3LB8C

Crystal structure of the covalent putidaredoxin reductase-putidaredoxin complex
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
104
structure length
104
Chain Sequence
SKVVYVSHDGTRRELDVADGVSLMQAAVSNGIYDIVGDCGGSASCATCHVYVNEAFTDKVPAANEREIGMLESVTAELKPNSRLSCQIIMTPELDGIVVDVPDR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putidaredoxin reductase
publication title Crystal structure of the putidaredoxin reductase x putidaredoxin electron transfer complex.
pubmed doi rcsb
source organism Pseudomonas putida
molecule tags Oxidoreductase/electron transport
total genus 27
structure length 104
sequence length 104
chains with identical sequence D
ec nomenclature
pdb deposition date 2010-01-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00111 Fer2 2Fe-2S iron-sulfur cluster binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 3lb8C00
1RM6C 3SFDB 2MJDA 1FRDA 2KMMA 2K22A 3PO0A 3AECB 3AM9A 3P4RB 2WQYB 3AH7A 5H8YE 4ZHPA 1DOIA 2KAJA 3AE5B 1J7AA 1DOYA 2BS3B 1V97A 4JWSC 2L83A 2G1EA 1GAQB 1F0ZA 1QLBB 2K9XA 2PVOD 3NVWA 4YSXB 1FXIA 1T3QA 2B76B 1ROEA 4C7ZA 1VLBA 1WYGA 3ZYYX 1DOXA 2MJ3A 3W9CB 3AE2B 1N63A 3LXFA 2WLBA 1FMAD 1AWDA 1JRPA 2BT6A 3AE1B 3AN1A 4LTUA 1UWMA 4ZOHC 1RYJA 4YTPB 1FFVA 1V8CA 1NVID 1FM0D 3NVVA 1FFUA 3EUB2 1J7BA 1QOBA 2WDVB 1KFYB 2QJLA 1KF6B 2CJNA 3B2GA 3P4SB 1JWBD 1N5XA 1NENB 4YT0B 4C80A 3W5UB 4YTMB 2FBWB 3AE7B 2H88B 1PUTA 2WDRB 1OQRA 1TYGB 4WWMA 1JALA 1XLQA 1I7HA 1VDVA 1L5PA 2EKIA 1IUEA 3AE3B 3P4QB 1QF6A 2PIAA 1TJEA 1WRIA 1N61A 1CZPA 3NS1A 1JROA 1QOGA 3P63A 2PVGC 4JX1C 1L6VA 1CJEA 1XLNA 1TKEA 3DWGC 4N59A 1R7SA 1FRRA 3AV8A 3NVYA 2CJOA 5C2TB 3RPFC 3AEEB 5AUKA 4YXDB 1B9RA 1JWAD 4P6VF 1E7PB 3W5VB 1WXQA 1RWSA 1WGKA 3FAHA 3SFEB 3VRAB 1FO4A 1OQQA 1JQ4A 2L52A 1NI3A 2MJEA 1E6EB 4A9AA 4N58A 1NEKB 2CU3A 2HTME 1ZUD2 3VRBB 3HUIA 5MPOA 1A70A 2WP9B 2K5PA 4FXCA 4HRSA 5H92C 1XO3A 1YQ4B 2W54A 5G5GA 1QT9A 3AE6B 1DGJA 3CIRB 4US8A 3HVZA 4N6EB 1N5WA 3HRDD 1N62A 2M56B 2N0SB 3NVZA 1WWTA 1E0ZA 2W3RA 1SIJA 1L0VB 1NYQA 2DBYA 1N60A 5G5HA 1FIQA 1E10A 3ETRA 3B2FA 1NYRA 2ACZB 3DWMA 3AE9B 3AEFB 1QOAA 2WU5B 3SR6A 2H89B 2JX5A 3AEAB 3KWLA 4C7YA 1QOFA 3NRZA 1SB3C 1EWYC 1SF0A 2DWQA 3AB5A 3VR8B 2Y5CA 1ZP0B 2W55A 1XLPA 4HROA 1XLOA 3AEDB 2AX5A 5EE9A 3L4PA 3AMZA 4YSYB 5EE3A 5GXGB 1E9MA 2OHFA 2WS3B 2WU2B 3AE8B 1PFDA 4KX6B 4JWUC 1L6UA 3P4PB 3LB8C 1J7CA 2Q5WD 5EE0A 2M19A 2PKOA 1YQ3B 3BIID 1GPXA 2W3SA 5EE1A 1YJIA 1YJJA 1JW9D 2JQRB 2E3TA 3CWIA 3WCQA 3P1MA 4YSZB 1OFFA 3VR9B 4US9A 4USAA 3AEBB 1PDXA 4WQMA 2WDQB 3AEGB 1RFKA 1ZXIA 3FC4A 1FXAA 1ZOYB 3B9JA 4IDIA 2LEKA 3ABVB 4ITKA 4YTNB 1TKGA 2BS2B 1KRHA 5AUIA 3AE4B 4ZHOA 1TKYA 2MH7A 2BS4B 5C3JB 1VJKA 1AYFA 2QIEB
chains in the Genus database with same CATH superfamily
3PO0A 4JIOU 1QILA 1WZ3A 2Y5PA 1F0ZA 2ZPYA 3NVWA 4LK0M 3ZXRA 3JSVA 1VLBA 3A9KA 3W9CB 2IYDB 4RH6A 1TS4A 1HXYD 2EMSA 2YVCA 4II3B 2Z59B 2CHWA 3QX1A 1FM0D 2D2QA 1J7BA 1GC7A 3TEWA 2QILA 3PTFC 1ZXHA 5J17A 2YEPB 4FULA 5D7GA 4LJOB 4C00A 4KGTA 3IAS1 2KDFB 1NDDA 1E8XA 1EM7A 2O2VA 1AN8A 5JZEB 5AUKA 3TEZA 3U7DA 4BOZB 2PE6B 2KKCA 1WXQA 1RWSA 3IXSA 3N32A 2Y3AA 2CU3A 1T0RC 3QJZA 3O65B 1V5TA 1WMHB 4FA6A 3GZNB 1GOZA 1WX8A 5HG2A 3BZDB 1UZXB 4TUUA 5DPTA 3Q8EA 4MM3A 4OW0A 2KFJA 3U30A 4XZ4A 1UGJA 2Y5CA 3R8BA 2AQ3B 3ZTDA 4OVZA 3QA8A 1JMLA 3B08A 1EF1A 4KX6B 4FLHA 2INDC 3BINA 1PGBA 2OJRA 2NMQA 2DZIA 3BIID 2L1AA 4OVVA 1OFFA 5KHOA 1XQQA 1PDXA 1E7UA 3N1YC 4BBNF 1TKGA 5FKAC 1TKYA 2MH7A 3AM9A 2KYWA 5D94A 4ICVA 4GU2A 4FBJB 3DCGA 4A55A 1QLBB 4ASWC 1TZOA 3TCAA 1P3QU 3ML8A 3IFWB 4A8XC 2LRWA 1IBXA 1WFYA 1WJ4A 1JRPA 5HFYA 2KZRA 4BZAA 4MSMB 3M3JA 3NG0A 2QJLA 3RN9C 4K7UA 3KUZA 2FBWB 1PUTA 3RNCC 1OQRA 1KTKA 4WJNA 1V1PB 1X1MA 2UU7A 3NUHB 2EMTA 4K7SA 3UQBA 1H8CA 2V4IB 1C79A 1P7FA 3L54A 4P6VF 1UELA 4A9AA 3OLMD 2BYFA 3EFCA 2WP9B 4HRSA 4DXFA 2K1FA 4A90A 3CIRB 2KX3A 1N5WA 4WJPA 3X0WA 1T6BX 2VH2A 2KC1A 1JWMD 3EC8A 1HZ5A 2SEBD 1K52A 4PYZA 3HM6X 4FHKA 1QOAA 3AEAB 3QIJA 3KLSX 3PRPB 4YL8A 1ET6A 5D3DA 3DHIC 4C56C 1XLPA 2GOWA 3A1QA 5G2NA 1WGRA 2K3UA 2ZVNA 4UDUC 4RNAA 4XC2A 4HCPB 1LQBA 3LB8C 1RRBA 3TL5A 3PLVA 2LJIA 2JQRB 5DPSA 4PK1A 3WCQA 4EE2A 3L17A 2OJWA 3ECIA 5AZGA 4YTNB 4BOSC 2LVPA 2ZW1A 2MCNB 4C4VB 2WQYB 2ONQA 3PVLA 4B9KA 3BVZA 2ZEQA 4IM0A 1YJ1A 1DOXA 1SJED 4W9GA 1UH6A 3Q2AC 1VRAB 1MVKA 4RM8A 2JWZA 2G45B 1RYJA 1C3TA 4KZ0A 3DHGC 3GP7A 4HWIB 4GSWA 3B2GA 4EOYA 1N5XA 4RGTA 3AXCA 1MPEA 1LFDA 2RSUA 4KVGB 3ZNZB 4HPLB 4KGSA 1TYGB 2KACA 4IW0A 5JHAA 3W2DA 2Y5BB 1I4GA 1BUIC 3MC9A 1WM2A 5C1ZA 4LNKA 3M62B 2BB5A 1UNSA 3Q69A 3KWVA 1EU4A 1WSPA 4GB9A 1JRUA 4AJWA 4GDKB 4DXAB 1QT9A 3HVDA 3U8ZA 5KHQA 1U4AA 3N1XC 1TBEA 2V4LA 4TQ1A 2NBUA 3ZJUA 3R7RA 1F77A 2IY0B 3R3MA 1ZP0B 1A5RA 1D5MC 3L4PA 4W9KA 4M0WB 1KM7A 2INCC 4ANVA 4HXDA 3P4PB 3NZSA 4CHKA 2RDGA 4XGAB 2M19A 2WXLA 1YJIA 2BKRB 2MSED 4JPSA 4IUMB 2BS2B 3LYYA 4JWSC 2K6DB 2IDYA 5C23A 4RM9A 4F1SA 3AE5B 3ZJVA 1M4VA 1WGGA 3M95A 4DXGA 2VZKB 1WXAA 2KTFA 3EA6A 3HK0A 2DLBA 1DYQA 1EO6A 3R2TA 2N9LA 5AZHA 5FR6A 2KDMA 1L0XB 3Q3NC 4YT0B 2KJHB 4HJKA 3IT4B 4LNIA 3N3KB 3ZUNA 3DQVA 2IO1B 3UI3A 4F8CB 5CTRC 1N61A 2PEAA 1WRDB 2D5GA 3DWGC 3W1SA 4NY0A 1P1AA 4EZLA 3VTVA 3LJ3A 2MP2B 1NI3A 5IAAC 4OZCA 2Z0EB 2N1VA 1A70A 2KQSA 3BK2A 3AE6B 3VUYA 1UGMA 4MGZE 1GUAB 1WJUA 1TS5A 2KT7A 1FEHA 2JYEA 5IOIA 2WXHA 3ETRA 1IGDA 3AEFB 3SR6A 1NI2A 1P0RA 1EWYC 4GOCA 3KW5B 5AZFA 3TUOA 4FN2A 4BFRA 4NJ6A 4W9HA 2WXNA 3DBHI 3N9YC 3DOWA 5L83A 1N6ZA 3DBSA 1E90A 3WIMA 5G55A 2W3SA 2QHOA 3V3XA 3WALA 3VXWA 2V3SA 2KDBA 2KTRA 3RUIB 2LEKA 3RZWC 1D3ZA 1GB1A 1DOIA 2BS3B 2O6VD 1FXIA 5T8IA 2FIDA 3U4EG 4L1BA 4GGQA 4WAFA 2K25A 2D3GA 2JZ3B 3OJ4B 5CHFA 3NVVA 