1XXGA

Crystal structure of staphylococcal enterotoxin g
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
233
structure length
227
Chain Sequence
QPDPKLDELNKVSDYKSNKGTMGNVMNLYMSPPVEGRGVINSRQFLSHDLIFPIEYKSYNEVKTELENTELANNYKGKKVDIFGVPYFYTCIIPKSEPFGGCCMYGGLTFNSSENRDKLITVQVTIDNRQSLGFTITTNKNMVTIQELDYKARHWLTKEKKLYEFDGSAFESGYIKFTEKNNTSFWFDLFPKKELVPFVPYKFLNIYGDNKVVDSKSIKMEVFLNTH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords enterotoxin
publication title The Crystal Structure of Staphylococcal Enterotoxin G and binding affinity to T-cell receptor and MHC class II molecule
rcsb
source organism Staphylococcus aureus
total genus 61
structure length 227
sequence length 233
ec nomenclature
pdb deposition date 2004-11-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01123 Stap_Strp_toxin Staphylococcal/Streptococcal toxin, OB-fold domain
A PF02876 Stap_Strp_tox_C Staphylococcal/Streptococcal toxin, beta-grasp domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.110 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1xxgA02
3.10.20.120 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1xxgA01
3OWEB 3BVZA 1LT6D 1S5FD 1CHQD 3EFXD 1LT3D 4RGOS 1LO5D 2NTTA 2XRQD 2Z8LA 1HXYD 1L0XB 4O1NA 4RH6A 1DYQA 1SJHD 1EEID 1PZKD 1RD9D 4RFBA 4L63B 1V1PB 1ET9A 1TS3A 2TSSA 1PTOB 3SEBA 1LTTD 1BXTA 3DWQA 2CHBD 1YN3A 2QEJC 1UUPA 1T5XD 3DWAA 4DXGA 1SXTA 1PTOD 3BZDB 1G8ZD 2IPKD 1RCVD 1JWSD 1SJED 1YN4A 1PTOC 4RCOA 1BCPB 1JR0D 2XNAC 1JCKB 1KLUD 1S5CD 4RGNA 2RDGA 1S5BD 1STEA 1UNSA 5ELDA 1AW7A 1PRTF 1EU4A 1BCPD 5I4DA 1YN5A 2WV6D 1XTCD 1S5DD 1SE4A 4UDUC 5D3DA 5ELFA 5TSSA 1BCPC 1D5ZC 1HA5A 2SEBD 1I4XA 1JQYD 1RF2D 1PYWD 2G9HD 4BWGB 3CHBD 1V1PA 3GP7A 1EFID 2QILA 1I4RA 1PZID 1FGBD 1LTBD 4Z9CB 3W2DA 3R8BA 4RGTA 1TS5A 1S5ED 5FKAC 4TSSA 1B44D 2O2LD 1LT4D 1LTGD 3BVGA 1XXGA 1I4PA 1EU3A 3MC0B 2RDHA 2XRSD 1CT1D 1KLGD 3KLSX 1EEFD 1LLRD 3URYA 2NTSA 2ICIA 1RDPD 5ELEA 1D6EC 1DJRD 2R61A 1B1ZA 1TS2A 1LTSD 3TSSA 3O13A 3V05A 1LTAD 2AQ1B 1CHPD 3MFGA 1LTID 1TY0A 3BYTB 3BVMA 4L6TB 1CQVA 1JWUD 4RHRA 5ELBA 1KTKA 1PTOH 2XN9C 4OHJA 4RGMA 1JWMD 1L0YB 1PRTB 1LTRD 1SBBB 4NZLB 3BYYB 4DXFA 1TY2A 5FK9C 1FNWA 1PTOF 5D3IB 1PRTD 2IJ0A 1ESFA 1AN8A 1PRTC 1TS4A 1QILA 4RHSA 1SE2A 1M4VA 4ZYSA 1HQRD 1EWCA 1BCPF 1I4GA 1PZJD 1ET6A 3R2IA 3R2TA 1CK1A 1D5MC 1I4HA 1SE3A 5ELCA 1MD2D 3DWPA 4C56C 1ENFA 1F77A 1I4QA 2J4XA 1D5XC 1LT5D 1V1OA 1HTLD 2AQ2B 1FD7D 3EA6A 1FNVA 1GOZA 1FNUA 1SEBD 4K6LA 2AQ3B
chains in the Genus database with same CATH superfamily
1ILPA 4LFAQ 3CKIB 1VQLA 2YVCA 3KYCD 3NRZA 3M4YA 1YHAA 2UU9Q 1LO5D 3JW0X 2JVCA 4KX6B 1V86A 3D32A 4EE2A 3APCA 4GLAC 4A3DB 1WXSA 3VYRA 3G71A 4BS9A 1TTNA 1J7BA 3GE3C 1UBQA 3VA7A 1P98A 3KF8B 5GADC 1N33L 2D3AA 5J2RA 3V2TA 1HA6A 2NBFA 4LJOB 3SVMA 1CZPA 4POGA 4A3JG 1BBUA 2AMCB 1ZYRD 2R2OA 2M19A 4TMAB 2FINB 1WCMG 1VQ7A 4ACFA 1E9MA 2HQEA 4DKAC 5C3WA 3AECB 2PW9A 3C46A 1O78A 2KBNA 4J8QA 1GUWA 1RLFA 3Q0AA 3CCRA 1VD2A 2K5PA 5E6JA 1B50A 3NELA 2B63H 4KV2A 1EU4A 2KHWB 4JLCA 5JHAA 3AB9A 5D14A 2IO2B 3P4RB 4JWUC 1XJVA 3KUZA 3F2DA 1I94L 4C3JG 4NJCA 5BN3A 4YL8A 1I4XA 3H8HA 2N3SA 3ZNHB 2DYMA 2QHOA 5IE8A 2B2VA 1OXUA 3MHZA 4KGSA 4DR3Q 3HEJA 3NXWA 2QEXA 1WJ6A 3DVNU 4FN2A 1F2LA 3EROA 2Y0SE 5KHOA 1HFNA 3S9WA 3J7AV 1LM8B 2FFKB 2WIIB 5KGUA 2O5IC 1LT4D 5CX3A 2GVAA 2JXMB 5HGQA 3D4WA 2ID0A 1L6UA 1PDQA 1QE6A 4N9F4 1GPXA 1CT1D 2F0SA 2VQFL 2H4OA 1HCZA 4CO7A 1YQ4B 4A93B 2Q2UA 2BKFA 1EUVB 4MGIE 4IPDA 2UXCL 4WJPA 2RD0A 3DEOA 4DR5L 4IM0A 1A70A 2R61A 1I50H 1D1KA 1S40A 4KD3A 1WFQA 4LF7Q 1Q1EA 4H0LC 3V05A 1K28A 2KDMA 1V2YA 4C3HH 2WXIA 2KFKB 1VCIA 3MFGA 3PO0A 4KJNA 3SDZA 2LFNA 5EQ0A 5C6AA 3GD7A 3UE1A 2DY7A 4PZ7A 1X56A 1YJNA 3VAWA 2I1JA 3EJIA 4NZLB 4V0BA 1CA6A 1QJOA 3CSTA 1WI5A 1QNUA 4BY1H 1NJIC 3GE8C 4FBJB 3J81j 5DNFA 1WJUA 4YIJA 4DR1Q 1FRDA 1HH2P 3T9LA 4DAPA 2BPSA 3D8GA 4MN3A 3CU7A 2IGDA 3QG1A 5IYCH 1J7AA 2WX0A 4CQNA 3A9JB 1HQRD 3PMFA 2XEWA 4B9XA 4DV3Q 4IUUA 4JCVE 3RN5A 4PT5A 5CV9A 3S1QH 1ASZA 4RA8A 2V9HA 1EQVA 3KJOA 1VZ6A 4LFBQ 2SOBA 3GTGH 4GZYC 3NWSA 2KXJA 3N1XC 1UE1A 4KY7A 2WYQA 2KWVB 2UUBL 4MDKE 5IGBA 4UY8C 3HM3A 5FR3A 4LWCA 4TRDA 2RGFA 2YEPF 2CU3A 2YYZA 2JA8G 2LGDA 4RKBA 1QVGA 5GROA 2ZM6L 5IO9A 1KH0A 3TBLD 4CDFC 2KJHB 3NVWA 2OCEA 3SK5A 1SNQA 3Q3OC 1TKWB 3DQVA 4HPLB 1ICWA 3AFQA 3DVGY 2QW7A 3FP9A 2FCQA 3UINB 4JPBW 2R7ZB 3AEEB 2V1YA 1YVCA 3TEXA 1CSQA 1ZE3D 2PQEA 5EAYA 1WZ0A 4DUZQ 2VRRB 4K7WA 1BVSA 4L5QA 4B3SL 4UP7A 1YIJA 2JA5G 1G51A 2GMIC 4HPPA 2F3WA 5CC4A 1J6QA 3QARA 3VR6A 1Z5SB 4C80A 3G48A 1GAQB 1FCCC 1FFVA 2JEBI 4AUQC 1FPYA 2DAFA 3SR6A 2KHIA 3V61A 1IKLA 4BA2I 2IPKD 2VQFQ 1U0LA 2ICEC 4EVOA 1WFYA 1WVLA 1VQKA 4LFCL 4DR5Q 5E3FA 3PHXB 3CCSA 1SE9A 3AXCA 1L5PA 1EYAA 4BBSH 4FXDA 3B6YA 1HUMA 4LNQA 2M1MA 4OZAA 1DOLA 2FMCA 5I4DA 1VDVA 3D4RA 2HTHA 3TS0A 2WAQE 4ZRQA 1Q90A 2WKDA 3UDFA 2E2HH 4N58A 2SEBD 1A2UA 1JQYD 1VLBA 3N20C 4ARIA 3PO3H 1FMAD 1F2RI 1JOOA 1S4ZA 3VVWB 1C9OA 1Y1VG 2C7MB 3E56A 2CR5A 2PYKA 3M3YH 4B3RQ 4BZAA 1LTGD 3K80C 1PV4A 2WACA 3H0GB 5DM63 2WDQB 5KEEA 5C0XJ 4G4KA 2AL3A 2ON8A 3GQBA 1N32Q 2PQAB 2RDHA 2XRSD 4PV1C 3S1RH 4IDIA 1YBYA 2VUMG 2K9XA 4DV0Q 3CMEA 1Q5WB 