4ZDVA

Crystal structure of lc3 in complex with fam134b lir
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
126
structure length
126
Chain Sequence
DDFELLDGPSDRPFKQRRSFADRCKEVQQIRDQHPSKIPVIIERYKGEKQLPVLDKTKFLVPDHVNMSELVKIIRRRLQLNPTQAFFLLVNQHSMVSVSTPIADIYEQEKDEDGFLYMVYASQETF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Microtubule-associated proteins 1A/1B light chain 3A
publication title Regulation of endoplasmic reticulum turnover by selective autophagy.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein transport
total genus 35
structure length 126
sequence length 126
ec nomenclature
pdb deposition date 2015-04-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02991 Atg8 Autophagy protein Atg8 ubiquitin like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 4zdvA00
4ASWC 4M0WB 1WXSA 1UZXB 5GMVA 1PQSA 4EKUA 3AU5A 2D11A 4HDQA 4W9FA 1S1QB 1VCBA 2C7NB 2KDBA 4II3B 2C5LC 2JUOA 4W9HA 3QK0A 2HTHA 4URKA 2EMTA 3KYCD 4PS8A 1J8CA 3IHPC 3JW0X 2KC1A 2D10A 4NJ7A 4LJOB 4PYUA 5IA7A 1P9DU 2A4ZA 3WAMA 2ZJDA 1XQQA 1EO6A 2JY6A 2N1WA 5E6NA 2IZVB 3N3KB 4LCDE 2DYBA 3IG3A 5J17A 5EDSA 1Y8RC 2M17A 3HM3A 1YX5B 3WANA 2FAZA 3KVFB 4ANWA 1A5RA 4GDLB 2L3ZA 2M8SA 3U8ZA 2KJRA 2MBQA 5DPRA 2LXCA 2HD5B 1NDDA 1Z5SB 3L08A 4RM9A 3W1SA 3PRPB 2LRWA 1WIAA 2NR2A 1XD3B 2MQJA 3X0WA 1NBFC 4CO7A 1ZKHA 4BKTA 4HLEA 2KFJA 4M8NA 4FADA 2IBIB 4FBJB 3OJ3A 2KN5A 3PRMB 2IO3B 3M63B 2O6VB 4FN2A 2DZIA 4W9KA 1WYWB 3KUCB 3CF6E 4AOFA 1SGHA 3JSVB 4LJPB 3RULA 2RR9A 3U30A 1NI2A 2KMAA 3O65B 4WWOA 1WE6A 2L76A 2GBJA 2M1MA 2MBOA 3GZNI 4W9CA 3Q3JA 2IYDB 1WFYA 4DK5A 4IWPA 2M4NA 2LRUA 4ZRIA 3EHVA 1YX6B 4EOYA 2QHOA 2HE7A 3AXCA 5FR6A 3TIXA 3VVWB 2I1JA 2JRHA 2LZ6A 3MTNB 1V81A 5DPSA 3ZNGC 2MBEA 4JGHB 3VUXA 4B6WA 2WDTB 2FIFA 4MSMB 1E8WA 4LDTB 1M94A 2V1YA 4JLCA 4F7ZA 4IM0A 2AYOB 4PYZA 4MGKE 3L54A 2WYQA 3ML9A 4HK2A 4I6NB 2Y5BB 3DBHI 3K9OB 4B9KA 3ZRFA 2OJRA 2KANA 2KNBA 5D2MB 2UYZB 3APDA 3RCZA 2FCSA 3S2AA 2YVCA 3A1QA 2NPTB 2FIDA 3C0RB 3PT2B 3ENEA 4GDKA 3BY4B 1L2NA 2MP2B 2CR5A 2EKEC 4WWNA 5L83A 2G3QB 1IPGA 2AEHA 5AZGA 2REXA 3UINB 2BGFA 3A9JB 1Z2MA 2KDIA 4A20A 3APCA 2O2VB 2UWQA 2KWCA 4FLHA 1V9JA 2GOWA 1KJTA 2I1KA 4GIVA 2CKHB 2K6QA 1Q1OA 4EZKA 3DDCB 4GDLA 1U4AA 4IUMB 5E6OA 3VQIA 3KYDD 4DBGA 3QAQA 3AULA 1LM8B 2N4FA 4BFRA 2DENB 2CHWA 4IC7B 3NS8A 4BKGA 2FUHB 3DVGX 1GG3A 2KFKB 2BF8B 4FHKA 4KDLB 2IO1B 1L7YA 3T9LA 3QIJA 2GBNA 3A4RA 3X23A 3PREA 1WJNA 3L0WB 5G2NA 3W1SC 3APFA 4MGIE 4XZ4A 2ZPNA 3GOEA 1MG8A 5JHBA 4DWFA 3EECA 2L00B 5L95C 4W9EA 1UH6A 2C7MB 3H9DA 1KM7A 1UBIA 2O6VA 2JZ3B 3DBLI 2FCMA 1OQYA 1AARA 2RGFA 4KSKC 3ZNHB 2J7QB 2ZZPB 3PLUA 5JH5C 2MRPA 4AJYB 2LGYA 2NS5A 2L8JA 3UIOB 1V49A 2C9WB 2Z0DB 2AL3A 2GBKA 4WJPA 3TJPA 1RLFA 1WF9A 3HM6X 4AWJA 4IWOA 1SIFA 2DZMA 2K1FA 2KMCA 1WMHB 4IM3A 1YD8U 3OLMD 4A3OA 1GJZA 1WR6E 1V80A 1E7VA 1LXDA 2CU1A 4BKSA 3WA0A 2KO3A 1E90A 3U7DA 2NBUA 1BT0A 2K8BA 1H8CA 1WRDB 1WGHA 2HJ8A 2R2QA 4I6PA 4TV3A 4EEWA 2KTRA 4HPLB 4WJNA 3VH3B 4BOSC 4HDOA 3VHTC 5IAAC 1P3QU 4XC2A 1E7UA 2B3AA 4BOZB 4NJ6A 3ZRCA 2LI5A 1IYFA 1WGDA 4W9IA 5G55A 1TGZB 4IG7B 2G4SA 2ZPYA 3B08A 3OAWA 5LLIA 3PTFC 1V5OA 2VRRB 3W1YA 4G0NB 2KQSA 2BYEA 1K8RB 5E6PA 3MJWA 3DBSA 4KV2A 3PHWB 2KJHB 3ONSA 4IWQA 2JWZA 2KTFA 5D94A 4GOCA 2Z59B 2JPHA 2OOBB 4ZRKA 2LXAA 3M3JA 4TUUA 5CX3A 2O2VA 2FCNA 5C23A 2C7HA 1OGWA 2WX1A 4MJSB 4ICUA 5LXIB 3QC8B 2D3GA 3IVFA 2IY0B 3H7PA 3R3MA 1J19A 2XBBC 4IW0A 2RPQA 4MGZE 1JRUA 2CS4A 1WR1A 4M8MA 3ZO5B 2KXJA 3ZDMC 4WJOA 2KFKA 3LDZE 3PV1A 3V6EB 2GBMA 3R7RA 3ZNZB 2D07B 5KHQA 4G11A 3NZUA 4FULA 2XEWA 2MBHA 2MX2A 1I42A 4TQ0A 2MW5A 4DHJD 3N32A 2XK5A 1T0YA 1FXTB 1RRBA 1F9JA 1E8ZA 2Z0EB 4G50A 2KK8A 4ZDVA 3R66C 2KJ6A 3PS6A 3QWZB 1RFAA 4G3XB 2WWZA 3JVZX 4MDKE 1E8XA 2PJHA 3WIMA 1WXMA 3NY5A 4AUQC 4EUTA 4FHJA 1UELA 1V5TA 3CSFA 3KH0A 1LQBA 5DPWA 5CHWA 4W9GA 3HHMA 1R4NI 3PPAA 3B0AA 5D7GA 1WMHA 1D3ZA 2CHXA 2IY1B 3ML8A 5JHAA 4KIKB 2MBBB 3IBEA 1UGMA 2GMIC 4ANVA 3H6NA 4GB9A 3BINA 2BYVE 1V2YA 3UQBA 3UIPB 2ZNVC 5CTRC 3VTUA 4CYEA 2PE6B 3IFWB 2BYFA 3SHQA 3V6CB 3ZLZA 1WX9A 3PZDA 4NNJB 4HPMB 5AZHA 2LVOA 3QCAA 3L16A 2EMSA 4BBNF 1KLVA 3M62B 5DPTA 4GMVA 1XT9B 3VUYA 3CSTA 1WX8A 3L17A 2KWUB 2DAJA 3AU4A 3RT3B 4JQWC 