1WF9A

Solution structure of a novel beta-grasp fold like domain of hypothetical protein (arabidopsis thaliana)
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
107
structure length
107
Chain Sequence
GSSGSSGTMLRVRSRDGLERVSVDGPHITVSQLKTLIQDQLQIPIHNQTLSTNRNLLLAKSPSDFLAFTDMADPNLRISSLNLAHGSMVYLAYEGERTIRGSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural genomics, unknown function
molecule keywords NPL4 family protein
publication title Solution structure of a novel beta-grasp fold like domain of Hypothetical protein (Arabidopsis thaliana)
rcsb
source organism Arabidopsis thaliana
total genus 16
structure length 107
sequence length 107
ec nomenclature
pdb deposition date 2004-05-26
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 1wf9A00
2IZVB 5CTRC 1V6EA 3RZFA 1H8CA 4ANUA 3QJZA 2R2OA 4GDLB 2BWFA 4AUQC 2IYDB 2YVCA 2M17A 4NNJB 2O6VB 1WGDA 2K39A 2IO3B 2NBWB 4HCPB 4WJOA 3ZRFA 2RGFA 1WJUA 2I1JA 2CHXA 2KFKA 2LD9A 3ZNID 2KMAA 2JY6A 4AOFA 3ALBA 4F1SA 2C5LC 3DBRI 2V4LA 3A9JB 4FN2A 2LUEA 3T9LA 1WE7A 4ICUA 5JZEB 2KC2A 4M8MA 2GBRA 2LVOA 2KC1A 4WJPA 3ZO5B 2DYMA 2HD5B 2AL6A 3CF6E 4B6WA 2YLMA 3TCAA 3DVNV 2L3ZA 1P0RA 2M4NA 1LFDA 1UBIA 1YQBA 3H9DA 4W9HA 1V80A 2LWPA 4IWQA 2CHZA 2Y5BB 4DBGA 1Z5SB 1L7YA 1WMHB 2G4SA 2KWUB 3PREA 4GGQA 3U7DA 3N3KB 5DPWA 3TBLD 2FCQA 5G55A 4WQOB 2K1FA 1E8ZA 1LXDA 2KN5A 2VRRB 2AEHA 3QA8A 3WAOA 2I1KA 2FIFA 3MTNB 5C23A 4K7UA 3GZNI 4X57B 3ZLZA 1VCBA 1OQYA 2DZKA 2KDIA 2IY0B 4TUUA 3UIPB 2LGXA 1P1AA 2D07B 2N7EA 3JSVB 4NJ6A 1J19A 2G3QB 2MCNB 1WJ4A 4GIVA 2DZJA 4G3XB 5JHBA 1WR1A 2MW5A 2C60A 5IA7A 1E7VA 1RFAA 3OJ3A 1YX5B 4JIOU 4G0NB 2KFJA 1EUVB 3ZIMA 4DK5A 4W9GA 2RPQA 4EZKA 1U4AA 4E74A 2AWTA 2CHWA 1X1MA 2MA9B 1UBQA 3SU8X 4EEWA 4MH0E 2JVCA 4HLEA 3PPAA 2JXXA 3VTWA 3X23A 3WA0A 3DVGY 4J6IA 2J0JA 2BGFA 5LXHA 1L2NA 4KIKB 2C7MB 2N1WA 2KXJA 2AL3A 4FA6A 2KDEB 4DDGD 5DPRA 4W9FA 3ML9A 3EFUA 2D10A 2J7QB 1AARA 3V6CB 4EZLA 4IG7B 2C7NB 1A5RA 4BFRA 1SIFA 2Z0DB 3IFWB 3AU4A 2A4ZA 4P7IA 3HM6X 2MBEA 5E6PA 2KFKB 5DPTA 2IO1B 3V60A 2L76A 3L10B 4FULA 4XZ4A 1UD7A 4HPMB 1C3TA 4AWJA 3TJPA 4LDTB 3WANA 2JZZA 3VDZA 2O2VA 4OVVA 5L95C 4KDIC 1KOTA 2DHZA 2JPHA 4KSKC 2GBNA 2G4DB 1XT9B 4GOCA 2L00B 4HDQA 1GC6A 2NS5A 3APDA 1WF9A 2ASQA 2L7RA 5D2MB 4CO7A 3M95A 3KW5B 3PRZA 3R7QA 4KSLC 1EF1A 4HDOA 5FR6A 3L17A 3DVNU 3UINB 4FHJA 1GNUA 4HVBA 3VAWA 3ZW3A 4GDKA 3IBEA 2KJRA 4IWOA 5J17A 1WXSA 3H7PA 5LLIA 3KUCB 2WDTB 2HE7A 4IM2A 1HE8A 2AYOB 2DYOA 3VFKA 2LGDA 1K8RB 1KM7A 2BYFA 4K7WA 2LZ6A 2XEWA 4W9DA 1E8XA 2MP2A 2RSUA 4W9JA 4ANXA 2IO2B 3N30A 5CHFA 5HKHA 4FJYA 4MGZE 1OTRB 4FBJB 1R4MI 2FCNA 2LJ5A 3APCA 4GMVA 4PS8A 2IBIB 1KLVA 1E90A 4A3PA 3NS8A 3TIXA 3KUDB 3R3MA 3RYTA 1TTNA 3UQAA 4FLHA 2B3AA 1VD2A 2KTRA 3ZDTA 3QARA 2MQJA 4IC7B 4I6LB 3DQVA 3QAQA 2PE9A 2HTHA 5L83A 3B1LX 3V62A 2V3SA 2PE6B 2KANA 2PEAA 3AU5A 3QX1A 5AEKB 1P98A 2KZRA 4JLCA 1WGRA 1WIAA 5CX3A 1S1QB 2KLCA 3P2BA 2EKEC 4FJVB 4MSQB 2LVQA 2MWSB 2V1YA 3PRMB 2RD0A 2MBOA 1WJNA 4TQ0A 2KX0A 1S3SG 1TZ1A 2KNBA 4BKSD 4W9KA 1WXAA 2IO0B 2DAFA 2GBKA 2MX2A 3L54A 3NY5A 5CHVC 1YX6B 2EMSA 4B9KA 1CMXB 4PYZA 4W9IA 3PZDA 3TL5A 2O6VD 3PRPB 4WAAA 1IPGA 3CSTA 4BVUC 5CHWA 2ZCBA 2KJ6A 3NHEB 4A20A 1NI2A 3JVZX 2G45B 1GC7A 2KDFB 2KJHB 3QC8B 4NQLB 1PQSA 3KVFB 4WWNA 1WM2A 1V9JA 2O2VB 3KYDD 2KQ7A 1ZGUB 1Q0WB 1OEYA 1UH6A 2L05A 4G50A 4MGIE 3PV1A 4E3CA 4RM9A 3DDCB 3PS6A 1ZW7A 2ZVNA 3UGBB 3HM3A 3HHMA 4G11A 3VUWA 3RD2A 2ZNVB 4HK2A 5DPSA 5BO4B 1Z2MA 3ZNZB 1SGHA 3HK0A 3VXWA 2RR9A 4XX5A 4W9LA 2BF8B 2KQSA 4CYEA 3I3TB 3PLVA 3ZDMC 3B0AA 3PSEB 1OEYJ 4AJYB 1F9JA 3QIJA 4GDKB 1YD8U 1TGZB 2ZZPB 4AP4C 1WGHA 2M8SA 3H7PB 3DBSA 2K25A 1LQBA 1I42A 1YJ1A 2BKRB 4GU2A 1RLFA 1WGYA 2KX3A 3ZKJC 5D7GA 2DYBA 1WE6A 3VH4B 3V61A 4DHJB 2R2QA 1LM8B 2MP2B 4WWOA 3RZWC 2ZPYA 1WGGA 1MG8A 2D11A 4MELA 2OOBB 3LDZE 4W9EA 3IVFA 4OVUA 4DDID 2LRWA 2KDBA 3VTUA 2BYVE 3N32A 5AZHA 4WWPA 3RCZA 1YIWA 1V86A 2LXCA 5GMVA 1E8YA 2W9NA 3LJ3A 2L0TA 2KTRB 4K81A 4FADA 5J18A 3R7RA 4K7SA 4EKUA 2LXAA 1RAXA 2N9XA 4NPNA 4EUTA 2ZNVC 4PS7A 3AI5A 2JWZA 4BBNC 4ANWA 3UQBA 4URKA 4ICVA 3ZRCA 3QQ8B 3R66C 4HWIB 2LGYA 1XD3B 2ZEQA 2BYEA 4ANVA 2FUHB 3C0RB 4GXBA 4MDKE 1BT0A 1XQQA 2GOWA 4JL9A 2N9PC 3K9OB 3PHXB 4NY0A 1WR6E 4NJ7A 3PLUA 4E71A 2HJ8A 1UZXB 1WI0A 1V5OA 4HXDA 1Y8RC 4HCNB 3D32A 3V6EB 4LJOB 5JHAA 2UWQA 1E5WA 2GBJA 3RULA 3ENEA 1ZKHA 4I6PA 4EZJA 3KUZA 1OGWA 2FIDA 1EF5A 3OLMD 3APFA 3UF8A 1WX8A 2NPTA 3IHPC 4DHZE 2JF5A 3A9KA 2DZMA 2D2QA 3L13A 2LASA 1V81A 3RT3B 2JRHA 2ZPNA 4IUMB 3ZVVA 3VUXA 3GOEA 3TMPB 5LXIB 3SDLC 2GMIC 3PVLA 4LDTD 2JUOA 1WZ0A 3OAWA 1Q5WB 1R4NI 4IW0A 3EHVA 5D6JB 5EDSA 3PT2B 4GB9A 4I6NB 3NZSA 2KTFA 3PHWB 3EECA 1IYFA 2KWCA 2MLBA 3W1SA 1WXVA 2K8CA 2JRIB 4JGHB 3JYUA 3H1UA 4MGKE 3SD5A 4A3OA 1KJTA 3RUIB 2NBUA 2KO3A 3M63B 3CSFA 3QWZB 2KD0A 2LI5A 5D94A 1WZ3A 3DBHI 3K9PB 4GSWA 2Z59B 4F8CB 2DZIA 4HJKA 3ML8A 5KHOA 4KV2A 4AJWA 1I35A 4BKGA 1Q1OA 1RRBA 1H4RA 2XK5A 3BINA 3NOBA 4IM0A 2MBHA 4ZRIA 1D3ZA 1GJZA 2K8BA 3Q3FA 3WAMA 2DX5B 3NZUA 2L0FA 4EFOA 5TR5A 4M0WB 3ONSA 3S2AA 5C1ZA 2CR5A 4MJSA 1EO6A 2WX1A 4IWPA 2NCNA 3X0WA 1E8WA 3H7SA 2MSED 4LCDE 2FNJB 1NDDA 3A33B 2N1VA 4ZRJA 4RM8A 1V2YA 2C7HA 2M0XA 2MBBB 2KOXA 4NQKE 4TKNA 5E6NA 1FXTB 4MEMA 2IY1B 3A1QA 4YL8A 1UELA 3U30A 3O65B 3A4SC 2K6DB 3H6NA 2D3GA 2KVRA 2CU1A 2REXA 3L08A 2WWZA 5AZFA 2K8HA 3QK0A 1E7UA 2FCSA 1GG3A 2C9WB 1WFYA 3KYCD 1G6JA 2MBQA 5AZGA 2JT4B 4ZRKA 3VQIA 3L16A 4NAWA 4MM3A 4TQ1A 1M94A 2OJRA 3SHQA 5E6OA 5J2RA 5IAAC 1WYWB 4JQWC 1WX7A 4MGYE 2K6QA 3DBLI 2KK8A 4BKSA 1WH3A 1J8CA 4DWFA 3VHTC 2NPTB 2J0KA 3W1YA 1WY8A 3A9KB 3MJWA 3ZNHB 5G2NA 3ECIA 2ZVOA 2WX0A 5DCNA 4II2B 4GDLA 4FJZA 2J0MA 2PJHA 4GN1A 2O6VA 4N9F4 4RMAA 3QCAA 4BOSC 2Z0EB 4II3B 4HPLB 2LVPA 3T8MA 4ASWC 1GUAB 4DXAB 4KZCA 1NBFC 4DHZB 3VUYA 4MSMB 3OJ4B 3VTVA 3ZTDA 4B95A 2FCMA 2NR2A 5KHQA 4ZYNA 2N4FA 3A9JA 1V5TA 3AXCA 3EC8A 3DCGA 2CS4A 4M8NA 4PYUA 1IP9A 3VVWB 2PPHA 2KKCA 2UYZB 5JH5C 2BWES 2DAJA 2GBMA 2JZ3B 2BPSA 4LJPB 2M1MA 2ZCCA 2XBBC 4W9CA 3CMMB 2CKHB 4FHKA 1C1YB 3U8ZA 4WJQA 2XK5B 2KLGA 2NVUI 4KZ0A 4DHJD 3MHSD 3QHTA 3VH3B 2NBVB 3ZTCA 1WMHA 2A5UA 3PGEA 2EMTA 4MJSB 3UIOB 4F7ZA 3WIMA 2FAZA 2LRUA 4TV3A 4BKTA 1P9DU 1WXMA 4CHKA 1SE9A 3DOWA 3HIZA 4ZDVA 4IM3A 4KDLB 1TBEA 4XC2A 2KHWB 3M3JA 4KVGB 1JRUA 3IG3A 3PTFC 2WYQA 3B08A 3Q3JA 1T0YA 1UGMA 3A1QB 2L8JA 2N9EB 3A4RA 3JSVA 3W1SC 3WALA 1WJ6A 1QZEA 3DVGX 2QHOA 2ZJDA 1WX9A 3ZUNA 3DPDA 4K1RB 4BOZB 1P3QU 4WJNA 2MRPA 1V49A 2KMCA 3JW0X 3WAPA 2KWVB 3KH0A 3ZNGC 4NAWB 1ISNA 1WRDB 4PS3A 2BKFA 2N7DA 2DENB 1J0GA 3BY4B 3M62B 4KIKA 4BBNF 1WM3A 4EOYA 3L0WB 3AULA
chains in the Genus database with same CATH superfamily
