1XXGA

Crystal structure of staphylococcal enterotoxin g
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
233
structure length
227
Chain Sequence
QPDPKLDELNKVSDYKSNKGTMGNVMNLYMSPPVEGRGVINSRQFLSHDLIFPIEYKSYNEVKTELENTELANNYKGKKVDIFGVPYFYTCIIPKSEPFGGCCMYGGLTFNSSENRDKLITVQVTIDNRQSLGFTITTNKNMVTIQELDYKARHWLTKEKKLYEFDGSAFESGYIKFTEKNNTSFWFDLFPKKELVPFVPYKFLNIYGDNKVVDSKSIKMEVFLNTH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords enterotoxin
publication title The Crystal Structure of Staphylococcal Enterotoxin G and binding affinity to T-cell receptor and MHC class II molecule
rcsb
source organism Staphylococcus aureus
molecule tags Immune system
total genus 61
structure length 227
sequence length 233
ec nomenclature
pdb deposition date 2004-11-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01123 Stap_Strp_toxin Staphylococcal/Streptococcal toxin, OB-fold domain
A PF02876 Stap_Strp_tox_C Staphylococcal/Streptococcal toxin, beta-grasp domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.110 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1xxgA02
3.10.20.120 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1xxgA01
5D3DA 1PTOH 4RCOA 1LTTD 1PZKD 2AQ3B 4L63B 4ZYSA 1KLGD 1LO5D 1TS5A 3BZDB 5FKAC 4K6LA 4RGMA 1SE4A 3DWAA 1V1PA 3GP7A 1LT6D 5ELEA 1F77A 1LT5D 1DYQA 1PRTB 1EEID 1LT3D 3BVZA 1RD9D 1HTLD 1FNWA 1FGBD 3BVGA 1G8ZD 1I4XA 4RGNA 1SE3A 2SEBD 1RDPD 1CQVA 1STEA 1TS3A 5TSSA 1LTID 5ELFA 1AN8A 1RF2D 1LT4D 3OWEB 1FD7D 5ELCA 1TS4A 1L0XB 1PZJD 2RDGA 1EFID 1I4HA 5FK9C 1ET9A 4RFBA 1I4GA 1SBBB 1S5BD 1LTAD 3EFXD 1LTSD 1PTOD 1PYWD 1SJED 2RDHA 1LTRD 3EA6A 1SE2A 2AQ2B 1LLRD 3BVMA 4UDUC 1JQYD 5D3IB 3TSSA 5I4DA 2G9HD 1QILA 1BCPF 1B1ZA 3MFGA 1D6EC 2NTSA 2R61A 4RGTA 4RHRA 1EWCA 2J4XA 2XRSD 1HQRD 1AW7A 3URYA 1D5MC 1JCKB 3R2IA 1PRTF 4DXFA 3O13A 2TSSA 3V05A 1I4QA 1CHQD 2AQ1B 2Z8LA 1S5DD 1FNVA 1EEFD 1V1OA 1XTCD 2XN9C 1EU4A 1GOZA 2IPKD 4RHSA 1ESFA 1YN3A 1PZID 1PTOC 1B44D 2CHBD 3SEBA 4C56C 4O1NA 1UUPA 1SJHD 1CHPD 2XRQD 1M4VA 1D5ZC 1PRTD 1JWUD 1BXTA 1DJRD 1S5CD 3DWPA 1LTGD 4OHJA 1KLUD 4L6TB 1D5XC 4NZLB 1KTKA 1YN5A 1S5FD 1PTOB 3BYTB 2QEJC 1ET6A 1SXTA 4DXGA 4BWGB 4RH6A 3BYYB 1HA5A 1JR0D 2QILA 1XXGA 1V1PB 2NTTA 2ICIA 4RGOS 4Z9CB 2IJ0A 1CT1D 3DWQA 1T5XD 3R8BA 1JWMD 1YN4A 1JWSD 5ELDA 5ELBA 1SEBD 2WV6D 1BCPD 1HXYD 3KLSX 4TSSA 1PTOF 1L0YB 3R2TA 1TY0A 1BCPC 1TY2A 1TS2A 1ENFA 1EU3A 1I4PA 2XNAC 1RCVD 1I4RA 1S5ED 1LTBD 2O2LD 3CHBD 1MD2D 1CK1A 3W2DA 1FNUA 1UNSA 3MC0B 1PRTC 1BCPB
chains in the Genus database with same CATH superfamily
1NYRA 1PTOH 1JMLA 1LTTD 4JOIC 2XVSA 4A55A 2CW0C 2BA1A 2OT2A 3OOCA 2B2VC 5C0XI 2KFKB 3K0YA 2RR9A 4P1BC 4FNFA 3MWYW 3T51B 2DUDA 3ZVVA 1D4BA 2JVCA 2KK8A 1C7YA 2KEDA 1P7FA 3AE2B 3BWUD 1Y8RC 4ID6A 1B9RA 3AYHB 1LT3D 4ODGA 3PT2B 1RD9D 1N36Q 2JY6A 3KYCD 1CKMA 1E2ZA 1FNWA 1FGBD 3EQLC 1J0GA 1I4XA 4N6EB 3NELA 5KEEA 1E0ZA 2P5ZX 3KH0A 1LYLA 4GNXB 5M3FH 3AMUA 4K0KL 1OGWA 3W5VB 5IGCA 2JSVX 4RMAA 1CQVA 2CKZB 3ZUNA 2MO0A 1KC8C 1PUTA 2FFKB 2J0TD 2BB5A 1AN8A 1WJJA 5IE8A 1SMYD 1IBKL 2YTVA 1XD3B 3FRPB 3NS8A 4IUTA 2E74C 2CHZA 1OEYA 4RNAA 2I46A 3QG1A 2AWNA 4JG2A 1N34Q 2EPBA 1PH6A 3GTLH 3CU7A 5IYCH 2RHSB 3T8MA 1LFDA 1NMGA 4C3HH 1N5XA 2GB1A 1L4DB 5IGGA 2ZTDA 4CQNA 1EQVA 1SJED 3G6JB 2JRHA 2JRIB 3NVVA 4HJGE 3PV1A 1SE2A 3V60A 4E71A 1UZXB 1EY7A 4UDUC 2K14A 4U673 3M4OB 2PE9A 3W1SA 3OLMD 1WGYA 4LFAL 5BYRA 5EGTA 5AJ3Q 1A3TA 2Z0DB 3KF8A 1AYFA 4EEWA 3GTOH 3NHHA 5KHQA 2B2YC 4OWXB 4ZYNA 4A3PA 2BF8B 2WB1B 3OHXC 4PMBA 2UUAL 2C35B 4EX5A 3T1YL 4L1BA 1E7ZA 3PS6A 4LWCA 1KOTA 4B3MQ 1HZ5A 2IGDA 3L2PA 3Q3FA 1ZOYB 1BMLC 5E7NA 2NVQH 2B63H 4WJQA 2XBBC 4DQOC 1EEFD 1XTCD 1AE3A 5KYIA 3ZRCA 3PREA 2GOWA 1C79A 2RQXA 3PF4A 1B70B 1Q0WB 5HI1A 3QR8A 1YBYA 2DLBA 1NYQA 1SNQA 5LMNW 1TTNA 2L32A 1Q12A 1SSOA 3DWPA 3E9IA 1VCBA 1MJEA 4OHJA 2N88A 4EKUA 3PLVA 3DMUA 1QZEA 1T6BX 2JYEA 2EKEC 3QK0A 2L15A 2NVYB 3NVWA 2BYFA 4DXGA 3FPUB 3I4LA 2LD9A 4ZRKA 5LMNQ 1J5EL 3PUZA 4A3BH 1JWBD 4ABNA 4LMQD 3PMFA 1SYFA 5IYCG 2LJ5A 4C3HG 3DWQA 2BDNA 4J6IA 4QB4A 5G2NA 4HLEA 2WLBA 2QHOA 3CQZH 4XWWA 3KVFB 1UE1A 4GB9A 1W6JA 1GM5A 4A93B 2EY5A 2R7ZG 1UGMA 2XTIA 4CDCC 5K36G 4JIOU 1I50H 2AWTA 4XYCA 2KHJA 2B2WA 4NAWB 4RA8A 1I4PA 4B0EA 1EIGA 5EBCA 5C4XH 1A3UA 5D14A 1EY4A 3KF6B 3U9SA 4EGVA 3PUWA 3VR6A 4TKOB 2NN6H 4UP9A 2A69D 2W82A 3LJ3A 5AZGA 1H9RA 2NVUI 4KKIA 1WIAA 1AH9A 2M1MA 2ZPYA 4HXDA 2WU2B 3VTVA 4NXNL 1XCTL 2VQEL 2G4SA 2BTEA 4GLXA 4KY5A 1VQPA 4A20A 2F0DA 2CH4W 1F0ZA 3HHMA 1G8ZD 1M8AA 3B2FA 2Y0SE 3AFQA 1DGSA 2E2HB 1WFQA 2OEOA 1MJDA 3M63B 4BBNC 4IQZA 1B9MA 4R8NA 1WYGA 3DM3A 5ELFA 1HNXQ 1WTOA 1P3QU 1SNCA 2C7NB 2HDEA 2KC2A 3P4SB 3OWEB 4NDXA 2GBMA 1FD7D 2EYFA 3Q69A 2VRRB 1AP0A 4BKSA 3Q3OC 4RKLA 2LFNA 2NBWB 3S14H 1ZDXA 2FMMA 3IFWB 2MHVA 4LFBL 3RUIB 5C6AA 4G7ZC 2DZIA 1XMQQ 4P71A 1UBIA 1WX8A 3PQIA 2A4ZA 5BN5A 3MEFA 1Y8PB 1SFOB 1QUQB 1ZXTA 1RYJA 1Z6HA 1XNRL 3K81C 1CKNA 2O6VD 4TUUA 1NJIC 1WTRA 2G9HD 3IG3A 4R1JA 2ZXOA 4X3UA 2WKCA 4DV3L 1MHWC 5M5XB 4B3SQ 4MTNA 3S17H 1WR6E 2R2OA 2LHEA 3CC7A 1V80A 2SDFA 4FA6A 1XLNA 1L1OC 2JJQA 2DZKA 2K1BA 4G50A 4YTNB 3KLWA 3S24A 2XEWA 4H13C 5H1SE 4KDIC 2F0IA 3FHWA 3KUDB 