1X3EA 1WJJA 4FO2A 1JB7A 2NVTB 2WLBA 3VH4B 2F4VQ 2EPBA 3FKIH 3JC66 2HE7A 1V5TA 2SNMA 3MVVA 4K5XA 2LEKA 4ZHOA 1K50A 3NENA 1C48A 2KLGA 4K1RB 5HFYA 3RUIB 3RR5A 3DHIC 2WXQA 4ME5A 3VR4A 2J0KA 1TWFH 3GTLB 1MI2A 4DV7Q 3QCAA 1PMRA 2MNAA 1RWSA 1WTWA 2Y0SB 4LLGM 2B2VC 1A63A 2XSCA 4OX9L 1K8AC 4NXNL 1PH3A 1UGMA 3TL5A 2EYHA 4EUTA 4PS7A 4HSPA 2I5LX 2B2UA 3I4NH 2A4ZA 4S3SA 2WU5B 2DZIA 1Y1WG 4O2DA 3ICEA 1E8XA 2K5NA 3NS1A 4ZYSA 2B63G 1MJDA 2DX5B 2PW5A 4G57A 1D1IA 2JYEA 5TR5A 3DDCB 1QZGA 1EOTA 4JOIC 4FP5D 2QDLA 3D6CA 4KN4C 3CQZH 4HVBA 5IP7G 3L0OA 1SSNA 5CV6A 4FXCA 1VQNA 3L4PA 3H6MA 3UIPB 3VR3A 3N1YC 3N6RA 4QUFA 4DK1A 2K33A 4X66Q 2D3CA 3L9AX 1DOIA 4K0KL 1YOVB 2LGYA 1K9MC 1SMXA 4HDQA 2BS2B 3RD4A 5E4WC 5EPLA 2MO0A 4NQLB 2F0PA 2XRQD 4IOIE 1HXYD 1YITA 2RSUA 2RKSA 1VQHA 3TUOA 2EY5A 2KVMA 4BFRA 4W9JA 2F0DA 1JJCB 1TS3A 3ZNGC 1PHJA 4N8FA 2JSVX 3W5UB 1UE5A 3AM9A 4JG2A 4A3EB 3K9PB 1NSNS 3EECA 3S14B 2EDGA 4KHPQ 3W1SA 1SMYD 4DXGA 4IUTA 4KIKA 3CPWA 3NOBA 2MLBA 1TKYA 3HUIA 3A4RA 4RCOA 2BWES 1ZXTA 3TS2A 4KJOA 2BS3B 3AE7B 2WDVB 1JB3A 1TZOA 4LF5L 5IP4D 4X65L 4N6EB 4BY1G 4GOPB 4IWPA 1AW7A 1E24A 3WDNA 2CWPA 3UIOB 4NXML 3ZNZB 3NP8A 1WXVA 1BKBA 5IYCG 4LNIA 3IFWB 4NW2A 4OVVA 2EY1A 4OW0A 2ZW0A 5IGDA 3HOYH 3Q24A 3PUVA 3T4AC 4DR6Q 1ZDVA 2WHIA 3KWVA 5JZEB 1I4RA 1LTBD 4JK1C 2CJNA 3PO2H 2L0CA 3OTOL 4CGYB 4G50A 3KOJA 1NMGA 1N36L 4OX9Q 4A3DG 1MPEA 4M0WB 3UI2A 4IFDI 2MBBB 3RLFA 3T1YL 1L0WA 2K6DB 3LDZE 3AEDB 3UF8A 1FM0D 4JI6Q 1XT9B 3VH3B 3RNGC 3G6EA 4A3GB 2MWSB 3MP9A 5M9OA 2LFIA 2DHZA 2HIXA 1Q82C 3DLLA 1DONA 4ASWC 3PT2B 1IKMA 1YNTE 1E2WA 2L52A 5FJ8H 3H3VC 4OZBA 1FGUA 3AEAB 5EGTA 4DV1Q 2MJEA 3LX0A 1NR4A 3P1HA 3K7AH 2LXKA 4JBWA 4KLKA 4ME3A 4N9TA 5J1ZA 5IYDG 1F9JA 1Q1OA 1YMHE 3Q8EA 1VF7A 1E1OA 1WGDA 3A1QA 3MEFA 1U4RA 1Y8NB 3IHPC 2ZW1A 3NZSA 1BUVT 3VHTC 4F8CB 2Z0SA 1EZ6A 4DAYB 2D0OA 1XNRL 4KZCA 5EKKA 1IBLL 2BYVE 4Q2JA 4W9EA 3J80E 3LYYA 3I2ZA 1X55A 5FLMH 1K0SA 3A9KB 3PSIA 5FO9B 4HAEA 5JEAH 3NHEB 3VRAB 4YWGG 3NUHB 3VTVA 4E74A 4ARCA 4XC2A 4TUUA 2CJOA 4DDGD 1AARA 2WS3B 2Q2HA 4R4QA 3CAMA 4ZKCB 4A93G 2E8GA 3OHXC 2B2WC 3W3AA 5I6WA 5IYBG 2ZJPA 3DWGC 4JQWC 2JQRB 1ENFA 1QVFA 2IY1B 2CQAA 4URKA 4X62L 1KC8C 2DNCA 4HJ7A 1FNVA 4LF5Q 4AQYQ 4K3BA 2BA1A 2Z9HA 4IURA 1FIQA 2LHEA 2KN5A 3P7JA 2RF4A 1K8OA 3J81E 3C3LA 2GI9A 1STBA 1KDAA 1PH6A 4BKSA 3RUZA 5LXHA 3GTPB 4IJLA 2HUGA 3PGZA 1UE6A 2C35B 2CS4A 4S17A 2A74C 4MGZE 1VQAA 2IWHA 4DV6Q 3FEWX 4PYZA 4BKSD 1H8CA 2EYMA 1JROA 2R3ZA 4F87A 4GDKA 2B2UC 2FAZA 1I6VC 1QOAA 1Y56A 3QAQA 1SIJA 4S0RA 4CJ2C 1R4PB 3B1LX 2BS4B 4EFOA 3V96A 4AJYB 3HG9A 1IBXA 3LJ3A 1X1MA 1DOYA 3MZ5A 1PTOC 3VA5A 1JCKB 3SK4A 3HIZA 5CGKA 1XQQA 4EQNA 1YNND 1T6BX 4I6PA 1SIFA 1STEA 2CHXA 2Z6BA 1VQIA 3JAMc 1QOHA 1XWEA 3KF6A 4APVA 1PH8A 2QF7A 1OGWA 3I4NG 2BB6A 2SAKA 3J9CA 4B08A 2N9KA 4C3IB 2ZXRA 1QWYA 3AE1B 1WD1A 1FL0A 1EFID 4NQKE 2QILA 3ZGZA 1C4QA 1C0AA 1JORA 1NMFA 2HQLA 2K14A 3BDCA 4QGUA 2R7ZG 3HVZA 3KUCB 1WXMA 4OIKA 3NQTA 3ML8A 4RF0A 1XNRQ 3H9DA 4IFDG 2F0TA 2RVLA 1AE2A 1LUZA 5EPKA 4X64Q 1R4QB 1XX8A 1OTCA 1L2NA 3H7SA 1E2VA 4DNIA 3GB1A 3L7ZC 1K3BC 3I56A 1EY7A 1LLRD 2JWUA 2NTSA 2A73B 2MP2A 4JI5Q 1RDPD 1GM5A 4K5WA 4XQJA 2J52A 5JHBA 2GN5A 2D3BA 5DPSA 1L1OC 3UQAA 3RLOA 2I38A 2KEDA 2PW7A 5K36G 1TWCH 3F8TA 1GNUA 3ZQ4A 4W9DA 2L9HA 4CKCA 2D2CC 2L11A 3HOUH 1IZ6A 3J7AF 2N7DA 1BDOA 4UPAA 3VYSA 3PLVA 4X3SA 1IYFA 3S2HB 4QQBX 2FHTA 5JVH3 1YEZA 1HNXL 4LNNA 4WFN3 5GAGC 5E4XA 1WJ4A 1TIID 1XCQL 5I2YA 4C00A 3Q6SA 3EHVA 1VQCA 3KUDB 1N61A 2E2IH 4HCEA 3CD6A 3DBRB 3TEZA 4KKSA 1A5RA 4RHSA 3S17B 3EGRA 3K7UC 2WX1A 3JAML 1UD7A 1WSPA 1EWCA 3RZOB 3IG3A 3GTOH 1PH5A 2L83A 3AV8A 4DDID 1ZXIA 2L0FA 1A2TA 1F2YA 3HRDD 4A4IA 2N88A 3IAS1 1KQSA 1PUTA 1SE3A 1X3PA 1MD2D 3TREA 4C56C 2I0QA 1DCZA 3HOYG 1Q1BA 4A75A 2INDC 1L2FA 5JJLA 1F2ZA 3K6OA 4DV2Q 1FNUA 1V1QA 2A6HC 4QJFA 1KNAA 4L63B 4R8NA 1I3QB 2F0EA 4FHKA 4J3OD 1YZ6A 3NPPA 3H7PA 3BVZA 3S1MH 1XO3A 1SYBA 3FKYA 3CP0A 4RGOS 1WJNA 2NTTA 2DN8A 3OIQA 3SU8X 2NZ1D 3BS1A 4RH6A 2F0MA 2Y0SG 2ZZPB 3S2AA 1EIFA 1E3PA 3SXHA 4HRSA 3RN2A 1YJWA 2CHZA 1NCVA 4P1CC 2KCMA 3AQQA 2YTXA 2Z59B 1TVXA 2SDFA 2OJWA 4XQNA 2M4NA 2JA9A 1TBEA 4QAYA 4F1SA 5J17A 2M00A 1R7SA 3K5LA 4TKNA 4MIUA 2L76A 3S15H 1EOVA 5DLQE 4A3IH 1U9RA 1H9KA 4C2MB 4KDIC 4PMWA 1GUOA 4YCWA 1I6HH 1CKMA 1SNCA 3DEPA 1ZGUB 1B9RA 3ERQA 5ELDA 1XPOA 1VQJA 2L5TA 5NUCA 1FXAA 2NVUI 3PZ7A 4IM3A 1T3QA 3IVFA 3SFEB 2F0VA 3ZLZA 5ELFA 4OWWB 4IWQA 4POFA 1BCPC 1Y1VB 4IW0A 2ENBA 3GV3A 4MACA 4JI2Q 2ZXPA 2QGQA 3E6ZX 4EX5A 2YEPB 5JEAG 4BY7H 1TWHH 3NSWA 1EL0A 2M56B 1QG7A 1FGBD 5EJWA 2XBBC 2R2QA 3DWMA 4YSYB 4Z9CB 3QJYA 2XIWA 3T51B 2ASQA 3EUB2 4FJVB 1WYDA 4RAUC 2WP8J 3B2FA 1XXGA 1VMPA 4GN4B 1I4PA 2WXLA 1T5EA 4I7ZC 3IAYA 4CYEA 3I4LA 2INCC 4A3EG 3A56A 4P74A 1K8MA 3KLSX 4B3TQ 2MUYA 3RZFA 1RFAA 2EJMA 1EZ8A 1XLNA 1YNNC 4IPHA 3ONAB 3PF4A 3D31A 4IOCA 2JF5A 2OF1A 2JK8A 1LTSD 3TSSA 3MA2B 4XDXA 2LUMA 4WJ4A 2AWTA 3BY4B 4FULA 2NUCA 1VQ4A 2CCZA 3L16A 1YD8U 2PVOD 3BVMA 2DWQA 3M95A 3NVYA 4H13C 1KRHA 4LUZA 3RI7C 1Q12A 3OIPA 1EQQA 3TZUA 2EY2A 1C77A 2AL6A 1B3QA 3GS2A 1UGJA 4XXEA 1NBWA 2DUDA 2B63B 1MHXA 2IJ0A 2JYOA 2FUG1 3TN2A 1UWXA 1AN8A 1PRTC 3HOZH 2BYEA 2IL8A 4OO1I 5AUKA 