1WF9A

Solution structure of a novel beta-grasp fold like domain of hypothetical protein (arabidopsis thaliana)
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
107
structure length
107
Chain Sequence
GSSGSSGTMLRVRSRDGLERVSVDGPHITVSQLKTLIQDQLQIPIHNQTLSTNRNLLLAKSPSDFLAFTDMADPNLRISSLNLAHGSMVYLAYEGERTIRGSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords NPL4 family protein
publication title Solution structure of a novel beta-grasp fold like domain of Hypothetical protein (Arabidopsis thaliana)
rcsb
source organism Arabidopsis thaliana
molecule tags Structural genomics, unknown function
total genus 16
structure length 107
sequence length 107
ec nomenclature
pdb deposition date 2004-05-26
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 1wf9A00
2OOBB 2KC1A 2JY6A 4G50A 1GUAB 3RD2A 3KH0A 1V49A 1GJZA 4FHKA 1J8CA 2EMTA 5G55A 1XT9B 4XC2A 2XK5A 5IA7A 4LCDE 4TUUA 2BYEA 1YJ1A 2G45B 2KOXA 1CMXB 5D6JB 4CYEA 4DHZB 2YVCA 4OVVA 2O6VB 2AEHA 4IM2A 3W1YA 1NDDA 3PLVA 4GDKA 4G11A 4DDID 5D2MB 2GBRA 1OEYJ 3K9PB 4NAWA 3VUXA 3VQIA 1WXSA 2C60A 2C9WB 2N9PC 1OGWA 2ZVNA 4BOSC 1SGHA 3RULA 3DCGA 1YIWA 2LZ6A 1WX7A 2N9XA 2KTFA 4KZ0A 2LVPA 3QCAA 5AZGA 1UH6A 2LVQA 1RAXA 1WMHB 2KQ7A 2AL6A 2NVUI 1YQBA 1WRDB 5L95C 4NQLB 3ZDTA 1XD3B 2MLBA 4MJSB 4AJWA 3PHXB 4KSLC 4HVBA 2XBBC 2OJRA 3PZDA 1AARA 4G0NB 1P1AA 4DHZE 4DXAB 4EKUA 2KD0A 3DDCB 1E8XA 2KLGA 2KWCA 4I6NB 1V86A 3MHSD 4WJQA 4FBJB 3B0AA 3DVGX 1U4AA 2L0FA 3LJ3A 4K7WA 2KDFB 2ZPYA 4TKNA 3DBRI 2QHOA 2RSUA 4EZLA 5EDSA 2LRWA 2PE9A 2L76A 3ZKJC 1EF5A 2GBJA 3ZUNA 4FLHA 1WXAA 2K8CA 4BKGA 4HPMB 2RD0A 3MTNB 2WWZA 4W9CA 3HM6X 3VXWA 2MRPA 2CS4A 2PPHA 1VCBA 1WX8A 4KVGB 2LGYA 1LQBA 4WWPA 1YD8U 2C7NB 3SU8X 4AOFA 1OEYA 1Q1OA 3UQAA 3A1QB 2KN5A 3V61A 2JPHA 2M4NA 2FCQA 1NBFC 3V6CB 2V3SA 1E8ZA 2BYVE 3RZWC 4WWOA 3ZIMA 2N1WA 1E7UA 3RZFA 2N1VA 3AXCA 4II3B 1SIFA 3N30A 5AZFA 2KX0A 3M63B 4XZ4A 3VFKA 5IAAC 5KHQA 3EFUA 2DAJA 3OJ3A 3QAQA 4ZDVA 4DDGD 2UWQA 2RR9A 3A9JA 4HDQA 2JT4B 3KYDD 1V5OA 5TR5A 2KDBA 3PREA 5CHVC 3H6NA 3RUIB 2A5UA 3L13A 3EHVA 1EF1A 3WAPA 2BYFA 1D3ZA 2ZZPB 4ICVA 2M1MA 4ASWC 2N9EB 3APDA 4XX5A 2YLMA 1KJTA 3TMPB 3X23A 4HCNB 2JZ3B 3BINA 1GNUA 4W9EA 1E8YA 1WX9A 1WF9A 2BKFA 4GDLB 2JF5A 4IM0A 4ZRJA 3OLMD 3PRPB 4M8NA 2PEAA 2K6QA 5JHAA 3VH3B 2WX1A 3O65B 4KSKC 3VHTC 2DAFA 2IYDB 4BKSD 5CX3A 5JZEB 3KYCD 2BWFA 1BT0A 4HWIB 2KANA 2WDTB 1LFDA 2PJHA 3KUZA 3PSEB 3QHTA 2KFJA 4YL8A 3DBSA 1V9JA 3N3KB 5GMVA 4DBGA 3VTWA 3ZNGC 2D07B 2FCNA 3KW5B 4NJ7A 5DPSA 1WH3A 3Q3FA 4EOYA 2MP2A 5DPRA 3ZTDA 4EZJA 3TBLD 1WE6A 4KZCA 3AU4A 5CHWA 3PV1A 3PVLA 3GOEA 2ZJDA 1WE7A 5CHFA 2R2OA 2K39A 3ONSA 1IP9A 4JGHB 1PQSA 1I42A 4X57B 2KHWB 2MA9B 3QQ8B 4RMAA 4AUQC 2PE6B 3U30A 3L54A 1E7VA 2XEWA 3R3MA 1Q5WB 2DHZA 4NY0A 1C1YB 1T0YA 3A9KA 3SDLC 2LVOA 3JVZX 3V60A 5HKHA 2FUHB 4ZYNA 3M62B 4W9IA 3L0WB 4IW0A 2NR2A 2Z0EB 2KJHB 2REXA 4W9FA 1RFAA 2CHXA 2NBVB 3NHEB 3TJPA 4DK5A 3U8ZA 5LXIB 2J0MA 3OAWA 3HK0A 3PGEA 2A4ZA 2C5LC 3QC8B 4DHJD 5C1ZA 2D2QA 5AZHA 4FULA 3AU5A 3JYUA 3WIMA 4KIKA 4AP4C 1WJ6A 3APFA 3K9OB 1ZGUB 2C7HA 1P9DU 4A3PA 2DZJA 2DX5B 3DPDA 2GBMA 4FJVB 4PYUA 2AYOB 3HHMA 2NPTB 2HD5B 3MJWA 3H7SA 1TZ1A 3JSVA 3PPAA 3V6EB 5AEKB 3RT3B 3WAOA 4MSQB 4HXDA 3PHWB 3L10B 2MP2B 3A4SC 4MELA 3QA8A 4K1RB 5BO4B 3PLUA 3IHPC 1ISNA 4F7ZA 4TV3A 1MG8A 4I6LB 2MWSB 1C3TA 4GB9A 5DPTA 3A9KB 2XK5B 3P2BA 4JIOU 4ANWA 3PRZA 2BF8B 2KFKA 5FR6A 4GU2A 3UIPB 4E74A 2NS5A 1UZXB 4F1SA 5JHBA 3A4RA 2L05A 2AWTA 3CSTA 1LXDA 2KLCA 2KX3A 1Z2MA 2KWUB 2KWVB 3AI5A 3V62A 2G4SA 2ZPNA 2LI5A 4GDKB 4KDIC 4NAWB 2HE7A 1GC6A 3DBHI 3DVNU 3R7RA 2N7EA 2DYOA 1ZKHA 3H9DA 3NZUA 4II2B 4IG7B 2KDEB 4TQ1A 4KIKB 3ALBA 4F8CB 4EFOA 3IG3A 1RRBA 4WWNA 1S1QB 1YX5B 2KO3A 2V1YA 4EUTA 2DZMA 2N4FA 1WY8A 4BKSA 4ICUA 5C23A 3ZO5B 1M94A 3W1SC 2VRRB 3RYTA 3T8MA 3NZSA 2BPSA 2WX0A 3JSVB 3VH4B 5LXHA 3WAMA 3W1SA 3LDZE 1GG3A 3CF6E 2IZVB 1WXVA 3DQVA 3S2AA 3ZRFA 2KK8A 1FXTB 1WM3A 2JRHA 5KHOA 3SD5A 2M0XA 3UGBB 1YX6B 4KV2A 3PRMB 3L16A 5E6PA 4LDTD 1G6JA 3H7PA 2LD9A 3OJ4B 1WR6E 4FHJA 1JRUA 4LJOB 3A33B 2J0KA 1L2NA 2V4LA 4MGYE 2M17A 3EECA 5D94A 2IO2B 3KUDB 4G3XB 2KC2A 1WI0A 1WM2A 2M8SA 3L08A 4FJYA 4WJNA 3QJZA 3ZNHB 4URKA 1Q0WB 2MBEA 3KUCB 2NBWB 3N32A 4CHKA 2RGFA 3TCAA 3U7DA 1K8RB 2KXJA 4GOCA 2DZKA 4M0WB 2KTRA 4GXBA 2GBKA 3C0RB 3ZW3A 1OQYA 3Q3JA 2NBUA 2CHZA 3A9JB 4PS3A 1Z5SB 2IY0B 1WGHA 2K25A 4HLEA 2GOWA 3UQBA 1GC7A 1LM8B 2BGFA 3R7QA 2LUEA 4GN1A 3D32A 4FJZA 1IPGA 1E8WA 4MJSA 4B95A 2ZNVC 5CTRC 1L7YA 1NI2A 2K6DB 3AULA 2D3GA 2D10A 2O6VD 5E6OA 3VUYA 4HK2A 3B08A 3TIXA 2J0JA 1EO6A 1WFYA 2LXAA 3H7PB 2G4DB 3QWZB 3NY5A 3B1LX 4GIVA 2MCNB 4NJ6A 2FNJB 2ZCCA 4MM3A 2KMAA 4HCPB 4IUMB 2HTHA 2I1JA 5J17A 2Z59B 1WGYA 2Z0DB 3M95A 1RLFA 2O2VA 4FA6A 2ASQA 1WZ3A 2Y5BB 3ENEA 4NQKE 4ZRKA 3ZLZA 2CKHB 3WA0A 2EKEC 5J18A 1J19A 4A20A 1V2YA 1WIAA 1ZW7A 3PS6A 2WYQA 4W9JA 3ZNID 4N9F4 2ZCBA 4IWPA 4JQWC 3VAWA 1WJ4A 1V80A 3A1QA 4FN2A 4RM8A 3VTUA 2CHWA 1QZEA 2JUOA 1E90A 1WGRA 1WXMA 2EMSA 1UGMA 3M3JA 2KTRB 2GBNA 4MDKE 4GGQA 3GZNI 2KDIA 2D11A 1P98A 3X0WA 4DHJB 3QK0A 1X1MA 4IWQA 4IM3A 1V6EA 4K81A 2KKCA 5JH5C 3ZRCA 2KQSA 2BKRB 5LLIA 5J2RA 4I6PA 4JLCA 1WJNA 2GMIC 2G3QB 2KVRA 2NCNA 2L3ZA 4MGKE 4ANUA 3TL5A 2FAZA 2J7QB 2N7DA 4EZKA 4GMVA 4W9GA 2KJRA 2R2QA 2IO3B 1WZ0A 2IBIB 4ANXA 2BWES 3EC8A 2LWPA 4W9HA 3IFWB 4W9KA 3ZNZB 2ZNVB 4MH0E 5DCNA 3VTVA 4PS7A 3UIOB 3I3TB 2KZRA 2IO1B 3DVNV 3ECIA 4GDLA 2FIFA 3ML9A 2FCSA 3KVFB 2MQJA 3QX1A 2KNBA 3SHQA 1KM7A 1UELA 2JZZA 1S3SG 2O2VB 3BY4B 4M8MA 4W9LA 4AJYB 4ANVA 1TBEA 1F9JA 2KMCA 2ZEQA 4DWFA 2DZIA 1UBIA 4BKTA 4E3CA 1VD2A 2DYMA 1UD7A 4FADA 3VDZA 2L8JA 3PTFC 3QARA 2CU1A 3DBLI 2LJ5A 1XQQA 4RM9A 2K8HA 3HM3A 3PT2B 2MX2A 3WANA 4AWJA 1OTRB 5DPWA 1E5WA 4HDOA 1V81A 2AL3A 3L17A 2W9NA 3APCA 4MGIE 3DOWA 4W9DA 4EEWA 3DVGY 4K7UA 3QIJA 4HPLB 1SE9A 2K1FA 2RPQA 4PYZA 3HIZA 2LGXA 3ZTCA 2LGDA 2L0TA 4K7SA 3VVWB 4WJPA 4WQOB 3ZVVA 2MBHA 1A5RA 2JXXA 3R66C 3IVFA 5E6NA 4OVUA 4MEMA 2IO0B 4IC7B 1WYWB 2KFKB 4E71A 1EUVB 2DYBA 1TGZB 2JVCA 2FCMA 2L00B 2ZVOA 3CSFA 3NOBA 4JL9A 3T9LA 2B3AA 3UINB 4A3OA 1WR1A 4LJPB 2LASA 3IBEA 2IY1B 2DENB 4PS8A 1IYFA 1WGGA 2HJ8A 3WALA 2K8BA 2O6VA 2MBQA 1KLVA 4B6WA 4ZRIA 1TTNA 2UYZB 4LDTB 4NNJB 2C7MB 2L7RA 2LXCA 5D7GA 1J0GA 1R4NI 3RCZA 4J6IA 2KJ6A 4BFRA 2JWZA 2MBOA 1R4MI 3H1UA 4KDLB 2I1KA 4P7IA 3ZDMC 4MGZE 1I35A 3UF8A 3VUWA 3JW0X 2JRIB 1Y8RC 1WMHA 3ML8A 4WJOA 2MBBB 5G2NA 1WJUA 4BVUC 4IWOA 2CR5A 4CO7A 4BBNF 1P0RA 2LRUA 4HJKA 1KOTA 2FIDA 4WAAA 4BOZB 2NPTA 1V5TA 1P3QU 4TQ0A 1H8CA 1HE8A 1UBQA 4BBNC 1H4RA 4NPNA 2MSED 4GSWA 3CMMB 5L83A 2MW5A 4MSMB 1WGDA 3NS8A 4B9KA
chains in the Genus database with same CATH superfamily