3CW2C 1TT5B 4ZOHC 1BF4A 2KDBA 3KFUA 4A3MH 3GTKB 2XN9C 2R92B 1YJ1A 2WX1A 2IPKD 2KBNA 4MTKA 4CJ2C 3AEGB 3TBIB 3N32A 2JA6H 5HKHA 1FXTB 4FJZA 4DNRB 1VQ9A 3DBRI 3DVGX 5JZEB 2K7VA 3DM1A 3P1HA 4KV2A 1Y1WH 4P16A 4E74A 2RCFA 3DBRB 2IX3A 2BWFA 1TWCB 2ONQA 4PS3A 2PZWA 4OW0A 1SXTA 2KTRB 1HTPA 4A3LH 2BW2A 3IBEA 1WRDB 3S16B 3OYYA 4OXPA 3T13A 2MBOA 3EGRA 4IUMB 4L5QA 3I4NH 1HEZE 4FXDA 1SIFA 2A6ED 3JAME 3WDNA 1WCMB 1YN4A 2CU3A 2WP9B 4J8QA 2KENA 4DF7A 1TWHH 2XSCA 5KNBA 4BKTA 1SNMA 1PQSA 1IBLQ 1TGZB 3EFCA 3PRMB 3C19A 3EROA 2GRIA 2Q2UA 1QE6A 5I2XA 4KZ0A 2MJDA 2PPBC 1YD8U 2HIXA 2MSED 4M00A 1VQ8A 4R3DA 1ML0D 4DV6Q 3NZSA 4PMWA 2B76B 3L7ZC 3SK8A 3TEHB 4X66Q 4A3CG 1UGJA 3JVZX 3TEWA 5JVG3 4HPPA 2WXPA 1ZYRC 3CKIB 4RGMA 3PZ8A 4GNXC 2VUMB 3QO2A 4DR4Q 1LT5D 1Q46A 3WWVA 3RNEC 1EEID 3S1QH 5E1FA 2LS01 2K04A 4GOPB 5M5WB 1HTLD 2DWQA 2O2VB 4WWPA 3W1YA 1Q1BA 2I1JA 5M9OA 4GN3B 1GAQB 3P4QB 2K5WA 1Z9FA 2J0MA 4DAYA 3VDZA 2N9KA 3DEPA 1Q81C 3AM9A 1ZGUB 4EE2A 3VH3B 2VL6A 2E2JB 1QF6A 4DK6C 3H91A 3RZOB 2HQEA 1PH4A 4GN5A 1VR9A 2CJNA 2R3ZA 5ELCA 2D3CA 3B2GA 4IWOA 1L0XB 3ZXVA 2F0TA 1Q8KA 4ZRJA 1EY8A 1F2RI 1EYGA 4JYAL 1KIXA 5FLXE 3T56B 2EYMA 2BKFA 3ND8A 4A3DG 5C3EG 3Q8FA 3TS2A 1GD7A 2D62A 3RZDB 1IGDA 4KKJA 1LLRD 2BH8A 1UBQA 3NOBA 3TSSA 1WI5A 1Y1VB 1V49A 4NXML 4OO1G 3ZGZA 3S1NB 4B3RQ 1D6EC 3TMPB 5DPWA 1WTPA 4E3CA 5LL6S 1E2VA 4BXXG 2UWQA 1H9SA 2K6AA 3HOZG 3ML8A 4IUNA 3U58A 1E0BA 1ENCA 4R4OA 4FF1A 2ENBA 4JI1L 1Q10A 2LRWA 2O6VB 4MEMA 2HT1A 4OEMB 3M4QA 1UEBA 5CV6A 1IYVA 5IO9A 3FKIH 1EYCA 1YNTE 1T5EA 3PHXB 4MZ9A 4KK7A 2MWSB 4IKGA 1CM9A 2WXQA 3FP9A 4AJWA 1M94A 1QG7A 2YYZA 1WXMA 3WAMA 4RM9A 4RG1A 3JAMc 3ZJTA 3JSVB 4FN2A 3TIXA 2DJGC 4AH6A 3HOWH 2RBMA 2I2YA 1UUPA 1W3SA 1R4NI 2N55A 1SN8A 2NB0A 1I42A 1PGXA 4LFCQ 5LMUQ 4L6TB 1ZXHA 3SHLA 3ENEA 5JAVA 3TP6A 1RWSA 2XWJB 5A2QE 3CCJA 4NQLB 2V1CC 1EQRA 1WXVA 1JMCA 3H0GB 3HRZC 3STBD 2ID0A 2Q8RE 4DR1Q 3TEYA 3AE7B 2NBVB 3R3OA 4N8X1 4IFDJ 3CIRB 4QIWE 2BWES 3T1HQ 4JI4L 1STGA 3TUOA 3J80E 1WTVA 4L5TA 4MNOA 4R4TA 1T0RC 1TY2A 1E8ZA 2O5JC 5IIFA 3QIAA 2LXJA 2LJIA 2LWPA 1VDVA 1RCVD 1K0RA 1U4PA 3BDLA 1K8AC 2IX1A 1IGCA 1OQYA 2EZVA 4FBJB 1VF7A 3HKSA 5G5GA 1IBXA 2NVYH 1FVIA 2AQ3B 1FYCA 5C4HA 5CC4A 2VH2A 2WIIB 1LO5D 1TS5A 1YQBA 2KQ4X 3QC8B 1WMHA 4APVA 3K57A 2JP1A 4A3KH 4A3FH 4C1NK 3C46A 1MG4A 3Q24A 4OVZA 3RFZB 5FLXc 3BDOA 2MPMA 2N7EA 2K05A 3B08A 4BY7G 1EIYB 3H6MA 3D3RA 5JJLA 2ZVOA 2AKWB 2HCIA 4A93H 1S4ZA 3NBHB 4DAPA 1FIQA 1EWIA 1B9NA 1RDPD 2JN4A 2K5NA 5CBAE 1UH6A 3EJIA 2RPVA 2ZEQA 4MGYE 2HDLA 4DR3L 4A3IG 4GZYC 1LTID 5J3BA 1JOKA 3U2SC 1Q1OA 1V43A 4QGUA 1V9JA 1CZGA 2D3GA 4FHKA 2IO2B 4W9DA 1TWFB 4JI5L 1WM2A 3AE9B 4CHKA 4I7AA 2GBJA 4BY1G 5EDSA 2LY7A 1EFID 4LFAQ 2KTRA 3HVZA 2KCNA 1V8CA 3R66C 4IPCA 4EZJA 1TT2A 1PH8A 1UWXA 2OEDA 4HTHA 2K50A 5CV9A 4C00A 2AWOA 3MXNB 2JA5H 4KY7A 1G91A 1WGKA 4ZQ3A 2HD3A 1CJEA 2DAJA 1YJNA 2UXCQ 4MM3B 1NSNS 5IWAQ 1LTRD 2UUAQ 2MJEA 2MP2B 3X23A 1WJUA 1DONA 3PO3B 3NTHA 4L8JA 1MSGA 4C2MB 2OHFA 1O7YA 1HZ6A 3OW2A 1QILA 1Y14B 3OMCA 3TZUA 3F2CA 2E2HH 3CC2A 3H3VC 2JYOA 5KGUA 5FLMH 2EKIA 2MH7A 2R61A 2EYPA 1VQHA 1GUOA 2D10A 3URYA 1WJ6A 3Q8BA 1PRTF 5GAGC 1S1QB 3MJ5A 3EFUA 2ZXRA 3CXCA 4FXGC 2MBQA 3I73A 4YSXB 2LXKA 2R7ZB 3UGBB 4A3KG 4A3FG 1QT9A 2WXRA 5DPSA 2M00A 5IGEA 3AXCA 3TRZA 2R93H 3K80C 4IJLA 1EU4A 5J39A 2XK5B 4GOPA 2KHIA 3I63C 4F8MA 1EY6A 1WGDA 1M1KC 1EIHA 3ZRFA 3AE4B 4HPMB 3VQIA 1VQJA 2PI2E 1CHPD 1WTXA 2IYDB 4IPGA 5BR8Q 1HUMA 2KVRA 2FCSA 1KLUD 5M5XH 1AE2A 5CHWA 3VH4B 2PMVA 4OZBA 4W9EA 4B6WA 1WD0A 1IBML 1YJ9A 1XLOA 3IL8A 2D5DA 2A19A 2QF7A 2JZPA 2JT4B 2NTTA 3H3VH 3A7LA 2KUMA 1CT1D 2KQ3A 5ELBA 3OG5A 4QL5A 1BCPD 1L5PA 5GMVA 2FAZA 1IKLA 3MFYA 1QCBD 4KKTA 2R92H 3L13A 2HE7A 2Y0SG 3SU8X 1FO4A 1E7PB 3AMZA 3BS1A 1E7VA 1QZGA 5C44H 3MA2B 1KJTA 1G6PA 3NZ3A 1IHZA 1SAPA 3TEZA 2IHFA 3W2DA 3NWTA 2N0SB 4K3CA 3SGIA 4HSPA 1DXMA 1TWCH 2F0JA 4XQQA 3GV6A 1CSQA 1OXUA 2MBEA 3AU4A 3BZDB 3ZJUA 1SE4A 3DWAA 4XXEA 3CWIA 2X6GA 2JU6X 4NKLA 4S3SA 2JQRB 1PRTB 1VQ7A 3HOUB 3RI7C 2Z0SA 4LDTD 5M5YB 4K2KA 2AX5A 2WFWA 2D5GA 3MP9A 2R93G 3PZDA 2E76C 5M3MB 3P20A 5E4XA 1L0WA 1UF0A 3A9JA 2WNMA 2SNSA 1B8AA 3HKZB 2JXMB 3KF8B 4OIJA 4C80A 4A3JB 2Z6KA 4GLAC 3APFA 1VQKA 3HOVH 4KHPQ 4C3IH 3K5NA 3IRBA 1HCZA 2G9DA 5E4WC 2JSOA 4YTMB 4AIMA 1FFUA 4R8IA 2EY1A 2DX5B 3MTNB 4YWMA 4K6DA 3U4EG 3PGEA 4YHHL 1L0VB 3K7AH 2M0XA 2VUMH 2MO1A 1TWGB 2L0CA 1N32Q 2JPHA 3KDFA 4XZ4A 2B2TA 1EZ6A 4BAXA 4CJ1B 3DWMA 2M4NA 4J15A 3G7LA 1BCPF 2YV5A 5C44G 1STAA 4JI8L 4MH8A 3W5UB 4C3JH 2QSDA 4K3BA 4DR2L 1VQDA 3GD7A 4LUVA 1FPYA 3DBHB 3VR4A 2J53A 1TYGB 3G4SA 1VQFA 4DNTB 2F1MA 4ZAIA 3PV0A 1O7ZA 4A3EG 5CX3A 1WJ4A 1EY9A 4K8JA 4KGTA 4IFDH 3PUXA 1CZWA 4A3GH 1OEYJ 3DHQA 2AQ1B 2ZVNA 1HNZL 3AE1B 4LF9Q 1L2FA 3NG0A 2V9HA 1YN3A 4JW0A 1X3PA 1EFWA 2HHHQ 3E3XA 4HMIA 1IYJB 2JX5A 2MA9B 5T1GA 3KYDD 3RZDH 4NJ7A 3RUZA 2ZJQA 4FF2A 1NDDA 2KJHB 1XLPA 2KHWB 3WCQA 3NBHA 2KCTA 4I7ZC 2ZJRA 4TQUS 2E2IB 1D7QA 1DOXA 3I91A 4AYBE 4BBRG 3S1NH 3HOVG 4PV1C 1Z47A 2INCC 2K9XA 3GZNI 2AMCB 2QEJC 1STNA 4A4IA 4HJAA 4JBMA 1GJXA 2HUGA 1DOIA 2V4LA 2KA7A 1JROA 4HIOA 5DEHA 3GZNB 3NSWA 1WXQA 3RN2A 3CCQA 1XO3A 1C76A 1A2TA 3U9OA 1GUSA 2PO4A 3C3LA 2B3GA 2PPHA 2K5HA 