2KJ6A

Nmr solution structure of a tubulin folding cofactor b obtained from arabidopsis thaliana: northeast structural genomics consortium target ar3436a
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
97
structure length
97
Chain Sequence
MGHHHHHHSHGDDSVHLHITHANLKSFSADARFSPQMSVEAVKEKLWKKCGTSVNSMALELYDDSGSKVAVLSDDSRPLGFFSPFDGFRLHIIDLDP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Chaperone
molecule keywords Tubulin folding cofactor B
publication title NMR Solution Structure of Tbulin folding Cofactor B obtained from Arabidopsis thaliana: Northeast
rcsb
source organism Arabidopsis thaliana
total genus 17
structure length 97
sequence length 97
ec nomenclature
pdb deposition date 2009-05-22
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 2kj6A01
3RT3B 1UZXB 2KTRA 3IFWB 2KMCA 1GNUA 1V86A 3ONSA 3TIXA 2K6QA 1WE6A 4TQ1A 4E71A 2LJ5A 1E7VA 2XBBC 3VAWA 2FCSA 2L76A 3UGBB 3DBLI 4LJOB 2MWSB 2XEWA 4WWOA 3EC8A 2MBBB 2N4FA 3IBEA 2LZ6A 1E8ZA 1WIAA 2G45B 2B3AA 4NJ6A 4DXAB 2O2VB 2DZMA 4W9LA 5AZGA 3VH3B 1C3TA 3H7PA 1IPGA 2FCQA 3WAOA 1WXSA 3NZSA 2K8BA 3R3MA 3ZKJC 1TZ1A 2KWUB 3A9KB 2KQSA 3DPDA 1V81A 3A1QA 4P7IA 4W9FA 4KDIC 3PS6A 4IM2A 5E6NA 1A5RA 2NCNA 1OGWA 1R4MI 3MJWA 1UH6A 3PTFC 2L8JA 2DZJA 4HCPB 3CMMB 2J0JA 3VTWA 1UGMA 1GUAB 1ZW7A 4BFRA 2KJHB 3V6CB 4PS8A 2K6DB 2DYOA 1V9JA 1T0YA 3VTUA 5CHWA 2CKHB 1H8CA 1L2NA 5D7GA 2LASA 2ZJDA 1UELA 1C1YB 2MBQA 4KVGB 1EO6A 5D6JB 4HDOA 4DHZE 2O6VB 3B1LX 1SIFA 3GOEA 4JQWC 4G3XB 3ZNID 2FAZA 2I1JA 5DPSA 4WWNA 4ICUA 2N9PC 2DYBA 4FLHA 2IO1B 3QX1A 4BOSC 3LDZE 4GSWA 4I6LB 4EEWA 2AYOB 4KZCA 4KZ0A 3MTNB 3X0WA 2UWQA 2RPQA 3L16A 2I1KA 1GG3A 1WXAA 1JRUA 1S1QB 4J6IA 2IO2B 3RZWC 4DBGA 2N1VA 4BBNC 3V61A 2CR5A 2ZVNA 2KTRB 3KUZA 1I35A 3ZW3A 4X57B 1EUVB 2MCNB 1WX8A 4TQ0A 1WX7A 3T9LA 3W1YA 4AJWA 3HM6X 2LRWA 3VXWA 3WANA 1YJ1A 2MSED 3W1SA 1Y8RC 2DENB 4HXDA 1VCBA 1M94A 2V1YA 2K8HA 2LVOA 3NOBA 1OEYA 2LD9A 3PLVA 4W9EA 5KHOA 1J8CA 4GMVA 2BWFA 2ZPNA 2M4NA 3V62A 3RUIB 2NVUI 1WE7A 1UD7A 3IHPC 4B6WA 2JRIB 4EZJA 1WM3A 1WJ4A 2O6VD 2RGFA 1WYWB 3P2BA 2M8SA 3QQ8B 4BKTA 4IWOA 1J0GA 5GMVA 3GZNI 3A9JB 1VD2A 2O6VA 1Z2MA 2L7RA 2LI5A 2REXA 3EFUA 4FA6A 4DDGD 3JYUA 4AP4C 1WY8A 4II3B 2N1WA 2CS4A 4E74A 2KHWB 2RSUA 2KKCA 1YIWA 4DHJD 3PPAA 4W9GA 3ZRFA 1BT0A 2BYVE 2K8CA 2L0TA 2L0FA 1ISNA 3QCAA 1WGYA 2LVPA 4DK5A 2KC1A 4KDLB 5E6OA 2AWTA 4K7UA 3BINA 4MDKE 2KZRA 1OQYA 2HD5B 2LXCA 3EECA 4MSMB 4MGKE 3I3TB 3WAPA 1J19A 3H6NA 3Q3JA 4WJOA 1E7UA 4FHKA 5LLIA 3OJ3A 4GXBA 1IYFA 3CSFA 4BKGA 1WX9A 3N3KB 4KSLC 4TV3A 4WAAA 3WAMA 2EMSA 3PREA 4BVUC 4EZLA 2MBHA 1L7YA 2ZNVB 4IM0A 4PS3A 3KUDB 4IM3A 3H9DA 1YQBA 3ZLZA 4PYZA 1WRDB 4GU2A 1WXVA 1NDDA 3ZNHB 3UINB 4IUMB 4EFOA 3QIJA 2C7NB 2OOBB 3ZVVA 1Q0WB 1S3SG 4K81A 2WYQA 4ANVA 3DVGY 2DZIA 4IC7B 4FBJB 4AWJA 1CMXB 1GC6A 2D3GA 4FN2A 2ASQA 2N9EB 2J0KA 4MGZE 2KANA 2CHZA 1E8YA 2EMTA 3VUWA 3DOWA 4PS7A 1WJUA 3RCZA 3V6EB 3PHWB 3RZFA 4AOFA 2BWES 1RFAA 2MA9B 1KM7A 3ZUNA 2JWZA 1V6EA 1V49A 3A9JA 4HK2A 4HDQA 2C5LC 2L05A 3B08A 4IWPA 5D2MB 2CHWA 4ZDVA 3DVGX 5CHVC 4F7ZA 3JSVB 1WGDA 2N7EA 2N7DA 2WX0A 4B9KA 1WH3A 4GOCA 4JGHB 2HJ8A 3D32A 2Z0DB 4NAWA 3T8MA 4ANXA 2DX5B 2KDEB 3KYCD 1P9DU 3OLMD 2KDFB 2MX2A 3ZNZB 1GC7A 1Z5SB 3CF6E 2C7HA 2XK5B 3A33B 2KMAA 2L3ZA 3AU5A 4FADA 2FCMA 4G50A 4NNJB 3HIZA 2BKRB 3SHQA 1YX6B 2UYZB 1AARA 1LFDA 4B95A 3EHVA 2G3QB 3L54A 4G0NB 1WJNA 3M3JA 3AULA 1WGRA 2DHZA 4KIKB 4RM9A 3QWZB 4AJYB 5IAAC 2NPTB 4DHJB 4RM8A 4MEMA 2LVQA 3DVNU 2KXJA 3N30A 5AEKB 1G6JA 3L17A 2MQJA 2IO3B 4MSQB 2NBVB 4GB9A 3UIPB 4CHKA 2CU1A 4BKSD 2CHXA 2JUOA 2RD0A 2DZKA 2Z0EB 2ZEQA 3C0RB 3PGEA 4GDKB 4LJPB 4MM3A 2KLGA 1F9JA 4IWQA 3JVZX 4MJSB 1K8RB 1TTNA 2MBOA 2KVRA 1HE8A 3PRMB 4BBNF 1ZKHA 1WMHA 2QHOA 2LXAA 4BOZB 3ECIA 5AZFA 3TJPA 4JLCA 5D94A 2DYMA 2KO3A 4E3CA 1YX5B 3ALBA 2KQ7A 3IG3A 3AXCA 1UBQA 4HVBA 5HKHA 2PPHA 3TCAA 3JSVA 4OVUA 4TUUA 4FJVB 3DBRI 2D2QA 2WWZA 3WIMA 4WQOB 2J0MA 4N9F4 5L83A 1Q1OA 3QAQA 4ICVA 1UBIA 2D07B 3ZDTA 4W9CA 2C7MB 2XK5A 5C23A 4K7SA 2FCNA 2JXXA 1WI0A 2GBNA 4GIVA 3DCGA 3H1UA 3ML8A 2IO0B 2NBWB 2R2QA 3APCA 3KVFB 4KV2A 5AZHA 2RR9A 4W9KA 5J17A 3ZNGC 2PE9A 3TBLD 5JH5C 2MW5A 2OJRA 2Z59B 3TL5A 3M63B 4NAWB 2GMIC 1OTRB 1XT9B 2GBJA 2LGXA 3APFA 5J18A 5L95C 4KIKA 3DVNV 1RAXA 3KUCB 2L00B 2NPTA 3QC8B 4EOYA 3UQBA 3W1SC 4CO7A 2Y5BB 4FULA 2K25A 2IY0B 4GDLB 2NR2A 4NQKE 2JT4B 3ZO5B 5JZEB 2KX3A 1TGZB 2IYDB 2M0XA 3KYDD 4F1SA 5CX3A 1GJZA 3HK0A 4M8MA 3PSEB 4MGIE 4GDKA 3VQIA 1RRBA 2KC2A 3AI5A 2G4DB 2FIDA 4W9JA 5BO4B 1WZ3A 4JL9A 4MJSA 5C1ZA 3KW5B 2BKFA 2EKEC 1WGGA 4ZRKA 3O65B 5CTRC 1RLFA 2WX1A 2MP2B 4HLEA 3UIOB 3NHEB 2N9XA 3R7RA 2KX0A 3NZUA 3RYTA 3SDLC 4DHZB 2M17A 3HHMA 5G55A 3IVFA 3VUYA 2A5UA 1E8WA 2AL3A 1SE9A 3UF8A 3KH0A 2KFJA 1V80A 5JHBA 5DCNA 3OAWA 2JRHA 3DBSA 1LXDA 1WMHB 3PHXB 3NS8A 3PV1A 1WFYA 3ML9A 3U7DA 3VVWB 4AUQC 2VRRB 3UQAA 1R4NI 2GBRA 2KN5A 2FNJB 2MLBA 4F8CB 2PEAA 4FHJA 1P0RA 2W9NA 4NQLB 2KNBA 1U4AA 4XC2A 3U8ZA 2KJRA 2PJHA 3PRZA 3R66C 2C9WB 3M62B 2IY1B 4W9HA 1V5OA 1E8XA 3PT2B 1I42A 4II2B 2V3SA 1P3QU 5CHFA 3LJ3A 2HE7A 4HPMB 3ZDMC 1V2YA 4HJKA 4ASWC 4HCNB 5JHAA 1WZ0A 2D10A 3M95A 1D3ZA 2ZZPB 3ZIMA 1E5WA 4GDLA 2DAJA 2YVCA 1WJ6A 5EDSA 2ZVOA 4NJ7A 3AU4A 4K7WA 3S2AA 2KWCA 3A4RA 4YL8A 2KFKB 1LM8B 3DDCB 4FJZA 2K39A 3VFKA 5LXHA 3PVLA 1KOTA 5DPWA 2YLMA 3ZTDA 4A3OA 2GOWA 4JIOU 3K9OB 4WJQA 4EKUA 2JPHA 4K1RB 4A3PA 5J2RA 4ANWA 2MP2A 2JY6A 2BPSA 2BGFA 2LRUA 5IA7A 2PE6B 1XQQA 1X1MA 3JW0X 2ZCCA 4MGYE 4LCDE 3SD5A 2ZCBA 4NPNA 4WWPA 1KJTA 3CSTA 4IW0A 2A4ZA 4ZRJA 3RULA 4BKSA 2MBEA 3HM3A 3ZRCA 2GBMA 2IZVB 2KOXA 2HTHA 4MH0E 4A20A 3ZTCA 1LQBA 2AEHA 1OEYJ 2AL6A 2JZ3B 2NBUA 3QK0A 4G11A 3X23A 4ZRIA 3R7QA 4LDTB 4CYEA 4URKA 1MG8A 5KHQA 1WM2A 3B0AA 4DWFA 5DPRA 2KLCA 1XD3B 2O2VA 2LWPA 3VH4B 2J7QB 2IBIB 3TMPB 5LXIB 5G2NA 5DPTA 1EF1A 4GGQA 2ZNVC 2KDIA 2R2OA 4XX5A 3A9KA 3DQVA 2KDBA 1QZEA 3L08A 2JZZA 4ZYNA 4WJPA 1Q5WB 3DBHI 3PZDA 3VHTC 2NS5A 4PYUA 2LUEA 2BYFA 3PLUA 2WDTB 3VDZA 2BF8B 1SGHA 4TKNA 4HWIB 5FR6A 3VTVA 1E90A 1WXMA 3NY5A 2JF5A 5TR5A 1YD8U 2KFKA 1NBFC 4I6NB 3OJ4B 3H7PB 3L0WB 3QARA 4M0WB 4ANUA 3H7SA 2LGDA 2JVCA 3V60A 2KD0A 2MRPA 4W9DA 2V4LA 3RD2A 3A1QB 1P98A 3QA8A 1WR6E 1P1AA 3WA0A 4GN1A 1NI2A 4FJYA 1ZGUB 3Q3FA 4EUTA 1PQSA 3A4SC 3APDA 2D11A 2DAFA 1V5TA 2K1FA 2C60A 2LGYA 1EF5A 4IG7B 4OVVA 4WJNA 1WGHA 4M8NA 1WR1A 3L13A 2FUHB 4W9IA 4RMAA 4NY0A 2GBKA 2G4SA 1TBEA 2BYEA 3MHSD 3ENEA 3K9PB 4I6PA 4LDTD 4KSKC 4DDID 2KWVB 3QJZA 2ZPYA 4MELA 3PRPB 1FXTB 5E6PA 1WF9A 4HPLB 2KJ6A 4XZ4A 1KLVA 2KK8A 3U30A 3QHTA 2KTFA 3VUXA 3WALA 3BY4B 2FIFA 3N32A 1IP9A 2M1MA 1H4RA 3L10B 3SU8X 4EZKA
chains in the Genus database with same CATH superfamily
