4ZDVA

Crystal structure of lc3 in complex with fam134b lir
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
126
structure length
126
Chain Sequence
DDFELLDGPSDRPFKQRRSFADRCKEVQQIRDQHPSKIPVIIERYKGEKQLPVLDKTKFLVPDHVNMSELVKIIRRRLQLNPTQAFFLLVNQHSMVSVSTPIADIYEQEKDEDGFLYMVYASQETF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Microtubule-associated proteins 1A/1B light chain 3A
publication title Regulation of endoplasmic reticulum turnover by selective autophagy.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein transport
total genus 35
structure length 126
sequence length 126
ec nomenclature
pdb deposition date 2015-04-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02991 Atg8 Autophagy protein Atg8 ubiquitin like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 4zdvA00
4E71A 3EFUA 2V3SA 1E8WA 2KX0A 4GXBA 4JLCA 3PSEB 1J19A 1OEYJ 3CSFA 1NI2A 3KUZA 4MJSA 4CHKA 4MM3A 1XD3B 2M8SA 4MDKE 4EOYA 3TIXA 2O6VD 2CHZA 1WRDB 4HWIB 1WY8A 3V6EB 4W9LA 2J7QB 2MP2B 2NBWB 4BOZB 3DBRI 2HE7A 4W9GA 4I6LB 2DENB 2JY6A 2WX0A 4ZRJA 5DPWA 5JH5C 1MG8A 2KTFA 4HXDA 4K81A 2AWTA 5AZHA 1IYFA 4XC2A 3ECIA 1Q5WB 3A9JB 4PS7A 3U8ZA 2R2QA 2DYOA 3PGEA 1WGGA 3SDLC 3IG3A 2L8JA 3H1UA 2RGFA 3IFWB 3QC8B 4W9IA 4N9F4 2C9WB 1WR6E 2GBMA 4ANWA 4IWQA 2Z0DB 2MA9B 5D6JB 2Z0EB 3ZW3A 4BKSA 4FA6A 1K8RB 1V49A 4J6IA 2EKEC 4IG7B 2RR9A 2K6DB 3WAPA 4EZLA 4W9FA 5LXHA 3PLUA 1M94A 4DDID 1P0RA 3MHSD 4IWOA 5IA7A 2NR2A 4EKUA 5DPSA 2BYVE 3ZUNA 5FR6A 1EF5A 5LXIB 2KLGA 3N32A 3JSVA 4EUTA 1GNUA 2JT4B 4NY0A 3A1QA 5LLIA 2MBHA 1S1QB 1NBFC 2G45B 3ZO5B 4IM2A 4GIVA 1Y8RC 3RT3B 2M4NA 3Q3FA 4PYZA 4W9EA 3UINB 3TMPB 3EC8A 4KDIC 4B6WA 4G11A 2KN5A 3BINA 4DWFA 5EDSA 2LRUA 3B08A 3VQIA 3WALA 2RSUA 4A3OA 4HCNB 2L00B 3AXCA 3DVNV 1TZ1A 4ANVA 3NY5A 2KTRA 2NCNA 2BKRB 3M63B 2AYOB 2BF8B 4AJWA 2UWQA 2ZEQA 2ZVNA 2FCNA 3KUCB 2MBEA 3ONSA 3PPAA 4FN2A 3SU8X 3Q3JA 2IO0B 5E6OA 1YD8U 2CR5A 4HDQA 1E8ZA 1RFAA 3V60A 4XZ4A 3QHTA 4WWOA 3VTWA 2KNBA 5IAAC 2L0FA 3R7RA 2Z59B 3ENEA 2M1MA 4IUMB 2KLCA 2ZNVB 4BFRA 1Q1OA 4FULA 4TV3A 3R7QA 3KVFB 1A5RA 3RZWC 3A9KB 1WH3A 2MRPA 2C60A 1FXTB 3D32A 4DHZE 2M0XA 3PRZA 4DK5A 3ZRFA 2N4FA 4XX5A 4GOCA 3UQAA 4URKA 4EFOA 3RCZA 1EO6A 2K1FA 2C7MB 1SGHA 5BO4B 3WA0A 5CTRC 2DYBA 1WF9A 4WWPA 2JPHA 2JZ3B 1XQQA 3EHVA 2XEWA 2FCQA 2IBIB 2FCSA 3VUYA 5J17A 2XK5A 3APCA 2XBBC 3ALBA 2KDIA 3PREA 5CHWA 2DZIA 3TJPA 3NHEB 2W9NA 1WMHA 3APFA 3DBLI 4PYUA 3RULA 5JHBA 5JZEB 3AU4A 4RMAA 3VUXA 2K8HA 1XT9B 1WGHA 2C7HA 1OTRB 4LCDE 3I3TB 2IYDB 2O6VB 2J0KA 4GDKB 2OOBB 2PPHA 1L7YA 1V5TA 2I1JA 2NPTB 3LDZE 2IO2B 3M62B 4KVGB 1VCBA 3ZDTA 4BKGA 4I6NB 2FUHB 1V81A 4JL9A 2KWCA 2HTHA 3AULA 3PT2B 2K8BA 1I42A 3APDA 2LGYA 3NZUA 2LWPA 1V2YA 2JRHA 1E7VA 4GU2A 1R4NI 1KLVA 3KYCD 1OGWA 1V9JA 4K7SA 3OLMD 3OAWA 4IC7B 4LJOB 2PJHA 2KFKB 4WJOA 4PS3A 2BWFA 2WYQA 1CMXB 4F7ZA 4GB9A 1P3QU 4LDTB 3N3KB 3GZNI 1YIWA 3H7PB 4KSKC 3W1SA 3RZFA 3IBEA 2GBNA 1Z2MA 1LXDA 3ZDMC 5D2MB 4AUQC 3NS8A 2A5UA 2D10A 3TCAA 4ZRKA 3JYUA 4BOSC 2PE9A 3T9LA 1GUAB 2JUOA 3L08A 3K9OB 3WANA 2NBUA 3K9PB 3IVFA 1H4RA 3DBHI 2OJRA 2QHOA 2KWVB 3VFKA 4OVUA 1T0YA 2EMTA 4X57B 1UBQA 2FCMA 1H8CA 1E7UA 2AL6A 2MP2A 2LXAA 1Q0WB 4B9KA 4ASWC 3AI5A 5CHVC 4NJ7A 1WX8A 1ZW7A 3B0AA 4FJYA 3A33B 1KJTA 1TTNA 2KD0A 4II3B 4W9HA 3A9JA 4AJYB 2G4DB 1TGZB 4M8NA 2DZKA 2IO1B 4DDGD 4K7WA 4DXAB 4EZKA 2ZCCA 3TL5A 3VH3B 2JWZA 1WIAA 4MGKE 2JVCA 2KVRA 3IHPC 3JSVB 4KIKB 3PRPB 2ZPYA 3RUIB 2I1KA 1YJ1A 2B3AA 1UELA 2RD0A 3ML8A 3SD5A 3OJ3A 1BT0A 2KO3A 2MSED 3QWZB 1WJ4A 5DCNA 3PV1A 3VTUA 4BKSD 1WX9A 1RAXA 2YLMA 4FHKA 5E6PA 2L76A 2C7NB 2N1VA 1L2NA 3DPDA 1WZ0A 2N1WA 3VTVA 3L0WB 4A3PA 1ISNA 1AARA 1YQBA 3QARA 3ZRCA 4JGHB 2ZPNA 4A20A 3X23A 1J0GA 2J0JA 3DQVA 4GSWA 3A4SC 4WAAA 4KZCA 4W9DA 4HPMB 5HKHA 4E74A 2WWZA 3UGBB 5G2NA 3DOWA 2A4ZA 5C23A 2LGDA 3UIOB 4G3XB 2KDFB 4MSMB 2KJRA 3L16A 2JXXA 1V5OA 1LM8B 4WJPA 3ZTDA 3ZIMA 1TBEA 4NNJB 4DHJD 1OEYA 3CMMB 4F1SA 1ZGUB 2V1YA 1ZKHA 1WZ3A 3ZVVA 1E90A 1WGDA 5DPRA 3A4RA 1UH6A 4JQWC 2KDEB 2D11A 4ZRIA 3ZNHB 3P2BA 3N30A 2K25A 2KMAA 3M95A 1WXVA 2O2VB 4NJ6A 3AU5A 4F8CB 4NQKE 4MGZE 3LJ3A 4MELA 2GBJA 2LUEA 2KKCA 2KANA 1WXAA 2LXCA 1E5WA 3A9KA 4MH0E 2N9PC 2XK5B 3VXWA 2CHXA 3GOEA 1PQSA 3QCAA 3V61A 4W9JA 3O65B 1WMHB 4IW0A 4IWPA 4CYEA 4WJNA 3WIMA 3OJ4B 3VAWA 1YX6B 4M0WB 4BKTA 3HM3A 5KHQA 3QIJA 4B95A 3KW5B 2LVPA 1D3ZA 2WDTB 2ZZPB 2MBOA 3HIZA 4M8MA 4GDLB 2MCNB 2LD9A 3KYDD 5CHFA 3DCGA 2CHWA 3ML9A 1OQYA 5C1ZA 2DHZA 3QA8A 1V80A 2KWUB 2DZMA 3R66C 4NAWB 2MLBA 4DHZB 1WGRA 3RD2A 4ZYNA 1WGYA 2R2OA 5L95C 1GC7A 5J18A 3PVLA 2GOWA 1P1AA 3S2AA 3WAMA 4ICVA 3QK0A 4E3CA 2D2QA 2K6QA 4TQ1A 4PS8A 2J0MA 4YL8A 2LZ6A 2O6VA 4GDKA 3X0WA 4KZ0A 2KFJA 3W1SC 4MJSB 3U30A 1WJUA 5JHAA 1WM2A 2KDBA 2BYFA 2PEAA 4FADA 1WJNA 3PTFC 1C3TA 4OVVA 3SHQA 4W9KA 4EEWA 5J2RA 5KHOA 1WFYA 2KQSA 2REXA 3L17A 3HHMA 4P7IA 1IP9A 4AWJA 1LFDA 4HDOA 2AEHA 2BWES 2KFKA 4TUUA 1R4MI 2D3GA 4LJPB 2LI5A 2FAZA 2LVOA 4I6PA 3PRMB 3U7DA 2L05A 1Z5SB 3L10B 2IO3B 1GJZA 4G50A 3H7PA 4MGYE 2KOXA 4NPNA 5AEKB 5AZFA 1WM3A 1F9JA 4FJVB 2BKFA 2FIDA 1UGMA 2KJ6A 3ZNGC 3V6CB 2MQJA 3QX1A 4HK2A 3PHWB 3HM6X 1VD2A 1S3SG 1WJ6A 4K7UA 3T8MA 1E8YA 3R3MA 4BBNC 2EMSA 2G3QB 2FNJB 3PHXB 3QJZA 1IPGA 1P9DU 4IM3A 4HCPB 4HPLB 1KM7A 5CX3A 1RRBA 2KXJA 4GN1A 3C0RB 1SE9A 4LDTD 3A1QB 5AZGA 3PS6A 3KH0A 4WQOB 3DVGY 2MX2A 2PE6B 2GMIC 2K8CA 3ZKJC 4II2B 1G6JA 2K39A 2ASQA 1RLFA 2D07B 4W9CA 4GGQA 1C1YB 4ZDVA 3NOBA 5E6NA 3PLVA 1KOTA 4HLEA 3M3JA 2RPQA 5G55A 4DHJB 2BGFA 4KIKA 3W1YA 3JW0X 2KTRB 1GG3A 1WXSA 2KQ7A 1WR1A 3CSTA 3B1LX 2BYEA 2M17A 4KSLC 3VHTC 4G0NB 2WX1A 3UF8A 4KDLB 4WJQA 1WE6A 3VUWA 3TBLD 3VVWB 2DAFA 2NS5A 1QZEA 2ZJDA 2MWSB 2N7DA 5GMVA 2IY0B 3DBSA 2VRRB 4TKNA 3UIPB 1WYWB 3DVGX 4GMVA 3DVNU 2JF5A 3MTNB 1YX5B 1V6EA 2IY1B 3H7SA 3ZLZA 3RYTA 1J8CA 2C5LC 3EECA 5D94A 2CKHB 3ZNZB 2MBQA 2G4SA 1V86A 2LVQA 2YVCA 2KHWB 2KK8A 5TR5A 2MBBB 2DZJA 2DYMA 2IZVB 1EUVB 1SIFA 2ZNVC 3VH4B 5DPTA 5L83A 2UYZB 3NZSA 4BBNF 2JRIB 4RM9A 2NVUI 1U4AA 2CU1A 4BVUC 3ZTCA 2FIFA 1WE7A 2V4LA 1WXMA 4JIOU 1WI0A 2DX5B 2MW5A 2LGXA 1X1MA 2GBKA 2HJ8A 2L3ZA 4FHJA 2KZRA 2N9EB 3QAQA 4NQLB 3ZNID 2L0TA 2N7EA 4FJZA 3V62A 1GC6A 2DAJA 1UD7A 2O2VA 1UZXB 2KC1A 4K1RB 3JVZX 4IM0A 4FLHA 2LASA 2LRWA 4HJKA 3VDZA 3CF6E 4MGIE 4ANUA 2AL3A 4EZJA 2GBRA 1E8XA 3L54A 4FBJB 4CO7A 2NBVB 1WX7A 2L7RA 2Y5BB 2HD5B 3MJWA 3H6NA 3HK0A 3PZDA 3QQ8B 2BPSA 2ZCBA 4MEMA 4ANXA 1P98A 2CS4A 2KJHB 4GDLA 4AP4C 4DBGA 1NDDA 2KC2A 2LJ5A 4TQ0A 1EF1A 2NPTA 2JZZA 3WAOA 4AOFA 4NAWA 4HVBA 3KUDB 4MSQB 3H9DA 3L13A 1LQBA 1UBIA 4ICUA 2N9XA 2KMCA 1HE8A 4RM8A 5D7GA 3UQBA 4KV2A 2KX3A 2ZVOA 3BY4B 1I35A 4WWNA 1JRUA 3DDCB
chains in the Genus database with same CATH superfamily
