2KJ6A

Nmr solution structure of a tubulin folding cofactor b obtained from arabidopsis thaliana: northeast structural genomics consortium target ar3436a
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
97
structure length
97
Chain Sequence
MGHHHHHHSHGDDSVHLHITHANLKSFSADARFSPQMSVEAVKEKLWKKCGTSVNSMALELYDDSGSKVAVLSDDSRPLGFFSPFDGFRLHIIDLDP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Tubulin folding cofactor B
publication title NMR Solution Structure of Tbulin folding Cofactor B obtained from Arabidopsis thaliana: Northeast
rcsb
source organism Arabidopsis thaliana
molecule tags Chaperone
total genus 17
structure length 97
sequence length 97
ec nomenclature
pdb deposition date 2009-05-22
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 2kj6A01
4GGQA 3RZWC 4DK5A 3T9LA 1V9JA 4GDLB 3R66C 4KIKA 2EKEC 1NI2A 2RPQA 3VTWA 2C5LC 4GOCA 3APDA 2KOXA 1MG8A 4IWOA 2V4LA 3V6CB 2ZNVC 2CR5A 4KZCA 2NBUA 1JRUA 5D2MB 2K6DB 3A4RA 1UZXB 1J19A 2KZRA 3QHTA 2JRIB 4GDKB 4HXDA 3PREA 4ANWA 2FNJB 2W9NA 1M94A 1E8WA 1WJUA 1V5OA 1WY8A 2KKCA 2MQJA 3JSVA 4GXBA 1Q0WB 2AWTA 1YX5B 3A1QB 4DHZE 5HKHA 1UBQA 4NQKE 1I42A 4WWOA 5TR5A 2K8BA 4F1SA 4M0WB 3R3MA 3PRZA 4PYZA 5D6JB 4PYUA 3D32A 1VD2A 2KANA 2N9PC 5AZGA 2ZNVB 4N9F4 2KX3A 3ENEA 3QAQA 4GB9A 2L05A 2KWUB 3AULA 1WZ0A 3AU4A 4G50A 1WFYA 1WM3A 3DBSA 1WI0A 2KX0A 3H1UA 3V60A 1XT9B 4HCPB 2HJ8A 2ZPNA 2IZVB 3PZDA 2MP2A 4W9LA 2NR2A 2JT4B 3ZDMC 2KJRA 3U30A 3L08A 4F8CB 5G55A 1NDDA 1YJ1A 2AL3A 3OAWA 3PSEB 1J8CA 4TUUA 2N7DA 3QQ8B 3IBEA 1V86A 2KFKB 2GBNA 4AWJA 2DHZA 4DDGD 1ZKHA 1ZW7A 5GMVA 3UIOB 4KDIC 2HE7A 2M17A 2FCQA 2IO2B 2KQSA 2KHWB 1IPGA 2GBJA 3IG3A 3M95A 4BKTA 1WJ4A 4ZRJA 1SIFA 4JGHB 1WGGA 3H7PB 3HK0A 5G2NA 3TIXA 3VUYA 4K7UA 4FA6A 3PRPB 4GDLA 5CX3A 3VAWA 2CHZA 2MBHA 2O6VA 2ZVOA 2M8SA 1T0YA 2JPHA 2MA9B 2KXJA 4LDTD 1L2NA 1E5WA 3EC8A 3P2BA 4WJNA 1WGRA 4IW0A 2DX5B 2CU1A 4MH0E 4GDKA 2NVUI 2DAJA 3TCAA 3ONSA 5L95C 4XZ4A 1WYWB 2XK5B 2JF5A 4WJQA 1KJTA 4G11A 4BFRA 5J17A 2L0FA 2L7RA 3ZRCA 3NY5A 1WMHB 1UGMA 3B0AA 1WX9A 3ZIMA 2L00B 2C7MB 2MX2A 1VCBA 3W1YA 3ZNID 3U8ZA 3IFWB 3UIPB 4IM3A 3L13A 2LXCA 2LGXA 1YD8U 2N1WA 2N4FA 3VTVA 3K9OB 3VUWA 5L83A 4W9IA 2G4DB 2N9XA 3H9DA 2D10A 4IG7B 2KQ7A 4JQWC 3VQIA 4W9EA 4W9DA 2KJ6A 1SE9A 3PGEA 3PVLA 3TL5A 3X0WA 4TKNA 3VUXA 2KLCA 2UYZB 2KFKA 5C23A 3JW0X 4AUQC 1Y8RC 1WIAA 2CHXA 4FULA 2J0KA 3ALBA 1GG3A 1UH6A 4KSKC 3WAMA 3AU5A 3MJWA 3PLUA 4LDTB 4GIVA 4CHKA 1WX7A 2K8CA 3QC8B 2J7QB 2KVRA 4E3CA 2LUEA 5E6PA 2DENB 2BF8B 2BYEA 2ZVNA 4HDQA 2CKHB 1LFDA 2REXA 3CMMB 3GZNI 4HWIB 3UF8A 4EKUA 1RAXA 4ANXA 3RYTA 4WAAA 4NPNA 3PHWB 2FIFA 2D07B 5IA7A 1CMXB 1EF1A 1WXSA 1WH3A 1WJNA 2R2OA 4K81A 4KVGB 1IYFA 3NZSA 2VRRB 2RSUA 1XD3B 2LRUA 3APCA 1I35A 2IY0B 1V49A 2MBBB 3ZVVA 1P3QU 2ZCCA 1WR1A 1X1MA 3ML9A 3VH3B 4A3PA 2LGYA 1J0GA 4OVUA 2NBVB 3S2AA 1WMHA 2WX1A 4LJOB 4KZ0A 4PS3A 3UINB 3NZUA 3A4SC 4P7IA 2JVCA 1E7UA 1UELA 2C9WB 2DYMA 3A9KA 4MJSA 4TV3A 5LLIA 3X23A 3VDZA 4ANUA 2K39A 1WX8A 3WAOA 3JVZX 5J18A 2FIDA 2MBQA 1V6EA 2FCNA 2NPTA 2OJRA 3W1SC 4EOYA 2LRWA 1WGDA 2IY1B 1Z5SB 2AL6A 4FJZA 4M8NA 4WJOA 5JHBA 1WRDB 2JXXA 2ZCBA 4MGIE 4XX5A 3ZDTA 4DXAB 5CHFA 2K8HA 2ASQA 5DPSA 3VTUA 3PS6A 2KLGA 2MW5A 4B6WA 5DPRA 4BBNF 3R7QA 2O2VB 3OLMD 2C7NB 3ZNHB 1HE8A 1WE6A 1WE7A 3ZRFA 4B95A 4AP4C 2GMIC 1LM8B 2AEHA 5J2RA 1GJZA 3KVFB 1IP9A 3A9JB 1E90A 4NJ7A 2BKFA 2K1FA 1TTNA 3VXWA 1TGZB 2ZJDA 3PTFC 4NQLB 2FCMA 2LVQA 2Z59B 4AJYB 4E74A 4WWPA 1V2YA 2KFJA 3MTNB 3C0RB 3M63B 1KLVA 4ASWC 2N7EA 1D3ZA 2IYDB 2WX0A 1E8XA 2D11A 1WZ3A 4GN1A 2A4ZA 2J0JA 1NBFC 3L10B 4I6LB 2PEAA 3MHSD 2A5UA 1KM7A 3WIMA 1WM2A 5JH5C 1UBIA 4KDLB 4HPMB 4W9JA 4A3OA 4MDKE 4RM8A 1UD7A 4MGKE 2DZMA 4BKSD 5EDSA 1KOTA 5CTRC 4DDID 3ML8A 3HM6X 3WAPA 5LXIB 4FADA 4EZKA 3V61A 3L54A 2JZZA 3H6NA 4II3B 5CHVC 4ICUA 3A1QA 1P1AA 4PS7A 2MCNB 3RZFA 4HJKA 4RMAA 2K25A 2NCNA 3ZNZB 2GBMA 2HTHA 4GSWA 3RULA 2AYOB 2WDTB 3QWZB 4IC7B 2KK8A 3WALA 3M3JA 1EUVB 3DVNV 4NNJB 1BT0A 3IVFA 1L7YA 2FCSA 3WA0A 2CS4A 2BGFA 3CSTA 3HM3A 5CHWA 4ZRIA 2XBBC 1H8CA 3KYCD 2R2QA 1P9DU 2WWZA 5JHAA 1S1QB 3T8MA 2EMSA 3KYDD 3W1SA 4HPLB 2GBRA 2V1YA 3OJ4B 2DZIA 2KO3A 3DVGY 3TBLD 2FUHB 4HCNB 1C3TA 4FHKA 2GBKA 4K7SA 4K7WA 1LXDA 1S3SG 3ZTCA 4AOFA 2LGDA 1AARA 5DPTA 4DWFA 3DBRI 2IO1B 3ZO5B 5D94A 1OTRB 4J6IA 2MRPA 3VHTC 1H4RA 2KC2A 4OVVA 2C60A 3H7PA 1R4NI 4G0NB 5BO4B 4IM0A 2I1KA 4NAWB 2CHWA 2J0MA 3KW5B 3SHQA 3NS8A 2IO3B 3NHEB 3ZW3A 2MLBA 3VFKA 2B3AA 4MSMB 3UGBB 3WANA 4EEWA 2MP2B 3A33B 4BBNC 2YLMA 3RD2A 2LD9A 2G45B 4K1RB 2IO0B 4RM9A 1TBEA 4FJYA 3RT3B 3VVWB 5C1ZA 2KWVB 1V81A 1OQYA 2LVPA 1F9JA 2XK5A 1WGYA 3B08A 4MGYE 4PS8A 4DBGA 3PPAA 1V5TA 3CF6E 4JL9A 2RR9A 3M62B 1E8YA 2LJ5A 4KSLC 2IBIB 4GU2A 4ZDVA 5AEKB 2BYFA 3UQBA 4IWQA 2KMAA 3L17A 2EMTA 3H7SA 2BWFA 3BINA 3ZTDA 4M8MA 2LZ6A 4DHZB 3CSFA 4FLHA 1OGWA 4WJPA 4EZJA 2G3QB 2K6QA 1ISNA 2KJHB 3QARA 2N1VA 2DYBA 3TJPA 1ZGUB 4ZYNA 4ICVA 2JUOA 4GMVA 2KNBA 4NY0A 3DPDA 2O6VB 3L0WB 2MBOA 3DBLI 1Q1OA 4YL8A 1U4AA 2KDBA 3QK0A 4WWNA 2Z0DB 4EZLA 2LWPA 1WXAA 2PPHA 4FJVB 2KMCA 3DDCB 1WGHA 1SGHA 2KTRB 4I6PA 1WR6E 4F7ZA 5DCNA 4URKA 2KN5A 3I3TB 3TMPB 2MBEA 2N9EB 2HD5B 2KDFB 2MSED 2L3ZA 4BKSA 2MWSB 3RUIB 2G4SA 3QIJA 3DOWA 4MSQB 1G6JA 2WYQA 1WXMA 3LDZE 2JRHA 1OEYA 1Z2MA 3KUZA 2KWCA 3AXCA 4NAWA 3N30A 2V3SA 4WQOB 5D7GA 2M1MA 3BY4B 3EECA 5LXHA 4TQ1A 4KV2A 4NJ6A 2FAZA 3QA8A 4I6NB 4E71A 2BPSA 4A20A 3V62A 3Q3JA 3R7RA 1Q5WB 2C7HA 2JZ3B 1YIWA 2L0TA 4X57B 3OJ3A 1EO6A 3ZLZA 1WJ6A 4JLCA 4FBJB 3KUDB 1WF9A 3UQAA 4HK2A 5KHQA 2PE9A 3ZNGC 4ZRKA 3SU8X 4BVUC 4TQ0A 1P98A 2LXAA 2PE6B 3HHMA 3AI5A 1LQBA 1RLFA 4XC2A 3KUCB 3N3KB 4W9KA 5E6OA 5IAAC 4BKGA 1GUAB 3QJZA 3SDLC 3ZKJC 3ECIA 2I1JA 3V6EB 3SD5A 3IHPC 3K9PB 4G3XB 3EHVA 4FHJA 1FXTB 4JIOU 4ANVA 2ZPYA 1R4MI 4EFOA 1YX6B 2NS5A 2L76A 3B1LX 4HLEA 4W9FA 4LJPB 1TZ1A 2BKRB 2LVOA 2KTRA 3LJ3A 2M4NA 5DPWA 2ZZPB 4BOSC 4KIKB 3EFUA 5E6NA 2O2VA 2LASA 4DHJD 2DAFA 1RFAA 2PJHA 3APFA 3DVGX 3U7DA 1EF5A 4BOZB 2KDEB 3L16A 5JZEB 1C1YB 3A9JA 2D3GA 3RCZA 3JYUA 2KC1A 5KHOA 4MEMA 3PHXB 1PQSA 4W9HA 3JSVB 3HIZA 2QHOA 2D2QA 4IM2A 2BWES 3A9KB 2RD0A 3PRMB 4MJSB 2O6VD 3DVNU 2KTFA 4FN2A 2NBWB 2YVCA 2NPTB 4IUMB 1GC7A 4LCDE 4CYEA 3QX1A 2KD0A 2DZJA 4CO7A 1WXVA 3O65B 2ZEQA 3GOEA 4W9CA 2XEWA 2Y5BB 4B9KA 5AZHA 4HDOA 4II2B 4HVBA 2BYVE 3PLVA 3QCAA 3DBHI 1A5RA 3Q3FA 1RRBA 4MGZE 2GOWA 1GNUA 2DYOA 1E8ZA 3NOBA 5AZFA 4MELA 1E7VA 4W9GA 3N32A 1QZEA 2L8JA 2DZKA 1YQBA 2M0XA 3VH4B 2Z0EB 3ZUNA 3PT2B 1K8RB 4DHJB 2JY6A 1XQQA 2OOBB 3PV1A 4EUTA 3DQVA 4IWPA 2KDIA 3DCGA 4AJWA 3KH0A 2LI5A 4MM3A 1V80A 1P0RA 1OEYJ 2UWQA 2RGFA 1GC6A 5FR6A 2JWZA
chains in the Genus database with same CATH superfamily