2KC1A 2JY6A 1GUAB 3AH7A 1V49A 2K9XA 3L4PA 5G55A 1HQRD 3ZJTA 2V9HA 5FR3A 1YJ1A 4CYEA 1CMXB 4C00A 2E3TA 1ESFA 3KQ4A 2WXRA 3W1YA 4NAWA 2AQ2B 3EA6A 4R3DA 3TUOA 2C9WB 1OGWA 1SGHA 5E6JA 3T3OA 1WX7A 2N9XA 2QJLA 4YT0B 4KZ0A 3QCAA 2D3AA 5AZGA 1RAXA 2WXFA 4LNFA 2KQ7A 2IJ0A 5GXGB 2BQQA 3ZDTA 3H8HA 4MJSB 3SEBA 1N63A 1QOAA 3AEAB 4EKUA 1J7CA 2KD0A 2V4IB 2Z8LA 1QILA 2KLGA 1TZOA 1V86A 3MHSD 3LJ3A 4MM3B 2IDYA 2E6XA 2LRWA 2L76A 3ZKJC 3ZUNA 2IGGA 2K8CA 4BKGA 4YSXB 2RD0A 2ZW1A 4W9CA 2MRPA 2CS4A 3BYTB 4MH8A 1VCBA 1WX8A 1SEBD 4LNKA 3A1QB 2JPHA 2FCQA 3ZIMA 2CU3A 1E7UA 3AXCA 5AZFA 2QDFA 3EFCA 3VFKA 5KHQA 1HA5A 2RR9A 2JT4B 2KDBA 3H6NA 3RUIB 2A5UA 4OVZA 2WXQA 4ASWC 4XX5A 1WX9A 4A90A 3AE1B 4GDLB 2JWUA 1F2RC 1WYGA 1D5ZC 1C76A 2JSVX 4GLSC 5CX3A 3KYCD 3RN9C 2BWFA 1IBXB 3KUZA 1V97A 2FCNA 4BZAA 4P1BC 3E56A 1WE6A 3IAM1 3PZ8A 3TBLD 3PV1A 3GOEA 5BMIA 2N9KA 5G5GA 4CQNA 3IT4B 1C4CA 3L54A 3BIID 1T0YA 2LVOA 3Q8EA 3V60A 4ZYNA 2REXA 4ZHPA 2BS3B 4W9FA 2NBVB 4DK5A 3U8ZA 3PGEA 2OJWA 4N59A 4DHJD 1L6VA 4YTNB 5AZHA 3AU5A 3JYUA 3WIMA 4KIKA 4YXDB 1TS2A 1AN8A 4A3PA 2DX5B 2GBMA 3C8YA 3MJWA 3TEYA 3H7SA 3JSVA 3V6EB 4A8XC 3PHWB 4XWTA 3DBHB 1PYWD 2INCC 3PO0A 2NMQA 1OQQA 1VZ6A 2PKOA 4ITKA 2BF8B 2AWTA 2KWVB 2KWUB 4WWMA 1FD6A 2LI5A 1GC6A 3DVNU 4Q2JA 2DYOA 3H9DA 2OEDA 4KIKB 1WSPA 3IG3A 1RRBA 4OZCA 2KO3A 4EUTA 1EU3A 4OZBA 4AS1A 1C77A 1PGBA 1N61A 2WX0A 3JSVB 5LXHA 3WAMA 1GG3A 2IZVB 2Y5PA 3S2AA 2KK8A 2MJ3A 4KV2A 4LDTD 2IPKD 2LD9A 1TT5B 1JRUA 2BB5A 3BYYB 1UF0A 1STEA 2RDHA 4DQOC 2M17A 2EELA 4BAXA 2WHIA 4TMAB 3B9JA 2IO2B 2WQYB 5IKCM 4FJYA 3QJZA 1EWYC 1ET9A 1I4GA 2V3NA 5FK9C 3ZNHB 4C80A 4URKA 3TCAA 3U7DA 4M0WB 2GBKA 3BVZA 2K5PA 2CHZA 2D3BA 1SJED 1HZ5A 1Z5SB 2IY0B 4HLEA 2GOWA 3AE9B 2FUG1 2KAJA 4FXCA 2L1AA 4M00A 4FJZA 1FRRA 1MPEA 2ZNVC 3AULA 1YN3A 1IGDA 5EE1A 3TIXA 2CJOA 1EO6A 3QWZB 2G4DB 3NY5A 1SJHD 3U2SC 2HTHA 3NVZA 3VRAB 1FXAA 1E7PB 2CKHB 3WA0A 2EKEC 2LHEA 1J19A 3OWEB 2ZW0A 2RDBC 2PVOD 1JWMD 1V80A 3DWMA 1KLUD 3M3JA 4MDKE 3X0WA 3QK0A 2KN4A 4IWQA 4IM3A 2KKCA 4XWWA 5JH5C 2IGDA 1QF6A 2G3QB 2KVRA 4ANUA 4MGKE 3DBLB 2R2QA 4KX6B 2PTLA 3HUIA 4W9HA 1NI3A 3ZNZB 2K3UA 3UIOB 3AE6B 2FCSA 3KVFB 3QX1A 3SHQA 1FXIA 2JZZA 4M8MA 4LTUA 2KMCA 1RYJA 4E3CA 2WXOA 3PTFC 1FO4A 1I7HA 1XQQA 3HM3A 3PT2B 5AUKA 3W2DA 1WWTA 1NENB 1A70A 4RF0A 2AL3A 4W9DA 3DOWA 3DHIC 3U4EG 3ABVB 2WXKA 4WJPA 1MHHE 2MBHA 1A5RA 3RNGC 1WYWB 2L00B 2MHJA 2B3AA 1I4HA 1KFYB 1XLPA 4K3BA 3MHZA 3IBEA 2IY1B 3GB1A 2ON8A 2K8BA 2O6VA 1JALA 1KLVA 1L4DB 1TTNA 2JYEA 5D7GA 1J0GA 3RCZA 4J6IA 2KJ6A 4YWGG 3Q3NC 3RMKC 3RNAC 3O13A 4P7IA 3ZDMC 3NVWA 3VUWA 3JW0X 1WMHA 2MBBB 3NUHB 1BXTA 1WJUA 4BVUC 4JWUC 4CO7A 2TSSA 2LRUA 1V5TA 4TQ0A 1HE8A 4A55A 1L6UA 3AEGB 2MSED 2RDGA 4WAFA 3CMMB 4MSMB 4G50A 3KH0A 1J8CA 3SFEB 1TJEA 4XC2A 2H89B 2HTME 2BBCA 2XK5A 4TUUA 2BYEA 5D6JB 3P42A 3AB5A 2O6VB 3V05A 3Q69A 4DDID 4LNNA 2GBRA 5D2MB 3VUXA 1YN4A 2N9PC 3RULA 1L0YB 1YIWA 1ENFA 4RNAA 1GOZA 4C7YA 1UH6A 1KTKA 1WMHB 2AL6A 1YQBA 1FFUA 1TS3A 2MLBA 3Q8BA 4AJWA 3PHXB 4KSLC 4HVBA 1DOXA 2PLPA 4DXAB 2WLBA 4LK0M 2KWCA 4FBJB 1U4AA 1T0QC 3ZXVA 4RH6A 1KF6B 2KDFB 3DBRI 2QHOA 1D5XC 2LGIA 1JMLA 3VR9B 4HPMB 3VXWA 2WWZA 3HM6X 2PPHA 4KVGB 1DOYA 1YD8U 2C7NB 4AOFA 1OEYA 1Q1OA 3UQAA 2KN5A 4A9AA 1NBFC 1E8ZA 4RFBA 4KKJA 3I5JC 3RZFA 2N1VA 3J9CA 4II3B 3M63B 5IAAC 2J53A 4ZDVA 2B76B 2NTSA 4HDQA 4XGAB 3KYDD 2BW2A 2ICIA 5CHVC 1JWBD 1SXTA 3L13A 3WAPA 3WCQA 2MEKA 2RPVA 2ZZPB 4ICVA 2M1MA 1ET6A 2N9EB 2JU6X 3APDA 3LXFA 3TMPB 1KJTA 3GP7A 4HCNB 1GAQB 2JZ3B 3BINA 1GNUA 1K51A 2JF5A 3OLMD 3PRPB 2PEAA 2G9HD 2L52A 3VH3B 3O65B 3Q14C 3VHTC 1BMLC 2IYDB 5H8YE 1BT0A 2KANA 1JROA 3N3KB 3VTWA 3ZJUA 2N9LA 3KW5B 5DPSA 3ONSA 4X57B 1Q5WB 1QOGA 3AE4B 4XDDA 2NR2A 3NHEB 4ZYSA 3GZNB 5LXIB 3OAWA 1XXGA 2WXLA 1SSNA 4FULA 4AP4C 3APFA 1ZGUB 1VZ8A 3I9V1 1ZXIA 3DPDA 2BVCA 1HTQA 3HRDD 2NPTB 2HD5B 3PPAA 4MSQB 3L10B 4NAMA 2KVZA 1UUPA 2DNFA 1E9MA 3MJ5A 2KYWA 1L5PA 1DOIA 3SR6A 3PLUA 3IHPC 5BYQA 1TY2A 1UGJA 5MPOA 1C3TA 2KFKA 1Y56A 4EE2A 5JHBA 2L05A 2KLCA 2R61A 3AI5A 1Z2MA 3RNFC 2G4SA 1ZXHA 2ZPNA 1YN5A 1TY0A 1L0VB 4NAWB 3DBHI 4JX1C 4II2B 4TQ1A 2KDEB 2GI9A 4KKIA 3AE7B 2DZMA 1C9FA 5C23A 2VZKD 3ZO5B 3RYTA 3T8MA 2INNE 3VH4B 1GPXA 3NZ3A 1Q10A 3HVDA 1WXVA 3ZRFA 3AV8A 3SD5A 3UGBB 2JRHA 5BYRA 3L16A 2WXHA 2UU7A 1JCKB 3RI7C 3TEXA 4LJOB 5IO9A 5C2TB 1GB4A 2YEPB 2GRIA 1VRAB 1I4RA 5D94A 3AEBB 5BMHA 2KC2A 4HJGE 3L08A 4CHKA 4P6VF 3P4RB 4GOCA 4YTMB 4GXBA 1YJJA 3C0RB 3ZW3A 3Q3JA 2WXGA 1B1ZA 3P63A 1TYGB 3MFGA 5C3JB 3B2GA 1T6BX 2QMTA 3DHHC 5HG2A 1JRPA 1LM8B 3R7QA 3D32A 1E8WA 3KLSX 1FPYA 2O6VD 4HK2A 5TSSA 4GIVA 2MCNB 3B1LX 4NJ6A 2FNJB 2ZCCA 3Q2AC 2KMAA 4IUMB 2I1JA 2WNMA 3M95A 4FA6A 1FNUA 1F1HA 4NQKE 3DHGC 3P1MA 1HEZE 3AEFB 5J18A 2WYQA 2WGSA 2X38A 4IWPA 3VAWA 2SEBD 4RF1A 2AX5A 1WJ4A 4C56C 3BK1A 3B2FA 3VTUA 2CHWA 1QZEA 1M4VA 1WXMA 2LFIA 3URYA 2KDIA 1P98A 1QQRA 1V6EA 3ZRCA 5LLIA 4REZA 1FCCC 4I6PA 2LHDA 2LGSA 2L3ZA 4WURA 5EE9A 4W9GA 3Q3MC 2IO3B 4L2YA 2BWES 5JXVA 2ZNVB 2M0AA 4PS7A 1VDVA 3PZ7A 2WXPA 2KZRA 2FIFA 4RCOA 1DGJA 4W9LA 4ANVA 1KH0A 1TBEA 4HPPA 1CJEA 2ZEQA 4BKTA 2GLSA 1VD2A 3VDZA 3QARA 3DBLI 1P7EA 1SE3A 4AWJA 2AQ3B 1OTRB 5DPWA 3L17A 4MGIE 5EE0A 3HIZA 3ZTCA 4RGMA 1R4MB 2L0TA 3VVWB 1NYQA 1F77A 2J42A 3IVFA 3NVVA 4IC7B 4RGOS 4JL9A 1TKYA 2FCMA 3CSFA 2ZVOA 1XLNA 2BYTA 1FCLA 4LJPB 4PS8A 2D5GA 1HXYD 4KGRA 3BK2A 2UYZB 4DXFA 2LXCA 1C78A 3NRZA 2JRIB 4WJOA 3Q8CA 4IWOA 1ROEA 1KOTA 1YQ3B 2FIDA 2BB6A 4BOZB 1OQRA 1P3QU 2RMMA 1UBQA 1UWXA 4RGNA 3NS8A 1FMAD 4ZRQA 3RD2A 1GJZA 2EKIA 1FFVA 5IA7A 2KOXA 4HKQA 4DHZB 1QKZA 1PGAA 2YVCA 2AEHA 1NDDA 3PLVA 4GDKA 1SB3C 3K9PB 1OEYJ 3VQIA 2BT6A 1WXSA 2C60A 2LJIA 2Y5CA 4BOSC 3DCGA 2LZ6A 1LO5D 2LVPA 1J7AA 4OHJA 2NVUI 4NQLB 1XD3B 1JWUD 3MC9A 2OJRA 3PZDA 1AARA 4G0NB 2Y3AA 3DDCB 3I57A 1E8XA 1XCTL 1F0ZA 4I6NB 1N5WA 5EE3A 1MHXA 3KWVA 2RSUA 4EZLA 2PE9A 4A6QA 1EF5A 4HKZE 1WXAA 4IDIA 1P7FA 3SU8X 5LNK1 3AEDB 2V3PA 1XLQA 2M4NA 4OW0A 1WGKA 3V6CB 2BYVE 3GE8C 1SF0A 3N30A 1SE4A 4XZ4A 3OJ3A 1ACCA 3A9JA 2W82A 1V5OA 5TR5A 2IGHA 2VZKB 3N20C 3AE5B 4LLGM 3EHVA 1EF1A 2BYFA 1D3ZA 2YLMA 4L1BA 1E8YA 2L32A 2QC8A 1N5XA 1WF9A 2BKFA 4IM0A 5IP4D 4M8NA 2K6QA 4ACFA 2KWDA 3NG0A 4JWSC 2WDTB 1LFDA 3PSEB 2ACZB 3DBSA 1AYFA 4O1NA 1EM7A 1V9JA 1UNSA 2D07B 3GS2A 1WH3A 3Q3FA 4EOYA 2MP2A 5DPRA 3ZTDA 4EZJA 4KZCA 3AU4A 5CHWA 3PVLA 4MT5A 5CHFA 4JGHB 4KGTA 1PQSA 1I42A 2KHWB 3QQ8B 1K53A 3U30A 1E7VA 2XEWA 1N60A 2DHZA 2NTTA 1C1YB 4NY0A 3JVZX 3M62B 3P4PB 3L0WB 4IW0A 2Z0EB 3IAS1 1RFAA 2W3RA 3HK0A 5HFYA 2C5LC 3QC8B 5C1ZA 1XEEA 1WJ6A 3K9OB 1XF5L 3CWIA 2DZJA 3AE3B 3NVYA 5D3DA 4FJVB 4PYUA 3HHMA 3ZQ4A 1TZ1A 5AEKB 4HXDA 1FNVA 2MP2B 3A4SC 4MELA 1JWAD 1KLGD 4K1RB 2J52A 2WDVB 1ISNA 4F7ZA 3SFDB 2MWSB 5DPTA 4PK1A 3P2BA 2XK5B 4JIOU 4ANWA 5FR6A 1YMHE 2FBWB 3R2TA 4E74A 1UZXB 1V8CA 4HROA 4AQ7A 5T8IA 2N7EA 1ZKHA 3NZUA 3V3XA 3LYYA 2PW9A 1DYQA 4P1CC 3NJTA 2BTEA 4M01A 4BKSA 4ICUA 3AECB 1M94A 3T3NA 3W1SC 3I63C 3NZSA 2BPSA 2I38A 3CF6E 3DQVA 1WM3A 1YX6B 4NJCA 4TSSA 1G6JA 4C4VA 2OHFA 3H7PA 3N1ZC 3W5VB 3OJ4B 4KGSA 4JE3B 2M19A 2WP9B 2J0KA 3UI3A 1IUEA 2SAKA 3VRBB 1NEKB 1WI0A 4B0EA 2M8SA 3KUCB 2NBWB 2LMCA 2KTRA 2WU5B 2JX5A 3IXSA 1AWDA 1T5XD 2NBUA 2J4XA 2QILA 4S0RA 3FAHA 1WGHA 2K25A 2KDMA 1XCQL 3UQBA 1VJKA 1I4PA 4GN1A 4MJSA 1CQVA 4B95A 5CTRC 1E10A 1RFKA 2D3GA 4US9A 2DBYA 2K22A 3B08A 1VLBA 3N1XC 2J0JA 4C4VB 2LXAA 3H7PB 4MM3A 2N7JA 1ZDXA 2Z0DB 2ASQA 2Y5BB 4ZRKA 3ZXRA 3ZLZA 1UWMA 1TKGA 3PS6A 4W9JA 3ZNID 4N9F4 2ZCBA 4JQWC 3MC8A 3A1QA 5FKAC 4H2AA 4FN2A 2JUOA 1JW9D 1V1OA 1WGRA 2EMSA 1UGMA 2KTRB 4GGQA 3DBRB 1TS5A 4K81A 2KQSA 1V1PA 5J2RA 4JPSA 2QSDA 3FC4A 2J7QB 4EZKA 1JWSD 4GMVA 2QIEB 4WQMA 2WXJA 2IBIB 3EC8A 2LWPA 5HHDG 4W9KA 1T3QA 3VTVA 3I3TB 2IO1B 4GDLA 2LUMA 1ZUD2 2KNBA 1KM7A 2FE8A 3BY4B 5BYSA 2WXMA 4DWFA 2H88B 1C4PA 1UBIA 2DYMA 1UD7A 4L23A 1IBXA 2CU1A 3Q8AA 2W55A 4RM9A 