4GDLA 2KANA 4AJYB 3P4SB 3HM3A 1I4RA 4A3PA 3OJ3A 4NZLB 2R61A 4WWMA 1YQBA 4KKIA 1JALA 1F1HA 1WIAA 4KIKB 1L2NA 4FHJA 4NJCA 2GI9A 2CJOA 3V62A 2RDHA 1JWAD 4KSLC 2DZKA 2JY6A 3VRAB 2LI5A 2N7DA 1GB4A 1XXGA 1L7YA 2FE8A 3UF8A 1HQRD 2NPTA 1E0ZA 3AU4A 4DHZE 2BWFA 1PGXA 1YD8U 2ACZB 3MHZA 2G9HD 4WWNA 1L0YB 5IO9A 2M17A 4QAYA 3WAMA 2WX1A 4XDCA 3TEXA 2MBEA 2L00B 2AYOB 2WU2B 4MSQB 1B1ZA 1TGZB 2I38A 1CK1A 2WXQA 4K3CA 5LNK1 1JW9D 4MGYE 2E3TA 3VFKA 1OEYA 3QWZB 2JWUA 1VCBA 4FJZA 5E6OA 4NNJB 3VAWA 4MH0E 4ZHOA 2M1MA 3P42A 2BGFA 3HHMA 1Y56A 4AP4C 1LGRA 5DCNA 4KDLB 3ZRCA 3RCZA 3R66C 4EKUA 3B0AA 2GBKA 2WLBA 2WXKA 2IZVB 2GMIC 1V6EA 4LTUA 3RYTA 2JZZA 3L16A 3GOEA 1SIFA 1QOBA 4R3DA 2QDFA 4EUTA 3RNEC 1QKZA 2EKIA 3P4QB 2V1YA 1QOGA 1TKEA 4B0EA 1WR6E 4MGIE 2RR9A 1OQQA 2L52A 4B0MA 1JWUD 1D4BA 4ZRJA 1GC6A 2FCMA 2IBIB 1XO3A 2DZMA 4MGKE 4US8A 1RFAA 3ZQ4A 4DQOC 3QARA 1VD2A 2DBYA 2KX0A 4MELA 3DWMA 1WMHA 2KFKA 4O1NA 2YLMA 1OGWA 3KWLA 3RNFC 2O6VA 4HKZE 4XWWA 2KWDA 2CHXA 3JSVB 1EF5A 1T0QC 1V80A 3A9KB 3PGEA 3H9DA 2EKEC 4WIPA 1WM3A 1MJDA 2L8JA 3VQIA 3M63B 4US9A 4REZA 3RMKC 4WQOB 5L95C 2CKHB 3ABVB 5BYQA 1WY8A 4GIVA 3QQ8B 2O2VB 3ZRFA 2BW2A 3PZDA 3V6EB 2ZJDA 2QEJC 3U52E 1V97A 2NBVB 2RDBC 3L13A 2L0TA 2K8BA 4KSKC 3JVZX 1N63A 2KN4A 2V3PA 2IGHA 1UWMA 4BAXA 4HDQA 3APDA 4G11A 4W9EA 1FFUA 5D3IB 1OTRB 2CS4A 1YN3A 2KVRA 4ZDVA 3IHPC 2CR5A 2I2YA 4ZRQA 2ZCBA 3A33B 4DHJB 2BQQA 1OQYA 3P63A 2PVGC 3DBLI 3SHQA 1WJNA 1XCTL 1H4RA 2CU1A 3Q8AA 4HK2A 2LVQA 4HEA1 2LGXA 1HE8A 2K39A 4LDTB 1WX7A 3Q8BA 3AU5A 5LXHA 2JSVX 3N20C 2W3RA 3H7PA 4DDID 2FNJB 1D5ZC 3EECA 1CQVA 4K7WA 3H1UA 3DVNU 4HROA 1C76A 3PHXB 2AQ2B 4YSYB 2WXPA 1Q5WB 1C4PA 1K53A 4JWUC 1R4MI 2BBCA 5EE0A 2MBOA 1Z2MA 4KKJA 2RGFA 5DPWA 4K3BA 3LDZE 3B9JA 1RLFA 1J0GA 4M00A 2KMMA 5CHVC 2LRUA 1WXMA 4P7IA 3AH7A 5I4DA 2IPKD 4IG7B 4CQNA 1STEA 3VHTC 4TKNA 2KHWB 2JZPA 3C19A 3H6NA 1LM8B 2MJ3A 4HPPA 2LXAA 2LVOA 4LCDE 4TSSA 4WURA 3ZDTA 3I3TB 4BBNC 3APFA 2MLBA 1EUVB 3SD5A 1UUPA 2J7QB 3A4RA 2DAJA 1KLGD 3VH4B 4DDGD 4ZYSA 2PIAA 4PS7A 2J53A 4HDOA 2MHJA 3A9JA 3ZVVA 1CJEA 1XLNA 4F7ZA 3A1QB 4JL9A 3U2SC 2M8SA 4E74A 1C1YB 2AL6A 2C7HA 4MACA 2ON8A 2IO2B 2J0JA 1ZUD2 4II2B 3A4SC 5H92C 4XYCA 1K8RB 3MHSD 4N6EB 4LLGM 2XK5B 2N0SB 4BKGA 5G5HA 2I1KA 1Y8RC 1FIQA 1SGHA 2OEDA 3AE9B 2ZPNA 2WU5B 2A5UA 3ZDMC 3WAOA 3Q3OC 2FIFA 2L05A 2L0FA 1E9MA 3AE8B 4W9LA 1OEYJ 1ZE3D 3MC0B 2PTLA 2KWUB 1S1QB 4DHZB 1AARA 3CWIA 3JW0X 1I35A 1V5OA 4ANWA 1CMXB 1WXVA 1FXAA 3ZGZA 2LXCA 1AYFA 4KGRA 1J8CA 3E9SA 5H8YE 3DVGX 4RF0A 3SEBA 1IYFA 2PVOD 2LFIA 1FXTB 4M02A 5D2MB 4ARIA 2KLCA 2WXFA 3BVMA 1FMAD 2J0KA 2QMTA 4ZOHC 3KUCB 1TT5B 1C4CA 3DDCB 3MFGA 4MJSA 3EHVA 3EFUA 4N58A 2KDIA 1TS3A 1S3SG 1ZPSA 3FILA 4HLEA 1IUEA 3L0WB 1CZPA 2PLPA 2C7MB 3UIPB 3I57A 1R7SA 3NVYA 4OZBA 3NOBA 3UQAA 5JXVA 1B9RA 1BT0A 1FO4A 3SFEB 3ZKJC 4BKSD 1MG4A 2REXA 4NQKE 3V6CB 2K5PA 3DBRI 5D6JB 5DPRA 2MX2A 3K9OB 3T8MA 3NVZA 1NYQA 5BMGA 2N7JA 1WI0A 3PREA 3CMMB 4WJOA 4OVUA 4HCNB 2KN5A 4ACFA 2AX5A 3VDZA 1T5XD 3B1LX 2JT4B 2C7NB 4FJYA 1M94A 2NS5A 2L76A 3NS8A 4CO7A 1C78A 5BMHA 2G3QB 2KVZA 5EE1A 4TQ0A 4YSZB 4ICUA 1PQSA 3FC4A 3UINB 4IDIA 4MH8A 1I4PA 4P16A 3WAPA 2XEWA 5BYRA 4HPMB 2WHIA 1TTNA 1WE7A 3P4RB 3OG5A 1GJZA 3TJPA 2HJ1A 3BY4B 4YSXB 1T0SC 4W9JA 4NAWA 4C7ZA 3ZYYX 3AE2B 1F2RI 3LXFA 1K51A 1KJTA 2KJ6A 4OHJA 1NBFC 3ALBA 3IVFA 4RF1A 2KWVB 1KH0A 4P1BC 5E6PA 1YX6B 4HKQA 4YTMB 3H8HA 3Q3MC 3MJ5A 4EZKA 2FCSA 3ZW3A 3VUXA 3JYUA 2N4FA 3C0RB 1FRRA 3D32A 2JYTA 3QAQA 3BVGA 2DYBA 1FPYA 4KIKA 1YNTE 1FD6A 2G4DB 2LASA 2WYQA 3Q3JA 2MJEA 2A4ZA 3ML9A 1NEKB 2OOBB 1E8WA 4FXCA 1YQ4B 1I4XA 1TIFA 3KUDB 1F9JA 2LMCA 1WE6A 2GBJA 4MDKE 1SB3C 4G0NB 2DWQA 1L4ZB 4EFOA 2HTHA 3ZXVA 3AMZA 2C60A 4NAMA 3RNGC 1QZEA 2J4XA 1ET9A 3RFZB 3H7SA 2LGDA 4WJQA 4M8NA 4GDLB 5IKCM 1IP9A 2KJRA 1EU3A 2K8CA 4WQMA 5LLIA 1VZ7A 2X38A 1FCLA 1T0YA 4GXBA 2MW5A 4KZCA 4IM3A 4BVUC 2QIEB 3HIZA 3I9V1 4ZHPA 5CX3A 2KAJA 1FNVA 1F52A 1GAQB 2LWPA 2RPVA 4BKSA 2JRHA 2MBHA 1R4NI 2KQ4X 2JU6X 1YN5A 2MEKA 3NZUA 5GMVA 2AQ1B 4XX5A 3CSTA 1ESFA 1FFVA 1V8CA 2NPTB 1WGDA 4LNFA 3ENEA 4ZRPA 3PS6A 3AE3B 2N9EB 4I6NB 3R7QA 3NS1A 4WWOA 4Q2JA 1V49A 3SU8X 4G50A 1VZ8A 1TZ1A 1E5WA 1SE3A 3SDLC 3ZIMA 4JLCA 1E6EB 1J19A 2FCQA 1WF9A 1ISNA 1ZGUB 2IO3B 3FKYA 1KOTA 3PZ8A 1DGJA 4LJPB 2NVUI 3Q6BA 3RNAC 4S17A 4RMAA 1G6JA 1NYRA 2JPHA 2H89B 3C8YA 2JUOA 5TR5A 3O13A 3AEDB 2GB1A 5EE3A 4AUQC 2XNAC 4OZAA 3TBLD 2KQ7A 3U7ZA 2Q5WD 4S0RA 2HD5B 1ENFA 3MTNB 1SE2A 1YX5B 1XT9B 4GLSC 1MI0A 1ZOYB 1ZDVA 3ZLZA 2L7RA 2WXJA 3SFDB 1FRDA 1HEZE 2JF5A 2LGSA 1UF0A 2PJHA 3DBLB 2WXMA 2L83A 2WGSA 2G1EA 1HA5A 1XD3B 2GBRA 2QCZA 1WX9A 1HTQA 2KDEB 1I4QA 3GS2A 1WGHA 2D07B 4KV2A 3RI7C 2WDVB 2H88B 2KFKB 4LNOA 2QC8A 2O6VB 4TV3A 2IGDA 2WNMA 3Q8CA 2QSDA 3V61A 3AI5A 4N59A 3GB1A 5C2TB 1GG3A 2D3CA 1WJ6A 2KO3A 3W5VB 4IC7B 1FCCC 1Q1OA 1R4MB 3HUIA 1JWSD 2GRIA 3OAWA 4MM3B 2VRRB 1VZ6A 5CHWA 3HRDD 1N62A 2DHZA 2BF8B 2LGIA 2WXRA 4W9DA 1PYWD 2NBWB 4PS8A 5E6JA 1WR1A 3NZ3A 4WWPA 2R2QA 2LJ5A 4G3XB 3DPDA 4ANXA 2PE9A 2ASQA 2W55A 2D3BA 1VR9A 4LNNA 1V1PA 3QCAA 4NQLB 3GE3C 2OHFA 1QQRA 2V9HA 2V0GA 1L6UA 2VZKD 1J7CA 2XBBC 3BWUD 3I5JC 1KLUD 2IGGA 3TEYA 1YJJA 4K1RB 2I1JA 1BMLC 3GZNI 5IA7A 1RFKA 1ZXIA 2WXOA 3QC8B 4ANUA 4ITKA 5C3JB 1I42A 2LHEA 1VJKA 3EGRA 3AECB 1IBXB 3RULA 1Z5SB 1J7AA 1DOYA 2N9KA 3NHEB 2N9PC 2JRIB 2MRPA 2WX0A 3ZJTA 3BK1A 2DYMA 1UBQA 1GNUA 2BT6A 3AE1B 2KMCA 5AEKB 4GMVA 2W9NA 4H2AA 1JWBD 2DENB 3H7PB 3DVGY 2LGYA 2XN9C 1VDVA 1IPGA 4C4VA 3WANA 1TJEA 1YN4A 2PMVA 1JROA 4FJVB 4J3OD 3UGBB 2LZ6A 1SJHD 5HHDG 4EEWA 1E7PB 1WGKA 3S2AA 3FAHA 4I6PA 2N1WA 1YMHE 1UWXA 2R2OA 4X57B 3IG3A 2C5LC 3IAM1 5LXIB 3HVZA 2M56B 4M01A 2ZNVC 5BO4B 2W82A 2FUG1 2UYZB 