1XXGA

Crystal structure of staphylococcal enterotoxin g
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
233
structure length
227
Chain Sequence
b'QPDPKLDELNKVSDYKSNKGTMGNVMNLYMSPPVEGRGVINSRQFLSHDLIFPIEYKSYNEVKTELENTELANNYKGKKVDIFGVPYFYTCIIPKSEPFGGCCMYGGLTFNSSENRDKLITVQVTIDNRQSLGFTITTNKNMVTIQELDYKARHWLTKEKKLYEFDGSAFESGYIKFTEKNNTSFWFDLFPKKELVPFVPYKFLNIYGDNKVVDSKSIKMEVFLNTH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords enterotoxin
publication title The Crystal Structure of Staphylococcal Enterotoxin G and binding affinity to T-cell receptor and MHC class II molecule
rcsb
source organism Staphylococcus aureus
molecule tags Immune system
total genus 61
structure length 227
sequence length 233
ec nomenclature
pdb deposition date 2004-11-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01123 Stap_Strp_toxin Staphylococcal/Streptococcal toxin, OB-fold domain
A PF02876 Stap_Strp_tox_C Staphylococcal/Streptococcal toxin, beta-grasp domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.110 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1xxgA02
3.10.20.120 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1xxgA01
2AQ2B 1DYQA 1EEID 1RDPD 3W2DA 1TS4A 1T5XD 2G9HD 1MD2D 1PZID 1V1OA 1M4VA 1EFID 2TSSA 1I4RA 4TSSA 1GOZA 1UUPA 1PRTB 1LT4D 1YN4A 3BVGA 1LO5D 3R2IA 1CHPD 3V05A 4RHRA 1TS5A 1CQVA 3DWPA 1EU4A 2CHBD 1LT5D 1ET9A 1FNVA 1QILA 3BVMA 3MFGA 4UDUC 4DXFA 3R8BA 1XXGA 3TSSA 1LTAD 3URYA 1D5MC 4C56C 4L63B 2RDGA 2Z8LA 1B44D 2J4XA 1ET6A 1PTOD 1FNUA 3BYTB 3SEBA 1YN5A 1PYWD 1SJED 1JCKB 1BCPB 1UNSA 1TS2A 2NTSA 1PZKD 1V1PA 5TSSA 3EA6A 1I4QA 3BVZA 3BYYB 1DJRD 1ESFA 2R61A 1FGBD 3OWEB 4OHJA 4RGMA 1I4GA 1S5ED 1STEA 1PRTD 4RH6A 1HXYD 1PTOH 1SE2A 1D5ZC 1CT1D 1S5CD 2XRSD 5FKAC 3CHBD 2QEJC 3DWAA 4BWGB 1CHQD 1I4PA 1KLUD 1PTOC 1RF2D 1LTBD 2XNAC 1CK1A 3BZDB 3KLSX 3O13A 1TY2A 1D5XC 1TS3A 4RGTA 5ELFA 4NZLB 1SBBB 1YN3A 1FNWA 1LLRD 4RFBA 1PRTF 1BCPC 2QILA 5ELBA 1RCVD 1PRTC 1BCPD 1S5FD 4RHSA 5ELEA 1JR0D 4DXGA 1RD9D 2AQ3B 2NTTA 1ENFA 1S5DD 1S5BD 4RCOA 4L6TB 4ZYSA 1JWSD 1HQRD 1JQYD 1PZJD 2IPKD 1SEBD 1SE3A 1EU3A 1JWUD 1SE4A 2XN9C 1PTOF 1FD7D 3DWQA 1HA5A 1I4HA 2SEBD 5ELCA 2IJ0A 2O2LD 5FK9C 1EEFD 1I4XA 1D6EC 4Z9CB 3R2TA 1SXTA 1JWMD 1TY0A 1KTKA 1L0YB 1BXTA 1LT3D 1LTRD 2WV6D 1SJHD 1V1PB 1BCPF 1LTTD 1F77A 2RDHA 2AQ1B 3MC0B 4RGNA 1XTCD 2ICIA 1HTLD 1AN8A 4K6LA 5ELDA 5D3DA 5D3IB 1LTSD 4O1NA 1LTGD 3EFXD 1LTID 5I4DA 1EWCA 1G8ZD 1L0XB 1AW7A 3GP7A 2XRQD 1PTOB 4RGOS 1B1ZA 1LT6D 1KLGD
chains in the Genus database with same CATH superfamily
4R4TA 4JPBW 1AP0A 4A3BH 3PIP3 1MKHA 3BZKA 3K0XA 1XT9B 3B0AA 2CHXA 3S2AA 4EE2A 2A74C 2K5QA 1WE7A 5AUKA 1AYFA 1ISNA 2IDYA 2AUJD 2M19A 2RDBC 2NWGA 4C3JG 1YJIA 2KMMA 3BDCA 3EUB2 3NWSA 1EOTA 3Q3MC 3PRZA 2IL8A 3SR1A 1ROEA 2O6VB 3KJOA 1NVID 4NAWB 2QSDA 3ZVVA 2G1EA 3M9BA 4GIVA 3F8TA 4A93G 2K25A 1EU4A 1GB1A 1ZXHA 1AZQA 3QIAA 1WTQA 1ESRA 3BVMA 3MFGA 4JOIC 4P71A 4BKSD 4FLHA 1PQSA 4R1JA 2NBFA 4NQLB 4EZLA 2ZVNA 1EF5A 3ITPA 2OXPA 5C3EH 4HEA1 1EF1A 2IYDB 4DV2L 2F4IA 4I6NB 3SEBA 4JI0Q 3J81L 5C5MA 1WSPA 4LF7Q 4A3JG 1BCPB 3RNUA 2EMTA 1JRPA 4W9KA 2MJ3A 1R9TB 4NAWA 3DCGA 4YY3Q 3IFTA 4QGUA 1JB7A 2N9PC 3IAM1 1GKHA 4DK0A 1JOOA 4O42A 4IOIE 2BOSA 1G2TA 2X6LA 2LS01 2MSED 2PNHA 2V4IB 4USAA 4YL8A 3A5ZB 1SE2A 2MP1A 4GKJQ 4GDKB 1EM7A 1LGRA 4X3KA 3NZUA 4X66Q 5FOBB 4MDKE 1BNZA 4DR2Q 4QY7A 1WTRA 1B7YB 1D7QA 1N32L 2X8XX 4OWWB 3NE5B 1EFWA 1NI3A 1YEZA 4GKKL 3A0JA 4YHHL 1QNKA 3O13A 2ZM6Q 1PH9A 4RKBA 4AP4C 4JI7Q 2DYOA 3VYUA 2UU9Q 2N0SB 2V3NA 2WX0A 4PS8A 4RMAA 4AJYB 4R9WA 1EY8A 2O2VB 1VQ8A 1XO3A 1O78A 2YLMA 3G7LA 3TRZA 1S40A 1UAPA 2QILA 4LFBQ 1VJKA 3H09A 2MEKA 4QUFA 3VA7A 3RN9C 5JHBA 1SNPA 4FF3A 4TQUS 2K39A 5CV8A 2PI2A 3NP8A 2KDBA 2PPHA 1JR0D 3RT3B 2EKEC 2F0HA 3QB3A 4AJWA 2BE5D 4YSXB 5AEKB 2WXIA 1JB3A 2HIVA 2ZVOA 1JQYD 2VS1A 1B3AA 4LMQD 3CMAA 4JIOU 2KLCA 1JJ2A 3A7AB 4B0MA 3D31A 4X57B 4TQ0A 3DWQA 4IJHA 3K0YA 4GNXC 5M3MB 5JEAG 1TR5A 2OEDA 3ERSX 5IP4D 1TGZB 1AE3A 3AV8A 1C4QA 3T8MA 1BBUA 1TY0A 4GS3A 1R9TH 1TXYA 3RN5A 1EL0A 4QMGA 4HCNB 1LTRD 3L3OC 5IYDG 2Y0SE 3I72A 1FXAA 3TZDA 1VQPA 3PO3B 4HDOA 2KHWB 3I56A 1K50A 1P7FA 4GOCA 1C9FA 5CHVC 1VS0A 2MP2A 2NYZD 3CRKC 2YYZA 2H88B 1J7AA 3Q8BA 1OEYJ 1GO3E 4KTAA 5D2MB 1Q12A 4X3TA 2DYMA 2M8SA 2F3WA 3RD2A 1YZ6A 3S24A 1VQ7A 1OQYA 2E3TA 4BBNC 1EWCA 4DKAC 1XPOA 1UD7A 2WXLA 3N3KB 3ULLA 3AE5B 4YTMB 1JORA 1LT6D 4LFCL 3I7FA 3CCLA 1JWBD 3DVNU 1G2SA 4NXNL 1HRJA 1OXTA 2DJGC 1SR3A 1RHPA 2G9HD 3LNNA 5JVG3 4ZHPA 1YHAA 1KRTA 3A74A 1HR0Q 4OO1I 3MFYA 1EIGA 2CS4A 4RKLA 4CKCA 3PRMB 1LABA 5IE8A 1LO5D 1VMCA 1WZ3A 3T9LA 3ZNZB 1Y1VB 1YITA 2NVQH 3WWVA 3CF6E 1CQVA 2EZVA 2CKHB 4G57A 1T9HA 1V49A 2DJFC 3FKYA 3T13A 4C4VB 1ASYA 2ON8A 3GE3C 5DM73 3TSSA 2JA5B 5M3MH 1Y1WG 2BF8B 4UP8A 2K6AA 3DWMA 2KK8A 4MH0E 4ANVA 3A8KE 4ZK9B 4GB9A 3CRLC 3T1YQ 2BA1A 2UUCL 2VRRB 3PGZA 3S1NH 2IO1B 1IHZA 5FLXE 4DR5L 3LGJA 2A8VA 4G7HC 3DXJC 4MSMB 4DR6L 2JA9A 1E7VA 4NKLA 1JJGA 3VTWA 1OXUA 4OGQC 5M5WH 3NRZA 1U4AA 1AE2A 1FO4A 2R61A 4XYOA 1HTPA 5LXIB 3NBHB 2WAQG 1S5ED 2E76C 1JWAD 4C4VA 1Q1BA 1RTNA 2KCCA 1RAXA 5KHQA 2KTRA 2WB1G 1S5CD 3HOXG 2VH1A 1K3BC 1PDQA 3DBLI 