2ASQA

Solution structure of sumo-1 in complex with a sumo-binding motif (sbm)
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
77
structure length
77
Chain Sequence
YIKLKVIGQDSSEIHFKVKMTTHLKKLKESYCQRQGVPMNSLRFLFEGQRIADNHTPKELGMEEEDVIEVYQEQTGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Protein binding
molecule keywords Small ubiquitin-related modifier 1
publication title Small Ubiquitin-like Modifier (SUMO) Recognition of a SUMO Binding Motif: A reversal of the bound orientation
pubmed doi rcsb
source organism Homo sapiens
total genus 13
structure length 77
sequence length 77
ec nomenclature
pdb deposition date 2005-08-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF11976 Rad60-SLD Ubiquitin-2 like Rad60 SUMO-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 2asqA00
1WZ0A 2WX0A 1ISNA 2CR5A 2LASA 3H7SA 3H6NA 4JL9A 2KDBA 3H7PA 2BPSA 4HK2A 2VRRB 5CHFA 3ONSA 2BYEA 1EF1A 5J2RA 1OEYJ 2N9XA 3ZW3A 1L7YA 2AL6A 4N9F4 4TV3A 4GGQA 1Q5WB 1WJ4A 2ZCBA 4PYUA 2MBOA 4ZYNA 4DDGD 3QJZA 1WE6A 2DX5B 2J0MA 1SGHA 3VFKA 1V6EA 4KIKA 2KMCA 3VXWA 2KJHB 4F1SA 2MRPA 3PPAA 1Z5SB 2GOWA 3CMMB 4HCPB 1CMXB 3VQIA 3RT3B 1R4NI 4GOCA 1D3ZA 3A4RA 1G6JA 4E74A 1J19A 3L16A 2HJ8A 4NJ6A 3UIOB 2MWSB 1H4RA 2XBBC 3B1LX 2LXAA 3HK0A 1IP9A 4KZCA 1WGRA 1WJ6A 3TCAA 4AJYB 3CF6E 3QK0A 4MM3A 2LWPA 4PS8A 4BOSC 2MBBB 4B9KA 3ZRCA 3N32A 5C1ZA 1HE8A 4HPMB 2KTRA 2A5UA 5J18A 2RGFA 4W9EA 3APFA 1WXVA 1WRDB 4HDOA 1XD3B 3DQVA 4ZRKA 4NNJB 3WAMA 1SIFA 3PTFC 1H8CA 1IYFA 2MBEA 1LXDA 2KO3A 5JZEB 3PGEA 2REXA 3PT2B 3P2BA 4EZKA 3L13A 2LVPA 2MP2B 2K25A 3VH3B 1WX8A 3ZNHB 4IWPA 3UGBB 1RAXA 4ZRJA 1EUVB 5JHAA 4DHZE 1YIWA 3A9JB 3V6EB 1I35A 4WJQA 3N3KB 4IM2A 4MGKE 3PHXB 4TQ1A 1JRUA 1V9JA 1WMHA 4J6IA 1E90A 2BKFA 3IFWB 4MJSA 5CX3A 4A3OA 4B6WA 1WGDA 2ASQA 1X1MA 3ALBA 3QC8B 3QCAA 4E71A 3DBHI 2C9WB 5D94A 3IG3A 3RYTA 3DPDA 2K6QA 4XX5A 3HIZA 3KUZA 4URKA 4G11A 4G0NB 4NQLB 4E3CA 4GDKB 2O6VA 4I6LB 3VHTC 4HDQA 4DHZB 2FIDA 1J0GA 4ICUA 3APDA 3HM3A 2PE9A 3K9PB 2O2VB 3ZNGC 2GBRA 3NHEB 3L0WB 1LQBA 3ZIMA 3DCGA 4K7UA 2EMTA 2I1KA 2NBVB 5BO4B 1Z2MA 3R3MA 1P9DU 4FADA 1WF9A 4II2B 2WWZA 4EEWA 4G50A 3V6CB 4WJNA 4KV2A 2PE6B 3WAOA 2IBIB 2KFJA 4WAAA 2BWES 3QHTA 1WY8A 5LLIA 3RD2A 3A1QA 2DZMA 4W9GA 5IA7A 1WR6E 1WJUA 4ANUA 4BKTA 2C60A 1TTNA 3H7PB 3QA8A 1YX6B 3OJ3A 3KH0A 3ZRFA 1WJNA 1VD2A 4W9CA 2M1MA 3JSVA 4GXBA 1GG3A 5E6PA 4FJVB 2BWFA 3PRZA 2FIFA 2ZVNA 3ENEA 2LVOA 4KIKB 2ZEQA 4FN2A 5L95C 1Q1OA 2FAZA 4A20A 4MGIE 1F9JA 1V49A 2GBKA 4ANXA 2HE7A 1T0YA 1WFYA 3LJ3A 4K7SA 1P0RA 3B08A 3QWZB 3SDLC 2JVCA 2KK8A 4JIOU 2KN5A 4EZJA 1XT9B 2IZVB 3ZNID 3HHMA 4K81A 3PLUA 2V4LA 5AZHA 3U30A 1V5TA 3VH4B 1P98A 3BINA 1RLFA 1E8ZA 1UGMA 4JQWC 4FA6A 4GU2A 4FHJA 3VUXA 2WX1A 2KMAA 1EF5A 2DHZA 4GIVA 2OJRA 3NS8A 5HKHA 4LJOB 2KVRA 4AJWA 4FJYA 5J17A 2M0XA 2M8SA 2NCNA 3M63B 2M4NA 3A33B 4BKGA 4A3PA 3B0AA 1I42A 4AWJA 2AWTA 2LXCA 4AP4C 3EFUA 3M3JA 5DCNA 2CHXA 3PRMB 2V1YA 2M17A 2IO1B 2BGFA 4LDTB 1TGZB 2K39A 3MHSD 1WMHB 5DPSA 3O65B 3PV1A 4PS3A 4II3B 3UIPB 2C7HA 4DDID 4WJPA 3Q3FA 2BKRB 4PS7A 2L3ZA 3ZO5B 1SE9A 1UH6A 2RR9A 3D32A 3L08A 2N9EB 2K6DB 3NY5A 4FLHA 2DYOA 1KLVA 5G2NA 3IVFA 2KWUB 2LGDA 4BVUC 2KQ7A 3UINB 2L05A 2KLCA 3MTNB 4RMAA 1VCBA 4FJZA 4HWIB 4NPNA 2L8JA 2N1WA 1LFDA 3L54A 1ZKHA 2JPHA 3ZDMC 1XQQA 2I1JA 1WZ3A 3TL5A 2XEWA 4GB9A 3V62A 3ZNZB 1A5RA 2AEHA 2MBQA 2DZIA 2RSUA 2MSED 4IG7B 4MGYE 3AU4A 2K1FA 4LJPB 3L17A 1V86A 2D07B 2ZPYA 2MQJA 2L7RA 5D6JB 4AOFA 2EKEC 1GC7A 2IY0B 1E7VA 4MSQB 3WIMA 2L76A 3JVZX 2K8HA 3KW5B 2CHWA 2ZZPB 4MH0E 2FUHB 2C5LC 4HCNB 4LCDE 4GDLA 2RD0A 4NY0A 2KJ6A 1NI2A 2ZNVC 2J7QB 1UELA 5DPWA 1KOTA 3APCA 2C7MB 3EECA 2PPHA 1E8YA 1GNUA 2GBMA 4NQKE 3ZDTA 3ZTDA 4BBNC 1OQYA 3KUDB 2LI5A 3DBLI 2JF5A 4TUUA 2D10A 4W9HA 3QAQA 2J0KA 3PREA 4WJOA 3AI5A 4ICVA 2IO3B 3ZKJC 3T9LA 3DVNU 1UBQA 1R4MI 5AZFA 2CS4A 3PVLA 2XK5A 3U7DA 1WI0A 2J0JA 2L00B 3EHVA 2KWCA 1IPGA 2L0FA 3PHWB 1AARA 3ML8A 1MG8A 4ZRIA 1WM2A 3W1SA 1C1YB 4EFOA 5JH5C 4YL8A 2KNBA 2N9PC 3DBSA 2ZPNA 4EUTA 2DAFA 2CHZA 4KSKC 2LRUA 3A4SC 3CSTA 1TZ1A 2MA9B 2KKCA 4TKNA 5D2MB 3ZTCA 4M8NA 2LD9A 4IC7B 4WWNA 3SD5A 2KANA 2LZ6A 5LXIB 3W1YA 2KTFA 1EO6A 3GOEA 1S3SG 2FCMA 1WR1A 2ZCCA 5C23A 2D2QA 2AYOB 3ZLZA 2L0TA 2NS5A 2N1VA 3DOWA 5FR6A 1V80A 1NDDA 1YJ1A 3A9JA 2UWQA 5IAAC 1E8XA 3JW0X 1C3TA 1WX9A 3VTUA 2KWVB 2UYZB 3PS6A 2ZJDA 2WDTB 2LRWA 2HTHA 1WGGA 2GBJA 2N4FA 3R7QA 3H9DA 1WXSA 2KTRB 3AXCA 4IM3A 1PQSA 1WIAA 2IYDB 4MSMB 4GDKA 4LDTD 4W9KA 2AL3A 1U4AA 3L10B 3VUWA 2O2VA 3C0RB 1P3QU 2NVUI 2ZVOA 1E7UA 2KDFB 3QQ8B 1BT0A 3W1SC 1WXAA 2JRIB 5JHBA 2KFKA 2FCSA 1M94A 3PSEB 3OAWA 4NJ7A 2R2QA 3LDZE 3U8ZA 2KJRA 3UF8A 3V61A 2JZZA 2MX2A 5GMVA 4ASWC 4WWPA 4F7ZA 3A9KA 4GN1A 2KD0A 4MJSB 3TIXA 3BY4B 3SU8X 3VDZA 5D7GA 4P7IA 3KUCB 5CHWA 2GBNA 5E6OA 1KJTA 2DZJA 3WAPA 3TBLD 3DBRI 2PEAA 5L83A 2FCQA 4DHJB 2EMSA 2O6VB 3T8MA 2NBUA 3X0WA 2KX3A 3QIJA 2KC2A 3AULA 4MELA 4DWFA 3UQAA 2JT4B 2KQSA 4ANWA 2NBWB 3NOBA 3TJPA 3WA0A 2IO2B 3DVNV 3NZSA 4IM0A 4EKUA 2XK5B 1YQBA 1LM8B 2FNJB 3AU5A 2CKHB 4BOZB 4WWOA 5CTRC 1KM7A 4CHKA 4XZ4A 2JUOA 2YVCA 2KZRA 2LUEA 3EC8A 3OJ4B 2JY6A 3A1QB 2KXJA 4B95A 3HM6X 3M95A 2LJ5A 4W9IA 2N7DA 4PYZA 2DENB 4GSWA 2NPTA 4NAWA 4MGZE 4W9JA 4I6NB 1UZXB 3I3TB 3PZDA 1Q0WB 2HD5B 4I6PA 3JSVB 1QZEA 2G4DB 2MCNB 1OGWA 1WX7A 5KHOA 2G45B 2NR2A 4X57B 1E8WA 5EDSA 1NBFC 1UBIA 2GMIC 2BYFA 2KDIA 2WYQA 3K9OB 2BF8B 5KHQA 3JYUA 2BYVE 4BKSD 4IWQA 4KVGB 1UD7A 1Y8RC 3KYDD 4HXDA 4ZDVA 2R2OA 1WGHA 1TBEA 5TR5A 3IHPC 3X23A 5AZGA 2JXXA 4JGHB 4XC2A 1WH3A 3UQBA 4FULA 1P1AA 2D11A 2B3AA 2KOXA 1WE7A 4IW0A 3VVWB 2KX0A 1GJZA 4FHKA 4KDLB 4IUMB 2YLMA 4M0WB 1J8CA 3IBEA 3VTVA 3ZUNA 1L2NA 4DK5A 4MEMA 3QX1A 2D3GA 2IY1B 3Q3JA 4DXAB 4M8MA 4IWOA 4ANVA 4K1RB 1OEYA 3NZUA 2JZ3B 5AEKB 1YX5B 1V81A 3KVFB 4HJKA 3H1UA 4HPLB 3S2AA 5DPTA 2ZNVB 2KFKB 4DBGA 4FBJB 1GUAB 5G55A 2DYBA 4CYEA 3M62B 2C7NB 2W9NA 3PLVA 3ECIA 3RCZA 2MP2A 4CO7A 2KC1A 3A9KB 3KYCD 1GC6A 1V5OA 3WALA 2DZKA 2KHWB 4OVVA 3ML9A 1FXTB 3DVGY 2K8CA 4BBNF 3RULA 3RZFA 4WQOB 2IO0B 4W9LA 2LVQA 3RUIB 3WANA 3QARA 3GZNI 4W9DA 2KLGA 3MJWA 2A4ZA 4AUQC 4K7WA 2MBHA 2N7EA 3CSFA 1OTRB 1ZGUB 2K8BA 2G3QB 2Z59B 2MLBA 4MDKE 4RM9A 2LGXA 3VAWA 5E6NA 1RFAA 2JRHA 4KDIC 4HLEA 4BFRA 3VTWA 1ZW7A 2RPQA 1E5WA 2CU1A 3DDCB 4G3XB 1WXMA 2OOBB 1S1QB 1YD8U 2DAJA 2V3SA 5DPRA 3VUYA 3RZWC 3DVGX 4RM8A 4TQ0A 3N30A 3TMPB 3R7RA 3V60A 4GMVA 4EZLA 1K8RB 2KDEB 4KZ0A 2MW5A 1V2YA 3ZVVA 5LXHA 2JWZA 4HVBA 4F8CB 2DYMA 5CHVC 1WM3A 4BKSA 2Z0DB 4KSLC 1WGYA 2Z0EB 2PJHA 4EOYA 2QHOA 3PRPB 1WYWB 2FCNA 2G4SA 4DHJD 2O6VD 1RRBA 4OVUA 4NAWB 2NPTB 2LGYA 2Y5BB 4JLCA 3SHQA 4W9FA 4GDLB 3OLMD 3R66C
chains in the Genus database with same CATH superfamily
