4ZDVA

Crystal structure of lc3 in complex with fam134b lir
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
126
structure length
126
Chain Sequence
DDFELLDGPSDRPFKQRRSFADRCKEVQQIRDQHPSKIPVIIERYKGEKQLPVLDKTKFLVPDHVNMSELVKIIRRRLQLNPTQAFFLLVNQHSMVSVSTPIADIYEQEKDEDGFLYMVYASQETF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Regulation of endoplasmic reticulum turnover by selective autophagy.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein transport
molecule keywords Microtubule-associated proteins 1A/1B light chain 3A
total genus 35
structure length 126
sequence length 126
ec nomenclature
pdb deposition date 2015-04-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02991 Atg8 Autophagy protein Atg8 ubiquitin like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 4zdvA00
4AOFA 4NAWB 4GB9A 3H6NA 1S1QB 1GG3A 2BWES 2NPTA 4WJPA 1ZW7A 2JPHA 3PPAA 4RMAA 4NAWA 4HLEA 3ZNHB 3MTNB 1WM2A 2K8HA 3A9KA 3UQBA 2IY0B 2JUOA 3DVGX 4JIOU 1WGDA 5EDSA 2KQ7A 3HM3A 2CR5A 2K6DB 2R2OA 4HJKA 1NBFC 1Z2MA 5D6JB 3RD2A 3ZNID 1G6JA 2LXAA 3DVGY 3PRMB 3PHWB 2KX0A 5CHVC 2C9WB 4IC7B 1P9DU 4DXAB 2CHWA 4MGZE 2OOBB 4WWNA 4DHZE 1SGHA 1P98A 3RUIB 3QIJA 2MBHA 2FCNA 2ZVNA 2JWZA 3H7PB 2KDEB 1XD3B 3AULA 1NI2A 1UD7A 2V3SA 3ZKJC 2LI5A 5E6PA 2L8JA 5KHQA 2CS4A 4DWFA 1Y8RC 2V1YA 1YD8U 4GU2A 4M8MA 4P7IA 2D10A 1R4NI 2UWQA 1OGWA 3RZFA 1Z5SB 3SU8X 2GMIC 4F8CB 3ZVVA 1WGGA 3A4RA 3PVLA 2ZCBA 3ZNZB 2CHXA 2DZJA 4LJOB 2DZKA 2KVRA 2LVPA 1EUVB 1WJUA 4IM0A 3ZIMA 2JT4B 2VRRB 3QCAA 3IG3A 2NCNA 4K81A 2KQSA 3M62B 4GDLA 3T9LA 1WMHB 2IO3B 1SIFA 2N7DA 2LZ6A 3RYTA 2DENB 5CTRC 2KN5A 2NVUI 1VD2A 1R4MI 4BKGA 2MBBB 1T0YA 3PTFC 1E7VA 2MQJA 3MJWA 2DYOA 3DPDA 2LVQA 4B9KA 2LRUA 2AWTA 2M8SA 1RRBA 3JSVA 3EHVA 2Z59B 2NS5A 3HHMA 3DVNU 1P1AA 4HDQA 4EZJA 4KDIC 1GJZA 4W9EA 2LXCA 2Z0DB 3OJ4B 4LDTB 2N1VA 3EECA 3Q3FA 4IUMB 3D32A 4HPMB 3VVWB 4LDTD 3V61A 4TV3A 4JQWC 1WX9A 2JRIB 3ZDMC 3L08A 2RPQA 3H7SA 4IWQA 4YL8A 1WXVA 1IP9A 1YJ1A 4GMVA 4DBGA 1Q1OA 3DBRI 4GDLB 2LWPA 1WF9A 1WE7A 1E8XA 3W1SA 4OVVA 4BKTA 2QHOA 4KZ0A 1WXSA 4MH0E 4IWOA 4MGKE 2LD9A 5L83A 2IO2B 3QK0A 2KDIA 4RM8A 2ZVOA 3V6EB 4FADA 1L2NA 2DHZA 2DZIA 1WRDB 2MSED 4KVGB 2LUEA 4II3B 4KZCA 4HCPB 3QC8B 1Q0WB 1A5RA 1HE8A 2DX5B 1UBIA 4XZ4A 3C0RB 2DAFA 4PS8A 1WH3A 4I6NB 4X57B 3TJPA 4NNJB 2IZVB 3NS8A 4G3XB 5J17A 3SDLC 1J8CA 4MSQB 2HD5B 2FAZA 1H4RA 2GBRA 2L00B 3DCGA 1V5TA 2ZJDA 4KDLB 2MP2B 2RGFA 4W9HA 1J0GA 2MLBA 2JXXA 2XK5A 2JY6A 1GC7A 2K8CA 4GSWA 2J7QB 2XBBC 4HPLB 2PPHA 3AI5A 3GOEA 2KJHB 4II2B 2R2QA 3APFA 2D3GA 1V81A 2RSUA 1J19A 3RCZA 1M94A 2MX2A 2WWZA 3BINA 1WR6E 4DHJD 3IFWB 4K7SA 4AUQC 4E3CA 3LDZE 3U8ZA 3N30A 4ZDVA 5JH5C 3KH0A 4KSLC 3VTVA 4F1SA 3W1YA 2KC1A 2RD0A 5IAAC 2PJHA 1TZ1A 1YIWA 3ONSA 1E8YA 1WFYA 4W9KA 2O6VA 4ANXA 3VTUA 4BKSD 2JVCA 2BYEA 3AU5A 3NOBA 4GDKA 4CYEA 3PRPB 3PHXB 1PQSA 1K8RB 3UF8A 3UQAA 1U4AA 1OEYJ 2KLGA 3A1QB 5L95C 1EF5A 1LM8B 2HJ8A 4TKNA 3UGBB 3X23A 1EO6A 1C1YB 1GC6A 3JVZX 2GBNA 3TIXA 1X1MA 2GOWA 3OLMD 4N9F4 1QZEA 4DK5A 4BOZB 2KNBA 1EF1A 2AYOB 3APCA 4MELA 3JYUA 2WX0A 4WJOA 4WWOA 4DDID 2C7NB 4ZRJA 3DOWA 4I6PA 4W9FA 1RAXA 1WXMA 2N9EB 2DYBA 2KANA 2PE6B 2KFJA 3ML8A 1E90A 3ECIA 1F9JA 3TMPB 3PLVA 4TQ1A 4FHJA 2M1MA 3L54A 3O65B 2MA9B 4G11A 1UGMA 5JHAA 3WIMA 2KTFA 5G55A 5DPRA 3V60A 1RLFA 3IHPC 3QWZB 2LRWA 3VHTC 5D94A 1KOTA 3CSTA 3JSVB 4JLCA 4JL9A 5DPTA 1LFDA 3M63B 5AZHA 3H9DA 4ICVA 5DCNA 4FJYA 1V49A 2G4DB 3A1QA 4EOYA 4NQLB 1V80A 2KDFB 2K6QA 3AXCA 3KUZA 4HWIB 2KJ6A 5BO4B 2J0KA 3N3KB 1WR1A 4BFRA 4W9CA 2MWSB 4URKA 3KYDD 1E5WA 1OTRB 5J2RA 4ZYNA 2AL3A 3ZRCA 2KC2A 2KZRA 2YVCA 3PZDA 1WGYA 2HTHA 3CMMB 5DPSA 1V86A 2IO1B 3ML9A 2O6VD 3R7RA 5DPWA 2L0TA 1E8WA 2KLCA 1WJ6A 4TUUA 1WZ0A 2IYDB 4G50A 4GGQA 3ZLZA 2NBUA 1TTNA 1XT9B 3DBLI 2MW5A 3V6CB 5JZEB 3NZSA 2OJRA 3L13A 3H7PA 1WX8A 3L10B 3ZO5B 3HM6X 3OAWA 2AL6A 3VUYA 1YX6B 4XC2A 4ANUA 2N9XA 3OJ3A 2IBIB 2W9NA 1KJTA 4AJWA 3VUXA 1UZXB 1V6EA 3GZNI 2KO3A 1GUAB 3PGEA 4MGIE 3MHSD 2A5UA 1KLVA 1LQBA 2B3AA 2J0JA 2ZNVB 1WM3A 1V2YA 3DVNV 3ENEA 3R7QA 3TBLD 2KK8A 4IG7B 2KTRB 3A9KB 1WIAA 4AWJA 2Z0EB 2KOXA 1C3TA 5TR5A 2EKEC 4I6LB 2WX1A 2ZNVC 3KW5B 4OVUA 2FCMA 5GMVA 2LVOA 1WGHA 2Y5BB 4WAAA 4RM9A 2D2QA 2RR9A 3NZUA 4WWPA 2MBOA 3PLUA 3P2BA 2M0XA 3Q3JA 5AZGA 3DQVA 4DHJB 1NDDA 2LGXA 2KMAA 4IWPA 2LASA 4PS7A 1CMXB 1WY8A 3KYCD 4A20A 2YLMA 3BY4B 2BYFA 4ANVA 3NHEB 5C23A 2I1KA 1LXDA 4CHKA 3N32A 5AZFA 2KDBA 4K7WA 2N7EA 3KVFB 3PV1A 4HVBA 2D11A 3WANA 2GBKA 2KJRA 2LJ5A 2XEWA 3CSFA 4GIVA 1E8ZA 4MJSA 2CU1A 3L17A 3PT2B 2WYQA 1VCBA 3QARA 5LXIB 3RULA 3VXWA 4BOSC 1WZ3A 1WMHA 1GNUA 1WJNA 2LGYA 2C7HA 4XX5A 2O2VA 3SD5A 3WAMA 4WQOB 4MSMB 2BWFA 3VH3B 2G4SA 3VUWA 1YX5B 1V5OA 4M8NA 4HXDA 3B0AA 4KIKA 4W9IA 4FULA 2DAJA 4ASWC 3TL5A 4F7ZA 3KUDB 3U7DA 5E6NA 3ZTDA 5G2NA 4AP4C 5CHFA 1WXAA 4E74A 3PS6A 3B08A 1WI0A 4NJ6A 4EZKA 4PYUA 2MRPA 4J6IA 3UIPB 3LJ3A 3DDCB 4GDKB 2MBQA 1P3QU 4K7UA 4B95A 2KMCA 3SHQA 1Q5WB 2ZZPB 4FJVB 3L16A 4PYZA 2M17A 1WYWB 3ZTCA 5LXHA 4ZRIA 2BF8B 2K25A 3PRZA 3WA0A 2FUHB 3ZW3A 2FIDA 3H1UA 3R3MA 3CF6E 3PSEB 2BYVE 2JZ3B 5D7GA 2V4LA 4ZRKA 4FN2A 5KHOA 3DBHI 4K1RB 2FCSA 2KXJA 3QAQA 2JZZA 4GOCA 3RT3B 1S3SG 5JHBA 3WALA 2IO0B 3ALBA 4AJYB 2XK5B 2KWCA 2JRHA 2MP2A 1OQYA 3HIZA 2ZPYA 2HE7A 2N4FA 3VFKA 2DZMA 2KFKB 4LCDE 3PREA 3T8MA 2KWUB 1UBQA 1L7YA 2D07B 1TBEA 2NPTB 3A4SC 5LLIA 5J18A 4W9DA 3KUCB 5HKHA 3EFUA 1IPGA 4W9GA 2KTRA 3QJZA 1D3ZA 3QA8A 3TCAA 3UIOB 1I42A 3EC8A 3IVFA 3UINB 4CO7A 4DHZB 2EMSA 2DYMA 4W9JA 4GXBA 1P0RA 2CHZA 3K9PB 4M0WB 1RFAA 4FLHA 3ZRFA 4PS3A 1UH6A 5E6OA 3S2AA 3V62A 4FJZA 2KD0A 4HDOA 3ZNGC 2KFKA 2REXA 4MDKE 3ZUNA 3IBEA 3WAOA 3I3TB 1ISNA 2MBEA 2EMTA 2KKCA 1I35A 3M95A 2LGDA 2K8BA 2FIFA 4FHKA 2M4NA 1AARA 2GBJA 4EUTA 5C1ZA 1OEYA 3M3JA 4FBJB 3A9JA 4MEMA 2G45B 2C7MB 2J0MA 4WJQA 3VH4B 1SE9A 1WE6A 1XQQA 4NQKE 4EFOA 1ZKHA 2CKHB 4NPNA 2JF5A 4EEWA 2IY1B 1BT0A 1TGZB 5CHWA 4G0NB 3B1LX 1FXTB 1ZGUB 5CX3A 2L0FA 1JRUA 4BKSA 2GBMA 2KWVB 3APDA 2NR2A 2BKFA 4IW0A 1KM7A 4ANWA 1MG8A 3QX1A 4TQ0A 5IA7A 4IM2A 1WJ4A 4EKUA 1WGRA 3QHTA 4W9LA 2C5LC 2G3QB 4HK2A 4LJPB 2KX3A 4WJNA 4BBNF 3NY5A 2WDTB 2AEHA 5D2MB 3ZDTA 3U30A 4IM3A 4KIKB 3L0WB 2FCQA 2K1FA 2BKRB 3R66C 2O2VB 2UYZB 2ZCCA 2C60A 2N1WA 4DDGD 4E71A 3VAWA 4BBNC 4A3PA 2A4ZA 3DBSA 4B6WA 2KHWB 4MJSB 2L7RA 3A9JB 1E7UA 4ICUA 2NBVB 3X0WA 4FA6A 2NBWB 3RZWC 1H8CA 3AU4A 3JW0X 2ZPNA 2PE9A 1YQBA 3K9OB 1UELA 2FNJB 3WAPA 2L76A 2ASQA 2N9PC 2MCNB 2PEAA 1IYFA 1WX7A 4NY0A 2ZEQA 4BVUC 2BGFA 4MGYE 4HCNB 3A33B 3QQ8B 2I1JA 5FR6A 3VQIA 3W1SC 4JGHB 2L05A 2BPSA 4NJ7A 4KV2A 4GN1A 2O6VB 1V9JA 3HK0A 4MM3A 2L3ZA 4KSKC 3VDZA 4A3OA 2K39A 5AEKB 3VTWA 4EZLA
chains in the Genus database with same CATH superfamily
