3LB8C

Crystal structure of the covalent putidaredoxin reductase-putidaredoxin complex
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
104
structure length
104
Chain Sequence
SKVVYVSHDGTRRELDVADGVSLMQAAVSNGIYDIVGDCGGSASCATCHVYVNEAFTDKVPAANEREIGMLESVTAELKPNSRLSCQIIMTPELDGIVVDVPDR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of the putidaredoxin reductase x putidaredoxin electron transfer complex.
pubmed doi rcsb
source organism Pseudomonas putida
molecule tags Oxidoreductase/electron transport
molecule keywords Putidaredoxin reductase
total genus 27
structure length 104
sequence length 104
chains with identical sequence D
ec nomenclature
pdb deposition date 2010-01-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00111 Fer2 2Fe-2S iron-sulfur cluster binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 3lb8C00
1E6EB 5EE3A 1PDXA 1NYQA 1FIQA 1RM6C 3AV8A 3CWIA 4YSYB 1QF6A 2WLBA 1TKYA 1SIJA 4ITKA 3W9CB 3AECB 3DWGC 3SFEB 2CJNA 1L5PA 1N60A 1NEKB 3ABVB 1F0ZA 1L6VA 2DBYA 2PVGC 3SR6A 1YQ3B 4N58A 2W54A 1JQ4A 4N59A 2PIAA 4HROA 4US8A 2WDRB 1TKEA 2B76B 2Y5CA 3B2FA 1ROEA 3HRDD 2CU3A 2WP9B 3NVWA 5MPOA 1NI3A 1XO3A 2H89B 4P6VF 1JROA 1AWDA 1JW9D 3CIRB 5AUIA 3VRBB 2WQYB 1J7BA 3VR9B 4C7YA 1FM0D 1ZUD2 1A70A 1V97A 1TKGA 1N5WA 2ACZB 2QIEB 3AN1A 3SFDB 2K22A 2PKOA 3AE6B 4YT0B 2E3TA 1NYRA 2BS3B 5GXGB 2WDQB 1WRIA 1ZP0B 1ZXIA 2WU2B 3AE3B 3DWMA 4WQMA 5H8YE 4ZOHC 1CZPA 1QOAA 2KMMA 1TJEA 1UWMA 3AE7B 3AEFB 1RFKA 1WGKA 1JRPA 2BT6A 4C7ZA 1L6UA 3B2GA 4YTMB 1E10A 2WDVB 3FC4A 4ZHPA 2W55A 1JWBD 3HVZA 1J7CA 2BS4B 4JWUC 3AEGB 5C2TB 1V8CA 3WCQA 4JWSC 3W5UB 1WXQA 2Q5WD 3B9JA 1N62A 2WU5B 1DOIA 3FAHA 1KRHA 2JQRB 1DOYA 1FMAD 1QOFA 1GAQB 2PVOD 3NVYA 3VRAB 4USAA 1WWTA 3RPFC 1VLBA 4C80A 3ETRA 1E7PB 3NRZA 1OQQA 2DWQA 2L83A 1JWAD 3KWLA 1L0VB 4LTUA 4WWMA 1OQRA 1YJIA 2L52A 2M19A 2M56B 3AEDB 3BIID 3P4RB 1VJKA 1XLPA 1J7AA 1XLOA 3P4QB 1FXIA 4A9AA 1SB3C 3L4PA 1B9RA 3AE1B 1KF6B 4ZHOA 4JX1C 1DGJA 5H92C 1PFDA 2MJDA 2JX5A 1I7HA 3AE4B 4US9A 3NS1A 3AH7A 1TYGB 1YQ4B 1VDVA 2K5PA 4YSZB 4YSXB 1JALA 3LXFA 3AB5A 3NVVA 3AE2B 1E9MA 4YXDB 5EE1A 1N63A 1QOGA 5G5HA 2AX5A 1PUTA 1XLNA 2QJLA 2MJ3A 2EKIA 2WS3B 3P63A 2N0SB 4YTPB 1XLQA 3VR8B 1KFYB 4HRSA 1RWSA 3AE9B 1FXAA 1EWYC 5EE9A 1R7SA 3AEEB 3P4SB 2KAJA 1FFUA 1OFFA 4YTNB 5AUKA 2MH7A 1FRDA 1NVID 3P4PB 2H88B 2CJOA 1FO4A 1FRRA 1DOXA 3NVZA 5G5GA 3AEAB 3HUIA 1YJJA 1QT9A 4N6EB 2G1EA 2LEKA 3PO0A 1QOBA 3AMZA 2FBWB 1T3QA 1QLBB 4IDIA 3ZYYX 3LB8C 1N5XA 2K9XA 1IUEA 3AE5B 3AEBB 2MJEA 1E0ZA 2W3SA 3W5VB 3P1MA 2BS2B 5EE0A 2OHFA 3AM9A 1SF0A 1N61A 1NENB 1RYJA 5C3JB 1FFVA 1ZOYB 2W3RA 1AYFA 3AE8B 3EUB2 4KX6B 1GPXA 2HTME 4FXCA 1CJEA 1WYGA
chains in the Genus database with same CATH superfamily
1E6EB 1PDXA 1RM6C 1P7FA 1F9JA 4ITKA 2L1AA 4HCNB 3KUDB 1L6VA 4N59A 4IWOA 4RGNA 1UH6A 3HRDD 3DBHI 1F2RI 5FKAC 1WGHA 3X23A 2JPHA 3OAWA 4MH8A 2CKHB 1FM0D 1TTNA 3EFCA 3AN1A 1HZ5A 2FE8A 4UDUC 5GXGB 1SGHA 1WRIA 2N9EB 3IT4B 3V62A 5JH5C 4URKA 4XDCA 4ZHPA 2RR9A 2BS4B 3UF8A 5DPWA 2BYEA 1V8CA 4JWSC 3IHPC 2HTHA 2X38A 3BVGA 1F1HA 2XN9C 3WANA 3MFGA 1E90A 1SE9A 4B0MA 3I9V1 3Q2AC 1L4ZB 3SDLC 2WXOA 2INDC 3AE1B 5FK9C 4W9LA 1F2RC 3ZVVA 2K5PA 3T3OA 3AB5A 3KUCB 5L95C 2QJLA 3E9SA 2K8HA 3ZRCA 4M00A 3P4SB 3PREA 1IBXA 2MQJA 2KX0A 3U7DA 2VRRB 4TSSA 3V3XA 1R4MI 4B9KA 1QT9A 2C7HA 1HEZE 2LEKA 1QLBB 3PS6A 4PYZA 1J0GA 1GC7A 4KZ0A 2KD0A 1GPXA 1WYGA 2D3GA 2QEJC 1WH3A 2ZCBA 4HCPB 2KNBA 3TEYA 2J52A 4PYUA 4HROA 2REXA 2D3AA 1NBFC 4IM2A 4BFRA 1VZ6A 4ZRJA 5MPOA 1KH0A 2J7QB 5D3IB 3CIRB 3VRBB 1WXAA 2DAJA 1J7BA 3NJTA 3UIOB 1HXYD 1PQSA 4HEA1 1QKZA 2BS3B 2V3SA 2PW9A 1WGYA 1WZ3A 4KDIC 2KWUB 3DHGC 2KMMA 3AEFB 4MGIE 4GMVA 3AEGB 4HPLB 1WXQA 3PZ7A 2C9WB 3RNCC 4C4VA 2JQRB 3NG0A 3EHVA 2KDMA 2IGGA 2C7NB 1JWAD 2KDBA 1OQRA 3VUXA 2WX1A 2K3UA 1TS2A 3AE4B 2JZPA 3U8ZA 2E6XA 4KKIA 4IWPA 1EF1A 2QHOA 1YOVB 4YTPB 3L10B 2L05A 4PS8A 5E6NA 2NBWB 4HK2A 1WM2A 2MH7A 4KGRA 2KHWB 3ZTDA 3NVZA 4GXBA 2OEDA 3HUIA 4RMAA 5C1ZA 3R2IA 1UGJA 3DBLB 3RCZA 3DQVA 4N9F4 4LNNA 3WALA 4RH6A 3AEBB 4TQ0A 2KFJA 1C9FA 1TZOA 1L4DB 1NENB 5TSSA 3DCGA 1C3TA 4AOFA 1WGDA 4NY0A 2ICIA 2FCSA 2J53A 2D11A 4YSYB 1YIWA 1JWUD 1YX6B 1WI0A 3X0WA 1NDDA 3DVGY 3C8YA 1D4BA 1WGGA 1I4QA 2BB6A 2G3QB 3RUIB 4AJWA 1BT0A 1JQ4A 1TKEA 4C00A 1XCTL 1SJED 3B2FA 4TMAB 3ZJTA 3AXCA 4HLEA 4WH4A 1QILA 4H2AA 5E6JA 5G55A 2RDGA 2ACZB 3VAWA 2IY1B 4LJPB 3AE3B 2JYTA 4L1BA 2M0XA 2CR5A 2BT6A 2WXRA 2JZZA 2HJ1A 4ANWA 3APDA 3QX1A 3PV1A 3B9JA 1DOIA 4FHKA 2MRPA 3Q3NC 1KOTA 1FD6A 3NRZA 1OQQA 2HDEA 3C19A 3APCA 2C7MB 1MVKA 4LK0M 4BBNF 4NPNA 1SB3C 2MLBA 3OLMD 1E8YA 3DVNV 2PJHA 1TBEA 5IKCM 3RZWC 1E9MA 2MCNB 2G4SA 4XDDA 2M1MA 4RGMA 3MC8A 3VR8B 1I4PA 1Q1OA 3K9OB 4BZAA 4J6IA 2H88B 5HHDG 2ZW0A 4FHJA 2BBCA 5DPRA 4XC2A 2N1WA 5IOIA 2LGDA 4K1RB 2GMIC 1KM7A 5D94A 1QZEA 1HTQA 2QSDA 2HJ8A 3RNEC 3NY5A 2LHDA 3PRMB 1ZOYB 3R7QA 2W3RA 2IJ0A 2KXJA 4KX6B 1GB4A 4NQLB 2V0GA 3AV8A 1QF6A 2WLBA 3W2DA 4IWQA 4XE0A 2J4XA 1WFYA 4WWNA 5DPTA 1U4AA 3Q8AA 2DYOA 4N58A 3GB1A 4US8A 2MHJA 2Y5CA 4IM0A 1YN5A 1GOZA 5BO4B 1AWDA 3L17A 3TJPA 3VR9B 1ZKHA 4YWGG 4ICUA 2EMTA 5AEKB 4IKGA 2MA9B 2KX3A 3A4RA 1EUVB 2GBKA 1M94A 4NJ7A 2J42A 2IPKD 3BVMA 3TCAA 1D5ZC 2PPHA 3FC4A 2N7JA 3N32A 3NHEB 5E6OA 4ZYNA 3FAHA 3W1YA 5BYQA 3ZGZA 4USAA 3VQIA 5IA7A 2LHEA 4AQ7A 3AI5A 4WIPA 4B6WA 5IP4D 1VZ8A 5DCNA 3KUZA 1T0QC 2RDHA 1TYGB 3ML8A 1BUIC 4DHZE 3Q14C 3Q3FA 2VH2A 3AE2B 1ZPSA 2KTRB 4WWOA 3UI3A 1XLNA 2CU1A 3PLVA 2KTRA 3GZNB 1RWSA 5EE9A 3QCAA 3AEEB 2BQQA 4KSKC 1C77A 4S0RA 1OFFA 4JQWC 3ZXRA 2IGHA 2XEWA 4FA6A 3H6NA 1OEYA 4LCDE 1IPGA 1QOBA 2M4NA 1A5RA 4IDIA 3Q6BA 2L0FA 2XK5B 5IAAC 5T8IA 3W5VB 2BS2B 4W9JA 