2RA4A 3GZNB 3VFKA 4JI3Q 3GTJB 3BIID 3PLUA 1XPRA 3KUCB 2WKDA 4P1CC 2JK8A 1PH7A 2BGFA 1KLUD 1YMHE 3PVLA 1F9QA 1VZ8A 1IW7C 4A75A 1WRIA 1RF2D 3FEWX 4G11A 3AEVA 3UIOB 3RFZB 4C00A 2PNRC 1Y56A 1E22A 4KDIC 1LACA 5C4XG 4P73A 1U0LA 1EUJA 3HOZB 2IWHA 2L1BA 5MPOA 1IGDA 1GPXA 2F0WA 2LRWA 3BJUA 3VR4A 3AQQA 2ASBA 3IAS1 3SHLA 3NBHA 3TDQA 1T6BX 1RODA 2B8FA 3QG1A 3UDIA 4DUZQ 1DONA 2EYHA 2ZJRA 3S2HH 2KEEA 2QF7A 3A56A 2JA7B 4PMCA 2SNSA 3R7QA 4HSVA 3I4MH 4WJWA 2C9OA 1WMHB 3AECB 3AFPA 1PFBA 3I57A 5C3JB 1KNEA 3NWTA 2WXNA 3SFEB 2JP1A 3I4LA 2LY7A 4WRDA 3HOYB 3ZW3A 2NN6H 3KUZA 2IJ0A 3GTOB 4II3B 1E8ZA 4R4CA 4JYAQ 3U8ZA 2Z9HA 1OEYA 5EE9A 5EDSA 1E2WA 4QB4A 1EY9A 1OQQA 5H92C 3W1YA 3FC4A 4KGSA 3W5UB 4KHZA 3APDA 1FMAD 3H15A 2BCOA 3B08A 4EQPA 4U68A 3CWIA 1BKBA 2KO3A 4KIKA 2EJFC 2FHTA 1VF7A 1R4PB 2H89B 1Q46A 2PYKA 5AZGA 3NJTA 3OW7A 2K5NA 4LK1C 4KJNA 3U4ZA 5GAEC 2IBIB 2MH7A 3RUIB 4O1NA 3AE7B 1T5EA 5I4DA 4BY7B 3K9PB 2FCMA 2F0LA 2KA7A 3QJZA 3F2UA 3GP7A 4POGA 2YTXA 4XZ4A 1KLGD 4K1RB 2AHOB 2JZZA 2VW9A 3AE1B 2F52A 1WR1A 1MJEA 4C3HB 4Y7NH 4KHPQ 1AZPA 1BO0A 2RHQB 4YT0B 4J8QA 2LUEA 1YN4A 4N9F4 3HOUH 3F2DA 4K2KA 1R4MI 3M95A 3VA5A 2JA7H 2W54A 1HFGA 3JSVB 1KDBA 2B2VA 3SDZA 5EE1A 2NS5A 5HGQA 2EY2A 2G5DA 2GLSA 3D4DA 4BY1G 3H3VI 3ONSA 1U9RA 2EQSA 3URYA 3GTOH 2PEAA 1XWEA 3FDTA 3RYTA 1YNND 2L76A 4HJ8A 1PH1A 2G9DA 4JI5Q 2VZAA 4IQZA 2EY1A 3DVNV 2LGYA 3OOCA 1P8LA 4YTPB 3D6WA 5KNDA 1UNSA 1C3TA 1K3RA 2K6DB 2IY1B 2A68D 3CMMB 3B2GA 1K8AC 2JA6B 4XXEA 4HKZE 1ZE3D 4RG1A 1O7IA 2NVUI 3JSVA 4BY7H 1ZOYB 4FULA 4B3TL 1VQGA 4HJ9A 1YQ4B 1PRTD 2HCIA 1ZPSA 4HAEA 1EY6A 2B2YA 1KDAA 3HKZB 2A6ED 2IO0B 5GADC 3SDLC 4N8FA 3CHBD 4DUYL 3RUZA 4DV0L 2FINB 2QEJC 2FBWB 4BWGB 1WYWB 2UUCQ 1WYGA 2IO3B 3GTQB 4DR5Q 3AMZA 1L2NA 3HKZE 5CV6A 3KLWA 4C3HH 3MTSA 4B3RL 2R7ZG 1B9MA 2BYVE 4A3IG 4ACFA 4PYUA 3I3TB 1WGRA 1GD7A 3I4NG 3A7LA 3SVMA 4D2KA 2WS3B 3DVGX 1CKNB 2F4VL 1DD2A 1BCPC 2DX5B 3M62B 4IN3A 2RF4A 2L4NA 1PH8A 4MTNA 1S5FD 2JQRB 1WGYA 2NVTB 1U4LA 1A0IA 3VVWB 3Q24A 1VQ9A 5M5XH 4XWWA 3VTUA 1SE3A 3J80c 3AN1A 3VHTC 1VR9A 2F0SA 2I0QA 5ELCA 5EQ0A 3Q23A 3MHZA 1MHWC 4IW0A 4DR1L 1SXTA 4WH4A 3ZIMA 1L0YB 2JYEA 4H7BA 3VDZA 2JA6H 2WQYB 1V8QA 4LF6Q 3KWVA 4ULLA 1KHIA 3BWUD 3HZXA 4AUQC 1F77A 3VUYA 4W9HA 1TT5B 1E8YA 4C80A 4Q0FA 3NUCA 1B4OA 3L2PA 3P20A 5L83A 4DK3C 3PV1A 1UWXA 3A9KB 3MHBA 3P7JA 3PQIA 1MPEA 1QZHA 2L1AA 2OJRA 5IKCM 1WCMB 4JI2L 4GLSC 4K5WA 1SNDA 1L0XB 3Q6BA 4WWMA 3U50C 4JBMA 1SMXA 4K8IA 1K9MC 3VUWA 3PO2H 1DYQA 3ML9A 2IGDA 5JPMC 3ICEA 3TS2A 3KDFB 1MD2D 4HVBA 3E0EA 3E6ZX 4CKBA 5IGDA 2RCNA 2LMCA 1RWSA 4IPGA 3HOWG 4BBSG 2N7DA 4MGKE 1GHJA 1PLFA 4TSSA 1P98A 2V4DA 2KJRA 2NMQA 4W9FA 1UUPA 1X3EA 3I70A 1N60A 3QOJA 1VQOA 4HWIB 1ENAA 3PHWB 3RNCC 2WLBA 1V97A 1K73C 1U4RA 2RBMA 3CQZH 2NVTH 1X65A 4WJPA 4B9WA 3PF5A 4WQOB 1YJNA 5CTRC 5CYUA 1K8MA 3PIOA 2KJ6A 3KOJA 1ZXTA 2L12A 1VQMA 1V6EA 1KIXA 2V1YA 4QIWE 1RFAA 2F0VA 3HKSA 1N8RC 3CMEA 1CZGA 3H0GB 4ODGA 2ACZB 4R4OA 5IYBG 3DBLB 3WCQA 4HCEA 3WDNA 1CKOA 1X3GA 5M5YB 2KOXA 3KDFA 2N1VA 4HPLB 3WAPA 2KC2A 2BYTA 4DV6L 1LQBA 2N55A 1P3QU 4OO1H 1Q86C 4FJVB 3S15H 4DN4M 3CCRA 2JYTA 1IYFA 1VQDA 4GLVB 4FHJA 2KOLA 1HNZQ 4DV1Q 1SYCA 1VQJA 3BYYB 2ZTDA 2HHHL 2WXOA 1KH0A 4OW0A 3HVZA 1E90A 4V190 5LXHA 4OVVA 1V1QA 2M0XA 4IOCA 3F2BA 3NEMA 1Q10A 1BBXC 4KY7A 3J80L 3N20C 3ZKJC 3KLRA 3QX1A 5HI1A 2JU6X 2K5PA 5J22A 2QDBA 3VXWA 4KGTA 3K5OA 3Q8EA 2FUHB 4DNTB 1I5FA 2VQFL 2X6GA 1PGAA 4HMIA 2XK5B 5DLQE 1HFNA 4XE0A 4RGTA 3EVQA 2YU9B 2LKVA 2AL3A 3X0WA 3CW2C 1VZ7A 3PREA 4HR7B 1IUEA 1HTQA 1F2ZA 1YQ3B 5E3FA 1XPUA 3L54A 3W1BA 3L08A 2KWCA 2L0CA 2GOWA 2R93B 2M4NA 4YTNB 3DBSA 2N78A 4POFA 3KQ4A 2R3ZA 3HFZB 3CC2A 4OWXB 3S2DH 1Y8RC 1EZ6A 4P6VF 2VUMH 2NBVB 5M5YH 3OHXC 1VQKA 1SF0A 3WOFA 4DV3L 5M3FB 2KFKB 2N9EB 1SRUA 1K51A 1VZ6A 1YHQA 4WJ3M 1EY7A 1ZYRC 5IGCA 3M4PA 3HVDA 3AYHB 4A3GB 2RGFA 3AE3B 3WAMA 2D11A 3W1SA 4J6HA 2JA8H 3V6CB 1BOSA 1D2BA 2CFMA 5CBAE 2PE6B 4G50A 4BBRB 4A6QA 4F1SA 2OTJA 1WJJA 2DAJA 3A33B 2KLGA 1AN8A 4A3FG 3E9IA 2F0EA 1VCBA 4MGIE 3C3LA 3V60A 1WXAA 2DGYA 2BE5C 5C44G 5G5GA 1SIJA 1QOHA 1MHXA 4H44C 3DBRB 4IUVA 3TUOA 1YQBA 2LRUA 1WGGA 2KFKA 5ELNA 3UIPB 2MBEA 2JWZA 1RDPD 1SNMA 1J9OA 1XCQL 1ZDVA 3BINA 2LVOA 1ONLA 2B63B 4R4QA 5E6OA 3H6MA 1PH3A 4BXXH 3ZXRA 1QZEA 4XGAB 4LNKA 5C0XI 3ABVB 4XYQA 3QARA 4EZJA 1WTXA 3DOWA 4HKQA 2E2HB 3M3YH 1E3PA 2R93H 1UE6A 4K6DA 3GTMB 4P74A 4EQOA 3S1QB 3VR9B 1QVCA 5EPJA 2BDOA 4IC7B 5G2NA 4B9KA 1AEXA 1NMGA 4JI2Q 2Z0EB 3DHGC 4G0NB 4II2B 3TP7A 2ZPNA 5M3FH 1CA5A 1K52A 3NVYA 1E24A 3NSWA 3DDCB 2IW3A 4UP7A 3QHTA 4TUUA 4R8IA 1J7CA 4UAIA 1XMQL 3SGIA 4A3GH 4M8MA 4YCUA 3GV3A 2I07B 3DVGY 1B44D 4JG2A 5FO7B 5C5LA 3GTLB 4BBRH 5DPSA 5C1ZA 3ZRCA 1GJZA 2IHFA 1I4QA 1ZP0B 3T3NA 2C9WB 5IN7A 1MJCA 1STYA 4JQWC 1L0WA 1IBXB 1FCLA 2Z6BA 2CU1A 2MBBB 2O6VD 4MJSA 1GUSA 1YNTE 4AIMA 4H2AA 4K5XA 1D8LA 2FE8A 5IAAC 4EKUA 5IWAL 1H9RA 2B63H 4US8A 5A2QL 2D0PA 2K33A 2VL6A 1H4RA 2R92G 4DV6Q 1RLFA 2L7RA 2NVYH 3H94A 1UEAB 4IUTA 4XX5A 4AQ7A 3O65B 3CC4A 1LM0A 2E2HH 2I1JA 2N9XA 4IFDG 2QMTA 4A3MG 2F0UA 4TVAB 2D9UA 2MJDA 4EFOA 3SR6A 1Z5SB 2HHHQ 5CHWA 2PZUA 2Q2TA 2DBYA 5EBDA 3IVFA 4TQ1A 4P1BC 4RM9A 1BCPD 1TIID 3QCAA 3OW2A 2FAZA 4E74A 