2KJ6A

Nmr solution structure of a tubulin folding cofactor b obtained from arabidopsis thaliana: northeast structural genomics consortium target ar3436a
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
97
structure length
97
Chain Sequence
b'MGHHHHHHSHGDDSVHLHITHANLKSFSADARFSPQMSVEAVKEKLWKKCGTSVNSMALELYDDSGSKVAVLSDDSRPLGFFSPFDGFRLHIIDLDP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Tubulin folding cofactor B
publication title NMR Solution Structure of Tbulin folding Cofactor B obtained from Arabidopsis thaliana: Northeast
rcsb
source organism Arabidopsis thaliana
molecule tags Chaperone
total genus 17
structure length 97
sequence length 97
ec nomenclature
pdb deposition date 2009-05-22
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 2kj6A01
4ZRJA 1UBIA 5C23A 2MBBB 2WDTB 4FJZA 2MCNB 3DOWA 1WXMA 4BKGA 2A5UA 2O2VA 3D32A 3PVLA 4JGHB 5KHQA 4LJPB 4NAWA 3H1UA 2AWTA 2MLBA 2N4FA 3V6EB 2G3QB 1EO6A 3DCGA 2M17A 3VQIA 2MBHA 3A4SC 3QARA 1BT0A 2ZEQA 4F1SA 1FXTB 3PRPB 3PTFC 4BBNC 1P1AA 2LGYA 2GBKA 1R4NI 2ZCCA 4K7WA 1WXVA 2IO3B 2NBUA 2BYFA 3VVWB 2HTHA 2BF8B 3M63B 3ZKJC 3VTUA 1E90A 4HLEA 2M0XA 2I1KA 4IC7B 4RM8A 3ZNID 2LVQA 4TUUA 5GMVA 2BWES 5JH5C 2Z0EB 3AXCA 1MG8A 3K9OB 2IO0B 4HPLB 1IP9A 3IHPC 2CHXA 4W9HA 3A33B 2CR5A 2ZVNA 1LQBA 2D07B 3WALA 4P7IA 1Q1OA 3PT2B 1ISNA 2ZZPB 3UGBB 2N7EA 3CF6E 2KDFB 1WMHA 4AP4C 4DWFA 2LXCA 2KTFA 4TV3A 3VUYA 2CHZA 2KK8A 2O6VB 3PREA 2FNJB 4HCNB 2GOWA 3GZNI 4E71A 3T9LA 1WF9A 3LJ3A 4K1RB 4W9IA 3H9DA 1YX6B 2C7NB 5DPRA 3A9KA 5KHOA 4NJ7A 2MA9B 2PPHA 2R2OA 1C1YB 3M62B 2J0MA 2DX5B 3CSFA 3OLMD 3TMPB 3UF8A 2V1YA 4DHZE 2DYMA 3VH4B 3PGEA 3DPDA 4PYZA 2B3AA 2WX0A 4MJSA 1QZEA 4JL9A 1WX8A 2KMAA 1E5WA 2MBOA 4II2B 1XD3B 2MP2A 4FBJB 1OEYJ 2JWZA 5CHFA 4GXBA 5LXHA 2HE7A 2RPQA 3PLVA 2BYEA 3V61A 4EKUA 3A1QB 4ANVA 2VRRB 4DDID 4A20A 4E3CA 4PS3A 4FLHA 1SE9A 4WWOA 2L0FA 5G2NA 3H7PA 3S2AA 2JVCA 5L83A 3KUDB 5CX3A 3B1LX 4GDLB 1Q5WB 3KW5B 2IY0B 2KFJA 5FR6A 3QQ8B 4WAAA 3N3KB 2V4LA 2KHWB 4IM2A 2XK5B 2EMSA 1P9DU 1GC6A 1WZ3A 3O65B 4ANXA 1R4MI 5DPWA 3QK0A 3KH0A 4W9JA 3X0WA 1ZKHA 5D6JB 1WI0A 3ZLZA 4KZCA 2FIDA 5AZGA 3QAQA 3ML8A 5C1ZA 3L10B 3QWZB 3VXWA 1WIAA 2MX2A 4HCPB 4M8MA 4DHJD 1RLFA 1WJ6A 3AULA 5D2MB 3L08A 3OJ3A 1KM7A 2IY1B 2OJRA 2ZCBA 3MTNB 2IBIB 2N1WA 3PRZA 1WXSA 1YQBA 1V6EA 2BYVE 2JY6A 3N32A 4NNJB 1E8XA 1WGDA 4KSKC 3TJPA 4AJYB 2K39A 4ZRKA 2KTRB 2DAFA 1WR1A 2MSED 2KFKB 2KWUB 2PE9A 3P2BA 1IYFA 2KOXA 4AOFA 4HWIB 4A3OA 3JW0X 3ZO5B 1YIWA 2L3ZA 5CHVC 4EZLA 3VUXA 2FAZA 1XT9B 2LWPA 2DZIA 3KYCD 4IM0A 5LXIB 1SIFA 4IW0A 4CYEA 1YD8U 2LZ6A 4KIKB 3R7QA 2LRWA 3ZNHB 1K8RB 3JSVB 2GBRA 4YL8A 1G6JA 3V6CB 4IWQA 1S3SG 3KVFB 1WX9A 2MBEA 5EDSA 2JRIB 3ZIMA 3NZSA 4HVBA 2YVCA 1WE6A 4KVGB 2FIFA 3OAWA 2JPHA 1NBFC 2KVRA 4G11A 3RYTA 3X23A 3ZVVA 4G3XB 1I35A 3AU5A 3TCAA 1J0GA 3WAMA 2LASA 5L95C 4DHZB 4K81A 1JRUA 4LCDE 3A4RA 1WJNA 3M3JA 4GDKB 4IWOA 2KDIA 3APDA 3R3MA 3DQVA 3ECIA 3WIMA 3JVZX 4BOZB 2NR2A 3KUCB 3PSEB 1GUAB 1WXAA 4G50A 4W9EA 2YLMA 4LDTD 4IM3A 1P98A 4URKA 3SHQA 2LD9A 2D11A 4FHKA 3L13A 1E7UA 1OEYA 5DPTA 3GOEA 4ANUA 4EUTA 2MWSB 4CO7A 4DK5A 4TQ0A 2KANA 3TBLD 3QJZA 2UWQA 3H6NA 5BO4B 4TQ1A 3A1QA 3NY5A 1KLVA 3ZTDA 4B6WA 3Q3JA 4PYUA 1V80A 3CSTA 1KJTA 2PEAA 1J8CA 4W9DA 5IAAC 3PPAA 4WQOB 5DPSA 3ZNGC 2JXXA 4KV2A 4NQLB 2K6QA 3HK0A 2IZVB 3MJWA 2LVPA 3NZUA 4ZDVA 1LXDA 4MGYE 2ASQA 5AZFA 3RCZA 3ZNZB 4DHJB 3PZDA 4FN2A 2KZRA 2CHWA 3W1YA 4FADA 4HXDA 4JLCA 4OVVA 5IA7A 1J19A 1WGHA 1XQQA 4NAWB 5HKHA 3EECA 3RUIB 2OOBB 1RAXA 4B9KA 2WWZA 4MEMA 3VHTC 1C3TA 1NDDA 1WH3A 2FCQA 2GBMA 4W9GA 1WM3A 1Q0WB 3PRMB 1PQSA 4PS7A 4XX5A 2J0KA 2REXA 4NQKE 2K8HA 3SDLC 2ZVOA 2L00B 2BKFA 3RT3B 4E74A 2KWVB 3NHEB 1A5RA 2C60A 1WFYA 4NPNA 4W9CA 4GMVA 3IBEA 4JIOU 4EFOA 2IO1B 5DCNA 4BKTA 3UQAA 2AEHA 5J2RA 1EF1A 4MSQB 4RM9A 5JHBA 3ZUNA 4MH0E 4FHJA 3U30A 3VTWA 2AL6A 4DDGD 2KTRA 3VH3B 3CMMB 1WZ0A 2NCNA 1EUVB 3AI5A 4GN1A 4ICVA 2KLCA 4FJYA 1WMHB 4KSLC 4GOCA 4WJQA 2ZNVC 2EKEC 3RD2A 2AL3A 3ZTCA 1WRDB 4X57B 3UINB 3VAWA 1V5OA 2I1JA 1NI2A 2KNBA 2N9PC 1D3ZA 2J7QB 1E8YA 3A9KB 2Y5BB 3ZRFA 2N9EB 4BBNF 2JF5A 1L2NA 2DYBA 3PS6A 1X1MA 3DVGX 3HIZA 2K8CA 2CKHB 3ZW3A 2MQJA 2BKRB 4BFRA 4WWNA 3HM3A 4I6PA 1S1QB 1RFAA 2JRHA 3DVNU 3MHSD 3QX1A 4MJSB 4LDTB 1H8CA 5JZEB 3BY4B 3IFWB 2MP2B 1V49A 1GNUA 4AWJA 1WE7A 2M4NA 3ZDMC 2DAJA 1OQYA 3UIPB 2DZKA 4EZJA 4F7ZA 2V3SA 3JYUA 4GGQA 2KJHB 2KLGA 3I3TB 4XZ4A 2IYDB 1UGMA 2JZZA 3L17A 2NS5A 3R66C 1LM8B 4B95A 2L05A 4IWPA 1WX7A 4HDOA 3SD5A 3U8ZA 1WM2A 1YX5B 2BWFA 3L0WB 4A3PA 2K25A 3PHWB 4GSWA 4MDKE 1EF5A 2LGXA 2G4SA 4FJVB 1E8WA 3A9JB 3UQBA 2IO2B 5D7GA 1P0RA 1UELA 4DXAB 2MW5A 2GBJA 2LJ5A 2O6VA 5AZHA 4ZYNA 4HDQA 3APFA 4HK2A 1TTNA 1U4AA 3DVNV 4MGKE 3RULA 3C0RB 2L76A 3DBLI 3NOBA 4JQWC 1E8ZA 2KXJA 2D3GA 2EMTA 3EFUA 4CHKA 2LXAA 3L16A 2R2QA 2MRPA 3B08A 2ZPYA 3ZRCA 4BKSA 2NVUI 5D94A 3QIJA 5E6PA 2G4DB 4M0WB 1VCBA 2A4ZA 2KD0A 3PV1A 3TIXA 4RMAA 4WJPA 2KMCA 1HE8A 2PJHA 4J6IA 2JZ3B 2GMIC 2LGDA 3QHTA 2BPSA 2NBWB 4MSMB 2KN5A 1GC7A 3AU4A 3WA0A 2XEWA 3QA8A 2KX0A 1UD7A 2MBQA 2LI5A 2NPTB 3N30A 4I6NB 4LJOB 1OTRB 3W1SA 2KDBA 2Z0DB 1VD2A 4DBGA 2FCSA 2UYZB 3ZDTA 3SU8X 4GIVA 3PLUA 2JT4B 2C7HA 2C5LC 3APCA 4XC2A 4EZKA 4GDLA 1GJZA 4K7UA 4MM3A 5J18A 1Z2MA 4I6LB 2M1MA 2NBVB 2N7DA 4MELA 1OGWA 3Q3FA 3PHXB 4G0NB 2O2VB 4KZ0A 2RD0A 1WJUA 2XK5A 3T8MA 2DYOA 1V86A 2C9WB 4W9LA 4W9FA 4EOYA 4GB9A 3V60A 1TBEA 3U7DA 3WANA 1GG3A 2KKCA 4GU2A 4TKNA 4FA6A 2K8BA 4MGIE 2DHZA 4MGZE 1UZXB 3UIOB 2FUHB 5TR5A 2KX3A 4ASWC 4WWPA 1P3QU 2KC1A 2ZNVB 5CTRC 5J17A 1T0YA 2C7MB 2KDEB 3LDZE 3ALBA 3DBRI 3IG3A 2K1FA 3R7RA 4W9KA 1LFDA 2D2QA 3B0AA 2KQ7A 1CMXB 1SGHA 3K9PB 1TGZB 2L8JA 4NJ6A 3V62A 3VFKA 4F8CB 1ZW7A 2BGFA 2DZMA 1ZGUB 3KYDD 3VUWA 2KFKA 3WAPA 3NS8A 1UBQA 5CHWA 3VTVA 2FCMA 3L54A 2KQSA 2XBBC 3OJ4B 1E7VA 4N9F4 4BOSC 1UH6A 2KC2A 3ONSA 5LLIA 4OVUA 1I42A 1Z5SB 4AUQC 4BVUC 1IPGA 3EHVA 1V81A 1AARA 1F9JA 2Z59B 4II3B 2CU1A 4KIKA 4NY0A 3DBSA 1V2YA 3JSVA 2WX1A 2L7RA 2ZPNA 2WYQA 2W9NA 1WGGA 1WGYA 3WAOA 1WYWB 4ZRIA 2K6DB 5AEKB 3A9JA 1WY8A 2N9XA 4WJOA 2DENB 2O6VD 2FCNA 3DBHI 3M95A 1Y8RC 2LUEA 2GBNA 3QCAA 3W1SC 2KJRA 3HHMA 2CS4A 1KOTA 2N1VA 2KJ6A 5E6OA 1YJ1A 4GDKA 5JHAA 3H7SA 4M8NA 1TZ1A 2HD5B 4BKSD 4AJWA 5E6NA 4ANWA 4KDLB 1V9JA 3H7PB 4HPMB 3ENEA 3QC8B 4FULA 1WR6E 1V5TA 2RR9A 4PS8A 2KWCA 2RGFA 2LVOA 3IVFA 4IG7B 1H4RA 3RZFA 4WJNA 2L0TA 2LRUA 2DZJA 3KUZA 4KDIC 2D10A 2KO3A 5G55A 1M94A 2G45B 2M8SA 4ICUA 2AYOB 2HJ8A 2QHOA 2J0JA 3HM6X 1RRBA 2ZJDA 3ML9A 2NPTA 2RSUA 3EC8A 4HJKA 3DDCB 3DVGY 2JUOA 3RZWC 3TL5A 1L7YA 4K7SA 3BINA 4EEWA 1WGRA 2PE6B 1WJ4A 4IUMB 3VDZA
chains in the Genus database with same CATH superfamily