2KTRA 1GNUA 3MC8A 3TIXA 1WE6A 1V1PB 3OG5A 1E7VA 3UGBB 4LJOB 3W5VB 2MBBB 1E8ZA 1JCKB 2O2VB 2NMQA 4W9LA 5AZGA 1I7HA 1MG4A 3VH3B 3B2GA 5TSSA 1IPGA 2FCQA 2WXIA 4WAFA 2KWUB 2KQSA 2WXNA 3DPDA 4KDIC 4H2AA 2KN4A 2WXOA 4XE0A 2L8JA 2J0JA 3RI7C 4N58A 3AE8B 3V6CB 2DYOA 5CHWA 2LASA 4IOIE 3BYYB 2AQ3B 4KVGB 3AEDB 4DHZE 3GOEA 2ON8A 4NJCA 3Q2AC 4K3CA 2IO1B 4EEWA 1SB3C 2PVOD 1V1PA 1F52A 3DWGC 2BB5A 3L16A 1GG3A 1YQ4B 1IGDA 3AE5B 3RZWC 3NVYA 2N1VA 2CR5A 1L0YB 3KUZA 1EU4A 1WX8A 3W1YA 3HM6X 2MSED 1YMHE 4WQMA 2V1YA 2K8HA 2LVOA 3PLVA 4W9EA 4GMVA 4B0MA 3IHPC 4B6WA 1J7AA 1XCQL 1YN3A 3QQ8B 1WYWB 1J0GA 3GP7A 3GZNI 2KMMA 3A9JB 1QT9A 4MH8A 2HTME 5C3JB 3JYUA 4II3B 1YN5A 3AB5A 2KHWB 1L6UA 2RSUA 1VZ6A 2KKCA 3NVWA 4W9GA 4HROA 2WXJA 3TEZA 1T3QA 2K8CA 2L0TA 1WGYA 2LVPA 4DK5A 2LGIA 4KDLB 4XZ4A 2W3SA 3NZ3A 2KZRA 4MSMB 3EECA 4MGKE 2K9XA 3N1YC 4FHKA 3OJ3A 4GXBA 3CSFA 1WX9A 3WAMA 4WAAA 3H9DA 4JE3B 1DYQA 1F77A 4IUMB 4EFOA 4S17A 4NAMA 3N20C 4AWJA 1GC6A 2D3GA 4FN2A 2N9EB 2CHZA 2EMTA 1PDXA 2BWES 3DBRB 3N1XC 1KM7A 5BMHA 1VJKA 3A9JA 2IPKD 4IWPA 2L05A 4HDQA 3DHHC 4F7ZA 2N7EA 4B9KA 4N6EB 1WH3A 3D32A 2KDEB 2KDFB 1GC7A 1MFWA 1F2RI 2C7HA 3A33B 3AU5A 1STEA 4FADA 4OVZA 4NNJB 2W55A 1YX6B 4S0RA 1LFDA 3EHVA 1ENFA 4MEMA 1ZPSA 1FD6A 1QILA 4OHJA 1D5ZC 1G6JA 2IDYA 2CHXA 3SR6A 3GS2A 5BYSA 2KLGA 4IWQA 2MBOA 3P1MA 2KVRA 3PRMB 1ZKHA 2QHOA 4N59A 2LXAA 1HEZE 2LUMA 3TJPA 2KO3A 1YX5B 2KQ7A 1I4GA 2BBCA 3AXCA 1R4NB 3HRDD 4TUUA 2D2QA 4WQOB 2J0MA 1E6EB 1LO5D 4HRSA 4XGAB 4C56C 4HEA1 1UBIA 2JSVX 2D07B 2C7MB 4OZBA 1FO4A 3H1UA 5AZHA 3APCA 3IAM1 4KV2A 1JQ4A 4W9KA 2PE9A 4REZA 2OJRA 2Z59B 1UWMA 5EE1A 2L32A 1Q10A 2INPE 1TKYA 1D5XC 4UDUC 3NG0A 3W1SC 2Y5BB 4NQKE 2K25A 3ZO5B 2JT4B 3NJTA 3RPFC 1RFKA 2M0XA 5CX3A 3VQIA 2KC2A 5C1ZA 1WGGA 2BW2A 2SAKA 2WX1A 2MP2B 4L2YA 3R7RA 2QMTA 4PK1A 3AEFB 4MM3B 3VUYA 1E8WA 1C76A 5JHBA 3CWIA 3OAWA 4MT5A 3DBSA 1FFVA 1WMHB 3NS8A 2M56B 1WFYA 3ZXVA 1KH0A 1QOAA 3VVWB 4AUQC 3V3XA 2FNJB 3NVVA 2PJHA 2KQ4X 2C9WB 2D3BA 2QDFA 1WRIA 3LJ3A 4EE2A 4HPMB 2D10A 4D2KA 2ZW1A 3CIRB 5EDSA 3AU4A 1C77A 4FJZA 3VFKA 1ROEA 3PVLA 2JYEA 5DPWA 4DXFA 3ZTDA 3SFEB 3K9OB 4EKUA 3MC0B 2JPHA 4K1RB 4K3BA 5J2RA 1T6BX 4ANWA 2MP2A 2JY6A 3KLSX 2BPSA 4A6QA 3P4SB 2QIEB 1X1MA 3JW0X 2ZCCA 3I5JC 2I2YA 3ZRCA 3BK2A 4RGNA 5BMGA 2HTHA 4A20A 1LQBA 1B1ZA 3X23A 4CYEA 2CU3A 1MG8A 3KWVA 1HA5A 2E6XA 2KLCA 5E6JA 5D3DA 2IBIB 5DPTA 3Q69A 2ZNVC 1L5PA 1VZ8A 5GXGB 4XX5A 3V05A 3A9KA 2KDBA 3L08A 2JZZA 2XNAC 3DBHI 4PYUA 2LUEA 3TUOA 1KFYB 1SGHA 4HWIB 1AW7A 1E90A 4I6NB 1NBFC 3QARA 3MHZA 4ANUA 3SEBA 5G5GA 4GN1A 1NI2A 1ZGUB 3A4SC 1V5TA 1HTQA 2C60A 4OVVA 1EF5A 2PW9A 4M8NA 4WJNA 4KGSA 4JPSA 4W9IA 1N60A 2GBKA 1C4AA 1JW9D 2QCZA 3R2TA 3QJZA 2ZPYA 2V0GA 2JU6X 4HPLB 2KJ6A 3U30A 3QHTA 4AQ7A 2FIFA 3RNCC 2IGHA 2M1MA 4ZRQA 1IP9A 2KMCA 3ONSA 2K6QA 4E71A 1XF5L 2XEWA 3EC8A 3R2IA 2QJLA 2LZ6A 2LMCA 3IT4B 3U2SC 1I4QA 3WAOA 1NVID 1WXSA 3ZKJC 1TZ1A 2N0SB 3ZJTA 1ET9A 1V81A 3EUB2 4P7IA 4IM2A 1N63A 2NCNA 3ETRA 1PGBA 2DNFA 4XDCA 2DWQA 2WXLA 3AE4B 4RCOA 1V9JA 2CKHB 1H8CA 1SBBB 1UELA 4HDOA 3B1LX 1SIFA 3ZNID 2FAZA 1C78A 5DPSA 4WWNA 4ICUA 2RMMA 2N9PC 4WWMA 2DYBA 3IT6B 1C79A 4GSWA 4I6LB 3AMZA 2AYOB 4YTNB 1OQRA 2UWQA 2RPQA 1QLBB 1WXAA 2LJIA 1S1QB 4J6IA 4WIPA 4WURA 3V61A 2JZPA 3E9SA 2KTRB 1FEHA 3EGRA 2MCNB 4TQ0A 1WX7A 3T9LA 2LRWA 3VXWA 3WANA 3U52E 2DENB 1TS3A 1M94A 4YSZB 3NOBA 3DHGC 5KHOA 2CJOA 3V62A 3Q3NC 1R7SA 2MJEA 4EZJA 3AEEB 3AE6B 3OWEB 2WU2B 5IOIA 3TEXA 2L7RA 2VH2A 2LI5A 2REXA 1KLGD 4FA6A 2D3CA 4AP4C 1WY8A 2MH7A 4E74A 4KX6B 1SIJA 4M00A 4FXCA 1N62A 4DHJD 3PPAA 1BT0A 2L0FA 3C19A 5E6OA 1FXIA 3BINA 1OQYA 2HD5B 2LXCA 3N1ZC 2JYTA 1Y56A 3H6NA 4MACA 5LLIA 3N3KB 4TV3A 4BVUC 2MBHA 1FNUA 4IM0A 4IM3A 4YSYB 2FUG1 1YQBA 3T3OA 4PYZA 1WXVA 1NDDA 3UINB 1NI3A 2OOBB 4ANVA 2K3UA 3Q3OC 4IC7B 4FBJB 2ASQA 4MGZE 1E8YA 3VUWA 3DOWA 4PS7A 3RCZA 1RFAA 2MA9B 1V6EA 2BS3B 4HK2A 2RDGA 2GI9A 1E9MA 2W3RA 2CHWA 4ZDVA 3DVGX 1ZDXA 3IXSA 4GOCA 3FILB 2HJ8A 1B9RA 1OQQA 2DX5B 3KYCD 1HZ6A 1L0VB 1YNTE 2JX5A 3ZNZB 1D6EC 1JALA 1FXAA 1L6VA 1YQ3B 3SHQA 2UYZB 3NUHB 3M3JA 3J9CA 4KIKB 4RM9A 2NPTB 3RNGC 4RM8A 2LVQA 3N30A 5AEKB 2MQJA 2IO3B 1XLNA 4CHKA 3PGEA 2JUOA 3C0RB 1FFUA 3Q8CA 4LJPB 1ZXHA 2XN9C 1F9JA 2GRIA 3JVZX 1A70A 2DBYA 1XLPA 3B2FA 4BOZB 1JWBD 5AZFA 4JLCA 2WXPA 2DYMA 2KYWA 3ALBA 4IKGA 3IG3A 2PPHA 3TCAA 4FJVB 2WWZA 1T0RC 3WIMA 3FILA 3RMKC 1CZPA 1MPEA 1Q1OA 4ICVA 3RFZB 3ZDTA 4W9CA 1SJHD 4K7SA 2FCNA 4GLSC 2NBWB 1DGJA 3ZNGC 2H89B 3TL5A 1FRDA 1M4VA 3AV8A 2LEKA 1XT9B 1GB4A 4KIKA 3KUCB 2L00B 2NPTA 3QC8B 1V1OA 4FULA 4LNIA 2NR2A 3HVDA 2YEPB 2IYDB 3KYDD 1GJZA 3HK0A 3PSEB 3MFGA 1RRBA 4P16A 1WZ3A 1NYRA 3VRBB 1CK1A 1K52A 4L1BA 5CTRC 3UIOB 3NHEB 3KQ4A 2N9XA 4JX1C 3SDLC 5IKCM 4DHZB 2M17A 4C4VB 2WNMA 2ICIA 3KH0A 2KFJA 3BWUD 4M01A 5DCNA 1SE2A 2JRHA 3RNFC 3WCQA 3U7DA 3UQAA 5D3IB 2GBRA 2KN5A 1L4DB 4F8CB 1VDVA 5EE9A 1P0RA 4XC2A 1U4AA 1D4BA 3DBHB 1YN4A 1V5OA 1I42A 1P3QU 5CHFA 2H88B 2HE7A 3EA6A 4ARCA 4HJKA 4HCNB 1WZ0A 1D3ZA 1E5WA 4YWGG 2DAJA 2ZVOA 2J42A 3S2AA 4XWTA 1I4HA 1LM8B 1N5WA 1QOGA 1EM7A 2GOWA 4WJQA 3DHIC 3AE9B 5EE0A 2BGFA 2LRUA 2PE6B 3L4PA 4C4VA 3W2DA 4P1BC 4MGYE 4LCDE 2WXGA 2A4ZA 4IW0A 2M19A 4US8A 2KOXA 1PFDA 4MH0E 5FK9C 1OEYJ 1K53A 4G11A 4ARIA 3R7QA 2QEJC 4DWFA 5DPRA 3H8HA 4RGMA 2LWPA 5G2NA 1F1HA 4A55A 3ZJUA 1EWYC 4WJPA 4ZYNA 3PZDA 3VHTC 4CQNA 1RWSA 3PLUA 3VDZA 3KWLA 2BF8B 3W9CB 3PZ7A 1WXMA 2WDQB 3NY5A 1JRPA 1ESFA 1WWTA 1SE4A 1T0QC 4M0WB 2GB1A 1K50A 5IP4D 1FMAD 2L1AA 2V4LA 3QA8A 1WR6E 1ET6A 3WA0A 4RH6A 3Q3FA 4EUTA 1ZXIA 3MC9A 2VZKB 3APDA 2D11A 4YT0B 4KGRA 4HKQA 2FUHB 4RMAA 4NY0A 1VRAB 3LXFA 2RPVA 1FNVA 4DDID 4MELA 3PRPB 1FXTB 4KGTA 1WF9A 1I4PA 1KLVA 5BYQA 3WALA 2HDEA 2WXFA 1H4RA 3L10B 4EZKA 3IFWB 4TQ1A 1V97A 2XBBC 3VAWA 2FCSA 1GPXA 2DLBA 1PGXA 3DBLI 5EE3A 2WDVB 2N4FA 3AE1B 1WIAA 4R3DA 2D3AA 2B3AA 4IDIA 2DZMA 4M0WA 2D5GA 3NZSA 2K8BA 4HKZE 3A9KB 2VZKD 3ZYYX 2TSSA 1ZDVA 1J7CA 3PS6A 5E6NA 1OGWA 1R4MI 3MJWA 5LNK1 3MJ5A 3VTWA 1C4PA 2WXHA 2BB6A 1GUAB 4BFRA 4C7ZA 1EWCA 2K6DB 3VTUA 1L2NA 1TY2A 2ZJDA 2MBQA 5D6JB 2O6VB 4J3OD 4FLHA 2VH1A 3QX1A 3LDZE 4YXDB 3AEGB 2ONQA 3P63A 4KZCA 1SXTA 3MTNB 2K5PA 1JRUA 1FCLA 3VR9B 4BBNC 1J7BA 1MVKA 4DXGA 2ZVNA 1I35A 3ZW3A 4PT5A 1YJJA 2N9KA 1K51A 3W1SA 4HXDA 1P7EA 1J8CA 4RF0A 3GE3C 1P7FA 2BWFA 2ZPNA 2M4NA 4P1CC 2J52A 3RUIB 5FR3A 1WE7A 3B9JA 2JRIB 2O6VD 1I4XA 2M8SA 4IWOA 1VD2A 2O6VA 2BTEA 2K22A 1TKGA 2N1WA 5BYRA 2OHFA 3FC4A 3ZRFA 2JXTA 2BYVE 3QCAA 1GOZA 2FBWB 2AWTA 4MDKE 4QAYA 3WAPA 1J19A 4HJGE 2JQRB 3Q3JA 1DOXA 2EMSA 4TMAB 4EZLA 2ZNVB 4KKJA 3I63C 3ZLZA 4YTPB 4GU2A 3ZNHB 1VR9A 3QIJA 2C7NB 3ZVVA 1S3SG 4K81A 4C80A 2DZIA 5H92C 2KANA 2IJ0A 2LHEA 1TS2A 4B0EA 3PHWB 3RZFA 4AOFA 3ZUNA 5JXVA 1L0XB 2JWZA 3AEBB 2C5LC 3B08A 3GZNB 5C2TB 3JSVB 1WGDA 2WX0A 2SEBD 2M0AA 1PUTA 2KWDA 4NAWA 3BVGA 4C00A 1P9DU 2N9LA 4JWSC 2Y3AA 3VR8B 3AECB 1Z5SB 1N61A 2KMAA 2L3ZA 2KAJA 2FCMA 1FCCC 3HIZA 2BKRB 1I4RA 1IUEA 4JWUC 3RNAC 4B95A 4G0NB 2G9HD 2DHZA 2G1EA 2X38A 3QWZB 4AJYB 5IAAC 4DHJB 3AEAB 4LNOA 2KXJA 4ACFA 4MSQB 2NBVB 4BKSD 2QILA 4GDKB 2RD0A 2Z0EB 1SEBD 2ZEQA 2MEKA 4MJSB 1TTNA 2BYTA 1HE8A 1ZE3D 4BBNF 2CJNA 4ITKA 1BMLC 1TY0A 1UBQA 4HVBA 1TS5A 3JSVA 2B76B 4A90A 5L83A 3QAQA 1UNSA 4RNAA 3BZDB 4P6VF 1OFFA 4GIVA 2INDC 2LHDA 2PTLA 3DCGA 3ML8A 2R2QA 3DWMA 2QC8A 2R61A 3O13A 3TBLD 2NTTA 2GMIC 1E7PB 2LGXA 5J18A 5L95C 5H8YE 3ZJVA 2LFIA 3PZ8A 3UQBA 1GAQB 2K0PA 4LK0M 4CO7A 1NENB 5JZEB 1TGZB 2PIAA 4M8MA 4GDKA 4JL9A 5MPOA 4MJSA 3KW5B 2BKFA 3O65B 2PLPA 1TKEA 1RLFA 4HLEA 1ZUD2 3NZUA 3RYTA 1RYJA 5G55A 2X8XX 3IVFA 2AL3A 4AS1A 4OZAA 1NEKB 2WU5B 2KT7A 3UF8A 3PV1A 2EKIA 1JWSD 2EELA 4NZLB 2NTSA 2J53A 1UGJA 4FHJA 4LLGM 3RN9C 2KJRA 5HI1A 3PRZA 3R66C 2Z8LA 3M62B 5AUIA 3U4EG 3PT2B 4II2B 3BVMA 3ZDMC 3E56A 1YOVB 2ZZPB 5HHDG 3ZIMA 4K7WA 2KWCA 1TT5B 3A4RA 4YL8A 2KFKB 2K39A 4WH4A 5LXHA 