2NBVB

Solution structure of the rpn13 pru domain engaging the hplic2 ubl domain
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
78
structure length
78
Chain Sequence
APAEPKIIKVTVKTPKEKEEFAVPENSSVQQFKEAISKRFKSQTDQLVLIFAGKILKDQDTLIQHGIHDGLTVHLVIK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structures of Rpn1 T1:Rad23 and hRpn13:hPLIC2 Reveal Distinct Binding Mechanisms between Substrate Receptors and Shuttle Factors of the Proteasome.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein binding
molecule keywords Proteasomal ubiquitin receptor ADRM1
total genus 9
structure length 78
sequence length 78
ec nomenclature
pdb deposition date 2016-03-12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 2nbvB00
1WM3A 4ZYNA 3M63B 1NDDA 5JHAA 2IO2B 2MRPA 2MLBA 1OGWA 4FBJB 1CMXB 1YQBA 2DAJA 2REXA 1XQQA 4NQKE 4NAWA 2WDTB 3PRZA 2N7DA 3L13A 1GG3A 4TQ1A 1YX6B 4NQLB 4HCNB 2HTHA 1V80A 4DHJD 3T8MA 1K8RB 3SHQA 1GUAB 1BT0A 1Q0WB 1V5OA 3CSFA 4LJPB 5KHOA 4KZ0A 2G45B 2KZRA 3ECIA 3L10B 3PLVA 1WI0A 3UQBA 1WXAA 1WXVA 4KDLB 2AL6A 3X0WA 2PE9A 1E8XA 5LXIB 1WGGA 1A5RA 1T0YA 2V4LA 4JGHB 2LGDA 2PEAA 2ZEQA 3TL5A 2BYVE 2NPTA 3UGBB 3ZW3A 2ASQA 2KD0A 3A9JA 4GDLA 2Z0DB 4KIKA 2FUHB 1U4AA 3VH3B 3DOWA 1ZKHA 3L16A 3X23A 2BWES 3AI5A 3VTVA 3B1LX 3GOEA 1S3SG 1X1MA 3M3JA 2JPHA 3EC8A 4G50A 4II2B 1WE6A 1WE7A 2A5UA 2KDEB 1WZ0A 2O2VA 4ANWA 4GXBA 4XZ4A 5AZGA 4JL9A 3SU8X 3WIMA 4KV2A 2NVUI 2K25A 2KJHB 3O65B 2N7EA 3L54A 1WJ4A 3DPDA 4W9IA 2V3SA 1LFDA 3ZDMC 2KANA 4B6WA 1UZXB 4F8CB 3QAQA 5LLIA 3AU5A 3NS8A 1OEYA 4K7UA 4I6LB 1OQYA 2DZMA 2J0KA 5KHQA 4LDTB 4DHZE 2KWCA 2IO0B 2IBIB 3C0RB 4E74A 4K81A 4ZDVA 3DCGA 3ZVVA 4G11A 1P9DU 1WY8A 4FULA 1WGHA 1WXSA 2UWQA 3KYCD 3QWZB 1YX5B 3JW0X 4KSLC 2K8CA 4ANVA 1F9JA 2CU1A 2KTRA 1WH3A 2KX3A 2M1MA 3KUCB 3ZIMA 4B9KA 2AYOB 2CKHB 1NBFC 2KJRA 2LVQA 3OJ4B 3PLUA 3ZRCA 2JY6A 2MBHA 3DBHI 3GZNI 3N32A 3ZKJC 3WALA 3JYUA 4ICVA 1GC7A 3WANA 1S1QB 2D3GA 1UD7A 2FCSA 4NJ6A 2KTFA 1EF5A 2JF5A 5CX3A 3RULA 1YIWA 2FCMA 2O6VD 3EHVA 3PV1A 4IG7B 4W9DA 4WJOA 1Q5WB 5D6JB 3U8ZA 2FNJB 4EOYA 5C1ZA 1RFAA 2DENB 3PZDA 2DZJA 2KHWB 4M8MA 3A9KA 2MX2A 4RM8A 1FXTB 1TTNA 4I6NB 3H6NA 2KMAA 4WWPA 1V2YA 2MCNB 2GBJA 3QA8A 4MJSB 3ZNHB 4DBGA 3QARA 2NBUA 3W1YA 4FJYA 2NR2A 2GMIC 4PS3A 1LM8B 2ZNVB 2LGXA 2K6DB 2JZZA 2FIFA 4W9JA 4BOSC 4FADA 3NY5A 4AUQC 3NOBA 2KC2A 5J17A 2K6QA 2CR5A 4MGYE 3U7DA 5L95C 3JSVB 1E5WA 2BGFA 4II3B 3RZWC 3PRPB 4PS7A 2WX1A 4MDKE 1JRUA 4IM3A 4KVGB 3N30A 1LQBA 3B08A 2JWZA 2RSUA 4DK5A 2JUOA 2DX5B 1RLFA 2K8BA 3EFUA 4MGZE 4NAWB 2A4ZA 3Q3FA 4N9F4 3VVWB 2OJRA 3ZLZA 3OLMD 5TR5A 1V49A 1V9JA 2WYQA 4IWOA 3RT3B 1M94A 3VUXA 4NJ7A 3AXCA 5E6NA 4DDGD 1C3TA 1E8WA 5CHVC 1WF9A 4K7WA 2FAZA 2PPHA 1IYFA 4EUTA 3BINA 1WM2A 3PGEA 5G55A 5JH5C 1C1YB 5E6OA 1RRBA 2C9WB 2JZ3B 1SE9A 5GMVA 2KVRA 2C7MB 3DBSA 2C7HA 1WR6E 1EUVB 4HK2A 4W9FA 3ONSA 4GDKA 3A9JB 4GDLB 5D94A 2XBBC 1Y8RC 4ZRIA 1KM7A 2BKRB 2G4SA 3V61A 5G2NA 4WJNA 2BKFA 4GN1A 2MBEA 2GBKA 5C23A 2L05A 4EFOA 5J18A 2KOXA 1WMHB 5D2MB 4RM9A 1R4MI 1WX7A 3CMMB 3B0AA 3JSVA 3RZFA 1ZW7A 4BKTA 3DDCB 1E8ZA 2KFJA 2KDBA 5E6PA 3APCA 1J19A 3DVNU 2GBRA 2MWSB 2MP2A 3DBLI 2MBQA 3HK0A 4TKNA 2WX0A 3R7QA 4AWJA 2DZKA 1WFYA 3NHEB 1ISNA 2K8HA 2FCNA 3T9LA 3PS6A 2C5LC 2LVOA 3JVZX 4XC2A 5AZFA 2LWPA 4BVUC 4DHZB 5DPSA 3HIZA 2KQ7A 4CYEA 2MP2B 4WWOA 2L8JA 4EZKA 1I42A 3ZTDA 4F7ZA 2NBWB 5DPTA 5AZHA 2OOBB 4ANUA 1KJTA 3A33B 4DXAB 3LDZE 2L0TA 3PVLA 1P98A 4EZJA 1J0GA 3IHPC 3QC8B 1XT9B 2CHZA 3DVGY 3PPAA 4HPLB 3H7PB 4A3OA 2MBBB 4B95A 3QJZA 4MH0E 4OVVA 3TBLD 2C7NB 4OVUA 4M0WB 3VHTC 4DDID 2LZ6A 1WJ6A 4BKSA 2BF8B 2LXCA 2ZVOA 3KVFB 4W9KA 2RPQA 2EMTA 4F1SA 3VAWA 1NI2A 4TUUA 2EKEC 2KDIA 4FN2A 1OTRB 3HM3A 2XK5A 2MBOA 3V6EB 2M17A 3R66C 1SIFA 3QIJA 2M8SA 2K1FA 4MM3A 5BO4B 1RAXA 3RCZA 4LCDE 1LXDA 3APFA 3KH0A 1WJUA 2ZZPB 2I1JA 4JQWC 3TCAA 3H1UA 3VUYA 3ZDTA 4CO7A 2ZPYA 2N4FA 3A4RA 4KZCA 1J8CA 4G0NB 3PHXB 2KO3A 1WRDB 2KQSA 4FHJA 2R2QA 5AEKB 4GU2A 4MSMB 3SD5A 3VH4B 3K9OB 4HVBA 4MELA 1UBIA 1UGMA 4WQOB 3RYTA 3ML8A 4EZLA 3U30A 3APDA 1WX9A 4IM2A 1E90A 3R7RA 4AJWA 4A20A 3NZUA 4WWNA 1E7VA 4IW0A 3ZTCA 4BOZB 2G3QB 4KSKC 2N9XA 2CHWA 2D10A 2GBMA 2O2VB 2LUEA 2KK8A 3HM6X 4GSWA 4WJQA 2IY0B 3ENEA 2MW5A 4GB9A 4X57B 4ASWC 2KDFB 2O6VB 3HHMA 1KLVA 2KFKB 3IG3A 1WJNA 5FR6A 3OAWA 4PS8A 1WZ3A 2LVPA 2N9EB 1IPGA 4KDIC 4ANXA 1H8CA 4IWQA 3K9PB 4W9GA 2XK5B 1WIAA 1MG8A 3KUZA 3A1QB 4LJOB 4NY0A 3VTUA 1P0RA 3VUWA 3QCAA 2IZVB 4HCPB 2KFKA 2J7QB 4IM0A 1P1AA 4MGKE 4HLEA 3KUDB 2L3ZA 4NNJB 3BY4B 2PE6B 2PJHA 3PREA 3I3TB 4PYUA 3V60A 2BYEA 3H7SA 3VFKA 1WXMA 3IBEA 2V1YA 4GGQA 4A3PA 2IO1B 1Q1OA 1KOTA 2C60A 3AU4A 2MSED 4LDTD 2I1KA 5HKHA 3ZNID 2B3AA 2FCQA 2N1WA 2NPTB 2JXXA 4TQ0A 2M0XA 4MSQB 2NCNA 3DQVA 5L83A 2KLCA 3UIPB 3AULA 1WYWB 4HJKA 3WAOA 4BBNF 3A9KB 3S2AA 4W9CA 5IAAC 3CSTA 4E3CA 1WX8A 3PRMB 5EDSA 3UIOB 3L17A 2LI5A 1HE8A 3EECA 2KJ6A 4URKA 3QHTA 5JHBA 2M4NA 2DHZA 2JRIB 4MEMA 4JIOU 2Y5BB 2DYMA 2KX0A 1SGHA 3ZRFA 4FHKA 1D3ZA 1WGRA 2L00B 4WAAA 2LRWA 3MTNB 4GOCA 2KNBA 3WAPA 3P2BA 2KXJA 1V86A 2IO3B 3IVFA 5CTRC 4AJYB 4JLCA 3M62B 4BBNC 4IWPA 2DYBA 4FA6A 2BWFA 4HDQA 2NBVB 4K1RB 2VRRB 4E71A 2LGYA 3H7PA 1V81A 3UQAA 2KC1A 2EMSA 2LRUA 1VCBA 2HE7A 1TZ1A 3KW5B 2D11A 2KWUB 4IC7B 4I6PA 5CHFA 2L76A 2LD9A 2RGFA 3PSEB 3TIXA 3ZO5B 2UYZB 2KKCA 3MHSD 4HDOA 1WGDA 3QQ8B 3VQIA 1E7UA 1EO6A 1EF1A 2J0MA 2KWVB 3PHWB 3PTFC 4NPNA 3ZNGC 2ZPNA 4W9HA 3QX1A 4W9EA 2R2OA 3D32A 1YD8U 4FLHA 1E8YA 4BFRA 5DPRA 4RMAA 3KYDD 2ZCCA 2MA9B 2G4DB 2JVCA 2RD0A 4XX5A 2DZIA 1GNUA 4BKSD 2YLMA 3NZSA 4GMVA 3UF8A 2JT4B 4K7SA 3M95A 1ZGUB 2KN5A 2LJ5A 2D2QA 3CF6E 3MJWA 4EEWA 3VTWA 4ICUA 2DYOA 4ZRJA 3RUIB 1UELA 5D7GA 2CS4A 1IP9A 3N3KB 4AOFA 2HD5B 2L7RA 1WMHA 2BPSA 2L0FA 2FIDA 2Z59B 3WAMA 3L08A 1L2NA 2MQJA 4G3XB 4FJVB 4DWFA 2QHOA 3LJ3A 4P7IA 2BYFA 4MJSA 1XD3B 3OJ3A 4DHJB 2D07B 1V5TA 3R3MA 2KLGA 2JRHA 4GIVA 2O6VA 3A1QA 2YVCA 3IFWB 4BKGA 1GJZA 4GDKB 5DCNA 1UBQA 4HXDA 2LXAA 2N9PC 3V6CB 5IA7A 5J2RA 2RR9A 1L7YA 2ZCBA 1QZEA 3DBRI 3V62A 2IYDB 2WWZA 3DVNV 3SDLC 4WJPA 3W1SA 1R4NI 2HJ8A 4W9LA 4MGIE 1AARA 2ZVNA 1H4RA 4M8NA 4TV3A 4YL8A 5JZEB 1G6JA 3RD2A 3Q3JA 5LXHA 2LASA 2GOWA 2NS5A 1I35A 1Z2MA 1PQSA 1TBEA 2AL3A 2ZJDA 4J6IA 4CHKA 2Z0EB 2XEWA 2KTRB 4FJZA 2AWTA 1GC6A 4AP4C 2KMCA 1V6EA 3ML9A 5CHWA 2DAFA 1WR1A 4KIKB 2IY1B 4HPMB 3QK0A 3A4SC 4ZRKA 3TJPA 2N1VA 3WA0A 4EKUA 1OEYJ 3VDZA 1WGYA 4PYZA 3H9DA 2GBNA 3TMPB 4IUMB 3DVGX 3PT2B 2CHXA 3ZNZB 1Z5SB 2K39A 1VD2A 2J0JA 4HWIB 3L0WB 3W1SC 3VXWA 5DPWA 1YJ1A 2W9NA 2ZNVC 2AEHA 3ZUNA 1TGZB 3ALBA 3UINB 1UH6A 1P3QU
chains in the Genus database with same CATH superfamily