4OHJA 1S1QB 4C7ZA 3RNBC 1YN5A 3PPAA 3ABVB 4RMAA 4NAWA 3ZNHB 3MTNB 3A9KA 2IY0B 3DVGX 2KQ7A 1DYQA 4HJKA 1NBFC 1G6JA 3PRMB 1FNWA 3AE2B 4DXAB 2OOBB 4WWNA 4PT5A 4DWFA 1Y8RC 4L1BA 1QOFA 3B2FA 4M8MA 4GU2A 1QQRA 3SU8X 1Z5SB 2GMIC 4F8CB 3ZVVA 1WGGA 2BYTA 2ZCBA 3VRAB 1LGRA 1N63A 2M0AA 4IM0A 2VRRB 2PLPA 2G9HD 1FD6A 3RYTA 1YNTE 2MBBB 2LEKA 1V1PA 4OZBA 2LRUA 1RRBA 2Z59B 3BYTB 1WYGA 4KDIC 2PTLA 2N1VA 3Q3FA 3AEBB 3D32A 4LDTD 2JRIB 2RPQA 4DBGA 3MC8A 1TS2A 1QKZA 1MG4A 3Q14C 4OVVA 1WXSA 3V3XA 4MGKE 3AE9B 2KDIA 3V6EB 4FADA 2DZIA 2WXIA 1DOIA 3ZYYX 1KLUD 2D3AA 3C0RB 2BQQA 3N1YC 4X57B 1MPEA 2IZVB 1VZ8A 4MSQB 2GBRA 2L00B 4YXDB 2XK5A 3DWMA 2XBBC 4HPLB 3AI5A 3GOEA 3ZJVA 1V81A 1C77A 2WWZA 3AN1A 1WR6E 4E3CA 4YTPB 3LDZE 1UWXA 5JH5C 4KSLC 2PJHA 1E8YA 3R2IA 2MEKA 4XWWA 3P1MA 3NOBA 2RDGA 1L4DB 1K8RB 3UQAA 1EF5A 1LM8B 2HJ8A 3X23A 3OLMD 2W82A 1STEA 1QZEA 4DK5A 1N6ZA 2AYOB 5EE3A 3APCA 5HFYA 3JYUA 4WWOA 3DOWA 4I6PA 4W9FA 2KANA 2PE6B 2KFJA 1E90A 3ECIA 4TQ1A 1SIJA 1E7PB 4KGTA 3L54A 2XNAC 5G55A 5DPRA 1RLFA 3IHPC 2KACA 1SJHD 3VHTC 3UI3A 5D94A 3CSTA 3SR6A 4ICVA 4ZYSA 1V49A 2G4DB 3A1QA 1VR9A 3AXCA 5BO4B 1TT5B 1E9MA 2MWSB 4URKA 1E5WA 2BS2B 3TUOA 4ZYNA 3ZRCA 2KZRA 1L6UA 3PZDA 1WGYA 5DPWA 3RNFC 1MFWA 2L1AA 3CWIA 1TTNA 3NZSA 2OJRA 1WX8A 2MJ3A 3L10B 3OJ3A 4XGAB 2DNFA 1VDVA 3VUXA 2KO3A 1A70A 1IUEA 1QOGA 3TBLD 1C3TA 2LMCA 2WX1A 2ZNVC 3KW5B 4R3DA 4L23A 2Y5BB 2LGSA 2CU3A 2MBOA 4OZCA 2JYTA 2M0XA 1NDDA 3NZ3A 2LGXA 2KMAA 4PS7A 3NG0A 3KYCD 2YLMA 3VR9B 4ANVA 5C23A 5BYSA 2I1KA 4HROA 4ZRQA 1FRRA 4K7WA 1F1HA 3LYYA 3P4RB 3ZGZA 3N1ZC 2KJRA 1E8ZA 3AE4B 3PT2B 2WYQA 1VCBA 1I4HA 2MJDA 1HTOA 3RULA 3VXWA 2J42A 4AQ7A 3SD5A 3VH3B 1SBBB 4YTNB 2K22A 3B0AA 4W9IA 2OEDA 2ONQA 3TL5A 3CIRB 5G2NA 2GLSA 4E74A 3B08A 4NJ6A 2QMTA 4J6IA 3UIPB 2K0PA 1C76A 3RN9C 1Q5WB 3DWGC 4FJVB 3W5UB 3ZTCA 2AX5A 1JWMD 3PSEB 2BYVE 5KHOA 2KYWA 2FCSA 4WH4A 3R8BA 1LO5D 3C19A 3GE8C 4IKGA 1CJEA 1MHHE 1N5XA 2XK5B 2KWCA 2ZPYA 2N4FA 2DZMA 4B0EA 1L7YA 2D07B 2IJ0A 3C8YA 2DLBA 2WLBA 2LUMA 1ZDVA 3DBLB 3IVFA 3UINB 3HRDD 2IGHA 4M0WB 2W54A 4OVZA 4FLHA 4PS3A 4FJZA 1V1OA 1ROEA 2KKCA 1I35A 2K8BA 2FIFA 4FHKA 1OEYA 3M3JA 4FBJB 1RYJA 4MEMA 1T0QC 3VH4B 1WE6A 1XQQA 3R2TA 1ZKHA 2QILA 3GZNB 4G0NB 1ZGUB 2GBMA 2GI9A 2KWVB 3IT6B 1L0VB 1K50A 3TSSA 5FK9C 2NR2A 2BKFA 4IW0A 1KM7A 4ANWA 4TQ0A 3ZJTA 4LTUA 1R4NB 3BVMA 3QHTA 2C5LC 4XWTA 2W3SA 3URYA 2KX3A 4WJNA 3ZDTA 2VZKD 4KIKB 3AE8B 4A9AA 2O2VB 4A90A 2UYZB 4Q2JA 4E71A 1NEKB 4FXCA 1PGXA 4A3PA 3DBSA 2PKOA 5FR3A 2L7RA 3DHIC 2VZKB 2NBVB 2RDHA 1L0YB 1EM7A 1EWCA 2NBWB 3JW0X 1YQBA 3WAPA 2MCNB 2MJEA 1YJJA 1WX7A 3Q3OC 1WSPA 4JGHB 3Q8FA 2O6VB 3HK0A 4MM3A 2L3ZA 1J8CA 4N58A 1ET6A 5AEKB 1EU3A 2PVOD 4NAWB 3N9YC 2BWES 4MACA 5FKAC 5I4DA 1SXTA 4HLEA 4REZA 3UQBA 2JUOA 1HTQA 5D6JB 3ZNID 3J9CA 3PHWB 5CHVC 3HVZA 4IC7B 1P9DU 2PVGC 4MGZE 2JWZA 3AE1B 1Q10A 1XD3B 1UD7A 4LLGM 3DBRB 2QDFA 2V1YA 2D10A 1R4NI 4LNOA 3RZFA 2RPVA 3PVLA 3ZNZB 2DZJA 2KVRA 1EUVB 1WJUA 3BZDB 3ZIMA 1UUPA 1JROA 2NCNA 2J52A 4K81A 3T9LA 2QIEB 2N7DA 2IO3B 1C4CA 1SIFA 2ICIA 2LZ6A 1VD2A 1P7EA 4BKGA 1T0YA 1E7VA 3AEFB 2LVQA 2AWTA 1SE4A 4P1BC 3HHMA 2Y5PA 3DVNU 4EZJA 5HI1A 4W9EA 2Z0DB 3IT4B 3OJ4B 4LDTB 4WURA 4HPMB 3VVWB 4TV3A 4JQWC 1I4PA 1TIFA 3ZDMC 4YL8A 1Q1OA 2LWPA 3FILA 1WF9A 3W1SA 2Q5WD 4BKTA 1TJEA 4MH0E 2LD9A 2WXRA 1RWSA 4C4VA 2RMMA 4WQMA 4ARCA 2MSED 3PZ7A 2LUEA 4KZCA 3QC8B 4NAMA 3H8HA 1MVKA 2DAFA 3NS8A 2QEJC 3AE6B 4YSYB 1E10A 1T5XD 4W9HA 1H4RA 4KDLB 2RGFA 1XLOA 4K3BA 2KJHB 1IGDA 1T0RC 1WGKA 1JWUD 1AYFA 4K7SA 4US9A 4AUQC 2H89B 4A6QA 4F1SA 4HKQA 1TZ1A 1YIWA 3AEGB 1WFYA 4W9KA 1UNSA 4BKSD 2JVCA 3Q8BA 3AU5A 2WXKA 3Q3MC 1ZXIA 1PQSA 1U4AA 3A1QB 5L95C 3UGBB 1FCLA 1EO6A 1C1YB 1GC6A 3TIXA 1X1MA 4RFBA 3FC4A 2KNBA 2YEPF 2C7NB 2LHEA 2WXJA 1ZDXA 3BVZA 4OW0A 1YMHE 4FHJA 3LXFA 1UGMA 2KTFA 3V60A 1PUTA 2LRWA 1L0XB 2ZW1A 4EOYA 3FKYA 4NQLB 3MHZA 1QT9A 3KUZA 2J0KA 3N3KB 1V97A 1KRHA 3IAM1 2E6XA 4N6EB 1AN8A 2I2YA 3RNGC 3RI7C 2IO1B 2L0TA 1V8CA 3U4EG 1E8WA 1ZXHA 1WJ6A 2MW5A 4ZOHC 5D3DA 3H7PA 3OAWA 1HZ6A 4C56C 1YX6B 4XC2A 1E0ZA 2N9XA 2W9NA 2KQ4X 1UZXB 1GUAB 3PGEA 4MGIE 2WQYB 2A5UA 3MHSD 3P4QB 1KLVA 2ZNVB 3R7QA 3ENEA 4US8A 1DOYA 1HQRD 2WS3B 4AWJA 1WIAA 2L83A 5TR5A 2WDRB 2GRIA 2KMMA 3RNEC 2FCMA 5GMVA 2QSDA 2RDBC 2RR9A 3NZUA 3PLUA 3Q3JA 4JX1C 3DQVA 1SEBD 5TSSA 4A20A 3BY4B 2BYFA 3Q8AA 2N9KA 4CHKA 1JALA 2GBKA 1CZPA 2LJ5A 2XEWA 2FUG1 3QARA 5LXIB 4BOSC 1WZ3A 3GB1A 1WJNA 2LGYA 5JXVA 3WAMA 4WQOB 1XLNA 2G4SA 2OJWA 1YX5B 2WXMA 1V5OA 1I4XA 4HXDA 4XYCA 1D5MC 4F7ZA 5E6NA 4JE3B 2JYEA 5C2TB 4PYUA 4UDUC 2MBQA 4KKIA 4B95A 3MFGA 2B76B 5G5HA 4YSXB 1SB3C 1HEZE 2BVCA 3BK1A 2FUHB 1XF5L 2FIDA 3R3MA 2JXTA 3AECB 1SJED 2LGIA 2V4LA 5D7GA 3DBHI 3QAQA 4RGOS 1OQRA 2JZZA 1S3SG 3AB5A 3WALA 4AJYB 4EE2A 1OQYA 2ACZB 4S17A 1L6VA 2HE7A 1TS4A 2KAJA 1OFFA 1ET9A 4JWSC 4W9DA 2WXQA 4HEA1 1D3ZA 3QA8A 1I42A 1FRDA 2M19A 2EMSA 3W9CB 2XN9C 2WHIA 4P16A 2VH2A 1P0RA 3K9PB 4HDOA 3ZNGC 3ZUNA 3IBEA 3WAOA 1ISNA 4M02A 2G1EA 2KDMA 2M4NA 4DQOC 3A9JA 2J0MA 4B0MA 2INDC 2IGGA 5IKCM 2CKHB 2V3NA 2IY1B 5EE9A 1BT0A 5CHWA 3MC0B 3B1LX 5CX3A 1ZP0B 2L0FA 1MG8A 1WGRA 4W9LA 2BW2A 4HK2A 2WDQB 4LJPB 4YT0B 2E3TA 2M56B 4BBNF 2K9XA 2PIAA 1NVID 3NY5A 2WDTB 5G5GA 2QC8A 5D2MB 3B2GA 1CK1A 1TS5A 3U30A 2FCQA 1K52A 1YQ3B 1WXQA 2BS3B 2ZCCA 2C60A 2N1WA 2J4XA 4B6WA 4IOIE 2IGDA 2DBYA 3AU4A 2ZPNA 2WXLA 2PEAA 4N59A 4ACFA 4ITKA 3I63C 4NY0A 4BVUC 4HCNB 3QQ8B 2I1JA 3VQIA 2BPSA 3RPFC 1V9JA 1C78A 3VTWA 3HUIA 4AOFA 4GB9A 3H6NA 1MHXA 1GB4A 2NPTA 1UWMA 1BXTA 1ZW7A 4S0RA 2JPHA 1J7AA 2V3PA 5BMIA 1FCCC 1WM2A 3Q8CA 4JIOU 2R2OA 2K6DB 1Z2MA 3RD2A 2AQ1B 3DVGY 2C9WB 1ZUD2 3BYYB 1SGHA 1P98A 3QIJA 2FCNA 3H7PB 2KDEB 1MJDA 3LB8C 3ZKJC 2JU6X 2LI5A 5E6PA 2L8JA 3NRZA 1YD8U 1PYWD 1OGWA 4LNKA 2X38A 4LJOB 4YWGG 3BIID 3TEWA 2DZKA 2JT4B 1ESFA 2ZW0A 3IG3A 1D5XC 3FILB 2KQSA 1FIQA 1FM0D 3M62B 4GDLA 4H2AA 5E6JA 5BYQA 5CTRC 1QOBA 3I5JC 3PTFC 2MQJA 3MJWA 4OZAA 2DYOA 2WXNA 4ZHOA 4B9KA 1C4AA 1QLBB 1N62A 3AV8A 4HDQA 2N9LA 1GJZA 2LXCA 3AH7A 3EECA 2VH1A 4IUMB 2WU5B 4K3CA 1NYRA 4BAXA 1WXVA 1IP9A 4GMVA 1JQ4A 3P63A 4GDLB 1JWBD 2QHOA 2NTSA 5L83A 4RM8A 2GB1A 2ZVOA 1L2NA 1FFVA 1WRDB 5MPOA 3NVZA 4HCPB 1Q0WB 1UBIA 4XZ4A 4PS8A 4I6NB 3TJPA 1F52A 1VRAB 4G3XB 1ENFA 4A8XC 2FAZA 3DCGA 1V5TA 2MP2B 2JXXA 2JY6A 2K8CA 2WNMA 2PPHA 1I4GA 1EU4A 2R2QA 2D3GA 5HHDG 2RSUA 4LK0M 1L5PA 1DOXA 3AE7B 3IFWB 1FO4A 2INNE 4ZDVA 3ZJUA 3KH0A 2BBCA 3VTVA 1IGCA 3W1YA 2KC1A 2RD0A 1HZ5A 2O6VA 3VTUA 1JRPA 1FMAD 2BYEA 3PRPB 3PHXB 1E6EB 3UF8A 2KLGA 4TKNA 3Q8EA 1WRIA 3JVZX 4PK1A 2QJLA 4NZLB 3B9JA 4MELA 4WJOA 4DDID 3SFDB 4YTMB 2N9EB 1JWSD 2WGSA 3ML8A 3ZXVA 2HJ1A 3TMPB 5BMGA 3PLVA 4RGNA 3KLSX 2NTTA 3O65B 4KKJA 3QWZB 1F77A 1KOTA 5DPTA 1LFDA 3M63B 1HXYD 3H9DA 3KQ4A 1V80A 1N60A 3L4PA 2KDFB 4HWIB 2KJ6A 4BFRA 4W9CA 1HA5A 4USAA 1D6EC 2R61A 1OTRB 5J2RA 1B1ZA 2AL3A 2KC2A 4RGMA 2YVCA 4YSZB 4BZAA 1V86A 3R7RA 1TS3A 1OQQA 2KLCA 3AEAB 4G50A 2NBUA 1XT9B 5JZEB 2YEPB 4P1CC 3ZO5B 3HM6X 3AE5B 2AL6A 2HTME 2IBIB 1KJTA 2WU2B 1XLQA 1YQ4B 4C00A 2WXPA 1V6EA 2K5PA 4M0WA 3GZNI 2I38A 2SAKA 2B3AA 1TZOA 3DVNV 1UF0A 1V2YA 4D2KA 4IG7B 2Z0EB 2KOXA 2EKEC 4I6LB 5IOIA 2LVOA 1WGHA 4WAAA 4RM9A 2D2QA 3NVYA 4WWPA 3P2BA 5D3IB 4MM3B 4DHJB 1M4VA 5IN7A 2BB5A 1CMXB 1WY8A 2D5GA 2V0GA 1KTKA 1K53A 3NHEB 1LXDA 2KDBA 3IXSA 3KVFB 1F2RI 1N5WA 1FNUA 3WANA 1FNVA 1MI0A 2N0SB 3NVVA 1GNUA 2V4IB 2C7HA 1TYGB 2O2VA 2BS4B 4MSMB 2INCC 1XCQL 4M8NA 4KIKA 4FULA 2DAJA 3KUDB 3U7DA 2V9HA 4AP4C 2HDEA 5CHFA 1WXAA 4DXFA 3PS6A 3GS2A 4EZKA 2MRPA 3DDCB 4GDKB 1P3QU 3NUHB 2ZZPB 4PYZA 2M17A 3ZXRA 2BF8B 2K25A 4TSSA 1YN4A 3ZW3A 2KT7A 1TY2A 4FN2A 2KXJA 3W5VB 4GOCA 1BMLC 3RT3B 1I4QA 5JHBA 3P42A 3SEBA 2JRHA 2MP2A 4M00A 1PFDA 1WWTA 3VFKA 2LFIA 3PREA 2KWUB 1UBQA 2H88B 3A4SC 5J18A 4IDIA 3KUCB 1F2RC 4W9GA 3N20C 3UIOB 4DHZB 2DYMA 1KLGD 3Q69A 3O13A 