3EFUA 1JCKB 1E8WA 3PSEB 1J19A 1HZ6A 1NI2A 1FRRA 3P4PB 1XD3B 3GZNB 2CHZA 5T8IA 1WRDB 3Q3OC 4W9LA 3DBRI 2KMMA 2JY6A 1L0VB 2CJNA 2KTFA 4K81A 2FUG1 3U8ZA 2R2QA 2DYOA 1WGGA 2L8JA 4D2KA 1WR6E 2GBMA 4ANWA 4ZYSA 3GE8C 3NRZA 3ZW3A 1K8RB 1N61A 1V49A 1XCQL 1I4GA 4Q2JA 4EKUA 3Q2AC 2BYVE 3ZUNA 3GS2A 2JYTA 2W55A 3JSVA 4EUTA 4WWMA 5LLIA 5HFYA 3NS1A 3Q3FA 1OQQA 3EC8A 1J7AA 4B6WA 5BYSA 1XXGA 1YQ4B 5EDSA 2RSUA 1E7PB 1AYFA 2E3TA 4HCNB 4L23A 5H92C 3DVNV 3MJ5A 2BF8B 3PPAA 3ONSA 2J53A 5E6OA 3GB1A 1T0RC 4HDQA 3QHTA 3VTWA 2SEBD 3TEZA 2ZW1A 4TMAB 2KLCA 4JX1C 4BFRA 1Q1OA 4FULA 3A9KB 2MRPA 4DHZE 3PRZA 3DHHC 3VRAB 3RCZA 2K1FA 2C7MB 3BK2A 1WF9A 2JPHA 2WXKA 3VR9B 2FCSA 3VUYA 3APCA 2XBBC 3ALBA 2KDIA 5CHWA 3TJPA 3OG5A 2W9NA 3U4EG 1XT9B 4LCDE 2MH7A 3P4RB 3R2TA 1MI0A 3FC4A 2IYDB 4P16A 2K3UA 4BAXA 1L7YA 2I1JA 2KN4A 4KVGB 3M62B 4I6NB 1I42A 2IGDA 3APDA 1V2YA 3NJTA 4LTUA 5EE9A 1OGWA 1V9JA 4K7SA 3OAWA 3AEFB 2KFKB 1MG4A 1TS5A 3GZNI 3H7PB 3W1SA 1PGXA 4OW0A 2J52A 2W54A 4N6EB 1LXDA 4C4VA 3LXFA 1KLUD 4ZRKA 4OZCA 1IBXA 2PE9A 3L08A 3K9OB 2NBUA 1MFWA 1H4RA 4XYCA 5HG2A 3VFKA 1UBQA 1H8CA 1VRAB 2MP2A 1EWCA 1ZW7A 3B0AA 1TTNA 1TGZB 3Q69A 2BW2A 2IO1B 2LGSA 1N62A 3AE4B 4K7WA 4EZKA 2W82A 3PZ8A 1HQRD 1TS3A 4MGKE 1FPYA 2TSSA 3RUIB 1KF6B 1YJ1A 3SD5A 1QT9A 1WJ4A 3TEWA 2CJOA 5E6PA 3LYYA 2HJ1A 1L4DB 3TSSA 1L2NA 2N1WA 2X8XX 3L0WB 1AARA 1YQBA 3Q8CA 3QARA 3RNBC 3BZDB 4A20A 1KFYB 1PDXA 3DQVA 3MC0B 4ITKA 4WAAA 4E74A 5G5GA 1Y56A 4JPSA 5C23A 1C9FA 2KDFB 4MSMB 1TJEA 2JXXA 5IO9A 4WJPA 1TBEA 1OEYA 2WP9B 3BWUD 1ZKHA 1WZ3A 2JSVX 3ZVVA 1FMAD 3AEEB 3C19A 2BQQA 1HA5A 3LJ3A 3U7ZA 3AMZA 1JALA 1WXAA 2WXHA 4MH0E 2L1AA 3QCAA 5AUKA 3V61A 3RNFC 4W9JA 3EA6A 3O65B 1MVKA 5KHQA 4M0WB 3HM3A 4B95A 4RCOA 1D3ZA 2RMMA 2ZZPB 3ZJVA 2D3BA 4JWUC 2LD9A 1ZDVA 3LB8C 1OQYA 1YQ3B 1TY0A 1UUPA 2R2OA 3IAM1 3ETRA 2WXJA 4XDCA 2VH2A 2QEJC 1FNVA 3S2AA 3P42A 1SF0A 5JHAA 4K3CA 2PEAA 4A9AA 1C3TA 2D3CA 5KHOA 3L17A 4M00A 1P7EA 4P7IA 2JU6X 1STEA 5E6JA 3L10B 2KOXA 1FO4A 3W5VB 2FIDA 3MP9A 3W9CB 3Q8EA 2MQJA 1VD2A 2IPKD 3T8MA 1B9RA 1V1OA 2FNJB 2WGSA 3B9JA 1FNUA 1ESFA 1SE9A 5AZGA 4WQOB 3DVGY 2MX2A 2K8CA 4II2B 4AS1A 1G6JA 2WHIA 4GGQA 2BTEA 5E6NA 1DOXA 3PLVA 2RPQA 5G55A 4C00A 3RNCC 3JW0X 2KTRB 3NZ3A 3MFGA 2KQ7A 2M17A 4KSLC 1VDVA 1QILA 3RN9C 3UF8A 1WE6A 1FFVA 2V9HA 1ZOYB 3TBLD 4LK0M 2DAFA 2BS2B 4ZOHC 2ZJDA 4P1BC 5GMVA 3DBSA 2VRRB 1BXTA 1YX5B 1V6EA 2IY1B 2JWUA 3H7SA 3RYTA 3EECA 2NTTA 4US8A 1ET6A 2DYMA 2ONQA 2ZNVC 4ZRQA 5L83A 3NZSA 5HI1A 2NVUI 2PKOA 5BMGA 2MW5A 3GP7A 1X1MA 2HJ8A 2QDFA 2KZRA 2N9EB 3QAQA 4NQLB 3ZNID 1FD6A 1KTKA 3V62A 1GC6A 1UZXB 2K22A 2L52A 2IGHA 4MGIE 3W5UB 4ANUA 4EZJA 4RFBA 1QF6A 2WS3B 4FBJB 2NBVB 1WX7A 2L7RA 3MJWA 2ZCBA 3HVDA 4RGMA 1P98A 5BMIA 2Y3AA 2KJHB 4GDLA 4DBGA 4XWTA 1ENFA 3AE5B 1HXYD 3AECB 4AOFA 1SXTA 4NAWA 4O1NA 1L5PA 4MSQB 1UBIA 4ICUA 2N9XA 5D7GA 2ZVOA 3BY4B 1JRUA 3DDCB 4GXBA 4JLCA 1OEYJ 1K52A 3Q14C 3KUZA 4MJSA 4MDKE 2AX5A 1VLBA 1I4RA 4HWIB 3AEGB 4I6LB 2DENB 2WX0A 4ZRJA 1MG8A 4HXDA 4IKGA 2AWTA 3A9JB 3PGEA 3SDLC 3IG3A 3IFWB 3QC8B 3DBHB 1K50A 3IXSA 2MHJA 2RDBC 5IKCM 2EKEC 2RR9A 3BVZA 4EZLA 3PLUA 4DDID 1P0RA 3RNAC 4IWOA 1E10A 4A6QA 5C3JB 4RH6A 2KACA 2KLGA 2WDVB 1GNUA 2JT4B 1FCCC 1NBFC 4IM2A 4A55A 2M4NA 3IT4B 3UINB 3IAS1 4KDIC 1I7HA 4G11A 3BINA 2LRUA 3B08A 3VQIA 3WALA 4ANVA 1JMLA 2NCNA 2BKRB 2UWQA 4A90A 2ZVNA 2FCNA 3KUCB 4FN2A 3Q3JA 1YD8U 4EE2A 3V60A 2J4XA 1L0YB 5IAAC 1C4CA 3ENEA 4L1BA 4C56C 4BZAA 2ZNVB 1JWSD 1WWTA 4TV3A 1FXAA 3KVFB 3U2SC 1A5RA 2C60A 2M0XA 2N4FA 4XX5A 3OWEB 4GOCA 4JE3B 3BIID 3UQAA 1ET9A 4YTMB 1WYGA 3MHZA 2WXRA 1C4PA 2DLBA 2JZ3B 3CIRB 3I5JC 3EHVA 2XEWA 2Q5WD 2XK5A 1TS4A 4ZHPA 1WMHA 4PYUA 5JZEB 4RMAA 2D5GA 1FM0D 1WGHA 2C7HA 1R7SA 3AEDB 4TSSA 1MHXA 2KDMA 4M01A 3I3TB 2J0KA 4XDDA 1CK1A 1V5TA 4BKGA 3SR6A 2HTHA 3PT2B 2LWPA 4WAFA 4GU2A 1C76A 1UWMA 3OLMD 4IC7B 4LJOB 4WJOA 4PS3A 2DBYA 2BWFA 2WYQA 3SFDB 1P3QU 3AE2B 4KSKC 2E6XA 1Z2MA 2HTME 3TCAA 1D5XC 3K9PB 3DBHI 2M19A 2QHOA 3P4SB 4C80A 2AL6A 4HEA1 4ASWC 3AI5A 4ZHOA 3A33B 2MJEA 3W2DA 1M4VA 1KJTA 1FEHA 5MPOA 4AJYB 2G4DB 1JROA 2ZCCA 3TL5A 3I57A 2JWZA 2KVRA 4KIKB 2FE8A 3JSVB 5TSSA 2LEKA 2B3AA 1UELA 1KRHA 3ML8A 3OJ3A 2MSED 3PV1A 3E56A 1WX9A 4FHKA 2N1VA 1WZ0A 1VR9A 4A3PA 3KQ4A 4M02A 2DNFA 3KWLA 1JWMD 4WIPA 4W9DA 4HPMB 2WWZA 3RI7C 2RDGA 1YJJA 3UGBB 5G2NA 3DOWA 2D3AA 1SB3C 3IT6B 3HRDD 1V5OA 3ZTDA 3CMMB 1ZGUB 1WGDA 5DPRA 3A4RA 1UH6A 4MT5A 2D11A 4ZRIA 3P2BA 2KMAA 3M95A 1WXVA 2O2VB 2IGGA 4F8CB 2WXPA 4LNNA 4B0MA 2GBJA 2LUEA 2WQYB 1E5WA 3A9KA 2N9PC 1YN5A 3GOEA 2PIAA 1Q10A 1XLOA 1QLBB 2BYTA 4CYEA 1QKZA 4BKTA 3VAWA 1NVID 3QIJA 2GI9A 2LVPA 1SE4A 2INNE 2MCNB 3KYDD 5CHFA 3DCGA 3ML9A 2KWUB 2DZMA 2INPE 2V3PA 3RD2A 2BT6A 1WGYA 4KGTA 2LHEA 1NYRA 3FKYA 5L95C 1GC7A 5I4DA 5J18A 3EGRA 4ICVA 3AM9A 2D2QA 1FIQA 2K6QA 2J0MA 4RGOS 2LZ6A 4ARIA 4KZ0A 2IJ0A 4MM3B 2KDBA 1WJNA 1UGJA 5J2RA 2KQSA 4ARCA 1LFDA 1GOZA 4HDOA 2KFKA 2D3GA 2FAZA 1D5MC 3PRMB 1Z5SB 1GJZA 2IO3B 4YT0B 4L2YA 3H7PA 4NPNA 2QC8A 2BKFA 1JRPA 2M56B 3PHWB 4DQOC 1WJ6A 1E8YA 2G3QB 2LUMA 1SJHD 3NVZA 4IM3A 3AEBB 3TEXA 1L0XB 2KXJA 4LDTD 3A1QB 3PS6A 1PUTA 2WXOA 5IN7A 1GB4A 2PE6B 3ZKJC 2HDEA 2VH1A 1JWBD 1SBBB 3NG0A 1C1YB 3RMKC 1TKYA 3O13A 1F2RC 1KOTA 2AQ3B 4DHJB 2BGFA 4UDUC 1TYGB 1WXSA 3MC9A 1WR1A 3B1LX 2BYEA 3PZ7A 1LGRA 2WX1A 1TT5B 4S0RA 2N9LA 2NS5A 4K3BA 3RFZB 1QZEA 3AE3B 4YTPB 2IY0B 4TKNA 3UIPB 3N9YC 5BMHA 4LNIA 4HKZE 3MTNB 1I4XA 2KVZA 1J8CA 2C5LC 5D94A 1WXQA 2PTLA 4USAA 1LO5D 2KHWB 1V1PB 2KK8A 5TR5A 1J7BA 1I4QA 2IZVB 1SIFA 5D3IB 1T0SC 1U4AA 2CU1A 3ZTCA 2FIFA 2V4LA 2DX5B 2L3ZA 4FHJA 1DYQA 2N7EA 1XLNA 2KWDA 5EE0A 4IM0A 2PVGC 4HKQA 2G9HD 2LRWA 3L54A 1MJDA 2Y5BB 2HD5B 4M0WA 3PZDA 4ANXA 2LMCA 2CS4A 4AP4C 1IUEA 1NDDA 4DXGA 2NPTA 2JZZA 2WU5B 3KUDB 3H9DA 3L13A 1RYJA 3Q3NC 1FFUA 2PMVA 1TKGA 1SE2A 1I35A 4WWNA 4E71A 3RNEC 2KX0A 3Q3MC 1R4NB 1WGKA 3CSFA 4C7ZA 3N1YC 4CHKA 2NTSA 5EE1A 2NBWB 4BOZB 3Q8AA 1WRIA 2HE7A 2PLPA 5AZHA 3ECIA 4PS7A 1CQVA 3H1UA 2LGIA 2RGFA 4N9F4 2C9WB 4IDIA 4IWQA 1XLPA 2MA9B 1N5WA 4HRSA 2Z0EB 2BB5A 3NVYA 4IG7B 5LXHA 4W9FA 1M94A 2NR2A 5DPSA 3C8YA 5FR6A 2Z8LA 2I38A 3B2GA 4NY0A 2MBHA 2SAKA 2G45B 3ZO5B 3RPFC 1Y8RC 3RT3B 4W9EA 1L4ZB 3TMPB 1HTOA 1WSPA 2CU3A 1TZ1A 2FBWB 3NY5A 2KTRA 1SEBD 2LJIA 3VR8B 2AYOB 2ZEQA 2MBEA 3SU8X 2KAJA 2N7JA 1FRDA 1RFAA 5IOIA 2OEDA 1YOVB 1TZOA 2M1MA 2GLSA 1XCTL 4LNKA 2N0SB 4RGTA 3BYYB 1FXTB 3BK1A 3P4QB 3AB5A 4EFOA 2Y5CA 4REZA 1DOIA 5CTRC 4WWPA 1T6BX 1XQQA 2FCQA 1EM7A 3DHGC 3PREA 2DZIA 5BYRA 3APFA 5JHBA 3VUXA 2K8HA 1OTRB 2QSDA 3EFCA 3P1MA 1ZE3D 1AW7A 2O6VB 4GDKB 3ZDTA 2JZPA 2FUHB 3ABVB 1V81A 4JL9A 3AULA 1I4PA 3NZUA 2LGYA 1R4NI 3KYCD 1L6VA 2PJHA 2QMTA 4LDTB 3N3KB 3RZFA 1XF5L 3IBEA 1SE3A 3ZDMC 5D2MB 4AUQC 3NS8A 2D10A 3T9LA 1L6UA 1PGBA 1R4MB 4KGRA 5C2TB 2OJRA 2KWVB 3U52E 4X57B 2FCMA 5BYQA 1E7UA 2LXAA 1F1HA 1Q0WB 1TKEA 5CHVC 3PO0A 4FJYA 3ZJUA 4II3B 4W9HA 1QOAA 3A9JA 2DZKA 2NMQA 1RWSA 1SIJA 1HZ5A 2JVCA 3IHPC 2LFIA 2L32A 1JWAD 3QWZB 2KO3A 5DCNA 4BKSD 2KYWA 2YLMA 2L76A 3DPDA 4AQ7A 1ROEA 3V3XA 1ISNA 2ZPNA 5HHDG 4JWSC 1J0GA 4GSWA 3A4SC 4KZCA 5D3DA 5HKHA 2VZKD 4ZRPA 3UIOB 2ICIA 4OZBA 1IGDA 3ZIMA 4NNJB 4DHJD 1PYWD 5JXVA 2W3SA 1ACCA 3N30A 3SFEB 2BS4B 4LNFA 1GB1A 4NQKE 4N59A 4MELA 2KKCA 3AE1B 1RFKA 2XK5B 3VXWA 1FXIA 3FILB 2QJLA 1WMHB 4IWPA 5AUIA 4WJNA 3WIMA 3NVVA 1YX6B 2INDC 2WDTB 3HIZA 4M8MA 1RM6C 5C1ZA 1JWUD 2DHZA 3RNGC 2MLBA 4RGNA 3PVLA 3QK0A 4E3CA 4TQ1A 3VRBB 2WXLA 1UWXA 2KFJA 3W1SC 3U30A 2BYFA 4OVVA 3TEYA 1V8CA 2ON8A 1CJEA 1IP9A 4AWJA 2JXTA 2AEHA 2BWES 4A3OA 1R4MI 4LJPB 4NJCA 3R2IA 5AEKB 5AZFA 1WM3A 1MPEA 2KJ6A 3ZNGC 2WNMA 3QX1A 3HM6X 4KGSA 1S3SG 3R3MA 1FCLA 2EMSA 3PHXB 2WXMA 1KH0A 1N6ZA 4HPLB 1KM7A 5CX3A 4YSXB 1SSNA 3C0RB 3FAHA 3KH0A 1ZXIA 2GMIC 4RF1A 2ASQA 1RLFA 2K5PA 3NOBA 4GLSC 4HLEA 4KIKA 1GG3A 3CSTA 1I4HA 3AN1A 4WJQA 1VZ7A 