2ASQA

Solution structure of sumo-1 in complex with a sumo-binding motif (sbm)
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
77
structure length
77
Chain Sequence
YIKLKVIGQDSSEIHFKVKMTTHLKKLKESYCQRQGVPMNSLRFLFEGQRIADNHTPKELGMEEEDVIEVYQEQTGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Small Ubiquitin-like Modifier (SUMO) Recognition of a SUMO Binding Motif: A reversal of the bound orientation
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein binding
molecule keywords Small ubiquitin-related modifier 1
total genus 13
structure length 77
sequence length 77
ec nomenclature
pdb deposition date 2005-08-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF11976 Rad60-SLD Ubiquitin-2 like Rad60 SUMO-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 2asqA00
3CMMB 2GBNA 3HK0A 2C7NB 1WXMA 4BKGA 4G0NB 4XZ4A 1G6JA 2PJHA 1X1MA 3L13A 3ZDTA 3WAMA 3KUZA 3UF8A 4W9EA 2IO1B 4NJ6A 2KDEB 1WJ6A 4DDID 1WI0A 3W1SA 5C23A 4WQOB 1OEYJ 3K9PB 1UGMA 1UD7A 3DOWA 3EHVA 4LDTD 4FBJB 4DBGA 4PS8A 3DVNU 2K25A 2DZMA 3R7QA 3QA8A 1Z2MA 2DHZA 2WDTB 2XBBC 3NY5A 3PTFC 4RMAA 3UIOB 4ANWA 4M8NA 5CHVC 1WM3A 3KYCD 5JHAA 3SU8X 3ZNZB 1EUVB 2MQJA 3TL5A 2MA9B 2LXAA 3NS8A 4NQLB 4DXAB 2BWES 2AEHA 2JZ3B 3DVGY 4MEMA 4ICVA 1V86A 2IY0B 2LVQA 5E6NA 4ANXA 5BO4B 3CF6E 4AP4C 1FXTB 2ZVNA 4DWFA 4ANVA 5L83A 1J19A 2KX0A 2FCMA 3SD5A 3UQAA 2C9WB 3VQIA 1S1QB 2KVRA 3A9KA 1NDDA 2MSED 3EECA 4HK2A 4KV2A 2K39A 2ZPNA 1WGHA 1IYFA 2K1FA 2G3QB 4MSMB 1WJ4A 1KLVA 1JRUA 4TQ0A 3LJ3A 3CSFA 2NVUI 5C1ZA 2EMTA 1J0GA 3R7RA 3VVWB 3ALBA 1WR6E 3OLMD 1V5OA 2XEWA 2GOWA 3PRZA 4LJPB 3CSTA 1YQBA 4NY0A 3PPAA 1WY8A 2NS5A 2N1VA 1XT9B 4I6LB 1UBIA 1P1AA 4KZCA 3PHXB 2RD0A 1RFAA 3RCZA 4FLHA 2C7MB 4DHZE 3V6EB 3TMPB 3DBRI 3M62B 1KOTA 3ZNID 1WGGA 3NZSA 4K7WA 4XX5A 1S3SG 2KX3A 2KWUB 3ZVVA 1Q0WB 1IP9A 2I1JA 4FN2A 1Y8RC 3GOEA 1GNUA 3TCAA 3JVZX 4EZKA 2CU1A 4TUUA 3V6CB 2EKEC 1WH3A 3VAWA 3AXCA 3H7SA 3B0AA 3MHSD 2JWZA 2KJHB 3DBLI 3KUDB 4II2B 1H8CA 4AUQC 2KO3A 2ZEQA 3B1LX 1YX6B 3RZFA 1OQYA 1H4RA 1E90A 2DYBA 2L76A 3ZLZA 2R2OA 2DENB 3A1QB 5LXIB 3PRMB 4KIKB 2CKHB 1UBQA 2K8BA 2V3SA 2C60A 1Q5WB 1P9DU 1SGHA 2L7RA 3PRPB 2PE6B 4FJVB 2KQ7A 4ZRIA 2Z59B 2PE9A 5TR5A 2CR5A 1EF1A 2OOBB 2K6DB 2ZVOA 3PT2B 5GMVA 4N9F4 3VXWA 2N9XA 2MLBA 2A4ZA 2DZKA 2K8HA 3LDZE 3Q3JA 2GBKA 2BKFA 3PS6A 2G45B 2ZZPB 4I6NB 3X0WA 1EF5A 3IHPC 4W9FA 3MTNB 3VDZA 4F7ZA 2FCQA 2GBMA 2LI5A 4KZ0A 5CTRC 5E6PA 1E8YA 3QIJA 1WXAA 2G4DB 2NR2A 2FUHB 4GXBA 4LDTB 4MGIE 2KWCA 2RSUA 4BKTA 2WWZA 3ZNHB 5CX3A 2ZNVC 4JL9A 4PYZA 2J0MA 2DYMA 1P0RA 4GDLA 2DX5B 5AEKB 1RRBA 3L10B 1K8RB 2RPQA 2KFKB 2B3AA 2CS4A 2REXA 2LRUA 1P98A 4ANUA 4EOYA 3ZO5B 2KDBA 3HHMA 1I42A 2D07B 2M4NA 1V49A 2JF5A 4GU2A 4TQ1A 1IPGA 3TIXA 2IZVB 4IWQA 2MRPA 3DVGX 3WANA 3IFWB 3X23A 2JY6A 3VTVA 2JZZA 1QZEA 3NZUA 4MELA 3QHTA 2DZJA 4WJQA 2KMCA 2QHOA 3VH3B 2KOXA 3VTWA 4P7IA 2BYFA 3L54A 2V4LA 4NPNA 1V5TA 1WX7A 2JRHA 3QQ8B 1Q1OA 3A33B 1P3QU 1WFYA 4JIOU 4IWOA 4MDKE 2ZPYA 4A20A 2BKRB 3R66C 2J7QB 4DHJD 1A5RA 4A3PA 1EO6A 2LGYA 1ISNA 3N32A 3TJPA 2HTHA 4DHJB 1AARA 1RAXA 2BF8B 3H1UA 4HPMB 5D2MB 5DCNA 4EEWA 4EZJA 2UWQA 2JPHA 4WAAA 3R3MA 1GJZA 4K7UA 4LJOB 3AULA 4NAWA 2KNBA 4J6IA 3D32A 1R4MI 1GUAB 2YLMA 3AU5A 4GDKB 1I35A 2GBJA 4BBNC 2IY1B 4GSWA 4DK5A 1GC7A 1WXVA 4IWPA 3QK0A 4K1RB 2MWSB 4ZRJA 5JH5C 2DYOA 3TBLD 4EFOA 2O2VA 2IO0B 3S2AA 1C1YB 3H7PA 2AYOB 2N7EA 4NJ7A 2IYDB 2KQSA 4FULA 4W9KA 4BVUC 4G11A 1LXDA 2O2VB 3ZTDA 4B9KA 2WX1A 3HM6X 1WGRA 4ZRKA 4CO7A 4URKA 1HE8A 3BINA 4DDGD 3SHQA 2DAFA 1MG8A 4HWIB 2FAZA 2LGDA 3V61A 3NOBA 2N9EB 4KVGB 5IAAC 1WE6A 4BOZB 4XC2A 2MBQA 1L2NA 3WA0A 3VUXA 4WWPA 2FCSA 1WRDB 3DPDA 2KZRA 3I3TB 3QC8B 2A5UA 2KDIA 2KTFA 4WJOA 4ICUA 1TBEA 1WMHB 3A9JA 2AL3A 1WMHA 3A9JB 4KDIC 2LVPA 3MJWA 4W9LA 5J18A 3VFKA 4W9DA 4FHKA 1VD2A 2AWTA 3L0WB 1YJ1A 4I6PA 1KM7A 2KANA 3EFUA 3A4SC 4GDKA 1V2YA 3UINB 3O65B 2I1KA 3QAQA 1ZW7A 3ZRCA 2KXJA 2OJRA 2WYQA 2Z0EB 4PS7A 4AOFA 5EDSA 2NPTA 3ML9A 2UYZB 2DAJA 1D3ZA 5KHOA 2W9NA 2KLGA 2BYEA 5G55A 4BBNF 4E3CA 4II3B 5AZGA 4HJKA 1WIAA 4LCDE 4EKUA 3A1QA 4WWOA 4BOSC 2KFKA 4X57B 5IA7A 4F8CB 2MBEA 3QCAA 4KSKC 1OEYA 3T8MA 5J17A 2PPHA 2RGFA 4RM8A 4IM3A 4A3OA 2IBIB 3ZKJC 2LD9A 2M1MA 1WM2A 3B08A 2XK5B 2ZJDA 5AZFA 3SDLC 1VCBA 4EZLA 3JSVA 3OAWA 1WR1A 3ENEA 4MGKE 3WAPA 3ZTCA 1GG3A 1C3TA 2JT4B 3H7PB 3PV1A 3VH4B 4HCNB 4MGZE 3U7DA 2L00B 2JXXA 3L08A 3JW0X 3U30A 3UQBA 3IG3A 4CHKA 3H6NA 4MM3A 3U8ZA 1E7VA 1Z5SB 3PREA 3V60A 3KVFB 2BGFA 2KWVB 4B6WA 3ZUNA 2K8CA 2KTRB 3WIMA 4AJYB 3RUIB 3ONSA 3ZNGC 1E8XA 3DBHI 2KTRA 1R4NI 4MH0E 4OVVA 2N9PC 2RR9A 3JYUA 4HXDA 3RT3B 1V9JA 3IVFA 4JQWC 4G3XB 3VUYA 4BFRA 1V81A 2KKCA 1TZ1A 2EMSA 2FCNA 3GZNI 2DZIA 2D2QA 2KMAA 2YVCA 3APDA 2KLCA 3PGEA 3N3KB 2KJ6A 4M0WB 2C7HA 2G4SA 3DDCB 3T9LA 2NBWB 3APCA 5FR6A 2M8SA 3DBSA 2KC2A 3KUCB 4ZDVA 5JHBA 2O6VD 2D3GA 2HD5B 3QX1A 3ZDMC 1LFDA 3PLVA 4HLEA 3BY4B 3EC8A 3P2BA 2D10A 1PQSA 2L05A 1WZ3A 2KN5A 3RZWC 2ASQA 1NBFC 4FJYA 1L7YA 4IUMB 5DPTA 4FJZA 3AI5A 1TTNA 2MW5A 3RD2A 1WJNA 2FNJB 4GIVA 3UIPB 3RYTA 3UGBB 4IG7B 4NQKE 2MBBB 3ZRFA 4WWNA 4K81A 4E71A 3ML8A 5L95C 5KHQA 2MBOA 2VRRB 4WJPA 5J2RA 4HPLB 1E7UA 2ZNVB 2KD0A 1WE7A 4CYEA 2MBHA 2O6VA 3WAOA 2GMIC 4GMVA 2L0FA 3DQVA 5D6JB 2AL6A 3ZIMA 4MGYE 4GB9A 1ZGUB 2KHWB 5LLIA 2L3ZA 2CHWA 2LGXA 5D7GA 3QJZA 5CHWA 1OGWA 2V1YA 4MSQB 4TKNA 4G50A 2D11A 1WJUA 1SIFA 3V62A 2XK5A 1YD8U 2GBRA 2N1WA 4PYUA 5DPSA 3ZW3A 5HKHA 3ECIA 5LXHA 2NBUA 2C5LC 2KK8A 4GOCA 3A9KB 3QWZB 4BKSD 3NHEB 2J0JA 2JUOA 1J8CA 1LM8B 1E8WA 2CHXA 1M94A 2LASA 2ZCCA 2J0KA 4YL8A 2KC1A 1LQBA 3KH0A 2Y5BB 3PLUA 2IO2B 4B95A 4DHZB 1NI2A 1GC6A 3L17A 2M0XA 3N30A 4HDOA 4IM2A 4TV3A 3DVNV 1XD3B 4KDLB 2LRWA 4KSLC 1E5WA 4W9IA 4GDLB 3HIZA 2LUEA 4E74A 2LXCA 3JSVB 4PS3A 2BPSA 4NAWB 1V80A 2LJ5A 5CHFA 4AWJA 3PSEB 2L0TA 2MX2A 2KJRA 3KW5B 4KIKA 1T0YA 2Z0DB 5G2NA 5AZHA 2IO3B 4HDQA 4JLCA 5DPWA 1TGZB 3M95A 4W9HA 4GGQA 5E6OA 4WJNA 1CMXB 1U4AA 2HJ8A 3APFA 3M63B 4ZYNA 2NPTB 2K6QA 4IW0A 2KDFB 1WZ0A 1XQQA 2LZ6A 3QARA 2FIFA 2LVOA 3DCGA 1WX8A 2NCNA 1WF9A 1WGYA 1WYWB 3H9DA 3VTUA 3VUWA 3M3JA 3OJ3A 1ZKHA 4AJWA 2JVCA 4W9GA 4HVBA 1V6EA 4K7SA 4W9JA 1RLFA 3VHTC 5DPRA 2LWPA 4IM0A 1F9JA 2O6VB 4RM9A 1WX9A 2HE7A 3W1YA 1WGDA 1UZXB 1UH6A 3RULA 3W1SC 4IC7B 1UELA 4OVUA 4GN1A 3L16A 3K9OB 4HCPB 1YX5B 2NBVB 1E8ZA 1OTRB 2BWFA 2N7DA 3AU4A 2MP2B 2WX0A 3WALA 3HM3A 3PHWB 2KFJA 2JRIB 2PEAA 2MP2A 4M8MA 1BT0A 3C0RB 3IBEA 2ZCBA 3KYDD 4EUTA 4FADA 4JGHB 2R2QA 2MCNB 4F1SA 3A4RA 2BYVE 4MJSA 5JZEB 1KJTA 5D94A 3Q3FA 1WXSA 4MJSB 2FIDA 4BKSA 2N4FA 4W9CA 4FA6A 2L8JA 3PVLA 3OJ4B 4FHJA 4NNJB 1SE9A 1YIWA 4ASWC 2M17A 3PZDA 2CHZA
chains in the Genus database with same CATH superfamily