4ZYNA 1JWUD 1ROEA 3Q3NC 2IO2B 4FBJB 3ZJTA 1XQQA 4Q2JA 2N7DA 1V80A 3T8MA 1DYQA 1GUAB 1Q0WB 3TSSA 3L10B 3UQBA 1WXAA 1E8XA 5IP4D 4N59A 1FNVA 1F2RC 4GDLA 1TKYA 2FUHB 3VH3B 3DOWA 2PVOD 2WXLA 1HTQA 3X23A 3AI5A 3B1LX 1FEHA 2V0GA 2JPHA 3AEFB 4II2B 1XXGA 4ANWA 3KWLA 3FILB 2GRIA 4XZ4A 3SU8X 3VRBB 4W9IA 1VLBA 2V3SA 2JQRB 1LFDA 4XWTA 4B6WA 1QOGA 2W55A 3AU5A 3NS8A 4K7UA 2M0AA 4S17A 2IBIB 1HZ5A 1HZ6A 4ZDVA 1P9DU 4FULA 1WXSA 1R7SA 4ARIA 4HPPA 3Q14C 4ANVA 2RDHA 2CU1A 1EU4A 3KUCB 4B9KA 2AYOB 3DHIC 3NVWA 3PLUA 2MBHA 4XWWA 3RFZB 3EA6A 1UD7A 1PGXA 2FCSA 4NJ6A 1EF5A 1K50A 3P4SB 1YIWA 2L83A 3DBLB 3VUXA 4US8A 4W9DA 2W54A 3PZDA 2KHWB 2WXOA 2MCNB 3ZNHB 3QARA 2NBUA 2NR2A 2ZNVB 4FADA 2K6DB 2FIFA 4DQOC 1R4NB 2K6QA 2CR5A 2WDVB 3JSVB 2BGFA 3RZWC 3PRPB 3ZXVA 2KT7A 2WX1A 4MDKE 1KLGD 4IM3A 3N30A 1RWSA 2QJLA 1ZXHA 1FD6A 2JWZA 1OFFA 2JUOA 3IT4B 3AE8B 4NAWB 3Q3FA 3ZLZA 1V49A 1SE4A 1M94A 1K53A 5CHVC 2BTEA 1XEEA 4EUTA 1WM2A 4DXFA 1TT5B 4WH4A 1WR6E 5D94A 5T8IA 1SSNA 1Y8RC 2W3RA 3LXFA 5AUKA 2MBEA 4OHJA 1IBXA 1WMHB 1I7HA 5D2MB 1R4MI 1WX7A 1YN4A 4NJCA 3RZFA 1ZW7A 1PGBA 3DDCB 3KWVA 3AE5B 2KDBA 2WHIA 3W5VB 3DVNU 2GBRA 1MPEA 4LNFA 1WWTA 2CJNA 1EWCA 2MP2A 2MBQA 2WX0A 3HVDA 3NHEB 2PTLA 2K8HA 2FCNA 3T9LA 3PS6A 2LVOA 3JVZX 5AZFA 3HIZA 2KN4A 4BZAA 2L8JA 1I42A 1F1HA 5DPTA 5AZHA 2OOBB 2BBCA 4EZJA 3IHPC 3QC8B 1XT9B 2CHZA 4A3OA 3H7PB 5EE9A 3RI7C 2MBBB 1QOBA 4B95A 4OVVA 3TBLD 2C7NB 4OVUA 2BF8B 2LXCA 2V3PA 3E9SA 3KVFB 2RPQA 4AS1A 2PLPA 1NI2A 1VZ7A 2EKEC 2KDIA 3FKYA 4FN2A 1D4BA 2OEDA 3SFEB 2M8SA 1YQ3B 1JWMD 2INPE 3KH0A 4JQWC 4ZHPA 3VUYA 4C4VB 1MI0A 2ZPYA 5FKAC 2N4FA 4YSXB 3RMKC 2N7JA 4G0NB 4C80A 3SD5A 4WQOB 5D3DA 3RYTA 4EZLA 3ML8A 1F0ZA 4IM2A 1E90A 3Q8BA 4IW0A 4BOZB 2CU3A 2CHWA 2O2VB 2MJEA 3HM6X 2DLBA 2IY0B 3FAHA 1NYQA 1ESFA 1UWXA 5FR6A 1T5XD 2N9EB 1H8CA 1VZ8A 2WXGA 4W9GA 1WIAA 3KUZA 3NZ3A 3VTUA 1XCQL 3AB5A 2MJDA 4ZRPA 4WWMA 2WP9B 1V1PA 2WXMA 2WDRB 1WXMA 1Q1OA 2EELA 3ZNID 1N60A 1I4HA 2N0SB 4MSQB 3AEAB 3UIPB 3AULA 1WYWB 4BBNF 3R2TA 5EDSA 2IGHA 4PT5A 3EECA 2DHZA 2BB6A 4JIOU 1F52A 2DYMA 1N6ZA 2KX0A 3RNFC 4WAAA 3P2BA 2KACA 2FBWB 2WU5B 4JLCA 1VZ6A 1GB1A 2DYBA 4FA6A 3AE1B 1ZXIA 2NBVB 4K1RB 2VRRB 4E71A 2LRUA 3KW5B 3SFDB 1TZOA 1TKEA 2RGFA 2UYZB 3MHSD 4HDOA 2LEKA 1EF1A 2J0MA 1YN5A 2LHEA 2ZPNA 4W9HA 3QX1A 4W9EA 2R2OA 2YEPF 4FLHA 2BS3B 3KYDD 1VRAB 2ZCCA 2MA9B 2DZIA 1GNUA 3NZSA 1PFDA 3M95A 2KN5A 2QIEB 1OQQA 3CF6E 1Y56A 2H89B 4ICUA 1I4QA 2CS4A 4LNIA 1IP9A 3N3KB 2HD5B 2L7RA 1GB4A 2NTSA 2JYEA 4KGSA 5IOIA 2MQJA 1LGRA 1ENFA 2QHOA 1IBXB 1JROA 5EE0A 4DHJB 3H8HA 4KKIA 1GJZA 3I57A 3L4PA 3DWMA 5IA7A 2BT6A 1XLPA 1L7YA 3V62A 1JRPA 2HJ8A 4YL8A 5JZEB 1AARA 4TV3A 1G6JA 1WSPA 2OJWA 4TMAB 3Q3JA 2GOWA 2QMTA 1EM7A 2W3SA 1PQSA 2AL3A 2ZJDA 3NVYA 2Z0EB 2XEWA 1SJHD 1WR1A 2N1VA 4EKUA 1OEYJ 3VDZA 1WGYA 4YWGG 3TMPB 3DVGX 3Q69A 4L2YA 4P6VF 2LJIA 2IJ0A 2K39A 1FXAA 4HWIB 3W1SC 5DPWA 1FMAD 1YJ1A 2ZNVC 4BAXA 1TGZB 3UINB 3AE2B 5JXVA 2WXJA 4JWSC 2MRPA 4NZLB 5G5HA 2DAJA 1YQBA 1I4PA 1OQRA 3L13A 4TQ1A 1YX6B 2HTHA 3BK1A 4DHJD 1FFVA 1BT0A 3DWGC 2EKIA 1YQ4B 3PLVA 1C9FA 1KRHA 3R8BA 2PE9A 5LXIB 1T0YA 4JGHB 2VH2A 2ZEQA 3UGBB 3ZW3A 2NPTA 2ASQA 2KD0A 3A9JA 4USAA 2Z0DB 1U4AA 3L16A 3VTVA 3GOEA 1N62A 4C00A 2KDEB 2A5UA 1WZ0A 1K51A 3WIMA 2D3CA 2K25A 5C3JB 1WJ4A 3AE9B 3DPDA 3ZDMC 3QAQA 4JPSA 4ARCA 1M4VA 5LLIA 2KWDA 1A70A 2DZMA 5KHQA 4WURA 4LDTB 2KWCA 2IO0B 1ET6A 2BS2B 3NS1A 4G11A 1WY8A 4N58A 1F9JA 1WH3A 1D5XC 2CKHB 2BQQA 1NBFC 1JW9D 1QQRA 1SBBB 2LVQA 1AWDA 2JY6A 3B2GA 3GZNI 3WALA 4US9A 4ICVA 3PZ8A 1S1QB 2KTFA 3RULA 3DHGC 3IXSA 2VZKB 3KLSX 4IG7B 1Q5WB 5IKCM 2FNJB 1RFAA 4RM8A 3W5UB 1TTNA 4I6NB 2KMAA 1V2YA 2GBJA 1SB3C 3QA8A 1NYRA 4MJSB 4DBGA 2QDFA 4FJYA 4RGMA 1HEZE 3NY5A 4AUQC 4MGYE 2QCZA 3P4PB 4PS7A 3CWIA 4KVGB 3B08A 4DK5A 2LMCA 5BYSA 5AUIA 4MGZE 3BWUD 1CJEA 1E0ZA 5EE1A 1I4XA 3OLMD 1V9JA 2WYQA 2K3UA 4YTNB 5E6NA 4DDGD 3RNBC 2PPHA 3BINA 2RDGA 3PGEA 1KTKA 5HI1A 5E6OA 2J53A 2WXFA 2WLBA 2Y5CA 2C7HA 4IDIA 1EUVB 3ONSA 3V61A 3ABVB 4GN1A 1FM0D 1KF6B 2L05A 2KOXA 3Q3OC 4RM9A 1SEBD 3JSVA 3AV8A 3TEWA 1LO5D 3APCA 1L6VA 2MWSB 1ZUD2 3DBLI 2JWUA 1QT9A 4KGRA 3R7QA 4RGTA 1J7CA 4XC2A 1JWAD 4BVUC 1QILA 2INCC 2KQ7A 4CYEA 4WWOA 4LK0M 3BYTB 3ZTDA 4F7ZA 2NBWB 4ANUA 4HKZE 3PVLA 1P98A 4FXCA 3NJTA 4HPLB 3RNEC 3PZ7A 5IO9A 1QOAA 4M0WB 1V1OA 2LZ6A 1WJ6A 4BKSA 4W9KA 2EMTA 3HVZA 4M01A 1HA5A 4TUUA 1XLQA 3HM3A 2M17A 4RFBA 2K1FA 3I63C 5BO4B 3RCZA 1LXDA 1UGJA 1MVKA 2ZZPB 3TCAA 3H1UA 2JX5A 3AH7A 2Q5WD 1J8CA 1FRRA 3PHXB 1MJDA 1WRDB 4A9AA 4HJGE 2KQSA 4CQNA 1SXTA 4MSMB 5C2TB 2V3NA 2GLSA 3IAS1 1UBIA 1UGMA 1YN3A 3U30A 1FNWA 3R7RA 1NI3A 1E7VA 1CZPA 2G3QB 3WCQA 5I4DA 2D10A 2GBMA 4WJQA 4GB9A 2WXPA 2O6VB 3HHMA 4UDUC 1GPXA 4L1BA 2LVPA 1VDVA 4KDIC 2QC8A 1TS2A 1MHHE 5E6JA 3BVMA 1P0RA 4OZBA 3Q6BA 2I2YA 4IM0A 4XDDA 1AYFA 2KVZA 1N61A 2VH1A 1JALA 4NNJB 4PYUA 2BYEA 4A3PA 1KOTA 5BMGA 2MSED 5HKHA 1T6BX 2FCQA 2N1WA 3MJ5A 3V3XA 2KMMA 3WAOA 3GE8C 3S2AA 1QLBB 3PRMB 3L17A 2LI5A 3QHTA 1FFUA 1AN8A 3GP7A 4S0RA 1TS3A 2G9HD 2Y5BB 3IT6B 2Y3AA 3TEZA 3ZRFA 1SGHA 4FHKA 1WGRA 3ZJVA 2L00B 2IO3B 4AJYB 3M62B 1ACCA 4RGNA 1C79A 2HE7A 4GLSC 1DOYA 2L76A 3TIXA 2WU2B 3Q8FA 2AQ1B 3BK2A 2PMVA 3C8YA 1DGJA 1EO6A 1XLNA 3PTFC 4NPNA 3ZNGC 1L5PA 4JE3B 1J7BA 3VRAB 2LGIA 1EU3A 2RD0A 4XX5A 2RDBC 2HDEA 2YLMA 4K7SA 1T0SC 3KQ4A 2LJ5A 2D2QA 3MJWA 3Q8CA 4EEWA 1UELA 1VJKA 4YSYB 2BPSA 2L0FA 2I38A 2FIDA 2D3BA 2Z59B 3EUB2 2BYFA 2NMQA 2JRHA 3A1QA 2YVCA 1ET9A 4BKGA 4GDKB 4HXDA 2LXAA 3V6CB 2RR9A 2ZCBA 1KLUD 3DBRI 2WWZA 3SDLC 2WGSA 1TS5A 4HRSA 4W9LA 2ZVNA 1H4RA 4M8NA 3RD2A 2HTME 2J4XA 3C19A 2BS4B 4CHKA 1B9RA 4RH6A 2ICIA 4ZHOA 2KTRB 2AWTA 4AP4C 3QK0A 4PYZA 2GBNA 4IUMB 1NENB 5IN7A 3ZNZB 1WGKA 1T0QC 1VD2A 2J0JA 4N6EB 3L0WB 3VXWA 2UU7A 1IGDA 2PKOA 2KAJA 4RCOA 3ZQ4A 2WDQB 1WM3A 2ZW0A 3M63B 4OW0A 3AE3B 4LNOA 5JHAA 2LHDA 1I4GA 1OGWA 4NQKE 1L4DB 2REXA 2WDTB 1NVID 3PRZA 5HHDG 1GG3A 4NQLB 4HCNB 4HROA 3HRDD 1E6EB 4KZ0A 2G45B 2KZRA 1JMLA 5MPOA 2AL6A 3X0WA 1A5RA 1WGGA 3FC4A 4XDCA 4KIKA 3N1YC 1S3SG 1X1MA 3EC8A 4MH8A 1WE6A 1WE7A 3N20C 4IOIE 5AZGA 4R3DA 3O65B 2N7EA 1TJEA 3L54A 1TY2A 3W2DA 1PYWD 2L32A 4C7ZA 1P7FA 2G1EA 1UZXB 4IKGA 4XGAB 1OEYA 4I6LB 3NVZA 1OQYA 2J0KA 1ZDVA 1YOVB 4E74A 3ZYYX 3DCGA 4M02A 3RPFC 3JW0X 4KSLC 4ZYSA 2KX3A 3ZIMA 3HUIA 2D5GA 3ZRCA 3DBHI 3N32A 3ZKJC 4LNKA 3JYUA 4REZA 5LNK1 2D3GA 2JF5A 4L23A 4JX1C 2FCMA 2O6VD 3EHVA 3PV1A 1TYGB 5C1ZA 3B9JA 1FXTB 3H6NA 4OZAA 4WWPA 3P63A 1TIFA 3AMZA 2Y5PA 3I5JC 1LM8B 2RPVA 3NOBA 3BIID 2KC2A 2LUMA 5J17A 2BB5A 5L95C 1E5WA 2V9HA 3OG5A 1FNUA 1LQBA 2N9KA 1PDXA 2RSUA 1RLFA 1QKZA 5FK9C 2K8BA 3E56A 2A4ZA 2OJRA 5TR5A 3RT3B 4A55A 4NJ7A 1C3TA 1E8WA 1KFYB 1VR9A 4LLGM 1YJIA 2WNMA 1IYFA 2MEKA 5G55A 1MHXA 1L4ZB 2C9WB 1SE9A 1RFKA 3MC8A 3DBSA 1V8CA 4HK2A 3A9JB 4XE0A 2XBBC 2BKRB 2G4SA 4M0WA 3U2SC 4B0EA 5G2NA 4WJNA 2TSSA 2BKFA 4EFOA 4NAMA 5J18A 1ZOYB 1UF0A 3CMMB 2N9LA 3B0AA 2ZW1A 3O13A 4BKTA 1E8ZA 2KFJA 4C4VA 4LTUA 1J19A 2W82A 4AWJA 2DZKA 1WFYA 1ISNA 2R61A 2X38A 3GZNB 2C5LC 2LWPA 5DPSA 4EE2A 3RNGC 2MHJA 3OWEB 1KJTA 3FILA 3A33B 1RM6C 4DXAB 3BYYB 1UNSA 3DVGY 3PPAA 1C4PA 4HEA1 5TSSA 3VHTC 1QOFA 4DDID 1CK1A 1YNTE 3TUOA 2BYTA 1QF6A 4M00A 3VAWA 4WQMA 4KGTA 2XK5A 2MBOA 3V6EB 5HG2A 2L52A 3R66C 1SIFA 2K0PA 3QIJA 4ZRQA 4MM3A 4LCDE 2ON8A 2FE8A 3ZDTA 4CO7A 3NVVA 2YEPB 3ZXRA 2KDMA 1FIQA 4FHJA 2R2QA 5AEKB 4GU2A 1UWMA 3VH4B 3K9OB 4HVBA 4MELA 1B1ZA 2ACZB 4AJWA 2WXKA 3NZUA 4WWNA 1D5MC 2N9XA 4KSKC 1PUTA 4GSWA 2KK8A 4ASWC 1TKGA 3GE3C 2VZKD 1L6UA 2KFKB 4K3BA 4HKQA 2DBYA 1WZ3A 4PS8A 1CQVA 1IPGA 1L0YB 4ANXA 2WXHA 3K9PB 2XK5B 2K9XA 1MG8A 4LJOB 4NY0A 3T3OA 1TY0A 3VUWA 2E6XA 2KFKA 4WAFA 4J3OD 4MGKE 3ZJUA 3BY4B 2PE6B 2PJHA 3PREA 3V60A 3H7SA 3VFKA 3B2FA 1FPYA 2V1YA 4GGQA 3T3NA 4LDTD 2SEBD 4RF1A 4H2AA 2B3AA 1D6EC 4TQ0A 4KX6B 5L83A 3N1XC 2KLCA 4HJKA 2IGDA 4MT5A 3A9KB 5IAAC 3U4EG 4E3CA 3UIOB 1HE8A 4URKA 1E10A 