2K8HA 2MX2A 3WANA 2JYTA 1ZOYB 2W9NA 1EU4A 3APCA 4K7UA 3DVGY 1R4NB 4HPLB 2K1FA 2RPQA 4PYZA 2LGXA 4K7SA 1V1PB 1MFWA 1QT9A 2JXXA 2XNAC 3RNEC 2MJEA 2IO0B 2KFKB 4E71A 1EUVB 3NOBA 2WDQB 1TGZB 1FM0D 2DYBA 3T9LA 4A3OA 1WR1A 1WGGA 3WALA 3W9CB 2HDEA 4B6WA 4ZRIA 1YNTE 2L7RA 3ZJVA 1PUTA 2MBOA 1R4MI 3BWUD 3H1UA 2I1KA 3AEEB 1I35A 3UF8A 1TKEA 5G2NA 1Y8RC 1FEHA 3N9YC 2CR5A 4S17A 1NVID 4BBNF 4HJKA 1FIQA 1SIJA 1GB1A 3W5UB 1H4RA 2OOBB 4FHKA 2EMTA 1XT9B 5I4DA 4LCDE 2G45B 3KWLA 4NZLB 4WH4A 2PIAA 4OVVA 4IM2A 4G11A 2QEJC 3AMZA 2ZVNA 4YTPB 2KTFA 3BVMA 1RWSA 2LVQA 2L83A 1VR9A 1WRDB 5L95C 1SE2A 4N6EB 2XBBC 3VR8B 3RNBC 1P1AA 4DHZE 4HRSA 4WJQA 4PT5A 3B0AA 3DVGX 1RM6C 3N1YC 2L0FA 4K7WA 2ZPYA 4TKNA 1TIFA 5EDSA 3E9SA 1CK1A 1N6ZA 2GBJA 4FLHA 2I2YA 4HEA1 2AQ1B 3MTNB 4WWPA 2LGYA 1LQBA 3EGRA 4D2KA 1K52A 3V61A 1NYRA 2V3SA 2Q5WD 3RZWC 4WWOA 2N1WA 4K3CA 1SIFA 4M0WA 2KX0A 1XLOA 4YSYB 3EFUA 2DAJA 3QAQA 4DDGD 2MJDA 2UWQA 1D4BA 2D3CA 4ZHOA 3PREA 1EWCA 1FRDA 2INPE 2KACA 3LB8C 3X23A 2MH7A 1MVKA 3ZGZA 4W9EA 2ONQA 5D3IB 2WXIA 3CIRB 4ZRJA 3RNCC 5JHAA 3OG5A 2WX1A 2DAFA 1F52A 4ZOHC 4BKSD 5JZEB 4WIPA 3RPFC 2M56B 4HWIB 3AE2B 2PJHA 1VZ7A 3QHTA 2KFJA 4YL8A 1B9RA 5GMVA 4DBGA 3ZNGC 3BZDB 1E6EB 4NJ7A 4DXGA 5IN7A 2LEKA 2ZJDA 1WE7A 5G5HA 2JXTA 2R2OA 2K39A 1IP9A 1ZPSA 2G1EA 2MA9B 1SBBB 4RMAA 4LNOA 4AUQC 2PE6B 3R3MA 3SDLC 3Q6BA 3A9KA 5HKHA 1PGXA 2FUHB 3Q3OC 1TS4A 4W9IA 3TSSA 2KJHB 2CHXA 3TJPA 2K0PA 2J0MA 3BVGA 2A4ZA 3MC0B 4LNIA 4M02A 2D2QA 2JZPA 2WXNA 4US8A 4YSZB 2C7HA 1P9DU 1AW7A 2GB1A 2AYOB 1HZ6A 3HVZA 3RT3B 2HJ1A 3WAOA 2YEPF 3QA8A 4ZRPA 5BO4B 3R2IA 1QOBA 4TV3A 1MG8A 4I6LB 4GB9A 3A9KB 3PRZA 1BUIC 4GU2A 3UIPB 1I4QA 2NS5A 4F1SA 3A4RA 4HDOA 3CSTA 1LXDA 3V62A 2KX3A 4KDIC 4GDKB 3R8BA 2X8XX 3C19A 2HE7A 3ZYYX 3R7RA 4IG7B 4RGTA 4XE0A 3ALBA 4F8CB 4EFOA 4WWNA 1S1QB 3FKYA 1E0ZA 4ARIA 1YX5B 2V1YA 2N4FA 2V0GA 1WY8A 4USAA 2VRRB 3W1SA 3LDZE 4IOIE 1T0SC 3EUB2 1FXTB 5KHOA 2M0XA 3PRMB 5E6PA 1C79A 4MACA 1XO3A 1WR6E 4FHJA 1D5MC 3A33B 1L2NA 4P16A 2V4LA 4MGYE 1ZDVA 3EECA 3KUDB 4G3XB 1WM2A 4WJNA 4XYCA 1Q0WB 2MBEA 3N32A 2RGFA 1IGCA 1K8RB 2KXJA 2DZKA 1OQYA 3DWGC 3U52E 3A9JB 4PS3A 4B0MA 3GE3C 2KMMA 1GC7A 1MJDA 2KT7A 2BGFA 2LUEA 1IPGA 1L7YA 1NI2A 1C4AA 2K6DB 2W54A 1WXQA 1WRIA 2D10A 5E6OA 3VUYA 1OFFA 1ZP0B 4OZAA 4KSKC 1WFYA 2VH2A 4HCPB 2INDC 5J17A 2Z59B 1WGYA 1D6EC 1RLFA 1QLBB 2O2VA 1WZ3A 3ENEA 1YJIA 1MI0A 4A20A 1V2YA 1WIAA 1ZW7A 2PMVA 4UDUC 4RM8A 5IOIA 4N58A 1E90A 2GBNA 3GZNI 3AE8B 2WDRB 2D11A 4DHJB 1L0XB 1X1MA 5H92C 1QOFA 2BKRB 1F2RI 4JLCA 2BS2B 1WJNA 2GMIC 2N0SB 2NCNA 2W3SA 2QCZA 3TL5A 2FAZA 2N7DA 2KJRA 1WZ0A 1YOVB 4ANXA 1YQ4B 2WS3B 3IFWB 4MH0E 5DCNA 2JQRB 3DVNV 3ECIA 3ML9A 2MQJA 1JQ4A 1UELA 2O2VB 1S3SG 4AJYB 1F9JA 2DLBA 1PDXA 2DZIA 2VH1A 1KRHA 3ETRA 4FADA 2L8JA 1ZE3D 2LJ5A 3FILA 1K50A 4XDCA 2BS4B 1E5WA 1V81A 3P4QB 4EEWA 3IT6B 2KQ4X 1MG4A 3QIJA 1SE9A 3P4SB 2LGDA 4WQOB 3ZVVA 3MP9A 3R66C 5E6NA 4OVUA 4MEMA 3U7ZA 2PVGC 1FNWA 4IKGA 2JVCA 3UINB 1HTOA 1L4ZB 2LASA 1IYFA 2DENB 4J3OD 2HJ8A 4QAYA 1N62A 2MBQA 3TEWA 4LDTB 4NNJB 2C7MB 4C7ZA 1R4NI 2CJNA 4BFRA 2JWZA 3TEZA 1J7BA 4KDLB 1LGRA 3NS1A 5BMGA 4MGZE 1PFDA 3Q8FA 3ML8A 3AM9A 2XN9C 1R7SA 1CZPA 3FILB 1P0RA 1T0RC 4WAAA 4ARCA 2WU2B 2NPTA 1H8CA 2DWQA 3RFZB 4BBNC 4NPNA 3AN1A 1I4XA 4GSWA 5AUIA 5HI1A 5L83A 2MW5A 1WGDA 4B9KA
chains in the Genus database with same CATH topology
2OOBB 2KC1A 2JY6A 4G50A 1GUAB 3RD2A 3KH0A 1V49A 1GJZA 4FHKA 1J8CA 2EMTA 5G55A 1XT9B 4XC2A 2XK5A 5IA7A 4LCDE 4TUUA 2BYEA 1YJ1A 2G45B 2KOXA 1CMXB 5D6JB 4CYEA 4DHZB 2YVCA 4OVVA 2O6VB 2AEHA 4IM2A 3W1YA 1NDDA 3PLVA 4GDKA 4G11A 4DDID 5D2MB 2GBRA 1OEYJ 3K9PB 4NAWA 3VUXA 3VQIA 1WXSA 2C60A 2C9WB 2N9PC 1OGWA 2ZVNA 4BOSC 1SGHA 3RULA 3DCGA 1YIWA 2LZ6A 1WX7A 2N9XA 2KTFA 4KZ0A 2LVPA 3QCAA 5AZGA 1UH6A 2LVQA 1RAXA 1WMHB 2KQ7A 2AL6A 2NVUI 1YQBA 1WRDB 5L95C 4NQLB 3ZDTA 1XD3B 2MLBA 4MJSB 4AJWA 3PHXB 4KSLC 4HVBA 2XBBC 2OJRA 3PZDA 1AARA 4G0NB 1P1AA 4DHZE 4DXAB 4EKUA 2KD0A 3DDCB 1E8XA 2KLGA 2KWCA 4I6NB 1V86A 3MHSD 4WJQA 4FBJB 3B0AA 3DVGX 1U4AA 2L0FA 3LJ3A 4K7WA 2KDFB 2ZPYA 4TKNA 3DBRI 2QHOA 2RSUA 4EZLA 5EDSA 2LRWA 2PE9A 2L76A 3ZKJC 1EF5A 2GBJA 3ZUNA 4FLHA 1WXAA 2K8CA 4BKGA 4HPMB 2RD0A 3MTNB 2WWZA 4W9CA 3HM6X 3VXWA 2MRPA 2CS4A 2PPHA 1VCBA 1WX8A 4KVGB 2LGYA 1LQBA 4WWPA 1YD8U 2C7NB 3SU8X 4AOFA 1OEYA 1Q1OA 3UQAA 3A1QB 2KN5A 3V61A 2JPHA 2M4NA 2FCQA 1NBFC 3V6CB 2V3SA 1E8ZA 2BYVE 3RZWC 4WWOA 3ZIMA 2N1WA 1E7UA 3RZFA 2N1VA 3AXCA 4II3B 1SIFA 3N30A 5AZFA 2KX0A 3M63B 4XZ4A 3VFKA 5IAAC 5KHQA 3EFUA 2DAJA 3OJ3A 3QAQA 4ZDVA 4DDGD 2UWQA 2RR9A 3A9JA 4HDQA 2JT4B 3KYDD 1V5OA 5TR5A 2KDBA 3PREA 5CHVC 3H6NA 3RUIB 2A5UA 3L13A 3EHVA 1EF1A 3WAPA 2BYFA 1D3ZA 2ZZPB 4ICVA 2M1MA 4ASWC 2N9EB 3APDA 4XX5A 2YLMA 1KJTA 3TMPB 3X23A 4HCNB 2JZ3B 3BINA 1GNUA 4W9EA 1E8YA 1WX9A 1WF9A 2BKFA 4GDLB 2JF5A 4IM0A 4ZRJA 3OLMD 3PRPB 4M8NA 2PEAA 2K6QA 5JHAA 3VH3B 2WX1A 3O65B 4KSKC 3VHTC 2DAFA 2IYDB 4BKSD 5CX3A 5JZEB 3KYCD 2BWFA 1BT0A 4HWIB 2KANA 2WDTB 1LFDA 2PJHA 3KUZA 3PSEB 3QHTA 2KFJA 4YL8A 3DBSA 1V9JA 3N3KB 5GMVA 4DBGA 3VTWA 3ZNGC 2D07B 2FCNA 3KW5B 4NJ7A 5DPSA 1WH3A 3Q3FA 4EOYA 2MP2A 5DPRA 3ZTDA 4EZJA 3TBLD 1WE6A 4KZCA 3AU4A 5CHWA 3PV1A 3PVLA 3GOEA 2ZJDA 1WE7A 5CHFA 2R2OA 2K39A 3ONSA 1IP9A 4JGHB 1PQSA 1I42A 4X57B 2KHWB 2MA9B 3QQ8B 4RMAA 4AUQC 2PE6B 3U30A 3L54A 1E7VA 2XEWA 3R3MA 1Q5WB 2DHZA 4NY0A 1C1YB 1T0YA 3A9KA 3SDLC 2LVOA 3JVZX 3V60A 5HKHA 2FUHB 4ZYNA 3M62B 4W9IA 3L0WB 4IW0A 2NR2A 2Z0EB 2KJHB 2REXA 4W9FA 1RFAA 2CHXA 2NBVB 3NHEB 3TJPA 4DK5A 3U8ZA 5LXIB 2J0MA 3OAWA 3HK0A 3PGEA 2A4ZA 2C5LC 3QC8B 4DHJD 5C1ZA 2D2QA 5AZHA 4FULA 3AU5A 3JYUA 3WIMA 4KIKA 4AP4C 1WJ6A 3APFA 3K9OB 1ZGUB 2C7HA 1P9DU 4A3PA 2DZJA 2DX5B 3DPDA 2GBMA 4FJVB 4PYUA 2AYOB 3HHMA 2NPTB 2HD5B 3MJWA 3H7SA 1TZ1A 3JSVA 3PPAA 3V6EB 5AEKB 3RT3B 3WAOA 4MSQB 4HXDA 3PHWB 3L10B 2MP2B 3A4SC 4MELA 3QA8A 4K1RB 5BO4B 3PLUA 3IHPC 1ISNA 4F7ZA 4TV3A 1MG8A 4I6LB 2MWSB 1C3TA 4GB9A 5DPTA 3A9KB 2XK5B 3P2BA 4JIOU 4ANWA 3PRZA 2BF8B 2KFKA 5FR6A 4GU2A 3UIPB 4E74A 2NS5A 1UZXB 4F1SA 5JHBA 3A4RA 2L05A 2AWTA 3CSTA 1LXDA 2KLCA 2KX3A 1Z2MA 2KWUB 2KWVB 3AI5A 3V62A 2G4SA 2ZPNA 2LI5A 4GDKB 4KDIC 4NAWB 2HE7A 1GC6A 3DBHI 3DVNU 3R7RA 2N7EA 2DYOA 1ZKHA 3H9DA 3NZUA 4II2B 4IG7B 2KDEB 4TQ1A 4KIKB 3ALBA 4F8CB 4EFOA 3IG3A 1RRBA 4WWNA 1S1QB 1YX5B 2KO3A 2V1YA 4EUTA 2DZMA 2N4FA 1WY8A 4BKSA 4ICUA 5C23A 3ZO5B 1M94A 3W1SC 2VRRB 3RYTA 3T8MA 3NZSA 2BPSA 2WX0A 3JSVB 3VH4B 5LXHA 3WAMA 3W1SA 3LDZE 1GG3A 3CF6E 2IZVB 1WXVA 3DQVA 3S2AA 3ZRFA 2KK8A 1FXTB 1WM3A 2JRHA 5KHOA 3SD5A 2M0XA 3UGBB 1YX6B 4KV2A 3PRMB 3L16A 5E6PA 4LDTD 1G6JA 3H7PA 2LD9A 3OJ4B 1WR6E 4FHJA 1JRUA 4LJOB 3A33B 2J0KA 1L2NA 2V4LA 4MGYE 2M17A 3EECA 5D94A 2IO2B 3KUDB 4G3XB 2KC2A 1WI0A 1WM2A 2M8SA 3L08A 4FJYA 4WJNA 3QJZA 3ZNHB 4URKA 1Q0WB 2MBEA 3KUCB 2NBWB 3N32A 4CHKA 2RGFA 3TCAA 3U7DA 1K8RB 2KXJA 4GOCA 2DZKA 4M0WB 2KTRA 4GXBA 2GBKA 3C0RB 3ZW3A 1OQYA 3Q3JA 2NBUA 2CHZA 3A9JB 4PS3A 1Z5SB 2IY0B 1WGHA 2K25A 4HLEA 2GOWA 3UQBA 1GC7A 1LM8B 2BGFA 3R7QA 2LUEA 4GN1A 3D32A 4FJZA 1IPGA 1E8WA 4MJSA 4B95A 2ZNVC 5CTRC 1L7YA 1NI2A 2K6DB 3AULA 2D3GA 2D10A 2O6VD 5E6OA 3VUYA 4HK2A 3B08A 3TIXA 2J0JA 1EO6A 1WFYA 2LXAA 3H7PB 2G4DB 3QWZB 3NY5A 3B1LX 4GIVA 2MCNB 4NJ6A 2FNJB 2ZCCA 4MM3A 2KMAA 4HCPB 4IUMB 2HTHA 