1SBBB 1WYWB 1E7VA 2BYTA 4C7YA 3MC8A 2XK5A 3NY5A 1SF0A 1V2YA 3AULA 1JCKB 2LUEA 4MEMA 5GXGB 2ZCCA 4YWGG 2X8XX 3IT6B 4AQ7A 2J0MA 2M0XA 4W9FA 3DHHC 3W1YA 2KOXA 4AS1A 2NTTA 4IWOA 4XWTA 4GDKA 4USAA 4DBGA 2BPSA 3AEBB 3PZ7A 1C9FA 1WXSA 1KRHA 3AE4B 2FAZA 2NR2A 1RM6C 3KYDD 3A9JB 2K22A 1YIWA 4IM2A 2WWZA 1MFWA 2ZNVB 5EDSA 2B76B 5IP4D 1ROEA 5E6NA 1LO5D 1WYGA 4M0WA 1FNWA 4URKA 2NTSA 2BKFA 4ARCA 3AN1A 3DBRB 4XE0A 1NVID 4K81A 4J6IA 4ZYNA 3AE7B 3ZNGC 1D5XC 1EWCA 2WDRB 4A6QA 3T3NA 4A20A 2CHZA 1XLQA 1I7HA 1E8ZA 1L5PA 3MJWA 1F2RC 1TY2A 3N1ZC 1SE9A 2HDEA 2WXIA 3RPFC 2AEHA 3T9LA 4A3OA 2V3NA 4YXDB 3VH3B 3RD2A 3MP9A 3ONSA 5TSSA 1JQ4A 2KLGA 1WGYA 4M8MA 2JVCA 3URYA 4IOIE 1MG8A 2BYVE 5MPOA 1Q0WB 2W54A 4D2KA 3NJTA 3PRZA 2WDTB 3QHTA 2Z0DB 3BYTB 3T3OA 1SIJA 1N60A 2DAFA 4XDDA 2G4SA 2KWCA 4I6LB 2LD9A 1HTOA 3UIOB 3L10B 2NCNA 1QOFA 3DBHB 4EZJA 1XLOA 4NJ7A 2B3AA 1WH3A 4RGOS 2WS3B 2EELA 1XCQL 3J9CA 3Q14C 1LXDA 4W9CA 3RNBC 3W1SC 5BMIA 2MP2A 2KK8A 2BB6A 4TMAB 1GPXA 4MJSB 3Q3FA 4IWPA 2K6QA 3V05A 3VR9B 4E71A 2MWSB 1XF5L 3K9PB 3FILB 2K0PA 4B6WA 2WXGA 4N9F4 2JXXA 2ICIA 3VUWA 1QF6A 4JGHB 4P1CC 2E6XA 2MJDA 2BYEA 1SE4A 2L32A 2GBMA 2K9XA 2AWTA 2MBBB 4CYEA 2JXTA 1K50A 5FR3A 1SSNA 2MA9B 3APCA 2UWQA 4AOFA 2FUHB 1ZDXA 2L3ZA 4L2YA 3V60A 4KDIC 1I4HA 3PHWB 1KFYB 2ZZPB 2BTEA 1NENB 1P7EA 5J2RA 3RT3B 1P9DU 4GN1A 2HE7A 4IKGA 3WA0A 2ZVOA 1WRIA 2INPE 1L6VA 3DVNV 4WH4A 3R2IA 4DK5A 4WAAA 1UBIA 3KVFB 2N7EA 4HVBA 2BVCA 3KYCD 3X23A 1KLVA 3KQ4A 1V81A 2HTME 3VRBB 2K8HA 1YOVB 2GLSA 2ZW0A 3BYYB 2LUMA 3GE8C 1PGAA 2D3AA 4PT5A 2AL3A 1TY0A 3PPAA 3I63C 4IWQA 4RCOA 2HJ8A 3KH0A 1E10A 3B2FA 3OWEB 4E3CA 1V1OA 2JX5A 2RMMA 4PYUA 1FNUA 3AB5A 3VR8B 5HI1A 3ZNHB 3PSEB 3QK0A 4NAWB 3ZTCA 4RGNA 1R4NB 2D10A 1PFDA 1IGCA 1V9JA 2YEPF 4MT5A 5J18A 1XEEA 2KTRB 3RZFA 1YQ3B 3TMPB 3VTWA 5FK9C 4ZRIA 2PPHA 2WDQB 3AEGB 2RPQA 3PLUA 2GBNA 2DYOA 1UD7A 2PW9A 2KD0A 5AUIA 2BS4B 2DNFA 3ZO5B 1P98A 1SEBD 2INNE 2FCNA 1BXTA 3TIXA 1T3QA 2D11A 3CSFA 4DHJD 2BWES 2C9WB 2KXJA 1AWDA 4RFBA 4YTPB 2SAKA 1AW7A 3EUB2 1KF6B 1MHXA 2CJNA 4C80A 3W5UB 3IBEA 2IJ0A 4LDTD 3PV1A 4DWFA 2Z8LA 3PT2B 4RGMA 4B95A 4L23A 2MQJA 4JX1C 3AV8A 2M0AA 4AWJA 3AEEB 3VTUA 1MHHE 2TSSA 1TS2A 4FADA 1E8YA 1ACCA 3PRMB 1C77A 1HZ6A 1RAXA 5IN7A 5BYSA 2M4NA 1WZ0A 2J52A 2MBQA 4ZRKA 5HKHA 2DZJA 1ZKHA 5G5GA 5JH5C 2IO0B 4HJGE 3CF6E 4PS3A 1WWTA 1L0VB 1Q10A 2VH1A 2KMAA 4W9IA 3TSSA 3NRZA 2RD0A 1D6EC 4JE3B 3N30A 5EE9A 1SXTA 3Q8FA 1ZW7A 2KNBA 2N9XA 3ZNID 3P2BA 4NPNA 2PKOA 1L4DB 2J42A 3L08A 3E56A 2IY1B 3VVWB 3P1MA 1V86A 4BKTA 2KC2A 5JHBA 4JQWC 1C4AA 2DX5B 2LHDA
chains in the Genus database with same CATH topology
3PO0A 3AECB 3E9SA 5H8YE 1DOIA 1IBXB 1QILA 1J7AA 4RF0A 2BS3B 2N9KA 1DOYA 2Y5PA 1F0ZA 3SEBA 3NVWA 2PVOD 4LK0M 2LFIA 1FXIA 5T8IA 1VLBA 3ZJTA 3U4EG 4ARIA 4L1BA 3BK1A 3W9CB 2WXFA 3BVMA 2DYMA 4WAFA 1FMAD 4RH6A 2BT6A 3AE1B 1TS4A 2QMTA 1HXYD 4ZOHC 1C4CA 1FM0D 3MFGA 3NVVA 1J7BA 4N58A 3P4SB 1TS3A 4H2AA 1JWBD 1I4RA 3TEWA 1ZPSA 2QILA 1ZXHA 4NZLB 2R61A 2YEPB 3FILA 5D7GA 4WWMA 4KKIA 1JALA 2XN9C 1VDVA 1IUEA 4KGTA 3IAS1 1TJEA 1EM7A 1CZPA 1YN4A 1JROA 2PMVA 4J3OD 2PLPA 4NJCA 1AN8A 2GI9A 3I57A 1R7SA 3NVYA 2CJOA 4OZBA 1SJHD 5HHDG 2RDHA 5AUKA 3TEZA 5JXVA 1B9RA 1JWAD 1E7PB 1FO4A 1WXQA 1RWSA 1WGKA 3FAHA 3SFEB 3VRAB 3IXSA 2Y3AA 1YMHE 1UWXA 2CU3A 1GB4A 1XXGA 2K5PA 2FE8A 3IAM1 3HVZA 1HQRD 2M56B 1GOZA 3NVZA 5HG2A 3BZDB 1E0ZA 2W82A 1NYQA 5BMGA 2FUG1 2N7JA 1PGXA 1SBBB 3Q8EA 2ACZB 4OW0A 3MHZA 2BYTA 4C7YA 1SF0A 2G9HD 1L0YB 1UGJA 2Y5CA 3R8BA 4XDCA 1JCKB 2AQ3B 2AX5A 3TEXA 1T5XD 5GXGB 4OVZA 1JMLA 2WU2B 4YWGG 4KX6B 3IT6B 4AQ7A 1PGBA 1B1ZA 1C78A 5BMHA 2NMQA 3BIID 2L1AA 4AS1A 5EE1A 2I38A 2WXQA 1CK1A 2NTTA 4TQ0A 5LNK1 1JW9D 2E3TA 4YSZB 2JWUA 4XWTA 1OFFA 4USAA 3AEBB 1PDXA 3PZ7A 3FC4A 4IDIA 4MH8A 1C9FA 1TKGA 5FKAC 1I4PA 1KRHA 3AE4B 2LHDA 1TKYA 2MH7A 4P16A 4ZHOA 5BYRA 1RM6C 3P42A 2K22A 3AM9A 3P4RB 1Y56A 4A55A 1QLBB 1TZOA 4YSXB 2B76B 4A8XC 1ROEA 4C7ZA 1LO5D 1WYGA 4M0WA 3ZYYX 1IBXA 1FNWA 3AE2B 1F2RI 2NTSA 3LXFA 1K51A 2WLBA 2WXKA 1JRPA 4OHJA 5HFYA 4ARCA 3AN1A 4LTUA 4RF1A 4XE0A 1KH0A 1NVID 1QOBA 4HKQA 2QJLA 4R3DA 4YTMB 3H8HA 2FBWB 3MJ5A 3AE7B 1D5XC 1EWCA 1PUTA 2WDRB 4A6QA 1OQRA 1KTKA 3T3NA 1XLQA 1I7HA 1L5PA 1QKZA 2EKIA 3P4QB 1F2RC 1QOGA 1V1PB 1TY2A 1TKEA 2HDEA 2WXIA 1FRRA 4B0EA 3RPFC 3NUHB 2JYTA 2V3NA 4YXDB 3BVGA 2V4IB 1C79A 1P7FA 4P6VF 3MP9A 1YNTE 1FD6A 1OQQA 5TSSA 2L52A 1JQ4A 2MJEA 4A9AA 4B0MA 1JWUD 1D4BA 1NEKB 3URYA 4IOIE 5MPOA 2WP9B 4FXCA 4HRSA 1XO3A 4DXFA 1YQ4B 2W54A 4D2KA 4A90A 4US8A 3CIRB 1I4XA 1N5WA 3ZQ4A 1T6BX 4DQOC 3BYTB 3T3OA 1SIJA 2LMCA 2DBYA 1N60A 1JWMD 1HZ5A 2SEBD 3DWMA 4XDDA 1K52A 1QOAA 4O1NA 3AEAB 3KWLA 1QOFA 1SB3C 3KLSX 2DWQA 1L4ZB 1ET6A 4HKZE 5D3DA 4XWWA 4C56C 2KWDA 1XLPA 1XLOA 3AMZA 4NAMA 4RGOS 2K3UA 4UDUC 2WS3B 4RNAA 2EELA 2J4XA 1XCQL 1ET9A 3J9CA 4WIPA 3RFZB 3LB8C 5BMIA 2BB6A 4TMAB 1GPXA 2LJIA 4GDLB 3VQIA 3V05A 2JQRB 3WCQA 4EE2A 3VR9B 4US9A 4REZA 1XF5L 1EU3A 4WQMA 3FILB 2K0PA 1VZ7A 2X38A 2WXGA 4YTNB 3ABVB 1FCLA 2ZW1A 2ICIA 5BYQA 1QF6A 2QIEB 2E6XA 2MJDA 2BW2A 3I9V1 2WQYB 2ONQA 1SE4A 4ZHPA 2KAJA 2L32A 2QEJC 1FNVA 3U52E 1V97A 1GAQB 3BVZA 2K9XA 2RPVA 2JXTA 1DOXA 2KQ4X 1SJED 2JU6X 1YN5A 2MEKA 1N63A 2KN4A 1K50A 5FR3A 1SSNA 2V3PA 2AQ1B 2IGHA 1VRAB 1ESFA 1MVKA 1UWMA 1ZDXA 1RYJA 4L2YA 1FFVA 1V8CA 1FFUA 3GP7A 1I4HA 5D3IB 1KFYB 3B2GA 2BTEA 1N5XA 1NENB 4RGTA 1MPEA 1P7EA 1YN3A 4KGSA 4ZRPA 1TYGB 2KACA 2I2YA 4IKGA 4ZRQA 3AE3B 1WRIA 3NS1A 3W2DA 1I4GA 2INPE 2PVGC 3P63A 1L6VA 1BUIC 4Q2JA 1XCTL 4WH4A 3R2IA 1VZ8A 1SE3A 3Q8AA 2BB5A 1E6EB 4HEA1 3KQ4A 1UNSA 2HTME 3Q69A 3KWVA 1EU4A 1WSPA 3VRBB 2ZW0A 3BYYB 2LUMA 3PZ8A 4GDKB 1QT9A 1PGAA 1DGJA 3HVDA 3Q8BA 4PT5A 