4FXCA 3Q8FA 2L83A 2N7DA 2WDQB 4GMVA 4QAYA 4S17A 2LVQA 1C79A 3B2FA 2MBBB 2DZJA 3VH4B 2RDHA 2UYZB 2W3RA 2GB1A 1EU4A 1N60A 2PVOD 1WE7A 3MC8A 4OHJA 4H2AA 4XE0A 1UD7A 2O2VA 2UU7A 2KC1A 2XNAC 4K1RB 1NYQA 1P7FA 2LASA 4HJKA 5FR3A 1KLGD 2AL3A 1QOFA 1E8XA 1A70A 1ZUD2 4HPPA 4WH4A 4WQMA 3DBLB 1K53A 4J3OD 3HK0A 4MEMA 2BPSA 4PK1A 4YXDB 1HEZE 3ZJTA 2LJ5A 4TQ0A 2ACZB 1SJED 4HVBA 1GAQB 1TIFA 4US9A 1LQBA 4RM8A 2WDRB 4C4VB 3SEBA 1IBXB 3NVWA 2V3SA 2I2YA 1VJKA 1B1ZA 1XLQA 4MM3A 2M8SA 4EOYA 2OHFA 2O6VD 3TIXA 4OZAA 4KKJA 1WY8A 3V6EB 4C7YA 2J7QB 2MP2B 3AE8B 3J9CA 4LNOA 4W9GA 2M0AA 5DPWA 5JH5C 3ZGZA 3AH7A 1IYFA 4XC2A 4P1CC 1Q5WB 1AN8A 4W9IA 2Z0DB 5D6JB 4BKSA 2VZKB 4FA6A 3T3NA 4J6IA 2AQ1B 2K6DB 3WAPA 5IA7A 1T0QC 3HUIA 3MHSD 1T3QA 1ZPSA 1EF5A 5LXIB 1UNSA 3N32A 3R8BA 2EKIA 1BUIC 3A1QA 1S1QB 4GIVA 3DHIC 4PYZA 2V3NA 2DWQA 3T3OA 4DWFA 2KN5A 3ZYYX 1TY2A 2INCC 5H8YE 1F0ZA 1PGAA 2L00B 3AXCA 2MEKA 3M63B 1QOBA 4AJWA 3Q6BA 3UI3A 2H88B 2IO0B 2CR5A 2WXFA 1E8ZA 4XZ4A 2ZW0A 4WWOA 2KQ4X 1AWDA 2KNBA 2L0FA 3R7RA 1F52A 2Z59B 3HVZA 4IUMB 4YSYB 1EU3A 3R7QA 3RZWC 1OQRA 1WH3A 4DK5A 3D32A 1XEEA 1XO3A 3ZRFA 1V1PA 4URKA 2KT7A 1EO6A 1SGHA 5BO4B 3WA0A 2DYBA 1N5XA 1JQ4A 2IBIB 5J17A 2H89B 2AQ2B 3NHEB 3DBLI 3RULA 3AU4A 1HTQA 1E6EB 3AEAB 2OOBB 2PPHA 2NPTB 3I63C 3BVGA 3LDZE 2IO2B 1VCBA 4YTNB 2JX5A 2KWCA 2K8BA 4DXFA 4XGAB 1QOGA 2JRHA 1E7VA 1YN3A 1ZP0B 1KLVA 2BVCA 4MACA 2K0PA 1CMXB 1UF0A 4F7ZA 4GB9A 2WXIA 1YIWA 1D6EC 2GBNA 1ZXHA 3N20C 2A5UA 3JYUA 4BOSC 1GUAB 2JUOA 3WANA 4R3DA 3IVFA 4OVUA 1T0YA 2EMTA 5LNK1 1E0ZA 4ACFA 4B9KA 4NJ7A 1WX8A 1EWYC 1IGCA 2JQRB 2KD0A 2BB6A 3BYTB 4M8NA 4DDGD 4DXAB 3VH3B 1WIAA 3PRPB 2ZPYA 2I1KA 3AE6B 2RD0A 1BT0A 3ZQ4A 1C77A 3VTUA 1NENB 1RAXA 2C7NB 2JYEA 2GRIA 3VTVA 1D5ZC 1YJIA 3ZRCA 4JGHB 3I9V1 1MHHE 3X23A 2J0JA 2V0GA 2V4IB 3Q8BA 2MJ3A 2A4ZA 2LGDA 4G3XB 3H8HA 2KJRA 3L16A 3KLSX 1LM8B 3URYA 4F1SA 2V1YA 1E90A 4MH8A 4JQWC 2KDEB 1T5XD 2BS3B 3ZNHB 2K25A 4CQNA 4NJ6A 3AU5A 3L4PA 4MGZE 2IDYA 2B76B 2WU2B 2KANA 2LXCA 2CHXA 4N58A 1PQSA 2YEPF 4IW0A 2QIEB 3OJ4B 3DWGC 3NUHB 3KW5B 5IP4D 2MBOA 4GDLB 2CHWA 3QA8A 1ZDXA 1NEKB 1V80A 4OVZA 3R66C 4NAWB 4DHZB 1WGRA 1YNTE 4ZYNA 5FKAC 2LHDA 4IOIE 2GOWA 1P1AA 5G5HA 3WAMA 4PS8A 3ZXVA 4YL8A 2O6VA 2BBCA 4GDKA 3X0WA 3ZXRA 2J42A 4MJSB 3P63A 1WJUA 2X38A 1WM2A 1YN4A 4FADA 3PTFC 1J7CA 3SHQA 2R61A 2QCZA 4W9KA 5FK9C 5GXGB 4EEWA 1WFYA 4YSZB 2REXA 3HHMA 2WLBA 4NAMA 4TUUA 2Y5PA 3U7DA 2LI5A 2LVOA 2WXQA 4I6PA 4P6VF 4B0EA 2L05A 4G50A 3TUOA 4MGYE 4FJVB 1F9JA 1TS2A 4HJGE 3V05A 1UGMA 4RF0A 3V6CB 4HK2A 4K7UA 1DGJA 4BBNC 3DBRB 4WURA 3QJZA 1IPGA 4PT5A 1P9DU 2XN9C 1E9MA 1F2RI 4YWGG 4HCPB 2PW9A 1RRBA 4HROA 2YEPB 4GN1A 5EE3A 2K39A 1PFDA 1V97A 2D07B 4W9CA 1JW9D 4ZDVA 3AV8A 3M3JA 4LLGM 3N1ZC 3W1YA 1OFFA 1C78A 3WCQA 3VHTC 4G0NB 1QQRA 3GE3C 4KDLB 3N1XC 2WXGA 3VUWA 3VVWB 3BVMA 2MWSB 3KWVA 2N9KA 1F77A 2WXNA 1WYWB 3DVGX 1N63A 4KX6B 3DVNU 2JF5A 3ZLZA 3EUB2 3ZNZB 2CKHB 2G1EA 2MBQA 2G4SA 1V86A 2YVCA 1YMHE 2K9XA 1EUVB 1GPXA 4NZLB 5DPTA 4RNAA 4BBNF 2JRIB 4RM9A 4BVUC 1K51A 1WXMA 4JIOU 1WI0A 2LGXA 2GBKA 4A8XC 1BMLC 2OJWA 2L0TA 4FJZA 1VZ8A 2DAJA 3AE7B 3JVZX 4FLHA 1FNWA 1CZPA 3VDZA 3CF6E 4XWWA 2GBRA 3FILA 4CO7A 3CWIA 2EELA 3H6NA 3QQ8B 3AE9B 3DWMA 2KC2A 1VZ6A 2MJDA 1EF1A 4KKIA 3WAOA 2RPVA 3E9SA 1DOYA 1C4AA 2KMCA 1HE8A 2QILA 3UQBA 4KV2A 1NI3A 2KX3A 1D4BA
chains in the Genus database with same CATH topology
4E71A 3EFUA 2V3SA 1E8WA 2KX0A 4GXBA 4JLCA 3PSEB 1J19A 1OEYJ 3CSFA 1NI2A 3KUZA 4MJSA 4CHKA 4MM3A 1XD3B 2M8SA 4MDKE 4EOYA 3TIXA 2O6VD 2CHZA 1WRDB 4HWIB 1WY8A 3V6EB 4W9LA 2J7QB 2MP2B 2NBWB 4BOZB 3DBRI 2HE7A 4W9GA 4I6LB 2DENB 2JY6A 2WX0A 4ZRJA 5DPWA 5JH5C 1MG8A 2KTFA 4HXDA 4K81A 2AWTA 5AZHA 1IYFA 4XC2A 3ECIA 1Q5WB 3A9JB 4PS7A 3U8ZA 2R2QA 2DYOA 3PGEA 1WGGA 3SDLC 3IG3A 2L8JA 3H1UA 2RGFA 3IFWB 3QC8B 4W9IA 4N9F4 2C9WB 1WR6E 2GBMA 4ANWA 4IWQA 2Z0DB 2MA9B 5D6JB 2Z0EB 3ZW3A 4BKSA 4FA6A 1K8RB 1V49A 4J6IA 2EKEC 4IG7B 2RR9A 2K6DB 3WAPA 4EZLA 4W9FA 5LXHA 3PLUA 1M94A 4DDID 1P0RA 3MHSD 4IWOA 5IA7A 2NR2A 4EKUA 5DPSA 2BYVE 3ZUNA 5FR6A 1EF5A 5LXIB 2KLGA 3N32A 3JSVA 4EUTA 1GNUA 2JT4B 4NY0A 3A1QA 5LLIA 2MBHA 1S1QB 1NBFC 2G45B 3ZO5B 4IM2A 4GIVA 1Y8RC 3RT3B 2M4NA 3Q3FA 4PYZA 4W9EA 3UINB 3TMPB 3EC8A 4KDIC 4B6WA 4G11A 2KN5A 3BINA 4DWFA 5EDSA 2LRUA 3B08A 3VQIA 3WALA 2RSUA 4A3OA 4HCNB 2L00B 3AXCA 3DVNV 1TZ1A 4ANVA 3NY5A 2KTRA 2NCNA 2BKRB 3M63B 2AYOB 2BF8B 4AJWA 2UWQA 2ZEQA 2ZVNA 2FCNA 3KUCB 2MBEA 3ONSA 3PPAA 4FN2A 3SU8X 3Q3JA 2IO0B 5E6OA 1YD8U 2CR5A 4HDQA 1E8ZA 1RFAA 3V60A 4XZ4A 3QHTA 4WWOA 3VTWA 2KNBA 5IAAC 2L0FA 3R7RA 2Z59B 3ENEA 2M1MA 4IUMB 2KLCA 2ZNVB 4BFRA 1Q1OA 4FULA 4TV3A 3R7QA 3KVFB 1A5RA 3RZWC 3A9KB 1WH3A 2MRPA 2C60A 1FXTB 3D32A 4DHZE 2M0XA 3PRZA 4DK5A 3ZRFA 2N4FA 4XX5A 4GOCA 3UQAA 4URKA 4EFOA 3RCZA 1EO6A 2K1FA 2C7MB 1SGHA 5BO4B 3WA0A 5CTRC 2DYBA 1WF9A 4WWPA 2JPHA 2JZ3B 1XQQA 3EHVA 2XEWA 2FCQA 2IBIB 2FCSA 3VUYA 5J17A 2XK5A 3APCA 2XBBC 3ALBA 2KDIA 3PREA 5CHWA 2DZIA 3TJPA 3NHEB 2W9NA 1WMHA 3APFA 3DBLI 4PYUA 3RULA 5JHBA 5JZEB 3AU4A 4RMAA 3VUXA 2K8HA 1XT9B 1WGHA 2C7HA 1OTRB 4LCDE 3I3TB 2IYDB 2O6VB 2J0KA 4GDKB 2OOBB 2PPHA 1L7YA 1V5TA 2I1JA 2NPTB 3LDZE 2IO2B 3M62B 4KVGB 1VCBA 3ZDTA 4BKGA 4I6NB 2FUHB 1V81A 4JL9A 2KWCA 2HTHA 3AULA 3PT2B 2K8BA 1I42A 3APDA 2LGYA 3NZUA 2LWPA 1V2YA 2JRHA 1E7VA 4GU2A 1R4NI 1KLVA 3KYCD 1OGWA 1V9JA 4K7SA 3OLMD 3OAWA 4IC7B 4LJOB 2PJHA 2KFKB 4WJOA 4PS3A 2BWFA 2WYQA 1CMXB 4F7ZA 4GB9A 1P3QU 4LDTB 3N3KB 3GZNI 1YIWA 3H7PB 4KSKC 3W1SA 3RZFA 3IBEA 2GBNA 1Z2MA 1LXDA 3ZDMC 5D2MB 4AUQC 3NS8A 2A5UA 2D10A 3TCAA 4ZRKA 3JYUA 4BOSC 2PE9A 3T9LA 1GUAB 2JUOA 3L08A 3K9OB 3WANA 2NBUA 3K9PB 3IVFA 1H4RA 3DBHI 2OJRA 2QHOA 2KWVB 3VFKA 4OVUA 1T0YA 2EMTA 4X57B 1UBQA 2FCMA 1H8CA 1E7UA 2AL6A 2MP2A 2LXAA 1Q0WB 4B9KA 4ASWC 3AI5A 5CHVC 4NJ7A 1WX8A 1ZW7A 3B0AA 4FJYA 3A33B 1KJTA 1TTNA 2KD0A 4II3B 4W9HA 3A9JA 4AJYB 2G4DB 1TGZB 4M8NA 2DZKA 2IO1B 4DDGD 4K7WA 4DXAB 4EZKA 2ZCCA 3TL5A 3VH3B 2JWZA 1WIAA 4MGKE 2JVCA 2KVRA 3IHPC 3JSVB 4KIKB 3PRPB 2ZPYA 3RUIB 2I1KA 1YJ1A 2B3AA 1UELA 2RD0A 3ML8A 3SD5A 3OJ3A 1BT0A 2KO3A 2MSED 3QWZB 1WJ4A 5DCNA 3PV1A 3VTUA 4BKSD 1WX9A 1RAXA 2YLMA 4FHKA 5E6PA 2L76A 2C7NB 2N1VA 1L2NA 3DPDA 1WZ0A 2N1WA 3VTVA 3L0WB 4A3PA 1ISNA 1AARA 1YQBA 3QARA 3ZRCA 4JGHB 2ZPNA 4A20A 3X23A 1J0GA 2J0JA 3DQVA 4GSWA 3A4SC 4WAAA 4KZCA 4W9DA 4HPMB 5HKHA 4E74A 2WWZA 3UGBB 5G2NA 3DOWA 2A4ZA 5C23A 2LGDA 3UIOB 4G3XB 2KDFB 4MSMB 2KJRA 3L16A 2JXXA 1V5OA 1LM8B 4WJPA 3ZTDA 3ZIMA 1TBEA 4NNJB 4DHJD 1OEYA 3CMMB 4F1SA 1ZGUB 2V1YA 1ZKHA 1WZ3A 3ZVVA 1E90A 1WGDA 5DPRA 3A4RA 1UH6A 4JQWC 2KDEB 2D11A 4ZRIA 3ZNHB 3P2BA 3N30A 2K25A 2KMAA 3M95A 1WXVA 2O2VB 4NJ6A 3AU5A 4F8CB 4NQKE 4MGZE 3LJ3A 4MELA 2GBJA 2LUEA 2KKCA 2KANA 1WXAA 2LXCA 1E5WA 3A9KA 4MH0E 2N9PC 2XK5B 3VXWA 2CHXA 3GOEA 1PQSA 3QCAA 3V61A 4W9JA 3O65B 1WMHB 4IW0A 4IWPA 4CYEA 4WJNA 3WIMA 3OJ4B 3VAWA 1YX6B 4M0WB 4BKTA 3HM3A 5KHQA 3QIJA 4B95A 3KW5B 2LVPA 1D3ZA 2WDTB 2ZZPB 2MBOA 3HIZA 4M8MA 4GDLB 2MCNB 2LD9A 3KYDD 5CHFA 3DCGA 2CHWA 3ML9A 1OQYA 5C1ZA 2DHZA 3QA8A 1V80A 2KWUB 2DZMA 3R66C 4NAWB 2MLBA 4DHZB 1WGRA 3RD2A 4ZYNA 1WGYA 2R2OA 5L95C 1GC7A 5J18A 3PVLA 2GOWA 1P1AA 3S2AA 3WAMA 4ICVA 3QK0A 4E3CA 2D2QA 2K6QA 4TQ1A 4PS8A 2J0MA 4YL8A 2LZ6A 2O6VA 4GDKA 3X0WA 4KZ0A 2KFJA 