2NVUI 4II2B 1GC6A 4AJWA 2L7RA 2PE9A 1KOTA 2PEAA 2RD0A 3H7SA 4GGQA 2JF5A 3DVNV 2K39A 3NHEB 3A9KB 3L13A 3PLVA 2R2OA 4KZ0A 4P7IA 3JSVA 3ZDTA 1C3TA 3SD5A 2LJ5A 1ISNA 2LASA 3ZIMA 2IO2B 1TBEA 3RZFA 3PHXB 1WGRA 2PPHA 3PSEB 2DHZA 3DBRI 1EF5A 2BKRB 2KLCA 1S3SG 2LUEA 4MJSA 3CMMB 4NAWB 4F8CB 4WAAA 5J2RA 4K1RB 2J0JA 2M0XA 3QARA 2MA9B 4HCNB 4DDGD 1OEYJ 2ZCCA 2MLBA 4W9JA 1P98A 1GUAB 3K9PB 1QZEA 4B95A 2DZKA 2NBWB 4FJYA 4MSQB 3QHTA 2KLGA 1HE8A 3QA8A 3A1QB 4HWIB 5C1ZA 1IP9A 3N30A 2JXXA 1E8YA 3P2BA 4GDKB 4HJKA 4ICVA 4K7SA 2V4LA 3DOWA 3PGEA 3UF8A 2IO0B 2MSED 3R7QA 4MEMA 4WJQA 2LD9A 4KSLC 1TTNA 4A3PA 4NQLB 1GC7A 3DVGY 5DCNA 3UQAA 2KVRA 1Q5WB 4GU2A 3I3TB 3PRZA 1Q0WB 4DDID 3WAOA 2NPTA 3LJ3A 1V86A 3ZKJC 1YQBA 5CHVC 3EFUA 2N7DA 2MP2A 1ZW7A 2JRIB 4KZCA 4RM8A 2NBVB 3ZTCA 2K25A 5D6JB 2ASQA 4WWPA 4BVUC 3A9JA 1CMXB 4OVUA 2N7EA 4DHZE 4KDIC 2KDFB 3QQ8B 4KIKA 1I35A 3VUWA 2KZRA 1WM2A 4TQ1A 4OVVA 2DYOA 3ALBA 4GSWA 3A33B 1RAXA 4NPNA 4EZLA 4PS7A 3OJ4B 1WJUA 4JIOU 4CHKA 2L05A 2KX3A 2D2QA 2O6VD 3RYTA 4XX5A 4WQOB 3AI5A 3TCAA 2ZVOA 3SU8X 2BKFA 3MHSD 4K7WA 3TMPB 4DHJB 4GXBA 1V6EA 3VDZA 2LVQA 2J0MA 3HIZA 3T8MA 3ZW3A 4MH0E 2V3SA 3EC8A 2BPSA 3L10B 2W9NA 2N9XA 1WI0A 3A9KA 1H4RA 3KW5B 2DX5B 4W9DA 1WZ0A 2KDEB 2LWPA 3VFKA 3QX1A 2LGXA 2GBRA 2G45B 3D32A 5HKHA 2AL6A 2ZNVB 4IM2A 3WALA 4DHZB 2WX0A 3SDLC 1TZ1A 2MWSB 3JYUA 1EF1A 1OTRB 4NAWA 3DVNU 3TL5A 1R4MI 4AP4C 4BKSD 2KWVB 4F1SA 1WGYA 3WAPA 1WXAA 1VD2A 2KTRB 2FCQA 2JT4B 1P0RA 4FJZA 4EFOA 3B1LX 4LDTD 5AZFA 4ANUA 2KHWB 4ANXA 2N9PC 2LGDA 3ECIA 4FJVB 4J6IA 3RZWC 3H1UA 1LFDA 2ZVNA 3Q3FA 4HXDA 2JVCA 4TKNA 5TR5A 2NCNA 4KVGB 1WJ6A 1WX7A 1WGGA 4K81A 2YLMA 4YL8A 3ZUNA 5JZEB 1YIWA 1OEYA 1G6JA 3ZNID 3M95A 2KQ7A 3PVLA 2KKCA 1E5WA 1J0GA 2AWTA 4W9LA 4MGYE 5KHOA 3NZSA 1C1YB 2MCNB 3TBLD 1WJ4A 1GNUA 2DAFA 4RMAA 2KD0A 1WH3A 4ZYNA 4E3CA 5J18A 2KC2A 2BWFA 3V60A 4N9F4 4HVBA 3DCGA 5AEKB 2K6DB 5CHFA 3VTVA 2DYMA 2RSUA 4BBNC 3HK0A 4JL9A 4NQKE 1WE7A 1UBQA 3V62A 2JZZA 3H7PB 2J0KA 3NOBA 4HCPB 1WM3A 2DZJA 2K8CA 4X57B 3KUZA 3V61A 5LXHA 2BWES 2LVPA 3DPDA 3KUDB 4MM3A 2ZCBA 1ZGUB 4GN1A 5BO4B 3VTWA 1X1MA 2KOXA 1WY8A 2ZEQA 4PS3A 4K7UA 3ZVVA 4EZJA 3ZTDA 3RUIB 3VXWA 4DXAB 1WXVA 3A4SC 4FA6A 3VAWA 4E71A 3UGBB 3VH4B 1EUVB 1SE9A 2K8HA 2L0FA 2CHZA 2A5UA 3DQVA 2N9EB 2FNJB 4I6LB 2N1VA 4E74A 1P1AA 1WZ3A 2KX0A 2XK5B 3QJZA 4MELA 4ZRJA 4NY0A 1YJ1A 2L0TA 1UD7A 2G4DB 3RD2A 2C60A
chains in the Genus database with same CATH superfamily
5GMVA 3TUOA 3AU5A 4W9FA 1MI0A 2KDBA 3AE5B 3BVMA 2C5LC 2D3AA 2HTHA 4URKA 3W9CB 4LJOB 3J9CA 4C00A 4WIPA 1C77A 3WAMA 1MG4A 2N1WA 2WXQA 4LCDE 3RNAC 1EWYC 4P1CC 2DYBA 1HA5A 4ANWA 2INDC 4GDLB 2WXIA 4KKIA 2LXCA 3W1SA 2BB5A 4BZAA 2MQJA 1R7SA 4PK1A 3DBLB 4FADA 4FBJB 1XF5L 3PRMB 4L1BA 1HQRD 3M63B 1N61A 2JYEA 2O6VB 4FN2A 2EELA 2KAJA 4AOFA 1P7EA 1SGHA 3RULA 1N62A 3O65B 3AE7B 1TT5B 1OFFA 4RF0A 3EHVA 1YX6B 2JWUA 1JRPA 3NRZA 5FR6A 2Y5PA 4IKGA 1FM0D 2I1JA 2LZ6A 3MTNB 2WXJA 2MBEA 3NJTA 4B6WA 2WDTB 1E8WA 4H2AA 1V8CA 2AYOB 3ML9A 3Q6BA 4HK2A 4KGRA 5D2MB 1K51A 2FCSA 3S2AA 2YVCA 1IGCA 3A1QA 2FIDA 3C0RB 2WXHA 4WWMA 3UI3A 3VR8B 1IPGA 1L0XB 2KDIA 4IDIA 1KJTA 1FCLA 2CKHB 4HKZE 1XCQL 1WYGA 4EZKA 1U4AA 2I38A 2KWDA 1J7CA 2CHWA 4DQOC 2D3CA 3DVGX 2KFKB 4KDLB 4A9AA 3T9LA 4B0MA 2GBNA 3A4RA 3L0WB 2ICIA 4MGIE 1AYFA 3GOEA 4S17A 2NTTA 5L95C 2JZ3B 2FCMA 5HFYA 3RNCC 2QSDA 2J7QB 1R4NB 2NS5A 3UIOB 1JW9D 2C9WB 2AL3A 3TJPA 2K22A 1WF9A 3HM6X 4IWOA 4OZBA 3OLMD 3Q3NC 4P16A 3AE8B 1AN8A 2XN9C 2NBUA 1C9FA 3H8HA 4JE3B 2R2QA 4KX6B 3Q69A 4WJNA 3VH3B 4BOSC 1D6EC 2ZW1A 2LGIA 4W9IA 2LMCA 1TGZB 2G4SA 3B08A 5LLIA 3PTFC 1V5OA 2RDBC 1K8RB 1HZ6A 4ARCA 3DBSA 1IGDA 1I4QA 2JWZA 3NVYA 2Z59B 2JPHA 4ZRKA 1TY2A 3P4PB 4TUUA 5CX3A 2O2VA 2C7HA 2BYTA 4ICUA 5LXIB 3QC8B 3ABVB 2IY0B 3H7PA 2MH7A 2PTLA 2RPQA 3ZO5B 3V6EB 4K3BA 3R7RA 1V1OA 1F1HA 3N9YC 5C2TB 4XYCA 2XK5A 3NVVA 1MVKA 4ZOHC 2H89B 3W2DA 4G3XB 1E8XA 2KDMA 1UELA 1V5TA 2LFIA 3N20C 2QJLA 2IGHA 3B2FA 3B0AA 1WMHA 2CHXA 2IY1B 3ML8A 5JHAA 4KIKB 1BXTA 2MBBB 4YSXB 1XCTL 3AEGB 3Q14C 3N1XC 4KGSA 4CYEA 2PE6B 3IFWB 2BYFA 1KF6B 3ZLZA 3GE8C 3PZDA 3E56A 3QCAA 4BBNF 3URYA 3VUYA 2W3SA 1L0VB 1L6UA 2FUG1 2PE9A 4A55A 1UUPA 1JWMD 2BTEA 1DGJA 4GGQA 2K39A 4KZ0A 2D3BA 1QF6A 2LJ5A 1FD6A 