2BT6A 1RFAA 3ZRFA 3S2AA 1UH6A 3V62A 1L4ZB 2KFKA 4MDKE 4CQNA 3I3TB 5LNK1 2MBEA 2EMTA 2PMVA 1XXGA 3M95A 2LGDA 4HRSA 4KGSA 2GBJA 1C79A 1JW9D 4EUTA 3AE3B 5C1ZA 3TEYA 2CJOA 1QF6A 1SE9A 1R4MB 4NPNA 4EEWA 1TGZB 1IBXB 1RM6C 4RCOA 1FXTB 1JRUA 4BKSA 4NJCA 3APDA 1VJKA 3QX1A 3KWLA 1WJ4A 2G3QB 4JWUC 5HG2A 1PGAA 3WCQA 4DDGD 2A4ZA 4C7YA 4HJGE 1E7UA 4ICUA 1H8CA 4LNIA 3NS1A 2FNJB 2N9PC 1IYFA 3U2SC 3DHHC 1YJIA 2ZEQA 2BGFA 3EFCA 1K51A 4GN1A 4KSKC 1YOVB 1GAQB 1TKGA 3EA6A 3AMZA 1GG3A 4WJPA 1FXAA 2K8HA 4A55A 1WGDA 5EDSA 4WWMA 1FEHA 3HM3A 4RNAA 2CR5A 3EUB2 3I57A 2LXAA 2KX0A 4KGRA 2CHWA 4DHZE 3RUIB 2MBHA 2WXHA 2ZVNA 1I7HA 2SEBD 3AULA 1NI2A 1ZOYB 2V3SA 5EE0A 5KHQA 2CS4A 2WXGA 1N61A 2UWQA 4P7IA 4C4VB 1PGBA 3A4RA 2DWQA 1T3QA 2CHXA 2LVPA 3QCAA 3RFZB 4JPSA 3AM9A 1WMHB 2DENB 2KN5A 2NVUI 3P4SB 1R4MI 3PZ8A 3EGRA 3Q6BA 3DPDA 4KX6B 1YN3A 2M8SA 3JSVA 3EHVA 2ON8A 2NS5A 1P1AA 1XCTL 1ZE3D 1XLPA 1V1PB 3V61A 4O1NA 1WX9A 1R7SA 3L08A 3H7SA 4IWQA 3ZQ4A 1YJ1A 1F0ZA 3DBRI 4M01A 1WE7A 1E8XA 4KZ0A 4IWOA 4XDCA 1VZ6A 4MH8A 2IO2B 3QK0A 1FFUA 2JWUA 2DHZA 3VRBB 4KVGB 4II3B 2LHDA 1UGJA 1A5RA 1B9RA 1HE8A 2DX5B 1WH3A 1D5ZC 4NNJB 1TKYA 5J17A 3SDLC 2HD5B 1J0GA 2ZJDA 4TMAB 2EELA 2MLBA 5IP4D 1GC7A 4GSWA 2J7QB 4II2B 3APFA 3KWVA 2WXOA 1J19A 3RCZA 1M94A 2MX2A 3BINA 5EE1A 4DHJD 4XE0A 3U8ZA 4WAFA 3N30A 1J7CA 5IAAC 1FPYA 3ONSA 4ANXA 4WIPA 4CYEA 4GDKA 3DBHB 1GOZA 1OEYJ 1CQVA 1VLBA 2GBNA 2GOWA 4N9F4 2BB6A 4BOZB 1KFYB 1EF1A 3MP9A 1D4BA 2WX0A 4ZRJA 1RAXA 2Y5CA 1WXMA 2DYBA 2N7JA 4RF0A 1F9JA 5H92C 2MHJA 2M1MA 2W55A 1VZ7A 2JQRB 2MA9B 4G11A 5JHAA 1PDXA 3WIMA 1SE3A 3HVDA 1GB1A 5BMHA 1T6BX 3OWEB 3JSVB 4JLCA 4JL9A 3RMKC 2TSSA 5AZHA 5DCNA 4FJYA 3TEZA 2K6QA 1WR1A 1NI3A 3KYDD 3DHGC 3BWUD 4RF1A 1JWAD 2HTHA 3CMMB 5DPSA 3NVWA 3ML9A 2O6VD 3ETRA 3T3NA 3PO0A 4TUUA 1WZ0A 2IYDB 4GGQA 2MH7A 3ZLZA 2IPKD 3DBLI 3RNCC 1P7FA 3V6CB 3L13A 1SF0A 3VUYA 4ANUA 4AJWA 1LQBA 2WDVB 2J0JA 1WM3A 2PW9A 2KK8A 4ZHPA 2KTRB 3RNAC 3A9KB 3I9V1 4QAYA 1TY0A 2OHFA 3FAHA 4OVUA 1XEEA 3AEEB 1Y56A 5AZGA 3OG5A 4IWPA 2LASA 2BTEA 3W2DA 3IAS1 5BYRA 2UU7A 3T3OA 3N32A 1KF6B 5AZFA 2N7EA 2L52A 3PV1A 1RFKA 4HVBA 2D11A 3CSFA 1NYQA 2KN4A 4GIVA 2D3CA 4MJSA 2CU1A 3L17A 2AQ3B 1WMHA 4RH6A 1I4RA 4XX5A 2LJIA 1ZPSA 3VUWA 2BWFA 3SFEB 4L2YA 4ZRPA 3TEXA 3BK2A 2QCZA 1FXIA 3ZTDA 4RGTA 1WI0A 1NENB 2INPE 3LJ3A 1T0SC 4K7UA 2W3RA 2KMCA 3Q3NC 3SHQA 3L16A 1WYWB 5LXHA 4ZRIA 3PRZA 3WA0A 2JX5A 3H1UA 3CF6E 2K3UA 1AW7A 3GE3C 2JZ3B 4ZRKA 1C4PA 4K1RB 1JCKB 3MC9A 3E9SA 5C3JB 2L32A 1GPXA 2IO0B 2FBWB 3ALBA 4ARIA 3HIZA 4P6VF 3E56A 4LCDE 2IDYA 2KFKB 3T8MA 4ASWC 2NPTB 5LLIA 1TBEA 1KH0A 2JZPA 3EFUA 5HKHA 1IPGA 2KTRA 3QJZA 4LNFA 1DGJA 3GP7A 3TCAA 1QOAA 3EC8A 4CO7A 4W9JA 4GXBA 2CHZA 2CJNA 1TKEA 5E6OA 2AQ2B 3V05A 2WP9B 2KD0A 1SE2A 2REXA 4LNNA 1C9FA 3AEDB 5IO9A 3BVGA 5AUIA 1AARA 2J53A 2D3BA 3NJTA 2G45B 5AUKA 2C7MB 4WJQA 4MT5A 4NQKE 4EFOA 2JF5A 1XO3A 2NMQA 4J3OD 2EKIA 3U52E 4HKZE 1EWYC 1JMLA 4AS1A 5GXGB 5IA7A 4IM2A 4EKUA 2Y3AA 2FE8A 1SSNA 4GLSC 2Z8LA 2AEHA 4IM3A 3L0WB 2K1FA 3Q2AC 2BKRB 3R66C 5H8YE 3N1XC 4HPPA 5T8IA 4C80A 1IBXA 3VAWA 4BBNC 4DXGA 2KHWB 4MJSB 3A9JB 3X0WA 4FA6A 3RZWC 1BUIC 2PE9A 1J7BA 3K9OB 1UELA 4XDDA 1AWDA 3U7ZA 2L76A 2ASQA 3VR8B 2KWDA 1QILA 2WXFA 4MGYE 3A33B 2JSVX 1ACCA 5FR6A 3W1SC 2L05A 3P4PB 4NJ7A 4KV2A 2KVZA 2X8XX 3VDZA 3MJ5A 4A3OA 2K39A 4EZLA
chains in the Genus database with same CATH topology
4AOFA 4NAWB 4GB9A 3H6NA 1S1QB 1GG3A 2BWES 2NPTA 4WJPA 1ZW7A 2JPHA 3PPAA 4RMAA 4NAWA 4HLEA 3ZNHB 3MTNB 1WM2A 2K8HA 3A9KA 3UQBA 2IY0B 2JUOA 3DVGX 4JIOU 1WGDA 5EDSA 2KQ7A 3HM3A 2CR5A 2K6DB 2R2OA 4HJKA 1NBFC 1Z2MA 5D6JB 3RD2A 3ZNID 1G6JA 2LXAA 3DVGY 3PRMB 3PHWB 2KX0A 5CHVC 2C9WB 4IC7B 1P9DU 4DXAB 2CHWA 4MGZE 2OOBB 4WWNA 4DHZE 1SGHA 1P98A 3RUIB 3QIJA 2MBHA 2FCNA 2ZVNA 2JWZA 3H7PB 2KDEB 1XD3B 3AULA 1NI2A 1UD7A 2V3SA 3ZKJC 2LI5A 5E6PA 2L8JA 5KHQA 2CS4A 4DWFA 1Y8RC 2V1YA 1YD8U 4GU2A 4M8MA 4P7IA 2D10A 1R4NI 2UWQA 1OGWA 3RZFA 1Z5SB 3SU8X 2GMIC 4F8CB 3ZVVA 1WGGA 3A4RA 3PVLA 2ZCBA 3ZNZB 2CHXA 2DZJA 4LJOB 2DZKA 2KVRA 2LVPA 1EUVB 1WJUA 4IM0A 3ZIMA 2JT4B 2VRRB 3QCAA 3IG3A 2NCNA 4K81A 2KQSA 3M62B 4GDLA 3T9LA 1WMHB 2IO3B 1SIFA 2N7DA 2LZ6A 3RYTA 2DENB 5CTRC 2KN5A 2NVUI 1VD2A 1R4MI 4BKGA 2MBBB 1T0YA 3PTFC 1E7VA 2MQJA 3MJWA 2DYOA 3DPDA 2LVQA 4B9KA 2LRUA 2AWTA 2M8SA 1RRBA 3JSVA 3EHVA 2Z59B 2NS5A 3HHMA 3DVNU 1P1AA 4HDQA 4EZJA 4KDIC 1GJZA 4W9EA 2LXCA 2Z0DB 3OJ4B 4LDTB 2N1VA 3EECA 3Q3FA 4IUMB 3D32A 4HPMB 3VVWB 4LDTD 3V61A 4TV3A 4JQWC 1WX9A 2JRIB 3ZDMC 3L08A 2RPQA 3H7SA 4IWQA 4YL8A 1WXVA 1IP9A 1YJ1A 4GMVA 4DBGA 1Q1OA 3DBRI 4GDLB 2LWPA 1WF9A 1WE7A 1E8XA 3W1SA 4OVVA 4BKTA 2QHOA 4KZ0A 1WXSA 4MH0E 4IWOA 4MGKE 2LD9A 5L83A 2IO2B 3QK0A 2KDIA 4RM8A 2ZVOA 3V6EB 4FADA 1L2NA 2DHZA 2DZIA 1WRDB 2MSED 4KVGB 2LUEA 4II3B 4KZCA 4HCPB 3QC8B 1Q0WB 1A5RA 1HE8A 2DX5B 1UBIA 4XZ4A 3C0RB 2DAFA 4PS8A 1WH3A 4I6NB 4X57B 3TJPA 4NNJB 2IZVB 3NS8A 4G3XB 5J17A 3SDLC 1J8CA 4MSQB 2HD5B 2FAZA 1H4RA 2GBRA 2L00B 3DCGA 1V5TA 2ZJDA 4KDLB 2MP2B 2RGFA 4W9HA 1J0GA 2MLBA 2JXXA 2XK5A 2JY6A 1GC7A 2K8CA 4GSWA 2J7QB 2XBBC 4HPLB 2PPHA 3AI5A 3GOEA 2KJHB 4II2B 2R2QA 3APFA 2D3GA 1V81A 2RSUA 1J19A 3RCZA 1M94A 2MX2A 2WWZA 3BINA 1WR6E 4DHJD 3IFWB 4K7SA 4AUQC 4E3CA 3LDZE 3U8ZA 3N30A 4ZDVA 5JH5C 3KH0A 4KSLC 3VTVA 4F1SA 3W1YA 2KC1A 2RD0A 5IAAC 2PJHA 1TZ1A 1YIWA 3ONSA 1E8YA 1WFYA 4W9KA 2O6VA 4ANXA 3VTUA 4BKSD 2JVCA 2BYEA 3AU5A 3NOBA 4GDKA 4CYEA 3PRPB 3PHXB 1PQSA 1K8RB 3UF8A 3UQAA 1U4AA 1OEYJ 2KLGA 3A1QB 5L95C 1EF5A 1LM8B 2HJ8A 4TKNA 3UGBB 3X23A 1EO6A 1C1YB 1GC6A 3JVZX 2GBNA 3TIXA 1X1MA 2GOWA 3OLMD 4N9F4 1QZEA 4DK5A 4BOZB 2KNBA 1EF1A 2AYOB 3APCA 4MELA 3JYUA 2WX0A 4WJOA 4WWOA 4DDID 2C7NB 4ZRJA 3DOWA 4I6PA 4W9FA 1RAXA 1WXMA 2N9EB 2DYBA 2KANA 2PE6B 2KFJA 3ML8A 1E90A 3ECIA 1F9JA 3TMPB 3PLVA 4TQ1A 4FHJA 2M1MA 3L54A 3O65B 2MA9B 4G11A 1UGMA 5JHAA 3WIMA 2KTFA 5G55A 5DPRA 3V60A 1RLFA 3IHPC 3QWZB 2LRWA 3VHTC 5D94A 1KOTA 3CSTA 3JSVB 4JLCA 4JL9A 5DPTA 1LFDA 3M63B 5AZHA 3H9DA 4ICVA 5DCNA 4FJYA 1V49A 2G4DB 3A1QA 4EOYA 4NQLB 1V80A 2KDFB 2K6QA 3AXCA 3KUZA 4HWIB 2KJ6A 5BO4B 2J0KA 3N3KB 1WR1A 4BFRA 4W9CA 2MWSB 4URKA 3KYDD 1E5WA 1OTRB 5J2RA 4ZYNA 2AL3A 3ZRCA 2KC2A 2KZRA 2YVCA 3PZDA 1WGYA 2HTHA 3CMMB 5DPSA 1V86A 2IO1B 3ML9A 2O6VD 3R7RA 5DPWA 2L0TA 1E8WA 2KLCA 1WJ6A 4TUUA 1WZ0A 2IYDB 4G50A 4GGQA 3ZLZA 2NBUA 1TTNA 1XT9B 3DBLI 2MW5A 3V6CB 5JZEB 3NZSA 2OJRA 3L13A 3H7PA 1WX8A 3L10B 3ZO5B 3HM6X 3OAWA 2AL6A 3VUYA 1YX6B 4XC2A 4ANUA 2N9XA 3OJ3A 2IBIB 2W9NA 1KJTA 4AJWA 3VUXA 1UZXB 1V6EA 3GZNI 2KO3A 1GUAB 3PGEA 4MGIE 3MHSD 2A5UA 1KLVA 1LQBA 2B3AA 2J0JA 2ZNVB 1WM3A 1V2YA 3DVNV 3ENEA 3R7QA 3TBLD 2KK8A 4IG7B 2KTRB 3A9KB 1WIAA 4AWJA 2Z0EB 2KOXA 1C3TA 5TR5A 2EKEC 4I6LB 2WX1A 2ZNVC 3KW5B 4OVUA 2FCMA 5GMVA 2LVOA 1WGHA 2Y5BB 4WAAA 4RM9A 2D2QA 2RR9A 3NZUA 4WWPA 2MBOA 3PLUA 3P2BA 2M0XA 3Q3JA 5AZGA 3DQVA 4DHJB 1NDDA 2LGXA 2KMAA 4IWPA 2LASA 4PS7A 1CMXB 1WY8A 3KYCD 4A20A 2YLMA 3BY4B 2BYFA 4ANVA 3NHEB 5C23A 2I1KA 1LXDA 4CHKA 3N32A 5AZFA 2KDBA 4K7WA 2N7EA 3KVFB 3PV1A 4HVBA 2D11A 3WANA 2GBKA 2KJRA 2LJ5A 2XEWA 3CSFA 4GIVA 1E8ZA 4MJSA 2CU1A 3L17A 3PT2B 2WYQA 1VCBA 3QARA 5LXIB 3RULA 3VXWA 4BOSC 1WZ3A 1WMHA 1GNUA 1WJNA 2LGYA 2C7HA 4XX5A 2O2VA 3SD5A 3WAMA 4WQOB 4MSMB 2BWFA 3VH3B 2G4SA 3VUWA 1YX5B 