2ASQA

Solution structure of sumo-1 in complex with a sumo-binding motif (sbm)
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
77
structure length
77
Chain Sequence
YIKLKVIGQDSSEIHFKVKMTTHLKKLKESYCQRQGVPMNSLRFLFEGQRIADNHTPKELGMEEEDVIEVYQEQTGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Small Ubiquitin-like Modifier (SUMO) Recognition of a SUMO Binding Motif: A reversal of the bound orientation
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein binding
molecule keywords Small ubiquitin-related modifier 1
total genus 13
structure length 77
sequence length 77
ec nomenclature
pdb deposition date 2005-08-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF11976 Rad60-SLD Ubiquitin-2 like Rad60 SUMO-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 2asqA00
3SU8X 2GBKA 4IWOA 2JZ3B 2G4DB 3IFWB 4F8CB 3H7SA 4DHZB 4ZRIA 2KDIA 5E6NA 1VCBA 4HCNB 5C23A 1WY8A 2CHZA 5HKHA 4ICUA 3W1YA 3DPDA 1D3ZA 2LXAA 3PS6A 2PE6B 4MGZE 4GDLA 4TKNA 4W9KA 3IHPC 4RMAA 5C1ZA 4HJKA 3JVZX 1WZ3A 1SE9A 2IO2B 4NNJB 3ML9A 2KO3A 2XBBC 2WX0A 4HPLB 4IWPA 1EF5A 1AARA 4WQOB 2CR5A 3QC8B 4EUTA 4MDKE 2J0MA 3VDZA 2BWFA 1E8XA 4MJSA 1C3TA 1TBEA 1NBFC 4CHKA 5JH5C 1ZGUB 2KJHB 3OJ3A 3ZDMC 2BYEA 1V5OA 3R66C 3DCGA 1WR6E 4HLEA 3R3MA 3WAMA 3TJPA 1WH3A 4EZJA 1LM8B 2JVCA 3K9OB 1GG3A 4XC2A 2MA9B 5BO4B 1GC7A 4M0WB 3VTWA 3WIMA 3M63B 3QX1A 3WANA 2N9PC 4GMVA 4WJNA 3IVFA 4OVUA 1KOTA 3SHQA 1YX5B 4EOYA 3A9KB 3ZRCA 4CYEA 2BYFA 4BBNF 2L0TA 3EECA 4GDKA 2D07B 2NS5A 3QJZA 1JRUA 3P2BA 4WWPA 2C7NB 1WMHB 1WIAA 1WGRA 4BKGA 5JHBA 2IY0B 2LRUA 4WAAA 2N7EA 4MEMA 2L8JA 4KDLB 2JUOA 2C60A 4K7SA 2O2VB 4URKA 2DZIA 3DDCB 4FADA 1OEYA 1E90A 4NQKE 5L95C 5CTRC 2CHXA 3T9LA 3EHVA 3PPAA 1ISNA 4FJZA 2K8HA 4WJQA 1P0RA 2FUHB 4HCPB 3QIJA 4NQLB 1UGMA 4G0NB 1WXSA 4NPNA 3DVGX 2KWCA 3AULA 3OAWA 1SIFA 3PHWB 4JGHB 3ECIA 2KJ6A 1J19A 1UH6A 3B1LX 1GUAB 5G2NA 2R2QA 1J0GA 4E3CA 3RZFA 4ICVA 3PLVA 1YJ1A 4P7IA 5D6JB 4ZYNA 2MWSB 3BY4B 5CHFA 4GDKB 2J0KA 2DZKA 4K7WA 2KJRA 3U30A 5EDSA 2ZNVC 2ZCCA 4PS7A 5CX3A 1WJNA 2HE7A 2KWVB 4DXAB 3ZRFA 1YD8U 3A9KA 2ASQA 3VQIA 4FULA 4MGKE 3PSEB 2AL3A 2ZPNA 2KC1A 2KMCA 5DPSA 2KZRA 2IO1B 3TL5A 1V9JA 4AJWA 2KFJA 4FBJB 3TCAA 2L05A 2KWUB 4BOZB 1V6EA 4GOCA 4IG7B 4IUMB 2MW5A 4EZKA 3A33B 1WFYA 3KVFB 1WXVA 2D10A 4W9IA 4K1RB 4YL8A 5AZHA 3S2AA 3W1SA 3JW0X 4AUQC 3DBLI 3L08A 5J17A 4MELA 2D3GA 1ZW7A 2UWQA 3OJ4B 4ZRJA 4KVGB 5DPWA 3Q3FA 3QA8A 2WYQA 2PEAA 2NPTB 2M17A 4KV2A 2PPHA 3X0WA 4KIKA 3RYTA 4PYZA 4MSQB 3JYUA 4FA6A 4WWOA 4LCDE 3OLMD 2FCNA 2DZJA 2UYZB 2MRPA 2JF5A 3WAOA 1V2YA 1WXMA 2KKCA 4K7UA 4KZ0A 3I3TB 1WZ0A 2L76A 2GBRA 1H4RA 1P98A 2HTHA 3U7DA 3DBSA 4HXDA 2N1WA 2BYVE 3PRMB 4XX5A 3VH4B 5JHAA 4EFOA 2N9EB 4MGIE 4FHKA 5CHVC 1R4MI 2KX0A 4HVBA 3RULA 2M4NA 2ZJDA 4FHJA 2G4SA 2KK8A 4HWIB 2M8SA 4FJYA 2O6VA 4G11A 1UBIA 2GOWA 3DVNU 2ZZPB 4AWJA 1V80A 1S3SG 4GU2A 2FAZA 2V4LA 2Y5BB 1U4AA 2MP2B 3N3KB 3A4RA 3ALBA 1TGZB 2IBIB 4IC7B 2KANA 3A1QB 3PHXB 2LZ6A 1WGHA 1IP9A 5DPTA 4W9FA 4FLHA 5LXHA 3HM3A 3KUZA 1HE8A 3ZTDA 5GMVA 4BKSA 4BKTA 2BKFA 3UINB 2KTRA 3KUDB 2J7QB 2J0JA 2KVRA 1RAXA 3MHSD 4RM8A 2MCNB 3U8ZA 2HJ8A 1FXTB 3V62A 1Y8RC 3QWZB 2KC2A 2AEHA 4B9KA 2MBQA 4HDOA 4HK2A 4DHJB 4DDID 3A9JA 4ANXA 3RCZA 2HD5B 1KM7A 1WF9A 2JRIB 2KNBA 3L0WB 2JPHA 3APDA 1WJ4A 4F1SA 1E7UA 1WYWB 2JRHA 4TQ0A 2A5UA 2K1FA 2O6VB 3IG3A 1OGWA 4DBGA 2L0FA 4NY0A 4KZCA 4FJVB 1Q1OA 1V81A 3DBRI 2DX5B 3VVWB 3UQAA 3IBEA 2ZVOA 3RUIB 3K9PB 2PE9A 4EZLA 3VHTC 3PRPB 1XT9B 2Z0DB 3NHEB 4W9JA 2I1JA 2LD9A 2RGFA 2ZNVB 3ONSA 3KYCD 4JL9A 5E6OA 1WE6A 2O6VD 3PT2B 2EMSA 4II2B 4DWFA 2LI5A 3L17A 3CSTA 1EUVB 3LDZE 1Q5WB 2DHZA 1RFAA 1WX8A 1BT0A 4E74A 2QHOA 3PREA 3X23A 2GBJA 4K81A 4RM9A 1WXAA 2KX3A 2CHWA 2MSED 3GZNI 3SD5A 2IY1B 2NBUA 5LLIA 3ZNZB 3A9JB 1K8RB 2JY6A 4GSWA 4MGYE 1GJZA 1QZEA 2CU1A 1OTRB 2M0XA 2V3SA 2XEWA 2KFKB 4II3B 1WX7A 2N1VA 3TIXA 2NBVB 4W9GA 4W9EA 3R7RA 4J6IA 1UBQA 1E5WA 2IO0B 4BVUC 3AU4A 1I35A 2LUEA 3NS8A 2MBOA 3M3JA 1G6JA 3M95A 3LJ3A 2MBHA 2NVUI 1TTNA 1L7YA 1XD3B 3A4SC 3ML8A 3QAQA 2N9XA 5DCNA 3WALA 3MJWA 3CF6E 2N4FA 5AEKB 2CS4A 2LGDA 1WE7A 2C7MB 2NBWB 1V49A 2AL6A 1GC6A 3ZNID 2MBBB 2NCNA 3HK0A 2KLGA 4NJ6A 2K6QA 3M62B 3JSVA 3PV1A 4GN1A 4KSLC 1P9DU 1F9JA 1RLFA 2IYDB 3DBHI 2DYMA 5KHOA 2D2QA 3PVLA 2LGYA 4ANUA 2LVOA 3PTFC 3Q3JA 3ZTCA 3A1QA 2KDEB 2AYOB 2Z0EB 4GGQA 2BF8B 2G3QB 2WX1A 3H7PB 4W9HA 3QCAA 4M8NA 4W9CA 3KYDD 4WJPA 2RD0A 4A3PA 2DAJA 1NDDA 2FIFA 4GB9A 5D2MB 3B0AA 2LWPA 1V86A 4IW0A 2K39A 1WI0A 5D7GA 3VUXA 3ZDTA 3R7QA 2CKHB 3HHMA 3DOWA 1LFDA 4MJSB 2BPSA 4B95A 2AWTA 3DVGY 3CMMB 4AP4C 3T8MA 2BKRB 3DVNV 1TZ1A 3NOBA 1YIWA 4NJ7A 2K25A 5IAAC 3PLUA 1A5RA 1WGDA 2GBMA 1OEYJ 2KN5A 3DQVA 3ZKJC 1T0YA 2IZVB 2Z59B 1WGGA 2RSUA 4XZ4A 3C0RB 3VTVA 3V61A 3H9DA 2YLMA 3KUCB 4JLCA 3KW5B 4IWQA 4EKUA 2FCQA 2LXCA 3B08A 1WM2A 4A20A 1WJUA 2DAFA 1E8YA 2KD0A 2JXXA 3QK0A 3TMPB 3PRZA 1I42A 1UZXB 4TQ1A 3APCA 4HPMB 2YVCA 3VFKA 2DENB 4G3XB 1LXDA 3O65B 3NZSA 1WRDB 2B3AA 2LVPA 2JWZA 2MLBA 3L16A 4OVVA 2M1MA 2KQSA 1E8ZA 2MBEA 4AOFA 3H6NA 1WMHA 3VH3B 2KDFB 4DDGD 1IYFA 2IO3B 1XQQA 1LQBA 2JZZA 4W9DA 5AZGA 2ZVNA 1Q0WB 1H8CA 4X57B 2FCSA 3RZWC 3ZO5B 4LJOB 1PQSA 5IA7A 2FIDA 4DHJD 4G50A 3ZUNA 2C5LC 1P1AA 4MM3A 5E6PA 2KMAA 2G45B 2L3ZA 1RRBA 2V1YA 2ZEQA 3AI5A 4I6NB 4W9LA 3RT3B 4ASWC 2KLCA 4JQWC 2KDBA 3V60A 1E8WA 1YQBA 3MTNB 3PZDA 3NZUA 2W9NA 2OOBB 1WJ6A 1X1MA 2FCMA 3WAPA 3ZW3A 4KSKC 2KFKA 4E71A 1M94A 1P3QU 3L10B 3UGBB 5L83A 2KXJA 1WM3A 3TBLD 1V5TA 3VAWA 5LXIB 1R4NI 1UELA 2R2OA 4I6PA 1S1QB 2I1KA 2KTRB 4KDIC 3HM6X 2LJ5A 1GNUA 2NR2A 2DYBA 2L7RA 3GOEA 4I6LB 2REXA 2RR9A 1E7VA 4PS8A 3VUWA 1L2NA 2JT4B 3NY5A 4ZDVA 3QQ8B 3L13A 1NI2A 5JZEB 2K6DB 4BKSD 2LGXA 4TUUA 4CO7A 4FN2A 2NPTA 1VD2A 4IM0A 2PJHA 2N7DA 1KJTA 1UD7A 5CHWA 4B6WA 3JSVB 1WR1A 3V6CB 2OJRA 3H1UA 4WWNA 3AU5A 5DPRA 4WJOA 4N9F4 3VUYA 1KLVA 4LJPB 5TR5A 2K8BA 4GXBA 4BOSC 1ZKHA 5FR6A 2KQ7A 1CMXB 3UQBA 3UF8A 3RD2A 3H7PA 2KHWB 3L54A 3VTUA 1OQYA 5J18A 2BWES 3EC8A 4MH0E 2DYOA 3D32A 4F7ZA 2MP2A 4JIOU 1MG8A 5J2RA 3EFUA 4DHZE 2K8CA 2C7HA 2VRRB 2WDTB 4EEWA 5G55A 1C1YB 1IPGA 2ZCBA 2O2VA 2BGFA 2ZPYA 4GIVA 3HIZA 2LRWA 2GBNA 3CSFA 1YX6B 4M8MA 2MQJA 2WWZA 4ZRKA 3V6EB 4AJYB 5KHQA 2RPQA 4NAWA 4HDQA 4IM3A 3W1SC 3ZNGC 1WGYA 2EMTA 2KOXA 4BBNC 3KH0A 4DK5A 4GDLB 4LDTD 1WX9A 2FNJB 4ANVA 2XK5A 5AZFA 4TV3A 4KIKB 2D11A 2LASA 3SDLC 2MX2A 3N32A 3QARA 4NAWB 4MSMB 3ZLZA 2DZMA 3APFA 3AXCA 4IM2A 3WA0A 3ZNHB 4A3OA 2A4ZA 2KTFA 3UIPB 4PS3A 3ZVVA 1SGHA 2EKEC 2XK5B 3ZIMA 2C9WB 1EF1A 3QHTA 4LDTB 3UIOB 3PGEA 4PYUA 2LVQA 4ANWA 1Z5SB 2GMIC 3BINA 1J8CA 4BFRA 3ENEA 1EO6A 1Z2MA 3N30A 2L00B 5D94A 3VXWA
chains in the Genus database with same CATH superfamily