1BXTA 1EM7A 4K3CA 4G0NB 1G6JA 5HFYA 1QQRA 1IBXB 3FILB 5C23A 4WQOB 3LXFA 1UD7A 1VR9A 4LDTD 3DVNU 3DBHB 3R7QA 3QA8A 2WDTB 4RMAA 4ANWA 4M8NA 4YSYB 5JHAA 3ZNZB 3TL5A 3NS8A 4XYCA 4DXAB 3GZNB 2AEHA 3DVGY 5E6NA 3CF6E 4DWFA 4ANVA 4YTNB 1J19A 2LHEA 3UQAA 2C9WB 3VQIA 3IXSA 4NJCA 4ZYSA 1N63A 1IYFA 3PO0A 4LLGM 5C1ZA 2EMTA 1J0GA 3GS2A 3AE4B 4A8XC 1V5OA 2GOWA 1HTOA 4GLSC 4LJPB 1ET6A 3N20C 5IN7A 1FEHA 4I6LB 1UBIA 3N1YC 3PHXB 1RFAA 2JZPA 1AN8A 3ZNID 4K7WA 1S3SG 2KWUB 4OZCA 4EZKA 2JSVX 3AXCA 1R4MB 2W55A 3MHSD 1VZ6A 2M0AA 2KJHB 3KUDB 4A9AA 3KWLA 4ACFA 1J7CA 1E90A 3ZLZA 3Q8BA 2DENB 1L6VA 1XLOA 2V3SA 1SGHA 5D3DA 4FJVB 4ZRIA 3I9V1 1D5XC 1LO5D 2ZW1A 3ETRA 1EU4A 1PGAA 3LDZE 5BMHA 2BKFA 2GLSA 4I6NB 1F1HA 1BUIC 3VDZA 2JWUA 2LI5A 4KZ0A 5CTRC 1E8YA 2G4DB 4LDTB 2FUHB 3NS1A 2K5PA 3ZNHB 1KH0A 4PYZA 1P0RA 4GDLA 1XXGA 2RPQA 2N9LA 2B3AA 2CS4A 4P6VF 1J7BA 2INDC 1QOAA 3Q14C 1HZ5A 4B0MA 4M01A 1C4CA 3DVGX 3IFWB 3X23A 3W5UB 2JZZA 3QHTA 4CQNA 2KMCA 2QHOA 2KOXA 4P7IA 4NPNA 2JRHA 2K3UA 3GE8C 1FXAA 2ZPYA 2BKRB 2BYTA 4HRSA 1FMAD 4RGTA 1AARA 4EEWA 4EZJA 2JPHA 3MC9A 4ZHPA 4H2AA 3ZXVA 3AU5A 2GBJA 1RM6C 4PT5A 1GC7A 1WXVA 4K1RB 1YJJA 1JWAD 5JH5C 3TBLD 2O2VA 1L0XB 2ON8A 1C1YB 2AYOB 2IYDB 4RF1A 1KFYB 4G11A 2O2VB 4RNAA 3HM6X 1WGRA 4CO7A 3V61A 4LTUA 1K50A 2QEJC 4BOZB 2RDGA 4N59A 4XC2A 2MBQA 4WWPA 1FNUA 1NI3A 3I3TB 2WXIA 2JYEA 1TBEA 2G9HD 1VZ8A 3FAHA 2INNE 1M4VA 4KDIC 2QJLA 3MJWA 3VFKA 4W9DA 1VD2A 1QILA 2JYTA 3EFUA 2J52A 4GDKA 2K0PA 2KXJA 2OJRA 3NRZA 2NPTA 2DAJA 1TIFA 4JWUC 2YEPF 1L0VB 1YN3A 4E3CA 3RNBC 5AZGA 3A1QA 3IT4B 5IA7A 2W82A 2BBCA 1F52A 2INCC 1WWTA 2K9XA 1YMHE 5J17A 2PPHA 1B1ZA 4IM3A 2LD9A 1A70A 1OFFA 2G1EA 3B08A 2XN9C 3NJTA 4MGKE 1GG3A 1TY2A 3ABVB 2L00B 4ZRPA 2V4IB 2JXTA 2J53A 4MM3A 3WCQA 2KWVB 3KWVA 3H8HA 4HKQA 2K8CA 1E9MA 1I4RA 3IT6B 3RUIB 1V97A 2WLBA 1R4NI 4MH0E 1GB4A 4HXDA 2KKCA 1D5ZC 2D2QA 2Y5PA 2KLCA 4M0WB 2KJ6A 4DQOC 3T9LA 5FR6A 1SJHD 3TUOA 3DHGC 2O6VD 2D3GA 3ZDMC 1HTQA 4HLEA 2ZW0A 3BY4B 2D10A 1WZ3A 2L05A 2KN5A 1CZPA 1MPEA 4IUMB 2ASQA 2QILA 5DPTA 3RZWC 3AI5A 3DWMA 2WXFA 1N6ZA 3U2SC 3V05A 1JWBD 4K81A 2GB1A 5L95C 5KHQA 2MBOA 4C4VB 3DHHC 1TT5B 3EUB2 4ITKA 2KD0A 1WE7A 4CYEA 2GMIC 4C4VA 4RGMA 2L0FA 1GPXA 1SXTA 1ZGUB 2KHWB 5D7GA 3L4PA 4MSQB 4TKNA 2D11A 1SIFA 3DWGC 2WXHA 1DOIA 2QSDA 2PMVA 2N1WA 1PYWD 4XGAB 3ZW3A 4A55A 3ECIA 3NHEB 2JUOA 1TS2A 1LM8B 1M94A 1ZUD2 2KC1A 4B95A 1R7SA 3N30A 1NYRA 1KLUD 2AQ1B 2PW9A 4KSLC 5LNK1 3HIZA 2LUEA 4E74A 4AWJA 1F2RC 5CHFA 2L0TA 3E56A 1T0YA 3MP9A 2QMTA 2IO3B 5DPWA 1ZDVA 1V1OA 4W9HA 4GGQA 5E6OA 1L4ZB 4WJNA 1GOZA 2K6QA 4ZRQA 2LZ6A 3QARA 1BMLC 1WX8A 2SEBD 3DHIC 1WYWB 3H9DA 4HVBA 4W9JA 5DPRA 4IM0A 1IBXA 1F9JA 2KACA 4RM9A 3W1YA 1UZXB 4IC7B 1UELA 4HCPB 1YX5B 1OTRB 2BWFA 3PHWB 3C0RB 3IBEA 4JGHB 5IP4D 2R2QA 1D6EC 2BYVE 4MJSA 4YXDB 5JZEB 1KJTA 2MJEA 4RGNA 4MJSB 5HG2A 4W9CA 2N7JA 3AEBB 1YIWA 1WGKA 4ASWC 2M17A 4A3PA 3CMMB 1N60A 2GBNA 3HK0A 1I7HA 1T6BX 1L4DB 2C7NB 4NAMA 1SE3A 2PJHA 3WAMA 3KUZA 3RMKC 3W1SA 3BYTB 5T8IA 3DOWA 1RWSA 5EE0A 1EWYC 4PS8A 1DYQA 5CHVC 1WM3A 2X8XX 3SU8X 2MQJA 2MA9B 2LXAA 4KX6B 4MEMA 4ICVA 3VRBB 4XWTA 1F2RI 2PKOA 3T3NA 2FCMA 2FBWB 1S1QB 3A9KA 1XEEA 2TSSA 5MPOA 2K1FA 2G3QB 2BS3B 1YN4A 3R7RA 3OLMD 3B2GA 4NY0A 1MG4A 2NS5A 2N1VA 1XT9B 2WP9B 1P1AA 2LMCA 2RD0A 4FLHA 4DHZE 3V6EB 3TMPB 5C2TB 3DBRI 2HTME 1CQVA 1WGGA 3NVYA 1IP9A 1Q0WB 3TCAA 3JVZX 4TUUA 3V6CB 3VR8B 3AE2B 3B0AA 2WS3B 3FILA 2KO3A 1UF0A 3B1LX 1YX6B 5JXVA 1VJKA 2DYBA 1HQRD 3A1QB 4KIKB 1HZ6A 2L7RA 2PE9A 2OOBB 2ZVOA 1ZOYB 3PT2B 4N9F4 2N9XA 2NTSA 2DZKA 2K8HA 3Q3JA 2G45B 3TEXA 3MTNB 2M19A 4HJGE 3GB1A 4GXBA 3R8BA 2WXKA 2RSUA 2ZNVC 1I4XA 2DYMA 4HKZE 5AEKB 1CJEA 1K8RB 2LRUA 1P98A 2KDBA 1NENB 3HHMA 1HEZE 2Y5CA 3AM9A 5BYRA 1FIQA 2K22A 1E7PB 1UUPA 4GU2A 1ACCA 2J4XA 4TQ1A 3N1ZC 2JY6A 3VTVA 2DZJA 1SEBD 2IJ0A 2DNFA 4L1BA 1WX7A 3BVMA 3AECB 3CWIA 5IO9A 3A33B 1P3QU 4JIOU 4MDKE 3EFCA 5HHDG 1A5RA 3IAS1 4DXFA 5BYQA 3N32A 3H1UA 3ZJUA 2E6XA 2UWQA 1HA5A 4NAWA 3P4QB 2I2YA 4J6IA 5D3IB 2EKIA 1QOFA 3AH7A 1R4MI 2YLMA 2WXJA 4GDKB 2BS2B 5EE9A 4GSWA 4DK5A 2BS4B 4EFOA 1C78A 4W9KA 3P4RB 2KQSA 1AWDA 5L83A 2LFIA 2WX1A 3MC0B 1HE8A 2DAFA 4HWIB 4M00A 4A6QA 1C79A 2WXQA 3WA0A 2KZRA 2KAJA 3QC8B 3ZGZA 4WJOA 4ICUA 1WMHB 3A9JA 2BB6A 1EWCA 2AL3A 3AEDB 4L2YA 1WMHA 3A9JB 1K53A 3BYYB 1QF6A 2I38A 1YJ1A 2B76B 2KANA 4N58A 3O65B 3QAQA 5TSSA 4AOFA 5EDSA 2UYZB 1JWSD 3SFEB 2W9NA 4BBNF 4II3B 4C80A 1XLNA 2LHDA 3IAM1 1ZDXA 1WIAA 1GAQB 4LCDE 1ET9A 2QCZA 2WU5B 5AUIA 4X57B 2MBEA 4KSKC 4ARCA 1PDXA 1OEYA 2CU3A 1C77A 3T8MA 4RM8A 2IBIB 2M1MA 1VCBA 4BZAA 1WR1A 4C00A 3WAPA 3ZTCA 3FKYA 2E3TA 3PV1A 4RGOS 3U7DA 2RDBC 3L08A 3U30A 1SF0A 4CHKA 4MT5A 3H6NA 1PGBA 1E7VA 1Z5SB 3HRDD 4P16A 4IOIE 3ZUNA 2KT7A 2WXRA 3B2FA 3ONSA 3DBHI 1JW9D 4OVVA 2RR9A 1CK1A 3IVFA 2WXOA 4G3XB 3VUYA 2FCNA 3GZNI 2DZIA 3I57A 2C7HA 3DDCB 4XDCA 3KUCB 2KC2A 3HUIA 3T3OA 2QDFA 3VR9B 3PLVA 3P2BA 1PQSA 4FJYA 3PZ8A 1TKEA 4FJZA 1P7EA 1C76A 4B0EA 2OJWA 3UGBB 4IG7B 2PIAA 2MBBB 2MJDA 3HVZA 2GI9A 2VRRB 1AW7A 4HPLB 1F77A 1L5PA 2MBHA 3GE3C 2O6VA 3WAOA 3ZQ4A 4GMVA 3DQVA 2AL6A 4MGYE 5I4DA 3RNFC 5CHWA 1V1PB 3BIID 1WJUA 3V62A 2XK5A 1FO4A 4ZHOA 3RFZB 3AEFB 2NBUA 4LNFA 3QWZB 4BKSD 1I4HA 2LASA 2LUMA 1WSPA 1SE4A 2XNAC 2J0KA 3PLUA 2Y5BB 2IO2B 4DHZB 3L17A 4IM2A 2R61A 4TV3A 2X38A 2LRWA 4KDLB 4GDLB 2KMMA 4PS3A 1V80A 3PSEB 3PZDA 4KIKA 1QOGA 4YTMB 5G2NA 1N5WA 4HDQA 1TGZB 2DLBA 3APFA 1WZ0A 3DCGA 1R4NB 2ACZB 3VTUA 1JWUD 1ZKHA 3LB8C 1NVID 5FR3A 3EGRA 3VHTC 1RLFA 2LWPA 1YQ4B 1HXYD 1P7FA 1KRHA 3RNEC 1WX9A 2HE7A 4MM3B 3FC4A 4WWMA 1MI0A 3L16A 3K9OB 1FPYA 2WNMA 1JCKB 3U52E 2NBVB 1E8ZA 3OG5A 2WX0A 1E0ZA 1XO3A 2PEAA 4XDDA 1OQRA 1RFKA 2ZCBA 2M56B 2MCNB 5GXGB 4KKJA 2KVZA 3BVZA 5D94A 1XLPA 3Q3FA 1C9FA 2FIDA 4ZOHC 4BKSA 1KTKA 3OWEB 4FA6A 3PVLA 4FHJA 4NNJB 1SE9A 2CHZA 3BZDB 1WXMA 4BKGA 4XZ4A 2D5GA 1X1MA 3ZDTA 1IUEA 3UF8A 2MHJA 2IO1B 4NJ6A 1TKYA 2KDEB 4DDID 1WI0A 2WXGA 3K9PB 3PZ7A 2SAKA 2CJNA 2MJ3A 4HPPA 2K25A 2DZMA 1JRPA 2MH7A 3UIOB 1Z2MA 2DHZA 3NY5A 3PTFC 3AE9B 4C56C 2BWES 2JZ3B 1UWMA 1V86A 2IY0B 4XWWA 1N61A 2LVQA 2WXMA 4ANXA 5BO4B 1ESFA 2JQRB 2Y3AA 1Q10A 1SIJA 4HK2A 2ZPNA 1WGHA 1WJ4A 1KLVA 1JRUA 4TQ0A 2NVUI 3ALBA 2BQQA 2RPVA 2XEWA 2N0SB 3Q6BA 2WU2B 1YQBA 3PPAA 3Q3MC 4N6EB 1TJEA 2C7MB 1KOTA 4XX5A 3VRAB 2KX3A 3ZVVA 4FN2A 3GOEA 1GNUA 2CU1A 2EKEC 1WH3A 2PTLA 3VAWA 4II2B 3DBLI 1H8CA 1YJIA 2ZEQA 2KYWA 2L76A 2QIEB 5LXIB 1FXIA 1TS4A 4WH4A 1Q5WB 1P9DU 2KQ7A 2Z59B 5TR5A 2CR5A 5GMVA 3VXWA 1NEKB 4Q2JA 4PK1A 2MLBA 4L23A 2A4ZA 2GBKA 3PS6A 1EF5A 1RYJA 4F7ZA 5E6PA 3N9YC 4WIPA 4WAFA 4MGIE 2KWCA 5G5GA 4NZLB 3TSSA 3V3XA 4JL9A 2J0MA 1RRBA 3L10B 1TS3A 4ANUA 1OQQA 4EOYA 2W3RA 2M4NA 2IDYA 1V49A 4S0RA 1ENFA 1IPGA 1QOBA 3TIXA 2LGSA 2MRPA 2D3AA 3VH3B 3SR6A 3VTWA 2V4LA 1V5TA 3QQ8B 4EE2A 2ONQA 1T5XD 3R66C 2J7QB 4AQ7A 1EO6A 2LGYA 4DHJB 4HPMB 5DCNA 2BF8B 3MJ5A 5D2MB 1MVKA 2YEPB 4K7UA 4LJOB 3AULA 2KNBA 1GUAB 4BBNC 2IY1B 1XCTL 3P63A 4MH8A 1QT9A 4IWPA 3QK0A 4ZRJA 5G5HA 3TEZA 2DYOA 4RF0A 2V3PA 3H7PA 4BVUC 2N7EA 4NJ7A 4FULA 4B9KA 4YSZB 4URKA 3BINA 4DDGD 4JX1C 3SHQA 2LGDA 3NOBA 2N9EB 4KVGB 5IAAC 1WE6A 3VUXA 2RDHA 5C3JB 2FCSA 3DPDA 3O13A 2WXPA 2KTFA 3RNCC 2JU6X 5J18A 3J9CA 1ZXHA 4FHKA 1FRDA 1TZOA 4I6PA 2W54A 2J42A 1V2YA 3UINB 2I1KA 3NZ3A 2WYQA 5KHOA 1SJED 2KLGA 2BYEA 5G55A 3W5VB 1I4GA 1PFDA 4F8CB 2Z8LA 3QCAA 3B9JA 2ICIA 1MFWA 2INPE 4RFBA 2D3BA 4US9A 3ZKJC 1ZPSA 5AZFA 3AE7B 3OAWA 2WQYB 4AS1A 1SSNA 3UI3A 1C3TA 2JT4B 3VH4B 1J7AA 4MGZE 2LEKA 4QAYA 2N9KA 3JW0X 4A90A 3U8ZA 3PREA 3V60A 3NG0A 4B6WA 2KTRB 3WIMA 3ZNGC 1E8XA 2KTRA 2N9PC 3RT3B 3AMZA 3RI7C 4REZA 4BFRA 1TZ1A 2EMSA 4P1BC 1VRAB 2L32A 2PLPA 2KMAA 3APDA 2NTTA 3PGEA 3N3KB 4KGTA 2G4SA 3APCA 2M8SA 3DBSA 3P1MA 5JHBA 2HD5B 3Q2AC 1ROEA 1T0SC 1GJZA 3RD2A 1TTNA 1WJNA 1TS5A 1PUTA 3RYTA 1AYFA 4WWNA 2HDEA 4WJPA 5J2RA 2ZNVB 