4ZDVA

Crystal structure of lc3 in complex with fam134b lir
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
126
structure length
126
Chain Sequence
DDFELLDGPSDRPFKQRRSFADRCKEVQQIRDQHPSKIPVIIERYKGEKQLPVLDKTKFLVPDHVNMSELVKIIRRRLQLNPTQAFFLLVNQHSMVSVSTPIADIYEQEKDEDGFLYMVYASQETF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Protein transport
molecule keywords Microtubule-associated proteins 1A/1B light chain 3A
publication title Regulation of endoplasmic reticulum turnover by selective autophagy.
pubmed doi rcsb
source organism Homo sapiens
total genus 35
structure length 126
sequence length 126
ec nomenclature
pdb deposition date 2015-04-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02991 Atg8 Autophagy protein Atg8 ubiquitin like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 4zdvA00
2J0KA 4JGHB 2VRRB 3APCA 3ZTCA 4A3OA 1UH6A 2V1YA 4JLCA 2LGXA 2O6VB 1J0GA 2NPTB 4NAWA 2KLCA 2DZMA 1NI2A 2D07B 4X57B 2N1WA 3IBEA 5J2RA 5AEKB 1S3SG 3DBHI 1WJ6A 2BF8B 2D2QA 3L16A 4NJ6A 5HKHA 1WXVA 3WAPA 4KV2A 2LRUA 2KQSA 2L76A 3GZNI 4FA6A 3JSVB 2PE6B 4HJKA 1E90A 4W9GA 4MGYE 4W9FA 2GBKA 4BFRA 3DDCB 4MDKE 1ISNA 3V60A 2WDTB 4AP4C 2C7HA 2KXJA 2MW5A 3EC8A 4IM3A 3VTUA 2NVUI 2KVRA 3QHTA 2MRPA 1H4RA 2PEAA 3KUZA 5DPRA 2KLGA 3VTVA 4A20A 4AOFA 3OAWA 2NS5A 3IVFA 4PYUA 2K6DB 4BOZB 5CX3A 3L54A 4NJ7A 2D10A 3ZIMA 2BYEA 2CHWA 4DHZE 1WX7A 1WYWB 3L08A 3UINB 2PPHA 4IWOA 1EF1A 2IO0B 2MBEA 2UYZB 3M62B 3ZW3A 2RR9A 3K9PB 2K8HA 2EKEC 4N9F4 3AI5A 2MX2A 5AZGA 4NY0A 3K9OB 2MA9B 4F1SA 4DDGD 1GJZA 3ZTDA 5CTRC 3V6CB 2KMCA 1V81A 3IHPC 4EZJA 1WZ3A 1J19A 1P98A 1WH3A 3H9DA 1Q1OA 3ECIA 4GDLB 4MGIE 1A5RA 1G6JA 4HCPB 2ZVOA 2PE9A 5BO4B 4HWIB 5DPSA 4B9KA 2L0TA 2LXCA 3Q3FA 3A4RA 4EZKA 1I35A 3ZNGC 2D3GA 2FCMA 3QC8B 1WGHA 2FCSA 3APDA 5J18A 1WJ4A 2KDBA 1WFYA 1U4AA 4EZLA 4MM3A 4ZYNA 5JHBA 3ZO5B 4MH0E 2ZNVB 1V86A 2G4SA 3VHTC 1CMXB 3JSVA 2CS4A 2GMIC 3B0AA 4DHJD 1WXAA 1YIWA 4II2B 3SD5A 4BVUC 2N1VA 2JUOA 3A1QA 3D32A 3ONSA 4WJPA 1WE7A 2GOWA 2KTRA 4GB9A 2N9EB 4OVVA 2EMTA 1OEYA 1P1AA 3VUWA 1RFAA 2FCQA 3WAMA 1F9JA 1J8CA 2LZ6A 2KO3A 1GC7A 3I3TB 4EEWA 2BPSA 2JZ3B 1E8WA 4BBNC 1R4NI 1V6EA 1WJNA 4IWPA 2BWFA 4KZCA 4MGZE 3HM6X 2JRHA 2WX1A 3KH0A 3L13A 2ZCCA 4MJSB 4DDID 4F7ZA 4FHJA 1V9JA 4GMVA 2MBHA 4ZRIA 4G3XB 5DCNA 5AZFA 3ZUNA 3RYTA 3NS8A 4BKGA 2J0MA 4W9CA 3ZDMC 4ANWA 4KIKA 4HPLB 3WAOA 4FBJB 3UF8A 3PREA 3RD2A 2KKCA 4ANUA 4DXAB 3L0WB 4M0WB 1C1YB 3VUXA 1YJ1A 1ZW7A 2N7DA 2WX0A 3O65B 5AZHA 1WE6A 3B1LX 1VD2A 4W9LA 1L7YA 1WGGA 1WIAA 2DYMA 2NCNA 4HCNB 3H7PB 3M3JA 3PHWB 1E7VA 2UWQA 3DVNU 2GBJA 2M8SA 4E3CA 3H6NA 1TGZB 2LVQA 3R7QA 1LFDA 3OJ4B 2MLBA 1QZEA 1FXTB 3V61A 4HVBA 2KANA 2RD0A 2O2VA 3TMPB 3VH4B 3S2AA 3V6EB 1Q0WB 3N3KB 5JH5C 1LQBA 2K6QA 1GNUA 3AU4A 5G2NA 4WJQA 3ALBA 2RSUA 2MBQA 4LCDE 3ZVVA 4I6PA 4B95A 3RZFA 2WWZA 4E74A 3W1SC 4NNJB 1KLVA 1V49A 4PS7A 3TJPA 2CR5A 2KC1A 3GOEA 1Z5SB 4URKA 2CKHB 2MP2A 4NQLB 4W9IA 3IFWB 5CHWA 1NDDA 4KSKC 4FJYA 4GIVA 4J6IA 4LDTB 1WXSA 3EHVA 1WXMA 1GC6A 4TUUA 4FJZA 4GN1A 4M8NA 4II3B 2FIDA 2I1KA 3KUCB 5E6PA 1E8XA 4DWFA 2KX3A 2GBNA 1YX6B 4OVUA 4AUQC 3IG3A 1LXDA 3VAWA 1HE8A 1K8RB 3T9LA 3ENEA 3MHSD 2N9XA 1KOTA 2W9NA 2DX5B 4PS3A 1UBQA 2KMAA 4EFOA 5C23A 2A4ZA 3M63B 1UGMA 3LDZE 2IY1B 3QCAA 2C7NB 2L0FA 3DOWA 1WMHA 2LVPA 2J7QB 2KNBA 2B3AA 3AU5A 3H1UA 2HTHA 3QJZA 5D6JB 4LJPB 1SIFA 1WR1A 2CHZA 2ZPYA 2NBWB 5KHOA 2HE7A 5GMVA 5E6NA 2MWSB 1ZKHA 3APFA 5J17A 1TTNA 3QX1A 2LASA 4WJNA 2KJRA 4W9JA 3PHXB 1KJTA 1WY8A 3DVNV 3JVZX 4IC7B 4JQWC 3WA0A 2LJ5A 1E8YA 4HDQA 4BKSA 3A9JA 4K1RB 3M95A 2JVCA 2YVCA 3X23A 4ICUA 2Z59B 2HD5B 3U30A 4WQOB 4W9DA 4NQKE 4RM9A 2O6VA 2NPTA 4IG7B 5L95C 4JIOU 2NR2A 3P2BA 1YD8U 3A33B 2V3SA 4ICVA 4TV3A 2KK8A 2KFKB 2FIFA 4G50A 4PS8A 2XK5B 4HLEA 2JT4B 3PT2B 5D7GA 2GBMA 4EOYA 5DPTA 3PSEB 2V4LA 3L17A 4GDKB 4HDOA 2N4FA 2KFJA 4KZ0A 1RRBA 2DAFA 2LGDA 3R66C 3X0WA 2OJRA 2J0JA 1VCBA 4HXDA 3NY5A 1V2YA 1WF9A 2LI5A 3RUIB 3NZUA 2DZIA 3ZRCA 1LM8B 5L83A 4ZRKA 2L8JA 2JPHA 2PJHA 3RT3B 3UQBA 3QK0A 1NBFC 3VVWB 2FCNA 1YX5B 4NAWB 2KJ6A 3H7SA 3PVLA 1JRUA 3SU8X 2LUEA 2IYDB 4IW0A 4AJWA 4FULA 1WI0A 3Q3JA 3PRMB 5TR5A 2D11A 1OEYJ 1Q5WB 3ML9A 2DYBA 3N30A 3W1YA 4DBGA 3SDLC 1WM2A 4HPMB 2C60A 2DHZA 4WWOA 2G4DB 2DENB 2EMSA 3VXWA 2BYFA 4HK2A 4MGKE 2ZPNA 4F8CB 4W9HA 2AWTA 2MBBB 2ASQA 1Y8RC 2LRWA 4EKUA 1OTRB 3HK0A 2KDEB 4CHKA 2C7MB 2K39A 4ANVA 5DPWA 2NBUA 2JZZA 4GDLA 4TKNA 2KC2A 3CSFA 4FLHA 3CF6E 4ZDVA 2CHXA 3DVGX 1I42A 3VDZA 3EFUA 1UBIA 4WAAA 4TQ0A 4PYZA 1S1QB 1EO6A 2JY6A 3A9KB 1WX9A 3UIOB 4BKSD 4K7UA 2IY0B 1PQSA 3N32A 4KDIC 5D94A 3AXCA 2QHOA 3ZNID 3CMMB 5LXIB 2O6VD 2XK5A 3MTNB 3ZDTA 1SGHA 2G3QB 2L05A 4GDKA 2KD0A 3QWZB 4GOCA 3VUYA 5JHAA 2RGFA 4BOSC 1XQQA 3PS6A 4JL9A 2A5UA 3ZLZA 2BKRB 2I1JA 2DYOA 3AULA 2ZCBA 3QQ8B 4AJYB 3B08A 3L10B 5C1ZA 5IA7A 1XD3B 3BINA 3DVGY 2N9PC 3WIMA 1EUVB 3MJWA 4LDTD 4KVGB 4XC2A 4MELA 4BBNF 2AYOB 1RLFA 2KJHB 3NOBA 4WWNA 4DHZB 2ZNVC 3HM3A 4MJSA 2IO2B 2R2QA 5JZEB 4I6LB 1EF5A 1M94A 3WANA 3UGBB 4W9EA 4ANXA 3A4SC 2BYVE 3PTFC 3VFKA 5EDSA 2KX0A 1OGWA 2JRIB 1T0YA 2L00B 1WJUA 1WR6E 3A1QB 4FJVB 1SE9A 2OOBB 4E71A 4WWPA 2AL3A 2KTRB 3KUDB 2KN5A 1WGYA 1WM3A 2KTFA 2M4NA 1IP9A 2IO1B 3R3MA 2CU1A 2LXAA 4K81A 3R7RA 3LJ3A 2K8BA 2K1FA 3OLMD 2YLMA 3H7PA 3DCGA 3PRPB 4YL8A 3QARA 3TIXA 4ASWC 4AWJA 2BKFA 1AARA 2AEHA 2ZEQA 3ZKJC 1E7UA 2KDIA 3JW0X 3U8ZA 1TZ1A 3ZNHB 4DK5A 3TBLD 1OQYA 2FUHB 2RPQA 1WGDA 2ZJDA 3CSTA 3A9KA 3VQIA 2KWCA 2C9WB 2NBVB 2DZKA 2KWUB 1IPGA 4KIKB 2K8CA 5CHVC 1H8CA 2KZRA 3TCAA 2REXA 3QIJA 5LLIA 4K7SA 2KHWB 1KM7A 4IM0A 1BT0A 1XT9B 3PRZA 3DPDA 3DQVA 3DBSA 3HIZA 4FHKA 2MSED 2L7RA 2DAJA 2IBIB 4MSQB 3ZNZB 3KYDD 2DZJA 1WRDB 3TL5A 2AL6A 2IZVB 2ZVNA 4EUTA 1TBEA 1GUAB 4TQ1A 4IWQA 3KYCD 4M8MA 3VTWA 1L2NA 1WZ0A 2HJ8A 1P3QU 2M1MA 1WGRA 1ZGUB 2R2OA 3KW5B 2Y5BB 4GGQA 3V62A 3U7DA 2LGYA 3QAQA 2O2VB 1E8ZA 2L3ZA 4XX5A 2KWVB 4CYEA 1GG3A 1E5WA 3RZWC 5FR6A 3SHQA 1UZXB 3HHMA 4DHJB 4CO7A 1UD7A 3ZRFA 2XBBC 2KDFB 1V80A 4MEMA 3WALA 4P7IA 1C3TA 3PLVA 3OJ3A 4KDLB 4GU2A 2WYQA 4WJOA 1YQBA 2XEWA 2KQ7A 1V5TA 3KVFB 1R4MI 2MP2B 2LWPA 3PPAA 2GBRA 2JF5A 2K25A 4I6NB 2Z0EB 2MCNB 4IM2A 1MG8A 4G11A 4GSWA 2M0XA 4G0NB 4K7WA 2BWES 1UELA 5E6OA 5G55A 4FN2A 3RULA 2ZZPB 4RM8A 4XZ4A 3NZSA 1Z2MA 2IO3B 3VH3B 3QA8A 4ZRJA 1D3ZA 4MSMB 1V5OA 1X1MA 3DBRI 3BY4B 5KHQA 4IUMB 3PZDA 2MQJA 4B6WA 2FAZA 1P0RA 2BGFA 2C5LC 2G45B 2LD9A 4FADA 4LJOB 3RCZA 2MBOA 1WMHB 2LVOA 2M17A 4BKTA 1P9DU 5D2MB 2JWZA 2KOXA 4A3PA 2KFKA 2Z0DB 3ML8A 4RMAA 3JYUA 3DBLI 4GXBA 2JXXA 3T8MA 3W1SA 5LXHA 3NHEB 2N7EA 3EECA 3PLUA 4KSLC 5IAAC 3UIPB 3UQAA 1IYFA 3PGEA 1RAXA 1WX8A 3C0RB 2FNJB 5CHFA 4W9KA 3A9JB 4NPNA 3PV1A
chains in the Genus database with same CATH superfamily