4GGQA 3Q14C 1V9JA 1NI2A 1PGAA 2C5LC 5C3JB 1MG8A 4IWOA 3NRZA 1UZXB 1J19A 2JRIB 4ANWA 1E8WA 2AQ1B 1I42A 4DHZE 5HKHA 1TS3A 4WWOA 3HUIA 1VD2A 3N9YC 3VR9B 2N9PC 2KX3A 3QAQA 4GB9A 2L05A 2KWUB 3DBSA 1XT9B 2IZVB 2MP2A 3ZDMC 2JT4B 4WIPA 3OAWA 1J8CA 1ZDVA 4AWJA 3GS2A 4L23A 2D3CA 2GB1A 1MJDA 2HE7A 2FCQA 4OZCA 1VRAB 2KHWB 2LHEA 5FK9C 1SIFA 2JX5A 2FBWB 1JRPA 4FA6A 3PRPB 5CX3A 3VAWA 2O6VA 1T0YA 2MA9B 3U52E 1L2NA 4WJNA 4IW0A 1PDXA 2WHIA 3FAHA 3DBLB 1UUPA 1VDVA 4CQNA 2M0AA 2DAJA 1TZOA 1WYWB 2V3NA 2JF5A 2LJIA 5HI1A 4C80A 2L7RA 3ZRCA 2K5PA 2DNFA 3B0AA 3ZIMA 2EKIA 1VCBA 3LYYA 3U8ZA 2LGXA 3K9OB 4N58A 1VZ8A 2N9XA 2D3BA 1I4HA 3VQIA 4W9DA 3W5UB 2KJ6A 1SE9A 5I4DA 2WXFA 4YWGG 2UYZB 2V9HA 5C23A 1AW7A 2V4IB 1WIAA 2J0KA 1NI3A 2OEDA 3WAMA 3VRBB 3PLUA 2PW9A 2KVRA 5T8IA 2BF8B 4LTUA 3MP9A 4HDQA 2CKHB 2REXA 4EKUA 5IA7A 1XCTL 2JU6X 2IY0B 1V49A 3TUOA 2VZKB 2X38A 1P3QU 2IGHA 2LGYA 1NVID 4OVUA 1FFUA 1E7UA 4TV3A 4MJSA 4ANUA 3Q69A 3X23A 3OWEB 1SE4A 2QSDA 2MBQA 2OJRA 1WGDA 4FJZA 2WXLA 5JHBA 1WRDB 1N6ZA 4MGIE 3ZDTA 3P63A 3VTUA 3PS6A 2FE8A 1N5XA 4KKJA 2W3RA 1WE6A 1WE7A 2AEHA 5J2RA 1JMLA 2BS3B 3KVFB 3DBHB 1E90A 4NJ7A 3VXWA 2ZJDA 3RNEC 4E74A 2KFJA 3C0RB 3MC8A 2L32A 1E8XA 2D11A 3L10B 2A5UA 1NYQA 4W9JA 4MDKE 5CTRC 4DDID 2AX5A 3HM6X 3WAPA 5LXIB 3H6NA 5CHVC 1P1AA 4HJKA 1OQQA 2HTHA 2AYOB 4IC7B 3IT4B 3KWLA 1ZDXA 3IVFA 2N9LA 1L7YA 4HVBA 4LNNA 5BMGA 3CSTA 3HM3A 4WWMA 2XBBC 3AV8A 1XLNA 1JWAD 5TSSA 1B1ZA 4R3DA 4HPLB 1RWSA 4ZOHC 4FHKA 4K7SA 3ZTCA 1S3SG 2ZW1A 2LGDA 1AARA 3Q2AC 1FNVA 1F77A 5HFYA 2WDQB 1TKGA 4J6IA 2MRPA 1HZ6A 4OVVA 2PIAA 2CHWA 1E10A 3KW5B 3NS8A 3NHEB 3ZW3A 4YTMB 3A33B 1K52A 2YLMA 3RD2A 3VVWB 4FJYA 2LVPA 4A55A 4DBGA 3OG5A 4JL9A 3M62B 1E8YA 2LJ5A 4ZDVA 5AEKB 2BYFA 4WH4A 3C8YA 3L4PA 3UQBA 3L17A 2KMMA 3ZTDA 4DHZB 3CSFA 4FLHA 4RGTA 4WJPA 2K6QA 2KJHB 1QILA 3QARA 2N1VA 1QF6A 4NY0A 3DPDA 2VH2A 1ET6A 2JXTA 1K53A 3I63C 1U4AA 3QK0A 3NVVA 2LWPA 3DDCB 2YEPB 1SGHA 2KTRB 1WR6E 5DCNA 2KN5A 2WXIA 4RGOS 2N9EB 2HD5B 3RI7C 2G9HD 3BYYB 2MSED 3IXSA 2G4SA 3QIJA 3RNGC 2WYQA 3LDZE 3KUZA 3Q3OC 1DOXA 1UGJA 3ZGZA 3EECA 4TQ1A 2BPSA 1XLQA 2HTME 4JWSC 2ACZB 2FUG1 2L0TA 2Q5WD 3AM9A 4HK2A 2PE9A 4BVUC 4ZRKA 3SU8X 4TQ0A 2LXAA 2WP9B 1LQBA 1RLFA 4NJCA 3KUCB 4XC2A 5BYRA 2Y5PA 5AUIA 5E6OA 3DWMA 3SDLC 3SD5A 3IHPC 4FHJA 3FKYA 4JIOU 2ZPYA 4EFOA 2NS5A 1TKEA 4MM3B 3B1LX 2LVOA 1I7HA 2WS3B 2M4NA 1YN5A 1VJKA 4TSSA 2KDEB 1TS4A 2D3GA 2PVOD 4MEMA 1PQSA 3U4EG 1FD6A 4IM2A 2O6VD 4RFBA 2NPTB 4LCDE 4RH6A 3V3XA 3ETRA 3QX1A 2KD0A 1V1PB 2XEWA 3I9V1 4II2B 2KN4A 4P16A 3AE4B 3GE8C 1A5RA 2WXJA 4MGZE 1D5ZC 2J53A 1HZ5A 5AZFA 2QCZA 2L8JA 2DZKA 1YQBA 2M0XA 3VH4B 2Z0EB 1R7SA 2WXOA 1K8RB 3PT2B 2JY6A 4JX1C 1QOBA 3DQVA 2KDIA 4P1CC 1GB4A 2UWQA 1GC6A 4E3CA 4DK5A 4MH8A 5G5GA 4KIKA 4GOCA 3SFDB 2G1EA 3APDA 3W9CB 2KOXA 3V6CB 2K6DB 4REZA 4ZRPA 3JSVA 4A90A 2E3TA 2KKCA 2K22A 1YX5B 2K3UA 2ICIA 2K8BA 3B2GA 3KWVA 5D6JB 4PYZA 3D32A 5AZGA 2ZNVB 1JCKB 3AULA 1L0VB 5JXVA 1WFYA 1WI0A 3Q8AA 3PZDA 2WGSA 4F8CB 5G55A 3E56A 1YJ1A 2AL3A 1FPYA 1PGBA 2N7DA 1V86A 1EU4A 4DDGD 1IGDA 5GMVA 4KDIC 1SBBB 2KQSA 1VZ7A 4BKTA 2WQYB 1L4DB 1WGGA 3H7PB 3VUYA 3VRAB 3Q8BA 4GDLA 2RDBC 2ZVOA 4P6VF 3TEWA 2KXJA 4LDTD 3EC8A 3P2BA 1DOYA 2DX5B 1TJEA 3B9JA 2CU1A 4MH0E 4AQ7A 2NVUI 2KT7A 3ZQ4A 3ZJTA 4G11A 2L0FA 4KKIA 1MPEA 3NY5A 1UGMA 3KLSX 1WX9A 2L00B 1C9FA 2BB6A 1ZE3D 4IM3A 2LXCA 1YD8U 3VTVA 1JWSD 4W9IA 1UNSA 1N61A 2G4DB 3AECB 2D10A 1FRRA 4W9EA 3PGEA 3PVLA 3TL5A 3X0WA 3VUXA 4AUQC 4FULA 1LGRA 4KSKC 1BXTA 2RMMA 3AU5A 3MJWA 4LDTB 2NTSA 1WX7A 2K8CA 4N6EB 4C56C 3QC8B 1N5WA 2LUEA 5E6PA 1DYQA 2BYEA 3V05A 1LFDA 4HKZE 3CMMB 4RF1A 2GRIA 1L0YB 4XWWA 4WAAA 4NPNA 1SE3A 1EF1A 4O1NA 4K81A 1IYFA 5C2TB 1I35A 1X1MA 3ML9A 1WMHA 4KZ0A 4PS3A 2JVCA 3IAM1 5FKAC 2K39A 3JVZX 2PTLA 2NPTA 4EOYA 3W1SC 2LRWA 4B0EA 4M8NA 4XX5A 2K8HA 1FCCC 1V1PA 1GB1A 3ZXVA 2KLGA 2MW5A 4B6WA 3R7QA 4A6QA 2BW2A 3EUB2 2JYTA 1HE8A 1N60A 4B95A 4BZAA 3NVYA 2GMIC 1LM8B 1YMHE 4IOIE 1IP9A 3A9JB 4ACFA 1TTNA 3PTFC 2LVQA 4AJYB 1E0ZA 4WWPA 3SR6A 3MTNB 1FMAD 3AEDB 3M63B 3P1MA 4ASWC 1D3ZA 2WX0A 2J0JA 4I6LB 2PEAA 1UWMA 1KM7A 3WIMA 1ROEA 5E6JA 1QKZA 1UD7A 4MGKE 1V1OA 2DZMA 2QEJC 4YTNB 4EZKA 4ICUA 4DXGA 2MCNB 1IGCA 4IKGA 1OFFA 2AQ3B 3ZNZB 5D3DA 3BVGA 2MJ3A 2WDTB 4ZRQA 2KK8A 3WALA 3M3JA 1EUVB 2LEKA 5BYSA 4NNJB 1GAQB 1BT0A 1VR9A 5FR3A 4KGTA 3MFGA 2FCSA 1H8CA 2VZKD 2R2QA 1SSNA 5JHAA 3PO0A 4XGAB 2EMSA 2NTTA 3OJ4B 1F2RI 2WDRB 2FUHB 1YN3A 3RN9C 4D2KA 4DWFA 1C79A 3DBRI 1C4CA 3ZO5B 1JROA 2QILA 1BMLC 5D94A 1OTRB 1ESFA 3VHTC 1H4RA 1RFKA 3N1XC 2C60A 3FILA 3H7PA 1R4NI 4G0NB 4LK0M 3RNFC 1MHHE 2INNE 2B3AA 4EEWA 1TS5A 4BBNC 2G45B 2LD9A 4K1RB 1OQYA 1F9JA 4MGYE 4PS8A 3PPAA 2LGSA 3CF6E 3P4RB 4IWQA 1E7PB 2EMTA 3H7SA 2INPE 1L4ZB 2LZ6A 1OGWA 2JUOA 2QJLA 4GMVA 3BK2A 2BVCA 2MBOA 5GXGB 3HRDD 4YSZB 3DHHC 2Z0DB 1HQRD 4EZLA 2KMCA 1T3QA 2KACA 3Q8EA 4URKA 3TMPB 3I3TB 2KDFB 4BKSA 3U2SC 4MSQB 1G6JA 3TEZA 1WXMA 2JRHA 2JSVX 1Z2MA 2KWCA 2V3SA 4UDUC 5D7GA 2M1MA 3BY4B 4KV2A 2YEPF 4NJ6A 3WCQA 4XE0A 1N62A 3V62A 1M4VA 3Q3JA 3R7RA 4OZAA 1YIWA 4DQOC 2K0PA 3ZLZA 1WJ6A 3KUDB 1SIJA 5KHQA 3N20C 2PKOA 1D6EC 3HHMA 3AI5A 4W9KA 4BKGA 1GUAB 3QJZA 1F52A 1C4AA 1FFVA 3K9PB 3R8BA 3FC4A 4G3XB 4ARCA 1R4MI 4ZYSA 3ZJUA 1VZ6A 1TY2A 2GI9A 4JWUC 2L76A 2J4XA 4RCOA 4LJPB 1L6UA 3LJ3A 3ZJVA 5DPWA 4KIKB 1D5XC 2DAFA 1RFAA 2PJHA 1WWTA 4BOZB 1L0XB 3A9JA 3J9CA 3AB5A 3JSVB 2D2QA 3A9KB 2RD0A 3EFCA 2KTFA 4FN2A 2NBWB 2YVCA 4IUMB 4CYEA 1T0QC 3O65B 3GOEA 4W9CA 4P1BC 1FRDA 3URYA 1GNUA 2DYOA 2W82A 2IJ0A 3TEYA 1YJJA 3HVZA 1XF5L 5LNK1 4JE3B 1KFYB 5H8YE 3ZUNA 4IWPA 2INDC 4AJWA 3KH0A 1V80A 5FR6A 2JWZA 1I4RA 3T9LA 4GDLB 2RPQA 3VTWA 3IT6B 2BBCA 2V4LA 2JZPA 4OZBA 2CR5A 2NBUA 3AN1A 1QLBB 2KZRA 3QHTA 4LLGM 1EWYC 2FNJB 1M94A 1WJUA 1V5OA 1ZP0B 4GXBA 1Q0WB 2DBYA 4S0RA 3A1QB 1CZPA 2PLPA 4XYCA 1BUIC 4F1SA 4M0WB 3R3MA 3DBRB 4PYUA 2KANA 4N9F4 3ENEA 3P4SB 3C19A 1WZ0A 5BMHA 4G50A 1WM3A 2KX0A 4NZLB 3H1UA 3V60A 1R4NB 4HCPB 1QT9A 3PZ8A 4W9LA 2RDHA 1ZPSA 2KJRA 3U30A 4KGSA 4TUUA 1P7FA 1XLPA 3NVWA 3N1ZC 2WU2B 3UIOB 2M17A 2GBJA 5G5HA 1Y56A 1WJ4A 1KH0A 4ZRJA 3TIXA 1ZXIA 5G2NA 4K7UA 1UWXA 2CHZA 1YQ4B 3H8HA 2JPHA 2IGDA 1EU3A 1E5WA 1WGRA 4WAFA 3HVDA 4GDKA 4C00A 3TCAA 3ONSA 5L95C 4XZ4A 2XK5B 4WJQA 4LNFA 1KJTA 5J17A 2BQQA 1CQVA 3NS1A 1WMHB 2XN9C 5IN7A 1QOAA 2MX2A 1FNWA 2TSSA 3IFWB 3UIPB 3L13A 2N0SB 1EM7A 1HXYD 3VUWA 5L83A 2CJNA 4IG7B 2MHJA 5HHDG 4JQWC 2VH1A 2KDMA 2KLCA 2KFKA 3JW0X 2BYTA 1I4XA 3ALBA 2SEBD 1UH6A 4CHKA 2J7QB 2DENB 2ZVNA 2WNMA 4HWIB 1TIFA 2NMQA 3RYTA 2WXMA 1XLOA 2DLBA 2FIFA 3ZXRA 1WXSA 2V3PA 1WJNA 4KVGB 3NZSA 1PGXA 1R4MB 2L83A 2ON8A 2RSUA 1XD3B 2LRUA 5IKCM 2MBBB 1C77A 2RDGA 3ZVVA 4HROA 3AEAB 1J0GA 3S2AA 1F1HA 2WX1A 3UINB 2L1AA 1HEZE 1T0SC 1UELA 3A9KA 2DYMA 3VDZA 1WX8A 5J18A 1IUEA 2FCNA 4NAMA 2IY1B 5BYQA 2AL6A 4WJOA 2JXXA 1FXAA 2EELA 4LNKA 4M01A 4DXAB 5CHFA 5DPSA 3RMKC 1ET9A 2W54A 1NEKB 3OLMD 2C7NB 3ZRFA 4HRSA 4AP4C 1CK1A 2WXNA 2BKFA 4NQLB 2FCMA 2Z59B 2LMCA 3AEFB 1KLVA 1JWMD 2N7EA 1RM6C 3FILB 1EWCA 2D3AA 2IGGA 1WM2A 1UBIA 4KDLB 4HPMB 1KLUD 2MJEA 4BKSD 1KOTA 4ARIA 3ML8A 4FADA 3V61A 4II3B 2JZZA 4US8A 3A1QA 4PS7A 4M0WA 4RMAA 4GSWA 3RULA 3QWZB 1N63A 4KGRA 1YJIA 4L1BA 1L5PA 4US9A 3WA0A 2CS4A 2BGFA 4PK1A 3EGRA 3SEBA 3W1SA 4HPPA 2DZIA 5BMIA 3DVGY 4RNAA 3TBLD 4HCNB 2D5GA 2GBKA 4K7WA 1LXDA 3GB1A 4S17A 4J3OD 3Q8CA 2KC2A 1MI0A 3P42A 1YQ3B 1TS2A 3AEBB 4IM0A 2J0MA 3AH7A 1AWDA 1UF0A 2IO3B 2WXQA 2MLBA 4USAA 3VFKA 4MSMB 3WANA 2IO0B 1NYRA 4RM9A 1TBEA 3RT3B 5C1ZA 1V81A 3GE3C 2J42A 2XK5A 1WGYA 3B08A 4YXDB 1NENB 2CJOA 2WU5B 3BINA 1FCLA 2G3QB 3TJPA 2DYBA 1ZOYB 4ICVA 2KNBA 3NVZA 2H88B 4YL8A 1A70A 2KDBA 4L2YA 4M00A 2PPHA 1WGKA 4FJVB 1C76A 5D3IB 4I6PA 4JPSA 2JWUA 4F7ZA 2MBEA 3U7ZA 2MWSB 5IO9A 2N7JA 3AE3B 3PZ7A 2BS2B 4NAWA 3N30A 4GLSC 4WQOB 2PMVA 1OQRA 5EE1A 4I6NB 2ZW0A 3N1YC 4QAYA 2XNAC 2C7HA 