A;  2DLB A;  3X23 A;  4AWJ A;  1E9M A;  2EMS A;  1CJE A;  4S0R A;  3TIX A;  2GBN A;  2RGF A;  1YN4 A;  2O6V B;  5C1Z A;  3CSF A;  5D94 A;  2V9H A;  1R4M B;  2N9E B;  4AJW A;  1WXA A;  4GMV A;  1R4N I;  2RDH A;  3RZW C;  1QOF A;  1GAQ B;  4ZRJ A;  1K53 A;  2Y3A A;  4KGT A;  3WIM A;  2AX5 A;  3KQ4 A;  1QKZ A;  3QAR A;  2BS2 B;  5T8I A;  3ZW3 A;  1VDV A;  3AE7 B;  5D3D A;  3NY5 A;  1SE9 A;  1ISN A;  4OVV A;  3AEF B;  5BMG A;  3TBL D;  3M3J A;  3ZTC A;  1ZDV A;  1RM6 C;  4IDI A;  3DWM A;  3W5V B;  2X8X X;  1N6Z A;  1JRP A;  2YEP B;  4HCP B;  3A4R A;  2KAJ A;  1FNU A;  1IYF A;  3VRB B;  4F8C B;  3BVM A;  4GN1 A;  2GBM A;  1WE6 A;  2PE9 A;  1FFV A;  2KJH B;  2ZW1 A;  2RDB C;  3UGB B;  3WAN A;  1E8Y A;  1YX5 B;  2SEB D;  2WWZ A;  2C7M B;  3V6E B;  4KIK A;  2XK5 B;  2KQ7 A;  3A1Q A;  3RN9 C;  5AZH A;  1TS2 A;  2O2V A;  1VJK A;  1UGJ A;  2LMC A;  1WRD B;  4RGO S;  3WCQ A;  3V62 A;  1QLB B;  3MP9 A;  1L2N A;  2MX2 A;  3SFE B;  1QZE A;  3KWL A;  3NVY A;  2LI5 A;  5BMH A;  4NJ7 A;  1EWY C;  1WJN A;  4HJK A;  1E8X A;  3O13 A;  5E6O A;  4RH6 A;  2IO1 B;  1PDX A;  1FXI A;  1RFK A;  3H7P A;  2CKH B;  2K8H A;  3VVW B;  4LNF A;  3HIZ A;  5J17 A;  4KKI A;  3DBS A;  2G1E A;  3RNG C;  4HRS A;  1IP9 A;  2FBW B;  2YEP F;  4EFO A;  1C9F A;  2BS4 B;  2MWS B;  2WXM A;  4MSQ B;  1TBE A;  3IVF A;  2WDR B;  1FO4 A;  1TZ1 A;  1WR6 E;  2G45 B;  3SD5 A;  1DYQ A;  4EKU A;  3I3T B;  1L7Y A;  4RGN A;  2FNJ B;  3RNC C;  3VDZ A;  3P4Q B;  2MBO A;  2D5G A;  4P1C C;  3APF A;  1H8C A;  2AWT A;  4KGS A;  2DYO A;  4W9J A;  4K7U A;  3MFG A;  4E3C A;  1N5X A;  4ANV A;  2I1K A;  4J3O D;  2KVR A;  2LHD A;  3GE8 C;  3ZNZ B;  2JX5 A;  1Q1O A;  4W9I A;  1XLP A;  4BZA A;  1BXT A;  1UH6 A;  4WWO A;  1JWS D;  4M8M A;  4NJC A;  1WGH A;  1UBI A;  3QA8 A;  1I4R A;  3P4S B;  4IWQ A;  5EE3 A;  3HK0 A;  3RUL A;  3DDC B;  2ZPY A;  3V61 A;  1S3S G;  2KTR A; 
#chains in the Genus database with same CATH homology
