2NBVB

Solution structure of the rpn13 pru domain engaging the hplic2 ubl domain
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
78
structure length
78
Chain Sequence
APAEPKIIKVTVKTPKEKEEFAVPENSSVQQFKEAISKRFKSQTDQLVLIFAGKILKDQDTLIQHGIHDGLTVHLVIK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Protein binding
molecule keywords Proteasomal ubiquitin receptor ADRM1
publication title Structures of Rpn1 T1:Rad23 and hRpn13:hPLIC2 Reveal Distinct Binding Mechanisms between Substrate Receptors and Shuttle Factors of the Proteasome.
pubmed doi rcsb
source organism Homo sapiens
total genus 9
structure length 78
sequence length 78
ec nomenclature
pdb deposition date 2016-03-12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 2nbvB00
5D7GA 3T8MA 5D2MB 4K7UA 1NI2A 4MELA 3QA8A 3X23A 3NS8A 2K8CA 2ZVOA 3PPAA 1UH6A 4AUQC 3BY4B 4N9F4 2KTRB 3PHXB 2KFJA 2DX5B 2NR2A 4TUUA 1WGGA 2NPTB 4DHZB 5AZHA 3UIOB 3HM6X 5CHVC 1WJ6A 3V62A 1OTRB 4WWOA 1V81A 2DYMA 2KNBA 2ZNVC 3L16A 2I1KA 2LRUA 1V2YA 2L0TA 3VFKA 3W1YA 2KWUB 4HCNB 3NOBA 4GDLB 3RUIB 2KJ6A 2C7HA 2RPQA 3NZUA 2LGDA 3UGBB 3ZTDA 2KX0A 4M8NA 2CHZA 3WA0A 5J17A 2BPSA 4LDTB 2G45B 4GU2A 3IG3A 2GOWA 3W1SC 1Y8RC 3KVFB 2KLCA 4PS7A 1J8CA 3IHPC 4BKTA 1E8XA 2I1JA 3DQVA 3TMPB 1V5OA 2Y5BB 3ZDMC 2DENB 4ASWC 4JIOU 1Q0WB 1CMXB 2NBUA 5J2RA 4HK2A 2PE9A 4K7SA 2BWES 3ZRFA 4KVGB 3IBEA 4HPLB 2M4NA 3LDZE 4JL9A 3WIMA 1WMHA 3KYCD 3PZDA 3H9DA 2JVCA 3CSFA 3DVGY 4CHKA 2ZNVB 2C60A 3A9JA 1WYWB 4DHZE 4F8CB 2UYZB 4B6WA 1UGMA 2EMSA 1K8RB 2CHWA 3L17A 3A4SC 2DZJA 3HM3A 5CHFA 4AWJA 3DVNU 4ANUA 3GZNI 1WXSA 4RM8A 2FCMA 2FIFA 2PPHA 4TQ0A 1WZ0A 1LXDA 1G6JA 4EEWA 3QQ8B 4ANVA 1L7YA 2D10A 2KO3A 3N30A 4XZ4A 5JHBA 1EUVB 2NS5A 3QARA 3VH4B 1XD3B 2GBJA 3ZW3A 2KTRA 1WI0A 2LRWA 3B0AA 2BKFA 3KUZA 2WYQA 3PRZA 1WE6A 2IO3B 2N4FA 3PHWB 1ZW7A 1WJ4A 3QK0A 4AOFA 2JRIB 2M1MA 1OGWA 4NY0A 1KOTA 5G2NA 4EKUA 2KJHB 1KM7A 2KX3A 1WM3A 3HHMA 4AP4C 2EKEC 3ENEA 4GDLA 2NVUI 5CHWA 4ZRKA 4IG7B 3VUYA 4I6PA 1E8WA 1T0YA 3DBLI 3AULA 3K9OB 2K6DB 4K7WA 2J0MA 4JQWC 4NAWA 2MSED 3PLUA 2L76A 3APFA 4FHJA 2DZMA 3ZUNA 4RMAA 5DPSA 5C1ZA 1TGZB 3A33B 3APDA 3MJWA 3UIPB 3DCGA 1V9JA 4KSLC 2LASA 5DPWA 1WRDB 4B95A 2JXXA 1S3SG 4HLEA 3JSVA 5TR5A 2KC2A 1P3QU 4IC7B 3VTUA 1R4MI 4EZLA 4MGYE 5CTRC 3VAWA 4W9EA 5E6NA 3DPDA 1GG3A 2KVRA 2RGFA 2ZEQA 1RRBA 1WXMA 4ICVA 4DXAB 3UQAA 3VDZA 4A3OA 3I3TB 2IO1B 3LJ3A 2N1WA 3ZLZA 3M95A 2O6VB 2DYOA 1E8YA 3H7PA 2CS4A 4K1RB 3R3MA 3A1QA 2DHZA 4BOSC 2HJ8A 2R2OA 3H1UA 5E6PA 1WGYA 4KIKA 4WAAA 2BYFA 4NQLB 2NCNA 3NZSA 3EFUA 4NQKE 4E74A 1WX9A 2LGYA 1QZEA 5C23A 4BKSA 5KHOA 4DHJB 2XBBC 2JY6A 1XQQA 3V6CB 5AEKB 2JZZA 2J0KA 2WWZA 1RFAA 1Q5WB 4GB9A 4LJPB 4CO7A 2JPHA 4IWOA 3RZWC 1J0GA 3QJZA 3IFWB 1UD7A 2KFKB 2YVCA 1E5WA 4MM3A 4IUMB 3Q3JA 2C5LC 3WAMA 4HPMB 1OEYJ 3QX1A 2AL3A 4GXBA 3A9KA 3V60A 4MH0E 4FADA 4DDGD 2A5UA 3ZNID 2XK5B 4W9FA 1TZ1A 2MBBB 1Z5SB 2KKCA 4MJSB 4W9LA 3ZIMA 2BGFA 3H7SA 3CSTA 2OJRA 3MHSD 2GBMA 4FJYA 4GMVA 2FNJB 1WGHA 2PE6B 1UBQA 1RLFA 1UELA 2LVPA 4IW0A 3EECA 2KTFA 1IYFA 5HKHA 5LXIB 4M8MA 4I6NB 2IO2B 3AXCA 1WZ3A 2MX2A 2O2VA 4GSWA 3VQIA 2REXA 1RAXA 4HWIB 5AZFA 2MP2B 3DVNV 4BKSD 4BVUC 1V80A 3HK0A 2N7DA 3JVZX 1GNUA 3B08A 4HDOA 4HVBA 4FN2A 3DOWA 2AL6A 2O6VA 1P0RA 1WJNA 1WM2A 2N9XA 5LLIA 1EO6A 2R2QA 3N32A 4NJ7A 3ZNZB 2LI5A 1P1AA 5IAAC 1I35A 2L0FA 2V4LA 3RYTA 4XC2A 3DDCB 3L10B 1C1YB 4MDKE 2VRRB 3R7QA 2L7RA 2QHOA 3V61A 1E7VA 2EMTA 1NDDA 5EDSA 5IA7A 1GC6A 4NJ6A 3DBRI 1LM8B 1WH3A 3OAWA 5KHQA 3IVFA 4FULA 4K81A 4PS8A 5D94A 4I6LB 3L08A 4W9KA 2KN5A 3GOEA 4XX5A 2JZ3B 5JHAA 2NPTA 2C9WB 2ZPNA 4W9JA 4DDID 4NNJB 2DZIA 5CX3A 2N1VA 3RULA 2FIDA 3OJ3A 3ALBA 2G3QB 2CR5A 3PRMB 4GN1A 3ML9A 3OLMD 3QIJA 3C0RB 3PT2B 1IPGA 2C7NB 1TBEA 4IWQA 4E3CA 1SE9A 1P98A 4KZCA 4G3XB 2BYVE 4TQ1A 3QWZB 1LFDA 4MJSA 3VVWB 4P7IA 1WXVA 4IM0A 1WX7A 4MGZE 3B1LX 1WGDA 3EC8A 4WJNA 1EF1A 2N7EA 1I42A 4AJWA 5L95C 4KSKC 2MQJA 2MBHA 1YIWA 2ASQA 2IY0B 3PS6A 2BWFA 2L8JA 3ML8A 2KC1A 3M63B 3PREA 1V49A 3MTNB 4WWPA 4OVUA 4MSQB 2LVQA 2LUEA 3AI5A 1M94A 3DBSA 1E90A 2HE7A 4IM2A 4LJOB 4EOYA 1MG8A 2IBIB 2KDFB 2Z0DB 2FCQA 2MLBA 3L13A 5DCNA 1J19A 3WAOA 3UQBA 2JF5A 2WX0A 4PS3A 4EUTA 4F7ZA 1X1MA 3HIZA 3DBHI 3N3KB 4DWFA 3TIXA 3DVGX 1D3ZA 2AEHA 2GMIC 2KLGA 3NY5A 4MGKE 4E71A 2V1YA 1WIAA 3L54A 4WJPA 2YLMA 1YX5B 4FBJB 1V86A 3ZDTA 1UZXB 1WGRA 3RT3B 4W9GA 5L83A 2K39A 4GDKB 1YJ1A 3PV1A 4LCDE 4CYEA 3TJPA 2D3GA 3W1SA 2D07B 4W9HA 5AZGA 1WE7A 2N9EB 2Z59B 2AYOB 2LWPA 2CU1A 1WXAA 4G0NB 4FJZA 2RD0A 3TBLD 3AU5A 3VHTC 4HDQA 3ECIA 1Q1OA 1A5RA 4MEMA 3ZNHB 2LGXA 2ZVNA 1WR6E 3OJ4B 1NBFC 4PYUA 3CMMB 3X0WA 2KQSA 1WMHB 4II3B 2ZZPB 3QAQA 4RM9A 3RCZA 2M0XA 2ZPYA 2KJRA 2KZRA 3D32A 4EZKA 4WJOA 2KQ7A 4BKGA 1GJZA 4GGQA 3VH3B 2L05A 1V6EA 3V6EB 2B3AA 2KANA 5LXHA 2KMAA 3BINA 2KXJA 4W9CA 1IP9A 4X57B 2KDEB 3VTWA 2ZCBA 2IZVB 2CKHB 3KUCB 3KW5B 1FXTB 1VD2A 2HTHA 4IM3A 1YQBA 2K8HA 5DPTA 4IWPA 1BT0A 3JYUA 5DPRA 2ZCCA 1WY8A 2MBEA 3UINB 3ZTCA 1WFYA 2JRHA 1OEYA 2K25A 2CHXA 3R7RA 4ANWA 2DAFA 4WWNA 3L0WB 4ZYNA 3VTVA 3K9PB 1WX8A 4WQOB 2FUHB 3JW0X 2MBQA 3PSEB 2GBRA 3TL5A 3A4RA 4BOZB 2IYDB 3PLVA 3WAPA 3S2AA 3KYDD 3WANA 4W9IA 1F9JA 1H4RA 4W9DA 1SIFA 4HXDA 3WALA 3SU8X 2LZ6A 4GDKA 4ANXA 1XT9B 2IY1B 4NAWB 3KH0A 1UBIA 2GBKA 2KD0A 1C3TA 3H6NA 2V3SA 3P2BA 2BKRB 3O65B 2WX1A 4G50A 3ZNGC 2BF8B 4FLHA 1HE8A 4FA6A 4BFRA 1E8ZA 2JWZA 3JSVB 4DK5A 2PEAA 3T9LA 4DBGA 1WJUA 1E7UA 2M8SA 3U30A 1WR1A 2PJHA 1ISNA 4KV2A 1TTNA 1V5TA 2NBWB 2FCSA 3RZFA 2KWCA 2KFKA 4HCPB 1KLVA 2C7MB 3U8ZA 1OQYA 4EZJA 1PQSA 1R4NI 2G4DB 1SGHA 2L00B 3PTFC 3QHTA 4JLCA 1ZGUB 2RSUA 2GBNA 3VUWA 4YL8A 4WJQA 1P9DU 4FHKA 2BYEA 2XK5A 2IO0B 3H7PB 1EF5A 2FAZA 3SD5A 3A1QB 2O6VD 4KDIC 3QC8B 2KOXA 4BBNF 1YD8U 2LJ5A 2K6QA 5E6OA 4MSMB 3VUXA 2N9PC 4KIKB 4II2B 4KDLB 4ZRIA 2Z0EB 4ZDVA 2JUOA 2HD5B 1L2NA 4ZRJA 2MBOA 2KWVB 3U7DA 1YX6B 2MWSB 3AU4A 2W9NA 3RD2A 2MP2A 2MW5A 3KUDB 4TV3A 4DHJD 2LD9A 2KDBA 1VCBA 3PGEA 1GUAB 4FJVB 5JH5C 2K8BA 2MRPA 4B9KA 2J0JA 5BO4B 3TCAA 4GIVA 2M17A 2XEWA 5JZEB 3VXWA 3NHEB 3R66C 4MGIE 3ZRCA 2DAJA 5GMVA 2KMCA 2JT4B 2MA9B 3A9KB 4ICUA 2L3ZA 5FR6A 1S1QB 2LXCA 5G55A 3SDLC 1JRUA 4G11A 4J6IA 4A20A 2KDIA 1Z2MA 4JGHB 1H8CA 3ZVVA 2AWTA 4PYZA 3ZKJC 2D11A 4M0WB 2DYBA 2ZJDA 3PRPB 4LDTD 2LVOA 2O2VB 3APCA 4A3PA 4KZ0A 2LXAA 2WDTB 3Q3FA 3QCAA 4URKA 3M3JA 3CF6E 2KK8A 2J7QB 3ZO5B 1AARA 4OVVA 2UWQA 4BBNC 2FCNA 4AJYB 1LQBA 2D2QA 3EHVA 5D6JB 3UF8A 3M62B 4EFOA 4TKNA 1KJTA 5J18A 2KHWB 2A4ZA 3ONSA 1U4AA 3A9JB 3SHQA 4GOCA 4HJKA 1GC7A 1WF9A 1ZKHA 2RR9A 3PVLA 4NPNA 2DZKA 2K1FA 2MCNB 2G4SA 2OOBB 2NBVB 4F1SA
chains in the Genus database with same CATH superfamily