1IGDA 1SE4A 1XLQA 4FJZA 2MCNB 5KHQA 2LHEA 2K0PA 3MJ5A 2MLBA 3V6EB 1HQRD 3VQIA 3A4SC 3QARA 1FXTB 2ZCCA 4WURA 2IO3B 2XNAC 1IUEA 2BYFA 3VVWB 2BF8B 3ZKJC 1E0ZA 3RNCC 4IC7B 3ZNID 3ZYYX 4HPLB 2IO0B 3IHPC 1N61A 1EM7A 2CR5A 2ZVNA 3EGRA 4P7IA 2J4XA 1ISNA 1YMHE 2N7EA 2KDFB 3Q8AA 1YN3A 2LXCA 4RGOS 3TSSA 1L4ZB 4YXDB 4W9IA 1PFDA 5KHOA 3R8BA 3VH4B 1J7BA 1ENFA 2Y3AA 4MJSA 2QIEB 1E5WA 1XD3B 2Y5CA 3BK2A 4KGTA 5LXHA 3GE3C 3PLVA 2INPE 3RNAC 4ANVA 4DDID 2MHJA 4E3CA 2N9LA 5G2NA 3H7PA 3ZJVA 3TEWA 3KUDB 3B1LX 1Q5WB 5BYQA 4WAAA 3AM9A 3N3KB 2KDMA 2BTEA 1V8CA 3O65B 1R4MI 3KH0A 3NVYA 1ZPSA 2LUMA 4OZAA 5D6JB 3AE6B 3ZLZA 3QAQA 1UGJA 2W54A 3L10B 3P42A 4EE2A 2IY1B 2OJRA 1E10A 1WXSA 3N32A 1V6EA 3MP9A 4AJYB 4NNJB 5HKHA 2KTRB 1WR1A 1RWSA 2PKOA 4AOFA 4HJGE 5CHVC 4JX1C 3GE8C 1WYGA 3KYCD 4IM0A 1F0ZA 1SIFA 3ZNHB 1K8RB 1L5PA 1S3SG 3KVFB 1VDVA 1WX9A 2LFIA 5EE1A 2R61A 2MBEA 3ZQ4A 1HA5A 2JPHA 1NBFC 2KVRA 3X23A 1JQ4A 3TCAA 4BAXA 1WJNA 3M3JA 4IWOA 4RH6A 2KDIA 2QILA 3DQVA 3ECIA 1XLNA 1MVKA 2NR2A 3KUCB 3FC4A 3MC8A 1T3QA 4LDTD 3SHQA 4FHKA 4EUTA 5HI1A 1EU4A 1KLVA 1KJTA 2KT7A 2BQQA 1VRAB 2RDGA 3NZUA 4HKQA 3BYYB 4NZLB 4HXDA 4KKIA 3RUIB 1IGCA 2MJEA 2WWZA 3AEBB 5C3JB 2D3CA 4PS7A 1FFVA 2J0KA 2TSSA 3I63C 4E74A 1UNSA 1SE2A 3IBEA 3U52E 2QSDA 2IO1B 1XCQL 4BKTA 5J2RA 1I4XA 4KGSA 2AL6A 1FXAA 2KTRA 4XGAB 4DDGD 5G5GA 1EUVB 2KLCA 4FJYA 1WMHB 5EE3A 3RD2A 2AL3A 3ZXRA 1V5OA 5HG2A 2KNBA 2N9PC 3A9KB 1MI0A 2JF5A 1LGRA 4JWSC 1QOBA 4M02A 4USAA 1X1MA 3DVGX 2CKHB 2RDHA 3VRAB 5H8YE 3C19A 3HM3A 5FK9C 1NYQA 1S1QB 1YNTE 3QX1A 1MJDA 1H8CA 3IFWB 2MP2B 1V49A 1WE7A 5G5HA 4EZJA 4S17A 4GGQA 2KLGA 2IYDB 3DHIC 1UGMA 4WIPA 1C9FA 3U8ZA 2BWFA 3PHWB 4GSWA 4MDKE 1EF5A 3UQBA 1P0RA 2MW5A 2O6VA 3NJTA 1RYJA 1FCLA 3C0RB 2L83A 1D4BA 1PGAA 3NOBA 4YSZB 2QDFA 1E8ZA 3EFUA 2EKIA 3L16A 3ZRCA 2NVUI 5D94A 2SAKA 1VCBA 2KMCA 2Z8LA 2JZPA 3ZJUA 1GB4A 1UD7A 5D3IB 1D5ZC 2FCSA 2INDC 4XWWA 2RPVA 2JT4B 3APCA 1C4PA 4EZKA 4GDLA 3WCQA 2VZKD 1GJZA 2WDRB 4I6LB 3LYYA 2M1MA 2NBVB 3PHXB 2O2VB 4KZ0A 4RCOA 4EOYA 4GB9A 3U7DA 3DBHB 2KKCA 4TKNA 4FA6A 2JU6X 3O13A 1UZXB 4ASWC 5J17A 1T0YA 4OZCA 4DQOC 2K1FA 3BIID 4R3DA 1LFDA 2KQ7A 1SGHA 4NJ6A 1YJJA 2KFKA 3AH7A 5CHWA 2FCMA 3L54A 1L6VA 4N9F4 2XBBC 4LNKA 1UH6A 2BT6A 3W9CB 4ARIA 1F9JA 4NY0A 2WU5B 1V2YA 3JSVA 2W9NA 3MC0B 1WYWB 1ZXHA 3AE2B 2N9XA 2DENB 2K22A 2O6VD 3DWMA 3DBHI 4BZAA 2KJRA 3HHMA 2CS4A 1KOTA 2N1VA 1YJ1A 5JHAA 5EE0A 2WXFA 3E9SA 4ANWA 2FBWB 1V9JA 1F77A 3IT6B 1PDXA 2RGFA 4MH8A 3T3OA 4KKJA 1H4RA 4WJNA 1I4GA 1QOFA 2BVCA 2L0TA 2LRUA 1TKYA 2ZW1A 4XDCA 4H2AA 2QHOA 2J0JA 3HRDD 1F2RC 1AWDA 5FKAC 3VDZA 2WDTB 2JQRB 4BKGA 2A5UA 2O2VA 3D32A 3N20C 2LGIA 2IJ0A 2AWTA 3PTFC 3PRPB 1R4NI 2OJWA 5D3DA 3Q3NC 4KX6B 1KH0A 2HTHA 4HLEA 4TUUA 5JH5C 1MG8A 4NJCA 2CHXA 1LQBA 1IBXB 3MFGA 3CF6E 4DWFA 2IGDA 3GS2A 2KK8A 1BXTA 1HTQA 2FNJB 3T9LA 4LLGM 3LJ3A 4K1RB 5DPRA 2C7NB 2R2OA 4ARCA 5HHDG 2J0MA 3CSFA 3TMPB 2NTSA 3DWGC 3KLSX 1SF0A 4PYZA 2B3AA 1Q10A 2KMAA 2MBOA 4II2B 1OEYJ 1VZ7A 4ZRQA 2HE7A 3V61A 4EKUA 3A1QB 2VRRB 4A20A 4PS3A 1EWCA 3VR8B 4WWOA 2FE8A 2L0FA 4N6EB 3L4PA 1C77A 2JVCA 4C00A 5L83A 5CX3A 1KFYB 3KW5B 4MT5A 2IY0B 4MM3B 3QQ8B 3AECB 2MEKA 2J53A 2XK5B 2EMSA 1P9DU 1WZ3A 4ANXA 4CQNA 3B9JA 2INCC 2NMQA 3X0WA 3BVGA 3BVMA 3ML8A 2BW2A 2JYEA 3VXWA 4HCPB 3DBLB 4DHJD 1E7PB 3L08A 2CU3A 1N63A 3B2GA 3MTNB 3TEYA 1TS5A 4KSKC 2K39A 1EU3A 1NVID 3AN1A 2WXGA 2E3TA 2MSED 1FRRA 1OFFA 4OVZA 4A3OA 1VZ6A 3VUXA 2FAZA 3P4SB 3FILA 5LXIB 4IW0A 4KIKB 3R7QA 1DOYA 1G6JA 4YL8A 1IBXA 3V6CB 5H92C 4L2YA 2JRIB 1WE6A 2X8XX 3RYTA 4G3XB 3AEEB 1J0GA 3WAMA 5L95C 2XN9C 4LCDE 2WHIA 4GDKB 3R3MA 3AE7B 4C7YA 1ZDVA 1WXAA 1RM6C 5BMHA 4G50A 3Q14C 1P98A 4URKA 3RMKC 2D11A 3L13A 1OEYA 4NAMA 1I4RA 4L1BA 3A1QA 2INNE 4B6WA 1JWAD 2QEJC 1TKEA 1MHHE 4FXCA 3PPAA 5DPSA 5IOIA 4KV2A 1TZOA 2IZVB 2LVPA 4LNFA 4ZDVA 1LXDA 3OWEB 4MGYE 2ASQA 3RCZA 1FNUA 2JXTA 3PZDA 4FN2A 2KZRA 3W1YA 4JLCA 5IA7A 1J19A 1XQQA 4NAWB 4RF1A 3EECA 3NG0A 2OOBB 5TSSA 1C3TA 1DYQA 1WH3A 2GBMA 1Q0WB 1PQSA 1ACCA 4XX5A 2K8HA 1AN8A 1JWMD 2L00B 3RT3B 4PK1A 3AE9B 4JIOU 1UWXA 1WSPA 2W55A 4MSQB 5IN7A 3VTWA 3VH3B 4LTUA 3CMMB 2NCNA 2WNMA 3AI5A 1DGJA 4JWUC 1QILA 2ZNVC 1N6ZA 2EKEC 3ZTCA 1WRDB 2WXRA 2K5PA 4A8XC 1NI2A 2J7QB 4BBNF 1PGXA 2Y5BB 1L2NA 3PS6A 1OQRA 3N1YC 1YN5A 3B2FA 3ZW3A 2BKRB 3AB5A 4WWNA 4YT0B 3DVNU 3BWUD 1C79A 2QMTA 2VH2A 1KRHA 4AWJA 4GLSC 2PW9A 2HDEA 2V9HA 2M4NA 2PVGC 2DZKA 3KWVA 5BMIA 4XWTA 1NENB 3L17A 3R66C 2I38A 1LM8B 4TMAB 4HDOA 3SD5A 3L0WB 2K25A 2DNFA 3Q3OC 2V3PA 1T5XD 1YQ4B 3Q3MC 4TSSA 1E8WA 3A9JB 2IO2B 4DXAB 4ZYNA 3APFA 2N0SB 3HVDA 4HK2A 2WXOA 3GZNB 4M00A 3DVNV 4MGKE 3RULA 2WXJA 1ZUD2 2WXLA 4JQWC 2KXJA 4CHKA 1C76A 2IGGA 3QIJA 2J52A 5E6PA 4M0WB 1N5WA 1T0QC 2LEKA 2G9HD 4J6IA 2PTLA 1GB1A 2BS4B 3QHTA 1XLPA 2Q5WD 4MSMB 3WA0A 3QA8A 3TEZA 3N30A 4ZRPA 3AE4B 3R2TA 3N1XC 4DBGA 2UYZB 4UDUC 4XC2A 4LNOA 4K7UA 5J18A 2H89B 2D5GA 2RD0A 1WJUA 3T8MA 4C4VB 3AE1B 2DYOA 2C9WB 4W9LA 4W9FA 3Q8FA 1GG3A 1FIQA 1F52A 2K8BA 4MGIE 1HTOA 2OHFA 2DHZA 4MGZE 3UIOB 2KX3A 3EUB2 2BS2B 3IAM1 1DOXA 2L52A 2KDEB 3LDZE 3IG3A 2ICIA 5AUIA 2L8JA 4MACA 3NVWA 4YWGG 4A90A 2DZMA 1FD6A 2D3AA 3WAPA 1UBQA 3VTVA 4LK0M 2LMCA 2KQSA 1Y56A 1E7VA 1HZ6A 5LLIA 3NRZA 4AUQC 4BVUC 1XXGA 3SFEB 1V81A 1SIJA 4II3B 2CU1A 1RFKA 3DBSA 2WX1A 2ZPNA 1WGYA 3WAOA 4DXFA 3A9JA 4A55A 3M95A 3AV8A 4RGNA 4RF0A 1HXYD 5E6OA 4JE3B 1D5MC 2GB1A 1QT9A 1TZ1A 4ZOHC 4KDLB 1FPYA 4HROA 1XF5L 4HPMB 3QC8B 4FULA 1WR6E 2AQ1B 2KN4A 3IXSA 3J9CA 1YOVB 1B9RA 3V3XA 1AW7A 2G1EA 3KUZA 1K50A 2D10A 5G55A 2G45B 2HJ8A 3HM6X 3RZWC 2JUOA 2LHDA 1L7YA 4YSXB 1WGRA 2PE6B 1QQRA 4IUMB 1F2RI 5C23A 1KTKA 1VLBA 3PVLA 2N4FA 2G3QB 3DCGA 1WXQA 2MBHA 2QJLA 1BT0A 4P16A 4AS1A 4BBNC 2LGYA 2GBKA 4WH4A 3P63A 2NBUA 1D6EC 3KQ4A 2SEBD 2M0XA 1SSNA 5GMVA 2Z0EB 3W2DA 3K9OB 3WALA 1UWMA 3PT2B 2ZZPB 3UGBB 3LXFA 1WMHA 1I7HA 2WP9B 1FCCC 1WF9A 2GI9A 1YX6B 4RNAA 3A9KA 4NJ7A 2MA9B 2PPHA 1CK1A 2K3UA 3BZDB 2V1YA 1C4CA 2DYMA 3AEGB 3PGEA 3DPDA 1TS3A 3BVZA 3KWLA 3ABVB 1QZEA 1WX8A 1JWBD 2MP2A 2JWZA 1KLGD 4GXBA 2X38A 3HUIA 2BYTA 3S2AA 3Q8CA 1SEBD 2M19A 2KFJA 5FR6A 4J3OD 2KHWB 4IM2A 3HVZA 5DPWA 2OEDA 4W9JA 4ZHOA 1ROEA 1J7AA 1ZKHA 1FEHA 4KZCA 3QWZB 2MX2A 2DWQA 1RLFA 2JWUA 2WXMA 3AULA 5D2MB 3OJ3A 1KM7A 2BB5A 2ZCBA 3PRZA 2ZW0A 2BYVE 3RI7C 3TJPA 1JALA 4RFBA 2DAFA 2KWUB 2PE9A 1IYFA 1GAQB 3SEBA 1JWUD 3AEDB 1C78A 2LRWA 3N9YC 4IWQA 5EDSA 2WDQB 4KVGB 4IKGA 3OAWA 1KF6B 4G11A 1K51A 3A4RA 3LB8C 3APDA 2N7JA 2BBCA 3WIMA 3JVZX 4BOZB 1GUAB 4W9EA 3I9V1 2I2YA 2LD9A 5DPTA 1E7UA 3GOEA 4ANUA 2MWSB 4CO7A 4DK5A 1ET6A 2KANA 4TQ0A 3QJZA 2PVOD 2UWQA 3H6NA 5BO4B 3NY5A 3ZTDA 2PEAA 1FO4A 2AQ3B 2QC8A 4W9DA 3ZNGC 4WQOB 2JXXA 4NQLB 2K6QA 1BUIC 3MJWA 4A6QA 5AZFA 1MHXA 3ZNZB 1FXIA 2EELA 2CHWA 1B1ZA 4OVVA 2IDYA 1WGHA 3RNGC 1NEKB 1RAXA 4B9KA 1FFUA 4MEMA 3VHTC 1NDDA 2KMMA 1CZPA 2REXA 4IOIE 4REZA 3SDLC 2BKFA 3NHEB 2FUG1 4W9CA 4GMVA 5DCNA 3UQAA 1EF1A 3U30A 3Q6BA 1QF6A 5E6JA 1WZ0A 3TUOA 3R2IA 4YSYB 1I4HA 4GN1A 3H8HA 4ICVA 1YN4A 4GOCA 4WJQA 3RNFC 2VH1A 3IAS1 4X57B 3VAWA 2L1AA 1VZ8A 1D3ZA 1E8YA 3ZRFA 2N9EB 3HIZA 2K8CA 4C80A 3P4RB 2MQJA 4I6PA 1RFAA 4N59A 3MHSD 4MJSB 4LDTB 3FKYA 5JXVA 2DAJA 3ETRA 3UIPB 4KGRA 2KAJA 3JYUA 3I3TB 2AX5A 2H88B 1TY0A 2NS5A 3AMZA 2L05A 4IWPA 1WX7A 1WM2A 1YX5B 4M01A 2JYTA 2KACA 5D7GA 1UELA 1L6UA 2LJ5A 5AZHA 4HDQA 1CJEA 1BMLC 1TTNA 3DBLI 4C56C 1E9MA 1T0RC 2EMTA 2LXAA 2PIAA 2MRPA 3B08A 4BKSA 3DBRB 2WDVB 2WGSA 3PV1A 3TIXA 4RMAA 2PJHA 4ACFA 1ZE3D 2JZ3B 4B0EA 2GMIC 2BPSA 2NBWB 2KX0A 3AEFB 2MBQA 2LI5A 5BYRA 2E6XA 2NPTB 2GRIA 4I6NB 3NVZA 3W1SA 3Q69A 2KDBA 1VD2A 3ZDTA 4O1NA 1TJEA 4GIVA 3PLUA 2C7HA 2C5LC 4K3CA 4MM3A 3PZ7A 1TY2A 3Q3FA 1OGWA 2V3NA 1C4AA 2XK5A 4QAYA 3V60A 1TBEA 1R4MB 4GU2A 1STEA 1PGBA 2CJOA 1M4VA 3PZ8A 1HZ5A 2FUHB 4WWPA 2KC1A 1MPEA 2L32A 2C7MB 3DBRI 3VRBB 3R7RA 2D2QA 3B0AA 1CMXB 2KQ4X 1FNWA 4F8CB 