1OFFA 2CR5A 4XGAB 3H7SA 3ZQ4A 2KDBA 4HK2A 3BWUD 2V9HA 1QLBB 2WXGA 1GB4A 4GGQA 1LO5D 1WJ4A 2MBOA 3E9SA 1SGHA 3L4PA 4F1SA 2KMCA 3VQIA 1D3ZA 3L16A 4C80A 4R3DA 4XDCA 3I57A 4JX1C 2KACA 4WURA 1WJ6A 2FE8A 3N1YC 4BOSC 4B9KA 3T3NA 3N32A 4W9EA 1MHHE 4ZRKA 4NNJB 2N9LA 1RM6C 2MBEA 5GXGB 2REXA 4ACFA 5HI1A 1GOZA 4RGNA 2INCC 2MP2B 1RAXA 1F1HA 5BMHA 4HROA 3V6EB 2KDMA 4MGKE 3PHXB 2BKFA 3IFWB 4MJSA 4A3OA 1X1MA 3ALBA 1DOXA 4O1NA 5BYRA 2VH2A 2DBYA 3DPDA 3MC0B 3HIZA 1I4HA 4G11A 4NQLB 4LNKA 1PGBA 4HDQA 4DHZB 4ICUA 2ACZB 2K9XA 1FFUA 3AMZA 5T8IA 1YMHE 2NBVB 5BO4B 2IGDA 3DWGC 1Z2MA 2V3PA 4WWMA 4FADA 2INDC 1QOFA 1VR9A 3V6CB 4KKJA 4WJNA 4KV2A 3WAOA 4WAAA 2BWES 3W5VB 3B9JA 5LLIA 3RD2A 4EE2A 4REZA 1WJUA 4ANUA 4A90A 3QA8A 1N5XA 3KH0A 1PYWD 1SE3A 1WJNA 1VD2A 5E6PA 1BXTA 3ENEA 4XWTA 1C77A 4FN2A 5L95C 1Q1OA 2XNAC 1EM7A 1V49A 4ANXA 1T0YA 1WFYA 1QT9A 2KK8A 1TS5A 1QOBA 4K81A 3TEXA 2V4LA 5AZHA 3U30A 2ZW1A 1V5TA 5EE0A 1RLFA 2MJ3A 2GRIA 1AN8A 1N61A 1UGMA 2JZPA 3FILB 1L4ZB 1TS2A 4LJOB 2FUG1 1MVKA 1XLQA 2LXCA 5IO9A 3M3JA 2LEKA 5TSSA 4LDTB 2K39A 1D6EC 1WGKA 4IDIA 2PLPA 3PV1A 2BT6A 3RNCC 3UIPB 3GE3C 2BKRB 4PS7A 2L3ZA 1SE9A 2RR9A 3D32A 2K6DB 2DYOA 4CQNA 4BVUC 2WXPA 4AS1A 4ITKA 2KLCA 3MTNB 1GAQB 1PGAA 2L8JA 2N1WA 2INPE 2B76B 3TL5A 2XEWA 3GE8C 4GB9A 2BB6A 5BMGA 2V0GA 1A5RA 2RSUA 2JQRB 1KFYB 2D07B 1WSPA 1R7SA 4JWUC 2IY0B 4MSQB 1JRPA 5C2TB 2E6XA 4TMAB 4A9AA 4US9A 2C7MB 3ZTDA 3DBLI 4TUUA 1N63A 3UI3A 2WXLA 3PREA 3ZJUA 1D5ZC 2J0JA 2L00B 4YTPB 4K3CA 1SE4A 5D3IB 2KWCA 1IPGA 4NZLB 1V1PB 2WLBA 1MG8A 3ABVB 3DBSA 2DAFA 1ZUD2 3RNAC 3A4SC 1TZ1A 2KKCA 1VDVA 3Q14C 1CZPA 4WWNA 3SD5A 1OQQA 2KANA 2LZ6A 1EO6A 4ZYSA 1S3SG 2ZCCA 1SB3C 2L0TA 2NS5A 3DOWA 5FR6A 3A9JA 3DBLB 2BQQA 2WXNA 1JW9D 1I7HA 1C78A 3VTUA 2LFIA 1RFKA 2KWVB 2WDRB 2BVCA 2UYZB 3Q69A 2ZJDA 2WDTB 2LRWA 3OWEB 4MM3B 1WGGA 1IGCA 2GBJA 1JWBD 1WXSA 5G5HA 4LDTD 2JYEA 1U4AA 1PDXA 2O2VA 3Q6BA 1E7UA 3N20C 2JRIB 4M00A 3B2GA 4OVZA 1C4PA 3PSEB 3OAWA 1FMAD 5H92C 1B9RA 5GMVA 4P1BC 1TKGA 2GBNA 3EGRA 2DZJA 2OHFA 3WAPA 3TBLD 4S0RA 5D3DA 1Y56A 5L83A 2FCQA 4DHJB 3T3OA 2O6VB 2GLSA 4DWFA 3AULA 2NMQA 3NOBA 3TJPA 3NZSA 1LM8B 3SFDB 1UNSA 4USAA 1CJEA 5C3JB 1KM7A 2KZRA 3HM6X 2LJ5A 3EFCA 1FFVA 2N7DA 4PYZA 4GSWA 2NPTA 3P1MA 4W9JA 3PZDA 3WCQA 1OQRA 3JSVB 3RNBC 3IT4B 2MCNB 1WX7A 1JWSD 1FIQA 2GMIC 1UBIA 1PFDA 2BYFA 2KDIA 2BYVE 4KVGB 1I4RA 1Y8RC 3RNEC 1KRHA 2JWUA 5EE9A 1D5XC 3X23A 5AZGA 2JXXA 4JGHB 1L5PA 3UQBA 4FULA 2B3AA 4IW0A 4FHKA 3U7ZA 1J8CA 4DK5A 2L32A 3QX1A 2D3GA 2WXRA 3N1XC 4RH6A 2M0AA 2ZW0A 1V81A 5AUIA 3H1UA 3S2AA 1GUAB 3M62B 1AWDA 2W9NA 4OZCA 2ONQA 1FRDA 1V5OA 3RNFC 3ML9A 3DVGY 2K8CA 3ZXRA 4YWGG 2WS3B 2A4ZA 4K7WA 2WU2B 4YTMB 5E6NA 1RFAA 4HLEA 1K51A 4BFRA 3VTWA 1E10A 3DDCB 1MI0A 1K52A 2OOBB 2V3SA 1ACCA 1FNWA 4C7ZA 3TEWA 4KGSA 3R7RA 4EZLA 4GMVA 1K8RB 2MW5A 1V2YA 1JROA 2DYMA 4ZHPA 4KSLC 1ZDVA 2PJHA 1WYWB 4DHJD 2O6VD 4OVUA 2NTTA 2NPTB 4JLCA 4W9FA 3R66C 1FCLA 2WX0A 3NS1A 3H7PA 2BPSA 2H88B 2Q5WD 3PZ7A 3ONSA 1EF1A 1TKYA 1HZ6A 1E0ZA 1L7YA 2IDYA 2V4IB 4PYUA 4ZYNA 3QJZA 1WE6A 3N9YC 4KIKA 3VXWA 2KJHB 1E6EB 3I9V1 1Z5SB 3MJ5A 4GOCA 3A4RA 4E74A 3UIOB 2EKIA 1HTOA 2IGGA 2IPKD 2XBBC 3PZ8A 1KH0A 2CU3A 4JPSA 3TCAA 3QK0A 4PS8A 2MBBB 1A70A 1HE8A 3Q8EA 2RGFA 1XD3B 2RDGA 2YEPB 2KO3A 2X38A 4S17A 3EA6A 3P2BA 4EZKA 5LNK1 2K25A 3ZNHB 3UGBB 4ZRJA 5JHAA 1I35A 1ESFA 5IOIA 1V9JA 1WMHA 4B6WA 2ASQA 2D5GA 3QC8B 1WRIA 4E71A 3DBHI 3Q3OC 1RWSA 1V1OA 2QMTA 2K6QA 4BAXA 4GDKB 1J0GA 3K9PB 4DQOC 2KMMA 1GPXA 5BYQA 3ZIMA 1C9FA 3TUOA 2EMTA 1B1ZA 2JSVX 3R3MA 1WF9A 4EEWA 4G50A 2IBIB 4LK0M 1WY8A 2DZMA 5IA7A 2C60A 1TTNA 3H7PB 3ZXVA 1ENFA 1L0VB 5EE1A 2M1MA 4FJVB 2BWFA 1DOIA 2FIFA 2ZVNA 1ZP0B 3GP7A 4J3OD 2CJNA 3U4EG 4KIKB 3DBHB 3LB8C 1F9JA 2V3NA 3SDLC 2JVCA 4JIOU 2KN5A 1WXQA 3ZNID 3DHHC 1BUIC 2WXHA 3PLUA 1P98A 3Q8AA 3U2SC 1XLNA 4FHJA 2KMAA 4GIVA 3NS8A 2KVRA 4AJWA 4FJYA 5J17A 2M4NA 3A33B 4BKGA 4A3PA 1L0YB 1VZ6A 1I42A 2AWTA 1EWYC 3ZJVA 1ZDXA 2IO1B 4P16A 1STEA 3AN1A 3MHSD 1WMHB 1VRAB 5FR3A 3O65B 4PS3A 2GI9A 4K3BA 2C7HA 4DDID 3ZO5B 1UH6A 1T6BX 4FLHA 1KLVA 1QF6A 3IVFA 4RGTA 3LYYA 4NJCA 1I4PA 3UINB 1VCBA 2Y5CA 4HEA1 2I1JA 1HTQA 1WZ3A 1TKEA 3V62A 1GB1A 3MHZA 4LJPB 1F52A 1V86A 3TSSA 2MQJA 5D6JB 4AOFA 1V97A 3AE3B 3KWLA 3KW5B 4RGOS 2C5LC 1RYJA 3W5UB 3VR8B 1L6VA 4IKGA 2ZNVC 2J7QB 3APCA 1GNUA 2M56B 4W9HA 2D10A 3AI5A 3ZKJC 1UBQA 2LUMA 4JE3B 2IJ0A 3EHVA 2D3AA 2J4XA 3PHWB 3ML8A 3GS2A 1WM2A 1XCQL 3W1SA 1C4CA 2KNBA 1UUPA 2MH7A 2X8XX 2MHJA 4EUTA 4WIPA 1E9MA 1PGXA 4ZHOA 1ZE3D 2BBCA 2CHZA 2LRUA 3CSTA 2MA9B 1HZ5A 2BB5A 4TKNA 2EELA 2D3BA 1KTKA 2LD9A 5LXIB 2KTFA 3RMKC 2N1VA 3VR9B 1NDDA 1E7PB 5IAAC 2JU6X 1VZ7A 3HRDD 3R7QA 4IM3A 5IP4D 3Q3MC 4MSMB 1F2RC 2WXOA 3R8BA 2AL3A 1T3QA 4IOIE 4MT5A 2K0PA 3VUWA 3AEBB 2ZVOA 1WXAA 1HQRD 5JHBA 1M94A 2GB1A 3U8ZA 3LDZE 3V61A 3A9KA 4GN1A 2KD0A 4MJSB 3SU8X 3NVWA 2JXTA 1TYGB 5CHWA 1PUTA 5E6OA 1AYFA 1I4XA 4ARIA 2KVZA 2QEJC 3Q8FA 4BZAA 4L2YA 2EMSA 4RF0A 2NBUA 1NVID 2KQSA 2WXFA 4EKUA 2IO2B 4IM0A 2LHEA 1YQBA 1FXIA 2FNJB 2G1EA 1HEZE 4XZ4A 3P4PB 3URYA 3RPFC 3OJ4B 2KXJA 4B95A 3M95A 3MFGA 3B2FA 4N59A 4I6NB 1QKZA 2LGSA 1ET9A 1DOYA 2BW2A 2G45B 2NR2A 5IN7A 3K9OB 2J52A 2WYQA 1TJEA 2BF8B 3W2DA 1YN5A 4BKSD 1UWXA 2QDFA 3KYDD 2R2OA 3MP9A 3Q2AC 1P1AA 2W82A 1WE7A 2KX0A 2LJIA 4KGRA 3VTVA 3ZUNA 3NVYA 1L2NA 4DXGA 1BMLC 2IY1B 5BMIA 4K1RB 2JZ3B 5AEKB 1TIFA 2ZNVB 5G55A 2DYBA 3ECIA 4YXDB 4A55A 5H8YE 2KC1A 3A9KB 3WALA 1GC6A 3AE1B 4OVVA 4GLSC 2TSSA 4WQOB 4W9LA 1T5XD 4W9DA 3MJWA 1VLBA 1OTRB 2PVOD 4HKQA 4HKZE 2KYWA 5FK9C 2KT7A 4MH8A 1F2RI 1VJKA 2RPQA 1E5WA 3Q3NC 1WXMA 3RNGC 3TEZA 3VUYA 4M01A 1TZOA 3V05A 4RM8A 4TQ0A 2E3TA 1N60A 2KDEB 2I2YA 3AECB 4LNFA 1JWUD 4F8CB 2QHOA 3PRPB 2G4SA 1N62A 2Y5BB 1WZ0A 1ISNA 2LASA 1JALA 3H6NA 1FO4A 2N9XA 2AL6A 4TV3A 1KF6B 1Q5WB 1SIJA 2ZCBA 4DDGD 3VFKA 3PPAA 2WP9B 2GOWA 3CMMB 1CMXB 1FXAA 3NG0A 3RT3B 4C4VA 1J19A 4NJ6A 2HJ8A 5BYSA 2VZKB 2KWDA 2WXJA 1H4RA 2DWQA 3AH7A 3HK0A 4KZCA 1WGRA 3CF6E 2LWPA 4N58A 3ZRCA 4YT0B 4WAFA 2KTRA 5J18A 1V8CA 3APFA 1WXVA 1SIFA 3PTFC 1LXDA 3PGEA 1IBXA 3L13A 4D2KA 3VH3B 4IWPA 1XLOA 4DHZE 3A9JB 4IM2A 4YSYB 1JRUA 1QQRA 4J6IA 2QSDA 2VH1A 1LGRA 1XCTL 1CK1A 3QCAA 3IAS1 4PT5A 5D94A 3IG3A 3RYTA 3O13A 1TT5B 2WXMA 4Q2JA 4URKA 3P4SB 4G0NB 4I6LB 3R2TA 3I63C 2FIDA 3HM3A 2PE9A 2O2VB 3ZNGC 4XWWA 2GBRA 5JXVA 3BVZA 4HPPA 3NJTA 1XXGA 4II2B 4TSSA 2PE6B 1DGJA 3A1QA 4W9GA 1EU3A 1SSNA 3AE4B 4GXBA 1GG3A 2ICIA 3CIRB 3PRZA 1L6UA 3BK1A 2LVOA 3AEGB 4LLGM 2ZEQA 4B0MA 3P63A 5G5GA 4A20A 4MGIE 2HE7A 3MC8A 4EZJA 1XT9B 2IZVB 4ZOHC 2Z8LA 1YQ4B 3HVDA 1E8ZA 4OZAA 1J7CA 4GU2A 1TS4A 2WX1A 1EF5A 2DHZA 2OJRA 5HKHA 2M8SA 4AP4C 1FCCC 5DCNA 2VZKD 2HTME 2M17A 1L0XB 2BGFA 1TGZB 2H89B 2L1AA 4RGMA 4II3B 4WJPA 3Q3FA 1JWAD 3NY5A 2W55A 5G2NA 2KWUB 2HJ1A 4RMAA 4FJZA 4NPNA 1JMLA 3L54A 1D5MC 1ZKHA 2JPHA 1UF0A 3ZNZB 3NZ3A 2MBQA 2DZIA 2MSED 2K1FA 3L17A 3BYYB 1JWMD 4OW0A 1GC7A 1E7VA 2L76A 4PK1A 2CHWA 2JX5A 2ZZPB 2FUHB 4HCNB 4LCDE 2KQ4X 4GDLA 4NY0A 4KX6B 1JQ4A 1L4DB 1NI2A 2RMMA 3C8YA 5DPWA 2BS4B 2PPHA 1E8YA 3ZDTA 4BBNC 3KUDB 2INNE 3QAQA 2J0KA 3P4RB 1D4BA 1FM0D 3DVNU 2RDHA 1R4MI 1TY0A 2CS4A 3MC9A 3U7DA 1WI0A 2L0FA 1AARA 1C1YB 4EFOA 2ZPNA 1KLGD 3IT6B 2N7JA 2W54A 3KWVA 3ZTCA 2JYTA 4M8NA 4JWSC 2AQ2B 3W1YA 3ZLZA 1FEHA 3DHIC 1QILA 3JW0X 3DWMA 1ROEA 3RI7C 2BTEA 1C3TA 2L83A 1N6ZA 1WX9A 4ZRQA 1FD6A 3PS6A 2N9KA 1R4MB 2N4FA 2ON8A 3H9DA 1FPYA 2K22A 4M0WA 3AXCA 1PQSA 2IYDB 3AV8A 3NVZA 3C0RB 2KDFB 3W1SC 1BT0A 1K50A 2FCSA 3ZYYX 4NJ7A 3UF8A 2UU7A 2N0SB 4ASWC 4WWPA 3VDZA 5D7GA 4P7IA 5EE3A 2PIAA 4P6VF 3BZDB 1NI3A 4RCOA 4OZBA 2PMVA 4DXFA 3X0WA 2KX3A 4MELA 4H2AA 3UQAA 2WDVB 4ANWA 2NBWB 3WA0A 1MFWA 3AU5A 3C19A 3NVVA 1YJIA 4HRSA 2CKHB 4BOZB 4WWOA 4CHKA 3AE8B 4US8A 2JUOA 4KGTA 1KLUD 4ZRPA 3P42A 2LUEA 3EC8A 3N1ZC 2JY6A 4W9IA 3EUB2 2WXIA 3FILA 2BS3B 3AEEB 