1XXGA

Crystal structure of staphylococcal enterotoxin g
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
233
structure length
227
Chain Sequence
QPDPKLDELNKVSDYKSNKGTMGNVMNLYMSPPVEGRGVINSRQFLSHDLIFPIEYKSYNEVKTELENTELANNYKGKKVDIFGVPYFYTCIIPKSEPFGGCCMYGGLTFNSSENRDKLITVQVTIDNRQSLGFTITTNKNMVTIQELDYKARHWLTKEKKLYEFDGSAFESGYIKFTEKNNTSFWFDLFPKKELVPFVPYKFLNIYGDNKVVDSKSIKMEVFLNTH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Crystal Structure of Staphylococcal Enterotoxin G and binding affinity to T-cell receptor and MHC class II molecule
rcsb
source organism Staphylococcus aureus
molecule tags Immune system
molecule keywords enterotoxin
total genus 61
structure length 227
sequence length 233
ec nomenclature
pdb deposition date 2004-11-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01123 Stap_Strp_toxin Staphylococcal/Streptococcal toxin, OB-fold domain
A PF02876 Stap_Strp_tox_C Staphylococcal/Streptococcal toxin, beta-grasp domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.110 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1xxgA02
3.10.20.120 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1xxgA01
4RFBA 2AQ2B 1JWSD 1D5ZC 1T5XD 5D3IB 3EFXD 5FKAC 1EEID 1B44D 4RGNA 1I4PA 1PTOF 1FD7D 3TSSA 1LT6D 1LTAD 3R2TA 1G8ZD 5D3DA 2NTTA 1PTOH 1PRTF 5ELBA 3W2DA 1CHPD 2XRQD 1FNWA 1BCPC 1JR0D 1KLGD 2TSSA 4RGTA 1XXGA 1FGBD 1UUPA 4NZLB 1DYQA 2XNAC 1SJED 1S5CD 2J4XA 1S5FD 1CQVA 1JWMD 1PZKD 1RD9D 3BVZA 1YN4A 1I4QA 4TSSA 4Z9CB 1JQYD 1PRTC 2R61A 1BXTA 3MC0B 1B1ZA 4L63B 5FK9C 1UNSA 1PTOC 1SXTA 4RGOS 1V1OA 1AN8A 1HTLD 1ENFA 1V1PB 1PZID 2ICIA 1S5DD 1LTSD 1TS4A 1SE3A 2AQ3B 1I4HA 1F77A 1KTKA 1XTCD 5ELCA 1FNUA 1GOZA 1S5BD 3DWAA 2IPKD 1V1PA 4O1NA 4RHRA 4C56C 4ZYSA 1LT3D 2RDHA 5ELFA 1TY0A 1LLRD 1LT5D 3BYYB 2SEBD 1SEBD 1TS3A 1LTID 1CK1A 3BZDB 1EU3A 4OHJA 2NTSA 1EFID 1LTRD 1QILA 1AW7A 3SEBA 1HA5A 3EA6A 1JWUD 1BCPD 1ESFA 3GP7A 1HXYD 1PTOB 3KLSX 1LO5D 1STEA 4RH6A 1TS2A 1I4XA 2CHBD 2IJ0A 3DWPA 1EU4A 1LTGD 1PRTD 1RF2D 2RDGA 1SE2A 1LT4D 2QEJC 4L6TB 2O2LD 2WV6D 1M4VA 3R2IA 1HQRD 5TSSA 1D5MC 1MD2D 3DWQA 1JCKB 1I4GA 1PZJD 1EEFD 1D5XC 1ET6A 1CT1D 3OWEB 4RHSA 3R8BA 3URYA 1SBBB 1S5ED 1DJRD 3MFGA 1RDPD 5ELDA 1YN5A 1YN3A 1D6EC 1PRTB 2G9HD 1EWCA 1L0YB 1SJHD 1TY2A 1CHQD 1RCVD 3BVGA 2Z8LA 2QILA 2AQ1B 3BVMA 5I4DA 4BWGB 1ET9A 4RGMA 1KLUD 1LTBD 3BYTB 4RCOA 1TS5A 1I4RA 1PYWD 4K6LA 3V05A 2XN9C 1BCPF 1FNVA 2XRSD 1PTOD 4DXGA 1BCPB 3O13A 5ELEA 4UDUC 4DXFA 3CHBD 1SE4A 1L0XB 1LTTD
chains in the Genus database with same CATH superfamily
3L9AX 2WX1A 1V43A 4FHJA 2BT6A 1J19A 1KNEA 3OOCA 4A3LG 2B2WC 5K36G 2GB1A 3BK1A 4DR3L 3TUOA 3TJPA 4RGNA 1I4PA 2WU2B 1I42A 3TZDA 2HIXA 1L4DB 1WGKA 1E10A 1IBLL 2BWFA 1FPYA 1U4AA 5D3DA 3STBC 1IGCA 2FNJB 2JRIB 3NHHA 2UXCQ 3G6JB 5H92C 1Q86C 4ZAIA 5ISRA 5KNCA 4FHKA 5DLQE 1WCMG 1K3RA 1WJJA 3ZRFA 3RZOH 1JJ2A 3FVQA 1G6JA 3S1NH 1JT8A 4BKGA 3I3CA 1CQVA 1PXUA 1SYDA 1AYFA 1KRHA 1XYIA 3AXCA 1HZ9A 3WDNA 4CGYB 2K50A 3KF6A 1VZ8A 4NPNA 3CP0A 2C60A 2ZCBA 1E8XA 3APDA 1FFUA 1UGJA 2HD5B 3HG9A 2FXQA 1NNXA 1BF4A 2JY6A 4XE0A 1LGRA 1TWAH 3PZDA 3LYYA 1TZ1A 4L5SA 2FIFA 4GLVB 3ZLZA 4FP5D 4WWOA 1IYUA 1OQYA 1EIFA 4REZA 1P9DU 3RZFA 1ACCA 1ZXIA 2HCIA 2ZNVB 4P72A 2KYWA 2B29A 2G9DA 3AEBB 4DHZE 1UEAB 1IBXA 3IKJA 4NPSA 1YJJA 3HK0A 4A3GG 3R3MA 3SDLC 3A7LA 1LT5D 2L11A 1PVOA 4IDIA 1JOKA 3KJPA 2KLCA 1JQ4A 1CA5A 4KKTA 4ARIA 2LXCA 3IT4B 1LTRD 4LNKA 3A55A 1QILA 2MPMA 1YNXA 4NXML 3H7SA 2CHXA 1DM0B 1C8CA 1HA5A 3BK2A 3N30A 1ESFA 3Q3MC 5E6NA 4JI3L 4MZ9A 1H95A 2M1MA 4BBSG 3JAMc 4L8JA 4PZ7A 4C80A 3T56B 2FMCA 1PH4A 4HAEA 1WX7A 2M19A 1PFMA 3EJIA 3KLSA 3GB1A 2BDOA 5TSSA 1QKZA 2VL6A 1K83B 1MD2D 2F4VL 1VQ5A 1TKYA 5GXGB 4ALPA 1G6PA 1LYLA 2DZIA 1WJ4A 3UDFA 2FCQA 2DJGC 2KJRA 2UU7A 4I6LB 3X23A 2PMVA 4GS3A 2OJWA 3M4OH 2IY0B 4DNTB 3EFUA 2R2QA 3I4MB 3VYUA 4R4IA 1IKMA 2QCPX 2OXPA 3F2UA 4Q2JA 3NY5A 4DV5L 4BFRA 2HQEA 1V5TA 1WJNA 5BYQA 3SR6A 3U4VA 2DAFA 4B3MQ 3HOVH 4HROA 3QK0A 1CHQD 2MFIA 2OEOA 4O0AA 2M56B 2VNUD 4N9F4 1PH3A 4MEMA 4W9JA 4YSZB 5IO9A 1KAAA 1PUTA 4FLHA 4FA6A 2VXWA 2M0AA 3BYTB 2WNMA 2B2VC 3OJ4B 4WJNA 4K6LA 1PFBA 2E8GA 3CQZB 4PMBA 1Y1VH 2IX1A 1HFGA 1FRDA 2FE8A 3PPAA 4GDKA 2I5LX 4TVAB 2KN4A 1GUNA 1PH9A 5JHBA 3K57A 1LTTD 1ZYRC 2ALYB 3ITPA 4YWLA 1MJEA 3C2PA 1C76A 2GBRA 3KUZA 2MX2A 4OELB 1E2WA 3QIAA 1SDFA 4N58A 5D3IB 1KD1C 2MRPA 4LF5Q 1BO0A 4UY8C 3GDEA 4PT5A 2RA4A 3NTHA 1II3A 3D8GA 2F0FA 2X38A 2NTTA 4LF7Q 1A3UA 4ZYNA 1WTVA 4MHEA 4XXEA 1AEXA 4RGTA 4F88A 3ETRA 1QOBA 5CGKA 4JI5Q 2DZMA 2RSOA 5C44H 4K2KA 1A3TA 3GTLH 4GOPC 1TWCB 1EY8A 4OVVA 2FCSA 2KEEA 3G7LA 1NI3A 3L0WB 3BDOA 4DV4L 3KOJA 1WH3A 2CU1A 4P73A 1NI2A 4W9FA 3R7QA 4LF6Q 2HDEA 3A56A 1Q1OA 3ZJUA 3WAMA 1B1ZA 4BKSA 5J17A 4HTHA 2KWDA 2K33A 2ZEQA 3KLRA 2KVRA 4TQ1A 4YWMA 3A1QB 4V190 2Q5WD 1Y1VG 2QMTA 4D2KA 4JG2A 4IN3A 2ZM6L 3IAM1 1IZ6A 1XTCD 2Q8RE 1FNUA 1GOZA 1HR0L 1B2TA 2KACA 1JALA 2WXPA 5D6JB 5BYSA 4LK1C 3C46A 2REXA 4IFDI 4EQ5A 5M5XH 1GHKA 1TY0A 1VS0A 4RMFA 4KKIA 4HCEA 3PHWB 3U52E 5DPRA 4DR6L 1VQ4A 2LS01 1ZGUB 2KJXA 4H13C 5CC4A 5GAGC 3KYCD 4A3DG 1OQQA 2KX3A 3CCSA 3NEMA 1GUGA 3T1YL 2A69C 1BBWA 3KUPA 1L6VA 1WTQA 1XO3A 3NUCA 