2J0KA 3ZTCA 4AQ7A 1UH6A 4P1CC 2O6VB 1ZP0B 4NAWA 2KLCA 4GLSC 1QT9A 2RDBC 3DBHI 1WJ6A 4RNAA 1N61A 1TS4A 3JSVB 3AE1B 1VR9A 4YSZB 4IOIE 2VZKB 4MGYE 3DDCB 4AP4C 3RNCC 3EC8A 2M19A 2W54A 1H4RA 2WXMA 4OZCA 2PEAA 1MVKA 1C76A 1PUTA 3KUZA 1L4DB 3WCQA 4BOZB 2D10A 2BYEA 1N60A 3RNEC 4IWOA 2MBEA 3ZW3A 2PW9A 2EKEC 2MX2A 3DHGC 1TZOA 2PLPA 1R4NB 2MA9B 3AV8A 3R2TA 3IAM1 3RN9C 3IHPC 4MGIE 1WH3A 1KLUD 1XCQL 5BO4B 4HWIB 4O1NA 2L0TA 2LXCA 3W5VB 3FAHA 1I35A 2D3GA 1WGHA 5J18A 2MEKA 2WNMA 3RNAC 4MH0E 2ZNVB 1V86A 2RDHA 2PMVA 4DHJD 3JSVA 2CS4A 1WXAA 4II2B 2BS3B 2JUOA 4GB9A 1TKGA 2N9EB 4KKIA 1CZPA 1RFAA 2FCQA 1F9JA 1J8CA 2LZ6A 3HVZA 3N1YC 1N63A 3I3TB 2WQYB 4EEWA 2JZ3B 1R4NI 3NZ3A 3ZJUA 3AE9B 2WX1A 2ZCCA 4MJSB 4G3XB 5DCNA 4HPPA 5AZFA 1HEZE 4BKGA 3VR9B 3ZDMC 4ANWA 4KIKA 4MT5A 1ESFA 4ANUA 4YSYB 1MJDA 1RFKA 4M0WB 3VUXA 2N7DA 1QKZA 2DYMA 3H7PB 3PHWB 4HRSA 3DVNU 2M8SA 4E3CA 3AEAB 1QZEA 3NUHB 1SSNA 3V61A 4XWWA 1ZXHA 3VH4B 4C4VB 3N3KB 2J53A 1LQBA 2K6QA 4WJQA 3U4EG 1YJIA 1GAQB 3ABVB 4E74A 1P7EA 1LO5D 2WXQA 1T5XD 2MP2A 4NQLB 4W9IA 1NENB 1MHXA 3HVDA 4FJZA 3KUCB 2X38A 5E6PA 4DWFA 2KX3A 2GBNA 1YX6B 4AUQC 4A55A 1HE8A 1K8RB 1YN4A 5LNK1 1XLQA 3AB5A 1I4HA 2A4ZA 2K5PA 2IY1B 2L0FA 1EU3A 2KNBA 2B3AA 3AU5A 2E3TA 1C4CA 4M02A 2WGSA 1ZKHA 3QX1A 4JQWC 3AE7B 2QSDA 2LJ5A 4HDQA 2KAJA 1B9RA 2JVCA 4W9DA 1UUPA 2NPTA 2JYTA 4KX6B 2MH7A 4ICVA 4TV3A 1VZ6A 1XLOA 2KK8A 3FILB 2KFKB 4HLEA 3HUIA 1I7HA 4C80A 2V4LA 3L17A 1JWAD 5HI1A 4KZ0A 1RRBA 2BVCA 4HXDA 1V2YA 1SJHD 3ZRCA 2DZIA 4ZRKA 2L8JA 1KLGD 1YX5B 3PVLA 3ZXVA 3SU8X 2LUEA 2V3PA 1TJEA 3R2IA 1ET9A 2LFIA 1E10A 4ARIA 1WI0A 2D11A 4LK0M 2G1EA 5TSSA 1Q5WB 2H88B 1NI3A 2CJNA 4HPMB 2C60A 4LTUA 4XGAB 1F77A 4A90A 5BMGA 4HK2A 1JMLA 4HROA 4EKUA 4KGSA 4P6VF 1UWMA 3CSFA 3CF6E 3NG0A 2CHXA 1N6ZA 4FXCA 4WAAA 3RFZB 3UIOB 3A9KB 1WX9A 1K52A 1PQSA 3N32A 5BYSA 2QHOA 1OQRA 3MTNB 1SGHA 1WGKA 1SE3A 2KD0A 4GOCA 2RMMA 1WRIA 1XQQA 4JL9A 4JWUC 3ZLZA 1VDVA 1SIJA 3QQ8B 4AJYB 3B08A 4RF1A 1XD3B 2KACA 2K9XA 3GB1A 4MELA 2AYOB 1J7AA 2KJHB 4MM3B 2PIAA 1T3QA 4I6LB 1M94A 4ANXA 1ENFA 3HRDD 2L00B 3A1QB 1SE9A 2OOBB 1PFDA 1RYJA 1WM3A 2K1FA 1IUEA 3RI7C 5G5GA 3DCGA 3TIXA 4ASWC 3RNBC 4QAYA 2KDIA 1TZ1A 1QF6A 3ZNHB 2DNFA 2I2YA 1QLBB 1YOVB 1FXAA 3A9KA 1QOFA 1R4MB 3CIRB 2NBVB 1GPXA 2KWUB 1IPGA 2X8XX 2KHWB 1I4PA 1BT0A 1E0ZA 3PRZA 4XYCA 2MSED 3ZNZB 4RGNA 2GRIA 4EUTA 3NS1A 4TQ1A 3KYCD 1WZ0A 1UNSA 2M1MA 2R2OA 4GGQA 2Y5BB 3U7DA 2LGYA 3QAQA 4ZHPA 4XX5A 2KWVB 1GG3A 1FPYA 3TSSA 1UZXB 3HHMA 2BBCA 1ET6A 2XBBC 1V80A 3PLVA 3N9YC 4KDLB 1QOBA 2BQQA 1YQBA 4P16A 1V5TA 3KVFB 1R4MI 2LWPA 2WXJA 2MCNB 4IM2A 1MG8A 4G11A 2M0XA 4G0NB 4K7WA 1ZE3D 4XZ4A 4XDDA 2IGDA 4PT5A 3QA8A 5BYQA 1X1MA 3DBRI 5KHQA 3GZNB 5T8IA 4B6WA 4NJCA 2C5LC 1FRRA 2M17A 1P9DU 5D2MB 3ML8A 3JYUA 1IGCA 4GXBA 2LEKA 2N7EA 1IYFA 4KSLC 4W9KA 1V97A 3A9JB 4NPNA 3J9CA 4JGHB 3C19A 2VRRB 3APCA 2CU3A 2LGXA 1J0GA 1SEBD 2D07B 4X57B 3C8YA 3IBEA 1MPEA 4LNNA 3WAPA 1ROEA 3GZNI 4FA6A 3Q8BA 4W9GA 2JZPA 1YN5A 3PZ8A 4MDKE 3SFDB 1ISNA 2WDTB 2C7HA 4RGMA 4IM3A 2M56B 2NVUI 2MRPA 1T0RC 3EA6A 1UF0A 4L1BA 4A20A 2G9HD 3L54A 5I4DA 1MHHE 2K3UA 3UINB 2PPHA 1EF1A 4N9F4 2LHDA 5AZGA 3BWUD 3K9OB 4DDGD 1GJZA 2KMCA 4BZAA 1WZ3A 3H9DA 1Q1OA 4OHJA 3AEFB 3Q3FA 3IXSA 3QC8B 3APDA 1WJ4A 3VR8B 1U4AA 3ZO5B 1TS2A 3VHTC 2GMIC 4A8XC 2N1VA 3B2FA 3UI3A 1JWUD 3D32A 3ONSA 2V0GA 4IKGA 2ONQA 2KTRA 2NTTA 1GB4A 1Y56A 3KWVA 1GC7A 1WXQA 4BBNC 2BWFA 3KH0A 3L13A 4DDID 1V9JA 1C79A 1JW9D 3FC4A 4ZRIA 3ETRA 3NS8A 4HPLB 3UF8A 3L0WB 2FBWB 1YJ1A 2WX0A 1FM0D 4W9LA 1WIAA 3SR6A 1V8CA 2WU5B 3Q3NC 1D5ZC 3RMKC 1JCKB 2GBJA 1WYGA 1YN3A 5JXVA 3H6NA 2LVQA 3OJ4B 2MLBA 1ZPSA 4RFBA 2HJ1A 4HVBA 3PZ7A 2KANA 1N62A 3TMPB 3P4RB 3OG5A 3AEDB 5JH5C 1PGXA 4B95A 3TEWA 2KMMA 2JQRB 1KLVA 1YJJA 3TJPA 2KC1A 2CKHB 1QOGA 2V9HA 4WH4A 4KSKC 3AH7A 3BK2A 4GN1A 2BW2A 2I1KA 2MJDA 1E8XA 1K51A 3VAWA 1JWBD 3EFCA 4J3OD 3LB8C 5BMIA 4EFOA 1UGMA 3LDZE 1WMHA 2J7QB 4N58A 2KVZA 2KN4A 3QJZA 5D6JB 4LJPB 1WR1A 1HQRD 2NBWB 2OHFA 5J17A 1TTNA 2R61A 1BMLC 2KJRA 3WA0A 1C77A 3DVNV 3JVZX 3DWMA 4K1RB 4HEA1 3M95A 4ICUA 2HD5B 1SF0A 4NQKE 4RGOS 2O6VA 3P2BA 2WS3B 4REZA 1YD8U 3A33B 2V3SA 2AQ1B 2FIFA 4TSSA 4WWMA 4LNIA 4EOYA 5DPTA 4HDOA 2KFJA 2RDGA 4JWSC 2DAFA 3P42A 4RH6A 3X0WA 2I38A 3NZUA 1KTKA 5L83A 4PK1A 3UQBA 1NBFC 4M00A 1HZ6A 3R8BA 2IYDB 1T0QC 3DHIC 2WXPA 5MPOA 5TR5A 1OEYJ 3ML9A 3SDLC 4KGRA 2RPVA 1C4PA 1B1ZA 2DENB 4C7ZA 2ZPNA 4F8CB 1LGRA 3HK0A 3TEYA 2NBUA 2KC2A 1XXGA 1I42A 3MP9A 3EFUA 4TQ0A 1EO6A 2JY6A 1EM7A 2IY0B 1UGJA 4KDIC 3AXCA 3EUB2 2O6VD 1XCTL 1SBBB 2N7JA 2AX5A 2L05A 3AE6B 3QWZB 2LHEA 3VUYA 2RGFA 4BOSC 4OZAA 1NYRA 3AULA 1D5XC 3L10B 2INDC 2CJOA 5IA7A 2VZKD 1IBXB 4LNKA 2N9PC 3WIMA 1FD6A 4XC2A 3TEXA 3NOBA 4MJSA 2IO2B 3WANA 1SB3C 3A4SC 3P1MA 4JX1C 1J7BA 2KX0A 2BS2B 4E71A 2K0PA 2JWUA 4YT0B 1V1PB 4M0WA 2M4NA 1IP9A 2CU1A 2LXAA 3R7RA 3LJ3A 1VJKA 3H7PA 2QMTA 4YL8A 2AEHA 2LGIA 3JW0X 1PDXA 3NJTA 1T6BX 2WP9B 4DK5A 1ZUD2 2JU6X 1OQYA 3U2SC 2FUHB 2WXKA 1FMAD 3VQIA 1E6EB 2DLBA 4C4VA 3AEBB 3BVZA 1D4BA 3NVWA 1XT9B 1JWMD 1VLBA 2L7RA 2N9KA 1WRDB 2ZVNA 3O13A 1GUAB 5IKCM 1DOXA 1P3QU 3V62A 1C3TA 3KW5B 3MC8A 1V1OA 2O2VB 5FR6A 1NVID 4RF0A 2DWQA 1T0SC 1QILA 3PPAA 2GBRA 4GSWA 1I4GA 1HZ5A 2BWES 5G55A 4Q2JA 4FN2A 3Q8EA 3U52E 4N6EB 5C2TB 3URYA 4IUMB 3PZDA 4ZHOA 4FADA 4LJOB 3RCZA 2MBOA 2KQ4X 3BIID 4BKTA 2W55A 3FILA 2KOXA 2KFKA 1AW7A 3MC9A 2JXXA 5AUIA 4WQMA 1L4ZB 3EECA 3U7ZA 1RAXA 3MC0B 2FNJB 3PV1A 2V1YA 4JLCA 4LNOA 2DZMA 3KLSX 2N1WA 1BUIC 2BF8B 4NJ6A 1WXVA 1ZDXA 4KV2A 1XO3A 2KQSA 2WHIA 3RNFC 4DXFA 4RGTA 4W9FA 2GBKA 4BFRA 1GOZA 4LLGM 2KXJA 2MW5A 5D3IB 5G5HA 2KVRA 3QHTA 5EE1A 4ZYSA 2LGSA 4AOFA 1AWDA 3IVFA 3ZJVA 2TSSA 4NJ7A 3ZIMA 1AYFA 1A70A 4DHZE 1WX7A 3L08A 4ARCA 3V05A 2UYZB 3M62B 2RR9A 4ITKA 3AI5A 1MG4A 3P4SB 4NY0A 2XNAC 1NYQA 4RCOA 3ZTDA 5CTRC 4EZJA 1V81A 4S17A 5J2RA 1P98A 4GDLB 4HCPB 2ZVOA 2PE9A 5DPSA 4EZKA 3W5UB 1TYGB 2ZW1A 3ZNGC 1FFVA 5IP4D 4XWTA 2FCSA 3GP7A 4MM3A 5JHBA 1C9FA 2VH2A 2D5GA 1CMXB 1YIWA 2Y5CA 2W82A 3SD5A 4N59A 3A1QA 4WJPA 2GOWA 1EWYC 4OVVA 2EMTA 3VUWA 1EU4A 1SE4A 2KO3A 3AE4B 4NZLB 4A9AA 1V6EA 4KZCA 2JRHA 4F7ZA 4GMVA 3B2GA 3ZUNA 4ZRPA 3VRBB 2J0MA 4W9CA 4WIPA 3NVVA 3PREA 2L1AA 2KKCA 1XF5L 4HKQA 4DXAB 1ZW7A 3Q8FA 5AZHA 2WXLA 2NCNA 4HCNB 1TY2A 3N1ZC 1FNWA 1TGZB 3R7QA 1LFDA 5BMHA 3S2AA 1Q0WB 3I63C 3L4PA 5G2NA 2MBQA 3ZVVA 4I6PA 1F1HA 4NNJB 1V49A 3GOEA 3TEZA 4URKA 3MFGA 1R7SA 4J6IA 3GS2A 4UDUC 5EE3A 1WXSA 3EHVA 1WXMA 1GC6A 4II3B 2FIDA 5IO9A 4OVUA 3IG3A 1LXDA 2B76B 3ENEA 3MHSD 1FIQA 3T9LA 4PS3A 2DX5B 1KOTA 5C23A 3IT6B 3QCAA 2C7NB 5AUKA 2LVPA 1PGBA 2K22A 2HTHA 1EWCA 1SIFA 2N0SB 2CHZA 5KHOA 5GMVA 5E6NA 2LASA 1JROA 3PHXB 1KJTA 3Q3OC 1E8YA 1SJED 4BKSA 3A9JA 2YVCA 3X23A 4KKJA 1E9MA 3U30A 4RM9A 5L95C 1F0ZA 2AQ2B 2J42A 4PS8A 3PT2B 1YNTE 4GDKB 2N4FA 2WDRB 2N9LA 2QIEB 2LGDA 4XE0A 3I5JC 2OJRA 2J0JA 1VCBA 3NY5A 2LI5A 2IGGA 3TUOA 1LM8B 1RM6C 2JPHA 2PJHA 3RT3B 4NAWB 3H7SA 4IW0A 5HG2A 3ZQ4A 3Q3JA 3MJ5A 3W1YA 2DYBA 2M0AA 2DHZA 4WWOA 1ACCA 2G4DB 2EMSA 3VXWA 5FR3A 2BYFA 2GI9A 3B9JA 4W9HA 3W2DA 1Q10A 2LRWA 2QILA 3SFEB 1JQ4A 1OTRB 1YMHE 2YEPF 3E9SA 2KDEB 2ZW0A 2C7MB 4ANVA 4CHKA 5DPWA 4TKNA 2FE8A 4FLHA 2EKIA 4ZDVA 3DVGX 2WXFA 4BKSD 4B0EA 3Q3MC 4K7UA 3NVYA 1GB1A 1J7CA 3ZNID 1VRAB 1HTOA 3ZDTA 2G3QB 4GDKA 2WU2B 1XLPA 5JHAA 2A5UA 3KWLA 1DOIA 1FXIA 2I1JA 1STEA 2ZCBA 4MACA 5C1ZA 2PVOD 3BINA 3GE8C 1EUVB 4KVGB 5FKAC 4DHZB 2J4XA 2R2QA 4C7YA 2KT7A 1ZOYB 1EF5A 4W9EA 2FUG1 2LMCA 1OGWA 2JRIB 1T0YA 1WJUA 4YTPB 4WWPA 1C78A 2KN5A 2KTFA 3R3MA 4K81A 3I57A 3ZXRA 2BKFA 1AARA 2ZEQA 3ZKJC 2J52A 2IPKD 1E7UA 2GLSA 3EGRA 3BZDB 2L83A 1XLNA 2ZJDA 3CSTA 2KWCA 2C9WB 1K50A 2DZKA 3BYYB 4KIKB 1RWSA 5CHVC 1FCCC 1H8CA 2KZRA 3QIJA 5LLIA 4K7SA 1KM7A 4IM0A 1PYWD 3DBSA 3DPDA 4MSQB 4FHKA 4P7IA 2DAJA 3AE5B 3SEBA 1DYQA 1TKEA 2AL6A 2BT6A 