2DENB 4NAWA 1Q0WB 2HD5B 1HA5A 2G4DB 2HDEA 3BVGA 1OGWA 2KAJA 5KHOA 1E8WA 2KN4A 5EDSA 1NBFC 4A8XC 3IAM1 4HXDA 4ZDVA 1TBEA 2MEKA 1ET6A 1SEBD 3BK2A 1WH3A 2SAKA 2D11A 2KOXA 1ZPSA 3VVWB 1GJZA 1SBBB 4RFBA 4KDLB 4C56C 4IUMB 4M0WB 3IBEA 4YTNB 4MEMA 2WQYB 1UWMA 3Q3JA 4DXAB 4M8MA 4IWOA 4ANVA 1OEYA 2WDQB 3KVFB 4HJKA 2WHIA 2W3RA 5DPTA 4CYEA 1YQ3B 5E6JA 3FC4A 3PLVA 3RCZA 3AB5A 2DZKA 2KHWB 1FXTB 3RULA 3RZFA 2LHDA 3GZNI 4C7YA 2MBHA 3CSFA 2Z59B 1ZGUB 2K8BA 2G3QB 4RM9A 2MLBA 2LGXA 1ZOYB 5HG2A 4KDIC 1ZW7A 2CU1A 4LNNA 1S1QB 1YD8U 4C00A 2DAJA 5DPRA 1YN3A 3RZWC 3DVGX 3OG5A 3N30A 3TMPB 3V60A 5HFYA 3ZVVA 1AW7A 5LXHA 2JWZA 1V1PA 5CHVC 1WM3A 2Z0DB 4EOYA 1P7FA 1XF5L 4NAWB 3SHQA 3AE5B 3J9CA 4WH4A 4JL9A 2WGSA 1T0RC 2VRRB 5CHFA 5J2RA 2BYEA 3CWIA 1OEYJ 3ZW3A 4N9F4 1DYQA 3GZNB 2WXQA 2DX5B 2J0MA 2W3SA 1V6EA 2MRPA 4HCPB 1R4NI 1G6JA 2MWSB 4FXCA 2MJDA 4UDUC 3B1LX 2LXAA 3BVMA 1IP9A 2WXKA 4AJYB 4MM3A 3NUHB 5C1ZA 4HPMB 2A5UA 1C4AA 3VRBB 1T0SC 1WRDB 4HDOA 3DQVA 3WAMA 1SJED 1H8CA 1IYFA 2Y3AA 5JZEB 2WNMA 3PT2B 2LVPA 4KKIA 1WX8A 4L1BA 1Q10A 1EUVB 2D3CA 1YIWA 3V3XA 4WJQA 3N3KB 4TQ1A 4HJGE 3PO0A 1E90A 5CX3A 1WGDA 2AQ1B 2C9WB 1R4NB 3RN9C 4XX5A 3KUZA 1I4QA 4XYCA 4E3CA 2O6VA 3VHTC 3APDA 3NHEB 3L0WB 1LQBA 1EU4A 3DCGA 3I5JC 4K7UA 2I1KA 1P9DU 2WWZA 2KFJA 1MPEA 1K53A 3QHTA 1VZ8A 2J53A 1CQVA 2OEDA 5HHDG 1WR6E 2FBWB 4BKTA 1YX6B 3OJ3A 4L23A 3ZRFA 4W9CA 3JSVA 2K3UA 3AE7B 1NEKB 1NYRA 3DHGC 2FAZA 4YSZB 2GBKA 4K7SA 3LJ3A 1P0RA 3B08A 3QWZB 3SFEB 4RF1A 3HHMA 3AE2B 1QOAA 2Y5PA 3VH4B 2QCZA 3BINA 4JQWC 4FA6A 1SE2A 3VUXA 2RPVA 1YN4A 1IUEA 2M0XA 2NCNA 3M63B 2LGIA 2IGHA 2G9HD 3B0AA 4AWJA 3EFUA 4NAMA 3GB1A 1ZXHA 2CHXA 3PRMB 1QOGA 2V1YA 4LTUA 5MPOA 2DNFA 5DPSA 3AEDB 1XO3A 4XE0A 2CJOA 1NYQA 3L08A 2N9EB 3IXSA 1J7AA 2LGDA 2KQ7A 3AE9B 1HXYD 2L05A 4LNIA 4HWIB 2PKOA 4A6QA 1LFDA 2RDBC 3ZDMC 1XQQA 4AQ7A 3KLSX 3ZGZA 5FKAC 2AEHA 4IG7B 4MGYE 3AU4A 2YEPF 2L52A 2ZPYA 1SF0A 2L7RA 2EKEC 3WIMA 2WU5B 1I4GA 3JVZX 2K8HA 4MH0E 1ZXIA 2RD0A 3SR6A 2KJ6A 1T0QC 2QILA 1UELA 1KOTA 3EECA 2QIEB 3NRZA 2GBMA 4NQKE 3U52E 1OQYA 2LI5A 2JF5A 4WJOA 4ICVA 2IO3B 3T9LA 4WQMA 2PVGC 5AZFA 3PVLA 2XK5A 4M02A 1SXTA 4ZRIA 2QC8A 2I38A 5JH5C 4YL8A 3H8HA 2N9PC 4QAYA 3LXFA 4KSKC 1WWTA 3AEAB 3E56A 1XLPA 5D2MB 1C79A 4IC7B 3BYTB 2K5PA 3GOEA 2FCMA 1WR1A 5C23A 2D2QA 2AYOB 1V80A 1YJ1A 3Q8BA 2UWQA 4C4VB 1E8XA 4RNAA 1C76A 3SEBA 2AQ3B 2HTHA 2KTRB 1WIAA 4GDKA 4W9KA 3L10B 3BIID 1P3QU 2NVUI 5AUKA 3QQ8B 1IBXB 2KFKA 1F77A 2R2QA 2KJRA 1NENB 2JZZA 2MX2A 1FRRA 4F7ZA 3TIXA 4MACA 3BY4B 4N6EB 3FAHA 3HUIA 3KUCB 1M4VA 1KJTA 3DBRI 2PEAA 1WYGA 1YOVB 3T8MA 5IKCM 3QIJA 2KC2A 4LNOA 2JT4B 2M19A 3DVNV 2QJLA 3W9CB 2XK5B 2PTLA 3HVZA 3Q8CA 3RFZB 5CTRC 2YVCA 3AM9A 4P1CC 3VRAB 3A1QB 5I4DA 4MGZE 1UZXB 3I3TB 4I6PA 1QZEA 1EWCA 3AE6B 1MHXA 4X57B 5KHQA 3JYUA 4IWQA 1UD7A 2LMCA 3DBRB 4B0EA 1WGHA 5TR5A 3IHPC 4XC2A 1N5WA 2SEBD 1MG4A 1MJDA 1J7BA 1F0ZA 3ZJTA 3AEFB 1IGDA 2YLMA 2XN9C 2BYTA 3FKYA 1TS3A 2OJWA 1SJHD 3NZUA 1YX5B 3ETRA 2NTSA 4HPLB 4ARCA 2KFKB 4DBGA 2BS2B 4FBJB 1YJJA 4XDDA 2C7NB 1JCKB 4CO7A 2MP2A 3KYCD 3R2IA 1FNVA 2MJEA 4BBNF 3WANA 1TY2A 2IO0B 2LVQA 3RUIB 3QARA 4OHJA 2KLGA 4AUQC 2DLBA 2N7EA 1UGJA 4MDKE 3VAWA 2R61A 2AX5A 2J42A 2JRHA 3KQ4A 3P4QB 4G3XB 1XEEA 1P7EA 2PW9A 4YSXB 1FNUA 4KZ0A 4HVBA 1YNTE 4BKSA 1WGYA 2Z0EB 2FCNA 1RRBA 2LGYA 3TEYA 4GDLB 3OLMD
chains in the Genus database with same CATH topology
1WZ0A 2WX0A 1ISNA 2CR5A 2LASA 3H7SA 3H6NA 4JL9A 2KDBA 3H7PA 2BPSA 4HK2A 2VRRB 5CHFA 3ONSA 2BYEA 1EF1A 5J2RA 1OEYJ 2N9XA 3ZW3A 1L7YA 2AL6A 4N9F4 4TV3A 4GGQA 1Q5WB 1WJ4A 2ZCBA 4PYUA 2MBOA 4ZYNA 4DDGD 3QJZA 1WE6A 2DX5B 2J0MA 1SGHA 3VFKA 1V6EA 4KIKA 2KMCA 3VXWA 2KJHB 4F1SA 2MRPA 3PPAA 1Z5SB 2GOWA 3CMMB 4HCPB 1CMXB 3VQIA 3RT3B 1R4NI 4GOCA 1D3ZA 3A4RA 1G6JA 4E74A 1J19A 3L16A 2HJ8A 4NJ6A 3UIOB 2MWSB 1H4RA 2XBBC 3B1LX 2LXAA 3HK0A 1IP9A 4KZCA 1WGRA 1WJ6A 3TCAA 4AJYB 3CF6E 3QK0A 4MM3A 2LWPA 4PS8A 4BOSC 2MBBB 4B9KA 3ZRCA 3N32A 5C1ZA 1HE8A 4HPMB 2KTRA 2A5UA 5J18A 2RGFA 4W9EA 3APFA 1WXVA 1WRDB 4HDOA 1XD3B 3DQVA 4ZRKA 4NNJB 3WAMA 1SIFA 3PTFC 1H8CA 1IYFA 2MBEA 1LXDA 2KO3A 5JZEB 3PGEA 2REXA 3PT2B 3P2BA 4EZKA 3L13A 2LVPA 2MP2B 2K25A 3VH3B 1WX8A 3ZNHB 4IWPA 3UGBB 1RAXA 4ZRJA 1EUVB 5JHAA 4DHZE 1YIWA 3A9JB 3V6EB 1I35A 4WJQA 3N3KB 4IM2A 4MGKE 3PHXB 4TQ1A 1JRUA 1V9JA 1WMHA 4J6IA 1E90A 2BKFA 3IFWB 4MJSA 5CX3A 4A3OA 4B6WA 1WGDA 2ASQA 1X1MA 3ALBA 3QC8B 3QCAA 4E71A 3DBHI 2C9WB 5D94A 3IG3A 3RYTA 3DPDA 2K6QA 4XX5A 3HIZA 3KUZA 4URKA 4G11A 4G0NB 4NQLB 4E3CA 4GDKB 2O6VA 4I6LB 3VHTC 4HDQA 4DHZB 2FIDA 1J0GA 4ICUA 3APDA 3HM3A 2PE9A 3K9PB 2O2VB 3ZNGC 2GBRA 3NHEB 3L0WB 1LQBA 3ZIMA 3DCGA 4K7UA 2EMTA 2I1KA 2NBVB 5BO4B 1Z2MA 3R3MA 1P9DU 4FADA 1WF9A 4II2B 2WWZA 4EEWA 4G50A 3V6CB 4WJNA 4KV2A 2PE6B 3WAOA 2IBIB 2KFJA 4WAAA 2BWES 3QHTA 1WY8A 5LLIA 3RD2A 3A1QA 2DZMA 4W9GA 5IA7A 1WR6E 1WJUA 4ANUA 4BKTA 2C60A 1TTNA 3H7PB 3QA8A 1YX6B 3OJ3A 3KH0A 3ZRFA 1WJNA 1VD2A 4W9CA 2M1MA 3JSVA 4GXBA 1GG3A 5E6PA 4FJVB 2BWFA 3PRZA 2FIFA 2ZVNA 3ENEA 2LVOA 4KIKB 2ZEQA 4FN2A 5L95C 1Q1OA 2FAZA 4A20A 4MGIE 1F9JA 1V49A 2GBKA 4ANXA 2HE7A 1T0YA 1WFYA 3LJ3A 4K7SA 1P0RA 3B08A 3QWZB 3SDLC 2JVCA 2KK8A 4JIOU 2KN5A 4EZJA 1XT9B 2IZVB 3ZNID 3HHMA 4K81A 3PLUA 2V4LA 5AZHA 3U30A 1V5TA 3VH4B 1P98A 3BINA 1RLFA 1E8ZA 1UGMA 4JQWC 4FA6A 4GU2A 4FHJA 3VUXA 2WX1A 2KMAA 1EF5A 2DHZA 4GIVA 2OJRA 3NS8A 5HKHA 4LJOB 2KVRA 4AJWA 4FJYA 5J17A 2M0XA 2M8SA 2NCNA 3M63B 2M4NA 3A33B 4BKGA 4A3PA 3B0AA 1I42A 4AWJA 2AWTA 2LXCA 4AP4C 3EFUA 3M3JA 5DCNA 2CHXA 3PRMB 2V1YA 2M17A 2IO1B 2BGFA 4LDTB 1TGZB 2K39A 3MHSD 1WMHB 5DPSA 3O65B 3PV1A 4PS3A 4II3B 3UIPB 2C7HA 4DDID 4WJPA 3Q3FA 2BKRB 4PS7A 2L3ZA 3ZO5B 1SE9A 1UH6A 2RR9A 3D32A 3L08A 2N9EB 2K6DB 3NY5A 4FLHA 2DYOA 1KLVA 5G2NA 3IVFA 2KWUB 2LGDA 4BVUC 2KQ7A 3UINB 2L05A 2KLCA 3MTNB 4RMAA 1VCBA 4FJZA 4HWIB 4NPNA 2L8JA 2N1WA 1LFDA 3L54A 1ZKHA 2JPHA 3ZDMC 1XQQA 2I1JA 1WZ3A 3TL5A 2XEWA 4GB9A 3V62A 3ZNZB 1A5RA 2AEHA 2MBQA 2DZIA 2RSUA 2MSED 4IG7B 4MGYE 3AU4A 2K1FA 4LJPB 3L17A 1V86A 2D07B 2ZPYA 2MQJA 2L7RA 5D6JB 4AOFA 2EKEC 1GC7A 2IY0B 1E7VA 4MSQB 3WIMA 2L76A 3JVZX 2K8HA 3KW5B 2CHWA 2ZZPB 4MH0E 2FUHB 2C5LC 4HCNB 4LCDE 4GDLA 2RD0A 4NY0A 2KJ6A 1NI2A 2ZNVC 2J7QB 1UELA 5DPWA 1KOTA 3APCA 2C7MB 3EECA 2PPHA 1E8YA 1GNUA 2GBMA 4NQKE 3ZDTA 3ZTDA 4BBNC 1OQYA 3KUDB 2LI5A 3DBLI 2JF5A 4TUUA 2D10A 4W9HA 3QAQA 2J0KA 3PREA 4WJOA 3AI5A 4ICVA 2IO3B 3ZKJC 3T9LA 3DVNU 1UBQA 1R4MI 5AZFA 2CS4A 3PVLA 2XK5A 3U7DA 1WI0A 2J0JA 2L00B 3EHVA 2KWCA 1IPGA 2L0FA 3PHWB 1AARA 3ML8A 1MG8A 4ZRIA 1WM2A 3W1SA 1C1YB 4EFOA 5JH5C 4YL8A 2KNBA 2N9PC 3DBSA 2ZPNA 4EUTA 2DAFA 2CHZA 4KSKC 2LRUA 3A4SC 3CSTA 1TZ1A 2MA9B 2KKCA 4TKNA 5D2MB 3ZTCA 4M8NA 2LD9A 4IC7B 4WWNA 3SD5A 2KANA 2LZ6A 5LXIB 3W1YA 2KTFA 1EO6A 3GOEA 1S3SG 2FCMA 1WR1A 2ZCCA 5C23A 2D2QA 2AYOB 3ZLZA 2L0TA 2NS5A 2N1VA 3DOWA 5FR6A 1V80A 1NDDA 1YJ1A 3A9JA 2UWQA 5IAAC 1E8XA 3JW0X 1C3TA 1WX9A 3VTUA 2KWVB 2UYZB 3PS6A 2ZJDA 2WDTB 2LRWA 2HTHA 1WGGA 2GBJA 2N4FA 3R7QA 3H9DA 1WXSA 2KTRB 3AXCA 4IM3A 1PQSA 1WIAA 2IYDB 4MSMB 4GDKA 4LDTD 4W9KA 2AL3A 1U4AA 3L10B 3VUWA 2O2VA 3C0RB 1P3QU 2NVUI 2ZVOA 1E7UA 2KDFB 3QQ8B 1BT0A 3W1SC 1WXAA 2JRIB 5JHBA 2KFKA 2FCSA 1M94A 3PSEB 3OAWA 4NJ7A 2R2QA 3LDZE 3U8ZA 2KJRA 3UF8A 3V61A 2JZZA 2MX2A 5GMVA 4ASWC 