2J53A 3ND9A 2EKIA 1HNZL 3RNEC 2WXOA 3DHHC 1HZAA 2E5LQ 1W2BA 4A3GG 2FUHB 2ZJDA 3Q8BA 3L17A 2NPTA 1I4HA 2LS01 3CMMB 5IOIA 2D5GA 1GUNA 1WGRA 3K0YA 5D6JB 4A3CH 4X57B 3K5NA 2I1KA 3PZDA 1CTMA 3BZCA 1GOZA 4LUVA 4JI3L 2MHJA 3MXNA 5FO7B 1Y14B 2IZVB 2ES2A 2F0KA 5BR8Q 1TWAH 3OLMD 4MGYE 2K0PA 3V62A 5BYSA 4DV5Q 2K8HA 1CHQD 1I50B 2F0IA 1LFDA 1YX6B 2WXNA 3C1EA 1HEZE 4UP8A 4C3HB 5DPRA 3PIPA 4YCVA 4YTMB 2L12A 1V81A 4WH4A 5AFWA 2IDYA 5H92C 2A8VA 1RTNA 4LMQD 3DBRI 3A7AB 3HGBA 2NN6H 4F8MA 4DWFA 5CMDA 1H9SB 3HHMA 2X6LA 3BG3A 1E2ZA 4FF4A 3C0RB 1BXTA 4H44C 1OEYJ 1RRBA 4JL9A 4B9KA 4BY1B 4AH6A 1UEAB 2L1BA 2G3QB 4LJPB 4DXAB 4OVZA 1SJED 1I35A 3SHLA 3MXGA 4IUMB 4A90A 3NEMA 4CDCC 1EO6A 3JVZX 2W3SA 3Q8DA 2UXBL 1E7UA 4LCDE 1STNA 1C3TA 3DBHB 2YU9H 5KNCA 2LD9A 1XPRA 1WI0A 1SB3C 2EKEC 5MPOA 3EVQA 1WX9A 3S1QB 1TYGB 1D7QA 4PZ8A 3A5ZB 3GTGB 1LM0A 4P71A 3EFUA 3PUXA 4F7XA 3L2PA 2AKWB 1K3RA 3NG0A 2F0QA 1JJGA 1PGBA 2WDTB 1WTVA 4DNRB 1VQ5A 2DYOA 2AHOB 2WP9B 2PZTA 4KKUA 2DLBA 3U58A 1DGJA 1UF0A 3FILA 1PVOA 4OELB 1N6ZA 1WGGA 5C3EH 4YSZB 1B7YB 2PKOA 2F3VA 4JI8L 2OTLA 4DAMA 5BN5A 3J7YW 2O6VB 3M7GA 1CKNA 2K4KA 4GDLB 2LSSA 4K14A 3UDIA 1VMCA 3G6JB 5AZGA 4A3FH 3OYYA 2N7JA 3ZDTA 1PH4A 2NPTB 4XT1B 1GD7A 3J81i 4JBKA 3HOVH 4DR2L 2KD0A 4UAIA 2NVXH 1FJGL 2NN6I 1OQQA 5IOCA 2F1MA 1A3VA 3E0JA 3K9OB 2EYFA 3MXNB 1U4MA 2KUMA 1U4LA 4C3IG 5M5YH 2IYDB 2N1VA 3CIRB 4TQ0A 2K28A 1FNWA 4LF8Q 2B8GA 4O42A 4BBSB 1SYEA 1M94A 1U4AA 1X6OA 3RLNA 3ONSA 4L2YA 4JI4L 5HHDG 1QZHA 3BWUD 4AWJA 1MHWC 2EOTA 1EYGA 1K53A 1L6VA 2Y3AA 2E2HB 4JOIA 4OO1G 3ZNID 1EY4A 5JJKA 3NZ3A 1PFMA 3EN2A 1NENB 1SYGA 3EQLC 5JJZA 1HQMC 3VYTA 4HLEA 3PO3B 4NMZA 2A6ED 4PS8A 2XTIA 2G45B 3A54A 2K50A 1VQOA 1CA5A 2XVSA 5M3MH 2IW3A 2R6GA 3KDFA 3CMAA 4A3KH 3AU4A 3DWPA 5CBAE 3M3YB 2C9WB 2KJXA 3ERSX 5I9PA 2HTME 4IUVA 1JQ4A 1D5XC 1CM9A 1LT5D 1WMHB 3N32A 1SYCA 3K81C 4RKLA 1WXAA 3CSFA 1E10A 3NHHA 4DUYL 3S1RB 4BVUC 1J19A 3FMCA 4NPSA 1STYA 1MJCA 1F9QA 1EF1A 2JU6X 3OWEB 2KMCA 3PVLA 2PNRC 3DBSA 4HROA 1YQBA 4MM3A 1S5FD 3ZW3A 1CZWA 1L0VB 2B29A 3FKIB 3FPPA 2JT4B 3AH7A 2ZEQA 2WINB 4IUQA 2YTYA 5JJIA 4W9CA 1N33Q 2KKCA 3OPOA 4HCNB 1ICFB 4LF4L 4M01A 1TWFB 1F2RC 5I2XA 3ULPA 2PO4A 2L0TA 3KWLA 5EE9A 4HJ9A 3ER0A 1T5XD 2N4FA 1JRPA 4OZCA 1YNJC 1CQFA 1WF9A 2WQYB 4WJOA 4B9WA 4G3XB 1TIFA 3UE0A 2DNEA 3I4NB 1UWMA 3C8YA 3QJZA 4GN1A 1QCBD 4L5SA 4IJHA 1PDXA 2KAJA 2CH4A 2PMZE 1I94Q 3D0FA 1P8LA 2CHWA 2F0HA 1WRIA 2MCNB 5TSSA 2KNBA 1J9OA 2KK8A 3CCVA 2BDNA 4CKBA 1GJZA 1FJGQ 3GP7A 4JVZA 5IP9H 4R1JA 3CQZB 1UE7A 2OQ0A 4I6LB 2WU2B 2MHVA 2W3RA 4QY7A 3SE0A 2A19A 4P75A 4XT3B 3R8BA 4EOYA 3TEYA 2MBOA 3U2SC 5CHVC 4NKLA 1N8RC 2C5LC 1O7LA 1KAAA 2CWAA 1RIPA 1JMLA 1P9DU 4AYBE 3PV1A 4A3CG 3DUZA 3UGBB 2C5CA 4XTCS 4WWOA 2FE8A 2UXCQ 2MPMA 3HKZE 4RM8A 2H1EA 1GUAB 3ZTDA 1MKHA 1C1YB 2Y5BB 2JQOA 1NI3A 2H89B 2L8JA 1STHA 3DHGC 4JI1L 2I07B 2XK5A 2N9XA 4GOCA 1P16A 1VQBA 3AYHB 3KLWA 1IBKL 1NTGA 1EY9A 3ZTCA 5AJ3L 3OWFA 5J39A 1V8QA 4MH0E 2D5DA 3X0WA 2H5XA 1LTID 5IIFA 2QJLA 1B70B 1HFGA 1JOQA 3DBHI 1DM0B 1QNKA 3L0WB 3RD2A 5KIXA 4MJSA 3I7FA 2PJHA 3ENEA 2NN6G 1E22A 4XE0A 3T56B 2E2DC 2HDLA 1SBBB 4GKJL 1ESRA 2DNFA 3LXFA 5E6PA 1B3AA 1A3UA 4KD4A 1E7ZA 2BDOA 5E7NA 2O4XA 4KTAA 2MX2A 4NPNA 3K58A 1EF5A 2F0FA 2OEOA 1VCBA 1HNWL 2R7FA 4XX5A 3NK9A 1O7IA 5AUIA 1AFPA 2B2WA 5J3BA 1PXUA 3CWIA 3NUCA 4GN3B 4BXXH 3IBEA 2QDBA 3VR2A 2KYWA 3N3KB 3HOYB 1DOMA 3JSVA 5IWAL 4II2B 1L4ZB 3R2IA 3DCGA 4ZRPA 2OTJA 4RF1A 3GDEA 3PGEA 1C4AA 3PO2B 4GSWA 3Q3JA 3RNAC 2V3PA 3P2BA 2UUBQ 1MVKA 4ITKA 1BQQT 4EKUA 3M85A 3AN1A 2KT7A 1F9SA 2E76C 3AE5B 1GHJA 1SNPA 3NBIA 2ZM6Q 2RPVA 1IPGA 4C7ZA 2KHJA 3VTWA 4CDDC 1XD3B 1X54A 3ZYYX 3U4VA 3NVVA 4RM9A 5L37A 2XWJB 3CCJA 1OXSC 1LT3D 2Z0DB 5CORA 1KIXA 2LY7A 2RBMA 2E2JB 2GBKA 1OO9B 4DK6C 1II3A 3A5UA 4GNXA 4B3SQ 4P72A 1WZ3A 2ZCBA 1XMOL 5C4HA 3MWYW 4RNAA 2UUAL 2MW5A 3K7AB 2TSSA 2QIEB 3S24A 2QCZA 4B3ML 2RPQA 2KA7A 2F52A 4YWLA 2A6EC 4XQQA 4HPMB 2BW2A 3J7A5 3I4MH 2K03A 4PK1A 1JE4A 3A8KE 2JUOA 2MA9B 1E8YA 1PTOD 5AZHA 4HJ8A 1HR0W 1RCVD 4LFCQ 2EMTA 1CZGA 3SDLC 3SK6A 1EM7A 2DJFC 2ZJQA 1K83H 1FEHA 5C4JH 2GVBA 2F0NA 1IUEA 1ZDXA 3M4OH 1ONLA 2RR9A 1XTCD 2ZT9C 1EWIA 1MGSA 1SYFA 5BO4B 4DNTB 1E6EB 4WQOB 5HGTA 4YT0B 2GBMA 3CHBD 3CRKC 5LMNW 2LXJA 4B0MA 3I55A 1PZID 4U673 4US8A 1QUQA 4GGQA 4MJSB 1NYQA 4MGKE 4A20A 5ISRA 4C3HG 1N62A 3RZWC 1S5ED 4DHJD 5FKAC 4XYOA 5M3MG 4WURA 3P75A 1MG4A 3I9V1 1J5EL 5CHFA 4TVAB 3CRLC 1GB4A 1FXIA 1KABA 3I57A 2WGSA 1D8LA 3HOWH 1L1OA 3P1MA 1JWBD 2KX3A 1BUIC 4JC0A 4ZUJA 3ABVB 3MJWA 1GB1A 3KBGA 2UXDL 2AUJD 3TBIB 2R92H 3RULA 1U4PA 3BU2A 1P3QU 5C2TB 2PMZB 1YNXA 1Z7TA 4YHHL 4XWWA 4HJ5A 3SK8A 2AQ1B 3H1UA 4ANXA 3E0EA 2FIFA 3Q8FA 3ULLA 2D9UA 3HK0A 4J6IA 3VRBB 2ONQA 3PZ8A 3NJTA 3OMGA 4TQUS 1N5WA 2DENB 2E6XA 4NXNQ 1NI2A 5D94A 3OJ3A 1EWYC 1S72A 5FK9C 1HTOA 2NVYH 5C3XA 2Z6KA 5AEKB 1FCLA 2ACZB 4HSVA 4N8X1 4WAAA 1EUJA 4AYBB 3EC8A 1UH6A 1GKHA 3U50C 2V4IB 2K1BA 1A6XA 3WAMA 2UUAQ 2KCCA 2ZVNA 3QOLA 1HZ9A 3HKZB 4RMFA 5JPMC 4ILWA 1V49A 2G4DB 2MBQA 3QOJA 2B2YC 4OVUA 1CFMA 2EXZA 2E2JH 4RG1A 1QQRA 3T16A 3U9OA 2I46A 2WAQB 2K8CA 2KENA 4DGZA 4JWSC 2RSNA 4XIGS 3DHQA 1HZBA 3NTKA 1V9PA 1BBXC 2KDBA 3GTQH 3V6EB 1TZ1A 