4LF8L 1T5XD 2MCNB 1N63A 3VRAB 2PKOA 3K5OA 3I4MG 1JOQA 2WXMA 4URKA 4P2CB 3X0WA 4ZUIA 5HGQA 1L0YB 4ME3A 2UUBQ 2LVOA 4LF5L 1MPEA 4DV2Q 3A8JE 2MP2A 3AI5A 4M8AA 4KSKC 2LMCA 1ACCA 2F3VA 3TZDA 1GG3A 2N9EB 4DBGA 5IKCM 4ANWA 1STHA 1Z7TA 4IUQA 4WRDA 4HJ8A 1MD2D 4YY3Q 4DUZQ 1PH1A 2RSUA 3N1YC 3I4OA 2WXJA 4FF3A 5IGFA 2LVQA 3VAWA 1BCPB 2ASBA 1E8XA 3V62A 4M1UB 4JWUC 4XYOA 4UP8A 4L63B 4ZYSA 2F0FA 3HZXA 1HZ9A 2EELA 4A3DB 3AU7A 3RLNA 2GVAA 3H0GH 1KAAA 1LT6D 2R6GA 3CPFA 5EQ0A 4OO1I 3N1XC 4AJYB 4LUZA 1B2TA 4XC2A 1A3VA 4HEA1 1QKZA 1CKNB 4LNKA 1TKYA 2V3PA 4HSVA 4HCPB 2VW9A 1SE3A 1UE6A 1L4ZB 2UU7A 3QARA 1MIUA 1IL2A 1WE6A 2KWUB 4F87A 1FRDA 3HOXG 4FXCA 2WAQE 1B4OA 1U4AA 4XTCS 1YZ6A 4CDDC 4Q0FA 4JI3L 1GC6A 2NVXB 2WDTB 5BYSA 2N49A 2JA8G 2AHOB 2K32A 4D2KA 2I0QA 2OJWA 4JC0A 2B2UC 3OPOA 5AUKA 4MDKE 2VB2X 3ND9A 4KD4A 4QQBX 2ZTEA 2TMPA 2WDRB 1V2YA 3N6RA 2I5MX 3GS2A 3RLFA 1HH2P 1WYWB 3W5OA 1WZ0A 4LF4Q 2L76A 3NVYA 1VQ4A 1ASZA 1Q3LA 1HFNA 3WAPA 4YXDB 4CGYB 4B95A 1DCZA 2LXAA 1O7LA 3S2DB 1JRUA 3HFZB 3H8HA 1X65A 4HCEA 3W1BA 3GTJH 3FDTA 2WS3B 5D6JB 2RA4A 4OONA 1YQ4B 2FNJB 3P75A 2MNAA 1FR3A 3S2HB 2R7DA 1TWFH 1W6KA 2JA7H 2AEHA 3A54A 2CQAA 1J9OA 2FCQA 3QCAA 1VQBA 1WTHA 2RVLA 1HTQA 4KJNA 5FR3A 2QKIC 3KWVA 1V1OA 5H92C 3SVMA 3I55A 2Y5BB 1X54A 2RF4A 2C5CA 1TZOA 4IJHA 3GB1A 3PZ7A 1K73C 3PO3H 3VVWB 1SNOA 3MZ5A 4C2MH 3UINB 3OTOL 1SIJA 2BBCA 2E5LL 5EE1A 2ZNVB 2NR2A 4K8IA 1DGJA 4ZRIA 3ZNGC 1MI2A 5IN7A 4ILWA 1A15A 3PO2B 2OF1A 3RZFA 1S72A 4JI7Q 3CCEA 1L6UA 4LK1C 5F2DA 1K8GA 1EIFA 2WB1E 3BDCA 2C7HA 3B9JA 3RNCC 4DV1Q 1G6JA 4G4KA 4M8MA 3MAQA 1CA6A 4Q2JA 3ABVB 3I3TB 2YTXA 2DY7A 2Z4HA 3HP3A 3M9BA 3ULLA 4WFN3 2WV6D 4DDGD 2G3QB 3NBIA 2K01A 4H2AA 3KUPA 4A3IB 2INPE 1WVLA 1WM3A 3DQVA 2LXCA 2UU9L 5C0XJ 4PZ6A 4P75A 5GROA 1NR4A 4DAYB 5M3FG 3ZXRA 1JRPA 2L0FA 3U4ZA 5I9OA 2H4OA 2O2LD 4DV4Q 2V1YA 3CF6E 1PRTC 1VZ7A 3AEEB 3F1ZA 4X65L 2K0PA 4M02A 2BGFA 2JA7G 1QNUA 3SFDB 3FVQA 4IPDA 1JJGA 1V1PA 2HD5B 1BVSA 3H09A 5C4JB 3W1SC 1NEKB 4IUUA 4DK5A 3GE8C 4JBWA 3R7QA 3PSIA 1FJGL 1NMFA 3Q23A 4RGNA 1TKEA 1RHPA 2K25A 4ULLA 2YLMA 5BMIA 1TBEA 4W9IA 3ZYYX 4CDFC 3E6ZX 2BPSA 4X62L 2DNEA 3F2BA 2F0NA 2Y5PA 4K5WA 1J6QA 1EWHA 4DV0Q 1TVXA 4A75A 2PQAB 1XPRA 1MBYA 1C77A 1KM7A 2KDMA 1W2BA 3WANA 1H9SB 2KQ7A 2YU9B 2Y3AA 2F0SA 1KABA 3K59A 1J7BA 1IZ6A 1WXAA 5IT9L 3CF5A 5GAEC 3RNUA 1JOOA 2KLCA 1UEAB 3UQAA 2K5QA 4V0BA 2F52A 4F1SA 3JYUA 1PDQA 1S5BD 1CKOA 3NTIA 4X64Q 1D2BA 2EY2A 2KANA 1AARA 1VZ6A 2B63G 3HOUH 1SROA 1U4RA 5T1IA 3RD4A 1PH9A 2PNRC 3EA6A 1JWAD 1S3SG 1H4RA 4DV7Q 2IGHA 4B08A 4PK1A 1JQYD 3PF5A 1RKNA 3SK5A 2WXHA 5IYBH 3OJ4B 1LM0A 5EBDA 1P7EA 1U4MA 2CKHB 5FOBB 3RNGC 2EQSA 1QOFA 1HNWQ 4C7YA 4A3JH 2M17A 1NR2A 4WWNA 4DDID 3SR6A 1EWCA 1HTOA 3HVDA 1I6VC 3AULA 1J8CA 5IOIA 1DOLA 2QGQA 3X3NA 1WJNA 4DR7L 1F1HA 4K7UA 1B7YB 4DFAA 4A3BG 4DV5L 2B2WC 1JE4A 1PFMA 2DGYA 1Q1EA 2JK8A 3ICEA 4HK2A 3OIQA 3FKYA 4KHZA 5IAAC 1IBMQ 2NWGA 4FO2A 3RLOA 2L4NA 2LVPA 1C8CA 2M9VA 2PQEA 1TWGH 2BQQA 2K3UA 5JJZA 1BQQT 4FVMA 2IY5B 2IWHA 1G51A 1I6HB 2WXGA 1VMPA 3LDZE 3Q2AC 4FJYA 4KJOA 4BBSB 1AEXA 1SJHD 3PIOA 3K8AA 1N33Q 4JL9A 1I94Q 1WGGA 4TQ1A 3J7A5 1E8WA 1LACA 3VHTC 3EBEA 3S1MB 3J81L 5C4XG 1YN5A 1IBXB 4P1CC 2CU1A 2CFMA 1QOHA 4JI0Q 1Q82C 1P16A 3RNFC 4EZLA 4GKKQ 2NN6G 5JEAJ 1PYBA 1WMHB 4ICUA 4KDLB 4ZHPA 4LF7Q 2KDFB 4DK0A 4RGOS 4HKQA 1C9OA 1ESRA 2CQOA 2HJ8A 1R4PB 1XTDA 2MHJA 5FO7B 2K8CA 1N60A 2M0AA 4W9LA 2D3BA 3M85A 4POGA 4OWWB 5C23A 3PO0A 1BCPC 4DUYL 2IO3B 1ILQA 4TVAB 1GPXA 1WD1A 3A56A 2VQFQ 3QA8A 5C3JB 4PQXA 3I2ZA 1EF5A 1WX7A 5T8IA 4UP7A 1CK1A 3C1FA 1EQQA 5EPKA 2EY6A 2X6LA 3HOYB 3RT3B 3MC0B 1VQIA 2BVCA 2J0JA 2K6DB 4XQJA 3J9CA 4II2B 4RCOA 4QUFA 5I9PA 1E9MA 4IM2A 2ZT9C 5CHFA 2IHEA 2MRPA 1QOAA 1HFGA 3ER0A 2AL6A 1KQSA 1IYUA 5GAHC 4KI0A 5IP9H 5LHY1 3DHGC 4K1RB 5JPMC 4DR5Q 1XQQA 4CYEA 4FYDA 5NUCA 3NEMA 1BBUA 1RM6C 4JE3B 3Q0AA 1I3QH 4HPLB 2UUCL 2OJRA 3ZNHB 2A68D 2DZMA 2H89B 4EZKA 1D1IA 4FLHA 1XNQQ 1STEA 3C1EA 1R7SA 3G48A 2KVZA 2PVOD 4A3EB 2F4VL 1E8YA 2IY1B 2KACA 2HJ1A 5AZFA 2K8HA 5I2YA 5D94A 1PZJD 4MT5A 1H9MA 4R9WA 1XMOQ 1I4HA 1NAPA 4FXKC 4OGQC 3NUCA 4B3TL 1ILPA 1NI2A 2UXDQ 2GBKA 4XX5A 3VTUA 3U30A 1J7AA 2WYQA 3WIMA 4BVUC 1S3OA 1EQTA 1PTOD 4US8A 3PHWB 1CQFA 3N3KB 3D32A 2LEKA 4XT3B 4A3MG 3EUB2 3U8ZA 2IBIB 4LJPB 2L9HA 1TWAB 1M90C 2JA6G 1NENB 4W9KA 3E9SA 1QVGA 4IM0A 3RULA 2QCZA 4DR6L 4HKZE 1RJTA 2IZVB 2EDGA 4X3SA 1Y1WG 4OX9Q 1OQQA 4AYBG 2CCZA 4XIGS 1CSPA 1VQ5A 3LGJA 1D5MC 1FMAD 1YHAA 4KHVA 3LNNA 2NVXH 1GUAB 1VD2A 5EKIA 3O13A 3K58A 4A3LG 1BNZA 4DPGA 2BS2B 4ZRQA 2TSSA 3I4MB 2BB6A 4EOYA 3U50C 1CHQD 4ZCKA 1PH2A 1SNPA 4HEDA 3I4NG 4JX1C 2KMAA 1Q86C 4DHJD 3QAQA 1H8CA 2UXBL 4EQNA 1LUZA 1RLFA 2FCMA 4GDKA 3DCGA 1K53A 5IP9G 3A55A 3QOJA 4IUPA 5C0XH 5C5LA 2ZNVC 4HROA 4N9TA 2RSOA 2WXIA 4L5RC 4IALA 5JJKA 2CHBD 2PW7A 4XT1B 3K9PB 1WYDA 2L1BA 1WH3A 4IW0A 1YNJD 4LF6Q 5EPLA 3CSTA 1Y8OB 1CTMA 3KLSA 2QIEB 4K7WA 3BU2A 3I5JC 3S2DH 4GS3A 1F9PA 2CW0D 4JV5Q 1JW9D 1Q5WB 2PQAA 5CV4A 1JR0D 2EVBA 4JI2L 3K5MA 3NXWA 4P73A 3S2HH 4GKJL 4YT0B 4ANXA 3AB5A 4JI6Q 5CV8A 1PA6A 2IJ0A 2L0TA 1IKMA 1X3EA 2F0LA 1JWMD 3G71A 2J7ZA 5J1ZA 5L37A 4P6VF 2M56B 1F2YA 4XDXA 4GDLA 1SSNA 3A9JB 3J7AF 1PTOF 