4IDIA 1ZXIA 4M8MA 3VTWA 1FFUA 4H2AA 1L2NA 5D3DA 3BVGA 1CQVA 4YWGG 3N20C 3FKYA 4CO7A 4CQNA 1UD7A 2WXRA 1KH0A 2KDFB 4MEMA 3OJ3A 1CJEA 1L0YB 3W9CB 4WJOA 2PTLA 2KQ7A 1F2RC 3KQ4A 2MP2B 4I6NB 3RNGC 2JF5A 3E56A 2ZZPB 4RM8A 1Z2MA 1SE2A 2IO3B 2WDQB 1V5OA 3BY4B 1FEHA 2AQ3B 4A6QA 5IOIA 2BGFA 2G45B 4OVZA 1JRPA 1M4VA 2INNE 4A3PA 2Z0DB 3AE3B 4RMAA 3T8MA 3Q8AA 1E7PB 3NHEB 5H92C 3UQAA 3PLUA 5IAAC 3RPFC 1WX8A 1OFFA 5EE0A 1QQRA 2L32A 4A3OA 1DGJA 2SEBD 2NPTB 1TKYA 2WXHA 3P4QB 1NI2A 5AEKB 1S3SG 1TS3A 1WWTA 2D2QA 3L16A 5HKHA 3T3NA 2LRUA 2L76A 2WXIA 2PE6B 4M01A 1FNUA 4HJKA 1E90A 2H89B 1I4XA 3V60A 1DOYA 3VTUA 1L0VB 4OZBA 5DPRA 2KLGA 3VTVA 2V3NA 1I4RA 3BVMA 2OJWA 2NS5A 3OAWA 2ON8A 3Q8CA 4PYUA 2K6DB 5CX3A 2CHWA 1WYWB 2IO0B 3K9PB 2K8HA 4YTMB 4F1SA 4JE3B 1XEEA 3OWEB 3V6CB 4YSXB 1A5RA 1J19A 3ECIA 2WXOA 1P7FA 1G6JA 4B9KA 4US8A 1TY0A 3A4RA 1IBXA 2FCMA 2WLBA 2KDBA 1WFYA 3LYYA 4EZLA 4ZYNA 2Y3AA 1PGAA 1L5PA 2G4SA 3B0AA 4BVUC 1WE7A 1V1PA 1ZDVA 1OEYA 1P1AA 2XN9C 3WAMA 2WDVB 2BPSA 3AM9A 1E8WA 2WXGA 4IWPA 1WJNA 4MGZE 3ZJTA 3HM6X 4R3DA 2W3SA 4FHJA 4K3BA 2MBHA 2BS4B 3RYTA 3DHHC 2NTSA 3WAOA 4FBJB 3RD2A 1NEKB 1C1YB 1TT5B 2QJLA 4D2KA 3O65B 1WE6A 3B1LX 1VD2A 1L7YA 1WGGA 2LUMA 3I9V1 3M3JA 1E7VA 2YEPB 2UWQA 4NAMA 1FXTB 3Q14C 2RD0A 2O2VA 2KWDA 3V6EB 1GNUA 3AU4A 2INPE 4HJGE 1FO4A 3ALBA 2RSUA 4YXDB 4LCDE 1HTQA 3RZFA 1JWSD 2WWZA 1D5MC 2D3CA 3W1SC 3N1XC 4PS7A 5GXGB 2CR5A 1Z5SB 3IFWB 5CHWA 1NDDA 4FJYA 4LDTB 3BYTB 4TUUA 1FNVA 3Q6BA 1KF6B 4M8NA 2BYTA 2GB1A 3DWGC 2LJIA 2N9XA 2W9NA 1MI0A 1UBQA 2KMAA 3PO0A 3M63B 2MHJA 4EE2A 3DOWA 1L0XB 3H1UA 3P63A 3Q69A 2ZPYA 2HE7A 2MWSB 3APFA 2UU7A 4WJNA 4W9JA 1WY8A 4IC7B 4P1BC 2QDFA 1F2RI 4ACFA 2Z59B 4LNFA 4WQOB 1I4QA 4IG7B 4JIOU 2NR2A 4G50A 2XK5B 4S0RA 2JT4B 5D7GA 1QOAA 2GBMA 3PSEB 5C3JB 3DBRB 1KFYB 3R66C 4USAA 1WF9A 2JX5A 3AEEB 3RUIB 4WAFA 3IT4B 1IGDA 3QK0A 3VVWB 2FCNA 2WXNA 2E6XA 2KJ6A 1JRUA 1YQ4B 4AJWA 2MJ3A 4FULA 3VRAB 1L6VA 3PRMB 4ZRQA 4DBGA 3N30A 3ZGZA 1WM2A 2IDYA 3IAS1 5FK9C 1VZ8A 1VZ7A 4MGKE 3AE2B 2AWTA 2MBBB 2ASQA 4KGTA 1Y8RC 2K39A 2KYWA 2JZZA 1JALA 4GDLA 4BAXA 3NRZA 2PVGC 3VDZA 1UBIA 1YQ3B 4PYZA 1S1QB 3P4PB 5D94A 2QEJC 1KRHA 3CMMB 5LXIB 1L6UA 3AEGB 2XK5A 2IJ0A 2W3RA 5IN7A 2L52A 1N5WA 4DQOC 4XDCA 3PS6A 4C56C 4US9A 2ACZB 1C4AA 2BKRB 2DYOA 2QC8A 4MH8A 3DVGY 5HHDG 3GE3C 3MJWA 4LDTD 4BBNF 2V4IB 2D3BA 5HFYA 2Z8LA 1MFWA 1RLFA 4WWNA 2ZNVC 3HM3A 4B0MA 5JZEB 3UGBB 2BYVE 3PTFC 3VFKA 5EDSA 1WR6E 4FJVB 2AL3A 2INCC 2KTRB 3KUDB 1WGYA 4WURA 2IO1B 1BXTA 2ICIA 2K8BA 3BK1A 3OLMD 3AE8B 2YLMA 3PRPB 1SXTA 3QARA 4AWJA 2MJEA 2HTME 3U8ZA 4L23A 4OW0A 5H8YE 1HA5A 3TBLD 3H8HA 2RPQA 1WGDA 4ZOHC 1K53A 5E6JA 1CK1A 2K8CA 4C00A 4TMAB 3TCAA 2REXA 3HIZA 3DQVA 2IBIB 3KYDD 2PKOA 2DZJA 2Y5PA 3TL5A 2IZVB 1TBEA 1TS5A 2SAKA 3AMZA 2DBYA 4IWQA 4L2YA 2HJ8A 1FCLA 1N5XA 1WGRA 3AN1A 1ZGUB 2KDMA 2OEDA 2JSVX 2VH1A 4HKZE 1E8ZA 2L3ZA 1HXYD 4YTNB 4CYEA 2D3AA 1E5WA 3RZWC 3SHQA 3AECB 4DHJB 3ZRFA 3DBLB 3V3XA 2NMQA 1FRDA 3WALA 4GU2A 2WYQA 2XEWA 4AS1A 1WSPA 2Q5WD 2BTEA 3T3OA 5BYRA 2K25A 2Z0EB 2BB6A 1D6EC 1TIFA 1UELA 4K3CA 5E6OA 2BB5A 3RULA 1OQQA 3NZSA 3MHZA 5EE9A 3DBHB 3VH3B 2QCZA 3NVZA 4ZRJA 1D3ZA 4MSMB 2JXTA 2MQJA 2FAZA 3ZYYX 1P0RA 1F52A 3LXFA 3CWIA 2LD9A 1WMHB 2LVOA 2EELA 3Q2AC 2HDEA 2JYEA 2JWZA 1UWXA 3DBLI 3W1SA 5LXHA 2IGHA 1AN8A 3UIPB 3PGEA 4JPSA 3C0RB 5CHFA 4DXGA 4GIVA
chains in the Genus database with same CATH topology
2J0KA 4JGHB 2VRRB 3APCA 3ZTCA 4A3OA 1UH6A 2V1YA 4JLCA 2LGXA 2O6VB 1J0GA 2NPTB 4NAWA 2KLCA 2DZMA 1NI2A 2D07B 4X57B 2N1WA 3IBEA 5J2RA 5AEKB 1S3SG 3DBHI 1WJ6A 2BF8B 2D2QA 3L16A 4NJ6A 5HKHA 1WXVA 3WAPA 4KV2A 2LRUA 2KQSA 2L76A 3GZNI 4FA6A 3JSVB 2PE6B 4HJKA 1E90A 4W9GA 4MGYE 4W9FA 2GBKA 4BFRA 3DDCB 4MDKE 1ISNA 3V60A 2WDTB 4AP4C 2C7HA 2KXJA 2MW5A 3EC8A 4IM3A 3VTUA 2NVUI 2KVRA 3QHTA 2MRPA 1H4RA 2PEAA 3KUZA 5DPRA 2KLGA 3VTVA 4A20A 4AOFA 3OAWA 2NS5A 3IVFA 4PYUA 2K6DB 4BOZB 5CX3A 3L54A 4NJ7A 2D10A 3ZIMA 2BYEA 2CHWA 4DHZE 1WX7A 1WYWB 3L08A 3UINB 2PPHA 4IWOA 1EF1A 2IO0B 2MBEA 2UYZB 3M62B 3ZW3A 2RR9A 3K9PB 2K8HA 2EKEC 4N9F4 3AI5A 2MX2A 5AZGA 4NY0A 3K9OB 2MA9B 4F1SA 4DDGD 1GJZA 3ZTDA 5CTRC 3V6CB 2KMCA 1V81A 3IHPC 4EZJA 1WZ3A 1J19A 1P98A 1WH3A 3H9DA 1Q1OA 3ECIA 4GDLB 4MGIE 1A5RA 1G6JA 4HCPB 2ZVOA 2PE9A 5BO4B 4HWIB 5DPSA 4B9KA 2L0TA 2LXCA 3Q3FA 3A4RA 4EZKA 1I35A 3ZNGC 2D3GA 2FCMA 3QC8B 1WGHA 2FCSA 3APDA 5J18A 1WJ4A 2KDBA 1WFYA 1U4AA 4EZLA 4MM3A 4ZYNA 5JHBA 3ZO5B 4MH0E 2ZNVB 1V86A 2G4SA 3VHTC 1CMXB 3JSVA 2CS4A 2GMIC 3B0AA 4DHJD 1WXAA 1YIWA 4II2B 3SD5A 4BVUC 2N1VA 2JUOA 3A1QA 3D32A 3ONSA 4WJPA 1WE7A 2GOWA 2KTRA 4GB9A 2N9EB 4OVVA 2EMTA 1OEYA 1P1AA 3VUWA 1RFAA 2FCQA 3WAMA 1F9JA 1J8CA 2LZ6A 2KO3A 1GC7A 3I3TB 4EEWA 2BPSA 2JZ3B 1E8WA 4BBNC 1R4NI 1V6EA 1WJNA 4IWPA 2BWFA 4KZCA 4MGZE 3HM6X 2JRHA 2WX1A 3KH0A 3L13A 2ZCCA 4MJSB 4DDID 4F7ZA 4FHJA 1V9JA 4GMVA 2MBHA 4ZRIA 4G3XB 5DCNA 5AZFA 3ZUNA 3RYTA 3NS8A 4BKGA 2J0MA 4W9CA 3ZDMC 4ANWA 4KIKA 4HPLB 3WAOA 4FBJB 3UF8A 3PREA 3RD2A 2KKCA 4ANUA 4DXAB 3L0WB 4M0WB 1C1YB 3VUXA 1YJ1A 1ZW7A 2N7DA 2WX0A 3O65B 5AZHA 1WE6A 3B1LX 1VD2A 4W9LA 1L7YA 1WGGA 1WIAA 2DYMA 2NCNA 4HCNB 3H7PB 3M3JA 3PHWB 1E7VA 2UWQA 3DVNU 2GBJA 2M8SA 4E3CA 3H6NA 1TGZB 2LVQA 3R7QA 1LFDA 3OJ4B 2MLBA 1QZEA 1FXTB 3V61A 4HVBA 2KANA 2RD0A 2O2VA 3TMPB 3VH4B 3S2AA 3V6EB 1Q0WB 3N3KB 5JH5C 1LQBA 2K6QA 1GNUA 3AU4A 5G2NA 4WJQA 3ALBA 2RSUA 2MBQA 4LCDE 3ZVVA 4I6PA 4B95A 3RZFA 2WWZA 4E74A 3W1SC 4NNJB 1KLVA 1V49A 4PS7A 3TJPA 2CR5A 2KC1A 3GOEA 1Z5SB 4URKA 2CKHB 2MP2A 4NQLB 4W9IA 3IFWB 5CHWA 1NDDA 4KSKC 4FJYA 4GIVA 4J6IA 4LDTB 1WXSA 3EHVA 1WXMA 1GC6A 4TUUA 4FJZA 4GN1A 4M8NA 4II3B 2FIDA 2I1KA 3KUCB 5E6PA 1E8XA 4DWFA 2KX3A 2GBNA 1YX6B 4OVUA 4AUQC 3IG3A 1LXDA 3VAWA 1HE8A 1K8RB 3T9LA 3ENEA 3MHSD 2N9XA 1KOTA 2W9NA 2DX5B 4PS3A 1UBQA 2KMAA 4EFOA 5C23A 2A4ZA 3M63B 1UGMA 3LDZE 2IY1B 3QCAA 2C7NB 2L0FA 3DOWA 1WMHA 2LVPA 2J7QB 2KNBA 2B3AA 3AU5A 3H1UA 2HTHA 3QJZA 5D6JB 4LJPB 1SIFA 1WR1A 2CHZA 2ZPYA 2NBWB 5KHOA 2HE7A 5GMVA 5E6NA 2MWSB 1ZKHA 3APFA 5J17A 1TTNA 3QX1A 2LASA 4WJNA 2KJRA 4W9JA 3PHXB 1KJTA 1WY8A 3DVNV 3JVZX 4IC7B 4JQWC 3WA0A 2LJ5A 1E8YA 4HDQA 4BKSA 3A9JA 4K1RB 3M95A 2JVCA 2YVCA 3X23A 4ICUA 2Z59B 2HD5B 3U30A 4WQOB 4W9DA 4NQKE 4RM9A 2O6VA 2NPTA 4IG7B 5L95C 4JIOU 2NR2A 3P2BA 1YD8U 3A33B 2V3SA 4ICVA 4TV3A 2KK8A 2KFKB 2FIFA 4G50A 4PS8A 2XK5B 4HLEA 2JT4B 3PT2B 5D7GA 2GBMA 4EOYA 5DPTA 3PSEB 2V4LA 3L17A 4GDKB 4HDOA 2N4FA 2KFJA 4KZ0A 1RRBA 2DAFA 2LGDA 3R66C 3X0WA 2OJRA 2J0JA 1VCBA 4HXDA 3NY5A 1V2YA 1WF9A 2LI5A 3RUIB 3NZUA 2DZIA 3ZRCA 1LM8B 5L83A 4ZRKA 2L8JA 2JPHA 2PJHA 3RT3B 3UQBA 3QK0A 1NBFC 3VVWB 2FCNA 1YX5B 4NAWB 2KJ6A 3H7SA 3PVLA 1JRUA 3SU8X 2LUEA 2IYDB 4IW0A 4AJWA 4FULA 1WI0A 3Q3JA 3PRMB 5TR5A 2D11A 1OEYJ 1Q5WB 3ML9A 2DYBA 3N30A 3W1YA 4DBGA 3SDLC 1WM2A 4HPMB 2C60A 2DHZA 4WWOA 2G4DB 2DENB 2EMSA 3VXWA 2BYFA 4HK2A 4MGKE 2ZPNA 4F8CB 4W9HA 2AWTA 2MBBB 2ASQA 1Y8RC 2LRWA 4EKUA 1OTRB 3HK0A 2KDEB 4CHKA 2C7MB 2K39A 4ANVA 5DPWA 2NBUA 2JZZA 4GDLA 4TKNA 2KC2A 3CSFA 4FLHA 3CF6E 4ZDVA 2CHXA 3DVGX 1I42A 3VDZA 3EFUA 1UBIA 4WAAA 4TQ0A 4PYZA 1S1QB 1EO6A 2JY6A 3A9KB 1WX9A 3UIOB 4BKSD 4K7UA 2IY0B 1PQSA 3N32A 4KDIC 5D94A 3AXCA 2QHOA 3ZNID 3CMMB 5LXIB 2O6VD 2XK5A 3MTNB 3ZDTA 1SGHA 2G3QB 2L05A 4GDKA 2KD0A 3QWZB 4GOCA 3VUYA 