2NBVB

Solution structure of the rpn13 pru domain engaging the hplic2 ubl domain
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
78
structure length
78
Chain Sequence
APAEPKIIKVTVKTPKEKEEFAVPENSSVQQFKEAISKRFKSQTDQLVLIFAGKILKDQDTLIQHGIHDGLTVHLVIK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structures of Rpn1 T1:Rad23 and hRpn13:hPLIC2 Reveal Distinct Binding Mechanisms between Substrate Receptors and Shuttle Factors of the Proteasome.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein binding
molecule keywords Proteasomal ubiquitin receptor ADRM1
total genus 9
structure length 78
sequence length 78
ec nomenclature
pdb deposition date 2016-03-12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 2nbvB00
4II2B 1WX8A 3VAWA 2FCMA 1WF9A 5LXIB 3DBLI 3GZNI 1YD8U 2JF5A 3WALA 3ZNGC 3KW5B 5L83A 1KLVA 1OTRB 2REXA 1EO6A 1ZGUB 4B9KA 3ZVVA 2FUHB 2GBKA 1PQSA 1WGDA 3APCA 3DVNV 3NZSA 4GOCA 3DDCB 3VVWB 2KC2A 5CHVC 2BWFA 5BO4B 3PVLA 2DENB 1M94A 1UBQA 1C3TA 1E7VA 2LRWA 2NR2A 3HIZA 5E6NA 2CHXA 4DHJB 3KUCB 3ZLZA 2J0JA 3ZKJC 4B6WA 2L8JA 2JPHA 2NPTA 3L16A 2J0MA 2KDFB 4G50A 2LVQA 2WX1A 3QX1A 4GSWA 5JHAA 4NAWA 1WXSA 2MBEA 2NBVB 2PPHA 3KVFB 1UZXB 2KWCA 4F8CB 2V3SA 4B95A 2L3ZA 4DHZB 4HJKA 1WGHA 3O65B 2EMSA 4DWFA 4I6PA 4W9HA 3ZTDA 1WMHB 2DZIA 3QCAA 3ECIA 3KUZA 4W9EA 2L76A 2LXAA 2LWPA 3H7PA 4KV2A 3ENEA 4MSMB 1IPGA 3W1YA 1RFAA 3A9KB 1TTNA 2KHWB 2KJHB 4GIVA 2ZNVB 1H4RA 2Z0DB 3PS6A 2DAFA 4DK5A 3Q3FA 4NQLB 5AZFA 3VUXA 3L0WB 2KFJA 5DPRA 4E74A 5AEKB 3M62B 1WM2A 1WI0A 4KDIC 3RT3B 2N1VA 2L0TA 4LCDE 5C23A 4PS3A 3T9LA 2RPQA 4MGZE 4A20A 1LXDA 5DPSA 3KYDD 2RD0A 4FADA 2G45B 4FJVB 4TQ0A 3RD2A 2DZJA 3OLMD 1KM7A 2BYEA 3KYCD 2XK5A 3DVNU 1V86A 3QIJA 2BF8B 3QC8B 4BOZB 4MGKE 3QA8A 3QQ8B 3IBEA 1WE6A 1WGGA 3JSVA 4K1RB 4AP4C 4ICUA 1Z5SB 2N7DA 2AWTA 4AJYB 3ZRFA 5G55A 5KHOA 3UINB 2ZPNA 3ZRCA 1OQYA 2BGFA 2KKCA 1F9JA 3V62A 1TBEA 1GC6A 1GUAB 2VRRB 1H8CA 4YL8A 4BFRA 5HKHA 4WWPA 2L05A 4MEMA 3UQBA 3LJ3A 2MBQA 4BOSC 4EUTA 2LUEA 3RULA 4ASWC 2BPSA 3UIOB 3X0WA 5LXHA 1J0GA 3RZFA 2Y5BB 3A1QA 4FHKA 2NPTB 3TL5A 3H7SA 2KJRA 4W9FA 1LQBA 4HXDA 4G3XB 3M63B 4M8NA 1Q1OA 2LRUA 2ZVOA 2Z0EB 2ZCBA 3L54A 4DBGA 1IP9A 1RLFA 4NY0A 1WJ4A 1WRDB 2M1MA 2AEHA 4MM3A 1YX5B 4I6LB 4FHJA 1YQBA 2KC1A 4HDOA 2IO0B 5L95C 3WAMA 1V6EA 2G4SA 1E8WA 3OAWA 2N7EA 2MP2B 1V5OA 3MJWA 2K1FA 3N3KB 2KQ7A 3VDZA 5J2RA 1LFDA 1EUVB 3JVZX 3ZO5B 2D2QA 1MG8A 4JL9A 1S1QB 3H6NA 1J8CA 3V6EB 3L10B 1S3SG 2BKFA 2JUOA 2CKHB 3CMMB 4K81A 3PRPB 3WIMA 4II3B 3A1QB 3QHTA 4GGQA 3R7RA 1UGMA 4FBJB 2IY1B 1P9DU 2LGDA 2KTFA 2FCSA 4XC2A 4JIOU 3R7QA 2R2OA 4PS8A 2WX0A 1E8XA 5LLIA 5IAAC 4EZLA 2D07B 1ZKHA 2G3QB 4AUQC 2MSED 1WM3A 3AXCA 2A4ZA 3EHVA 1WIAA 2HTHA 3ZUNA 3AU4A 1JRUA 1WH3A 4ANWA 4EOYA 3JSVB 2GBJA 3NY5A 2I1KA 4MJSB 2FCQA 1L2NA 2MLBA 2PEAA 1SE9A 2D11A 4LDTD 2LVOA 3PSEB 3RZWC 2DZMA 3DPDA 3TCAA 2WWZA 4GB9A 2BYFA 4K7SA 1EF5A 2GBNA 2KFKA 4MH0E 2KWUB 2IYDB 3DOWA 2M8SA 2CHWA 3U7DA 2PE9A 5JZEB 2CS4A 3DQVA 3ZDTA 2KN5A 3PPAA 5TR5A 5KHQA 4IM2A 4KVGB 3MHSD 2ZZPB 4GDLB 2KMCA 1C1YB 1GNUA 4JQWC 3VHTC 4P7IA 2NCNA 4W9IA 1UH6A 2AL6A 4BBNC 1E90A 2ZVNA 4CHKA 1WJNA 2V1YA 1WR6E 2N1WA 3NZUA 2MQJA 1V49A 2CU1A 4ICVA 2KDEB 2L7RA 1KOTA 1K8RB 4DDID 2N9EB 4OVVA 3VQIA 3ALBA 4G11A 4XZ4A 2FIDA 1CMXB 2GBRA 2N4FA 1UELA 4NNJB 2MW5A 4FJZA 3VH3B 4GU2A 2C5LC 2ASQA 1WXMA 4LJPB 1WR1A 4ANXA 2ZEQA 2K6QA 2KFKB 2DYMA 3ZDMC 3L17A 1EF1A 3TMPB 4HK2A 2MBHA 4ZRJA 2C9WB 4WJQA 3W1SA 2NBUA 4BKGA 1GJZA 1WFYA 2IZVB 3SU8X 3V6CB 4HCPB 2N9PC 2XK5B 1V5TA 2RGFA 2KK8A 3CSFA 2DZKA 2D3GA 1WXVA 2KTRA 2V4LA 1WE7A 4LJOB 4RM9A 3ZNHB 1E8ZA 3VUWA 4MDKE 4KIKB 2JRHA 4XX5A 3NHEB 2O2VA 4AOFA 4TUUA 4KSLC 4W9LA 5G2NA 2JT4B 3BY4B 4HPMB 4PYZA 1WX9A 2EMTA 2MBBB 2IBIB 4DHZE 2IO3B 2NBWB 4HCNB 3N30A 2XEWA 3DBHI 5CHWA 2K8CA 3ZTCA 1RAXA 1Q5WB 1R4NI 3A9KA 2QHOA 2KDIA 4EZKA 1UBIA 4MSQB 4IW0A 4PYUA 1Y8RC 2KANA 1YJ1A 1XD3B 4NPNA 3ML8A 3X23A 1YX6B 2M0XA 4TKNA 4ZRIA 1V80A 5AZHA 4GMVA 3K9PB 2MA9B 5EDSA 1R4MI 2C7NB 1UD7A 3OJ3A 3U30A 3R66C 4NJ6A 1VCBA 3TBLD 2C60A 3LDZE 2KLGA 2B3AA 2KZRA 4J6IA 1QZEA 3L08A 4HPLB 3B1LX 3IVFA 3H1UA 3EECA 3JW0X 3DVGX 4ANUA 1V9JA 4E71A 1YIWA 3PLUA 1D3ZA 3A4RA 3CSTA 2LGYA 3PZDA 4RMAA 2KQSA 1V81A 2O6VA 3B08A 3PREA 1OEYJ 2FAZA 1P0RA 3ZNZB 2KX0A 4BKSA 4F1SA 4MELA 3PGEA 4KDLB 2KOXA 5E6PA 2FNJB 2C7HA 4M8MA 3HM3A 2M17A 3MTNB 1WX7A 2RSUA 2WDTB 3N32A 1WZ0A 1I35A 3KUDB 1E5WA 1WJ6A 3PT2B 4W9KA 2ZPYA 4W9CA 2HD5B 3VFKA 4ZRKA 1AARA 1NI2A 2MCNB 1ZW7A 5DPWA 1SGHA 4IM0A 4MJSA 2MRPA 2BWES 2O2VB 2HE7A 3ZW3A 3K9OB 5JH5C 2K8HA 5FR6A 5JHBA 2KLCA 3A9JA 3DVGY 2RR9A 3HHMA 2ZNVC 1SIFA 2XBBC 2K6DB 2J7QB 3IFWB 3TJPA 3PLVA 2JXXA 2A5UA 3VH4B 2C7MB 2LD9A 1FXTB 3OJ4B 4DDGD 1P1AA 1LM8B 2NVUI 2OJRA 4G0NB 2FCNA 4TQ1A 2OOBB 4W9GA 2GOWA 4IWPA 4GDLA 3PV1A 1IYFA 3S2AA 1NDDA 3TIXA 4NAWB 5D2MB 5J17A 4MGYE 2KDBA 5C1ZA 2CHZA 2IO2B 2UYZB 2WYQA 2Z59B 4GDKB 5D94A 1Z2MA 2DYOA 4GXBA 4ANVA 4WJOA 2K25A 4OVUA 2BYVE 1U4AA 4IWOA 2JZ3B 2ZJDA 1WMHA 3EC8A 3RCZA 4FN2A 3C0RB 3IHPC 2MWSB 3H7PB 3QWZB 4KZ0A 3WAPA 4A3PA 4AWJA 2UWQA 5AZGA 2JVCA 1J19A 5D6JB 3U8ZA 1NBFC 4WWOA 3B0AA 3HK0A 3NS8A 2BKRB 2LZ6A 4IM3A 4N9F4 1WGRA 2GMIC 3D32A 3QJZA 3L13A 4K7UA 4WJPA 4F7ZA 1L7YA 4KZCA 4CYEA 3Q3JA 4RM8A 4K7WA 3PHXB 5CHFA 3ZNID 1OGWA 5CTRC 3VUYA 3I3TB 4FA6A 1BT0A 2FIFA 3JYUA 4KIKA 3PHWB 4NJ7A 2GBMA 4W9JA 3VTUA 1GC7A 2KNBA 5J18A 2LGXA 1G6JA 3SHQA 3UF8A 3QK0A 3UGBB 3QARA 2J0KA 4WWNA 5CX3A 4DHJD 3A33B 2LVPA 4JGHB 2JZZA 3UIPB 2JY6A 3WAOA 3PRMB 3RYTA 3A9JB 1WXAA 3H9DA 3EFUA 4IWQA 4X57B 1Q0WB 2LI5A 2KJ6A 3IG3A 1A5RA 2LJ5A 2I1JA 2ZCCA 3UQAA 2MX2A 2DAJA 4FULA 3WA0A 1WY8A 4EZJA 2AYOB 2DYBA 2LASA 2W9NA 4LDTB 3V61A 2KTRB 3QAQA 4MGIE 4E3CA 1WZ3A 3SDLC 3BINA 3SD5A 2DX5B 2EKEC 4GDKA 4TV3A 2IY0B 4CO7A 2MBOA 3AU5A 4WJNA 4ZYNA 5D7GA 1XT9B 4GN1A 2AL3A 3AULA 5GMVA 2MP2A 3R3MA 4FLHA 4EFOA 2HJ8A 3W1SC 1VD2A 2KD0A 4A3OA 1WJUA 4ZDVA 4HWIB 4WQOB 3ML9A 4I6NB 2L00B 4BKTA 2O6VB 1GG3A 4W9DA 2R2QA 5DCNA 3RUIB 2NS5A 4M0WB 3PTFC 3T8MA 3AI5A 2G4DB 4BVUC 2D10A 1XQQA 4AJWA 3APFA 3M3JA 3M95A 4FJYA 1E7UA 5E6OA 3PRZA 2KX3A 2KMAA 4HVBA 3NOBA 2KXJA 2PE6B 3GOEA 4IC7B 3DBRI 3CF6E 2M4NA 2DHZA 1TZ1A 2KVRA 4DXAB 1P98A 3ZIMA 4URKA 3APDA 4HLEA 3VTVA 2CR5A 2IO1B 2YVCA 4JLCA 1V2YA 1WYWB 1I42A 2KO3A 1E8YA 3HM6X 1X1MA 2JRIB 3VTWA 4BBNF 3DBSA 3ONSA 4BKSD 1P3QU 2JWZA 1HE8A 4EKUA 3KH0A 2O6VD 3A4SC 1RRBA 2PJHA 1T0YA 2K8BA 3WANA 3P2BA 5DPTA 1WGYA 4KSKC 4EEWA 2N9XA 2LXCA 4IG7B 1KJTA 3VXWA 4HDQA 2K39A 1TGZB 4NQKE 4PS7A 3V60A 2L0FA 5IA7A 1OEYA 2YLMA 4WAAA 4IUMB 2KWVB 3DCGA 1ISNA
chains in the Genus database with same CATH superfamily