2I1JA 5J17A 2Z59B 1WGYA 2Z0DB 3M95A 1RLFA 2O2VA 4FA6A 2ASQA 1WZ3A 2Y5BB 3ENEA 4NQKE 4ZRKA 3ZLZA 2CKHB 3WA0A 2EKEC 5J18A 1J19A 4A20A 1V2YA 1WIAA 1ZW7A 3PS6A 2WYQA 4W9JA 3ZNID 4N9F4 2ZCBA 4IWPA 4JQWC 3VAWA 1WJ4A 1V80A 3A1QA 4FN2A 4RM8A 3VTUA 2CHWA 1QZEA 2JUOA 1E90A 1WGRA 1WXMA 2EMSA 1UGMA 3M3JA 2KTRB 2GBNA 4MDKE 4GGQA 3GZNI 2KDIA 2D11A 1P98A 3X0WA 4DHJB 3QK0A 1X1MA 4IWQA 4IM3A 1V6EA 4K81A 2KKCA 5JH5C 3ZRCA 2KQSA 2BKRB 5LLIA 5J2RA 4I6PA 4JLCA 1WJNA 2GMIC 2G3QB 2KVRA 2NCNA 2L3ZA 4MGKE 4ANUA 3TL5A 2FAZA 2J7QB 2N7DA 4EZKA 4GMVA 4W9GA 2KJRA 2R2QA 2IO3B 1WZ0A 2IBIB 4ANXA 2BWES 3EC8A 2LWPA 4W9HA 3IFWB 4W9KA 3ZNZB 2ZNVB 4MH0E 5DCNA 3VTVA 4PS7A 3UIOB 3I3TB 2KZRA 2IO1B 3DVNV 3ECIA 4GDLA 2FIFA 3ML9A 2FCSA 3KVFB 2MQJA 3QX1A 2KNBA 3SHQA 1KM7A 1UELA 2JZZA 1S3SG 2O2VB 3BY4B 4M8MA 4W9LA 4AJYB 4ANVA 1TBEA 1F9JA 2KMCA 2ZEQA 4DWFA 2DZIA 1UBIA 4BKTA 4E3CA 1VD2A 2DYMA 1UD7A 4FADA 3VDZA 2L8JA 3PTFC 3QARA 2CU1A 3DBLI 2LJ5A 1XQQA 4RM9A 2K8HA 3HM3A 3PT2B 2MX2A 3WANA 4AWJA 1OTRB 5DPWA 1E5WA 4HDOA 1V81A 2AL3A 3L17A 2W9NA 3APCA 4MGIE 3DOWA 4W9DA 4EEWA 3DVGY 4K7UA 3QIJA 4HPLB 1SE9A 2K1FA 2RPQA 4PYZA 3HIZA 2LGXA 3ZTCA 2LGDA 2L0TA 4K7SA 3VVWB 4WJPA 4WQOB 3ZVVA 2MBHA 1A5RA 2JXXA 3R66C 3IVFA 5E6NA 4OVUA 4MEMA 2IO0B 4IC7B 1WYWB 2KFKB 4E71A 1EUVB 2DYBA 1TGZB 2JVCA 2FCMA 2L00B 2ZVOA 3CSFA 3NOBA 4JL9A 3T9LA 2B3AA 3UINB 4A3OA 1WR1A 4LJPB 2LASA 3IBEA 2IY1B 2DENB 4PS8A 1IYFA 1WGGA 2HJ8A 3WALA 2K8BA 2O6VA 2MBQA 1KLVA 4B6WA 4ZRIA 1TTNA 2UYZB 4LDTB 4NNJB 2C7MB 2L7RA 2LXCA 5D7GA 1J0GA 1R4NI 3RCZA 4J6IA 2KJ6A 4BFRA 2JWZA 2MBOA 1R4MI 3H1UA 4KDLB 2I1KA 4P7IA 3ZDMC 4MGZE 1I35A 3UF8A 3VUWA 3JW0X 2JRIB 1Y8RC 1WMHA 3ML8A 4WJOA 2MBBB 5G2NA 1WJUA 4BVUC 4IWOA 2CR5A 4CO7A 4BBNF 1P0RA 2LRUA 4HJKA 1KOTA 2FIDA 4WAAA 4BOZB 2NPTA 1V5TA 1P3QU 4TQ0A 1H8CA 1HE8A 1UBQA 4BBNC 1H4RA 4NPNA 2MSED 4GSWA 3CMMB 5L83A 2MW5A 4MSMB 1WGDA 3NS8A 4B9KA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2OOB B;  2KC1 A;  2JY6 A;  4G50 A;  1GUA B;  3RD2 A;  3KH0 A;  1V49 A;  1GJZ A;  4FHK A;  1J8C A;  2EMT A;  5G55 A;  1XT9 B;  4XC2 A;  2XK5 A;  5IA7 A;  4LCD E;  4TUU A;  2BYE A;  1YJ1 A;  2G45 B;  2KOX A;  1CMX B;  5D6J B;  4CYE A;  4DHZ B;  2YVC A;  4OVV A;  2O6V B;  2AEH A;  4IM2 A;  3W1Y A;  1NDD A;  3PLV A;  4GDK A;  4G11 A;  4DDI D;  5D2M B;  2GBR A;  1OEY J;  3K9P B;  4NAW A;  3VUX A;  3VQI A;  1WXS A;  2C60 A;  2C9W B;  2N9P C;  1OGW A;  2ZVN A;  4BOS C;  1SGH A;  3RUL A;  3DCG A;  1YIW A;  2LZ6 A;  1WX7 A;  2N9X A;  2KTF A;  4KZ0 A;  2LVP A;  3QCA A;  5AZG A;  1UH6 A;  2LVQ A;  1RAX A;  1WMH B;  2KQ7 A;  2AL6 A;  2NVU I;  1YQB A;  1WRD B;  5L95 C;  4NQL B;  3ZDT A;  1XD3 B;  2MLB A;  4MJS B;  4AJW A;  3PHX B;  4KSL C;  4HVB A;  2XBB C;  2OJR A;  3PZD A;  1AAR A;  4G0N B;  1P1A A;  4DHZ E;  4DXA B;  4EKU A;  2KD0 A;  3DDC B;  1E8X A;  2KLG A;  2KWC A;  4I6N B;  1V86 A;  3MHS D;  4WJQ A;  4FBJ B;  3B0A A;  3DVG X;  1U4A A;  2L0F A;  3LJ3 A;  4K7W A;  2KDF B;  2ZPY A;  4TKN A;  3DBR I;  2QHO A;  2RSU A;  4EZL A;  5EDS A;  2LRW A;  2PE9 A;  2L76 A;  3ZKJ C;  1EF5 A;  2GBJ A;  3ZUN A;  4FLH A;  1WXA A;  2K8C A;  4BKG A;  4HPM B;  2RD0 A;  3MTN B;  2WWZ A;  4W9C A;  3HM6 X;  3VXW A;  2MRP A;  2CS4 A;  2PPH A;  1VCB A;  1WX8 A;  4KVG B;  2LGY A;  1LQB A;  4WWP A;  1YD8 U;  2C7N B;  3SU8 X;  4AOF A;  1OEY A;  1Q1O A;  3UQA A;  3A1Q B;  2KN5 A;  3V61 A;  2JPH A;  2M4N A;  2FCQ A;  1NBF C;  3V6C B;  2V3S A;  1E8Z A;  2BYV E;  3RZW C;  4WWO A;  3ZIM A;  2N1W A;  1E7U A;  3RZF A;  2N1V A;  3AXC A;  4II3 B;  1SIF A;  3N30 A;  5AZF A;  2KX0 A;  3M63 B;  4XZ4 A;  3VFK A;  5IAA C;  5KHQ A;  3EFU A;  2DAJ A;  3OJ3 A;  3QAQ A;  4ZDV A;  4DDG D;  2UWQ A;  2RR9 A;  3A9J A;  4HDQ A;  2JT4 B;  3KYD D;  1V5O A;  5TR5 A;  2KDB A;  3PRE A;  5CHV C;  3H6N A;  3RUI B;  2A5U A;  3L13 A;  3EHV A;  1EF1 A;  3WAP A;  2BYF A;  1D3Z A;  2ZZP B;  4ICV A;  2M1M A;  4ASW C;  2N9E B;  3APD A;  4XX5 A;  2YLM A;  1KJT A;  3TMP B;  3X23 A;  4HCN B;  2JZ3 B;  3BIN A;  1GNU A;  4W9E A;  1E8Y A;  1WX9 A;  1WF9 A;  2BKF A;  4GDL B;  2JF5 A;  4IM0 A;  4ZRJ A;  3OLM D;  3PRP B;  4M8N A;  2PEA A;  2K6Q A;  5JHA A;  3VH3 B;  2WX1 A;  3O65 B;  4KSK C;  3VHT C;  2DAF A;  2IYD B;  4BKS D;  5CX3 A;  5JZE B;  3KYC D;  2BWF A;  1BT0 A;  4HWI B;  2KAN A;  2WDT B;  1LFD A;  2PJH A;  3KUZ A;  3PSE B;  3QHT A;  2KFJ A;  4YL8 A;  3DBS A;  1V9J A;  3N3K B;  5GMV A;  4DBG A;  3VTW A;  3ZNG C;  2D07 B;  2FCN A;  3KW5 B;  4NJ7 A;  5DPS A;  1WH3 A;  3Q3F A;  4EOY A;  2MP2 A;  5DPR A;  3ZTD A;  4EZJ A;  3TBL D;  1WE6 A;  4KZC A;  3AU4 A;  5CHW A;  3PV1 A;  3PVL A;  3GOE A;  2ZJD A;  1WE7 A;  5CHF A;  2R2O A;  2K39 A;  3ONS A;  1IP9 A;  4JGH B;  1PQS A;  1I42 A;  4X57 B;  2KHW B;  2MA9 B;  3QQ8 B;  4RMA A;  4AUQ C;  2PE6 B;  3U30 A;  3L54 A;  1E7V A;  2XEW A;  3R3M A;  1Q5W B;  2DHZ A;  4NY0 A;  1C1Y B;  1T0Y A;  3A9K A;  3SDL C;  2LVO A;  3JVZ X;  3V60 A;  5HKH A;  2FUH B;  4ZYN A;  3M62 B;  4W9I A;  3L0W B;  4IW0 A;  2NR2 A;  2Z0E B;  2KJH B;  2REX A;  4W9F A;  1RFA A;  2CHX A;  2NBV B;  3NHE B;  3TJP A;  4DK5 A;  3U8Z A;  5LXI B;  2J0M A;  3OAW A;  3HK0 A;  3PGE A;  2A4Z A;  2C5L C;  3QC8 B;  4DHJ D;  5C1Z A;  2D2Q A;  5AZH A;  4FUL A;  3AU5 A;  3JYU A;  3WIM A;  4KIK A;  4AP4 C;  1WJ6 A;  3APF A;  3K9O B;  1ZGU B;  2C7H A;  1P9D U;  4A3P A;  2DZJ A;  2DX5 B;  3DPD A;  2GBM A;  4FJV B;  4PYU A;  2AYO B;  3HHM A;  2NPT B;  2HD5 B;  3MJW A;  3H7S A;  1TZ1 A;  3JSV A;  3PPA A;  3V6E B;  5AEK B;  3RT3 B;  3WAO A;  4MSQ B;  4HXD A;  3PHW B;  3L10 B;  2MP2 B;  3A4S C;  4MEL A;  3QA8 A;  4K1R B;  5BO4 B;  3PLU A;  3IHP C;  1ISN A;  4F7Z A;  4TV3 A;  1MG8 A;  4I6L B;  2MWS B;  1C3T A;  4GB9 A;  5DPT A;  3A9K B;  2XK5 B;  3P2B A;  4JIO U;  4ANW A;  3PRZ A;  2BF8 B;  2KFK A;  5FR6 A;  4GU2 A;  3UIP B;  4E74 A;  2NS5 A;  1UZX B;  4F1S A;  5JHB A;  3A4R A;  2L05 A;  2AWT A;  3CST A;  1LXD A;  2KLC A;  2KX3 A;  1Z2M A;  2KWU B;  2KWV B;  3AI5 A;  3V62 A;  2G4S A;  2ZPN A;  2LI5 A;  4GDK B;  4KDI C;  4NAW B;  2HE7 A;  1GC6 A;  3DBH I;  3DVN U;  3R7R A;  2N7E A;  2DYO A;  1ZKH A;  3H9D A;  3NZU A;  4II2 B;  4IG7 B;  2KDE B;  4TQ1 A;  4KIK B;  3ALB A;  4F8C B;  4EFO A;  3IG3 A;  1RRB A;  4WWN A;  1S1Q B;  1YX5 B;  2KO3 A;  2V1Y A;  4EUT A;  2DZM A;  2N4F A;  1WY8 A;  4BKS A;  4ICU A;  5C23 A;  3ZO5 B;  1M94 A;  3W1S C;  2VRR B;  3RYT A;  3T8M A;  3NZS A;  2BPS A;  2WX0 A;  3JSV B;  3VH4 B;  5LXH A;  3WAM A;  3W1S A;  3LDZ E;  1GG3 A;  3CF6 E;  2IZV B;  1WXV A;  3DQV A;  3S2A A;  3ZRF A;  2KK8 A;  1FXT B;  1WM3 A;  2JRH A;  5KHO A;  3SD5 A;  2M0X A;  3UGB B;  1YX6 B;  4KV2 A;  3PRM B;  3L16 A;  5E6P A;  4LDT D;  1G6J A;  3H7P A;  2LD9 A;  3OJ4 B;  1WR6 E;  4FHJ A;  1JRU A;  4LJO B;  3A33 B;  2J0K A;  1L2N A;  2V4L A;  4MGY E;  2M17 A;  3EEC A;  5D94 A;  2IO2 B;  3KUD B;  4G3X B;  2KC2 A;  1WI0 A;  1WM2 A;  2M8S A;  3L08 A;  4FJY A;  4WJN A;  3QJZ A;  3ZNH B;  4URK A;  1Q0W B;  2MBE A;  3KUC B;  2NBW B;  3N32 A;  4CHK A;  2RGF A;  3TCA A;  3U7D A;  1K8R B;  2KXJ A;  4GOC A;  2DZK A;  4M0W B;  2KTR A;  4GXB A;  2GBK A;  3C0R B;  3ZW3 A;  1OQY A;  3Q3J A;  