5JHAA 2RGFA 4BOSC 1XQQA 3PS6A 4JL9A 2A5UA 3ZLZA 2BKRB 2I1JA 2DYOA 3AULA 2ZCBA 3QQ8B 4AJYB 3B08A 3L10B 5C1ZA 5IA7A 1XD3B 3BINA 3DVGY 2N9PC 3WIMA 1EUVB 3MJWA 4LDTD 4KVGB 4XC2A 4MELA 4BBNF 2AYOB 1RLFA 2KJHB 3NOBA 4WWNA 4DHZB 2ZNVC 3HM3A 4MJSA 2IO2B 2R2QA 5JZEB 4I6LB 1EF5A 1M94A 3WANA 3UGBB 4W9EA 4ANXA 3A4SC 2BYVE 3PTFC 3VFKA 5EDSA 2KX0A 1OGWA 2JRIB 1T0YA 2L00B 1WJUA 1WR6E 3A1QB 4FJVB 1SE9A 2OOBB 4E71A 4WWPA 2AL3A 2KTRB 3KUDB 2KN5A 1WGYA 1WM3A 2KTFA 2M4NA 1IP9A 2IO1B 3R3MA 2CU1A 2LXAA 4K81A 3R7RA 3LJ3A 2K8BA 2K1FA 3OLMD 2YLMA 3H7PA 3DCGA 3PRPB 4YL8A 3QARA 3TIXA 4ASWC 4AWJA 2BKFA 1AARA 2AEHA 2ZEQA 3ZKJC 1E7UA 2KDIA 3JW0X 3U8ZA 1TZ1A 3ZNHB 4DK5A 3TBLD 1OQYA 2FUHB 2RPQA 1WGDA 2ZJDA 3CSTA 3A9KA 3VQIA 2KWCA 2C9WB 2NBVB 2DZKA 2KWUB 1IPGA 4KIKB 2K8CA 5CHVC 1H8CA 2KZRA 3TCAA 2REXA 3QIJA 5LLIA 4K7SA 2KHWB 1KM7A 4IM0A 1BT0A 1XT9B 3PRZA 3DPDA 3DQVA 3DBSA 3HIZA 4FHKA 2MSED 2L7RA 2DAJA 2IBIB 4MSQB 3ZNZB 3KYDD 2DZJA 1WRDB 3TL5A 2AL6A 2IZVB 2ZVNA 4EUTA 1TBEA 1GUAB 4TQ1A 4IWQA 3KYCD 4M8MA 3VTWA 1L2NA 1WZ0A 2HJ8A 1P3QU 2M1MA 1WGRA 1ZGUB 2R2OA 3KW5B 2Y5BB 4GGQA 3V62A 3U7DA 2LGYA 3QAQA 2O2VB 1E8ZA 2L3ZA 4XX5A 2KWVB 4CYEA 1GG3A 1E5WA 3RZWC 5FR6A 3SHQA 1UZXB 3HHMA 4DHJB 4CO7A 1UD7A 3ZRFA 2XBBC 2KDFB 1V80A 4MEMA 3WALA 4P7IA 1C3TA 3PLVA 3OJ3A 4KDLB 4GU2A 2WYQA 4WJOA 1YQBA 2XEWA 2KQ7A 1V5TA 3KVFB 1R4MI 2MP2B 2LWPA 3PPAA 2GBRA 2JF5A 2K25A 4I6NB 2Z0EB 2MCNB 4IM2A 1MG8A 4G11A 4GSWA 2M0XA 4G0NB 4K7WA 2BWES 1UELA 5E6OA 5G55A 4FN2A 3RULA 2ZZPB 4RM8A 4XZ4A 3NZSA 1Z2MA 2IO3B 3VH3B 3QA8A 4ZRJA 1D3ZA 4MSMB 1V5OA 1X1MA 3DBRI 3BY4B 5KHQA 4IUMB 3PZDA 2MQJA 4B6WA 2FAZA 1P0RA 2BGFA 2C5LC 2G45B 2LD9A 4FADA 4LJOB 3RCZA 2MBOA 1WMHB 2LVOA 2M17A 4BKTA 1P9DU 5D2MB 2JWZA 2KOXA 4A3PA 2KFKA 2Z0DB 3ML8A 4RMAA 3JYUA 3DBLI 4GXBA 2JXXA 3T8MA 3W1SA 5LXHA 3NHEB 2N7EA 3EECA 3PLUA 4KSLC 5IAAC 3UIPB 3UQAA 1IYFA 3PGEA 1RAXA 1WX8A 3C0RB 2FNJB 5CHFA 4W9KA 3A9JB 4NPNA 3PV1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2J0K A;  4JGH B;  2VRR B;  3APC A;  3ZTC A;  4A3O A;  1UH6 A;  2V1Y A;  4JLC A;  2LGX A;  2O6V B;  1J0G A;  2NPT B;  4NAW A;  2KLC A;  2DZM A;  1NI2 A;  2D07 B;  4X57 B;  2N1W A;  3IBE A;  5J2R A;  5AEK B;  1S3S G;  3DBH I;  1WJ6 A;  2BF8 B;  2D2Q A;  3L16 A;  4NJ6 A;  5HKH A;  1WXV A;  3WAP A;  4KV2 A;  2LRU A;  2KQS A;  2L76 A;  3GZN I;  4FA6 A;  3JSV B;  2PE6 B;  4HJK A;  1E90 A;  4W9G A;  4MGY E;  4W9F A;  2GBK A;  4BFR A;  3DDC B;  4MDK E;  1ISN A;  3V60 A;  2WDT B;  4AP4 C;  2C7H A;  2KXJ A;  2MW5 A;  3EC8 A;  4IM3 A;  3VTU A;  2NVU I;  2KVR A;  3QHT A;  2MRP A;  1H4R A;  2PEA A;  3KUZ A;  5DPR A;  2KLG A;  3VTV A;  4A20 A;  4AOF A;  3OAW A;  2NS5 A;  3IVF A;  4PYU A;  2K6D B;  4BOZ B;  5CX3 A;  3L54 A;  4NJ7 A;  2D10 A;  3ZIM A;  2BYE A;  2CHW A;  4DHZ E;  1WX7 A;  1WYW B;  3L08 A;  3UIN B;  2PPH A;  4IWO A;  1EF1 A;  2IO0 B;  2MBE A;  2UYZ B;  3M62 B;  3ZW3 A;  2RR9 A;  3K9P B;  2K8H A;  2EKE C;  4N9F 4;  3AI5 A;  2MX2 A;  5AZG A;  4NY0 A;  3K9O B;  2MA9 B;  4F1S A;  4DDG D;  1GJZ A;  3ZTD A;  5CTR C;  3V6C B;  2KMC A;  1V81 A;  3IHP C;  4EZJ A;  1WZ3 A;  1J19 A;  1P98 A;  1WH3 A;  3H9D A;  1Q1O A;  3ECI A;  4GDL B;  4MGI E;  1A5R A;  1G6J A;  4HCP B;  2ZVO A;  2PE9 A;  5BO4 B;  4HWI B;  5DPS A;  4B9K A;  2L0T A;  2LXC A;  3Q3F A;  3A4R A;  4EZK A;  1I35 A;  3ZNG C;  2D3G A;  2FCM A;  3QC8 B;  1WGH A;  2FCS A;  3APD A;  5J18 A;  1WJ4 A;  2KDB A;  1WFY A;  1U4A A;  4EZL A;  4MM3 A;  4ZYN A;  5JHB A;  3ZO5 B;  4MH0 E;  2ZNV B;  1V86 A;  2G4S A;  3VHT C;  1CMX B;  3JSV A;  2CS4 A;  2GMI C;  3B0A A;  4DHJ D;  1WXA A;  1YIW A;  4II2 B;  3SD5 A;  4BVU C;  2N1V A;  2JUO A;  3A1Q A;  3D32 A;  3ONS A;  4WJP A;  1WE7 A;  2GOW A;  2KTR A;  4GB9 A;  2N9E B;  4OVV A;  2EMT A;  1OEY A;  1P1A A;  3VUW A;  1RFA A;  2FCQ A;  3WAM A;  1F9J A;  1J8C A;  2LZ6 A;  2KO3 A;  1GC7 A;  3I3T B;  4EEW A;  2BPS A;  2JZ3 B;  1E8W A;  4BBN C;  1R4N I;  1V6E A;  1WJN A;  4IWP A;  2BWF A;  4KZC A;  4MGZ E;  3HM6 X;  2JRH A;  2WX1 A;  3KH0 A;  3L13 A;  2ZCC A;  4MJS B;  4DDI D;  4F7Z A;  4FHJ A;  1V9J A;  4GMV A;  2MBH A;  4ZRI A;  4G3X B;  5DCN A;  5AZF A;  3ZUN A;  3RYT A;  3NS8 A;  4BKG A;  2J0M A;  4W9C A;  3ZDM C;  4ANW A;  4KIK A;  4HPL B;  3WAO A;  4FBJ B;  3UF8 A;  3PRE A;  3RD2 A;  2KKC A;  4ANU A;  4DXA B;  3L0W B;  4M0W B;  1C1Y B;  3VUX A;  1YJ1 A;  1ZW7 A;  2N7D A;  2WX0 A;  3O65 B;  5AZH A;  1WE6 A;  3B1L X;  1VD2 A;  4W9L A;  1L7Y A;  1WGG A;  1WIA A;  2DYM A;  2NCN A;  4HCN B;  3H7P B;  3M3J A;  3PHW B;  1E7V A;  2UWQ A;  3DVN U;  2GBJ A;  2M8S A;  4E3C A;  3H6N A;  1TGZ B;  2LVQ A;  3R7Q A;  1LFD A;  3OJ4 B;  2MLB A;  1QZE A;  1FXT B;  3V61 A;  4HVB A;  2KAN A;  2RD0 A;  2O2V A;  3TMP B;  3VH4 B;  3S2A A;  3V6E B;  1Q0W B;  3N3K B;  5JH5 C;  1LQB A;  2K6Q A;  1GNU A;  3AU4 A;  5G2N A;  4WJQ A;  3ALB A;  2RSU A;  2MBQ A;  4LCD E;  3ZVV A;  4I6P A;  4B95 A;  3RZF A;  2WWZ A;  4E74 A;  3W1S C;  4NNJ B;  1KLV A;  1V49 A;  4PS7 A;  3TJP A;  2CR5 A;  2KC1 A;  3GOE A;  1Z5S B;  4URK A;  2CKH B;  2MP2 A;  4NQL B;  4W9I A;  3IFW B;  5CHW A;  1NDD A;  4KSK C;  4FJY A;  4GIV A;  4J6I A;  4LDT B;  1WXS A;  3EHV A;  1WXM A;  1GC6 A;  4TUU A;  4FJZ A;  4GN1 A;  4M8N A;  4II3 B;  2FID A;  2I1K A;  3KUC B;  5E6P A;  1E8X A;  4DWF A;  2KX3 A;  2GBN A;  1YX6 B;  4OVU A;  4AUQ C;  3IG3 A;  1LXD A;  3VAW A;  1HE8 A;  1K8R B;  3T9L A;  3ENE A;  3MHS D;  2N9X A;  1KOT A;  2W9N A;  2DX5 B;  4PS3 A;  1UBQ A;  2KMA A;  4EFO A;  5C23 A;  2A4Z A;  3M63 B;  1UGM A;  3LDZ E;  2IY1 B;  3QCA A;  2C7N B;  2L0F A;  3DOW A;  1WMH A;  2LVP A;  2J7Q B;  2KNB A;  2B3A A;  3AU5 A;  3H1U A;  2HTH A;  3QJZ A;  5D6J B;  4LJP B;  1SIF A;  1WR1 A;  2CHZ A;  2ZPY A;  2NBW B;  5KHO A;  2HE7 A;  5GMV A;  5E6N A;  2MWS B;  1ZKH A;  3APF A;  5J17 A;  1TTN A;  3QX1 A;  2LAS A;  4WJN A;  2KJR A;  4W9J A;  3PHX B;  1KJT A;  1WY8 A;  3DVN V;  3JVZ X;  4IC7 B;  4JQW C;  3WA0 A;  2LJ5 A;  1E8Y A;  4HDQ A;  4BKS A;  3A9J A;  4K1R B;  3M95 A;  2JVC A;  2YVC A;  3X23 A;  4ICU A;  2Z59 B;  2HD5 B;  3U30 A;  4WQO B;  4W9D A;  4NQK E;  4RM9 A;  2O6V A;  2NPT A;  4IG7 B;  5L95 C;  4JIO U;  2NR2 A;  3P2B A;  1YD8 U;  3A33 B;  2V3S A;  4ICV A;  4TV3 A;  2KK8 A;  2KFK B;  2FIF A;  4G50 A;  4PS8 A;  2XK5 B;  4HLE A;  2JT4 B;  3PT2 B;  5D7G A;  2GBM A;  4EOY A;  5DPT A;  3PSE B;  2V4L A;  3L17 A;  4GDK B;  4HDO A;  2N4F A;  2KFJ A;  4KZ0 A;  1RRB A;  2DAF A;  2LGD A;  3R66 C;  3X0W A;  2OJR A;  2J0J A;  1VCB A;  4HXD A;  3NY5 A;  1V2Y A;  1WF9 A;  2LI5 A;  3RUI B;  3NZU A;  2DZI A;  3ZRC A;  1LM8 B;  5L83 A;  4ZRK A;  2L8J A;  2JPH A;  2PJH A;  3RT3 B;  3UQB A;  3QK0 A;  1NBF C;  3VVW B;  2FCN A;  1YX5 B;  4NAW B;  2KJ6 A;  3H7S A;  3PVL A;  1JRU A;  3SU8 X;  2LUE A;  2IYD B;  4IW0 A;  4AJW A;  4FUL A;  1WI0 A;  3Q3J A;  3PRM B;  5TR5 A;  2D11 A;  1OEY J;  1Q5W B;  3ML9 A;  2DYB A;  3N30 A;  3W1Y A;  4DBG A;  3SDL C;  1WM2 A;  4HPM B;  2C60 A;  2DHZ A;  4WWO A;  2G4D B;  2DEN B;  2EMS A;  3VXW A;  2BYF A;  4HK2 A;  4MGK E;  2ZPN A;  4F8C B;  4W9H A;  2AWT A;  2MBB B;  2ASQ A;  1Y8R C;  2LRW A;  4EKU A;  1OTR B;  3HK0 A;  2KDE B;  4CHK