3W1SC 4MJSB 3U30A 1WJUA 5JHAA 1WM2A 2KDBA 2BYFA 2PEAA 4FADA 1WJNA 3PTFC 1C3TA 4OVVA 3SHQA 4W9KA 4EEWA 5J2RA 5KHOA 1WFYA 2KQSA 2REXA 3L17A 3HHMA 4P7IA 1IP9A 4AWJA 1LFDA 4HDOA 2AEHA 2BWES 2KFKA 4TUUA 1R4MI 2D3GA 4LJPB 2LI5A 2FAZA 2LVOA 4I6PA 3PRMB 3U7DA 2L05A 1Z5SB 3L10B 2IO3B 1GJZA 4G50A 3H7PA 4MGYE 2KOXA 4NPNA 5AEKB 5AZFA 1WM3A 1F9JA 4FJVB 2BKFA 2FIDA 1UGMA 2KJ6A 3ZNGC 3V6CB 2MQJA 3QX1A 4HK2A 3PHWB 3HM6X 1VD2A 1S3SG 1WJ6A 4K7UA 3T8MA 1E8YA 3R3MA 4BBNC 2EMSA 2G3QB 2FNJB 3PHXB 3QJZA 1IPGA 1P9DU 4IM3A 4HCPB 4HPLB 1KM7A 5CX3A 1RRBA 2KXJA 4GN1A 3C0RB 1SE9A 4LDTD 3A1QB 5AZGA 3PS6A 3KH0A 4WQOB 3DVGY 2MX2A 2PE6B 2GMIC 2K8CA 3ZKJC 4II2B 1G6JA 2K39A 2ASQA 1RLFA 2D07B 4W9CA 4GGQA 1C1YB 4ZDVA 3NOBA 5E6NA 3PLVA 1KOTA 4HLEA 3M3JA 2RPQA 5G55A 4DHJB 2BGFA 4KIKA 3W1YA 3JW0X 2KTRB 1GG3A 1WXSA 2KQ7A 1WR1A 3CSTA 3B1LX 2BYEA 2M17A 4KSLC 3VHTC 4G0NB 2WX1A 3UF8A 4KDLB 4WJQA 1WE6A 3VUWA 3TBLD 3VVWB 2DAFA 2NS5A 1QZEA 2ZJDA 2MWSB 2N7DA 5GMVA 2IY0B 3DBSA 2VRRB 4TKNA 3UIPB 1WYWB 3DVGX 4GMVA 3DVNU 2JF5A 3MTNB 1YX5B 1V6EA 2IY1B 3H7SA 3ZLZA 3RYTA 1J8CA 2C5LC 3EECA 5D94A 2CKHB 3ZNZB 2MBQA 2G4SA 1V86A 2LVQA 2YVCA 2KHWB 2KK8A 5TR5A 2MBBB 2DZJA 2DYMA 2IZVB 1EUVB 1SIFA 2ZNVC 3VH4B 5DPTA 5L83A 2UYZB 3NZSA 4BBNF 2JRIB 4RM9A 2NVUI 1U4AA 2CU1A 4BVUC 3ZTCA 2FIFA 1WE7A 2V4LA 1WXMA 4JIOU 1WI0A 2DX5B 2MW5A 2LGXA 1X1MA 2GBKA 2HJ8A 2L3ZA 4FHJA 2KZRA 2N9EB 3QAQA 4NQLB 3ZNID 2L0TA 2N7EA 4FJZA 3V62A 1GC6A 2DAJA 1UD7A 2O2VA 1UZXB 2KC1A 4K1RB 3JVZX 4IM0A 4FLHA 2LASA 2LRWA 4HJKA 3VDZA 3CF6E 4MGIE 4ANUA 2AL3A 4EZJA 2GBRA 1E8XA 3L54A 4FBJB 4CO7A 2NBVB 1WX7A 2L7RA 2Y5BB 2HD5B 3MJWA 3H6NA 3HK0A 3PZDA 3QQ8B 2BPSA 2ZCBA 4MEMA 4ANXA 1P98A 2CS4A 2KJHB 4GDLA 4AP4C 4DBGA 1NDDA 2KC2A 2LJ5A 4TQ0A 1EF1A 2NPTA 2JZZA 3WAOA 4AOFA 4NAWA 4HVBA 3KUDB 4MSQB 3H9DA 3L13A 1LQBA 1UBIA 4ICUA 2N9XA 2KMCA 1HE8A 4RM8A 5D7GA 3UQBA 4KV2A 2KX3A 2ZVOA 3BY4B 1I35A 4WWNA 1JRUA 3DDCB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4E71 A;  3EFU A;  2V3S A;  1E8W A;  2KX0 A;  4GXB A;  4JLC A;  3PSE B;  1J19 A;  1OEY J;  3CSF A;  1NI2 A;  3KUZ A;  4MJS A;  4CHK A;  4MM3 A;  1XD3 B;  2M8S A;  4MDK E;  4EOY A;  3TIX A;  2O6V D;  2CHZ A;  1WRD B;  4HWI B;  1WY8 A;  3V6E B;  4W9L A;  2J7Q B;  2MP2 B;  2NBW B;  4BOZ B;  3DBR I;  2HE7 A;  4W9G A;  4I6L B;  2DEN B;  2JY6 A;  2WX0 A;  4ZRJ A;  5DPW A;  5JH5 C;  1MG8 A;  2KTF A;  4HXD A;  4K81 A;  2AWT A;  5AZH A;  1IYF A;  4XC2 A;  3ECI A;  1Q5W B;  3A9J B;  4PS7 A;  3U8Z A;  2R2Q A;  2DYO A;  3PGE A;  1WGG A;  3SDL C;  3IG3 A;  2L8J A;  3H1U A;  2RGF A;  3IFW B;  3QC8 B;  4W9I A;  4N9F 4;  2C9W B;  1WR6 E;  2GBM A;  4ANW A;  4IWQ A;  2Z0D B;  2MA9 B;  5D6J B;  2Z0E B;  3ZW3 A;  4BKS A;  4FA6 A;  1K8R B;  1V49 A;  4J6I A;  2EKE C;  4IG7 B;  2RR9 A;  2K6D B;  3WAP A;  4EZL A;  4W9F A;  5LXH A;  3PLU A;  1M94 A;  4DDI D;  1P0R A;  3MHS D;  4IWO A;  5IA7 A;  2NR2 A;  4EKU A;  5DPS A;  2BYV E;  3ZUN A;  5FR6 A;  1EF5 A;  5LXI B;  2KLG A;  3N32 A;  3JSV A;  4EUT A;  1GNU A;  2JT4 B;  4NY0 A;  3A1Q A;  5LLI A;  2MBH A;  1S1Q B;  1NBF C;  2G45 B;  3ZO5 B;  4IM2 A;  4GIV A;  1Y8R C;  3RT3 B;  2M4N A;  3Q3F A;  4PYZ A;  4W9E A;  3UIN B;  3TMP B;  3EC8 A;  4KDI C;  4B6W A;  4G11 A;  2KN5 A;  3BIN A;  4DWF A;  5EDS A;  2LRU A;  3B08 A;  3VQI A;  3WAL A;  2RSU A;  4A3O A;  4HCN B;  2L00 B;  3AXC A;  3DVN V;  1TZ1 A;  4ANV A;  3NY5 A;  2KTR A;  2NCN A;  2BKR B;  3M63 B;  2AYO B;  2BF8 B;  4AJW A;  2UWQ A;  2ZEQ A;  2ZVN A;  2FCN A;  3KUC B;  2MBE A;  3ONS A;  3PPA A;  4FN2 A;  3SU8 X;  3Q3J A;  2IO0 B;  5E6O A;  1YD8 U;  2CR5 A;  4HDQ A;  1E8Z A;  1RFA A;  3V60 A;  4XZ4 A;  3QHT A;  4WWO A;  3VTW A;  2KNB A;  5IAA C;  2L0F A;  3R7R A;  2Z59 B;  3ENE A;  2M1M A;  4IUM B;  2KLC A;  2ZNV B;  4BFR A;  1Q1O A;  4FUL A;  4TV3 A;  3R7Q A;  3KVF B;  1A5R A;  3RZW C;  3A9K B;  1WH3 A;  2MRP A;  2C60 A;  1FXT B;  3D32 A;  4DHZ E;  2M0X A;  3PRZ A;  4DK5 A;  3ZRF A;  2N4F A;  4XX5 A;  4GOC A;  3UQA A;  4URK A;  4EFO A;  3RCZ A;  1EO6 A;  2K1F A;  2C7M B;  1SGH A;  5BO4 B;  3WA0 A;  5CTR C;  2DYB A;  1WF9 A;  4WWP A;  2JPH A;  2JZ3 B;  1XQQ A;  3EHV A;  2XEW A;  2FCQ A;  2IBI B;  2FCS A;  3VUY A;  5J17 A;  2XK5 A;  3APC A;  2XBB C;  3ALB A;  2KDI A;  3PRE A;  5CHW A;  2DZI A;  3TJP A;  3NHE B;  2W9N A;  1WMH A;  3APF A;  3DBL I;  4PYU A;  3RUL A;  5JHB A;  5JZE B;  3AU4 A;  4RMA A;  3VUX A;  2K8H A;  1XT9 B;  1WGH A;  2C7H A;  1OTR B;  4LCD E;  3I3T B;  2IYD B;  2O6V B;  2J0K A;  4GDK B;  2OOB B;  2PPH A;  1L7Y A;  1V5T A;  2I1J A;  2NPT B;  3LDZ E;  2IO2 B;  3M62 B;  4KVG B;  1VCB A;  3ZDT A;  4BKG A;  4I6N B;  2FUH B;  1V81 A;  4JL9 A;  2KWC A;  2HTH A;  3AUL A;  3PT2 B;  2K8B A;  1I42 A;  3APD A;  2LGY A;  3NZU A;  2LWP A;  1V2Y A;  2JRH A;  1E7V A;  4GU2 A;  1R4N I;  1KLV A;  3KYC D;  1OGW A;  1V9J A;  4K7S A;  3OLM D;  3OAW A;  4IC7 B;  4LJO B;  2PJH A;  2KFK B;  4WJO A;  4PS3 A;  2BWF A;  2WYQ A;  1CMX B;  4F7Z A;  4GB9 A;  1P3Q U;  4LDT B;  3N3K B;  3GZN I;  1YIW A;  3H7P B;  4KSK C;  3W1S A;  3RZF A;  3IBE A;  2GBN A;  1Z2M A;  1LXD A;  3ZDM C;  5D2M B;  4AUQ C;  3NS8 A;  2A5U A;  2D10 A;  3TCA A;  4ZRK A;  3JYU A;  4BOS C;  2PE9 A;  3T9L A;  1GUA B;  2JUO A;  3L08 A;  3K9O B;  3WAN A;  2NBU A;  3K9P B;  3IVF A;  1H4R A;  3DBH I;  2OJR A;  2QHO A;  2KWV B;  3VFK A;  4OVU A;  1T0Y A;  2EMT A;  4X57 B;  1UBQ A;  2FCM A;  1H8C A;  1E7U A;  2AL6 A;  2MP2 A;  2LXA A;  1Q0W B;  4B9K A;  4ASW C;  3AI5 A;  5CHV C;  4NJ7 A;  1WX8 A;  1ZW7 A;  3B0A A;  4FJY A;  3A33 B;  1KJT A;  1TTN A;  2KD0 A;  4II3 B;  4W9H A;  3A9J A;  4AJY B;  2G4D B;  1TGZ B;  4M8N A;  2DZK A;  2IO1 B;  4DDG D;  4K7W A;  4DXA B;  4EZK A;  2ZCC A;  3TL5 A;  3VH3 B;  2JWZ A;  1WIA A;  4MGK E;  2JVC A;  2KVR A;  3IHP C;  3JSV B;  4KIK B;  3PRP B;  2ZPY A;  3RUI B;  2I1K A;  1YJ1 A;  2B3A A;  1UEL A;  2RD0 A;  3ML8 A;  3SD5 A;  3OJ3 A;  1BT0 A;  2KO3 A;  2MSE D;  3QWZ B;  1WJ4 A;  5DCN A;  3PV1 A;  3VTU A;  4BKS D;  1WX9 A;  1RAX A;  2YLM A;  4FHK A;  5E6P A;  2L76 A;  2C7N B;  2N1V A;  1L2N A;  3DPD A;  1WZ0 A;  2N1W A;  3VTV A;  3L0W B;  4A3P A;  1ISN A;  1AAR A;  1YQB A;  3QAR A;  3ZRC A;  4JGH B;  2ZPN A;  4A20 A;  3X23 A;  1J0G A;  2J0J A;  3DQV A;  4GSW A;  3A4S C;  4WAA A;  4KZC A;  4W9D A;  4HPM B;  5HKH A;  4E74 A;  2WWZ A;  3UGB B;  5G2N A;  3DOW A;  2A4Z A;  5C23 A;  2LGD A;  3UIO B;  4G3X B;  2KDF B;  4MSM B;  2KJR A;  3L16 A;  2JXX A;  1V5O A;  1LM8 B;  4WJP A;  3ZTD A;  3ZIM A;  1TBE A;  4NNJ B;  4DHJ D;  1OEY A;  3CMM B;  4F1S A;  1ZGU B;  2V1Y A;  1ZKH A;  1WZ3 A;  3ZVV A;  1E90 A;  1WGD A;  5DPR A;  3A4R A;  1UH6 A;  4JQW C;  2KDE B;  2D11 A;  4ZRI A;  3ZNH B;  3P2B A;  3N30 A;  2K25 A;  2KMA A;  3M95 A;  1WXV A;  2O2V B;  4NJ6 A;  3AU5 A;  4F8C B;  4NQK E;  4MGZ E;  3LJ3 A;  4MEL A;  2GBJ A;  2LUE A;  2KKC A;  2KAN A;  1WXA A;  2LXC A;  1E5W A;  3A9K A;  4MH0 E;  2N9P C;  2XK5 B;  3VXW A;  2CHX A;  3GOE A;  1PQS A;  3QCA A;  3V61 A;  4W9J A;  3O65 B;  1WMH B;  4IW0 A;  4IWP A;  4CYE A;  4WJN A;  3WIM A;  3OJ4 B;  3VAW A;  1YX6 B;  4M0W B;  4BKT A;  3HM3 A;  5KHQ A;  3QIJ A;  4B95 A;  3KW5 B;  