3LB8C

Crystal structure of the covalent putidaredoxin reductase-putidaredoxin complex
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
104
structure length
104
Chain Sequence
b'SKVVYVSHDGTRRELDVADGVSLMQAAVSNGIYDIVGDCGGSASCATCHVYVNEAFTDKVPAANEREIGMLESVTAELKPNSRLSCQIIMTPELDGIVVDVPDR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putidaredoxin reductase
molecule tags Oxidoreductase/electron transport
source organism Pseudomonas putida
publication title Crystal structure of the putidaredoxin reductase x putidaredoxin electron transfer complex.
pubmed doi rcsb
total genus 27
structure length 104
sequence length 104
chains with identical sequence D
ec nomenclature
pdb deposition date 2010-01-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00111 Fer2 2Fe-2S iron-sulfur cluster binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 3lb8C00
3RPFC 1XLPA 2K9XA 1FRRA 2PVGC 1NEKB 3AE7B 3AEAB 3FAHA 4YSZB 1N5XA 1WYGA 5EE1A 2KAJA 3W5UB 4ZHOA 2QIEB 1ZUD2 3LXFA 1OQRA 2WDRB 3NRZA 4KX6B 4C7ZA 3NVZA 4P6VF 4US8A 1RWSA 1TKGA 1TJEA 2KMMA 3NS1A 2PKOA 1ZXIA 3NVYA 2BS2B 3P4SB 3AB5A 1V97A 2WU5B 2CJNA 3AE2B 4HROA 2B76B 1WGKA 2W3RA 3ABVB 3HVZA 4YTMB 1JWBD 1VDVA 3NVVA 1DOIA 1N62A 2LEKA 1E7PB 2WDVB 5EE9A 5G5GA 1N63A 3AE6B 1YJJA 3AE3B 1TKEA 4FXCA 3CIRB 2AX5A 3SFDB 3SFEB 1JQ4A 2MJ3A 2E3TA 1N60A 2PIAA 4ITKA 1E9MA 1V8CA 5H92C 3HRDD 4C7YA 1N5WA 2JX5A 3LB8C 4YTNB 1FXAA 3W5VB 1CZPA 1T3QA 2DWQA 3AEBB 2MJDA 4N58A 2Q5WD 2MH7A 3KWLA 1ROEA 1VJKA 1E0ZA 4YT0B 2W55A 1FFVA 1DGJA 1PUTA 2ACZB 2BT6A 1PDXA 5EE3A 1XLNA 5GXGB 1FFUA 3W9CB 4JWSC 4YSYB 3DWGC 4USAA 3VRBB 3CWIA 3NVWA 3VR8B 1E10A 1QF6A 3DWMA 3AEDB 3AMZA 1I7HA 1J7CA 1OQQA 3AH7A 5G5HA 1ZP0B 2HTME 3L4PA 2WS3B 2BS4B 3WCQA 3AE9B 1FM0D 1L6UA 1QOAA 3B2FA 3P4RB 3PO0A 1R7SA 1B9RA 1J7BA 4JX1C 1DOXA 1FMAD 4C80A 2WDQB 2WU2B 1IUEA 2H88B 1QOFA 1RYJA 4WWMA 4A9AA 3BIID 5MPOA 3AE4B 2CU3A 2QJLA 2N0SB 2WQYB 1TYGB 2EKIA 1N61A 4N6EB 1A70A 4HRSA 4N59A 1QLBB 3AN1A 1JALA 5AUKA 1SIJA 2CJOA 4LTUA 1E6EB 1SF0A 3SR6A 4YXDB 1QT9A 2G1EA 1RFKA 1JWAD 2PVOD 1EWYC 2JQRB 4WQMA 5EE0A 1FRDA 1QOBA 3P63A 2WP9B 1FIQA 1AYFA 1NI3A 3AE5B 3B9JA 2M56B 3EUB2 1JW9D 2M19A 1AWDA 1J7AA 1CJEA 1L0VB 1TKYA 1OFFA 3AM9A 4ZOHC 3ZYYX 4YTPB 3AE1B 1NYQA 2DBYA 3HUIA 2W3SA 3AEFB 4IDIA 1XLQA 1JROA 1PFDA 5C2TB 1WRIA 1NVID 3AEEB 3P4QB 1JRPA 5H8YE 1WXQA 2L83A 3FC4A 3P4PB 4JWUC 3VR9B 1GAQB 1NYRA 3AE8B 2WLBA 1XO3A 1ZOYB 2H89B 1RM6C 4ZHPA 2BS3B 2Y5CA 2W54A 4YSXB 2K5PA 1NENB 1VLBA 1L6VA 1SB3C 3AV8A 1L5PA 1YQ3B 2OHFA 3B2GA 5C3JB 1YQ4B 1UWMA 3VRAB 1QOGA 2K22A 2L52A 4US9A 1F0ZA 2FBWB 1WWTA 1XLOA 1KFYB 2MJEA 1KRHA 3AEGB 3ETRA 1KF6B 1YJIA 1DOYA 1FXIA 3AECB 3P1MA 1FO4A 5AUIA 1GPXA
chains in the Genus database with same CATH superfamily
2HTHA 4HJGE 2KAJA 4ZHOA 1T0YA 4TV3A 2N7EA 2LFIA 3NVYA 2PKOA 3TJPA 1WJUA 3ABVB 1F2RC 1GOZA 1WFYA 2MWSB 3OJ3A 3U52E 4O1NA 4TMAB 2KN5A 3PHWB 4FLHA 2J0MA 1TKEA 2GBMA 2J0KA 2E3TA 3A9JA 5DCNA 4WWNA 3TBLD 1N5WA 1YIWA 3T3OA 1DGJA 3OLMD 3J9CA 1H8CA 2FUHB 4JWSC 2K3UA 3PTFC 4DQOC 3IBEA 1SEBD 5JH5C 3UIPB 1WGYA 5JHBA 1PGBA 2KT7A 1ZP0B 1UF0A 3H6NA 2RDHA 1R7SA 1IUEA 3L0WB 2R2OA 2DAJA 2AEHA 4DXFA 2GOWA 4BKTA 1TYGB 1A70A 4MGZE 3KLSX 1E7VA 3ZGZA 1OQYA 1V5OA 2JYTA 4ICUA 1UWXA 4K3BA 1JWAD 2PVOD 3VUYA 5DPSA 2LGXA 4E74A 1LXDA 1ACCA 1TS4A 1EUVB 2AL3A 2AL6A 3T8MA 2K0PA 2ZW0A 1JRPA 2AWTA 5I4DA 5JXVA 1C76A 3AE8B 1RFAA 3PREA 1V49A 1YQ3B 3RUIB 2MSED 2IY0B 4BOZB 3NHEB 2CHXA 3ZXVA 4CHKA 2NVUI 3ENEA 4XYCA 4ZRPA 1ZPSA 4P16A 3KYDD 2QMTA 3D32A 4REZA 4D2KA 4II3B 3U2SC 3VUWA 2FAZA 1N62A 3BY4B 2KVZA 4K1RB 2K8CA 1QZEA 3JSVB 2V4LA 1FCLA 1FXAA 4M0WA 4LNKA 3AXCA 2L1AA 2MH7A 2L8JA 2JT4B 4HVBA 5EE3A 2D3GA 1FFUA 3W9CB 4ZRIA 2ZZPB 4WIPA 2BPSA 2CHWA 2IGGA 3Q14C 3PRMB 4HPMB 4ZRJA 2BW2A 1DOXA 2KXJA 1SJED 2MP2B 2DAFA 2AQ2B 2NTSA 3GP7A 5CHVC 1JALA 4RF0A 2HE7A 3NJTA 2N9LA 1G6JA 5AEKB 4FULA 2FCNA 3WALA 4W9JA 4FJVB 1I4RA 4XGAB 2WP9B 1FIQA 1C4PA 4MT5A 2M56B 2M19A 3IT4B 4LNNA 3I63C 1CJEA 2MHJA 4L1BA 4NZLB 4TQ1A 1FCCC 4WWOA 1UZXB 4GB9A 2BQQA 3RNFC 1C1YB 4PT5A 4MH0E 1TTNA 1SE3A 2K22A 3RT3B 5HKHA 2XEWA 3W1YA 1PGAA 4LLGM 3T9LA 3M3JA 2QHOA 1VRAB 2EMTA 2J42A 2K6QA 2QIEB 1WJ4A 3NZ3A 5IOIA 2L0FA 4KX6B 2WXQA 3S2AA 1TKGA 3NS1A 4IUMB 1ESFA 3EC8A 3TMPB 2I38A 1VDVA 2WDVB 3QCAA 4QAYA 2CHZA 2G4SA 3TSSA 1JQ4A 2D3AA 3DVGY 3TEYA 4EE2A 3H1UA 4WAAA 4HKQA 2KFJA 3KQ4A 5H92C 4AJWA 2JX5A 3M63B 3DHGC 2DYMA 4MSQB 3KWLA 1KH0A 2KWUB 1ET9A 3A9JB 2FCMA 1MG4A 3Q8FA 1WY8A 1OQQA 3AH7A 3L4PA 4RGMA 2WS3B 2IO0B 2KOXA 2BS4B 3P4RB 4EZLA 2RDBC 1J7BA 3R7RA 2WXHA 2LVOA 2D3CA 2WWZA 3I3TB 4K7SA 3AE4B 1C78A 4AJYB 1C4AA 2QJLA 4NQKE 4XZ4A 4P1BC 1VR9A 4I6LB 3AN1A 1RFKA 5E6PA 1EF1A 2MCNB 1GC7A 2Z0EB 4NQLB 2L0TA 3V60A 3B9JA 1NI3A 2BF8B 3DPDA 1M94A 2NBWB 4MEMA 3AE1B 1LGRA 2L7RA 1WRIA 3P4QB 1STEA 3P4PB 4CO7A 2JPHA 2AQ1B 2DZMA 2N9PC 4WJNA 3UI3A 2BKRB 4OZCA 1BUIC 2NCNA 1I4HA 2JXXA 3DQVA 3ML8A 3NG0A 3TUOA 3TL5A 4AUQC 3ZQ4A 3ZRFA 1FNVA 1WX7A 3ZVVA 3NVZA 4EFOA 2UU7A 3R2IA 1V2YA 1WRDB 2B76B 2C60A 3RULA 3NVVA 2MRPA 1DOIA 4DK5A 4GDKB 3HIZA 4ANVA 3MTNB 2X8XX 2KVRA 2MJ3A 1YMHE 1Q0WB 2KNBA 1YN4A 3V62A 4W9DA 4A90A 3QIJA 1ZKHA 3DDCB 1UD7A 4YT0B 2W55A 4BBNF 2RSUA 3JSVA 5GXGB 4M8MA 3WAPA 4YSYB 1WE6A 2JRIB 4MH8A 4JIOU 2KYWA 4M00A 4IOIE 4KSKC 2QCZA 5HI1A 2MA9B 2QDFA 2KX3A 4RFBA 1QOAA 3HHMA 1B9RA 1J0GA 2SAKA 3BIID 2N0SB 1YX5B 2KKCA 5FR3A 1OEYJ 2L32A 4FJYA 4YXDB 4IWOA 1WJNA 4BFRA 4ZRQA 2IO1B 2HJ1A 2IO2B 3DBRI 2WXOA 2MBBB 1TS5A 2J4XA 4W9EA 1GB4A 2DBYA 1C9FA 3ZXRA 5D6JB 1FXTB 2KWCA 3M95A 2W54A 2K5PA 3AV8A 3DCGA 3ALBA 3Q2AC 2YVCA 1QOGA 2KDMA 4ZYSA 3AEGB 1YJIA 1E5WA 4RGOS 1V1PA 2YEPF 3I5JC 2K9XA 4MGYE 