3ZNGC 2JRHA 4AWJA 1ZGUB 1EWCA 2O2VB 4PS7A 2AEHA 4HJKA 3N9YC 2IO3B 2CJNA 3OG5A 2KO3A 3P42A 2NBUA 2MX2A 2W54A 4ZRKA 2I2YA 2B76B 2L0TA 4M02A 1D3ZA 1ROEA 5KHOA 2N7EA 5LLIA 2LASA 1WJUA 1IGDA 3U52E 3TIXA 3H9DA 4YT0B 1NYRA 2WU2B 2DNFA 1TY0A 2R2OA 4A6QA 3VH4B 2Z0EB 4YTMB 2DZJA 1VR9A 2KMCA 4JWUC 1R4NB 1UF0A 2RD0A 1WXMA 1AARA 1MHHE 2KYWA 4WJNA 1OGWA 2C60A 2V9HA 4HVBA 4PK1A 3R7RA 1XXGA 1F52A 1VD2A 4MGZE 3HM3A 4YSXB 3IT6B 2LMCA 3JSVA 2UU7A 2KOXA 2KLCA 1P98A 1PUTA 3M62B 2LJ5A 5CX3A 3VH3B 3PPAA 3ZKJC 4C56C 1WYWB 4MSQB 5J18A 2SEBD 1YJJA 2NPTA 1IGCA 2KVZA 2D3CA 2CHZA 3PT2B 4REZA 2NPTB 1UZXB 5BMHA 4P7IA 4WURA 1N5XA 2Z0DB 2JZ3B 5CHWA 2KFKA 1SF0A 5HKHA 1N61A 4HPPA 5C3JB 1Y56A 1JMLA 4GN1A 2NCNA 2MW5A 1FNVA 3W9CB 4ZYSA 3AECB 2KJ6A 1N60A 4TKNA 2IGDA 2N4FA 1T6BX 3HHMA 4TUUA 4GOCA 3BK2A 1NI3A 3KH0A 4IG7B 3RD2A 1E8WA 2AL3A 1N5WA 4G0NB 2N9KA 4RM8A 4HPMB 4W9IA 1ZW7A 5H8YE 2VZKB 4CO7A 1ENFA 3B2GA 3T3NA 1JWBD 2V4LA 1WR6E 4M0WB 2XK5A 2PVOD 3IAM1 2IO1B 2BF8B 2KJHB 4M0WA 2RPQA 4WWMA 3K9PB 4OZAA 4A9AA 4EE2A 4A90A 4II2B 2WNMA 4M01A 4RM9A 3I3TB 3LXFA 4MDKE 2AQ2B 3GS2A 2AX5A 2WX0A 4ZRQA 1YD8U 3VVWB 3KVFB 5LXHA 4HJGE 2FUHB 4I6PA 3JYUA 2DHZA 2B3AA 1V1PA 4PT5A 1WMHA 1XQQA 3M3JA 3S2AA 4A55A 2LGYA 3QAQA 3ZTCA 2FNJB 1FRRA 1TIFA 1WMHB 3U30A 3FILB 4ASWC 1TS4A 3PHWB 2W82A 3PRPB 2Z59B 3PVLA 3AE5B 4RCOA 3N3KB 2K25A 1Q0WB 1WGRA 3NVVA 4FADA 3DWGC 2KWVB 2TSSA 1WJNA 2LVPA 3CSFA 2KKCA 3PSEB 3H7PA 2WWZA 4AUQC 2BYVE 2JXXA 3EECA 3VHTC 5LXIB 1WX7A 1XF5L 2D3BA 2HD5B 2KN5A 2I1JA 3TEWA 1MG4A 4WJOA 2D2QA 2WDQB 4IM3A 1TS5A 4PS3A 1ET9A 3UQBA 1JRPA 3RULA 1HTOA 5C2TB 3ZNHB 2Q5WD 2WU5B 4FLHA 4JIOU 2I1KA 1N6ZA 1UBQA 2QILA 1VLBA 2N7DA 4R3DA 3QIJA 2Y5PA 2FIFA 1E7UA 4LLGM 4HKQA 1J7AA 3P4QB 3N20C 1J19A 5IO9A 4GDKA 2FCQA 4GDKB 4AP4C 2NR2A 1QOGA 2YLMA 2EKIA 4DHJD 3Q8CA 3IFWB 1E5WA 4GB9A 1R4MB 1JCKB 1FRDA 2BW2A 3HIZA 3RNFC 5FR3A 1C76A 3ZRFA 3BK1A 5JZEB 1LM8B 3JW0X 2RPVA 3ZNZB 1UGMA 4FJYA 1IBXB 3IAS1 3RN9C 1SJHD 2PTLA 3AE8B 1UUPA 1LQBA 5EE3A 1FIQA 2WXIA 3FKYA 3QHTA 3WAMA 1SIJA 4HWIB 2UYZB 2OJWA 1KLUD 2DBYA 1D5XC 3MHZA 3AU5A 2J0JA 1MJDA 3M63B 3DVGX 3MHSD 4GU2A 1G6JA 2EMSA 2DLBA 4EEWA 1UWXA 1V97A 1TKGA 2K22A 2PKOA 2SAKA 4EZLA 2BYTA 5BYRA 4YL8A 4DWFA 3DVNU 2NS5A 3DBRI 2MP2A 1PYWD 4DHJB 2LVOA 4XX5A 3NVYA 3OJ4B 2RGFA 3VTUA 1WWTA 1E7PB 1V5TA 2IO2B 4DXGA 3BZDB 2ZCCA 1XLOA 5E6PA 1B9RA 4BBNC 2MJDA 2JX5A 1L0XB 2LXAA 5G5HA 1OTRB 2WXNA 5HI1A 3H7PB 2JUOA 1FXAA 1K52A 5FR6A 4MH0E 3L16A 4DXAB 4RGOS 4MGYE 5G2NA 1WX9A 3IBEA 3PO0A 4NJ6A 1P7EA 2LI5A 4QAYA 2ONQA 4HDQA 3PTFC 3LDZE 2PEAA 3NUHB 3QWZB 4NAMA 1ZDXA 1H4RA 4EKUA 4LDTD 1TGZB 1CJEA 2Z8LA 1PGBA 2QMTA 4W9KA 3V6EB 2VZKD 3WAPA 4HKZE 3ABVB 1NEKB 1JWMD 1BMLC 2L3ZA 2MSED 5KHQA 2PIAA 3ZUNA 1T0RC 2JU6X 4W9GA 3OJ3A 1Z2MA 4XWTA 1YQBA 1L2NA 1IYFA 1FNUA 1V80A 5AUIA 3RZFA 2KQ7A 1WX8A 2C5LC 2WXMA 1GG3A 2BWES 1CMXB 1FPYA 3BINA 3NZUA 4LNOA 1ZP0B 4AS1A 5I4DA 3MJWA 1QOAA 4G3XB 3VUYA 1RFKA 3M95A 3WAOA 1PGXA 3VXWA 4K7WA 1P1AA 4MSMB 1FMAD 1ISNA 3RPFC 3EA6A 3CSTA 2R2QA 3EC8A 3VDZA 4X57B 4TV3A 2M19A 3URYA 4K7SA 2A4ZA 2QCZA 2N9XA 3U4EG 3L4PA 3U7ZA 3H7SA 1LFDA 3NS1A 4XGAB 4MEMA 3TMPB 4LNKA 1D6EC 3A9KB 2DYMA 2MBQA 3KWVA 4GGQA 1T0SC 3A9KA 1WF9A 1YN3A 3I63C 4N6EB 1KLGD 4CHKA 2FBWB 1T3QA 2BB5A 2JWUA 4ICVA 2IYDB 3E56A 2MEKA 3ZQ4A 2MP2B 2N9PC 4TQ1A 3EUB2 5TR5A 2HTME 3KYCD 3CWIA 1ZXHA 3R8BA 2V1YA 3QARA 3U2SC 2JY6A 2KZRA 4CQNA 3DBSA 3RI7C 1TY2A 3D32A 3DOWA 4ZDVA 4MT5A 4B0EA 2L8JA 1MI0A 3QA8A 4XYCA 3GE8C 2JT4B 1WM3A 2BTEA 2LRWA 1RLFA 1ZUD2 1XT9B 3HVDA 3UGBB 4MGKE 4A8XC 4IUMB 5HG2A 2JYEA 1CZPA 1TJEA 5D7GA 3V60A 1ACCA 1L6UA 1PGAA 2JWZA 2V4IB 5AZGA 4FBJB 3GOEA 2W9NA 4Q2JA 4WAAA 4ACFA 3KLSX 2ZZPB 2LVQA 3V05A 2LWPA 2D10A 4MACA 1C4CA 1I4XA 3WA0A 2HE7A 3PZ8A 1V1OA 2FUG1 1GJZA 2BWFA 4GIVA 2WXGA 2QDFA 3KYDD 2ZPNA 2JXTA 2IDYA 3AH7A 1YQ4B 2FCNA 2G4DB 4YSZB 1AW7A 1UNSA 3N1YC 2NBVB 1SE3A 4BKTA 1HZ6A 1FFUA 4D2KA 1P0RA 4RNAA 3H1UA 4LNFA 3MC9A 2KDEB 3P4PB 3DBLI 1WXSA 3IXSA 4EZKA 4OZBA 3Q3JA 2O6VA 4OVVA 4A3OA 3LB8C 3WIMA 4JE3B 2J0MA 2K9XA 3Q8EA 5D6JB 1X1MA 4KSLC 4ARCA 4OZCA 4OHJA 3BWUD 4K3CA 2L76A 1NYQA 2WYQA 3EFUA 4I6NB 2KJRA 3L54A 4L23A 3HK0A 3IG3A 3T8MA 3TL5A 1I42A 2WDRB 2ZEQA 4OVUA 1KJTA 2OJRA 1UBIA 2INPE 2WQYB 3MP9A 1ZDVA 4C7YA 1EU4A 3ZNID 1A70A 2DENB 2I38A 2ZNVC 3AE6B 4KKJA 1VZ7A 3SHQA 5JHBA 3N1XC 4E71A 2ZW1A 2MWSB 2LD9A 2YEPF 4NJCA 1E7VA 3A33B 4KIKB 1GAQB 4F7ZA 2K8CA 2XNAC 2M8SA 1V2YA 3Q8FA 4LTUA 2KC1A 2V3NA 2L52A 3BIID 1KF6B 2K0PA 4JX1C 3ZDMC 1OQYA 1C1YB 3RNBC 1JALA 4G11A 2DYBA 3O13A 3RNGC 1N63A 4HDOA 1FXTB 3P63A 1FNWA 1TZ1A 1YJ1A 2KAJA 3I5JC 2O6VD 1DYQA 1NVID 3APFA 2Y3AA 2KACA 3NS8A 3SD5A 3SEBA 2UWQA 4RF0A 1IP9A 2AQ1B 5EDSA 4FJVB 2MJEA 2W3SA 2D07B 3Q8BA 3TSSA 4E3CA 4MELA 5D2MB 3AM9A 1CK1A 2KC2A 1RYJA 1Y8RC 4HXDA 2G45B 3DHHC 1FFVA 1AYFA 3CF6E 4WJPA 3RYTA 2MBOA 3ZJUA 4LJOB 2GRIA 2KFKB 3SR6A 1D5MC 2AQ3B 2K39A 2G9HD 2NTSA 4BOSC 4XWWA 3R3MA 4JPSA 4W9EA 3KW5B 4DXFA 1JROA 2M0AA 4ZRPA 1AN8A 3SFDB 2QIEB 4B95A 4OW0A 1RFAA 2E3TA 4M8MA 1UD7A 5C23A 4W9CA 4ZOHC 1V6EA 4OVZA 4W9DA 3HVZA 4LDTB 1J7CA 1Q5WB 4J3OD 4A20A 1WE6A 1BXTA 3W1SA 4C80A 1VCBA 2L83A 2L00B 1WIAA 1UELA 1MG8A 2KDIA 2KTFA 4GLSC 4IC7B 2GBJA 4W9FA 1I7HA 2DZKA 2Y5BB 1Q10A 4EOYA 3UINB 2J0KA 3UQAA 1RRBA 1QQRA 3RNAC 2FCMA 2BGFA 1KTKA 1V81A 1EWYC 1ET6A 2BVCA 3V61A 1B1ZA 3DBHB 1LO5D 1T0YA 2KANA 3OWEB 2N1VA 3PRZA 2RSUA 1WR1A 2EELA 1I4RA 2IY0B 4S17A 3T9LA 3Q3OC 4DDGD 1V1PB 5J17A 1K8RB 1SE2A 1TT5B 5EE0A 2INCC 2JRIB 3FILA 3VTWA 4KIKA 1XD3B 2ZPYA 4O1NA 1HQRD 3RMKC 2IBIB 2KVRA 3BVZA 4ZRIA 3SFEB 3HM6X 4K81A 1F0ZA 3N30A 2BPSA 2LRUA 3H8HA 3A1QA 2KK8A 3IVFA 3JVZX 4AJYB 3A1QB 2AL6A 2DAFA 1JW9D 3EGRA 