1K52A 4IWOA 4F8CB 1MI0A 1F0ZA 2KDIA 4HCNB 5C23A 1SB3C 2CHZA 5HKHA 1TS5A 4W9KA 3IHPC 4OVZA 3BVGA 1I7HA 4IWPA 3MC8A 1V1OA 4MJSA 4CHKA 1ZGUB 3OJ3A 2EELA 2BYEA 1V5OA 1QT9A 3NS1A 3TJPA 3U52E 1LM8B 3K9OB 1GG3A 3QX1A 2W3RA 4OVUA 4BAXA 2M0AA 2KWDA 5HI1A 4YT0B 2L0TA 4L23A 3QJZA 3P2BA 4XWWA 1T6BX 2X38A 4BKGA 3I63C 4MEMA 4FADA 2FE8A 1XO3A 5CTRC 2DBYA 1JQ4A 3I57A 5IOIA 2QC8A 2FUHB 2OEDA 2DNFA 3QIJA 4NQLB 1UGMA 4G0NB 3DVGX 1TS2A 4RNAA 3RMKC 3AE4B 2I2YA 2KJ6A 1J19A 1UH6A 2GRIA 2WXPA 1J0GA 4K3CA 3TEYA 4XDCA 5D6JB 4EE2A 4C80A 1XF5L 5CHFA 4K7WA 4KKJA 2ZNVC 1WJNA 2HE7A 2KWVB 2Y3AA 3AN1A 2BS3B 2KZRA 4FBJB 4RH6A 3AEDB 4BOZB 1YMHE 1XCQL 3P4RB 4IG7B 1TY0A 3A33B 3AV8A 1ET6A 1WFYA 3ZYYX 4K1RB 3W1SA 3Q8BA 1KLGD 2WDRB 3IXSA 2PEAA 3P63A 2NPTB 3X0WA 4HEA1 4MSQB 3OLMD 2MRPA 4XDDA 3VR8B 2L76A 3U7DA 3NJTA 3PRMB 4KGSA 1XXGA 3VH4B 5JHAA 2BS4B 4HVBA 1OQRA 2ZJDA 2KK8A 1N62A 3DVNU 4JPSA 4GU2A 3OWEB 2Q5WD 1CQVA 2WXNA 1U4AA 1SJED 1HZ6A 2PW9A 1ZOYB 2KANA 3A1QB 4W9FA 5LXHA 3KUZA 1E0ZA 2VH1A 1A70A 2RPVA 3GP7A 3MHSD 1FXTB 1Y8RC 2BB6A 3BWUD 1UWMA 5EE9A 3RN9C 2KC2A 1JWUD 4B9KA 4HDOA 4HK2A 1N60A 2BYTA 2JPHA 3APDA 3E9SA 4TQ0A 4DBGA 2L0FA 4FJVB 1Q1OA 1V81A 2MH7A 1YJJA 2Y5PA 1ROEA 3AEEB 3K9PB 2PE9A 1DOIA 3VHTC 4LTUA 1GOZA 1HQRD 2LD9A 4W9JA 3ONSA 3KYCD 1WE6A 2LI5A 2INPE 1SE4A 3LDZE 2DHZA 1RFAA 3WCQA 3X23A 1P7FA 2GBJA 4K81A 4WWMA 4LNNA 1WXAA 4N58A 2KX3A 2CHWA 3AEAB 5LLIA 3ZNZB 1K8RB 3AEBB 1HZ5A 2M0XA 1OTRB 1WX7A 3EUB2 1J7CA 1Y56A 2NBVB 4W9GA 5TSSA 3BK2A 4BVUC 2IO0B 3AU4A 3NS8A 1G6JA 1AYFA 2WGSA 3M95A 1L7YA 3ML8A 5DCNA 2C7MB 2NBWB 2X8XX 1GC6A 3ZNID 2KLGA 2V9HA 2K6QA 2WU5B 4MT5A 4RFBA 5KHOA 1CJEA 4M0WA 3Q3OC 3PTFC 2G3QB 3H7PB 4FXCA 4M8NA 3UI3A 3KYDD 2FIFA 4P1BC 2LWPA 5IO9A 4B95A 3DVGY 4LLGM 3CMMB 4B0EA 2D3AA 4PT5A 3Q8EA 5IAAC 3PLUA 2KN5A 1OEYJ 1T0YA 1WGGA 2RSUA 2VZKD 4JLCA 2LXCA 3AE6B 2L52A 1WJUA 1E8YA 3PRZA 4TQ1A 4HPMB 2GB1A 2DENB 2ZW1A 2LVPA 5BMHA 2JWZA 4OVVA 2XNAC 1E8ZA 2GLSA 3VH3B 1IYFA 2DLBA 1SBBB 1XQQA 1LQBA 1E6EB 1PUTA 1PGXA 3RZWC 1FNWA 3ZO5B 4LJOB 1PQSA 2E6XA 3ZUNA 2C5LC 5E6PA 4W9LA 3BZDB 4C4VB 1E8WA 1YQBA 3PZDA 3L10B 4MM3B 2KXJA 2L83A 2R2OA 4KDIC 2I1KA 3HM6X 3L4PA 4USAA 2NR2A 3RPFC 1GB1A 2INNE 1SEBD 1ZXHA 3VUWA 1T5XD 2NPTA 4IM0A 4JWUC 2N7DA 2RDBC 1KJTA 4B6WA 2J53A 4WWNA 3AU5A 1FXAA 5DPRA 1JW9D 1SE3A 3RNCC 5BYSA 2YEPF 4LJPB 4DXFA 2JQRB 2K8BA 4GXBA 2G9HD 3UF8A 5J18A 1DOYA 2BWES 3EC8A 1DYQA 2BBCA 2DYOA 4JIOU 2YEPB 3EFCA 4EEWA 4GIVA 2BGFA 5D3IB 3HIZA 2GBNA 1YX6B 2MQJA 4NAWA 4IM3A 3W1SC 4BBNC 2EMTA 2V3NA 2W54A 1L6VA 3KH0A 3HVZA 2KAJA 4TV3A 2D11A 2LASA 2OJWA 4HRSA 2MX2A 3QARA 4NAWB 3APFA 4IM2A 1ET9A 2EKEC 1EWYC 1FXIA 4LDTB 2LVQA 4WURA 1C78A 2JWUA 3DBLB 2LJIA 1Z2MA 1Q5WB 2L00B 3SU8X 2GBKA 2D3BA 3RNFC 3IFWB 4LNFA 3N1YC 2MJEA 5IKCM 3AEFB 3W1YA 3DPDA 3PS6A 4IOIE 4TKNA 4GDLA 4ZHPA 4HJKA 2K9XA 2IO2B 4NNJB 1ACCA 4O1NA 3B2GA 1FIQA 1AARA 3BYYB 1RM6C 4XWTA 2KJHB 3MC0B 3ZDMC 3RNEC 4UDUC 3R66C 3DCGA 1WR6E 4HLEA 3DWGC 1I4HA 1WH3A 1XLNA 2JVCA 2MA9B 4ITKA 1GC7A 1MHHE 1SE2A 2N9PC 3GS2A 1LO5D 1KOTA 1YX5B 3P4SB 5G5HA 3ZRCA 4CYEA 4S0RA 2WQYB 2BYFA 4GDKA 3EECA 4M01A 2D07B 2NS5A 2QSDA 2D5GA 4OZBA 3TSSA 5JHBA 2LRUA 5BYQA 2N7EA 2CJNA 2JUOA 2O2VB 2WLBA 4URKA 4NJCA 1ZP0B 2VZKB 3ZGZA 1E90A 3Q3NC 2PVOD 5T8IA 3EHVA 3I9V1 3AULA 2ON8A 3OAWA 4JGHB 4BZAA 3B1LX 2R2QA 4E3CA 3RZFA 3GE3C 3PZ8A 4ACFA 2HTME 1YJ1A 1C77A 3U30A 2ZCCA 4PS7A 3ZRFA 5JXVA 4FULA 4MGKE 3PSEB 3FAHA 2KMCA 5DPSA 3TL5A 4AJWA 4KGRA 3TCAA 1JWBD 4A6QA 2L05A 2KWUB 2AQ3B 4P1CC 1PFDA 2L1AA 3AB5A 2AQ2B 2MW5A 1PYWD 2BW2A 1YQ4B 3JW0X 3L08A 4MELA 2D3GA 1MPEA 2UWQA 4ZRJA 5DPWA 2JYEA 2WYQA 3NVWA 4KIKA 3CWIA 4US9A 3JYUA 4LCDE 3FC4A 3I3TB 3DBSA 2BYVE 4EFOA 4FHKA 5CHVC 1R4MI 3RULA 1V97A 2G4SA 2O6VA 1WYGA 2WU2B 1IGDA 4AWJA 1V80A 2FAZA 1NI3A 2V4LA 1WSPA 3DHGC 2M19A 2MP2B 4WH4A 3A4RA 3ALBA 1Q10A 3U2SC 4IC7B 1SSNA 4RF0A 3V3XA 1WGHA 4FLHA 4KKIA 4BKSA 5GMVA 1VZ6A 2BKFA 1VLBA 1ZDXA 2KTRA 3KUDB 2J7QB 2J0JA 1PGAA 4RM8A 2MCNB 2WXKA 2AEHA 1ZUD2 3A9JA 4ANXA 3RCZA 2HD5B 1KM7A 1WF9A 2XN9C 1XLQA 3L0WB 1WJ4A 1N63A 1TS4A 1WYWB 3TEXA 4RCOA 2A5UA 2O6VB 2WXOA 1P7EA 1V8CA 4KZCA 1D4BA 3DBRI 1FPYA 2ZVOA 1QQRA 3HVDA 1YNTE 2QJLA 4HROA 2PIAA 2EKIA 3NHEB 2I1JA 2ICIA 2EMSA 1QOFA 4M02A 4E74A 1WXQA 2QHOA 1AN8A 2H89B 3C19A 1VZ7A 4MGYE 1GJZA 1GPXA 3TIXA 3I5JC 4LK0M 4J6IA 1FCCC 3M3JA 4N6EB 4WAFA 5HG2A 4IKGA 4Q2JA 1D5ZC 3QAQA 1F2RC 3B9JA 2CS4A 2LGDA 1WE7A 3ZJUA 2HJ1A 1MG4A 3R2IA 3JSVA 1FFVA 3AH7A 2DYMA 1YQ3B 3Q8FA 5EE1A 3PVLA 2LGYA 3SEBA 4ANUA 3SR6A 2ONQA 5IN7A 3A1QA 2AYOB 4HKQA 4GGQA 4WJPA 2BF8B 5HFYA 4W9CA 3QCAA 2DAJA 1NDDA 4GB9A 1YN5A 2LHDA 1V86A 2WS3B 4IW0A 5D7GA 1ESFA 4JWSC 3VUXA 1R4MB 2L32A 3P1MA 4MJSB 2OHFA 1FO4A 3DVNV 4QAYA 1TZ1A 3DBHB 1YIWA 4NJ7A 2K25A 1KF6B 2GBMA 2PTLA 3DQVA 2IZVB 2LGIA 2Z59B 5FR3A 4XZ4A 2YLMA 3Q8AA 3KW5B 4RGNA 2FCQA 2ACZB 1K53A 2DAFA 3QK0A 2JZPA 4KGTA 2J4XA 1UZXB 1V1PA 1TJEA 2YVCA 3VFKA 3O65B 3NZSA 4YSZB 3L16A 3ZJVA 2M1MA 4DDGD 1SF0A 5BMIA 1TKEA 2NTTA 2JZZA 2ZVNA 4X57B 2FCSA 4G50A 1P1AA 4YSXB 2KMAA 2V1YA 2KLCA 4JQWC 3V60A 3MTNB 3NZUA 2W9NA 3ZW3A 3RNGC 2G1EA 3Q3MC 2KFKA 3UGBB 4RF1A 4DXGA 3TBLD 3VAWA 1YOVB 2CU3A 2J52A 4YTMB 2WXFA 2L7RA 2RR9A 2WXLA 4PS8A 2JT4B 3NY5A 3QQ8B 3NVZA 3P4PB 5JZEB 3MHZA 2MHJA 2LGXA 4FN2A 1VD2A 2PJHA 3JSVB 1WR1A 1XLPA 3IAS1 4WJOA 1JRPA 4N9F4 1KLVA 4C00A 3GE8C 1NYRA 1CMXB 3UQBA 3RD2A 3H7PA 2KHWB 3L54A 3VTUA 3D32A 4F7ZA 4HJGE 3V05A 3EFUA 4DHZE 2K8CA 2VRRB 3DHHC 3AE9B 1C1YB 3U4EG 2QCZA 4ZRQA 4AJYB 1I4GA 3ZNGC 2KOXA 4DK5A 2N0SB 4GDLB 1E10A 5AZFA 3RI7C 3N32A 3LB8C 4A3OA 3WA0A 3ZNHB 2A4ZA 3LYYA 3UIPB 4PS3A 3ZVVA 1SGHA 4RGOS 3ZIMA 3PGEA 2I38A 4ANWA 1Z5SB 3BINA 3AECB 3MP9A 3NVVA 4C56C 2JZ3B 3H7SA 4LNKA 4ZRIA 5E6NA 4YWGG 3AMZA 5GXGB 1WY8A 4ICUA 1EM7A 2LXAA 1XLOA 4MGZE 5C1ZA 2VH2A 3JVZX 5H92C 1SIJA 4NZLB 2XBBC 2WX0A 1EF5A 4WQOB 1JROA 4EUTA 2BWFA 4LNIA 1TBEA 1NBFC 2WXIA 4R3DA 4CQNA 1TS3A 3WAMA 4EZJA 1FRDA 4XC2A 5BO4B 3VTWA 3WANA 2ZW0A 4WJNA 3PO0A 5AUKA 1R4NB 2WDQB 2JYTA 3PZ7A 3RNAC 1DGJA 2C7NB 1WMHB 4A8XC 1WIAA 1WGRA 1C79A 3BVMA 2L8JA 3AE1B 4K7SA 5I4DA 1VR9A 1D5MC 2DZIA 3DDCB 1OEYA 1VJKA 4NQKE 2CHXA 3AM9A 1JALA 1FCLA 2K8HA 4WJQA 1P0RA 4HCPB 5C3JB 2IJ0A 1RWSA 2KWCA 1SIFA 3Q14C 3ECIA 5G2NA 1L0VB 4NAMA 3AE8B 1I4XA 4ZYNA 2PLPA 3SFDB 2MWSB 2DZKA 4C7YA 1F52A 2AX5A 5EDSA 1TKYA 3C8YA 5CX3A 4DXAB 3URYA 2ASQA 1C4AA 5E6JA 2AL3A 3OG5A 1D5XC 1V6EA 4XYCA 4EZKA 2W3SA 3KVFB 1WXVA 2D10A 4YL8A 5AZHA 3ZXRA 4AUQC 1STEA 5BYRA 1ZW7A 3DWMA 4KVGB 1UUPA 1RFKA 3TEWA 2M17A 2PPHA 2JSVX 3RYTA 4PYZA 4WWOA 2PKOA 2UYZB 3WAOA 1V2YA 1WXMA 2N9LA 1GB4A 4HXDA 2N1WA 2N9EB 2KX0A 5HHDG 2M4NA 2JXTA 1TIFA 2M8SA 4FJYA 1AW7A 1UBIA 1N5WA 2GOWA 1S3SG 2Y5BB 3W9CB 3DHIC 1TYGB 2KVZA 1GAQB 1TGZB 2IBIB 1FNUA 3PHXB 2LZ6A 4N59A 1IP9A 5DPTA 1PDXA 1L0YB 3ZTDA 1HE8A 3FILB 1IUEA 1M4VA 2KVRA 3U8ZA 2V0GA 3QWZB 1IBXB 2GI9A 3CIRB 2MBQA 2MJDA 2KNBA 2JRIB 4OHJA 3RNBC 2JU6X 4H2AA 2WNMA 1E7UA 2JRHA 1I4QA 3AE7B 2K1FA 3IG3A 1OGWA 2CJOA 4NY0A 2LMCA 2WDVB 1QLBB 2DX5B 3VVWB 3UQAA 3IBEA 1DOXA 4P6VF 1XT9B 2Z0DB 3PT2B 2O6VD 4DWFA 3L17A 3CSTA 1FNVA 1YN3A 1PGBA 2RMMA 3NUHB 1BT0A 3P4QB 3PREA 1N61A 4HKZE 2MSED 3GZNI 2DWQA 3SD5A 2LHEA 2NBUA 5BMGA 1K50A 1J7BA 2JY6A 4GSWA 2XEWA 2CU1A 2V3SA 2KFKB 5IP4D 2N1VA 3MJ5A 3J9CA 2BVCA 5FKAC 3NRZA 1IGCA 1UBQA 4AQ7A 1QOGA 1I35A 2LUEA 2MBOA 2MBHA 1TTNA 3EGRA 1XD3B 3A4SC 3N20C 3WALA 4B0MA 5AEKB 2WP9B 3H8HA 2AL6A 2W55A 3ZJTA 4NJ6A 4ZHOA 4GN1A 1NENB 1P9DU 2IYDB 3DBHI 2WXHA 2NTSA 3TUOA 2D2QA 2LVOA 3GB1A 5D3DA 3Q3JA 2B76B 2K3UA 3HRDD 4W9HA 2WX1A 2J42A 4A3PA 2KACA 3P42A 2WXJA 2K39A 2BB5A 3ZDTA 2CKHB 3HHMA 1LFDA 3KWLA 4AP4C 3BYTB 2BKRB 1A5RA 3ZKJC 3VTVA 3V61A 3H9DA 3KUCB 4IWQA 3BVZA 3B08A 1WM2A 1KFYB 2MJ3A 2JXXA 1I42A 4TSSA 5C2TB 3APCA 2WXGA 4G3XB 1WRDB 2B3AA 1F1HA 1L4DB 2MLBA 1RYJA 2D3CA 2MBEA 1MHXA 4ZYSA 2IO3B 