2ASQA

Solution structure of sumo-1 in complex with a sumo-binding motif (sbm)
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
77
structure length
77
Chain Sequence
YIKLKVIGQDSSEIHFKVKMTTHLKKLKESYCQRQGVPMNSLRFLFEGQRIADNHTPKELGMEEEDVIEVYQEQTGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Small ubiquitin-related modifier 1
publication title Small Ubiquitin-like Modifier (SUMO) Recognition of a SUMO Binding Motif: A reversal of the bound orientation
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein binding
total genus 13
structure length 77
sequence length 77
ec nomenclature
pdb deposition date 2005-08-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF11976 Rad60-SLD Ubiquitin-2 like Rad60 SUMO-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 2asqA00
2XEWA 4XC2A 2MP2B 1P1AA 1WGHA 3OAWA 2KD0A 4AJYB 1A5RA 4HWIB 2GOWA 4HDOA 5D7GA 2B3AA 2ZZPB 5DPSA 3A9JA 4FHKA 3QK0A 1Z2MA 4PS7A 2JPHA 2GBKA 2MW5A 1WGRA 2DAJA 2LXCA 1FXTB 2KX0A 3VTUA 1WJNA 3NHEB 2W9NA 2IZVB 4FJZA 2RGFA 2AWTA 2JF5A 2CR5A 3UIOB 2L0FA 1WF9A 4GDLA 4KVGB 3EC8A 4M8NA 2RR9A 2KMAA 1S1QB 5E6NA 1E7UA 2AL6A 1M94A 3KYCD 2FIDA 1TGZB 2LVPA 4W9CA 4EZKA 4DWFA 1Q1OA 2R2OA 3PRZA 2KX3A 2BYEA 3LDZE 3A1QA 3OJ4B 4RMAA 1J0GA 4GB9A 5JHAA 2M17A 4KV2A 2NBUA 1H8CA 2KLCA 2DZKA 3DBSA 2BYFA 4MELA 3QQ8B 4M8MA 4NJ6A 2DZMA 4YL8A 4MDKE 5AZGA 4DDGD 2K1FA 3ZNHB 1LFDA 5E6PA 3EECA 2HD5B 1WGYA 5HKHA 4ICUA 3X23A 2MRPA 3SHQA 1LQBA 2GBMA 3ZRCA 5FR6A 3CSFA 2KTRA 3D32A 2A4ZA 4I6PA 3ZNZB 3DVNV 3PVLA 3KUDB 1WIAA 5CX3A 4JIOU 4MEMA 4W9JA 2O6VA 4BKSD 4DHZB 4DXAB 3WALA 4ASWC 1IPGA 3S2AA 2N9PC 3TL5A 4TV3A 4DHJB 2CHWA 2FNJB 4GOCA 4ANXA 4DHZE 5TR5A 3B08A 3L13A 4EOYA 2KVRA 3PRMB 4ICVA 2IY1B 5IAAC 3TIXA 2PEAA 2FUHB 3VHTC 2NBVB 4BKGA 5KHOA 1X1MA 1GC6A 1WZ0A 1D3ZA 1AARA 2JRIB 4K7UA 5AZHA 2KN5A 3IHPC 4IG7B 1EUVB 4IWPA 1LXDA 3A4SC 2KZRA 3B0AA 4LDTB 1Q5WB 4G0NB 1WR1A 2KDEB 2KQ7A 4EZJA 4JQWC 4WAAA 3KH0A 3QIJA 4BBNF 4W9LA 3PZDA 4ANWA 2XBBC 4F1SA 2LZ6A 4II3B 2JY6A 1WMHB 1YX5B 2JVCA 4WJQA 3V60A 3WAMA 3ZRFA 1OTRB 4BVUC 3VVWB 4W9IA 4E3CA 3HK0A 4PS8A 2ZJDA 4KSLC 1NDDA 2D2QA 3UQBA 3T8MA 2Z0EB 3H7PB 5BO4B 2N1WA 4E71A 4PYZA 4HCNB 4E74A 3EFUA 4B6WA 2C7NB 4W9FA 5C23A 4W9GA 1VCBA 4WJOA 3PREA 4FLHA 2JWZA 4FADA 5LXIB 1ZGUB 2HJ8A 3V6CB 4IM2A 2O2VB 2PPHA 2LWPA 1WJ6A 2N7DA 2KJ6A 3R7RA 4I6NB 4IUMB 2L0TA 3ZO5B 2LGDA 2YVCA 3KYDD 2K39A 3MJWA 2ZNVB 3L08A 4AJWA 3VH4B 5IA7A 4NY0A 3PTFC 3L0WB 4WWPA 2L3ZA 4FA6A 4IWOA 1SGHA 1WGGA 1YIWA 2G4SA 2KTFA 1WRDB 2XK5B 3A33B 4F7ZA 4XZ4A 1K8RB 1Q0WB 1V9JA 2BWFA 2R2QA 4WJNA 2G4DB 2V1YA 1EF1A 1J8CA 4KIKA 2IYDB 2BGFA 3IBEA 5J17A 4ZDVA 4II2B 1GUAB 2ZEQA 3WA0A 2BWES 2LRWA 2D07B 2K8HA 4GIVA 2GBJA 2MBEA 3B1LX 3DQVA 3IG3A 4W9DA 2HE7A 3ZTDA 3OJ3A 3ZNID 2IY0B 4GSWA 5G55A 4AWJA 3QA8A 3RULA 2L00B 2LRUA 3VQIA 5CHWA 4BKTA 4AOFA 2EKEC 4G50A 1RRBA 4LDTD 4WWNA 4ZRJA 1WM3A 4EUTA 4NAWB 2J0MA 4TQ0A 3N32A 4KDIC 3ZW3A 2MSED 3RD2A 4XX5A 3L10B 2FCMA 3VUYA 2CKHB 2KWVB 3PLUA 1WY8A 1OGWA 1HE8A 4IM3A 3VXWA 3A9JB 2ZCCA 3JVZX 4MSMB 3KUCB 3QWZB 2C60A 2BYVE 2DYMA 2IBIB 2L76A 4MGZE 1YQBA 2KHWB 3JSVA 2ZVNA 1YX6B 3APCA 3N30A 3HM6X 2FCNA 2LUEA 4GDKA 2N9EB 2Z59B 4MJSA 5DPWA 1KOTA 1G6JA 2MBQA 3TBLD 3ZVVA 2RSUA 1SE9A 1T0YA 3Q3JA 4GMVA 4RM8A 2N1VA 4CO7A 2FIFA 2D11A 2MLBA 4GU2A 4W9HA 1MG8A 4BBNC 1WX9A 1OQYA 4GDLB 4HVBA 4KZCA 2MQJA 4LJOB 4EEWA 3M62B 3GZNI 4HDQA 1SIFA 2J0KA 3VUWA 3A1QB 1PQSA 1P98A 2FCQA 1WX8A 3A9KA 3OLMD 2N4FA 4KDLB 2KK8A 3H6NA 3APFA 1TTNA 1V81A 3ML9A 1V2YA 2M1MA 1J19A 2LVQA 1WM2A 4OVVA 1XT9B 1UBIA 4TUUA 1EF5A 3ZIMA 3C0RB 1Z5SB 3DBRI 2GMIC 1V6EA 2BPSA 4FULA 1WXMA 3PHXB 5LLIA 3WAPA 3TJPA 4M0WB 1ZW7A 3K9OB 1WXSA 2JZZA 3NZSA 3RCZA 3DVGX 4FHJA 2KTRB 1WI0A 2M0XA 2UYZB 1GNUA 4NQLB 4G11A 2N9XA 4B9KA 2K8CA 3QHTA 4FJVB 3SU8X 3ALBA 2V3SA 2O6VB 3PLVA 4G3XB 2KDFB 1UZXB 3SDLC 3DVNU 3RZWC 3BY4B 1IYFA 1S3SG 2REXA 2L8JA 4CYEA 1V86A 4TQ1A 4EZLA 5JHBA 3QJZA 1RFAA 2MA9B 5CHVC 1NI2A 1TZ1A 5AEKB 3P2BA 3V6EB 4BOZB 1P3QU 2DYOA 3IVFA 4RM9A 2KDBA 2AYOB 4AUQC 1WFYA 4ANVA 4HLEA 1E5WA 4WJPA 1UH6A 3ZKJC 2K6DB 2KC1A 2KJHB 2C7MB 4ZRIA 3UQAA 4HXDA 2WYQA 3QARA 2KFKA 2VRRB 3PHWB 5CHFA 5C1ZA 3VFKA 4AP4C 3ML8A 2BKFA 2I1KA 3L16A 2G3QB 3QAQA 1WZ3A 1WXAA 4WQOB 1NBFC 4URKA 3AULA 2UWQA 2CHZA 2NPTA 2Y5BB 3DBLI 2A5UA 5E6OA 3TMPB 1U4AA 1E8YA 2LVOA 2WX1A 5L95C 2JXXA 3K9PB 4K7WA 4DBGA 1VD2A 2J0JA 1E8WA 4NPNA 2KLGA 3H1UA 2ZVOA 5DCNA 3ZDTA 1R4NI 3M95A 4K81A 3O65B 4IW0A 4NQKE 5G2NA 3RT3B 1GC7A 4BFRA 1ZKHA 2LI5A 3AI5A 2MP2A 4FN2A 2KWCA 3I3TB 3IFWB 4OVUA 3PSEB 4WWOA 2OJRA 4MH0E 3UGBB 1TBEA 1LM8B 3VTVA 2C7HA 2KWUB 2BKRB 4P7IA 3MTNB 3WANA 1WJUA 2M4NA 4IC7B 2CS4A 3M63B 2JZ3B 4J6IA 4A20A 2DYBA 4TKNA 4PS3A 3A4RA 3U7DA 2AL3A 2DZIA 1WE7A 3NZUA 4MGYE 1RAXA 3L17A 4X57B 5CTRC 1XD3B 3CSTA 1I42A 1I35A 1KJTA 3ZDMC 2KOXA 4FBJB 2O6VD 1JRUA 3DCGA 2FAZA 2KO3A 2MCNB 3AU5A 1P9DU 2NVUI 2PE6B 4ZRKA 1C3TA 2FCSA 1YD8U 4HJKA 3CF6E 1KM7A 1GJZA 3CMMB 3DDCB 4W9EA 4KIKB 2NCNA 3VDZA 1OEYA 1WYWB 3PGEA 5JH5C 4B95A 3W1SA 4GXBA 1E8XA 3UF8A 1GG3A 4A3PA 2ZPNA 4JGHB 4K1RB 3QCAA 3RUIB 2DZJA 2LGYA 1YJ1A 2NR2A 4NJ7A 4BOSC 2JUOA 2D10A 4CHKA 1F9JA 2LXAA 3LJ3A 4MSQB 2QHOA 1V5OA 2MBBB 2RPQA 3QC8B 3T9LA 3V62A 4A3OA 3L54A 2WX0A 3W1SC 2IO3B 2EMTA 2ZCBA 5EDSA 4DK5A 3DPDA 3DOWA 1C1YB 3JW0X 3NY5A 3ZNGC 1L7YA 3KUZA 3JSVB 2G45B 4GDKB 3VH3B 2GBNA 3PPAA 2NS5A 2WDTB 4GGQA 4MJSB 2C5LC 3H9DA 3VTWA 2AEHA 2K8BA 2EMSA 3HHMA 2JT4B 3ENEA 4MM3A 2Z0DB 4I6LB 3U30A 3PS6A 4EKUA 2ZPYA 4MGKE 2MX2A 2C9WB 3X0WA 2ASQA 3VAWA 1ISNA 1E90A 2V4LA 4LJPB 1WX7A 2JRHA 4HPLB 2DX5B 3NS8A 1E8ZA 1E7VA 1WH3A 2LJ5A 1WJ4A 3Q3FA 4JL9A 5GMVA 4F8CB 2DAFA 3HIZA 2KANA 2KJRA 2NBWB 4HK2A 3A9KB 2BF8B 3ECIA 3DVGY 1WMHA 2DHZA 2K6QA 2KMCA 3AU4A 3ONSA 3R3MA 4N9F4 3N3KB 2KKCA 3ZTCA 5D2MB 2LASA 3V61A 3SD5A 3UINB 1V5TA 3R66C 5L83A 5JZEB 1QZEA 2J7QB 2D3GA 3HM3A 3H7PA 2WWZA 1V80A 2DENB 2PJHA 3MHSD 4MGIE 1EO6A 3PV1A 5DPRA 4IM0A 2OOBB 3M3JA 3QX1A 1WE6A 3R7QA 4ZYNA 4ANUA 2YLMA 3RYTA 3W1YA 1UBQA 2I1JA 2O2VA 2KC2A 1KLVA 4NNJB 1V49A 4BKSA 2M8SA 1CMXB 2RD0A 3RZFA 1WGDA 1OEYJ 2KDIA 4W9KA 3AXCA 3KW5B 3U8ZA 2CU1A 5J2RA 3DBHI 4HPMB 3APDA 2KQSA 1UGMA 2L05A 2LGXA 2IO1B 1R4MI 1RLFA 1UD7A 3BINA 3WAOA 3ZUNA 1UELA 2GBRA 2KNBA 2HTHA 4JLCA 1WXVA 2XK5A 1BT0A 3NOBA 5KHQA 4HCPB 1P0RA 3KVFB 4KZ0A 2PE9A 5AZFA 1H4RA 2L7RA 2KFJA 2MWSB 5LXHA 1L2NA 3GOEA 4KSKC 2MBOA 2K25A 4PYUA 4DDID 1WR6E 2KFKB 2IO2B 2IO0B 5D94A 3PRPB 2ZNVC 3EHVA 4K7SA 2NPTB 3JYUA 4FJYA 5DPTA 2KXJA 3TCAA 1IP9A 3H7SA 4IWQA 4EFOA 3WIMA 3UIPB 3PT2B 1Y8RC 2N7EA 3ZLZA 2LD9A 4NAWA 2CHXA 2MBHA 4GN1A 4LCDE 1XQQA 3VUXA 5J18A 4DHJD 5D6JB
chains in the Genus database with same CATH superfamily
