3LB8C

Crystal structure of the covalent putidaredoxin reductase-putidaredoxin complex
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
104
structure length
104
Chain Sequence
SKVVYVSHDGTRRELDVADGVSLMQAAVSNGIYDIVGDCGGSASCATCHVYVNEAFTDKVPAANEREIGMLESVTAELKPNSRLSCQIIMTPELDGIVVDVPDR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase/electron transport
molecule keywords Putidaredoxin reductase
publication title Crystal structure of the putidaredoxin reductase x putidaredoxin electron transfer complex.
pubmed doi rcsb
source organism Pseudomonas putida
total genus 27
structure length 104
sequence length 104
chains with identical sequence D
ec nomenclature
pdb deposition date 2010-01-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00111 Fer2 2Fe-2S iron-sulfur cluster binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 3lb8C00
2WDRB 5G5GA 2MJDA 3LXFA 1QT9A 1ZUD2 1E6EB 2K9XA 2MJ3A 1AWDA 2M19A 4ZOHC 1IUEA 1RFKA 3AE9B 1JALA 1JROA 4YXDB 3NVYA 3BIID 3WCQA 3HVZA 3VR9B 2B76B 4ITKA 2L83A 3B9JA 3SFEB 4FXCA 4YTMB 1B9RA 1R7SA 2LEKA 1XLOA 1TKYA 3P4PB 3PO0A 1FMAD 4JWSC 1WYGA 4US8A 2W54A 3FAHA 1RM6C 1N5XA 1WXQA 2BS3B 2ACZB 4YTPB 2MJEA 1JQ4A 3B2GA 1RWSA 1PDXA 1KFYB 3AEEB 1L0VB 1E10A 5G5HA 2W3RA 1FXAA 1FXIA 1PFDA 2WP9B 3W5UB 1JW9D 2WDVB 1J7AA 1KF6B 1RYJA 4JX1C 5AUIA 2HTME 1EWYC 2MH7A 3NVWA 5EE0A 1DOYA 2CJOA 2H89B 3AE4B 1SF0A 1DOIA 2BS4B 3AMZA 3ZYYX 2M56B 5EE1A 3RPFC 1E9MA 3SFDB 3AE8B 3VRBB 3NVVA 2DBYA 1FIQA 1ZXIA 1QOAA 1V8CA 3AEAB 3AE3B 3KWLA 2CU3A 2Q5WD 3AEFB 2AX5A 2KMMA 1L6VA 1WGKA 5EE3A 1VLBA 2BS2B 1V97A 2Y5CA 2PVGC 2H88B 3LB8C 2WS3B 1YJJA 3P1MA 1KRHA 5C2TB 1FO4A 3ETRA 3AEDB 1SB3C 1TYGB 2FBWB 2QJLA 3HRDD 1SIJA 2QIEB 5AUKA 1A70A 3CWIA 4N58A 1T3QA 1NI3A 3AE6B 1QOFA 3P4RB 2PIAA 3B2FA 2L52A 4WQMA 2JQRB 4N6EB 1YQ3B 1FRRA 3AEGB 2JX5A 1FFUA 4YSYB 2WU5B 2PKOA 1XO3A 3L4PA 4A9AA 3VR8B 3AE5B 2CJNA 3ABVB 3AE2B 3AECB 4LTUA 1DOXA 3DWGC 2K22A 2WQYB 1ZP0B 1ZOYB 1AYFA 2DWQA 3EUB2 3P4SB 1CJEA 1FM0D 4C7YA 1OQQA 1N5WA 1UWMA 1CZPA 4IDIA 1NENB 1F0ZA 4KX6B 2WLBA 4C80A 3HUIA 1GPXA 4WWMA 1YJIA 3AM9A 1QOGA 2W55A 1XLQA 4ZHPA 2WU2B 4P6VF 1I7HA 3FC4A 2E3TA 2BT6A 3DWMA 1VDVA 1TKEA 2K5PA 5H92C 2OHFA 5H8YE 1NYRA 5EE9A 4C7ZA 4HROA 1QF6A 4YSXB 4YT0B 1FRDA 1QOBA 2N0SB 3AE1B 5MPOA 3AV8A 2WDQB 1N62A 1PUTA 3AEBB 2G1EA 3P4QB 1OFFA 3NVZA 4HRSA 5GXGB 3W5VB 4JWUC 4ZHOA 1QLBB 1OQRA 1J7CA 3VRAB 1TJEA 3SR6A 1DGJA 2KAJA 1XLNA 1L5PA 2EKIA 2PVOD 1N60A 3CIRB 1FFVA 3AB5A 3AE7B 3NRZA 2W3SA 1NVID 1XLPA 1JRPA 1YQ4B 1JWAD 3W9CB 3AN1A 1E7PB 3P63A 4YTNB 1E0ZA 1NEKB 5C3JB 1JWBD 3AH7A 1WWTA 1GAQB 4USAA 4YSZB 1L6UA 1WRIA 4N59A 1N61A 1NYQA 3NS1A 1TKGA 1ROEA 4US9A 1J7BA 1N63A 1VJKA
chains in the Genus database with same CATH superfamily
1PYWD 2L3ZA 3TEYA 1IPGA 1ZUD2 2KANA 2DLBA 2M0AA 2JSVX 3GZNB 2KLGA 3UIPB 5CHVC 4DDID 4HJGE 3R8BA 3ML9A 1R4MB 3SD5A 5HFYA 3TEXA 3V6EB 1J19A 1YNTE 3L17A 3SU8X 2RMMA 2CR5A 2HJ8A 1FXIA 4BVUC 5DPSA 2R2QA 1I4HA 4XWWA 3QK0A 4JPSA 1FCCC 1DOYA 1ESFA 2BS4B 1S1QB 2JXTA 1TTNA 2CU3A 2PEAA 3HK0A 4C4VB 1L6VA 1ET6A 1MFWA 4AJYB 1VLBA 2WS3B 2WXFA 2BTEA 2O6VA 2MBHA 1SIJA 2OJWA 3CWIA 2FNJB 1NI3A 3H7PA 5D2MB 5HHDG 2E6XA 4KIKA 4LNKA 3CF6E 2C7NB 1DOXA 2KHWB 1WJ6A 2V0GA 1ZP0B 2LI5A 4ZRKA 2KN4A 4II2B 1YOVB 5KHOA 1UZXB 3MC0B 3NHEB 3ECIA 4WWMA 2INPE 3DBHI 3W1SC 1QILA 1PGAA 4HDQA 4PK1A 1MJDA 2DZMA 1UNSA 4IWQA 3TSSA 2EKEC 2ZJDA 1EU4A 3R2TA 4KVGB 3V61A 4DHZE 3IAS1 3RNGC 2PVOD 2N9KA 4JGHB 2DENB 1KLVA 3A1QB 2B3AA 3Q8AA 4QAYA 3LDZE 1QZEA 3NOBA 4K1RB 3IAM1 3IHPC 1EUVB 1PGBA 1C79A 3LXFA 3BK2A 1F1HA 2M19A 2AEHA 3BK1A 2JZ3B 4L2YA 4ITKA 2NS5A 1EWCA 4KZ0A 4P1CC 2NBUA 4OZAA 4HK2A 1Y8RC 4A55A 2C60A 3FAHA 1UUPA 4BAXA 1KFYB 2RDBC 1P98A 4K3CA 4RF0A 2BKRB 2K8CA 3PLVA 2XK5A 2GLSA 3SFDB 3AE8B 2J4XA 1FIQA 4W9JA 1GC6A 1WMHB 1NDDA 2CHXA 3Q3FA 5E6NA 3AXCA 3N20C 1WXSA 1KRHA 2NTSA 3ETRA 3V62A 4K7UA 2QJLA 3MFGA 2ZEQA 2XBBC 2LZ6A 1EO6A 5DCNA 4WQMA 1N6ZA 4E3CA 2INDC 3R7RA 2QSDA 4IWPA 1YD8U 2BVCA 1SE3A 1TIFA 3WANA 2WLBA 2XEWA 1WM2A 3OWEB 4PT5A 4LJOB 4ZHPA 2KDIA 4ARIA 2GBMA 2KVZA 2L0TA 4DXGA 3IXSA 3JVZX 2WDQB 5DPRA 1PUTA 4HRSA 4ZDVA 2ZCCA 3KUZA 4ZHOA 1OQRA 3VRAB 2IDYA 4IWOA 4RH6A 3SR6A 2GOWA 2L05A 4YWGG 1NVID 3W9CB 5C1ZA 3APCA 1JWUD 2DZKA 3RZWC 2WXLA 4IG7B 1K52A 2YVCA 3PHWB 1JROA 4ZRIA 3A33B 1SJED 5L83A 2JY6A 3PS6A 2IZVB 2ASQA 2KFKB 2D07B 3JSVB 3AU5A 3RNAC 2ONQA 1SEBD 2JZZA 1V86A 3GB1A 1PFDA 3UINB 2Z59B 2LUMA 1ET9A 4CHKA 4TUUA 3B08A 3AE4B 2H89B 1V6EA 3RPFC 1E9MA 1R4NB 3ZNHB 4EZLA 1FPYA 2JZPA 1VRAB 4GN1A 3AEFB 2JWZA 2LGIA 2MW5A 2N1WA 1L0YB 4FA6A 3E56A 3RMKC 3GS2A 2I2YA 3BVGA 3V60A 4OW0A 2QMTA 3VQIA 5D7GA 2JQRB 1FRRA 1GOZA 5GMVA 3FKYA 2D3AA 2CJNA 2V3NA 2WXGA 1MPEA 2LVOA 1U4AA 3U8ZA 1ZOYB 2INCC 3Q69A 4DXFA 2JXXA 1CZPA 2K0PA 4N9F4 2K3UA 1XCTL 4NJ6A 1P7EA 2WGSA 1WX7A 2WXHA 1QOGA 3PV1A 2OOBB 2KWUB 4FLHA 2OHFA 3ZNID 4LK0M 2INNE 3K9PB 2BYFA 3P4QB 4G11A 4HLEA 2KAJA 2C7MB 2EMTA 3CIRB 1FFVA 3QA8A 1L4DB 4CYEA 1SE2A 3L0WB 1Z2MA 2K25A 2FCQA 4ASWC 1VZ7A 3I57A 2KQ4X 1WRIA 4W9HA 2HDEA 1D3ZA 2LHEA 1V5OA 4GB9A 5E6OA 2BYEA 2WWZA 3DVGX 1XCQL 1SGHA 3BVMA 1E90A 1C3TA 4YTMB 4OVUA 3B0AA 4ZYSA 4PS3A 4P1BC 4PS7A 3B2GA 1PDXA 1BXTA 1EF5A 1IGCA 1S3SG 2D3BA 1FXAA 3RFZB 4LNFA 2HJ1A 2FCMA 1VZ6A 3AMZA 3Q2AC 1DOIA 1E8XA 1YX6B 1ZGUB 2DBYA 1V8CA 2NR2A 3KWVA 3RNBC 2KTRB 2FE8A 2D3CA 3QWZB 1TGZB 5AZFA 2V4IB 1VR9A 4K7WA 1GB1A 4IUMB 3AI5A 4MSQB 1YX5B 3Q8CA 3RNCC 2N9LA 1D5MC 2V9HA 4BKSA 3ABVB 2KJHB 4BFRA 4L1BA 2RGFA 2DX5B 2DYBA 1TY0A 1AYFA 3HM3A 3OJ3A 2IJ0A 2FUG1 1FNWA 1WJ4A 3D32A 4FN2A 1E7VA 2KN5A 1OEYA 3ZTDA 4GOCA 4ZRJA 2Z8LA 2DYOA 5MPOA 1RFAA 3S2AA 3AEBB 2KQ7A 1J7CA 2KT7A 5TR5A 