2AYOB 1HNXL 4KV2A 3VRBB 4A3CH 3D0FA 4KZ0A 1RTOA 1IL2A 2Y5BB 1JWUD 1IYUA 4H0LC 2DNEA 5IP9H 5HGTA 2SEBD 3AEBB 3KWLA 5KHOA 1WM3A 4IWPA 3RMKC 3KJPA 4GGQA 2K50A 2NN6I 2KDEB 4WJQA 3D8GA 4K8JA 1WR6E 5C4ZA 4A3BB 2CHZA 1IP9A 2HD5B 2N3SA 5GAHC 2PVOD 2YVCA 3W5VB 1T0RC 5C4JB 1WGHA 4MIUA 2NPTB 1WZ0A 5DNFA 1FXIA 4RAUC 5AJ3Q 1GUGA 1U4PA 1I50H 3PUWA 3T1HQ 4Y52H 2Q5WD 1CTMA 3IHPC 4DQOC 1NENB 3GZNI 3VR3A 5I6YA 4KX6B 1QVGA 3FILB 4DV3Q 2L05A 1PTOB 3VR6A 1SYGA 2BYEA 2LVQA 5GQOA 2M0AA 1TWFB 4AQYL 2VQEL 4LW1A 1I6HB 2R7DA 2RR9A 1GHKA 3RZOH 2WFWA 2ZTCA 4I6PA 1M4VA 4A3DG 1BQQT 1A3UA 4DR3Q 3PO3G 2FIDA 2Q2HA 1F2RC 2N7JA 4CDEC 2INNE 5KYIA 4DV7L 1S1QB 2PVGC 4A3EG 5IOIA 3V05A 1OGWA 1YD8U 4ZLTF 2K9XA 2M00A 4IUQA 3VR8B 4B95A 3MA2B 3J81j 4F7XA 2ASQA 4ZQ3A 4HIOA 1Y8PB 1QWYA 5AZFA 3V96A 5L95C 4YCWA 4JI1L 3NELA 1S72A 3R8BA 1TYGB 1QNUA 4DU9A 1K8OA 1CI3M 4C56C 2ID0A 3L9AX 2AWOA 2E2IB 3CCEA 4L63B 3DLLA 4NDXA 5JJIA 3EN2A 3D6CA 3L13A 1P16A 5C4JH 1EUVB 2KVMA 1SJED 1LV9A 3P63A 3P75A 3NVWA 4PS3A 4MGYE 2Y3AA 4HK2A 3C8YA 5TSSA 4C1NI 4OWTB 5A2QE 3EA6A 1RYJA 3P42A 2ZTEA 1Y1VG 3ZTDA 1RJTA 5E4WC 2J53A 2PIAA 1GXDC 1WTHA 1NY4A 1PA6A 1JMCA 3RNFC 5IGEA 1PTOH 3W1GA 1TKYA 1D4BA 2F0QA 3E5SA 5CR3A 2Y5CA 1N63A 2W3RA 2WXKA 5FKAC 4DAYA 1MIUA 3KBGA 1TWFH 2ALYB 2JA5G 4B3MQ 4ZOHC 4PT5A 2JN4A 1YNNC 1XMQQ 1I6HH 3Q2AC 4FXKC 3CF5A 3TEYA 3R66C 1GM5A 3P4PB 3RNEC 5IIFA 3HOVB 1HHVA 2BA0A 3D4RA 3AE4B 3JVZX 2ZXRA 2VZKD 4A8XC 2REXA 1VQAA 2PQAB 1D5XC 3TP5A 4W9IA 4IO9A 1J0GA 4XQNA 3TMPB 4KN7C 3GTGB 2A68C 2K1FA 2CCZA 1QE6A 1SNOA 5TR5A 1EQTA 4EOYA 1V86A 3R3OA 2GA4B 4FVMA 4DR7L 2O6VA 2WDTB 2MBHA 1C9OA 1MG4A 2BB6A 1PRTC 2MNAA 2DHZA 4YWMA 4DK1A 2KT7A 2A6EC 1NBWA 5DCNA 3V62A 1L1OB 1V43A 3TEHB 1JMLA 2E2IH 3EBEA 1B8AA 1KRSA 4A3KH 2IPKD 4F8MA 4HJ5A 4S0RA 1QT9A 1T0QC 2I5MX 5KNBA 2SDFA 1N33Q 4ZCKA 2OJWA 4I7AA 1HUNA 3EECA 4OEMB 3RLNA 4WAFA 2W55A 3CKIB 1ZEQX 5L37A 4ALPA 4PS7A 1ZYRD 3HOZG 4A3LG 4O0AA 3IFWB 2Z1CA 4DK5A 2OTLA 5M9OA 4WIPA 1LTTD 5C3XA 2RDHA 3DM1A 3W1SC 3FHWA 4GN5A 2FMCA 3QR8A 3MEHA 1FFVA 4LAAA 3NBIA 5EE3A 4B9XA 3AE2B 4K81A 3NXWA 4KV6A 3EFXD 2J52A 2QIEB 4XDCA 3VYTA 5IA7A 2K0PA 4GDKA 1G8ZD 1S3SG 2NVQB 1YJJA 2XRQD 1IXRA 1B1ZA 5EKLA 3HOVH 3H7PB 3HRDD 1Z9FA 4IPCA 3HOYG 3AEAB 4FF1A 1TZOA 3A54A 2Y0SB 1GVPA 2MPMA 4ZRIA 1A8VA 4YSZB 1TS4A 2FIFA 3GTGH 1PZID 1L0VB 3DHQA 1QLBB 3PIO3 1RL2A 3N1ZC 4KK7A 1DZ1A 2DZMA 3GQBA 2L83A 3S1NB 3R93A 1Z47A 2O2VA 3PUYA 4EX5A 2GN5A 3VYSA 3U2SC 4BVUC 3K9OB 3ZJVA 2A4ZA 3PF4A 1C8CA 2JZ3B 2HTHA 5M5WB 2KNBA 5JVH3 4M0WB 3WAOA 4BFRA 4UDUC 1ILQA 2H5XA 2I2YA 2NB0A 4CJ1B 1NTGA 4AQYQ 2VQEQ 2HE7A 2MWSB 5IYCH 4LF8L 4HCPB 1WXMA 2F3VA 4PZ6A 3UI2A 3H3VC 3AEEB 5D94A 4XDDA 3ZNGC 1ET6A 1DGJA 3SK5A 5IT9c 5FLMH 1BMLC 2F1MA 3TIXA 5C0XH 4HJAA 1TS2A 5IP7H 1X3FA 2HDEA 3H9DA 4BAXA 1WTVA 2DZKA 4G7ZC 3VRAB 4PZ8A 4B3SQ 2MBQA 1CM9A 3MVVA 4JI4Q 3AEDB 3J81E 4DDGD 4IM0A 2IZVB 2KQSA 4M0WA 1BF4A 4NJ7A 3CCVA 4DAPA 4FYDA 2JPHA 2HJ8A 5FO9B 1ZKOA 3FRPB 3ZYYX 2VZKB 3ONAB 3S2HB 1XD3B 3RCZA 2JE6I 5KNCA 4WWNA 3I4MB 2E5LL 1L6VA 1CSPA 2KN5A 4W9CA 4KY6A 2UYZB 1HE8A 3AU4A 1WI0A 4C3IG 2CJOA 2WU2B 4LTUA 1TS3A 4R4IA 4C3JB 1J19A 2NR2A 4GLAC 4KKUA 4KD3A 5J3BA 2JF5A 4ICUA 1TJEA 1RKNA 1D3ZA 4KD4A 4ZKBB 5JXVA 1WIAA 1UGJA 3M7GA 2ONQA 1T0YA 5J17A 4K3BA 3UGBB 2P5ZX 5DEHA 2QHOA 3PTFC 5C23A 5KIXA 2KWDA 4AH6A 5FJ8G 3GV6A 3MJWA 2K05A 3PSIA 4PV1C 2KENA 1VMPA 1SMYD 4IUPA 1IKMA 4DV2Q 3CD6A 2WXJA 3ER0A 2EOTA 5D14A 1Q3LA 1S3OA 1KTKA 3U4VA 2JZPA 2WP9B 1BDOA 4UY8C 1Z2MA 2V9HA 3I63C 4PK1A 4FNFA 2I46A 4JI6L 3NPPA 1HR0W 3MC0B 4DR7Q 4HRSA 2WWZA 2KACA 2ICIA 1N36L 4Y7NB 4HXDA 1QJOA 1E8WA 3BG3A 2L0TA 4P2CB 2IGHA 3IG3A 5DPWA 3HOUB 2IX0A 1QCBD 1QUQB 2BW2A 4IDIA 3RNAC 2MA9B 3OYYA 4NNJB 1WD1A 1C7YA 3D3RA 1N32Q 3A9JB 1YJ9A 1PFNA 4US9A 2MRPA 1N34L 1KM7A 1E10A 2SOBA 5JPNC 1QZGA 4GKKQ 3I4OA 4YHHQ 1F1HA 4C3JH 2HUGA 5IT9L 5EKIA 2F0PA 3FPUB 3KUDB 4OO1G 4L8JA 4S3SA 2J0KA 1LT4D 2CJNA 2PW5A 3B2FA 1KDCA 4HCSA 2UWQA 1Z6HA 1CHPD 5E1FA 3HUIA 1LT5D 1ACCA 1WCMG 4LDTB 2JRHA 4KSLC 3KK7A 2OWOA 2J0TD 4K14A 1WMHA 2QCZA 4OL7A 2MCNB 4GN3B 1GG3A 3A55A 4JVZA 1MFWA 1LXDA 4A3JH 2D62A 4APVA 3AEFB 1FNUA 2B2TA 1YN5A 2BB5A 4N58A 3RNBC 2SAKA 1PYWD 1PHJA 3AEGB 1JCKB 3AB9A 3C1EA 4GZYC 1C79A 3VR5A 5KEEA 2YTYA 2WNMA 5HURA 5CV7A 3TP8A 1NR2A 1F9RA 3OWEB 1WX7A 1I3QB 2L3ZA 1PDXA 2OOBB 3ZNID 4RH6A 2J7QB 3S9WA 1XEEA 1VF5C 3TZUA 4X3SA 3DBRI 2KBNA 5LL6X 1QVFA 3H0GG 2D3AA 2WXPA 2CWAA 1PUTA 4LFCQ 3AU5A 3DPDA 4LF8Q 1YNXA 1SSNA 3BY4B 1WE6A 4NXNQ 1PVOA 3E9HA 5I6WA 5LNK1 4LF4L 1TWGH 1B9RA 5M5XB 2R2OA 1NEKB 4X65L 1TY2A 4H02A 3MXPA 2BTEA 2N4FA 2ZNVB 2LXKA 4EVOA 2HD3A 4YCVA 2MO0A 4RMFA 4PMWA 2D10A 1Y8NB 3AM9A 4RM8A 1V8CA 1RCVD 2JRIB 2J0JA 4CJ2C 4DV4L 5K36G 1N6ZA 1DCZA 2MQHA 1DM0B 4IOAA 1FRRA 4BS9A 1TBEA 1O80A 4X6AH 1W6JA 2W3SA 3EFCA 1HCZA 2AX5A 2B2WA 3MXNB 3G6EA 1JWSD 3K8AA 4IPHA 4JI8L 4DV5L 3SXHA 4CDFC 5JEAH 1Y1WB 3AI5A 3FAHA 4ASWC 1HEZE 5NUCA 2QW7A 2N7EA 3MAQA 1VQFA 2DAFA 2WP8J 2O2LD 5IYDH 1MI2A 4MHEA 1Q82C 2K8HA 2NBUA 5JJLA 1UWMA 2B2UA 3PO2B 4DR6Q 2RPQA 1SNCA 1VQIA 3RN2A 1V80A 2C7HA 1I3QH 2E75C 2KFJA 1EOVA 4BXXG 1LFDA 3FKIB 4WQMA 3AULA 3KFUA 5ELOA 5IT9E 2ZW0A 2WAQB 1Y69U 4K6LA 3ZJTA 1UELA 