A;  2C7M B;  2K39 A;  4ANV A;  5DPW A;  2NBU A;  2JZZ A;  4GDL A;  4TKN A;  2KC2 A;  3CSF A;  4FLH A;  3CF6 E;  4ZDV A;  2CHX A;  3DVG X;  1I42 A;  3VDZ A;  3EFU A;  1UBI A;  4WAA A;  4TQ0 A;  4PYZ A;  1S1Q B;  1EO6 A;  2JY6 A;  3A9K B;  1WX9 A;  3UIO B;  4BKS D;  4K7U A;  2IY0 B;  1PQS A;  3N32 A;  4KDI C;  5D94 A;  3AXC A;  2QHO A;  3ZNI D;  3CMM B;  5LXI B;  2O6V D;  2XK5 A;  3MTN B;  3ZDT A;  1SGH A;  2G3Q B;  2L05 A;  4GDK A;  2KD0 A;  3QWZ B;  4GOC A;  3VUY A;  5JHA A;  2RGF A;  4BOS C;  1XQQ A;  3PS6 A;  4JL9 A;  2A5U A;  3ZLZ A;  2BKR B;  2I1J A;  2DYO A;  3AUL A;  2ZCB A;  3QQ8 B;  4AJY B;  3B08 A;  3L10 B;  5C1Z A;  5IA7 A;  1XD3 B;  3BIN A;  3DVG Y;  2N9P C;  3WIM A;  1EUV B;  3MJW A;  4LDT D;  4KVG B;  4XC2 A;  4MEL A;  4BBN F;  2AYO B;  1RLF A;  2KJH B;  3NOB A;  4WWN A;  4DHZ B;  2ZNV C;  3HM3 A;  4MJS A;  2IO2 B;  2R2Q A;  5JZE B;  4I6L B;  1EF5 A;  1M94 A;  3WAN A;  3UGB B;  4W9E A;  4ANX A;  3A4S C;  2BYV E;  3PTF C;  3VFK A;  5EDS A;  2KX0 A;  1OGW A;  2JRI B;  1T0Y A;  2L00 B;  1WJU A;  1WR6 E;  3A1Q B;  4FJV B;  1SE9 A;  2OOB B;  4E71 A;  4WWP A;  2AL3 A;  2KTR B;  3KUD B;  2KN5 A;  1WGY A;  1WM3 A;  2KTF A;  2M4N A;  1IP9 A;  2IO1 B;  3R3M A;  2CU1 A;  2LXA A;  4K81 A;  3R7R A;  3LJ3 A;  2K8B A;  2K1F A;  3OLM D;  2YLM A;  3H7P A;  3DCG A;  3PRP B;  4YL8 A;  3QAR A;  3TIX A;  4ASW C;  4AWJ A;  2BKF A;  1AAR A;  2AEH A;  2ZEQ A;  3ZKJ C;  1E7U A;  2KDI A;  3JW0 X;  3U8Z A;  1TZ1 A;  3ZNH B;  4DK5 A;  3TBL D;  1OQY A;  2FUH B;  2RPQ A;  1WGD A;  2ZJD A;  3CST A;  3A9K A;  3VQI A;  2KWC A;  2C9W B;  2NBV B;  2DZK A;  2KWU B;  1IPG A;  4KIK B;  2K8C A;  5CHV C;  1H8C A;  2KZR A;  3TCA A;  2REX A;  3QIJ A;  5LLI A;  4K7S A;  2KHW B;  1KM7 A;  4IM0 A;  1BT0 A;  1XT9 B;  3PRZ A;  3DPD A;  3DQV A;  3DBS A;  3HIZ A;  4FHK A;  2MSE D;  2L7R A;  2DAJ A;  2IBI B;  4MSQ B;  3ZNZ B;  3KYD D;  2DZJ A;  1WRD B;  3TL5 A;  2AL6 A;  2IZV B;  2ZVN A;  4EUT A;  1TBE A;  1GUA B;  4TQ1 A;  4IWQ A;  3KYC D;  4M8M A;  3VTW A;  1L2N A;  1WZ0 A;  2HJ8 A;  1P3Q U;  2M1M A;  1WGR A;  1ZGU B;  2R2O A;  3KW5 B;  2Y5B B;  4GGQ A;  3V62 A;  3U7D A;  2LGY A;  3QAQ A;  2O2V B;  1E8Z A;  2L3Z A;  4XX5 A;  2KWV B;  4CYE A;  1GG3 A;  1E5W A;  3RZW C;  5FR6 A;  3SHQ A;  1UZX B;  3HHM A;  4DHJ B;  4CO7 A;  1UD7 A;  3ZRF A;  2XBB C;  2KDF B;  1V80 A;  4MEM A;  3WAL A;  4P7I A;  1C3T A;  3PLV A;  3OJ3 A;  4KDL B;  4GU2 A;  2WYQ A;  4WJO A;  1YQB A;  2XEW A;  2KQ7 A;  1V5T A;  3KVF B;  1R4M I;  2MP2 B;  2LWP A;  3PPA A;  2GBR A;  2JF5 A;  2K25 A;  4I6N B;  2Z0E B;  2MCN B;  4IM2 A;  1MG8 A;  4G11 A;  4GSW A;  2M0X A;  4G0N B;  4K7W A;  2BWE S;  1UEL A;  5E6O A;  5G55 A;  4FN2 A;  3RUL A;  2ZZP B;  4RM8 A;  4XZ4 A;  3NZS A;  1Z2M A;  2IO3 B;  3VH3 B;  3QA8 A;  4ZRJ A;  1D3Z A;  4MSM B;  1V5O A;  1X1M A;  3DBR I;  3BY4 B;  5KHQ A;  4IUM B;  3PZD A;  2MQJ A;  4B6W A;  2FAZ A;  1P0R A;  2BGF A;  2C5L C;  2G45 B;  2LD9 A;  4FAD A;  4LJO B;  3RCZ A;  2MBO A;  1WMH B;  2LVO A;  2M17 A;  4BKT A;  1P9D U;  5D2M B;  2JWZ A;  2KOX A;  4A3P A;  2KFK A;  2Z0D B;  3ML8 A;  4RMA A;  3JYU A;  3DBL I;  4GXB A;  2JXX A;  3T8M A;  3W1S A;  5LXH A;  3NHE B;  2N7E A;  3EEC A;  3PLU A;  4KSL C;  5IAA C;  3UIP B;  3UQA A;  1IYF A;  3PGE A;  1RAX A;  1WX8 A;  3C0R B;  2FNJ B;  5CHF A;  4W9K A;  3A9J B;  4NPN A;  3PV1 A; 
#chains in the Genus database with same CATH topology
 2J0K A;  3ZTC A;  4AQ7 A;  1UH6 A;  4P1C C;  2O6V B;  1ZP0 B;  4NAW A;  2KLC A;  4GLS C;  1QT9 A;  2RDB C;  3DBH I;  1WJ6 A;  4RNA A;  1N61 A;  1TS4 A;  3JSV B;  3AE1 B;  1VR9 A;  4YSZ B;  4IOI E;  2VZK B;  4MGY E;  3DDC B;  4AP4 C;  3RNC C;  3EC8 A;  2M19 A;  2W54 A;  1H4R A;  2WXM A;  4OZC A;  2PEA A;  1MVK A;  1C76 A;  1PUT A;  3KUZ A;  1L4D B;  3WCQ A;  4BOZ B;  2D10 A;  2BYE A;  1N60 A;  3RNE C;  4IWO A;  2MBE A;  3ZW3 A;  2PW9 A;  2EKE C;  2MX2 A;  3DHG C;  1TZO A;  2PLP A;  1R4N B;  2MA9 B;  3AV8 A;  3R2T A;  3IAM 1;  3RN9 C;  3IHP C;  4MGI E;  1WH3 A;  1KLU D;  1XCQ L;  5BO4 B;  4HWI B;  4O1N A;  2L0T A;  2LXC A;  3W5V B;  3FAH A;  1I35 A;  2D3G A;  1WGH A;  5J18 A;  2MEK A;  2WNM A;  3RNA C;  4MH0 E;  2ZNV B;  1V86 A;  2RDH A;  2PMV A;  4DHJ D;  3JSV A;  2CS4 A;  1WXA A;  4II2 B;  2BS3 B;  2JUO A;  4GB9 A;  1TKG A;  2N9E B;  4KKI A;  1CZP A;  1RFA A;  2FCQ A;  1F9J A;  1J8C A;  2LZ6 A;  3HVZ A;  3N1Y C;  1N63 A;  3I3T B;  2WQY B;  4EEW A;  2JZ3 B;  1R4N I;  3NZ3 A;  3ZJU A;  3AE9 B;  2WX1 A;  2ZCC A;  4MJS B;  4G3X B;  5DCN A;  4HPP A;  5AZF A;  1HEZ E;  4BKG A;  3VR9 B;  3ZDM C;  4ANW A;  4KIK A;  4MT5 A;  1ESF A;  4ANU A;  4YSY B;  1MJD A;  1RFK A;  4M0W B;  3VUX A;  2N7D A;  1QKZ A;  2DYM A;  3H7P B;  3PHW B;  4HRS A;  3DVN U;  2M8S A;  4E3C A;  3AEA B;  1QZE A;  3NUH B;  1SSN A;  3V61 A;  4XWW A;  1ZXH A;  3VH4 B;  4C4V B;  3N3K B;  2J53 A;  1LQB A;  2K6Q A;  4WJQ A;  3U4E G;  1YJI A;  1GAQ B;  3ABV B;  4E74 A;  1P7E A;  1LO5 D;  2WXQ A;  1T5X D;  2MP2 A;  4NQL B;  4W9I A;  1NEN B;  1MHX A;  3HVD A;  4FJZ A;  3KUC B;  2X38 A;  5E6P A;  4DWF A;  2KX3 A;  2GBN A;  1YX6 B;  4AUQ C;  4A55 A;  1HE8 A;  1K8R B;  1YN4 A;  5LNK 1;  1XLQ A;  3AB5 A;  1I4H A;  2A4Z A;  2K5P A;  2IY1 B;  2L0F A;  1EU3 A;  2KNB A;  2B3A A;  3AU5 A;  2E3T A;  1C4C A;  4M02 A;  2WGS A;  1ZKH A;  3QX1 A;  4JQW C;  3AE7 B;  2QSD A;  2LJ5 A;  4HDQ A;  2KAJ A;  1B9R A;  2JVC A;  4W9D A;  1UUP A;  2NPT A;  2JYT A;  4KX6 B;  2MH7 A;  4ICV A;  4TV3 A;  1VZ6 A;  1XLO A;  2KK8 A;  3FIL B;  2KFK B;  4HLE A;  3HUI A;  1I7H A;  4C80 A;  2V4L A;  3L17 A;  1JWA D;  5HI1 A;  4KZ0 A;  1RRB A;  2BVC A;  4HXD A;  1V2Y A;  1SJH D;  3ZRC A;  2DZI A;  4ZRK A;  2L8J A;  1KLG D;  1YX5 B;  3PVL A;  3ZXV A;  3SU8 X;  2LUE A;  2V3P A;  1TJE A;  3R2I A;  1ET9 A;  2LFI A;  1E10 A;  4ARI A;  1WI0 A;  2D11 A;  4LK0 M;  2G1E A;  5TSS A;  1Q5W B;  2H88 B;  1NI3 A;  2CJN A;  4HPM B;  2C60 A;  4LTU A;  4XGA B;  1F77 A;  4A90 A;  5BMG A;  4HK2 A;  1JML A;  4HRO A;  4EKU A;  4KGS A;  4P6V F;  1UWM A;  3CSF A;  3CF6 E;  3NG0 A;  2CHX A;  1N6Z A;  4FXC A;  4WAA A;  3RFZ B;  3UIO B;  3A9K B;  1WX9 A;  1K52 A;  1PQS A;  3N32 A;  5BYS A;  2QHO A;  1OQR A;  3MTN B;  1SGH A;  1WGK A;  1SE3 A;  2KD0 A;  4GOC A;  2RMM A;  1WRI A;  1XQQ A;  4JL9 A;  4JWU C;  3ZLZ A;  1VDV A;  1SIJ A;  3QQ8 B;  4AJY B;  3B08 A;  4RF1 A;  1XD3 B;  2KAC A;  2K9X A;  3GB1 A;  4MEL A;  2AYO B;  1J7A A;  2KJH B;  4MM3 B;  2PIA A;  1T3Q A;  4I6L B;  1M94 A;  4ANX A;  1ENF A;  3HRD D;  2L00 B;  3A1Q B;  1SE9 A;  2OOB B;  1PFD A;  1RYJ A;  1WM3 A;  2K1F A;  1IUE A;  3RI7 C;  5G5G A;  3DCG A;  3TIX A;  4ASW C;  3RNB C;  4QAY A;  2KDI A;  1TZ1 A;  1QF6 A;  3ZNH B;  2DNF A;  2I2Y A;  1QLB B;  1YOV B;  1FXA A;  3A9K A;  1QOF A;  1R4M B;  3CIR B;  2NBV B;  1GPX A;  2KWU B;  1IPG A;  2X8X X;  2KHW B;  1I4P A;  1BT0 A;  1E0Z A;  3PRZ A;  4XYC A;  2MSE D;  3ZNZ B;  4RGN A;  2GRI A;  4EUT A;  3NS1 A;  4TQ1 A;  3KYC D;  1WZ0 A;  1UNS A;  2M1M A;  2R2O A;  4GGQ A;  2Y5B B;  3U7D A;  2LGY A;  3QAQ A;  4ZHP A;  4XX5 A;  2KWV B;  1GG3 A;  1FPY A;  3TSS A;  1UZX B;  3HHM A;  2BBC A;  1ET6 