2R2OA 4P1CC 2YVCA 2M17A 3ZRFA 2O6VB 2NBWB 4DQOC 2IO3B 2I2YA 3U52E 1KFYB 1C77A 3EA6A 3GB1A 2L32A 2KMAA 2MEKA 4AOFA 2WXOA 2C5LC 2JSVX 1CJEA 1FM0D 3T9LA 2WXPA 4WJPA 3MC8A 2HD5B 2EELA 2YLMA 5HG2A 2HTME 3DVNV 3AE9B 3BIID 2L3ZA 4UDUC 3AEFB 1UBIA 1YQBA 3PO0A 1V80A 4DXGA 3DBLB 4IDIA 3ZYYX 1VZ7A 4WWMA 1LXDA 2VRRB 3QA8A 2I1KA 1PGBA 2MCNB 3JSVB 4NJ6A 1WJ4A 1EWYC 2C60A 3AEEB 1RFAA 2BB5A 4JIOU 4G0NB 1Q10A 4MT5A 4EZKA 2WDVB 2AWTA 3Q69A 3WA0A 3RMKC 2BGFA 2WXNA 3Q3MC 3AE4B 2KQ4X 3EFUA 1TS5A 3MJ5A 3P42A 4IG7B 4P7IA 3AU4A 3HM6X 1FRRA 1NYRA 2Y5PA 2L76A 3L10B 4XZ4A 3WANA 2E3TA 5H8YE 4KDIC 3T3OA 2TSSA 1TT5B 4HDQA 2NS5A 4M01A 2ASQA 2L7RA 1FPYA 3PRZA 3LXFA 1EF1A 4HDOA 5FR6A 3L17A 3DVNU 2HDEA 4HVBA 1IBXB 2WXIA 3IBEA 2KJRA 4YTPB 4OW0A 3KUCB 2WDTB 2W55A 2LGDA 1K8RB 2BYFA 1E8XA 2RSUA 2WU2B 1YJJA 4MGZE 1OTRB 5IO9A 4BZAA 2FCNA 1WYGA 5IN7A 2IBIB 4A3PA 3NS8A 3R3MA 4XE0A 4WURA 1E10A 4M00A 3DQVA 4HPPA 5L83A 3V62A 2PIAA 1J7BA 5BMIA 1WGRA 2MWSB 2G9HD 1WJNA 1S3SG 1TZ1A 1HZ5A 3ABVB 4JPSA 1V8CA 2SEBD 2BTEA 3L54A 2WLBA 5CHVC 2GBKA 2EKIA 2N9KA 1L6UA 4ARIA 1QLBB 1ZOYB 3EGRA 4W9IA 2V0GA 3PZDA 2O6VD 4OZCA 1FXIA 4A8XC 3TEZA 1PQSA 1WM2A 2O2VB 2PMVA 2L05A 4G50A 1QOAA 1HTOA 3VUWA 3RD2A 3IAM1 3Q2AC 5DPSA 3ZNZB 1D6EC 1SGHA 3HK0A 2WXHA 3H8HA 2KQSA 1FCCC 1F9JA 4AQ7A 1YD8U 1TGZB 2M8SA 3H7PB 3DBSA 2K25A 1LQBA 3BK1A 1RLFA 3Q8BA 5D7GA 1ESFA 2R2QA 3AEBB 2MP2B 5JXVA 3RZWC 2ZPYA 1MG8A 2D11A 2INPE 4OVUA 2M56B 2CJOA 1VRAB 1YIWA 2LXCA 4C4VB 4FADA 4EKUA 1TKYA 4NPNA 1AWDA 4PS7A 3TEWA 4ARCA 3QQ8B 4HWIB 4ANVA 1XD3B 2ZEQA 3C0RB 3HUIA 1XQQA 3SFDB 4NY0A 1WR6E 1V97A 3AM9A 4NJ7A 3PLUA 4LJOB 3RNCC 3RULA 1ZKHA 1OGWA 2H89B 2K3UA 4DHZE 2JF5A 1V1PA 5FKAC 2D2QA 1J7AA 1V81A 3LYYA 2ZPNA 3ZVVA 5LXIB 2GMIC 1L4DB 5EE3A 1K53A 1WZ0A 2JYEA 1ZPSA 2JZPA 3OAWA 5EDSA 2KTFA 3EECA 2MLBA 2JWUA 3SD5A 1KJTA 3RUIB 1CK1A 2NBUA 2KO3A 3KWLA 3ZJVA 1WZ3A 2DZIA 3ML8A 3U7ZA 1H4RA 1XEEA 3WAMA 2XN9C 3OG5A 2DX5B 1DOXA 3NZUA 4EFOA 5C1ZA 1E8WA 2MSED 3A33B 4ZRJA 2KOXA 2IY1B 3A1QA 2GB1A 1B1ZA 1DYQA 1MG4A 3U30A 4P1BC 2DWQA 2WHIA 2R61A 2CU1A 2WWZA 3QK0A 1GG3A 2C9WB 3KYCD 5AZGA 3RPFC 4TQ1A 3SFEB 3SHQA 3FILA 1WYWB 1WX7A 4MGYE 2K6QA 3DBLI 2KK8A 1ZXHA 5IP4D 1MHHE 1ZUD2 3A9KB 5G2NA 2WX0A 4XDDA 2LEKA 2O6VA 2PVGC 3SEBA 2V3NA 3RFZB 4RF1A 4KZCA 1NBFC 3ZXRA 1I4HA 2IGHA 3VUYA 4MSMB 3OJ4B 1B9RA 3AE5B 4ZYNA 2DLBA 4WIPA 3DCGA 2KMMA 4M8NA 3DHHC 4XWWA 3BK2A 1VJKA 2XBBC 3CMMB 3Q14C 1C1YB 3I5JC 1N6ZA 1DOYA 3B9JA 1JALA 3ZXVA 1VZ8A 4TV3A 4BKTA 1WXMA 4CHKA 4IM3A 2OJWA 4XC2A 2KHWB 5G5GA 1R4NB 2WYQA 4A55A 1C78A 2INDC 2L8JA 3JSVA 2GLSA 1QZEA 3DVGX 5EE1A 2KMCA 3JW0X 3DBHB 3ZNGC 4NAWB 4MM3B 4K3BA 2DENB 1YMHE 1K52A 3M62B 4BBNF 5H92C 1WM3A 1YN5A 2IZVB 3RZFA 1H8CA 1MVKA 2IYDB 3RNAC 2K39A 3W5VB 1WJUA 1ZP0B 3HVDA 2LD9A 3ZNID 2JY6A 3ALBA 2V4IB 3BWUD 1WE7A 4LLGM 4PK1A 5JZEB 4M8MA 4KX6B 3CF6E 4B6WA 3TCAA 1AN8A 1C4CA 1XLOA 1SE3A 4IWQA 1IBXA 3GZNB 4JE3B 3PREA 2G4SA 2ACZB 4RH6A 3U7DA 2FCQA 1SE4A 2PLPA 3MTNB 2K5PA 3AE3B 4K7UA 4BAXA 1ET6A 1I4GA 2DZKA 4S0RA 1C76A 4TUUA 3UIPB 2D07B 5MPOA 1J19A 3P4SB 4IKGA 1WR1A 2MW5A 1E7VA 2KFJA 4DK5A 4W9GA 1U4AA 1TS2A 4E74A 2CHWA 1UBQA 3PPAA 3VTWA 3X23A 1SBBB 5LXHA 1L2NA 3GP7A 4LNOA 1E9MA 2AL3A 4FA6A 1FNVA 4DDGD 5DPRA 3ML9A 2D10A 2J7QB 2QJLA 4NAMA 4KKIA 5C3JB 1FNUA 5E6PA 2A4ZA 3C8YA 5DPTA 2IO1B 3PZ7A 1FFUA 1UD7A 3BYYB 2QDFA 4HPMB 3E56A 4AWJA 1OQQA 3VDZA 3VR9B 2O2VA 1WSPA 2DHZA 1ZE3D 2JPHA 1XT9B 5D3DA 4US8A 1GC6A 1WF9A 1FFVA 1L0XB 1BMLC 1YNTE 4WH4A 4KSLC 3DHGC 3KWVA 5J17A 3H7PA 1P7EA 2PKOA 1R4MB 4IM2A 1HE8A 2AYOB 4GLSC 4W9DA 2MP2A 2ONQA 2IO2B 3N30A 4C80A 4FJYA 2LJ5A 4GMVA 1K51A 1E90A 2W3RA 3DBRB 3KUDB 1C4PA 4FLHA 2B3AA 4C4VA 1VD2A 3ZDTA 2MQJA 4I6LB 4RGOS 2PEAA 3AU5A 3N9YC 3QX1A 2WS3B 1K50A 1SXTA 2KZRA 2L83A 5CX3A 1S1QB 2KLCA 1SSNA 4FJVB 2OHFA 2N7JA 3PRMB 2MBOA 3IT4B 4BKSD 3NY5A 3HRDD 1VDVA 2EMSA 3GE8C 1T6BX 1TKGA 1T3QA 1TS3A 3GE3C 4WAAA 4BVUC 2ZCBA 4K3CA 1NI2A 2W54A 3QC8B 3KVFB 4DXFA 1L0VB 1PYWD 1V9JA 1ZGUB 1UH6A 4MGIE 3PV1A 4E3CA 3DDCB 2V3PA 1ZW7A 2ZVNA 1KF6B 3PS6A 4G11A 1Z2MA 4MACA 2MJEA 3I3TB 3PLVA 3ZDMC 4AJYB 1OEYJ 2ZZPB 2J4XA 1N62A 4GU2A 2KX3A 2VZKB 1WE6A 3V61A 2W3SA 4W9EA 1YQ4B 3IVFA 4USAA 1PDXA 3VTUA 4WWPA 3R2TA 1V86A 2CU3A 1E8YA 2W9NA 3V05A 1RWSA 5J18A 3R7RA 4RNAA 4K7SA 1RAXA 1I4XA 4EUTA 3SR6A 3AI5A 2JWZA 4BBNC 3AN1A 3UQBA 2VH1A 1ET9A 1YJIA 5HKHA 3P4QB 1BT0A 4JL9A 4E71A 1UZXB 4NZLB 4HXDA 3NUHB 2H88B 1Y8RC 2LJIA 3Q8FA 3V6EB 4Q2JA 4I6PA 1E0ZA 2PW9A 5HI1A 1F77A 1QF6A 3OLMD 3APFA 2KDMA 1I4RA 2WXJA 2FE8A 3A9KA 2DZMA 1RM6C 3B2FA 1RYJA 1R4NI 2JQRB 4I6NB 3NZSA 2QILA 3PHWB 2KWCA 1QILA 2X38A 2XNAC 1WXVA 2J52A 4L2YA 5FR3A 1T5XD 3M63B 3CSFA 3QWZB 3DBHI 3K9PB 3FAHA 3NG0A 4F8CB 3VR8B 4BKGA 1Q1OA 1D3ZA 2ZW1A 3AEAB 4C00A 1GJZA 2K8BA 1SB3C 1STEA 2WXKA 2JU6X 2L0FA 3S2AA 2BW2A 1DOIA 3E9SA 5I4DA 5HHDG 2WX1A 2IGGA 3FC4A 2GRIA 2FNJB 2BBCA 4RM8A 3N1XC 1FXTB 4MEMA 4LNFA 3BZDB 4YTMB 1FNWA 2REXA 3ZGZA 2K8HA 1G6JA 1WFYA 2JT4B 2BS3B 3L16A 4MM3A 4NAWA 3NS1A 2MJ3A 3RNGC 4JQWC 4B0EA 5IOIA 2I38A 4BKSA 1J8CA 2BB6A 2NPTB 1SE2A 2J0KA 1UWXA 4FJZA 4GN1A 3QCAA 4BOSC 2LVPA 3T8MA 3W2DA 1GUAB 1HA5A 2ZW0A 4DXAB 1UF0A 3U2SC 4DHZB 3ZTDA 2NR2A 5KHQA 1UGJA 1F0ZA 2CS4A 4PYUA 1DGJA 3VVWB 4XGAB 3P4RB 2BWES 2DAJA 2RMMA 1QQRA 4LJPB 1FMAD 1E7PB 4FHKA 2KLGA 2VZKD 4KZ0A 3QHTA 4XYCA 4CQNA 3ZTCA 1FXAA 3PGEA 4MJSB 3URYA 2M0AA 4ZOHC 4F7ZA 1P9DU 2ON8A 3AE6B 3C19A 4KDLB 1JROA 1D4BA 3BVGA 4KVGB 5C2TB 1JRUA 3PTFC 3Q3JA 1T0YA 1GB4A 3A4RA 3I9V1 3WALA 1WJ6A 1HZ6A 3ZUNA 2L1AA 1WX9A 3N20C 4KGTA 4YSYB 3IAS1 2DNFA 1XLNA 1WXQA 4EOYA 1KRHA 4HJGE 3L0WB 3AULA 1V6EA 4ANUA 3V3XA 2BWFA 4AUQC 4NNJB 4HCPB 2RGFA 2D3CA 1D5ZC 3DBRI 4FN2A 1A70A 4ICUA 2WP9B 2LVOA 4JX1C 4RGNA 3ZO5B 2AL6A 3MC0B 2M4NA 2M19A 3H9DA 1TJEA 2CHZA 2Y5BB 2VH2A 1Z5SB 1L7YA 1WMHB 2KWUB 3AEDB 5DPWA 2FBWB 5HFYA 2JYTA 2K1FA 2KN5A 2AEHA 3WAOA 2LHDA 4LK0M 2FIFA 3T3NA 2L52A 4X57B 4C56C 3AEGB 3TEXA 1VCBA 4WQMA 1J7CA 1P1AA 2G3QB 3W5UB 2DZJA 5JHBA 1D5XC 1YX5B 5EE0A 3ZIMA 1HEZE 2RPQA 2N9LA 3SU8X 4EEWA 1LGRA 3EFCA 3ZJTA 4HLEA 2JXXA 3DVGY 4J6IA 3CIRB 2J0JA 3ZQ4A 4HEA1 4KIKB 2C7MB 2KXJA 4W9FA 1AARA 3HVZA 4EZLA 1A5RA 4BFRA 1ENFA 2Z0DB 3AMZA 2AQ3B 3IFWB 1VR9A 4C7ZA 2KFKB 1IGDA 1QOBA 4XDCA 1MHXA 3NVVA 1C3TA 1EU3A 3TJPA 4LDTB 3MC9A 4J3OD 2G4DB 2GBNA 1PGXA 2L00B 4CO7A 5D2MB 3UINB 5G5HA 1VZ6A 3VAWA 3ZW3A 4IWOA 1WXSA 1D5MC 2V9HA 3MFGA 1T0QC 2WXRA 2DYOA 5BMHA 3KLSX 1KM7A 1FD6A 3DHIC 4K7WA 1N5XA 4ANXA 1UUPA 1SIJA 4HRSA 5T8IA 3R8BA 3VRBB 3UI3A 4N58A 1OFFA 3FKYA 1I7HA 4PS8A 1KLVA 3TIXA 2IDYA 3RYTA 1TTNA 3UQAA 3NRZA 1OQRA 4IC7B 4LNNA 3QAQA 2PE9A 2HTHA 3Q8CA 3Q8AA 2V3SA 2LGIA 2Y5CA 5AEKB 1P98A 1C79A 1ZDVA 1WIAA 2EKEC 2J53A 2LVQA 2V1YA 3Q6BA 2RD0A 4TQ0A 2KNBA 1TS4A 3GS2A 2DAFA 5BMGA 2WXQA 4B9KA 1PGAA 3TL5A 3Q8EA 3PRPB 3CSTA 2KJ6A 5BYQA 2KJHB 2MJDA 3KYDD 1OEYA 3UGBB 2JX5A 2ZNVB 4HK2A 5BO4B 4XWTA 3VXWA 4W9LA 2WNMA 3B0AA 3PSEB 3QIJA 4GDKB 2DBYA 4AP4C 1WGHA 3NVWA 1I42A 1YJ1A 2SAKA 4TSSA 4MH8A 2DYBA 4DHJB 1AYFA 3I63C 1TY2A 3DWGC 2OOBB 3LDZE 2PTLA 4DDID 5AUIA 2LRWA 2KDBA 2NTSA 3N32A 3RCZA 1L6VA 5GMVA 3LJ3A 2L0TA 2KTRB 4K81A 4US9A 3AE1B 1GAQB 2LXAA 4ANWA 4URKA 4YSZB 4ICVA 3R66C 1XCQL 2BYEA 4GXBA 4MDKE 1IGCA 4D2KA 3PHXB 1YQ3B 1JWUD 2HJ8A 1V5OA 1JRPA 1NVID 4HCNB 3D32A 1MPEA 2UWQA 1QT9A 2GBJA 4EZJA 3ENEA 4KGSA 2FIDA 1EF5A 3UF8A 1WX8A 2NPTA 2WDQB 2FUG1 2JRHA 1XLQA 3AECB 3DWMA 3PVLA 4LDTD 1QOFA 4FXCA 4LNIA 5D6JB 4GB9A 2OEDA 4KGRA 3W1SA 3B2GA 2K8CA 2JRIB 4MGKE 4ZHOA 2KACA 3IXSA 2PVOD 2KD0A 5D94A 2Z59B 4HJKA 5KHOA 4KV2A 4AJWA 1I35A 2LFIA 3RNEC 5TR5A 4M0WB 3ONSA 2CR5A 4MJSA 1TKEA 4IWPA 3R2IA 3H7SA 4LCDE 2GI9A 4A6QA 1IUEA 2N1VA 5AUKA 1V2YA 1P7FA 4TKNA 1UWMA 2LHEA 2D3GA 2KVRA 1MFWA 5AZFA 5D3IB 3KQ4A 3VQIA 3NVZA 4NJCA 2Y3AA 1JWBD 5IAAC 1WH3A 1N60A 4DWFA 3VHTC 4N6EB 3ZNHB 2ZVOA 5DCNA 4II2B 2J0MA 2PJHA 4N9F4 1F52A 2Z0EB 