1MG4A 2JZ3B 1CJEA 3OJ3A 3R2TA 4N59A 4JLCA 1PYWD 1FXIA 3ZNGC 3NG0A 1P98A 2PE6B 1Q10A 3AE5B 3EA6A 5IAAC 3ZKJC 2I1JA 3V6EB 3Q3MC 3UI3A 2H89B 1FXTB 3BVMA 4ZHOA 3P4PB 2W3SA 4HLEA 1PFDA 1FO4A 1D4BA 3ABVB 1ACCA 1TZ1A 3T3NA 2ONQA 2ZZPB 1XCQL 3IAS1 2LASA 3DVGX 3APFA 3U7DA 3AE7B 4WURA 1JQ4A 2HDEA 5JZEB 3RCZA 3MC0B 2KC1A 1FNUA 3PHXB 1TT5B 4W9HA 4AS1A 1QOFA 4XDCA 3HIZA 2BWES 3PRMB 3I5JC 3W2DA 4OHJA 1GC7A 2DZJA 1WXVA 4C7ZA 1IBXA 2Y5BB 1FIQA 2CU3A 5AZHA 4HDOA 2WDVB 2LFIA 3Q3FA 1RRBA 2WXRA 2GOWA 2MH7A 1E8ZA 3RFZB 4MELA 1E7VA 3DWGC 4W9GA 2OOBB 2Z8LA 3PV1A 1QQRA 3CWIA 3RZWC 3R66C 4YSYB 2EKEC 4DXFA 2ZNVC 4KZCA 1K50A 1JRUA 5D2MB 3A4RA 4GDKB 4HXDA 2KAJA 3PREA 2W9NA 4LNOA 3RPFC 1WY8A 2MQJA 3MJ5A 1V97A 1HTOA 2AWTA 5IP4D 3RNAC 1UBQA 1KF6B 4NQKE 5TR5A 3PRZA 1GPXA 3AU4A 4H2AA 3DHIC 4MT5A 2HJ8A 2OHFA 2ZPNA 2JQRB 3RNBC 2NR2A 2JYEA 2WXGA 1T0RC 3L08A 1NDDA 3PSEB 1P7EA 1LO5D 3QQ8B 3IBEA 3LB8C 2KFKB 1F2RC 2GLSA 2GBNA 2DHZA 4BAXA 3BWUD 1ZKHA 1ZW7A 2IO2B 1IPGA 3BZDB 3IG3A 1KLGD 4PT5A 3M95A 4HKQA 2WXPA 4JGHB 3HK0A 3P4QB 2MBHA 2M8SA 1YN4A 2QDFA 2KWDA 3RNCC 3AE2B 2QC8A 1YNTE 1D5MC 4BFRA 3R2IA 2E6XA 1JW9D 2C7MB 3W1YA 3ZNID 4HEA1 4XDDA 1WYGA 2N1WA 2N4FA 1C4PA 2BB5A 3E9SA 2DWQA 3GP7A 3H9DA 2KQ7A 2IDYA 4TKNA 1Y8RC 4A9AA 2CHXA 3I57A 1GG3A 4GIVA 1KRHA 1MHXA 4FXCA 3Q6BA 5EE3A 3GZNI 3UF8A 1RAXA 3LXFA 4ANXA 1ZUD2 3AMZA 3PHWB 2D07B 2M56B 1CMXB 1WH3A 2R2OA 1SJED 2VRRB 3APCA 1FM0D 2ZCCA 1WR1A 2I38A 3BIID 3VH3B 1C78A 4A3PA 2NBVB 4K3BA 4LJOB 3NZUA 1TYGB 3A4SC 4P7IA 2C9WB 1KTKA 5LLIA 1K51A 3WAOA 1WSPA 2FIDA 1V6EA 3TSSA 4OW0A 5MPOA 4B0MA 1Z5SB 1TY0A 2ZCBA 1SXTA 5HG2A 2ASQA 2HJ1A 1F0ZA 5DPRA 4BBNF 1E9MA 2O2VB 4K3CA 2M19A 2INCC 3CIRB 3ZNHB 2WXHA 1GJZA 2OJWA 2K1FA 1TGZB 1V2YA 5H92C 2KYWA 2RPVA 2IYDB 1WZ3A 4GN1A 2A4ZA 1NBFC 3MHSD 5JH5C 2QMTA 4A3OA 4RM8A 2Y5CA 5EDSA 2W55A 1YOVB 3L54A 3RZFA 1AN8A 2BS4B 2K25A 2NCNA 3TEXA 2GBMA 4Q2JA 2BT6A 3DVNV 1SB3C 1XEEA 4C4VB 5CHWA 4ZRIA 4KX6B 3KYCD 2WWZA 1P9DU 1S1QB 3AE6B 5EE9A 3T8MA 1TKYA 3KYDD 3DHGC 2GBRA 2V1YA 2KO3A 1J7AA 1FEHA 4ITKA 1C3TA 4AOFA 4YT0B 5DPTA 1J7BA 1B9RA 2R61A 2IO1B 1SE2A 1JALA 1STEA 3AE9B 3NJTA 4M02A 4YSXB 5BO4B 2I1KA 4NAWB 1PUTA 3Q3NC 3SHQA 4ZHPA 2KQ4X 3UGBB 2MP2B 4RGMA 1AYFA 2N9KA 2KWVB 4MACA 3MHZA 3B2FA 4YTPB 1QOGA 1V5TA 2RR9A 4KSLC 2IBIB 2LGIA 1T6BX 4GU2A 2PVGC 2KMAA 3BK1A 2MEKA 2BWFA 4M8MA 4EZJA 2BTEA 1ISNA 1V8CA 1I4PA 1ZGUB 2MJDA 4ZYNA 1T5XD 3L0WB 2O6VB 3NUHB 3DBLI 1SEBD 1Q1OA 4HJGE 4A8XC 4WWNA 1WXAA 1WGHA 2LHDA 2QIEB 4OVZA 1HA5A 2L3ZA 3RUIB 3DOWA 3VR8B 3KQ4A 1OEYA 3AEEB 4IDIA 3AXCA 3MC9A 4TMAB 5LXHA 2FAZA 1E6EB 3QA8A 1WXQA 4E71A 3GZNB 4A20A 3W5VB 4EE2A 1Q5WB 1DGJA 4RGNA 4X57B 1EO6A 1L6VA 5AUKA 4FBJB 3UQAA 1WF9A 1IBXB 1ZXHA 5EE0A 3AE8B 2L52A 2K9XA 3N3KB 3ECIA 2Y3AA 3EHVA 2I2YA 4ANVA 1YX6B 4WQMA 1DOIA 1RYJA 4W9FA 4LNIA 2BKRB 2V0GA 2KTRA 1SF0A 1JWUD 3SFEB 1I4GA 4BOSC 4RF0A 2SAKA 3EFUA 5E6NA 1JWBD 2O2VA 2WLBA 4DHJD 1J7CA 2B76B 1EF5A 1GOZA 1I4QA 3L16A 1C1YB 3JYUA 4XWTA 5KHOA 2QHOA 5IOIA 4MJSB 3T3OA 1HTQA 3DVNU 1MVKA 1XXGA 4CO7A 1MFWA 2ZEQA 3BVZA 1WRIA 3AEGB 4B9KA 2X8XX 3BYTB 2BYVE 2IPKD 3PLVA 3QCAA 3DBHI 3NZ3A 1ENFA 3NOBA 3ZYYX 1XO3A 1SJHD 2AQ2B 3N32A 1QZEA 2KVZA 3AE1B 4C7YA 4DHJB 4EUTA 1XQQA 3Q8FA 3DCGA 2J52A 2LI5A 3O13A 4MM3A 2LUMA 2UU7A 1P0RA 1OEYJ 4C4VA 1VLBA 2RGFA 2WXKA
chains in the Genus database with same CATH topology
4GGQA 3RZWC 4DK5A 3T9LA 1V9JA 4GDLB 3R66C 4KIKA 2EKEC 1NI2A 2RPQA 3VTWA 2C5LC 4GOCA 3APDA 2KOXA 1MG8A 4IWOA 2V4LA 3V6CB 2ZNVC 2CR5A 4KZCA 2NBUA 1JRUA 5D2MB 2K6DB 3A4RA 1UZXB 1J19A 2KZRA 3QHTA 2JRIB 4GDKB 4HXDA 3PREA 4ANWA 2FNJB 2W9NA 1M94A 1E8WA 1WJUA 1V5OA 1WY8A 2KKCA 2MQJA 3JSVA 4GXBA 1Q0WB 2AWTA 1YX5B 3A1QB 4DHZE 5HKHA 1UBQA 4NQKE 1I42A 4WWOA 5TR5A 2K8BA 4F1SA 4M0WB 3R3MA 3PRZA 4PYZA 5D6JB 4PYUA 3D32A 1VD2A 2KANA 2N9PC 5AZGA 2ZNVB 4N9F4 2KX3A 3ENEA 3QAQA 4GB9A 2L05A 2KWUB 3AULA 1WZ0A 3AU4A 4G50A 1WFYA 1WM3A 3DBSA 1WI0A 2KX0A 3H1UA 3V60A 1XT9B 4HCPB 2HJ8A 2ZPNA 2IZVB 3PZDA 2MP2A 4W9LA 2NR2A 2JT4B 3ZDMC 2KJRA 3U30A 3L08A 4F8CB 5G55A 1NDDA 1YJ1A 2AL3A 3OAWA 3PSEB 1J8CA 4TUUA 2N7DA 3QQ8B 3IBEA 1V86A 2KFKB 2GBNA 4AWJA 2DHZA 4DDGD 1ZKHA 1ZW7A 5GMVA 3UIOB 4KDIC 2HE7A 2M17A 2FCQA 2IO2B 2KQSA 2KHWB 1IPGA 2GBJA 3IG3A 3M95A 4BKTA 1WJ4A 4ZRJA 1SIFA 4JGHB 1WGGA 3H7PB 3HK0A 5G2NA 3TIXA 3VUYA 4K7UA 4FA6A 3PRPB 4GDLA 5CX3A 3VAWA 2CHZA 2MBHA 2O6VA 2ZVOA 2M8SA 1T0YA 2JPHA 2MA9B 2KXJA 4LDTD 1L2NA 1E5WA 3EC8A 3P2BA 4WJNA 1WGRA 4IW0A 2DX5B 2CU1A 4MH0E 4GDKA 2NVUI 2DAJA 3TCAA 3ONSA 5L95C 4XZ4A 1WYWB 2XK5B 2JF5A 4WJQA 1KJTA 4G11A 4BFRA 5J17A 2L0FA 2L7RA 3ZRCA 3NY5A 1WMHB 1UGMA 3B0AA 1WX9A 3ZIMA 2L00B 2C7MB 2MX2A 1VCBA 3W1YA 3ZNID 3U8ZA 3IFWB 3UIPB 4IM3A 3L13A 2LXCA 2LGXA 1YD8U 2N1WA 2N4FA 3VTVA 3K9OB 3VUWA 5L83A 4W9IA 2G4DB 2N9XA 3H9DA 2D10A 4IG7B 2KQ7A 4JQWC 3VQIA 4W9EA 4W9DA 2KJ6A 1SE9A 3PGEA 3PVLA 3TL5A 3X0WA 4TKNA 3VUXA 2KLCA 2UYZB 2KFKA 5C23A 3JW0X 4AUQC 1Y8RC 1WIAA 2CHXA 4FULA 2J0KA 3ALBA 1GG3A 1UH6A 4KSKC 3WAMA 3AU5A 3MJWA 3PLUA 4LDTB 4GIVA 4CHKA 1WX7A 2K8CA 3QC8B 2J7QB 2KVRA 4E3CA 2LUEA 5E6PA 2DENB 2BF8B 2BYEA 2ZVNA 4HDQA 2CKHB 1LFDA 2REXA 3CMMB 3GZNI 4HWIB 3UF8A 4EKUA 1RAXA 4ANXA 3RYTA 4WAAA 4NPNA 3PHWB 2FIFA 2D07B 5IA7A 1CMXB 1EF1A 1WXSA 1WH3A 1WJNA 2R2OA 4K81A 4KVGB 1IYFA 3NZSA 2VRRB 2RSUA 1XD3B 2LRUA 3APCA 1I35A 2IY0B 1V49A 2MBBB 3ZVVA 1P3QU 2ZCCA 1WR1A 1X1MA 3ML9A 3VH3B 4A3PA 2LGYA 1J0GA 4OVUA 2NBVB 3S2AA 1WMHA 2WX1A 4LJOB 4KZ0A 4PS3A 3UINB 3NZUA 3A4SC 4P7IA 2JVCA 1E7UA 1UELA 2C9WB 2DYMA 3A9KA 4MJSA 4TV3A 5LLIA 3X23A 3VDZA 4ANUA 2K39A 1WX8A 3WAOA 3JVZX 5J18A 2FIDA 2MBQA 1V6EA 2FCNA 2NPTA 2OJRA 3W1SC 4EOYA 2LRWA 1WGDA 2IY1B 1Z5SB 2AL6A 4FJZA 4M8NA 4WJOA 5JHBA 1WRDB 2JXXA 2ZCBA 4MGIE 4XX5A 3ZDTA 4DXAB 5CHFA 2K8HA 2ASQA 5DPSA 3VTUA 3PS6A 2KLGA 2MW5A 4B6WA 5DPRA 4BBNF 3R7QA 2O2VB 3OLMD 2C7NB 3ZNHB 1HE8A 1WE6A 1WE7A 3ZRFA 4B95A 4AP4C 2GMIC 1LM8B 2AEHA 5J2RA 1GJZA 3KVFB 1IP9A 3A9JB 1E90A 4NJ7A 2BKFA 2K1FA 1TTNA 3VXWA 1TGZB 2ZJDA 3PTFC 4NQLB 2FCMA 2LVQA 2Z59B 4AJYB 4E74A 4WWPA 1V2YA 2KFJA 3MTNB 3C0RB 3M63B 1KLVA 4ASWC 2N7EA 1D3ZA 2IYDB 2WX0A 1E8XA 2D11A 1WZ3A 4GN1A 2A4ZA 2J0JA 1NBFC 3L10B 4I6LB 2PEAA 3MHSD 2A5UA 1KM7A 3WIMA 1WM2A 5JH5C 1UBIA 4KDLB 4HPMB 4W9JA 4A3OA 4MDKE 4RM8A 1UD7A 4MGKE 2DZMA 4BKSD 5EDSA 1KOTA 5CTRC 4DDID 3ML8A 3HM6X 3WAPA 5LXIB 4FADA 4EZKA 3V61A 3L54A 2JZZA 3H6NA 4II3B 5CHVC 4ICUA 3A1QA 1P1AA 4PS7A 2MCNB 3RZFA 4HJKA 4RMAA 2K25A 2NCNA 3ZNZB 2GBMA 2HTHA 4GSWA 3RULA 2AYOB 2WDTB 3QWZB 4IC7B 2KK8A 3WALA 3M3JA 1EUVB 3DVNV 4NNJB 1BT0A 3IVFA 1L7YA 2FCSA 3WA0A 2CS4A 2BGFA 3CSTA 3HM3A 5CHWA 4ZRIA 2XBBC 1H8CA 3KYCD 2R2QA 1P9DU 2WWZA 5JHAA 1S1QB 3T8MA 2EMSA 3KYDD 3W1SA 4HPLB 2GBRA 2V1YA 3OJ4B 2DZIA 2KO3A 3DVGY 3TBLD 2FUHB 4HCNB 1C3TA 4FHKA 2GBKA 4K7SA 4K7WA 1LXDA 1S3SG 3ZTCA 4AOFA 2LGDA 1AARA 5DPTA 4DWFA 3DBRI 2IO1B 3ZO5B 5D94A 1OTRB 4J6IA 2MRPA 3VHTC 1H4RA 2KC2A 4OVVA 2C60A 3H7PA 1R4NI 4G0NB 5BO4B 4IM0A 2I1KA 4NAWB 2CHWA 2J0MA 3KW5B 3SHQA 3NS8A 2IO3B 3NHEB 3ZW3A 2MLBA 3VFKA 2B3AA 4MSMB 3UGBB 3WANA 4EEWA 2MP2B 3A33B 4BBNC 2YLMA 3RD2A 2LD9A 2G45B 4K1RB 2IO0B 4RM9A 1TBEA 4FJYA 3RT3B 3VVWB 5C1ZA 2KWVB 1V81A 1OQYA 2LVPA 1F9JA 2XK5A 1WGYA 3B08A 4MGYE 4PS8A 4DBGA 3PPAA 1V5TA 3CF6E 4JL9A 2RR9A 3M62B 