2L7RA 2GBRA 1SXTA 5BYSA 2GB1A 2MBHA 1LGRA 4JLCA 4A3PA 3TBLD 4K7UA 4ANVA 1ESFA 1R4NI 2PE6B 2KWCA 1E10A 1WGKA 4MJSB 2N9LA 3MJ5A 2WDVB 2CHWA 1XCQL 4MJSA 3TEZA 4ANXA 1DOYA 1YMHE 1I4GA 1QOFA 4KGSA 2LXCA 3TEXA 4BKSD 4EUTA 1C4PA 4JL9A 2RMMA 1L0YB 3ZW3A 3ECIA 2GOWA 1NI2A 1SIFA 4WQOB 4XZ4A 2KWDA 1E8XA 2WXKA 1WRDB 3W1SC 1KLVA 4II3B 1JWSD 2GBMA 1E8ZA 2IO0B 2WS3B 4FJZA 4RGTA 2N0SB 4F1SA 4HRSA 2DZIA 3VTVA 1GUAB 2LGXA 3Q3MC 2JF5A 5AUKA 4C4VB 3LJ3A 3UIPB 3SU8X 1FO4A 5G5GA 1K51A 2V3PA 2G1EA 1F77A 5CHVC 2PMVA 4F8CB 1SE4A 4BKGA 1E0ZA 4ARIA 4NNJB 1STEA 2WHIA 2OHFA 2K1FA 1GNUA 1YNTE 4P1CC 2QC8A 1EU3A 1TKYA 1OEYJ 2KMAA 4DK5A 1L5PA 1FEHA 2PVGC 1P9DU 1WSPA 4MM3A 1RAXA 2YVCA 2LZ6A 3Q69A 2CU3A 3PHXB 5D3DA 1M4VA 2WXJA 3DPDA 4RF1A 2MBEA 2R61A 1WXVA 2LJIA 1ZXIA 3ML9A 2IZVB 1UWMA 2WXLA 1K53A 2AYOB 2WXQA 3L08A 3R2TA 2CHXA 1P3QU 4BAXA 2L32A 2BYFA 1C79A 1V49A 2ZVNA 3MTNB 3QJZA 3C0RB 1GC6A 4LNIA 4EZJA 1I4HA 3PZDA 2M56B 2LUMA 1VJKA 2K8BA 5J2RA 4ZHOA 2WXHA 4FN2A 3O65B 4M8NA 1J8CA 3MC0B 1C78A 4DDID 5JXVA 4WWPA 2X8XX 4YXDB 2ZVOA 4DBGA 1FCLA 3VFKA 2INNE 4GDLB 1EM7A 2GI9A 2MBBB 3NZSA 3ZLZA 3RFZB 5GMVA 4KZCA 1WE7A 3ZYYX 2JVCA 1IUEA 3QC8B 1WJ6A 2NMQA 3BYTB 2VH1A 3KQ4A 4E74A 2PE9A 4BVUC 2K6QA 4EFOA 1SEBD 3BYYB 4JGHB 3RT3B 4GSWA 1Z5SB 2RDBC 4DHZB 2LGSA 1YQ3B 3DHIC 3ONSA 3GE3C 3QK0A 2WXFA 3GZNI 4G50A 2ZJDA 4WAFA 2WP9B 4W9HA 3NVWA 2LGIA 5LNK1 3A4SC 3LYYA 1XO3A 2H89B 4DQOC 4NZLB 3R66C 3I57A 2LFIA 2ZNVB 3ZXVA 4WQMA 3ALBA 1H8CA 1ZE3D 4C7ZA 2EKEC 1GB1A 2W55A 2A5UA 3W5UB 1N62A 3NOBA 1KRHA 5DPSA 3VRAB 3V6CB 1SBBB 2O6VB 3B0AA 2DWQA 3JSVB 1L0VB 4P16A 2FIDA 3P4RB 1XLPA 1V86A 2WGSA 5IN7A 4WJQA 1JRUA 2GBNA 5H92C 1PFDA 4CYEA 1WJ4A 4US9A 1VDVA 1S3SG 2FAZA 1CQVA 2BKFA 2OOBB 2KQ4X 4MM3B 3NZ3A 3GP7A 3ZO5B 1YN4A 1XLQA 2AWTA 2JSVX 1KFYB 5AZFA 1L7YA 3J9CA 4ANUA 2KN4A 4IOIE 4K3BA 1DOXA 3AEAB 1LXDA 3ZIMA 3BY4B 3L13A 2YEPB 4P1BC 2CS4A 2KDFB 5HFYA 3VUWA 3PGEA 3ENEA 2KLGA 3ZJVA 5BMGA 2PLPA 2NVUI 4FXCA 5JHAA 5CTRC 1K50A 2KQSA 4BOZB 1EF5A 1T5XD 2BKRB 3AU4A 3N1ZC 1FCCC 2DZMA 5CHFA 1I35A 1MFWA 2XBBC 4RFBA 4NQKE 4P6VF 4L2YA 1YX5B 4KDLB 4GDLA 2ASQA 5AZHA 4BKSA 1TS3A 3DWMA 3B1LX 2DX5B 1HA5A 1HE8A 3AE7B 3P2BA 3QQ8B 4NAWA 4FULA 2KT7A 1C4AA 2M17A 2O2VA 4NAWB 3WCQA 3CMMB 2NTTA 3DBRB 3ETRA 2D5GA 3AULA 3KWLA 1YJIA 4IW0A 3AEDB 1MHXA 5L83A 1FXIA 1SSNA 1V9JA 1DGJA 3TUOA 1WY8A 5EE1A 2MJ3A 3DDCB 3AE9B 1R7SA 3PLUA 4YTNB 2WXPA 4KGTA 1V5OA 2CJOA 1VRAB 3A9JB 5BMIA 3B08A 3ZDTA 3AMZA 2LUEA 1EO6A 1MPEA 2WDTB 3A9JA 1WZ0A 1XEEA 2GLSA 3P1MA 2ON8A 2K6DB 4I6LB 4KVGB 3L0WB 1S1QB 4KV2A
chains in the Genus database with same CATH topology
1E6EB 1PDXA 4O1NA 1RM6C 1HQRD 1PGBA 2QMTA 2Z8LA 1P7FA 1EWCA 2VZKD 3BVZA 4ITKA 2L1AA 3N9YC 4HKZE 3SFEB 2CJNA 3ABVB 1NEKB 1F0ZA 1JWMD 1BMLC 1L6VA 3P42A 2W54A 2I2YA 3H8HA 4N59A 2PIAA 2B76B 4RGNA 2JU6X 1ROEA 3HRDD 4XWTA 1F2RI 5FKAC 1FNUA 1JW9D 5AUIA 3EGRA 1IGDA 3U52E 2WXMA 4MH8A 1SXTA 5BYSA 1FM0D 2GB1A 3AN1A 1HZ5A 2FE8A 4UDUC 4YT0B 5GXGB 1NYRA 1WRIA 1ZP0B 1ESFA 2WU2B 3IT4B 1TY0A 4AS1A 5I4DA 1QOAA 4A6QA 1RFKA 1WGKA 1E10A 2N9LA 3MJ5A 4YTMB 4XDCA 2WDVB 1VR9A 4ZHPA 4JWUC 2BS4B 1XCQL 1V8CA 1PGXA 4JWSC 3TEZA 1DOYA 1YMHE 1FMAD 1I4GA 2X38A 1MHHE 1QOFA 2XN9C 3BVGA 4KGSA 3RPFC 3EA6A 3MFGA 4B0MA 3I9V1 2M19A 3URYA 1L4ZB 3TEXA 3U4EG 1C4PA 3L4PA 1XXGA 2WXOA 3U7ZA 3AE1B 5FK9C 2RMMA 1F2RC 1L0YB 3NS1A 2K5PA 4YSXB 3T3OA 3IT6B 2KWDA 2LMCA 3AB5A 2WXKA 1JWSD 1PUTA 2QJLA 2WS3B 4RGTA 3E9SA 2N0SB 4HRSA 1D6EC 3P4SB 4C56C 2DYMA 5AUKA 1IBXA 3KWVA 4TSSA 3V3XA 1FO4A 2SEBD 5G5GA 1K51A 5BMGA 1YN3A 1YJJA 1QT9A 4N6EB 1IGCA 1HEZE 1KLGD 2V3PA 2G1EA 2LEKA 4REZA 2FBWB 1T3QA 1QLBB 5BMHA 2BB5A 4WURA 1F77A 1N5XA 2JWUA 2PMVA 1SE4A 1E0ZA 4ARIA 1STEA 3E56A 2OHFA 1SF0A 1N61A 2MEKA 3ZQ4A 5C3JB 4TQ1A 1Y56A 3EUB2 1GPXA 1YNTE 1JMLA 2HTME 1WYGA 1EU3A 2QEJC 3CWIA 1ZXHA 1FNVA 1TKYA 3R8BA 3W9CB 3U2SC 4ZYSA 3AECB 4CQNA 1L5PA 1N60A 1FEHA 1TY2A 2PVGC 3TEYA 2J52A 4MT5A 4B0EA 1WSPA 2IGDA 4HROA 1MI0A 1T6BX 3Q69A 2CU3A 1VZ6A 3BK2A 5D3DA 5MPOA 1NI3A 1KH0A 5D3IB 1M4VA 2WXJA 3CIRB 3VRBB 2BTEA 1J7BA 4RF1A 1ZUD2 1HXYD 1N5WA 2N9KA 2R61A 4HEA1 1QKZA 3HVDA 2BS3B 2PW9A 2LJIA 1ZXIA 4A8XC 5H8YE 5HG2A 2JYEA 1CZPA 2VZKB 2KMMA 1TJEA 1UWMA 5D7GA 3AEFB 1ENFA 1ACCA 1L6UA 1PGAA 2V4IB 3B2GA 3T3NA 2WXLA 1JWBD 1K53A 2WXQA 3AEGB 3R2TA 1WXQA 4Q2JA 3PZ7A 3KLSX 2L32A 3V05A 2JQRB 2PVOD 3IAM1 1C79A 4MACA 1I4XA 1C4CA 2KDMA 2IGGA 4M0WA 3PZ8A 1V1OA 2FUG1 1JWAD 4WWMA 1I4HA 1OQRA 2WXGA 2M56B 2LUMA 1VJKA 4OZAA 2JXTA 4A9AA 2IDYA 4EE2A 2K3UA 4A90A 4ZHOA 1TS2A 3AE4B 2WNMA 2WXHA 1YQ4B 3AH7A 4YSZB 2JZPA 3MC0B 3LXFA 1AW7A 1UNSA 2E6XA 1C78A 2AQ2B 3GS2A 4KKIA 5JXVA 4YXDB 1SE3A 2AX5A 1HZ6A 4ZRQA 1FCLA 4YTPB 4HJGE 2INNE 4GDLB 1FFUA 4D2KA 1EM7A 1V1PA 4PT5A 2MH7A 4RNAA 2GI9A 3P4PB 4KGRA 4A55A 1FRRA 3IXSA 3NVZA 2OEDA 3FILB 3HUIA 3RFZB 4OZBA 3R2IA 1TS4A 1UGJA 2W82A 3ZYYX 3LB8C 4JE3B 2K9XA 1IUEA 3AE5B 3AEBB 4RH6A 4TQ0A 3Q8EA 2NMQA 3BYTB 4RCOA 3KQ4A 1C9FA 1TZOA 1L4DB 4ARCA 1NENB 5TSSA 1SEBD 4OZCA 4OHJA 2ICIA 3NVVA 3BWUD 3BYYB 2J53A 1NYQA 4YSYB 1JWUD 3DWGC 3C8YA 4L23A 1D4BA 1I4QA 2BB6A 2TSSA 1YQ3B 1JQ4A 2WXFA 2WDRB 1TKEA 1XCTL 1SJED 3B2FA 4TMAB 3ZJTA 4WAFA 2WP9B 3NVWA 2LGIA 5LNK1 3LYYA 1XO3A 2H89B 4DQOC 4NZLB 2INPE 4WH4A 1QILA 2WQYB 3MP9A 4H2AA 1ZDVA 4C7YA 1EU4A 1XF5L 1A70A 5E6JA 2I38A 3I57A 2RDGA 2ACZB 3TEWA 2LFIA 3AE6B 4KKJA 1VZ7A 2WDQB 3AE3B 4WQMA 1TS5A 2JYTA 4L1BA 1ZE3D 1ET9A 2BT6A 1JRPA 4C7ZA 2WXRA 1GB1A 2ZW1A 2W55A 2YEPF 5C2TB 4NJCA 3W5UB 2Q5WD 3B9JA 1N62A 2WU5B 1DOIA 1KRHA 2QILA 1FD6A 1GAQB 3VRAB 2XNAC 1VLBA 3NRZA 1SBBB 1OQQA 2HDEA 4R3DA 2DWQA 3Q8FA 4LTUA 1L0VB 2V3NA 4P16A 2Y5PA 1MVKA 2L52A 3BIID 4LK0M 3P4RB 1XLPA 4LLGM 4HKQA 