4XC2A 2MP2B 2KD0A 4IOIE 3MC0B 3QK0A 1Z2MA 4PS7A 1T0SC 4K3CA 2GBKA 4WH4A 2KN4A 2Y5CA 3NHEB 1NENB 1EWCA 2CR5A 1XLQA 3UIOB 2L0FA 3W9CB 3EGRA 4M8NA 2RR9A 5HHDG 2KMAA 5E6NA 4ZRQA 3KYCD 1TGZB 2LVPA 1Q1OA 4RMAA 3OJ4B 1J0GA 3DBSA 4MELA 4DDGD 2K1FA 3ZNHB 4BZAA 4WQMA 1YMHE 3J9CA 5LNK1 3P4SB 3SR6A 3CSFA 3D32A 3UI3A 1JCKB 3DVNV 3AB5A 4JIOU 4MEMA 2O6VA 1STEA 3DBHB 4DHZB 4DXAB 4UDUC 3TL5A 4TV3A 4GOCA 4DHZE 4EOYA 2IY1B 5IAAC 2AQ3B 1WXQA 3GP7A 3TIXA 2FUHB 3O13A 5KHOA 2QSDA 5AZHA 4N59A 3IHPC 2INPE 2GI9A 1ESFA 2H88B 4JQWC 2MJDA 4ANWA 2M56B 4RF0A 2JY6A 1WMHB 3V60A 3VVWB 4E3CA 1JWSD 2DNFA 4R3DA 2QCZA 1VZ6A 1NDDA 1AYFA 3H7PB 2ZW1A 5BO4B 4E71A 4PYZA 4A9AA 2C7NB 5C23A 4W9GA 2JWZA 3FC4A 5LXIB 2HJ8A 3V6CB 4M01A 1ZP0B 2LWPA 2N7DA 2KJ6A 1B9RA 4IUMB 2L0TA 3KYDD 3RNGC 3SFEB 4PK1A 1L4DB 2ZNVB 3L08A 3VH4B 1SGHA 2G4SA 3N1ZC 2XK5B 1HTQA 2WXLA 2R2QA 1ZOYB 2E3TA 1IUEA 2QDFA 2BGFA 3NUHB 4L1BA 4II2B 4ZDVA 3WA0A 2FBWB 4GIVA 3IG3A 3FILB 2GB1A 4DXFA 1JW9D 3ZNID 2IY0B 5G55A 3RULA 4BKTA 5CHWA 4G50A 2LHEA 4NAWB 2J0MA 4TQ0A 1XCQL 4M02A 2KVZA 4A90A 3R2IA 1WY8A 5MPOA 4IM3A 3VXWA 1FM0D 5IO9A 1MG4A 4MGZE 2L76A 1YQBA 3WANA 3N30A 2ZVNA 3APCA 4GDKA 4P1BC 1PUTA 1YN3A 2QIEB 1KOTA 2MBQA 1GOZA 3TSSA 2N1VA 4CO7A 1R7SA 3KQ4A 4W9HA 1VDVA 1OQYA 3B2FA 3FAHA 4GDLB 2MQJA 4LJOB 1L4ZB 4ITKA 1P98A 1D5MC 2FCQA 3HUIA 3H6NA 3AN1A 2M1MA 4OVVA 3DBRI 2GMIC 2BPSA 3PHXB 1I4HA 2L32A 4M0WB 1ZW7A 3K9OB 2JZZA 3NZSA 4ARIA 2K0PA 1V1PA 3W2DA 1XLOA 4WIPA 4G11A 1C76A 3SU8X 3ALBA 2V3SA 1N5WA 3KWLA 3PLVA 1UZXB 3RZWC 1XLNA 1S3SG 1RM6C 1ZDVA 3QJZA 1RFAA 3R2TA 3P2BA 4HLEA 1QLBB 1UH6A 2ACZB 3B2GA 1NVID 4A55A 1GB1A 1UNSA 3NVWA 1GPXA 2I38A 3QARA 3PHWB 2BKFA 3L16A 1QKZA 1WXAA 1NBFC 4RH6A 2NPTA 2WX1A 3K9PB 1BUIC 5C3JB 2J0JA 4WURA 2ZVOA 3ZDTA 1R4NI 3EFCA 3M95A 3BWUD 3RN9C 3E9SA 3IFWB 3Q8EA 4OVUA 1TBEA 2C7HA 3AE2B 2DYBA 4XWWA 3U7DA 1WE7A 4MGYE 1I7HA 1E0ZA 5CTRC 1XD3B 1KJTA 3ZDMC 2KOXA 3DCGA 2FAZA 4YXDB 2PE6B 3DBRB 3P4QB 4WAFA 1JWBD 1OEYA 2DLBA 4OVZA 5HG2A 2BQQA 1TY2A 3QCAA 3DWGC 1SXTA 3BVZA 1K53A 4JE3B 3MJ5A 2LXAA 4MSQB 2ICIA 3V62A 2RPQA 1KFYB 4OZBA 3W1SC 2IO3B 1EM7A 2ZCBA 3RNFC 3U7ZA 4ACFA 1C1YB 3JW0X 1L7YA 1UGJA 3C19A 3JSVB 2G45B 3ZQ4A 2PLPA 3U2SC 2C5LC 2K8BA 3AEEB 3ENEA 3TEXA 4MM3A 4I6LB 3PS6A 4EKUA 2ZPYA 4S0RA 2TSSA 2V4LA 3AE3B 1WWTA 1TJEA 4JL9A 1E7VA 4F8CB 1NI3A 2DAFA 2KJRA 2NBWB 4HK2A 1R4NB 2BF8B 3TEWA 3RPFC 2K6QA 3ONSA 1MVKA 3ZTCA 4HKQA 3UINB 3R66C 1FNVA 3Q3OC 4NJCA 3MHSD 1XF5L 2Y3AA 1TYGB 4ANUA 1RFKA 2YLMA 3W1YA 4D2KA 2I1JA 1V49A 4BKSA 1OEYJ 4W9KA 3KW5B 2KQSA 2L05A 2LGXA 1OFFA 1UD7A 1N60A 3WAOA 1UELA 1TS3A 2NMQA 2WXIA 1P0RA 4KZ0A 2LJIA 3DHIC 5LXHA 1C4AA 1CQVA 2K25A 2G9HD 1K52A 4KGRA 3AM9A 3RFZB 3PRPB 2ZNVC 2V3NA 1QOBA 1I4GA 4O1NA 4K7SA 4HJGE 4FJYA 2KXJA 3MHZA 2QMTA 3ZXVA 1IP9A 3H7SA 1ZE3D 3WIMA 3UIPB 1VRAB 3DHHC 4ZYSA 1XQQA 1P1AA 1LO5D 1TKYA 1ACCA 4HDOA 2JYTA 2ZZPB 1ZUD2 2M19A 3AE5B 1J7AA 2J4XA 1WJNA 4YWGG 4FJZA 2AWTA 2MH7A 1WF9A 3EC8A 1S1QB 2AL6A 4W9CA 4DWFA 2R2OA 2KX3A 4B0EA 3A1QA 2WXHA 3VRBB 5JHAA 2M17A 4KV2A 4WWMA 2KLCA 4NAMA 2DZKA 3NS1A 2BYFA 4NJ6A 2LHDA 2KQ4X 1JMLA 2HD5B 2WXKA 5HKHA 3X23A 2GBMA 4J3OD 2QJLA 2A4ZA 3PVLA 1YQ3B 1WIAA 3MP9A 4BKSD 3WALA 1IPGA 3BZDB 2N9PC 4DHJB 4TMAB 3B08A 3L13A 5IP4D 2AQ1B 3Q8AA 2RDBC 2PKOA 2BS3B 2PEAA 3VHTC 5FKAC 4C7ZA 2IGDA 2V0GA 1AARA 4K7UA 2EELA 4IWPA 1LXDA 2KZRA 3Q2AC 3I9V1 2KQ7A 4CQNA 4WAAA 3KH0A 3PZDA 2XBBC 1YX5B 3PZ8A 5BYRA 4PS8A 2ZJDA 1XEEA 4KSLC 1DGJA 1N63A 1QQRA 1T6BX 1GAQB 4W9FA 4WJOA 4FLHA 5AUIA 1CK1A 1SSNA 2YEPF 4IM2A 2Z8LA 3ZO5B 2LGDA 2YVCA 2K39A 2JYEA 1FFUA 5IA7A 1SEBD 3L0WB 4WWPA 1C79A 1EWYC 3A33B 2L83A 3NZ3A 1QILA 4LK0M 4XZ4A 2D3CA 4WJNA 3VR8B 2G4DB 1EF1A 2IYDB 5J17A 2CJOA 1GUAB 2PVGC 2ZEQA 3P4RB 2GBJA 3GE8C 1FNUA 1ZXIA 3ZTDA 3OJ3A 4AWJA 3QA8A 4FXCA 2WDRB 3V3XA 2KT7A 5E6JA 1IBXB 3NVVA 1HQRD 4C80A 3N32A 4KDIC 2MSED 2FE8A 2BW2A 1PGBA 1FPYA 2FCMA 2JX5A 1C78A 4Q2JA 4YTMB 2WHIA 3JVZX 4QAYA 2C60A 1MHHE 2KHWB 3LB8C 4HPPA 1YX6B 2BVCA 3HM6X 2Z59B 4MJSA 2V3PA 2RSUA 4JWSC 3Q3JA 4GMVA 1C77A 1C4CA 1MG8A 2WXGA 2WXOA 4JWUC 4EEWA 4HDQA 3VRAB 1SIFA 3VUWA 2MJ3A 3BYTB 1WX8A 1F1HA 1K50A 2N4FA 4TSSA 1V81A 2WXMA 1XT9B 1L6VA 4TUUA 3TJPA 3RCZA 4OHJA 2M0XA 2UYZB 2KAJA 1QOGA 3MFGA 3QHTA 3HVZA 2O6VB 2GRIA 1KRHA 1QOFA 1T5XD 3BY4B 1IYFA 2L8JA 1CJEA 3RNAC 1KH0A 4EZLA 2B76B 5JHBA 1TZ1A 3V6EB 1FCLA 1P3QU 2DYOA 4C7YA 2N7JA 2AYOB 5H92C 4ANVA 2I2YA 1E5WA 1I4PA 1YJJA 2KC1A 2C7MB 1HA5A 4HXDA 4C56C 2KFKA 2VRRB 3CIRB 5CHFA 5C1ZA 3VFKA 2WGSA 4AP4C 4URKA 3AULA 2UWQA 5E6OA 2A5UA 2WXFA 2LVOA 4LNFA 1JALA 1VD2A 1E8WA 2KLGA 1Y56A 3H1UA 5DCNA 3O65B 1EU3A 4NQKE 1GC7A 2LI5A 2M0AA 2FUG1 3I3TB 2BBCA 3PSEB 4LLGM 2OJRA 4MH0E 1T0QC 1LM8B 2BKRB 1V97A 4IC7B 2IPKD 2JZ3B 1UWXA 4A20A 5G5GA 1B1ZA 1MFWA 2DZIA 4X57B 3P1MA 3P63A 1I42A 4FBJB 2O6VD 4P6VF 2KO3A 1TT5B 1EU4A 1P9DU 1YD8U 1I4RA 3NG0A 3P4PB 1GJZA 4K3BA 4H2AA 3Q14C 3VDZA 3PGEA 1L5PA 2JWUA 3UF8A 3RMKC 4K1RB 1YJ1A 1ET9A 4PT5A 4BOSC 2JUOA 4REZA 2QHOA 2MBBB 3QC8B 4ARCA 2WP9B 5EDSA 3DOWA 3ZNGC 2WS3B 4N58A 2IGHA 4GDKB 1RYJA 2AEHA 2EMSA 4P1CC 1V8CA 5AUKA 1XCTL 3IXSA 1SIJA 3U30A 2MX2A 2C9WB 2ASQA 1E90A 1WX7A 2JRHA 2DX5B 5D3DA 3NS8A 1E8ZA 1WH3A 3Q3FA 4LNNA 4A8XC 5GMVA 1TKEA 1BXTA 2LFIA 2EKIA 3ECIA 1TKGA 3Q3NC 4KKJA 4N9F4 3V61A 4AQ7A 1Q10A 2J7QB 2D3GA 1YN5A 2WWZA 2D3AA 4MGIE 1EO6A 2MJEA 1V1PB 3PV1A 5DPRA 3R7QA 3M3JA 3QX1A 1WE6A 3GS2A 3EA6A 4XDDA 2O2VA 2KC2A 1P7EA 2M8SA 1CMXB 3AE1B 2CU1A 4HPMB 2N9KA 2IO1B 2WLBA 1JWAD 1C9FA 4JLCA 1BT0A 3NOBA 2PE9A 2L7RA 1L2NA 3GOEA 3DHGC 3EHVA 2NPTB 3Q3MC 4JPSA 3I5JC 1FCCC 1Y8RC 3KWVA 1L0XB 4LCDE 2D5GA 4ZRPA 3OAWA 4AJYB 1A5RA 4OW0A 5DPSA 2W3RA 4YSYB 3A9JA 2JPHA 2DAJA 2LXCA 3L4PA 1FXTB 2IJ0A 1FRRA 2JF5A 3P42A 2WXQA 4HKZE 2QILA 3AE7B 4KVGB 1J7CA 1M94A 4EZKA 2FIDA 3PRZA 3BVGA 2R61A 1M4VA 3ETRA 2CJNA 4M8MA 3QQ8B 2DZMA 4MDKE 5AZGA 1LFDA 2QEJC 4US9A 1FRDA 3EECA 2MRPA 1PFDA 5FR6A 4RCOA 2KTRA 3KUDB 4RGNA 4W9JA 2WU5B 3HRDD 1KLUD 3S2AA 1AWDA 1ENFA 2LMCA 3NVZA 5TR5A 4XE0A 2KVRA 3PRMB 4JX1C 4ICVA 3BIID 3GB1A 2NBVB 4MACA 4DQOC 1GC6A 4MM3B 1FMAD 3A4SC 1E6EB 1Q5WB 3RNCC 1WR1A 2KDEB 4MH8A 4C4VA 3QIJA 4BBNF 1XO3A 2LZ6A 1TY0A 4BVUC 3HK0A 4KGSA 2D2QA 3UQBA 1DOXA 2Z0EB 4HCNB 4E74A 3DWMA 4B6WA 1VCBA 1CZPA 1ZGUB 1D5XC 3C8YA 2PPHA 1WJ6A 3R7RA 4I6NB 5BMGA 3MJWA 5IOIA 3IAM1 1AN8A 3H8HA 1JWUD 3IAS1 2RDHA 2KWDA 4NY0A 3PTFC 2L3ZA 3RNEC 4IWOA 2JQRB 2KTFA 1UWMA 1WRDB 2X38A 3ABVB 1K8RB 1V9JA 1J8CA 3Q8FA 4KIKA 3IBEA 2K3UA 1LGRA 2DBYA 1F52A 2D07B 2K8HA 2PIAA 3B1LX 3DQVA 4GLSC 4ZOHC 2HE7A 3N20C 2LRUA 3U52E 4AOFA 4WWNA 1RRBA 1I4XA 4ZRJA 1FD6A 1WM3A 4EUTA 4XX5A 4IKGA 1SF0A 2ON8A 2LUMA 3PLUA 4MSMB 3KUCB 5GXGB 2IBIB 1SB3C 2FCNA 2LUEA 5I4DA 4ZHPA 1G6JA 3TBLD 3ZVVA 2AX5A 1SE9A 1T0YA 4RM8A 4USAA 4BAXA 2FIFA 2D11A 4GU2A 2CU3A 2WQYB 4KZCA 1PDXA 3T3NA 1QOAA 5BMHA 3A1QB 1PQSA 3A9KA 2L52A 3APFA 4B0MA 4YTNB 1J19A 1PYWD 3ZIMA 1UBIA 3FKYA 1Z5SB 4FULA 3WAPA 4C00A 5LLIA 2NTSA 1KTKA 3DVGX 4FHJA 1ZXHA 1GNUA 4NQLB 2N9XA 2K8CA 4FJVB 5EE1A 4G3XB 1PGXA 1PGAA 2KDFB 3DVNU 3N9YC 4CYEA 2DWQA 2SAKA 3MC9A 1N5XA 4TQ1A 2JSVX 1WYGA 2MA9B 3VR9B 5CHVC 1KF6B 3NVYA 1F2RI 1VR9A 3URYA 4RM9A 1NYQA 1WFYA 4WJPA 3ZKJC 1SE4A 4RNAA 4ZRIA 4RGMA 2WYQA 3ZJVA 3ML8A 5C2TB 2I1KA 2G3QB 4RGTA 1WZ3A 4WQOB 1MJDA 3TMPB 1U4AA 5L95C 2QC8A 2IDYA 4NPNA 2KACA 4K81A 5FK9C 4LNOA 1HZ5A 1ZKHA 3AI5A 2MP2A 1QF6A 3UGBB 2LGIA 2KWUB 4P7IA 1YQ4B 1WJUA 2M4NA 2JXTA 4LTUA 2CS4A 1J7BA 4J6IA 1FFVA 3A4RA 2AL3A 2RDGA 3NZUA 1RAXA 3L17A 3LYYA 3I57A 1I35A 4A6QA 1JRUA 2MCNB 3AE9B 2SEBD 1SBBB 1YOVB 3AU5A 1HXYD 2UU7A 1JQ4A 2IGGA 2FCSA 1C3TA 1YJIA 1HZ6A 3E56A 4W9EA 5EE3A 4ZHOA 1WYWB 1N6ZA 3W1SA 1JROA 4AS1A 1GG3A 4A3PA 2ZPNA 2WXJA 3RUIB 2DZJA 2LGYA 3BYYB 1E10A 2NR2A 3I63C 3AEAB 1T0RC 3ZXRA 4CHKA 5EE9A 1V5OA 2BT6A 3T9LA 1A70A 2WX0A 1MPEA 2EMTA 4DK5A 2K9XA 3DPDA 2AQ2B 3NY5A 