4HPLB 4ASWC 3VTVA 4ZHPA 3NZ3A 1V5TA 2BS2B 1L5PA 1IP9A 1QOGA 2KKCA 2UYZB 2YEPF 2JZ3B 1KH0A 2BPSA 2QC8A 2ZCCA 5BYRA 2CKHB 3U8ZA 1SEBD 2ICIA 2XK5B 2D5GA 4DHJD 1FEHA 3MHSD 4AS1A 3VH3B 3P4PB 1WMHA 2A5UA 1FRDA 3WIMA 2FAZA 2LRUA 1WGKA 3HIZA 3DOWA 3TUOA 4ZDVA 1SF0A 1LO5D 3IG3A 3B08A 3ETRA 5FK9C 1TYGB 1UGMA 1R7SA 3W1SC 3AB5A 1V1OA 2ZJDA 3DPDA 4BOZB 1P3QU 2K0PA 2RPVA 4RGTA 3RI7C 1XF5L 4A90A 2QEJC 2Q5WD 3KH0A 2WXGA 2BKFA 2Z8LA 4OZAA 4H2AA 4RGMA 3BY4B 1TZOA 4KIKA 4YT0B 5CTRC 4O1NA 4PT5A 3QJZA 4GDLB 3RNFC 1WGDA 4WJOA 2I1JA 2KWDA 2LMCA 2CHXA 1BXTA 2KFKA 3VRAB 4F1SA 2V4LA 3A9JB 2LUEA 1C9FA 4REZA 2KC2A 2GBRA 2BQQA 2KC1A 2LUMA 2DYMA 3BVMA 1NEKB 1P0RA 1AW7A 4TMAB 1LFDA 2MHJA 2WXFA 4W9HA 2RDGA 2LWPA 4DBGA 2BYTA 4WAFA 4YXDB 2D3AA 4GGQA 3N3KB 4YWGG 3TBLD 5G55A 1GPXA 4WQOB 2IJ0A 1E8ZA 3PZ8A 4L23A 1FCLA 5C23A 3GZNI 1JWAD 3ZLZA 1ZXIA 1OQYA 2KDIA 2IY0B 2AQ2B 2LGXA 2N7EA 2X8XX 4GIVA 4G3XB 5IA7A 3OJ3A 1EUVB 1X1MA 2MA9B 1Y56A 2HJ1A 4MH0E 2JVCA 1VLBA 2LGSA 1XXGA 4LNKA 2K9XA 2N1WA 2KDEB 1F2RI 3CWIA 3V6CB 3P63A 2C7NB 1SIFA 2J42A 2WU5B 4RFBA 2MBEA 1JWSD 4LTUA 2INNE 1ROEA 3V60A 4FULA 2JZZA 1GB1A 1ZDXA 4OVVA 5L95C 1KOTA 3L4PA 4KSKC 4GOCA 3Q3OC 1M4VA 2BT6A 3APDA 1JCKB 1XLPA 3M95A 5EE9A 3KW5B 3R7QA 4S17A 4FHJA 1GNUA 4GDKA 4EE2A 5LLIA 1MJDA 2HE7A 4ACFA 3Q3NC 3VFKA 2AX5A 1SJED 1NI3A 5BYSA 2LZ6A 2XEWA 4W9JA 3EUB2 5CHFA 4FBJB 1R4MI 4R3DA 3APCA 1N63A 3AV8A 1L4ZB 2G1EA 2KTRA 3QARA 1HXYD 3RN9C 2KAJA 3B1LX 2RDBC 3AE2B 1JMLA 4ZRQA 2PE6B 2KANA 1FIQA 4JLCA 3I57A 2BVCA 3P2BA 4MSQB 4L1BA 4QAYA 2KX0A 1T0RC 4B0MA 3N1ZC 3N1YC 4W9KA 1WXAA 2IO0B 2MX2A 1MI0A 3BVZA 1YX6B 1CMXB 1NYQA 4PYZA 1CQVA 3TSSA 1IPGA 5CHWA 4A20A 3NHEB 3JVZX 2G45B 1GC7A 2KDFB 4NQLB 4WWNA 2WXLA 2KQ7A 1Q0WB 4RM9A 3HM3A 3HHMA 1JWMD 3BYTB 5E6JA 3W9CB 2B76B 3U4EG 2RR9A 4XX5A 2BF8B 4CYEA 1KLGD 2BKRB 1WGYA 3ZKJC 3VH4B 1LM8B 4WWOA 2AQ1B 1T0SC 1WGGA 3MP9A 4MELA 4C7YA 1TY0A 1ACCA 1JQ4A 1WRIA 3MHZA 3WCQA 2BYVE 4M0WA 5AZHA 2KVZA 1SJHD 3ZJUA 2N9XA 1HTQA 2ZNVC 3ZRCA 2KYWA 2LGYA 2FUHB 4KKJA 5TSSA 2GOWA 3NJTA 2N9PC 3K9OB 1RFKA 1WI0A 3OWEB 1F2RC 5JHAA 4ZRPA 1E5WA 2N0SB 1YN4A 1EU4A 3IT6B 3KUZA 1HQRD 1KLUD 3IHPC 2WGSA 2UU7A 2QCZA 3L13A 2LASA 4JWSC 3RT3B 4IUMB 4HKZE 3VUXA 3GOEA 3TMPB 1KTKA 3SDLC 2JUOA 4HROA 1CZPA 4IW0A 1Q5WB 2WXMA 2YEPB 3EHVA 3PT2B 3RNBC 1IYFA 1YOVB 4JGHB 3JYUA 3H1UA 4A3OA 1N61A 4ZYSA 2LI5A 4GSWA 4N59A 1PFDA 1RRBA 1JW9D 2XK5A 3BINA 3NOBA 4IM0A 2MBHA 4ZRIA 3Q3FA 1L0YB 1E6EB 4JWUC 2E6XA 2RDHA 5IKCM 1EO6A 2NCNA 3X0WA 4YSXB 1QKZA 1NDDA 1WWTA 2C7HA 2M0XA 2MBBB 4NQKE 4OZBA 5E6NA 2IGDA 4RCOA 1GOZA 4YL8A 1UELA 1EWCA 2WDRB 3A4SC 3O65B 2K6DB 2WQYB 3H6NA 3L08A 2INCC 1E7UA 2FCSA 2MBQA 4ZRKA 1M94A 2OJRA 5E6OA 5J2RA 2JXTA 3W1YA 5LNK1 1WY8A 1XCTL 1V1PB 3AE7B 3MJWA 3ECIA 4A9AA 1I4PA 4GDLA 4RMAA 4ITKA 4II3B 1I4QA 1XO3A 2MH7A 3AE8B 4HKQA 2CJNA 1FO4A 4OVZA 1N5WA 2FCMA 4B95A 2N4FA 1NENB 2KT7A 3A9JA 3AXCA 4IOIE 2QSDA 3EC8A 4P6VF 3NVYA 5GXGB 2PPHA 5JH5C 2GBMA 3AH7A 2M1MA 4W9CA 4M02A 1PUTA 4WJQA 2W82A 2IPKD 2NVUI 1F1HA 2NBVB 2K22A 3O13A 2EMTA 3UIOB 3J9CA 2NTTA 4RF0A 2QMTA 1BUIC 1SE9A 1TBEA 3M3JA 2NMQA 3P1MA 3A1QB 2N9EB 4P16A 1C4AA 2QHOA 4K1RB 4WJNA 2MRPA 1V49A 4OHJA 1YN3A 4YTNB 1TIFA 1EM7A 1UNSA 2D3BA 3WAPA 2KWVB 3LB8C 2KN4A 3TEYA 1ISNA 1WRDB 4PS3A 3FILB 2N7DA 1J0GA 2QIEB 2BS4B
chains in the Genus database with same CATH topology
2IZVB 5CTRC 1V6EA 3RZFA 1H8CA 4ANUA 3QJZA 2R2OA 4GDLB 2BWFA 4AUQC 2IYDB 2YVCA 2M17A 4NNJB 2O6VB 1WGDA 2K39A 2IO3B 2NBWB 4HCPB 4WJOA 3ZRFA 2RGFA 1WJUA 2I1JA 2CHXA 2KFKA 2LD9A 3ZNID 2KMAA 2JY6A 4AOFA 3ALBA 4F1SA 2C5LC 3DBRI 2V4LA 3A9JB 4FN2A 2LUEA 3T9LA 1WE7A 4ICUA 5JZEB 2KC2A 4M8MA 2GBRA 2LVOA 2KC1A 4WJPA 3ZO5B 2DYMA 2HD5B 2AL6A 3CF6E 4B6WA 2YLMA 3TCAA 3DVNV 2L3ZA 1P0RA 2M4NA 1LFDA 1UBIA 1YQBA 3H9DA 4W9HA 1V80A 2LWPA 4IWQA 2CHZA 2Y5BB 4DBGA 1Z5SB 1L7YA 1WMHB 2G4SA 2KWUB 3PREA 4GGQA 3U7DA 3N3KB 5DPWA 3TBLD 2FCQA 5G55A 4WQOB 2K1FA 1E8ZA 1LXDA 2KN5A 2VRRB 2AEHA 3QA8A 3WAOA 2I1KA 2FIFA 3MTNB 5C23A 4K7UA 3GZNI 4X57B 3ZLZA 1VCBA 1OQYA 2DZKA 2KDIA 2IY0B 4TUUA 3UIPB 2LGXA 1P1AA 2D07B 2N7EA 3JSVB 4NJ6A 1J19A 2G3QB 2MCNB 1WJ4A 4GIVA 2DZJA 4G3XB 5JHBA 1WR1A 2MW5A 2C60A 5IA7A 1E7VA 1RFAA 3OJ3A 1YX5B 4JIOU 4G0NB 2KFJA 1EUVB 3ZIMA 4DK5A 4W9GA 2RPQA 4EZKA 1U4AA 4E74A 2AWTA 2CHWA 1X1MA 2MA9B 1UBQA 3SU8X 4EEWA 4MH0E 2JVCA 4HLEA 3PPAA 2JXXA 3VTWA 3X23A 3WA0A 3DVGY 4J6IA 2J0JA 2BGFA 5LXHA 1L2NA 4KIKB 2C7MB 2N1WA 2KXJA 2AL3A 4FA6A 2KDEB 4DDGD 5DPRA 4W9FA 3ML9A 3EFUA 2D10A 2J7QB 1AARA 3V6CB 4EZLA 4IG7B 2C7NB 1A5RA 4BFRA 1SIFA 2Z0DB 3IFWB 3AU4A 2A4ZA 4P7IA 3HM6X 2MBEA 5E6PA 2KFKB 5DPTA 2IO1B 3V60A 2L76A 3L10B 4FULA 4XZ4A 1UD7A 4HPMB 1C3TA 4AWJA 3TJPA 4LDTB 3WANA 2JZZA 3VDZA 2O2VA 4OVVA 5L95C 4KDIC 1KOTA 2DHZA 2JPHA 4KSKC 2GBNA 2G4DB 1XT9B 4GOCA 2L00B 4HDQA 1GC6A 2NS5A 3APDA 1WF9A 2ASQA 2L7RA 5D2MB 4CO7A 3M95A 3KW5B 3PRZA 3R7QA 4KSLC 1EF1A 4HDOA 5FR6A 3L17A 3DVNU 3UINB 4FHJA 1GNUA 4HVBA 3VAWA 3ZW3A 4GDKA 3IBEA 2KJRA 4IWOA 5J17A 1WXSA 3H7PA 5LLIA 3KUCB 2WDTB 2HE7A 4IM2A 1HE8A 2AYOB 2DYOA 3VFKA 2LGDA 1K8RB 1KM7A 2BYFA 4K7WA 2LZ6A 2XEWA 4W9DA 1E8XA 2MP2A 2RSUA 4W9JA 4ANXA 2IO2B 3N30A 5CHFA 5HKHA 4FJYA 4MGZE 1OTRB 4FBJB 1R4MI 2FCNA 2LJ5A 3APCA 4GMVA 4PS8A 2IBIB 1KLVA 1E90A 4A3PA 3NS8A 3TIXA 3KUDB 3R3MA 3RYTA 1TTNA 3UQAA 4FLHA 2B3AA 1VD2A 2KTRA 3ZDTA 3QARA 2MQJA 4IC7B 4I6LB 3DQVA 3QAQA 2PE9A 2HTHA 5L83A 3B1LX 3V62A 2V3SA 2PE6B 2KANA 2PEAA 3AU5A 3QX1A 5AEKB 1P98A 2KZRA 4JLCA 1WGRA 1WIAA 5CX3A 1S1QB 2KLCA 3P2BA 2EKEC 4FJVB 4MSQB 2LVQA 2MWSB 2V1YA 3PRMB 2RD0A 2MBOA 1WJNA 4TQ0A 2KX0A 1S3SG 1TZ1A 2KNBA 4BKSD 4W9KA 1WXAA 2IO0B 2DAFA 2GBKA 2MX2A 3L54A 3NY5A 5CHVC 1YX6B 2EMSA 4B9KA 1CMXB 4PYZA 4W9IA 3PZDA 3TL5A 2O6VD 3PRPB 4WAAA 1IPGA 3CSTA 4BVUC 5CHWA 2ZCBA 2KJ6A 3NHEB 4A20A 1NI2A 3JVZX 2G45B 1GC7A 2KDFB 2KJHB 3QC8B 4NQLB 1PQSA 3KVFB 4WWNA 1WM2A 1V9JA 2O2VB 3KYDD 2KQ7A 1ZGUB 1Q0WB 1OEYA 1UH6A 2L05A 4G50A 4MGIE 3PV1A 4E3CA 4RM9A 3DDCB 3PS6A 1ZW7A 2ZVNA 3UGBB 3HM3A 3HHMA 4G11A 3VUWA 3RD2A 2ZNVB 4HK2A 5DPSA 5BO4B 1Z2MA 3ZNZB 1SGHA 3HK0A 3VXWA 2RR9A 4XX5A 4W9LA 2BF8B 2KQSA 4CYEA 3I3TB 3PLVA 3ZDMC 3B0AA 3PSEB 1OEYJ 4AJYB 1F9JA 3QIJA 4GDKB 1YD8U 1TGZB 2ZZPB 4AP4C 1WGHA 2M8SA 3H7PB 3DBSA 2K25A 1LQBA 1I42A 1YJ1A 2BKRB 4GU2A 1RLFA 1WGYA 2KX3A 3ZKJC 5D7GA 2DYBA 1WE6A 3VH4B 3V61A 4DHJB 2R2QA 1LM8B 2MP2B 4WWOA 3RZWC 2ZPYA 1WGGA 1MG8A 2D11A 4MELA 2OOBB 3LDZE 4W9EA 3IVFA 4OVUA 4DDID 2LRWA 2KDBA 3VTUA 2BYVE 3N32A 5AZHA 4WWPA 3RCZA 1YIWA 1V86A 2LXCA 5GMVA 1E8YA 2W9NA 3LJ3A 2L0TA 2KTRB 4K81A 4FADA 5J18A 3R7RA 4K7SA 4EKUA 2LXAA 1RAXA 2N9XA 4NPNA 4EUTA 2ZNVC 4PS7A 3AI5A 2JWZA 4BBNC 4ANWA 3UQBA 4URKA 4ICVA 3ZRCA 3QQ8B 3R66C 4HWIB 2LGYA 1XD3B 2ZEQA 2BYEA 4ANVA 2FUHB 3C0RB 4GXBA 4MDKE 1BT0A 1XQQA 2GOWA 4JL9A 2N9PC 3K9OB 3PHXB 4NY0A 1WR6E 4NJ7A 3PLUA 4E71A 2HJ8A 1UZXB 1WI0A 1V5OA 4HXDA 1Y8RC 4HCNB 3D32A 3V6EB 4LJOB 5JHAA 2UWQA 1E5WA 2GBJA 3RULA 3ENEA 1ZKHA 4I6PA 4EZJA 3KUZA 1OGWA 2FIDA 1EF5A 3OLMD 3APFA 3UF8A 1WX8A 2NPTA 3IHPC 4DHZE 2JF5A 3A9KA 2DZMA 2D2QA 3L13A 2LASA 1V81A 3RT3B 2JRHA 2ZPNA 4IUMB 3ZVVA 3VUXA 3GOEA 3TMPB 5LXIB 3SDLC 2GMIC 3PVLA 4LDTD 2JUOA 1WZ0A 3OAWA 1Q5WB 1R4NI 4IW0A 3EHVA 5D6JB 5EDSA 3PT2B 4GB9A 4I6NB 3NZSA 2KTFA 3PHWB 3EECA 