5JHBA 2M4NA 3MC9A 2QEJC 1GAQB 1D3ZA 4K3CA 2LRWA 3MTNB 2KNBA 3WAPA 3AE6B 1V86A 3IVFA 5CTRC 3NRZA 3PO0A 4BBNC 2XN9C 4HDQA 1SJED 1V81A 4WIPA 2KC1A 3CIRB 2D11A 2KWUB 1JWSD 1L0VB 2LFIA 4I6PA 5CHFA 2LD9A 3ZO5B 1WGDA 3QQ8B 3VQIA 4C56C 3AE4B 4BFRA 4RMAA 1E9MA 2G4DB 2JVCA 1F2RI 1DOXA 3VR9B 2JT4B 1ZGUB 1XCTL 2PW9A 4XYCA 4AOFA 3SEBA 3TEYA 1UH6A 4G3XB 4FJVB 4P7IA 1N5XA 4MJSA 1XD3B 3OJ3A 3EGRA 1C78A 4ZOHC 1K52A 3R2IA 4GIVA 2O6VA 5DCNA 2M56B 1UBQA 2N9PC 1QZEA 3URYA 2IYDB 2WXRA 1PGAA 1R4NI 1WRIA 1V1PB 5LXHA 2M19A 3AECB 1C76A 1GC6A 2KMCA 1V6EA 1FXIA 4ZRKA 2IY1B 1HTOA 2HJ1A 3A4SC 2AQ2B 4HPMB 3TJPA 1JQ4A 3WA0A 2JZPA 2CHXA 4MACA 4D2KA 1L0XB 3ZUNA 3ALBA 1P3QU 1NDDA 1JWBD 2MLBA 4YSZB 1CMXB 4NAWA 1AW7A 4YXDB 3MFGA 1K8RB 3SHQA 1V5OA 3CSFA 4LJPB 5KHOA 1EWYC 3ECIA 3U52E 3U7ZA 1WI0A 1WXVA 4KDLB 1DOIA 1T0RC 2FUG1 2V4LA 1ZDXA 2LGDA 2PEAA 3TL5A 2BYVE 3EFCA 3BZDB 1GOZA 1XLOA 1ZKHA 2BWES 3GB1A 3RNAC 3M3JA 2L1AA 4G50A 4LNNA 2Z8LA 2O2VA 3AEDB 4GXBA 4JL9A 4KV2A 2NVUI 4RNAA 2KJHB 1UUPA 1FRDA 2JSVX 4AQ7A 2KANA 2OHFA 2SAKA 4F8CB 1XO3A 2WS3B 4DHZE 1C77A 2K22A 3ZGZA 3C0RB 4K81A 5BMHA 3ZVVA 1V97A 1WGHA 2UWQA 2INDC 3KYCD 3QWZB 1YX5B 1TS4A 2K8CA 2KTRA 2M1MA 2KJRA 3OJ4B 2RMMA 2J42A 1ZP0B 1GC7A 2JU6X 3RN9C 1J7AA 3WANA 2CJOA 1HQRD 5CX3A 5D6JB 3U8ZA 4WJOA 4EOYA 3Q3MC 2DENB 4M8MA 2DZJA 4KKJA 2GI9A 3A9KA 2MX2A 2PIAA 3MC0B 3V05A 2AQ3B 2GB1A 2QSDA 3UI3A 3W1YA 2GMIC 2X8XX 3MHZA 4PS3A 2XNAC 2LGXA 3ETRA 2JZZA 4W9JA 4BOSC 3IAM1 2WXQA 3U7DA 4II3B 2KQ4X 3W9CB 1JRUA 4A8XC 4P16A 2DX5B 3P4RB 2V4IB 3EFUA 4ITKA 4N9F4 3VVWB 1FO4A 4IWOA 1BMLC 2DWQA 3AXCA 1WF9A 4K7WA 2FAZA 1XF5L 2D3AA 2B76B 5JH5C 1C1YB 2WXNA 1RRBA 1MG4A 1R4MB 2JZ3B 5GMVA 2KVRA 2C7MB 2ONQA 4W9FA 2MJ3A 4GDKA 4GDLB 2MH7A 4P1BC 4ZRIA 1KM7A 1RYJA 3AEGB 5C23A 2GBKA 1C4CA 1WYGA 1BXTA 5E6PA 4OZCA 3HK0A 4TKNA 1STEA 3VR8B 3DBHB 4DHZB 2MP2B 5FR3A 4EZKA 5G5GA 3AEEB 2DNFA 3DBRB 3AEBB 1YJJA 3LDZE 2L0TA 4A6QA 3SR6A 4C7YA 1J0GA 1I4RA 3TEXA 5D3IB 3QJZA 4MH0E 2QILA 2ZVOA 4F1SA 1OTRB 1IUEA 5H92C 3AE7B 1IGCA 1RAXA 2H88B 2WXIA 3GS2A 3AM9A 1YMHE 3APFA 1WJUA 2I1JA 1SE3A 2WQYB 3A4RA 3DHHC 3MP9A 4KZCA 4QAYA 1N5WA 2KO3A 1F77A 2PVGC 1D5ZC 3N9YC 3APDA 1WX9A 5BYQA 1Q10A 3I9V1 4A20A 3NUHB 3ZTCA 1NEKB 2LUEA 3J9CA 4TSSA 3ENEA 2MW5A 4X57B 1JCKB 2KDFB 1KLVA 1ZPSA 3IG3A 3LB8C 1WJNA 3OAWA 5EE3A 4A90A 2BW2A 1SF0A 4IWQA 3A1QB 1N63A 4DXGA 4MM3B 1MFWA 2IPKD 3QCAA 2IZVB 4HCPB 3BVGA 2J7QB 3RNCC 1P1AA 4HLEA 3KUDB 2L3ZA 3I3TB 3IBEA 2IO1B 4P1CC 1WXQA 2C60A 3AU4A 2I1KA 4RF0A 2KYWA 2NPTB 2JXXA 5HFYA 2M0XA 1SIJA 5GXGB 2NCNA 3DQVA 4RGOS 4W9CA 3CSTA 1WX8A 2KJ6A 5BYRA 2E3TA 4MEMA 2JRIB 4GOCA 3N1ZC 2BVCA 2KXJA 4IWPA 2BWFA 2LGYA 3P42A 3H7PA 2AX5A 3UQAA 2EMSA 1VCBA 3BVZA 1TZ1A 4IC7B 3PSEB 2KKCA 3P4QB 2JYTA 1E7UA 2KWVB 4YT0B 3PHWB 5H8YE 1FCCC 1KH0A 1FCLA 3D32A 4OVZA 1YD8U 1E8YA 5DPRA 4O1NA 4ACFA 4BKSD 4GMVA 3UF8A 1T3QA 3VTWA 2DYOA 3Q2AC 4ZRJA 2NTTA 3RUIB 5BMIA 5D7GA 1BUIC 1WMHA 3WAMA 3P1MA 3L08A 1L2NA 1ZE3D 4DWFA 3LJ3A 1C4AA 3LYYA 2J52A 2D07B 1V5TA 3R3MA 2KLGA 4YTMB 4PK1A 3IFWB 2JXTA 1HXYD 5J2RA 3DVNV 4WJPA 3W1SA 1P7EA 4MGIE 3NG0A 2LASA 3Q8EA 2NS5A 1E7PB 1I35A 1Z2MA 1TBEA 3Q8AA 4J6IA 4B0MA 4FJZA 3ML9A 5CHWA 2DAFA 4JWUC 4KIKB 3H9DA 3PT2B 2K5PA 1Z5SB 2LGSA 4YTPB 2W9NA 2AEHA 2IGGA 2INNE 1SE2A 3AN1A 2IDYA
chains in the Genus database with same CATH topology
1WM3A 4ZYNA 3M63B 1NDDA 5JHAA 2IO2B 2MRPA 2MLBA 1OGWA 4FBJB 1CMXB 1YQBA 2DAJA 2REXA 1XQQA 4NQKE 4NAWA 2WDTB 3PRZA 2N7DA 3L13A 1GG3A 4TQ1A 1YX6B 4NQLB 4HCNB 2HTHA 1V80A 4DHJD 3T8MA 1K8RB 3SHQA 1GUAB 1BT0A 1Q0WB 1V5OA 3CSFA 4LJPB 5KHOA 4KZ0A 2G45B 2KZRA 3ECIA 3L10B 3PLVA 1WI0A 3UQBA 1WXAA 1WXVA 4KDLB 2AL6A 3X0WA 2PE9A 1E8XA 5LXIB 1WGGA 1A5RA 1T0YA 2V4LA 4JGHB 2LGDA 2PEAA 2ZEQA 3TL5A 2BYVE 2NPTA 3UGBB 3ZW3A 2ASQA 2KD0A 3A9JA 4GDLA 2Z0DB 4KIKA 2FUHB 1U4AA 3VH3B 3DOWA 1ZKHA 3L16A 3X23A 2BWES 3AI5A 3VTVA 3B1LX 3GOEA 1S3SG 1X1MA 3M3JA 2JPHA 3EC8A 4G50A 4II2B 1WE6A 1WE7A 2A5UA 2KDEB 1WZ0A 2O2VA 4ANWA 4GXBA 4XZ4A 5AZGA 4JL9A 3SU8X 3WIMA 4KV2A 2NVUI 2K25A 2KJHB 3O65B 2N7EA 3L54A 1WJ4A 3DPDA 4W9IA 2V3SA 1LFDA 3ZDMC 2KANA 4B6WA 1UZXB 4F8CB 3QAQA 5LLIA 3AU5A 3NS8A 1OEYA 4K7UA 4I6LB 1OQYA 2DZMA 2J0KA 5KHQA 4LDTB 4DHZE 2KWCA 2IO0B 2IBIB 3C0RB 4E74A 4K81A 4ZDVA 3DCGA 3ZVVA 4G11A 1P9DU 1WY8A 4FULA 1WGHA 1WXSA 2UWQA 3KYCD 3QWZB 1YX5B 3JW0X 4KSLC 2K8CA 4ANVA 1F9JA 2CU1A 2KTRA 1WH3A 2KX3A 2M1MA 3KUCB 3ZIMA 4B9KA 2AYOB 2CKHB 1NBFC 2KJRA 2LVQA 3OJ4B 3PLUA 3ZRCA 2JY6A 2MBHA 3DBHI 3GZNI 3N32A 3ZKJC 3WALA 3JYUA 4ICVA 1GC7A 3WANA 1S1QB 2D3GA 1UD7A 2FCSA 4NJ6A 2KTFA 1EF5A 2JF5A 5CX3A 3RULA 1YIWA 2FCMA 2O6VD 3EHVA 3PV1A 4IG7B 4W9DA 4WJOA 1Q5WB 5D6JB 3U8ZA 2FNJB 4EOYA 5C1ZA 1RFAA 2DENB 3PZDA 2DZJA 2KHWB 4M8MA 3A9KA 2MX2A 4RM8A 1FXTB 1TTNA 4I6NB 3H6NA 2KMAA 4WWPA 1V2YA 2MCNB 2GBJA 3QA8A 4MJSB 3ZNHB 4DBGA 3QARA 2NBUA 3W1YA 4FJYA 2NR2A 2GMIC 4PS3A 1LM8B 2ZNVB 2LGXA 2K6DB 2JZZA 2FIFA 4W9JA 4BOSC 4FADA 3NY5A 4AUQC 3NOBA 2KC2A 5J17A 2K6QA 2CR5A 4MGYE 3U7DA 5L95C 3JSVB 1E5WA 2BGFA 4II3B 3RZWC 3PRPB 4PS7A 2WX1A 4MDKE 1JRUA 4IM3A 4KVGB 3N30A 1LQBA 3B08A 2JWZA 2RSUA 4DK5A 2JUOA 2DX5B 1RLFA 2K8BA 3EFUA 4MGZE 4NAWB 2A4ZA 3Q3FA 4N9F4 3VVWB 2OJRA 3ZLZA 3OLMD 5TR5A 1V49A 1V9JA 2WYQA 4IWOA 3RT3B 1M94A 3VUXA 4NJ7A 3AXCA 5E6NA 4DDGD 1C3TA 1E8WA 5CHVC 1WF9A 4K7WA 2FAZA 2PPHA 1IYFA 4EUTA 3BINA 1WM2A 3PGEA 5G55A 5JH5C 1C1YB 5E6OA 1RRBA 2C9WB 2JZ3B 1SE9A 5GMVA 2KVRA 2C7MB 3DBSA 2C7HA 1WR6E 1EUVB 4HK2A 4W9FA 3ONSA 4GDKA 3A9JB 4GDLB 5D94A 2XBBC 1Y8RC 4ZRIA 1KM7A 2BKRB 2G4SA 3V61A 5G2NA 4WJNA 2BKFA 4GN1A 2MBEA 2GBKA 5C23A 2L05A 4EFOA 5J18A 2KOXA 1WMHB 5D2MB 4RM9A 1R4MI 1WX7A 3CMMB 3B0AA 3JSVA 3RZFA 1ZW7A 4BKTA 3DDCB 1E8ZA 2KFJA 2KDBA 5E6PA 3APCA 1J19A 3DVNU 2GBRA 2MWSB 2MP2A 3DBLI 2MBQA 3HK0A 4TKNA 2WX0A 3R7QA 4AWJA 2DZKA 1WFYA 3NHEB 1ISNA 2K8HA 2FCNA 3T9LA 3PS6A 2C5LC 2LVOA 3JVZX 4XC2A 5AZFA 2LWPA 4BVUC 4DHZB 5DPSA 3HIZA 2KQ7A 4CYEA 2MP2B 4WWOA 2L8JA 4EZKA 1I42A 3ZTDA 4F7ZA 2NBWB 5DPTA 5AZHA 2OOBB 4ANUA 1KJTA 3A33B 4DXAB 3LDZE 2L0TA 3PVLA 1P98A 4EZJA 1J0GA 3IHPC 3QC8B 1XT9B 2CHZA 3DVGY 3PPAA 4HPLB 3H7PB 4A3OA 2MBBB 4B95A 3QJZA 4MH0E 4OVVA 3TBLD 2C7NB 4OVUA 4M0WB 3VHTC 4DDID 2LZ6A 1WJ6A 4BKSA 2BF8B 2LXCA 2ZVOA 3KVFB 4W9KA 2RPQA 2EMTA 4F1SA 3VAWA 1NI2A 4TUUA 2EKEC 2KDIA 4FN2A 1OTRB 3HM3A 2XK5A 2MBOA 3V6EB 2M17A 3R66C 1SIFA 3QIJA 2M8SA 2K1FA 4MM3A 5BO4B 1RAXA 3RCZA 4LCDE 1LXDA 3APFA 3KH0A 1WJUA 2ZZPB 2I1JA 4JQWC 3TCAA 3H1UA 3VUYA 3ZDTA 4CO7A 2ZPYA 2N4FA 3A4RA 4KZCA 1J8CA 4G0NB 3PHXB 2KO3A 1WRDB 2KQSA 4FHJA 2R2QA 5AEKB 4GU2A 4MSMB 3SD5A 3VH4B 3K9OB 4HVBA 4MELA 1UBIA 1UGMA 4WQOB 3RYTA 3ML8A 4EZLA 3U30A 3APDA 1WX9A 4IM2A 1E90A 3R7RA 4AJWA 4A20A 3NZUA 4WWNA 1E7VA 4IW0A 3ZTCA 4BOZB 2G3QB 4KSKC 2N9XA 2CHWA 2D10A 2GBMA 2O2VB 2LUEA 2KK8A 3HM6X 4GSWA 4WJQA 2IY0B 3ENEA 2MW5A 4GB9A 4X57B 4ASWC 2KDFB 2O6VB 3HHMA 1KLVA 2KFKB 3IG3A 1WJNA 5FR6A 3OAWA 4PS8A 1WZ3A 2LVPA 2N9EB 1IPGA 4KDIC 4ANXA 1H8CA 4IWQA 3K9PB 4W9GA 2XK5B 1WIAA 1MG8A 3KUZA 3A1QB 4LJOB 4NY0A 3VTUA 1P0RA 3VUWA 3QCAA 2IZVB 4HCPB 2KFKA 2J7QB 4IM0A 1P1AA 4MGKE 4HLEA 3KUDB 2L3ZA 4NNJB 3BY4B 2PE6B 2PJHA 3PREA 3I3TB 4PYUA 3V60A 2BYEA 3H7SA 3VFKA 1WXMA 3IBEA 2V1YA 4GGQA 4A3PA 2IO1B 1Q1OA 1KOTA 2C60A 3AU4A 2MSED 4LDTD 2I1KA 