2LVP A;  1D3Z A;  2WDT B;  2ZZP B;  2MBO A;  3HIZ A;  4M8M A;  4GDL B;  2MCN B;  2LD9 A;  3KYD D;  5CHF A;  3DCG A;  2CHW A;  3ML9 A;  1OQY A;  5C1Z A;  2DHZ A;  3QA8 A;  1V80 A;  2KWU B;  2DZM A;  3R66 C;  4NAW B;  2MLB A;  4DHZ B;  1WGR A;  3RD2 A;  4ZYN A;  1WGY A;  2R2O A;  5L95 C;  1GC7 A;  5J18 A;  3PVL A;  2GOW A;  1P1A A;  3S2A A;  3WAM A;  4ICV A;  3QK0 A;  4E3C A;  2D2Q A;  2K6Q A;  4TQ1 A;  4PS8 A;  2J0M A;  4YL8 A;  2LZ6 A;  2O6V A;  4GDK A;  3X0W A;  4KZ0 A;  2KFJ A;  3W1S C;  4MJS B;  3U30 A;  1WJU A;  5JHA A;  1WM2 A;  2KDB A;  2BYF A;  2PEA A;  4FAD A;  1WJN A;  3PTF C;  1C3T A;  4OVV A;  3SHQ A;  4W9K A;  4EEW A;  5J2R A;  5KHO A;  1WFY A;  2KQS A;  2REX A;  3L17 A;  3HHM A;  4P7I A;  1IP9 A;  4AWJ A;  1LFD A;  4HDO A;  2AEH A;  2BWE S;  2KFK A;  4TUU A;  1R4M I;  2D3G A;  4LJP B;  2LI5 A;  2FAZ A;  2LVO A;  4I6P A;  3PRM B;  3U7D A;  2L05 A;  1Z5S B;  3L10 B;  2IO3 B;  1GJZ A;  4G50 A;  3H7P A;  4MGY E;  2KOX A;  4NPN A;  5AEK B;  5AZF A;  1WM3 A;  1F9J A;  4FJV B;  2BKF A;  2FID A;  1UGM A;  2KJ6 A;  3ZNG C;  3V6C B;  2MQJ A;  3QX1 A;  4HK2 A;  3PHW B;  3HM6 X;  1VD2 A;  1S3S G;  1WJ6 A;  4K7U A;  3T8M A;  1E8Y A;  3R3M A;  4BBN C;  2EMS A;  2G3Q B;  2FNJ B;  3PHX B;  3QJZ A;  1IPG A;  1P9D U;  4IM3 A;  4HCP B;  4HPL B;  1KM7 A;  5CX3 A;  1RRB A;  2KXJ A;  4GN1 A;  3C0R B;  1SE9 A;  4LDT D;  3A1Q B;  5AZG A;  3PS6 A;  3KH0 A;  4WQO B;  3DVG Y;  2MX2 A;  2PE6 B;  2GMI C;  2K8C A;  3ZKJ C;  4II2 B;  1G6J A;  2K39 A;  2ASQ A;  1RLF A;  2D07 B;  4W9C A;  4GGQ A;  1C1Y B;  4ZDV A;  3NOB A;  5E6N A;  3PLV A;  1KOT A;  4HLE A;  3M3J A;  2RPQ A;  5G55 A;  4DHJ B;  2BGF A;  4KIK A;  3W1Y A;  3JW0 X;  2KTR B;  1GG3 A;  1WXS A;  2KQ7 A;  1WR1 A;  3CST A;  3B1L X;  2BYE A;  2M17 A;  4KSL C;  3VHT C;  4G0N B;  2WX1 A;  3UF8 A;  4KDL B;  4WJQ A;  1WE6 A;  3VUW A;  3TBL D;  3VVW B;  2DAF A;  2NS5 A;  1QZE A;  2ZJD A;  2MWS B;  2N7D A;  5GMV A;  2IY0 B;  3DBS A;  2VRR B;  4TKN A;  3UIP B;  1WYW B;  3DVG X;  4GMV A;  3DVN U;  2JF5 A;  3MTN B;  1YX5 B;  1V6E A;  2IY1 B;  3H7S A;  3ZLZ A;  3RYT A;  1J8C A;  2C5L C;  3EEC A;  5D94 A;  2CKH B;  3ZNZ B;  2MBQ A;  2G4S A;  1V86 A;  2LVQ A;  2YVC A;  2KHW B;  2KK8 A;  5TR5 A;  2MBB B;  2DZJ A;  2DYM A;  2IZV B;  1EUV B;  1SIF A;  2ZNV C;  3VH4 B;  5DPT A;  5L83 A;  2UYZ B;  3NZS A;  4BBN F;  2JRI B;  4RM9 A;  2NVU I;  1U4A A;  2CU1 A;  4BVU C;  3ZTC A;  2FIF A;  1WE7 A;  2V4L A;  1WXM A;  4JIO U;  1WI0 A;  2DX5 B;  2MW5 A;  2LGX A;  1X1M A;  2GBK A;  2HJ8 A;  2L3Z A;  4FHJ A;  2KZR A;  2N9E B;  3QAQ A;  4NQL B;  3ZNI D;  2L0T A;  2N7E A;  4FJZ A;  3V62 A;  1GC6 A;  2DAJ A;  1UD7 A;  2O2V A;  1UZX B;  2KC1 A;  4K1R B;  3JVZ X;  4IM0 A;  4FLH A;  2LAS A;  2LRW A;  4HJK A;  3VDZ A;  3CF6 E;  4MGI E;  4ANU A;  2AL3 A;  4EZJ A;  2GBR A;  1E8X A;  3L54 A;  4FBJ B;  4CO7 A;  2NBV B;  1WX7 A;  2L7R A;  2Y5B B;  2HD5 B;  3MJW A;  3H6N A;  3HK0 A;  3PZD A;  3QQ8 B;  2BPS A;  2ZCB A;  4MEM A;  4ANX A;  1P98 A;  2CS4 A;  2KJH B;  4GDL A;  4AP4 C;  4DBG A;  1NDD A;  2KC2 A;  2LJ5 A;  4TQ0 A;  1EF1 A;  2NPT A;  2JZZ A;  3WAO A;  4AOF A;  4NAW A;  4HVB A;  3KUD B;  4MSQ B;  3H9D A;  3L13 A;  1LQB A;  1UBI A;  4ICU A;  2N9X A;  2KMC A;  1HE8 A;  4RM8 A;  5D7G A;  3UQB A;  4KV2 A;  2KX3 A;  2ZVO A;  3BY4 B;  1I35 A;  4WWN A;  1JRU A;  3DDC B; 
#chains in the Genus database with same CATH topology
 3EFU A;  1JCK B;  1E8W A;  3PSE B;  1J19 A;  1HZ6 A;  1NI2 A;  1FRR A;  3P4P B;  1XD3 B;  3GZN B;  2CHZ A;  5T8I A;  1WRD B;  3Q3O C;  4W9L A;  3DBR I;  2KMM A;  2JY6 A;  1L0V B;  2CJN A;  2KTF A;  4K81 A;  2FUG 1;  3U8Z A;  2R2Q A;  2DYO A;  1WGG A;  2L8J A;  4D2K A;  1WR6 E;  2GBM A;  4ANW A;  4ZYS A;  3GE8 C;  3NRZ A;  3ZW3 A;  1K8R B;  1N61 A;  1V49 A;  1XCQ L;  1I4G A;  4Q2J A;  4EKU A;  3Q2A C;  2BYV E;  3ZUN A;  3GS2 A;  2JYT A;  2W55 A;  3JSV A;  4EUT A;  4WWM A;  5LLI A;  5HFY A;  3NS1 A;  3Q3F A;  1OQQ A;  3EC8 A;  1J7A A;  4B6W A;  5BYS A;  1XXG A;  1YQ4 B;  5EDS A;  2RSU A;  1E7P B;  1AYF A;  2E3T A;  4HCN B;  4L23 A;  5H92 C;  3DVN V;  3MJ5 A;  2BF8 B;  3PPA A;  3ONS A;  2J53 A;  5E6O A;  3GB1 A;  1T0R C;  4HDQ A;  3QHT A;  3VTW A;  2SEB D;  3TEZ A;  2ZW1 A;  4TMA B;  2KLC A;  4JX1 C;  4BFR A;  1Q1O A;  4FUL A;  3A9K B;  2MRP A;  4DHZ E;  3PRZ A;  3DHH C;  3VRA B;  3RCZ A;  2K1F A;  2C7M B;  3BK2 A;  1WF9 A;  2JPH A;  2WXK A;  3VR9 B;  2FCS A;  3VUY A;  3APC A;  2XBB C;  3ALB A;  2KDI A;  5CHW A;  3TJP A;  3OG5 A;  2W9N A;  3U4E G;  1XT9 B;  4LCD E;  2MH7 A;  3P4R B;  3R2T A;  1MI0 A;  3FC4 A;  2IYD B;  4P16 A;  2K3U A;  4BAX A;  1L7Y A;  2I1J A;  2KN4 A;  4KVG B;  3M62 B;  4I6N B;  1I42 A;  2IGD A;  3APD A;  1V2Y A;  3NJT A;  4LTU A;  5EE9 A;  1OGW A;  1V9J A;  4K7S A;  3OAW A;  3AEF B;  2KFK B;  1MG4 A;  1TS5 A;  3GZN I;  3H7P B;  3W1S A;  1PGX A;  4OW0 A;  2J52 A;  2W54 A;  4N6E B;  1LXD A;  4C4V A;  3LXF A;  1KLU D;  4ZRK A;  4OZC A;  1IBX A;  2PE9 A;  3L08 A;  3K9O B;  2NBU A;  1MFW A;  1H4R A;  4XYC A;  5HG2 A;  3VFK A;  1UBQ A;  1H8C A;  1VRA B;  2MP2 A;  1EWC A;  1ZW7 A;  3B0A A;  1TTN A;  1TGZ B;  3Q69 A;  2BW2 A;  2IO1 B;  2LGS A;  1N62 A;  3AE4 B;  4K7W A;  4EZK A;  2W82 A;  3PZ8 A;  1HQR D;  1TS3 A;  4MGK E;  1FPY A;  2TSS A;  3RUI B;  1KF6 B;  1YJ1 A;  3SD5 A;  1QT9 A;  1WJ4 A;  3TEW A;  2CJO A;  5E6P A;  3LYY A;  2HJ1 A;  1L4D B;  3TSS A;  1L2N A;  2N1W A;  2X8X X;  3L0W B;  1AAR A;  1YQB A;  3Q8C A;  3QAR A;  3RNB C;  3BZD B;  4A20 A;  1KFY B;  1PDX A;  3DQV A;  3MC0 B;  4ITK A;  4WAA A;  4E74 A;  5G5G A;  1Y56 A;  4JPS A;  5C23 A;  1C9F A;  2KDF B;  4MSM B;  1TJE A;  2JXX A;  5IO9 A;  4WJP A;  1TBE A;  1OEY A;  2WP9 B;  3BWU D;  1ZKH A;  1WZ3 A;  2JSV X;  3ZVV A;  1FMA D;  3AEE B;  3C19 A;  2BQQ A;  1HA5 A;  3LJ3 A;  3U7Z A;  3AMZ A;  1JAL A;  1WXA A;  2WXH A;  4MH0 E;  2L1A A;  3QCA A;  5AUK A;  3V61 A;  3RNF C;  4W9J A;  3EA6 A;  3O65 B;  1MVK A;  5KHQ A;  4M0W B;  3HM3 A;  4B95 A;  4RCO A;  1D3Z A;  2RMM A;  2ZZP B;  3ZJV A;  2D3B A;  4JWU C;  2LD9 A;  1ZDV A;  3LB8 C;  1OQY A;  1YQ3 B;  1TY0 A;  1UUP A;  2R2O A;  3IAM 1;  3ETR A;  2WXJ A;  4XDC A;  2VH2 A;  2QEJ C;  1FNV A;  3S2A A;  3P42 A;  1SF0 A;  5JHA A;  4K3C A;  2PEA A;  4A9A A;  1C3T A;  2D3C A;  5KHO A;  3L17 A;  4M00 A;  1P7E A;  4P7I A;  2JU6 X;  1STE A;  5E6J A;  3L10 B;  2KOX A;  1FO4 A;  3W5V B;  2FID A;  3MP9 A;  3W9C B;  3Q8E A;  2MQJ A;  1VD2 A;  2IPK D;  3T8M A;  1B9R A;  1V1O A;  2FNJ B;  2WGS A;  3B9J A;  1FNU A;  1ESF A;  1SE9 A;  5AZG A;  4WQO B;  3DVG Y;  2MX2 A;  2K8C A;  4II2 B;  4AS1 A;  1G6J A;  2WHI A;  4GGQ A;  2BTE A;  5E6N A;  1DOX A;  3PLV A;  2RPQ A;  5G55 A;  4C00 A;  3RNC C;  3JW0 X;  2KTR B;  3NZ3 A;  3MFG A;  2KQ7 A;  2M17 A;  4KSL C;  1VDV A;  1QIL A;  3RN9 C;  3UF8 A;  1WE6 A;  1FFV A;  2V9H A;  1ZOY B;  3TBL D;  4LK0 M;  2DAF A;  2BS2 B;  4ZOH C;  2ZJD A;  4P1B C;  5GMV A;  3DBS A;  2VRR B;  1BXT A;  1YX5 B;  1V6E A;  2IY1 B;  2JWU A;  3H7S A;  3RYT A;  3EEC A;  2NTT A;  4US8 A;  1ET6 A;  2DYM A;  2ONQ A;  2ZNV C;  4ZRQ A;  5L83 A;  3NZS A;  5HI1 A;  2NVU I;  2PKO A;  5BMG