1XXGA

Crystal structure of staphylococcal enterotoxin g
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
233
structure length
227
Chain Sequence
QPDPKLDELNKVSDYKSNKGTMGNVMNLYMSPPVEGRGVINSRQFLSHDLIFPIEYKSYNEVKTELENTELANNYKGKKVDIFGVPYFYTCIIPKSEPFGGCCMYGGLTFNSSENRDKLITVQVTIDNRQSLGFTITTNKNMVTIQELDYKARHWLTKEKKLYEFDGSAFESGYIKFTEKNNTSFWFDLFPKKELVPFVPYKFLNIYGDNKVVDSKSIKMEVFLNTH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Crystal Structure of Staphylococcal Enterotoxin G and binding affinity to T-cell receptor and MHC class II molecule
rcsb
source organism Staphylococcus aureus
molecule tags Immune system
molecule keywords enterotoxin
total genus 61
structure length 227
sequence length 233
ec nomenclature
pdb deposition date 2004-11-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01123 Stap_Strp_toxin Staphylococcal/Streptococcal toxin, OB-fold domain
A PF02876 Stap_Strp_tox_C Staphylococcal/Streptococcal toxin, beta-grasp domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.110 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1xxgA02
3.10.20.120 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1xxgA01
3O13A 1FNVA 3BVZA 4ZYSA 1SJHD 1D6EC 1STEA 1LTGD 1HA5A 1D5MC 1RCVD 1FGBD 1L0YB 2IPKD 1SE2A 1JWMD 3TSSA 5D3DA 1PZID 4RH6A 1L0XB 1S5DD 1FNWA 1S5BD 1V1OA 4DXFA 1BCPB 1PRTC 1HTLD 3SEBA 1T5XD 1CK1A 1RF2D 2RDGA 1LTBD 5ELFA 1TS4A 1S5ED 3CHBD 5ELDA 4RCOA 1PTOD 4L6TB 2QILA 1PTOB 1TS2A 1BCPD 1DYQA 1ET6A 1SXTA 3BYTB 1AN8A 1HXYD 4RGOS 5ELCA 2XRQD 1CHPD 2NTTA 3W2DA 1S5FD 5FK9C 1YN3A 1V1PB 3KLSX 1PZJD 2XN9C 4C56C 1LO5D 1SEBD 5D3IB 1AW7A 4OHJA 1JQYD 2WV6D 3URYA 1KLUD 1LLRD 4O1NA 1I4XA 1LTAD 1TY2A 2ICIA 4RHRA 4Z9CB 1MD2D 1V1PA 1HQRD 2AQ1B 3V05A 1B44D 1PTOF 1BXTA 1SJED 3R8BA 3MC0B 1EEID 3MFGA 5ELEA 3BYYB 2AQ3B 2XNAC 4K6LA 1LT5D 1JCKB 1SBBB 1S5CD 3EA6A 4RHSA 1JR0D 1LTID 1QILA 2TSSA 2J4XA 1ENFA 1I4RA 2SEBD 3BVMA 1YN5A 1LTSD 1I4PA 1DJRD 1F77A 1KLGD 1LT3D 3BVGA 5FKAC 2QEJC 1JWUD 1XXGA 4RFBA 2NTSA 3DWPA 1I4HA 1BCPC 1PRTD 1FNUA 2AQ2B 1TY0A 1PTOH 1PRTB 1LT6D 3DWAA 3DWQA 1SE3A 4RGMA 1YN4A 2IJ0A 1GOZA 1SE4A 1PZKD 1CQVA 1B1ZA 4RGNA 1PTOC 1XTCD 1FD7D 1RD9D 2O2LD 4TSSA 2XRSD 3EFXD 1TS5A 1LT4D 1I4QA 3GP7A 1I4GA 2R61A 1EU4A 4RGTA 3OWEB 1G8ZD 1ET9A 1PRTF 1PYWD 3BZDB 4DXGA 1UNSA 1RDPD 3R2TA 4UDUC 5ELBA 1LTRD 1CHQD 2G9HD 1EFID 1M4VA 4L63B 1KTKA 5I4DA 1ESFA 2Z8LA 5TSSA 1D5ZC 1EU3A 4NZLB 1TS3A 1LTTD 2CHBD 4BWGB 1BCPF 1CT1D 1UUPA 1D5XC 1EEFD 1EWCA 1JWSD 3R2IA 2RDHA
chains in the Genus database with same CATH superfamily
4IALA 5C3EH 2EMSA 1E1TA 1FNVA 4YL8A 1SNPA 1K73C 1S4ZA 3HOWB 3MA2B 2MBQA 2JA8G 1CJEA 4NQKE 1HA5A 1PLFA 2KFKB 4LF4Q 2DZJA 1QVCA 2L4NA 4C2MH 2VQEQ 1STBA 1C79A 4A3DB 1VCIA 1BBXC 4L2YA 1AEXA 4DAYA 2BKRB 2QHOA 2R7DA 4DR2Q 2Z59B 2ZEQA 2JYTA 2OXPA 4REZA 4A90A 2ZZPB 1RTOA 4DR3L 5IT9E 2CR5A 2N9KA 2EKEC 4KJNA 3CCSA 1AZPA 3S1NB 4NNJB 3M4OH 3DWGC 3ZNHB 4GN4B 2LSSA 3I8ZA 3X0WA 4IPDA 1GUOA 4LJOB 4MACA 2IHFA 5ELDA 4FXGC 4DK0A 5GXGB 4KIKB 3GDEA 1DYQA 2KVZA 3NRZA 4JBWA 1VZ7A 4IJHA 4R4IA 1T0SC 5CV8A 3I4OA 3DXJC 1PZJD 4WIPA 3RR5A 3PIP3 4B0EA 3MC9A 4IWOA 2L76A 2YU9B 5C3XA 4OHJA 3UQBA 1EY4A 3WOEA 2ZM6L 1I6HH 1E1OA 2F0QA 3B08A 4FF1A 1F2MA 3G6EA 4IUTA 1GHKA 1TBEA 1V5TA 1KNEA 4Z9CB 3H1UA 3H9DA 3GTMH 2V3NA 2ZM6Q 1XLQA 5FJ8H 1BXTA 1EYGA 1WCMG 3BZKA 4WFN3 4ZRPA 4YSYB 3U4EG 1RODA 2RPVA 2SNMA 1EIYB 4HIMA 5CHVC 1N36L 1U0LA 3HK0A 3STBC 1N62A 4II2B 2N49A 2XWJB 3MHBA 4OL7A 1L0VB 1UBIA 3HOVB 3A9KA 3B9JA 4B95A 1VDZA 1YNJC 5C1ZA 2N4FA 5GAHC 3DBRB 3S2AA 4EFOA 1PFSA 4NAWB 2O6VB 1S40A 4K3BA 2WX1A 4EX5A 3F1ZA 3IT6B 2DYMA 3KVFB 1ML0D 5GQOA 2IY5B 1UWVA 3IFDA 5M3MG 2INNE 2RHQB 2JYEA 2M8SA 4MH8A 3AMZA 2WXMA 3GTKB 2UXBL 1TWAH 2JA5H 5IYBH 1JMLA 2B2VA 2I46A 1B8AA 2I0QA 1G6PA 3HVDA 3DEPA 4JV5Q 1M1KC 5EPJA 4OWXB 1RD9D 2O2LD 2K6QA 3EFXD 3ERQA 5JAVA 5L95C 1SYCA 2QGQA 2MBBB 4JI5L 4KD4A 1D2BA 3PHXB 4KY5A 2GBJA 3L08A 2VUMG 4GOPB 2Z6KA 2LVPA 1ET9A 4US8A 1VQIA 2F0LA 2E2HH 4B3RL 2HD3A 1H8CA 2XWBB 1OEYA 1M90C 3H7SA 1ZPSA 3MZ5A 3SVMA 4G50A 4KLKA 2L05A 2PIAA 4A9AA 3AE7B 3DWMA 1GUWA 5IT9c 2X8XX 4OELB 4HIKA 2JWUA 1JE5A 3E3XA 2RVLA 4CJ0B 2KQ7A 5H1SE 3BK1A 1Q7YC 5FOBB 4TMAB 4ANVA 1HNZL 4LFCL 1N36Q 2PCFB 2CQOA 3TMPB 3HEJA 3CW2C 3GTLB 1LM8B 2KAJA 1W3SA 3KUCB 3TIXA 1NMFA 1V2YA 2EXZA 4IPHA 4FLHA 1JWMD 1WI5A 2QCZA 4BXXH 2F0KA 3J9CA 1G291 3GTQB 2WS3B 5JVH3 2GA4B 3SK8A 2LRUA 2KTRB 3VR5A 4AQ7A 2R7ZH 4FJZA 4AS1A 5HI1A 3T16A 1G51A 2K3UA 2O6VD 5J17A 2L8JA 4MGIE 2D5GA 1WD0A 3E5SA 1HZBA 2F0WA 4A3GB 3K0YA 1TS2A 5CX3A 1V9JA 1SXTA 2BT6A 2LFNA 4GLXA 3A1QB 3JSVA 4YWGG 4HEDA 4QQBX 4LFAQ 5BYQA 3I56A 4DR4L 4NDXA 1FO4A 3PO2B 1LO5D 4PZ8A 1P7EA 4JK1C 5D3IB 1TKEA 1G6ZA 3ULJA 5E4WC 2NBUA 3A74A 4BY1B 2O2VA 2ZJDA 1T5EA 2E74C 5EE1A 1X3GA 1T0QC 2D2QA 3QWNA 2JA8B 3P4QB 3QC8B 2K7VA 4W9DA 4IOIE 1GM5A 2J52A 4WWMA 2OQKA 5FO9B 2F1MA 4NAWA 2K8BA 5C5LA 2E2DC 3SFDB 1WJJA 1A63A 1AARA 2BA0A 2PNHA 4W9LA 2AQ3B 3A0JA 4EQPA 1SYGA 2E6XA 4CDDC 4DV4L 2CKHB 2YTVA 1VQ8A 1S3SG 1SAPA 5L37A 1RL2A 4ABNA 1II3A 2KWUB 3CWIA 2JPHA 5F2DA 5FKAC 2UXDL 4HCEA 2PO4A 1WMHA 3AEGB 2FJ2A 2C7HA 4WWPA 4BAXA 1QOHA 2AQ2B 1R4QB 4AQYQ 3WAPA 2UXDQ 