3CMMB 1DOMA 4UAIA 2NVXH 2F0HA 1X9NA 1TKEA 4DK3C 2KDIA 4JOIA 2K03A 3FMCA 2V3SA 1KNAA 3PV0A 4PS3A 3AFQA 1HXYD 3FKIG 1WGYA 1TS2A 1U4PA 4A3MH 5JHAA 3KK7A 4ZRJA 3VFKA 2LGDA 1UE1A 4JYAQ 1U4LA 5LNK1 3K58A 1K8GA 1M4VA 4I7ZC 3SR1A 2RCFA 1XEEA 3UE1A 4IUPA 2DAJA 3MXNB 3P75A 4FADA 1CZPA 2FCNA 4H44C 1GB4A 2XGTA 4O42A 1G2SA 4G0NB 2JPHA 1GAQB 4FJVB 3MEFA 4EE2A 4ID6A 4A3DB 2K9XA 4WURA 1I6VC 2L55A 1ML0D 5F2DA 1FXIA 3Q3JA 4JQWC 3Q6BA 3S15B 4ITKA 1PRTB 2G9HD 2BB6A 4X65Q 1L0YB 2MH7A 3CMAA 1F9JA 5IT9c 2QDBA 4QY7A 1YJWA 1DD2A 1K53A 4HIKA 3ZJTA 1A6XA 2PZTA 5IODA 5AJ3Q 3W5VB 3A4RA 4KZ0A 3HOYB 1QCBD 3DHQA 2KD0A 1D1KA 1HPCA 2N55A 2BYFA 4WRDA 1Z5SB 3V05A 2AL6A 3M85A 4LF6L 4IZ8A 1MKHA 1YITA 2FUG1 5KIXA 1Y1WB 5IOCA 2KCMA 1DCZA 1WD0A 1X54A 1PH7A 3QR8A 3PO2B 2JWUA 2G1EA 3ZTCA 3MHZA 4ARCA 3TCAA 4GDKB 3B9JA 4ME3A 3VTUA 1DZ1A 3RYTA 3WWVA 2F03A 3PIO3 3AMUA 4PZ8A 1YIJA 1XPOA 2WQYB 3UI3A 2KA7A 1CI3M 1OO9B 1JC7A 2N1WA 4GLAC 3NTKA 1WCMH 3M4QA 1PDQA 3PUYA 1VQEA 3R2TA 1WFQA 5FJ8G 2RCNA 3B0AA 1X3PA 5BO4B 1YQ3B 3MXNA 4N8X1 4YHHL 1T0QC 1ZPSA 4MGZE 1Q81C 2NYZD 4AH6A 1HHVA 1V97A 4NJ7A 3GV6A 5EQ0A 1TT5B 1VZ6A 2K4KA 2QKIC 1CKOA 1F2LA 2LEKA 2X6GA 3E9HA 1SF0A 4Q5VA 5JJLA 1XNRQ 5LMNW 4BBSB 1TWGB 2MQJA 1JB7A 2C35B 2IX0A 5C1ZA 1LABA 2HD3A 3NTIA 2F0PA 4AS1A 2ID0A 5L37A 4K3CA 2WWZA 4I6NB 2EYMA 5IGGA 1L6UA 2HJ1A 3VHTC 1LACA 2K0PA 1E0ZA 1I35A 1PMRA 3TZUA 2KJ6A 5JH5C 3VR3A 2OTLA 1E0BA 2J0MA 4DXAB 1ZOYB 3T9LA 1N34L 2SNSA 1I3QB 4C56C 5C3WA 3EECA 2PW7A 3EN2A 2BS3B 4GOCA 3FHWA 3Q3FA 1WXQA 2K8CA 1A3VA 2A5UA 3AE1B 2PMZB 5ELFA 5AUIA 1TZOA 5IGEA 2LHDA 4EVOA 2PQEA 2N3SA 3NOBA 2RSUA 4ZRPA 1KRSA 3K59A 1SYFA 2UUAL 2R7FA 2C5LC 3W1BA 3M9BA 2BA1A 3QWZB 4OHJA 4BA2I 2JRHA 1XF5L 4MGIE 3KF8B 1WTOA 3Q8AA 4NQLB 3C1FA 4DHJD 4GKKL 4J8QA 4A93H 4CDFC 4OVUA 4QIWE 4HK2A 1V86A 3O65B 4JI7Q 3TS2A 3QWNA 2V4LA 4KN7C 4YCUA 1YJ1A 3CIRB 3I72A 3CCJA 2RDGA 2KHWB 2KCCA 2E3TA 3NRZA 1HQRD 2SDFA 5G3LF 2KDBA 2AWOA 1JMLA 3I56A 5KNDA 4JI2L 2R92H 5IGDA 4DAYA 2KOLA 2MEKA 1E9MA 5G3LD 1B7YB 1GUTA 3RLOA 5HGQA 4C7ZA 2DLBA 1NENB 1WI5A 4HJ8A 3EGRA 5D7GA 3NVYA 1HZ6A 1EY5A 1QOHA 1IUEA 1EF1A 2JX5A 4G11A 1NJIC 2LMCA 1YN5A 4KSKC 2WAQE 4KD4A 1TY2A 4NJCA 4HSPA 4H2AA 4IWPA 2AQ1B 3K0XA 1NY4A 4CJ2C 4F87A 1RRBA 5E1FA 1MFWA 2MW5A 3UIPB 1AE2A 2CW0D 1KXLA 2KVMA 1UWVA 2XWJB 4R4TA 3OIQA 2KJHB 4RCOA 1UE5A 2IO3B 4S0RA 4DR1L 3N1XC 3A8KE 1JE4A 3W3AA 4JI2Q 2G45B 2NVUI 2L00B 1L1OB 4DN4M 1Z2MA 5ELEA 3HOXB 3NK9A 1A62A 4GN4B 2MNAA 4O2DA 4B3RQ 5M3FH 4ICVA 5G2NA 1GUAB 3P4RB 1F2RI 3B2FA 1HEZE 4RFBA 4PQXA 4Y52H 1N63A 4HKZE 4LF9Q 2Z6KA 2INPE 3EFXD 2DENB 4GKKQ 4L2YA 3UQAA 3UDXA 3QARA 1PLFA 3AM9A 4XGAB 5K36H 2C7HA 1LT6D 2DZKA 1NE3A 2KTRB 2BDNA 4R1JA 4QUFA 3ZO5B 4P1CC 4C3HG 1YBYA 1LQBA 3DVNU 3VUXA 4KGTA 4XWWA 4BY7H 3ZDMC 4DAPA 3FP9A 1EQTA 1STBA 3PHXB 4LNNA 3A8IE 3DHGC 2CVRA 2MWSB 4ZHPA 1EY6A 5LHY1 2K52A 3C0RB 5C0XG 4GMVA 2NBWB 3K9PB 3IL8A 1ZXTA 4I7AA 3TMPB 3TP6A 1N34Q 1I4QA 4QIWB 3S1MB 2W3RA 2Y5PA 1H9SA 5C3JB 1KL9A 2KN5A 5FK9C 5M5XB 5IP7G 1F2ZA 2KMCA 2M8SA 3K6OA 2DNCA 1QVCA 5EDSA 3GTOB 1C3TA 3A5UA 4RGOS 2Q2UA 2KZRA 1WTPA 1AN8A 3M4OB 3T16A 1KDBA 5IWAL 1D1IA 2OF1A 1E8YA 3GZNB 4M00A 4C2MB 3KJOA 3E6ZX 4M8NA 1S5BD 1EF5A 1MI0A 1XCTL 4A3EB 1YEZA 4EZLA 1HRJA 1G6ZA 4BVUC 3N20C 1R7SA 2YVCA 2IYDB 2RD0A 3OYYA 1Q7YC 2JYTA 4ICUA 2WIIB 5JPNC 3MWYW 1H9JA 4CHTB 3NE5B 4N9TA 4NB3A 4ULLA 2V4DA 1R4QB 4X3TA 3RNUA 2ZXOA 3SK5A 4HCNB 2Q2HA 2F0NA 1JJCB 3HFZB 3R3OA 5A2QL 2ZJPA 1SN8A 1G2TA 3PS6A 4BOSC 4MSQB 1J0GA 4BS9A 1C77A 4QL5A 3CCVA 5HGTA 3J81i 4B3TQ 1LO5D 4IURA 2CHBD 1I4XA 4TKOB 4A4IA 1OQRA 1TTNA 2JYEA 4FF2A 3LWUA 2PYKA 1ASZA 2MSED 3P7JA 3S17H 1NBFC 3FRPB 3U2SC 1FO4A 2KCTA 3CCLA 3AEEB 1ZDVA 1J5EQ 3PSEB 3ULLA 1QZGA 2BH2A 3UE0A 2I07B 3VA5A 5EPLA 1UE6A 3DWMA 4RHSA 3SU8X 3URYA 2YTYA 3DCGA 2K8HA 3RT3B 3FILA 1SYEA 5AJ3L 3WIMA 2QC8A 3W1SA 4IG7B 3M3JA 1ZKHA 1K8MA 3CU7A 4WJ4A 1F9RA 5EPJA 1N36L 1EM7A 2KANA 2LGXA 3HRDD 2QW7A 1WFYA 3WALA 3BINA 3RD2A 3DWGC 2AX5A 2LJ5A 3ZUNA 3X3NA 2IBIB 2LMCB 1HZAA 1N8RC 2BBCA 2L52A 4M1UB 2L12A 3AE4B 1O78A 5DM63 2QA4A 3I4MH 4UP7A 2EYPA 2KCNA 2XN9C 4DR7L 3DPDA 1R4PB 3RI7C 2J0KA 4IM0A 3D0FA 3VA7A 2GBJA 1BCPB 2L7RA 1SNOA 2PZUA 2A4ZA 1FCLA 2W9NA 4B9WA 4YCWA 2F4VQ 2E2HB 1XLOA 2XWBB 4FBJB 4YY3L 5IT9E 1J8IA 2B3GA 1N32L 4DUYL 4A3KH 2B63G 3L13A 1TVXA 1WZ3A 3QHTA 1STHA 2R7DA 1ZXHA 5IP9G 3J80L 3N52A 4HSVA 2Y0SE 3H7PB 3L2PA 4ZUJA 1NMFA 4CJ0B 2VQFL 2H1EA 4RWSC 4LF9L 2NBUA 4JGHB 4BKSD 1PFDA 1YHBA 3NJTA 2QCZA 5ELBA 1XLNA 4E74A 3MJWA 4DR6Q 1EYDA 1B50A 1T5EA 2KTRA 2AEHA 2RHQB 1WTRA 1TWFH 5C2TB 1VQHA 1DYQA 2JK8A 1SNDA 2IT1A 2MBHA 3H0GH 1F9SA 3KLWA 3PUZA 1XPUA 1FFVA 1ICWA 4DR1Q 2B2UA 2RPQA 4P6VF 2CFMA 1HR0Q 4A3KG 2B63H 3FKYA 3K5MA 2J42A 3MXPA 3NS1A 4Z9CB 2C7NB 3CSTA 4L5TA 1IBML 1CKNB 2K14A 1RL2A 1Y56A 1U4MA 3RNBC 1Y1WG 3NXWA 2WYQA 4KGSA 3APFA 4Y7NB 2MA9B 2K5WA 1K8AC 2BYVE 3MC8A 2XVSA 4W9EA 1V1PA 4KJNA 2NPTB 1D7QA 4HLEA 3CXCA 1UD7A 2D11A 4GLSC 1HNXQ 3SD5A 2O4XA 4JI5L 2JEBI 4MTKA 1C4PA 4BBRB 2PEAA 4TKNA 4LDTB 2LWPA 4XC2A 1ROEA 2B2UC 2SEBD 2ZPYA 3QCAA 2V3PA 3QIJA 3TQYA 3CF5A 2R7ZH 2CW0C 2RDFA 4JI7L 4MNOA 2PVOD 3ZNID 2H5XA 2KMMA 3MC9A 4EQOA 4IO9A 2D5GA 4LF5L 2WXGA 3ZJYC 