1IYFA 2KWCA 2MLBA 3W1SA 1WXVA 2K8CA 2JRIB 4JGHB 3JYUA 3H1UA 4MGKE 3SD5A 4A3OA 1KJTA 3RUIB 2NBUA 2KO3A 3M63B 3CSFA 3QWZB 2KD0A 2LI5A 5D94A 1WZ3A 3DBHI 3K9PB 4GSWA 2Z59B 4F8CB 2DZIA 4HJKA 3ML8A 5KHOA 4KV2A 4AJWA 1I35A 4BKGA 1Q1OA 1RRBA 1H4RA 2XK5A 3BINA 3NOBA 4IM0A 2MBHA 4ZRIA 1D3ZA 1GJZA 2K8BA 3Q3FA 3WAMA 2DX5B 3NZUA 2L0FA 4EFOA 5TR5A 4M0WB 3ONSA 3S2AA 5C1ZA 2CR5A 4MJSA 1EO6A 2WX1A 4IWPA 2NCNA 3X0WA 1E8WA 3H7SA 2MSED 4LCDE 2FNJB 1NDDA 3A33B 2N1VA 4ZRJA 4RM8A 1V2YA 2C7HA 2M0XA 2MBBB 2KOXA 4NQKE 4TKNA 5E6NA 1FXTB 4MEMA 2IY1B 3A1QA 4YL8A 1UELA 3U30A 3O65B 3A4SC 2K6DB 3H6NA 2D3GA 2KVRA 2CU1A 2REXA 3L08A 2WWZA 5AZFA 2K8HA 3QK0A 1E7UA 2FCSA 1GG3A 2C9WB 1WFYA 3KYCD 1G6JA 2MBQA 5AZGA 2JT4B 4ZRKA 3VQIA 3L16A 4NAWA 4MM3A 4TQ1A 1M94A 2OJRA 3SHQA 5E6OA 5J2RA 5IAAC 1WYWB 4JQWC 1WX7A 4MGYE 2K6QA 3DBLI 2KK8A 4BKSA 1WH3A 1J8CA 4DWFA 3VHTC 2NPTB 2J0KA 3W1YA 1WY8A 3A9KB 3MJWA 3ZNHB 5G2NA 3ECIA 2ZVOA 2WX0A 5DCNA 4II2B 4GDLA 4FJZA 2J0MA 2PJHA 4GN1A 2O6VA 4N9F4 4RMAA 3QCAA 4BOSC 2Z0EB 4II3B 4HPLB 2LVPA 3T8MA 4ASWC 1GUAB 4DXAB 4KZCA 1NBFC 4DHZB 3VUYA 4MSMB 3OJ4B 3VTVA 3ZTDA 4B95A 2FCMA 2NR2A 5KHQA 4ZYNA 2N4FA 3A9JA 1V5TA 3AXCA 3EC8A 3DCGA 2CS4A 4M8NA 4PYUA 1IP9A 3VVWB 2PPHA 2KKCA 2UYZB 5JH5C 2BWES 2DAJA 2GBMA 2JZ3B 2BPSA 4LJPB 2M1MA 2ZCCA 2XBBC 4W9CA 3CMMB 2CKHB 4FHKA 1C1YB 3U8ZA 4WJQA 2XK5B 2KLGA 2NVUI 4KZ0A 4DHJD 3MHSD 3QHTA 3VH3B 2NBVB 3ZTCA 1WMHA 2A5UA 3PGEA 2EMTA 4MJSB 3UIOB 4F7ZA 3WIMA 2FAZA 2LRUA 4TV3A 4BKTA 1P9DU 1WXMA 4CHKA 1SE9A 3DOWA 3HIZA 4ZDVA 4IM3A 4KDLB 1TBEA 4XC2A 2KHWB 3M3JA 4KVGB 1JRUA 3IG3A 3PTFC 2WYQA 3B08A 3Q3JA 1T0YA 1UGMA 3A1QB 2L8JA 2N9EB 3A4RA 3JSVA 3W1SC 3WALA 1WJ6A 1QZEA 3DVGX 2QHOA 2ZJDA 1WX9A 3ZUNA 3DPDA 4K1RB 4BOZB 1P3QU 4WJNA 2MRPA 1V49A 2KMCA 3JW0X 3WAPA 2KWVB 3KH0A 3ZNGC 4NAWB 1ISNA 1WRDB 4PS3A 2BKFA 2N7DA 2DENB 1J0GA 3BY4B 3M62B 4KIKA 4BBNF 1WM3A 4EOYA 3L0WB 3AULA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2IZV B;  5CTR C;  1V6E A;  3RZF A;  1H8C A;  4ANU A;  3QJZ A;  2R2O A;  4GDL B;  2BWF A;  4AUQ C;  2IYD B;  2YVC A;  2M17 A;  4NNJ B;  2O6V B;  1WGD A;  2K39 A;  2IO3 B;  2NBW B;  4HCP B;  4WJO A;  3ZRF A;  2RGF A;  1WJU A;  2I1J A;  2CHX A;  2KFK A;  2LD9 A;  3ZNI D;  2KMA A;  2JY6 A;  4AOF A;  3ALB A;  4F1S A;  2C5L C;  3DBR I;  2V4L A;  3A9J B;  4FN2 A;  2LUE A;  3T9L A;  1WE7 A;  4ICU A;  5JZE B;  2KC2 A;  4M8M A;  2GBR A;  2LVO A;  2KC1 A;  4WJP A;  3ZO5 B;  2DYM A;  2HD5 B;  2AL6 A;  3CF6 E;  4B6W A;  2YLM A;  3TCA A;  3DVN V;  2L3Z A;  1P0R A;  2M4N A;  1LFD A;  1UBI A;  1YQB A;  3H9D A;  4W9H A;  1V80 A;  2LWP A;  4IWQ A;  2CHZ A;  2Y5B B;  4DBG A;  1Z5S B;  1L7Y A;  1WMH B;  2G4S A;  2KWU B;  3PRE A;  4GGQ A;  3U7D A;  3N3K B;  5DPW A;  3TBL D;  2FCQ A;  5G55 A;  4WQO B;  2K1F A;  1E8Z A;  1LXD A;  2KN5 A;  2VRR B;  2AEH A;  3QA8 A;  3WAO A;  2I1K A;  2FIF A;  3MTN B;  5C23 A;  4K7U A;  3GZN I;  4X57 B;  3ZLZ A;  1VCB A;  1OQY A;  2DZK A;  2KDI A;  2IY0 B;  4TUU A;  3UIP B;  2LGX A;  1P1A A;  2D07 B;  2N7E A;  3JSV B;  4NJ6 A;  1J19 A;  2G3Q B;  2MCN B;  1WJ4 A;  4GIV A;  2DZJ A;  4G3X B;  5JHB A;  1WR1 A;  2MW5 A;  2C60 A;  5IA7 A;  1E7V A;  1RFA A;  3OJ3 A;  1YX5 B;  4JIO U;  4G0N B;  2KFJ A;  1EUV B;  3ZIM A;  4DK5 A;  4W9G A;  2RPQ A;  4EZK A;  1U4A A;  4E74 A;  2AWT A;  2CHW A;  1X1M A;  2MA9 B;  1UBQ A;  3SU8 X;  4EEW A;  4MH0 E;  2JVC A;  4HLE A;  3PPA A;  2JXX A;  3VTW A;  3X23 A;  3WA0 A;  3DVG Y;  4J6I A;  2J0J A;  2BGF A;  5LXH A;  1L2N A;  4KIK B;  2C7M B;  2N1W A;  2KXJ A;  2AL3 A;  4FA6 A;  2KDE B;  4DDG D;  5DPR A;  4W9F A;  3ML9 A;  3EFU A;  2D10 A;  2J7Q B;  1AAR A;  3V6C B;  4EZL A;  4IG7 B;  2C7N B;  1A5R A;  4BFR A;  1SIF A;  2Z0D B;  3IFW B;  3AU4 A;  2A4Z A;  4P7I A;  3HM6 X;  2MBE A;  5E6P A;  2KFK B;  5DPT A;  2IO1 B;  3V60 A;  2L76 A;  3L10 B;  4FUL A;  4XZ4 A;  1UD7 A;  4HPM B;  1C3T A;  4AWJ A;  3TJP A;  4LDT B;  3WAN A;  2JZZ A;  3VDZ A;  2O2V A;  4OVV A;  5L95 C;  4KDI C;  1KOT A;  2DHZ A;  2JPH A;  4KSK C;  2GBN A;  2G4D B;  1XT9 B;  4GOC A;  2L00 B;  4HDQ A;  1GC6 A;  2NS5 A;  3APD A;  1WF9 A;  2ASQ A;  2L7R A;  5D2M B;  4CO7 A;  3M95 A;  3KW5 B;  3PRZ A;  3R7Q A;  4KSL C;  1EF1 A;  4HDO A;  5FR6 A;  3L17 A;  3DVN U;  3UIN B;  4FHJ A;  1GNU A;  4HVB A;  3VAW A;  3ZW3 A;  4GDK A;  3IBE A;  2KJR A;  4IWO A;  5J17 A;  1WXS A;  3H7P A;  5LLI A;  3KUC B;  2WDT B;  2HE7 A;  4IM2 A;  1HE8 A;  2AYO B;  2DYO A;  3VFK A;  2LGD A;  1K8R B;  1KM7 A;  2BYF A;  4K7W A;  2LZ6 A;  2XEW A;  4W9D A;  1E8X A;  2MP2 A;  2RSU A;  4W9J A;  4ANX A;  2IO2 B;  3N30 A;  5CHF A;  5HKH A;  4FJY A;  4MGZ E;  1OTR B;  4FBJ B;  1R4M I;  2FCN A;  2LJ5 A;  3APC A;  4GMV A;  4PS8 A;  2IBI B;  1KLV A;  1E90 A;  4A3P A;  3NS8 A;  3TIX A;  3KUD B;  3R3M A;  3RYT A;  1TTN A;  3UQA A;  4FLH A;  2B3A A;  1VD2 A;  2KTR A;  3ZDT A;  3QAR A;  2MQJ A;  4IC7 B;  4I6L B;  3DQV A;  3QAQ A;  2PE9 A;  2HTH A;  5L83 A;  3B1L X;  3V62 A;  2V3S A;  2PE6 B;  2KAN A;  2PEA A;  3AU5 A;  3QX1 A;  5AEK B;  1P98 A;  2KZR A;  4JLC A;  1WGR A;  1WIA A;  5CX3 A;  1S1Q B;  2KLC A;  3P2B A;  2EKE C;  4FJV B;  4MSQ B;  2LVQ A;  2MWS B;  2V1Y A;  3PRM B;  2RD0 A;  2MBO A;  1WJN A;  4TQ0 A;  2KX0 A;  1S3S G;  1TZ1 A;  2KNB A;  4BKS D;  4W9K A;  1WXA A;  2IO0 B;  2DAF A;  2GBK A;  2MX2 A;  3L54 A;  3NY5 A;  5CHV C;  1YX6 B;  2EMS A;  4B9K A;  1CMX B;  4PYZ A;  4W9I A;  3PZD A;  3TL5 A;  2O6V D;  3PRP B;  4WAA A;  1IPG A;  3CST A;  4BVU C;  5CHW A;  2ZCB A;  2KJ6 A;  3NHE B;  4A20 A;  1NI2 A;  3JVZ X;  2G45 B;  1GC7 A;  2KDF B;  2KJH B;  3QC8 B;  4NQL B;  1PQS A;  3KVF B;  4WWN A;  1WM2 A;  1V9J A;  2O2V B;  3KYD D;  2KQ7 A;  1ZGU B;  1Q0W B;  1OEY A;  1UH6 A;  2L05 A;  4G50 A;  4MGI E;  3PV1 A;  4E3C A;  4RM9 A;  3DDC B;  3PS6 A;  1ZW7 A;  2ZVN A;  3UGB B;  3HM3 A;  3HHM A;  4G11 A;  3VUW A;  3RD2 A;  2ZNV B;  4HK2 A;  5DPS A;  5BO4 B;  1Z2M A;  3ZNZ B;  1SGH A;  3HK0 A;  3VXW A;  2RR9 A;  4XX5 A;  4W9L A;  2BF8 B;  2KQS A;  4CYE A;  3I3T B;  3PLV A;  3ZDM C;  3B0A A;  3PSE B;  1OEY J;  4AJY B;  1F9J A;  3QIJ A;  4GDK B;  1YD8 U;  1TGZ B;  2ZZP B;  4AP4 C;  1WGH A;  2M8S A;  3H7P B;  3DBS A;  2K25 A;  1LQB A;  1I42 A;  1YJ1 A;  2BKR B;  4GU2 A;  1RLF A;  1WGY A;  2KX3 A;  3ZKJ C;  5D7G A;  2DYB A;  1WE6 A;  3VH4 B;  3V61 A;  4DHJ B;  2R2Q A;  1LM8 B;  2MP2 B;  4WWO A;  3RZW C;  2ZPY A;  1WGG A;  1MG8 A;  2D11 A;  4MEL A;  2OOB B;  3LDZ E;  4W9E A;  3IVF A;  4OVU A;  4DDI D;  2LRW A;  2KDB A;  3VTU A;  2BYV E;  3N32 A;  5AZH A;  4WWP A;  3RCZ A;  1YIW A;  1V86 A;  2LXC A;  5GMV A;  1E8Y A;  2W9N A;  3LJ3 A;  2L0T A;  2KTR B;  4K81 A;  4FAD A;  5J18 A;  3R7R A;  4K7S A;  4EKU A;  2LXA A;  1RAX A;  2N9X A;  4NPN A;  4EUT A;  2ZNV C;  4PS7 A;  3AI5 A;  2JWZ A;  4BBN C;  4ANW A;  3UQB A;  4URK A;  4ICV A;  3ZRC A;  3QQ8 B;  3R66 C;  4HWI B;  2LGY A;  1XD3 B;  2ZEQ A;  2BYE A;  4ANV A;  2FUH B;  3C0R B;  4GXB A;  4MDK E;  1BT0 A;  1XQQ A;  2GOW A;  4JL9 A;  2N9P C;  3K9O B;  3PHX B;  4NY0 A;  1WR6 E;  4NJ7 A;  3PLU A;  4E71 A;  2HJ8 A;  1UZX B;  1WI0 A;  1V5O A;  4HXD A;  1Y8R C;  4HCN B;  3D32 A;  3V6E B;  4LJO B;  5JHA