2WDTB 2X8XX 2LUEA 2AWTA 3MHZA 4IM3A 2EMSA 1N61A 3NS1A 1WXAA 1NBFC 2WDRB 3NUHB 2AYOB 4LNNA 4RF1A 4NAMA 2MJ3A 4TQ0A 1JALA 3WCQA 1E7UA 4MM3B 4KGRA 5LXIB 1LFDA 2B76B 4ANWA 4A6QA 1XLOA 2PJHA 1FMAD 1RM6C 5KHQA 1WXQA 3GE8C 4DQOC 4HVBA 2LASA 3DBRB 4B0EA 4MEMA 5BMGA 3VH3B 1LXDA 2M0XA 1UWXA 4EUTA 4M8MA 2Y5BB 1EWYC 1IBXA 2L8JA 1ZXIA 3TJPA 2J0MA 3HHMA 3EA6A 3ZIMA 2MEKA 2XNAC 3EFCA 4LNIA 3U4EG 3VTWA 3PZ8A 3L08A 4W9DA 4MACA 2A4ZA 1T0SC 1T3QA 3ML8A 2ZCBA 1FFUA 3A9KA 5BO4B 2DWQA 3MHSD 2Z0DB 1GPXA 2NVUI 3NJTA 1GC7A 2IO0B 1XLQA 3T3OA 2MP2B 3DWMA 2CKHB 4J3OD 4M02A 4C7ZA 2FIDA 3H9DA 2DAJA 2K8HA 3Q6BA 1FRDA 4GDKB 3NVZA 2JVCA 3APDA 3AB5A 1XLPA 1JWAD 2V1YA 3OJ4B 2WXPA 5C3JB 1JWBD 3PT2B 2YLMA 4L23A 4YSZB 4GXBA 4MH0E 2GBNA 1WE6A 3EFUA 4OZCA 1QT9A 1E6EB 1RFKA 2D11A 3L54A 1QKZA 1WX8A 4IM0A 3BIID 4X57B 4C4VA 4HWIB 3PZ7A 4FXCA 4PYUA 3KYDD 4ARCA 2MA9B 4BBNF 4XZ4A 2MBQA 2WP9B 4KDLB 1KF6B 2MBBB 3TCAA 1RYJA 5AUIA 2WXNA 2JRIB 1SF0A 3EHVA 1JWSD 1BMLC 2M56B 2LHDA 3DQVA 3VRBB 4CO7A 5BYRA 4NY0A 3OLMD 1MG8A 2AX5A 3VTUA 1L0XB 1WGKA 4EFOA 1V97A 2RSUA 1MG4A 1V81A 3DCGA 4BKGA 3HRDD 2QIEB 2NTTA 3PGEA 2C7HA 3MC9A 3P2BA 1WGRA 2PKOA 3V05A 2KYWA 3U7DA 1F77A 1C76A 1FM0D 3C0RB 1N5WA 1ZKHA 4A3OA 4IDIA 3A1QA 4MSMB 1I4QA 5CX3A 5IOIA 3NZSA 4MELA 3Q3OC 2N7JA 4P6VF 4K3BA 4GDLB 4TKNA 3H8HA 4HROA 2IGDA 1QOBA 3AE1B 3AV8A 3DDCB 4NAWA 2BB6A 2LFIA 3BZDB 2KWVB 1MHXA 2MBEA 5BMHA 1LQBA 3V6CB 4IKGA 3FILB 3T8MA 4US9A 5G5GA 4DBGA 3JYUA 4HCPB 1WMHA 5HKHA 3TEWA 3OG5A 2MX2A 4DXAB 2AL3A 3L13A 2BB5A 4OVVA 4I6LB 4RGMA 2J52A 1N5XA 4XC2A 1TT5B 3WIMA 4DDGD 3ZJVA 1GJZA 1WXVA 2LXCA 1HXYD 1T6BX 1P1AA 2CJOA 1V49A 2EELA 4KSKC 2LD9A 3NZ3A 3WAOA 3PRMB 4NAWB 5D3IB 2KDBA 2AQ3B 1YJJA 2J7QB 5C2TB 4BZAA 1Q1OA 1OGWA 5JXVA 1A70A 1GB4A 4M0WB 3B2FA 2WX1A 3PRPB 2BQQA 2ZNVC 2BBCA 2KQSA 4CQNA 1F2RC 4S17A 4LJPB 1XEEA 2KC1A 2ZVNA 4WAAA 1OTRB 1CQVA 3HM6X 3N9YC 1OQQA 1F0ZA 5LXHA 1WGDA 2RDHA 2UU7A 4B0MA 5TSSA 3W1SA 1H8CA 3EC8A 2QDFA 3ZRCA 1C9FA 2ZW1A 3ZNZB 3KQ4A 5CHFA 2DZJA 1UF0A 5JHAA 2JPHA 4G0NB 2NCNA 4R3DA 2KFKA 1L5PA 1HE8A 1J8CA 5BYSA 3JSVA 3VTVA 1WM3A 3KLSX 1YJ1A 1GAQB 1L6UA 3Q8EA 2KNBA 1NYQA 3R2IA 3KUCB 2G3QB 2N7EA 4NJ7A 2KMAA 1K53A 2L7RA 3TEZA 4ZOHC 4YL8A 3AE9B 4HKQA 2I1JA 2RPVA 3VFKA 4DHJB 2L00B 5I4DA 1SIFA 3N32A 2KX3A 2MBOA 4US8A 1E8ZA 2ACZB 1JQ4A 4WQOB 3DOWA 1MHHE 3R66C 2LGXA 2R61A 1GNUA 2WXJA 3RZFA 3IBEA 4RGTA 1LM8B 2MWSB 4LDTD 5EE1A 5LNK1 1UD7A 3WA0A 2WX0A 3M95A 1V1PB 4WJNA 3VUYA 2FCSA 1WRDB 2KMMA 1RLFA 5JHBA 5EE3A 2DAFA 2KDFB 2Y5CA 4DHJD 1VCBA 3M3JA 4MGYE 3U7ZA 3AU4A 4RM8A 2LGYA 2VH1A 4JLCA 1MVKA 3IT4B 4XX5A 1WGGA 3N3KB 1HTQA 3DWGC 1FCLA 2WQYB 3EUB2 3QHTA 1JWMD 4URKA 2DNFA 4NPNA 4ZRQA 3K9OB 4FJZA 4NZLB 3SEBA 2KD0A 1ZDVA 3FC4A 3DBLB 3RT3B 2LJ5A 2CU1A 2G4SA 4MJSB 4C00A 4OHJA 1PQSA 3N1YC 2ZNVB 3UF8A 3J9CA 3PREA 2G1EA 5GXGB 2DHZA 5HI1A 3W5VB 1TS5A 3ZUNA 1XLNA 1N60A 4IOIE 4DWFA 2BWES 2N1VA 4HKZE 1IGDA 5AZGA 4WJQA 2IY0B 1LGRA 2QEJC 3H6NA 2JYEA 4JL9A 4MGIE 2Y5PA 3KVFB 2KTRA 4ZYNA 2L83A 3C19A 1E5WA 1WXMA 2TSSA 2IBIB 4PS8A 2PW9A 3VAWA 1JW9D 1UBIA 3GZNI 2MSED 4JX1C 5HG2A 4D2KA 1Q0WB 1R4MI 1L4ZB 2KK8A 4LLGM 4IW0A 2WYQA 4HCNB 2NBWB 2BS2B 4BKTA 2RD0A 5BYQA 3RNEC 2FBWB 3U30A 4W9KA 2G45B 1K8RB 4KSLC 4P16A 2G4DB 3DPDA 2JX5A 3DBHB 4HPMB 2WU5B 2HE7A 4ANUA 1E8YA 1D5XC 1XXGA 3AE2B 4LTUA 4EE2A 1K51A 2KX0A 3APFA 1SE4A 3DVNV 4E71A 3R3MA 1G6JA 1UWMA 5E6JA 1NENB 2KTFA 4WURA 5FK9C 2BPSA 2LRWA 1TZOA 1NI2A 1HZ6A 3DVGY 4A90A 2LGSA 2LMCA 2HTHA 4IM2A 4W9GA 1YQBA 5H92C 3PSEB 2D10A 4S0RA 2JWUA 3TIXA 4MM3A 2IY1B 1GG3A 1ZW7A 4NQLB 1K50A 2C9WB 1RAXA 1NEKB 1P0RA 3DVNU 2MHJA 1I4XA 5CHWA 2LGDA 4MDKE 1VJKA 5FKAC 4M8NA 2MJDA 1V2YA 3VHTC 1AWDA 5IKCM 4XE0A 4AJWA 4Q2JA 3CSFA 3EGRA 1XT9B 1RRBA 4EKUA 3QC8B 4WJPA 4JWSC 3P4PB 1WYGA 3BY4B 3QX1A 1L0VB 2SAKA 3VUWA 4DK5A 3PZDA 2VH2A 3ZDTA 4WWOA 3NG0A 4G3XB 3AEAB 3KWLA 3RUIB 2D3GA 5FR3A 2V4LA 3UQAA 3UQBA 3N30A 2KLCA 5EDSA 2LVQA 2MP2A 1T0QC 4FHKA 1E8WA 3BYTB 4GDKA 2IO1B 3WAMA 5AEKB 3AECB 2AQ1B 3O65B 3T3NA 1LO5D 4C80A 3TL5A 3RI7C 3IVFA 3AM9A 2W55A 5EE9A 3I63C 5J18A 3QARA 5IN7A 2KDMA 2GRIA 3QQ8B 2LWPA 3I5JC 2JRHA 3ZXRA 4WH4A 4BKSD 1FNVA 4NJCA 3EECA 2AL6A 2UYZB 1D6EC 1XQQA 2O2VA 4USAA 1L7YA 4RGOS 3WAPA 1UELA 5DPTA 3MJWA 1FNUA 4KKJA 4HXDA 1KOTA 5JH5C 4YXDB 3NVYA 4TV3A 1FD6A 2PE9A 4W9CA 1R7SA 2LEKA 4TSSA 3RULA 2W54A 1HZ5A 3RNFC 3CMMB 3AEEB 2PTLA 1P9DU 2NPTA 2J0KA 4I6PA 4IC7B 2WDVB 2YEPB 1C4AA 1J7AA 2KC2A 5C23A 3TMPB 5G55A 2V3SA 2MCNB 3A4RA 3Q3MC 2VZKB 3PHXB 3QAQA 1IYFA 4RNAA 2L76A 2M8SA 2Q5WD 3ZXVA 1FO4A 3AEDB 3VDZA 4GDLA 2LVPA 1R4NI 3ENEA 1TS2A 1JMLA 4N6EB 3C8YA 2O2VB 3AEGB 3N1XC 1ZXHA 1ACCA 4FHJA 3HIZA 1I4GA 2WXOA 4XWTA 4KGTA 2FIFA 2G9HD 3FILA 2BKFA 5LLIA 2VZKD 4W9FA 3VXWA 1V5TA 2QCZA 4PYZA 3JW0X 1WZ3A 3PTFC 4KKIA 1C78A 4B9KA 1NYRA 4KZCA 2NPTB 1Y56A 3RD2A 2GBRA 1CMXB 1SBBB 3Q3JA 2GI9A 4FJYA 2OJRA 1TS4A 4HPPA 4B95A 3NRZA 4F7ZA 4XDDA 1JRPA 1KH0A 1XD3B 1AARA 5D6JB 4GLSC 4RGNA 1C77A 2ZPYA 3AE3B 1VD2A 1STEA 1IUEA 2KZRA 3MC8A 2QILA 2L1AA 3SFEB 3UI3A 4WWPA 3AULA 3U2SC 3OAWA 4YTPB 2PMVA 4W9EA 4M0WA 1ISNA 4BOZB 1UGJA 2WNMA 2K1FA 2K8BA 3R7QA 5DPWA 1QOAA 5J17A 2CHWA 2IO2B 1EU3A 1ENFA 2H88B 3LB8C 1WH3A 3DHIC 1SB3C 1X1MA 1WSPA 5AUKA 1KLGD 4N58A 3AE6B 2L52A 2PE6B 1TS3A 3MP9A 2WXMA 2K6DB 1A5RA 3MJ5A 4ACFA 2Z0EB 2KACA 2R2OA 4ANXA 2N9XA 2ON8A 3HUIA 2VRRB 2N9PC 4DHZB 2O6VB 2W9NA 1EF1A 3H7PB 5J2RA 1T5XD 3Q14C 4GMVA 3CSTA 1OFFA 1BUIC 1QLBB 4KIKB 1C4CA 1WIAA 2BF8B 1WFYA 4XYCA 3AE7B 1YQ4B 2K39A 1FXTB 1E0ZA 2M17A 3KW5B 3VVWB 4P7IA 1ZPSA 2Y3AA 1TKGA 1ROEA 4F8CB 1V1PA 2O6VD 4AP4C 2GBKA 3V3XA 1WJUA 2KJ6A 3DHHC 3PO0A 3BWUD 2W82A 3X0WA 2MJEA 3P42A 3GOEA 3ZJUA 2IGGA 5G2NA 4LDTB 