2IGGA 2JXTA 4QB4A 2DYBA 3I4OA 5AEKB 2L76A 2W55A 1M94A 3SHQA 1HH2P 2INNE 2K8BA 1KABA 4HCSA 2PQAB 1LV9A 2O2LD 2WV6D 1MHWC 2VH2A 3KUDB 5D2MB 2YU9B 2JEAI 2RSNA 3AMZA 1EYAA 2KX0A 1X1MA 3MTSA 1F9QA 1VD2A 2KC2A 1A63A 2O6VD 4ABNA 1E22A 3AEDB 1JB3A 4KTAA 2EIFA 2WXLA 1J7CA 3T4AC 2I0QA 3H0GB 3MEHA 1AP0A 1D6EC 2ES2A 4JI1L 2DYOA 2Z8LA 5BN5A 3BDCA 4RG1A 3PIOA 1EWIA 5JJKA 2I1KA 1UEBA 3AH7A 5CHFA 3TN2A 4XYCA 3OMGA 3DVNV 3D6WA 5LL6S 3RPFC 5CHVC 2OT2A 4J3OD 4JI6L 1HZCA 5FO7B 5IT9L 5IP7H 2D2CC 2NZOA 4ME5A 2VUMB 1K51A 1RKNA 1WMHA 1SSOA 2MLBA 2ENBA 2ZNVC 3R66C 3S2AA 2G5DA 1G291 3K0YA 4II3B 1SMYD 4GOPB 5FOBB 2IY1B 3OSOA 3V60A 5KYIA 4AWJA 4KD3A 1SB3C 4WFN3 1EEID 1B44D 3W5UB 4DKAC 2E2IH 1PTOF 3GTOH 4NXMQ 4DAMA 1P7FA 3Q23A 1JMCA 2PQAA 1STAA 4BY7G 3FAHA 3F2BA 2IX3A 4P74A 3S1MH 4A3MG 2BE5C 3P20A 5KNBA 4BA1I 3ABVB 1FNWA 2EQSA 1V6EA 4JX1C 2LXKA 3G6EA 4HPMB 2K25A 2F52A 1PHJA 3JAML 2IL8A 5KGUA 3DUZA 3NENA 3QOJA 4W9DA 1SFOH 1XWEA 3MP9A 2LVOA 3V6CB 3JAMi 4WORA 3IFWB 4X65L 4C1NK 1K8OA 1RFAA 4WJWA 5BN3A 4XQQA 4A3BH 2MO1A 1HTLD 1FRRA 2QIEB 4NNJB 1JJGA 1KDAA 1LTSD 4FJZA 4M02A 2D2QA 3GZNI 3NVZA 2BH8A 2PNRC 4A3IH 1C79A 3MJ5A 4JWSC 2R6GA 3HUIA 4N8FA 1IL2A 4GOPA 1CMXB 1G91A 2L8JA 2WKDA 2EYOA 4A3JB 4F7XA 1HTOA 1GUSA 3DHHC 4YWGG 3TEXA 1VRAB 4EZKA 1WVLA 4RKBA 1WR1A 2BB5A 1EFID 1WGGA 1F0ZA 1OXXK 2DNEA 1MSGA 1VQOA 1RAXA 1XNQQ 3DEPA 2VQEQ 2VUMH 5HG2A 4F7ZA 1C9FA 1EY7A 2R93B 1PV4A 4EUTA 4YWKA 3G71A 1HJPA 2IW3A 1OFFA 5M5WH 4GGQA 4OXPA 1SE2A 1UAPA 3T51B 3CCQA 3R2IA 2LFNA 1MI2A 2ON8A 3K5NA 3AV8A 1QUQB 1NUCA 4X3KA 1HNZQ 3GTLB 4KHPL 1KOTA 1ENCA 1B9MA 1KIXA 1AARA 1CTMA 3N1YC 4OX9L 4CKEA 2KDFB 5IN7A 3L17A 1RDPD 1R4MI 2JE6I 2EMSA 1SIFA 1SNQA 2JQRB 3ERSX 1AH9A 2HIVA 5ELOA 2KK8A 5AUKA 1EWYC 3BVMA 3FPUB 5C4JB 2JSVX 4LJPB 4WWNA 4YSXB 1EUVB 3L7ZC 2HHHQ 3DBLI 4XWTA 4A3KB 3P63A 1VQ8A 3M3YH 1LTBD 2N7EA 4A55A 2JF5A 4DV4Q 4BXXG 2ONQA 1I4RA 5IAAC 2E76C 2M9VA 5JEAH 2FUHB 3D32A 3J9CA 1FNVA 4MT5A 2JWZA 3DHIC 2JZPA 3HOVG 4DV7Q 5C6AA 4K5VA 2JUOA 2KWUB 3KH0A 3DLLA 5IGFA 2VH1A 1E8WA 3ZDTA 4JW0A 3JC66 4L23A 4C2MH 1EZ8A 1GUOA 1ZKOA 3D4DA 3M7GA 2LRWA 4WAAA 2HUGA 1A15A 2JA6H 1WMHB 3ZKJC 1NSNS 2B8FA 5FR3A 2DZJA 4KV2A 1SNPA 3CW2C 1L5PA 2XIWA 3HIZA 1QOFA 1FL0A 1B9RA 4KVGB 1J9OA 1LTAD 3EIVA 4X64Q 3I55A 1K52A 4XZ4A 2QSDA 4C4VB 4H7BA 2JA5B 5J22A 4A75A 1OXVA 4B3SL 4NXNQ 2QGQA 4OEMB 3A33B 3DEOA 4PZ6A 5M5YB 4A3MB 1F52A 4MDKE 3WANA 2PNHA 2K32A 2QDFA 3I63C 4FVMA 3M63B 5LMUQ 4GDLB 4NZLB 2UXDL 1Q8KA 5A2QE 1C4QA 3BWUD 2N9XA 4X62L 1HTQA 4E3CA 3IRBA 5CV6A 1XT9B 1OTRB 3N3KB 3IG3A 4AQYQ 4H0LC 3DM1A 5LMNL 2CR5A 4W9KA 4L63B 1EO6A 1VF5C 2R3ZA 2N9PC 3DVGY 4B3ML 1UNSA 1CZWA 4K6DA 5D65A 5H1SE 4P2CB 4DAVA 4UHVA 2VW9A 4JI4Q 1PZID 2ICIA 3AI5A 5CORA 3VDYA 1TS4A 3JVZX 2MBOA 5J18A 4TRDA 2RF4A 1ZYRD 3VXWA 5EKLA 4CKBA 2KHJA 4LFCL 1BNZA 2O2VA 5E6PA 4ZYSA 4GLXA 1E8ZA 3ICEA 1E7ZA 2CQAA 2KECA 2NN6H 2Y0SG 2EKEC 4S17A 4DDID 5CR3A 1H9RA 3CRLC 2D3CA 2NMQA 4HVBA 3S2DB 5FLMG 1HNWQ 5CV4A 3OW7A 4IUMB 1LTLA 4WJOA 4S3SA 4JI3Q 2RMMA 4TUUA 3VR5A 1Q1EA 2WB1E 4A3EH 3CF6E 3IAYA 4HJAA 1E24A 1C1YB 3ZJVA 3SEBA 2PZWA 4LF8L 2OJRA 1J6QA 1MHHE 2CU3A 2GOWA 1EYCA 4G7OC 3L3OC 2AL3A 2Z0DB 3AEAB 4W9CA 1PFSA 1WTHA 2B2TA 2D0OA 4ANUA 1LT4D 1SMYC 4KHVA 4L6TB 3V2TA 2QEXA 4L5RC 2LGIA 4YIJA 4U68A 3VTWA 2JXMB 1S3OA 1P3QU 3PUWA 5IA7A 3DWQA 2JA7B 4KIKA 2OHFA 3ALBA 3PO2H 1MJCA 1OXTA 3VYTA 2NS5A 3E9IA 3K81C 5K5PA 1LXDA 3IFTA 4GNXB 1DJRD 1S1QB 2C7MB 2MHJA 3GTMH 3GTJB 4GB9A 3J7YW 1YN3A 4HMIA 2M2LA 2CCZA 1SLJA 1ZDXA 1K83H 3NUHB 4GU2A 4HN7A 1B4OA 3HOUH 3V96A 2O2VB 5EE9A 2G4SA 1PH6A 3H6NA 4JBJA 3HZXA 2D3BA 3AULA 2EY2A 2LVPA 1F1HA 5JEAJ 2V4IB 4TMAB 2F0DA 4X66L 1T0RC 2KNBA 3PLUA 3EBEA 3I73A 2MGSA 1F2RC 2PPHA 3P4SB 4IUVA 3LB8C 1XLPA 4ANXA 1KM7A 4QJFA 3SK4A 4FULA 4DR2Q 2L3ZA 2WDTB 4BBRH 1BT0A 1PGXA 3I90A 5NUCA 2UUCL 1V81A 4R3DA 4C3HB 3C8YA 3Q8BA 1EL0A 2ZJDA 3I8ZA 2KEDA 4DV0Q 3TREA 1PH2A 1N33Q 1HCZA 5JJIA 4R4QA 2J7QB 2JU6X 2L05A 2A68C 4KLKA 4GNXC 4C3JG 5M3MB 4ASWC 2K5VA 3Q24A 2I1JA 4LF4L 2NVTH 1OEYA 1S3SG 2WFWA 4FYDA 4P71A 3OIPA 3M3YB 2NVQB 1JOQA 4NP5A 4C3IH 3KUCB 4A90A 2PO4A 1BR9A 5C3XA 2MJDA 2ZCCA 3GTKH 2CJNA 4A8XC 2KKCA 4M0WB 4R8NA 1ILQA 3PGZA 4B0EA 4DFAA 1D2BA 4MTNA 1GHJA 2XNAC 3QOLA 3S15H 2B76B 2KWCA 2LGSA 3HM6X 2EJMA 3F2DA 2PE9A 4F8MA 3IHPC 5JEAG 4POFA 4JIOU 1JRUA 1EUJA 1RD9D 3HOWB 4BBNC 3PRZA 4DV6L 4MN3A 1E3PA 3SGIA 4A3CH 2C9WB 2OCEA 4GIVA 4FNFA 3GE8C 3JW0X 2QJLA 4OVZA 2D3GA 3MC0B 1B9NA 4ZLTF 3H8HA 1B8AA 2CH4A 3FILB 4OIJA 4GKJQ 3NG0A 1SIJA 2E5LQ 4OO1H 2ICEC 2NZ1D 4AOFA 2KC1A 3RR5A 4DV1L 1AZPA 2LI5A 2UU9Q 3RNCC 2BWES 4DV3L 2YEPF 4WJPA 1AE3A 1MJDA 3A0JA 4DV2Q 1UELA 4OZBA 5M3MH 2E2HH 1WD1A 1VZ7A 1TS3A 4LFBQ 4LCDE 4C3IG 4BAXA 3T53B 3VUWA 3S9WA 2M4NA 2K7VA 5EKKA 3RN2A 3RULA 3CMEA 2B2WA 3TEWA 5EE0A 5C3EH 2J52A 3AE8B 1WE6A 3DBHB 1YNNC 3EA6A 1V8CA 3T3NA 1ZP0B 4DDGD 3GP7A 3KF8A 4YTNB 3D4WA 3KLSX 1IXRA 4IC7B 3H7PA 2LUEA 4M0WA 3QB3A 1U5KA 2RVLA 4BBSH 1WXSA 3VH3B 3NVVA 3QO2A 3UIOB 2AUKA 5E4XA 1D5MC 2KXJA 4LF8Q 4G50A 3RLFA 3Q0AA 3BZKA 1GB1A 4DUZL 1CT1D 5GAEC 3R8BA 1F2YA 4HPPA 1X6OA 4DPGA 4A3IG 1SBBB 2MP1A 1V2YA 3WA0A 5DPWA 4KIKB 2K1FA 1NYQA 5EE3A 3CCUA 1IBKQ 3HOUG 4DR4L 