 1OGW A;  2IO3 B;  2LAS A;  2NBV B;  1WF9 A;  2R2Q A;  2DZK A;  1PQS A;  1VD2 A;  2JRH A;  3L08 A;  3ZNH B;  3PRZ A;  4BKS D;  2LJ5 A;  4KDI C;  3KUD B;  5D7G A;  3TL5 A;  2IO2 B;  2KDF B;  3PVL A;  3ZDT A;  3SU8 X;  5HKH A;  4IM2 A;  1HE8 A;  1Q0W B;  1UBQ A;  4XC2 A;  1LXD A;  4G50 A;  2ZZP B;  4WAA A;  4BKT A;  4ZRK A;  4EZK A;  2HE7 A;  4JIO U;  2BWE S;  3OJ3 A;  4HPM B;  3DVG X;  3KYC D;  3PSE B;  2QHO A;  2K6D B;  3R7R A;  3ML9 A;  3A9J A;  5CHF A;  5C23 A;  1X1M A;  2KTR B;  2PJH A;  4MGY E;  2FCS A;  2JY6 A;  2KFJ A;  4HDO A;  3OLM D;  4LJP B;  4HK2 A;  2N9P C;  2BKF A;  2ZPN A;  3ZVV A;  1Y8R C;  2N7D A;  1AAR A;  2MP2 B;  4EZL A;  5CHV C;  4HPL B;  3B1L X;  2D3G A;  2LGY A;  3AI5 A;  3LJ3 A;  4AP4 C;  3DCG A;  2JXX A;  4GDK A;  4BBN F;  2KK8 A;  4MJS B;  4ANX A;  2KXJ A;  2LRU A;  2KX0 A;  3EFU A;  3AU5 A;  3AUL A;  3T8M A;  1RAX A;  5LXH A;  3K9P B;  3W1S A;  3GOE A;  4MGI E;  2WX0 A;  4E74 A;  5TR5 A;  2KC1 A;  4DDG D;  1WX9 A;  2KNB A;  5JHB A;  4AOF A;  3R7Q A;  4BVU C;  3PHW B;  3CMM B;  3L54 A;  1WXM A;  4FJY A;  4KIK B;  4MDK E;  4W9K A;  2CHX A;  2KAN A;  5JZE B;  2AL3 A;  1UGM A;  4NPN A;  2D10 A;  5D6J B;  4W9H A;  1J8C A;  3UIN B;  3DOW A;  4WWP A;  2ZVN A;  1WMH A;  2K6Q A;  4FHK A;  4FLH A;  2FCM A;  4FBJ B;  1OQY A;  3QX1 A;  3A9J B;  1JRU A;  1V49 A;  4WJN A;  4MJS A;  1P1A A;  1KJT A;  4I6P A;  4W9G A;  4BKS A;  2DZI A;  1V6E A;  1H4R A;  3BY4 B;  4MM3 A;  3X0W A;  3H7S A;  3A4S C;  3ZRF A;  2DHZ A;  2C7N B;  3OAW A;  2IBI B;  3PV1 A;  4RM9 A;  4DHZ B;  4DHJ D;  1GUA B;  1EO6 A;  4PYU A;  3ECI A;  3QC8 B;  3PHX B;  3TCA A;  3RD2 A;  1WE7 A;  3UF8 A;  2GBR A;  3DVN V;  4LCD E;  3QIJ A;  3SHQ A;  3UQA A;  3PRE A;  1WH3 A;  4ZYN A;  1YX6 B;  2O2V B;  4FJZ A;  1R4M I;  2FAZ A;  2L3Z A;  1UEL A;  3PRM B;  4MH0 E;  4ANW A;  3KVF B;  2KN5 A;  3P2B A;  3R66 C;  2ZCC A;  4I6L B;  2GBK A;  3U7D A;  3ZTD A;  3QK0 A;  1E8Z A;  2JUO A;  1WM3 A;  2NBW B;  2KJ6 A;  2MBB B;  4B9K A;  4GDL B;  4KZC A;  3QWZ B;  2PPH A;  2RSU A;  1J19 A;  2N1V A;  2DYM A;  4G3X B;  4WJP A;  3ALB A;  3B0A A;  5KHO A;  5LLI A;  2KDI A;  5L83 A;  4HVB A;  4GU2 A;  2LXA A;  2BYE A;  4DHZ E;  1GC6 A;  4MEM A;  2KD0 A;  4MGK E;  4RM8 A;  2RR9 