4JQWC 3DHGC 3BYYB 1JRUA 3ALBA 1UBQA 2MH7A 3NVWA 5EE0A 3ZYYX 2LJIA 1AW7A 2V3PA 5D94A 2KKCA 2N7DA 1WR1A 2WXQA 3DBRI 4ICUA 2CHZA 2KWDA 4ICVA 5AZHA 2J42A 2ZZPB 4RMAA 2BYTA 3PVLA 2QHOA 1I4PA 4W9LA 4MJSA 3QIJA 3W1YA 1JCKB 3RN9C 1CK1A 4YSYB 2ZPNA 4GGQA 4G50A 2XK5B 1ZDXA 2PPHA 2ICIA 2KXJA 1H4RA 2QC8A 4KV2A 4AOFA 2L32A 2SEBD 1I7HA 4WIPA 1L2NA 3N1ZC 2K5PA 5H8YE 3Q8FA 1BT0A 5E6PA 3I9V1 1V9JA 4YT0B 2KFJA 4WAFA 3ZJTA 3IG3A 3B1LX 3SDLC 2BWFA 1Q5WB 1WWTA 3KH0A 1TBEA 3A9JA 1KJTA 1C4PA 3P63A 2XN9C 2JYTA 3U52E 3MTNB 4FADA 2LRUA 4M00A 2ZVOA 2MQJA 1T0YA 3HVZA 3TUOA 2OEDA 1B9RA 3NZUA 4A8XC 1TKYA 3HVDA 4W9IA 3TBLD 4LNOA 5T8IA 2BW2A 4KGSA 1RWSA 1UH6A 2KO3A 1IP9A 1E10A 4J6IA 1HA5A 2W3RA 3W5UB 3ZO5B 2MLBA 3GE3C 3ZVVA 2KMCA 2HTME 4ANVA 2D5GA 2KDEB 1SSNA 5JZEB 3NVVA 3KUDB 1I35A 4A3PA 2FCNA 3W2DA 2RR9A 2PVGC 4MT5A 2CS4A 5CTRC 1YMHE 4C56C 2KWCA 3P4RB 2PIAA 4FULA 3ONSA 4JE3B 3ZRFA 3IT6B 2L0FA 1WR6E 3A9JB 3AE5B 4XGAB 1WYWB 1D4BA 1F9JA 2M1MA 2GB1A 1KM7A 4C7YA 1T0RC 2GBJA 3LJ3A 3L16A 4KX6B 1SE9A 1F52A 3NS8A 4E74A 2FAZA 2WU2B 1B1ZA 1HTOA 1XF5L 3QCAA 4WWNA 2JU6X 1YN5A 2JF5A 4YSXB 2N0SB 2IPKD 3O13A 1HEZE 1SJHD 3PPAA 1PGXA 2A5UA 1TJEA 4RFBA 2EKIA 5BMIA 2PLPA 1WF9A 1C1YB 4A20A 1E7PB 1OQYA 1P3QU 2AQ2B 3Q8BA 3AH7A 1VZ8A 2RDGA 4EZJA 1WX9A 3NY5A 4GSWA 4GU2A 5L95C 2NBVB 4MGKE 5FR6A 3VR9B 3DBSA 2X38A 3B9JA 4JIOU 1WI0A 2D2QA 3KYCD 4M01A 2BS3B 1EM7A 3BVZA 3UIOB 1MI0A 2DYMA 1ZE3D 2MRPA 1GUAB 2JT4B 4EZKA 1WGYA 2J53A 3ZKJC 4NNJB 1I42A 3RCZA 3ZGZA 4BOSC 3A4SC 3P1MA 5D3DA 3GP7A 3M62B 1YIWA 2DZIA 1QOFA 4REZA 4TQ1A 4HEA1 3URYA 1M94A 1J0GA 3T9LA 4F1SA 1V80A 3H1UA 1XO3A 2I1KA 3VR8B 1WZ0A 3QJZA 2N9EB 3E9SA 3WALA 1WY8A 5IAAC 3P4SB 2HD5B 2RPQA 4EEWA 4RCOA 1TZ1A 1YJIA 4GIVA 2KOXA 2E3TA 2M4NA 3VH4B 4LCDE 2C5LC 4HPLB 1QF6A 5IO9A 1YN3A 1N62A 2J0JA 2YEPF 4MGZE 4JWUC 3ZDMC 4MH8A 4H2AA 3SHQA 2N4FA 1DGJA 3ZW3A 4XDCA 2IO3B 3BINA 2IGHA 4YTNB 4I6NB 2FUHB 2WXRA 4NQKE 1HQRD 1SXTA 4II3B 2IYDB 2JUOA 1J7BA 1N63A 1WE7A 4HDOA 2K9XA 4K7SA 5IP4D 2K6QA 4RM9A 2WHIA 4WJOA 2WXKA 2ZW0A 1WJNA 2BGFA 1KTKA 3ZTCA 1D5ZC 4HJKA 2REXA 5G5HA 3ZQ4A 4FJVB 3UGBB 2KVRA 4OZBA 3LYYA 1UGMA 1V1OA 4BBNC 3PLUA 4K81A 4FBJB 4UDUC 2WXIA 1Q10A 1TYGB 3X23A 4O1NA 3I3TB 1OEYJ 1Z5SB 4ZRPA 1KLUD 1YQ3B 2GMIC 2UWQA 3L4PA 4A9AA 1YN4A 2KJRA 1I4RA 1FEHA 3H7SA 2K22A 4OVZA 1CJEA 2BYVE 4AQ7A 1IBXB 1P7FA 1AN8A 1DYQA 3PRZA 4KDIC 3M63B 4B6WA 1TY2A 3ZLZA 2LXAA 3ZNGC 2BT6A 1VDVA 1TKEA 4AUQC 4EOYA 3RYTA 5IA7A 3IFWB 3VUXA 1QQRA 4TMAB 1M4VA 3Q3NC 3A9KB 1WGHA 2NMQA 2I38A 2W3SA 3DBLI 3AN1A 4AS1A 4AWJA 4N59A 3L10B 1F2RI
chains in the Genus database with same CATH topology
1PYWD 2WDRB 3NUHB 4RF1A 3TEYA 2QEJC 4NAMA 1V1PA 1ZUD2 2MJ3A 2DLBA 2JYEA 4TQ0A 1JALA 2M0AA 2Y5PA 3V3XA 2JSVX 3WCQA 4MM3B 4KGRA 2B76B 2L83A 4A6QA 4HJGE 3R8BA 1XLOA 3PO0A 1FMAD 3TEXA 5HFYA 3BWUD 1RM6C 2W82A 1WXQA 2MJEA 3P42A 1YNTE 4DQOC 2TSSA 3ZJUA 2IGGA 4B0EA 5BMGA 2RMMA 1FXIA 2PW9A 1JW9D 1UWXA 3BYYB 1I4HA 4JX1C 5HG2A 4XWWA 1EWYC 2MH7A 4JPSA 3NVWA 1FCCC 5EE0A 4D2KA 1ESFA 1DOYA 2BS4B 3ZYYX 1L4ZB 2LJIA 1AW7A 2V3PA 4LLGM 1IBXA 1ZXIA 2JXTA 2CU3A 2WXQA 2MEKA 3EA6A 1L6VA 1ET6A 2XNAC 3U4EG 1VLBA 2BS2B 2KWDA 2WS3B 5BYQA 2WXFA 2BTEA 3PZ8A 2J42A 2FBWB 4MACA 2BYTA 1SIJA 1I4PA 3CWIA 1T3QA 1NI3A 1JCKB 4P16A 5HHDG 1CK1A 1FFUA 2E6XA 2JX5A 2WU5B 4YSYB 1D5XC 1XXGA 3AE2B 4LTUA 4EE2A 1K51A 1DOXA 1ZDXA 2V0GA 2ICIA 1ZP0B 1SE4A 2DWQA 2KN4A 1UWMA 5E6JA 1NENB 4WURA 5FK9C 1GPXA 3MC0B 2L32A 1TZOA 2SEBD 4WWMA 1HZ6A 2INPE 3T3OA 1XLQA 4A90A 1QILA 1I7HA 1PGAA 3DWMA 4WIPA 2LMCA 2K5PA 4J3OD 5H92C 5H8YE 4C7ZA 3Q8FA 1UNSA 3I9V1 4YT0B 2JWUA 1FRDA 4GDKB 4WAFA 3TSSA 3ZJTA 1EU4A 3NVZA 3R2TA 3IAS1 1K50A 2PVOD 3AB5A 1XLPA 2N9KA 1JWAD 1NEKB 2WXPA 3Q8AA 5C3JB 1JWBD 4L23A 1I4XA 1WWTA 4YSZB 3IAM1 1PGBA 1VJKA 1C4PA 3P63A 5FKAC 4OZCA 1C79A 2MJDA 2XN9C 3LXFA 1QT9A 1E6EB 2JYTA 3BK2A 1AWDA 2M19A 3BK1A 1RFKA 4XE0A 3U52E 1QKZA 4Q2JA 3BIID 3EGRA 4L2YA 3TUOA 3HVZA 3PZ7A 4ITKA 1EWCA 2OEDA 4FXCA 1B9RA 4OZAA 4JWSC 3P4PB 4A8XC 1TKYA 4A55A 3HVDA 1WYGA 4ARCA 3FAHA 1UUPA 5T8IA 2BW2A 4KGSA 1RWSA 1KFYB 1L0VB 2SAKA 1E10A 1HA5A 2W3RA 2WP9B 3W5UB 4RF0A 1KF6B 1RYJA 5AUIA 2HTME 2WXNA 1SF0A 1JWSD 1BMLC 2D5GA 2M56B 2LHDA 3SFDB 3AE8B 1SSNA 3VRBB 3NVVA 2J4XA 1FIQA 5BYRA 3AEAB 3KWLA 2AX5A 3W2DA 1L0XB 1WGKA 5FR3A 1V97A 2PVGC 4MT5A 1KRHA 2NTSA 1YMHE 3ETRA 4C56C 2QJLA 3MFGA 3HRDD 2QIEB 2NTTA 3P4RB 2PIAA 3BYTB 4WQMA 4JE3B 2PKOA 3IT6B 3V05A 3AE5B 2QSDA 3AECB 1D4BA 2AQ1B 2GB1A 1F77A 1C76A 1SE3A 3T3NA 1FM0D 1LO5D 4C7YA 1N5WA 4IDIA 1I4QA 2WLBA 4KX6B 4C80A 3AM9A 3OWEB 4PT5A 2W55A 4ZHPA 2WU2B 1B1ZA 2N7JA 4P6VF 4ARIA 1XF5L 2JU6X 4GDLB 1YN5A 5EE9A 3H8HA 4HROA 4DXGA 2IGDA 4YSXB 3IXSA 1QOBA 2N0SB 3AE1B 3AV8A 2IPKD 2WDQB 3O13A 1PUTA 4HRSA 1HEZE 1SJHD 1PGXA 2BB6A 2LFIA 4ZHOA 1OQRA 2KDMA 2GRIA 2IDYA 3BZDB 1TJEA 4RH6A 4RFBA 3SR6A 3VRAB 2EKIA 1MHXA 4YWGG 5BMIA 2PLPA 1NVID 3W9CB 5BMHA 4WH4A 1E7PB 4IKGA 1FNVA 1JWUD 4NJCA 3FILB 2AQ2B 1D6EC 3Q8BA 3AH7A 4USAA 1VZ8A 2WXLA 2RDGA 4RGOS 4US9A 1K52A 5G5GA 1FNUA 4KKJA 1JROA 4YXDB 3TEWA 3NVYA 1FD6A 3VR9B 1SJED 2X38A 3B9JA 2BB5A 1R7SA 2LEKA 4TSSA 4RGMA 2W54A 1HZ5A 2J52A 1N5XA 2BS3B 2ONQA 3AEEB 1EM7A 1SEBD 2PTLA 3BVZA 3GB1A 1MI0A 1PFDA 2DYMA 1ZE3D 3ZJVA 2WDVB 2YEPB 1C4AA 1J7AA 1ET9A 2LUMA 1HXYD 1T6BX 2CJOA 2EELA 2H89B 3AE4B 3RPFC 3NZ3A 1E9MA 2J53A 2VZKB 2JZPA 1VRAB 4RNAA 2Q5WD 3ZGZA 3AEFB 4NAWB 5D3IB 2LGIA 1L0YB 2AQ3B 3P1MA 1YJJA 3E56A 5D3DA 5C2TB 3GP7A 3GS2A 1FO4A 2I2YA 3AEDB 3BVGA 4OW0A 5JXVA 1A70A 1GB4A 2QMTA 3VQIA 1QOFA 4REZA 1TS2A 4TQ1A 3B2FA 4HEA1 5D7GA 1JMLA 2JQRB 3C8YA 4N6EB 1FRRA 3URYA 2BBCA 3AEGB 1GOZA 4CQNA 1F2RC 1XO3A 3VR8B 1XEEA 2CJNA 1ZXHA 1ACCA 1MPEA 