4NNJB 4P6VF 3ZJUA 1MIUA 2AQ2B 2TMPA 2EY6A 3CPFA 2X38A 4B6WA 1KD1C 1IW7D 2A6HD 4K0KQ 2GLSA 4YSXB 2K32A 1YHBA 4OEMB 3A8IE 3V6CB 1T0SC 1OXXK 5F2DA 3R3MA 2R93H 1YX5B 2K7VA 3H3VH 4EQOA 3A8JE 4Y7NH 3AE3B 5J18A 4KHVA 2K52A 1UWVA 3OG5A 2JN4A 2YV5A 3IFDA 4A3BH 4LF6L 1XMQL 4ZOHC 3KH0A 4BBSG 1GVPA 1TWCB 2IHEA 3OW7A 1A3TA 2Q8RE 4ALPA 3DVNV 1FO4A 2XWBB 4JYAL 3HOUB 3X3NA 5D2MB 1MI0A 2WXKA 3PS6A 4HIKA 2UUCL 2LWPA 1VZ8A 3PIO3 1A62A 1ENCA 4K3CA 2GBRA 2K05A 1UUPA 5C4XH 4G7OC 1LQBA 4R8IA 3K57A 1D2BA 3PO3G 1MFWA 3I3TB 1J0GA 1G8ZD 4KIKB 2N78A 4DQOC 1BOSA 2HCIA 1V97A 1RTOA 4X65Q 1L1OB 2UXDQ 2E2IB 1IYJB 1IGDA 1S5CD 3R7RA 1AP0A 2BH8A 2ZTDA 4K8JA 4LAAA 3C2PA 1C8CA 4NXMQ 1P0RA 4M02A 5LLIA 1GG3A 3VFKA 4F7ZA 5BMIA 4YHHQ 1BCPD 3RNUA 2JA7H 1NEKB 1QLBB 1YN5A 1S5DD 3GTOB 2V3SA 1R4MB 3SFDB 1Y8PB 4W9KA 1JWAD 1M8AA 2F0OA 2W55A 3GZNB 4RWSC 3HOXH 2LGIA 4Y52H 1Q8KA 3OTOQ 4GOPC 2NZHA 2DYBA 4R4OA 3UI3A 2EQSA 1N36Q 4GKKL 3EBEA 1C78A 1K52A 4I6NB 3FKIG 3QIAA 2JY6A 3T1YQ 5M3FH 1FR3A 3WOEA 5DEHA 2EYJA 1GXDC 1MBYA 2EYLA 4GNXC 2O2LD 4GLVB 3AMUA 2IO3B 3N1ZC 3MXUA 1WD0A 1YI2A 1Q81C 1F9PA 5KNBA 3S1MB 4NB3A 3C1FA 4KY5A 3TP6A 3PV0A 4KN7C 4B95A 1L4DB 1X3QA 1JC7A 2QA4A 3T1HL 2LUEA 2CKZB 4JIOU 3M7NA 1N34L 2I5MX 3ZRFA 2C9OA 3U9SA 3GV6A 1DJRD 3H3VI 3BINA 1GO3E 4L8JA 2PZWA 4C7YA 4ZQ3A 3S2DH 2DZMA 2ZPYA 1NAPA 4X3UA 3JAME 1KL9A 4PYUA 5IODA 1SNMA 2JA6H 3RZDH 2NBWB 3L13A 3O65B 4ZRKA 1ZOYB 1PH1A 1VRAB 2D07B 2YLMA 1RL2A 1PTOH 3NBHA 3CCMA 3R3OA 1H9RA 3S15B 4A3IB 2KEEA 3I73A 1FRRA 3I5JC 4O0AA 3A1QB 1IBLQ 1I6HB 2KLCA 4JV5L 1TJEA 2HHHL 2KDFB 1K8RB 3L10B 4NAWA 1PRTD 3FDTA 3VR9B 4ICUA 4PMCA 2BB5A 5CV5A 1K8GA 1M4VA 4N9PA 5LMUL 3PUYA 4HMJA 4DK5A 4FF3A 2EYOA 2I5HA 4KKJA 4RMAA 4QUCA 1TWHB 1SR3A 5C44H 4BY7B 2EMSA 5L95C 3FHWA 5DM73 2VW9A 1YJIA 4HWIB 3W1BA 4A6QA 5IGEA 3LB8C 1D5MC 5ELCA 3PF5A 2MJ8A 3HFZB 1C76A 2PCFB 4X62Q 3VDYA 4MHEA 4K2KA 5BN4A 2X6GA 4HR7B 1OTRB 4YY3L 1LXDA 1STAA 1XCTL 2HJ8A 5DCNA 1ISNA 4DR7L 1E7PB 2VH1A 1VF5C 1N9WA 3AE2B 1QOGA 3A4SC 1XLQA 3S1NH 2BBCA 3ZXVA 3HOWG 1YJ1A 2FMMA 4WJ3M 2L05A 4IM2A 2N0SB 2NBUA 4REZA 3PQIA 2K39A 1ZKHA 4A8XC 1EEID 2Z6KC 2LHDA 3BJUA 4FXGC 4UHVA 1WM3A 2VZKD 3AB5A 4HJKA 3MHBA 4GDKB 2J0JA 5GQOA 4EGVA 1H95A 2RDBC 2VB3X 3HP3A 3DWQA 4IALA 2B8FA 5IGGA 2QEJC 4DK3C 3KFUA 2LMCA 3DWAA 1IP9A 1G6JA 4DR4L 1IBXB 1TWGH 5C4ZA 2JRIB 1UEBA 4G0NB 3PO2G 3Q6BA 2L3ZA 1Q46A 3K5OA 3HOZB 3APDA 1IW7C 4LNKA 3M9BA 4RGNA 2PPHA 2KECA 2RDGA 4WJNA 3K59A 3GTJB 1WGKA 2GRIA 1ASYA 1WGHA 2IGHA 4IFDJ 2VL6A 3KF6B 5LHY1 1SE4A 4RCNA 1RKNA 1RFKA 2INPE 2QSDA 3FVQA 2EZVA 4DBGA 2NS5A 2RHSB 1JRUA 2M0XA 1SN8A 2JSOA 3AI5A 2G9HD 1ILQA 3GTMH 1PYWD 4A3JH 2GBNA 3OJ4B 5JH5C 2UWQA 1WCMH 5FJ8G 5A35A 3G4SA 5G2NA 2LJ5A 3W5VB 2WB1E 5LXIB 1JT8A 3W2DA 1PYSB 4K81A 3H15A 1TU2B 2WXRA 4BBRH 2MBHA 4IWOA 1Y8RC 2LASA 3W1YA 4AS1A 2RCFA 2V0GA 3EIVA 4DPGA 1TWAB 3QO2A 4A3MH 1GC7A 4CBVA 4NAWB 2EIFA 3DBLI 4JI7L 4C3JH 3ZDMC 2BKRB 4ANUA 4DU9A 2KOXA 1SRUA 2MP2B 1SE8A 2R93G 1NY4A 2KC1A 3JYUA 2DY8A 1D6EC 4MNOA 3VQIA 3NQIA 3ZO5B 1B1ZA 2NVQH 4WQMA 2HIVA 2FNJB 3HVDA 2OXPA 1G291 5FLMG 2D10A 4G7ZC 2MEKA 5CHWA 1HPCA 2QC8A 3SHQA 3BYTB 4H7BA 2W54A 2IGGA 5FLXc 2CQOA 2BT6A 1HR0L 1OXVA 3PUWA 1R4MI 1KTKA 4FLHA 4NJ7A 1HNXQ 5G5HA 5BYQA 1CUKA 1NR2A 4BBNC 3GZNI 3ZJVA 1SYDA 2D62A 3D6WA 1O7YA 2OQKA 1U5KA 1TY2A 3KJPA 3P4QB 3E5SA 5CBEE 2PI2E 1X3FA 1PTOF 5D3IB 5C4XG 1JALA 1UBIA 4OIJA 3Q14C 5HY6A 2G5DA 3I63C 3U4EG 1PGXA 3ZJTA 2YU9B 1F1HA 5IT9c 4H2AA 1OXTA 1J8CA 4A3PA 5LMNL 3BK1A 2ZPNA 4XWTA 1VQFA 3Q3MC 1GUSA 2MJDA 2W9NA 1ET6A 4CDEC 2JRHA 1F0ZA 4MH8A 4LNFA 4KGTA 4DV4L 1R9TH 1SAPA 2LI5A 3TP7A 5LL6X 2LMCB 2VB2X 1Q0WB 1V5OA 3X23A 4GLXA 3WAOA 1Y8OB 1WTOA 4OGQC 1HTLD 2L7RA 1D3ZA 4LDTD 3IAM1 1XEEA 2FXQA 2K5WA 5M3FG 2EXDA 5C3EB 2AYOB 1H9JA 2K3UA 2NCNA 2PE6B 3QQ8B 2AQ3B 1EYDA 4L5RC 4MELA 3H7PB 2N49A 1LT6D 3I91A 1VS0A 3KYHC 4YXDB 2V4DA 3T13A 4LFAL 4ZRIA 1L0XB 4O1NA 3GTJH 3M3JA 4A3FB 3I8ZA 4DF7A 2UU9L 4LW1A 5C0XH 4PS3A 3D4DA 3HOVB 4R3DA 1IYUA 3MHSD 4AYBG 3KF8A 2PZUA 4KY6A 4X3TA 1YJ9A 2NVXB 2IHFA 3PPAA 2JA8H 5FLXL 4M00A 1X9NA 4HIOA 3HKZG 2ZNVC 3IRBA 2JA6G 1YNJD 1WWTA 4AP4C 5M5YB 4I65A 4ZRZA 3AFPA 1QOBA 5JEAJ 2BGFA 3ND8A 2C7NB 3KYDD 4IG7B 1TKEA 2F0WA 2Q5WD 5G3LD 2WAQG 1STGA 2IT1A 1Q10A 2ZTEA 1V8CA 2LVQA 3A55A 2WXHA 1P1AA 1K51A 4A55A 3B08A 1WOCA 2OWOA 2IY5B 5IT9L 1VZ7A 2IO1B 2PI2A 3MC8A 1K0RA 2KTRA 3FC4A 3R7QA 1Q8IA 3F2BA 1D5ZC 4Q5VA 2JA5H 1HZ5A 3WALA 1W3SA 5I9OA 2DGYA 3I90A 5M3MB 3E9IA 4A3KB 4V190 4ZAIA 5C44G 1WTHA 4GMVA 4IO9A 1WXQA 4FF1A 5M5XH 1TS5A 4DR3L 2PEAA 5A2QL 2AX5A 3IKJA 5ELOA 1ZPSA 5IGCA 3HOUG 1VQGA 1LTLA 3MC0B 1BBWA 4KI0A 1FXTB 2KQ4X 3NZUA 2NBVB 3T3OA 1F9RA 1LABA 2NZOA 5EPJA 4X6AH 3VR5A 5FO8B 4ZCKA 1EEFD 3ML9A 3W9CB 4BOSC 2ICIA 3TCAA 2LVOA 2PE9A 2EJGC 2A5HA 5CV8A 1ZXHA 5M5WH 1CJEA 3S16H 2VS1A 3GTKH 3T53B 1W6KA 4JW0A 2KFKA 3APFA 1Z6HA 3FAHA 4MZ9A 1K73C 1I5FA 5C0XI 2M9VA 4A76A 4CJ0B 4LF7L 2VZAA 2FJ2A 2N7EA 3TZDA 3J80i 1L7YA 1RM6C 1ENAA 2K75A 1HJPA 4IQZA 1PLFA 4XGAB 4ID6A 2VUMH 5EKIA 1SNDA 1Z2MA 2WB1B 3NVZA 4DA2A 4KKIA 3FRPB 3OSOA 4K8IA 2HT1A 1N5XA 2JPHA 3BIID 4G11A 2P5ZX 5KHQA 4XYQA 4FHJA 1NYRA 1HNZQ 3CCUA 1O80A 1B8AA 5LNK1 2LGSA 1FVIA 4WJQA 