3LB8C

Crystal structure of the covalent putidaredoxin reductase-putidaredoxin complex
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
104
structure length
104
Chain Sequence
b'SKVVYVSHDGTRRELDVADGVSLMQAAVSNGIYDIVGDCGGSASCATCHVYVNEAFTDKVPAANEREIGMLESVTAELKPNSRLSCQIIMTPELDGIVVDVPDR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putidaredoxin reductase
publication title Crystal structure of the putidaredoxin reductase x putidaredoxin electron transfer complex.
pubmed doi rcsb
source organism Pseudomonas putida
molecule tags Oxidoreductase/electron transport
total genus 27
structure length 104
sequence length 104
chains with identical sequence D
ec nomenclature
pdb deposition date 2010-01-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00111 Fer2 2Fe-2S iron-sulfur cluster binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 3lb8C00
1FIQA 2WQYB 1N60A 4YSYB 3WCQA 2H89B 1JW9D 3AB5A 3AE6B 1I7HA 4WQMA 1TKYA 3DWGC 1L5PA 1NYQA 2FBWB 3ABVB 1QLBB 3BIID 3EUB2 4C7YA 4FXCA 1TYGB 2B76B 3P63A 3AEEB 3VRBB 1FXAA 1TKGA 4P6VF 5AUKA 1NYRA 3B2FA 1FFVA 2PVOD 4ZHOA 2W54A 4ZHPA 1J7BA 1ZXIA 3FAHA 5EE3A 5MPOA 1JQ4A 4KX6B 2N0SB 1QOBA 1FRDA 1A70A 2WS3B 3AE3B 1VDVA 1J7CA 3L4PA 3P4PB 1L6VA 2WU5B 4YXDB 4C7ZA 3B9JA 3AE2B 3PO0A 4C80A 2MJEA 1NVID 3W5VB 3AEGB 3HRDD 1B9RA 1OQQA 1OFFA 5G5HA 1UWMA 1XLPA 2WDQB 1CZPA 1FMAD 1DOXA 1FO4A 1NI3A 2M19A 2DWQA 1JWBD 3AEFB 4JWUC 1RYJA 5GXGB 2EKIA 4YSZB 1ROEA 3SR6A 1PUTA 2CU3A 3DWMA 1N63A 2L83A 2W3RA 1FFUA 3P4RB 2Q5WD 2M56B 1FXIA 2K5PA 1QOFA 2MH7A 4WWMA 2K9XA 1XLQA 1KF6B 1GAQB 1JWAD 2Y5CA 1N5XA 3NS1A 1RM6C 1VLBA 3AE1B 5H8YE 3RPFC 1JRPA 1NENB 2PVGC 1YQ3B 3AE8B 3AH7A 5EE1A 2QJLA 2ACZB 3AE4B 3HUIA 4HROA 1VJKA 4N6EB 3VR8B 1R7SA 1DOIA 4US9A 1RFKA 1DOYA 1XO3A 3P1MA 1XLOA 2WDVB 1GPXA 1T3QA 1JALA 1L6UA 1WYGA 2CJNA 1YJIA 3AM9A 3P4SB 4LTUA 5EE0A 1E10A 1FRRA 1QOGA 1ZP0B 2PIAA 3SFEB 4ITKA 2CJOA 1KFYB 1PFDA 2QIEB 1DGJA 3AEDB 4A9AA 2MJDA 2JQRB 3P4QB 2OHFA 4N58A 3NVVA 1YQ4B 1XLNA 2BS2B 2G1EA 3AE7B 4YTNB 3VR9B 1E0ZA 2K22A 1SB3C 1V8CA 3NVYA 1TKEA 1TJEA 2WDRB 1YJJA 1N61A 1PDXA 3CWIA 4YSXB 3NVWA 1AYFA 2BS4B 1V97A 1E7PB 4HRSA 3LXFA 4YTMB 3AEAB 1FM0D 1ZUD2 2W55A 4IDIA 2H88B 1SIJA 4ZOHC 3AEBB 1RWSA 4YTPB 5G5GA 1OQRA 1QF6A 2PKOA 1KRHA 2W3SA 1L0VB 2MJ3A 3ETRA 2E3TA 2AX5A 3AE5B 1NEKB 1SF0A 3AV8A 3AN1A 3NVZA 2JX5A 3VRAB 3LB8C 1WWTA 4US8A 2WU2B 1JROA 1N62A 5H92C 2BT6A 1CJEA 2LEKA 2KMMA 4JWSC 3FC4A 1N5WA 1ZOYB 2BS3B 3AE9B 3KWLA 4YT0B 5C3JB 2WP9B 1QOAA 3AMZA 4JX1C 1WXQA 3AECB 2DBYA 4USAA 1J7AA 3W5UB 1QT9A 1IUEA 1E9MA 5C2TB 2L52A 3ZYYX 3CIRB 1F0ZA 2WLBA 2KAJA 3NRZA 1E6EB 5EE9A 3B2GA 3SFDB 3W9CB 1AWDA 5AUIA 3HVZA 2HTME 1WRIA 4N59A 1EWYC 1WGKA
chains in the Genus database with same CATH superfamily
4JPSA 4KKJA 1L5PA 3VRBB 1TKGA 3L10B 4WH4A 1V1OA 1FFVA 5D7GA 4ZHOA 2GOWA 1QOBA 1J7CA 2WU5B 2KZRA 2CS4A 2MP2A 5AZGA 2PE6B 3PZ8A 4P1BC 4LNIA 5G5HA 1GOZA 2WDQB 3ZXVA 2L0FA 2LGSA 2ASQA 1TZ1A 1RYJA 1D5XC 4FJVB 1M94A 4W9KA 4BKSD 1UNSA 2D2QA 3EECA 2D11A 1TT5B 1D5ZC 4CHKA 4HK2A 1L0YB 3VR8B 4DDID 2D10A 3AULA 1XLOA 4DDGD 4CYEA 1JALA 4BKTA 4EZKA 2WXGA 2JQRB 2KD0A 4M0WB 1J0GA 2BS2B 5D94A 2C7HA 1Q1OA 2Z8LA 3JW0X 1FXTB 4ICVA 2CU1A 4M00A 2BS4B 4DXGA 2K39A 2J7QB 2YLMA 2X38A 4DWFA 4ZOHC 1PQSA 3Q8CA 4A3OA 3P2BA 2JZ3B 4MDKE 3NS8A 1D4BA 3LB8C 1YMHE 2DNFA 2LVQA 4X57B 4OHJA 2ZNVC 4GOCA 1LM8B 4YT0B 4W9JA 2PJHA 2WXRA 4RF1A 3RCZA 3MTNB 2KLCA 2KN5A 1D6EC 2L00B 1E6EB 4M0WA 4K7UA 2RGFA 4URKA 4LDTB 2ZEQA 4WQMA 3V61A 1K8RB 2KQSA 2FBWB 3TEYA 3GE8C 3BK1A 3TJPA 2EMTA 1YN3A 4MH0E 4EZJA 2N0SB 4OVUA 2KKCA 3EGRA 4LK0M 1J8CA 1EF1A 3Q8FA 1FD6A 2DWQA 4WWNA 4BAXA 2RSUA 1P3QU 2INCC 3VH4B 2KC2A 3L54A 4GSWA 5E6PA 4K3BA 4UDUC 1V1PB 1RM6C 2O6VB 4TV3A 3TL5A 2MBHA 3HUIA 2LRUA 2BWFA 5DPSA 4LNKA 3V6CB 3RNGC 1QOGA 2VZKD 2KMAA 4HEA1 3M3JA 1XLNA 4YTNB 1V8CA 2DLBA 1UBQA 3APCA 1SGHA 4NNJB 3NVWA 1AYFA 1A5RA 3VQIA 4M02A 4HRSA 2KWVB 2J53A 1BXTA 1HQRD 4HCNB 1SIJA 2BKRB 1C9FA 3Q8BA 1QF6A 5HG2A 3PGEA 3BVGA 1V1PA 2GBJA 3KWLA 4KDIC 2EKEC 2WXOA 2HE7A 2DZJA 3PRZA 4FJYA 1ACCA 3TEWA 3FILB 4DHJD 1R4MB 2ZPYA 4W9FA 3W1SC 1WGKA 2BTEA 2CHWA 5FR3A 1ENFA 2BF8B 3R2TA 1WXVA 4P6VF 5AUKA 4GLSC 3L17A 2ZZPB 3KWVA 5AEKB 1UUPA 1TS5A 2MW5A 2K3UA 4AOFA 1LXDA 4BBNC 4YXDB 5E6JA 5BYQA 2L0TA 2MJEA 2LMCA 4C00A 4S0RA 5AZFA 3I3TB 1WH3A 2QHOA 4K7WA 3ZVVA 4EUTA 4HKQA 2NCNA 3FILA 1XLQA 3Q3MC 4O1NA 3RNEC 3Q3FA 1BT0A 2HDEA 2IBIB 2KVRA 3NS1A 3RPFC 1JRPA 3AH7A 1RRBA 2PTLA 3DBHI 1RFKA 3T8MA 5CHFA 1T5XD 3AM9A 2CR5A 3ZJVA 1ZP0B 3LJ3A 4BVUC 1WXMA 1VZ8A 4W9IA 5BYSA 1ESFA 4GDLB 2LJIA 3K9PB 2DZKA 4TKNA 3GS2A 4E3CA 1Y8RC 1FM0D 4G0NB 1F77A 1SSNA 3L16A 4XWTA 3NVZA 1WWTA 4J6IA 3KLSX 4JGHB 2L05A 2J0MA 3ENEA 4G50A 1KLGD 2D3GA 4DXAB 1VZ7A 4XDDA 2N9PC 1SJED 2WQYB 3Q6BA 1TS3A 3N3KB 4EFOA 3DWGC 4GDLA 1E8ZA 1NYQA 3EUB2 5HKHA 3P63A 3U2SC 1ZW7A 2KOXA 1FXAA 2MLBA 4XC2A 4NJ7A 3HM6X 3SU8X 2I1JA 2PVOD 3A9KB 5EE3A 3PZ7A 3R7QA 4HJKA 4AJYB 2Y5BB 2L3ZA 4I6NB 2LD9A 2WDTB 5EDSA 5IOIA 2ZNVB 1J19A 2MHJA 1JCKB 5JHAA 1ET9A 3DWMA 3ZRFA 1GB1A 3P4RB 4W9LA 3ZRCA 1WI0A 1VD2A 1WX9A 1WXAA 3AU4A 2HD5B 3AE4B 1L2NA 4PYUA 3RULA 4ZRKA 1GPXA 4LTUA 5EE0A 1WFYA 4ITKA 2VH1A 2K25A 3N1XC 3R3MA 3A9KA 1ZDVA 1E7VA 4GMVA 4L23A 1T6BX 1WGYA 3U4EG 1TGZB 3R8BA 1WMHB 3J9CA 4LLGM 2FAZA 2MBQA 2WXNA 4YWGG 3M63B 3QARA 4RF0A 2A4ZA 3PRPB 3TIXA 3AN1A 4US8A 2IY0B 1JROA 4H2AA 2Y3AA 5C3JB 2MQJA 3MP9A 2WP9B 2GBKA 4GU2A 4WJOA 2ON8A 3W5UB 1J7AA 2CHZA 3A4SC 3WANA 2FCSA 1C76A 1AARA 4OZAA 2K0PA 1Y56A 3W9CB 1SE3A 4C56C 2IPKD 2FCNA 3R66C 2WWZA 2L1AA 2C60A 2L8JA 4YSYB 4HWIB 2MSED 2DZIA 3H8HA 3AE6B 2AEHA 4EEWA 1C4CA 4S17A 1WMHA 4EKUA 5LLIA 1D3ZA 1J7BA 