4IOAA 4ZUIA 2D3CA 3WANA 4BKTA 2KT7A 3I72A 1QZGA 1AYFA 1RJTA 2FNJB 3D6WA 3U9SA 2KOXA 3C8YA 3QIAA 4H13C 2IO1B 4HCSA 2PZTA 2JF5A 1UWMA 3BIID 1HTQA 2AL6A 2MO0A 5M9OA 1V9PA 5C6AA 1N8RC 4JL9A 1YHQA 2E5LL 3ZYYX 3ULLA 3BINA 2ZVNA 3QARA 1CI3M 1DCZA 2KTRA 4OWWB 3K57A 2IGHA 1J7BA 4KVGB 3WCQA 1EQTA 2SNSA 3DEOA 4A4IA 2RD0A 1ENCA 2B39A 2FIDA 3RT3B 4DUZQ 3H3VH 1EU4A 3B2GA 4DFAA 3MP9A 4Y7NB 5IGBA 4MTNA 1RWSA 1SGHA 5EKLA 4HJKA 2VRRB 1YQ4B 3D3RA 4MELA 2N78A 1DGSA 1KABA 5IWAQ 2DNFA 3OPOA 3CRLC 1Z6HA 5EQ0A 2V4IB 5C0XG 1YJ9A 1I94L 1IW7D 1Q46A 4ZKCB 2EJFC 1PH8A 4OO1H 4LNFA 3OWFA 3GTOH 3W1YA 2FCSA 2RDHA 1FJGQ 2PKOA 1IL8A 2RCNA 3LGJA 1HZ6A 2MJEA 1IYFA 1IPGA 1PFNA 1B50A 2PEAA 3R93A 4XX5A 5JEAH 4YXDB 4JW0A 1VQFA 4LFBQ 3HOXB 3PRZA 4JI2Q 2DX5B 3O65B 3ZIMA 1C4CA 1L0YB 2EIFA 3PIPA 4A93G 3U58A 4JG2A 1NDDA 2EYMA 2J42A 3A4RA 2K33A 4GDLB 2B29A 1BUIC 2JX5A 4KGSA 2WAQG 4B3RQ 2IGDA 2CU3A 3I4NG 1CFMA 4JX1C 2IDYA 1MSHA 1A3VA 1EZ6A 1NR4A 2WB1E 2JA7G 2FCQA 2C9OA 4M00A 4X57B 1SYDA 4JBKA 3KJPA 2WFWA 4P1BC 2KLGA 4JE3B 3EROA 4BZAA 3BJUA 2MEKA 5EBCA 3OG5A 2BTEA 2E2HB 1QZEA 3A8JE 4LNIA 1XNRQ 1KLVA 2INCC 2Q2IA 3Q69A 4U673 1EY6A 5C44B 2GBKA 4JLCA 1SEBD 5JJKA 3EFUA 1YZ6A 3RUZA 1YX5B 3FAHA 3V6CB 5IODA 1EL0A 4AJWA 5C4XH 4LF6L 1G2TA 3K58A 1JC7A 5E6PA 4UPAA 2EELA 1DOKA 5FLXL 1QKZA 4P71A 4WAAA 4XZ4A 5IE8A 2L15A 2ZJRA 4A3EG 2FXQA 3TQYA 1N33Q 4YWLA 2QMTA 3T3NA 4PT5A 1TKYA 2RCFA 1CTMA 3DM3A 4G0NB 4KKUA 2OJRA 5AUIA 1WCMB 1EOTA 2F4VL 3IL8A 4G7ZC 1U4MA 4HCPB 4DUZL 4KX6B 1NMGA 2ZT9C 2NN6H 3CSTA 5IT9L 1XYIA 2LGXA 2J4XA 5EPKA 1WGHA 1D1IA 2WNMA 4CJ1B 1E9MA 4RKBA 3KF6A 4KHZA 2IGGA 1SF0A 3V62A 2LD9A 1XLNA 3DWPA 2Z9HA 3KLWA 1Y8PB 4B3ML 5J18A 3KBGA 2LWPA 4ICUA 5AZHA 2QKIC 2D9UA 4A20A 1Q81C 4BOSC 3EN2A 1RYJA 4XYOA 3ETRA 3NTHA 3J81E 1WXSA 3JYUA 5AJ3L 4NAMA 4OVZA 2NS5A 4ZRKA 3RN9C 1EO6A 1PFDA 4A3KH 1UWXA 3ZW3A 2WXHA 2L1BA 1ZE3D 4K3CA 3N1ZC 4PS3A 3A9JA 4OONA 1D1KA 2M17A 5K36H 2HD5B 1CZGA 5C4XB 3H7PA 2CVRA 2ZXPA 4G57A 4KZ0A 5C4JB 1F1HA 4MJSB 4DN4M 4BBRG 1XNQL 1K3BC 1TS5A 2F4IA 3K7AH 4P72A 4RWSC 1I7HA 2BS3B 2L7RA 1I4QA 3KWLA 1BNZA 4YT0B 2L0FA 4RGTA 3L0OA 4GKJL 2F0SA 4JI6L 1EOVA 1C4PA 4DGZA 4N6EB 1IBXA 1QUQB 2JEBI 4KDLB 4DV2Q 4W9JA 4YSZB 2A6EC 4FF3A 3J7AF 5CBEE 2CW0C 4JGHB 5M3FB 1ESFA 2Z8LA 3UGBB 1PH4A 4X3UA 1NE3A 4DV2L 3CU7A 4GOPC 3NS1A 2F3IA 2Z0EB 2I5LX 4BKSA 4X62L 4LAAA 4JQWC 4XQQA 3SGIA 4YWKA 4EE2A 1M94A 3KWVA 3U30A 2F03A 1OQRA 2CJNA 2R93B 1E7VA 3OJ4B 3AULA 1EIGA 1SMYD 1LTGD 4JI8L 1LABA 4NJCA 3JVZX 1PGAA 1VQDA 1E8YA 5CV9A 2D3GA 5FO7B 2IPKD 2CU1A 3SR6A 3H09A 3TP6A 1K8GA 1JORA 1S1QB 5BMHA 1VF7A 5HFYA 4BKSD 5FJ8G 2WB1B 3I55A 4P16A 4DXFA 3M85A 1JQ4A 3CCEA 3FILB 1DOXA 3VDYA 1NI2A 1HNWQ 2IO0B 4QUCA 2KECA 4WURA 4URKA 2XK5B 4RCOA 4MEMA 2M19A 1HFGA 3VAWA 1EYCA 3QIJA 3Q14C 2R92G 2K14A 1TWAB 4N9PA 3KFUA 3JAMi 3P2BA 3I3CA 1X65A 4ZHOA 2J0TD 4X64L 1VQKA 2G45B 3F8TA 4G7HC 5ELOA 1ZW7A 4LF5Q 5E4XA 2MJ3A 5IGCA 3T3OA 2WU2B 5IYDH 1K8AC 2RHSB 1I35A 2CH4A 1N63A 1OXVA 4A3IH 1ZYRD 3NBHB 4RHRA 1V1PA 3T56B 3UDGA 3C46A 2EKIA 1HQRD 2QSDA 2KJHB 1FCLA 1HUNA 1Q10A 3AXCA 2Y5BB 1EUJA 4CBVA 4LJZC 4HTHA 1PGBA 2KC1A 2YTYA 4L5RC 3NG0A 3VR4A 1OTRB 4IUNA 3W3AA 1I3QH 3I91A 2EVBA 1XT9B 3TREA 4KDIC 3ZRCA 3AE6B 2KC2A 1LFDA 3D4WA 2QF7A 4JPBW 3RMKC 2N1WA 2A69C 5I9PA 1KLGD 4KHPL 2RR9A 4KHVA 4MN3A 2K0PA 4ODGA 4A8XC 2KX0A 2VQFL 1I4HA 3JAME 1MGSA 3I5JC 3U7DA 2R93G 3HIZA 3PLVA 5BO4B 1EIHA 1C77A 1MPEA 4DAMA 5KEEA 2KX3A 2EYOA 5GADC 2KMCA 3CPFA 2ZPNA 4JI1L 2A74C 2B3GA 3NSWA 4OX9L 2MA9B 3M4OB 3NUHB 3GTGH 4X3KA 2WAQB 2JY6A 4E74A 4C1NK 3J7AV 2KDIA 1R4MB 1I4GA 2R61A 1LTLA 2O4XA 2AUJD 3OWEB 3V3XA 3CC4A 1PYWD 1EWIA 1A5RA 1NSNS 4TQ1A 2B63G 4X66Q 1UNSA 4IKGA 1U4LA 3HRZC 1L1OC 4DR6L 3QOLA 1LTRD 2AWOA 1WSPA 3I4NB 4DU9A 2HCIA 3JSVB 1TWFB 1VMPA 1WTWA 3TS2A 4A3CH 1XTDA 1T0RC 1VZ6A 2W55A 2Y5PA 4X66L 3B0AA 1WR1A 1SNMA 1O7LA 5GMVA 4ZCKA 2IO2B 1ROEA 1HH2P 1RIPA 1FXAA 4W9IA 2DGYA 4K5VA 3CF5A 1HHVA 1FM0D 1K0SA 5IO9A 3P20A 4K7SA 2HE7A 2JZPA 2ZTEA 1GUSA 1Q8KA 4IW0A 5IP7G 1CKMA 3D31A 1EF1A 2K6AA 1AZQA 1XWEA 1I3QB 3ZDMC 4I7ZC 3U9OA 2LRWA 3Q8DA 5K5PA 2BDOA 4GNXC 1S5BD 2PMZB 2N0SB 3UF8A 1F9PA 4C3IH 4C4VB 1N61A 4AYBE 3P1HA 1C8CA 1GNUA 3P4PB 3GQBA 4OO1G 2ZW1A 2W54A 1XPOA 3J7A5 1ZDXA 2KMMA 2MP2A 2PE6B 1NYQA 2QDLA 3FPPA 3DBLB 3K7AB 2EYPA 3H8HA 3NZUA 4JBMA 3W5VB 4F1SA 1K52A 4NPSA 2OT2A 3OIQA 3QQ8B 4QUFA 2PJHA 2R92B 2FFKB 3ZJVA 2ZNVB 3Q22A 1UZXB 4M8NA 1AN8A 2DYBA 4BS9A 2KJXA 2XRQD 2NTTA 3W1BA 1WXQA 3MXUA 3IXSA 1L2NA 5KYLA 4C56C 3PV1A 4C3HG 3N30A 2VH1A 3N9YC 1TWFH 1AW7A 5GAGC 3ZJYC 2E2IB 3C0RB 2PI2A 3T1HL 4DHZE 4IFDG 5CR3A 3URYA 3Q0AA 1CZPA 3ZNGC 2GMIC 2WB1G 2AEHA 1BBWA 1HZ9A 3UE1A 4PZ7A 2HQLA 2EQSA 5LHY1 3G4SA 3AEBB 2L00B 3E6ZX 3MJWA 1SNQA 5C0XH 1L6VA 2A69D 3BY4B 1JB3A 3AEFB 2EE1A 1A3UA 4KGRA 3AE2B 2MGSA 4A3EB 2NVQH 2FAZA 4W9EA 4DV7L 1EY5A 3H3VI 1C4AA 1LTID 2W3SA 2TSSA 4US9A 3KLRA 3U4ZA 1YNJD 2KDBA 1LTSD 1I4PA 1M8AA 4F8CB 3QJZA 5I2XA 5E1FA 1X3FA 3VR2A 2K5VA 5FLXE 2UXBQ 5E6JA 2B2UC 2PLPA 5C4HA 5DPTA 3BZCA 3K9OB 1FNUA 4ZRZA 1JB7A 5D94A 3W1SC 2G4SA 2LMCB 3RLOA 5HY6A 1OO9B 2OWOA 2JP1A 1E2VA 3UQAA 5KHOA 3HOZB 1Y69U 2QJLA 1QF6A 2BE5D 1DOYA 2BPSA 3AMUA 1TVXA 1C76A 