4IDIA 2V4IB 3OWEB 2KDMA 2GBNA 4GGQA 4MJSB 1VLBA 1FIQA 3H9DA 3VTWA 1TIFA 2L1AA 5G5HA 1SJHD 4MGKE 1NYRA 3VAWA 1ET6A 5JH5C 1WJ4A 2KANA 3EUB2 2J53A 2KYWA 2BB5A 3IT6B 2INNE 5IKCM 3DVGY 1SE3A 1WMHA 2WXNA 2KMCA 3R3MA 2KKCA 5D2MB 3SD5A 2LGSA 3AECB 5L83A 1YNTE 3H7PA 1V80A 2PJHA 2PTLA 3AV8A 3LXFA 4IM0A 3W5UB 1F0ZA 2XN9C 1OQQA 2Q5WD 2XNAC 3RYTA 4NNJB 1NEKB 3N1YC 3W5VB 2RD0A 3RZFA 1WGDA 2BS2B 2KDIA 2VH1A 4RFBA 1ZPSA 5IN7A 1R4MI 1TS2A 3ZUNA 4S17A 2KNBA 2HTHA 1I4QA 3AEBB 3N1XC 3TEZA 1WXVA 2XK5A 3HVDA 4HCPB 3KVFB 1FNWA 1WGKA 2MBOA 4PYUA 2HTME 4DDID 2KFKB 2IO2B 2LEKA 5JXVA 5D94A 3FILA 2MHJA 3JYUA 3RNBC 5DPTA 3TCAA 1XXGA 1FEHA 1BMLC 4EFOA 5FR3A 3PT2B 2N7EA 1DOIA 2LD9A 4NAWA 2CHXA 2MBHA 2V9HA 3VUXA 5J18A 2WDQB 2XEWA 1WGHA 4L23A 4HWIB 2GOWA 5D7GA 2B3AA 4FHKA 1AW7A 2MW5A 1WGRA 2WU2B 5BYSA 2KX0A 3VTUA 2W9NA 2IZVB 2RGFA 4GDLA 1WSPA 2OJWA 3AEDB 1E7UA 3LDZE 2BYEA 4GB9A 1MHXA 3Q6BA 2NBUA 1T3QA 1H8CA 4YL8A 3KLSX 5E6PA 1WGYA 1L0YB 4ICUA 1F77A 3ZJTA 3SHQA 4M0WA 1LQBA 1GB4A 2HJ1A 3ZRCA 4I6PA 3ZNZB 5CX3A 2YEPB 4LNIA 4ASWC 2BS4B 1R4MB 2INDC 2CHWA 2FNJB 3MC8A 4ANXA 4YTPB 3T3OA 3AMZA 1TS5A 4BKGA 1OQRA 1N61A 1X1MA 1WZ0A 4OZAA 1D3ZA 2MEKA 1RWSA 2JRIB 1WRIA 5BMIA 2KN5A 4IG7B 1E9MA 1EUVB 2RMMA 4LDTB 3B0AA 2HDEA 4G0NB 1FO4A 3Q69A 4EZJA 5HFYA 4W9LA 1V1OA 4F1SA 4II3B 5D3IB 1FXAA 2JVCA 4WJQA 3WAMA 3ZRFA 1OTRB 4W9IA 3NRZA 4XDCA 1VJKA 3T8MA 1XLPA 2N1WA 2H89B 5BYQA 3EFUA 2PW9A 3PREA 4FADA 4YSXB 2O2VB 1L6UA 4YSZB 2N0SB 1UUPA 1ZDXA 2OHFA 4RF1A 3AEFB 1QT9A 4AJWA 1N62A 4FA6A 1FXIA 1WGGA 1K51A 1YIWA 4F7ZA 1YN4A 3AEGB 1JRPA 2Y5PA 3Q8CA 1Q0WB 2BWFA 2JZPA 2V1YA 3NJTA 1JWMD 2BWES 2LRWA 2MBEA 1E7PB 4W9DA 4MT5A 4GSWA 4EE2A 2L00B 3VQIA 3TEYA 2EKEC 4LDTD 2J42A 3ZW3A 2WXRA 3RD2A 2ZW0A 3L10B 3RI7C 1P7FA 3VUYA 4M00A 2CKHB 2KWVB 3ZYYX 1OGWA 1HE8A 2INCC 3A9JB 2ZCCA 3QWZB 2BYVE 2DYMA 3JSVA 2N9EB 5DPWA 1C4PA 4KGTA 2MLBA 4BBNC 1F2RC 1WX9A 4HVBA 2OEDA 3M62B 3GZNI 2J0KA 2NTTA 1IGCA 3OLMD 4KDLB 2KK8A 1TTNA 3ML9A 1V2YA 2LVQA 2WXPA 1WM2A 4OZCA 1EF5A 3C0RB 1V6EA 1WXMA 3GE3C 2BYTA 1WXSA 4HRSA 4XWTA 2KTRB 1WI0A 4US8A 4B9KA 4DXGA 3SFDB 1VZ8A 3SDLC 2K22A 3U4EG 2REXA 5H8YE 3BK1A 1V86A 1NI2A 5AEKB 4BOZB 3IVFA 2KDBA 4AUQC 3V05A 2K6DB 2KJHB 2W3SA 3UQAA 3QAQA 3OG5A 2N9LA 2CHZA 5HI1A 2Y5BB 3DBLI 4C4VB 1E8YA 2JXXA 3ZGZA 4K7WA 2X8XX 3AE8B 4DBGA 4L2YA 4YT0B 2D3BA 4KKIA 1TZOA 4IW0A 3RT3B 5G2NA 4BFRA 1ROEA 4FN2A 2KWCA 3B9JA 2W55A 1TS4A 4WWOA 2VZKB 3VTVA 4XGAB 4HROA 3MTNB 1HEZE 3M63B 2PMVA 3R8BA 1HTOA 4TKNA 4PS3A 3GZNB 2J52A 1D5ZC 3CSTA 4NZLB 3IT4B 1DYQA 2NVUI 4ZRKA 4HJKA 3CF6E 2KMMA 1KM7A 3AE6B 3CMMB 3DDCB 4KIKB 2NCNA 4B95A 4GXBA 1E8XA 1MI0A 4RGOS 4JGHB 2WDVB 2RPVA 4NJ7A 1SE2A 2D10A 1F9JA 5EE0A 3LJ3A 1D4BA 4A3OA 2K5PA 3L54A 1KLGD 2ONQA 4KX6B 4N6EB 3KUZA 3VH3B 3PPAA 2NS5A 2WDTB 3Q8BA 4XYCA 3AH7A 3SEBA 3HHMA 2JT4B 5TSSA 2Z0DB 3PZ7A 2BTEA 2VZKD 3DBLB 4P16A 3X0WA 1ISNA 1IGDA 1DOYA 4LJPB 4HPLB 2LJ5A 3TUOA 2G1EA 3HIZA 3A9KB 3CWIA 1UF0A 2DHZA 3AU4A 1L0VB 3N3KB 2LASA 1V5TA 5JZEB 1QZEA 3HM3A 2DENB 1VZ7A 5T8IA 2OOBB 4ZYNA 1UBQA 1KLVA 4HEA1 3ZJUA 3AXCA 1SJED 3BK2A 4LNKA 2W82A 3U8ZA 5J2RA 3DBHI 3APDA 1UGMA 3AE4B 1RLFA 3BINA 2GBRA 2VH2A 5KHQA 5AZFA 1H4RA 2KFJA 2MWSB 4KSKC 3BVMA 1WR6E 2GLSA 2W54A 2IO0B 3WCQA 2WNMA 2BB6A 1D6EC 4IWQA 1IBXA 3PO0A 3ZLZA 4GN1A 2E6XA 2JU6X 2PVOD 4DHJD 5D6JB
chains in the Genus database with same CATH topology
2XEWA 4XC2A 2MP2B 1P1AA 1WGHA 3OAWA 2KD0A 4AJYB 1A5RA 4HWIB 2GOWA 4HDOA 5D7GA 2B3AA 2ZZPB 5DPSA 3A9JA 4FHKA 3QK0A 1Z2MA 4PS7A 2JPHA 2GBKA 2MW5A 1WGRA 2DAJA 2LXCA 1FXTB 2KX0A 3VTUA 1WJNA 3NHEB 2W9NA 2IZVB 4FJZA 2RGFA 2AWTA 2JF5A 2CR5A 3UIOB 2L0FA 1WF9A 4GDLA 4KVGB 3EC8A 4M8NA 2RR9A 2KMAA 1S1QB 5E6NA 1E7UA 2AL6A 1M94A 3KYCD 2FIDA 1TGZB 2LVPA 4W9CA 4EZKA 4DWFA 1Q1OA 2R2OA 3PRZA 2KX3A 2BYEA 3LDZE 3A1QA 3OJ4B 4RMAA 1J0GA 4GB9A 5JHAA 2M17A 4KV2A 2NBUA 1H8CA 2KLCA 2DZKA 3DBSA 2BYFA 4MELA 3QQ8B 4M8MA 4NJ6A 2DZMA 4YL8A 4MDKE 5AZGA 4DDGD 2K1FA 3ZNHB 1LFDA 5E6PA 3EECA 2HD5B 1WGYA 5HKHA 4ICUA 3X23A 2MRPA 3SHQA 1LQBA 2GBMA 3ZRCA 5FR6A 3CSFA 2KTRA 3D32A 2A4ZA 4I6PA 3ZNZB 3DVNV 3PVLA 3KUDB 1WIAA 5CX3A 4JIOU 4MEMA 4W9JA 2O6VA 4BKSD 4DHZB 4DXAB 3WALA 4ASWC 1IPGA 3S2AA 2N9PC 3TL5A 4TV3A 4DHJB 2CHWA 2FNJB 4GOCA 4ANXA 4DHZE 5TR5A 3B08A 3L13A 4EOYA 2KVRA 3PRMB 4ICVA 2IY1B 5IAAC 3TIXA 2PEAA 2FUHB 3VHTC 2NBVB 4BKGA 5KHOA 1X1MA 1GC6A 1WZ0A 1D3ZA 1AARA 2JRIB 4K7UA 5AZHA 2KN5A 3IHPC 4IG7B 1EUVB 4IWPA 1LXDA 3A4SC 2KZRA 3B0AA 4LDTB 1Q5WB 4G0NB 1WR1A 2KDEB 2KQ7A 4EZJA 4JQWC 4WAAA 3KH0A 3QIJA 4BBNF 4W9LA 3PZDA 4ANWA 2XBBC 4F1SA 2LZ6A 4II3B 2JY6A 1WMHB 1YX5B 2JVCA 4WJQA 3V60A 3WAMA 3ZRFA 1OTRB 4BVUC 3VVWB 4W9IA 4E3CA 3HK0A 4PS8A 2ZJDA 4KSLC 1NDDA 2D2QA 3UQBA 3T8MA 2Z0EB 3H7PB 5BO4B 2N1WA 4E71A 4PYZA 4HCNB 4E74A 3EFUA 4B6WA 2C7NB 4W9FA 5C23A 4W9GA 1VCBA 4WJOA 3PREA 4FLHA 2JWZA 4FADA 5LXIB 1ZGUB 2HJ8A 3V6CB 4IM2A 2O2VB 2PPHA 2LWPA 1WJ6A 2N7DA 2KJ6A 3R7RA 4I6NB 4IUMB 2L0TA 3ZO5B 2LGDA 2YVCA 3KYDD 2K39A 3MJWA 2ZNVB 3L08A 4AJWA 3VH4B 5IA7A 4NY0A 3PTFC 3L0WB 4WWPA 2L3ZA 4FA6A 4IWOA 1SGHA 1WGGA 1YIWA 2G4SA 2KTFA 1WRDB 2XK5B 3A33B 4F7ZA 4XZ4A 1K8RB 1Q0WB 1V9JA 2BWFA 2R2QA 4WJNA 2G4DB 2V1YA 1EF1A 1J8CA 4KIKA 2IYDB 2BGFA 3IBEA 5J17A 4ZDVA 4II2B 1GUAB 2ZEQA 3WA0A 2BWES 2LRWA 2D07B 2K8HA 4GIVA 2GBJA 2MBEA 3B1LX 3DQVA 3IG3A 4W9DA 2HE7A 3ZTDA 3OJ3A 3ZNID 2IY0B 4GSWA 5G55A 4AWJA 3QA8A 3RULA 2L00B 2LRUA 3VQIA 5CHWA 4BKTA 4AOFA 2EKEC 4G50A 1RRBA 4LDTD 4WWNA 4ZRJA 1WM3A 4EUTA 4NAWB 2J0MA 4TQ0A 3N32A 4KDIC 3ZW3A 2MSED 3RD2A 4XX5A 3L10B 2FCMA 3VUYA 2CKHB 2KWVB 3PLUA 1WY8A 1OGWA 1HE8A 4IM3A 3VXWA 3A9JB 2ZCCA 3JVZX 4MSMB 3KUCB 3QWZB 2C60A 2BYVE 2DYMA 2IBIB 2L76A 4MGZE 1YQBA 2KHWB 3JSVA 2ZVNA 1YX6B 3APCA 3N30A 3HM6X 2FCNA 2LUEA 4GDKA 2N9EB 2Z59B 4MJSA 5DPWA 1KOTA 1G6JA 2MBQA 3TBLD 3ZVVA 2RSUA 1SE9A 1T0YA 3Q3JA 4GMVA 4RM8A 2N1VA 4CO7A 2FIFA 2D11A 2MLBA 4GU2A 4W9HA 1MG8A 4BBNC 1WX9A 1OQYA 4GDLB 4HVBA 4KZCA 2MQJA 4LJOB 4EEWA 3M62B 3GZNI 4HDQA 1SIFA 2J0KA 3VUWA 3A1QB 1PQSA 1P98A 2FCQA 1WX8A 3A9KA 3OLMD 2N4FA 4KDLB 2KK8A 3H6NA 3APFA 1TTNA 1V81A 3ML9A 1V2YA 2M1MA 1J19A 2LVQA 1WM2A 4OVVA 1XT9B 1UBIA 4TUUA 1EF5A 3ZIMA 3C0RB 1Z5SB 3DBRI 2GMIC 1V6EA 2BPSA 4FULA 1WXMA 3PHXB 5LLIA 3WAPA 3TJPA 4M0WB 1ZW7A 3K9OB 1WXSA 2JZZA 3NZSA 3RCZA 3DVGX 4FHJA 2KTRB 1WI0A 2M0XA 2UYZB 1GNUA 4NQLB 4G11A 2N9XA 4B9KA 2K8CA 3QHTA 4FJVB 3SU8X 3ALBA 2V3SA 2O6VB 3PLVA 4G3XB 2KDFB 1UZXB 3SDLC 3DVNU 3RZWC 3BY4B 1IYFA 1S3SG 2REXA 2L8JA 4CYEA 1V86A 4TQ1A 4EZLA 5JHBA 3QJZA 1RFAA 2MA9B 5CHVC 1NI2A 1TZ1A 5AEKB 3P2BA 3V6EB 4BOZB 1P3QU 2DYOA 3IVFA 4RM9A 2KDBA 2AYOB 4AUQC 1WFYA 4ANVA 4HLEA 1E5WA 4WJPA 1UH6A 3ZKJC 2K6DB 2KC1A 2KJHB 2C7MB 4ZRIA 3UQAA 4HXDA 2WYQA 3QARA 2KFKA 2VRRB 3PHWB 5CHFA 5C1ZA 3VFKA 4AP4C 3ML8A 2BKFA 2I1KA 3L16A 2G3QB 3QAQA 1WZ3A 1WXAA 4WQOB 1NBFC 4URKA 3AULA 2UWQA 2CHZA 2NPTA 2Y5BB 3DBLI 2A5UA 5E6OA 3TMPB 1U4AA 1E8YA 2LVOA 2WX1A 5L95C 2JXXA 3K9PB 4K7WA 4DBGA 1VD2A 2J0JA 1E8WA 4NPNA 2KLGA 3H1UA 2ZVOA 5DCNA 3ZDTA 1R4NI 3M95A 4K81A 3O65B 4IW0A 4NQKE 5G2NA 3RT3B 1GC7A 4BFRA 1ZKHA 2LI5A 3AI5A 2MP2A 4FN2A 2KWCA 3I3TB 3IFWB 4OVUA 3PSEB 4WWOA 2OJRA 4MH0E 3UGBB 1TBEA 1LM8B 3VTVA 2C7HA 2KWUB 2BKRB 4P7IA 3MTNB 3WANA 1WJUA 2M4NA 4IC7B 2CS4A 3M63B 2JZ3B 4J6IA 4A20A 