5D2MB 1NI2A 3QA8A 3X23A 2MJDA 1XCQL 1UH6A 3AMZA 3BY4B 5AUIA 2NR2A 1WGGA 2LFIA 1OTRB 1V1PB 2ZNVC 3L16A 2K22A 2L0TA 3NOBA 4XDDA 2RPQA 3UGBB 2LGDA 3ZTDA 4M8NA 3WA0A 2BPSA 2G45B 4GU2A 4CQNA 3KVFB 1J8CA 2QILA 4BKTA 1E8XA 2I1JA 5MPOA 3AE3B 2NBUA 3ZXVA 1VRAB 1PGXA 3ZRFA 1T0QC 3IBEA 2XN9C 3LDZE 3WIMA 3H9DA 4OVZA 4CHKA 2ZNVB 1N61A 2LUMA 4YXDB 3A4SC 3PZ8A 1HTOA 3DVNU 3GZNI 4RM8A 2YEPB 5IP4D 4ANVA 5HI1A 2J52A 2D10A 4HKZE 4K3BA 3N1YC 5JHBA 2NS5A 3QARA 2GBJA 2WDRB 1WE6A 2N4FA 1WJ4A 4AOFA 4C4VB 2D5GA 4GLSC 1V1PA 4NY0A 2V3PA 3FKYA 2J53A 1KM7A 2KX3A 3HHMA 2BTEA 2G1EA 5CHWA 4I6PA 1E8WA 3K9OB 1K50A 4NAWA 1MFWA 2HJ1A 1D4BA 4RMAA 1TGZB 3MJWA 3DCGA 1V9JA 4A9AA 5H8YE 5DPWA 3AECB 4HLEA 3W5UB 1GOZA 5IOIA 4S17A 1C77A 3VAWA 4W9EA 2ZEQA 1WXMA 1HEZE 1IBXB 2V9HA 2IO1B 2N1WA 3ZLZA 4DQOC 2KYWA 1ZP0B 2BBCA 1OQQA 3R3MA 3A1QA 1HA5A 1QOAA 2R2OA 2IPKD 5E6PA 1SJHD 1HXYD 5T8IA 1KFYB 1FXIA 3NZSA 4E74A 2JZPA 1XLOA 2XBBC 2KQ4X 5AEKB 2IGGA 3AM9A 2J0KA 2WWZA 2VH2A 1RFAA 1Q5WB 2WQYB 4GB9A 3QJZA 2YVCA 4IUMB 3QX1A 4RFBA 2AL3A 5HHDG 1HQRD 4FADA 5BMIA 1IUEA 4KKJA 5EE9A 4GMVA 1CQVA 2FNJB 1WGHA 1UBQA 3RFZB 1IYFA 1GB1A 3RNGC 5LXIB 2N7JA 2MX2A 3BYYB 3VQIA 1JROA 2REXA 3IAS1 1TS4A 4RF1A 1IBXA 1C4CA 1V80A 3B08A 3AEDB 1JQ4A 1UWXA 2N9XA 2R2QA 4NJ7A 1ZXHA 2LI5A 1P1AA 1YN5A 2L0FA 2LMCA 2WXGA 3R7QA 2I38A 3W2DA 3BK2A 3V61A 5EDSA 4K81A 3GOEA 2C9WB 2KVZA 3WCQA 3ALBA 1YMHE 3PRMB 2CR5A 2KAJA 3ML9A 1MHHE 3QIJA 1VZ8A 4A8XC 4RCOA 4IWQA 1SE9A 4IOIE 1L4ZB 3VVWB 4P7IA 4MGZE 1WX7A 2X38A 3Q3MC 1AWDA 2LHEA 4KSKC 2MQJA 2ASQA 2KC1A 4RGNA 3MTNB 4OVUA 3TEWA 3AI5A 2WXQA 2K0PA 2XNAC 1MG8A 2FCQA 2MLBA 4XDCA 3N3KB 4S0RA 2V4IB 2KLGA 3NY5A 1FM0D 2V1YA 2WDQB 4YSYB 1R4NB 1MVKA 3I9V1 4XWTA 4FBJB 3AE4B 1NI3A 2MHJA 4LLGM 3ZDTA 1WGRA 4W9GA 5L83A 1JALA 1DOYA 4LCDE 3PV1A 3RNEC 3TJPA 2WXLA 5AUKA 2D07B 2Z59B 2LGSA 2CU1A 2RMMA 4G0NB 2JXTA 3ECIA 1Q1OA 4YTMB 4A55A 2ZVNA 1WR6E 2J4XA 1NBFC 4C56C 2PIAA 4WAFA 2ZZPB 2ZPYA 4EZKA 4GGQA 4IDIA 3VH3B 2L05A 2INNE 2E6XA 2H89B 4W9CA 3TEYA 5C2TB 2IZVB 2IGHA 2CKHB 1IGDA 1YQBA 2WHIA 3ZGZA 3JYUA 2CJNA 3OG5A 1WY8A 3GP7A 2MJEA 4ANWA 2ZW0A 3VTVA 3HVZA 2MBQA 4BOZB 3S2AA 3KYDD 3TEXA 3VRAB 4W9DA 4HEA1 5FKAC 3KH0A 3H6NA 3P2BA 4HRSA 2BKRB 2BS2B 4FA6A 3Q69A 1ZPSA 3JSVB 2PEAA 1XXGA 1E7UA 2PJHA 4KGRA 4KV2A 4DXGA 1V5TA 2WXKA 4ZRPA 2FBWB 3U8ZA 1OQYA 4Q2JA 1R4NI 2BYTA 3GE3C 2W3RA 1F52A 2GBNA 3AE6B 4YL8A 4WJQA 2GI9A 1LO5D 5IN7A 4OW0A 3H7PB 2FAZA 2PTLA 1TS2A 2LJ5A 3N1XC 1T0SC 1L2NA 3U7DA 3P42A 2MWSB 3RD2A 1VR9A 2AQ2B 4OZAA 2LD9A 5JH5C 2WDVB 4BZAA 2D3BA 4MM3B 4N58A 2KN4A 1DOXA 3R66C 4EEWA 3IAM1 1UNSA 2LJIA 1I7HA 1BUIC 5FR6A 1H8CA 4A3PA 2WDTB 3CF6E 1WSPA 2KK8A 4BBNC 1I4RA 2DLBA 4YSZB 3EHVA 2WXHA 3TUOA 4EFOA 1D5MC 1F2RC 4YT0B 3AEAB 2INCC 1U4AA 1TS3A 4GOCA 2K1FA 1E10A 3AE5B 4MELA 3NS8A 2K8CA 1CZPA 3PPAA 5BMGA 1FIQA 4AUQC 2RPVA 2KFJA 3KLSX 2NPTB 4DHZB 5FR3A 3UIOB 5CHVC 1WJ6A 3V62A 4XGAB 2DYMA 2KNBA 1WRIA 2I1KA 3Q8EA 4MT5A 2JYTA 4GDLB 3RUIB 2KJ6A 3NZUA 4HJGE 3IG3A 1SE2A 5D3DA 1Y8RC 2QIEB 3IHPC 2W55A 3DQVA 3TMPB 1V5OA 2Y5BB 4ASWC 1CMXB 4HK2A 2PE9A 4K7SA 2I2YA 1NYRA 2BWES 2WXPA 2M4NA 4XYCA 4IKGA 3DVGY 1C4AA 1KTKA 4DHZE 4F8CB 1FNUA 2Z8LA 2CHWA 1KLGD 2JYEA 2FCMA 4TQ0A 1LXDA 3QQ8B 1EUVB 1HZ6A 3VH4B 1FFVA 1XD3B 1XO3A 3ZW3A 3KUZA 2WYQA 2IO3B 3Q6BA 3QK0A 4P1CC 4NJCA 2MH7A 3EFCA 2MJ3A 4GDLA 2AQ1B 4IG7B 4ZRKA 3VUYA 1T0YA 1Q10A 2J0MA 1T6BX 2L76A 3APFA 2DZMA 1MG4A 1N60A 1CJEA 5DPSA 1XEEA 2INPE 4WIPA 3A33B 3RNCC 4KSLC 1UGJA 4B95A 2W3SA 2KC2A 4IC7B 3VTUA 4EZLA 3U52E 1QKZA 4MGYE 3OWEB 1TKGA 5E6NA 3EA6A 1GG3A 4ICVA 1D6EC 4DXAB 3PO0A 1WXQA 1JW9D 4A3OA 2BS3B 1KH0A 2O6VB 1CK1A 1E8YA 1EWYC 2CS4A 2KDMA 1HZ5A 2PW9A 4BOSC 3H1UA 2B76B 3EFUA 3LXFA 1PDXA 2L52A 5C23A 1KRHA 2JY6A 1XQQA 3DHHC 3V6CB 1I4GA 4LJPB 4CO7A 3RZWC 1J0GA 3DBHB 1E5WA 3RI7C 3U2SC 1OEYJ 4ZHPA 4MH0E 2IJ0A 1J7CA 4NAMA 2A5UA 2SEBD 3Q2AC 2BGFA 3H7SA 2OJRA 3MHSD 4HROA 1RLFA 2LVPA 4M8MA 1WZ3A 2O2VA 1N5XA 1RAXA 4LNFA 5AZFA 3E56A 4YSXB 1DOIA 1XF5L 3DOWA 2O6VA 1F77A 1WM2A 3C19A 3Q8FA 2NTSA 5IAAC 2V4LA 1WWTA 4MDKE 1F0ZA 2L7RA 1K52A 1FFUA 1E7VA 2EMTA 5IA7A 1FNWA 3IVFA 4FULA 4PS8A 5D94A 3L08A 2KN5A 1ENFA 5JHAA 3NVVA 4DDID 2ZPNA 1VDVA 2OEDA 5CX3A 2FIDA 1UF0A 4D2KA 1GPXA 2G3QB 4ZHOA 3C0RB 1E0ZA 1P98A 4KZCA 4G3XB 3P4QB 1WXVA 2N7EA 1TS5A 1C9FA 2J42A 1YIWA 4OHJA 3PS6A 2BWFA 3ML8A 3PREA 4WWPA 1ET9A 1ZUD2 3DBSA 2SAKA 3AB5A 2QJLA 2IBIB 5E6JA 3L13A 5DCNA 1J19A 1FRRA 1X1MA 3DBHI 4DWFA 3DVGX 2LGIA 2AEHA 1D3ZA 2DNFA 1L4DB 1WIAA 1QF6A 1T0RC 1AYFA 1SSNA 2TSSA 4WJPA 4BAXA 1UWMA 1UZXB 2Q5WD 3ZJUA 3BIID 5BYSA 2AYOB 3BVZA 1WXAA 2YEPF 3AEBB 4C4VA 3RMKC 4HDQA 4MEMA 3ZNHB 2LGXA 3OJ4B 5GXGB 4KGSA 2KQSA 1WMHB 3RCZA 2BB5A 2KJRA 3D32A 1GJZA 4BKGA 2MEKA 2KANA 2KXJA 2KDEB 1JWUD 5D3IB 3VTWA 1FXTB 3DWGC 3Q8CA 3AE2B 2V3NA 3AH7A 3ZTCA 3AV8A 1OEYA 2DAFA 4WWNA 3L0WB 3ZXRA 3JW0X 2IYDB 1FCLA 3SEBA 4W9IA 2PKOA 1SIFA 3SU8X 4WH4A 1QOBA 2IY1B 2V3SA 3VRBB 2OHFA 2WX1A 2BF8B 3FC4A 4FLHA 2JWZA 3T9LA 4DBGA 3BWUD 2M56B 3U30A 2NBWB 2FCSA 1YJIA 2KWCA 4HCPB 1PQSA 1SGHA 4JLCA 3VUWA 1P9DU 4FHKA 1PUTA 2IO0B 1EWCA 4ARCA 1SB3C 1RYJA 3H8HA 3SD5A 2O6VD 1YN3A 3QC8B 2OJWA 1TIFA 3VUXA 1TKYA 1QOGA 4KIKB 1VZ7A 4PK1A 4ZDVA 4A90A 1YX6B 3AU4A 5H92C 2W9NA 2MW5A 1GUAB 2W54A 5BO4B 4GIVA 5JZEB 3VXWA 2DAJA 5GMVA 2KMCA 2MA9B 3A9KB 3BK1A 2WXMA 1JRPA 4PYZA 2VZKB 2ZJDA 1EU3A 1FMAD 4KZ0A 3QCAA 3CWIA 1D5ZC 2FCNA 4AJYB 1LQBA 2D2QA 4LK0M 5J18A 2QEJC 1DYQA 1E9MA 1ZE3D 4HJKA 1ZKHA 2RDGA 2G4SA 5D7GA 4K7UA 4C00A 2ZVOA 4P6VF 2D3CA 3TSSA 2KTRB 1R4MB 3PHXB 3EGRA 4WWOA 1V81A 1MHXA 2LRUA 1L6VA 4RF0A 2KWUB 4HKQA 4LDTB 2DWQA 4RGTA 3W1SC 1SXTA 2X8XX 2L1AA 3C8YA 3ZDMC 4JIOU 1Q0WB 5IKCM 4KVGB 2V0GA 1PGAA 4JL9A 2JX5A 2CU3A 3RNFC 3KYCD 3AE8B 1WYWB 3NUHB 3T3OA 2UYZB 1K8RB 3L17A 3KQ4A 5CHFA 1ZOYB 3FILB 2FIFA 1G6JA 3ZYYX 2KO3A 3E9SA 4XZ4A 5EE0A 2KTRA 1WI0A 3GS2A 3B0AA 2BKFA 3PHWB 1GB4A 2M1MA 1ZDXA 4EKUA 1JCKB 3DHIC 1WM3A 2ONQA 3ENEA 1ROEA 3Q3OC 3SR6A 2K6DB 1OQRA 4JQWC 4YTPB 2MSED 1PGBA 1TY0A 4RNAA 3UIPB 2LASA 1QOFA 3GE8C 2JXXA 3DBRB 2R61A 3JSVA 1P3QU 1R4MI 2WU5B 3DPDA 1XLQA 1JMLA 2KVRA 4OZCA 3I3TB 1P7FA 4JE3B 3FILA 2JU6X 1SBBB 3H7PA 4K1RB 1MPEA 3T3NA 2DHZA 1QT9A 1WGYA 4ITKA 1C76A 2HDEA 2PVOD 2LGYA 3NS1A 4DHJB 5KHOA 3I63C 1A70A 2JSVX 4IWOA 3IFWB 1UD7A 2KFKB 4MM3A 3Q3JA 3WAMA 4HPMB 3LYYA 3V60A 4DDGD 3ZNID 2XK5B 4L23A 4M01A 4W9FA 1TZ1A 3CIRB 5LNK1 2MBBB 1Z5SB 2EKIA 1DGJA 2KKCA 3ZIMA 3AN1A 2GBMA 3AE7B 2QSDA 3NVYA 3EECA 4I6NB 2IO2B 1PFDA 3AXCA 2WU2B 4WURA 4HWIB 2MP2B 4BKSD 2N7DA 4ZYSA 3I5JC 1GNUA 4HDOA 4FN2A 2BVCA 2AL6A 1WJNA 5LLIA 4A6QA 1EO6A 3N32A 2AQ3B 3RYTA 4XC2A 3DDCB 3L10B 1ZXIA 2VRRB 2QHOA 4YWGG 1AN8A 1NDDA 3L4PA 3DBRI 3O13A 4LNOA 3OAWA 4NJ6A 2VZKD 1R7SA 4R3DA 4XX5A 2JZ3B 2NPTA 4OZBA 2N1VA 3RULA 1FO4A 3OJ3A 2BB6A 4GN1A 3PT2B 2W82A 3W5VB 4E3CA 2BYVE 4TQ1A 1LFDA 1RFKA 4IM0A 1F1HA 1WGDA 4J3OD 1EF1A 1M4VA 1L0VB 2MBHA 1I4QA 3M63B 4MSQB 1ESFA 4IM2A 4LJOB 4EOYA 4RH6A 5EE1A 3UQBA 2N0SB 2JF5A 4EUTA 4F7ZA 3HIZA 2GMIC 4MGKE 4E71A 2YLMA 2E3TA 1F2RI 3P4PB 2WXOA 3N20C 1HTQA 2K39A 1YJ1A 4CYEA 4ARIA 2D3GA 2PLPA 3DHGC 3MJ5A 2RDBC 4W9HA 5AZGA 3B2GA 2LWPA 2WLBA 3MP9A 4FJZA 3AU5A 3VHTC 1A5RA 3HUIA 4L2YA 4PYUA 4XE0A 3X0WA 1MI0A 2NMQA 2BW2A 3SFEB 1T5XD 2KZRA 1EM7A 2KMMA 3NJTA 4TSSA 3P4RB 3LB8C 3V6EB 2KMAA 3BINA 1IP9A 5EE3A 3MC0B 4M00A 2WNMA 3AE1B 1SIJA 2UU7A 1L5PA 1RM6C 3R8BA 5DPTA 4IWPA 4O1NA 5DPRA 2ZCCA 2MBEA 2WXRA 2JRHA 2K25A 3R7RA 2JQRB 1FEHA 4ZYNA 5I4DA 3K9PB 1WX8A 4US8A 3PSEB 2GBRA 4N59A 1FPYA 3A4RA 5C3JB 3PLVA 3R2IA 3WANA 1H4RA 3IT6B 3RPFC 4ANXA 4NAWB 2QMTA 1UBIA 2GBKA 1C3TA 3O65B 4LTUA 1RWSA 4ZRQA 3I57A 1E8ZA 4DK5A 1UUPA 1WJUA 1WR1A 2L83A 3AE9B 3RZFA 1KLVA 2C7MB 4KX6B 4EZJA 2G4DB 3PTFC 3QHTA 2H88B 1ZGUB 2RSUA 1JWMD 3ETRA 1EF5A 1N5WA 3A1QB 2KOXA 4MSMB 2N9PC 1XCTL 2JUOA 2MBOA 2KWVB 2GLSA 5G5GA 4DHJD 2VH1A 2ACZB 1VCBA 2KDBA 2MRPA 