2W82A 3PHXB 1VZ6A 3CWIA 2LUEA 4F8CB 4K1RB 4LNKA 2E3TA 4ZHOA 3MC0B 4HROA 1FEHA 1P98A 1JWBD 4XDDA 4B95A 2OHFA 3EUB2 2DZKA 3QHTA 2KLGA 4EE2A 4HWIB 1QKZA 5C1ZA 4A20A 3P2BA 4GDKB 2ON8A 3DOWA 3PGEA 3IXSA 3R7QA 4A3PA 2LD9A 4NQLB 1RM6C 3DVGY 4GU2A 4LNIA 1Q0WB 3ZKJC 3AE9B 2QC8A 2N7DA 4RM8A 4O1NA 2ASQA 4REZA 1L5PA 4KDIC 3QQ8B 2KZRA 4OVVA 1JWSD 2Q5WD 1QOFA 1TS5A 1RAXA 3OJ4B 5FKAC 1DOYA 3RYTA 2ZVOA 3FILB 3Q8BA 4LNFA 2YEPB 1T0RC 4GXBA 1I4PA 3R8BA 2V3SA 1NYQA 5BYQA 2N9XA 1ZUD2 3A9KA 3SR6A 2KDEB 3P4QB 4OZCA 3WALA 2WX0A 1E6EB 3IAM1 2V4IB 1EF1A 2KWVB 3WAPA 5IKCM 3MP9A 4FJZA 5AZFA 3ECIA 2ZVNA 4HXDA 5G5GA 2JQRB 1OEYA 1J7AA 3ZNID 2KQ7A 1GNUA 3ZQ4A 1XXGA 5J18A 1HTOA 2WNMA 4K3CA 3HK0A 4JL9A 1HTQA 2JSVX 1TKYA 2JZZA 1TY0A 2DZJA 3DPDA 3KUDB 3AEAB 2ZCBA 1TS4A 4GN1A 4K7UA 1JWAD 1C76A 3A4SC 3UGBB 2WXNA 1ET9A 2N9EB 3B9JA 4ZRJA 2L52A 1TJEA 1SEBD 1PQSA 4HDQA 1S1QB 4II3B 1F2RC 2WXPA 3IHPC 2WXKA 2D10A 4PYUA 1P9DU 3AH7A 2JY6A 1EO6A 2IZVB 4RH6A 1T6BX 3DWMA 4N58A 3IG3A 3WANA 2FAZA 3KVFB 1A5RA 2L3ZA 2B76B 2ZW0A 1C78A 4AS1A 2KYWA 4BAXA 2INPE 3E9SA 1HXYD 1ZDVA 4CO7A 1ZKHA 4BKTA 4HLEA 2BB6A 4L2YA 2BS3B 2K5PA 3OJ3A 2KMMA 3I5JC 2DLBA 4W9KA 1WYWB 3CF6E 1WE6A 1ACCA 2GBJA 4GLSC 1WFYA 1XLNA 4DK5A 4ZRIA 2Z8LA 4LLGM 1AWDA 1SSNA 3VVWB 2JRHA 1V81A 3ZNGC 1KH0A 3BK2A 1CJEA 4MSMB 4C7ZA 1UWXA 4JLCA 4F7ZA 4HRSA 2WYQA 3AE6B 1SBBB 2WXRA 2Y5BB 3DBHI 4B9KA 2KNBA 2UYZB 3RCZA 1PFDA 1TS3A 4JX1C 3CIRB 2E6XA 3ENEA 4GDKA 2INNE 3BY4B 1L2NA 4KKJA 5L83A 1FNVA 2REXA 3UINB 2BGFA 4NAMA 2O2VB 1T5XD 4B0EA 1V9JA 2I1KA 2BS4B 3BK1A 3I57A 3DDCB 4IUMB 5E6OA 3PO0A 3KYDD 1ZP0B 5AUIA 1OQQA 1WSPA 1LM8B 1T0SC 2DENB 4ZRQA 1OQRA 1GG3A 4FHKA 5IP4D 1NI3A 2IO1B 3QIJA 2VZKB 3X23A 3PREA 3APFA 4J3OD 4XZ4A 1MG8A 3H9DA 1UBIA 3DBLI 1LGRA 2GRIA 4JWUC 1AARA 3FILA 1P7FA 3PLUA 2MRPA 2J52A 1K50A 2L8JA 2RDGA 2WU5B 3BVZA 1ESFA 2INCC 3BVGA 3FAHA 1SIFA 2DZMA 4IM3A 1WMHB 1YD8U 5MPOA 2NTSA 1V80A 4BKSA 2K3UA 1E90A 2KO3A 3R2TA 2AQ1B 2K8BA 1H8CA 1WRDB 1WGHA 2QIEB 4EEWA 1B9RA 4HDOA 3VHTC 2WS3B 4XC2A 3U4EG 3V05A 3ZRCA 2M56B 1ZXIA 5G55A 4IG7B 4M02A 3W1YA 3VRBB 4G0NB 1VZ8A 5E6PA 3PHWB 2KJHB 2LUMA 2WU2B 3BIID 2KTFA 1DOXA 4MM3B 3LYYA 3M3JA 5LNK1 5C23A 2OJWA 4RFBA 1I4XA 3DHHC 3VR9B 4M01A 2TSSA 1FMAD 1MFWA 3MC9A 3AM9A 3AB5A 3P1MA 2XBBC 1V1PA 1SJHD 5HG2A 3P4RB 1QT9A 1ROEA 1WXQA 3PV1A 4OW0A 3DHGC 2MBHA 2WXOA 4DHJD 5D3DA 2QILA 1JMLA 2FBWB 1RRBA 1E8ZA 3R66C 3RNFC 2WGSA 3SFEB 2PJHA 2CJNA 4EUTA 4R3DA 2KVZA 3KH0A 5DPWA 5CHWA 1R4NI 3PPAA 2H88B 1D3ZA 5D7GA 1WRIA 1NEKB 1WGKA 1QILA 1M4VA 1V2YA 3UQBA 2MEKA 1TIFA 2ZNVC 5CTRC 3V6CB 1WX9A 3IT4B 4NNJB 2ACZB 4HPMB 2LVOA 3L16A 2V9HA 4L23A 2KWUB 4JQWC 4A8XC 1XEEA 1GC6A 2L7RA 3P4SB 3C19A 3BYYB 3A9KB 3PLVA 2R2OA 4C4VA 1ISNA 1R4MB 2I2YA 1WGRA 1EF5A 1FRRA 2BKRB 4MJSA 5J2RA 2M0XA 2J4XA 3BZDB 3BWUD 2MLBA 2QEJC 3K9PB 4HJGE 4FJYA 4RGMA 4A6QA 1MHXA 4RF1A 4NZLB 4ICVA 2JXXA 4W9HA 4HJKA 2MSED 4KSLC 2WQYB 1GC7A 2PW9A 2KVRA 1Q5WB 3I3TB 1BMLC 1YQBA 3EFUA 3Q2AC 4KZCA 1ZW7A 3ZTCA 1C4PA 4TSSA 1CMXB 1LO5D 2GB1A 1I35A 2DNFA 1YN3A 4NPNA 4EZLA 1PDXA 1WJUA 4JIOU 4CHKA 2KX3A 2O6VD 3TEZA 3TCAA 1ZOYB 2BKFA 4WAFA 3TMPB 1V6EA 2XNAC 1XO3A 3VDZA 3HIZA 2J0MA 3T8MA 3AEFB 3ZW3A 2LJIA 3L10B 3EC8A 2BPSA 2WDQB 1H4RA 3KW5B 4W9DA 1FNUA 1WZ0A 1VZ7A 2GBRA 2G45B 2AL6A 2HTME 2ZNVB 1GAQB 3KWLA 4DHZB 3SDLC 3DVNU 3TL5A 1CK1A 1VD2A 2JT4B 4EFOA 5D3IB 1HEZE 2N9PC 2J53A 4TKNA 4Q2JA 2NCNA 1WJ6A 1WX7A 1WGGA 2YEPF 2YLMA 3ZUNA 1YIWA 1G6JA 1TYGB 1B1ZA 2AWTA 3NZSA 1C1YB 3TBLD 2DAFA 3VRAB 2KD0A 1WH3A 5EE1A 2K0PA 3V60A 3FKYA 4N9F4 3ZXVA 1QOAA 2JYTA 3VTVA 4BBNC 2DYMA 4YSZB 3V62A 3EFCA 3NOBA 4ZRPA 1WM3A 1I4HA 3DHIC 2X8XX 4MM3A 5BO4B 1X1MA 1WY8A 3TEXA 4PS3A 3ZVVA 3VXWA 4DXAB 1SE9A 5EE0A 3DQVA 4MACA 3AE4B 4I6LB 4E74A 1PUTA 2DBYA 1WZ3A 3QJZA 4MELA 1NVID 5H92C 4D2KA 4ASWC 1WXSA 1UZXB 4EKUA 1YN4A 2D11A 2C7NB 1YN5A 2EMTA 4PS8A 4NJ7A 5IA7A 3GE3C 5IOIA 2N9LA 1XLPA 5EDSA 1Y8RC 2IPKD 2M17A 3HM3A 4P6VF 3AE3B 2M8SA 3EA6A 3U8ZA 2KJRA 2MBQA 2HD5B 4WURA 3P42A 4YT0B 1V97A 1Z5SB 3L08A 4RM9A 3PRPB 4C7YA 1WIAA 2NR2A 1XD3B 5BYSA 1NBFC 2W3RA 3RNGC 1N5WA 2D5GA 4M8NA 5BMIA 2KN5A 3KUCB 2AX5A 3JSVB 4LJPB 1GOZA 2L76A 2M1MA 3Q3JA 5AUKA 2IYDB 1L4DB 1ZDXA 2M4NA 2LRUA 3TEYA 2QHOA 2HE7A 3AXCA 