1K50A 1WX8A 2FCMA 5LXIB 3ZNGC 5D3IB 1HTOA 2LFIA 1KLVA 1OTRB 2REXA 3AEEB 3Q3OC 1ZGUB 3ZVVA 1QOBA 3VVWB 4RGMA 3P4QB 2LUMA 1MFWA 3SR6A 3HIZA 2NR2A 2EKIA 4LNIA 2J0JA 1FMAD 4JX1C 2J0MA 1I7HA 4MH8A 2WX1A 4H2AA 2FE8A 2IDYA 2MBEA 1UZXB 3P63A 3AN1A 2V3SA 4FXCA 4MM3B 4DHZB 2EMSA 3KUZA 4MSMB 3W1YA 1RFAA 3RN9C 1TTNA 1TS5A 5AUIA 2DAFA 4NQLB 3GB1A 1J7BA 3RPFC 4KDIC 1C76A 1ZDXA 5C2TB 4FJVB 2BYEA 1ZOYB 2DBYA 3IT6B 2BVCA 1TIFA 3EGRA 3NVVA 4CQNA 2V3PA 4MGKE 4ZOHC 4N58A 1JMLA 4AJYB 4RH6A 1B9RA 2KKCA 1F9JA 1D5XC 1GC6A 1GUAB 3VRAB 1H8CA 4WWPA 3UQBA 3RNCC 3RULA 3NJTA 3UIOB 2WQYB 1SEBD 3Q8CA 4HRSA 3RZFA 1LO5D 2QC8A 3URYA 3H7SA 2PVGC 1ZXHA 1Q1OA 1SE3A 4DBGA 1RLFA 4P16A 1VJKA 3WAMA 1V6EA 3TEYA 3Q3NC 3VDZA 2K1FA 3N3KB 2KQ7A 1LFDA 1I4PA 1EUVB 4JL9A 3HVDA 1S3SG 2BKFA 2CKHB 2GI9A 4OZBA 2OJWA 3BYTB 1SF0A 1UGMA 2K9XA 4JIOU 3R7QA 4PS8A 2XN9C 1E8XA 5LLIA 2D07B 2WXLA 3AXCA 2A4ZA 2HTHA 1SE4A 1P7EA 1JRUA 1FXAA 2RPVA 2I1KA 4ZRQA 1JW9D 4A8XC 1L2NA 2E6XA 2PEAA 2D11A 2LVOA 3PSEB 3TCAA 3BVZA 2WWZA 4GB9A 2INDC 2ZW1A 2WDVB 2KFKA 4ZHOA 4OZAA 2CS4A 1FEHA 1N6ZA 4IM2A 3VHTC 4P7IA 4KKIA 1SJHD 3O13A 2KDEB 1CMXB 1UELA 4FJZA 4M01A 3VH3B 2CJNA 4LJPB 1WXMA 1WR1A 1JRPA 3TEXA 2K6QA 2KFKB 3ZDMC 4ZRJA 1TKYA 1GJZA 3AB5A 3SU8X 2N9PC 1B1ZA 3CSFA 3DWMA 1E8ZA 3VUWA 2LHDA 1BXTA 3AE6B 2JRHA 4C80A 4C4VA 1IBXB 4DHZE 2IO3B 3NVYA 2XEWA 1I4RA 3ZTCA 1R4NI 4YWGG 2KDIA 3BIID 4KGRA 4MSQB 4ZHPA 2KANA 1XD3B 2N0SB 1V1OA 3X23A 2M0XA 4HROA 5FR3A 4GMVA 5EDSA 4UDUC 1UD7A 3AE1B 1KLGD 3Q69A 2HDEA 4NJ6A 1VZ6A 1ESFA 2W55A 2DLBA 1NYRA 1WYGA 2LHEA 4HPLB 2KAJA 3IVFA 2KYWA 1TS2A 4ANUA 1PYWD 4E71A 3PLUA 4RMAA 4IDIA 1V81A 4ARIA 4KDLB 1KH0A 1VR9A 1WWTA 5HI1A 3KUDB 1E5WA 2Y5CA 4W9KA 1AN8A 1QT9A 2IGDA 3TSSA 4ZRKA 3AEAB 1NI2A 1QQRA 2X38A 2LGIA 1ZP0B 4IM0A 2BWES 2O2VB 1FPYA 3ZJTA 1QKZA 3DVGY 2ZNVC 2K6DB 2INNE 3T3NA 3TJPA 4RF1A 4S0RA 5E6JA 3BK2A 3VH4B 1MPEA 3OJ4B 4DDGD 1P1AA 2FCNA 4W9GA 4IWPA 4GDLA 1IYFA 2IPKD 1NDDA 3ZQ4A 3BYYB 4MGYE 4K3CA 2CHZA 2IO2B 2Z59B 1M4VA 5D94A 1Z2MA 1L0VB 2DYOA 4WJOA 1I4QA 2K25A 2KMMA 4IWOA 1JWSD 2ZJDA 1WMHA 1ZE3D 4FN2A 3C0RB 3H7PB 2JVCA 3U8ZA 2GRIA 4US8A 2IJ0A 2BKRB 2LZ6A 3J9CA 4M00A 2GMIC 2W54A 4WJPA 3Q3JA 4N59A 1HQRD 5H92C 2GLSA 1BT0A 4KIKA 2INCC 4P1BC 1GC7A 3L4PA 2VH1A 1HZ6A 3A33B 1VZ7A 3WAOA 3PRMB 3H9DA 3EFUA 4IWQA 1DGJA 4XYCA 4D2KA 2LI5A 2KJ6A 1DOIA 3IG3A 2LGSA 4DXGA 3WA0A 1WY8A 4EZJA 2DYBA 2K0PA 1SIJA 4E3CA 1WZ3A 3BINA 2DX5B 4CO7A 2MBOA 3AV8A 2AL3A 5G5HA 3R3MA 1XCQL 4FLHA 4EFOA 2HJ8A 3W1SC 3NG0A 4ZDVA 3ML9A 4I6NB 4BKTA 3RUIB 3T8MA 4OHJA 4WIPA 3APFA 1QOGA 2KX3A 4P6VF 1TZOA 3GOEA 4IC7B 4NZLB 2W82A 3GP7A 3APDA 4WQMA 4HLEA 1AYFA 1T3QA 1I42A 4BBNF 4BKSD 1P3QU 1MHHE 1R7SA 3N1XC 3W2DA 2ONQA 1KFYB 4B0EA 3V60A 1C4PA 3BVMA 3Q2AC 2L0FA 1OEYA 4WAAA 1YN3A 3B2GA 4AJWA 4FADA 3VAWA 3ZJUA 1YN5A 1XF5L 3HRDD 1YD8U 5IOIA 3WALA 3SEBA 3KW5B 1Y56A 1MG4A 3BZDB 1EO6A 1J7CA 5HHDG 3ZYYX 3APCA 1PQSA 2KC2A 2BWFA 2WNMA 1HTQA 4HPPA 1UBQA 2CHXA 2L52A 2L8JA 2JPHA 4A55A 1V1PA 3L16A 2FBWB 4G50A 1D4BA 5JHAA 2NBVB 2KWCA 4F8CB 5I4DA 1VLBA 2L3ZA 2MJEA 4HJKA 4W9HA 3SFDB 2BW2A 1WMHB 3ZTDA 4W9EA 1JCKB 2INPE 1YJIA 3H7PA 3A9KB 4YSXB 1H4RA 2Z0DB 3Q3FA 1PUTA 5DPRA 3M62B 4L1BA 2J52A 2L0TA 4LCDE 1ET9A 4PS3A 2BS3B 4LNNA 4MGZE 3E56A 5DPSA 2L1AA 3NZ3A 3OLMD 3C19A 1HXYD 2BF8B 3QC8B 4BOZB 1FM0D 1KF6B 1V8CA 1WE6A 1WGGA 4K1RB 4AP4C 4ICUA 2WLBA 2N7DA 1TY0A 4XWTA 5G55A 3ZRCA 2BGFA 3V62A 3FAHA 2MHJA 2L05A 3AECB 4MEMA 4ASWC 3X0WA 3A1QA 2J42A 3TL5A 1C79A 5G5GA 4HXDA 4G3XB 3M63B 2YEPF 2LRUA 4M8NA 3BK1A 1IP9A 4NY0A 2M1MA 4I6LB 1YQBA 2KC1A 2VZKD 5L95C 2G4SA 2N7EA 4L2YA 1UGJA 4BZAA 3B2FA 3ZO5B 2WS3B 3H6NA 2RDGA 2D3AA 3PRPB 3WIMA 4J3OD 4GGQA 3R7RA 1HZ5A 3I63C 5FKAC 1D6EC 2K3UA 1P9DU 2JQRB 2R2OA 3UI3A 5IAAC 4EZLA 4HEA1 2G3QB 1UWMA 1FNVA 2PMVA 4JWUC 3EFCA 3TUOA 3Q14C 1RFKA 4O1NA 4LDTD 3PZ7A 3RZWC 3DPDA 2W3SA 4K7SA 2M19A 4MH0E 2IYDB 3DOWA 2CHWA 3W9CB 5JZEB 3BVGA 1KLUD 2JXTA 3ZDTA 4GDLB 2NTSA 2KMCA 1C1YB 4NJCA 2WP9B 2AL6A 3U2SC 1E90A 4ZYSA 4CHKA 3MC8A 1JWMD 1V49A 2AQ2B 3AEFB 4G11A 1GB4A 2MW5A 1J7AA 4ANXA 1OFFA 2DYMA 1MVKA 1L4DB 4HK2A 4BKGA 3W1SA 1WFYA 1T6BX 3Q6BA 2XK5B 1F2RI 2BB6A 2KK8A 2M56B 2DZKA 4C00A 2D3GA 1WXVA 2KTRA 2V4LA 1WE7A 4LJOB 2O2VA 4A90A 3KLSX 3BY4B 1WX9A 2EMTA 2IBIB 2NBWB 3N30A 1VZ8A 5BMIA 4IW0A 3EUB2 1C9FA 2BB5A 3DWGC 2FUG1 1L0XB 2G1EA 1FIQA 3IAS1 3RNEC 4ZRIA 1V80A 3K9PB 3DBHB 2C7NB 4C7ZA 1E9MA 3U30A 2WXRA 3TBLD 3AE3B 1SB3C 2C60A 2KZRA 1F2RC 3H1UA 3JW0X 2PIAA 1Q10A 1D3ZA 2LGYA 1D5MC 2KQSA 2O6VA 1YN4A 3B08A 1OEYJ 1R4NB 1P0RA 4F1SA 4YT0B 2QILA 3PGEA 1WX7A 3Q3MC 3N32A 2SEBD 1RYJA 1ROEA 3VFKA 2WDRB 3TEWA 2BS4B 3K9OB 2KQ4X 4C4VB 2KLCA 2KDMA 2PVOD 2ZW0A 2J7QB 5GXGB 3PLVA 2A5UA 1LM8B 1N5WA 2OOBB 1HA5A 3TIXA 4NAWB 2KT7A 4TSSA 1ZPSA 2RDHA 2ON8A 1U4AA 3RCZA 3QWZB 3WAPA 1WRIA 1E6EB 3Q8BA 5D6JB 1PGBA 2G9HD 4USAA 2KWDA 3GE8C 4N9F4 2WXFA 1I4HA 3QJZA 3D32A 4F7ZA 3L13A 1L7YA 4KZCA 2JSVX 5CTRC 2WXIA 4C56C 4LK0M 4NJ7A 2GBMA 3TEZA 4W9JA 3VTUA 5J18A 2BT6A 1G6JA 3UF8A 3QK0A 3QARA 1A70A 4WWNA 3MP9A 3UIPB 1WXAA 1Q0WB 1NEKB 1PDXA 4US9A 2LJ5A 2WXNA 2I1JA 2W9NA 4LDTB 3V61A 2KTRB 3SDLC 2AQ3B 2EKEC 4LTUA 2IY0B 4ZYNA 3AU5A 4WJNA 2D3BA 2WU2B 2WGSA 2N9KA 3RI7C 1VD2A 2KD0A 3MC9A 4HWIB 2R2QA 4M0WB 3DHGC 1XQQA 3AMZA 3M95A 1F52A 1E7UA 2KMAA 4XWWA 3PZ8A 3NOBA 1UF0A 2KXJA 3CF6E 2DHZA 1TZ1A 2KVRA 1P98A 4URKA 4WURA 3C8YA 2CR5A 4A6QA 2YVCA 4JLCA 1TKEA 1E8YA 3HM6X 1X1MA 2JRIB 3VTWA 4EKUA 3DBSA 3RMKC 1HE8A 3KH0A 1RRBA 5C3JB 2K8BA 3WANA 3P2BA 2HJ1A 4YXDB 4KSKC 4EEWA 2N9XA 2LXCA 2V0GA 3ZJVA 3VXWA 1F1HA 3NS1A 4NQKE 2QSDA 3B9JA 1GOZA 1ISNA 1VRAB 3LB8C 1WF9A 2BTEA 3DBLI 1T0SC 4PK1A 1GAQB 4MACA 4B9KA 4ARCA 3HUIA 3DDCB 5BO4B 2DENB 2HTME 1M94A 1C3TA 2LRWA 4R3DA 5E6NA 1NENB 3ZLZA 3AE9B 2IGHA 2KDFB 3QX1A 4NAWA 3FILB 1WXSA 3KVFB 2I38A 4B95A 1P7FA 4DWFA 4I6PA 2DZIA 3QCAA 3ECIA 3DBRB 2LWPA 2EELA 2RMMA 4KV2A 3ENEA 1IPGA 2BQQA 3AE5B 2ZNVB 4DK5A 1XO3A 3PS6A 3AE7B 2QCZA 5EE1A 3L0WB 2KFJA 5IP4D 2WXPA 4DXFA 2N1VA 5C23A 4HKZE 3V3XA 3T9LA 2RPQA 4A20A 4TQ0A 2DZJA 1UUPA 1KM7A 2X8XX 2XK5A 1V86A 1C4CA 2GB1A 3JSVA 4AS1A 2LEKA 3ZRFA 2ZPNA 1OQYA 2MJ3A 5MPOA 5HKHA 2MBQA 4BOSC 4EUTA 2LUEA 5LXHA 2I2YA 2NPTB 1DOYA 2KJRA 2WXKA 4EE2A 2ZVOA 2ZCBA 3FKYA 1WJ4A 1QLBB 3BWUD 2OEDA 2IO0B 2Y5PA 1FCLA 3NVZA 3R8BA 3JVZX 1PGAA 1S1QB 3L10B 4II3B 1YNTE 3KQ4A 4YTNB 4XC2A 3HVZA 2WX0A 2UU7A 2Q5WD 4AUQC 3P1MA 1WIAA 3AU4A 4ANWA 5BMHA 1IUEA 4MJSB 2FCQA 2MLBA 1JWAD 1SE9A 1EWCA 4BAXA 1F77A 1EF5A 2Z8LA 3NVWA 2GBNA 5BMGA 2KWUB 2PE9A 2W3RA 2RDBC 2QIEB 2KN5A 3PPAA 5TR5A 5KHQA 2D3CA 2ZZPB 1GNUA 2NCNA 1SBBB 5EE0A 4BBNC 2ZVNA 1WJNA 1WR6E 3I5JC 3NZUA 2MQJA 4ICVA 3ZXRA 1SXTA 2L7RA 3U7ZA 4DDID 2N9EB 4OVVA 3ALBA 3CWIA 4XZ4A 2FIDA 4NNJB 2QMTA 1JWBD 4GU2A 2C5LC 1E10A 2ASQA 2K22A 2WXQA 4JWSC 2ZEQA 3L17A 1MJDA 4ZRPA 4RGOS 2MBHA 2C9WB 4WJQA 2NBUA 1T0RC 2IZVB 3V6CB 4HCPB 1DOXA 5FK9C 2RGFA 3ZNHB 1XXGA 4NAMA 4XX5A 2JU6X 3NHEB 4AOFA 4W9LA 2M0AA 2K8CA 1Q5WB 3IXSA 2QHOA 1K51A 2Y3AA 3P4SB 2YEPB 3RFZB 3N20C 1ZXIA 1Y8RC 1FD6A 1IGCA 2QJLA 3E9SA 4TKNA 5AZHA 3AEGB 1ZDVA 1RWSA 3OJ3A 1VCBA 2KLGA 2B3AA 1QZEA 1HEZE 2V4IB 3EECA 3MFGA 2PW9A 3RNBC 3A4RA 3AE2B 3V05A 2TSSA 1YQ3B 3PREA 1YQ4B 1UNSA 4MELA 2KOXA 2FNJB 4QAYA 3I9V1 3P42A 3KWVA 4M8MA 3HM3A 2M17A 3MTNB 2QEJC 2ZPYA 4W9CA 3OWEB 1EM7A 1SGHA 2MRPA 1I4XA 1YJJA 1AW7A 2ACZB 2K8HA 2WDQB 5JHBA 2RR9A 3LYYA 3HHMA 3NUHB 1SIFA 2XBBC 1ZUD2 1FNWA 2JXXA 2LMCA 2LD9A 1DYQA 2NVUI 4KKJA 4G0NB 4KGSA 2LJIA 1TS3A 3PV1A 3S2AA 4C7YA 4K3BA 5D2MB 2KDBA 5JXVA 2PLPA 4RGTA 2UYZB 4GDKB 4OVUA 2JZ3B 2KVZA 3IHPC 2MWSB 4KZ0A 1I4GA 2H89B 3ZGZA 5AZGA 1J19A 3W5VB 1NBFC 3AM9A 4LNKA 3HK0A 3NS8A 1FFVA 1XCTL 4K7UA 4RM8A 4K7WA 5CHFA 1N5XA 1OGWA 1QOAA 4FA6A 2FIFA 1QF6A 3PHWB 4IKGA 2KNBA 2WXJA 1L6VA 2LGXA 3FILA 3SHQA 1WGKA 3UGBB 5CX3A 2WU5B 2DWQA 2JZZA 2CJOA 5IKCM 1BMLC 3RYTA 3A9JB 3ABVB 4X57B 1WSPA 2JYTA 