3A9JA 4DR1L 2MJ3A 1BCPF 2INNE 5H8YE 1I4GA 3I70A 2W82A 2BVCA 5C1ZA 1DZ1A 3T3NA 2J7ZA 1KLVA 4DV3L 3I3CA 3AE9B 2MGSA 3RMKC 2Q8TA 3E3XA 5I6YA 4JI3Q 5JAVA 3CW2C 4LFBL 4OXPA 2FBWB 2HCCA 4BBNF 1EY0A 2IX0A 1N60A 4J6HA 1Y1WH 4TV3A 4XZ4A 2WWZA 1DD2A 1G91A 4BBRG 4ULLA 3RCZA 4BOZB 2CKHB 4A3IG 4A3MG 2IX1A 2KTRB 1T0QC 1Q3LA 4B0EA 1SFOH 4KGRA 2EYPA 3A33B 3CF6E 1DYQA 4G7HC 2JZPA 1DGSA 1SJHD 3ZJYC 4NP5A 1NNXA 2A68C 1Q86C 5IP7H 2N9LA 1XNQL 5CV4A 3A74A 2ATWA 3DM3A 3NY5A 4NY0A 4WJWA 2HD5B 4YTPB 4DUZL 3K8AA 1KF6B 2Z1CA 2CHBD 3U8ZA 4BY7G 3SD5A 1B2TA 3H94A 2ZJRA 1DOKA 1EIHA 4US9A 5HI1A 1UAPA 1JWSD 2J7QB 3JAMi 1SDFA 3B0AA 2MQHA 2UXBQ 2NYZD 2FCSA 2KWDA 4M1UB 4W9IA 4C1NK 4F88A 2V3NA 1PRTF 3WWVA 2WXJA 3TQYA 2F4IA 1NVID 1CKOA 4W9LA 2JX5A 3KW5B 3OMCA 1KXLA 2PLPA 4KSLC 4X3KA 1EFWA 3ETRA 4M8NA 1G2TA 2KQ7A 3U7DA 2FCMA 4HEDA 3K5MA 2CU1A 3MFYA 1ML0D 1HTQA 2ZVOA 4QIWE 2RHQB 5HURA 1A8VA 2DBYA 2GOWA 1EY6A 1WM2A 5KNDA 1H9MA 3RMHA 2K6QA 2A69C 1B9NA 4EQPA 4B3RL 2PQAA 4JI8Q 3FILB 2MP1A 4BKTA 1MJEA 1N32L 3DPDA 5E1FA 4FNFA 3PRMB 3RYTA 4IZ8A 4DV0L 1CKNB 3HOZG 3IXSA 4R4TA 4DN4M 4DR2Q 4ZYNA 4KK7A 4AIMA 1CHPD 2F4VL 4A3DH 2KJ6A 3I4MB 2WDRB 2MO1A 5C0XG 1EIYB 2VY3A 4JBJA 2KOLA 1SGHA 4RHRA 2Y5PA 2N8NA 5E6OA 3LWUA 3TIXA 4LK0M 1Y69U 3L3OC 3TRZA 2O2VA 1K83B 2BH2A 2X69A 4AQ7A 5C4JB 4KHZA 5KYIA 4JI4Q 4DV7L 2LZ6A 3PTFC 1JJ2A 1KDCA 3WIMA 4AOFA 2B2YA 3CCLA 4P1BC 3CF5A 3M4OB 1Z47A 2CW0C 2OT2A 2G9DA 1HE8A 4L1BA 3BDOA 1QILA 4P16A 3RNCC 1KOTA 2KHSA 3PCOB 1KM7A 1XNQQ 3TEHB 3LWEA 3STBC 3QK0A 1YQ3B 5IYDH 2VQEL 1PGAA 3RNFC 4IUPA 2GB1A 4UP9A 3VUWA 1CK1A 2KCTA 2BTEA 1PH9A 1M1KC 4HJGE 4HCSA 1V80A 4ANVA 3KDFB 4LF9L 3MJ5A 3CCQA 1WYWB 1C9FA 4DUYQ 1V1OA 2KVZA 3L54A 3K0XA 2LJIA 2L15A 3HOWB 3Q2AC 3TMPB 2D11A 3AE8B 3QWNA 2KFJA 3N52A 5EBCA 4QL5A 3TP5A 1A0IA 1EY5A 3MXPA 1JW9D 1M90C 4MM3B 4X66L 2R92B 4U68A 2WXPA 2IO0B 2QKIC 3TDQA 1VQMA 1I7HA 2OEDA 5EE3A 4LF4Q 2PIAA 4A93H 3KQ4A 4KMUC 5IYBH 1OQYA 1TXYA 2KDEB 3L08A 4MT5A 1WTRA 3IL8A 3Q22A 1ET9A 2JJQA 2Q8IB 4HN7A 1VQPA 3M62B 4GU2A 5HKHA 3BDLA 1KFYB 3VYUA 1LTTD 1PYBA 1BT0A 1IXRA 1OFFA 2F03A 4WWNA 2K5VA 1ZYRC 2NVYB 5JPNC 4KHPL 2GA4B 3MTNB 1TT5B 2JP1A 2Z0EB 1AH9A 1OEYA 1S5BD 2ZXOA 5BYRA 1UNSA 4GOPA 3UDXA 4WRDA 1EYCA 2K04A 4ICVA 3VDZA 4MEMA 4QF4A 3H91A 5C3EG 3NS8A 3KLSA 4ZKBB 2AUKA 1RF2D 2L55A 4JE3B 5J22A 3M4QA 5KYLA 1JMCA 4ZK9B 1V1PA 1F52A 1OQRA 3EFCA 3U52E 1QT9A 3KUPA 1JICA 3SR1A 2Z4IA 3GTQB 3B9JA 3MAQA 4A3LH 2K8BA 2KCNA 4W9HA 2WKCA 4XYCA 3F2UA 2EE1A 4HJAA 4A3FG 4JBMA 4DR6L 3CC7A 2M2LA 3E9HA 4M0WA 4JPSA 3KVFB 3HOVG 2O2VB 3CC4A 3ZRCA 2R93B 2REXA 3P4SB 2K5QA 4M8MA 1LV9A 4EQ5A 3P4PB 4Y7NB 3TEWA 2JXXA 4JI1Q 2L32A 1AE3A 3PSEB 3URYA 2VQEQ 1IBKQ 4JI6L 2JEAI 5AJ3Q 1V6EA 4OWTB 4FVMA 4A3BB 2JYTA 2KZRA 3G7LA 1C79A 4K6DA 4HIMA 2XK5B 1TS2A 2NB0A 4FXKC 1IHZA 3TP8A 2R7ZH 1CI3M 3QC8B 2X8XX 1LTAD 4LF9Q 2K01A 2EJFC 1IBML 3N30A 4DV1L 1CQVA 4IFDH 2F0GA 5C4XB 4JX1C 4GKJQ 2WXGA 2B3GA 4OHJA 2JE6I 1JWMD 3PRZA 1L0YB 3NE5B 1HNWQ 1NDDA 3ZXRA 4A3KG 2PMVA 1Z9FA 3AULA 4I7AA 4QIWB 2Z4HA 1TR5A 3AEVA 4DAYA 2QCPX 5C5LA 2KANA 2NR2A 5GAHC 2M0AA 4GS3A 5G3LF 1TQOA 2JA7B 3NWTA 1UELA 2KQSA 5EE0A 4IOAA 1SE2A 3A9KA 5IWAQ 2RSOA 4D2KA 5K36H 3UQBA 1MSHA 3HOXB 2PTLA 1T0YA 2N9EB 1HUNA 3JSVB 4M8AA 1HHVA 2V4LA 3ZVVA 1X65A 2IBIB 3P42A 5BMHA 5M3FB 1X32A 4HTHA 1HZCA 2KC2A 3W1GA 2KDIA 2MSED 2MFIA 2E3TA 1FD7D 3BK2A 1B4OA 2QMTA 4FYDA 2BE5D 4OONA 5H1SE 4OWXB 2MBEA 1TT2A 3H0GH 1AZQA 4AQYL 3TJPA 2K1FA 2F0LA 4C1NI 5FOBB 1VQDA 4FJZA 4XDDA 5IGFA 1XMOQ 3S2DB 2WB1G 5K5PA 3ZIMA 2NVTH 4ABNA 3AU7A 4B3MQ 1E90A 4WAFA 5EDSA 4GNXB 2JA6B 1RD9D 1E0BA 4P2CB 5CYUA 4RFBA 3CXCA 3F2CA 1V1PB 3RZDB 1T0RC 3I4OA 2CVRA 1A15A 3A7LA 1ZW7A 2WFWA 4ZLTF 2RA4A 3CC2A 1PTOB 1AZPA 2RMMA 4DV6L 5KRUA 4KDLB 4QCLA 2OHFA 4DHZE 5IP9G 1EWHA 1SXTA 3M63B 4EZKA 1R4NB 2B3AA 4USAA 1SNOA 4PZ6A 3GTLH 2BWFA 3WCQA 5GAEC 2L4NA 2K5HA 4HCPB 1KLUD 3BZKA 1WTXA 2LXCA 3PRPB 1J7CA 3Q69A 4E71A 3ULJA 4L5TA 3ZUNA 2H88B 5C44B 5LL6S 4UDUC 5D3DA 4PMBA 1IBMQ 2RDFA 1XLPA 2BA0A 4DAVA 3F1ZA 2UU7A 2WNMA 3Q3FA 4GN5A 1DOXA 4DHJB 1WGYA 1SROA 3HS0C 4HMIA 4E3CA 4MTNA 4L23A 4AJWA 1QUQB 1J5EQ 3DBLB 1D4BA 4TSSA 1PQSA 1B44D 2Q2TA 1PFBA 4P73A 4GIVA 1GJXA 4MSMB 3J80c 3D3RA 4DK0A 3S1NB 2ZCCA 5C3JB 1XPUA 4X64L 1ACCA 3MTSA 5DPWA 1GUTA 3QR8A 5ELEA 1WH3A 1AYFA 2JZ3B 1X3GA 2KVRA 4JI5L 1EQRA 1LYLA 1F2MA 2K22A 1Q7YC 4GLSC 4R4CA 3M4PA 3KLRA 3R66C 1TY0A 4BXXG 3HRZC 1VQ8A 1JE5A 1JWUD 4II3B 3WAPA 3QIJA 2XN9C 1TWGB 4A3EH 2RQXA 4LUOA 2IY0B 3V3XA 2BOSA 3VR8B 2HD3A 4LTUA 3S14H 3J81c 3BYYB 4DXFA 4FJYA 5T8IA 3AU5A 3A0JA 3HZXA 2ALYB 4MSQB 1C4CA 1ESFA 2MQJA 4ZUIA 4K2LA 1TS4A 1T9HA 1WRDB 4GXBA 4J1MA 2LVPA 5COYA 4LNOA 1GUGA 3GTMB 4JGHB 4JI0L 2AWNA 4A3JB 1G6ZA 3OW2A 2M17A 1WCMB 3R2TA 4KKTA 1WTQA 3QX1A 1QVCA 3RNBC 1B9MA 4EZJA 1ROEA 4E6IA 1F77A 1CSPA 4BBRB 1I4QA 2J4XA 3I72A 3ZKJC 1AEXA 4K7UA 4A3MB 4A3LG 2O5JC 1WE7A 3R93A 3PREA 4K6LA 3I4MG 3Q8CA 5CR3A 3J80L 4C3JB 3PLUA 1EQTA 3RN9C 2K25A 3P63A 4DV2L 1P7FA 4N59A 4WORA 1RODA 4LF6Q 1XMQQ 4A3GH 2NVQB 3KK7A 1PFDA 4FF2A 2BYTA 2KQ3A 2D2QA 1BNZA 4JYAQ 2BCOA 4ZRJA 1PZKD 2UUCQ 1NE3A 4ZDVA 5EKLA 2PVGC 1CMXB 3IT4B 3SEBA 4IKGA 1I42A 4HIDA 5FR6A 5D65A 4EZLA 1SSOA 