2L1AA 3ZIMA 4GB9A 1OGWA 4G50A 3CIRB 2OHFA 3TEYA 3AE3B 1YD8U 2GBRA 1ZXIA 5HKHA 2KWDA 2KK8A 3AE1B 2KDMA 3I5JC 1MJDA 4YL8A 1GC6A 2M0XA 4HDOA 1XD3B 4OZBA 3AV8A 4W9IA 3Q3NC 2AQ3B 5AUKA 3AB5A 4DXGA 1FRRA 3KW5B 2Z0DB 1SB3C 5AZHA 4JLCA 2BTEA 1LGRA 2HJ8A 3M63B 3RCZA 2KDFB 3ZJVA 3Q8AA 1TKGA 2NCNA 1WF9A 1WGYA 2EELA 3VUWA 3M3JA 4JWSC 3OJ3A 3KQ4A 4AJWA 5H92C 2VH2A 2JVCA 1YN5A 1STEA 1PGXA 4USAA 3ZJTA 2O6VB 4GN1A 1V1PA 2KN4A 5IKCM 2V0GA 3AE6B 3AU4A 2MP2B 4LNIA 2IGDA 4WURA 2WHIA 1UGJA 2MP2A 3KYDD 1YNTE 4FADA 5EE1A 3A4RA 2QC8A 3R2TA 4OZAA 4YWGG 1QLBB 2V9HA 2LJIA 2N4FA 2L8JA 1JROA 4BAXA 3BVGA 4LNNA 3L13A 2JX5A 3GP7A 1T0RC 4W9EA 1FNWA 1WJ6A 1IGCA 1OEYJ 1UGMA 3EHVA 4FBJB 4DBGA 4TSSA 1L0YB 2XBBC 3KYCD 1EUVB 2H88B 2VZKB 4NQLB 1VDVA 5BMGA 1TYGB 1JWMD 4AP4C 1FXTB 2ZVNA 2KX0A 3SD5A 2KVRA 1NDDA 2MSED 3EECA 4KV2A 2K39A 2CJOA 4MSMB 3LJ3A 3CSFA 4OHJA 5H8YE 3VVWB 1WR6E 3P42A 4UDUC 3PRZA 3CSTA 4M0WA 1T0QC 1WY8A 4US8A 2Q5WD 4KZCA 1K51A 1GB1A 4RCOA 4XE0A 5HI1A 3M62B 3P4SB 3AEGB 3NZSA 4OVZA 2I1JA 1Y8RC 1JQ4A 5IOIA 3H7SA 2JWZA 4AUQC 3W2DA 3RNAC 3RZFA 1I4PA 1OQYA 2UU7A 1H4RA 3AE5B 2R2OA 1YOVB 2WDVB 3Q3OC 3PRMB 2CKHB 1UBQA 2K8BA 2DWQA 2C60A 4YT0B 4KGSA 3PRPB 2PE6B 4K3BA 2LGIA 1EF1A 2K6DB 1JMLA 4LK0M 1UNSA 1D5MC 2HJ1A 4YTPB 1E6EB 4WQMA 3X0WA 2ZZPB 4C7YA 3IHPC 4W9FA 2BB5A 5FK9C 2FCQA 2GBMA 1FCLA 3QIJA 1WXAA 2NR2A 4KGRA 4BKTA 1DOYA 1WRIA 3NVVA 2WWZA 5CX3A 2DX5B 1SBBB 4FXCA 2AQ2B 3HVDA 5FKAC 2KFKB 2VZKD 1Y56A 2REXA 3ZO5B 1I42A 2D07B 3RN9C 2JF5A 2V3NA 3R2IA 2IZVB 3Q8FA 4IWQA 3WANA 3C8YA 1QZEA 3NZUA 4MELA 4WJQA 2BYFA 3L54A 4D2KA 5E6JA 1EU3A 2IGGA 1SE2A 2WGSA 1Q1OA 1C4AA 1WFYA 4IWOA 3AEAB 4A20A 4DHJD 2BW2A 1ISNA 1JALA 3TJPA 1XLQA 2HTHA 1RAXA 4WAAA 3R3MA 4JPSA 3D32A 4TMAB 1I35A 2BVCA 1VZ7A 3SEBA 1MHHE 2MWSB 1XF5L 2IO0B 2IPKD 1LXDA 3ZTDA 2L52A 4J3OD 3C19A 4ZRKA 1MG8A 2FAZA 1ZE3D 1VLBA 1L2NA 1WRDB 2A5UA 2KDIA 3E9SA 4S17A 1WXQA 2L83A 2LVPA 3U4EG 4W9LA 1WYGA 1DGJA 4KKIA 4LNOA 2AWTA 3L0WB 4HEA1 1KM7A 3A4SC 4R3DA 1ZW7A 1XCQL 3ZRCA 2Z0EB 4PS7A 3ML9A 1D3ZA 1E10A 4HJKA 4C7ZA 1N5XA 4EKUA 4WWOA 4BOSC 2KFKA 1T3QA 2RGFA 4HROA 4A3OA 3BK1A 1WM2A 2WDQB 2XK5B 2ZJDA 3SDLC 5BYSA 2RMMA 4EZLA 3JSVA 1FD6A 3ENEA 1IGDA 3H7PB 4HCNB 2JXXA 3RPFC 1FFUA 3UQBA 3IG3A 2GRIA 3KVFB 3EA6A 2BGFA 3BK2A 3LYYA 1FFVA 1KF6B 5EE3A 4AJYB 3AEEB 3ZYYX 1UWXA 3URYA 3JYUA 1V9JA 4JQWC 4OW0A 1V81A 2YVCA 3MC8A 3KLSX 2NMQA 2NBWB 3RNGC 4ZDVA 3QX1A 1LFDA 2PVGC 3EC8A 3I63C 1NBFC 3S2AA 1L7YA 3ZXRA 2MW5A 4O1NA 2FNJB 4GIVA 3U7ZA 3Q69A 3UIPB 2WXNA 1FM0D 3ZRFA 1FCCC 4P1CC 1I4QA 4E71A 3ML8A 3MFGA 1K52A 1E7UA 2WXLA 4LNKA 1D4BA 4ARIA 5D6JB 5LLIA 2IGHA 2L3ZA 2CHWA 2LGXA 3QJZA 3SFDB 2V1YA 1KLGD 2BT6A 1F0ZA 3Q8EA 3Q8CA 3P4PB 1QKZA 4PYUA 5DPSA 3DBLB 1L6UA 4GOCA 2C5LC 5LXHA 3A9KB 3AN1A 3NVWA 3BWUD 3NVZA 1YQ3B 2J0JA 1J8CA 2H89B 2OEDA 2FE8A 1E8WA 2CHXA 2PVOD 2ZCCA 4RH6A 3KH0A 1LQBA 1B9RA 1FNVA 1NI2A 3DVNV 1E5WA 2LXCA 3JSVB 1C4PA 2BPSA 4NAWB 2LJ5A 1TY0A 2MX2A 2KJRA 1MHXA 1DOXA 2WDRB 3MHZA 4IDIA 3N1XC 3M95A 2KQ4X 1CMXB 1U4AA 4ZYNA 2NPTB 4IW0A 1XQQA 2DBYA 2FIFA 2LVOA 4JE3B 2W3SA 4W9GA 1V6EA 4K7SA 2D3CA 4M02A 3DBRB 3W9CB 1WGDA 2AX5A 1UH6A 3AE8B 3RULA 4IKGA 3W1SC 4OVUA 3NUHB 2N7DA 4YSXB 3WALA 3HM3A 1ZP0B 2KFJA 2JRIB 4M8MA 1BT0A 4EUTA 1V8CA 4MACA 4F1SA 3TEWA 1N62A 1WXSA 1NYQA 2FUG1 2VH1A 5BMIA 3OJ4B 4NQKE 2MEKA
chains in the Genus database with same CATH topology
3CMMB 2GBNA 3HK0A 2C7NB 1WXMA 4BKGA 4G0NB 4XZ4A 1G6JA 2PJHA 1X1MA 3L13A 3ZDTA 3WAMA 3KUZA 3UF8A 4W9EA 2IO1B 4NJ6A 2KDEB 1WJ6A 4DDID 1WI0A 3W1SA 5C23A 4WQOB 1OEYJ 3K9PB 1UGMA 1UD7A 3DOWA 3EHVA 4LDTD 4FBJB 4DBGA 4PS8A 3DVNU 2K25A 2DZMA 3R7QA 3QA8A 1Z2MA 2DHZA 2WDTB 2XBBC 3NY5A 3PTFC 4RMAA 3UIOB 4ANWA 4M8NA 5CHVC 1WM3A 3KYCD 5JHAA 3SU8X 3ZNZB 1EUVB 2MQJA 3TL5A 2MA9B 2LXAA 3NS8A 4NQLB 4DXAB 2BWES 2AEHA 2JZ3B 3DVGY 4MEMA 4ICVA 1V86A 2IY0B 2LVQA 5E6NA 4ANXA 5BO4B 3CF6E 4AP4C 1FXTB 2ZVNA 4DWFA 4ANVA 5L83A 1J19A 2KX0A 2FCMA 3SD5A 3UQAA 2C9WB 3VQIA 1S1QB 2KVRA 3A9KA 1NDDA 2MSED 3EECA 4HK2A 4KV2A 2K39A 2ZPNA 1WGHA 1IYFA 2K1FA 2G3QB 4MSMB 1WJ4A 1KLVA 1JRUA 4TQ0A 3LJ3A 3CSFA 2NVUI 5C1ZA 2EMTA 1J0GA 3R7RA 3VVWB 3ALBA 1WR6E 3OLMD 1V5OA 2XEWA 2GOWA 3PRZA 4LJPB 3CSTA 1YQBA 4NY0A 3PPAA 1WY8A 2NS5A 2N1VA 1XT9B 4I6LB 1UBIA 1P1AA 4KZCA 3PHXB 2RD0A 1RFAA 3RCZA 4FLHA 2C7MB 4DHZE 3V6EB 3TMPB 3DBRI 3M62B 1KOTA 3ZNID 1WGGA 3NZSA 4K7WA 4XX5A 1S3SG 2KX3A 2KWUB 3ZVVA 1Q0WB 1IP9A 2I1JA 4FN2A 1Y8RC 3GOEA 1GNUA 3TCAA 3JVZX 4EZKA 2CU1A 4TUUA 3V6CB 2EKEC 1WH3A 3VAWA 3AXCA 3H7SA 3B0AA 3MHSD 2JWZA 2KJHB 3DBLI 3KUDB 4II2B 1H8CA 4AUQC 2KO3A 2ZEQA 3B1LX 1YX6B 3RZFA 1OQYA 1H4RA 1E90A 2DYBA 2L76A 3ZLZA 2R2OA 2DENB 3A1QB 5LXIB 3PRMB 4KIKB 2CKHB 1UBQA 2K8BA 2V3SA 2C60A 1Q5WB 1P9DU 1SGHA 2L7RA 3PRPB 2PE6B 4FJVB 2KQ7A 4ZRIA 2Z59B 2PE9A 5TR5A 2CR5A 1EF1A 2OOBB 2K6DB 2ZVOA 3PT2B 5GMVA 4N9F4 3VXWA 2N9XA 2MLBA 2A4ZA 2DZKA 2K8HA 3LDZE 3Q3JA 2GBKA 2BKFA 3PS6A 2G45B 2ZZPB 4I6NB 3X0WA 1EF5A 3IHPC 4W9FA 3MTNB 3VDZA 4F7ZA 2FCQA 2GBMA 2LI5A 4KZ0A 5CTRC 5E6PA 1E8YA 3QIJA 1WXAA 2G4DB 2NR2A 2FUHB 4GXBA 4LDTB 4MGIE 2KWCA 2RSUA 4BKTA 2WWZA 3ZNHB 5CX3A 2ZNVC 4JL9A 4PYZA 2J0MA 2DYMA 1P0RA 4GDLA 2DX5B 5AEKB 1RRBA 3L10B 1K8RB 2RPQA 2KFKB 2B3AA 2CS4A 2REXA 2LRUA 1P98A 4ANUA 4EOYA 3ZO5B 2KDBA 3HHMA 1I42A 2D07B 2M4NA 1V49A 2JF5A 4GU2A 4TQ1A 1IPGA 3TIXA 2IZVB 4IWQA 2MRPA 3DVGX 3WANA 3IFWB 3X23A 2JY6A 3VTVA 2JZZA 1QZEA 3NZUA 4MELA 3QHTA 2DZJA 4WJQA 2KMCA 2QHOA 3VH3B 2KOXA 3VTWA 4P7IA 2BYFA 3L54A 2V4LA 4NPNA 1V5TA 1WX7A 2JRHA 3QQ8B 1Q1OA 3A33B 1P3QU 1WFYA 4JIOU 4IWOA 4MDKE 2ZPYA 4A20A 2BKRB 3R66C 2J7QB 4DHJD 1A5RA 4A3PA 1EO6A 2LGYA 1ISNA 3N32A 3TJPA 2HTHA 4DHJB 1AARA 1RAXA 2BF8B 3H1UA 4HPMB 5D2MB 5DCNA 4EEWA 4EZJA 2UWQA 2JPHA 4WAAA 3R3MA 1GJZA 4K7UA 4LJOB 3AULA 4NAWA 2KNBA 4J6IA 3D32A 1R4MI 1GUAB 2YLMA 3AU5A 4GDKB 1I35A 2GBJA 4BBNC 2IY1B 4GSWA 4DK5A 1GC7A 1WXVA 4IWPA 3QK0A 4K1RB 2MWSB 4ZRJA 5JH5C 2DYOA 3TBLD 4EFOA 2O2VA 2IO0B 3S2AA 1C1YB 3H7PA 2AYOB 2N7EA 4NJ7A 2IYDB 2KQSA 4FULA 4W9KA 4BVUC 4G11A 1LXDA 2O2VB 3ZTDA 4B9KA 2WX1A 3HM6X 1WGRA 4ZRKA 4CO7A 4URKA 1HE8A 3BINA 4DDGD 3SHQA 2DAFA 1MG8A 4HWIB 2FAZA 2LGDA 3V61A 3NOBA 2N9EB 4KVGB 5IAAC 1WE6A 4BOZB 4XC2A 2MBQA 1L2NA 3WA0A 3VUXA 4WWPA 2FCSA 1WRDB 3DPDA 2KZRA 3I3TB 3QC8B 2A5UA 2KDIA 2KTFA 4WJOA 4ICUA 1TBEA 1WMHB 3A9JA 2AL3A 1WMHA 3A9JB 4KDIC 2LVPA 3MJWA 4W9LA 5J18A 3VFKA 4W9DA 4FHKA 1VD2A 2AWTA 3L0WB 1YJ1A 4I6PA 1KM7A 2KANA 3EFUA 3A4SC 4GDKA 1V2YA 3UINB 3O65B 2I1KA 3QAQA 1ZW7A 3ZRCA 2KXJA 2OJRA 2WYQA 2Z0EB 4PS7A 4AOFA 5EDSA 2NPTA 3ML9A 2UYZB 2DAJA 1D3ZA 5KHOA 2W9NA 2KLGA 2BYEA 5G55A 4BBNF 4E3CA 4II3B 5AZGA 4HJKA 1WIAA 4LCDE 4EKUA 3A1QA 4WWOA 4BOSC 2KFKA 4X57B 5IA7A 4F8CB 2MBEA 3QCAA 4KSKC 1OEYA 3T8MA 5J17A 2PPHA 2RGFA 4RM8A 4IM3A 4A3OA 2IBIB 3ZKJC 2LD9A 2M1MA 1WM2A 3B08A 2XK5B 2ZJDA 5AZFA 3SDLC 1VCBA 4EZLA 3JSVA 3OAWA 1WR1A 3ENEA 4MGKE 3WAPA 3ZTCA 1GG3A 1C3TA 2JT4B 3H7PB 3PV1A 3VH4B 4HCNB 4MGZE 3U7DA 2L00B 2JXXA 3L08A 3JW0X 3U30A 3UQBA 3IG3A 4CHKA 3H6NA 4MM3A 3U8ZA 1E7VA 1Z5SB 3PREA 3V60A 3KVFB 2BGFA 2KWVB 4B6WA 3ZUNA 2K8CA 2KTRB 3WIMA 4AJYB 3RUIB 3ONSA 3ZNGC 1E8XA 3DBHI 2KTRA 1R4NI 4MH0E 4OVVA 2N9PC 2RR9A 3JYUA 4HXDA 3RT3B 1V9JA 3IVFA 4JQWC 4G3XB 3VUYA 4BFRA 1V81A 2KKCA 1TZ1A 2EMSA 2FCNA 3GZNI 