1XXGA

Crystal structure of staphylococcal enterotoxin g
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
233
structure length
227
Chain Sequence
QPDPKLDELNKVSDYKSNKGTMGNVMNLYMSPPVEGRGVINSRQFLSHDLIFPIEYKSYNEVKTELENTELANNYKGKKVDIFGVPYFYTCIIPKSEPFGGCCMYGGLTFNSSENRDKLITVQVTIDNRQSLGFTITTNKNMVTIQELDYKARHWLTKEKKLYEFDGSAFESGYIKFTEKNNTSFWFDLFPKKELVPFVPYKFLNIYGDNKVVDSKSIKMEVFLNTH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Crystal Structure of Staphylococcal Enterotoxin G and binding affinity to T-cell receptor and MHC class II molecule
rcsb
source organism Staphylococcus aureus
molecule tags Immune system
molecule keywords enterotoxin
total genus 61
structure length 227
sequence length 233
ec nomenclature
pdb deposition date 2004-11-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01123 Stap_Strp_toxin Staphylococcal/Streptococcal toxin, OB-fold domain
A PF02876 Stap_Strp_tox_C Staphylococcal/Streptococcal toxin, beta-grasp domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.110 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1xxgA02
3.10.20.120 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1xxgA01
1CK1A 2R61A 1S5CD 5ELCA 1RDPD 4RFBA 2AQ1B 5ELFA 1HQRD 1EEFD 1I4QA 1LTBD 3DWQA 1PRTB 1ESFA 1CHQD 1I4GA 2IPKD 1S5FD 1SE3A 2TSSA 1PRTC 2XNAC 1M4VA 1SBBB 4BWGB 3KLSX 1PZKD 3GP7A 1BCPD 1UUPA 1JWSD 1SJHD 4UDUC 1ET6A 1SEBD 1EU3A 1PYWD 1RF2D 3W2DA 1PTOB 1TY0A 2RDGA 2XRSD 1I4RA 1D6EC 1LTRD 1V1PB 1BCPF 1FNWA 1AW7A 1D5ZC 1I4HA 1JQYD 2NTTA 1PTOF 1PZID 1ENFA 1I4PA 1LT4D 1LLRD 2J4XA 1LTSD 1ET9A 3BZDB 3MC0B 1RCVD 2AQ3B 1F77A 4K6LA 1XXGA 3BVGA 1EU4A 4L63B 3O13A 4RGNA 1LT5D 5I4DA 1TS3A 2O2LD 1YN4A 3V05A 2SEBD 3R2IA 2QEJC 4RGTA 5D3DA 3TSSA 1PTOC 1DYQA 1KLUD 1LTAD 3R2TA 2G9HD 1T5XD 4RHRA 1LTID 1S5DD 1SE2A 5ELDA 4C56C 4DXGA 4RCOA 3SEBA 1JR0D 1EFID 1EEID 2NTSA 1S5BD 1YN5A 1FNUA 1PTOD 4L6TB 1GOZA 1MD2D 5FK9C 2WV6D 1QILA 3BYTB 2XN9C 2IJ0A 1TS4A 1TS2A 1RD9D 4RHSA 5ELEA 1BXTA 1LT3D 1EWCA 1LTTD 3URYA 2ICIA 1D5XC 1LTGD 1JWUD 1LO5D 3CHBD 1L0YB 1PRTD 1PTOH 3DWAA 1DJRD 4TSSA 1B44D 1HXYD 1TY2A 4DXFA 3EA6A 5FKAC 1FGBD 2CHBD 1UNSA 4RGOS 1V1PA 1BCPB 4RGMA 3EFXD 1KLGD 4OHJA 3BVMA 1CQVA 4ZYSA 2Z8LA 1D5MC 1LT6D 1CHPD 1TS5A 3BYYB 1AN8A 1G8ZD 1SE4A 2QILA 1S5ED 1STEA 4NZLB 3DWPA 4Z9CB 1KTKA 1SJED 3R8BA 5D3IB 3BVZA 1V1OA 3OWEB 2AQ2B 1CT1D 4O1NA 1PZJD 4RH6A 1FNVA 1L0XB 1PRTF 1I4XA 1XTCD 1B1ZA 5TSSA 2RDHA 1BCPC 1SXTA 1JWMD 1YN3A 1JCKB 1HTLD 1HA5A 5ELBA 1FD7D 2XRQD 3MFGA
chains in the Genus database with same CATH superfamily
1CK1A 2WB1E 2R93H 5KIXA 4NY0A 1Y1WG 5AZHA 2OT2A 3HKZB 4HCEA 4DV7Q 1IXRA 1A2UA 4IPDA 3T3OA 4A76A 1STHA 2JEBI 3I73A 4NPSA 3TP6A 5BN3A 2V0GA 3GTQH 5FLXL 2N9XA 4A3FH 5E1FA 3HEJA 3AI5A 4HKZE 1BOSA 2WAQB 3SE0A 4UDUC 1FRDA 5CHFA 5BO4B 5JJIA 1D8LA 1TWAH 4DR6Q 1GG3A 2G45B 2JRIB 4KDLB 1QOFA 4GKJL 3STBC 3KWVA 2R7DA 4H0LC 5HG2A 3K80C 1UD7A 3GTJH 2PW9A 3HOUH 1C78A 2DJGC 5IP7H 4OIJA 2AHOB 1WH3A 4DN4M 2QDFA 3DHHC 4N59A 4B0MA 2DZIA 1CTMA 3PUYA 3NBHB 2I1JA 3ECIA 3CC2A 4BXXG 1F0ZA 4CKEA 3W1GA 2LGYA 4WAAA 3RNFC 2LXJA 1GHJA 4GNXB 4C4VB 3NQIA 4WJ4A 2UXBL 2AQ3B 2JJQA 1F9RA 3FRPB 1FGUA 4WORA 1LQBA 2F0IA 3CCVA 3AEGB 3VAWA 2WNMA 4KY5A 3AH7A 2JY6A 1SNQA 2RSUA 2SEBD 3ALBA 4YL8A 4RGTA 3VUWA 3TBIB 1T0RC 2LD9A 3JSVA 3H3VC 3RNGC 3ZVVA 3PMFA 2HTME 4KKJA 5TR5A 3HG9A 2G9HD 3UDXA 2EYMA 3W5OA 1GNUA 2KWVB 4BBNF 2HD5B 4RHRA 4KD4A 2E2JH 2LVPA 3B08A 2NTSA 3NZ3A 3S17B 2UUAL 2VZKD 3IAS1 1IBKL 3HZXA 2E5LQ 1XLNA 2DUDA 2IY5B 1MHHE 3L13A 3QR8A 2F0WA 1N34Q 2L0FA 4ACFA 4WURA 4BBSG 4YCVA 2DLBA 1ACCA 5A35A 2LJIA 3I90A 3BYTB 2KANA 2KEEA 5E3FA 2GBMA 2WU5B 3MP9A 3NJTA 4XGAB 3ZUNA 2HIVA 1U4RA 2MEKA 2F0OA 1YX6B 3PIOA 2MLBA 3AEBB 4NNJB 2GVBA 4KKSA 3FDTA 3Q8CA 3P1MA 1WIAA 4ARCA 2GB1A 2JA6H 2C9WB 3SFEB 2PVOD 1YJNA 2RVLA 4XDDA 1ZDXA 2EMTA 1EY0A 1VQPA 2KTRA 3ZNID 5C4XG 3SK8A 2WQYB 5C0XJ 2WDQB 3M4QA 1KRTA 2RHSB 4A3LG 4POFA 4HJ9A 1AYFA 2KOXA 3FILB 3E9SA 1X65A 3BDCA 2KFKA 1N32L 1G2SA 5E6JA 4MM3A 4AOFA 2HE7A 3QQ8B 1HFNA 2PE6B 4KGTA 4W9LA 2N8NA 1BDOA 4IO9A 4JYAL 3W9CB 1IGDA 1LTLA 4YTMB 4A3KG 1HTLD 4QIWE 4XIGS 1MHWC 4BA1I 2UU9L 3BWUD 3MFGA 2E2JB 2B63B 4DHZE 1H9MA 4R4IA 1IHZA 3U9OA 1I4QA 2A5HA 2H4OA 1C48A 1FR3A 1BUIC 1DOIA 2KBNA 1MVKA 2HCCA 3J7ZC 1I4GA 1SF0A 4G57A 1TZOA 3PREA 1F1HA 5BYQA 4JPSA 1BCPD 4R9WA 3HOVB 4IN3A 1JWSD 4OVVA 4JQWC 1XX8A 4PQXA 4MM3B 3HOWH 1YNTE 3RD4A 5H1SE 4K3BA 4A3IG 3A5ZB 3I70A 2RF4A 3A0JA 1TWHH 3S1MB 4BY7G 1V97A 2IO1B 4CHTB 2YLMA 2ALYB 2KKCA 2WXIA 3HOVG 2D0PA 3TEWA 3H7SA 3E56A 1HTPA 1ML0D 1LT4D 1O7IA 1W6KA 2Y0SG 4R4OA 3ENEA 4JI0L 4H2AA 2B63G 4B08A 2BH8A 1NTGA 3PF5A 3BS1A 4P1CC 4P72A 3MWYW 4JCVE 3WWVA 2VUMH 1ZKHA 1LT5D 2KN5A 3DBLI 3VA7A 2IX3A 2E2HH 4GOCA 4M0WB 4DNIA 4GN1A 3T1HQ 4JE3B 2A69D 4C3IB 3SK4A 1QVCA 4XE0A 1DYQA 1D7QA 1NYQA 2N1WA 3OHXC 4OX9L 1WZ3A 4KKIA 3T8MA 3VXWA 5FJ8G 1GO3E 3I72A 4YCUA 2IW3A 2L32A 5CMDA 2VQFL 4CKBA 1XNRL 2Z4IA 3HOXH 4L6TB 2L9HA 1JOQA 3ZLZA 2KYWA 1ASYA 4AP4C 2L0CA 3KF6A 3U7ZA 4ZKCB 1HNXL 2MJEA 3APCA 2MBHA 3OW2A 1STYA 2V4IB 4OX9Q 3A7LA 1WXQA 4W9IA 4NPNA 3TEZA 4HEA1 5EBDA 4KI0A 5IAAC 2AMCB 3ZJYC 5IKCM 1Q8IA 4DV1Q 4EQOA 4TV3A 1C3TA 