2K6QA 5CHVC 4AOFA 2WHIA 5J2RA 4UAIA 2F0GA 1L6VA 4G11A 4HJ5A 3ZW3A 1MKHA 4MH0E 4GLVB 3M4OH 2JA8B 2KHSA 2HCCA 2WAQG 2KDIA 1O7IA 3BJUA 3MVVA 4X6AH 4U68A 1HA6A 3DHHC 1R4NB 2DHZA 2F0OA 4N8FA 5AUIA 1A0IA 4NMZA 3I9V1 4JGHB 1IL8A 3E56A 1BBWA 1YIWA 2KOXA 3DBSA 4WJPA 4BOZB 4TKNA 2DYBA 2WACA 3S1RB 5EE3A 1PMRA 4E6IA 1QNKA 3NQTA 2PTLA 3NPPA 3OWFA 4NPSA 3KDFB 3UDIA 3QX1A 3VXWA 5J22A 3GTGB 4RCNA 1EUVB 1XCQL 5C0XG 3A5ZB 1JC7A 2Q2IA 1GC7A 2G45B 3ONSA 1Y8NB 5DAUA 1N34L 1EUJA 1TS3A 2Q2TA 3V3XA 4C7ZA 3KBXA 4PNYA 1E3PA 2NPTA 2HDMA 3VYRA 2LKVA 1IUEA 1K83B 4TQ0A 1TQOA 4HCNB 4K0KQ 2NVTB 2ALYB 2LGYA 2RDBC 1SBBB 1H9JA 2EYLA 3FKIG 3ZNZB 1IBKQ 1PYWD 4LTUA 4EQOA 3NRZA 2F03A 3ZQ4A 1RRBA 2RGFA 2DNCA 2K8BA 1V86A 3MC8A 4W9HA 4BA2I 3KUCB 4KKUA 2RCNA 3HOWG 3EIVA 4B3ML 1LXDA 2X8XX 4GLSC 2V4IB 1RODA 3ML9A 4DXAB 3FMCA 2NYZD 4RHRA 2J4XA 3FEWX 3AFPA 1ZE3D 2NS5A 1WTQA 3PCOB 4DN4M 5JEAH 3FILB 2K1FA 2G5DA 4W9FA 2IY0B 1SMYC 4S17A 2PZTA 2Q2HA 3FPPA 3IFTA 5LL6X 2W9NA 4BA1I 5C3XA 2JWZA 3B0AA 3H9DA 2WB1G 4NJ6A 3D6WA 5AFWA 3A4SC 2ZW0A 1IP9A 2VNUD 2QDBA 1FCLA 5COYA 4KIKA 1KFYB 5IP4D 2BH2A 2BDOA 4GN4B 2DY8A 2CWPA 5JHBA 3T1YQ 1WWTA 2J7QB 5LMNL 2LMCB 3VYTA 2JA9A 3M7NA 3GV3A 1A70A 1WI0A 3LYYA 1ZEQX 2Z4IA 3DOWA 1M4VA 2KKCA 2MP1A 1ZKHA 2L00B 1QLBB 4XE0A 4MN3A 3BK1A 1S5FD 2IGGA 3KQ4A 1HRJA 1S40A 5E6PA 2JE6I 4A76A 1GHKA 4BWGB 4WQOB 2KECA 1RFAA 3ZNID 3NE5B 2W3SA 4C3HB 1BBXC 5HY6A 3TDQA 3P7JA 1ISNA 2KMCA 4IN3A 5MPOA 1CUKA 1PFNA 3OMGA 4LJOB 4RF0A 2Z1CA 1H9KA 1VQNA 5KHOA 1KF6B 1PH5A 5ELDA 4PG3A 3I7FA 1SEBD 4X65Q 3Q8AA 4WORA 1VJKA 2ATWA 2ZCBA 2CVRA 2I38A 1J5EQ 3H7PA 1GO3E 4DKAC 1SFOH 2CR5A 5KNDA 1C78A 1E10A 3P63A 3GTOB 3EHVA 1C9FA 1EF1A 4A93G 3APCA 5K5PA 4BBSH 2D07B 2H1EA 1U5KA 4DK1A 4AQYL 1MHXA 4XWTA 3DBLI 3TS0A 3MHSD 5L95C 1ET6A 3L4PA 3S1MH 4I6LB 1V8QA 3UE1A 5LXHA 1PZKD 3ALBA 1EYDA 3MXPA 5FKAC 4BOSC 2FE8A 2PJHA 1JQ4A 3IVFA 2A74C 4V190 2KJXA 2K22A 1C3TA 4YL8A 4POFA 1HNXL 4KV6A 2MJ3A 1VRAB 2M19A 3P2BA 3D31A 2JA5G 4ZKBB 1EOTA 1Q8IA 1EYAA 5DNFA 1GUWA 3BVGA 2EOTA 2KDEB 3Q22A 5G3LD 2EE1A 3NVZA 3GTKH 2YEPF 4HAEA 1KH0A 2AYOB 5LLIA 4OIKA 4IC7B 1F2LA 1N9WA 5FJ8H 1GUNA 1U9RA 2KCMA 1XMQL 2VQEQ 4NXNQ 2PLPA 3NUHB 3PRPB 2A5HA 5FLMG 1ZDVA 3H7SA 1B53A 3HM3A 1V97A 5DPTA 4DAMA 1Z5SB 3AH7A 4A3BB 4OVVA 1ASYA 1TKWB 4GOPC 1K8OA 4LK0M 3ZJVA 3QJYA 2BOSA 4RAUC 2IX0A 2A69C 3DVGY 2GMIC 1I4GA 2F0EA 4B3SL 3S16H 1K52A 4GXBA 3A33B 4AP4C 1C4QA 4BFRA 3ZO5B 3SK6A 5JH5C 1KRTA 1P0RA 1I7HA 1I50B 1WF9A 2WDQB 4KX6B 3RZWC 4HDOA 1WCMH 4XDCA 2AUKA 4FP5D 2K28A 4OZAA 2NN6I 4LFBQ 3SDZA 3J7ZC 4HR7B 5C4XB 3L3OC 2E75C 4BBNF 1B1ZA 2RDFA 4PZ8A 4I6PA 3GDEA 3HKZE 1C4PA 1NVID 3DPDA 1SMXA 3AV8A 2LUEA 3F2UA 1WY8A 4ARCA 5CORA 3J81i 1XNRQ 1C0AA 3IHPC 1F2RC 3UDGA 2L05A 2NBUA 3NK9A 1N61A 1YMHE 3CC4A 4DV3Q 2I5HA 4YCVA 3TREA 5JJIA 4HVBA 4A90A 1HHVA 1FFVA 4LW1A 1KL9A 2RHQB 3UIPB 4PYUA 4ZDVA 2C60A 5M5WH 1FM0D 4AS1A 1B44D 1K28A 1QVFA 4WWMA 3W3AA 2R92G 1VQLA 1BOSA 2IO0B 1TWAH 2L83A 2FUHB 3ONAB 3CRKC 2F0VA 3CP0A 5FJ8G 1S5CD 2D9UA 1VQOA 2JXTA 2LGXA 3QHTA 4M0WA 3U4VA 2LZ6A 3EVQA 4B9WA 2N9XA 2REXA 2YEPB 5BMHA 4RWSC 3S14B 4Y52H 2A6HD 2DENB 2EMTA 2NCNA 1ZYRD 3A4RA 3Q8EA 1BT0A 2E2JH 3RZOH 1IBLL 1V1PB 2JYTA 3AU5A 1CMXB 1YX5B 5IYDH 2WXNA 2IW3A 3RYTA 4YCUA 4K81A 2Z6KC 2D2QA 3E9HA 2LI5A 3AE3B 4RMFA 2L11A 1JE5A 1Q7YC 1HXYD 4DV6L 1PH7A 2PZUA 3GTQB 3AEDB 5JXVA 2KN4A 2D0PA 5ELOA 1TY0A 3TP5A 4X66L 3A1QA 2D0OA 3AEAB 1ENFA 4ZUJA 3RR5A 1GXDC 1YITA 4DR4L 1P1AA 1Y1VH 4IOCA 4BKGA 3VFKA 4JQWC 3KLRA 1NCVA 3Q14C 2DJFC 4C3IG 5D3DA 1RAXA 5C1ZA 2J42A 4B9KA 2B2TC 3VR5A 2RPQA 3FILA 1KD1C 4K6LA 3VUWA 3NENA 4A3MB 3GP7A 1V1QA 5HGTA 3OIPA 4JK1C 3EECA 3V61A 1WZ3A 2CS4A 2JA6B 3N20C 2F4IA 2VUMG 2SAKA 3TL5A 1RTNA 2A6EC 2BA0A 3A5UA 1BUIC 4WURA 1AZPA 1VQAA 1NUCA 1Y1WB 1DM0B 3OJ3A 4UPAA 3KBGA 2MQHA 1MI0A 2N7JA 2R7FA 2FHTA 4R4QA 2PIAA 3NZUA 3R3MA 4R4IA 3PSEB 4OVUA 3TCAA 5AEKB 4FF4A 4C3JG 1LT4D 1E22A 1KNAA 1YQ3B 3LWEA 4S0RA 4ALPA 2SOBA 1SYCA 3N9YC 3P42A 1KDCA 3S2AA 5C3EB 1L1OB 1ET9A 3I70A 3BG3A 4A3GG 4IFDG 4B3RL 3B6YA 5A35A 3IKJA 2KD0A 1T0SC 2F0WA 1FGUA 2E2DC 2ZZPB 4JOIA 3S15B 1BKBA 3L0OA 3RMKC 2B8GA 2A8VA 2B2VA 3GTGH 3H6NA 4JYAQ 2E3TA 4OZCA 2FIFA 4KD3A 1V81A 3ZLZA 3DVNV 4K5XA 4O0AA 1YIJA 3SDLC 1PXUA 1B3AA 1Y1VG 3HOZB 2WXLA 5IOCA 4LDTB 2JUOA 5EJWA 3R2IA 2A1AA 1K83H 3K5LA 2C5LC 2L8JA 4NXMQ 5DPRA 2H5XA 4A6QA 4H7BA 3M4PA 3U7DA 5IODA 3M4YA 1X9NA 2NVTH 5AZHA 5LNK1 4LFCL 3J7YW 2FXQA 5LMUL 1KXLA 2ZPNA 2NZHA 4EQ5A 3R93A 1GOZA 4DHZB 1EY5A 3Q6BA 3OW7A 4DWFA 2K52A 1X3GA 3OSOA 5CV7A 4JI1Q 4GKJQ 2N9LA 2PI2A 1X32A 2PW9A 2ZM6L 3C2PA 4KGRA 4BS9A 4DR1L 1ICFB 4Y7NB 2A5UA 1JWUD 1UD7A 1HZAA 4RM8A 2LRUA 3QJZA 1KTKA 3KJOA 4A8XC 1A2UA 4J1MA 2KLGA 3T1HL 1NNXA 1VMCA 1D8LA 3HS0C 5IGDA 3BYYB 3CCLA 5HFYA 2MJ8A 3UF8A 4HJ9A 4N58A 4N9F4 2VZKD 1SF0A 2AUJD 4AQ7A 4GIVA 2B2YA 1HZBA 4W9JA 3H0GG 4REZA 1MFWA 1VLBA 4KTAA 4QF4A 1UELA 3CMEA 2W54A 3KLSX 3TEXA 3KW5B 3UDXA 5BN4A 3IXSA 3CRLC 1STYA 3ERQA 4HRSA 2OTLA 3KJPA 1SYGA 4HIDA 1FXAA 2OWOA 3UIOB 1K3RA 2ZJDA 3D8GA 3F8TA 4CHTB 3IAYA 3RMHA 1VQ6A 3KWLA 1L2NA 1LTLA 4JI4Q 1JJCB 1UNSA 4MHEA 4PT5A 5BMGA 1I5FA 2L5TA 3VYSA 3K0XA 2BE5D 2PW5A 3FKIB 4C4VA 3N1ZC 2L55A 2MGSA 5TR5A 