A;  1NDD A;  2Y5B B;  2ZCB A;  1GC7 A;  2K1F A;  4II2 B;  5CHW A;  5IAA C;  5BO4 B;  2L76 A;  3PS6 A;  2BKR B;  2LZ6 A;  4PS8 A;  4ZRI A;  3WAL A;  3ZUN A;  4AJY B;  2MBH A;  2M0X A;  2CHZ A;  5CTR C;  4NAW B;  2V3S A;  1E5W A;  4KVG B;  4IWO A;  3MTN B;  2KWC A;  2VRR B;  1LM8 B;  4II3 B;  2FID A;  2LGX A;  3H9D A;  4GSW A;  4NNJ B;  2DX5 B;  4XZ4 A;  5JH5 C;  4ZDV A;  1YIW A;  3A33 B;  3JSV B;  3OJ4 B;  2MBQ A;  4HWI B;  1V5T A;  2FIF A;  1RRB A;  2Z59 B;  3PGE A;  2ASQ A;  3APD A;  2XBB C;  1YJ1 A;  3NZU A;  3HM3 A;  3V60 A;  4HCN B;  2BPS A;  1BT0 A;  3K9O B;  4EEW A;  2L0T A;  3QHT A;  2LGD A;  3UIO B;  4MEL A;  4YL8 A;  4B6W A;  3CST A;  1D3Z A;  3VTW A;  2BYV E;  5GMV A;  1IPG A;  2W9N A;  2B3A A;  2KJR A;  1ZKH A;  3AXC A;  3WAM A;  5DPR A;  2IYD B;  1EF5 A;  4G0N B;  2J0J A;  3WAO A;  5DPW A;  2JT4 B;  4F7Z A;  3W1S C;  2KOX A;  2KC2 A;  3A9K B;  1P3Q U;  2KLC A;  2CHW A;  3ZDM C;  3UQB A;  3U30 A;  3WA0 A;  2G4D B;  1V86 A;  3AU4 A;  1C3T A;  4TUU A;  1TTN A;  4WWN A;  2L8J A;  3H6N A;  2LD9 A;  2LXC A;  2EMT A;  2ZNV C;  4M8N A;  4DWF A;  1P98 A;  4BOZ B;  4LDT D;  3TJP A;  4E71 A;  1P0R A;  4CO7 A;  2LRW A;  2ZEQ A;  4DDI D;  3ZLZ A;  3VUX A;  4TKN A;  1S1Q B;  2M17 A;  5E6N A;  1WM2 A;  4WJQ A;  2GBJ A;  3A1Q B;  2M8S A;  3RYT A;  2BGF A;  4GB9 A;  2G3Q B;  1Z5S B;  4K81 A;  1EF1 A;  3D32 A;  4FAD A;  1MG8 A;  4IG7 B;  1SGH A;  2MBE A;  4PYZ A;  2XEW A;  1WYW B;  1V2Y A;  3DVN U;  2JRI B;  1RFA A;  2FCN A;  2Z0E B;  3R3M A;  2MW5 A;  2KLG A;  3N32 A;  3RCZ A;  3L13 A;  4NY0 A;  4M0W B;  1YD8 U;  4JGH B;  2WDT B;  2PEA A;  2K39 A;  4F1S A;  1KM7 A;  3S2A A;  3ZO5 B;  1XD3 B;  1V9J A;  1WZ0 A;  4LDT B;  4EOY A;  2DYB A;  3Q3J A;  4DXA B;  3M63 B;  4TQ0 A;  2D11 A;  2REX A;  2G4S A;  3VXW A;  3IHP C;  3QQ8 B;  1WGR A;  2KHW B;  3M62 B;  1SIF A;  1V5O A;  2M4N A;  5J2R A;  2JF5 A;  2LUE A;  3Q3F A;  1WJ4 A;  3DVG Y;  2KWV B;  4W9D A;  4W9F A;  4G11 A;  5CX3 A;  3L10 B;  3ONS A;  2NBU A;  5J18 A;  2HTH A;  5DPS A;  2K25 A;  3ZNI D;  2ZNV B;  2AL6 A;  2MP2 A;  2K8B A;  2L7R A;  2R2O