1E8YA 2LJ5A 4KSLC 2IBIB 4GU2A 4ZDVA 5AEKB 2BYFA 3UQBA 4IWQA 2KMAA 3L17A 2EMTA 3H7SA 2BWFA 3BINA 3ZTDA 4M8MA 2LZ6A 4DHZB 3CSFA 4FLHA 1OGWA 4WJPA 4EZJA 2G3QB 2K6QA 1ISNA 2KJHB 3QARA 2N1VA 2DYBA 3TJPA 1ZGUB 4ZYNA 4ICVA 2JUOA 4GMVA 2KNBA 4NY0A 3DPDA 2O6VB 3L0WB 2MBOA 3DBLI 1Q1OA 4YL8A 1U4AA 2KDBA 3QK0A 4WWNA 2Z0DB 4EZLA 2LWPA 1WXAA 2PPHA 4FJVB 2KMCA 3DDCB 1WGHA 1SGHA 2KTRB 4I6PA 1WR6E 4F7ZA 5DCNA 4URKA 2KN5A 3I3TB 3TMPB 2MBEA 2N9EB 2HD5B 2KDFB 2MSED 2L3ZA 4BKSA 2MWSB 3RUIB 2G4SA 3QIJA 3DOWA 4MSQB 1G6JA 2WYQA 1WXMA 3LDZE 2JRHA 1OEYA 1Z2MA 3KUZA 2KWCA 3AXCA 4NAWA 3N30A 2V3SA 4WQOB 5D7GA 2M1MA 3BY4B 3EECA 5LXHA 4TQ1A 4KV2A 4NJ6A 2FAZA 3QA8A 4I6NB 4E71A 2BPSA 4A20A 3V62A 3Q3JA 3R7RA 1Q5WB 2C7HA 2JZ3B 1YIWA 2L0TA 4X57B 3OJ3A 1EO6A 3ZLZA 1WJ6A 4JLCA 4FBJB 3KUDB 1WF9A 3UQAA 4HK2A 5KHQA 2PE9A 3ZNGC 4ZRKA 3SU8X 4BVUC 4TQ0A 1P98A 2LXAA 2PE6B 3HHMA 3AI5A 1LQBA 1RLFA 4XC2A 3KUCB 3N3KB 4W9KA 5E6OA 5IAAC 4BKGA 1GUAB 3QJZA 3SDLC 3ZKJC 3ECIA 2I1JA 3V6EB 3SD5A 3IHPC 3K9PB 4G3XB 3EHVA 4FHJA 1FXTB 4JIOU 4ANVA 2ZPYA 1R4MI 4EFOA 1YX6B 2NS5A 2L76A 3B1LX 4HLEA 4W9FA 4LJPB 1TZ1A 2BKRB 2LVOA 2KTRA 3LJ3A 2M4NA 5DPWA 2ZZPB 4BOSC 4KIKB 3EFUA 5E6NA 2O2VA 2LASA 4DHJD 2DAFA 1RFAA 2PJHA 3APFA 3DVGX 3U7DA 1EF5A 4BOZB 2KDEB 3L16A 5JZEB 1C1YB 3A9JA 2D3GA 3RCZA 3JYUA 2KC1A 5KHOA 4MEMA 3PHXB 1PQSA 4W9HA 3JSVB 3HIZA 2QHOA 2D2QA 4IM2A 2BWES 3A9KB 2RD0A 3PRMB 4MJSB 2O6VD 3DVNU 2KTFA 4FN2A 2NBWB 2YVCA 2NPTB 4IUMB 1GC7A 4LCDE 4CYEA 3QX1A 2KD0A 2DZJA 4CO7A 1WXVA 3O65B 2ZEQA 3GOEA 4W9CA 2XEWA 2Y5BB 4B9KA 5AZHA 4HDOA 4II2B 4HVBA 2BYVE 3PLVA 3QCAA 3DBHI 1A5RA 3Q3FA 1RRBA 4MGZE 2GOWA 1GNUA 2DYOA 1E8ZA 3NOBA 5AZFA 4MELA 1E7VA 4W9GA 3N32A 1QZEA 2L8JA 2DZKA 1YQBA 2M0XA 3VH4B 2Z0EB 3ZUNA 3PT2B 1K8RB 4DHJB 2JY6A 1XQQA 2OOBB 3PV1A 4EUTA 3DQVA 4IWPA 2KDIA 3DCGA 4AJWA 3KH0A 2LI5A 4MM3A 1V80A 1P0RA 1OEYJ 2UWQA 2RGFA 1GC6A 5FR6A 2JWZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4GGQ A;  3RZW C;  4DK5 A;  3T9L A;  1V9J A;  4GDL B;  3R66 C;  4KIK A;  2EKE C;  1NI2 A;  2RPQ A;  3VTW A;  2C5L C;  4GOC A;  3APD A;  2KOX A;  1MG8 A;  4IWO A;  2V4L A;  3V6C B;  2ZNV C;  2CR5 A;  4KZC A;  2NBU A;  1JRU A;  5D2M B;  2K6D B;  3A4R A;  1UZX B;  1J19 A;  2KZR A;  3QHT A;  2JRI B;  4GDK B;  4HXD A;  3PRE A;  4ANW A;  2FNJ B;  2W9N A;  1M94 A;  1E8W A;  1WJU A;  1V5O A;  1WY8 A;  2KKC A;  2MQJ A;  3JSV A;  4GXB A;  1Q0W B;  2AWT A;  1YX5 B;  3A1Q B;  4DHZ E;  5HKH A;  1UBQ A;  4NQK E;  1I42 A;  4WWO A;  5TR5 A;  2K8B A;  4F1S A;  4M0W B;  3R3M A;  3PRZ A;  4PYZ A;  5D6J B;  4PYU A;  3D32 A;  1VD2 A;  2KAN A;  2N9P C;  5AZG A;  2ZNV B;  4N9F 4;  2KX3 A;  3ENE A;  3QAQ A;  4GB9 A;  2L05 A;  2KWU B;  3AUL A;  1WZ0 A;  3AU4 A;  4G50 A;  1WFY A;  1WM3 A;  3DBS A;  1WI0 A;  2KX0 A;  3H1U A;  3V60 A;  1XT9 B;  4HCP B;  2HJ8 A;  2ZPN A;  2IZV B;  3PZD A;  2MP2 A;  4W9L A;  2NR2 A;  2JT4 B;  3ZDM C;  2KJR A;  3U30 A;  3L08 A;  4F8C B;  5G55 A;  1NDD A;  1YJ1 A;  2AL3 A;  3OAW A;  3PSE B;  1J8C A;  4TUU A;  2N7D A;  3QQ8 B;  3IBE A;  1V86 A;  2KFK B;  2GBN A;  4AWJ A;  2DHZ A;  4DDG D;  1ZKH A;  1ZW7 A;  5GMV A;  3UIO B;  4KDI C;  2HE7 A;  2M17 A;  2FCQ A;  2IO2 B;  2KQS A;  2KHW B;  1IPG A;  2GBJ A;  3IG3 A;  3M95 A;  4BKT A;  1WJ4 A;  4ZRJ A;  1SIF A;  4JGH B;  1WGG A;  3H7P B;  3HK0 A;  5G2N A;  3TIX A;  3VUY A;  4K7U A;  4FA6 A;  3PRP B;  4GDL A;  5CX3 A;  3VAW A;  2CHZ A;  2MBH A;  2O6V A;  2ZVO A;  2M8S A;  1T0Y A;  2JPH A;  2MA9 B;  2KXJ A;  4LDT D;  1L2N A;  1E5W A;  3EC8 A;  3P2B A;  4WJN A;  1WGR A;  4IW0 A;  2DX5 B;  2CU1 A;  4MH0 E;  4GDK A;  2NVU I;  2DAJ A;  3TCA A;  3ONS A;  5L95 C;  4XZ4 A;  1WYW B;  2XK5 B;  2JF5 A;  4WJQ A;  1KJT A;  4G11 A;  4BFR A;  5J17 A;  2L0F A;  2L7R A;  3ZRC A;  3NY5 A;  1WMH B;  1UGM A;  3B0A A;  1WX9 A;  3ZIM A;  2L00 B;  2C7M B;  2MX2 A;  1VCB A;  3W1Y A;  3ZNI D;  3U8Z A;  3IFW B;  3UIP B;  4IM3 A;  3L13 A;  2LXC A;  2LGX A;  1YD8 U;  2N1W A;  2N4F A;  3VTV A;  3K9O B;  3VUW A;  5L83 A;  4W9I A;  2G4D B;  2N9X A;  3H9D A;  2D10 A;  4IG7 B;  2KQ7 A;  4JQW C;  3VQI A;  4W9E A;  4W9D A;  2KJ6 A;  1SE9 A;  3PGE A;  3PVL A;  3TL5 A;  3X0W A;  4TKN A;  3VUX A;  2KLC A;  2UYZ B;  2KFK A;  5C23 A;  3JW0 X;  4AUQ C;  1Y8R C;  1WIA A;  2CHX A;  4FUL A;  2J0K A;  3ALB A;  1GG3 A;  1UH6 A;  4KSK C;  3WAM A;  3AU5 A;  3MJW A;  3PLU A;  4LDT B;  4GIV A;  4CHK A;  1WX7 A;  2K8C A;  3QC8 B;  2J7Q B;  2KVR A;  4E3C A;  2LUE A;  5E6P A;  2DEN B;  2BF8 B;  2BYE A;  2ZVN A;  4HDQ A;  2CKH B;  1LFD A;  2REX A;  3CMM B;  3GZN I;  4HWI B;  3UF8 A;  4EKU A;  1RAX A;  4ANX A;  3RYT A;  4WAA A;  4NPN A;  3PHW B;  2FIF A;  2D07 B;  5IA7 A;  1CMX B;  1EF1 A;  1WXS A;  1WH3 A;  1WJN A;  2R2O A;  4K81 A;  4KVG B;  1IYF A;  3NZS A;  2VRR B;  2RSU A;  1XD3 B;  2LRU A;  3APC A;  1I35 A;  2IY0 B;  1V49 A;  2MBB B;  3ZVV A;  1P3Q U;  2ZCC A;  1WR1 A;  1X1M A;  3ML9 A;  3VH3 B;  4A3P A;  2LGY A;  1J0G A;  4OVU A;  2NBV B;  3S2A A;  1WMH A;  2WX1 A;  4LJO B;  4KZ0 A;  4PS3 A;  3UIN B;  3NZU A;  3A4S C;  4P7I A;  2JVC A;  1E7U A;  1UEL A;  2C9W B;  2DYM A;  3A9K A;  4MJS A;  4TV3 A;  5LLI A;  3X23 A;  3VDZ A;  4ANU A;  2K39 A;  1WX8 A;  3WAO A;  3JVZ X;  5J18 A;  2FID A;  2MBQ A;  1V6E A;  2FCN A;  2NPT A;  2OJR A;  3W1S C;  4EOY A;  2LRW A;  1WGD A;  2IY1 B;  1Z5S B;  2AL6 A;  4FJZ A;  4M8N A;  4WJO A;  5JHB A;  1WRD B;  2JXX A;  2ZCB A;  4MGI E;  4XX5 A;  3ZDT A;  4DXA B;  5CHF A;  2K8H A;  2ASQ A;  5DPS A;  3VTU A;  3PS6 A;  2KLG A;  2MW5 A;  4B6W A;  5DPR A;  4BBN F;  3R7Q A;  2O2V B;  3OLM D;  2C7N B;  3ZNH B;  1HE8 A;  1WE6 A;  1WE7 A;  3ZRF A;  4B95 A;  4AP4 C;  2GMI C;  1LM8 B;  2AEH A;  5J2R A;  1GJZ A;  3KVF B;  1IP9 A;  3A9J B;  1E90 A;  4NJ7 A;  2BKF A;  2K1F A;  1TTN A;  3VXW A;  1TGZ B;  2ZJD A;  3PTF C;  4NQL B;  2FCM A;  2LVQ A;  2Z59 B;  4AJY B;  4E74 A;  4WWP A;  1V2Y A;  2KFJ A;  3MTN B;  3C0R B;  3M63 B;  1KLV A;  4ASW C;  2N7E A;  1D3Z A;  2IYD B;  2WX0 A;  1E8X A;  2D11 A;  1WZ3 A;  4GN1 A;  2A4Z A;  2J0J A;  1NBF C;  3L10 B;  4I6L B;  2PEA A;  3MHS D;  2A5U A;  1KM7 A;  3WIM A;  1WM2 A;  5JH5 C;  1UBI A;  4KDL B;  4HPM B;  4W9J A;  4A3O A;  4MDK E;  4RM8 A;  1UD7 A;  4MGK E;  2DZM A;  4BKS D;  5EDS A;  1KOT A;  5CTR C;  4DDI D;  3ML8 A;  3HM6 X;  3WAP A;  5LXI B;  4FAD A;  4EZK A;  3V61 A;  3L54 A;  2JZZ A;  3H6N A;  4II3 B;  5CHV C;  4ICU A;  3A1Q A;  1P1A A;  4PS7 A;  2MCN B;  3RZF A;  4HJK A;  4RMA A;  2K25 A;  2NCN A;  3ZNZ B;  2GBM A;  2HTH A;  4GSW A;  3RUL A;  2AYO B;  2WDT B;  3QWZ B;  4IC7 B;  2KK8 A;  3WAL A;  3M3J A;  1EUV B;  3DVN V;  4NNJ B;  1BT0 A;  3IVF A;  1L7Y A;  2FCS A;  3WA0 A;  2CS4 A;  2BGF A;  3CST A;  3HM3 A;  5CHW A;  4ZRI A;  2XBB C;  1H8C A;  3KYC D;  2R2Q A;  1P9D U;  2WWZ A;  5JHA A;  1S1Q B;  3T8M A;  2EMS A;  3KYD D;  3W1S A;  4HPL B;  2GBR A;  2V1Y A;  3OJ4 B;  2DZI A;  2KO3 A;  3DVG Y;  3TBL D;  2FUH B;  4HCN B;  1C3T A;  4FHK A;  2GBK A;  4K7S A;  4K7W A;  1LXD A;  1S3S G;  3ZTC A;  4AOF A;  2LGD A;  1AAR A;  5DPT A;  4DWF A;  3DBR I;  2IO1 B;  3ZO5 B;  5D94 A;  1OTR B;  4J6I A;  2MRP A;  3VHT C;  1H4R A;  2KC2 A;  