2V3NA 2WXGA 1I4GA 3E9SA 2WXOA 1ZOYB 4XWTA 3P4SB 1CQVA 3Q69A 4DXFA 3N9YC 1OQQA 1CZPA 4KGTA 2K0PA 4RCOA 1F0ZA 2G9HD 3FILA 2K3UA 2RDHA 4B0MA 1XCTL 2VZKD 1P7EA 1YJIA 2WXHA 5TSSA 1QOGA 3W1SA 4KKIA 2E3TA 1C78A 2OHFA 4LK0M 1NYRA 1C9FA 2INNE 2ZW1A 1Y56A 1QF6A 3KQ4A 1YN3A 1N62A 3P4QB 2YEPF 1SBBB 4JWUC 4MH8A 4H2AA 2GI9A 1TS4A 1DGJA 2KAJA 4R3DA 1L5PA 3CIRB 1FFVA 5BYSA 3NRZA 1L4DB 4XDDA 1JRPA 4XDCA 1SE2A 1KH0A 2IGHA 4YTNB 3KLSX 2WXRA 4GLSC 1VZ7A 3I57A 1GAQB 1HQRD 1L6UA 1SXTA 1WRIA 2KQ4X 4RGNA 3Q8EA 1NYQA 3R2IA 1C77A 2HDEA 1J7BA 1N63A 3AE3B 1K53A 2LHEA 3TEZA 2K9XA 4ZOHC 1STEA 1IUEA 4HKQA 3AE9B 2RPVA 1XCQL 3BVMA 5I4DA 2QILA 2L1AA 3SFEB 3UI3A 4YTMB 4ZYSA 4US8A 3U2SC 2WXKA 2ZW0A 4YTPB 2ACZB 1JQ4A 2PMVA 3B2GA 1MHHE 1PDXA 1KTKA 1BXTA 4M0WA 1D5ZC 1IGCA 5G5HA 3ZQ4A 1FXAA 3RFZB 2R61A 2WXJA 1UGJA 4RGTA 2WNMA 1VZ6A 3AMZA 1DOIA 4OZBA 5EE1A 5LNK1 1V1PB 3LYYA 2DBYA 1QOAA 1V1OA 1V8CA 1EU3A 3KWVA 2KMMA 2FE8A 5EE3A 1ENFA 2Y5CA 2H88B 3LB8C 4UDUC 2WXIA 2V4IB 1Q10A 1VR9A 1SB3C 1TYGB 1WSPA 4O1NA 5AUKA 1KLGD 4N58A 3U7ZA 1GB1A 3AE6B 4ZRPA 1KLUD 2L52A 1MVKA 1TS3A 1YQ3B 3IT4B 3Q8CA 3MP9A 2N9LA 1D5MC 2WXMA 3L4PA 4A9AA 1YN4A 1I4RA 3ABVB 3MJ5A 4L1BA 1FEHA 3DWGC 2KACA 1FCLA 2K22A 2WQYB 4OVZA 1TY0A 1AYFA 3EUB2 1CJEA 4AQ7A 1IBXB 1P7FA 1AN8A 1DYQA 1JWMD 2ON8A 2IJ0A 4ZRQA 3HUIA 2FUG1 1TY2A 1FNWA 4NZLB 3SEBA 1ZDVA 3FC4A 2BT6A 1VDVA 1TKEA 2Z8LA 1T5XD 4OHJA 1QQRA 2DYOA 5MPOA 3J9CA 4TMAB 3AEBB 2G1EA 5GXGB 1OFFA 5HI1A 3W5VB 1BUIC 1QLBB 1J7CA 1M4VA 1C4CA 1TS5A 1XLNA 2NMQA 1N60A 2I38A 3AE7B 4IOIE 2W3SA 1YQ4B 3AN1A 4AS1A 1E0ZA 4HKZE 1IGDA 3MHZA 1ZPSA 2Y3AA 4N59A 1N61A 1F2RI 3NS1A 1TKGA 1ROEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2WDR B;  5G5G A;  2MJD A;  3LXF A;  1QT9 A;  1ZUD 2;  1E6E B;  2K9X A;  2MJ3 A;  1AWD A;  2M19 A;  4ZOH C;  1IUE A;  1RFK A;  3AE9 B;  1JAL A;  1JRO A;  4YXD B;  3NVY A;  3BII D;  3WCQ A;  3HVZ A;  3VR9 B;  2B76 B;  4ITK A;  2L83 A;  3B9J A;  3SFE B;  4FXC A;  4YTM B;  1B9R A;  1R7S A;  2LEK A;  1XLO A;  1TKY A;  3P4P B;  3PO0 A;  1FMA D;  4JWS C;  1WYG A;  4US8 A;  2W54 A;  3FAH A;  1RM6 C;  1N5X A;  1WXQ A;  2BS3 B;  2ACZ B;  4YTP B;  2MJE A;  1JQ4 A;  3B2G A;  1RWS A;  1PDX A;  1KFY B;  3AEE B;  1L0V B;  1E10 A;  5G5H A;  2W3R A;  1FXA A;  1FXI A;  1PFD A;  2WP9 B;  3W5U B;  1JW9 D;  2WDV B;  1J7A A;  1KF6 B;  1RYJ A;  4JX1 C;  5AUI A;  2HTM E;  1EWY C;  2MH7 A;  3NVW A;  5EE0 A;  1DOY A;  2CJO A;  2H89 B;  3AE4 B;  1SF0 A;  1DOI A;  2BS4 B;  3AMZ A;  3ZYY X;  2M56 B;  5EE1 A;  3RPF C;  1E9M A;  3SFD B;  3AE8 B;  3VRB B;  3NVV A;  2DBY A;  1FIQ A;  1ZXI A;  1QOA A;  1V8C A;  3AEA B;  3AE3 B;  3KWL A;  2CU3 A;  2Q5W D;  3AEF B;  2AX5 A;  2KMM A;  1L6V A;  1WGK A;  5EE3 A;  1VLB A;  2BS2 B;  1V97 A;  2Y5C A;  2PVG C;  2H88 B;  3LB8 C;  2WS3 B;  1YJJ A;  3P1M A;  1KRH A;  5C2T B;  1FO4 A;  3ETR A;  3AED B;  1SB3 C;  1TYG B;  2FBW B;  2QJL A;  3HRD D;  1SIJ A;  2QIE B;  5AUK A;  1A70 A;  3CWI A;  4N58 A;  1T3Q A;  1NI3 A;  3AE6 B;  1QOF A;  3P4R B;  2PIA A;  3B2F A;  2L52 A;  4WQM A;  2JQR B;  4N6E B;  1YQ3 B;  1FRR A;  3AEG B;  2JX5 A;  1FFU A;  4YSY B;  2WU5 B;  2PKO A;  1XO3 A;  3L4P A;  4A9A A;  3VR8 B;  3AE5 B;  2CJN A;  3ABV B;  3AE2 B;  3AEC B;  4LTU A;  1DOX A;  3DWG C;  2K22 A;  2WQY B;  1ZP0 B;  1ZOY B;  1AYF A;  2DWQ A;  3EUB 2;  3P4S B;  1CJE A;  1FM0 D;  4C7Y A;  1OQQ A;  1N5W A;  1UWM A;  1CZP A;  4IDI A;  1NEN B;  1F0Z A;  4KX6 B;  2WLB A;  4C80 A;  3HUI A;  1GPX A;  4WWM A;  1YJI A;  3AM9 A;  1QOG A;  2W55 A;  1XLQ A;  4ZHP A;  2WU2 B;  4P6V F;  1I7H A;  3FC4 A;  2E3T A;  2BT6 A;  3DWM A;  1VDV A;  1TKE A;  2K5P A;  5H92 C;  2OHF A;  5H8Y E;  1NYR A;  5EE9 A;  4C7Z A;  4HRO A;  1QF6 A;  4YSX B;  4YT0 B;  1FRD A;  1QOB A;  2N0S B;  3AE1 B;  5MPO A;  3AV8 A;  2WDQ B;  1N62 A;  1PUT A;  3AEB B;  2G1E A;  3P4Q B;  1OFF A;  3NVZ A;  4HRS A;  5GXG B;  3W5V B;  4JWU C;  4ZHO A;  1QLB B;  1OQR A;  1J7C A;  3VRA B;  1TJE A;  3SR6 A;  1DGJ A;  2KAJ A;  1XLN A;  1L5P A;  2EKI A;  2PVO D;  1N60 A;  3CIR B;  1FFV A;  3AB5 A;  3AE7 B;  3NRZ A;  2W3S A;  1NVI D;  1XLP A;  1JRP A;  1YQ4 B;  1JWA D;  3W9C B;  3AN1 A;  1E7P B;  3P63 A;  4YTN B;  1E0Z A;  1NEK B;  5C3J B;  1JWB D;  3AH7 A;  1WWT A;  1GAQ B;  4USA A;  4YSZ B;  1L6U A;  1WRI A;  4N59 A;  1N61 A;  1NYQ A;  3NS1 A;  1TKG A;  1ROE A;  4US9 A;  1J7B A;  1N63 A;  1VJK A; 
#chains in the Genus database with same CATH topology
 1PYW D;  2L3Z A;  3TEY A;  1IPG A;  1ZUD 2;  2KAN A;  2DLB A;  2M0A A;  2JSV X;  3GZN B;  2KLG A;  3UIP B;  5CHV C;  4DDI D;  4HJG E;  3R8B A;  3ML9 A;  1R4M B;  3SD5 A;  5HFY A;  3TEX A;  3V6E B;  1J19 A;  1YNT E;  3L17 A;  3SU8 X;  2RMM A;  2CR5 A;  2HJ8 A;  1FXI A;  4BVU C;  5DPS A;  2R2Q A;  1I4H A;  4XWW A;  3QK0 A;  4JPS A;  1FCC C;  1DOY A;  1ESF A;  2BS4 B;  1S1Q B;  2JXT A;  1TTN A;  2CU3 A;  2PEA A;  3HK0 A;  4C4V B;  1L6V A;  1ET6 A;  1MFW A;  4AJY B;  1VLB A;  2WS3 B;  2WXF A;  2BTE A;  2O6V A;  2MBH A;  1SIJ A;  2OJW A;  3CWI A;  2FNJ B;  1NI3 A;  3H7P A;  5D2M B;  5HHD G;  2E6X A;  4KIK A;  4LNK A;  3CF6 E;  2C7N B;  1DOX A;  2KHW B;  1WJ6 A;  2V0G A;  1ZP0 B;  2LI5 A;  4ZRK A;  2KN4 A;  4II2 B;  1YOV B;  5KHO A;  1UZX B;  3MC0 B;  3NHE B;  3ECI A;  4WWM A;  2INP E;  3DBH I;  3W1S C;  1QIL A;  1PGA A;  4HDQ A;  4PK1 A;  1MJD A;  2DZM A;  1UNS A;  4IWQ A;  3TSS A;  2EKE C;  2ZJD A;  1EU4 A;  3R2T A;  4KVG B;  3V61 A;  4DHZ E;  3IAS 1;  3RNG C;  2PVO D;  2N9K A;  4JGH B;  2DEN B;  1KLV A;  3A1Q B;  2B3A A;  3Q8A A;  4QAY A;  3LDZ E;  1QZE A;  3NOB A;  4K1R B;  3IAM 1;  3IHP C;  1EUV