2ZPYA 1E90A 2MNAA 1NI2A 5DPSA 4YWGG 3UQBA 1PRTD 2D3AA 3T4AC 4YT0B 1C9OA 3RCZA 2KCMA 1WGYA 1J5EQ 1V8QA 3CSFA 2LVOA 3SFDB 1WGHA 5C4JB 4DU9A 1JMLA 2D5GA 1NNXA 1WD1A 2C7MB 3A55A 2LGSA 4A93B 1KLGD 2A6ED 4FF2A 3X3MA 1R4MI 3D4RA 3KF6B 4ZYSA 2TMPA 1J6QA 1KIXA 1XT9B 2PPBC 2K5WA 3M85A 4K5XA 3NBHA 2O5JC 2K1FA 1CUKA 2Y5CA 3RZDB 4J1MA 4O2DA 4Z9CB 2KN4A 3G48A 1Z5SB 3J7A5 1SJED 2A73B 3GTGB 4JV5L 2K6DB 4UP7A 1FIQA 1TGZB 1CZWA 4HJAA 3M62B 3N20C 2RPVA 1SLJA 2EY5A 4JK1C 4GOPC 4HPLB 3J81L 5LHY1 1RLFA 1I4XA 2IT1A 3OG5A 3Q2AC 2KJXA 1V9PA 1R4PB 4FN2A 2AQ1B 1HJPA 4WJ3M 5FR6A 5C6AA 3DUZA 1RIPA 1PRTB 1PYBA 2K01A 3NE5B 2Z59B 3H7PA 3SK5A 1E22A 2XNAC 1VZ6A 1WX7A 1R9TB 4IOAA 1WOCA 3PO3B 2WXMA 4LMQD 1EYAA 3S1RH 3GTKH 3DWGC 4LLGM 4FJVB 1AZQA 2KX0A 2JA7H 3KYCD 1QCBD 4LFAL 1A8VA 5C3WA 1SEBD 2LSSA 4A3BB 4TMAB 3VTWA 4YSXB 2BYTA 4QMGA 3SVMA 3KYDD 2NCNA 3LB8C 4BY1H 2LZ6A 4DR1Q 3HUIA 5IT9c 1V80A 4P7IA 1I4RA 2K33A 2A8VA 4L5SA 2NBFA 2K4KA 1Q5WB 1LTRD 1RKNA 2EY6A 1BCPF 3AEAB 2GVAA 1WYDA 4RA8A 1Q3LA 2HJ8A 5EE0A 3WDNA 5BMIA 1KLVA 1SNOA 2NTTA 2WKCA 3QIJA 3F2BA 2K8CA 2ZTEA 1PXUA 2RQXA 3VFKA 1B7YB 2FUG1 2LRWA 4HKQA 1QOBA 2FIFA 1JORA 5C4JH 4MACA 4IUVA 5FOBB 1HFGA 1JWBD 2O6VB 4HMJA 3IT4B 1RWSA 3Q8EA 4L63B 4RAUC 4RGNA 4ZDVA 1TWGH 5J2RA 1VQNA 1O7ZA 4M8MA 2SAKA 1U4LA 1LTAD 3PUXA 3G71A 5CHVC 1IGCA 4LF6L 4G3XB 2C5LC 3DMUA 3QK0A 1SE9A 4RCOA 1LACA 3CQZH 1V5TA 3WA0A 3WCQA 2DWQA 3G6JB 4BBRH 1CKNB 2RDFA 1T0YA 1FNUA 3H91A 4X64Q 4DAPA 2M0AA 4PS7A 4GKKL 3ZXVA 1OXXK 4DV5Q 3QA8A 1AE3A 4P1BC 2A1AA 3RNUA 4XWWA 3JSVB 1OXUA 2DY7A 1YVCA 4GZYC 1H9SB 1A15A 4OO1H 1JJGA 1N5XA 2N3SA 2IL8A 4TQ0A 4IWOA 1Q86C 4OVUA 2EVBA 2RMMA 1VS0A 2B2TA 1LO5D 3RT3B 1X3QA 1GVPA 2LY7A 1G2TA 3P4RB 3J81E 4DHJD 4EEWA 2IHEA 2CR5A 3DEOA 2JK8A 2JA5H 2K0PA 4LCDE 2PJHA 1B9MA 3MA2B 4RGOS 3EUB2 3HRZC 4YY3L 2J52A 4KKTA 1VQDA 3LWUA 2CH4A 3EFXD 4R4TA 4L2YA 1K28A 3Q3FA 1NJIC 3I56A 3IFWB 3EFUA 3NVVA 1Q1EA 2PZUA 2GA4B 3IVFA 1ZKOA 4I65A 4DHZB 2WB1B 4IWQA 4BAXA 2VRRB 1X55A 1Y8PB 1Z7TA 5IT9E 3N9YC 1SIFA 3ZJUA 2I2YA 3BVZA 2KCNA 4O1NA 1CT1D 4J8QA 2ZM6Q 1PUTA 3N1YC 1Q81C 2NVYH 1GUAB 5LNK1 1ZUD2 2PQEA 1I42A 4EKUA 3A8IE 5FLMH 3KVFB 4B0EA 1BCPC 4FJZA 1CSQA 3ND8A 2VNUD 1Y1WB 4S0RA 5AJ3L 1T0QC 4PK1A 2CFMA 2WXNA 4QF4A 2BWFA 4LF8L 1PH9A 1Q46A 1HQRD 1VQCA 4ARIA 4C3JB 1ESFA 2H5XA 1SB3C 3NVYA 1J5EL 5M3FB 3AE7B 3OWFA 3KLSX 3T51B 1V49A 2ZZPB 2ZT9C 3QX1A 2MQHA 4NDXA 1VF7A 4W9DA 3GTPB 3QO2A 4FA6A 2PNHA 2JA8H 2K5VA 1CQFA 5E4WC 1EU3A 3J81i 4LF5Q 1S3OA 4WRDA 4J3OD 1WTHA 3VDZA 1NYRA 3ZJTA 3ULLA 1K83H 5C0XH 1ZYRC 3S16H 2DHZA 2F3IA 5DPWA 2EXDA 4RG1A 3LDZE 3HOUB 2XEWA 5JH5C 1SGHA 2LASA 2BTEA 2KEDA 4HSVA 4JBMA 1WCMH 1WXMA 2F0EA 1WM2A 5L37A 1BMLC 3DWMA 2SDFA 5DM63 2AX5A 3RFZB 3JYUA 2K04A 2K28A 1XLPA 1LLRD 2YTYA 4CHKA 3V60A 2PMZB 3CXCA 1PFBA 1F77A 3PO3G 5FLXc 2L00B 4FLHA 1IKLA 3QHTA 3PO2B 1IW7C 1LV9A 3I4NH 4TKNA 3V05A 1XNQL 1A70A 4GKJQ 4HDOA 2MHVA 4B9WA 3J9CA 1KLUD 3OOCA 2KVRA 2L52A 4X65Q 4JI0Q 1NR4A 3SEBA 3GO5A 4WAFA 1XPOA 2KMCA 3ND9A 3D0FA 2JXMB 1TQOA 2JYEA 1WTPA 2SNSA 3N1ZC 2RBMA 4FXCA 2L76A 1WTWA 1IYFA 2E2IH 3HS0C 4GDLB 2O5IC 3STBD 3RI7C 1Y8RC 2KC2A 3OMCA 2D0OA 1ZXIA 5CV8A 2RSOA 4C00A 1RJTA 2YU9B 3ZYYX 1BXTA 3JAML 1N63A 1LTTD 5M3FH 4IQZA 2ATWA 1UBQA 2FUHB 2HDEA 3BDOA 5L83A 2Q8TA 1K9MC 3BDLA 1L0YB 1PQSA 1G6JA 3HOYH 1STAA 4XYQA 1UWXA 3CAMA 4D2KA 3S1QB 1GJXA 4JBWA 5C44B 1WX8A 2JEAI 1FCLA 2WXQA 5C3EG 4KIKA 4U673 3KDFB 4H7BA 5IP9G 3GE3C 3DM3A 1L1OA 1VR9A 4B9KA 2DY8A 3A54A 3AEVA 1I3QH 4EGVA 4G7OC 2Z9HA 1EQVA 2QIEB 1E7PB 3PSEB 1KDBA 3TZUA 2DNEA 2F0GA 1HZ6A 2QMTA 5J39A 2Y0SE 3PF4A 3E9IA 3M7NA 2DYBA 4KV2A 3H3VI 3R8BA 1TWFH 1B70B 1TWFB 4C3IH 2K7VA 3OWEB 2BF8B 3MC8A 3FKIB 1Q82C 1FFVA 1SYEA 2BKFA 3KWLA 4MDKE 3SU8X 5K5PA 1K73C 2EIFA 4OZCA 1SSOA 4EUTA 2HUGA 4JI1Q 1JMCA 4R4QA 2PQAB 4LJZC 4JWUC 2WP8J 1LUZA 2L05A 1YNNC 3JAME 1OFFA 2MH7A 3PO3H 4M00A 2NVTB 3CD6A 1CKMA 3T53B 3PO2H 1C79A 4HTHA 3RNBC 4F7ZA 4ZHPA 1SYDA 1GUOA 2N55A 5CV4A 2IX1A 4RNAA 4W9CA 2M0XA 2K9XA 4ZHOA 1TTNA 4FXDA 1GD7A 1SNDA 4BWGB 1HTOA 1TYGB 3V3XA 3U4VA 2PO4A 4LNQA 2ICEC 4IG7B 4Q2JA 5BMHA 4DV1L 2DAFA 1PV4A 2NZHA 1SJHD 3OIQA 3V2TA 2R92B 2XK5B 3C0RB 3LYYA 3G6EA 3QCAA 2PI2A 2OOBB 2PMVA 1X3EA 4ASWC 4CQNA 5LMNW 2JA8G 2FCQA 1JOOA 4AYBE 1A3UA 5IGDA 3CF5A 4C80A 1VQLA 1I94L 2HHHL 4W9EA 2KFKB 2HJ1A 3DHGC 5D14A 4G7HC 1ICFB 1PZID 2X69A 1ENFA 2KXJA 2FCMA 5HKHA 1YQBA 4DUZL 2ZW1A 5C44H 1K3RA 1RCVD 4IZ8A 2ZW0A 1SMYD 1QOGA 3KUCB 1I35A 4K2LA 1Q90A 2MW5A 1EYDA 2QEJC 2K1BA 1BUVT 3PSIA 2W3SA 3DQVA 2VY3A 4IFDG 4XQQA 2NB0A 1WGDA 2FE8A 2LWPA 3VTUA 4C3HB 1G6PA 1X3PA 3AMUA 5M5XB 2LS01 4C56C 1EWIA 1VCBA 1T9HA 1XJVA 3UE0A 2UU9Q 2EKIA 3H09A 2FMCA 5EQ0A 3A1QA 2KQ3A 2AL3A 1HZ5A 1R9TH 1E8ZA 4IWPA 1TVXA 3IAM1 1JT8A 4APVA 2O4XA 4JI1L 4AJYB 1HZBA 2MP2A 1WTXA 1LGRA 3X23A 1JWAD 2IBIB 1VQHA 4I7ZC 2CCZA 4LDTB 2R7FA 2A68D 3VVWB 4US9A 2BS3B 3R3MA 1EL0A 4WWNA 2MRPA 4GLXA 4DV5L 1E7VA 3IFTA 2J0TD 4CKCA 2CU1A 2WXPA 5CV7A 4TQUS 1FGBD 2MJ8A 3JAMi 2L15A 4A3MB 2XK5A 4A93H 4DFAA 3Q69A 1QLBB 2YTXA 4OO1G 2B2VC 2BS4B 2JU6X 4F8MA 1YJWA 3NXWA 1YQ3B 1C7YA 1TXYA 1KC8C 2UUCQ 1IYUA 1K8GA 2KDEB 2K6AA 3DVNV 3PZ7A 4IKGA 1STEA 2PQAA 2NVYB 4DAYA 3UI2A 