4NJ6A 4IM3A 3MHZA 4DK5A 3T3NA 3E9SA 4KSLC 3PLVA 1X1MA 1PYWD 2W9NA 1HA5A 1OQQA 4HPLB 3RN9C 4AWJA 4TQ0A 1WM3A 2CU3A 3VUYA 1Q5WB 3BYTB 1P0RA 1UF0A 1EF5A 2LGXA 4IW0A 1P1AA 1FXIA 2D3CA 3FKYA 2K9XA 4RNAA 3BVZA 1V81A 2MRPA 2JZPA 3X23A 1WJ4A 4RGMA 4JIOU 2CHXA 3NZUA 2JRHA 2KWDA 1T0YA 4KZCA 1T3QA 1WYGA 3P4SB 4ICUA 2PIAA 1DYQA 3RUIB 2QIEB 1KFYB 1GNUA 5TSSA 3Q3OC 3VTVA 3VR9B 1MG4A 3AE7B 1E0ZA 1HXYD 2BKFA 1TJEA 4FADA 2UWQA 1V5TA 2KNBA 1N61A 4RFBA 3GE3C 3QA8A 1HTOA 3APDA 1OTRB 2H88B 2AQ1B 3N32A 4XWWA 1RWSA 1L0VB 2NPTA 3GP7A 4ZRJA 3DBRB 2WU2B 3MJWA 2JF5A 4ASWC 1L0XB 1WGHA 1N5WA 3ZKJC 4WAFA 3AMZA 3AECB 3WALA 3NY5A 1QZEA 2W82A 1E9MA 1F9JA 3NOBA 4L2YA 1XCTL 1FIQA 1BMLC 3AB5A 1K52A 2MP2B 4C7YA 2ZCCA 1NYRA 4IC7B 2N1WA 3PREA 1WJUA 4AS1A 2M1MA 3M95A 2IGHA 2NBVB 3JSVA 2N7EA 4C7ZA 1MI0A 3OAWA 1NVID 3DBLB 2QC8A 3DHHC 1DOXA 3E56A 2V0GA 1C79A 2KLGA 2MH7A 1UZXB 1XT9B 2K5PA 4WWMA 3MHSD 3QJZA 3CMMB 3TSSA 1VLBA 2UYZB 1YQ3B 2KJ6A 2XNAC 3VUWA 3B08A 3IFWB 2WXKA 4HJGE 1DOIA 4US9A 2L76A 5D3IB 1C1YB 2C9WB 1E90A 2CJNA 4ZYSA 1FRRA 2R2OA 3OJ3A 2N7JA 4JQWC 5HFYA 4ARCA 1SJHD 1C77A 2OHFA 2AWTA 4K81A 4CO7A 3OWEB 2YEPF 3Q3NC 3ZO5B 4P1CC 2JRIB 2ZW0A 1ZUD2 2O2VB 3UIPB 2RMMA 5D6JB 1WR6E 3RI7C 2KWUB 4YTPB 4WQOB 2Z59B 4MGIE 3VRAB 5D3DA 3JYUA 3SDLC 2WHIA 3PLUA 2IZVB 5IKCM 1N6ZA 3N20C 4W9DA 1ZOYB 2ZW1A 1YN4A 3ZIMA 3U8ZA 4C4VA 4JX1C 2OJRA 4FLHA 1UELA 1F0ZA 2RDGA 3B2GA 3HM3A 2PPHA 1JWSD 1MHXA 2H89B 2KK8A 5HI1A 1SEBD 1L4ZB 2HJ1A 2NVUI 4LCDE 2BB5A 1RAXA 2UU7A 2O2VA 1I4QA 1ZXIA 1EUVB 1FRDA 3P4PB 1WR1A 3L13A 4GN1A 3PO0A 1ZGUB 4GDKA 2DAJA 1XLPA 2BB6A 2K8BA 1CZPA 2IO3B 3U7DA 2VRRB 3DCGA 3UF8A 2IDYA 2LGIA 2FCMA 3JVZX 4ZRPA 2L83A 3GZNB 2W3RA 5FR6A 4CQNA 5FKAC 2ZPNA 1GAQB 2FNJB 2ONQA 2PLPA 3PV1A 2ACZB 2KX0A 3IT6B 1R4MI 1M4VA 2Z0DB 3H6NA 3ZXRA 1YOVB 3OLMD 2N9XA 4DHZE 3ML8A 2NTTA 4PK1A 5L83A 1KOTA 1PDXA 3D32A 4IUMB 4KGTA 4ANXA 3P42A 3UINB 3IHPC 2BGFA 4TMAB 3V62A 1S3SG 2MJ3A 3AE5B 2QMTA 3RZWC 4NQLB 1WRDB 2LEKA 2WXIA 2DBYA 5J18A 4TQ1A 2ZCBA 4OW0A 1WIAA 4M8MA 1KH0A 5AUIA 1WRIA 1Z2MA 3RNFC 3CSTA 2JSVX 1I4PA 3N1ZC 4J3OD 1ZPSA 4OZCA 4BZAA 2JYEA 5LXIB 5C1ZA 1VR9A 4WWPA 5TR5A 3TCAA 3W5VB 2PW9A 1B1ZA 1C3TA 2IGDA 2WXMA 1YNTE 3VDZA 2R2QA 4P16A 4LDTD 1I4GA 3RYTA 4MGZE 4IWQA 3IAS1 1QOFA 3H7PB 1V2YA 2X8XX 1MJDA 4M01A 2DAFA 2WGSA 5EE1A 4HROA 3DVNU 4N6EB 1VJKA 2IO2B 5CHVC 1EU4A 3PS6A 1PGXA 2CJOA 2KDFB 1EWCA 2ZJDA 4DBGA 1OQYA 4N58A 3NVVA 2GBNA 3PSEB 4BOSC 2AL3A 2K22A 4RM8A 2KQ4X 4M8NA 2G4SA 1YJJA 5HHDG 1LGRA 4II2B 4ANVA 3T3OA 3RNBC 2O6VD 1UD7A 1SF0A 3H7PA 3RNCC 1SE2A 2KDEB 2KN4A 1UGJA 3EA6A 3EC8A 3H9DA 3AE9B 4LNFA 4LJOB 4MSQB 1WX7A 4PS8A 3VFKA 2XK5B 5KHQA 3HVDA 3CIRB 2K1FA 4L1BA 4A55A 1B9RA 3ZNZB 1WJNA 3AU5A 3VVWB 2D07B 2AL6A 3QQ8B 1E8WA 3R2IA 2KT7A 2LFIA 3DHIC 2WNMA 1YIWA 2WX0A 3B2FA 1UWXA 3QX1A 1GJZA 1TBEA 3KQ4A 3N1YC 5BMHA 2LUMA 1GC7A 1D5MC 3B9JA 1FCLA 4MJSB 1VCBA 2D3BA 2FCQA 2GBMA 2AQ3B 1JWBD 3NUHB 3BYYB 2YVCA 3OJ4B 4IG7B 1L7YA 1RFAA 2XK5A 2I1KA 3RZFA 2LGYA 2KFKA 2WXJA 1WF9A 2JXTA 2Y5CA 2MX2A 3ALBA 4HDQA 5FK9C 1ET6A 1L4DB 3RMKC 1YJIA 1OEYA 3A1QB 4A6QA 2JUOA 1V9JA 4A9AA 4II3B 1WSPA 4PS7A 4G11A 2LHDA 4AP4C 1GB4A 4K3CA 3WAMA 4MJSA 2REXA 4KGRA 2N1VA 3Q69A 2NBWB 3NG0A 5T8IA 2DYMA 3RNAC 1NEKB 3AV8A 5D2MB 5G55A 4WAAA 4GGQA 1HE8A 3U7ZA 4KV2A 1QT9A 4FULA 2LRWA 4DHZB 3A1QA 3SFDB 1MFWA 1IPGA 2JZZA 1AW7A 1TS2A 1WGGA 2HJ8A 3K9OB 1QLBB 1K51A 4FXCA 2RD0A 2A5UA 2WXFA 3KYCD 3VUXA 4REZA 3ZUNA 5J2RA 4RGNA 3X0WA 3DHGC 4EOYA 1TY2A 5BMGA 3ZNID 1IGDA 5AZHA 3ZW3A 1TIFA 2N9KA 1HZ5A 2NBUA 2N7DA 2CKHB 2QEJC 1YD8U 3O13A 4BOZB 3IT4B 2C7MB 2Q5WD 4KGSA 3I57A 3PTFC 1I35A 1JWAD 2FUG1 1F2RI 5G2NA 3AE8B 1ZXHA 4AJWA 2GLSA 1Z5SB 3V6EB 1XXGA 2XN9C 2J0JA 1MG8A 3H7SA 2INDC 5BO4B 4IKGA 1MHHE 2IO1B 2NPTB 4MSMB 1HEZE 4HPMB 3CWIA 1V86A 3WIMA 2AYOB 2M8SA 4GXBA 1V97A 3LXFA 2GI9A 1H8CA 4E71A 4WJPA 4RGOS 3VTWA 2GRIA 4I6LB 2JT4B 2N9LA 3ZTCA 3HHMA 2WXQA 1N62A 2QILA 2KACA 1QOAA 2IO0B 1JRUA 4HPPA 4B0EA 4B95A 1V49A 1Q0WB 2EELA 2EMSA 5C2TB 2L52A 3N9YC 4W9CA 4P7IA 1ZKHA 1T0QC 2LZ6A 1K50A 2HTHA 3HVZA 2HTME 3IBEA 2SAKA 4ARIA 1S1QB 3JSVB 2V4LA 1IP9A 2FIFA 4W9GA 3WAOA 3VXWA 5GMVA 3W1SA 4OVVA 5DCNA 3SD5A 2WXHA 3DVNV 3Q2AC 2JPHA 1SE4A 3HK0A 1I42A 4AUQC 1GG3A 4NAWA 4QAYA 1A70A 1E8XA 2V3PA 2K8HA 1C4AA 3SEBA 1WM2A 4DQOC 1FO4A 2M19A 1JMLA 4HVBA 3BVMA 4NJCA 1ROEA 2L7RA 2GBRA 3MC8A 3GOEA 1WX8A 4HDOA 4W9EA 3ZTDA 4BKSA 1C4PA 1P7EA 1SE9A 3V05A 1WZ3A 1DOYA 3A9JB 2WX1A 3C8YA 2IGGA 1PFDA 2K6QA 2LJ5A 3UI3A 2MA9B 2LVOA 2XBBC 2NMQA 4TUUA 1E5WA 4K7SA 1E7PB 1CMXB 1JWUD 3AEAB 3PPAA 2J52A 4C4VB 3UIOB 5IO9A 5G5GA 5IN7A 1YX6B 1GC6A 1KRHA 1RLFA 2BQQA 2KX3A 5LNK1 1FNVA 2BWES 2JWUA 1YQBA 4EZLA 2KMCA 2N4FA 2C5LC 3QHTA 3GZNI 5BYRA 3R7RA 3GB1A 3A9JA 4PYZA 3WAPA 1XF5L 2G9HD 3W1YA 2JWZA 3DBSA 3EFCA 2KAJA 3UQAA 3W2DA 3DDCB 3DOWA 2MBOA 1EWYC 2B3AA 1I7HA 1UBIA 2KHWB 5E6OA 4TSSA 2KDBA 4GDKB 1V6EA 2LHEA 5CHWA 3L0WB 3NZ3A 3BZDB 1TZOA 1XD3B 2LVPA 1R4NB 2WS3B 4LNOA 1VDVA 2NR2A 2OOBB 2VZKB 3VAWA 4NAMA 1WE7A 2Z0EB 3T9LA 1VZ6A 3DVGY 3BINA 4RMAA 4JE3B 1LQBA 1XCQL 3IXSA 5C23A 2LUEA 3B1LX 2KO3A 5JH5C 2BYEA 1FNWA 3ZDMC 3EFUA 5H8YE 3AI5A 4F7ZA 2OJWA 2J4XA 3APFA 1JWMD 3QIJA 4EE2A 1Q10A 2AQ2B 3P1MA 1HZ6A 4ZRQA 2WDVB 3PVLA 4WURA 2V9HA 2BYVE 3L08A 2LWPA 1PGAA 1YQ4B 4MGKE 2KXJA 3IG3A 4DXFA 4IM0A 4DHJB 4IM2A 4NZLB 1ISNA 2LGDA 2J42A 4NY0A 2KTFA 2OEDA 1PGBA 2BPSA 2PKOA 2K8CA 2KDIA 3ONSA 3I63C 2L32A 2INNE 2MBBB 2M17A 2LXAA 3PZDA 4HLEA 2GMIC 4F1SA 3IVFA 3KYDD 1AN8A 1BUIC 4N59A 1I4HA 1STEA 1FCCC 1FPYA 1N60A 3NJTA 3WCQA 2PE9A 4B6WA 3ZQ4A 3Q14C 3A33B 3VHTC 1QQRA 1KLVA 1I4XA 1TS4A 3RFZB 2KTRB 1SBBB 3FAHA 1YN5A 1JQ4A 2JYTA 3LDZE 3L4PA 2BVCA 4C80A 3PRMB 