5HKHA 3ZNID 2B3AA 2FCQA 2N1WA 2NPTB 2JXXA 4TQ0A 2M0XA 4MSQB 2NCNA 3DQVA 5L83A 2KLCA 3UIPB 3AULA 1WYWB 4HJKA 3WAOA 4BBNF 3A9KB 3S2AA 4W9CA 5IAAC 3CSTA 4E3CA 1WX8A 3PRMB 5EDSA 3UIOB 3L17A 2LI5A 1HE8A 3EECA 2KJ6A 4URKA 3QHTA 5JHBA 2M4NA 2DHZA 2JRIB 4MEMA 4JIOU 2Y5BB 2DYMA 2KX0A 1SGHA 3ZRFA 4FHKA 1D3ZA 1WGRA 2L00B 4WAAA 2LRWA 3MTNB 4GOCA 2KNBA 3WAPA 3P2BA 2KXJA 1V86A 2IO3B 3IVFA 5CTRC 4AJYB 4JLCA 3M62B 4BBNC 4IWPA 2DYBA 4FA6A 2BWFA 4HDQA 2NBVB 4K1RB 2VRRB 4E71A 2LGYA 3H7PA 1V81A 3UQAA 2KC1A 2EMSA 2LRUA 1VCBA 2HE7A 1TZ1A 3KW5B 2D11A 2KWUB 4IC7B 4I6PA 5CHFA 2L76A 2LD9A 2RGFA 3PSEB 3TIXA 3ZO5B 2UYZB 2KKCA 3MHSD 4HDOA 1WGDA 3QQ8B 3VQIA 1E7UA 1EO6A 1EF1A 2J0MA 2KWVB 3PHWB 3PTFC 4NPNA 3ZNGC 2ZPNA 4W9HA 3QX1A 4W9EA 2R2OA 3D32A 1YD8U 4FLHA 1E8YA 4BFRA 5DPRA 4RMAA 3KYDD 2ZCCA 2MA9B 2G4DB 2JVCA 2RD0A 4XX5A 2DZIA 1GNUA 4BKSD 2YLMA 3NZSA 4GMVA 3UF8A 2JT4B 4K7SA 3M95A 1ZGUB 2KN5A 2LJ5A 2D2QA 3CF6E 3MJWA 4EEWA 3VTWA 4ICUA 2DYOA 4ZRJA 3RUIB 1UELA 5D7GA 2CS4A 1IP9A 3N3KB 4AOFA 2HD5B 2L7RA 1WMHA 2BPSA 2L0FA 2FIDA 2Z59B 3WAMA 3L08A 1L2NA 2MQJA 4G3XB 4FJVB 4DWFA 2QHOA 3LJ3A 4P7IA 2BYFA 4MJSA 1XD3B 3OJ3A 4DHJB 2D07B 1V5TA 3R3MA 2KLGA 2JRHA 4GIVA 2O6VA 3A1QA 2YVCA 3IFWB 4BKGA 1GJZA 4GDKB 5DCNA 1UBQA 4HXDA 2LXAA 2N9PC 3V6CB 5IA7A 5J2RA 2RR9A 1L7YA 2ZCBA 1QZEA 3DBRI 3V62A 2IYDB 2WWZA 3DVNV 3SDLC 4WJPA 3W1SA 1R4NI 2HJ8A 4W9LA 4MGIE 1AARA 2ZVNA 1H4RA 4M8NA 4TV3A 4YL8A 5JZEB 1G6JA 3RD2A 3Q3JA 5LXHA 2LASA 2GOWA 2NS5A 1I35A 1Z2MA 1PQSA 1TBEA 2AL3A 2ZJDA 4J6IA 4CHKA 2Z0EB 2XEWA 2KTRB 4FJZA 2AWTA 1GC6A 4AP4C 2KMCA 1V6EA 3ML9A 5CHWA 2DAFA 1WR1A 4KIKB 2IY1B 4HPMB 3QK0A 3A4SC 4ZRKA 3TJPA 2N1VA 3WA0A 4EKUA 1OEYJ 3VDZA 1WGYA 4PYZA 3H9DA 2GBNA 3TMPB 4IUMB 3DVGX 3PT2B 2CHXA 3ZNZB 1Z5SB 2K39A 1VD2A 2J0JA 4HWIB 3L0WB 3W1SC 3VXWA 5DPWA 1YJ1A 2W9NA 2ZNVC 2AEHA 3ZUNA 1TGZB 3ALBA 3UINB 1UH6A 1P3QU
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1WM3 A;  4ZYN A;  3M63 B;  1NDD A;  5JHA A;  2IO2 B;  2MRP A;  2MLB A;  1OGW A;  4FBJ B;  1CMX B;  1YQB A;  2DAJ A;  2REX A;  1XQQ A;  4NQK E;  4NAW A;  2WDT B;  3PRZ A;  2N7D A;  3L13 A;  1GG3 A;  4TQ1 A;  1YX6 B;  4NQL B;  4HCN B;  2HTH A;  1V80 A;  4DHJ D;  3T8M A;  1K8R B;  3SHQ A;  1GUA B;  1BT0 A;  1Q0W B;  1V5O A;  3CSF A;  4LJP B;  5KHO A;  4KZ0 A;  2G45 B;  2KZR A;  3ECI A;  3L10 B;  3PLV A;  1WI0 A;  3UQB A;  1WXA A;  1WXV A;  4KDL B;  2AL6 A;  3X0W A;  2PE9 A;  1E8X A;  5LXI B;  1WGG A;  1A5R A;  1T0Y A;  2V4L A;  4JGH B;  2LGD A;  2PEA A;  2ZEQ A;  3TL5 A;  2BYV E;  2NPT A;  3UGB B;  3ZW3 A;  2ASQ A;  2KD0 A;  3A9J A;  4GDL A;  2Z0D B;  4KIK A;  2FUH B;  1U4A A;  3VH3 B;  3DOW A;  1ZKH A;  3L16 A;  3X23 A;  2BWE S;  3AI5 A;  3VTV A;  3B1L X;  3GOE A;  1S3S G;  1X1M A;  3M3J A;  2JPH A;  3EC8 A;  4G50 A;  4II2 B;  1WE6 A;  1WE7 A;  2A5U A;  2KDE B;  1WZ0 A;  2O2V A;  4ANW A;  4GXB A;  4XZ4 A;  5AZG A;  4JL9 A;  3SU8 X;  3WIM A;  4KV2 A;  2NVU I;  2K25 A;  2KJH B;  3O65 B;  2N7E A;  3L54 A;  1WJ4 A;  3DPD A;  4W9I A;  2V3S A;  1LFD A;  3ZDM C;  2KAN A;  4B6W A;  1UZX B;  4F8C B;  3QAQ A;  5LLI A;  3AU5 A;  3NS8 A;  1OEY A;  4K7U A;  4I6L B;  1OQY A;  2DZM A;  2J0K A;  5KHQ A;  4LDT B;  4DHZ E;  2KWC A;  2IO0 B;  2IBI B;  3C0R B;  4E74 A;  4K81 A;  4ZDV A;  3DCG A;  3ZVV A;  4G11 A;  1P9D U;  1WY8 A;  4FUL A;  1WGH A;  1WXS A;  2UWQ A;  3KYC D;  3QWZ B;  1YX5 B;  3JW0 X;  4KSL C;  2K8C A;  4ANV A;  1F9J A;  2CU1 A;  2KTR A;  1WH3 A;  2KX3 A;  2M1M A;  3KUC B;  3ZIM A;  4B9K A;  2AYO B;  2CKH B;  1NBF C;  2KJR A;  2LVQ A;  3OJ4 B;  3PLU A;  3ZRC A;  2JY6 A;  2MBH A;  3DBH I;  3GZN I;  3N32 A;  3ZKJ C;  3WAL A;  3JYU A;  4ICV A;  1GC7 A;  3WAN A;  1S1Q B;  2D3G A;  1UD7 A;  2FCS A;  4NJ6 A;  2KTF A;  1EF5 A;  2JF5 A;  5CX3 A;  3RUL A;  1YIW A;  2FCM A;  2O6V D;  3EHV A;  3PV1 A;  4IG7 B;  4W9D A;  4WJO A;  1Q5W B;  5D6J B;  3U8Z A;  2FNJ B;  4EOY A;  5C1Z A;  1RFA A;  2DEN B;  3PZD A;  2DZJ A;  2KHW B;  4M8M A;  3A9K A;  2MX2 A;  4RM8 A;  1FXT B;  1TTN A;  4I6N B;  3H6N A;  2KMA A;  4WWP A;  1V2Y A;  2MCN B;  2GBJ A;  3QA8 A;  4MJS B;  3ZNH B;  4DBG A;  3QAR A;  2NBU A;  3W1Y A;  4FJY A;  2NR2 A;  2GMI C;  4PS3 A;  1LM8 B;  2ZNV B;  2LGX A;  2K6D B;  2JZZ A;  2FIF A;  4W9J A;  4BOS C;  4FAD A;  3NY5 A;  4AUQ C;  3NOB A;  2KC2 A;  5J17 A;  2K6Q A;  2CR5 A;  4MGY E;  3U7D A;  5L95 C;  3JSV B;  1E5W A;  2BGF A;  4II3 B;  3RZW C;  3PRP B;  4PS7 A;  2WX1 A;  4MDK E;  1JRU A;  4IM3 A;  4KVG B;  3N30 A;  1LQB A;  3B08 A;  2JWZ A;  2RSU A;  4DK5 A;  2JUO A;  2DX5 B;  1RLF A;  2K8B A;  3EFU A;  4MGZ E;  4NAW B;  2A4Z A;  3Q3F A;  4N9F 4;  3VVW B;  2OJR A;  3ZLZ A;  3OLM D;  5TR5 A;  1V49 A;  1V9J A;  2WYQ A;  4IWO A;  3RT3 B;  1M94 A;  3VUX A;  4NJ7 A;  3AXC A;  5E6N A;  4DDG D;  1C3T A;  1E8W A;  5CHV C;  1WF9 A;  4K7W A;  2FAZ A;  2PPH A;  1IYF A;  4EUT A;  3BIN A;  1WM2 A;  3PGE A;  5G55 A;  5JH5 C;  1C1Y B;  5E6O A;  1RRB A;  2C9W B;  2JZ3 B;  1SE9 A;  5GMV A;  2KVR A;  2C7M B;  3DBS A;  2C7H A;  1WR6 E;  1EUV B;  4HK2 A;  4W9F A;  3ONS A;  4GDK A;  3A9J B;  4GDL B;  5D94 A;  2XBB C;  1Y8R C;  4ZRI A;  1KM7 A;  2BKR B;  2G4S A;  3V61 A;  5G2N A;  4WJN A;  2BKF A;  4GN1 A;  2MBE A;  2GBK A;  5C23 A;  2L05 A;  4EFO A;  5J18 A;  2KOX A;  1WMH B;  5D2M B;  4RM9 A;  1R4M I;  1WX7 A;  3CMM B;  3B0A A;  3JSV A;  3RZF A;  1ZW7 A;  4BKT A;  3DDC B;  1E8Z A;  2KFJ A;  2KDB A;  5E6P A;  3APC A;  1J19 A;  3DVN U;  2GBR A;  2MWS B;  2MP2 A;  3DBL I;  2MBQ A;  3HK0 A;  4TKN A;  2WX0 A;  3R7Q A;  4AWJ A;  2DZK A;  1WFY A;  3NHE B;  1ISN A;  2K8H A;  2FCN A;  3T9L A;  3PS6 A;  2C5L C;  2LVO A;  3JVZ X;  4XC2 A;  5AZF A;  2LWP A;  4BVU C;  4DHZ B;  5DPS A;  3HIZ A;  2KQ7 A;  4CYE A;  2MP2 B;  4WWO A;  2L8J A;  4EZK A;  1I42 A;  3ZTD A;  4F7Z A;  2NBW B;  5DPT A;  5AZH A;  2OOB B;  4ANU A;  1KJT A;  3A33 B;  4DXA B;  3LDZ E;  2L0T A;  3PVL A;  1P98 A;  4EZJ A;  1J0G A;  3IHP C;  3QC8 B;  1XT9 B;  2CHZ A;  3DVG Y;  3PPA A;  4HPL B;  3H7P B;  4A3O A;  2MBB B;  4B95 A;  3QJZ A;  4MH0 E;  4OVV A;  3TBL D;  2C7N B;  4OVU A;  4M0W B;  3VHT C;  4DDI D;  2LZ6 A;  1WJ6 A;  4BKS A;  2BF8 B;  2LXC A;  2ZVO A;  3KVF B;  4W9K A;  2RPQ A;  2EMT A;  4F1S A;  3VAW A;  1NI2 A;  4TUU A;  2EKE C;  2KDI A;  4FN2 A;  1OTR B;  3HM3 A;  2XK5 A;  2MBO A;  3V6E B;  2M17 A;  3R66 C;  1SIF A;  3QIJ A;  2M8S A;  2K1F A;  4MM3 A;  5BO4 B;  1RAX A;  3RCZ A;  4LCD E;  1LXD A;  3APF A;  3KH0 A;  1WJU A;  2ZZP B;  2I1J A;  4JQW C;  3TCA A;  3H1U A;  3VUY A;  3ZDT A;  4CO7 A;  2ZPY A;  2N4F A;  3A4R A;  4KZC A;  1J8C A;  4G0N B;  3PHX B;  2KO3 A;  1WRD B;  2KQS A;  4FHJ A;  2R2Q A;  5AEK B;  4GU2 A;  4MSM B;  3SD5 A;  3VH4 B;  3K9O B;  4HVB A;  4MEL A;  1UBI A;  1UGM A;  4WQO B;  3RYT A;  3ML8 A;  4EZL A;  3U30 A;  3APD A;  1WX9 A;  4IM2 A;  1E90 A;  3R7R A;  4AJW A;  4A20 A;  3NZU A;  4WWN A;  1E7V A;  4IW0 A;  3ZTC A;  4BOZ B;  2G3Q B;  4KSK C;  2N9X A;  2CHW A;  2D10 A;  2GBM A;  2O2V B;  2LUE A;  2KK8 A;  3HM6 X;  4GSW A;  4WJQ A;  2IY0 B;  3ENE A;  2MW5 A;  4GB9 A;  4X57 B;  4ASW C;  2KDF B;  2O6V B;  3HHM A;  1KLV A;  2KFK B;  3IG3 A;  1WJN A;  