A;  4IC7 B;  1WR1 A;  3NZS A;  2AEH A;  2WX1 A;  2N7E A;  2NVU I;  5IA7 A;  2KMA A;  2CR5 A;  3NS8 A;  3ZIM A;  1E7U A;  2MRP A;  1C1Y B;  4KSL C;  5E6P A;  4GOC A;  4W9C A;  4KZ0 A;  2NPT A;  3TMP B;  2J0M A;  2A4Z A;  1NBF C;  2MLB A;  2DEN B;  2M1M A;  3JYU A;  4FN2 A;  4NQK E;  5AZG A;  3RZF A;  4BKG A;  2KDB A;  2PE6 B;  2L00 B;  3DBL I;  4AWJ A;  3X23 A;  3O65 B;  2KX3 A;  1GJZ A;  1V80 A;  2JVC A;  2GMI C;  1WX8 A;  2EMS A;  2ZJD A;  4FHJ A;  3PT2 B;  3VHT C;  4KV2 A;  3TIX A;  2L05 A;  1V81 A;  2GBN A;  2RGF A;  2O6V B;  1Z2M A;  5DCN A;  4ASW C;  2LVQ A;  4EZJ A;  3VFK A;  2C9W B;  3CSF A;  5D94 A;  5C1Z A;  1I42 A;  4JL9 A;  3RUI B;  3KH0 A;  3KYD D;  2FCQ A;  4WQO B;  2N9E B;  4AJW A;  1WXA A;  1KOT A;  2I1J A;  4GMV A;  1R4N I;  2N1W A;  2UWQ A;  1WX7 A;  3PLU A;  4IUM B;  4WJO A;  3RZW C;  3APC A;  2A5U A;  4K7W A;  4HDQ A;  4ZRJ A;  2XK5 A;  5L95 C;  2MA9 B;  4FA6 A;  3VH4 B;  3WIM A;  1NI2 A;  5G55 A;  4OVU A;  2BF8 B;  4GXB A;  4HLE A;  3QAR A;  4W9L A;  2J0K A;  3ZW3 A;  4HXD A;  4PS7 A;  4RMA A;  1OTR B;  3PTF C;  3V6C B;  2KFK B;  3NY5 A;  1SE9 A;  1ISN A;  3CF6 E;  4OVV A;  3TBL D;  3M3J A;  3ZTC A;  1FXT B;  2IZV B;  2FUH B;  3EEC A;  4KDL B;  3EC8 A;  4TQ1 A;  5FR6 A;  2LVO A;  4CYE A;  3B08 A;  4HCP B;  1WJU A;  3A4R A;  4ICV A;  2LWP A;  2HD5 B;  2K8C A;  2OOB B;  2RPQ A;  3HM6 X;  1IYF A;  2CS4 A;  4F8C B;  4GN1 A;  3HHM A;  2GBM A;  4DBG A;  1WE6 A;  4FUL A;  3VH3 B;  2PE9 A;  1VCB A;  4AUQ C;  3ZNG C;  2V4L A;  2AYO B;  3VAW A;  4URK A;  1WXS A;  2KJH B;  3IBE A;  2O6V A;  5JHA A;  4MSM B;  3UGB B;  2HJ8 A;  4XX5 A;  2KDE B;  2NPT B;  3MHS D;  3WAN A;  1TGZ B;  4A3P A;  1WMH B;  1E8Y A;  1OEY A;  1YX5 B;  2KWU B;  3VQI A;  2WWZ A;  2NCN A;  1YQB A;  2C7M B;  2KKC A;  3V6E B;  3WAP A;  2LVP A;  3ENE A;  1KLV A;  2YVC A;  4NAW A;  3L17 A;  4KIK A;  4EUT A;  2D2Q A;  2XK5 B;  4NQL B;  4B95 A;  2KQ7 A;  3JSV A;  1U4A A;  1XT9 B;  1LFD A;  3A1Q A;  2Z0D B;  2KTF A;  4K7S A;  3SDL C;  3VTV A;  4ICU A;  2UYZ B;  2ZVO A;  4W9E A;  5AZH A;  2WYQ A;  1WIA A;  1CMX B;  2RD0 