3AEGB 3HRDD 1CK1A 3PHWB 2DENB 4GIVA 2JVCA 1P7FA 3TUOA 1N63A 1MPEA 4KSKC 4OVZA 1EU3A 2M0XA 2LXCA 3V60A 2Y5PA 4XDCA 1YX5B 2J0KA 5DPRA 3KW5B 5JXVA 1XO3A 4WIPA 1L6UA 1E10A 3KH0A 4RH6A 1WGRA 4NQKE 1U4AA 4HXDA 2MJDA 2KVZA 2YEPB 2G1EA 2KTRA 2O6VA 4XX5A 5IAAC 1E7UA 2RR9A 3QCAA 4HKZE 4IOIE 4NPNA 4A20A 1KTKA 2K6DB 5IA7A 3AEBB 3QWZB 1P98A 2KWCA 3NHEB 1OEYJ 3DPDA 2JU6X 2E6XA 3ZJTA 4GB9A 4FHKA 2KYWA 3ML9A 4MACA 4OZBA 3A4RA 2G3QB 1CQVA 3MJ5A 1EM7A 5EE9A 2PEAA 4KIKB 3ZJUA 1T0RC 4IWOA 1IGCA 4XZ4A 3DVGX 3I5JC 1TKYA 3MC9A 4XE0A 3ABVB 3Q3JA 3C19A 3AEEB 2M4NA 1EO6A 3UGBB 4ZHPA 1TTNA 2MWSB 1V80A 2SEBD 1F2RC 3OG5A 1SXTA 2NS5A 2GB1A 2KFKB 2TSSA 3S2AA 2KFJA 2INPE 1QILA 1FMAD 1VRAB 1YJ1A 3AEFB 4WJQA 5GXGB 2DYBA 3O65B 3Q8EA 2BYFA 1FFUA 3WA0A 3BY4B 4ZYNA 1KF6B 1FNUA 5DPTA 4KIKA 1NBFC 1NENB 3CF6E 3HIZA 4YL8A 1MVKA 4ZRIA 4BFRA 3ZLZA 3AXCA 4IWPA 1G6JA 3AEDB 2KANA 3KUDB 3NVYA 1TKEA 4G3XB 1E8YA 4BBNF 4A90A 4YTMB 4E74A 2MCNB 3ZNHB 2D5GA 3N30A 1OQRA 3BWUD 2BW2A 2BYTA 4XYCA 2DX5B 2IY1B 2RPQA 2I38A 1I4RA 4JWSC 4PS3A 5CTRC 1WXQA 4USAA 4FN2A 4A3PA 2V4IB 4ANWA 3KUZA 3ZYYX 2C7NB 3DBHB 1SIFA 4BKGA 2DZMA 1JW9D 3TEXA 3C0RB 3ECIA 2VH2A 2B76B 1V5OA 3I9V1 1WY8A 1TY0A 2WXLA 5MPOA 2FIDA 3ZGZA 3TBLD 2QCZA 3AE3B 1UGMA 2ZVNA 3AE2B 5J17A 1H4RA 1OFFA 2JXXA 1UWMA 1WE6A 4B0MA 2KJHB 3VH3B 4R3DA 4YSZB 1QKZA 4F8CB 1PUTA 3U52E 4WJNA 4MM3B 4FBJB 4D2KA 3ZDTA 4ACFA 3U30A 4LJPB 3BK2A 2V1YA 1HTQA 3SFEB 1KJTA 4ZDVA 4LNNA 3ZNGC 3DBRI 1DGJA 4KDLB 3P4QB 4FA6A 4MT5A 4RM9A 2BBCA 2IYDB 2WDRB 4YSXB 3Q8AA 2G45B 2V3NA 4I6PA 4A8XC 1ZE3D 4KVGB 5KHOA 2ZVOA 4MM3A 4RCOA 3UQBA 4MH8A 1NI2A 5CX3A 1CJEA 2WYQA 3FC4A 2BS3B 2D3AA 3QK0A 3M62B 1ZDXA 3IAM1 1IBXB 3MC0B 4JL9A 3NRZA 2PMVA 1AWDA 5JHBA 4B9KA 4NAWB 4MEMA 2KJRA 3DBLI 4RGTA 4Q2JA 3QC8B 3BIID 2KQ7A 3NZSA 4MGYE 1TYGB 1WJ6A 2FE8A 5DPWA 1IYFA 1XQQA 3PT2B 2W54A 4KX6B 5I4DA 4FJZA 4MELA 1L6VA 3VTUA 3KUCB 2FUHB 1T0SC 2XEWA 2RDHA 1F1HA 4PT5A 2KDMA 3SHQA 2R61A 1NI3A 1WYWB 1UH6A 4HCPB 4JWUC 2EKIA 3SR6A 2WXPA 5JZEB 3V3XA 2MBEA 2MEKA 2M56B 5IP4D 5L95C 4XGAB 4KKIA 1IBXA 1N5XA 4W9HA 3AE1B 4KZ0A 2PVGC 2JY6A 2QJLA 1F52A 3QAQA 2LI5A 3PHXB 2I2YA 1R7SA 1WGDA 3H1UA 3TMPB 2ICIA 5E6NA 2QSDA 1LFDA 4K1RB 4WWOA 3MFGA 1KM7A 5BMIA 3EHVA 3CSFA 1KLUD 1SB3C 2V3SA 2RPVA 1WXSA 3B0AA 3RD2A 4AQ7A 1C78A 1LO5D 3KVFB 2W55A 1K53A 2RDBC 1R4NI 4IDIA 1FEHA 2G4DB 2IJ0A 1P9DU 2W3SA 4FHJA 1XEEA 2E3TA 3ETRA 2AX5A 3RT3B 1OGWA 2JX5A 3TEZA 5H92C 3DQVA 2BT6A 2KMMA 2M0AA 2DYOA 1GUAB 4JLCA 4ANUA 3URYA 1IUEA 5LXHA 2QDFA 2LASA 2KC1A 2WLBA 4N9F4 2N9EB 1NDDA 2DHZA 1WZ0A 3LYYA 2NTSA
chains in the Genus database with same CATH topology
1STEA 1FCCC 1N60A 4YSYB 3WCQA 4JPSA 3H8HA 3AE6B 4KKJA 3ZQ4A 3R2IA 1L5PA 1QQRA 2LFIA 1I4XA 3VRBB 2WNMA 1TKGA 1C4CA 1TS4A 4WH4A 1V1OA 3B2FA 1UWXA 1FFVA 5D7GA 4ZHOA 3RFZB 1J7BA 1SBBB 3FAHA 1YN5A 3MHZA 3T3NA 1JQ4A 2JYTA 3E9SA 1QOBA 3L4PA 1J7CA 2WU5B 3KQ4A 4A55A 5BMHA 2LUMA 1PYWD 3B9JA 1D5MC 4C80A 1HA5A 3PZ8A 3AEGB 3HRDD 1FCLA 1OQQA 5G5HA 1GOZA 2WDQB 1CK1A 2AQ3B 1JWBD 1RYJA 3NUHB 4TQ0A 3BYYB 1D5XC 2CU3A 1P7FA 3TUOA 1N63A 3BYTB 1MPEA 1FXIA 1UNSA 4OVZA 2K9XA 1EU3A 3BVZA 4RNAA 2WXJA 2JXTA 2Y5CA 1D5ZC 2Y5PA 2JZPA 4XDCA 4RGMA 1L0YB 5FK9C 3VR8B 5JXVA 1XO3A 2KWDA 1ET6A 1L4DB 1XLOA 4WIPA 1JALA 1L6UA 1T3QA 1WYGA 3P4SB 1YJIA 4RH6A 4A6QA 1E10A 2PIAA 1DYQA 2QIEB 1KFYB 2WXGA 4A9AA 2MJDA 2JQRB 5TSSA 1WSPA 2YEPB 2BS2B 2G1EA 3AE7B 3VR9B 1E0ZA 2Z8LA 1HXYD 1TJEA 2L1AA 2LHDA 1N61A 4RFBA 1GB4A 2BS4B 4HKZE 4IOIE 4DXGA 4KGRA 3Q69A 1KTKA 2X38A 2H88B 4ZOHC 2AQ1B 4XWWA 3AEBB 1RWSA 5T8IA 3Q8CA 1L0VB 3GP7A 2DYMA 1NEKB 2JU6X 3AV8A 1D4BA 3LB8C 2E6XA 3ZJTA 1YMHE 2WU2B 3U7ZA 4OHJA 1L0XB 4YT0B 1N5WA 4MACA 4WAFA 4OZBA 3AMZA 2WXRA 3AECB 4RF1A 1QT9A 2W82A 1E9MA 1CQVA 3MJ5A 1EM7A 1D6EC 1E6EB 5EE9A 3SFDB 4L2YA 4M0WA 1XCTL 3ZJUA 1AW7A 1FIQA 1BMLC 1TS2A 1IGCA 3AB5A 1K52A 4WQMA 1TKYA 4XE0A 2FBWB 3ABVB 1QLBB 3TEYA 4C7YA 1K51A 4FXCA 3BK1A 3AEEB 2WXFA 1NYRA 4REZA 1YN3A 4ZHPA 4AS1A 4RGNA 2N0SB 2SEBD 2IGHA 1F2RC 1TY2A 5BMGA 1SXTA 1MI0A 3EGRA 1IGDA 2GB1A 2TSSA 4C7ZA 1NVID 2N9KA 1HZ5A 2INPE 4LK0M 1QILA 1FMAD 1DOXA 1VRAB 2QEJC 3Q8FA 1FD6A 2DWQA 3AEFB 3O13A 5GXGB 3E56A 3IT4B 2V0GA 3Q8EA 1FFUA 1C79A 2Q5WD 2MH7A 2K5PA 4WWMA 4KGSA 3I57A 1KF6B 4UDUC 1FNUA 1JWAD 1V1PB 1F2RI 2FUG1 3TSSA 1RM6C 1VLBA 3AE8B 1NENB 1ZXHA 1YQ3B 2XNAC 3HUIA 2WXKA 4HJGE 1DOIA 4US9A 5D3IB 1MVKA 1XXGA 2XN9C 2CJNA 4ZYSA 1FRRA 1QOGA 2VZKD 2N7JA 5HFYA 4ARCA 1SJHD 3AEDB 1C77A 4HEA1 4IKGA 1MHHE 2OHFA 1XLNA 4YTNB 1HEZE 3OWEB 2YEPF 1V8CA 3NVYA 1TKEA 2DLBA 3CWIA 3NVWA 1AYFA 1V97A 4A90A 3VQIA 4HRSA 3LXFA 4YTMB 2ZW0A 2GI9A 1ZUD2 2J53A 1BXTA 1HQRD 2RMMA 2D5GA 1SIJA 4RGOS 1C9FA 4YTPB 3Q8BA 1OQRA 3BWUD 1QF6A 2BW2A 2GRIA 2BYTA 5HG2A 3VRAB 2N9LA 5D3DA 2WXQA 1N62A 2I38A 3BVGA 1I4RA 1V1PA 4JWSC 1ZOYB 3KWLA 2ZW1A 1YN4A 2QILA 2KACA 2WXOA 1QOAA 4JX1C 1WXQA 4B0EA 4USAA 2EELA 2V4IB 5C2TB 2L52A 1ACCA 3TEWA 3N9YC 3ZYYX 3FILB 1F0ZA 2RDGA 1K50A 3B2GA 3HVZA 2HTME 1WGKA 2BTEA 2SAKA 4ARIA 1JWSD 1MHXA 2H89B 5FR3A 1ENFA 1JW9D 3TEXA 5HI1A 1SEBD 1L4ZB 3R2TA 2B76B 3W1SA 2BB5A 3I9V1 2WXHA 4P6VF 5AUKA 1TY0A 4GLSC 2WXLA 1SE4A 3KWVA 1I4QA 1UUPA 1ZXIA 1TS5A 5MPOA 3ZGZA 2K3UA 1FRDA 1A70A 3P4PB 3AE3B 2V3PA 4YXDB 5E6JA 5BYQA 1C4AA 3AE2B 3PO0A 2MJEA 2LMCA 3SEBA 1OFFA 1UWMA 1XLPA 2BB6A 4DQOC 1CZPA 1FO4A 2M19A 4B0MA 1JMLA 3BVMA 2IDYA 4NJCA 2LGIA 4R3DA 4YSZB 1QKZA 1ROEA 1PUTA 3U52E 4ZRPA 2L83A 4CQNA 2W3RA 4MM3B 5FKAC 4HKQA 3FILA 1XLQA 4O1NA 4D2KA 1GAQB 2HDEA 3NS1A 2ONQA 2PLPA 3RPFC 1JRPA 3AH7A 1C4PA 1P7EA 2PTLA 2ACZB 3V05A 3IT6B 3BK2A 1RFKA 1DOYA 1M4VA 1T5XD 3C8YA 3AM9A 2IGGA 3ZJVA 3SFEB 1ZP0B 1PFDA 1VZ8A 1DGJA 3UI3A 3P4QB 2NTTA 4MT5A 2BBCA 