2DZIA 2D2QA 2KMAA 2YVCA 3APDA 2KLCA 3PGEA 3N3KB 2KJ6A 4M0WB 2C7HA 2G4SA 3DDCB 3T9LA 2NBWB 3APCA 5FR6A 2M8SA 3DBSA 2KC2A 3KUCB 4ZDVA 5JHBA 2O6VD 2D3GA 2HD5B 3QX1A 3ZDMC 1LFDA 3PLVA 4HLEA 3BY4B 3EC8A 3P2BA 2D10A 1PQSA 2L05A 1WZ3A 2KN5A 3RZWC 2ASQA 1NBFC 4FJYA 1L7YA 4IUMB 5DPTA 4FJZA 3AI5A 1TTNA 2MW5A 3RD2A 1WJNA 2FNJB 4GIVA 3UIPB 3RYTA 3UGBB 4IG7B 4NQKE 2MBBB 3ZRFA 4WWNA 4K81A 4E71A 3ML8A 5L95C 5KHQA 2MBOA 2VRRB 4WJPA 5J2RA 4HPLB 1E7UA 2ZNVB 2KD0A 1WE7A 4CYEA 2MBHA 2O6VA 3WAOA 2GMIC 4GMVA 2L0FA 3DQVA 5D6JB 2AL6A 3ZIMA 4MGYE 4GB9A 1ZGUB 2KHWB 5LLIA 2L3ZA 2CHWA 2LGXA 5D7GA 3QJZA 5CHWA 1OGWA 2V1YA 4MSQB 4TKNA 4G50A 2D11A 1WJUA 1SIFA 3V62A 2XK5A 1YD8U 2GBRA 2N1WA 4PYUA 5DPSA 3ZW3A 5HKHA 3ECIA 5LXHA 2NBUA 2C5LC 2KK8A 4GOCA 3A9KB 3QWZB 4BKSD 3NHEB 2J0JA 2JUOA 1J8CA 1LM8B 1E8WA 2CHXA 1M94A 2LASA 2ZCCA 2J0KA 4YL8A 2KC1A 1LQBA 3KH0A 2Y5BB 3PLUA 2IO2B 4B95A 4DHZB 1NI2A 1GC6A 3L17A 2M0XA 3N30A 4HDOA 4IM2A 4TV3A 3DVNV 1XD3B 4KDLB 2LRWA 4KSLC 1E5WA 4W9IA 4GDLB 3HIZA 2LUEA 4E74A 2LXCA 3JSVB 4PS3A 2BPSA 4NAWB 1V80A 2LJ5A 5CHFA 4AWJA 3PSEB 2L0TA 2MX2A 2KJRA 3KW5B 4KIKA 1T0YA 2Z0DB 5G2NA 5AZHA 2IO3B 4HDQA 4JLCA 5DPWA 1TGZB 3M95A 4W9HA 4GGQA 5E6OA 4WJNA 1CMXB 1U4AA 2HJ8A 3APFA 3M63B 4ZYNA 2NPTB 2K6QA 4IW0A 2KDFB 1WZ0A 1XQQA 2LZ6A 3QARA 2FIFA 2LVOA 3DCGA 1WX8A 2NCNA 1WF9A 1WGYA 1WYWB 3H9DA 3VTUA 3VUWA 3M3JA 3OJ3A 1ZKHA 4AJWA 2JVCA 4W9GA 4HVBA 1V6EA 4K7SA 4W9JA 1RLFA 3VHTC 5DPRA 2LWPA 4IM0A 1F9JA 2O6VB 4RM9A 1WX9A 2HE7A 3W1YA 1WGDA 1UZXB 1UH6A 3RULA 3W1SC 4IC7B 1UELA 4OVUA 4GN1A 3L16A 3K9OB 4HCPB 1YX5B 2NBVB 1E8ZA 1OTRB 2BWFA 2N7DA 3AU4A 2MP2B 2WX0A 3WALA 3HM3A 3PHWB 2KFJA 2JRIB 2PEAA 2MP2A 4M8MA 1BT0A 3C0RB 3IBEA 2ZCBA 3KYDD 4EUTA 4FADA 4JGHB 2R2QA 2MCNB 4F1SA 3A4RA 2BYVE 4MJSA 5JZEB 1KJTA 5D94A 3Q3FA 1WXSA 4MJSB 2FIDA 4BKSA 2N4FA 4W9CA 4FA6A 2L8JA 3PVLA 3OJ4B 4FHJA 4NNJB 1SE9A 1YIWA 4ASWC 2M17A 3PZDA 2CHZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CMM B;  2GBN A;  3HK0 A;  2C7N B;  1WXM A;  4BKG A;  4G0N B;  4XZ4 A;  1G6J A;  2PJH A;  1X1M A;  3L13 A;  3ZDT A;  3WAM A;  3KUZ A;  3UF8 A;  4W9E A;  2IO1 B;  4NJ6 A;  2KDE B;  1WJ6 A;  4DDI D;  1WI0 A;  3W1S A;  5C23 A;  4WQO B;  1OEY J;  3K9P B;  1UGM A;  1UD7 A;  3DOW A;  3EHV A;  4LDT D;  4FBJ B;  4DBG A;  4PS8 A;  3DVN U;  2K25 A;  2DZM A;  3R7Q A;  3QA8 A;  1Z2M A;  2DHZ A;  2WDT B;  2XBB C;  3NY5 A;  3PTF C;  4RMA A;  3UIO B;  4ANW A;  4M8N A;  5CHV C;  1WM3 A;  3KYC D;  5JHA A;  3SU8 X;  3ZNZ B;  1EUV B;  2MQJ A;  3TL5 A;  2MA9 B;  2LXA A;  3NS8 A;  4NQL B;  4DXA B;  2BWE S;  2AEH A;  2JZ3 B;  3DVG Y;  4MEM A;  4ICV A;  1V86 A;  2IY0 B;  2LVQ A;  5E6N A;  4ANX A;  5BO4 B;  3CF6 E;  4AP4 C;  1FXT B;  2ZVN A;  4DWF A;  4ANV A;  5L83 A;  1J19 A;  2KX0 A;  2FCM A;  3SD5 A;  3UQA A;  2C9W B;  3VQI A;  1S1Q B;  2KVR A;  3A9K A;  1NDD A;  2MSE D;  3EEC A;  4HK2 A;  4KV2 A;  2K39 A;  2ZPN A;  1WGH A;  1IYF A;  2K1F A;  2G3Q B;  4MSM B;  1WJ4 A;  1KLV A;  1JRU A;  4TQ0 A;  3LJ3 A;  3CSF A;  2NVU I;  5C1Z A;  2EMT A;  1J0G A;  3R7R A;  3VVW B;  3ALB A;  1WR6 E;  3OLM D;  1V5O A;  2XEW A;  2GOW A;  3PRZ A;  4LJP B;  3CST A;  1YQB A;  4NY0 A;  3PPA A;  1WY8 A;  2NS5 A;  2N1V A;  1XT9 B;  4I6L B;  1UBI A;  1P1A A;  4KZC A;  3PHX B;  2RD0 A;  1RFA A;  3RCZ A;  4FLH A;  2C7M B;  4DHZ E;  3V6E B;  3TMP B;  3DBR I;  3M62 B;  1KOT A;  3ZNI D;  1WGG A;  3NZS A;  4K7W A;  4XX5 A;  1S3S G;  2KX3 A;  2KWU B;  3ZVV A;  1Q0W B;  1IP9 A;  2I1J A;  4FN2 A;  1Y8R C;  3GOE A;  1GNU A;  3TCA A;  3JVZ X;  4EZK A;  2CU1 A;  4TUU A;  3V6C B;  2EKE C;  1WH3 A;  3VAW A;  3AXC A;  3H7S A;  3B0A A;  3MHS D;  2JWZ A;  2KJH B;  3DBL I;  3KUD B;  4II2 B;  1H8C A;  4AUQ C;  2KO3 A;  2ZEQ A;  3B1L X;  1YX6 B;  3RZF A;  1OQY A;  1H4R A;  1E90 A;  2DYB A;  2L76 A;  3ZLZ A;  2R2O A;  2DEN B;  3A1Q B;  5LXI B;  3PRM B;  4KIK B;  2CKH B;  1UBQ A;  2K8B A;  2V3S A;  2C60 A;  1Q5W B;  1P9D U;  1SGH A;  2L7R A;  3PRP B;  2PE6 B;  4FJV B;  2KQ7 A;  4ZRI A;  2Z59 B;  2PE9 A;  5TR5 A;  2CR5 A;  1EF1 A;  2OOB B;  2K6D B;  2ZVO A;  3PT2 B;  5GMV A;  4N9F 4;  3VXW A;  2N9X A;  2MLB A;  2A4Z A;  2DZK A;  2K8H A;  3LDZ E;  3Q3J A;  2GBK A;  2BKF A;  3PS6 A;  2G45 B;  2ZZP B;  4I6N B;  3X0W A;  1EF5 A;  3IHP C;  4W9F A;  3MTN B;  3VDZ A;  4F7Z A;  2FCQ A;  2GBM A;  2LI5 A;  4KZ0 A;  5CTR C;  5E6P A;  1E8Y A;  3QIJ A;  1WXA A;  2G4D B;  2NR2 A;  2FUH B;  4GXB A;  4LDT B;  4MGI E;  2KWC A;  2RSU A;  4BKT A;  2WWZ A;  3ZNH B;  5CX3 A;  2ZNV C;  4JL9 A;  4PYZ A;  2J0M A;  2DYM A;  1P0R A;  4GDL A;  2DX5 B;  5AEK B;  1RRB A;  3L10 B;  1K8R B;  2RPQ A;  2KFK B;  2B3A A;  2CS4 A;  2REX A;  2LRU A;  1P98 A;  4ANU A;  4EOY A;  3ZO5 B;  2KDB A;  3HHM A;  1I42 A;  2D07 B;  2M4N A;  1V49 A;  2JF5 A;  4GU2 A;  4TQ1 A;  1IPG A;  3TIX A;  2IZV B;  4IWQ A;  2MRP A;  3DVG X;  3WAN A;  3IFW B;  3X23 A;  2JY6 A;  3VTV A;  2JZZ A;  1QZE A;  3NZU A;  4MEL A;  3QHT A;  2DZJ A;  4WJQ A;  2KMC A;  2QHO A;  3VH3 B;  2KOX A;  3VTW A;  4P7I A;  2BYF A;  3L54 A;  2V4L A;  4NPN A;  1V5T A;  1WX7 A;  2JRH A;  3QQ8 B;  1Q1O A;  3A33 B;  1P3Q U;  1WFY A;  4JIO U;  4IWO A;  4MDK E;  2ZPY A;  4A20 A;  2BKR B;  3R66 C;  2J7Q B;  4DHJ D;  1A5R A;  4A3P A;  1EO6 A;  2LGY A;  1ISN A;  3N32 A;  3TJP A;  2HTH A;  4DHJ B;  1AAR A;  1RAX A;  2BF8 B;  3H1U A;  4HPM B;  5D2M B;  5DCN A;  4EEW A;  4EZJ A;  2UWQ A;  2JPH A;  4WAA A;  3R3M A;  1GJZ A;  4K7U A;  4LJO B;  3AUL A;  4NAW A;  2KNB A;  4J6I A;  3D32 A;  1R4M I;  1GUA B;  2YLM A;  3AU5 A;  4GDK B;  1I35 A;  2GBJ A;  4BBN C;  2IY1 B;  4GSW A;  4DK5 A;  1GC7 A;  1WXV A;  4IWP A;  3QK0 A;  4K1R B;  2MWS B;  4ZRJ A;  5JH5 C;  2DYO A;  3TBL D;  4EFO A;  2O2V A;  2IO0 B;  3S2A A;  1C1Y B;  3H7P A;  2AYO B;  2N7E A;  4NJ7 A;  2IYD B;  2KQS A;  4FUL A;  4W9K A;  4BVU C;  4G11 A;  1LXD A;  2O2V B;  3ZTD A;  4B9K A;  2WX1 A;  3HM6 X;  1WGR A;  4ZRK A;  4CO7 A;  4URK A;  1HE8 A;  3BIN A;  4DDG D;  3SHQ A;  2DAF A;  1MG8 A;  4HWI B;  2FAZ A;  2LGD A;  3V61 A;  3NOB A;  2N9E B;  4KVG B;  5IAA C;  1WE6 A;  4BOZ B;  4XC2 A;  2MBQ A;  1L2N A;  3WA0 A;  3VUX A;  4WWP A;  2FCS A;  1WRD B;  3DPD A;  2KZR A;  3I3T B;  3QC8 B;  2A5U A;  2KDI A;  2KTF A;  4WJO A;  4ICU A;  1TBE A;  1WMH B;  3A9J A;  2AL3 A;  1WMH A;  3A9J B;  4KDI C;  2LVP A;  3MJW A;  4W9L A;  5J18 A;  3VFK A;  4W9D A;  4FHK A;  1VD2 A;  2AWT A;  3L0W B;  1YJ1 A;  4I6P A;  1KM7 A;  2KAN A;  3EFU A;  3A4S C;  4GDK A;  1V2Y A;  3UIN B;  3O65 B;  2I1K A;  3QAQ A;  1ZW7 A;  3ZRC A;  2KXJ A;  2OJR A;  2WYQ A;  2Z0E B;  4PS7 A;  4AOF A;  5EDS A;  2NPT A;  3ML9 A;  2UYZ B;  2DAJ A;  1D3Z A;  5KHO A;  2W9N A;  2KLG A;  2BYE A;  5G55 A;  4BBN F;  4E3C A;  4II3 B;  5AZG A;  4HJK A;  1WIA A;  4LCD E;  4EKU A;  3A1Q A;  4WWO A;  4BOS C;  2KFK A;  4X57 B;  5IA7 A;  4F8C B;  2MBE A;  3QCA A;  4KSK C;  1OEY A;  3T8M A;  5J17 A;  2PPH A;  2RGF A;  4RM8 A;  4IM3 A;  4A3O A;  2IBI B;  3ZKJ C;  2LD9 A;  2M1M A;  1WM2 A;  3B08 A;  2XK5 B;  2ZJD A;  5AZF A;  3SDL C;  1VCB A;  4EZL A;  3JSV A;  3OAW A;  1WR1 A;  3ENE A;  4MGK E;  3WAP A;  3ZTC A;  1GG3 A;  1C3T A;  2JT4 B;  3H7P B;  