3M62B 5C1ZA 3VUXA 1NI2A 3LXFA 2Z59B 2BBCA 2IO3B 4P6VF 4N59A 2V0GA 3P4SB 1GNUA 2RPQA 2LGYA 1AW7A 3U7DA 3EA6A 3C19A 1YJJA 3ZNGC 1SIFA 4LK0M 1WF9A 1E90A 2BYEA 2KMCA 3BINA 1WR1A 4W9KA 2C7NB 3DBLB 3TEZA 3KUCB 3RCZA 4N58A 3AEBB 1MI0A 3U4EG 2MP2A 1K8RB 4HLEA 1PDXA 3R2TA 2HJ8A 1OGWA 3Q3NC 1V5TA 3AEDB 3KH0A 1L6UA 3CF6E 3FKYA 3W2DA 2WU2B 1IGCA 5MPOA 2MEKA 2CU3A 1KM7A 3AU4A 1AARA 3P2BA 4HRSA 2BYTA 2JWZA 5D3IB 1LQBA 2KWVB 4GN1A 4GOCA 1L2NA 3CSTA 3TEWA 3DVNV 2M17A 3WANA 1L0YB 2DZJA 1HTQA 4B9KA 2KD0A 2LHDA 1XLQA 1JROA 4RMAA 1QKZA 1JWUD 2L83A 3LJ3A 4JWUC 1XO3A 4URKA 2BS3B 1SB3C 2XN9C 1FD6A 5IN7A 3UF8A 3ETRA 5J2RA 4C56C 1FO4A 4GIVA 1V1OA 1R4NB 3ZLZA 4HEA1 1N5XA 4PS3A 4NJCA 4B0EA 3H7PB 4RCOA 1CMXB 4FN2A 4WWPA 5TSSA 3ZO5B 4YTMB 2KDIA 2LEKA 5G5GA 3AE6B 1VZ7A 2LWPA 4H2AA 3IFWB 2KK8A 2WXJA 2JYEA 4AS1A 3LB8C 4JE3B 3EECA 3RZWC 2LJ5A 2GBKA 1V81A 1I4GA 2VH1A 3QK0A 4HPLB 4ZYNA 3IG3A 3VTUA 3IAS1 3ECIA 1MVKA 3VR8B 1QF6A 3R66C 2DNFA 3DWMA 2K39A 1Z5SB 3PV1A 1TZ1A 4TUUA 3ML9A 1JRUA 2LUEA 2WXRA 3IVFA 1FMAD 1B1ZA 1D6EC 1WGGA 1YJ1A 4A9AA 2FUG1 2WXKA 1TS2A 1XF5L 1V86A 2LVQA 5BO4B 2NBUA 2R2QA 1SF0A 2KDBA 1GC6A 1T6BX 2G1EA 4KIKA 1HEZE 2WXNA 2KQ7A 3ZJTA 1EWYC 5JZEB 3NZUA 1Q5WB 1AYFA 4HCPB 1JW9D 3PPAA 4HPPA 4NAWA 3AEFB 2DYOA 2PJHA 3AEEB 5CTRC 2INCC 1WXQA 4AP4C 3R3MA 4WJPA 1D5XC 2KLCA 1L6VA 2PLPA 1K51A 2FCQA 1KTKA 2N1WA 4US9A 1XLOA 2O6VD 3HK0A 1E8XA 4YWGG 2KMAA 1IP9A 3RPFC 1XLPA 3MHZA 3QARA 1F2RI 2IDYA 2KDEB 2GLSA 3AEAB 2ZPYA 4J6IA 4EZJA 1WX9A 2VH2A 3A9KA 4B95A 3Q3MC 2GI9A 4W9LA 3CMMB 4EUTA 1MPEA 1WYWB 3V6EB 1MJDA 1WH3A 1XEEA 2N9XA 2C7HA 5EE9A 5L95C 2WX1A 1N60A 4ITKA 4N9F4 1E9MA 1J19A 2MBQA 1CZPA 1WXAA 1E7UA 1P98A 4LNOA 1TY2A 4W9GA 2J52A 3RI7C 1MG8A 4A55A 2OJWA 1AN8A 2LD9A 2YLMA 3ZDTA 3KWVA 3SD5A 1GB1A 4ANXA 4BKSA 1P7EA 4HDQA 4G0NB 1SSNA 3RD2A 1RYJA 3BYYB 3TEXA 3RNCC 2ZNVB 4ARCA 3Q8BA 3IAM1 2ZPNA 4A8XC 2N1VA 4JGHB 4OVZA 2PE9A 2FIDA 3APDA 1TGZB 3ZRCA 5IO9A 3ZNID 1PGXA 4YTPB 1WZ3A 1V9JA 2BKFA 2QEJC 1M4VA 2JZ3B 2KO3A 1T5XD 2LI5A 3RNEC 3MJWA 1SGHA 2WXGA 2WXMA 2NMQA 3U8ZA 2FE8A 4EOYA 3KYCD 3Q8EA 4I6NB 3SU8X 3L54A 2QC8A 2JUOA 1NEKB 4XDCA 1GUAB 3Q69A 1R4NI 2WHIA 1RWSA 1ZDVA 1ZXIA 3AB5A 1V97A 2CJNA 3HVZA 2KTRB 4KGRA 3URYA 1BXTA 2RGFA 1E7PB 2W9NA 3RNAC 2OEDA 4DHZB 1J8CA 2O6VA 4JL9A 4DHZE 3B08A 4KSLC 4YL8A 3N1ZC 4WJOA 3DVNU 3LDZE 5BMGA 2IYDB 4MELA 1N6ZA 1P3QU 1D5MC 1TIFA 5IKCM 2ACZB 3DBHB 2J0JA 1L4DB 2N7DA 3A4SC 2IJ0A 3O65B 4TQ0A 4BKGA 4S0RA 3IHPC 3WCQA 4HJKA 5E6OA 2V3PA 3PZDA 1EWCA 1EF5A 4FADA 3BVZA 1QLBB 5AUKA 3ZJUA 4F1SA 3Q3OC 2DZKA 4LNFA 2V3NA 2JQRB 1C77A 2N9KA 3OJ4B 2BB5A 3ZTCA 2WXPA 1AWDA 3L08A 1L0VB 4PYZA 1OFFA 4IDIA 1UGJA 1SBBB 3VTWA 1SXTA 5G2NA 3ZDMC 5FK9C 1C4CA 3Q3JA 2LXCA 2KJHB 4GDLA 1F0ZA 2M0AA 1KRHA 5E6NA 1DOYA 2KTRA 3P1MA 2ZCCA 3MC8A 1FRRA 1D3ZA 3EHVA 1WGDA 1ZUD2 4NPNA 4RGTA 3N30A 2KMMA 3IT6B 1KOTA 4WAFA 2WU5B 3AE2B 3BVGA 1YQBA 2VRRB 3WA0A 4II2B 2V9HA 3AU5A 4TKNA 3CIRB 4XC2A 3QA8A 2KFKB 2MBEA 1ENFA 5D2MB 2I2YA 1P9DU 1WI0A 1ROEA 4GGQA 4W9HA 2NBVB 2JU6X 1XLNA 1XCQL 3ZIMA 1ET6A 2PE6B 4MGKE 4EEWA 1I7HA 2Y5PA 3A33B 3X0WA 4EZKA 2INDC 3PO0A 4NNJB 3NZSA 1XXGA 1IBXA 2D11A 2EKIA 1SE9A 1ZW7A 4M0WB 1UNSA 5HFYA 4FHJA 1SIJA 1V6EA 4DBGA 1IGDA 2K1FA 3UQAA 4G50A 1MHXA 1FRDA 1QOBA 3GOEA 3PZ7A 1TKYA 1I4QA 2L3ZA 4WQOB 3HUIA 5H8YE 4RM9A 1F1HA 1KLUD 1ZOYB 4GLSC 2KJRA 3B1LX 2ZEQA 3QX1A 4MJSB 4KGSA 3SDLC 2WX0A 2KC1A 2PVGC 3MFGA 1WYGA 3W5UB 1I35A 2KDFB 3QHTA 4FHKA 2BS2B 3VVWB 2V1YA 2QSDA 2WDTB 2ZVNA 3I9V1 2XBBC 1WGKA 3DHIC 3H7PA 1HQRD 5LNK1 3BZDB 4JPSA 4AQ7A 2L00B 3R7QA 1OEYA 2LMCA 5CHWA 1E8WA 4YTNB 3DBHI 4OW0A 1WIAA 1E0ZA 2NS5A 2KQSA 2C5LC 3VTVA 1JCKB 2A5UA 1TS3A 1EU3A 4GXBA 1J7CA 4KZCA 5G5HA 5T8IA 4DXGA 2JVCA 3RNGC 4LJPB 2KJ6A 3PGEA 4TSSA 4WWMA 5FKAC 3UGBB 3MC9A 1ISNA 2FCSA 2JY6A 1N61A 3KVFB 1WGRA 3L13A 1YOVB 4E3CA 2Y3AA 3PT2B 1QT9A 2Z8LA 3WIMA 1QILA 3P63A 4MSMB 5D3DA 3AE5B 3GB1A 3PZ8A 4MJSA 2NR2A 3UIOB 3H8HA 4RH6A 2LRWA 1JMLA 1T0QC 2KLGA 5CX3A 2IGDA 1EM7A 4YSXB 1LM8B 3W1SC 3B2GA 2BYFA 2HDEA 2O6VB 1WMHA 1WR6E 5IA7A 4EKUA 2AYOB 4KKJA 4F7ZA 4BVUC 3PHXB 2E6XA 1DYQA 3PS6A 2RR9A 2WXFA 4PYUA 2KHWB 4M01A 3ZTDA 1JWBD 3GZNB 5G55A 4BBNC 2AX5A 3H7SA 4A3OA 1L7YA 1UBQA 2MW5A 3BWUD 3E9SA 4GDKA 3KW5B 2YEPB 3W5VB 2KACA 1P7FA 2DWQA 4OZBA 2AQ3B 3EFUA 4W9IA 3DHHC 2DX5B 4A20A 5CHFA 4DHJB 4L23A 1WXVA 3DWGC 4USAA 2RD0A 2D07B 2KZRA 2N7JA 3MHSD 1MHHE 3TIXA 4PS8A 2Z0DB 3AULA 2KX0A 4JX1C 2VZKD 1QOFA 3HM6X 4ZDVA 4XWTA 3RMKC 5BYQA 3SR6A 3QC8B 2QILA 1UBIA 2GBJA 3N1YC 2LXAA 2DLBA 4J3OD 5EE0A 1EO6A 1BMLC 1TZOA 3I57A 1KLVA 3AM9A 5LLIA 3B0AA 4KV2A 1NYQA 2IGHA 1UUPA 1QQRA 2KQ4X 2IBIB 2D2QA 1GJZA 2BVCA 4PS7A 2H89B 1RM6C 4FA6A 4BAXA 4MDKE 1NENB 2V4IB 4WJQA 2FNJB 3WAMA 2RMMA 4AWJA 5HG2A 3H9DA 5BMHA 3GE8C 1YN3A 3AE7B 2W82A 1OQRA 2WDRB 4I6PA 1IYFA 4M02A 1YNTE 4HROA 1WE7A 2OOBB 3VH4B 1WZ0A 4K7UA 1D4BA 1OTRB 4HKZE 1CQVA 1JWMD 2JXTA 1NBFC 2PIAA 3VXWA 4BKSD 3VFKA 4XDDA 4KDLB 1T3QA 4NAWB 3ZW3A 1VJKA 1VD2A 1Y56A 2BT6A 2TSSA 4RF1A 1HTOA 4NJ7A 2IZVB 2N4FA 1T0RC 2INPE 3RYTA 3JVZX 5HHDG 2L76A 2HTME 1H4RA 4C4VA 5AZFA 3N32A 1XCTL 3RFZB 2R61A 2A4ZA 2VZKB 2L05A 2M1MA 1XT9B 3A1QB 2LZ6A 4GMVA 3NY5A 3N3KB 4PK1A 4S17A 2CJOA 1U4AA 1E6EB 2KFKA 1V80A 1WM3A 4DDID 2BGFA 4DHJD 2K8BA 1KLGD 2K6DB 2UWQA 4DWFA 1FPYA 3VAWA 3V3XA 3O13A 1P0RA 3A9KB 4MACA 3VR9B 3VDZA 1YD8U 2GBRA 1XQQA 4ZHPA 1L5PA 3MP9A 1UWMA 2UYZB 2L52A 4M8NA 4CQNA 1GPXA 2C7MB 2PPHA 2C9WB 2M8SA 5BYSA 2JSVX 4IW0A 1F52A 4X57B 3GZNI 3OWEB 3MJ5A 2ZJDA 1D5ZC 4KDIC 4B0MA 3VH3B 2XK5A 3V6CB 1IPGA 5DPRA 1S1QB 4C7YA 5J17A 2MJDA 4F8CB 3L10B 2BYVE 4IWPA 2O2VB 2NPTB 2CR5A 5AZGA 2WYQA 1E10A 2M4NA 2PMVA 4GU2A 3ZUNA 3C8YA 5LXHA 1FEHA 