A;  2XBB C;  1V80 A;  3PLV A;  3N9Y C;  4KDL B;  1QOB A;  2BQQ A;  1YQB A;  4P16 A;  1V5T A;  3KVF B;  1R4M I;  2LWP A;  2WXJ A;  2MCN B;  4IM2 A;  1MG8 A;  4G11 A;  2M0X A;  4G0N B;  4K7W A;  1ZE3 D;  4XZ4 A;  4XDD A;  2IGD A;  4PT5 A;  3QA8 A;  5BYQ A;  1X1M A;  3DBR I;  5KHQ A;  3GZN B;  5T8I A;  4B6W A;  4NJC A;  2C5L C;  1FRR A;  2M17 A;  1P9D U;  5D2M B;  3ML8 A;  3JYU A;  1IGC A;  4GXB A;  2LEK A;  2N7E A;  1IYF A;  4KSL C;  4W9K A;  1V97 A;  3A9J B;  4NPN A;  3J9C A;  4JGH B;  3C19 A;  2VRR B;  3APC A;  2CU3 A;  2LGX A;  1J0G A;  1SEB D;  2D07 B;  4X57 B;  3C8Y A;  3IBE A;  1MPE A;  4LNN A;  3WAP A;  1ROE A;  3GZN I;  4FA6 A;  3Q8B A;  4W9G A;  2JZP A;  1YN5 A;  3PZ8 A;  4MDK E;  3SFD B;  1ISN A;  2WDT B;  2C7H A;  4RGM A;  4IM3 A;  2M56 B;  2NVU I;  2MRP A;  1T0R C;  3EA6 A;  1UF0 A;  4L1B A;  4A20 A;  2G9H D;  3L54 A;  5I4D A;  1MHH E;  2K3U A;  3UIN B;  2PPH A;  1EF1 A;  4N9F 4;  2LHD A;  5AZG A;  3BWU D;  3K9O B;  4DDG D;  1GJZ A;  2KMC A;  4BZA A;  1WZ3 A;  3H9D A;  1Q1O A;  4OHJ A;  3AEF B;  3Q3F A;  3IXS A;  3QC8 B;  3APD A;  1WJ4 A;  3VR8 B;  1U4A A;  3ZO5 B;  1TS2 A;  3VHT C;  2GMI C;  4A8X C;  2N1V A;  3B2F A;  3UI3 A;  1JWU D;  3D32 A;  3ONS A;  2V0G A;  4IKG A;  2ONQ A;  2KTR A;  2NTT A;  1GB4 A;  1Y56 A;  3KWV A;  1GC7 A;  1WXQ A;  4BBN C;  2BWF A;  3KH0 A;  3L13 A;  4DDI D;  1V9J A;  1C79 A;  1JW9 D;  3FC4 A;  4ZRI A;  3ETR A;  3NS8 A;  4HPL B;  3UF8 A;  3L0W B;  2FBW B;  1YJ1 A;  2WX0 A;  1FM0 D;  4W9L A;  1WIA A;  3SR6 A;  1V8C A;  2WU5 B;  3Q3N C;  1D5Z C;  3RMK C;  1JCK B;  2GBJ A;  1WYG A;  1YN3 A;  5JXV A;  3H6N A;  2LVQ A;  3OJ4 B;  2MLB A;  1ZPS A;  4RFB A;  2HJ1 A;  4HVB A;  3PZ7 A;  2KAN A;  1N62 A;  3TMP B;  3P4R B;  3OG5 A;  3AED B;  5JH5 C;  1PGX A;  4B95 A;  3TEW A;  2KMM A;  2JQR B;  1KLV A;  1YJJ A;  3TJP A;  2KC1 A;  2CKH B;  1QOG A;  2V9H A;  4WH4 A;  4KSK C;  3AH7 A;  3BK2 A;  4GN1 A;  2BW2 A;  2I1K A;  2MJD A;  1E8X A;  1K51 A;  3VAW A;  1JWB D;  3EFC A;  4J3O D;  3LB8 C;  5BMI A;  4EFO A;  1UGM A;  3LDZ E;  1WMH A;  2J7Q B;  4N58 A;  2KVZ A;  2KN4 A;  3QJZ A;  5D6J B;  4LJP B;  1WR1 A;  1HQR D;  2NBW B;  2OHF A;  5J17 A;  1TTN A;  2R61 A;  1BML C;  2KJR A;  3WA0 A;  1C77 A;  3DVN V;  3JVZ X;  3DWM A;  4K1R B;  4HEA 1;  3M95 A;  4ICU A;  2HD5 B;  1SF0 A;  4NQK E;  4RGO S;  2O6V A;  3P2B A;  2WS3 B;  4REZ A;  1YD8 U;  3A33 B;  2V3S A;  2AQ1 B;  2FIF A;  4TSS A;  4WWM A;  4LNI A;  4EOY A;  5DPT A;  4HDO A;  2KFJ A;  2RDG A;  4JWS C;  2DAF A;  3P42 A;  4RH6 A;  3X0W A;  2I38 A;  3NZU A;  1KTK A;  5L83 A;  4PK1 A;  3UQB A;  1NBF C;  4M00 A;  1HZ6 A;  3R8B A;  2IYD B;  1T0Q C;  3DHI C;  2WXP A;  5MPO A;  5TR5 A;  1OEY J;  3ML9 A;  3SDL C;  4KGR A;  2RPV A;  1C4P A;  1B1Z A;  2DEN B;  4C7Z A;  2ZPN A;  4F8C B;  1LGR A;  3HK0 A;  3TEY A;  2NBU A;  2KC2 A;  1XXG A;  1I42 A;  3MP9 A;  3EFU A;  4TQ0 A;  1EO6 A;  2JY6 A;  1EM7 A;  2IY0 B;  1UGJ A;  4KDI C;  3AXC A;  3EUB 2;  2O6V D;  1XCT L;  1SBB B;  2N7J A;  2AX5 A;  2L05 A;  3AE6 B;  3QWZ B;  2LHE A;  3VUY A;  2RGF A;  4BOS C;  4OZA A;  1NYR A;  3AUL A;  1D5X C;  3L10 B;  2IND C;  2CJO A;  5IA7 A;  2VZK D;  1IBX B;  4LNK A;  2N9P C;  3WIM A;  1FD6 A;  4XC2 A;  3TEX A;  3NOB A;  4MJS A;  2IO2 B;  3WAN A;  1SB3 C;  3A4S C;  3P1M A;  4JX1 C;  1J7B A;  2KX0 A;  2BS2 B;  4E71 A;  2K0P A;  2JWU A;  4YT0 B;  1V1P B;  4M0W A;  2M4N A;  1IP9 A;  2CU1 A;  2LXA A;  3R7R A;  3LJ3 A;  1VJK A;  3H7P A;  2QMT A;  4YL8 A;  2AEH A;  2LGI A;  3JW0 X;  1PDX A;  3NJT A;  1T6B X;  2WP9 B;  4DK5 A;  1ZUD 2;  2JU6 X;  1OQY A;  3U2S C;  2FUH B;  2WXK A;  1FMA D;  3VQI A;  1E6E B;  2DLB A;  4C4V A;  3AEB B;  3BVZ A;  1D4B A;  3NVW A;  1XT9 B;  1JWM D;  1VLB A;  2L7R A;  2N9K A;  1WRD B;  2ZVN A;  3O13 A;  1GUA B;  5IKC M;  1DOX A;  1P3Q U;  3V62 A;  1C3T A;  3KW5 B;  3MC8 A;  1V1O A;  2O2V B;  5FR6 A;  1NVI D;  4RF0 A;  2DWQ A;  1T0S C;  1QIL A;  3PPA A;  2GBR A;  4GSW A;  1I4G A;  1HZ5 A;  2BWE S;  5G55 A;  4Q2J A;  4FN2 A;  3Q8E A;  3U52 E;  4N6E B;  5C2T B;  3URY A;  4IUM B;  3PZD A;  4ZHO A;  4FAD A;  4LJO B;  3RCZ A;  2MBO A;  2KQ4 X;  3BII D;  4BKT A;  2W55 A;  3FIL A;  2KOX A;  2KFK A;  1AW7 A;  3MC9 A;  2JXX A;  5AUI A;  4WQM A;  1L4Z B;  3EEC A;  3U7Z A;  1RAX A;  3MC0 B;  2FNJ B;  3PV1 A;  2V1Y A;  4JLC A;  4LNO A;  2DZM A;  3KLS X;  2N1W A;  1BUI C;  2BF8 B;  4NJ6 A;  1WXV A;  1ZDX A;  4KV2 A;  1XO3 A;  2KQS A;  2WHI A;  3RNF C;  4DXF A;  4RGT A;  4W9F A;  2GBK A;  4BFR A;  1GOZ A;  4LLG M;  2KXJ A;  2MW5 A;  5D3I B;  5G5H A;  2KVR A;  3QHT A;  5EE1 A;  4ZYS A;  2LGS A;  4AOF A;  1AWD A;  3IVF A;  3ZJV A;  2TSS A;  4NJ7 A;  3ZIM A;  1AYF A;  1A70 A;  4DHZ E;  1WX7 A;  3L08 A;  4ARC A;  3V05 A;  2UYZ B;  3M62 B;  2RR9 A;  4ITK A;  3AI5 A;  1MG4 A;  3P4S B;  4NY0 A;  2XNA C;  1NYQ A;  4RCO A;  3ZTD A;  5CTR C;  4EZJ A;  1V81 A;  4S17 A;  5J2R A;  1P98 A;  4GDL B;  4HCP B;  2ZVO A;  2PE9 A;  5DPS A;  4EZK A;  3W5U B;  1TYG B;  2ZW1 A;  3ZNG C;  1FFV A;  5IP4 D;  4XWT A;  2FCS A;  3GP7 A;  4MM3 A;  5JHB A;  1C9F A;  2VH2 A;  2D5G A;  1CMX B;  1YIW A;  2Y5C A;  2W82 A;  3SD5 A;  4N59 A;  3A1Q A;  4WJP A;  2GOW A;  1EWY C;  4OVV A;  2EMT A;  3VUW A;  1EU4 A;  1SE4 A;  2KO3 A;  3AE4 B;  4NZL B;  4A9A A;  1V6E A;  4KZC A;  2JRH A;  4F7Z A;  4GMV A;  3B2G A;  3ZUN A;  4ZRP A;  3VRB B;  2J0M A;  4W9C A;  4WIP A;  3NVV A;  3PRE A;  2L1A A;  2KKC A;  1XF5 L;  4HKQ A;  4DXA B;  1ZW7 A;  3Q8F A;  5AZH A;  2WXL A;  2NCN A;  4HCN B;  1TY2 A;  3N1Z C;  1FNW A;  1TGZ B;  3R7Q A;  1LFD A;  5BMH A;  3S2A A;  1Q0W B;  3I63 C;  3L4P A;  5G2N A;  2MBQ A;  3ZVV A;  4I6P A;  1F1H A;  4NNJ B;  1V49 A;  3GOE A;  3TEZ A;  4URK A;  3MFG A;  1R7S A;  4J6I A;  3GS2 A;  4UDU C;  5EE3 A;  1WXS A;  3EHV A;  1WXM A;  1GC6 A;  4II3 B;  2FID A;  5IO9 A;  4OVU A;  3IG3 A;  1LXD A;  2B76 B;  3ENE A;  3MHS D;  1FIQ A;  3T9L A;  4PS3 A;  2DX5 B;  1KOT A;  5C23 A;  3IT6 B;  3QCA A;  2C7N B;  5AUK A;  2LVP A;  1PGB A;  2K22 A;  2HTH A;  1EWC A;  1SIF A;  2N0S B;  2CHZ A;  5KHO A;  5GMV A;  5E6N A;  2LAS A;  1JRO A;  3PHX B;  1KJT A;  3Q3O C;  1E8Y A;  1SJE D;  4BKS A;  3A9J A;  2YVC A;  3X23 A;  4KKJ A;  1E9M A;  3U30 A;  4RM9 A;  5L95 C;  1F0Z A;  2AQ2 B;  2J42 A;  4PS8 A;  3PT2 B;  1YNT E;  4GDK B;  2N4F A;  2WDR B;  2N9L A;  2QIE B;  2LGD A;  4XE0 A;  3I5J C;  2OJR A;  2J0J A;  1VCB A;  3NY5 A;  2LI5 A;  2IGG A;  3TUO A;  1LM8 B;  1RM6 C;  2JPH A;  2PJH A;  3RT3 B;  4NAW B;  3H7S A;  4IW0 A;  5HG2 A;  3ZQ4 A;  3Q3J A;  3MJ5 A;  3W1Y A;  2DYB A;  2M0A A;  2DHZ A;  4WWO A;  1ACC A;  2G4D B;  2EMS A;  3VXW A;  5FR3 A;  2BYF A;  2GI9 A;  3B9J A;  4W9H A;  3W2D A;  1Q10 A;  2LRW A;  2QIL A;  3SFE B;  1JQ4 A;  1OTR B;  1YMH E;  2YEP F;  3E9S A;  2KDE B;  2ZW0 A;  2C7M B;  4ANV A;  4CHK A;  5DPW A;  4TKN A;  2FE8 A;  4FLH A;  2EKI A;  4ZDV A;  3DVG X;  2WXF A;  4BKS D;  4B0E A;  3Q3M C;  4K7U A;  3NVY A;  1GB1 A;  1J7C A;  3ZNI D;  1VRA B;  1HTO A;  3ZDT A;  2G3Q B;  4GDK A;  2WU2 B;  1XLP A;  5JHA A;  2A5U A;  3KWL A;  1DOI A;  1FXI A;  2I1J A;  1STE A;  2ZCB A;  4MAC A;  5C1Z A;  2PVO D;  