4OVV A;  2C60 A;  3H7P A;  1R4N I;  4G0N B;  5BO4 B;  4IM0 A;  2I1K A;  4NAW B;  2CHW A;  2J0M A;  3KW5 B;  3SHQ A;  3NS8 A;  2IO3 B;  3NHE B;  3ZW3 A;  2MLB A;  3VFK A;  2B3A A;  4MSM B;  3UGB B;  3WAN A;  4EEW A;  2MP2 B;  3A33 B;  4BBN C;  2YLM A;  3RD2 A;  2LD9 A;  2G45 B;  4K1R B;  2IO0 B;  4RM9 A;  1TBE A;  4FJY A;  3RT3 B;  3VVW B;  5C1Z A;  2KWV B;  1V81 A;  1OQY A;  2LVP A;  1F9J A;  2XK5 A;  1WGY A;  3B08 A;  4MGY E;  4PS8 A;  4DBG A;  3PPA A;  1V5T A;  3CF6 E;  4JL9 A;  2RR9 A;  3M62 B;  1E8Y A;  2LJ5 A;  4KSL C;  2IBI B;  4GU2 A;  4ZDV A;  5AEK B;  2BYF A;  3UQB A;  4IWQ A;  2KMA A;  3L17 A;  2EMT A;  3H7S A;  2BWF A;  3BIN A;  3ZTD A;  4M8M A;  2LZ6 A;  4DHZ B;  3CSF A;  4FLH A;  1OGW A;  4WJP A;  4EZJ A;  2G3Q B;  2K6Q A;  1ISN A;  2KJH B;  3QAR A;  2N1V A;  2DYB A;  3TJP A;  1ZGU B;  4ZYN A;  4ICV A;  2JUO A;  4GMV A;  2KNB A;  4NY0 A;  3DPD A;  2O6V B;  3L0W B;  2MBO A;  3DBL I;  1Q1O A;  4YL8 A;  1U4A A;  2KDB A;  3QK0 A;  4WWN A;  2Z0D B;  4EZL A;  2LWP A;  1WXA A;  2PPH A;  4FJV B;  2KMC A;  3DDC B;  1WGH A;  1SGH A;  2KTR B;  4I6P A;  1WR6 E;  4F7Z A;  5DCN A;  4URK A;  2KN5 A;  3I3T B;  3TMP B;  2MBE A;  2N9E B;  2HD5 B;  2KDF B;  2MSE D;  2L3Z A;  4BKS A;  2MWS B;  3RUI B;  2G4S A;  3QIJ A;  3DOW A;  4MSQ B;  1G6J A;  2WYQ A;  1WXM A;  3LDZ E;  2JRH A;  1OEY A;  1Z2M A;  3KUZ A;  2KWC A;  3AXC A;  4NAW A;  3N30 A;  2V3S A;  4WQO B;  5D7G A;  2M1M A;  3BY4 B;  3EEC A;  5LXH A;  4TQ1 A;  4KV2 A;  4NJ6 A;  2FAZ A;  3QA8 A;  4I6N B;  4E71 A;  2BPS A;  4A20 A;  3V62 A;  3Q3J A;  3R7R A;  1Q5W B;  2C7H A;  2JZ3 B;  1YIW A;  2L0T A;  4X57 B;  3OJ3 A;  1EO6 A;  3ZLZ A;  1WJ6 A;  4JLC A;  4FBJ B;  3KUD B;  1WF9 A;  3UQA A;  4HK2 A;  5KHQ A;  2PE9 A;  3ZNG C;  4ZRK A;  3SU8 X;  4BVU C;  4TQ0 A;  1P98 A;  2LXA A;  2PE6 B;  3HHM A;  3AI5 A;  1LQB A;  1RLF A;  4XC2 A;  3KUC B;  3N3K B;  4W9K A;  5E6O A;  5IAA C;  4BKG A;  1GUA B;  3QJZ A;  3SDL C;  3ZKJ C;  3ECI A;  2I1J A;  3V6E B;  3SD5 A;  3IHP C;  3K9P B;  4G3X B;  3EHV A;  4FHJ A;  1FXT B;  4JIO U;  4ANV A;  2ZPY A;  1R4M I;  4EFO A;  1YX6 B;  2NS5 A;  2L76 A;  3B1L X;  4HLE A;  4W9F A;  4LJP B;  1TZ1 A;  2BKR B;  2LVO A;  2KTR A;  3LJ3 A;  2M4N A;  5DPW A;  2ZZP B;  4BOS C;  4KIK B;  3EFU A;  5E6N A;  2O2V A;  2LAS A;  4DHJ D;  2DAF A;  1RFA A;  2PJH A;  3APF A;  3DVG X;  3U7D A;  1EF5 A;  4BOZ B;  2KDE B;  3L16 A;  5JZE B;  1C1Y B;  3A9J A;  2D3G A;  3RCZ A;  3JYU A;  2KC1 A;  5KHO A;  4MEM A;  3PHX B;  1PQS A;  4W9H A;  3JSV B;  3HIZ A;  2QHO A;  2D2Q A;  4IM2 A;  2BWE S;  3A9K B;  2RD0 A;  3PRM B;  4MJS B;  2O6V D;  3DVN U;  2KTF A;  4FN2 A;  2NBW B;  2YVC A;  2NPT B;  4IUM B;  1GC7 A;  4LCD E;  4CYE A;  3QX1 A;  2KD0 A;  2DZJ A;  4CO7 A;  1WXV A;  3O65 B;  2ZEQ A;  3GOE A;  4W9C A;  2XEW A;  2Y5B B;  4B9K A;  5AZH A;  4HDO A;  4II2 B;  4HVB A;  2BYV E;  3PLV A;  3QCA A;  3DBH I;  1A5R A;  3Q3F A;  1RRB A;  4MGZ E;  2GOW A;  1GNU A;  2DYO A;  1E8Z A;  3NOB A;  5AZF A;  4MEL A;  1E7V A;  4W9G A;  3N32 A;  1QZE A;  2L8J A;  2DZK A;  1YQB A;  2M0X A;  3VH4 B;  2Z0E B;  3ZUN A;  3PT2 B;  1K8R B;  4DHJ B;  2JY6 A;  1XQQ A;  2OOB B;  3PV1 A;  4EUT A;  3DQV A;  4IWP A;  2KDI A;  3DCG A;  4AJW A;  3KH0 A;  2LI5 A;  4MM3 A;  1V80 A;  1P0R A;  1OEY J;  2UWQ A;  2RGF A;  1GC6 A;  5FR6 A;  2JWZ A; 
#chains in the Genus database with same CATH topology
 4GGQ A;  3Q14 C;  1V9J A;  1NI2 A;  1PGA A;  2C5L C;  5C3J B;  1MG8 A;  4IWO A;  3NRZ A;  1UZX B;  1J19 A;  2JRI B;  4ANW A;  1E8W A;  2AQ1 B;  1I42 A;  4DHZ E;  5HKH A;  1TS3 A;  4WWO A;  3HUI A;  1VD2 A;  3N9Y C;  3VR9 B;  2N9P C;  2KX3 A;  3QAQ A;  4GB9 A;  2L05 A;  2KWU B;  3DBS A;  1XT9 B;  2IZV B;  2MP2 A;  3ZDM C;  2JT4 B;  4WIP A;  3OAW A;  1J8C A;  1ZDV A;  4AWJ A;  3GS2 A;  4L23 A;  2D3C A;  2GB1 A;  1MJD A;  2HE7 A;  2FCQ A;  4OZC A;  1VRA B;  2KHW B;  2LHE A;  5FK9 C;  1SIF A;  2JX5 A;  2FBW B;  1JRP A;  4FA6 A;  3PRP B;  5CX3 A;  3VAW A;  2O6V A;  1T0Y A;  2MA9 B;  3U52 E;  1L2N A;  4WJN A;  4IW0 A;  1PDX A;  2WHI A;  3FAH A;  3DBL B;  1UUP A;  1VDV A;  4CQN A;  2M0A A;  2DAJ A;  1TZO A;  1WYW B;  2V3N A;  2JF5 A;  2LJI A;  5HI1 A;  4C80 A;  2L7R A;  3ZRC A;  2K5P A;  2DNF A;  3B0A A;  3ZIM A;  2EKI A;  1VCB A;  3LYY A;  3U8Z A;  2LGX A;  3K9O B;  4N58 A;  1VZ8 A;  2N9X A;  2D3B A;  1I4H A;  3VQI A;  4W9D A;  3W5U B;  2KJ6 A;  1SE9 A;  5I4D A;  2WXF A;  4YWG G;  2UYZ B;  2V9H A;  5C23 A;  1AW7 A;  2V4I B;  1WIA A;  2J0K A;  1NI3 A;  2OED A;  3WAM A;  3VRB B;  3PLU A;  2PW9 A;  2KVR A;  5T8I A;  2BF8 B;  4LTU A;  3MP9 A;  4HDQ A;  2CKH B;  2REX A;  4EKU A;  5IA7 A;  1XCT L;  2JU6 X;  2IY0 B;  1V49 A;  3TUO A;  2VZK B;  2X38 A;  1P3Q U;  2IGH A;  2LGY A;  1NVI D;  4OVU A;  1FFU A;  1E7U A;  4TV3 A;  4MJS A;  4ANU A;  3Q69 A;  3X23 A;  3OWE B;  1SE4 A;  2QSD A;  2MBQ A;  2OJR A;  1WGD A;  4FJZ A;  2WXL A;  5JHB A;  1WRD B;  1N6Z A;  4MGI E;  3ZDT A;  3P63 A;  3VTU A;  3PS6 A;  2FE8 A;  1N5X A;  4KKJ A;  2W3R A;  1WE6 A;  1WE7 A;  2AEH A;  5J2R A;  1JML A;  2BS3 B;  3KVF B;  3DBH B;  1E90 A;  4NJ7 A;  3VXW A;  2ZJD A;  3RNE C;  4E74 A;  2KFJ A;  3C0R B;  3MC8 A;  2L32 A;  1E8X A;  2D11 A;  3L10 B;  2A5U A;  1NYQ A;  4W9J A;  4MDK E;  5CTR C;  4DDI D;  2AX5 A;  3HM6 X;  3WAP A;  5LXI B;  3H6N A;  5CHV C;  1P1A A;  4HJK A;  1OQQ A;  2HTH A;  2AYO B;  4IC7 B;  3IT4 B;  3KWL A;  1ZDX A;  3IVF A;  2N9L A;  1L7Y A;  4HVB A;  4LNN A;  5BMG A;  3CST A;  3HM3 A;  4WWM A;  2XBB C;  3AV8 A;  1XLN A;  1JWA D;  5TSS A;  1B1Z A;  4R3D A;  4HPL B;  1RWS A;  4ZOH C;  4FHK A;  4K7S A;  3ZTC A;  1S3S G;  2ZW1 A;  2LGD A;  1AAR A;  3Q2A C;  1FNV A;  1F77 A;  5HFY A;  2WDQ B;  1TKG A;  4J6I A;  2MRP A;  1HZ6 A;  4OVV A;  2PIA A;  2CHW A;  1E10 A;  3KW5 B;  3NS8 A;  3NHE B;  3ZW3 A;  4YTM B;  3A33 B;  1K52 A;  2YLM A;  3RD2 A;  3VVW B;  4FJY A;  2LVP A;  4A55 A;  4DBG A;  3OG5 A;  4JL9 A;  3M62 B;  1E8Y A;  2LJ5 A;  4ZDV A;  5AEK B;  2BYF A;  4WH4 A;  3C8Y A;  3L4P A;  3UQB A;  3L17 A;  2KMM A;  3ZTD A;  4DHZ B;  3CSF A;  4FLH A;  4RGT A;  4WJP A;  2K6Q A;  2KJH B;  1QIL A;  3QAR A;  2N1V A;  1QF6 A;  4NY0 A;  3DPD A;  2VH2 A;  1ET6 A;  2JXT A;  1K53 A;  3I63 C;  1U4A A;  3QK0 A;  3NVV A;  2LWP A;  3DDC B;  2YEP B;  1SGH A;  2KTR B;  1WR6 E;  5DCN A;  2KN5 A;  2WXI A;  4RGO S;  2N9E B;  2HD5 B;  3RI7 C;  2G9H D;  3BYY B;  2MSE D;  3IXS A;  2G4S A;  3QIJ A;  3RNG C;  2WYQ A;  3LDZ E;  3KUZ A;  3Q3O C;  1DOX A;  1UGJ A;  3ZGZ A;  3EEC A;  4TQ1 A;  2BPS A;  1XLQ A;  2HTM E;  4JWS C;  2ACZ B;  2FUG 1;  2L0T A;  2Q5W D;  3AM9 A;  4HK2 A;  2PE9 A;  4BVU C;  4ZRK A;  3SU8 X;  4TQ0 A;  2LXA A;  2WP9 B;  1LQB A;  1RLF A;  4NJC A;  3KUC B;  4XC2 A;  5BYR A;  2Y5P A;  5AUI A;  5E6O A;  3DWM A;  3SDL C;  3SD5 A;  3IHP C;  4FHJ A;  3FKY A;  4JIO U;  2ZPY A;  4EFO A;  2NS5 A;  1TKE A;  4MM3 B;  3B1L X;  2LVO A;  1I7H A;  2WS3 B;  2M4N A;  1YN5 A;  1VJK A;  4TSS A;  2KDE B;  1TS4 A;  2D3G A;  2PVO D;  4MEM A;  1PQS A;  3U4E G;  1FD6 A;  4IM2 A;  2O6V D;  4RFB A;  2NPT B;  4LCD E;  4RH6 A;  3V3X A;  3ETR A;  3QX1 A;  2KD0 A;  1V1P