1HZ5A 2XNAC 3B2FA 5J18A 3ZKJC 2V3SA 2IPKD 1WJ6A 1IBXB 4ICVA 1C3TA 3APFA 4N6EB 2BWFA 3K9OB 5KHQA 1FNUA 5BYRA 3APCA 3NS8A 3RN9C 4BOSC 2J7QB 2GB1A 3N1XC 3V61A 3Q8CA 4LDTB 3KUDB 3EUB2 1MFWA 2LUMA 2KWDA 3EFCA 4W9FA 2B3AA 4WURA 3RNBC 4MGIE 4IM2A 1E8YA 4G3XB 3PLVA 3BK2A 2Y5CA 1VZ6A 2XK5B 5C3JB 5LXIB 2ICIA 3EGRA 1KF6B 3ZNHB 3AECB 3BYTB 1ZGUB 1C79A 4BZAA 5EDSA 2D10A 5EE1A 2NPTA 3KUZA 3UQBA 2MX2A 4C7ZA 1YN5A 4HWIB 1YX6B 2K8HA 2KTFA 3U7ZA 2W3RA 4KVGB 3A4RA 3VQIA 1WM2A 2LJIA 1RAXA 3LYYA 3AE3B 2N9EB 2DHZA 4GDLB 2ASQA 2LGIA 3WAOA 1R4MB 1CK1A 4KZ0A 3HRDD 5D94A 2OJRA 4ACFA 2M0XA 2LHEA 1Q1OA 4LDTD 5TR5A 1PUTA 4L2YA 3X23A 5BMIA 4IM0A 1WX8A 3CWIA 3UINB 3C0RB 3IXSA 2ZNVC 2ON8A 2JZPA 4IWQA 4C80A 2WDQB 4IG7B 2WQYB 2DYBA 4XE0A 1ZDXA 2LRUA 1L0XB 4C4VB 2WXIA 3L17A 2GRIA 4E71A 5C23A 4FBJB 1NDDA 4LJOB 3QQ8B 1SJHD 5D7GA 3E56A 2W3SA 3DOWA 2LASA 3OG5A 5C2TB 5KHOA 3FC4A 1GAQB 1WSPA 3T3NA 2LGDA 3DBRB 3HM3A 1VLBA 4KGTA 1S3SG 3GE3C 1T0SC 2OHFA 3AI5A 1WXSA 2PEAA 4ASWC 2FBWB 3PVLA 4HDOA 2RPVA 2ZVOA 2DENB 1UH6A 2CU1A 5AUIA 4P7IA 2D5GA 4DDGD 1KJTA 4YSZB 3DBLI 2JZZA 2JWUA 1ZE3D 3NRZA 2G4DB 4US8A 1TJEA 2EELA 2EMSA 4HXDA 5IAAC 1Y8RC 3JW0X 1N63A 4ZRKA 2Y5BB 4IKGA 4ANWA 4RGNA 2MLBA 3NUHB 3SFEB 1A5RA 5JHAA 4HCNB 1I4PA 4A6QA 4KIKB 4IC7B 1GG3A 3PRZA 2DZIA 2WXLA 3PRPB 3ZNZB 2PW9A 4MM3B 2BWES 2INNE 1P1AA 4OZAA 2MQJA 3VRBB 3NVWA 5GMVA 2G9HD 1XD3B 3AMZA 4CYEA 5DPWA 1I42A 1LO5D 1UELA 4P1CC 2MBHA 3P42A 1RRBA 1I4XA 3OAWA 1PQSA 1X1MA 3TCAA 4RNAA 1SE2A 2G45B 2WNMA 1K53A 2KN4A 1RLFA 4NJ6A 4UDUC 4K81A 4LTUA 5AZHA 1LFDA 1WXMA 3V05A 3K9PB 3Q8AA 4HK2A 2GBNA 3PLUA 1HA5A 2GMIC 4W9CA 1L4ZB 3PSEB 5DPTA 1VCBA 4K7WA 3HVDA 1E8ZA 3FILA 2CS4A 5E6JA 1HXYD 2ZW1A 4FJZA 3ZYYX 1TT5B 1JWSD 2J53A 4G11A 4ANUA 1NVID 4JLCA 4B6WA 1NYRA 3N9YC 4WH4A 3ZJVA 1F77A 1YQ4B 2FIFA 4RM8A 2BTEA 2MJEA 1KFYB 4ARIA 1FXIA 2CKHB 3BVMA 2D3BA 3R8BA 2EKEC 1TBEA 2G3QB 3FAHA 3GS2A 4K3CA 2O2VA 3DBSA 3MC0B 2IY1B 3SEBA 2REXA 2NTTA 1SE4A 4XX5A 4A3PA 4FXCA 3SFDB 4JQWC 3QWZB 2HD5B 3SHQA 1V8CA 3QJZA 4IM3A 2RDGA 2SEBD 4XWWA 2Q5WD 1FFVA 2K25A 1HZ6A 1FNWA 5IP4D 2I1JA 4C00A 2MBOA 2KANA 1UGMA 1Z2MA 3FILB 1F9JA 2X38A 4R3DA 1WMHB 1HE8A 2LGSA 4DXAB 2WGSA 4OHJA 3AE9B 1FM0D 4MM3A 2JRHA 4AOFA 1K52A 2H88B 2KC2A 4LNIA 3N20C 4NY0A 1WGHA 3L16A 3U30A 5L83A 3JYUA 2I1KA 3CSFA 1ZXHA 5FR6A 3ONSA 2ZCBA 3NOBA 1Q10A 4KKIA 4WQMA 1TY0A 3W1SA 2JF5A 2LVPA 4OVUA 3Q6BA 1J7AA 3VHTC 4ZOHC 1R4MI 4NAMA 1PYWD 4OVVA 2ONQA 1EU4A 1PFDA 2PTLA 1VZ8A 2WLBA 3A1QA 4GSWA 3DVGX 3Q3FA 1V1PB 1K50A 4Q2JA 3VRAB 4LCDE 3BK1A 3QAQA 3RZFA 1WWTA 1BT0A 2BB6A
chains in the Genus database with same CATH topology
2YEPF 2K9XA 1FRRA 4HJGE 2KAJA 4ZHOA 1ZUD2 5BYSA 3LXFA 2JSVX 4RGTA 2BBCA 2LFIA 4P6VF 3NVYA 4N59A 2KMMA 2V0GA 2PKOA 3P4SB 3IT6B 4WAFA 3OWEB 3MJ5A 2WU5B 3AE2B 3ABVB 1F2RC 1GOZA 3BVGA 1D5ZC 3U52E 1AW7A 4O1NA 4B0MA 3EA6A 4TMAB 1YJJA 4LK0M 1TKEA 3CIRB 2E3TA 1ENFA 4C7YA 1N5WA 3TEZA 2I2YA 4N58A 3AEBB 1MI0A 2MJDA 3U4EG 3T3OA 1ROEA 1GPXA 1DGJA 2JU6X 3J9CA 1PDXA 1XLNA 1XCQL 3R2TA 4JWSC 2K3UA 1ET6A 4DQOC 1E10A 1SEBD 2PMVA 3AEDB 1I7HA 1PGBA 2Y5PA 1ZP0B 3C8YA 1FEHA 1HZ5A 1L6UA 2RDHA 2XNAC 3B2FA 1R7SA 3PO0A 3W2DA 2WU2B 1IUEA 1XXGA 1IGCA 5MPOA 2IPKD 2MEKA 4DXFA 1IBXA 1IBXB 2CU3A 1TYGB 2EKIA 4N6EB 1A70A 4HRSA 2BYTA 3KLSX 1UNSA 1FNUA 5BYRA 3ZGZA 5HFYA 2JYTA 1SIJA 5D3IB 1IGDA 1UWXA 1JWAD 2PVOD 2GB1A 3TEWA 1MHXA 3Q8CA 1FRDA 1L0YB 1QOBA 1ACCA 1TS4A 3EUB2 2LUMA 3PZ7A 2KWDA 1I4QA 1TKYA 4WURA 2LHDA 3HUIA 1XLQA 2K0PA 1JROA 2ZW0A 5H8YE 1JRPA 1QKZA 5I4DA 1JWUD 2L83A 4JWUC 5JXVA 1KLUD 1C76A 3AE8B 3BK2A 1XO3A 1ZOYB 2BS3B 2Y5CA 4GLSC 1VZ6A 1SB3C 2XN9C 1FD6A 1YQ3B 5C3JB 2ICIA 3EGRA 3ETRA 1KF6B 4KGSA 3AECB 3BYTB 4C56C 1FO4A 1V1OA 2PVGC 1C79A 4ZRPA 4HEA1 1N5XA 3MFGA 1WYGA 1ZPSA 4NJCA 4P16A 5EE1A 3W5UB 4B0EA 4RCOA 2QMTA 4C7ZA 4REZA 1YN5A 4D2KA 2BS2B 5TSSA 2QSDA 3I9V1 3U2SC 1WGKA 2W3RA 3U7ZA 4YTMB 3VQIA 1HQRD 5LNK1 1N62A 2LEKA 2LJIA 3BZDB 5G5GA 3AE6B 4JPSA 1VZ7A 3LYYA 3AE3B 4AQ7A 4GDLB 4H2AA 2WXJA 2LGIA 2JYEA 2LMCA 1CK1A 3HRDD 4AS1A 1FCLA 3LB8C 4JE3B 1FXAA 4YTNB 4M0WA 2LHEA 1I4GA 4OW0A 2L1AA 2MH7A 1E0ZA 1PUTA 4L2YA 1JCKB 5EE3A 5BMIA 1FFUA 3IAS1 3W9CB 1TS3A 1MVKA 3CWIA 3VR8B 1EU3A 1QF6A 4WIPA 3DWMA 1J7CA 3IXSA 5G5HA 2IGGA 5T8IA 4DXGA 2ON8A 2BW2A 2JZPA 2WXRA 1DOXA 1FMAD 4C80A 1B1ZA 1D6EC 2WDQB 4WWMA 1SJED 4TSSA 2FUG1 5FKAC 4A9AA 2WQYB 2WXKA 1TS2A 4XE0A 1N61A 1XF5L 1ZDXA 2AQ2B 2NTSA 3GP7A 1L0XB 2Y3AA 1JALA 4RF0A 1SF0A 1QT9A 1T6BX 2G1EA 2N9LA 2WXIA 2Z8LA 1HEZE 2WXNA 2GRIA 3ZJTA 1EWYC 1I4RA 1QILA 3P63A 2WP9B 1FIQA 1C4PA 5D3DA 1AYFA 4MT5A 3AE5B 3GB1A 3PZ8A 2M56B 3H8HA 1JW9D 2M19A 3IT4B 4RH6A 1CJEA 1SJHD 4L1BA 1JMLA 4NZLB 5D7GA 3E56A 2W3SA 3AEFB 1FCCC 4TQ1A 2DYOA 5C2TB 3AEEB 1WXQA 3FC4A 2IGDA 1GAQB 1WSPA 3T3NA 1D5XC 4PT5A 1EM7A 4YSXB 1VLBA 1L6VA 2PLPA 3B2GA 4KGTA 2OHFA 1SE3A 1K51A 1KTKA 2HDEA 2K22A 4US9A 2FBWB 1XLOA 2RPVA 1PGAA 4LLGM 4KKJA 5AUIA 4YWGG 3RPFC 1XLPA 3MHZA 2D5GA 1F2RI 2IDYA 1VRAB 3AEAB 4YSZB 2J42A 2JWUA 1ZE3D 2QIEB 2E6XA 3NZ3A 3NRZA 1DYQA 4KX6B 4US8A 2WXQA 1TKGA 1TJEA 3NS1A 1ESFA 2GI9A 2WXFA 2EELA 2I38A 1MPEA 1JWBD 1VDVA 1XEEA 5EE9A 2WDVB 1N63A 4IKGA 4RGNA 3NUHB 3SFEB 2AX5A 3TSSA 1JQ4A 1N60A 4ITKA 1I4PA 4A6QA 4EE2A 3TEYA 4HKQA 1E9MA 3BWUD 3E9SA 3KQ4A 5H92C 2JX5A 2YEPB 3W5VB 2KACA 1P7FA 1CZPA 2DWQA 4OZBA 2AQ3B 2DYMA 2WXLA 3KWLA 1KH0A 2PW9A 4L23A 1TY2A 1ET9A 4MM3B 2INNE 2J52A 3DWGC 4USAA 4OZAA 3VRBB 4A55A 3NVWA 2G9HD 1AN8A 3Q8FA 2N7JA 3AMZA 1OQQA 3AH7A 1MHHE 3KWVA 1GB1A 3L4PA 1LO5D 4RGMA 2WS3B 2BS4B 3P42A 3P4RB 1I4XA 1J7BA 1P7EA 4JX1C 2WXHA 2VZKD 1SSNA 1QOFA 1RYJA 4RNAA 3AE4B 3BYYB 3TEXA 1C78A 1SE2A 1C4AA 2QJLA 2WNMA 1K53A 2KN4A 1VR9A 