2NBU A;  2CHZ A;  3A9J B;  4PS3 A;  1Z5S B;  2IY0 B;  1WGH A;  2K25 A;  4HLE A;  2GOW A;  3UQB A;  1GC7 A;  1LM8 B;  2BGF A;  3R7Q A;  2LUE A;  4GN1 A;  3D32 A;  4FJZ A;  1IPG A;  1E8W A;  4MJS A;  4B95 A;  2ZNV C;  5CTR C;  1L7Y A;  1NI2 A;  2K6D B;  3AUL A;  2D3G A;  2D10 A;  2O6V D;  5E6O A;  3VUY A;  4HK2 A;  3B08 A;  3TIX A;  2J0J A;  1EO6 A;  1WFY A;  2LXA A;  3H7P B;  2G4D B;  3QWZ B;  3NY5 A;  3B1L X;  4GIV A;  2MCN B;  4NJ6 A;  2FNJ B;  2ZCC A;  4MM3 A;  2KMA A;  4HCP B;  4IUM B;  2HTH A;  2I1J A;  5J17 A;  2Z59 B;  1WGY A;  2Z0D B;  3M95 A;  1RLF A;  2O2V A;  4FA6 A;  2ASQ A;  1WZ3 A;  2Y5B B;  3ENE A;  4NQK E;  4ZRK A;  3ZLZ A;  2CKH B;  3WA0 A;  2EKE C;  5J18 A;  1J19 A;  4A20 A;  1V2Y A;  1WIA A;  1ZW7 A;  3PS6 A;  2WYQ A;  4W9J A;  3ZNI D;  4N9F 4;  2ZCB A;  4IWP A;  4JQW C;  3VAW A;  1WJ4 A;  1V80 A;  3A1Q A;  4FN2 A;  4RM8 A;  3VTU A;  2CHW A;  1QZE A;  2JUO A;  1E90 A;  1WGR A;  1WXM A;  2EMS A;  1UGM A;  3M3J A;  2KTR B;  2GBN A;  4MDK E;  4GGQ A;  3GZN I;  2KDI A;  2D11 A;  1P98 A;  3X0W A;  4DHJ B;  3QK0 A;  1X1M A;  4IWQ A;  4IM3 A;  1V6E A;  4K81 A;  2KKC A;  5JH5 C;  3ZRC A;  2KQS A;  2BKR B;  5LLI A;  5J2R A;  4I6P A;  4JLC A;  1WJN A;  2GMI C;  2G3Q B;  2KVR A;  2NCN A;  2L3Z A;  4MGK E;  4ANU A;  3TL5 A;  2FAZ A;  2J7Q B;  2N7D A;  4EZK A;  4GMV A;  4W9G A;  2KJR A;  2R2Q A;  2IO3 B;  1WZ0 A;  2IBI B;  4ANX A;  2BWE S;  3EC8 A;  2LWP A;  4W9H A;  3IFW B;  4W9K A;  3ZNZ B;  2ZNV B;  4MH0 E;  5DCN A;  3VTV A;  4PS7 A;  3UIO B;  3I3T B;  2KZR A;  2IO1 B;  3DVN V;  3ECI A;  4GDL A;  2FIF A;  3ML9 A;  2FCS A;  3KVF B;  2MQJ A;  3QX1 A;  2KNB A;  3SHQ A;  1KM7 A;  1UEL A;  2JZZ A;  1S3S G;  2O2V B;  3BY4 B;  4M8M A;  4W9L A;  4AJY B;  4ANV A;  1TBE A;  1F9J A;  2KMC A;  2ZEQ A;  4DWF A;  2DZI A;  1UBI A;  4BKT A;  4E3C A;  1VD2 A;  2DYM A;  1UD7 A;  4FAD A;  3VDZ A;  2L8J A;  3PTF C;  3QAR A;  2CU1 A;  3DBL I;  2LJ5 A;  1XQQ A;  4RM9 A;  2K8H A;  3HM3 A;  3PT2 B;  2MX2 A;  3WAN A;  4AWJ A;  1OTR B;  5DPW A;  1E5W A;  4HDO A;  1V81 A;  2AL3 A;  3L17 A;  2W9N A;  3APC A;  4MGI E;  3DOW A;  4W9D A;  4EEW A;  3DVG Y;  4K7U A;  3QIJ A;  4HPL B;  1SE9 A;  2K1F A;  2RPQ A;  4PYZ A;  3HIZ A;  2LGX A;  3ZTC A;  2LGD A;  2L0T A;  4K7S A;  3VVW B;  4WJP A;  4WQO B;  3ZVV A;  2MBH A;  1A5R A;  2JXX A;  3R66 C;  3IVF A;  5E6N A;  4OVU A;  4MEM A;  2IO0 B;  4IC7 B;  1WYW B;  2KFK B;  4E71 A;  1EUV B;  2DYB A;  1TGZ B;  2JVC A;  2FCM A;  2L00 B;  2ZVO A;  3CSF A;  3NOB A;  4JL9 A;  3T9L A;  2B3A A;  3UIN B;  4A3O A;  1WR1 A;  4LJP B;  2LAS A;  3IBE A;  2IY1 B;  2DEN B;  4PS8 A;  1IYF A;  1WGG A;  2HJ8 A;  3WAL A;  2K8B A;  2O6V A;  2MBQ A;  1KLV A;  4B6W A;  4ZRI A;  1TTN A;  2UYZ B;  4LDT B;  4NNJ B;  2C7M B;  2L7R A;  2LXC A;  5D7G A;  1J0G A;  1R4N I;  3RCZ A;  4J6I A;  2KJ6 A;  4BFR A;  2JWZ A;  2MBO A;  1R4M I;  3H1U A;  4KDL B;  2I1K A;  4P7I A;  3ZDM C;  4MGZ E;  1I35 A;  3UF8 A;  3VUW A;  3JW0 X;  2JRI B;  1Y8R C;  1WMH A;  3ML8 A;  4WJO A;  2MBB B;  5G2N A;  1WJU A;  4BVU C;  4IWO A;  2CR5 A;  4CO7 A;  4BBN F;  1P0R A;  2LRU A;  4HJK A;  1KOT A;  2FID A;  4WAA A;  4BOZ B;  2NPT A;  1V5T A;  1P3Q U;  4TQ0 A;  1H8C A;  1HE8 A;  1UBQ A;  4BBN C;  1H4R A;  4NPN A;  2MSE D;  4GSW A;  3CMM B;  5L83 A;  2MW5 A;  4MSM B;  1WGD A;  3NS8 A;  4B9K A; 
#chains in the Genus database with same CATH topology
 2KC1 A;  2JY6 A;  1GUA B;  3AH7 A;  1V49 A;  2K9X A;  3L4P A;  5G55 A;  1HQR D;  3ZJT A;  2V9H A;  5FR3 A;  1YJ1 A;  4CYE A;  1CMX B;  4C00 A;  2E3T A;  1ESF A;  3KQ4 A;  2WXR A;  3W1Y A;  4NAW A;  2AQ2 B;  3EA6 A;  4R3D A;  3TUO A;  2C9W B;  1OGW A;  1SGH A;  5E6J A;  3T3O A;  1WX7 A;  2N9X A;  2QJL A;  4YT0 B;  4KZ0 A;  3QCA A;  2D3A A;  5AZG A;  1RAX A;  2WXF A;  4LNF A;  2KQ7 A;  2IJ0 A;  5GXG B;  2BQQ A;  3ZDT A;  3H8H A;  4MJS B;  3SEB A;  1N63 A;  1QOA A;  3AEA B;  4EKU A;  1J7C A;  2KD0 A;  2V4I B;  2Z8L A;  1QIL A;  2KLG A;  1TZO A;  1V86 A;  3MHS D;  3LJ3 A;  4MM3 B;  2IDY A;  2E6X A;  2LRW A;  2L76 A;  3ZKJ C;  3ZUN A;  2IGG A;  2K8C A;  4BKG A;  4YSX B;  2RD0 A;  2ZW1 A;  4W9C A;  2MRP A;  2CS4 A;  3BYT B;  4MH8 A;  1VCB A;  1WX8 A;  1SEB D;  4LNK A;  3A1Q B;  2JPH A;  2FCQ A;  3ZIM A;  2CU3 A;  1E7U A;  3AXC A;  5AZF A;  2QDF A;  3EFC A;  3VFK A;  5KHQ A;  1HA5 A;  2RR9 A;  2JT4 B;  2KDB A;  3H6N A;  3RUI B;  2A5U A;  4OVZ A;  2WXQ A;  4ASW C;  4XX5 A;  1WX9 A;  4A90 A;  3AE1 B;  4GDL B;  2JWU A;  1F2R C;  1WYG A;  1D5Z C;  1C76 A;  2JSV X;  4GLS C;  5CX3 A;  3KYC D;  3RN9 C;  2BWF A;  1IBX B;  3KUZ A;  1V97 A;  2FCN A;  4BZA A;  4P1B C;  3E56 A;  1WE6 A;  3IAM 1;  3PZ8 A;  3TBL D;  3PV1 A;  3GOE A;  5BMI A;  2N9K A;  5G5G A;  4CQN A;  3IT4 B;  1C4C A;  3L54 A;  3BII D;  1T0Y A;  2LVO A;  3Q8E A;  3V60 A;  4ZYN A;  2REX A;  4ZHP A;  2BS3 B;  4W9F A;  2NBV B;  4DK5 A;  3U8Z A;  3PGE A;  2OJW A;  4N59 A;  4DHJ D;  1L6V A;  4YTN B;  5AZH A;  3AU5 A;  3JYU A;  3WIM A;  4KIK A;  4YXD B;  1TS2 A;  1AN8 A;  4A3P A;  2DX5 B;  2GBM A;  3C8Y A;  3MJW A;  3TEY A;  3H7S A;  3JSV A;  3V6E B;  4A8X C;  3PHW B;  4XWT A;  3DBH B;  1PYW D;  2INC C;  3PO0 A;  2NMQ A;  1OQQ A;  1VZ6 A;  2PKO A;  4ITK A;  2BF8 B;  2AWT A;  2KWV B;  2KWU B;  4WWM A;  1FD6 A;  2LI5 A;  1GC6 A;  3DVN U;  4Q2J A;  2DYO A;  3H9D A;  2OED A;  4KIK B;  1WSP A;  3IG3 A;  1RRB A;  4OZC A;  2KO3 A;  4EUT A;  1EU3 A;  4OZB A;  4AS1 A;  1C77 A;  1PGB A;  1N61 A;  2WX0 A;  3JSV B;  5LXH A;  3WAM A;  1GG3 A;  2IZV B;  2Y5P A;  3S2A A;  2KK8 A;  2MJ3 A;  4KV2 A;  4LDT D;  2IPK D;  2LD9 A;  1TT5 B;  1JRU A;  2BB5 A;  3BYY B;  1UF0 A;  1STE A;  2RDH A;  4DQO C;  2M17 A;  2EEL A;  4BAX A;  2WHI A;  4TMA B;  3B9J A;  2IO2 B;  2WQY B;  5IKC M;  4FJY A;  3QJZ A;  1EWY C;  1ET9 A;  1I4G A;  2V3N A;  5FK9 C;  3ZNH B;  4C80 A;  4URK A;  3TCA A;  3U7D A;  4M0W B;  2GBK A;  3BVZ A;  2K5P A;  2CHZ A;  2D3B A;  1SJE D;  1HZ5 A;  1Z5S B;  2IY0 B;  4HLE A;  2GOW A;  3AE9 B;  2FUG 1;  2KAJ A;  4FXC A;  2L1A A;  4M00 A;  4FJZ A;  1FRR A;  1MPE A;  2ZNV C;  3AUL A;  1YN3 A;  1IGD A;  5EE1 A;  3TIX A;  2CJO A;  1EO6 A;  3QWZ B;  2G4D B;  3NY5 A;  1SJH D;  3U2S C;  2HTH A;  3NVZ A;  3VRA B;  1FXA A;  1E7P B;  2CKH B;  3WA0 A;  2EKE C;  2LHE A;  1J19 A;  3OWE B;  2ZW0 A;  2RDB C;  2PVO D;  1JWM D;  1V80 A;  3DWM A;  1KLU D;  3M3J A;  4MDK E;  3X0W A;  3QK0 A;  2KN4 A;  4IWQ A;  4IM3 A;  2KKC A;  4XWW A;  5JH5 C;  2IGD A;  1QF6 A;  2G3Q B;  2KVR A;  4ANU A;  4MGK E;  3DBL B;  2R2Q A;  4KX6 B;  2PTL A;  3HUI A;  4W9H A;  1NI3 A;  3ZNZ B;  2K3U A;  3UIO B;  3AE6 B;  2FCS A;  3KVF B;  3QX1 A;  3SHQ A;  1FXI A;  2JZZ A;  4M8M A;  4LTU A;  2KMC A;  1RYJ A;  4E3C A;  2WXO A;  3PTF C;  1FO4 A;  1I7H A;  1XQQ A;  3HM3 A;  3PT2 B;  5AUK A;  3W2D A;  1WWT A;  1NEN B;  1A70 A;  4RF0 A;  2AL3 A;  4W9D A;  3DOW A;  3DHI C;  3U4E G;  3ABV B;  2WXK A;  4WJP A;  1MHH E;  2MBH A;  1A5R A;  3RNG C;  1WYW B;  2L00 B;  2MHJ A;  2B3A A;  1I4H A;  1KFY B;  1XLP A;  4K3B A;  3MHZ A;  3IBE A;  2IY1 B;  3GB1 A;  2ON8 A;  2K8B A;  2O6V A;  1JAL A;  1KLV A;  1L4D B;  1TTN A;  2JYE A;  5D7G