3BIN A;  3GE8 C;  1EUV B;  4KVG B;  5FKA C;  4DHZ B;  2J4X A;  2R2Q A;  4C7Y A;  2KT7 A;  1ZOY B;  1EF5 A;  4W9E A;  2FUG 1;  2LMC A;  1OGW A;  2JRI B;  1T0Y A;  1WJU A;  4YTP B;  4WWP A;  1C78 A;  2KN5 A;  2KTF A;  3R3M A;  4K81 A;  3I57 A;  3ZXR A;  2BKF A;  1AAR A;  2ZEQ A;  3ZKJ C;  2J52 A;  2IPK D;  1E7U A;  2GLS A;  3EGR A;  3BZD B;  2L83 A;  1XLN A;  2ZJD A;  3CST A;  2KWC A;  2C9W B;  1K50 A;  2DZK A;  3BYY B;  4KIK B;  1RWS A;  5CHV C;  1FCC C;  1H8C A;  2KZR A;  3QIJ A;  5LLI A;  4K7S A;  1KM7 A;  4IM0 A;  1PYW D;  3DBS A;  3DPD A;  4MSQ B;  4FHK A;  4P7I A;  2DAJ A;  3AE5 B;  3SEB A;  1DYQ A;  1TKE A;  2AL6 A;  2BT6 A;  4IDI A;  1ZXI A;  4M8M A;  3VTW A;  1FFU A;  4H2A A;  1L2N A;  5D3D A;  3BVG A;  1CQV A;  4YWG G;  3N20 C;  3FKY A;  4CO7 A;  4CQN A;  1UD7 A;  2WXR A;  1KH0 A;  2KDF B;  4MEM A;  3OJ3 A;  1CJE A;  1L0Y B;  3W9C B;  4WJO A;  2PTL A;  2KQ7 A;  1F2R C;  3KQ4 A;  2MP2 B;  4I6N B;  3RNG C;  2JF5 A;  3E56 A;  2ZZP B;  4RM8 A;  1Z2M A;  1SE2 A;  2IO3 B;  2WDQ B;  1V5O A;  3BY4 B;  1FEH A;  2AQ3 B;  4A6Q A;  5IOI A;  2BGF A;  2G45 B;  4OVZ A;  1JRP A;  1M4V A;  2INN E;  4A3P A;  2Z0D B;  3AE3 B;  4RMA A;  3T8M A;  3Q8A A;  1E7P B;  3NHE B;  5H92 C;  3UQA A;  3PLU A;  5IAA C;  3RPF C;  1WX8 A;  1OFF A;  5EE0 A;  1QQR A;  2L32 A;  4A3O A;  1DGJ A;  2SEB D;  2NPT B;  1TKY A;  2WXH A;  3P4Q B;  1NI2 A;  5AEK B;  1S3S G;  1TS3 A;  1WWT A;  2D2Q A;  3L16 A;  5HKH A;  3T3N A;  2LRU A;  2L76 A;  2WXI A;  2PE6 B;  4M01 A;  1FNU A;  4HJK A;  1E90 A;  2H89 B;  1I4X A;  3V60 A;  1DOY A;  3VTU A;  1L0V B;  4OZB A;  5DPR A;  2KLG A;  3VTV A;  2V3N A;  1I4R A;  3BVM A;  2OJW A;  2NS5 A;  3OAW A;  2ON8 A;  3Q8C A;  4PYU A;  2K6D B;  5CX3 A;  2CHW A;  1WYW B;  2IO0 B;  3K9P B;  2K8H A;  4YTM B;  4F1S A;  4JE3 B;  1XEE A;  3OWE B;  3V6C B;  4YSX B;  1A5R A;  1J19 A;  3ECI A;  2WXO A;  1P7F A;  1G6J A;  4B9K A;  4US8 A;  1TY0 A;  3A4R A;  1IBX A;  2FCM A;  2WLB A;  2KDB A;  1WFY A;  3LYY A;  4EZL A;  4ZYN A;  2Y3A A;  1PGA A;  1L5P A;  2G4S A;  3B0A A;  4BVU C;  1WE7 A;  1V1P A;  1ZDV A;  1OEY A;  1P1A A;  2XN9 C;  3WAM A;  2WDV B;  2BPS A;  3AM9 A;  1E8W A;  2WXG A;  4IWP A;  1WJN A;  4MGZ E;  3ZJT A;  3HM6 X;  4R3D A;  2W3S A;  4FHJ A;  4K3B A;  2MBH A;  2BS4 B;  3RYT A;  3DHH C;  2NTS A;  3WAO A;  4FBJ B;  3RD2 A;  1NEK B;  1C1Y B;  1TT5 B;  2QJL A;  4D2K A;  3O65 B;  1WE6 A;  3B1L X;  1VD2 A;  1L7Y A;  1WGG A;  2LUM A;  3I9V 1;  3M3J A;  1E7V A;  2YEP B;  2UWQ A;  4NAM A;  1FXT B;  3Q14 C;  2RD0 A;  2O2V A;  2KWD A;  3V6E B;  1GNU A;  3AU4 A;  2INP E;  4HJG E;  1FO4 A;  3ALB A;  2RSU A;  4YXD B;  4LCD E;  1HTQ A;  3RZF A;  1JWS D;  2WWZ A;  1D5M C;  2D3C A;  3W1S C;  3N1X C;  4PS7 A;  5GXG B;  2CR5 A;  1Z5S B;  3IFW B;  5CHW A;  1NDD A;  4FJY A;  4LDT B;  3BYT B;  4TUU A;  1FNV A;  3Q6B A;  1KF6 B;  4M8N A;  2BYT A;  2GB1 A;  3DWG C;  2LJI A;  2N9X A;  2W9N A;  1MI0 A;  1UBQ A;  2KMA A;  3PO0 A;  3M63 B;  2MHJ A;  4EE2 A;  3DOW A;  1L0X B;  3H1U A;  3P63 A;  3Q69 A;  2ZPY A;  2HE7 A;  2MWS B;  3APF A;  2UU7 A;  4WJN A;  4W9J A;  1WY8 A;  4IC7 B;  4P1B C;  2QDF A;  1F2R I;  4ACF A;  2Z59 B;  4LNF A;  4WQO B;  1I4Q A;  4IG7 B;  4JIO U;  2NR2 A;  4G50 A;  2XK5 B;  4S0R A;  2JT4 B;  5D7G A;  1QOA A;  2GBM A;  3PSE B;  5C3J B;  3DBR B;  1KFY B;  3R66 C;  4USA A;  1WF9 A;  2JX5 A;  3AEE B;  3RUI B;  4WAF A;  3IT4 B;  1IGD A;  3QK0 A;  3VVW B;  2FCN A;  2WXN A;  2E6X A;  2KJ6 A;  1JRU A;  1YQ4 B;  4AJW A;  2MJ3 A;  4FUL A;  3VRA B;  1L6V A;  3PRM B;  4ZRQ A;  4DBG A;  3N30 A;  3ZGZ A;  1WM2 A;  2IDY A;  3IAS 1;  5FK9 C;  1VZ8 A;  1VZ7 A;  4MGK E;  3AE2 B;  2AWT A;  2MBB B;  2ASQ A;  4KGT A;  1Y8R C;  2K39 A;  2KYW A;  2JZZ A;  1JAL A;  4GDL A;  4BAX A;  3NRZ A;  2PVG C;  3VDZ A;  1UBI A;  1YQ3 B;  4PYZ A;  1S1Q B;  3P4P B;  5D94 A;  2QEJ C;  1KRH A;  3CMM B;  5LXI B;  1L6U A;  3AEG B;  2XK5 A;  2IJ0 A;  2W3R A;  5IN7 A;  2L52 A;  1N5W A;  4DQO C;  4XDC A;  3PS6 A;  4C56 C;  4US9 A;  2ACZ B;  1C4A A;  2BKR B;  2DYO A;  2QC8 A;  4MH8 A;  3DVG Y;  5HHD G;  3GE3 C;  3MJW A;  4LDT D;  4BBN F;  2V4I B;  2D3B A;  5HFY A;  2Z8L A;  1MFW A;  1RLF A;  4WWN A;  2ZNV C;  3HM3 A;  4B0M A;  5JZE B;  3UGB B;  2BYV E;  3PTF C;  3VFK A;  5EDS A;  1WR6 E;  4FJV B;  2AL3 A;  2INC C;  2KTR B;  3KUD B;  1WGY A;  4WUR A;  2IO1 B;  1BXT A;  2ICI A;  2K8B A;  3BK1 A;  3OLM D;  3AE8 B;  2YLM A;  3PRP B;  1SXT A;  3QAR A;  4AWJ A;  2MJE A;  2HTM E;  3U8Z A;  4L23 A;  4OW0 A;  5H8Y E;  1HA5 A;  3TBL D;  3H8H A;  2RPQ A;  1WGD A;  4ZOH C;  1K53 A;  5E6J A;  1CK1 A;  2K8C A;  4C00 A;  4TMA B;  3TCA A;  2REX A;  3HIZ A;  3DQV A;  2IBI B;  3KYD D;  2PKO A;  2DZJ A;  2Y5P A;  3TL5 A;  2IZV B;  1TBE A;  1TS5 A;  2SAK A;  3AMZ A;  2DBY A;  4IWQ A;  4L2Y A;  2HJ8 A;  1FCL A;  1N5X A;  1WGR A;  3AN1 A;  1ZGU B;  2KDM A;  2OED A;  2JSV X;  2VH1 A;  4HKZ E;  1E8Z A;  2L3Z A;  1HXY D;  4YTN B;  4CYE A;  2D3A A;  1E5W A;  3RZW C;  3SHQ A;  3AEC B;  4DHJ B;  3ZRF A;  3DBL B;  3V3X A;  2NMQ A;  1FRD A;  3WAL A;  4GU2 A;  2WYQ A;  2XEW A;  4AS1 A;  1WSP A;  2Q5W D;  2BTE A;  3T3O A;  5BYR A;  2K25 A;  2Z0E B;  2BB6 A;  1D6E C;  1TIF A;  1UEL A;  4K3C A;  5E6O A;  2BB5 A;  3RUL A;  1OQQ A;  3NZS A;  3MHZ A;  5EE9 A;  3DBH B;  3VH3 B;  2QCZ A;  3NVZ A;  4ZRJ A;  1D3Z A;  4MSM B;  2JXT A;  2MQJ A;  2FAZ A;  3ZYY X;  1P0R A;  1F52 A;  3LXF A;  3CWI A;  2LD9 A;  1WMH B;  2LVO A;  2EEL A;  3Q2A C;  2HDE A;  2JYE A;  2JWZ A;  1UWX A;  3DBL I;  3W1S A;  5LXH A;  2IGH A;  1AN8 A;  3UIP B;  3PGE A;  4JPS A;  3C0R B;  5CHF A;  4DXG A;  4GIV A; 
#chains in the Genus database with same CATH homology
 2J0K A;  4JGH B;  2VRR B;  3APC A;  3ZTC A;  4A3O A;  1UH6 A;  2V1Y A;  4JLC A;  2LGX A;  2O6V B;  1J0G A;  2NPT B;  4NAW A;  2KLC A;  2DZM A;  1NI2 A;  2D07 B;  4X57 B;  2N1W A;  3IBE A;  5J2R A;  5AEK B;  1S3S G;  3DBH I;  1WJ6 A;  2BF8 B;  2D2Q A;  3L16 A;  4NJ6 A;  5HKH A;  1WXV A;  3WAP A;  4KV2 A;  2LRU A;  2KQS A;  2L76 A;  3GZN I;  4FA6 A;  3JSV B;  2PE6 B;  4HJK A;  1E90 A;  4W9G A;  4MGY E;  4W9F A;  2GBK A;  4BFR A;  3DDC B;  4MDK E;  1ISN A;  3V60 A;  2WDT B;  4AP4 C;  2C7H A;  2KXJ A;  2MW5 A;  3EC8 A;  4IM3 A;  3VTU A;  2NVU I;  2KVR A;  3QHT A;  2MRP A;  1H4R A;  2PEA A;  3KUZ A;  5DPR A;  2KLG A;  3VTV A;  4A20 A;  4AOF A;  3OAW A;  2NS5 A;  3IVF A;  4PYU A;  2K6D B;  4BOZ B;  5CX3 A;  3L54 A;  4NJ7 A;  2D10 A;  3ZIM A;  2BYE A;  2CHW A;  4DHZ E;  1WX7 A;  1WYW B;  3L08 A;  3UIN B;  2PPH A;  4IWO A;  1EF1 A;  2IO0 B;  2MBE A;  2UYZ B;  3M62 B;  3ZW3 A;  2RR9 A;  3K9P B;  2K8H A;  2EKE C;  4N9F 4;  3AI5 A;  2MX2 A;  5AZG A;  4NY0 A;  3K9O B;  2MA9 B;  4F1S A;  4DDG D;  1GJZ A;  3ZTD A;  5CTR C;  3V6C B;  2KMC A;  1V81 A;  3IHP C;  4EZJ A;  1WZ3 A;  1J19 A;  1P98 A;  1WH3 A;  3H9D A;  1Q1O A;  3ECI A;  4GDL B;  4MGI E;  1A5R A;  1G6J A;  4HCP B;  2ZVO A;  2PE9 A;  5BO4 B;  4HWI B;  5DPS A;  4B9K A;  2L0T A;  2LXC A;  3Q3F A;  3A4R A;  4EZK A;  1I35 A;  3ZNG C;  2D3G A;  2FCM A;  3QC8 B;  1WGH A;  2FCS A;  3APD A;  5J18 A;  1WJ4 A;  2KDB A;  1WFY A;  1U4A A;  