B;  1PGB A;  1C79 A;  3LXF A;  3BK2 A;  1F1H A;  2M19 A;  2AEH A;  3BK1 A;  2JZ3 B;  4L2Y A;  4ITK A;  2NS5 A;  1EWC A;  4KZ0 A;  4P1C C;  2NBU A;  4OZA A;  4HK2 A;  1Y8R C;  4A55 A;  2C60 A;  3FAH A;  1UUP A;  4BAX A;  1KFY B;  2RDB C;  1P98 A;  4K3C A;  4RF0 A;  2BKR B;  2K8C A;  3PLV A;  2XK5 A;  2GLS A;  3SFD B;  3AE8 B;  2J4X A;  1FIQ A;  4W9J A;  1GC6 A;  1WMH B;  1NDD A;  2CHX A;  3Q3F A;  5E6N A;  3AXC A;  3N20 C;  1WXS A;  1KRH A;  2NTS A;  3ETR A;  3V62 A;  4K7U A;  2QJL A;  3MFG A;  2ZEQ A;  2XBB C;  2LZ6 A;  1EO6 A;  5DCN A;  4WQM A;  1N6Z A;  4E3C A;  2IND C;  3R7R A;  2QSD A;  4IWP A;  1YD8 U;  2BVC A;  1SE3 A;  1TIF A;  3WAN A;  2WLB A;  2XEW A;  1WM2 A;  3OWE B;  4PT5 A;  4LJO B;  4ZHP A;  2KDI A;  4ARI A;  2GBM A;  2KVZ A;  2L0T A;  4DXG A;  3IXS A;  3JVZ X;  2WDQ B;  5DPR A;  1PUT A;  4HRS A;  4ZDV A;  2ZCC A;  3KUZ A;  4ZHO A;  1OQR A;  3VRA B;  2IDY A;  4IWO A;  4RH6 A;  3SR6 A;  2GOW A;  2L05 A;  4YWG G;  1NVI D;  3W9C B;  5C1Z A;  3APC A;  1JWU D;  2DZK A;  3RZW C;  2WXL A;  4IG7 B;  1K52 A;  2YVC A;  3PHW B;  1JRO A;  4ZRI A;  3A33 B;  1SJE D;  5L83 A;  2JY6 A;  3PS6 A;  2IZV B;  2ASQ A;  2KFK B;  2D07 B;  3JSV B;  3AU5 A;  3RNA C;  2ONQ A;  1SEB D;  2JZZ A;  1V86 A;  3GB1 A;  1PFD A;  3UIN B;  2Z59 B;  2LUM A;  1ET9 A;  4CHK A;  4TUU A;  3B08 A;  3AE4 B;  2H89 B;  1V6E A;  3RPF C;  1E9M A;  1R4N B;  3ZNH B;  4EZL A;  1FPY A;  2JZP A;  1VRA B;  4GN1 A;  3AEF B;  2JWZ A;  2LGI A;  2MW5 A;  2N1W A;  1L0Y B;  4FA6 A;  3E56 A;  3RMK C;  3GS2 A;  2I2Y A;  3BVG A;  3V60 A;  4OW0 A;  2QMT A;  3VQI A;  5D7G A;  2JQR B;  1FRR A;  1GOZ A;  5GMV A;  3FKY A;  2D3A A;  2CJN A;  2V3N A;  2WXG A;  1MPE A;  2LVO A;  1U4A A;  3U8Z A;  1ZOY B;  2INC C;  3Q69 A;  4DXF A;  2JXX A;  1CZP A;  2K0P A;  4N9F 4;  2K3U A;  1XCT L;  4NJ6 A;  1P7E A;  2WGS A;  1WX7 A;  2WXH A;  1QOG A;  3PV1 A;  2OOB B;  2KWU B;  4FLH A;  2OHF A;  3ZNI D;  4LK0 M;  2INN E;  3K9P B;  2BYF A;  3P4Q B;  4G11 A;  4HLE A;  2KAJ A;  2C7M B;  2EMT A;  3CIR B;  1FFV A;  3QA8 A;  1L4D B;  4CYE A;  1SE2 A;  3L0W B;  1Z2M A;  2K25 A;  2FCQ A;  4ASW C;  1VZ7 A;  3I57 A;  2KQ4 X;  1WRI A;  4W9H A;  2HDE A;  1D3Z A;  2LHE A;  1V5O A;  4GB9 A;  5E6O A;  2BYE A;  2WWZ A;  3DVG X;  1XCQ L;  1SGH A;  3BVM A;  1E90 A;  1C3T A;  4YTM B;  4OVU A;  3B0A A;  4ZYS A;  4PS3 A;  4P1B C;  4PS7 A;  3B2G A;  1PDX A;  1BXT A;  1EF5 A;  1IGC A;  1S3S G;  2D3B A;  1FXA A;  3RFZ B;  4LNF A;  2HJ1 A;  2FCM A;  1VZ6 A;  3AMZ A;  3Q2A C;  1DOI A;  1E8X A;  1YX6 B;  1ZGU B;  2DBY A;  1V8C A;  2NR2 A;  3KWV A;  3RNB C;  2KTR B;  2FE8 A;  2D3C A;  3QWZ B;  1TGZ B;  5AZF A;  2V4I B;  1VR9 A;  4K7W A;  1GB1 A;  4IUM B;  3AI5 A;  4MSQ B;  1YX5 B;  3Q8C A;  3RNC C;  2N9L A;  1D5M C;  2V9H A;  4BKS A;  3ABV B;  2KJH B;  4BFR A;  4L1B A;  2RGF A;  2DX5 B;  2DYB A;  1TY0 A;  1AYF A;  3HM3 A;  3OJ3 A;  2IJ0 A;  2FUG 1;  1FNW A;  1WJ4 A;  3D32 A;  4FN2 A;  1E7V A;  2KN5 A;  1OEY A;  3ZTD A;  4GOC A;  4ZRJ A;  2Z8L A;  2DYO A;  5MPO A;  1RFA A;  3S2A A;  3AEB B;  2KQ7 A;  1J7C A;  2KT7 A;  5TR5 A;  2WDT B;  2X8X X;  2LUE A;  2AWT A;  3MHZ A;  4IM3 A;  2EMS A;  1N61 A;  3NS1 A;  1WXA A;  1NBF C;  2WDR B;  3NUH B;  2AYO B;  4LNN A;  4RF1 A;  4NAM A;  2MJ3 A;  4TQ0 A;  1JAL A;  3WCQ A;  1E7U A;  4MM3 B;  4KGR A;  5LXI B;  1LFD A;  2B76 B;  4ANW A;  4A6Q A;  1XLO A;  2PJH A;  1FMA D;  1RM6 C;  5KHQ A;  1WXQ A;  3GE8 C;  4DQO C;  4HVB A;  2LAS A;  3DBR B;  4B0E A;  4MEM A;  5BMG A;  3VH3 B;  1LXD A;  2M0X A;  1UWX A;  4EUT A;  4M8M A;  2Y5B B;  1EWY C;  1IBX A;  2L8J A;  1ZXI A;  3TJP A;  2J0M A;  3HHM A;  3EA6 A;  3ZIM A;  2MEK A;  2XNA C;  3EFC A;  4LNI A;  3U4E G;  3VTW A;  3PZ8 A;  3L08 A;  4W9D A;  4MAC A;  2A4Z A;  1T0S C;  1T3Q A;  3ML8 A;  2ZCB A;  1FFU A;  3A9K A;  5BO4 B;  2DWQ A;  3MHS D;  2Z0D B;  1GPX A;  2NVU I;  3NJT A;  1GC7 A;  2IO0 B;  1XLQ A;  3T3O A;  2MP2 B;  3DWM A;  2CKH B;  4J3O D;  4M02 A;  4C7Z A;  2FID A;  3H9D A;  2DAJ A;  2K8H A;  3Q6B A;  1FRD A;  4GDK B;  3NVZ A;  2JVC A;  3APD A;  3AB5 A;  1XLP A;  1JWA D;  2V1Y A;  3OJ4 B;  2WXP A;  5C3J B;  1JWB D;  3PT2 B;  2YLM A;  4L23 A;  4YSZ B;  4GXB A;  4MH0 E;  2GBN A;  1WE6 A;  3EFU A;  4OZC A;  1QT9 A;  1E6E B;  1RFK A;  2D11 A;  3L54 A;  1QKZ A;  1WX8 A;  4IM0 A;  3BII D;  4X57 B;  4C4V A;  4HWI B;  3PZ7 A;  4FXC A;  4PYU A;  3KYD D;  4ARC A;  2MA9 B;  4BBN F;  4XZ4 A;  2MBQ A;  2WP9 B;  4KDL B;  1KF6 B;  2MBB B;  3TCA A;  1RYJ A;  5AUI A;  2WXN A;  2JRI B;  1SF0 A;  3EHV A;  1JWS D;  1BML C;  2M56 B;  2LHD A;  3DQV A;  3VRB B;  4CO7 A;  5BYR A;  4NY0 A;  3OLM D;  1MG8 A;  2AX5 A;  3VTU A;  1L0X B;  1WGK A;  4EFO A;  1V97 A;  2RSU A;  1MG4 A;  1V81 A;  3DCG A;  4BKG A;  3HRD D;  2QIE B;  2NTT A;  3PGE A;  2C7H A;  3MC9 A;  3P2B A;  1WGR A;  2PKO A;  3V05 A;  2KYW A;  3U7D A;  1F77 A;  1C76 A;  1FM0 D;  3C0R B;  1N5W A;  1ZKH A;  4A3O A;  4IDI A;  3A1Q A;  4MSM B;  1I4Q A;  5CX3 A;  5IOI A;  3NZS A;  4MEL A;  3Q3O C;  2N7J A;  4P6V F;  4K3B A;  4GDL B;  4TKN A;  3H8H A;  4HRO A;  2IGD A;  1QOB A;  3AE1 B;  3AV8 A;  3DDC B;  4NAW A;  2BB6 A;  2LFI A;  3BZD B;  2KWV B;  1MHX A;  2MBE A;  5BMH A;  1LQB A;  3V6C B;  4IKG A;  3FIL B;  3T8M A;  4US9 A;  5G5G A;  4DBG A;  3JYU A;  4HCP B;  1WMH A;  5HKH A;  3TEW A;  3OG5 A;  2MX2 A;  4DXA B;  2AL3 A;  3L13 A;  2BB5 A;  4OVV A;  4I6L B;  4RGM A;  2J52 A;  1N5X A;  4XC2 A;  1TT5 B;  3WIM A;  4DDG D;  3ZJV A;  1GJZ A;  1WXV A;  2LXC A;  1HXY D;  1T6B X;  1P1A A;  2CJO A;  1V49 A;  2EEL A;  4KSK C;  2LD9 A;  3NZ3 