3TIXA 4JGHB 3VUXA 4LDTB 1M94A 4IM0A 1RFKA 4PYZA 4MGKE 3L54A 4NJCA 1GB4A 1SJED 3KQ4A 4I6NB 3ZRFA 2OJRA 3APDA 1TKEA 4XWWA 4M0WA 1MHHE 2MP2B 4DXGA 2CR5A 1T3QA 2FE8A 2AEHA 5AZGA 3Q3OC 3A9JB 1Z2MA 2BT6A 2UWQA 1KLGD 2KWCA 2GOWA 1N60A 2K6QA 1BUIC 3VQIA 2WP9B 4YTPB 4DBGA 3QAQA 3N1ZC 3AULA 2N4FA 1V1PB 1FXIA 2BBCA 4BFRA 3NS8A 3RFZB 2BF8B 1L7YA 2L83A 2W55A 1WJNA 2HDEA 3KLSX 4DWFA 3EECA 2L00B 5EE3A 2C7MB 1KM7A 3WCQA 3KWVA 1L4ZB 1OQYA 2RGFA 4KSKC 3ZNHB 1MJDA 2ZZPB 4AJYB 1N63A 1PGBA 2IDYA 4AWJA 2KMCA 2J42A 1GJZA 1WR6E 1E7VA 2CU1A 3WA0A 4KGTA 3U7DA 3ETRA 3EGRA 5T8IA 4I6PA 1D5ZC 1YMHE 4HPLB 5IAAC 1E7UA 2B3AA 4BOZB 4NJ6A 2LI5A 4ARIA 1WGDA 2MHJA 4ZHPA 3OAWA 1JWUD 2VRRB 1VLBA 3OG5A 2BYEA 2MJ3A 3ONSA 5D94A 3DBRB 4GOCA 4C56C 2LXAA 4C4VB 1I7HA 1OGWA 2WX1A 4MJSB 2LGSA 1RYJA 1UNSA 2D3GA 1VRAB 3HRDD 4IW0A 4MGZE 1JRUA 3W5VB 3Q8EA 2CS4A 4M8MA 3ZDMC 3LDZE 2GBMA 1Y56A 3ZNZB 5KHQA 4G11A 3NZUA 4FULA 2XEWA 1F0ZA 4M00A 1F52A 4TQ0A 4USAA 3N32A 3OWEB 1FXTB 4G50A 2KJ6A 3PS6A 3QWZB 2LHDA 1KFYB 2LEKA 2QDFA 3JVZX 4MDKE 3AE1B 4FHJA 3CSFA 2PLPA 4ACFA 4WQMA 3H6NA 1IBXA 2PVGC 3UIPB 3SHQA 2CJOA 3U7ZA 1C4CA 4RCOA 1KLVA 3TEWA 5DPTA 4GMVA 1E10A 2ONQA 3L17A 2NVUI 2RD0A 1PGAA 1N5XA 1YQ4B 3H7SA 3DVNV 3JSVA 2WXGA 3SFDB 3SD5A 3ZIMA 1EU3A 1TBEA 3PSEB 1FFUA 2KLCA 4TMAB 1D4BA 4FXCA 3CMMB 3IT6B 3QARA 2JXTA 4HCNB 4DDGD 1OEYJ 2GI9A 2ZCCA 4W9JA 1GUAB 1QZEA 3FC4A 1PGXA 4MSQB 1SE3A 1TZOA 2L1AA 1HE8A 3QA8A 1YNTE 1IP9A 3N30A 3NUHB 4K7SA 4MEMA 4WJQA 2JZPA 3UQAA 1Q10A 3WAOA 1A70A 1FNWA 2MP2A 2JRIB 2N7JA 2NBVB 5D6JB 4WWPA 1WWTA 3A9JA 5IN7A 2N7EA 2KDFB 1JROA 1TKGA 1WM2A 4IOIE 4TQ1A 5E6JA 2DYOA 2RPVA 3AN1A 3A33B 3NVWA 3HVZA 2JU6X 1YQ3B 4XDCA 5H8YE 1C4AA 1KRHA 2LVQA 2SEBD 2W9NA 4YXDB 2WXFA 3V3XA 2DX5B 2LWPA 3QX1A 2LGXA 3D32A 4IM2A 5TSSA 3JYUA 1OTRB 4NAWA 1R4MI 1ZXHA 1WGYA 2KTRB 2FCQA 1P0RA 3B1LX 4ANUA 4ANXA 3RZWC 4FJVB 3AMZA 3H1UA 3L4PA 1LFDA 2RDHA 2JVCA 2W54A 4KVGB 5C3JB 1SXTA 3M95A 1J0GA 1E5WA 3MJ5A 3W5UB 4MGYE 3DWGC 2MCNB 4ZYNA 2PVOD 4E3CA 2KC2A 4UDUC 2NMQA 5AEKB 2K6DB 1SE4A 4NQKE 1WE7A 1UBQA 1ET6A 3NZ3A 1N6ZA 3NVZA 2J0KA 2N0SB 4HCPB 2K8CA 4X57B 3KUZA 5LXHA 2BWES 2LVPA 1ZGUB 2KOXA 2WLBA 4EZJA 5JXVA 3RUIB 2M0AA 4E71A 2K8HA 2VZKD 2CHZA 2A5UA 2V0GA 2N1VA 1P1AA 2L0TA 2G4DB 3RD2A 2C60A 3MC8A 4M0WB 2MJDA 1VCBA 2JUOA 3QK0A 4LTUA 3KYCD 1J8CA 2N9KA 3JW0X 2KC1A 4ITKA 2PIAA 3I9V1 1SIJA 2A4ZA 2ZJDA 1XQQA 4PT5A 5E6NA 3N3KB 1VDVA 2X38A 5J17A 2DWQA 1YX5B 4MH8A 3Q8AA 5GXGB 4US8A 5DPRA 2CU3A 1NDDA 2LRWA 3X0WA 2BS2B 1VR9A 2KFJA 2IBIB 2V3PA 2KT7A 2IO3B 4N59A 2RMMA 2DZIA 3ZJVA 4YTMB 2RR9A 3U30A 1NI2A 2KMAA 4WWOA 1I4RA 3GZNI 2MBOA 4YSYB 4W9CA 3R2IA 4HPPA 4RGTA 4IWPA 5BMGA 4OZAA 4EOYA 1EU4A 1UF0A 1XLOA 4CQNA 1DYQA 3ZXRA 4XWTA 5DPSA 4QAYA 2FIFA 5IO9A 3MFGA 2V1YA 3K9OB 1SB3C 1GPXA 3Q8FA 2KANA 4RGOS 2NPTB 1ZE3D 3PT2B 3IAS1 2EKEC 4WWNA 2K9XA 2G3QB 1FXAA 3AEDB 3GZNB 1PYWD 1FPYA 3APCA 1CZPA 4FLHA 4GIVA 4YTNB 1Q1OA 2KN4A 4GDLA 4XGAB 4MT5A 4IC7B 4BKGA 2FUHB 4OVZA 2QMTA 3Q8CA 5G2NA 3W1SC 2ZPNA 1E0ZA 1RWSA 5JHBA 4W9EA 1UH6A 2O6VA 1SE2A 1FCCC 4DXFA 4RNAA 5JH5C 2HJ1A 2LGYA 1V49A 2WDVB 2Z0DB 4WJPA 2GBKA 1RLFA 3GS2A 4HKQA 2K1FA 1KTKA 2IGDA 4A3OA 3T3OA 3ZJUA 1LXDA 1MPEA 1IBXB 1BT0A 2HJ8A 4HEA1 4TV3A 3AEBB 2KTRA 2Y5CA 3O13A 5FK9C 3HUIA 1P3QU 2M19A 5G5HA 1IYFA 2ZPYA 3MHZA 1ZPSA 2KQSA 3GB1A 1K53A 3MJWA 4KV2A 2VH2A 4IWQA 2BW2A 2OOBB 2FCNA 1YOVB 1K52A 1XLQA 1T0QC 3IVFA 3T3NA 1J7BA 1VJKA 3R3MA 1J19A 5EE9A 3AV8A 2MJEA 1WR1A 3RN9C 2KXJA 3RI7C 4WJOA 2KFKA 3Q3MC 2D07B 3AEEB 5HHDG 2MX2A 2WXMA 2WHIA 1I42A 2MW5A 1UWMA 4LK0M 1T0YA 2EKIA 1F9JA 2Z0EB 4ZDVA 2KK8A 3C8YA 1RFAA 2WWZA 1AW7A 1NYRA 3WIMA 3LXFA 1WXMA 3NY5A 3ZYYX 4AUQC 1LQBA 2R61A 4W9GA 3HHMA 1QQRA 2BQQA 2SAKA 4RGNA 5HI1A 1FIQA 2VH1A 3P63A 3IBEA 1UGMA 2GMIC 5FR3A 1EWCA 4ANVA 4GB9A 3BINA 2BYVE 3VTUA 2JX5A 1I4GA 2AQ3B 2WXLA 5AZHA 2EMSA 3M62B 3B2GA 1QLBB 5BYRA 1FO4A 1XT9B 2Y3AA 3CSTA 1WX8A 2KACA 1QOBA 2DAJA 3AU4A 3RT3B 4II2B 4AJWA 1KOTA 3AECB 1SF0A 2PEAA 2JF5A 3NHEB 3L13A 1F77A 4P7IA 3ZDTA 1C3TA 2LASA 2IO2B 3RZFA 2PPHA 2DHZA 3DBRI 1S3SG 3SEBA 1L0YB 3ZGZA 4NAWB 1EM7A 4WAAA 3TSSA 2J0JA 2MA9B 3U52E 4XE0A 1E7PB 3NG0A 3I63C 2NBWB 1STEA 3A1QB 2WDRB 1E8YA 1TS2A 2V4LA 4C80A 3UF8A 2IGGA 2LHEA 