1O7LA 3CQZB 2E2JB 1L4ZB 3Q6SA 2WB1B 3HOXB 2K01A 3J7ZC 3MXNA 1C77A 5COYA 1AW7A 2I5HA 1H9SB 3M4YA 2WAQE 3PMFA 3AE6B 5M3FG 1CUKA 3C2PA 1TZ1A 2FJ2A 5E4XA 2NZOA 4DDID 2GVAA 3GDEA 1JW9D 3T53B 2WB1E 1YJ1A 1E8XA 2KMCA 2L00B 4WJOA 2BPSA 4DAMA 1WX8A 2INPE 1M1KC 2A73B 4JI6Q 2JXXA 2BWFA 3CIRB 2LFNA 1IBLL 1N36Q 1CKNA 1WF9A 3GS2A 4J6IA 1YNJD 4B08A 1I94L 3OLMD 1UF0A 2WHIA 5LMNL 3S15B 4DGZA 1G6ZA 4B6WA 3CSTA 1GJXA 3AE8B 1H8CA 1XNRL 3PZ8A 2VY3A 1K83B 1Y1WH 1OXVA 1CZPA 1IBKL 1PH5A 3ZQ4A 1XLQA 3K81C 4JWUC 2F03A 1XXGA 4V0BA 2AEHA 2V3PA 3K7AB 4W9GA 4A90A 1N34Q 2XWBB 4IUNA 1S4ZA 2EMSA 3WA0A 2IHEA 2H1EA 1PH2A 5HY6A 2Q2IA 5BO4B 1V5TA 2D2CC 4ZDVA 2FCNA 2BH2A 2AKWB 1RFKA 1ZXIA 3SE0A 4WORA 2A19A 1XQQA 2IGGA 3KH0A 3FKIH 1UEBA 1NBFC 1I6VC 1NR4A 2IY0B 2KQ4X 2UU7A 1LTLA 4DBGA 3NK9A 1MSGA 3BVZA 4QIWB 2LUMA 2MJEA 1FGBD 2E2JH 1X1MA 3HOXH 1STNA 2RCFA 1X9NA 3GB1A 1WVLA 3A9KA 3ZO5B 1GUOA 2LVPA 2BBCA 1X3QA 4NQKE 1N5WA 1HNWL 1A3VA 1KL9A 3ERQA 2Z4IA 2HIXA 3K5MA 1E6EB 3VQIA 4UPAA 3S2DB 5DAUA 5C4XH 3R3MA 2VUMB 1X32A 4KJOA 2UUAL 2D5GA 4IM3A 2L55A 4G3XB 4C7ZA 4ID6A 2C5CA 1Q7YC 4QAYA 3TJPA 2LSSA 2DLBA 1KRHA 2JSVX 4PQXA 2F0DA 1EY5A 2ZCBA 4NMZA 1TIFA 2INCC 3I5JC 4TMAB 3BZCA 3C0RB 1K83H 2JA8B 1P0RA 2UXBL 4CO7A 1WJ6A 2GI9A 3Q0AA 2UXCL 2W9NA 2VB2X 5E7NA 1STGA 5ELEA 3K7AH 2KWUB 1Q8KA 3NVVA 2KCTA 2E74C 2NTTA 3QQ8B 1TWCB 4MN3A 1WH3A 2RHSB 1B50A 1DOLA 1WTOA 3F1ZA 1K8GA 3ML8A 4GXBA 1SE4A 2ZXOA 1GC7A 4AOFA 1PTOF 3IFDA 3EQLC 1JC7A 5AFWA 1CA6A 3RD4A 4CKEA 4JV5L 3JAMi 5CHFA 1L7YA 1Q1EA 2L15A 1J8CA 3DEOA 5BN5A 1O7ZA 4OX9L 1J7BA 1SB3C 2MW5A 3U7ZA 4ZYNA 1SJHD 2D5DA 3CCQA 1GUWA 2EYFA 4DR4L 2I5LX 3X3NA 2K3UA 1FL0A 4DHJB 4LNFA 1VQHA 4DV4Q 2ATWA 1UE1A 3KBXA 4JOIA 2PJHA 4B3TQ 1MI0A 3M3YB 1SYEA 1LTGD 4M02A 4JI8Q 4DUYQ 4DV5Q 2M1MA 2KDIA 4DV0Q 4LNIA 4HPMB 5GROA 2L52A 2F3IA 1V81A 1ML0D 1J5EL 4ZAIA 1FFUA 5H8YE 3OPOA 2JJQA 2CH4A 2DY7A 3RLOA 4B3RQ 2PPBC 4U673 2Q8IB 2R7ZB 2KAJA 4KVGB 4MACA 4A3IB 4A3BG 1EZ8A 3T56B 1PFDA 2XK5A 2N49A 1VQNA 2K5DA 3NOBA 3TREA 2ZJPA 2F4VQ 1WYDA 1X55A 4GMVA 3GTKB 4K2LA 2PCFB 2ZZPB 3RZFA 5I9PA 4A3OA 1TWCH 2QEXA 4BY1H 1QQRA 1V5OA 3DWPA 3U58A 2CHBD 2UXDL 1BT0A 2LHEA 3GOEA 3AU7A 1ICFB 3BK2A 4LFAL 4GNXB 3I90A 3GO5A 1NE3A 4N9PA 4KKIA 2F0KA 2EYLA 3AB5A 3NENA 1J6QA 3ECIA 3G4SA 1OFFA 1WJNA 4HPPA 4MEMA 3WIMA 2E6XA 2UUBL 4DR1Q 4W9EA 1PTOD 1AWDA 5T1GA 1FRDA 3LB8C 5C3EG 1QOGA 3RULA 1A5RA 4N9TA 4ICVA 4EZKA 1K28A 5EJWA 1P7EA 1WTWA 1MG8A 2HDLA 3S16H 2NVYB 1I94Q 3UE0A 4A76A 3RZDB 2K8BA 4LK0M 4AYBG 4CHKA 2N1WA 1TKEA 3K57A 2JT4B 2WU5B 1CT1D 4A20A 4ZRQA 1NUCA 2B2VC 2MX2A 3MP9A 1TQOA 1WI5A 3Q14C 4CYEA 4M8AA 5ISRA 2R7ZH 1F9JA 1ASZA 2FCSA 2V3SA 5BMGA 4A3IH 5I2XA 5I9OA 3KVFB 2PTLA 3E0JA 3I4NH 1XLNA 1KOTA 1ZDXA 1CK1A 4E6IA 4I7ZC 1N5XA 2LGXA 3HOWB 5CMDA 4FHKA 4X3UA 4NY0A 3MXGA 3GTKH 1FM0D 4URKA 1IBML 3J80E 2BS4B 1HUMA 1KNAA 1FNWA 1UWVA 1X56A 4DFAA 4RFBA 4YSYB 2N9LA 3EJIA 1WRDB 1Q0WB 3SK4A 1NNXA 5AZHA 5DM63 2J42A 3CP0A 1XYIA 1JALA 3CXCA 2AL6A 4DAVA 2M17A 3PZDA 2I1KA 5FR6A 2V1CC 4F7ZA 4KHVA 4BA1I 2BQQA 1CMXB 5LMNW 1IPGA 5LLIA 1ENFA 2Z4HA 1HNWQ 2FMMA 1I50B 2DNCA 4ZYSA 1NMFA 3ULPA 1HZ6A 1N62A 1PZJD 3P4SB 1E7UA 3G6JB 2B2YC 4LUOA 2QDFA 3HK0A 2B2WC 3JW0X 2BKFA 2UUAQ 4RCNA 1KD1C 5BYSA 2KDFB 1EEFD 2KHJA 5CV5A 4N8X1 3EC8A 3TEXA 4IURA 2WDVB 3STBD 3CPFA 3RZDH 2C7MB 4W9JA 1V1PB 1G51A 1WOCA 2B2UC 3I73A 5EPLA 4MZ9A 3RZOB 2WDRB 2CU3A 1CSQA 2ZNVC 1SYBA 1JROA 2KJHB 3NTIA 4OXPA 1E9MA 3DEPA 3S17H 3KF6B 4F88A 4IKGA 1IBXA 1PXUA 1LTID 1YHBA 4CDCC 1C48A 1B2TA 1I35A 3OJ3A 2A5HA 2JXMB 4RGOS 5FR3A 2HDMA 1SMYC 1ENCA 3TBIB 4JV5Q 3NY5A 3ND8A 2MFIA 2PW9A 3HOWH 4P75A 3W2DA 4PMBA 2VQFQ 4OVUA 2KEDA 1T5XD 2DZIA 2Q8RE 2ZM6L 3RPFC 4AWJA 2TSSA 2BVCA 2JVCA 3N32A 1YJWA 1U4MA 1I42A 1PYSB 1T0SC 1C4AA 5C0XG 3PGEA 3BVGA 3UDGA 4P72A 4LFBL 3R2IA 2KUMA 3SK8A 3CC7A 1EY0A 4XWTA 2CWPA 3U9OA 1ET9A 5IYBH 2L32A 1FNVA 1QILA 1JOKA 4NJCA 4FP5D 2M9VA 5BR8L 1BVSA 4HSPA 3U30A 2Y0SG 2BS2B 5M3MG 2RDGA 3WOEA 3HIZA 3GD7A 4HLEA 1JQ4A 1G91A 1F2MA 4PG3A 1PYBA 5HHDG 1A2UA 5C2TB 1WGDA 2L5TA 1LYLA 1U5KA 2NPTA 2BWES 2K32A 2MBOA 1PH6A 4J15A 4A3FB 2Q8TA 4XQQA 5DPRA 4EQNA 2MLBA 4WJNA 5FLXc 3MJ5A 1DOMA 2SNMA 2NBWB 3APFA 4LFAQ 3OJ4B 2XRSD 5A35A 3P2BA 1D1IA 3DM3A 1UBQA 4K7UA 3DWAA 3FILA 5C0XJ 2PZTA 3LWUA 3AE9B 2N8NA 3AMUA 2WXFA 3J81i 1I4PA 3DBHI 1SDFA 1CQFA 2Z0SA 4OIKA 4YWKA 2E2DC 4A3KB 1QOBA 3NQIA 1RM6C 2DN8A 4DF7A 1STAA 1JICA 3LXFA 4ANUA 3T4AC 2G4DB 4JBWA 1HR0L 3NG0A 3EGRA 4RNAA 3PO0A 4NZLB 4X62L 3U7DA 1WXVA 4ZRKA 2MQJA 2XTIA 1Q81C 3NQTA 2OF1A 1E5WA 3B1LX 3LYYA 2HCCA 2I38A 1H95A 4DXGA 4I65A 1TU2B 3PT2B 3DWGC 1JE4A 1NJIC 3CPWA 3B6YA 4L6TB 4LF5L 3TMEA 2Q2UA 3L17A 4GOPB 1VQ5A 3P1HA 3M4OH 4TV3A 4TRDA 2XN9C 1UH6A 5C6AA 4ZHOA 3I4MG 3T1YL 1Y14B 2XEWA 3NTHA 1XMOL 2NVXB 2LASA 1D6EC 2A6HD 2LFIA 1SNQA 2QDLA 1F9PA 5JOBA 1BXTA 1IBMQ 2KHSA 2NN6G 1XNQL 1ZW7A 4AS1A 4NJ6A 2WV6D 4HDQA 3UI3A 1TVXA 2EY6A 4HN7A 4A3FH 4LCDE 1EWHA 4REZA 2YV5A 2M56B 3HS0C 5C44H 5LMUL 4XC2A 2WYQA 1LUZA 1Q1OA 1X54A 2WXGA 1LTSD 3KF8B 1GC6A 5D7GA 4J1MA 1XLPA 4CQNA 2BS3B 4UHVA 4GOPA 4JI3L 5IWAQ 1OO9B 3HRZC 1JRUA 2RSNA 4M1UB 1YOVB 3ZRFA 3NHEB 2CR5A 4FN2A 2R92B 1EEID 4CGYB 3HHMA 4HEDA 3GE8C 3N1YC 4ZRZA 