2DBYA 1ZGUB 2AQ2B 1XLOA 3VUWA 1ZOYB 2QCZA 3Q8EA 3PO0A 4BOSC 2YEPF 3ONSA 5EE9A 4L23A 2BS3B 1Z5SB 1UF0A 1V97A 3EFCA 3EHVA 2Z59B 4KIKA 1PUTA 2L7RA 1MG4A 2WYQA 1TS4A 4ZRIA 3ZGZA 4YTPB 2K6DB 1QOAA 5AEKB 4WJOA 1SBBB 3GP7A 4P6VF 2LUEA 4ZHPA 2CJNA 2GBNA 3AE8B 3QCAA 2M56B 3W1SC 2YEPB 4PT5A 2KJ6A 4C7ZA 4GDKA 3H7SA 3NS1A 5I4DA 2J42A 2HD5B 4BKSD 3TEXA 4AJWA 3U7ZA 2HJ1A 3BYTB 3ENEA 2RR9A 3T3NA 2KWCA 1HEZE 3RZFA 2VZKB 1JCKB 4KDIC 1M94A 5FR3A 1J7CA 4HJKA 1RRBA 3ML9A 2W3SA 2NPTA 1SJHD 1T0SC 3AE5B 3DVGY 3NVVA 4WQMA 3TL5A 1A70A 1L0XB 4K7SA 3BINA 5T8IA 3EA6A 2KWDA 2MH7A 1JW9D 3A33B 1I4PA 4ZRJA 5IP4D 4P1CC 1UBIA 2V4IB 2MBBB 3DOWA 1WXMA 4JGHB 5GXGB 4LJPB 4NAWA 3H1UA 1JROA 5IKCM 1EO6A 2M17A 2ZEQA 4F1SA 4US8A 4B0MA 1P1AA 1KLUD 4K7WA 1WXVA 3M63B 3VTUA 1E90A 3RNEC 2WXPA 2I1KA 4RM8A 2LVQA 1I4QA 2BWES 3AXCA 1IP9A 4W9HA 1E6EB 2D07B 3GB1A 1FM0D 1Q1OA 4ITKA 4AP4C 1D5XC 2KTFA 4TV3A 3VUYA 2CHZA 2O6VB 3PREA 4HCNB 2GOWA 3RN9C 3GZNI 4E71A 4JPSA 3H9DA 4LNNA 2WXHA 1C1YB 3OLMD 1L0YB 2DX5B 3M62B 3UF8A 4DHZE 4XYCA 2WXIA 1P7EA 1TKGA 3I5JC 3E56A 2WX0A 1UUPA 4JL9A 4D2KA 4FBJB 2ONQA 2KVZA 5CHFA 1L4DB 2RPQA 2BYEA 1ESFA 3CIRB 1P7FA 4FLHA 1SE9A 2M0AA 3CWIA 4HEA1 4HPPA 2V0GA 3IT4B 4GDLB 3DHGC 2V4LA 1JMLA 1OQQA 3Q2AC 1GC6A 3QK0A 2Y5PA 1WI0A 2FIDA 5AZGA 5C1ZA 2GLSA 3NZ3A 1WIAA 4M8MA 1V1OA 1WJ6A 3NUHB 4M0WA 2IBIB 2N1WA 2W82A 3OG5A 1NYRA 4XE0A 1YQBA 2JY6A 1E8XA 1WGDA 4LNIA 2K9XA 3MC9A 4ZRKA 5MPOA 1GOZA 2KFKB 3P2BA 2KOXA 4HWIB 3JW0X 2PLPA 3ZO5B 1YIWA 2KYWA 2L3ZA 4EZLA 1XT9B 2LWPA 2DZIA 5LNK1 4CYEA 1YD8U 2LZ6A 1SJED 1XO3A 2GBRA 3JSVB 5C2TB 1N5XA 4WWMA 1VJKA 3URYA 4C4VA 3RPFC 3NZSA 3ZIMA 4HVBA 2YVCA 2FIFA 3ZVVA 1TIFA 1ZP0B 3RNBC 1I35A 3AU5A 1EWYC 1XCTL 3SR6A 1WWTA 2LASA 4DHZB 4K81A 1JRUA 4YTNB 4WAFA 4DXGA 1QKZA 3PSEB 4Q2JA 1VR9A 2WQYB 2YLMA 1QOGA 4A9AA 3VR9B 3P4QB 4IM3A 1GPXA 3Q8BA 3RFZB 3MHZA 1ZXIA 4OW0A 3TBLD 4TQ1A 2B76B 2PMVA 3Q3JA 3P4PB 4PYUA 4RGMA 1V80A 3CSTA 1AYFA 1ZDXA 5AUKA 1J8CA 5IAAC 4IDIA 4YTMB 2WXNA 1TS2A 3HK0A 2RDBC 1YQ3B 1N62A 4DHJB 4S0RA 2LGSA 2UU7A 4FADA 1ET9A 2FCQA 4W9GA 1WM3A 3PRMB 4NQKE 2ZVOA 3ZXVA 4HKZE 2KWVB 2C60A 1WFYA 4NPNA 4EFOA 3W5UB 2AEHA 1XEEA 5JHBA 4RM9A 3ZUNA 4MH0E 1DOIA 4FHJA 4ZYSA 4AQ7A 2BB6A 4KSLC 4RGTA 3SFDB 3UINB 4HRSA 2I1JA 2DYBA 1TT5B 4BFRA 2LJIA 3N1ZC 4K3BA 2JRHA 2MJ3A 5JZEB 3BY4B 1GNUA 2WXQA 3ZDMC 1R4NB 1OQYA 4F7ZA 2V3SA 3AE3B 1T6BX 2KJHB 4XZ4A 2JZZA 1JWSD 1MFWA 4B95A 5BMGA 2RMMA 1L0VB 4A3PA 1FMAD 2LGXA 2G4SA 4FJVB 2IGHA 3UI3A 1V1PB 2GBJA 1CQVA 3AEAB 1U4AA 2L76A 1YJIA 2D3GA 4OHJA 2R2QA 2ZPYA 2G4DB 2N9KA 2A4ZA 2KD0A 4WJPA 1HE8A 2LGDA 1SB3C 2KN5A 1GC7A 3AU4A 2XEWA 1R7SA 4LJOB 1OTRB 5IO9A 2Z0DB 3SU8X 4P1BC 3W5VB 3FILB 4OZBA 3U4EG 1Z2MA 1K52A 2ON8A 2N7DA 4MELA 2DLBA 1FRDA 2D3BA 4G0NB 2JX5A 1V86A 3DHHC 2W3RA 5BYSA 3WANA 1QLBB 1FNVA 5TR5A 1P3QU 2WU2B 2ZNVB 5CTRC 3ALBA 4W9KA 1JRPA 3K9PB 3I57A 1TGZB 3V62A 5HFYA 3VFKA 2WXKA 1ZW7A 2BGFA 4US9A 3KYDD 1SXTA 3NS8A 3FAHA 3OJ4B 1NI3A 2KC2A 1WGKA 4OVUA 1I42A 1TYGB 1IPGA 3ZJTA 2WS3B 1AARA 1WGGA 3U2SC 3BK1A 1WY8A 1K53A 1V1PA 2ACZB 2FCNA 2MJDA 1Y8RC 1LO5D 2WLBA 2IPKD 1SE3A 3V05A 2NTTA 4M8NA 5E6NA 2JSVX 3C8YA 3H7PB 1V5TA 4PS8A 1F1HA 2HTME 2LVOA 3IVFA 4IG7B 4N58A 1N60A 2DZJA 2KO3A 2M8SA 4ICUA 1WRIA 2AYOB 2ZJDA 2RSUA 3EC8A 4XDDA 3DDCB 4EEWA 1PYWD 3P1MA 1WJ4A 1A5RA
chains in the Genus database with same CATH topology
4ZRJA 1UBIA 5C23A 2MBBB 2WDTB 4FJZA 2MCNB 3DOWA 1WXMA 4BKGA 2A5UA 2O2VA 3D32A 3PVLA 4JGHB 5KHQA 4LJPB 4NAWA 3H1UA 2AWTA 2MLBA 2N4FA 3V6EB 2G3QB 1EO6A 3DCGA 2M17A 3VQIA 2MBHA 3A4SC 3QARA 1BT0A 2ZEQA 4F1SA 1FXTB 3PRPB 3PTFC 4BBNC 1P1AA 2LGYA 2GBKA 1R4NI 2ZCCA 4K7WA 1WXVA 2IO3B 2NBUA 2BYFA 3VVWB 2HTHA 2BF8B 3M63B 3ZKJC 3VTUA 1E90A 4HLEA 2M0XA 2I1KA 4IC7B 4RM8A 3ZNID 2LVQA 4TUUA 5GMVA 2BWES 5JH5C 2Z0EB 3AXCA 1MG8A 3K9OB 2IO0B 4HPLB 1IP9A 3IHPC 2CHXA 4W9HA 3A33B 2CR5A 2ZVNA 1LQBA 2D07B 3WALA 4P7IA 1Q1OA 3PT2B 1ISNA 2ZZPB 3UGBB 2N7EA 3CF6E 2KDFB 1WMHA 4AP4C 4DWFA 2LXCA 2KTFA 4TV3A 3VUYA 2CHZA 2KK8A 2O6VB 3PREA 2FNJB 4HCNB 2GOWA 3GZNI 4E71A 3T9LA 1WF9A 3LJ3A 4K1RB 4W9IA 3H9DA 1YX6B 2C7NB 5DPRA 3A9KA 5KHOA 4NJ7A 2MA9B 2PPHA 2R2OA 1C1YB 3M62B 2J0MA 2DX5B 3CSFA 3OLMD 3TMPB 3UF8A 2V1YA 4DHZE 2DYMA 3VH4B 3PGEA 3DPDA 4PYZA 2B3AA 2WX0A 4MJSA 1QZEA 4JL9A 1WX8A 2KMAA 1E5WA 2MBOA 4II2B 1XD3B 2MP2A 4FBJB 1OEYJ 2JWZA 5CHFA 4GXBA 5LXHA 2HE7A 2RPQA 3PLVA 2BYEA 3V61A 4EKUA 3A1QB 4ANVA 2VRRB 4DDID 4A20A 4E3CA 4PS3A 4FLHA 1SE9A 4WWOA 2L0FA 5G2NA 3H7PA 3S2AA 2JVCA 5L83A 3KUDB 5CX3A 3B1LX 4GDLB 1Q5WB 3KW5B 2IY0B 2KFJA 5FR6A 3QQ8B 4WAAA 3N3KB 2V4LA 2KHWB 4IM2A 2XK5B 2EMSA 1P9DU 1GC6A 1WZ3A 3O65B 4ANXA 1R4MI 5DPWA 3QK0A 3KH0A 4W9JA 3X0WA 1ZKHA 5D6JB 1WI0A 3ZLZA 4KZCA 2FIDA 5AZGA 3QAQA 3ML8A 5C1ZA 3L10B 3QWZB 3VXWA 1WIAA 2MX2A 4HCPB 4M8MA 4DHJD 1RLFA 1WJ6A 3AULA 5D2MB 3L08A 3OJ3A 1KM7A 2IY1B 2OJRA 2ZCBA 3MTNB 2IBIB 2N1WA 3PRZA 1WXSA 1YQBA 1V6EA 2BYVE 2JY6A 3N32A 4NNJB 1E8XA 1WGDA 4KSKC 3TJPA 4AJYB 2K39A 4ZRKA 2KTRB 2DAFA 1WR1A 2MSED 2KFKB 2KWUB 2PE9A 3P2BA 1IYFA 2KOXA 4AOFA 4HWIB 4A3OA 3JW0X 3ZO5B 1YIWA 2L3ZA 5CHVC 4EZLA 3VUXA 2FAZA 1XT9B 2LWPA 2DZIA 3KYCD 4IM0A 5LXIB 1SIFA 4IW0A 4CYEA 1YD8U 2LZ6A 4KIKB 3R7QA 2LRWA 3ZNHB 1K8RB 3JSVB 2GBRA 4YL8A 1G6JA 3V6CB 4IWQA 1S3SG 3KVFB 1WX9A 2MBEA 5EDSA 2JRIB 3ZIMA 3NZSA 4HVBA 2YVCA 1WE6A 4KVGB 2FIFA 3OAWA 2JPHA 1NBFC 2KVRA 4G11A 3RYTA 3X23A 3ZVVA 4G3XB 1I35A 3AU5A 3TCAA 1J0GA 3WAMA 2LASA 5L95C 4DHZB 4K81A 1JRUA 4LCDE 3A4RA 1WJNA 3M3JA 4GDKB 4IWOA 2KDIA 3APDA 3R3MA 3DQVA 3ECIA 3WIMA 3JVZX 4BOZB 2NR2A 3KUCB 3PSEB 1GUAB 1WXAA 4G50A 4W9EA 2YLMA 4LDTD 4IM3A 1P98A 4URKA 3SHQA 2LD9A 2D11A 4FHKA 3L13A 1E7UA 1OEYA 5DPTA 3GOEA 4ANUA 4EUTA 2MWSB 4CO7A 4DK5A 4TQ0A 2KANA 3TBLD 3QJZA 2UWQA 3H6NA 5BO4B 4TQ1A 3A1QA 3NY5A 1KLVA 3ZTDA 4B6WA 3Q3JA 4PYUA 1V80A 3CSTA 1KJTA 2PEAA 1J8CA 4W9DA 5IAAC 3PPAA 4WQOB 5DPSA 3ZNGC 2JXXA 4KV2A 4NQLB 2K6QA 3HK0A 2IZVB 3MJWA 2LVPA 3NZUA 4ZDVA 1LXDA 4MGYE 2ASQA 5AZFA 3RCZA 3ZNZB 4DHJB 3PZDA 4FN2A 2KZRA 2CHWA 3W1YA 4FADA 4HXDA 4JLCA 4OVVA 5IA7A 1J19A 1WGHA 1XQQA 4NAWB 5HKHA 3EECA 3RUIB 2OOBB 1RAXA 4B9KA 2WWZA 4MEMA 3VHTC 1C3TA 1NDDA 1WH3A 2FCQA 2GBMA 4W9GA 1WM3A 1Q0WB 3PRMB 1PQSA 4PS7A 4XX5A 2J0KA 2REXA 4NQKE 2K8HA 3SDLC 2ZVOA 2L00B 2BKFA 3RT3B 4E74A 2KWVB 3NHEB 1A5RA 2C60A 1WFYA 4NPNA 4W9CA 4GMVA 3IBEA 4JIOU 4EFOA 2IO1B 5DCNA 4BKTA 3UQAA 2AEHA 5J2RA 1EF1A 4MSQB 4RM9A 5JHBA 3ZUNA 4MH0E 4FHJA 3U30A 3VTWA 2AL6A 4DDGD 2KTRA 3VH3B 3CMMB 1WZ0A 2NCNA 1EUVB 3AI5A 4GN1A 4ICVA 2KLCA 4FJYA 1WMHB 4KSLC 4GOCA 4WJQA 2ZNVC 2EKEC 3RD2A 2AL3A 3ZTCA 1WRDB 4X57B 3UINB 3VAWA 1V5OA 2I1JA 1NI2A 2KNBA 2N9PC 1D3ZA 2J7QB 1E8YA 3A9KB 2Y5BB 3ZRFA 2N9EB 4BBNF 2JF5A 1L2NA 2DYBA 3PS6A 1X1MA 3DVGX 3HIZA 2K8CA 2CKHB 3ZW3A 2MQJA 2BKRB 4BFRA 4WWNA 3HM3A 4I6PA 1S1QB 1RFAA 2JRHA 3DVNU 3MHSD 3QX1A 4MJSB 4LDTB 1H8CA 5JZEB 3BY4B 3IFWB 2MP2B 1V49A 1GNUA 4AWJA 1WE7A 2M4NA 3ZDMC 2DAJA 1OQYA 3UIPB 2DZKA 4EZJA 4F7ZA 2V3SA 3JYUA 4GGQA 2KJHB 2KLGA 3I3TB 4XZ4A 2IYDB 1UGMA 2JZZA 3L17A 2NS5A 3R66C 1LM8B 4B95A 2L05A 4IWPA 1WX7A 4HDOA 3SD5A 3U8ZA 1WM2A 1YX5B 2BWFA 3L0WB 4A3PA 2K25A 3PHWB 4GSWA 4MDKE 1EF5A 2LGXA 2G4SA 4FJVB 1E8WA 3A9JB 3UQBA 2IO2B 5D7GA 1P0RA 1UELA 4DXAB 2MW5A 2GBJA 2LJ5A 2O6VA 5AZHA 4ZYNA 