1RIPA 3ITPA 5EE9A 4BY7B 2G4DB 3KYHC 4G57A 4O42A 3STBC 2J52A 2WWZA 1L7YA 1BO0A 3W1GA 2JF5A 2R7ZH 3HOWB 2CHWA 2EMSA 3FAHA 5K36H 1ROEA 1P98A 1FD6A 2CWAA 3PTFC 1XX8A 3DVNU 4ACFA 2KXJA 2K33A 3JAML 3AQQA 5G5HA 2BCOA 5TSSA 4HJ7A 1OO9B 1C4AA 3HRDD 3IT6B 3RD2A 4ANVA 4BY1B 4MGZE 5BO4B 3D6CA 4HCSA 4ME5A 1YNND 2UXCL 1IW7D 1TS4A 5IWAL 1KRHA 2JXXA 4MJSB 2EIFA 5GQOA 5C5MA 5BYQA 3SE0A 1T3QA 4ZRPA 4K14A 3J81j 4CKCA 4DR3Q 4GDKB 3EFXD 3LB8C 5FR6A 1DOKA 2RKSA 4GGQA 4JI5Q 4K7SA 2IT1A 1UAPA 4KY6A 3IAS1 3HEJA 3I90A 4IPHA 2KNBA 4XDDA 5I4DA 1ZW7A 2JZ3B 1YEZA 1TKGA 1U0LA 4FDBA 2GA4B 3PO3G 1AZQA 3VA7A 3WOEA 3MFGA 1E6EB 1F9JA 4A9AA 2B39A 4RGTA 1HUNA 4KVGB 2KJ6A 4LNFA 2WP8J 1E5WA 1K0SA 2K39A 3AECB 3TJPA 2FINB 3BY4B 1VQEA 1E7UA 3ULPA 4RKBA 3A7AB 4A3KB 4A3FB 1JICA 4F7ZA 5D65A 1I4QA 1DZ1A 2CJOA 3L10B 1QQRA 4XGAB 5BR8L 3MHBA 3APDA 4G0NB 4GDLB 2N3SA 1PGAA 2LGIA 2KAJA 5M5YH 3A8IE 1FL0A 3A9KA 4IM3A 3CMMB 1K50A 5M3MH 5FLXL 2L3ZA 1IPGA 3SXHA 4NJCA 2K5DA 3HUIA 3GTPB 1GJZA 1K51A 4LNOA 2BS4B 3W9CB 1DD2A 3BYTB 2D11A 5EPJA 4QJFA 3FC4A 1P8LA 1E2WA 3RN5A 1Z2MA 1R4MI 3HM6X 1A63A 2FJ2A 3F2DA 4LNQA 1TU2B 2J0KA 3K6OA 1XXGA 2WQYB 3VR8B 1F2MA 1F52A 4NPNA 3VUXA 2JA5B 2ES2A 2KT7A 2V4DA 4AQYQ 1BR9A 1N5WA 1T9HA 5CBEE 1R4MB 2ICEC 2QDLA 1L1OA 1R9TB 1GHJA 2Y0SB 4DNIA 1ONLA 2IL8A 5C4ZA 2FMCA 2Y5CA 4W9CA 2X69A 1G2SA 3DUZA 1QJOA 2FBWB 2DYOA 3ZTDA 1CI3M 3NQIA 5JVH3 2INNE 3CD6A 2VZKB 1EZ8A 5IA7A 2NPTB 1GB1A 4G3XB 5KRUA 1FNUA 1LV9A 2EXZA 2CH4A 5JPNC 4KLKA 4F88A 1WXSA 2DNFA 3L0WB 1WR1A 4JVZA 1KHIA 4FHJA 1WX9A 3SHQA 3RN9C 1KLGD 1XEEA 3L17A 3P4PB 2VY3A 1GNUA 3PIO3 2R93B 3O65B 1LGRA 1DYQA 2K5PA 1X1MA 5CR3A 2EXDA 5A2QL 4KHPL 1QB5D 2WXKA 3OAWA 1X6OA 4NAMA 3HOUG 2LSSA 3DEOA 2E8GA 4USAA 5E6OA 2B3AA 4LUOA 1WTWA 3BINA 2FUG1 3MHZA 2SEBD 1OFFA 3GTQH 2QC8A 3M3YB 4JPBW 5M3MG 2KX3A 1AFPA 5IYBG 2N1WA 2F3IA 4CJ0B 1ZUD2 3H3VI 1EO6A 3IT4B 3HKZG 3Q6SA 3J80L 4A3JG 1E1OA 3VYUA 2E2IH 2HQLA 1N32L 2KFJA 4AWJA 4A3CH 2ZXPA 2L12A 2BKRB 3PGZA 3I8ZA 4HIMA 2NZOA 4YIJA 1NBWA 3SR1A 2BYVE 2QJLA 2KFKA 4KIKB 1JALA 4MELA 1OXSC 1HE8A 2I07B 3V2TA 3T9LA 2LHDA 5C44B 1KDBA 5D3IB 2GN5A 4LNNA 1K8RB 4GNXA 3I72A 4YHHQ 2N1VA 3HK0A 1GUGA 2F0KA 3Q8CA 3Q8DA 2RSNA 4J6HA 4NB3A 4LF9L 1ZPSA 1NY4A 3Q3JA 1AW7A 2JEBI 3L54A 1PH3A 3QOLA 4DXFA 2HHHL 3LXFA 5C2TB 4CO7A 3DLLA 3T4AC 4JI8Q 2WU5B 4KGSA 1Q90A 4DR2Q 1RFKA 4A3DH 2Z8LA 5C3EH 4IDIA 4B0MA 1UE5A 3ETRA 1X3FA 3T53B 4K5VA 4EVOA 1J7CA 3NHEB 1ESFA 1SYBA 2D3AA 3H7PB 4BZAA 2KQSA 2F0QA 3H15A 3S15H 3X3MA 4HDQA 1TJEA 4OO1H 4IG7B 3I56A 4BBRB 3HOVB 1U4LA 4C3IB 3T16A 1T0YA 1ZXIA 1HNZQ 1YJJA 2KMMA 3VR9B 2XIWA 3N52A 4BXXH 3AEVA 3HOZH 3GE3C 5DM63 5CGKA 2UUBL 2A6HC 3H94A 4DV2L 3K7AB 3VA5A 2ICIA 4MJSA 4YSZB 1HQMC 2QA4A 4ZK9B 1JWSD 4YY3L 4DUZL 3JW0X 2O5IC 2B29A 3GO5A 2N4FA 2N8NA 3K9OB 2BYTA 1JT8A 1HR0L 1XT9B 1G291 1XYIA 5IT9E 1TS2A 4C3JB 2ZW1A 2L1AA 4M8NA 3V6CB 1O80A 1CA5A 2JEAI 4WIPA 5HG2A 4YWGG 3P4RB 4PMCA 3PIPA 4LF8Q 2C9OA 1JJ2A 4IFDI 4Y7NH 2I5LX 1NTGA 1EOVA 2B8FA 2VZAA 3TQYA 4WH4A 4DK3C 3IFDA 4HMJA 4GSWA 2F0PA 4M01A 4CDEC 3MEHA 1Y69U 4UY8C 4LF5Q 4ZKCB 3D0FA 5KYLA 4A3GB 4PYZA 2O4XA 1HJPA 1YHQA 3ZDMC 2MW5A 2DN8A 3MTSA 4GN1A 1PLFA 1STBA 3PIP3 2QEXA 1SGHA 5ELEA 4IOIE 2KEEA 3D4DA 3BVZA 3HGBA 3RNBC 2KWDA 4JCVE 4JWSC 2EYHA 3UQBA 1V5OA 3HOXB 5CYUA 4IWPA 1CFMA 3GQBA 3DXJC 4NAWA 1KDAA 4YCWA 4DA2A 5D2MB 1RF2D 4ZLTF 3WALA 1SYDA 3PUYA 3GOEA 3KOJA 3KF6A 1K3BC 5DM73 1N36L 2F0UA 2IO1B 2WGSA 1E24A 4LF4L 4MGIE 3PO2H 2CHXA 2Q8IB 4GMVA 4OELB 1N62A 4FJVB 3TP8A 1TZ1A 3GTMB 1D3ZA 4RFBA 4L23A 5EKKA 5H8YE 5L83A 4JI3Q 4QUCA 5IP7H 4BY7H 2OCEA 1JB7A 4MGKE 3J81E 5J17A 5HHDG 2W55A 3BVMA 2L7RA 2RD0A 1WFYA 1X55A 2NUCA 4HN7A 1ZP0B 1VQCA 4WWOA 1F9RA 2M2LA 3CMAA 4A3IH 4IWQA 1UWMA 4M0WB 4ASWC 3HIZA 3ZIMA 2Q8TA 4XYQA 1OXXK 2EYOA 1C4CA 3UE0A 4C1NI 4FULA 3I3CA 1HPCA 4EQPA 4BY1H 1RTOA 1BUVT 2MQJA 5KNCA 2ZM6Q 4ARIA 1PYSB 3A0JA 1VF5C 2KCCA 3L16A 4PS7A 4YWKA 4QIWB 4DU9A 5AJ3L 1YJIA 1EL0A 5FO8B 2MBHA 2KYWA 5C4JH 3V96A 1II3A 4N9PA 2EJMA 3NJTA 4P7IA 2OQ0A 1QUQA 5I6YA 4OL7A 2DBYA 3A1QB 4JI7L 4CKBA 1LQBA 2OXPA 3D4RA 3QQ8B 4DV1L 2WKDA 1WOCA 1NBFC 2BS3B 1PRTD 5IT9c 1SDFA 1LTGD 3CCMA 1EWYC 2PNHA 1D5XC 4NZLB 1OQRA 3C8YA 1PTOB 1PHJA 2KZRA 2WXFA 4R4CA 3CCUA 5CTRC 5BN3A 2YU9H 1HA5A 3VDYA 2I1KA 1EY0A 3DDCB 2VB3X 4QMGA 3PO2G 1KRSA 1TIFA 3OTOQ 3CSFA 4GU2A 4IUVA 1NE3A 2M8SA 4ZRZA 1ZKOA 2E5LQ 3CCRA 1TXYA 1ENAA 4DV4L 2DYMA 1V5TA 3UI2A 4JBJA 5IP7G 1F2ZA 3TMEA 2MFIA 1G2TA 5M3FB 1BDOA 4TSSA 1A62A 1KAWA 3SFEB 1VCIA 3PVLA 3R7RA 1SYEA 2LFIA 2UYZB 1EU3A 3CCSA 3GTJB 2XNAC 3AN1A 3U52E 1SE9A 2QDFA 1R4QB 2KN5A 1V9PA 2EYJA 4DHJB 3JAMi 3GTPH 3SD5A 3UI3A 3TN2A 1YNXA 1F9SA 2KVMA 3SK4A 2JA7B 2G1EA 2KWCA 4ICVA 3NP8A 3GTLB 5ISRA 4N59A 2UU9Q 2GLSA 2WX0A 1MSHA 3BIID 2BE5C 1P9DU 2QCPX 4O2DA 3UDFA 3K7UC 2BYEA 1SB3C 1E1TA 2INDC 3U7ZA 3JC66 4DV0L 1OXVA 2QMTA 2OOBB 1VS0A 4L5SA 2OQKA 1UWVA 1A6XA 1E90A 4WJWA 1R9TH 1PFBA 1QWYA 1N6ZA 1WRIA 2VXWA 4A3OA 3T3OA 3RCZA 2V0GA 1MJCA 3J81c 2IDYA 3M62B 2Z59B 1MGSA 1YOVB 1I6HH 4NY0A 3PLUA 2XGTA 4G7HC 1WGRA 2V3NA 4X64L 1O78A 1XLQA 1FJGQ 1CZPA 3TP7A 3TBLD 4K2LA 5JEAG 4WQMA 2RDGA 4DV7L 1T0QC 4X57B 1YNNC 1J19A 1IW7C 4X62Q 1QVCA 2GBNA 4KSLC 