1SB3C 2CHWA 4IG7B 1HJPA 1HPCA 4BY1H 2RGFA 2BYTA 2M00A 1NTGA 4TSSA 2N9XA 3Q3OC 3NP8A 3WWVA 2K5WA 2IYDB 1BVSA 4GIVA 2KJ6A 4BKGA 4B9XA 2Z4IA 3PV0A 3NVVA 3K5NA 1E24A 1BOSA 5C4XG 4KHPQ 1GUNA 1WOCA 1KH0A 1MG8A 1CSQA 3WIMA 1P98A 1CHQD 3STBD 5J3BA 4HDOA 1JRPA 4XYQA 1WR6E 1QOGA 2MUYA 4XQJA 3J80E 3DLLA 4A3EH 4JOIA 1PA6A 4NZLB 3KF6B 4DV3Q 5JHAA 3CCLA 3PRPB 3SDLC 4Q2JA 2Z0DB 1CM9A 2CH4W 1JT8A 4EQNA 1BR9A 1Z47A 2UU9Q 2MLBA 4DV0L 2F0NA 1DOLA 4ZHPA 1N34Q 1VQPA 1W6JA 4GLVB 2HDMA 1RCVD 1FPYA 2SAKA 1YHAA 2ZJPA 3FILA 2PMZE 3AE9B 1FL0A 2IW3A 1UF0A 4OZBA 4F8MA 2LUEA 2FBWB 3TSSA 3D4RA 3L7ZC 4RH6A 4ALPA 4A3DG 5BYSA 2BDNA 4DNRB 3VYUA 1N9WA 1YHBA 2F0MA 1IL2A 3PVLA 4MJSA 5LXHA 1QOBA 4NPNA 3Q24A 4HJ9A 3SE0A 2RF4A 4RM9A 4E3CA 1F2RC 4JI7L 3AB5A 4NQLB 2EJMA 1NENB 4WJNA 2E5LQ 3CHBD 1OQQA 1Z2MA 2LUMA 3N32A 1MI0A 4AWJA 1QNKA 3CQZB 4NXNQ 4IDIA 4H2AA 2ON8A 1VCBA 4WJOA 1WJ6A 4FVMA 4XTCS 2WXFA 1MJEA 3GTPB 4LCDE 3AH7A 4NXNL 4B3TQ 1JQYD 1LYLA 3N6RA 4L5QA 3T1YQ 1VQ9A 3I57A 2KUMA 4LFBL 5HG2A 2QW7A 2JQOA 2P5ZX 2Y0SB 2GB1A 5I9OA 5DLQE 4K8JA 2YV5A 4OO1I 3ALBA 4P75A 1H9RA 5CTRC 1KDBA 3TZUA 3L3OC 2LHDA 1V81A 5CHWA 2JA6G 1VR9A 3KUDB 1FXTB 2B2TA 3R8BA 3ML8A 4LNOA 2HIXA 4K5XA 4P74A 4A3JG 4M0WB 4RG1A 1FGUA 1JCKB 1PMRA 1WFQA 1G91A 1PHJA 3RLNA 1VQLA 2BKFA 3VR9B 2A68C 2L5TA 1ENFA 5IYBG 1N34L 2KEEA 3E0EA 1E8WA 5C5MA 4G7OC 2UUAQ 1WIAA 4ZKBB 3MAQA 1D7QA 4MM3B 2BQQA 2ZTDA 3IAS1 1YVCA 4C7ZA 4DAVA 1PRTD 3GZNB 1LQBA 1AE2A 4A3FG 1MKHA 1HNXL 4TKNA 1KC8C 1Q12A 3KDFB 1WX7A 5IGEA 3Q8FA 4A3LH 4H44C 4F7XA 4HAEA 1WRDB 2KKCA 3Q8BA 1SROA 4TVAB 1XMOL 3Q8AA 2A5HA 3D6CA 1NVID 1UE7A 2AYOB 4II3B 1I6HB 3L13A 3L9AX 3NELA 2KEDA 4ME5A 1XF5L 5H8YE 4GGQA 1GVPA 1TJEA 2W82A 2JN4A 3GE3C 1KD1C 2IZVB 4XIGS 4ANUA 5CHFA 2WX0A 5BN5A 1MJDA 2EMTA 3EUB2 5C23A 1MBYA 2XK5A 3NEMA 2NVYH 3V96A 2BF8B 5C0XI 4TQUS 1HNWL 2M1MA 2JE6I 1TU2B 5JOBA 1GHJA 1IW7C 5HURA 2KDMA 1QOAA 2LXKA 1YNNC 2L0CA 2O2VB 1GD7A 4HPMB 1FIQA 1YI2A 2KDFB 2KQ4X 2XTIA 2BS2B 1EWYC 3DBSA 2WU5B 1O7ZA 3OSOA 4FHKA 4YSXB 1D5MC 3H0GH 5FLMH 3W1SA 2KXJA 4HDQA 1NUCA 4J1MA 4DV1Q 1TZOA 4I6NB 4DPGA 1SE2A 2JA5B 1UGJA 1S5DD 4A93B 4IZ8A 3VA7A 3HM3A 4OVVA 4A55A 4CQNA 3P63A 3HOYB 5DPSA 4DR5L 4EKUA 3GS2A 2DHZA 1TKWB 4FF2A 4CO7A 3K9PB 1E2ZA 3IKJA 4JI0L 3PHWB 3JAMc 5GAEC 1N32L 2L83A 2QILA 2EJGC 2KNBA 2N9PC 3NS8A 4L1BA 3DHQA 4HMJA 1X3EA 2BBCA 5LNK1 3ZGZA 3TEWA 1XMOQ 1F9SA 4ARIA 4KY7A 4R4TA 1S5FD 4XQNA 2UU7A 4O42A 2XN9C 3PT2B 1ZXHA 4YTPB 4K6DA 2H89B 3H6NA 4M0WA 3T9LA 1GC7A 2N88A 2UUBQ 3AECB 3WA0A 2ZNVC 1KLUD 1L1OB 4O1NA 3S1MB 3A9KB 2EY5A 2D2CC 4KN4C 4DK1A 1V6EA 3PO0A 3PZ7A 1R7SA 4A76A 2WXNA 3RNFC 4UAIA 1QJOA 1ICFB 5LMUL 4Y7NH 1YQBA 2B76B 1D8LA 3I7FA 4ILWA 2KANA 2M0XA 4AJYB 3S16H 2F0PA 2K4KA 1SSOA 5DPRA 2JT4B 2WXIA 3IFWB 3MXPA 1ZYRC 1E7PB 1SBBB 3WOFA 3AE1B 2IY0B 5DNFA 5D14A 4A3FB 5HKHA 1LUZA 5G5HA 1K8MA 1MIUA 3QO2A 5G3LD 1GJZA 4W9HA 5IWAL 3PMFA 1UH6A 4MH0E 4AIMA 2NTSA 2A19A 5CORA 2KVRA 3PS6A 4GXBA 3VTUA 4RAUC 3CCUA 3MEFA 4FA6A 3E56A 2GRIA 1TY0A 2EYJA 4JI3Q 4R4CA 3HOWG 3M4QA 2AWTA 5EBDA 2M2LA 4ICVA 5LMNW 4MTKA 2A1AA 1F2RI 2K5HA 4XDXA 3UDFA 1G2SA 1STHA 1Y1WG 2KOLA 3AM9A 3HS0C 2YU9H 4W9FA 5E6NA 1SYBA 4P2CB 4HR7B 5KRUA 3GO5A 4JI6Q 4G3XB 2JRIB 2Q2HA 3VRBB 2MFIA 4IFDI 1VQ6A 2NZOA 3W9CB 2E2JH 2RBMA 3S16B 5ELBA 4ZUJA 4IFDH 2NBVB 3TMEA 1HZ5A 5M5YH 2RSUA 1ZKOA 2I5MX 4K2LA 3CMEA 1MFWA 5KIXA 3NOBA 4XWTA 1XJVA 2RA4A 2LFIA 2OHFA 3KYHC 4BWGB 3R7QA 1C9OA 1TWGH 2PQAB 2H1EA 4FYDA 1GUAB 4RMAA 1ZGUB 3ITPA 2WGSA 1D6EC 4K5WA 4PZ6A 1YJJA 3WALA 3A54A 1TT5B 1EYDA 4UP7A 3A5UA 2DUDA 1VQ4A 2ASBA 1V49A 4GDLA 4CKBA 3RZWC 2VUMH 1JW9D 2JA7H 2BB5A 1UE1A 3APFA 1F9JA 1R4PB 4ZQ3A 1HFNA 1E2WA 4DNIA 2Q2TA 2J0MA 2XVSA 2KACA 3KDFA 3M9BA 1STAA 1L0WA 4A3JH 3K6OA 1YOVB 4AYBG 1EF5A 1N5XA 3V2TA 3RUIB 3ENEA 1NCVA 2F4VQ 4E71A 5IP4D 3PPAA 1HUMA 2KD0A 2ZTCA 2QC8A 2KFKA 4OGQC 4FXDA 5G55A 2R7FA 2JSOA 1B9NA 2Z6BA 3OW7A 3PZ8A 3J81L 4ME3A 1PTOD 3VUYA 5BMIA 2CCZA 1P7FA 4XDDA 4XE0A 3UINB 1T9HA 1WZ3A 1F9RA 3TEHB 1XEEA 5IGFA 2FIFA 3AEAB 4C3JH 2ZXOA 3KLSX 2EYLA 3RMHA 1WYDA 3K80C 2PQEA 1WTVA 1WI0A 3S15B 2VB3X 3L10B 4K7UA 1HTOA 3H3VC 4IUPA 4JI2L 2F3VA 2NBFA 1JJ2A 1J7CA 3APCA 4ITKA 4M01A 5JPMC 3S2HB 2G4DB 2DZIA 3DBHI 3AI5A 3LJ3A 4KKTA 1WXMA 2NYZD 1RTNA 2L9HA 2VL6A 2WXOA 3PZDA 4LJPB 2B2YA 2A68D 1ISNA 4DK5A 2I2YA 3G48A 3TDQA 4XDCA 3S2DH 4P6VF 1Q1OA 1VD2A 3C19A 3C1EA 2BB6A 4QCLA 3TN2A 2UUCL 2NVYB 2G3QB 3KOJA 3NE5B 1ZUD2 1LM0A 3SR1A 3OYYA 2D0OA 3Q23A 2DY7A 4O0AA 2K6DB 2DENB 3NXWA 4GKJQ 4GU2A 5H92C 1JR0D 4WJWA 2KWVB 1KL9A 5J22A 2BH2A 1JOKA 2KHSA 1O7IA 4GKKL 2BW2A 4AOFA 2PZUA 2Q8TA 1PH5A 5C3EB 2PPBC 1YD8U 1PV4A 4QGUA 2R93H 3RLFA 3P7JA 2JWZA 4LUOA 1QB5D 3PO3H 2Q2UA 2JXXA 1RAXA 4BBNC 1L2FA 1K50A 1HQMC 5KNCA 2WYQA 2NWGA 4GLSC 1YIWA 3EECA 4GOPA 4N9F4 3SFEB 4QY7A 2VXWA 5CYUA 1KRTA 4B08A 4OX9Q 2MNAA 2VB2X 1K51A 2QIEB 2KCMA 5IGDA 3P4SB 4HWIB 2XSCA 4C3IB 4HIDA 2JVCA 4EUTA 1SIJA 2E2IH 1EUVB 1VZ8A 2HJ8A 1IBMQ 5M5XH 2F3WA 2XRSD 1NR2A 4IO9A 2ZCCA 4CGYB 2BVCA 3PRMB 3RNEC 4KKIA 1WZ0A 2ID0A 5AUKA 1A0IA 1WJNA 4M8AA 4JWSC 2R92H 2IX3A 1N6ZA 3HOUH 1AWDA 2LI5A 1RDPD 3R2TA 2FINB 5CGKA 1NI3A 5IKCM 4POGA 1X32A 5BN3A 4B3MQ 5C44H 4BA1I 4GN5A 5I4DA 