4HDQA 3APFA 4HK2A 1TTNA 1U4AA 3DVNV 4MGKE 3RULA 3C0RB 2L76A 3DBLI 3NOBA 4JQWC 1E8ZA 2KXJA 2D3GA 2EMTA 3EFUA 4CHKA 2LXAA 3L16A 2R2QA 2MRPA 3B08A 2ZPYA 3ZRCA 4BKSA 2NVUI 5D94A 3QIJA 5E6PA 2G4DB 4M0WB 1VCBA 2A4ZA 2KD0A 3PV1A 3TIXA 4RMAA 4WJPA 2KMCA 1HE8A 2PJHA 4J6IA 2JZ3B 2GMIC 2LGDA 3QHTA 2BPSA 2NBWB 4MSMB 2KN5A 1GC7A 3AU4A 3WA0A 2XEWA 3QA8A 2KX0A 1UD7A 2MBQA 2LI5A 2NPTB 3N30A 4I6NB 4LJOB 1OTRB 3W1SA 2KDBA 2Z0DB 1VD2A 4DBGA 2FCSA 2UYZB 3ZDTA 3SU8X 4GIVA 3PLUA 2JT4B 2C7HA 2C5LC 3APCA 4XC2A 4EZKA 4GDLA 1GJZA 4K7UA 4MM3A 5J18A 1Z2MA 4I6LB 2M1MA 2NBVB 2N7DA 4MELA 1OGWA 3Q3FA 3PHXB 4G0NB 2O2VB 4KZ0A 2RD0A 1WJUA 2XK5A 3T8MA 2DYOA 1V86A 2C9WB 4W9LA 4W9FA 4EOYA 4GB9A 3V60A 1TBEA 3U7DA 3WANA 1GG3A 2KKCA 4GU2A 4TKNA 4FA6A 2K8BA 4MGIE 2DHZA 4MGZE 1UZXB 3UIOB 2FUHB 5TR5A 2KX3A 4ASWC 4WWPA 1P3QU 2KC1A 2ZNVB 5CTRC 5J17A 1T0YA 2C7MB 2KDEB 3LDZE 3ALBA 3DBRI 3IG3A 2K1FA 3R7RA 4W9KA 1LFDA 2D2QA 3B0AA 2KQ7A 1CMXB 1SGHA 3K9PB 1TGZB 2L8JA 4NJ6A 3V62A 3VFKA 4F8CB 1ZW7A 2BGFA 2DZMA 1ZGUB 3KYDD 3VUWA 2KFKA 3WAPA 3NS8A 1UBQA 5CHWA 3VTVA 2FCMA 3L54A 2KQSA 2XBBC 3OJ4B 1E7VA 4N9F4 4BOSC 1UH6A 2KC2A 3ONSA 5LLIA 4OVUA 1I42A 1Z5SB 4AUQC 4BVUC 1IPGA 3EHVA 1V81A 1AARA 1F9JA 2Z59B 4II3B 2CU1A 4KIKA 4NY0A 3DBSA 1V2YA 3JSVA 2WX1A 2L7RA 2ZPNA 2WYQA 2W9NA 1WGGA 1WGYA 3WAOA 1WYWB 4ZRIA 2K6DB 5AEKB 3A9JA 1WY8A 2N9XA 4WJOA 2DENB 2O6VD 2FCNA 3DBHI 3M95A 1Y8RC 2LUEA 2GBNA 3QCAA 3W1SC 2KJRA 3HHMA 2CS4A 1KOTA 2N1VA 2KJ6A 5E6OA 1YJ1A 4GDKA 5JHAA 3H7SA 4M8NA 1TZ1A 2HD5B 4BKSD 4AJWA 5E6NA 4ANWA 4KDLB 1V9JA 3H7PB 4HPMB 3ENEA 3QC8B 4FULA 1WR6E 1V5TA 2RR9A 4PS8A 2KWCA 2RGFA 2LVOA 3IVFA 4IG7B 1H4RA 3RZFA 4WJNA 2L0TA 2LRUA 2DZJA 3KUZA 4KDIC 2D10A 2KO3A 5G55A 1M94A 2G45B 2M8SA 4ICUA 2AYOB 2HJ8A 2QHOA 2J0JA 3HM6X 1RRBA 2ZJDA 3ML9A 2NPTA 2RSUA 3EC8A 4HJKA 3DDCB 3DVGY 2JUOA 3RZWC 3TL5A 1L7YA 4K7SA 3BINA 4EEWA 1WGRA 2PE6B 1WJ4A 4IUMB 3VDZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4ZRJ A;  1UBI A;  5C23 A;  2MBB B;  2WDT B;  4FJZ A;  2MCN B;  3DOW A;  1WXM A;  4BKG A;  2A5U A;  2O2V A;  3D32 A;  3PVL A;  4JGH B;  5KHQ A;  4LJP B;  4NAW A;  3H1U A;  2AWT A;  2MLB A;  2N4F A;  3V6E B;  2G3Q B;  1EO6 A;  3DCG A;  2M17 A;  3VQI A;  2MBH A;  3A4S C;  3QAR A;  1BT0 A;  2ZEQ A;  4F1S A;  1FXT B;  3PRP B;  3PTF C;  4BBN C;  1P1A A;  2LGY A;  2GBK A;  1R4N I;  2ZCC A;  4K7W A;  1WXV A;  2IO3 B;  2NBU A;  2BYF A;  3VVW B;  2HTH A;  2BF8 B;  3M63 B;  3ZKJ C;  3VTU A;  1E90 A;  4HLE A;  2M0X A;  2I1K A;  4IC7 B;  4RM8 A;  3ZNI D;  2LVQ A;  4TUU A;  5GMV A;  2BWE S;  5JH5 C;  2Z0E B;  3AXC A;  1MG8 A;  3K9O B;  2IO0 B;  4HPL B;  1IP9 A;  3IHP C;  2CHX A;  4W9H A;  3A33 B;  2CR5 A;  2ZVN A;  1LQB A;  2D07 B;  3WAL A;  4P7I A;  1Q1O A;  3PT2 B;  1ISN A;  2ZZP B;  3UGB B;  2N7E A;  3CF6 E;  2KDF B;  1WMH A;  4AP4 C;  4DWF A;  2LXC A;  2KTF A;  4TV3 A;  3VUY A;  2CHZ A;  2KK8 A;  2O6V B;  3PRE A;  2FNJ B;  4HCN B;  2GOW A;  3GZN I;  4E71 A;  3T9L A;  1WF9 A;  3LJ3 A;  4K1R B;  4W9I A;  3H9D A;  1YX6 B;  2C7N B;  5DPR A;  3A9K A;  5KHO A;  4NJ7 A;  2MA9 B;  2PPH A;  2R2O A;  1C1Y B;  3M62 B;  2J0M A;  2DX5 B;  3CSF A;  3OLM D;  3TMP B;  3UF8 A;  2V1Y A;  4DHZ E;  2DYM A;  3VH4 B;  3PGE A;  3DPD A;  4PYZ A;  2B3A A;  2WX0 A;  4MJS A;  1QZE A;  4JL9 A;  1WX8 A;  2KMA A;  1E5W A;  2MBO A;  4II2 B;  1XD3 B;  2MP2 A;  4FBJ B;  1OEY J;  2JWZ A;  5CHF A;  4GXB A;  5LXH A;  2HE7 A;  2RPQ A;  3PLV A;  2BYE A;  3V61 A;  4EKU A;  3A1Q B;  4ANV A;  2VRR B;  4DDI D;  4A20 A;  4E3C A;  4PS3 A;  4FLH A;  1SE9 A;  4WWO A;  2L0F A;  5G2N A;  3H7P A;  3S2A A;  2JVC A;  5L83 A;  3KUD B;  5CX3 A;  3B1L X;  4GDL B;  1Q5W B;  3KW5 B;  2IY0 B;  2KFJ A;  5FR6 A;  3QQ8 B;  4WAA A;  3N3K B;  2V4L A;  2KHW B;  4IM2 A;  2XK5 B;  2EMS A;  1P9D U;  1GC6 A;  1WZ3 A;  3O65 B;  4ANX A;  1R4M I;  5DPW A;  3QK0 A;  3KH0 A;  4W9J A;  3X0W A;  1ZKH A;  5D6J B;  1WI0 A;  3ZLZ A;  4KZC A;  2FID A;  5AZG A;  3QAQ A;  3ML8 A;  5C1Z A;  3L10 B;  3QWZ B;  3VXW A;  1WIA A;  2MX2 A;  4HCP B;  4M8M A;  4DHJ D;  1RLF A;  1WJ6 A;  3AUL A;  5D2M B;  3L08 A;  3OJ3 A;  1KM7 A;  2IY1 B;  2OJR A;  2ZCB A;  3MTN B;  2IBI B;  2N1W A;  3PRZ A;  1WXS A;  1YQB A;  1V6E A;  2BYV E;  2JY6 A;  3N32 A;  4NNJ B;  1E8X A;  1WGD A;  4KSK C;  3TJP A;  4AJY B;  2K39 A;  4ZRK A;  2KTR B;  2DAF A;  1WR1 A;  2MSE D;  2KFK B;  2KWU B;  2PE9 A;  3P2B A;  1IYF A;  2KOX A;  4AOF A;  4HWI B;  4A3O A;  3JW0 X;  3ZO5 B;  1YIW A;  2L3Z A;  5CHV C;  4EZL A;  3VUX A;  2FAZ A;  1XT9 B;  2LWP A;  2DZI A;  3KYC D;  4IM0 A;  5LXI B;  1SIF A;  4IW0 A;  4CYE A;  1YD8 U;  2LZ6 A;  4KIK B;  3R7Q A;  2LRW A;  3ZNH B;  1K8R B;  3JSV B;  2GBR A;  4YL8 A;  1G6J A;  3V6C B;  4IWQ A;  1S3S G;  3KVF B;  1WX9 A;  2MBE A;  5EDS A;  2JRI B;  3ZIM A;  3NZS A;  4HVB A;  2YVC A;  1WE6 A;  4KVG B;  2FIF A;  3OAW A;  2JPH A;  1NBF C;  2KVR A;  4G11 A;  3RYT A;  3X23 A;  3ZVV A;  4G3X B;  1I35 A;  3AU5 A;  3TCA A;  1J0G A;  3WAM A;  2LAS A;  5L95 C;  4DHZ B;  4K81 A;  1JRU A;  4LCD E;  3A4R A;  1WJN A;  3M3J A;  4GDK B;  4IWO A;  2KDI A;  3APD A;  3R3M A;  3DQV A;  3ECI A;  3WIM A;  3JVZ X;  4BOZ B;  2NR2 A;  3KUC B;  3PSE B;  1GUA B;  1WXA A;  4G50 A;  4W9E A;  2YLM A;  4LDT D;  4IM3 A;  1P98 A;  4URK A;  3SHQ A;  2LD9 A;  2D11 A;  4FHK A;  3L13 A;  1E7U A;  1OEY A;  5DPT A;  3GOE A;  4ANU A;  4EUT A;  2MWS B;  4CO7 A;  4DK5 A;  4TQ0 A;  2KAN A;  3TBL D;  3QJZ A;  2UWQ A;  3H6N A;  5BO4 B;  4TQ1 A;  3A1Q A;  3NY5 A;  1KLV A;  3ZTD A;  4B6W A;  3Q3J A;  4PYU A;  1V80 A;  3CST A;  1KJT A;  2PEA A;  1J8C A;  4W9D A;  5IAA C;  3PPA A;  4WQO B;  5DPS A;  3ZNG C;  2JXX A;  4KV2 A;  4NQL B;  2K6Q A;  3HK0 A;  2IZV B;  3MJW A;  2LVP A;  3NZU A;  4ZDV A;  1LXD A;  4MGY E;  2ASQ A;  5AZF A;  3RCZ A;  3ZNZ B;  4DHJ B;  3PZD A;  4FN2 A;  2KZR A;  2CHW A;  3W1Y A;  4FAD A;  4HXD A;  4JLC A;  4OVV A;  5IA7 A;  1J19 A;  1WGH A;  1XQQ A;  4NAW B;  5HKH A;  3EEC A;  3RUI B;  2OOB B;  1RAX A;  4B9K A;  2WWZ A;  4MEM A;  3VHT C;  1C3T A;  1NDD A;  1WH3 A;  2FCQ A;  2GBM A;  4W9G A;  1WM3 A;  1Q0W B;  3PRM B;  1PQS A;  4PS7 A;  4XX5 A;  2J0K A;  2REX A;  4NQK E;  2K8H A;  3SDL C;  2ZVO A;  2L00 B;  2BKF A;  3RT3 B;  4E74 A;  2KWV B;  3NHE B;  1A5R A;  2C60 A;  1WFY A;  4NPN A;  4W9C A;  4GMV A;  3IBE A;  4JIO U;  4EFO A;  2IO1 B;  5DCN A;  4BKT A;  3UQA A;  2AEH A;  5J2R A;  1EF1 A;  4MSQ B;  4RM9 A;  5JHB A;  3ZUN A;  4MH0 E;  4FHJ A;  3U30 A;  3VTW A;  2AL6 A;  4DDG D;  2KTR A;  3VH3 B;  3CMM B;  1WZ0 A;  2NCN A;  1EUV B;  3AI5 A;  4GN1 A;  4ICV A;  2KLC A;  4FJY A;  1WMH B;  4KSL C;  4GOC A;  4WJQ A;  2ZNV C;  2EKE C;  3RD2 A;  2AL3 A;  3ZTC A;  1WRD B;  4X57 B;  3UIN B;  3VAW A;  1V5O A;  2I1J A;  1NI2 A;  2KNB A;  2N9P C;  1D3Z A;  2J7Q B;  1E8Y A;  3A9K B;  2Y5B B;  3ZRF A;  2N9E B;  4BBN F;  2JF5 A;  1L2N A;  2DYB A;  3PS6 A;  1X1M A;  3DVG X;  3HIZ A;  2K8C A;  2CKH B;  3ZW3 A;  2MQJ A;  2BKR B;  4BFR A;  4WWN A;  3HM3 A;  4I6P A;  1S1Q B;  1RFA A;  2JRH A;  3DVN U;  3MHS D;  3QX1 A;  4MJS B;  4LDT B;  1H8C A;  5JZE B;  3BY4 B;  3IFW B;  2MP2 B;  1V49 A;  1GNU A;  4AWJ A;  1WE7 A;  2M4N A;  