1KOTA 4JIOU 4A3PA 3TEWA 4ZOHC 2Y5PA 1IGCA 1XQQA 2WDRB 3SD5A 3NVZA 2ZCBA 4WWPA 2GLSA 1KJTA 3CSTA 3RULA 3HM3A 1UF0A 2GBMA 2LGSA 2JZ3B 3AN1A 2NBUA 4ZRIA 4LDTB 1UWXA 4URKA 1TYGB 3DBLB 1JMLA 2O2VA 3TMPB 5LXIB 1YJIA 2KDIA 2R2OA 2WHIA 3Q8FA 1Q5WB 2NS5A 2PKOA 3FAHA 5TR5A 1R4MB 3P4QB 2JF5A 3I57A 5IN7A 2KFKA 3OJ4B 3H7PB 3H7SA 2LGDA 1KLUD 3V60A 3AH7A 2MRPA 3A1QB 4DQOC 4XWWA 1FIQA 1PQSA 4WJOA 4IG7B 1WGHA 1WYGA 1WR1A 1TBEA 2IGGA 4LNKA 3MHSD 4LDTD 1CQVA 2KWVB 2BS4B 5E6PA 1QOFA 1AWDA 3BY4B 3N32A 3RT3B 1UZXB 2AQ2B 1V86A 2LJ5A 1E10A 2W82A 2L76A 1T5XD 1D5MC 2MWSB 3LB8C 4WWOA 2V9HA 2E3TA 5G5HA 3IBEA 2G45B 4NJ6A 4DXAB 1E0ZA 1C3TA 3H7PA 2BS2B 3R3MA 3I9V1 2PMVA 3R8BA 3A1QA 4W9FA 1A5RA 2V4IB 2QSDA 1UH6A 3PTFC 2DZJA 1TJEA 4YSXB 4HCPB 3CMMB 1GB1A 1UGMA 1ZW7A 5FKAC 2KJHB 4PS8A 1T0YA 5D7GA 2MJDA 1C1YB 1EO6A 1BXTA 2V3PA 4JQWC 4G3XB 4LNNA 3LYYA 3AE7B 2I1JA 1RM6C 4BOSC 1N6ZA 4KZ0A 4O1NA 3X0WA 1IBXB 2I1KA 4LNFA 4OW0A 5T8IA 2IO2B 4DBGA 2WGSA 1EU3A 1KTKA 4X57B 1EUVB 2J4XA 4AJWA 2YEPF 2BVCA 1F0ZA 1YJ1A 1Y8RC 1VCBA 1OEYA 2LD9A 2AQ1B 4OZCA 2NVUI 1UD7A 3PO0A 1ZOYB 1MJDA 1WM3A 1WJ4A 2OJWA 4RFBA 2RGFA 3P2BA 1NYQA 4ZYSA 4BKTA 3HVZA 1QKZA 1HQRD 1JWMD 5GMVA 4A8XC 5AUKA 1WGKA 1Z2MA 2INNE 3EFUA 4DDGD 1QF6A 2CS4A 5HFYA 2UU7A 4RF1A 1YIWA 1C9FA 1ISNA 2KC1A 3Q3MC 4K7UA 1IBXA 4ZHOA 2WXKA 3SFDB 3I3TB 4L23A 1SSNA 2Q5WD 4ZHPA 3U7ZA 1E7UA 1IYFA 4BKGA 4KSLC 3PREA 1WSPA 3BYTB 1L7YA 1MHHE 4PS3A 4ZRPA 3KUDB 1KF6B 4RGTA 1TZOA 1WRDB 4BZAA 1Q0WB 2WYQA 3DVGY 5HG2A 1CMXB 1HXYD 2RDBC 2J0KA 4USAA 1DOIA 3V6EB 1WJUA 2KACA 1V49A 5D2MB 2KVZA 5CHVC 1DOYA 2N7DA 1XCTL 3Q14C 4M02A 4JGHB 2Z0DB 3T8MA 4ANXA 3BK1A 1ZP0B 3VRAB 1L4ZB 3OLMD 4XYCA 4C7YA 2MX2A 3AE3B 3CF6E 2XK5B 2AX5A 4G50A 1SE3A 1JROA 2WXRA 1AARA 3L54A 2G3QB 1WJNA 3AULA 1WGRA 2W54A 2INCC 3Q8BA 3DVNU 2RDHA 3HUIA 3L17A 3AE2B 1TS4A 4GB9A 3UIPB 2CU1A 1FM0D 2DZKA 4MM3A 1HZ5A 1K8RB 2BQQA 2L83A 1WMHA 3ECIA 1MHXA 5D94A 4E3CA 2N7JA 2ZW0A 2WP9B 5HKHA 4OVUA 2JWUA 3DBRI 1WXQA 3Q8EA 2WQYB 1SF0A 4BAXA 4N9F4 1KRHA 1LGRA 1PGAA 2XK5A 5C23A 1FPYA 1TIFA 2JXXA 1WI0A 2GBNA 3FKYA 2IO0B 3KVFB 2RR9A 5J17A 5JH5C 2MW5A 3M63B 2Y5CA 4NAWB 1OTRB 2GBJA 1XLQA 3APFA 3DVNV 1RAXA 1HTOA 4EOYA 2IY0B 4GDLB 3GE8C 3RNBC 2KX3A 4F1SA 4MGIE 2WS3B 3AI5A 2G4DB 3Q6BA 2FIDA 4W9JA 5BO4B 2EKEC 3NS1A 1T0SC 4US9A 1XO3A 4ZRKA 1JWAD 2KX0A 3P4PB 3HHMA 4RGOS 2WXQA 2I38A 1XEEA 2A5UA 3IAS1 4XDDA 4YTMB 1SE9A 2BT6A 1SJED 1V80A 4Q2JA 1LXDA 3PHXB 3P4RB 5BMIA 3ML9A 2VRRB 1R4NI 2HJ1A 2MLBA 2PEAA 2W9NA 4NQLB 3ZGZA 2KNBA 3U8ZA 2IY1B 4W9HA 2IGDA 1E8XA 2V3SA 3W5UB 1V2YA 4ASWC 5JHAA 3ABVB 3M95A 4GDLA 1AYFA 2FE8A 2YVCA 1AN8A 1MI0A 1WJ6A 1XXGA 3ZXRA 3T3NA 4NJ7A 3DDCB 4HPPA 2YLMA 3MP9A 4A3OA 3NRZA 3BVZA 2WXMA 5IO9A 3ZQ4A 2OEDA 5IA7A 3RNEC 5I4DA 1QQRA 4NPNA 4ZRJA 4A9AA 1F2RC 4BKSA 2MBEA 1UUPA 1JWUD 2IZVB 3ZTCA 2AEHA 2AL6A 3QK0A 1XLOA 5KHQA 1WM2A 2KDMA 3B0AA 3N9YC 2L52A 1XD3B 3VH4B 2J7QB 1C4CA 1QOBA 2PVGC 1EF1A 4GGQA 2V3NA 3DQVA 1QZEA 2ACZB 3UI3A 1ACCA 3TSSA 1FNWA 2WLBA 2BYFA 3URYA 2WDTB 3GB1A 3VTVA 4TKNA 5FR6A 1YD8U 3L0WB 3C8YA 4TSSA 1CJEA 2JVCA 3Q8AA 2KD0A 4W9DA 3RD2A 1FRRA 1P98A 1P1AA 4FJYA 3AM9A 1BUIC 3EFCA 3BIID 2DAFA 2LGYA 2K1FA 4KKIA 1PYWD 3L13A 2G4SA 3TEYA 2BYEA 3ENEA 3K9PB 1N5XA 3P42A 4I6PA 4KSKC 1VZ7A 1VLBA 2KK8A 2KTFA 3VUXA 4LTUA 2MJ3A 2MHJA 1V8CA 3SU8X
chains in the Genus database with same CATH topology
3RT3B 1UZXB 2KTRA 3IFWB 2KMCA 1GNUA 1V86A 3ONSA 3TIXA 2K6QA 1WE6A 4TQ1A 4E71A 2LJ5A 1E7VA 2XBBC 3VAWA 2FCSA 2L76A 3UGBB 3DBLI 4LJOB 2MWSB 2XEWA 4WWOA 3EC8A 2MBBB 2N4FA 3IBEA 2LZ6A 1E8ZA 1WIAA 2G45B 2B3AA 4NJ6A 4DXAB 2O2VB 2DZMA 4W9LA 5AZGA 3VH3B 1C3TA 3H7PA 1IPGA 2FCQA 3WAOA 1WXSA 3NZSA 2K8BA 3R3MA 3ZKJC 1TZ1A 2KWUB 3A9KB 2KQSA 3DPDA 1V81A 3A1QA 4P7IA 4W9FA 4KDIC 3PS6A 4IM2A 5E6NA 1A5RA 2NCNA 1OGWA 1R4MI 3MJWA 1UH6A 3PTFC 2L8JA 2DZJA 4HCPB 3CMMB 2J0JA 3VTWA 1UGMA 1GUAB 1ZW7A 4BFRA 2KJHB 3V6CB 4PS8A 2K6DB 2DYOA 1V9JA 1T0YA 3VTUA 5CHWA 2CKHB 1H8CA 1L2NA 5D7GA 2LASA 2ZJDA 1UELA 1C1YB 2MBQA 4KVGB 1EO6A 5D6JB 4HDOA 4DHZE 2O6VB 3B1LX 1SIFA 3GOEA 4JQWC 4G3XB 3ZNID 2FAZA 2I1JA 5DPSA 4WWNA 4ICUA 2N9PC 2DYBA 4FLHA 2IO1B 3QX1A 4BOSC 3LDZE 4GSWA 4I6LB 4EEWA 2AYOB 4KZCA 4KZ0A 3MTNB 3X0WA 2UWQA 2RPQA 3L16A 2I1KA 1GG3A 1WXAA 1JRUA 1S1QB 4J6IA 2IO2B 3RZWC 4DBGA 2N1VA 4BBNC 3V61A 2CR5A 2ZVNA 2KTRB 3KUZA 1I35A 3ZW3A 4X57B 1EUVB 2MCNB 1WX8A 4TQ0A 1WX7A 3T9LA 3W1YA 4AJWA 3HM6X 2LRWA 3VXWA 3WANA 1YJ1A 2MSED 3W1SA 1Y8RC 2DENB 4HXDA 1VCBA 1M94A 2V1YA 2K8HA 2LVOA 3NOBA 1OEYA 2LD9A 3PLVA 4W9EA 5KHOA 1J8CA 4GMVA 2BWFA 2ZPNA 2M4NA 3V62A 3RUIB 2NVUI 1WE7A 1UD7A 3IHPC 4B6WA 2JRIB 4EZJA 1WM3A 1WJ4A 2O6VD 2RGFA 1WYWB 3P2BA 2M8SA 3QQ8B 4BKTA 4IWOA 1J0GA 5GMVA 3GZNI 3A9JB 1VD2A 2O6VA 1Z2MA 2L7RA 2LI5A 2REXA 3EFUA 4FA6A 4DDGD 3JYUA 4AP4C 1WY8A 4II3B 2N1WA 2CS4A 4E74A 2KHWB 2RSUA 2KKCA 1YIWA 4DHJD 3PPAA 4W9GA 3ZRFA 1BT0A 2BYVE 2K8CA 2L0TA 2L0FA 1ISNA 3QCAA 1WGYA 2LVPA 4DK5A 2KC1A 4KDLB 5E6OA 2AWTA 4K7UA 3BINA 4MDKE 2KZRA 1OQYA 2HD5B 2LXCA 3EECA 4MSMB 4MGKE 3I3TB 3WAPA 1J19A 3H6NA 3Q3JA 4WJOA 1E7UA 4FHKA 5LLIA 3OJ3A 4GXBA 1IYFA 3CSFA 4BKGA 1WX9A 3N3KB 4KSLC 4TV3A 4WAAA 3WAMA 2EMSA 3PREA 4BVUC 4EZLA 2MBHA 1L7YA 2ZNVB 4IM0A 4PS3A 3KUDB 4IM3A 3H9DA 1YQBA 3ZLZA 4PYZA 1WRDB 4GU2A 1WXVA 1NDDA 3ZNHB 3UINB 4IUMB 4EFOA 3QIJA 2C7NB 2OOBB 3ZVVA 1Q0WB 1S3SG 4K81A 2WYQA 4ANVA 3DVGY 2DZIA 4IC7B 4FBJB 4AWJA 1CMXB 1GC6A 2D3GA 4FN2A 2ASQA 2N9EB 2J0KA 4MGZE 2KANA 2CHZA 1E8YA 2EMTA 3VUWA 3DOWA 4PS7A 1WJUA 3RCZA 3V6EB 3PHWB 3RZFA 4AOFA 2BWES 1RFAA 2MA9B 1KM7A 3ZUNA 2JWZA 1V6EA 1V49A 3A9JA 4HK2A 4HDQA 2C5LC 2L05A 3B08A 4IWPA 5D2MB 2CHWA 4ZDVA 3DVGX 5CHVC 4F7ZA 3JSVB 1WGDA 2N7EA 2N7DA 2WX0A 4B9KA 1WH3A 4GOCA 4JGHB 2HJ8A 3D32A 2Z0DB 4NAWA 3T8MA 4ANXA 2DX5B 2KDEB 3KYCD 1P9DU 3OLMD 2KDFB 2MX2A 3ZNZB 1GC7A 1Z5SB 3CF6E 2C7HA 2XK5B 3A33B 2KMAA 2L3ZA 3AU5A 4FADA 2FCMA 4G50A 4NNJB 3HIZA 2BKRB 3SHQA 1YX6B 2UYZB 1AARA 1LFDA 4B95A 3EHVA 2G3QB 3L54A 4G0NB 1WJNA 3M3JA 3AULA 1WGRA 2DHZA 4KIKB 4RM9A 3QWZB 4AJYB 5IAAC 2NPTB 4DHJB 4RM8A 4MEMA 2LVQA 3DVNU 2KXJA 3N30A 5AEKB 1G6JA 3L17A 2MQJA 2IO3B 4MSQB 2NBVB 4GB9A 3UIPB 4CHKA 2CU1A 4BKSD 2CHXA 2JUOA 2RD0A 2DZKA 2Z0EB 2ZEQA 3C0RB 3PGEA 4GDKB 4LJPB 4MM3A 2KLGA 1F9JA 4IWQA 3JVZX 4MJSB 1K8RB 1TTNA 2MBOA 2KVRA 1HE8A 3PRMB 4BBNF 1ZKHA 1WMHA 2QHOA 2LXAA 4BOZB 3ECIA 5AZFA 3TJPA 4JLCA 5D94A 2DYMA 2KO3A 4E3CA 1YX5B 3ALBA 2KQ7A 3IG3A 3AXCA 1UBQA 4HVBA 5HKHA 2PPHA 3TCAA 3JSVA 4OVUA 4TUUA 4FJVB 3DBRI 2D2QA 2WWZA 3WIMA 4WQOB 2J0MA 4N9F4 5L83A 1Q1OA 3QAQA 4ICVA 1UBIA 2D07B 3ZDTA 4W9CA 2C7MB 2XK5A 5C23A 4K7SA 2FCNA 2JXXA 1WI0A 2GBNA 4GIVA 3DCGA 3H1UA 3ML8A 2IO0B 2NBWB 2R2QA 3APCA 3KVFB 4KV2A 5AZHA 2RR9A 4W9KA 5J17A 3ZNGC 2PE9A 3TBLD 5JH5C 2MW5A 2OJRA 2Z59B 3TL5A 3M63B 4NAWB 2GMIC 1OTRB 1XT9B 2GBJA 2LGXA 3APFA 5J18A 5L95C 4KIKA 3DVNV 1RAXA 3KUCB 2L00B 2NPTA 3QC8B 4EOYA 3UQBA 3W1SC 4CO7A 2Y5BB 4FULA 2K25A 2IY0B 4GDLB 2NR2A 4NQKE 2JT4B 3ZO5B 5JZEB 2KX3A 1TGZB 2IYDB 2M0XA 3KYDD 4F1SA 5CX3A 1GJZA 3HK0A 4M8MA 3PSEB 4MGIE 4GDKA 3VQIA 1RRBA 2KC2A 3AI5A 2G4DB 2FIDA 4W9JA 5BO4B 1WZ3A 4JL9A 4MJSA 5C1ZA 3KW5B 2BKFA 2EKEC 1WGGA 4ZRKA 3O65B 5CTRC 1RLFA 2WX1A 2MP2B 4HLEA 3UIOB 3NHEB 2N9XA 3R7RA 2KX0A 3NZUA 3RYTA 3SDLC 4DHZB 2M17A 3HHMA 