A;  2MW5 A;  3GP7 A;  1X1M A;  2HJ8 A;  2QDF A;  2KZR A;  2N9E B;  3QAQ A;  4NQL B;  3ZNI D;  1FD6 A;  1KTK A;  3V62 A;  1GC6 A;  1UZX B;  2K22 A;  2L52 A;  2IGH A;  4MGI E;  3W5U B;  4ANU A;  4EZJ A;  4RFB A;  1QF6 A;  2WS3 B;  4FBJ B;  2NBV B;  1WX7 A;  2L7R A;  3MJW A;  2ZCB A;  3HVD A;  4RGM A;  1P98 A;  5BMI A;  2Y3A A;  2KJH B;  4GDL A;  4DBG A;  4XWT A;  1ENF A;  3AE5 B;  1HXY D;  3AEC B;  4AOF A;  1SXT A;  4NAW A;  4O1N A;  1L5P A;  4MSQ B;  1UBI A;  4ICU A;  2N9X A;  5D7G A;  2ZVO A;  3BY4 B;  1JRU A;  3DDC B;  4GXB A;  4JLC A;  1OEY J;  1K52 A;  3Q14 C;  3KUZ A;  4MJS A;  4MDK E;  2AX5 A;  1VLB A;  1I4R A;  4HWI B;  3AEG B;  4I6L B;  2DEN B;  2WX0 A;  4ZRJ A;  1MG8 A;  4HXD A;  4IKG A;  2AWT A;  3A9J B;  3PGE A;  3SDL C;  3IG3 A;  3IFW B;  3QC8 B;  3DBH B;  1K50 A;  3IXS A;  2MHJ A;  2RDB C;  5IKC M;  2EKE C;  2RR9 A;  3BVZ A;  4EZL A;  3PLU A;  4DDI D;  1P0R A;  3RNA C;  4IWO A;  1E10 A;  4A6Q A;  5C3J B;  4RH6 A;  2KAC A;  2KLG A;  2WDV B;  1GNU A;  2JT4 B;  1FCC C;  1NBF C;  4IM2 A;  4A55 A;  2M4N A;  3IT4 B;  3UIN B;  3IAS 1;  4KDI C;  1I7H A;  4G11 A;  3BIN A;  2LRU A;  3B08 A;  3VQI A;  3WAL A;  4ANV A;  1JML A;  2NCN A;  2BKR B;  2UWQ A;  4A90 A;  2ZVN A;  2FCN A;  3KUC B;  4FN2 A;  3Q3J A;  1YD8 U;  4EE2 A;  3V60 A;  2J4X A;  1L0Y B;  5IAA C;  1C4C A;  3ENE A;  4L1B A;  4C56 C;  4BZA A;  2ZNV B;  1JWS D;  1WWT A;  4TV3 A;  1FXA A;  3KVF B;  3U2S C;  1A5R A;  2C60 A;  2M0X A;  2N4F A;  4XX5 A;  3OWE B;  4GOC A;  4JE3 B;  3BII D;  3UQA A;  1ET9 A;  4YTM B;  1WYG A;  3MHZ A;  2WXR A;  1C4P A;  2DLB A;  2JZ3 B;  3CIR B;  3I5J C;  3EHV A;  2XEW A;  2Q5W D;  2XK5 A;  1TS4 A;  4ZHP A;  1WMH A;  4PYU A;  5JZE B;  4RMA A;  2D5G A;  1FM0 D;  1WGH A;  2C7H A;  1R7S A;  3AED B;  4TSS A;  1MHX A;  2KDM A;  4M01 A;  3I3T B;  2J0K A;  4XDD A;  1CK1 A;  1V5T A;  4BKG A;  3SR6 A;  2HTH A;  3PT2 B;  2LWP A;  4WAF A;  4GU2 A;  1C76 A;  1UWM A;  3OLM D;  4IC7 B;  4LJO B;  4WJO A;  4PS3 A;  2DBY A;  2BWF A;  2WYQ A;  3SFD B;  1P3Q U;  3AE2 B;  4KSK C;  2E6X A;  1Z2M A;  2HTM E;  3TCA A;  1D5X C;  3K9P B;  3DBH I;  2M19 A;  2QHO A;  3P4S B;  4C80 A;  2AL6 A;  4HEA 1;  4ASW C;  3AI5 A;  4ZHO A;  3A33 B;  2MJE A;  3W2D A;  1M4V A;  1KJT A;  1FEH A;  5MPO A;  4AJY B;  2G4D B;  1JRO A;  2ZCC A;  3TL5 A;  3I57 A;  2JWZ A;  2KVR A;  4KIK B;  2FE8 A;  3JSV B;  5TSS A;  2LEK A;  2B3A A;  1UEL A;  1KRH A;  3ML8 A;  3OJ3 A;  2MSE D;  3PV1 A;  3E56 A;  1WX9 A;  4FHK A;  2N1V A;  1WZ0 A;  1VR9 A;  4A3P A;  3KQ4 A;  4M02 A;  2DNF A;  3KWL A;  1JWM D;  4WIP A;  4W9D A;  4HPM B;  2WWZ A;  3RI7 C;  2RDG A;  1YJJ A;  3UGB B;  5G2N A;  3DOW A;  2D3A A;  1SB3 C;  3IT6 B;  3HRD D;  1V5O A;  3ZTD A;  3CMM B;  1ZGU B;  1WGD A;  5DPR A;  3A4R A;  1UH6 A;  4MT5 A;  2D11 A;  4ZRI A;  3P2B A;  2KMA A;  3M95 A;  1WXV A;  2O2V B;  2IGG A;  4F8C B;  2WXP A;  4LNN A;  4B0M A;  2GBJ A;  2LUE A;  2WQY B;  1E5W A;  3A9K A;  2N9P C;  1YN5 A;  3GOE A;  2PIA A;  1Q10 A;  1XLO A;  1QLB B;  2BYT A;  4CYE A;  1QKZ A;  4BKT A;  3VAW A;  1NVI D;  3QIJ A;  2GI9 A;  2LVP A;  1SE4 A;  2INN E;  2MCN B;  3KYD D;  5CHF A;  3DCG A;  3ML9 A;  2KWU B;  2DZM A;  2INP E;  2V3P A;  3RD2 A;  2BT6 A;  1WGY A;  4KGT A;  2LHE A;  1NYR A;  3FKY A;  5L95 C;  1GC7 A;  5I4D A;  5J18 A;  3EGR A;  4ICV A;  3AM9 A;  2D2Q A;  1FIQ A;  2K6Q A;  2J0M A;  4RGO S;  2LZ6 A;  4ARI A;  4KZ0 A;  2IJ0 A;  4MM3 B;  2KDB A;  1WJN A;  1UGJ A;  5J2R A;  2KQS A;  4ARC A;  1LFD A;  1GOZ A;  4HDO A;  2KFK A;  2D3G A;  2FAZ A;  1D5M C;  3PRM B;  1Z5S B;  1GJZ A;  2IO3 B;  4YT0 B;  4L2Y A;  3H7P A;  4NPN A;  2QC8 A;  2BKF A;  1JRP A;  2M56 B;  3PHW B;  4DQO C;  1WJ6 A;  1E8Y A;  2G3Q B;  2LUM A;  1SJH D;  3NVZ A;  4IM3 A;  3AEB B;  3TEX A;  1L0X B;  2KXJ A;  4LDT D;  3A1Q B;  3PS6 A;  1PUT A;  2WXO A;  5IN7 A;  1GB4 A;  2PE6 B;  3ZKJ C;  2HDE A;  2VH1 A;  1JWB D;  1SBB B;  3NG0 A;  1C1Y B;  3RMK C;  1TKY A;  3O13 A;  1F2R C;  1KOT A;  2AQ3 B;  4DHJ B;  2BGF A;  4UDU C;  1TYG B;  1WXS A;  3MC9 A;  1WR1 A;  3B1L X;  2BYE A;  3PZ7 A;  1LGR A;  2WX1 A;  1TT5 B;  4S0R A;  2N9L A;  2NS5 A;  4K3B A;  3RFZ B;  1QZE A;  3AE3 B;  4YTP B;  2IY0 B;  4TKN A;  3UIP B;  3N9Y C;  5BMH A;  4LNI A;  4HKZ E;  3MTN B;  1I4X A;  2KVZ A;  1J8C A;  2C5L C;  5D94 A;  1WXQ A;  2PTL A;  4USA A;  1LO5 D;  2KHW B;  1V1P B;  2KK8 A;  5TR5 A;  1J7B A;  1I4Q A;  2IZV B;  1SIF A;  5D3I B;  1T0S C;  1U4A A;  2CU1 A;  3ZTC A;  2FIF A;  2V4L A;  2DX5 B;  2L3Z A;  4FHJ A;  1DYQ A;  2N7E A;  1XLN A;  2KWD A;  5EE0 A;  4IM0 A;  2PVG C;  4HKQ A;  2G9H D;  2LRW A;  3L54 A;  1MJD A;  2Y5B B;  2HD5 B;  4M0W A;  3PZD A;  4ANX A;  2LMC A;  2CS4 A;  4AP4 C;  1IUE A;  1NDD A;  4DXG A;  2NPT A;  2JZZ A;  2WU5 B;  3KUD B;  3H9D A;  3L13 A;  1RYJ A;  3Q3N C;  1FFU A;  2PMV A;  1TKG A;  1SE2 A;  1I35 A;  4WWN A;  4E71 A;  3RNE C;  2KX0 A;  3Q3M C;  1R4N B;  1WGK A;  3CSF A;  4C7Z A;  3N1Y C;  4CHK A;  2NTS A;  5EE1 A;  2NBW B;  4BOZ B;  3Q8A A;  1WRI A;  2HE7 A;  2PLP A;  5AZH A;  3ECI A;  4PS7 A;  1CQV A;  3H1U A;  2LGI A;  2RGF A;  4N9F 4;  2C9W B;  4IDI A;  4IWQ A;  1XLP A;  2MA9 B;  1N5W A;  4HRS A;  2Z0E B;  2BB5 A;  3NVY A;  4IG7 B;  5LXH A;  4W9F A;  1M94 A;  2NR2 A;  5DPS A;  3C8Y A;  5FR6 A;  2Z8L A;  2I38 A;  3B2G A;  4NY0 A;  2MBH A;  2SAK A;  2G45 B;  3ZO5 B;  3RPF C;  1Y8R C;  3RT3 B;  4W9E A;  1L4Z B;  3TMP B;  1HTO A;  1WSP A;  2CU3 A;  1TZ1 A;  2FBW B;  3NY5 A;  2KTR A;  1SEB D;  2LJI A;  3VR8 B;  2AYO B;  2ZEQ A;  2MBE A;  3SU8 X;  2KAJ A;  2N7J A;  1FRD A;  1RFA A;  5IOI A;  2OED A;  1YOV B;  1TZO A;  2M1M A;  2GLS A;  1XCT L;  4LNK A;  2N0S B;  4RGT A;  3BYY B;  1FXT B;  3BK1 A;  3P4Q B;  3AB5 A;  4EFO A;  2Y5C A;  4REZ A;  1DOI A;  5CTR C;  4WWP A;  1T6B X;  1XQQ A;  2FCQ A;  1EM7 A;  3DHG C;  3PRE A;  2DZI A;  5BYR A;  3APF A;  5JHB A;  3VUX A;  2K8H A;  1OTR B;  2QSD A;  3EFC A;  3P1M A;  1ZE3 D;  1AW7 A;  2O6V B;  4GDK B;  3ZDT A;  2JZP A;  2FUH B;  3ABV B;  1V81 A;  4JL9 A;  3AUL A;  1I4P A;  3NZU A;  2LGY A;  1R4N I;  3KYC D;  1L6V A;  2PJH A;  2QMT A;  4LDT B;  3N3K B;  3RZF A;  1XF5 L;  3IBE A;  1SE3 A;  3ZDM C;  5D2M B;  4AUQ C;  3NS8 A;  2D10 A;  3T9L A;  1L6U A;  1PGB A;  1R4M B;  4KGR A;  5C2T B;  2OJR A;  2KWV B;  3U52 E;  4X57 B;  2FCM A;  5BYQ A;  1E7U A;  2LXA A;  1F1H A;  1Q0W B;  1TKE A;  5CHV C;  3PO0 A;  4FJY A;  3ZJU A;  4II3 B;  4W9H A;  1QOA A;  3A9J A;  2DZK A;  2NMQ A;  1RWS A;  1SIJ A;  1HZ5 A;  2JVC A;  3IHP C;  2LFI A;  2L32 A;  1JWA D;  3QWZ B;  2KO3 A;  5DCN A;  4BKS D;  2KYW A;  2YLM A;  2L76 A;  3DPD A;  4AQ7 A;  1ROE A;  3V3X A;  1ISN A;  2ZPN A;  5HHD G;  4JWS C;  1J0G A;  4GSW A;  3A4S C;  4KZC A;  5D3D A;  5HKH A;  2VZK D;  4ZRP A;  3UIO B;  2ICI A;  4OZB A;  1IGD A;  3ZIM A;  4NNJ B;  4DHJ D;  1PYW D;  5JXV A;  2W3S A;  1ACC A;  3N30 A;  3SFE B;  2BS4 B;  4LNF A;  1GB1 A;  4NQK E;  4N59 A;  4MEL A;  2KKC A;  3AE1 B;  1RFK A;  2XK5 B;  3VXW A;  1FXI A;  3FIL B;  2QJL A;  1WMH B;  4IWP A;  5AUI A;  4WJN A;  3WIM A;  3NVV A;  1YX6 B;  2IND C;  2WDT B;  3HIZ A;  4M8M A;  1RM6 C;  5C1Z A;  1JWU