3UQAA 3IT4B 4FULA 2AYOB 2OHFA 1E0ZA 1TY2A 3QAQA 3SD5A 5D7GA 1JWUD 1XT9B 3AULA 1EU3A 2MP2A 5AUKA 1C77A 4RF0A 4A3OA 1WJUA 4WQOB 3MJ5A 2O6VB 1GG3A 4W9DA 2NS5A 3PTFC 2KACA 4BVUC 4PT5A 4RCOA 3M3JA 4FJYA 1L5PA 4HVBA 1N61A 2CU3A 3DBRI 2M4NA 1TT5B 4DXAB 3VTVA 2IO1B 1V2YA 1WYWB 4L23A 3RNAC 3ONSA 4JPSA 2JWZA 3A4SC 2H88B 2PJHA 2B76B 3I57A 3P4PB 4HDQA 2K39A 3ZXVA 3R2TA 4PS7A 2K5PA 2YLMA 2V3NA 2KWVB 3DCGA 4II2B 3Q8EA 1YMHE 1T0QC 3GZNI 2JF5A 2D5GA 2J4XA 3NRZA 3CIRB 5L83A 1FRDA 2FUHB 1XLOA 1WGDA 2GBKA 3DVNV 3NZSA 4GOCA 5CHVC 3PVLA 3VR8B 1ACCA 1E7VA 1MI0A 5EE3A 4DHJB 3KUCB 2L32A 3ZKJC 4B6WA 1E7PB 4HKQA 3DBLB 2NPTA 2LVQA 4GSWA 1EWYC 2MJDA 2PPHA 5BYRA 1XLQA 1WGHA 3O65B 1MHXA 2L76A 4GLSC 2LXAA 3MHZA 2KHWB 2KJHB 4GIVA 3AE4B 5AZFA 3VUXA 3SFEB 4E74A 5AEKB 1WM2A 1WI0A 3RT3B 3DHIC 1JALA 1LXDA 3KYDD 2RD0A 2G45B 4OZCA 2JWUA 3RD2A 3KYCD 3DVNU 1V97A 2PTLA 3QIJA 1RM6C 4OVZA 4YTPB 4MT5A 3QA8A 3QQ8B 2NTTA 3IBEA 2BBCA 1Z5SB 2AWTA 4LNFA 5KHOA 3UINB 1TBEA 2IGGA 2VRRB 4YL8A 4BFRA 2MH7A 3LJ3A 3VR9B 2BPSA 1J0GA 2Y5BB 4FHKA 1BUIC 1NYQA 4W9FA 3U4EG 1LQBA 2Z0EB 3L54A 1WRDB 2AEHA 1JQ4A 4MM3A 1YX5B 4FHJA 1OQQA 4HDOA 1E8WA 3OAWA 1KTKA 2MP2B 1V5OA 3MJWA 5J2RA 1T5XD 2D2QA 1MG8A 1XEEA 1J8CA 3V6EB 4K81A 2JUOA 2JZPA 1K52A 2NMQA 3CMMB 1TYGB 1FO4A 3A1QB 3QHTA 5EE9A 3AEBB 4FBJB 2IY1B 4M02A 2LGDA 4OW0A 2KTFA 2FCSA 3N1ZC 1FNUA 1N63A 1ZKHA 3LXFA 2MSED 2JX5A 1WM3A 5LNK1 1XLPA 3ETRA 1CQVA 3EHVA 3ZUNA 1N62A 1WH3A 4EOYA 3JSVB 2GBJA 3NY5A 3T3OA 4LNOA 3W5UB 2DZMA 4XDCA 2BYFA 1FCCC 4B0MA 1FXIA 3EA6A 2M8SA 3U7DA 1AWDA 4RFBA 3DQVA 4KVGB 3MHSD 4JQWC 4W9IA 1UH6A 2V1YA 2N1WA 4LLGM 1L6UA 2CU1A 1KOTA 1K8RB 2ICIA 3N1YC 3VQIA 5T8IA 2GBRA 2N4FA 4IOIE 4WAFA 1TKGA 1SE2A 1D5ZC 2AQ1B 1EF1A 3TMPB 1F0ZA 4HJGE 1EU4A 2J53A 1V5TA 2WHIA 5BYSA 4YSZB 4RM9A 4KGTA 4MDKE 4KIKB 2SAKA 3OG5A 4TUUA 4KSLC 5G2NA 2JT4B 4HPMB 1QILA 2MBBB 4PYZA 4TMAB 4HCNB 3IAM1 3DBHI 5CHWA 1ET6A 1RAXA 1NI3A 3A9KA 4M0WA 4EZKA 1UBIA 1SSNA 5HG2A 4PYUA 1YJ1A 3H8HA 4NPNA 3ML8A 1STEA 1YX6B 4RGNA 1N60A 2MA9B 1FFUA 1R4MI 3Q8FA 3AH7A 1TJEA 2PKOA 3R66C 5TSSA 3LDZE 2N7JA 4J6IA 3L08A 2MEKA 3B1LX 3DVGX 1CJEA 1V9JA 1YIWA 4ITKA 4XE0A 2XNAC 3CSTA 3PZDA 3ZNZB 2FAZA 2KX0A 4BKSA 2E3TA 2VZKB 5BYQA 5E6PA 3AE8B 2C7HA 3VRBB 3RNGC 2N9LA 2RSUA 2WDTB 1WZ0A 1I35A 1WJ6A 4A9AA 3PT2B 2HD5B 1AARA 2MCNB 5IO9A 1ZW7A 5DPWA 2JYEA 2BYTA 4MJSA 1WXQA 3GZNB 2HE7A 3ZW3A 5JH5C 5FR6A 3A9JA 1IBXA 4N6EB 1IGDA 3IFWB 2C7MB 4DQOC 1FXTB 2OJRA 4TQ1A 1ENFA 2GOWA 1GPXA 1C78A 5J17A 5C1ZA 2WYQA 1YOVB 2AX5A 2L83A 1L4ZB 4GXBA 5D3DA 4ANVA 1XLNA 2BYVE 3P4RB 3EC8A 4REZA 3GS2A 4YSYB 3DHHC 4A3PA 2KN4A 2UWQA 4AWJA 1R4MB 4S17A 3RNFC 4WWOA 3B0AA 4IM3A 1WGRA 2DNFA 4CYEA 4RNAA 3PHXB 3ZNID 4YTMB 3VUYA 3I3TB 3Q8AA 3JYUA 3R2IA 1FRRA 2R61A 2WXOA 4ACFA 4WH4A 2J0KA 4DHJD 2LVPA 4JGHB 1C4AA 5HFYA 2JY6A 3KWLA 2V9HA 1A5RA 4P1CC 2ZCCA 2MX2A 3U52E 2DAJA 1KRHA 3PO0A 1CK1A 2LASA 4MGIE 3GE3C 1OQRA 3AEDB 3FC4A 4GDKA 4TV3A 5H8YE 1PFDA 4GN1A 4WWMA 5GMVA 4KX6B 4XGAB 1GB1A 2WXGA 2L00B 5DCNA 3AI5A 2G4DB 2D10A 1LGRA 1UWXA 1V1PB 4Q2JA 2QDFA 5E6OA 3PRZA 2WXMA 2BS2B 1K53A 1JROA 2PE6B 3N9YC 1SJED 3ZIMA 5IN7A 2WXHA 4XDDA 1CZPA 2KO3A 2O6VD 1T0YA 1TS4A 1PGXA 4AQ7A 5DPTA 1WGYA 4IG7B 1KJTA 1VDVA 1NVID 1L0YB 4JE3B 1QOFA 3WCQA 1TGZB 2VH2A 3MC0B 5IA7A 4IUMB
chains in the Genus database with same CATH topology
4II2B 1WX8A 3VAWA 2FCMA 1WF9A 5LXIB 3DBLI 3GZNI 1YD8U 2JF5A 3WALA 3ZNGC 3KW5B 5L83A 1KLVA 1OTRB 2REXA 1EO6A 1ZGUB 4B9KA 3ZVVA 2FUHB 2GBKA 1PQSA 1WGDA 3APCA 3DVNV 3NZSA 4GOCA 3DDCB 3VVWB 2KC2A 5CHVC 2BWFA 5BO4B 3PVLA 2DENB 1M94A 1UBQA 1C3TA 1E7VA 2LRWA 2NR2A 3HIZA 5E6NA 2CHXA 4DHJB 3KUCB 3ZLZA 2J0JA 3ZKJC 4B6WA 2L8JA 2JPHA 2NPTA 3L16A 2J0MA 2KDFB 4G50A 2LVQA 2WX1A 3QX1A 4GSWA 5JHAA 4NAWA 1WXSA 2MBEA 2NBVB 2PPHA 3KVFB 1UZXB 2KWCA 4F8CB 2V3SA 4B95A 2L3ZA 4DHZB 4HJKA 1WGHA 3O65B 2EMSA 4DWFA 4I6PA 4W9HA 3ZTDA 1WMHB 2DZIA 3QCAA 3ECIA 3KUZA 4W9EA 2L76A 2LXAA 2LWPA 3H7PA 4KV2A 3ENEA 4MSMB 1IPGA 3W1YA 1RFAA 3A9KB 1TTNA 2KHWB 2KJHB 4GIVA 2ZNVB 1H4RA 2Z0DB 3PS6A 2DAFA 4DK5A 3Q3FA 4NQLB 5AZFA 3VUXA 3L0WB 2KFJA 5DPRA 4E74A 5AEKB 3M62B 1WM2A 1WI0A 4KDIC 3RT3B 2N1VA 2L0TA 4LCDE 5C23A 4PS3A 3T9LA 2RPQA 4MGZE 4A20A 1LXDA 5DPSA 3KYDD 2RD0A 4FADA 2G45B 4FJVB 4TQ0A 3RD2A 2DZJA 3OLMD 1KM7A 2BYEA 3KYCD 2XK5A 3DVNU 1V86A 3QIJA 2BF8B 3QC8B 4BOZB 4MGKE 3QA8A 3QQ8B 3IBEA 1WE6A 1WGGA 3JSVA 4K1RB 4AP4C 4ICUA 1Z5SB 2N7DA 2AWTA 4AJYB 3ZRFA 5G55A 5KHOA 3UINB 2ZPNA 3ZRCA 1OQYA 2BGFA 2KKCA 1F9JA 3V62A 1TBEA 1GC6A 1GUAB 2VRRB 1H8CA 4YL8A 4BFRA 5HKHA 4WWPA 2L05A 4MEMA 3UQBA 3LJ3A 2MBQA 4BOSC 4EUTA 2LUEA 3RULA 4ASWC 2BPSA 3UIOB 3X0WA 5LXHA 1J0GA 3RZFA 2Y5BB 3A1QA 4FHKA 2NPTB 3TL5A 3H7SA 2KJRA 4W9FA 1LQBA 4HXDA 4G3XB 3M63B 4M8NA 1Q1OA 2LRUA 2ZVOA 2Z0EB 2ZCBA 3L54A 4DBGA 1IP9A 1RLFA 4NY0A 1WJ4A 1WRDB 2M1MA 2AEHA 4MM3A 1YX5B 4I6LB 4FHJA 1YQBA 2KC1A 4HDOA 2IO0B 5L95C 3WAMA 1V6EA 2G4SA 1E8WA 3OAWA 2N7EA 2MP2B 1V5OA 3MJWA 2K1FA 3N3KB 2KQ7A 3VDZA 5J2RA 1LFDA 1EUVB 3JVZX 3ZO5B 2D2QA 1MG8A 4JL9A 1S1QB 3H6NA 1J8CA 3V6EB 3L10B 1S3SG 2BKFA 2JUOA 2CKHB 3CMMB 4K81A 3PRPB 3WIMA 4II3B 3A1QB 3QHTA 4GGQA 3R7RA 1UGMA 4FBJB 2IY1B 1P9DU 2LGDA 2KTFA 2FCSA 4XC2A 4JIOU 3R7QA 2R2OA 4PS8A 2WX0A 1E8XA 5LLIA 5IAAC 4EZLA 2D07B 1ZKHA 2G3QB 4AUQC 2MSED 1WM3A 3AXCA 2A4ZA 3EHVA 1WIAA 2HTHA 3ZUNA 3AU4A 1JRUA 1WH3A 4ANWA 4EOYA 3JSVB 2GBJA 3NY5A 2I1KA 4MJSB 2FCQA 1L2NA 2MLBA 2PEAA 1SE9A 2D11A 4LDTD 2LVOA 3PSEB 3RZWC 2DZMA 3DPDA 3TCAA 2WWZA 4GB9A 2BYFA 4K7SA 1EF5A 2GBNA 2KFKA 4MH0E 2KWUB 2IYDB 3DOWA 2M8SA 2CHWA 3U7DA 2PE9A 5JZEB 2CS4A 3DQVA 3ZDTA 2KN5A 3PPAA 5TR5A 5KHQA 4IM2A 4KVGB 3MHSD 2ZZPB 4GDLB 2KMCA 1C1YB 1GNUA 4JQWC 3VHTC 4P7IA 2NCNA 4W9IA 1UH6A 2AL6A 4BBNC 1E90A 2ZVNA 4CHKA 1WJNA 2V1YA 1WR6E 2N1WA 3NZUA 2MQJA 1V49A 2CU1A 4ICVA 2KDEB 2L7RA 1KOTA 1K8RB 4DDID 2N9EB 4OVVA 3VQIA 3ALBA 4G11A 4XZ4A 2FIDA 1CMXB 2GBRA 2N4FA 1UELA 4NNJB 2MW5A 4FJZA 3VH3B 4GU2A 2C5LC 2ASQA 1WXMA 4LJPB 1WR1A 4ANXA 2ZEQA 2K6QA 2KFKB 2DYMA 3ZDMC 3L17A 1EF1A 3TMPB 4HK2A 2MBHA 4ZRJA 2C9WB 4WJQA 3W1SA 2NBUA 4BKGA 1GJZA 1WFYA 2IZVB 3SU8X 3V6CB 4HCPB 2N9PC 2XK5B 1V5TA 2RGFA 2KK8A 3CSFA 2DZKA 2D3GA 1WXVA 2KTRA 2V4LA 1WE7A 4LJOB 4RM9A 3ZNHB 1E8ZA 3VUWA 4MDKE 4KIKB 2JRHA 4XX5A 3NHEB 2O2VA 4AOFA 4TUUA 4KSLC 4W9LA 5G2NA 2JT4B 3BY4B 4HPMB 4PYZA 1WX9A 2EMTA 2MBBB 2IBIB 4DHZE 2IO3B 2NBWB 4HCNB 3N30A 2XEWA 3DBHI 5CHWA 2K8CA 3ZTCA 1RAXA 1Q5WB 1R4NI 3A9KA 2QHOA 2KDIA 4EZKA 1UBIA 4MSQB 4IW0A 4PYUA 1Y8RC 2KANA 1YJ1A 1XD3B 4NPNA 3ML8A 3X23A 1YX6B 2M0XA 4TKNA 4ZRIA 1V80A 5AZHA 4GMVA 3K9PB 2MA9B 5EDSA 1R4MI 2C7NB 1UD7A 3OJ3A 3U30A 3R66C 4NJ6A 1VCBA 3TBLD 2C60A 3LDZE 2KLGA 2B3AA 2KZRA 4J6IA 1QZEA 3L08A 4HPLB 3B1LX 3IVFA 3H1UA 3EECA 3JW0X 3DVGX 4ANUA 1V9JA 4E71A 1YIWA 3PLUA 1D3ZA 3A4RA 3CSTA 2LGYA 3PZDA 4RMAA 2KQSA 1V81A 2O6VA 3B08A 3PREA 1OEYJ 2FAZA 1P0RA 3ZNZB 2KX0A 4BKSA 4F1SA 4MELA 3PGEA 4KDLB 2KOXA 5E6PA 2FNJB 2C7HA 4M8MA 3HM3A 2M17A 3MTNB 1WX7A 2RSUA 2WDTB 3N32A 1WZ0A 1I35A 3KUDB 1E5WA 1WJ6A 3PT2B 4W9KA 2ZPYA 4W9CA 2HD5B 3VFKA 4ZRKA 1AARA 1NI2A 2MCNB 1ZW7A 5DPWA 1SGHA 4IM0A 4MJSA 2MRPA 2BWES 2O2VB 2HE7A 3ZW3A 3K9OB 5JH5C 2K8HA 5FR6A 5JHBA 2KLCA 3A9JA 3DVGY 2RR9A 3HHMA 2ZNVC 1SIFA 2XBBC 2K6DB 2J7QB 3IFWB 3TJPA 3PLVA 