5G55A 3IVFA 3VUYA 2A5UA 1E8WA 2AL3A 1SE9A 3UF8A 3KH0A 2KFJA 1V80A 5JHBA 5DCNA 3OAWA 2JRHA 3DBSA 1LXDA 1WMHB 3PHXB 3NS8A 3PV1A 1WFYA 3ML9A 3U7DA 3VVWB 4AUQC 2VRRB 3UQAA 1R4NI 2GBRA 2KN5A 2FNJB 2MLBA 4F8CB 2PEAA 4FHJA 1P0RA 2W9NA 4NQLB 2KNBA 1U4AA 4XC2A 3U8ZA 2KJRA 2PJHA 3PRZA 3R66C 2C9WB 3M62B 2IY1B 4W9HA 1V5OA 1E8XA 3PT2B 1I42A 4II2B 2V3SA 1P3QU 5CHFA 3LJ3A 2HE7A 4HPMB 3ZDMC 1V2YA 4HJKA 4ASWC 4HCNB 5JHAA 1WZ0A 2D10A 3M95A 1D3ZA 2ZZPB 3ZIMA 1E5WA 4GDLA 2DAJA 2YVCA 1WJ6A 5EDSA 2ZVOA 4NJ7A 3AU4A 4K7WA 3S2AA 2KWCA 3A4RA 4YL8A 2KFKB 1LM8B 3DDCB 4FJZA 2K39A 3VFKA 5LXHA 3PVLA 1KOTA 5DPWA 2YLMA 3ZTDA 4A3OA 2GOWA 4JIOU 3K9OB 4WJQA 4EKUA 2JPHA 4K1RB 4A3PA 5J2RA 4ANWA 2MP2A 2JY6A 2BPSA 2BGFA 2LRUA 5IA7A 2PE6B 1XQQA 1X1MA 3JW0X 2ZCCA 4MGYE 4LCDE 3SD5A 2ZCBA 4NPNA 4WWPA 1KJTA 3CSTA 4IW0A 2A4ZA 4ZRJA 3RULA 4BKSA 2MBEA 3HM3A 3ZRCA 2GBMA 2IZVB 2KOXA 2HTHA 4MH0E 4A20A 3ZTCA 1LQBA 2AEHA 1OEYJ 2AL6A 2JZ3B 2NBUA 3QK0A 4G11A 3X23A 4ZRIA 3R7QA 4LDTB 4CYEA 4URKA 1MG8A 5KHQA 1WM2A 3B0AA 4DWFA 5DPRA 2KLCA 1XD3B 2O2VA 2LWPA 3VH4B 2J7QB 2IBIB 3TMPB 5LXIB 5G2NA 5DPTA 1EF1A 4GGQA 2ZNVC 2KDIA 2R2OA 4XX5A 3A9KA 3DQVA 2KDBA 1QZEA 3L08A 2JZZA 4ZYNA 4WJPA 1Q5WB 3DBHI 3PZDA 3VHTC 2NS5A 4PYUA 2LUEA 2BYFA 3PLUA 2WDTB 3VDZA 2BF8B 1SGHA 4TKNA 4HWIB 5FR6A 3VTVA 1E90A 1WXMA 3NY5A 2JF5A 5TR5A 1YD8U 2KFKA 1NBFC 4I6NB 3OJ4B 3H7PB 3L0WB 3QARA 4M0WB 4ANUA 3H7SA 2LGDA 2JVCA 3V60A 2KD0A 2MRPA 4W9DA 2V4LA 3RD2A 3A1QB 1P98A 3QA8A 1WR6E 1P1AA 3WA0A 4GN1A 1NI2A 4FJYA 1ZGUB 3Q3FA 4EUTA 1PQSA 3A4SC 3APDA 2D11A 2DAFA 1V5TA 2K1FA 2C60A 2LGYA 1EF5A 4IG7B 4OVVA 4WJNA 1WGHA 4M8NA 1WR1A 3L13A 2FUHB 4W9IA 4RMAA 4NY0A 2GBKA 2G4SA 1TBEA 2BYEA 3MHSD 3ENEA 3K9PB 4I6PA 4LDTD 4KSKC 4DDID 2KWVB 3QJZA 2ZPYA 4MELA 3PRPB 1FXTB 5E6PA 1WF9A 4HPLB 2KJ6A 4XZ4A 1KLVA 2KK8A 3U30A 3QHTA 2KTFA 3VUXA 3WALA 3BY4B 2FIFA 3N32A 1IP9A 2M1MA 1H4RA 3L10B 3SU8X 4EZKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3RT3 B;  1UZX B;  2KTR A;  3IFW B;  2KMC A;  1GNU A;  1V86 A;  3ONS A;  3TIX A;  2K6Q A;  1WE6 A;  4TQ1 A;  4E71 A;  2LJ5 A;  1E7V A;  2XBB C;  3VAW A;  2FCS A;  2L76 A;  3UGB B;  3DBL I;  4LJO B;  2MWS B;  2XEW A;  4WWO A;  3EC8 A;  2MBB B;  2N4F A;  3IBE A;  2LZ6 A;  1E8Z A;  1WIA A;  2G45 B;  2B3A A;  4NJ6 A;  4DXA B;  2O2V B;  2DZM A;  4W9L A;  5AZG A;  3VH3 B;  1C3T A;  3H7P A;  1IPG A;  2FCQ A;  3WAO A;  1WXS A;  3NZS A;  2K8B A;  3R3M A;  3ZKJ C;  1TZ1 A;  2KWU B;  3A9K B;  2KQS A;  3DPD A;  1V81 A;  3A1Q A;  4P7I A;  4W9F A;  4KDI C;  3PS6 A;  4IM2 A;  5E6N A;  1A5R A;  2NCN A;  1OGW A;  1R4M I;  3MJW A;  1UH6 A;  3PTF C;  2L8J A;  2DZJ A;  4HCP B;  3CMM B;  2J0J A;  3VTW A;  1UGM A;  1GUA B;  1ZW7 A;  4BFR A;  2KJH B;  3V6C B;  4PS8 A;  2K6D B;  2DYO A;  1V9J A;  1T0Y A;  3VTU A;  5CHW A;  2CKH B;  1H8C A;  1L2N A;  5D7G A;  2LAS A;  2ZJD A;  1UEL A;  1C1Y B;  2MBQ A;  4KVG B;  1EO6 A;  5D6J B;  4HDO A;  4DHZ E;  2O6V B;  3B1L X;  1SIF A;  3GOE A;  4JQW C;  4G3X B;  3ZNI D;  2FAZ A;  2I1J A;  5DPS A;  4WWN A;  4ICU A;  2N9P C;  2DYB A;  4FLH A;  2IO1 B;  3QX1 A;  4BOS C;  3LDZ E;  4GSW A;  4I6L B;  4EEW A;  2AYO B;  4KZC A;  4KZ0 A;  3MTN B;  3X0W A;  2UWQ A;  2RPQ A;  3L16 A;  2I1K A;  1GG3 A;  1WXA A;  1JRU A;  1S1Q B;  4J6I A;  2IO2 B;  3RZW C;  4DBG A;  2N1V A;  4BBN C;  3V61 A;  2CR5 A;  2ZVN A;  2KTR B;  3KUZ A;  1I35 A;  3ZW3 A;  4X57 B;  1EUV B;  2MCN B;  1WX8 A;  4TQ0 A;  1WX7 A;  3T9L A;  3W1Y A;  4AJW A;  3HM6 X;  2LRW A;  3VXW A;  3WAN A;  1YJ1 A;  2MSE D;  3W1S A;  1Y8R C;  2DEN B;  4HXD A;  1VCB A;  1M94 A;  2V1Y A;  2K8H A;  2LVO A;  3NOB A;  1OEY A;  2LD9 A;  3PLV A;  4W9E A;  5KHO A;  1J8C A;  4GMV A;  2BWF A;  2ZPN A;  2M4N A;  3V62 A;  3RUI B;  2NVU I;  1WE7 A;  1UD7 A;  3IHP C;  4B6W A;  2JRI B;  4EZJ A;  1WM3 A;  1WJ4 A;  2O6V D;  2RGF A;  1WYW B;  3P2B A;  2M8S A;  3QQ8 B;  4BKT A;  4IWO A;  1J0G A;  5GMV A;  3GZN I;  3A9J B;  1VD2 A;  2O6V A;  1Z2M A;  2L7R A;  2LI5 A;  2REX A;  3EFU A;  4FA6 A;  4DDG D;  3JYU A;  4AP4 C;  1WY8 A;  4II3 B;  2N1W A;  2CS4 A;  4E74 A;  2KHW B;  2RSU A;  2KKC A;  1YIW A;  4DHJ D;  3PPA A;  4W9G A;  3ZRF A;  1BT0 A;  2BYV E;  2K8C A;  2L0T A;  2L0F A;  1ISN A;  3QCA A;  1WGY A;  2LVP A;  4DK5 A;  2KC1 A;  4KDL B;  5E6O A;  2AWT A;  4K7U A;  3BIN A;  4MDK E;  2KZR A;  1OQY A;  2HD5 B;  2LXC A;  3EEC A;  4MSM B;  4MGK E;  3I3T B;  3WAP A;  1J19 A;  3H6N A;  3Q3J A;  4WJO A;  1E7U A;  4FHK A;  5LLI A;  3OJ3 A;  4GXB A;  1IYF A;  3CSF A;  4BKG A;  1WX9 A;  3N3K B;  4KSL C;  4TV3 A;  4WAA A;  3WAM A;  2EMS A;  3PRE A;  4BVU C;  4EZL A;  2MBH A;  1L7Y A;  2ZNV B;  4IM0 A;  4PS3 A;  3KUD B;  4IM3 A;  3H9D A;  1YQB A;  3ZLZ A;  4PYZ A;  1WRD B;  4GU2 A;  1WXV A;  1NDD A;  3ZNH B;  3UIN B;  4IUM B;  4EFO A;  3QIJ A;  2C7N B;  2OOB B;  3ZVV A;  1Q0W B;  1S3S G;  4K81 A;  2WYQ A;  4ANV A;  3DVG Y;  2DZI A;  4IC7 B;  4FBJ B;  4AWJ A;  1CMX B;  1GC6 A;  2D3G A;  4FN2 A;  2ASQ A;  2N9E B;  2J0K A;  4MGZ E;  2KAN A;  2CHZ A;  1E8Y A;  2EMT A;  3VUW A;  3DOW A;  4PS7 A;  1WJU A;  3RCZ A;  3V6E B;  3PHW B;  3RZF A;  4AOF A;  2BWE S;  1RFA A;  2MA9 B;  1KM7 A;  3ZUN A;  2JWZ A;  1V6E A;  1V49 A;  3A9J A;  4HK2 A;  4HDQ A;  2C5L C;  2L05 A;  3B08 A;  4IWP A;  5D2M B;  2CHW A;  4ZDV A;  3DVG X;  5CHV C;  4F7Z A;  3JSV B;  1WGD A;  2N7E A;  2N7D A;  2WX0 A;  4B9K A;  1WH3 A;  4GOC A;  4JGH B;  2HJ8 A;  3D32 A;  2Z0D B;  4NAW A;  3T8M A;  4ANX A;  2DX5 B;  2KDE B;  3KYC D;  1P9D U;  3OLM D;  2KDF B;  2MX2 A;  3ZNZ B;  1GC7 A;  1Z5S B;  3CF6 E;  2C7H A;  2XK5 B;  3A33 B;  2KMA A;  2L3Z A;  3AU5 A;  4FAD A;  2FCM A;  4G50 A;  4NNJ B;  3HIZ A;  2BKR B;  3SHQ A;  1YX6 B;  2UYZ B;  1AAR A;  1LFD A;  4B95 A;  3EHV A;  2G3Q B;  3L54 A;  4G0N B;  1WJN A;  3M3J A;  3AUL A;  1WGR A;  2DHZ A;  4KIK B;  4RM9 A;  3QWZ B;  4AJY B;  5IAA C;  2NPT B;  4DHJ B;  4RM8 A;  4MEM A;  2LVQ A;  3DVN U;  2KXJ A;  3N30 A;  5AEK B;  1G6J A;  3L17 A;  2MQJ A;  2IO3 B;  4MSQ B;  2NBV B;  4GB9 A;  3UIP B;  4CHK A;  2CU1 A;  4BKS D;  2CHX A;  2JUO A;  2RD0 A;  2DZK A;  2Z0E B;  2ZEQ A;  3C0R B;  3PGE A;  4GDK B;  4LJP B;  4MM3 A;  2KLG A;  1F9J A;  4IWQ A;  3JVZ X;  4MJS B;  1K8R B;  1TTN A;  2MBO A;  2KVR A;  1HE8 A;  3PRM B;  4BBN F;  1ZKH A;  1WMH A;  2QHO A;  2LXA A;  4BOZ B;  3ECI A;  5AZF A;  3TJP A;  4JLC A;  5D94 A;  2DYM A;  2KO3 A;  4E3C A;  1YX5 B;  3ALB A;  2KQ7 A;  3IG3 A;  3AXC A;  1UBQ A;  4HVB A;  5HKH A;  2PPH A;  3TCA A;  3JSV A;  4OVU A;  4TUU A;  4FJV B;  3DBR I;  2D2Q A;  2WWZ A;  3WIM A;  4WQO B;  2J0M A;  4N9F 4;  5L83 A;  1Q1O A;  3QAQ A;  4ICV A;  1UBI A;  2D07 B;  3ZDT A;  4W9C A;  2C7M B;  2XK5 A;  5C23 A;  4K7S A;  2FCN A;  2JXX A;  1WI0 A;  2GBN A;  4GIV A;  3DCG A;  3H1U A;  3ML8 A;  2IO0 B;  2NBW B;  2R2Q A;  3APC A;  3KVF B;  4KV2 A;  5AZH A;  2RR9 A;  4W9K A;  5J17 A;  3ZNG C;  2PE9 A;  3TBL D;  5JH5 C;  2MW5 A;  2OJR A;  2Z59 B;  3TL5 A;  3M63 B;  4NAW B;  2GMI C;  1OTR B;  1XT9 B;  2GBJ A;  2LGX A;  3APF A;  5J18 A;  5L95 C;  4KIK A;  3DVN V;  1RAX A;  3KUC B;  2L00 B;  2NPT A;  3QC8 B;  4EOY A;  3UQB A;  3W1S C;  4CO7 A;  2Y5B B;  4FUL A;  