2BDNA 4JBJA 4X65L 1SFOH 3QOJA 4WQOB 1QVGA 4OWTB 3W1YA 3T3NA 5JAVA 1OXVA 1E8XA 3KLSA 2HQEA 3L08A 3TREA 1OXSC 1HR0Q 2XSCA 5LMUQ 2A19A 1WJUA 3OLMD 2F0DA 1BO0A 2D5DA 4C3HH 2I5MX 4DUYL 1IBLQ 2VUMB 4A8XC 1VRAB 1CM9A 1NR2A 1MBYA 1QB5D 2UWQA 3PV1A 3NWSA 5IYBH 3H15A 1EZ6A 1Y8OB 1S40A 2J42A 1S5FD 3I55A 2TSSA 1PRTC 4N58A 5LMUL 3L0WB 3VR8B 2WB1G 4GOPB 1VLBA 3GB1A 1JE4A 1ZGUB 5IYDG 4K3CA 2UXCQ 1ROEA 1VMPA 1UELA 1F2MA 4HPMB 4ID6A 5NUCA 4FJYA 2A6EC 4HN7A 4ABNA 4FYDA 2D07B 3H6NA 3S1RB 5HHDG 4KK7A 3RN9C 2KECA 3PUZA 3W2DA 1Y1VG 2NN6H 3OPOA 4MN3A 4Y7NB 3L16A 3JAMc 2MCNB 1VQJA 4A20A 1FNWA 4J6HA 1K8RB 5IYDH 1FCCC 2A5UA 3NBIA 5J22A 4POGA 1YHQA 1P7EA 2WINB 1FXIA 1H9RA 5IYBG 2E76C 4X66Q 2A4ZA 4MGIE 1IUEA 3NWTA 2BE5D 2GBJA 2AYOB 2N78A 5M3MB 1QZEA 3J7AF 3PHWB 3QC8B 1X6OA 5D65A 4KGRA 4IALA 3X0WA 3EHVA 2O2LD 3Q3JA 2WAQE 3UIOB 3APFA 3TSSA 1E8WA 4PS8A 1DOMA 2RSNA 3HKZG 1OQYA 3Q6BA 2BB6A 3R2TA 5EJWA 3PVLA 3NELA 1WYWB 4DK0A 5IGFA 4B3RQ 3DEPA 1YQ4B 3MHZA 1L2NA 1LTID 1SE2A 2L83A 2QDBA 1SROA 2R7ZB 4EQNA 1DXMA 1KL9A 4C2MB 2NVQH 4K14A 2JN4A 4WQMA 1IP9A 4IM3A 5LMNQ 3MJWA 2MPMA 2Q2IA 3LJ3A 2L12A 2EJGC 5C5LA 4A3DH 3PO0A 5LXIB 4A3GB 2L7RA 1EY7A 3A8JE 4CDCC 4LFBL 1QILA 4YCWA 4BBRB 2IO2B 4GGQA 2IJ0A 4RHSA 3M3YH 2I1KA 3S1QH 4ANXA 3DVGX 4EE2A 3O65B 1KF6B 2N49A 1XF5L 1EOVA 2WYQA 3OMGA 4RM8A 3UDIA 3TP8A 4JPBW 2EYFA 1YHBA 4BVUC 1GB1A 2B8FA 5LLIA 5JPNC 1R4NB 1KNAA 3HGBA 1E1OA 1GUGA 2INPE 5IIFA 1MI2A 1HQMC 3OJ3A 4A3BH 1LT6D 1CHPD 2EOTA 5JJZA 1Y69U 3TDQA 2IGGA 1JW9D 1QOAA 3I4OA 2L11A 2H1EA 2QKIC 5M5WB 2KVZA 2QILA 4C7ZA 1WI5A 3N1XC 3GTOB 4W9FA 3P4QB 1TKGA 1O7LA 1CI3M 1YNND 3HOXG 1E24A 2MGSA 1KTKA 4DAVA 3ER0A 5GAGC 3RN2A 5FJ8H 1ZPSA 1RTNA 3K0XA 2KJRA 3D8GA 4RH6A 2BT6A 4F88A 1VF5C 2IO3B 1PLFA 3EN2A 4JOIC 4JW0A 1CFMA 1EM7A 3A4SC 1CKOA 2RCNA 3J80L 4AH6A 2QJLA 2VUMG 1FD7D 2A6HC 3VYRA 1BT0A 2W82A 3QG1A 4RKBA 3VR3A 2BQQA 3AU5A 1TT2A 4E71A 4US8A 3LWEA 4G4KA 3AU4A 1J7AA 5J18A 3HRDD 2QEXA 1RFKA 1QQRA 4MGZE 2GOWA 2HCIA 4DPGA 3PZDA 3DHQA 3QOLA 4IPHA 5G5HA 3KBGA 1N32Q 5E6OA 2JA8B 3TEYA 3HKZE 1PDXA 1BQQT 4XC2A 1T5EA 1G91A 2XTIA 3A4RA 5H8YE 3RNEC 2I0QA 4AQ7A 4MNOA 2NVUI 3CIRB 1STGA 2PZWA 2WXGA 4FHKA 4A3IH 3ICEA 5AZFA 4BBNC 1XD3B 5IY0A 2BA0A 2JX5A 4WJQA 1I3QB 5JPMC 4L23A 2N7EA 1T3QA 1NI3A 4NAWB 1WTQA 3TIXA 2QCZA 2IDYA 2OQ0A 4LNIA 2A69C 3MC0B 4BZAA 3ZGZA 2L55A 4BKSA 4OIKA 4NXNL 5C3JB 1N36Q 3HK0A 1EU4A 1X3GA 2FINB 1C8CA 2IY1B 4EZLA 3BK1A 1Z6HA 3F2UA 3R2IA 3C46A 2V1YA 2WS3B 4JC0A 1UBIA 1MJEA 5LL6S 3H3VH 4OO1I 4BOSC 4II2B 4HR7B 1HRJA 2B2WC 2KT7A 4C3IG 3NZUA 4KDIC 3AEFB 3MFYA 2A68C 3K57A 1N36L 2FFKB 1FL0A 4QUCA 2PI2E 1JRUA 4FF4A 1GOZA 1ENCA 4DNTB 2D3BA 2F0NA 3NTKA 5FK9C 1E2WA 1XMOQ 1E7ZA 2KCTA 4CDEC 5HGTA 2JZ3B 5HY6A 2Y0SB 2NS5A 1ZYRD 4DF7A 1D4BA 1RM6C 1KDAA 1LT3D 5C3EH 1EY5A 4G11A 2IY0B 2WXRA 5C44G 3S1NB 1J19A 3DDCB 2G5DA 2PNRC 1BVSA 4DR1L 2VH2A 3PT2B 3ML9A 2HIXA 3I63C 4PNYA 2N4FA 4OL7A 3I4MG 3IXSA 4BY7B 1TKYA 1WJ6A 1WFYA 2B76B 4B3TQ 2MJDA 2NYZD 1I94Q 2MP2B 3RD2A 1W3SA 2Z0SA 2MBOA 1IW7D 3AE6B 2QW7A 3CWIA 1GJZA 5IP4D 2JYOA 2E8GA 3RR5A 3AE9B 4AJWA 1CQVA 1PYSB 1OEYA 3NTHA 3P20A 4ILWA 2Q8IB 4G0NB 4ICUA 2N7JA 3RPFC 4ZRJA 4W9GA 2EYLA 4IPGA 2DYMA 1S5ED 4I7AA 1H95A 3FC4A 3DWPA 4RMAA 5JXVA 2VW9A 3W5VB 3CQZB 1WJ4A 3IG3A 3QB3A 4LNOA 1OEYJ 3A9KB 1L5PA 3NG0A 2N7DA 3VH4B 4YSYB 2P5ZX 4J15A 4EX5A 1KFYB 1Q12A 2XWBB 3D4DA 4LF9L 3VDYA 1L0XB 3MHSD 2F0PA 4A3KB 1DOXA 1P16A 4IUTA 3I4NG 4QJFA 3RLFA 3FEWX 3I2ZA 3PO2G 1T0SC 5ELBA 3A56A 1WM3A 3A8KE 2Z6KA 2D2CC 2N0SB 1B9NA 1SN8A 4QGUA 1YMHE 2D3CA 4LK1C 1QOHA 4ULLA 2KWUB 1F2ZA 4PMCA 3CCLA 4AYBB 5ELNA 1CMXB 4EVOA 5JHAA 3M3JA 1CHQD 4LF7Q 1YI2A 2RKSA 5IWAQ 1PFSA 3ZNHB 3GP7A 3OTOL 1VQBA 4RCNA 4IUQA 1UUPA 5C4XB 1YX5B 4KMUC 1MFWA 3HOUG 2JA7B 4I6LB 3AEDB 2NPTB 2OCEA 3TRZA 1EUJA 4ZRZA 2JWZA 2LXAA 4QIWB 2JVCA 3CMMB 3I91A 4LJOB 1XLQA 2KLCA 4LFCL 3MEHA 4IURA 4ZQ3A 2VQEL 2XRSD 1GUWA 2MJ3A 1QUQA 1ENAA 1YIWA 1VQAA 4FHJA 2WDRB 1WMHB 2O2VB 4E3CA 1VQIA 2MFIA 3NTIA 5KHQA 2LRUA 3QJYA 4JI7Q 5C4HA 3I4MH 5E6PA 2F0HA 4GKKQ 5DPTA 3T1YQ 3S14B 4W9HA 4FP5D 2KHJA 2ONQA 3UF8A 1C9FA 2JRHA 1LFDA 2INNE 3NOBA 1XNRQ 2NVXB 4K6DA 4KY6A 1E8YA 2CVRA 1SYFA 3F2DA 2X38A 3NSWA 1B50A 3QIAA 3MAQA 5JJKA 3S24A 1WWTA 4HSPA 2F0QA 3TMPB 1GUNA 1H9SA 2BOSA 2WKDA 4B3SQ 2KDMA 1SR3A 2F0MA 2FMMA 2WHIA 4IM0A 4HAEA 5ELDA 1IL8A 3TQYA 3VR4A 1HCZA 1JR0D 1EEID 3N6RA 2OEOA 4RWSC 1PTOD 3TP5A 2BPSA 2L3ZA 2RR9A 3LGJA 4YSZB 1IYVA 1B9RA 1R4MB 1JB7A 4DUZQ 3AE8B 2KHIA 5IGGA 1E5WA 2WX0A 4WJPA 3PIO3 5KGUA 4PYUA 3GZNI 1HNWQ 4C1NI 1VQ5A 1E7UA 1A62A 1TKEA 1SNPA 4TQ1A 1WTOA 2JZPA 4NJ7A 2V4LA 4UPAA 3AN1A 1C4QA 4FNFA 2F0KA 4V0BA 1J0GA 1TY2A 2AWOA 1N33Q 2LXCA 1UEBA 4L5TA 3PRMB 2CHBD 1UNSA 4WJWA 2ES2A 2F0VA 4NXNQ 3K0YA 4X64L 4PZ7A 4CGYB 1V2YA 1WRIA 3ZRFA 4PV1C 4XT3B 2CJNA 4NAWA 4QAYA 4ME5A 3K58A 2N9PC 2ZVOA 2Z8LA 3C8YA 3NS1A 3EQLC 4GDLA 2R6GA 2RHQB 5C0XG 2LFNA 1VDVA 2NR2A 1SRUA 3MHBA 1D1IA 4L5QA 4GMVA 3CCMA 1L0WA 2JXTA 2L0TA 2A6HD 2VS1A 3NPPA 4U68A 4BBRG 2WWZA 2XBBC 4KHVA 1PH8A 3IHPC 3K7AB 2NVXH 2B2UA 3CMEA 3TL5A 3N32A 4A4IA 1MJDA 1J7BA 4LF5L 2JWUA 2OF1A 2BKRB 3I57A 3P4PB 2F52A 5LXHA 3MXNB 3D31A 4DV2L 1V5OA 1YN3A 4DDID 2E75C 3B6YA 1SNMA 2XRQD 3VHTC 2K5NA 3TBLD 1S5CD 5ELCA 3DVGY 4OVZA 5FLMG 2KJ6A 3HOYB 3OW7A 4ME3A 3M4OB 1VCIA 4ITKA 1PVOA 3ZO5B 5T8IA 1K83B 2F1MA 2JP1A 3CCRA 1TU2B 4ZRPA 5KEEA 4CJ0B 1NY4A 3PLUA 1PGAA 3DBRB 3P42A 2KZRA 2K03A 4DV7L 4XDCA 3EGRA 2Z6KC 1KXLA 1SIJA 4DHJB 4ZKBB 4QQBX 2MHJA 1QWYA 3IKJA 1EO6A 3A5UA 1I6VC 3EFCA 2UYZB 1K8MA 4A3BG 2HDMA 3L2PA 1ILQA 4UHVA 3B0AA 3AE5B 2DNCA 4ZYNA 5IA7A 2GBKA 1K0SA 4P6VF 3KLWA 2ON8A 1I4HA 4K7UA 3B2FA 4GSWA 1JQYD 3U9SA 3ZQ4A 2JA5G 1S3SG 3PPAA 5G3LD 1MG8A 3CCQA 1YJ1A 2GN5A 2M00A 2MO0A 4CJ2C 2YEPB 1QNKA 4IFDJ 4GOPA 4X3SA 3S15H 5CC4A 2BB5A 1B3AA 3GE8C 5DM73 4HJGE 2REXA 4K6LA 2UUAQ 2NVTH 5I4DA 2VH1A 3AFQA 2VZKB 1RYJA 5KRUA 4JVZA 3UINB 5D3DA 4JI5Q 4LUVA 1PTOC 4DGZA 4DK3C 3RZOB 1PFMA 4LWCA 4A3DG 3NVWA 4MJSA 4HPPA 3ZDMC 3HVDA 3Q24A 4V190 1V9JA 4L1BA 4C4VA 2UXBQ 5FO9B 1RHPA 3VYTA 4EZJA 1YBYA 3DCGA 5CBEE 5IE8A 4URKA 1U4PA 5EKLA 2MBQA 5DCNA 2LMCB 3M7GA 2NBUA 3GTLB 1JRPA 1CZGA 2E2IB 1MD2D 4OWXB 1XLOA 2XN9C 1UWMA 4JBKA 1IL2A 5ELEA 4OWWB 1IBXA 5KNDA 4YWKA 3V6EB 5IGEA 5C0XI 1PGBA 3HKSA 4MIUA 1NUCA 4OGQC 3KW5B 5C1ZA 2A74C 3V96A 3OIPA 4E6IA 2I07B 1EQQA 3SGIA 4JWSC 1L6VA 4MH0E 3VR2A 3OAWA 1KHIA 4K8JA 4A3MG 1FJGL 2ZTDA 2CQOA 4HIDA 4P74A 1CA5A 2JA6B 2LFIA 4KSLC 2N9LA 1HEZE 3KQ4A 5C2TB 1WF9A 4IPCA 4DR2Q 5BYSA 4NXML 1Y1VH 2NN6G 5HURA 1N60A 2QC8A 3A9JB 3PTFC 4K7SA 1BKBA 3ONAB 4GLAC 4BY1G 1QZHA 3PV0A 3DOWA 4DWFA 4AS1A 2C60A 2F0TA 1XEEA 2GLSA 3B1LX 1QT9A 5IOCA 5KNBA 4GB9A 4TVAB 1E1TA 3Q22A 2AUJD 2B3GA 3Q8DA 3EJIA 1E3PA 2ZXOA 2VQFQ 3CPWA 4CBVA 1V1OA 5F2DA 3U30A 4TRDA 4DAMA 4F7XA 2DYOA 2GBRA 4A75A 2LMCA 1VQFA 2FAZA 2H89B 3KF8A 2LHEA 4A3JB 3BINA 5TSSA 2F0LA 3S15B 4UAIA 4DKAC 3PGEA 4P75A 3UE1A 5E6NA 2B29A 1RFAA 2EKEC 1HNWL 4C3HG 2JE6I 1YOVB 4XQNA 2K25A 5C3XA 5GMVA 1VZ7A 2KHWB 1XMOL 1IBMQ 4M1UB 5I2YA 1V86A 4O42A 1GC7A 4LF6Q 4ZK9B 2ZXRA 1HZ9A 1M4VA 1MPEA 4NJCA 1P9DU 1FM0D 2CS4A 4JI6Q 3ITPA 1TKWB 3HOVH 2LGIA 2I5LX 1VDZA 2FXQA 2E5LL 1NENB 2R92H 1J8IA 4LUOA 2GRIA 3E0JA 1RF2D 2PTLA 3G4SA 2N1VA 4ANUA 3MXNA 1TY0A 2X6GA 4MGYE 4OEMB 1STBA 2V4DA 3CCJA 1S72A 3MEFA 3GV3A 4A93G 2JZZA 1WFQA 2FCNA 3C3LA 1KRSA 1D5ZC 1SYBA 3AB9A 2WGSA 3NY5A 3MTSA 1YIJA 1TZ1A 1WY8A 1GB4A 4DR5Q 3BY4B 1P7FA 2BYVE 1YZ6A 1VJKA 3CU7A 4OELB 2E6XA 2ZVNA 4JX1C 4DV4Q 4LNNA 1GPXA 4DK6C 2ZCBA 2IZVB 1ET9A 4KKUA 2WXKA 3HOZG 3D4WA 3J80i 2Y5BB 4DR2L 3E9HA 3ZKJC 3UGBB 1YN4A 1WXSA 2INCC 2D2QA 1U4AA 1HR0L 2K39A 1E0ZA 4ALPA 1E2ZA 1E2VA 5EAYA 3HIZA 5M5WH 1AP0A 1T5XD 1IYJB 4NKLA 1EFID 1N5WA 1X56A 1I5FA 1S5BD 3I3CA 4B3TL 4HCPB 4WJNA 3ERQA 2CU3A 4MELA 3NHEB 2WXFA 4IFDH 1TIFA 1L4ZB 1C1YB 4YWLA 3VUYA 5JHBA 3A7AB 3C1FA 2UXCL 2EELA 5IYCG 5AJ3Q 3VTVA 4N8X1 4ZUIA 4HCSA 4UP8A 3MTNB 1UE5A 2JA6G 1LTGD 1EUVB 2EZVA 4XYOA 4FF1A 1MSHA 3TMEA 2B63H 2ID0A 2K3UA 2KAJA 2KC1A 2NPTA 4BKSD 3FHWA 3DWAA 3KYHC 1CSPA 5CR3A 1DJRD 1IBML 3TUOA 4LF9Q 1PH4A 3AULA 3GD7A 3EA6A 3NQTA 4LAAA 4HJ7A 5DNFA 2QA4A 3BZKA 2KTFA 3H9DA 3J81c 1GM5A 1EIHA 1TBEA 1HUNA 1SYGA 4HEDA 5GROA 1FPYA 1BCPB 3AV8A 4XT1B 2MX2A 1UE6A 4NAMA 5I2XA 3K5NA 1V6EA 2Q5WD 4BKGA 2HHHQ 3F1ZA 2KMMA 4N8FA 3SHQA 1WTRA 1YJ9A 3BYYB 4BY7H 4USAA 4EFOA 5EPKA 1UE7A 2F0SA 1HE8A 4FF3A 2EQSA 4A3IB 2O6VA 5BR8L 2AKWB 1TIID 3KBXA 4XXEA 1QVFA 4Y52H 2RPQA 2WDVB 1XQQA 1D1KA 1SFOB 4LK0M 3RYTA 1KM7A 2G9DA 1OO9B 2EYOA 1VQMA 1KH0A 4GXBA 4HK2A 4A3OA 1IBKQ 1XMQQ 1EYGA 1NVID 3R3OA 2KTRB 2UU7A 1FNVA 1F9JA 1NBWA 4DK1A 2LEKA 1ESRA 4DV6L 3PIPA 2B2VA 3K9OB 2NZ1D 3S2DH 4LFCQ 1Q1OA 4B9XA 2VQEQ 3GTQB 3QJZA 3R7RA 4KD3A 4HJ5A 1JOKA 5IT9L 2MUYA 3TEXA 2DJFC 4UY8C 2NUCA 1EEFD 2VB2X 3V61A 2MA9B 2D11A 4KHPL 1DOKA 2IYDB 2IPKD 2BDOA 3QWZB 3VH3B 2JA5B 3S2HB 2KUMA 4KJNA 1A6XA 2BBCA 3IT6B 3GTKB 4I6PA 2PMZE 4ZRQA 1AARA 5IP7G 4X3TA 2CWAA 3VQIA 3KJPA 1YNJC 4ZOHC 1I50H 3I9V1 4MH8A 4MGKE 1N33L 3AMZA 1MIUA 5C4XH 1SAPA 2D62A 3GTOH 3R93A 5IP9H 2B3AA 4GN4B 3GTMB 2Z0EB 3ZTCA 4FO2A 1D3ZA 2F3VA 3SHLA 2CKHB 2Q2TA 3JVZX 5L95C 1AW7A 2BW2A 1L4DB 1EOTA 1FXAA 2N9EB 2YEPF 4ICVA 1C4CA 2ZM6L 3HOYG 1WX9A 2PLPA 3QARA 1KAAA 3KUDB 1U4MA 1KAWA 3U8ZA 2AWNA 2J4XA 2K5PA 1GC6A 3S9WA 3UI3A 1JJ2A 3NEMA 4FBJB 3PRPB 4S17A 3W1SC 1Y1WH 2W9NA 2WXHA 2FHTA 5M3FG 3RZDH 1M8AA 4DNRB 2DZJA 2OWOA 3WAOA 1TWGB 3L3OC 2ZJQA 2NVQB 2EYJA 3NHHA 4NB3A 4BBSH 4C3JH 3APDA 1PMRA 2JT4B 2ZTCA 1MJCA 3AQQA 5C4ZA 2CKZB 1GKHA 4A3EG 5M5YB 4A3GH 3BZCA 4R8IA 1FO4A 2I5HA 1GAQB 4IUMB 3BIID 4B3MQ 1XPRA 3GTGH 3J80E 3C2PA 1JB3A 2FJ2A 4WWPA 2J0JA 2KNBA 3L4PA 2Z0DB 4M8NA 4K2KA 1ZW7A 1WRDB 2UUBL 4PMBA 4K0KQ 2BS2B 3DBLB 1HTQA 4DDGD 1HUMA 3GDEA 2WV6D 4IJLA 5I9OA 1WI0A 1F2RI 4HROA 4JI8L 3RUIB 3KDFA 1C76A 2K32A 4FVMA 1HZAA 4A3CH 3AE3B 3V62A 5C5MA 1NCVA 5FO7B 1JC7A 4R8NA 4B3ML 1OQRA 4HJKA 4RM9A 4DR7Q 3NVZA 1Q7YC 1VQGA 2M1MA 2WIIB 1P0RA 1H9KA 2UUCL 1UF0A 2DBYA 4XDXA 4XZ4A 1C4AA 1F52A 1WCMB 5FKAC 3ULJA 2G4DB 1WCMG 1FYCA 4KZ0A 3LXFA 4LNFA 4OHJA 2ZCCA 4HDQA 1GXDC 1YITA 1LXDA 2J53A 1XWEA 4ANWA 5MPOA 2K52A 1P98A 4S3SA 3B2GA 2QDLA 1V43A 3MJ5A 2WXOA 4YIJA 2ZPNA 4Q5VA 2FCSA 3DXJC 3WANA 3Q3OC 1UWVA 2WAQG 3CCUA 2MQJA 5C23A 3K81C 3ZIMA 3K7AH 3WALA 1QKZA 4KY7A 3T56B 3K5LA 2W55A 4NMZA 1LM8B 2CW0D 3D3RA 1Q10A 2KQSA 3FKYA 2QSDA 5DLQE 3EROA 1XTCD 5FO8B 1NDDA 1XPUA 3IBEA 5EGTA 