2JSVX 1TY0A 2W3RA 4RCOA 1E10A 3B2FA 1NYRA 1D5ZC 4TQ1A 3ZJUA 3OWEB 1V1OA 2H89B 2JX5A 2RMMA 3C8YA 1FNUA 1CQVA 3AB5A 3VR8B 5HI1A 1F77A 3O13A 1ZP0B 4HROA 1C76A 4NAWB 1D5MC 3AEDB 2AQ2B 3L4PA 2GB1A 4YSYB 2WXPA 5EE3A 2XNAC 4OZAA 4RGNA 1PFDA 1C4PA 1K53A 4JWUC 1IGCA 3P4PB 2BBCA 2YEPF 4MT5A 3U7ZA 2Q5WD 2RDGA 1XEEA 5EE0A 2M19A 1YQ3B 2WXLA 1YJIA 1ENFA 1SE2A 4KKJA 4JPSA 5FK9C 2WDQB 3AEGB 4GLSC 1MI0A 2DYOA 1ZOYB 3B9JA 1ZDVA 2PW9A 2BS2B 5AUIA 3LYYA 2BS4B 4JWSC 2WXJA 3SFDB 1FRDA 1HEZE 2KMMA 2IDYA 3AH7A 3AE5B 1SEBD 5I4DA 3ZJVA 1M4VA 2INNE 2IPKD 2WXMA 4DXGA 2L83A 2G1EA 1BXTA 2VZKB 4CQNA 1HA5A 1STEA 1T3QA 3EA6A 2JZPA 2DLBA 2MJ3A 1DYQA 3R2TA 2N9LA 1AWDA 1I4QA 3GS2A 4RFBA 4TSSA 4WURA 4YTPB 2SAKA 1AW7A 2KDMA 1L0XB 3EUB2 2WDVB 1KF6B 1MHXA 2CJNA 4YT0B 4C80A 1UUPA 3W5UB 3IT4B 2IJ0A 1KLGD 2H88B 2Z8LA 3UI3A 4RGMA 2IGDA 2WNMA 2PIAA 3Q8CA 2J53A 4ZYSA 2QSDA 4L23A 1N61A 2D5GA 4JX1C 3DWGC 1CJEA 1XLNA 4N59A 3GB1A 3W1SA 3AV8A 2M0AA 5C2TB 3AEEB 1MHHE 3U2SC 2TSSA 1TS2A 3W5VB 1ACCA 1C77A 1FCCC 1NI3A 1HZ6A 4MACA 2ON8A 4OZCA 5BYSA 1ZUD2 3HUIA 1A70A 1JWSD 2GRIA 2J52A 5H92C 4MM3B 3BK2A 1VZ6A 5G5GA 3AE6B 4HJGE 4N6EB 3HRDD 1N62A 4LLGM 2WXRA 2N0SB 2LGIA 1PYWD 1WWTA 1L0VB 5G5HA 1TS5A 5E6JA 1FEHA 2JYEA 2WXHA 1Q10A 1FIQA 2OEDA 3ETRA 3NZ3A 3AE9B 1IGDA 3AEFB 2WU5B 3SR6A 3TSSA 3NRZA 1EWYC 3TUOA 1D6EC 4JE3B 2W55A 1VR9A 1V1PA 5EE9A 1SXTA 1E9MA 2OHFA 2WXNA 3Q8FA 3N9YC 1QQRA 3AE8B 2V0GA 1L6UA 2VZKD 1J7CA 1ZE3D 3BWUD 3MC0B 2PTLA 2PKOA 1KLUD 2IGGA 2W3SA 1L4DB 2J42A 3TEYA 3E56A 1YJJA 3V3XA 3CWIA 3P1MA 1BMLC 1RFKA 1ZXIA 2WXOA 1FXAA 2LEKA 1C4AA 4ITKA 3ZGZA 5C3JB 2LHEA 4KGRA 1VJKA 3EGRA 1AYFA 1GB1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1RM6 C;  3SFD B;  2MJD A;  1FRD A;  2KMM A;  2K22 A;  3PO0 A;  3AEC B;  3AM9 A;  3P4R B;  2WQY B;  3AH7 A;  5H8Y E;  4ZHP A;  1DOI A;  2KAJ A;  3AE5 B;  1J7A A;  1DOY A;  2BS3 B;  1V97 A;  4JWS C;  2L83 A;  2G1E A;  1GAQ B;  1F0Z A;  1QLB B;  2K9X A;  2PVO D;  3NVW A;  4YSX B;  1FXI A;  1T3Q A;  2B76 B;  1ROE A;  4C7Z A;  1VLB A;  1WYG A;  3ZYY X;  1DOX A;  2MJ3 A;  3W9C B;  3AE2 B;  1N63 A;  3LXF A;  2WLB A;  1FMA D;  1AWD A;  1JRP A;  2BT6 A;  3AE1 B;  3AN1 A;  4LTU A;  1UWM A;  4ZOH C;  1RYJ A;  4YTP B;  1FFV A;  1V8C A;  1NVI D;  1FM0 D;  3NVV A;  1FFU A;  3EUB 2;  1J7B A;  1QOB A;  2WDV B;  1KFY B;  2QJL A;  1KF6 B;  2CJN A;  3B2G A;  3P4S B;  1JWB D;  1N5X A;  1NEN B;  4YT0 B;  4C80 A;  3W5U B;  4YTM B;  2FBW B;  3AE7 B;  2H88 B;  1PUT A;  2WDR B;  1OQR A;  1TYG B;  4WWM A;  1JAL A;  1XLQ A;  1I7H A;  1VDV A;  1L5P A;  2EKI A;  1IUE A;  3AE3 B;  3P4Q B;  1QF6 A;  2PIA A;  1TJE A;  1WRI A;  1N61 A;  1CZP A;  3NS1 A;  1JRO A;  1QOG A;  3P63 A;  2PVG C;  4JX1 C;  1L6V A;  1CJE A;  1XLN A;  1TKE A;  3DWG C;  4N59 A;  1R7S A;  1FRR A;  3AV8 A;  3NVY A;  2CJO A;  5C2T B;  3RPF C;  3AEE B;  5AUK A;  4YXD B;  1B9R A;  1JWA D;  4P6V F;  1E7P B;  3W5V B;  1WXQ A;  1RWS A;  1WGK A;  3FAH A;  3SFE B;  3VRA B;  1FO4 A;  1OQQ A;  1JQ4 A;  2L52 A;  1NI3 A;  2MJE A;  1E6E B;  4A9A A;  4N58 A;  1NEK B;  2CU3 A;  2HTM E;  1ZUD 2;  3VRB B;  3HUI A;  5MPO A;  1A70 A;  2WP9 B;  2K5P A;  4FXC A;  4HRS A;  5H92 C;  1XO3 A;  1YQ4 B;  2W54 A;  5G5G A;  1QT9 A;  3AE6 B;  1DGJ A;  3CIR B;  4US8 A;  3HVZ A;  4N6E B;  1N5W A;  3HRD D;  1N62 A;  2M56 B;  2N0S B;  3NVZ A;  1WWT A;  1E0Z A;  2W3R A;  1SIJ A;  1L0V B;  1NYQ A;  2DBY A;  1N60 A;  5G5H A;  1FIQ A;  1E10 A;  3ETR A;  3B2F A;  1NYR A;  2ACZ B;  3DWM A;  3AE9 B;  3AEF B;  1QOA A;  2WU5 B;  3SR6 A;  2H89 B;  2JX5 A;  3AEA B;  3KWL A;  4C7Y A;  1QOF A;  3NRZ A;  1SB3 C;  1EWY C;  1SF0 A;  2DWQ A;  3AB5 A;  3VR8 B;  2Y5C A;  1ZP0 B;  2W55 A;  1XLP A;  4HRO A;  1XLO A;  3AED B;  2AX5 A;  5EE9 A;  3L4P A;  3AMZ A;  4YSY B;  5EE3 A;  5GXG B;  1E9M A;  2OHF A;  2WS3 B;  2WU2 B;  3AE8 B;  1PFD A;  4KX6 B;  4JWU C;  1L6U A;  3P4P B;  3LB8 C;  1J7C A;  2Q5W D;  5EE0 A;  2M19 A;  2PKO A;  1YQ3 B;  3BII D;  1GPX A;  2W3S A;  5EE1 A;  1YJI A;  1YJJ A;  1JW9 D;  2JQR B;  2E3T A;  3CWI A;  3WCQ A;  3P1M A;  4YSZ B;  1OFF A;  3VR9 B;  4US9 A;  4USA A;  3AEB B;  1PDX A;  4WQM A;  2WDQ B;  3AEG B;  1RFK A;  1ZXI A;  3FC4 A;  1FXA A;  1ZOY B;  3B9J A;  4IDI A;  2LEK A;  3ABV B;  4ITK A;  4YTN B;  1TKG A;  2BS2 B;  1KRH A;  5AUI A;  3AE4 B;  4ZHO A;  1TKY A;  2MH7 A;  2BS4 B;  5C3J B;  1VJK A;  1AYF A;  2QIE B; 
#chains in the Genus database with same CATH topology
 3PO0 A;  4JIO U;  1QIL A;  1WZ3 A;  2Y5P A;  1F0Z A;  2ZPY A;  3NVW A;  4LK0 M;  3ZXR A;  3JSV A;  1VLB A;  3A9K A;  3W9C B;  2IYD B;  4RH6 A;  1TS4 A;  1HXY D;  2EMS A;  2YVC A;  4II3 B;  2Z59 B;  2CHW A;  3QX1 A;  1FM0 D;  2D2Q A;  1J7B A;  1GC7 A;  3TEW A;  2QIL A;  3PTF C;  1ZXH A;  5J17 A;  2YEP B;  4FUL A;  5D7G A;  4LJO B;  4C00 A;  4KGT A;  3IAS 1;  2KDF B;  1NDD A;  1E8X A;  1EM7 A;  2O2V A;  1AN8 A;  5JZE B;  5AUK A;  3TEZ A;  3U7D A;  4BOZ B;  2PE6 B;  2KKC A;  1WXQ A;  1RWS A;  3IXS A;  3N32 A;  2Y3A A;  2CU3 A;  1T0R C;  3QJZ A;  3O65 B;  1V5T A;  1WMH B;  4FA6 A;  3GZN B;  1GOZ A;  1WX8 A;  5HG2 A;  3BZD B;  1UZX B;  4TUU A;  5DPT A;  3Q8E A;  4MM3 A;  4OW0 A;  2KFJ A;  3U30 A;  4XZ4 A;  1UGJ A;  2Y5C A;  3R8B A;  2AQ3 B;  3ZTD A;  4OVZ A;  3QA8 A;  1JML A;  3B08 A;  1EF1 A;  4KX6 B;  4FLH A;  2IND C;  3BIN A;  1PGB A;  2OJR A;  2NMQ A;  2DZI A;  3BII D;  2L1A A;  4OVV A;  1OFF A;  5KHO A;  1XQQ A;  1PDX A;  1E7U A;  3N1Y C;  4BBN F;  1TKG A;  5FKA C;  1TKY A;  2MH7 A;  3AM9 A;  2KYW A;  5D94 A;  4ICV A;  4GU2 A;  4FBJ B;  3DCG A;  4A55 A;  1QLB B;  4ASW C;  1TZO A;  3TCA A;  