2DYBA 4TKNA 4PS3A 3A4RA 3U7DA 2AL3A 2DZIA 1WE7A 3NZUA 4MGYE 1RAXA 3L17A 4X57B 5CTRC 1XD3B 3CSTA 1I42A 1I35A 1KJTA 3ZDMC 2KOXA 4FBJB 2O6VD 1JRUA 3DCGA 2FAZA 2KO3A 2MCNB 3AU5A 1P9DU 2NVUI 2PE6B 4ZRKA 1C3TA 2FCSA 1YD8U 4HJKA 3CF6E 1KM7A 1GJZA 3CMMB 3DDCB 4W9EA 4KIKB 2NCNA 3VDZA 1OEYA 1WYWB 3PGEA 5JH5C 4B95A 3W1SA 4GXBA 1E8XA 3UF8A 1GG3A 4A3PA 2ZPNA 4JGHB 4K1RB 3QCAA 3RUIB 2DZJA 2LGYA 1YJ1A 2NR2A 4NJ7A 4BOSC 2JUOA 2D10A 4CHKA 1F9JA 2LXAA 3LJ3A 4MSQB 2QHOA 1V5OA 2MBBB 2RPQA 3QC8B 3T9LA 3V62A 4A3OA 3L54A 2WX0A 3W1SC 2IO3B 2EMTA 2ZCBA 5EDSA 4DK5A 3DPDA 3DOWA 1C1YB 3JW0X 3NY5A 3ZNGC 1L7YA 3KUZA 3JSVB 2G45B 4GDKB 3VH3B 2GBNA 3PPAA 2NS5A 2WDTB 4GGQA 4MJSB 2C5LC 3H9DA 3VTWA 2AEHA 2K8BA 2EMSA 3HHMA 2JT4B 3ENEA 4MM3A 2Z0DB 4I6LB 3U30A 3PS6A 4EKUA 2ZPYA 4MGKE 2MX2A 2C9WB 3X0WA 2ASQA 3VAWA 1ISNA 1E90A 2V4LA 4LJPB 1WX7A 2JRHA 4HPLB 2DX5B 3NS8A 1E8ZA 1E7VA 1WH3A 2LJ5A 1WJ4A 3Q3FA 4JL9A 5GMVA 4F8CB 2DAFA 3HIZA 2KANA 2KJRA 2NBWB 4HK2A 3A9KB 2BF8B 3ECIA 3DVGY 1WMHA 2DHZA 2K6QA 2KMCA 3AU4A 3ONSA 3R3MA 4N9F4 3N3KB 2KKCA 3ZTCA 5D2MB 2LASA 3V61A 3SD5A 3UINB 1V5TA 3R66C 5L83A 5JZEB 1QZEA 2J7QB 2D3GA 3HM3A 3H7PA 2WWZA 1V80A 2DENB 2PJHA 3MHSD 4MGIE 1EO6A 3PV1A 5DPRA 4IM0A 2OOBB 3M3JA 3QX1A 1WE6A 3R7QA 4ZYNA 4ANUA 2YLMA 3RYTA 3W1YA 1UBQA 2I1JA 2O2VA 2KC2A 1KLVA 4NNJB 1V49A 4BKSA 2M8SA 1CMXB 2RD0A 3RZFA 1WGDA 1OEYJ 2KDIA 4W9KA 3AXCA 3KW5B 3U8ZA 2CU1A 5J2RA 3DBHI 4HPMB 3APDA 2KQSA 1UGMA 2L05A 2LGXA 2IO1B 1R4MI 1RLFA 1UD7A 3BINA 3WAOA 3ZUNA 1UELA 2GBRA 2KNBA 2HTHA 4JLCA 1WXVA 2XK5A 1BT0A 3NOBA 5KHQA 4HCPB 1P0RA 3KVFB 4KZ0A 2PE9A 5AZFA 1H4RA 2L7RA 2KFJA 2MWSB 5LXHA 1L2NA 3GOEA 4KSKC 2MBOA 2K25A 4PYUA 4DDID 1WR6E 2KFKB 2IO2B 2IO0B 5D94A 3PRPB 2ZNVC 3EHVA 4K7SA 2NPTB 3JYUA 4FJYA 5DPTA 2KXJA 3TCAA 1IP9A 3H7SA 4IWQA 4EFOA 3WIMA 3UIPB 3PT2B 1Y8RC 2N7EA 3ZLZA 2LD9A 4NAWA 2CHXA 2MBHA 4GN1A 4LCDE 1XQQA 3VUXA 5J18A 4DHJD 5D6JB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2XEW A;  4XC2 A;  2MP2 B;  1P1A A;  1WGH A;  3OAW A;  2KD0 A;  4AJY B;  1A5R A;  4HWI B;  2GOW A;  4HDO A;  5D7G A;  2B3A A;  2ZZP B;  5DPS A;  3A9J A;  4FHK A;  3QK0 A;  1Z2M A;  4PS7 A;  2JPH A;  2GBK A;  2MW5 A;  1WGR A;  2DAJ A;  2LXC A;  1FXT B;  2KX0 A;  3VTU A;  1WJN A;  3NHE B;  2W9N A;  2IZV B;  4FJZ A;  2RGF A;  2AWT A;  2JF5 A;  2CR5 A;  3UIO B;  2L0F A;  1WF9 A;  4GDL A;  4KVG B;  3EC8 A;  4M8N A;  2RR9 A;  2KMA A;  1S1Q B;  5E6N A;  1E7U A;  2AL6 A;  1M94 A;  3KYC D;  2FID A;  1TGZ B;  2LVP A;  4W9C A;  4EZK A;  4DWF A;  1Q1O A;  2R2O A;  3PRZ A;  2KX3 A;  2BYE A;  3LDZ E;  3A1Q A;  3OJ4 B;  4RMA A;  1J0G A;  4GB9 A;  5JHA A;  2M17 A;  4KV2 A;  2NBU A;  1H8C A;  2KLC A;  2DZK A;  3DBS A;  2BYF A;  4MEL A;  3QQ8 B;  4M8M A;  4NJ6 A;  2DZM A;  4YL8 A;  4MDK E;  5AZG A;  4DDG D;  2K1F A;  3ZNH B;  1LFD A;  5E6P A;  3EEC A;  2HD5 B;  1WGY A;  5HKH A;  4ICU A;  3X23 A;  2MRP A;  3SHQ A;  1LQB A;  2GBM A;  3ZRC A;  5FR6 A;  3CSF A;  2KTR A;  3D32 A;  2A4Z A;  4I6P A;  3ZNZ B;  3DVN V;  3PVL A;  3KUD B;  1WIA A;  5CX3 A;  4JIO U;  4MEM A;  4W9J A;  2O6V A;  4BKS D;  4DHZ B;  4DXA B;  3WAL A;  4ASW C;  1IPG A;  3S2A A;  2N9P C;  3TL5 A;  4TV3 A;  4DHJ B;  2CHW A;  2FNJ B;  4GOC A;  4ANX A;  4DHZ E;  5TR5 A;  3B08 A;  3L13 A;  4EOY A;  2KVR A;  3PRM B;  4ICV A;  2IY1 B;  5IAA C;  3TIX A;  2PEA A;  2FUH B;  3VHT C;  2NBV B;  4BKG A;  5KHO A;  1X1M A;  1GC6 A;  1WZ0 A;  1D3Z A;  1AAR A;  2JRI B;  4K7U A;  5AZH A;  2KN5 A;  3IHP C;  4IG7 B;  1EUV B;  4IWP A;  1LXD A;  3A4S C;  2KZR A;  3B0A A;  4LDT B;  1Q5W B;  4G0N B;  1WR1 A;  2KDE B;  2KQ7 A;  4EZJ A;  4JQW C;  4WAA A;  3KH0 A;  3QIJ A;  4BBN F;  4W9L A;  3PZD A;  4ANW A;  2XBB C;  4F1S A;  2LZ6 A;  4II3 B;  2JY6 A;  1WMH B;  1YX5 B;  2JVC A;  4WJQ A;  3V60 A;  3WAM A;  3ZRF A;  1OTR B;  4BVU C;  3VVW B;  4W9I A;  4E3C A;  3HK0 A;  4PS8 A;  2ZJD A;  4KSL C;  1NDD A;  2D2Q A;  3UQB A;  3T8M A;  2Z0E B;  3H7P B;  5BO4 B;  2N1W A;  4E71 A;  4PYZ A;  4HCN B;  4E74 A;  3EFU A;  4B6W A;  2C7N B;  4W9F A;  5C23 A;  4W9G A;  1VCB A;  4WJO A;  3PRE A;  4FLH A;  2JWZ A;  4FAD A;  5LXI B;  1ZGU B;  2HJ8 A;  3V6C B;  4IM2 A;  2O2V B;  2PPH A;  2LWP A;  1WJ6 A;  2N7D A;  2KJ6 A;  3R7R A;  4I6N B;  4IUM B;  2L0T A;  3ZO5 B;  2LGD A;  2YVC A;  3KYD D;  2K39 A;  3MJW A;  2ZNV B;  3L08 A;  4AJW A;  3VH4 B;  5IA7 A;  4NY0 A;  3PTF C;  3L0W B;  4WWP A;  2L3Z A;  4FA6 A;  4IWO A;  1SGH A;  1WGG A;  1YIW A;  2G4S A;  2KTF A;  1WRD B;  2XK5 B;  3A33 B;  4F7Z A;  4XZ4 A;  1K8R B;  1Q0W B;  1V9J A;  2BWF A;  2R2Q A;  4WJN A;  2G4D B;  2V1Y A;  1EF1 A;  1J8C A;  4KIK A;  2IYD B;  2BGF A;  3IBE A;  5J17 A;  4ZDV A;  4II2 B;  1GUA B;  2ZEQ A;  3WA0 A;  2BWE S;  2LRW A;  2D07 B;  2K8H A;  4GIV A;  2GBJ A;  2MBE A;  3B1L X;  3DQV A;  3IG3 A;  4W9D A;  2HE7 A;  3ZTD A;  3OJ3 A;  3ZNI D;  2IY0 B;  4GSW A;  5G55 A;  4AWJ A;  3QA8 A;  3RUL A;  2L00 B;  2LRU A;  3VQI A;  5CHW A;  4BKT A;  4AOF A;  2EKE C;  4G50 A;  1RRB A;  4LDT D;  4WWN A;  4ZRJ A;  1WM3 A;  4EUT A;  4NAW B;  2J0M A;  4TQ0 A;  3N32 A;  4KDI C;  3ZW3 A;  2MSE D;  3RD2 A;  4XX5 A;  3L10 B;  2FCM A;  3VUY A;  2CKH B;  2KWV B;  3PLU A;  1WY8 A;  1OGW A;  1HE8 A;  4IM3 A;  3VXW A;  3A9J B;  2ZCC A;  3JVZ X;  4MSM B;  3KUC B;  3QWZ B;  2C60 A;  2BYV E;  2DYM A;  2IBI B;  2L76 A;  4MGZ E;  1YQB A;  2KHW B;  3JSV A;  2ZVN A;  1YX6 B;  3APC A;  3N30 A;  3HM6 X;  2FCN A;  2LUE A;  4GDK A;  2N9E B;  2Z59 B;  4MJS A;  5DPW A;  1KOT A;  1G6J A;  2MBQ A;  3TBL D;  3ZVV A;  2RSU A;  1SE9 A;  1T0Y A;  3Q3J A;  4GMV A;  4RM8 A;  2N1V A;  4CO7 A;  2FIF A;  2D11 A;  2MLB A;  4GU2 A;  4W9H A;  1MG8 A;  4BBN C;  1WX9 A;  1OQY A;  4GDL B;  4HVB A;  4KZC A;  2MQJ A;  4LJO B;  4EEW A;  3M62 B;  3GZN I;  4HDQ A;  1SIF A;  2J0K A;  3VUW A;  3A1Q B;  1PQS A;  1P98 A;  2FCQ A;  1WX8 A;  3A9K A;  3OLM D;  2N4F A;  4KDL B;  2KK8 A;  3H6N A;  3APF A;  1TTN A;  1V81 A;  3ML9 A;  1V2Y A;  2M1M A;  1J19 A;  2LVQ A;  1WM2 A;  4OVV A;  1XT9 B;  1UBI A;  4TUU A;  1EF5 A;  3ZIM A;  3C0R B;  1Z5S B;  3DBR I;  2GMI C;  1V6E A;  2BPS A;  4FUL A;  1WXM A;  3PHX B;  5LLI A;  3WAP A;  3TJP A;  4M0W B;  1ZW7 A;  3K9O B;  1WXS A;  2JZZ A;  3NZS A;  3RCZ A;  3DVG X;  4FHJ A;  2KTR B;  1WI0 A;  2M0X A;  2UYZ B;  1GNU A;  4NQL B;  4G11 A;  2N9X A;  4B9K A;  2K8C A;  3QHT A;  4FJV B;  3SU8 X;  3ALB A;  2V3S A;  2O6V B;  3PLV A;  4G3X B;  2KDF B;  1UZX B;  3SDL C;  3DVN U;  3RZW C;  3BY4 B;  1IYF A;  1S3S G;  2REX A;  2L8J A;  4CYE A;  1V86 A;  4TQ1 A;  4EZL A;  5JHB A;  3QJZ A;  1RFA A;  2MA9 B;  5CHV C;  1NI2 A;  1TZ1 A;  5AEK B;  3P2B A;  3V6E B;  4BOZ B;  1P3Q U;  2DYO A;  3IVF A;  4RM9 A;  2KDB A;  2AYO B;  4AUQ C;  1WFY A;  4ANV A;  4HLE A;  1E5W A;  4WJP A;  1UH6 A;  3ZKJ C;  2K6D B;  2KC1 A;  2KJH B;  2C7M B;  4ZRI A;  3UQA A;  4HXD A;  2WYQ A;  3QAR A;  2KFK A;  2VRR B;  3PHW B;  5CHF A;  5C1Z A;  3VFK A;  4AP4 C;  3ML8 A;  2BKF A;  2I1K A;  3L16 A;  2G3Q B;  3QAQ A;  1WZ3 A;  1WXA A;  4WQO B;  1NBF C;  4URK A;  3AUL A;  2UWQ A;  2CHZ A;  2NPT A;  2Y5B B;  3DBL I;  2A5U A;  5E6O A;  3TMP B;  1U4A A;  1E8Y A;  2LVO A;  2WX1 A;  