5FR6 A;  3OAW A;  4PS8 A;  1WZ3 A;  2LVP A;  2N9E B;  1IPG A;  4KDI C;  4ANX A;  1H8C A;  4IWQ A;  3K9P B;  4W9G A;  2XK5 B;  1WIA A;  1MG8 A;  3KUZ A;  3A1Q B;  4LJO B;  4NY0 A;  3VTU A;  1P0R A;  3VUW A;  3QCA A;  2IZV B;  4HCP B;  2KFK A;  2J7Q B;  4IM0 A;  1P1A A;  4MGK E;  4HLE A;  3KUD B;  2L3Z A;  4NNJ B;  3BY4 B;  2PE6 B;  2PJH A;  3PRE A;  3I3T B;  4PYU A;  3V60 A;  2BYE A;  3H7S A;  3VFK A;  1WXM A;  3IBE A;  2V1Y A;  4GGQ A;  4A3P A;  2IO1 B;  1Q1O A;  1KOT A;  2C60 A;  3AU4 A;  2MSE D;  4LDT D;  2I1K A;  5HKH A;  3ZNI D;  2B3A A;  2FCQ A;  2N1W A;  2NPT B;  2JXX A;  4TQ0 A;  2M0X A;  4MSQ B;  2NCN A;  3DQV A;  5L83 A;  2KLC A;  3UIP B;  3AUL A;  1WYW B;  4HJK A;  3WAO A;  4BBN F;  3A9K B;  3S2A A;  4W9C A;  5IAA C;  3CST A;  4E3C A;  1WX8 A;  3PRM B;  5EDS A;  3UIO B;  3L17 A;  2LI5 A;  1HE8 A;  3EEC A;  2KJ6 A;  4URK A;  3QHT A;  5JHB A;  2M4N A;  2DHZ A;  2JRI B;  4MEM A;  4JIO U;  2Y5B B;  2DYM A;  2KX0 A;  1SGH A;  3ZRF A;  4FHK A;  1D3Z A;  1WGR A;  2L00 B;  4WAA A;  2LRW A;  3MTN B;  4GOC A;  2KNB A;  3WAP A;  3P2B A;  2KXJ A;  1V86 A;  2IO3 B;  3IVF A;  5CTR C;  4AJY B;  4JLC A;  3M62 B;  4BBN C;  4IWP A;  2DYB A;  4FA6 A;  2BWF A;  4HDQ A;  2NBV B;  4K1R B;  2VRR B;  4E71 A;  2LGY A;  3H7P A;  1V81 A;  3UQA A;  2KC1 A;  2EMS A;  2LRU A;  1VCB A;  2HE7 A;  1TZ1 A;  3KW5 B;  2D11 A;  2KWU B;  4IC7 B;  4I6P A;  5CHF A;  2L76 A;  2LD9 A;  2RGF A;  3PSE B;  3TIX A;  3ZO5 B;  2UYZ B;  2KKC A;  3MHS D;  4HDO A;  1WGD A;  3QQ8 B;  3VQI A;  1E7U A;  1EO6 A;  1EF1 A;  2J0M A;  2KWV B;  3PHW B;  3PTF C;  4NPN A;  3ZNG C;  2ZPN A;  4W9H A;  3QX1 A;  4W9E A;  2R2O A;  3D32 A;  1YD8 U;  4FLH A;  1E8Y A;  4BFR A;  5DPR A;  4RMA A;  3KYD D;  2ZCC A;  2MA9 B;  2G4D B;  2JVC A;  2RD0 A;  4XX5 A;  2DZI A;  1GNU A;  4BKS D;  2YLM A;  3NZS A;  4GMV A;  3UF8 A;  2JT4 B;  4K7S A;  3M95 A;  1ZGU B;  2KN5 A;  2LJ5 A;  2D2Q A;  3CF6 E;  3MJW A;  4EEW A;  3VTW A;  4ICU A;  2DYO A;  4ZRJ A;  3RUI B;  1UEL A;  5D7G A;  2CS4 A;  1IP9 A;  3N3K B;  4AOF A;  2HD5 B;  2L7R A;  1WMH A;  2BPS A;  2L0F A;  2FID A;  2Z59 B;  3WAM A;  3L08 A;  1L2N A;  2MQJ A;  4G3X B;  4FJV B;  4DWF A;  2QHO A;  3LJ3 A;  4P7I A;  2BYF A;  4MJS A;  1XD3 B;  3OJ3 A;  4DHJ B;  2D07 B;  1V5T A;  3R3M A;  2KLG A;  2JRH A;  4GIV A;  2O6V A;  3A1Q A;  2YVC A;  3IFW B;  4BKG A;  1GJZ A;  4GDK B;  5DCN A;  1UBQ A;  4HXD A;  2LXA A;  2N9P C;  3V6C B;  5IA7 A;  5J2R A;  2RR9 A;  1L7Y A;  2ZCB A;  1QZE A;  3DBR I;  3V62 A;  2IYD B;  2WWZ A;  3DVN V;  3SDL C;  4WJP A;  3W1S A;  1R4N I;  2HJ8 A;  4W9L A;  4MGI E;  1AAR A;  2ZVN A;  1H4R A;  4M8N A;  4TV3 A;  4YL8 A;  5JZE B;  1G6J A;  3RD2 A;  3Q3J A;  5LXH A;  2LAS A;  2GOW A;  2NS5 A;  1I35 A;  1Z2M A;  1PQS A;  1TBE A;  2AL3 A;  2ZJD A;  4J6I A;  4CHK A;  2Z0E B;  2XEW A;  2KTR B;  4FJZ A;  2AWT A;  1GC6 A;  4AP4 C;  2KMC A;  1V6E A;  3ML9 A;  5CHW A;  2DAF A;  1WR1 A;  4KIK B;  2IY1 B;  4HPM B;  3QK0 A;  3A4S C;  4ZRK A;  3TJP A;  2N1V A;  3WA0 A;  4EKU A;  1OEY J;  3VDZ A;  1WGY A;  4PYZ A;  3H9D A;  2GBN A;  3TMP B;  4IUM B;  3DVG X;  3PT2 B;  2CHX A;  3ZNZ B;  1Z5S B;  2K39 A;  1VD2 A;  2J0J A;  4HWI B;  3L0W B;  3W1S C;  3VXW A;  5DPW A;  1YJ1 A;  2W9N A;  2ZNV C;  2AEH A;  3ZUN A;  1TGZ B;  3ALB A;  3UIN B;  1UH6 A;  1P3Q U; 
#chains in the Genus database with same CATH topology
 4ZYN A;  1JWU D;  1ROE A;  3Q3N C;  2IO2 B;  4FBJ B;  3ZJT A;  1XQQ A;  4Q2J A;  2N7D A;  1V80 A;  3T8M A;  1DYQ A;  1GUA B;  1Q0W B;  3TSS A;  3L10 B;  3UQB A;  1WXA A;  1E8X A;  5IP4 D;  4N59 A;  1FNV A;  1F2R C;  4GDL A;  1TKY A;  2FUH B;  3VH3 B;  3DOW A;  2PVO D;  2WXL A;  1HTQ A;  3X23 A;  3AI5 A;  3B1L X;  1FEH A;  2V0G A;  2JPH A;  3AEF B;  4II2 B;  1XXG A;  4ANW A;  3KWL A;  3FIL B;  2GRI A;  4XZ4 A;  3SU8 X;  3VRB B;  4W9I A;  1VLB A;  2V3S A;  2JQR B;  1LFD A;  4XWT A;  4B6W A;  1QOG A;  2W55 A;  3AU5 A;  3NS8 A;  4K7U A;  2M0A A;  4S17 A;  2IBI B;  1HZ5 A;  1HZ6 A;  4ZDV A;  1P9D U;  4FUL A;  1WXS A;  1R7S A;  4ARI A;  4HPP A;  3Q14 C;  4ANV A;  2RDH A;  2CU1 A;  1EU4 A;  3KUC B;  4B9K A;  2AYO B;  3DHI C;  3NVW A;  3PLU A;  2MBH A;  4XWW A;  3RFZ B;  3EA6 A;  1UD7 A;  1PGX A;  2FCS A;  4NJ6 A;  1EF5 A;  1K50 A;  3P4S B;  1YIW A;  2L83 A;  3DBL B;  3VUX A;  4US8 A;  4W9D A;  2W54 A;  3PZD A;  2KHW B;  2WXO A;  2MCN B;  3ZNH B;  3QAR A;  2NBU A;  2NR2 A;  2ZNV B;  4FAD A;  2K6D B;  2FIF A;  4DQO C;  1R4N B;  2K6Q A;  2CR5 A;  2WDV B;  3JSV B;  2BGF A;  3RZW C;  3PRP B;  3ZXV A;  2KT7 A;  2WX1 A;  4MDK E;  1KLG D;  4IM3 A;  3N30 A;  1RWS A;  2QJL A;  1ZXH A;  1FD6 A;  2JWZ A;  1OFF A;  2JUO A;  3IT4 B;  3AE8 B;  4NAW B;  3Q3F A;  3ZLZ A;  1V49 A;  1SE4 A;  1M94 A;  1K53 A;  5CHV C;  2BTE A;  1XEE A;  4EUT A;  1WM2 A;  4DXF A;  1TT5 B;  4WH4 A;  1WR6 E;  5D94 A;  5T8I A;  1SSN A;  1Y8R C;  2W3R A;  3LXF A;  5AUK A;  2MBE A;  4OHJ A;  1IBX A;  1WMH B;  1I7H A;  5D2M B;  1R4M I;  1WX7 A;  1YN4 A;  4NJC A;  3RZF A;  1ZW7 A;  1PGB A;  3DDC B;  3KWV A;  3AE5 B;  2KDB A;  2WHI A;  3W5V B;  3DVN U;  2GBR A;  1MPE A;  4LNF A;  1WWT A;  2CJN A;  1EWC A;  2MP2 A;  2MBQ A;  2WX0 A;  3HVD A;  3NHE B;  2PTL A;  2K8H A;  2FCN A;  3T9L A;  3PS6 A;  2LVO A;  3JVZ X;  5AZF A;  3HIZ A;  2KN4 A;  4BZA A;  2L8J A;  1I42 A;  1F1H A;  5DPT A;  5AZH A;  2OOB B;  2BBC A;  4EZJ A;  3IHP C;  3QC8 B;  1XT9 B;  2CHZ A;  4A3O A;  3H7P B;  5EE9 A;  3RI7 C;  2MBB B;  1QOB A;  4B95 A;  4OVV A;  3TBL D;  2C7N B;  4OVU A;  2BF8 B;  2LXC A;  2V3P A;  3E9S A;  3KVF B;  2RPQ A;  4AS1 A;  2PLP A;  1NI2 A;  1VZ7 A;  2EKE C;  2KDI A;  3FKY A;  4FN2 A;  1D4B A;  2OED A;  3SFE B;  2M8S A;  1YQ3 B;  1JWM D;  2INP E;  3KH0 A;  4JQW C;  4ZHP A;  3VUY A;  4C4V B;  1MI0 A;  2ZPY A;  5FKA C;  2N4F A;  4YSX B;  3RMK C;  2N7J A;  4G0N B;  4C80 A;  3SD5 A;  4WQO B;  5D3D A;  3RYT A;  4EZL A;  3ML8 A;  1F0Z A;  4IM2 A;  1E90 A;  3Q8B A;  4IW0 A;  4BOZ B;  2CU3 A;  2CHW A;  2O2V B;  2MJE A;  3HM6 X;  2DLB A;  2IY0 B;  3FAH A;  1NYQ A;  1ESF A;  1UWX A;  5FR6 A;  1T5X D;  2N9E B;  1H8C A;  1VZ8 A;  2WXG A;  4W9G A;  1WIA A;  3KUZ A;  3NZ3 A;  3VTU A;  1XCQ L;  3AB5 A;  2MJD A;  4ZRP A;  4WWM A;  2WP9 B;  1V1P A;  2WXM A;  2WDR B;  1WXM A;  1Q1O A;  2EEL A;  3ZNI D;  1N60 A;  1I4H A;  2N0S B;  4MSQ B;  3AEA B;  3UIP B;  3AUL A;  1WYW B;  4BBN F;  3R2T A;  5EDS A;  2IGH A;  4PT5 A;  3EEC A;  2DHZ A;  2BB6 A;  4JIO U;  1F52 A;  2DYM A;  1N6Z A;  2KX0 A;  3RNF C;  4WAA A;  3P2B A;  2KAC A;  2FBW B;  2WU5 B;  4JLC A;  1VZ6 A;  1GB1 A;  2DYB A;  4FA6 A;  3AE1 B;  1ZXI A;  2NBV B;  4K1R B;  2VRR B;  4E71 A;  2LRU A;  3KW5 B;  3SFD B;  1TZO A;  1TKE A;  2RGF A;  2UYZ B;  3MHS D;  4HDO A;  2LEK A;  1EF1 A;  2J0M A;  1YN5 A;  2LHE A;  2ZPN A;  4W9H A;  3QX1 A;  4W9E A;  2R2O A;  2YEP F;  4FLH A;  2BS3 B;  3KYD D;  1VRA B;  2ZCC A;  2MA9 B;  2DZI A;  1GNU A;  3NZS A;  1PFD A;  3M95 A;  2KN5 A;  2QIE B;  1OQQ A;  3CF6 E;  1Y56 A;  2H89 B;  4ICU A;  1I4Q A;  2CS4 A;  4LNI A;  1IP9 A;  3N3K B;  2HD5 B;  2L7R A;  1GB4 A;  2NTS A;  2JYE A;  4KGS A;  5IOI A;  2MQJ A;  1LGR A;  