4GNXA 3ULJA 3K7AH 3X0WA 4E71A 1ZE3D 4C7YA 1SJHD 4EQNA 4W9GA 4IWQA 3LXFA 2Y0SB 3TEYA 3OPOA 4KKUA 2WACA 1ET9A 1OXSC 4TQUS 1RLFA 3HVDA 2GBKA 3HM3A 2WXOA 1R9TH 4RMAA 2XSCA 4K7WA 1V8QA 3T13A 2NR2A 5DNFA 4DK0A 1PGBA 1TKGA 1X56A 1MPEA 3N1ZC 3AECB 4F8CB 1TIFA 1VQIA 2W82A 4PK1A 2NPTA 3R93A 3PV1A 4B6WA 2SAKA 1NEKB 2KTFA 1EIGA 2ZVNA 4PS8A 4NMZA 1LUZA 1SE4A 5C5LA 2I46A 2F0LA 1L1OA 4JI8Q 4XDCA 2KOXA 2R93G 2NZHA 1E90A 2K5QA 5HKHA 3S16H 3KDFB 3I5JC 5I9OA 1K73C 3GTPH 2LGYA 3CC4A 4X3UA 1CJEA 1KHIA 3RN9C 1VQFA 1NBWA 1C0AA 2V1YA 3RFZB 3EQLC 1PTOH 2DBYA 1YNJC 1YNTE 3VAWA 3TL5A 4K8IA 1C4CA 3I4LA 1FMAD 4LUOA 1FEHA 4IW0A 3KBGA 3S1RB 3HKZB 1NAPA 3NSWA 4JBWA 3QC8B 3ZGZA 3HOZG 2FIDA 3PZ8A 4CHKA 3CKIB 3GTGH 4YCVA 4LUVA 2CKZB 1UBQA 3NVWA 4YSYB 1MBYA 2I5MX 3RN5A 1QNKA 3DBLB 3MHBA 4X3SA 3U9OA 2YTVA 4CDCC 2JA5G 2QF7A 2BTEA 4LFBL 1PRTC 1BXTA 4BOZB 3STBD 5JVG3 1GG3A 1UE7A 4NAWA 2E2JB 1HUMA 4LUZA 3W5OA 4DV2L 4HWIB 2NVXB 1H9SB 4DV3Q 1TKWB 2WKCA 4TQ0A 5KYLA 2IO0B 1YX6B 5C4JH 1PA6A 4KX6B 1I4HA 3F8TA 2UXBL 4O1NA 2UYZB 2HTHA 3TBIB 4XT3B 1Q12A 3HOZB 3CQZH 3JSVB 4GKJL 1CUKA 1H9MA 1R4NB 2F0OA 3I4NG 2W3SA 4K1RB 3P1HA 2JA7H 3H94A 2HCCA 1M1KC 3OHXC 3VYRA 3DM3A 1WYGA 4WIPA 1JRPA 4XQNA 1UGMA 4K0KL 3SFEB 2Q8IB 3QG1A 4DR5L 1IKLA 3P1MA 2OOBB 2L15A 1WM3A 3AE7B 2KQ7A 2K5HA 3HOZH 2PI2A 4A6QA 3G4SA 1BDOA 1PTOB 2JA6G 3ZXRA 3N6RA 4IFDH 1W3SA 1EY0A 2VQEL 1VQDA 2D0PA 1PZJD 4M8AA 4A3OA 3RZDB 5IYCH 5L83A 3VQIA 3VR9B 3V62A 3WCQA 1SROA 1VQAA 3J81E 3RUIB 1T0YA 3PO3G 2KMAA 3ONSA 5FLXL 4K3BA 4KKJA 3BG3A 2B63B 1SYCA 4LNIA 1M8AA 2JYOA 2K28A 2AYOB 2XK5B 4HDOA 4JPSA 1JICA 4DBGA 1U9RA 1K50A 1VQJA 3PCOB 3BVGA 3EFCA 1I5FA 3U9SA 1BMLC 3D6CA 2EMTA 3I70A 4EEWA 4RGMA 3JSVA 5BMIA 3TRZA 4ZRIA 3SDZA 4J6HA 3T1HQ 5C4XB 2NN6I 3GTKB 3BIID 2XRSD 3P42A 4IPHA 1IBKL 3PF4A 2ZJRA 2NVTB 5KRUA 1T3QA 2AMCB 1VDVA 3N9YC 2RR9A 4JV5Q 3DMUA 2IHEA 2V9HA 2GN5A 4XX5A 2AQ2B 3RCZA 1D5ZC 2V3NA 2JN4A 3R7RA 2ZXPA 1RJTA 3D4RA 3H1UA 1T0SC 5JXVA 4CQNA 4QCLA 4BY1G 4R4CA 5JAVA 4TV3A 5JZEB 1JWAD 4HJ9A 3K5OA 2Z9HA 4HMJA 3K5LA 1O7IA 2V0GA 2N78A 4DNIA 4MSMB 4ZHOA 2ZW0A 1RODA 1XD3B 1C78A 2WP9B 1WX9A 2JZZA 1VQCA 2F0WA 3ER0A 3HKZG 3SHLA 2G3QB 1GJXA 4FN2A 5D94A 1CM9A 3C1EA 3E56A 3ZQ4A 1TT2A 1Y8NB 4JC0A 4UP8A 5I2XA 4AQ7A 3A74A 2OWOA 5T1GA 2MP2B 3NQIA 3PQIA 2F1MA 2EJFC 4NKLA 3W1GA 1KFYB 4G3XB 1SR3A 5TR5A 4N9PA 2KQSA 3J7AV 2UU9L 1YHAA 3APCA 4DV1Q 3P4QB 5E6OA 2LUMA 1NCVA 5KEEA 2KQ3A 1EY9A 3IT6B 5J39A 1S5DD 3F2CA 4P1BC 1GPXA 2AQ3B 1I6HH 2H89B 1F77A 5ELCA 2B2VA 5BR8L 1Z47A 4FDBA 1UF0A 2Z59B 4W9HA 1X3QA 1C48A 2FFKB 1KRTA 5A35A 2UUBQ 2RDHA 4JI4L 1N5WA 2D07B 4IJLA 1PH1A 4A20A 1V1QA 1XQQA 2L4NA 2PW9A 2X8XX 1WGHA 4JE3B 2LXJA 2LHEA 1B3QA 1SEBD 2D3AA 3NELA 1QQRA 1LTID 3A8JE 3OTOQ 2LKVA 3BZDB 4FF1A 1IYVA 2INDC 3U4EG 4II2B 2YU9H 4X62Q 1YHQA 1TWAB 4B9KA 2WXQA 1BOSA 1WM2A 1JWUD 2EVBA 5EE1A 2F3VA 4IFDG 2NVQH 3E9SA 4WJQA 4K14A 4B3SQ 1GC6A 3H3VH 2EELA 4A3JG 2EJGC 1VCIA 1O7ZA 1Q3LA 1K3BC 3ERQA 4PG3A 3X3MA 2JXXA 4RM9A 5GMVA 4HIMA 4IPCA 2LFIA 1JCKB 3J81L 3ENEA 1W6KA 2WXJA 1ZEQX 3KYHC 2RBMA 4PS7A 2AUJD 5CBAE 4HEDA 3CD6A 2K3UA 3EC8A 1BUVT 4GDLA 4EOYA 2DUDA 3KBXA 2GRIA 1S5ED 1XMQQ 2WXMA 4HJ5A 3MAQA 4L1BA 4OONA 1LFDA 4AIMA 1YMHE 4X66Q 2M00A 1WSPA 3AE6B 1FYCA 4Y7NH 2RKSA 3CCEA 2JZ3B 2WXRA 1RIPA 1TWGH 2MQHA 1U0LA 1IL8A 1YNJD 4LTUA 4CKCA 2MJ3A 5DEHA 4LJZC 5M5YH 4MJSB 3HKZE 4FO2A 4QAYA 1LM0A 2AWNA 3D3RA 2IWHA 1WCMB 4K5WA 4NDXA 2JA8H 1WE7A 3W1YA 2FCMA 1DXMA 4TSSA 2J0TD 4OX9Q 1D3ZA 2CJOA 3UF8A 3SFDB 1O7LA 3S1RH 3GV3A 1JWSD 1FCCC 1T5XD 5FO8B 5C3EB 1JOOA 2PMZE 4KGRA 2PKOA 2GI9A 1S4ZA 4P75A 3TSSA 3I7FA 4DGZA 2BW2A 3P4PB 3BDLA 1UWMA 2JA8B 3RMKC 2D5DA 1N9WA 2ZTEA 2R7ZG 5IOIA 1DOLA 1JR0D 3QJYA 4OO1I 2KT7A 1QB5D 4EFOA 1UUPA 3IBEA 2P5ZX 2GVBA 3ZNHB 1NMGA 2PJHA 3RD4A 2B3AA 1SJED 2EY6A 2WU5B 3BY4B 1DOKA 3PLVA 2F0TA 2J4XA 1SGHA 4A3EG 4WQOB 2IO1B 1WRDB 1VJKA 4KY7A 3CRKC 3BS1A 1XCQL 2KUMA 5EBCA 5L95C 1VQGA 3IFDA 5FO9B 4YY3Q 3H6MA 1EQQA 2IGHA 2VZKB 2M0XA 2B2YC 1SYBA 5C0XI 3W1SC 3M4PA 4ZDVA 3S14B 3VRBB 1TWFB 4LFCQ 5C44B 3K7UC 3ML8A 3MXGA 3RUZA 1STGA 3K8AA 3U4ZA 4FJYA 4MJSA 1KF6B 2HDMA 3V61A 1E5WA 3FDTA 1QOGA 2NUCA 4FXKC 1AWDA 3FKIB 3ULPA 3ZRCA 4A93B 4WH4A 3QA8A 1HE8A 2EXDA 3GO5A 5IYBG 3FPPA 4KSLC 1WY8A 5HURA 5BN4A 4ILWA 3A5ZB 1QWYA 5M5WB 5EGTA 3V3XA 3CAMA 4OWWB 4K5XA 2HJ8A 1P8LA 2PCFB 1AW7A 4R9WA 3GTJH 1KQSA 4LFAL 3PGEA 4WWMA 1IP9A 3LNNA 5IYDG 3HOXG 1UWXA 2RPVA 3ZW3A 1BVSA 5E7NA 1M90C 3OG5A 3I3TB 3PUVA 1RTNA 1OGWA 1J8CA 4X64L 4KMUC 1TXYA 4DU9A 1DGJA 1V80A 2FAZA 5CTRC 1LTGD 3AEGB 4DR5Q 2QEJC 1N6ZA 4B3TL 2KLGA 4J6IA 2JA8G 2JA7G 4W9LA 4IWOA 1UBIA 3HOVB 2RGFA 3ND8A 3EHVA 3WAOA 4MGYE 4AUQC 5BYRA 4KKSA 1D5XC 1MGSA 5M9OA 2DWQA 1KLVA 4XTCS 2WHIA 1QUQA 2SOBA 1Q0WB 3ECIA 4AJYB 1AZQA 1Q46A 3TS0A 3T3OA 3J7A5 2B2YA 4US9A 4A3BB 4G7HC 1L2NA 4LMQD 3EUB2 4A3GB 3Q3NC 1RCVD 5DCNA 3CWIA 5CV5A 2QILA 4CBVA 1EYGA 2DYMA 1EQRA 4ZUIA 4AYBB 5I4DA 2LD9A 4NY0A 2I5HA 3VR6A 2JA5H 3GD7A 3MFYA 3EROA 4NJ6A 3NP8A 2YYZA 4ANWA 5C0XJ 3NWTA 2LJIA 4MELA 4C1NI 4GZYC 4JI1Q 2Q2TA 4DXGA 5I6WA 1P7EA 4HRSA 1FR3A 1ILPA 3HVZA 3L08A 4FXCA 3I2ZA 5LL6X 1N60A 3SK6A 2LASA 3OW2A 3RLNA 3PSIA 2GBNA 4KHPQ 4PMCA 3PIP3 1PYBA 