2JXXA 2A5UA 3VH4B 2C7MB 2LD9A 1FXTB 3OJ4B 4DDGD 1P1AA 1LM8B 2NVUI 2OJRA 4G0NB 2FCNA 4TQ1A 2OOBB 4W9GA 2GOWA 4IWPA 4GDLA 3PV1A 1IYFA 3S2AA 1NDDA 3TIXA 4NAWB 5D2MB 5J17A 4MGYE 2KDBA 5C1ZA 2CHZA 2IO2B 2UYZB 2WYQA 2Z59B 4GDKB 5D94A 1Z2MA 2DYOA 4GXBA 4ANVA 4WJOA 2K25A 4OVUA 2BYVE 1U4AA 4IWOA 2JZ3B 2ZJDA 1WMHA 3EC8A 3RCZA 4FN2A 3C0RB 3IHPC 2MWSB 3H7PB 3QWZB 4KZ0A 3WAPA 4A3PA 4AWJA 2UWQA 5AZGA 2JVCA 1J19A 5D6JB 3U8ZA 1NBFC 4WWOA 3B0AA 3HK0A 3NS8A 2BKRB 2LZ6A 4IM3A 4N9F4 1WGRA 2GMIC 3D32A 3QJZA 3L13A 4K7UA 4WJPA 4F7ZA 1L7YA 4KZCA 4CYEA 3Q3JA 4RM8A 4K7WA 3PHXB 5CHFA 3ZNID 1OGWA 5CTRC 3VUYA 3I3TB 4FA6A 1BT0A 2FIFA 3JYUA 4KIKA 3PHWB 4NJ7A 2GBMA 4W9JA 3VTUA 1GC7A 2KNBA 5J18A 2LGXA 1G6JA 3SHQA 3UF8A 3QK0A 3UGBB 3QARA 2J0KA 4WWNA 5CX3A 4DHJD 3A33B 2LVPA 4JGHB 2JZZA 3UIPB 2JY6A 3WAOA 3PRMB 3RYTA 3A9JB 1WXAA 3H9DA 3EFUA 4IWQA 4X57B 1Q0WB 2LI5A 2KJ6A 3IG3A 1A5RA 2LJ5A 2I1JA 2ZCCA 3UQAA 2MX2A 2DAJA 4FULA 3WA0A 1WY8A 4EZJA 2AYOB 2DYBA 2LASA 2W9NA 4LDTB 3V61A 2KTRB 3QAQA 4MGIE 4E3CA 1WZ3A 3SDLC 3BINA 3SD5A 2DX5B 2EKEC 4GDKA 4TV3A 2IY0B 4CO7A 2MBOA 3AU5A 4WJNA 4ZYNA 5D7GA 1XT9B 4GN1A 2AL3A 3AULA 5GMVA 2MP2A 3R3MA 4FLHA 4EFOA 2HJ8A 3W1SC 1VD2A 2KD0A 4A3OA 1WJUA 4ZDVA 4HWIB 4WQOB 3ML9A 4I6NB 2L00B 4BKTA 2O6VB 1GG3A 4W9DA 2R2QA 5DCNA 3RUIB 2NS5A 4M0WB 3PTFC 3T8MA 3AI5A 2G4DB 4BVUC 2D10A 1XQQA 4AJWA 3APFA 3M3JA 3M95A 4FJYA 1E7UA 5E6OA 3PRZA 2KX3A 2KMAA 4HVBA 3NOBA 2KXJA 2PE6B 3GOEA 4IC7B 3DBRI 3CF6E 2M4NA 2DHZA 1TZ1A 2KVRA 4DXAB 1P98A 3ZIMA 4URKA 3APDA 4HLEA 3VTVA 2CR5A 2IO1B 2YVCA 4JLCA 1V2YA 1WYWB 1I42A 2KO3A 1E8YA 3HM6X 1X1MA 2JRIB 3VTWA 4BBNF 3DBSA 3ONSA 4BKSD 1P3QU 2JWZA 1HE8A 4EKUA 3KH0A 2O6VD 3A4SC 1RRBA 2PJHA 1T0YA 2K8BA 3WANA 3P2BA 5DPTA 1WGYA 4KSKC 4EEWA 2N9XA 2LXCA 4IG7B 1KJTA 3VXWA 4HDQA 2K39A 1TGZB 4NQKE 4PS7A 3V60A 2L0FA 5IA7A 1OEYA 2YLMA 4WAAA 4IUMB 2KWVB 3DCGA 1ISNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4II2 B;  1WX8 A;  3VAW A;  2FCM A;  1WF9 A;  5LXI B;  3DBL I;  3GZN I;  1YD8 U;  2JF5 A;  3WAL A;  3ZNG C;  3KW5 B;  5L83 A;  1KLV A;  1OTR B;  2REX A;  1EO6 A;  1ZGU B;  4B9K A;  3ZVV A;  2FUH B;  2GBK A;  1PQS A;  1WGD A;  3APC A;  3DVN V;  3NZS A;  4GOC A;  3DDC B;  3VVW B;  2KC2 A;  5CHV C;  2BWF A;  5BO4 B;  3PVL A;  2DEN B;  1M94 A;  1UBQ A;  1C3T A;  1E7V A;  2LRW A;  2NR2 A;  3HIZ A;  5E6N A;  2CHX A;  4DHJ B;  3KUC B;  3ZLZ A;  2J0J A;  3ZKJ C;  4B6W A;  2L8J A;  2JPH A;  2NPT A;  3L16 A;  2J0M A;  2KDF B;  4G50 A;  2LVQ A;  2WX1 A;  3QX1 A;  4GSW A;  5JHA A;  4NAW A;  1WXS A;  2MBE A;  2NBV B;  2PPH A;  3KVF B;  1UZX B;  2KWC A;  4F8C B;  2V3S A;  4B95 A;  2L3Z A;  4DHZ B;  4HJK A;  1WGH A;  3O65 B;  2EMS A;  4DWF A;  4I6P A;  4W9H A;  3ZTD A;  1WMH B;  2DZI A;  3QCA A;  3ECI A;  3KUZ A;  4W9E A;  2L76 A;  2LXA A;  2LWP A;  3H7P A;  4KV2 A;  3ENE A;  4MSM B;  1IPG A;  3W1Y A;  1RFA A;  3A9K B;  1TTN A;  2KHW B;  2KJH B;  4GIV A;  2ZNV B;  1H4R A;  2Z0D B;  3PS6 A;  2DAF A;  4DK5 A;  3Q3F A;  4NQL B;  5AZF A;  3VUX A;  3L0W B;  2KFJ A;  5DPR A;  4E74 A;  5AEK B;  3M62 B;  1WM2 A;  1WI0 A;  4KDI C;  3RT3 B;  2N1V A;  2L0T A;  4LCD E;  5C23 A;  4PS3 A;  3T9L A;  2RPQ A;  4MGZ E;  4A20 A;  1LXD A;  5DPS A;  3KYD D;  2RD0 A;  4FAD A;  2G45 B;  4FJV B;  4TQ0 A;  3RD2 A;  2DZJ A;  3OLM D;  1KM7 A;  2BYE A;  3KYC D;  2XK5 A;  3DVN U;  1V86 A;  3QIJ A;  2BF8 B;  3QC8 B;  4BOZ B;  4MGK E;  3QA8 A;  3QQ8 B;  3IBE A;  1WE6 A;  1WGG A;  3JSV A;  4K1R B;  4AP4 C;  4ICU A;  1Z5S B;  2N7D A;  2AWT A;  4AJY B;  3ZRF A;  5G55 A;  5KHO A;  3UIN B;  2ZPN A;  3ZRC A;  1OQY A;  2BGF A;  2KKC A;  1F9J A;  3V62 A;  1TBE A;  1GC6 A;  1GUA B;  2VRR B;  1H8C A;  4YL8 A;  4BFR A;  5HKH A;  4WWP A;  2L05 A;  4MEM A;  3UQB A;  3LJ3 A;  2MBQ A;  4BOS C;  4EUT A;  2LUE A;  3RUL A;  4ASW C;  2BPS A;  3UIO B;  3X0W A;  5LXH A;  1J0G A;  3RZF A;  2Y5B B;  3A1Q A;  4FHK A;  2NPT B;  3TL5 A;  3H7S A;  2KJR A;  4W9F A;  1LQB A;  4HXD A;  4G3X B;  3M63 B;  4M8N A;  1Q1O A;  2LRU A;  2ZVO A;  2Z0E B;  2ZCB A;  3L54 A;  4DBG A;  1IP9 A;  1RLF A;  4NY0 A;  1WJ4 A;  1WRD B;  2M1M A;  2AEH A;  4MM3 A;  1YX5 B;  4I6L B;  4FHJ A;  1YQB A;  2KC1 A;  4HDO A;  2IO0 B;  5L95 C;  3WAM A;  1V6E A;  2G4S A;  1E8W A;  3OAW A;  2N7E A;  2MP2 B;  1V5O A;  3MJW A;  2K1F A;  3N3K B;  2KQ7 A;  3VDZ A;  5J2R A;  1LFD A;  1EUV B;  3JVZ X;  3ZO5 B;  2D2Q A;  1MG8 A;  4JL9 A;  1S1Q B;  3H6N A;  1J8C A;  3V6E B;  3L10 B;  1S3S G;  2BKF A;  2JUO A;  2CKH B;  3CMM B;  4K81 A;  3PRP B;  3WIM A;  4II3 B;  3A1Q B;  3QHT A;  4GGQ A;  3R7R A;  1UGM A;  4FBJ B;  2IY1 B;  1P9D U;  2LGD A;  2KTF A;  2FCS A;  4XC2 A;  4JIO U;  3R7Q A;  2R2O A;  4PS8 A;  2WX0 A;  1E8X A;  5LLI A;  5IAA C;  4EZL A;  2D07 B;  1ZKH A;  2G3Q B;  4AUQ C;  2MSE D;  1WM3 A;  3AXC A;  2A4Z A;  3EHV A;  1WIA A;  2HTH A;  3ZUN A;  3AU4 A;  1JRU A;  1WH3 A;  4ANW A;  4EOY A;  3JSV B;  2GBJ A;  3NY5 A;  2I1K A;  4MJS B;  2FCQ A;  1L2N A;  2MLB A;  2PEA A;  1SE9 A;  2D11 A;  4LDT D;  2LVO A;  3PSE B;  3RZW C;  2DZM A;  3DPD A;  3TCA A;  2WWZ A;  4GB9 A;  2BYF A;  4K7S A;  1EF5 A;  2GBN A;  2KFK A;  4MH0 E;  2KWU B;  2IYD B;  3DOW A;  2M8S A;  2CHW A;  3U7D A;  2PE9 A;  5JZE B;  2CS4 A;  3DQV A;  3ZDT A;  2KN5 A;  3PPA A;  5TR5 A;  5KHQ A;  4IM2 A;  4KVG B;  3MHS D;  2ZZP B;  4GDL B;  2KMC A;  1C1Y B;  1GNU A;  4JQW C;  3VHT C;  4P7I A;  2NCN A;  4W9I A;  1UH6 A;  2AL6 A;  4BBN C;  1E90 A;  2ZVN A;  4CHK A;  1WJN A;  2V1Y A;  1WR6 E;  2N1W A;  3NZU A;  2MQJ A;  1V49 A;  2CU1 A;  4ICV A;  2KDE B;  2L7R A;  1KOT A;  1K8R B;  4DDI D;  2N9E B;  4OVV A;  3VQI A;  3ALB A;  4G11 A;  4XZ4 A;  2FID A;  1CMX B;  2GBR A;  2N4F A;  1UEL A;  4NNJ B;  2MW5 A;  4FJZ A;  3VH3 B;  4GU2 A;  2C5L C;  2ASQ A;  1WXM A;  4LJP B;  1WR1 A;  4ANX A;  2ZEQ A;  2K6Q A;  2KFK B;  2DYM A;  3ZDM C;  3L17 A;  1EF1 A;  3TMP B;  4HK2 A;  2MBH A;  4ZRJ A;  2C9W B;  4WJQ A;  3W1S A;  2NBU A;  4BKG A;  1GJZ A;  1WFY A;  2IZV B;  3SU8 X;  3V6C B;  4HCP B;  2N9P C;  2XK5 B;  1V5T A;  2RGF A;  2KK8 A;  3CSF A;  2DZK A;  2D3G A;  1WXV A;  2KTR A;  2V4L A;  1WE7 A;  4LJO B;  4RM9 A;  3ZNH B;  1E8Z A;  3VUW A;  4MDK E;  4KIK B;  2JRH A;  4XX5 A;  3NHE B;  2O2V A;  4AOF A;  4TUU A;  4KSL C;  4W9L A;  5G2N A;  2JT4 B;  3BY4 B;  4HPM B;  4PYZ A;  1WX9 A;  2EMT A;  2MBB B;  2IBI B;  4DHZ E;  2IO3 B;  2NBW B;  4HCN B;  3N30 A;  2XEW A;  3DBH I;  5CHW A;  2K8C A;  3ZTC A;  1RAX A;  1Q5W B;  1R4N I;  3A9K A;  2QHO A;  2KDI A;  4EZK A;  1UBI A;  4MSQ B;  4IW0 A;  4PYU A;  1Y8R C;  2KAN A;  1YJ1 A;  1XD3 B;  4NPN A;  3ML8 A;  3X23 A;  1YX6 B;  2M0X A;  4TKN A;  4ZRI A;  1V80 A;  5AZH A;  4GMV A;  3K9P B;  2MA9 B;  5EDS A;  1R4M I;  2C7N B;  1UD7 A;  3OJ3 A;  3U30 A;  3R66 C;  4NJ6 A;  1VCB A;  3TBL D;  2C60 A;  3LDZ E;  2KLG A;  2B3A A;  2KZR A;  4J6I A;  1QZE A;  3L08 A;  4HPL B;  3B1L X;  3IVF A;  3H1U A;  3EEC A;  3JW0 X;  3DVG X;  4ANU A;  1V9J A;  4E71 A;  1YIW A;  3PLU A;  1D3Z A;  3A4R A;  3CST A;  2LGY A;  3PZD A;  4RMA A;  2KQS A;  1V81 A;  2O6V A;  3B08 A;  3PRE A;  1OEY J;  2FAZ A;  1P0R A;  3ZNZ B;  2KX0 A;  4BKS A;  4F1S A;  4MEL A;  