1ENF A;  2QHO A;  1IBX B;  1JRO A;  5EE0 A;  4DHJ B;  3H8H A;  4KKI A;  1GJZ A;  3I57 A;  3L4P A;  3DWM A;  5IA7 A;  2BT6 A;  1XLP A;  1L7Y A;  3V62 A;  1JRP A;  2HJ8 A;  4YL8 A;  5JZE B;  1AAR A;  4TV3 A;  1G6J A;  1WSP A;  2OJW A;  4TMA B;  3Q3J A;  2GOW A;  2QMT A;  1EM7 A;  2W3S A;  1PQS A;  2AL3 A;  2ZJD A;  3NVY A;  2Z0E B;  2XEW A;  1SJH D;  1WR1 A;  2N1V A;  4EKU A;  1OEY J;  3VDZ A;  1WGY A;  4YWG G;  3TMP B;  3DVG X;  3Q69 A;  4L2Y A;  4P6V F;  2LJI A;  2IJ0 A;  2K39 A;  1FXA A;  4HWI B;  3W1S C;  5DPW A;  1FMA D;  1YJ1 A;  2ZNV C;  4BAX A;  1TGZ B;  3UIN B;  3AE2 B;  5JXV A;  2WXJ A;  4JWS C;  2MRP A;  4NZL B;  5G5H A;  2DAJ A;  1YQB A;  1I4P A;  1OQR A;  3L13 A;  4TQ1 A;  1YX6 B;  2HTH A;  3BK1 A;  4DHJ D;  1FFV A;  1BT0 A;  3DWG C;  2EKI A;  1YQ4 B;  3PLV A;  1C9F A;  1KRH A;  3R8B A;  2PE9 A;  5LXI B;  1T0Y A;  4JGH B;  2VH2 A;  2ZEQ A;  3UGB B;  3ZW3 A;  2NPT A;  2ASQ A;  2KD0 A;  3A9J A;  4USA A;  2Z0D B;  1U4A A;  3L16 A;  3VTV A;  3GOE A;  1N62 A;  4C00 A;  2KDE B;  2A5U A;  1WZ0 A;  1K51 A;  3WIM A;  2D3C A;  2K25 A;  5C3J B;  1WJ4 A;  3AE9 B;  3DPD A;  3ZDM C;  3QAQ A;  4JPS A;  4ARC A;  1M4V A;  5LLI A;  2KWD A;  1A70 A;  2DZM A;  5KHQ A;  4WUR A;  4LDT B;  2KWC A;  2IO0 B;  1ET6 A;  2BS2 B;  3NS1 A;  4G11 A;  1WY8 A;  4N58 A;  1F9J A;  1WH3 A;  1D5X C;  2CKH B;  2BQQ A;  1NBF C;  1JW9 D;  1QQR A;  1SBB B;  2LVQ A;  1AWD A;  2JY6 A;  3B2G A;  3GZN I;  3WAL A;  4US9 A;  4ICV A;  3PZ8 A;  1S1Q B;  2KTF A;  3RUL A;  3DHG C;  3IXS A;  2VZK B;  3KLS X;  4IG7 B;  1Q5W B;  5IKC M;  2FNJ B;  1RFA A;  4RM8 A;  3W5U B;  1TTN A;  4I6N B;  2KMA A;  1V2Y A;  2GBJ A;  1SB3 C;  3QA8 A;  1NYR A;  4MJS B;  4DBG A;  2QDF A;  4FJY A;  4RGM A;  1HEZ E;  3NY5 A;  4AUQ C;  4MGY E;  2QCZ A;  3P4P B;  4PS7 A;  3CWI A;  4KVG B;  3B08 A;  4DK5 A;  2LMC A;  5BYS A;  5AUI A;  4MGZ E;  3BWU D;  1CJE A;  1E0Z A;  5EE1 A;  1I4X A;  3OLM D;  1V9J A;  2WYQ A;  2K3U A;  4YTN B;  5E6N A;  4DDG D;  3RNB C;  2PPH A;  3BIN A;  2RDG A;  3PGE A;  1KTK A;  5HI1 A;  5E6O A;  2J53 A;  2WXF A;  2WLB A;  2Y5C A;  2C7H A;  4IDI A;  1EUV B;  3ONS A;  3V61 A;  3ABV B;  4GN1 A;  1FM0 D;  1KF6 B;  2L05 A;  2KOX A;  3Q3O C;  4RM9 A;  1SEB D;  3JSV A;  3AV8 A;  3TEW A;  1LO5 D;  3APC A;  1L6V A;  2MWS B;  1ZUD 2;  3DBL I;  2JWU A;  1QT9 A;  4KGR A;  3R7Q A;  4RGT A;  1J7C A;  4XC2 A;  1JWA D;  4BVU C;  1QIL A;  2INC C;  2KQ7 A;  4CYE A;  4WWO A;  4LK0 M;  3BYT B;  3ZTD A;  4F7Z A;  2NBW B;  4ANU A;  4HKZ E;  3PVL A;  1P98 A;  4FXC A;  3NJT A;  4HPL B;  3RNE C;  3PZ7 A;  5IO9 A;  1QOA A;  4M0W B;  1V1O A;  2LZ6 A;  1WJ6 A;  4BKS A;  4W9K A;  2EMT A;  3HVZ A;  4M01 A;  1HA5 A;  4TUU A;  1XLQ A;  3HM3 A;  2M17 A;  4RFB A;  2K1F A;  3I63 C;  5BO4 B;  3RCZ A;  1LXD A;  1UGJ A;  1MVK A;  2ZZP B;  3TCA A;  3H1U A;  2JX5 A;  3AH7 A;  2Q5W D;  1J8C A;  1FRR A;  3PHX B;  1MJD A;  1WRD B;  4A9A A;  4HJG E;  2KQS A;  4CQN A;  1SXT A;  4MSM B;  5C2T B;  2V3N A;  2GLS A;  3IAS 1;  1UBI A;  1UGM A;  1YN3 A;  3U30 A;  1FNW A;  3R7R A;  1NI3 A;  1E7V A;  1CZP A;  2G3Q B;  3WCQ A;  5I4D A;  2D10 A;  2GBM A;  4WJQ A;  4GB9 A;  2WXP A;  2O6V B;  3HHM A;  4UDU C;  1GPX A;  4L1B A;  2LVP A;  1VDV A;  4KDI C;  2QC8 A;  1TS2 A;  1MHH E;  5E6J A;  3BVM A;  1P0R A;  4OZB A;  3Q6B A;  2I2Y A;  4IM0 A;  4XDD A;  1AYF A;  2KVZ A;  1N61 A;  2VH1 A;  1JAL A;  4NNJ B;  4PYU A;  2BYE A;  4A3P A;  1KOT A;  5BMG A;  2MSE D;  5HKH A;  1T6B X;  2FCQ A;  2N1W A;  3MJ5 A;  3V3X A;  2KMM A;  3WAO A;  3GE8 C;  3S2A A;  1QLB B;  3PRM B;  3L17 A;  2LI5 A;  3QHT A;  1FFU A;  1AN8 A;  3GP7 A;  4S0R A;  1TS3 A;  2G9H D;  2Y5B B;  3IT6 B;  2Y3A A;  3TEZ A;  3ZRF A;  1SGH A;  4FHK A;  1WGR A;  3ZJV A;  2L00 B;  2IO3 B;  4AJY B;  3M62 B;  1ACC A;  4RGN A;  1C79 A;  2HE7 A;  4GLS C;  1DOY A;  2L76 A;  3TIX A;  2WU2 B;  3Q8F A;  2AQ1 B;  3BK2 A;  2PMV A;  3C8Y A;  1DGJ A;  1EO6 A;  1XLN A;  3PTF C;  4NPN A;  3ZNG C;  1L5P A;  4JE3 B;  1J7B A;  3VRA B;  2LGI A;  1EU3 A;  2RD0 A;  4XX5 A;  2RDB C;  2HDE A;  2YLM A;  4K7S A;  1T0S C;  3KQ4 A;  2LJ5 A;  2D2Q A;  3MJW A;  3Q8C A;  4EEW A;  1UEL A;  1VJK A;  4YSY B;  2BPS A;  2L0F A;  2I38 A;  2FID A;  2D3B A;  2Z59 B;  3EUB 2;  2BYF A;  2NMQ A;  2JRH A;  3A1Q A;  2YVC A;  1ET9 A;  4BKG A;  4GDK B;  4HXD A;  2LXA A;  3V6C B;  2RR9 A;  2ZCB A;  1KLU D;  3DBR I;  2WWZ A;  3SDL C;  2WGS A;  1TS5 A;  4HRS A;  4W9L A;  2ZVN A;  1H4R A;  4M8N A;  3RD2 A;  2HTM E;  2J4X A;  3C19 A;  2BS4 B;  4CHK A;  1B9R A;  4RH6 A;  2ICI A;  4ZHO A;  2KTR B;  2AWT A;  4AP4 C;  3QK0 A;  4PYZ A;  2GBN A;  4IUM B;  1NEN B;  5IN7 A;  3ZNZ B;  1WGK A;  1T0Q C;  1VD2 A;  2J0J A;  4N6E B;  3L0W B;  3VXW A;  2UU7 A;  1IGD A;  2PKO A;  2KAJ A;  4RCO A;  3ZQ4 A;  2WDQ B;  1WM3 A;  2ZW0 A;  3M63 B;  4OW0 A;  3AE3 B;  4LNO A;  5JHA A;  2LHD A;  1I4G A;  1OGW A;  4NQK E;  1L4D B;  2REX A;  2WDT B;  1NVI D;  3PRZ A;  5HHD G;  1GG3 A;  4NQL B;  4HCN B;  4HRO A;  3HRD D;  1E6E B;  4KZ0 A;  2G45 B;  2KZR A;  1JML A;  5MPO A;  2AL6 A;  3X0W A;  1A5R A;  1WGG A;  3FC4 A;  4XDC A;  4KIK A;  3N1Y C;  1S3S G;  1X1M A;  3EC8 A;  4MH8 A;  1WE6 A;  1WE7 A;  3N20 C;  4IOI E;  5AZG A;  4R3D A;  3O65 B;  2N7E A;  1TJE A;  3L54 A;  1TY2 A;  3W2D A;  1PYW D;  2L32 A;  4C7Z A;  1P7F A;  2G1E A;  1UZX B;  4IKG A;  4XGA B;  1OEY A;  4I6L B;  3NVZ A;  1OQY A;  2J0K A;  1ZDV A;  1YOV B;  4E74 A;  3ZYY X;  3DCG A;  4M02 A;  3RPF C;  3JW0 X;  4KSL C;  4ZYS A;  2KX3 A;  3ZIM A;  3HUI A;  2D5G A;  3ZRC A;  3DBH I;  3N32 A;  3ZKJ C;  4LNK A;  3JYU A;  4REZ A;  5LNK 1;  2D3G A;  2JF5 A;  4L23 A;  4JX1 C;  2FCM A;  2O6V D;  3EHV A;  3PV1 A;  1TYG B;  5C1Z A;  3B9J A;  1FXT B;  3H6N A;  4OZA A;  4WWP A;  3P63 A;  1TIF A;  3AMZ A;  2Y5P A;  3I5J C;  1LM8 B;  2RPV A;  3NOB A;  3BII D;  2KC2 A;  2LUM A;  5J17 A;  2BB5 A;  5L95 C;  1E5W A;  2V9H A;  3OG5 A;  1FNU A;  1LQB A;  2N9K A;  1PDX A;  2RSU A;  1RLF A;  1QKZ A;  5FK9 C;  2K8B A;  3E56 A;  2A4Z A;  2OJR A;  5TR5 A;  3RT3 B;  4A55 A;  4NJ7 A;  1C3T A;  1E8W A;  1KFY B;  1VR9 A;  4LLG M;  1YJI A;  2WNM A;  1IYF A;  2MEK A;  5G55 A;  1MHX A;  1L4Z B;  2C9W B;  1SE9 A;  1RFK A;  3MC8 A;  3DBS A;  1V8C A;  4HK2 A;  3A9J B;  4XE0 A;  2XBB C;  2BKR B;  2G4S A;  4M0W A;  3U2S C;  4B0E A;  5G2N A;  4WJN A;  2TSS A;  2BKF A;  4EFO A;  4NAM A;  5J18 A;  1ZOY B;  1UF0 A;  3CMM B;  2N9L A;  3B0A A;  2ZW1 A;  3O13 A;  4BKT A;  1E8Z A;  2KFJ A;  4C4V A;  4LTU A;  1J19 A;  2W82 A;  4AWJ A;  2DZK A;  1WFY A;  1ISN A;  2R61 A;  2X38 A;  3GZN B;  2C5L C;  2LWP A;  5DPS A;  4EE2 A;  3RNG C;  2MHJ A;  3OWE B;  1KJT A;  3FIL A;  3A33 B;  1RM6 C;  4DXA B;  3BYY B;  1UNS A;  3DVG Y;  3PPA A;  1C4P A;  4HEA 1;  5TSS A;  3VHT C;  1QOF A;  4DDI D;  1CK1 A;  1YNT E;  3TUO A;  2BYT A;  1QF6 A;  4M00 A;  3VAW A;  4WQM A;  4KGT A;  2XK5 A;  2MBO A;  3V6E B;  5HG2 A;  2L52 A;  3R66 C;  1SIF A;  2K0P A;  3QIJ A;  4ZRQ A;  4MM3 A;  4LCD E;  2ON8 A;  2FE8 A;  3ZDT A;  4CO7 A;  3NVV A;  2YEP B;  3ZXR A;  2KDM A;  1FIQ A;  4FHJ A;  2R2Q A;  5AEK B;  4GU2 A;  1UWM A;  3VH4 B;  3K9O B;  4HVB