3DXJC 1IYVA 3PHWB 1YN3A 3DOWA 3E9SA 4W9FA 5C5MA 1S1QB 3H09A 2AEHA 1VJKA 1SMYC 2ZTCA 3J81L 2L00B 4HDOA 1WIAA 1BCPB 2KWUB 3AMZA 2XNAC 1QB5D 5GXGB 1RJTA 4J15A 2D0PA 4TKOB 2CFMA 2N9PC 1WX7A 2BE5C 5GMVA 2N1WA 5CTRC 2C7HA 3W1SC 1YIWA 1SF0A 2K5DA 2PPBC 3NTHA 3WA0A 1HA5A 1EIGA 1VQEA 1VR9A 5IKCM 4GKKQ 4K7SA 1R9TB 1C7YA 5EE1A 2KMMA 2E75C 4IC7B 2Q2IA 2DZKA 2R92G 4JI2L 5D7GA 3QWZB 4HKZE 5C23A 4C4VA 2V1CC 1J8IA 4CHTB 1S3SG 2VXWA 2MH7A 2NMQA 3RT3B 2B2TA 4QMGA 3DMUA 2A5UA 2OOBB 3U30A 4CJ1B 2VH2A 5ELNA 3P20A 1HZ6A 3AEBB 3C19A 1FD6A 1EU3A 1MSGA 4DHZB 3T1HQ 2CH4W 1PFNA 5EBDA 1E8WA 2G4SA 1BMLC 2GBJA 2JXTA 1N34Q 4KVGB 1W6JA 4JI0Q 1XLOA 3PIP3 4A3OA 2WXFA 1R4NI 2E74C 3H0GG 3TMEA 3Q23A 4B3TL 3GTPH 2UYZB 4XDCA 3O13A 2LXAA 2I2YA 1PA6A 2K6AA 3ITPA 3LNNA 3MEHA 2JA8B 1KRTA 3QA8A 2KWCA 4L6TB 1IGCA 5IAAC 1RHPA 1WYGA 4EEWA 5ELBA 1RAXA 1PH2A 1B53A 1KDBA 1G2SA 5T1IA 2KX0A 2QDFA 3NBHB 1KNEA 1PRTB 2KN4A 4JV5Q 5JXVA 2HHHQ 1LTRD 1EY8A 5DAUA 1O7ZA 4R4IA 1GC6A 1PH7A 3PIOA 4WIPA 4PQXA 1E7VA 2DZJA 5LMUQ 5AZFA 2HJ1A 1XYIA 2JA5B 1TGZB 1YJJA 3GOEA 1TKGA 2OJRA 2MRPA 2ZNVB 1V43A 1DXMA 3DM1A 1PZJD 4K5VA 5M5XB 2KJRA 2LRWA 2E5LL 4A3BG 3FPUB 3KBXA 2WXMA 4C3IH 4YY3Q 2HDMA 4YTNB 1WE6A 1NBFC 1P7EA 3B2GA 3ECIA 5FLXE 4QB4A 3UDGA 3H6NA 1S3OA 4DR7Q 3X3MA 3OAWA 5JOBA 4IPCA 4FA6A 1WTPA 3V60A 3DVGX 4OO1H 3NTIA 5IA7A 1QOFA 3MC9A 2A1AA 4LK1C 1WY8A 5M5WB 3EFXD 3S16B 1LGRA 3PUZA 4FDBA 1FFUA 1SLJA 2KO3A 2VZKB 2Z8LA 5BR8L 3GTKB 3AEGB 4H02A 4CKEA 4IUNA 1UZXB 4DV5L 2A68D 2JWZA 5IT9E 1VQ6A 1IL2A 2PNHA 3HKSA 2JA7G 4C4VB 1JOKA 2G1EA 1BF4A 1H9SA 3QB3A 4DR4Q 1V9JA 3J7ZC 1HTPA 4ODGA 2VUMB 3HOXG 4ZHPA 4NAMA 2BYFA 3VUYA 4CHKA 1E1TA 1KHIA 3BZDB 1HRJA 1KJTA 3IT6B 1YN4A 1JR0D 5A2QE 3S2HH 5BMGA 1WX8A 4MTKA 2IX3A 2FIDA 2N55A 4HEA1 3VUXA 2BF8B 4KSKC 3OOCA 2DJGC 2RCNA 2WV6D 4YWMA 1WR6E 4R9WA 5T1GA 2EELA 2FCNA 2J0MA 2J42A 3AEFB 3GO5A 3S17H 3RFZB 2B76B 1PFSA 2NWGA 1C4PA 3W5OA 4BWGB 3RZOH 4PG3A 5G5GA 4ANWA 4GB9A 2B39A 3CCEA 1MG8A 2DAJA 1KRSA 2AWOA 4DFAA 1XTDA 4P7IA 4RGTA 2A69D 4OL7A 1Y1WB 1QF6A 1GHKA 3BVGA 4YCUA 3HM6X 4YWKA 4JI7Q 3VXWA 3AE4B 5IY0A 3AE6B 4BAXA 1KLGD 4LJZC 1ZUD2 1SFOB 1I3QH 5G55A 2F3IA 4IPGA 2D3GA 1ZP0B 2R7DA 4IN3A 2HDEA 2O6VA 2BQQA 2SNSA 4GDLA 1N63A 1IL8A 1HR0Q 1NUCA 2F0UA 2XGTA 4WWMA 1QZEA 1RYJA 2O6VD 5CV7A 2C60A 4KZ0A 4RGMA 2EVBA 1QKZA 2LGXA 1AWDA 1VQ9A 4KV6A 4HK2A 1ZEQX 5IN7A 2KTFA 2YTVA 2LRUA 2L1AA 5JVG3 4BA1I 1XF5L 2CW0D 4PNYA 1FYCA 1E5WA 3Q3NC 5HG2A 3T8MA 1ZKOA 1E0ZA 4C2MH 4NDXA 1E8ZA 5LMNQ 4LF8L 2B2TC 2F0JA 2KACA 2M8SA 5E6NA 5L83A 4WWPA 3STBD 3VTUA 4A9AA 4W9GA 1YHQA 2KMAA 1KAWA 1G6PA 4DV4Q 2VNUD 2Y5CA 3RPFC 1LACA 1Y1VH 2JZZA 5DPTA 3Q8AA 2J0TD 3SGIA 4LDTB 1H4RA 4Q0FA 1MHHE 4TQ1A 3WOFA 4BKGA 3LGJA 4HXDA 4HKQA 3IFTA 1WMHA 1WR1A 3ALBA 1BR9A 3U7ZA 4FADA 3QHTA 3EA6A 3WANA 1SEBD 3U4ZA 2LKVA 4NJ6A 1BO0A 2ASBA 3N9YC 1VDZA
chains in the Genus database with same CATH topology
1ILPA 3CKIB 3NRZA 3M4YA 1LO5D 4KX6B 4EE2A 4A3DB 3VYRA 4BS9A 1J7BA 3VA7A 3V2TA 1HA6A 2NBFA 3SVMA 1CZPA 1ZYRD 2M19A 4TMAB 2FINB 1E9MA 2HQEA 5C3WA 3AECB 2PW9A 3C46A 1O78A 4J8QA 1GUWA 3Q0AA 2K5PA 5E6JA 1B50A 1EU4A 3AB9A 5D14A 3P4RB 4JWUC 4NJCA 4C3JG 5BN3A 1I4XA 3H8HA 2DYMA 2B2VA 1OXUA 3MHZA 4KGSA 3HEJA 3NXWA 1F2LA 3EROA 1HFNA 3S9WA 3J7AV 2FFKB 2WIIB 5KGUA 2O5IC 1LT4D 2JXMB 3D4WA 2ID0A 1L6UA 1PDQA 1QE6A 1GPXA 1CT1D 2F0SA 2H4OA 1HCZA 1YQ4B 4A93B 3DEOA 1A70A 2R61A 1D1KA 4KD3A 1Q1EA 4H0LC 3V05A 2KDMA 2WXIA 1VCIA 3MFGA 3PO0A 4KJNA 3SDZA 2LFNA 5EQ0A 5C6AA 3GD7A 2DY7A 3EJIA 4NZLB 4V0BA 1CA6A 1QJOA 1QNUA 5DNFA 4YIJA 1FRDA 4DAPA 3D8GA 4MN3A 3CU7A 2IGDA 3QG1A 1J7AA 4CQNA 1HQRD 3PMFA 4B9XA 4PT5A 4IUUA 5CV9A 4RA8A 1EQVA 1VZ6A 2SOBA 4GZYC 3NWSA 4KY7A 5IGBA 5FR3A 4TRDA 2YEPF 2CU3A 2YYZA 4RKBA 1KH0A 3NVWA 3SK5A 1SNQA 1TKWB 1ICWA 2R7ZB 3AEEB 3TEXA 1ZE3D 2PQEA 2F3WA 5CC4A 3VR6A 4C80A 1GAQB 1FCCC 1FFVA 2JEBI 3SR6A 1IKLA 4BA2I 2IPKD 2ICEC 4EVOA 1WVLA 5E3FA 1L5PA 1EYAA 4FXDA 1HUMA 4OZAA 1DOLA 2FMCA 5I4DA 1VDVA 3D4RA 1Q90A 2WKDA 4N58A 2SEBD 1A2UA 1JQYD 1VLBA 4ARIA 1FMAD 1F2RI 1JOOA 1S4ZA 3E56A 2PYKA 1LTGD 2WACA 3H0GB 5DM63 2WDQB 5KEEA 5C0XJ 4G4KA 2ON8A 3GQBA 2RDHA 2XRSD 4PV1C 4IDIA 2K9XA 4FO2A 2NVTB 2WLBA 2EPBA 2LEKA 4ZHOA 2SNMA 3MVVA 4K5XA 1K50A 5HFYA 1C48A 2WXQA 4ME5A 3VR4A 3GTLB 1MI2A 1PMRA 1RWSA 1WTWA 2Y0SB 4LLGM 2B2VC 2XSCA 2EYHA 4HSPA 2B2UA 4S3SA 2WU5B 3NS1A 4ZYSA 2PW5A 4G57A 1D1IA 2JYEA 1EOTA 4FP5D 3D6CA 4KN4C 1SSNA 4FXCA 5CV6A 3L4PA 3H6MA 3VR3A 3N6RA 4QUFA 4DK1A 2K33A 3L9AX 1DOIA 2BS2B 3RD4A 5E4WC 5EPLA 2F0PA 2XRQD 4IOIE 1HXYD 2RKSA 3TUOA 2EY5A 2KVMA 2F0DA 1TS3A 2JSVX 3W5UB 3AM9A 4A3EB 1NSNS 3S14B 2EDGA 3W1SA 1SMYD 4DXGA 4IUTA 1TKYA 3HUIA 4RCOA 1ZXTA 4KJOA 2BS3B 3AE7B 2WDVB 1JB3A 1TZOA 4N6EB 1AW7A 3WDNA 3NP8A 4NW2A 2EY1A 4OW0A 2ZW0A 5IGDA 3Q24A 3PUVA 3T4AC 1ZDVA 3KWVA 1I4RA 1LTBD 4JK1C 2CJNA 2L0CA 4CGYB 1MPEA 3UI2A 4IFDI 3RLFA 3AEDB 1FM0D 4A3GB 3MP9A 5M9OA 2LFIA 1DONA 1IKMA 1YNTE 1E2WA 2L52A 3H3VC 4OZBA 3AEAB 5EGTA 2MJEA 3LX0A 1NR4A 3P1HA 4JBWA 4N9TA 4ZRQA 5J1ZA 3Q8EA 1YMHE 1VF7A 1U4RA 1Y8NB 2ZW1A 1BUVT 1EZ6A 5EKKA 4Q2JA 3J80E 3LYYA 5FO9B 4HAEA 5JEAH 3VRAB 4YWGG 3NUHB 4ARCA 2CJOA 2WS3B 4ZKCB 3OHXC 5I6WA 2B2WC 3W3AA 3DWGC 