1V5OA 4M8NA 4HXDA 3B0AA 4KIKA 4W9IA 4FULA 2DAJA 4ASWC 3TL5A 4F7ZA 3KUDB 3U7DA 5E6NA 3ZTDA 5G2NA 4AP4C 5CHFA 1WXAA 4E74A 3PS6A 3B08A 1WI0A 4NJ6A 4EZKA 4PYUA 2MRPA 4J6IA 3UIPB 3LJ3A 3DDCB 4GDKB 2MBQA 1P3QU 4K7UA 4B95A 2KMCA 3SHQA 1Q5WB 2ZZPB 4FJVB 3L16A 4PYZA 2M17A 1WYWB 3ZTCA 5LXHA 4ZRIA 2BF8B 2K25A 3PRZA 3WA0A 2FUHB 3ZW3A 2FIDA 3H1UA 3R3MA 3CF6E 3PSEB 2BYVE 2JZ3B 5D7GA 2V4LA 4ZRKA 4FN2A 5KHOA 3DBHI 4K1RB 2FCSA 2KXJA 3QAQA 2JZZA 4GOCA 3RT3B 1S3SG 5JHBA 3WALA 2IO0B 3ALBA 4AJYB 2XK5B 2KWCA 2JRHA 2MP2A 1OQYA 3HIZA 2ZPYA 2HE7A 2N4FA 3VFKA 2DZMA 2KFKB 4LCDE 3PREA 3T8MA 2KWUB 1UBQA 1L7YA 2D07B 1TBEA 2NPTB 3A4SC 5LLIA 5J18A 4W9DA 3KUCB 5HKHA 3EFUA 1IPGA 4W9GA 2KTRA 3QJZA 1D3ZA 3QA8A 3TCAA 3UIOB 1I42A 3EC8A 3IVFA 3UINB 4CO7A 4DHZB 2EMSA 2DYMA 4W9JA 4GXBA 1P0RA 2CHZA 3K9PB 4M0WB 1RFAA 4FLHA 3ZRFA 4PS3A 1UH6A 5E6OA 3S2AA 3V62A 4FJZA 2KD0A 4HDOA 3ZNGC 2KFKA 2REXA 4MDKE 3ZUNA 3IBEA 3WAOA 3I3TB 1ISNA 2MBEA 2EMTA 2KKCA 1I35A 3M95A 2LGDA 2K8BA 2FIFA 4FHKA 2M4NA 1AARA 2GBJA 4EUTA 5C1ZA 1OEYA 3M3JA 4FBJB 3A9JA 4MEMA 2G45B 2C7MB 2J0MA 4WJQA 3VH4B 1SE9A 1WE6A 1XQQA 4NQKE 4EFOA 1ZKHA 2CKHB 4NPNA 2JF5A 4EEWA 2IY1B 1BT0A 1TGZB 5CHWA 4G0NB 3B1LX 1FXTB 1ZGUB 5CX3A 2L0FA 1JRUA 4BKSA 2GBMA 2KWVB 3APDA 2NR2A 2BKFA 4IW0A 1KM7A 4ANWA 1MG8A 3QX1A 4TQ0A 5IA7A 4IM2A 1WJ4A 4EKUA 1WGRA 3QHTA 4W9LA 2C5LC 2G3QB 4HK2A 4LJPB 2KX3A 4WJNA 4BBNF 3NY5A 2WDTB 2AEHA 5D2MB 3ZDTA 3U30A 4IM3A 4KIKB 3L0WB 2FCQA 2K1FA 2BKRB 3R66C 2O2VB 2UYZB 2ZCCA 2C60A 2N1WA 4DDGD 4E71A 3VAWA 4BBNC 4A3PA 2A4ZA 3DBSA 4B6WA 2KHWB 4MJSB 2L7RA 3A9JB 1E7UA 4ICUA 2NBVB 3X0WA 4FA6A 2NBWB 3RZWC 1H8CA 3AU4A 3JW0X 2ZPNA 2PE9A 1YQBA 3K9OB 1UELA 2FNJB 3WAPA 2L76A 2ASQA 2N9PC 2MCNB 2PEAA 1IYFA 1WX7A 4NY0A 2ZEQA 4BVUC 2BGFA 4MGYE 4HCNB 3A33B 3QQ8B 2I1JA 5FR6A 3VQIA 3W1SC 4JGHB 2L05A 2BPSA 4NJ7A 4KV2A 4GN1A 2O6VB 1V9JA 3HK0A 4MM3A 2L3ZA 4KSKC 3VDZA 4A3OA 2K39A 5AEKB 3VTWA 4EZLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4AOF A;  4NAW B;  4GB9 A;  3H6N A;  1S1Q B;  1GG3 A;  2BWE S;  2NPT A;  4WJP A;  1ZW7 A;  2JPH A;  3PPA A;  4RMA A;  4NAW A;  4HLE A;  3ZNH B;  3MTN B;  1WM2 A;  2K8H A;  3A9K A;  3UQB A;  2IY0 B;  2JUO A;  3DVG X;  4JIO U;  1WGD A;  5EDS A;  2KQ7 A;  3HM3 A;  2CR5 A;  2K6D B;  2R2O A;  4HJK A;  1NBF C;  1Z2M A;  5D6J B;  3RD2 A;  3ZNI D;  1G6J A;  2LXA A;  3DVG Y;  3PRM B;  3PHW B;  2KX0 A;  5CHV C;  2C9W B;  4IC7 B;  1P9D U;  4DXA B;  2CHW A;  4MGZ E;  2OOB B;  4WWN A;  4DHZ E;  1SGH A;  1P98 A;  3RUI B;  3QIJ A;  2MBH A;  2FCN A;  2ZVN A;  2JWZ A;  3H7P B;  2KDE B;  1XD3 B;  3AUL A;  1NI2 A;  1UD7 A;  2V3S A;  3ZKJ C;  2LI5 A;  5E6P A;  2L8J A;  5KHQ A;  2CS4 A;  4DWF A;  1Y8R C;  2V1Y A;  1YD8 U;  4GU2 A;  4M8M A;  4P7I A;  2D10 A;  1R4N I;  2UWQ A;  1OGW A;  3RZF A;  1Z5S B;  3SU8 X;  2GMI C;  4F8C B;  3ZVV A;  1WGG A;  3A4R A;  3PVL A;  2ZCB A;  3ZNZ B;  2CHX A;  2DZJ A;  4LJO B;  2DZK A;  2KVR A;  2LVP A;  1EUV B;  1WJU A;  4IM0 A;  3ZIM A;  2JT4 B;  2VRR B;  3QCA A;  3IG3 A;  2NCN A;  4K81 A;  2KQS A;  3M62 B;  4GDL A;  3T9L A;  1WMH B;  2IO3 B;  1SIF A;  2N7D A;  2LZ6 A;  3RYT A;  2DEN B;  5CTR C;  2KN5 A;  2NVU I;  1VD2 A;  1R4M I;  4BKG A;  2MBB B;  1T0Y A;  3PTF C;  1E7V A;  2MQJ A;  3MJW A;  2DYO A;  3DPD A;  2LVQ A;  4B9K A;  2LRU A;  2AWT A;  2M8S A;  1RRB A;  3JSV A;  3EHV A;  2Z59 B;  2NS5 A;  3HHM A;  3DVN U;  1P1A A;  4HDQ A;  4EZJ A;  4KDI C;  1GJZ A;  4W9E A;  2LXC A;  2Z0D B;  3OJ4 B;  4LDT B;  2N1V A;  3EEC A;  3Q3F A;  4IUM B;  3D32 A;  4HPM B;  3VVW B;  4LDT D;  3V61 A;  4TV3 A;  4JQW C;  1WX9 A;  2JRI B;  3ZDM C;  3L08 A;  2RPQ A;  3H7S A;  4IWQ A;  4YL8 A;  1WXV A;  1IP9 A;  1YJ1 A;  4GMV A;  4DBG A;  1Q1O A;  3DBR I;  4GDL B;  2LWP A;  1WF9 A;  1WE7 A;  1E8X A;  3W1S A;  4OVV A;  4BKT A;  2QHO A;  4KZ0 A;  1WXS A;  4MH0 E;  4IWO A;  4MGK E;  2LD9 A;  5L83 A;  2IO2 B;  3QK0 A;  2KDI A;  4RM8 A;  2ZVO A;  3V6E B;  4FAD A;  1L2N A;  2DHZ A;  2DZI A;  1WRD B;  2MSE D;  4KVG B;  2LUE A;  4II3 B;  4KZC A;  4HCP B;  3QC8 B;  1Q0W B;  1A5R A;  1HE8 A;  2DX5 B;  1UBI A;  4XZ4 A;  3C0R B;  2DAF A;  4PS8 A;  1WH3 A;  4I6N B;  4X57 B;  3TJP A;  4NNJ B;  2IZV B;  3NS8 A;  4G3X B;  5J17 A;  3SDL C;  1J8C A;  4MSQ B;  2HD5 B;  2FAZ A;  1H4R A;  2GBR A;  2L00 B;  3DCG A;  1V5T A;  2ZJD A;  4KDL B;  2MP2 B;  2RGF A;  4W9H A;  1J0G A;  2MLB A;  2JXX A;  2XK5 A;  2JY6 A;  1GC7 A;  2K8C A;  4GSW A;  2J7Q B;  2XBB C;  4HPL B;  2PPH A;  3AI5 A;  3GOE A;  2KJH B;  4II2 B;  2R2Q A;  3APF A;  2D3G A;  1V81 A;  2RSU A;  1J19 A;  3RCZ A;  1M94 A;  2MX2 A;  2WWZ A;  3BIN A;  1WR6 E;  4DHJ D;  3IFW B;  4K7S A;  4AUQ C;  4E3C A;  3LDZ E;  3U8Z A;  3N30 A;  4ZDV A;  5JH5 C;  3KH0 A;  4KSL C;  3VTV A;  4F1S A;  3W1Y A;  2KC1 A;  2RD0 A;  5IAA C;  2PJH A;  1TZ1 A;  1YIW A;  3ONS A;  1E8Y A;  1WFY A;  4W9K A;  2O6V A;  4ANX A;  3VTU A;  4BKS D;  2JVC A;  2BYE A;  3AU5 A;  3NOB A;  4GDK A;  4CYE A;  3PRP B;  3PHX B;  1PQS A;  1K8R B;  3UF8 A;  3UQA A;  1U4A A;  1OEY J;  2KLG A;  3A1Q B;  5L95 C;  1EF5 A;  1LM8 B;  2HJ8 A;  4TKN A;  3UGB B;  3X23 A;  1EO6 A;  1C1Y B;  1GC6 A;  3JVZ X;  2GBN A;  3TIX A;  1X1M A;  2GOW A;  3OLM D;  4N9F 4;  1QZE A;  4DK5 A;  4BOZ B;  2KNB A;  1EF1 A;  2AYO B;  3APC A;  4MEL A;  3JYU A;  2WX0 A;  4WJO A;  4WWO A;  4DDI D;  2C7N B;  4ZRJ A;  3DOW A;  4I6P A;  4W9F A;  1RAX A;  1WXM A;  2N9E B;  2DYB A;  2KAN A;  2PE6 B;  2KFJ A;  3ML8 A;  1E90 A;  3ECI A;  1F9J A;  3TMP B;  3PLV A;  4TQ1 A;  4FHJ A;  2M1M A;  3L54 A;  3O65 B;  2MA9 B;  4G11 A;  1UGM A;  5JHA A;  3WIM A;  2KTF A;  5G55 A;  5DPR A;  3V60 A;  1RLF A;  3IHP C;  3QWZ B;  2LRW A;  3VHT C;  5D94 A;  1KOT A;  3CST A;  3JSV B;  4JLC A;  4JL9 A;  5DPT A;  1LFD A;  3M63 B;  5AZH A;  3H9D A;  4ICV A;  5DCN A;  4FJY A;  1V49 A;  2G4D B;  3A1Q A;  4EOY A;  4NQL B;  1V80 A;  2KDF B;  2K6Q A;  3AXC A;  3KUZ A;  4HWI B;  2KJ6 A;  5BO4 B;  2J0K A;  3N3K B;  1WR1 A;  4BFR A;  4W9C A;  2MWS B;  4URK A;  3KYD D;  1E5W A;  1OTR B;  5J2R A;  4ZYN A;  2AL3 A;  3ZRC A;  2KC2 A;  2KZR A;  2YVC A;  3PZD A;  1WGY A;  2HTH A;  3CMM B;  5DPS A;  1V86 A;  2IO1 B;  3ML9 A;  2O6V D;  3R7R A;  5DPW A;  2L0T A;  1E8W A;  2KLC A;  1WJ6 A;  4TUU A;  1WZ0 A;  2IYD B;  4G50 A;  4GGQ A;  3ZLZ A;  2NBU A;  1TTN A;  1XT9 B;  3DBL I;  2MW5 A;  3V6C B;  5JZE B;  3NZS A;  2OJR A;  3L13 A;  3H7P A;  1WX8 A;  3L10 B;  3ZO5 B;  3HM6 X;  3OAW A;  2AL6 A;  3VUY A;  1YX6 B;  4XC2 A;  4ANU A;  2N9X A;  3OJ3 A;  2IBI B;  2W9N A;  1KJT A;  4AJW A;  3VUX A;  1UZX B;  1V6E A;  3GZN I;  2KO3 A;  1GUA B;  3PGE A;  4MGI E;  3MHS D;  2A5U A;  1KLV A;  1LQB A;  2B3A A;  2J0J A;  2ZNV B;  1WM3 A;  1V2Y A;  3DVN V;  3ENE A;  3R7Q A;  3TBL D;  2KK8 A;  4IG7 B;  2KTR B;  3A9K B;  1WIA A;  4AWJ A;  2Z0E B;  2KOX A;  1C3T A;  5TR5 A;  2EKE C;  4I6L B;  2WX1 A;  2ZNV C;  3KW5 B;  4OVU A;  2FCM A;  5GMV A;  2LVO A;  1WGH A;  2Y5B B;  4WAA A;  4RM9 A;  2D2Q A;  2RR9 A;  3NZU A;  4WWP A;  2MBO A;  3PLU A;  3P2B A;  2M0X A;  3Q3J A;  5AZG A;  3DQV A;  4DHJ B;  1NDD A;  2LGX A;  2KMA A;  4IWP A;  2LAS A;  4PS7 A;  1CMX B;  1WY8 A;  3KYC D;  4A20 A;  