1JWAD 3Q8AA 3PZ7A 2XEWA 2IDYA 1EU4A 3NHEB 3ZRCA 3IT4B 4US9A 5G55A 1JWSD 1JRUA 4J6IA 3P4SB 4WQMA 1QLBB 2LHDA 4KKIA 5BYRA 1I4PA 2GRIA 4M0WB 2DYBA 2JWUA 2LVOA 3APCA 2G9HD 4URKA 2J7QB 1GAQB 2UWQA 3NVZA 3BYTB 3Q14C 3UF8A 3B9JA 1KJTA 3MC8A 2A4ZA 3DBLB 3A9JB 3SHQA 1GC7A 3PVLA 3MC9A 2DZKA 3B2FA 1SEBD 3V3XA 1BXTA 4F1SA 3T8MA 1KLUD 1E7PB 1V97A 4N9F4 2DX5B 4TUUA 5AZHA 3HM6X 4JWUC 3URYA 2QC8A 3Q8BA 3P63A 1V2YA 3VFKA 4FXCA 3W1YA 4HCNB 1L0XB 2KACA 2C7HA 2ZW1A 2KX0A 3KWVA 2CHZA 5J17A 3BVMA 4M0WA 4H2AA 2GOWA 2ON8A 2KLCA 4LNNA 1WYGA 4PS7A 2PVGC 4ZOHC 3Q3NC 2DENB 5J2RA 1YOVB 4B0EA 1D5XC 1FD6A 2PMVA 2Y5CA 1WMHA 3PZDA 2JVCA 3CSFA 1BMLC 2C60A 3A9JA 4YTNB 2GB1A 1QQRA 4B6WA 1UGMA 2EMSA 2DZJA 3HM3A 4AWJA 4ANUA 1WXSA 2PPHA 3U7ZA 1WZ0A 1L7YA 3N30A 2KT7A 1FRDA 2LRWA 2K9XA 3PRZA 1ZW7A 1YQ4B 2JRIB 1Y56A 1OGWA 3P1MA 1KOTA 5G2NA 2KJHB 1P7EA 2LEKA 5TSSA 4AP4C 2EKEC 2NVUI 4MACA 1KF6B 3DBLI 3R2TA 3AULA 1VJKA 5BYQA 4K7WA 3PLUA 3EUB2 2KWDA 4FHJA 1IGCA 3ZUNA 5HFYA 5C1ZA 3APDA 3VR9B 1WRDB 2ICIA 5BMHA 1S3SG 5TR5A 4USAA 4K3CA 3NVWA 2HTME 5CTRC 1ZDVA 2RGFA 1RRBA 1FXAA 3UQAA 1TYGB 1I4XA 3AEEB 3VDZA 1YN4A 3LJ3A 3M95A 1YNTE 3ABVB 2DYOA 2BT6A 2WS3B 4MH8A 4N6EB 2HJ8A 1SE3A 3FAHA 4KIKA 4WAAA 2BYFA 4NQLB 2INDC 2NCNA 4NQKE 3TEZA 1WX9A 1QZEA 4NZLB 4BKSA 1TJEA 2JZZA 2JPHA 2C5LC 2Y5PA 1ET6A 3NG0A 2L32A 4GXBA 3A9KA 1ACCA 3V05A 1XLNA 4W9LA 4MJSB 3N9YC 3CSTA 4FJYA 2EELA 2PE6B 1UELA 1I4HA 4XWWA 4IW0A 1B1ZA 2KTFA 4C80A 1NENB 4KGTA 5HKHA 2WP9B 4GSWA 3NRZA 5JXVA 3N1ZC 3DVNV 4BVUC 3HK0A 3JVZX 4HVBA 2BS4B 1P0RA 1V1OA 3ZNZB 2BQQA 1I35A 1C1YB 1K51A 1L6UA 1XLPA 2DBYA 1GC6A 1NVID 1LM8B 1WH3A 5KHQA 4QAYA 4I6LB 4W9KA 1N63A 4W9JA 4NNJB 2DZIA 1YQ3B 4P1BC 5FK9C 1YJJA 3OLMD 1IPGA 2C7NB 1TBEA 3ZQ4A 1B9RA 3QWZB 4MJSA 4JX1C 3B1LX 3EC8A 4WJNA 4TMAB 1I42A 4AJWA 5L95C 3J9CA 2IY0B 3VR8B 2L8JA 4WWMA 1V49A 4P16A 2WXJA 2LVQA 2LUEA 1M94A 1E90A 2HE7A 2N9KA 3UI3A 2D3AA 2KDFB 2Z0DB 3WAOA 2WX0A 3MHZA 4PS3A 1WGKA 3TIXA 3HRDD 1PYWD 3L54A 4AQ7A 1YX5B 2M19A 4PT5A 1VZ6A 4UDUC 2FE8A 2CJOA 1V86A 4JPSA 2QDFA 1N6ZA 3RT3B 4AS1A 1LGRA 4GDKB 1JWBD 3W1SA 1WE7A 1SJED 2N9EB 4M02A 1TY2A 3HVDA 2RD0A 3TBLD 1E6EB 3CMMB 4II3B 3QAQA 4RM9A 2M0XA 4WJOA 2KQ7A 5HG2A 1N62A 4ACFA 1V6EA 2B3AA 2WXNA 5LXHA 3ZJTA 3MFGA 4X57B 2ZCBA 1TZOA 3KUCB 1VD2A 2HTHA 3KW5B 4IM3A 2K8HA 1BT0A 3UINB 1TT5B 1VLBA 1STEA 1WFYA 2CHXA 4DXFA 4LNIA 3W9CB 4WQOB 2FUHB 3TL5A 1V8CA 5IO9A 4REZA 3WAPA 1FNVA 3RNAC 1F9JA 1NEKB 3BVGA 1NYQA 4HXDA 3WALA 2LZ6A 4GDKA 1XT9B 3IXSA 4C7ZA 2K5PA 2KD0A 2AX5A 4G50A 3ZNGC 4JWSC 1HE8A 3BZDB 1MJDA 4BFRA 2M0AA 2M8SA 2IGDA 1ISNA 2WXFA 1TTNA 3GB1A 1SF0A 3SFDB 1C78A 1SE4A 2KFKA 2RDHA 1J7BA 2L00B 1J7AA 4RGMA 2BYEA 2XK5A 2WXIA 1OFFA 3AEFB 4KDIC 4BBNF 1YD8U 2K6QA 5E6OA 1AW7A 2N9LA 4II2B 4KDLB 4ZRIA 2Z0EB 2HD5B 4ZRJA 2MP2A 3KUDB 4TV3A 1T3QA 3PGEA 4HPPA 3RNBC 4FJVB 2K8BA 4B9KA 1FCCC 2J0JA 3RN9C 3TCAA 3AEGB 2M17A 2NTTA 4MGIE 2JT4B 4ICUA 1C79A 2L3ZA 1S1QB 2LXCA 1L0YB 3SDLC 1C4PA 4RGOS 3GZNB 4G11A 4A20A 2KDIA 1Z2MA 4JGHB 1TKEA 3NZ3A 2WGSA 4B0MA 2Y3AA 2AWTA 3ZVVA 3ZKJC 2D11A 3PRPB 4LDTD 2O2VB 2LXAA 3Q3FA 4C7YA 4EE2A 2K3UA 2QCZA 3M3JA 3ZO5B 1AARA 4L1BA 4OVVA 1K53A 2FUG1 3U4EG 5D6JB 4LNKA 3KWLA 3M62B 4TKNA 2KHWB 3ZJVA 3DWMA 3ONSA 5G5HA 1WF9A 2RR9A 4NPNA 1QILA 2MCNB 4HPLB 2OOBB 2NBVB
chains in the Genus database with same CATH topology
5D7GA 3T8MA 5D2MB 4K7UA 1NI2A 4MELA 3QA8A 3X23A 3NS8A 2K8CA 2ZVOA 3PPAA 1UH6A 4AUQC 3BY4B 4N9F4 2KTRB 3PHXB 2KFJA 2DX5B 2NR2A 4TUUA 1WGGA 2NPTB 4DHZB 5AZHA 3UIOB 3HM6X 5CHVC 1WJ6A 3V62A 1OTRB 4WWOA 1V81A 2DYMA 2KNBA 2ZNVC 3L16A 2I1KA 2LRUA 1V2YA 2L0TA 3VFKA 3W1YA 2KWUB 4HCNB 3NOBA 4GDLB 3RUIB 2KJ6A 2C7HA 2RPQA 3NZUA 2LGDA 3UGBB 3ZTDA 2KX0A 4M8NA 2CHZA 3WA0A 5J17A 2BPSA 4LDTB 2G45B 4GU2A 3IG3A 2GOWA 3W1SC 1Y8RC 3KVFB 2KLCA 4PS7A 1J8CA 3IHPC 4BKTA 1E8XA 2I1JA 3DQVA 3TMPB 1V5OA 2Y5BB 3ZDMC 2DENB 4ASWC 4JIOU 1Q0WB 1CMXB 2NBUA 5J2RA 4HK2A 2PE9A 4K7SA 2BWES 3ZRFA 4KVGB 3IBEA 4HPLB 2M4NA 3LDZE 4JL9A 3WIMA 1WMHA 3KYCD 3PZDA 3H9DA 2JVCA 3CSFA 3DVGY 4CHKA 2ZNVB 2C60A 3A9JA 1WYWB 4DHZE 4F8CB 2UYZB 4B6WA 1UGMA 2EMSA 1K8RB 2CHWA 3L17A 3A4SC 2DZJA 3HM3A 5CHFA 4AWJA 3DVNU 4ANUA 3GZNI 1WXSA 4RM8A 2FCMA 2FIFA 2PPHA 4TQ0A 1WZ0A 1LXDA 1G6JA 4EEWA 3QQ8B 4ANVA 1L7YA 2D10A 2KO3A 3N30A 4XZ4A 5JHBA 1EUVB 2NS5A 3QARA 3VH4B 1XD3B 2GBJA 3ZW3A 2KTRA 1WI0A 2LRWA 3B0AA 2BKFA 3KUZA 2WYQA 3PRZA 1WE6A 2IO3B 2N4FA 3PHWB 1ZW7A 1WJ4A 3QK0A 4AOFA 2JRIB 2M1MA 1OGWA 4NY0A 1KOTA 5G2NA 4EKUA 2KJHB 1KM7A 2KX3A 1WM3A 3HHMA 4AP4C 2EKEC 3ENEA 4GDLA 2NVUI 5CHWA 4ZRKA 4IG7B 3VUYA 4I6PA 1E8WA 1T0YA 3DBLI 3AULA 3K9OB 2K6DB 4K7WA 2J0MA 4JQWC 4NAWA 2MSED 3PLUA 2L76A 3APFA 4FHJA 2DZMA 3ZUNA 4RMAA 5DPSA 5C1ZA 1TGZB 3A33B 3APDA 3MJWA 3UIPB 3DCGA 1V9JA 4KSLC 2LASA 5DPWA 1WRDB 4B95A 2JXXA 1S3SG 4HLEA 3JSVA 5TR5A 2KC2A 1P3QU 4IC7B 3VTUA 1R4MI 4EZLA 4MGYE 5CTRC 3VAWA 4W9EA 5E6NA 3DPDA 1GG3A 2KVRA 2RGFA 2ZEQA 1RRBA 1WXMA 4ICVA 4DXAB 3UQAA 3VDZA 4A3OA 3I3TB 2IO1B 3LJ3A 2N1WA 3ZLZA 3M95A 2O6VB 2DYOA 1E8YA 3H7PA 2CS4A 4K1RB 3R3MA 3A1QA 2DHZA 4BOSC 2HJ8A 2R2OA 3H1UA 5E6PA 1WGYA 4KIKA 4WAAA 2BYFA 4NQLB 2NCNA 3NZSA 3EFUA 4NQKE 4E74A 1WX9A 2LGYA 1QZEA 5C23A 4BKSA 5KHOA 4DHJB 2XBBC 2JY6A 1XQQA 3V6CB 5AEKB 2JZZA 2J0KA 2WWZA 1RFAA 1Q5WB 4GB9A 4LJPB 4CO7A 2JPHA 4IWOA 3RZWC 1J0GA 3QJZA 3IFWB 1UD7A 2KFKB 2YVCA 1E5WA 4MM3A 4IUMB 3Q3JA 2C5LC 3WAMA 4HPMB 1OEYJ 3QX1A 2AL3A 4GXBA 3A9KA 3V60A 4MH0E 4FADA 4DDGD 2A5UA 3ZNID 2XK5B 4W9FA 1TZ1A 2MBBB 1Z5SB 2KKCA 4MJSB 4W9LA 3ZIMA 2BGFA 3H7SA 3CSTA 2OJRA 3MHSD 2GBMA 4FJYA 4GMVA 2FNJB 1WGHA 2PE6B 1UBQA 1RLFA 1UELA 2LVPA 4IW0A 3EECA 2KTFA 1IYFA 5HKHA 5LXIB 4M8MA 4I6NB 2IO2B 3AXCA 1WZ3A 2MX2A 2O2VA 4GSWA 3VQIA 2REXA 1RAXA 4HWIB 5AZFA 2MP2B 3DVNV 4BKSD 4BVUC 1V80A 3HK0A 2N7DA 3JVZX 1GNUA 3B08A 4HDOA 4HVBA 4FN2A 3DOWA 2AL6A 2O6VA 1P0RA 1WJNA 1WM2A 2N9XA 5LLIA 1EO6A 2R2QA 3N32A 4NJ7A 3ZNZB 2LI5A 1P1AA 5IAAC 1I35A 2L0FA 2V4LA 3RYTA 4XC2A 3DDCB 3L10B 1C1YB 4MDKE 2VRRB 3R7QA 2L7RA 2QHOA 3V61A 1E7VA 2EMTA 1NDDA 5EDSA 5IA7A 1GC6A 4NJ6A 3DBRI 1LM8B 1WH3A 3OAWA 5KHQA 3IVFA 4FULA 4K81A 4PS8A 5D94A 4I6LB 3L08A 4W9KA 2KN5A 3GOEA 4XX5A 2JZ3B 5JHAA 2NPTA 2C9WB 2ZPNA 4W9JA 4DDID 4NNJB 2DZIA 5CX3A 2N1VA 3RULA 2FIDA 3OJ3A 3ALBA 2G3QB 2CR5A 3PRMB 4GN1A 3ML9A 3OLMD 3QIJA 3C0RB 3PT2B 1IPGA 2C7NB 1TBEA 4IWQA 4E3CA 1SE9A 1P98A 4KZCA 4G3XB 2BYVE 4TQ1A 3QWZB 1LFDA 4MJSA 3VVWB 4P7IA 1WXVA 4IM0A 1WX7A 4MGZE 3B1LX 1WGDA 3EC8A 4WJNA 1EF1A 2N7EA 1I42A 4AJWA 5L95C 4KSKC 2MQJA 2MBHA 1YIWA 2ASQA 2IY0B 3PS6A 2BWFA 2L8JA 3ML8A 2KC1A 3M63B 3PREA 1V49A 3MTNB 4WWPA 4OVUA 4MSQB 2LVQA 2LUEA 3AI5A 1M94A 3DBSA 1E90A 2HE7A 4IM2A 4LJOB 4EOYA 1MG8A 2IBIB 2KDFB 2Z0DB 2FCQA 2MLBA 3L13A 5DCNA 1J19A 3WAOA 3UQBA 2JF5A 2WX0A 4PS3A 4EUTA 4F7ZA 1X1MA 3HIZA 3DBHI 3N3KB 4DWFA 3TIXA 3DVGX 1D3ZA 2AEHA 2GMIC 2KLGA 3NY5A 4MGKE 4E71A 2V1YA 1WIAA 3L54A 4WJPA 2YLMA 1YX5B 4FBJB 1V86A 3ZDTA 1UZXB 1WGRA 3RT3B 4W9GA 5L83A 2K39A 4GDKB 1YJ1A 3PV1A 4LCDE 4CYEA 3TJPA 2D3GA 3W1SA 2D07B 4W9HA 5AZGA 1WE7A 2N9EB 2Z59B 2AYOB 2LWPA 2CU1A 1WXAA 4G0NB 4FJZA 2RD0A 3TBLD 3AU5A 3VHTC 4HDQA 3ECIA 1Q1OA 1A5RA 4MEMA 3ZNHB 2LGXA 2ZVNA 1WR6E 3OJ4B 1NBFC 4PYUA 3CMMB 3X0WA 2KQSA 1WMHB 4II3B 2ZZPB 3QAQA 4RM9A 3RCZA 2M0XA 