4M00A 5AZGA 1H8CA 5IA7A 2QMTA 4DHJD 3Q69A 4MM3A 1FM0D 2L3ZA 1RRBA 3AI5A 3RT3B 1WJ6A 1X1MA 4E71A 1P3QU 1WM3A 4WIPA 5LXIB 2KTRB 2LJ5A 2DYBA 1TZOA 2REXA 1L2NA 3Q6BA 1KLUD 3NG0A 2K6DB 4BKSD 4TUUA 3ZQ4A 4CO7A 3AE3B 3GZNB 2KT7A 3BIID 1TY2A 1UD7A 4JE3B 5CHWA 3H1UA 1LGRA 3VUYA 2V4IB 2BT6A 1T0RC 1L6UA 4BOSC 1ZKHA 2KQ7A 2Z8LA 2IGGA 1QF6A 1HXYD 4MH0E 1B1ZA 1L0XB 3KWVA 5MPOA 1VZ8A 1AWDA 1EWCA 2ZCBA 2O2VA 2LRWA 3CSFA 3V6EB 4M8MA 4ZRKA 2RPQA 1T0SC 1WGYA 1B9RA 1WX9A 1SJHD 4ANVA 2XK5A 4K3BA 4XE0A 4C7ZA 2DZMA 3AXCA 2XK5B 2C9WB 1EF1A 3QHTA 3UIOB 2IPKD 3KLSX 2GMIC 4WQMA 2NMQA 4BFRA 3ENEA 1EO6A 5D94A 1J7AA 3TEZA 2G4DB 4DHZB 3ABVB 1VCBA 1MVKA 1ZPSA 2PMVA 1ENFA 3LXFA 1E7PB 1ZE3D 1D3ZA 2KN4A 2PE6B 4RMAA 4A55A 1WZ3A 3W5UB 1SE9A 3ML9A 2KO3A 4HPLB 2QDFA 2CR5A 3QC8B 4MDKE 1TKGA 2J0MA 3VDZA 1E8XA 1C3TA 5JH5C 3VRAB 3FKYA 3VRBB 1JWAD 2KYWA 1WGKA 2N7JA 3R3MA 2INCC 4M0WB 3VR9B 3WIMA 1C9FA 3M63B 2IGDA 4GMVA 3IVFA 1V1PB 2R61A 3AE2B 3SHQA 2K22A 4EOYA 1N5XA 3A9KB 5AUIA 4BBNF 4XGAB 1UGJA 4YTPB 1BXTA 1JRUA 4WWPA 4A9AA 1HA5A 2IY0B 1L5PA 4WAAA 1BMLC 4KDLB 1JCKB 2C60A 3IT4B 3T3OA 5L95C 3O13A 2MEKA 2N9KA 4J3OD 3T9LA 4FJZA 3PPAA 1ISNA 4YTNB 1CK1A 3BK1A 4NPNA 1WXSA 3PHWB 4P16A 1E9MA 1QKZA 1R7SA 1QOAA 1FFUA 1GUAB 1YJIA 3RFZB 4ICVA 3PLVA 3E56A 4P7IA 3BY4B 3ETRA 4GDKB 2J0KA 2KJRA 1YD8U 3A9KA 3VQIA 2WHIA 2ZPNA 2KC1A 2IO1B 1V9JA 2KFJA 2LEKA 2H88B 4GOCA 4IUMB 2RDHA 3IT6B 4AS1A 4W9IA 3S2AA 1JWMD 3DBLI 5J17A 3OJ4B 1WRIA 3Q3FA 1WWTA 3QA8A 2FUG1 4KV2A 2WXQA 3KQ4A 4FA6A 1C4PA 2FCNA 2DZJA 2JF5A 1BUIC 2KKCA 4KZ0A 1C76A 2M56B 4K7UA 1WZ0A 2GBRA 1H4RA 1P98A 2HTHA 4XX5A 4MGIE 4FHJA 4S17A 4HWIB 4G11A 1OQQA 2ZZPB 3NVYA 4L2YA 1SXTA 3N3KB 2K0PA 2UU7A 4MACA 2WXRA 1XCTL 2TSSA 3HM3A 3SFEB 4BKTA 4C4VA 3UINB 2QEJC 2INDC 1RAXA 1NVID 4ARIA 2HJ8A 3V62A 3HUIA 4DHJB 4DDID 2KQ4X 3MC9A 4TMAB 1T0QC 4F1SA 3W5VB 3IAM1 2RDGA 2FBWB 4OZAA 4GLSC 2QILA 2SEBD 1UF0A 1ZDVA 3RUIB 1C4CA 3U7ZA 4REZA 3NZ3A 4EZLA 3EA6A 3PRPB 4D2KA 2JX5A 3N1ZC 1NYQA 2ZNVB 2RGFA 4JL9A 2QIEB 5E6OA 4II2B 3FILA 1EUVB 1WX8A 3N9YC 2PVGC 2KMMA 4RM9A 2LFIA 3T3NA 2IY1B 3DBRB 5H8YE 3A9JB 1T3QA 1QZEA 4II3B 4RGTA 4W9EA 1E5WA 1YN4A 1FRRA 3LJ3A 2NVUI 2N9XA 3MJWA 3CF6E 2N4FA 2V3PA 1UNSA 4ARCA 1V49A 2AQ1B 5G5GA 2MBBB 2NCNA 2W82A 3HK0A 3M62B 3PV1A 4KSLC 1F9JA 1RLFA 1KRHA 3W2DA 3MFGA 3ZTCA 2KDEB 2Z0EB 3N1XC 3R7RA 2RD0A 5D2MB 3B0AA 1D6EC 1WI0A 3R7QA 4JX1C 2E3TA 3DOWA 1MJDA 2BPSA 4IDIA 2AWTA 4OZCA 4HPPA 3T8MA 3NOBA 1QOBA 1WGDA 3C0RB 4EKUA 1K51A 5EE0A 4A20A 2KD0A 2SAKA 3TMPB 4A90A 1ZXIA 1JMLA 1LXDA 4KX6B 2IGHA 1L4ZB 2KQSA 1XEEA 4AOFA 3H6NA 1WMHA 2KDFB 2BQQA 1N6ZA 4W9DA 1VDVA 1Q0WB 4US8A 2FIDA 2HDEA 2G45B 2ZEQA 4I6NB 4ASWC 1F2RI 2KDBA 1FEHA 2OOBB 3WAPA 1I4PA 2FCMA 2IDYA 4KSKC 1M94A 5L83A 2LGSA 3Q2AC 1V5TA 4RGMA 3Q8CA 2BTEA 3R8BA 1EU4A 4L1BA 1R4NI 1UELA 1UWXA 1S1QB 4I6PA 1FD6A 1FMAD 1GNUA 1I4RA 3GOEA 1KH0A 4I6LB 1E7VA 4ZDVA 3L13A 2LUMA 1NI2A 1CZPA 4LNOA 3V6CB 1QILA 2OJRA 5EE3A 3B2FA 1MFWA 5LNK1 5TR5A 5FK9C 4ZOHC 2WXMA 5FR6A 1HEZE 2Y5CA 1OQYA 2KDMA 2MP2A 1HTQA 1MG8A 5J2RA 1OFFA 3ZXVA 2C7HA 2WDTB 1VRAB 5G55A 1KTKA 2K5PA 1IPGA 4MH8A 2ZPYA 3AE5B 4PK1A 2WWZA 1JWSD 5KHQA 4DQOC 4HDQA 4YSYB 4ZRPA 4LDTD 2FNJB 3R2TA 4KIKB 2BS2B 1NEKB 3SDLC 1IBXA 1HTOA 4MSMB 3ZLZA 3AEGB 4YXDB 2KTFA 1F77A 1EU3A 4PYUA 4OW0A 1TT5B 1J8CA 3N30A 3VXWA
chains in the Genus database with same CATH topology
3SU8X 2GBKA 4IWOA 2JZ3B 2G4DB 3IFWB 4F8CB 3H7SA 4DHZB 4ZRIA 2KDIA 5E6NA 1VCBA 4HCNB 5C23A 1WY8A 2CHZA 5HKHA 4ICUA 3W1YA 3DPDA 1D3ZA 2LXAA 3PS6A 2PE6B 4MGZE 4GDLA 4TKNA 4W9KA 3IHPC 4RMAA 5C1ZA 4HJKA 3JVZX 1WZ3A 1SE9A 2IO2B 4NNJB 3ML9A 2KO3A 2XBBC 2WX0A 4HPLB 4IWPA 1EF5A 1AARA 4WQOB 2CR5A 3QC8B 4EUTA 4MDKE 2J0MA 3VDZA 2BWFA 1E8XA 4MJSA 1C3TA 1TBEA 1NBFC 4CHKA 5JH5C 1ZGUB 2KJHB 3OJ3A 3ZDMC 2BYEA 1V5OA 3R66C 3DCGA 1WR6E 4HLEA 3R3MA 3WAMA 3TJPA 1WH3A 4EZJA 1LM8B 2JVCA 3K9OB 1GG3A 4XC2A 2MA9B 5BO4B 1GC7A 4M0WB 3VTWA 3WIMA 3M63B 3QX1A 3WANA 2N9PC 4GMVA 4WJNA 3IVFA 4OVUA 1KOTA 3SHQA 1YX5B 4EOYA 3A9KB 3ZRCA 4CYEA 2BYFA 4BBNF 2L0TA 3EECA 4GDKA 2D07B 2NS5A 3QJZA 1JRUA 3P2BA 4WWPA 2C7NB 1WMHB 1WIAA 1WGRA 4BKGA 5JHBA 2IY0B 2LRUA 4WAAA 2N7EA 4MEMA 2L8JA 4KDLB 2JUOA 2C60A 4K7SA 2O2VB 4URKA 2DZIA 3DDCB 4FADA 1OEYA 1E90A 4NQKE 5L95C 5CTRC 2CHXA 3T9LA 3EHVA 3PPAA 1ISNA 4FJZA 2K8HA 4WJQA 1P0RA 2FUHB 4HCPB 3QIJA 4NQLB 1UGMA 4G0NB 1WXSA 4NPNA 3DVGX 2KWCA 3AULA 3OAWA 1SIFA 3PHWB 4JGHB 3ECIA 2KJ6A 1J19A 1UH6A 3B1LX 1GUAB 5G2NA 2R2QA 1J0GA 4E3CA 3RZFA 4ICVA 3PLVA 1YJ1A 4P7IA 5D6JB 4ZYNA 2MWSB 3BY4B 5CHFA 4GDKB 2J0KA 2DZKA 4K7WA 2KJRA 3U30A 5EDSA 2ZNVC 2ZCCA 4PS7A 5CX3A 1WJNA 2HE7A 2KWVB 4DXAB 3ZRFA 1YD8U 3A9KA 2ASQA 3VQIA 4FULA 4MGKE 3PSEB 2AL3A 2ZPNA 2KC1A 2KMCA 5DPSA 2KZRA 2IO1B 3TL5A 1V9JA 4AJWA 2KFJA 4FBJB 3TCAA 2L05A 2KWUB 4BOZB 1V6EA 4GOCA 4IG7B 4IUMB 2MW5A 4EZKA 3A33B 1WFYA 3KVFB 1WXVA 2D10A 4W9IA 4K1RB 4YL8A 5AZHA 3S2AA 3W1SA 3JW0X 4AUQC 3DBLI 3L08A 5J17A 4MELA 2D3GA 1ZW7A 2UWQA 3OJ4B 4ZRJA 4KVGB 5DPWA 3Q3FA 3QA8A 2WYQA 2PEAA 2NPTB 2M17A 4KV2A 2PPHA 3X0WA 4KIKA 3RYTA 4PYZA 4MSQB 3JYUA 4FA6A 4WWOA 4LCDE 3OLMD 2FCNA 2DZJA 2UYZB 2MRPA 2JF5A 3WAOA 1V2YA 1WXMA 2KKCA 4K7UA 4KZ0A 3I3TB 1WZ0A 2L76A 2GBRA 1H4RA 1P98A 2HTHA 3U7DA 3DBSA 4HXDA 2N1WA 2BYVE 3PRMB 4XX5A 3VH4B 5JHAA 4EFOA 2N9EB 4MGIE 4FHKA 5CHVC 1R4MI 2KX0A 4HVBA 3RULA 2M4NA 2ZJDA 4FHJA 2G4SA 2KK8A 4HWIB 2M8SA 4FJYA 2O6VA 4G11A 1UBIA 2GOWA 3DVNU 2ZZPB 4AWJA 1V80A 1S3SG 4GU2A 2FAZA 2V4LA 2Y5BB 1U4AA 2MP2B 3N3KB 3A4RA 3ALBA 1TGZB 2IBIB 4IC7B 2KANA 3A1QB 3PHXB 2LZ6A 1WGHA 1IP9A 5DPTA 4W9FA 4FLHA 5LXHA 3HM3A 3KUZA 1HE8A 3ZTDA 5GMVA 4BKSA 4BKTA 2BKFA 3UINB 2KTRA 3KUDB 2J7QB 2J0JA 2KVRA 1RAXA 3MHSD 4RM8A 2MCNB 3U8ZA 2HJ8A 1FXTB 3V62A 1Y8RC 3QWZB 2KC2A 2AEHA 4B9KA 2MBQA 4HDOA 4HK2A 4DHJB 4DDID 3A9JA 4ANXA 3RCZA 2HD5B 1KM7A 1WF9A 2JRIB 2KNBA 3L0WB 2JPHA 3APDA 1WJ4A 4F1SA 1E7UA 1WYWB 2JRHA 4TQ0A 2A5UA 2K1FA 2O6VB 3IG3A 1OGWA 4DBGA 2L0FA 4NY0A 4KZCA 4FJVB 1Q1OA 1V81A 3DBRI 2DX5B 3VVWB 3UQAA 3IBEA 2ZVOA 3RUIB 3K9PB 2PE9A 4EZLA 3VHTC 3PRPB 1XT9B 2Z0DB 3NHEB 4W9JA 2I1JA 2LD9A 2RGFA 2ZNVB 3ONSA 3KYCD 4JL9A 5E6OA 1WE6A 2O6VD 3PT2B 2EMSA 4II2B 4DWFA 2LI5A 3L17A 3CSTA 1EUVB 3LDZE 1Q5WB 2DHZA 1RFAA 1WX8A 1BT0A 4E74A 2QHOA 3PREA 3X23A 2GBJA 4K81A 4RM9A 1WXAA 2KX3A 2CHWA 2MSED 3GZNI 3SD5A 2IY1B 2NBUA 5LLIA 3ZNZB 3A9JB 1K8RB 2JY6A 4GSWA 4MGYE 1GJZA 1QZEA 2CU1A 1OTRB 2M0XA 2V3SA 2XEWA 2KFKB 4II3B 1WX7A 2N1VA 3TIXA 2NBVB 4W9GA 4W9EA 3R7RA 4J6IA 1UBQA 1E5WA 2IO0B 4BVUC 3AU4A 1I35A 2LUEA 3NS8A 2MBOA 3M3JA 1G6JA 3M95A 3LJ3A 2MBHA 2NVUI 1TTNA 1L7YA 1XD3B 3A4SC 3ML8A 3QAQA 2N9XA 5DCNA 3WALA 3MJWA 3CF6E 2N4FA 5AEKB 2CS4A 2LGDA 1WE7A 2C7MB 2NBWB 1V49A 2AL6A 1GC6A 3ZNID 2MBBB 2NCNA 3HK0A 2KLGA 4NJ6A 2K6QA 3M62B 3JSVA 3PV1A 4GN1A 4KSLC 1P9DU 1F9JA 1RLFA 2IYDB 3DBHI 2DYMA 5KHOA 2D2QA 3PVLA 2LGYA 4ANUA 2LVOA 3PTFC 3Q3JA 3ZTCA 3A1QA 2KDEB 2AYOB 2Z0EB 4GGQA 2BF8B 2G3QB 2WX1A 3H7PB 4W9HA 3QCAA 4M8NA 4W9CA 3KYDD 4WJPA 2RD0A 4A3PA 2DAJA 1NDDA 2FIFA 4GB9A 5D2MB 3B0AA 2LWPA 1V86A 4IW0A 2K39A 1WI0A 5D7GA 3VUXA 3ZDTA 3R7QA 2CKHB 3HHMA 3DOWA 1LFDA 4MJSB 2BPSA 4B95A 2AWTA 3DVGY 3CMMB 4AP4C 3T8MA 2BKRB 3DVNV 1TZ1A 3NOBA 1YIWA 4NJ7A 2K25A 5IAAC 3PLUA 1A5RA 1WGDA 2GBMA 1OEYJ 2KN5A 3DQVA 