4XWTA 4ARCA 3Q8BA 3IAM1 5BYQA 3AN1A 4A8XC 4UDUC 4LTUA 3SR6A 3V05A 2QILA 3Q8AA 4OVZA 1RFKA 1HA5A 2DLBA 4J3OD 1L4ZB 5EE0A 3B9JA 1NI3A 1BMLC 3HVDA 3FILA 1TZOA 3I57A 3AM9A 1PGXA 3ZYYX 5E6JA 1HXYD 2ZW1A 4YTPB 3AE1B 1JWSD 1NYQA 2J53A 2QEJC 1M4VA 2IGHA 1UUPA 2KQ4X 1QQRA 1NVID 1WRIA 3P4QB 1STEA 1T5XD 3P4PB 1NYRA 2AQ1B 3N9YC 2H89B 1RM6C 4WH4A 3UI3A 4OZCA 1NENB 2V4IB 1BUIC 3ZJVA 1F77A 1YQ4B 2WXGA 2RMMA 5HG2A 1I4HA 2BTEA 2WXMA 2NMQA 2MJEA 1KFYB 3TUOA 2FE8A 4ARIA 5BMHA 1FXIA 3BVMA 3R8BA 3Q8EA 1YN3A 1NEKB 4XDCA 3AE7B 3FAHA 3GS2A 3ZQ4A 3Q69A 2W82A 1FNVA 1OQRA 2WDRB 3NVZA 1RWSA 1ZDVA 1ZXIA 1YNTE 3AB5A 1V97A 3MC0B 3R2IA 2CJNA 4HROA 2B76B 3HVZA 3SEBA 2NTTA 4KGRA 3URYA 1BXTA 1SE4A 1DOIA 3NVVA 1E7PB 1D4BA 4GDKB 4HKZE 1CQVA 2OEDA 1JWMD 2JXTA 4FXCA 3SFDB 2MJ3A 1YMHE 2PIAA 1V8CA 2RDGA 2SEBD 1YN4A 5BMGA 4XDDA 4A90A 1D5MC 1T3QA 4NAWB 4XWWA 2Q5WD 1VJKA 4YT0B 2W55A 1FFVA 1Y56A 2ACZB 2BT6A 2TSSA 4RF1A 1HZ6A 5GXGB 1FNWA 1L4DB 4YSYB 2INPE 4MH8A 3FILB 2IJ0A 5HHDG 2X38A 4R3DA 4IOIE 2HTME 5HI1A 4TQ0A 1XCTL 4OHJA 3WCQA 2R61A 4RFBA 3RFZB 3AE9B 1FM0D 1QOAA 1B9RA 2V3PA 2VZKB 1EWCA 1K52A 2H88B 2SAKA 3BIID 2N0SB 5FR3A 3BVZA 1QLBB 1V1PA 2L32A 1ZXHA 5AUKA 2CJOA 1E6EB 4YXDB 3ZJUA 4ZRQA 1KLGD 1Q10A 2V3NA 2JQRB 4KKIA 4WQMA 1C77A 1TY0A 2N9KA 3W1SA 2BB5A 2WXPA 1AWDA 1J7AA 1L0VB 2WXOA 1OFFA 4ZOHC 4NAMA 1TS5A 3V3XA 1PYWD 3O13A 2ONQA 2J4XA 1GB4A 1EU4A 2DBYA 4IDIA 4MACA 1C9FA 1UGJA 1PFDA 1SBBB 2PTLA 1VZ8A 3VR9B 2WLBA 1SXTA 5FK9C 1C4CA 2W54A 2K5PA 3AV8A 4ZHPA 1L5PA 1V1PB 1K50A 3MP9A 4Q2JA 1UWMA 3VRAB 1QOGA 2L52A 3BK1A 1F0ZA 2KDMA 1WWTA 2M0AA 3AEGB 1KRHA 4ZYSA 1YJIA 1DOYA 3P1MA 4CQNA 4RGOS 2BB6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3RPF C;  1XLP A;  2K9X A;  1FRR A;  2PVG C;  1NEK B;  3AE7 B;  3AEA B;  3FAH A;  4YSZ B;  1N5X A;  1WYG A;  5EE1 A;  2KAJ A;  3W5U B;  4ZHO A;  2QIE B;  1ZUD 2;  3LXF A;  1OQR A;  2WDR B;  3NRZ A;  4KX6 B;  4C7Z A;  3NVZ A;  4P6V F;  4US8 A;  1RWS A;  1TKG A;  1TJE A;  2KMM A;  3NS1 A;  2PKO A;  1ZXI A;  3NVY A;  2BS2 B;  3P4S B;  3AB5 A;  1V97 A;  2WU5 B;  2CJN A;  3AE2 B;  4HRO A;  2B76 B;  1WGK A;  2W3R A;  3ABV B;  3HVZ A;  4YTM B;  1JWB D;  1VDV A;  3NVV A;  1DOI A;  1N62 A;  2LEK A;  1E7P B;  2WDV B;  5EE9 A;  5G5G A;  1N63 A;  3AE6 B;  1YJJ A;  3AE3 B;  1TKE A;  4FXC A;  3CIR B;  2AX5 A;  3SFD B;  3SFE B;  1JQ4 A;  2MJ3 A;  2E3T A;  1N60 A;  2PIA A;  4ITK A;  1E9M A;  1V8C A;  5H92 C;  3HRD D;  4C7Y A;  1N5W A;  2JX5 A;  3LB8 C;  4YTN B;  1FXA A;  3W5V B;  1CZP A;  1T3Q A;  2DWQ A;  3AEB B;  2MJD A;  4N58 A;  2Q5W D;  2MH7 A;  3KWL A;  1ROE A;  1VJK A;  1E0Z A;  4YT0 B;  2W55 A;  1FFV A;  1DGJ A;  1PUT A;  2ACZ B;  2BT6 A;  1PDX A;  5EE3 A;  1XLN A;  5GXG B;  1FFU A;  3W9C B;  4JWS C;  4YSY B;  3DWG C;  4USA A;  3VRB B;  3CWI A;  3NVW A;  3VR8 B;  1E10 A;  1QF6 A;  3DWM A;  3AED B;  3AMZ A;  1I7H A;  1J7C A;  1OQQ A;  3AH7 A;  5G5H A;  1ZP0 B;  2HTM E;  3L4P A;  2WS3 B;  2BS4 B;  3WCQ A;  3AE9 B;  1FM0 D;  1L6U A;  1QOA A;  3B2F A;  3P4R B;  3PO0 A;  1R7S A;  1B9R A;  1J7B A;  4JX1 C;  1DOX A;  1FMA D;  4C80 A;  2WDQ B;  2WU2 B;  1IUE A;  2H88 B;  1QOF A;  1RYJ A;  4WWM A;  4A9A A;  3BII D;  5MPO A;  3AE4 B;  2CU3 A;  2QJL A;  2N0S B;  2WQY B;  1TYG B;  2EKI A;  1N61 A;  4N6E B;  1A70 A;  4HRS A;  4N59 A;  1QLB B;  3AN1 A;  1JAL A;  5AUK A;  1SIJ A;  2CJO A;  4LTU A;  1E6E B;  1SF0 A;  3SR6 A;  4YXD B;  1QT9 A;  2G1E A;  1RFK A;  1JWA D;  2PVO D;  1EWY C;  2JQR B;  4WQM A;  5EE0 A;  1FRD A;  1QOB A;  3P63 A;  2WP9 B;  1FIQ A;  1AYF A;  1NI3 A;  3AE5 B;  3B9J A;  2M56 B;  3EUB 2;  1JW9 D;  2M19 A;  1AWD A;  1J7A A;  1CJE A;  1L0V B;  1TKY A;  1OFF A;  3AM9 A;  4ZOH C;  3ZYY X;  4YTP B;  3AE1 B;  1NYQ A;  2DBY A;  3HUI A;  2W3S A;  3AEF B;  4IDI A;  1XLQ A;  1JRO A;  1PFD A;  5C2T B;  1WRI A;  1NVI D;  3AEE B;  3P4Q B;  1JRP A;  5H8Y E;  1WXQ A;  2L83 A;  3FC4 A;  3P4P B;  4JWU C;  3VR9 B;  1GAQ B;  1NYR A;  3AE8 B;  2WLB A;  1XO3 A;  1ZOY B;  2H89 B;  1RM6 C;  4ZHP A;  2BS3 B;  2Y5C A;  2W54 A;  4YSX B;  2K5P A;  1NEN B;  1VLB A;  1L6V A;  1SB3 C;  3AV8 A;  1L5P A;  1YQ3 B;  2OHF A;  3B2G A;  5C3J B;  1YQ4 B;  1UWM A;  3VRA B;  1QOG A;  2K22 A;  2L52 A;  4US9 A;  1F0Z A;  2FBW B;  1WWT A;  1XLO A;  1KFY B;  2MJE A;  1KRH A;  3AEG B;  3ETR A;  1KF6 B;  1YJI A;  1DOY A;  1FXI A;  3AEC B;  3P1M A;  1FO4 A;  5AUI A;  1GPX A; 
#chains in the Genus database with same CATH topology
 2HTH A;  4HJG E;  2KAJ A;  4ZHO A;  1T0Y A;  4TV3 A;  2N7E A;  2LFI A;  3NVY A;  2PKO A;  3TJP A;  1WJU A;  3ABV B;  1F2R C;  1GOZ A;  1WFY A;  2MWS B;  3OJ3 A;  3U52 E;  4O1N A;  4TMA B;  2KN5 A;  3PHW B;  4FLH A;  2J0M A;  1TKE A;  2GBM A;  2J0K A;  2E3T A;  3A9J A;  5DCN A;  4WWN A;  3TBL D;  1N5W A;  1YIW A;  3T3O A;  1DGJ A;  3OLM D;  3J9C A;  1H8C A;  2FUH B;  4JWS C;  2K3U A;  3PTF C;  4DQO C;  3IBE A;  1SEB D;  5JH5 C;  3UIP B;  1WGY A;  5JHB A;  1PGB A;  2KT7 A;  1ZP0 B;  1UF0 A;  3H6N A;  2RDH A;  1R7S A;  1IUE A;  3L0W B;  2R2O A;  2DAJ A;  2AEH A;  4DXF A;  2GOW A;  4BKT A;  1TYG B;  1A70 A;  4MGZ E;  3KLS X;  1E7V A;  3ZGZ A;  1OQY A;  1V5O A;  2JYT A;  4ICU A;  1UWX A;  4K3B A;  1JWA D;  2PVO D;  3VUY A;  5DPS A;  2LGX A;  4E74 A;  1LXD A;  1ACC A;  1TS4 A;  1EUV B;  2AL3 A;  2AL6 A;  3T8M A;  2K0P A;  2ZW0 A;  1JRP A;  2AWT A;  5I4D A;  5JXV A;  1C76 A;  3AE8 B;  1RFA A;  3PRE A;  1V49 A;  1YQ3 B;  3RUI B;  2MSE D;  2IY0 B;  4BOZ B;  3NHE B;  2CHX A;  3ZXV A;  4CHK A;  2NVU I;  3ENE A;  4XYC A;  4ZRP A;  1ZPS A;  4P16 A;  3KYD D;  2QMT A;  3D32 A;  4REZ A;  4D2K A;  4II3 B;  