A;  2UWQ A;  1E5W A;  2GBJ A;  3RUL A;  3ENE A;  1ZKH A;  4I6P A;  4EZJ A;  3KUZ A;  1OGW A;  2FID A;  1EF5 A;  3OLM D;  3APF A;  3UF8 A;  1WX8 A;  2NPT A;  3IHP C;  4DHZ E;  2JF5 A;  3A9K A;  2DZM A;  2D2Q A;  3L13 A;  2LAS A;  1V81 A;  3RT3 B;  2JRH A;  2ZPN A;  4IUM B;  3ZVV A;  3VUX A;  3GOE A;  3TMP B;  5LXI B;  3SDL C;  2GMI C;  3PVL A;  4LDT D;  2JUO A;  1WZ0 A;  3OAW A;  1Q5W B;  1R4N I;  4IW0 A;  3EHV A;  5D6J B;  5EDS A;  3PT2 B;  4GB9 A;  4I6N B;  3NZS A;  2KTF A;  3PHW B;  3EEC A;  1IYF A;  2KWC A;  2MLB A;  3W1S A;  1WXV A;  2K8C A;  2JRI B;  4JGH B;  3JYU A;  3H1U A;  4MGK E;  3SD5 A;  4A3O A;  1KJT A;  3RUI B;  2NBU A;  2KO3 A;  3M63 B;  3CSF A;  3QWZ B;  2KD0 A;  2LI5 A;  5D94 A;  1WZ3 A;  3DBH I;  3K9P B;  4GSW A;  2Z59 B;  4F8C B;  2DZI A;  4HJK A;  3ML8 A;  5KHO A;  4KV2 A;  4AJW A;  1I35 A;  4BKG A;  1Q1O A;  1RRB A;  1H4R A;  2XK5 A;  3BIN A;  3NOB A;  4IM0 A;  2MBH A;  4ZRI A;  1D3Z A;  1GJZ A;  2K8B A;  3Q3F A;  3WAM A;  2DX5 B;  3NZU A;  2L0F A;  4EFO A;  5TR5 A;  4M0W B;  3ONS A;  3S2A A;  5C1Z A;  2CR5 A;  4MJS A;  1EO6 A;  2WX1 A;  4IWP A;  2NCN A;  3X0W A;  1E8W A;  3H7S A;  2MSE D;  4LCD E;  2FNJ B;  1NDD A;  3A33 B;  2N1V A;  4ZRJ A;  4RM8 A;  1V2Y A;  2C7H A;  2M0X A;  2MBB B;  2KOX A;  4NQK E;  4TKN A;  5E6N A;  1FXT B;  4MEM A;  2IY1 B;  3A1Q A;  4YL8 A;  1UEL A;  3U30 A;  3O65 B;  3A4S C;  2K6D B;  3H6N A;  2D3G A;  2KVR A;  2CU1 A;  2REX A;  3L08 A;  2WWZ A;  5AZF A;  2K8H A;  3QK0 A;  1E7U A;  2FCS A;  1GG3 A;  2C9W B;  1WFY A;  3KYC D;  1G6J A;  2MBQ A;  5AZG A;  2JT4 B;  4ZRK A;  3VQI A;  3L16 A;  4NAW A;  4MM3 A;  4TQ1 A;  1M94 A;  2OJR A;  3SHQ A;  5E6O A;  5J2R A;  5IAA C;  1WYW B;  4JQW C;  1WX7 A;  4MGY E;  2K6Q A;  3DBL I;  2KK8 A;  4BKS A;  1WH3 A;  1J8C A;  4DWF A;  3VHT C;  2NPT B;  2J0K A;  3W1Y A;  1WY8 A;  3A9K B;  3MJW A;  3ZNH B;  5G2N A;  3ECI A;  2ZVO A;  2WX0 A;  5DCN A;  4II2 B;  4GDL A;  4FJZ A;  2J0M A;  2PJH A;  4GN1 A;  2O6V A;  4N9F 4;  4RMA A;  3QCA A;  4BOS C;  2Z0E B;  4II3 B;  4HPL B;  2LVP A;  3T8M A;  4ASW C;  1GUA B;  4DXA B;  4KZC A;  1NBF C;  4DHZ B;  3VUY A;  4MSM B;  3OJ4 B;  3VTV A;  3ZTD A;  4B95 A;  2FCM A;  2NR2 A;  5KHQ A;  4ZYN A;  2N4F A;  3A9J A;  1V5T A;  3AXC A;  3EC8 A;  3DCG A;  2CS4 A;  4M8N A;  4PYU A;  1IP9 A;  3VVW B;  2PPH A;  2KKC A;  2UYZ B;  5JH5 C;  2BWE S;  2DAJ A;  2GBM A;  2JZ3 B;  2BPS A;  4LJP B;  2M1M A;  2ZCC A;  2XBB C;  4W9C A;  3CMM B;  2CKH B;  4FHK A;  1C1Y B;  3U8Z A;  4WJQ A;  2XK5 B;  2KLG A;  2NVU I;  4KZ0 A;  4DHJ D;  3MHS D;  3QHT A;  3VH3 B;  2NBV B;  3ZTC A;  1WMH A;  2A5U A;  3PGE A;  2EMT A;  4MJS B;  3UIO B;  4F7Z A;  3WIM A;  2FAZ A;  2LRU A;  4TV3 A;  4BKT A;  1P9D U;  1WXM A;  4CHK A;  1SE9 A;  3DOW A;  3HIZ A;  4ZDV A;  4IM3 A;  4KDL B;  1TBE A;  4XC2 A;  2KHW B;  3M3J A;  4KVG B;  1JRU A;  3IG3 A;  3PTF C;  2WYQ A;  3B08 A;  3Q3J A;  1T0Y A;  1UGM A;  3A1Q B;  2L8J A;  2N9E B;  3A4R A;  3JSV A;  3W1S C;  3WAL A;  1WJ6 A;  1QZE A;  3DVG X;  2QHO A;  2ZJD A;  1WX9 A;  3ZUN A;  3DPD A;  4K1R B;  4BOZ B;  1P3Q U;  4WJN A;  2MRP A;  1V49 A;  2KMC A;  3JW0 X;  3WAP A;  2KWV B;  3KH0 A;  3ZNG C;  4NAW B;  1ISN A;  1WRD B;  4PS3 A;  2BKF A;  2N7D A;  2DEN B;  1J0G A;  3BY4 B;  3M62 B;  4KIK A;  4BBN F;  1WM3 A;  4EOY A;  3L0W B;  3AUL A; 
#chains in the Genus database with same CATH topology
 2R2O A;  4P1C C;  2YVC A;  2M17 A;  3ZRF A;  2O6V B;  2NBW B;  4DQO C;  2IO3 B;  2I2Y A;  3U52 E;  1KFY B;  1C77 A;  3EA6 A;  3GB1 A;  2L32 A;  2KMA A;  2MEK A;  4AOF A;  2WXO A;  2C5L C;  2JSV X;  1CJE A;  1FM0 D;  3T9L A;  2WXP A;  4WJP A;  3MC8 A;  2HD5 B;  2EEL A;  2YLM A;  5HG2 A;  2HTM E;  3DVN V;  3AE9 B;  3BII D;  2L3Z A;  4UDU C;  3AEF B;  1UBI A;  1YQB A;  3PO0 A;  1V80 A;  4DXG A;  3DBL B;  4IDI A;  3ZYY X;  1VZ7 A;  4WWM A;  1LXD A;  2VRR B;  3QA8 A;  2I1K A;  1PGB A;  2MCN B;  3JSV B;  4NJ6 A;  1WJ4 A;  1EWY C;  2C60 A;  3AEE B;  1RFA A;  2BB5 A;  4JIO U;  4G0N B;  1Q10 A;  4MT5 A;  4EZK A;  2WDV B;  2AWT A;  3Q69 A;  3WA0 A;  3RMK C;  2BGF A;  2WXN A;  3Q3M C;  3AE4 B;  2KQ4 X;  3EFU A;  1TS5 A;  3MJ5 A;  3P42 A;  4IG7 B;  4P7I A;  3AU4 A;  3HM6 X;  1FRR A;  1NYR A;  2Y5P A;  2L76 A;  3L10 B;  4XZ4 A;  3WAN A;  2E3T A;  5H8Y E;  4KDI C;  3T3O A;  2TSS A;  1TT5 B;  4HDQ A;  2NS5 A;  4M01 A;  2ASQ A;  2L7R A;  1FPY A;  3PRZ A;  3LXF A;  1EF1 A;  4HDO A;  5FR6 A;  3L17 A;  3DVN U;  2HDE A;  4HVB A;  1IBX B;  2WXI A;  3IBE A;  2KJR A;  4YTP B;  4OW0 A;  3KUC B;  2WDT B;  2W55 A;  2LGD A;  1K8R B;  2BYF A;  1E8X A;  2RSU A;  2WU2 B;  1YJJ A;  4MGZ E;  1OTR B;  5IO9 A;  4BZA A;  2FCN A;  1WYG A;  5IN7 A;  2IBI B;  4A3P A;  3NS8 A;  3R3M A;  4XE0 A;  4WUR A;  1E10 A;  4M00 A;  3DQV A;  4HPP A;  5L83 A;  3V62 A;  2PIA A;  1J7B A;  5BMI A;  1WGR A;  2MWS B;  2G9H D;  1WJN A;  1S3S G;  1TZ1 A;  1HZ5 A;  3ABV B;  4JPS A;  1V8C A;  2SEB D;  2BTE A;  3L54 A;  2WLB A;  5CHV C;  2GBK A;  2EKI A;  2N9K A;  1L6U A;  4ARI A;  1QLB B;  1ZOY B;  3EGR A;  4W9I A;  2V0G A;  3PZD A;  2O6V D;  4OZC A;  1FXI A;  4A8X C;  3TEZ A;  1PQS A;  1WM2 A;  2O2V B;  2PMV A;  2L05 A;  4G50 A;  1QOA A;  1HTO A;  3VUW A;  3RD2 A;  3IAM 1;  3Q2A C;  5DPS A;  3ZNZ B;  1D6E C;  1SGH A;  3HK0 A;  2WXH A;  3H8H A;  2KQS A;  1FCC C;  1F9J A;  4AQ7 A;  1YD8 U;  1TGZ B;  2M8S A;  3H7P B;  3DBS A;  2K25 A;  1LQB A;  3BK1 A;  1RLF A;  3Q8B A;  5D7G A;  1ESF A;  2R2Q A;  3AEB B;  2MP2 B;  5JXV A;  3RZW C;  2ZPY A;  1MG8 A;  2D11 A;  2INP E;  4OVU A;  2M56 B;  2CJO A;  1VRA B;  1YIW A;  2LXC A;  4C4V B;  4FAD A;  4EKU A;  1TKY A;  4NPN A;  1AWD A;  4PS7 A;  3TEW A;  4ARC A;  3QQ8 B;  4HWI B;  4ANV A;  1XD3 B;  2ZEQ A;  3C0R B;  3HUI A;  1XQQ A;  3SFD B;  4NY0 A;  1WR6 E;  1V97 A;  3AM9 A;  4NJ7 A;  3PLU A;  4LJO B;  3RNC C;  3RUL A;  1ZKH A;  1OGW A;  2H89 B;  2K3U A;  4DHZ E;  2JF5 A;  1V1P A;  5FKA C;  2D2Q A;  1J7A A;  1V81 A;  3LYY A;  2ZPN A;  3ZVV A;  5LXI B;  2GMI C;  1L4D B;  5EE3 A;  1K53 A;  1WZ0 A;  2JYE A;  1ZPS A;  2JZP A;  3OAW A;  5EDS A;  2KTF A;  3EEC A;  2MLB A;  2JWU A;  3SD5 A;  1KJT A;  3RUI B;  1CK1 A;  2NBU A;  2KO3 A;  3KWL A;  3ZJV A;  1WZ3 A;  2DZI A;  3ML8 A;  3U7Z A;  1H4R A;  1XEE A;  3WAM A;  2XN9 C;  3OG5 A;  2DX5 B;  1DOX A;  3NZU A;  4EFO A;  5C1Z A;  1E8W A;  2MSE D;  3A33 B;  4ZRJ A;  2KOX A;  2IY1 B;  3A1Q A;  2GB1 A;  1B1Z A;  1DYQ A;  1MG4 A;  3U30 A;  4P1B C;  2DWQ A;  2WHI A;  2R61 A;  2CU1 A;  2WWZ A;  3QK0 A;  1GG3 A;  2C9W B;  3KYC D;  5AZG A;  3RPF C;  4TQ1 A;  3SFE B;  3SHQ A;  3FIL A;  1WYW B;  1WX7 A;  4MGY E;  2K6Q A;  3DBL I;  2KK8 A;  1ZXH A;  5IP4 D;  1MHH E;  1ZUD 2;  3A9K B;  5G2N A;  2WX0 A;  4XDD A;  2LEK A;  2O6V A;  2PVG C;  3SEB A;  2V3N A;  3RFZ B;  4RF1 A;  4KZC A;  1NBF C;  3ZXR A;  1I4H A;  2IGH A;  3VUY A;  4MSM B;  3OJ4 B;  1B9R A;  3AE5 B;  4ZYN A;  2DLB A;  4WIP A;  3DCG A;  2KMM A;  4M8N A;  3DHH C;  4XWW A;  3BK2 A;  1VJK A;  2XBB C;  3CMM B;  3Q14 C;  1C1Y B;  3I5J C;  1N6Z A;  1DOY A;  3B9J A;  1JAL A;  3ZXV A;  1VZ8 A;  4TV3 A;  4BKT A;  1WXM A;  4CHK A;  4IM3 A;  2OJW A;  