3EFUA 2KXJA 1Q90A 4CHTB 4KI0A 1EFID 3BU2A 2PQAA 3H1UA 2X69A 4A3MB 1CZWA 1GOZA 1VLBA 3SHQA 2QCPX 4WAAA 5CBEE 4L5SA 3M63B 5E6PA 3UF8A 3E9SA 3QK0A 2KCNA 3BDOA 2W82A 5FLXL 1HNXQ 3HOUG 3KF8A 4DUZL 4HROA 1F2LA 3MC9A 4FBJB 2KTFA 3K6OA 2JA7G 4IUMB 4IWQA 3TCAA 1L1OA 2RSUA 1T3QA 3HM6X 3LX0A 1ICWA 3G48A 2NVXH 2PI2E 3BS1A 2KX3A 1WFYA 4WFN3 4PNYA 1B9NA 5J18A 4BOSC 1IYJB 2O4XA 2L9HA 4LNNA 4OIJA 3KYHC 2A69D 4JYAL 4MM3B 2RPVA 4EUTA 1B3QA 3HM3A 3PZ7A 2YTVA 4ZRPA 2IT1A 1PZKD 2RQXA 1YNJC 2VXWA 3T51B 2MP2B 1EO6A 5IO9A 1DJRD 3RLFA 3UINB 4QF4A 4GN4B 5D6JB 3FVQA 5IODA 1SGHA 2ZJDA 1EWYC 2KC1A 1W6KA 3MTNB 1HH2P 2RMMA 1D5ZC 4XT1B 4BY7G 5G5HA 3PRPB 1HZ9A 3K7UC 5BR8Q 2R92H 1UE5A 1H9JA 4KDLB 3H7PA 4FXGC 4LDTD 1NYRA 1VQCA 2WACA 4IFDH 1STHA 1VDVA 2ES2A 4A3MH 4L1BA 3TBLD 1HQMC 4MM3A 5JH5C 4A3DB 2XBBC 4C3HG 4KHPL 2K75A 3J7YW 1EQVA 2DY8A 1EQRA 3C1FA 5EAYA 2JUOA 3A5UA 1OTCA 2K6QA 5AUIA 4FA6A 4DV7Q 4A3EB 4LJOB 4HIKA 3PPAA 2KDMA 4W9DA 3TL5A 3MEFA 3NHHA 1WXQA 1B70B 1ZKHA 3ZLZA 1VD2A 1PFMA 5GXGB 1SAPA 2K4KA 4KMUC 4DNIA 2DWQA 1PFSA 4RHSA 4FF2A 4M00A 2DUDA 3V3XA 1RD9D 4X64L 4JI1Q 2YEPF 1S5BD 3JYUA 4RCOA 3RI7C 1CKMA 1E0BA 2F0OA 4S17A 3K59A 2KZRA 4HTHA 3KLSA 4A9AA 1F2RI 4JI5L 2KMAA 2CVRA 2LXAA 2VNUD 2J0MA 2WKCA 3OG5A 3QA8A 2CW0D 4TKOB 5KYLA 4X62Q 1A15A 3A8IE 3MHSD 3Q8AA 3M85A 3CU7A 2JA6G 5JEAJ 1SE9A 1VQBA 1WD0A 2JEAI 3H7SA 3P1MA 5ELDA 1WFQA 4A93B 1BUIC 1OXSC 2TMPA 1YI2A 4LF5Q 2KTRB 3MC8A 3HKZG 1NCVA 4ABNA 1FPYA 5T8IA 3P4QB 4HJKA 2G45B 3CSFA 2D0OA 2AWTA 1FVIA 1FYCA 1G291 2C35B 1IYVA 2AQ2B 4KN4C 1XMOQ 3VUXA 4A3DH 3A4SC 2LWPA 4ME5A 3PO3H 2XSCA 1XNQQ 5HFYA 1V1OA 2KYWA 3PO2G 1I7HA 1R7SA 5IGBA 5EKKA 4A3EH 4A3JB 4ZUJA 3FKIG 1GB4A 2D3BA 2GBNA 1KAWA 5LMUQ 2HT1A 3T16A 1EYGA 4K7SA 4BKSA 4KZCA 5HG2A 3OAWA 3TN2A 1XJVA 1A2TA 3IKJA 4WJ4A 2GBJA 3IAYA 2JY6A 1MHHE 2ZJQA 3ALBA 5G3LF 2K1BA 3PUVA 3X3MA 3C46A 5IOCA 4G7OC 1AARA 4OZBA 1F0ZA 1D5MC 1A62A 4KLKA 1OQRA 3A8JE 4YWGG 1E0ZA 1E2VA 2KD0A 4P7IA 2MHJA 2OCEA 4UP9A 4XQJA 1IZ6A 3PV0A 2KX0A 3DBHB 1XLOA 4ZUIA 4BKGA 3TEZA 3IRBA 3S14B 2NTSA 1VQLA 1TWGB 1Y1VH 4LF6L 4KIKB 4FJZA 3QOLA 4A93H 3AXCA 2Z6KA 4MGZE 3MXUA 4OHJA 4R3DA 5BYQA 4RGMA 4E71A 4LWCA 1R4NB 2K8CA 2FFKB 1I4GA 4JC0A 2JA5H 1BR9A 2WDQB 1QF6A 3J7AF 2CQOA 1V2YA 4L23A 3L7ZC 5I2YA 4JLCA 1K8RB 2LI5A 4IALA 1QUQA 2JQOA 4KY5A 1HZ5A 1QB5D 2EELA 1SROA 2K7VA 3GTPB 3A9JA 1CJEA 2EKIA 1E1TA 2XIWA 3K80C 1PTOC 3N30A 1JE5A 2F0TA 3BZDB 1LM8B 3L4PA 2JX5A 2KVRA 1MSHA 3U9SA 2V4LA 1SBBB 3T3OA 4GDLB 2C5LC 2R2QA 5CGKA 3VAWA 1PRTF 2JYOA 5ELBA 2DNFA 4IUUA 4ARIA 3RR5A 2J7ZA 3GTJH 2DYBA 1EYAA 4ZKCB 1E2ZA 3QAQA 3SD5A 5C4HA 2CQAA 1NSNS 2AMCB 2EDGA 3EROA 5JJZA 1EQQA 1IGCA 1EU3A 1VDZA 2EYOA 2PQEA 5G3LD 2IX3A 4Q2JA 2X38A 1MBYA 4HJGE 1FD7D 3G71A 2VUMG 2ICEC 3AH7A 3HOZH 4CDDC 4A3LH 3S14H 5FK9C 2NCNA 1I4XA 3IBEA 3D4WA 1SYDA 2RSOA 4JPSA 4HMJA 3LWEA 4LUVA 5KRUA 4EQ5A 4EEWA 1KLVA 3P4RB 1Q8IA 4GDLA 4MT5A 1HNZL 4JX1C 4G4KA 4DV1L 1JOQA 2D3CA 2WIIB 4N59A 2JA8G 5EE0A 4NB3A 1V9PA 4ANXA 2AUKA 1VRAB 1HTLD 3L0WB 4ANWA 2F0MA 2EJMA 2DENB 4X64Q 2IY5B 3GTPH 3JC66 1YIJA 3HOYH 1WY8A 5LL6S 4MH8A 2V0GA 1KABA 4FJYA 5CV9A 3K58A 3LDZE 2LGSA 2B39A 4GOPC 1TKGA 3KYCD 2E5LQ 3UDFA 2BYFA 4K5VA 4F8CB 1UZXB 2AWNA 3STBC 4C3IB 1WJUA 4JE3B 1X3PA 1EWIA 1KFYB 1FCCC 2EJGC 3B9JA 2Z0DB 3L10B 3PIPA 3V61A 3SK6A 5J2RA 4K7WA 4LF9L 1E7ZA 3QJYA 1YX5B 2LHDA 2KKCA 3BK1A 2LXCA 2R93G 2YEPB 4BBNF 4QUCA 1KC8C 4DHJD 1MJDA 1ZGUB 3NZ3A 4RF0A 1ZUD2 2PLPA 2N88A 3QO2A 5JAVA 3S1MB 1JT8A 3VH3B 1L1OC 3SFDB 5K5PA 2O5JC 2GVBA 1HPCA 4PYZA 1EIHA 3HGBA 2EYJA 4ILWA 1K53A 2C7NB 1HA6A 3PUZA 2L0FA 1STBA 4A3GG 3FMCA 4XDXA 2L11A 1SLJA 1FIQA 5C4XB 4K0KL 3M3JA 2EY5A 1II3A 3DMUA 1CFMA 1FJGL 1KF6B 4BBRG 4GN1A 5IGGA 2B76B 4QQBX 2K04A 2NZ1D 2ZEQA 1DOXA 3ULJA 1TWHB 4RWSC 5G55A 3KUPA 4C1NK 2RD0A 4LJZC 1HXYD 1HZAA 2Y5PA 1RIPA 2KECA 3PSEB 2FUG1 4GLXA 3NVZA 2MO1A 1GUNA 2OQ0A 1M94A 3VH4B 4ME3A 1H9SA 1L6UA 3VDYA 3WALA 1A6XA 4L2YA 4A3PA 1EIYB 4C3IH 4NW2A 3M7NA 4LNQA 2KQ3A 1WWTA 3M4QA 3PHXB 4MNOA 2LMCB 2B63G 3QIJA 4FF4A 3IT4B 2FCQA 1MGSA 3OMGA 1ILPA 3UQAA 5J1ZA 2QA4A 1LLRD 3TEWA 1FXTB 3N1XC 4LUZA 3AFQA 1DGSA 3CCSA 5FJ8H 3J80i 4XT3B 1KQSA 2ZT9C 2F0FA 2ZPYA 3N9YC 3PS6A 3X23A 3S1MH 4FXCA 3GTQH 2R7FA 4E3CA 4NP5A 2HQEA 1N9WA 1YBYA 3EHVA 3OTOL 2RDFA 5EGTA 4FO2A 1DOIA 2HTME 4A3CG 2PO4A 1PGBA 1JJCB 4OELB 5GAGC 4NXML 1N61A 2WXMA 3NZSA 4FADA 4FXDA 4QL5A 5IP9G 1JWMD 1EYCA 4RA8A 4JGHB 2BDNA 4L5RC 1TKWB 2PKOA 4QCLA 4WWOA 3N52A 3JAMc 4CJ0B 1EY4A 2PMVA 4RGNA 1TWHH 3OIQA 1HTOA 3ETRA 3NUHB 3DUZA 1XTCD 3Q3FA 4JWSC 2KN4A 2H4OA 2B29A 2RKSA 2G3QB 2GBRA 3ZXVA 1K0SA 4XTCS 2NUCA 1VQ4A 4W9LA 2B3AA 3HEJA 1E7PB 1EIFA 1SFOB 4BY1B 3A1QB 3TP6A 1AFPA 4JW0A 2ZW1A 4DWFA 1P9DU 2MHVA 4LF4Q 2A6HC 1NAPA 4DA2A 1IL8A 1QOFA 4LLGM 5CX3A 5F2DA 2K5VA 1M90C 4X65Q 2CHWA 5D65A 3Q8CA 3ZGZA 2BH8A 3HG9A 1C4PA 1G6JA 2GBMA 5CC4A 2GMIC 3FP9A 1PRTB 4DNRB 3CCUA 4LNOA 1QG7A 3ND9A 3ZNHB 1TT2A 1WCMH 3OIPA 2QJLA 1MVKA 4KSKC 3S16B 1M8AA 1TS5A 2KHIA 3FPPA 4ZRJA 5JJKA 1DOKA 1V9JA 3DHHC 1LTAD 3A1QA 3TQYA 2A1AA 3CCMA 2XGTA 3U4EG 1XTDA 2K03A 4IZ8A 3E56A 3V6EB 2MJ8A 1BUVT 4JBJA 3L0OA 4BA2I 3I55A 1F9SA 2J4XA 1XF5L 5E6JA 1IW7D 3BYTB 3KYDD 3NS8A 4OZCA 