1J7AA 3P4QB 1SB3C 1KF6B 2K0PA 4JX1C 5H92C 1PFDA 4US9A 1VDVA 4GDKB 1JALA 1CQVA 1E9MA 2KQ4X 3O13A 1N63A 1QOGA 4MM3B 4XDDA 3NZ3A 2EKIA 3GP7A 4RGMA 1YN4A 3P63A 1XLQA 2JSVX 1FNWA 1KFYB 3Q8CA 3VR8B 3J9CA 1I4PA 2KAJA 1JCKB 1DYQA 1FRDA 1NVID 2BW2A 2KN4A 2H88B 2Y3AA 4IOIE 5HHDG 5FR3A 2KACA 2ZW0A 1DOXA 3AEAB 3SEBA 1C76A 2BBCA 3BK1A 2YEPB 4RF0A 2AQ1B 2RPVA 2MJEA 2W3SA 1IBXB 3Q8BA 5HFYA 3IAS1 3TSSA 3AM9A 1CK1A 1RYJA 1SJHD 2QSDA 2PTLA 3ZJVA 2LHDA 1FFVA 1ZOYB 1UUPA 1AYFA 2PLPA 2W3RA 2IJ0A 3AE8B 4KX6B 4FXCA 1GB4A 5EE3A 2V0GA 1FIQA 2WXIA 3AV8A 1QF6A 1K50A 2WLBA 1SIJA 3ZJUA 3W2DA 4XE0A 2J4XA 1KLUD 2GRIA 3Q8AA 1T5XD 1FCCC 1D5XC 2DBYA 2DYOA 3MHZA 4N58A 1D5MC 3SR6A 2AQ3B 3GB1A 2G9HD 2NTSA 4US8A 2Y5CA 4XWWA 1YN5A 1GOZA 4JPSA 4RFBA 4P6VF 4DXFA 1JROA 1AWDA 4L2YA 2DLBA 2M0AA 4ZRPA 3VR9B 1AN8A 1UWXA 1V97A 1TKGA 4YWGG 2QIEB 3SFDB 4IKGA 2K22A 2PKOA 4OW0A 2E3TA 2SAKA 1TS3A 3DWMA 4ZOHC 2J42A 1HA5A 2IPKD 3BVMA 2BYTA 3AE7B 5BYRA 1D5ZC 3FC4A 4OVZA 3HVZA 1J7CA 1C4AA 4NAWB 2N7JA 3WCQA 3FAHA 4J3OD 1PYWD 2NTTA 5BYQA 3ZGZA 1BXTA 3NVYA 3W1SA 4USAA 1WWTA 3VQIA 4C80A 3ETRA 1E7PB 2D5GA 2L83A 3KWLA 2LHEA 4DXGA 4AQ7A 1YJIA 3BZDB 3AEDB 4WIPA 1MHXA 4GLSC 1XLOA 1FXIA 1VZ8A 1B9RA 1SSNA 1DGJA 2MJDA 3TUOA 2RDHA 2JX5A 1I7HA 1L0XB 1TYGB 1Q10A 1BUIC 3AE2B 1QQRA 1ZPSA 5EE1A 3UI3A 5G5HA 1XLNA 2WXNA 2MJ3A 1KTKA 5HI1A 1RWSA 3AE9B 1FXAA 1EWYC 5EE9A 1R7SA 3AEEB 1ET6A 1C77A 4YTNB 1K52A 1B1ZA 1OFFA 2WXPA 1LO5D 3OWEB 4KGTA 2IGHA 2CJOA 1VRAB 4RGOS 2EELA 1I4RA 3PO0A 5BMIA 1P7EA 1QOBA 3AMZA 1MPEA 2ONQA 4IDIA 1XEEA 1V1PB 5T8IA 1SE2A 3W5VB 3P1MA 2BS2B 5EE0A 2ON8A 3NUHB 4NAMA 1ZDXA 3FILA 1CJEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1E6E B;  5EE3 A;  1PDX A;  1NYQ A;  1FIQ A;  1RM6 C;  3AV8 A;  3CWI A;  4YSY B;  1QF6 A;  2WLB A;  1TKY A;  1SIJ A;  4ITK A;  3W9C B;  3AEC B;  3DWG C;  3SFE B;  2CJN A;  1L5P A;  1N60 A;  1NEK B;  3ABV B;  1F0Z A;  1L6V A;  2DBY A;  2PVG C;  3SR6 A;  1YQ3 B;  4N58 A;  2W54 A;  1JQ4 A;  4N59 A;  2PIA A;  4HRO A;  4US8 A;  2WDR B;  1TKE A;  2B76 B;  2Y5C A;  3B2F A;  1ROE A;  3HRD D;  2CU3 A;  2WP9 B;  3NVW A;  5MPO A;  1NI3 A;  1XO3 A;  2H89 B;  4P6V F;  1JRO A;  1AWD A;  1JW9 D;  3CIR B;  5AUI A;  3VRB B;  2WQY B;  1J7B A;  3VR9 B;  4C7Y A;  1FM0 D;  1ZUD 2;  1A70 A;  1V97 A;  1TKG A;  1N5W A;  2ACZ B;  2QIE B;  3AN1 A;  3SFD B;  2K22 A;  2PKO A;  3AE6 B;  4YT0 B;  2E3T A;  1NYR A;  2BS3 B;  5GXG B;  2WDQ B;  1WRI A;  1ZP0 B;  1ZXI A;  2WU2 B;  3AE3 B;  3DWM A;  4WQM A;  5H8Y E;  4ZOH C;  1CZP A;  1QOA A;  2KMM A;  1TJE A;  1UWM A;  3AE7 B;  3AEF B;  1RFK A;  1WGK A;  1JRP A;  2BT6 A;  4C7Z A;  1L6U A;  3B2G A;  4YTM B;  1E10 A;  2WDV B;  3FC4 A;  4ZHP A;  2W55 A;  1JWB D;  3HVZ A;  1J7C A;  2BS4 B;  4JWU C;  3AEG B;  5C2T B;  1V8C A;  3WCQ A;  4JWS C;  3W5U B;  1WXQ A;  2Q5W D;  3B9J A;  1N62 A;  2WU5 B;  1DOI A;  3FAH A;  1KRH A;  2JQR B;  1DOY A;  1FMA D;  1QOF A;  1GAQ B;  2PVO D;  3NVY A;  3VRA B;  4USA A;  1WWT A;  3RPF C;  1VLB A;  4C80 A;  3ETR A;  1E7P B;  3NRZ A;  1OQQ A;  2DWQ A;  2L83 A;  1JWA D;  3KWL A;  1L0V B;  4LTU A;  4WWM A;  1OQR A;  1YJI A;  2L52 A;  2M19 A;  2M56 B;  3AED B;  3BII D;  3P4R B;  1VJK A;  1XLP A;  1J7A A;  1XLO A;  3P4Q B;  1FXI A;  4A9A A;  1SB3 C;  3L4P A;  1B9R A;  3AE1 B;  1KF6 B;  4ZHO A;  4JX1 C;  1DGJ A;  5H92 C;  1PFD A;  2MJD A;  2JX5 A;  1I7H A;  3AE4 B;  4US9 A;  3NS1 A;  3AH7 A;  1TYG B;  1YQ4 B;  1VDV A;  2K5P A;  4YSZ B;  4YSX B;  1JAL A;  3LXF A;  3AB5 A;  3NVV A;  3AE2 B;  1E9M A;  4YXD B;  5EE1 A;  1N63 A;  1QOG A;  5G5H A;  2AX5 A;  1PUT A;  1XLN A;  2QJL A;  2MJ3 A;  2EKI A;  2WS3 B;  3P63 A;  2N0S B;  4YTP B;  1XLQ A;  3VR8 B;  1KFY B;  4HRS A;  1RWS A;  3AE9 B;  1FXA A;  1EWY C;  5EE9 A;  1R7S A;  3AEE B;  3P4S B;  2KAJ A;  1FFU A;  1OFF A;  4YTN B;  5AUK A;  2MH7 A;  1FRD A;  1NVI D;  3P4P B;  2H88 B;  2CJO A;  1FO4 A;  1FRR A;  1DOX A;  3NVZ A;  5G5G A;  3AEA B;  3HUI A;  1YJJ A;  1QT9 A;  4N6E B;  2G1E A;  2LEK A;  3PO0 A;  1QOB A;  3AMZ A;  2FBW B;  1T3Q A;  1QLB B;  4IDI A;  3ZYY X;  3LB8 C;  1N5X A;  2K9X A;  1IUE A;  3AE5 B;  3AEB B;  2MJE A;  1E0Z A;  2W3S A;  3W5V B;  3P1M A;  2BS2 B;  5EE0 A;  2OHF A;  3AM9 A;  1SF0 A;  1N61 A;  1NEN B;  1RYJ A;  5C3J B;  1FFV A;  1ZOY B;  2W3R A;  1AYF A;  3AE8 B;  3EUB 2;  4KX6 B;  1GPX A;  2HTM E;  4FXC A;  1CJE A;  1WYG A; 
#chains in the Genus database with same CATH topology
 1E6E B;  1PDX A;  1RM6 C;  1P7F A;  1F9J A;  4ITK A;  2L1A A;  4HCN B;  3KUD B;  1L6V A;  4N59 A;  4IWO A;  4RGN A;  1UH6 A;  3HRD D;  3DBH I;  1F2R I;  5FKA C;  1WGH A;  3X23 A;  2JPH A;  3OAW A;  4MH8 A;  2CKH B;  1FM0 D;  1TTN A;  3EFC A;  3AN1 A;  1HZ5 A;  2FE8 A;  4UDU C;  5GXG B;  1SGH A;  1WRI A;  2N9E B;  3IT4 B;  3V62 A;  5JH5 C;  4URK A;  4XDC A;  4ZHP A;  2RR9 A;  2BS4 B;  3UF8 A;  5DPW A;  2BYE A;  1V8C A;  4JWS C;  3IHP C;  2HTH A;  2X38 A;  3BVG A;  1F1H A;  2XN9 C;  3WAN A;  3MFG A;  1E90 A;  1SE9 A;  4B0M A;  3I9V 1;  3Q2A C;  1L4Z B;  3SDL C;  2WXO A;  2IND C;  3AE1 B;  5FK9 C;  4W9L A;  1F2R C;  3ZVV A;  2K5P A;  3T3O A;  3AB5 A;  3KUC B;  5L95 C;  2QJL A;  3E9S A;  2K8H A;  3ZRC A;  4M00 A;  3P4S B;  3PRE A;  1IBX A;  2MQJ A;  2KX0 A;  3U7D A;  2VRR B;  4TSS A;  3V3X A;  1R4M I;  4B9K A;  1QT9 A;  2C7H A;  1HEZ E;  2LEK A;  1QLB B;  3PS6 A;  4PYZ A;  1J0G A;  1GC7 A;  4KZ0 A;  2KD0 A;  1GPX A;  1WYG A;  2D3G A;  2QEJ C;  1WH3 A;  2ZCB A;  4HCP B;  2KNB A;  3TEY A;  2J52 A;  4PYU A;  4HRO A;  2REX A;  2D3A A;  1NBF C;  4IM2 A;  4BFR A;  1VZ6 A;  4ZRJ A;  5MPO A;  1KH0 A;  2J7Q B;  