2FMMA 1TQOA 3NWSA 3OMCA 2XBBC 1E7VA 5C23A 1GO3E 2KFJA 2L32A 2EY5A 2EYJA 1MVKA 4LFAQ 2CHWA 4HXDA 3TBLD 4BBNF 1J7BA 2O6VB 2R93H 3DXJC 3C3LA 2X6LA 3HOYH 3W2DA 3TP8A 2INCC 2K5PA 4XYOA 1BCPC 2TSSA 4C4VA 1EY4A 3OTOL 2YLMA 3UDIA 3Q22A 1FGBD 1NR2A 4DV0L 4JBKA 2R92B 4AP4C 3A7AB 2A74C 3EVQA 1VQKA 4CJ1B 4MACA 1S5CD 4HIDA 4RNAA 1S5FD 3SVMA 1W6JA 4GN3B 1QOAA 3AE2B 2L0TA 4KZCA 3Q2AC 3LJ3A 4DR2L 1VQBA 3GS2A 4N59A 2K22A 1JQYD 4JCVE 1WYDA 1PGAA 4B9XA 1HTPA 1MSHA 2EDGA 1SXTA 3S1QB 1SE9A 2B39A 2PPBC 1V1OA 2BS2B 1I7HA 1HNXL 1XLQA 4ZOHC 2Z4HA 3KVFB 2AKWB 3OAWA 3J80i 2IZVB 1GM5A 5CHWA 1ESRA 1VMPA 2F0QA 5CV9A 1QVFA 2ATWA 1Y8RC 3MHSD 3AYHB 4IPDA 1KC8C 2RHSB 1XMOL 4C3JB 4DUZQ 4IUQA 1TYGB 1A8VA 1IBMQ 1HZ5A 3A54A 1SFOB 3NBHA 3VTVA 4ACFA 4GXBA 2G4DB 3KWVA 3M4YA 4C3HH 1QG7A 4FXGC 2GA4B 4DF7A 1WWTA 4BKTA 5EKIA 4IKGA 1VQ6A 1A2UA 3AQQA 3U8ZA 4DWFA 1QF6A 3Q8DA 3AEFB 2ZT9C 1PYSB 1KJTA 3L16A 5C4HA 3KWLA 4HDQA 2MJ8A 4USAA 5AZGA 3KDFA 1STEA 1ISNA 1EU4A 2YEPB 1IYJB 1K0RA 4YTPB 2WAQB 2ASQA 2NBFA 2VZAA 1NVID 4JL9A 3ND9A 1XMOQ 4BY1B 3ZYYX 1L0VB 1GC7A 2WB1B 2BQQA 2MJEA 1YX5B 5HI1A 4EKUA 2MCNB 2KFKA 5E4WC 1E2ZA 1E6EB 1STYA 4IJHA 1P98A 4OL7A 2VS1A 1H8CA 1Z6HA 1C9OA 2CWAA 4DA2A 4IQZA 5ELDA 1T6BX 2WXIA 4HJGE 4KY5A 1WTWA 1E1OA 1YJ9A 3DVGX 1DOXA 2HQLA 1E7PB 1E2VA 2V1CC 4RA8A 1GKHA 2NN6G 2OQKA 2NB0A 4LLGM 4OGQC 4MH0E 4NAWB 3PIPA 2KVZA 1XMQL 2OTJA 4BWGB 5JVH3 1N5XA 1YIWA 1Z9FA 2J0JA 2JSOA 3PRPB 1K28A 2X69A 3PMFA 4XYQA 2LXAA 2A1AA 1BCPF 4DV6Q 5IYCG 1UZXB 3KW5B 4DK6C 3PF5A 4APVA 2R92G 1YOVB 2N1VA 4GN1A 4LK0M 5LMNQ 4FF3A 5C44G 3AN1A 1CKMA 2CWPA 4AQYL 2N9EB 1JE5A 3U30A 1GNUA 1SRUA 2K1BA 3TP7A 3ZTDA 1L0XB 2K75A 2GMIC 4CDEC 3SXHA 3I91A 2N9KA 2E6XA 3NS8A 5LMUL 5FKAC 4ZRZA 3S24A 4C3JH 4HJ7A 4ZRQA 1T9HA 3Q8EA 5BMGA 4JOIC 2YV5A 1DOYA 5DM73 2BS4B 3U50C 2WX0A 1GUWA 2VY3A 1PRTF 2B2TC 1N33L 3TP5A 1YVCA 2F0JA 2ZXRA 3AFPA 1I3QH 1KLGD 2A6HD 4OW0A 3H91A 2N49A 2KFKB 2WDRB 3GE3C 3I4NH 3ML9A 4I6PA 1A2TA 3ZIMA 2BYTA 2GVAA 2BOSA 2D62A 4I65A 5CMDA 3HOXH 2UUBL 5IYDH 2BPSA 3J7AF 1ONLA 2KDEB 1VDZA 5BR8Q 3BVZA 4WJ3M 2MHVA 3TDQA 1QZHA 1YN4A 3NHEB 4RF1A 3FEWX 4AYBG 2QHOA 4EX5A 3A1QA 1Q82C 3WAPA 2UXBQ 1JROA 1Y69U 4QMGA 2O5IC 1B3AA 5IYBH 2F3WA 3M7NA 4IM3A 1PTOC 3GTPB 1E1TA 2D9UA 3KFUA 1ENFA 3DBHI 3RNAC 2KBNA 5LXHA 1DGSA 3AU4A 5GQOA 3RNEC 1KTKA 3GTMB 1X55A 1X65A 1VQLA 5IWAQ 4IOCA 2ZZPB 4KI0A 3LDZE 3U7ZA 1E7UA 2MBEA 3NQTA 3S1QH 4RM8A 1BKBA 1VQ7A 2PIAA 4RCNA 5HY6A 3Q3OC 3J7ZC 3PT2B 4FF4A 1HQMC 2HE7A 1FXAA 1WRIA 4M8MA 1XTDA 4JWUC 3HGBA 3PRMB 2WDVB 3I57A 1CSPA 3Q8CA 3ZVVA 2WDQB 2A19A 3B1LX 4RH6A 3VVWB 3MVVA 3TEHB 4YTMB 3RNGC 2A73B 3LX0A 1XNQL 4QQBX 2JQOA 4A3GH 3WOFA 5IY0A 4W9IA 1N32Q 1TGZB 3S2HH 5J2RA 1ET6A 1FXTB 1R4MB 1IW7C 3RMHA 3UDGA 2ACZB 4M01A 5D14A 1QJOA 1VLBA 2FBWB 5GROA 3MFGA 4PNYA 4RF0A 5FR6A 1BUIC 3NBIA 1PH5A 2F0VA 1SAPA 4DR7Q 2CKHB 1MG8A 1BBUA 4XQJA 5FLXc 2L1AA 2WXFA 2F0KA 1Z7TA 2J53A 1HUNA 1NDDA 1EIHA 3BZCA 3PREA 1KLUD 3AE3B 5KHQA 2FINB 2L0CA 4X6AH 1ZW7A 1PYWD 2WP8J 4LNQA 1SMXA 1N36Q 4XDDA 1IW7D 1RM6C 2WS3B 1A0IA 2CQOA 2YTXA 5EBDA 1IPGA 2WLBA 4YL8A 2A6HC 4NW2A 1X3EA 4CDDC 2N0SB 4DHJB 2HTME 2VB3X 1P1AA 2ZTDA 3FKIH 2EYLA 1J5EL 2WINB 1I50B 4NQKE 4NXNL 1ICFB 2OEDA 5C3EG 2Y3AA 4A3LH 2JT4B 5T8IA 1PH8A 4H02A 3T8MA 2SNMA 3HOYG 5BMHA 1CHPD 1PFNA 4IPGA 5HFYA 1J7AA 2N8NA 2J7ZA 2F0EA 4KJOA 4IM2A 3L54A 2BCOA 1SSNA 4MM3A 1QLBB 2Q2IA 4PMWA 2KHSA 1X3GA 4IUNA 4GN5A 3J81j 2E2DC 1XPRA 1QVGA 3QX1A 3ZNGC 1TJEA 4HR7B 1JWMD 5IGBA 1HFNA 4DV7L 3V6EB 2L5TA 4OO1G 1EZ6A 4C3IB 4JI6Q 2LRUA 4XIGS 2MBBB 1FGUA 1EOVA 3A9JA 4KHZA 1TWHH 4LAAA 1JW9D 2A68D 1OEYJ 4PYUA 1EQVA 3H15A 4IOAA 1ASYA 3JYUA 3L4PA 2NBVB 2HT1A 1SE3A 1OTCA 4JPBW 4A3CG 1R9TB 3OLMD 4B0MA 1VR9A 2F0GA 2IPKD 4OIKA 1SYGA 2BYEA 4L5QA 4QGUA 1WXMA 3VRAB 2QDLA 3B08A 4HIOA 2I38A 4JVZA 1Q5WB 3U58A 1C7YA 3S14H 1VQNA 3B2GA 4DV5Q 4G4KA 3QJZA 2WXHA 2LY7A 3BJUA 2KHIA 3FC4A 4DNRB 1YZ6A 4HKQA 4P7IA 1CK1A 1I50H 5EJWA 3MA2B 5IE8A 1OXUA 1U4RA 2GLSA 2A8VA 5KHOA 4RAUC 2VUMG 3E5SA 5C0XH 3E0EA 2VZKD 2K05A 2R2OA 4LF4Q 5J3BA 3E0JA 1N62A 5AZFA 5ELNA 2K39A 2EYFA 2WXNA 2LSSA 1WI0A 4X57B 4BZAA 2BF8B 2XEWA 1K9MC 1EOTA 4OWXB 4YHHQ 3HS0C 2MBQA 3DBRI 4MM3B 3HHMA 3E3XA 4U673 3H9DA 2DY8A 1TU2B 3AEVA 4ZRKA 2EXZA 1IGDA 4BBRG 3DQVA 4IOIE 4MGKE 4IFDJ 1K8RB 3IAS1 1VF7A 2N4FA 1ENAA 2RQXA 2UUCQ 1RYJA 4ZCKA 3RZOB 4KY6A 2W54A 1UH6A 1CSQA 2F0MA 1EEFD 4PYZA 2R7ZB 2F3IA 5G5GA 1PDXA 2NWGA 3G48A 5T1IA 1FD6A 2KO3A 4A3IB 3B6YA 3Q6SA 1B53A 2PLPA 2EPBA 4WWPA 5GADC 4A3BG 2E75C 1EWCA 1L7YA 4WAFA 1BQQT 1XX8A 1YNND 3P2BA 4IUUA 2F0UA 2XK5A 3DBRB 5IGCA 5EPKA 3PUXA 4K81A 1QNUA 4ZK9B 4A3PA 5CV8A 5I2YA 4K7UA 1X3FA 2JJQA 2DNFA 2L83A 2WGSA 2DN8A 2PI2E 1KDCA 4MIUA 3PO2G 5MPOA 1EWHA 3J80c 2E2JH 2GBMA 1P0RA 1QE6A 3NZUA 1B70B 4WQMA 1MG4A 5DPSA 1TWCH 1Y8OB 4JBMA 2A69D 1NTGA 2EE1A 4UDUC 3HEJA 5EAYA 3HKSA 4DXFA 1WJ6A 3CHBD 3A4SC 4LDTD 3DOWA 1YQ4B 1SNMA 1LM8B 3TMEA 3H0GG 3MTNB 3QAQA 3UQBA 1F2MA 1FD7D 3PVLA 4R8IA 1A5RA 2DJFC 3HOWH 1G8ZD 3OWFA 2BGFA 4UPAA 4JYAL 3L10B 2Z1CA 4JV5L 3NPPA 2VQFQ 1I6HB 1HA6A 1VMCA 4K2LA 3JAME 2F0SA 2TMPA 1FM0D 3IXSA 5FLMH 1XXGA 3TEZA 1IBLQ 4A9AA 1Q8IA 1KH0A 3C19A 3RZDH 2NVYB 2E74C 3M62B 2UUAQ 1R4NI 