2IO0B 1GB1A 5I4DA 1TTNA 1QOGA 2G1EA 5DCNA 1FFVA 3PRZA 4DDID 2NPTA 3LJ3A 1V86A 4S0RA 5CHVC 1D5MC 1YJJA 2K25A 4BVUC 1IUEA 2G9HD 4OVUA 4DHZE 4KIKA 3VUWA 3N1YC 1UGJA 2IJ0A 3ALBA 1JALA 4GSWA 3NS1A 4PS7A 3RNBC 2L05A 2D2QA 4XX5A 4WQOB 3AI5A 3SU8X 3MHSD 4K7WA 3LB8C 4DHJB 1F2RI 1E9MA 3ZJTA 4MH0E 3BYTB 1WI0A 3RMKC 1JQ4A 3VFKA 1CQVA 5HKHA 4AQ7A 1C79A 2GLSA 3PZ8A 1TZ1A 2MWSB 4BKSD 4AP4C 4WH4A 1NENB 4F1SA 1WXAA 3HVDA 4LDTD 4LNOA 2KHWB 3U2SC 4N6EB 2LGDA 4J6IA 4A90A 4OHJA 3Q3FA 2KQ4X 5TR5A 1L6VA 1FRDA 2OEDA 4US9A 4P1BC 4YL8A 4K81A 5JZEB 3PVLA 2KKCA 4W9LA 1D5XC 5KHOA 1WJ4A 4RMAA 1JCKB 1DOIA 2BWFA 4HVBA 3DCGA 2QCZA 5CHFA 2RSUA 1HZ5A 3RPFC 3H7PB 3V61A 1ENFA 4YWGG 4JPSA 4LNNA 2V3NA 3VTWA 2ZEQA 5BMHA 3ZTDA 3AE2B 1WXVA 2BVCA 3DBHB 3RNEC 4FA6A 3VAWA 2PKOA 3VH4B 1YJIA 1EUVB 2L0FA 3PZ7A 4JWSC 2FNJB 2UU7A 2L32A 2KX0A 2XK5B 1KLUD 4NY0A 4ZYSA 2AQ2B 1YJ1A 1UD7A 2PMVA 3GP7A
chains in the Genus database with same CATH topology
4ASWC 4M0WB 1WXSA 1UZXB 5GMVA 1PQSA 4EKUA 3AU5A 2D11A 4HDQA 4W9FA 1S1QB 1VCBA 2C7NB 2KDBA 4II3B 2C5LC 2JUOA 4W9HA 3QK0A 2HTHA 4URKA 2EMTA 3KYCD 4PS8A 1J8CA 3IHPC 3JW0X 2KC1A 2D10A 4NJ7A 4LJOB 4PYUA 5IA7A 1P9DU 2A4ZA 3WAMA 2ZJDA 1XQQA 1EO6A 2JY6A 2N1WA 5E6NA 2IZVB 3N3KB 4LCDE 2DYBA 3IG3A 5J17A 5EDSA 1Y8RC 2M17A 3HM3A 1YX5B 3WANA 2FAZA 3KVFB 4ANWA 1A5RA 4GDLB 2L3ZA 2M8SA 3U8ZA 2KJRA 2MBQA 5DPRA 2LXCA 2HD5B 1NDDA 1Z5SB 3L08A 4RM9A 3W1SA 3PRPB 2LRWA 1WIAA 2NR2A 1XD3B 2MQJA 3X0WA 1NBFC 4CO7A 1ZKHA 4BKTA 4HLEA 2KFJA 4M8NA 4FADA 2IBIB 4FBJB 3OJ3A 2KN5A 3PRMB 2IO3B 3M63B 2O6VB 4FN2A 2DZIA 4W9KA 1WYWB 3KUCB 3CF6E 4AOFA 1SGHA 3JSVB 4LJPB 3RULA 2RR9A 3U30A 1NI2A 2KMAA 3O65B 4WWOA 1WE6A 2L76A 2GBJA 2M1MA 2MBOA 3GZNI 4W9CA 3Q3JA 2IYDB 1WFYA 4DK5A 4IWPA 2M4NA 2LRUA 4ZRIA 3EHVA 1YX6B 4EOYA 2QHOA 2HE7A 3AXCA 5FR6A 3TIXA 3VVWB 2I1JA 2JRHA 2LZ6A 3MTNB 1V81A 5DPSA 3ZNGC 2MBEA 4JGHB 3VUXA 4B6WA 2WDTB 2FIFA 4MSMB 1E8WA 4LDTB 1M94A 2V1YA 4JLCA 4F7ZA 4IM0A 2AYOB 4PYZA 4MGKE 3L54A 2WYQA 3ML9A 4HK2A 4I6NB 2Y5BB 3DBHI 3K9OB 4B9KA 3ZRFA 2OJRA 2KANA 2KNBA 5D2MB 2UYZB 3APDA 3RCZA 2FCSA 3S2AA 2YVCA 3A1QA 2NPTB 2FIDA 3C0RB 3PT2B 3ENEA 4GDKA 3BY4B 1L2NA 2MP2B 2CR5A 2EKEC 4WWNA 5L83A 2G3QB 1IPGA 2AEHA 5AZGA 2REXA 3UINB 2BGFA 3A9JB 1Z2MA 2KDIA 4A20A 3APCA 2O2VB 2UWQA 2KWCA 4FLHA 1V9JA 2GOWA 1KJTA 2I1KA 4GIVA 2CKHB 2K6QA 1Q1OA 4EZKA 3DDCB 4GDLA 1U4AA 4IUMB 5E6OA 3VQIA 3KYDD 4DBGA 3QAQA 3AULA 1LM8B 2N4FA 4BFRA 2DENB 2CHWA 4IC7B 3NS8A 4BKGA 2FUHB 3DVGX 1GG3A 2KFKB 2BF8B 4FHKA 4KDLB 2IO1B 1L7YA 3T9LA 3QIJA 2GBNA 3A4RA 3X23A 3PREA 1WJNA 3L0WB 5G2NA 3W1SC 3APFA 4MGIE 4XZ4A 2ZPNA 3GOEA 1MG8A 5JHBA 4DWFA 3EECA 2L00B 5L95C 4W9EA 1UH6A 2C7MB 3H9DA 1KM7A 1UBIA 2O6VA 2JZ3B 3DBLI 2FCMA 1OQYA 1AARA 2RGFA 4KSKC 3ZNHB 2J7QB 2ZZPB 3PLUA 5JH5C 2MRPA 4AJYB 2LGYA 2NS5A 2L8JA 3UIOB 1V49A 2C9WB 2Z0DB 2AL3A 2GBKA 4WJPA 3TJPA 1RLFA 1WF9A 3HM6X 4AWJA 4IWOA 1SIFA 2DZMA 2K1FA 2KMCA 1WMHB 4IM3A 1YD8U 3OLMD 4A3OA 1GJZA 1WR6E 1V80A 1E7VA 1LXDA 2CU1A 4BKSA 3WA0A 2KO3A 1E90A 3U7DA 2NBUA 1BT0A 2K8BA 1H8CA 1WRDB 1WGHA 2HJ8A 2R2QA 4I6PA 4TV3A 4EEWA 2KTRA 4HPLB 4WJNA 3VH3B 4BOSC 4HDOA 3VHTC 5IAAC 1P3QU 4XC2A 1E7UA 2B3AA 4BOZB 4NJ6A 3ZRCA 2LI5A 1IYFA 1WGDA 4W9IA 5G55A 1TGZB 4IG7B 2G4SA 2ZPYA 3B08A 3OAWA 5LLIA 3PTFC 1V5OA 2VRRB 3W1YA 4G0NB 2KQSA 2BYEA 1K8RB 5E6PA 3MJWA 3DBSA 4KV2A 3PHWB 2KJHB 3ONSA 4IWQA 2JWZA 2KTFA 5D94A 4GOCA 2Z59B 2JPHA 2OOBB 4ZRKA 2LXAA 3M3JA 4TUUA 5CX3A 2O2VA 2FCNA 5C23A 2C7HA 1OGWA 2WX1A 4MJSB 4ICUA 5LXIB 3QC8B 2D3GA 3IVFA 2IY0B 3H7PA 3R3MA 1J19A 2XBBC 4IW0A 2RPQA 4MGZE 1JRUA 2CS4A 1WR1A 4M8MA 3ZO5B 2KXJA 3ZDMC 4WJOA 2KFKA 3LDZE 3PV1A 3V6EB 2GBMA 3R7RA 3ZNZB 2D07B 5KHQA 4G11A 3NZUA 4FULA 2XEWA 2MBHA 2MX2A 1I42A 4TQ0A 2MW5A 4DHJD 3N32A 2XK5A 1T0YA 1FXTB 1RRBA 1F9JA 1E8ZA 2Z0EB 4G50A 2KK8A 4ZDVA 3R66C 2KJ6A 3PS6A 3QWZB 1RFAA 4G3XB 2WWZA 3JVZX 4MDKE 1E8XA 2PJHA 3WIMA 1WXMA 3NY5A 4AUQC 4EUTA 4FHJA 1UELA 1V5TA 3CSFA 3KH0A 1LQBA 5DPWA 5CHWA 4W9GA 3HHMA 1R4NI 3PPAA 3B0AA 5D7GA 1WMHA 1D3ZA 2CHXA 2IY1B 3ML8A 5JHAA 4KIKB 2MBBB 3IBEA 1UGMA 2GMIC 4ANVA 3H6NA 4GB9A 3BINA 2BYVE 1V2YA 3UQBA 3UIPB 2ZNVC 5CTRC 3VTUA 4CYEA 2PE6B 3IFWB 2BYFA 3SHQA 3V6CB 3ZLZA 1WX9A 3PZDA 4NNJB 4HPMB 5AZHA 2LVOA 