3U2S C;  3VUW A;  2FAZ A;  1N62 A;  3BY4 B;  2KVZ A;  4K1R B;  2K8C A;  1QZE A;  3JSV B;  2V4L A;  1FCL A;  1FXA A;  4M0W A;  4LNK A;  3AXC A;  2L1A A;  2MH7 A;  2L8J A;  2JT4 B;  4HVB A;  5EE3 A;  2D3G A;  1FFU A;  3W9C B;  4ZRI A;  2ZZP B;  4WIP A;  2BPS A;  2CHW A;  2IGG A;  3Q14 C;  3PRM B;  4HPM B;  4ZRJ A;  2BW2 A;  1DOX A;  2KXJ A;  1SJE D;  2MP2 B;  2DAF A;  2AQ2 B;  2NTS A;  3GP7 A;  5CHV C;  1JAL A;  4RF0 A;  2HE7 A;  3NJT A;  2N9L A;  1G6J A;  5AEK B;  4FUL A;  2FCN A;  3WAL A;  4W9J A;  4FJV B;  1I4R A;  4XGA B;  2WP9 B;  1FIQ A;  1C4P A;  4MT5 A;  2M56 B;  2M19 A;  3IT4 B;  4LNN A;  3I63 C;  1CJE A;  2MHJ A;  4L1B A;  4NZL B;  4TQ1 A;  1FCC C;  4WWO A;  1UZX B;  4GB9 A;  2BQQ A;  3RNF C;  1C1Y B;  4PT5 A;  4MH0 E;  1TTN A;  1SE3 A;  2K22 A;  3RT3 B;  5HKH A;  2XEW A;  3W1Y A;  1PGA A;  4LLG M;  3T9L A;  3M3J A;  2QHO A;  1VRA B;  2EMT A;  2J42 A;  2K6Q A;  2QIE B;  1WJ4 A;  3NZ3 A;  5IOI A;  2L0F A;  4KX6 B;  2WXQ A;  3S2A A;  1TKG A;  3NS1 A;  4IUM B;  1ESF A;  3EC8 A;  3TMP B;  2I38 A;  1VDV A;  2WDV B;  3QCA A;  4QAY A;  2CHZ A;  2G4S A;  3TSS A;  1JQ4 A;  2D3A A;  3DVG Y;  3TEY A;  4EE2 A;  3H1U A;  4WAA A;  4HKQ A;  2KFJ A;  3KQ4 A;  5H92 C;  4AJW A;  2JX5 A;  3M63 B;  3DHG C;  2DYM A;  4MSQ B;  3KWL A;  1KH0 A;  2KWU B;  1ET9 A;  3A9J B;  2FCM A;  1MG4 A;  3Q8F A;  1WY8 A;  1OQQ A;  3AH7 A;  3L4P A;  4RGM A;  2WS3 B;  2IO0 B;  2KOX A;  2BS4 B;  3P4R B;  4EZL A;  2RDB C;  1J7B A;  3R7R A;  2WXH A;  2LVO A;  2D3C A;  2WWZ A;  3I3T B;  4K7S A;  3AE4 B;  1C78 A;  4AJY B;  1C4A A;  2QJL A;  4NQK E;  4XZ4 A;  4P1B C;  1VR9 A;  4I6L B;  3AN1 A;  1RFK A;  5E6P A;  1EF1 A;  2MCN B;  1GC7 A;  2Z0E B;  4NQL B;  2L0T A;  3V60 A;  3B9J A;  1NI3 A;  2BF8 B;  3DPD A;  1M94 A;  2NBW B;  4MEM A;  3AE1 B;  1LGR A;  2L7R A;  1WRI A;  3P4Q B;  1STE A;  3P4P B;  4CO7 A;  2JPH A;  2AQ1 B;  2DZM A;  2N9P C;  4WJN A;  3UI3 A;  2BKR B;  4OZC A;  1BUI C;  2NCN A;  1I4H A;  2JXX A;  3DQV A;  3ML8 A;  3NG0 A;  3TUO A;  3TL5 A;  4AUQ C;  3ZQ4 A;  3ZRF A;  1FNV A;  1WX7 A;  3ZVV A;  3NVZ A;  4EFO A;  2UU7 A;  3R2I A;  1V2Y A;  1WRD B;  2B76 B;  2C60 A;  3RUL A;  3NVV A;  2MRP A;  1DOI A;  4DK5 A;  4GDK B;  3HIZ A;  4ANV A;  3MTN B;  2X8X X;  2KVR A;  2MJ3 A;  1YMH E;  1Q0W B;  2KNB A;  1YN4 A;  3V62 A;  4W9D A;  4A90 A;  3QIJ A;  1ZKH A;  3DDC B;  1UD7 A;  4YT0 B;  2W55 A;  4BBN F;  2RSU A;  3JSV A;  5GXG B;  4M8M A;  3WAP A;  4YSY B;  1WE6 A;  2JRI B;  4MH8 A;  4JIO U;  2KYW A;  4M00 A;  4IOI E;  4KSK C;  2QCZ A;  5HI1 A;  2MA9 B;  2QDF A;  2KX3 A;  4RFB A;  1QOA A;  3HHM A;  1B9R A;  1J0G A;  2SAK A;  3BII D;  2N0S B;  1YX5 B;  2KKC A;  5FR3 A;  1OEY J;  2L32 A;  4FJY A;  4YXD B;  4IWO A;  1WJN A;  4BFR A;  4ZRQ A;  2IO1 B;  2HJ1 A;  2IO2 B;  3DBR I;  2WXO A;  2MBB B;  1TS5 A;  2J4X A;  4W9E A;  1GB4 A;  2DBY A;  1C9F A;  3ZXR A;  5D6J B;  1FXT B;  2KWC A;  3M95 A;  2W54 A;  2K5P A;  3AV8 A;  3DCG A;  3ALB A;  3Q2A C;  2YVC A;  1QOG A;  2KDM A;  4ZYS A;  3AEG B;  1YJI A;  1E5W A;  4RGO S;  1V1P A;  2YEP F;  3I5J C;  2K9X A;  4MGY E;  3M62 B;  5C1Z A;  3VUX A;  1NI2 A;  3LXF A;  2Z59 B;  2BBC A;  2IO3 B;  4P6V F;  4N59 A;  2V0G A;  3P4S B;  1GNU A;  2RPQ A;  2LGY A;  1AW7 A;  3U7D A;  3EA6 A;  3C19 A;  1YJJ A;  3ZNG C;  1SIF A;  4LK0 M;  1WF9 A;  1E90 A;  2BYE A;  2KMC A;  3BIN A;  1WR1 A;  4W9K A;  2C7N B;  3DBL B;  3TEZ A;  3KUC B;  3RCZ A;  4N58 A;  3AEB B;  1MI0 A;  3U4E G;  2MP2 A;  1K8R B;  4HLE A;  1PDX A;  3R2T A;  2HJ8 A;  1OGW A;  3Q3N C;  1V5T A;  3AED B;  3KH0 A;  1L6U A;  3CF6 E;  3FKY A;  3W2D A;  2WU2 B;  1IGC A;  5MPO A;  2MEK A;  2CU3 A;  1KM7 A;  3AU4 A;  1AAR A;  3P2B A;  4HRS A;  2BYT A;  2JWZ A;  5D3I B;  1LQB A;  2KWV B;  4GN1 A;  4GOC A;  1L2N A;  3CST A;  3TEW A;  3DVN V;  2M17 A;  3WAN A;  1L0Y B;  2DZJ A;  1HTQ A;  4B9K A;  2KD0 A;  2LHD A;  1XLQ A;  1JRO A;  4RMA A;  1QKZ A;  1JWU D;  2L83 A;  3LJ3 A;  4JWU C;  1XO3 A;  4URK A;  2BS3 B;  1SB3 C;  2XN9 C;  1FD6 A;  5IN7 A;  3UF8 A;  3ETR A;  5J2R A;  4C56 C;  1FO4 A;  4GIV A;  1V1O A;  1R4N B;  3ZLZ A;  4HEA 1;  1N5X A;  4PS3 A;  4NJC A;  4B0E A;  3H7P B;  4RCO A;  1CMX B;  4FN2 A;  4WWP A;  5TSS A;  3ZO5 B;  4YTM B;  2KDI A;  2LEK A;  5G5G A;  3AE6 B;  1VZ7 A;  2LWP A;  4H2A A;  3IFW B;  2KK8 A;  2WXJ A;  2JYE A;  4AS1 A;  3LB8 C;  4JE3 B;  3EEC A;  3RZW C;  2LJ5 A;  2GBK A;  1V81 A;  1I4G A;  2VH1 A;  3QK0 A;  4HPL B;  4ZYN A;  3IG3 A;  3VTU A;  3IAS 1;  3ECI A;  1MVK A;  3VR8 B;  1QF6 A;  3R66 C;  2DNF A;  3DWM A;  2K39 A;  1Z5S B;  3PV1 A;  1TZ1 A;  4TUU A;  3ML9 A;  1JRU A;  2LUE A;  2WXR A;  3IVF A;  1FMA D;  1B1Z A;  1D6E C;  1WGG A;  1YJ1 A;  4A9A A;  2FUG 1;  2WXK A;  1TS2 A;  1XF5 L;  1V86 A;  2LVQ A;  5BO4 B;  2NBU A;  2R2Q A;  1SF0 A;  2KDB A;  1GC6 A;  1T6B X;  2G1E A;  4KIK A;  1HEZ E;  2WXN A;  2KQ7 A;  3ZJT A;  1EWY C;  5JZE B;  3NZU A;  1Q5W B;  1AYF A;  4HCP B;  1JW9 D;  3PPA A;  4HPP A;  4NAW A;  3AEF B;  2DYO A;  2PJH A;  3AEE B;  5CTR C;  2INC C;  1WXQ A;  4AP4 C;  3R3M A;  4WJP A;  1D5X C;  2KLC A;  1L6V A;  2PLP A;  1K51 A;  2FCQ A;  1KTK A;  2N1W A;  4US9 A;  1XLO A;  2O6V D;  3HK0 A;  1E8X A;  4YWG G;  2KMA A;  1IP9 A;  3RPF C;  1XLP A;  3MHZ A;  3QAR A;  1F2R I;  2IDY A;  2KDE B;  2GLS A;  3AEA B;  2ZPY A;  4J6I A;  4EZJ A;  1WX9 A;  2VH2 A;  3A9K A;  4B95 A;  3Q3M C;  2GI9 A;  4W9L A;  3CMM B;  4EUT A;  1MPE A;  1WYW B;  3V6E B;  1MJD A;  1WH3 A;  1XEE A;  2N9X A;  2C7H A;  5EE9 A;  5L95 C;  2WX1 A;  1N60 A;  4ITK A;  4N9F 4;  1E9M A;  1J19 A;  2MBQ A;  1CZP A;  