3T1HL 2BVCA 1C4AA 3Q14C 4LJOB 2CS4A 3RZWC 4DQOC 2E5LL 3UGBB 2IHFA 2PW5A 4E6IA 2R61A 1CZGA 4JLCA 4YT0B 5G5HA 4JK1C 2EYHA 1FIQA 2MP2A 1O80A 2I2YA 2L9HA 1RHPA 4LW1A 3WOEA 3S1NB 4ZKCB 2ASBA 2UWQA 4OZAA 1RWSA 3I4MG 5CYUA 2DX5B 3A9JB 3PO3B 2LVQA 4PV1C 3H09A 3LGJA 3DWAA 4RHRA 1FJGQ 2CH4W 3GQBA 1TR5A 1VQPA 2ZM6Q 3AU7A 2JA9A 1YI2A 1I94L 1WYWB 2Y5BB 1GVPA 1H4RA 2MO0A 2AWTA 2IDYA 1LT3D 1VQ9A 5CX3A 5I9PA 1SNCA 3RNFC 5GAHC 2BKFA 2JVCA 4C00A 4OWTB 4CYEA 4HEA1 4POGA 4K8JA 2DGYA 1L4ZB 2NTSA 1Y1VB 2OQ0A 3CCRA 1CQFA 3CSFA 3CC2A 2ZPNA 3BU2A 1WF9A 4A3JH 4K0KQ 3DWPA 4XT1B 4DHZB 1PRTD 4AYBE 3AB5A 1HZBA 2K5NA 5FJ8H 2K6DB 1F9PA 3I9V1 2VB2X 3VR8B 2O6VA 3I4NB 5IKCM 1MIUA 1GD7A 2ZTCA 3J80E 5HHDG 2F4IA 5J1ZA 1WGDA 3PO0A 3Q8FA 4LWCA 2KAJA 1CFMA 1IYFA 1V5OA 4BXXH 5DPTA 3IVFA 3OJ3A 3NZ3A 3CC7A 3CPFA 2BE5D 2Z6KC 2Z0EB 1A70A 1EFWA 2N88A 1WR6E 1STNA 1Y1WH 2KQ4X 2N7JA 2VRRB 4P16A 2NVYH 1S40A 1W2BA 3TIXA 2EKIA 3Q69A 2Z6BA 4A76A 2JP1A 1YD8U 3S2DH 2EOTA 4A3FH 5C4XG 3VDZA 4YXDB 1TBEA 3M95A 5C5MA 3CCMA 3H3VI 5G55A 5JPMC 1TS5A 2C9OA 4QF4A 3S17B 3ZXVA 2FHTA 1WX8A 2RDBC 1D8LA 4Q0FA 4OZCA 2H88B 4US8A 1PTOD 2FJ2A 3UINB 5C4ZA 1V9PA 3O13A 1GJZA 4QUCA 2EZVA 1N61A 2L1BA 2O5JC 1HNZL 1WTXA 3GTGB 2H4OA 4G57A 5DAUA 1NR4A 1IHZA 1YJNA 3GTQB 1VQMA 5IIFA 4URKA 3SK8A 3NBHB 3HOWG 3VH4B 4MH8A 4IUTA 1Y14B 3KYDD 2BA0A 4JI0Q 1YQBA 1Q10A 1TWHB 1WOCA 1K0SA 4LNOA 5IP9H 4B08A 2PVGC 2ZVOA 1Q1BA 4JI8L 4EGVA 1WXAA 1FVIA 3ZNZB 2MUYA 2XRQD 1HNWL 4ZKBB 4DAYB 3DBSA 2ZJQA 4DUYQ 4BY1H 4FXDA 5I6YA 4ODGA 1WXVA 1WGRA 3T1YQ 4DK5A 5COYA 1EIYB 3QQ8B 4JI0L 1L0WA 4F1SA 4ANVA 2WAQG 1JWBD 2K5DA 4LNFA 1PZKD 2BKRB 4NAMA 4KV6A 4A3DH 4B3RL 2JA6B 1CKNA 3K9OB 4XDXA 3SE0A 5JOBA 2B8GA 2XTIA 3J81c 5M3FG 3U7DA 5M3MG 1RFKA 1S72A 5AZHA 4CO7A 1L2FA 2DY7A 4J15A 3LWEA 4DR4Q 3S2HB 1QT9A 2A5HA 1V1PB 1V9JA 3K80C 5CBEE 4A3FB 1Y8PB 3AB9A 3W9CB 1PQSA 1IBXB 2F0IA 2IO2B 3GOEA 2K04A 1D4BA 1SE8A 5AFWA 4ZQ3A 3HP3A 4HCPB 1TIID 1ZUD2 2PE6B 2UXDQ 3A9KA 2KENA 2K6AA 3S16B 1MHXA 2KWVB 3N32A 1LLRD 2Y5CA 4AJWA 3VR4A 3BYYB 2Q8TA 3GTQH 2M17A 4V0BA 5CV7A 1V49A 3MXUA 3HRZC 4IALA 1EU3A 5E3FA 3PO3H 1DONA 1L1OC 3MZ5A 4R4OA 2N9LA 5LXIB 3UI2A 1NYRA 2K01A 5H8YE 3VUYA 2WXKA 2LZ6A 2WB1G 2Z4IA 1WJUA 2D10A 2AHOB 2E2IB 3PTFC 3D31A 1BCPD 4LF7L 4EZJA 4B95A 1WZ0A 2L0FA 2IJ0A 4GSWA 1H9KA 1RF2D 2UXCL 4KK7A 1BBXC 4HPLB 4BY7B 1AFPA 4A93G 2N7DA 1I4GA 4UP9A 1GXDC 3DDCB 2KDMA 3AE5B 4DR3Q 4KN4C 1O7YA 1G51A 1X32A 3L0OA 4K7SA 3OWEB 1CA6A 2HHHL 3AU5A 5LLIA 5C4XH 5JJZA 4G7ZC 2A6ED 4J1MA 4A3FG 3AE9B 1WIAA 4KDIC 4KDLB 5FLXE 2DHZA 5IP4D 4DK1A 3KF6B 5E6JA 3CPWA 2C5CA 2HDLA 3VYSA 1Q90A 2EY1A 5M3FB 2CHZA 2NCNA 2IY5B 3H3VC 3VR2A 4HJKA 1I94Q 4EQPA 1FJGL 1RTOA 1XJVA 1VCBA 3A9KB 4N6EB 3PZ7A 1JORA 3ONAB 2PTLA 4RKLA 3KQ4A 2A6EC 3K7AB 1HR0W 1P16A 1YJIA 2K6QA 1KAWA 3F1ZA 1XNRL 2Z0SA 3HOUB 2IGDA 2ZW1A 1DOIA 1QZEA 3NZSA
chains in the Genus database with same CATH topology
3L9AX 1V43A 2BT6A 1KNEA 3OOCA 2GB1A 2B2WC 5K36G 3TUOA 3BK1A 4RGNA 1I4PA 2WU2B 3TZDA 1L4DB 1WGKA 1E10A 5D3DA 1IGCA 3NHHA 5H92C 3G6JB 4ZAIA 5ISRA 5KNCA 3FVQA 3I3CA 1CQVA 1PXUA 1SYDA 1AYFA 1KRHA 1XYIA 3WDNA 4CGYB 1VZ8A 1FFUA 1UGJA 3HG9A 1BF4A 4XE0A 3LYYA 4FP5D 1IYUA 4REZA 1ACCA 1ZXIA 2HCIA 2G9DA 3AEBB 1UEAB 1IBXA 3IKJA 1YJJA 3A7LA 1LT5D 2L11A 4IDIA 1JOKA 1JQ4A 1CA5A 4KKTA 4ARIA 3IT4B 1LTRD 3A55A 1QILA 2MPMA 1DM0B 1C8CA 1HA5A 3BK2A 1ESFA 4L8JA 4C80A 3T56B 2FMCA 4HAEA 2M19A 1PFMA 3EJIA 3KLSA 3GB1A 2BDOA 5TSSA 1QKZA 1K83B 1MD2D 1TKYA 5GXGB 2PMVA 4DNTB 3I4MB 3VYUA 1IKMA 2QCPX 2OXPA 3F2UA 4Q2JA 2HQEA 3SR6A 5BYQA 4HROA 1CHQD 2OEOA 2M56B 2VNUD 4YSZB 1KAAA 1PUTA 2VXWA 2M0AA 3BYTB 2WNMA 2B2VC 4K6LA 1PFBA 3CQZB 4PMBA 2IX1A 1HFGA 1FRDA 2FE8A 2KN4A 1GUNA 3K57A 1LTTD 1ZYRC 3ITPA 3C2PA 1C76A 1E2WA 3QIAA 1SDFA 4N58A 5D3IB 1BO0A 4PT5A 2RA4A 3NTHA 1II3A 3D8GA 2F0FA 2X38A 2NTTA 1A3UA 1WTVA 4MHEA 4XXEA 1AEXA 4RGTA 4F88A 3ETRA 1QOBA 5CGKA 2RSOA 4K2KA 1A3TA 1TWCB 1EY8A 2KEEA 3G7LA 1NI3A 3BDOA 2HDEA 3A56A 3ZJUA 1B1ZA 4HTHA 2KWDA 2K33A 3KLRA 4TQ1A 4V190 2Q5WD 2QMTA 4D2KA 4IN3A 3IAM1 1XTCD 2Q8RE 1FNUA 1GOZA 1B2TA 2KACA 1JALA 2WXPA 5BYSA 4LK1C 3C46A 4IFDI 1GHKA 1TY0A 4KKIA 4HCEA 3U52E 2LS01 2KJXA 4H13C 5CC4A 1OQQA 1GUGA 2A69C 3KUPA 1L6VA 1WTQA 1XO3A 3NUCA 1DOMA 4UAIA 2F0HA 1TKEA 2K03A 3FMCA 1KNAA 3PV0A 1HXYD 1TS2A 1U4PA 3KK7A 1U4LA 5LNK1 3K58A 1M4VA 4I7ZC 3SR1A 1XEEA 4IUPA 3P75A 1CZPA 4H44C 1GB4A 4O42A 1G2SA 1GAQB 4EE2A 4ID6A 4A3DB 2K9XA 4WURA 1I6VC 2L55A 1ML0D 5F2DA 1FXIA 3S15B 4ITKA 1PRTB 2G9HD 2BB6A 2MH7A 1L0YB 1DD2A 2QDBA 1K53A 3ZJTA 1A6XA 2PZTA 5IODA 3W5VB 3HOYB 1QCBD 3DHQA 1D1KA 1HPCA 2N55A 4WRDA 3V05A 3M85A 4IZ8A 2FUG1 5KIXA 1Y1WB 5IOCA 1WD0A 1DCZA 3PO2B 2JWUA 2G1EA 3MHZA 4ARCA 4GDKB 3B9JA 1DZ1A 3AMUA 2F03A 3PIO3 2WQYB 3UI3A 2KA7A 1CI3M 1OO9B 1JC7A 3NTKA 1PDQA 3PUYA 3R2TA 1X3PA 1YQ3B 3MXNA 1ZPSA 2NYZD 1HHVA 1V97A 3GV6A 5EQ0A 1VZ6A 2QKIC 1F2LA 2LEKA 2X6GA 1SF0A 4Q5VA 4BBSB 1TWGB 2IX0A 1LABA 3NTIA 2F0PA 4AS1A 2ID0A 5IGGA 2EYMA 1L6UA 1E0ZA 1LACA 2K0PA 1PMRA 3TZUA 3VR3A 1E0BA 1ZOYB 2SNSA 1I3QB 4C56C 5C3WA 2PW7A 2BS3B 1WXQA 1A3VA 3AE1B 2PMZB 5ELFA 5AUIA 1TZOA 5IGEA 2LHDA 4EVOA 2PQEA 4ZRPA 3K59A 1SYFA 2BA1A 4OHJA 4BA2I 1XF5L 