A;  4MEL A;  1B1Z A;  2ACZ B;  4AJW A;  2WXK A;  3NZU A;  4WWN A;  1D5M C;  2N9X A;  4KSK C;  1PUT A;  4GSW A;  2KK8 A;  4ASW C;  1TKG A;  3GE3 C;  2VZK D;  1L6U A;  2KFK B;  4K3B A;  4HKQ A;  2DBY A;  1WZ3 A;  4PS8 A;  1CQV A;  1IPG A;  1L0Y B;  4ANX A;  2WXH A;  3K9P B;  2XK5 B;  2K9X A;  1MG8 A;  4LJO B;  4NY0 A;  3T3O A;  1TY0 A;  3VUW A;  2E6X A;  2KFK A;  4WAF A;  4J3O D;  4MGK E;  3ZJU A;  3BY4 B;  2PE6 B;  2PJH A;  3PRE A;  3V60 A;  3H7S A;  3VFK A;  3B2F A;  1FPY A;  2V1Y A;  4GGQ A;  3T3N A;  4LDT D;  2SEB D;  4RF1 A;  4H2A A;  2B3A A;  1D6E C;  4TQ0 A;  4KX6 B;  5L83 A;  3N1X C;  2KLC A;  4HJK A;  2IGD A;  4MT5 A;  3A9K B;  5IAA C;  3U4E G;  4E3C A;  3UIO B;  1HE8 A;  4URK A;  1E10 A;  5JHB A;  2M4N A;  3MC9 A;  2QEJ C;  1GAQ B;  1D3Z A;  4K3C A;  2LRW A;  3MTN B;  2KNB A;  3WAP A;  3AE6 B;  1V86 A;  3IVF A;  5CTR C;  3NRZ A;  3PO0 A;  4BBN C;  2XN9 C;  4HDQ A;  1SJE D;  1V81 A;  4WIP A;  2KC1 A;  3CIR B;  2D11 A;  2KWU B;  1JWS D;  1L0V B;  2LFI A;  4I6P A;  5CHF A;  2LD9 A;  3ZO5 B;  1WGD A;  3QQ8 B;  3VQI A;  4C56 C;  3AE4 B;  4BFR A;  4RMA A;  1E9M A;  2G4D B;  2JVC A;  1F2R I;  1DOX A;  3VR9 B;  2JT4 B;  1ZGU B;  1XCT L;  2PW9 A;  4XYC A;  4AOF A;  3SEB A;  3TEY A;  1UH6 A;  4G3X B;  4FJV B;  4P7I A;  1N5X A;  4MJS A;  1XD3 B;  3OJ3 A;  3EGR A;  1C78 A;  4ZOH C;  1K52 A;  3R2I A;  4GIV A;  2O6V A;  5DCN A;  2M56 B;  1UBQ A;  2N9P C;  1QZE A;  3URY A;  2IYD B;  2WXR A;  1PGA A;  1R4N I;  1WRI A;  1V1P B;  5LXH A;  2M19 A;  3AEC B;  1C76 A;  1GC6 A;  2KMC A;  1V6E A;  1FXI A;  4ZRK A;  2IY1 B;  1HTO A;  2HJ1 A;  3A4S C;  2AQ2 B;  4HPM B;  3TJP A;  1JQ4 A;  3WA0 A;  2JZP A;  2CHX A;  4MAC A;  4D2K A;  1L0X B;  3ZUN A;  3ALB A;  1P3Q U;  1NDD A;  1JWB D;  2MLB A;  4YSZ B;  1CMX B;  4NAW A;  1AW7 A;  4YXD B;  3MFG A;  1K8R B;  3SHQ A;  1V5O A;  3CSF A;  4LJP B;  5KHO A;  1EWY C;  3ECI A;  3U52 E;  3U7Z A;  1WI0 A;  1WXV A;  4KDL B;  1DOI A;  1T0R C;  2FUG 1;  2V4L A;  1ZDX A;  2LGD A;  2PEA A;  3TL5 A;  2BYV E;  3EFC A;  3BZD B;  1GOZ A;  1XLO A;  1ZKH A;  2BWE S;  3GB1 A;  3RNA C;  3M3J A;  2L1A A;  4G50 A;  4LNN A;  2Z8L A;  2O2V A;  3AED B;  4GXB A;  4JL9 A;  4KV2 A;  2NVU I;  4RNA A;  2KJH B;  1UUP A;  1FRD A;  2JSV X;  4AQ7 A;  2KAN A;  2OHF A;  2SAK A;  4F8C B;  1XO3 A;  2WS3 B;  4DHZ E;  1C77 A;  2K22 A;  3ZGZ A;  3C0R B;  4K81 A;  5BMH A;  3ZVV A;  1V97 A;  1WGH A;  2UWQ A;  2IND C;  3KYC D;  3QWZ B;  1YX5 B;  1TS4 A;  2K8C A;  2KTR A;  2M1M A;  2KJR A;  3OJ4 B;  2RMM A;  2J42 A;  1ZP0 B;  1GC7 A;  2JU6 X;  3RN9 C;  1J7A A;  3WAN A;  2CJO A;  1HQR D;  5CX3 A;  5D6J B;  3U8Z A;  4WJO A;  4EOY A;  3Q3M C;  2DEN B;  4M8M A;  2DZJ A;  4KKJ A;  2GI9 A;  3A9K A;  2MX2 A;  2PIA A;  3MC0 B;  3V05 A;  2AQ3 B;  2GB1 A;  2QSD A;  3UI3 A;  3W1Y A;  2GMI C;  2X8X X;  3MHZ A;  4PS3 A;  2XNA C;  2LGX A;  3ETR A;  2JZZ A;  4W9J A;  4BOS C;  3IAM 1;  2WXQ A;  3U7D A;  4II3 B;  2KQ4 X;  3W9C B;  1JRU A;  4A8X C;  4P16 A;  2DX5 B;  3P4R B;  2V4I B;  3EFU A;  4ITK A;  4N9F 4;  3VVW B;  1FO4 A;  4IWO A;  1BML C;  2DWQ A;  3AXC A;  1WF9 A;  4K7W A;  2FAZ A;  1XF5 L;  2D3A A;  2B76 B;  5JH5 C;  1C1Y B;  2WXN A;  1RRB A;  1MG4 A;  1R4M B;  2JZ3 B;  5GMV A;  2KVR A;  2C7M B;  2ONQ A;  4W9F A;  2MJ3 A;  4GDK A;  4GDL B;  2MH7 A;  4P1B C;  4ZRI A;  1KM7 A;  1RYJ A;  3AEG B;  5C23 A;  2GBK A;  1C4C A;  1WYG A;  1BXT A;  5E6P A;  4OZC A;  3HK0 A;  4TKN A;  1STE A;  3VR8 B;  3DBH B;  4DHZ B;  2MP2 B;  5FR3 A;  4EZK A;  5G5G A;  3AEE B;  2DNF A;  3DBR B;  3AEB B;  1YJJ A;  3LDZ E;  2L0T A;  4A6Q A;  3SR6 A;  4C7Y A;  1J0G A;  1I4R A;  3TEX A;  5D3I B;  3QJZ A;  4MH0 E;  2QIL A;  2ZVO A;  4F1S A;  1OTR B;  1IUE A;  5H92 C;  3AE7 B;  1IGC A;  1RAX A;  2H88 B;  2WXI A;  3GS2 A;  3AM9 A;  1YMH E;  3APF A;  1WJU A;  2I1J A;  1SE3 A;  2WQY B;  3A4R A;  3DHH C;  3MP9 A;  4KZC A;  4QAY A;  1N5W A;  2KO3 A;  1F77 A;  2PVG C;  1D5Z C;  3N9Y C;  3APD A;  1WX9 A;  5BYQ A;  1Q10 A;  3I9V 1;  4A20 A;  3NUH B;  3ZTC A;  1NEK B;  2LUE A;  3J9C A;  4TSS A;  3ENE A;  2MW5 A;  4X57 B;  1JCK B;  2KDF B;  1KLV A;  1ZPS A;  3IG3 A;  3LB8 C;  1WJN A;  3OAW A;  5EE3 A;  4A90 A;  2BW2 A;  1SF0 A;  4IWQ A;  3A1Q B;  1N63 A;  4DXG A;  4MM3 B;  1MFW A;  2IPK D;  3QCA A;  2IZV B;  4HCP B;  3BVG A;  2J7Q B;  3RNC C;  1P1A A;  4HLE A;  3KUD B;  2L3Z A;  3I3T B;  3IBE A;  2IO1 B;  4P1C C;  1WXQ A;  2C60 A;  3AU4 A;  2I1K A;  4RF0 A;  2KYW A;  2NPT B;  2JXX A;  5HFY A;  2M0X A;  1SIJ A;  5GXG B;  2NCN A;  3DQV A;  4RGO S;  4W9C A;  3CST A;  1WX8 A;  2KJ6 A;  5BYR A;  2E3T A;  4MEM A;  2JRI B;  4GOC A;  3N1Z C;  2BVC A;  2KXJ A;  4IWP A;  2BWF A;  2LGY A;  3P42 A;  3H7P A;  2AX5 A;  3UQA A;  2EMS A;  1VCB A;  3BVZ A;  1TZ1 A;  4IC7 B;  3PSE B;  2KKC A;  3P4Q B;  2JYT A;  1E7U A;  2KWV B;  4YT0 B;  3PHW B;  5H8Y E;  1FCC C;  1KH0 A;  1FCL A;  3D32 A;  4OVZ A;  1YD8 U;  1E8Y A;  5DPR A;  4O1N A;  4ACF A;  4BKS D;  4GMV A;  3UF8 A;  1T3Q A;  3VTW A;  2DYO A;  3Q2A C;  4ZRJ A;  2NTT A;  3RUI B;  5BMI A;  5D7G A;  1BUI C;  1WMH A;  3WAM A;  3P1M A;  3L08 A;  1L2N A;  1ZE3 D;  4DWF A;  3LJ3 A;  1C4A A;  3LYY A;  2J52 A;  2D07 B;  1V5T A;  3R3M A;  2KLG A;  4YTM B;  4PK1 A;  3IFW B;  2JXT A;  1HXY D;  5J2R A;  3DVN V;  4WJP A;  3W1S A;  1P7E A;  4MGI E;  3NG0 A;  2LAS A;  3Q8E A;  2NS5 A;  1E7P B;  1I35 A;  1Z2M A;  1TBE A;  3Q8A A;  4J6I A;  4B0M A;  4FJZ A;  3ML9 A;  5CHW A;  2DAF A;  4JWU C;  4KIK B;  3H9D A;  3PT2 B;  2K5P A;  1Z5S B;  2LGS A;  4YTP B;  2W9N A;  2AEH A;  2IGG A;  2INN E;  1SE2 A;  3AN1 A;  2IDY A; 
#chains in the Genus database with same CATH homology
 1WM3 A;  4ZYN A;  3M63 B;  1NDD A;  5JHA A;  2IO2 B;  2MRP A;  2MLB A;  1OGW A;  4FBJ B;  1CMX B;  1YQB A;  2DAJ A;  2REX A;  1XQQ A;  4NQK E;  4NAW A;  2WDT B;  3PRZ A;  2N7D A;  3L13 A;  1GG3 A;  4TQ1 A;  1YX6 B;  4NQL B;  4HCN B;  2HTH A;  1V80 A;  4DHJ D;  3T8M A;  1K8R B;  3SHQ A;  1GUA B;  1BT0 A;  1Q0W B;  1V5O A;  3CSF A;  4LJP B;  5KHO A;  4KZ0 A;  2G45 B;  2KZR A;  3ECI A;  3L10 B;  3PLV A;  1WI0 A;  3UQB A;  1WXA A;  1WXV A;  4KDL B;  2AL6 A;  3X0W A;  2PE9 A;  1E8X A;  5LXI B;  1WGG A;  1A5R A;  1T0Y A;  2V4L A;  4JGH B;  2LGD A;  2PEA A;  2ZEQ A;  3TL5 A;  2BYV E;  2NPT A;  3UGB B;  3ZW3 A;  2ASQ A;  2KD0 A;  3A9J A;  4GDL A;  2Z0D B;  4KIK A;  2FUH B;  1U4A A;  3VH3 B;  3DOW A;  1ZKH A;  3L16 A;  3X23 A;  2BWE S;  3AI5 A;  3VTV A;  3B1L X;  3GOE A;  1S3S G;  1X1M A;  3M3J A;  2JPH A;  3EC8 A;  4G50 A;  4II2 B;  1WE6 A;  1WE7 A;  2A5U A;  2KDE B;  1WZ0 A;  2O2V A;  4ANW A;  4GXB A;  4XZ4 A;  5AZG A;  4JL9 A;  3SU8 X;  3WIM A;  4KV2 A;  2NVU I;  2K25 A;  2KJH B;  3O65 B;  2N7E A;  3L54 A;  1WJ4 A;  3DPD A;  4W9I A;  2V3S A;  1LFD A;  3ZDM C;  2KAN A;  4B6W A;  1UZX B;  4F8C B;  3QAQ A;  5LLI A;  3AU5 A;  3NS8 A;  1OEY A;  4K7U A;  4I6L B;  1OQY A;  2DZM A;  2J0K A;  5KHQ A;  4LDT B;  4DHZ E;  2KWC A;  2IO0 B;  2IBI B;  3C0R B;  4E74 A;  4K81 A;  4ZDV A;  3DCG A;  3ZVV A;  4G11 A;  1P9D U;  1WY8 A;  4FUL A;  1WGH A;  1WXS A;  2UWQ A;  3KYC D;  3QWZ B;  1YX5 B;  3JW0 X;  4KSL