B;  2XEW A;  3I9V 1;  4II2 B;  2KN4 A;  4P16 A;  3AE4 B;  3GE8 C;  1A5R A;  2WXJ A;  4MGZ E;  1D5Z C;  2J53 A;  1HZ5 A;  5AZF A;  2QCZ A;  2L8J A;  2DZK A;  1YQB A;  2M0X A;  3VH4 B;  2Z0E B;  1R7S A;  2WXO A;  1K8R B;  3PT2 B;  2JY6 A;  4JX1 C;  1QOB A;  3DQV A;  2KDI A;  4P1C C;  1GB4 A;  2UWQ A;  1GC6 A;  4E3C A;  4DK5 A;  4MH8 A;  5G5G A;  4KIK A;  4GOC A;  3SFD B;  2G1E A;  3APD A;  3W9C B;  2KOX A;  3V6C B;  2K6D B;  4REZ A;  4ZRP A;  3JSV A;  4A90 A;  2E3T A;  2KKC A;  2K22 A;  1YX5 B;  2K3U A;  2ICI A;  2K8B A;  3B2G A;  3KWV A;  5D6J B;  4PYZ A;  3D32 A;  5AZG A;  2ZNV B;  1JCK B;  3AUL A;  1L0V B;  5JXV A;  1WFY A;  1WI0 A;  3Q8A A;  3PZD A;  2WGS A;  4F8C B;  5G55 A;  3E56 A;  1YJ1 A;  2AL3 A;  1FPY A;  1PGB A;  2N7D A;  1V86 A;  1EU4 A;  4DDG D;  1IGD A;  5GMV A;  4KDI C;  1SBB B;  2KQS A;  1VZ7 A;  4BKT A;  2WQY B;  1L4D B;  1WGG A;  3H7P B;  3VUY A;  3VRA B;  3Q8B A;  4GDL A;  2RDB C;  2ZVO A;  4P6V F;  3TEW A;  2KXJ A;  4LDT D;  3EC8 A;  3P2B A;  1DOY A;  2DX5 B;  1TJE A;  3B9J A;  2CU1 A;  4MH0 E;  4AQ7 A;  2NVU I;  2KT7 A;  3ZQ4 A;  3ZJT A;  4G11 A;  2L0F A;  4KKI A;  1MPE A;  3NY5 A;  1UGM A;  3KLS X;  1WX9 A;  2L00 B;  1C9F A;  2BB6 A;  1ZE3 D;  4IM3 A;  2LXC A;  1YD8 U;  3VTV A;  1JWS D;  4W9I A;  1UNS A;  1N61 A;  2G4D B;  3AEC B;  2D10 A;  1FRR A;  4W9E A;  3PGE A;  3PVL A;  3TL5 A;  3X0W A;  3VUX A;  4AUQ C;  4FUL A;  1LGR A;  4KSK C;  1BXT A;  2RMM A;  3AU5 A;  3MJW A;  4LDT B;  2NTS A;  1WX7 A;  2K8C A;  4N6E B;  4C56 C;  3QC8 B;  1N5W A;  2LUE A;  5E6P A;  1DYQ A;  2BYE A;  3V05 A;  1LFD A;  4HKZ E;  3CMM B;  4RF1 A;  2GRI A;  1L0Y B;  4XWW A;  4WAA A;  4NPN A;  1SE3 A;  1EF1 A;  4O1N A;  4K81 A;  1IYF A;  5C2T B;  1I35 A;  1X1M A;  3ML9 A;  1WMH A;  4KZ0 A;  4PS3 A;  2JVC A;  3IAM 1;  5FKA C;  2K39 A;  3JVZ X;  2PTL A;  2NPT A;  4EOY A;  3W1S C;  2LRW A;  4B0E A;  4M8N A;  4XX5 A;  2K8H A;  1FCC C;  1V1P A;  1GB1 A;  3ZXV A;  2KLG A;  2MW5 A;  4B6W A;  3R7Q A;  4A6Q A;  2BW2 A;  3EUB 2;  2JYT A;  1HE8 A;  1N60 A;  4B95 A;  4BZA A;  3NVY A;  2GMI C;  1LM8 B;  1YMH E;  4IOI E;  1IP9 A;  3A9J B;  4ACF A;  1TTN A;  3PTF C;  2LVQ A;  4AJY B;  1E0Z A;  4WWP A;  3SR6 A;  3MTN B;  1FMA D;  3AED B;  3M63 B;  3P1M A;  4ASW C;  1D3Z A;  2WX0 A;  2J0J A;  4I6L B;  2PEA A;  1UWM A;  1KM7 A;  3WIM A;  1ROE A;  5E6J A;  1QKZ A;  1UD7 A;  4MGK E;  1V1O A;  2DZM A;  2QEJ C;  4YTN B;  4EZK A;  4ICU A;  4DXG A;  2MCN B;  1IGC A;  4IKG A;  1OFF A;  2AQ3 B;  3ZNZ B;  5D3D A;  3BVG A;  2MJ3 A;  2WDT B;  4ZRQ A;  2KK8 A;  3WAL A;  3M3J A;  1EUV B;  2LEK A;  5BYS A;  4NNJ B;  1GAQ B;  1BT0 A;  1VR9 A;  5FR3 A;  4KGT A;  3MFG A;  2FCS A;  1H8C A;  2VZK D;  2R2Q A;  1SSN A;  5JHA A;  3PO0 A;  4XGA B;  2EMS A;  2NTT A;  3OJ4 B;  1F2R I;  2WDR B;  2FUH B;  1YN3 A;  3RN9 C;  4D2K A;  4DWF A;  1C79 A;  3DBR I;  1C4C A;  3ZO5 B;  1JRO A;  2QIL A;  1BML C;  5D94 A;  1OTR B;  1ESF A;  3VHT C;  1H4R A;  1RFK A;  3N1X C;  2C60 A;  3FIL A;  3H7P A;  1R4N I;  4G0N B;  4LK0 M;  3RNF C;  1MHH E;  2INN E;  2B3A A;  4EEW A;  1TS5 A;  4BBN C;  2G45 B;  2LD9 A;  4K1R B;  1OQY A;  1F9J A;  4MGY E;  4PS8 A;  3PPA A;  2LGS A;  3CF6 E;  3P4R B;  4IWQ A;  1E7P B;  2EMT A;  3H7S A;  2INP E;  1L4Z B;  2LZ6 A;  1OGW A;  2JUO A;  2QJL A;  4GMV A;  3BK2 A;  2BVC A;  2MBO A;  5GXG B;  3HRD D;  4YSZ B;  3DHH C;  2Z0D B;  1HQR D;  4EZL A;  2KMC A;  1T3Q A;  2KAC A;  3Q8E A;  4URK A;  3TMP B;  3I3T B;  2KDF B;  4BKS A;  3U2S C;  4MSQ B;  1G6J A;  3TEZ A;  1WXM A;  2JRH A;  2JSV X;  1Z2M A;  2KWC A;  2V3S A;  4UDU C;  5D7G A;  2M1M A;  3BY4 B;  4KV2 A;  2YEP F;  4NJ6 A;  3WCQ A;  4XE0 A;  1N62 A;  3V62 A;  1M4V A;  3Q3J A;  3R7R A;  4OZA A;  1YIW A;  4DQO C;  2K0P A;  3ZLZ A;  1WJ6 A;  3KUD B;  1SIJ A;  5KHQ A;  3N20 C;  2PKO A;  1D6E C;  3HHM A;  3AI5 A;  4W9K A;  4BKG A;  1GUA B;  3QJZ A;  1F52 A;  1C4A A;  1FFV A;  3K9P B;  3R8B A;  3FC4 A;  4G3X B;  4ARC A;  1R4M I;  4ZYS A;  3ZJU A;  1VZ6 A;  1TY2 A;  2GI9 A;  4JWU C;  2L76 A;  2J4X A;  4RCO A;  4LJP B;  1L6U A;  3LJ3 A;  3ZJV A;  5DPW A;  4KIK B;  1D5X C;  2DAF A;  1RFA A;  2PJH A;  1WWT A;  4BOZ B;  1L0X B;  3A9J A;  3J9C A;  3AB5 A;  3JSV B;  2D2Q A;  3A9K B;  2RD0 A;  3EFC A;  2KTF A;  4FN2 A;  2NBW B;  2YVC A;  4IUM B;  4CYE A;  1T0Q C;  3O65 B;  3GOE A;  4W9C A;  4P1B C;  1FRD A;  3URY A;  1GNU A;  2DYO A;  2W82 A;  2IJ0 A;  3TEY A;  1YJJ A;  3HVZ A;  1XF5 L;  5LNK 1;  4JE3 B;  1KFY B;  5H8Y E;  3ZUN A;  4IWP A;  2IND C;  4AJW A;  3KH0 A;  1V80 A;  5FR6 A;  2JWZ A;  1I4R A;  3T9L A;  4GDL B;  2RPQ A;  3VTW A;  3IT6 B;  2BBC A;  2V4L A;  2JZP A;  4OZB A;  2CR5 A;  2NBU A;  3AN1 A;  1QLB B;  2KZR A;  3QHT A;  4LLG M;  1EWY C;  2FNJ B;  1M94 A;  1WJU A;  1V5O A;  1ZP0 B;  4GXB A;  1Q0W B;  2DBY A;  4S0R A;  3A1Q B;  1CZP A;  2PLP A;  4XYC A;  1BUI C;  4F1S A;  4M0W B;  3R3M A;  3DBR B;  4PYU A;  2KAN A;  4N9F 4;  3ENE A;  3P4S B;  3C19 A;  1WZ0 A;  5BMH A;  4G50 A;  1WM3 A;  2KX0 A;  4NZL B;  3H1U A;  3V60 A;  1R4N B;  4HCP B;  1QT9 A;  3PZ8 A;  4W9L A;  2RDH A;  1ZPS A;  2KJR A;  3U30 A;  4KGS A;  4TUU A;  1P7F A;  1XLP A;  3NVW A;  3N1Z C;  2WU2 B;  3UIO B;  2M17 A;  2GBJ A;  5G5H A;  1Y56 A;  1WJ4 A;  1KH0 A;  4ZRJ A;  3TIX A;  1ZXI A;  5G2N A;  4K7U A;  1UWX A;  2CHZ A;  1YQ4 B;  3H8H A;  2JPH A;  2IGD A;  1EU3 A;  1E5W A;  1WGR A;  4WAF A;  3HVD A;  4GDK A;  4C00 A;  3TCA A;  3ONS A;  5L95 C;  4XZ4 A;  2XK5 B;  4WJQ A;  4LNF A;  1KJT A;  5J17 A;  2BQQ A;  1CQV A;  3NS1 A;  1WMH B;  2XN9 C;  5IN7 A;  1QOA A;  2MX2 A;  1FNW A;  2TSS A;  3IFW B;  3UIP B;  3L13 A;  2N0S B;  1EM7 A;  1HXY D;  3VUW A;  5L83 A;  2CJN A;  4IG7 B;  2MHJ A;  5HHD G;  4JQW C;  2VH1 A;  2KDM A;  2KLC A;  2KFK A;  3JW0 X;  2BYT A;  1I4X A;  3ALB A;  2SEB D;  1UH6 A;  4CHK A;  2J7Q B;  2DEN B;  2ZVN A;  2WNM A;  4HWI B;  1TIF A;  2NMQ A;  3RYT A;  2WXM A;  1XLO A;  2DLB A;  2FIF A;  3ZXR A;  1WXS A;  2V3P A;  1WJN A;  4KVG B;  3NZS A;  1PGX A;  1R4M B;  2L83 A;  2ON8 A;  2RSU A;  1XD3 B;  2LRU A;  5IKC M;  2MBB B;  1C77 A;  2RDG A;  3ZVV A;  4HRO A;  3AEA B;  1J0G A;  3S2A A;  1F1H A;  2WX1 A;  3UIN B;  2L1A A;  1HEZ E;  1T0S C;  1UEL A;  3A9K A;  2DYM A;  3VDZ A;  1WX8 A;  5J18 A;  1IUE A;  2FCN A;  4NAM A;  2IY1 B;  5BYQ A;  2AL6 A;  4WJO A;  2JXX A;  1FXA A;  2EEL A;  4LNK A;  4M01 A;  4DXA B;  5CHF A;  5DPS A;  3RMK C;  1ET9 A;  2W54 A;  1NEK B;  3OLM D;  2C7N B;  3ZRF A;  4HRS A;  4AP4 C;  1CK1 A;  2WXN A;  2BKF A;  4NQL B;  2FCM A;  2Z59 B;  2LMC A;  3AEF B;  1KLV A;  1JWM D;  2N7E A;  1RM6 C;  3FIL B;  1EWC A;  2D3A A;  2IGG A;  1WM2 A;  1UBI A;  4KDL B;  4HPM B;  1KLU D;  2MJE A;  4BKS D;  1KOT A;  4ARI A;  3ML8 A;  4FAD A;  3V61 A;  4II3 B;  2JZZ A;  4US8 A;  3A1Q A;  4PS7 A;  4M0W A;  4RMA A;  4GSW A;  3RUL A;  3QWZ B;  1N63 A;  4KGR A;  1YJI A;  4L1B A;  1L5P A;  4US9 A;  3WA0 A;  2CS4 A;  2BGF A;  4PK1 A;  3EGR A;  3SEB A;  3W1S A;  4HPP A;  2DZI A;  5BMI A;  3DVG Y;  4RNA A;  3TBL D;  4HCN B;  2D5G A;  2GBK A;  4K7W A;  1LXD A;  3GB1 A;  4S17 A;  4J3O D;  3Q8C A;  2KC2 A;  1MI0 A;  3P42 A;  1YQ3 