5BYSA 2NMQA 1ESFA 2WDRB 4GDLB 1PDXA 4YSXB 2LJIA 4KGTA 3GS2A 1E7PB 3P42A 3Q8AA 1JWUD 3AEAB 1FM0D 2J52A 2V3NA 4TMAB 1F77A 5G5GA 1ZE3D 4A8XC 1SSNA 4XWTA 1KRHA 5LNK1 2MJ3A 1FNVA 3AE5B 4RCOA 2QMTA 2JWUA 3NVZA 1WWTA 4MH8A 3KLSX 1CJEA 2LEKA 3FC4A 2BS3B 2WXIA 5BYRA 3GB1A 1KLGD 2DBYA 4TQ1A 1XF5L 2G9HD 1ZDXA 1VZ7A 3IAM1 1IBXB 4OW0A 2NTSA 3MC0B 2KAJA 4XDDA 3NRZA 3W2DA 2PMVA 1KH0A 1SJED 1AWDA 5AUIA 1WRIA 4NAWB 1EWYC 2WQYB 1TS3A 4RGTA 4Q2JA 1I7HA 3DWGC 1NYQA 4TSSA 2JSVX 1I4PA 3BIID 3EUB2 4GDKB 1ZPSA 4J3OD 1TYGB 2LHEA 3P63A 3U2SC 2FE8A 4OZCA 1FXAA 2JYEA 3NZ3A 3BZDB 2PVOD 1TZOA 2W54A 5EE3A 4KX6B 3PZ7A 5I4DA 2WS3B 1VDVA 1VR9A 1L6VA 2VZKB 2RDHA 4NAMA 3W5VB 2PW9A 1B1ZA 4PT5A 2IGDA 2KDMA 1VZ6A 2R61A 1NI3A 4JE3B 2WXMA 1YNTE 4JWUC 2EKIA 1JCKB 3SR6A 1XCQL 1ET9A 2WXPA 4P16A 3DWMA 1I4GA 3IXSA 1GB1A 3V3XA 3IAS1 2MEKA 3P4RB 2M56B 1QOFA 4KKIA 1IBXA 1FNWA 1N5XA 3AE1B 5H8YE 2PVGC 5EE1A 2QJLA 2J4XA 3AE4B 4HROA 4N6EB 1VJKA 2I2YA 1R7SA 1JWMD 4EE2A 1Q10A 2AQ2B 3P1MA 1HZ6A 4ZRQA 2WDVB 2ICIA 1GPXA 2QSDA 4LTUA 1EU4A 5EE0A 4WURA 3MFGA 4ITKA 1PGXA 2CJOA 1EWCA 5BMIA 1PGAA 4N58A 3NVVA 1YQ4B 1ZDVA 2K22A 1KLUD 1SB3C 2KQ4X 4DXFA 1YJJA 4L23A 5HHDG 1T6BX 2RPVA 3U4EG 4AQ7A 4NZLB 1C78A 3R8BA 1LO5D 2W55A 1K53A 3J9CA 4IDIA 4LLGM 2WXNA 1FEHA 2J42A 3T3OA 2IJ0A 2OEDA 4YWGG 1PGBA 2PKOA 2W3SA 4RF0A 1XEEA 2E3TA 3ETRA 2AX5A 3AN1A 1SF0A 4US8A 2JX5A 3TEZA 1JROA 1SE2A 2KN4A 5H92C 4H2AA 1UGJA 2BT6A 3EA6A 2L32A 2KMMA 2INNE 2M0AA 2Y3AA 5C3JB 3AE9B 2DYOA 3MP9A 2WP9B 2ON8A 3URYA 3W5UB 1J7AA 1IUEA 3HVDA 3CIRB 1C76A 2WLBA 4L1BA 4OZAA 2K0PA 1AN8A 1Y56A 1SE3A 3W9CB 4C56C 3LYYA 1BUIC 2IPKD 4N59A 1B9RA 1I4HA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1FIQ A;  2WQY B;  1N60 A;  4YSY B;  3WCQ A;  2H89 B;  1JW9 D;  3AB5 A;  3AE6 B;  1I7H A;  4WQM A;  1TKY A;  3DWG C;  1L5P A;  1NYQ A;  2FBW B;  3ABV B;  1QLB B;  3BII D;  3EUB 2;  4C7Y A;  4FXC A;  1TYG B;  2B76 B;  3P63 A;  3AEE B;  3VRB B;  1FXA A;  1TKG A;  4P6V F;  5AUK A;  1NYR A;  3B2F A;  1FFV A;  2PVO D;  4ZHO A;  2W54 A;  4ZHP A;  1J7B A;  1ZXI A;  3FAH A;  5EE3 A;  5MPO A;  1JQ4 A;  4KX6 B;  2N0S B;  1QOB A;  1FRD A;  1A70 A;  2WS3 B;  3AE3 B;  1VDV A;  1J7C A;  3L4P A;  3P4P B;  1L6V A;  2WU5 B;  4YXD B;  4C7Z A;  3B9J A;  3AE2 B;  3PO0 A;  4C80 A;  2MJE A;  1NVI D;  3W5V B;  3AEG B;  3HRD D;  1B9R A;  1OQQ A;  1OFF A;  5G5H A;  1UWM A;  1XLP A;  2WDQ B;  1CZP A;  1FMA D;  1DOX A;  1FO4 A;  1NI3 A;  2M19 A;  2DWQ A;  1JWB D;  3AEF B;  4JWU C;  1RYJ A;  5GXG B;  2EKI A;  4YSZ B;  1ROE A;  3SR6 A;  1PUT A;  2CU3 A;  3DWM A;  1N63 A;  2L83 A;  2W3R A;  1FFU A;  3P4R B;  2Q5W D;  2M56 B;  1FXI A;  2K5P A;  1QOF A;  2MH7 A;  4WWM A;  2K9X A;  1XLQ A;  1KF6 B;  1GAQ B;  1JWA D;  2Y5C A;  1N5X A;  3NS1 A;  1RM6 C;  1VLB A;  3AE1 B;  5H8Y E;  3RPF C;  1JRP A;  1NEN B;  2PVG C;  1YQ3 B;  3AE8 B;  3AH7 A;  5EE1 A;  2QJL A;  2ACZ B;  3AE4 B;  3HUI A;  4HRO A;  1VJK A;  4N6E B;  3VR8 B;  1R7S A;  1DOI A;  4US9 A;  1RFK A;  1DOY A;  1XO3 A;  3P1M A;  1XLO A;  2WDV B;  1GPX A;  1T3Q A;  1JAL A;  1L6U A;  1WYG A;  2CJN A;  1YJI A;  3AM9 A;  3P4S B;  4LTU A;  5EE0 A;  1E10 A;  1FRR A;  1QOG A;  1ZP0 B;  2PIA A;  3SFE B;  4ITK A;  2CJO A;  1KFY B;  1PFD A;  2QIE B;  1DGJ A;  3AED B;  4A9A A;  2MJD A;  2JQR B;  3P4Q B;  2OHF A;  4N58 A;  3NVV A;  1YQ4 B;  1XLN A;  2BS2 B;  2G1E A;  3AE7 B;  4YTN B;  3VR9 B;  1E0Z A;  2K22 A;  1SB3 C;  1V8C A;  3NVY A;  1TKE A;  1TJE A;  2WDR B;  1YJJ A;  1N61 A;  1PDX A;  3CWI A;  4YSX B;  3NVW A;  1AYF A;  2BS4 B;  1V97 A;  1E7P B;  4HRS A;  3LXF A;  4YTM B;  3AEA B;  1FM0 D;  1ZUD 2;  2W55 A;  4IDI A;  2H88 B;  1SIJ A;  4ZOH C;  3AEB B;  1RWS A;  4YTP B;  5G5G A;  1OQR A;  1QF6 A;  2PKO A;  1KRH A;  2W3S A;  1L0V B;  2MJ3 A;  3ETR A;  2E3T A;  2AX5 A;  3AE5 B;  1NEK B;  1SF0 A;  3AV8 A;  3AN1 A;  3NVZ A;  2JX5 A;  3VRA B;  3LB8 C;  1WWT A;  4US8 A;  2WU2 B;  1JRO A;  1N62 A;  5H92 C;  2BT6 A;  1CJE A;  2LEK A;  2KMM A;  4JWS C;  3FC4 A;  1N5W A;  1ZOY B;  2BS3 B;  3AE9 B;  3KWL A;  4YT0 B;  5C3J B;  2WP9 B;  1QOA A;  3AMZ A;  4JX1 C;  1WXQ A;  3AEC B;  2DBY A;  4USA A;  1J7A A;  3W5U B;  1QT9 A;  1IUE A;  1E9M A;  5C2T B;  2L52 A;  3ZYY X;  3CIR B;  1F0Z A;  2WLB A;  2KAJ A;  3NRZ A;  1E6E B;  5EE9 A;  3B2G A;  3SFD B;  3W9C B;  1AWD A;  5AUI A;  3HVZ A;  2HTM E;  1WRI A;  4N59 A;  1EWY C;  1WGK A; 
#chains in the Genus database with same CATH topology
 4JPS A;  4KKJ A;  1L5P A;  3VRB B;  1TKG A;  3L10 B;  4WH4 A;  1V1O A;  1FFV A;  5D7G A;  4ZHO A;  2GOW A;  1QOB A;  1J7C A;  2WU5 B;  2KZR A;  2CS4 A;  2MP2 A;  5AZG A;  2PE6 B;  3PZ8 A;  4P1B C;  4LNI A;  5G5H A;  1GOZ A;  2WDQ B;  3ZXV A;  2L0F A;  2LGS A;  2ASQ A;  1TZ1 A;  1RYJ A;  1D5X C;  4FJV B;  1M94 A;  4W9K A;  4BKS D;  1UNS A;  2D2Q A;  3EEC A;  2D11 A;  1TT5 B;  1D5Z C;  4CHK A;  4HK2 A;  1L0Y B;  3VR8 B;  4DDI D;  2D10 A;  3AUL A;  1XLO A;  4DDG D;  4CYE A;  1JAL A;  4BKT A;  4EZK A;  2WXG A;  2JQR B;  2KD0 A;  4M0W B;  1J0G A;  2BS2 B;  5D94 A;  2C7H A;  1Q1O A;  2Z8L A;  3JW0 X;  1FXT B;  4ICV A;  2CU1 A;  4M00 A;  2BS4 B;  4DXG A;  2K39 A;  2J7Q B;  2YLM A;  2X38 A;  4DWF A;  4ZOH C;  1PQS A;  3Q8C A;  4A3O A;  3P2B A;  2JZ3 B;  4MDK E;  3NS8 A;  1D4B A;  3LB8 C;  1YMH E;  2DNF A;  2LVQ A;  4X57 B;  4OHJ A;  2ZNV C;  4GOC A;  1LM8 B;  4YT0 B;  4W9J A;  2PJH A;  2WXR A;  4RF1 A;  3RCZ A;  3MTN B;  2KLC A;  2KN5 A;  1D6E C;  2L00 B;  1E6E B;  4M0W A;  4K7U A;  2RGF A;  4URK A;  4LDT B;  2ZEQ A;  4WQM A;  3V61 A;  1K8R B;  2KQS A;  2FBW B;  3TEY A;  3GE8 C;  3BK1 A;  3TJP A;  