C;  2K8C A;  4ANV A;  1F9J A;  2CU1 A;  2KTR A;  1WH3 A;  2KX3 A;  2M1M A;  3KUC B;  3ZIM A;  4B9K A;  2AYO B;  2CKH B;  1NBF C;  2KJR A;  2LVQ A;  3OJ4 B;  3PLU A;  3ZRC A;  2JY6 A;  2MBH A;  3DBH I;  3GZN I;  3N32 A;  3ZKJ C;  3WAL A;  3JYU A;  4ICV A;  1GC7 A;  3WAN A;  1S1Q B;  2D3G A;  1UD7 A;  2FCS A;  4NJ6 A;  2KTF A;  1EF5 A;  2JF5 A;  5CX3 A;  3RUL A;  1YIW A;  2FCM A;  2O6V D;  3EHV A;  3PV1 A;  4IG7 B;  4W9D A;  4WJO A;  1Q5W B;  5D6J B;  3U8Z A;  2FNJ B;  4EOY A;  5C1Z A;  1RFA A;  2DEN B;  3PZD A;  2DZJ A;  2KHW B;  4M8M A;  3A9K A;  2MX2 A;  4RM8 A;  1FXT B;  1TTN A;  4I6N B;  3H6N A;  2KMA A;  4WWP A;  1V2Y A;  2MCN B;  2GBJ A;  3QA8 A;  4MJS B;  3ZNH B;  4DBG A;  3QAR A;  2NBU A;  3W1Y A;  4FJY A;  2NR2 A;  2GMI C;  4PS3 A;  1LM8 B;  2ZNV B;  2LGX A;  2K6D B;  2JZZ A;  2FIF A;  4W9J A;  4BOS C;  4FAD A;  3NY5 A;  4AUQ C;  3NOB A;  2KC2 A;  5J17 A;  2K6Q A;  2CR5 A;  4MGY E;  3U7D A;  5L95 C;  3JSV B;  1E5W A;  2BGF A;  4II3 B;  3RZW C;  3PRP B;  4PS7 A;  2WX1 A;  4MDK E;  1JRU A;  4IM3 A;  4KVG B;  3N30 A;  1LQB A;  3B08 A;  2JWZ A;  2RSU A;  4DK5 A;  2JUO A;  2DX5 B;  1RLF A;  2K8B A;  3EFU A;  4MGZ E;  4NAW B;  2A4Z A;  3Q3F A;  4N9F 4;  3VVW B;  2OJR A;  3ZLZ A;  3OLM D;  5TR5 A;  1V49 A;  1V9J A;  2WYQ A;  4IWO A;  3RT3 B;  1M94 A;  3VUX A;  4NJ7 A;  3AXC A;  5E6N A;  4DDG D;  1C3T A;  1E8W A;  5CHV C;  1WF9 A;  4K7W A;  2FAZ A;  2PPH A;  1IYF A;  4EUT A;  3BIN A;  1WM2 A;  3PGE A;  5G55 A;  5JH5 C;  1C1Y B;  5E6O A;  1RRB A;  2C9W B;  2JZ3 B;  1SE9 A;  5GMV A;  2KVR A;  2C7M B;  3DBS A;  2C7H A;  1WR6 E;  1EUV B;  4HK2 A;  4W9F A;  3ONS A;  4GDK A;  3A9J B;  4GDL B;  5D94 A;  2XBB C;  1Y8R C;  4ZRI A;  1KM7 A;  2BKR B;  2G4S A;  3V61 A;  5G2N A;  4WJN A;  2BKF A;  4GN1 A;  2MBE A;  2GBK A;  5C23 A;  2L05 A;  4EFO A;  5J18 A;  2KOX A;  1WMH B;  5D2M B;  4RM9 A;  1R4M I;  1WX7 A;  3CMM B;  3B0A A;  3JSV A;  3RZF A;  1ZW7 A;  4BKT A;  3DDC B;  1E8Z A;  2KFJ A;  2KDB A;  5E6P A;  3APC A;  1J19 A;  3DVN U;  2GBR A;  2MWS B;  2MP2 A;  3DBL I;  2MBQ A;  3HK0 A;  4TKN A;  2WX0 A;  3R7Q A;  4AWJ A;  2DZK A;  1WFY A;  3NHE B;  1ISN A;  2K8H A;  2FCN A;  3T9L A;  3PS6 A;  2C5L C;  2LVO A;  3JVZ X;  4XC2 A;  5AZF A;  2LWP A;  4BVU C;  4DHZ B;  5DPS A;  3HIZ A;  2KQ7 A;  4CYE A;  2MP2 B;  4WWO A;  2L8J A;  4EZK A;  1I42 A;  3ZTD A;  4F7Z A;  2NBW B;  5DPT A;  5AZH A;  2OOB B;  4ANU A;  1KJT A;  3A33 B;  4DXA B;  3LDZ E;  2L0T A;  3PVL A;  1P98 A;  4EZJ A;  1J0G A;  3IHP C;  3QC8 B;  1XT9 B;  2CHZ A;  3DVG Y;  3PPA A;  4HPL B;  3H7P B;  4A3O A;  2MBB B;  4B95 A;  3QJZ A;  4MH0 E;  4OVV A;  3TBL D;  2C7N B;  4OVU A;  4M0W B;  3VHT C;  4DDI D;  2LZ6 A;  1WJ6 A;  4BKS A;  2BF8 B;  2LXC A;  2ZVO A;  3KVF B;  4W9K A;  2RPQ A;  2EMT A;  4F1S A;  3VAW A;  1NI2 A;  4TUU A;  2EKE C;  2KDI A;  4FN2 A;  1OTR B;  3HM3 A;  2XK5 A;  2MBO A;  3V6E B;  2M17 A;  3R66 C;  1SIF A;  3QIJ A;  2M8S A;  2K1F A;  4MM3 A;  5BO4 B;  1RAX A;  3RCZ A;  4LCD E;  1LXD A;  3APF A;  3KH0 A;  1WJU A;  2ZZP B;  2I1J A;  4JQW C;  3TCA A;  3H1U A;  3VUY A;  3ZDT A;  4CO7 A;  2ZPY A;  2N4F A;  3A4R A;  4KZC A;  1J8C A;  4G0N B;  3PHX B;  2KO3 A;  1WRD B;  2KQS A;  4FHJ A;  2R2Q A;  5AEK B;  4GU2 A;  4MSM B;  3SD5 A;  3VH4 B;  3K9O B;  4HVB A;  4MEL A;  1UBI A;  1UGM A;  4WQO B;  3RYT A;  3ML8 A;  4EZL A;  3U30 A;  3APD A;  1WX9 A;  4IM2 A;  1E90 A;  3R7R A;  4AJW A;  4A20 A;  3NZU A;  4WWN A;  1E7V A;  4IW0 A;  3ZTC A;  4BOZ B;  2G3Q B;  4KSK C;  2N9X A;  2CHW A;  2D10 A;  2GBM A;  2O2V B;  2LUE A;  2KK8 A;  3HM6 X;  4GSW A;  4WJQ A;  2IY0 B;  3ENE A;  2MW5 A;  4GB9 A;  4X57 B;  4ASW C;  2KDF B;  2O6V B;  3HHM A;  1KLV A;  2KFK B;  3IG3 A;  1WJN A;  5FR6 A;  3OAW A;  4PS8 A;  1WZ3 A;  2LVP A;  2N9E B;  1IPG A;  4KDI C;  4ANX A;  1H8C A;  4IWQ A;  3K9P B;  4W9G A;  2XK5 B;  1WIA A;  1MG8 A;  3KUZ A;  3A1Q B;  4LJO B;  4NY0 A;  3VTU A;  1P0R A;  3VUW A;  3QCA A;  2IZV B;  4HCP B;  2KFK A;  2J7Q B;  4IM0 A;  1P1A A;  4MGK E;  4HLE A;  3KUD B;  2L3Z A;  4NNJ B;  3BY4 B;  2PE6 B;  2PJH A;  3PRE A;  3I3T B;  4PYU A;  3V60 A;  2BYE A;  3H7S A;  3VFK A;  1WXM A;  3IBE A;  2V1Y A;  4GGQ A;  4A3P A;  2IO1 B;  1Q1O A;  1KOT A;  2C60 A;  3AU4 A;  2MSE D;  4LDT D;  2I1K A;  5HKH A;  3ZNI D;  2B3A A;  2FCQ A;  2N1W A;  2NPT B;  2JXX A;  4TQ0 A;  2M0X A;  4MSQ B;  2NCN A;  3DQV A;  5L83 A;  2KLC A;  3UIP B;  3AUL A;  1WYW B;  4HJK A;  3WAO A;  4BBN F;  3A9K B;  3S2A A;  4W9C A;  5IAA C;  3CST A;  4E3C A;  1WX8 A;  3PRM B;  5EDS A;  3UIO B;  3L17 A;  2LI5 A;  1HE8 A;  3EEC A;  2KJ6 A;  4URK A;  3QHT A;  5JHB A;  2M4N A;  2DHZ A;  2JRI B;  4MEM A;  4JIO U;  2Y5B B;  2DYM A;  2KX0 A;  1SGH A;  3ZRF A;  4FHK A;  1D3Z A;  1WGR A;  2L00 B;  4WAA A;  2LRW A;  3MTN B;  4GOC A;  2KNB A;  3WAP A;  3P2B A;  2KXJ A;  1V86 A;  2IO3 B;  3IVF A;  5CTR C;  4AJY B;  4JLC A;  3M62 B;  4BBN C;  4IWP A;  2DYB A;  4FA6 A;  2BWF A;  4HDQ A;  2NBV B;  4K1R B;  2VRR B;  4E71 A;  2LGY A;  3H7P A;  1V81 A;  3UQA A;  2KC1 A;  2EMS A;  2LRU A;  1VCB A;  2HE7 A;  1TZ1 A;  3KW5 B;  2D11 A;  2KWU B;  4IC7 B;  4I6P A;  5CHF A;  2L76 A;  2LD9 A;  2RGF A;  3PSE B;  3TIX A;  3ZO5 B;  2UYZ B;  2KKC A;  3MHS D;  4HDO A;  1WGD A;  3QQ8 B;  3VQI A;  1E7U A;  1EO6 A;  1EF1 A;  2J0M A;  2KWV B;  3PHW B;  3PTF C;  4NPN A;  3ZNG C;  2ZPN A;  4W9H A;  3QX1 A;  4W9E A;  2R2O A;  3D32 A;  1YD8 U;  4FLH A;  1E8Y A;  4BFR A;  5DPR A;  4RMA A;  3KYD D;  2ZCC A;  2MA9 B;  2G4D B;  2JVC A;  2RD0 A;  4XX5 A;  2DZI A;  1GNU A;  4BKS D;  2YLM A;  3NZS A;  4GMV A;  3UF8 A;  2JT4 B;  4K7S A;  3M95 A;  1ZGU B;  2KN5 A;  2LJ5 A;  2D2Q A;  3CF6 E;  3MJW A;  4EEW A;  3VTW A;  4ICU A;  2DYO A;  4ZRJ A;  3RUI B;  1UEL A;  5D7G A;  2CS4 A;  1IP9 A;  3N3K B;  4AOF A;  2HD5 B;  2L7R A;  1WMH A;  2BPS A;  2L0F A;  2FID A;  2Z59 B;  3WAM A;  3L08 A;  1L2N A;  2MQJ A;  4G3X B;  4FJV B;  4DWF A;  2QHO A;  3LJ3 A;  4P7I A;  2BYF A;  4MJS A;  1XD3 B;  3OJ3 A;  4DHJ B;  2D07 B;  1V5T A;  3R3M A;  2KLG A;  2JRH A;  4GIV A;  2O6V A;  3A1Q A;  2YVC A;  3IFW B;  4BKG A;  1GJZ A;  4GDK B;  5DCN A;  1UBQ A;  4HXD A;  2LXA A;  2N9P C;  3V6C B;  5IA7 A;  5J2R A;  2RR9 A;  1L7Y A;  2ZCB A;  1QZE A;  3DBR I;  3V62 A;  2IYD B;  2WWZ A;  3DVN V;  3SDL C;  4WJP A;  3W1S A;  1R4N I;  2HJ8 A;  4W9L A;  4MGI E;  1AAR A;  2ZVN A;  1H4R A;  4M8N A;  4TV3 A;  4YL8 A;  5JZE B;  1G6J A;  3RD2 A;  3Q3J A;  5LXH A;  2LAS A;  2GOW A;  2NS5 A;  1I35 A;  1Z2M A;  1PQS A;  1TBE A;  2AL3 A;  2ZJD A;  4J6I A;  4CHK A;  2Z0E B;  2XEW A;  2KTR B;  4FJZ A;  2AWT A;  1GC6 A;  4AP4 C;  2KMC A;  1V6E A;  3ML9 A;  5CHW A;  2DAF A;  1WR1 A;  4KIK B;  2IY1 B;  4HPM B;  3QK0 A;  3A4S C;  4ZRK A;  3TJP A;  2N1V A;  3WA0 A;  4EKU A;  1OEY J;  3VDZ A;  1WGY A;  4PYZ A;  3H9D A;  2GBN A;  3TMP B;  4IUM B;  3DVG X;  3PT2 B;  2CHX A;  3ZNZ B;  1Z5S B;  2K39 A;  1VD2 A;  2J0J A;  4HWI B;  3L0W B;  3W1S C;  3VXW A;  5DPW A;  1YJ1 A;  2W9N A;  2ZNV C;  2AEH A;  3ZUN A;  1TGZ B;  3ALB A;  3UIN B;  1UH6 A;  1P3Q U; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...