3QCAA 3L16A 2EMSA 4BBNF 1KLVA 3M62B 5DPTA 4GMVA 1XT9B 3VUYA 3CSTA 1WX8A 3L17A 2KWUB 2DAJA 3AU4A 3RT3B 4JQWC 2NVUI 4II2B 1GC6A 4AJWA 2L7RA 2PE9A 1KOTA 2PEAA 2RD0A 3H7SA 4GGQA 2JF5A 3DVNV 2K39A 3NHEB 3A9KB 3L13A 3PLVA 2R2OA 4KZ0A 4P7IA 3JSVA 3ZDTA 1C3TA 3SD5A 2LJ5A 1ISNA 2LASA 3ZIMA 2IO2B 1TBEA 3RZFA 3PHXB 1WGRA 2PPHA 3PSEB 2DHZA 3DBRI 1EF5A 2BKRB 2KLCA 1S3SG 2LUEA 4MJSA 3CMMB 4NAWB 4F8CB 4WAAA 5J2RA 4K1RB 2J0JA 2M0XA 3QARA 2MA9B 4HCNB 4DDGD 1OEYJ 2ZCCA 2MLBA 4W9JA 1P98A 1GUAB 3K9PB 1QZEA 4B95A 2DZKA 2NBWB 4FJYA 4MSQB 3QHTA 2KLGA 1HE8A 3QA8A 3A1QB 4HWIB 5C1ZA 1IP9A 3N30A 2JXXA 1E8YA 3P2BA 4GDKB 4HJKA 4ICVA 4K7SA 2V4LA 3DOWA 3PGEA 3UF8A 2IO0B 2MSED 3R7QA 4MEMA 4WJQA 2LD9A 4KSLC 1TTNA 4A3PA 4NQLB 1GC7A 3DVGY 5DCNA 3UQAA 2KVRA 1Q5WB 4GU2A 3I3TB 3PRZA 1Q0WB 4DDID 3WAOA 2NPTA 3LJ3A 1V86A 3ZKJC 1YQBA 5CHVC 3EFUA 2N7DA 2MP2A 1ZW7A 2JRIB 4KZCA 4RM8A 2NBVB 3ZTCA 2K25A 5D6JB 2ASQA 4WWPA 4BVUC 3A9JA 1CMXB 4OVUA 2N7EA 4DHZE 4KDIC 2KDFB 3QQ8B 4KIKA 1I35A 3VUWA 2KZRA 1WM2A 4TQ1A 4OVVA 2DYOA 3ALBA 4GSWA 3A33B 1RAXA 4NPNA 4EZLA 4PS7A 3OJ4B 1WJUA 4JIOU 4CHKA 2L05A 2KX3A 2D2QA 2O6VD 3RYTA 4XX5A 4WQOB 3AI5A 3TCAA 2ZVOA 3SU8X 2BKFA 3MHSD 4K7WA 3TMPB 4DHJB 4GXBA 1V6EA 3VDZA 2LVQA 2J0MA 3HIZA 3T8MA 3ZW3A 4MH0E 2V3SA 3EC8A 2BPSA 3L10B 2W9NA 2N9XA 1WI0A 3A9KA 1H4RA 3KW5B 2DX5B 4W9DA 1WZ0A 2KDEB 2LWPA 3VFKA 3QX1A 2LGXA 2GBRA 2G45B 3D32A 5HKHA 2AL6A 2ZNVB 4IM2A 3WALA 4DHZB 2WX0A 3SDLC 1TZ1A 2MWSB 3JYUA 1EF1A 1OTRB 4NAWA 3DVNU 3TL5A 1R4MI 4AP4C 4BKSD 2KWVB 4F1SA 1WGYA 3WAPA 1WXAA 1VD2A 2KTRB 2FCQA 2JT4B 1P0RA 4FJZA 4EFOA 3B1LX 4LDTD 5AZFA 4ANUA 2KHWB 4ANXA 2N9PC 2LGDA 3ECIA 4FJVB 4J6IA 3RZWC 3H1UA 1LFDA 2ZVNA 3Q3FA 4HXDA 2JVCA 4TKNA 5TR5A 2NCNA 4KVGB 1WJ6A 1WX7A 1WGGA 4K81A 2YLMA 4YL8A 3ZUNA 5JZEB 1YIWA 1OEYA 1G6JA 3ZNID 3M95A 2KQ7A 3PVLA 2KKCA 1E5WA 1J0GA 2AWTA 4W9LA 4MGYE 5KHOA 3NZSA 1C1YB 2MCNB 3TBLD 1WJ4A 1GNUA 2DAFA 4RMAA 2KD0A 1WH3A 4ZYNA 4E3CA 5J18A 2KC2A 2BWFA 3V60A 4N9F4 4HVBA 3DCGA 5AEKB 2K6DB 5CHFA 3VTVA 2DYMA 2RSUA 4BBNC 3HK0A 4JL9A 4NQKE 1WE7A 1UBQA 3V62A 2JZZA 3H7PB 2J0KA 3NOBA 4HCPB 1WM3A 2DZJA 2K8CA 4X57B 3KUZA 3V61A 5LXHA 2BWES 2LVPA 3DPDA 3KUDB 4MM3A 2ZCBA 1ZGUB 4GN1A 5BO4B 3VTWA 1X1MA 2KOXA 1WY8A 2ZEQA 4PS3A 4K7UA 3ZVVA 4EZJA 3ZTDA 3RUIB 3VXWA 4DXAB 1WXVA 3A4SC 4FA6A 3VAWA 4E71A 3UGBB 3VH4B 1EUVB 1SE9A 2K8HA 2L0FA 2CHZA 2A5UA 3DQVA 2N9EB 2FNJB 4I6LB 2N1VA 4E74A 1P1AA 1WZ3A 2KX0A 2XK5B 3QJZA 4MELA 4ZRJA 4NY0A 1YJ1A 2L0TA 1UD7A 2G4DB 3RD2A 2C60A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4ASW C;  4M0W B;  1WXS A;  1UZX B;  5GMV A;  1PQS A;  4EKU A;  3AU5 A;  2D11 A;  4HDQ A;  4W9F A;  1S1Q B;  1VCB A;  2C7N B;  2KDB A;  4II3 B;  2C5L C;  2JUO A;  4W9H A;  3QK0 A;  2HTH A;  4URK A;  2EMT A;  3KYC D;  4PS8 A;  1J8C A;  3IHP C;  3JW0 X;  2KC1 A;  2D10 A;  4NJ7 A;  4LJO B;  4PYU A;  5IA7 A;  1P9D U;  2A4Z A;  3WAM A;  2ZJD A;  1XQQ A;  1EO6 A;  2JY6 A;  2N1W A;  5E6N A;  2IZV B;  3N3K B;  4LCD E;  2DYB A;  3IG3 A;  5J17 A;  5EDS A;  1Y8R C;  2M17 A;  3HM3 A;  1YX5 B;  3WAN A;  2FAZ A;  3KVF B;  4ANW A;  1A5R A;  4GDL B;  2L3Z A;  2M8S A;  3U8Z A;  2KJR A;  2MBQ A;  5DPR A;  2LXC A;  2HD5 B;  1NDD A;  1Z5S B;  3L08 A;  4RM9 A;  3W1S A;  3PRP B;  2LRW A;  1WIA A;  2NR2 A;  1XD3 B;  2MQJ A;  3X0W A;  1NBF C;  4CO7 A;  1ZKH A;  4BKT A;  4HLE A;  2KFJ A;  4M8N A;  4FAD A;  2IBI B;  4FBJ B;  3OJ3 A;  2KN5 A;  3PRM B;  2IO3 B;  3M63 B;  2O6V B;  4FN2 A;  2DZI A;  4W9K A;  1WYW B;  3KUC B;  3CF6 E;  4AOF A;  1SGH A;  3JSV B;  4LJP B;  3RUL A;  2RR9 A;  3U30 A;  1NI2 A;  2KMA A;  3O65 B;  4WWO A;  1WE6 A;  2L76 A;  2GBJ A;  2M1M A;  2MBO A;  3GZN I;  4W9C A;  3Q3J A;  2IYD B;  1WFY A;  4DK5 A;  4IWP A;  2M4N A;  2LRU A;  4ZRI A;  3EHV A;  1YX6 B;  4EOY A;  2QHO A;  2HE7 A;  3AXC A;  5FR6 A;  3TIX A;  3VVW B;  2I1J A;  2JRH A;  2LZ6 A;  3MTN B;  1V81 A;  5DPS A;  3ZNG C;  2MBE A;  4JGH B;  3VUX A;  4B6W A;  2WDT B;  2FIF A;  4MSM B;  1E8W A;  4LDT B;  1M94 A;  2V1Y A;  4JLC A;  4F7Z A;  4IM0 A;  2AYO B;  4PYZ A;  4MGK E;  3L54 A;  2WYQ A;  3ML9 A;  4HK2 A;  4I6N B;  2Y5B B;  3DBH I;  3K9O B;  4B9K A;  3ZRF A;  2OJR A;  2KAN A;  2KNB A;  5D2M