2EMT A;  1YN3 A;  4MH0 E;  4EZJ A;  2N0S B;  4OVU A;  2KKC A;  3EGR A;  4LK0 M;  1J8C A;  1EF1 A;  3Q8F A;  1FD6 A;  2DWQ A;  4WWN A;  4BAX A;  2RSU A;  1P3Q U;  2INC C;  3VH4 B;  2KC2 A;  3L54 A;  4GSW A;  5E6P A;  4K3B A;  4UDU C;  1V1P B;  1RM6 C;  2O6V B;  4TV3 A;  3TL5 A;  2MBH A;  3HUI A;  2LRU A;  2BWF A;  5DPS A;  4LNK A;  3V6C B;  3RNG C;  1QOG A;  2VZK D;  2KMA A;  4HEA 1;  3M3J A;  1XLN A;  4YTN B;  1V8C A;  2DLB A;  1UBQ A;  3APC A;  1SGH A;  4NNJ B;  3NVW A;  1AYF A;  1A5R A;  3VQI A;  4M02 A;  4HRS A;  2KWV B;  2J53 A;  1BXT A;  1HQR D;  4HCN B;  1SIJ A;  2BKR B;  1C9F A;  3Q8B A;  1QF6 A;  5HG2 A;  3PGE A;  3BVG A;  1V1P A;  2GBJ A;  3KWL A;  4KDI C;  2EKE C;  2WXO A;  2HE7 A;  2DZJ A;  3PRZ A;  4FJY A;  1ACC A;  3TEW A;  3FIL B;  4DHJ D;  1R4M B;  2ZPY A;  4W9F A;  3W1S C;  1WGK A;  2BTE A;  2CHW A;  5FR3 A;  1ENF A;  2BF8 B;  3R2T A;  1WXV A;  4P6V F;  5AUK A;  4GLS C;  3L17 A;  2ZZP B;  3KWV A;  5AEK B;  1UUP A;  1TS5 A;  2MW5 A;  2K3U A;  4AOF A;  1LXD A;  4BBN C;  4YXD B;  5E6J A;  5BYQ A;  2L0T A;  2MJE A;  2LMC A;  4C00 A;  4S0R A;  5AZF A;  3I3T B;  1WH3 A;  2QHO A;  4K7W A;  3ZVV A;  4EUT A;  4HKQ A;  2NCN A;  3FIL A;  1XLQ A;  3Q3M C;  4O1N A;  3RNE C;  3Q3F A;  1BT0 A;  2HDE A;  2IBI B;  2KVR A;  3NS1 A;  3RPF C;  1JRP A;  3AH7 A;  1RRB A;  2PTL A;  3DBH I;  1RFK A;  3T8M A;  5CHF A;  1T5X D;  3AM9 A;  2CR5 A;  3ZJV A;  1ZP0 B;  3LJ3 A;  4BVU C;  1WXM A;  1VZ8 A;  4W9I A;  5BYS A;  1ESF A;  4GDL B;  2LJI A;  3K9P B;  2DZK A;  4TKN A;  3GS2 A;  4E3C A;  1Y8R C;  1FM0 D;  4G0N B;  1F77 A;  1SSN A;  3L16 A;  4XWT A;  3NVZ A;  1WWT A;  4J6I A;  3KLS X;  4JGH B;  2L05 A;  2J0M A;  3ENE A;  4G50 A;  1KLG D;  2D3G A;  4DXA B;  1VZ7 A;  4XDD A;  2N9P C;  1SJE D;  2WQY B;  3Q6B A;  1TS3 A;  3N3K B;  4EFO A;  3DWG C;  4GDL A;  1E8Z A;  1NYQ A;  3EUB 2;  5HKH A;  3P63 A;  3U2S C;  1ZW7 A;  2KOX A;  1FXA A;  2MLB A;  4XC2 A;  4NJ7 A;  3HM6 X;  3SU8 X;  2I1J A;  2PVO D;  3A9K B;  5EE3 A;  3PZ7 A;  3R7Q A;  4HJK A;  4AJY B;  2Y5B B;  2L3Z A;  4I6N B;  2LD9 A;  2WDT B;  5EDS A;  5IOI A;  2ZNV B;  1J19 A;  2MHJ A;  1JCK B;  5JHA A;  1ET9 A;  3DWM A;  3ZRF A;  1GB1 A;  3P4R B;  4W9L A;  3ZRC A;  1WI0 A;  1VD2 A;  1WX9 A;  1WXA A;  3AU4 A;  2HD5 B;  3AE4 B;  1L2N A;  4PYU A;  3RUL A;  4ZRK A;  1GPX A;  4LTU A;  5EE0 A;  1WFY A;  4ITK A;  2VH1 A;  2K25 A;  3N1X C;  3R3M A;  3A9K A;  1ZDV A;  1E7V A;  4GMV A;  4L23 A;  1T6B X;  1WGY A;  3U4E G;  1TGZ B;  3R8B A;  1WMH B;  3J9C A;  4LLG M;  2FAZ A;  2MBQ A;  2WXN A;  4YWG G;  3M63 B;  3QAR A;  4RF0 A;  2A4Z A;  3PRP B;  3TIX A;  3AN1 A;  4US8 A;  2IY0 B;  1JRO A;  4H2A A;  2Y3A A;  5C3J B;  2MQJ A;  3MP9 A;  2WP9 B;  2GBK A;  4GU2 A;  4WJO A;  2ON8 A;  3W5U B;  1J7A A;  2CHZ A;  3A4S C;  3WAN A;  2FCS A;  1C76 A;  1AAR A;  4OZA A;  2K0P A;  1Y56 A;  3W9C B;  1SE3 A;  4C56 C;  2IPK D;  2FCN A;  3R66 C;  2WWZ A;  2L1A A;  2C60 A;  2L8J A;  4YSY B;  4HWI B;  2MSE D;  2DZI A;  3H8H A;  3AE6 B;  2AEH A;  4EEW A;  1C4C A;  4S17 A;  1WMH A;  4EKU A;  5LLI A;  1D3Z A;  1J7B A;  4NJ6 A;  4IM3 A;  3MHZ A;  4DK5 A;  3T3N A;  3E9S A;  4KSL C;  3PLV A;  1X1M A;  1PYW D;  2W9N A;  1HA5 A;  1OQQ A;  4HPL B;  3RN9 C;  4AWJ A;  4TQ0 A;  1WM3 A;  2CU3 A;  3VUY A;  1Q5W B;  3BYT B;  1P0R A;  1UF0 A;  1EF5 A;  2LGX A;  4IW0 A;  1P1A A;  1FXI A;  2D3C A;  3FKY A;  2K9X A;  4RNA A;  3BVZ A;  1V81 A;  2MRP A;  2JZP A;  3X23 A;  1WJ4 A;  4RGM A;  4JIO U;  2CHX A;  3NZU A;  2JRH A;  2KWD A;  1T0Y A;  4KZC A;  1T3Q A;  1WYG A;  3P4S B;  4ICU A;  2PIA A;  1DYQ A;  3RUI B;  2QIE B;  1KFY B;  1GNU A;  5TSS A;  3Q3O C;  3VTV A;  3VR9 B;  1MG4 A;  3AE7 B;  1E0Z A;  1HXY D;  2BKF A;  1TJE A;  4FAD A;  2UWQ A;  1V5T A;  2KNB A;  1N61 A;  4RFB A;  3GE3 C;  3QA8 A;  1HTO A;  3APD A;  1OTR B;  2H88 B;  2AQ1 B;  3N32 A;  4XWW A;  1RWS A;  1L0V B;  2NPT A;  3GP7 A;  4ZRJ A;  3DBR B;  2WU2 B;  3MJW A;  2JF5 A;  4ASW C;  1L0X B;  1WGH A;  1N5W A;  3ZKJ C;  4WAF A;  3AMZ A;  3AEC B;  3WAL A;  3NY5 A;  1QZE A;  2W82 A;  1E9M A;  1F9J A;  3NOB A;  4L2Y A;  1XCT L;  1FIQ A;  1BML C;  3AB5 A;  1K52 A;  2MP2 B;  4C7Y A;  2ZCC A;  1NYR A;  4IC7 B;  2N1W A;  3PRE A;  1WJU A;  4AS1 A;  2M1M A;  3M95 A;  2IGH A;  2NBV B;  3JSV A;  2N7E A;  4C7Z A;  1MI0 A;  3OAW A;  1NVI D;  3DBL B;  2QC8 A;  3DHH C;  1DOX A;  3E56 A;  2V0G A;  1C79 A;  2KLG A;  2MH7 A;  1UZX B;  1XT9 B;  2K5P A;  4WWM A;  3MHS D;  3QJZ A;  3CMM B;  3TSS A;  1VLB A;  2UYZ B;  1YQ3 B;  2KJ6 A;  2XNA C;  3VUW A;  3B08 A;  3IFW B;  2WXK A;  4HJG E;  1DOI A;  4US9 A;  2L76 A;  5D3I B;  1C1Y B;  2C9W B;  1E90 A;  2CJN A;  4ZYS A;  1FRR A;  2R2O A;  3OJ3 A;  2N7J A;  4JQW C;  5HFY A;  4ARC A;  1SJH D;  1C77 A;  2OHF A;  2AWT A;  4K81 A;  4CO7 A;  3OWE B;  2YEP F;  3Q3N C;  3ZO5 B;  4P1C C;  2JRI B;  2ZW0 A;  1ZUD 2;  2O2V B;  3UIP B;  2RMM A;  5D6J B;  1WR6 E;  3RI7 C;  2KWU B;  4YTP B;  4WQO B;  2Z59 B;  4MGI E;  3VRA B;  5D3D A;  3JYU A;  3SDL C;  2WHI A;  3PLU A;  2IZV B;  5IKC M;  1N6Z A;  3N20 C;  4W9D A;  1ZOY B;  2ZW1 A;  1YN4 A;  3ZIM A;  3U8Z A;  4C4V A;  4JX1 C;  2OJR A;  4FLH A;  1UEL A;  1F0Z A;  2RDG A;  3B2G A;  3HM3 A;  2PPH A;  1JWS D;  1MHX A;  2H89 B;  2KK8 A;  5HI1 A;  1SEB D;  1L4Z B;  2HJ1 A;  2NVU I;  4LCD E;  2BB5 A;  1RAX A;  2UU7 A;  2O2V A;  1I4Q A;  1ZXI A;  1EUV B;  1FRD A;  3P4P B;  1WR1 A;  3L13 A;  4GN1 A;  3PO0 A;  1ZGU B;  4GDK A;  2DAJ A;  1XLP A;  2BB6 A;  2K8B A;  1CZP A;  2IO3 B;  3U7D A;  2VRR B;  3DCG A;  3UF8 A;  2IDY A;  2LGI A;  2FCM A;  3JVZ X;  4ZRP