1NYQA 5IY0A 1FD6A 2WXHA 4K3CA 3UDXA 3I4NB 1C4CA 2PZWA 2FXQA 2OHFA 2DZJA 4LF9Q 1NI2A 2LD9A 2JWUA 5AJ3L 4BKTA 2Z59B 3H0GH 3Q3OC 4KKJA 4BZAA 3T1HL 2KCMA 2Z6KC 4OZAA 1SFOH 4IG7B 3I2ZA 4C2MB 1O7YA 1SE8A 3ZDMC 3Q8DA 1SSOA 2WX1A 3NS1A 3IT6B 2XVSA 4JBKA 1SN8A 3EIVA 1CHQD 1WX9A 3U52E 1IKLA 1EYDA 4XIGS 2LXJA 2L8JA 2LEKA 4F87A 2B3GA 2D07B 3ZJUA 2A69C 3J9CA 1LTBD 4IFDI 2F0IA 2OQKA 4QJFA 1KJTA 4K0KQ 3CAMA 3APCA 4J3OD 5EBCA 4DR3L 5ELFA 1XX8A 3JAML 2WXRA 1FJGQ 1IBLQ 4GU2A 4HJ7A 2B2TC 5K36H 2RVLA 1YVCA 5LMNQ 3Q3NC 1B53A 5JZEB 2KJXA 2BT6A 2IO2B 5BN4A 2INDC 1KXLA 5BYRA 4CBVA 4MTKA 1R4MB 1XNRQ 3BDLA 3OWFA 1IBKQ 4DHZB 2AQ3B 3VYRA 4JL9A 2MGSA 3HP3A 1WXSA 2B8GA 3PCOB 2GRIA 4B0EA 4BOZB 3S17B 1SEBD 2JSOA 3NTKA 4HIMA 4GNXA 1WTPA 1PH4A 3KW5B 1OXXK 4P16A 4XYCA 3PLVA 3W9CB 3H8HA 4M8NA 4DHZE 1H9MA 1HA5A 4A3KG 3WANA 2YU9H 3F2CA 4YWLA 2G4SA 5J39A 3OSOA 2ENBA 5BN3A 3DQVA 3Q69A 4BBSB 1GUAB 4N6EB 1W3SA 3RNGC 1BCPF 1TWAB 4NPNA 2K5WA 2AQ1B 1TTNA 5GMVA 2EYPA 3ZJYC 2EXZA 1NDDA 2F0NA 5CV4A 4C2MH 1P1AA 4RF1A 4L5QA 1PGXA 1WJ4A 4EGVA 4NPSA 4MJSB 1FGUA 3DHIC 2WINB 3ZTCA 3OTOQ 1VCIA 1A70A 4IPDA 4B3ML 1Q5WB 1F2YA 2F0GA 1GUTA 3V2TA 4NXMQ 4LJPB 1HZBA 3IL8A 2QGQA 1FEHA 2CH4W 2OEOA 5LHY1 3HOVG 2VH2A 4GSWA 3QWNA 2CW0C 2EE1A 4PZ7A 2R6GA 1DXMA 3Q3JA 4JI0L 2M2LA 1I4RA 4LF7L 3ZUNA 2IX1A 1A63A 2K22A 2ZCCA 2K5HA 3UQBA 5T1IA 1C1YB 1WM2A 4R8NA 3CCJA 2ZXPA 3S1RB 4IWOA 1C76A 4YY3L 2UXBQ 2E8GA 1L4DB 2UXCQ 4RHRA 3K5LA 3A4RA 4WURA 3H3VH 4ITKA 5E6NA 4ARCA 4DXFA 4GKJL 4A4IA 5C3WA 4O2DA 4JCVE 2LJ5A 4L5TA 3SU8X 4X66L 2K28A 2EYMA 1PMRA 4DR2L 2PE9A 3H6NA 3W5OA 1QKZA 4WWPA 3OMCA 4C7YA 4KKTA 1N33L 4BBSH 3L16A 2Z8LA 4OVZA 3Q8FA 1L5PA 3C19A 1TWAH 4MELA 4OX9Q 2F0JA 5IYCG 3S1QH 3GTMH 4IM2A 3ZDTA 4JI7L 3RZWC 1QOAA 2UU9L 2KANA 1K0RA 2WGSA 1FR3A 2K52A 1V1PA 2MUYA 4DR4Q 5FLMG 1UBIA 3R7RA 1ESFA 1G6PA 2QC8A 1PV4A 1DOYA 5IP7G 3H91A 4DPGA 3Q22A 1STEA 4MSQB 5JHAA 1H9KA 3LJ3A 3KF6A 5KGUA 3I3CA 2GBKA 1RRBA 4TKNA 3JAME 1Y8OB 1HZCA 2KVZA 3QC8B 1KAAA 2HQLA 1A3TA 3J7AV 3ENEA 2K14A 2OT2A 1J5EQ 1UGMA 4FDBA 3GTLH 3VTVA 2XWJB 2LGDA 2PMZB 2WXQA 1SYFA 3KLSX 2XNAC 1J8IA 3M4OB 2PW7A 1L2FA 1D1KA 3N6RA 4IJLA 5FO8B 3J81c 1W2BA 5BMIA 3S1RH 2CKZB 3TS0A 2VB3X 2FNJB 2PMZE 1YN3A 3K5NA 2EXDA 2NZHA 4I6LB 1GAQB 5EPKA 3W3AA 4YIJA 5CORA 3D32A 3I91A 2KWVB 1AH9A 1Z7TA 1UE7A 3E3XA 3UE1A 2UXDQ 4IFDJ 2N9KA 2LJIA 5C44B 4YXDB 2QKIC 1YX6B 1S5DD 4OONA 1OTRB 1HQRD 1VQEA 3MZ5A 4JK1C 1XCTL 1VQ6A 2KQ7A 4KKSA 1X6OA 1WGKA 1YIWA 2BKRB 2D2QA 1I4HA 2LZ6A 3MWYW 5HKHA 4M01A 2UUBQ 4Z9CB 3R2TA 2C60A 3I9V1 5C3EB 2D3GA 2EIFA 2JXTA 1E1OA 1LT3D 2EPBA 4H13C 2HJ1A 4DXAB 2O5IC 4NAMA 3VR2A 3J7A5 1C0AA 5DPTA 3RMHA 3I8ZA 4A55A 2LGIA 1R4NI 4AYBB 4KGRA 2JEBI 1GNUA 4B3SL 3QWZB 4JI4L 2A5UA 4HIDA 4Q5VA 5D3DA 5D3IB 4DK6C 5IGFA 1C78A 1SIFA 2GB1A 2EVBA 1R4QB 1F52A 4DAYB 1HJPA 3PUXA 3IXSA 4AYBE 5BMHA 1BBWA 5H1SE
chains in the Genus database with same CATH topology
1AP0A 3PIP3 2A74C 2K5QA 5AUKA 1AYFA 2IDYA 2AUJD 2M19A 2NWGA 4C3JG 1YJIA 2KMMA 3BDCA 3EUB2 3NWSA 1EOTA 4NAWB 2IL8A 3SR1A 1ROEA 1NVID 2QSDA 2G1EA 1EU4A 1GB1A 1ZXHA 1AZQA 3QIAA 1WTQA 1ESRA 3BVMA 3MFGA 2NBFA 3ITPA 2OXPA 4HEA1 2F4IA 3SEBA 3J81L 5C5MA 1WSPA 1BCPB 1JRPA 2MJ3A 1R9TB 3IFTA 3IAM1 4DK0A 1JOOA 4O42A 4IOIE 2BOSA 1G2TA 2X6LA 2LS01 4USAA 2V4IB 1SE2A 2MP1A 4GDKB 1EM7A 4X3KA 5FOBB 1BNZA 1WTRA 3NE5B 1NI3A 1QNKA 3O13A 4RKBA 2DYOA 3VYUA 2N0SB 2V3NA 4R9WA 1EY8A 1XO3A 1O78A 3G7LA 1UAPA 2QILA 1VJKA 3H09A 2MEKA 4QUFA 3VA7A 1SNPA 4FF3A 4TQUS 5CV8A 3NP8A 1JR0D 2F0HA 3QB3A 4YSXB 2BE5D 2WXIA 1JB3A 1JQYD 4LMQD 1B3AA 3A7AB 4B0MA 3D31A 4TQ0A 3DWQA 3K0YA 5M3MB 5JEAG 1TR5A 2OEDA 3AV8A 1C4QA 1TY0A 1EL0A 4QMGA 1LTRD 3L3OC 1FXAA 3I72A 3TZDA 3PO3B 1K50A 1P7FA 1C9FA 2NYZD 3CRKC 2YYZA 2H88B 1J7AA 3Q8BA 4KTAA 1Q12A 4X3TA 2DYMA 2F3WA 2E3TA 1EWCA 2WXLA 3AE5B 4YTMB 1JORA 1LT6D 1JWBD 1G2SA 1HRJA 1OXTA 2G9HD 3LNNA 1RHPA 5JVG3 4ZHPA 4OO1I 3MFYA 1EIGA 4RKLA 4CKCA 1LABA 1LO5D 1VMCA 1Y1VB 1CQVA 2EZVA 4G57A 3T13A 2ON8A 5DM73 3TSSA 2JA5B 2K6AA 3DWMA 3A8KE 4ZK9B 3CRLC 2BA1A 1IHZA 5FLXE 4G7HC 3DXJC 4NKLA 1OXUA 4OGQC 3NRZA 1FO4A 2R61A 4XYOA 1HTPA 1S5ED 2E76C 1JWAD 1Q1BA 1RTNA 2KCCA 1S5CD 1PDQA 2RA4A 3GTJB 3BIID 2WKDA 1KLUD 1YMHE 1F9QA 1VZ8A 1IW7C 1WRIA 1RF2D 3FEWX 3RFZB 2PNRC 1Y56A 1LACA 3HOZB 2IWHA 2L1BA 5MPOA 1IGDA 1GPXA 2F0WA 3VR4A 3IAS1 3SHLA 3NBHA 3TDQA 1T6BX 1RODA 2B8FA 3QG1A 1DONA 2EYHA 2KEEA 2QF7A 3A56A 2JA7B 4PMCA 2SNSA 4HSVA 4WJWA 2C9OA 3AECB 3I57A 1PFBA 5C3JB 1KNEA 3NWTA 2WXNA 3SFEB 2JP1A 3I4LA 2LY7A 4WRDA 3HOYB 2NN6H 2IJ0A 3GTOB 5EE9A 1E2WA 4QB4A 1EY9A 1OQQA 5H92C 3W5UB 3FC4A 4KGSA 4KHZA 1FMAD 2BCOA 4EQPA 4U68A 3CWIA 2EJFC 2FHTA 1VF7A 1R4PB 2H89B 2PYKA 3OW7A 4LK1C 4KJNA 2MH7A 4O1NA 3AE7B 1T5EA 5I4DA 4BY7B 2F0LA 2KA7A 3F2UA 3GP7A 1KLGD 3AE1B 4C3HB 1AZPA 1BO0A 4YT0B 4J8QA 1YN4A 4K2KA 3VA5A 2W54A 1HFGA 1KDBA 2B2VA 3SDZA 5EE1A 2EY2A 3D4DA 1U9RA 3URYA 1XWEA 3FDTA 1YNND 2G9DA 4IQZA 2EY1A 3OOCA 4YTPB 3D6WA 5KNDA 1UNSA 2A68D 3B2GA 2JA6B 4XXEA 4HKZE 1ZE3D 1ZOYB 1YQ4B 1PRTD 2HCIA 1ZPSA 4HAEA 1EY6A 2B2YA 1KDAA 3HKZB 2A6ED 3CHBD 3RUZA 2FINB 2QEJC 2FBWB 4BWGB 1WYGA 3GTQB 3AMZA 5CV6A 3MTSA 1B9MA 3A7LA 3SVMA 4D2KA 2WS3B 1DD2A 1BCPC 4IN3A 