2ZPYA 2KJRA 2KZRA 3D32A 4EZKA 4WJOA 2KQ7A 4BKGA 1GJZA 4GGQA 3VH3B 2L05A 1V6EA 3V6EB 2B3AA 2KANA 5LXHA 2KMAA 3BINA 2KXJA 4W9CA 1IP9A 4X57B 2KDEB 3VTWA 2ZCBA 2IZVB 2CKHB 3KUCB 3KW5B 1FXTB 1VD2A 2HTHA 4IM3A 1YQBA 2K8HA 5DPTA 4IWPA 1BT0A 3JYUA 5DPRA 2ZCCA 1WY8A 2MBEA 3UINB 3ZTCA 1WFYA 2JRHA 1OEYA 2K25A 2CHXA 3R7RA 4ANWA 2DAFA 4WWNA 3L0WB 4ZYNA 3VTVA 3K9PB 1WX8A 4WQOB 2FUHB 3JW0X 2MBQA 3PSEB 2GBRA 3TL5A 3A4RA 4BOZB 2IYDB 3PLVA 3WAPA 3S2AA 3KYDD 3WANA 4W9IA 1F9JA 1H4RA 4W9DA 1SIFA 4HXDA 3WALA 3SU8X 2LZ6A 4GDKA 4ANXA 1XT9B 2IY1B 4NAWB 3KH0A 1UBIA 2GBKA 2KD0A 1C3TA 3H6NA 2V3SA 3P2BA 2BKRB 3O65B 2WX1A 4G50A 3ZNGC 2BF8B 4FLHA 1HE8A 4FA6A 4BFRA 1E8ZA 2JWZA 3JSVB 4DK5A 2PEAA 3T9LA 4DBGA 1WJUA 1E7UA 2M8SA 3U30A 1WR1A 2PJHA 1ISNA 4KV2A 1TTNA 1V5TA 2NBWB 2FCSA 3RZFA 2KWCA 2KFKA 4HCPB 1KLVA 2C7MB 3U8ZA 1OQYA 4EZJA 1PQSA 1R4NI 2G4DB 1SGHA 2L00B 3PTFC 3QHTA 4JLCA 1ZGUB 2RSUA 2GBNA 3VUWA 4YL8A 4WJQA 1P9DU 4FHKA 2BYEA 2XK5A 2IO0B 3H7PB 1EF5A 2FAZA 3SD5A 3A1QB 2O6VD 4KDIC 3QC8B 2KOXA 4BBNF 1YD8U 2LJ5A 2K6QA 5E6OA 4MSMB 3VUXA 2N9PC 4KIKB 4II2B 4KDLB 4ZRIA 2Z0EB 4ZDVA 2JUOA 2HD5B 1L2NA 4ZRJA 2MBOA 2KWVB 3U7DA 1YX6B 2MWSB 3AU4A 2W9NA 3RD2A 2MP2A 2MW5A 3KUDB 4TV3A 4DHJD 2LD9A 2KDBA 1VCBA 3PGEA 1GUAB 4FJVB 5JH5C 2K8BA 2MRPA 4B9KA 2J0JA 5BO4B 3TCAA 4GIVA 2M17A 2XEWA 5JZEB 3VXWA 3NHEB 3R66C 4MGIE 3ZRCA 2DAJA 5GMVA 2KMCA 2JT4B 2MA9B 3A9KB 4ICUA 2L3ZA 5FR6A 1S1QB 2LXCA 5G55A 3SDLC 1JRUA 4G11A 4J6IA 4A20A 2KDIA 1Z2MA 4JGHB 1H8CA 3ZVVA 2AWTA 4PYZA 3ZKJC 2D11A 4M0WB 2DYBA 2ZJDA 3PRPB 4LDTD 2LVOA 2O2VB 3APCA 4A3PA 4KZ0A 2LXAA 2WDTB 3Q3FA 3QCAA 4URKA 3M3JA 3CF6E 2KK8A 2J7QB 3ZO5B 1AARA 4OVVA 2UWQA 4BBNC 2FCNA 4AJYB 1LQBA 2D2QA 3EHVA 5D6JB 3UF8A 3M62B 4EFOA 4TKNA 1KJTA 5J18A 2KHWB 2A4ZA 3ONSA 1U4AA 3A9JB 3SHQA 4GOCA 4HJKA 1GC7A 1WF9A 1ZKHA 2RR9A 3PVLA 4NPNA 2DZKA 2K1FA 2MCNB 2G4SA 2OOBB 2NBVB 4F1SA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5D7G A;  3T8M A;  5D2M B;  4K7U A;  1NI2 A;  4MEL A;  3QA8 A;  3X23 A;  3NS8 A;  2K8C A;  2ZVO A;  3PPA A;  1UH6 A;  4AUQ C;  3BY4 B;  4N9F 4;  2KTR B;  3PHX B;  2KFJ A;  2DX5 B;  2NR2 A;  4TUU A;  1WGG A;  2NPT B;  4DHZ B;  5AZH A;  3UIO B;  3HM6 X;  5CHV C;  1WJ6 A;  3V62 A;  1OTR B;  4WWO A;  1V81 A;  2DYM A;  2KNB A;  2ZNV C;  3L16 A;  2I1K A;  2LRU A;  1V2Y A;  2L0T A;  3VFK A;  3W1Y A;  2KWU B;  4HCN B;  3NOB A;  4GDL B;  3RUI B;  2KJ6 A;  2C7H A;  2RPQ A;  3NZU A;  2LGD A;  3UGB B;  3ZTD A;  2KX0 A;  4M8N A;  2CHZ A;  3WA0 A;  5J17 A;  2BPS A;  4LDT B;  2G45 B;  4GU2 A;  3IG3 A;  2GOW A;  3W1S C;  1Y8R C;  3KVF B;  2KLC A;  4PS7 A;  1J8C A;  3IHP C;  4BKT A;  1E8X A;  2I1J A;  3DQV A;  3TMP B;  1V5O A;  2Y5B B;  3ZDM C;  2DEN B;  4ASW C;  4JIO U;  1Q0W B;  1CMX B;  2NBU A;  5J2R A;  4HK2 A;  2PE9 A;  4K7S A;  2BWE S;  3ZRF A;  4KVG B;  3IBE A;  4HPL B;  2M4N A;  3LDZ E;  4JL9 A;  3WIM A;  1WMH A;  3KYC D;  3PZD A;  3H9D A;  2JVC A;  3CSF A;  3DVG Y;  4CHK A;  2ZNV B;  2C60 A;  3A9J A;  1WYW B;  4DHZ E;  4F8C B;  2UYZ B;  4B6W A;  1UGM A;  2EMS A;  1K8R B;  2CHW A;  3L17 A;  3A4S C;  2DZJ A;  3HM3 A;  5CHF A;  4AWJ A;  3DVN U;  4ANU A;  3GZN I;  1WXS A;  4RM8 A;  2FCM A;  2FIF A;  2PPH A;  4TQ0 A;  1WZ0 A;  1LXD A;  1G6J A;  4EEW A;  3QQ8 B;  4ANV A;  1L7Y A;  2D10 A;  2KO3 A;  3N30 A;  4XZ4 A;  5JHB A;  1EUV B;  2NS5 A;  3QAR A;  3VH4 B;  1XD3 B;  2GBJ A;  3ZW3 A;  2KTR A;  1WI0 A;  2LRW A;  3B0A A;  2BKF A;  3KUZ A;  2WYQ A;  3PRZ A;  1WE6 A;  2IO3 B;  2N4F A;  3PHW B;  1ZW7 A;  1WJ4 A;  3QK0 A;  4AOF A;  2JRI B;  2M1M A;  1OGW A;  4NY0 A;  1KOT A;  5G2N A;  4EKU A;  2KJH B;  1KM7 A;  2KX3 A;  1WM3 A;  3HHM A;  4AP4 C;  2EKE C;  3ENE A;  4GDL A;  2NVU I;  5CHW A;  4ZRK A;  4IG7 B;  3VUY A;  4I6P A;  1E8W A;  1T0Y A;  3DBL I;  3AUL A;  3K9O B;  2K6D B;  4K7W A;  2J0M A;  4JQW C;  4NAW A;  2MSE D;  3PLU A;  2L76 A;  3APF A;  4FHJ A;  2DZM A;  3ZUN A;  4RMA A;  5DPS A;  5C1Z A;  1TGZ B;  3A33 B;  3APD A;  3MJW A;  3UIP B;  3DCG A;  1V9J A;  4KSL C;  2LAS A;  5DPW A;  1WRD B;  4B95 A;  2JXX A;  1S3S G;  4HLE A;  3JSV A;  5TR5 A;  2KC2 A;  1P3Q U;  4IC7 B;  3VTU A;  1R4M I;  4EZL A;  4MGY E;  5CTR C;  3VAW A;  4W9E A;  5E6N A;  3DPD A;  1GG3 A;  2KVR A;  2RGF A;  2ZEQ A;  1RRB A;  1WXM A;  4ICV A;  4DXA B;  3UQA A;  3VDZ A;  4A3O A;  3I3T B;  2IO1 B;  3LJ3 A;  2N1W A;  3ZLZ A;  3M95 A;  2O6V B;  2DYO A;  1E8Y A;  3H7P A;  2CS4 A;  4K1R B;  3R3M A;  3A1Q A;  2DHZ A;  4BOS C;  2HJ8 A;  2R2O A;  3H1U A;  5E6P A;  1WGY A;  4KIK A;  4WAA A;  2BYF A;  4NQL B;  2NCN A;  3NZS A;  3EFU A;  4NQK E;  4E74 A;  1WX9 A;  2LGY A;  1QZE A;  5C23 A;  4BKS A;  5KHO A;  4DHJ B;  2XBB C;  2JY6 A;  1XQQ A;  3V6C B;  5AEK B;  2JZZ A;  2J0K A;  2WWZ A;  1RFA A;  1Q5W B;  4GB9 A;  4LJP B;  4CO7 A;  2JPH A;  4IWO A;  3RZW C;  1J0G A;  3QJZ A;  3IFW B;  1UD7 A;  2KFK B;  2YVC A;  1E5W A;  4MM3 A;  4IUM B;  3Q3J A;  2C5L C;  3WAM A;  4HPM B;  1OEY J;  3QX1 A;  2AL3 A;  4GXB A;  3A9K A;  3V60 A;  4MH0 E;  4FAD A;  4DDG D;  2A5U A;  3ZNI D;  2XK5 B;  4W9F A;  1TZ1 A;  2MBB B;  1Z5S B;  2KKC A;  4MJS B;  4W9L A;  3ZIM A;  2BGF A;  3H7S A;  3CST A;  2OJR A;  3MHS D;  2GBM A;  4FJY A;  4GMV A;  2FNJ B;  1WGH A;  2PE6 B;  1UBQ A;  1RLF A;  1UEL A;  2LVP A;  4IW0 A;  3EEC A;  2KTF A;  1IYF A;  5HKH A;  5LXI B;  4M8M A;  4I6N B;  2IO2 B;  3AXC A;  1WZ3 A;  2MX2 A;  2O2V A;  4GSW A;  3VQI A;  2REX A;  1RAX A;  4HWI B;  5AZF A;  2MP2 B;  3DVN V;  4BKS D;  4BVU C;  1V80 A;  3HK0 A;  2N7D A;  3JVZ X;  1GNU A;  3B08 A;  4HDO A;  4HVB A;  4FN2 A;  3DOW A;  2AL6 A;  2O6V A;  1P0R A;  1WJN A;  1WM2 A;  2N9X A;  5LLI A;  1EO6 A;  2R2Q A;  3N32 A;  4NJ7 A;  3ZNZ B;  2LI5 A;  1P1A A;  5IAA C;  1I35 A;  2L0F A;  2V4L A;  3RYT A;  4XC2 A;  3DDC B;  3L10 B;  1C1Y B;  4MDK E;  2VRR B;  3R7Q A;  2L7R A;  2QHO A;  3V61 A;  1E7V A;  2EMT A;  1NDD A;  5EDS A;  5IA7 A;  1GC6 A;  4NJ6 A;  3DBR I;  1LM8 B;  1WH3 A;  3OAW A;  5KHQ A;  3IVF A;  4FUL A;  4K81 A;  4PS8 A;  5D94 A;  4I6L B;  3L08 A;  4W9K A;  2KN5 A;  3GOE A;  4XX5 A;  2JZ3 B;  5JHA A;  2NPT A;  2C9W B;  2ZPN A;  4W9J A;  4DDI D;  4NNJ B;  2DZI A;  5CX3 A;  2N1V A;  3RUL A;  2FID A;  3OJ3 A;  3ALB A;  2G3Q B;  2CR5 A;  3PRM B;  4GN1 A;  3ML9 A;  3OLM D;  3QIJ A;  3C0R B;  3PT2 B;  1IPG A;  2C7N B;  1TBE A;  4IWQ A;  4E3C A;  1SE9 A;  1P98 A;  4KZC A;  4G3X B;  2BYV E;  4TQ1 A;  3QWZ B;  1LFD A;  4MJS A;  3VVW B;  4P7I A;  1WXV A;  4IM0 A;  1WX7 A;  4MGZ E;  3B1L X;  1WGD A;  3EC8 A;  4WJN A;  1EF1 A;  2N7E A;  1I42 A;  4AJW A;  5L95 C;  4KSK C;  2MQJ A;  2MBH A;  1YIW A;  2ASQ A;  2IY0 B;  3PS6 A;  2BWF A;  2L8J A;  3ML8 A;  2KC1 A;  3M63 B;  3PRE A;  1V49 A;  3MTN B;  4WWP A;  4OVU A;  4MSQ B;  2LVQ A;  2LUE A;  3AI5 A;  1M94 A;  3DBS A;  1E90 A;  2HE7 A;  4IM2 A;  4LJO B;  4EOY A;  1MG8 A;  2IBI B;  2KDF B;  2Z0D B;  2FCQ A;  2MLB A;  3L13 A;  5DCN A;  1J19 A;  3WAO A;  3UQB A;  2JF5 A;  2WX0 A;  4PS3 A;  4EUT A;  4F7Z A;  1X1M A;  3HIZ A;  3DBH I;  3N3K B;  4DWF A;  3TIX A;  3DVG X;  1D3Z A;  2AEH A;  2GMI C;  2KLG A;  3NY5 A;  4MGK E;  4E71 A;  2V1Y A;  1WIA A;  3L54 A;  4WJP A;  