3ZDM C;  2DAJ A;  1OQY A;  3UIP B;  2DZK A;  4EZJ A;  4F7Z A;  2V3S A;  3JYU A;  4GGQ A;  2KJH B;  2KLG A;  3I3T B;  4XZ4 A;  2IYD B;  1UGM A;  2JZZ A;  3L17 A;  2NS5 A;  3R66 C;  1LM8 B;  4B95 A;  2L05 A;  4IWP A;  1WX7 A;  4HDO A;  3SD5 A;  3U8Z A;  1WM2 A;  1YX5 B;  2BWF A;  3L0W B;  4A3P A;  2K25 A;  3PHW B;  4GSW A;  4MDK E;  1EF5 A;  2LGX A;  2G4S A;  4FJV B;  1E8W A;  3A9J B;  3UQB A;  2IO2 B;  5D7G A;  1P0R A;  1UEL A;  4DXA B;  2MW5 A;  2GBJ A;  2LJ5 A;  2O6V A;  5AZH A;  4ZYN A;  4HDQ A;  3APF A;  4HK2 A;  1TTN A;  1U4A A;  3DVN V;  4MGK E;  3RUL A;  3C0R B;  2L76 A;  3DBL I;  3NOB A;  4JQW C;  1E8Z A;  2KXJ A;  2D3G A;  2EMT A;  3EFU A;  4CHK A;  2LXA A;  3L16 A;  2R2Q A;  2MRP A;  3B08 A;  2ZPY A;  3ZRC A;  4BKS A;  2NVU I;  5D94 A;  3QIJ A;  5E6P A;  2G4D B;  4M0W B;  1VCB A;  2A4Z A;  2KD0 A;  3PV1 A;  3TIX A;  4RMA A;  4WJP A;  2KMC A;  1HE8 A;  2PJH A;  4J6I A;  2JZ3 B;  2GMI C;  2LGD A;  3QHT A;  2BPS A;  2NBW B;  4MSM B;  2KN5 A;  1GC7 A;  3AU4 A;  3WA0 A;  2XEW A;  3QA8 A;  2KX0 A;  1UD7 A;  2MBQ A;  2LI5 A;  2NPT B;  3N30 A;  4I6N B;  4LJO B;  1OTR B;  3W1S A;  2KDB A;  2Z0D B;  1VD2 A;  4DBG A;  2FCS A;  2UYZ B;  3ZDT A;  3SU8 X;  4GIV A;  3PLU A;  2JT4 B;  2C7H A;  2C5L C;  3APC A;  4XC2 A;  4EZK A;  4GDL A;  1GJZ A;  4K7U A;  4MM3 A;  5J18 A;  1Z2M A;  4I6L B;  2M1M A;  2NBV B;  2N7D A;  4MEL A;  1OGW A;  3Q3F A;  3PHX B;  4G0N B;  2O2V B;  4KZ0 A;  2RD0 A;  1WJU A;  2XK5 A;  3T8M A;  2DYO A;  1V86 A;  2C9W B;  4W9L A;  4W9F A;  4EOY A;  4GB9 A;  3V60 A;  1TBE A;  3U7D A;  3WAN A;  1GG3 A;  2KKC A;  4GU2 A;  4TKN A;  4FA6 A;  2K8B A;  4MGI E;  2DHZ A;  4MGZ E;  1UZX B;  3UIO B;  2FUH B;  5TR5 A;  2KX3 A;  4ASW C;  4WWP A;  1P3Q U;  2KC1 A;  2ZNV B;  5CTR C;  5J17 A;  1T0Y A;  2C7M B;  2KDE B;  3LDZ E;  3ALB A;  3DBR I;  3IG3 A;  2K1F A;  3R7R A;  4W9K A;  1LFD A;  2D2Q A;  3B0A A;  2KQ7 A;  1CMX B;  1SGH A;  3K9P B;  1TGZ B;  2L8J A;  4NJ6 A;  3V62 A;  3VFK A;  4F8C B;  1ZW7 A;  2BGF A;  2DZM A;  1ZGU B;  3KYD D;  3VUW A;  2KFK A;  3WAP A;  3NS8 A;  1UBQ A;  5CHW A;  3VTV A;  2FCM A;  3L54 A;  2KQS A;  2XBB C;  3OJ4 B;  1E7V A;  4N9F 4;  4BOS C;  1UH6 A;  2KC2 A;  3ONS A;  5LLI A;  4OVU A;  1I42 A;  1Z5S B;  4AUQ C;  4BVU C;  1IPG A;  3EHV A;  1V81 A;  1AAR A;  1F9J A;  2Z59 B;  4II3 B;  2CU1 A;  4KIK A;  4NY0 A;  3DBS A;  1V2Y A;  3JSV A;  2WX1 A;  2L7R A;  2ZPN A;  2WYQ A;  2W9N A;  1WGG A;  1WGY A;  3WAO A;  1WYW B;  4ZRI A;  2K6D B;  5AEK B;  3A9J A;  1WY8 A;  2N9X A;  4WJO A;  2DEN B;  2O6V D;  2FCN A;  3DBH I;  3M95 A;  1Y8R C;  2LUE A;  2GBN A;  3QCA A;  3W1S C;  2KJR A;  3HHM A;  2CS4 A;  1KOT A;  2N1V A;  2KJ6 A;  5E6O A;  1YJ1 A;  4GDK A;  5JHA A;  3H7S A;  4M8N A;  1TZ1 A;  2HD5 B;  4BKS D;  4AJW A;  5E6N A;  4ANW A;  4KDL B;  1V9J A;  3H7P B;  4HPM B;  3ENE A;  3QC8 B;  4FUL A;  1WR6 E;  1V5T A;  2RR9 A;  4PS8 A;  2KWC A;  2RGF A;  2LVO A;  3IVF A;  4IG7 B;  1H4R A;  3RZF A;  4WJN A;  2L0T A;  2LRU A;  2DZJ A;  3KUZ A;  4KDI C;  2D10 A;  2KO3 A;  5G55 A;  1M94 A;  2G45 B;  2M8S A;  4ICU A;  2AYO B;  2HJ8 A;  2QHO A;  2J0J A;  3HM6 X;  1RRB A;  2ZJD A;  3ML9 A;  2NPT A;  2RSU A;  3EC8 A;  4HJK A;  3DDC B;  3DVG Y;  2JUO A;  3RZW C;  3TL5 A;  1L7Y A;  4K7S A;  3BIN A;  4EEW A;  1WGR A;  2PE6 B;  1WJ4 A;  4IUM B;  3VDZ A; 
#chains in the Genus database with same CATH topology
 1IGD A;  1SE4 A;  1XLQ A;  4FJZ A;  2MCN B;  5KHQ A;  2LHE A;  2K0P A;  3MJ5 A;  2MLB A;  3V6E B;  1HQR D;  3VQI A;  3A4S C;  3QAR A;  1FXT B;  2ZCC A;  4WUR A;  2IO3 B;  2XNA C;  1IUE A;  2BYF A;  3VVW B;  2BF8 B;  3ZKJ C;  1E0Z A;  3RNC C;  4IC7 B;  3ZNI D;  3ZYY X;  4HPL B;  2IO0 B;  3IHP C;  1N61 A;  1EM7 A;  2CR5 A;  2ZVN A;  3EGR A;  4P7I A;  2J4X A;  1ISN A;  1YMH E;  2N7E A;  2KDF B;  3Q8A A;  1YN3 A;  2LXC A;  4RGO S;  3TSS A;  1L4Z B;  4YXD B;  4W9I A;  1PFD A;  5KHO A;  3R8B A;  3VH4 B;  1J7B A;  1ENF A;  2Y3A A;  4MJS A;  2QIE B;  1E5W A;  1XD3 B;  2Y5C A;  3BK2 A;  4KGT A;  5LXH A;  3GE3 C;  3PLV A;  2INP E;  3RNA C;  4ANV A;  4DDI D;  2MHJ A;  4E3C A;  2N9L A;  5G2N A;  3H7P A;  3ZJV A;  3TEW A;  3KUD B;  3B1L X;  1Q5W B;  5BYQ A;  4WAA A;  3AM9 A;  3N3K B;  2KDM A;  2BTE A;  1V8C A;  3O65 B;  1R4M I;  3KH0 A;  3NVY A;  1ZPS A;  2LUM A;  4OZA A;  5D6J B;  3AE6 B;  3ZLZ A;  3QAQ A;  1UGJ A;  2W54 A;  3L10 B;  3P42 A;  4EE2 A;  2IY1 B;  2OJR A;  1E10 A;  1WXS A;  3N32 A;  1V6E A;  3MP9 A;  4AJY B;  4NNJ B;  5HKH A;  2KTR B;  1WR1 A;  1RWS A;  2PKO A;  4AOF A;  4HJG E;  5CHV C;  4JX1 C;  3GE8 C;  1WYG A;  3KYC D;  4IM0 A;  1F0Z A;  1SIF A;  3ZNH B;  1K8R B;  1L5P A;  1S3S G;  3KVF B;  1VDV A;  1WX9 A;  2LFI A;  5EE1 A;  2R61 A;  2MBE A;  3ZQ4 A;  1HA5 A;  2JPH A;  1NBF C;  2KVR A;  3X23 A;  1JQ4 A;  3TCA A;  4BAX A;  1WJN A;  3M3J A;  4IWO A;  4RH6 A;  2KDI A;  2QIL A;  3DQV A;  3ECI A;  1XLN A;  1MVK A;  2NR2 A;  3KUC B;  3FC4 A;  3MC8 A;  1T3Q A;  4LDT D;  3SHQ A;  4FHK A;  4EUT A;  5HI1 A;  1EU4 A;  1KLV A;  1KJT A;  2KT7 A;  2BQQ A;  1VRA B;  2RDG A;  3NZU A;  4HKQ A;  3BYY B;  4NZL B;  4HXD A;  4KKI A;  3RUI B;  1IGC A;  2MJE A;  2WWZ A;  3AEB B;  5C3J B;  2D3C A;  4PS7 A;  1FFV A;  2J0K A;  2TSS A;  3I63 C;  4E74 A;  1UNS A;  1SE2 A;  3IBE A;  3U52 E;  2QSD A;  2IO1 B;  1XCQ L;  4BKT A;  5J2R A;  1I4X A;  4KGS A;  2AL6 A;  1FXA A;  2KTR A;  4XGA B;  4DDG D;  5G5G A;  1EUV B;  2KLC A;  4FJY A;  1WMH B;  5EE3 A;  3RD2 A;  2AL3 A;  3ZXR A;  1V5O A;  5HG2 A;  2KNB A;  2N9P C;  3A9K B;  1MI0 A;  2JF5 A;  1LGR A;  4JWS C;  1QOB A;  4M02 A;  4USA A;  1X1M A;  3DVG X;  2CKH B;  2RDH A;  3VRA B;  5H8Y E;  3C19 A;  3HM3 A;  5FK9 C;  1NYQ A;  1S1Q B;  1YNT E;  3QX1 A;  1MJD A;  1H8C A;  3IFW B;  2MP2 B;  1V49 A;  1WE7 A;  5G5H A;  4EZJ A;  4S17 A;  4GGQ A;  2KLG A;  2IYD B;  3DHI C;  1UGM A;  4WIP A;  1C9F A;  3U8Z A;  2BWF A;  3PHW B;  4GSW A;  4MDK E;  1EF5 A;  3UQB A;  1P0R A;  2MW5 A;  2O6V A;  3NJT A;  1RYJ A;  1FCL A;  3C0R B;  2L83 A;  1D4B A;  1PGA A;  3NOB A;  4YSZ B;  2QDF A;  1E8Z A;  3EFU A;  2EKI A;  3L16 A;  3ZRC A;  2NVU I;  5D94 A;  2SAK A;  1VCB A;  2KMC A;  2Z8L A;  2JZP A;  3ZJU A;  1GB4 A;  1UD7 A;  5D3I B;  1D5Z C;  2FCS A;  2IND C;  4XWW A;  2RPV A;  2JT4 B;  3APC A;  1C4P A;  4EZK A;  4GDL A;  3WCQ A;  2VZK D;  1GJZ A;  2WDR B;  4I6L B;  3LYY A;  2M1M A;  2NBV B;  3PHX B;  2O2V B;  4KZ0 A;  4RCO A;  4EOY A;  4GB9 A;  3U7D A;  3DBH B;  2KKC A;  4TKN A;  4FA6 A;  2JU6 X;  3O13 A;  1UZX B;  4ASW C;  5J17 A;  1T0Y A;  4OZC A;  4DQO C;  2K1F A;  3BII D;  4R3D A;  1LFD A;  2KQ7 A;  1SGH A;  4NJ6 A;  1YJJ A;  2KFK A;  3AH7 A;  5CHW A;  2FCM A;  3L54 A;  1L6V A;  4N9F 4;  2XBB C;  4LNK A;  1UH6 A;  2BT6 A;  3W9C B;  4ARI A;  1F9J A;  4NY0 A;  2WU5 B;  1V2Y A;  3JSV A;  2W9N A;  3MC0 B;  1WYW B;  1ZXH A;  3AE2 B;  2N9X A;  2DEN B;  2K22 A;  2O6V D;  3DWM A;  3DBH I;  4BZA A;  2KJR A;  3HHM A;  2CS4 A;  1KOT A;  2N1V A;  1YJ1 A;  5JHA A;  5EE0 A;  2WXF A;  3E9S A;  4ANW A;  2FBW B;  1V9J A;  1F77 A;  3IT6 B;  1PDX A;  2RGF A;  4MH8 A;  3T3O A;  4KKJ A;  1H4R A;  4WJN A;  1I4G A;  1QOF