D;  2DHZ A;  3RNG C;  2MLB A;  4RGN A;  3PVL A;  3QK0 A;  4E3C A;  4TQ1 A;  3VRB B;  2WXL A;  1UWX A;  2KFJ A;  3W1S C;  3U30 A;  2BYF A;  4OVV A;  3TEY A;  1V8C A;  2ON8 A;  1CJE A;  1IP9 A;  4AWJ A;  2JXT A;  2AEH A;  2BWE S;  4A3O A;  1R4M I;  4LJP B;  4NJC A;  3R2I A;  5AEK B;  5AZF A;  1WM3 A;  1MPE A;  2KJ6 A;  3ZNG C;  2WNM A;  3QX1 A;  3HM6 X;  4KGS A;  1S3S G;  3R3M A;  1FCL A;  2EMS A;  3PHX B;  2WXM A;  1KH0 A;  1N6Z A;  4HPL B;  1KM7 A;  5CX3 A;  4YSX B;  1SSN A;  3C0R B;  3FAH A;  3KH0 A;  1ZXI A;  2GMI C;  4RF1 A;  2ASQ A;  1RLF A;  2K5P A;  3NOB A;  4GLS C;  4HLE A;  4KIK A;  1GG3 A;  3CST A;  1I4H A;  3AN1 A;  4WJQ A;  1VZ7 A;  4FXC A;  3Q8F A;  2L83 A;  2N7D A;  2WDQ B;  4GMV A;  4QAY A;  4S17 A;  2LVQ A;  1C79 A;  3B2F A;  2MBB B;  2DZJ A;  3VH4 B;  2RDH A;  2UYZ B;  2W3R A;  2GB1 A;  1EU4 A;  1N60 A;  2PVO D;  1WE7 A;  3MC8 A;  4OHJ A;  4H2A A;  4XE0 A;  1UD7 A;  2O2V A;  2UU7 A;  2KC1 A;  2XNA C;  4K1R B;  1NYQ A;  1P7F A;  2LAS A;  4HJK A;  5FR3 A;  1KLG D;  2AL3 A;  1QOF A;  1E8X A;  1A70 A;  1ZUD 2;  4HPP A;  4WH4 A;  4WQM A;  3DBL B;  1K53 A;  4J3O D;  3HK0 A;  4MEM A;  2BPS A;  4PK1 A;  4YXD B;  1HEZ E;  3ZJT A;  2LJ5 A;  4TQ0 A;  2ACZ B;  1SJE D;  4HVB A;  1GAQ B;  1TIF A;  4US9 A;  1LQB A;  4RM8 A;  2WDR B;  4C4V B;  3SEB A;  1IBX B;  3NVW A;  2V3S A;  2I2Y A;  1VJK A;  1B1Z A;  1XLQ A;  4MM3 A;  2M8S A;  4EOY A;  2OHF A;  2O6V D;  3TIX A;  4OZA A;  4KKJ A;  1WY8 A;  3V6E B;  4C7Y A;  2J7Q B;  2MP2 B;  3AE8 B;  3J9C A;  4LNO A;  4W9G A;  2M0A A;  5DPW A;  5JH5 C;  3ZGZ A;  3AH7 A;  1IYF A;  4XC2 A;  4P1C C;  1Q5W B;  1AN8 A;  4W9I A;  2Z0D B;  5D6J B;  4BKS A;  2VZK B;  4FA6 A;  3T3N A;  4J6I A;  2AQ1 B;  2K6D B;  3WAP A;  5IA7 A;  1T0Q C;  3HUI A;  3MHS D;  1T3Q A;  1ZPS A;  1EF5 A;  5LXI B;  1UNS A;  3N32 A;  3R8B A;  2EKI A;  1BUI C;  3A1Q A;  1S1Q B;  4GIV A;  3DHI C;  4PYZ A;  2V3N A;  2DWQ A;  3T3O A;  4DWF A;  2KN5 A;  3ZYY X;  1TY2 A;  2INC C;  5H8Y E;  1F0Z A;  1PGA A;  2L00 B;  3AXC A;  2MEK A;  3M63 B;  1QOB A;  4AJW A;  3Q6B A;  3UI3 A;  2H88 B;  2IO0 B;  2CR5 A;  2WXF A;  1E8Z A;  4XZ4 A;  2ZW0 A;  4WWO A;  2KQ4 X;  1AWD A;  2KNB A;  2L0F A;  3R7R A;  1F52 A;  2Z59 B;  3HVZ A;  4IUM B;  4YSY B;  1EU3 A;  3R7Q A;  3RZW C;  1OQR A;  1WH3 A;  4DK5 A;  3D32 A;  1XEE A;  1XO3 A;  3ZRF A;  1V1P A;  4URK A;  2KT7 A;  1EO6 A;  1SGH A;  5BO4 B;  3WA0 A;  2DYB A;  1N5X A;  1JQ4 A;  2IBI B;  5J17 A;  2H89 B;  2AQ2 B;  3NHE B;  3DBL I;  3RUL A;  3AU4 A;  1HTQ A;  1E6E B;  3AEA B;  2OOB B;  2PPH A;  2NPT B;  3I63 C;  3BVG A;  3LDZ E;  2IO2 B;  1VCB A;  4YTN B;  2JX5 A;  2KWC A;  2K8B A;  4DXF A;  4XGA B;  1QOG A;  2JRH A;  1E7V A;  1YN3 A;  1ZP0 B;  1KLV A;  2BVC A;  4MAC A;  2K0P A;  1CMX B;  1UF0 A;  4F7Z A;  4GB9 A;  2WXI A;  1YIW A;  1D6E C;  2GBN A;  1ZXH A;  3N20 C;  2A5U A;  3JYU A;  4BOS C;  1GUA B;  2JUO A;  3WAN A;  4R3D A;  3IVF A;  4OVU A;  1T0Y A;  2EMT A;  5LNK 1;  1E0Z A;  4ACF A;  4B9K A;  4NJ7 A;  1WX8 A;  1EWY C;  1IGC A;  2JQR B;  2KD0 A;  2BB6 A;  3BYT B;  4M8N A;  4DDG D;  4DXA B;  3VH3 B;  1WIA A;  3PRP B;  2ZPY A;  2I1K A;  3AE6 B;  2RD0 A;  1BT0 A;  3ZQ4 A;  1C77 A;  3VTU A;  1NEN B;  1RAX A;  2C7N B;  2JYE A;  2GRI A;  3VTV A;  1D5Z C;  1YJI A;  3ZRC A;  4JGH B;  3I9V 1;  1MHH E;  3X23 A;  2J0J A;  2V0G A;  2V4I B;  3Q8B A;  2MJ3 A;  2A4Z A;  2LGD A;  4G3X B;  3H8H A;  2KJR A;  3L16 A;  3KLS X;  1LM8 B;  3URY A;  4F1S A;  2V1Y A;  1E90 A;  4MH8 A;  4JQW C;  2KDE B;  1T5X D;  2BS3 B;  3ZNH B;  2K25 A;  4CQN A;  4NJ6 A;  3AU5 A;  3L4P A;  4MGZ E;  2IDY A;  2B76 B;  2WU2 B;  2KAN A;  2LXC A;  2CHX A;  4N58 A;  1PQS A;  2YEP F;  4IW0 A;  2QIE B;  3OJ4 B;  3DWG C;  3NUH B;  3KW5 B;  5IP4 D;  2MBO A;  4GDL B;  2CHW A;  3QA8 A;  1ZDX A;  1NEK B;  1V80 A;  4OVZ A;  3R66 C;  4NAW B;  4DHZ B;  1WGR A;  1YNT E;  4ZYN A;  5FKA C;  2LHD A;  4IOI E;  2GOW A;  1P1A A;  5G5H A;  3WAM A;  4PS8 A;  3ZXV A;  4YL8 A;  2O6V A;  2BBC A;  4GDK A;  3X0W A;  3ZXR A;  2J42 A;  4MJS B;  3P63 A;  1WJU A;  2X38 A;  1WM2 A;  1YN4 A;  4FAD A;  3PTF C;  1J7C A;  3SHQ A;  2R61 A;  2QCZ A;  4W9K A;  5FK9 C;  5GXG B;  4EEW A;  1WFY A;  4YSZ B;  2REX A;  3HHM A;  2WLB A;  4NAM A;  4TUU A;  2Y5P A;  3U7D A;  2LI5 A;  2LVO A;  2WXQ A;  4I6P A;  4P6V F;  4B0E A;  2L05 A;  4G50 A;  3TUO A;  4MGY E;  4FJV B;  1F9J A;  1TS2 A;  4HJG E;  3V05 A;  1UGM A;  4RF0 A;  3V6C B;  4HK2 A;  4K7U A;  1DGJ A;  4BBN C;  3DBR B;  4WUR A;  3QJZ A;  1IPG A;  4PT5 A;  1P9D U;  2XN9 C;  1E9M A;  1F2R I;  4YWG G;  4HCP B;  2PW9 A;  1RRB A;  4HRO A;  2YEP B;  4GN1 A;  5EE3 A;  2K39 A;  1PFD A;  1V97 A;  2D07 B;  4W9C A;  1JW9 D;  4ZDV A;  3AV8 A;  3M3J A;  4LLG M;  3N1Z C;  3W1Y A;  1OFF A;  1C78 A;  3WCQ A;  3VHT C;  4G0N B;  1QQR A;  3GE3 C;  4KDL B;  3N1X C;  2WXG A;  3VUW A;  3VVW B;  3BVM A;  2MWS B;  3KWV A;  2N9K A;  1F77 A;  2WXN A;  1WYW B;  3DVG X;  1N63 A;  4KX6 B;  3DVN U;  2JF5 A;  3ZLZ A;  3EUB 2;  3ZNZ B;  2CKH B;  2G1E A;  2MBQ A;  2G4S A;  1V86 A;  2YVC A;  1YMH E;  2K9X A;  1EUV B;  1GPX A;  4NZL B;  5DPT A;  4RNA A;  4BBN F;  2JRI B;  4RM9 A;  4BVU C;  1K51 A;  1WXM A;  4JIO U;  1WI0 A;  2LGX A;  2GBK A;  4A8X C;  1BML C;  2OJW A;  2L0T A;  4FJZ A;  1VZ8 A;  2DAJ A;  3AE7 B;  3JVZ X;  4FLH A;  1FNW A;  1CZP A;  3VDZ A;  3CF6 E;  4XWW A;  2GBR A;  3FIL A;  4CO7 A;  3CWI A;  2EEL A;  3H6N A;  3QQ8 B;  3AE9 B;  3DWM A;  2KC2 A;  1VZ6 A;  2MJD A;  1EF1 A;  4KKI A;  3WAO A;  2RPV A;  3E9S A;  1DOY A;  1C4A A;  2KMC A;  1HE8 A;  2QIL A;  3UQB A;  4KV2 A;  1NI3 A;  2KX3 A;  1D4B A; 
#chains in the Genus database with same CATH homology
 4E71 A;  3EFU A;  2V3S A;  1E8W A;  2KX0 A;  4GXB A;  4JLC A;  3PSE B;  1J19 A;  1OEY J;  3CSF A;  1NI2 A;  3KUZ A;  4MJS A;  4CHK A;  4MM3 A;  1XD3 B;  2M8S A;  4MDK E;  4EOY A;  3TIX A;  2O6V D;  2CHZ A;  1WRD B;  4HWI B;  1WY8 A;  3V6E B;  4W9L A;  2J7Q B;  2MP2 B;  2NBW B;  4BOZ B;  3DBR I;  2HE7 A;  4W9G A;  4I6L B;  2DEN B;  2JY6 A;  2WX0 A;  4ZRJ A;  5DPW A;  5JH5 C;  1MG8 A;  2KTF A;  4HXD A;  4K81 A;  2AWT A;  5AZH A;  1IYF A;  4XC2 A;  3ECI A;  1Q5W B;  3A9J B;  4PS7 A;  3U8Z A;  2R2Q A;  2DYO A;  3PGE A;  1WGG A;  3SDL C;  3IG3 A;  2L8J A;  3H1U A;  2RGF A;  3IFW B;  3QC8 B;  4W9I A;  4N9F 4;  2C9W B;  1WR6 E;  2GBM A;  4ANW A;  4IWQ A;  2Z0D B;  2MA9 B;  5D6J B;  2Z0E B;  3ZW3 A;  4BKS A;  4FA6 A;  1K8R B;  1V49 A;  4J6I A;  2EKE C;  4IG7 B;  2RR9 A;  2K6D B;  3WAP A;  4EZL A;  4W9F A;  5LXH A;  3PLU A;  1M94 A;  4DDI D;  1P0R A;  3MHS D;  4IWO A;  5IA7 A;  2NR2 A;  4EKU A;  5DPS A;  2BYV E;  3ZUN A;  5FR6 A;  1EF5 A;  5LXI B;  2KLG A;  3N32 A;  3JSV A;  4EUT A;  1GNU A;  2JT4 B;  4NY0 A;  3A1Q A;  5LLI A;  2MBH A;  1S1Q B;  1NBF C;  2G45 B;  3ZO5 B;  4IM2 A;  4GIV A;  1Y8R C;  3RT3 B;  2M4N A;  3Q3F A;  4PYZ A;  4W9E A;  3UIN B;  3TMP B;  3EC8 A;  4KDI C;  4B6W A;  4G11 A;  2KN5 A;  3BIN A;  4DWF A;  5EDS A;  2LRU A;  3B08 A;  3VQI A;  3WAL A;  2RSU A;  4A3O A;  4HCN B;  2L00 B;  3AXC A;  3DVN V;  1TZ1 A;  4ANV A;  3NY5 A;  2KTR A;  2NCN A;  2BKR B;  3M63 B;  2AYO