A;  3WAO A;  3PRM B;  4NAW B;  5D3I B;  2KDB A;  2AQ3 B;  1YJJ A;  2J7Q B;  5C2T B;  4BZA A;  1Q1O A;  1OGW A;  5JXV A;  1A70 A;  1GB4 A;  4M0W B;  3B2F A;  2WX1 A;  3PRP B;  2BQQ A;  2ZNV C;  2BBC A;  2KQS A;  4CQN A;  1F2R C;  4S17 A;  4LJP B;  1XEE A;  2KC1 A;  2ZVN A;  4WAA A;  1OTR B;  1CQV A;  3HM6 X;  3N9Y C;  1OQQ A;  1F0Z A;  5LXH A;  1WGD A;  2RDH A;  2UU7 A;  4B0M A;  5TSS A;  3W1S A;  1H8C A;  3EC8 A;  2QDF A;  3ZRC A;  1C9F A;  2ZW1 A;  3ZNZ B;  3KQ4 A;  5CHF A;  2DZJ A;  1UF0 A;  5JHA A;  2JPH A;  4G0N B;  2NCN A;  4R3D A;  2KFK A;  1L5P A;  1HE8 A;  1J8C A;  5BYS A;  3JSV A;  3VTV A;  1WM3 A;  3KLS X;  1YJ1 A;  1GAQ B;  1L6U A;  3Q8E A;  2KNB A;  1NYQ A;  3R2I A;  3KUC B;  2G3Q B;  2N7E A;  4NJ7 A;  2KMA A;  1K53 A;  2L7R A;  3TEZ A;  4ZOH C;  4YL8 A;  3AE9 B;  4HKQ A;  2I1J A;  2RPV A;  3VFK A;  4DHJ B;  2L00 B;  5I4D A;  1SIF A;  3N32 A;  2KX3 A;  2MBO A;  4US8 A;  1E8Z A;  2ACZ B;  1JQ4 A;  4WQO B;  3DOW A;  1MHH E;  3R66 C;  2LGX A;  2R61 A;  1GNU A;  2WXJ A;  3RZF A;  3IBE A;  4RGT A;  1LM8 B;  2MWS B;  4LDT D;  5EE1 A;  5LNK 1;  1UD7 A;  3WA0 A;  2WX0 A;  3M95 A;  1V1P B;  4WJN A;  3VUY A;  2FCS A;  1WRD B;  2KMM A;  1RLF A;  5JHB A;  5EE3 A;  2DAF A;  2KDF B;  2Y5C A;  4DHJ D;  1VCB A;  3M3J A;  4MGY E;  3U7Z A;  3AU4 A;  4RM8 A;  2LGY A;  2VH1 A;  4JLC A;  1MVK A;  3IT4 B;  4XX5 A;  1WGG A;  3N3K B;  1HTQ A;  3DWG C;  1FCL A;  2WQY B;  3EUB 2;  3QHT A;  1JWM D;  4URK A;  2DNF A;  4NPN A;  4ZRQ A;  3K9O B;  4FJZ A;  4NZL B;  3SEB A;  2KD0 A;  1ZDV A;  3FC4 A;  3DBL B;  3RT3 B;  2LJ5 A;  2CU1 A;  2G4S A;  4MJS B;  4C00 A;  4OHJ A;  1PQS A;  3N1Y C;  2ZNV B;  3UF8 A;  3J9C A;  3PRE A;  2G1E A;  5GXG B;  2DHZ A;  5HI1 A;  3W5V B;  1TS5 A;  3ZUN A;  1XLN A;  1N60 A;  4IOI E;  4DWF A;  2BWE S;  2N1V A;  4HKZ E;  1IGD A;  5AZG A;  4WJQ A;  2IY0 B;  1LGR A;  2QEJ C;  3H6N A;  2JYE A;  4JL9 A;  4MGI E;  2Y5P A;  3KVF B;  2KTR A;  4ZYN A;  2L83 A;  3C19 A;  1E5W A;  1WXM A;  2TSS A;  2IBI B;  4PS8 A;  2PW9 A;  3VAW A;  1JW9 D;  1UBI A;  3GZN I;  2MSE D;  4JX1 C;  5HG2 A;  4D2K A;  1Q0W B;  1R4M I;  1L4Z B;  2KK8 A;  4LLG M;  4IW0 A;  2WYQ A;  4HCN B;  2NBW B;  2BS2 B;  4BKT A;  2RD0 A;  5BYQ A;  3RNE C;  2FBW B;  3U30 A;  4W9K A;  2G45 B;  1K8R B;  4KSL C;  4P16 A;  2G4D B;  3DPD A;  2JX5 A;  3DBH B;  4HPM B;  2WU5 B;  2HE7 A;  4ANU A;  1E8Y A;  1D5X C;  1XXG A;  3AE2 B;  4LTU A;  4EE2 A;  1K51 A;  2KX0 A;  3APF A;  1SE4 A;  3DVN V;  4E71 A;  3R3M A;  1G6J A;  1UWM A;  5E6J A;  1NEN B;  2KTF A;  4WUR A;  5FK9 C;  2BPS A;  2LRW A;  1TZO A;  1NI2 A;  1HZ6 A;  3DVG Y;  4A90 A;  2LGS A;  2LMC A;  2HTH A;  4IM2 A;  4W9G A;  1YQB A;  5H92 C;  3PSE B;  2D10 A;  4S0R A;  2JWU A;  3TIX A;  4MM3 A;  2IY1 B;  1GG3 A;  1ZW7 A;  4NQL B;  1K50 A;  2C9W B;  1RAX A;  1NEK B;  1P0R A;  3DVN U;  2MHJ A;  1I4X A;  5CHW A;  2LGD A;  4MDK E;  1VJK A;  5FKA C;  4M8N A;  2MJD A;  1V2Y A;  3VHT C;  1AWD A;  5IKC M;  4XE0 A;  4AJW A;  4Q2J A;  3CSF A;  3EGR A;  1XT9 B;  1RRB A;  4EKU A;  3QC8 B;  4WJP A;  4JWS C;  3P4P B;  1WYG A;  3BY4 B;  3QX1 A;  1L0V B;  2SAK A;  3VUW A;  4DK5 A;  3PZD A;  2VH2 A;  3ZDT A;  4WWO A;  3NG0 A;  4G3X B;  3AEA B;  3KWL A;  3RUI B;  2D3G A;  5FR3 A;  2V4L A;  3UQA A;  3UQB A;  3N30 A;  2KLC A;  5EDS A;  2LVQ A;  2MP2 A;  1T0Q C;  4FHK A;  1E8W A;  3BYT B;  4GDK A;  2IO1 B;  3WAM A;  5AEK B;  3AEC B;  2AQ1 B;  3O65 B;  3T3N A;  1LO5 D;  4C80 A;  3TL5 A;  3RI7 C;  3IVF A;  3AM9 A;  2W55 A;  5EE9 A;  3I63 C;  5J18 A;  3QAR A;  5IN7 A;  2KDM A;  2GRI A;  3QQ8 B;  2LWP A;  3I5J C;  2JRH A;  3ZXR A;  4WH4 A;  4BKS D;  1FNV A;  4NJC A;  3EEC A;  2AL6 A;  2UYZ B;  1D6E C;  1XQQ A;  2O2V A;  4USA A;  1L7Y A;  4RGO S;  3WAP A;  1UEL A;  5DPT A;  3MJW A;  1FNU A;  4KKJ A;  4HXD A;  1KOT A;  5JH5 C;  4YXD B;  3NVY A;  4TV3 A;  1FD6 A;  2PE9 A;  4W9C A;  1R7S A;  2LEK A;  4TSS A;  3RUL A;  2W54 A;  1HZ5 A;  3RNF C;  3CMM B;  3AEE B;  2PTL A;  1P9D U;  2NPT A;  2J0K A;  4I6P A;  4IC7 B;  2WDV B;  2YEP B;  1C4A A;  1J7A A;  2KC2 A;  5C23 A;  3TMP B;  5G55 A;  2V3S A;  2MCN B;  3A4R A;  3Q3M C;  2VZK B;  3PHX B;  3QAQ A;  1IYF A;  4RNA A;  2L76 A;  2M8S A;  2Q5W D;  3ZXV A;  1FO4 A;  3AED B;  3VDZ A;  4GDL A;  2LVP A;  1R4N I;  3ENE A;  1TS2 A;  1JML A;  4N6E B;  3C8Y A;  2O2V B;  3AEG B;  3N1X C;  1ZXH A;  1ACC A;  4FHJ A;  3HIZ A;  1I4G A;  2WXO A;  4XWT A;  4KGT A;  2FIF A;  2G9H D;  3FIL A;  2BKF A;  5LLI A;  2VZK D;  4W9F A;  3VXW A;  1V5T A;  2QCZ A;  4PYZ A;  3JW0 X;  1WZ3 A;  3PTF C;  4KKI A;  1C78 A;  4B9K A;  1NYR A;  4KZC A;  2NPT B;  1Y56 A;  3RD2 A;  2GBR A;  1CMX B;  1SBB B;  3Q3J A;  2GI9 A;  4FJY A;  2OJR A;  1TS4 A;  4HPP A;  4B95 A;  3NRZ A;  4F7Z A;  4XDD A;  1JRP A;  1KH0 A;  1XD3 B;  1AAR A;  5D6J B;  4GLS C;  4RGN A;  1C77 A;  2ZPY A;  3AE3 B;  1VD2 A;  1STE A;  1IUE A;  2KZR A;  3MC8 A;  2QIL A;  2L1A A;  3SFE B;  3UI3 A;  4WWP A;  3AUL A;  3U2S C;  3OAW A;  4YTP B;  2PMV A;  4W9E A;  4M0W A;  1ISN A;  4BOZ B;  1UGJ A;  2WNM A;  2K1F A;  2K8B A;  3R7Q A;  5DPW A;  1QOA A;  5J17 A;  2CHW A;  2IO2 B;  1EU3 A;  1ENF A;  2H88 B;  3LB8 C;  1WH3 A;  3DHI C;  1SB3 C;  1X1M A;  1WSP A;  5AUK A;  1KLG D;  4N58 A;  3AE6 B;  2L52 A;  2PE6 B;  1TS3 A;  3MP9 A;  2WXM A;  2K6D B;  1A5R A;  3MJ5 A;  4ACF A;  2Z0E B;  2KAC A;  2R2O A;  4ANX A;  2N9X A;  2ON8 A;  3HUI A;  2VRR B;  2N9P C;  4DHZ B;  2O6V B;  2W9N A;  1EF1 A;  3H7P B;  5J2R A;  1T5X D;  3Q14 C;  4GMV A;  3CST A;  1OFF A;  1BUI C;  1QLB B;  4KIK B;  1C4C A;  1WIA A;  2BF8 B;  1WFY