4WWPA 4F7ZA 3A9KA 4GN1A 2KD0A 4MJSB 3TIXA 3BY4B 3SU8X 3VDZA 5D7GA 4P7IA 3KUCB 5CHWA 2GBNA 5E6OA 1KJTA 2DZJA 3WAPA 3TBLD 3DBRI 2PEAA 5L83A 2FCQA 4DHJB 2EMSA 2O6VB 3T8MA 2NBUA 3X0WA 2KX3A 3QIJA 2KC2A 3AULA 4MELA 4DWFA 3UQAA 2JT4B 2KQSA 4ANWA 2NBWB 3NOBA 3TJPA 3WA0A 2IO2B 3DVNV 3NZSA 4IM0A 4EKUA 2XK5B 1YQBA 1LM8B 2FNJB 3AU5A 2CKHB 4BOZB 4WWOA 5CTRC 1KM7A 4CHKA 4XZ4A 2JUOA 2YVCA 2KZRA 2LUEA 3EC8A 3OJ4B 2JY6A 3A1QB 2KXJA 4B95A 3HM6X 3M95A 2LJ5A 4W9IA 2N7DA 4PYZA 2DENB 4GSWA 2NPTA 4NAWA 4MGZE 4W9JA 4I6NB 1UZXB 3I3TB 3PZDA 1Q0WB 2HD5B 4I6PA 3JSVB 1QZEA 2G4DB 2MCNB 1OGWA 1WX7A 5KHOA 2G45B 2NR2A 4X57B 1E8WA 5EDSA 1NBFC 1UBIA 2GMIC 2BYFA 2KDIA 2WYQA 3K9OB 2BF8B 5KHQA 3JYUA 2BYVE 4BKSD 4IWQA 4KVGB 1UD7A 1Y8RC 3KYDD 4HXDA 4ZDVA 2R2OA 1WGHA 1TBEA 5TR5A 3IHPC 3X23A 5AZGA 2JXXA 4JGHB 4XC2A 1WH3A 3UQBA 4FULA 1P1AA 2D11A 2B3AA 2KOXA 1WE7A 4IW0A 3VVWB 2KX0A 1GJZA 4FHKA 4KDLB 4IUMB 2YLMA 4M0WB 1J8CA 3IBEA 3VTVA 3ZUNA 1L2NA 4DK5A 4MEMA 3QX1A 2D3GA 2IY1B 3Q3JA 4DXAB 4M8MA 4IWOA 4ANVA 4K1RB 1OEYA 3NZUA 2JZ3B 5AEKB 1YX5B 1V81A 3KVFB 4HJKA 3H1UA 4HPLB 3S2AA 5DPTA 2ZNVB 2KFKB 4DBGA 4FBJB 1GUAB 5G55A 2DYBA 4CYEA 3M62B 2C7NB 2W9NA 3PLVA 3ECIA 3RCZA 2MP2A 4CO7A 2KC1A 3A9KB 3KYCD 1GC6A 1V5OA 3WALA 2DZKA 2KHWB 4OVVA 3ML9A 1FXTB 3DVGY 2K8CA 4BBNF 3RULA 3RZFA 4WQOB 2IO0B 4W9LA 2LVQA 3RUIB 3WANA 3QARA 3GZNI 4W9DA 2KLGA 3MJWA 2A4ZA 4AUQC 4K7WA 2MBHA 2N7EA 3CSFA 1OTRB 1ZGUB 2K8BA 2G3QB 2Z59B 2MLBA 4MDKE 4RM9A 2LGXA 3VAWA 5E6NA 1RFAA 2JRHA 4KDIC 4HLEA 4BFRA 3VTWA 1ZW7A 2RPQA 1E5WA 2CU1A 3DDCB 4G3XB 1WXMA 2OOBB 1S1QB 1YD8U 2DAJA 2V3SA 5DPRA 3VUYA 3RZWC 3DVGX 4RM8A 4TQ0A 3N30A 3TMPB 3R7RA 3V60A 4GMVA 4EZLA 1K8RB 2KDEB 4KZ0A 2MW5A 1V2YA 3ZVVA 5LXHA 2JWZA 4HVBA 4F8CB 2DYMA 5CHVC 1WM3A 4BKSA 2Z0DB 4KSLC 1WGYA 2Z0EB 2PJHA 4EOYA 2QHOA 3PRPB 1WYWB 2FCNA 2G4SA 4DHJD 2O6VD 1RRBA 4OVUA 4NAWB 2NPTB 2LGYA 2Y5BB 4JLCA 3SHQA 4W9FA 4GDLB 3OLMD 3R66C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1WZ0 A;  2WX0 A;  1ISN A;  2CR5 A;  2LAS A;  3H7S A;  3H6N A;  4JL9 A;  2KDB A;  3H7P A;  2BPS A;  4HK2 A;  2VRR B;  5CHF A;  3ONS A;  2BYE A;  1EF1 A;  5J2R A;  1OEY J;  2N9X A;  3ZW3 A;  1L7Y A;  2AL6 A;  4N9F 4;  4TV3 A;  4GGQ A;  1Q5W B;  1WJ4 A;  2ZCB A;  4PYU A;  2MBO A;  4ZYN A;  4DDG D;  3QJZ A;  1WE6 A;  2DX5 B;  2J0M A;  1SGH A;  3VFK A;  1V6E A;  4KIK A;  2KMC A;  3VXW A;  2KJH B;  4F1S A;  2MRP A;  3PPA A;  1Z5S B;  2GOW A;  3CMM B;  4HCP B;  1CMX B;  3VQI A;  3RT3 B;  1R4N I;  4GOC A;  1D3Z A;  3A4R A;  1G6J A;  4E74 A;  1J19 A;  3L16 A;  2HJ8 A;  4NJ6 A;  3UIO B;  2MWS B;  1H4R A;  2XBB C;  3B1L X;  2LXA A;  3HK0 A;  1IP9 A;  4KZC A;  1WGR A;  1WJ6 A;  3TCA A;  4AJY B;  3CF6 E;  3QK0 A;  4MM3 A;  2LWP A;  4PS8 A;  4BOS C;  2MBB B;  4B9K A;  3ZRC A;  3N32 A;  5C1Z A;  1HE8 A;  4HPM B;  2KTR A;  2A5U A;  5J18 A;  2RGF A;  4W9E A;  3APF A;  1WXV A;  1WRD B;  4HDO A;  1XD3 B;  3DQV A;  4ZRK A;  4NNJ B;  3WAM A;  1SIF A;  3PTF C;  1H8C A;  1IYF A;  2MBE A;  1LXD A;  2KO3 A;  5JZE B;  3PGE A;  2REX A;  3PT2 B;  3P2B A;  4EZK A;  3L13 A;  2LVP A;  2MP2 B;  2K25 A;  3VH3 B;  1WX8 A;  3ZNH B;  4IWP A;  3UGB B;  1RAX A;  4ZRJ A;  1EUV B;  5JHA A;  4DHZ E;  1YIW A;  3A9J B;  3V6E B;  1I35 A;  4WJQ A;  3N3K B;  4IM2 A;  4MGK E;  3PHX B;  4TQ1 A;  1JRU A;  1V9J A;  1WMH A;  4J6I A;  1E90 A;  2BKF A;  3IFW B;  4MJS A;  5CX3 A;  4A3O A;  4B6W A;  1WGD A;  2ASQ A;  1X1M A;  3ALB A;  3QC8 B;  3QCA A;  4E71 A;  3DBH I;  2C9W B;  5D94 A;  3IG3 A;  3RYT A;  3DPD A;  2K6Q A;  4XX5 A;  3HIZ A;  3KUZ A;  4URK A;  4G11 A;  4G0N B;  4NQL B;  4E3C A;  4GDK B;  2O6V A;  4I6L B;  3VHT C;  4HDQ A;  4DHZ B;  2FID A;  1J0G A;  4ICU A;  3APD A;  3HM3 A;  2PE9 A;  3K9P B;  2O2V B;  3ZNG C;  2GBR A;  3NHE B;  3L0W B;  1LQB A;  3ZIM A;  3DCG A;  4K7U A;  2EMT A;  2I1K A;  2NBV B;  5BO4 B;  1Z2M A;  3R3M A;  1P9D U;  4FAD A;  1WF9 A;  4II2 B;  2WWZ A;  4EEW A;  4G50 A;  3V6C B;  4WJN A;  4KV2 A;  2PE6 B;  3WAO A;  2IBI B;  2KFJ A;  4WAA A;  2BWE S;  3QHT A;  1WY8 A;  5LLI A;  3RD2 A;  3A1Q A;  2DZM A;  4W9G A;  5IA7 A;  1WR6 E;  1WJU A;  4ANU A;  4BKT A;  2C60 A;  1TTN A;  3H7P B;  3QA8 A;  1YX6 B;  3OJ3 A;  3KH0 A;  3ZRF A;  1WJN A;  1VD2 A;  4W9C A;  2M1M A;  3JSV A;  4GXB A;  1GG3 A;  5E6P A;  4FJV B;  2BWF A;  3PRZ A;  2FIF A;  2ZVN A;  3ENE A;  2LVO A;  4KIK B;  2ZEQ A;  4FN2 A;  5L95 C;  1Q1O A;  2FAZ A;  4A20 A;  4MGI E;  1F9J A;  1V49 A;  2GBK A;  4ANX A;  2HE7 A;  1T0Y A;  1WFY A;  3LJ3 A;  4K7S A;  1P0R A;  3B08 A;  3QWZ B;  3SDL C;  2JVC A;  2KK8 A;  4JIO U;  2KN5 A;  4EZJ A;  1XT9 B;  2IZV B;  3ZNI D;  3HHM A;  4K81 A;  3PLU A;  2V4L A;  5AZH A;  3U30 A;  1V5T A;  3VH4 B;  1P98 A;  3BIN A;  1RLF A;  1E8Z A;  1UGM A;  4JQW C;  4FA6 A;  4GU2 A;  4FHJ A;  3VUX A;  2WX1 A;  2KMA A;  1EF5 A;  2DHZ A;  4GIV A;  2OJR A;  3NS8 A;  5HKH A;  4LJO B;  2KVR A;  4AJW A;  4FJY A;  5J17 A;  2M0X A;  2M8S A;  2NCN A;  3M63 B;  2M4N A;  3A33 B;  4BKG A;  4A3P A;  3B0A A;  1I42 A;  4AWJ A;  2AWT A;  2LXC A;  4AP4 C;  3EFU A;  3M3J A;  5DCN A;  2CHX A;  3PRM B;  2V1Y A;  2M17 A;  2IO1 B;  2BGF A;  4LDT B;  1TGZ B;  2K39 A;  3MHS D;  1WMH B;  5DPS A;  3O65 B;  3PV1 A;  4PS3 A;  4II3 B;  3UIP B;  2C7H A;  4DDI D;  4WJP A;  3Q3F A;  2BKR B;  4PS7 A;  2L3Z A;  3ZO5 B;  1SE9 A;  1UH6 A;  2RR9 A;  3D32 A;  3L08 A;  2N9E B;  2K6D B;  3NY5 A;  4FLH A;  2DYO A;  1KLV A;  5G2N A;  3IVF A;  2KWU B;  2LGD A;  4BVU C;  2KQ7 A;  3UIN B;  2L05 A;  2KLC A;  3MTN B;  4RMA A;  1VCB A;  4FJZ A;  4HWI B;  4NPN A;  2L8J A;  2N1W A;  1LFD A;  3L54 A;  1ZKH A;  2JPH A;  3ZDM C;  1XQQ A;  2I1J A;  1WZ3 A;  3TL5 A;  2XEW A;  4GB9 A;  3V62 A;  3ZNZ B;  1A5R A;  2AEH A;  2MBQ A;  2DZI A;  2RSU A;  2MSE D;  4IG7 B;  4MGY E;  3AU4 A;  2K1F A;  4LJP B;  3L17 A;  1V86 A;  2D07 B;  2ZPY A;  2MQJ A;  2L7R A;  5D6J B;  4AOF A;  2EKE C;  1GC7 A;  2IY0 B;  1E7V A;  4MSQ B;  3WIM A;  2L76 A;  3JVZ X;  2K8H A;  3KW5 B;  2CHW A;  2ZZP B;  4MH0 E;  2FUH B;  2C5L C;  4HCN B;  4LCD E;  4GDL A;  2RD0 A;  4NY0 A;  2KJ6 A;  1NI2 A;  2ZNV C;  2J7Q B;  1UEL A;  5DPW A;  1KOT A;  3APC A;  2C7M B;  3EEC A;  2PPH A;  1E8Y A;  1GNU A;  2GBM A;  4NQK E;  3ZDT A;  3ZTD A;  4BBN C;  1OQY A;  3KUD B;  2LI5 A;  3DBL I;  2JF5 A;  4TUU A;  2D10 A;  4W9H A;  3QAQ A;  2J0K A;  3PRE A;  4WJO A;  3AI5 A;  4ICV A;  2IO3 B;  3ZKJ C;  3T9L A;  3DVN U;  1UBQ A;  1R4M I;  5AZF A;  2CS4 A;  3PVL A;  2XK5 A;  3U7D A;  1WI0 A;  2J0J A;  2L00 B;  3EHV A;  2KWC A;  1IPG A;  2L0F A;  3PHW B;  1AAR A;  3ML8 A;  1MG8 A;  4ZRI A;  1WM2 A;  3W1S A;  1C1Y B;  4EFO A;  5JH5 C;  4YL8 A;  2KNB A;  2N9P C;  3DBS A;  2ZPN A;  4EUT A;  2DAF A;  2CHZ A;  4KSK C;  2LRU A;  3A4S C;  3CST A;  1TZ1 A;  2MA9 B;  2KKC A;  4TKN A;  5D2M B;  3ZTC A;  4M8N A;  2LD9 A;  4IC7 B;  4WWN A;  3SD5 A;  2KAN A;  2LZ6 A;  5LXI B;  3W1Y A;  2KTF A;  1EO6 A;  3GOE A;  1S3S G;  2FCM A;  1WR1 A;  2ZCC A;  5C23 A;  2D2Q A;  2AYO B;  3ZLZ A;  2L0T A;  2NS5 A;  2N1V A;  3DOW A;  5FR6 A;  1V80 A;  1NDD A;  1YJ1 A;  3A9J A;  2UWQ A;  5IAA C;  1E8X A;  3JW0 X;  1C3T A;  1WX9 A;  3VTU A;  2KWV B;  2UYZ B;  