2YLM A;  3BY4 B;  2BYF A;  4ANV A;  3NHE B;  5C23 A;  2I1K A;  1LXD A;  4CHK A;  3N32 A;  5AZF A;  2KDB A;  4K7W A;  2N7E A;  3KVF B;  3PV1 A;  4HVB A;  2D11 A;  3WAN A;  2GBK A;  2KJR A;  2LJ5 A;  2XEW A;  3CSF A;  4GIV A;  1E8Z A;  4MJS A;  2CU1 A;  3L17 A;  3PT2 B;  2WYQ A;  1VCB A;  3QAR A;  5LXI B;  3RUL A;  3VXW A;  4BOS C;  1WZ3 A;  1WMH A;  1GNU A;  1WJN A;  2LGY A;  2C7H A;  4XX5 A;  2O2V A;  3SD5 A;  3WAM A;  4WQO B;  4MSM B;  2BWF A;  3VH3 B;  2G4S A;  3VUW A;  1YX5 B;  1V5O A;  4M8N A;  4HXD A;  3B0A A;  4KIK A;  4W9I A;  4FUL A;  2DAJ A;  4ASW C;  3TL5 A;  4F7Z A;  3KUD B;  3U7D A;  5E6N A;  3ZTD A;  5G2N A;  4AP4 C;  5CHF A;  1WXA A;  4E74 A;  3PS6 A;  3B08 A;  1WI0 A;  4NJ6 A;  4EZK A;  4PYU A;  2MRP A;  4J6I A;  3UIP B;  3LJ3 A;  3DDC B;  4GDK B;  2MBQ A;  1P3Q U;  4K7U A;  4B95 A;  2KMC A;  3SHQ A;  1Q5W B;  2ZZP B;  4FJV B;  3L16 A;  4PYZ A;  2M17 A;  1WYW B;  3ZTC A;  5LXH A;  4ZRI A;  2BF8 B;  2K25 A;  3PRZ A;  3WA0 A;  2FUH B;  3ZW3 A;  2FID A;  3H1U A;  3R3M A;  3CF6 E;  3PSE B;  2BYV E;  2JZ3 B;  5D7G A;  2V4L A;  4ZRK A;  4FN2 A;  5KHO A;  3DBH I;  4K1R B;  2FCS A;  2KXJ A;  3QAQ A;  2JZZ A;  4GOC A;  3RT3 B;  1S3S G;  5JHB A;  3WAL A;  2IO0 B;  3ALB A;  4AJY B;  2XK5 B;  2KWC A;  2JRH A;  2MP2 A;  1OQY A;  3HIZ A;  2ZPY A;  2HE7 A;  2N4F A;  3VFK A;  2DZM A;  2KFK B;  4LCD E;  3PRE A;  3T8M A;  2KWU B;  1UBQ A;  1L7Y A;  2D07 B;  1TBE A;  2NPT B;  3A4S C;  5LLI A;  5J18 A;  4W9D A;  3KUC B;  5HKH A;  3EFU A;  1IPG A;  4W9G A;  2KTR A;  3QJZ A;  1D3Z A;  3QA8 A;  3TCA A;  3UIO B;  1I42 A;  3EC8 A;  3IVF A;  3UIN B;  4CO7 A;  4DHZ B;  2EMS A;  2DYM A;  4W9J A;  4GXB A;  1P0R A;  2CHZ A;  3K9P B;  4M0W B;  1RFA A;  4FLH A;  3ZRF A;  4PS3 A;  1UH6 A;  5E6O A;  3S2A A;  3V62 A;  4FJZ A;  2KD0 A;  4HDO A;  3ZNG C;  2KFK A;  2REX A;  4MDK E;  3ZUN A;  3IBE A;  3WAO A;  3I3T B;  1ISN A;  2MBE A;  2EMT A;  2KKC A;  1I35 A;  3M95 A;  2LGD A;  2K8B A;  2FIF A;  4FHK A;  2M4N A;  1AAR A;  2GBJ A;  4EUT A;  5C1Z A;  1OEY A;  3M3J A;  4FBJ B;  3A9J A;  4MEM A;  2G45 B;  2C7M B;  2J0M A;  4WJQ A;  3VH4 B;  1SE9 A;  1WE6 A;  1XQQ A;  4NQK E;  4EFO A;  1ZKH A;  2CKH B;  4NPN A;  2JF5 A;  4EEW A;  2IY1 B;  1BT0 A;  1TGZ B;  5CHW A;  4G0N B;  3B1L X;  1FXT B;  1ZGU B;  5CX3 A;  2L0F A;  1JRU A;  4BKS A;  2GBM A;  2KWV B;  3APD A;  2NR2 A;  2BKF A;  4IW0 A;  1KM7 A;  4ANW A;  1MG8 A;  3QX1 A;  4TQ0 A;  5IA7 A;  4IM2 A;  1WJ4 A;  4EKU A;  1WGR A;  3QHT A;  4W9L A;  2C5L C;  2G3Q B;  4HK2 A;  4LJP B;  2KX3 A;  4WJN A;  4BBN F;  3NY5 A;  2WDT B;  2AEH A;  5D2M B;  3ZDT A;  3U30 A;  4IM3 A;  4KIK B;  3L0W B;  2FCQ A;  2K1F A;  2BKR B;  3R66 C;  2O2V B;  2UYZ B;  2ZCC A;  2C60 A;  2N1W A;  4DDG D;  4E71 A;  3VAW A;  4BBN C;  4A3P A;  2A4Z A;  3DBS A;  4B6W A;  2KHW B;  4MJS B;  2L7R A;  3A9J B;  1E7U A;  4ICU A;  2NBV B;  3X0W A;  4FA6 A;  2NBW B;  3RZW C;  1H8C A;  3AU4 A;  3JW0 X;  2ZPN A;  2PE9 A;  1YQB A;  3K9O B;  1UEL A;  2FNJ B;  3WAP A;  2L76 A;  2ASQ A;  2N9P C;  2MCN B;  2PEA A;  1IYF A;  1WX7 A;  4NY0 A;  2ZEQ A;  4BVU C;  2BGF A;  4MGY E;  4HCN B;  3A33 B;  3QQ8 B;  2I1J A;  5FR6 A;  3VQI A;  3W1S C;  4JGH B;  2L05 A;  2BPS A;  4NJ7 A;  4KV2 A;  4GN1 A;  2O6V B;  1V9J A;  3HK0 A;  4MM3 A;  2L3Z A;  4KSK C;  3VDZ A;  4A3O A;  2K39 A;  5AEK B;  3VTW A;  4EZL A; 
#chains in the Genus database with same CATH topology
 4OHJ A;  1S1Q B;  4C7Z A;  3RNB C;  1YN5 A;  3PPA A;  3ABV B;  4RMA A;  4NAW A;  3ZNH B;  3MTN B;  3A9K A;  2IY0 B;  3DVG X;  2KQ7 A;  1DYQ A;  4HJK A;  1NBF C;  1G6J A;  3PRM B;  1FNW A;  3AE2 B;  4DXA B;  2OOB B;  4WWN A;  4PT5 A;  4DWF A;  1Y8R C;  4L1B A;  1QOF A;  3B2F A;  4M8M A;  4GU2 A;  1QQR A;  3SU8 X;  1Z5S B;  2GMI C;  4F8C B;  3ZVV A;  1WGG A;  2BYT A;  2ZCB A;  3VRA B;  1LGR A;  1N63 A;  2M0A A;  4IM0 A;  2VRR B;  2PLP A;  2G9H D;  1FD6 A;  3RYT A;  1YNT E;  2MBB B;  2LEK A;  1V1P A;  4OZB A;  2LRU A;  1RRB A;  2Z59 B;  3BYT B;  1WYG A;  4KDI C;  2PTL A;  2N1V A;  3Q3F A;  3AEB B;  3D32 A;  4LDT D;  2JRI B;  2RPQ A;  4DBG A;  3MC8 A;  1TS2 A;  1QKZ A;  1MG4 A;  3Q14 C;  4OVV A;  1WXS A;  3V3X A;  4MGK E;  3AE9 B;  2KDI A;  3V6E B;  4FAD A;  2DZI A;  2WXI A;  1DOI A;  3ZYY X;  1KLU D;  2D3A A;  3C0R B;  2BQQ A;  3N1Y C;  4X57 B;  1MPE A;  2IZV B;  1VZ8 A;  4MSQ B;  2GBR A;  2L00 B;  4YXD B;  2XK5 A;  3DWM A;  2XBB C;  4HPL B;  3AI5 A;  3GOE A;  3ZJV A;  1V81 A;  1C77 A;  2WWZ A;  3AN1 A;  1WR6 E;  4E3C A;  4YTP B;  3LDZ E;  1UWX A;  5JH5 C;  4KSL C;  2PJH A;  1E8Y A;  3R2I A;  2MEK A;  4XWW A;  3P1M A;  3NOB A;  2RDG A;  1L4D B;  1K8R B;  3UQA A;  1EF5 A;  1LM8 B;  2HJ8 A;  3X23 A;  3OLM D;  2W82 A;  1STE A;  1QZE A;  4DK5 A;  1N6Z A;  2AYO B;  5EE3 A;  3APC A;  5HFY A;  3JYU A;  4WWO A;  3DOW A;  4I6P A;  4W9F A;  2KAN A;  2PE6 B;  2KFJ A;  1E90 A;  3ECI A;  4TQ1 A;  1SIJ A;  1E7P B;  4KGT A;  3L54 A;  2XNA C;  5G55 A;  5DPR A;  1RLF A;  3IHP C;  2KAC A;  1SJH D;  3VHT C;  3UI3 A;  5D94 A;  3CST A;  3SR6 A;  4ICV A;  4ZYS A;  1V49 A;  2G4D B;  3A1Q A;  1VR9 A;  3AXC A;  5BO4 B;  1TT5 B;  1E9M A;  2MWS B;  4URK A;  1E5W A;  2BS2 B;  3TUO A;  4ZYN A;  3ZRC A;  2KZR A;  1L6U A;  3PZD A;  1WGY A;  5DPW A;  3RNF C;  1MFW A;  2L1A A;  3CWI A;  1TTN A;  3NZS A;  2OJR A;  1WX8 A;  2MJ3 A;  3L10 B;  3OJ3 A;  4XGA B;  2DNF A;  1VDV A;  3VUX A;  2KO3 A;  1A70 A;  1IUE A;  1QOG A;  3TBL D;  1C3T A;  2LMC A;  2WX1 A;  2ZNV C;  3KW5 B;  4R3D A;  4L23 A;  2Y5B B;  2LGS A;  2CU3 A;  2MBO A;  4OZC A;  2JYT A;  2M0X A;  1NDD A;  3NZ3 A;  2LGX A;  2KMA A;  4PS7 A;  3NG0 A;  3KYC D;  2YLM A;  3VR9 B;  4ANV A;  5C23 A;  5BYS A;  2I1K A;  4HRO A;  4ZRQ A;  1FRR A;  4K7W A;  1F1H A;  3LYY A;  3P4R B;  3ZGZ A;  3N1Z C;  2KJR A;  1E8Z A;  3AE4 B;  3PT2 B;  2WYQ A;  1VCB A;  1I4H A;  2MJD A;  1HTO A;  3RUL A;  3VXW A;  2J42 A;  4AQ7 A;  3SD5 A;  3VH3 B;  1SBB B;  4YTN B;  2K22 A;  3B0A A;  4W9I A;  2OED A;  2ONQ A;  3TL5 A;  3CIR B;  5G2N A;  2GLS A;  4E74 A;  3B08 A;  4NJ6 A;  2QMT A;  4J6I A;  3UIP B;  2K0P A;  1C76 A;  3RN9 C;  1Q5W B;  3DWG C;  4FJV B;  3W5U B;  3ZTC A;  2AX5 A;  1JWM D;  3PSE B;  2BYV E;  5KHO A;  2KYW A;  2FCS A;  4WH4 A;  3R8B A;  1LO5 D;  3C19 A;  3GE8 C;  4IKG A;  1CJE A;  1MHH E;  1N5X A;  2XK5 B;  2KWC A;  2ZPY A;  2N4F A;  2DZM A;  4B0E A;  1L7Y A;  2D07 B;  2IJ0 A;  3C8Y A;  2DLB A;  2WLB A;  2LUM A;  1ZDV A;  3DBL B;  3IVF A;  3UIN B;  3HRD D;  2IGH A;  4M0W B;  2W54 A;  4OVZ A;  4FLH A;  4PS3 A;  4FJZ A;  1V1O A;  1ROE A;  2KKC A;  1I35 A;  2K8B A;  2FIF A;  4FHK A;  1OEY A;  3M3J A;  4FBJ B;  1RYJ A;  4MEM A;  1T0Q C;  3VH4 B;  1WE6 A;  1XQQ A;  3R2T A;  1ZKH A;  2QIL A;  3GZN B;  4G0N B;  1ZGU B;  2GBM A;  2GI9 A;  2KWV B;  3IT6 B;  1L0V B;  1K50 A;  3TSS A;  5FK9 C;  2NR2 A;  2BKF A;  4IW0 A;  1KM7 A;  4ANW A;  4TQ0 A;  3ZJT A;  4LTU A;  1R4N B;  3BVM A;  3QHT A;  2C5L C;  4XWT A;  2W3S A;  3URY A;  2KX3 A;  4WJN A;  3ZDT A;  2VZK D;  4KIK B;  3AE8 B;  4A9A A;  2O2V B;  4A90 A;  2UYZ B;  4Q2J A;  4E71 A;  1NEK B;  4FXC A;  1PGX A;  4A3P A;  3DBS A;  2PKO A;  5FR3 A;  