1FVIA 2ACZB 3AEDB 2O6VA 3ZJUA 4GN1A 1V5OA 1IKMA 5AFWA 3HP3A 3S14H 1C78A 1A8VA 2JRHA 2LHEA 4K1RB 4MT5A 1KHIA 3QJYA 1STNA 3S2HH 3ZNID 1U4AA 2RPQA 3L17A 3AU5A 4HVBA 4QMGA 2MHJA 3MXNB 3VYRA 1TR5A 2F0EA 2CFMA 2DJFC 1TWHB 4H7BA 3MWYW 4DR2L 4B3TL 3S17B 2MP2B 4HJ5A 2R2OA 4PYUA 2I07B 2YEPF 4A3MG 3CKIB 4X3TA 2O5IC 1DONA 3AQQA 5D3DA 4DV5Q 2A4ZA 4HEA1 1L0XB 1B4OA 3NVZA 1NAPA 4JC0A 3HM6X 2NPTB 5LMNQ 2ENBA 3T8MA 4X65Q 1Y1VB 1MHXA 1Y8NB 2W3RA 2CHXA 4LNQA 3QK0A 1VRAB 5ELFA 5I6WA 4R8IA 3PREA 2OTJA 4QF4A 4DR3Q 3N3KB 3CC7A 2MX2A 2DNCA 5DM63 2KBNA 4DBGA 4PMCA 2V3SA 3LYYA 3GTKH 2F0OA 5BR8Q 2K5DA 1SNOA 3P1MA 2F0IA 3CCVA 4LMQD 3H6MA 3Q3NC 1PDXA 1DXMA 4W9CA 2X6LA 2FHTA 2MJ8A 1Y1WH 2GBRA 1VQHA 1IBLL 2AX5A 3BDCA 2SOBA 3TS0A 5C2TB 4GNXA 3KBXA 3BDOA 1TIFA 2A6ED 2ZCBA 2K5QA 1IBLQ 3NPPA 4NXML 3S17H 2R7ZG 3AV8A 2JZ3B 2JA7B 1IUEA 1B53A 2AMCB 4MM3A 4B3SL 4QJFA 2J0JA 3Q2AC 1LT5D 4K8IA 1S5CD 3EA6A 2K04A 1SDFA 2DY8A 2SDFA 4RHSA 4ZK9B 3DBHB 3SK5A 1EY8A 1WGRA 3A7LA 1Y1VH 3Q6SA 4A3BG 1Q5WB 3H0GG 5FLMG 5C3EG 1C4QA 4RKLA 2LVQA 1VQAA 2D62A 2JA9A 4J8QA 4MNOA 3CXCA 2KQ3A 2DNEA 4H0LC 4RFBA 5DEHA 4WQOB 2N1VA 3FKIG 1P8LA 3ABVB 3L4PA 4WJQA 1TGZB 3GV6A 4JV5L 3DWQA 5J2RA 2N9LA 1HE8A 5D6JB 4C3JB 1A15A 1SE4A 2F0HA 4UHVA 2LXCA 4BY1G 3UIPB 4DDGD 1WH3A 1TZ1A 2MBEA 1T3QA 2L0TA 3EVQA 1KDCA 3S1NH 4CDFC 1AFPA 4DF7A 1SE8A 2WXJA 4KSKC 5AZFA 2YYZA 3A8KE 4RF1A 1PYSB 2VZKB 1B9RA 5IAAC 1G6JA 2G1EA 1GKHA 1Q8IA 1VQJA 3G71A 4DV3L 3DQVA 4YY3Q 5T1IA 1V8CA 4EGVA 1NEKB 3KJOA 3PO2H 3DDCB 4HJAA 5CC4A 3VR6A 3G6JB 4K14A 4LWCA 4NY0A 2MQHA 4A3FH 1OTCA 1X6OA 1D5XC 3JC66 1OEYJ 4DV4Q 2B63B 1GB1A 1IXRA 4ZYSA 4IWQA 2IX0A 2F0JA 4ASWC 3MHSD 4NJ7A 3VH3B 2FUG1 1VMCA 3OLMD 3I4LA 3C2PA 4PMBA 5C0XJ 4GZYC 4IM2A 2NZHA 2EZVA 1H4RA 2WWZA 4I6LB 4JIOU 3JW0X 5DPWA 1Q1BA 5M5WH 1WTQA 1WGKA 4WJ3M 2B2UA 1B7YB 2J53A 4B0MA 3W1GA 2PYKA 1N33L 4HKZE 3RFZB 1JOOA 2C35B 4EZJA 4LLGM 3S24A 1WJUA 4ZYNA 1EWHA 2M56B 1I5FA 3T13A 4YIJA 3KW5B 2Y5CA 3OHXC 3NZ3A 1U4RA 3TJPA 3D8GA 1GJXA 1JJCB 2GN5A 1UE5A 2BGFA 5J39A 2L32A 1SE9A 2MRPA 3W2DA 4NW2A 1YN3A 4IOCA 2L55A 1WGDA 3GV3A 4DDID 2KDEB 3NUCA 3H91A 2BE5C 4MSQB 3K8AA 1XPUA 4A3MB 1WY8A 2VQEL 3H94A 4HCNB 4FO2A 5G3LF 2OJWA 1IBKQ 1OXXK 1XCTL 2WXPA 4JCVE 2NUCA 5MPOA 2HHHQ 4FJYA 1J6QA 3VHTC 3EGRA 2HDLA 3H0GB 3LNNA 4JYAQ 2K03A 1RFKA 2VUMB 1WGGA 1T6BX 5JXVA 3MFGA 1CSPA 4K7WA 4K6LA 3KYCD 4W9KA 3RZDB 2G9DA 2WHIA 1D4BA 4TRDA 4Y52H 3PLUA 1E8ZA 1XX8A 2E8GA 1LT3D 2K28A 3TP5A 3UI2A 2BYVE 1QG7A 1XXGA 2JJQA 2LY7A 2PQAA 2CWAA 5KNDA 4DR7Q 1I50H 3A55A 5HHDG 4A3GH 3T1HQ 3GTLH 1PRTB 4C2MB 3RNAC 3H15A 1YJIA 3QAQA 4M8MA 4X62Q 4M1UB 4OXPA 4LNNA 3BDLA 2UU9L 4C3JG 1QCBD 4FN2A 3S1RB 1SR3A 5KGUA 4DAYB 1E0ZA 3BU2A 1WX9A 1RRBA 3BK2A 1QVGA 1PH6A 1VQEA 1F9QA 3U50C 1HNXQ 4L5SA 2L12A 4MHEA 4QIWB 3NY5A 3PGEA 1SLJA 4DXAB 4WH4A 3MTSA 3U2SC 2PVOD 3RPFC 3OTOQ 4FJVB 4A3BB 3D0FA 4OW0A 4O2DA 4CKEA 3A4SC 3NQIA 4KIKA 3U4VA 4BY7B 3SXHA 1YX6B 2WIIB 4RCNA 1F2LA 5K36G 4GOCA 4MGYE 5J1ZA 1TTNA 3AEEB 1P0RA 1WTXA 1PQSA 2WP8J 3AFQA 1ASYA 2K5PA 1VQ7A 5TSSA 3VTWA 1EU3A 4E6IA 3CCRA 2K25A 2YTXA 2HJ1A 2Z4HA 2MH7A 1SRUA 3CMMB 1P16A 2HUGA 2B2VC 1FYCA 1K0RA 4JYAL 3ZJTA 1SJHD 3KF8A 1PYBA 1WF9A 1I50B 2RMMA 2F0TA 1K9MC 4PMWA 1TIID 2F0VA 3PSEB 4ZDVA 2JYOA 3HFZB 1IBKL 2KQSA 5BMGA 3FVQA 1TWCH 4ANXA 3A9JB 3R3OA 4HK2A 4RF0A 4X3SA 2V1CC 4ID6A 1WTHA 1V43A 4IWPA 3BS1A 4P1CC 5IP9G 5AJ3Q 3TP7A 1FMAD 3RNBC 2L11A 4JI0Q 1HTLD 3HOXG 1WTRA 3CCJA 3I2ZA 2DYOA 1CK1A 2MJDA 3LWUA 1RF2D 3GD7A 2WDTB 4IM0A 3NWSA 4DHZB 1QNUA 4FDBA 2F0UA 2A6HD 1HTPA 3B1LX 1XD3B 2GVAA 4BY7H 3NVYA 1HXYD 4RGOS 3GE8C 3DVGX 4F87A 4PG3A 3B2FA 5FK9C 3APDA 3TP8A 4EQ5A 3D4DA 4DV0Q 1RM6C 5M5YB 2DWQA 4ZOHC 4I7AA 1NNXA 2ZW0A 2K8HA 4I65A 3FKIB 5CV5A 2WV6D 1YNXA 3EJIA 3OTOL 3DCGA 2N3SA 3MXNA 1WM3A 1LTAD 2B63H 2K5NA 3X3NA 2KYWA 4DR1Q 1DZ1A 4FNFA 4LTUA 3QX1A 2INDC 1SMYC 5EJWA 5C44G 2EOTA 2A8VA 1U9RA 3EHVA 1EY7A 3RN5A 3K59A 2A5UA 5T8IA 1OXUA 4GDKB 2AWNA 3MC0B 4LF8Q 4A3PA 1I94Q 5ISRA 2J7ZA 3BYYB 3M62B 1CKOA 4ZRQA 1GUTA 2Y0SG 4TKOB 2PNRC 5CMDA 3OW2A 1GUGA 4CKCA 1KM7A 2BH8A 4N8X1 1YNND 4DAPA 4HN7A 3HOYH 4HJ7A 4JWUC 1BF4A 1YN5A 1STGA 4J15A 4DR6Q 2IO3B 3HOWH 2F0GA 1FXIA 2WXGA 5IOCA 1E90A 1FEHA 1LT6D 2CKZB 4LF5L 2K52A 1E0BA 1E8XA 1XMQQ 2LASA 1Q86C 3TEYA 2IJ0A 1F0ZA 4WJ4A 1PZKD 1WJ4A 2PTLA 4UP9A 3VRAB 1LGRA 3L2PA 4A3MH 4LF4L 2MP1A 2MBHA 3K0XA 4YCWA 2WINB 1AP0A 1A2UA 5M3FG 2C5LC 2UUCQ 1EY9A 3PCOB 1CZWA 2DLBA 1VQNA 1Q90A 3KYDD 1PFMA 1G8ZD 1PRTF 2EPBA 2JK8A 4GN3B 2PW5A 1UD7A 2DAFA 4QAYA 3BWUD 4CDCC 1NJIC 3L16A 3CP0A 1WX8A 2LJ5A 4I6PA 2IT1A 1W6KA 1KTKA 1YJNA 1UELA 4AH6A 1PH9A 1J8CA 1ENAA 3PO3G 2VQFQ 3ND8A 1HR0W 1K3RA 1UE6A 2VZKD 3M63B 2JEAI 1GB4A 1CT1D 1HZCA 4BBSG 4JI8Q 4A3GG 2C7MB 1DM0B 4BBNF 5E3FA 3DVNU 3ZXRA 1Q3LA 1IYJB 3O13A 1GXDC 2KJRA 3RNUA 3TEZA 3MVVA 5BYRA 2JQRB 1BKBA 4G4KA 4LF6Q 1B3AA 3PO3B 2WXRA 2DZMA 1EFWA 2Z6KC 1Y56A 4YWMA 1E6EB 2B8FA 2DBYA 3EQLC 1L6UA 2LVOA 4DHJB 2N7EA 4K0KQ 1O80A 3HKZG 5KYIA 1R4MI 3E0JA 3FPUB 4Q5VA 2HCCA 1Y8RC 1V1OA 1ZKHA 2WXKA 1WXAA 2IY1B 1PRTC 4PS8A 2FMMA 2R6GA 3NK9A 3A8IE 3NWTA 5LXIB 3BG3A 3R7RA 1LTBD 1MVKA 1WMHB 3C3LA 2Q8IB 3V6EB 2VW9A 1AE3A 4X64Q 3PSIA 1ILPA 3VUWA 4B6WA 