3PV1 A;  3VH4 B;  4HCN B;  4MGZ E;  3U7D A;  2L00 B;  2JXX A;  3L08 A;  3JW0 X;  3U30 A;  3UQB A;  3IG3 A;  4CHK A;  3H6N A;  4MM3 A;  3U8Z A;  1E7V A;  1Z5S B;  3PRE A;  3V60 A;  3KVF B;  2BGF A;  2KWV B;  4B6W A;  3ZUN A;  2K8C A;  2KTR B;  3WIM A;  4AJY B;  3RUI B;  3ONS A;  3ZNG C;  1E8X A;  3DBH I;  2KTR A;  1R4N I;  4MH0 E;  4OVV A;  2N9P C;  2RR9 A;  3JYU A;  4HXD A;  3RT3 B;  1V9J A;  3IVF A;  4JQW C;  4G3X B;  3VUY A;  4BFR A;  1V81 A;  2KKC A;  1TZ1 A;  2EMS A;  2FCN A;  3GZN I;  2DZI A;  2D2Q A;  2KMA A;  2YVC A;  3APD A;  2KLC A;  3PGE A;  3N3K B;  2KJ6 A;  4M0W B;  2C7H A;  2G4S A;  3DDC B;  3T9L A;  2NBW B;  3APC A;  5FR6 A;  2M8S A;  3DBS A;  2KC2 A;  3KUC B;  4ZDV A;  5JHB A;  2O6V D;  2D3G A;  2HD5 B;  3QX1 A;  3ZDM C;  1LFD A;  3PLV A;  4HLE A;  3BY4 B;  3EC8 A;  3P2B A;  2D10 A;  1PQS A;  2L05 A;  1WZ3 A;  2KN5 A;  3RZW C;  2ASQ A;  1NBF C;  4FJY A;  1L7Y A;  4IUM B;  5DPT A;  4FJZ A;  3AI5 A;  1TTN A;  2MW5 A;  3RD2 A;  1WJN A;  2FNJ B;  4GIV A;  3UIP B;  3RYT A;  3UGB B;  4IG7 B;  4NQK E;  2MBB B;  3ZRF A;  4WWN A;  4K81 A;  4E71 A;  3ML8 A;  5L95 C;  5KHQ A;  2MBO A;  2VRR B;  4WJP A;  5J2R A;  4HPL B;  1E7U A;  2ZNV B;  2KD0 A;  1WE7 A;  4CYE A;  2MBH A;  2O6V A;  3WAO A;  2GMI C;  4GMV A;  2L0F A;  3DQV A;  5D6J B;  2AL6 A;  3ZIM A;  4MGY E;  4GB9 A;  1ZGU B;  2KHW B;  5LLI A;  2L3Z A;  2CHW A;  2LGX A;  5D7G A;  3QJZ A;  5CHW A;  1OGW A;  2V1Y A;  4MSQ B;  4TKN A;  4G50 A;  2D11 A;  1WJU A;  1SIF A;  3V62 A;  2XK5 A;  1YD8 U;  2GBR A;  2N1W A;  4PYU A;  5DPS A;  3ZW3 A;  5HKH A;  3ECI A;  5LXH A;  2NBU A;  2C5L C;  2KK8 A;  4GOC A;  3A9K B;  3QWZ B;  4BKS D;  3NHE B;  2J0J A;  2JUO A;  1J8C A;  1LM8 B;  1E8W A;  2CHX A;  1M94 A;  2LAS A;  2ZCC A;  2J0K A;  4YL8 A;  2KC1 A;  1LQB A;  3KH0 A;  2Y5B B;  3PLU A;  2IO2 B;  4B95 A;  4DHZ B;  1NI2 A;  1GC6 A;  3L17 A;  2M0X A;  3N30 A;  4HDO A;  4IM2 A;  4TV3 A;  3DVN V;  1XD3 B;  4KDL B;  2LRW A;  4KSL C;  1E5W A;  4W9I A;  4GDL B;  3HIZ A;  2LUE A;  4E74 A;  2LXC A;  3JSV B;  4PS3 A;  2BPS A;  4NAW B;  1V80 A;  2LJ5 A;  5CHF A;  4AWJ A;  3PSE B;  2L0T A;  2MX2 A;  2KJR A;  3KW5 B;  4KIK A;  1T0Y A;  2Z0D B;  5G2N A;  5AZH A;  2IO3 B;  4HDQ A;  4JLC A;  5DPW A;  1TGZ B;  3M95 A;  4W9H A;  4GGQ A;  5E6O A;  4WJN A;  1CMX B;  1U4A A;  2HJ8 A;  3APF A;  3M63 B;  4ZYN A;  2NPT B;  2K6Q A;  4IW0 A;  2KDF B;  1WZ0 A;  1XQQ A;  2LZ6 A;  3QAR A;  2FIF A;  2LVO A;  3DCG A;  1WX8 A;  2NCN A;  1WF9 A;  1WGY A;  1WYW B;  3H9D A;  3VTU A;  3VUW A;  3M3J A;  3OJ3 A;  1ZKH A;  4AJW A;  2JVC A;  4W9G A;  4HVB A;  1V6E A;  4K7S A;  4W9J A;  1RLF A;  3VHT C;  5DPR A;  2LWP A;  4IM0 A;  1F9J A;  2O6V B;  4RM9 A;  1WX9 A;  2HE7 A;  3W1Y A;  1WGD A;  1UZX B;  1UH6 A;  3RUL A;  3W1S C;  4IC7 B;  1UEL A;  4OVU A;  4GN1 A;  3L16 A;  3K9O B;  4HCP B;  1YX5 B;  2NBV B;  1E8Z A;  1OTR B;  2BWF A;  2N7D A;  3AU4 A;  2MP2 B;  2WX0 A;  3WAL A;  3HM3 A;  3PHW B;  2KFJ A;  2JRI B;  2PEA A;  2MP2 A;  4M8M A;  1BT0 A;  3C0R B;  3IBE A;  2ZCB A;  3KYD D;  4EUT A;  4FAD A;  4JGH B;  2R2Q A;  2MCN B;  4F1S A;  3A4R A;  2BYV E;  4MJS A;  5JZE B;  1KJT A;  5D94 A;  3Q3F A;  1WXS A;  4MJS B;  2FID A;  4BKS A;  2N4F A;  4W9C A;  4FA6 A;  2L8J A;  3PVL A;  3OJ4 B;  4FHJ A;  4NNJ B;  1SE9 A;  1YIW A;  4ASW C;  2M17 A;  3PZD A;  2CHZ A; 
#chains in the Genus database with same CATH topology
 1BXT A;  1EM7 A;  4K3C A;  4G0N B;  1G6J A;  5HFY A;  1QQR A;  1IBX B;  3FIL B;  5C23 A;  4WQO B;  3LXF A;  1UD7 A;  1VR9 A;  4LDT D;  3DVN U;  3DBH B;  3R7Q A;  3QA8 A;  2WDT B;  4RMA A;  4ANW A;  4M8N A;  4YSY B;  5JHA A;  3ZNZ B;  3TL5 A;  3NS8 A;  4XYC A;  4DXA B;  3GZN B;  2AEH A;  3DVG Y;  5E6N A;  3CF6 E;  4DWF A;  4ANV A;  4YTN B;  1J19 A;  2LHE A;  3UQA A;  2C9W B;  3VQI A;  3IXS A;  4NJC A;  4ZYS A;  1N63 A;  1IYF A;  3PO0 A;  4LLG M;  5C1Z A;  2EMT A;  1J0G A;  3GS2 A;  3AE4 B;  4A8X C;  1V5O A;  2GOW A;  1HTO A;  4GLS C;  4LJP B;  1ET6 A;  3N20 C;  5IN7 A;  1FEH A;  4I6L B;  1UBI A;  3N1Y C;  3PHX B;  1RFA A;  2JZP A;  1AN8 A;  3ZNI D;  4K7W A;  1S3S G;  2KWU B;  4OZC A;  4EZK A;  2JSV X;  3AXC A;  1R4M B;  2W55 A;  3MHS D;  1VZ6 A;  2M0A A;  2KJH B;  3KUD B;  4A9A A;  3KWL A;  4ACF A;  1J7C A;  1E90 A;  3ZLZ A;  3Q8B A;  2DEN B;  1L6V A;  1XLO A;  2V3S A;  1SGH A;  5D3D A;  4FJV B;  4ZRI A;  3I9V 1;  1D5X C;  1LO5 D;  2ZW1 A;  3ETR A;  1EU4 A;  1PGA A;  3LDZ E;  5BMH A;  2BKF A;  2GLS A;  4I6N B;  1F1H A;  1BUI C;  3VDZ A;  2JWU A;  2LI5 A;  4KZ0 A;  5CTR C;  1E8Y A;  2G4D B;  4LDT B;  2FUH B;  3NS1 A;  2K5P A;  3ZNH B;  1KH0 A;  4PYZ A;  1P0R A;  4GDL A;  1XXG A;  2RPQ A;  2N9L A;  2B3A A;  2CS4 A;  4P6V F;  1J7B A;  2IND C;  1QOA A;  3Q14 C;  1HZ5 A;  4B0M A;  4M01 A;  1C4C A;  3DVG X;  3IFW B;  3X23 A;  3W5U B;  2JZZ A;  3QHT A;  4CQN A;  2KMC A;  2QHO A;  2KOX A;  4P7I A;  4NPN A;  2JRH A;  2K3U A;  3GE8 C;  1FXA A;  2ZPY A;  2BKR B;  2BYT A;  4HRS A;  1FMA D;  4RGT A;  1AAR A;  4EEW A;  4EZJ A;  2JPH A;  3MC9 A;  4ZHP A;  4H2A A;  3ZXV A;  3AU5 A;  2GBJ A;  1RM6 C;  4PT5 A;  1GC7 A;  1WXV A;  4K1R B;  1YJJ A;  1JWA D;  5JH5 C;  3TBL D;  2O2V A;  1L0X B;  2ON8 A;  1C1Y B;  2AYO B;  2IYD B;  4RF1 A;  1KFY B;  4G11 A;  2O2V B;  4RNA A;  3HM6 X;  1WGR A;  4CO7 A;  3V61 A;  4LTU A;  1K50 A;  2QEJ C;  4BOZ B;  2RDG A;  4N59 A;  4XC2 A;  2MBQ A;  4WWP A;  1FNU A;  1NI3 A;  3I3T B;  2WXI A;  2JYE A;  1TBE A;  2G9H D;  1VZ8 A;  3FAH A;  2INN E;  1M4V A;  4KDI C;  2QJL A;  3MJW A;  3VFK A;  4W9D A;  1VD2 A;  1QIL A;  2JYT A;  3EFU A;  2J52 A;  4GDK A;  2K0P A;  2KXJ A;  2OJR A;  3NRZ A;  2NPT A;  2DAJ A;  1TIF A;  4JWU C;  2YEP F;  1L0V B;  1YN3 A;  4E3C A;  3RNB C;  5AZG A;  3A1Q A;  3IT4 B;  5IA7 A;  2W82 A;  2BBC A;  1F52 A;  2INC C;  1WWT A;  2K9X A;  1YMH E;  5J17 A;  2PPH A;  1B1Z A;  4IM3 A;  2LD9 A;  1A70 A;  1OFF A;  2G1E A;  3B08 A;  2XN9 C;  3NJT A;  4MGK E;  1GG3 A;  1TY2 A;  3ABV B;  2L00 B;  4ZRP A;  2V4I B;  2JXT A;  2J53 A;  4MM3 A;  3WCQ A;  2KWV B;  3KWV A;  3H8H A;  4HKQ A;  2K8C A;  1E9M A;  1I4R A;  3IT6 B;  3RUI B;  1V97 A;  2WLB A;  1R4N I;  4MH0 E;  1GB4 A;  4HXD A;  2KKC A;  1D5Z C;  2D2Q A;  2Y5P A;  2KLC A;  4M0W B;  2KJ6 A;  4DQO C;  3T9L A;  5FR6 A;  1SJH D;  3TUO A;  3DHG C;  2O6V D;  2D3G A;  3ZDM C;  1HTQ A;  4HLE A;  2ZW0 A;  3BY4 B;  2D10 A;  1WZ3 A;  2L05 A;  2KN5 A;  1CZP A;  1MPE A;  4IUM B;  2ASQ A;  2QIL A;  5DPT A;  3RZW C;  3AI5 A;  3DWM A;  2WXF A;  1N6Z A;  3U2S C;  3V05 A;  1JWB D;  4K81 A;  2GB1 A;  5L95 C;  5KHQ A;  2MBO A;  4C4V B;  3DHH C;  1TT5 B;  3EUB 2;  4ITK A;  2KD0 A;  1WE7 A;  4CYE A;  2GMI C;  4C4V A;  4RGM A;  2L0F A;  1GPX A;  1SXT A;  1ZGU B;  2KHW B;  5D7G A;  3L4P A;  4MSQ B;  4TKN A;  2D11 A;  1SIF A;  3DWG C;  2WXH A;  1DOI A;  2QSD A;  2PMV A;  2N1W A;  1PYW D;  4XGA B;  3ZW3 A;  4A55 A;  3ECI A;  3NHE B;  2JUO A;  1TS2 A;  1LM8 B;  1M94 A;  1ZUD 2;  2KC1 A;  4B95 A;  1R7S A;  3N30 A;  1NYR A;  1KLU D;  2AQ1 B;  2PW9 A;  4KSL C;  5LNK 1;  3HIZ A;  2LUE A;  4E74 A;  4AWJ A;  1F2R C;  5CHF A;  2L0T A;  3E56 A;  1T0Y A;  3MP9 A;  