3ZKJC 1T0YA 2IZVB 2Z59B 1WGGA 2RSUA 4XZ4A 3C0RB 3VTVA 3V61A 3H9DA 2YLMA 3KUCB 4JLCA 3KW5B 4IWQA 4EKUA 2FCQA 2LXCA 3B08A 1WM2A 4A20A 1WJUA 2DAFA 1E8YA 2KD0A 2JXXA 3QK0A 3TMPB 3PRZA 1I42A 1UZXB 4TQ1A 3APCA 4HPMB 2YVCA 3VFKA 2DENB 4G3XB 1LXDA 3O65B 3NZSA 1WRDB 2B3AA 2LVPA 2JWZA 2MLBA 3L16A 4OVVA 2M1MA 2KQSA 1E8ZA 2MBEA 4AOFA 3H6NA 1WMHA 3VH3B 2KDFB 4DDGD 1IYFA 2IO3B 1XQQA 1LQBA 2JZZA 4W9DA 5AZGA 2ZVNA 1Q0WB 1H8CA 4X57B 2FCSA 3RZWC 3ZO5B 4LJOB 1PQSA 5IA7A 2FIDA 4DHJD 4G50A 3ZUNA 2C5LC 1P1AA 4MM3A 5E6PA 2KMAA 2G45B 2L3ZA 1RRBA 2V1YA 2ZEQA 3AI5A 4I6NB 4W9LA 3RT3B 4ASWC 2KLCA 4JQWC 2KDBA 3V60A 1E8WA 1YQBA 3MTNB 3PZDA 3NZUA 2W9NA 2OOBB 1WJ6A 1X1MA 2FCMA 3WAPA 3ZW3A 4KSKC 2KFKA 4E71A 1M94A 1P3QU 3L10B 3UGBB 5L83A 2KXJA 1WM3A 3TBLD 1V5TA 3VAWA 5LXIB 1R4NI 1UELA 2R2OA 4I6PA 1S1QB 2I1KA 2KTRB 4KDIC 3HM6X 2LJ5A 1GNUA 2NR2A 2DYBA 2L7RA 3GOEA 4I6LB 2REXA 2RR9A 1E7VA 4PS8A 3VUWA 1L2NA 2JT4B 3NY5A 4ZDVA 3QQ8B 3L13A 1NI2A 5JZEB 2K6DB 4BKSD 2LGXA 4TUUA 4CO7A 4FN2A 2NPTA 1VD2A 4IM0A 2PJHA 2N7DA 1KJTA 1UD7A 5CHWA 4B6WA 3JSVB 1WR1A 3V6CB 2OJRA 3H1UA 4WWNA 3AU5A 5DPRA 4WJOA 4N9F4 3VUYA 1KLVA 4LJPB 5TR5A 2K8BA 4GXBA 4BOSC 1ZKHA 5FR6A 2KQ7A 1CMXB 3UQBA 3UF8A 3RD2A 3H7PA 2KHWB 3L54A 3VTUA 1OQYA 5J18A 2BWES 3EC8A 4MH0E 2DYOA 3D32A 4F7ZA 2MP2A 4JIOU 1MG8A 5J2RA 3EFUA 4DHZE 2K8CA 2C7HA 2VRRB 2WDTB 4EEWA 5G55A 1C1YB 1IPGA 2ZCBA 2O2VA 2BGFA 2ZPYA 4GIVA 3HIZA 2LRWA 2GBNA 3CSFA 1YX6B 4M8MA 2MQJA 2WWZA 4ZRKA 3V6EB 4AJYB 5KHQA 2RPQA 4NAWA 4HDQA 4IM3A 3W1SC 3ZNGC 1WGYA 2EMTA 2KOXA 4BBNC 3KH0A 4DK5A 4GDLB 4LDTD 1WX9A 2FNJB 4ANVA 2XK5A 5AZFA 4TV3A 4KIKB 2D11A 2LASA 3SDLC 2MX2A 3N32A 3QARA 4NAWB 4MSMB 3ZLZA 2DZMA 3APFA 3AXCA 4IM2A 3WA0A 3ZNHB 4A3OA 2A4ZA 2KTFA 3UIPB 4PS3A 3ZVVA 1SGHA 2EKEC 2XK5B 3ZIMA 2C9WB 1EF1A 3QHTA 4LDTB 3UIOB 3PGEA 4PYUA 2LVQA 4ANWA 1Z5SB 2GMIC 3BINA 1J8CA 4BFRA 3ENEA 1EO6A 1Z2MA 3N30A 2L00B 5D94A 3VXWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3SU8 X;  2GBK A;  4IWO A;  2JZ3 B;  2G4D B;  3IFW B;  4F8C B;  3H7S A;  4DHZ B;  4ZRI A;  2KDI A;  5E6N A;  1VCB A;  4HCN B;  5C23 A;  1WY8 A;  2CHZ A;  5HKH A;  4ICU A;  3W1Y A;  3DPD A;  1D3Z A;  2LXA A;  3PS6 A;  2PE6 B;  4MGZ E;  4GDL A;  4TKN A;  4W9K A;  3IHP C;  4RMA A;  5C1Z A;  4HJK A;  3JVZ X;  1WZ3 A;  1SE9 A;  2IO2 B;  4NNJ B;  3ML9 A;  2KO3 A;  2XBB C;  2WX0 A;  4HPL B;  4IWP A;  1EF5 A;  1AAR A;  4WQO B;  2CR5 A;  3QC8 B;  4EUT A;  4MDK E;  2J0M A;  3VDZ A;  2BWF A;  1E8X A;  4MJS A;  1C3T A;  1TBE A;  1NBF C;  4CHK A;  5JH5 C;  1ZGU B;  2KJH B;  3OJ3 A;  3ZDM C;  2BYE A;  1V5O A;  3R66 C;  3DCG A;  1WR6 E;  4HLE A;  3R3M A;  3WAM A;  3TJP A;  1WH3 A;  4EZJ A;  1LM8 B;  2JVC A;  3K9O B;  1GG3 A;  4XC2 A;  2MA9 B;  5BO4 B;  1GC7 A;  4M0W B;  3VTW A;  3WIM A;  3M63 B;  3QX1 A;  3WAN A;  2N9P C;  4GMV A;  4WJN A;  3IVF A;  4OVU A;  1KOT A;  3SHQ A;  1YX5 B;  4EOY A;  3A9K B;  3ZRC A;  4CYE A;  2BYF A;  4BBN F;  2L0T A;  3EEC A;  4GDK A;  2D07 B;  2NS5 A;  3QJZ A;  1JRU A;  3P2B A;  4WWP A;  2C7N B;  1WMH B;  1WIA A;  1WGR A;  4BKG A;  5JHB A;  2IY0 B;  2LRU A;  4WAA A;  2N7E A;  4MEM A;  2L8J A;  4KDL B;  2JUO A;  2C60 A;  4K7S A;  2O2V B;  4URK A;  2DZI A;  3DDC B;  4FAD A;  1OEY A;  1E90 A;  4NQK E;  5L95 C;  5CTR C;  2CHX A;  3T9L A;  3EHV A;  3PPA A;  1ISN A;  4FJZ A;  2K8H A;  4WJQ A;  1P0R A;  2FUH B;  4HCP B;  3QIJ A;  4NQL B;  1UGM A;  4G0N B;  1WXS A;  4NPN A;  3DVG X;  2KWC A;  3AUL A;  3OAW A;  1SIF A;  3PHW B;  4JGH B;  3ECI A;  2KJ6 A;  1J19 A;  1UH6 A;  3B1L X;  1GUA B;  5G2N A;  2R2Q A;  1J0G A;  4E3C A;  3RZF A;  4ICV A;  3PLV A;  1YJ1 A;  4P7I A;  5D6J B;  4ZYN A;  2MWS B;  3BY4 B;  5CHF A;  4GDK B;  2J0K A;  2DZK A;  4K7W A;  2KJR A;  3U30 A;  5EDS A;  2ZNV C;  2ZCC A;  4PS7 A;  5CX3 A;  1WJN A;  2HE7 A;  2KWV B;  4DXA B;  3ZRF A;  1YD8 U;  3A9K A;  2ASQ A;  3VQI A;  4FUL A;  4MGK E;  3PSE B;  2AL3 A;  2ZPN A;  2KC1 A;  2KMC A;  5DPS A;  2KZR A;  2IO1 B;  3TL5 A;  1V9J A;  4AJW A;  2KFJ A;  4FBJ B;  3TCA A;  2L05 A;  2KWU B;  4BOZ B;  1V6E A;  4GOC A;  4IG7 B;  4IUM B;  2MW5 A;  4EZK A;  3A33 B;  1WFY A;  3KVF B;  1WXV A;  2D10 A;  4W9I A;  4K1R B;  4YL8 A;  5AZH A;  3S2A A;  3W1S A;  3JW0 X;  4AUQ C;  3DBL I;  3L08 A;  5J17 A;  4MEL A;  2D3G A;  1ZW7 A;  2UWQ A;  3OJ4 B;  4ZRJ A;  4KVG B;  5DPW A;  3Q3F A;  3QA8 A;  2WYQ A;  2PEA A;  2NPT B;  2M17 A;  4KV2 A;  2PPH A;  3X0W A;  4KIK A;  3RYT A;  4PYZ A;  4MSQ B;  3JYU A;  4FA6 A;  4WWO A;  4LCD E;  3OLM D;  2FCN A;  2DZJ A;  2UYZ B;  2MRP A;  2JF5 A;  3WAO A;  1V2Y A;  1WXM A;  2KKC A;  4K7U A;  4KZ0 A;  3I3T B;  1WZ0 A;  2L76 A;  2GBR A;  1H4R A;  1P98 A;  2HTH A;  3U7D A;  3DBS A;  4HXD A;  2N1W A;  2BYV E;  3PRM B;  4XX5 A;  3VH4 B;  5JHA A;  4EFO A;  2N9E B;  4MGI E;  4FHK A;  5CHV C;  1R4M I;  2KX0 A;  4HVB A;  3RUL A;  2M4N A;  2ZJD A;  4FHJ A;  2G4S A;  2KK8 A;  4HWI B;  2M8S A;  4FJY A;  2O6V A;  4G11 A;  1UBI A;  2GOW A;  3DVN U;  2ZZP B;  4AWJ A;  1V80 A;  1S3S G;  4GU2 A;  2FAZ A;  2V4L A;  2Y5B B;  1U4A A;  2MP2 B;  3N3K B;  3A4R A;  3ALB A;  1TGZ B;  2IBI B;  4IC7 B;  2KAN A;  3A1Q B;  3PHX B;  2LZ6 A;  1WGH A;  1IP9 A;  5DPT A;  4W9F A;  4FLH A;  5LXH A;  3HM3 A;  3KUZ A;  1HE8 A;  3ZTD A;  5GMV A;  4BKS A;  4BKT A;  2BKF A;  3UIN B;  2KTR A;  3KUD B;  2J7Q B;  2J0J A;  2KVR A;  1RAX A;  3MHS D;  4RM8 A;  2MCN B;  3U8Z A;  2HJ8 A;  1FXT B;  3V62 A;  1Y8R C;  3QWZ B;  2KC2 A;  2AEH A;  4B9K A;  2MBQ A;  4HDO A;  4HK2 A;  4DHJ B;  4DDI D;  3A9J A;  4ANX A;  3RCZ A;  2HD5 B;  1KM7 A;  1WF9 A;  2JRI B;  2KNB A;  3L0W B;  2JPH A;  3APD A;  1WJ4 A;  4F1S A;  1E7U A;  1WYW B;  2JRH A;  4TQ0 A;  2A5U A;  2K1F A;  2O6V B;  3IG3 A;  1OGW A;  4DBG A;  2L0F A;  4NY0 A;  4KZC A;  4FJV B;  1Q1O A;  1V81 A;  3DBR I;  2DX5 B;  3VVW B;  3UQA A;  3IBE A;  2ZVO A;  3RUI B;  3K9P B;  2PE9 A;  4EZL A;  3VHT C;  3PRP B;  1XT9 B;  2Z0D B;  3NHE B;  4W9J A;  2I1J A;  2LD9 A;  2RGF A;  2ZNV B;  3ONS A;  3KYC D;  4JL9 A;  5E6O A;  1WE6 A;  2O6V D;  3PT2 B;  2EMS A;  4II2 B;  4DWF A;  2LI5 A;  3L17 A;  3CST A;  1EUV B;  3LDZ E;  1Q5W B;  2DHZ A;  1RFA A;  1WX8 A;  1BT0 A;  4E74 A;  2QHO A;  3PRE A;  3X23 A;  2GBJ A;  4K81 A;  4RM9 A;  1WXA A;  2KX3 A;  2CHW A;  2MSE D;  3GZN I;  3SD5 A;  2IY1 B;  2NBU A;  5LLI A;  3ZNZ B;  3A9J B;  1K8R B;  2JY6 A;  4GSW A;  4MGY E;  1GJZ A;  1QZE A;  2CU1 A;  1OTR B;  2M0X A;  2V3S A;  2XEW A;  2KFK B;  4II3 B;  1WX7 A;  2N1V A;  3TIX A;  2NBV B;  4W9G A;  4W9E A;  3R7R A;  4J6I A;  1UBQ A;  1E5W A;  2IO0 B;  4BVU C;  3AU4 A;  1I35 A;  2LUE A;  3NS8 A;  2MBO A;  3M3J A;  1G6J A;  3M95 A;  3LJ3 A;  2MBH A;  2NVU I;  1TTN A;  1L7Y A;  1XD3 B;  3A4S C;  3ML8 A;  3QAQ A;  2N9X A;  5DCN A;  3WAL A;  3MJW A;  3CF6 E;  2N4F A;  5AEK B;  2CS4 A;  2LGD A;  1WE7 A;  2C7M B;  2NBW B;  1V49 A;  2AL6 A;  1GC6 A;  3ZNI D;  2MBB B;  2NCN A;  3HK0 A;  2KLG A;  4NJ6 A;  2K6Q A;  3M62 B;  3JSV A;  3PV1 A;  4GN1 A;  4KSL C;  1P9D U;  1F9J A;  1RLF A;  2IYD B;  3DBH I;  2DYM A;  5KHO A;  2D2Q A;  3PVL A;  2LGY A;  4ANU A;  2LVO A;  3PTF C;  3Q3J A;  3ZTC A;  3A1Q A;  2KDE B;  2AYO B;  2Z0E B;  