1WXA A;  1E7U A;  1P98 A;  4LNO A;  1TY2 A;  4W9G A;  2J52 A;  3RI7 C;  1MG8 A;  4A55 A;  2OJW A;  1AN8 A;  2LD9 A;  2YLM A;  3ZDT A;  3KWV A;  3SD5 A;  1GB1 A;  4ANX A;  4BKS A;  1P7E A;  4HDQ A;  4G0N B;  1SSN A;  3RD2 A;  1RYJ A;  3BYY B;  3TEX A;  3RNC C;  2ZNV B;  4ARC A;  3Q8B A;  3IAM 1;  2ZPN A;  4A8X C;  2N1V A;  4JGH B;  4OVZ A;  2PE9 A;  2FID A;  3APD A;  1TGZ B;  3ZRC A;  5IO9 A;  3ZNI D;  1PGX A;  4YTP B;  1WZ3 A;  1V9J A;  2BKF A;  2QEJ C;  1M4V A;  2JZ3 B;  2KO3 A;  1T5X D;  2LI5 A;  3RNE C;  3MJW A;  1SGH A;  2WXG A;  2WXM A;  2NMQ A;  3U8Z A;  2FE8 A;  4EOY A;  3KYC D;  3Q8E A;  4I6N B;  3SU8 X;  3L54 A;  2QC8 A;  2JUO A;  1NEK B;  4XDC A;  1GUA B;  3Q69 A;  1R4N I;  2WHI A;  1RWS A;  1ZDV A;  1ZXI A;  3AB5 A;  1V97 A;  2CJN A;  3HVZ A;  2KTR B;  4KGR A;  3URY A;  1BXT A;  2RGF A;  1E7P B;  2W9N A;  3RNA C;  2OED A;  4DHZ B;  1J8C A;  2O6V A;  4JL9 A;  4DHZ E;  3B08 A;  4KSL C;  4YL8 A;  3N1Z C;  4WJO A;  3DVN U;  3LDZ E;  5BMG A;  2IYD B;  4MEL A;  1N6Z A;  1P3Q U;  1D5M C;  1TIF A;  5IKC M;  2ACZ B;  3DBH B;  2J0J A;  1L4D B;  2N7D A;  3A4S C;  2IJ0 A;  3O65 B;  4TQ0 A;  4BKG A;  4S0R A;  3IHP C;  3WCQ A;  4HJK A;  5E6O A;  2V3P A;  3PZD A;  1EWC A;  1EF5 A;  4FAD A;  3BVZ A;  1QLB B;  5AUK A;  3ZJU A;  4F1S A;  3Q3O C;  2DZK A;  4LNF A;  2V3N A;  2JQR B;  1C77 A;  2N9K A;  3OJ4 B;  2BB5 A;  3ZTC A;  2WXP A;  1AWD A;  3L08 A;  1L0V B;  4PYZ A;  1OFF A;  4IDI A;  1UGJ A;  1SBB B;  3VTW A;  1SXT A;  5G2N A;  3ZDM C;  5FK9 C;  1C4C A;  3Q3J A;  2LXC A;  2KJH B;  4GDL A;  1F0Z A;  2M0A A;  1KRH A;  5E6N A;  1DOY A;  2KTR A;  3P1M A;  2ZCC A;  3MC8 A;  1FRR A;  1D3Z A;  3EHV A;  1WGD A;  1ZUD 2;  4NPN A;  4RGT A;  3N30 A;  2KMM A;  3IT6 B;  1KOT A;  4WAF A;  2WU5 B;  3AE2 B;  3BVG A;  1YQB A;  2VRR B;  3WA0 A;  4II2 B;  2V9H A;  3AU5 A;  4TKN A;  3CIR B;  4XC2 A;  3QA8 A;  2KFK B;  2MBE A;  1ENF A;  5D2M B;  2I2Y A;  1P9D U;  1WI0 A;  1ROE A;  4GGQ A;  4W9H A;  2NBV B;  2JU6 X;  1XLN A;  1XCQ L;  3ZIM A;  1ET6 A;  2PE6 B;  4MGK E;  4EEW A;  1I7H A;  2Y5P A;  3A33 B;  3X0W A;  4EZK A;  2IND C;  3PO0 A;  4NNJ B;  3NZS A;  1XXG A;  1IBX A;  2D11 A;  2EKI A;  1SE9 A;  1ZW7 A;  4M0W B;  1UNS A;  5HFY A;  4FHJ A;  1SIJ A;  1V6E A;  4DBG A;  1IGD A;  2K1F A;  3UQA A;  4G50 A;  1MHX A;  1FRD A;  1QOB A;  3GOE A;  3PZ7 A;  1TKY A;  1I4Q A;  2L3Z A;  4WQO B;  3HUI A;  5H8Y E;  4RM9 A;  1F1H A;  1KLU D;  1ZOY B;  4GLS C;  2KJR A;  3B1L X;  2ZEQ A;  3QX1 A;  4MJS B;  4KGS A;  3SDL C;  2WX0 A;  2KC1 A;  2PVG C;  3MFG A;  1WYG A;  3W5U B;  1I35 A;  2KDF B;  3QHT A;  4FHK A;  2BS2 B;  3VVW B;  2V1Y A;  2QSD A;  2WDT B;  2ZVN A;  3I9V 1;  2XBB C;  1WGK A;  3DHI C;  3H7P A;  1HQR D;  5LNK 1;  3BZD B;  4JPS A;  4AQ7 A;  2L00 B;  3R7Q A;  1OEY A;  2LMC A;  5CHW A;  1E8W A;  4YTN B;  3DBH I;  4OW0 A;  1WIA A;  1E0Z A;  2NS5 A;  2KQS A;  2C5L C;  3VTV A;  1JCK B;  2A5U A;  1TS3 A;  1EU3 A;  4GXB A;  1J7C A;  4KZC A;  5G5H A;  5T8I A;  4DXG A;  2JVC A;  3RNG C;  4LJP B;  2KJ6 A;  3PGE A;  4TSS A;  4WWM A;  5FKA C;  3UGB B;  3MC9 A;  1ISN A;  2FCS A;  2JY6 A;  1N61 A;  3KVF B;  1WGR A;  3L13 A;  1YOV B;  4E3C A;  2Y3A A;  3PT2 B;  1QT9 A;  2Z8L A;  3WIM A;  1QIL A;  3P63 A;  4MSM B;  5D3D A;  3AE5 B;  3GB1 A;  3PZ8 A;  4MJS A;  2NR2 A;  3UIO B;  3H8H A;  4RH6 A;  2LRW A;  1JML A;  1T0Q C;  2KLG A;  5CX3 A;  2IGD A;  1EM7 A;  4YSX B;  1LM8 B;  3W1S C;  3B2G A;  2BYF A;  2HDE A;  2O6V B;  1WMH A;  1WR6 E;  5IA7 A;  4EKU A;  2AYO B;  4KKJ A;  4F7Z A;  4BVU C;  3PHX B;  2E6X A;  1DYQ A;  3PS6 A;  2RR9 A;  2WXF A;  4PYU A;  2KHW B;  4M01 A;  3ZTD A;  1JWB D;  3GZN B;  5G55 A;  4BBN C;  2AX5 A;  3H7S A;  4A3O A;  1L7Y A;  1UBQ A;  2MW5 A;  3BWU D;  3E9S A;  4GDK A;  3KW5 B;  2YEP B;  3W5V B;  2KAC A;  1P7F A;  2DWQ A;  4OZB A;  2AQ3 B;  3EFU A;  4W9I A;  3DHH C;  2DX5 B;  4A20 A;  5CHF A;  4DHJ B;  4L23 A;  1WXV A;  3DWG C;  4USA A;  2RD0 A;  2D07 B;  2KZR A;  2N7J A;  3MHS D;  1MHH E;  3TIX A;  4PS8 A;  2Z0D B;  3AUL A;  2KX0 A;  4JX1 C;  2VZK D;  1QOF A;  3HM6 X;  4ZDV A;  4XWT A;  3RMK C;  5BYQ A;  3SR6 A;  3QC8 B;  2QIL A;  1UBI A;  2GBJ A;  3N1Y C;  2LXA A;  2DLB A;  4J3O D;  5EE0 A;  1EO6 A;  1BML C;  1TZO A;  3I57 A;  1KLV A;  3AM9 A;  5LLI A;  3B0A A;  4KV2 A;  1NYQ A;  2IGH A;  1UUP A;  1QQR A;  2KQ4 X;  2IBI B;  2D2Q A;  1GJZ A;  2BVC A;  4PS7 A;  2H89 B;  1RM6 C;  4FA6 A;  4BAX A;  4MDK E;  1NEN B;  2V4I B;  4WJQ A;  2FNJ B;  3WAM A;  2RMM A;  4AWJ A;  5HG2 A;  3H9D A;  5BMH A;  3GE8 C;  1YN3 A;  3AE7 B;  2W82 A;  1OQR A;  2WDR B;  4I6P A;  1IYF A;  4M02 A;  1YNT E;  4HRO A;  1WE7 A;  2OOB B;  3VH4 B;  1WZ0 A;  4K7U A;  1D4B A;  1OTR B;  4HKZ E;  1CQV A;  1JWM D;  2JXT A;  1NBF C;  2PIA A;  3VXW A;  4BKS D;  3VFK A;  4XDD A;  4KDL B;  1T3Q A;  4NAW B;  3ZW3 A;  1VJK A;  1VD2 A;  1Y56 A;  2BT6 A;  2TSS A;  4RF1 A;  1HTO A;  4NJ7 A;  2IZV B;  2N4F A;  1T0R C;  2INP E;  3RYT A;  3JVZ X;  5HHD G;  2L76 A;  2HTM E;  1H4R A;  4C4V A;  5AZF A;  3N32 A;  1XCT L;  3RFZ B;  2R61 A;  2A4Z A;  2VZK B;  2L05 A;  2M1M A;  1XT9 B;  3A1Q B;  2LZ6 A;  4GMV A;  3NY5 A;  3N3K B;  4PK1 A;  4S17 A;  2CJO A;  1U4A A;  1E6E B;  2KFK A;  1V80 A;  1WM3 A;  4DDI D;  2BGF A;  4DHJ D;  2K8B A;  1KLG D;  2K6D B;  2UWQ A;  4DWF A;  1FPY A;  3VAW A;  3V3X A;  3O13 A;  1P0R A;  3A9K B;  4MAC A;  3VR9 B;  3VDZ A;  1YD8 U;  2GBR A;  1XQQ A;  4ZHP A;  1L5P A;  3MP9 A;  1UWM A;  2UYZ B;  2L52 A;  4M8N A;  4CQN A;  1GPX A;  2C7M B;  2PPH A;  2C9W B;  2M8S A;  5BYS A;  2JSV X;  4IW0 A;  1F52 A;  4X57 