3DBLB 3ZKJC 2NVQB 1GB4A 2D2CC 5DCNA 2B63B 1WE7A 2PMZB 1IXRA 3CPWA 1MHHE 1HNWL 2KC1A 5E3FA 2LUMA 5HURA 2K5VA 2PMZE 1AWDA 4RF1A 4OWTB 5C3WA 2MX2A 2O2VA 3BK2A 2E6XA 3ZDTA 1PFDA 3J80c 2NBFA 3EN2A 4ITKA 2L52A 4JBKA 4YWLA 2V3SA 3L08A 5FO9B 3M3YH 4F8CB 1LABA 5LXIB 3PPAA 2ZJPA 1JORA 2N7DA 3AEFB 1JB3A 1V6EA 1XWEA 1TR5A 2MBBB 1JCKB 3HOYH 3NS1A 4TMAB 5JHAA 1VZ8A 4QY7A 4CBVA 2SNMA 2JWUA 4UHVA 1DOYA 1SR3A 2DAFA 5CV5A 2YTYA 4IURA 3AE6B 3VTWA 4LAAA 4LNIA 1SE8A 1N33L 3LX0A 1I94L 1S5DD 3CQZB 3ZTCA 4BKSD 1XPUA 3ECIA 4MSQB 1GVPA 2F0MA 2KX0A 4KZCA 4HWIB 1PZID 4DR7Q 4JI0L 1NI3A 5KIXA 2KTFA 4GKKL 1X56A 3HG9A 4C56C 4JPSA 4LF7L 4DV5Q 3QWZB 1B3QA 2XRQD 2PE6B 2W3RA 1BXTA 1DJRD 1QZHA 4BBSG 3NTKA 3AEBB 3PRZA 1XJVA 4IOAA 4WJOA 3KK7A 2GI9A 1WGHA 4A3EH 4C4VB 5CMDA 1A8VA 2AL3A 1OXTA 4TV3A 2HIVA 5GADC 2O6VA 1FRRA 3ULJA 1G6ZA 2VQFL 5ELNA 3E0JA 5D7GA 2VH1A 4NP5A 1F9QA 3DHIC 1PGBA 3NY5A 2KO3A 1VQMA 4I6NB 3L9AX 3A74A 2X38A 3JSVA 4MSMB 1UE7A 3S9WA 4WAAA 2KWVB 2WDVB 4FADA 4BBRH 5G3LF 1S5ED 1LTBD 2K03A 3CHBD 5E6JA 1XF5L 3QWNA 1I35A 3CCVA 3AB9A 1YHBA 3QIJA 4HJKA 4MACA 3EC8A 3WAOA 4DR5L 4NQKE 3J80i 3HOYG 2NMQA 4HIKA 5G55A 4DUYQ 4KKSA 2Z6BA 2KOLA 4L2YA 4US9A 4P72A 4PZ7A 3MC9A 1XNQL 1F77A 1MVKA 3I4MH 3VUYA 1A5RA 2ZCCA 2R2QA 2ZTCA 1H95A 3P1MA 3DWGC 1QOGA 2DZJA 2GBRA 1WCMG 1XMOL 4WJNA 2VS1A 3PUVA 1RL2A 2A73B 3S17B 1FCCC 5DLQE 3DBHI 3BZKA 2UXDL 4II3B 3Q3NC 2WXOA 3B1LX 3D4WA 4LCDE 1C48A 3QB3A 2ON8A 4EFOA 3A8KE 4I65A 3V6EB 2N78A 5IY0A 4KN4C 3E5SA 3Q3MC 1J8IA 2RMMA 3WOFA 2UUCQ 2K4KA 1SLJA 4TRDA 3WA0A 4YTPB 2JZZA 3I57A 5FK9C 3C0RB 2PCFB 4Q5VA 2ACZB 2FCNA 5E6NA 1LTAD 1K9MC 1LTSD 4G7OC 2F4VQ 4OX9L 3MXGA 4KN7C 4ANUA 1D1KA 4MIUA 4DGZA 4AUQC 1DOMA 2JQOA 2QW7A 2RDHA 4W9GA 4JLCA 3CAMA 2AQ2B 2NZ1D 5GXGB 2WINB 3A9KB 3KUZA 4B3TQ 2F3WA 1N8RC 3HOXH 1SNDA 4AYBB 4ZHOA 1VQGA 2H88B 2NTSA 2A68C 2LGDA 1KNEA 4LJZC 2XRSD 2JA8H 3AE8B 1HQRD 5I6WA 5EKLA 2C7MB 4EUTA 4F7XA 3H1UA 3I4NB 3BZCA 4NW2A 2ASQA 5J18A 1XPOA 3V05A 3VR3A 1QOBA 2N9PC 4DR6Q 5IGBA 1SRUA 4LF6L 2Q5WD 5IYDG 2C9WB 3MJWA 1HZCA 3GTMH 1FNVA 3S1RH 4QAYA 4WAFA 4XQNA 3MXNA 4JV5L 1TWHB 2HTME 4RHSA 1I3QB 2EJFC 4IZ8A 4IO9A 1X3QA 3N30A 1Y56A 4LLGM 3RPFC 4MM3A 1GUTA 1PTOC 5EE0A 2EJGC 2B2UA 2OTJA 1HR0W 2PYKA 4X3KA 3SEBA 2KJRA 4O1NA 2BT6A 5JOBA 2F0HA 2XWBB 4JI6L 1D5ZC 4DAVA 4KMUC 1ICWA 2UXBQ 2LASA 2GVBA 4QCLA 5EAYA 2PEAA 1EM7A 1PVOA 1WSPA 3AE5B 2MLBA 1C1YB 1HR0Q 2K75A 1VDZA 4X3TA 4PS8A 3E0EA 4RH6A 4WJ3M 1IYFA 2QILA 1LM8B 3J7AV 1FEHA 1OTRB 1GKHA 3MXUA 1B50A 3LWUA 4Z9CB 2MEKA 1YJWA 1TIID 3S1QB 4J3OD 3G6EA 3ERSX 3R8BA 4WJ4A 2YVCA 1PDXA 3M3JA 4YSYB 3NWSA 4H02A 2LGSA 4GOCA 2XK5A 3M95A 3M7GA 3R2TA 4JI2Q 4B9XA 1PV4A 2Z0EB 1K8MA 4DHZE 4H44C 3T3NA 2PVGC 2WAQB 3ZJYC 1OTCA 2Z9HA 4P74A 3VRBB 4NNJB 4CKEA 2FIDA 4H0LC 1PFSA 1YVCA 2MUYA 1MG8A 2HTHA 1I4RA 1YX6B 3RNAC 3IAM1 1KLVA 3VR2A 1FXIA 1YNJC 1YI2A
chains in the Genus database with same CATH topology
1NYRA 1PTOH 1JMLA 1LTTD 4A55A 2XVSA 2CW0C 2BA1A 2OT2A 3OOCA 2B2VC 5C0XI 3K0YA 4FNFA 3MWYW 3T51B 1D4BA 1P7FA 2KEDA 3AE2B 3BWUD 1B9RA 4ID6A 1LT3D 4ODGA 1RD9D 1E2ZA 1FNWA 1FGBD 3EQLC 1I4XA 4N6EB 1E0ZA 5KEEA 3AMUA 3W5VB 5IGCA 2JSVX 1CQVA 1PUTA 2FFKB 2J0TD 2BB5A 1AN8A 1SMYD 3FRPB 4IUTA 2E74C 4RNAA 2I46A 3QG1A 2AWNA 2EPBA 3CU7A 1N5XA 2GB1A 1L4DB 5IGGA 4CQNA 1EQVA 1SJED 3G6JB 3NVVA 4HJGE 1SE2A 1EY7A 4UDUC 4U673 3M4OB 3W1SA 5BYRA 5EGTA 1A3TA 3KF8A 1AYFA 3NHHA 2B2YC 2WB1B 3OHXC 4PMBA 4L1BA 1HZ5A 2IGDA 1ZOYB 1BMLC 4DQOC 1EEFD 1XTCD 5KYIA 1C79A 2RQXA 5HI1A 2DLBA 1NYQA 1SNQA 2L32A 1Q12A 1SSOA 3DWPA 4OHJA 2N88A 3DMUA 1T6BX 2JYEA 2NVYB 3NVWA 4DXGA 3FPUB 3I4LA 3PUZA 1JWBD 4ABNA 4LMQD 3PMFA 1SYFA 4C3HG 3DWQA 2BDNA 4QB4A 2WLBA 4XWWA 1W6JA 4A93B 2EY5A 5K36G 2B2WA 4NAWB 4RA8A 1I4PA 4B0EA 1EIGA 5EBCA 1A3UA 5D14A 1EY4A 3U9SA 4EGVA 3PUWA 3VR6A 4TKOB 2NN6H 2A69D 2W82A 1H9RA 4KKIA 2WU2B 1XCTL 2BTEA 4KY5A 2F0DA 1F0ZA 1G8ZD 1M8AA 3B2FA 2E2HB 2OEOA 4IQZA 1B9MA 4R8NA 1WYGA 5ELFA 1WTOA 1SNCA 2HDEA 3P4SB 3OWEB 4NDXA 1FD7D 2EYFA 3Q69A 1AP0A 4RKLA 2LFNA 1ZDXA 2FMMA 2MHVA 5C6AA 4G7ZC 5BN5A 1Y8PB 1SFOB 1ZXTA 1RYJA 1Z6HA 1WTRA 2G9HD 2ZXOA 4X3UA 2WKCA 5M5XB 2LHEA 2SDFA 1XLNA 2K1BA 4YTNB 4H13C 2F0IA 4ZOHC 1BF4A 3GTKB 2XN9C 2R92B 3AEGB 2IPKD 4CJ2C 3TBIB 4DNRB 2K7VA 3DM1A 3P1HA 4P16A 2IX3A 1TWCB 2ONQA 2PZWA 4OW0A 1SXTA 1HTPA 2BW2A 3S16B 3T13A 3EGRA 1HEZE 4FXDA 2A6ED 3JAME 3WDNA 1WCMB 1YN4A 2CU3A 2WP9B 4J8QA 4DF7A 2XSCA 5KNBA 1SNMA 3EROA 2GRIA 1QE6A 5I2XA 2MJDA 2PPBC 4R3DA 1ML0D 4PMWA 2B76B 3L7ZC 3SK8A 1UGJA 3TEWA 5JVG3 2WXPA 1ZYRC 3CKIB 4RGMA 3PZ8A 2VUMB 3QO2A 1LT5D 1EEID 5E1FA 2LS01 2K04A 5M5WB 2DWQA 1HTLD 1Q1BA 5M9OA 3P4QB 1GAQB 2K5WA 4DAYA 2N9KA 3DEPA 3AM9A 4EE2A 2E2JB 1QF6A 3H91A 3RZOB 2HQEA 1VR9A 2CJNA 2R3ZA 5ELCA 3B2GA 1L0XB 2F0TA 1EY8A 1F2RI 5FLXE 3T56B 2EYMA 3ND8A 3Q8FA 2D62A 3RZDB 1IGDA 4KKJA 1LLRD 3TSSA 1Y1VB 4OO1G 3ZGZA 3S1NB 1D6EC 1WTPA 5LL6S 1E2VA 1H9SA 2K6AA 4IUNA 1Q10A 1E0BA 1ENCA 4FF1A 2ENBA 5CV6A 1IYVA 1EYCA 1YNTE 1T5EA 4KK7A 4IKGA 1CM9A 2WXQA 1QG7A 2YYZA 3ZJTA 2RBMA 2I2YA 1UUPA 2N55A 2NB0A 1PGXA 4L6TB 1ZXHA 3SHLA 5JAVA 3TP6A 1RWSA 2XWJB 5A2QE 3H0GB 3HRZC 2ID0A 2Q8RE 3AE7B 3R3OA 4IFDJ 3CIRB 1STGA 3TUOA 3J80E 1WTVA 1TY2A 