4XC2 A;  2KHW B;  5G5G A;  1R4N B;  2WYQ A;  4A55 A;  1C78 A;  2IND C;  2L8J A;  3JSV A;  2GLS A;  1QZE A;  3DVG X;  5EE1 A;  2KMC A;  3JW0 X;  3DBH B;  3ZNG C;  4NAW B;  4MM3 B;  4K3B A;  2DEN B;  1YMH E;  1K52 A;  3M62 B;  4BBN F;  5H92 C;  1WM3 A;  1YN5 A;  2IZV B;  3RZF A;  1H8C A;  1MVK A;  2IYD B;  3RNA C;  2K39 A;  3W5V B;  1WJU A;  1ZP0 B;  3HVD A;  2LD9 A;  3ZNI D;  2JY6 A;  3ALB A;  2V4I B;  3BWU D;  1WE7 A;  4LLG M;  4PK1 A;  5JZE B;  4M8M A;  4KX6 B;  3CF6 E;  4B6W A;  3TCA A;  1AN8 A;  1C4C A;  1XLO A;  1SE3 A;  4IWQ A;  1IBX A;  3GZN B;  4JE3 B;  3PRE A;  2G4S A;  2ACZ B;  4RH6 A;  3U7D A;  2FCQ A;  1SE4 A;  2PLP A;  3MTN B;  2K5P A;  3AE3 B;  4K7U A;  4BAX A;  1ET6 A;  1I4G A;  2DZK A;  4S0R A;  1C76 A;  4TUU A;  3UIP B;  2D07 B;  5MPO A;  1J19 A;  3P4S B;  4IKG A;  1WR1 A;  2MW5 A;  1E7V A;  2KFJ A;  4DK5 A;  4W9G A;  1U4A A;  1TS2 A;  4E74 A;  2CHW A;  1UBQ A;  3PPA A;  3VTW A;  3X23 A;  1SBB B;  5LXH A;  1L2N A;  3GP7 A;  4LNO A;  1E9M A;  2AL3 A;  4FA6 A;  1FNV A;  4DDG D;  5DPR A;  3ML9 A;  2D10 A;  2J7Q B;  2QJL A;  4NAM A;  4KKI A;  5C3J B;  1FNU A;  5E6P A;  2A4Z A;  3C8Y A;  5DPT A;  2IO1 B;  3PZ7 A;  1FFU A;  1UD7 A;  3BYY B;  2QDF A;  4HPM B;  3E56 A;  4AWJ A;  1OQQ A;  3VDZ A;  3VR9 B;  2O2V A;  1WSP A;  2DHZ A;  1ZE3 D;  2JPH A;  1XT9 B;  5D3D A;  4US8 A;  1GC6 A;  1WF9 A;  1FFV A;  1L0X B;  1BML C;  1YNT E;  4WH4 A;  4KSL C;  3DHG C;  3KWV A;  5J17 A;  3H7P A;  1P7E A;  2PKO A;  1R4M B;  4IM2 A;  1HE8 A;  2AYO B;  4GLS C;  4W9D A;  2MP2 A;  2ONQ A;  2IO2 B;  3N30 A;  4C80 A;  4FJY A;  2LJ5 A;  4GMV A;  1K51 A;  1E90 A;  2W3R A;  3DBR B;  3KUD B;  1C4P A;  4FLH A;  2B3A A;  4C4V A;  1VD2 A;  3ZDT A;  2MQJ A;  4I6L B;  4RGO S;  2PEA A;  3AU5 A;  3N9Y C;  3QX1 A;  2WS3 B;  1K50 A;  1SXT A;  2KZR A;  2L83 A;  5CX3 A;  1S1Q B;  2KLC A;  1SSN A;  4FJV B;  2OHF A;  2N7J A;  3PRM B;  2MBO A;  3IT4 B;  4BKS D;  3NY5 A;  3HRD D;  1VDV A;  2EMS A;  3GE8 C;  1T6B X;  1TKG A;  1T3Q A;  1TS3 A;  3GE3 C;  4WAA A;  4BVU C;  2ZCB A;  4K3C A;  1NI2 A;  2W54 A;  3QC8 B;  3KVF B;  4DXF A;  1L0V B;  1PYW D;  1V9J A;  1ZGU B;  1UH6 A;  4MGI E;  3PV1 A;  4E3C A;  3DDC B;  2V3P A;  1ZW7 A;  2ZVN A;  1KF6 B;  3PS6 A;  4G11 A;  1Z2M A;  4MAC A;  2MJE A;  3I3T B;  3PLV A;  3ZDM C;  4AJY B;  1OEY J;  2ZZP B;  2J4X A;  1N62 A;  4GU2 A;  2KX3 A;  2VZK B;  1WE6 A;  3V61 A;  2W3S A;  4W9E A;  1YQ4 B;  3IVF A;  4USA A;  1PDX A;  3VTU A;  4WWP A;  3R2T A;  1V86 A;  2CU3 A;  1E8Y A;  2W9N A;  3V05 A;  1RWS A;  5J18 A;  3R7R A;  4RNA A;  4K7S A;  1RAX A;  1I4X A;  4EUT A;  3SR6 A;  3AI5 A;  2JWZ A;  4BBN C;  3AN1 A;  3UQB A;  2VH1 A;  1ET9 A;  1YJI A;  5HKH A;  3P4Q B;  1BT0 A;  4JL9 A;  4E71 A;  1UZX B;  4NZL B;  4HXD A;  3NUH B;  2H88 B;  1Y8R C;  2LJI A;  3Q8F A;  3V6E B;  4Q2J A;  4I6P A;  1E0Z A;  2PW9 A;  5HI1 A;  1F77 A;  1QF6 A;  3OLM D;  3APF A;  2KDM A;  1I4R A;  2WXJ A;  2FE8 A;  3A9K A;  2DZM A;  1RM6 C;  3B2F A;  1RYJ A;  1R4N I;  2JQR B;  4I6N B;  3NZS A;  2QIL A;  3PHW B;  2KWC A;  1QIL A;  2X38 A;  2XNA C;  1WXV A;  2J52 A;  4L2Y A;  5FR3 A;  1T5X D;  3M63 B;  3CSF A;  3QWZ B;  3DBH I;  3K9P B;  3FAH A;  3NG0 A;  4F8C B;  3VR8 B;  4BKG A;  1Q1O A;  1D3Z A;  2ZW1 A;  3AEA B;  4C00 A;  1GJZ A;  2K8B A;  1SB3 C;  1STE A;  2WXK A;  2JU6 X;  2L0F A;  3S2A A;  2BW2 A;  1DOI A;  3E9S A;  5I4D A;  5HHD G;  2WX1 A;  2IGG A;  3FC4 A;  2GRI A;  2FNJ B;  2BBC A;  4RM8 A;  3N1X C;  1FXT B;  4MEM A;  4LNF A;  3BZD B;  4YTM B;  1FNW A;  2REX A;  3ZGZ A;  2K8H A;  1G6J A;  1WFY A;  2JT4 B;  2BS3 B;  3L16 A;  4MM3 A;  4NAW A;  3NS1 A;  2MJ3 A;  3RNG C;  4JQW C;  4B0E A;  5IOI A;  2I38 A;  4BKS A;  1J8C A;  2BB6 A;  2NPT B;  1SE2 A;  2J0K A;  1UWX A;  4FJZ A;  4GN1 A;  3QCA A;  4BOS C;  2LVP A;  3T8M A;  3W2D A;  1GUA B;  1HA5 A;  2ZW0 A;  4DXA B;  1UF0 A;  3U2S C;  4DHZ B;  3ZTD A;  2NR2 A;  5KHQ A;  1UGJ A;  1F0Z A;  2CS4 A;  4PYU A;  1DGJ A;  3VVW B;  4XGA B;  3P4R B;  2BWE S;  2DAJ A;  2RMM A;  1QQR A;  4LJP B;  1FMA D;  1E7P B;  4FHK A;  2KLG A;  2VZK D;  4KZ0 A;  3QHT A;  4XYC A;  4CQN A;  3ZTC A;  1FXA A;  3PGE A;  4MJS B;  3URY A;  2M0A A;  4ZOH C;  4F7Z A;  1P9D U;  2ON8 A;  3AE6 B;  3C19 A;  4KDL B;  1JRO A;  1D4B A;  3BVG A;  4KVG B;  5C2T B;  1JRU A;  3PTF C;  3Q3J A;  1T0Y A;  1GB4 A;  3A4R A;  3I9V 1;  3WAL A;  1WJ6 A;  1HZ6 A;  3ZUN A;  2L1A A;  1WX9 A;  3N20 C;  4KGT A;  4YSY B;  3IAS 1;  2DNF A;  1XLN A;  1WXQ A;  4EOY A;  1KRH A;  4HJG E;  3L0W B;  3AUL A;  1V6E A;  4ANU A;  3V3X A;  2BWF A;  4AUQ C;  4NNJ B;  4HCP B;  2RGF A;  2D3C A;  1D5Z C;  3DBR I;  4FN2 A;  1A70 A;  4ICU A;  2WP9 B;  2LVO A;  4JX1 C;  4RGN A;  3ZO5 B;  2AL6 A;  3MC0 B;  2M4N A;  2M19 A;  3H9D A;  1TJE A;  2CHZ A;  2Y5B B;  2VH2 A;  1Z5S B;  1L7Y A;  1WMH B;  2KWU B;  3AED B;  5DPW A;  2FBW B;  5HFY A;  2JYT A;  2K1F A;  2KN5 A;  2AEH A;  3WAO A;  2LHD A;  4LK0 M;  2FIF A;  3T3N A;  2L52 A;  4X57 B;  4C56 C;  3AEG B;  3TEX A;  1VCB A;  4WQM A;  1J7C A;  1P1A A;  2G3Q B;  3W5U B;  2DZJ A;  5JHB A;  1D5X C;  1YX5 B;  5EE0 A;  3ZIM A;  1HEZ E;  2RPQ A;  2N9L A;  3SU8 X;  4EEW A;  1LGR A;  3EFC A;  3ZJT A;  4HLE A;  2JXX A;  3DVG Y;  4J6I A;  3CIR B;  2J0J A;  3ZQ4 A;  4HEA 1;  4KIK B;  2C7M B;  2KXJ A;  4W9F A;  1AAR A;  3HVZ A;  4EZL A;  1A5R A;  4BFR A;  1ENF A;  2Z0D B;  3AMZ A;  2AQ3 B;  3IFW B;  1VR9 A;  4C7Z A;  2KFK B;  1IGD A;  1QOB A;  4XDC A;  1MHX A;  3NVV A;  1C3T A;  1EU3 A;  3TJP A;  4LDT B;  3MC9 A;  4J3O D;  2G4D B;  2GBN A;  1PGX A;  2L00 B;  4CO7 A;  5D2M B;  3UIN B;  5G5H A;  1VZ6 A;  3VAW A;  3ZW3 A;  4IWO A;  1WXS A;  1D5M C;  2V9H A;  3MFG A;  1T0Q C;  2WXR A;  2DYO A;  5BMH A;  3KLS X;  1KM7 A;  1FD6 A;  3DHI C;  4K7W A;  1N5X A;  4ANX A;  1UUP A;  1SIJ A;  4HRS A;  5T8I A;  3R8B A;  3VRB B;  3UI3 A;  4N58 A;  1OFF A;  3FKY A;  1I7H A;  4PS8 A;  1KLV A;  3TIX A;  2IDY A;  3RYT A;  1TTN A;  3UQA A;  3NRZ A;  1OQR A;  4IC7 B;  4LNN A;  3QAQ A;  2PE9 A;  2HTH A;  3Q8C A;  3Q8A A;  2V3S A;  2LGI A;  2Y5C A;  5AEK B;  1P98 A;  1C79 A;  1ZDV A;  1WIA A;  2EKE C;  2J53 A;  2LVQ A;  2V1Y A;  3Q6B A;  2RD0 A;  4TQ0 A;  2KNB A;  1TS4 A;  3GS2 A;  2DAF A;  5BMG A;  2WXQ A;  4B9K A;  1PGA A;  3TL5 A;  3Q8E A;  3PRP B;  3CST A;  2KJ6 A;  5BYQ A;  2KJH B;  2MJD A;  3KYD D;  1OEY A;  3UGB B;  2JX5 A;  2ZNV B;  4HK2 A;  5BO4 B;  4XWT A;  3VXW A;  4W9L A;  2WNM A;  3B0A A;  3PSE B;  3QIJ A;  4GDK B;  2DBY A;  4AP4 C;  1WGH A;  3NVW A;  1I42 A;  1YJ1 A;  2SAK A;  4TSS A;  4MH8 A;  2DYB A;  4DHJ B;  1AYF A;  3I63 C;  1TY2 A;  3DWG C;  2OOB B;  3LDZ E;  2PTL A;  4DDI D;  5AUI A;  2LRW A;  2KDB A;  2NTS A;  3N32 A;  3RCZ A;  1L6V A;  5GMV A;  3LJ3 A;  2L0T A;  2KTR B;  4K81 A;  4US9 A;  3AE1 B;  1GAQ B;  2LXA A;  4ANW A;  4URK A;  4YSZ B;  4ICV A;  3R66 C;  1XCQ L;  2BYE A;  4GXB A;  4MDK E;  1IGC A;  4D2K A;  3PHX B;  1YQ3 B;  1JWU D;  2HJ8 A;  1V5O A;  1JRP A;  1NVI D;  4HCN B;  3D32 A;  1MPE A;  2UWQ A;  1QT9 A;  2GBJ A;  4EZJ A;  3ENE A;  4KGS A;  2FID A;  1EF5 A;  3UF8 A;  1WX8 A;  2NPT A;  2WDQ B;  2FUG 1;  2JRH A;  1XLQ A;  3AEC B;  3DWM A;  3PVL A;  4LDT D;  1QOF A;  4FXC A;  4LNI A;  5D6J B;  4GB9 A;  2OED A;  4KGR A;  3W1S A;  3B2G A;  2K8C A;  2JRI B;  4MGK E;  4ZHO A;  2KAC A;  3IXS A;  2PVO D;  2KD0 A;  5D94 A;  2Z59 B;  4HJK A;  5KHO A;  4KV2 A;  4AJW A;  1I35 A;  2LFI A;  3RNE C;  5TR5 A;  4M0W B;  3ONS A;  2CR5 A;  4MJS A;  1TKE A;  4IWP A;  3R2I A;  3H7S A;  4LCD E;  2GI9 A;  4A6Q A;  1IUE A;  2N1V A;  5AUK A;  1V2Y A;  1P7F A;  4TKN A;  1UWM A;  2LHE A;  2D3G A;  2KVR A;  1MFW A;  5AZF A;  5D3I B;  3KQ4 A;  3VQI A;  3NVZ A;  4NJC A;  2Y3A A;  1JWB D;  5IAA C;  1WH3 A;  1N60 A;  4DWF A;  3VHT C;  4N6E B;  3ZNH B;  2ZVO A;  5DCN A;  4II2 B;  2J0M A;  2PJH A;  4N9F 4;  1F52 A;  2Z0E B;  4HPL B;  4ASW C;  3VTV A;  4ZHP A;  3NZ3 A;  1V5T A;  2BS2 B;  1L5P A;  1IP9 A;  1QOG A;  2KKC A;  2UYZ B;  2YEP F;  2JZ3 B;  1KH0 A;  2BPS A;  2QC8 A;  2ZCC A;  5BYR A;  2CKH B;  3U8Z A;  1SEB D;  2ICI A;  2XK5 B;  2D5G A;  4DHJ D;  1FEH A;  3MHS D;  4AS1 A;  3VH3 B;  3P4P B;  1WMH A;  2A5U A;  1FRD A;  3WIM A;  2FAZ A;  2LRU A;  1WGK A;  3HIZ A;  3DOW A;  3TUO A;  4ZDV A;  1SF0 A;  1LO5 D;  3IG3 A;  3B08 A;  3ETR A;  5FK9 C;  1TYG B;  1UGM A;  1R7S A;  3W1S C;  3AB5 A;  1V1O A;  2ZJD A;  3DPD A;  4BOZ B;  1P3Q U;  2K0P A;  2RPV A;  4RGT A;  3RI7 C;  1XF5 L;  4A90 A;  2QEJ C;  2Q5W D;  3KH0 A;  2WXG A;  2BKF A;  2Z8L A;  4OZA A;  4H2A A;  4RGM A;  3BY4 B;  1TZO A;  4KIK A;  4YT0 B;  5CTR C;  4O1N A;  4PT5 A;  3QJZ A;  4GDL B;  3RNF C;  1WGD A;  4WJO A;  2I1J A;  2KWD A;  2LMC A;  2CHX A;  1BXT A;  2KFK A;  3VRA B;  4F1S A;  2V4L A;  3A9J B;  2LUE A;  1C9F A;  4REZ A;  2KC2 A;  2GBR A;  2BQQ A;  2KC1 A;  2LUM A;  2DYM A;  3BVM A;  1NEK B;  1P0R A;  1AW7 A;  4TMA B;  1LFD A;  2MHJ A;  2WXF A;  4W9H A;  2RDG A;  2LWP A;  4DBG A;  2BYT A;  4WAF A;  4YXD B;  2D3A A;  4GGQ A;  3N3K B;  4YWG G;  3TBL D;  5G55 A;  1GPX A;  4WQO B;  2IJ0 A;  1E8Z A;  3PZ8 A;  4L23 A;  1FCL A;  5C23 A;  3GZN I;  1JWA D;  3ZLZ A;  1ZXI A;  1OQY A;  2KDI A;  2IY0 B;  2AQ2 B;  2LGX A;  2N7E A;  2X8X X;  4GIV A;  4G3X B;  5IA7 A;  3OJ3 A;  1EUV B;  1X1M A;  2MA9 B;  1Y56 A;  2HJ1 A;  4MH0 E;  2JVC A;  1VLB A;  2LGS A;  1XXG A;  4LNK A;  2K9X A;  2N1W A;  2KDE B;  1F2R I;  3CWI A;  3V6C B;  3P63 A;  2C7N B;  1SIF A;  2J42 A;  2WU5 B;  4RFB A;  2MBE A;  1JWS D;  4LTU A;  2INN E;  1ROE A;  3V60 A;  4FUL A;  2JZZ A;  1GB1 A;  1ZDX A;  4OVV A;  5L95 C;  1KOT A;  3L4P A;  4KSK C;  4GOC A;  3Q3O C;  1M4V A;  2BT6 A;  3APD A;  1JCK B;  1XLP A;  3M95 A;  5EE9 A;  3KW5 B;  3R7Q A;  4S17 A;  4FHJ A;  1GNU A;  4GDK A;  4EE2 A;  5LLI A;  1MJD A;  2HE7 A;  4ACF A;  3Q3N C;  3VFK A;  2AX5 A;  1SJE D;  1NI3 A;  5BYS A;  2LZ6 A;  2XEW A;  4W9J A;  3EUB 2;  5CHF A;  4FBJ B;  1R4M I;  4R3D A;  3APC A;  1N63 A;  3AV8 A;  1L4Z B;  2G1E A;  2KTR A;  3QAR A;  1HXY D;  3RN9 C;  2KAJ A;  3B1L X;  2RDB C;  3AE2 B;  1JML A;  4ZRQ A;  2PE6 B;  2KAN A;  1FIQ A;  4JLC A;  3I57 A;  2BVC A;  3P2B A;  4MSQ B;  4L1B A;  4QAY A;  2KX0 A;  1T0R C;  4B0M A;  3N1Z C;  3N1Y C;  4W9K A;  1WXA A;  2IO0 B;  2MX2 A;  1MI0 A;  3BVZ A;  1YX6 B;  1CMX B;  1NYQ A;  4PYZ A;  1CQV A;  3TSS A;  1IPG A;  5CHW A;  4A20 A;  3NHE B;  3JVZ X;  2G45 B;  1GC7 A;  2KDF B;  4NQL B;  4WWN A;  2WXL A;  2KQ7 A;  1Q0W B;  4RM9 A;  3HM3 A;  3HHM A;  1JWM D;  3BYT B;  5E6J A;  3W9C B;  2B76 B;  3U4E G;  2RR9 A;  4XX5 A;  2BF8 B;  4CYE A;  1KLG D;  2BKR B;  1WGY A;  3ZKJ C;  3VH4 B;  1LM8 B;  4WWO A;  2AQ1 B;  1T0S C;  1WGG A;  3MP9 A;  4MEL A;  4C7Y A;  1TY0 A;  1ACC A;  1JQ4 A;  1WRI A;  3MHZ A;  3WCQ A;  2BYV E;  4M0W A;  5AZH A;  2KVZ A;  1SJH D;  3ZJU A;  2N9X A;  1HTQ A;  2ZNV C;  3ZRC A;  2KYW A;  2LGY A;  2FUH B;  4KKJ A;  5TSS A;  2GOW A;  3NJT A;  2N9P C;  3K9O B;  1RFK A;  1WI0 A;  3OWE B;  1F2R C;  5JHA A;  4ZRP A;  1E5W A;  2N0S B;  1YN4 A;  1EU4 A;  3IT6 B;  3KUZ A;  1HQR D;  1KLU D;  3IHP C;  2WGS A;  2UU7 A;  2QCZ A;  3L13 A;  2LAS A;  4JWS C;  3RT3 B;  4IUM B;  4HKZ E;  3VUX A;  3GOE A;  3TMP B;  1KTK A;  3SDL C;  2JUO A;  4HRO A;  1CZP A;  4IW0 A;  1Q5W B;  2WXM A;  2YEP B;  3EHV A;  3PT2 B;  3RNB C;  1IYF A;  1YOV B;  4JGH B;  3JYU A;  3H1U A;  4A3O A;  1N61 A;  4ZYS A;  2LI5 A;  4GSW A;  4N59 A;  1PFD A;  1RRB A;  1JW9 D;  2XK5 A;  3BIN A;  3NOB A;  4IM0 A;  2MBH A;  4ZRI A;  3Q3F A;  1L0Y B;  1E6E B;  4JWU C;  2E6X A;  2RDH A;  5IKC M;  1EO6 A;  2NCN A;  3X0W A;  4YSX B;  1QKZ A;  1NDD A;  1WWT A;  2C7H A;  2M0X A;  2MBB B;  4NQK E;  4OZB A;  5E6N A;  2IGD A;  4RCO A;  1GOZ A;  4YL8 A;  1UEL A;  1EWC A;  2WDR B;  3A4S C;  3O65 B;  2K6D B;  2WQY B;  3H6N A;  3L08 A;  2INC C;  1E7U A;  2FCS A;  2MBQ A;  4ZRK A;  1M94 A;  2OJR A;  5E6O A;  5J2R A;  2JXT A;  3W1Y A;  5LNK 1;  1WY8 A;  1XCT L;  1V1P B;  3AE7 B;  3MJW A;  3ECI A;  4A9A A;  1I4P A;  4GDL A;  4RMA A;  4ITK A;  4II3 B;  1I4Q A;  1XO3 A;  2MH7 A;  3AE8 B;  4HKQ A;  2CJN A;  1FO4 A;  4OVZ A;  1N5W A;  2FCM A;  4B95 A;  2N4F A;  1NEN B;  2KT7 A;  3A9J A;  3AXC A;  4IOI E;  2QSD A;  3EC8 A;  4P6V F;  3NVY A;  5GXG B;  2PPH A;  5JH5 C;  2GBM A;  3AH7 A;  2M1M A;  4W9C A;  4M02 A;  1PUT A;  4WJQ A;  2W82 A;  2IPK D;  2NVU I;  1F1H A;  2NBV B;  2K22 A;  3O13 A;  2EMT A;  3UIO B;  3J9C A;  2NTT A;  4RF0 A;  2QMT A;  1BUI C;  1SE9 A;  1TBE A;  3M3J A;  2NMQ A;  3P1M A;  3A1Q B;  2N9E B;  4P16 A;  1C4A A;  2QHO A;  4K1R B;  4WJN A;  2MRP A;  1V49 A;  4OHJ A;  1YN3 A;  4YTN B;  1TIF A;  1EM7 A;  1UNS A;  2D3B A;  3WAP A;  2KWV B;  3LB8 C;  2KN4 A;  3TEY A;  1ISN A;  1WRD B;  4PS3 A;  3FIL B;  2N7D A;  1J0G A;  2QIE B;  2BS4 B; 
#chains in the Genus database with same CATH homology
 2IZV B;  5CTR C;  1V6E A;  3RZF A;  1H8C A;  4ANU A;  3QJZ A;  2R2O A;  4GDL B;  2BWF A;  4AUQ C;  2IYD B;  2YVC A;  2M17 A;  4NNJ B;  2O6V B;  1WGD A;  2K39 A;  2IO3 B;  2NBW B;  4HCP B;  4WJO A;  3ZRF A;  2RGF A;  1WJU A;  2I1J A;  2CHX A;  2KFK A;  2LD9 A;  3ZNI D;  2KMA A;  2JY6 A;  4AOF A;  3ALB A;  4F1S A;  2C5L C;  3DBR I;  2V4L A;  3A9J B;  4FN2 A;  2LUE A;  3T9L A;  1WE7 A;  4ICU A;  5JZE B;  2KC2 A;  4M8M A;  2GBR A;  2LVO A;  2KC1 A;  4WJP A;  3ZO5 B;  2DYM A;  2HD5 B;  2AL6 A;  3CF6 E;  4B6W A;  2YLM A;  3TCA A;  3DVN V;  2L3Z A;  1P0R A;  2M4N A;  1LFD A;  1UBI A;  1YQB A;  3H9D A;  4W9H A;  1V80 A;  2LWP A;  4IWQ A;  2CHZ A;  2Y5B B;  4DBG A;  1Z5S B;  1L7Y A;  1WMH B;  2G4S A;  2KWU B;  3PRE A;  4GGQ A;  3U7D A;  3N3K B;  5DPW A;  3TBL D;  2FCQ A;  5G55 A;  4WQO B;  2K1F A;  1E8Z A;  1LXD A;  2KN5 A;  2VRR B;  2AEH A;  3QA8 A;  3WAO A;  2I1K A;  2FIF A;  3MTN B;  5C23 A;  4K7U A;  3GZN I;  4X57 B;  3ZLZ A;  1VCB A;  1OQY A;  2DZK A;  2KDI A;  2IY0 B;  4TUU A;  3UIP B;  2LGX A;  1P1A A;  2D07 B;  2N7E A;  3JSV B;  4NJ6 A;  1J19 A;  2G3Q B;  2MCN B;  1WJ4 A;  4GIV A;  2DZJ A;  4G3X B;  5JHB A;  1WR1 A;  2MW5 A;  2C60 A;  5IA7 A;  1E7V A;  1RFA A;  3OJ3 A;  1YX5 B;  4JIO U;  4G0N B;  2KFJ A;  1EUV B;  3ZIM A;  4DK5 A;  4W9G A;  2RPQ A;  4EZK A;  1U4A A;  4E74 A;  2AWT A;  2CHW A;  1X1M A;  2MA9 B;  1UBQ A;  3SU8 X;  4EEW A;  4MH0 E;  2JVC A;  4HLE A;  3PPA A;  2JXX A;  