A;  2BVC A;  2L0T A;  2LRU A;  1TKY A;  2ZW1 A;  4XDC A;  4H2A A;  2QHO A;  2J0J A;  3HRD D;  1F2R C;  1AWD A;  5FKA C;  3VDZ A;  2WDT B;  2JQR B;  4BKG A;  2A5U A;  2O2V A;  3D32 A;  3N20 C;  2LGI A;  2IJ0 A;  2AWT A;  3PTF C;  3PRP B;  1R4N I;  2OJW A;  5D3D A;  3Q3N C;  4KX6 B;  1KH0 A;  2HTH A;  4HLE A;  4TUU A;  5JH5 C;  1MG8 A;  4NJC A;  2CHX A;  1LQB A;  1IBX B;  3MFG A;  3CF6 E;  4DWF A;  2IGD A;  3GS2 A;  2KK8 A;  1BXT A;  1HTQ A;  2FNJ B;  3T9L A;  4LLG M;  3LJ3 A;  4K1R B;  5DPR A;  2C7N B;  2R2O A;  4ARC A;  5HHD G;  2J0M A;  3CSF A;  3TMP B;  2NTS A;  3DWG C;  3KLS X;  1SF0 A;  4PYZ A;  2B3A A;  1Q10 A;  2KMA A;  2MBO A;  4II2 B;  1OEY J;  1VZ7 A;  4ZRQ A;  2HE7 A;  3V61 A;  4EKU A;  3A1Q B;  2VRR B;  4A20 A;  4PS3 A;  1EWC A;  3VR8 B;  4WWO A;  2FE8 A;  2L0F A;  4N6E B;  3L4P A;  1C77 A;  2JVC A;  4C00 A;  5L83 A;  5CX3 A;  1KFY B;  3KW5 B;  4MT5 A;  2IY0 B;  4MM3 B;  3QQ8 B;  3AEC B;  2MEK A;  2J53 A;  2XK5 B;  2EMS A;  1P9D U;  1WZ3 A;  4ANX A;  4CQN A;  3B9J A;  2INC C;  2NMQ A;  3X0W A;  3BVG A;  3BVM A;  3ML8 A;  2BW2 A;  2JYE A;  3VXW A;  4HCP B;  3DBL B;  4DHJ D;  1E7P B;  3L08 A;  2CU3 A;  1N63 A;  3B2G A;  3MTN B;  3TEY A;  1TS5 A;  4KSK C;  2K39 A;  1EU3 A;  1NVI D;  3AN1 A;  2WXG A;  2E3T A;  2MSE D;  1FRR A;  1OFF A;  4OVZ A;  4A3O A;  1VZ6 A;  3VUX A;  2FAZ A;  3P4S B;  3FIL A;  5LXI B;  4IW0 A;  4KIK B;  3R7Q A;  1DOY A;  1G6J A;  4YL8 A;  1IBX A;  3V6C B;  5H92 C;  4L2Y A;  2JRI B;  1WE6 A;  2X8X X;  3RYT A;  4G3X B;  3AEE B;  1J0G A;  3WAM A;  5L95 C;  2XN9 C;  4LCD E;  2WHI A;  4GDK B;  3R3M A;  3AE7 B;  4C7Y A;  1ZDV A;  1WXA A;  1RM6 C;  5BMH A;  4G50 A;  3Q14 C;  1P98 A;  4URK A;  3RMK C;  2D11 A;  3L13 A;  1OEY A;  4NAM A;  1I4R A;  4L1B A;  3A1Q A;  2INN E;  4B6W A;  1JWA D;  2QEJ C;  1TKE A;  1MHH E;  4FXC A;  3PPA A;  5DPS A;  5IOI A;  4KV2 A;  1TZO A;  2IZV B;  2LVP A;  4LNF A;  4ZDV A;  1LXD A;  3OWE B;  4MGY E;  2ASQ A;  3RCZ A;  1FNU A;  2JXT A;  3PZD A;  4FN2 A;  2KZR A;  3W1Y A;  4JLC A;  5IA7 A;  1J19 A;  1XQQ A;  4NAW B;  4RF1 A;  3EEC A;  3NG0 A;  2OOB B;  5TSS A;  1C3T A;  1DYQ A;  1WH3 A;  2GBM A;  1Q0W B;  1PQS A;  1ACC A;  4XX5 A;  2K8H A;  1AN8 A;  1JWM D;  2L00 B;  3RT3 B;  4PK1 A;  3AE9 B;  4JIO U;  1UWX A;  1WSP A;  2W55 A;  4MSQ B;  5IN7 A;  3VTW A;  3VH3 B;  4LTU A;  3CMM B;  2NCN A;  2WNM A;  3AI5 A;  1DGJ A;  4JWU C;  1QIL A;  2ZNV C;  1N6Z A;  2EKE C;  3ZTC A;  1WRD B;  2WXR A;  2K5P A;  4A8X C;  1NI2 A;  2J7Q B;  4BBN F;  1PGX A;  2Y5B B;  1L2N A;  3PS6 A;  1OQR A;  3N1Y C;  1YN5 A;  3B2F A;  3ZW3 A;  2BKR B;  3AB5 A;  4WWN A;  4YT0 B;  3DVN U;  3BWU D;  1C79 A;  2QMT A;  2VH2 A;  1KRH A;  4AWJ A;  4GLS C;  2PW9 A;  2HDE A;  2V9H A;  2M4N A;  2PVG C;  2DZK A;  3KWV A;  5BMI A;  4XWT A;  1NEN B;  3L17 A;  3R66 C;  2I38 A;  1LM8 B;  4TMA B;  4HDO A;  3SD5 A;  3L0W B;  2K25 A;  2DNF A;  3Q3O C;  2V3P A;  1T5X D;  1YQ4 B;  3Q3M C;  4TSS A;  1E8W A;  3A9J B;  2IO2 B;  4DXA B;  4ZYN A;  3APF A;  2N0S B;  3HVD A;  4HK2 A;  2WXO A;  3GZN B;  4M00 A;  3DVN V;  4MGK E;  3RUL A;  2WXJ A;  1ZUD 2;  2WXL A;  4JQW C;  2KXJ A;  4CHK A;  1C76 A;  2IGG A;  3QIJ A;  2J52 A;  5E6P A;  4M0W B;  1N5W A;  1T0Q C;  2LEK A;  2G9H D;  4J6I A;  2PTL A;  1GB1 A;  2BS4 B;  3QHT A;  1XLP A;  2Q5W D;  4MSM B;  3WA0 A;  3QA8 A;  3TEZ A;  3N30 A;  4ZRP A;  3AE4 B;  3R2T A;  3N1X C;  4DBG A;  2UYZ B;  4UDU C;  4XC2 A;  4LNO A;  4K7U A;  5J18 A;  2H89 B;  2D5G A;  2RD0 A;  1WJU A;  3T8M A;  4C4V B;  3AE1 B;  2DYO A;  2C9W B;  4W9L A;  4W9F A;  3Q8F A;  1GG3 A;  1FIQ A;  1F52 A;  2K8B A;  4MGI E;  1HTO A;  2OHF A;  2DHZ A;  4MGZ E;  3UIO B;  2KX3 A;  3EUB 2;  2BS2 B;  3IAM 1;  1DOX A;  2L52 A;  2KDE B;  3LDZ E;  3IG3 A;  2ICI A;  5AUI A;  2L8J A;  4MAC A;  3NVW A;  4YWG G;  4A90 A;  2DZM A;  1FD6 A;  2D3A A;  3WAP A;  1UBQ A;  3VTV A;  4LK0 M;  2LMC A;  2KQS A;  1Y56 A;  1E7V A;  1HZ6 A;  5LLI A;  3NRZ A;  4AUQ C;  4BVU C;  1XXG A;  3SFE B;  1V81 A;  1SIJ A;  4II3 B;  2CU1 A;  1RFK A;  3DBS A;  2WX1 A;  2ZPN A;  1WGY A;  3WAO A;  4DXF A;  3A9J A;  4A55 A;  3M95 A;  3AV8 A;  4RGN A;  4RF0 A;  1HXY D;  5E6O A;  4JE3 B;  1D5M C;  2GB1 A;  1QT9 A;  1TZ1 A;  4ZOH C;  4KDL B;  1FPY A;  4HRO A;  1XF5 L;  4HPM B;  3QC8 B;  4FUL A;  1WR6 E;  2AQ1 B;  2KN4 A;  3IXS A;  3J9C A;  1YOV B;  1B9R A;  3V3X A;  1AW7 A;  2G1E A;  3KUZ A;  1K50 A;  2D10 A;  5G55 A;  2G45 B;  2HJ8 A;  3HM6 X;  3RZW C;  2JUO A;  2LHD A;  1L7Y A;  4YSX B;  1WGR A;  2PE6 B;  1QQR A;  4IUM B;  1F2R I;  5C23 A;  1KTK A;  1VLB A;  3PVL A;  2N4F A;  2G3Q B;  3DCG A;  1WXQ A;  2MBH A;  2QJL A;  1BT0 A;  4P16 A;  4AS1 A;  4BBN C;  2LGY A;  2GBK A;  4WH4 A;  3P63 A;  2NBU A;  1D6E C;  3KQ4 A;  2SEB D;  2M0X A;  1SSN A;  5GMV A;  2Z0E B;  3W2D A;  3K9O B;  3WAL A;  1UWM A;  3PT2 B;  2ZZP B;  3UGB B;  3LXF A;  1WMH A;  1I7H A;  2WP9 B;  1FCC C;  1WF9 A;  2GI9 A;  1YX6 B;  4RNA A;  3A9K A;  4NJ7 A;  2MA9 B;  2PPH A;  1CK1 A;  2K3U A;  3BZD B;  2V1Y A;  1C4C A;  2DYM A;  3AEG B;  3PGE A;  3DPD A;  1TS3 A;  3BVZ A;  3KWL A;  3ABV B;  1QZE A;  1WX8 A;  1JWB D;  2MP2 A;  2JWZ A;  1KLG D;  4GXB A;  2X38 A;  3HUI A;  2BYT A;  3S2A A;  3Q8C A;  1SEB D;  2M19 A;  2KFJ A;  5FR6 A;  4J3O D;  2KHW B;  4IM2 A;  3HVZ A;  5DPW A;  2OED A;  4W9J A;  4ZHO A;  1ROE A;  1J7A A;  1ZKH A;  1FEH A;  4KZC A;  3QWZ B;  2MX2 A;  2DWQ A;  1RLF A;  2JWU A;  2WXM A;  3AUL A;  5D2M B;  3OJ3 A;  1KM7 A;  2BB5 A;  2ZCB A;  3PRZ A;  2ZW0 A;  2BYV E;  3RI7 C;  3TJP A;  1JAL A;  4RFB A;  2DAF A;  2KWU B;  2PE9 A;  1IYF A;  1GAQ B;  3SEB A;  1JWU D;  3AED B;  1C78 A;  2LRW A;  3N9Y C;  4IWQ A;  5EDS A;  2WDQ B;  4KVG B;  4IKG A;  3OAW A;  1KF6 B;  4G11 A;  1K51 A;  3A4R A;  3LB8 C;  3APD A;  2N7J A;  2BBC A;  3WIM A;  3JVZ X;  4BOZ B;  1GUA B;  4W9E A;  3I9V 1;  2I2Y A;  2LD9 A;  5DPT A;  1E7U A;  3GOE A;  4ANU A;  2MWS B;  4CO7 A;  4DK5 A;  1ET6 A;  2KAN A;  4TQ0 A;  3QJZ A;  2PVO D;  2UWQ A;  3H6N A;  5BO4 B;  3NY5 A;  3ZTD A;  2PEA A;  1FO4 A;  2AQ3 B;  2QC8 A;  4W9D A;  3ZNG C;  4WQO B;  2JXX A;  4NQL B;  2K6Q A;  1BUI C;  3MJW A;  4A6Q A;  5AZF A;  1MHX A;  3ZNZ B;  1FXI A;  2EEL A;  2CHW A;  1B1Z A;  4OVV A;  2IDY A;  1WGH A;  3RNG C;  1NEK B;  1RAX A;  4B9K A;  1FFU A;  4MEM A;  3VHT C;  1NDD A;  2KMM A;  1CZP A;  2REX A;  4IOI E;  4REZ A;  3SDL C;  2BKF A;  3NHE B;  2FUG 1;  4W9C A;  4GMV A;  5DCN A;  3UQA A;  1EF1 A;  3U30 A;  3Q6B A;  1QF6 A;  5E6J A;  1WZ0 A;  3TUO A;  3R2I A;  4YSY B;  1I4H A;  4GN1 A;  3H8H A;  4ICV A;  1YN4 A;  4GOC A;  4WJQ A;  3RNF C;  2VH1 A;  3IAS 1;  4X57 B;  3VAW A;  2L1A A;  1VZ8 A;  1D3Z A;  1E8Y A;  3ZRF A;  2N9E B;  3HIZ A;  2K8C A;  4C80 A;  3P4R B;  2MQJ A;  4I6P A;  1RFA A;  4N59 A;  3MHS D;  4MJS B;  4LDT B;  3FKY A;  5JXV A;  2DAJ A;  3ETR A;  3UIP B;  4KGR A;  2KAJ A;  3JYU A;  3I3T B;  2AX5 A;  2H88 B;  1TY0 A;  2NS5 A;  3AMZ A;  2L05 A;  4IWP A;  1WX7 A;  1WM2 A;  1YX5 B;  4M01 A;  2JYT A;  2KAC A;  5D7G A;  1UEL A;  1L6U A;  2LJ5 A;  5AZH A;  4HDQ A;  1CJE A;  1BML C;  1TTN A;  3DBL I;  4C56 C;  1E9M A;  1T0R C;  2EMT