2L4NA 1S5FD 2JQRB 2NVTB 1U4LA 3Q24A 4XWWA 1SE3A 3AN1A 1VR9A 2F0SA 5ELCA 5EQ0A 3Q23A 3MHZA 1SXTA 4WH4A 1L0YB 2JYEA 4H7BA 2WQYB 1V8QA 4ULLA 3BWUD 3HZXA 1F77A 4C80A 4Q0FA 3NUCA 1B4OA 3P20A 1UWXA 3MHBA 3P7JA 1MPEA 2L1AA 1WCMB 4GLSC 4K5WA 1SNDA 1L0XB 4WWMA 4K8IA 1DYQA 2IGDA 5JPMC 1MD2D 3E6ZX 5IGDA 4CKBA 2LMCA 1RWSA 1GHJA 1PLFA 4TSSA 2NMQA 2V4DA 1UUPA 3I70A 1N60A 3QOJA 1ENAA 2WLBA 1V97A 1U4RA 2RBMA 4B9WA 5CYUA 1K8MA 1ZXTA 2L12A 2F0VA 1CZGA 3H0GB 4ODGA 2ACZB 3WCQA 4HCEA 3WDNA 5M5YB 2BYTA 2N55A 4OO1H 4DN4M 2JYTA 2KOLA 1SYCA 3BYYB 2WXOA 1KH0A 4OW0A 3HVZA 4V190 1Q10A 1BBXC 4KY7A 3J80L 3KLRA 5HI1A 2JU6X 2K5PA 5J22A 2QDBA 4KGTA 3K5OA 3Q8EA 4DNTB 2X6GA 1PGAA 4HMIA 1HFNA 4XE0A 4RGTA 3EVQA 2YU9B 2LKVA 1VZ7A 4HR7B 1IUEA 1F2ZA 1YQ3B 5E3FA 2L0CA 2R93B 4YTNB 3KQ4A 2R3ZA 4P6VF 1EZ6A 3OHXC 1SF0A 3WOFA 5M3FB 1K51A 1VZ6A 1EY7A 1ZYRC 5IGCA 3HVDA 4A3GB 3AE3B 3W1SA 4J6HA 1BOSA 1D2BA 5CBAE 4BBRB 4A6QA 1AN8A 2F0EA 3C3LA 2BE5C 5G5GA 1SIJA 1QOHA 1MHXA 4H44C 3TUOA 4IUVA 1RDPD 1SNMA 1J9OA 1XCQL 1ZDVA 1ONLA 2B63B 3H6MA 5C0XI 3ABVB 4XYQA 1WTXA 4HKQA 2E2HB 4K6DA 3GTMB 3S1QB 4EQOA 3VR9B 5EPJA 2BDOA 1AEXA 3TP7A 1CA5A 1K52A 3NVYA 3NSWA 2IW3A 4R8IA 1J7CA 4UAIA 3GV3A 2I07B 1B44D 5C5LA 5FO7B 3GTLB 1I4QA 1ZP0B 3T3NA 1STYA 1IBXB 1FCLA 1GUSA 1YNTE 4H2AA 4K5XA 2FE8A 1H9RA 4US8A 5A2QL 2K33A 3H94A 1UEAB 4IUTA 4AQ7A 4IFDG 2QMTA 2F0UA 2D9UA 2MJDA 3SR6A 2PZUA 2DBYA 5EBDA 4TQ1A 1BCPD 1TIID 3VRBB 1RTOA 1JWUD 1IYUA 4H0LC 2DNEA 5HGTA 2SEBD 3AEBB 3KWLA 2NN6I 3D8GA 4K8JA 5C4ZA 4A3BB 2PVOD 3W5VB 5C4JB 4MIUA 5DNFA 1FXIA 4RAUC 1GUGA 1U4PA 2Q5WD 3PUWA 1CTMA 4DQOC 1NENB 3VR3A 5I6YA 4KX6B 3FILB 1PTOB 3VR6A 1SYGA 2M0AA 1TWFB 1I6HB 1GHKA 1M4VA 1BQQT 1A3UA 1F2RC 2N7JA 2INNE 5KYIA 2PVGC 3V05A 2K9XA 4ZLTF 2M00A 4IUQA 3VR8B 3MA2B 4F7XA 4ZQ3A 1Y8PB 1QWYA 3V96A 3R8BA 1TYGB 1QNUA 4DU9A 1K8OA 1CI3M 4C56C 2ID0A 3L9AX 2AWOA 2E2IB 4L63B 4NDXA 3D6CA 2KVMA 1SJED 1LV9A 3P63A 3P75A 3NVWA 2Y3AA 3C8YA 5TSSA 4C1NI 5A2QE 3EA6A 1RYJA 3P42A 1RJTA 5E4WC 2J53A 2PIAA 1GXDC 5IGEA 1PTOH 1D4BA 1TKYA 2F0QA 3E5SA 5CR3A 2Y5CA 1N63A 2W3RA 2WXKA 5FKAC 4DAYA 3KBGA 4ZOHC 4PT5A 1YNNC 4FXKC 3TEYA 3P4PB 5IIFA 3HOVB 1HHVA 2BA0A 3D4RA 3AE4B 2ZXRA 2VZKD 4A8XC 3TP5A 1D5XC 4XQNA 4KN7C 3GTGB 2A68C 1QE6A 1SNOA 1EQTA 3R3OA 2GA4B 4FVMA 2BB6A 1PRTC 4DK1A 2A6EC 1V43A 1JMLA 2IPKD 4F8MA 1QT9A 5KNBA 2SDFA 1HUNA 4WAFA 2W55A 3CKIB 1ZEQX 1ZYRD 2Z1CA 4WIPA 5M9OA 1LTTD 5C3XA 2RDHA 3DM1A 2FMCA 3MEHA 1FFVA 4LAAA 3NBIA 5EE3A 4B9XA 3AE2B 3NXWA 4KV6A 3EFXD 2J52A 2QIEB 4XDCA 3VYTA 2K0PA 1G8ZD 2NVQB 1YJJA 2XRQD 1B1ZA 5EKLA 3HRDD 3AEAB 4FF1A 1TZOA 3A54A 2Y0SB 2MPMA 4YSZB 1TS4A 1PZID 1L0VB 3DHQA 1QLBB 3PIO3 4KK7A 1DZ1A 3GQBA 2L83A 3S1NB 3R93A 1Z47A 3PUYA 3VYSA 3U2SC 3ZJVA 1C8CA 5M5WB 5JVH3 4UDUC 1ILQA 2I2YA 2NB0A 4CJ1B 2F3VA 3UI2A 3H3VC 3AEEB 4XDDA 1ET6A 1DGJA 3SK5A 1BMLC 2F1MA 5C0XH 1TS2A 2HDEA 1WTVA 4G7ZC 3VRAB 1CM9A 3MVVA 3AEDB 3J81E 4M0WA 1BF4A 4DAPA 4FYDA 5FO9B 1ZKOA 3FRPB 3ZYYX 2VZKB 3ONAB 3S2HB 2JE6I 5KNCA 3I4MB 1L6VA 4KY6A 4C3IG 2CJOA 2WU2B 4LTUA 1TS3A 4C3JB 4KKUA 4KD3A 1TJEA 1RKNA 4KD4A 4ZKBB 5JXVA 1UGJA 3M7GA 2ONQA 5DEHA 5KIXA 2KWDA 3GV6A 2K05A 4PV1C 1VMPA 1SMYD 4IUPA 1IKMA 2WXJA 5D14A 2EOTA 1Q3LA 2JZPA 1KTKA 2WP9B 1BDOA 4FNFA 2I46A 3NPPA 3MC0B 4HRSA 2KACA 2ICIA 4Y7NB 1QJOA 3BG3A 4P2CB 2IGHA 3HOUB 2IX0A 1QCBD 4IDIA 2BW2A 1WD1A 3D3RA 1PFNA 4US9A 1E10A 2SOBA 5JPNC 2HUGA 5IT9L 5EKIA 2F0PA 3FPUB 4OO1G 4L8JA 4S3SA 1LT4D 2CJNA 2PW5A 1KDCA 4HCSA 1Z6HA 1CHPD 5E1FA 3HUIA 1LT5D 1ACCA 3KK7A 2J0TD 4K14A 4OL7A 3A55A 2D62A 3AEFB 1FNUA 2B2TA 1YN5A 2BB5A 4N58A 2SAKA 1PYWD 3AEGB 1JCKB 3AB9A 3C1EA 4GZYC 1C79A 3VR5A 5KEEA 2WNMA 5HURA 5CV7A 3TP8A 1NR2A 1F9RA 3OWEB 1I3QB 1PDXA 4RH6A 3S9WA 1XEEA 1VF5C 3TZUA 4X3SA 5LL6X 2WXPA 1PUTA 1SSNA 5LNK1 5I6WA 1B9RA 5M5XB 1NEKB 2BTEA 1TY2A 3MXPA 4EVOA 4PMWA 1Y8NB 3AM9A 1V8CA 1RCVD 4CJ2C 5K36G 1DCZA 1DM0B 1FRRA 4BS9A 1O80A 1W6JA 2W3SA 1HCZA 2AX5A 2B2WA 1JWSD 3KWVA 3SXHA 5JEAH 1Y1WB 3FAHA 1HEZE 5NUCA 3MAQA 3B2FA 2WP8J 2O2LD 1MI2A 4MHEA 1UWMA 2B2UA 3PO2B 1SNCA 2E75C 3FKIB 4WQMA 5IT9E 2ZW0A 2WAQB 1Y69U 4K6LA 3ZJTA 1O7LA 3CQZB 2E2JB 1L4ZB 3Q6SA 2WB1B 3HOXB 2K01A 3MXNA 1C77A 5COYA 1AW7A 1H9SB 3M4YA 3PMFA 3AE6B 3C2PA 2FJ2A 5E4XA 1JW9D 3T53B 2INPE 2A73B 3CIRB 2LFNA 3GS2A 1YNJD 4B08A 3S15B 4DGZA 1G6ZA 1GJXA 3AE8B 3PZ8A 1K83B 1CZPA 1OXVA 3ZQ4A 1XLQA 4JWUC 2F03A 1XXGA 4V0BA 2V3PA 3K7AB 4A90A 2XWBB 4IUNA 1S4ZA 2H1EA 2D2CC 2IGGA 1RFKA 1ZXIA 3SE0A 4WORA 1I6VC 1NR4A 2KQ4X 3NK9A 1MSGA 3BVZA 4QIWB 2LUMA 2MJEA 1FGBD 1STNA 3GB1A 1WVLA 1GUOA 2BBCA 1X3QA 1N5WA 1A3VA 3ERQA 2Z4IA 3K5MA 1E6EB 3VQIA 3S2DB 5DAUA 2VUMB 1X32A 4KJOA 2D5GA 2L55A 4C7ZA 4ID6A 2C5CA 2DLBA 1KRHA 2JSVX 4PQXA 2F0DA 1EY5A 4NMZA 4TMAB 2JA8B 2GI9A 3Q0AA 2VB2X 1STGA 5ELEA 3NVVA 2E74C 2NTTA 1TWCB 4MN3A 1B50A 1DOLA 1WTOA 1SE4A 2ZXOA 1PTOF 3IFDA 3EQLC 1JC7A 5AFWA 1CA6A 3RD4A 4CKEA 1Q1EA 3DEOA 5BN5A 1O7ZA 1J7BA 1SB3C 3U7ZA 1SJHD 2D5DA 1GUWA 2EYFA 3X3NA 2K3UA 3KBXA 1MI0A 3M3YB 1SYEA 1LTGD 2L52A 1ML0D 4ZAIA 1FFUA 5H8YE 3OPOA 2DY7A 2PPBC 4U673 2Q8IB 2R7ZB 2KAJA 4MACA 4A3IB 1EZ8A 3T56B 1PFDA 2K5DA 3GTKB 4K2LA 2PCFB 5I9PA 1QQRA 3DWPA 2CHBD 2LHEA 3AU7A 3BK2A 3I90A 3GO5A 