2YLM A;  1YX5 B;  4FBJ B;  1V86 A;  3ZDT A;  1UZX B;  1WGR A;  3RT3 B;  4W9G A;  5L83 A;  2K39 A;  4GDK B;  1YJ1 A;  3PV1 A;  4LCD E;  4CYE A;  3TJP A;  2D3G A;  3W1S A;  2D07 B;  4W9H A;  5AZG A;  1WE7 A;  2N9E B;  2Z59 B;  2AYO B;  2LWP A;  2CU1 A;  1WXA A;  4G0N B;  4FJZ A;  2RD0 A;  3TBL D;  3AU5 A;  3VHT C;  4HDQ A;  3ECI A;  1Q1O A;  1A5R A;  4MEM A;  3ZNH B;  2LGX A;  2ZVN A;  1WR6 E;  3OJ4 B;  1NBF C;  4PYU A;  3CMM B;  3X0W A;  2KQS A;  1WMH B;  4II3 B;  2ZZP B;  3QAQ A;  4RM9 A;  3RCZ A;  2M0X A;  2ZPY A;  2KJR A;  2KZR A;  3D32 A;  4EZK A;  4WJO A;  2KQ7 A;  4BKG A;  1GJZ A;  4GGQ A;  3VH3 B;  2L05 A;  1V6E A;  3V6E B;  2B3A A;  2KAN A;  5LXH A;  2KMA A;  3BIN A;  2KXJ A;  4W9C A;  1IP9 A;  4X57 B;  2KDE B;  3VTW A;  2ZCB A;  2IZV B;  2CKH B;  3KUC B;  3KW5 B;  1FXT B;  1VD2 A;  2HTH A;  4IM3 A;  1YQB A;  2K8H A;  5DPT A;  4IWP A;  1BT0 A;  3JYU A;  5DPR A;  2ZCC A;  1WY8 A;  2MBE A;  3UIN B;  3ZTC A;  1WFY A;  2JRH A;  1OEY A;  2K25 A;  2CHX A;  3R7R A;  4ANW A;  2DAF A;  4WWN A;  3L0W B;  4ZYN A;  3VTV A;  3K9P B;  1WX8 A;  4WQO B;  2FUH B;  3JW0 X;  2MBQ A;  3PSE B;  2GBR A;  3TL5 A;  3A4R A;  4BOZ B;  2IYD B;  3PLV A;  3WAP A;  3S2A A;  3KYD D;  3WAN A;  4W9I A;  1F9J A;  1H4R A;  4W9D A;  1SIF A;  4HXD A;  3WAL A;  3SU8 X;  2LZ6 A;  4GDK A;  4ANX A;  1XT9 B;  2IY1 B;  4NAW B;  3KH0 A;  1UBI A;  2GBK A;  2KD0 A;  1C3T A;  3H6N A;  2V3S A;  3P2B A;  2BKR B;  3O65 B;  2WX1 A;  4G50 A;  3ZNG C;  2BF8 B;  4FLH A;  1HE8 A;  4FA6 A;  4BFR A;  1E8Z A;  2JWZ A;  3JSV B;  4DK5 A;  2PEA A;  3T9L A;  4DBG A;  1WJU A;  1E7U A;  2M8S A;  3U30 A;  1WR1 A;  2PJH A;  1ISN A;  4KV2 A;  1TTN A;  1V5T A;  2NBW B;  2FCS A;  3RZF A;  2KWC A;  2KFK A;  4HCP B;  1KLV A;  2C7M B;  3U8Z A;  1OQY A;  4EZJ A;  1PQS A;  1R4N I;  2G4D B;  1SGH A;  2L00 B;  3PTF C;  3QHT A;  4JLC A;  1ZGU B;  2RSU A;  2GBN A;  3VUW A;  4YL8 A;  4WJQ A;  1P9D U;  4FHK A;  2BYE A;  2XK5 A;  2IO0 B;  3H7P B;  1EF5 A;  2FAZ A;  3SD5 A;  3A1Q B;  2O6V D;  4KDI C;  3QC8 B;  2KOX A;  4BBN F;  1YD8 U;  2LJ5 A;  2K6Q A;  5E6O A;  4MSM B;  3VUX A;  2N9P C;  4KIK B;  4II2 B;  4KDL B;  4ZRI A;  2Z0E B;  4ZDV A;  2JUO A;  2HD5 B;  1L2N A;  4ZRJ A;  2MBO A;  2KWV B;  3U7D A;  1YX6 B;  2MWS B;  3AU4 A;  2W9N A;  3RD2 A;  2MP2 A;  2MW5 A;  3KUD B;  4TV3 A;  4DHJ D;  2LD9 A;  2KDB A;  1VCB A;  3PGE A;  1GUA B;  4FJV B;  5JH5 C;  2K8B A;  2MRP A;  4B9K A;  2J0J A;  5BO4 B;  3TCA A;  4GIV A;  2M17 A;  2XEW A;  5JZE B;  3VXW A;  3NHE B;  3R66 C;  4MGI E;  3ZRC A;  2DAJ A;  5GMV A;  2KMC A;  2JT4 B;  2MA9 B;  3A9K B;  4ICU A;  2L3Z A;  5FR6 A;  1S1Q B;  2LXC A;  5G55 A;  3SDL C;  1JRU A;  4G11 A;  4J6I A;  4A20 A;  2KDI A;  1Z2M A;  4JGH B;  1H8C A;  3ZVV A;  2AWT A;  4PYZ A;  3ZKJ C;  2D11 A;  4M0W B;  2DYB A;  2ZJD A;  3PRP B;  4LDT D;  2LVO A;  2O2V B;  3APC A;  4A3P A;  4KZ0 A;  2LXA A;  2WDT B;  3Q3F A;  3QCA A;  4URK A;  3M3J A;  3CF6 E;  2KK8 A;  2J7Q B;  3ZO5 B;  1AAR A;  4OVV A;  2UWQ A;  4BBN C;  2FCN A;  4AJY B;  1LQB A;  2D2Q A;  3EHV A;  5D6J B;  3UF8 A;  3M62 B;  4EFO A;  4TKN A;  1KJT A;  5J18 A;  2KHW B;  2A4Z A;  3ONS A;  1U4A A;  3A9J B;  3SHQ A;  4GOC A;  4HJK A;  1GC7 A;  1WF9 A;  1ZKH A;  2RR9 A;  3PVL A;  4NPN A;  2DZK A;  2K1F A;  2MCN B;  2G4S A;  2OOB B;  2NBV B;  4F1S A; 
#chains in the Genus database with same CATH topology
 5D2M B;  1NI2 A;  3QA8 A;  3X23 A;  2MJD A;  1XCQ L;  1UH6 A;  3AMZ A;  3BY4 B;  5AUI A;  2NR2 A;  1WGG A;  2LFI A;  1OTR B;  1V1P B;  2ZNV C;  3L16 A;  2K22 A;  2L0T A;  3NOB A;  4XDD A;  2RPQ A;  3UGB B;  2LGD A;  3ZTD A;  4M8N A;  3WA0 A;  2BPS A;  2G45 B;  4GU2 A;  4CQN A;  3KVF B;  1J8C A;  2QIL A;  4BKT A;  1E8X A;  2I1J A;  5MPO A;  3AE3 B;  2NBU A;  3ZXV A;  1VRA B;  1PGX A;  3ZRF A;  1T0Q C;  3IBE A;  2XN9 C;  3LDZ E;  3WIM A;  3H9D A;  4OVZ A;  4CHK A;  2ZNV B;  1N61 A;  2LUM A;  4YXD B;  3A4S C;  3PZ8 A;  1HTO A;  3DVN U;  3GZN I;  4RM8 A;  2YEP B;  5IP4 D;  4ANV A;  5HI1 A;  2J52 A;  2D10 A;  4HKZ E;  4K3B A;  3N1Y C;  5JHB A;  2NS5 A;  3QAR A;  2GBJ A;  2WDR B;  1WE6 A;  2N4F A;  1WJ4 A;  4AOF A;  4C4V B;  2D5G A;  4GLS C;  1V1P A;  4NY0 A;  2V3P A;  3FKY A;  2J53 A;  1KM7 A;  2KX3 A;  3HHM A;  2BTE A;  2G1E A;  5CHW A;  4I6P A;  1E8W A;  3K9O B;  1K50 A;  4NAW A;  1MFW A;  2HJ1 A;  1D4B A;  4RMA A;  1TGZ B;  3MJW A;  3DCG A;  1V9J A;  4A9A A;  5H8Y E;  5DPW A;  3AEC B;  4HLE A;  3W5U B;  1GOZ A;  5IOI A;  4S17 A;  1C77 A;  3VAW A;  4W9E A;  2ZEQ A;  1WXM A;  1HEZ E;  1IBX B;  2V9H A;  2IO1 B;  2N1W A;  3ZLZ A;  4DQO C;  2KYW A;  1ZP0 B;  2BBC A;  1OQQ A;  3R3M A;  3A1Q A;  1HA5 A;  1QOA A;  2R2O A;  2IPK D;  5E6P A;  1SJH D;  1HXY D;  5T8I A;  1KFY B;  1FXI A;  3NZS A;  4E74 A;  2JZP A;  1XLO A;  2XBB C;  2KQ4 X;  5AEK B;  2IGG A;  3AM9 A;  2J0K A;  2WWZ A;  2VH2 A;  1RFA A;  1Q5W B;  2WQY B;  4GB9 A;  3QJZ A;  2YVC A;  4IUM B;  3QX1 A;  4RFB A;  2AL3 A;  5HHD G;  1HQR D;  4FAD A;  5BMI A;  1IUE A;  4KKJ A;  5EE9 A;  4GMV A;  1CQV A;  2FNJ B;  1WGH A;  1UBQ A;  3RFZ B;  1IYF A;  1GB1 A;  3RNG C;  5LXI B;  2N7J A;  2MX2 A;  3BYY B;  3VQI A;  1JRO A;  2REX A;  3IAS 1;  1TS4 A;  4RF1 A;  1IBX A;  1C4C A;  1V80 A;  3B08 A;  3AED B;  1JQ4 A;  1UWX A;  2N9X A;  2R2Q A;  4NJ7 A;  1ZXH A;  2LI5 A;  1P1A A;  1YN5 A;  2L0F A;  2LMC A;  2WXG A;  3R7Q A;  2I38 A;  3W2D A;  3BK2 A;  3V61 A;  5EDS A;  4K81 A;  3GOE A;  2C9W B;  2KVZ A;  3WCQ A;  3ALB A;  1YMH E;  3PRM B;  2CR5 A;  2KAJ A;  3ML9 A;  1MHH E;  3QIJ A;  1VZ8 A;  4A8X C;  4RCO A;  4IWQ A;  1SE9 A;  4IOI E;  1L4Z B;  3VVW B;  4P7I A;  4MGZ E;  1WX7 A;  2X38 A;  3Q3M C;  1AWD A;  2LHE A;  4KSK C;  2MQJ A;  2ASQ A;  2KC1 A;  4RGN A;  3MTN B;  4OVU A;  3TEW A;  3AI5 A;  2WXQ A;  2K0P A;  2XNA C;  1MG8 A;  2FCQ A;  2MLB A;  4XDC A;  3N3K B;  4S0R A;  2V4I B;  2KLG A;  3NY5 A;  1FM0 D;  2V1Y A;  2WDQ B;  4YSY B;  1R4N B;  1MVK A;  3I9V 1;  4XWT A;  4FBJ B;  3AE4 B;  1NI3 A;  2MHJ A;  4LLG M;  3ZDT A;  1WGR A;  4W9G A;  5L83 A;  1JAL A;  1DOY A;  4LCD E;  3PV1 A;  3RNE C;  3TJP A;  2WXL A;  5AUK A;  2D07 B;  2Z59 B;  2LGS A;  2CU1 A;  2RMM A;  4G0N B;  2JXT A;  3ECI A;  1Q1O A;  4YTM B;  4A55 A;  2ZVN A;  1WR6 E;  2J4X A;  1NBF C;  4C56 C;  2PIA A;  4WAF A;  2ZZP B;  2ZPY A;  4EZK A;  4GGQ A;  4IDI A;  3VH3 B;  2L05 A;  2INN E;  2E6X A;  2H89 B;  4W9C A;  3TEY A;  5C2T B;  2IZV B;  2IGH A;  2CKH B;  1IGD A;  1YQB A;  2WHI A;  3ZGZ A;  3JYU A;  2CJN A;  3OG5 A;  1WY8 A;  3GP7 A;  2MJE A;  4ANW A;  2ZW0 A;  3VTV A;  3HVZ A;  2MBQ A;  4BOZ B;  3S2A A;  3KYD D;  3TEX A;  3VRA B;  4W9D A;  4HEA 1;  5FKA C;  3KH0 A;  3H6N A;  3P2B A;  4HRS A;  2BKR B;  2BS2 B;  4FA6 A;  3Q69 A;  1ZPS A;  3JSV B;  2PEA A;  1XXG A;  1E7U A;  2PJH A;  4KGR A;  4KV2 A;  4DXG A;  1V5T A;  2WXK A;  4ZRP A;  2FBW B;  3U8Z A;  1OQY A;  4Q2J A;  1R4N I;  2BYT A;  3GE3 C;  2W3R A;  1F52 A;  2GBN A;  3AE6 B;  4YL8 A;  4WJQ A;  2GI9 A;  1LO5 D;  5IN7 A;  4OW0 A;  3H7P B;  2FAZ A;  2PTL A;  1TS2 A;  2LJ5 A;  3N1X C;  1T0S C;  1L2N A;  3U7D A;  3P42 A;  2MWS B;  3RD2 A;  1VR9 A;  2AQ2 B;  4OZA