A;  4XYC A;  3AE7 B;  1YQ4 B;  2K39 A;  1FXT B;  1E0Z A;  2M17 A;  3KW5 B;  3VVW B;  4P7I A;  1ZPS A;  2Y3A A;  1TKG A;  1ROE A;  4F8C B;  1V1P A;  2O6V D;  4AP4 C;  2GBK A;  3V3X A;  1WJU A;  2KJ6 A;  3DHH C;  3PO0 A;  3BWU D;  2W82 A;  3X0W A;  2MJE A;  3P42 A;  3GOE A;  3ZJU A;  2IGG A;  5G2N A;  4LDT B;  4JQW C;  3DHG C;  3BYY B;  1JRU A;  3ALB A;  1UBQ A;  2MH7 A;  3NVW A;  5EE0 A;  3ZYY X;  2LJI A;  1AW7 A;  2V3P A;  5D94 A;  2KKC A;  2N7D A;  1WR1 A;  2WXQ A;  3DBR I;  4ICU A;  2CHZ A;  2KWD A;  4ICV A;  5AZH A;  2J42 A;  2ZZP B;  4RMA A;  2BYT A;  3PVL A;  2QHO A;  1I4P A;  4W9L A;  4MJS A;  3QIJ A;  3W1Y A;  1JCK B;  3RN9 C;  1CK1 A;  4YSY B;  2ZPN A;  4GGQ A;  4G50 A;  2XK5 B;  1ZDX A;  2PPH A;  2ICI A;  2KXJ A;  1H4R A;  2QC8 A;  4KV2 A;  4AOF A;  2L32 A;  2SEB D;  1I7H A;  4WIP A;  1L2N A;  3N1Z C;  2K5P A;  5H8Y E;  3Q8F A;  1BT0 A;  5E6P A;  3I9V 1;  1V9J A;  4YT0 B;  2KFJ A;  4WAF A;  3ZJT A;  3IG3 A;  3B1L X;  3SDL C;  2BWF A;  1Q5W B;  1WWT A;  3KH0 A;  1TBE A;  3A9J A;  1KJT A;  1C4P A;  3P63 A;  2XN9 C;  2JYT A;  3U52 E;  3MTN B;  4FAD A;  2LRU A;  4M00 A;  2ZVO A;  2MQJ A;  1T0Y A;  3HVZ A;  3TUO A;  2OED A;  1B9R A;  3NZU A;  4A8X C;  1TKY A;  3HVD A;  4W9I A;  3TBL D;  4LNO A;  5T8I A;  2BW2 A;  4KGS A;  1RWS A;  1UH6 A;  2KO3 A;  1IP9 A;  1E10 A;  4J6I A;  1HA5 A;  2W3R A;  3W5U B;  3ZO5 B;  2MLB A;  3GE3 C;  3ZVV A;  2KMC A;  2HTM E;  4ANV A;  2D5G A;  2KDE B;  1SSN A;  5JZE B;  3NVV A;  3KUD B;  1I35 A;  4A3P A;  2FCN A;  3W2D A;  2RR9 A;  2PVG C;  4MT5 A;  2CS4 A;  5CTR C;  1YMH E;  4C56 C;  2KWC A;  3P4R B;  2PIA A;  4FUL A;  3ONS A;  4JE3 B;  3ZRF A;  3IT6 B;  2L0F A;  1WR6 E;  3A9J B;  3AE5 B;  4XGA B;  1WYW B;  1D4B A;  1F9J A;  2M1M A;  2GB1 A;  1KM7 A;  4C7Y A;  1T0R C;  2GBJ A;  3LJ3 A;  3L16 A;  4KX6 B;  1SE9 A;  1F52 A;  3NS8 A;  4E74 A;  2FAZ A;  2WU2 B;  1B1Z A;  1HTO A;  1XF5 L;  3QCA A;  4WWN A;  2JU6 X;  1YN5 A;  2JF5 A;  4YSX B;  2N0S B;  2IPK D;  3O13 A;  1HEZ E;  1SJH D;  3PPA A;  1PGX A;  2A5U A;  1TJE A;  4RFB A;  2EKI A;  5BMI A;  2PLP A;  1WF9 A;  1C1Y B;  4A20 A;  1E7P B;  1OQY A;  1P3Q U;  2AQ2 B;  3Q8B A;  3AH7 A;  1VZ8 A;  2RDG A;  4EZJ A;  1WX9 A;  3NY5 A;  4GSW A;  4GU2 A;  5L95 C;  2NBV B;  4MGK E;  5FR6 A;  3VR9 B;  3DBS A;  2X38 A;  3B9J A;  4JIO U;  1WI0 A;  2D2Q A;  3KYC D;  4M01 A;  2BS3 B;  1EM7 A;  3BVZ A;  3UIO B;  1MI0 A;  2DYM A;  1ZE3 D;  2MRP A;  1GUA B;  2JT4 B;  4EZK A;  1WGY A;  2J53 A;  3ZKJ C;  4NNJ B;  1I42 A;  3RCZ A;  3ZGZ A;  4BOS C;  3A4S C;  3P1M A;  5D3D A;  3GP7 A;  3M62 B;  1YIW A;  2DZI A;  1QOF A;  4REZ A;  4TQ1 A;  4HEA 1;  3URY A;  1M94 A;  1J0G A;  3T9L A;  4F1S A;  1V80 A;  3H1U A;  1XO3 A;  2I1K A;  3VR8 B;  1WZ0 A;  3QJZ A;  2N9E B;  3E9S A;  3WAL A;  1WY8 A;  5IAA C;  3P4S B;  2HD5 B;  2RPQ A;  4EEW A;  4RCO A;  1TZ1 A;  1YJI A;  4GIV A;  2KOX A;  2E3T A;  2M4N A;  3VH4 B;  4LCD E;  2C5L C;  4HPL B;  1QF6 A;  5IO9 A;  1YN3 A;  1N62 A;  2J0J A;  2YEP F;  4MGZ E;  4JWU C;  3ZDM C;  4MH8 A;  4H2A A;  3SHQ A;  2N4F A;  1DGJ A;  3ZW3 A;  4XDC A;  2IO3 B;  3BIN A;  2IGH A;  4YTN B;  4I6N B;  2FUH B;  2WXR A;  4NQK E;  1HQR D;  1SXT A;  4II3 B;  2IYD B;  2JUO A;  1J7B A;  1N63 A;  1WE7 A;  4HDO A;  2K9X A;  4K7S A;  5IP4 D;  2K6Q A;  4RM9 A;  2WHI A;  4WJO A;  2WXK A;  2ZW0 A;  1WJN A;  2BGF A;  1KTK A;  3ZTC A;  1D5Z C;  4HJK A;  2REX A;  5G5H A;  3ZQ4 A;  4FJV B;  3UGB B;  2KVR A;  4OZB A;  3LYY A;  1UGM A;  1V1O A;  4BBN C;  3PLU A;  4K81 A;  4FBJ B;  4UDU C;  2WXI A;  1Q10 A;  1TYG B;  3X23 A;  4O1N A;  3I3T B;  1OEY J;  1Z5S B;  4ZRP A;  1KLU D;  1YQ3 B;  2GMI C;  2UWQ A;  3L4P A;  4A9A A;  1YN4 A;  2KJR A;  1I4R A;  1FEH A;  3H7S A;  2K22 A;  4OVZ A;  1CJE A;  2BYV E;  4AQ7 A;  1IBX B;  1P7F A;  1AN8 A;  1DYQ A;  3PRZ A;  4KDI C;  3M63 B;  4B6W A;  1TY2 A;  3ZLZ A;  2LXA A;  3ZNG C;  2BT6 A;  1VDV A;  1TKE A;  4AUQ C;  4EOY A;  3RYT A;  5IA7 A;  3IFW B;  3VUX A;  1QQR A;  4TMA B;  1M4V A;  3Q3N C;  3A9K B;  1WGH A;  2NMQ A;  2I38 A;  2W3S A;  3DBL I;  3AN1 A;  4AS1 A;  4AWJ A;  4N59 A;  3L10 B;  1F2R I; 
#chains in the Genus database with same CATH homology
 1PYW D;  2WDR B;  3NUH B;  4RF1 A;  3TEY A;  2QEJ C;  4NAM A;  1V1P A;  1ZUD 2;  2MJ3 A;  2DLB A;  2JYE A;  4TQ0 A;  1JAL A;  2M0A A;  2Y5P A;  3V3X A;  2JSV X;  3WCQ A;  4MM3 B;  4KGR A;  2B76 B;  2L83 A;  4A6Q A;  4HJG E;  3R8B A;  1XLO A;  3PO0 A;  1FMA D;  3TEX A;  5HFY A;  3BWU D;  1RM6 C;  2W82 A;  1WXQ A;  2MJE A;  3P42 A;  1YNT E;  4DQO C;  2TSS A;  3ZJU A;  2IGG A;  4B0E A;  5BMG A;  2RMM A;  1FXI A;  2PW9 A;  1JW9 D;  1UWX A;  3BYY B;  1I4H A;  4JX1 C;  5HG2 A;  4XWW A;  1EWY C;  2MH7 A;  4JPS A;  3NVW A;  1FCC C;  5EE0 A;  4D2K A;  1ESF A;  1DOY A;  2BS4 B;  3ZYY X;  1L4Z B;  2LJI A;  1AW7 A;  2V3P A;  4LLG M;  1IBX A;  1ZXI A;  2JXT A;  2CU3 A;  2WXQ A;  2MEK A;  3EA6 A;  1L6V A;  1ET6 A;  2XNA C;  3U4E G;  1VLB A;  2BS2 B;  2KWD A;  2WS3 B;  5BYQ A;  2WXF A;  2BTE A;  3PZ8 A;  2J42 A;  2FBW B;  4MAC A;  2BYT A;  1SIJ A;  1I4P A;  3CWI A;  1T3Q A;  1NI3 A;  1JCK B;  4P16 A;  5HHD G;  1CK1 A;  1FFU A;  2E6X A;  2JX5 A;  2WU5 B;  4YSY B;  1D5X C;  1XXG A;  3AE2 B;  4LTU A;  4EE2 A;  1K51 A;  1DOX A;  1ZDX A;  2V0G A;  2ICI A;  1ZP0 B;  1SE4 A;  2DWQ A;  2KN4 A;  1UWM A;  5E6J A;  1NEN B;  4WUR A;  5FK9 C;  1GPX A;  3MC0 B;  2L32 A;  1TZO A;  2SEB D;  4WWM A;  1HZ6 A;  2INP E;  3T3O A;  1XLQ A;  4A90 A;  1QIL A;  1I7H A;  1PGA A;  3DWM A;  4WIP A;  2LMC A;  2K5P A;  4J3O D;  5H92 C;  5H8Y E;  4C7Z A;  3Q8F