B;  1TS2 A;  3AEB B;  4IM0 A;  2J0M A;  3AH7 A;  1AWD A;  1UF0 A;  2IO3 B;  2WXQ A;  2MLB A;  4USA A;  3VFK A;  4MSM B;  3WAN A;  2IO0 B;  1NYR A;  4RM9 A;  1TBE A;  3RT3 B;  5C1Z A;  1V81 A;  3GE3 C;  2J42 A;  2XK5 A;  1WGY A;  3B08 A;  4YXD B;  1NEN B;  2CJO A;  2WU5 B;  3BIN A;  1FCL A;  2G3Q B;  3TJP A;  2DYB A;  1ZOY B;  4ICV A;  2KNB A;  3NVZ A;  2H88 B;  4YL8 A;  1A70 A;  2KDB A;  4L2Y A;  4M00 A;  2PPH A;  1WGK A;  4FJV B;  1C76 A;  5D3I B;  4I6P A;  4JPS A;  2JWU A;  4F7Z A;  2MBE A;  3U7Z A;  2MWS B;  5IO9 A;  2N7J A;  3AE3 B;  3PZ7 A;  2BS2 B;  4NAW A;  3N30 A;  4GLS C;  4WQO B;  2PMV A;  1OQR A;  5EE1 A;  4I6N B;  2ZW0 A;  3N1Y C;  4QAY A;  2XNA C;  2C7H A;  1MG4 A;  2JZ3 B;  1CJE A;  3OJ3 A;  3R2T A;  4N59 A;  4JLC A;  1PYW D;  1FXI A;  3ZNG C;  3NG0 A;  1P98 A;  2PE6 B;  1Q10 A;  3AE5 B;  3EA6 A;  5IAA C;  3ZKJ C;  2I1J A;  3V6E B;  3Q3M C;  3UI3 A;  2H89 B;  1FXT B;  3BVM A;  4ZHO A;  3P4P B;  2W3S A;  4HLE A;  1PFD A;  1FO4 A;  1D4B A;  3ABV B;  1ACC A;  1TZ1 A;  3T3N A;  2ONQ A;  2ZZP B;  1XCQ L;  3IAS 1;  2LAS A;  3DVG X;  3APF A;  3U7D A;  3AE7 B;  4WUR A;  1JQ4 A;  2HDE A;  5JZE B;  3RCZ A;  3MC0 B;  2KC1 A;  1FNU A;  3PHX B;  1TT5 B;  4W9H A;  4AS1 A;  1QOF A;  4XDC A;  3HIZ A;  2BWE S;  3PRM B;  3I5J C;  3W2D A;  4OHJ A;  1GC7 A;  2DZJ A;  1WXV A;  4C7Z A;  1IBX A;  2Y5B B;  1FIQ A;  2CU3 A;  5AZH A;  4HDO A;  2WDV B;  2LFI A;  3Q3F A;  1RRB A;  2WXR A;  2GOW A;  2MH7 A;  1E8Z A;  3RFZ B;  4MEL A;  1E7V A;  3DWG C;  4W9G A;  2OOB B;  2Z8L A;  3PV1 A;  1QQR A;  3CWI A;  3RZW C;  3R66 C;  4YSY B;  2EKE C;  4DXF A;  2ZNV C;  4KZC A;  1K50 A;  1JRU A;  5D2M B;  3A4R A;  4GDK B;  4HXD A;  2KAJ A;  3PRE A;  2W9N A;  4LNO A;  3RPF C;  1WY8 A;  2MQJ A;  3MJ5 A;  1V97 A;  1HTO A;  2AWT A;  5IP4 D;  3RNA C;  1UBQ A;  1KF6 B;  4NQK E;  5TR5 A;  3PRZ A;  1GPX A;  3AU4 A;  4H2A A;  3DHI C;  4MT5 A;  2HJ8 A;  2OHF A;  2ZPN A;  2JQR B;  3RNB C;  2NR2 A;  2JYE A;  2WXG A;  1T0R C;  3L08 A;  1NDD A;  3PSE B;  1P7E A;  1LO5 D;  3QQ8 B;  3IBE A;  3LB8 C;  2KFK B;  1F2R C;  2GLS A;  2GBN A;  2DHZ A;  4BAX A;  3BWU D;  1ZKH A;  1ZW7 A;  2IO2 B;  1IPG A;  3BZD B;  3IG3 A;  1KLG D;  4PT5 A;  3M95 A;  4HKQ A;  2WXP A;  4JGH B;  3HK0 A;  3P4Q B;  2MBH A;  2M8S A;  1YN4 A;  2QDF A;  2KWD A;  3RNC C;  3AE2 B;  2QC8 A;  1YNT E;  1D5M C;  4BFR A;  3R2I A;  2E6X A;  1JW9 D;  2C7M B;  3W1Y A;  3ZNI D;  4HEA 1;  4XDD A;  1WYG A;  2N1W A;  2N4F A;  1C4P A;  2BB5 A;  3E9S A;  2DWQ A;  3GP7 A;  3H9D A;  2KQ7 A;  2IDY A;  4TKN A;  1Y8R C;  4A9A A;  2CHX A;  3I57 A;  1GG3 A;  4GIV A;  1KRH A;  1MHX A;  4FXC A;  3Q6B A;  5EE3 A;  3GZN I;  3UF8 A;  1RAX A;  3LXF A;  4ANX A;  1ZUD 2;  3AMZ A;  3PHW B;  2D07 B;  2M56 B;  1CMX B;  1WH3 A;  2R2O A;  1SJE D;  2VRR B;  3APC A;  1FM0 D;  2ZCC A;  1WR1 A;  2I38 A;  3BII D;  3VH3 B;  1C78 A;  4A3P A;  2NBV B;  4K3B A;  4LJO B;  3NZU A;  1TYG B;  3A4S C;  4P7I A;  2C9W B;  1KTK A;  5LLI A;  1K51 A;  3WAO A;  1WSP A;  2FID A;  1V6E A;  3TSS A;  4OW0 A;  5MPO A;  4B0M A;  1Z5S B;  1TY0 A;  2ZCB A;  1SXT A;  5HG2 A;  2ASQ A;  2HJ1 A;  1F0Z A;  5DPR A;  4BBN F;  1E9M A;  2O2V B;  4K3C A;  2M19 A;  2INC C;  3CIR B;  3ZNH B;  2WXH A;  1GJZ A;  2OJW A;  2K1F A;  1TGZ B;  1V2Y A;  5H92 C;  2KYW A;  2RPV A;  2IYD B;  1WZ3 A;  4GN1 A;  2A4Z A;  1NBF C;  3MHS D;  5JH5 C;  2QMT A;  4A3O A;  4RM8 A;  2Y5C A;  5EDS A;  2W55 A;  1YOV B;  3L54 A;  3RZF A;  1AN8 A;  2BS4 B;  2K25 A;  2NCN A;  3TEX A;  2GBM A;  4Q2J A;  2BT6 A;  3DVN V;  1SB3 C;  1XEE A;  4C4V B;  5CHW A;  4ZRI A;  4KX6 B;  3KYC D;  2WWZ A;  1P9D U;  1S1Q B;  3AE6 B;  5EE9 A;  3T8M A;  1TKY A;  3KYD D;  3DHG C;  2GBR A;  2V1Y A;  2KO3 A;  1J7A A;  1FEH A;  4ITK A;  1C3T A;  4AOF A;  4YT0 B;  5DPT A;  1J7B A;  1B9R A;  2R61 A;  2IO1 B;  1SE2 A;  1JAL A;  1STE A;  3AE9 B;  3NJT A;  4M02 A;  4YSX B;  5BO4 B;  2I1K A;  4NAW B;  1PUT A;  3Q3N C;  3SHQ A;  4ZHP A;  2KQ4 X;  3UGB B;  2MP2 B;  4RGM A;  1AYF A;  2N9K A;  2KWV B;  4MAC A;  3MHZ A;  3B2F A;  4YTP B;  1QOG A;  1V5T A;  2RR9 A;  4KSL C;  2IBI B;  2LGI A;  1T6B X;  4GU2 A;  2PVG C;  2KMA A;  3BK1 A;  2MEK A;  2BWF A;  4M8M A;  4EZJ A;  2BTE A;  1ISN A;  1V8C A;  1I4P A;  1ZGU B;  2MJD A;  4ZYN A;  1T5X D;  3L0W B;  2O6V B;  3NUH B;  3DBL I;  1SEB D;  1Q1O A;  4HJG E;  4A8X C;  4WWN A;  1WXA A;  1WGH A;  2LHD A;  2QIE B;  4OVZ A;  1HA5 A;  2L3Z A;  3RUI B;  3DOW A;  3VR8 B;  3KQ4 A;  1OEY A;  3AEE B;  4IDI A;  3AXC A;  3MC9 A;  4TMA B;  5LXH A;  2FAZ A;  1E6E B;  3QA8 A;  1WXQ A;  4E71 A;  3GZN B;  4A20 A;  3W5V B;  4EE2 A;  1Q5W B;  1DGJ A;  4RGN A;  4X57 B;  1EO6 A;  1L6V A;  5AUK A;  4FBJ B;  3UQA A;  1WF9 A;  1IBX B;  1ZXH A;  5EE0 A;  3AE8 B;  2L52 A;  2K9X A;  3N3K B;  3ECI A;  2Y3A A;  3EHV A;  2I2Y A;  4ANV A;  1YX6 B;  4WQM A;  1DOI A;  1RYJ A;  4W9F A;  4LNI A;  2BKR B;  2V0G A;  2KTR A;  1SF0 A;  1JWU D;  3SFE B;  1I4G A;  4BOS C;  4RF0 A;  2SAK A;  3EFU A;  5E6N A;  1JWB D;  2O2V A;  2WLB A;  4DHJ D;  1J7C A;  2B76 B;  1EF5 A;  1GOZ A;  1I4Q A;  3L16 A;  1C1Y B;  3JYU A;  4XWT A;  5KHO A;  2QHO A;  5IOI A;  4MJS B;  3T3O A;  1HTQ A;  3DVN U;  1MVK A;  1XXG A;  4CO7 A;  1MFW A;  2ZEQ A;  3BVZ A;  1WRI A;  3AEG B;  4B9K A;  2X8X X;  3BYT B;  2BYV E;  2IPK D;  3PLV A;  3QCA A;  3DBH I;  3NZ3 A;  1ENF A;  3NOB A;  3ZYY X;  1XO3 A;  1SJH D;  2AQ2 B;  3N32 A;  1QZE A;  2KVZ A;  3AE1 B;  4C7Y A;  4DHJ B;  4EUT A;  1XQQ A;  3Q8F A;  3DCG A;  2J52 A;  2LI5 A;  3O13 A;  4MM3 A;  2LUM A;  2UU7 A;  1P0R A;  1OEY J;  4C4V A;  1VLB A;  2RGF A;  2WXK A; 
#chains in the Genus database with same CATH homology
 4GGQ A;  3RZW C;  4DK5 A;  3T9L A;  1V9J A;  4GDL B;  3R66 C;  4KIK A;  2EKE C;  1NI2 A;  2RPQ A;  3VTW A;  2C5L C;  4GOC A;  3APD A;  2KOX A;  1MG8 A;  4IWO A;  2V4L A;  3V6C B;  2ZNV C;  2CR5 A;  4KZC A;  2NBU A;  1JRU A;  5D2M B;  2K6D B;  3A4R A;  1UZX B;  1J19 A;  2KZR A;  3QHT A;  2JRI B;  4GDK B;  4HXD A;  3PRE A;  4ANW A;  2FNJ B;  2W9N A;  1M94 A;  1E8W A;  1WJU A;  1V5O A;  1WY8 A;  2KKC A;  2MQJ A;  3JSV A;  4GXB A;  1Q0W B;  2AWT A;  1YX5 B;  3A1Q B;  4DHZ E;  5HKH A;  1UBQ A;  4NQK E;  1I42 A;  4WWO A;  5TR5 A;  2K8B A;  4F1S A;  4M0W B;  3R3M A;  3PRZ A;  4PYZ A;  5D6J B;  4PYU A;  3D32 A;  1VD2 A;  2KAN A;  2N9P C;  5AZG A;  2ZNV B;  4N9F 4;  2KX3 A;  3ENE A;  3QAQ A;  4GB9 A;  2L05 A;  2KWU B;  3AUL A;  1WZ0 A;  3AU4 A;  4G50 A;  1WFY A;  1WM3 A;  3DBS A;  1WI0 A;  2KX0 A;  3H1U A;  3V60 A;  1XT9 B;  4HCP B;  2HJ8 A;  2ZPN A;  2IZV B;  3PZD A;  2MP2 A;  4W9L A;  2NR2 A;  2JT4 B;  3ZDM C;  2KJR A;  3U30 A;  3L08 A;  4F8C B;  5G55 A;  1NDD A;  1YJ1 A;  2AL3 A;  3OAW A;  3PSE B;  1J8C A;  4TUU A;  2N7D A;  3QQ8 B;  3IBE A;  1V86 A;  2KFK B;  2GBN A;  4AWJ A;  2DHZ A;  4DDG D;  1ZKH A;  1ZW7 A;  5GMV A;  3UIO B;  4KDI C;  2HE7 A;  2M17 A;  2FCQ A;  2IO2 B;  2KQS A;  2KHW B;  1IPG A;  2GBJ A;  3IG3 A;  3M95 A;  4BKT A;  1WJ4 A;  4ZRJ A;  1SIF A;  4JGH B;  1WGG A;  3H7P B;  3HK0 A;  5G2N A;  3TIX A;  3VUY A;  4K7U A;  4FA6 A;  3PRP B;  4GDL A;  5CX3 A;  3VAW A;  2CHZ A;  