1P3Q U;  3ML8 A;  3IFW B;  4A8X C;  2LRW A;  1IBX A;  1WFY A;  1WJ4 A;  1JRP A;  5HFY A;  2KZR A;  4BZA A;  4MSM B;  3M3J A;  3NG0 A;  2QJL A;  3RN9 C;  4K7U A;  3KUZ A;  2FBW B;  1PUT A;  3RNC C;  1OQR A;  1KTK A;  4WJN A;  1V1P B;  1X1M A;  2UU7 A;  3NUH B;  2EMT A;  4K7S A;  3UQB A;  1H8C A;  2V4I B;  1C79 A;  1P7F A;  3L54 A;  4P6V F;  1UEL A;  4A9A A;  3OLM D;  2BYF A;  3EFC A;  2WP9 B;  4HRS A;  4DXF A;  2K1F A;  4A90 A;  3CIR B;  2KX3 A;  1N5W A;  4WJP A;  3X0W A;  1T6B X;  2VH2 A;  2KC1 A;  1JWM D;  3EC8 A;  1HZ5 A;  2SEB D;  1K52 A;  4PYZ A;  3HM6 X;  4FHK A;  1QOA A;  3AEA B;  3QIJ A;  3KLS X;  3PRP B;  4YL8 A;  1ET6 A;  5D3D A;  3DHI C;  4C56 C;  1XLP A;  2GOW A;  3A1Q A;  5G2N A;  1WGR A;  2K3U A;  2ZVN A;  4UDU C;  4RNA A;  4XC2 A;  4HCP B;  1LQB A;  3LB8 C;  1RRB A;  3TL5 A;  3PLV A;  2LJI A;  2JQR B;  5DPS A;  4PK1 A;  3WCQ A;  4EE2 A;  3L17 A;  2OJW A;  3ECI A;  5AZG A;  4YTN B;  4BOS C;  2LVP A;  2ZW1 A;  2MCN B;  4C4V B;  2WQY B;  2ONQ A;  3PVL A;  4B9K A;  3BVZ A;  2ZEQ A;  4IM0 A;  1YJ1 A;  1DOX A;  1SJE D;  4W9G A;  1UH6 A;  3Q2A C;  1VRA B;  1MVK A;  4RM8 A;  2JWZ A;  2G45 B;  1RYJ A;  1C3T A;  4KZ0 A;  3DHG C;  3GP7 A;  4HWI B;  4GSW A;  3B2G A;  4EOY A;  1N5X A;  4RGT A;  3AXC A;  1MPE A;  1LFD A;  2RSU A;  4KVG B;  3ZNZ B;  4HPL B;  4KGS A;  1TYG B;  2KAC A;  4IW0 A;  5JHA A;  3W2D A;  2Y5B B;  1I4G A;  1BUI C;  3MC9 A;  1WM2 A;  5C1Z A;  4LNK A;  3M62 B;  2BB5 A;  1UNS A;  3Q69 A;  3KWV A;  1EU4 A;  1WSP A;  4GB9 A;  1JRU A;  4AJW A;  4GDK B;  4DXA B;  1QT9 A;  3HVD A;  3U8Z A;  5KHQ A;  1U4A A;  3N1X C;  1TBE A;  2V4L A;  4TQ1 A;  2NBU A;  3ZJU A;  3R7R A;  1F77 A;  2IY0 B;  3R3M A;  1ZP0 B;  1A5R A;  1D5M C;  3L4P A;  4W9K A;  4M0W B;  1KM7 A;  2INC C;  4ANV A;  4HXD A;  3P4P B;  3NZS A;  4CHK A;  2RDG A;  4XGA B;  2M19 A;  2WXL A;  1YJI A;  2BKR B;  2MSE D;  4JPS A;  4IUM B;  2BS2 B;  3LYY A;  4JWS C;  2K6D B;  2IDY A;  5C23 A;  4RM9 A;  4F1S A;  3AE5 B;  3ZJV A;  1M4V A;  1WGG A;  3M95 A;  4DXG A;  2VZK B;  1WXA A;  2KTF A;  3EA6 A;  3HK0 A;  2DLB A;  1DYQ A;  1EO6 A;  3R2T A;  2N9L A;  5AZH A;  5FR6 A;  2KDM A;  1L0X B;  3Q3N C;  4YT0 B;  2KJH B;  4HJK A;  3IT4 B;  4LNI A;  3N3K B;  3ZUN A;  3DQV A;  2IO1 B;  3UI3 A;  4F8C B;  5CTR C;  1N61 A;  2PEA A;  1WRD B;  2D5G A;  3DWG C;  3W1S A;  4NY0 A;  1P1A A;  4EZL A;  3VTV A;  3LJ3 A;  2MP2 B;  1NI3 A;  5IAA C;  4OZC A;  2Z0E B;  2N1V A;  1A70 A;  2KQS A;  3BK2 A;  3AE6 B;  3VUY A;  1UGM A;  4MGZ E;  1GUA B;  1WJU A;  1TS5 A;  2KT7 A;  1FEH A;  2JYE A;  5IOI A;  2WXH A;  3ETR A;  1IGD A;  3AEF B;  3SR6 A;  1NI2 A;  1P0R A;  1EWY C;  4GOC A;  3KW5 B;  5AZF A;  3TUO A;  4FN2 A;  4BFR A;  4NJ6 A;  4W9H A;  2WXN A;  3DBH I;  3N9Y C;  3DOW A;  5L83 A;  1N6Z A;  3DBS A;  1E90 A;  3WIM A;  5G55 A;  2W3S A;  2QHO A;  3V3X A;  3WAL A;  3VXW A;  2V3S A;  2KDB A;  2KTR A;  3RUI B;  2LEK A;  3RZW C;  1D3Z A;  1GB1 A;  1DOI A;  2BS3 B;  2O6V D;  1FXI A;  5T8I A;  2FID A;  3U4E G;  4L1B A;  4GGQ A;  4WAF A;  2K25 A;  2D3G A;  2JZ3 B;  3OJ4 B;  5CHF A;  3NVV A;  4GDL A;  2KAN A;  4AJY B;  3P4S B;  3HM3 A;  1I4R A;  4A3P A;  3OJ3 A;  4NZL B;  2R61 A;  4WWM A;  1YQB A;  4KKI A;  1JAL A;  1F1H A;  1WIA A;  4KIK B;  1L2N A;  4FHJ A;  4NJC A;  2GI9 A;  2CJO A;  3V62 A;  2RDH A;  1JWA D;  4KSL C;  2DZK A;  2JY6 A;  3VRA B;  2LI5 A;  2N7D A;  1GB4 A;  1XXG A;  1L7Y A;  2FE8 A;  3UF8 A;  1HQR D;  2NPT A;  1E0Z A;  3AU4 A;  4DHZ E;  2BWF A;  1PGX A;  1YD8 U;  2ACZ B;  3MHZ A;  2G9H D;  4WWN A;  1L0Y B;  5IO9 A;  2M17 A;  4QAY A;  3WAM A;  2WX1 A;  4XDC A;  3TEX A;  2MBE A;  2L00 B;  2AYO B;  2WU2 B;  4MSQ B;  1B1Z A;  1TGZ B;  2I38 A;  1CK1 A;  2WXQ A;  4K3C A;  5LNK 1;  1JW9 D;  4MGY E;  2E3T A;  3VFK A;  1OEY A;  3QWZ B;  2JWU A;  1VCB A;  4FJZ A;  5E6O A;  4NNJ B;  3VAW A;  4MH0 E;  4ZHO A;  2M1M A;  3P42 A;  2BGF A;  3HHM A;  1Y56 A;  4AP4 C;  1LGR A;  5DCN A;  4KDL B;  3ZRC A;  3RCZ A;  3R66 C;  4EKU A;  3B0A A;  2GBK A;  2WLB A;  2WXK A;  2IZV B;  2GMI C;  1V6E A;  4LTU A;  3RYT A;  2JZZ A;  3L16 A;  3GOE A;  1SIF A;  1QOB A;  4R3D A;  2QDF A;  4EUT A;  3RNE C;  1QKZ A;  2EKI A;  3P4Q B;  2V1Y A;  1QOG A;  1TKE A;  4B0E A;  1WR6 E;  4MGI E;  2RR9 A;  1OQQ A;  2L52 A;  4B0M A;  1JWU D;  1D4B A;  4ZRJ A;  1GC6 A;  2FCM A;  2IBI B;  1XO3 A;  2DZM A;  4MGK E;  4US8 A;  1RFA A;  3ZQ4 A;  4DQO C;  3QAR A;  1VD2 A;  2DBY A;  2KX0 A;  4MEL A;  3DWM A;  1WMH A;  2KFK A;  4O1N A;  2YLM A;  1OGW A;  3KWL A;  3RNF C;  2O6V A;  4HKZ E;  4XWW A;  2KWD A;  2CHX A;  3JSV B;  1EF5 A;  1T0Q C;  1V80 A;  3A9K B;  3PGE A;  3H9D A;  2EKE C;  4WIP A;  1WM3 A;  1MJD A;  2L8J A;  3VQI A;  3M63 B;  4US9 A;  4REZ A;  3RMK C;  4WQO B;  5L95 C;  2CKH B;  3ABV B;  5BYQ A;  1WY8 A;  4GIV A;  3QQ8 B;  2O2V B;  3ZRF A;  2BW2 A;  3PZD A;  3V6E B;  2ZJD A;  2QEJ C;  3U52 E;  1V97 A;  2NBV B;  2RDB C;  3L13 A;  2L0T A;  2K8B A;  4KSK C;  3JVZ X;  1N63 A;  2KN4 A;  2V3P A;  2IGH A;  1UWM A;  4BAX A;  4HDQ A;  3APD A;  4G11 A;  4W9E A;  1FFU A;  5D3I B;  1OTR B;  2CS4 A;  1YN3 A;  2KVR A;  4ZDV A;  3IHP C;  2CR5 A;  2I2Y A;  4ZRQ A;  2ZCB A;  3A33 B;  4DHJ B;  2BQQ A;  1OQY A;  3P63 A;  2PVG C;  3DBL I;  3SHQ A;  1WJN A;  1XCT L;  1H4R A;  2CU1 A;  3Q8A A;  4HK2 A;  2LVQ A;  4HEA 1;  2LGX A;  1HE8 A;  2K39 A;  4LDT B;  1WX7 A;  3Q8B A;  3AU5 A;  5LXH A;  2JSV X;  3N20 C;  2W3R A;  3H7P A;  4DDI D;  2FNJ B;  1D5Z C;  3EEC A;  1CQV A;  4K7W A;  3H1U A;  3DVN U;  4HRO A;  1C76 A;  3PHX B;  2AQ2 B;  4YSY B;  2WXP A;  1Q5W B;  1C4P A;  1K53 