A;  2N4F A;  2NR2 A;  2O2V A;  2KFK A;  3VTU A;  3M95 A;  1WRD B;  3V62 A;  3KW5 B;  2KZR A;  1UD7 A;  1UZX B;  4DHJ B;  5EDS A;  2MX2 A;  3N3K B;  4NJ6 A;  1L2N A;  3LDZ E;  1WGG A;  1E7V A;  1QZE A;  2C7H A;  4TV3 A;  3UIP B;  2BYF A;  3T9L A;  2LI5 A;  1GNU A;  2DAJ A;  4ANU A;  4NJ7 A;  4HJK A;  1WJN A;  1XQQ A;  4PS3 A;  4JQW C;  4X57 B;  2DZM A;  1E8X A;  2D07 B;  5E6O A;  1RLF A;  2IO1 B;  2KQS A;  1K8R B;  1WI0 A;  2IY1 B;  4A20 A;  2NS5 A;  4P7I A;  3H7P A;  3IFW B;  1E90 A;  5AEK B;  4IM3 A;  3PZD A;  2CKH B;  3PPA A;  4JLC A;  1J0G A;  2K8H A;  3VVW B;  5J17 A;  3HIZ A;  3RT3 B;  3DBS A;  4DK5 A;  3ML8 A;  3IG3 A;  4IWP A;  1IP9 A;  1P9D U;  2IO0 B;  4EFO A;  2J7Q B;  2MWS B;  3KUC B;  2DZJ A;  3W1Y A;  2O6V D;  2C60 A;  2L0F A;  4MSQ B;  1TBE A;  3IVF A;  5DPT A;  3EHV A;  1G6J A;  1E8W A;  3BIN A;  2C5L C;  2KTR A;  1OEY J;  1TZ1 A;  1A5R A;  5KHQ A;  1WR6 E;  2G45 B;  3SD5 A;  3U8Z A;  4CHK A;  1I35 A;  2GOW A;  3N30 A;  2EKE C;  4EKU A;  3DPD A;  3I3T B;  2JZ3 B;  1Q5W B;  3DBH I;  4FJV B;  1L7Y A;  2FNJ B;  1T0Y A;  3VDZ A;  3VUY A;  4BBN C;  2MBO A;  3A9K A;  1F9J A;  1WGY A;  3KUZ A;  2V1Y A;  4BFR A;  3H7P B;  4GIV A;  2N9X A;  4KSK C;  3APF A;  4IW0 A;  1H8C A;  2AWT A;  1EUV B;  1WFY A;  1M94 A;  4I6N B;  5LXI B;  1LQB A;  1ZW7 A;  1WGD A;  2DYO A;  2JZZ A;  2KO3 A;  2OJR A;  2DAF A;  3JW0 X;  4K7U A;  4W9J A;  3ZRC A;  4E3C A;  2CU1 A;  4ANV A;  2I1K A;  3VUW A;  4K1R B;  1WZ3 A;  2KVR A;  3GZN I;  4GDL A;  2JPH A;  1WJ6 A;  3NHE B;  3MJW A;  1WXV A;  2IY0 B;  3ZNZ B;  4N9F 4;  2JWZ A;  3NOB A;  3L0W B;  4J6I A;  5D2M B;  3QCA A;  4W9I A;  1Q1O A;  1WY8 A;  1UH6 A;  3L16 A;  3JVZ X;  4WWO A;  3H1U A;  3DQV A;  2MCN B;  4M8M A;  3PRP B;  1ZGU B;  4IM0 A;  4LJO B;  1WGH A;  1UBI A;  3QA8 A;  4GDK B;  3QJZ A;  4A3O A;  2YLM A;  2MQJ A;  5G2N A;  3PLV A;  5AZF A;  2KMC A;  3QAQ A;  2BWF A;  3C0R B;  4IWQ A;  4MGZ E;  1GG3 A;  3ZKJ C;  3DBR I;  3HK0 A;  3RUL A;  4BOS C;  3DDC B;  2ZPY A;  3V61 A;  1S3S G;  2MSE D;  4GGQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...