2L7R A;  3DHI C;  2VZK B;  2NBV B;  2RDH A;  1L0Y B;  1EM7 A;  1EWC A;  2NBW B;  3JW0 X;  1YQB A;  3WAP A;  2MCN B;  2MJE A;  1YJJ A;  1WX7 A;  3Q3O C;  1WSP A;  4JGH B;  3Q8F A;  2O6V B;  3HK0 A;  4MM3 A;  2L3Z A;  1J8C A;  4N58 A;  1ET6 A;  5AEK B;  1EU3 A;  2PVO D;  4NAW B;  3N9Y C;  2BWE S;  4MAC A;  5FKA C;  5I4D A;  1SXT A;  4HLE A;  4REZ A;  3UQB A;  2JUO A;  1HTQ A;  5D6J B;  3ZNI D;  3J9C A;  3PHW B;  5CHV C;  3HVZ A;  4IC7 B;  1P9D U;  2PVG C;  4MGZ E;  2JWZ A;  3AE1 B;  1Q10 A;  1XD3 B;  1UD7 A;  4LLG M;  3DBR B;  2QDF A;  2V1Y A;  2D10 A;  1R4N I;  4LNO A;  3RZF A;  2RPV A;  3PVL A;  3ZNZ B;  2DZJ A;  2KVR A;  1EUV B;  1WJU A;  3BZD B;  3ZIM A;  1UUP A;  1JRO A;  2NCN A;  2J52 A;  4K81 A;  3T9L A;  2QIE B;  2N7D A;  2IO3 B;  1C4C A;  1SIF A;  2ICI A;  2LZ6 A;  1VD2 A;  1P7E A;  4BKG A;  1T0Y A;  1E7V A;  3AEF B;  2LVQ A;  2AWT A;  1SE4 A;  4P1B C;  3HHM A;  2Y5P A;  3DVN U;  4EZJ A;  5HI1 A;  4W9E A;  2Z0D B;  3IT4 B;  3OJ4 B;  4LDT B;  4WUR A;  4HPM B;  3VVW B;  4TV3 A;  4JQW C;  1I4P A;  1TIF A;  3ZDM C;  4YL8 A;  1Q1O A;  2LWP A;  3FIL A;  1WF9 A;  3W1S A;  2Q5W D;  4BKT A;  1TJE A;  4MH0 E;  2LD9 A;  2WXR A;  1RWS A;  4C4V A;  2RMM A;  4WQM A;  4ARC A;  2MSE D;  3PZ7 A;  2LUE A;  4KZC A;  3QC8 B;  4NAM A;  3H8H A;  1MVK A;  2DAF A;  3NS8 A;  2QEJ C;  3AE6 B;  4YSY B;  1E10 A;  1T5X D;  4W9H A;  1H4R A;  4KDL B;  2RGF A;  1XLO A;  4K3B A;  2KJH B;  1IGD A;  1T0R C;  1WGK A;  1JWU D;  1AYF A;  4K7S A;  4US9 A;  4AUQ C;  2H89 B;  4A6Q A;  4F1S A;  4HKQ A;  1TZ1 A;  1YIW A;  3AEG B;  1WFY A;  4W9K A;  1UNS A;  4BKS D;  2JVC A;  3Q8B A;  3AU5 A;  2WXK A;  3Q3M C;  1ZXI A;  1PQS A;  1U4A A;  3A1Q B;  5L95 C;  3UGB B;  1FCL A;  1EO6 A;  1C1Y B;  1GC6 A;  3TIX A;  1X1M A;  4RFB A;  3FC4 A;  2KNB A;  2YEP F;  2C7N B;  2LHE A;  2WXJ A;  1ZDX A;  3BVZ A;  4OW0 A;  1YMH E;  4FHJ A;  3LXF A;  1UGM A;  2KTF A;  3V60 A;  1PUT A;  2LRW A;  1L0X B;  2ZW1 A;  4EOY A;  3FKY A;  4NQL B;  3MHZ A;  1QT9 A;  3KUZ A;  2J0K A;  3N3K B;  1V97 A;  1KRH A;  3IAM 1;  2E6X A;  4N6E B;  1AN8 A;  2I2Y A;  3RNG C;  3RI7 C;  2IO1 B;  2L0T A;  1V8C A;  3U4E G;  1E8W A;  1ZXH A;  1WJ6 A;  2MW5 A;  4ZOH C;  5D3D A;  3H7P A;  3OAW A;  1HZ6 A;  4C56 C;  1YX6 B;  4XC2 A;  1E0Z A;  2N9X A;  2W9N A;  2KQ4 X;  1UZX B;  1GUA B;  3PGE A;  4MGI E;  2WQY B;  2A5U A;  3MHS D;  3P4Q B;  1KLV A;  2ZNV B;  3R7Q A;  3ENE A;  4US8 A;  1DOY A;  1HQR D;  2WS3 B;  4AWJ A;  1WIA A;  2L83 A;  5TR5 A;  2WDR B;  2GRI A;  2KMM A;  3RNE C;  2FCM A;  5GMV A;  2QSD A;  2RDB C;  2RR9 A;  3NZU A;  3PLU A;  3Q3J A;  4JX1 C;  3DQV A;  1SEB D;  5TSS A;  4A20 A;  3BY4 B;  2BYF A;  3Q8A A;  2N9K A;  4CHK A;  1JAL A;  2GBK A;  1CZP A;  2LJ5 A;  2XEW A;  2FUG 1;  3QAR A;  5LXI B;  4BOS C;  1WZ3 A;  3GB1 A;  1WJN A;  2LGY A;  5JXV A;  3WAM A;  4WQO B;  1XLN A;  2G4S A;  2OJW A;  1YX5 B;  2WXM A;  1V5O A;  1I4X A;  4HXD A;  4XYC A;  1D5M C;  4F7Z A;  5E6N A;  4JE3 B;  2JYE A;  5C2T B;  4PYU A;  4UDU C;  2MBQ A;  4KKI A;  4B95 A;  3MFG A;  2B76 B;  5G5H A;  4YSX B;  1SB3 C;  1HEZ E;  2BVC A;  3BK1 A;  2FUH B;  1XF5 L;  2FID A;  3R3M A;  2JXT A;  3AEC B;  1SJE D;  2LGI A;  2V4L A;  5D7G A;  3DBH I;  3QAQ A;  4RGO S;  1OQR A;  2JZZ A;  1S3S G;  3AB5 A;  3WAL A;  4AJY B;  4EE2 A;  1OQY A;  2ACZ B;  4S17 A;  1L6V A;  2HE7 A;  1TS4 A;  2KAJ A;  1OFF A;  1ET9 A;  4JWS C;  4W9D A;  2WXQ A;  4HEA 1;  1D3Z A;  3QA8 A;  1I42 A;  1FRD A;  2M19 A;  2EMS A;  3W9C B;  2XN9 C;  2WHI A;  4P16 A;  2VH2 A;  1P0R A;  3K9P B;  4HDO A;  3ZNG C;  3ZUN A;  3IBE A;  3WAO A;  1ISN A;  4M02 A;  2G1E A;  2KDM A;  2M4N A;  4DQO C;  3A9J A;  2J0M A;  4B0M A;  2IND C;  2IGG A;  5IKC M;  2CKH B;  2V3N A;  2IY1 B;  5EE9 A;  1BT0 A;  5CHW A;  3MC0 B;  3B1L X;  5CX3 A;  1ZP0 B;  2L0F A;  1MG8 A;  1WGR A;  4W9L A;  2BW2 A;  4HK2 A;  2WDQ B;  4LJP B;  4YT0 B;  2E3T A;  2M56 B;  4BBN F;  2K9X A;  2PIA A;  1NVI D;  3NY5 A;  2WDT B;  5G5G A;  2QC8 A;  5D2M B;  3B2G A;  1CK1 A;  1TS5 A;  3U30 A;  2FCQ A;  1K52 A;  1YQ3 B;  1WXQ A;  2BS3 B;  2ZCC A;  2C60 A;  2N1W A;  2J4X A;  4B6W A;  4IOI E;  2IGD A;  2DBY A;  3AU4 A;  2ZPN A;  2WXL A;  2PEA A;  4N59 A;  4ACF A;  4ITK A;  3I63 C;  4NY0 A;  4BVU C;  4HCN B;  3QQ8 B;  2I1J A;  3VQI A;  2BPS A;  3RPF C;  1V9J A;  1C78 A;  3VTW A;  3HUI A;  4AOF A;  4GB9 A;  3H6N A;  1MHX A;  1GB4 A;  2NPT A;  1UWM A;  1BXT A;  1ZW7 A;  4S0R A;  2JPH A;  1J7A A;  2V3P A;  5BMI A;  1FCC C;  1WM2 A;  3Q8C A;  4JIO U;  2R2O A;  2K6D B;  1Z2M A;  3RD2 A;  2AQ1 B;  3DVG Y;  2C9W B;  1ZUD 2;  3BYY B;  1SGH A;  1P98 A;  3QIJ A;  2FCN A;  3H7P B;  2KDE B;  1MJD A;  3LB8 C;  3ZKJ C;  2JU6 X;  2LI5 A;  5E6P A;  2L8J A;  3NRZ A;  1YD8 U;  1PYW D;  1OGW A;  4LNK A;  2X38 A;  4LJO B;  4YWG G;  3BII D;  3TEW A;  2DZK A;  2JT4 B;  1ESF A;  2ZW0 A;  3IG3 A;  1D5X C;  3FIL B;  2KQS A;  1FIQ A;  1FM0 D;  3M62 B;  4GDL A;  4H2A A;  5E6J A;  5BYQ A;  5CTR C;  1QOB A;  3I5J C;  3PTF C;  2MQJ A;  3MJW A;  4OZA A;  2DYO A;  2WXN A;  4ZHO A;  4B9K A;  1C4A A;  1QLB B;  1N62 A;  3AV8 A;  4HDQ A;  2N9L A;  1GJZ A;  2LXC A;  3AH7 A;  3EEC A;  2VH1 A;  4IUM B;  2WU5 B;  4K3C A;  1NYR A;  4BAX A;  1WXV A;  1IP9 A;  4GMV A;  1JQ4 A;  3P63 A;  4GDL B;  1JWB D;  2QHO A;  2NTS A;  5L83 A;  4RM8 A;  2GB1 A;  2ZVO A;  1L2N A;  1FFV A;  1WRD B;  5MPO A;  3NVZ A;  4HCP B;  1Q0W B;  1UBI A;  4XZ4 A;  4PS8 A;  4I6N B;  3TJP A;  1F52 A;  1VRA B;  4G3X B;  1ENF A;  4A8X C;  2FAZ A;  3DCG A;  1V5T A;  2MP2 B;  2JXX A;  2JY6 A;  2K8C A;  2WNM A;  2PPH A;  1I4G A;  1EU4 A;  2R2Q A;  2D3G A;  5HHD G;  2RSU A;  4LK0 M;  1L5P A;  1DOX A;  3AE7 B;  3IFW B;  1FO4 A;  2INN E;  4ZDV A;  3ZJU A;  3KH0 A;  2BBC A;  3VTV A;  1IGC A;  3W1Y A;  2KC1 A;  2RD0 A;  1HZ5 A;  2O6V A;  3VTU A;  1JRP A;  1FMA D;  2BYE A;  3PRP B;  3PHX B;  1E6E B;  3UF8 A;  2KLG A;  4TKN A;  3Q8E A;  1WRI A;  3JVZ X;  4PK1 A;  2QJL A;  4NZL B;  3B9J A;  4MEL A;  4WJO A;  4DDI D;  3SFD B;  4YTM B;  2N9E B;  1JWS D;  2WGS A;  3ML8 A;  3ZXV A;  2HJ1 A;  3TMP B;  5BMG A;  3PLV A;  4RGN A;  3KLS X;  2NTT A;  3O65 B;  4KKJ A;  3QWZ B;  1F77 A;  1KOT A;  5DPT A;  1LFD A;  3M63 B;  1HXY D;  3H9D A;  3KQ4 A;  1V80 A;  1N60 A;  3L4P A;  2KDF B;  4HWI B;  2KJ6 A;  4BFR A;  4W9C A;  1HA5 A;  4USA A;  1D6E C;  2R61 A;  1OTR B;  5J2R A;  1B1Z A;  2AL3 A;  2KC2 A;  4RGM A;  2YVC A;  4YSZ B;  4BZA A;  1V86 A;  3R7R A;  1TS3 A;  1OQQ A;  2KLC A;  3AEA B;  4G50 A;  2NBU A;  1XT9 B;  5JZE B;  2YEP B;  4P1C C;  3ZO5 B;  3HM6 X;  3AE5 B;  2AL6 A;  2HTM E;  2IBI B;  1KJT A;  2WU2 B;  1XLQ A;  1YQ4 B;  4C00 A;  2WXP A;  1V6E A;  2K5P A;  4M0W A;  3GZN I;  2I38 A;  2SAK A;  2B3A A;  1TZO A;  3DVN V;  1UF0 A;  1V2Y A;  4D2K A;  4IG7 B;  2Z0E B;  2KOX A;  2EKE C;  4I6L B;  5IOI A;  2LVO A;  1WGH A;  4WAA A;  4RM9 A;  2D2Q A;  3NVY A;  4WWP A;  3P2B A;  5D3I B;  4MM3 B;  4DHJ B;  1M4V A;  5IN7 A;  2BB5 A;  1CMX B;  1WY8 A;  2D5G A;  2V0G A;  1KTK A;  1K53 A;  3NHE B;  1LXD A;  2KDB A;  3IXS A;  3KVF B;  1F2R I;  1N5W A;  1FNU A;  3WAN A;  1FNV A;  1MI0 A;  2N0S B;  3NVV A;  1GNU A;  2V4I