2K25 A;  2IY0 B;  4GDL B;  2NR2 A;  4NQK E;  2JT4 B;  3ZO5 B;  5JZE B;  2KX3 A;  1TGZ B;  2IYD B;  2M0X A;  3KYD D;  4F1S A;  5CX3 A;  1GJZ A;  3HK0 A;  4M8M A;  3PSE B;  4MGI E;  4GDK A;  3VQI A;  1RRB A;  2KC2 A;  3AI5 A;  2G4D B;  2FID A;  4W9J A;  5BO4 B;  1WZ3 A;  4JL9 A;  4MJS A;  5C1Z A;  3KW5 B;  2BKF A;  2EKE C;  1WGG A;  4ZRK A;  3O65 B;  5CTR C;  1RLF A;  2WX1 A;  2MP2 B;  4HLE A;  3UIO B;  3NHE B;  2N9X A;  3R7R A;  2KX0 A;  3NZU A;  3RYT A;  3SDL C;  4DHZ B;  2M17 A;  3HHM A;  5G55 A;  3IVF A;  3VUY A;  2A5U A;  1E8W A;  2AL3 A;  1SE9 A;  3UF8 A;  3KH0 A;  2KFJ A;  1V80 A;  5JHB A;  5DCN A;  3OAW A;  2JRH A;  3DBS A;  1LXD A;  1WMH B;  3PHX B;  3NS8 A;  3PV1 A;  1WFY A;  3ML9 A;  3U7D A;  3VVW B;  4AUQ C;  2VRR B;  3UQA A;  1R4N I;  2GBR A;  2KN5 A;  2FNJ B;  2MLB A;  4F8C B;  2PEA A;  4FHJ A;  1P0R A;  2W9N A;  4NQL B;  2KNB A;  1U4A A;  4XC2 A;  3U8Z A;  2KJR A;  2PJH A;  3PRZ A;  3R66 C;  2C9W B;  3M62 B;  2IY1 B;  4W9H A;  1V5O A;  1E8X A;  3PT2 B;  1I42 A;  4II2 B;  2V3S A;  1P3Q U;  5CHF A;  3LJ3 A;  2HE7 A;  4HPM B;  3ZDM C;  1V2Y A;  4HJK A;  4ASW C;  4HCN B;  5JHA A;  1WZ0 A;  2D10 A;  3M95 A;  1D3Z A;  2ZZP B;  3ZIM A;  1E5W A;  4GDL A;  2DAJ A;  2YVC A;  1WJ6 A;  5EDS A;  2ZVO A;  4NJ7 A;  3AU4 A;  4K7W A;  3S2A A;  2KWC A;  3A4R A;  4YL8 A;  2KFK B;  1LM8 B;  3DDC B;  4FJZ A;  2K39 A;  3VFK A;  5LXH A;  3PVL A;  1KOT A;  5DPW A;  2YLM A;  3ZTD A;  4A3O A;  2GOW A;  4JIO U;  3K9O B;  4WJQ A;  4EKU A;  2JPH A;  4K1R B;  4A3P A;  5J2R A;  4ANW A;  2MP2 A;  2JY6 A;  2BPS A;  2BGF A;  2LRU A;  5IA7 A;  2PE6 B;  1XQQ A;  1X1M A;  3JW0 X;  2ZCC A;  4MGY E;  4LCD E;  3SD5 A;  2ZCB A;  4NPN A;  4WWP A;  1KJT A;  3CST A;  4IW0 A;  2A4Z A;  4ZRJ A;  3RUL A;  4BKS A;  2MBE A;  3HM3 A;  3ZRC A;  2GBM A;  2IZV B;  2KOX A;  2HTH A;  4MH0 E;  4A20 A;  3ZTC A;  1LQB A;  2AEH A;  1OEY J;  2AL6 A;  2JZ3 B;  2NBU A;  3QK0 A;  4G11 A;  3X23 A;  4ZRI A;  3R7Q A;  4LDT B;  4CYE A;  4URK A;  1MG8 A;  5KHQ A;  1WM2 A;  3B0A A;  4DWF A;  5DPR A;  2KLC A;  1XD3 B;  2O2V A;  2LWP A;  3VH4 B;  2J7Q B;  2IBI B;  3TMP B;  5LXI B;  5G2N A;  5DPT A;  1EF1 A;  4GGQ A;  2ZNV C;  2KDI A;  2R2O A;  4XX5 A;  3A9K A;  3DQV A;  2KDB A;  1QZE A;  3L08 A;  2JZZ A;  4ZYN A;  4WJP A;  1Q5W B;  3DBH I;  3PZD A;  3VHT C;  2NS5 A;  4PYU A;  2LUE A;  2BYF A;  3PLU A;  2WDT B;  3VDZ A;  2BF8 B;  1SGH A;  4TKN A;  4HWI B;  5FR6 A;  3VTV A;  1E90 A;  1WXM A;  3NY5 A;  2JF5 A;  5TR5 A;  1YD8 U;  2KFK A;  1NBF C;  4I6N B;  3OJ4 B;  3H7P B;  3L0W B;  3QAR A;  4M0W B;  4ANU A;  3H7S A;  2LGD A;  2JVC A;  3V60 A;  2KD0 A;  2MRP A;  4W9D A;  2V4L A;  3RD2 A;  3A1Q B;  1P98 A;  3QA8 A;  1WR6 E;  1P1A A;  3WA0 A;  4GN1 A;  1NI2 A;  4FJY A;  1ZGU B;  3Q3F A;  4EUT A;  1PQS A;  3A4S C;  3APD A;  2D11 A;  2DAF A;  1V5T A;  2K1F A;  2C60 A;  2LGY A;  1EF5 A;  4IG7 B;  4OVV A;  4WJN A;  1WGH A;  4M8N A;  1WR1 A;  3L13 A;  2FUH B;  4W9I A;  4RMA A;  4NY0 A;  2GBK A;  2G4S A;  1TBE A;  2BYE A;  3MHS D;  3ENE A;  3K9P B;  4I6P A;  4LDT D;  4KSK C;  4DDI D;  2KWV B;  3QJZ A;  2ZPY A;  4MEL A;  3PRP B;  1FXT B;  5E6P A;  1WF9 A;  4HPL B;  2KJ6 A;  4XZ4 A;  1KLV A;  2KK8 A;  3U30 A;  3QHT A;  2KTF A;  3VUX A;  3WAL A;  3BY4 B;  2FIF A;  3N32 A;  1IP9 A;  2M1M A;  1H4R A;  3L10 B;  3SU8 X;  4EZK A; 
#chains in the Genus database with same CATH topology
 2KTR A;  1GNU A;  3MC8 A;  3TIX A;  1WE6 A;  1V1P B;  3OG5 A;  1E7V A;  3UGB B;  4LJO B;  3W5V B;  2MBB B;  1E8Z A;  1JCK B;  2O2V B;  2NMQ A;  4W9L A;  5AZG A;  1I7H A;  1MG4 A;  3VH3 B;  3B2G A;  5TSS A;  1IPG A;  2FCQ A;  2WXI A;  4WAF A;  2KWU B;  2KQS A;  2WXN A;  3DPD A;  4KDI C;  4H2A A;  2KN4 A;  2WXO A;  4XE0 A;  2L8J A;  2J0J A;  3RI7 C;  4N58 A;  3AE8 B;  3V6C B;  2DYO A;  5CHW A;  2LAS A;  4IOI E;  3BYY B;  2AQ3 B;  4KVG B;  3AED B;  4DHZ E;  3GOE A;  2ON8 A;  4NJC A;  3Q2A C;  4K3C A;  2IO1 B;  4EEW A;  1SB3 C;  2PVO D;  1V1P A;  1F52 A;  3DWG C;  2BB5 A;  3L16 A;  1GG3 A;  1YQ4 B;  1IGD A;  3AE5 B;  3RZW C;  3NVY A;  2N1V A;  2CR5 A;  1L0Y B;  3KUZ A;  1EU4 A;  1WX8 A;  3W1Y A;  3HM6 X;  2MSE D;  1YMH E;  4WQM A;  2V1Y A;  2K8H A;  2LVO A;  3PLV A;  4W9E A;  4GMV A;  4B0M A;  3IHP C;  4B6W A;  1J7A A;  1XCQ L;  1YN3 A;  3QQ8 B;  1WYW B;  1J0G A;  3GP7 A;  3GZN I;  2KMM A;  3A9J B;  1QT9 A;  4MH8 A;  2HTM E;  5C3J B;  3JYU A;  4II3 B;  1YN5 A;  3AB5 A;  2KHW B;  1L6U A;  2RSU A;  1VZ6 A;  2KKC A;  3NVW A;  4W9G A;  4HRO A;  2WXJ A;  3TEZ A;  1T3Q A;  2K8C A;  2L0T A;  1WGY A;  2LVP A;  4DK5 A;  2LGI A;  4KDL B;  4XZ4 A;  2W3S A;  3NZ3 A;  2KZR A;  4MSM B;  3EEC A;  4MGK E;  2K9X A;  3N1Y C;  4FHK A;  3OJ3 A;  4GXB A;  3CSF A;  1WX9 A;  3WAM A;  4WAA A;  3H9D A;  4JE3 B;  1DYQ A;  1F77 A;  4IUM B;  4EFO A;  4S17 A;  4NAM A;  3N20 C;  4AWJ A;  1GC6 A;  2D3G A;  4FN2 A;  2N9E B;  2CHZ A;  2EMT A;  1PDX A;  2BWE S;  3DBR B;  3N1X C;  1KM7 A;  5BMH A;  1VJK A;  3A9J A;  2IPK D;  4IWP A;  2L05 A;  4HDQ A;  3DHH C;  4F7Z A;  2N7E A;  4B9K A;  4N6E B;  1WH3 A;  3D32 A;  2KDE B;  2KDF B;  1GC7 A;  1MFW A;  1F2R I;  2C7H A;  3A33 B;  3AU5 A;  1STE A;  4FAD A;  4OVZ A;  4NNJ B;  2W55 A;  1YX6 B;  4S0R A;  1LFD A;  3EHV A;  1ENF A;  4MEM A;  1ZPS A;  1FD6 A;  1QIL A;  4OHJ A;  1D5Z C;  1G6J A;  2IDY A;  2CHX A;  3SR6 A;  3GS2 A;  5BYS A;  2KLG A;  4IWQ A;  2MBO A;  3P1M A;  2KVR A;  3PRM B;  1ZKH A;  2QHO A;  4N59 A;  2LXA A;  1HEZ E;  2LUM A;  3TJP A;  2KO3 A;  1YX5 B;  2KQ7 A;  1I4G A;  2BBC A;  3AXC A;  1R4N B;  3HRD D;  4TUU A;  2D2Q A;  4WQO B;  2J0M A;  1E6E B;  1LO5 D;  4HRS A;  4XGA B;  4C56 C;  4HEA 1;  1UBI A;  2JSV X;  2D07 B;  2C7M B;  4OZB A;  1FO4 A;  3H1U A;  5AZH A;  3APC A;  3IAM 1;  4KV2 A;  1JQ4 A;  4W9K A;  2PE9 A;  4REZ A;  2OJR A;  2Z59 B;  1UWM A;  5EE1 A;  2L32 A;  1Q10 A;  2INP E;  1TKY A;  1D5X C;  4UDU C;  3NG0 A;  3W1S C;  2Y5B B;  4NQK E;  2K25 A;  3ZO5 B;  2JT4 B;  3NJT A;  3RPF C;  1RFK A;  2M0X A;  5CX3 A;  3VQI A;  2KC2 A;  5C1Z A;  1WGG A;  2BW2 A;  2SAK A;  2WX1 A;  2MP2 B;  4L2Y A;  3R7R A;  2QMT A;  4PK1 A;  3AEF B;  4MM3 B;  3VUY A;  1E8W A;  1C76 A;  5JHB A;  3CWI A;  3OAW A;  4MT5 A;  3DBS A;  1FFV A;  1WMH B;  3NS8 A;  2M56 B;  1WFY A;  3ZXV A;  1KH0 A;  1QOA A;  3VVW B;  4AUQ C;  3V3X A;  2FNJ B;  3NVV A;  2PJH A;  2KQ4 X;  2C9W B;  2D3B A;  2QDF A;  1WRI A;  3LJ3 A;  4EE2 A;  4HPM B;  2D10 A;  4D2K A;  2ZW1 A;  3CIR B;  5EDS A;  3AU4 A;  1C77 A;  4FJZ A;  3VFK A;  1ROE A;  3PVL A;  2JYE A;  5DPW A;  4DXF A;  3ZTD A;  3SFE B;  3K9O B;  4EKU A;  3MC0 B;  2JPH A;  4K1R B;  4K3B A;  5J2R A;  1T6B X;  4ANW A;  2MP2 A;  2JY6 A;  3KLS X;  2BPS A;  4A6Q A;  3P4S B;  2QIE B;  1X1M A;  3JW0 X;  2ZCC A;  3I5J C;  2I2Y A;  3ZRC A;  3BK2 A;  4RGN A;  5BMG A;  2HTH A;  4A20 A;  1LQB A;  1B1Z A;  3X23 A;  4CYE A;  2CU3 A;  1MG8 A;  3KWV A;  1HA5 A;  2E6X A;  2KLC A;  5E6J A;  5D3D A;  2IBI B;  5DPT A;  3Q69 A;  2ZNV C;  1L5P A;  1VZ8 A;  5GXG B;  4XX5 A;  3V05 A;  3A9K A;  2KDB A;  3L08 A;  2JZZ A;  2XNA C;  3DBH I;  4PYU A;  2LUE A;  3TUO A;  1KFY B;  1SGH A;  4HWI B;  1AW7 