5D3I B;  3CIR B;  3VRB B;  1WXA A;  2DAJ A;  1J7B A;  3NJT A;  3UIO B;  1HXY D;  1PQS A;  4HEA 1;  1QKZ A;  2BS3 B;  2V3S A;  2PW9 A;  1WGY A;  1WZ3 A;  4KDI C;  2KWU B;  3DHG C;  2KMM A;  3AEF B;  4MGI E;  4GMV A;  3AEG B;  4HPL B;  1WXQ A;  3PZ7 A;  2C9W B;  3RNC C;  4C4V A;  2JQR B;  3NG0 A;  3EHV A;  2KDM A;  2IGG A;  2C7N B;  1JWA D;  2KDB A;  1OQR A;  3VUX A;  2WX1 A;  2K3U A;  1TS2 A;  3AE4 B;  2JZP A;  3U8Z A;  2E6X A;  4KKI A;  4IWP A;  1EF1 A;  2QHO A;  1YOV B;  4YTP B;  3L10 B;  2L05 A;  4PS8 A;  5E6N A;  2NBW B;  4HK2 A;  1WM2 A;  2MH7 A;  4KGR A;  2KHW B;  3ZTD A;  3NVZ A;  4GXB A;  2OED A;  3HUI A;  4RMA A;  5C1Z A;  3R2I A;  1UGJ A;  3DBL B;  3RCZ A;  3DQV A;  4N9F 4;  4LNN A;  3WAL A;  4RH6 A;  3AEB B;  4TQ0 A;  2KFJ A;  1C9F A;  1TZO A;  1L4D B;  1NEN B;  5TSS A;  3DCG A;  1C3T A;  4AOF A;  1WGD A;  4NY0 A;  2ICI A;  2FCS A;  2J53 A;  2D11 A;  4YSY B;  1YIW A;  1JWU D;  1YX6 B;  1WI0 A;  3X0W A;  1NDD A;  3DVG Y;  3C8Y A;  1D4B A;  1WGG A;  1I4Q A;  2BB6 A;  2G3Q B;  3RUI B;  4AJW A;  1BT0 A;  1JQ4 A;  1TKE A;  4C00 A;  1XCT L;  1SJE D;  3B2F A;  4TMA B;  3ZJT A;  3AXC A;  4HLE A;  4WH4 A;  1QIL A;  4H2A A;  5E6J A;  5G55 A;  2RDG A;  2ACZ B;  3VAW A;  2IY1 B;  4LJP B;  3AE3 B;  2JYT A;  4L1B A;  2M0X A;  2CR5 A;  2BT6 A;  2WXR A;  2JZZ A;  2HJ1 A;  4ANW A;  3APD A;  3QX1 A;  3PV1 A;  3B9J A;  1DOI A;  4FHK A;  2MRP A;  3Q3N C;  1KOT A;  1FD6 A;  3NRZ A;  1OQQ A;  2HDE A;  3C19 A;  3APC A;  2C7M B;  1MVK A;  4LK0 M;  4BBN F;  4NPN A;  1SB3 C;  2MLB A;  3OLM D;  1E8Y A;  3DVN V;  2PJH A;  1TBE A;  5IKC M;  3RZW C;  1E9M A;  2MCN B;  2G4S A;  4XDD A;  2M1M A;  4RGM A;  3MC8 A;  3VR8 B;  1I4P A;  1Q1O A;  3K9O B;  4BZA A;  4J6I A;  2H88 B;  5HHD G;  2ZW0 A;  4FHJ A;  2BBC A;  5DPR A;  4XC2 A;  2N1W A;  5IOI A;  2LGD A;  4K1R B;  2GMI C;  1KM7 A;  5D94 A;  1QZE A;  1HTQ A;  2QSD A;  2HJ8 A;  3RNE C;  3NY5 A;  2LHD A;  3PRM B;  1ZOY B;  3R7Q A;  2W3R A;  2IJ0 A;  2KXJ A;  4KX6 B;  1GB4 A;  4NQL B;  2V0G A;  3AV8 A;  1QF6 A;  2WLB A;  3W2D A;  4IWQ A;  4XE0 A;  2J4X A;  1WFY A;  4WWN A;  5DPT A;  1U4A A;  3Q8A A;  2DYO A;  4N58 A;  3GB1 A;  4US8 A;  2MHJ A;  2Y5C A;  4IM0 A;  1YN5 A;  1GOZ A;  5BO4 B;  1AWD A;  3L17 A;  3TJP A;  3VR9 B;  1ZKH A;  4YWG G;  4ICU A;  2EMT A;  5AEK B;  4IKG A;  2MA9 B;  2KX3 A;  3A4R A;  1EUV B;  2GBK A;  1M94 A;  4NJ7 A;  2J42 A;  2IPK D;  3BVM A;  3TCA A;  1D5Z C;  2PPH A;  3FC4 A;  2N7J A;  3N32 A;  3NHE B;  5E6O A;  4ZYN A;  3FAH A;  3W1Y A;  5BYQ A;  3ZGZ A;  4USA A;  3VQI A;  5IA7 A;  2LHE A;  4AQ7 A;  3AI5 A;  4WIP A;  4B6W A;  5IP4 D;  1VZ8 A;  5DCN A;  3KUZ A;  1T0Q C;  2RDH A;  1TYG B;  3ML8 A;  1BUI C;  4DHZ E;  3Q14 C;  3Q3F A;  2VH2 A;  3AE2 B;  1ZPS A;  2KTR B;  4WWO A;  3UI3 A;  1XLN A;  2CU1 A;  3PLV A;  2KTR A;  3GZN B;  1RWS A;  5EE9 A;  3QCA A;  3AEE B;  2BQQ A;  4KSK C;  1C77 A;  4S0R A;  1OFF A;  4JQW C;  3ZXR A;  2IGH A;  2XEW A;  4FA6 A;  3H6N A;  1OEY A;  4LCD E;  1IPG A;  1QOB A;  2M4N A;  1A5R A;  4IDI A;  3Q6B A;  2L0F A;  2XK5 B;  5IAA C;  5T8I A;  3W5V B;  2BS2 B;  4W9J A;  3ZNG C;  2JRH A;  4AWJ A;  1ZGU B;  1EWC A;  2O2V B;  4PS7 A;  2AEH A;  4HJK A;  3N9Y C;  2IO3 B;  2CJN A;  3OG5 A;  2KO3 A;  3P42 A;  2NBU A;  2MX2 A;  2W54 A;  4ZRK A;  2I2Y A;  2B76 B;  2L0T A;  4M02 A;  1D3Z A;  1ROE A;  5KHO A;  2N7E A;  5LLI A;  2LAS A;  1WJU A;  1IGD A;  3U52 E;  3TIX A;  3H9D A;  4YT0 B;  1NYR A;  2WU2 B;  2DNF A;  1TY0 A;  2R2O A;  4A6Q A;  3VH4 B;  2Z0E B;  4YTM B;  2DZJ A;  1VR9 A;  2KMC A;  4JWU C;  1R4N B;  1UF0 A;  2RD0 A;  1WXM A;  1AAR A;  1MHH E;  2KYW A;  4WJN A;  1OGW A;  2C60 A;  2V9H A;  4HVB A;  4PK1 A;  3R7R A;  1XXG A;  1F52 A;  1VD2 A;  4MGZ E;  3HM3 A;  4YSX B;  3IT6 B;  2LMC A;  3JSV A;  2UU7 A;  2KOX A;  2KLC A;  1P98 A;  1PUT A;  3M62 B;  2LJ5 A;  5CX3 A;  3VH3 B;  3PPA A;  3ZKJ C;  4C56 C;  1WYW B;  4MSQ B;  5J18 A;  2SEB D;  1YJJ A;  2NPT A;  1IGC A;  2KVZ A;  2D3C A;  2CHZ A;  3PT2 B;  4REZ A;  2NPT B;  1UZX B;  5BMH A;  4P7I A;  4WUR A;  1N5X A;  2Z0D B;  2JZ3 B;  5CHW A;  2KFK A;  1SF0 A;  5HKH A;  1N61 A;  4HPP A;  5C3J B;  1Y56 A;  1JML A;  4GN1 A;  2NCN A;  2MW5 A;  1FNV A;  3W9C B;  4ZYS A;  3AEC B;  2KJ6 A;  1N60 A;  4TKN A;  2IGD A;  2N4F A;  1T6B X;  3HHM A;  4TUU A;  4GOC A;  3BK2 A;  1NI3 A;  3KH0 A;  4IG7 B;  3RD2 A;  1E8W A;  2AL3 A;  1N5W A;  4G0N B;  2N9K A;  4RM8 A;  4HPM B;  4W9I A;  1ZW7 A;  5H8Y E;  2VZK B;  4CO7 A;  1ENF A;  3B2G A;  3T3N A;  1JWB D;  2V4L A;  1WR6 E;  4M0W B;  2XK5 A;  2PVO D;  3IAM 1;  2IO1 B;  2BF8 B;  2KJH B;  4M0W A;  2RPQ A;  4WWM A;  3K9P B;  4OZA A;  4A9A A;  4EE2 A;  4A90 A;  4II2 B;  2WNM A;  4M01 A;  4RM9 A;  3I3T B;  3LXF A;  4MDK E;  2AQ2 B;  3GS2 A;  2AX5 A;  2WX0 A;  4ZRQ A;  1YD8 U;  3VVW B;  3KVF B;  5LXH A;  4HJG E;  2FUH B;  4I6P A;  3JYU A;  2DHZ A;  2B3A A;  1V1P A;  4PT5 A;  1WMH A;  1XQQ A;  3M3J A;  3S2A A;  4A55 A;  2LGY A;  3QAQ A;  3ZTC A;  2FNJ B;  1FRR A;  1TIF A;  1WMH B;  3U30 A;  3FIL B;  4ASW C;  1TS4 A;  3PHW B;  2W82 A;  3PRP B;  2Z59 B;  3PVL A;  3AE5 B;  4RCO A;  3N3K B;  2K25 A;  1Q0W B;  1WGR A;  3NVV A;  4FAD A;  3DWG C;  2KWV B;  2TSS A;  1WJN A;  2LVP A;  3CSF A;  2KKC A;  3PSE B;  3H7P A;  2WWZ A;  4AUQ C;  2BYV E;  2JXX A;  3EEC A;  3VHT C;  5LXI B;  1WX7 A;  1XF5 L;  2D3B A;  2HD5 B;  2KN5 A;  2I1J A;  3TEW A;  1MG4 A;  4WJO A;  2D2Q A;  2WDQ B;  4IM3 A;  1TS5 A;  4PS3 A;  1ET9 A;  3UQB A;  1JRP A;  3RUL A;  1HTO A;  5C2T B;  3ZNH B;  2Q5W D;  2WU5 B;  4FLH A;  4JIO U;  2I1K A;  1N6Z A;  