B;  2C7H A;  1TYG B;  2O2V A;  2BS4 B;  4MSM B;  2INC C;  1XCQ L;  4M8N A;  4KIK A;  4FUL A;  2DAJ A;  3KUD B;  3U7D A;  2V9H A;  4AP4 C;  2HDE A;  5CHF A;  1WXA A;  4DXF A;  3PS6 A;  3GS2 A;  4EZK A;  2MRP A;  3DDC B;  4GDK B;  1P3Q U;  3NUH B;  2ZZP B;  4PYZ A;  2M17 A;  3ZXR A;  2BF8 B;  2K25 A;  4TSS A;  1YN4 A;  3ZW3 A;  2KT7 A;  1TY2 A;  4FN2 A;  2KXJ A;  3W5V B;  4GOC A;  1BML C;  3RT3 B;  1I4Q A;  5JHB A;  3P42 A;  3SEB A;  2JRH A;  2MP2 A;  4M00 A;  1PFD A;  1WWT A;  3VFK A;  2LFI A;  3PRE A;  2KWU B;  1UBQ A;  2H88 B;  3A4S C;  5J18 A;  4IDI A;  3KUC B;  1F2R C;  4W9G A;  3N20 C;  3UIO B;  4DHZ B;  2DYM A;  1KLG D;  3Q69 A;  3O13 A;  2BT6 A;  1RFA A;  3ZRF A;  3S2A A;  1UH6 A;  3V62 A;  1L4Z B;  2KFK A;  4MDK E;  4CQN A;  3I3T B;  5LNK 1;  2MBE A;  2EMT A;  2PMV A;  1XXG A;  3M95 A;  2LGD A;  4HRS A;  4KGS A;  2GBJ A;  1C79 A;  1JW9 D;  4EUT A;  3AE3 B;  5C1Z A;  3TEY A;  2CJO A;  1QF6 A;  1SE9 A;  1R4M B;  4NPN A;  4EEW A;  1TGZ B;  1IBX B;  1RM6 C;  4RCO A;  1FXT B;  1JRU A;  4BKS A;  4NJC A;  3APD A;  1VJK A;  3QX1 A;  3KWL A;  1WJ4 A;  2G3Q B;  4JWU C;  5HG2 A;  1PGA A;  3WCQ A;  4DDG D;  2A4Z A;  4C7Y A;  4HJG E;  1E7U A;  4ICU A;  1H8C A;  4LNI A;  3NS1 A;  2FNJ B;  2N9P C;  1IYF A;  3U2S C;  3DHH C;  1YJI A;  2ZEQ A;  2BGF A;  3EFC A;  1K51 A;  4GN1 A;  4KSK C;  1YOV B;  1GAQ B;  1TKG A;  3EA6 A;  3AMZ A;  1GG3 A;  4WJP A;  1FXA A;  2K8H A;  4A55 A;  1WGD A;  5EDS A;  4WWM A;  1FEH A;  3HM3 A;  4RNA A;  2CR5 A;  3EUB 2;  3I57 A;  2LXA A;  2KX0 A;  4KGR A;  2CHW A;  4DHZ E;  3RUI B;  2MBH A;  2WXH A;  2ZVN A;  1I7H A;  2SEB D;  3AUL A;  1NI2 A;  1ZOY B;  2V3S A;  5EE0 A;  5KHQ A;  2CS4 A;  2WXG A;  1N61 A;  2UWQ A;  4P7I A;  4C4V B;  1PGB A;  3A4R A;  2DWQ A;  1T3Q A;  2CHX A;  2LVP A;  3QCA A;  3RFZ B;  4JPS A;  3AM9 A;  1WMH B;  2DEN B;  2KN5 A;  2NVU I;  3P4S B;  1R4M I;  3PZ8 A;  3EGR A;  3Q6B A;  3DPD A;  4KX6 B;  1YN3 A;  2M8S A;  3JSV A;  3EHV A;  2ON8 A;  2NS5 A;  1P1A A;  1XCT L;  1ZE3 D;  1XLP A;  1V1P B;  3V61 A;  4O1N A;  1WX9 A;  1R7S A;  3L08 A;  3H7S A;  4IWQ A;  3ZQ4 A;  1YJ1 A;  1F0Z A;  3DBR I;  4M01 A;  1WE7 A;  1E8X A;  4KZ0 A;  4IWO A;  4XDC A;  1VZ6 A;  4MH8 A;  2IO2 B;  3QK0 A;  1FFU A;  2JWU A;  2DHZ A;  3VRB B;  4KVG B;  4II3 B;  2LHD A;  1UGJ A;  1A5R A;  1B9R A;  1HE8 A;  2DX5 B;  1WH3 A;  1D5Z C;  4NNJ B;  1TKY A;  5J17 A;  3SDL C;  2HD5 B;  1J0G A;  2ZJD A;  4TMA B;  2EEL A;  2MLB A;  5IP4 D;  1GC7 A;  4GSW A;  2J7Q B;  4II2 B;  3APF A;  3KWV A;  2WXO A;  1J19 A;  3RCZ A;  1M94 A;  2MX2 A;  3BIN A;  5EE1 A;  4DHJ D;  4XE0 A;  3U8Z A;  4WAF A;  3N30 A;  1J7C A;  5IAA C;  1FPY A;  3ONS A;  4ANX A;  4WIP A;  4CYE A;  4GDK A;  3DBH B;  1GOZ A;  1OEY J;  1CQV A;  1VLB A;  2GBN A;  2GOW A;  4N9F 4;  2BB6 A;  4BOZ B;  1KFY B;  1EF1 A;  3MP9 A;  1D4B A;  2WX0 A;  4ZRJ A;  1RAX A;  2Y5C A;  1WXM A;  2DYB A;  2N7J A;  4RF0 A;  1F9J A;  5H92 C;  2MHJ A;  2M1M A;  2W55 A;  1VZ7 A;  2JQR B;  2MA9 B;  4G11 A;  5JHA A;  1PDX A;  3WIM A;  1SE3 A;  3HVD A;  1GB1 A;  5BMH A;  1T6B X;  3OWE B;  3JSV B;  4JLC A;  4JL9 A;  3RMK C;  2TSS A;  5AZH A;  5DCN A;  4FJY A;  3TEZ A;  2K6Q A;  1WR1 A;  1NI3 A;  3KYD D;  3DHG C;  3BWU D;  4RF1 A;  1JWA D;  2HTH A;  3CMM B;  5DPS A;  3NVW A;  3ML9 A;  2O6V D;  3ETR A;  3T3N A;  3PO0 A;  4TUU A;  1WZ0 A;  2IYD B;  4GGQ A;  2MH7 A;  3ZLZ A;  2IPK D;  3DBL I;  3RNC C;  1P7F A;  3V6C B;  3L13 A;  1SF0 A;  3VUY A;  4ANU A;  4AJW A;  1LQB A;  2WDV B;  2J0J A;  1WM3 A;  2PW9 A;  2KK8 A;  4ZHP A;  2KTR B;  3RNA C;  3A9K B;  3I9V 1;  4QAY A;  1TY0 A;  2OHF A;  3FAH A;  4OVU A;  1XEE A;  3AEE B;  1Y56 A;  5AZG A;  3OG5 A;  4IWP A;  2LAS A;  2BTE A;  3W2D A;  3IAS 1;  5BYR A;  2UU7 A;  3T3O A;  3N32 A;  1KF6 B;  5AZF A;  2N7E A;  2L52 A;  3PV1 A;  1RFK A;  4HVB A;  2D11 A;  3CSF A;  1NYQ A;  2KN4 A;  4GIV A;  2D3C A;  4MJS A;  2CU1 A;  3L17 A;  2AQ3 B;  1WMH A;  4RH6 A;  1I4R A;  4XX5 A;  2LJI A;  1ZPS A;  3VUW A;  2BWF A;  3SFE B;  4L2Y A;  4ZRP A;  3TEX A;  3BK2 A;  2QCZ A;  1FXI A;  3ZTD A;  4RGT A;  1WI0 A;  1NEN B;  2INP E;  3LJ3 A;  1T0S C;  4K7U A;  2W3R A;  2KMC A;  3Q3N C;  3SHQ A;  3L16 A;  1WYW B;  5LXH A;  4ZRI A;  3PRZ A;  3WA0 A;  2JX5 A;  3H1U A;  3CF6 E;  2K3U A;  1AW7 A;  3GE3 C;  2JZ3 B;  4ZRK A;  1C4P A;  4K1R B;  1JCK B;  3MC9 A;  3E9S A;  5C3J B;  2L32 A;  1GPX A;  2IO0 B;  2FBW B;  3ALB A;  4ARI A;  3HIZ A;  4P6V F;  3E56 A;  4LCD E;  2IDY A;  2KFK B;  3T8M A;  4ASW C;  2NPT B;  5LLI A;  1TBE A;  1KH0 A;  2JZP A;  3EFU A;  5HKH A;  1IPG A;  2KTR A;  3QJZ A;  4LNF A;  1DGJ A;  3GP7 A;  3TCA A;  1QOA A;  3EC8 A;  4CO7 A;  4W9J A;  4GXB A;  2CHZ A;  2CJN A;  1TKE A;  5E6O A;  2AQ2 B;  3V05 A;  2WP9 B;  2KD0 A;  1SE2 A;  2REX A;  4LNN A;  1C9F A;  3AED B;  5IO9 A;  3BVG A;  5AUI A;  1AAR A;  2J53 A;  2D3B A;  3NJT A;  2G45 B;  5AUK A;  2C7M B;  4WJQ A;  4MT5 A;  4NQK E;  4EFO A;  2JF5 A;  1XO3 A;  2NMQ A;  4J3O D;  2EKI A;  3U52 E;  4HKZ E;  1EWY C;  1JML A;  4AS1 A;  5GXG B;  5IA7 A;  4IM2 A;  4EKU A;  2Y3A A;  2FE8 A;  1SSN A;  4GLS C;  2Z8L A;  2AEH A;  4IM3 A;  3L0W B;  2K1F A;  3Q2A C;  2BKR B;  3R66 C;  5H8Y E;  3N1X C;  4HPP A;  5T8I A;  4C80 A;  1IBX A;  3VAW A;  4BBN C;  4DXG A;  2KHW B;  4MJS B;  3A9J B;  3X0W A;  4FA6 A;  3RZW C;  1BUI C;  2PE9 A;  1J7B A;  3K9O B;  1UEL A;  4XDD A;  1AWD A;  3U7Z A;  2L76 A;  2ASQ A;  3VR8 B;  2KWD A;  1QIL A;  2WXF A;  4MGY E;  3A33 B;  2JSV X;  1ACC A;  5FR6 A;  3W1S C;  2L05 A;  3P4P B;  4NJ7 A;  4KV2 A;  2KVZ A;  2X8X X;  3VDZ A;  3MJ5 A;  4A3O A;  2K39 A;  4EZL A; 
#chains in the Genus database with same CATH homology
 4AOF A;  4NAW B;  4GB9 A;  3H6N A;  1S1Q B;  1GG3 A;  2BWE S;  2NPT A;  4WJP A;  1ZW7 A;  2JPH A;  3PPA A;  4RMA A;  4NAW A;  4HLE A;  3ZNH B;  3MTN B;  1WM2 A;  2K8H A;  3A9K A;  3UQB A;  2IY0 B;  2JUO A;  3DVG X;  4JIO U;  1WGD A;  5EDS A;  2KQ7 A;  3HM3 A;  2CR5 A;  2K6D B;  2R2O A;  4HJK A;  1NBF C;  1Z2M A;  5D6J B;  3RD2 A;  3ZNI D;  1G6J A;  2LXA A;  3DVG Y;  3PRM B;  3PHW B;  2KX0 A;  5CHV C;  2C9W B;  4IC7 B;  1P9D U;  4DXA B;  2CHW A;  4MGZ E;  2OOB B;  4WWN A;  4DHZ E;  1SGH A;  1P98 A;  3RUI B;  3QIJ A;  2MBH A;  2FCN A;  2ZVN A;  2JWZ A;  3H7P B;  2KDE B;  1XD3 B;  3AUL A;  1NI2 A;  1UD7 A;  2V3S A;  3ZKJ C;  2LI5 A;  5E6P A;  2L8J A;  5KHQ A;  2CS4 A;  4DWF A;  1Y8R C;  2V1Y A;  1YD8 U;  4GU2 A;  4M8M A;  4P7I A;  2D10 A;  1R4N I;  2UWQ A;  1OGW A;  3RZF A;  1Z5S B;  3SU8 X;  2GMI C;  4F8C B;  3ZVV A;  1WGG A;  3A4R A;  3PVL A;  2ZCB A;  3ZNZ B;  2CHX A;  2DZJ A;  4LJO B;  2DZK A;  2KVR A;  2LVP A;  1EUV B;  1WJU A;  4IM0 A;  3ZIM A;  2JT4 B;  2VRR B;  3QCA A;  3IG3 A;  2NCN A;  4K81 A;  2KQS A;  3M62 B;  4GDL A;  3T9L A;  1WMH B;  2IO3 B;  1SIF A;  2N7D A;  2LZ6 A;  3RYT A;  2DEN B;  5CTR C;  2KN5 A;  2NVU I;  1VD2 A;  1R4M I;  4BKG A;  2MBB B;  1T0Y A;  3PTF C;  1E7V A;  2MQJ A;  3MJW A;  2DYO A;  3DPD A;  2LVQ A;  4B9K A;  2LRU A;  2AWT A;  2M8S A;  1RRB A;  3JSV A;  3EHV A;  2Z59 B;  2NS5 A;  3HHM A;  3DVN U;  1P1A A;  4HDQ A;  4EZJ A;  4KDI C;  1GJZ A;  4W9E