A;  1E90 A;  4I6N B;  1NBF C;  3QAR A;  3MHZ A;  4ANU A;  3SEB A;  5G5G A;  4GN1 A;  1NI2 A;  1ZGU B;  3A4S C;  1V5T A;  1HTQ A;  2C60 A;  4OVV A;  1EF5 A;  2PW9 A;  4M8N A;  4WJN A;  4KGS A;  4JPS A;  4W9I A;  1N60 A;  2GBK A;  1C4A A;  1JW9 D;  2QCZ A;  3R2T A;  3QJZ A;  2ZPY A;  2V0G A;  2JU6 X;  4HPL B;  2KJ6 A;  3U30 A;  3QHT A;  4AQ7 A;  2FIF A;  3RNC C;  2IGH A;  2M1M A;  4ZRQ A;  1IP9 A;  2KMC A;  3ONS A;  2K6Q A;  4E71 A;  1XF5 L;  2XEW A;  3EC8 A;  3R2I A;  2QJL A;  2LZ6 A;  2LMC A;  3IT4 B;  3U2S C;  1I4Q A;  3WAO A;  1NVI D;  1WXS A;  3ZKJ C;  1TZ1 A;  2N0S B;  3ZJT A;  1ET9 A;  1V81 A;  3EUB 2;  4P7I A;  4IM2 A;  1N63 A;  2NCN A;  3ETR A;  1PGB A;  2DNF A;  4XDC A;  2DWQ A;  2WXL A;  3AE4 B;  4RCO A;  1V9J A;  2CKH B;  1H8C A;  1SBB B;  1UEL A;  4HDO A;  3B1L X;  1SIF A;  3ZNI D;  2FAZ A;  1C78 A;  5DPS A;  4WWN A;  4ICU A;  2RMM A;  2N9P C;  4WWM A;  2DYB A;  3IT6 B;  1C79 A;  4GSW A;  4I6L B;  3AMZ A;  2AYO B;  4YTN B;  1OQR A;  2UWQ A;  2RPQ A;  1QLB B;  1WXA A;  2LJI A;  1S1Q B;  4J6I A;  4WIP A;  4WUR A;  3V61 A;  2JZP A;  3E9S A;  2KTR B;  1FEH A;  3EGR A;  2MCN B;  4TQ0 A;  1WX7 A;  3T9L A;  2LRW A;  3VXW A;  3WAN A;  3U52 E;  2DEN B;  1TS3 A;  1M94 A;  4YSZ B;  3NOB A;  3DHG C;  5KHO A;  2CJO A;  3V62 A;  3Q3N C;  1R7S A;  2MJE A;  4EZJ A;  3AEE B;  3AE6 B;  3OWE B;  2WU2 B;  5IOI A;  3TEX A;  2L7R A;  2VH2 A;  2LI5 A;  2REX A;  1KLG D;  4FA6 A;  2D3C A;  4AP4 C;  1WY8 A;  2MH7 A;  4E74 A;  4KX6 B;  1SIJ A;  4M00 A;  4FXC A;  1N62 A;  4DHJ D;  3PPA A;  1BT0 A;  2L0F A;  3C19 A;  5E6O A;  1FXI A;  3BIN A;  1OQY A;  2HD5 B;  2LXC A;  3N1Z C;  2JYT A;  1Y56 A;  3H6N A;  4MAC A;  5LLI A;  3N3K B;  4TV3 A;  4BVU C;  2MBH A;  1FNU A;  4IM0 A;  4IM3 A;  4YSY B;  2FUG 1;  1YQB A;  3T3O A;  4PYZ A;  1WXV A;  1NDD A;  3UIN B;  1NI3 A;  2OOB B;  4ANV A;  2K3U A;  3Q3O C;  4IC7 B;  4FBJ B;  2ASQ A;  4MGZ E;  1E8Y A;  3VUW A;  3DOW A;  4PS7 A;  3RCZ A;  1RFA A;  2MA9 B;  1V6E A;  2BS3 B;  4HK2 A;  2RDG A;  2GI9 A;  1E9M A;  2W3R A;  2CHW A;  4ZDV A;  3DVG X;  1ZDX A;  3IXS A;  4GOC A;  3FIL B;  2HJ8 A;  1B9R A;  1OQQ A;  2DX5 B;  3KYC D;  1HZ6 A;  1L0V B;  1YNT E;  2JX5 A;  3ZNZ B;  1D6E C;  1JAL A;  1FXA A;  1L6V A;  1YQ3 B;  3SHQ A;  2UYZ B;  3NUH B;  3M3J A;  3J9C A;  4KIK B;  4RM9 A;  2NPT B;  3RNG C;  4RM8 A;  2LVQ A;  3N30 A;  5AEK B;  2MQJ A;  2IO3 B;  1XLN A;  4CHK A;  3PGE A;  2JUO A;  3C0R B;  1FFU A;  3Q8C A;  4LJP B;  1ZXH A;  2XN9 C;  1F9J A;  2GRI A;  3JVZ X;  1A70 A;  2DBY A;  1XLP A;  3B2F A;  4BOZ B;  1JWB D;  5AZF A;  4JLC A;  2WXP A;  2DYM A;  2KYW A;  3ALB A;  4IKG A;  3IG3 A;  2PPH A;  3TCA A;  4FJV B;  2WWZ A;  1T0R C;  3WIM A;  3FIL A;  3RMK C;  1CZP A;  1MPE A;  1Q1O A;  4ICV A;  3RFZ B;  3ZDT A;  4W9C A;  1SJH D;  4K7S A;  2FCN A;  4GLS C;  2NBW B;  1DGJ A;  3ZNG C;  2H89 B;  3TL5 A;  1FRD A;  1M4V A;  3AV8 A;  2LEK A;  1XT9 B;  1GB4 A;  4KIK A;  3KUC B;  2L00 B;  2NPT A;  3QC8 B;  1V1O A;  4FUL A;  4LNI A;  2NR2 A;  3HVD A;  2YEP B;  2IYD B;  3KYD D;  1GJZ A;  3HK0 A;  3PSE B;  3MFG A;  1RRB A;  4P16 A;  1WZ3 A;  1NYR A;  3VRB B;  1CK1 A;  1K52 A;  4L1B A;  5CTR C;  3UIO B;  3NHE B;  3KQ4 A;  2N9X A;  4JX1 C;  3SDL C;  5IKC M;  4DHZ B;  2M17 A;  4C4V B;  2WNM A;  2ICI A;  3KH0 A;  2KFJ A;  3BWU D;  4M01 A;  5DCN A;  1SE2 A;  2JRH A;  3RNF C;  3WCQ A;  3U7D A;  3UQA A;  5D3I B;  2GBR A;  2KN5 A;  1L4D B;  4F8C B;  1VDV A;  5EE9 A;  1P0R A;  4XC2 A;  1U4A A;  1D4B A;  3DBH B;  1YN4 A;  1V5O A;  1I42 A;  1P3Q U;  5CHF A;  2H88 B;  2HE7 A;  3EA6 A;  4ARC A;  4HJK A;  4HCN B;  1WZ0 A;  1D3Z A;  1E5W A;  4YWG G;  2DAJ A;  2ZVO A;  2J42 A;  3S2A A;  4XWT A;  1I4H A;  1LM8 B;  1N5W A;  1QOG A;  1EM7 A;  2GOW A;  4WJQ A;  3DHI C;  3AE9 B;  5EE0 A;  2BGF A;  2LRU A;  2PE6 B;  3L4P A;  4C4V A;  3W2D A;  4P1B C;  4MGY E;  4LCD E;  2WXG A;  2A4Z A;  4IW0 A;  2M19 A;  4US8 A;  2KOX A;  1PFD A;  4MH0 E;  5FK9 C;  1OEY J;  1K53 A;  4G11 A;  4ARI A;  3R7Q A;  2QEJ C;  4DWF A;  5DPR A;  3H8H A;  4RGM A;  2LWP A;  5G2N A;  1F1H A;  4A55 A;  3ZJU A;  1EWY C;  4WJP A;  4ZYN A;  3PZD A;  3VHT C;  4CQN A;  1RWS A;  3PLU A;  3VDZ A;  3KWL A;  2BF8 B;  3W9C B;  3PZ7 A;  1WXM A;  2WDQ B;  3NY5 A;  1JRP A;  1ESF A;  1WWT A;  1SE4 A;  1T0Q C;  4M0W B;  2GB1 A;  1K50 A;  5IP4 D;  1FMA D;  2L1A A;  2V4L A;  3QA8 A;  1WR6 E;  1ET6 A;  3WA0 A;  4RH6 A;  3Q3F A;  4EUT A;  1ZXI A;  3MC9 A;  2VZK B;  3APD A;  2D11 A;  4YT0 B;  4KGR A;  4HKQ A;  2FUH B;  4RMA A;  4NY0 A;  1VRA B;  3LXF A;  2RPV A;  1FNV A;  4DDI D;  4MEL A;  3PRP B;  1FXT B;  4KGT A;  1WF9 A;  1I4P A;  1KLV A;  5BYQ A;  3WAL A;  2HDE A;  2WXF A;  1H4R A;  3L10 B;  4EZK A;  3IFW B;  4TQ1 A;  1V97 A;  2XBB C;  3VAW A;  2FCS A;  1GPX A;  2DLB A;  1PGX A;  3DBL I;  5EE3 A;  2WDV B;  2N4F A;  3AE1 B;  1WIA A;  4R3D A;  2D3A A;  2B3A A;  4IDI A;  2DZM A;  4M0W A;  2D5G A;  3NZS A;  2K8B A;  4HKZ E;  3A9K B;  2VZK D;  3ZYY X;  2TSS A;  1ZDV A;  1J7C A;  3PS6 A;  5E6N A;  1OGW A;  1R4M I;  3MJW A;  5LNK 1;  3MJ5 A;  3VTW A;  1C4P A;  2WXH A;  2BB6 A;  1GUA B;  4BFR A;  4C7Z A;  1EWC A;  2K6D B;  3VTU A;  1L2N A;  1TY2 A;  2ZJD A;  2MBQ A;  5D6J B;  2O6V B;  4J3O D;  4FLH A;  2VH1 A;  3QX1 A;  3LDZ E;  4YXD B;  3AEG B;  2ONQ A;  3P63 A;  4KZC A;  1SXT A;  3MTN B;  2K5P A;  1JRU A;  1FCL A;  3VR9 B;  4BBN C;  1J7B A;  1MVK A;  4DXG A;  2ZVN A;  1I35 A;  3ZW3 A;  4PT5 A;  1YJJ A;  2N9K A;  1K51 A;  3W1S A;  4HXD A;  1P7E A;  1J8C A;  4RF0 A;  3GE3 C;  1P7F A;  2BWF A;  2ZPN A;  2M4N A;  4P1C C;  2J52 A;  3RUI B;  5FR3 A;  1WE7 A;  3B9J A;  2JRI B;  2O6V D;  1I4X A;  2M8S A;  4IWO A;  1VD2 A;  2O6V A;  2BTE A;  2K22 A;  1TKG A;  2N1W A;  5BYR A;  2OHF A;  3FC4 A;  3ZRF A;  2JXT A;  2BYV E;  3QCA A;  1GOZ A;  2FBW B;  2AWT A;  4MDK E;  4QAY A;  3WAP A;  1J19 A;  4HJG E;  2JQR B;  3Q3J A;  1DOX A;  2EMS A;  4TMA B;  4EZL A;  2ZNV B;  4KKJ A;  3I63 C;  3ZLZ A;  4YTP B;  4GU2 A;  3ZNH B;  1VR9 A;  3QIJ A;  2C7N B;  3ZVV A;  1S3S G;  4K81 A;  4C80 A;  2DZI A;  5H92 C;  2KAN A;  2IJ0 A;  2LHE A;  1TS2 A;  4B0E A;  3PHW B;  3RZF A;  4AOF A;  3ZUN A;  5JXV A;  1L0X B;  2JWZ A;  3AEB B;  2C5L C;  3B08 A;  3GZN B;  5C2T B;  3JSV B;  1WGD A;  2WX0 A;  2SEB D;  2M0A A;  1PUT A;  2KWD A;  4NAW A;  3BVG A;  4C00 A;  1P9D U;  2N9L A;  4JWS C;  2Y3A A;  3VR8 B;  3AEC B;  1Z5S B;  1N61 A;  2KMA A;  2L3Z A;  2KAJ A;  2FCM A;  1FCC C;  3HIZ A;  2BKR B;  1I4R A;  1IUE A;  4JWU C;  3RNA C;  4B95 A;  4G0N B;  2G9H D;  2DHZ A;  2G1E A;  2X38 A;  3QWZ B;  4AJY B;  5IAA C;  4DHJ B;  3AEA B;  4LNO A;  2KXJ A;  4ACF A;  4MSQ B;  2NBV B;  4BKS D;  2QIL A;  4GDK B;  2RD0 A;  2Z0E B;  1SEB D;  2ZEQ A;  2MEK A;  4MJS B;  1TTN A;  2BYT A;  1HE8 A;  1ZE3 D;  4BBN F;  2CJN A;  4ITK A;  1BML C;  1TY0 A;  1UBQ A;  4HVB A;  1TS5 A;  3JSV A;  2B76 B;  4A90 A;  5L83 A;  3QAQ A;  1UNS A;  4RNA A;  3BZD B;  4P6V F;  1OFF A;  4GIV A;  2IND C;  2LHD A;  2PTL A;  3DCG A;  3ML8 A;  2R2Q A;  3DWM A;  2QC8 A;  2R61 A;  3O13 A;  3TBL D;  2NTT A;  2GMI C;  1E7P B;  2LGX A;  5J18 A;  5L95 C;  5H8Y E;  