A;  1J0G A;  3RCZ A;  4J6I A;  2KJ6 A;  4YWG G;  3Q3N C;  3RMK C;  3RNA C;  3O13 A;  4P7I A;  3ZDM C;  3NVW A;  3VUW A;  3JW0 X;  1WMH A;  2MBB B;  3NUH B;  1BXT A;  1WJU A;  4BVU C;  4JWU C;  4CO7 A;  2TSS A;  2LRU A;  1V5T A;  4TQ0 A;  1HE8 A;  4A55 A;  1L6U A;  3AEG B;  2MSE D;  2RDG A;  4WAF A;  3CMM B;  4MSM B;  4G50 A;  3KH0 A;  1J8C A;  3SFE B;  1TJE A;  4XC2 A;  2H89 B;  2HTM E;  2BBC A;  2XK5 A;  4TUU A;  2BYE A;  5D6J B;  3P42 A;  3AB5 A;  2O6V B;  3V05 A;  3Q69 A;  4DDI D;  4LNN A;  2GBR A;  5D2M B;  3VUX A;  1YN4 A;  2N9P C;  3RUL A;  1L0Y B;  1YIW A;  1ENF A;  4RNA A;  1GOZ A;  4C7Y A;  1UH6 A;  1KTK A;  1WMH B;  2AL6 A;  1YQB A;  1FFU A;  1TS3 A;  2MLB A;  3Q8B A;  4AJW A;  3PHX B;  4KSL C;  4HVB A;  1DOX A;  2PLP A;  4DXA B;  2WLB A;  4LK0 M;  2KWC A;  4FBJ B;  1U4A A;  1T0Q C;  3ZXV A;  4RH6 A;  1KF6 B;  2KDF B;  3DBR I;  2QHO A;  1D5X C;  2LGI A;  1JML A;  3VR9 B;  4HPM B;  3VXW A;  2WWZ A;  3HM6 X;  2PPH A;  4KVG B;  1DOY A;  1YD8 U;  2C7N B;  4AOF A;  1OEY A;  1Q1O A;  3UQA A;  2KN5 A;  4A9A A;  1NBF C;  1E8Z A;  4RFB A;  4KKJ A;  3I5J C;  3RZF A;  2N1V A;  3J9C A;  4II3 B;  3M63 B;  5IAA C;  2J53 A;  4ZDV A;  2B76 B;  2NTS A;  4HDQ A;  4XGA B;  3KYD D;  2BW2 A;  2ICI A;  5CHV C;  1JWB D;  1SXT A;  3L13 A;  3WAP A;  3WCQ A;  2MEK A;  2RPV A;  2ZZP B;  4ICV A;  2M1M A;  1ET6 A;  2N9E B;  2JU6 X;  3APD A;  3LXF A;  3TMP B;  1KJT A;  3GP7 A;  4HCN B;  1GAQ B;  2JZ3 B;  3BIN A;  1GNU A;  1K51 A;  2JF5 A;  3OLM D;  3PRP B;  2PEA A;  2G9H D;  2L52 A;  3VH3 B;  3O65 B;  3Q14 C;  3VHT C;  1BML C;  2IYD B;  5H8Y E;  1BT0 A;  2KAN A;  1JRO A;  3N3K B;  3VTW A;  3ZJU A;  2N9L A;  3KW5 B;  5DPS A;  3ONS A;  4X57 B;  1Q5W B;  1QOG A;  3AE4 B;  4XDD A;  2NR2 A;  3NHE B;  4ZYS A;  3GZN B;  5LXI B;  3OAW A;  1XXG A;  2WXL A;  1SSN A;  4FUL A;  4AP4 C;  3APF A;  1ZGU B;  1VZ8 A;  3I9V 1;  1ZXI A;  3DPD A;  2BVC A;  1HTQ A;  3HRD D;  2NPT B;  2HD5 B;  3PPA A;  4MSQ B;  3L10 B;  4NAM A;  2KVZ A;  1UUP A;  2DNF A;  1E9M A;  3MJ5 A;  2KYW A;  1L5P A;  1DOI A;  3SR6 A;  3PLU A;  3IHP C;  5BYQ A;  1TY2 A;  1UGJ A;  5MPO A;  1C3T A;  2KFK A;  1Y56 A;  4EE2 A;  5JHB A;  2L05 A;  2KLC A;  2R61 A;  3AI5 A;  1Z2M A;  3RNF C;  2G4S A;  1ZXH A;  2ZPN A;  1YN5 A;  1TY0 A;  1L0V B;  4NAW B;  3DBH I;  4JX1 C;  4II2 B;  4TQ1 A;  2KDE B;  2GI9 A;  4KKI A;  3AE7 B;  2DZM A;  1C9F A;  5C23 A;  2VZK D;  3ZO5 B;  3RYT A;  3T8M A;  2INN E;  3VH4 B;  1GPX A;  3NZ3 A;  1Q10 A;  3HVD A;  1WXV A;  3ZRF A;  3AV8 A;  3SD5 A;  3UGB B;  2JRH A;  5BYR A;  3L16 A;  2WXH A;  2UU7 A;  1JCK B;  3RI7 C;  3TEX A;  4LJO B;  5IO9 A;  5C2T B;  1GB4 A;  2YEP B;  2GRI A;  1VRA B;  1I4R A;  5D94 A;  3AEB B;  5BMH A;  2KC2 A;  4HJG E;  3L08 A;  4CHK A;  4P6V F;  3P4R B;  4GOC A;  4YTM B;  4GXB A;  1YJJ A;  3C0R B;  3ZW3 A;  3Q3J A;  2WXG A;  1B1Z A;  3P63 A;  1TYG B;  3MFG A;  5C3J B;  3B2G A;  1T6B X;  2QMT A;  3DHH C;  5HG2 A;  1JRP A;  1LM8 B;  3R7Q A;  3D32 A;  1E8W A;  3KLS X;  1FPY A;  2O6V D;  4HK2 A;  5TSS A;  4GIV A;  2MCN B;  3B1L X;  4NJ6 A;  2FNJ B;  2ZCC A;  3Q2A C;  2KMA A;  4IUM B;  2I1J A;  2WNM A;  3M95 A;  4FA6 A;  1FNU A;  1F1H A;  4NQK E;  3DHG C;  3P1M A;  1HEZ E;  3AEF B;  5J18 A;  2WYQ A;  2WGS A;  2X38 A;  4IWP A;  3VAW A;  2SEB D;  4RF1 A;  2AX5 A;  1WJ4 A;  4C56 C;  3BK1 A;  3B2F A;  3VTU A;  2CHW A;  1QZE A;  1M4V A;  1WXM A;  2LFI A;  3URY A;  2KDI A;  1P98 A;  1QQR A;  1V6E A;  3ZRC A;  5LLI A;  4REZ A;  1FCC C;  4I6P A;  2LHD A;  2LGS A;  2L3Z A;  4WUR A;  5EE9 A;  4W9G A;  3Q3M C;  2IO3 B;  4L2Y A;  2BWE S;  5JXV A;  2ZNV B;  2M0A A;  4PS7 A;  1VDV A;  3PZ7 A;  2WXP A;  2KZR A;  2FIF A;  4RCO A;  1DGJ A;  4W9L A;  4ANV A;  1KH0 A;  1TBE A;  4HPP A;  1CJE A;  2ZEQ A;  4BKT A;  2GLS A;  1VD2 A;  3VDZ A;  3QAR A;  3DBL I;  1P7E A;  1SE3 A;  4AWJ A;  2AQ3 B;  1OTR B;  5DPW A;  3L17 A;  4MGI E;  5EE0 A;  3HIZ A;  3ZTC A;  4RGM A;  1R4M B;  2L0T A;  3VVW B;  1NYQ A;  1F77 A;  2J42 A;  3IVF A;  3NVV A;  4IC7 B;  4RGO S;  4JL9 A;  1TKY A;  2FCM A;  3CSF A;  2ZVO A;  1XLN A;  2BYT A;  1FCL A;  4LJP B;  4PS8 A;  2D5G A;  1HXY D;  4KGR A;  3BK2 A;  2UYZ B;  4DXF A;  2LXC A;  1C78 A;  3NRZ A;  2JRI B;  4WJO A;  3Q8C A;  4IWO A;  1ROE A;  1KOT A;  1YQ3 B;  2FID A;  2BB6 A;  4BOZ B;  1OQR A;  1P3Q U;  2RMM A;  1UBQ A;  1UWX A;  4RGN A;  3NS8 A;  1FMA D;  4ZRQ A;  3RD2 A;  1GJZ A;  2EKI A;  1FFV A;  5IA7 A;  2KOX A;  4HKQ A;  4DHZ B;  1QKZ A;  1PGA A;  2YVC A;  2AEH A;  1NDD A;  3PLV A;  4GDK A;  1SB3 C;  3K9P B;  1OEY J;  3VQI A;  2BT6 A;  1WXS A;  2C60 A;  2LJI A;  2Y5C A;  4BOS C;  3DCG A;  2LZ6 A;  1LO5 D;  2LVP A;  1J7A A;  4OHJ A;  2NVU I;  4NQL B;  1XD3 B;  1JWU D;  3MC9 A;  2OJR A;  3PZD A;  1AAR A;  4G0N B;  2Y3A A;  3DDC B;  3I57 A;  1E8X A;  1XCT L;  1F0Z A;  4I6N B;  1N5W A;  5EE3 A;  1MHX A;  3KWV A;  2RSU A;  4EZL A;  2PE9 A;  4A6Q A;  1EF5 A;  4HKZ E;  1WXA A;  4IDI A;  1P7F A;  3SU8 X;  5LNK 1;  3AED B;  2V3P A;  1XLQ A;  2M4N A;  4OW0 A;  1WGK A;  3V6C B;  2BYV E;  3GE8 C;  1SF0 A;  3N30 A;  1SE4 A;  4XZ4 A;  3OJ3 A;  1ACC A;  3A9J A;  2W82 A;  1V5O A;  5TR5 A;  2IGH A;  2VZK B;  3N20 C;  3AE5 B;  4LLG M;  3EHV A;  1EF1 A;  2BYF A;  1D3Z A;  2YLM A;  4L1B A;  1E8Y A;  2L32 A;  2QC8 A;  1N5X A;  1WF9 A;  2BKF A;  4IM0 A;  5IP4 D;  4M8N A;  2K6Q A;  4ACF A;  2KWD A;  3NG0 A;  4JWS C;  2WDT B;  1LFD A;  3PSE B;  2ACZ B;  3DBS A;  1AYF A;  4O1N A;  1EM7 A;  1V9J A;  1UNS A;  2D07 B;  3GS2 A;  1WH3 A;  3Q3F A;  4EOY A;  2MP2 A;  5DPR A;  3ZTD A;  4EZJ A;  4KZC A;  3AU4 A;  5CHW A;  3PVL A;  4MT5 A;  5CHF A;  4JGH B;  4KGT A;  1PQS A;  1I42 A;  2KHW B;  3QQ8 B;  1K53 A;  3U30 A;  1E7V A;  2XEW A;  1N60 A;  2DHZ A;  2NTT A;  1C1Y B;  4NY0 A;  3JVZ X;  3M62 B;  3P4P B;  3L0W B;  4IW0 A;  2Z0E B;  3IAS 1;  1RFA A;  2W3R A;  3HK0 A;  5HFY A;  2C5L C;  3QC8 B;  5C1Z A;  1XEE A;  1WJ6 A;  3K9O B;  1XF5 L;  3CWI A;  2DZJ A;  3AE3 B;  3NVY A;  5D3D A;  4FJV B;  4PYU A;  3HHM A;  3ZQ4 A;  1TZ1 A;  5AEK B;  4HXD A;  1FNV A;  2MP2 B;  3A4S C;  4MEL A;  1JWA D;  1KLG D;  4K1R B;  2J52 A;  2WDV B;  1ISN A;  4F7Z A;  3SFD B;  2MWS B;  5DPT A;  4PK1 A;  3P2B A;  2XK5 B;  4JIO U;  4ANW A;  5FR6 A;  1YMH E;  2FBW B;  3R2T A;  4E74 A;  1UZX B;  1V8C A;  4HRO A;  4AQ7 A;  5T8I A;  2N7E A;  1ZKH A;  3NZU A;  3V3X A;  3LYY A;  2PW9 A;  1DYQ A;  4P1C C;  3NJT A;  2BTE A;  4M01 A;  4BKS A;  4ICU A;  3AEC B;  1M94 A;  3T3N A;  3W1S C;  3I63 C;  3NZS A;  2BPS A;  2I38 A;  3CF6 E;  3DQV A;  1WM3 A;  1YX6 B;  4NJC A;  4TSS A;  1G6J A;  4C4V A;  2OHF A;  3H7P A;  3N1Z C;  3W5V B;  3OJ4 B;  4KGS A;  4JE3 B;  2M19 A;  2WP9 B;  2J0K A;  3UI3 A;  1IUE A;  2SAK A;  3VRB B;  1NEK B;  1WI0 A;  4B0E A;  2M8S A;  3KUC B;  2NBW B;  2LMC A;  2KTR A;  2WU5 B;  2JX5 A;  3IXS A;  1AWD A;  1T5X D;  2NBU A;  2J4X A;  2QIL A;  4S0R A;  3FAH A;  1WGH A;  2K25 A;  2KDM A;  1XCQ L;  3UQB A;  1VJK A;  1I4P A;  4GN1 A;  4MJS A;  1CQV A;  4B95 A;  5CTR C;  1E10 A;  1RFK A;  2D3G A;  4US9 A;  2DBY A;  2K22 A;  3B08 A;  1VLB A;  3N1X C;  2J0J A;  4C4V B;  2LXA A;  3H7P B;  4MM3 