A;  2LXC A;  2Z0D B;  3OJ4 B;  4LDT B;  2N1V A;  3EEC A;  3Q3F A;  4IUM B;  3D32 A;  4HPM B;  3VVW B;  4LDT D;  3V61 A;  4TV3 A;  4JQW C;  1WX9 A;  2JRI B;  3ZDM C;  3L08 A;  2RPQ A;  3H7S A;  4IWQ A;  4YL8 A;  1WXV A;  1IP9 A;  1YJ1 A;  4GMV A;  4DBG A;  1Q1O A;  3DBR I;  4GDL B;  2LWP A;  1WF9 A;  1WE7 A;  1E8X A;  3W1S A;  4OVV A;  4BKT A;  2QHO A;  4KZ0 A;  1WXS A;  4MH0 E;  4IWO A;  4MGK E;  2LD9 A;  5L83 A;  2IO2 B;  3QK0 A;  2KDI A;  4RM8 A;  2ZVO A;  3V6E B;  4FAD A;  1L2N A;  2DHZ A;  2DZI A;  1WRD B;  2MSE D;  4KVG B;  2LUE A;  4II3 B;  4KZC A;  4HCP B;  3QC8 B;  1Q0W B;  1A5R A;  1HE8 A;  2DX5 B;  1UBI A;  4XZ4 A;  3C0R B;  2DAF A;  4PS8 A;  1WH3 A;  4I6N B;  4X57 B;  3TJP A;  4NNJ B;  2IZV B;  3NS8 A;  4G3X B;  5J17 A;  3SDL C;  1J8C A;  4MSQ B;  2HD5 B;  2FAZ A;  1H4R A;  2GBR A;  2L00 B;  3DCG A;  1V5T A;  2ZJD A;  4KDL B;  2MP2 B;  2RGF A;  4W9H A;  1J0G A;  2MLB A;  2JXX A;  2XK5 A;  2JY6 A;  1GC7 A;  2K8C A;  4GSW A;  2J7Q B;  2XBB C;  4HPL B;  2PPH A;  3AI5 A;  3GOE A;  2KJH B;  4II2 B;  2R2Q A;  3APF A;  2D3G A;  1V81 A;  2RSU A;  1J19 A;  3RCZ A;  1M94 A;  2MX2 A;  2WWZ A;  3BIN A;  1WR6 E;  4DHJ D;  3IFW B;  4K7S A;  4AUQ C;  4E3C A;  3LDZ E;  3U8Z A;  3N30 A;  4ZDV A;  5JH5 C;  3KH0 A;  4KSL C;  3VTV A;  4F1S A;  3W1Y A;  2KC1 A;  2RD0 A;  5IAA C;  2PJH A;  1TZ1 A;  1YIW A;  3ONS A;  1E8Y A;  1WFY A;  4W9K A;  2O6V A;  4ANX A;  3VTU A;  4BKS D;  2JVC A;  2BYE A;  3AU5 A;  3NOB A;  4GDK A;  4CYE A;  3PRP B;  3PHX B;  1PQS A;  1K8R B;  3UF8 A;  3UQA A;  1U4A A;  1OEY J;  2KLG A;  3A1Q B;  5L95 C;  1EF5 A;  1LM8 B;  2HJ8 A;  4TKN A;  3UGB B;  3X23 A;  1EO6 A;  1C1Y B;  1GC6 A;  3JVZ X;  2GBN A;  3TIX A;  1X1M A;  2GOW A;  3OLM D;  4N9F 4;  1QZE A;  4DK5 A;  4BOZ B;  2KNB A;  1EF1 A;  2AYO B;  3APC A;  4MEL A;  3JYU A;  2WX0 A;  4WJO A;  4WWO A;  4DDI D;  2C7N B;  4ZRJ A;  3DOW A;  4I6P A;  4W9F A;  1RAX A;  1WXM A;  2N9E B;  2DYB A;  2KAN A;  2PE6 B;  2KFJ A;  3ML8 A;  1E90 A;  3ECI A;  1F9J A;  3TMP B;  3PLV A;  4TQ1 A;  4FHJ A;  2M1M A;  3L54 A;  3O65 B;  2MA9 B;  4G11 A;  1UGM A;  5JHA A;  3WIM A;  2KTF A;  5G55 A;  5DPR A;  3V60 A;  1RLF A;  3IHP C;  3QWZ B;  2LRW A;  3VHT C;  5D94 A;  1KOT A;  3CST A;  3JSV B;  4JLC A;  4JL9 A;  5DPT A;  1LFD A;  3M63 B;  5AZH A;  3H9D A;  4ICV A;  5DCN A;  4FJY A;  1V49 A;  2G4D B;  3A1Q A;  4EOY A;  4NQL B;  1V80 A;  2KDF B;  2K6Q A;  3AXC A;  3KUZ A;  4HWI B;  2KJ6 A;  5BO4 B;  2J0K A;  3N3K B;  1WR1 A;  4BFR A;  4W9C A;  2MWS B;  4URK A;  3KYD D;  1E5W A;  1OTR B;  5J2R A;  4ZYN A;  2AL3 A;  3ZRC A;  2KC2 A;  2KZR A;  2YVC A;  3PZD A;  1WGY A;  2HTH A;  3CMM B;  5DPS A;  1V86 A;  2IO1 B;  3ML9 A;  2O6V D;  3R7R A;  5DPW A;  2L0T A;  1E8W A;  2KLC A;  1WJ6 A;  4TUU A;  1WZ0 A;  2IYD B;  4G50 A;  4GGQ A;  3ZLZ A;  2NBU A;  1TTN A;  1XT9 B;  3DBL I;  2MW5 A;  3V6C B;  5JZE B;  3NZS A;  2OJR A;  3L13 A;  3H7P A;  1WX8 A;  3L10 B;  3ZO5 B;  3HM6 X;  3OAW A;  2AL6 A;  3VUY A;  1YX6 B;  4XC2 A;  4ANU A;  2N9X A;  3OJ3 A;  2IBI B;  2W9N A;  1KJT A;  4AJW A;  3VUX A;  1UZX B;  1V6E A;  3GZN I;  2KO3 A;  1GUA B;  3PGE A;  4MGI E;  3MHS D;  2A5U A;  1KLV A;  1LQB A;  2B3A A;  2J0J A;  2ZNV B;  1WM3 A;  1V2Y A;  3DVN V;  3ENE A;  3R7Q A;  3TBL D;  2KK8 A;  4IG7 B;  2KTR B;  3A9K B;  1WIA A;  4AWJ A;  2Z0E B;  2KOX A;  1C3T A;  5TR5 A;  2EKE C;  4I6L B;  2WX1 A;  2ZNV C;  3KW5 B;  4OVU A;  2FCM A;  5GMV A;  2LVO A;  1WGH A;  2Y5B B;  4WAA A;  4RM9 A;  2D2Q A;  2RR9 A;  3NZU A;  4WWP A;  2MBO A;  3PLU A;  3P2B A;  2M0X A;  3Q3J A;  5AZG A;  3DQV A;  4DHJ B;  1NDD A;  2LGX A;  2KMA A;  4IWP A;  2LAS A;  4PS7 A;  1CMX B;  1WY8 A;  3KYC D;  4A20 A;  2YLM A;  3BY4 B;  2BYF A;  4ANV A;  3NHE B;  5C23 A;  2I1K A;  1LXD A;  4CHK A;  3N32 A;  5AZF A;  2KDB A;  4K7W A;  2N7E A;  3KVF B;  3PV1 A;  4HVB A;  2D11 A;  3WAN A;  2GBK A;  2KJR A;  2LJ5 A;  2XEW A;  3CSF A;  4GIV A;  1E8Z A;  4MJS A;  2CU1 A;  3L17 A;  3PT2 B;  2WYQ A;  1VCB A;  3QAR A;  5LXI B;  3RUL A;  3VXW A;  4BOS C;  1WZ3 A;  1WMH A;  1GNU A;  1WJN A;  2LGY A;  2C7H A;  4XX5 A;  2O2V A;  3SD5 A;  3WAM A;  4WQO B;  4MSM B;  2BWF A;  3VH3 B;  2G4S A;  3VUW A;  1YX5 B;  1V5O A;  4M8N A;  4HXD A;  3B0A A;  4KIK A;  4W9I A;  4FUL A;  2DAJ A;  4ASW C;  3TL5 A;  4F7Z A;  3KUD B;  3U7D A;  5E6N A;  3ZTD A;  5G2N A;  4AP4 C;  5CHF A;  1WXA A;  4E74 A;  3PS6 A;  3B08 A;  1WI0 A;  4NJ6 A;  4EZK A;  4PYU A;  2MRP A;  4J6I A;  3UIP B;  3LJ3 A;  3DDC B;  4GDK B;  2MBQ A;  1P3Q U;  4K7U A;  4B95 A;  2KMC A;  3SHQ A;  1Q5W B;  2ZZP B;  4FJV B;  3L16 A;  4PYZ A;  2M17 A;  1WYW B;  3ZTC A;  5LXH A;  4ZRI A;  2BF8 B;  2K25 A;  3PRZ A;  3WA0 A;  2FUH B;  3ZW3 A;  2FID A;  3H1U A;  3R3M A;  3CF6 E;  3PSE B;  2BYV E;  2JZ3 B;  5D7G A;  2V4L A;  4ZRK A;  4FN2 A;  5KHO A;  3DBH I;  4K1R B;  2FCS A;  2KXJ A;  3QAQ A;  2JZZ A;  4GOC A;  3RT3 B;  1S3S G;  5JHB A;  3WAL A;  2IO0 B;  3ALB A;  4AJY B;  2XK5 B;  2KWC A;  2JRH A;  2MP2 A;  1OQY A;  3HIZ A;  2ZPY A;  2HE7 A;  2N4F A;  3VFK A;  2DZM A;  2KFK B;  4LCD E;  3PRE A;  3T8M A;  2KWU B;  1UBQ A;  1L7Y A;  2D07 B;  1TBE A;  2NPT B;  3A4S C;  5LLI A;  5J18 A;  4W9D A;  3KUC B;  5HKH A;  3EFU A;  1IPG A;  4W9G A;  2KTR A;  3QJZ A;  1D3Z A;  3QA8 A;  3TCA A;  3UIO B;  1I42 A;  3EC8 A;  3IVF A;  3UIN B;  4CO7 A;  4DHZ B;  2EMS A;  2DYM A;  4W9J A;  4GXB A;  1P0R A;  2CHZ A;  3K9P B;  4M0W B;  1RFA A;  4FLH A;  3ZRF A;  4PS3 A;  1UH6 A;  5E6O A;  3S2A A;  3V62 A;  4FJZ A;  2KD0 A;  4HDO A;  3ZNG C;  2KFK A;  2REX A;  4MDK E;  3ZUN A;  3IBE A;  3WAO A;  3I3T B;  1ISN A;  2MBE A;  2EMT A;  2KKC A;  1I35 A;  3M95 A;  2LGD A;  2K8B A;  2FIF A;  4FHK A;  2M4N A;  1AAR A;  2GBJ A;  4EUT A;  5C1Z A;  1OEY A;  3M3J A;  4FBJ B;  3A9J A;  4MEM A;  2G45 B;  2C7M B;  2J0M A;  4WJQ A;  3VH4 B;  1SE9 A;  1WE6 A;  1XQQ A;  4NQK E;  4EFO A;  1ZKH A;  2CKH B;  4NPN A;  2JF5 A;  4EEW A;  2IY1 B;  1BT0 A;  1TGZ B;  5CHW A;  4G0N B;  3B1L X;  1FXT B;  1ZGU B;  5CX3 A;  2L0F A;  1JRU A;  4BKS A;  2GBM A;  2KWV B;  3APD A;  2NR2 A;  2BKF A;  4IW0 A;  1KM7 A;  4ANW A;  1MG8 A;  3QX1 A;  4TQ0 A;  5IA7 A;  4IM2 A;  1WJ4 A;  4EKU A;  1WGR A;  3QHT A;  4W9L A;  2C5L C;  2G3Q B;  4HK2 A;  4LJP B;  2KX3 A;  4WJN A;  4BBN F;  3NY5 A;  2WDT B;  2AEH A;  5D2M B;  3ZDT A;  3U30 A;  4IM3 A;  4KIK B;  3L0W B;  2FCQ A;  2K1F A;  2BKR B;  3R66 C;  2O2V B;  2UYZ B;  2ZCC A;  2C60 A;  2N1W A;  4DDG D;  4E71 A;  3VAW A;  4BBN C;  4A3P A;  2A4Z A;  3DBS A;  4B6W A;  2KHW B;  4MJS B;  2L7R A;  3A9J B;  1E7U A;  4ICU A;  2NBV B;  3X0W A;  4FA6 A;  2NBW B;  3RZW C;  1H8C A;  3AU4 A;  3JW0 X;  2ZPN A;  2PE9 A;  1YQB A;  3K9O B;  1UEL A;  2FNJ B;  3WAP A;  2L76 A;  2ASQ A;  2N9P C;  2MCN B;  2PEA A;  1IYF A;  1WX7 A;  4NY0 A;  2ZEQ A;  4BVU C;  2BGF A;  4MGY E;  4HCN B;  3A33 B;  3QQ8 B;  2I1J A;  5FR6 A;  3VQI A;  3W1S C;  4JGH B;  2L05 A;  2BPS A;  4NJ7 A;  4KV2 A;  4GN1 A;  2O6V B;  1V9J A;  3HK0 A;  4MM3 A;  2L3Z A;  4KSK C;  3VDZ A;  4A3O A;  2K39 A;  5AEK B;  3VTW A;  4EZL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...