5L95 C;  2JXX A;  3K9P B;  4K7W A;  4DBG A;  1VD2 A;  2J0J A;  1E8W A;  4NPN A;  2KLG A;  3H1U A;  2ZVO A;  5DCN A;  3ZDT A;  1R4N I;  3M95 A;  4K81 A;  3O65 B;  4IW0 A;  4NQK E;  5G2N A;  3RT3 B;  1GC7 A;  4BFR A;  1ZKH A;  2LI5 A;  3AI5 A;  2MP2 A;  4FN2 A;  2KWC A;  3I3T B;  3IFW B;  4OVU A;  3PSE B;  4WWO A;  2OJR A;  4MH0 E;  3UGB B;  1TBE A;  1LM8 B;  3VTV A;  2C7H A;  2KWU B;  2BKR B;  4P7I A;  3MTN B;  3WAN A;  1WJU A;  2M4N A;  4IC7 B;  2CS4 A;  3M63 B;  2JZ3 B;  4J6I A;  4A20 A;  2DYB A;  4TKN A;  4PS3 A;  3A4R A;  3U7D A;  2AL3 A;  2DZI A;  1WE7 A;  3NZU A;  4MGY E;  1RAX A;  3L17 A;  4X57 B;  5CTR C;  1XD3 B;  3CST A;  1I42 A;  1I35 A;  1KJT A;  3ZDM C;  2KOX A;  4FBJ B;  2O6V D;  1JRU A;  3DCG A;  2FAZ A;  2KO3 A;  2MCN B;  3AU5 A;  1P9D U;  2NVU I;  2PE6 B;  4ZRK A;  1C3T A;  2FCS A;  1YD8 U;  4HJK A;  3CF6 E;  1KM7 A;  1GJZ A;  3CMM B;  3DDC B;  4W9E A;  4KIK B;  2NCN A;  3VDZ A;  1OEY A;  1WYW B;  3PGE A;  5JH5 C;  4B95 A;  3W1S A;  4GXB A;  1E8X A;  3UF8 A;  1GG3 A;  4A3P A;  2ZPN A;  4JGH B;  4K1R B;  3QCA A;  3RUI B;  2DZJ A;  2LGY A;  1YJ1 A;  2NR2 A;  4NJ7 A;  4BOS C;  2JUO A;  2D10 A;  4CHK A;  1F9J A;  2LXA A;  3LJ3 A;  4MSQ B;  2QHO A;  1V5O A;  2MBB B;  2RPQ A;  3QC8 B;  3T9L A;  3V62 A;  4A3O A;  3L54 A;  2WX0 A;  3W1S C;  2IO3 B;  2EMT A;  2ZCB A;  5EDS A;  4DK5 A;  3DPD A;  3DOW A;  1C1Y B;  3JW0 X;  3NY5 A;  3ZNG C;  1L7Y A;  3KUZ A;  3JSV B;  2G45 B;  4GDK B;  3VH3 B;  2GBN A;  3PPA A;  2NS5 A;  2WDT B;  4GGQ A;  4MJS B;  2C5L C;  3H9D A;  3VTW A;  2AEH A;  2K8B A;  2EMS A;  3HHM A;  2JT4 B;  3ENE A;  4MM3 A;  2Z0D B;  4I6L B;  3U30 A;  3PS6 A;  4EKU A;  2ZPY A;  4MGK E;  2MX2 A;  2C9W B;  3X0W A;  2ASQ A;  3VAW A;  1ISN A;  1E90 A;  2V4L A;  4LJP B;  1WX7 A;  2JRH A;  4HPL B;  2DX5 B;  3NS8 A;  1E8Z A;  1E7V A;  1WH3 A;  2LJ5 A;  1WJ4 A;  3Q3F A;  4JL9 A;  5GMV A;  4F8C B;  2DAF A;  3HIZ A;  2KAN A;  2KJR A;  2NBW B;  4HK2 A;  3A9K B;  2BF8 B;  3ECI A;  3DVG Y;  1WMH A;  2DHZ A;  2K6Q A;  2KMC A;  3AU4 A;  3ONS A;  3R3M A;  4N9F 4;  3N3K B;  2KKC A;  3ZTC A;  5D2M B;  2LAS A;  3V61 A;  3SD5 A;  3UIN B;  1V5T A;  3R66 C;  5L83 A;  5JZE B;  1QZE A;  2J7Q B;  2D3G A;  3HM3 A;  3H7P A;  2WWZ A;  1V80 A;  2DEN B;  2PJH A;  3MHS D;  4MGI E;  1EO6 A;  3PV1 A;  5DPR A;  4IM0 A;  2OOB B;  3M3J A;  3QX1 A;  1WE6 A;  3R7Q A;  4ZYN A;  4ANU A;  2YLM A;  3RYT A;  3W1Y A;  1UBQ A;  2I1J A;  2O2V A;  2KC2 A;  1KLV A;  4NNJ B;  1V49 A;  4BKS A;  2M8S A;  1CMX B;  2RD0 A;  3RZF A;  1WGD A;  1OEY J;  2KDI A;  4W9K A;  3AXC A;  3KW5 B;  3U8Z A;  2CU1 A;  5J2R A;  3DBH I;  4HPM B;  3APD A;  2KQS A;  1UGM A;  2L05 A;  2LGX A;  2IO1 B;  1R4M I;  1RLF A;  1UD7 A;  3BIN A;  3WAO A;  3ZUN A;  1UEL A;  2GBR A;  2KNB A;  2HTH A;  4JLC A;  1WXV A;  2XK5 A;  1BT0 A;  3NOB A;  5KHQ A;  4HCP B;  1P0R A;  3KVF B;  4KZ0 A;  2PE9 A;  5AZF A;  1H4R A;  2L7R A;  2KFJ A;  2MWS B;  5LXH A;  1L2N A;  3GOE A;  4KSK C;  2MBO A;  2K25 A;  4PYU A;  4DDI D;  1WR6 E;  2KFK B;  2IO2 B;  2IO0 B;  5D94 A;  3PRP B;  2ZNV C;  3EHV A;  4K7S A;  2NPT B;  3JYU A;  4FJY A;  5DPT A;  2KXJ A;  3TCA A;  1IP9 A;  3H7S A;  4IWQ A;  4EFO A;  3WIM A;  3UIP B;  3PT2 B;  1Y8R C;  2N7E A;  3ZLZ A;  2LD9 A;  4NAW A;  2CHX A;  2MBH A;  4GN1 A;  4LCD E;  1XQQ A;  3VUX A;  5J18 A;  4DHJ D;  5D6J B; 
#chains in the Genus database with same CATH topology
 4XC2 A;  2MP2 B;  2KD0 A;  4IOI E;  3MC0 B;  3QK0 A;  1Z2M A;  4PS7 A;  1T0S C;  4K3C A;  2GBK A;  4WH4 A;  2KN4 A;  2Y5C A;  3NHE B;  1NEN B;  1EWC A;  2CR5 A;  1XLQ A;  3UIO B;  2L0F A;  3W9C B;  3EGR A;  4M8N A;  2RR9 A;  5HHD G;  2KMA A;  5E6N A;  4ZRQ A;  3KYC D;  1TGZ B;  2LVP A;  1Q1O A;  4RMA A;  3OJ4 B;  1J0G A;  3DBS A;  4MEL A;  4DDG D;  2K1F A;  3ZNH B;  4BZA A;  4WQM A;  1YMH E;  3J9C A;  5LNK 1;  3P4S B;  3SR6 A;  3CSF A;  3D32 A;  3UI3 A;  1JCK B;  3DVN V;  3AB5 A;  4JIO U;  4MEM A;  2O6V A;  1STE A;  3DBH B;  4DHZ B;  4DXA B;  4UDU C;  3TL5 A;  4TV3 A;  4GOC A;  4DHZ E;  4EOY A;  2IY1 B;  5IAA C;  2AQ3 B;  1WXQ A;  3GP7 A;  3TIX A;  2FUH B;  3O13 A;  5KHO A;  2QSD A;  5AZH A;  4N59 A;  3IHP C;  2INP E;  2GI9 A;  1ESF A;  2H88 B;  4JQW C;  2MJD A;  4ANW A;  2M56 B;  4RF0 A;  2JY6 A;  1WMH B;  3V60 A;  3VVW B;  4E3C A;  1JWS D;  2DNF A;  4R3D A;  2QCZ A;  1VZ6 A;  1NDD A;  1AYF A;  3H7P B;  2ZW1 A;  5BO4 B;  4E71 A;  4PYZ A;  4A9A A;  2C7N B;  5C23 A;  4W9G A;  2JWZ A;  3FC4 A;  5LXI B;  2HJ8 A;  3V6C B;  4M01 A;  1ZP0 B;  2LWP A;  2N7D A;  2KJ6 A;  1B9R A;  4IUM B;  2L0T A;  3KYD D;  3RNG C;  3SFE B;  4PK1 A;  1L4D B;  2ZNV B;  3L08 A;  3VH4 B;  1SGH A;  2G4S A;  3N1Z C;  2XK5 B;  1HTQ A;  2WXL A;  2R2Q A;  1ZOY B;  2E3T A;  1IUE A;  2QDF A;  2BGF A;  3NUH B;  4L1B A;  4II2 B;  4ZDV A;  3WA0 A;  2FBW B;  4GIV A;  3IG3 A;  3FIL B;  2GB1 A;  4DXF A;  1JW9 D;  3ZNI D;  2IY0 B;  5G55 A;  3RUL A;  4BKT A;  5CHW A;  4G50 A;  2LHE A;  4NAW B;  2J0M A;  4TQ0 A;  1XCQ L;  4M02 A;  2KVZ A;  4A90 A;  3R2I A;  1WY8 A;  5MPO A;  4IM3 A;  3VXW A;  1FM0 D;  5IO9 A;  1MG4 A;  4MGZ E;  2L76 A;  1YQB A;  3WAN A;  3N30 A;  2ZVN A;  3APC A;  4GDK A;  4P1B C;  1PUT A;  1YN3 A;  2QIE B;  1KOT A;  2MBQ A;  1GOZ A;  3TSS A;  2N1V A;  4CO7 A;  1R7S A;  3KQ4 A;  4W9H A;  1VDV A;  1OQY A;  3B2F A;  3FAH A;  4GDL B;  2MQJ A;  4LJO B;  1L4Z B;  4ITK A;  1P98 A;  1D5M C;  2FCQ A;  3HUI A;  3H6N A;  3AN1 A;  2M1M A;  4OVV A;  3DBR I;  2GMI C;  2BPS A;  3PHX B;  1I4H A;  2L32 A;  4M0W B;  1ZW7 A;  3K9O B;  2JZZ A;  3NZS A;  4ARI A;  2K0P A;  1V1P A;  3W2D A;  1XLO A;  4WIP A;  4G11 A;  1C76 A;  3SU8 X;  3ALB A;  2V3S A;  1N5W A;  3KWL A;  3PLV A;  1UZX B;  3RZW C;  1XLN A;  1S3S G;  1RM6 C;  1ZDV A;  3QJZ A;  1RFA A;  3R2T A;  3P2B A;  4HLE A;  1QLB B;  1UH6 A;  2ACZ B;  3B2G A;  1NVI D;  4A55 A;  1GB1 A;  1UNS A;  3NVW A;  1GPX A;  2I38 A;  3QAR A;  3PHW B;  2BKF A;  3L16 A;  1QKZ A;  1WXA A;  1NBF C;  4RH6 A;  2NPT A;  2WX1 A;  3K9P B;  1BUI C;  5C3J B;  2J0J A;  4WUR A;  2ZVO A;  3ZDT A;  1R4N I;  3EFC A;  3M95 A;  3BWU D;  3RN9 C;  3E9S A;  3IFW B;  3Q8E A;  4OVU A;  1TBE A;  2C7H A;  3AE2 B;  2DYB A;  4XWW A;  3U7D A;  1WE7 A;  4MGY E;  1I7H A;  1E0Z A;  5CTR C;  1XD3 B;  1KJT A;  3ZDM C;  2KOX A;  3DCG A;  2FAZ A;  4YXD B;  2PE6 B;  3DBR B;  3P4Q B;  4WAF A;  1JWB D;  1OEY A;  2DLB A;  4OVZ A;  5HG2 A;  2BQQ A;  1TY2 A;  3QCA A;  3DWG C;  1SXT A;  3BVZ A;  1K53 A;  4JE3 B;  3MJ5 A;  2LXA A;  4MSQ B;  2ICI A;  3V62 A;  2RPQ A;  1KFY B;  4OZB A;  3W1S C;  2IO3 B;  1EM7 A;  2ZCB A;  3RNF C;  3U7Z A;  4ACF A;  1C1Y B;  3JW0 X;  1L7Y A;  1UGJ A;  3C19 A;  3JSV B;  2G45 B;  3ZQ4 A;  2PLP A;  3U2S C;  2C5L C;  2K8B A;  3AEE B;  3ENE A;  3TEX A;  4MM3 A;  4I6L B;  3PS6 A;  4EKU A;  2ZPY A;  4S0R A;  2TSS A;  2V4L A;  3AE3 B;  1WWT A;  1TJE A;  4JL9 A;  1E7V A;  4F8C B;  1NI3 A;  2DAF A;  2KJR A;  2NBW B;  4HK2 A;  1R4N B;  2BF8 B;  3TEW A;  3RPF C;  2K6Q A;  3ONS A;  1MVK A;  3ZTC A;  4HKQ A;  3UIN B;  3R66 C;  1FNV A;  3Q3O C;  4NJC A;  3MHS D;  1XF5 L;  2Y3A A;  1TYG B;  4ANU A;  1RFK A;  2YLM A;  3W1Y A;  4D2K A;  