1OQQA 2WFWA 2J0MA 4N9TA 4KIKB 1JCKB 2JA9A 4F87A 3AU7A 1WE6A 2OEDA 3BJUA 3SR1A 3ML8A 4OZAA 3SD5A 1JROA 1RL2A 3UIPB 3WAPA 4C2MH 1VQEA 2EE1A 1CJEA 3HOWB 4BA2I 1ASZA 1NE3A 2C35B 3FILA 1SE3A 2YTVA 1Q1BA 2KHSA 2XIWA 4RF1A 1SBBB 4B6WA 3E6ZX 1HPCA 2B2WA 1SSNA 1J8CA 1NBFC 5CV6A 1N9WA 4F8CB 1ET6A 3KJOA 1LYLA 2SOBA 2EY1A 1QE6A 4PS3A 2AUKA 3PIP3 3UDFA 4LW1A 3ULPA 3J7YW 4JI5L 1L6UA 3AFPA 5JVG3 4PZ8A 4M8AA 4CDFC 2FIDA 4PT5A 3W3AA 2HDLA 4L5RC 4JI8Q 5FLXE 3CCSA 4W9JA 2CJOA 2RD0A 4OONA 5M9OA 2DGYA 3K6OA 1RTOA 4GS3A 5JZEB 1VQ9A 3Q8AA 2LKVA 2JXXA 5IGCA 2E3TA 5BN4A 4GN5A 4DV3Q 4KZCA 2K50A 3PS6A 1VQOA 4H44C 4MEMA 5KHOA 1N34L 2D9UA 1VQ6A 2OXPA 1L1OC 4JOIA 4YY3Q 4MZ9A 1EFWA 4DR4Q 2ZJDA 4RKLA 4IUNA 4AQYL 2VL6A 3I4NB 4KV6A 4II3B 1PH2A 3JW0X 1TJEA 3UDGA 1UGJA 1VD2A 2PE9A 3KUZA 4WH4A 2BH2A 4K8IA 4NP5A 3NUCA 4KVGB 1NMFA 1QUQB 1H4RA 4YWMA 1TWCH 1FJGQ 1EF5A 4EQ5A 5D94A 3WAMA 5JJLA 2FNJB 1EIYB 2D10A 1YN5A 4FXGC 2RCFA 1RODA 3RZOH 1JQ4A 3QAQA 2KCCA 3GTLH 3AM9A 1XNQQ 3KF8B 2JSOA 3CMAA 4K1RB 3K7UC 1UEAB 2UXDQ 1V1QA 4YXDB 1II3A 3OTOQ 1NEKB 2M17A 3DLLA 1F9SA 2KOLA 2ASQA 1G51A 1HR0W 4NQLB 3KH0A 1O80A 1TS2A 2F0FA 3RZWC 3TZDA 2ICIA 3DBHI 1D5XC 5EKKA 3S1MH 1Z2MA 4R3DA 1WGGA 4HCNB 3CHBD 3GTPH 5D2MB 4MTKA 4TSSA 4QCLA 4GU2A 1QJOA 3HP3A 4DR6L 2LI5A 2UXDL 4DXFA 3M3YB 5K36H 4K7WA 4KTAA 1DGJA 3H0GB 3IRBA 3N52A 3EC8A 2LGXA 2WACA 5J3BA 2DAJA 4M01A 4JI7L 2PPHA 3BVMA 3OSOA 4XYCA 2Y3AA 1TS5A 3ONSA 4DA2A 1G8ZD 1YHAA 5IO9A 1A2TA 3F2CA 3R66C 3ZDTA 4PG3A 4X3KA 2C7NB 2KD0A 2J7ZA 3SR6A 1ZXHA 3JC66 5KNCA 2JA7G 1ZEQX 2E2HB 2AWTA 5IOIA 2BYFA 4P73A 4FADA 2AQ2B 1A3VA 2G4SA 1H8CA 1CA6A 3HM3A 3ZNZB 3DHIC 4AYBG 1KDCA 1WVLA 4YTNB 2QF7A 3J81j 1SXTA 1YEZA 3Q8BA 3ZW3A 3GV6A 4AQYQ 4NXMQ 2L1AA 3AB5A 1EQTA 2PKOA 3N3KB 3T13A 5ELFA 4A3JH 3N30A 3DBHB 3P2BA 1UE1A 2EMSA 3AE1B 3DBSA 2ASBA 1PA6A 1WYGA 3L54A 2K5QA 2L4NA 3CC4A 1ZOYB 3RLOA 4K81A 2W3RA 3Q3MC 4E74A 3ERSX 3H94A 3SK6A 1I7HA 3H1UA 5GAEC 3PUWA 3KK7A 4JI4L 3I4LA 3M95A 4LF4Q 4AUQC 2X8XX 1B8AA 4IM2A 2YYZA 1A3TA 5I6WA 3E5SA 5C3EB 1F2RC 4XWTA 3OYYA 3M4YA 3S2AA 5EDSA 2KWCA 2R2OA 1QZGA 2H88B 2LJ5A 3TS2A 2J7QB 2KMAA 5E4XA 1AE2A 3SXHA 1IBXB 3TCAA 1QG7A 1V1PB 4KSKC 4YTPB 2ZNVC 3TS0A 1M1KC 4XQJA 2EYHA 5J1ZA 2O6VD 2R2QA 4X6AH 2V1CC 4LF7L 2E74C 1OXTA 1I4PA 2R3ZA 1VZ8A 4KX6B 4P71A 3IL8A 1HZCA 1LTSD 1X3FA 1AH9A 3DVNU 3H0GH 5JEAH 4ZUJA 2C9OA 2J0KA 2LUMA 1XXGA 4JGHB 2IX0A 2R93B 4HIKA 3A9KA 5AZGA 2V9HA 4HMIA 3W1BA 4JL9A 4RF0A 4QY7A 1JJCB 3MZ5A 2K5HA 2DZKA 3S2DB 4X62Q 2M8SA 2KA7A 5HGQA 1X9NA 2C5CA 3AE4B 3M4OH 4MT5A 3PHXB 1U0LA 4JYAQ 4A3FB 1WE7A 5E7NA 2KO3A 1CZPA 3LNNA 2WXLA 3IFDA 2CHZA 1PHJA 3L0OA 5G2NA 2KQ4X 2PZTA 1U5KA 1WR6E 1ONLA 1SYCA 4DV4L 4ZLTF 1J9OA 1PH1A 4BOZB 2X6LA 1K50A 3CPFA 1SNCA 2C7HA 1TS4A 1RD9D 1PFNA 3M9BA 3U4EG 2KACA 4R1JA 3KUPA 1B4OA 3A1QB 3X3NA 2F03A 2UUBQ 4Y7NH 2ACZB 1XCQL 4MSQB 1B44D 1HXYD 4WJOA 2BE5C 1Q0WB 2ZJPA 1DOYA 1Z9FA 4WFN3 1MSGA 3ETRA 2NWGA 1SMXA 4JI4Q 4CYEA 2K8HA 3RUZA 3Q0AA 4XX5A 2KWDA 4IFDI 2INDC 4KN4C 4P2CB 3CF6E 1EIFA 4NQKE 1L0VB 4AIMA 1D5MC 4MHEA 5GADC 1FMAD 1AN8A 2ZJRA 1SE4A 2KFJA 4WWOA 4R4CA 1XYIA 2F3WA 1L7YA 1C77A 3IAYA 3HOWG 4B3RL 3H6MA 1GHKA 3MVVA 3MXGA 3P7JA 2R7ZG 4BBSB 3U7DA 3NUHB 5KYLA 3RULA 4A3EH 1PFDA 4K5WA 4LFAQ 2YV5A 1OTRB 1PZJD 5CTRC 2PEAA 3SDLC 5M5YH 2HTHA 5JVH3 3T1HL 1EWYC 3GOEA 2PIAA 2IHFA 4MJSB 2KENA 2W54A 1FD6A 1L2FA 1HA5A 1N8RC 2WU2B 2R61A 5M3MG 1X1MA 1IZ6A 4H02A 5M5XH 4A3DB 1K53A 4LDTD 4A3KH 1K8OA 4UP9A 3Q14C 5BYRA 4HLEA 3KOJA 2M56B 3WOEA 3FP9A 1DZ1A 3CW2C 3LX0A 5H92C 3ABVB 2NBWB 2OJWA 4JV5Q 3RMKC 2RGFA 4CJ1B 3VR5A 5IGBA 1EY8A 1K8AC 4OZBA 4A6QA 4DUYQ 1IBLL 1PDQA 3HOXB 2L8JA 2F0UA 4IOIE 4LF8Q 5AFWA 2KDFB 2F4VQ 4A3LH 3A33B 2F0JA 1BBXC 2EXZA 4BKTA 1O78A 5BN5A 3VR6A 2E2DC 1FVIA 3U58A 3ZJVA 5GAHC 5ELOA 1RAXA 3E0EA 4C7YA 2RDGA 2BVCA 1UH6A 4HRSA 3NK9A 1ZXTA 2V3NA 4YHHL 3EIVA 3NP8A 3A9JA 2WXJA 2MBBB 1WTVA 3P4SB 1AFPA 4JLCA 2B2UC 2HT1A 1I6HB 4B3SL 4IW0A 1I6HH 2V3SA 4EZKA 4JIOU 3K5MA 3BZDB 3NS8A 2N9KA 2DENB 2D3GA 1EZ8A 1CKNA 5DEHA 3BVGA 2ENBA 5LL6X 1TS3A 1M90C 2K05A 1XMQL 1G6ZA 1KNEA 1EWHA 3RNCC 4DV3L 1DCZA 4FULA 2ZNVB 1S5DD 1U9RA 3TEHB 2B2TC 2R7ZH 2PYKA 3PRZA 4PYZA 3U52E 5I9PA 3J7AV 1DONA 5GQOA 1ZDVA 3VRBB 4HIOA 2BWES 1VQ8A 4XTCS 3B9JA 4GLSC 5CHWA 1A0IA 1YNJD 3L9AX 5D7GA 5EKIA 4A3PA 4IDIA 1DM0B 4PZ6A 3RLNA 4DK5A 1A5RA 3MXPA 4IC7B 1KQSA 5KYIA 1Z47A 3SDZA 1EY9A 4X57B 3PUVA 4JI3Q 1T6BX 2NMQA 5G5GA 2LVQA 1Q8KA 4TKOB 4BXXH 1MHXA 4Q0FA 4C1NK 1TWAB 2K14A 1W6JA 4LFBQ 4KJOA 4EQPA 4GNXA 2DN8A 3L17A 3PGZA 4DR3Q 3E3XA 1S4ZA 2XVSA 3BU2A 3V6CB 4RGMA 3I3TB 5IYCH 1NMGA 1VQ4A 1ICWA 4H13C 3WOFA 1AZPA 4K0KL 2GI9A 3J80c 2SNMA 2F4VL 1P3QU 1Y1VB 1FEHA 2BA1A 1N6ZA 3H7PB 1YD8U 4WWMA 4N9PA 5CYUA 4HIMA 1WGKA 2M4NA 3CCEA 1B53A 5IODA 4HWIB 1XO3A 3GTMH 1FXTB 3M4PA 1E6EB 1GUTA 4NJ6A 3FMCA 4DR7L 4JI6L 1KJTA 4GNXC 4A3FG 1DD2A 4JG2A 5CV9A 2VZAA 3MXUA 3DBRI 3GS2A 2EPBA 1YNXA 1EQRA 2M2LA 3P1HA 3TN2A 2Q2HA 1KRHA 2G1EA 4J6IA 1N62A 4OW0A 5IN7A 4X66L 1PRTF 4KLKA 5D6JB 2MWSB 1BBWA 2K5DA 5AUKA 3FAHA 1QNUA 5EPJA 2R93G 2LXKA 5M3MH 5ISRA 2PW7A 5GXGB 3S1NH 3VR9B 3HOZH 5T1GA 2K22A 1NSNS 4RFBA 4DV0L 1HNXQ 3S17H 1J7CA 1ISNA 1LTBD 4IJHA 3DWQA 3I7FA 1PH6A 