A;  2L83 A;  3GZN B;  2W3R A;  5FR6 A;  4CQN A;  5FKA C;  2ZPN A;  1GAQ B;  2FNJ B;  2ONQ A;  2PLP A;  3PV1 A;  2ACZ B;  2KX0 A;  3IT6 B;  1R4M I;  1M4V A;  2Z0D B;  3H6N A;  3ZXR A;  1YOV B;  3OLM D;  2N9X A;  4DHZ E;  3ML8 A;  2NTT A;  4PK1 A;  5L83 A;  1KOT A;  1PDX A;  3D32 A;  4IUM B;  4KGT A;  4ANX A;  3P42 A;  3UIN B;  3IHP C;  2BGF A;  4TMA B;  3V62 A;  1S3S G;  2MJ3 A;  3AE5 B;  2QMT A;  3RZW C;  4NQL B;  1WRD B;  2LEK A;  2WXI A;  2DBY A;  5J18 A;  4TQ1 A;  2ZCB A;  4OW0 A;  1WIA A;  4M8M A;  1KH0 A;  5AUI A;  1WRI A;  1Z2M A;  3RNF C;  3CST A;  2JSV X;  1I4P A;  3N1Z C;  4J3O D;  1ZPS A;  4OZC A;  4BZA A;  2JYE A;  5LXI B;  5C1Z A;  1VR9 A;  4WWP A;  5TR5 A;  3TCA A;  3W5V B;  2PW9 A;  1B1Z A;  1C3T A;  2IGD A;  2WXM A;  1YNT E;  3VDZ A;  2R2Q A;  4P16 A;  4LDT D;  1I4G A;  3RYT A;  4MGZ E;  4IWQ A;  3IAS 1;  1QOF A;  3H7P B;  1V2Y A;  2X8X X;  1MJD A;  4M01 A;  2DAF A;  2WGS A;  5EE1 A;  4HRO A;  3DVN U;  4N6E B;  1VJK A;  2IO2 B;  5CHV C;  1EU4 A;  3PS6 A;  1PGX A;  2CJO A;  2KDF B;  1EWC A;  2ZJD A;  4DBG A;  1OQY A;  4N58 A;  3NVV A;  2GBN A;  3PSE B;  4BOS C;  2AL3 A;  2K22 A;  4RM8 A;  2KQ4 X;  4M8N A;  2G4S A;  1YJJ A;  5HHD G;  1LGR A;  4II2 B;  4ANV A;  3T3O A;  3RNB C;  2O6V D;  1UD7 A;  1SF0 A;  3H7P A;  3RNC C;  1SE2 A;  2KDE B;  2KN4 A;  1UGJ A;  3EA6 A;  3EC8 A;  3H9D A;  3AE9 B;  4LNF A;  4LJO B;  4MSQ B;  1WX7 A;  4PS8 A;  3VFK A;  2XK5 B;  5KHQ A;  3HVD A;  3CIR B;  2K1F A;  4L1B A;  4A55 A;  1B9R A;  3ZNZ B;  1WJN A;  3AU5 A;  3VVW B;  2D07 B;  2AL6 A;  3QQ8 B;  1E8W A;  3R2I A;  2KT7 A;  2LFI A;  3DHI C;  2WNM A;  1YIW A;  2WX0 A;  3B2F A;  1UWX A;  3QX1 A;  1GJZ A;  1TBE A;  3KQ4 A;  3N1Y C;  5BMH A;  2LUM A;  1GC7 A;  1D5M C;  3B9J A;  1FCL A;  4MJS B;  1VCB A;  2D3B A;  2FCQ A;  2GBM A;  2AQ3 B;  1JWB D;  3NUH B;  3BYY B;  2YVC A;  3OJ4 B;  4IG7 B;  1L7Y A;  1RFA A;  2XK5 A;  2I1K A;  3RZF A;  2LGY A;  2KFK A;  2WXJ A;  1WF9 A;  2JXT A;  2Y5C A;  2MX2 A;  3ALB A;  4HDQ A;  5FK9 C;  1ET6 A;  1L4D B;  3RMK C;  1YJI A;  1OEY A;  3A1Q B;  4A6Q A;  2JUO A;  1V9J A;  4A9A A;  4II3 B;  1WSP A;  4PS7 A;  4G11 A;  2LHD A;  4AP4 C;  1GB4 A;  4K3C A;  3WAM A;  4MJS A;  2REX A;  4KGR A;  2N1V A;  3Q69 A;  2NBW B;  3NG0 A;  5T8I A;  2DYM A;  3RNA C;  1NEK B;  3AV8 A;  5D2M B;  5G55 A;  4WAA A;  4GGQ A;  1HE8 A;  3U7Z A;  4KV2 A;  1QT9 A;  4FUL A;  2LRW A;  4DHZ B;  3A1Q A;  3SFD B;  1MFW A;  1IPG A;  2JZZ A;  1AW7 A;  1TS2 A;  1WGG A;  2HJ8 A;  3K9O B;  1QLB B;  1K51 A;  4FXC A;  2RD0 A;  2A5U A;  2WXF A;  3KYC D;  3VUX A;  4REZ A;  3ZUN A;  5J2R A;  4RGN A;  3X0W A;  3DHG C;  4EOY A;  1TY2 A;  5BMG A;  3ZNI D;  1IGD A;  5AZH A;  3ZW3 A;  1TIF A;  2N9K A;  1HZ5 A;  2NBU A;  2N7D A;  2CKH B;  2QEJ C;  1YD8 U;  3O13 A;  4BOZ B;  3IT4 B;  2C7M B;  2Q5W D;  4KGS A;  3I57 A;  3PTF C;  1I35 A;  1JWA D;  2FUG 1;  1F2R I;  5G2N A;  3AE8 B;  1ZXH A;  4AJW A;  2GLS A;  1Z5S B;  3V6E B;  1XXG A;  2XN9 C;  2J0J A;  1MG8 A;  3H7S A;  2IND C;  5BO4 B;  4IKG A;  1MHH E;  2IO1 B;  2NPT B;  4MSM B;  1HEZ E;  4HPM B;  3CWI A;  1V86 A;  3WIM A;  2AYO B;  2M8S A;  4GXB A;  1V97 A;  3LXF A;  2GI9 A;  1H8C A;  4E71 A;  4WJP A;  4RGO S;  3VTW A;  2GRI A;  4I6L B;  2JT4 B;  2N9L A;  3ZTC A;  3HHM A;  2WXQ A;  1N62 A;  2QIL A;  2KAC A;  1QOA A;  2IO0 B;  1JRU A;  4HPP A;  4B0E A;  4B95 A;  1V49 A;  1Q0W B;  2EEL A;  2EMS A;  5C2T B;  2L52 A;  3N9Y C;  4W9C A;  4P7I A;  1ZKH A;  1T0Q C;  2LZ6 A;  1K50 A;  2HTH A;  3HVZ A;  2HTM E;  3IBE A;  2SAK A;  4ARI A;  1S1Q B;  3JSV B;  2V4L A;  1IP9 A;  2FIF A;  4W9G A;  3WAO A;  3VXW A;  5GMV A;  3W1S A;  4OVV A;  5DCN A;  3SD5 A;  2WXH A;  3DVN V;  3Q2A C;  2JPH A;  1SE4 A;  3HK0 A;  1I42 A;  4AUQ C;  1GG3 A;  4NAW A;  4QAY A;  1A70 A;  1E8X A;  2V3P A;  2K8H A;  1C4A A;  3SEB A;  1WM2 A;  4DQO C;  1FO4 A;  2M19 A;  1JML A;  4HVB A;  3BVM A;  4NJC A;  1ROE A;  2L7R A;  2GBR A;  3MC8 A;  3GOE A;  1WX8 A;  4HDO A;  4W9E A;  3ZTD A;  4BKS A;  1C4P A;  1P7E A;  1SE9 A;  3V05 A;  1WZ3 A;  1DOY A;  3A9J B;  2WX1 A;  3C8Y A;  2IGG A;  1PFD A;  2K6Q A;  2LJ5 A;  3UI3 A;  2MA9 B;  2LVO A;  2XBB C;  2NMQ A;  4TUU A;  1E5W A;  4K7S A;  1E7P B;  1CMX B;  1JWU D;  3AEA B;  3PPA A;  2J52 A;  4C4V B;  3UIO B;  5IO9 A;  5G5G A;  5IN7 A;  1YX6 B;  1GC6 A;  1KRH A;  1RLF A;  2BQQ A;  2KX3 A;  5LNK 1;  1FNV A;  2BWE S;  2JWU A;  1YQB A;  4EZL A;  2KMC A;  2N4F A;  2C5L C;  3QHT A;  3GZN I;  5BYR A;  3R7R A;  3GB1 A;  3A9J A;  4PYZ A;  3WAP A;  1XF5 L;  2G9H D;  3W1Y A;  2JWZ A;  3DBS A;  3EFC A;  2KAJ A;  3UQA A;  3W2D A;  3DDC B;  3DOW A;  2MBO A;  1EWY C;  2B3A A;  1I7H A;  1UBI A;  2KHW B;  5E6O A;  4TSS A;  2KDB A;  4GDK B;  1V6E A;  2LHE A;  5CHW A;  3L0W B;  3NZ3 A;  3BZD B;  1TZO A;  1XD3 B;  2LVP A;  1R4N B;  2WS3 B;  4LNO A;  1VDV A;  2NR2 A;  2OOB B;  2VZK B;  3VAW A;  4NAM A;  1WE7 A;  2Z0E B;  3T9L A;  1VZ6 A;  3DVG Y;  3BIN A;  4RMA A;  4JE3 B;  1LQB A;  1XCQ L;  3IXS A;  5C23 A;  2LUE A;  3B1L X;  2KO3 A;  5JH5 C;  2BYE A;  1FNW A;  3ZDM C;  3EFU A;  5H8Y E;  3AI5 A;  4F7Z A;  2OJW A;  2J4X A;  3APF A;  1JWM D;  3QIJ A;  4EE2 A;  1Q10 A;  2AQ2 B;  3P1M A;  1HZ6 A;  4ZRQ A;  2WDV B;  3PVL A;  4WUR A;  2V9H A;  2BYV E;  3L08 A;  2LWP A;  1PGA A;  1YQ4 B;  4MGK E;  2KXJ A;  3IG3 A;  4DXF A;  4IM0 A;  4DHJ B;  4IM2 A;  4NZL B;  1ISN A;  2LGD A;  2J42 A;  4NY0 A;  2KTF A;  2OED A;  1PGB A;  2BPS A;  2PKO A;  2K8C A;  2KDI A;  3ONS A;  3I63 C;  2L32 A;  2INN E;  2MBB B;  2M17 A;  2LXA A;  3PZD A;  4HLE A;  2GMI C;  4F1S A;  3IVF