2JQRB 1ENFA 2CQAA 2DNCA 1FNVA 2BA1A 1FIQA 4IURA 2LHEA 3P7JA 1K8OA 3J81E 3C3LA 2GI9A 1STBA 1KDAA 3RUZA 3GTPB 2HUGA 2A74C 2IWHA 3FEWX 2EYMA 1JROA 2R3ZA 4F87A 2B2UC 1I6VC 1QOAA 1Y56A 1SIJA 4CJ2C 1R4PB 1IBXA 2BS4B 3V96A 3HG9A 1DOYA 3MZ5A 1PTOC 3VA5A 1JCKB 3SK4A 5CGKA 4EQNA 1YNND 1T6BX 1STEA 1QOHA 1XWEA 2QF7A 2BB6A 2SAKA 3J9CA 4B08A 2N9KA 4C3IB 2ZXRA 1QWYA 3AE1B 1WD1A 3ZGZA 1EFID 2QILA 1C4QA 1JORA 3BDCA 3HVZA 4OIKA 3NQTA 4RF0A 4IFDG 2F0TA 2RVLA 5EPKA 1R4QB 1XX8A 1E2VA 3GB1A 3L7ZC 1EY7A 1LLRD 2JWUA 2NTSA 2A73B 1RDPD 4K5WA 4XQJA 2J52A 2I38A 2KEDA 2PW7A 5K36G 3ZQ4A 2L9HA 4CKCA 2D2CC 2L11A 3J7AF 1BDOA 3VYSA 4X3SA 3S2HB 2FHTA 5JVH3 4WFN3 5E4XA 1TIID 1XCQL 5I2YA 3Q6SA 1N61A 4HCEA 3TEZA 4KKSA 4RHSA 3S17B 3EGRA 3JAML 1WSPA 1EWCA 3RZOB 2L83A 3AV8A 1ZXIA 3HRDD 1A2TA 1F2YA 2N88A 3IAS1 1PUTA 1SE3A 1X3PA 1MD2D 4C56C 1DCZA 1Q1BA 1F2ZA 3K6OA 1FNUA 2A6HC 1KNAA 4L63B 4R8NA 1I3QB 2F0EA 4J3OD 3NPPA 3BVZA 1XO3A 1SYBA 4RGOS 2NTTA 2DN8A 3OIQA 2NZ1D 3BS1A 4RH6A 2F0MA 3SXHA 4HRSA 1NCVA 1TVXA 2SDFA 4XQNA 2M00A 1R7SA 3K5LA 4MIUA 1U9RA 1H9KA 4C2MB 4PMWA 1GUOA 1SNCA 3DEPA 1B9RA 3ERQA 5ELDA 1FXAA 2L5TA 5NUCA 3PZ7A 1T3QA 3SFEB 2F0VA 5ELFA 1BCPC 1Y1VB 2ENBA 3GV3A 4MACA 2ZXPA 3E6ZX 2YEPB 5JEAG 1EL0A 3NSWA 2M56B 1QG7A 1FGBD 5EJWA 3DWMA 4YSYB 4Z9CB 3QJYA 2XIWA 3T51B 3EUB2 4RAUC 2WP8J 3B2FA 1XXGA 1VMPA 2WXLA 1I4PA 1T5EA 4I7ZC 3IAYA 3I4LA 3A56A 1K8MA 3KLSX 2MUYA 2EJMA 1EZ8A 1XLNA 1YNNC 3ONAB 3D31A 2OF1A 1LTSD 3TSSA 3MA2B 4XDXA 2LUMA 2NUCA 2PVOD 3BVMA 2DWQA 3NVYA 4H13C 1KRHA 1Q12A 3OIPA 3TZUA 2EY2A 1C77A 3GS2A 1UGJA 4XXEA 2B63B 1MHXA 2IJ0A 2JYOA 2FUG1 3TN2A 1UWXA 1AN8A 1PRTC 2IL8A 4OO1I 5AUKA 2J53A 3ND9A 2EKIA 2WXOA 3Q8BA 1I4HA 2LS01 2D5GA 1GUNA 3K0YA 3K5NA 1CTMA 1GOZA 3MXNA 5FO7B 2F0KA 2K0PA 5BYSA 1CHQD 1I50B 2F0IA 2WXNA 3C1EA 1HEZE 4C3HB 4YTMB 2L12A 4WH4A 5AFWA 2IDYA 5H92C 1RTNA 4LMQD 3A7AB 3HGBA 2NN6H 4F8MA 5CMDA 1H9SB 2X6LA 3BG3A 1E2ZA 4FF4A 1BXTA 4H44C 4BY1B 1UEAB 2L1BA 4OVZA 1SJED 3SHLA 3MXGA 4A90A 2W3SA 1STNA 5KNCA 1SB3C 5MPOA 3EVQA 3S1QB 1TYGB 3GTGB 3PUXA 4F7XA 2F0QA 1PGBA 1WTVA 4DNRB 2DYOA 2WP9B 2PZTA 4KKUA 2DLBA 1DGJA 3FILA 4YSZB 2PKOA 2F3VA 5BN5A 3J7YW 3M7GA 4GDLB 4K14A 1VMCA 3G6JB 2N7JA 4XT1B 4UAIA 2NN6I 1OQQA 5IOCA 2F1MA 1A3VA 3E0JA 2EYFA 3CIRB 1U4MA 2KUMA 1U4LA 4C3IG 4TQ0A 2K28A 1FNWA 2B8GA 4O42A 4BBSB 1SYEA 4L2YA 5HHDG 3BWUD 2EOTA 1K53A 1L6VA 2Y3AA 2E2HB 4OO1G 1EY4A 3NZ3A 1PFMA 1NENB 1SYGA 3EQLC 5JJZA 1HQMC 3VYTA 3PO3B 4NMZA 2A6ED 3A54A 1CA5A 2XVSA 2IW3A 2R6GA 3DWPA 5CBAE 3M3YB 2KJXA 5I9PA 2HTME 4IUVA 1JQ4A 1D5XC 1CM9A 1LT5D 1SYCA 4RKLA 1E10A 3NHHA 3S1RB 3FMCA 1STYA 1F9QA 2JU6X 4HROA 3OWEB 2PNRC 1S5FD 1CZWA 1L0VB 3FKIB 3FPPA 3AH7A 2WINB 4IUQA 3OPOA 1TWFB 1F2RC 5I2XA 2PO4A 3KWLA 5EE9A 1T5XD 1JRPA 4OZCA 1YNJC 1CQFA 2WQYB 4B9WA 1UWMA 3I4NB 2DNEA 3C8YA 1QCBD 2KAJA 1PDXA 2F0HA 1WRIA 5TSSA 1J9OA 2BDNA 4CKBA 3GP7A 3CQZB 2WU2B 2MHVA 2W3RA 3SE0A 4XT3B 3R8BA 3TEYA 4NKLA 1O7LA 1KAAA 1JMLA 3DUZA 2C5CA 4XTCS 2FE8A 2MPMA 2H1EA 1NI3A 2H89B 1STHA 2I07B 1EY9A 3OWFA 5J39A 1V8QA 2D5DA 1LTID 5IIFA 2QJLA 1HFGA 1JOQA 1DM0B 1QNKA 5KIXA 2NN6G 4XE0A 3T56B 2E2DC 2HDLA 1SBBB 3LXFA 1ESRA 1B3AA 1A3UA 4KD4A 2BDOA 2O4XA 4KTAA 3K58A 2F0FA 2OEOA 3NK9A 5AUIA 1AFPA 2B2WA 1PXUA 3CWIA 3NUCA 2QDBA 3VR2A 3HOYB 1DOMA 1L4ZB 3R2IA 4ZRPA 4RF1A 1C4AA 3PO2B 2V3PA 1MVKA 4ITKA 1BQQT 3M85A 3AN1A 1F9SA 2E76C 3AE5B 1GHJA 1SNPA 3NBIA 2RPVA 4C7ZA 3NVVA 3ZYYX 2XWJB 1OXSC 1LT3D 5CORA 2LY7A 2RBMA 2E2JB 1OO9B 1II3A 5C4HA 3MWYW 4RNAA 3K7AB 2TSSA 2QIEB 2KA7A 4XQQA 2A6EC 2BW2A 2K03A 1JE4A 3A8KE 1PTOD 1RCVD 1CZGA 3SK6A 1EM7A 1FEHA 2F0NA 1IUEA 1ZDXA 1ONLA 1XTCD 2ZT9C 1MGSA 1SYFA 4DNTB 1E6EB 5HGTA 4YT0B 3CHBD 3CRKC 4B0MA 1PZID 4U673 4US8A 1NYQA 5ISRA 4C3HG 1N62A 1S5ED 5FKAC 4XYOA 4WURA 3P75A 3I9V1 1GB4A 3CRLC 1FXIA 1KABA 3I57A 3P1MA 1JWBD 1BUIC 4ZUJA 3ABVB 1GB1A 3KBGA 2AUJD 3TBIB 1U4PA 5C2TB 2PMZB 4XWWA 1Z7TA 3SK8A 2AQ1B 3Q8FA 2D9UA 3VRBB 2ONQA 3PZ8A 3OMGA 4TQUS 1N5WA 2E6XA 1EWYC 5FK9C 5C3XA 1FCLA 2ACZB 4HSVA 4AYBB 2V4IB 2K1BA 1A6XA 2KCCA 3QOLA 3HKZB 5JPMC 4ILWA 3QOJA 2B2YC 1CFMA 2EXZA 1QQRA 3T16A 3U9OA 2I46A 2WAQB 4DGZA 4JWSC 2RSNA 4XIGS 3DHQA 3NTKA 1BBXC 4P6VF 3ZJUA 2TMPA 2AQ2B 2EY6A 2X38A 4YSXB 1IW7D 2A6HD 2K32A 3A8IE 5F2DA 1OXXK 2K7VA 4EQOA 3A8JE 3AE3B 4KHVA 3IFDA 4ZOHC 1TWCB 3OW7A 1A3TA 2Q8RE 1FO4A 2XWBB 3HOUB 3X3NA 1MI0A 2WXKA 1VZ8A 3PIO3 1ENCA 2K05A 1UUPA 4G7OC 4R8IA 3K57A 1D2BA 1G8ZD 4DQOC 1BOSA 2HCIA 1V97A 1RTOA 2E2IB 1IGDA 1S5CD 1AP0A 4K8JA 4LAAA 3C2PA 1C8CA 5BMIA 1YN5A 1BCPD 1QLBB 3SFDB 1NEKB 1S5DD 3GTOB 1Y8PB 1JWAD 1M8AA 2F0OA 2W55A 4RWSC 2LGIA 3UI3A 1K52A 1C78A 3QIAA 1FR3A 3WOEA 5DEHA 2EYJA 1GXDC 1MBYA 2EYLA 2O2LD 3AMUA 3MXUA 1WD0A 1F9PA 5KNBA 3S1MB 3C1FA 4KY5A 3TP6A 3PV0A 4KN7C 1L4DB 1X3QA 1JC7A 3M7NA 2C9OA 3U9SA 3GV6A 1DJRD 4L8JA 2PZWA 4C7YA 4ZQ3A 1NAPA 4X3UA 3JAME 5IODA 1SNMA 1ZOYB 1VRAB 1PTOH 3NBHA 3R3OA 1H9RA 3S15B 4A3IB 2KEEA 3I73A 1FRRA 1I6HB 1TJEA 1PRTD 3FDTA 3VR9B 4PMCA 2BB5A 5CV5A 1M4VA 4N9PA 3PUYA 4HMJA 4FF3A 2EYOA 4KKJA 4QUCA 1TWHB 4BY7B 5DM73 1YJIA 4A6QA 5IGEA 3LB8C 1D5MC 5ELCA 2MJ8A 1C76A 2PCFB 4MHEA 4K2KA 5BN4A 2X6GA 4HR7B 1STAA 1XCTL 1E7PB 1VF5C 3AE2B 1QOGA 1XLQA 