B;  2BF8 B;  4AJW A;  2UWQ A;  2ZEQ A;  2ZVN A;  2FCN A;  3KUC B;  2MBE A;  3ONS A;  3PPA A;  4FN2 A;  3SU8 X;  3Q3J A;  2IO0 B;  5E6O A;  1YD8 U;  2CR5 A;  4HDQ A;  1E8Z A;  1RFA A;  3V60 A;  4XZ4 A;  3QHT A;  4WWO A;  3VTW A;  2KNB A;  5IAA C;  2L0F A;  3R7R A;  2Z59 B;  3ENE A;  2M1M A;  4IUM B;  2KLC A;  2ZNV B;  4BFR A;  1Q1O A;  4FUL A;  4TV3 A;  3R7Q A;  3KVF B;  1A5R A;  3RZW C;  3A9K B;  1WH3 A;  2MRP A;  2C60 A;  1FXT B;  3D32 A;  4DHZ E;  2M0X A;  3PRZ A;  4DK5 A;  3ZRF A;  2N4F A;  4XX5 A;  4GOC A;  3UQA A;  4URK A;  4EFO A;  3RCZ A;  1EO6 A;  2K1F A;  2C7M B;  1SGH A;  5BO4 B;  3WA0 A;  5CTR C;  2DYB A;  1WF9 A;  4WWP A;  2JPH A;  2JZ3 B;  1XQQ A;  3EHV A;  2XEW A;  2FCQ A;  2IBI B;  2FCS A;  3VUY A;  5J17 A;  2XK5 A;  3APC A;  2XBB C;  3ALB A;  2KDI A;  3PRE A;  5CHW A;  2DZI A;  3TJP A;  3NHE B;  2W9N A;  1WMH A;  3APF A;  3DBL I;  4PYU A;  3RUL A;  5JHB A;  5JZE B;  3AU4 A;  4RMA A;  3VUX A;  2K8H A;  1XT9 B;  1WGH A;  2C7H A;  1OTR B;  4LCD E;  3I3T B;  2IYD B;  2O6V B;  2J0K A;  4GDK B;  2OOB B;  2PPH A;  1L7Y A;  1V5T A;  2I1J A;  2NPT B;  3LDZ E;  2IO2 B;  3M62 B;  4KVG B;  1VCB A;  3ZDT A;  4BKG A;  4I6N B;  2FUH B;  1V81 A;  4JL9 A;  2KWC A;  2HTH A;  3AUL A;  3PT2 B;  2K8B A;  1I42 A;  3APD A;  2LGY A;  3NZU A;  2LWP A;  1V2Y A;  2JRH A;  1E7V A;  4GU2 A;  1R4N I;  1KLV A;  3KYC D;  1OGW A;  1V9J A;  4K7S A;  3OLM D;  3OAW A;  4IC7 B;  4LJO B;  2PJH A;  2KFK B;  4WJO A;  4PS3 A;  2BWF A;  2WYQ A;  1CMX B;  4F7Z A;  4GB9 A;  1P3Q U;  4LDT B;  3N3K B;  3GZN I;  1YIW A;  3H7P B;  4KSK C;  3W1S A;  3RZF A;  3IBE A;  2GBN A;  1Z2M A;  1LXD A;  3ZDM C;  5D2M B;  4AUQ C;  3NS8 A;  2A5U A;  2D10 A;  3TCA A;  4ZRK A;  3JYU A;  4BOS C;  2PE9 A;  3T9L A;  1GUA B;  2JUO A;  3L08 A;  3K9O B;  3WAN A;  2NBU A;  3K9P B;  3IVF A;  1H4R A;  3DBH I;  2OJR A;  2QHO A;  2KWV B;  3VFK A;  4OVU A;  1T0Y A;  2EMT A;  4X57 B;  1UBQ A;  2FCM A;  1H8C A;  1E7U A;  2AL6 A;  2MP2 A;  2LXA A;  1Q0W B;  4B9K A;  4ASW C;  3AI5 A;  5CHV C;  4NJ7 A;  1WX8 A;  1ZW7 A;  3B0A A;  4FJY A;  3A33 B;  1KJT A;  1TTN A;  2KD0 A;  4II3 B;  4W9H A;  3A9J A;  4AJY B;  2G4D B;  1TGZ B;  4M8N A;  2DZK A;  2IO1 B;  4DDG D;  4K7W A;  4DXA B;  4EZK A;  2ZCC A;  3TL5 A;  3VH3 B;  2JWZ A;  1WIA A;  4MGK E;  2JVC A;  2KVR A;  3IHP C;  3JSV B;  4KIK B;  3PRP B;  2ZPY A;  3RUI B;  2I1K A;  1YJ1 A;  2B3A A;  1UEL A;  2RD0 A;  3ML8 A;  3SD5 A;  3OJ3 A;  1BT0 A;  2KO3 A;  2MSE D;  3QWZ B;  1WJ4 A;  5DCN A;  3PV1 A;  3VTU A;  4BKS D;  1WX9 A;  1RAX A;  2YLM A;  4FHK A;  5E6P A;  2L76 A;  2C7N B;  2N1V A;  1L2N A;  3DPD A;  1WZ0 A;  2N1W A;  3VTV A;  3L0W B;  4A3P A;  1ISN A;  1AAR A;  1YQB A;  3QAR A;  3ZRC A;  4JGH B;  2ZPN A;  4A20 A;  3X23 A;  1J0G A;  2J0J A;  3DQV A;  4GSW A;  3A4S C;  4WAA A;  4KZC A;  4W9D A;  4HPM B;  5HKH A;  4E74 A;  2WWZ A;  3UGB B;  5G2N A;  3DOW A;  2A4Z A;  5C23 A;  2LGD A;  3UIO B;  4G3X B;  2KDF B;  4MSM B;  2KJR A;  3L16 A;  2JXX A;  1V5O A;  1LM8 B;  4WJP A;  3ZTD A;  3ZIM A;  1TBE A;  4NNJ B;  4DHJ D;  1OEY A;  3CMM B;  4F1S A;  1ZGU B;  2V1Y A;  1ZKH A;  1WZ3 A;  3ZVV A;  1E90 A;  1WGD A;  5DPR A;  3A4R A;  1UH6 A;  4JQW C;  2KDE B;  2D11 A;  4ZRI A;  3ZNH B;  3P2B A;  3N30 A;  2K25 A;  2KMA A;  3M95 A;  1WXV A;  2O2V B;  4NJ6 A;  3AU5 A;  4F8C B;  4NQK E;  4MGZ E;  3LJ3 A;  4MEL A;  2GBJ A;  2LUE A;  2KKC A;  2KAN A;  1WXA A;  2LXC A;  1E5W A;  3A9K A;  4MH0 E;  2N9P C;  2XK5 B;  3VXW A;  2CHX A;  3GOE A;  1PQS A;  3QCA A;  3V61 A;  4W9J A;  3O65 B;  1WMH B;  4IW0 A;  4IWP A;  4CYE A;  4WJN A;  3WIM A;  3OJ4 B;  3VAW A;  1YX6 B;  4M0W B;  4BKT A;  3HM3 A;  5KHQ A;  3QIJ A;  4B95 A;  3KW5 B;  2LVP A;  1D3Z A;  2WDT B;  2ZZP B;  2MBO A;  3HIZ A;  4M8M A;  4GDL B;  2MCN B;  2LD9 A;  3KYD D;  5CHF A;  3DCG A;  2CHW A;  3ML9 A;  1OQY A;  5C1Z A;  2DHZ A;  3QA8 A;  1V80 A;  2KWU B;  2DZM A;  3R66 C;  4NAW B;  2MLB A;  4DHZ B;  1WGR A;  3RD2 A;  4ZYN A;  1WGY A;  2R2O A;  5L95 C;  1GC7 A;  5J18 A;  3PVL A;  2GOW A;  1P1A A;  3S2A A;  3WAM A;  4ICV A;  3QK0 A;  4E3C A;  2D2Q A;  2K6Q A;  4TQ1 A;  4PS8 A;  2J0M A;  4YL8 A;  2LZ6 A;  2O6V A;  4GDK A;  3X0W A;  4KZ0 A;  2KFJ A;  3W1S C;  4MJS B;  3U30 A;  1WJU A;  5JHA A;  1WM2 A;  2KDB A;  2BYF A;  2PEA A;  4FAD A;  1WJN A;  3PTF C;  1C3T A;  4OVV A;  3SHQ A;  4W9K A;  4EEW A;  5J2R A;  5KHO A;  1WFY A;  2KQS A;  2REX A;  3L17 A;  3HHM A;  4P7I A;  1IP9 A;  4AWJ A;  1LFD A;  4HDO A;  2AEH A;  2BWE S;  2KFK A;  4TUU A;  1R4M I;  2D3G A;  4LJP B;  2LI5 A;  2FAZ A;  2LVO A;  4I6P A;  3PRM B;  3U7D A;  2L05 A;  1Z5S B;  3L10 B;  2IO3 B;  1GJZ A;  4G50 A;  3H7P A;  4MGY E;  2KOX A;  4NPN A;  5AEK B;  5AZF A;  1WM3 A;  1F9J A;  4FJV B;  2BKF A;  2FID A;  1UGM A;  2KJ6 A;  3ZNG C;  3V6C B;  2MQJ A;  3QX1 A;  4HK2 A;  3PHW B;  3HM6 X;  1VD2 A;  1S3S G;  1WJ6 A;  4K7U A;  3T8M A;  1E8Y A;  3R3M A;  4BBN C;  2EMS A;  2G3Q B;  2FNJ B;  3PHX B;  3QJZ A;  1IPG A;  1P9D U;  4IM3 A;  4HCP B;  4HPL B;  1KM7 A;  5CX3 A;  1RRB A;  2KXJ A;  4GN1 A;  3C0R B;  1SE9 A;  4LDT D;  3A1Q B;  5AZG A;  3PS6 A;  3KH0 A;  4WQO B;  3DVG Y;  2MX2 A;  2PE6 B;  2GMI C;  2K8C A;  3ZKJ C;  4II2 B;  1G6J A;  2K39 A;  2ASQ A;  1RLF A;  2D07 B;  4W9C A;  4GGQ A;  1C1Y B;  4ZDV A;  3NOB A;  5E6N A;  3PLV A;  1KOT A;  4HLE A;  3M3J A;  2RPQ A;  5G55 A;  4DHJ B;  2BGF A;  4KIK A;  3W1Y A;  3JW0 X;  2KTR B;  1GG3 A;  1WXS A;  2KQ7 A;  1WR1 A;  3CST A;  3B1L X;  2BYE A;  2M17 A;  4KSL C;  3VHT C;  4G0N B;  2WX1 A;  3UF8 A;  4KDL B;  4WJQ A;  1WE6 A;  3VUW A;  3TBL D;  3VVW B;  2DAF A;  2NS5 A;  1QZE A;  2ZJD A;  2MWS B;  2N7D A;  5GMV A;  2IY0 B;  3DBS A;  2VRR B;  4TKN A;  3UIP B;  1WYW B;  3DVG X;  4GMV A;  3DVN U;  2JF5 A;  3MTN B;  1YX5 B;  1V6E A;  2IY1 B;  3H7S A;  3ZLZ A;  3RYT A;  1J8C A;  2C5L C;  3EEC A;  5D94 A;  2CKH B;  3ZNZ B;  2MBQ A;  2G4S A;  1V86 A;  2LVQ A;  2YVC A;  2KHW B;  2KK8 A;  5TR5 A;  2MBB B;  2DZJ A;  2DYM A;  2IZV B;  1EUV B;  1SIF A;  2ZNV C;  3VH4 B;  5DPT A;  5L83 A;  2UYZ B;  3NZS A;  4BBN F;  2JRI B;  4RM9 A;  2NVU I;  1U4A A;  2CU1 A;  4BVU C;  3ZTC A;  2FIF A;  1WE7 A;  2V4L A;  1WXM A;  4JIO U;  1WI0 A;  2DX5 B;  2MW5 A;  2LGX A;  1X1M A;  2GBK A;  2HJ8 A;  2L3Z A;  4FHJ A;  2KZR A;  2N9E B;  3QAQ A;  4NQL B;  3ZNI D;  2L0T A;  2N7E A;  4FJZ A;  3V62 A;  1GC6 A;  2DAJ A;  1UD7 A;  2O2V A;  1UZX B;  2KC1 A;  4K1R B;  3JVZ X;  4IM0 A;  4FLH A;  2LAS A;  2LRW A;  4HJK A;  3VDZ A;  3CF6 E;  4MGI E;  4ANU A;  2AL3 A;  4EZJ A;  2GBR A;  1E8X A;  3L54 A;  4FBJ B;  4CO7 A;  2NBV B;  1WX7 A;  2L7R A;  2Y5B B;  2HD5 B;  3MJW A;  3H6N A;  3HK0 A;  3PZD A;  3QQ8 B;  2BPS A;  2ZCB A;  4MEM A;  4ANX A;  1P98 A;  2CS4 A;  2KJH B;  4GDL A;  4AP4 C;  4DBG A;  1NDD A;  2KC2 A;  2LJ5 A;  4TQ0 A;  1EF1 A;  2NPT A;  2JZZ A;  3WAO A;  4AOF A;  4NAW A;  4HVB A;  3KUD B;  4MSQ B;  3H9D A;  3L13 A;  1LQB A;  1UBI A;  4ICU A;  2N9X A;  2KMC A;  1HE8 A;  4RM8 A;  5D7G A;  3UQB A;  4KV2 A;  2KX3 A;  2ZVO A;  3BY4 B;  1I35 A;  4WWN A;  1JRU A;  3DDC B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...