3PS6 A;  2ZJD A;  2WDT B;  2LRW A;  2HTH A;  1WGG A;  2GBJ A;  2N4F A;  3R7Q A;  3H9D A;  1WXS A;  2KTR B;  3AXC A;  4IM3 A;  1PQS A;  1WIA A;  2IYD B;  4MSM B;  4GDK A;  4LDT D;  4W9K A;  2AL3 A;  1U4A A;  3L10 B;  3VUW A;  2O2V A;  3C0R B;  1P3Q U;  2NVU I;  2ZVO A;  1E7U A;  2KDF B;  3QQ8 B;  1BT0 A;  3W1S C;  1WXA A;  2JRI B;  5JHB A;  2KFK A;  2FCS A;  1M94 A;  3PSE B;  3OAW A;  4NJ7 A;  2R2Q A;  3LDZ E;  3U8Z A;  2KJR A;  3UF8 A;  3V61 A;  2JZZ A;  2MX2 A;  5GMV A;  4ASW C;  4WWP A;  4F7Z A;  3A9K A;  4GN1 A;  2KD0 A;  4MJS B;  3TIX A;  3BY4 B;  3SU8 X;  3VDZ A;  5D7G A;  4P7I A;  3KUC B;  5CHW A;  2GBN A;  5E6O A;  1KJT A;  2DZJ A;  3WAP A;  3TBL D;  3DBR I;  2PEA A;  5L83 A;  2FCQ A;  4DHJ B;  2EMS A;  2O6V B;  3T8M A;  2NBU A;  3X0W A;  2KX3 A;  3QIJ A;  2KC2 A;  3AUL A;  4MEL A;  4DWF A;  3UQA A;  2JT4 B;  2KQS A;  4ANW A;  2NBW B;  3NOB A;  3TJP A;  3WA0 A;  2IO2 B;  3DVN V;  3NZS A;  4IM0 A;  4EKU A;  2XK5 B;  1YQB A;  1LM8 B;  2FNJ B;  3AU5 A;  2CKH B;  4BOZ B;  4WWO A;  5CTR C;  1KM7 A;  4CHK A;  4XZ4 A;  2JUO A;  2YVC A;  2KZR A;  2LUE A;  3EC8 A;  3OJ4 B;  2JY6 A;  3A1Q B;  2KXJ A;  4B95 A;  3HM6 X;  3M95 A;  2LJ5 A;  4W9I A;  2N7D A;  4PYZ A;  2DEN B;  4GSW A;  2NPT A;  4NAW A;  4MGZ E;  4W9J A;  4I6N B;  1UZX B;  3I3T B;  3PZD A;  1Q0W B;  2HD5 B;  4I6P A;  3JSV B;  1QZE A;  2G4D B;  2MCN B;  1OGW A;  1WX7 A;  5KHO A;  2G45 B;  2NR2 A;  4X57 B;  1E8W A;  5EDS A;  1NBF C;  1UBI A;  2GMI C;  2BYF A;  2KDI A;  2WYQ A;  3K9O B;  2BF8 B;  5KHQ A;  3JYU A;  2BYV E;  4BKS D;  4IWQ A;  4KVG B;  1UD7 A;  1Y8R C;  3KYD D;  4HXD A;  4ZDV A;  2R2O A;  1WGH A;  1TBE A;  5TR5 A;  3IHP C;  3X23 A;  5AZG A;  2JXX A;  4JGH B;  4XC2 A;  1WH3 A;  3UQB A;  4FUL A;  1P1A A;  2D11 A;  2B3A A;  2KOX A;  1WE7 A;  4IW0 A;  3VVW B;  2KX0 A;  1GJZ A;  4FHK A;  4KDL B;  4IUM B;  2YLM A;  4M0W B;  1J8C A;  3IBE A;  3VTV A;  3ZUN A;  1L2N A;  4DK5 A;  4MEM A;  3QX1 A;  2D3G A;  2IY1 B;  3Q3J A;  4DXA B;  4M8M A;  4IWO A;  4ANV A;  4K1R B;  1OEY A;  3NZU A;  2JZ3 B;  5AEK B;  1YX5 B;  1V81 A;  3KVF B;  4HJK A;  3H1U A;  4HPL B;  3S2A A;  5DPT A;  2ZNV B;  2KFK B;  4DBG A;  4FBJ B;  1GUA B;  5G55 A;  2DYB A;  4CYE A;  3M62 B;  2C7N B;  2W9N A;  3PLV A;  3ECI A;  3RCZ A;  2MP2 A;  4CO7 A;  2KC1 A;  3A9K B;  3KYC D;  1GC6 A;  1V5O A;  3WAL A;  2DZK A;  2KHW B;  4OVV A;  3ML9 A;  1FXT B;  3DVG Y;  2K8C A;  4BBN F;  3RUL A;  3RZF A;  4WQO B;  2IO0 B;  4W9L A;  2LVQ A;  3RUI B;  3WAN A;  3QAR A;  3GZN I;  4W9D A;  2KLG A;  3MJW A;  2A4Z A;  4AUQ C;  4K7W A;  2MBH A;  2N7E A;  3CSF A;  1OTR B;  1ZGU B;  2K8B A;  2G3Q B;  2Z59 B;  2MLB A;  4MDK E;  4RM9 A;  2LGX A;  3VAW A;  5E6N A;  1RFA A;  2JRH A;  4KDI C;  4HLE A;  4BFR A;  3VTW A;  1ZW7 A;  2RPQ A;  1E5W A;  2CU1 A;  3DDC B;  4G3X B;  1WXM A;  2OOB B;  1S1Q B;  1YD8 U;  2DAJ A;  2V3S A;  5DPR A;  3VUY A;  3RZW C;  3DVG X;  4RM8 A;  4TQ0 A;  3N30 A;  3TMP B;  3R7R A;  3V60 A;  4GMV A;  4EZL A;  1K8R B;  2KDE B;  4KZ0 A;  2MW5 A;  1V2Y A;  3ZVV A;  5LXH A;  2JWZ A;  4HVB A;  4F8C B;  2DYM A;  5CHV C;  1WM3 A;  4BKS A;  2Z0D B;  4KSL C;  1WGY A;  2Z0E B;  2PJH A;  4EOY A;  2QHO A;  3PRP B;  1WYW B;  2FCN A;  2G4S A;  4DHJ D;  2O6V D;  1RRB A;  4OVU A;  4NAW B;  2NPT B;  2LGY A;  2Y5B B;  4JLC A;  3SHQ A;  4W9F A;  4GDL B;  3OLM D;  3R66 C; 
#chains in the Genus database with same CATH topology
 1OFF A;  2CR5 A;  4XGA B;  3H7S A;  3ZQ4 A;  2KDB A;  4HK2 A;  3BWU D;  2V9H A;  1QLB B;  2WXG A;  1GB4 A;  4GGQ A;  1LO5 D;  1WJ4 A;  2MBO A;  3E9S A;  1SGH A;  3L4P A;  4F1S A;  2KMC A;  3VQI A;  1D3Z A;  3L16 A;  4C80 A;  4R3D A;  4XDC A;  3I57 A;  4JX1 C;  2KAC A;  4WUR A;  1WJ6 A;  2FE8 A;  3N1Y C;  4BOS C;  4B9K A;  3T3N A;  3N32 A;  4W9E A;  1MHH E;  4ZRK A;  4NNJ B;  2N9L A;  1RM6 C;  2MBE A;  5GXG B;  2REX A;  4ACF A;  5HI1 A;  1GOZ A;  4RGN A;  2INC C;  2MP2 B;  1RAX A;  1F1H A;  5BMH A;  4HRO A;  3V6E B;  2KDM A;  4MGK E;  3PHX B;  2BKF A;  3IFW B;  4MJS A;  4A3O A;  1X1M A;  3ALB A;  1DOX A;  4O1N A;  5BYR A;  2VH2 A;  2DBY A;  3DPD A;  3MC0 B;  3HIZ A;  1I4H A;  4G11 A;  4NQL B;  4LNK A;  1PGB A;  4HDQ A;  4DHZ B;  4ICU A;  2ACZ B;  2K9X A;  1FFU A;  3AMZ A;  5T8I A;  1YMH E;  2NBV B;  5BO4 B;  2IGD A;  3DWG C;  1Z2M A;  2V3P A;  4WWM A;  4FAD A;  2IND C;  1QOF A;  1VR9 A;  3V6C B;  4KKJ A;  4WJN A;  4KV2 A;  3WAO A;  4WAA A;  2BWE S;  3W5V B;  3B9J A;  5LLI A;  3RD2 A;  4EE2 A;  4REZ A;  1WJU A;  4ANU A;  4A90 A;  3QA8 A;  1N5X A;  3KH0 A;  1PYW D;  1SE3 A;  1WJN A;  1VD2 A;  5E6P A;  1BXT A;  3ENE A;  4XWT A;  1C77 A;  4FN2 A;  5L95 C;  1Q1O A;  2XNA C;  1EM7 A;  1V49 A;  4ANX A;  1T0Y A;  1WFY A;  1QT9 A;  2KK8 A;  1TS5 A;  1QOB A;  4K81 A;  3TEX A;  2V4L A;  5AZH A;  3U30 A;  2ZW1 A;  1V5T A;  5EE0 A;  1RLF A;  2MJ3 A;  2GRI A;  1AN8 A;  1N61 A;  1UGM A;  2JZP A;  3FIL B;  1L4Z B;  1TS2 A;  4LJO B;  2FUG 1;  1MVK A;  1XLQ A;  2LXC A;  5IO9 A;  3M3J A;  2LEK A;  5TSS A;  4LDT B;  2K39 A;  1D6E C;  1WGK A;  4IDI A;  2PLP A;  3PV1 A;  2BT6 A;  3RNC C;  3UIP B;  3GE3 C;  2BKR B;  4PS7 A;  2L3Z A;  1SE9 A;  2RR9 A;  3D32 A;  2K6D B;  2DYO A;  4CQN A;  4BVU C;  2WXP A;  4AS1 A;  4ITK A;  2KLC A;  3MTN B;  1GAQ B;  1PGA A;  2L8J A;  2N1W A;  2INP E;  2B76 B;  3TL5 A;  2XEW A;  3GE8 C;  4GB9 A;  2BB6 A;  5BMG A;  2V0G A;  1A5R A;  2RSU A;  2JQR B;  1KFY B;  2D07 B;  1WSP A;  1R7S A;  4JWU C;  2IY0 B;  4MSQ B;  1JRP A;  5C2T B;  2E6X A;  4TMA B;  4A9A A;  4US9 A;  2C7M B;  3ZTD A;  3DBL I;  4TUU A;  1N63 A;  3UI3 A;  2WXL A;  3PRE A;  3ZJU A;  1D5Z C;  2J0J A;  2L00 B;  4YTP B;  4K3C A;  1SE4 A;  5D3I B;  2KWC A;  1IPG A;  4NZL B;  1V1P B;  2WLB A;  1MG8 A;  3ABV B;  3DBS A;  2DAF A;  1ZUD 2;  3RNA C;  3A4S C;  1TZ1 A;  2KKC A;  1VDV A;  3Q14 C;  1CZP A;  4WWN A;  3SD5 A;  1OQQ A;  2KAN A;  2LZ6 A;  1EO6 A;  4ZYS A;  1S3S G;  2ZCC A;  1SB3 C;  2L0T A;  2NS5 A;  3DOW A;  5FR6 A;  3A9J A;  3DBL B;  2BQQ A;  2WXN A;  1JW9 D;  1I7H A;  1C78 A;  3VTU A;  2LFI A;  1RFK A;  2KWV B;  2WDR B;  2BVC A;  2UYZ B;  3Q69 A;  2ZJD A;  2WDT B;  2LRW A;  3OWE B;  4MM3 B;  1WGG A;  1IGC A;  2GBJ A;  1JWB D;  1WXS A;  5G5H A;  4LDT D;  2JYE A;  1U4A A;  1PDX A;  2O2V A;  3Q6B A;  1E7U A;  3N20 C;  2JRI B;  4M00 A;  3B2G A;  4OVZ A;  1C4P A;  3PSE B;  3OAW A;  1FMA D;  5H92 C;  1B9R A;  5GMV A;  4P1B C;  1TKG A;  2GBN A;  3EGR A;  2DZJ A;  2OHF A;  3WAP A;  3TBL D;  4S0R A;  5D3D A;  1Y56 A;  5L83 A;  2FCQ A;  4DHJ B;  3T3O A;  2O6V B;  2GLS A;  4DWF A;  3AUL A;  2NMQ A;  3NOB A;  3TJP A;  3NZS A;  1LM8 B;  3SFD B;  1UNS A;  4USA A;  1CJE A;  5C3J B;  1KM7 A;  2KZR A;  3HM6 X;  2LJ5 A;  3EFC A;  1FFV A;  2N7D A;  4PYZ A;  4GSW A;  2NPT A;  3P1M A;  4W9J A;  3PZD A;  3WCQ A;  1OQR A;  3JSV B;  3RNB C;  3IT4 B;  2MCN B;  1WX7 A;  1JWS D;  1FIQ A;  2GMI C;  1UBI A;  1PFD A;  2BYF A;  2KDI A;  2BYV E;  4KVG B;  1I4R A;  1Y8R C;  3RNE C;  1KRH A;  2JWU A;  5EE9 A;  1D5X C;  3X23 A;  5AZG A;  2JXX A;  4JGH B;  1L5P A;  3UQB A;  4FUL A;  2B3A A;  4IW0 A;  4FHK A;  3U7Z A;  1J8C A;  4DK5 A;  2L32 A;  3QX1 A;  2D3G