2BBCA 2FMMA 2N0SB 4REZA 4A8XC 1EEID 2LHDA 4FXGC 2VZKD 3AB5A 3MHBA 4GDKB 4EGVA 2VB3X 5IGGA 3DWQA 3HP3A 2B8FA 4IALA 2QEJC 2LMCA 3DWAA 1IBXB 5C4ZA 3K5OA 3HOZB 1IW7C 4RGNA 2KECA 2RDGA 3K59A 3GTJB 1WGKA 2GRIA 2IGHA 4IFDJ 5LHY1 1RFKA 2QSDA 1SE4A 4RCNA 1RKNA 2INPE 3FVQA 2EZVA 2JSOA 2G9HD 1ILQA 1PYWD 5A35A 3W5VB 3W2DA 2WXRA 1TU2B 4AS1A 2V0GA 1TWAB 3QO2A 4NAWB 4CBVA 4DU9A 3VQIA 2DY8A 1D6EC 3NQIA 1B1ZA 4WQMA 3HVDA 2OXPA 1G291 4G7ZC 2MEKA 1HPCA 3BYTB 4H7BA 2W54A 2IGGA 2BT6A 1OXVA 3PUWA 1KTKA 5G5HA 5BYQA 1NR2A 3ZJVA 1SYDA 2D62A 1O7YA 3D6WA 3P4QB 1TY2A 3E5SA 5CBEE 1PTOF 5D3IB 1JALA 3ZJTA 4OIJA 3U4EG 1PGXA 2YU9B 4H2AA 1OXTA 3BK1A 4XWTA 1GUSA 2MJDA 1ET6A 1F0ZA 4MH8A 4KGTA 1SAPA 3TP7A 5LL6X 2LMCB 2VB2X 1Y8OB 1WTOA 4OGQC 1HTLD 3IAM1 1XEEA 2K5WA 2K3UA 5C3EB 1H9JA 2AQ3B 1EYDA 1LT6D 3I91A 4YXDB 2V4DA 3T13A 1L0XB 4O1NA 4A3FB 3I8ZA 4DF7A 5C0XH 3D4DA 3HOVB 4R3DA 1IYUA 3KF8A 2PZUA 4KY6A 4X3TA 2NVXB 5FLXL 1YNJD 1WWTA 5M5YB 4I65A 4ZRZA 1QOBA 5JEAJ 3ND8A 1TKEA 2F0WA 2Q5WD 5G3LD 1STGA 2IT1A 1Q10A 1V8CA 3A55A 2WXHA 4A55A 1K51A 5IT9L 1VZ7A 3FC4A 1Q8IA 1D5ZC 4Q5VA 1HZ5A 5I9OA 3I90A 5M3MB 4A3KB 4V190 4ZAIA 1WXQA 4FF1A 1TS5A 5A2QL 2AX5A 3IKJA 1ZPSA 5IGCA 3MC0B 4KI0A 2KQ4X 3T3OA 1F9RA 1LABA 5EPJA 3VR5A 5FO8B 1EEFD 3W9CB 2ICIA 2EJGC 2A5HA 5CV8A 1ZXHA 1CJEA 3T53B 1W6KA 1Z6HA 3FAHA 5C0XI 2M9VA 4CJ0B 2FJ2A 3TZDA 1RM6C 1ENAA 4IQZA 1PLFA 4ID6A 5EKIA 1SNDA 2WB1B 3NVZA 4DA2A 4KKIA 3FRPB 3OSOA 4K8IA 1N5XA 3BIID 4XYQA 1NYRA 1O80A 5LNK1 2MJ3A 1BCPF 2INNE 5H8YE 1I4GA 3I70A 2W82A 1DZ1A 3T3NA 2J7ZA 3I3CA 3AE9B 2MGSA 2Q8TA 5I6YA 5JAVA 2HCCA 1EY0A 2IX0A 1N60A 4J6HA 1DD2A 1G91A 4ULLA 2IX1A 1Q3LA 4B0EA 4KGRA 2EYPA 1DYQA 4G7HC 2JZPA 1SJHD 4NP5A 2A68C 2N9LA 5CV4A 4WJWA 4YTPB 1KF6B 2Z1CA 2CHBD 1B2TA 3H94A 4US9A 1DOKA 1EIHA 5HI1A 1UAPA 1JWSD 1SDFA 2NYZD 2KWDA 4M1UB 4C1NK 4F88A 2V3NA 1PRTF 2WXJA 2F4IA 1NVID 2JX5A 3OMCA 2PLPA 4X3KA 3ETRA 1G2TA 4HEDA 3K5MA 3MFYA 1ML0D 5HURA 2DBYA 1EY6A 5KNDA 1H9MA 3RMHA 2A69C 1B9NA 4EQPA 3FILB 2MP1A 5E1FA 4FNFA 4IZ8A 3IXSA 4DN4M 4KK7A 1CHPD 3I4MB 2WDRB 5C0XG 2KOLA 4RHRA 2Y5PA 3LWUA 4LK0M 1Y69U 3L3OC 1K83B 2X69A 4AQ7A 5C4JB 4KHZA 5KYIA 1KDCA 2B2YA 3M4OB 1Z47A 2CW0C 2OT2A 2G9DA 4L1BA 3BDOA 1QILA 4P16A 2KHSA 3LWEA 1YQ3B 1PGAA 4IUPA 2GB1A 1CK1A 2BTEA 4HJGE 4HCSA 3MJ5A 1C9FA 1V1OA 2LJIA 3HOWB 3AE8B 3QWNA 3N52A 5EBCA 3TP5A 1EY5A 3MXPA 1JW9D 4MM3B 2R92B 4U68A 2WXPA 2QKIC 3TDQA 1I7HA 5EE3A 2PIAA 3KQ4A 4KMUC 4MT5A 1WTRA 3IL8A 3Q22A 1ET9A 2Q8IB 4HN7A 3BDLA 1KFYB 3VYUA 1LTTD 1OFFA 2F03A 1ZYRC 2NVYB 5JPNC 2GA4B 2JP1A 1S5BD 2ZXOA 5BYRA 1UNSA 4WRDA 1EYCA 2K04A 4QF4A 3H91A 3KLSA 4ZKBB 2AUKA 1RF2D 2L55A 4JE3B 5J22A 5KYLA 4ZK9B 1V1PA 1OQRA 3U52E 1QT9A 3KUPA 1JICA 3SR1A 2Z4IA 3GTQB 3B9JA 3MAQA 2KCNA 2WKCA 3F2UA 2EE1A 4JPSA 2M2LA 4M0WA 2R93B 2K5QA 1LV9A 3P4PB 4Y7NB 3TEWA 2L32A 3URYA 2OEDA 2JEAI 2JYTA 4FVMA 4A3BB 3G7LA 1C79A 4K6DA 1TS2A 2NB0A 4FXKC 1IHZA 3TP8A 1CI3M 1LTAD 2K01A 2EJFC 1CQVA 4IFDH 2F0GA 5C4XB 4JX1C 2WXGA 4OHJA 2JE6I 1JWMD 1L0YB 3NE5B 2PMVA 4QIWB 2Z4HA 1TR5A 4DAYA 2QCPX 5C5LA 2M0AA 5EE0A 5G3LF 1TQOA 2JA7B 3NWTA 1SE2A 4D2KA 2RSOA 5K36H 1MSHA 3HOXB 2PTLA 1HUNA 4M8AA 1HHVA 3P42A 5BMHA 5M3FB 1X32A 4HTHA 2E3TA 1FD7D 3BK2A 1B4OA 2QMTA 4FYDA 2BE5D 1TT2A 1AZQA 2F0LA 4C1NI 5FOBB 4XDDA 5IGFA 3S2DB 5K5PA 4ABNA 3AU7A 4WAFA 2JA6B 1RD9D 1E0BA 4P2CB 5CYUA 4RFBA 3RZDB 2FBWB 1V1PB 2CVRA 1A15A 3A7LA 2RMMA 4ZLTF 2RA4A 1PTOB 1AZPA 5KRUA 4QCLA 2OHFA 1EWHA 1SXTA 4USAA 1SNOA 3WCQA 2L4NA 1KLUD 1WTXA 1J7CA 3Q69A 2H88B 5C44B 5LL6S 4UDUC 5D3DA 4PMBA 2RDFA 1XLPA 2BA0A 4DAVA 2WNMA 1DOXA 3HS0C 4HMIA 4L23A 1D4BA 4TSSA 1B44D 1PFBA 1GJXA 3D3RA 4DK0A 3S1NB 5C3JB 1ACCA 3MTSA 1GUTA 5ELEA 1AYFA 2K22A 1F2MA 4GLSC 3KLRA 1TY0A 3HRZC 1JWUD 2XN9C 1TWGB 2RQXA 3VR8B 3V3XA 2BOSA 4LTUA 3BYYB 4DXFA 5T8IA 3HZXA 1C4CA 1ESFA 4ZUIA 4K2LA 1TS4A 4J1MA 5COYA 1GUGA 3GTMB 2AWNA 4A3JB 1G6ZA 1WCMB 3R2TA 4KKTA 1WTQA 1B9MA 1ROEA 4E6IA 1F77A 4BBRB 1I4QA 2J4XA 3I72A 1AEXA 4A3MB 2O5JC 3R93A 4K6LA 3Q8CA 5CR3A 3J80L 4C3JB 1EQTA 3P63A 1P7FA 4N59A 4WORA 1RODA 2BYTA 1PFDA 2NVQB 3KK7A 4FF2A 2KQ3A 1BNZA 2BCOA 1PZKD 5EKLA 2PVGC 3IT4B 3SEBA 4IKGA 5D65A 1SSOA 3DXJC 1IYVA 1YN3A 3E9SA 5C5MA 3H09A 1VJKA 1SMYC 3J81L 3AMZA 1BCPB 2XNAC 1QB5D 5GXGB 1RJTA 4TKOB 2BE5C 1SF0A 2K5DA 2PPBC 3NTHA 1HA5A 1EIGA 1VR9A 1R9TB 5EE1A 2KMMA 2E75C 5D7GA 4HKZE 1J8IA 4CHTB 2VXWA 2MH7A 2NMQA 2B2TA 4QMGA 3DMUA 4CJ1B 3P20A 1HZ6A 3AEBB 1FD6A 1EU3A 1MSGA 2JXTA 1PFNA 5EBDA 1BMLC 1W6JA 1XLOA 3PIP3 2WXFA 2E74C 3TMEA 3Q23A 4XDCA 3O13A 2I2YA 2K6AA 3ITPA 3LNNA 3MEHA 2JA8B 4L6TB 1IGCA 1RHPA 1WYGA 5ELBA 1B53A 1KDBA 1G2SA 5T1IA 1KNEA 1PRTB 2KN4A 5JXVA 1LTRD 1EY8A 5DAUA 1O7ZA 4WIPA 4PQXA 1XYIA 2JA5B 1YJJA 1TKGA 1V43A 1DXMA 3DM1A 1PZJD 4K5VA 5M5XB 3FPUB 3KBXA 2WXMA 2HDMA 4YTNB 3B2GA 1P7EA 5FLXE 4QB4A 3X3MA 5JOBA 1WTPA 4OO1H 3NTIA 1QOFA 4LK1C 5M5WB 3EFXD 3S16B 3PUZA 1FFUA 2VZKB 2Z8LA 3GTKB 3AEGB 4CKEA 4IUNA 2A68D 5IT9E 1JOKA 2G1EA 1BF4A 1H9SA 3QB3A 1HTPA 4ODGA 2VUMB 4ZHPA 4NAMA 3BZDB 1HRJA 3IT6B 1YN4A 1JR0D 5A2QE 5BMGA 2IX3A 2N55A 4HEA1 3OOCA 3P4SB 2WV6D 2EELA 4R9WA 5T1GA 2J42A 3AEFB 3RFZB 3GO5A 2B76B 2NWGA 1C4PA 4BWGB 5G5GA 2B39A 2AWOA 4DFAA 4RGTA