3PGE A;  4KDL B;  2KOX A;  5E6P A;  2FNJ B;  2C7H A;  4M8M A;  3HM3 A;  2M17 A;  3MTN B;  1WX7 A;  2RSU A;  2WDT B;  3N32 A;  1WZ0 A;  1I35 A;  3KUD B;  1E5W A;  1WJ6 A;  3PT2 B;  4W9K A;  2ZPY A;  4W9C A;  2HD5 B;  3VFK A;  4ZRK A;  1AAR A;  1NI2 A;  2MCN B;  1ZW7 A;  5DPW A;  1SGH A;  4IM0 A;  4MJS A;  2MRP A;  2BWE S;  2O2V B;  2HE7 A;  3ZW3 A;  3K9O B;  5JH5 C;  2K8H A;  5FR6 A;  5JHB A;  2KLC A;  3A9J A;  3DVG Y;  2RR9 A;  3HHM A;  2ZNV C;  1SIF A;  2XBB C;  2K6D B;  2J7Q B;  3IFW B;  3TJP A;  3PLV A;  2JXX A;  2A5U A;  3VH4 B;  2C7M B;  2LD9 A;  1FXT B;  3OJ4 B;  4DDG D;  1P1A A;  1LM8 B;  2NVU I;  2OJR A;  4G0N B;  2FCN A;  4TQ1 A;  2OOB B;  4W9G A;  2GOW A;  4IWP A;  4GDL A;  3PV1 A;  1IYF A;  3S2A A;  1NDD A;  3TIX A;  4NAW B;  5D2M B;  5J17 A;  4MGY E;  2KDB A;  5C1Z A;  2CHZ A;  2IO2 B;  2UYZ B;  2WYQ A;  2Z59 B;  4GDK B;  5D94 A;  1Z2M A;  2DYO A;  4GXB A;  4ANV A;  4WJO A;  2K25 A;  4OVU A;  2BYV E;  1U4A A;  4IWO A;  2JZ3 B;  2ZJD A;  1WMH A;  3EC8 A;  3RCZ A;  4FN2 A;  3C0R B;  3IHP C;  2MWS B;  3H7P B;  3QWZ B;  4KZ0 A;  3WAP A;  4A3P A;  4AWJ A;  2UWQ A;  5AZG A;  2JVC A;  1J19 A;  5D6J B;  3U8Z A;  1NBF C;  4WWO A;  3B0A A;  3HK0 A;  3NS8 A;  2BKR B;  2LZ6 A;  4IM3 A;  4N9F 4;  1WGR A;  2GMI C;  3D32 A;  3QJZ A;  3L13 A;  4K7U A;  4WJP A;  4F7Z A;  1L7Y A;  4KZC A;  4CYE A;  3Q3J A;  4RM8 A;  4K7W A;  3PHX B;  5CHF A;  3ZNI D;  1OGW A;  5CTR C;  3VUY A;  3I3T B;  4FA6 A;  1BT0 A;  2FIF A;  3JYU A;  4KIK A;  3PHW B;  4NJ7 A;  2GBM A;  4W9J A;  3VTU A;  1GC7 A;  2KNB A;  5J18 A;  2LGX A;  1G6J A;  3SHQ A;  3UF8 A;  3QK0 A;  3UGB B;  3QAR A;  2J0K A;  4WWN A;  5CX3 A;  4DHJ D;  3A33 B;  2LVP A;  4JGH B;  2JZZ A;  3UIP B;  2JY6 A;  3WAO A;  3PRM B;  3RYT A;  3A9J B;  1WXA A;  3H9D A;  3EFU A;  4IWQ A;  4X57 B;  1Q0W B;  2LI5 A;  2KJ6 A;  3IG3 A;  1A5R A;  2LJ5 A;  2I1J A;  2ZCC A;  3UQA A;  2MX2 A;  2DAJ A;  4FUL A;  3WA0 A;  1WY8 A;  4EZJ A;  2AYO B;  2DYB A;  2LAS A;  2W9N A;  4LDT B;  3V61 A;  2KTR B;  3QAQ A;  4MGI E;  4E3C A;  1WZ3 A;  3SDL C;  3BIN A;  3SD5 A;  2DX5 B;  2EKE C;  4GDK A;  4TV3 A;  2IY0 B;  4CO7 A;  2MBO A;  3AU5 A;  4WJN A;  4ZYN A;  5D7G A;  1XT9 B;  4GN1 A;  2AL3 A;  3AUL A;  5GMV A;  2MP2 A;  3R3M A;  4FLH A;  4EFO A;  2HJ8 A;  3W1S C;  1VD2 A;  2KD0 A;  4A3O A;  1WJU A;  4ZDV A;  4HWI B;  4WQO B;  3ML9 A;  4I6N B;  2L00 B;  4BKT A;  2O6V B;  1GG3 A;  4W9D A;  2R2Q A;  5DCN A;  3RUI B;  2NS5 A;  4M0W B;  3PTF C;  3T8M A;  3AI5 A;  2G4D B;  4BVU C;  2D10 A;  1XQQ A;  4AJW A;  3APF A;  3M3J A;  3M95 A;  4FJY A;  1E7U A;  5E6O A;  3PRZ A;  2KX3 A;  2KMA A;  4HVB A;  3NOB A;  2KXJ A;  2PE6 B;  3GOE A;  4IC7 B;  3DBR I;  3CF6 E;  2M4N A;  2DHZ A;  1TZ1 A;  2KVR A;  4DXA B;  1P98 A;  3ZIM A;  4URK A;  3APD A;  4HLE A;  3VTV A;  2CR5 A;  2IO1 B;  2YVC A;  4JLC A;  1V2Y A;  1WYW B;  1I42 A;  2KO3 A;  1E8Y A;  3HM6 X;  1X1M A;  2JRI B;  3VTW A;  4BBN F;  3DBS A;  3ONS A;  4BKS D;  1P3Q U;  2JWZ A;  1HE8 A;  4EKU A;  3KH0 A;  2O6V D;  3A4S C;  1RRB A;  2PJH A;  1T0Y A;  2K8B A;  3WAN A;  3P2B A;  5DPT A;  1WGY A;  4KSK C;  4EEW A;  2N9X A;  2LXC A;  4IG7 B;  1KJT A;  3VXW A;  4HDQ A;  2K39 A;  1TGZ B;  4NQK E;  4PS7 A;  3V60 A;  2L0F A;  5IA7 A;  1OEY A;  2YLM A;  4WAA A;  4IUM B;  2KWV B;  3DCG A;  1ISN A; 
#chains in the Genus database with same CATH topology
 1K50 A;  1WX8 A;  2FCM A;  5LXI B;  3ZNG C;  5D3I B;  1HTO A;  2LFI A;  1KLV A;  1OTR B;  2REX A;  3AEE B;  3Q3O C;  1ZGU B;  3ZVV A;  1QOB A;  3VVW B;  4RGM A;  3P4Q B;  2LUM A;  1MFW A;  3SR6 A;  3HIZ A;  2NR2 A;  2EKI A;  4LNI A;  2J0J A;  1FMA D;  4JX1 C;  2J0M A;  1I7H A;  4MH8 A;  2WX1 A;  4H2A A;  2FE8 A;  2IDY A;  2MBE A;  1UZX B;  3P63 A;  3AN1 A;  2V3S A;  4FXC A;  4MM3 B;  4DHZ B;  2EMS A;  3KUZ A;  4MSM B;  3W1Y A;  1RFA A;  3RN9 C;  1TTN A;  1TS5 A;  5AUI A;  2DAF A;  4NQL B;  3GB1 A;  1J7B A;  3RPF C;  4KDI C;  1C76 A;  1ZDX A;  5C2T B;  4FJV B;  2BYE A;  1ZOY B;  2DBY A;  3IT6 B;  2BVC A;  1TIF A;  3EGR A;  3NVV A;  4CQN A;  2V3P A;  4MGK E;  4ZOH C;  4N58 A;  1JML A;  4AJY B;  4RH6 A;  1B9R A;  2KKC A;  1F9J A;  1D5X C;  1GC6 A;  1GUA B;  3VRA B;  1H8C A;  4WWP A;  3UQB A;  3RNC C;  3RUL A;  3NJT A;  3UIO B;  2WQY B;  1SEB D;  3Q8C A;  4HRS A;  3RZF A;  1LO5 D;  2QC8 A;  3URY A;  3H7S A;  2PVG C;  1ZXH A;  1Q1O A;  1SE3 A;  4DBG A;  1RLF A;  4P16 A;  1VJK A;  3WAM A;  1V6E A;  3TEY A;  3Q3N C;  3VDZ A;  2K1F A;  3N3K B;  2KQ7 A;  1LFD A;  1I4P A;  1EUV B;  4JL9 A;  3HVD A;  1S3S G;  2BKF A;  2CKH B;  2GI9 A;  4OZB A;  2OJW A;  3BYT B;  1SF0 A;  1UGM A;  2K9X A;  4JIO U;  3R7Q A;  4PS8 A;  2XN9 C;  1E8X A;  5LLI A;  2D07 B;  2WXL A;  3AXC A;  2A4Z A;  2HTH A;  1SE4 A;  1P7E A;  1JRU A;  1FXA A;  2RPV A;  2I1K A;  4ZRQ A;  1JW9 D;  4A8X C;  1L2N A;  2E6X A;  2PEA A;  2D11 A;  2LVO A;  3PSE B;  3TCA A;  3BVZ A;  2WWZ A;  4GB9 A;  2IND C;  2ZW1 A;  2WDV B;  2KFK A;  4ZHO A;  4OZA A;  2CS4 A;  1FEH A;  1N6Z A;  4IM2 A;  3VHT C;  4P7I A;  4KKI A;  1SJH D;  3O13 A;  2KDE B;  1CMX B;  1UEL A;  4FJZ A;  4M01 A;  3VH3 B;  2CJN A;  4LJP B;  1WXM A;  1WR1 A;  1JRP A;  3TEX A;  2K6Q A;  2KFK B;  3ZDM C;  4ZRJ A;  1TKY A;  1GJZ A;  3AB5 A;  3SU8 X;  2N9P C;  1B1Z A;  3CSF A;  3DWM A;  1E8Z A;  3VUW A;  2LHD A;  1BXT A;  3AE6 B;  2JRH A;  4C80 A;  4C4V A;  1IBX B;  4DHZ E;  2IO3 B;  3NVY A;  2XEW A;  1I4R A;  3ZTC A;  1R4N I;  4YWG G;  2KDI A;  3BII D;  4KGR A;  4MSQ B;  4ZHP A;  2KAN A;  1XD3 B;  2N0S B;  1V1O A;  3X23 A;  2M0X A;  4HRO A;  5FR3 A;  4GMV A;  5EDS A;  4UDU C;  1UD7 A;  3AE1 B;  1KLG D;  3Q69 A;  2HDE A;  4NJ6 A;  1VZ6 A;  1ESF A;  2W55 A;  2DLB A;  1NYR A;  1WYG A;  2LHE A;  4HPL B;  2KAJ A;  3IVF A;  2KYW A;  1TS2 A;  4ANU A;  1PYW D;  4E71 A;  3PLU A;  4RMA A;  4IDI A;  1V81 A;  4ARI A;  4KDL B;  1KH0 A;  1VR9 A;  1WWT A;  5HI1 A;  3KUD B;  1E5W A;  2Y5C A;  4W9K A;  1AN8 A;  1QT9 A;  2IGD A;  3TSS A;  4ZRK A;  3AEA B;  1NI2 A;  1QQR A;  2X38 A;  2LGI A;  1ZP0 B;  4IM0 A;  2BWE S;  2O2V B;  1FPY A;  3ZJT A;  1QKZ A;  3DVG Y;  2ZNV C;  2K6D B;  2INN E;  3T3N A;  3TJP A;  4RF1 A;  4S0R A;  5E6J A;  3BK2 A;  3VH4 B;  1MPE A;  3OJ4 B;  4DDG D;  1P1A A;  2FCN A;  4W9G A;  4IWP A;  4GDL A;  1IYF A;  2IPK D;  1NDD A;  3ZQ4 A;  3BYY B;  4MGY E;  4K3C A;  2CHZ A;  2IO2 B;  2Z59 B;  1M4V A;  5D94 A;  1Z2M A;  1L0V B;  2DYO A;  4WJO A;  1I4Q A;  2K25 A;  2KMM A;  4IWO A;  1JWS D;  2ZJD A;  1WMH A;  1ZE3 D;  4FN2 A;  3C0R B;  3H7P B;  2JVC A;  3U8Z A;  2GRI A;  4US8 A;  2IJ0 A;  2BKR B;  2LZ6 A;  3J9C A;  4M00 A;  2GMI C;  2W54 A;  4WJP A;  3Q3J A;  4N59 A;  1HQR D;  5H92 C;  2GLS A;  1BT0 A;  4KIK A;  2INC C;  4P1B C;  1GC7 A;  3L4P A;  2VH1 A;  1HZ6 A;  3A33 B;  1VZ7 A;  3WAO A;  3PRM B;  3H9D A;  3EFU A;  4IWQ A;  1DGJ A;  4XYC A;  4D2K A;  2LI5 A;  2KJ6 A;  1DOI A;  3IG3 A;  2LGS A;  4DXG A;  3WA0 A;  1WY8 A;  4EZJ A;  2DYB A;  2K0P A;  1SIJ A;  4E3C A;  1WZ3 A;  3BIN A;  2DX5 B;  4CO7 A;  2MBO A;  3AV8 A;  2AL3 A;  5G5H A;  3R3M A;  1XCQ L;  4FLH A;  4EFO A;  2HJ8 A;  3W1S C;  3NG0 A;  4ZDV A;  3ML9 A;  