2I1J A;  1V49 A;  4BKS A;  1OEY J;  4W9K A;  3KW5 B;  2KQS A;  2L05 A;  2LGX A;  1OFF A;  1UD7 A;  1N60 A;  3WAO A;  1UEL A;  1TS3 A;  2NMQ A;  2WXI A;  1P0R A;  4KZ0 A;  2LJI A;  3DHI C;  5LXH A;  1C4A A;  1CQV A;  2K25 A;  2G9H D;  1K52 A;  4KGR A;  3AM9 A;  3RFZ B;  3PRP B;  2ZNV C;  2V3N A;  1QOB A;  1I4G A;  4O1N A;  4K7S A;  4HJG E;  4FJY A;  2KXJ A;  3MHZ A;  2QMT A;  3ZXV A;  1IP9 A;  3H7S A;  1ZE3 D;  3WIM A;  3UIP B;  1VRA B;  3DHH C;  4ZYS A;  1XQQ A;  1P1A A;  1LO5 D;  1TKY A;  1ACC A;  4HDO A;  2JYT A;  2ZZP B;  1ZUD 2;  2M19 A;  3AE5 B;  1J7A A;  2J4X A;  1WJN A;  4YWG G;  4FJZ A;  2AWT A;  2MH7 A;  1WF9 A;  3EC8 A;  1S1Q B;  2AL6 A;  4W9C A;  4DWF A;  2R2O A;  2KX3 A;  4B0E A;  3A1Q A;  2WXH A;  3VRB B;  5JHA A;  2M17 A;  4KV2 A;  4WWM A;  2KLC A;  4NAM A;  2DZK A;  3NS1 A;  2BYF A;  4NJ6 A;  2LHD A;  2KQ4 X;  1JML A;  2HD5 B;  2WXK A;  5HKH A;  3X23 A;  2GBM A;  4J3O D;  2QJL A;  2A4Z A;  3PVL A;  1YQ3 B;  1WIA A;  3MP9 A;  4BKS D;  3WAL A;  1IPG A;  3BZD B;  2N9P C;  4DHJ B;  4TMA B;  3B08 A;  3L13 A;  5IP4 D;  2AQ1 B;  3Q8A A;  2RDB C;  2PKO A;  2BS3 B;  2PEA A;  3VHT C;  5FKA C;  4C7Z A;  2IGD A;  2V0G A;  1AAR A;  4K7U A;  2EEL A;  4IWP A;  1LXD A;  2KZR A;  3Q2A C;  3I9V 1;  2KQ7 A;  4CQN A;  4WAA A;  3KH0 A;  3PZD A;  2XBB C;  1YX5 B;  3PZ8 A;  5BYR A;  4PS8 A;  2ZJD A;  1XEE A;  4KSL C;  1DGJ A;  1N63 A;  1QQR A;  1T6B X;  1GAQ B;  4W9F A;  4WJO A;  4FLH A;  5AUI A;  1CK1 A;  1SSN A;  2YEP F;  4IM2 A;  2Z8L A;  3ZO5 B;  2LGD A;  2YVC A;  2K39 A;  2JYE A;  1FFU A;  5IA7 A;  1SEB D;  3L0W B;  4WWP A;  1C79 A;  1EWY C;  3A33 B;  2L83 A;  3NZ3 A;  1QIL A;  4LK0 M;  4XZ4 A;  2D3C A;  4WJN A;  3VR8 B;  2G4D B;  1EF1 A;  2IYD B;  5J17 A;  2CJO A;  1GUA B;  2PVG C;  2ZEQ A;  3P4R B;  2GBJ A;  3GE8 C;  1FNU A;  1ZXI A;  3ZTD A;  3OJ3 A;  4AWJ A;  3QA8 A;  4FXC A;  2WDR B;  3V3X A;  2KT7 A;  5E6J A;  1IBX B;  3NVV A;  1HQR D;  4C80 A;  3N32 A;  4KDI C;  2MSE D;  2FE8 A;  2BW2 A;  1PGB A;  1FPY A;  2FCM A;  2JX5 A;  1C78 A;  4Q2J A;  4YTM B;  2WHI A;  3JVZ X;  4QAY A;  2C60 A;  1MHH E;  2KHW B;  3LB8 C;  4HPP A;  1YX6 B;  2BVC A;  3HM6 X;  2Z59 B;  4MJS A;  2V3P A;  2RSU A;  4JWS C;  3Q3J A;  4GMV A;  1C77 A;  1C4C A;  1MG8 A;  2WXG A;  2WXO A;  4JWU C;  4EEW A;  4HDQ A;  3VRA B;  1SIF A;  3VUW A;  2MJ3 A;  3BYT B;  1WX8 A;  1F1H A;  1K50 A;  2N4F A;  4TSS A;  1V81 A;  2WXM A;  1XT9 B;  1L6V A;  4TUU A;  3TJP A;  3RCZ A;  4OHJ A;  2M0X A;  2UYZ B;  2KAJ A;  1QOG A;  3MFG A;  3QHT A;  3HVZ A;  2O6V B;  2GRI A;  1KRH A;  1QOF A;  1T5X D;  3BY4 B;  1IYF A;  2L8J A;  1CJE A;  3RNA C;  1KH0 A;  4EZL A;  2B76 B;  5JHB A;  1TZ1 A;  3V6E B;  1FCL A;  1P3Q U;  2DYO A;  4C7Y A;  2N7J A;  2AYO B;  5H92 C;  4ANV A;  2I2Y A;  1E5W A;  1I4P A;  1YJJ A;  2KC1 A;  2C7M B;  1HA5 A;  4HXD A;  4C56 C;  2KFK A;  2VRR B;  3CIR B;  5CHF A;  5C1Z A;  3VFK A;  2WGS A;  4AP4 C;  4URK A;  3AUL A;  2UWQ A;  5E6O A;  2A5U A;  2WXF A;  2LVO A;  4LNF A;  1JAL A;  1VD2 A;  1E8W A;  2KLG A;  1Y56 A;  3H1U A;  5DCN A;  3O65 B;  1EU3 A;  4NQK E;  1GC7 A;  2LI5 A;  2M0A A;  2FUG 1;  3I3T B;  2BBC A;  3PSE B;  4LLG M;  2OJR A;  4MH0 E;  1T0Q C;  1LM8 B;  2BKR B;  1V97 A;  4IC7 B;  2IPK D;  2JZ3 B;  1UWX A;  4A20 A;  5G5G A;  1B1Z A;  1MFW A;  2DZI A;  4X57 B;  3P1M A;  3P63 A;  1I42 A;  4FBJ B;  2O6V D;  4P6V F;  2KO3 A;  1TT5 B;  1EU4 A;  1P9D U;  1YD8 U;  1I4R A;  3NG0 A;  3P4P B;  1GJZ A;  4K3B A;  4H2A A;  3Q14 C;  3VDZ A;  3PGE A;  1L5P A;  2JWU A;  3UF8 A;  3RMK C;  4K1R B;  1YJ1 A;  1ET9 A;  4PT5 A;  4BOS C;  2JUO A;  4REZ A;  2QHO A;  2MBB B;  3QC8 B;  4ARC A;  2WP9 B;  5EDS A;  3DOW A;  3ZNG C;  2WS3 B;  4N58 A;  2IGH A;  4GDK B;  1RYJ A;  2AEH A;  2EMS A;  4P1C C;  1V8C A;  5AUK A;  1XCT L;  3IXS A;  1SIJ A;  3U30 A;  2MX2 A;  2C9W B;  2ASQ A;  1E90 A;  1WX7 A;  2JRH A;  2DX5 B;  5D3D A;  3NS8 A;  1E8Z A;  1WH3 A;  3Q3F A;  4LNN A;  4A8X C;  5GMV A;  1TKE A;  1BXT A;  2LFI A;  2EKI A;  3ECI A;  1TKG A;  3Q3N C;  4KKJ A;  4N9F 4;  3V61 A;  4AQ7 A;  1Q10 A;  2J7Q B;  2D3G A;  1YN5 A;  2WWZ A;  2D3A A;  4MGI E;  1EO6 A;  2MJE A;  1V1P B;  3PV1 A;  5DPR A;  3R7Q A;  3M3J A;  3QX1 A;  1WE6 A;  3GS2 A;  3EA6 A;  4XDD A;  2O2V A;  2KC2 A;  1P7E A;  2M8S A;  1CMX B;  3AE1 B;  2CU1 A;  4HPM B;  2N9K A;  2IO1 B;  2WLB A;  1JWA D;  1C9F A;  4JLC A;  1BT0 A;  3NOB A;  2PE9 A;  2L7R A;  1L2N A;  3GOE A;  3DHG C;  3EHV A;  2NPT B;  3Q3M C;  4JPS A;  3I5J C;  1FCC C;  1Y8R C;  3KWV A;  1L0X B;  4LCD E;  2D5G A;  4ZRP A;  3OAW A;  4AJY B;  1A5R A;  4OW0 A;  5DPS A;  2W3R A;  4YSY B;  3A9J A;  2JPH A;  2DAJ A;  2LXC A;  3L4P A;  1FXT B;  2IJ0 A;  1FRR A;  2JF5 A;  3P42 A;  2WXQ A;  4HKZ E;  2QIL A;  3AE7 B;  4KVG B;  1J7C A;  1M94 A;  4EZK A;  2FID A;  3PRZ A;  3BVG A;  2R61 A;  1M4V A;  3ETR A;  2CJN A;  4M8M A;  3QQ8 B;  2DZM A;  4MDK E;  5AZG A;  1LFD A;  2QEJ C;  4US9 A;  1FRD A;  3EEC A;  2MRP A;  1PFD A;  5FR6 A;  4RCO A;  2KTR A;  3KUD B;  4RGN A;  4W9J A;  2WU5 B;  3HRD D;  1KLU D;  3S2A A;  1AWD A;  1ENF A;  2LMC A;  3NVZ A;  5TR5 A;  4XE0 A;  2KVR A;  3PRM B;  4JX1 C;  4ICV A;  3BII D;  3GB1 A;  2NBV B;  4MAC A;  4DQO C;  1GC6 A;  4MM3 B;  1FMA D;  3A4S C;  1E6E B;  1Q5W B;  3RNC C;  1WR1 A;  2KDE B;  4MH8 A;  4C4V A;  3QIJ A;  4BBN F;  1XO3 A;  2LZ6 A;  1TY0 A;  4BVU C;  3HK0 A;  4KGS A;  2D2Q A;  3UQB A;  1DOX A;  2Z0E B;  4HCN B;  4E74 A;  3DWM A;  4B6W A;  1VCB A;  1CZP A;  1ZGU B;  1D5X C;  3C8Y A;  2PPH A;  1WJ6 A;  3R7R A;  4I6N B;  5BMG A;  3MJW A;  5IOI A;  3IAM 1;  1AN8 A;  3H8H A;  1JWU D;  3IAS 1;  2RDH A;  2KWD A;  4NY0 A;  3PTF C;  2L3Z A;  3RNE C;  4IWO A;  2JQR B;  2KTF A;  1UWM A;  1WRD B;  2X38 A;  3ABV B;  1K8R B;  1V9J A;  1J8C A;  3Q8F A;  4KIK A;  3IBE A;  2K3U A;  1LGR A;  2DBY A;  1F52 A;  2D07 B;  2K8H A;  2PIA A;  3B1L X;  3DQV A;  4GLS C;  4ZOH C;  2HE7 A;  3N20 C;  2LRU A;  3U52 E;  4AOF A;  4WWN A;  1RRB A;  1I4X A;  4ZRJ A;  1FD6 A;  1WM3 A;  4EUT A;  4XX5 A;  4IKG A;  1SF0 A;  2ON8 A;  2LUM A;  3PLU A;  4MSM B;  3KUC B;  5GXG B;  2IBI B;  1SB3 C;  2FCN A;  2LUE A;  5I4D A;  4ZHP A;  1G6J A;  3TBL D;  3ZVV A;  2AX5 A;  1SE9 A;  1T0Y A;  4RM8 A;  4USA A;  4BAX A;  2FIF A;  2D11 A;  4GU2 A;  2CU3 A;  2WQY B;  4KZC A;  1PDX A;  3T3N A;  1QOA A;  5BMH A;  3A1Q B;  1PQS A;  3A9K A;  2L52 A;  3APF A;  4B0M A;  4YTN B;  1J19 A;  1PYW D;  3ZIM A;  1UBI A;  3FKY A;  1Z5S B;  4FUL A;  3WAP A;  4C00 A;  5LLI A;  2NTS A;  1KTK A;  3DVG X;  4FHJ A;  1ZXH A;  1GNU A;  4NQL B;  2N9X A;  2K8C A;  4FJV B;  5EE1 A;  4G3X B;  1PGX A;  1PGA A;  2KDF B;  3DVN U;  3N9Y C;  4CYE A;  2DWQ A;  2SAK A;  3MC9 A;  1N5X A;  4TQ1 A;  2JSV X;  1WYG A;  2MA9 B;  3VR9 B;  5CHV C;  1KF6 B;  3NVY A;  1F2R I;  1VR9 A;  3URY A;  4RM9 A;  1NYQ A;  1WFY A;  4WJP A;  3ZKJ C;  1SE4 A;  4RNA A;  4ZRI A;  4RGM A;  2WYQ A;  3ZJV A;  3ML8 A;  5C2T B;  2I1K A;  2G3Q B;  4RGT A;  1WZ3 A;  4WQO B;  1MJD A;  3TMP B;  1U4A A;  5L95 C;  2QC8 A;  2IDY A;  4NPN A;  2KAC A;  4K81 A;  5FK9 C;  4LNO A;  1HZ5 A;  1ZKH A;  3AI5 A;  2MP2 A;  1QF6 A;  3UGB B;  