2QMT A;  2IO3 B;  5DPW A;  1ZDV A;  1V1O A;  4W9H A;  4GGQ A;  5E6O A;  1L4Z B;  4WJN A;  1GOZ A;  2K6Q A;  4ZRQ A;  2LZ6 A;  3QAR A;  1BML C;  1WX8 A;  2SEB D;  3DHI C;  1WYW B;  3H9D A;  4HVB A;  4W9J A;  5DPR A;  4IM0 A;  1IBX A;  1F9J A;  2KAC A;  4RM9 A;  3W1Y A;  1UZX B;  4IC7 B;  1UEL A;  4HCP B;  1YX5 B;  1OTR B;  2BWF A;  3PHW B;  3C0R B;  3IBE A;  4JGH B;  5IP4 D;  2R2Q A;  1D6E C;  2BYV E;  4MJS A;  4YXD B;  5JZE B;  1KJT A;  2MJE A;  4RGN A;  4MJS B;  5HG2 A;  4W9C A;  2N7J A;  3AEB B;  1YIW A;  1WGK A;  4ASW C;  2M17 A;  4A3P A;  3CMM B;  1N60 A;  2GBN A;  3HK0 A;  1I7H A;  1T6B X;  1L4D B;  2C7N B;  4NAM A;  1SE3 A;  2PJH A;  3WAM A;  3KUZ A;  3RMK C;  3W1S A;  3BYT B;  5T8I A;  3DOW A;  1RWS A;  5EE0 A;  1EWY C;  4PS8 A;  1DYQ A;  5CHV C;  1WM3 A;  2X8X X;  3SU8 X;  2MQJ A;  2MA9 B;  2LXA A;  4KX6 B;  4MEM A;  4ICV A;  3VRB B;  4XWT A;  1F2R I;  2PKO A;  3T3N A;  2FCM A;  2FBW B;  1S1Q B;  3A9K A;  1XEE A;  2TSS A;  5MPO A;  2K1F A;  2G3Q B;  2BS3 B;  1YN4 A;  3R7R A;  3OLM D;  3B2G A;  4NY0 A;  1MG4 A;  2NS5 A;  2N1V A;  1XT9 B;  2WP9 B;  1P1A A;  2LMC A;  2RD0 A;  4FLH A;  4DHZ E;  3V6E B;  3TMP B;  5C2T B;  3DBR I;  2HTM E;  1CQV A;  1WGG A;  3NVY A;  1IP9 A;  1Q0W B;  3TCA A;  3JVZ X;  4TUU A;  3V6C B;  3VR8 B;  3AE2 B;  3B0A A;  2WS3 B;  3FIL A;  2KO3 A;  1UF0 A;  3B1L X;  1YX6 B;  5JXV A;  1VJK A;  2DYB A;  1HQR D;  3A1Q B;  4KIK B;  1HZ6 A;  2L7R A;  2PE9 A;  2OOB B;  2ZVO A;  1ZOY B;  3PT2 B;  4N9F 4;  2N9X A;  2NTS A;  2DZK A;  2K8H A;  3Q3J A;  2G45 B;  3TEX A;  3MTN B;  2M19 A;  4HJG E;  3GB1 A;  4GXB A;  3R8B A;  2WXK A;  2RSU A;  2ZNV C;  1I4X A;  2DYM A;  4HKZ E;  5AEK B;  1CJE A;  1K8R B;  2LRU A;  1P98 A;  2KDB A;  1NEN B;  3HHM A;  1HEZ E;  2Y5C A;  3AM9 A;  5BYR A;  1FIQ A;  2K22 A;  1E7P B;  1UUP A;  4GU2 A;  1ACC A;  2J4X A;  4TQ1 A;  3N1Z C;  2JY6 A;  3VTV A;  2DZJ A;  1SEB D;  2IJ0 A;  2DNF A;  4L1B A;  1WX7 A;  3BVM A;  3AEC B;  3CWI A;  5IO9 A;  3A33 B;  1P3Q U;  4JIO U;  4MDK E;  3EFC A;  5HHD G;  1A5R A;  3IAS 1;  4DXF A;  5BYQ A;  3N32 A;  3H1U A;  3ZJU A;  2E6X A;  2UWQ A;  1HA5 A;  4NAW A;  3P4Q B;  2I2Y A;  4J6I A;  5D3I B;  2EKI A;  1QOF A;  3AH7 A;  1R4M I;  2YLM A;  2WXJ A;  4GDK B;  2BS2 B;  5EE9 A;  4GSW A;  4DK5 A;  2BS4 B;  4EFO A;  1C78 A;  4W9K A;  3P4R B;  2KQS A;  1AWD A;  5L83 A;  2LFI A;  2WX1 A;  3MC0 B;  1HE8 A;  2DAF A;  4HWI B;  4M00 A;  4A6Q A;  1C79 A;  2WXQ A;  3WA0 A;  2KZR A;  2KAJ A;  3QC8 B;  3ZGZ A;  4WJO A;  4ICU A;  1WMH B;  3A9J A;  2BB6 A;  1EWC A;  2AL3 A;  3AED B;  4L2Y A;  1WMH A;  3A9J B;  1K53 A;  3BYY B;  1QF6 A;  2I38 A;  1YJ1 A;  2B76 B;  2KAN A;  4N58 A;  3O65 B;  3QAQ A;  5TSS A;  4AOF A;  5EDS A;  2UYZ B;  1JWS D;  3SFE B;  2W9N A;  4BBN F;  4II3 B;  4C80 A;  1XLN A;  2LHD A;  3IAM 1;  1ZDX A;  1WIA A;  1GAQ B;  4LCD E;  1ET9 A;  2QCZ A;  2WU5 B;  5AUI A;  4X57 B;  2MBE A;  4KSK C;  4ARC A;  1PDX A;  1OEY A;  2CU3 A;  1C77 A;  3T8M A;  4RM8 A;  2IBI B;  2M1M A;  1VCB A;  4BZA A;  1WR1 A;  4C00 A;  3WAP A;  3ZTC A;  3FKY A;  2E3T A;  3PV1 A;  4RGO S;  3U7D A;  2RDB C;  3L08 A;  3U30 A;  1SF0 A;  4CHK A;  4MT5 A;  3H6N A;  1PGB A;  1E7V A;  1Z5S B;  3HRD D;  4P16 A;  4IOI E;  3ZUN A;  2KT7 A;  2WXR A;  3B2F A;  3ONS A;  3DBH I;  1JW9 D;  4OVV A;  2RR9 A;  1CK1 A;  3IVF A;  2WXO A;  4G3X B;  3VUY A;  2FCN A;  3GZN I;  2DZI A;  3I57 A;  2C7H A;  3DDC B;  4XDC A;  3KUC B;  2KC2 A;  3HUI A;  3T3O A;  2QDF A;  3VR9 B;  3PLV A;  3P2B A;  1PQS A;  4FJY A;  3PZ8 A;  1TKE A;  4FJZ A;  1P7E A;  1C76 A;  4B0E A;  2OJW A;  3UGB B;  4IG7 B;  2PIA A;  2MBB B;  2MJD A;  3HVZ A;  2GI9 A;  2VRR B;  1AW7 A;  4HPL B;  1F77 A;  1L5P A;  2MBH A;  3GE3 C;  2O6V A;  3WAO A;  3ZQ4 A;  4GMV A;  3DQV A;  2AL6 A;  4MGY E;  5I4D A;  3RNF C;  5CHW A;  1V1P B;  3BII D;  1WJU A;  3V62 A;  2XK5 A;  1FO4 A;  4ZHO A;  3RFZ B;  3AEF B;  2NBU A;  4LNF A;  3QWZ B;  4BKS D;  1I4H A;  2LAS A;  2LUM A;  1WSP A;  1SE4 A;  2XNA C;  2J0K A;  3PLU A;  2Y5B B;  2IO2 B;  4DHZ B;  3L17 A;  4IM2 A;  2R61 A;  4TV3 A;  2X38 A;  2LRW A;  4KDL B;  4GDL B;  2KMM A;  4PS3 A;  1V80 A;  3PSE B;  3PZD A;  4KIK A;  1QOG A;  4YTM B;  5G2N A;  1N5W A;  4HDQ A;  1TGZ B;  2DLB A;  3APF A;  1WZ0 A;  3DCG A;  1R4N B;  2ACZ B;  3VTU A;  1JWU D;  1ZKH A;  3LB8 C;  1NVI D;  5FR3 A;  3EGR A;  3VHT C;  1RLF A;  2LWP A;  1YQ4 B;  1HXY D;  1P7F A;  1KRH A;  3RNE C;  1WX9 A;  2HE7 A;  4MM3 B;  3FC4 A;  4WWM A;  1MI0 A;  3L16 A;  3K9O B;  1FPY A;  2WNM A;  1JCK B;  3U52 E;  2NBV B;  1E8Z A;  3OG5 A;  2WX0 A;  1E0Z A;  1XO3 A;  2PEA A;  4XDD A;  1OQR A;  1RFK A;  2ZCB A;  2M56 B;  2MCN B;  5GXG B;  4KKJ A;  2KVZ A;  3BVZ A;  5D94 A;  1XLP A;  3Q3F A;  1C9F A;  2FID A;  4ZOH C;  4BKS A;  1KTK A;  3OWE B;  4FA6 A;  3PVL A;  4FHJ A;  4NNJ B;  1SE9 A;  2CHZ A;  3BZD B;  1WXM A;  4BKG A;  4XZ4 A;  2D5G A;  1X1M A;  3ZDT A;  1IUE A;  3UF8 A;  2MHJ A;  2IO1 B;  4NJ6 A;  1TKY A;  2KDE B;  4DDI D;  1WI0 A;  2WXG A;  3K9P B;  3PZ7 A;  2SAK A;  2CJN A;  2MJ3 A;  4HPP A;  2K25 A;  2DZM A;  1JRP A;  2MH7 A;  3UIO B;  1Z2M A;  2DHZ A;  3NY5 A;  3PTF C;  3AE9 B;  4C56 C;  2BWE S;  2JZ3 B;  1UWM A;  1V86 A;  2IY0 B;  4XWW A;  1N61 A;  2LVQ A;  2WXM A;  4ANX A;  5BO4 B;  1ESF A;  2JQR B;  2Y3A A;  1Q10 A;  1SIJ A;  4HK2 A;  2ZPN A;  1WGH A;  1WJ4 A;  1KLV A;  1JRU A;  4TQ0 A;  2NVU I;  3ALB A;  2BQQ A;  2RPV A;  2XEW A;  2N0S B;  3Q6B A;  2WU2 B;  1YQB A;  3PPA A;  3Q3M C;  4N6E B;  1TJE A;  2C7M B;  1KOT A;  4XX5 A;  3VRA B;  2KX3 A;  3ZVV A;  4FN2 A;  3GOE A;  1GNU A;  2CU1 A;  2EKE C;  1WH3 A;  2PTL A;  3VAW A;  4II2 B;  3DBL I;  1H8C A;  1YJI A;  2ZEQ A;  2KYW A;  2L76 A;  2QIE B;  5LXI B;  1FXI A;  1TS4 A;  4WH4 A;  1Q5W B;  1P9D U;  2KQ7 A;  2Z59 B;  5TR5 A;  2CR5 A;  5GMV A;  3VXW A;  1NEK B;  4Q2J A;  4PK1 A;  2MLB A;  4L23 A;  2A4Z A;  2GBK A;  3PS6 A;  1EF5 A;  1RYJ A;  4F7Z A;  5E6P A;  3N9Y C;  4WIP A;  4WAF A;  4MGI E;  2KWC A;  5G5G A;  4NZL B;  3TSS A;  3V3X A;  4JL9 A;  2J0M A;  1RRB A;  3L10 B;  1TS3 A;  4ANU A;  1OQQ A;  4EOY A;  2W3R A;  2M4N A;  2IDY A;  1V49 A;  4S0R A;  1ENF A;  1IPG A;  1QOB A;  3TIX A;  2LGS A;  2MRP A;  2D3A A;  3VH3 B;  3SR6 A;  3VTW A;  2V4L A;  1V5T A;  3QQ8 B;  4EE2 A;  2ONQ A;  1T5X D;  3R66 C;  2J7Q B;  4AQ7 A;  1EO6 A;  2LGY A;  4DHJ B;  4HPM B;  5DCN A;  2BF8 B;  3MJ5 A;  5D2M B;  1MVK A;  2YEP B;  4K7U A;  4LJO B;  3AUL A;  2KNB A;  1GUA B;  4BBN C;  2IY1 B;  1XCT L;  3P63 A;  4MH8 A;  1QT9 A;  4IWP A;  3QK0 A;  4ZRJ A;  5G5H A;  3TEZ A;  2DYO A;  4RF0 A;  2V3P A;  3H7P A;  4BVU C;  2N7E A;  4NJ7 A;  4FUL A;  4B9K A;  4YSZ B;  4URK A;  3BIN A;  4DDG D;  4JX1 C;  3SHQ A;  2LGD A;  3NOB A;  2N9E B;  4KVG B;  5IAA C;  1WE6 A;  3VUX A;  2RDH A;  5C3J B;  2FCS A;  3DPD A;  3O13 A;  2WXP A;  2KTF A;  3RNC C;  2JU6 X;  5J18 A;  3J9C A;  1ZXH A;  4FHK A;  1FRD A;  1TZO A;  4I6P A;  2W54 A;  2J42 A;  1V2Y A;  3UIN B;  2I1K A;  3NZ3 A;  2WYQ A;  5KHO A;  1SJE D;  2KLG A;  2BYE A;  5G55 A;  3W5V B;  1I4G A;  1PFD A;  4F8C B;  2Z8L A;  3QCA A;  3B9J A;  2ICI A;  1MFW A;  2INP E;  