1UBQ A;  2QIL A;  1VLB A;  2N7D A;  4R3D A;  3QIJ A;  2Y5P A;  2FIF A;  1E7U A;  4LLG M;  4HKQ A;  1J7A A;  3P4Q B;  3N20 C;  1J19 A;  5IO9 A;  4GDK A;  2FCQ A;  4GDK B;  4AP4 C;  2NR2 A;  1QOG A;  2YLM A;  2EKI A;  4DHJ D;  3Q8C A;  3IFW B;  1E5W A;  4GB9 A;  1R4M B;  1JCK B;  1FRD A;  2BW2 A;  3HIZ A;  3RNF C;  5FR3 A;  1C76 A;  3ZRF A;  3BK1 A;  5JZE B;  1LM8 B;  3JW0 X;  2RPV A;  3ZNZ B;  1UGM A;  4FJY A;  1IBX B;  3IAS 1;  3RN9 C;  1SJH D;  2PTL A;  3AE8 B;  1UUP A;  1LQB A;  5EE3 A;  1FIQ A;  2WXI A;  3FKY A;  3QHT A;  3WAM A;  1SIJ A;  4HWI B;  2UYZ B;  2OJW A;  1KLU D;  2DBY A;  1D5X C;  3MHZ A;  3AU5 A;  2J0J A;  1MJD A;  3M63 B;  3DVG X;  3MHS D;  4GU2 A;  1G6J A;  2EMS A;  2DLB A;  4EEW A;  1UWX A;  1V97 A;  1TKG A;  2K22 A;  2PKO A;  2SAK A;  4EZL A;  2BYT A;  5BYR A;  4YL8 A;  4DWF A;  3DVN U;  2NS5 A;  3DBR I;  2MP2 A;  1PYW D;  4DHJ B;  2LVO A;  4XX5 A;  3NVY A;  3OJ4 B;  2RGF A;  3VTU A;  1WWT A;  1E7P B;  1V5T A;  2IO2 B;  4DXG A;  3BZD B;  2ZCC A;  1XLO A;  5E6P A;  1B9R A;  4BBN C;  2MJD A;  2JX5 A;  1L0X B;  2LXA A;  5G5H A;  1OTR B;  2WXN A;  5HI1 A;  3H7P B;  2JUO A;  1FXA A;  1K52 A;  5FR6 A;  4MH0 E;  3L16 A;  4DXA B;  4RGO S;  4MGY E;  5G2N A;  1WX9 A;  3IBE A;  3PO0 A;  4NJ6 A;  1P7E A;  2LI5 A;  4QAY A;  2ONQ A;  4HDQ A;  3PTF C;  3LDZ E;  2PEA A;  3NUH B;  3QWZ B;  4NAM A;  1ZDX A;  1H4R A;  4EKU A;  4LDT D;  1TGZ B;  1CJE A;  2Z8L A;  1PGB A;  2QMT A;  4W9K A;  3V6E B;  2VZK D;  3WAP A;  4HKZ E;  3ABV B;  1NEK B;  1JWM D;  1BML C;  2L3Z A;  2MSE D;  5KHQ A;  2PIA A;  3ZUN A;  1T0R C;  2JU6 X;  4W9G A;  3OJ3 A;  1Z2M A;  4XWT A;  1YQB A;  1L2N A;  1IYF A;  1FNU A;  1V80 A;  5AUI A;  3RZF A;  2KQ7 A;  1WX8 A;  2C5L C;  2WXM A;  1GG3 A;  2BWE S;  1CMX B;  1FPY A;  3BIN A;  3NZU A;  4LNO A;  1ZP0 B;  4AS1 A;  5I4D A;  3MJW A;  1QOA A;  4G3X B;  3VUY A;  1RFK A;  3M95 A;  3WAO A;  1PGX A;  3VXW A;  4K7W A;  1P1A A;  4MSM B;  1FMA D;  1ISN A;  3RPF C;  3EA6 A;  3CST A;  2R2Q A;  3EC8 A;  3VDZ A;  4X57 B;  4TV3 A;  2M19 A;  3URY A;  4K7S A;  2A4Z A;  2QCZ A;  2N9X A;  3U4E G;  3L4P A;  3U7Z A;  3H7S A;  1LFD A;  3NS1 A;  4XGA B;  4MEM A;  3TMP B;  4LNK A;  1D6E C;  3A9K B;  2DYM A;  2MBQ A;  3KWV A;  4GGQ A;  1T0S C;  3A9K A;  1WF9 A;  1YN3 A;  3I63 C;  4N6E B;  1KLG D;  4CHK A;  2FBW B;  1T3Q A;  2BB5 A;  2JWU A;  4ICV A;  2IYD B;  3E56 A;  2MEK A;  3ZQ4 A;  2MP2 B;  2N9P C;  4TQ1 A;  3EUB 2;  5TR5 A;  2HTM E;  3KYC D;  3CWI A;  1ZXH A;  3R8B A;  2V1Y A;  3QAR A;  3U2S C;  2JY6 A;  2KZR A;  4CQN A;  3DBS A;  3RI7 C;  1TY2 A;  3D32 A;  3DOW A;  4ZDV A;  4MT5 A;  4B0E A;  2L8J A;  1MI0 A;  3QA8 A;  4XYC A;  3GE8 C;  2JT4 B;  1WM3 A;  2BTE A;  2LRW A;  1RLF A;  1ZUD 2;  1XT9 B;  3HVD A;  3UGB B;  4MGK E;  4A8X C;  4IUM B;  5HG2 A;  2JYE A;  1CZP A;  1TJE A;  5D7G A;  3V60 A;  1ACC A;  1L6U A;  1PGA A;  2JWZ A;  2V4I B;  5AZG A;  4FBJ B;  3GOE A;  2W9N A;  4Q2J A;  4WAA A;  4ACF A;  3KLS X;  2ZZP B;  2LVQ A;  3V05 A;  2LWP A;  2D10 A;  4MAC A;  1C4C A;  1I4X A;  3WA0 A;  2HE7 A;  3PZ8 A;  1V1O A;  2FUG 1;  1GJZ A;  2BWF A;  4GIV A;  2WXG A;  2QDF A;  3KYD D;  2ZPN A;  2JXT A;  2IDY A;  3AH7 A;  1YQ4 B;  2FCN A;  2G4D B;  4YSZ B;  1AW7 A;  1UNS A;  3N1Y C;  2NBV B;  1SE3 A;  4BKT A;  1HZ6 A;  1FFU A;  4D2K A;  1P0R A;  4RNA A;  3H1U A;  4LNF A;  3MC9 A;  2KDE B;  3P4P B;  3DBL I;  1WXS A;  3IXS A;  4EZK A;  4OZB A;  3Q3J A;  2O6V A;  4OVV A;  4A3O A;  3LB8 C;  3WIM A;  4JE3 B;  2J0M A;  2K9X A;  3Q8E A;  5D6J B;  1X1M A;  4KSL C;  4ARC A;  4OZC A;  4OHJ A;  3BWU D;  4K3C A;  2L76 A;  1NYQ A;  2WYQ A;  3EFU A;  4I6N B;  2KJR A;  3L54 A;  4L23 A;  3HK0 A;  3IG3 A;  3T8M A;  3TL5 A;  1I42 A;  2WDR B;  2ZEQ A;  4OVU A;  1KJT A;  2OJR A;  1UBI A;  2INP E;  2WQY B;  3MP9 A;  1ZDV A;  4C7Y A;  1EU4 A;  3ZNI D;  1A70 A;  2DEN B;  2I38 A;  2ZNV C;  3AE6 B;  4KKJ A;  1VZ7 A;  3SHQ A;  5JHB A;  3N1X C;  4E71 A;  2ZW1 A;  2MWS B;  2LD9 A;  2YEP F;  4NJC A;  1E7V A;  3A33 B;  4KIK B;  1GAQ B;  4F7Z A;  2K8C A;  2XNA C;  2M8S A;  1V2Y A;  3Q8F A;  4LTU A;  2KC1 A;  2V3N A;  2L52 A;  3BII D;  1KF6 B;  2K0P A;  4JX1 C;  3ZDM C;  1OQY A;  1C1Y B;  3RNB C;  1JAL A;  4G11 A;  2DYB A;  3O13 A;  3RNG C;  1N63 A;  4HDO A;  1FXT B;  3P63 A;  1FNW A;  1TZ1 A;  1YJ1 A;  2KAJ A;  3I5J C;  2O6V D;  1DYQ A;  1NVI D;  3APF A;  2Y3A A;  2KAC A;  3NS8 A;  3SD5 A;  3SEB A;  2UWQ A;  4RF0 A;  1IP9 A;  2AQ1 B;  5EDS A;  4FJV B;  2MJE A;  2W3S A;  2D07 B;  3Q8B A;  3TSS A;  4E3C A;  4MEL A;  5D2M B;  3AM9 A;  1CK1 A;  2KC2 A;  1RYJ A;  1Y8R C;  4HXD A;  2G45 B;  3DHH C;  1FFV A;  1AYF A;  3CF6 E;  4WJP A;  3RYT A;  2MBO A;  3ZJU A;  4LJO B;  2GRI A;  2KFK B;  3SR6 A;  1D5M C;  2AQ3 B;  2K39 A;  2G9H D;  2NTS A;  4BOS C;  4XWW A;  3R3M A;  4JPS A;  4W9E A;  3KW5 B;  4DXF A;  1JRO A;  2M0A A;  4ZRP A;  1AN8 A;  3SFD B;  2QIE B;  4B95 A;  4OW0 A;  1RFA A;  2E3T A;  4M8M A;  1UD7 A;  5C23 A;  4W9C A;  4ZOH C;  1V6E A;  4OVZ A;  4W9D A;  3HVZ A;  4LDT B;  1J7C A;  1Q5W B;  4J3O D;  4A20 A;  1WE6 A;  1BXT A;  3W1S A;  4C80 A;  1VCB A;  2L83 A;  2L00 B;  1WIA A;  1UEL A;  1MG8 A;  2KDI A;  2KTF A;  4GLS C;  4IC7 B;  2GBJ A;  4W9F A;  1I7H A;  2DZK A;  2Y5B B;  1Q10 A;  4EOY A;  3UIN B;  2J0K A;  3UQA A;  1RRB A;  1QQR A;  3RNA C;  2FCM A;  2BGF A;  1KTK A;  1V81 A;  1EWY C;  1ET6 A;  2BVC A;  3V61 A;  1B1Z A;  3DBH B;  1LO5 D;  1T0Y A;  2KAN A;  3OWE B;  2N1V A;  3PRZ A;  2RSU A;  1WR1 A;  2EEL A;  1I4R A;  2IY0 B;  4S17 A;  3T9L A;  3Q3O C;  4DDG D;  1V1P B;  5J17 A;  1K8R B;  