2I38A 1S1QB 2WX1A 4DR5L 1K0RA 2NBVB 2GBNA 3ZRCA 1TWHB 2K75A 2WP9B 2B8GA 1PZKD 3FPUB 1VQKA 2IGDA 4HXDA 4I6NB 4ZRIA 1HH2P 1A63A 2B39A 3HFZB 4DR4L 2Y5PA 1EF1A 1R4NI 5BMGA 1V81A 1K52A 1P1AA 1NAPA 1DOLA 4ZAIA 4JI2Q 1HA6A 5EPLA 5CGKA 1EIGA 2R92G 3W5UB 5CV5A 3NRZA 1M94A 1W2BA 1TT5B 5EE3A 2BYEA 2K6QA 3T9LA 2V3PA 4GLVB 3Q8FA 4LF4L 5G55A 2EJMA 4P16A 1PTOF 3I8ZA 2CW0C 1PH3A 3U2SC 3VYSA 2XGTA 3GTJB 5HI1A 1WSPA 4JI2L 2WLBA 2MP1A 2OQKA 3BK2A 1YJIA 3VUXA 1F2LA 3PZ8A 1STNA 4ODGA 3F8TA 3O13A 4W9KA 4N6EB 5CORA 2AL6A 2G3QB 1JE5A 2N88A 1FFUA 2Z4HA 4BFRA 4GIVA 2HQLA 1RRBA 3GZNB 3OJ4B 4OXPA 3S2HH 2KX3A 3CRKC 2CHXA 5I6YA 1HHVA 3D6WA 1IPGA 1SMYC 3W1SA 4L8JA 4HJ8A 4RMFA 4IUUA 1AWDA 3L10B 3HOZB 4ZCKA 3EECA 1KD1C 1TWCB 2JUOA 3EVQA 3VRAB 4KN7C 1F9QA 2F4IA 2YU9H 2NN6I 2KLGA 4DBGA 2EDGA 1MKHA 4YHHQ 2IGHA 2HD3A 2K8BA 3H0GG 4BS9A 5JEAG 1EYCA 1TR5A 4A3MH 3AE2B 1E0BA 1F2YA 5AUIA 1PTOH 2I46A 1SE8A 4GN3B 1GUSA 1BNZA 2BCOA 4NW2A 5CBAE 2MBEA 3MC9A 4TUUA 3RZFA 3C19A 2CWPA 1PGXA 4GDKB 3P75A 1V1PA 1VMCA 3I4MB 2JSVX 1O7YA 1WXAA 2EY2A 3HVZA 3K59A 2ZEQA 3WIMA 4QB4A 1LM0A 1OGWA 1R7SA 4X3UA 3CC7A 1ZE3D 2BGFA 1K3BC 1UGMA 4M0WA 2KK8A 3ZTDA 3S16B 1BR9A 2OTLA 4NZLB 3DPDA 2EJFC 1XTDA 3FPPA 2OHFA 2M9VA 2RDBC 4LJPB 5JEAJ 4ZRKA 3VA5A 2JQOA 3D6CA 2CHWA 3FKIH 1Y14B 3NZSA 4X62L 3K8AA 4CDDC 1L1OB 1JALA 4CO7A 2M19A 1KOTA 3HHMA 1HNZQ 1N61A 1E10A 4A3JG 1WR1A 4AWJA 4WIPA 5DPRA 1JWMD 2DNFA 5A2QE 3RNAC 3ZXRA 4G7ZC 1RDPD 3TP7A 2PVGC 2KDIA 1B3QA 1OTCA 2AEHA 2JPHA 5BR8Q 4DAYB 2L5TA 3PLVA 4IOCA 2IWHA 1HNZL 3AYHB 3FKIG 1WJJA 4BY1B 4N9F4 3RN5A 1WMHA 1F9PA 1ILPA 2O2VA 4DR3L 1KABA 3EBEA 1R4QB 2XWJB 4A9AA 3CKIB 4QL5A 3AECB 1PH7A 2Z1CA 3HM6X 5EE1A 1I50B 2JF5A 1PYWD 1G291 3AXCA 2QHOA 4DQOC 1PTOB 1V8CA 5IWAL 1D6EC 1P8LA 2Q2UA 4MSMB 1BBUA 3NENA 2VXWA 3AEEB 2LHDA 4HVBA 5K36G 3GQBA 5T1IA 1LABA 3PCOB 5G3LF 3QWNA 2WDTB 4B95A 3K5OA 1WJNA 4K5VA 1E9MA 1UAPA 1K51A 2B2YC 2EYPA 1PH5A 1MGSA 5A2QL 3L7ZC 3PQIA 3D32A 2LUEA 1WZ0A 4DV0Q 4KHZA 3Q3NC 2ZXPA 2KDBA 1C4PA 2FBWB 2JYTA 5DAUA 4DV6Q 4DXGA 3G7LA 4A90A 4LTUA 1Y56A 4A55A 4IUPA 4MTNA 3K9PB 2PCFB 1YJJA 5J17A 3FVQA 3M63B 4ANVA 1MI0A 1H9JA 2CQAA 4PMWA 1AEXA 3U50C 4O0AA 5EBCA 3R7QA 5JOBA 1DGSA 3CRLC 1UZXB 4QUFA 1C0AA 1EWCA 3URYA 1IKMA 4F1SA 1JWUD 3KLRA 1B2TA 2LGDA 1D2BA 5HFYA 2Q8RE 2QGQA 1ZP0B 2Z6BA 5COYA 3RMHA 1FRRA 2KVMA 2MO1A 1VQ7A 2PW5A 2QCPX 5FR3A 4G50A 1EY4A 3ZNGC 2GMIC 2NZOA 4A3CG 3U4ZA 1MG4A 1WXVA 3CSTA 4EOYA 1EY6A 1XCTL 4M02A 1BF4A 2B2YA 4LNKA 4JI3L 5CX3A 3BG3A 4FDBA 2OTJA 3KFUA 3DM1A 4LUZA 1Y8NB 4DXAB 4DV2Q 4FXKC 3S14H 1WD0A 2MSED 2KJHB 3TJPA 2DX5B 3CP0A 2IO0B 1JICA 1SDFA 5D3IB 2VB3X 3T16A 4A3EB 4A3GG 2CH4W 3Q23A 2YVCA 5EE9A 2RA4A 3VYUA 3P63A 3T1YL 1QF6A 3UQAA 2KQ7A 4KHPQ 1X32A 1X54A 3A74A 2DZMA 3I5JC 4C3JG 4REZA 2JQRB 1B1ZA 5AEKB 2RDHA 4GDKA 2OJRA 3H8HA 4KGSA 5LMNL 2L1BA 1WGRA 3C1EA 3Q6SA
chains in the Genus database with same CATH topology
1CK1A 5KIXA 2OT2A 3HKZB 4HCEA 3T3OA 1A2UA 1STHA 2JEBI 3I73A 2V0GA 3TP6A 5BN3A 5FLXL 5E1FA 3HEJA 4HKZE 1BOSA 2WAQB 3SE0A 4UDUC 1FRDA 1QOFA 3KWVA 4H0LC 5HG2A 2PW9A 1C78A 4N59A 4OIJA 4DN4M 4B0MA 1CTMA 3PUYA 1F0ZA 4CKEA 1GHJA 3NQIA 2AQ3B 1F9RA 3FRPB 4WORA 2F0IA 3AEGB 2WNMA 4KY5A 3AH7A 1SNQA 2SEBD 4RGTA 3TBIB 3H3VC 3PMFA 2HTME 4KKJA 3HG9A 2G9HD 2EYMA 4RHRA 4KD4A 2NTSA 3NZ3A 3S17B 2VZKD 3IAS1 3HZXA 1XLNA 1MHHE 2F0WA 4WURA 2DLBA 1ACCA 5A35A 2LJIA 3I90A 3BYTB 2WU5B 2KEEA 5E3FA 3MP9A 1U4RA 2MEKA 2F0OA 3AEBB 4KKSA 3FDTA 3Q8CA 3P1MA 4ARCA 2GB1A 3SFEB 2PVOD 2RVLA 4XDDA 1ZDXA 1EY0A 3SK8A 2WQYB 5C0XJ 2WDQB 1AYFA 3FILB 3E9SA 3BDCA 1G2SA 5E6JA 1HFNA 4KGTA 1BDOA 3W9CB 1IGDA 4YTMB 1HTLD 4BA1I 4XIGS 3BWUD 3MFGA 2E2JB 2B63B 1H9MA 1IHZA 3U9OA 1I4QA 2A5HA 2H4OA 1C48A 1FR3A 1BUIC 1DOIA 1MVKA 1TZOA 2HCCA 1I4GA 1SF0A 4G57A 5BYQA 4JPSA 1BCPD 4R9WA 3HOVB 4IN3A 1JWSD 1XX8A 4PQXA 4MM3B 1YNTE 3RD4A 3I70A 3S1MB 1V97A 4CHTB 2WXIA 3TEWA 3E56A 1HTPA 1ML0D 1LT4D 1W6KA 4H2AA 4B08A 3BS1A 3MWYW 1LT5D 3VA7A 2IX3A 4JE3B 2A69D 4C3IB 3SK4A 4XE0A 1DYQA 1NYQA 3OHXC 4KKIA 3I72A 2IW3A 2L32A 5CMDA 4CKBA 2Z4IA 4L6TB 2L9HA 1JOQA 2L0CA 3U7ZA 4ZKCB 2MJEA 1STYA 2V4IB 3A7LA 1WXQA 3TEZA 4HEA1 5EBDA 4KI0A 1Q8IA 4EQOA 4YWGG 1PRTD 4YT0B 3T4AC 1V8QA 3SFDB 5C4JB 4DU9A 1JMLA 2D5GA 1WD1A 3A55A 4A93B 1KLGD 4FF2A 2A6ED 3X3MA 3D4RA 4ZYSA 2TMPA 2PPBC 2K5WA 3M85A 4K5XA 3NBHA 2O5JC 2Y5CA 3RZDB 4J1MA 4Z9CB 2KN4A 1SJED 2A73B 3GTGB 1FIQA 1CZWA 2RPVA 2EY5A 4JK1C 3J81L 5LHY1 1I4XA 2IT1A 2KJXA 1R4PB 2AQ1B 5C6AA 3DUZA 1PRTB 3NE5B 2K01A 3SK5A 2XNAC 1VZ6A 1R9TB 3PO3B 2WXMA 4LMQD 1EYAA 4LLGM 3DWGC 1AZQA 1QCBD 5C3WA 1SEBD 4TMAB 4A3BB 4YSXB 2BYTA 4QMGA 3SVMA 3LB8C 3HUIA 1I4RA 2K33A 2NBFA 1LTRD 1RKNA 2EY6A 1BCPF 3AEAB 5BMIA 4RA8A 1Q3LA 5EE0A 3WDNA 1SNOA 2NTTA 2WKCA 1PXUA 2RQXA 2FUG1 4HKQA 1QOBA 1JORA 4MACA 4IUVA 5FOBB 1HFGA 1JWBD 4HMJA 3IT4B 1RWSA 3Q8EA 4L63B 4RAUC 4RGNA 1O7ZA 2SAKA 1U4LA 1LTAD 3PUXA 1IGCA 3DMUA 4RCOA 1LACA 3WCQA 2DWQA 3G6JB 2RDFA 1FNUA 3H91A 4DAPA 2M0AA 1OXXK 4XWWA 1OXUA 2DY7A 4GZYC 1H9SB 1A15A 4OO1H 1N5XA 2IL8A 4TQ0A 2EVBA 2RMMA 2B2TA 1LO5D 1X3QA 2LY7A 1G2TA 3P4RB 3J81E 3DEOA 2K0PA 1B9MA 3MA2B 4RGOS 3EUB2 3HRZC 2J52A 4KKTA 3LWUA 4L2YA 3EFXD 3NVVA 1Q1EA 2PZUA 