2MBH A;  2O6V A;  2ZVO A;  2M8S A;  1T0Y A;  2JPH A;  2MA9 B;  2KXJ A;  4LDT D;  1L2N A;  1E5W A;  3EC8 A;  3P2B A;  4WJN A;  1WGR A;  4IW0 A;  2DX5 B;  2CU1 A;  4MH0 E;  4GDK A;  2NVU I;  2DAJ A;  3TCA A;  3ONS A;  5L95 C;  4XZ4 A;  1WYW B;  2XK5 B;  2JF5 A;  4WJQ A;  1KJT A;  4G11 A;  4BFR A;  5J17 A;  2L0F A;  2L7R A;  3ZRC A;  3NY5 A;  1WMH B;  1UGM A;  3B0A A;  1WX9 A;  3ZIM A;  2L00 B;  2C7M B;  2MX2 A;  1VCB A;  3W1Y A;  3ZNI D;  3U8Z A;  3IFW B;  3UIP B;  4IM3 A;  3L13 A;  2LXC A;  2LGX A;  1YD8 U;  2N1W A;  2N4F A;  3VTV A;  3K9O B;  3VUW A;  5L83 A;  4W9I A;  2G4D B;  2N9X A;  3H9D A;  2D10 A;  4IG7 B;  2KQ7 A;  4JQW C;  3VQI A;  4W9E A;  4W9D A;  2KJ6 A;  1SE9 A;  3PGE A;  3PVL A;  3TL5 A;  3X0W A;  4TKN A;  3VUX A;  2KLC A;  2UYZ B;  2KFK A;  5C23 A;  3JW0 X;  4AUQ C;  1Y8R C;  1WIA A;  2CHX A;  4FUL A;  2J0K A;  3ALB A;  1GG3 A;  1UH6 A;  4KSK C;  3WAM A;  3AU5 A;  3MJW A;  3PLU A;  4LDT B;  4GIV A;  4CHK A;  1WX7 A;  2K8C A;  3QC8 B;  2J7Q B;  2KVR A;  4E3C A;  2LUE A;  5E6P A;  2DEN B;  2BF8 B;  2BYE A;  2ZVN A;  4HDQ A;  2CKH B;  1LFD A;  2REX A;  3CMM B;  3GZN I;  4HWI B;  3UF8 A;  4EKU A;  1RAX A;  4ANX A;  3RYT A;  4WAA A;  4NPN A;  3PHW B;  2FIF A;  2D07 B;  5IA7 A;  1CMX B;  1EF1 A;  1WXS A;  1WH3 A;  1WJN A;  2R2O A;  4K81 A;  4KVG B;  1IYF A;  3NZS A;  2VRR B;  2RSU A;  1XD3 B;  2LRU A;  3APC A;  1I35 A;  2IY0 B;  1V49 A;  2MBB B;  3ZVV A;  1P3Q U;  2ZCC A;  1WR1 A;  1X1M A;  3ML9 A;  3VH3 B;  4A3P A;  2LGY A;  1J0G A;  4OVU A;  2NBV B;  3S2A A;  1WMH A;  2WX1 A;  4LJO B;  4KZ0 A;  4PS3 A;  3UIN B;  3NZU A;  3A4S C;  4P7I A;  2JVC A;  1E7U A;  1UEL A;  2C9W B;  2DYM A;  3A9K A;  4MJS A;  4TV3 A;  5LLI A;  3X23 A;  3VDZ A;  4ANU A;  2K39 A;  1WX8 A;  3WAO A;  3JVZ X;  5J18 A;  2FID A;  2MBQ A;  1V6E A;  2FCN A;  2NPT A;  2OJR A;  3W1S C;  4EOY A;  2LRW A;  1WGD A;  2IY1 B;  1Z5S B;  2AL6 A;  4FJZ A;  4M8N A;  4WJO A;  5JHB A;  1WRD B;  2JXX A;  2ZCB A;  4MGI E;  4XX5 A;  3ZDT A;  4DXA B;  5CHF A;  2K8H A;  2ASQ A;  5DPS A;  3VTU A;  3PS6 A;  2KLG A;  2MW5 A;  4B6W A;  5DPR A;  4BBN F;  3R7Q A;  2O2V B;  3OLM D;  2C7N B;  3ZNH B;  1HE8 A;  1WE6 A;  1WE7 A;  3ZRF A;  4B95 A;  4AP4 C;  2GMI C;  1LM8 B;  2AEH A;  5J2R A;  1GJZ A;  3KVF B;  1IP9 A;  3A9J B;  1E90 A;  4NJ7 A;  2BKF A;  2K1F A;  1TTN A;  3VXW A;  1TGZ B;  2ZJD A;  3PTF C;  4NQL B;  2FCM A;  2LVQ A;  2Z59 B;  4AJY B;  4E74 A;  4WWP A;  1V2Y A;  2KFJ A;  3MTN B;  3C0R B;  3M63 B;  1KLV A;  4ASW C;  2N7E A;  1D3Z A;  2IYD B;  2WX0 A;  1E8X A;  2D11 A;  1WZ3 A;  4GN1 A;  2A4Z A;  2J0J A;  1NBF C;  3L10 B;  4I6L B;  2PEA A;  3MHS D;  2A5U A;  1KM7 A;  3WIM A;  1WM2 A;  5JH5 C;  1UBI A;  4KDL B;  4HPM B;  4W9J A;  4A3O A;  4MDK E;  4RM8 A;  1UD7 A;  4MGK E;  2DZM A;  4BKS D;  5EDS A;  1KOT A;  5CTR C;  4DDI D;  3ML8 A;  3HM6 X;  3WAP A;  5LXI B;  4FAD A;  4EZK A;  3V61 A;  3L54 A;  2JZZ A;  3H6N A;  4II3 B;  5CHV C;  4ICU A;  3A1Q A;  1P1A A;  4PS7 A;  2MCN B;  3RZF A;  4HJK A;  4RMA A;  2K25 A;  2NCN A;  3ZNZ B;  2GBM A;  2HTH A;  4GSW A;  3RUL A;  2AYO B;  2WDT B;  3QWZ B;  4IC7 B;  2KK8 A;  3WAL A;  3M3J A;  1EUV B;  3DVN V;  4NNJ B;  1BT0 A;  3IVF A;  1L7Y A;  2FCS A;  3WA0 A;  2CS4 A;  2BGF A;  3CST A;  3HM3 A;  5CHW A;  4ZRI A;  2XBB C;  1H8C A;  3KYC D;  2R2Q A;  1P9D U;  2WWZ A;  5JHA A;  1S1Q B;  3T8M A;  2EMS A;  3KYD D;  3W1S A;  4HPL B;  2GBR A;  2V1Y A;  3OJ4 B;  2DZI A;  2KO3 A;  3DVG Y;  3TBL D;  2FUH B;  4HCN B;  1C3T A;  4FHK A;  2GBK A;  4K7S A;  4K7W A;  1LXD A;  1S3S G;  3ZTC A;  4AOF A;  2LGD A;  1AAR A;  5DPT A;  4DWF A;  3DBR I;  2IO1 B;  3ZO5 B;  5D94 A;  1OTR B;  4J6I A;  2MRP A;  3VHT C;  1H4R A;  2KC2 A;  4OVV A;  2C60 A;  3H7P A;  1R4N I;  4G0N B;  5BO4 B;  4IM0 A;  2I1K A;  4NAW B;  2CHW A;  2J0M A;  3KW5 B;  3SHQ A;  3NS8 A;  2IO3 B;  3NHE B;  3ZW3 A;  2MLB A;  3VFK A;  2B3A A;  4MSM B;  3UGB B;  3WAN A;  4EEW A;  2MP2 B;  3A33 B;  4BBN C;  2YLM A;  3RD2 A;  2LD9 A;  2G45 B;  4K1R B;  2IO0 B;  4RM9 A;  1TBE A;  4FJY A;  3RT3 B;  3VVW B;  5C1Z A;  2KWV B;  1V81 A;  1OQY A;  2LVP A;  1F9J A;  2XK5 A;  1WGY A;  3B08 A;  4MGY E;  4PS8 A;  4DBG A;  3PPA A;  1V5T A;  3CF6 E;  4JL9 A;  2RR9 A;  3M62 B;  1E8Y A;  2LJ5 A;  4KSL C;  2IBI B;  4GU2 A;  4ZDV A;  5AEK B;  2BYF A;  3UQB A;  4IWQ A;  2KMA A;  3L17 A;  2EMT A;  3H7S A;  2BWF A;  3BIN A;  3ZTD A;  4M8M A;  2LZ6 A;  4DHZ B;  3CSF A;  4FLH A;  1OGW A;  4WJP A;  4EZJ A;  2G3Q B;  2K6Q A;  1ISN A;  2KJH B;  3QAR A;  2N1V A;  2DYB A;  3TJP A;  1ZGU B;  4ZYN A;  4ICV A;  2JUO A;  4GMV A;  2KNB A;  4NY0 A;  3DPD A;  2O6V B;  3L0W B;  2MBO A;  3DBL I;  1Q1O A;  4YL8 A;  1U4A A;  2KDB A;  3QK0 A;  4WWN A;  2Z0D B;  4EZL A;  2LWP A;  1WXA A;  2PPH A;  4FJV B;  2KMC A;  3DDC B;  1WGH A;  1SGH A;  2KTR B;  4I6P A;  1WR6 E;  4F7Z A;  5DCN A;  4URK A;  2KN5 A;  3I3T B;  3TMP B;  2MBE A;  2N9E B;  2HD5 B;  2KDF B;  2MSE D;  2L3Z A;  4BKS A;  2MWS B;  3RUI B;  2G4S A;  3QIJ A;  3DOW A;  4MSQ B;  1G6J A;  2WYQ A;  1WXM A;  3LDZ E;  2JRH A;  1OEY A;  1Z2M A;  3KUZ A;  2KWC A;  3AXC A;  4NAW A;  3N30 A;  2V3S A;  4WQO B;  5D7G A;  2M1M A;  3BY4 B;  3EEC A;  5LXH A;  4TQ1 A;  4KV2 A;  4NJ6 A;  2FAZ A;  3QA8 A;  4I6N B;  4E71 A;  2BPS A;  4A20 A;  3V62 A;  3Q3J A;  3R7R A;  1Q5W B;  2C7H A;  2JZ3 B;  1YIW A;  2L0T A;  4X57 B;  3OJ3 A;  1EO6 A;  3ZLZ A;  1WJ6 A;  4JLC A;  4FBJ B;  3KUD B;  1WF9 A;  3UQA A;  4HK2 A;  5KHQ A;  2PE9 A;  3ZNG C;  4ZRK A;  3SU8 X;  4BVU C;  4TQ0 A;  1P98 A;  2LXA A;  2PE6 B;  3HHM A;  3AI5 A;  1LQB A;  1RLF A;  4XC2 A;  3KUC B;  3N3K B;  4W9K A;  5E6O A;  5IAA C;  4BKG A;  1GUA B;  3QJZ A;  3SDL C;  3ZKJ C;  3ECI A;  2I1J A;  3V6E B;  3SD5 A;  3IHP C;  3K9P B;  4G3X B;  3EHV A;  4FHJ A;  1FXT B;  4JIO U;  4ANV A;  2ZPY A;  1R4M I;  4EFO A;  1YX6 B;  2NS5 A;  2L76 A;  3B1L X;  4HLE A;  4W9F A;  4LJP B;  1TZ1 A;  2BKR B;  2LVO A;  2KTR A;  3LJ3 A;  2M4N A;  5DPW A;  2ZZP B;  4BOS C;  4KIK B;  3EFU A;  5E6N A;  2O2V A;  2LAS A;  4DHJ D;  2DAF A;  1RFA A;  2PJH A;  3APF A;  3DVG X;  3U7D A;  1EF5 A;  4BOZ B;  2KDE B;  3L16 A;  5JZE B;  1C1Y B;  3A9J A;  2D3G A;  3RCZ A;  3JYU A;  2KC1 A;  5KHO A;  4MEM A;  3PHX B;  1PQS A;  4W9H A;  3JSV B;  3HIZ A;  2QHO A;  2D2Q A;  4IM2 A;  2BWE S;  3A9K B;  2RD0 A;  3PRM B;  4MJS B;  2O6V D;  3DVN U;  2KTF A;  4FN2 A;  2NBW B;  2YVC A;  2NPT B;  4IUM B;  1GC7 A;  4LCD E;  4CYE A;  3QX1 A;  2KD0 A;  2DZJ A;  4CO7 A;  1WXV A;  3O65 B;  2ZEQ A;  3GOE A;  4W9C A;  2XEW A;  2Y5B B;  4B9K A;  5AZH A;  4HDO A;  4II2 B;  4HVB A;  2BYV E;  3PLV A;  3QCA A;  3DBH I;  1A5R A;  3Q3F A;  1RRB A;  4MGZ E;  2GOW A;  1GNU A;  2DYO A;  1E8Z A;  3NOB A;  5AZF A;  4MEL A;  1E7V A;  4W9G A;  3N32 A;  1QZE A;  2L8J A;  2DZK A;  1YQB A;  2M0X A;  3VH4 B;  2Z0E B;  3ZUN A;  3PT2 B;  1K8R B;  4DHJ B;  2JY6 A;  1XQQ A;  2OOB B;  3PV1 A;  4EUT A;  3DQV A;  4IWP A;  2KDI A;  3DCG A;  4AJW A;  3KH0 A;  2LI5 A;  4MM3 A;  1V80 A;  1P0R A;  1OEY J;  2UWQ A;  2RGF A;  1GC6 A;  5FR6 A;  2JWZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...