1SE2 A;  1TT5 B;  5EE0 A;  2INC C;  2JRI B;  3FIL A;  3VTW A;  4KIK A;  1XD3 B;  2ZPY A;  4O1N A;  1HQR D;  3RMK C;  2IBI B;  2KVR A;  3BVZ A;  4ZRI A;  3SFE B;  3HM6 X;  4K81 A;  1F0Z A;  3N30 A;  2BPS A;  2LRU A;  3H8H A;  3A1Q A;  2KK8 A;  3IVF A;  3JVZ X;  4AJY B;  3A1Q B;  2AL6 A;  2DAF A;  1JW9 D;  3EGR A;  2L7R A;  2GBR A;  1SXT A;  5BYS A;  2GB1 A;  2MBH A;  1LGR A;  4JLC A;  4A3P A;  3TBL D;  4K7U A;  4ANV A;  1ESF A;  1R4N I;  2PE6 B;  2KWC A;  1E10 A;  1WGK A;  4MJS B;  2N9L A;  3MJ5 A;  2WDV B;  2CHW A;  1XCQ L;  4MJS A;  3TEZ A;  4ANX A;  1DOY A;  1YMH E;  1I4G A;  1QOF A;  4KGS A;  2LXC A;  3TEX A;  4BKS D;  4EUT A;  1C4P A;  4JL9 A;  2RMM A;  1L0Y B;  3ZW3 A;  3ECI A;  2GOW A;  1NI2 A;  1SIF A;  4WQO B;  4XZ4 A;  2KWD A;  1E8X A;  2WXK A;  1WRD B;  3W1S C;  1KLV A;  4II3 B;  1JWS D;  2GBM A;  1E8Z A;  2IO0 B;  2WS3 B;  4FJZ A;  4RGT A;  2N0S B;  4F1S A;  4HRS A;  2DZI A;  3VTV A;  1GUA B;  2LGX A;  3Q3M C;  2JF5 A;  5AUK A;  4C4V B;  3LJ3 A;  3UIP B;  3SU8 X;  1FO4 A;  5G5G A;  1K51 A;  2V3P A;  2G1E A;  1F77 A;  5CHV C;  2PMV A;  4F8C B;  1SE4 A;  4BKG A;  1E0Z A;  4ARI A;  4NNJ B;  1STE A;  2WHI A;  2OHF A;  2K1F A;  1GNU A;  1YNT E;  4P1C C;  2QC8 A;  1EU3 A;  1TKY A;  1OEY J;  2KMA A;  4DK5 A;  1L5P A;  1FEH A;  2PVG C;  1P9D U;  1WSP A;  4MM3 A;  1RAX A;  2YVC A;  2LZ6 A;  3Q69 A;  2CU3 A;  3PHX B;  5D3D A;  1M4V A;  2WXJ A;  3DPD A;  4RF1 A;  2MBE A;  2R61 A;  1WXV A;  2LJI A;  1ZXI A;  3ML9 A;  2IZV B;  1UWM A;  2WXL A;  1K53 A;  2AYO B;  2WXQ A;  3L08 A;  3R2T A;  2CHX A;  1P3Q U;  4BAX A;  2L32 A;  2BYF A;  1C79 A;  1V49 A;  2ZVN A;  3MTN B;  3QJZ A;  3C0R B;  1GC6 A;  4LNI A;  4EZJ A;  1I4H A;  3PZD A;  2M56 B;  2LUM A;  1VJK A;  2K8B A;  5J2R A;  4ZHO A;  2WXH A;  4FN2 A;  3O65 B;  4M8N A;  1J8C A;  3MC0 B;  1C78 A;  4DDI D;  5JXV A;  4WWP A;  2X8X X;  4YXD B;  2ZVO A;  4DBG A;  1FCL A;  3VFK A;  2INN E;  4GDL B;  1EM7 A;  2GI9 A;  2MBB B;  3NZS A;  3ZLZ A;  3RFZ B;  5GMV A;  4KZC A;  1WE7 A;  3ZYY X;  2JVC A;  1IUE A;  3QC8 B;  1WJ6 A;  2NMQ A;  3BYT B;  2VH1 A;  3KQ4 A;  4E74 A;  2PE9 A;  4BVU C;  2K6Q A;  4EFO A;  1SEB D;  3BYY B;  4JGH B;  3RT3 B;  4GSW A;  1Z5S B;  2RDB C;  4DHZ B;  2LGS A;  1YQ3 B;  3DHI C;  3ONS A;  3GE3 C;  3QK0 A;  2WXF A;  3GZN I;  4G50 A;  2ZJD A;  4WAF A;  2WP9 B;  4W9H A;  3NVW A;  2LGI A;  5LNK 1;  3A4S C;  3LYY A;  1XO3 A;  2H89 B;  4DQO C;  4NZL B;  3R66 C;  3I57 A;  2LFI A;  2ZNV B;  3ZXV A;  4WQM A;  3ALB A;  1H8C A;  1ZE3 D;  4C7Z A;  2EKE C;  1GB1 A;  2W55 A;  2A5U A;  3W5U B;  1N62 A;  3NOB A;  1KRH A;  5DPS A;  3VRA B;  3V6C B;  1SBB B;  2O6V B;  3B0A A;  2DWQ A;  3JSV B;  1L0V B;  4P16 A;  2FID A;  3P4R B;  1XLP A;  1V86 A;  2WGS A;  5IN7 A;  4WJQ A;  1JRU A;  2GBN A;  5H92 C;  1PFD A;  4CYE A;  1WJ4 A;  4US9 A;  1VDV A;  1S3S G;  2FAZ A;  1CQV A;  2BKF A;  2OOB B;  2KQ4 X;  4MM3 B;  3NZ3 A;  3GP7 A;  3ZO5 B;  1YN4 A;  1XLQ A;  2AWT A;  2JSV X;  1KFY B;  5AZF A;  1L7Y A;  3J9C A;  4ANU A;  2KN4 A;  4IOI E;  4K3B A;  1DOX A;  3AEA B;  1LXD A;  3ZIM A;  3BY4 B;  3L13 A;  2YEP B;  4P1B C;  2CS4 A;  2KDF B;  5HFY A;  3VUW A;  3PGE A;  3ENE A;  2KLG A;  3ZJV A;  5BMG A;  2PLP A;  2NVU I;  4FXC A;  5JHA A;  5CTR C;  1K50 A;  2KQS A;  4BOZ B;  1EF5 A;  1T5X D;  2BKR B;  3AU4 A;  3N1Z C;  1FCC C;  2DZM A;  5CHF A;  1I35 A;  1MFW A;  2XBB C;  4RFB A;  4NQK E;  4P6V F;  4L2Y A;  1YX5 B;  4KDL B;  4GDL A;  2ASQ A;  5AZH A;  4BKS A;  1TS3 A;  3DWM A;  3B1L X;  2DX5 B;  1HA5 A;  1HE8 A;  3AE7 B;  3P2B A;  3QQ8 B;  4NAW A;  4FUL A;  2KT7 A;  1C4A A;  2M17 A;  2O2V A;  4NAW B;  3WCQ A;  3CMM B;  2NTT A;  3DBR B;  3ETR A;  2D5G A;  3AUL A;  3KWL A;  1YJI A;  4IW0 A;  3AED B;  1MHX A;  5L83 A;  1FXI A;  1SSN A;  1V9J A;  1DGJ A;  3TUO A;  1WY8 A;  5EE1 A;  2MJ3 A;  3DDC B;  3AE9 B;  1R7S A;  3PLU A;  4YTN B;  2WXP A;  4KGT A;  1V5O A;  2CJO A;  1VRA B;  3A9J B;  5BMI A;  3B08 A;  3ZDT A;  3AMZ A;  2LUE A;  1EO6 A;  1MPE A;  2WDT B;  3A9J A;  1WZ0 A;  1XEE A;  2GLS A;  3P1M A;  2ON8 A;  2K6D B;  4I6L B;  4KVG B;  3L0W B;  1S1Q B;  4KV2 A; 
#chains in the Genus database with same CATH homology
 1E6E B;  1PDX A;  4O1N A;  1RM6 C;  1HQR D;  1PGB A;  2QMT A;  2Z8L A;  1P7F A;  1EWC A;  2VZK D;  3BVZ A;  4ITK A;  2L1A A;  3N9Y C;  4HKZ E;  3SFE B;  2CJN A;  3ABV B;  1NEK B;  1F0Z A;  1JWM D;  1BML C;  1L6V A;  3P42 A;  2W54 A;  2I2Y A;  3H8H A;  4N59 A;  2PIA A;  2B76 B;  4RGN A;  2JU6 X;  1ROE A;  3HRD D;  4XWT A;  1F2R I;  5FKA C;  1FNU A;  1JW9 D;  5AUI A;  3EGR A;  1IGD A;  3U52 E;  2WXM A;  4MH8 A;  1SXT A;  5BYS A;  1FM0 D;  2GB1 A;  3AN1 A;  1HZ5 A;  2FE8 A;  4UDU C;  4YT0 B;  5GXG B;  1NYR A;  1WRI A;  1ZP0 B;  1ESF A;  2WU2 B;  3IT4 B;  1TY0 A;  4AS1 A;  5I4D A;  1QOA A;  4A6Q A;  1RFK A;  1WGK A;  1E10 A;  2N9L A;  3MJ5 A;  4YTM B;  4XDC A;  2WDV B;  1VR9 A;  4ZHP A;  4JWU C;  2BS4 B;  1XCQ L;  1V8C A;  1PGX A;  4JWS C;  3TEZ A;  1DOY A;  1YMH E;  1FMA D;  1I4G A;  2X38 A;  1MHH E;  1QOF A;  2XN9 C;  3BVG A;  4KGS A;  3RPF C;  3EA6 A;  3MFG A;  4B0M A;  3I9V 1;  2M19 A;  3URY A;  1L4Z B;  3TEX A;  3U4E G;  1C4P A;  3L4P A;  1XXG A;  2WXO A;  3U7Z A;  3AE1 B;  5FK9 C;  2RMM A;  1F2R C;  1L0Y B;  3NS1 A;  2K5P A;  4YSX B;  3T3O A;  3IT6 B;  2KWD A;  2LMC A;  3AB5 A;  2WXK A;  1JWS D;  1PUT A;  2QJL A;  2WS3 B;  4RGT A;  3E9S A;  2N0S B;  4HRS A;  1D6E C;  3P4S B;  4C56 C;  2DYM A;  5AUK A;  1IBX A;  3KWV A;  4TSS A;  3V3X A;  1FO4 A;  2SEB D;  5G5G A;  1K51 A;  5BMG A;  1YN3 A;  1YJJ A;  1QT9 A;  4N6E