4GGQ A;  2BF8 B;  2G3Q B;  2WX1 A;  3H7P B;  4W9H A;  3QCA A;  4M8N A;  4W9C A;  3KYD D;  4WJP A;  2RD0 A;  4A3P A;  2DAJ A;  1NDD A;  2FIF A;  4GB9 A;  5D2M B;  3B0A A;  2LWP A;  1V86 A;  4IW0 A;  2K39 A;  1WI0 A;  5D7G A;  3VUX A;  3ZDT A;  3R7Q A;  2CKH B;  3HHM A;  3DOW A;  1LFD A;  4MJS B;  2BPS A;  4B95 A;  2AWT A;  3DVG Y;  3CMM B;  4AP4 C;  3T8M A;  2BKR B;  3DVN V;  1TZ1 A;  3NOB A;  1YIW A;  4NJ7 A;  2K25 A;  5IAA C;  3PLU A;  1A5R A;  1WGD A;  2GBM A;  1OEY J;  2KN5 A;  3DQV A;  3ZKJ C;  1T0Y A;  2IZV B;  2Z59 B;  1WGG A;  2RSU A;  4XZ4 A;  3C0R B;  3VTV A;  3V61 A;  3H9D A;  2YLM A;  3KUC B;  4JLC A;  3KW5 B;  4IWQ A;  4EKU A;  2FCQ A;  2LXC A;  3B08 A;  1WM2 A;  4A20 A;  1WJU A;  2DAF A;  1E8Y A;  2KD0 A;  2JXX A;  3QK0 A;  3TMP B;  3PRZ A;  1I42 A;  1UZX B;  4TQ1 A;  3APC A;  4HPM B;  2YVC A;  3VFK A;  2DEN B;  4G3X B;  1LXD A;  3O65 B;  3NZS A;  1WRD B;  2B3A A;  2LVP A;  2JWZ A;  2MLB A;  3L16 A;  4OVV A;  2M1M A;  2KQS A;  1E8Z A;  2MBE A;  4AOF A;  3H6N A;  1WMH A;  3VH3 B;  2KDF B;  4DDG D;  1IYF A;  2IO3 B;  1XQQ A;  1LQB A;  2JZZ A;  4W9D A;  5AZG A;  2ZVN A;  1Q0W B;  1H8C A;  4X57 B;  2FCS A;  3RZW C;  3ZO5 B;  4LJO B;  1PQS A;  5IA7 A;  2FID A;  4DHJ D;  4G50 A;  3ZUN A;  2C5L C;  1P1A A;  4MM3 A;  5E6P A;  2KMA A;  2G45 B;  2L3Z A;  1RRB A;  2V1Y A;  2ZEQ A;  3AI5 A;  4I6N B;  4W9L A;  3RT3 B;  4ASW C;  2KLC A;  4JQW C;  2KDB A;  3V60 A;  1E8W A;  1YQB A;  3MTN B;  3PZD A;  3NZU A;  2W9N A;  2OOB B;  1WJ6 A;  1X1M A;  2FCM A;  3WAP A;  3ZW3 A;  4KSK C;  2KFK A;  4E71 A;  1M94 A;  1P3Q U;  3L10 B;  3UGB B;  5L83 A;  2KXJ A;  1WM3 A;  3TBL D;  1V5T A;  3VAW A;  5LXI B;  1R4N I;  1UEL A;  2R2O A;  4I6P A;  1S1Q B;  2I1K A;  2KTR B;  4KDI C;  3HM6 X;  2LJ5 A;  1GNU A;  2NR2 A;  2DYB A;  2L7R A;  3GOE A;  4I6L B;  2REX A;  2RR9 A;  1E7V A;  4PS8 A;  3VUW A;  1L2N A;  2JT4 B;  3NY5 A;  4ZDV A;  3QQ8 B;  3L13 A;  1NI2 A;  5JZE B;  2K6D B;  4BKS D;  2LGX A;  4TUU A;  4CO7 A;  4FN2 A;  2NPT A;  1VD2 A;  4IM0 A;  2PJH A;  2N7D A;  1KJT A;  1UD7 A;  5CHW A;  4B6W A;  3JSV B;  1WR1 A;  3V6C B;  2OJR A;  3H1U A;  4WWN A;  3AU5 A;  5DPR A;  4WJO A;  4N9F 4;  3VUY A;  1KLV A;  4LJP B;  5TR5 A;  2K8B A;  4GXB A;  4BOS C;  1ZKH A;  5FR6 A;  2KQ7 A;  1CMX B;  3UQB A;  3UF8 A;  3RD2 A;  3H7P A;  2KHW B;  3L54 A;  3VTU A;  1OQY A;  5J18 A;  2BWE S;  3EC8 A;  4MH0 E;  2DYO A;  3D32 A;  4F7Z A;  2MP2 A;  4JIO U;  1MG8 A;  5J2R A;  3EFU A;  4DHZ E;  2K8C A;  2C7H A;  2VRR B;  2WDT B;  4EEW A;  5G55 A;  1C1Y B;  1IPG A;  2ZCB A;  2O2V A;  2BGF A;  2ZPY A;  4GIV A;  3HIZ A;  2LRW A;  2GBN A;  3CSF A;  1YX6 B;  4M8M A;  2MQJ A;  2WWZ A;  4ZRK A;  3V6E B;  4AJY B;  5KHQ A;  2RPQ A;  4NAW A;  4HDQ A;  4IM3 A;  3W1S C;  3ZNG C;  1WGY A;  2EMT A;  2KOX A;  4BBN C;  3KH0 A;  4DK5 A;  4GDL B;  4LDT D;  1WX9 A;  2FNJ B;  4ANV A;  2XK5 A;  5AZF A;  4TV3 A;  4KIK B;  2D11 A;  2LAS A;  3SDL C;  2MX2 A;  3N32 A;  3QAR A;  4NAW B;  4MSM B;  3ZLZ A;  2DZM A;  3APF A;  3AXC A;  4IM2 A;  3WA0 A;  3ZNH B;  4A3O A;  2A4Z A;  2KTF A;  3UIP B;  4PS3 A;  3ZVV A;  1SGH A;  2EKE C;  2XK5 B;  3ZIM A;  2C9W B;  1EF1 A;  3QHT A;  4LDT B;  3UIO B;  3PGE A;  4PYU A;  2LVQ A;  4ANW A;  1Z5S B;  2GMI C;  3BIN A;  1J8C A;  4BFR A;  3ENE A;  1EO6 A;  1Z2M A;  3N30 A;  2L00 B;  5D94 A;  3VXW A; 
#chains in the Genus database with same CATH topology
 1K52 A;  4IWO A;  4F8C B;  1MI0 A;  1F0Z A;  2KDI A;  4HCN B;  5C23 A;  1SB3 C;  2CHZ A;  5HKH A;  1TS5 A;  4W9K A;  3IHP C;  4OVZ A;  3BVG A;  1I7H A;  4IWP A;  3MC8 A;  1V1O A;  4MJS A;  4CHK A;  1ZGU B;  3OJ3 A;  2EEL A;  2BYE A;  1V5O A;  1QT9 A;  3NS1 A;  3TJP A;  3U52 E;  1LM8 B;  3K9O B;  1GG3 A;  3QX1 A;  2W3R A;  4OVU A;  4BAX A;  2M0A A;  2KWD A;  5HI1 A;  4YT0 B;  2L0T A;  4L23 A;  3QJZ A;  3P2B A;  4XWW A;  1T6B X;  2X38 A;  4BKG A;  3I63 C;  4MEM A;  4FAD A;  2FE8 A;  1XO3 A;  5CTR C;  2DBY A;  1JQ4 A;  3I57 A;  5IOI A;  2QC8 A;  2FUH B;  2OED A;  2DNF A;  3QIJ A;  4NQL B;  1UGM A;  4G0N B;  3DVG X;  1TS2 A;  4RNA A;  3RMK C;  3AE4 B;  2I2Y A;  2KJ6 A;  1J19 A;  1UH6 A;  2GRI A;  2WXP A;  1J0G A;  4K3C A;  3TEY A;  4XDC A;  5D6J B;  4EE2 A;  4C80 A;  1XF5 L;  5CHF A;  4K7W A;  4KKJ A;  2ZNV C;  1WJN A;  2HE7 A;  2KWV B;  2Y3A A;  3AN1 A;  2BS3 B;  2KZR A;  4FBJ B;  4RH6 A;  3AED B;  4BOZ B;  1YMH E;  1XCQ L;  3P4R B;  4IG7 B;  1TY0 A;  3A33 B;  3AV8 A;  1ET6 A;  1WFY A;  3ZYY X;  4K1R B;  3W1S A;  3Q8B A;  1KLG D;  2WDR B;  3IXS A;  2PEA A;  3P63 A;  2NPT B;  3X0W A;  4HEA 1;  4MSQ B;  3OLM D;  2MRP A;  4XDD A;  3VR8 B;  2L76 A;  3U7D A;  3NJT A;  3PRM B;  4KGS A;  1XXG A;  3VH4 B;  5JHA A;  2BS4 B;  4HVB A;  1OQR A;  2ZJD A;  2KK8 A;  1N62 A;  3DVN U;  4JPS A;  4GU2 A;  3OWE B;  2Q5W D;  1CQV A;  2WXN A;  1U4A A;  1SJE D;  1HZ6 A;  2PW9 A;  1ZOY B;  2KAN A;  3A1Q B;  4W9F A;  5LXH A;  3KUZ A;  1E0Z A;  2VH1 A;  1A70 A;  2RPV A;  3GP7 A;  3MHS D;  1FXT B;  1Y8R C;  2BB6 A;  3BWU D;  1UWM A;  5EE9 A;  3RN9 C;  2KC2 A;  1JWU D;  4B9K A;  4HDO A;  4HK2 A;  1N60 A;  2BYT A;  2JPH A;  3APD A;  3E9S A;  4TQ0 A;  4DBG A;  2L0F A;  4FJV B;  1Q1O A;  1V81 A;  2MH7 A;  1YJJ A;  2Y5P A;  1ROE A;  3AEE B;  3K9P B;  2PE9 A;  1DOI A;  3VHT C;  4LTU A;  1GOZ A;  1HQR D;  2LD9 A;  4W9J A;  3ONS A;  3KYC D;  1WE6 A;  2LI5 A;  2INP E;  1SE4 A;  3LDZ E;  2DHZ A;  1RFA A;  3WCQ A;  3X23 A;  1P7F A;  2GBJ A;  4K81 A;  4WWM A;  4LNN A;  1WXA A;  4N58 A;  2KX3 A;  2CHW A;  3AEA B;  5LLI A;  3ZNZ B;  1K8R B;  3AEB B;  1HZ5 A;  2M0X A;  1OTR B;  1WX7 A;  3EUB 2;  1J7C A;  1Y56 A;  2NBV B;  4W9G A;  5TSS A;  3BK2 A;  4BVU C;  2IO0 B;  3AU4 A;  3NS8 A;  1G6J A;  1AYF A;  2WGS A;  3M95 A;  1L7Y A;  3ML8 A;  5DCN A;  2C7M B;  2NBW B;  2X8X X;  1GC6 A;  3ZNI D;  2KLG A;  2V9H A;  2K6Q A;  2WU5 B;  4MT5 A;  4RFB A;  5KHO A;  1CJE A;  4M0W A;  3Q3O C;  3PTF C;  2G3Q B;  3H7P B;  4FXC A;  4M8N A;  3UI3 A;  3KYD D;  2FIF A;  4P1B C;  2LWP A;  5IO9 A;  4B95 A;  3DVG Y;  4LLG M;  3CMM B;  4B0E A;  2D3A A;  4PT5 A;  3Q8E A;  5IAA C;  3PLU A;  2KN5 A;  1OEY J;  1T0Y A;  1WGG A;  2RSU A;  2VZK D;  4JLC A;  2LXC A;  3AE6 B;  2L52 A;  1WJU A;  1E8Y A;  3PRZ A;  4TQ1 A;  4HPM B;  2GB1 A;  2DEN B;  2ZW1 A;  2LVP A;  5BMH A;  2JWZ A;  4OVV A;  2XNA C;  1E8Z A;  2GLS A;  3VH3 B;  1IYF A;  2DLB A;  1SBB B;  1XQQ A;  1LQB A;  1E6E B;  1PUT A;  1PGX A;  3RZW C;  1FNW A;  3ZO5 B;  4LJO B;  1PQS A;  2E6X A;  3ZUN A;  2C5L C;  5E6P A;  4W9L A;  3BZD B;  4C4V B;  1E8W A;  1YQB A;  3PZD A;  3L10 B;  4MM3 B;  2KXJ A;  2L83 A;  2R2O A;  4KDI C;  2I1K A;  3HM6 X;  3L4P A;  4USA A;  2NR2 A;  3RPF C;  1GB1 A;  2INN E;  1SEB D;  1ZXH A;  3VUW A;  1T5X D;  2NPT A;  4IM0 A;  4JWU C;  2N7D A;  2RDB C;  1KJT A;  4B6W A;  2J53 A;  4WWN A;  3AU5 A;  1FXA A;  5DPR A;  1JW9 D;  1SE3 A;  3RNC C;  5BYS A;  2YEP F;  4LJP B;  4DXF A;  2JQR B;  2K8B A;  4GXB A;  2G9H D;  3UF8 A;  5J18 A;  1DOY A;  2BWE S;  3EC8 A;  1DYQ A;  2BBC A;  2DYO A;  4JIO U;  2YEP B;  3EFC A;  4EEW A;  4GIV A;  2BGF A;  5D3I B;  3HIZ A;  2GBN A;  1YX6 B;  2MQJ A;  4NAW A;  4IM3 A;  