4I6N B;  4BKT A;  3RUI B;  3T8M A;  4OHJ A;  4WIP A;  3APF A;  1QOG A;  2KX3 A;  4P6V F;  1TZO A;  3GOE A;  4IC7 B;  4NZL B;  2W82 A;  3GP7 A;  3APD A;  4WQM A;  4HLE A;  1AYF A;  1T3Q A;  1I42 A;  4BBN F;  4BKS D;  1P3Q U;  1MHH E;  1R7S A;  3N1X C;  3W2D A;  2ONQ A;  1KFY B;  4B0E A;  3V60 A;  1C4P A;  3BVM A;  3Q2A C;  2L0F A;  1OEY A;  4WAA A;  1YN3 A;  3B2G A;  4AJW A;  4FAD A;  3VAW A;  3ZJU A;  1YN5 A;  1XF5 L;  3HRD D;  1YD8 U;  5IOI A;  3WAL A;  3SEB A;  3KW5 B;  1Y56 A;  1MG4 A;  3BZD B;  1EO6 A;  1J7C A;  5HHD G;  3ZYY X;  3APC A;  1PQS A;  2KC2 A;  2BWF A;  2WNM A;  1HTQ A;  4HPP A;  1UBQ A;  2CHX A;  2L52 A;  2L8J A;  2JPH A;  4A55 A;  1V1P A;  3L16 A;  2FBW B;  4G50 A;  1D4B A;  5JHA A;  2NBV B;  2KWC A;  4F8C B;  5I4D A;  1VLB A;  2L3Z A;  2MJE A;  4HJK A;  4W9H A;  3SFD B;  2BW2 A;  1WMH B;  3ZTD A;  4W9E A;  1JCK B;  2INP E;  1YJI A;  3H7P A;  3A9K B;  4YSX B;  1H4R A;  2Z0D B;  3Q3F A;  1PUT A;  5DPR A;  3M62 B;  4L1B A;  2J52 A;  2L0T A;  4LCD E;  1ET9 A;  4PS3 A;  2BS3 B;  4LNN A;  4MGZ E;  3E56 A;  5DPS A;  2L1A A;  3NZ3 A;  3OLM D;  3C19 A;  1HXY D;  2BF8 B;  3QC8 B;  4BOZ B;  1FM0 D;  1KF6 B;  1V8C A;  1WE6 A;  1WGG A;  4K1R B;  4AP4 C;  4ICU A;  2WLB A;  2N7D A;  1TY0 A;  4XWT A;  5G55 A;  3ZRC A;  2BGF A;  3V62 A;  3FAH A;  2MHJ A;  2L05 A;  3AEC B;  4MEM A;  4ASW C;  3X0W A;  3A1Q A;  2J42 A;  3TL5 A;  1C79 A;  5G5G A;  4HXD A;  4G3X B;  3M63 B;  2YEP F;  2LRU A;  4M8N A;  3BK1 A;  1IP9 A;  4NY0 A;  2M1M A;  4I6L B;  1YQB A;  2KC1 A;  2VZK D;  5L95 C;  2G4S A;  2N7E A;  4L2Y A;  1UGJ A;  4BZA A;  3B2F A;  3ZO5 B;  2WS3 B;  3H6N A;  2RDG A;  2D3A A;  3PRP B;  3WIM A;  4J3O D;  4GGQ A;  3R7R A;  1HZ5 A;  3I63 C;  5FKA C;  1D6E C;  2K3U A;  1P9D U;  2JQR B;  2R2O A;  3UI3 A;  5IAA C;  4EZL A;  4HEA 1;  2G3Q B;  1UWM A;  1FNV A;  2PMV A;  4JWU C;  3EFC A;  3TUO A;  3Q14 C;  1RFK A;  4O1N A;  4LDT D;  3PZ7 A;  3RZW C;  3DPD A;  2W3S A;  4K7S A;  2M19 A;  4MH0 E;  2IYD B;  3DOW A;  2CHW A;  3W9C B;  5JZE B;  3BVG A;  1KLU D;  2JXT A;  3ZDT A;  4GDL B;  2NTS A;  2KMC A;  1C1Y B;  4NJC A;  2WP9 B;  2AL6 A;  3U2S C;  1E90 A;  4ZYS A;  4CHK A;  3MC8 A;  1JWM D;  1V49 A;  2AQ2 B;  3AEF B;  4G11 A;  1GB4 A;  2MW5 A;  1J7A A;  4ANX A;  1OFF A;  2DYM A;  1MVK A;  1L4D B;  4HK2 A;  4BKG A;  3W1S A;  1WFY A;  1T6B X;  3Q6B A;  2XK5 B;  1F2R I;  2BB6 A;  2KK8 A;  2M56 B;  2DZK A;  4C00 A;  2D3G A;  1WXV A;  2KTR A;  2V4L A;  1WE7 A;  4LJO B;  2O2V A;  4A90 A;  3KLS X;  3BY4 B;  1WX9 A;  2EMT A;  2IBI B;  2NBW B;  3N30 A;  1VZ8 A;  5BMI A;  4IW0 A;  3EUB 2;  1C9F A;  2BB5 A;  3DWG C;  2FUG 1;  1L0X B;  2G1E A;  1FIQ A;  3IAS 1;  3RNE C;  4ZRI A;  1V80 A;  3K9P B;  3DBH B;  2C7N B;  4C7Z A;  1E9M A;  3U30 A;  2WXR A;  3TBL D;  3AE3 B;  1SB3 C;  2C60 A;  2KZR A;  1F2R C;  3H1U A;  3JW0 X;  2PIA A;  1Q10 A;  1D3Z A;  2LGY A;  1D5M C;  2KQS A;  2O6V A;  1YN4 A;  3B08 A;  1OEY J;  1R4N B;  1P0R A;  4F1S A;  4YT0 B;  2QIL A;  3PGE A;  1WX7 A;  3Q3M C;  3N32 A;  2SEB D;  1RYJ A;  1ROE A;  3VFK A;  2WDR B;  3TEW A;  2BS4 B;  3K9O B;  2KQ4 X;  4C4V B;  2KLC A;  2KDM A;  2PVO D;  2ZW0 A;  2J7Q B;  5GXG B;  3PLV A;  2A5U A;  1LM8 B;  1N5W A;  2OOB B;  1HA5 A;  3TIX A;  4NAW B;  2KT7 A;  4TSS A;  1ZPS A;  2RDH A;  2ON8 A;  1U4A A;  3RCZ A;  3QWZ B;  3WAP A;  1WRI A;  1E6E B;  3Q8B A;  5D6J B;  1PGB A;  2G9H D;  4USA A;  2KWD A;  3GE8 C;  4N9F 4;  2WXF A;  1I4H A;  3QJZ A;  3D32 A;  4F7Z A;  3L13 A;  1L7Y A;  4KZC A;  2JSV X;  5CTR C;  2WXI A;  4C56 C;  4LK0 M;  4NJ7 A;  2GBM A;  3TEZ A;  4W9J A;  3VTU A;  5J18 A;  2BT6 A;  1G6J A;  3UF8 A;  3QK0 A;  3QAR A;  1A70 A;  4WWN A;  3MP9 A;  3UIP B;  1WXA A;  1Q0W B;  1NEK B;  1PDX A;  4US9 A;  2LJ5 A;  2WXN A;  2I1J A;  2W9N A;  4LDT B;  3V61 A;  2KTR B;  3SDL C;  2AQ3 B;  2EKE C;  4LTU A;  2IY0 B;  4ZYN A;  3AU5 A;  4WJN A;  2D3B A;  2WU2 B;  2WGS A;  2N9K A;  3RI7 C;  1VD2 A;  2KD0 A;  3MC9 A;  4HWI B;  2R2Q A;  4M0W B;  3DHG C;  1XQQ A;  3AMZ A;  3M95 A;  1F52 A;  1E7U A;  2KMA A;  4XWW A;  3PZ8 A;  3NOB A;  1UF0 A;  2KXJ A;  3CF6 E;  2DHZ A;  1TZ1 A;  2KVR A;  1P98 A;  4URK A;  4WUR A;  3C8Y A;  2CR5 A;  4A6Q A;  2YVC A;  4JLC A;  1TKE A;  1E8Y A;  3HM6 X;  1X1M A;  2JRI B;  3VTW A;  4EKU A;  3DBS A;  3RMK C;  1HE8 A;  3KH0 A;  1RRB A;  5C3J B;  2K8B A;  3WAN A;  3P2B A;  2HJ1 A;  4YXD B;  4KSK C;  4EEW A;  2N9X A;  2LXC A;  2V0G A;  3ZJV A;  3VXW A;  1F1H A;  3NS1 A;  4NQK E;  2QSD A;  3B9J A;  1GOZ A;  1ISN A;  1VRA B;  3LB8 C;  1WF9 A;  2BTE A;  3DBL I;  1T0S C;  4PK1 A;  1GAQ B;  4MAC A;  4B9K A;  4ARC A;  3HUI A;  3DDC B;  5BO4 B;  2DEN B;  2HTM E;  1M94 A;  1C3T A;  2LRW A;  4R3D A;  5E6N A;  1NEN B;  3ZLZ A;  3AE9 B;  2IGH A;  2KDF B;  3QX1 A;  4NAW A;  3FIL B;  1WXS A;  3KVF B;  2I38 A;  4B95 A;  1P7F A;  4DWF A;  4I6P A;  2DZI A;  3QCA A;  3ECI A;  3DBR B;  2LWP A;  2EEL A;  2RMM A;  4KV2 A;  3ENE A;  1IPG A;  2BQQ A;  3AE5 B;  2ZNV B;  4DK5 A;  1XO3 A;  3PS6 A;  3AE7 B;  2QCZ A;  5EE1 A;  3L0W B;  2KFJ A;  5IP4 D;  2WXP A;  4DXF A;  2N1V A;  5C23 A;  4HKZ E;  3V3X A;  3T9L A;  2RPQ A;  4A20 A;  4TQ0 A;  2DZJ A;  1UUP A;  1KM7 A;  2X8X X;  2XK5 A;  1V86 A;  1C4C A;  2GB1 A;  3JSV A;  4AS1 A;  2LEK A;  3ZRF A;  2ZPN A;  1OQY A;  2MJ3 A;  5MPO A;  5HKH A;  2MBQ A;  4BOS C;  4EUT A;  2LUE A;  5LXH A;  2I2Y A;  2NPT B;  1DOY A;  2KJR A;  2WXK A;  4EE2 A;  2ZVO A;  2ZCB A;  3FKY A;  1WJ4 A;  1QLB B;  3BWU D;  2OED A;  2IO0 B;  2Y5P A;  1FCL A;  3NVZ A;  3R8B A;  3JVZ X;  1PGA A;  1S1Q B;  3L10 B;  4II3 B;  1YNT E;  3KQ4 A;  4YTN B;  4XC2 A;  3HVZ A;  2WX0 A;  2UU7 A;  2Q5W D;  4AUQ C;  3P1M A;  1WIA A;  3AU4 A;  4ANW A;  5BMH A;  1IUE A;  4MJS B;  2FCQ A;  2MLB A;  1JWA D;  1SE9 A;  1EWC A;  4BAX A;  1F77 A;  1EF5 A;  2Z8L A;  3NVW A;  2GBN A;  5BMG A;  2KWU B;  2PE9 A;  2W3R A;  2RDB C;  2QIE B;  2KN5 A;  3PPA A;  5TR5 A;  5KHQ A;  2D3C A;  2ZZP B;  1GNU A;  2NCN A;  1SBB B;  5EE0 A;  4BBN C;  2ZVN A;  1WJN A;  1WR6 E;  3I5J C;  3NZU A;  2MQJ A;  4ICV A;  3ZXR A;  1SXT A;  2L7R A;  3U7Z A;  4DDI D;  2N9E B;  4OVV A;  3ALB A;  3CWI A;  4XZ4 A;  2FID A;  4NNJ B;  2QMT A;  1JWB D;  4GU2 A;  2C5L C;  1E10 A;  2ASQ A;  2K22 A;  2WXQ A;  4JWS C;  2ZEQ A;  3L17 A;  1MJD A;  4ZRP A;  4RGO S;  2MBH A;  2C9W B;  4WJQ A;  2NBU A;  1T0R C;  2IZV B;  3V6C B;  4HCP B;  1DOX A;  5FK9 C;  2RGF A;  3ZNH B;  1XXG A;  4NAM A;  4XX5 A;  2JU6 X;  3NHE B;  4AOF A;  4W9L A;  2M0A A;  2K8C A;  1Q5W B;  3IXS A;  2QHO A;  1K51 A;  2Y3A A;  3P4S B;  2YEP B;  3RFZ B;  3N20 C;  1ZXI A;  1Y8R C;  1FD6 A;  1IGC A;  2QJL A;  3E9S A;  4TKN A;  5AZH A;  3AEG B;  1ZDV A;  1RWS A;  3OJ3 A;  1VCB A;  2KLG A;  2B3A A;  1QZE A;  1HEZ E;  2V4I B;  3EEC A;  3MFG A;  2PW9 A;  3RNB C;  3A4R A;  3AE2 B;  3V05 A;  2TSS A;  1YQ3 B;  3PRE A;  1YQ4 B;  1UNS A;  4MEL A;  2KOX A;  2FNJ B;  4QAY A;  3I9V 1;  3P42 A;  3KWV A;  4M8M A;  3HM3 A;  2M17 A;  3MTN B;  2QEJ C;  2ZPY A;  4W9C A;  3OWE B;  1EM7 A;  1SGH A;  2MRP A;  1I4X A;  1YJJ A;  1AW7 A;  2ACZ B;  2K8H A;  2WDQ B;  5JHB A;  2RR9 A;  3LYY A;  3HHM