B;  3GZN I;  3OWE B;  3MJ5 A;  2ZJD A;  1D5Z C;  4KDI C;  4B0M A;  3VH3 B;  2XK5 A;  3V6C B;  1IPG A;  5DPR A;  1S1Q B;  4C7Y A;  5J17 A;  2MJD A;  4F8C B;  3L10 B;  2BYV E;  4IWP A;  2O2V B;  2NPT B;  2CR5 A;  5AZG A;  2WYQ A;  1E10 A;  2M4N A;  2PMV A;  4GU2 A;  3ZUN A;  3C8Y A;  5LXH A;  1FEH A;  1HZ5 A;  2XNA C;  3B2F A;  5J18 A;  3ZKJ C;  2V3S A;  2IPK D;  1WJ6 A;  1IBX B;  4ICV A;  1C3T A;  3APF A;  4N6E B;  2BWF A;  3K9O B;  5KHQ A;  1FNU A;  5BYR A;  3APC A;  3NS8 A;  3RN9 C;  4BOS C;  2J7Q B;  2GB1 A;  3N1X C;  3V61 A;  3Q8C A;  4LDT B;  3KUD B;  3EUB 2;  1MFW A;  2LUM A;  2KWD A;  3EFC A;  4W9F A;  2B3A A;  4WUR A;  3RNB C;  4MGI E;  4IM2 A;  1E8Y A;  4G3X B;  3PLV A;  3BK2 A;  2Y5C A;  1VZ6 A;  2XK5 B;  5C3J B;  5LXI B;  2ICI A;  3EGR A;  1KF6 B;  3ZNH B;  3AEC B;  3BYT B;  1ZGU B;  1C79 A;  4BZA A;  5EDS A;  2D10 A;  5EE1 A;  2NPT A;  3KUZ A;  3UQB A;  2MX2 A;  4C7Z A;  1YN5 A;  4HWI B;  1YX6 B;  2K8H A;  2KTF A;  3U7Z A;  2W3R A;  4KVG B;  3A4R A;  3VQI A;  1WM2 A;  2LJI A;  1RAX A;  3LYY A;  3AE3 B;  2N9E B;  2DHZ A;  4GDL B;  2ASQ A;  2LGI A;  3WAO A;  1R4M B;  1CK1 A;  4KZ0 A;  3HRD D;  5D94 A;  2OJR A;  4ACF A;  2M0X A;  2LHE A;  1Q1O A;  4LDT D;  5TR5 A;  1PUT A;  4L2Y A;  3X23 A;  5BMI A;  4IM0 A;  1WX8 A;  3CWI A;  3UIN B;  3C0R B;  3IXS A;  2ZNV C;  2ON8 A;  2JZP A;  4IWQ A;  4C80 A;  2WDQ B;  4IG7 B;  2WQY B;  2DYB A;  4XE0 A;  1ZDX A;  2LRU A;  1L0X B;  4C4V B;  2WXI A;  3L17 A;  2GRI A;  4E71 A;  5C23 A;  4FBJ B;  1NDD A;  4LJO B;  3QQ8 B;  1SJH D;  5D7G A;  3E56 A;  2W3S A;  3DOW A;  2LAS A;  3OG5 A;  5C2T B;  5KHO A;  3FC4 A;  1GAQ B;  1WSP A;  3T3N A;  2LGD A;  3DBR B;  3HM3 A;  1VLB A;  4KGT A;  1S3S G;  3GE3 C;  1T0S C;  2OHF A;  3AI5 A;  1WXS A;  2PEA A;  4ASW C;  2FBW B;  3PVL A;  4HDO A;  2RPV A;  2ZVO A;  2DEN B;  1UH6 A;  2CU1 A;  5AUI A;  4P7I A;  2D5G A;  4DDG D;  1KJT A;  4YSZ B;  3DBL I;  2JZZ A;  2JWU A;  1ZE3 D;  3NRZ A;  2G4D B;  4US8 A;  1TJE A;  2EEL A;  2EMS A;  4HXD A;  5IAA C;  1Y8R C;  3JW0 X;  1N63 A;  4ZRK A;  2Y5B B;  4IKG A;  4ANW A;  4RGN A;  2MLB A;  3NUH B;  3SFE B;  1A5R A;  5JHA A;  4HCN B;  1I4P A;  4A6Q A;  4KIK B;  4IC7 B;  1GG3 A;  3PRZ A;  2DZI A;  2WXL A;  3PRP B;  3ZNZ B;  2PW9 A;  4MM3 B;  2BWE S;  2INN E;  1P1A A;  4OZA A;  2MQJ A;  3VRB B;  3NVW A;  5GMV A;  2G9H D;  1XD3 B;  3AMZ A;  4CYE A;  5DPW A;  1I42 A;  1LO5 D;  1UEL A;  4P1C C;  2MBH A;  3P42 A;  1RRB A;  1I4X A;  3OAW A;  1PQS A;  1X1M A;  3TCA A;  4RNA A;  1SE2 A;  2G45 B;  2WNM A;  1K53 A;  2KN4 A;  1RLF A;  4NJ6 A;  4UDU C;  4K81 A;  4LTU A;  5AZH A;  1LFD A;  1WXM A;  3V05 A;  3K9P B;  3Q8A A;  4HK2 A;  2GBN A;  3PLU A;  1HA5 A;  2GMI C;  4W9C A;  1L4Z B;  3PSE B;  5DPT A;  1VCB A;  4K7W A;  3HVD A;  1E8Z A;  3FIL A;  2CS4 A;  5E6J A;  1HXY D;  2ZW1 A;  4FJZ A;  3ZYY X;  1TT5 B;  1JWS D;  2J53 A;  4G11 A;  4ANU A;  1NVI D;  4JLC A;  4B6W A;  1NYR A;  3N9Y C;  4WH4 A;  3ZJV A;  1F77 A;  1YQ4 B;  2FIF A;  4RM8 A;  2BTE A;  2MJE A;  1KFY B;  4ARI A;  1FXI A;  2CKH B;  3BVM A;  2D3B A;  3R8B A;  2EKE C;  1TBE A;  2G3Q B;  3FAH A;  3GS2 A;  4K3C A;  2O2V A;  3DBS A;  3MC0 B;  2IY1 B;  3SEB A;  2REX A;  2NTT A;  1SE4 A;  4XX5 A;  4A3P A;  4FXC A;  3SFD B;  4JQW C;  3QWZ B;  2HD5 B;  3SHQ A;  1V8C A;  3QJZ A;  4IM3 A;  2RDG A;  2SEB D;  4XWW A;  2Q5W D;  1FFV A;  2K25 A;  1HZ6 A;  1FNW A;  5IP4 D;  2I1J A;  4C00 A;  2MBO A;  2KAN A;  1UGM A;  1Z2M A;  3FIL B;  1F9J A;  2X38 A;  4R3D A;  1WMH B;  1HE8 A;  2LGS A;  4DXA B;  2WGS A;  4OHJ A;  3AE9 B;  1FM0 D;  4MM3 A;  2JRH A;  4AOF A;  1K52 A;  2H88 B;  2KC2 A;  4LNI A;  3N20 C;  4NY0 A;  1WGH A;  3L16 A;  3U30 A;  5L83 A;  3JYU A;  2I1K A;  3CSF A;  1ZXH A;  5FR6 A;  3ONS A;  2ZCB A;  3NOB A;  1Q10 A;  4KKI A;  4WQM A;  1TY0 A;  3W1S A;  2JF5 A;  2LVP A;  4OVU A;  3Q6B A;  1J7A A;  3VHT C;  4ZOH C;  1R4M I;  4NAM A;  1PYW D;  4OVV A;  2ONQ A;  1EU4 A;  1PFD A;  2PTL A;  1VZ8 A;  2WLB A;  3A1Q A;  4GSW A;  3DVG X;  3Q3F A;  1V1P B;  1K50 A;  4Q2J A;  3VRA B;  4LCD E;  3BK1 A;  3QAQ A;  3RZF A;  1WWT A;  1BT0 A;  2BB6 A; 
#chains in the Genus database with same CATH homology
 2YEP F;  2K9X A;  1FRR A;  4HJG E;  2KAJ A;  4ZHO A;  1ZUD 2;  5BYS A;  3LXF A;  2JSV X;  4RGT A;  2BBC A;  2LFI A;  4P6V F;  3NVY A;  4N59 A;  2KMM A;  2V0G A;  2PKO A;  3P4S B;  3IT6 B;  4WAF A;  3OWE B;  3MJ5 A;  2WU5 B;  3AE2 B;  3ABV B;  1F2R C;  1GOZ A;  3BVG A;  1D5Z C;  3U52 E;  1AW7 A;  4O1N A;  4B0M A;  3EA6 A;  4TMA B;  1YJJ A;  4LK0 M;  1TKE A;  3CIR B;  2E3T A;  1ENF A;  4C7Y A;  1N5W A;  3TEZ A;  2I2Y A;  4N58 A;  3AEB B;  1MI0 A;  2MJD A;  3U4E G;  3T3O A;  1ROE A;  1GPX A;  1DGJ A;  2JU6 X;  3J9C A;  1PDX A;  1XLN A;  1XCQ L;  3R2T A;  4JWS C;  2K3U A;  1ET6 A;  4DQO C;  1E10 A;  1SEB D;  2PMV A;  3AED B;  1I7H A;  1PGB A;  2Y5P A;  1ZP0 B;  3C8Y A;  1FEH A;  1HZ5 A;  1L6U A;  2RDH A;  2XNA C;  3B2F A;  1R7S A;  3PO0 A;  3W2D A;  2WU2 B;  1IUE A;  1XXG A;  1IGC A;  5MPO A;  2IPK D;  2MEK A;  4DXF A;  1IBX A;  1IBX B;  2CU3 A;  1TYG B;  2EKI A;  4N6E B;  1A70 A;  4HRS A;  2BYT A;  3KLS X;  1UNS A;  1FNU A;  5BYR A;  3ZGZ A;  5HFY A;  2JYT A;  1SIJ A;  5D3I B;  1IGD A;  1UWX A;  1JWA D;  2PVO D;  2GB1 A;  3TEW A;  1MHX A;  3Q8C A;  1FRD A;  1L0Y B;  1QOB A;  1ACC A;  1TS4 A;  3EUB 2;  2LUM A;  3PZ7 A;  2KWD A;  1I4Q A;  1TKY A;  4WUR A;  2LHD A;  3HUI A;  1XLQ A;  2K0P A;  1JRO A;  2ZW0 A;  5H8Y E;  1JRP A;  1QKZ A;  5I4D A;  1JWU D;  2L83 A;  4JWU C;  5JXV A;  1KLU D;  1C76 A;  3AE8 B;  3BK2 A;  1XO3 