3ZJV A;  2LFI A;  3PZ8 A;  3UQB A;  1GAQ B;  2K0P A;  4LK0 M;  4CO7 A;  1NEN B;  5JZE B;  1TGZ B;  2PIA A;  4M8M A;  4GDK A;  4JL9 A;  5MPO A;  4MJS A;  3KW5 B;  2BKF A;  3O65 B;  2PLP A;  1TKE A;  1RLF A;  4HLE A;  1ZUD 2;  3NZU A;  3RYT A;  1RYJ A;  5G55 A;  2X8X X;  3IVF A;  2AL3 A;  4AS1 A;  4OZA A;  1NEK B;  2WU5 B;  2KT7 A;  3UF8 A;  3PV1 A;  2EKI A;  1JWS D;  2EEL A;  4NZL B;  2NTS A;  2J53 A;  1UGJ A;  4FHJ A;  4LLG M;  3RN9 C;  2KJR A;  5HI1 A;  3PRZ A;  3R66 C;  2Z8L A;  3M62 B;  5AUI A;  3U4E G;  3PT2 B;  4II2 B;  3BVM A;  3ZDM C;  3E56 A;  1YOV B;  2ZZP B;  5HHD G;  3ZIM A;  4K7W A;  2KWC A;  1TT5 B;  3A4R A;  4YL8 A;  2KFK B;  2K39 A;  4WH4 A;  5LXH A;  1KOT A;  4JIO U;  4A3P A;  3TEW A;  4ZOH C;  2Y5P A;  1IGC A;  1XQQ A;  2WDR B;  3SD5 A;  3NVZ A;  2ZCB A;  4WWP A;  2GLS A;  1KJT A;  3CST A;  3RUL A;  3HM3 A;  1UF0 A;  2GBM A;  2LGS A;  2JZ3 B;  3AN1 A;  2NBU A;  4ZRI A;  4LDT B;  1UWX A;  4URK A;  1TYG B;  3DBL B;  1JML A;  2O2V A;  3TMP B;  5LXI B;  1YJI A;  2KDI A;  2R2O A;  2WHI A;  3Q8F A;  1Q5W B;  2NS5 A;  2PKO A;  3FAH A;  5TR5 A;  1R4M B;  3P4Q B;  2JF5 A;  3I57 A;  5IN7 A;  2KFK A;  3OJ4 B;  3H7P B;  3H7S A;  2LGD A;  1KLU D;  3V60 A;  3AH7 A;  2MRP A;  3A1Q B;  4DQO C;  4XWW A;  1FIQ A;  1PQS A;  4WJO A;  4IG7 B;  1WGH A;  1WYG A;  1WR1 A;  1TBE A;  2IGG A;  4LNK A;  3MHS D;  4LDT D;  1CQV A;  2KWV B;  2BS4 B;  5E6P A;  1QOF A;  1AWD A;  3BY4 B;  3N32 A;  3RT3 B;  1UZX B;  2AQ2 B;  1V86 A;  2LJ5 A;  1E10 A;  2W82 A;  2L76 A;  1T5X D;  1D5M C;  2MWS B;  3LB8 C;  4WWO A;  2V9H A;  2E3T A;  5G5H A;  3IBE A;  2G45 B;  4NJ6 A;  4DXA B;  1E0Z A;  1C3T A;  3H7P A;  2BS2 B;  3R3M A;  3I9V 1;  2PMV A;  3R8B A;  3A1Q A;  4W9F A;  1A5R A;  2V4I B;  2QSD A;  1UH6 A;  3PTF C;  2DZJ A;  1TJE A;  4YSX B;  4HCP B;  3CMM B;  1GB1 A;  1UGM A;  1ZW7 A;  5FKA C;  2KJH B;  4PS8 A;  1T0Y A;  5D7G A;  2MJD A;  1C1Y B;  1EO6 A;  1BXT A;  2V3P A;  4JQW C;  4G3X B;  4LNN A;  3LYY A;  3AE7 B;  2I1J A;  1RM6 C;  4BOS C;  1N6Z A;  4KZ0 A;  4O1N A;  3X0W A;  1IBX B;  2I1K A;  4LNF A;  4OW0 A;  5T8I A;  2IO2 B;  4DBG A;  2WGS A;  1EU3 A;  1KTK A;  4X57 B;  1EUV B;  2J4X A;  4AJW A;  2YEP F;  2BVC A;  1F0Z A;  1YJ1 A;  1Y8R C;  1VCB A;  1OEY A;  2LD9 A;  2AQ1 B;  4OZC A;  2NVU I;  1UD7 A;  3PO0 A;  1ZOY B;  1MJD A;  1WM3 A;  1WJ4 A;  2OJW A;  4RFB A;  2RGF A;  3P2B A;  1NYQ A;  4ZYS A;  4BKT A;  3HVZ A;  1QKZ A;  1HQR D;  1JWM D;  5GMV A;  4A8X C;  5AUK A;  1WGK A;  1Z2M A;  2INN E;  3EFU A;  4DDG D;  1QF6 A;  2CS4 A;  5HFY A;  2UU7 A;  4RF1 A;  1YIW A;  1C9F A;  1ISN A;  2KC1 A;  3Q3M C;  4K7U A;  1IBX A;  4ZHO A;  2WXK A;  3SFD B;  3I3T B;  4L23 A;  1SSN A;  2Q5W D;  4ZHP A;  3U7Z A;  1E7U A;  1IYF A;  4BKG A;  4KSL C;  3PRE A;  1WSP A;  3BYT B;  1L7Y A;  1MHH E;  4PS3 A;  4ZRP A;  3KUD B;  1KF6 B;  4RGT A;  1TZO A;  1WRD B;  4BZA A;  1Q0W B;  2WYQ A;  3DVG Y;  5HG2 A;  1CMX B;  1HXY D;  2RDB C;  2J0K A;  4USA A;  1DOI A;  3V6E B;  1WJU A;  2KAC A;  1V49 A;  5D2M B;  2KVZ A;  5CHV C;  1DOY A;  2N7D A;  1XCT L;  3Q14 C;  4M02 A;  4JGH B;  2Z0D B;  3T8M A;  4ANX A;  3BK1 A;  1ZP0 B;  3VRA B;  1L4Z B;  3OLM D;  4XYC A;  4C7Y A;  2MX2 A;  3AE3 B;  3CF6 E;  2XK5 B;  2AX5 A;  4G50 A;  1SE3 A;  1JRO A;  2WXR A;  1AAR A;  3L54 A;  2G3Q B;  1WJN A;  3AUL A;  1WGR A;  2W54 A;  2INC C;  3Q8B A;  3DVN U;  2RDH A;  3HUI A;  3L17 A;  3AE2 B;  1TS4 A;  4GB9 A;  3UIP B;  2CU1 A;  1FM0 D;  2DZK A;  4MM3 A;  1HZ5 A;  1K8R B;  2BQQ A;  2L83 A;  1WMH A;  3ECI A;  1MHX A;  5D94 A;  4E3C A;  2N7J A;  2ZW0 A;  2WP9 B;  5HKH A;  4OVU A;  2JWU A;  3DBR I;  1WXQ A;  3Q8E A;  2WQY B;  1SF0 A;  4BAX A;  4N9F 4;  1KRH A;  1LGR A;  1PGA A;  2XK5 A;  5C23 A;  1FPY A;  1TIF A;  2JXX A;  1WI0 A;  2GBN A;  3FKY A;  2IO0 B;  3KVF B;  2RR9 A;  5J17 A;  5JH5 C;  2MW5 A;  3M63 B;  2Y5C A;  4NAW B;  1OTR B;  2GBJ A;  1XLQ A;  3APF A;  3DVN V;  1RAX A;  1HTO A;  4EOY A;  2IY0 B;  4GDL B;  3GE8 C;  3RNB C;  2KX3 A;  4F1S A;  4MGI E;  2WS3 B;  3AI5 A;  2G4D B;  3Q6B A;  2FID A;  4W9J A;  5BO4 B;  2EKE C;  3NS1 A;  1T0S C;  4US9 A;  1XO3 A;  4ZRK A;  1JWA D;  2KX0 A;  3P4P B;  3HHM A;  4RGO S;  2WXQ A;  2I38 A;  1XEE A;  2A5U A;  3IAS 1;  4XDD A;  4YTM B;  1SE9 A;  2BT6 A;  1SJE D;  1V80 A;  4Q2J A;  1LXD A;  3PHX B;  3P4R B;  5BMI A;  3ML9 A;  2VRR B;  1R4N I;  2HJ1 A;  2MLB A;  2PEA A;  2W9N A;  4NQL B;  3ZGZ A;  2KNB A;  3U8Z A;  2IY1 B;  4W9H A;  2IGD A;  1E8X A;  2V3S A;  3W5U B;  1V2Y A;  4ASW C;  5JHA A;  3ABV B;  3M95 A;  4GDL A;  1AYF A;  2FE8 A;  2YVC A;  1AN8 A;  1MI0 A;  1WJ6 A;  1XXG A;  3ZXR A;  3T3N A;  4NJ7 A;  3DDC B;  4HPP A;  2YLM A;  3MP9 A;  4A3O A;  3NRZ A;  3BVZ A;  2WXM A;  5IO9 A;  3ZQ4 A;  2OED A;  5IA7 A;  3RNE C;  5I4D A;  1QQR A;  4NPN A;  4ZRJ A;  4A9A A;  1F2R C;  4BKS A;  2MBE A;  1UUP A;  1JWU D;  2IZV B;  3ZTC A;  2AEH A;  2AL6 A;  3QK0 A;  1XLO A;  5KHQ A;  1WM2 A;  2KDM A;  3B0A A;  3N9Y C;  2L52 A;  1XD3 B;  3VH4 B;  2J7Q B;  1C4C A;  1QOB A;  2PVG C;  1EF1 A;  4GGQ A;  2V3N A;  3DQV A;  1QZE A;  2ACZ B;  3UI3 A;  1ACC A;  3TSS A;  1FNW A;  2WLB A;  2BYF A;  3URY A;  2WDT B;  3GB1 A;  3VTV A;  4TKN A;  5FR6 A;  1YD8 U;  3L0W B;  3C8Y A;  4TSS A;  1CJE A;  2JVC A;  3Q8A A;  2KD0 A;  4W9D A;  3RD2 A;  1FRR A;  1P98 A;  1P1A A;  4FJY A;  3AM9 A;  1BUI C;  3EFC A;  3BII D;  2DAF A;  2LGY A;  2K1F A;  4KKI A;  1PYW D;  3L13 A;  2G4S A;  3TEY A;  2BYE A;  3ENE A;  3K9P B;  1N5X A;  3P42 A;  4I6P A;  4KSK C;  1VZ7 A;  1VLB A;  2KK8 A;  2KTF A;  3VUX A;  4LTU A;  2MJ3 A;  2MHJ A;  1V8C A;  3SU8 X; 
#chains in the Genus database with same CATH homology
 3RT3 B;  1UZX B;  2KTR A;  3IFW B;  2KMC A;  1GNU A;  1V86 A;  3ONS A;  3TIX A;  2K6Q A;  1WE6 A;  4TQ1 A;  4E71 A;  2LJ5 A;  1E7V A;  2XBB C;  3VAW A;  2FCS A;  2L76 A;  3UGB B;  3DBL I;  4LJO B;  2MWS B;  2XEW A;  4WWO A;  3EC8 A;  2MBB B;  2N4F A;  3IBE A;  2LZ6 A;  1E8Z A;  1WIA A;  2G45 B;  2B3A A;  4NJ6 A;  4DXA B;  2O2V B;  2DZM A;  4W9L A;  5AZG A;  3VH3 B;  1C3T A;  3H7P A;  1IPG A;  2FCQ A;  3WAO A;  1WXS A;  3NZS A;  2K8B A;  3R3M A;  3ZKJ C;  1TZ1 A;  2KWU B;  3A9K B;  2KQS A;  3DPD A;  1V81 A;  3A1Q A;  4P7I A;  4W9F A;  4KDI C;  3PS6 A;  4IM2 A;  5E6N A;  1A5R A;  2NCN A;  1OGW A;  1R4M I;  3MJW A;  1UH6 A;  3PTF C;  2L8J A;  2DZJ A;  4HCP B;  3CMM B;  2J0J A;  3VTW A;  1UGM A;  1GUA B;  1ZW7 A;  4BFR A;  2KJH B;  3V6C B;  4PS8 A;  2K6D B;  2DYO A;  1V9J A;  1T0Y A;  3VTU A;  5CHW A;  2CKH B;  1H8C A;  1L2N A;  5D7G A;  2LAS A;  2ZJD A;  1UEL A;  1C1Y B;  2MBQ A;  4KVG B;  1EO6 A;  5D6J B;  4HDO A;  4DHZ E;  2O6V B;  3B1L X;  1SIF A;  3GOE A;  4JQW C;  4G3X B;  3ZNI D;  2FAZ A;  2I1J A;  5DPS A;  4WWN A;  4ICU A;  2N9P C;  2DYB A;  4FLH A;  2IO1 B;  3QX1 A;  4BOS C;  3LDZ E;  4GSW A;  4I6L B;  4EEW A;  2AYO B;  4KZC A;  4KZ0 A;  3MTN B;  3X0W A;  2UWQ A;  2RPQ A;  3L16 A;  2I1K A;  1GG3 A;  1WXA A;  1JRU A;  1S1Q B;  4J6I A;  2IO2 B;  3RZW C;  4DBG A;  2N1V A;  4BBN C;  3V61 A;  2CR5 A;  2ZVN A;  2KTR B;  3KUZ A;  1I35 A;  3ZW3 A;  4X57 B;  1EUV B;  2MCN B;  1WX8 A;  