A;  3NUH B;  1SIF A;  2XBB C;  1ZUD 2;  1FNW A;  2JXX A;  2LMC A;  2LD9 A;  1DYQ A;  2NVU I;  4KKJ A;  4G0N B;  4KGS A;  2LJI A;  1TS3 A;  3PV1 A;  3S2A A;  4C7Y A;  4K3B A;  5D2M B;  2KDB A;  5JXV A;  2PLP A;  4RGT A;  2UYZ B;  4GDK B;  4OVU A;  2JZ3 B;  2KVZ A;  3IHP C;  2MWS B;  4KZ0 A;  1I4G A;  2H89 B;  3ZGZ A;  5AZG A;  1J19 A;  3W5V B;  1NBF C;  3AM9 A;  4LNK A;  3HK0 A;  3NS8 A;  1FFV A;  1XCT L;  4K7U A;  4RM8 A;  4K7W A;  5CHF A;  1N5X A;  1OGW A;  1QOA A;  4FA6 A;  2FIF A;  1QF6 A;  3PHW B;  4IKG A;  2KNB A;  2WXJ A;  1L6V A;  2LGX A;  3FIL A;  3SHQ A;  1WGK A;  3UGB B;  5CX3 A;  2WU5 B;  2DWQ A;  2JZZ A;  2CJO A;  5IKC M;  1BML C;  3RYT A;  3A9J B;  3ABV B;  4X57 B;  1WSP A;  2JYT A;  3UQA A;  3IT4 B;  4FUL A;  2AYO B;  2OHF A;  1E0Z A;  1TY2 A;  3QAQ A;  3SD5 A;  5D7G A;  1JWU D;  1XT9 B;  3AUL A;  1EU3 A;  2MP2 A;  5AUK A;  1C77 A;  4RF0 A;  4A3O A;  1WJU A;  4WQO B;  3MJ5 A;  2O6V B;  1GG3 A;  4W9D A;  2NS5 A;  3PTF C;  2KAC A;  4BVU C;  4PT5 A;  4RCO A;  3M3J A;  4FJY A;  1L5P A;  4HVB A;  1N61 A;  2CU3 A;  3DBR I;  2M4N A;  1TT5 B;  4DXA B;  3VTV A;  2IO1 B;  1V2Y A;  1WYW B;  4L23 A;  3RNA C;  3ONS A;  4JPS A;  2JWZ A;  3A4S C;  2H88 B;  2PJH A;  2B76 B;  3I57 A;  3P4P B;  4HDQ A;  2K39 A;  3ZXV A;  3R2T A;  4PS7 A;  2K5P A;  2YLM A;  2V3N A;  2KWV B;  3DCG A;  4II2 B;  3Q8E A;  1YMH E;  1T0Q C;  3GZN I;  2JF5 A;  2D5G A;  2J4X A;  3NRZ A;  3CIR B;  5L83 A;  1FRD A;  2FUH B;  1XLO A;  1WGD A;  2GBK A;  3DVN V;  3NZS A;  4GOC A;  5CHV C;  3PVL A;  3VR8 B;  1ACC A;  1E7V A;  1MI0 A;  5EE3 A;  4DHJ B;  3KUC B;  2L32 A;  3ZKJ C;  4B6W A;  1E7P B;  4HKQ A;  3DBL B;  2NPT A;  2LVQ A;  4GSW A;  1EWY C;  2MJD A;  2PPH A;  5BYR A;  1XLQ A;  1WGH A;  3O65 B;  1MHX A;  2L76 A;  4GLS C;  2LXA A;  3MHZ A;  2KHW B;  2KJH B;  4GIV A;  3AE4 B;  5AZF A;  3VUX A;  3SFE B;  4E74 A;  5AEK B;  1WM2 A;  1WI0 A;  3RT3 B;  3DHI C;  1JAL A;  1LXD A;  3KYD D;  2RD0 A;  2G45 B;  4OZC A;  2JWU A;  3RD2 A;  3KYC D;  3DVN U;  1V97 A;  2PTL A;  3QIJ A;  1RM6 C;  4OVZ A;  4YTP B;  4MT5 A;  3QA8 A;  3QQ8 B;  2NTT A;  3IBE A;  2BBC A;  1Z5S B;  2AWT A;  4LNF A;  5KHO A;  3UIN B;  1TBE A;  2IGG A;  2VRR B;  4YL8 A;  4BFR A;  2MH7 A;  3LJ3 A;  3VR9 B;  2BPS A;  1J0G A;  2Y5B B;  4FHK A;  1BUI C;  1NYQ A;  4W9F A;  3U4E G;  1LQB A;  2Z0E B;  3L54 A;  1WRD B;  2AEH A;  1JQ4 A;  4MM3 A;  1YX5 B;  4FHJ A;  1OQQ A;  4HDO A;  1E8W A;  3OAW A;  1KTK A;  2MP2 B;  1V5O A;  3MJW A;  5J2R A;  1T5X D;  2D2Q A;  1MG8 A;  1XEE A;  1J8C A;  3V6E B;  4K81 A;  2JUO A;  2JZP A;  1K52 A;  2NMQ A;  3CMM B;  1TYG B;  1FO4 A;  3A1Q B;  3QHT A;  5EE9 A;  3AEB B;  4FBJ B;  2IY1 B;  4M02 A;  2LGD A;  4OW0 A;  2KTF A;  2FCS A;  3N1Z C;  1FNU A;  1N63 A;  1ZKH A;  3LXF A;  2MSE D;  2JX5 A;  1WM3 A;  5LNK 1;  1XLP A;  3ETR A;  1CQV A;  3EHV A;  3ZUN A;  1N62 A;  1WH3 A;  4EOY A;  3JSV B;  2GBJ A;  3NY5 A;  3T3O A;  4LNO A;  3W5U B;  2DZM A;  4XDC A;  2BYF A;  1FCC C;  4B0M A;  1FXI A;  3EA6 A;  2M8S A;  3U7D A;  1AWD A;  4RFB A;  3DQV A;  4KVG B;  3MHS D;  4JQW C;  4W9I A;  1UH6 A;  2V1Y A;  2N1W A;  4LLG M;  1L6U A;  2CU1 A;  1KOT A;  1K8R B;  2ICI A;  3N1Y C;  3VQI A;  5T8I A;  2GBR A;  2N4F A;  4IOI E;  4WAF A;  1TKG A;  1SE2 A;  1D5Z C;  2AQ1 B;  1EF1 A;  3TMP B;  1F0Z A;  4HJG E;  1EU4 A;  2J53 A;  1V5T A;  2WHI A;  5BYS A;  4YSZ B;  4RM9 A;  4KGT A;  4MDK E;  4KIK B;  2SAK A;  3OG5 A;  4TUU A;  4KSL C;  5G2N A;  2JT4 B;  4HPM B;  1QIL A;  2MBB B;  4PYZ A;  4TMA B;  4HCN B;  3IAM 1;  3DBH I;  5CHW A;  1ET6 A;  1RAX A;  1NI3 A;  3A9K A;  4M0W A;  4EZK A;  1UBI A;  1SSN A;  5HG2 A;  4PYU A;  1YJ1 A;  3H8H A;  4NPN A;  3ML8 A;  1STE A;  1YX6 B;  4RGN A;  1N60 A;  2MA9 B;  1FFU A;  1R4M I;  3Q8F A;  3AH7 A;  1TJE A;  2PKO A;  3R66 C;  5TSS A;  3LDZ E;  2N7J A;  4J6I A;  3L08 A;  2MEK A;  3B1L X;  3DVG X;  1CJE A;  1V9J A;  1YIW A;  4ITK A;  4XE0 A;  2XNA C;  3CST A;  3PZD A;  3ZNZ B;  2FAZ A;  2KX0 A;  4BKS A;  2E3T A;  2VZK B;  5BYQ A;  5E6P A;  3AE8 B;  2C7H A;  3VRB B;  3RNG C;  2N9L A;  2RSU A;  2WDT B;  1WZ0 A;  1I35 A;  1WJ6 A;  4A9A A;  3PT2 B;  2HD5 B;  1AAR A;  2MCN B;  5IO9 A;  1ZW7 A;  5DPW A;  2JYE A;  2BYT A;  4MJS A;  1WXQ A;  3GZN B;  2HE7 A;  3ZW3 A;  5JH5 C;  5FR6 A;  3A9J A;  1IBX A;  4N6E B;  1IGD A;  3IFW B;  2C7M B;  4DQO C;  1FXT B;  2OJR A;  4TQ1 A;  1ENF A;  2GOW A;  1GPX A;  1C78 A;  5J17 A;  5C1Z A;  2WYQ A;  1YOV B;  2AX5 A;  2L83 A;  1L4Z B;  4GXB A;  5D3D A;  4ANV A;  1XLN A;  2BYV E;  3P4R B;  3EC8 A;  4REZ A;  3GS2 A;  4YSY B;  3DHH C;  4A3P A;  2KN4 A;  2UWQ A;  4AWJ A;  1R4M B;  4S17 A;  3RNF C;  4WWO A;  3B0A A;  4IM3 A;  1WGR A;  2DNF A;  4CYE A;  4RNA A;  3PHX B;  3ZNI D;  4YTM B;  3VUY A;  3I3T B;  3Q8A A;  3JYU A;  3R2I A;  1FRR A;  2R61 A;  2WXO A;  4ACF A;  4WH4 A;  2J0K A;  4DHJ D;  2LVP A;  4JGH B;  1C4A A;  5HFY A;  2JY6 A;  3KWL A;  2V9H A;  1A5R A;  4P1C C;  2ZCC A;  2MX2 A;  3U52 E;  2DAJ A;  1KRH A;  3PO0 A;  1CK1 A;  2LAS A;  4MGI E;  3GE3 C;  1OQR A;  3AED B;  3FC4 A;  4GDK A;  4TV3 A;  5H8Y E;  1PFD A;  4GN1 A;  4WWM A;  5GMV A;  4KX6 B;  4XGA B;  1GB1 A;  2WXG A;  2L00 B;  5DCN A;  3AI5 A;  2G4D B;  2D10 A;  1LGR A;  1UWX A;  1V1P B;  4Q2J A;  2QDF A;  5E6O A;  3PRZ A;  2WXM A;  2BS2 B;  1K53 A;  1JRO A;  2PE6 B;  3N9Y C;  1SJE D;  3ZIM A;  5IN7 A;  2WXH A;  4XDD A;  1CZP A;  2KO3 A;  2O6V D;  1T0Y A;  1TS4 A;  1PGX A;  4AQ7 A;  5DPT A;  1WGY A;  4IG7 B;  1KJT A;  1VDV A;  1NVI D;  1L0Y B;  4JE3 B;  1QOF A;  3WCQ A;  1TGZ B;  2VH2 A;  3MC0 B;  5IA7 A;  4IUM B; 
#chains in the Genus database with same CATH homology
 4II2 B;  1WX8 A;  3VAW A;  2FCM A;  1WF9 A;  5LXI B;  3DBL I;  3GZN I;  1YD8 U;  2JF5 A;  3WAL A;  3ZNG C;  3KW5 B;  5L83 A;  1KLV A;  1OTR B;  2REX A;  1EO6 A;  1ZGU B;  4B9K A;  3ZVV A;  2FUH B;  2GBK A;  1PQS A;  1WGD A;  3APC A;  3DVN V;  3NZS A;  4GOC A;  3DDC B;  3VVW B;  2KC2 A;  5CHV C;  2BWF A;  5BO4 B;  3PVL A;  2DEN B;  1M94 A;  1UBQ A;  1C3T A;  1E7V A;  2LRW A;  2NR2 A;  3HIZ A;  5E6N A;  2CHX A;  4DHJ B;  3KUC B;  3ZLZ A;  2J0J A;  3ZKJ C;  4B6W A;  2L8J A;  2JPH A;  2NPT A;  3L16 A;  2J0M A;  2KDF B;  4G50 A;  2LVQ A;  2WX1 A;  3QX1 A;  4GSW A;  5JHA A;  4NAW A;  1WXS A;  2MBE A;  2NBV B;  2PPH A;  3KVF B;  1UZX B;  2KWC A;  4F8C B;  2V3S A;  4B95 A;  2L3Z A;  4DHZ B;  4HJK A;  1WGH A;  3O65 B;  2EMS A;  4DWF A;  4I6P A;  4W9H A;  3ZTD A;  1WMH B;  2DZI A;  3QCA A;  3ECI A;  3KUZ A;  4W9E A;  2L76 A;  2LXA A;  2LWP A;  3H7P A;  4KV2 A;  3ENE A;  4MSM B;  1IPG A;  3W1Y A;  1RFA A;  3A9K B;  1TTN A;  2KHW B;  2KJH B;  4GIV A;  2ZNV B;  1H4R A;  2Z0D B;  3PS6 A;  2DAF A;  4DK5 A;  3Q3F A;  4NQL B;  5AZF A;  3VUX A;  3L0W B;  2KFJ A;  5DPR A;  4E74 A;  5AEK B;  3M62 B;  1WM2 A;  1WI0 A;  4KDI C;  3RT3 B;  2N1V A;  2L0T A;  4LCD E;  5C23 A;  4PS3 A;  3T9L A;  2RPQ A;  4MGZ E;  4A20 A;  1LXD A;  5DPS A;  3KYD D;  2RD0 A;  4FAD A;  2G45 B;  4FJV B;  4TQ0 A;  3RD2 A;  2DZJ A;  3OLM D;  1KM7 A;  2BYE A;  3KYC D;  2XK5 A;  3DVN U;  1V86 A;  3QIJ A;  2BF8 B;  3QC8 B;  4BOZ B;  4MGK