2O5JC 5IIFA 3QIAA 2LJIA 1VDVA 1RCVD 1U4PA 3BDLA 2IX1A 1IGCA 2EZVA 1VF7A 5G5GA 1IBXA 2AQ3B 1FYCA 5C4HA 5CC4A 2WIIB 1LO5D 1TS5A 2KQ4X 3K57A 2JP1A 4C1NK 3C46A 3Q24A 4OVZA 3BDOA 2MPMA 2K05A 3H6MA 3D3RA 2HCIA 1S4ZA 4DAPA 1FIQA 1RDPD 1B9NA 5CBAE 3EJIA 2RPVA 2HDLA 4GZYC 1LTID 1JOKA 3U2SC 1V43A 1CZGA 1TWFB 3AE9B 2LY7A 1EFID 3HVZA 2KCNA 1V8CA 1TT2A 1UWXA 2OEDA 4HTHA 5CV9A 2AWOA 1G91A 1WGKA 4KY7A 4ZQ3A 1CJEA 4MM3B 1NSNS 2MJEA 1LTRD 1DONA 3PO3B 3NTHA 4L8JA 1MSGA 4C2MB 2OHFA 1O7YA 1HZ6A 1QILA 3TZUA 3OMCA 3H3VC 2JYOA 5KGUA 2EKIA 2MH7A 2R61A 2EYPA 1GUOA 3URYA 3Q8BA 1PRTF 3MJ5A 2ZXRA 4FXGC 3I73A 4YSXB 2R7ZB 2WXRA 1QT9A 2M00A 5IGEA 1EU4A 5J39A 4F8MA 1EY6A 1EIHA 3AE4B 3VQIA 1CHPD 1WTXA 1HUMA 1KLUD 2PMVA 4OZBA 1WD0A 1XLOA 3IL8A 2D5DA 2QF7A 2JZPA 2NTTA 3A7LA 2KUMA 1CT1D 2KQ3A 5ELBA 1BCPD 1L5PA 1IKLA 3MFYA 1QCBD 4KKTA 1FO4A 1E7PB 3AMZA 3BS1A 3MA2B 3NZ3A 1IHZA 1SAPA 3TEZA 3W2DA 3NWTA 2N0SB 4HSPA 1DXMA 2F0JA 4XQQA 3GV6A 1OXUA 3ZJUA 3BZDB 1SE4A 3DWAA 4XXEA 3CWIA 2X6GA 2JU6X 4NKLA 4S3SA 2JQRB 1PRTB 3HOUB 5M5YB 4K2KA 2AX5A 2D5GA 3MP9A 2E76C 5M3MB 3P20A 5E4XA 2WNMA 2SNSA 3HKZB 2JXMB 4OIJA 4C80A 4A3JB 3K5NA 1HCZA 2G9DA 5E4WC 2JSOA 4YTMB 1FFUA 4R8IA 2EY1A 4K6DA 3U4EG 1L0VB 1TWGB 2L0CA 2B2TA 1EZ6A 4CJ1B 3DWMA 3G7LA 1BCPF 1STAA 3W5UB 2QSDA 3GD7A 3VR4A 2J53A 1TYGB 4DNTB 2F1MA 4ZAIA 3PV0A 1O7ZA 1EY9A 4K8JA 4KGTA 4IFDH 3PUXA 1CZWA 3DHQA 2AQ1B 3AE1B 1YN3A 1X3PA 4HMIA 2JX5A 5T1GA 3RUZA 4FF2A 1XLPA 3WCQA 3NBHA 4I7ZC 2E2IB 1DOXA 4TQUS 3I91A 2K9XA 4PV1C 1Z47A 2QEJC 1STNA 1GJXA 2HUGA 1DOIA 2KA7A 1JROA 5DEHA 3NSWA 1WXQA 1XO3A 1C76A 1A2TA 3U9OA 1GUSA 2PO4A 3C3LA 1T5XD 1N63A 3VRAB 2PKOA 3K5OA 1JOQA 2WXMA 4P2CB 4ZUIA 1L0YB 1MPEA 3A8JE 4M8AA 2LMCA 1ACCA 2F3VA 3TZDA 1STHA 1Z7TA 4IUQA 4WRDA 4MH8A 1MD2D 2WXJA 4FF3A 5IGFA 1BCPB 4M1UB 4JWUC 4XYOA 4L63B 4ZYSA 2F0FA 3HZXA 2EELA 4A3DB 3AU7A 5EQ0A 1KAAA 1LT6D 2R6GA 4OO1I 1B2TA 1A3VA 4HEA1 1QKZA 1TKYA 2V3PA 4HSVA 1SE3A 1L4ZB 4F87A 1FRDA 4FXCA 1B4OA 4XTCS 4Q0FA 2NVXB 5BYSA 2K32A 4D2KA 2B2UC 3OPOA 5AUKA 2VB2X 3ND9A 4KD4A 2TMPA 2WDRB 3N6RA 3GS2A 3RLFA 3NVYA 1HFNA 1Q3LA 4YXDB 4CGYB 1DCZA 1O7LA 3S2DB 3H8HA 4HCEA 3FDTA 2WS3B 2RA4A 1YQ4B 3P75A 3S2HB 1FR3A 1W6KA 3A54A 2CQAA 1J9OA 2RVLA 4KJNA 5FR3A 2QKIC 3KWVA 1V1OA 5H92C 3SVMA 2C5CA 1TZOA 3GB1A 3PZ7A 1SNOA 3MZ5A 1SIJA 2BBCA 5EE1A 4K8IA 1DGJA 1MI2A 4ILWA 1A15A 3PO2B 2OF1A 1L6UA 4LK1C 5F2DA 3BDCA 3B9JA 4G4KA 3MAQA 1CA6A 4Q2JA 3ABVB 3HP3A 2DY7A 2Z4HA 4WFN3 2WV6D 3NBIA 2K01A 4H2AA 3KUPA 4A3IB 2INPE 1WVLA 5C0XJ 1NR4A 1JRPA 5I9OA 2H4OA 2O2LD 1PRTC 1VZ7A 3AEEB 2K0PA 1QNUA 3SFDB 3FVQA 1V1PA 3H09A 5C4JB 1NEKB 4IUUA 4JBWA 3Q23A 4RGNA 1TKEA 1RHPA 4ULLA 5BMIA 3ZYYX 3E6ZX 2DNEA 2F0NA 2Y5PA 4K5WA 1C77A 1EWHA 2KDMA 1TVXA 1MBYA 1H9SB 2YU9B 2Y3AA 2F0SA 1KABA 3K59A 1J7BA 5IT9L 1JOOA 1UEAB 2K5QA 4V0BA 1PDQA 1S5BD 3NTIA 1D2BA 2EY2A 1VZ6A 5T1IA 1U4RA 3RD4A 2PNRC 3EA6A 1JWAD 2IGHA 4B08A 1JQYD 1RKNA 3SK5A 2WXHA 5EBDA 1P7EA 1U4MA 5FOBB 1QOFA 4C7YA 1NR2A 3SR6A 1EWCA 3HVDA 1I6VC 1DOLA 3X3NA 4DFAA 2B2WC 1JE4A 1PFMA 1Q1EA 3OIQA 4KHZA 2NWGA 4FO2A 2L4NA 1C8CA 2M9VA 2PQEA 2K3UA 5JJZA 1BQQT 4FVMA 2IWHA 2WXGA 1I6HB 1VMPA 4KJOA 4BBSB 1AEXA 1SJHD 4TQ1A 1LACA 1YN5A 3S1MB 3J81L 1IBXB 1QOHA 2NN6G 5JEAJ 4ZHPA 4DK0A 4RGOS 4HKQA 1ESRA 1R4PB 5FO7B 1N60A 2M0AA 3M85A 3PO0A 1BCPC 1ILQA 1GPXA 1WD1A 3A56A 5C3JB 4PQXA 5T8IA 3HOYB 1CK1A 3C1FA 5EPKA 2EY6A 2X6LA 3MC0B 3J9CA 4XQJA 4RCOA 4QUFA 5I9PA 1E9MA 2ZT9C 1QOAA 1HFGA 1IYUA 4KI0A 5LHY1 5JPMC 4FYDA 5NUCA 1RM6C 4JE3B 3Q0AA 2A68D 2H89B 1D1IA 1STEA 3C1EA 1R7SA 2PVOD 4A3EB 2KACA 5I2YA 1PZJD 4MT5A 1H9MA 4R9WA 3RFZB 1I4HA 1NAPA 4FXKC 4OGQC 3NUCA 1ILPA 1J7AA 1EQTA 1PTOD 4US8A 1CQFA 2LEKA 4XT3B 3EUB2 2L9HA 1TWAB 1NENB 3E9SA 4HKZE 1RJTA 2EDGA 4X3SA 1OQQA 4XIGS 1D5MC 1FMAD 4KHVA 3LNNA 5D7GA 2BS2B 5EKIA 3O13A 3K58A 4ZRQA 1BNZA 2TSSA 3I4MB 2BB6A 1CHQD 1SNPA 4HEDA 4JX1C 4EQNA 1K53A 3A55A 3QOJA 4IUPA 5C0XH 5C5LA 4HROA 4N9TA 2RSOA 2WXIA 4IALA 2CHBD 2PW7A 4XT1B 2L1BA 1YNJD 5EPLA 1Y8OB 1CTMA 3KLSA 2QIEB 1F9PA 2CW0D 1JW9D 5CV4A 1JR0D 2EVBA 3K5MA 3NXWA 4YT0B 3AB5A 5CV8A 2IJ0A 1IKMA 2F0LA 1JWMD 2J7ZA 5J1ZA 4P6VF 2M56B 4XDXA 1F2YA 1SSNA 3J7AF 1PTOF 4UAIA 2F0GA 1L6VA 2JA8B 2KHSA 2HCCA 3MVVA 1HA6A 4U68A 2F0OA 5AUIA 4NMZA 3I9V1 1IL8A 3E56A 2WACA 3S1RB 5EE3A 1PMRA 4E6IA 1QNKA 3NQTA 2PTLA 3NPPA 3OWFA 5J22A 3GTGB 4RCNA 1XCQL 5C0XG 1JC7A 1Y8NB 5DAUA 1TS3A 3V3XA 4C7ZA 3KBXA 4PNYA 2HDMA 3VYRA 2LKVA 1IUEA 1K83B 4TQ0A 1TQOA 2NVTB 1SBBB 1H9JA 2EYLA 1PYWD 4LTUA 4EQOA 3NRZA 2F03A 3ZQ4A 2DNCA 4BA2I 4KKUA 4GLSC 2V4IB 1RODA 3FMCA 2NYZD 4RHRA 2J4XA 3FEWX 1ZE3D 1WTQA 4DN4M 5JEAH 3FILB 1SMYC 2PZTA 5LL6X 3FPPA 3IFTA 4BA1I 5C3XA 3D6WA 5AFWA 2ZW0A 2VNUD 2QDBA 1FCLA 5COYA 1KFYB 2BDOA 2DY8A 1WWTA 2LMCB 3VYTA 3M7NA 3GV3A 1A70A 3LYYA 1ZEQX 2Z4IA 1M4VA 2MP1A 1QLBB 4XE0A 4MN3A 3BK1A 1S5FD 2IGGA 3KQ4A 1HRJA 2JE6I 1GHKA 4BWGB 2KECA 3NE5B 2W3SA 4C3HB 1BBXC 3TDQA 3P7JA 4IN3A 5MPOA 3OMGA 1PFNA 4RF0A 2Z1CA 1H9KA 1KF6B 5ELDA 3Q8AA 1SEBD 4WORA 1VJKA 2CVRA 2I38A 1E10A 5KNDA 1C78A 3P63A 3GTOB 1C9FA 5K5PA 2H1EA 4DK1A 1MHXA 4XWTA 1ET6A 3L4PA 1V8QA 1PZKD 1EYDA 3MXPA 5FKAC 2FE8A 1JQ4A 2A74C 4V190 2KJXA 2K22A 2MJ3A 4KV6A 1VRAB 