A;  2WXR A;  3N1X C;  4RH6 A;  2M0A A;  2ZW0 A;  1V81 A;  5AUI A;  3H1U A;  3S2A A;  1GUA B;  3M62 B;  1AWD A;  2W9N A;  4OZC A;  2ONQ A;  1FRD A;  1V5O A;  3RNF C;  3ML9 A;  3DVG Y;  2K8C A;  3ZXR A;  4YWG G;  2WS3 B;  2A4Z A;  4K7W A;  2WU2 B;  4YTM B;  5E6N A;  1RFA A;  4HLE A;  1K51 A;  4BFR A;  3VTW A;  1E10 A;  3DDC B;  1MI0 A;  1K52 A;  2OOB B;  2V3S A;  1ACC A;  1FNW A;  4C7Z A;  3TEW A;  4KGS A;  3R7R A;  4EZL A;  4GMV A;  1K8R B;  2MW5 A;  1V2Y A;  1JRO A;  2DYM A;  4ZHP A;  4KSL C;  1ZDV A;  2PJH A;  1WYW B;  4DHJ D;  2O6V D;  4OVU A;  2NTT A;  2NPT B;  4JLC A;  4W9F A;  3R66 C;  1FCL A;  2WX0 A;  3NS1 A;  3H7P A;  2BPS A;  2H88 B;  2Q5W D;  3PZ7 A;  3ONS A;  1EF1 A;  1TKY A;  1HZ6 A;  1E0Z A;  1L7Y A;  2IDY A;  2V4I B;  4PYU A;  4ZYN A;  3QJZ A;  1WE6 A;  3N9Y C;  4KIK A;  3VXW A;  2KJH B;  1E6E B;  3I9V 1;  1Z5S B;  3MJ5 A;  4GOC A;  3A4R A;  4E74 A;  3UIO B;  2EKI A;  1HTO A;  2IGG A;  2IPK D;  2XBB C;  3PZ8 A;  1KH0 A;  2CU3 A;  4JPS A;  3TCA A;  3QK0 A;  4PS8 A;  2MBB B;  1A70 A;  1HE8 A;  3Q8E A;  2RGF A;  1XD3 B;  2RDG A;  2YEP B;  2KO3 A;  2X38 A;  4S17 A;  3EA6 A;  3P2B A;  4EZK A;  5LNK 1;  2K25 A;  3ZNH B;  3UGB B;  4ZRJ A;  5JHA A;  1I35 A;  1ESF A;  5IOI A;  1V9J A;  1WMH A;  4B6W A;  2ASQ A;  2D5G A;  3QC8 B;  1WRI A;  4E71 A;  3DBH I;  3Q3O C;  1RWS A;  1V1O A;  2QMT A;  2K6Q A;  4BAX A;  4GDK B;  1J0G A;  3K9P B;  4DQO C;  2KMM A;  1GPX A;  5BYQ A;  3ZIM A;  1C9F A;  3TUO A;  2EMT A;  1B1Z A;  2JSV X;  3R3M A;  1WF9 A;  4EEW A;  4G50 A;  2IBI B;  4LK0 M;  1WY8 A;  2DZM A;  5IA7 A;  2C60 A;  1TTN A;  3H7P B;  3ZXV A;  1ENF A;  1L0V B;  5EE1 A;  2M1M A;  4FJV B;  2BWF A;  1DOI A;  2FIF A;  2ZVN A;  1ZP0 B;  3GP7 A;  4J3O D;  2CJN A;  3U4E G;  4KIK B;  3DBH B;  3LB8 C;  1F9J A;  2V3N A;  3SDL C;  2JVC A;  4JIO U;  2KN5 A;  1WXQ A;  3ZNI D;  3DHH C;  1BUI C;  2WXH A;  3PLU A;  1P98 A;  3Q8A A;  3U2S C;  1XLN A;  4FHJ A;  2KMA A;  4GIV A;  3NS8 A;  2KVR A;  4AJW A;  4FJY A;  5J17 A;  2M4N A;  3A33 B;  4BKG A;  4A3P A;  1L0Y B;  1VZ6 A;  1I42 A;  2AWT A;  1EWY C;  3ZJV A;  1ZDX A;  2IO1 B;  4P16 A;  1STE A;  3AN1 A;  3MHS D;  1WMH B;  1VRA B;  5FR3 A;  3O65 B;  4PS3 A;  2GI9 A;  4K3B A;  2C7H A;  4DDI D;  3ZO5 B;  1UH6 A;  1T6B X;  4FLH A;  1KLV A;  1QF6 A;  3IVF A;  4RGT A;  3LYY A;  4NJC A;  1I4P A;  3UIN B;  1VCB A;  2Y5C A;  4HEA 1;  2I1J A;  1HTQ A;  1WZ3 A;  1TKE A;  3V62 A;  1GB1 A;  3MHZ A;  4LJP B;  1F52 A;  1V86 A;  3TSS A;  2MQJ A;  5D6J B;  4AOF A;  1V97 A;  3AE3 B;  3KWL A;  3KW5 B;  4RGO S;  2C5L C;  1RYJ A;  3W5U B;  3VR8 B;  1L6V A;  4IKG A;  2ZNV C;  2J7Q B;  3APC A;  1GNU A;  2M56 B;  4W9H A;  2D10 A;  3AI5 A;  3ZKJ C;  1UBQ A;  2LUM A;  4JE3 B;  2IJ0 A;  3EHV A;  2D3A A;  2J4X A;  3PHW B;  3ML8 A;  3GS2 A;  1WM2 A;  1XCQ L;  3W1S A;  1C4C A;  2KNB A;  1UUP A;  2MH7 A;  2X8X X;  2MHJ A;  4EUT A;  4WIP A;  1E9M A;  1PGX A;  4ZHO A;  1ZE3 D;  2BBC A;  2CHZ A;  2LRU A;  3CST A;  2MA9 B;  1HZ5 A;  2BB5 A;  4TKN A;  2EEL A;  2D3B A;  1KTK A;  2LD9 A;  5LXI B;  2KTF A;  3RMK C;  2N1V A;  3VR9 B;  1NDD A;  1E7P B;  5IAA C;  2JU6 X;  1VZ7 A;  3HRD D;  3R7Q A;  4IM3 A;  5IP4 D;  3Q3M C;  4MSM B;  1F2R C;  2WXO A;  3R8B A;  2AL3 A;  1T3Q A;  4IOI E;  4MT5 A;  2K0P A;  3VUW A;  3AEB B;  2ZVO A;  1WXA A;  1HQR D;  5JHB A;  1M94 A;  2GB1 A;  3U8Z A;  3LDZ E;  3V61 A;  3A9K A;  4GN1 A;  2KD0 A;  4MJS B;  3SU8 X;  3NVW A;  2JXT A;  1TYG B;  5CHW A;  1PUT A;  5E6O A;  1AYF A;  1I4X A;  4ARI A;  2KVZ A;  2QEJ C;  3Q8F A;  4BZA A;  4L2Y A;  2EMS A;  4RF0 A;  2NBU A;  1NVI D;  2KQS A;  2WXF A;  4EKU A;  2IO2 B;  4IM0 A;  2LHE A;  1YQB A;  1FXI A;  2FNJ B;  2G1E A;  1HEZ E;  4XZ4 A;  3P4P B;  3URY A;  3RPF C;  3OJ4 B;  2KXJ A;  4B95 A;  3M95 A;  3MFG A;  3B2F A;  4N59 A;  4I6N B;  1QKZ A;  2LGS A;  1ET9 A;  1DOY A;  2BW2 A;  2G45 B;  2NR2 A;  5IN7 A;  3K9O B;  2J52 A;  2WYQ A;  1TJE A;  2BF8 B;  3W2D A;  1YN5 A;  4BKS D;  1UWX A;  2QDF A;  3KYD D;  2R2O A;  3MP9 A;  3Q2A C;  1P1A A;  2W82 A;  1WE7 A;  2KX0 A;  2LJI A;  4KGR A;  3VTV A;  3ZUN A;  3NVY A;  1L2N A;  4DXG A;  1BML C;  2IY1 B;  5BMI A;  4K1R B;  2JZ3 B;  5AEK B;  1TIF A;  2ZNV B;  5G55 A;  2DYB A;  3ECI A;  4YXD B;  4A55 A;  5H8Y E;  2KC1 A;  3A9K B;  3WAL A;  1GC6 A;  3AE1 B;  4OVV A;  4GLS C;  2TSS A;  4WQO B;  4W9L A;  1T5X D;  4W9D A;  3MJW A;  1VLB A;  1OTR B;  2PVO D;  4HKQ A;  4HKZ E;  2KYW A;  5FK9 C;  2KT7 A;  4MH8 A;  1F2R I;  1VJK A;  2RPQ A;  1E5W A;  3Q3N C;  1WXM A;  3RNG C;  3TEZ A;  3VUY A;  4M01 A;  1TZO A;  3V05 A;  4RM8 A;  4TQ0 A;  2E3T A;  1N60 A;  2KDE B;  2I2Y A;  3AEC B;  4LNF A;  1JWU D;  4F8C B;  2QHO A;  3PRP B;  2G4S A;  1N62 A;  2Y5B B;  1WZ0 A;  1ISN A;  2LAS A;  1JAL A;  3H6N A;  1FO4 A;  2N9X A;  2AL6 A;  4TV3 A;  1KF6 B;  1Q5W B;  1SIJ A;  2ZCB A;  4DDG D;  3VFK A;  3PPA A;  2WP9 B;  2GOW A;  3CMM B;  1CMX B;  1FXA A;  3NG0 A;  3RT3 B;  4C4V A;  1J19 A;  4NJ6 A;  2HJ8 A;  5BYS A;  2VZK B;  2KWD A;  2WXJ A;  1H4R A;  2DWQ A;  3AH7 A;  3HK0 A;  4KZC A;  1WGR A;  3CF6 E;  2LWP A;  4N58 A;  3ZRC A;  4YT0 B;  4WAF A;  2KTR A;  5J18 A;  1V8C A;  3APF A;  1WXV A;  1SIF A;  3PTF C;  1LXD A;  3PGE A;  1IBX A;  3L13 A;  4D2K A;  3VH3 B;  4IWP A;  1XLO A;  4DHZ E;  3A9J B;  4IM2 A;  4YSY B;  1JRU A;  1QQR A;  4J6I A;  2QSD A;  2VH1 A;  1LGR A;  1XCT L;  1CK1 A;  3QCA A;  3IAS 1;  4PT5 A;  5D94 A;  3IG3 A;  3RYT A;  3O13 A;  1TT5 B;  2WXM A;  4Q2J A;  4URK A;  3P4S B;  4G0N B;  4I6L B;  3R2T A;  3I63 C;  2FID A;  3HM3 A;  2PE9 A;  2O2V B;  3ZNG C;  4XWW A;  2GBR A;  5JXV A;  3BVZ A;  4HPP A;  3NJT A;  1XXG A;  4II2 B;  4TSS A;  2PE6 B;  1DGJ A;  3A1Q A;  4W9G A;  1EU3 A;  1SSN A;  3AE4 B;  4GXB A;  1GG3 A;  2ICI A;  3CIR B;  3PRZ A;  1L6U A;  3BK1 A;  2LVO A;  3AEG B;  4LLG M;  2ZEQ A;  4B0M A;  3P63 A;  5G5G A;  4A20 A;  4MGI E;  2HE7 A;  3MC8 A;  4EZJ A;  1XT9 B;  2IZV B;  4ZOH C;  2Z8L A;  1YQ4 B;  3HVD A;  1E8Z A;  4OZA A;  1J7C A;  4GU2 A;  1TS4 A;  2WX1 A;  1EF5 A;  2DHZ A;  2OJR A;  5HKH A;  2M8S A;  4AP4 C;  1FCC C;  5DCN A;  2VZK D;  2HTM E;  2M17 A;  1L0X B;  2BGF A;  1TGZ B;  2H89 B;  2L1A A;  4RGM A;  4II3 B;  4WJP A;  3Q3F A;  1JWA D;  3NY5 A;  2W55 A;  5G2N A;  2KWU B;  2HJ1 A;  4RMA A;  4FJZ A;  4NPN A;  1JML A;  3L54 A;  1D5M C;  1ZKH A;  2JPH A;  1UF0 A;  3ZNZ B;  3NZ3 A;  2MBQ A;  2DZI A;  2MSE D;  2K1F A;  3L17 A;  3BYY B;  1JWM D;  4OW0 A;  1GC7 A;  1E7V A;  2L76 A;  4PK1 A;  2CHW A;  2JX5 A;  2ZZP B;  2FUH B;  4HCN B;  4LCD E;  2KQ4 X;  4GDL A;  4NY0 A;  4KX6 B;  1JQ4 A;  1L4D B;  1NI2 A;  2RMM A;  3C8Y A;  5DPW A;  2BS4 B;  2PPH A;  1E8Y A;  3ZDT A;  4BBN C;  3KUD B;  2INN E;  3QAQ A;  2J0K A;  3P4R B;  1D4B A;  1FM0 D;  3DVN U;  2RDH A;  1R4M I;  1TY0 A;  2CS4 A;  3MC9 A;  3U7D A;  1WI0 A;  2L0F A;  1AAR A;  1C1Y B;  4EFO A;  2ZPN A;  1KLG D;  3IT6 B;  2N7J A;  2W54 A;  3KWV A;  3ZTC A;  2JYT A;  4M8N A;  4JWS C;  2AQ2 B;  3W1Y A;  3ZLZ A;  1FEH A;  3DHI C;  1QIL A;  3JW0 X;  3DWM A;  1ROE A;  3RI7 C;  2BTE A;  1C3T A;  2L83 A;  1N6Z A;  1WX9 A;  4ZRQ A;  1FD6 A;  3PS6 A;  2N9K A;  1R4M