4RFB A;  2D3B A;  4US9 A;  3ZKJ C;  1ZPS A;  5AZF A;  3AE7 B;  3OAW A;  2WQY B;  4AS1 A;  1SSN A;  3UI3 A;  1C3T A;  2JT4 B;  3VH4 B;  1J7A A;  4MGZ E;  2LEK A;  4QAY A;  2N9K A;  3JW0 X;  4A90 A;  3U8Z A;  3PRE A;  3V60 A;  3NG0 A;  4B6W A;  2KTR B;  3WIM A;  3ZNG C;  1E8X A;  2KTR A;  2N9P C;  3RT3 B;  3AMZ A;  3RI7 C;  4REZ A;  4BFR A;  1TZ1 A;  2EMS A;  4P1B C;  1VRA B;  2L32 A;  2PLP A;  2KMA A;  3APD A;  2NTT A;  3PGE A;  3N3K B;  4KGT A;  2G4S A;  3APC A;  2M8S A;  3DBS A;  3P1M A;  5JHB A;  2HD5 B;  3Q2A C;  1ROE A;  1T0S C;  1GJZ A;  3RD2 A;  1TTN A;  1WJN A;  1TS5 A;  1PUT A;  3RYT A;  1AYF A;  4WWN A;  2HDE A;  4WJP A;  5J2R A;  2ZNV B;  2L1A A;  3ZIM A;  4GB9 A;  1OGW A;  4G50 A;  3CIR B;  2OHF A;  3TEY A;  3AE3 B;  1YD8 U;  2GBR A;  1ZXI A;  5HKH A;  2KWD A;  2KK8 A;  3AE1 B;  2KDM A;  3I5J C;  1MJD A;  4YL8 A;  1GC6 A;  2M0X A;  4HDO A;  1XD3 B;  4OZB A;  3AV8 A;  4W9I A;  3Q3N C;  2AQ3 B;  5AUK A;  3AB5 A;  4DXG A;  1FRR A;  3KW5 B;  2Z0D B;  1SB3 C;  5AZH A;  4JLC A;  2BTE A;  1LGR A;  2HJ8 A;  3M63 B;  3RCZ A;  2KDF B;  3ZJV A;  3Q8A A;  1TKG A;  2NCN A;  1WF9 A;  1WGY A;  2EEL A;  3VUW A;  3M3J A;  4JWS C;  3OJ3 A;  3KQ4 A;  4AJW A;  5H92 C;  2VH2 A;  2JVC A;  1YN5 A;  1STE A;  1PGX A;  4USA A;  3ZJT A;  2O6V B;  4GN1 A;  1V1P A;  2KN4 A;  5IKC M;  2V0G A;  3AE6 B;  3AU4 A;  2MP2 B;  4LNI A;  2IGD A;  4WUR A;  2WHI A;  1UGJ A;  2MP2 A;  3KYD D;  1YNT E;  4FAD A;  5EE1 A;  3A4R A;  2QC8 A;  3R2T A;  4OZA A;  4YWG G;  1QLB B;  2V9H A;  2LJI A;  2N4F A;  2L8J A;  1JRO A;  4BAX A;  3BVG A;  4LNN A;  3L13 A;  2JX5 A;  3GP7 A;  1T0R C;  4W9E A;  1FNW A;  1WJ6 A;  1IGC A;  1OEY J;  1UGM A;  3EHV A;  4FBJ B;  4DBG A;  4TSS A;  1L0Y B;  2XBB C;  3KYC D;  1EUV B;  2H88 B;  2VZK B;  4NQL B;  1VDV A;  5BMG A;  1TYG B;  1JWM D;  4AP4 C;  1FXT B;  2ZVN A;  2KX0 A;  3SD5 A;  2KVR A;  1NDD A;  2MSE D;  3EEC A;  4KV2 A;  2K39 A;  2CJO A;  4MSM B;  3LJ3 A;  3CSF A;  4OHJ A;  5H8Y E;  3VVW B;  1WR6 E;  3P42 A;  4UDU C;  3PRZ A;  3CST A;  4M0W A;  1T0Q C;  1WY8 A;  4US8 A;  2Q5W D;  4KZC A;  1K51 A;  1GB1 A;  4RCO A;  4XE0 A;  5HI1 A;  3M62 B;  3P4S B;  3AEG B;  3NZS A;  4OVZ A;  2I1J A;  1Y8R C;  1JQ4 A;  5IOI A;  3H7S A;  2JWZ A;  4AUQ C;  3W2D A;  3RNA C;  3RZF A;  1I4P A;  1OQY A;  2UU7 A;  1H4R A;  3AE5 B;  2R2O A;  1YOV B;  2WDV B;  3Q3O C;  3PRM B;  2CKH B;  1UBQ A;  2K8B A;  2DWQ A;  2C60 A;  4YT0 B;  4KGS A;  3PRP B;  2PE6 B;  4K3B A;  2LGI A;  1EF1 A;  2K6D B;  1JML A;  4LK0 M;  1UNS A;  1D5M C;  2HJ1 A;  4YTP B;  1E6E B;  4WQM A;  3X0W A;  2ZZP B;  4C7Y A;  3IHP C;  4W9F A;  2BB5 A;  5FK9 C;  2FCQ A;  2GBM A;  1FCL A;  3QIJ A;  1WXA A;  2NR2 A;  4KGR A;  4BKT A;  1DOY A;  1WRI A;  3NVV A;  2WWZ A;  5CX3 A;  2DX5 B;  1SBB B;  4FXC A;  2AQ2 B;  3HVD A;  5FKA C;  2KFK B;  2VZK D;  1Y56 A;  2REX A;  3ZO5 B;  1I42 A;  2D07 B;  3RN9 C;  2JF5 A;  2V3N A;  3R2I A;  2IZV B;  3Q8F A;  4IWQ A;  3WAN A;  3C8Y A;  1QZE A;  3NZU A;  4MEL A;  4WJQ A;  2BYF A;  3L54 A;  4D2K A;  5E6J A;  1EU3 A;  2IGG A;  1SE2 A;  2WGS A;  1Q1O A;  1C4A A;  1WFY A;  4IWO A;  3AEA B;  4A20 A;  4DHJ D;  2BW2 A;  1ISN A;  1JAL A;  3TJP A;  1XLQ A;  2HTH A;  1RAX A;  4WAA A;  3R3M A;  4JPS A;  3D32 A;  4TMA B;  1I35 A;  2BVC A;  1VZ7 A;  3SEB A;  1MHH E;  2MWS B;  1XF5 L;  2IO0 B;  2IPK D;  1LXD A;  3ZTD A;  2L52 A;  4J3O D;  3C19 A;  4ZRK A;  1MG8 A;  2FAZ A;  1ZE3 D;  1VLB A;  1L2N A;  1WRD B;  2A5U A;  2KDI A;  3E9S A;  4S17 A;  1WXQ A;  2L83 A;  2LVP A;  3U4E G;  4W9L A;  1WYG A;  1DGJ A;  4KKI A;  4LNO A;  2AWT A;  3L0W B;  4HEA 1;  1KM7 A;  3A4S C;  4R3D A;  1ZW7 A;  1XCQ L;  3ZRC A;  2Z0E B;  4PS7 A;  3ML9 A;  1D3Z A;  1E10 A;  4HJK A;  4C7Z A;  1N5X A;  4EKU A;  4WWO A;  4BOS C;  2KFK A;  1T3Q A;  2RGF A;  4HRO A;  4A3O A;  3BK1 A;  1WM2 A;  2WDQ B;  2XK5 B;  2ZJD A;  3SDL C;  5BYS A;  2RMM A;  4EZL A;  3JSV A;  1FD6 A;  3ENE A;  1IGD A;  3H7P B;  4HCN B;  2JXX A;  3RPF C;  1FFU A;  3UQB A;  3IG3 A;  2GRI A;  3KVF B;  3EA6 A;  2BGF A;  3BK2 A;  3LYY A;  1FFV A;  1KF6 B;  5EE3 A;  4AJY B;  3AEE B;  3ZYY X;  1UWX A;  3URY A;  3JYU A;  1V9J A;  4JQW C;  4OW0 A;  1V81 A;  2YVC A;  3MC8 A;  3KLS X;  2NMQ A;  2NBW B;  3RNG C;  4ZDV A;  3QX1 A;  1LFD A;  2PVG C;  3EC8 A;  3I63 C;  1NBF C;  3S2A A;  1L7Y A;  3ZXR A;  2MW5 A;  4O1N A;  2FNJ B;  4GIV A;  3U7Z A;  3Q69 A;  3UIP B;  2WXN A;  1FM0 D;  3ZRF A;  1FCC C;  4P1C C;  1I4Q A;  4E71 A;  3ML8 A;  3MFG A;  1K52 A;  1E7U A;  2WXL A;  4LNK A;  1D4B A;  4ARI A;  5D6J B;  5LLI A;  2IGH A;  2L3Z A;  2CHW A;  2LGX A;  3QJZ A;  3SFD B;  2V1Y A;  1KLG D;  2BT6 A;  1F0Z A;  3Q8E A;  3Q8C A;  3P4P B;  1QKZ A;  4PYU A;  5DPS A;  3DBL B;  1L6U A;  4GOC A;  2C5L C;  5LXH A;  3A9K B;  3AN1 A;  3NVW A;  3BWU D;  3NVZ A;  1YQ3 B;  2J0J A;  1J8C A;  2H89 B;  2OED A;  2FE8 A;  1E8W A;  2CHX A;  2PVO D;  2ZCC A;  4RH6 A;  3KH0 A;  1LQB A;  1B9R A;  1FNV A;  1NI2 A;  3DVN V;  1E5W A;  2LXC A;  3JSV B;  1C4P A;  2BPS A;  4NAW B;  2LJ5 A;  1TY0 A;  2MX2 A;  2KJR A;  1MHX A;  1DOX A;  2WDR B;  3MHZ A;  4IDI A;  3N1X C;  3M95 A;  2KQ4 X;  1CMX B;  1U4A A;  4ZYN A;  2NPT B;  4IW0 A;  1XQQ A;  2DBY A;  2FIF A;  2LVO A;  4JE3 B;  2W3S A;  4W9G A;  1V6E A;  4K7S A;  2D3C A;  4M02 A;  3DBR B;  3W9C B;  1WGD A;  2AX5 A;  1UH6 A;  3AE8 B;  3RUL A;  4IKG A;  3W1S C;  4OVU A;  3NUH B;  2N7D A;  4YSX B;  3WAL A;  3HM3 A;  1ZP0 B;  2KFJ A;  2JRI B;  4M8M A;  1BT0 A;  4EUT A;  1V8C A;  4MAC A;  4F1S A;  3TEW A;  1N62 A;  1WXS A;  1NYQ A;  2FUG 1;  2VH1 A;  5BMI A;  3OJ4 B;  4NQK E;  2MEK A; 
#chains in the Genus database with same CATH homology
 3CMM B;  2GBN A;  3HK0 A;  2C7N B;  1WXM A;  4BKG A;  4G0N B;  4XZ4 A;  1G6J A;  2PJH A;  1X1M A;  3L13 A;  3ZDT A;  3WAM A;  3KUZ A;  3UF8 A;  4W9E A;  2IO1 B;  4NJ6 A;  2KDE B;  1WJ6 A;  4DDI D;  1WI0 A;  3W1S A;  5C23 A;  4WQO B;  1OEY J;  3K9P B;  1UGM A;  1UD7 A;  3DOW A;  3EHV A;  4LDT D;  4FBJ B;  4DBG A;  4PS8 A;  3DVN U;  2K25 A;  2DZM A;  3R7Q A;  3QA8 A;  1Z2M A;  2DHZ A;  2WDT B;  2XBB C;  3NY5 A;  3PTF C;  4RMA A;  3UIO B;  4ANW A;  4M8N A;  5CHV C;  1WM3 A;  3KYC D;  5JHA A;  3SU8 X;  3ZNZ B;  1EUV B;  2MQJ A;  3TL5 A;  2MA9 B;  2LXA A;  3NS8 A;  4NQL B;  4DXA B;  2BWE S;  2AEH A;  2JZ3 B;  3DVG Y;  4MEM A;  4ICV A;  1V86 A;  2IY0 B;  2LVQ A;  5E6N A;  4ANX A;  5BO4 B;  3CF6 E;  4AP4 C;  1FXT B;  2ZVN A;  4DWF A;  4ANV A;  5L83 A;  1J19 A;  2KX0 A;  2FCM A;  3SD5 A;  3UQA A;  2C9W B;  3VQI A;  1S1Q B;  2KVR A;  3A9K A;  1NDD A;  2MSE D;  3EEC A;  4HK2 A;  4KV2 A;  2K39 A;  2ZPN A;  1WGH A;  1IYF A;  2K1F A;  2G3Q B;  4MSM B;  1WJ4 A;  1KLV A;  1JRU A;  4TQ0 A;  3LJ3 A;  3CSF A;  2NVU I;  5C1Z A;  2EMT A;  1J0G A;  3R7R A;  3VVW B;  3ALB A;  1WR6 E;  3OLM D;  1V5O A;  2XEW A;  2GOW A;  3PRZ A;  4LJP B;  3CST A;  1YQB A;  4NY0 A;  3PPA A;  1WY8 A;  2NS5 A;  2N1V A;  1XT9 B;  4I6L B;  1UBI A;  1P1A A;  4KZC A;  3PHX B;  2RD0 A;  1RFA A;  3RCZ A;  4FLH A;  2C7M B;  4DHZ E;  3V6E B;  3TMP B;  3DBR I;  3M62 B;  1KOT A;  3ZNI D;  1WGG A;  3NZS A;  4K7W A;  4XX5 A;  1S3S