B;  2UYZ B;  3APD A;  3RCZ A;  2FCS A;  3S2A A;  2YVC A;  3A1Q A;  2NPT B;  2FID A;  3C0R B;  3PT2 B;  3ENE A;  4GDK A;  3BY4 B;  1L2N A;  2MP2 B;  2CR5 A;  2EKE C;  4WWN A;  5L83 A;  2G3Q B;  1IPG A;  2AEH A;  5AZG A;  2REX A;  3UIN B;  2BGF A;  3A9J B;  1Z2M A;  2KDI A;  4A20 A;  3APC A;  2O2V B;  2UWQ A;  2KWC A;  4FLH A;  1V9J A;  2GOW A;  1KJT A;  2I1K A;  4GIV A;  2CKH B;  2K6Q A;  1Q1O A;  4EZK A;  3DDC B;  4GDL A;  1U4A A;  4IUM B;  5E6O A;  3VQI A;  3KYD D;  4DBG A;  3QAQ A;  3AUL A;  1LM8 B;  2N4F A;  4BFR A;  2DEN B;  2CHW A;  4IC7 B;  3NS8 A;  4BKG A;  2FUH B;  3DVG X;  1GG3 A;  2KFK B;  2BF8 B;  4FHK A;  4KDL B;  2IO1 B;  1L7Y A;  3T9L A;  3QIJ A;  2GBN A;  3A4R A;  3X23 A;  3PRE A;  1WJN A;  3L0W B;  5G2N A;  3W1S C;  3APF A;  4MGI E;  4XZ4 A;  2ZPN A;  3GOE A;  1MG8 A;  5JHB A;  4DWF A;  3EEC A;  2L00 B;  5L95 C;  4W9E A;  1UH6 A;  2C7M B;  3H9D A;  1KM7 A;  1UBI A;  2O6V A;  2JZ3 B;  3DBL I;  2FCM A;  1OQY A;  1AAR A;  2RGF A;  4KSK C;  3ZNH B;  2J7Q B;  2ZZP B;  3PLU A;  5JH5 C;  2MRP A;  4AJY B;  2LGY A;  2NS5 A;  2L8J A;  3UIO B;  1V49 A;  2C9W B;  2Z0D B;  2AL3 A;  2GBK A;  4WJP A;  3TJP A;  1RLF A;  1WF9 A;  3HM6 X;  4AWJ A;  4IWO A;  1SIF A;  2DZM A;  2K1F A;  2KMC A;  1WMH B;  4IM3 A;  1YD8 U;  3OLM D;  4A3O A;  1GJZ A;  1WR6 E;  1V80 A;  1E7V A;  1LXD A;  2CU1 A;  4BKS A;  3WA0 A;  2KO3 A;  1E90 A;  3U7D A;  2NBU A;  1BT0 A;  2K8B A;  1H8C A;  1WRD B;  1WGH A;  2HJ8 A;  2R2Q A;  4I6P A;  4TV3 A;  4EEW A;  2KTR A;  4HPL B;  4WJN A;  3VH3 B;  4BOS C;  4HDO A;  3VHT C;  5IAA C;  1P3Q U;  4XC2 A;  1E7U A;  2B3A A;  4BOZ B;  4NJ6 A;  3ZRC A;  2LI5 A;  1IYF A;  1WGD A;  4W9I A;  5G55 A;  1TGZ B;  4IG7 B;  2G4S A;  2ZPY A;  3B08 A;  3OAW A;  5LLI A;  3PTF C;  1V5O A;  2VRR B;  3W1Y A;  4G0N B;  2KQS A;  2BYE A;  1K8R B;  5E6P A;  3MJW A;  3DBS A;  4KV2 A;  3PHW B;  2KJH B;  3ONS A;  4IWQ A;  2JWZ A;  2KTF A;  5D94 A;  4GOC A;  2Z59 B;  2JPH A;  2OOB B;  4ZRK A;  2LXA A;  3M3J A;  4TUU A;  5CX3 A;  2O2V A;  2FCN A;  5C23 A;  2C7H A;  1OGW A;  2WX1 A;  4MJS B;  4ICU A;  5LXI B;  3QC8 B;  2D3G A;  3IVF A;  2IY0 B;  3H7P A;  3R3M A;  1J19 A;  2XBB C;  4IW0 A;  2RPQ A;  4MGZ E;  1JRU A;  2CS4 A;  1WR1 A;  4M8M A;  3ZO5 B;  2KXJ A;  3ZDM C;  4WJO A;  2KFK A;  3LDZ E;  3PV1 A;  3V6E B;  2GBM A;  3R7R A;  3ZNZ B;  2D07 B;  5KHQ A;  4G11 A;  3NZU A;  4FUL A;  2XEW A;  2MBH A;  2MX2 A;  1I42 A;  4TQ0 A;  2MW5 A;  4DHJ D;  3N32 A;  2XK5 A;  1T0Y A;  1FXT B;  1RRB A;  1F9J A;  1E8Z A;  2Z0E B;  4G50 A;  2KK8 A;  4ZDV A;  3R66 C;  2KJ6 A;  3PS6 A;  3QWZ B;  1RFA A;  4G3X B;  2WWZ A;  3JVZ X;  4MDK E;  1E8X A;  2PJH A;  3WIM A;  1WXM A;  3NY5 A;  4AUQ C;  4EUT A;  4FHJ A;  1UEL A;  1V5T A;  3CSF A;  3KH0 A;  1LQB A;  5DPW A;  5CHW A;  4W9G A;  3HHM A;  1R4N I;  3PPA A;  3B0A A;  5D7G A;  1WMH A;  1D3Z A;  2CHX A;  2IY1 B;  3ML8 A;  5JHA A;  4KIK B;  2MBB B;  3IBE A;  1UGM A;  2GMI C;  4ANV A;  3H6N A;  4GB9 A;  3BIN A;  2BYV E;  1V2Y A;  3UQB A;  3UIP B;  2ZNV C;  5CTR C;  3VTU A;  4CYE A;  2PE6 B;  3IFW B;  2BYF A;  3SHQ A;  3V6C B;  3ZLZ A;  1WX9 A;  3PZD A;  4NNJ B;  4HPM B;  5AZH A;  2LVO A;  3QCA A;  3L16 A;  2EMS A;  4BBN F;  1KLV A;  3M62 B;  5DPT A;  4GMV A;  1XT9 B;  3VUY A;  3CST A;  1WX8 A;  3L17 A;  2KWU B;  2DAJ A;  3AU4 A;  3RT3 B;  4JQW C;  2NVU I;  4II2 B;  1GC6 A;  4AJW A;  2L7R A;  2PE9 A;  1KOT A;  2PEA A;  2RD0 A;  3H7S A;  4GGQ A;  2JF5 A;  3DVN V;  2K39 A;  3NHE B;  3A9K B;  3L13 A;  3PLV A;  2R2O A;  4KZ0 A;  4P7I A;  3JSV A;  3ZDT A;  1C3T A;  3SD5 A;  2LJ5 A;  1ISN A;  2LAS A;  3ZIM A;  2IO2 B;  1TBE A;  3RZF A;  3PHX B;  1WGR A;  2PPH A;  3PSE B;  2DHZ A;  3DBR I;  1EF5 A;  2BKR B;  2KLC A;  1S3S G;  2LUE A;  4MJS A;  3CMM B;  4NAW B;  4F8C B;  4WAA A;  5J2R A;  4K1R B;  2J0J A;  2M0X A;  3QAR A;  2MA9 B;  4HCN B;  4DDG D;  1OEY J;  2ZCC A;  2MLB A;  4W9J A;  1P98 A;  1GUA B;  3K9P B;  1QZE A;  4B95 A;  2DZK A;  2NBW B;  4FJY A;  4MSQ B;  3QHT A;  2KLG A;  1HE8 A;  3QA8 A;  3A1Q B;  4HWI B;  5C1Z A;  1IP9 A;  3N30 A;  2JXX A;  1E8Y A;  3P2B A;  4GDK B;  4HJK A;  4ICV A;  4K7S A;  2V4L A;  3DOW