2LGI A;  2KWU B;  4P7I A;  1YQ4 B;  1WJU A;  2M4N A;  2JXT A;  4LTU A;  2CS4 A;  1J7B A;  4J6I A;  1FFV A;  3A4R A;  2AL3 A;  2RDG A;  3NZU A;  1RAX A;  3L17 A;  3LYY A;  3I57 A;  1I35 A;  4A6Q A;  1JRU A;  2MCN B;  3AE9 B;  2SEB D;  1SBB B;  1YOV B;  3AU5 A;  1HXY D;  2UU7 A;  1JQ4 A;  2IGG A;  2FCS A;  1C3T A;  1YJI A;  1HZ6 A;  3E56 A;  4W9E A;  5EE3 A;  4ZHO A;  1WYW B;  1N6Z A;  3W1S A;  1JRO A;  4AS1 A;  1GG3 A;  4A3P A;  2ZPN A;  2WXJ A;  3RUI B;  2DZJ A;  2LGY A;  3BYY B;  1E10 A;  2NR2 A;  3I63 C;  3AEA B;  1T0R C;  3ZXR A;  4CHK A;  5EE9 A;  1V5O A;  2BT6 A;  3T9L A;  1A70 A;  2WX0 A;  1MPE A;  2EMT A;  4DK5 A;  2K9X A;  3DPD A;  2AQ2 B;  3NY5 A;  4IDI A;  2V4I B;  3OWE B;  2KDM A;  2GBN A;  4GGQ A;  4MJS B;  1VLB A;  1FIQ A;  3H9D A;  3VTW A;  1TIF A;  2L1A A;  5G5H A;  1SJH D;  4MGK E;  1NYR A;  3VAW A;  1ET6 A;  5JH5 C;  1WJ4 A;  2KAN A;  3EUB 2;  2J53 A;  2KYW A;  2BB5 A;  3IT6 B;  2INN E;  5IKC M;  3DVG Y;  1SE3 A;  1WMH A;  2WXN A;  2KMC A;  3R3M A;  2KKC A;  5D2M B;  3SD5 A;  2LGS A;  3AEC B;  5L83 A;  1YNT E;  3H7P A;  1V80 A;  2PJH A;  2PTL A;  3AV8 A;  3LXF A;  4IM0 A;  3W5U B;  1F0Z A;  2XN9 C;  1OQQ A;  2Q5W D;  2XNA C;  3RYT A;  4NNJ B;  1NEK B;  3N1Y C;  3W5V B;  2RD0 A;  3RZF A;  1WGD A;  2BS2 B;  2KDI A;  2VH1 A;  4RFB A;  1ZPS A;  5IN7 A;  1R4M I;  1TS2 A;  3ZUN A;  4S17 A;  2KNB A;  2HTH A;  1I4Q A;  3AEB B;  3N1X C;  3TEZ A;  1WXV A;  2XK5 A;  3HVD A;  4HCP B;  3KVF B;  1FNW A;  1WGK A;  2MBO A;  4PYU A;  2HTM E;  4DDI D;  2KFK B;  2IO2 B;  2LEK A;  5JXV A;  5D94 A;  3FIL A;  2MHJ A;  3JYU A;  3RNB C;  5DPT A;  3TCA A;  1XXG A;  1FEH A;  1BML C;  4EFO A;  5FR3 A;  3PT2 B;  2N7E A;  1DOI A;  2LD9 A;  4NAW A;  2CHX A;  2MBH A;  2V9H A;  3VUX A;  5J18 A;  2WDQ B;  2XEW A;  1WGH A;  4L23 A;  4HWI B;  2GOW A;  5D7G A;  2B3A A;  4FHK A;  1AW7 A;  2MW5 A;  1WGR A;  2WU2 B;  5BYS A;  2KX0 A;  3VTU A;  2W9N A;  2IZV B;  2RGF A;  4GDL A;  1WSP A;  2OJW A;  3AED B;  1E7U A;  3LDZ E;  2BYE A;  4GB9 A;  1MHX A;  3Q6B A;  2NBU A;  1T3Q A;  1H8C A;  4YL8 A;  3KLS X;  5E6P A;  1WGY A;  1L0Y B;  4ICU A;  1F77 A;  3ZJT A;  3SHQ A;  4M0W A;  1LQB A;  1GB4 A;  2HJ1 A;  3ZRC A;  4I6P A;  3ZNZ B;  5CX3 A;  2YEP B;  4LNI A;  4ASW C;  2BS4 B;  1R4M B;  2IND C;  2CHW A;  2FNJ B;  3MC8 A;  4ANX A;  4YTP B;  3T3O A;  3AMZ A;  1TS5 A;  4BKG A;  1OQR A;  1N61 A;  1X1M A;  1WZ0 A;  4OZA A;  1D3Z A;  2MEK A;  1RWS A;  2JRI B;  1WRI A;  5BMI A;  2KN5 A;  4IG7 B;  1E9M A;  1EUV B;  2RMM A;  4LDT B;  3B0A A;  2HDE A;  4G0N B;  1FO4 A;  3Q69 A;  4EZJ A;  5HFY A;  4W9L A;  1V1O A;  4F1S A;  4II3 B;  5D3I B;  1FXA A;  2JVC A;  4WJQ A;  3WAM A;  3ZRF A;  1OTR B;  4W9I A;  3NRZ A;  4XDC A;  1VJK A;  3T8M A;  1XLP A;  2N1W A;  2H89 B;  5BYQ A;  3EFU A;  2PW9 A;  3PRE A;  4FAD A;  4YSX B;  2O2V B;  1L6U A;  4YSZ B;  2N0S B;  1UUP A;  1ZDX A;  2OHF A;  4RF1 A;  3AEF B;  1QT9 A;  4AJW A;  1N62 A;  4FA6 A;  1FXI A;  1WGG A;  1K51 A;  1YIW A;  4F7Z A;  1YN4 A;  3AEG B;  1JRP A;  2Y5P A;  3Q8C A;  1Q0W B;  2BWF A;  2JZP A;  2V1Y A;  3NJT A;  1JWM D;  2BWE S;  2LRW A;  2MBE A;  1E7P B;  4W9D A;  4MT5 A;  4GSW A;  4EE2 A;  2L00 B;  3VQI A;  3TEY A;  2EKE C;  4LDT D;  2J42 A;  3ZW3 A;  2WXR A;  3RD2 A;  2ZW0 A;  3L10 B;  3RI7 C;  1P7F A;  3VUY A;  4M00 A;  2CKH B;  2KWV B;  3ZYY X;  1OGW A;  1HE8 A;  2INC C;  3A9J B;  2ZCC A;  3QWZ B;  2BYV E;  2DYM A;  3JSV A;  2N9E B;  5DPW A;  1C4P A;  4KGT A;  2MLB A;  4BBN C;  1F2R C;  1WX9 A;  4HVB A;  2OED A;  3M62 B;  3GZN I;  2J0K A;  2NTT A;  1IGC A;  3OLM D;  4KDL B;  2KK8 A;  1TTN A;  3ML9 A;  1V2Y A;  2LVQ A;  2WXP A;  1WM2 A;  4OZC A;  1EF5 A;  3C0R B;  1V6E A;  1WXM A;  3GE3 C;  2BYT A;  1WXS A;  4HRS A;  4XWT A;  2KTR B;  1WI0 A;  4US8 A;  4B9K A;  4DXG A;  3SFD B;  1VZ8 A;  3SDL C;  2K22 A;  3U4E G;  2REX A;  5H8Y E;  3BK1 A;  1V86 A;  1NI2 A;  5AEK B;  4BOZ B;  3IVF A;  2KDB A;  4AUQ C;  3V05 A;  2K6D B;  2KJH B;  2W3S A;  3UQA A;  3QAQ A;  3OG5 A;  2N9L A;  2CHZ A;  5HI1 A;  2Y5B B;  3DBL I;  4C4V B;  1E8Y A;  2JXX A;  3ZGZ A;  4K7W A;  2X8X X;  3AE8 B;  4DBG A;  4L2Y A;  4YT0 B;  2D3B A;  4KKI A;  1TZO A;  4IW0 A;  3RT3 B;  5G2N A;  4BFR A;  1ROE A;  4FN2 A;  2KWC A;  3B9J A;  2W55 A;  1TS4 A;  4WWO A;  2VZK B;  3VTV A;  4XGA B;  4HRO A;  3MTN B;  1HEZ E;  3M63 B;  2PMV A;  3R8B A;  1HTO A;  4TKN A;  4PS3 A;  3GZN B;  2J52 A;  1D5Z C;  3CST A;  4NZL B;  3IT4 B;  1DYQ A;  2NVU I;  4ZRK A;  4HJK A;  3CF6 E;  2KMM A;  1KM7 A;  3AE6 B;  3CMM B;  3DDC B;  4KIK B;  2NCN A;  4B95 A;  4GXB A;  1E8X A;  1MI0 A;  4RGO S;  4JGH B;  2WDV B;  2RPV A;  4NJ7 A;  1SE2 A;  2D10 A;  1F9J A;  5EE0 A;  3LJ3 A;  1D4B A;  4A3O A;  2K5P A;  3L54 A;  1KLG D;  2ONQ A;  4KX6 B;  4N6E B;  3KUZ A;  3VH3 B;  3PPA A;  2NS5 A;  2WDT B;  3Q8B A;  4XYC A;  3AH7 A;  3SEB A;  3HHM A;  2JT4 B;  5TSS A;  2Z0D B;  3PZ7 A;  2BTE A;  2VZK D;  3DBL B;  4P16 A;  3X0W A;  1ISN A;  1IGD A;  1DOY A;  4LJP B;  4HPL B;  2LJ5 A;  3TUO A;  2G1E A;  3HIZ A;  3A9K B;  3CWI A;  1UF0 A;  2DHZ A;  3AU4 A;  1L0V B;  3N3K B;  2LAS A;  1V5T A;  5JZE B;  1QZE A;  3HM3 A;  2DEN B;  1VZ7 A;  5T8I A;  2OOB B;  4ZYN A;  1UBQ A;  1KLV A;  4HEA 1;  3ZJU A;  3AXC A;  1SJE D;  3BK2 A;  4LNK A;  2W82 A;  3U8Z A;  5J2R A;  3DBH I;  3APD A;  1UGM A;  3AE4 B;  1RLF A;  3BIN A;  2GBR A;  2VH2 A;  5KHQ A;  5AZF A;  1H4R A;  2KFJ A;  2MWS B;  4KSK C;  3BVM A;  1WR6 E;  2GLS A;  2W54 A;  2IO0 B;  3WCQ A;  2WNM A;  2BB6 A;  1D6E C;  4IWQ A;  1IBX A;  3PO0 A;  3ZLZ A;  4GN1 A;  2E6X A;  2JU6 X;  2PVO D;  4DHJ D;  5D6J B; 
#chains in the Genus database with same CATH homology
 2XEW A;  4XC2 A;  2MP2 B;  1P1A A;  1WGH A;  3OAW A;  2KD0 A;  4AJY B;  1A5R A;  4HWI B;  2GOW A;  4HDO A;  5D7G A;  2B3A A;  2ZZP B;  5DPS A;  3A9J A;  4FHK A;  3QK0 A;  1Z2M A;  4PS7 A;  2JPH A;  2GBK A;  2MW5 A;  1WGR A;  2DAJ A;  2LXC A;  1FXT B;  2KX0 A;  3VTU A;  1WJN A;  3NHE B;  2W9N A;  2IZV B;  4FJZ A;  2RGF A;  2AWT A;  2JF5 A;  2CR5 A;  3UIO B;  2L0F A;  1WF9 A;  4GDL A;  4KVG B;  3EC8 A;  4M8N A;  2RR9 A;  2KMA A;  1S1Q B;  5E6N A;  1E7U A;  2AL6 A;  1M94 A;  3KYC D;  2FID A;  1TGZ B;  2LVP A;  4W9C A;  4EZK A;  4DWF A;  1Q1O A;  2R2O A;  3PRZ A;  2KX3 A;  2BYE A;  3LDZ E;  3A1Q A;  3OJ4 B;  4RMA A;  1J0G A;  4GB9 A;  5JHA A;  2M17 A;  4KV2 A;  2NBU A;  1H8C A;  2KLC A;  2DZK A;  3DBS A;  2BYF A;  4MEL A;  3QQ8 B;  4M8M A;  4NJ6 A;  2DZM A;  4YL8 A;  4MDK E;  5AZG A;  4DDG D;  2K1F A;  3ZNH B;  1LFD A;  5E6P A;  3EEC A;  2HD5 B;  1WGY A;  5HKH A;  4ICU A;  3X23 A;  2MRP A;  3SHQ A;  1LQB A;  2GBM A;  3ZRC A;  5FR6 A;  3CSF A;  2KTR A;  3D32 A;  2A4Z A;  4I6P A;  3ZNZ B;  3DVN V;  3PVL A;  3KUD B;  1WIA A;  5CX3 A;  4JIO U;  4MEM A;  4W9J A;  2O6V A;  4BKS D;  4DHZ B;  4DXA B;  3WAL A;  4ASW C;  1IPG A;  3S2A A;  2N9P C;  3TL5 A;  4TV3 A;  4DHJ B;  2CHW A;  2FNJ B;  4GOC A;  4ANX A;  4DHZ E;  5TR5 A;  3B08 A;  3L13 A;  4EOY A;  2KVR A;  3PRM B;  4ICV A;  2IY1 B;  5IAA C;  3TIX A;  2PEA A;  2FUH B;  3VHT C;  2NBV B;  4BKG A;  5KHO A;  1X1M A;  1GC6 A;  1WZ0 A;  1D3Z A;  