B;  2N4F A;  2ON8 A;  3H9D A;  1FPY A;  2K22 A;  4M0W A;  3AXC A;  1PQS A;  2IYD B;  3AV8 A;  3NVZ A;  3C0R B;  2KDF B;  3W1S C;  1BT0 A;  1K50 A;  2FCS A;  3ZYY X;  4NJ7 A;  3UF8 A;  2UU7 A;  2N0S B;  4ASW C;  4WWP A;  3VDZ A;  5D7G A;  4P7I A;  5EE3 A;  2PIA A;  4P6V F;  3BZD B;  1NI3 A;  4RCO A;  4OZB A;  2PMV A;  4DXF A;  3X0W A;  2KX3 A;  4MEL A;  4H2A A;  3UQA A;  2WDV B;  4ANW A;  2NBW B;  3WA0 A;  1MFW A;  3AU5 A;  3C19 A;  3NVV A;  1YJI A;  4HRS A;  2CKH B;  4BOZ B;  4WWO A;  4CHK A;  3AE8 B;  4US8 A;  2JUO A;  4KGT A;  1KLU D;  4ZRP A;  3P42 A;  2LUE A;  3EC8 A;  3N1Z C;  2JY6 A;  4W9I A;  3EUB 2;  2WXI A;  3FIL A;  2BS3 B;  3AEE B;  2DEN B;  4NAW A;  1Q0W B;  2HD5 B;  1HA5 A;  2G4D B;  2HDE A;  3BVG A;  1OGW A;  2KAJ A;  5KHO A;  1E8W A;  2KN4 A;  5EDS A;  1NBF C;  4A8X C;  3IAM 1;  4HXD A;  4ZDV A;  1TBE A;  2MEK A;  1ET6 A;  1SEB D;  3BK2 A;  1WH3 A;  2SAK A;  2D11 A;  2KOX A;  1ZPS A;  3VVW B;  1GJZ A;  1SBB B;  4RFB A;  4KDL B;  4C56 C;  4IUM B;  4M0W B;  3IBE A;  4YTN B;  4MEM A;  2WQY B;  1UWM A;  3Q3J A;  4DXA B;  4M8M A;  4IWO A;  4ANV A;  1OEY A;  2WDQ B;  3KVF B;  4HJK A;  2WHI A;  2W3R A;  5DPT A;  4CYE A;  1YQ3 B;  5E6J A;  3FC4 A;  3PLV A;  3RCZ A;  3AB5 A;  2DZK A;  2KHW B;  1FXT B;  3RUL A;  3RZF A;  2LHD A;  3GZN I;  4C7Y A;  2MBH A;  3CSF A;  2Z59 B;  1ZGU B;  2K8B A;  2G3Q B;  4RM9 A;  2MLB A;  2LGX A;  1ZOY B;  5HG2 A;  4KDI C;  1ZW7 A;  2CU1 A;  4LNN A;  1S1Q B;  1YD8 U;  4C00 A;  2DAJ A;  5DPR A;  1YN3 A;  3RZW C;  3DVG X;  3OG5 A;  3N30 A;  3TMP B;  3V60 A;  5HFY A;  3ZVV A;  1AW7 A;  5LXH A;  2JWZ A;  1V1P A;  5CHV C;  1WM3 A;  2Z0D B;  4EOY A;  1P7F A;  1XF5 L;  4NAW B;  3SHQ A;  3AE5 B;  3J9C A;  4WH4 A;  4JL9 A;  2WGS A;  1T0R C;  2VRR B;  5CHF A;  5J2R A;  2BYE A;  3CWI A;  1OEY J;  3ZW3 A;  4N9F 4;  1DYQ A;  3GZN B;  2WXQ A;  2DX5 B;  2J0M A;  2W3S A;  1V6E A;  2MRP A;  4HCP B;  1R4N I;  1G6J A;  2MWS B;  4FXC A;  2MJD A;  4UDU C;  3B1L X;  2LXA A;  3BVM A;  1IP9 A;  2WXK A;  4AJY B;  4MM3 A;  3NUH B;  5C1Z A;  4HPM B;  2A5U A;  1C4A A;  3VRB B;  1T0S C;  1WRD B;  4HDO A;  3DQV A;  3WAM A;  1SJE D;  1H8C A;  1IYF A;  2Y3A A;  5JZE B;  2WNM A;  3PT2 B;  2LVP A;  4KKI A;  1WX8 A;  4L1B A;  1Q10 A;  1EUV B;  2D3C A;  1YIW A;  3V3X A;  4WJQ A;  3N3K B;  4TQ1 A;  4HJG E;  3PO0 A;  1E90 A;  5CX3 A;  1WGD A;  2AQ1 B;  2C9W B;  1R4N B;  3RN9 C;  4XX5 A;  3KUZ A;  1I4Q A;  4XYC A;  4E3C A;  2O6V A;  3VHT C;  3APD A;  3NHE B;  3L0W B;  1LQB A;  1EU4 A;  3DCG A;  3I5J C;  4K7U A;  2I1K A;  1P9D U;  2WWZ A;  2KFJ A;  1MPE A;  1K53 A;  3QHT A;  1VZ8 A;  2J53 A;  1CQV A;  2OED A;  5HHD G;  1WR6 E;  2FBW B;  4BKT A;  1YX6 B;  3OJ3 A;  4L23 A;  3ZRF A;  4W9C A;  3JSV A;  2K3U A;  3AE7 B;  1NEK B;  1NYR A;  3DHG C;  2FAZ A;  4YSZ B;  2GBK A;  4K7S A;  3LJ3 A;  1P0R A;  3B08 A;  3QWZ B;  3SFE B;  4RF1 A;  3HHM A;  3AE2 B;  1QOA A;  2Y5P A;  3VH4 B;  2QCZ A;  3BIN A;  4JQW C;  4FA6 A;  1SE2 A;  3VUX A;  2RPV A;  1YN4 A;  1IUE A;  2M0X A;  2NCN A;  3M63 B;  2LGI A;  2IGH A;  2G9H D;  3B0A A;  4AWJ A;  3EFU A;  4NAM A;  3GB1 A;  1ZXH A;  2CHX A;  3PRM B;  1QOG A;  2V1Y A;  4LTU A;  5MPO A;  2DNF A;  5DPS A;  3AED B;  1XO3 A;  4XE0 A;  2CJO A;  1NYQ A;  3L08 A;  2N9E B;  3IXS A;  1J7A A;  2LGD A;  2KQ7 A;  3AE9 B;  1HXY D;  2L05 A;  4LNI A;  4HWI B;  2PKO A;  4A6Q A;  1LFD A;  2RDB C;  3ZDM C;  1XQQ A;  4AQ7 A;  3KLS X;  3ZGZ A;  5FKA C;  2AEH A;  4IG7 B;  4MGY E;  3AU4 A;  2YEP F;  2L52 A;  2ZPY A;  1SF0 A;  2L7R A;  2EKE C;  3WIM A;  2WU5 B;  1I4G A;  3JVZ X;  2K8H A;  4MH0 E;  1ZXI A;  2RD0 A;  3SR6 A;  2KJ6 A;  1T0Q C;  2QIL A;  1UEL A;  1KOT A;  3EEC A;  2QIE B;  3NRZ A;  2GBM A;  4NQK E;  3U52 E;  1OQY A;  2LI5 A;  2JF5 A;  4WJO A;  4ICV A;  2IO3 B;  3T9L A;  4WQM A;  2PVG C;  5AZF A;  3PVL A;  2XK5 A;  4M02 A;  1SXT A;  4ZRI A;  2QC8 A;  2I38 A;  5JH5 C;  4YL8 A;  3H8H A;  2N9P C;  4QAY A;  3LXF A;  4KSK C;  1WWT A;  3AEA B;  3E56 A;  1XLP A;  5D2M B;  1C79 A;  4IC7 B;  3BYT B;  2K5P A;  3GOE A;  2FCM A;  1WR1 A;  5C23 A;  2D2Q A;  2AYO B;  1V80 A;  1YJ1 A;  3Q8B A;  2UWQ A;  4C4V B;  1E8X A;  4RNA A;  1C76 A;  3SEB A;  2AQ3 B;  2HTH A;  2KTR B;  1WIA A;  4GDK A;  4W9K A;  3L10 B;  3BII D;  1P3Q U;  2NVU I;  5AUK A;  3QQ8 B;  1IBX B;  2KFK A;  1F77 A;  2R2Q A;  2KJR A;  1NEN B;  2JZZ A;  2MX2 A;  1FRR A;  4F7Z A;  3TIX A;  4MAC A;  3BY4 B;  4N6E B;  3FAH A;  3HUI A;  3KUC B;  1M4V A;  1KJT A;  3DBR I;  2PEA A;  1WYG A;  1YOV B;  3T8M A;  5IKC M;  3QIJ A;  2KC2 A;  4LNO A;  2JT4 B;  2M19 A;  3DVN V;  2QJL A;  3W9C B;  2XK5 B;  2PTL A;  3HVZ A;  3Q8C A;  3RFZ B;  5CTR C;  2YVC A;  3AM9 A;  4P1C C;  3VRA B;  3A1Q B;  5I4D A;  4MGZ E;  1UZX B;  3I3T B;  4I6P A;  1QZE A;  1EWC A;  3AE6 B;  1MHX A;  4X57 B;  5KHQ A;  3JYU A;  4IWQ A;  1UD7 A;  2LMC A;  3DBR B;  4B0E A;  1WGH A;  5TR5 A;  3IHP C;  4XC2 A;  1N5W A;  2SEB D;  1MG4 A;  1MJD A;  1J7B A;  1F0Z A;  3ZJT A;  3AEF B;  1IGD A;  2YLM A;  2XN9 C;  2BYT A;  3FKY A;  1TS3 A;  2OJW A;  1SJH D;  3NZU A;  1YX5 B;  3ETR A;  2NTS A;  4HPL B;  4ARC A;  2KFK B;  4DBG A;  2BS2 B;  4FBJ B;  1YJJ A;  4XDD A;  2C7N B;  1JCK B;  4CO7 A;  2MP2 A;  3KYC D;  3R2I A;  1FNV A;  2MJE A;  4BBN F;  3WAN A;  1TY2 A;  2IO0 B;  2LVQ A;  3RUI B;  3QAR A;  4OHJ A;  2KLG A;  4AUQ C;  2DLB A;  2N7E A;  1UGJ A;  4MDK E;  3VAW A;  2R61 A;  2AX5 A;  2J42 A;  2JRH A;  3KQ4 A;  3P4Q B;  4G3X B;  1XEE A;  1P7E A;  2PW9 A;  4YSX B;  1FNU A;  4KZ0 A;  4HVB A;  1YNT E;  4BKS A;  1WGY A;  2Z0E B;  2FCN A;  1RRB A;  2LGY A;  3TEY A;  4GDL B;  3OLM D; 
#chains in the Genus database with same CATH homology
 1WZ0 A;  2WX0 A;  1ISN A;  2CR5 A;  2LAS A;  3H7S A;  3H6N A;  4JL9 A;  2KDB A;  3H7P A;  2BPS A;  4HK2 A;  2VRR B;  5CHF A;  3ONS A;  2BYE A;  1EF1 A;  5J2R A;  1OEY J;  2N9X A;  3ZW3 A;  1L7Y A;  2AL6 A;  4N9F 4;  4TV3 A;  4GGQ A;  1Q5W B;  1WJ4 A;  2ZCB A;  4PYU A;  2MBO A;  4ZYN A;  4DDG D;  3QJZ A;  1WE6 A;  2DX5 B;  2J0M A;  1SGH A;  3VFK A;  1V6E A;  4KIK A;  2KMC A;  3VXW A;  2KJH B;  4F1S A;  2MRP A;  3PPA A;  1Z5S B;  2GOW A;  3CMM B;  4HCP B;  1CMX B;  3VQI A;  3RT3 B;  1R4N I;  4GOC A;  1D3Z A;  3A4R A;  1G6J A;  4E74 A;  1J19 A;  3L16 A;  2HJ8 A;  4NJ6 A;  3UIO B;  2MWS B;  1H4R A;  2XBB C;  3B1L X;  2LXA A;  3HK0 A;  1IP9 A;  4KZC A;  1WGR A;  1WJ6 A;  3TCA A;  4AJY B;  3CF6 E;  3QK0 A;  4MM3 A;  2LWP A;  4PS8 A;  4BOS C;  2MBB B;  4B9K A;  3ZRC A;  3N32 A;  5C1Z A;  1HE8 A;  4HPM B;  2KTR A;  2A5U A;  5J18 A;  2RGF A;  4W9E A;  3APF A;  1WXV A;  1WRD B;  4HDO A;  1XD3 B;  3DQV A;  4ZRK A;  4NNJ B;  3WAM A;  1SIF A;  3PTF C;  1H8C A;  1IYF A;  2MBE A;  1LXD A;  2KO3 A;  5JZE B;  3PGE A;  2REX A;  3PT2 B;  3P2B A;  4EZK A;  3L13 A;  2LVP A;  2MP2 B;  2K25 A;  3VH3 B;  1WX8 A;  3ZNH B;  4IWP A;  3UGB B;  1RAX A;  4ZRJ A;  1EUV B;  5JHA A;  4DHZ E;  1YIW A;  3A9J B;  3V6E B;  1I35 A;  4WJQ A;  3N3K B;  4IM2 A;  4MGK E;  3PHX B;  4TQ1 A;  1JRU A;  1V9J A;  1WMH A;  4J6I A;  1E90 A;  2BKF A;  3IFW B;  4MJS A;  5CX3 A;  4A3O A;  4B6W A;  1WGD A;  2ASQ A;  1X1M A;  3ALB