A;  2LD9 A;  5JH5 C;  2WDV B;  4BZA A;  2D3B A;  4MM3 B;  4N58 A;  2KN4 A;  1DOX A;  3R66 C;  4EEW A;  3IAM 1;  1UNS A;  2LJI A;  1I7H A;  1BUI C;  5FR6 A;  1H8C A;  4A3P A;  2WDT B;  3CF6 E;  1WSP A;  2KK8 A;  4BBN C;  1I4R A;  2DLB A;  4YSZ B;  3EHV A;  2WXH A;  3TUO A;  4EFO A;  1D5M C;  1F2R C;  4YT0 B;  3AEA B;  2INC C;  1U4A A;  1TS3 A;  4GOC A;  2K1F A;  1E10 A;  3AE5 B;  4MEL A;  3NS8 A;  2K8C A;  1CZP A;  3PPA A;  5BMG A;  1FIQ A;  4AUQ C;  2RPV A;  2KFJ A;  3KLS X;  2NPT B;  4DHZ B;  5FR3 A;  3UIO B;  5CHV C;  1WJ6 A;  3V62 A;  4XGA B;  2DYM A;  2KNB A;  1WRI A;  2I1K A;  3Q8E A;  4MT5 A;  2JYT A;  4GDL B;  3RUI B;  2KJ6 A;  3NZU A;  4HJG E;  3IG3 A;  1SE2 A;  5D3D A;  1Y8R C;  2QIE B;  3IHP C;  2W55 A;  3DQV A;  3TMP B;  1V5O A;  2Y5B B;  4ASW C;  1CMX B;  4HK2 A;  2PE9 A;  4K7S A;  2I2Y A;  1NYR A;  2BWE S;  2WXP A;  2M4N A;  4XYC A;  4IKG A;  3DVG Y;  1C4A A;  1KTK A;  4DHZ E;  4F8C B;  1FNU A;  2Z8L A;  2CHW A;  1KLG D;  2JYE A;  2FCM A;  4TQ0 A;  1LXD A;  3QQ8 B;  1EUV B;  1HZ6 A;  3VH4 B;  1FFV A;  1XD3 B;  1XO3 A;  3ZW3 A;  3KUZ A;  2WYQ A;  2IO3 B;  3Q6B A;  3QK0 A;  4P1C C;  4NJC A;  2MH7 A;  3EFC A;  2MJ3 A;  4GDL A;  2AQ1 B;  4IG7 B;  4ZRK A;  3VUY A;  1T0Y A;  1Q10 A;  2J0M A;  1T6B X;  2L76 A;  3APF A;  2DZM A;  1MG4 A;  1N60 A;  1CJE A;  5DPS A;  1XEE A;  2INP E;  4WIP A;  3A33 B;  3RNC C;  4KSL C;  1UGJ A;  4B95 A;  2W3S A;  2KC2 A;  4IC7 B;  3VTU A;  4EZL A;  3U52 E;  1QKZ A;  4MGY E;  3OWE B;  1TKG A;  5E6N A;  3EA6 A;  1GG3 A;  4ICV A;  1D6E C;  4DXA B;  3PO0 A;  1WXQ A;  1JW9 D;  4A3O A;  2BS3 B;  1KH0 A;  2O6V B;  1CK1 A;  1E8Y A;  1EWY C;  2CS4 A;  2KDM A;  1HZ5 A;  2PW9 A;  4BOS C;  3H1U A;  2B76 B;  3EFU A;  3LXF A;  1PDX A;  2L52 A;  5C23 A;  1KRH A;  2JY6 A;  1XQQ A;  3DHH C;  3V6C B;  1I4G A;  4LJP B;  4CO7 A;  3RZW C;  1J0G A;  3DBH B;  1E5W A;  3RI7 C;  3U2S C;  1OEY J;  4ZHP A;  4MH0 E;  2IJ0 A;  1J7C A;  4NAM A;  2A5U A;  2SEB D;  3Q2A C;  2BGF A;  3H7S A;  2OJR A;  3MHS D;  4HRO A;  1RLF A;  2LVP A;  4M8M A;  1WZ3 A;  2O2V A;  1N5X A;  1RAX A;  4LNF A;  5AZF A;  3E56 A;  4YSX B;  1DOI A;  1XF5 L;  3DOW A;  2O6V A;  1F77 A;  1WM2 A;  3C19 A;  3Q8F A;  2NTS A;  5IAA C;  2V4L A;  1WWT A;  4MDK E;  1F0Z A;  2L7R A;  1K52 A;  1FFU A;  1E7V A;  2EMT A;  5IA7 A;  1FNW A;  3IVF A;  4FUL A;  4PS8 A;  5D94 A;  3L08 A;  2KN5 A;  1ENF A;  5JHA A;  3NVV A;  4DDI D;  2ZPN A;  1VDV A;  2OED A;  5CX3 A;  2FID A;  1UF0 A;  4D2K A;  1GPX A;  2G3Q B;  4ZHO A;  3C0R B;  1E0Z A;  1P98 A;  4KZC A;  4G3X B;  3P4Q B;  1WXV A;  2N7E A;  1TS5 A;  1C9F A;  2J42 A;  1YIW A;  4OHJ A;  3PS6 A;  2BWF A;  3ML8 A;  3PRE A;  4WWP A;  1ET9 A;  1ZUD 2;  3DBS A;  2SAK A;  3AB5 A;  2QJL A;  2IBI B;  5E6J A;  3L13 A;  5DCN A;  1J19 A;  1FRR A;  1X1M A;  3DBH I;  4DWF A;  3DVG X;  2LGI A;  2AEH A;  1D3Z A;  2DNF A;  1L4D B;  1WIA A;  1QF6 A;  1T0R C;  1AYF A;  1SSN A;  2TSS A;  4WJP A;  4BAX A;  1UWM A;  1UZX B;  2Q5W D;  3ZJU A;  3BII D;  5BYS A;  2AYO B;  3BVZ A;  1WXA A;  2YEP F;  3AEB B;  4C4V A;  3RMK C;  4HDQ A;  4MEM A;  3ZNH B;  2LGX A;  3OJ4 B;  5GXG B;  4KGS A;  2KQS A;  1WMH B;  3RCZ A;  2BB5 A;  2KJR A;  3D32 A;  1GJZ A;  4BKG A;  2MEK A;  2KAN A;  2KXJ A;  2KDE B;  1JWU D;  5D3I B;  3VTW A;  1FXT B;  3DWG C;  3Q8C A;  3AE2 B;  2V3N A;  3AH7 A;  3ZTC A;  3AV8 A;  1OEY A;  2DAF A;  4WWN A;  3L0W B;  3ZXR A;  3JW0 X;  2IYD B;  1FCL A;  3SEB A;  4W9I A;  2PKO A;  1SIF A;  3SU8 X;  4WH4 A;  1QOB A;  2IY1 B;  2V3S A;  3VRB B;  2OHF A;  2WX1 A;  2BF8 B;  3FC4 A;  4FLH A;  2JWZ A;  3T9L A;  4DBG A;  3BWU D;  2M56 B;  3U30 A;  2NBW B;  2FCS A;  1YJI A;  2KWC A;  4HCP B;  1PQS A;  1SGH A;  4JLC A;  3VUW A;  1P9D U;  4FHK A;  1PUT A;  2IO0 B;  1EWC A;  4ARC A;  1SB3 C;  1RYJ A;  3H8H A;  3SD5 A;  2O6V D;  1YN3 A;  3QC8 B;  2OJW A;  1TIF A;  3VUX A;  1TKY A;  1QOG A;  4KIK B;  1VZ7 A;  4PK1 A;  4ZDV A;  4A90 A;  1YX6 B;  3AU4 A;  5H92 C;  2W9N A;  2MW5 A;  1GUA B;  2W54 A;  5BO4 B;  4GIV A;  5JZE B;  3VXW A;  2DAJ A;  5GMV A;  2KMC A;  2MA9 B;  3A9K B;  3BK1 A;  2WXM A;  1JRP A;  4PYZ A;  2VZK B;  2ZJD A;  1EU3 A;  1FMA D;  4KZ0 A;  3QCA A;  3CWI A;  1D5Z C;  2FCN A;  4AJY B;  1LQB A;  2D2Q A;  4LK0 M;  5J18 A;  2QEJ C;  1DYQ A;  1E9M A;  1ZE3 D;  4HJK A;  1ZKH A;  2RDG A;  2G4S A;  5D7G A;  4K7U A;  4C00 A;  2ZVO A;  4P6V F;  2D3C A;  3TSS A;  2KTR B;  1R4M B;  3PHX B;  3EGR A;  4WWO A;  1V81 A;  1MHX A;  2LRU A;  1L6V A;  4RF0 A;  2KWU B;  4HKQ A;  4LDT B;  2DWQ A;  4RGT A;  3W1S C;  1SXT A;  2X8X X;  2L1A A;  3C8Y A;  3ZDM C;  4JIO U;  1Q0W B;  5IKC M;  4KVG B;  2V0G A;  1PGA A;  4JL9 A;  2JX5 A;  2CU3 A;  3RNF C;  3KYC D;  3AE8 B;  1WYW B;  3NUH B;  3T3O A;  2UYZ B;  1K8R B;  3L17 A;  3KQ4 A;  5CHF A;  1ZOY B;  3FIL B;  2FIF A;  1G6J A;  3ZYY X;  2KO3 A;  3E9S A;  4XZ4 A;  5EE0 A;  2KTR A;  1WI0 A;  3GS2 A;  3B0A A;  2BKF A;  3PHW B;  1GB4 A;  2M1M A;  1ZDX A;  4EKU A;  1JCK B;  3DHI C;  1WM3 A;  2ONQ A;  3ENE A;  1ROE A;  3Q3O C;  3SR6 A;  2K6D B;  1OQR A;  4JQW C;  4YTP B;  2MSE D;  1PGB A;  1TY0 A;  4RNA A;  3UIP B;  2LAS A;  1QOF A;  3GE8 C;  2JXX A;  3DBR B;  2R61 A;  3JSV A;  1P3Q U;  1R4M I;  2WU5 B;  3DPD A;  1XLQ A;  1JML A;  2KVR A;  4OZC A;  3I3T B;  1P7F A;  4JE3 B;  3FIL A;  2JU6 X;  1SBB B;  3H7P A;  4K1R B;  1MPE A;  3T3N A;  2DHZ A;  1QT9 A;  1WGY A;  4ITK A;  1C76 A;  2HDE A;  2PVO D;  2LGY A;  3NS1 A;  4DHJ B;  5KHO A;  3I63 C;  1A70 A;  2JSV X;  4IWO A;  3IFW B;  1UD7 A;  2KFK B;  4MM3 A;  3Q3J A;  3WAM A;  4HPM B;  3LYY A;  3V60 A;  4DDG D;  3ZNI D;  2XK5 B;  4L23 A;  4M01 A;  4W9F A;  1TZ1 A;  3CIR B;  5LNK 1;  2MBB B;  1Z5S B;  2EKI A;  1DGJ A;  2KKC A;  3ZIM A;  3AN1 A;  2GBM A;  3AE7 B;  2QSD A;  3NVY A;  3EEC A;  4I6N B;  2IO2 B;  1PFD A;  3AXC A;  2WU2 B;  4WUR A;  4HWI B;  2MP2 B;  4BKS D;  2N7D A;  4ZYS A;  3I5J C;  1GNU A;  4HDO A;  4FN2 A;  2BVC A;  2AL6 A;  1WJN A;  5LLI A;  4A6Q A;  1EO6 A;  3N32 A;  2AQ3 B;  3RYT A;  4XC2 A;  3DDC B;  3L10 B;  1ZXI A;  2VRR B;  2QHO A;  4YWG G;  1AN8 A;  1NDD A;  3L4P A;  3DBR I;  3O13 A;  4LNO A;  3OAW A;  4NJ6 A;  2VZK D;  1R7S A;  4R3D A;  4XX5 A;  2JZ3 B;  2NPT A;  4OZB A;  2N1V A;  3RUL A;  1FO4 A;  3OJ3 A;  2BB6 A;  4GN1 A;  3PT2 B;  2W82 A;  3W5V B;  4E3C A;  2BYV E;  4TQ1 A;  1LFD A;  1RFK A;  4IM0 A;  1F1H A;  1WGD A;  4J3O D;  1EF1 A;  1M4V A;  1L0V B;  2MBH A;  1I4Q A;  3M63 B;  4MSQ B;  1ESF A;  4IM2 A;  4LJO B;  4EOY A;  4RH6 A;  5EE1 A;  3UQB A;  2N0S B;  2JF5 A;  4EUT A;  4F7Z A;  3HIZ A;  2GMI C;  4MGK E;  4E71 A;  2YLM A;  2E3T A;  1F2R I;  3P4P B;  2WXO A;  3N20 C;  1HTQ A;  2K39 A;  1YJ1 A;  4CYE A;  4ARI A;  2D3G A;  2PLP A;  3DHG C;  3MJ5 A;  2RDB C;  4W9H A;  5AZG A;  3B2G A;  2LWP A;  2WLB A;  3MP9 A;  4FJZ A;  3AU5 A;  3VHT C;  1A5R A;  3HUI A;  4L2Y A;  4PYU A;  4XE0 A;  3X0W A;  1MI0 A;  2NMQ A;  2BW2 A;  3SFE B;  1T5X D;  2KZR A;  1EM7 A;  2KMM A;  3NJT A;  4TSS A;  3P4R B;  3LB8 C;  3V6E B;  2KMA A;  3BIN A;  1IP9 A;  5EE3 A;  3MC0 B;  4M00 A;  2WNM A;  3AE1 B;  1SIJ A;  2UU7 A;  1L5P A;  1RM6 C;  3R8B A;  