1WTOA 3Q8AA 3C1FA 4J8QA 3QWNA 3CIRB 4KN7C 3I72A 2RDGA 2KCCA 2E3TA 3NRZA 1HQRD 2SDFA 5G3LF 2AWOA 1JMLA 5KNDA 5IGDA 4DAYA 2KOLA 2MEKA 1E9MA 5G3LD 1GUTA 4C7ZA 2DLBA 1NENB 3EGRA 5D7GA 3NVYA 1HZ6A 1EY5A 1QOHA 1IUEA 2JX5A 2LMCA 1YN5A 4KD4A 1TY2A 4NJCA 4HSPA 4H2AA 2AQ1B 4F87A 4CJ2C 5E1FA 2CW0D 2KVMA 2XWJB 3OIQA 4RCOA 3A8KE 1JE4A 3W3AA 4DN4M 5ELEA 3HOXB 3NK9A 3P4RB 1F2RI 3B2FA 1HEZE 4RFBA 4PQXA 4HKZE 1N63A 2INPE 3EFXD 4L2YA 1PLFA 3AM9A 5K36H 1LT6D 2BDNA 4QUFA 4C3HG 4KGTA 4DAPA 1EQTA 1STBA 3A8IE 2CVRA 4ZHPA 1EY6A 5LHY1 5C0XG 3IL8A 1ZXTA 3TP6A 1I4QA 4QIWB 3S1MB 2W3RA 2Y5PA 1H9SA 5C3JB 5FK9C 5M5XB 1F2ZA 2DNCA 3K6OA 3GTOB 4RGOS 1WTPA 1AN8A 3M4OB 3T16A 1KDBA 1D1IA 2OF1A 4C2MB 3E6ZX 1S5BD 1MI0A 1XCTL 4A3EB 1HRJA 1G6ZA 1R7SA 2JYTA 2WIIB 5JPNC 3MWYW 1H9JA 4CHTB 3NE5B 4N9TA 4ULLA 4X3TA 2V4DA 1R4QB 2ZXOA 3SK5A 2F0NA 3R3OA 5A2QL 1G2TA 4BS9A 1C77A 5HGTA 1LO5D 4IURA 2CHBD 1I4XA 4TKOB 1OQRA 2JYEA 4FF2A 3LWUA 2PYKA 3P7JA 3U2SC 3FRPB 1FO4A 3AEEB 1ZDVA 2I07B 3VA5A 5EPLA 3DWMA 4RHSA 3URYA 3FILA 1SYEA 3W1SA 1K8MA 3CU7A 1EM7A 1F9RA 5EPJA 3HRDD 3DWGC 2AX5A 3X3NA 2LMCB 2BBCA 2L52A 4M1UB 2L12A 3AE4B 1O78A 5DM63 2EYPA 2KCNA 2XN9C 1R4PB 3VA7A 1BCPB 1SNOA 2PZUA 1FCLA 4B9WA 2E2HB 1XLOA 2XWBB 5IT9E 1J8IA 4A90A 1TVXA 1STHA 1ZXHA 3J80L 3N52A 4HSVA 4ZUJA 4CJ0B 2H1EA 4RWSC 1PFDA 5ELBA 1XLNA 1B50A 1EYDA 1T5EA 1WTRA 5C2TB 1DYQA 1SNDA 2IT1A 3PUZA 1F9SA 1FFVA 1ICWA 2B2UA 4P6VF 3K5MA 2J42A 3MXPA 3NS1A 4Z9CB 1Y56A 1U4MA 3NXWA 4KGSA 4Y7NB 2K5WA 2XVSA 1V1PA 4KJNA 4GLSC 2O4XA 1C4PA 2JEBI 4BBRB 1ROEA 2B2UC 2SEBD 2V3PA 2CW0C 2RDFA 2PVOD 2KMMA 4EQOA 2D5GA 2WXGA 2IGGA 2JXTA 4QB4A 2W55A 2INNE 1KABA 4HCSA 1LV9A 2O2LD 2WV6D 2YU9B 2JEAI 2RSNA 3AMZA 1EYAA 3MTSA 1F9QA 4ABNA 3AEDB 1JB3A 4KTAA 2WXLA 1J7CA 3T4AC 3H0GB 3MEHA 1AP0A 1D6EC 2DYOA 2Z8LA 5BN5A 3BDCA 3AH7A 3TN2A 3OMGA 3D6WA 5LL6S 3RPFC 2OT2A 4J3OD 5FO7B 5IT9L 2D2CC 4ME5A 2VUMB 1K51A 1RKNA 1SSOA 2ENBA 1G291 3K0YA 1SMYD 5FOBB 3OSOA 5KYIA 4KD3A 1SB3C 4WFN3 1EEID 1B44D 3W5UB 1PTOF 1P7FA 3Q23A 1STAA 3FAHA 2IX3A 2BE5C 3P20A 5KNBA 4BA1I 3ABVB 1FNWA 4JX1C 3JAML 2IL8A 5KGUA 3DUZA 3QOJA 1XWEA 3MP9A 4WORA 4C1NK 1K8OA 4WJWA 5BN3A 4XQQA 1HTLD 1FRRA 2QIEB 1KDAA 1LTSD 3NVZA 2PNRC 1C79A 3MJ5A 4JWSC 2R6GA 3HUIA 1G91A 2WKDA 2EYOA 4A3JB 4F7XA 4YWGG 1GUSA 3TEXA 1VRAB 1WVLA 4RKBA 2BB5A 1F0ZA 1EFID 1OXXK 2DNEA 1MSGA 3DEPA 5HG2A 1C9FA 1EY7A 2R93B 2IW3A 1OFFA 1SE2A 1UAPA 3T51B 3R2IA 2LFNA 1MI2A 2ON8A 3K5NA 3AV8A 1NUCA 4X3KA 3GTLB 1ENCA 1B9MA 1CTMA 4CKEA 1RDPD 2JE6I 2JQRB 1SNQA 5AUKA 1EWYC 3BVMA 3FPUB 5C4JB 2JSVX 4YSXB 3L7ZC 4XWTA 4A3KB 3P63A 1LTBD 4A55A 2ONQA 1I4RA 2E76C 2M9VA 5JEAH 3J9CA 4MT5A 1FNVA 2JZPA 5C6AA 4K5VA 5IGFA 4L23A 1EZ8A 1GUOA 1ZKOA 3D4DA 3M7GA 2HUGA 1A15A 1NSNS 2B8FA 5FR3A 1SNPA 1L5PA 2XIWA 1QOFA 1B9RA 1J9OA 1LTAD 4XWWA 1K52A 2QSDA 4H7BA 2JA5B 5J22A 1OXVA 3DEOA 5M5YB 4A3MB 2K32A 4FVMA 4NZLB 4GDLB 5A2QE 1C4QA 3BWUD 5CV6A 4H0LC 3DM1A 4L63B 1VF5C 2R3ZA 1UNSA 1CZWA 4K6DA 5D65A 4P2CB 4DAVA 1PZID 2ICIA 5CORA 1TS4A 4TRDA 1ZYRD 5EKLA 4CKBA 1BNZA 4ZYSA 1FD6A 2NN6H 2CQAA 2KECA 5CR3A 1H9RA 3CRLC 2NMQA 3S2DB 5CV4A 3OW7A 4S3SA 2RMMA 3VR5A 1Q1EA 3IAYA 3ZJVA 3SEBA 2PZWA 2CU3A 1MHHE 1EYCA 4G7OC 3L3OC 3AEAB 2B2TA 1LT4D 1SMYC 4KHVA 4L6TB 3V2TA 2LGIA 4YIJA 4U68A 2JXMB 3PUWA 3DWQA 2JA7B 2OHFA 1OXTA 3VYTA 5K5PA 3IFTA 1DJRD 3GTJB 3J7YW 1YN3A 4HMIA 2M2LA 1ZDXA 3NUHB 4HN7A 1B4OA 3V96A 5EE9A 3HZXA 2EY2A 5JEAJ 2V4IB 4TMAB 2F0DA 3I73A 2MGSA 1F2RC 3P4SB 4IUVA 3LB8C 1XLPA 3SK4A 4R3DA 1PGXA 3I90A 5NUCA 4C3HB 3C8YA 3Q8BA 1EL0A 3I8ZA 2KEDA 2JU6X 1HCZA 2A68C 4C3JG 5M3MB 3Q24A 2NVQB 4FYDA 3OIPA 3M3YB 1JOQA 4NP5A 2PO4A 1BR9A 5C3XA 2MJDA 2CJNA 4A8XC 4R8NA 1ILQA 4B0EA 4DFAA 1D2BA 2B76B 1GHJA 2XNAC 3QOLA 2EJMA 4F8MA 5JEAG 1RD9D 3HOWB 4MN3A 4FNFA 4OVZA 2QJLA 3MC0B 1B9NA 4ZLTF 3H8HA 3FILB 4OIJA 1SIJA 4OO1H 2ICEC 2NZ1D 1AZPA 2YEPF 4OZBA 1WD1A 1VZ7A 1TS3A 4C3IG 3T53B 3S9WA 2K7VA 5EKKA 2B2WA 3TEWA 5EE0A 2J52A 3AE8B 1YNNC 3EA6A 1V8CA 3T3NA 1ZP0B 3GP7A 3KF8A 4YTNB 3D4WA 3KLSX 4M0WA 3QB3A 2RVLA 3NVVA 3QO2A 2AUKA 5E4XA 1D5MC 3RLFA 3Q0AA 1GB1A 1CT1D 3R8BA 1F2YA 1SBBB 2MP1A 5EE3A 1NYQA 1ZE3D 4C7YA 1SJHD 4EQNA 3LXFA 2Y0SB 3TEYA 3OPOA 4KKUA 2WACA 1ET9A 1OXSC 4TQUS 3HVDA 2WXOA 2XSCA 1V8QA 3T13A 5DNFA 4DK0A 1PGBA 1TKGA 1MPEA 3AECB 2W82A 3R93A 2SAKA 1NEKB 1EIGA 4XDCA 5C5LA 4NMZA 1SE4A 2I46A 2F0LA 2K5QA 5I9OA 4X3UA 1CJEA 3RFZB 3EQLC 1PTOH 2DBYA 1YNJC 1YNTE 4K8IA 1C4CA 3I4LA 1FMAD 1FEHA 3KBGA 3S1RB 3HKZB 1NAPA 3NSWA 4JBWA 3ZGZA 3PZ8A 3CKIB 3NVWA 4YSYB 1MBYA 1QNKA 3MHBA 4X3SA 3U9OA 2QF7A 2BTEA 1PRTC 1BXTA 5JVG3 2E2JB 1HUMA 2NVXB 1H9SB 1TKWB 2WKCA 4TQ0A 5KYLA 4KX6B 1I4HA 4O1NA 3TBIB 4XT3B 1Q12A 3HOZB 2W3SA 1H9MA 2F0OA 3P1HA 3H94A 2HCCA 3OHXC 3VYRA 4WIPA 1WYGA 1JRPA 4XQNA 3SFEB 2Q8IB 3QG1A 1IKLA 3P1MA 3AE7B 4A6QA 1BDOA 1PTOB 3N6RA 4IFDH 1EY0A 1PZJD 4M8AA 3RZDB 3VQIA 3VR9B 3WCQA 3J81E 5FLXL 4KKJA 3BG3A 2B63B 1SYCA 1M8AA 2JYOA 2K28A 4JPSA 1JICA 1U9RA 1K50A 3BVGA 3U9SA 1BMLC 3D6CA 3I70A 4RGMA 5BMIA 3SDZA 4J6HA 5C4XB 2NN6I 3GTKB 3BIID 2XRSD 3P42A 2NVTB 5KRUA 1T3QA 1VDVA 3N9YC 3DMUA 2AQ2B 1D5ZC 2V3NA 2ZXPA 1RJTA 3D4RA 5JXVA 4CQNA 4QCLA 5JAVA 1JWAD 3K5OA 4HMJA 3K5LA 2V0GA 4ZHOA 2ZW0A 