A;  3QC8 B;  3QCA A;  4E71 A;  3DBH I;  2C9W B;  5D94 A;  3IG3 A;  3RYT A;  3DPD A;  2K6Q A;  4XX5 A;  3HIZ A;  3KUZ A;  4URK A;  4G11 A;  4G0N B;  4NQL B;  4E3C A;  4GDK B;  2O6V A;  4I6L B;  3VHT C;  4HDQ A;  4DHZ B;  2FID A;  1J0G A;  4ICU A;  3APD A;  3HM3 A;  2PE9 A;  3K9P B;  2O2V B;  3ZNG C;  2GBR A;  3NHE B;  3L0W B;  1LQB A;  3ZIM A;  3DCG A;  4K7U A;  2EMT A;  2I1K A;  2NBV B;  5BO4 B;  1Z2M A;  3R3M A;  1P9D U;  4FAD A;  1WF9 A;  4II2 B;  2WWZ A;  4EEW A;  4G50 A;  3V6C B;  4WJN A;  4KV2 A;  2PE6 B;  3WAO A;  2IBI B;  2KFJ A;  4WAA A;  2BWE S;  3QHT A;  1WY8 A;  5LLI A;  3RD2 A;  3A1Q A;  2DZM A;  4W9G A;  5IA7 A;  1WR6 E;  1WJU A;  4ANU A;  4BKT A;  2C60 A;  1TTN A;  3H7P B;  3QA8 A;  1YX6 B;  3OJ3 A;  3KH0 A;  3ZRF A;  1WJN A;  1VD2 A;  4W9C A;  2M1M A;  3JSV A;  4GXB A;  1GG3 A;  5E6P A;  4FJV B;  2BWF A;  3PRZ A;  2FIF A;  2ZVN A;  3ENE A;  2LVO A;  4KIK B;  2ZEQ A;  4FN2 A;  5L95 C;  1Q1O A;  2FAZ A;  4A20 A;  4MGI E;  1F9J A;  1V49 A;  2GBK A;  4ANX A;  2HE7 A;  1T0Y A;  1WFY A;  3LJ3 A;  4K7S A;  1P0R A;  3B08 A;  3QWZ B;  3SDL C;  2JVC A;  2KK8 A;  4JIO U;  2KN5 A;  4EZJ A;  1XT9 B;  2IZV B;  3ZNI D;  3HHM A;  4K81 A;  3PLU A;  2V4L A;  5AZH A;  3U30 A;  1V5T A;  3VH4 B;  1P98 A;  3BIN A;  1RLF A;  1E8Z A;  1UGM A;  4JQW C;  4FA6 A;  4GU2 A;  4FHJ A;  3VUX A;  2WX1 A;  2KMA A;  1EF5 A;  2DHZ A;  4GIV A;  2OJR A;  3NS8 A;  5HKH A;  4LJO B;  2KVR A;  4AJW A;  4FJY A;  5J17 A;  2M0X A;  2M8S A;  2NCN A;  3M63 B;  2M4N A;  3A33 B;  4BKG A;  4A3P A;  3B0A A;  1I42 A;  4AWJ A;  2AWT A;  2LXC A;  4AP4 C;  3EFU A;  3M3J A;  5DCN A;  2CHX A;  3PRM B;  2V1Y A;  2M17 A;  2IO1 B;  2BGF A;  4LDT B;  1TGZ B;  2K39 A;  3MHS D;  1WMH B;  5DPS A;  3O65 B;  3PV1 A;  4PS3 A;  4II3 B;  3UIP B;  2C7H A;  4DDI D;  4WJP A;  3Q3F A;  2BKR B;  4PS7 A;  2L3Z A;  3ZO5 B;  1SE9 A;  1UH6 A;  2RR9 A;  3D32 A;  3L08 A;  2N9E B;  2K6D B;  3NY5 A;  4FLH A;  2DYO A;  1KLV A;  5G2N A;  3IVF A;  2KWU B;  2LGD A;  4BVU C;  2KQ7 A;  3UIN B;  2L05 A;  2KLC A;  3MTN B;  4RMA A;  1VCB A;  4FJZ A;  4HWI B;  4NPN A;  2L8J A;  2N1W A;  1LFD A;  3L54 A;  1ZKH A;  2JPH A;  3ZDM C;  1XQQ A;  2I1J A;  1WZ3 A;  3TL5 A;  2XEW A;  4GB9 A;  3V62 A;  3ZNZ B;  1A5R A;  2AEH A;  2MBQ A;  2DZI A;  2RSU A;  2MSE D;  4IG7 B;  4MGY E;  3AU4 A;  2K1F A;  4LJP B;  3L17 A;  1V86 A;  2D07 B;  2ZPY A;  2MQJ A;  2L7R A;  5D6J B;  4AOF A;  2EKE C;  1GC7 A;  2IY0 B;  1E7V A;  4MSQ B;  3WIM A;  2L76 A;  3JVZ X;  2K8H A;  3KW5 B;  2CHW A;  2ZZP B;  4MH0 E;  2FUH B;  2C5L C;  4HCN B;  4LCD E;  4GDL A;  2RD0 A;  4NY0 A;  2KJ6 A;  1NI2 A;  2ZNV C;  2J7Q B;  1UEL A;  5DPW A;  1KOT A;  3APC A;  2C7M B;  3EEC A;  2PPH A;  1E8Y A;  1GNU A;  2GBM A;  4NQK E;  3ZDT A;  3ZTD A;  4BBN C;  1OQY A;  3KUD B;  2LI5 A;  3DBL I;  2JF5 A;  4TUU A;  2D10 A;  4W9H A;  3QAQ A;  2J0K A;  3PRE A;  4WJO A;  3AI5 A;  4ICV A;  2IO3 B;  3ZKJ C;  3T9L A;  3DVN U;  1UBQ A;  1R4M I;  5AZF A;  2CS4 A;  3PVL A;  2XK5 A;  3U7D A;  1WI0 A;  2J0J A;  2L00 B;  3EHV A;  2KWC A;  1IPG A;  2L0F A;  3PHW B;  1AAR A;  3ML8 A;  1MG8 A;  4ZRI A;  1WM2 A;  3W1S A;  1C1Y B;  4EFO A;  5JH5 C;  4YL8 A;  2KNB A;  2N9P C;  3DBS A;  2ZPN A;  4EUT A;  2DAF A;  2CHZ A;  4KSK C;  2LRU A;  3A4S C;  3CST A;  1TZ1 A;  2MA9 B;  2KKC A;  4TKN A;  5D2M B;  3ZTC A;  4M8N A;  2LD9 A;  4IC7 B;  4WWN A;  3SD5 A;  2KAN A;  2LZ6 A;  5LXI B;  3W1Y A;  2KTF A;  1EO6 A;  3GOE A;  1S3S G;  2FCM A;  1WR1 A;  2ZCC A;  5C23 A;  2D2Q A;  2AYO B;  3ZLZ A;  2L0T A;  2NS5 A;  2N1V A;  3DOW A;  5FR6 A;  1V80 A;  1NDD A;  1YJ1 A;  3A9J A;  2UWQ A;  5IAA C;  1E8X A;  3JW0 X;  1C3T A;  1WX9 A;  3VTU A;  2KWV B;  2UYZ B;  3PS6 A;  2ZJD A;  2WDT B;  2LRW A;  2HTH A;  1WGG A;  2GBJ A;  2N4F A;  3R7Q A;  3H9D A;  1WXS A;  2KTR B;  3AXC A;  4IM3 A;  1PQS A;  1WIA A;  2IYD B;  4MSM B;  4GDK A;  4LDT D;  4W9K A;  2AL3 A;  1U4A A;  3L10 B;  3VUW A;  2O2V A;  3C0R B;  1P3Q U;  2NVU I;  2ZVO A;  1E7U A;  2KDF B;  3QQ8 B;  1BT0 A;  3W1S C;  1WXA A;  2JRI B;  5JHB A;  2KFK A;  2FCS A;  1M94 A;  3PSE B;  3OAW A;  4NJ7 A;  2R2Q A;  3LDZ E;  3U8Z A;  2KJR A;  3UF8 A;  3V61 A;  2JZZ A;  2MX2 A;  5GMV A;  4ASW C;  4WWP A;  4F7Z A;  3A9K A;  4GN1 A;  2KD0 A;  4MJS B;  3TIX A;  3BY4 B;  3SU8 X;  3VDZ A;  5D7G A;  4P7I A;  3KUC B;  5CHW A;  2GBN A;  5E6O A;  1KJT A;  2DZJ A;  3WAP A;  3TBL D;  3DBR I;  2PEA A;  5L83 A;  2FCQ A;  4DHJ B;  2EMS A;  2O6V B;  3T8M A;  2NBU A;  3X0W A;  2KX3 A;  3QIJ A;  2KC2 A;  3AUL A;  4MEL A;  4DWF A;  3UQA A;  2JT4 B;  2KQS A;  4ANW A;  2NBW B;  3NOB A;  3TJP A;  3WA0 A;  2IO2 B;  3DVN V;  3NZS A;  4IM0 A;  4EKU A;  2XK5 B;  1YQB A;  1LM8 B;  2FNJ B;  3AU5 A;  2CKH B;  4BOZ B;  4WWO A;  5CTR C;  1KM7 A;  4CHK A;  4XZ4 A;  2JUO A;  2YVC A;  2KZR A;  2LUE A;  3EC8 A;  3OJ4 B;  2JY6 A;  3A1Q B;  2KXJ A;  4B95 A;  3HM6 X;  3M95 A;  2LJ5 A;  4W9I A;  2N7D A;  4PYZ A;  2DEN B;  4GSW A;  2NPT A;  4NAW A;  4MGZ E;  4W9J A;  4I6N B;  1UZX B;  3I3T B;  3PZD A;  1Q0W B;  2HD5 B;  4I6P A;  3JSV B;  1QZE A;  2G4D B;  2MCN B;  1OGW A;  1WX7 A;  5KHO A;  2G45 B;  2NR2 A;  4X57 B;  1E8W A;  5EDS A;  1NBF C;  1UBI A;  2GMI C;  2BYF A;  2KDI A;  2WYQ A;  3K9O B;  2BF8 B;  5KHQ A;  3JYU A;  2BYV E;  4BKS D;  4IWQ A;  4KVG B;  1UD7 A;  1Y8R C;  3KYD D;  4HXD A;  4ZDV A;  2R2O A;  1WGH A;  1TBE A;  5TR5 A;  3IHP C;  3X23 A;  5AZG A;  2JXX A;  4JGH B;  4XC2 A;  1WH3 A;  3UQB A;  4FUL A;  1P1A A;  2D11 A;  2B3A A;  2KOX A;  1WE7 A;  4IW0 A;  3VVW B;  2KX0 A;  1GJZ A;  4FHK A;  4KDL B;  4IUM B;  2YLM A;  4M0W B;  1J8C A;  3IBE A;  3VTV A;  3ZUN A;  1L2N A;  4DK5 A;  4MEM A;  3QX1 A;  2D3G A;  2IY1 B;  3Q3J A;  4DXA B;  4M8M A;  4IWO A;  4ANV A;  4K1R B;  1OEY A;  3NZU A;  2JZ3 B;  5AEK B;  1YX5 B;  1V81 A;  3KVF B;  4HJK A;  3H1U A;  4HPL B;  3S2A A;  5DPT A;  2ZNV B;  2KFK B;  4DBG A;  4FBJ B;  1GUA B;  5G55 A;  2DYB A;  4CYE A;  3M62 B;  2C7N B;  2W9N A;  3PLV A;  3ECI A;  3RCZ A;  2MP2 A;  4CO7 A;  2KC1 A;  3A9K B;  3KYC D;  1GC6 A;  1V5O A;  3WAL A;  2DZK A;  2KHW B;  4OVV A;  3ML9 A;  1FXT B;  3DVG Y;  2K8C A;  4BBN F;  3RUL A;  3RZF A;  4WQO B;  2IO0 B;  4W9L A;  2LVQ A;  3RUI B;  3WAN A;  3QAR A;  3GZN I;  4W9D A;  2KLG A;  3MJW A;  2A4Z A;  4AUQ C;  4K7W A;  2MBH A;  2N7E A;  3CSF A;  1OTR B;  1ZGU B;  2K8B A;  2G3Q B;  2Z59 B;  2MLB A;  4MDK E;  4RM9 A;  2LGX A;  3VAW A;  5E6N A;  1RFA A;  2JRH A;  4KDI C;  4HLE A;  4BFR A;  3VTW A;  1ZW7 A;  2RPQ A;  1E5W A;  2CU1 A;  3DDC B;  4G3X B;  1WXM A;  2OOB B;  1S1Q B;  1YD8 U;  2DAJ A;  2V3S A;  5DPR A;  3VUY A;  3RZW C;  3DVG X;  4RM8 A;  4TQ0 A;  3N30 A;  3TMP B;  3R7R A;  3V60 A;  4GMV A;  4EZL A;  1K8R B;  2KDE B;  4KZ0 A;  2MW5 A;  1V2Y A;  3ZVV A;  5LXH A;  2JWZ A;  4HVB A;  4F8C B;  2DYM A;  5CHV C;  1WM3 A;  4BKS A;  2Z0D B;  4KSL C;  1WGY A;  2Z0E B;  2PJH A;  4EOY A;  2QHO A;  3PRP B;  1WYW B;  2FCN A;  2G4S A;  4DHJ D;  2O6V D;  1RRB A;  4OVU A;  4NAW B;  2NPT B;  2LGY A;  2Y5B B;  4JLC A;  3SHQ A;  4W9F A;  4GDL B;  3OLM D;  3R66 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...