3VVWB 1KAAA 1BT0A 3SK4A 1ZXTA 4LW1A 4A3KG 2AL3A 3NBHA 3QG1A 4ZAIA 4GS3A 3RD4A 1YJWA 2D07B 2LXJA 1VQMA 3A33B 4HSVA 4LDTD 2OCEA 3I63C 1ICWA 2B2TC 4JI4L 4FXCA 2H4OA 1SMXA 2JXMB 3KK7A 2MWSB 3CC2A 5D2MB 2NBWB 1CKNB 2JA6B 1K83B 1STYA 2RQXA 3I73A 1VQ5A 3PO2G 1XLPA 2L3ZA 2PW9A 2NMQA 1SJED 5LMNL 3TCAA 3HKZE 1E5WA 1EEID 4KD3A 4CJ2C 3MEHA 3PUWA 3VTVA 4USAA 2PZWA 4CHTB 1U4PA 2WAQE 5CV6A 4JI5Q 1QUQA 2L1AA 3L54A 1YMHE 1TQOA 2TMPA 2FMCA 3VR3A 1OQYA 5ELNA 4BY7G 1F77A 3HHMA 3M3YB 4DK3C 1PDQA 3TBLD 1JWUD 2BWFA 1BUVT 1Q1EA 4HLEA 2CS4A 4DUYL 1IZ6A 2KCNA 4NKLA 2KK8A 5GROA 4BBRH 3P4RB 3MHZA 3MC8A 2EY1A 1ZDVA 3UIOB 4OIKA 3CIRB 3VUXA 1PVOA 3IVFA 1KNAA 2LGYA 4ACFA 1PH7A 4HKQA 4C7YA 2JXTA 4ULLA 5BR8L 1Q0WB 4XT3B 4MGKE 3CCMA 2KO3A 1KRSA 4NXMQ 2PVGC 1PH2A 1K28A 1FD7D 1VF5C 4OWTB 1PH1A 4LF8L 3RZOB 2NVTB 2VS1A 4R1JA 2NPTA 1L7YA 3OOCA 4C00A 4A3IB 3FC4A 4J3OD 3GP7A 3CAMA 2M4NA 3T51B 1IBML 3E9IA 3OIPA 4QB4A 1UBQA 2PE9A 4AYBB 5AEKB 1CA6A 1X55A 2KZRA 1EQQA 1Y14B 4WORA 1WCMH 3NTIA 2G9HD 5M3MB 3GTPH 2O5JC 1TT2A 3D32A 2VNUD 5EGTA 3CF6E 3LXFA 2ALYB 4KV2A 4N58A 3HZXA 1D5ZC 3HRDD 1TS3A 1ZEQX 2WXLA 1H9MA 4LK1C 1H9JA 1GO3E 2NVUI 1EZ8A 4A3OA 3R2IA 4V0BA 5CBAE 2EDGA 3S1MH 1H95A 2BS4B 2E3TA 2AKWB 3CRKC 2NZ1D 3HKSA 1GC6A 3SHQA 3DOWA 1STEA 4IUVA 1WGYA 1J9OA 2K75A 2F0FA 2K32A 3AU4A 3RD2A 2REXA 2KCTA 3HOZG 2GI9A 2NVXB 2INPE 3AU7A 4L8JA 1XNQQ 4TV3A 3RULA 1QE6A 2EY6A 2YVCA 3UDXA 3NZSA 4RA8A 1YJ1A 2GVBA 2PI2E 2Z1CA 3I4MH 4KSLC 4TUUA 2Q8RE 1E3PA 2EYHA 2QCPX 1A62A 3DM1A 1I6VC 4HMIA 2WKCA 3J80c 1T5XD 2UXCL 4DUYQ 1XCQL 2GBMA 2MQJA 3J81j 4UP8A 2CJOA 2M9VA 2C7NB 2BYFA 2LZ6A 1MHHE 3V61A 4IUMB 4IQZA 2CQAA 5IGGA 1WYGA 5IYDG 4LDTB 2CWPA 1BCPD 2N7JA 1X3QA 2WDRB 1SNCA 3BYTB 1Z5SB 3AE4B 3HOUB 3S1RH 4IM3A 3P75A 1KRHA 4MGZE 4LF9L 4R4OA 2ZJQA 3RZFA 2E76C 2ZXRA 2VZAA 4GLAC 3ULPA 3FKYA 4NJ6A 2HTME 1LLRD 1BBUA 2IWHA 4IJLA 4FULA 1PH3A 3ZUNA 5JJLA 1VQBA 3J81c 3V05A 4C3HB 4LNKA 1PTOF 1H9SA 3U7ZA 1FCCC 5IA7A 1WTOA 5LLIA 3E9SA 3J80L 2QA4A 2LGSA 2IL8A 5FLXc 1N5WA 2K8CA 2RDFA 3Q3JA 2XIWA 4A3JB 3AE3B 2FUHB 1UAPA 5CV4A 1F2ZA 4DV6L 1B70B 1WD1A 4R8NA 2F52A 3NVWA 3BVGA 5D7GA 4HPLB 3NJTA 1O78A 4YCVA 1WE6A 4DV7Q 4MSMB 1Z7TA 1ACCA 4CYEA 3Q3FA 1JWBD 3OJ3A 4DV5L 1RFAA 2GOWA 3A7AB 3GTJH 1L4ZB 3EBEA 4PS7A 2NVXH 2JUOA 2IBIB 1P3QU 3HUIA 1YIJA 1EYAA 4A6QA 2WACA 2OEOA 1SIFA 4EQOA 1IYVA 1DD2A 3LWEA 2ATWA 1AH9A 2V4LA 2K39A 4IN3A 1RHPA 3SHLA 4H02A 3F2CA 1EQVA 1SFOH 1XTCD 4DV1L 2X6GA 3AEVA 2GLSA 5KHQA 4BVUC 3HOYG 1CMXB 4IUQA 2KCCA 5IP9H 1CKNA 4YY3L 3RN2A 1VQOA 2DN8A 1K83H 2BYEA 5DM73 4C3IG 4GKKQ 2UXCQ 2HTHA 4DXGA 4IC7B 3ZTCA 2ASQA 4XGAB 3S9WA 4YTMB 3SD5A 1M4VA 2F0DA 2UUAL 2D3BA 5LL6X 1TYGB 5JPNC 1KDAA 4FP5D 1JOQA 1VS0A 5IP7H 1FRDA 3IG3A 4W9GA 1UGMA 1LTTD 2NR2A 1E10A 4LF7L 1PFBA 2MBOA 4C80A 1HNZQ 1EEFD 4IFDJ 2AUKA 4C4VA 5G2NA 4LF9Q 3TEXA 3BVZA 4MIUA 2CW0D 3ZKJC 5JJZA 4LF7Q 4C3HH 1EIFA 2D3AA 2N8NA 3E9HA 5LL6S 1X56A 3RNCC 1A70A 3R3MA 4WAFA 4ARCA 4BA2I 4KJOA 1BQQT 2WP9B 1YEZA 1PZID 4MZ9A 4LFCQ 4DR1L 4K81A 4HRSA 1QVFA 1NBWA 3GOEA 1JMCA 1BCPB 5C3JB 1BO0A 4BXXG 4QIWE 1JE4A 2K22A 2NVTH 5I2YA 1BMLC 4B3SQ 4PK1A 2RKSA 4K2KA 1V86A 1TS4A 4KTAA 1KXLA 3DBRI 1JWAD 1CUKA 2LKVA 3J80i 3NQTA 5TR5A 4L6TB 4DR4Q 1IYUA 1QQRA 5IN7A 4XC2A 1VJKA 3AB9A 2KFJA 3M95A 2MCNB 3HOVG 3RI7C 4FBJB 3FRPB 4IUUA 1VQGA 1SNDA 2WQYB 5A35A 1X1MA 1FJGL 4A3KB 2I1KA 1K53A 3I4NH 2KENA 5M3FH 2UWQA 2RDBC 1UEBA 2N7DA 3EFCA 3EC8A 4GB9A 4B9WA 5DCNA 2K01A 3ML9A 4N59A 4JI3L 2HHHL 3MFYA 3ZRFA 4UY8C 2ZVOA 4EZLA 1IGCA 5EE0A 1OFFA 2KVMA 3EIVA 3N20C 3F2DA 4J6HA 4KV6A 1Q82C 4A3BH 4G11A 3PUYA 1ASZA 3FEWX 1J5EL 2H88B 3SK6A 2V3PA 3HOXH 5EKIA 3I4MG 4AUQC 3A5ZB 2XNAC 1EM7A 5M5WB 4P73A 4V190 5EE3A 1J5EQ 1I42A 4A93H 1L1OA 2X38A 3GB1A 3HG9A 1KFYB 3ER0A 1YQ3B 4ZRJA 3S14B 5JVG3 1N32Q 1FRRA 5EKKA 1JJGA 2R7ZB 3KLSA 2SEBD 3IAM1 5FR6A 1GAQB 3LB8C 3NENA 4R4QA 1YITA 1XLOA 5T1GA 3JAML 4DHJD 4WRDA 2A6HC 2PPHA 2LJIA 3V60A 4S0RA 1J0GA 1QT9A 2KN4A 1DOMA 1VQCA 3DWAA 3W5OA 4A3DH 3NHHA 3GZNI 3K5MA 3M3JA 2KHJA 2EXDA 4A3CG 3VH4B 2VH2A 4JOIC 4HJGE 3LDZE 1GOZA 3PIOA 2BA1A 2UYZB 1CQVA 1B1ZA 5CV7A 4JI7Q 5KNBA 4AP4C 3CSFA 1Y1WB 3KUZA 1XNRL 2BCOA 1SN8A 2HDEA 4NB3A 1PGXA 3IBEA 3M7NA 4QL5A 1OXSC 2NB0A 4DKAC 1WWTA 3QHTA 4FADA 2JA8H 1X54A 3ZDTA 1IHZA 1ESRA 2G5DA 4KGTA 3PUZA 1HRJA 3NBIA 4F88A 3T53B 3ZNZB 3F2BA 4DA2A 3MXGA 4DV6Q 3I9V1 1T0YA 1WE7A 1YBYA 2K05A 2IX1A 3CCQA 4EOYA 4C1NI 5LMUQ 2BWES 4XXEA 1K8OA 2WDVB 1EFID 1MSGA 4IURA 1SYEA 3SDZA 2DAJA 3AN1A 4HROA 3RCZA 1WM2A 2KLCA 3VYSA 1J19A 2B2WC 1MG4A 2JSVX 2LEKA 2XEWA 3OMCA 3CMAA 4KN7C 1NBFC 3KH0A 5IYCG 2GBNA 4LFAL 1R9TH 4OIJA 4P7IA 2NCNA 2JA6H 3HGBA 5IYCH 5FR3A 4IPGA 5EPLA 3ZO5B 3T1YL 3DHHC 3ONAB 5BN4A 2D0PA 1PXUA 3S2DB 3VYTA 3GTJB 1L5PA 4BBRB 4GDKA 2C5CA 1FGBD 2KHWB 4EEWA 5JEAG 1Z9FA 4JPSA 1YNTE 5C4ZA 3UI3A 4S17A 4KKSA 4N8FA 3IAYA 4HIOA 2EY2A 4EVOA 1FNWA 2NVQB 1IGDA 4FXKC 2MO1A 2MHVA 2OQ0A 4YCUA 2CHZA 1V80A 2LXAA 1ONLA 4YHHQ 3RNGC 3SU8X 1SFOB 1J7AA 3RZOH 3SEBA 3KF8B 2K9XA 4JVZA 4AQYL 1Y8OB 3FDTA 4KZCA 4XT1B 1GPXA 3UDIA 3IHPC 2A73B 1L4DB 4N9TA 2R3ZA 2WDQB 4KY6A 3TBIB 1ZXIA 2B3AA 5D65A 4GNXB 1PTOB 5DAUA 2LMCA 2YEPB 1IBXB 1FFUA 5ELCA 2FCMA 1ZP0B 2OF1A 2RSOA 