A;  2LXA A;  2PIA A;  2MRP A;  3B08 A;  4BKS A;  3DBR B;  2WDV B;  2WGS A;  3PV1 A;  3TIX A;  4RMA A;  2PJH A;  4ACF A;  1ZE3 D;  2JZ3 B;  4B0E A;  2GMI C;  2BPS A;  2NBW B;  2KX0 A;  3AEF B;  2MBQ A;  2LI5 A;  5BYR A;  2E6X A;  2NPT B;  2GRI A;  4I6N B;  3NVZ A;  3W1S A;  3Q69 A;  2KDB A;  1VD2 A;  3ZDT A;  4O1N A;  1TJE A;  4GIV A;  3PLU A;  2C7H A;  2C5L C;  4K3C A;  4MM3 A;  3PZ7 A;  1TY2 A;  3Q3F A;  1OGW A;  2V3N A;  1C4A A;  2XK5 A;  4QAY A;  3V60 A;  1TBE A;  1R4M B;  4GU2 A;  1STE A;  1PGB A;  2CJO A;  1M4V A;  3PZ8 A;  1HZ5 A;  2FUH B;  4WWP A;  2KC1 A;  1MPE A;  2L32 A;  2C7M B;  3DBR I;  3VRB B;  3R7R A;  2D2Q A;  3B0A A;  1CMX B;  2KQ4 X;  1FNW A;  4F8C B;  2DBY A;  1ZGU B;  2AQ2 B;  1XLO A;  3VUW A;  1ZOY B;  2QCZ A;  3Q8E A;  3PO0 A;  4BOS C;  2YEP F;  3ONS A;  5EE9 A;  4L23 A;  2BS3 B;  1Z5S B;  1UF0 A;  1V97 A;  3EFC A;  3EHV A;  2Z59 B;  4KIK A;  1PUT A;  2L7R A;  1MG4 A;  2WYQ A;  1TS4 A;  4ZRI A;  3ZGZ A;  4YTP B;  2K6D B;  1QOA A;  5AEK B;  4WJO A;  1SBB B;  3GP7 A;  4P6V F;  2LUE A;  4ZHP A;  2CJN A;  2GBN A;  3AE8 B;  3QCA A;  2M56 B;  3W1S C;  2YEP B;  4PT5 A;  2KJ6 A;  4C7Z A;  4GDK A;  3H7S A;  3NS1 A;  5I4D A;  2J42 A;  2HD5 B;  4BKS D;  3TEX A;  4AJW A;  3U7Z A;  2HJ1 A;  3BYT B;  3ENE A;  2RR9 A;  3T3N A;  2KWC A;  1HEZ E;  3RZF A;  2VZK B;  1JCK B;  4KDI C;  1M94 A;  5FR3 A;  1J7C A;  4HJK A;  1RRB A;  3ML9 A;  2W3S A;  2NPT A;  1SJH D;  1T0S C;  3AE5 B;  3DVG Y;  3NVV A;  4WQM A;  3TL5 A;  1A70 A;  1L0X B;  4K7S A;  3BIN A;  5T8I A;  3EA6 A;  2KWD A;  2MH7 A;  1JW9 D;  3A33 B;  1I4P A;  4ZRJ A;  5IP4 D;  4P1C C;  1UBI A;  2V4I B;  2MBB B;  3DOW A;  1WXM A;  4JGH B;  5GXG B;  4LJP B;  4NAW A;  3H1U A;  1JRO A;  5IKC M;  1EO6 A;  2M17 A;  2ZEQ A;  4F1S A;  4US8 A;  4B0M A;  1P1A A;  1KLU D;  4K7W A;  1WXV A;  3M63 B;  3VTU A;  1E90 A;  3RNE C;  2WXP A;  2I1K A;  4RM8 A;  2LVQ A;  1I4Q A;  2BWE S;  3AXC A;  1IP9 A;  4W9H A;  1E6E B;  2D07 B;  3GB1 A;  1FM0 D;  1Q1O A;  4ITK A;  4AP4 C;  1D5X C;  2KTF A;  4TV3 A;  3VUY A;  2CHZ A;  2O6V B;  3PRE A;  4HCN B;  2GOW A;  3RN9 C;  3GZN I;  4E71 A;  4JPS A;  3H9D A;  4LNN A;  2WXH A;  1C1Y B;  3OLM D;  1L0Y B;  2DX5 B;  3M62 B;  3UF8 A;  4DHZ E;  4XYC A;  2WXI A;  1P7E A;  1TKG A;  3I5J C;  3E56 A;  2WX0 A;  1UUP A;  4JL9 A;  4D2K A;  4FBJ B;  2ONQ A;  2KVZ A;  5CHF A;  1L4D B;  2RPQ A;  2BYE A;  1ESF A;  3CIR B;  1P7F A;  4FLH A;  1SE9 A;  2M0A A;  3CWI A;  4HEA 1;  4HPP A;  2V0G A;  3IT4 B;  4GDL B;  3DHG C;  2V4L A;  1JML A;  1OQQ A;  3Q2A C;  1GC6 A;  3QK0 A;  2Y5P A;  1WI0 A;  2FID A;  5AZG A;  5C1Z A;  2GLS A;  3NZ3 A;  1WIA A;  4M8M A;  1V1O A;  1WJ6 A;  3NUH B;  4M0W A;  2IBI B;  2N1W A;  2W82 A;  3OG5 A;  1NYR A;  4XE0 A;  1YQB A;  2JY6 A;  1E8X A;  1WGD A;  4LNI A;  2K9X A;  3MC9 A;  4ZRK A;  5MPO A;  1GOZ A;  2KFK B;  3P2B A;  2KOX A;  4HWI B;  3JW0 X;  2PLP A;  3ZO5 B;  1YIW A;  2KYW A;  2L3Z A;  4EZL A;  1XT9 B;  2LWP A;  2DZI A;  5LNK 1;  4CYE A;  1YD8 U;  2LZ6 A;  1SJE D;  1XO3 A;  2GBR A;  3JSV B;  5C2T B;  1N5X A;  4WWM A;  1VJK A;  3URY A;  4C4V A;  3RPF C;  3NZS A;  3ZIM A;  4HVB A;  2YVC A;  2FIF A;  3ZVV A;  1TIF A;  1ZP0 B;  3RNB C;  1I35 A;  3AU5 A;  1EWY C;  1XCT L;  3SR6 A;  1WWT A;  2LAS A;  4DHZ B;  4K81 A;  1JRU A;  4YTN B;  4WAF A;  4DXG A;  1QKZ A;  3PSE B;  4Q2J A;  1VR9 A;  2WQY B;  2YLM A;  1QOG A;  4A9A A;  3VR9 B;  3P4Q B;  4IM3 A;  1GPX A;  3Q8B A;  3RFZ B;  3MHZ A;  1ZXI A;  4OW0 A;  3TBL D;  4TQ1 A;  2B76 B;  2PMV A;  3Q3J A;  3P4P B;  4PYU A;  4RGM A;  1V80 A;  3CST A;  1AYF A;  1ZDX A;  5AUK A;  1J8C A;  5IAA C;  4IDI A;  4YTM B;  2WXN A;  1TS2 A;  3HK0 A;  2RDB C;  1YQ3 B;  1N62 A;  4DHJ B;  4S0R A;  2LGS A;  2UU7 A;  4FAD A;  1ET9 A;  2FCQ A;  4W9G A;  1WM3 A;  3PRM B;  4NQK E;  2ZVO A;  3ZXV A;  4HKZ E;  2KWV B;  2C60 A;  1WFY A;  4NPN A;  4EFO A;  3W5U B;  2AEH A;  1XEE A;  5JHB A;  4RM9 A;  3ZUN A;  4MH0 E;  1DOI A;  4FHJ A;  4ZYS A;  4AQ7 A;  2BB6 A;  4KSL C;  4RGT A;  3SFD B;  3UIN B;  4HRS A;  2I1J A;  2DYB A;  1TT5 B;  4BFR A;  2LJI A;  3N1Z C;  4K3B A;  2JRH A;  2MJ3 A;  5JZE B;  3BY4 B;  1GNU A;  2WXQ A;  3ZDM C;  1R4N B;  1OQY A;  4F7Z A;  2V3S A;  3AE3 B;  1T6B X;  2KJH B;  4XZ4 A;  2JZZ A;  1JWS D;  1MFW A;  4B95 A;  5BMG A;  2RMM A;  1L0V B;  4A3P A;  1FMA D;  2LGX A;  2G4S A;  4FJV B;  2IGH A;  3UI3 A;  1V1P B;  2GBJ A;  1CQV A;  3AEA B;  1U4A A;  2L76 A;  1YJI A;  2D3G A;  4OHJ A;  2R2Q A;  2ZPY A;  2G4D B;  2N9K A;  2A4Z A;  2KD0 A;  4WJP A;  1HE8 A;  2LGD A;  1SB3 C;  2KN5 A;  1GC7 A;  3AU4 A;  2XEW A;  1R7S A;  4LJO B;  1OTR B;  5IO9 A;  2Z0D B;  3SU8 X;  4P1B C;  3W5V B;  3FIL B;  4OZB A;  3U4E G;  1Z2M A;  1K52 A;  2ON8 A;  2N7D A;  4MEL A;  2DLB A;  1FRD A;  2D3B A;  4G0N B;  2JX5 A;  1V86 A;  3DHH C;  2W3R A;  5BYS A;  3WAN A;  1QLB B;  1FNV A;  5TR5 A;  1P3Q U;  2WU2 B;  2ZNV B;  5CTR C;  3ALB A;  4W9K A;  1JRP A;  3K9P B;  3I57 A;  1TGZ B;  3V62 A;  5HFY A;  3VFK A;  2WXK A;  1ZW7 A;  2BGF A;  4US9 A;  3KYD D;  1SXT A;  3NS8 A;  3FAH A;  3OJ4 B;  1NI3 A;  2KC2 A;  1WGK A;  4OVU A;  1I42 A;  1TYG B;  1IPG A;  3ZJT A;  2WS3 B;  1AAR A;  1WGG A;  3U2S C;  3BK1 A;  1WY8 A;  1K53 A;  1V1P A;  2ACZ B;  2FCN A;  2MJD A;  1Y8R C;  1LO5 D;  2WLB A;  2IPK D;  1SE3 A;  3V05 A;  2NTT A;  4M8N A;  5E6N A;  2JSV X;  3C8Y A;  3H7P B;  1V5T A;  4PS8 A;  1F1H A;  2HTM E;  2LVO A;  3IVF A;  4IG7 B;  4N58 A;  1N60 A;  2DZJ A;  2KO3 A;  2M8S A;  4ICU A;  1WRI A;  2AYO B;  2ZJD A;  2RSU A;  3EC8 A;  4XDD A;  3DDC B;  4EEW A;  1PYW D;  3P1M A;  1WJ4 A;  1A5R A; 
#chains in the Genus database with same CATH homology
 4ZRJ A;  1UBI A;  5C23 A;  2MBB B;  2WDT B;  4FJZ A;  2MCN B;  3DOW A;  1WXM A;  4BKG A;  2A5U A;  2O2V A;  3D32 A;  3PVL A;  4JGH B;  5KHQ A;  4LJP B;  4NAW A;  3H1U A;  2AWT A;  2MLB A;  2N4F A;  3V6E B;  2G3Q B;  1EO6 A;  3DCG A;  2M17 A;  3VQI A;  2MBH A;  3A4S C;  3QAR A;  1BT0 A;  2ZEQ A;  4F1S A;  1FXT B;  3PRP B;  3PTF C;  4BBN C;  1P1A A;  2LGY A;  2GBK A;  1R4N I;  2ZCC A;  4K7W A;  1WXV A;  2IO3 B;  2NBU A;  2BYF A;  3VVW B;  2HTH A;  2BF8 B;  3M63 B;  3ZKJ C;  3VTU A;  1E90 A;  4HLE A;  2M0X A;  2I1K A;  4IC7 B;  4RM8 A;  3ZNI D;  2LVQ A;  4TUU A;  5GMV A;  2BWE S;  5JH5 C;  2Z0E B;  3AXC A;  1MG8 A;  3K9O B;  2IO0 B;  4HPL B;  1IP9 A;  3IHP C;  2CHX A;  4W9H A;  3A33 B;  2CR5 A;  2ZVN A;  1LQB A;  2D07 B;  3WAL A;  4P7I A;  1Q1O A;  3PT2 B;  1ISN A;  2ZZP B;  3UGB B;  2N7E A;  3CF6 E;  2KDF B;  1WMH A;  4AP4 C;  4DWF A;  2LXC A;  2KTF A;  4TV3 A;  3VUY A;  2CHZ A;  2KK8 A;  2O6V B;  3PRE A;  2FNJ B;  4HCN B;  2GOW A;  3GZN I;  4E71 A;  3T9L A;  1WF9 A;  3LJ3 A;  4K1R B;  4W9I A;  3H9D A;  1YX6 B;  2C7N B;  5DPR A;  3A9K A;  5KHO A;  4NJ7 A;  2MA9 B;  2PPH A;  2R2O A;  1C1Y B;  3M62 B;  2J0M A;  2DX5 B;  3CSF A;  3OLM D;  3TMP B;  3UF8 A;  2V1Y A;  4DHZ E;  2DYM A;  3VH4 B;  3PGE A;  3DPD A;  4PYZ A;  2B3A A;  2WX0 A;  4MJS A;  1QZE A;  4JL9 A;  1WX8 A;  2KMA A;  1E5W A;  2MBO A;  4II2 B;  1XD3 B;  2MP2 A;  4FBJ B;  1OEY J;  2JWZ A;  5CHF A;  4GXB A;  5LXH A;  2HE7 A;  