1AAR A;  2JRI B;  4K7U A;  5AZH A;  2KN5 A;  3IHP C;  4IG7 B;  1EUV B;  4IWP A;  1LXD A;  3A4S C;  2KZR A;  3B0A A;  4LDT B;  1Q5W B;  4G0N B;  1WR1 A;  2KDE B;  2KQ7 A;  4EZJ A;  4JQW C;  4WAA A;  3KH0 A;  3QIJ A;  4BBN F;  4W9L A;  3PZD A;  4ANW A;  2XBB C;  4F1S A;  2LZ6 A;  4II3 B;  2JY6 A;  1WMH B;  1YX5 B;  2JVC A;  4WJQ A;  3V60 A;  3WAM A;  3ZRF A;  1OTR B;  4BVU C;  3VVW B;  4W9I A;  4E3C A;  3HK0 A;  4PS8 A;  2ZJD A;  4KSL C;  1NDD A;  2D2Q A;  3UQB A;  3T8M A;  2Z0E B;  3H7P B;  5BO4 B;  2N1W A;  4E71 A;  4PYZ A;  4HCN B;  4E74 A;  3EFU A;  4B6W A;  2C7N B;  4W9F A;  5C23 A;  4W9G A;  1VCB A;  4WJO A;  3PRE A;  4FLH A;  2JWZ A;  4FAD A;  5LXI B;  1ZGU B;  2HJ8 A;  3V6C B;  4IM2 A;  2O2V B;  2PPH A;  2LWP A;  1WJ6 A;  2N7D A;  2KJ6 A;  3R7R A;  4I6N B;  4IUM B;  2L0T A;  3ZO5 B;  2LGD A;  2YVC A;  3KYD D;  2K39 A;  3MJW A;  2ZNV B;  3L08 A;  4AJW A;  3VH4 B;  5IA7 A;  4NY0 A;  3PTF C;  3L0W B;  4WWP A;  2L3Z A;  4FA6 A;  4IWO A;  1SGH A;  1WGG A;  1YIW A;  2G4S A;  2KTF A;  1WRD B;  2XK5 B;  3A33 B;  4F7Z A;  4XZ4 A;  1K8R B;  1Q0W B;  1V9J A;  2BWF A;  2R2Q A;  4WJN A;  2G4D B;  2V1Y A;  1EF1 A;  1J8C A;  4KIK A;  2IYD B;  2BGF A;  3IBE A;  5J17 A;  4ZDV A;  4II2 B;  1GUA B;  2ZEQ A;  3WA0 A;  2BWE S;  2LRW A;  2D07 B;  2K8H A;  4GIV A;  2GBJ A;  2MBE A;  3B1L X;  3DQV A;  3IG3 A;  4W9D A;  2HE7 A;  3ZTD A;  3OJ3 A;  3ZNI D;  2IY0 B;  4GSW A;  5G55 A;  4AWJ A;  3QA8 A;  3RUL A;  2L00 B;  2LRU A;  3VQI A;  5CHW A;  4BKT A;  4AOF A;  2EKE C;  4G50 A;  1RRB A;  4LDT D;  4WWN A;  4ZRJ A;  1WM3 A;  4EUT A;  4NAW B;  2J0M A;  4TQ0 A;  3N32 A;  4KDI C;  3ZW3 A;  2MSE D;  3RD2 A;  4XX5 A;  3L10 B;  2FCM A;  3VUY A;  2CKH B;  2KWV B;  3PLU A;  1WY8 A;  1OGW A;  1HE8 A;  4IM3 A;  3VXW A;  3A9J B;  2ZCC A;  3JVZ X;  4MSM B;  3KUC B;  3QWZ B;  2C60 A;  2BYV E;  2DYM A;  2IBI B;  2L76 A;  4MGZ E;  1YQB A;  2KHW B;  3JSV A;  2ZVN A;  1YX6 B;  3APC A;  3N30 A;  3HM6 X;  2FCN A;  2LUE A;  4GDK A;  2N9E B;  2Z59 B;  4MJS A;  5DPW A;  1KOT A;  1G6J A;  2MBQ A;  3TBL D;  3ZVV A;  2RSU A;  1SE9 A;  1T0Y A;  3Q3J A;  4GMV A;  4RM8 A;  2N1V A;  4CO7 A;  2FIF A;  2D11 A;  2MLB A;  4GU2 A;  4W9H A;  1MG8 A;  4BBN C;  1WX9 A;  1OQY A;  4GDL B;  4HVB A;  4KZC A;  2MQJ A;  4LJO B;  4EEW A;  3M62 B;  3GZN I;  4HDQ A;  1SIF A;  2J0K A;  3VUW A;  3A1Q B;  1PQS A;  1P98 A;  2FCQ A;  1WX8 A;  3A9K A;  3OLM D;  2N4F A;  4KDL B;  2KK8 A;  3H6N A;  3APF A;  1TTN A;  1V81 A;  3ML9 A;  1V2Y A;  2M1M A;  1J19 A;  2LVQ A;  1WM2 A;  4OVV A;  1XT9 B;  1UBI A;  4TUU A;  1EF5 A;  3ZIM A;  3C0R B;  1Z5S B;  3DBR I;  2GMI C;  1V6E A;  2BPS A;  4FUL A;  1WXM A;  3PHX B;  5LLI A;  3WAP A;  3TJP A;  4M0W B;  1ZW7 A;  3K9O B;  1WXS A;  2JZZ A;  3NZS A;  3RCZ A;  3DVG X;  4FHJ A;  2KTR B;  1WI0 A;  2M0X A;  2UYZ B;  1GNU A;  4NQL B;  4G11 A;  2N9X A;  4B9K A;  2K8C A;  3QHT A;  4FJV B;  3SU8 X;  3ALB A;  2V3S A;  2O6V B;  3PLV A;  4G3X B;  2KDF B;  1UZX B;  3SDL C;  3DVN U;  3RZW C;  3BY4 B;  1IYF A;  1S3S G;  2REX A;  2L8J A;  4CYE A;  1V86 A;  4TQ1 A;  4EZL A;  5JHB A;  3QJZ A;  1RFA A;  2MA9 B;  5CHV C;  1NI2 A;  1TZ1 A;  5AEK B;  3P2B A;  3V6E B;  4BOZ B;  1P3Q U;  2DYO A;  3IVF A;  4RM9 A;  2KDB A;  2AYO B;  4AUQ C;  1WFY A;  4ANV A;  4HLE A;  1E5W A;  4WJP A;  1UH6 A;  3ZKJ C;  2K6D B;  2KC1 A;  2KJH B;  2C7M B;  4ZRI A;  3UQA A;  4HXD A;  2WYQ A;  3QAR A;  2KFK A;  2VRR B;  3PHW B;  5CHF A;  5C1Z A;  3VFK A;  4AP4 C;  3ML8 A;  2BKF A;  2I1K A;  3L16 A;  2G3Q B;  3QAQ A;  1WZ3 A;  1WXA A;  4WQO B;  1NBF C;  4URK A;  3AUL A;  2UWQ A;  2CHZ A;  2NPT A;  2Y5B B;  3DBL I;  2A5U A;  5E6O A;  3TMP B;  1U4A A;  1E8Y A;  2LVO A;  2WX1 A;  5L95 C;  2JXX A;  3K9P B;  4K7W A;  4DBG A;  1VD2 A;  2J0J A;  1E8W A;  4NPN A;  2KLG A;  3H1U A;  2ZVO A;  5DCN A;  3ZDT A;  1R4N I;  3M95 A;  4K81 A;  3O65 B;  4IW0 A;  4NQK E;  5G2N A;  3RT3 B;  1GC7 A;  4BFR A;  1ZKH A;  2LI5 A;  3AI5 A;  2MP2 A;  4FN2 A;  2KWC A;  3I3T B;  3IFW B;  4OVU A;  3PSE B;  4WWO A;  2OJR A;  4MH0 E;  3UGB B;  1TBE A;  1LM8 B;  3VTV A;  2C7H A;  2KWU B;  2BKR B;  4P7I A;  3MTN B;  3WAN A;  1WJU A;  2M4N A;  4IC7 B;  2CS4 A;  3M63 B;  2JZ3 B;  4J6I A;  4A20 A;  2DYB A;  4TKN A;  4PS3 A;  3A4R A;  3U7D A;  2AL3 A;  2DZI A;  1WE7 A;  3NZU A;  4MGY E;  1RAX A;  3L17 A;  4X57 B;  5CTR C;  1XD3 B;  3CST A;  1I42 A;  1I35 A;  1KJT A;  3ZDM C;  2KOX A;  4FBJ B;  2O6V D;  1JRU A;  3DCG A;  2FAZ A;  2KO3 A;  2MCN B;  3AU5 A;  1P9D U;  2NVU I;  2PE6 B;  4ZRK A;  1C3T A;  2FCS A;  1YD8 U;  4HJK A;  3CF6 E;  1KM7 A;  1GJZ A;  3CMM B;  3DDC B;  4W9E A;  4KIK B;  2NCN A;  3VDZ A;  1OEY A;  1WYW B;  3PGE A;  5JH5 C;  4B95 A;  3W1S A;  4GXB A;  1E8X A;  3UF8 A;  1GG3 A;  4A3P A;  2ZPN A;  4JGH B;  4K1R B;  3QCA A;  3RUI B;  2DZJ A;  2LGY A;  1YJ1 A;  2NR2 A;  4NJ7 A;  4BOS C;  2JUO A;  2D10 A;  4CHK A;  1F9J A;  2LXA A;  3LJ3 A;  4MSQ B;  2QHO A;  1V5O A;  2MBB B;  2RPQ A;  3QC8 B;  3T9L A;  3V62 A;  4A3O A;  3L54 A;  2WX0 A;  3W1S C;  2IO3 B;  2EMT A;  2ZCB A;  5EDS A;  4DK5 A;  3DPD A;  3DOW A;  1C1Y B;  3JW0 X;  3NY5 A;  3ZNG C;  1L7Y A;  3KUZ A;  3JSV B;  2G45 B;  4GDK B;  3VH3 B;  2GBN A;  3PPA A;  2NS5 A;  2WDT B;  4GGQ A;  4MJS B;  2C5L C;  3H9D A;  3VTW A;  2AEH A;  2K8B A;  2EMS A;  3HHM A;  2JT4 B;  3ENE A;  4MM3 A;  2Z0D B;  4I6L B;  3U30 A;  3PS6 A;  4EKU A;  2ZPY A;  4MGK E;  2MX2 A;  2C9W B;  3X0W A;  2ASQ A;  3VAW A;  1ISN A;  1E90 A;  2V4L A;  4LJP B;  1WX7 A;  2JRH A;  4HPL B;  2DX5 B;  3NS8 A;  1E8Z A;  1E7V A;  1WH3 A;  2LJ5 A;  1WJ4 A;  3Q3F A;  4JL9 A;  5GMV A;  4F8C B;  2DAF A;  3HIZ A;  2KAN A;  2KJR A;  2NBW B;  4HK2 A;  3A9K B;  2BF8 B;  3ECI A;  3DVG Y;  1WMH A;  2DHZ A;  2K6Q A;  2KMC A;  3AU4 A;  3ONS A;  3R3M A;  4N9F 4;  3N3K B;  2KKC A;  3ZTC A;  5D2M B;  2LAS A;  3V61 A;  3SD5 A;  3UIN B;  1V5T A;  3R66 C;  5L83 A;  5JZE B;  1QZE A;  2J7Q B;  2D3G A;  3HM3 A;  3H7P A;  2WWZ A;  1V80 A;  2DEN B;  2PJH A;  3MHS D;  4MGI E;  1EO6 A;  3PV1 A;  5DPR A;  4IM0 A;  2OOB B;  3M3J A;  3QX1 A;  1WE6 A;  3R7Q A;  4ZYN A;  4ANU A;  2YLM A;  3RYT A;  3W1Y A;  1UBQ A;  2I1J A;  2O2V A;  2KC2 A;  1KLV A;  4NNJ B;  1V49 A;  4BKS A;  2M8S A;  1CMX B;  2RD0 A;  3RZF A;  1WGD A;  1OEY J;  2KDI A;  4W9K A;  3AXC A;  3KW5 B;  3U8Z A;  2CU1 A;  5J2R A;  3DBH I;  4HPM B;  3APD A;  2KQS A;  1UGM A;  2L05 A;  2LGX A;  2IO1 B;  1R4M I;  1RLF A;  1UD7 A;  3BIN A;  3WAO A;  3ZUN A;  1UEL A;  2GBR A;  2KNB A;  2HTH A;  4JLC A;  1WXV A;  2XK5 A;  1BT0 A;  3NOB A;  5KHQ A;  4HCP B;  1P0R A;  3KVF B;  4KZ0 A;  2PE9 A;  5AZF A;  1H4R A;  2L7R A;  2KFJ A;  2MWS B;  5LXH A;  1L2N A;  3GOE A;  4KSK C;  2MBO A;  2K25 A;  4PYU A;  4DDI D;  1WR6 E;  2KFK B;  2IO2 B;  2IO0 B;  5D94 A;  3PRP B;  2ZNV C;  3EHV A;  4K7S A;  2NPT B;  3JYU A;  4FJY A;  5DPT A;  2KXJ A;  3TCA A;  1IP9 A;  3H7S A;  4IWQ A;  4EFO A;  3WIM A;  3UIP B;  3PT2 B;  1Y8R C;  2N7E A;  3ZLZ A;  2LD9 A;  4NAW A;  2CHX A;  2MBH A;  4GN1 A;  4LCD E;  1XQQ A;  3VUX A;  5J18 A;  4DHJ D;  5D6J B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...