3HOZH 2KWDA 1C3TA 2D10A 2B2YC 2E75C 5COYA 2ES2A 4DR7L 4M02A 1V1PB 3W5UB 3PUXA 3M4PA 2EYFA 3QR8A 4HSPA 1C7YA 4OZCA 3KUPA 3ZVVA 1OXTA 4HXDA 5M5XB 1B3QA 3FHWA 2KTFA 2C9WB 3GTGB 1I4XA 1FD6A 3N1XC 1TY2A 3HOUG 1ZOYB 2LS01 1JALA 4A75A 3TRZA 2AQ1B 3R66C 4LK0M 5E6OA 3B6YA 1IKLA 1TWHH 2XBBC 1QZHA 2B8GA 1V97A 5EAYA 3S1QH 1FR3A 4U68A 3DVGY 4L5TA 2N55A 1VDVA 2LGDA 4APVA 3PQIA 5A2QL 3TZDA 3I3TB 3QA8A 2BOSA 1HEZE 1BDOA 2I5HA 1QLBB 2KWCA 1QILA 1TWGB 2K1BA 3TUOA 2B2WA 3GTOB 3FMCA 1HR0Q 1I4RA 4JBJA 3TL5A 1MHWC 1F2YA 2ICEC 5IIFA 5JJIA 1DJRD 1E7UA 4R9WA 4GSWA 1JICA 3MTNB 4RMFA 1S72A 1XMQL 1C0AA 1HR0L 1R4NB 4KI0A 4DQOC 4PV1C 1PUTA 1PTOH 2QDBA 3AE5B 1P9DU 1E22A 3PUVA 1YN4A 2VY3A 3LX0A 4OEMB 4YHHL 3AE8B 4IPCA 4DR5Q 3GTQH 3VFKA 3WAMA 1XQQA 1VLBA 5A2QE 3N52A 3I4MB 2R2QA 1JROA 3ICEA 2PMVA 3VA5A 1S3OA 2KA7A 1Y1VG 4LUVA 1H9SB 4L23A 1LT4D 2OOBB 2OTLA 4RNAA 2RSNA 3T4AC 3M7GA 4JI4Q 2FE8A 3U52E 2H5XA 1NYRA 2K1FA 3BZDB 3HKZB 3CQZH 4X65L 5EDSA 2DZKA 4WQMA 4FHJA 4F7ZA 3DHGC 5E7NA 4WWOA 2J7QB 5JZEB 3S1QB 3Q3MC 3ONSA 5AZGA 5IY0A 4ZLTF 1W2BA 3G7LA 1J8IA 1N60A 3Q6BA 4BBSH 4PYZA 2IHEA 3K7UC 2CHBD 1C9FA 1H9KA 4X6AH 1TXYA 5EE9A 3DVNV 3CPWA 3WDNA 1JWSD 2C60A 1MI2A 3QWZB 3AFPA 2JU6X 4OZAA 1U5KA 1EQRA 3N1YC 3VR8B 1UEAB 3DMUA 1KF6B 2PW7A 2QEXA 2FCNA 2QDFA 2X69A 3VDZA 1ILQA 2JA5G 3A56A 1B9MA 5C3WA 2W9NA 4LUZA 3I90A 4KMUC 3U8ZA 1EY0A 2I1JA 1X3PA 1TKGA 4HPPA 1DGJA 2YLMA 3IRBA 3DPDA 2L52A 3ZQ4A 4Q0FA 1QOFA 5I6YA 2ZPYA 4DNTB 2MSED 4WWNA 5C4JH 1WXVA 3ERSX 3M4YA 1GG3A 2Q5WD 2RDGA 3PGZA 3HVZA 1B2TA 1RKNA 1S5ED 1OGWA 4GMVA 3Q8CA 2NN6G 1ET6A 3Q8EA 2N9EB 5FO8B 3J7YW 3K5OA 2LGIA 4XWWA 1D3ZA 1CHPD 2M0AA 1KAWA 2I38A 3VXWA 3WAOA 3PF4A 5M3MH 3CD6A 1F52A 3QOJA 5HGQA 4BBSB 4S3SA 2D5DA 1LV9A 4CHKA 3C1FA 3DBLI 3K5LA 3NTKA 5NUCA 3X3MA 4KKJA 4KK7A 1R9TB 2V0GA 1SYFA 2ICIA 2V9HA 5IOIA 1MD2D 2AHOB 1JRUA 2WKDA 2J0KA 1SSNA 4HJ8A 1B44D 1WYWB 4A3IG 1WVLA 3AYHB 1WFYA 2E2JB 3ECIA 2OEDA 1C48A 2V4DA 5ELEA 3X23A 4YTNB 2V1YA 1MJCA 4A3LG 2Z0SA 3ND9A 1K8RB 4POFA 1DOIA 1IP9A 2WLBA 1KJTA 1CA5A 2Y0SE 3I70A 5JHBA 3BVMA 1LACA 4R3DA 3PTFC 2QEJC 4TQ0A 2KN5A 4OVUA 1QWYA 1WTPA 3UE0A 3MJ5A 4FF4A 4DWFA 1XPRA 4NP5A 3K81C 1BCPC 3P42A 4JI1Q 2UUBL 1NY4A 1C1YB 1KOTA 1TWCB 1X9NA 2WXQA 3ZXVA 4RGMA 1SE3A 1E7ZA 3OMGA 4PNYA 4CDEC 1LXDA 4MDKE 1V1QA 1A6XA 2KMAA 2ONQA 2DJGC 1KQSA 4J6IA 2K50A 5L83A 4RGNA 2KHIA 4ANWA 4DK6C 5G5GA 1PTOC 1R4NI 4BFRA 3DHIC 3RYTA 3FKIH 1XO3A 4XYCA 3IFTA 4NMZA 3PF5A 3DUZA 3QCAA 3QB3A 3J7ZC 4K0KL 2MW5A 3OAWA 2NN6I 4BOZB 2HQEA 1HCZA 4PQXA 3GTMB 1P1AA 1WRIA 2D11A 1A2TA 2MPMA 3NHEB 1FFVA 1HA6A 3L0WB 3VQIA 2JZZA 1CQFA 4B9KA 5JH5C 3H7PB 4EZKA 2Y3AA 3A1QA 3KQ4A 4UDUC 2HIVA 5JEAJ 2HT1A 3IT4B 1V8QA 1KIXA 4L63B 1O7YA 4ZRIA 3S15H 3RZDH 3ZTDA 5HGTA 2XGTA 3PIO3 4WJPA 4D2KA 3HOVH 1BCPF 1HZAA 1A3TA 1UUPA 1RLFA 4RM8A 3ZLZA 3FP9A 1EWCA 3J81i 3F2UA 3M3YH
chains in the Genus database with same CATH topology
4IALA 1FNVA 1SNPA 1S4ZA 3HOWB 3MA2B 1CJEA 1HA5A 1PLFA 2L4NA 1C79A 1STBA 4A3DB 1VCIA 1BBXC 4L2YA 1AEXA 4DAYA 2JYTA 2OXPA 4REZA 4A90A 1RTOA 5IT9E 2N9KA 4KJNA 1AZPA 3S1NB 3DWGC 3I8ZA 4MACA 1GUOA 5ELDA 4FXGC 4DK0A 5GXGB 1DYQA 3NRZA 4JBWA 1VZ7A 5CV8A 4WIPA 3DXJC 1PZJD 4B0EA 3PIP3 2YU9B 5C3XA 4OHJA 1EY4A 3WOEA 2F0QA 4FF1A 1F2MA 1GHKA 4IUTA 1KNEA 4Z9CB 2V3NA 1XLQA 1BXTA 4WFN3 4ZRPA 4YSYB 3U4EG 1RODA 2RPVA 2SNMA 1N62A 2XWJB 3MHBA 4OL7A 1L0VB 3HOVB 3B9JA 1VDZA 1YNJC 4NAWB 3IT6B 2DYMA 1ML0D 3IFDA 2INNE 2JYEA 4MH8A 3AMZA 2WXMA 3GTKB 1JMLA 2B2VA 2I46A 3HVDA 3DEPA 5EPJA 1RD9D 2O2LD 3EFXD 3ERQA 5JAVA 1SYCA 4KD4A 1D2BA 4KY5A 1ET9A 4US8A 2F0LA 2XWBB 1ZPSA 3MZ5A 3SVMA 2PIAA 4A9AA 3AE7B 3DWMA 1GUWA 2JWUA 2RVLA 4CJ0B 3BK1A 5FOBB 4TMAB 2PCFB 3HEJA 3GTLB 2KAJA 2EXZA 1JWMD 3J9CA 2F0KA 1G291 3GTQB 2WS3B 5JVH3 2GA4B 3SK8A 3VR5A 4AQ7A 4AS1A 5HI1A 3T16A 2K3UA 2D5GA 1WD0A 3E5SA 2F0WA 4A3GB 3K0YA 1TS2A 2BT6A 1SXTA 2LFNA 4YWGG 4HEDA 5BYQA 4NDXA 1FO4A 3PO2B 1LO5D 1P7EA 4JK1C 5D3IB 1TKEA 1G6ZA 5E4WC 4BY1B 5EE1A 1T5EA 2E74C 3QWNA 2JA8B 3P4QB 4WWMA 2K7VA 4IOIE 2J52A 5FO9B 2F1MA 5C5LA 2E2DC 3SFDB 2BA0A 2AQ3B 4EQPA 1SYGA 2E6XA 1SAPA 4ABNA 1II3A 3CWIA 5F2DA 5FKAC 4HCEA 2PO4A 3AEGB 2FJ2A 1QOHA 2AQ2B 1R4QB 4ZUIA 3I72A 1AYFA 1RJTA 3D6WA 3U9SA 3C8YA 3QIAA 4H13C 4HCSA 2PZTA 1UWMA 3BIID 5M9OA 5C6AA 3ZYYX 1CI3M 1DCZA 3K57A 2IGHA 1J7BA 3WCQA 1EQTA 2SNSA 3DEOA 1ENCA 2B39A 1EU4A 3B2GA 4DFAA 3MP9A 4Y7NB 5IGBA 1RWSA 5EKLA 1YQ4B 3D3RA 1KABA 3OPOA 3CRLC 1Z6HA 5EQ0A 2V4IB 5C0XG 1IW7D 4ZKCB 4OO1H 2EJFC 3OWFA 2RDHA 2PKOA 1IL8A 1HZ6A 2MJEA 1PFNA 1B50A 3R93A 5JEAH 4YXDB 3HOXB 1C4CA 1L0YB 2EYMA 2J42A 2K33A 4GDLB 1BUIC 2JX5A 4KGSA 4JX1C 2IGDA 2CU3A 1CFMA 2IDYA 1MSHA 1A3VA 1EZ6A 1NR4A 2C9OA 1SYDA 4JE3B 3EROA 2MEKA 5EBCA 2BTEA 2E2HB 3A8JE 3Q69A 4U673 1EY6A 5C44B 1SEBD 3FAHA 3RUZA 5IODA 1EL0A 1G2TA 3K58A 1JC7A 2EELA 1DOKA 5FLXL 1QKZA 2QMTA 3T3NA 4PT5A 1TKYA 1CTMA 4KKUA 5AUIA 1WCMB 1EOTA 4G7ZC 3IL8A 1U4MA 4KX6B 2ZT9C 2NN6H 5IT9L 1XYIA 2J4XA 5EPKA 1D1IA 2WNMA 4CJ1B 1E9MA 4RKBA 4KHZA 2IGGA 1SF0A 1XLNA 3DWPA 1Y8PB 3KBGA 2QKIC 2D9UA 1RYJA 4OVZA 4XYOA 3ETRA 3NTHA 3J81E 4NAMA 1PFDA 1UWXA 2WXHA 2L1BA 1ZE3D 1D1KA 5K36H 1CZGA 5C4XB 2CVRA 2ZXPA 4G57A 5C4JB 4DN4M 2F4IA 