B;  1IGC A;  1HEZ E;  1KLG D;  2V3P A;  2G1E A;  2LEK A;  4REZ A;  2FBW B;  1T3Q A;  1QLB B;  5BMH A;  2BB5 A;  4WUR A;  1F77 A;  1N5X A;  2JWU A;  2PMV A;  1SE4 A;  1E0Z A;  4ARI A;  1STE A;  3E56 A;  2OHF A;  1SF0 A;  1N61 A;  2MEK A;  3ZQ4 A;  5C3J B;  4TQ1 A;  1Y56 A;  3EUB 2;  1GPX A;  1YNT E;  1JML A;  2HTM E;  1WYG A;  1EU3 A;  2QEJ C;  3CWI A;  1ZXH A;  1FNV A;  1TKY A;  3R8B A;  3W9C B;  3U2S C;  4ZYS A;  3AEC B;  4CQN A;  1L5P A;  1N60 A;  1FEH A;  1TY2 A;  2PVG C;  3TEY A;  2J52 A;  4MT5 A;  4B0E A;  1WSP A;  2IGD A;  4HRO A;  1MI0 A;  1T6B X;  3Q69 A;  2CU3 A;  1VZ6 A;  3BK2 A;  5D3D A;  5MPO A;  1NI3 A;  1KH0 A;  5D3I B;  1M4V A;  2WXJ A;  3CIR B;  3VRB B;  2BTE A;  1J7B A;  4RF1 A;  1ZUD 2;  1HXY D;  1N5W A;  2N9K A;  2R61 A;  4HEA 1;  1QKZ A;  3HVD A;  2BS3 B;  2PW9 A;  2LJI A;  1ZXI A;  4A8X C;  5H8Y E;  5HG2 A;  2JYE A;  1CZP A;  2VZK B;  2KMM A;  1TJE A;  1UWM A;  5D7G A;  3AEF B;  1ENF A;  1ACC A;  1L6U A;  1PGA A;  2V4I B;  3B2G A;  3T3N A;  2WXL A;  1JWB D;  1K53 A;  2WXQ A;  3AEG B;  3R2T A;  1WXQ A;  4Q2J A;  3PZ7 A;  3KLS X;  2L32 A;  3V05 A;  2JQR B;  2PVO D;  3IAM 1;  1C79 A;  4MAC A;  1I4X A;  1C4C A;  2KDM A;  2IGG A;  4M0W A;  3PZ8 A;  1V1O A;  2FUG 1;  1JWA D;  4WWM A;  1I4H A;  1OQR A;  2WXG A;  2M56 B;  2LUM A;  1VJK A;  4OZA A;  2JXT A;  4A9A A;  2IDY A;  4EE2 A;  2K3U A;  4A90 A;  4ZHO A;  1TS2 A;  3AE4 B;  2WNM A;  2WXH A;  1YQ4 B;  3AH7 A;  4YSZ B;  2JZP A;  3MC0 B;  3LXF A;  1AW7 A;  1UNS A;  2E6X A;  1C78 A;  2AQ2 B;  3GS2 A;  4KKI A;  5JXV A;  4YXD B;  1SE3 A;  2AX5 A;  1HZ6 A;  4ZRQ A;  1FCL A;  4YTP B;  4HJG E;  2INN E;  4GDL B;  1FFU A;  4D2K A;  1EM7 A;  1V1P A;  4PT5 A;  2MH7 A;  4RNA A;  2GI9 A;  3P4P B;  4KGR A;  4A55 A;  1FRR A;  3IXS A;  3NVZ A;  2OED A;  3FIL B;  3HUI A;  3RFZ B;  4OZB A;  3R2I A;  1TS4 A;  1UGJ A;  2W82 A;  3ZYY X;  3LB8 C;  4JE3 B;  2K9X A;  1IUE A;  3AE5 B;  3AEB B;  4RH6 A;  4TQ0 A;  3Q8E A;  2NMQ A;  3BYT B;  4RCO A;  3KQ4 A;  1C9F A;  1TZO A;  1L4D B;  4ARC A;  1NEN B;  5TSS A;  1SEB D;  4OZC A;  4OHJ A;  2ICI A;  3NVV A;  3BWU D;  3BYY B;  2J53 A;  1NYQ A;  4YSY B;  1JWU D;  3DWG C;  3C8Y A;  4L23 A;  1D4B A;  1I4Q A;  2BB6 A;  2TSS A;  1YQ3 B;  1JQ4 A;  2WXF A;  2WDR B;  1TKE A;  1XCT L;  1SJE D;  3B2F A;  4TMA B;  3ZJT A;  4WAF A;  2WP9 B;  3NVW A;  2LGI A;  5LNK 1;  3LYY A;  1XO3 A;  2H89 B;  4DQO C;  4NZL B;  2INP E;  4WH4 A;  1QIL A;  2WQY B;  3MP9 A;  4H2A A;  1ZDV A;  4C7Y A;  1EU4 A;  1XF5 L;  1A70 A;  5E6J A;  2I38 A;  3I57 A;  2RDG A;  2ACZ B;  3TEW A;  2LFI A;  3AE6 B;  4KKJ A;  1VZ7 A;  2WDQ B;  3AE3 B;  4WQM A;  1TS5 A;  2JYT A;  4L1B A;  1ZE3 D;  1ET9 A;  2BT6 A;  1JRP A;  4C7Z A;  2WXR A;  1GB1 A;  2ZW1 A;  2W55 A;  2YEP F;  5C2T B;  4NJC A;  3W5U B;  2Q5W D;  3B9J A;  1N62 A;  2WU5 B;  1DOI A;  1KRH A;  2QIL A;  1FD6 A;  1GAQ B;  3VRA B;  2XNA C;  1VLB A;  3NRZ A;  1SBB B;  1OQQ A;  2HDE A;  4R3D A;  2DWQ A;  3Q8F A;  4LTU A;  1L0V B;  2V3N A;  4P16 A;  2Y5P A;  1MVK A;  2L52 A;  3BII D;  4LK0 M;  3P4R B;  1XLP A;  4LLG M;  4HKQ A;  1J7A A;  3P4Q B;  1SB3 C;  1KF6 B;  2K0P A;  4JX1 C;  5H92 C;  1PFD A;  4US9 A;  1VDV A;  4GDK B;  1JAL A;  1CQV A;  1E9M A;  2KQ4 X;  3O13 A;  1N63 A;  1QOG A;  4MM3 B;  4XDD A;  3NZ3 A;  2EKI A;  3GP7 A;  4RGM A;  1YN4 A;  3P63 A;  1XLQ A;  2JSV X;  1FNW A;  1KFY B;  3Q8C A;  3VR8 B;  3J9C A;  1I4P A;  2KAJ A;  1JCK B;  1DYQ A;  1FRD A;  1NVI D;  2BW2 A;  2KN4 A;  2H88 B;  2Y3A A;  4IOI E;  5HHD G;  5FR3 A;  2KAC A;  2ZW0 A;  1DOX A;  3AEA B;  3SEB A;  1C76 A;  2BBC A;  3BK1 A;  2YEP B;  4RF0 A;  2AQ1 B;  2RPV A;  2MJE A;  2W3S A;  1IBX B;  3Q8B A;  5HFY A;  3IAS 1;  3TSS A;  3AM9 A;  1CK1 A;  1RYJ A;  1SJH D;  2QSD A;  2PTL A;  3ZJV A;  2LHD A;  1FFV A;  1ZOY B;  1UUP A;  1AYF A;  2PLP A;  2W3R A;  2IJ0 A;  3AE8 B;  4KX6 B;  4FXC A;  1GB4 A;  5EE3 A;  2V0G A;  1FIQ A;  2WXI A;  3AV8 A;  1QF6 A;  1K50 A;  2WLB A;  1SIJ A;  3ZJU A;  3W2D A;  4XE0 A;  2J4X A;  1KLU D;  2GRI A;  3Q8A A;  1T5X D;  1FCC C;  1D5X C;  2DBY A;  2DYO A;  3MHZ A;  4N58 A;  1D5M C;  3SR6 A;  2AQ3 B;  3GB1 A;  2G9H D;  2NTS A;  4US8 A;  2Y5C A;  4XWW A;  1YN5 A;  1GOZ A;  4JPS A;  4RFB A;  4P6V F;  4DXF A;  1JRO A;  1AWD A;  4L2Y A;  2DLB A;  2M0A A;  4ZRP A;  3VR9 B;  1AN8 A;  1UWX A;  1V97 A;  1TKG A;  4YWG G;  2QIE B;  3SFD B;  4IKG A;  2K22 A;  2PKO A;  4OW0 A;  2E3T A;  2SAK A;  1TS3 A;  3DWM A;  4ZOH C;  2J42 A;  1HA5 A;  2IPK D;  3BVM A;  2BYT A;  3AE7 B;  5BYR A;  1D5Z C;  3FC4 A;  4OVZ A;  3HVZ A;  1J7C A;  1C4A A;  4NAW B;  2N7J A;  3WCQ A;  3FAH A;  4J3O D;  1PYW D;  2NTT A;  5BYQ A;  3ZGZ A;  1BXT A;  3NVY A;  3W1S A;  4USA A;  1WWT A;  3VQI A;  4C80 A;  3ETR A;  1E7P B;  2D5G A;  2L83 A;  3KWL A;  2LHE A;  4DXG A;  4AQ7 A;  1YJI A;  3BZD B;  3AED B;  4WIP A;  1MHX A;  4GLS C;  1XLO A;  1FXI A;  1VZ8 A;  1B9R A;  1SSN A;  1DGJ A;  2MJD A;  3TUO A;  2RDH A;  2JX5 A;  1I7H A;  1L0X B;  1TYG B;  1Q10 A;  1BUI C;  3AE2 B;  1QQR A;  1ZPS A;  5EE1 A;  3UI3 A;  5G5H A;  1XLN A;  2WXN A;  2MJ3 A;  1KTK A;  5HI1 A;  1RWS A;  3AE9 B;  1FXA A;  1EWY C;  5EE9 A;  1R7S A;  3AEE B;  1ET6 A;  1C77 A;  4YTN B;  1K52 A;  1B1Z A;  1OFF A;  2WXP A;  1LO5 D;  3OWE B;  4KGT A;  2IGH A;  2CJO A;  1VRA B;  4RGO S;  2EEL A;  1I4R A;  3PO0 A;  5BMI A;  1P7E A;  1QOB A;  3AMZ A;  1MPE A;  2ONQ A;  4IDI A;  1XEE A;  1V1P B;  5T8I A;  1SE2 A;  3W5V B;  3P1M A;  2BS2 B;  5EE0 A;  2ON8 A;  3NUH B;  4NAM A;  1ZDX A;  3FIL A;  1CJE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...