G;  2KX3 A;  2KWU B;  3ZVV A;  1Q0W B;  1IP9 A;  2I1J A;  4FN2 A;  1Y8R C;  3GOE A;  1GNU A;  3TCA A;  3JVZ X;  4EZK A;  2CU1 A;  4TUU A;  3V6C B;  2EKE C;  1WH3 A;  3VAW A;  3AXC A;  3H7S A;  3B0A A;  3MHS D;  2JWZ A;  2KJH B;  3DBL I;  3KUD B;  4II2 B;  1H8C A;  4AUQ C;  2KO3 A;  2ZEQ A;  3B1L X;  1YX6 B;  3RZF A;  1OQY A;  1H4R A;  1E90 A;  2DYB A;  2L76 A;  3ZLZ A;  2R2O A;  2DEN B;  3A1Q B;  5LXI B;  3PRM B;  4KIK B;  2CKH B;  1UBQ A;  2K8B A;  2V3S A;  2C60 A;  1Q5W B;  1P9D U;  1SGH A;  2L7R A;  3PRP B;  2PE6 B;  4FJV B;  2KQ7 A;  4ZRI A;  2Z59 B;  2PE9 A;  5TR5 A;  2CR5 A;  1EF1 A;  2OOB B;  2K6D B;  2ZVO A;  3PT2 B;  5GMV A;  4N9F 4;  3VXW A;  2N9X A;  2MLB A;  2A4Z A;  2DZK A;  2K8H A;  3LDZ E;  3Q3J A;  2GBK A;  2BKF A;  3PS6 A;  2G45 B;  2ZZP B;  4I6N B;  3X0W A;  1EF5 A;  3IHP C;  4W9F A;  3MTN B;  3VDZ A;  4F7Z A;  2FCQ A;  2GBM A;  2LI5 A;  4KZ0 A;  5CTR C;  5E6P A;  1E8Y A;  3QIJ A;  1WXA A;  2G4D B;  2NR2 A;  2FUH B;  4GXB A;  4LDT B;  4MGI E;  2KWC A;  2RSU A;  4BKT A;  2WWZ A;  3ZNH B;  5CX3 A;  2ZNV C;  4JL9 A;  4PYZ A;  2J0M A;  2DYM A;  1P0R A;  4GDL A;  2DX5 B;  5AEK B;  1RRB A;  3L10 B;  1K8R B;  2RPQ A;  2KFK B;  2B3A A;  2CS4 A;  2REX A;  2LRU A;  1P98 A;  4ANU A;  4EOY A;  3ZO5 B;  2KDB A;  3HHM A;  1I42 A;  2D07 B;  2M4N A;  1V49 A;  2JF5 A;  4GU2 A;  4TQ1 A;  1IPG A;  3TIX A;  2IZV B;  4IWQ A;  2MRP A;  3DVG X;  3WAN A;  3IFW B;  3X23 A;  2JY6 A;  3VTV A;  2JZZ A;  1QZE A;  3NZU A;  4MEL A;  3QHT A;  2DZJ A;  4WJQ A;  2KMC A;  2QHO A;  3VH3 B;  2KOX A;  3VTW A;  4P7I A;  2BYF A;  3L54 A;  2V4L A;  4NPN A;  1V5T A;  1WX7 A;  2JRH A;  3QQ8 B;  1Q1O A;  3A33 B;  1P3Q U;  1WFY A;  4JIO U;  4IWO A;  4MDK E;  2ZPY A;  4A20 A;  2BKR B;  3R66 C;  2J7Q B;  4DHJ D;  1A5R A;  4A3P A;  1EO6 A;  2LGY A;  1ISN A;  3N32 A;  3TJP A;  2HTH A;  4DHJ B;  1AAR A;  1RAX A;  2BF8 B;  3H1U A;  4HPM B;  5D2M B;  5DCN A;  4EEW A;  4EZJ A;  2UWQ A;  2JPH A;  4WAA A;  3R3M A;  1GJZ A;  4K7U A;  4LJO B;  3AUL A;  4NAW A;  2KNB A;  4J6I A;  3D32 A;  1R4M I;  1GUA B;  2YLM A;  3AU5 A;  4GDK B;  1I35 A;  2GBJ A;  4BBN C;  2IY1 B;  4GSW A;  4DK5 A;  1GC7 A;  1WXV A;  4IWP A;  3QK0 A;  4K1R B;  2MWS B;  4ZRJ A;  5JH5 C;  2DYO A;  3TBL D;  4EFO A;  2O2V A;  2IO0 B;  3S2A A;  1C1Y B;  3H7P A;  2AYO B;  2N7E A;  4NJ7 A;  2IYD B;  2KQS A;  4FUL A;  4W9K A;  4BVU C;  4G11 A;  1LXD A;  2O2V B;  3ZTD A;  4B9K A;  2WX1 A;  3HM6 X;  1WGR A;  4ZRK A;  4CO7 A;  4URK A;  1HE8 A;  3BIN A;  4DDG D;  3SHQ A;  2DAF A;  1MG8 A;  4HWI B;  2FAZ A;  2LGD A;  3V61 A;  3NOB A;  2N9E B;  4KVG B;  5IAA C;  1WE6 A;  4BOZ B;  4XC2 A;  2MBQ A;  1L2N A;  3WA0 A;  3VUX A;  4WWP A;  2FCS A;  1WRD B;  3DPD A;  2KZR A;  3I3T B;  3QC8 B;  2A5U A;  2KDI A;  2KTF A;  4WJO A;  4ICU A;  1TBE A;  1WMH B;  3A9J A;  2AL3 A;  1WMH A;  3A9J B;  4KDI C;  2LVP A;  3MJW A;  4W9L A;  5J18 A;  3VFK A;  4W9D A;  4FHK A;  1VD2 A;  2AWT A;  3L0W B;  1YJ1 A;  4I6P A;  1KM7 A;  2KAN A;  3EFU A;  3A4S C;  4GDK A;  1V2Y A;  3UIN B;  3O65 B;  2I1K A;  3QAQ A;  1ZW7 A;  3ZRC A;  2KXJ A;  2OJR A;  2WYQ A;  2Z0E B;  4PS7 A;  4AOF A;  5EDS A;  2NPT A;  3ML9 A;  2UYZ B;  2DAJ A;  1D3Z A;  5KHO A;  2W9N A;  2KLG A;  2BYE A;  5G55 A;  4BBN F;  4E3C A;  4II3 B;  5AZG A;  4HJK A;  1WIA A;  4LCD E;  4EKU A;  3A1Q A;  4WWO A;  4BOS C;  2KFK A;  4X57 B;  5IA7 A;  4F8C B;  2MBE A;  3QCA A;  4KSK C;  1OEY A;  3T8M A;  5J17 A;  2PPH A;  2RGF A;  4RM8 A;  4IM3 A;  4A3O A;  2IBI B;  3ZKJ C;  2LD9 A;  2M1M A;  1WM2 A;  3B08 A;  2XK5 B;  2ZJD A;  5AZF A;  3SDL C;  1VCB A;  4EZL A;  3JSV A;  3OAW A;  1WR1 A;  3ENE A;  4MGK E;  3WAP A;  3ZTC A;  1GG3 A;  1C3T A;  2JT4 B;  3H7P B;  3PV1 A;  3VH4 B;  4HCN B;  4MGZ E;  3U7D A;  2L00 B;  2JXX A;  3L08 A;  3JW0 X;  3U30 A;  3UQB A;  3IG3 A;  4CHK A;  3H6N A;  4MM3 A;  3U8Z A;  1E7V A;  1Z5S B;  3PRE A;  3V60 A;  3KVF B;  2BGF A;  2KWV B;  4B6W A;  3ZUN A;  2K8C A;  2KTR B;  3WIM A;  4AJY B;  3RUI B;  3ONS A;  3ZNG C;  1E8X A;  3DBH I;  2KTR A;  1R4N I;  4MH0 E;  4OVV A;  2N9P C;  2RR9 A;  3JYU A;  4HXD A;  3RT3 B;  1V9J A;  3IVF A;  4JQW C;  4G3X B;  3VUY A;  4BFR A;  1V81 A;  2KKC A;  1TZ1 A;  2EMS A;  2FCN A;  3GZN I;  2DZI A;  2D2Q A;  2KMA A;  2YVC A;  3APD A;  2KLC A;  3PGE A;  3N3K B;  2KJ6 A;  4M0W B;  2C7H A;  2G4S A;  3DDC B;  3T9L A;  2NBW B;  3APC A;  5FR6 A;  2M8S A;  3DBS A;  2KC2 A;  3KUC B;  4ZDV A;  5JHB A;  2O6V D;  2D3G A;  2HD5 B;  3QX1 A;  3ZDM C;  1LFD A;  3PLV A;  4HLE A;  3BY4 B;  3EC8 A;  3P2B A;  2D10 A;  1PQS A;  2L05 A;  1WZ3 A;  2KN5 A;  3RZW C;  2ASQ A;  1NBF C;  4FJY A;  1L7Y A;  4IUM B;  5DPT A;  4FJZ A;  3AI5 A;  1TTN A;  2MW5 A;  3RD2 A;  1WJN A;  2FNJ B;  4GIV A;  3UIP B;  3RYT A;  3UGB B;  4IG7 B;  4NQK E;  2MBB B;  3ZRF A;  4WWN A;  4K81 A;  4E71 A;  3ML8 A;  5L95 C;  5KHQ A;  2MBO A;  2VRR B;  4WJP A;  5J2R A;  4HPL B;  1E7U A;  2ZNV B;  2KD0 A;  1WE7 A;  4CYE A;  2MBH A;  2O6V A;  3WAO A;  2GMI C;  4GMV A;  2L0F A;  3DQV A;  5D6J B;  2AL6 A;  3ZIM A;  4MGY E;  4GB9 A;  1ZGU B;  2KHW B;  5LLI A;  2L3Z A;  2CHW A;  2LGX A;  5D7G A;  3QJZ A;  5CHW A;  1OGW A;  2V1Y A;  4MSQ B;  4TKN A;  4G50 A;  2D11 A;  1WJU A;  1SIF A;  3V62 A;  2XK5 A;  1YD8 U;  2GBR A;  2N1W A;  4PYU A;  5DPS A;  3ZW3 A;  5HKH A;  3ECI A;  5LXH A;  2NBU A;  2C5L C;  2KK8 A;  4GOC A;  3A9K B;  3QWZ B;  4BKS D;  3NHE B;  2J0J A;  2JUO A;  1J8C A;  1LM8 B;  1E8W A;  2CHX A;  1M94 A;  2LAS A;  2ZCC A;  2J0K A;  4YL8 A;  2KC1 A;  1LQB A;  3KH0 A;  2Y5B B;  3PLU A;  2IO2 B;  4B95 A;  4DHZ B;  1NI2 A;  1GC6 A;  3L17 A;  2M0X A;  3N30 A;  4HDO A;  4IM2 A;  4TV3 A;  3DVN V;  1XD3 B;  4KDL B;  2LRW A;  4KSL C;  1E5W A;  4W9I A;  4GDL B;  3HIZ A;  2LUE A;  4E74 A;  2LXC A;  3JSV B;  4PS3 A;  2BPS A;  4NAW B;  1V80 A;  2LJ5 A;  5CHF A;  4AWJ A;  3PSE B;  2L0T A;  2MX2 A;  2KJR A;  3KW5 B;  4KIK A;  1T0Y A;  2Z0D B;  5G2N A;  5AZH A;  2IO3 B;  4HDQ A;  4JLC A;  5DPW A;  1TGZ B;  3M95 A;  4W9H A;  4GGQ A;  5E6O A;  4WJN A;  1CMX B;  1U4A A;  2HJ8 A;  3APF A;  3M63 B;  4ZYN A;  2NPT B;  2K6Q A;  4IW0 A;  2KDF B;  1WZ0 A;  1XQQ A;  2LZ6 A;  3QAR A;  2FIF A;  2LVO A;  3DCG A;  1WX8 A;  2NCN A;  1WF9 A;  1WGY A;  1WYW B;  3H9D A;  3VTU A;  3VUW A;  3M3J A;  3OJ3 A;  1ZKH A;  4AJW A;  2JVC A;  4W9G A;  4HVB A;  1V6E A;  4K7S A;  4W9J A;  1RLF A;  3VHT C;  5DPR A;  2LWP A;  4IM0 A;  1F9J A;  2O6V B;  4RM9 A;  1WX9 A;  2HE7 A;  3W1Y A;  1WGD A;  1UZX B;  1UH6 A;  3RUL A;  3W1S C;  4IC7 B;  1UEL A;  4OVU A;  4GN1 A;  3L16 A;  3K9O B;  4HCP B;  1YX5 B;  2NBV B;  1E8Z A;  1OTR B;  2BWF A;  2N7D A;  3AU4 A;  2MP2 B;  2WX0 A;  3WAL A;  3HM3 A;  3PHW B;  2KFJ A;  2JRI B;  2PEA A;  2MP2 A;  4M8M A;  1BT0 A;  3C0R B;  3IBE A;  2ZCB A;  3KYD D;  4EUT A;  4FAD A;  4JGH B;  2R2Q A;  2MCN B;  4F1S A;  3A4R A;  2BYV E;  4MJS A;  5JZE B;  1KJT A;  5D94 A;  3Q3F A;  1WXS A;  4MJS B;  2FID A;  4BKS A;  2N4F A;  4W9C A;  4FA6 A;  2L8J A;  3PVL A;  3OJ4 B;  4FHJ A;  4NNJ B;  1SE9 A;  1YIW A;  4ASW C;  2M17 A;  3PZD A;  2CHZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...