2RPQ A;  3PLV A;  2BYE A;  3V61 A;  4EKU A;  3A1Q B;  4ANV A;  2VRR B;  4DDI D;  4A20 A;  4E3C A;  4PS3 A;  4FLH A;  1SE9 A;  4WWO A;  2L0F A;  5G2N A;  3H7P A;  3S2A A;  2JVC A;  5L83 A;  3KUD B;  5CX3 A;  3B1L X;  4GDL B;  1Q5W B;  3KW5 B;  2IY0 B;  2KFJ A;  5FR6 A;  3QQ8 B;  4WAA A;  3N3K B;  2V4L A;  2KHW B;  4IM2 A;  2XK5 B;  2EMS A;  1P9D U;  1GC6 A;  1WZ3 A;  3O65 B;  4ANX A;  1R4M I;  5DPW A;  3QK0 A;  3KH0 A;  4W9J A;  3X0W A;  1ZKH A;  5D6J B;  1WI0 A;  3ZLZ A;  4KZC A;  2FID A;  5AZG A;  3QAQ A;  3ML8 A;  5C1Z A;  3L10 B;  3QWZ B;  3VXW A;  1WIA A;  2MX2 A;  4HCP B;  4M8M A;  4DHJ D;  1RLF A;  1WJ6 A;  3AUL A;  5D2M B;  3L08 A;  3OJ3 A;  1KM7 A;  2IY1 B;  2OJR A;  2ZCB A;  3MTN B;  2IBI B;  2N1W A;  3PRZ A;  1WXS A;  1YQB A;  1V6E A;  2BYV E;  2JY6 A;  3N32 A;  4NNJ B;  1E8X A;  1WGD A;  4KSK C;  3TJP A;  4AJY B;  2K39 A;  4ZRK A;  2KTR B;  2DAF A;  1WR1 A;  2MSE D;  2KFK B;  2KWU B;  2PE9 A;  3P2B A;  1IYF A;  2KOX A;  4AOF A;  4HWI B;  4A3O A;  3JW0 X;  3ZO5 B;  1YIW A;  2L3Z A;  5CHV C;  4EZL A;  3VUX A;  2FAZ A;  1XT9 B;  2LWP A;  2DZI A;  3KYC D;  4IM0 A;  5LXI B;  1SIF A;  4IW0 A;  4CYE A;  1YD8 U;  2LZ6 A;  4KIK B;  3R7Q A;  2LRW A;  3ZNH B;  1K8R B;  3JSV B;  2GBR A;  4YL8 A;  1G6J A;  3V6C B;  4IWQ A;  1S3S G;  3KVF B;  1WX9 A;  2MBE A;  5EDS A;  2JRI B;  3ZIM A;  3NZS A;  4HVB A;  2YVC A;  1WE6 A;  4KVG B;  2FIF A;  3OAW A;  2JPH A;  1NBF C;  2KVR A;  4G11 A;  3RYT A;  3X23 A;  3ZVV A;  4G3X B;  1I35 A;  3AU5 A;  3TCA A;  1J0G A;  3WAM A;  2LAS A;  5L95 C;  4DHZ B;  4K81 A;  1JRU A;  4LCD E;  3A4R A;  1WJN A;  3M3J A;  4GDK B;  4IWO A;  2KDI A;  3APD A;  3R3M A;  3DQV A;  3ECI A;  3WIM A;  3JVZ X;  4BOZ B;  2NR2 A;  3KUC B;  3PSE B;  1GUA B;  1WXA A;  4G50 A;  4W9E A;  2YLM A;  4LDT D;  4IM3 A;  1P98 A;  4URK A;  3SHQ A;  2LD9 A;  2D11 A;  4FHK A;  3L13 A;  1E7U A;  1OEY A;  5DPT A;  3GOE A;  4ANU A;  4EUT A;  2MWS B;  4CO7 A;  4DK5 A;  4TQ0 A;  2KAN A;  3TBL D;  3QJZ A;  2UWQ A;  3H6N A;  5BO4 B;  4TQ1 A;  3A1Q A;  3NY5 A;  1KLV A;  3ZTD A;  4B6W A;  3Q3J A;  4PYU A;  1V80 A;  3CST A;  1KJT A;  2PEA A;  1J8C A;  4W9D A;  5IAA C;  3PPA A;  4WQO B;  5DPS A;  3ZNG C;  2JXX A;  4KV2 A;  4NQL B;  2K6Q A;  3HK0 A;  2IZV B;  3MJW A;  2LVP A;  3NZU A;  4ZDV A;  1LXD A;  4MGY E;  2ASQ A;  5AZF A;  3RCZ A;  3ZNZ B;  4DHJ B;  3PZD A;  4FN2 A;  2KZR A;  2CHW A;  3W1Y A;  4FAD A;  4HXD A;  4JLC A;  4OVV A;  5IA7 A;  1J19 A;  1WGH A;  1XQQ A;  4NAW B;  5HKH A;  3EEC A;  3RUI B;  2OOB B;  1RAX A;  4B9K A;  2WWZ A;  4MEM A;  3VHT C;  1C3T A;  1NDD A;  1WH3 A;  2FCQ A;  2GBM A;  4W9G A;  1WM3 A;  1Q0W B;  3PRM B;  1PQS A;  4PS7 A;  4XX5 A;  2J0K A;  2REX A;  4NQK E;  2K8H A;  3SDL C;  2ZVO A;  2L00 B;  2BKF A;  3RT3 B;  4E74 A;  2KWV B;  3NHE B;  1A5R A;  2C60 A;  1WFY A;  4NPN A;  4W9C A;  4GMV A;  3IBE A;  4JIO U;  4EFO A;  2IO1 B;  5DCN A;  4BKT A;  3UQA A;  2AEH A;  5J2R A;  1EF1 A;  4MSQ B;  4RM9 A;  5JHB A;  3ZUN A;  4MH0 E;  4FHJ A;  3U30 A;  3VTW A;  2AL6 A;  4DDG D;  2KTR A;  3VH3 B;  3CMM B;  1WZ0 A;  2NCN A;  1EUV B;  3AI5 A;  4GN1 A;  4ICV A;  2KLC A;  4FJY A;  1WMH B;  4KSL C;  4GOC A;  4WJQ A;  2ZNV C;  2EKE C;  3RD2 A;  2AL3 A;  3ZTC A;  1WRD B;  4X57 B;  3UIN B;  3VAW A;  1V5O A;  2I1J A;  1NI2 A;  2KNB A;  2N9P C;  1D3Z A;  2J7Q B;  1E8Y A;  3A9K B;  2Y5B B;  3ZRF A;  2N9E B;  4BBN F;  2JF5 A;  1L2N A;  2DYB A;  3PS6 A;  1X1M A;  3DVG X;  3HIZ A;  2K8C A;  2CKH B;  3ZW3 A;  2MQJ A;  2BKR B;  4BFR A;  4WWN A;  3HM3 A;  4I6P A;  1S1Q B;  1RFA A;  2JRH A;  3DVN U;  3MHS D;  3QX1 A;  4MJS B;  4LDT B;  1H8C A;  5JZE B;  3BY4 B;  3IFW B;  2MP2 B;  1V49 A;  1GNU A;  4AWJ A;  1WE7 A;  2M4N A;  3ZDM C;  2DAJ A;  1OQY A;  3UIP B;  2DZK A;  4EZJ A;  4F7Z A;  2V3S A;  3JYU A;  4GGQ A;  2KJH B;  2KLG A;  3I3T B;  4XZ4 A;  2IYD B;  1UGM A;  2JZZ A;  3L17 A;  2NS5 A;  3R66 C;  1LM8 B;  4B95 A;  2L05 A;  4IWP A;  1WX7 A;  4HDO A;  3SD5 A;  3U8Z A;  1WM2 A;  1YX5 B;  2BWF A;  3L0W B;  4A3P A;  2K25 A;  3PHW B;  4GSW A;  4MDK E;  1EF5 A;  2LGX A;  2G4S A;  4FJV B;  1E8W A;  3A9J B;  3UQB A;  2IO2 B;  5D7G A;  1P0R A;  1UEL A;  4DXA B;  2MW5 A;  2GBJ A;  2LJ5 A;  2O6V A;  5AZH A;  4ZYN A;  4HDQ A;  3APF A;  4HK2 A;  1TTN A;  1U4A A;  3DVN V;  4MGK E;  3RUL A;  3C0R B;  2L76 A;  3DBL I;  3NOB A;  4JQW C;  1E8Z A;  2KXJ A;  2D3G A;  2EMT A;  3EFU A;  4CHK A;  2LXA A;  3L16 A;  2R2Q A;  2MRP A;  3B08 A;  2ZPY A;  3ZRC A;  4BKS A;  2NVU I;  5D94 A;  3QIJ A;  5E6P A;  2G4D B;  4M0W B;  1VCB A;  2A4Z A;  2KD0 A;  3PV1 A;  3TIX A;  4RMA A;  4WJP A;  2KMC A;  1HE8 A;  2PJH A;  4J6I A;  2JZ3 B;  2GMI C;  2LGD A;  3QHT A;  2BPS A;  2NBW B;  4MSM B;  2KN5 A;  1GC7 A;  3AU4 A;  3WA0 A;  2XEW A;  3QA8 A;  2KX0 A;  1UD7 A;  2MBQ A;  2LI5 A;  2NPT B;  3N30 A;  4I6N B;  4LJO B;  1OTR B;  3W1S A;  2KDB A;  2Z0D B;  1VD2 A;  4DBG A;  2FCS A;  2UYZ B;  3ZDT A;  3SU8 X;  4GIV A;  3PLU A;  2JT4 B;  2C7H A;  2C5L C;  3APC A;  4XC2 A;  4EZK A;  4GDL A;  1GJZ A;  4K7U A;  4MM3 A;  5J18 A;  1Z2M A;  4I6L B;  2M1M A;  2NBV B;  2N7D A;  4MEL A;  1OGW A;  3Q3F A;  3PHX B;  4G0N B;  2O2V B;  4KZ0 A;  2RD0 A;  1WJU A;  2XK5 A;  3T8M A;  2DYO A;  1V86 A;  2C9W B;  4W9L A;  4W9F A;  4EOY A;  4GB9 A;  3V60 A;  1TBE A;  3U7D A;  3WAN A;  1GG3 A;  2KKC A;  4GU2 A;  4TKN A;  4FA6 A;  2K8B A;  4MGI E;  2DHZ A;  4MGZ E;  1UZX B;  3UIO B;  2FUH B;  5TR5 A;  2KX3 A;  4ASW C;  4WWP A;  1P3Q U;  2KC1 A;  2ZNV B;  5CTR C;  5J17 A;  1T0Y A;  2C7M B;  2KDE B;  3LDZ E;  3ALB A;  3DBR I;  3IG3 A;  2K1F A;  3R7R A;  4W9K A;  1LFD A;  2D2Q A;  3B0A A;  2KQ7 A;  1CMX B;  1SGH A;  3K9P B;  1TGZ B;  2L8J A;  4NJ6 A;  3V62 A;  3VFK A;  4F8C B;  1ZW7 A;  2BGF A;  2DZM A;  1ZGU B;  3KYD D;  3VUW A;  2KFK A;  3WAP A;  3NS8 A;  1UBQ A;  5CHW A;  3VTV A;  2FCM A;  3L54 A;  2KQS A;  2XBB C;  3OJ4 B;  1E7V A;  4N9F 4;  4BOS C;  1UH6 A;  2KC2 A;  3ONS A;  5LLI A;  4OVU A;  1I42 A;  1Z5S B;  4AUQ C;  4BVU C;  1IPG A;  3EHV A;  1V81 A;  1AAR A;  1F9J A;  2Z59 B;  4II3 B;  2CU1 A;  4KIK A;  4NY0 A;  3DBS A;  1V2Y A;  3JSV A;  2WX1 A;  2L7R A;  2ZPN A;  2WYQ A;  2W9N A;  1WGG A;  1WGY A;  3WAO A;  1WYW B;  4ZRI A;  2K6D B;  5AEK B;  3A9J A;  1WY8 A;  2N9X A;  4WJO A;  2DEN B;  2O6V D;  2FCN A;  3DBH I;  3M95 A;  1Y8R C;  2LUE A;  2GBN A;  3QCA A;  3W1S C;  2KJR A;  3HHM A;  2CS4 A;  1KOT A;  2N1V A;  2KJ6 A;  5E6O A;  1YJ1 A;  4GDK A;  5JHA A;  3H7S A;  4M8N A;  1TZ1 A;  2HD5 B;  4BKS D;  4AJW A;  5E6N A;  4ANW A;  4KDL B;  1V9J A;  3H7P B;  4HPM B;  3ENE A;  3QC8 B;  4FUL A;  1WR6 E;  1V5T A;  2RR9 A;  4PS8 A;  2KWC A;  2RGF A;  2LVO A;  3IVF A;  4IG7 B;  1H4R A;  3RZF A;  4WJN A;  2L0T A;  2LRU A;  2DZJ A;  3KUZ A;  4KDI C;  2D10 A;  2KO3 A;  5G55 A;  1M94 A;  2G45 B;  2M8S A;  4ICU A;  2AYO B;  2HJ8 A;  2QHO A;  2J0J A;  3HM6 X;  1RRB A;  2ZJD A;  3ML9 A;  2NPT A;  2RSU A;  3EC8 A;  4HJK A;  3DDC B;  3DVG Y;  2JUO A;  3RZW C;  3TL5 A;  1L7Y A;  4K7S A;  3BIN A;  4EEW A;  1WGR A;  2PE6 B;  1WJ4 A;  4IUM B;  3VDZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...