A;  2N7J A;  1ZDX A;  2Z0D B;  2ASQ A;  2Y5B B;  4ZRK A;  3ZXR A;  3ZLZ A;  1UWM A;  1TKG A;  3PS6 A;  4W9J A;  3ZNI D;  4N9F 4;  2ZCB A;  4JQW C;  3MC8 A;  3A1Q A;  5FKA C;  4H2A A;  4FN2 A;  2JUO A;  1JW9 D;  1V1O A;  1WGR A;  2EMS A;  1UGM A;  2KTR B;  4GGQ A;  3DBR B;  1TS5 A;  4K81 A;  2KQS A;  1V1P A;  5J2R A;  4JPS A;  2QSD A;  3FC4 A;  2J7Q B;  4EZK A;  1JWS D;  4GMV A;  2QIE B;  4WQM A;  2WXJ A;  2IBI B;  3EC8 A;  2LWP A;  5HHD G;  4W9K A;  1T3Q A;  3VTV A;  3I3T B;  2IO1 B;  4GDL A;  2LUM A;  1ZUD 2;  2KNB A;  1KM7 A;  2FE8 A;  3BY4 B;  5BYS A;  2WXM A;  4DWF A;  2H88 B;  1C4P A;  1UBI A;  2DYM A;  1UD7 A;  4L23 A;  1IBX A;  2CU1 A;  3Q8A A;  2W55 A;  4RM9 A;  2K8H A;  2MX2 A;  3WAN A;  2JYT A;  1ZOY B;  2W9N A;  1EU4 A;  3APC A;  4K7U A;  3DVG Y;  1R4N B;  4HPL B;  2K1F A;  2RPQ A;  4PYZ A;  2LGX A;  4K7S A;  1V1P B;  1MFW A;  1QT9 A;  2JXX A;  2XNA C;  3RNE C;  2MJE A;  2IO0 B;  2KFK B;  4E71 A;  1EUV B;  3NOB A;  2WDQ B;  1TGZ B;  1FM0 D;  2DYB A;  3T9L A;  4A3O A;  1WR1 A;  1WGG A;  3WAL A;  3W9C B;  2HDE A;  4B6W A;  4ZRI A;  1YNT E;  2L7R A;  3ZJV A;  1PUT A;  2MBO A;  1R4M I;  3BWU D;  3H1U A;  2I1K A;  3AEE B;  1I35 A;  3UF8 A;  1TKE A;  5G2N A;  1Y8R C;  1FEH A;  3N9Y C;  2CR5 A;  4S17 A;  1NVI D;  4BBN F;  4HJK A;  1FIQ A;  1SIJ A;  1GB1 A;  3W5U B;  1H4R A;  2OOB B;  4FHK A;  2EMT A;  1XT9 B;  5I4D A;  4LCD E;  2G45 B;  3KWL A;  4NZL B;  4WH4 A;  2PIA A;  4OVV A;  4IM2 A;  4G11 A;  2QEJ C;  3AMZ A;  2ZVN A;  4YTP B;  2KTF A;  3BVM A;  1RWS A;  2LVQ A;  2L83 A;  1VR9 A;  1WRD B;  5L95 C;  1SE2 A;  4N6E B;  2XBB C;  3VR8 B;  3RNB C;  1P1A A;  4DHZ E;  4HRS A;  4WJQ A;  4PT5 A;  3B0A A;  3DVG X;  1RM6 C;  3N1Y C;  2L0F A;  4K7W A;  2ZPY A;  4TKN A;  1TIF A;  5EDS A;  3E9S A;  1CK1 A;  1N6Z A;  2GBJ A;  4FLH A;  2I2Y A;  4HEA 1;  2AQ1 B;  3MTN B;  4WWP A;  2LGY A;  1LQB A;  3EGR A;  4D2K A;  1K52 A;  3V61 A;  1NYR A;  2V3S A;  2Q5W D;  3RZW C;  4WWO A;  2N1W A;  4K3C A;  1SIF A;  4M0W A;  2KX0 A;  1XLO A;  4YSY B;  3EFU A;  2DAJ A;  3QAQ A;  4DDG D;  2MJD A;  2UWQ A;  1D4B A;  2D3C A;  4ZHO A;  3PRE A;  1EWC A;  1FRD A;  2INP E;  2KAC A;  3LB8 C;  3X23 A;  2MH7 A;  1MVK A;  3ZGZ A;  4W9E A;  2ONQ A;  5D3I B;  2WXI A;  3CIR B;  4ZRJ A;  3RNC C;  5JHA A;  3OG5 A;  2WX1 A;  2DAF A;  1F52 A;  4ZOH C;  4BKS D;  5JZE B;  4WIP A;  3RPF C;  2M56 B;  4HWI B;  3AE2 B;  2PJH A;  1VZ7 A;  3QHT A;  2KFJ A;  4YL8 A;  1B9R A;  5GMV A;  4DBG A;  3ZNG C;  3BZD B;  1E6E B;  4NJ7 A;  4DXG A;  5IN7 A;  2LEK A;  2ZJD A;  1WE7 A;  5G5H A;  2JXT A;  2R2O A;  2K39 A;  1IP9 A;  1ZPS A;  2G1E A;  2MA9 B;  1SBB B;  4RMA A;  4LNO A;  4AUQ C;  2PE6 B;  3R3M A;  3SDL C;  3Q6B A;  3A9K A;  5HKH A;  1PGX A;  2FUH B;  3Q3O C;  1TS4 A;  4W9I A;  3TSS A;  2KJH B;  2CHX A;  3TJP A;  2K0P A;  2J0M A;  3BVG A;  2A4Z A;  3MC0 B;  4LNI A;  4M02 A;  2D2Q A;  2JZP A;  2WXN A;  4US8 A;  4YSZ B;  2C7H A;  1P9D U;  1AW7 A;  2GB1 A;  2AYO B;  1HZ6 A;  3HVZ A;  3RT3 B;  2HJ1 A;  3WAO A;  2YEP F;  3QA8 A;  4ZRP A;  5BO4 B;  3R2I A;  1QOB A;  4TV3 A;  1MG8 A;  4I6L B;  4GB9 A;  3A9K B;  3PRZ A;  1BUI C;  4GU2 A;  3UIP B;  1I4Q A;  2NS5 A;  4F1S A;  3A4R A;  4HDO A;  3CST A;  1LXD A;  3V62 A;  2KX3 A;  4KDI C;  4GDK B;  3R8B A;  2X8X X;  3C19 A;  2HE7 A;  3ZYY X;  3R7R A;  4IG7 B;  4RGT A;  4XE0 A;  3ALB A;  4F8C B;  4EFO A;  4WWN A;  1S1Q B;  3FKY A;  1E0Z A;  4ARI A;  1YX5 B;  2V1Y A;  2N4F A;  2V0G A;  1WY8 A;  4USA A;  2VRR B;  3W1S A;  3LDZ E;  4IOI E;  1T0S C;  3EUB 2;  1FXT B;  5KHO A;  2M0X A;  3PRM B;  5E6P A;  1C79 A;  4MAC A;  1XO3 A;  1WR6 E;  4FHJ A;  1D5M C;  3A33 B;  1L2N A;  4P16 A;  2V4L A;  4MGY E;  1ZDV A;  3EEC A;  3KUD B;  4G3X B;  1WM2 A;  4WJN A;  4XYC A;  1Q0W B;  2MBE A;  3N32 A;  2RGF A;  1IGC A;  1K8R B;  2KXJ A;  2DZK A;  1OQY A;  3DWG C;  3U52 E;  3A9J B;  4PS3 A;  4B0M A;  3GE3 C;  2KMM A;  1GC7 A;  1MJD A;  2KT7 A;  2BGF A;  2LUE A;  1IPG A;  1L7Y A;  1NI2 A;  1C4A A;  2K6D B;  2W54 A;  1WXQ A;  1WRI A;  2D10 A;  5E6O A;  3VUY A;  1OFF A;  1ZP0 B;  4OZA A;  4KSK C;  1WFY A;  2VH2 A;  4HCP B;  2IND C;  5J17 A;  2Z59 B;  1WGY A;  1D6E C;  1RLF A;  1QLB B;  2O2V A;  1WZ3 A;  3ENE A;  1YJI A;  1MI0 A;  4A20 A;  1V2Y A;  1WIA A;  1ZW7 A;  2PMV A;  4UDU C;  4RM8 A;  5IOI A;  4N58 A;  1E90 A;  2GBN A;  3GZN I;  3AE8 B;  2WDR B;  2D11 A;  4DHJ B;  1L0X B;  1X1M A;  5H92 C;  1QOF A;  2BKR B;  1F2R I;  4JLC A;  2BS2 B;  1WJN A;  2GMI C;  2N0S B;  2NCN A;  2W3S A;  2QCZ A;  3TL5 A;  2FAZ A;  2N7D A;  2KJR A;  1WZ0 A;  1YOV B;  4ANX A;  1YQ4 B;  2WS3 B;  3IFW B;  4MH0 E;  5DCN A;  2JQR B;  3DVN V;  3ECI A;  3ML9 A;  2MQJ A;  1JQ4 A;  1UEL A;  2O2V B;  1S3S G;  4AJY B;  1F9J A;  2DLB A;  1PDX A;  2DZI A;  2VH1 A;  1KRH A;  3ETR A;  4FAD A;  2L8J A;  1ZE3 D;  2LJ5 A;  3FIL A;  1K50 A;  4XDC A;  2BS4 B;  1E5W A;  1V81 A;  3P4Q B;  4EEW A;  3IT6 B;  2KQ4 X;  1MG4 A;  3QIJ A;  1SE9 A;  3P4S B;  2LGD A;  4WQO B;  3ZVV A;  3MP9 A;  3R66 C;  5E6N A;  4OVU A;  4MEM A;  3U7Z A;  2PVG C;  1FNW A;  4IKG A;  2JVC A;  3UIN B;  1HTO A;  1L4Z B;  2LAS A;  1IYF A;  2DEN B;  4J3O D;  2HJ8 A;  4QAY A;  1N62 A;  2MBQ A;  3TEW A;  4LDT B;  4NNJ B;  2C7M B;  4C7Z A;  1R4N I;  2CJN A;  4BFR A;  2JWZ A;  3TEZ A;  1J7B A;  4KDL B;  1LGR A;  3NS1 A;  5BMG A;  4MGZ E;  1PFD A;  3Q8F A;  3ML8 A;  3AM9 A;  2XN9 C;  1R7S A;  1CZP A;  3FIL B;  1P0R A;  1T0R C;  4WAA A;  4ARC A;  2WU2 B;  2NPT A;  1H8C A;  2DWQ A;  3RFZ B;  4BBN C;  4NPN A;  3AN1 A;  1I4X A;  4GSW A;  5AUI A;  5HI1 A;  5L83 A;  2MW5 A;  1WGD A;  4B9K A; 
#chains in the Genus database with same CATH homology
 2OOB B;  2KC1 A;  2JY6 A;  4G50 A;  1GUA B;  3RD2 A;  3KH0 A;  1V49 A;  1GJZ A;  4FHK A;  1J8C A;  2EMT A;  5G55 A;  1XT9 B;  4XC2 A;  2XK5 A;  5IA7 A;  4LCD E;  4TUU A;  2BYE A;  1YJ1 A;  2G45 B;  2KOX A;  1CMX B;  5D6J B;  4CYE A;  4DHZ B;  2YVC A;  4OVV A;  2O6V B;  2AEH A;  4IM2 A;  3W1Y A;  1NDD A;  3PLV A;  4GDK A;  4G11 A;  4DDI D;  5D2M B;  2GBR A;  1OEY J;  3K9P B;  4NAW A;  3VUX A;  3VQI A;  1WXS A;  2C60 A;  2C9W B;  2N9P C;  1OGW A;  2ZVN A;  4BOS C;  1SGH A;  3RUL A;  3DCG A;  1YIW A;  2LZ6 A;  1WX7 A;  2N9X A;  2KTF A;  4KZ0 A;  2LVP A;  3QCA A;  5AZG A;  1UH6 A;  2LVQ A;  1RAX A;  1WMH B;  2KQ7 A;  2AL6 A;  2NVU I;  1YQB A;  1WRD B;  5L95 C;  4NQL B;  3ZDT A;  1XD3 B;  2MLB A;  4MJS B;  4AJW A;  3PHX B;  4KSL C;  4HVB A;  2XBB C;  2OJR A;  3PZD A;  1AAR A;  4G0N B;  1P1A A;  4DHZ E;  4DXA B;  4EKU A;  2KD0 A;  3DDC B;  1E8X A;  2KLG A;  2KWC A;  4I6N B;  1V86 A;  3MHS D;  4WJQ A;  4FBJ B;  3B0A A;  3DVG X;  1U4A A;  2L0F A;  3LJ3 A;  4K7W A;  2KDF B;  2ZPY A;  4TKN A;  3DBR I;  2QHO A;  2RSU A;  4EZL A;  5EDS A;  2LRW A;  2PE9 A;  2L76 A;  3ZKJ C;  1EF5 A;  2GBJ A;  3ZUN A;  4FLH A;  1WXA A;  2K8C A;  4BKG A;  4HPM B;  2RD0 A;  3MTN B;  2WWZ A;  4W9C A;  3HM6 X;  3VXW A;  2MRP A;  2CS4 A;  2PPH A;  1VCB A;  1WX8 A;  4KVG B;  2LGY A;  1LQB A;  4WWP A;  1YD8 U;  2C7N B;  3SU8 X;  4AOF A;  1OEY A;  1Q1O A;  3UQA A;  3A1Q B;  2KN5 A;  3V61 A;  2JPH A;  2M4N A;  2FCQ A;  