E;  3QA8 A;  3QQ8 B;  3IBE A;  1WE6 A;  1WGG A;  3JSV A;  4K1R B;  4AP4 C;  4ICU A;  1Z5S B;  2N7D A;  2AWT A;  4AJY B;  3ZRF A;  5G55 A;  5KHO A;  3UIN B;  2ZPN A;  3ZRC A;  1OQY A;  2BGF A;  2KKC A;  1F9J A;  3V62 A;  1TBE A;  1GC6 A;  1GUA B;  2VRR B;  1H8C A;  4YL8 A;  4BFR A;  5HKH A;  4WWP A;  2L05 A;  4MEM A;  3UQB A;  3LJ3 A;  2MBQ A;  4BOS C;  4EUT A;  2LUE A;  3RUL A;  4ASW C;  2BPS A;  3UIO B;  3X0W A;  5LXH A;  1J0G A;  3RZF A;  2Y5B B;  3A1Q A;  4FHK A;  2NPT B;  3TL5 A;  3H7S A;  2KJR A;  4W9F A;  1LQB A;  4HXD A;  4G3X B;  3M63 B;  4M8N A;  1Q1O A;  2LRU A;  2ZVO A;  2Z0E B;  2ZCB A;  3L54 A;  4DBG A;  1IP9 A;  1RLF A;  4NY0 A;  1WJ4 A;  1WRD B;  2M1M A;  2AEH A;  4MM3 A;  1YX5 B;  4I6L B;  4FHJ A;  1YQB A;  2KC1 A;  4HDO A;  2IO0 B;  5L95 C;  3WAM A;  1V6E A;  2G4S A;  1E8W A;  3OAW A;  2N7E A;  2MP2 B;  1V5O A;  3MJW A;  2K1F A;  3N3K B;  2KQ7 A;  3VDZ A;  5J2R A;  1LFD A;  1EUV B;  3JVZ X;  3ZO5 B;  2D2Q A;  1MG8 A;  4JL9 A;  1S1Q B;  3H6N A;  1J8C A;  3V6E B;  3L10 B;  1S3S G;  2BKF A;  2JUO A;  2CKH B;  3CMM B;  4K81 A;  3PRP B;  3WIM A;  4II3 B;  3A1Q B;  3QHT A;  4GGQ A;  3R7R A;  1UGM A;  4FBJ B;  2IY1 B;  1P9D U;  2LGD A;  2KTF A;  2FCS A;  4XC2 A;  4JIO U;  3R7Q A;  2R2O A;  4PS8 A;  2WX0 A;  1E8X A;  5LLI A;  5IAA C;  4EZL A;  2D07 B;  1ZKH A;  2G3Q B;  4AUQ C;  2MSE D;  1WM3 A;  3AXC A;  2A4Z A;  3EHV A;  1WIA A;  2HTH A;  3ZUN A;  3AU4 A;  1JRU A;  1WH3 A;  4ANW A;  4EOY A;  3JSV B;  2GBJ A;  3NY5 A;  2I1K A;  4MJS B;  2FCQ A;  1L2N A;  2MLB A;  2PEA A;  1SE9 A;  2D11 A;  4LDT D;  2LVO A;  3PSE B;  3RZW C;  2DZM A;  3DPD A;  3TCA A;  2WWZ A;  4GB9 A;  2BYF A;  4K7S A;  1EF5 A;  2GBN A;  2KFK A;  4MH0 E;  2KWU B;  2IYD B;  3DOW A;  2M8S A;  2CHW A;  3U7D A;  2PE9 A;  5JZE B;  2CS4 A;  3DQV A;  3ZDT A;  2KN5 A;  3PPA A;  5TR5 A;  5KHQ A;  4IM2 A;  4KVG B;  3MHS D;  2ZZP B;  4GDL B;  2KMC A;  1C1Y B;  1GNU A;  4JQW C;  3VHT C;  4P7I A;  2NCN A;  4W9I A;  1UH6 A;  2AL6 A;  4BBN C;  1E90 A;  2ZVN A;  4CHK A;  1WJN A;  2V1Y A;  1WR6 E;  2N1W A;  3NZU A;  2MQJ A;  1V49 A;  2CU1 A;  4ICV A;  2KDE B;  2L7R A;  1KOT A;  1K8R B;  4DDI D;  2N9E B;  4OVV A;  3VQI A;  3ALB A;  4G11 A;  4XZ4 A;  2FID A;  1CMX B;  2GBR A;  2N4F A;  1UEL A;  4NNJ B;  2MW5 A;  4FJZ A;  3VH3 B;  4GU2 A;  2C5L C;  2ASQ A;  1WXM A;  4LJP B;  1WR1 A;  4ANX A;  2ZEQ A;  2K6Q A;  2KFK B;  2DYM A;  3ZDM C;  3L17 A;  1EF1 A;  3TMP B;  4HK2 A;  2MBH A;  4ZRJ A;  2C9W B;  4WJQ A;  3W1S A;  2NBU A;  4BKG A;  1GJZ A;  1WFY A;  2IZV B;  3SU8 X;  3V6C B;  4HCP B;  2N9P C;  2XK5 B;  1V5T A;  2RGF A;  2KK8 A;  3CSF A;  2DZK A;  2D3G A;  1WXV A;  2KTR A;  2V4L A;  1WE7 A;  4LJO B;  4RM9 A;  3ZNH B;  1E8Z A;  3VUW A;  4MDK E;  4KIK B;  2JRH A;  4XX5 A;  3NHE B;  2O2V A;  4AOF A;  4TUU A;  4KSL C;  4W9L A;  5G2N A;  2JT4 B;  3BY4 B;  4HPM B;  4PYZ A;  1WX9 A;  2EMT A;  2MBB B;  2IBI B;  4DHZ E;  2IO3 B;  2NBW B;  4HCN B;  3N30 A;  2XEW A;  3DBH I;  5CHW A;  2K8C A;  3ZTC A;  1RAX A;  1Q5W B;  1R4N I;  3A9K A;  2QHO A;  2KDI A;  4EZK A;  1UBI A;  4MSQ B;  4IW0 A;  4PYU A;  1Y8R C;  2KAN A;  1YJ1 A;  1XD3 B;  4NPN A;  3ML8 A;  3X23 A;  1YX6 B;  2M0X A;  4TKN A;  4ZRI A;  1V80 A;  5AZH A;  4GMV A;  3K9P B;  2MA9 B;  5EDS A;  1R4M I;  2C7N B;  1UD7 A;  3OJ3 A;  3U30 A;  3R66 C;  4NJ6 A;  1VCB A;  3TBL D;  2C60 A;  3LDZ E;  2KLG A;  2B3A A;  2KZR A;  4J6I A;  1QZE A;  3L08 A;  4HPL B;  3B1L X;  3IVF A;  3H1U A;  3EEC A;  3JW0 X;  3DVG X;  4ANU A;  1V9J A;  4E71 A;  1YIW A;  3PLU A;  1D3Z A;  3A4R A;  3CST A;  2LGY A;  3PZD A;  4RMA A;  2KQS A;  1V81 A;  2O6V A;  3B08 A;  3PRE A;  1OEY J;  2FAZ A;  1P0R A;  3ZNZ B;  2KX0 A;  4BKS A;  4F1S A;  4MEL A;  3PGE A;  4KDL B;  2KOX A;  5E6P A;  2FNJ B;  2C7H A;  4M8M A;  3HM3 A;  2M17 A;  3MTN B;  1WX7 A;  2RSU A;  2WDT B;  3N32 A;  1WZ0 A;  1I35 A;  3KUD B;  1E5W A;  1WJ6 A;  3PT2 B;  4W9K A;  2ZPY A;  4W9C A;  2HD5 B;  3VFK A;  4ZRK A;  1AAR A;  1NI2 A;  2MCN B;  1ZW7 A;  5DPW A;  1SGH A;  4IM0 A;  4MJS A;  2MRP A;  2BWE S;  2O2V B;  2HE7 A;  3ZW3 A;  3K9O B;  5JH5 C;  2K8H A;  5FR6 A;  5JHB A;  2KLC A;  3A9J A;  3DVG Y;  2RR9 A;  3HHM A;  2ZNV C;  1SIF A;  2XBB C;  2K6D B;  2J7Q B;  3IFW B;  3TJP A;  3PLV A;  2JXX A;  2A5U A;  3VH4 B;  2C7M B;  2LD9 A;  1FXT B;  3OJ4 B;  4DDG D;  1P1A A;  1LM8 B;  2NVU I;  2OJR A;  4G0N B;  2FCN A;  4TQ1 A;  2OOB B;  4W9G A;  2GOW A;  4IWP A;  4GDL A;  3PV1 A;  1IYF A;  3S2A A;  1NDD A;  3TIX A;  4NAW B;  5D2M B;  5J17 A;  4MGY E;  2KDB A;  5C1Z A;  2CHZ A;  2IO2 B;  2UYZ B;  2WYQ A;  2Z59 B;  4GDK B;  5D94 A;  1Z2M A;  2DYO A;  4GXB A;  4ANV A;  4WJO A;  2K25 A;  4OVU A;  2BYV E;  1U4A A;  4IWO A;  2JZ3 B;  2ZJD A;  1WMH A;  3EC8 A;  3RCZ A;  4FN2 A;  3C0R B;  3IHP C;  2MWS B;  3H7P B;  3QWZ B;  4KZ0 A;  3WAP A;  4A3P A;  4AWJ A;  2UWQ A;  5AZG A;  2JVC A;  1J19 A;  5D6J B;  3U8Z A;  1NBF C;  4WWO A;  3B0A A;  3HK0 A;  3NS8 A;  2BKR B;  2LZ6 A;  4IM3 A;  4N9F 4;  1WGR A;  2GMI C;  3D32 A;  3QJZ A;  3L13 A;  4K7U A;  4WJP A;  4F7Z A;  1L7Y A;  4KZC A;  4CYE A;  3Q3J A;  4RM8 A;  4K7W A;  3PHX B;  5CHF A;  3ZNI D;  1OGW A;  5CTR C;  3VUY A;  3I3T B;  4FA6 A;  1BT0 A;  2FIF A;  3JYU A;  4KIK A;  3PHW B;  4NJ7 A;  2GBM A;  4W9J A;  3VTU A;  1GC7 A;  2KNB A;  5J18 A;  2LGX A;  1G6J A;  3SHQ A;  3UF8 A;  3QK0 A;  3UGB B;  3QAR A;  2J0K A;  4WWN A;  5CX3 A;  4DHJ D;  3A33 B;  2LVP A;  4JGH B;  2JZZ A;  3UIP B;  2JY6 A;  3WAO A;  3PRM B;  3RYT A;  3A9J B;  1WXA A;  3H9D A;  3EFU A;  4IWQ A;  4X57 B;  1Q0W B;  2LI5 A;  2KJ6 A;  3IG3 A;  1A5R A;  2LJ5 A;  2I1J A;  2ZCC A;  3UQA A;  2MX2 A;  2DAJ A;  4FUL A;  3WA0 A;  1WY8 A;  4EZJ A;  2AYO B;  2DYB A;  2LAS A;  2W9N A;  4LDT B;  3V61 A;  2KTR B;  3QAQ A;  4MGI E;  4E3C A;  1WZ3 A;  3SDL C;  3BIN A;  3SD5 A;  2DX5 B;  2EKE C;  4GDK A;  4TV3 A;  2IY0 B;  4CO7 A;  2MBO A;  3AU5 A;  4WJN A;  4ZYN A;  5D7G A;  1XT9 B;  4GN1 A;  2AL3 A;  3AUL A;  5GMV A;  2MP2 A;  3R3M A;  4FLH A;  4EFO A;  2HJ8 A;  3W1S C;  1VD2 A;  2KD0 A;  4A3O A;  1WJU A;  4ZDV A;  4HWI B;  4WQO B;  3ML9 A;  4I6N B;  2L00 B;  4BKT A;  2O6V B;  1GG3 A;  4W9D A;  2R2Q A;  5DCN A;  3RUI B;  2NS5 A;  4M0W B;  3PTF C;  3T8M A;  3AI5 A;  2G4D B;  4BVU C;  2D10 A;  1XQQ A;  4AJW A;  3APF A;  3M3J A;  3M95 A;  4FJY A;  1E7U A;  5E6O A;  3PRZ A;  2KX3 A;  2KMA A;  4HVB A;  3NOB A;  2KXJ A;  2PE6 B;  3GOE A;  4IC7 B;  3DBR I;  3CF6 E;  2M4N A;  2DHZ A;  1TZ1 A;  2KVR A;  4DXA B;  1P98 A;  3ZIM A;  4URK A;  3APD A;  4HLE A;  3VTV A;  2CR5 A;  2IO1 B;  2YVC A;  4JLC A;  1V2Y A;  1WYW B;  1I42 A;  2KO3 A;  1E8Y A;  3HM6 X;  1X1M A;  2JRI B;  3VTW A;  4BBN F;  3DBS A;  3ONS A;  4BKS D;  1P3Q U;  2JWZ A;  1HE8 A;  4EKU A;  3KH0 A;  2O6V D;  3A4S C;  1RRB A;  2PJH A;  1T0Y A;  2K8B A;  3WAN A;  3P2B A;  5DPT A;  1WGY A;  4KSK C;  4EEW A;  2N9X A;  2LXC A;  4IG7 B;  1KJT A;  3VXW A;  4HDQ A;  2K39 A;  1TGZ B;  4NQK E;  4PS7 A;  3V60 A;  2L0F A;  5IA7 A;  1OEY A;  2YLM A;  4WAA A;  4IUM B;  2KWV B;  3DCG A;  1ISN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...