2M19A 3D31A 1GUWA 4ZKBB 1EOTA 1Q8IA 1EYAA 5DNFA 3TEYA 3BVGA 2EOTA 3Q22A 5G3LD 2EE1A 3NVZA 2YEPF 4HAEA 1KH0A 4OIKA 1F2LA 1GUNA 1U9RA 3NUHB 2PLPA 2A5HA 1ZDVA 1B53A 1V97A 3AH7A 4A3BB 1TKWB 1K8OA 4LK0M 3ZJVA 3QJYA 2BOSA 4RAUC 2IX0A 2A69C 1I4GA 2F0EA 1K52A 1C4QA 3SK6A 1I7HA 1I50B 2WDQB 4KX6B 4XDCA 2AUKA 4FP5D 2K28A 4OZAA 2NN6I 5C4XB 3SDZA 4HR7B 3L3OC 2E75C 1B1ZA 2RDFA 1C4PA 1NVID 3AV8A 3F2UA 4ARCA 5CORA 1F2RC 3NK9A 1N61A 1YMHE 4A90A 1HHVA 1FFVA 1FM0D 4AS1A 1B44D 4WWMA 3W3AA 1BOSA 2L83A 3ONAB 3CRKC 2F0VA 4M0WA 2JXTA 1S5CD 2D9UA 3EVQA 4B9WA 2YEPB 5BMHA 4RWSC 3S14B 2A6HD 3Q8EA 1ZYRD 1V1PB 2JYTA 2WXNA 2IW3A 3AE3B 2L11A 1HXYD 2PZUA 3GTQB 3AEDB 5JXVA 2KN4A 1TY0A 3TP5A 3AEAB 1ENFA 4ZUJA 1GXDC 3KLRA 1NCVA 4C3IG 5D3DA 2J42A 2B2TC 3VR5A 3FILA 4K6LA 4A3MB 3GP7A 5HGTA 3OIPA 4JK1C 2JA6B 2F4IA 2SAKA 1RTNA 2A6EC 2BA0A 4WURA 1BUIC 1AZPA 1NUCA 1Y1WB 1DM0B 3KBGA 1MI0A 2N7JA 2FHTA 2PIAA 4FF4A 4C3JG 1LT4D 1KNAA 1YQ3B 3LWEA 3P42A 2SOBA 1SYCA 3N9YC 1KDCA 5C3EB 1ET9A 3I70A 3BG3A 4IFDG 5A35A 3IKJA 2F0WA 2E2DC 3S15B 2B8GA 2B2VA 4OZCA 2E3TA 4KD3A 4K5XA 1PXUA 1B3AA 3HOZB 2WXLA 5IOCA 5EJWA 3R2IA 3K5LA 4A6QA 4H7BA 5IODA 3M4YA 5LNK1 3J7YW 3R93A 1GOZA 1EY5A 3OW7A 3OSOA 5CV7A 2N9LA 2PW9A 1X32A 3C2PA 4KGRA 4BS9A 4Y7NB 1JWUD 1KTKA 4A8XC 1A2UA 4J1MA 1VMCA 3HS0C 5IGDA 3BYYB 5HFYA 2MJ8A 4N58A 2VZKD 1SF0A 2AUJD 4AQ7A 2B2YA 4REZA 1VLBA 4KTAA 4QF4A 2W54A 3KLSX 3TEXA 5BN4A 3IXSA 3CRLC 1STYA 3ERQA 4HRSA 1FXAA 1SYGA 3D8GA 4CHTB 3IAYA 3RMHA 3KWLA 4PT5A 1UNSA 4MHEA 5BMGA 2L5TA 3VYSA 2BE5D 2PW5A 3FKIB 2L55A 2MGSA 3ITPA 5EE9A 4BY7B 4G57A 2J52A 4O42A 1BO0A 3HOWB 3FAHA 5K36H 1ROEA 1FD6A 1XX8A 2K33A 3JAML 5G5HA 2BCOA 5TSSA 3HRDD 1OO9B 1C4AA 3IT6B 4BY1B 3D6CA 4HCSA 4ME5A 1YNND 1IW7D 1TS4A 1KRHA 5C5MA 5BYQA 3SE0A 1T3QA 4ZRPA 4K14A 4CKCA 4GDKB 3EFXD 3LB8C 1DOKA 2RKSA 2IT1A 1UAPA 4KY6A 3IAS1 3HEJA 3I90A 4XDDA 5I4DA 1TKGA 2GA4B 1AZQA 3VA7A 3WOEA 3MFGA 1E6EB 4A9AA 2B39A 4RGTA 1HUNA 2WP8J 3AECB 2FINB 4RKBA 3A7AB 4A3KB 4A3FB 1JICA 5D65A 1I4QA 1DZ1A 2CJOA 1QQRA 3MHBA 4GDLB 1PGAA 2LGIA 2KAJA 3A8IE 1K50A 5FLXL 4NJCA 3SXHA 2K5DA 3HUIA 3GTPB 1K51A 2BS4B 3W9CB 1DD2A 3BYTB 5EPJA 3FC4A 1E2WA 2FJ2A 1TU2B 3VR8B 3K6OA 1XXGA 2WQYB 1F2MA 2JA5B 2V4DA 1BR9A 1N5WA 5CBEE 2ICEC 1R9TB 1GHJA 2Y0SB 1ONLA 2IL8A 5C4ZA 2FMCA 2Y5CA 2X69A 1G2SA 3DUZA 1QJOA 2FBWB 2DYOA 1CI3M 3NQIA 5JVH3 2INNE 2VZKB 1EZ8A 1GB1A 5KRUA 1FNUA 1LV9A 2EXZA 5JPNC 4F88A 1KLGD 1XEEA 3P4PB 3PIO3 2R93B 1DYQA 2K5PA 5CR3A 5A2QL 1QB5D 2WXKA 4NAMA 3DEOA 4USAA 1WTWA 2FUG1 3MHZA 2SEBD 1OFFA 3M3YB 1AFPA 4CJ0B 1ZUD2 3IT4B 3Q6SA 3J80L 3VYUA 2ZXPA 2L12A 3I8ZA 4YIJA 3SR1A 2QJLA 1JALA 1OXSC 2I07B 3V2TA 2LHDA 5C44B 1KDBA 5D3IB 3I72A 1GUGA 2F0KA 3Q8CA 4J6HA 2RSNA 1ZPSA 1AW7A 2JEBI 3QOLA 4DXFA 3LXFA 5C2TB 3T4AC 2WU5B 4KGSA 1Q90A 1RFKA 2Z8LA 4IDIA 4B0MA 3ETRA 3T53B 4K5VA 4EVOA 1J7CA 1ESFA 1SYBA 2F0QA 3X3MA 1TJEA 4OO1H 4BBRB 3HOVB 1U4LA 4C3IB 3T16A 1ZXIA 3VR9B 1YJJA 2KMMA 2XIWA 3N52A 5DM63 5CGKA 2A6HC 3H94A 3K7AB 3VA5A 2ICIA 4YSZB 1HQMC 4ZK9B 1JWSD 2O5IC 3GO5A 2BYTA 1G291 1XYIA 5IT9E 1TS2A 4C3JB 2ZW1A 2L1AA 1O80A 1CA5A 2JEAI 4WIPA 5HG2A 4YWGG 3P4RB 4PMCA 4IFDI 2C9OA 2B8FA 4WH4A 3IFDA 4HMJA 2F0PA 1Y69U 3MEHA 4A3GB 4ZKCB 5KYLA 2O4XA 2DN8A 3MTSA 1PLFA 1STBA 3PIP3 5ELEA 4IOIE 2KEEA 3D4DA 3BVZA 3HGBA 2KWDA 4JWSC 2EYHA 3HOXB 5CYUA 1CFMA 3GQBA 3DXJC 1KDAA 4DA2A 1RF2D 4ZLTF 1SYDA 3PUYA 5DM73 2F0UA 2Q8IB 1N62A 3TP8A 3GTMB 4RFBA 4L23A 5EKKA 5H8YE 4QUCA 3J81E 5HHDG 2W55A 3BVMA 2NUCA 4HN7A 1ZP0B 1F9RA 2M2LA 1UWMA 2Q8TA 4XYQA 1OXXK 2EYOA 1C4CA 4C1NI 3I3CA 1HPCA 4EQPA 1RTOA 1BUVT 5KNCA 4ARIA 1VF5C 2KCCA 4QIWB 4DU9A 1YJIA 1EL0A 5FO8B 3V96A 1II3A 4N9PA 2EJMA 5I6YA 4OL7A 2DBYA 4CKBA 2OXPA 3D4RA 2WKDA 2BS3B 1PRTD 1SDFA 1LTGD 1EWYC 4NZLB 1D5XC 1OQRA 3C8YA 1PTOB 2WXFA 5BN3A 1HA5A 1EY0A 2VB3X 4QMGA 4IUVA 4ZRZA 1ZKOA 1ENAA 2DYMA 3UI2A 1F2ZA 3TMEA 1G2TA 5M3FB 1BDOA 4TSSA 3SFEB 1VCIA 1SYEA 2LFIA 1EU3A 3GTJB 2XNAC 3AN1A 3U52E 1R4QB 2EYJA 3UI3A 3TN2A 1F9SA 2KVMA 3SK4A 2JA7B 2G1EA 3NP8A 3GTLB 5ISRA 4N59A 1MSHA 3BIID 2BE5C 2QCPX 1SB3C 3U7ZA 1OXVA 2QMTA 1A6XA 4WJWA 1PFBA 1QWYA 1WRIA 2VXWA 3T3OA 2V0GA 2IDYA 1MGSA 4G7HC 2V3NA 1O78A 1XLQA 1CZPA 3TP7A 4K2LA 5JEAG 4WQMA 2RDGA 1YNNC 1IW7C 2NVQB 1GB4A 2D2CC 2B63B 2PMZB 1MHHE 2LUMA 5E3FA 5HURA 4RF1A 1AWDA 5C3WA 3BK2A 2E6XA 1PFDA 2NBFA 4ITKA 2L52A 5FO9B 1LABA 1JORA 3AEFB 1JB3A 1XWEA 1TR5A 3NS1A 1JCKB 4TMAB 1VZ8A 4CBVA 2JWUA 2SNMA 1DOYA 5CV5A 4IURA 3AE6B 4LAAA 3LX0A 1S5DD 3CQZB 2F0MA 1PZID 1NI3A 5KIXA 3HG9A 4C56C 4JPSA 2XRQD 2W3RA 1BXTA 1DJRD 3NTKA 3AEBB 3KK7A 2GI9A 5CMDA 1OXTA 1FRRA 1G6ZA 3E0JA 4NP5A 1F9QA 1PGBA 3L9AX 2X38A 3S9WA 2WDVB 5G3LF 1S5ED 1LTBD 2K03A 3CHBD 5E6JA 1XF5L 3QWNA 3AB9A 4MACA 2NMQA 4KKSA 2KOLA 4L2YA 4US9A 1F77A 1MVKA 3P1MA 3DWGC 1QOGA 3PUVA 3S17B 2A73B 1FCCC 2WXOA 3D4WA 1C48A 3QB3A 2ON8A 3A8KE 4I65A 4KN4C 3E5SA 1J8IA 2RMMA 3WOFA 4TRDA 4YTPB 3I57A 5FK9C 2PCFB 4Q5VA 2ACZB 1LTAD 1LTSD 4G7OC 3MXGA 4KN7C 1D1KA 4MIUA 4DGZA 1DOMA 2RDHA 2AQ2B 2NZ1D 5GXGB 2WINB 2F3WA 1SNDA 4AYBB 4ZHOA 2H88B 2NTSA 2A68C 1KNEA 4LJZC 2XRSD 3AE8B 1HQRD 5I6WA 5EKLA 4F7XA 3I4NB 4NW2A 3V05A 3VR3A 1QOBA 5IGBA 2Q5WD 4WAFA 1FNVA 4XQNA 3MXNA 1TWHB