1TS5A 4RWSC 1I7HA 2BS3B 3KWLA 1I4QA 1BNZA 4YT0B 4RGTA 2F0SA 4N6EB 1C4PA 4DGZA 1IBXA 2JEBI 4YSZB 2A6EC 4FF3A 3J7AF 5CBEE 2CW0C 5M3FB 1ESFA 2Z8LA 4X3UA 3CU7A 3NS1A 4LAAA 4XQQA 4EE2A 3KWVA 2F03A 1OQRA 2CJNA 2R93B 4NJCA 1EIGA 1SMYD 1LTGD 1LABA 1PGAA 5CV9A 5FO7B 2IPKD 3SR6A 3H09A 3TP6A 1JORA 5BMHA 5HFYA 1VF7A 2WB1B 4P16A 4DXFA 3M85A 1JQ4A 3FILB 1DOXA 4QUCA 2KECA 4WURA 4RCOA 2M19A 1HFGA 1EYCA 4N9PA 1TWAB 3I3CA 4ZHOA 2J0TD 4G7HC 5E4XA 2MJ3A 5IGCA 3T3OA 2WU2B 1N63A 1OXVA 1ZYRD 3C46A 4RHRA 1V1PA 3T56B 2EKIA 1HQRD 2QSDA 1FCLA 1HUNA 1Q10A 4CBVA 4LJZC 4HTHA 1PGBA 3VR4A 3W3AA 3I91A 4IUNA 2EVBA 3AE6B 3D4WA 2QF7A 2A69C 5I9PA 1KLGD 4KHVA 4MN3A 2K0PA 4ODGA 4A8XC 1I4HA 3JAME 1MGSA 1EIHA 1C77A 1MPEA 5KEEA 2EYOA 2A74C 3NSWA 3M4OB 3NUHB 4X3KA 2WAQB 4C1NK 3J7AV 1I4GA 2R61A 2O4XA 2AUJD 3OWEB 3V3XA 1PYWD 1NSNS 4TQ1A 1UNSA 4IKGA 1U4LA 3HRZC 3QOLA 1LTRD 2AWOA 1WSPA 3I4NB 4DU9A 2HCIA 1TWFB 1VMPA 1WTWA 1VZ6A 2W55A 2Y5PA 1SNMA 1O7LA 1ROEA 1FXAA 4K5VA 1HHVA 1FM0D 3P20A 2JZPA 1GUSA 3D31A 2K6AA 1AZQA 1XWEA 1I3QB 4I7ZC 3U9OA 5K5PA 2BDOA 1S5BD 2PMZB 2N0SB 1F9PA 1N61A 3P1HA 1C8CA 3P4PB 3GQBA 4OO1G 2ZW1A 2W54A 1ZDXA 2KMMA 1NYQA 3FPPA 3W5VB 3K7AB 2EYPA 3H8HA 1K52A 2OT2A 3OIQA 4QUFA 3ZJVA 2R92B 2FFKB 3Q22A 1AN8A 4BS9A 2KJXA 2XRQD 2NTTA 1WXQA 3MXUA 3IXSA 5KYLA 4C56C 4C3HG 3N9YC 1AW7A 2E2IB 4IFDG 5CR3A 3URYA 3Q0AA 1CZPA 5LHY1 3AEBB 3E6ZX 1SNQA 5C0XH 1L6VA 2A69D 1JB3A 3AEFB 2EE1A 1A3UA 4KGRA 3AE2B 2MGSA 4A3EB 1EY5A 1C4AA 2W3SA 1LTID 2TSSA 4US9A 3KLRA 1YNJD 1LTSD 1I4PA 1M8AA 5I2XA 5E1FA 3VR2A 5FLXE 5E6JA 2B2UC 2PLPA 5C4HA 1FNUA 4ZRZA 2LMCB 1OO9B 2JP1A 1E2VA 3HOZB 1Y69U 2QJLA 1QF6A 2BE5D 1DOYA 3AMUA 1TVXA 1C76A 1SB3C 1HPCA 2BYTA 2M00A 4TSSA 3NP8A 2K5WA 4B9XA 2Z4IA 3PV0A 3NVVA 3K5NA 1BOSA 1GUNA 1KH0A 1CHQD 1JRPA 4XYQA 1QOGA 2MUYA 4XQJA 3J80E 4NZLB 4Q2JA 1CM9A 4EQNA 1BR9A 1Z47A 2F0NA 1DOLA 4ZHPA 1W6JA 2HDMA 1RCVD 2SAKA 3FILA 3AE9B 2IW3A 4OZBA 4F8MA 2FBWB 3TSSA 3D4RA 3L7ZC 4RH6A 5BYSA 2BDNA 4DNRB 3VYUA 2F0MA 1QOBA 3Q24A 3SE0A 1F2RC 3AB5A 2EJMA 1NENB 3CHBD 1OQQA 2LUMA 1MI0A 1QNKA 3CQZB 4IDIA 4H2AA 2ON8A 4FVMA 4XTCS 2WXFA 3GTPB 3AH7A 1JQYD 3N6RA 3I57A 2KUMA 5HG2A 2Y0SB 2GB1A 5I9OA 4K8JA 4OO1I 1H9RA 1KDBA 3TZUA 3L3OC 2LHDA 2B2TA 3R8BA 4K5XA 1JCKB 1PMRA 1G91A 3VR9B 2A68C 2L5TA 1ENFA 2KEEA 5C5MA 4G7OC 4ZKBB 3MAQA 4MM3B 3IAS1 4C7ZA 4DAVA 1PRTD 1Q12A 5IGEA 3Q8FA 3Q8BA 4H44C 4F7XA 4HAEA 3Q8AA 2A5HA 3D6CA 1NVID 1I6HB 3L9AX 4ME5A 2KEDA 1XF5L 5H8YE 1TJEA 2W82A 4XIGS 5BN5A 3EUB2 1MBYA 3V96A 5C0XI 4TQUS 2JE6I 1TU2B 5JOBA 1GHJA 1IW7C 5HURA 2KDMA 1QOAA 1YNNC 2L0CA 1FIQA 2KQ4X 2BS2B 1EWYC 2WU5B 1O7ZA 3OSOA 4YSXB 1D5MC 3W1SA 1NUCA 4J1MA 1TZOA 1SE2A 2JA5B 1UGJA 1S5DD 4A93B 4IZ8A 3VA7A 4CQNA 4A55A 3P63A 3HOYB 3GS2A 1TKWB 4FF2A 1E2ZA 3IKJA 2L83A 2QILA 2EJGC 4L1BA 3DHQA 4HMJA 2BBCA 5LNK1 3ZGZA 3TEWA 1F9SA 4ARIA 4KY7A 4XQNA 1S5FD 4O42A 2XN9C 1ZXHA 4YTPB 4K6DA 2H89B 4M0WA 2N88A 3AECB 1KLUD 4O1NA 3S1MB 2EY5A 2D2CC 4KN4C 4DK1A 3PO0A 3PZ7A 1R7SA 2WXNA 4UAIA 1QJOA 2B76B 4ILWA 2F0PA 1SSOA 2WXIA 3MXPA 1ZYRC 1E7PB 1SBBB 3WOFA 3AE1B 5DNFA 5D14A 4A3FB 5G5HA 1K8MA 3QO2A 5G3LD 3PMFA 2NTSA 5CORA 4RAUC 3E56A 2GRIA 1TY0A 2EYJA 5EBDA 2M2LA 1F2RI 4XDXA 1G2SA 1STHA 2KOLA 3AM9A 3HS0C 1SYBA 4P2CB 4HR7B 5KRUA 3GO5A 3VRBB 4IFDI 3W9CB 2RBMA 3S16B 5ELBA 4ZUJA 4IFDH 3TMEA 1HZ5A 4XDDA 1ZKOA 4K2LA 4XWTA 5KIXA 2RA4A 2LFIA 2OHFA 4BWGB 2H1EA 4FYDA 3ITPA 1D6EC 4K5WA 1YJJA 3A54A 1EYDA 4CKBA 1JW9D 2BB5A 1R4PB 4ZQ3A 1HFNA 1E2WA 2KACA 2XVSA 1STAA 3K6OA 1N5XA 3V2TA 1NCVA 1HUMA 4OGQC 4FXDA 3OW7A 2JSOA 1B9NA 3PZ8A 3J81L 1PTOD 5BMIA 1P7FA 4XE0A 1F9RA 1XEEA 5IGFA 3AEAB 2ZXOA 3KLSX 2EYLA 3RMHA 2PQEA 1WTVA 3S15B 2VB3X 3H3VC 4IUPA 4ITKA 2F3VA 2NBFA 1J7CA 5JPMC 3S2HB 4KKTA 2NYZD 1RTNA 2L9HA 2WXOA 2B2YA 2A68D 2I2YA 3TDQA 4XDCA 4P6VF 3C1EA 2BB6A 4QCLA 3TN2A 2NVYB 1ZUD2 3NE5B 3SR1A 3Q23A 2DY7A 3NXWA 5H92C 1JR0D 4WJWA 5J22A 1JOKA 2KHSA 2BW2A 2PZUA 2Q8TA 5C3EB 2PPBC 3RLFA 3P7JA 1QB5D 1K50A 1HQMC 5KNCA 2NWGA 4GLSC 3SFEB 5CYUA 2VXWA 1K51A 4B08A 2VB2X 2QIEB 3P4SB 5IGDA 2XSCA 4C3IB 1SIJA 1VZ8A 2F3WA 2XRSD 1NR2A 4CGYB 4KKIA 2ID0A 5AUKA 4M8AA 4JWSC 2IX3A 1AWDA 5CGKA 1RDPD 2FINB 3R2TA 1NI3A 5BN3A 1X32A 4BA1I 5I4DA 2ACZB 3AEDB 3ZJUA 1IKMA 5AFWA 3HP3A 1C78A 2LHEA 4MT5A 3QJYA 1STNA 4QMGA 3VYRA 1TR5A 2F0EA 1VR9A 3MWYW 1TWHB 4H7BA 3S17B 2I07B 2YEPF 3CKIB 4X3TA 2O5IC 1DONA 4HEA1 5D3DA 1L0XB 1B4OA 3NVZA 1NAPA 2ENBA 1Y1VB 1MHXA 1Y8NB 2W3RA 1VRAB 5ELFA 5I6WA 4R8IA 4QF4A 2DNCA 5DM63 4PMCA 3LYYA 2F0OA 2K5DA 1SNOA 3P1MA 2F0IA 4LMQD 3H6MA 1PDXA 1DXMA 2X6LA 2FHTA 2MJ8A 2AX5A 3BDCA 2SOBA 5C2TB 3KBXA 3BDOA 2A6ED 2K5QA 3NPPA 3AV8A 2JA7B 1IUEA 1B53A 1LT5D 4K8IA 1S5CD 3EA6A 2K04A 1SDFA 2DY8A 2SDFA 4RHSA 4ZK9B 3SK5A 1EY8A 3A7LA 3Q6SA 1C4QA 4RKLA 2D62A 4J8QA 2KQ3A 2DNEA 4H0LC 4RFBA 5DEHA 3ABVB 3L4PA 3GV6A 3DWQA 2N9LA 4C3JB 1A15A 1SE4A 2F0HA 1T3QA 3EVQA 1KDCA 1AFPA 4DF7A 2WXJA 2YYZA 3A8KE 4RF1A 2VZKB 1B9RA 2G1EA 1Q8IA 5T1IA 1V8CA 4EGVA 1NEKB 5CC4A 3VR6A 3G6JB 4K14A 1D5XC 2B63B 1GB1A 4ZYSA 2IX0A 2F0JA 2FUG1 1VMCA 3I4LA 3C2PA 4PMBA 5C0XJ 4GZYC 2EZVA 1Q1BA 1WTQA 1WGKA 2B2UA 2J53A 4B0MA 2PYKA 4HKZE 3RFZB 1JOOA 4LLGM 1EWHA 2M56B 3T13A 4YIJA 2Y5CA 3OHXC 3NZ3A 