A;  4JWU C;  1R4M I;  2BBC A;  5EE0 A;  2MBO A;  1Z2M A;  4KKJ A;  2RGF A;  5DPW A;  4K3B A;  3LDZ E;  3B9J A;  1RLF A;  1J0G A;  4M00 A;  2KMM A;  5CHV C;  2LRU A;  1WXM A;  4P7I A;  3AH7 A;  5I4D A;  2IPK D;  4IG7 B;  4CQN A;  1STE A;  3VHT C;  4TKN A;  2KHW B;  2JZP A;  3C19 A;  3H6N A;  1LM8 B;  2MJ3 A;  4HPP A;  2LXA A;  2LVO A;  4LCD E;  4TSS A;  4WUR A;  3ZDT A;  3I3T B;  4BBN C;  3APF A;  2MLB A;  1EUV B;  3SD5 A;  1UUP A;  2J7Q B;  3A4R A;  2DAJ A;  1KLG D;  3VH4 B;  4DDG D;  4ZYS A;  2PIA A;  4PS7 A;  2J53 A;  4HDO A;  2MHJ A;  3A9J A;  3ZVV A;  1CJE A;  1XLN A;  4F7Z A;  3A1Q B;  4JL9 A;  3U2S C;  2M8S A;  4E74 A;  1C1Y B;  2AL6 A;  2C7H A;  4MAC A;  2ON8 A;  2IO2 B;  2J0J A;  1ZUD 2;  4II2 B;  3A4S C;  5H92 C;  4XYC A;  1K8R B;  3MHS D;  4N6E B;  4LLG M;  2XK5 B;  2N0S B;  4BKG A;  5G5H A;  2I1K A;  1Y8R C;  1FIQ A;  1SGH A;  2OED A;  3AE9 B;  2ZPN A;  2WU5 B;  2A5U A;  3ZDM C;  3WAO A;  3Q3O C;  2FIF A;  2L05 A;  2L0F A;  1E9M A;  3AE8 B;  4W9L A;  1OEY J;  1ZE3 D;  3MC0 B;  2PTL A;  2KWU B;  1S1Q B;  4DHZ B;  1AAR A;  3CWI A;  3JW0 X;  1I35 A;  1V5O A;  4ANW A;  1CMX B;  1WXV A;  1FXA A;  3ZGZ A;  2LXC A;  1AYF A;  4KGR A;  1J8C A;  3E9S A;  5H8Y E;  3DVG X;  4RF0 A;  3SEB A;  1IYF A;  2PVO D;  2LFI A;  1FXT B;  4M02 A;  5D2M B;  4ARI A;  2KLC A;  2WXF A;  3BVM A;  1FMA D;  2J0K A;  2QMT A;  4ZOH C;  3KUC B;  1TT5 B;  1C4C A;  3DDC B;  3MFG A;  4MJS A;  3EHV A;  3EFU A;  4N58 A;  2KDI A;  1TS3 A;  1S3S G;  1ZPS A;  3FIL A;  4HLE A;  1IUE A;  3L0W B;  1CZP A;  2PLP A;  2C7M B;  3UIP B;  3I57 A;  1R7S A;  3NVY A;  4OZB A;  3NOB A;  3UQA A;  5JXV A;  1B9R A;  1BT0 A;  1FO4 A;  3SFE B;  3ZKJ C;  4BKS D;  1MG4 A;  2REX A;  4NQK E;  3V6C B;  2K5P A;  3DBR I;  5D6J B;  5DPR A;  2MX2 A;  3K9O B;  3T8M A;  3NVZ A;  1NYQ A;  5BMG A;  2N7J A;  1WI0 A;  3PRE A;  3CMM B;  4WJO A;  4OVU A;  4HCN B;  2KN5 A;  4ACF A;  2AX5 A;  3VDZ A;  1T5X D;  3B1L X;  2JT4 B;  2C7N B;  4FJY A;  1M94 A;  2NS5 A;  2L76 A;  3NS8 A;  4CO7 A;  1C78 A;  5BMH A;  2G3Q B;  2KVZ A;  5EE1 A;  4TQ0 A;  4YSZ B;  4ICU A;  1PQS A;  3FC4 A;  3UIN B;  4IDI A;  4MH8 A;  1I4P A;  4P16 A;  3WAP A;  2XEW A;  5BYR A;  4HPM B;  2WHI A;  1TTN A;  1WE7 A;  3P4R B;  3OG5 A;  1GJZ A;  3TJP A;  2HJ1 A;  3BY4 B;  4YSX B;  1T0S C;  4W9J A;  4NAW A;  4C7Z A;  3ZYY X;  3AE2 B;  1F2R I;  3LXF A;  1K51 A;  1KJT A;  2KJ6 A;  4OHJ A;  1NBF C;  3ALB A;  3IVF A;  4RF1 A;  2KWV B;  1KH0 A;  4P1B C;  5E6P A;  1YX6 B;  4HKQ A;  4YTM B;  3H8H A;  3Q3M C;  3MJ5 A;  4EZK A;  2FCS A;  3ZW3 A;  3VUX A;  3JYU A;  2N4F A;  3C0R B;  1FRR A;  3D32 A;  2JYT A;  3QAQ A;  3BVG A;  2DYB A;  1FPY A;  4KIK A;  1YNT E;  1FD6 A;  2G4D B;  2LAS A;  2WYQ A;  3Q3J A;  2MJE A;  2A4Z A;  3ML9 A;  1NEK B;  2OOB B;  1E8W A;  4FXC A;  1YQ4 B;  1I4X A;  1TIF A;  3KUD B;  1F9J A;  2LMC A;  1WE6 A;  2GBJ A;  4MDK E;  1SB3 C;  4G0N B;  2DWQ A;  1L4Z B;  4EFO A;  2HTH A;  3ZXV A;  3AMZ A;  2C60 A;  4NAM A;  3RNG C;  1QZE A;  2J4X A;  1ET9 A;  3RFZ B;  3H7S A;  2LGD A;  4WJQ A;  4M8N A;  4GDL B;  5IKC M;  1IP9 A;  2KJR A;  1EU3 A;  2K8C A;  4WQM A;  5LLI A;  1VZ7 A;  2X38 A;  1FCL A;  1T0Y A;  4GXB A;  2MW5 A;  4KZC A;  4IM3 A;  4BVU C;  2QIE B;  3HIZ A;  3I9V 1;  4ZHP A;  5CX3 A;  2KAJ A;  1FNV A;  1F52 A;  1GAQ B;  2LWP A;  2RPV A;  4BKS A;  2JRH A;  2MBH A;  1R4N I;  2KQ4 X;  2JU6 X;  1YN5 A;  2MEK A;  3NZU A;  5GMV A;  2AQ1 B;  4XX5 A;  3CST A;  1ESF A;  1FFV A;  1V8C A;  2NPT B;  1WGD A;  4LNF A;  3ENE A;  4ZRP A;  3PS6 A;  3AE3 B;  2N9E B;  4I6N B;  3R7Q A;  3NS1 A;  4WWO A;  4Q2J A;  1V49 A;  3SU8 X;  4G50 A;  1VZ8 A;  1TZ1 A;  1E5W A;  1SE3 A;  3SDL C;  3ZIM A;  4JLC A;  1E6E B;  1J19 A;  2FCQ A;  1WF9 A;  1ISN A;  1ZGU B;  2IO3 B;  3FKY A;  1KOT A;  3PZ8 A;  1DGJ A;  4LJP B;  2NVU I;  3Q6B A;  3RNA C;  4S17 A;  4RMA A;  1G6J A;  1NYR A;  2JPH A;  2H89 B;  3C8Y A;  2JUO A;  5TR5 A;  3O13 A;  3AED B;  2GB1 A;  5EE3 A;  4AUQ C;  2XNA C;  4OZA A;  3TBL D;  2KQ7 A;  3U7Z A;  2Q5W D;  4S0R A;  2HD5 B;  1ENF A;  3MTN B;  1SE2 A;  1YX5 B;  1XT9 B;  4GLS C;  1MI0 A;  1ZOY B;  1ZDV A;  3ZLZ A;  2L7R A;  2WXJ A;  3SFD B;  1FRD A;  1HEZ E;  2JF5 A;  2LGS A;  1UF0 A;  2PJH A;  3DBL B;  2WXM A;  2L83 A;  2WGS A;  2G1E A;  1HA5 A;  1XD3 B;  2GBR A;  2QCZ A;  1WX9 A;  1HTQ A;  2KDE B;  1I4Q A;  3GS2 A;  1WGH A;  2D07 B;  4KV2 A;  3RI7 C;  2WDV B;  2H88 B;  2KFK B;  4LNO A;  2QC8 A;  2O6V B;  4TV3 A;  2IGD A;  2WNM A;  3Q8C A;  2QSD A;  3V61 A;  3AI5 A;  4N59 A;  3GB1 A;  5C2T B;  1GG3 A;  2D3C A;  1WJ6 A;  2KO3 A;  3W5V B;  4IC7 B;  1FCC C;  1Q1O A;  1R4M B;  3HUI A;  1JWS D;  2GRI A;  3OAW A;  4MM3 B;  2VRR B;  1VZ6 A;  5CHW A;  3HRD D;  1N62 A;  2DHZ A;  2BF8 B;  2LGI A;  2WXR A;  4W9D A;  1PYW D;  2NBW B;  4PS8 A;  5E6J A;  1WR1 A;  3NZ3 A;  4WWP A;  2R2Q A;  2LJ5 A;  4G3X B;  3DPD A;  4ANX A;  2PE9 A;  2ASQ A;  2W55 A;  2D3B A;  1VR9 A;  4LNN A;  1V1P A;  3QCA A;  4NQL B;  3GE3 C;  2OHF A;  1QQR A;  2V9H A;  2V0G A;  1L6U A;  2VZK D;  1J7C A;  2XBB C;  3BWU D;  3I5J C;  1KLU D;  2IGG A;  3TEY A;  1YJJ A;  4K1R B;  2I1J A;  1BML C;  3GZN I;  5IA7 A;  1RFK A;  1ZXI A;  2WXO A;  3QC8 B;  4ANU A;  4ITK A;  5C3J B;  1I42 A;  2LHE A;  1VJK A;  3EGR A;  3AEC B;  1IBX B;  3RUL A;  1Z5S B;  1J7A A;  1DOY A;  2N9K A;  3NHE B;  2N9P C;  2JRI B;  2MRP A;  2WX0 A;  3ZJT A;  3BK1 A;  2DYM A;  1UBQ A;  1GNU A;  2BT6 A;  3AE1 B;  2KMC A;  5AEK B;  4GMV A;  2W9N A;  4H2A A;  1JWB D;  2DEN B;  3H7P B;  3DVG Y;  2LGY A;  2XN9 C;  1VDV A;  1IPG A;  4C4V A;  3WAN