5DPT A;  4IWP A;  4O1N A;  5DPR A;  2ZCC A;  2MBE A;  2WXR A;  2JRH A;  2K25 A;  3R7R A;  2JQR B;  1FEH A;  4ZYN A;  5I4D A;  3K9P B;  1WX8 A;  4US8 A;  3PSE B;  2GBR A;  4N59 A;  1FPY A;  3A4R A;  5C3J B;  3PLV A;  3R2I A;  3WAN A;  1H4R A;  3IT6 B;  3RPF C;  4ANX A;  4NAW B;  2QMT A;  1UBI A;  2GBK A;  1C3T A;  3O65 B;  4LTU A;  1RWS A;  4ZRQ A;  3I57 A;  1E8Z A;  4DK5 A;  1UUP A;  1WJU A;  1WR1 A;  2L83 A;  3AE9 B;  3RZF A;  1KLV A;  2C7M B;  4KX6 B;  4EZJ A;  2G4D B;  3PTF C;  3QHT A;  2H88 B;  1ZGU B;  2RSU A;  1JWM D;  3ETR A;  1EF5 A;  1N5W A;  3A1Q B;  2KOX A;  4MSM B;  2N9P C;  1XCT L;  2JUO A;  2MBO A;  2KWV B;  2GLS A;  5G5G A;  4DHJ D;  2VH1 A;  2ACZ B;  1VCB A;  2KDB A;  2MRP A;  1JWA D;  3Q8A A;  3PZ7 A;  2XEW A;  2IDY A;  1EU4 A;  3NHE B;  3ZRC A;  3IT4 B;  4US9 A;  5G55 A;  1JWS D;  1JRU A;  4J6I A;  3P4S B;  4WQM A;  1QLB B;  2LHD A;  4KKI A;  5BYR A;  1I4P A;  2GRI A;  4M0W B;  2DYB A;  2JWU A;  2LVO A;  3APC A;  2G9H D;  4URK A;  2J7Q B;  1GAQ B;  2UWQ A;  3NVZ A;  3BYT B;  3Q14 C;  3UF8 A;  3B9J A;  1KJT A;  3MC8 A;  2A4Z A;  3DBL B;  3A9J B;  3SHQ A;  1GC7 A;  3PVL A;  3MC9 A;  2DZK A;  3B2F A;  1SEB D;  3V3X A;  1BXT A;  4F1S A;  3T8M A;  1KLU D;  1E7P B;  1V97 A;  4N9F 4;  2DX5 B;  4TUU A;  5AZH A;  3HM6 X;  4JWU C;  3URY A;  2QC8 A;  3Q8B A;  3P63 A;  1V2Y A;  3VFK A;  4FXC A;  3W1Y A;  4HCN B;  1L0X B;  2KAC A;  2C7H A;  2ZW1 A;  2KX0 A;  3KWV A;  2CHZ A;  5J17 A;  3BVM A;  4M0W A;  4H2A A;  2GOW A;  2ON8 A;  2KLC A;  4LNN A;  1WYG A;  4PS7 A;  2PVG C;  4ZOH C;  3Q3N C;  2DEN B;  5J2R A;  1YOV B;  4B0E A;  1D5X C;  1FD6 A;  2PMV A;  2Y5C A;  1WMH A;  3PZD A;  2JVC A;  3CSF A;  1BML C;  2C60 A;  3A9J A;  4YTN B;  2GB1 A;  1QQR A;  4B6W A;  1UGM A;  2EMS A;  2DZJ A;  3HM3 A;  4AWJ A;  4ANU A;  1WXS A;  2PPH A;  3U7Z A;  1WZ0 A;  1L7Y A;  3N30 A;  2KT7 A;  1FRD A;  2LRW A;  2K9X A;  3PRZ A;  1ZW7 A;  1YQ4 B;  2JRI B;  1Y56 A;  1OGW A;  3P1M A;  1KOT A;  5G2N A;  2KJH B;  1P7E A;  2LEK A;  5TSS A;  4AP4 C;  2EKE C;  2NVU I;  4MAC A;  1KF6 B;  3DBL I;  3R2T A;  3AUL A;  1VJK A;  5BYQ A;  4K7W A;  3PLU A;  3EUB 2;  2KWD A;  4FHJ A;  1IGC A;  3ZUN A;  5HFY A;  5C1Z A;  3APD A;  3VR9 B;  1WRD B;  2ICI A;  5BMH A;  1S3S G;  5TR5 A;  4USA A;  4K3C A;  3NVW A;  2HTM E;  5CTR C;  1ZDV A;  2RGF A;  1RRB A;  1FXA A;  3UQA A;  1TYG B;  1I4X A;  3AEE B;  3VDZ A;  1YN4 A;  3LJ3 A;  3M95 A;  1YNT E;  3ABV B;  2DYO A;  2BT6 A;  2WS3 B;  4MH8 A;  4N6E B;  2HJ8 A;  1SE3 A;  3FAH A;  4KIK A;  4WAA A;  2BYF A;  4NQL B;  2IND C;  2NCN A;  4NQK E;  3TEZ A;  1WX9 A;  1QZE A;  4NZL B;  4BKS A;  1TJE A;  2JZZ A;  2JPH A;  2C5L C;  2Y5P A;  1ET6 A;  3NG0 A;  2L32 A;  4GXB A;  3A9K A;  1ACC A;  3V05 A;  1XLN A;  4W9L A;  4MJS B;  3N9Y C;  3CST A;  4FJY A;  2EEL A;  2PE6 B;  1UEL A;  1I4H A;  4XWW A;  4IW0 A;  1B1Z A;  2KTF A;  4C80 A;  1NEN B;  4KGT A;  5HKH A;  2WP9 B;  4GSW A;  3NRZ A;  5JXV A;  3N1Z C;  3DVN V;  4BVU C;  3HK0 A;  3JVZ X;  4HVB A;  2BS4 B;  1P0R A;  1V1O A;  3ZNZ B;  2BQQ A;  1I35 A;  1C1Y B;  1K51 A;  1L6U A;  1XLP A;  2DBY A;  1GC6 A;  1NVI D;  1LM8 B;  1WH3 A;  5KHQ A;  4QAY A;  4I6L B;  4W9K A;  1N63 A;  4W9J A;  4NNJ B;  2DZI A;  1YQ3 B;  4P1B C;  5FK9 C;  1YJJ A;  3OLM D;  1IPG A;  2C7N B;  1TBE A;  3ZQ4 A;  1B9R A;  3QWZ B;  4MJS A;  4JX1 C;  3B1L X;  3EC8 A;  4WJN A;  4TMA B;  1I42 A;  4AJW A;  5L95 C;  3J9C A;  2IY0 B;  3VR8 B;  2L8J A;  4WWM A;  1V49 A;  4P16 A;  2WXJ A;  2LVQ A;  2LUE A;  1M94 A;  1E90 A;  2HE7 A;  2N9K A;  3UI3 A;  2D3A A;  2KDF B;  2Z0D B;  3WAO A;  2WX0 A;  3MHZ A;  4PS3 A;  1WGK A;  3TIX A;  3HRD D;  1PYW D;  3L54 A;  4AQ7 A;  1YX5 B;  2M19 A;  4PT5 A;  1VZ6 A;  4UDU C;  2FE8 A;  2CJO A;  1V86 A;  4JPS A;  2QDF A;  1N6Z A;  3RT3 B;  4AS1 A;  1LGR A;  4GDK B;  1JWB D;  3W1S A;  1WE7 A;  1SJE D;  2N9E B;  4M02 A;  1TY2 A;  3HVD A;  2RD0 A;  3TBL D;  1E6E B;  3CMM B;  4II3 B;  3QAQ A;  4RM9 A;  2M0X A;  4WJO A;  2KQ7 A;  5HG2 A;  1N62 A;  4ACF A;  1V6E A;  2B3A A;  2WXN A;  5LXH A;  3ZJT A;  3MFG A;  4X57 B;  2ZCB A;  1TZO A;  3KUC B;  1VD2 A;  2HTH A;  3KW5 B;  4IM3 A;  2K8H A;  1BT0 A;  3UIN B;  1TT5 B;  1VLB A;  1STE A;  1WFY A;  2CHX A;  4DXF A;  4LNI A;  3W9C B;  4WQO B;  2FUH B;  3TL5 A;  1V8C A;  5IO9 A;  4REZ A;  3WAP A;  1FNV A;  3RNA C;  1F9J A;  1NEK B;  3BVG A;  1NYQ A;  4HXD A;  3WAL A;  2LZ6 A;  4GDK A;  1XT9 B;  3IXS A;  4C7Z A;  2K5P A;  2KD0 A;  2AX5 A;  4G50 A;  3ZNG C;  4JWS C;  1HE8 A;  3BZD B;  1MJD A;  4BFR A;  2M0A A;  2M8S A;  2IGD A;  1ISN A;  2WXF A;  1TTN A;  3GB1 A;  1SF0 A;  3SFD B;  1C78 A;  1SE4 A;  2KFK A;  2RDH A;  1J7B A;  2L00 B;  1J7A A;  4RGM A;  2BYE A;  2XK5 A;  2WXI A;  1OFF A;  3AEF B;  4KDI C;  4BBN F;  1YD8 U;  2K6Q A;  5E6O A;  1AW7 A;  2N9L A;  4II2 B;  4KDL B;  4ZRI A;  2Z0E B;  2HD5 B;  4ZRJ A;  2MP2 A;  3KUD B;  4TV3 A;  1T3Q A;  3PGE A;  4HPP A;  3RNB C;  4FJV B;  2K8B A;  4B9K A;  1FCC C;  2J0J A;  3RN9 C;  3TCA A;  3AEG B;  2M17 A;  2NTT A;  4MGI E;  2JT4 B;  4ICU A;  1C79 A;  2L3Z A;  1S1Q B;  2LXC A;  1L0Y B;  3SDL C;  1C4P A;  4RGO S;  3GZN B;  4G11 A;  4A20 A;  2KDI A;  1Z2M A;  4JGH B;  1TKE A;  3NZ3 A;  2WGS A;  4B0M A;  2Y3A A;  2AWT A;  3ZVV A;  3ZKJ C;  2D11 A;  3PRP B;  4LDT D;  2O2V B;  2LXA A;  3Q3F A;  4C7Y A;  4EE2 A;  2K3U A;  2QCZ A;  3M3J A;  3ZO5 B;  1AAR A;  4L1B A;  4OVV A;  1K53 A;  2FUG 1;  3U4E G;  5D6J B;  4LNK A;  3KWL A;  3M62 B;  4TKN A;  2KHW B;  3ZJV A;  3DWM A;  3ONS A;  5G5H A;  1WF9 A;  2RR9 A;  4NPN A;  1QIL A;  2MCN B;  4HPL B;  2OOB B;  2NBV B; 
#chains in the Genus database with same CATH homology
 5D7G A;  3T8M A;  5D2M B;  4K7U A;  1NI2 A;  4MEL A;  3QA8 A;  3X23 A;  3NS8 A;  2K8C A;  2ZVO A;  3PPA A;  1UH6 A;  4AUQ C;  3BY4 B;  4N9F 4;  2KTR B;  3PHX B;  2KFJ A;  2DX5 B;  2NR2 A;  4TUU A;  1WGG A;  2NPT B;  4DHZ B;  5AZH A;  3UIO B;  3HM6 X;  5CHV C;  1WJ6 A;  3V62 A;  1OTR B;  4WWO A;  1V81 A;  2DYM A;  2KNB A;  2ZNV C;  3L16 A;  2I1K A;  2LRU A;  1V2Y A;  2L0T A;  3VFK A;  3W1Y A;  2KWU B;  4HCN B;  3NOB A;  4GDL B;  3RUI B;  2KJ6 A;  2C7H A;  2RPQ A;  3NZU A;  2LGD A;  3UGB B;  3ZTD A;  2KX0 A;  4M8N A;  2CHZ A;  3WA0 A;  5J17 A;  2BPS A;  4LDT B;  2G45 B;  4GU2 A;  3IG3 A;  2GOW A;  3W1S C;  1Y8R C;  3KVF B;  2KLC A;  4PS7 A;  1J8C A;  3IHP C;  4BKT A;  1E8X A;  2I1J A;  3DQV A;  3TMP B;  1V5O A;  2Y5B B;  3ZDM C;  2DEN B;  4ASW C;  4JIO U;  1Q0W B;  1CMX B;  2NBU A;  5J2R A;  4HK2 A;  2PE9 A;  4K7S A;  2BWE S;  3ZRF A;  4KVG B;  3IBE A;  4HPL B;  2M4N A;  3LDZ E;  4JL9 A;  3WIM A;  1WMH A;  3KYC D;  3PZD A;  3H9D A;  2JVC A;  3CSF A;  3DVG Y;  4CHK A;  2ZNV B;  2C60 A;  3A9J A;  1WYW B;  4DHZ E;  4F8C B;  2UYZ B;  4B6W A;  1UGM A;  2EMS A;  1K8R B;  2CHW A;  3L17 A;  3A4S C;  2DZJ A;  3HM3 A;  5CHF A;  4AWJ A;  3DVN U;  4ANU A;  3GZN I;  1WXS A;  4RM8 A;  2FCM A;  2FIF A;  2PPH A;  4TQ0 A;  1WZ0 A;  1LXD A;  1G6J A;  4EEW A;  3QQ8 B;  4ANV A;  1L7Y A;  2D10 A;  2KO3 A;  3N30 A;  4XZ4 A;  5JHB A;  1EUV B;  2NS5 A;  3QAR A;  3VH4 B;  1XD3 B;  2GBJ A;  3ZW3 A;  2KTR A;  1WI0 