A;  1UNS A;  3I9V 1;  4YT0 B;  2JWU A;  1FRD A;  4GDK B;  4WAF A;  3TSS A;  3ZJT A;  1EU4 A;  3NVZ A;  3R2T A;  3IAS 1;  1K50 A;  2PVO D;  3AB5 A;  1XLP A;  2N9K A;  1JWA D;  1NEK B;  2WXP A;  3Q8A A;  5C3J B;  1JWB D;  4L23 A;  1I4X A;  1WWT A;  4YSZ B;  3IAM 1;  1PGB A;  1VJK A;  1C4P A;  3P63 A;  5FKA C;  4OZC A;  1C79 A;  2MJD A;  2XN9 C;  3LXF A;  1QT9 A;  1E6E B;  2JYT A;  3BK2 A;  1AWD A;  2M19 A;  3BK1 A;  1RFK A;  4XE0 A;  3U52 E;  1QKZ A;  4Q2J A;  3BII D;  3EGR A;  4L2Y A;  3TUO A;  3HVZ A;  3PZ7 A;  4ITK A;  1EWC A;  2OED A;  4FXC A;  1B9R A;  4OZA A;  4JWS C;  3P4P B;  4A8X C;  1TKY A;  4A55 A;  3HVD A;  1WYG A;  4ARC A;  3FAH A;  1UUP A;  5T8I A;  2BW2 A;  4KGS A;  1RWS A;  1KFY B;  1L0V B;  2SAK A;  1E10 A;  1HA5 A;  2W3R A;  2WP9 B;  3W5U B;  4RF0 A;  1KF6 B;  1RYJ A;  5AUI A;  2HTM E;  2WXN A;  1SF0 A;  1JWS D;  1BML C;  2D5G A;  2M56 B;  2LHD A;  3SFD B;  3AE8 B;  1SSN A;  3VRB B;  3NVV A;  2J4X A;  1FIQ A;  5BYR A;  3AEA B;  3KWL A;  2AX5 A;  3W2D A;  1L0X B;  1WGK A;  5FR3 A;  1V97 A;  2PVG C;  4MT5 A;  1KRH A;  2NTS A;  1YMH E;  3ETR A;  4C56 C;  2QJL A;  3MFG A;  3HRD D;  2QIE B;  2NTT A;  3P4R B;  2PIA A;  3BYT B;  4WQM A;  4JE3 B;  2PKO A;  3IT6 B;  3V05 A;  3AE5 B;  2QSD A;  3AEC B;  1D4B A;  2AQ1 B;  2GB1 A;  1F77 A;  1C76 A;  1SE3 A;  3T3N A;  1FM0 D;  1LO5 D;  4C7Y A;  1N5W A;  4IDI A;  1I4Q A;  2WLB A;  4KX6 B;  4C80 A;  3AM9 A;  3OWE B;  4PT5 A;  2W55 A;  4ZHP A;  2WU2 B;  1B1Z A;  2N7J A;  4P6V F;  4ARI A;  1XF5 L;  2JU6 X;  4GDL B;  1YN5 A;  5EE9 A;  3H8H A;  4HRO A;  4DXG A;  2IGD A;  4YSX B;  3IXS A;  1QOB A;  2N0S B;  3AE1 B;  3AV8 A;  2IPK D;  2WDQ B;  3O13 A;  1PUT A;  4HRS A;  1HEZ E;  1SJH D;  1PGX A;  2BB6 A;  2LFI A;  4ZHO A;  1OQR A;  2KDM A;  2GRI A;  2IDY A;  3BZD B;  1TJE A;  4RH6 A;  4RFB A;  3SR6 A;  3VRA B;  2EKI A;  1MHX A;  4YWG G;  5BMI A;  2PLP A;  1NVI D;  3W9C B;  5BMH A;  4WH4 A;  1E7P B;  4IKG A;  1FNV A;  1JWU D;  4NJC A;  3FIL B;  2AQ2 B;  1D6E C;  3Q8B A;  3AH7 A;  4USA A;  1VZ8 A;  2WXL A;  2RDG A;  4RGO S;  4US9 A;  1K52 A;  5G5G A;  1FNU A;  4KKJ A;  1JRO A;  4YXD B;  3TEW A;  3NVY A;  1FD6 A;  3VR9 B;  1SJE D;  2X38 A;  3B9J A;  2BB5 A;  1R7S A;  2LEK A;  4TSS A;  4RGM A;  2W54 A;  1HZ5 A;  2J52 A;  1N5X A;  2BS3 B;  2ONQ A;  3AEE B;  1EM7 A;  1SEB D;  2PTL A;  3BVZ A;  3GB1 A;  1MI0 A;  1PFD A;  2DYM A;  1ZE3 D;  3ZJV A;  2WDV B;  2YEP B;  1C4A A;  1J7A A;  1ET9 A;  2LUM A;  1HXY D;  1T6B X;  2CJO A;  2EEL A;  2H89 B;  3AE4 B;  3RPF C;  3NZ3 A;  1E9M A;  2J53 A;  2VZK B;  2JZP A;  1VRA B;  4RNA A;  2Q5W D;  3ZGZ A;  3AEF B;  4NAW B;  5D3I B;  2LGI A;  1L0Y B;  2AQ3 B;  3P1M A;  1YJJ A;  3E56 A;  5D3D A;  5C2T B;  3GP7 A;  3GS2 A;  1FO4 A;  2I2Y A;  3AED B;  3BVG A;  4OW0 A;  5JXV A;  1A70 A;  1GB4 A;  2QMT A;  3VQI A;  1QOF A;  4REZ A;  1TS2 A;  4TQ1 A;  3B2F A;  4HEA 1;  5D7G A;  1JML A;  2JQR B;  3C8Y A;  4N6E B;  1FRR A;  3URY A;  2BBC A;  3AEG B;  1GOZ A;  4CQN A;  1F2R C;  1XO3 A;  3VR8 B;  1XEE A;  2CJN A;  1ZXH A;  1ACC A;  1MPE A;  2V3N A;  2WXG A;  1I4G A;  3E9S A;  2WXO A;  1ZOY B;  4XWT A;  3P4S B;  1CQV A;  3Q69 A;  4DXF A;  3N9Y C;  1OQQ A;  1CZP A;  4KGT A;  2K0P A;  4RCO A;  1F0Z A;  2G9H D;  3FIL A;  2K3U A;  2RDH A;  4B0M A;  1XCT L;  2VZK D;  1P7E A;  1YJI A;  2WXH A;  5TSS A;  1QOG A;  3W1S A;  4KKI A;  2E3T A;  1C78 A;  2OHF A;  4LK0 M;  1NYR A;  1C9F A;  2INN E;  2ZW1 A;  1Y56 A;  1QF6 A;  3KQ4 A;  1YN3 A;  1N62 A;  3P4Q B;  2YEP F;  1SBB B;  4JWU C;  4MH8 A;  4H2A A;  2GI9 A;  1TS4 A;  1DGJ A;  2KAJ A;  4R3D A;  1L5P A;  3CIR B;  1FFV A;  5BYS A;  3NRZ A;  1L4D B;  4XDD A;  1JRP A;  4XDC A;  1SE2 A;  1KH0 A;  2IGH A;  4YTN B;  3KLS X;  2WXR A;  4GLS C;  1VZ7 A;  3I57 A;  1GAQ B;  1HQR D;  1L6U A;  1SXT A;  1WRI A;  2KQ4 X;  4RGN A;  3Q8E A;  1NYQ A;  3R2I A;  1C77 A;  2HDE A;  1J7B A;  1N63 A;  3AE3 B;  1K53 A;  2LHE A;  3TEZ A;  2K9X A;  4ZOH C;  1STE A;  1IUE A;  4HKQ A;  3AE9 B;  2RPV A;  1XCQ L;  3BVM A;  5I4D A;  2QIL A;  2L1A A;  3SFE B;  3UI3 A;  4YTM B;  4ZYS A;  4US8 A;  3U2S C;  2WXK A;  2ZW0 A;  4YTP B;  2ACZ B;  1JQ4 A;  2PMV A;  3B2G A;  1MHH E;  1PDX A;  1KTK A;  1BXT A;  4M0W A;  1D5Z C;  1IGC A;  5G5H A;  3ZQ4 A;  1FXA A;  3RFZ B;  2R61 A;  2WXJ A;  1UGJ A;  4RGT A;  2WNM A;  1VZ6 A;  3AMZ A;  1DOI A;  4OZB A;  5EE1 A;  5LNK 1;  1V1P B;  3LYY A;  2DBY A;  1QOA A;  1V1O A;  1V8C A;  1EU3 A;  3KWV A;  2KMM A;  2FE8 A;  5EE3 A;  1ENF A;  2Y5C A;  2H88 B;  3LB8 C;  4UDU C;  2WXI A;  2V4I B;  1Q10 A;  1VR9 A;  1SB3 C;  1TYG B;  1WSP A;  4O1N A;  5AUK A;  1KLG D;  4N58 A;  3U7Z A;  1GB1 A;  3AE6 B;  4ZRP A;  1KLU D;  2L52 A;  1MVK A;  1TS3 A;  1YQ3 B;  3IT4 B;  3Q8C A;  3MP9 A;  2N9L A;  1D5M C;  2WXM A;  3L4P A;  4A9A A;  1YN4 A;  1I4R A;  3ABV B;  3MJ5 A;  4L1B A;  1FEH A;  3DWG C;  2KAC A;  1FCL A;  2K22 A;  2WQY B;  4OVZ A;  1TY0 A;  1AYF A;  3EUB 2;  1CJE A;  4AQ7 A;  1IBX B;  1P7F A;  1AN8 A;  1DYQ A;  1JWM D;  2ON8 A;  2IJ0 A;  4ZRQ A;  3HUI A;  2FUG 1;  1TY2 A;  1FNW A;  4NZL B;  3SEB A;  1ZDV A;  3FC4 A;  2BT6 A;  1VDV A;  1TKE A;  2Z8L A;  1T5X D;  4OHJ A;  1QQR A;  2DYO A;  5MPO A;  3J9C A;  4TMA B;  3AEB B;  2G1E A;  5GXG B;  1OFF A;  5HI1 A;  3W5V B;  1BUI C;  1QLB B;  1J7C A;  1M4V A;  1C4C A;  1TS5 A;  1XLN A;  2NMQ A;  1N60 A;  2I38 A;  3AE7 B;  4IOI E;  2W3S A;  1YQ4 B;  3AN1 A;  4AS1 A;  1E0Z A;  4HKZ E;  1IGD A;  3MHZ A;  1ZPS A;  2Y3A A;  4N59 A;  1N61 A;  1F2R I;  3NS1 A;  1TKG A;  1ROE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...