3W1S C;  4BBN C;  2EMT A;  2V3N A;  2W54 A;  1L6V A;  3KH0 A;  3HVZ A;  2KAJ A;  4TV3 A;  2D11 A;  2LAS A;  2OJW A;  4HRS A;  2MX2 A;  3QAR A;  4NAW B;  3APF A;  4IM2 A;  1ET9 A;  2EKE C;  1EWY C;  1FXI A;  4LDT B;  2LVQ A;  4WUR A;  1C78 A;  2JWU A;  3DBL B;  2LJI A;  1Z2M A;  1Q5W B;  2L00 B;  3SU8 X;  2GBK A;  2D3B A;  3RNF C;  3IFW B;  4LNF A;  3N1Y C;  2MJE A;  5IKC M;  3AEF B;  3W1Y A;  3DPD A;  3PS6 A;  4IOI E;  4TKN A;  4GDL A;  4ZHP A;  4HJK A;  2K9X A;  2IO2 B;  4NNJ B;  1ACC A;  4O1N A;  3B2G A;  1FIQ A;  1AAR A;  3BYY B;  1RM6 C;  4XWT A;  2KJH B;  3MC0 B;  3ZDM C;  3RNE C;  4UDU C;  3R66 C;  3DCG A;  1WR6 E;  4HLE A;  3DWG C;  1I4H A;  1WH3 A;  1XLN A;  2JVC A;  2MA9 B;  4ITK A;  1GC7 A;  1MHH E;  1SE2 A;  2N9P C;  3GS2 A;  1LO5 D;  1KOT A;  1YX5 B;  3P4S B;  5G5H A;  3ZRC A;  4CYE A;  4S0R A;  2WQY B;  2BYF A;  4GDK A;  3EEC A;  4M01 A;  2D07 B;  2NS5 A;  2QSD A;  2D5G A;  4OZB A;  3TSS A;  5JHB A;  2LRU A;  5BYQ A;  2N7E A;  2CJN A;  2JUO A;  2O2V B;  2WLB A;  4URK A;  4NJC A;  1ZP0 B;  2VZK B;  3ZGZ A;  1E90 A;  3Q3N C;  2PVO D;  5T8I A;  3EHV A;  3I9V 1;  3AUL A;  2ON8 A;  3OAW A;  4JGH B;  4BZA A;  3B1L X;  2R2Q A;  4E3C A;  3RZF A;  3GE3 C;  3PZ8 A;  4ACF A;  2HTM E;  1YJ1 A;  1C77 A;  3U30 A;  2ZCC A;  4PS7 A;  3ZRF A;  5JXV A;  4FUL A;  4MGK E;  3PSE B;  3FAH A;  2KMC A;  5DPS A;  3TL5 A;  4AJW A;  4KGR A;  3TCA A;  1JWB D;  4A6Q A;  2L05 A;  2KWU B;  2AQ3 B;  4P1C C;  1PFD A;  2L1A A;  3AB5 A;  2AQ2 B;  2MW5 A;  1PYW D;  2BW2 A;  1YQ4 B;  3JW0 X;  3L08 A;  4MEL A;  2D3G A;  1MPE A;  2UWQ A;  4ZRJ A;  5DPW A;  2JYE A;  2WYQ A;  3NVW A;  4KIK A;  3CWI A;  4US9 A;  3JYU A;  4LCD E;  3FC4 A;  3I3T B;  3DBS A;  2BYV E;  4EFO A;  4FHK A;  5CHV C;  1R4M I;  3RUL A;  1V97 A;  2G4S A;  2O6V A;  1WYG A;  2WU2 B;  1IGD A;  4AWJ A;  1V80 A;  2FAZ A;  1NI3 A;  2V4L A;  1WSP A;  3DHG C;  2M19 A;  2MP2 B;  4WH4 A;  3A4R A;  3ALB A;  1Q10 A;  3U2S C;  4IC7 B;  1SSN A;  4RF0 A;  3V3X A;  1WGH A;  4FLH A;  4KKI A;  4BKS A;  5GMV A;  1VZ6 A;  2BKF A;  1VLB A;  1ZDX A;  2KTR A;  3KUD B;  2J7Q B;  2J0J A;  1PGA A;  4RM8 A;  2MCN B;  2WXK A;  2AEH A;  1ZUD 2;  3A9J A;  4ANX A;  3RCZ A;  2HD5 B;  1KM7 A;  1WF9 A;  2XN9 C;  1XLQ A;  3L0W B;  1WJ4 A;  1N63 A;  1TS4 A;  1WYW B;  3TEX A;  4RCO A;  2A5U A;  2O6V B;  2WXO A;  1P7E A;  1V8C A;  4KZC A;  1D4B A;  3DBR I;  1FPY A;  2ZVO A;  1QQR A;  3HVD A;  1YNT E;  2QJL A;  4HRO A;  2PIA A;  2EKI A;  3NHE B;  2I1J A;  2ICI A;  2EMS A;  1QOF A;  4M02 A;  4E74 A;  1WXQ A;  2QHO A;  1AN8 A;  2H89 B;  3C19 A;  1VZ7 A;  4MGY E;  1GJZ A;  1GPX A;  3TIX A;  3I5J C;  4LK0 M;  4J6I A;  1FCC C;  3M3J A;  4N6E B;  4WAF A;  5HG2 A;  4IKG A;  4Q2J A;  1D5Z C;  3QAQ A;  1F2R C;  3B9J A;  2CS4 A;  2LGD A;  1WE7 A;  3ZJU A;  2HJ1 A;  1MG4 A;  3R2I A;  3JSV A;  1FFV A;  3AH7 A;  2DYM A;  1YQ3 B;  3Q8F A;  5EE1 A;  3PVL A;  2LGY A;  3SEB A;  4ANU A;  3SR6 A;  2ONQ A;  5IN7 A;  3A1Q A;  2AYO B;  4HKQ A;  4GGQ A;  4WJP A;  2BF8 B;  5HFY A;  4W9C A;  3QCA A;  2DAJ A;  1NDD A;  4GB9 A;  1YN5 A;  2LHD A;  1V86 A;  2WS3 B;  4IW0 A;  5D7G A;  1ESF A;  4JWS C;  3VUX A;  1R4M B;  2L32 A;  3P1M A;  4MJS B;  2OHF A;  1FO4 A;  3DVN V;  4QAY A;  1TZ1 A;  3DBH B;  1YIW A;  4NJ7 A;  2K25 A;  1KF6 B;  2GBM A;  2PTL A;  3DQV A;  2IZV B;  2LGI A;  2Z59 B;  5FR3 A;  4XZ4 A;  2YLM A;  3Q8A A;  3KW5 B;  4RGN A;  2FCQ A;  2ACZ B;  1K53 A;  2DAF A;  3QK0 A;  2JZP A;  4KGT A;  2J4X A;  1UZX B;  1V1P A;  1TJE A;  2YVC A;  3VFK A;  3O65 B;  3NZS A;  4YSZ B;  3L16 A;  3ZJV A;  2M1M A;  4DDG D;  1SF0 A;  5BMI A;  1TKE A;  2NTT A;  2JZZ A;  2ZVN A;  4X57 B;  2FCS A;  4G50 A;  1P1A A;  4YSX B;  2KMA A;  2V1Y A;  2KLC A;  4JQW C;  3V60 A;  3MTN B;  3NZU A;  2W9N A;  3ZW3 A;  3RNG C;  2G1E A;  3Q3M C;  2KFK A;  3UGB B;  4RF1 A;  4DXG A;  3TBL D;  3VAW A;  1YOV B;  2CU3 A;  2J52 A;  4YTM B;  2WXF A;  2L7R A;  2RR9 A;  2WXL A;  4PS8 A;  2JT4 B;  3NY5 A;  3QQ8 B;  3NVZ A;  3P4P B;  5JZE B;  3MHZ A;  2MHJ A;  2LGX A;  4FN2 A;  1VD2 A;  2PJH A;  3JSV B;  1WR1 A;  1XLP A;  3IAS 1;  4WJO A;  1JRP A;  4N9F 4;  1KLV A;  4C00 A;  3GE8 C;  1NYR A;  1CMX B;  3UQB A;  3RD2 A;  3H7P A;  2KHW B;  3L54 A;  3VTU A;  3D32 A;  4F7Z A;  4HJG E;  3V05 A;  3EFU A;  4DHZ E;  2K8C A;  2VRR B;  3DHH C;  3AE9 B;  1C1Y B;  3U4E G;  2QCZ A;  4ZRQ A;  4AJY B;  1I4G A;  3ZNG C;  2KOX A;  4DK5 A;  2N0S B;  4GDL B;  1E10 A;  5AZF A;  3RI7 C;  3N32 A;  3LB8 C;  4A3O A;  3WA0 A;  3ZNH B;  2A4Z A;  3LYY A;  3UIP B;  4PS3 A;  3ZVV A;  1SGH A;  4RGO S;  3ZIM A;  3PGE A;  2I38 A;  4ANW A;  1Z5S B;  3BIN A;  3AEC B;  3MP9 A;  3NVV A;  4C56 C;  2JZ3 B;  3H7S A;  4LNK A;  4ZRI A;  5E6N A;  4YWG G;  3AMZ A;  5GXG B;  1WY8 A;  4ICU A;  1EM7 A;  2LXA A;  1XLO A;  4MGZ E;  5C1Z A;  2VH2 A;  3JVZ X;  5H92 C;  1SIJ A;  4NZL B;  2XBB C;  2WX0 A;  1EF5 A;  4WQO B;  1JRO A;  4EUT A;  2BWF A;  4LNI A;  1TBE A;  1NBF C;  2WXI A;  4R3D A;  4CQN A;  1TS3 A;  3WAM A;  4EZJ A;  1FRD A;  4XC2 A;  5BO4 B;  3VTW A;  3WAN A;  2ZW0 A;  4WJN A;  3PO0 A;  5AUK A;  1R4N B;  2WDQ B;  2JYT A;  3PZ7 A;  3RNA C;  1DGJ A;  2C7N B;  1WMH B;  4A8X C;  1WIA A;  1WGR A;  1C79 A;  3BVM A;  2L8J A;  3AE1 B;  4K7S A;  5I4D A;  1VR9 A;  1D5M C;  2DZI A;  3DDC B;  1OEY A;  1VJK A;  4NQK E;  2CHX A;  3AM9 A;  1JAL A;  1FCL A;  2K8H A;  4WJQ A;  1P0R A;  4HCP B;  5C3J B;  2IJ0 A;  1RWS A;  2KWC A;  1SIF A;  3Q14 C;  3ECI A;  5G2N A;  1L0V B;  4NAM A;  3AE8 B;  1I4X A;  4ZYN A;  2PLP A;  3SFD B;  2MWS B;  2DZK A;  4C7Y A;  1F52 A;  2AX5 A;  5EDS A;  1TKY A;  3C8Y A;  5CX3 A;  4DXA B;  3URY A;  2ASQ A;  1C4A A;  5E6J A;  2AL3 A;  3OG5 A;  1D5X C;  1V6E A;  4XYC A;  4EZK A;  2W3S A;  3KVF B;  1WXV A;  2D10 A;  4YL8 A;  5AZH A;  3ZXR A;  4AUQ C;  1STE A;  5BYR A;  1ZW7 A;  3DWM A;  4KVG B;  1UUP A;  1RFK A;  3TEW A;  2M17 A;  2PPH A;  2JSV X;  3RYT A;  4PYZ A;  4WWO A;  2PKO A;  2UYZ B;  3WAO A;  1V2Y A;  1WXM A;  2N9L A;  1GB4 A;  4HXD A;  2N1W A;  2N9E B;  2KX0 A;  5HHD G;  2M4N A;  2JXT A;  1TIF A;  2M8S A;  4FJY A;  1AW7 A;  1UBI A;  1N5W A;  2GOW A;  1S3S G;  2Y5B B;  3W9C B;  3DHI C;  1TYG B;  2KVZ A;  1GAQ B;  1TGZ B;  2IBI B;  1FNU A;  3PHX B;  2LZ6 A;  4N59 A;  1IP9 A;  5DPT A;  1PDX A;  1L0Y B;  3ZTD A;  1HE8 A;  3FIL B;  1IUE A;  1M4V A;  2KVR A;  3U8Z A;  2V0G A;  3QWZ B;  1IBX B;  2GI9 A;  3CIR B;  2MBQ A;  2MJD A;  2KNB A;  2JRI B;  4OHJ A;  3RNB C;  2JU6 X;  4H2A A;  2WNM A;  1E7U A;  2JRH A;  1I4Q A;  3AE7 B;  2K1F A;  3IG3 A;  1OGW A;  2CJO A;  4NY0 A;  2LMC A;  2WDV B;  1QLB B;  2DX5 B;  3VVW B;  3UQA A;  3IBE A;  1DOX A;  4P6V F;  1XT9 B;  2Z0D B;  3PT2 B;  2O6V D;  4DWF A;  3L17 A;  3CST A;  1FNV A;  1YN3 A;  1PGB A;  2RMM A;  3NUH B;  1BT0 A;  3P4Q B;  3PRE A;  1N61 A;  4HKZ E;  2MSE D;  3GZN I;  2DWQ A;  3SD5 A;  2LHE A;  2NBU A;  5BMG A;  1K50 A;  1J7B A;  2JY6 A;  4GSW A;  2XEW A;  2CU1 A;  2V3S A;  2KFK B;  5IP4 D;  2N1V A;  3MJ5 A;  3J9C A;  2BVC A;  5FKA C;  3NRZ A;  1IGC A;  1UBQ A;  4AQ7 A;  1QOG A;  1I35 A;  2LUE A;  2MBO A;  2MBH A;  1TTN A;  3EGR A;  1XD3 B;  3A4S C;  