A;  3KYD D;  1AN8 A;  1BUI C;  4N59 A;  1I4H A;  1STE A;  1FCC C;  1FPY A;  1N60 A;  3NJT A;  3WCQ A;  2PE9 A;  4B6W A;  3ZQ4 A;  3Q14 C;  3A33 B;  3VHT C;  1QQR A;  1KLV A;  1I4X A;  1TS4 A;  3RFZ B;  2KTR B;  1SBB B;  3FAH A;  1YN5 A;  1JQ4 A;  2JYT A;  3LDZ E;  3L4P A;  2BVC A;  4C80 A;  3PRM B;  3AEG B;  3HRD D;  1CK1 A;  3PHW B;  2DEN B;  4GIV A;  2JVC A;  1P7F A;  3TUO A;  1N63 A;  1MPE A;  4KSK C;  4OVZ A;  1EU3 A;  2M0X A;  2LXC A;  3V60 A;  2Y5P A;  4XDC A;  1YX5 B;  2J0K A;  5DPR A;  3KW5 B;  5JXV A;  1XO3 A;  4WIP A;  1L6U A;  1E10 A;  3KH0 A;  4RH6 A;  1WGR A;  4NQK E;  1U4A A;  4HXD A;  2MJD A;  2KVZ A;  2YEP B;  2G1E A;  2KTR A;  2O6V A;  4XX5 A;  5IAA C;  1E7U A;  2RR9 A;  3QCA A;  4HKZ E;  4IOI E;  4NPN A;  4A20 A;  1KTK A;  2K6D B;  5IA7 A;  3AEB B;  3QWZ B;  1P98 A;  2KWC A;  3NHE B;  1OEY J;  3DPD A;  2JU6 X;  2E6X A;  3ZJT A;  4GB9 A;  4FHK A;  2KYW A;  3ML9 A;  4MAC A;  4OZB A;  3A4R A;  2G3Q B;  1CQV A;  3MJ5 A;  1EM7 A;  5EE9 A;  2PEA A;  4KIK B;  3ZJU A;  1T0R C;  4IWO A;  1IGC A;  4XZ4 A;  3DVG X;  3I5J C;  1TKY A;  3MC9 A;  4XE0 A;  3ABV B;  3Q3J A;  3C19 A;  3AEE B;  2M4N A;  1EO6 A;  3UGB B;  4ZHP A;  1TTN A;  2MWS B;  1V80 A;  2SEB D;  1F2R C;  3OG5 A;  1SXT A;  2NS5 A;  2GB1 A;  2KFK B;  2TSS A;  3S2A A;  2KFJ A;  2INP E;  1QIL A;  1FMA D;  1VRA B;  1YJ1 A;  3AEF B;  4WJQ A;  5GXG B;  2DYB A;  3O65 B;  3Q8E A;  2BYF A;  1FFU A;  3WA0 A;  3BY4 B;  4ZYN A;  1KF6 B;  1FNU A;  5DPT A;  4KIK A;  1NBF C;  1NEN B;  3CF6 E;  3HIZ A;  4YL8 A;  1MVK A;  4ZRI A;  4BFR A;  3ZLZ A;  3AXC A;  4IWP A;  1G6J A;  3AED B;  2KAN A;  3KUD B;  3NVY A;  1TKE A;  4G3X B;  1E8Y A;  4BBN F;  4A90 A;  4YTM B;  4E74 A;  2MCN B;  3ZNH B;  2D5G A;  3N30 A;  1OQR A;  3BWU D;  2BW2 A;  2BYT A;  4XYC A;  2DX5 B;  2IY1 B;  2RPQ A;  2I38 A;  1I4R A;  4JWS C;  4PS3 A;  5CTR C;  1WXQ A;  4USA A;  4FN2 A;  4A3P A;  2V4I B;  4ANW A;  3KUZ A;  3ZYY X;  2C7N B;  3DBH B;  1SIF A;  4BKG A;  2DZM A;  1JW9 D;  3TEX A;  3C0R B;  3ECI A;  2VH2 A;  2B76 B;  1V5O A;  3I9V 1;  1WY8 A;  1TY0 A;  2WXL A;  5MPO A;  2FID A;  3ZGZ A;  3TBL D;  2QCZ A;  3AE3 B;  1UGM A;  2ZVN A;  3AE2 B;  5J17 A;  1H4R A;  1OFF A;  2JXX A;  1UWM A;  1WE6 A;  4B0M A;  2KJH B;  3VH3 B;  4R3D A;  4YSZ B;  1QKZ A;  4F8C B;  1PUT A;  3U52 E;  4WJN A;  4MM3 B;  4FBJ B;  4D2K A;  3ZDT A;  4ACF A;  3U30 A;  4LJP B;  3BK2 A;  2V1Y A;  1HTQ A;  3SFE B;  1KJT A;  4ZDV A;  4LNN A;  3ZNG C;  3DBR I;  1DGJ A;  4KDL B;  3P4Q B;  4FA6 A;  4MT5 A;  4RM9 A;  2BBC A;  2IYD B;  2WDR B;  4YSX B;  3Q8A A;  2G45 B;  2V3N A;  4I6P A;  4A8X C;  1ZE3 D;  4KVG B;  5KHO A;  2ZVO A;  4MM3 A;  4RCO A;  3UQB A;  4MH8 A;  1NI2 A;  5CX3 A;  1CJE A;  2WYQ A;  3FC4 A;  2BS3 B;  2D3A A;  3QK0 A;  3M62 B;  1ZDX A;  3IAM 1;  1IBX B;  3MC0 B;  4JL9 A;  3NRZ A;  2PMV A;  1AWD A;  5JHB A;  4B9K A;  4NAW B;  4MEM A;  2KJR A;  3DBL I;  4RGT A;  4Q2J A;  3QC8 B;  3BII D;  2KQ7 A;  3NZS A;  4MGY E;  1TYG B;  1WJ6 A;  2FE8 A;  5DPW A;  1IYF A;  1XQQ A;  3PT2 B;  2W54 A;  4KX6 B;  5I4D A;  4FJZ A;  4MEL A;  1L6V A;  3VTU A;  3KUC B;  2FUH B;  1T0S C;  2XEW A;  2RDH A;  1F1H A;  4PT5 A;  2KDM A;  3SHQ A;  2R61 A;  1NI3 A;  1WYW B;  1UH6 A;  4HCP B;  4JWU C;  2EKI A;  3SR6 A;  2WXP A;  5JZE B;  3V3X A;  2MBE A;  2MEK A;  2M56 B;  5IP4 D;  5L95 C;  4XGA B;  4KKI A;  1IBX A;  1N5X A;  4W9H A;  3AE1 B;  4KZ0 A;  2PVG C;  2JY6 A;  2QJL A;  1F52 A;  3QAQ A;  2LI5 A;  3PHX B;  2I2Y A;  1R7S A;  1WGD A;  3H1U A;  3TMP B;  2ICI A;  5E6N A;  2QSD A;  1LFD A;  4K1R B;  4WWO A;  3MFG A;  1KM7 A;  5BMI A;  3EHV A;  3CSF A;  1KLU D;  1SB3 C;  2V3S A;  2RPV A;  1WXS A;  3B0A A;  3RD2 A;  4AQ7 A;  1C78 A;  1LO5 D;  3KVF B;  2W55 A;  1K53 A;  2RDB C;  1R4N I;  4IDI A;  1FEH A;  2G4D B;  2IJ0 A;  1P9D U;  2W3S A;  4FHJ A;  1XEE A;  2E3T A;  3ETR A;  2AX5 A;  3RT3 B;  1OGW A;  2JX5 A;  3TEZ A;  5H92 C;  3DQV A;  2BT6 A;  2KMM A;  2M0A A;  2DYO A;  1GUA B;  4JLC A;  4ANU A;  3URY A;  1IUE A;  5LXH A;  2QDF A;  2LAS A;  2KC1 A;  2WLB A;  4N9F 4;  2N9E B;  1NDD A;  2DHZ A;  1WZ0 A;  3LYY A;  2NTS A; 
#chains in the Genus database with same CATH homology
 1STE A;  1FCC C;  1N60 A;  4YSY B;  3WCQ A;  4JPS A;  3H8H A;  3AE6 B;  4KKJ A;  3ZQ4 A;  3R2I A;  1L5P A;  1QQR A;  2LFI A;  1I4X A;  3VRB B;  2WNM A;  1TKG A;  1C4C A;  1TS4 A;  4WH4 A;  1V1O A;  3B2F A;  1UWX A;  1FFV A;  5D7G A;  4ZHO A;  3RFZ B;  1J7B A;  1SBB B;  3FAH A;  1YN5 A;  3MHZ A;  3T3N A;  1JQ4 A;  2JYT A;  3E9S A;  1QOB A;  3L4P A;  1J7C A;  2WU5 B;  3KQ4 A;  4A55 A;  5BMH A;  2LUM A;  1PYW D;  3B9J A;  1D5M C;  4C80 A;  1HA5 A;  3PZ8 A;  3AEG B;  3HRD D;  1FCL A;  1OQQ A;  5G5H A;  1GOZ A;  2WDQ B;  1CK1 A;  2AQ3 B;  1JWB D;  1RYJ A;  3NUH B;  4TQ0 A;  3BYY B;  1D5X C;  2CU3 A;  1P7F A;  3TUO A;  1N63 A;  3BYT B;  1MPE A;  1FXI A;  1UNS A;  4OVZ A;  2K9X A;  1EU3 A;  3BVZ A;  4RNA A;  2WXJ A;  2JXT A;  2Y5C A;  1D5Z C;  2Y5P A;  2JZP A;  4XDC A;  4RGM A;  1L0Y B;  5FK9 C;  3VR8 B;  5JXV A;  1XO3 A;  2KWD A;  1ET6 A;  1L4D B;  1XLO A;  4WIP A;  1JAL A;  1L6U A;  1T3Q A;  1WYG A;  3P4S B;  1YJI A;  4RH6 A;  4A6Q A;  1E10 A;  2PIA A;  1DYQ A;  2QIE B;  1KFY B;  2WXG A;  4A9A A;  2MJD A;  2JQR B;  5TSS A;  1WSP A;  2YEP B;  2BS2 B;  2G1E A;  3AE7 B;  3VR9 B;  1E0Z A;  2Z8L A;  1HXY D;  1TJE A;  2L1A A;  2LHD A;  1N61 A;  4RFB A;  1GB4 A;  2BS4 B;  4HKZ E;  4IOI E;  4DXG A;  4KGR A;  3Q69 A;  1KTK A;  2X38 A;  2H88 B;  4ZOH C;  2AQ1 B;  4XWW A;  3AEB B;  1RWS A;  5T8I A;  3Q8C A;  1L0V B;  3GP7 A;  2DYM