1U4RA 3D8GA 1GJXA 5J39A 2L32A 3W2DA 4NW2A 1YN3A 2L55A 3GV3A 3NUCA 3H91A 2BE5C 4A3MB 3H94A 4FO2A 5G3LF 1OXXK 1XCTL 2WXPA 2NUCA 5MPOA 3EGRA 2HDLA 3H0GB 3LNNA 1RFKA 2K03A 2VUMB 1T6BX 5JXVA 3MFGA 4K6LA 3RZDB 2G9DA 1D4BA 4TRDA 1XX8A 2K28A 1LT3D 3TP5A 3UI2A 1QG7A 1XXGA 2LY7A 5KNDA 3A55A 5HHDG 1PRTB 4C2MB 1YJIA 4M1UB 3BDLA 4C3JG 1QCBD 3S1RB 5KGUA 1E0ZA 3BK2A 1F9QA 2L12A 4MHEA 4QIWB 4WH4A 3MTSA 3U2SC 2PVOD 3RPFC 4A3BB 4OW0A 4CKEA 3NQIA 4BY7B 3SXHA 2WIIB 4RCNA 1F2LA 5K36G 5J1ZA 3AEEB 1WTXA 2WP8J 2K5PA 5TSSA 1EU3A 4E6IA 2MH7A 2Z4HA 2HUGA 2B2VC 1FYCA 3ZJTA 1SJHD 3KF8A 2RMMA 1I50B 2F0TA 4PMWA 1TIID 2F0VA 2JYOA 5BMGA 3FVQA 3R3OA 4RF0A 4X3SA 4ID6A 1V43A 3BS1A 3TP7A 1FMAD 2L11A 1HTLD 1WTRA 2DYOA 2MJDA 1CK1A 3LWUA 1RF2D 3GD7A 3NWSA 1QNUA 2F0UA 2A6HD 1HTPA 3NVYA 1HXYD 4RGOS 4F87A 3B2FA 5FK9C 3TP8A 3D4DA 1RM6C 5M5YB 2DWQA 4ZOHC 2ZW0A 4I65A 3FKIB 5CV5A 2WV6D 3EJIA 3MXNA 1LTAD 3X3NA 1DZ1A 4FNFA 4LTUA 1SMYC 5EJWA 2EOTA 1U9RA 1EY7A 3K59A 5T8IA 1OXUA 4GDKB 2AWNA 3MC0B 5ISRA 2J7ZA 3BYYB 4ZRQA 1GUTA 5CMDA 4TKOB 2PNRC 1GUGA 4CKCA 4DAPA 1YNND 4HN7A 4JWUC 1BF4A 1YN5A 1STGA 2F0GA 1FXIA 2WXGA 5IOCA 1FEHA 1LT6D 1E0BA 3TEYA 2IJ0A 1F0ZA 1PZKD 2PTLA 3VRAB 2MP1A 2WINB 1AP0A 1A2UA 1EY9A 1CZWA 2DLBA 1Q90A 1PFMA 1G8ZD 1PRTF 2EPBA 2PW5A 3BWUD 2IT1A 1W6KA 1KTKA 1ENAA 3ND8A 2VZKD 1GB4A 2JEAI 1CT1D 1DM0B 5E3FA 1Q3LA 3O13A 1GXDC 3TEZA 3MVVA 5BYRA 2JQRB 4G4KA 1B3AA 3PO3B 2WXRA 1Y56A 1E6EB 2B8FA 2DBYA 3EQLC 1L6UA 1O80A 5KYIA 3E0JA 3FPUB 4Q5VA 2HCCA 1V1OA 2WXKA 1PRTC 2FMMA 2R6GA 3NK9A 3A8IE 3NWTA 3BG3A 1LTBD 1MVKA 3C3LA 2Q8IB 1ILPA 1KAAA 3SK4A 1ZXTA 3NBHA 3QG1A 4ZAIA 3RD4A 4HSVA 1ICWA 2B2TC 4FXCA 2H4OA 2JXMB 3KK7A 2JA6B 1K83B 1STYA 2RQXA 3I73A 2PW9A 1XLPA 2NMQA 1SJED 1EEID 4KD3A 4CJ2C 3MEHA 3PUWA 4USAA 2PZWA 4CHTB 1U4PA 5CV6A 2L1AA 1YMHE 1TQOA 2TMPA 2FMCA 3VR3A 1F77A 3M3YB 1PDQA 1JWUD 1BUVT 1Q1EA 2KCNA 4NKLA 3P4RB 3MHZA 2EY1A 1ZDVA 4OIKA 3CIRB 1KNAA 4HKQA 4C7YA 2JXTA 4ULLA 4XT3B 2PVGC 1FD7D 1VF5C 3RZOB 2NVTB 3OOCA 4A3IB 3FC4A 4J3OD 3GP7A 3T51B 3OIPA 4QB4A 4AYBB 1CA6A 4WORA 3NTIA 2G9HD 5M3MB 2O5JC 1TT2A 3LXFA 2VNUD 5EGTA 4N58A 3HZXA 1D5ZC 3HRDD 1TS3A 1ZEQX 2WXLA 1H9MA 4LK1C 1H9JA 1EZ8A 3R2IA 4V0BA 5CBAE 2EDGA 2BS4B 2E3TA 3CRKC 2NZ1D 1STEA 4IUVA 1J9OA 2F0FA 2K32A 2GI9A 2NVXB 2INPE 3AU7A 4L8JA 1QE6A 2EY6A 4RA8A 2Z1CA 2Q8RE 2EYHA 2QCPX 3DM1A 1I6VC 4HMIA 2WKCA 1T5XD 1XCQL 2CJOA 2M9VA 1MHHE 4IQZA 2CQAA 5IGGA 1WYGA 1BCPD 2N7JA 1X3QA 2WDRB 1SNCA 3BYTB 3AE4B 3HOUB 3P75A 1KRHA 2E76C 2ZXRA 2HTME 1LLRD 2IWHA 3V05A 4C3HB 1PTOF 1H9SA 3U7ZA 1FCCC 1WTOA 3E9SA 3J80L 2IL8A 1N5WA 2RDFA 2XIWA 4A3JB 3AE3B 1UAPA 5CV4A 1F2ZA 1WD1A 4R8NA 3NVWA 3BVGA 5D7GA 1O78A 1Z7TA 1ACCA 1JWBD 3A7AB 1L4ZB 3HUIA 1EYAA 4A6QA 2WACA 2OEOA 4EQOA 1IYVA 1DD2A 3LWEA 4IN3A 1RHPA 3SHLA 1EQVA 1XTCD 2X6GA 4IUQA 2KCCA 2DN8A 5DM73 4C3IG 4DXGA 3S9WA 4YTMB 1M4VA 2F0DA 5LL6X 1TYGB 5JPNC 1KDAA 4FP5D 1JOQA 1FRDA 1E10A 1LTTD 1PFBA 4C80A 1EEFD 2AUKA 3TEXA 3BVZA 4MIUA 2CW0D 5JJZA 5LL6S 1A70A 4WAFA 4ARCA 4BA2I 4KJOA 1BQQT 2WP9B 1PZID 4HRSA 1BCPB 5C3JB 1BO0A 1JE4A 2K22A 5I2YA 1BMLC 2RKSA 4K2KA 1TS4A 4KTAA 1JWAD 2LKVA 3NQTA 4L6TB 1QQRA 1IYUA 1VJKA 3AB9A 3FRPB 4IUUA 1SNDA 2WQYB 5A35A 4A3KB 1K53A 4B9WA 2K01A 4N59A 3MFYA 1IGCA 5EE0A 1OFFA 2KVMA 4J6HA 4KV6A 3PUYA 2H88B 3FEWX 2V3PA 3SK6A 5EKIA 2XNAC 1EM7A 5M5WB 5EE3A 4V190 2X38A 3GB1A 3HG9A 1KFYB 1YQ3B 3S14B 5JVG3 1FRRA 5EKKA 2R7ZB 3KLSA 2SEBD 3IAM1 1GAQB 3LB8C 1XLOA 5T1GA 3JAML 4WRDA 2A6HC 2LJIA 1QT9A 2KN4A 1DOMA 3DWAA 3NHHA 3K5MA 4HJGE 1GOZA 2BA1A 1CQVA 1B1ZA 5CV7A 5KNBA 1Y1WB 2BCOA 2HDEA 1PGXA 3M7NA 1OXSC 2NB0A 1WWTA 1IHZA 1ESRA 4KGTA 3PUZA 1HRJA 3NBIA 4F88A 3T53B 4DA2A 3MXGA 3I9V1 2K05A 2IX1A 4C1NI 4XXEA 1K8OA 2WDVB 1EFID 1MSGA 3SDZA 4IURA 1SYEA 3AN1A 4HROA 3VYSA 2JSVX 2B2WC 2LEKA 3OMCA 4KN7C 4OIJA 3HGBA 5FR3A 5EPLA 3ONAB 5BN4A 1PXUA 3S2DB 3VYTA 3GTJB 1L5PA 4BBRB 2C5CA 1FGBD 5JEAG 4JPSA 1YNTE 5C4ZA 3UI3A 4KKSA 3IAYA 2EY2A 4EVOA 1FNWA 2NVQB 1IGDA 4FXKC 2MHVA 1ONLA 1SFOB 1J7AA 3SEBA 2K9XA 1Y8OB 3FDTA 1GPXA 4XT1B 2A73B 1L4DB 4N9TA 2R3ZA 2WDQB 4KY6A 3TBIB 1ZXIA 5D65A 1PTOB 5DAUA 2LMCA 2YEPB 1IBXB 1FFUA 5ELCA 1ZP0B 2OF1A 2RSOA 2KWDA 2B2YC 2E75C 5COYA 1V1PB 3W5UB 3PUXA 2EYFA 4HSPA 4OZCA 3KUPA 1OXTA 5M5XB 3GTGB 1I4XA 1FD6A 1TY2A 1ZOYB 2LS01 1JALA 4LK0M 2AQ1B 1IKLA 2B8GA 1V97A 1FR3A 4U68A 1VDVA 2N55A 5A2QL 3TZDA 2BOSA 1HEZE 1BDOA 1QLBB 1QILA 1TWGB 2K1BA 3TUOA 2B2WA 3GTOB 3FMCA 1I4RA 1F2YA 2ICEC 5IIFA 1DJRD 4R9WA 1JICA 4KI0A 4DQOC 4PV1C 1PUTA 1PTOH 2QDBA 3AE5B 3PUVA 1YN4A 3LX0A 3AE8B 1VLBA 5A2QE 3N52A 3I4MB 1JROA 2PMVA 3VA5A 2KA7A 1H9SB 4L23A 1LT4D 4RNAA 2RSNA 3T4AC 3M7GA 3U52E 2FE8A 1NYRA 3BZDB 3HKZB 4WQMA 3S1QB 4ZLTF 3G7LA 1J8IA 1N60A 2CHBD 1C9FA 1H9KA 5EE9A 3WDNA 1JWSD 1MI2A 2JU6X 4OZAA 3VR8B 1UEAB 3DMUA 1KF6B 2PW7A 2X69A 1ILQA 3A56A 1B9MA 5C3WA 3I90A 4KMUC 1EY0A 1X3PA 1TKGA 1DGJA 2L52A 3ZQ4A 4Q0FA 1QOFA 5I6YA 4DNTB 3M4YA 3HVZA 2Q5WD 2RDGA 1B2TA 1RKNA 1S5ED 3Q8CA 2NN6G 1ET6A 3Q8EA 5FO8B 3J7YW 3K5OA 2LGIA 4XWWA 1CHPD 2M0AA 2I38A 3QOJA 4BBSB 4S3SA 2D5DA 1LV9A 3C1FA 3K5LA 3NTKA 5NUCA 3X3MA 4KKJA 4KK7A 1R9TB 2V0GA 1SYFA 2ICIA 1MD2D 2WKDA 1SSNA 1B44D 1WVLA 2E2JB 2OEDA 1C48A