4TQ0 A;  1WX7 A;  3T9L A;  3W1Y A;  4AJW A;  3HM6 X;  2LRW A;  3VXW A;  3WAN A;  1YJ1 A;  2MSE D;  3W1S A;  1Y8R C;  2DEN B;  4HXD A;  1VCB A;  1M94 A;  2V1Y A;  2K8H A;  2LVO A;  3NOB A;  1OEY A;  2LD9 A;  3PLV A;  4W9E A;  5KHO A;  1J8C A;  4GMV A;  2BWF A;  2ZPN A;  2M4N A;  3V62 A;  3RUI B;  2NVU I;  1WE7 A;  1UD7 A;  3IHP C;  4B6W A;  2JRI B;  4EZJ A;  1WM3 A;  1WJ4 A;  2O6V D;  2RGF A;  1WYW B;  3P2B A;  2M8S A;  3QQ8 B;  4BKT A;  4IWO A;  1J0G A;  5GMV A;  3GZN I;  3A9J B;  1VD2 A;  2O6V A;  1Z2M A;  2L7R A;  2LI5 A;  2REX A;  3EFU A;  4FA6 A;  4DDG D;  3JYU A;  4AP4 C;  1WY8 A;  4II3 B;  2N1W A;  2CS4 A;  4E74 A;  2KHW B;  2RSU A;  2KKC A;  1YIW A;  4DHJ D;  3PPA A;  4W9G A;  3ZRF A;  1BT0 A;  2BYV E;  2K8C A;  2L0T A;  2L0F A;  1ISN A;  3QCA A;  1WGY A;  2LVP A;  4DK5 A;  2KC1 A;  4KDL B;  5E6O A;  2AWT A;  4K7U A;  3BIN A;  4MDK E;  2KZR A;  1OQY A;  2HD5 B;  2LXC A;  3EEC A;  4MSM B;  4MGK E;  3I3T B;  3WAP A;  1J19 A;  3H6N A;  3Q3J A;  4WJO A;  1E7U A;  4FHK A;  5LLI A;  3OJ3 A;  4GXB A;  1IYF A;  3CSF A;  4BKG A;  1WX9 A;  3N3K B;  4KSL C;  4TV3 A;  4WAA A;  3WAM A;  2EMS A;  3PRE A;  4BVU C;  4EZL A;  2MBH A;  1L7Y A;  2ZNV B;  4IM0 A;  4PS3 A;  3KUD B;  4IM3 A;  3H9D A;  1YQB A;  3ZLZ A;  4PYZ A;  1WRD B;  4GU2 A;  1WXV A;  1NDD A;  3ZNH B;  3UIN B;  4IUM B;  4EFO A;  3QIJ A;  2C7N B;  2OOB B;  3ZVV A;  1Q0W B;  1S3S G;  4K81 A;  2WYQ A;  4ANV A;  3DVG Y;  2DZI A;  4IC7 B;  4FBJ B;  4AWJ A;  1CMX B;  1GC6 A;  2D3G A;  4FN2 A;  2ASQ A;  2N9E B;  2J0K A;  4MGZ E;  2KAN A;  2CHZ A;  1E8Y A;  2EMT A;  3VUW A;  3DOW A;  4PS7 A;  1WJU A;  3RCZ A;  3V6E B;  3PHW B;  3RZF A;  4AOF A;  2BWE S;  1RFA A;  2MA9 B;  1KM7 A;  3ZUN A;  2JWZ A;  1V6E A;  1V49 A;  3A9J A;  4HK2 A;  4HDQ A;  2C5L C;  2L05 A;  3B08 A;  4IWP A;  5D2M B;  2CHW A;  4ZDV A;  3DVG X;  5CHV C;  4F7Z A;  3JSV B;  1WGD A;  2N7E A;  2N7D A;  2WX0 A;  4B9K A;  1WH3 A;  4GOC A;  4JGH B;  2HJ8 A;  3D32 A;  2Z0D B;  4NAW A;  3T8M A;  4ANX A;  2DX5 B;  2KDE B;  3KYC D;  1P9D U;  3OLM D;  2KDF B;  2MX2 A;  3ZNZ B;  1GC7 A;  1Z5S B;  3CF6 E;  2C7H A;  2XK5 B;  3A33 B;  2KMA A;  2L3Z A;  3AU5 A;  4FAD A;  2FCM A;  4G50 A;  4NNJ B;  3HIZ A;  2BKR B;  3SHQ A;  1YX6 B;  2UYZ B;  1AAR A;  1LFD A;  4B95 A;  3EHV A;  2G3Q B;  3L54 A;  4G0N B;  1WJN A;  3M3J A;  3AUL A;  1WGR A;  2DHZ A;  4KIK B;  4RM9 A;  3QWZ B;  4AJY B;  5IAA C;  2NPT B;  4DHJ B;  4RM8 A;  4MEM A;  2LVQ A;  3DVN U;  2KXJ A;  3N30 A;  5AEK B;  1G6J A;  3L17 A;  2MQJ A;  2IO3 B;  4MSQ B;  2NBV B;  4GB9 A;  3UIP B;  4CHK A;  2CU1 A;  4BKS D;  2CHX A;  2JUO A;  2RD0 A;  2DZK A;  2Z0E B;  2ZEQ A;  3C0R B;  3PGE A;  4GDK B;  4LJP B;  4MM3 A;  2KLG A;  1F9J A;  4IWQ A;  3JVZ X;  4MJS B;  1K8R B;  1TTN A;  2MBO A;  2KVR A;  1HE8 A;  3PRM B;  4BBN F;  1ZKH A;  1WMH A;  2QHO A;  2LXA A;  4BOZ B;  3ECI A;  5AZF A;  3TJP A;  4JLC A;  5D94 A;  2DYM A;  2KO3 A;  4E3C A;  1YX5 B;  3ALB A;  2KQ7 A;  3IG3 A;  3AXC A;  1UBQ A;  4HVB A;  5HKH A;  2PPH A;  3TCA A;  3JSV A;  4OVU A;  4TUU A;  4FJV B;  3DBR I;  2D2Q A;  2WWZ A;  3WIM A;  4WQO B;  2J0M A;  4N9F 4;  5L83 A;  1Q1O A;  3QAQ A;  4ICV A;  1UBI A;  2D07 B;  3ZDT A;  4W9C A;  2C7M B;  2XK5 A;  5C23 A;  4K7S A;  2FCN A;  2JXX A;  1WI0 A;  2GBN A;  4GIV A;  3DCG A;  3H1U A;  3ML8 A;  2IO0 B;  2NBW B;  2R2Q A;  3APC A;  3KVF B;  4KV2 A;  5AZH A;  2RR9 A;  4W9K A;  5J17 A;  3ZNG C;  2PE9 A;  3TBL D;  5JH5 C;  2MW5 A;  2OJR A;  2Z59 B;  3TL5 A;  3M63 B;  4NAW B;  2GMI C;  1OTR B;  1XT9 B;  2GBJ A;  2LGX A;  3APF A;  5J18 A;  5L95 C;  4KIK A;  3DVN V;  1RAX A;  3KUC B;  2L00 B;  2NPT A;  3QC8 B;  4EOY A;  3UQB A;  3W1S C;  4CO7 A;  2Y5B B;  4FUL A;  2K25 A;  2IY0 B;  4GDL B;  2NR2 A;  4NQK E;  2JT4 B;  3ZO5 B;  5JZE B;  2KX3 A;  1TGZ B;  2IYD B;  2M0X A;  3KYD D;  4F1S A;  5CX3 A;  1GJZ A;  3HK0 A;  4M8M A;  3PSE B;  4MGI E;  4GDK A;  3VQI A;  1RRB A;  2KC2 A;  3AI5 A;  2G4D B;  2FID A;  4W9J A;  5BO4 B;  1WZ3 A;  4JL9 A;  4MJS A;  5C1Z A;  3KW5 B;  2BKF A;  2EKE C;  1WGG A;  4ZRK A;  3O65 B;  5CTR C;  1RLF A;  2WX1 A;  2MP2 B;  4HLE A;  3UIO B;  3NHE B;  2N9X A;  3R7R A;  2KX0 A;  3NZU A;  3RYT A;  3SDL C;  4DHZ B;  2M17 A;  3HHM A;  5G55 A;  3IVF A;  3VUY A;  2A5U A;  1E8W A;  2AL3 A;  1SE9 A;  3UF8 A;  3KH0 A;  2KFJ A;  1V80 A;  5JHB A;  5DCN A;  3OAW A;  2JRH A;  3DBS A;  1LXD A;  1WMH B;  3PHX B;  3NS8 A;  3PV1 A;  1WFY A;  3ML9 A;  3U7D A;  3VVW B;  4AUQ C;  2VRR B;  3UQA A;  1R4N I;  2GBR A;  2KN5 A;  2FNJ B;  2MLB A;  4F8C B;  2PEA A;  4FHJ A;  1P0R A;  2W9N A;  4NQL B;  2KNB A;  1U4A A;  4XC2 A;  3U8Z A;  2KJR A;  2PJH A;  3PRZ A;  3R66 C;  2C9W B;  3M62 B;  2IY1 B;  4W9H A;  1V5O A;  1E8X A;  3PT2 B;  1I42 A;  4II2 B;  2V3S A;  1P3Q U;  5CHF A;  3LJ3 A;  2HE7 A;  4HPM B;  3ZDM C;  1V2Y A;  4HJK A;  4ASW C;  4HCN B;  5JHA A;  1WZ0 A;  2D10 A;  3M95 A;  1D3Z A;  2ZZP B;  3ZIM A;  1E5W A;  4GDL A;  2DAJ A;  2YVC A;  1WJ6 A;  5EDS A;  2ZVO A;  4NJ7 A;  3AU4 A;  4K7W A;  3S2A A;  2KWC A;  3A4R A;  4YL8 A;  2KFK B;  1LM8 B;  3DDC B;  4FJZ A;  2K39 A;  3VFK A;  5LXH A;  3PVL A;  1KOT A;  5DPW A;  2YLM A;  3ZTD A;  4A3O A;  2GOW A;  4JIO U;  3K9O B;  4WJQ A;  4EKU A;  2JPH A;  4K1R B;  4A3P A;  5J2R A;  4ANW A;  2MP2 A;  2JY6 A;  2BPS A;  2BGF A;  2LRU A;  5IA7 A;  2PE6 B;  1XQQ A;  1X1M A;  3JW0 X;  2ZCC A;  4MGY E;  4LCD E;  3SD5 A;  2ZCB A;  4NPN A;  4WWP A;  1KJT A;  3CST A;  4IW0 A;  2A4Z A;  4ZRJ A;  3RUL A;  4BKS A;  2MBE A;  3HM3 A;  3ZRC A;  2GBM A;  2IZV B;  2KOX A;  2HTH A;  4MH0 E;  4A20 A;  3ZTC A;  1LQB A;  2AEH A;  1OEY J;  2AL6 A;  2JZ3 B;  2NBU A;  3QK0 A;  4G11 A;  3X23 A;  4ZRI A;  3R7Q A;  4LDT B;  4CYE A;  4URK A;  1MG8 A;  5KHQ A;  1WM2 A;  3B0A A;  4DWF A;  5DPR A;  2KLC A;  1XD3 B;  2O2V A;  2LWP A;  3VH4 B;  2J7Q B;  2IBI B;  3TMP B;  5LXI B;  5G2N A;  5DPT A;  1EF1 A;  4GGQ A;  2ZNV C;  2KDI A;  2R2O A;  4XX5 A;  3A9K A;  3DQV A;  2KDB A;  1QZE A;  3L08 A;  2JZZ A;  4ZYN A;  4WJP A;  1Q5W B;  3DBH I;  3PZD A;  3VHT C;  2NS5 A;  4PYU A;  2LUE A;  2BYF A;  3PLU A;  2WDT B;  3VDZ A;  2BF8 B;  1SGH A;  4TKN A;  4HWI B;  5FR6 A;  3VTV A;  1E90 A;  1WXM A;  3NY5 A;  2JF5 A;  5TR5 A;  1YD8 U;  2KFK A;  1NBF C;  4I6N B;  3OJ4 B;  3H7P B;  3L0W B;  3QAR A;  4M0W B;  4ANU A;  3H7S A;  2LGD A;  2JVC A;  3V60 A;  2KD0 A;  2MRP A;  4W9D A;  2V4L A;  3RD2 A;  3A1Q B;  1P98 A;  3QA8 A;  1WR6 E;  1P1A A;  3WA0 A;  4GN1 A;  1NI2 A;  4FJY A;  1ZGU B;  3Q3F A;  4EUT A;  1PQS A;  3A4S C;  3APD A;  2D11 A;  2DAF A;  1V5T A;  2K1F A;  2C60 A;  2LGY A;  1EF5 A;  4IG7 B;  4OVV A;  4WJN A;  1WGH A;  4M8N A;  1WR1 A;  3L13 A;  2FUH B;  4W9I A;  4RMA A;  4NY0 A;  2GBK A;  2G4S A;  1TBE A;  2BYE A;  3MHS D;  3ENE A;  3K9P B;  4I6P A;  4LDT D;  4KSK C;  4DDI D;  2KWV B;  3QJZ A;  2ZPY A;  4MEL A;  3PRP B;  1FXT B;  5E6P A;  1WF9 A;  4HPL B;  2KJ6 A;  4XZ4 A;  1KLV A;  2KK8 A;  3U30 A;  3QHT A;  2KTF A;  3VUX A;  3WAL A;  3BY4 B;  2FIF A;  3N32 A;  1IP9 A;  2M1M A;  1H4R A;  3L10 B;  3SU8 X;  4EZK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...