1NBF C;  3V6C B;  2V3S A;  1E8Z A;  2BYV E;  3RZW C;  4WWO A;  3ZIM A;  2N1W A;  1E7U A;  3RZF A;  2N1V A;  3AXC A;  4II3 B;  1SIF A;  3N30 A;  5AZF A;  2KX0 A;  3M63 B;  4XZ4 A;  3VFK A;  5IAA C;  5KHQ A;  3EFU A;  2DAJ A;  3OJ3 A;  3QAQ A;  4ZDV A;  4DDG D;  2UWQ A;  2RR9 A;  3A9J A;  4HDQ A;  2JT4 B;  3KYD D;  1V5O A;  5TR5 A;  2KDB A;  3PRE A;  5CHV C;  3H6N A;  3RUI B;  2A5U A;  3L13 A;  3EHV A;  1EF1 A;  3WAP A;  2BYF A;  1D3Z A;  2ZZP B;  4ICV A;  2M1M A;  4ASW C;  2N9E B;  3APD A;  4XX5 A;  2YLM A;  1KJT A;  3TMP B;  3X23 A;  4HCN B;  2JZ3 B;  3BIN A;  1GNU A;  4W9E A;  1E8Y A;  1WX9 A;  1WF9 A;  2BKF A;  4GDL B;  2JF5 A;  4IM0 A;  4ZRJ A;  3OLM D;  3PRP B;  4M8N A;  2PEA A;  2K6Q A;  5JHA A;  3VH3 B;  2WX1 A;  3O65 B;  4KSK C;  3VHT C;  2DAF A;  2IYD B;  4BKS D;  5CX3 A;  5JZE B;  3KYC D;  2BWF A;  1BT0 A;  4HWI B;  2KAN A;  2WDT B;  1LFD A;  2PJH A;  3KUZ A;  3PSE B;  3QHT A;  2KFJ A;  4YL8 A;  3DBS A;  1V9J A;  3N3K B;  5GMV A;  4DBG A;  3VTW A;  3ZNG C;  2D07 B;  2FCN A;  3KW5 B;  4NJ7 A;  5DPS A;  1WH3 A;  3Q3F A;  4EOY A;  2MP2 A;  5DPR A;  3ZTD A;  4EZJ A;  3TBL D;  1WE6 A;  4KZC A;  3AU4 A;  5CHW A;  3PV1 A;  3PVL A;  3GOE A;  2ZJD A;  1WE7 A;  5CHF A;  2R2O A;  2K39 A;  3ONS A;  1IP9 A;  4JGH B;  1PQS A;  1I42 A;  4X57 B;  2KHW B;  2MA9 B;  3QQ8 B;  4RMA A;  4AUQ C;  2PE6 B;  3U30 A;  3L54 A;  1E7V A;  2XEW A;  3R3M A;  1Q5W B;  2DHZ A;  4NY0 A;  1C1Y B;  1T0Y A;  3A9K A;  3SDL C;  2LVO A;  3JVZ X;  3V60 A;  5HKH A;  2FUH B;  4ZYN A;  3M62 B;  4W9I A;  3L0W B;  4IW0 A;  2NR2 A;  2Z0E B;  2KJH B;  2REX A;  4W9F A;  1RFA A;  2CHX A;  2NBV B;  3NHE B;  3TJP A;  4DK5 A;  3U8Z A;  5LXI B;  2J0M A;  3OAW A;  3HK0 A;  3PGE A;  2A4Z A;  2C5L C;  3QC8 B;  4DHJ D;  5C1Z A;  2D2Q A;  5AZH A;  4FUL A;  3AU5 A;  3JYU A;  3WIM A;  4KIK A;  4AP4 C;  1WJ6 A;  3APF A;  3K9O B;  1ZGU B;  2C7H A;  1P9D U;  4A3P A;  2DZJ A;  2DX5 B;  3DPD A;  2GBM A;  4FJV B;  4PYU A;  2AYO B;  3HHM A;  2NPT B;  2HD5 B;  3MJW A;  3H7S A;  1TZ1 A;  3JSV A;  3PPA A;  3V6E B;  5AEK B;  3RT3 B;  3WAO A;  4MSQ B;  4HXD A;  3PHW B;  3L10 B;  2MP2 B;  3A4S C;  4MEL A;  3QA8 A;  4K1R B;  5BO4 B;  3PLU A;  3IHP C;  1ISN A;  4F7Z A;  4TV3 A;  1MG8 A;  4I6L B;  2MWS B;  1C3T A;  4GB9 A;  5DPT A;  3A9K B;  2XK5 B;  3P2B A;  4JIO U;  4ANW A;  3PRZ A;  2BF8 B;  2KFK A;  5FR6 A;  4GU2 A;  3UIP B;  4E74 A;  2NS5 A;  1UZX B;  4F1S A;  5JHB A;  3A4R A;  2L05 A;  2AWT A;  3CST A;  1LXD A;  2KLC A;  2KX3 A;  1Z2M A;  2KWU B;  2KWV B;  3AI5 A;  3V62 A;  2G4S A;  2ZPN A;  2LI5 A;  4GDK B;  4KDI C;  4NAW B;  2HE7 A;  1GC6 A;  3DBH I;  3DVN U;  3R7R A;  2N7E A;  2DYO A;  1ZKH A;  3H9D A;  3NZU A;  4II2 B;  4IG7 B;  2KDE B;  4TQ1 A;  4KIK B;  3ALB A;  4F8C B;  4EFO A;  3IG3 A;  1RRB A;  4WWN A;  1S1Q B;  1YX5 B;  2KO3 A;  2V1Y A;  4EUT A;  2DZM A;  2N4F A;  1WY8 A;  4BKS A;  4ICU A;  5C23 A;  3ZO5 B;  1M94 A;  3W1S C;  2VRR B;  3RYT A;  3T8M A;  3NZS A;  2BPS A;  2WX0 A;  3JSV B;  3VH4 B;  5LXH A;  3WAM A;  3W1S A;  3LDZ E;  1GG3 A;  3CF6 E;  2IZV B;  1WXV A;  3DQV A;  3S2A A;  3ZRF A;  2KK8 A;  1FXT B;  1WM3 A;  2JRH A;  5KHO A;  3SD5 A;  2M0X A;  3UGB B;  1YX6 B;  4KV2 A;  3PRM B;  3L16 A;  5E6P A;  4LDT D;  1G6J A;  3H7P A;  2LD9 A;  3OJ4 B;  1WR6 E;  4FHJ A;  1JRU A;  4LJO B;  3A33 B;  2J0K A;  1L2N A;  2V4L A;  4MGY E;  2M17 A;  3EEC A;  5D94 A;  2IO2 B;  3KUD B;  4G3X B;  2KC2 A;  1WI0 A;  1WM2 A;  2M8S A;  3L08 A;  4FJY A;  4WJN A;  3QJZ A;  3ZNH B;  4URK A;  1Q0W B;  2MBE A;  3KUC B;  2NBW B;  3N32 A;  4CHK A;  2RGF A;  3TCA A;  3U7D A;  1K8R B;  2KXJ A;  4GOC A;  2DZK A;  4M0W B;  2KTR A;  4GXB A;  2GBK A;  3C0R B;  3ZW3 A;  1OQY A;  3Q3J A;  2NBU A;  2CHZ A;  3A9J B;  4PS3 A;  1Z5S B;  2IY0 B;  1WGH A;  2K25 A;  4HLE A;  2GOW A;  3UQB A;  1GC7 A;  1LM8 B;  2BGF A;  3R7Q A;  2LUE A;  4GN1 A;  3D32 A;  4FJZ A;  1IPG A;  1E8W A;  4MJS A;  4B95 A;  2ZNV C;  5CTR C;  1L7Y A;  1NI2 A;  2K6D B;  3AUL A;  2D3G A;  2D10 A;  2O6V D;  5E6O A;  3VUY A;  4HK2 A;  3B08 A;  3TIX A;  2J0J A;  1EO6 A;  1WFY A;  2LXA A;  3H7P B;  2G4D B;  3QWZ B;  3NY5 A;  3B1L X;  4GIV A;  2MCN B;  4NJ6 A;  2FNJ B;  2ZCC A;  4MM3 A;  2KMA A;  4HCP B;  4IUM B;  2HTH A;  2I1J A;  5J17 A;  2Z59 B;  1WGY A;  2Z0D B;  3M95 A;  1RLF A;  2O2V A;  4FA6 A;  2ASQ A;  1WZ3 A;  2Y5B B;  3ENE A;  4NQK E;  4ZRK A;  3ZLZ A;  2CKH B;  3WA0 A;  2EKE C;  5J18 A;  1J19 A;  4A20 A;  1V2Y A;  1WIA A;  1ZW7 A;  3PS6 A;  2WYQ A;  4W9J A;  3ZNI D;  4N9F 4;  2ZCB A;  4IWP A;  4JQW C;  3VAW A;  1WJ4 A;  1V80 A;  3A1Q A;  4FN2 A;  4RM8 A;  3VTU A;  2CHW A;  1QZE A;  2JUO A;  1E90 A;  1WGR A;  1WXM A;  2EMS A;  1UGM A;  3M3J A;  2KTR B;  2GBN A;  4MDK E;  4GGQ A;  3GZN I;  2KDI A;  2D11 A;  1P98 A;  3X0W A;  4DHJ B;  3QK0 A;  1X1M A;  4IWQ A;  4IM3 A;  1V6E A;  4K81 A;  2KKC A;  5JH5 C;  3ZRC A;  2KQS A;  2BKR B;  5LLI A;  5J2R A;  4I6P A;  4JLC A;  1WJN A;  2GMI C;  2G3Q B;  2KVR A;  2NCN A;  2L3Z A;  4MGK E;  4ANU A;  3TL5 A;  2FAZ A;  2J7Q B;  2N7D A;  4EZK A;  4GMV A;  4W9G A;  2KJR A;  2R2Q A;  2IO3 B;  1WZ0 A;  2IBI B;  4ANX A;  2BWE S;  3EC8 A;  2LWP A;  4W9H A;  3IFW B;  4W9K A;  3ZNZ B;  2ZNV B;  4MH0 E;  5DCN A;  3VTV A;  4PS7 A;  3UIO B;  3I3T B;  2KZR A;  2IO1 B;  3DVN V;  3ECI A;  4GDL A;  2FIF A;  3ML9 A;  2FCS A;  3KVF B;  2MQJ A;  3QX1 A;  2KNB A;  3SHQ A;  1KM7 A;  1UEL A;  2JZZ A;  1S3S G;  2O2V B;  3BY4 B;  4M8M A;  4W9L A;  4AJY B;  4ANV A;  1TBE A;  1F9J A;  2KMC A;  2ZEQ A;  4DWF A;  2DZI A;  1UBI A;  4BKT A;  4E3C A;  1VD2 A;  2DYM A;  1UD7 A;  4FAD A;  3VDZ A;  2L8J A;  3PTF C;  3QAR A;  2CU1 A;  3DBL I;  2LJ5 A;  1XQQ A;  4RM9 A;  2K8H A;  3HM3 A;  3PT2 B;  2MX2 A;  3WAN A;  4AWJ A;  1OTR B;  5DPW A;  1E5W A;  4HDO A;  1V81 A;  2AL3 A;  3L17 A;  2W9N A;  3APC A;  4MGI E;  3DOW A;  4W9D A;  4EEW A;  3DVG Y;  4K7U A;  3QIJ A;  4HPL B;  1SE9 A;  2K1F A;  2RPQ A;  4PYZ A;  3HIZ A;  2LGX A;  3ZTC A;  2LGD A;  2L0T A;  4K7S A;  3VVW B;  4WJP A;  4WQO B;  3ZVV A;  2MBH A;  1A5R A;  2JXX A;  3R66 C;  3IVF A;  5E6N A;  4OVU A;  4MEM A;  2IO0 B;  4IC7 B;  1WYW B;  2KFK B;  4E71 A;  1EUV B;  2DYB A;  1TGZ B;  2JVC A;  2FCM A;  2L00 B;  2ZVO A;  3CSF A;  3NOB A;  4JL9 A;  3T9L A;  2B3A A;  3UIN B;  4A3O A;  1WR1 A;  4LJP B;  2LAS A;  3IBE A;  2IY1 B;  2DEN B;  4PS8 A;  1IYF A;  1WGG A;  2HJ8 A;  3WAL A;  2K8B A;  2O6V A;  2MBQ A;  1KLV A;  4B6W A;  4ZRI A;  1TTN A;  2UYZ B;  4LDT B;  4NNJ B;  2C7M B;  2L7R A;  2LXC A;  5D7G A;  1J0G A;  1R4N I;  3RCZ A;  4J6I A;  2KJ6 A;  4BFR A;  2JWZ A;  2MBO A;  1R4M I;  3H1U A;  4KDL B;  2I1K A;  4P7I A;  3ZDM C;  4MGZ E;  1I35 A;  3UF8 A;  3VUW A;  3JW0 X;  2JRI B;  1Y8R C;  1WMH A;  3ML8 A;  4WJO A;  2MBB B;  5G2N A;  1WJU A;  4BVU C;  4IWO A;  2CR5 A;  4CO7 A;  4BBN F;  1P0R A;  2LRU A;  4HJK A;  1KOT A;  2FID A;  4WAA A;  4BOZ B;  2NPT A;  1V5T A;  1P3Q U;  4TQ0 A;  1H8C A;  1HE8 A;  1UBQ A;  4BBN C;  1H4R A;  4NPN A;  2MSE D;  4GSW A;  3CMM B;  5L83 A;  2MW5 A;  4MSM B;  1WGD A;  3NS8 A;  4B9K A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...