3N20 C;  3WAL A;  4B0M A;  5AEK B;  2WP9 B;  3H8H A;  2AL6 A;  2W55 A;  3ZJT A;  4NJ6 A;  4ZHO A;  4GN1 A;  1NEN B;  1P9D U;  2IYD B;  3DBH I;  2WXH A;  2NTS A;  3TUO A;  2D2Q A;  2LVO A;  3GB1 A;  5D3D A;  3Q3J A;  2B76 B;  2K3U A;  3HRD D;  4W9H A;  2WX1 A;  2J42 A;  4A3P A;  2KAC A;  3P42 A;  2WXJ A;  2K39 A;  2BB5 A;  3ZDT A;  2CKH B;  3HHM A;  1LFD A;  3KWL A;  4AP4 C;  3BYT B;  2BKR B;  1A5R A;  3ZKJ C;  3VTV A;  3V61 A;  3H9D A;  3KUC B;  4IWQ A;  3BVZ A;  3B08 A;  1WM2 A;  1KFY B;  2MJ3 A;  2JXX A;  1I42 A;  4TSS A;  5C2T B;  3APC A;  2WXG A;  4G3X B;  1WRD B;  2B3A A;  1F1H A;  1L4D B;  2MLB A;  1RYJ A;  2D3C A;  2MBE A;  1MHX A;  4ZYS A;  2IO3 B;  4M00 A;  5AZG A;  1H8C A;  5IA7 A;  2QMT A;  4DHJ D;  3Q69 A;  4MM3 A;  1FM0 D;  2L3Z A;  1RRB A;  3AI5 A;  3RT3 B;  1WJ6 A;  1X1M A;  4E71 A;  1P3Q U;  1WM3 A;  4WIP A;  5LXI B;  2KTR B;  2LJ5 A;  2DYB A;  1TZO A;  2REX A;  1L2N A;  3Q6B A;  1KLU D;  3NG0 A;  2K6D B;  4BKS D;  4TUU A;  3ZQ4 A;  4CO7 A;  3AE3 B;  3GZN B;  2KT7 A;  3BII D;  1TY2 A;  1UD7 A;  4JE3 B;  5CHW A;  3H1U A;  1LGR A;  3VUY A;  2V4I B;  2BT6 A;  1T0R C;  1L6U A;  4BOS C;  1ZKH A;  2KQ7 A;  2Z8L A;  2IGG A;  1QF6 A;  1HXY D;  4MH0 E;  1B1Z A;  1L0X B;  3KWV A;  5MPO A;  1VZ8 A;  1AWD A;  1EWC A;  2ZCB A;  2O2V A;  2LRW A;  3CSF A;  3V6E B;  4M8M A;  4ZRK A;  2RPQ A;  1T0S C;  1WGY A;  1B9R A;  1WX9 A;  1SJH D;  4ANV A;  2XK5 A;  4K3B A;  4XE0 A;  4C7Z A;  2DZM A;  3AXC A;  2XK5 B;  2C9W B;  1EF1 A;  3QHT A;  3UIO B;  2IPK D;  3KLS X;  2GMI C;  4WQM A;  2NMQ A;  4BFR A;  3ENE A;  1EO6 A;  5D94 A;  1J7A A;  3TEZ A;  2G4D B;  4DHZ B;  3ABV B;  1VCB A;  1MVK A;  1ZPS A;  2PMV A;  1ENF A;  3LXF A;  1E7P B;  1ZE3 D;  1D3Z A;  2KN4 A;  2PE6 B;  4RMA A;  4A55 A;  1WZ3 A;  3W5U B;  1SE9 A;  3ML9 A;  2KO3 A;  4HPL B;  2QDF A;  2CR5 A;  3QC8 B;  4MDK E;  1TKG A;  2J0M A;  3VDZ A;  1E8X A;  1C3T A;  5JH5 C;  3VRA B;  3FKY A;  3VRB B;  1JWA D;  2KYW A;  1WGK A;  2N7J A;  3R3M A;  2INC C;  4M0W B;  3VR9 B;  3WIM A;  1C9F A;  3M63 B;  2IGD A;  4GMV A;  3IVF A;  1V1P B;  2R61 A;  3AE2 B;  3SHQ A;  2K22 A;  4EOY A;  1N5X A;  3A9K B;  5AUI A;  4BBN F;  4XGA B;  1UGJ A;  4YTP B;  1BXT A;  1JRU A;  4WWP A;  4A9A A;  1HA5 A;  2IY0 B;  1L5P A;  4WAA A;  1BML C;  4KDL B;  1JCK B;  2C60 A;  3IT4 B;  3T3O A;  5L95 C;  3O13 A;  2MEK A;  2N9K A;  4J3O D;  3T9L A;  4FJZ A;  3PPA A;  1ISN A;  4YTN B;  1CK1 A;  3BK1 A;  4NPN A;  1WXS A;  3PHW B;  4P16 A;  1E9M A;  1QKZ A;  1R7S A;  1QOA A;  1FFU A;  1GUA B;  1YJI A;  3RFZ B;  4ICV A;  3PLV A;  3E56 A;  4P7I A;  3BY4 B;  3ETR A;  4GDK B;  2J0K A;  2KJR A;  1YD8 U;  3A9K A;  3VQI A;  2WHI A;  2ZPN A;  2KC1 A;  2IO1 B;  1V9J A;  2KFJ A;  2LEK A;  2H88 B;  4GOC A;  4IUM B;  2RDH A;  3IT6 B;  4AS1 A;  4W9I A;  3S2A A;  1JWM D;  3DBL I;  5J17 A;  3OJ4 B;  1WRI A;  3Q3F A;  1WWT A;  3QA8 A;  2FUG 1;  4KV2 A;  2WXQ A;  3KQ4 A;  4FA6 A;  1C4P A;  2FCN A;  2DZJ A;  2JF5 A;  1BUI C;  2KKC A;  4KZ0 A;  1C76 A;  2M56 B;  4K7U A;  1WZ0 A;  2GBR A;  1H4R A;  1P98 A;  2HTH A;  4XX5 A;  4MGI E;  4FHJ A;  4S17 A;  4HWI B;  4G11 A;  1OQQ A;  2ZZP B;  3NVY A;  4L2Y A;  1SXT A;  3N3K B;  2K0P A;  2UU7 A;  4MAC A;  2WXR A;  1XCT L;  2TSS A;  3HM3 A;  3SFE B;  4BKT A;  4C4V A;  3UIN B;  2QEJ C;  2IND C;  1RAX A;  1NVI D;  4ARI A;  2HJ8 A;  3V62 A;  3HUI A;  4DHJ B;  4DDI D;  2KQ4 X;  3MC9 A;  4TMA B;  1T0Q C;  4F1S A;  3W5V B;  3IAM 1;  2RDG A;  2FBW B;  4OZA A;  4GLS C;  2QIL A;  2SEB D;  1UF0 A;  1ZDV A;  3RUI B;  1C4C A;  3U7Z A;  4REZ A;  3NZ3 A;  4EZL A;  3EA6 A;  3PRP B;  4D2K A;  2JX5 A;  3N1Z C;  1NYQ A;  2ZNV B;  2RGF A;  4JL9 A;  2QIE B;  5E6O A;  4II2 B;  3FIL A;  1EUV B;  1WX8 A;  3N9Y C;  2PVG C;  2KMM A;  4RM9 A;  2LFI A;  3T3N A;  2IY1 B;  3DBR B;  5H8Y E;  3A9J B;  1T3Q A;  1QZE A;  4II3 B;  4RGT A;  4W9E A;  1E5W A;  1YN4 A;  1FRR A;  3LJ3 A;  2NVU I;  2N9X A;  3MJW A;  3CF6 E;  2N4F A;  2V3P A;  1UNS A;  4ARC A;  1V49 A;  2AQ1 B;  5G5G A;  2MBB B;  2NCN A;  2W82 A;  3HK0 A;  3M62 B;  3PV1 A;  4KSL C;  1F9J A;  1RLF A;  1KRH A;  3W2D A;  3MFG A;  3ZTC A;  2KDE B;  2Z0E B;  3N1X C;  3R7R A;  2RD0 A;  5D2M B;  3B0A A;  1D6E C;  1WI0 A;  3R7Q A;  4JX1 C;  2E3T A;  3DOW A;  1MJD A;  2BPS A;  4IDI A;  2AWT A;  4OZC A;  4HPP A;  3T8M A;  3NOB A;  1QOB A;  1WGD A;  3C0R B;  4EKU A;  1K51 A;  5EE0 A;  4A20 A;  2KD0 A;  2SAK A;  3TMP B;  4A90 A;  1ZXI A;  1JML A;  1LXD A;  4KX6 B;  2IGH A;  1L4Z B;  2KQS A;  1XEE A;  4AOF A;  3H6N A;  1WMH A;  2KDF B;  2BQQ A;  1N6Z A;  4W9D A;  1VDV A;  1Q0W B;  4US8 A;  2FID A;  2HDE A;  2G45 B;  2ZEQ A;  4I6N B;  4ASW C;  1F2R I;  2KDB A;  1FEH A;  2OOB B;  3WAP A;  1I4P A;  2FCM A;  2IDY A;  4KSK C;  1M94 A;  5L83 A;  2LGS A;  3Q2A C;  1V5T A;  4RGM A;  3Q8C A;  2BTE A;  3R8B A;  1EU4 A;  4L1B A;  1R4N I;  1UEL A;  1UWX A;  1S1Q B;  4I6P A;  1FD6 A;  1FMA D;  1GNU A;  1I4R A;  3GOE A;  1KH0 A;  4I6L B;  1E7V A;  4ZDV A;  3L13 A;  2LUM A;  1NI2 A;  1CZP A;  4LNO A;  3V6C B;  1QIL A;  2OJR A;  5EE3 A;  3B2F A;  1MFW A;  5LNK 1;  5TR5 A;  5FK9 C;  4ZOH C;  2WXM A;  5FR6 A;  1HEZ E;  2Y5C A;  1OQY A;  2KDM A;  2MP2 A;  1HTQ A;  1MG8 A;  5J2R A;  1OFF A;  3ZXV A;  2C7H A;  2WDT B;  1VRA B;  5G55 A;  1KTK A;  2K5P A;  1IPG A;  4MH8 A;  2ZPY A;  3AE5 B;  4PK1 A;  2WWZ A;  1JWS D;  5KHQ A;  4DQO C;  4HDQ A;  4YSY B;  4ZRP A;  4LDT D;  2FNJ B;  3R2T A;  4KIK B;  2BS2 B;  1NEK B;  3SDL C;  1IBX A;  1HTO A;  4MSM B;  3ZLZ A;  3AEG B;  4YXD B;  2KTF A;  1F77 A;  1EU3 A;  4PYU A;  4OW0 A;  1TT5 B;  1J8C A;  3N30 A;  3VXW A; 
#chains in the Genus database with same CATH homology
 3SU8 X;  2GBK A;  4IWO A;  2JZ3 B;  2G4D B;  3IFW B;  4F8C B;  3H7S A;  4DHZ B;  4ZRI A;  2KDI A;  5E6N A;  1VCB A;  4HCN B;  5C23 A;  1WY8 A;  2CHZ A;  5HKH A;  4ICU A;  3W1Y A;  3DPD A;  1D3Z A;  2LXA A;  3PS6 A;  2PE6 B;  4MGZ E;  4GDL A;  4TKN A;  4W9K A;  3IHP C;  4RMA A;  5C1Z A;  4HJK A;  3JVZ X;  1WZ3 A;  1SE9 A;  2IO2 B;  4NNJ B;  3ML9 A;  2KO3 A;  2XBB C;  2WX0 A;  4HPL B;  4IWP A;  1EF5 A;  1AAR A;  4WQO B;  2CR5 A;  3QC8 B;  4EUT A;  4MDK E;  2J0M A;  3VDZ A;  2BWF A;  1E8X A;  4MJS A;  1C3T A;  1TBE A;  1NBF C;  4CHK A;  5JH5 C;  1ZGU B;  2KJH B;  3OJ3 A;  3ZDM C;  2BYE A;  1V5O A;  3R66 C;  3DCG A;  1WR6 E;  4HLE A;  3R3M A;  3WAM A;  3TJP A;  1WH3 A;  4EZJ A;  1LM8 B;  2JVC A;  3K9O B;  1GG3 A;  4XC2 A;  2MA9 B;  5BO4 B;  1GC7 A;  4M0W B;  3VTW A;  3WIM A;  3M63 B;  3QX1 A;  3WAN A;  2N9P C;  4GMV A;  4WJN A;  3IVF A;  4OVU A;  1KOT A;  3SHQ A;  1YX5 B;  4EOY A;  3A9K B;  3ZRC A;  4CYE A;  2BYF A;  4BBN F;  2L0T A;  3EEC A;  4GDK A;  2D07 B;  2NS5 A;  3QJZ A;  1JRU A;  3P2B A;  4WWP A;  2C7N B;  1WMH B;  1WIA A;  1WGR A;  4BKG A;  5JHB A;  2IY0 B;  2LRU A;  4WAA A;  2N7E A;  4MEM A;  2L8J A;  4KDL B;  2JUO A;  2C60 A;  4K7S A;  2O2V B;  4URK A;  2DZI A;  3DDC B;  4FAD A;  1OEY A;  1E90 A;  4NQK E;  5L95 C;  5CTR C;  2CHX A;  3T9L A;  3EHV A;  3PPA A;  1ISN A;  4FJZ A;  2K8H A;  4WJQ A;  1P0R A;  2FUH B;  4HCP B;  3QIJ A;  4NQL B;  1UGM A;  4G0N B;  1WXS A;  4NPN