A;  1TJE A;  1YN4 A;  2PMV A;  1JRO A;  4FJV B;  4J3O D;  3UGB B;  2LZ6 A;  1SJH D;  5HHD G;  4EEW A;  1E7P B;  1WGK A;  3S2A A;  3FAH A;  4I6P A;  2N1W A;  1YMH E;  1UWX A;  2R2O A;  4X57 B;  3IG3 A;  2C5L C;  3IAM 1;  5LXI B;  3HVZ A;  2M56 B;  4M01 A;  2ZNV C;  5BO4 B;  2W82 A;  2FUG 1;  2UYZ B;  1SBB B;  1WYW B;  1E7V A;  2BYT A;  4C7Y A;  3MC8 A;  2XK5 A;  3NY5 A;  1SF0 A;  1V2Y A;  3AUL A;  1JCK B;  2LUE A;  4MEM A;  5GXG B;  2ZCC A;  4YWG G;  2X8X X;  3IT6 B;  4AQ7 A;  2J0M A;  2M0X A;  4W9F A;  3DHH C;  3W1Y A;  2KOX A;  4AS1 A;  2NTT A;  4IWO A;  4XWT A;  4GDK A;  4USA A;  4DBG A;  2BPS A;  3AEB B;  3PZ7 A;  1C9F A;  1WXS A;  1KRH A;  3AE4 B;  2FAZ A;  2NR2 A;  1RM6 C;  3KYD D;  3A9J B;  2K22 A;  1YIW A;  4IM2 A;  2WWZ A;  1MFW A;  2ZNV B;  5EDS A;  2B76 B;  5IP4 D;  1ROE A;  5E6N A;  1LO5 D;  1WYG A;  4M0W A;  1FNW A;  4URK A;  2NTS A;  2BKF A;  4ARC A;  3AN1 A;  3DBR B;  4XE0 A;  1NVI D;  4K81 A;  4J6I A;  4ZYN A;  3AE7 B;  3ZNG C;  1D5X C;  1EWC A;  2WDR B;  4A6Q A;  3T3N A;  4A20 A;  2CHZ A;  1XLQ A;  1I7H A;  1E8Z A;  1L5P A;  3MJW A;  1F2R C;  1TY2 A;  3N1Z C;  1SE9 A;  2HDE A;  2WXI A;  3RPF C;  2AEH A;  3T9L A;  4A3O A;  2V3N A;  4YXD B;  3VH3 B;  3RD2 A;  3MP9 A;  3ONS A;  5TSS A;  1JQ4 A;  2KLG A;  1WGY A;  4M8M A;  2JVC A;  3URY A;  4IOI E;  1MG8 A;  2BYV E;  5MPO A;  1Q0W B;  2W54 A;  4D2K A;  3NJT A;  3PRZ A;  2WDT B;  3QHT A;  2Z0D B;  3BYT B;  3T3O A;  1SIJ A;  1N60 A;  2DAF A;  4XDD A;  2G4S A;  2KWC A;  4I6L B;  2LD9 A;  1HTO A;  3UIO B;  3L10 B;  2NCN A;  1QOF A;  3DBH B;  4EZJ A;  1XLO A;  4NJ7 A;  2B3A A;  1WH3 A;  4RGO S;  2WS3 B;  2EEL A;  1XCQ L;  3J9C A;  3Q14 C;  1LXD A;  4W9C A;  3RNB C;  3W1S C;  5BMI A;  2MP2 A;  2KK8 A;  2BB6 A;  4TMA B;  1GPX A;  4MJS B;  3Q3F A;  4IWP A;  2K6Q A;  3V05 A;  3VR9 B;  4E71 A;  2MWS B;  1XF5 L;  3K9P B;  3FIL B;  2K0P A;  4B6W A;  2WXG A;  4N9F 4;  2JXX A;  2ICI A;  3VUW A;  1QF6 A;  4JGH B;  4P1C C;  2E6X A;  2MJD A;  2BYE A;  1SE4 A;  2L32 A;  2GBM A;  2K9X A;  2AWT A;  2MBB B;  4CYE A;  2JXT A;  1K50 A;  5FR3 A;  1SSN A;  2MA9 B;  3APC A;  2UWQ A;  4AOF A;  2FUH B;  1ZDX A;  2L3Z A;  4L2Y A;  3V60 A;  4KDI C;  1I4H A;  3PHW B;  1KFY B;  2ZZP B;  2BTE A;  1NEN B;  1P7E A;  5J2R A;  3RT3 B;  1P9D U;  4GN1 A;  2HE7 A;  4IKG A;  3WA0 A;  2ZVO A;  1WRI A;  2INP E;  1L6V A;  3DVN V;  4WH4 A;  3R2I A;  4DK5 A;  4WAA A;  1UBI A;  3KVF B;  2N7E A;  4HVB A;  2BVC A;  3KYC D;  3X23 A;  1KLV A;  3KQ4 A;  1V81 A;  2HTM E;  3VRB B;  2K8H A;  1YOV B;  2GLS A;  2ZW0 A;  3BYY B;  2LUM A;  3GE8 C;  1PGA A;  2D3A A;  4PT5 A;  2AL3 A;  1TY0 A;  3PPA A;  3I63 C;  4IWQ A;  4RCO A;  2HJ8 A;  3KH0 A;  1E10 A;  3B2F A;  3OWE B;  4E3C A;  1V1O A;  2JX5 A;  2RMM A;  4PYU A;  1FNU A;  3AB5 A;  3VR8 B;  5HI1 A;  3ZNH B;  3PSE B;  3QK0 A;  4NAW B;  3ZTC A;  4RGN A;  1R4N B;  2D10 A;  1PFD A;  1IGC A;  1V9J A;  2YEP F;  4MT5 A;  5J18 A;  1XEE A;  2KTR B;  3RZF A;  1YQ3 B;  3TMP B;  3VTW A;  5FK9 C;  4ZRI A;  2PPH A;  2WDQ B;  3AEG B;  2RPQ A;  3PLU A;  2GBN A;  2DYO A;  1UD7 A;  2PW9 A;  2KD0 A;  5AUI A;  2BS4 B;  2DNF A;  3ZO5 B;  1P98 A;  1SEB D;  2INN E;  2FCN A;  1BXT A;  3TIX A;  1T3Q A;  2D11 A;  3CSF A;  4DHJ D;  2BWE S;  2C9W B;  2KXJ A;  1AWD A;  4RFB A;  4YTP B;  2SAK A;  1AW7 A;  3EUB 2;  1KF6 B;  1MHX A;  2CJN A;  4C80 A;  3W5U B;  3IBE A;  2IJ0 A;  4LDT D;  3PV1 A;  4DWF A;  2Z8L A;  3PT2 B;  4RGM A;  4B95 A;  4L23 A;  2MQJ A;  4JX1 C;  3AV8 A;  2M0A A;  4AWJ A;  3AEE B;  3VTU A;  1MHH E;  2TSS A;  1TS2 A;  4FAD A;  1E8Y A;  1ACC A;  3PRM B;  1C77 A;  1HZ6 A;  1RAX A;  5IN7 A;  5BYS A;  2M4N A;  1WZ0 A;  2J52 A;  2MBQ A;  4ZRK A;  5HKH A;  2DZJ A;  1ZKH A;  5G5G A;  5JH5 C;  2IO0 B;  4HJG E;  3CF6 E;  4PS3 A;  1WWT A;  1L0V B;  1Q10 A;  2VH1 A;  2KMA A;  4W9I A;  3TSS A;  3NRZ A;  2RD0 A;  1D6E C;  4JE3 B;  3N30 A;  5EE9 A;  1SXT A;  3Q8F A;  1ZW7 A;  2KNB A;  2N9X A;  3ZNI D;  3P2B A;  4NPN A;  2PKO A;  1L4D B;  2J42 A;  3L08 A;  3E56 A;  2IY1 B;  3VVW B;  3P1M A;  1V86 A;  4BKT A;  2KC2 A;  5JHB A;  4JQW C;  1C4A A;  2DX5 B;  2LHD A; 
#chains in the Genus database with same CATH homology
 3PO0 A;  3AEC B;  3E9S A;  5H8Y E;  1DOI A;  1IBX B;  1QIL A;  1J7A A;  4RF0 A;  2BS3 B;  2N9K A;  1DOY A;  2Y5P A;  1F0Z A;  3SEB A;  3NVW A;  2PVO D;  4LK0 M;  2LFI A;  1FXI A;  5T8I A;  1VLB A;  3ZJT A;  3U4E G;  4ARI A;  4L1B A;  3BK1 A;  3W9C B;  2WXF A;  3BVM A;  2DYM A;  4WAF A;  1FMA D;  4RH6 A;  2BT6 A;  3AE1 B;  1TS4 A;  2QMT A;  1HXY D;  4ZOH C;  1C4C A;  1FM0 D;  3MFG A;  3NVV A;  1J7B A;  4N58 A;  3P4S B;  1TS3 A;  4H2A A;  1JWB D;  1I4R A;  3TEW A;  1ZPS A;  2QIL A;  1ZXH A;  4NZL B;  2R61 A;  2YEP B;  3FIL A;  5D7G A;  4WWM A;  4KKI A;  1JAL A;  2XN9 C;  1VDV A;  1IUE A;  4KGT A;  3IAS 1;  1TJE A;  1EM7 A;  1CZP A;  1YN4 A;  1JRO A;  2PMV A;  4J3O D;  2PLP A;  4NJC A;  1AN8 A;  2GI9 A;  3I57 A;  1R7S A;  3NVY A;  2CJO A;  4OZB A;  1SJH D;  5HHD G;  2RDH A;  5AUK A;  3TEZ A;  5JXV A;  1B9R A;  1JWA D;  1E7P B;  1FO4 A;  1WXQ A;  1RWS A;  1WGK A;  3FAH A;  3SFE B;  3VRA B;  3IXS A;  2Y3A A;  1YMH E;  1UWX A;  2CU3 A;  1GB4 A;  1XXG A;  2K5P A;  2FE8 A;  3IAM 1;  3HVZ A;  1HQR D;  2M56 B;  1GOZ A;  3NVZ A;  5HG2 A;  3BZD B;  1E0Z A;  2W82 A;  1NYQ A;  5BMG A;  2FUG 1;  2N7J A;  1PGX A;  1SBB B;  3Q8E A;  2ACZ B;  4OW0 A;  3MHZ A;  2BYT A;  4C7Y A;  1SF0 A;  2G9H D;  1L0Y B;  1UGJ A;  2Y5C A;  3R8B A;  4XDC A;  1JCK B;  2AQ3 B;  2AX5 A;  3TEX A;  1T5X D;  5GXG B;  4OVZ A;  1JML A;  2WU2 B;  4YWG G;  4KX6 