4EZL A;  4MM3 A;  4ZYN A;  5JHB A;  3ZO5 B;  4MH0 E;  2ZNV B;  1V86 A;  2G4S A;  3VHT C;  1CMX B;  3JSV A;  2CS4 A;  2GMI C;  3B0A A;  4DHJ D;  1WXA A;  1YIW A;  4II2 B;  3SD5 A;  4BVU C;  2N1V A;  2JUO A;  3A1Q A;  3D32 A;  3ONS A;  4WJP A;  1WE7 A;  2GOW A;  2KTR A;  4GB9 A;  2N9E B;  4OVV A;  2EMT A;  1OEY A;  1P1A A;  3VUW A;  1RFA A;  2FCQ A;  3WAM A;  1F9J A;  1J8C A;  2LZ6 A;  2KO3 A;  1GC7 A;  3I3T B;  4EEW A;  2BPS A;  2JZ3 B;  1E8W A;  4BBN C;  1R4N I;  1V6E A;  1WJN A;  4IWP A;  2BWF A;  4KZC A;  4MGZ E;  3HM6 X;  2JRH A;  2WX1 A;  3KH0 A;  3L13 A;  2ZCC A;  4MJS B;  4DDI D;  4F7Z A;  4FHJ A;  1V9J A;  4GMV A;  2MBH A;  4ZRI A;  4G3X B;  5DCN A;  5AZF A;  3ZUN A;  3RYT A;  3NS8 A;  4BKG A;  2J0M A;  4W9C A;  3ZDM C;  4ANW A;  4KIK A;  4HPL B;  3WAO A;  4FBJ B;  3UF8 A;  3PRE A;  3RD2 A;  2KKC A;  4ANU A;  4DXA B;  3L0W B;  4M0W B;  1C1Y B;  3VUX A;  1YJ1 A;  1ZW7 A;  2N7D A;  2WX0 A;  3O65 B;  5AZH A;  1WE6 A;  3B1L X;  1VD2 A;  4W9L A;  1L7Y A;  1WGG A;  1WIA A;  2DYM A;  2NCN A;  4HCN B;  3H7P B;  3M3J A;  3PHW B;  1E7V A;  2UWQ A;  3DVN U;  2GBJ A;  2M8S A;  4E3C A;  3H6N A;  1TGZ B;  2LVQ A;  3R7Q A;  1LFD A;  3OJ4 B;  2MLB A;  1QZE A;  1FXT B;  3V61 A;  4HVB A;  2KAN A;  2RD0 A;  2O2V A;  3TMP B;  3VH4 B;  3S2A A;  3V6E B;  1Q0W B;  3N3K B;  5JH5 C;  1LQB A;  2K6Q A;  1GNU A;  3AU4 A;  5G2N A;  4WJQ A;  3ALB A;  2RSU A;  2MBQ A;  4LCD E;  3ZVV A;  4I6P A;  4B95 A;  3RZF A;  2WWZ A;  4E74 A;  3W1S C;  4NNJ B;  1KLV A;  1V49 A;  4PS7 A;  3TJP A;  2CR5 A;  2KC1 A;  3GOE A;  1Z5S B;  4URK A;  2CKH B;  2MP2 A;  4NQL B;  4W9I A;  3IFW B;  5CHW A;  1NDD A;  4KSK C;  4FJY A;  4GIV A;  4J6I A;  4LDT B;  1WXS A;  3EHV A;  1WXM A;  1GC6 A;  4TUU A;  4FJZ A;  4GN1 A;  4M8N A;  4II3 B;  2FID A;  2I1K A;  3KUC B;  5E6P A;  1E8X A;  4DWF A;  2KX3 A;  2GBN A;  1YX6 B;  4OVU A;  4AUQ C;  3IG3 A;  1LXD A;  3VAW A;  1HE8 A;  1K8R B;  3T9L A;  3ENE A;  3MHS D;  2N9X A;  1KOT A;  2W9N A;  2DX5 B;  4PS3 A;  1UBQ A;  2KMA A;  4EFO A;  5C23 A;  2A4Z A;  3M63 B;  1UGM A;  3LDZ E;  2IY1 B;  3QCA A;  2C7N B;  2L0F A;  3DOW A;  1WMH A;  2LVP A;  2J7Q B;  2KNB A;  2B3A A;  3AU5 A;  3H1U A;  2HTH A;  3QJZ A;  5D6J B;  4LJP B;  1SIF A;  1WR1 A;  2CHZ A;  2ZPY A;  2NBW B;  5KHO A;  2HE7 A;  5GMV A;  5E6N A;  2MWS B;  1ZKH A;  3APF A;  5J17 A;  1TTN A;  3QX1 A;  2LAS A;  4WJN A;  2KJR A;  4W9J A;  3PHX B;  1KJT A;  1WY8 A;  3DVN V;  3JVZ X;  4IC7 B;  4JQW C;  3WA0 A;  2LJ5 A;  1E8Y A;  4HDQ A;  4BKS A;  3A9J A;  4K1R B;  3M95 A;  2JVC A;  2YVC A;  3X23 A;  4ICU A;  2Z59 B;  2HD5 B;  3U30 A;  4WQO B;  4W9D A;  4NQK E;  4RM9 A;  2O6V A;  2NPT A;  4IG7 B;  5L95 C;  4JIO U;  2NR2 A;  3P2B A;  1YD8 U;  3A33 B;  2V3S A;  4ICV A;  4TV3 A;  2KK8 A;  2KFK B;  2FIF A;  4G50 A;  4PS8 A;  2XK5 B;  4HLE A;  2JT4 B;  3PT2 B;  5D7G A;  2GBM A;  4EOY A;  5DPT A;  3PSE B;  2V4L A;  3L17 A;  4GDK B;  4HDO A;  2N4F A;  2KFJ A;  4KZ0 A;  1RRB A;  2DAF A;  2LGD A;  3R66 C;  3X0W A;  2OJR A;  2J0J A;  1VCB A;  4HXD A;  3NY5 A;  1V2Y A;  1WF9 A;  2LI5 A;  3RUI B;  3NZU A;  2DZI A;  3ZRC A;  1LM8 B;  5L83 A;  4ZRK A;  2L8J A;  2JPH A;  2PJH A;  3RT3 B;  3UQB A;  3QK0 A;  1NBF C;  3VVW B;  2FCN A;  1YX5 B;  4NAW B;  2KJ6 A;  3H7S A;  3PVL A;  1JRU A;  3SU8 X;  2LUE A;  2IYD B;  4IW0 A;  4AJW A;  4FUL A;  1WI0 A;  3Q3J A;  3PRM B;  5TR5 A;  2D11 A;  1OEY J;  1Q5W B;  3ML9 A;  2DYB A;  3N30 A;  3W1Y A;  4DBG A;  3SDL C;  1WM2 A;  4HPM B;  2C60 A;  2DHZ A;  4WWO A;  2G4D B;  2DEN B;  2EMS A;  3VXW A;  2BYF A;  4HK2 A;  4MGK E;  2ZPN A;  4F8C B;  4W9H A;  2AWT A;  2MBB B;  2ASQ A;  1Y8R C;  2LRW A;  4EKU A;  1OTR B;  3HK0 A;  2KDE B;  4CHK A;  2C7M B;  2K39 A;  4ANV A;  5DPW A;  2NBU A;  2JZZ A;  4GDL A;  4TKN A;  2KC2 A;  3CSF A;  4FLH A;  3CF6 E;  4ZDV A;  2CHX A;  3DVG X;  1I42 A;  3VDZ A;  3EFU A;  1UBI A;  4WAA A;  4TQ0 A;  4PYZ A;  1S1Q B;  1EO6 A;  2JY6 A;  3A9K B;  1WX9 A;  3UIO B;  4BKS D;  4K7U A;  2IY0 B;  1PQS A;  3N32 A;  4KDI C;  5D94 A;  3AXC A;  2QHO A;  3ZNI D;  3CMM B;  5LXI B;  2O6V D;  2XK5 A;  3MTN B;  3ZDT A;  1SGH A;  2G3Q B;  2L05 A;  4GDK A;  2KD0 A;  3QWZ B;  4GOC A;  3VUY A;  5JHA A;  2RGF A;  4BOS C;  1XQQ A;  3PS6 A;  4JL9 A;  2A5U A;  3ZLZ A;  2BKR B;  2I1J A;  2DYO A;  3AUL A;  2ZCB A;  3QQ8 B;  4AJY B;  3B08 A;  3L10 B;  5C1Z A;  5IA7 A;  1XD3 B;  3BIN A;  3DVG Y;  2N9P C;  3WIM A;  1EUV B;  3MJW A;  4LDT D;  4KVG B;  4XC2 A;  4MEL A;  4BBN F;  2AYO B;  1RLF A;  2KJH B;  3NOB A;  4WWN A;  4DHZ B;  2ZNV C;  3HM3 A;  4MJS A;  2IO2 B;  2R2Q A;  5JZE B;  4I6L B;  1EF5 A;  1M94 A;  3WAN A;  3UGB B;  4W9E A;  4ANX A;  3A4S C;  2BYV E;  3PTF C;  3VFK A;  5EDS A;  2KX0 A;  1OGW A;  2JRI B;  1T0Y A;  2L00 B;  1WJU A;  1WR6 E;  3A1Q B;  4FJV B;  1SE9 A;  2OOB B;  4E71 A;  4WWP A;  2AL3 A;  2KTR B;  3KUD B;  2KN5 A;  1WGY A;  1WM3 A;  2KTF A;  2M4N A;  1IP9 A;  2IO1 B;  3R3M A;  2CU1 A;  2LXA A;  4K81 A;  3R7R A;  3LJ3 A;  2K8B A;  2K1F A;  3OLM D;  2YLM A;  3H7P A;  3DCG A;  3PRP B;  4YL8 A;  3QAR A;  3TIX A;  4ASW C;  4AWJ A;  2BKF A;  1AAR A;  2AEH A;  2ZEQ A;  3ZKJ C;  1E7U A;  2KDI A;  3JW0 X;  3U8Z A;  1TZ1 A;  3ZNH B;  4DK5 A;  3TBL D;  1OQY A;  2FUH B;  2RPQ A;  1WGD A;  2ZJD A;  3CST A;  3A9K A;  3VQI A;  2KWC A;  2C9W B;  2NBV B;  2DZK A;  2KWU B;  1IPG A;  4KIK B;  2K8C A;  5CHV C;  1H8C A;  2KZR A;  3TCA A;  2REX A;  3QIJ A;  5LLI A;  4K7S A;  2KHW B;  1KM7 A;  4IM0 A;  1BT0 A;  1XT9 B;  3PRZ A;  3DPD A;  3DQV A;  3DBS A;  3HIZ A;  4FHK A;  2MSE D;  2L7R A;  2DAJ A;  2IBI B;  4MSQ B;  3ZNZ B;  3KYD D;  2DZJ A;  1WRD B;  3TL5 A;  2AL6 A;  2IZV B;  2ZVN A;  4EUT A;  1TBE A;  1GUA B;  4TQ1 A;  4IWQ A;  3KYC D;  4M8M A;  3VTW A;  1L2N A;  1WZ0 A;  2HJ8 A;  1P3Q U;  2M1M A;  1WGR A;  1ZGU B;  2R2O A;  3KW5 B;  2Y5B B;  4GGQ A;  3V62 A;  3U7D A;  2LGY A;  3QAQ A;  2O2V B;  1E8Z A;  2L3Z A;  4XX5 A;  2KWV B;  4CYE A;  1GG3 A;  1E5W A;  3RZW C;  5FR6 A;  3SHQ A;  1UZX B;  3HHM A;  4DHJ B;  4CO7 A;  1UD7 A;  3ZRF A;  2XBB C;  2KDF B;  1V80 A;  4MEM A;  3WAL A;  4P7I A;  1C3T A;  3PLV A;  3OJ3 A;  4KDL B;  4GU2 A;  2WYQ A;  4WJO A;  1YQB A;  2XEW A;  2KQ7 A;  1V5T A;  3KVF B;  1R4M I;  2MP2 B;  2LWP A;  3PPA A;  2GBR A;  2JF5 A;  2K25 A;  4I6N B;  2Z0E B;  2MCN B;  4IM2 A;  1MG8 A;  4G11 A;  4GSW A;  2M0X A;  4G0N B;  4K7W A;  2BWE S;  1UEL A;  5E6O A;  5G55 A;  4FN2 A;  3RUL A;  2ZZP B;  4RM8 A;  4XZ4 A;  3NZS A;  1Z2M A;  2IO3 B;  3VH3 B;  3QA8 A;  4ZRJ A;  1D3Z A;  4MSM B;  1V5O A;  1X1M A;  3DBR I;  3BY4 B;  5KHQ A;  4IUM B;  3PZD A;  2MQJ A;  4B6W A;  2FAZ A;  1P0R A;  2BGF A;  2C5L C;  2G45 B;  2LD9 A;  4FAD A;  4LJO B;  3RCZ A;  2MBO A;  1WMH B;  2LVO A;  2M17 A;  4BKT A;  1P9D U;  5D2M B;  2JWZ A;  2KOX A;  4A3P A;  2KFK A;  2Z0D B;  3ML8 A;  4RMA A;  3JYU A;  3DBL I;  4GXB A;  2JXX A;  3T8M A;  3W1S A;  5LXH A;  3NHE B;  2N7E A;  3EEC A;  3PLU A;  4KSL C;  5IAA C;  3UIP B;  3UQA A;  1IYF A;  3PGE A;  1RAX A;  1WX8 A;  3C0R B;  2FNJ B;  5CHF A;  4W9K A;  3A9J B;  4NPN A;  3PV1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...