A;  1ZOY B;  2BS3 B;  2Y5C A;  4GLS C;  1VZ6 A;  1SB3 C;  2XN9 C;  1FD6 A;  1YQ3 B;  5C3J B;  2ICI A;  3EGR A;  3ETR A;  1KF6 B;  4KGS A;  3AEC B;  3BYT B;  4C56 C;  1FO4 A;  1V1O A;  2PVG C;  1C79 A;  4ZRP A;  4HEA 1;  1N5X A;  3MFG A;  1WYG A;  1ZPS A;  4NJC A;  4P16 A;  5EE1 A;  3W5U B;  4B0E A;  4RCO A;  2QMT A;  4C7Z A;  4REZ A;  1YN5 A;  4D2K A;  2BS2 B;  5TSS A;  2QSD A;  3I9V 1;  3U2S C;  1WGK A;  2W3R A;  3U7Z A;  4YTM B;  3VQI A;  1HQR D;  5LNK 1;  1N62 A;  2LEK A;  2LJI A;  3BZD B;  5G5G A;  3AE6 B;  4JPS A;  1VZ7 A;  3LYY A;  3AE3 B;  4AQ7 A;  4GDL B;  4H2A A;  2WXJ A;  2LGI A;  2JYE A;  2LMC A;  1CK1 A;  3HRD D;  4AS1 A;  1FCL A;  3LB8 C;  4JE3 B;  1FXA A;  4YTN B;  4M0W A;  2LHE A;  1I4G A;  4OW0 A;  2L1A A;  2MH7 A;  1E0Z A;  1PUT A;  4L2Y A;  1JCK B;  5EE3 A;  5BMI A;  1FFU A;  3IAS 1;  3W9C B;  1TS3 A;  1MVK A;  3CWI A;  3VR8 B;  1EU3 A;  1QF6 A;  4WIP A;  3DWM A;  1J7C A;  3IXS A;  5G5H A;  2IGG A;  5T8I A;  4DXG A;  2ON8 A;  2BW2 A;  2JZP A;  2WXR A;  1DOX A;  1FMA D;  4C80 A;  1B1Z A;  1D6E C;  2WDQ B;  4WWM A;  1SJE D;  4TSS A;  2FUG 1;  5FKA C;  4A9A A;  2WQY B;  2WXK A;  1TS2 A;  4XE0 A;  1N61 A;  1XF5 L;  1ZDX A;  2AQ2 B;  2NTS A;  3GP7 A;  1L0X B;  2Y3A A;  1JAL A;  4RF0 A;  1SF0 A;  1QT9 A;  1T6B X;  2G1E A;  2N9L A;  2WXI A;  2Z8L A;  1HEZ E;  2WXN A;  2GRI A;  3ZJT A;  1EWY C;  1I4R A;  1QIL A;  3P63 A;  2WP9 B;  1FIQ A;  1C4P A;  5D3D A;  1AYF A;  4MT5 A;  3AE5 B;  3GB1 A;  3PZ8 A;  2M56 B;  3H8H A;  1JW9 D;  2M19 A;  3IT4 B;  4RH6 A;  1CJE A;  1SJH D;  4L1B A;  1JML A;  4NZL B;  5D7G A;  3E56 A;  2W3S A;  3AEF B;  1FCC C;  4TQ1 A;  2DYO A;  5C2T B;  3AEE B;  1WXQ A;  3FC4 A;  2IGD A;  1GAQ B;  1WSP A;  3T3N A;  1D5X C;  4PT5 A;  1EM7 A;  4YSX B;  1VLB A;  1L6V A;  2PLP A;  3B2G A;  4KGT A;  2OHF A;  1SE3 A;  1K51 A;  1KTK A;  2HDE A;  2K22 A;  4US9 A;  2FBW B;  1XLO A;  2RPV A;  1PGA A;  4LLG M;  4KKJ A;  5AUI A;  4YWG G;  3RPF C;  1XLP A;  3MHZ A;  2D5G A;  1F2R I;  2IDY A;  1VRA B;  3AEA B;  4YSZ B;  2J42 A;  2JWU A;  1ZE3 D;  2QIE B;  2E6X A;  3NZ3 A;  3NRZ A;  1DYQ A;  4KX6 B;  4US8 A;  2WXQ A;  1TKG A;  1TJE A;  3NS1 A;  1ESF A;  2GI9 A;  2WXF A;  2EEL A;  2I38 A;  1MPE A;  1JWB D;  1VDV A;  1XEE A;  5EE9 A;  2WDV B;  1N63 A;  4IKG A;  4RGN A;  3NUH B;  3SFE B;  2AX5 A;  3TSS A;  1JQ4 A;  1N60 A;  4ITK A;  1I4P A;  4A6Q A;  4EE2 A;  3TEY A;  4HKQ A;  1E9M A;  3BWU D;  3E9S A;  3KQ4 A;  5H92 C;  2JX5 A;  2YEP B;  3W5V B;  2KAC A;  1P7F A;  1CZP A;  2DWQ A;  4OZB A;  2AQ3 B;  2DYM A;  2WXL A;  3KWL A;  1KH0 A;  2PW9 A;  4L23 A;  1TY2 A;  1ET9 A;  4MM3 B;  2INN E;  2J52 A;  3DWG C;  4USA A;  4OZA A;  3VRB B;  4A55 A;  3NVW A;  2G9H D;  1AN8 A;  3Q8F A;  2N7J A;  3AMZ A;  1OQQ A;  3AH7 A;  1MHH E;  3KWV A;  1GB1 A;  3L4P A;  1LO5 D;  4RGM A;  2WS3 B;  2BS4 B;  3P42 A;  3P4R B;  1I4X A;  1J7B A;  1P7E A;  4JX1 C;  2WXH A;  2VZK D;  1SSN A;  1QOF A;  1RYJ A;  4RNA A;  3AE4 B;  3BYY B;  3TEX A;  1C78 A;  1SE2 A;  1C4A A;  2QJL A;  2WNM A;  1K53 A;  2KN4 A;  1VR9 A;  4XWT A;  4ARC A;  3Q8B A;  3IAM 1;  5BYQ A;  3AN1 A;  4A8X C;  4UDU C;  4LTU A;  3SR6 A;  3V05 A;  2QIL A;  3Q8A A;  4OVZ A;  1RFK A;  1HA5 A;  2DLB A;  4J3O D;  1L4Z B;  5EE0 A;  3B9J A;  1NI3 A;  1BML C;  3HVD A;  3FIL A;  1TZO A;  3I57 A;  3AM9 A;  1PGX A;  3ZYY X;  5E6J A;  1HXY D;  2ZW1 A;  4YTP B;  3AE1 B;  1JWS D;  1NYQ A;  2J53 A;  2QEJ C;  1M4V A;  2IGH A;  1UUP A;  2KQ4 X;  1QQR A;  1NVI D;  1WRI A;  3P4Q B;  1STE A;  1T5X D;  3P4P B;  1NYR A;  2AQ1 B;  3N9Y C;  2H89 B;  1RM6 C;  4WH4 A;  3UI3 A;  4OZC A;  1NEN B;  2V4I B;  1BUI C;  3ZJV A;  1F77 A;  1YQ4 B;  2WXG A;  2RMM A;  5HG2 A;  1I4H A;  2BTE A;  2WXM A;  2NMQ A;  2MJE A;  1KFY B;  3TUO A;  2FE8 A;  4ARI A;  5BMH A;  1FXI A;  3BVM A;  3R8B A;  3Q8E A;  1YN3 A;  1NEK B;  4XDC A;  3AE7 B;  3FAH A;  3GS2 A;  3ZQ4 A;  3Q69 A;  2W82 A;  1FNV A;  1OQR A;  2WDR B;  3NVZ A;  1RWS A;  1ZDV A;  1ZXI A;  1YNT E;  3AB5 A;  1V97 A;  3MC0 B;  3R2I A;  2CJN A;  4HRO A;  2B76 B;  3HVZ A;  3SEB A;  2NTT A;  4KGR A;  3URY A;  1BXT A;  1SE4 A;  1DOI A;  3NVV A;  1E7P B;  1D4B A;  4GDK B;  4HKZ E;  1CQV A;  2OED A;  1JWM D;  2JXT A;  4FXC A;  3SFD B;  2MJ3 A;  1YMH E;  2PIA A;  1V8C A;  2RDG A;  2SEB D;  1YN4 A;  5BMG A;  4XDD A;  4A90 A;  1D5M C;  1T3Q A;  4NAW B;  4XWW A;  2Q5W D;  1VJK A;  4YT0 B;  2W55 A;  1FFV A;  1Y56 A;  2ACZ B;  2BT6 A;  2TSS A;  4RF1 A;  1HZ6 A;  5GXG B;  1FNW A;  1L4D B;  4YSY B;  2INP E;  4MH8 A;  3FIL B;  2IJ0 A;  5HHD G;  2X38 A;  4R3D A;  4IOI E;  2HTM E;  5HI1 A;  4TQ0 A;  1XCT L;  4OHJ A;  3WCQ A;  2R61 A;  4RFB A;  3RFZ B;  3AE9 B;  1FM0 D;  1QOA A;  1B9R A;  2V3P A;  2VZK B;  1EWC A;  1K52 A;  2H88 B;  2SAK A;  3BII D;  2N0S B;  5FR3 A;  3BVZ A;  1QLB B;  1V1P A;  2L32 A;  1ZXH A;  5AUK A;  2CJO A;  1E6E B;  4YXD B;  3ZJU A;  4ZRQ A;  1KLG D;  1Q10 A;  2V3N A;  2JQR B;  4KKI A;  4WQM A;  1C77 A;  1TY0 A;  2N9K A;  3W1S A;  2BB5 A;  2WXP A;  1AWD A;  1J7A A;  1L0V B;  2WXO A;  1OFF A;  4ZOH C;  4NAM A;  1TS5 A;  3V3X A;  1PYW D;  3O13 A;  2ONQ A;  2J4X A;  1GB4 A;  1EU4 A;  2DBY A;  4IDI A;  4MAC A;  1C9F A;  1UGJ A;  1PFD A;  1SBB B;  2PTL A;  1VZ8 A;  3VR9 B;  2WLB A;  1SXT A;  5FK9 C;  1C4C A;  2W54 A;  2K5P A;  3AV8 A;  4ZHP A;  1L5P A;  1V1P B;  1K50 A;  3MP9 A;  4Q2J A;  1UWM A;  3VRA B;  1QOG A;  2L52 A;  3BK1 A;  1F0Z A;  2KDM A;  1WWT A;  2M0A A;  3AEG B;  1KRH A;  4ZYS A;  1YJI A;  1DOY A;  3P1M A;  4CQN A;  4RGO S;  2BB6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...