A;  3DVG X;  2KWC A;  3AUL A;  3OAW A;  1SIF A;  3PHW B;  4JGH B;  3ECI A;  2KJ6 A;  1J19 A;  1UH6 A;  3B1L X;  1GUA B;  5G2N A;  2R2Q A;  1J0G A;  4E3C A;  3RZF A;  4ICV A;  3PLV A;  1YJ1 A;  4P7I A;  5D6J B;  4ZYN A;  2MWS B;  3BY4 B;  5CHF A;  4GDK B;  2J0K A;  2DZK A;  4K7W A;  2KJR A;  3U30 A;  5EDS A;  2ZNV C;  2ZCC A;  4PS7 A;  5CX3 A;  1WJN A;  2HE7 A;  2KWV B;  4DXA B;  3ZRF A;  1YD8 U;  3A9K A;  2ASQ A;  3VQI A;  4FUL A;  4MGK E;  3PSE B;  2AL3 A;  2ZPN A;  2KC1 A;  2KMC A;  5DPS A;  2KZR A;  2IO1 B;  3TL5 A;  1V9J A;  4AJW A;  2KFJ A;  4FBJ B;  3TCA A;  2L05 A;  2KWU B;  4BOZ B;  1V6E A;  4GOC A;  4IG7 B;  4IUM B;  2MW5 A;  4EZK A;  3A33 B;  1WFY A;  3KVF B;  1WXV A;  2D10 A;  4W9I A;  4K1R B;  4YL8 A;  5AZH A;  3S2A A;  3W1S A;  3JW0 X;  4AUQ C;  3DBL I;  3L08 A;  5J17 A;  4MEL A;  2D3G A;  1ZW7 A;  2UWQ A;  3OJ4 B;  4ZRJ A;  4KVG B;  5DPW A;  3Q3F A;  3QA8 A;  2WYQ A;  2PEA A;  2NPT B;  2M17 A;  4KV2 A;  2PPH A;  3X0W A;  4KIK A;  3RYT A;  4PYZ A;  4MSQ B;  3JYU A;  4FA6 A;  4WWO A;  4LCD E;  3OLM D;  2FCN A;  2DZJ A;  2UYZ B;  2MRP A;  2JF5 A;  3WAO A;  1V2Y A;  1WXM A;  2KKC A;  4K7U A;  4KZ0 A;  3I3T B;  1WZ0 A;  2L76 A;  2GBR A;  1H4R A;  1P98 A;  2HTH A;  3U7D A;  3DBS A;  4HXD A;  2N1W A;  2BYV E;  3PRM B;  4XX5 A;  3VH4 B;  5JHA A;  4EFO A;  2N9E B;  4MGI E;  4FHK A;  5CHV C;  1R4M I;  2KX0 A;  4HVB A;  3RUL A;  2M4N A;  2ZJD A;  4FHJ A;  2G4S A;  2KK8 A;  4HWI B;  2M8S A;  4FJY A;  2O6V A;  4G11 A;  1UBI A;  2GOW A;  3DVN U;  2ZZP B;  4AWJ A;  1V80 A;  1S3S G;  4GU2 A;  2FAZ A;  2V4L A;  2Y5B B;  1U4A A;  2MP2 B;  3N3K B;  3A4R A;  3ALB A;  1TGZ B;  2IBI B;  4IC7 B;  2KAN A;  3A1Q B;  3PHX B;  2LZ6 A;  1WGH A;  1IP9 A;  5DPT A;  4W9F A;  4FLH A;  5LXH A;  3HM3 A;  3KUZ A;  1HE8 A;  3ZTD A;  5GMV A;  4BKS A;  4BKT A;  2BKF A;  3UIN B;  2KTR A;  3KUD B;  2J7Q B;  2J0J A;  2KVR A;  1RAX A;  3MHS D;  4RM8 A;  2MCN B;  3U8Z A;  2HJ8 A;  1FXT B;  3V62 A;  1Y8R C;  3QWZ B;  2KC2 A;  2AEH A;  4B9K A;  2MBQ A;  4HDO A;  4HK2 A;  4DHJ B;  4DDI D;  3A9J A;  4ANX A;  3RCZ A;  2HD5 B;  1KM7 A;  1WF9 A;  2JRI B;  2KNB A;  3L0W B;  2JPH A;  3APD A;  1WJ4 A;  4F1S A;  1E7U A;  1WYW B;  2JRH A;  4TQ0 A;  2A5U A;  2K1F A;  2O6V B;  3IG3 A;  1OGW A;  4DBG A;  2L0F A;  4NY0 A;  4KZC A;  4FJV B;  1Q1O A;  1V81 A;  3DBR I;  2DX5 B;  3VVW B;  3UQA A;  3IBE A;  2ZVO A;  3RUI B;  3K9P B;  2PE9 A;  4EZL A;  3VHT C;  3PRP B;  1XT9 B;  2Z0D B;  3NHE B;  4W9J A;  2I1J A;  2LD9 A;  2RGF A;  2ZNV B;  3ONS A;  3KYC D;  4JL9 A;  5E6O A;  1WE6 A;  2O6V D;  3PT2 B;  2EMS A;  4II2 B;  4DWF A;  2LI5 A;  3L17 A;  3CST A;  1EUV B;  3LDZ E;  1Q5W B;  2DHZ A;  1RFA A;  1WX8 A;  1BT0 A;  4E74 A;  2QHO A;  3PRE A;  3X23 A;  2GBJ A;  4K81 A;  4RM9 A;  1WXA A;  2KX3 A;  2CHW A;  2MSE D;  3GZN I;  3SD5 A;  2IY1 B;  2NBU A;  5LLI A;  3ZNZ B;  3A9J B;  1K8R B;  2JY6 A;  4GSW A;  4MGY E;  1GJZ A;  1QZE A;  2CU1 A;  1OTR B;  2M0X A;  2V3S A;  2XEW A;  2KFK B;  4II3 B;  1WX7 A;  2N1V A;  3TIX A;  2NBV B;  4W9G A;  4W9E A;  3R7R A;  4J6I A;  1UBQ A;  1E5W A;  2IO0 B;  4BVU C;  3AU4 A;  1I35 A;  2LUE A;  3NS8 A;  2MBO A;  3M3J A;  1G6J A;  3M95 A;  3LJ3 A;  2MBH A;  2NVU I;  1TTN A;  1L7Y A;  1XD3 B;  3A4S C;  3ML8 A;  3QAQ A;  2N9X A;  5DCN A;  3WAL A;  3MJW A;  3CF6 E;  2N4F A;  5AEK B;  2CS4 A;  2LGD A;  1WE7 A;  2C7M B;  2NBW B;  1V49 A;  2AL6 A;  1GC6 A;  3ZNI D;  2MBB B;  2NCN A;  3HK0 A;  2KLG A;  4NJ6 A;  2K6Q A;  3M62 B;  3JSV A;  3PV1 A;  4GN1 A;  4KSL C;  1P9D U;  1F9J A;  1RLF A;  2IYD B;  3DBH I;  2DYM A;  5KHO A;  2D2Q A;  3PVL A;  2LGY A;  4ANU A;  2LVO A;  3PTF C;  3Q3J A;  3ZTC A;  3A1Q A;  2KDE B;  2AYO B;  2Z0E B;  4GGQ A;  2BF8 B;  2G3Q B;  2WX1 A;  3H7P B;  4W9H A;  3QCA A;  4M8N A;  4W9C A;  3KYD D;  4WJP A;  2RD0 A;  4A3P A;  2DAJ A;  1NDD A;  2FIF A;  4GB9 A;  5D2M B;  3B0A A;  2LWP A;  1V86 A;  4IW0 A;  2K39 A;  1WI0 A;  5D7G A;  3VUX A;  3ZDT A;  3R7Q A;  2CKH B;  3HHM A;  3DOW A;  1LFD A;  4MJS B;  2BPS A;  4B95 A;  2AWT A;  3DVG Y;  3CMM B;  4AP4 C;  3T8M A;  2BKR B;  3DVN V;  1TZ1 A;  3NOB A;  1YIW A;  4NJ7 A;  2K25 A;  5IAA C;  3PLU A;  1A5R A;  1WGD A;  2GBM A;  1OEY J;  2KN5 A;  3DQV A;  3ZKJ C;  1T0Y A;  2IZV B;  2Z59 B;  1WGG A;  2RSU A;  4XZ4 A;  3C0R B;  3VTV A;  3V61 A;  3H9D A;  2YLM A;  3KUC B;  4JLC A;  3KW5 B;  4IWQ A;  4EKU A;  2FCQ A;  2LXC A;  3B08 A;  1WM2 A;  4A20 A;  1WJU A;  2DAF A;  1E8Y A;  2KD0 A;  2JXX A;  3QK0 A;  3TMP B;  3PRZ A;  1I42 A;  1UZX B;  4TQ1 A;  3APC A;  4HPM B;  2YVC A;  3VFK A;  2DEN B;  4G3X B;  1LXD A;  3O65 B;  3NZS A;  1WRD B;  2B3A A;  2LVP A;  2JWZ A;  2MLB A;  3L16 A;  4OVV A;  2M1M A;  2KQS A;  1E8Z A;  2MBE A;  4AOF A;  3H6N A;  1WMH A;  3VH3 B;  2KDF B;  4DDG D;  1IYF A;  2IO3 B;  1XQQ A;  1LQB A;  2JZZ A;  4W9D A;  5AZG A;  2ZVN A;  1Q0W B;  1H8C A;  4X57 B;  2FCS A;  3RZW C;  3ZO5 B;  4LJO B;  1PQS A;  5IA7 A;  2FID A;  4DHJ D;  4G50 A;  3ZUN A;  2C5L C;  1P1A A;  4MM3 A;  5E6P A;  2KMA A;  2G45 B;  2L3Z A;  1RRB A;  2V1Y A;  2ZEQ A;  3AI5 A;  4I6N B;  4W9L A;  3RT3 B;  4ASW C;  2KLC A;  4JQW C;  2KDB A;  3V60 A;  1E8W A;  1YQB A;  3MTN B;  3PZD A;  3NZU A;  2W9N A;  2OOB B;  1WJ6 A;  1X1M A;  2FCM A;  3WAP A;  3ZW3 A;  4KSK C;  2KFK A;  4E71 A;  1M94 A;  1P3Q U;  3L10 B;  3UGB B;  5L83 A;  2KXJ A;  1WM3 A;  3TBL D;  1V5T A;  3VAW A;  5LXI B;  1R4N I;  1UEL A;  2R2O A;  4I6P A;  1S1Q B;  2I1K A;  2KTR B;  4KDI C;  3HM6 X;  2LJ5 A;  1GNU A;  2NR2 A;  2DYB A;  2L7R A;  3GOE A;  4I6L B;  2REX A;  2RR9 A;  1E7V A;  4PS8 A;  3VUW A;  1L2N A;  2JT4 B;  3NY5 A;  4ZDV A;  3QQ8 B;  3L13 A;  1NI2 A;  5JZE B;  2K6D B;  4BKS D;  2LGX A;  4TUU A;  4CO7 A;  4FN2 A;  2NPT A;  1VD2 A;  4IM0 A;  2PJH A;  2N7D A;  1KJT A;  1UD7 A;  5CHW A;  4B6W A;  3JSV B;  1WR1 A;  3V6C B;  2OJR A;  3H1U A;  4WWN A;  3AU5 A;  5DPR A;  4WJO A;  4N9F 4;  3VUY A;  1KLV A;  4LJP B;  5TR5 A;  2K8B A;  4GXB A;  4BOS C;  1ZKH A;  5FR6 A;  2KQ7 A;  1CMX B;  3UQB A;  3UF8 A;  3RD2 A;  3H7P A;  2KHW B;  3L54 A;  3VTU A;  1OQY A;  5J18 A;  2BWE S;  3EC8 A;  4MH0 E;  2DYO A;  3D32 A;  4F7Z A;  2MP2 A;  4JIO U;  1MG8 A;  5J2R A;  3EFU A;  4DHZ E;  2K8C A;  2C7H A;  2VRR B;  2WDT B;  4EEW A;  5G55 A;  1C1Y B;  1IPG A;  2ZCB A;  2O2V A;  2BGF A;  2ZPY A;  4GIV A;  3HIZ A;  2LRW A;  2GBN A;  3CSF A;  1YX6 B;  4M8M A;  2MQJ A;  2WWZ A;  4ZRK A;  3V6E B;  4AJY B;  5KHQ A;  2RPQ A;  4NAW A;  4HDQ A;  4IM3 A;  3W1S C;  3ZNG C;  1WGY A;  2EMT A;  2KOX A;  4BBN C;  3KH0 A;  4DK5 A;  4GDL B;  4LDT D;  1WX9 A;  2FNJ B;  4ANV A;  2XK5 A;  5AZF A;  4TV3 A;  4KIK B;  2D11 A;  2LAS A;  3SDL C;  2MX2 A;  3N32 A;  3QAR A;  4NAW B;  4MSM B;  3ZLZ A;  2DZM A;  3APF A;  3AXC A;  4IM2 A;  3WA0 A;  3ZNH B;  4A3O A;  2A4Z A;  2KTF A;  3UIP B;  4PS3 A;  3ZVV A;  1SGH A;  2EKE C;  2XK5 B;  3ZIM A;  2C9W B;  1EF1 A;  3QHT A;  4LDT B;  3UIO B;  3PGE A;  4PYU A;  2LVQ A;  4ANW A;  1Z5S B;  2GMI C;  3BIN A;  1J8C A;  4BFR A;  3ENE A;  1EO6 A;  1Z2M A;  3N30 A;  2L00 B;  5D94 A;  3VXW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...