1RODA 1C78A 2WP9B 2F0WA 3SHLA 1GJXA 1CM9A 3C1EA 3E56A 3ZQ4A 1TT2A 1Y8NB 5I2XA 4AQ7A 5T1GA 3NQIA 2F1MA 2EJFC 4NKLA 1KFYB 4N9PA 3J7AV 3P4QB 2LUMA 1NCVA 5KEEA 2KQ3A 1EY9A 3IT6B 5J39A 1S5DD 1GPXA 2AQ3B 2H89B 1F77A 5ELCA 2B2VA 1Z47A 1X3QA 1C48A 2FFKB 5A35A 2RDHA 1N5WA 4JE3B 2L4NA 2PW9A 2LHEA 1SEBD 1QQRA 1LTID 3A8JE 4FF1A 2LKVA 3BZDB 3U4EG 1IYVA 1TWAB 2WXQA 1BOSA 1JWUD 2EVBA 5EE1A 2F3VA 4IFDG 3E9SA 4K14A 2EELA 2EJGC 1VCIA 3X3MA 1O7ZA 1Q3LA 3ERQA 2LFIA 1JCKB 3J81L 1W6KA 2WXJA 1ZEQX 2RBMA 2AUJD 5CBAE 4HEDA 2K3UA 1BUVT 3KBXA 2GRIA 1S5ED 2WXMA 3MAQA 4L1BA 1YMHE 2M00A 1WSPA 3AE6B 1FYCA 2RKSA 2WXRA 1IL8A 1YNJD 4LTUA 4CKCA 2MJ3A 5DEHA 4LJZC 4FO2A 2AWNA 3D3RA 2IWHA 1WCMB 4K5WA 4NDXA 1DXMA 4TSSA 2J0TD 2CJOA 3SFDB 1O7LA 3GV3A 1JWSD 1FCCC 1T5XD 5FO8B 5C3EB 1JOOA 4KGRA 2PKOA 2GI9A 1S4ZA 3TSSA 4DGZA 3P4PB 2BW2A 3BDLA 1UWMA 2JA8B 2D5DA 1DOLA 1JR0D 3QJYA 4OO1I 1QB5D 1UUPA 3RD4A 1SJED 2EY6A 2WU5B 1DOKA 2F0TA 2J4XA 1VJKA 4KY7A 3CRKC 3BS1A 1XCQL 2KUMA 5EBCA 3IFDA 5FO9B 2IGHA 3H6MA 2VZKB 2B2YC 1SYBA 5C0XI 3S14B 3VRBB 1TWFB 5C44B 3MXGA 3RUZA 1STGA 1KF6B 2HDMA 3FDTA 1QOGA 2NUCA 4FXKC 1AWDA 3FKIB 4A93B 4WH4A 3GO5A 3FPPA 5HURA 5BN4A 4ILWA 1QWYA 5M5WB 5EGTA 3V3XA 4K5XA 2PCFB 1AW7A 4R9WA 4WWMA 3LNNA 1UWXA 2RPVA 3PUVA 1RTNA 4KMUC 1DGJA 4DU9A 1LTGD 3AEGB 2QEJC 3HOVB 3ND8A 5BYRA 4KKSA 1D5XC 1MGSA 5M9OA 2DWQA 4XTCS 2SOBA 1AZQA 3T3OA 2B2YA 4US9A 4A3BB 4G7HC 4LMQD 3EUB2 4A3GB 1RCVD 3CWIA 5CV5A 2QILA 4CBVA 2DYMA 4ZUIA 4AYBB 5I4DA 3VR6A 3GD7A 3MFYA 3EROA 3NP8A 2YYZA 5C0XJ 3NWTA 2LJIA 4C1NI 4GZYC 4DXGA 5I6WA 1P7EA 4HRSA 1FR3A 1ILPA 3HVZA 4FXCA 5LL6X 1N60A 3SK6A 4PMCA 3PIP3 2FMMA 1TQOA 3NWSA 3OMCA 2L32A 2EY5A 2EYJA 1MVKA 1J7BA 3DXJC 3C3LA 2X6LA 3W2DA 3TP8A 2K5PA 4XYOA 1BCPC 2TSSA 1EY4A 3Q22A 1FGBD 1NR2A 2R92B 3A7AB 2A74C 3EVQA 4MACA 4CJ1B 1S5CD 4RNAA 1S5FD 3SVMA 1W6JA 1QOAA 3AE2B 3GS2A 4N59A 2K22A 1JQYD 1PGAA 4B9XA 1HTPA 1MSHA 2EDGA 1SXTA 3S1QB 2BS2B 2B39A 2PPBC 1V1OA 1I7HA 1XLQA 4ZOHC 2Z4HA 1ESRA 1VMPA 2F0QA 5CV9A 4C3JB 4IUQA 1TYGB 1HZ5A 3A54A 1SFOB 3NBHA 3KWVA 3M4YA 1QG7A 4FXGC 2GA4B 4DF7A 1WWTA 5EKIA 4IKGA 1A2UA 1QF6A 3AEFB 2ZT9C 5C4HA 3KWLA 2MJ8A 4USAA 1STEA 2YEPB 1EU4A 4YTPB 2WAQB 2NBFA 1NVID 3ND9A 4BY1B 3ZYYX 1L0VB 2WB1B 5HI1A 2MJEA 5E4WC 1E2ZA 1E6EB 1STYA 4OL7A 1Z6HA 2WXIA 4DA2A 4HJGE 4IQZA 5ELDA 1T6BX 4KY5A 1WTWA 1DOXA 1E7PB 1E2VA 4RA8A 2NN6G 4LLGM 2NB0A 4OGQC 4NAWB 4BWGB 5JVH3 1N5XA 2JSOA 2X69A 4XYQA 3PMFA 1BCPF 4LK0M 4FF3A 3AN1A 2K1BA 3TP7A 1L0XB 3SXHA 3I91A 2N9KA 2E6XA 5FKAC 4ZRZA 4ZRQA 3Q8EA 5BMGA 1DOYA 5DM73 2BS4B 1GUWA 1PRTF 2B2TC 3TP5A 2F0JA 2ZXRA 1KLGD 2A6HD 4OW0A 3H91A 2WDRB 2BYTA 1A2TA 4I65A 2BOSA 2D62A 5CMDA 3J7AF 1ONLA 1VDZA 3BVZA 2MHVA 3TDQA 1YN4A 4RF1A 3FEWX 1JROA 1Y69U 4QMGA 2O5IC 1B3AA 3M7NA 2F3WA 1PTOC 3GTPB 2D9UA 1ENFA 1KTKA 3GTMB 4KI0A 3U7ZA 3NQTA 2PIAA 4RCNA 4FF4A 1HQMC 1FXAA 1WRIA 4JWUC 3HGBA 2WDVB 3I57A 3Q8CA 2WDQB 4RH6A 3MVVA 4YTMB 2A73B 3LX0A 3WOFA 1ET6A 1IW7C 3RMHA 2ACZB 5D14A 1QJOA 1VLBA 2FBWB 3MFGA 4PNYA 4RF0A 1BUIC 3NBIA 2F0VA 1SAPA 4XQJA 2L1AA 2WXFA 2F0KA 1Z7TA 2J53A 1HUNA 1EIHA 1KLUD 3AE3B 2FINB 2L0CA 1PYWD 2WP8J 4XDDA 1IW7D 1RM6C 2WS3B 5EBDA 2WLBA 2A6HC 4NW2A 2N0SB 2HTME 2VB3X 2EYLA 2WINB 1I50B 2OEDA 2Y3AA 5T8IA 2SNMA 5BMHA 5HFYA 1CHPD 1PFNA 1J7AA 2J7ZA 2F0EA 4KJOA 2BCOA 1SSNA 1QLBB 4PMWA 2KHSA 4IUNA 2E2DC 1TJEA 4HR7B 1JWMD 5IGBA 1HFNA 2L5TA 4OO1G 1EZ6A 4C3IB 4XIGS 4KHZA 4LAAA 1JW9D 2A68D 1EQVA 3L4PA 1SE3A 1R9TB 4B0MA 1VR9A 2F0GA 2IPKD 4OIKA 1SYGA 3VRAB 2I38A 3B2GA 4G4KA 2WXHA 2LY7A 3FC4A 4DNRB 4HKQA 1CK1A 5EJWA 3MA2B 1OXUA 1U4RA 4RAUC 3E5SA 5C0XH 2VZKD 2K05A 3E0JA 1N62A 2EYFA 2WXNA 4MM3B 1EOTA 3HS0C 4U673 2DY8A 1TU2B 2EXZA 1IGDA 4IOIE 4IFDJ 3IAS1 1VF7A 1ENAA 2RQXA 1RYJA 3RZOB 4KY6A 2W54A 2F0MA 1EEFD 2R7ZB 5G5GA 1PDXA 2NWGA 5T1IA 4A3IB 3Q6SA 1B53A 2PLPA 2EPBA 2E75C 1EWCA 4WAFA 1BQQT 1XX8A 1YNND 4IUUA 2F0UA 5IGCA 5EPKA 3PUXA 1QNUA 4ZK9B 5CV8A 5I2YA 2L83A 2DN8A 4MIUA 1KDCA 5MPOA 1EWHA 1QE6A 4WQMA 1Y8OB 2A69D 2EE1A 4UDUC 4DXFA 3HEJA 3CHBD 1YQ4B 1SNMA 3TMEA 1F2MA 1FD7D 4R8IA 1G8ZD 3OWFA 2Z1CA 1HA6A 3NPPA 1I6HB 3JAME 1VMCA 4K2LA 2F0SA 2TMPA 1FM0D 3IXSA 3TEZA 1XXGA 4A9AA 1Q8IA 1KH0A 2NVYB 2E74C 1C4AA 4DQOC 2PW5A 4E6IA 2R61A 1CZGA 4YT0B 5G5HA 4JK1C 2EYHA 1FIQA 1O80A 2I2YA 2L9HA 1RHPA 3WOEA 3S1NB 4OZAA 4ZKCB 1RWSA 5CYUA 3PO3B 4PV1C 3H09A 3DWAA 4RHRA 3GQBA 1TR5A 3AU7A 2IDYA 1LT3D 5I9PA 1SNCA 4HEA1 4K8JA 1L4ZB 2NTSA 1Y1VB 1CQFA 3DWPA 4XT1B 1PRTD 3I9V1 3AB5A 1F9PA 2VB2X 3VR8B 3I4NB 3J80E 5HHDG 2F4IA 5J1ZA 3Q8FA 3PO0A 2KAJA 1CFMA 3NZ3A 2BE5D 1A70A 2N88A 1STNA 2KQ4X 2N7JA 4P16A 2EKIA 3Q69A 2JP1A 2EOTA 4YXDB 5C5MA 5JPMC 1TS5A 2C9OA 4QF4A 3S17B 2FHTA 4Q0FA 4OZCA 2H88B 4US8A 1PTOD 2FJ2A 5C4ZA 3O13A 4QUCA 2EZVA 1N61A 2L1BA 2O5JC 1WTXA 3GTGB 2H4OA 4G57A 5DAUA 1NR4A 1IHZA 3GTQB 5IIFA 3SK8A 4MH8A 4IUTA 2BA0A 1Q10A 1TWHB 4B08A 2PVGC 1Q1BA 4EGVA 2MUYA 2XRQD 4ZKBB 4FXDA 5I6YA 4ODGA 5COYA 1JWBD 2K5DA 4NAMA 1PZKD 4KV6A 2JA6B 4XDXA 3SE0A 5JOBA 2B8GA 1RFKA 2DY7A 3LWEA 3S2HB 1QT9A 2A5HA 1V1PB 5CBEE 4A3FB 1Y8PB 3AB9A 3W9CB 1IBXB 2F0IA 2K04A 1D4BA 5AFWA 4ZQ3A 3HP3A 1TIID 1ZUD2 2K6AA 3S16B 1MHXA 1LLRD 2Y5CA 3VR4A 3BYYB 2Q8TA 5CV7A 4V0BA