4N9PA 4KKIA 2F0KA 2EYLA 3AB5A 1OFFA 2E6XA 1PTOD 1AWDA 5T1GA 1FRDA 3LB8C 1QOGA 4N9TA 5EJWA 1P7EA 1WTWA 2HDLA 2NVYB 3RZDB 4LK0M 1TKEA 3K57A 2WU5B 1CT1D 4ZRQA 1NUCA 2B2VC 3MP9A 1TQOA 4M8AA 5ISRA 5BMGA 5I2XA 5I9OA 2PTLA 3E0JA 1XLNA 1ZDXA 1CK1A 4E6IA 4I7ZC 1N5XA 3HOWB 5CMDA 4X3UA 3MXGA 1FM0D 3J80E 2BS4B 1HUMA 1KNAA 1FNWA 4YSYB 4DFAA 4RFBA 2N9LA 3EJIA 3SK4A 5DM63 2J42A 1XYIA 1JALA 4DAVA 4KHVA 4BA1I 1ENFA 2Z4HA 2FMMA 1I50B 2DNCA 4ZYSA 1N62A 1HZ6A 1PZJD 3P4SB 3G6JB 2B2YC 2B2WC 4RCNA 5BYSA 1EEFD 5CV5A 3TEXA 4IURA 2WDVB 1V1PB 5EPLA 2B2UC 3I73A 2WDRB 3RZOB 2CU3A 1SYBA 1JROA 3NTIA 1E9MA 3DEPA 4F88A 4IKGA 1IBXA 1PXUA 1LTID 1C48A 1B2TA 2A5HA 2JXMB 4RGOS 5FR3A 2HDMA 1SMYC 1ENCA 3TBIB 3ND8A 2PW9A 3W2DA 4PMBA 2KEDA 1T5XD 2Q8RE 3RPFC 2TSSA 1U4MA 1C4AA 5C0XG 3BVGA 3R2IA 2KUMA 3SK8A 1EY0A 4XWTA 3U9OA 1ET9A 2L32A 1FNVA 1QILA 1JOKA 4NJCA 4FP5D 2M9VA 4HSPA 2BS2B 2RDGA 3WOEA 3GD7A 1JQ4A 1G91A 1F2MA 5HHDG 1A2UA 5C2TB 2L5TA 2K32A 4A3FB 2Q8TA 4XQQA 4EQNA 3MJ5A 1DOMA 2SNMA 2XRSD 5A35A 1D1IA 3DWAA 3FILA 5C0XJ 2PZTA 3LWUA 3AE9B 3AMUA 2WXFA 1I4PA 1SDFA 1CQFA 4OIKA 2E2DC 4A3KB 1QOBA 3NQIA 1RM6C 2DN8A 4DF7A 1STAA 1JICA 3LXFA 3T4AC 4JBWA 4RNAA 3EGRA 3PO0A 4NZLB 3NQTA 2OF1A 3LYYA 2HCCA 2I38A 4DXGA 4I65A 1TU2B 3DWGC 1JE4A 4L6TB 3TMEA 3P1HA 4TRDA 2XN9C 4ZHOA 5C6AA 3NTHA 2NVXB 1D6EC 2A6HD 2LFIA 1SNQA 1F9PA 5JOBA 1BXTA 2KHSA 2NN6G 4AS1A 2WV6D 3UI3A 1TVXA 4HN7A 2EY6A 1EWHA 4REZA 2M56B 3HS0C 2WXGA 1LTSD 5D7GA 4J1MA 1XLPA 4CQNA 2BS3B 1OO9B 3HRZC 2RSNA 4M1UB 2R92B 1EEID 4CGYB 4HEDA 4ZRZA 1Q90A 4CHTB 4KI0A 1EFID 2X69A 4A3MB 1CZWA 1GOZA 1VLBA 2QCPX 5CBEE 3E9SA 2KCNA 3BDOA 2W82A 5FLXL 3KF8A 4HROA 1F2LA 3K6OA 1T3QA 3LX0A 1ICWA 3BS1A 4WFN3 4PNYA 1B9NA 2O4XA 2L9HA 4OIJA 2A69D 4MM3B 2RPVA 3PZ7A 4ZRPA 2IT1A 1PZKD 2RQXA 1YNJC 2VXWA 3T51B 1DJRD 3RLFA 4QF4A 3FVQA 5IODA 1EWYC 1W6KA 2RMMA 1D5ZC 4XT1B 5G5HA 1H9JA 4FXGC 1NYRA 2WACA 4IFDH 4L1BA 1STHA 1VDVA 1HQMC 4A3DB 4C3HG 3J7YW 1EQVA 2DY8A 3C1FA 5AUIA 4A3EB 4EE2A 2KDMA 3NHHA 1WXQA 1PFMA 5GXGB 1SAPA 4KMUC 2DWQA 4FF2A 4RHSA 3V3XA 1RD9D 2YEPF 1S5BD 4RCOA 1E0BA 2F0OA 3K59A 4A9AA 4HTHA 3KLSA 1F2RI 2CVRA 2VNUD 2WKCA 2CW0D 4TKOB 5KYLA 1A15A 3A8IE 3Q8AA 3M85A 3CU7A 5JEAJ 1WD0A 2JEAI 3P1MA 5ELDA 4A93B 1BUIC 1OXSC 2TMPA 1NCVA 4ABNA 5T8IA 3P4QB 1FYCA 1G291 1IYVA 2AQ2B 4KN4C 4ME5A 2XSCA 5HFYA 1V1OA 1R7SA 1I7HA 5IGBA 5EKKA 4A3JB 4ZUJA 1GB4A 3T16A 5HG2A 3TN2A 1A2TA 3IKJA 3IAYA 1MHHE 5G3LF 2K1BA 3PUVA 3X3MA 3C46A 5IOCA 4G7OC 4OZBA 1F0ZA 1D5MC 1OQRA 4YWGG 3A8JE 1E0ZA 1E2VA 4XQJA 3PV0A 1XLOA 4ZUIA 3TEZA 3S14B 2NTSA 1TWGB 3QOLA 3MXUA 4OHJA 4R3DA 5BYQA 4RGMA 2FFKB 1I4GA 2WDQB 1BR9A 1QF6A 3J7AF 4L23A 3L7ZC 5I2YA 4IALA 1HZ5A 4KY5A 1QB5D 2EELA 2K7VA 3GTPB 1CJEA 2EKIA 2XIWA 1PTOC 2F0TA 3BZDB 3L4PA 2JX5A 1MSHA 3U9SA 3T3OA 1SBBB 4GDLB 5CGKA 1PRTF 2JYOA 5ELBA 4ARIA 4IUUA 2J7ZA 1EYAA 4ZKCB 1E2ZA 5C4HA 2CQAA 1NSNS 2EDGA 3EROA 5JJZA 1IGCA 1EU3A 1VDZA 2EYOA 2PQEA 5G3LD 2IX3A 4Q2JA 2X38A 1MBYA 4HJGE 1FD7D 2ICEC 3AH7A 5FK9C 1I4XA 3D4WA 1SYDA 2RSOA 4JPSA 4HMJA 3LWEA 5KRUA 3P4RB 1Q8IA 4MT5A 4JX1C 4N59A 4G4KA 1JOQA 2WIIB 5EE0A 2AUKA 1VRAB 1HTLD 2F0MA 2EJMA 5LL6S 4MH8A 2V0GA 1KABA 5CV9A 3K58A 2B39A 1TKGA 4K5VA 2AWNA 4C3IB 4JE3B 1X3PA 1KFYB 1FCCC 2EJGC 3B9JA 3SK6A 3QJYA 2LHDA 3BK1A 2YEPB 4QUCA 4RF0A 3NZ3A 1ZUD2 2PLPA 2N88A 3QO2A 5JAVA 3S1MB 3SFDB 5K5PA 2O5JC 1HPCA 1EIHA 3HGBA 2EYJA 4ILWA 1K53A 1HA6A 3PUZA 1STBA 3FMCA 4XDXA 2L11A 1FIQA 5C4XB 2EY5A 1II3A 3DMUA 1CFMA 1KF6B 5IGGA 2B76B 2K04A 2NZ1D 1DOXA 1TWHB 4RWSC 3KUPA 4C1NK 4LJZC 1HXYD 2Y5PA 2KECA 2FUG1 3NVZA 1GUNA 1H9SA 1L6UA 1A6XA 4L2YA 4NW2A 3M7NA 2KQ3A 1WWTA 2LMCB 4FF4A 3IT4B 1MGSA 3OMGA 1ILPA 5J1ZA 1LLRD 3TEWA 4XT3B 2ZT9C 2F0FA 3N9YC 4FXCA 4NP5A 2HQEA 2RDFA 5EGTA 4FO2A 1DOIA 2HTME 2PO4A 1PGBA 1N61A 2WXMA 4FXDA 1JWMD 1EYCA 4RA8A 2BDNA 1TKWB 2PKOA 4QCLA 3N52A 4CJ0B 1EY4A 2PMVA 4RGNA 3ETRA 3OIQA 3NUHB 3DUZA 1XTCD 4JWSC 2KN4A 2H4OA 2RKSA 4XTCS 2NUCA 3HEJA 1E7PB 1SFOB 4BY1B 3TP6A 1AFPA 2ZW1A 2MHVA 1QOFA 2A6HC 1NAPA 4DA2A 1IL8A 4LLGM 5F2DA 5D65A 3Q8CA 3ZGZA 3HG9A 1C4PA 5CC4A 1PRTB 4DNRB 1QG7A 3ND9A 1TT2A 3OIPA 2QJLA 1MVKA 3S16B 1M8AA 1TS5A 3FPPA 1DOKA 1LTAD 3U4EG 2K03A 4IZ8A 3E56A 2MJ8A 1BUVT 4BA2I 1F9SA 2J4XA 1XF5L 5E6JA 1IW7D 3BYTB 4OZCA 1NYQA 1FD6A 2WXHA 3I4NB 1C4CA 2PZWA 2OHFA 2JWUA 4KKJA 4OZAA 4C2MB 1O7YA 1SSOA 3NS1A 3IT6B 2XVSA 1CHQD 3U52E 1IKLA 1EYDA 4XIGS 2LEKA 4F87A 3ZJUA 2A69C 3J9CA 1LTBD 4IFDI 2F0IA 4J3OD 5EBCA 5ELFA 1XX8A 3JAML 2WXRA 2B2TC 5K36H 2RVLA 1B53A 2KJXA 2BT6A 5BN4A 5BYRA 4CBVA 3BDLA 3OWFA 2AQ3B 3VYRA 2MGSA 3HP3A 2B8GA 2GRIA 4B0EA 3S17B 1SEBD 2JSOA 3NTKA 1WTPA 1OXXK 4P16A 3W9CB 3H8HA 1H9MA 1HA5A 5J39A 3OSOA 2ENBA 5BN3A 3Q69A 4N6EB 4BBSB 1BCPF 1TWAB 2K5WA 2AQ1B 2EYPA 2EXZA 2F0NA 5CV4A 4RF1A 1PGXA 4EGVA 2WINB 1VCIA 1A70A 1F2YA 2F0GA 1GUTA 3V2TA 3IL8A 1FEHA 2OEOA 5LHY1 3QWNA 2CW0C 2EE1A 2R6GA 1DXMA 2M2LA 1I4RA 2IX1A 2K22A 5T1IA 4R8NA 2ZXPA 3S1RB 1C76A 1L4DB 4RHRA 3K5LA 4WURA 4ITKA 4ARCA 4DXFA 5C3WA 2K28A 2EYMA 1PMRA 1QKZA 3OMCA 4C7YA 4KKTA 2Z8LA 4OVZA 3Q8FA 1L5PA 2F0JA 1QOAA 1FR3A 2MUYA 1V1PA 1ESFA 1DOYA 3H91A 3Q22A 1STEA 1H9KA 5KGUA 3I3CA 3JAME 1Y8OB 1KAAA 1A3TA 3J7AV 2OT2A 2XWJB 2PMZB