A;  1NEK B;  2JU6 X;  3AV8 A;  1D4B A;  3LB8 C;  2E6X A;  3ZJT A;  1YMH E;  2WU2 B;  3U7Z A;  4OHJ A;  1L0X B;  4YT0 B;  1N5W A;  4MAC A;  4WAF A;  4OZB A;  3AMZ A;  2WXR A;  3AEC B;  4RF1 A;  1QT9 A;  2W82 A;  1E9M A;  1CQV A;  3MJ5 A;  1EM7 A;  1D6E C;  1E6E B;  5EE9 A;  3SFD B;  4L2Y A;  4M0W A;  1XCT L;  3ZJU A;  1AW7 A;  1FIQ A;  1BML C;  1TS2 A;  1IGC A;  3AB5 A;  1K52 A;  4WQM A;  1TKY A;  4XE0 A;  2FBW B;  3ABV B;  1QLB B;  3TEY A;  4C7Y A;  1K51 A;  4FXC A;  3BK1 A;  3AEE B;  2WXF A;  1NYR A;  4REZ A;  1YN3 A;  4ZHP A;  4AS1 A;  4RGN A;  2N0S B;  2SEB D;  2IGH A;  1F2R C;  1TY2 A;  5BMG A;  1SXT A;  1MI0 A;  3EGR A;  1IGD A;  2GB1 A;  2TSS A;  4C7Z A;  1NVI D;  2N9K A;  1HZ5 A;  2INP E;  4LK0 M;  1QIL A;  1FMA D;  1DOX A;  1VRA B;  2QEJ C;  3Q8F A;  1FD6 A;  2DWQ A;  3AEF B;  3O13 A;  5GXG B;  3E56 A;  3IT4 B;  2V0G A;  3Q8E A;  1FFU A;  1C79 A;  2Q5W D;  2MH7 A;  2K5P A;  4WWM A;  4KGS A;  3I57 A;  1KF6 B;  4UDU C;  1FNU A;  1JWA D;  1V1P B;  1F2R I;  2FUG 1;  3TSS A;  1RM6 C;  1VLB A;  3AE8 B;  1NEN B;  1ZXH A;  1YQ3 B;  2XNA C;  3HUI A;  2WXK A;  4HJG E;  1DOI A;  4US9 A;  5D3I B;  1MVK A;  1XXG A;  2XN9 C;  2CJN A;  4ZYS A;  1FRR A;  1QOG A;  2VZK D;  2N7J A;  5HFY A;  4ARC A;  1SJH D;  3AED B;  1C77 A;  4HEA 1;  4IKG A;  1MHH E;  2OHF A;  1XLN A;  4YTN B;  1HEZ E;  3OWE B;  2YEP F;  1V8C A;  3NVY A;  1TKE A;  2DLB A;  3CWI A;  3NVW A;  1AYF A;  1V97 A;  4A90 A;  3VQI A;  4HRS A;  3LXF A;  4YTM B;  2ZW0 A;  2GI9 A;  1ZUD 2;  2J53 A;  1BXT A;  1HQR D;  2RMM A;  2D5G A;  1SIJ A;  4RGO S;  1C9F A;  4YTP B;  3Q8B A;  1OQR A;  3BWU D;  1QF6 A;  2BW2 A;  2GRI A;  2BYT A;  5HG2 A;  3VRA B;  2N9L A;  5D3D A;  2WXQ A;  1N62 A;  2I38 A;  3BVG A;  1I4R A;  1V1P A;  4JWS C;  1ZOY B;  3KWL A;  2ZW1 A;  1YN4 A;  2QIL A;  2KAC A;  2WXO A;  1QOA A;  4JX1 C;  1WXQ A;  4B0E A;  4USA A;  2EEL A;  2V4I B;  5C2T B;  2L52 A;  1ACC A;  3TEW A;  3N9Y C;  3ZYY X;  3FIL B;  1F0Z A;  2RDG A;  1K50 A;  3B2G A;  3HVZ A;  2HTM E;  1WGK A;  2BTE A;  2SAK A;  4ARI A;  1JWS D;  1MHX A;  2H89 B;  5FR3 A;  1ENF A;  1JW9 D;  3TEX A;  5HI1 A;  1SEB D;  1L4Z B;  3R2T A;  2B76 B;  3W1S A;  2BB5 A;  3I9V 1;  2WXH A;  4P6V F;  5AUK A;  1TY0 A;  4GLS C;  2WXL A;  1SE4 A;  3KWV A;  1I4Q A;  1UUP A;  1ZXI A;  1TS5 A;  5MPO A;  3ZGZ A;  2K3U A;  1FRD A;  1A70 A;  3P4P B;  3AE3 B;  2V3P A;  4YXD B;  5E6J A;  5BYQ A;  1C4A A;  3AE2 B;  3PO0 A;  2MJE A;  2LMC A;  3SEB A;  1OFF A;  1UWM A;  1XLP A;  2BB6 A;  4DQO C;  1CZP A;  1FO4 A;  2M19 A;  4B0M A;  1JML A;  3BVM A;  2IDY A;  4NJC A;  2LGI A;  4R3D A;  4YSZ B;  1QKZ A;  1ROE A;  1PUT A;  3U52 E;  4ZRP A;  2L83 A;  4CQN A;  2W3R A;  4MM3 B;  5FKA C;  4HKQ A;  3FIL A;  1XLQ A;  4O1N A;  4D2K A;  1GAQ B;  2HDE A;  3NS1 A;  2ONQ A;  2PLP A;  3RPF C;  1JRP A;  3AH7 A;  1C4P A;  1P7E A;  2PTL A;  2ACZ B;  3V05 A;  3IT6 B;  3BK2 A;  1RFK A;  1DOY A;  1M4V A;  1T5X D;  3C8Y A;  3AM9 A;  2IGG A;  3ZJV A;  3SFE B;  1ZP0 B;  1PFD A;  1VZ8 A;  1DGJ A;  3UI3 A;  3P4Q B;  2NTT A;  4MT5 A;  2BBC A;  5BYS A;  2NMQ A;  1ESF A;  2WDR B;  4GDL B;  1PDX A;  4YSX B;  2LJI A;  4KGT A;  3GS2 A;  1E7P B;  3P42 A;  3Q8A A;  1JWU D;  3AEA B;  1FM0 D;  2J52 A;  2V3N A;  4TMA B;  1F77 A;  5G5G A;  1ZE3 D;  4A8X C;  1SSN A;  4XWT A;  1KRH A;  5LNK 1;  2MJ3 A;  1FNV A;  3AE5 B;  4RCO A;  2QMT A;  2JWU A;  3NVZ A;  1WWT A;  4MH8 A;  3KLS X;  1CJE A;  2LEK A;  3FC4 A;  2BS3 B;  2WXI A;  5BYR A;  3GB1 A;  1KLG D;  2DBY A;  4TQ1 A;  1XF5 L;  2G9H D;  1ZDX A;  1VZ7 A;  3IAM 1;  1IBX B;  4OW0 A;  2NTS A;  3MC0 B;  2KAJ A;  4XDD A;  3NRZ A;  3W2D A;  2PMV A;  1KH0 A;  1SJE D;  1AWD A;  5AUI A;  1WRI A;  4NAW B;  1EWY C;  2WQY B;  1TS3 A;  4RGT A;  4Q2J A;  1I7H A;  3DWG C;  1NYQ A;  4TSS A;  2JSV X;  1I4P A;  3BII D;  3EUB 2;  4GDK B;  1ZPS A;  4J3O D;  1TYG B;  2LHE A;  3P63 A;  3U2S C;  2FE8 A;  4OZC A;  1FXA A;  2JYE A;  3NZ3 A;  3BZD B;  2PVO D;  1TZO A;  2W54 A;  5EE3 A;  4KX6 B;  3PZ7 A;  5I4D A;  2WS3 B;  1VDV A;  1VR9 A;  1L6V A;  2VZK B;  2RDH A;  4NAM A;  3W5V B;  2PW9 A;  1B1Z A;  4PT5 A;  2IGD A;  2KDM A;  1VZ6 A;  2R61 A;  1NI3 A;  4JE3 B;  2WXM A;  1YNT E;  4JWU C;  2EKI A;  1JCK B;  3SR6 A;  1XCQ L;  1ET9 A;  2WXP A;  4P16 A;  3DWM A;  1I4G A;  3IXS A;  1GB1 A;  3V3X A;  3IAS 1;  2MEK A;  3P4R B;  2M56 B;  1QOF A;  4KKI A;  1IBX A;  1FNW A;  1N5X A;  3AE1 B;  5H8Y E;  2PVG C;  5EE1 A;  2QJL A;  2J4X A;  3AE4 B;  4HRO A;  4N6E B;  1VJK A;  2I2Y A;  1R7S A;  1JWM D;  4EE2 A;  1Q10 A;  2AQ2 B;  3P1M A;  1HZ6 A;  4ZRQ A;  2WDV B;  2ICI A;  1GPX A;  2QSD A;  4LTU A;  1EU4 A;  5EE0 A;  4WUR A;  3MFG A;  4ITK A;  1PGX A;  2CJO A;  1EWC A;  5BMI A;  1PGA A;  4N58 A;  3NVV A;  1YQ4 B;  1ZDV A;  2K22 A;  1KLU D;  1SB3 C;  2KQ4 X;  4DXF A;  1YJJ A;  4L23 A;  5HHD G;  1T6B X;  2RPV A;  3U4E G;  4AQ7 A;  4NZL B;  1C78 A;  3R8B A;  1LO5 D;  2W55 A;  1K53 A;  3J9C A;  4IDI A;  4LLG M;  2WXN A;  1FEH A;  2J42 A;  3T3O A;  2IJ0 A;  2OED A;  4YWG G;  1PGB A;  2PKO A;  2W3S A;  4RF0 A;  1XEE A;  2E3T A;  3ETR A;  2AX5 A;  3AN1 A;  1SF0 A;  4US8 A;  2JX5 A;  3TEZ A;  1JRO A;  1SE2 A;  2KN4 A;  5H92 C;  4H2A A;  1UGJ A;  2BT6 A;  3EA6 A;  2L32 A;  2KMM A;  2INN E;  2M0A A;  2Y3A A;  5C3J B;  3AE9 B;  2DYO A;  3MP9 A;  2WP9 B;  2ON8 A;  3URY A;  3W5U B;  1J7A A;  1IUE A;  3HVD A;  3CIR B;  1C76 A;  2WLB A;  4L1B A;  4OZA A;  2K0P A;  1AN8 A;  1Y56 A;  1SE3 A;  3W9C B;  4C56 C;  3LYY A;  1BUI C;  2IPK D;  4N59 A;  1B9R A;  1I4H A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...