B;  3IT6 B;  4AQ7 A;  1PGB A;  1B1Z A;  1C78 A;  5BMH A;  2NMQ A;  3BII D;  2L1A A;  4AS1 A;  5EE1 A;  2I38 A;  2WXQ A;  1CK1 A;  2NTT A;  4TQ0 A;  5LNK 1;  1JW9 D;  2E3T A;  4YSZ B;  2JWU A;  4XWT A;  1OFF A;  4USA A;  3AEB B;  1PDX A;  3PZ7 A;  3FC4 A;  4IDI A;  4MH8 A;  1C9F A;  1TKG A;  5FKA C;  1I4P A;  1KRH A;  3AE4 B;  2LHD A;  1TKY A;  2MH7 A;  4P16 A;  4ZHO A;  5BYR A;  1RM6 C;  3P42 A;  2K22 A;  3AM9 A;  3P4R B;  1Y56 A;  4A55 A;  1QLB B;  1TZO A;  4YSX B;  2B76 B;  4A8X C;  1ROE A;  4C7Z A;  1LO5 D;  1WYG A;  4M0W A;  3ZYY X;  1IBX A;  1FNW A;  3AE2 B;  1F2R I;  2NTS A;  3LXF A;  1K51 A;  2WLB A;  2WXK A;  1JRP A;  4OHJ A;  5HFY A;  4ARC A;  3AN1 A;  4LTU A;  4RF1 A;  4XE0 A;  1KH0 A;  1NVI D;  1QOB A;  4HKQ A;  2QJL A;  4R3D A;  4YTM B;  3H8H A;  2FBW B;  3MJ5 A;  3AE7 B;  1D5X C;  1EWC A;  1PUT A;  2WDR B;  4A6Q A;  1OQR A;  1KTK A;  3T3N A;  1XLQ A;  1I7H A;  1L5P A;  1QKZ A;  2EKI A;  3P4Q B;  1F2R C;  1QOG A;  1V1P B;  1TY2 A;  1TKE A;  2HDE A;  2WXI A;  1FRR A;  4B0E A;  3RPF C;  3NUH B;  2JYT A;  2V3N A;  4YXD B;  3BVG A;  2V4I B;  1C79 A;  1P7F A;  4P6V F;  3MP9 A;  1YNT E;  1FD6 A;  1OQQ A;  5TSS A;  2L52 A;  1JQ4 A;  2MJE A;  4A9A A;  4B0M A;  1JWU D;  1D4B A;  1NEK B;  3URY A;  4IOI E;  5MPO A;  2WP9 B;  4FXC A;  4HRS A;  1XO3 A;  4DXF A;  1YQ4 B;  2W54 A;  4D2K A;  4A90 A;  4US8 A;  3CIR B;  1I4X A;  1N5W A;  3ZQ4 A;  1T6B X;  4DQO C;  3BYT B;  3T3O A;  1SIJ A;  2LMC A;  2DBY A;  1N60 A;  1JWM D;  1HZ5 A;  2SEB D;  3DWM A;  4XDD A;  1K52 A;  1QOA A;  4O1N A;  3AEA B;  3KWL A;  1QOF A;  1SB3 C;  3KLS X;  2DWQ A;  1L4Z B;  1ET6 A;  4HKZ E;  5D3D A;  4XWW A;  4C56 C;  2KWD A;  1XLP A;  1XLO A;  3AMZ A;  4NAM A;  4RGO S;  2K3U A;  4UDU C;  2WS3 B;  4RNA A;  2EEL A;  2J4X A;  1XCQ L;  1ET9 A;  3J9C A;  4WIP A;  3RFZ B;  3LB8 C;  5BMI A;  2BB6 A;  4TMA B;  1GPX A;  2LJI A;  4GDL B;  3VQI A;  3V05 A;  2JQR B;  3WCQ A;  4EE2 A;  3VR9 B;  4US9 A;  4REZ A;  1XF5 L;  1EU3 A;  4WQM A;  3FIL B;  2K0P A;  1VZ7 A;  2X38 A;  2WXG A;  4YTN B;  3ABV B;  1FCL A;  2ZW1 A;  2ICI A;  5BYQ A;  1QF6 A;  2QIE B;  2E6X A;  2MJD A;  2BW2 A;  3I9V 1;  2WQY B;  2ONQ A;  1SE4 A;  4ZHP A;  2KAJ A;  2L32 A;  2QEJ C;  1FNV A;  3U52 E;  1V97 A;  1GAQ B;  3BVZ A;  2K9X A;  2RPV A;  2JXT A;  1DOX A;  2KQ4 X;  1SJE D;  2JU6 X;  1YN5 A;  2MEK A;  1N63 A;  2KN4 A;  1K50 A;  5FR3 A;  1SSN A;  2V3P A;  2AQ1 B;  2IGH A;  1VRA B;  1ESF A;  1MVK A;  1UWM A;  1ZDX A;  1RYJ A;  4L2Y A;  1FFV A;  1V8C A;  1FFU A;  3GP7 A;  1I4H A;  5D3I B;  1KFY B;  3B2G A;  2BTE A;  1N5X A;  1NEN B;  4RGT A;  1MPE A;  1P7E A;  1YN3 A;  4KGS A;  4ZRP A;  1TYG B;  2KAC A;  2I2Y A;  4IKG A;  4ZRQ A;  3AE3 B;  1WRI A;  3NS1 A;  3W2D A;  1I4G A;  2INP E;  2PVG C;  3P63 A;  1L6V A;  1BUI C;  4Q2J A;  1XCT L;  4WH4 A;  3R2I A;  1VZ8 A;  1SE3 A;  3Q8A A;  2BB5 A;  1E6E B;  4HEA 1;  3KQ4 A;  1UNS A;  2HTM E;  3Q69 A;  3KWV A;  1EU4 A;  1WSP A;  3VRB B;  2ZW0 A;  3BYY B;  2LUM A;  3PZ8 A;  4GDK B;  1QT9 A;  1PGA A;  1DGJ A;  3HVD A;  3Q8B A;  4PT5 A;  2JSV X;  1TY0 A;  2W3R A;  4RCO A;  1E10 A;  3B2F A;  1NYR A;  1D5Z C;  4TQ1 A;  3ZJU A;  3OWE B;  1V1O A;  2H89 B;  2JX5 A;  2RMM A;  3C8Y A;  1FNU A;  1CQV A;  3AB5 A;  3VR8 B;  5HI1 A;  1F77 A;  3O13 A;  1ZP0 B;  4HRO A;  1C76 A;  4NAW B;  1D5M C;  3AED B;  2AQ2 B;  3L4P A;  2GB1 A;  4YSY B;  2WXP A;  5EE3 A;  2XNA C;  4OZA A;  4RGN A;  1PFD A;  1C4P A;  1K53 A;  4JWU C;  1IGC A;  3P4P B;  2BBC A;  2YEP F;  4MT5 A;  3U7Z A;  2Q5W D;  2RDG A;  1XEE A;  5EE0 A;  2M19 A;  1YQ3 B;  2WXL A;  1YJI A;  1ENF A;  1SE2 A;  4KKJ A;  4JPS A;  5FK9 C;  2WDQ B;  3AEG B;  4GLS C;  1MI0 A;  2DYO A;  1ZOY B;  3B9J A;  1ZDV A;  2PW9 A;  2BS2 B;  5AUI A;  3LYY A;  2BS4 B;  4JWS C;  2WXJ A;  3SFD B;  1FRD A;  1HEZ E;  2KMM A;  2IDY A;  3AH7 A;  3AE5 B;  1SEB D;  5I4D A;  3ZJV A;  1M4V A;  2INN E;  2IPK D;  2WXM A;  4DXG A;  2L83 A;  2G1E A;  1BXT A;  2VZK B;  4CQN A;  1HA5 A;  1STE A;  1T3Q A;  3EA6 A;  2JZP A;  2DLB A;  2MJ3 A;  1DYQ A;  3R2T A;  2N9L A;  1AWD A;  1I4Q A;  3GS2 A;  4RFB A;  4TSS A;  4WUR A;  4YTP B;  2SAK A;  1AW7 A;  2KDM A;  1L0X B;  3EUB 2;  2WDV B;  1KF6 B;  1MHX A;  2CJN A;  4YT0 B;  4C80 A;  1UUP A;  3W5U B;  3IT4 B;  2IJ0 A;  1KLG D;  2H88 B;  2Z8L A;  3UI3 A;  4RGM A;  2IGD A;  2WNM A;  2PIA A;  3Q8C A;  2J53 A;  4ZYS A;  2QSD A;  4L23 A;  1N61 A;  2D5G A;  4JX1 C;  3DWG C;  1CJE A;  1XLN A;  4N59 A;  3GB1 A;  3W1S A;  3AV8 A;  2M0A A;  5C2T B;  3AEE B;  1MHH E;  3U2S C;  2TSS A;  1TS2 A;  3W5V B;  1ACC A;  1C77 A;  1FCC C;  1NI3 A;  1HZ6 A;  4MAC A;  2ON8 A;  4OZC A;  5BYS A;  1ZUD 2;  3HUI A;  1A70 A;  1JWS D;  2GRI A;  2J52 A;  5H92 C;  4MM3 B;  3BK2 A;  1VZ6 A;  5G5G A;  3AE6 B;  4HJG E;  4N6E B;  3HRD D;  1N62 A;  4LLG M;  2WXR A;  2N0S B;  2LGI A;  1PYW D;  1WWT A;  1L0V B;  5G5H A;  1TS5 A;  5E6J A;  1FEH A;  2JYE A;  2WXH A;  1Q10 A;  1FIQ A;  2OED A;  3ETR A;  3NZ3 A;  3AE9 B;  1IGD A;  3AEF B;  2WU5 B;  3SR6 A;  3TSS A;  3NRZ A;  1EWY C;  3TUO A;  1D6E C;  4JE3 B;  2W55 A;  1VR9 A;  1V1P A;  5EE9 A;  1SXT A;  1E9M A;  2OHF A;  2WXN A;  3Q8F A;  3N9Y C;  1QQR A;  3AE8 B;  2V0G A;  1L6U A;  2VZK D;  1J7C A;  1ZE3 D;  3BWU D;  3MC0 B;  2PTL A;  2PKO A;  1KLU D;  2IGG A;  2W3S A;  1L4D B;  2J42 A;  3TEY A;  3E56 A;  1YJJ A;  3V3X A;  3CWI A;  3P1M A;  1BML C;  1RFK A;  1ZXI A;  2WXO A;  1FXA A;  2LEK A;  1C4A A;  4ITK A;  3ZGZ A;  5C3J B;  2LHE A;  4KGR A;  1VJK A;  3EGR A;  1AYF A;  1GB1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...