3VTW A;  3X23 A;  3WA0 A;  3DVG Y;  4J6I A;  2J0J A;  2BGF A;  5LXH A;  1L2N A;  4KIK B;  2C7M B;  2N1W A;  2KXJ A;  2AL3 A;  4FA6 A;  2KDE B;  4DDG D;  5DPR A;  4W9F A;  3ML9 A;  3EFU A;  2D10 A;  2J7Q B;  1AAR A;  3V6C B;  4EZL A;  4IG7 B;  2C7N B;  1A5R A;  4BFR A;  1SIF A;  2Z0D B;  3IFW B;  3AU4 A;  2A4Z A;  4P7I A;  3HM6 X;  2MBE A;  5E6P A;  2KFK B;  5DPT A;  2IO1 B;  3V60 A;  2L76 A;  3L10 B;  4FUL A;  4XZ4 A;  1UD7 A;  4HPM B;  1C3T A;  4AWJ A;  3TJP A;  4LDT B;  3WAN A;  2JZZ A;  3VDZ A;  2O2V A;  4OVV A;  5L95 C;  4KDI C;  1KOT A;  2DHZ A;  2JPH A;  4KSK C;  2GBN A;  2G4D B;  1XT9 B;  4GOC A;  2L00 B;  4HDQ A;  1GC6 A;  2NS5 A;  3APD A;  1WF9 A;  2ASQ A;  2L7R A;  5D2M B;  4CO7 A;  3M95 A;  3KW5 B;  3PRZ A;  3R7Q A;  4KSL C;  1EF1 A;  4HDO A;  5FR6 A;  3L17 A;  3DVN U;  3UIN B;  4FHJ A;  1GNU A;  4HVB A;  3VAW A;  3ZW3 A;  4GDK A;  3IBE A;  2KJR A;  4IWO A;  5J17 A;  1WXS A;  3H7P A;  5LLI A;  3KUC B;  2WDT B;  2HE7 A;  4IM2 A;  1HE8 A;  2AYO B;  2DYO A;  3VFK A;  2LGD A;  1K8R B;  1KM7 A;  2BYF A;  4K7W A;  2LZ6 A;  2XEW A;  4W9D A;  1E8X A;  2MP2 A;  2RSU A;  4W9J A;  4ANX A;  2IO2 B;  3N30 A;  5CHF A;  5HKH A;  4FJY A;  4MGZ E;  1OTR B;  4FBJ B;  1R4M I;  2FCN A;  2LJ5 A;  3APC A;  4GMV A;  4PS8 A;  2IBI B;  1KLV A;  1E90 A;  4A3P A;  3NS8 A;  3TIX A;  3KUD B;  3R3M A;  3RYT A;  1TTN A;  3UQA A;  4FLH A;  2B3A A;  1VD2 A;  2KTR A;  3ZDT A;  3QAR A;  2MQJ A;  4IC7 B;  4I6L B;  3DQV A;  3QAQ A;  2PE9 A;  2HTH A;  5L83 A;  3B1L X;  3V62 A;  2V3S A;  2PE6 B;  2KAN A;  2PEA A;  3AU5 A;  3QX1 A;  5AEK B;  1P98 A;  2KZR A;  4JLC A;  1WGR A;  1WIA A;  5CX3 A;  1S1Q B;  2KLC A;  3P2B A;  2EKE C;  4FJV B;  4MSQ B;  2LVQ A;  2MWS B;  2V1Y A;  3PRM B;  2RD0 A;  2MBO A;  1WJN A;  4TQ0 A;  2KX0 A;  1S3S G;  1TZ1 A;  2KNB A;  4BKS D;  4W9K A;  1WXA A;  2IO0 B;  2DAF A;  2GBK A;  2MX2 A;  3L54 A;  3NY5 A;  5CHV C;  1YX6 B;  2EMS A;  4B9K A;  1CMX B;  4PYZ A;  4W9I A;  3PZD A;  3TL5 A;  2O6V D;  3PRP B;  4WAA A;  1IPG A;  3CST A;  4BVU C;  5CHW A;  2ZCB A;  2KJ6 A;  3NHE B;  4A20 A;  1NI2 A;  3JVZ X;  2G45 B;  1GC7 A;  2KDF B;  2KJH B;  3QC8 B;  4NQL B;  1PQS A;  3KVF B;  4WWN A;  1WM2 A;  1V9J A;  2O2V B;  3KYD D;  2KQ7 A;  1ZGU B;  1Q0W B;  1OEY A;  1UH6 A;  2L05 A;  4G50 A;  4MGI E;  3PV1 A;  4E3C A;  4RM9 A;  3DDC B;  3PS6 A;  1ZW7 A;  2ZVN A;  3UGB B;  3HM3 A;  3HHM A;  4G11 A;  3VUW A;  3RD2 A;  2ZNV B;  4HK2 A;  5DPS A;  5BO4 B;  1Z2M A;  3ZNZ B;  1SGH A;  3HK0 A;  3VXW A;  2RR9 A;  4XX5 A;  4W9L A;  2BF8 B;  2KQS A;  4CYE A;  3I3T B;  3PLV A;  3ZDM C;  3B0A A;  3PSE B;  1OEY J;  4AJY B;  1F9J A;  3QIJ A;  4GDK B;  1YD8 U;  1TGZ B;  2ZZP B;  4AP4 C;  1WGH A;  2M8S A;  3H7P B;  3DBS A;  2K25 A;  1LQB A;  1I42 A;  1YJ1 A;  2BKR B;  4GU2 A;  1RLF A;  1WGY A;  2KX3 A;  3ZKJ C;  5D7G A;  2DYB A;  1WE6 A;  3VH4 B;  3V61 A;  4DHJ B;  2R2Q A;  1LM8 B;  2MP2 B;  4WWO A;  3RZW C;  2ZPY A;  1WGG A;  1MG8 A;  2D11 A;  4MEL A;  2OOB B;  3LDZ E;  4W9E A;  3IVF A;  4OVU A;  4DDI D;  2LRW A;  2KDB A;  3VTU A;  2BYV E;  3N32 A;  5AZH A;  4WWP A;  3RCZ A;  1YIW A;  1V86 A;  2LXC A;  5GMV A;  1E8Y A;  2W9N A;  3LJ3 A;  2L0T A;  2KTR B;  4K81 A;  4FAD A;  5J18 A;  3R7R A;  4K7S A;  4EKU A;  2LXA A;  1RAX A;  2N9X A;  4NPN A;  4EUT A;  2ZNV C;  4PS7 A;  3AI5 A;  2JWZ A;  4BBN C;  4ANW A;  3UQB A;  4URK A;  4ICV A;  3ZRC A;  3QQ8 B;  3R66 C;  4HWI B;  2LGY A;  1XD3 B;  2ZEQ A;  2BYE A;  4ANV A;  2FUH B;  3C0R B;  4GXB A;  4MDK E;  1BT0 A;  1XQQ A;  2GOW A;  4JL9 A;  2N9P C;  3K9O B;  3PHX B;  4NY0 A;  1WR6 E;  4NJ7 A;  3PLU A;  4E71 A;  2HJ8 A;  1UZX B;  1WI0 A;  1V5O A;  4HXD A;  1Y8R C;  4HCN B;  3D32 A;  3V6E B;  4LJO B;  5JHA A;  2UWQ A;  1E5W A;  2GBJ A;  3RUL A;  3ENE A;  1ZKH A;  4I6P A;  4EZJ A;  3KUZ A;  1OGW A;  2FID A;  1EF5 A;  3OLM D;  3APF A;  3UF8 A;  1WX8 A;  2NPT A;  3IHP C;  4DHZ E;  2JF5 A;  3A9K A;  2DZM A;  2D2Q A;  3L13 A;  2LAS A;  1V81 A;  3RT3 B;  2JRH A;  2ZPN A;  4IUM B;  3ZVV A;  3VUX A;  3GOE A;  3TMP B;  5LXI B;  3SDL C;  2GMI C;  3PVL A;  4LDT D;  2JUO A;  1WZ0 A;  3OAW A;  1Q5W B;  1R4N I;  4IW0 A;  3EHV A;  5D6J B;  5EDS A;  3PT2 B;  4GB9 A;  4I6N B;  3NZS A;  2KTF A;  3PHW B;  3EEC A;  1IYF A;  2KWC A;  2MLB A;  3W1S A;  1WXV A;  2K8C A;  2JRI B;  4JGH B;  3JYU A;  3H1U A;  4MGK E;  3SD5 A;  4A3O A;  1KJT A;  3RUI B;  2NBU A;  2KO3 A;  3M63 B;  3CSF A;  3QWZ B;  2KD0 A;  2LI5 A;  5D94 A;  1WZ3 A;  3DBH I;  3K9P B;  4GSW A;  2Z59 B;  4F8C B;  2DZI A;  4HJK A;  3ML8 A;  5KHO A;  4KV2 A;  4AJW A;  1I35 A;  4BKG A;  1Q1O A;  1RRB A;  1H4R A;  2XK5 A;  3BIN A;  3NOB A;  4IM0 A;  2MBH A;  4ZRI A;  1D3Z A;  1GJZ A;  2K8B A;  3Q3F A;  3WAM A;  2DX5 B;  3NZU A;  2L0F A;  4EFO A;  5TR5 A;  4M0W B;  3ONS A;  3S2A A;  5C1Z A;  2CR5 A;  4MJS A;  1EO6 A;  2WX1 A;  4IWP A;  2NCN A;  3X0W A;  1E8W A;  3H7S A;  2MSE D;  4LCD E;  2FNJ B;  1NDD A;  3A33 B;  2N1V A;  4ZRJ A;  4RM8 A;  1V2Y A;  2C7H A;  2M0X A;  2MBB B;  2KOX A;  4NQK E;  4TKN A;  5E6N A;  1FXT B;  4MEM A;  2IY1 B;  3A1Q A;  4YL8 A;  1UEL A;  3U30 A;  3O65 B;  3A4S C;  2K6D B;  3H6N A;  2D3G A;  2KVR A;  2CU1 A;  2REX A;  3L08 A;  2WWZ A;  5AZF A;  2K8H A;  3QK0 A;  1E7U A;  2FCS A;  1GG3 A;  2C9W B;  1WFY A;  3KYC D;  1G6J A;  2MBQ A;  5AZG A;  2JT4 B;  4ZRK A;  3VQI A;  3L16 A;  4NAW A;  4MM3 A;  4TQ1 A;  1M94 A;  2OJR A;  3SHQ A;  5E6O A;  5J2R A;  5IAA C;  1WYW B;  4JQW C;  1WX7 A;  4MGY E;  2K6Q A;  3DBL I;  2KK8 A;  4BKS A;  1WH3 A;  1J8C A;  4DWF A;  3VHT C;  2NPT B;  2J0K A;  3W1Y A;  1WY8 A;  3A9K B;  3MJW A;  3ZNH B;  5G2N A;  3ECI A;  2ZVO A;  2WX0 A;  5DCN A;  4II2 B;  4GDL A;  4FJZ A;  2J0M A;  2PJH A;  4GN1 A;  2O6V A;  4N9F 4;  4RMA A;  3QCA A;  4BOS C;  2Z0E B;  4II3 B;  4HPL B;  2LVP A;  3T8M A;  4ASW C;  1GUA B;  4DXA B;  4KZC A;  1NBF C;  4DHZ B;  3VUY A;  4MSM B;  3OJ4 B;  3VTV A;  3ZTD A;  4B95 A;  2FCM A;  2NR2 A;  5KHQ A;  4ZYN A;  2N4F A;  3A9J A;  1V5T A;  3AXC A;  3EC8 A;  3DCG A;  2CS4 A;  4M8N A;  4PYU A;  1IP9 A;  3VVW B;  2PPH A;  2KKC A;  2UYZ B;  5JH5 C;  2BWE S;  2DAJ A;  2GBM A;  2JZ3 B;  2BPS A;  4LJP B;  2M1M A;  2ZCC A;  2XBB C;  4W9C A;  3CMM B;  2CKH B;  4FHK A;  1C1Y B;  3U8Z A;  4WJQ A;  2XK5 B;  2KLG A;  2NVU I;  4KZ0 A;  4DHJ D;  3MHS D;  3QHT A;  3VH3 B;  2NBV B;  3ZTC A;  1WMH A;  2A5U A;  3PGE A;  2EMT A;  4MJS B;  3UIO B;  4F7Z A;  3WIM A;  2FAZ A;  2LRU A;  4TV3 A;  4BKT A;  1P9D U;  1WXM A;  4CHK A;  1SE9 A;  3DOW A;  3HIZ A;  4ZDV A;  4IM3 A;  4KDL B;  1TBE A;  4XC2 A;  2KHW B;  3M3J A;  4KVG B;  1JRU A;  3IG3 A;  3PTF C;  2WYQ A;  3B08 A;  3Q3J A;  1T0Y A;  1UGM A;  3A1Q B;  2L8J A;  2N9E B;  3A4R A;  3JSV A;  3W1S C;  3WAL A;  1WJ6 A;  1QZE A;  3DVG X;  2QHO A;  2ZJD A;  1WX9 A;  3ZUN A;  3DPD A;  4K1R B;  4BOZ B;  1P3Q U;  4WJN A;  2MRP A;  1V49 A;  2KMC A;  3JW0 X;  3WAP A;  2KWV B;  3KH0 A;  3ZNG C;  4NAW B;  1ISN A;  1WRD B;  4PS3 A;  2BKF A;  2N7D A;  2DEN B;  1J0G A;  3BY4 B;  3M62 B;  4KIK A;  4BBN F;  1WM3 A;  4EOY A;  3L0W B;  3AUL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...