2GA4B 1ZKOA 4I65A 2WB1B 1Y8PB 5IT9E 1Z7TA 3N9YC 3ZJUA 2I2YA 3BVZA 2KCNA 4O1NA 1CT1D 4J8QA 1PUTA 5LNK1 1ZUD2 2PQEA 3A8IE 4B0EA 1BCPC 3ND8A 2VNUD 1Y1WB 2WXNA 4QF4A 1HQRD 4ARIA 4C3JB 1ESFA 1SB3C 3NVYA 5M3FB 3AE7B 3OWFA 3KLSX 3T51B 2ZT9C 4NDXA 1VF7A 3GTPB 3QO2A 1CQFA 5E4WC 1EU3A 4J3OD 3ZJTA 4WRDA 1NYRA 5C0XH 1ZYRC 3HOUB 2BTEA 2KEDA 4HSVA 2F0EA 1BMLC 3DWMA 2SDFA 5DM63 2AX5A 3RFZB 2K04A 2K28A 1XLPA 1LLRD 2PMZB 1PFBA 1F77A 1IKLA 3PO2B 1IW7C 1LV9A 3V05A 1A70A 2MHVA 4B9WA 3J9CA 1KLUD 3OOCA 2L52A 1NR4A 3SEBA 3GO5A 4WAFA 3ND9A 2JYEA 2JXMB 1TQOA 1WTPA 2SNSA 2RBMA 4FXCA 1WTWA 3HS0C 4GDLB 2O5IC 3OMCA 1ZXIA 5CV8A 2RSOA 1RJTA 2YU9B 3ZYYX 1BXTA 3JAML 1N63A 1LTTD 4IQZA 2HDEA 3BDOA 2Q8TA 3BDLA 1L0YB 1STAA 4XYQA 1UWXA 4D2KA 3S1QB 1GJXA 4JBWA 5C44B 2JEAI 1FCLA 2WXQA 4U673 4H7BA 1VR9A 2DY8A 3A54A 4EGVA 4G7OC 1EQVA 2QIEB 1E7PB 1KDBA 3TZUA 2DNEA 2F0GA 1HZ6A 2QMTA 5J39A 3M7NA 3R8BA 1TWFB 2K7VA 3OWEB 3FKIB 1FFVA 1SYEA 3KWLA 5K5PA 4OZCA 1SSOA 2HUGA 4LJZC 4JWUC 2WP8J 1YNNC 3JAME 1OFFA 2MH7A 2NVTB 3T53B 1C79A 4HTHA 4ZHPA 1SYDA 1GUOA 2N55A 5CV4A 2IX1A 4RNAA 2K9XA 4ZHOA 4FXDA 1SNDA 4BWGB 1TYGB 3V3XA 2PO4A 2ICEC 5BMHA 4Q2JA 5MPOA 1SJHD 3OIQA 3V2TA 2R92B 3LYYA 2PMVA 4CQNA 1JOOA 1A3UA 5IGDA 4C80A 5D14A 4G7HC 1PZID 2X69A 1ENFA 2ZW1A 1RCVD 4IZ8A 2ZW0A 1SMYD 1QOGA 4K2LA 1Q90A 1EYDA 2QEJC 2K1BA 1BUVT 2W3SA 4IFDG 4XQQA 2NB0A 2FE8A 4C3HB 1X3PA 3AMUA 5M5XB 2LS01 4C56C 2EKIA 3H09A 2FMCA 5EQ0A 2KQ3A 1HZ5A 1TVXA 3IAM1 2O4XA 1WTXA 1JWAD 4I7ZC 2A68D 4US9A 2BS3B 1EL0A 2WXPA 3IFTA 2J0TD 4CKCA 5CV7A 4TQUS 1FGBD 2MJ8A 4A3MB 4DFAA 3Q69A 1QLBB 4OO1G 2BS4B 2B2VC 2JU6X 4F8MA 3NXWA 1YQ3B 1IYUA 3PZ7A 4IKGA 2K6AA 1STEA 2NVYB 4DAYA 3UI2A 2BDNA 3QOJA 3T3NA 5JAVA 1OXVA 3KLSA 2HQEA 1OXSC 2XSCA 2F0DA 1BO0A 2D5DA 2VUMB 4A8XC 1VRAB 1CM9A 1NR2A 1MBYA 1QB5D 3NWSA 1EZ6A 1Y8OB 2J42A 1S5FD 4N58A 2TSSA 1PRTC 3VR8B 1VLBA 3GB1A 1JE4A 1ROEA 1VMPA 1F2MA 4ID6A 5NUCA 2A6EC 4HN7A 4ABNA 4FYDA 3S1RB 5HHDG 4KK7A 2KECA 3PUZA 3W2DA 2NN6H 3OPOA 4MN3A 4Y7NB 1FNWA 4J6HA 1FCCC 3NBIA 5J22A 1P7EA 2WINB 1FXIA 1H9RA 2E76C 1IUEA 3NWTA 2BE5D 5M3MB 3J7AF 5D65A 4KGRA 4IALA 2O2LD 3TSSA 1DOMA 2RSNA 2BB6A 3R2TA 5EJWA 4DK0A 5IGFA 1YQ4B 3DEPA 3MHZA 1LTID 1SE2A 2L83A 2QDBA 2R7ZB 4EQNA 1DXMA 4C2MB 4WQMA 4K14A 2MPMA 2L12A 2EJGC 5C5LA 3PO0A 4A3GB 1EY7A 3A8JE 1QILA 4BBRB 2IJ0A 4RHSA 4EE2A 1KF6B 1XF5L 3OMGA 3TP8A 2EYFA 1GB1A 2B8FA 5JPNC 1KNAA 3HGBA 1GUGA 2INPE 5IIFA 1MI2A 1HQMC 1LT6D 1CHPD 2EOTA 5JJZA 1Y69U 3TDQA 2IGGA 1JW9D 1QOAA 4C7ZA 2L11A 2H1EA 2QKIC 5M5WB 2QILA 3GTOB 3P4QB 1TKGA 1O7LA 1CI3M 1YNND 2MGSA 1KTKA 4DAVA 1ZPSA 1RTNA 3D8GA 4RH6A 2BT6A 4F88A 1VF5C 1PLFA 1CFMA 1EM7A 3J80L 2QJLA 1FD7D 2A6HC 3VYRA 2W82A 3QG1A 4RKBA 3VR3A 4US8A 1TT2A 3LWEA 4G4KA 1J7AA 3HRDD 1RFKA 1QQRA 2HCIA 3DHQA 3QOLA 5G5HA 3KBGA 2JA8B 3TEYA 1PDXA 1BQQT 1T5EA 1G91A 5H8YE 4AQ7A 3CIRB 1STGA 2PZWA 2WXGA 2BA0A 2JX5A 1I3QB 5JPMC 4L23A 1T3QA 1NI3A 4NAWB 1WTQA 2IDYA 2A69C 3MC0B 3ZGZA 2L55A 4OIKA 5C3JB 1C8CA 1EU4A 2FINB 3BK1A 1Z6HA 3F2UA 3R2IA 3C46A 2WS3B 5LL6S 4OO1I 4HR7B 1HRJA 2B2WC 4C3IG 3AEFB 3MFYA 2A68C 3K57A 2FFKB 4QUCA 4FF4A 1GOZA 1ENCA 4DNTB 2F0NA 3NTKA 5FK9C 1E2WA 5HGTA 2Y0SB 1ZYRD 4DF7A 1D4BA 1RM6C 1KDAA 1LT3D 1EY5A 2WXRA 3S1NB 2PNRC 4PNYA 3IXSA 4OL7A 4BY7B 1TKYA 2B76B 2MJDA 2NYZD 1IW7D 3AE6B 3CWIA 2JYOA 3AE9B 1CQVA 3NTHA 3P20A 4ILWA 2Q8IB 3RPFC 2N7JA 2EYLA 2DYMA 5JXVA 1S5ED 3FC4A 3DWPA 3W5VB 3CQZB 3QB3A 1L5PA 4YSYB 1KFYB 1Q12A 2XWBB 3D4DA 1L0XB 2F0PA 4A3KB 1DOXA 4IUTA 3RLFA 3FEWX 5ELBA 3A56A 2N0SB 3A8KE 2D2CC 1B9NA 1YMHE 4LK1C 1QOHA 4ULLA 1F2ZA 4PMCA 4AYBB 4EVOA 1CHQD 2RKSA 3GP7A 4RCNA 4IUQA 1UUPA 5C4XB 4KMUC 2JA7B 3AEDB 4ZRZA 4QIWB 3I91A 1XLQA 3MEHA 4IURA 4ZQ3A 2XRSD 1GUWA 2MJ3A 1ENAA 2WDRB 3NTIA 3QJYA 5C4HA 2F0HA 3S14B 4FP5D 2ONQA 1C9FA 2INNE 2NVXB 4K6DA 4KY6A 2CVRA 1SYFA 2X38A 3NSWA 1B50A 3QIAA 3MAQA 1WWTA 4HSPA 2F0QA 1GUNA 1H9SA 2BOSA 2WKDA 2KDMA 2FMMA 2F0MA 4HAEA 5ELDA 1IL8A 3VR4A 1HCZA 1JR0D 1EEID 3N6RA 2OEOA 4RWSC 1PTOD 3TP5A 4YSZB 1IYVA 1B9RA 3AE8B 5IGGA 3PIO3 5KGUA 4C1NI 4TQ1A 1TKEA 1SNPA 1WTOA 2JZPA 3AN1A 1C4QA 4FNFA 2F0KA 4V0BA 1TY2A 2AWOA 2CHBD 1UNSA 4WJWA 2F0VA 3K0YA 4CGYB 1WRIA 4PV1C 4XT3B 2CJNA 4ME5A 3K58A 2Z8LA 3C8YA 3NS1A 3EQLC 2R6GA 5C0XG 1VDVA 2LFNA 3MHBA 1D1IA 2JXTA 2A6HD 3NPPA 4U68A 4KHVA 3K7AB 2B2UA 1J7BA 2JWUA 2OF1A 3I57A 3P4PB 3D31A 1YN3A 2E75C 1SNMA 2XRQD 1S5CD 5ELCA 4OVZA 3HOYB 3OW7A 3M4OB 4ITKA 1VCIA 5T8IA 1K83B 2F1MA 2JP1A 4ZRPA 1TU2B 5KEEA 4CJ0B 1PGAA 3P42A 2K03A 4XDCA 3EGRA 1SIJA 4ZKBB 1QWYA 3IKJA 1I6VC 1K8MA 2HDMA 1ILQA 3AE5B 2DNCA 4P6VF 2ON8A 1I4HA 3B2FA 1JQYD 3U9SA 3ZQ4A 5G3LD 2M00A 4CJ2C 2YEPB 1QNKA 4IFDJ 4X3SA 5CC4A 2BB5A 1B3AA 5DM73 4HJGE 4K6LA 5I4DA 2VZKB 1RYJA 5KRUA 5D3DA 1PTOC 4DGZA 3RZOB 1PFMA 3NVWA 3HVDA 3Q24A 4V190 4L1BA 5FO9B 1RHPA 3VYTA 5CBEE 1U4PA 5EKLA 2LMCB 3M7GA 3GTLB 1JRPA 1CZGA 2E2IB 1MD2D 1XLOA 2XN9C 1UWMA 5ELEA 1IBXA 5KNDA 5IGEA 5C0XI 1PGBA 4MIUA 4OGQC 1NUCA 2A74C 3V96A 3OIPA 4E6IA 2I07B 4JWSC 1L6VA 3VR2A 4K8JA 1CA5A 2JA6B 2LFIA 2N9LA 1HEZE 3KQ4A 5C2TB 5BYSA 2NN6G 5HURA 1N60A 3ONAB 3PV0A 4AS1A 2F0TA 1XEEA 1QT9A 5IOCA 5KNBA 3Q22A 2AUJD 3EJIA 2ZXOA 4CBVA 1V1OA 5F2DA 4TRDA 4F7XA 2DYOA 