A;  2LRW A;  3B0A A;  2BKF A;  3KUZ A;  2WYQ A;  3PRZ A;  1WE6 A;  2IO3 B;  2N4F A;  3PHW B;  1ZW7 A;  1WJ4 A;  3QK0 A;  4AOF A;  2JRI B;  2M1M A;  1OGW A;  4NY0 A;  1KOT A;  5G2N A;  4EKU A;  2KJH B;  1KM7 A;  2KX3 A;  1WM3 A;  3HHM A;  4AP4 C;  2EKE C;  3ENE A;  4GDL A;  2NVU I;  5CHW A;  4ZRK A;  4IG7 B;  3VUY A;  4I6P A;  1E8W A;  1T0Y A;  3DBL I;  3AUL A;  3K9O B;  2K6D B;  4K7W A;  2J0M A;  4JQW C;  4NAW A;  2MSE D;  3PLU A;  2L76 A;  3APF A;  4FHJ A;  2DZM A;  3ZUN A;  4RMA A;  5DPS A;  5C1Z A;  1TGZ B;  3A33 B;  3APD A;  3MJW A;  3UIP B;  3DCG A;  1V9J A;  4KSL C;  2LAS A;  5DPW A;  1WRD B;  4B95 A;  2JXX A;  1S3S G;  4HLE A;  3JSV A;  5TR5 A;  2KC2 A;  1P3Q U;  4IC7 B;  3VTU A;  1R4M I;  4EZL A;  4MGY E;  5CTR C;  3VAW A;  4W9E A;  5E6N A;  3DPD A;  1GG3 A;  2KVR A;  2RGF A;  2ZEQ A;  1RRB A;  1WXM A;  4ICV A;  4DXA B;  3UQA A;  3VDZ A;  4A3O A;  3I3T B;  2IO1 B;  3LJ3 A;  2N1W A;  3ZLZ A;  3M95 A;  2O6V B;  2DYO A;  1E8Y A;  3H7P A;  2CS4 A;  4K1R B;  3R3M A;  3A1Q A;  2DHZ A;  4BOS C;  2HJ8 A;  2R2O A;  3H1U A;  5E6P A;  1WGY A;  4KIK A;  4WAA A;  2BYF A;  4NQL B;  2NCN A;  3NZS A;  3EFU A;  4NQK E;  4E74 A;  1WX9 A;  2LGY A;  1QZE A;  5C23 A;  4BKS A;  5KHO A;  4DHJ B;  2XBB C;  2JY6 A;  1XQQ A;  3V6C B;  5AEK B;  2JZZ A;  2J0K A;  2WWZ A;  1RFA A;  1Q5W B;  4GB9 A;  4LJP B;  4CO7 A;  2JPH A;  4IWO A;  3RZW C;  1J0G A;  3QJZ A;  3IFW B;  1UD7 A;  2KFK B;  2YVC A;  1E5W A;  4MM3 A;  4IUM B;  3Q3J A;  2C5L C;  3WAM A;  4HPM B;  1OEY J;  3QX1 A;  2AL3 A;  4GXB A;  3A9K A;  3V60 A;  4MH0 E;  4FAD A;  4DDG D;  2A5U A;  3ZNI D;  2XK5 B;  4W9F A;  1TZ1 A;  2MBB B;  1Z5S B;  2KKC A;  4MJS B;  4W9L A;  3ZIM A;  2BGF A;  3H7S A;  3CST A;  2OJR A;  3MHS D;  2GBM A;  4FJY A;  4GMV A;  2FNJ B;  1WGH A;  2PE6 B;  1UBQ A;  1RLF A;  1UEL A;  2LVP A;  4IW0 A;  3EEC A;  2KTF A;  1IYF A;  5HKH A;  5LXI B;  4M8M A;  4I6N B;  2IO2 B;  3AXC A;  1WZ3 A;  2MX2 A;  2O2V A;  4GSW A;  3VQI A;  2REX A;  1RAX A;  4HWI B;  5AZF A;  2MP2 B;  3DVN V;  4BKS D;  4BVU C;  1V80 A;  3HK0 A;  2N7D A;  3JVZ X;  1GNU A;  3B08 A;  4HDO A;  4HVB A;  4FN2 A;  3DOW A;  2AL6 A;  2O6V A;  1P0R A;  1WJN A;  1WM2 A;  2N9X A;  5LLI A;  1EO6 A;  2R2Q A;  3N32 A;  4NJ7 A;  3ZNZ B;  2LI5 A;  1P1A A;  5IAA C;  1I35 A;  2L0F A;  2V4L A;  3RYT A;  4XC2 A;  3DDC B;  3L10 B;  1C1Y B;  4MDK E;  2VRR B;  3R7Q A;  2L7R A;  2QHO A;  3V61 A;  1E7V A;  2EMT A;  1NDD A;  5EDS A;  5IA7 A;  1GC6 A;  4NJ6 A;  3DBR I;  1LM8 B;  1WH3 A;  3OAW A;  5KHQ A;  3IVF A;  4FUL A;  4K81 A;  4PS8 A;  5D94 A;  4I6L B;  3L08 A;  4W9K A;  2KN5 A;  3GOE A;  4XX5 A;  2JZ3 B;  5JHA A;  2NPT A;  2C9W B;  2ZPN A;  4W9J A;  4DDI D;  4NNJ B;  2DZI A;  5CX3 A;  2N1V A;  3RUL A;  2FID A;  3OJ3 A;  3ALB A;  2G3Q B;  2CR5 A;  3PRM B;  4GN1 A;  3ML9 A;  3OLM D;  3QIJ A;  3C0R B;  3PT2 B;  1IPG A;  2C7N B;  1TBE A;  4IWQ A;  4E3C A;  1SE9 A;  1P98 A;  4KZC A;  4G3X B;  2BYV E;  4TQ1 A;  3QWZ B;  1LFD A;  4MJS A;  3VVW B;  4P7I A;  1WXV A;  4IM0 A;  1WX7 A;  4MGZ E;  3B1L X;  1WGD A;  3EC8 A;  4WJN A;  1EF1 A;  2N7E A;  1I42 A;  4AJW A;  5L95 C;  4KSK C;  2MQJ A;  2MBH A;  1YIW A;  2ASQ A;  2IY0 B;  3PS6 A;  2BWF A;  2L8J A;  3ML8 A;  2KC1 A;  3M63 B;  3PRE A;  1V49 A;  3MTN B;  4WWP A;  4OVU A;  4MSQ B;  2LVQ A;  2LUE A;  3AI5 A;  1M94 A;  3DBS A;  1E90 A;  2HE7 A;  4IM2 A;  4LJO B;  4EOY A;  1MG8 A;  2IBI B;  2KDF B;  2Z0D B;  2FCQ A;  2MLB A;  3L13 A;  5DCN A;  1J19 A;  3WAO A;  3UQB A;  2JF5 A;  2WX0 A;  4PS3 A;  4EUT A;  4F7Z A;  1X1M A;  3HIZ A;  3DBH I;  3N3K B;  4DWF A;  3TIX A;  3DVG X;  1D3Z A;  2AEH A;  2GMI C;  2KLG A;  3NY5 A;  4MGK E;  4E71 A;  2V1Y A;  1WIA A;  3L54 A;  4WJP A;  2YLM A;  1YX5 B;  4FBJ B;  1V86 A;  3ZDT A;  1UZX B;  1WGR A;  3RT3 B;  4W9G A;  5L83 A;  2K39 A;  4GDK B;  1YJ1 A;  3PV1 A;  4LCD E;  4CYE A;  3TJP A;  2D3G A;  3W1S A;  2D07 B;  4W9H A;  5AZG A;  1WE7 A;  2N9E B;  2Z59 B;  2AYO B;  2LWP A;  2CU1 A;  1WXA A;  4G0N B;  4FJZ A;  2RD0 A;  3TBL D;  3AU5 A;  3VHT C;  4HDQ A;  3ECI A;  1Q1O A;  1A5R A;  4MEM A;  3ZNH B;  2LGX A;  2ZVN A;  1WR6 E;  3OJ4 B;  1NBF C;  4PYU A;  3CMM B;  3X0W A;  2KQS A;  1WMH B;  4II3 B;  2ZZP B;  3QAQ A;  4RM9 A;  3RCZ A;  2M0X A;  2ZPY A;  2KJR A;  2KZR A;  3D32 A;  4EZK A;  4WJO A;  2KQ7 A;  4BKG A;  1GJZ A;  4GGQ A;  3VH3 B;  2L05 A;  1V6E A;  3V6E B;  2B3A A;  2KAN A;  5LXH A;  2KMA A;  3BIN A;  2KXJ A;  4W9C A;  1IP9 A;  4X57 B;  2KDE B;  3VTW A;  2ZCB A;  2IZV B;  2CKH B;  3KUC B;  3KW5 B;  1FXT B;  1VD2 A;  2HTH A;  4IM3 A;  1YQB A;  2K8H A;  5DPT A;  4IWP A;  1BT0 A;  3JYU A;  5DPR A;  2ZCC A;  1WY8 A;  2MBE A;  3UIN B;  3ZTC A;  1WFY A;  2JRH A;  1OEY A;  2K25 A;  2CHX A;  3R7R A;  4ANW A;  2DAF A;  4WWN A;  3L0W B;  4ZYN A;  3VTV A;  3K9P B;  1WX8 A;  4WQO B;  2FUH B;  3JW0 X;  2MBQ A;  3PSE B;  2GBR A;  3TL5 A;  3A4R A;  4BOZ B;  2IYD B;  3PLV A;  3WAP A;  3S2A A;  3KYD D;  3WAN A;  4W9I A;  1F9J A;  1H4R A;  4W9D A;  1SIF A;  4HXD A;  3WAL A;  3SU8 X;  2LZ6 A;  4GDK A;  4ANX A;  1XT9 B;  2IY1 B;  4NAW B;  3KH0 A;  1UBI A;  2GBK A;  2KD0 A;  1C3T A;  3H6N A;  2V3S A;  3P2B A;  2BKR B;  3O65 B;  2WX1 A;  4G50 A;  3ZNG C;  2BF8 B;  4FLH A;  1HE8 A;  4FA6 A;  4BFR A;  1E8Z A;  2JWZ A;  3JSV B;  4DK5 A;  2PEA A;  3T9L A;  4DBG A;  1WJU A;  1E7U A;  2M8S A;  3U30 A;  1WR1 A;  2PJH A;  1ISN A;  4KV2 A;  1TTN A;  1V5T A;  2NBW B;  2FCS A;  3RZF A;  2KWC A;  2KFK A;  4HCP B;  1KLV A;  2C7M B;  3U8Z A;  1OQY A;  4EZJ A;  1PQS A;  1R4N I;  2G4D B;  1SGH A;  2L00 B;  3PTF C;  3QHT A;  4JLC A;  1ZGU B;  2RSU A;  2GBN A;  3VUW A;  4YL8 A;  4WJQ A;  1P9D U;  4FHK A;  2BYE A;  2XK5 A;  2IO0 B;  3H7P B;  1EF5 A;  2FAZ A;  3SD5 A;  3A1Q B;  2O6V D;  4KDI C;  3QC8 B;  2KOX A;  4BBN F;  1YD8 U;  2LJ5 A;  2K6Q A;  5E6O A;  4MSM B;  3VUX A;  2N9P C;  4KIK B;  4II2 B;  4KDL B;  4ZRI A;  2Z0E B;  4ZDV A;  2JUO A;  2HD5 B;  1L2N A;  4ZRJ A;  2MBO A;  2KWV B;  3U7D A;  1YX6 B;  2MWS B;  3AU4 A;  2W9N A;  3RD2 A;  2MP2 A;  2MW5 A;  3KUD B;  4TV3 A;  4DHJ D;  2LD9 A;  2KDB A;  1VCB A;  3PGE A;  1GUA B;  4FJV B;  5JH5 C;  2K8B A;  2MRP A;  4B9K A;  2J0J A;  5BO4 B;  3TCA A;  4GIV A;  2M17 A;  2XEW A;  5JZE B;  3VXW A;  3NHE B;  3R66 C;  4MGI E;  3ZRC A;  2DAJ A;  5GMV A;  2KMC A;  2JT4 B;  2MA9 B;  3A9K B;  4ICU A;  2L3Z A;  5FR6 A;  1S1Q B;  2LXC A;  5G55 A;  3SDL C;  1JRU A;  4G11 A;  4J6I A;  4A20 A;  2KDI A;  1Z2M A;  4JGH B;  1H8C A;  3ZVV A;  2AWT A;  4PYZ A;  3ZKJ C;  2D11 A;  4M0W B;  2DYB A;  2ZJD A;  3PRP B;  4LDT D;  2LVO A;  2O2V B;  3APC A;  4A3P A;  4KZ0 A;  2LXA A;  2WDT B;  3Q3F A;  3QCA A;  4URK A;  3M3J A;  3CF6 E;  2KK8 A;  2J7Q B;  3ZO5 B;  1AAR A;  4OVV A;  2UWQ A;  4BBN C;  2FCN A;  4AJY B;  1LQB A;  2D2Q A;  3EHV A;  5D6J B;  3UF8 A;  3M62 B;  4EFO A;  4TKN A;  1KJT A;  5J18 A;  2KHW B;  2A4Z A;  3ONS A;  1U4A A;  3A9J B;  3SHQ A;  4GOC A;  4HJK A;  1GC7 A;  1WF9 A;  1ZKH A;  2RR9 A;  3PVL A;  4NPN A;  2DZK A;  2K1F A;  2MCN B;  2G4S A;  2OOB B;  2NBV B;  4F1S A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...