2LMCA 2H89B 3KF8A 2LHEA 4A3JB 5TSSA 2F0LA 3S15B 4UAIA 4C3HG 2JE6I 4XQNA 5C3XA 1VZ7A 4M1UB 5I2YA 4O42A 4ZK9B 2ZXRA 1M4VA 1MPEA 4NJCA 1FM0D 3ITPA 1TKWB 2LGIA 1VDZA 1NENB 1J8IA 2GRIA 3E0JA 1RF2D 2PTLA 3MXNA 1TY0A 2X6GA 1STBA 2V4DA 3GV3A 3C3LA 3AB9A 1D5ZC 1SYBA 3MTSA 1GB4A 1P7FA 1VJKA 3CU7A 2E6XA 1GPXA 4JX1C 1ET9A 4KKUA 2WXKA 3D4WA 1YN4A 1E0ZA 1E2ZA 1E2VA 1AP0A 1T5XD 4NKLA 1EFID 1N5WA 1S5BD 3I3CA 3ERQA 2CU3A 2WXFA 4IFDH 1L4ZB 3A7AB 3C1FA 2EELA 4ZUIA 4HCSA 1LTGD 2EZVA 4XYOA 4FF1A 1MSHA 3TMEA 2K3UA 2ID0A 2KAJA 5CR3A 3DWAA 3TUOA 1DJRD 3GD7A 3EA6A 3NQTA 4LAAA 5DNFA 1EIHA 1HUNA 1SYGA 4HEDA 3AV8A 1BCPB 4XT1B 4NAMA 5I2XA 3K5NA 2Q5WD 2KMMA 1WTRA 3BYYB 4USAA 5EPKA 2F0SA 4FF3A 4A3IB 3KBXA 1TIID 4XXEA 2WDVB 1D1KA 1SFOB 2G9DA 1OO9B 2EYOA 1KH0A 1NVID 3R3OA 1FNVA 4DK1A 2LEKA 1ESRA 2B2VA 2NZ1D 4B9XA 3GTQB 4KD3A 1JOKA 5IT9L 2MUYA 3TEXA 2NUCA 1EEFD 2VB2X 1DOKA 2IPKD 2BDOA 2JA5B 3S2HB 2KUMA 4KJNA 1A6XA 2BBCA 3IT6B 3GTKB 4ZRQA 4X3TA 3VQIA 1YNJC 4ZOHC 3I9V1 4MH8A 3AMZA 1SAPA 2D62A 3R93A 3GTMB 4FO2A 2F3VA 3SHLA 1AW7A 2BW2A 1L4DB 1EOTA 1FXAA 2YEPF 1C4CA 2PLPA 1KAAA 1U4MA 2AWNA 2J4XA 2K5PA 3UI3A 3S9WA 2WXHA 2FHTA 1M8AA 4DNRB 1TWGB 3L3OC 2NVQB 2EYJA 3NHHA 1PMRA 5C4ZA 5M5YB 1FO4A 4R8IA 1GAQB 3BIID 3J80E 3C2PA 1JB3A 2FJ2A 3L4PA 4K2KA 4PMBA 2BS2B 1HUMA 2WV6D 5I9OA 1F2RI 4HROA 1C76A 2K32A 4FVMA 3AE3B 5C5MA 1NCVA 5FO7B 1JC7A 4R8NA 1OQRA 3NVZA 2WIIB 1H9KA 2DBYA 4XDXA 1C4AA 1WCMB 5FKAC 1FYCA 3LXFA 4OHJA 1GXDC 2J53A 1XWEA 4S3SA 3B2GA 1V43A 3MJ5A 2WXOA 4YIJA 4Q5VA 3DXJC 1QKZA 4KY7A 3T56B 3K5LA 2W55A 4NMZA 2CW0D 3D3RA 1Q10A 2QSDA 3EROA 1XTCD 5FO8B 5EGTA 1OQQA 4N9TA 1JCKB 4F87A 2OEDA 3AU7A 3SR1A 4OZAA 1JROA 2EE1A 1CJEA 3HOWB 4BA2I 3FILA 1SE3A 1Q1BA 2KHSA 2XIWA 4RF1A 1SBBB 3E6ZX 1HPCA 2B2WA 1SSNA 5CV6A 1ET6A 2EY1A 1QE6A 2SOBA 2AUKA 3PIP3 3J7YW 1L6UA 5JVG3 4M8AA 4PT5A 3W3AA 2HDLA 5FLXE 2CJOA 5M9OA 3K6OA 1RTOA 3Q8AA 2LKVA 5IGCA 2E3TA 5BN4A 4H44C 2D9UA 2OXPA 4RKLA 4IUNA 3I4NB 4KV6A 1TJEA 1UGJA 4WH4A 4K8IA 4NP5A 3NUCA 1YN5A 4FXGC 1RODA 1JQ4A 2KCCA 3AM9A 2JSOA 1UEAB 4YXDB 1II3A 1NEKB 1F9SA 2KOLA 1O80A 1TS2A 2F0FA 3TZDA 2ICIA 1D5XC 5EKKA 4R3DA 3CHBD 4TSSA 4QCLA 1QJOA 3HP3A 5K36H 4DXFA 3M3YB 4KTAA 1DGJA 3H0GB 3N52A 2WACA 3BVMA 3OSOA 2Y3AA 1TS5A 4DA2A 1G8ZD 1A2TA 4X3KA 2J7ZA 3SR6A 1ZXHA 5KNCA 1ZEQX 2E2HB 2AQ2B 1A3VA 1CA6A 1KDCA 1WVLA 4YTNB 2QF7A 1SXTA 3Q8BA 3GV6A 2L1AA 3AB5A 1EQTA 2PKOA 3T13A 5ELFA 3AE1B 1WYGA 2K5QA 2L4NA 1ZOYB 2W3RA 3H94A 3SK6A 1I7HA 3PUWA 3KK7A 3I4LA 2YYZA 1A3TA 5I6WA 3E5SA 5C3EB 1F2RC 4XWTA 3M4YA 2H88B 5E4XA 3SXHA 1IBXB 1QG7A 1V1PB 4YTPB 4XQJA 2EYHA 5J1ZA 2E74C 1OXTA 1I4PA 2R3ZA 1VZ8A 4KX6B 3IL8A 1LTSD 5JEAH 4ZUJA 2C9OA 2LUMA 1XXGA 2IX0A 2R93B 4HMIA 4RF0A 3MZ5A 3S2DB 2KA7A 2C5CA 3AE4B 4MT5A 4A3FB 2WXLA 1CZPA 3LNNA 3IFDA 2KQ4X 2PZTA 1ONLA 1SYCA 4ZLTF 1J9OA 2X6LA 1K50A 1SNCA 1TS4A 1RD9D 1PFNA 3U4EG 2KACA 3KUPA 1B4OA 3X3NA 2F03A 2ACZB 1XCQL 1B44D 1HXYD 2BE5C 1DOYA 4WFN3 1MSGA 3ETRA 2NWGA 3RUZA 3Q0AA 2KWDA 4IFDI 4KN4C 4P2CB 1L0VB 1D5MC 4MHEA 1FMAD 1AN8A 1SE4A 1XYIA 2F3WA 1C77A 3IAYA 3H6MA 1GHKA 3MVVA 3MXGA 3P7JA 4BBSB 3NUHB 5KYLA 1PFDA 4K5WA 1PZJD 5JVH3 1EWYC 2PIAA 2W54A 1FD6A 1HA5A 2WU2B 2R61A 1K53A 4A3DB 1K8OA 5BYRA 2M56B 3WOEA 1DZ1A 5H92C 3LX0A 3ABVB 4CJ1B 3VR5A 5IGBA 1EY8A 4OZBA 4A6QA 1PDQA 3HOXB 2F0UA 4IOIE 5AFWA 2F0JA 1BBXC 2EXZA 1O78A 5BN5A 3VR6A 2E2DC 3ZJVA 4C7YA 2RDGA 4HRSA 3NK9A 1ZXTA 2V3NA 3NP8A 2WXJA 1WTVA 3P4SB 1AFPA 2B2UC 1I6HB 3K5MA 3BZDB 2N9KA 1EZ8A 5DEHA 3BVGA 2ENBA 5LL6X 1TS3A 2K05A 1G6ZA 1KNEA 1EWHA 1DCZA 1S5DD 1U9RA 2B2TC 2PYKA 3U52E 5I9PA 3J7AV 1DONA 3VRBB 1ZDVA 4XTCS 3B9JA 4GLSC 1YNJD 3L9AX 5D7GA 5EKIA 4IDIA 1DM0B 3MXPA 5KYIA 1Z47A 3SDZA 1EY9A 3PUVA 1T6BX 2NMQA 5G5GA 4TKOB 1MHXA 4Q0FA 4C1NK 1TWAB 1W6JA 4KJOA 4EQPA 2DN8A 1S4ZA 2XVSA 4RGMA 1AZPA 2GI9A 1ICWA 4H13C 3WOFA 2SNMA 1Y1VB 1FEHA 2BA1A 4WWMA 4N9PA 5CYUA 1WGKA 1B53A 5IODA 1XO3A 1E6EB 1GUTA 3FMCA 1DD2A 5CV9A 3MXUA 3GS2A 2EPBA 3P1HA 2M2LA 1KRHA 3TN2A 2G1EA 4OW0A 1N62A 1PRTF 2K5DA 5AUKA 3FAHA 1QNUA 5EPJA 5ISRA 2PW7A 5GXGB 3VR9B 5T1GA 2K22A 1NSNS 4RFBA 1J7CA 1LTBD 3DWQA 2I38A 1TWHB 2WP9B 2B8GA 1PZKD 3FPUB 2IGDA 2B39A 2Y5PA 5BMGA 1K52A 1NAPA 1DOLA 4ZAIA 1HA6A 5EPLA 5CGKA 1EIGA 3W5UB 5CV5A 3NRZA 5EE3A 2V3PA 3Q8FA 2EJMA 4P16A 1PTOF 3I8ZA 2CW0C 3U2SC 3VYSA 3GTJB 5HI1A 1WSPA 2WLBA 2MP1A 3BK2A 1YJIA 1F2LA 3PZ8A 1STNA 4ODGA 3O13A 4N6EB 5CORA 2N88A 1FFUA 2Z4HA 3CRKC 5I6YA 1HHVA 3D6WA 1SMYC 3W1SA 4L8JA 4IUUA 1AWDA 3HOZB 1TWCB 3EVQA 3VRAB 4KN7C 1F9QA 2F4IA 2NN6I 2EDGA 2IGHA 5JEAG 4BS9A 1EYCA 1TR5A 3AE2B 1E0BA 1F2YA 5AUIA 1PTOH 2I46A 1GUSA 1BNZA 2BCOA 4NW2A 5CBAE 1PGXA 4GDKB 3P75A 1V1PA 1VMCA 3I4MB 2JSVX 1O7YA 3HVZA 2EY2A 3K59A 4QB4A 1R7SA 4X3UA 1ZE3D 4M0WA 3S16B 1BR9A 4NZLB 2EJFC 3FPPA 2OHFA 2M9VA 5JEAJ 3VA5A 3D6CA 1JALA 2M19A 1E10A 1N61A 4WIPA 1JWMD 5A2QE 4G7ZC 1RDPD 3TP7A 2PVGC 2L5TA 2IWHA 4BY1B 1F9PA 1ILPA 1KABA 1R4QB 2XWJB 4A9AA 3CKIB 3AECB 2Z1CA 5EE1A 1I50B 1PYWD 1G291 4DQOC 1PTOB 1V8CA 1D6EC 2VXWA 3AEEB 2LHDA 5K36G 3GQBA 5T1IA 1LABA 5G3LF 3QWNA 3K5OA 4K5VA 1E9MA 1UAPA 1K51A 2B2YC 2EYPA 1MGSA 5A2QL 3L7ZC 4KHZA 2ZXPA 1C4PA 2FBWB 2JYTA 5DAUA 4DXGA 3G7LA 4A90A 4LTUA 1Y56A