A;  3PGE A;  3UF8 A;  2IO0 B;  2MSE D;  3R7Q A;  4MEM A;  4WJQ A;  2LD9 A;  4KSL C;  1TTN A;  4A3P A;  4NQL B;  1GC7 A;  3DVG Y;  5DCN A;  3UQA A;  2KVR A;  1Q5W B;  4GU2 A;  3I3T B;  3PRZ A;  1Q0W B;  4DDI D;  3WAO A;  2NPT A;  3LJ3 A;  1V86 A;  3ZKJ C;  1YQB A;  5CHV C;  3EFU A;  2N7D A;  2MP2 A;  1ZW7 A;  2JRI B;  4KZC A;  4RM8 A;  2NBV B;  3ZTC A;  2K25 A;  5D6J B;  2ASQ A;  4WWP A;  4BVU C;  3A9J A;  1CMX B;  4OVU A;  2N7E A;  4DHZ E;  4KDI C;  2KDF B;  3QQ8 B;  4KIK A;  1I35 A;  3VUW A;  2KZR A;  1WM2 A;  4TQ1 A;  4OVV A;  2DYO A;  3ALB A;  4GSW A;  3A33 B;  1RAX A;  4NPN A;  4EZL A;  4PS7 A;  3OJ4 B;  1WJU A;  4JIO U;  4CHK A;  2L05 A;  2KX3 A;  2D2Q A;  2O6V D;  3RYT A;  4XX5 A;  4WQO B;  3AI5 A;  3TCA A;  2ZVO A;  3SU8 X;  2BKF A;  3MHS D;  4K7W A;  3TMP B;  4DHJ B;  4GXB A;  1V6E A;  3VDZ A;  2LVQ A;  2J0M A;  3HIZ A;  3T8M A;  3ZW3 A;  4MH0 E;  2V3S A;  3EC8 A;  2BPS A;  3L10 B;  2W9N A;  2N9X A;  1WI0 A;  3A9K A;  1H4R A;  3KW5 B;  2DX5 B;  4W9D A;  1WZ0 A;  2KDE B;  2LWP A;  3VFK A;  3QX1 A;  2LGX A;  2GBR A;  2G45 B;  3D32 A;  5HKH A;  2AL6 A;  2ZNV B;  4IM2 A;  3WAL A;  4DHZ B;  2WX0 A;  3SDL C;  1TZ1 A;  2MWS B;  3JYU A;  1EF1 A;  1OTR B;  4NAW A;  3DVN U;  3TL5 A;  1R4M I;  4AP4 C;  4BKS D;  2KWV B;  4F1S A;  1WGY A;  3WAP A;  1WXA A;  1VD2 A;  2KTR B;  2FCQ A;  2JT4 B;  1P0R A;  4FJZ A;  4EFO A;  3B1L X;  4LDT D;  5AZF A;  4ANU A;  2KHW B;  4ANX A;  2N9P C;  2LGD A;  3ECI A;  4FJV B;  4J6I A;  3RZW C;  3H1U A;  1LFD A;  2ZVN A;  3Q3F A;  4HXD A;  2JVC A;  4TKN A;  5TR5 A;  2NCN A;  4KVG B;  1WJ6 A;  1WX7 A;  1WGG A;  4K81 A;  2YLM A;  4YL8 A;  3ZUN A;  5JZE B;  1YIW A;  1OEY A;  1G6J A;  3ZNI D;  3M95 A;  2KQ7 A;  3PVL A;  2KKC A;  1E5W A;  1J0G A;  2AWT A;  4W9L A;  4MGY E;  5KHO A;  3NZS A;  1C1Y B;  2MCN B;  3TBL D;  1WJ4 A;  1GNU A;  2DAF A;  4RMA A;  2KD0 A;  1WH3 A;  4ZYN A;  4E3C A;  5J18 A;  2KC2 A;  2BWF A;  3V60 A;  4N9F 4;  4HVB A;  3DCG A;  5AEK B;  2K6D B;  5CHF A;  3VTV A;  2DYM A;  2RSU A;  4BBN C;  3HK0 A;  4JL9 A;  4NQK E;  1WE7 A;  1UBQ A;  3V62 A;  2JZZ A;  3H7P B;  2J0K A;  3NOB A;  4HCP B;  1WM3 A;  2DZJ A;  2K8C A;  4X57 B;  3KUZ A;  3V61 A;  5LXH A;  2BWE S;  2LVP A;  3DPD A;  3KUD B;  4MM3 A;  2ZCB A;  1ZGU B;  4GN1 A;  5BO4 B;  3VTW A;  1X1M A;  2KOX A;  1WY8 A;  2ZEQ A;  4PS3 A;  4K7U A;  3ZVV A;  4EZJ A;  3ZTD A;  3RUI B;  3VXW A;  4DXA B;  1WXV A;  3A4S C;  4FA6 A;  3VAW A;  4E71 A;  3UGB B;  3VH4 B;  1EUV B;  1SE9 A;  2K8H A;  2L0F A;  2CHZ A;  2A5U A;  3DQV A;  2N9E B;  2FNJ B;  4I6L B;  2N1V A;  4E74 A;  1P1A A;  1WZ3 A;  2KX0 A;  2XK5 B;  3QJZ A;  4MEL A;  4ZRJ A;  4NY0 A;  1YJ1 A;  2L0T A;  1UD7 A;  2G4D B;  3RD2 A;  2C60 A; 
#chains in the Genus database with same CATH topology
 5GMV A;  3TUO A;  3AU5 A;  4W9F A;  1MI0 A;  2KDB A;  3AE5 B;  3BVM A;  2C5L C;  2D3A A;  2HTH A;  4URK A;  3W9C B;  4LJO B;  3J9C A;  4C00 A;  4WIP A;  1C77 A;  3WAM A;  1MG4 A;  2N1W A;  2WXQ A;  4LCD E;  3RNA C;  1EWY C;  4P1C C;  2DYB A;  1HA5 A;  4ANW A;  2IND C;  4GDL B;  2WXI A;  4KKI A;  2LXC A;  3W1S A;  2BB5 A;  4BZA A;  2MQJ A;  1R7S A;  4PK1 A;  3DBL B;  4FAD A;  4FBJ B;  1XF5 L;  3PRM B;  4L1B A;  1HQR D;  3M63 B;  1N61 A;  2JYE A;  2O6V B;  4FN2 A;  2EEL A;  2KAJ A;  4AOF A;  1P7E A;  1SGH A;  3RUL A;  1N62 A;  3O65 B;  3AE7 B;  1TT5 B;  1OFF A;  4RF0 A;  3EHV A;  1YX6 B;  2JWU A;  1JRP A;  3NRZ A;  5FR6 A;  2Y5P A;  4IKG A;  1FM0 D;  2I1J A;  2LZ6 A;  3MTN B;  2WXJ A;  2MBE A;  3NJT A;  4B6W A;  2WDT B;  1E8W A;  4H2A A;  1V8C A;  2AYO B;  3ML9 A;  3Q6B A;  4HK2 A;  4KGR A;  5D2M B;  1K51 A;  2FCS A;  3S2A A;  2YVC A;  1IGC A;  3A1Q A;  2FID A;  3C0R B;  2WXH A;  4WWM A;  3UI3 A;  3VR8 B;  1IPG A;  1L0X B;  2KDI A;  4IDI A;  1KJT A;  1FCL A;  2CKH B;  4HKZ E;  1XCQ L;  1WYG A;  4EZK A;  1U4A A;  2I38 A;  2KWD A;  1J7C A;  2CHW A;  4DQO C;  2D3C A;  3DVG X;  2KFK B;  4KDL B;  4A9A A;  3T9L A;  4B0M A;  2GBN A;  3A4R A;  3L0W B;  2ICI A;  4MGI E;  1AYF A;  3GOE A;  4S17 A;  2NTT A;  5L95 C;  2JZ3 B;  2FCM A;  5HFY A;  3RNC C;  2QSD A;  2J7Q B;  1R4N B;  2NS5 A;  3UIO B;  1JW9 D;  2C9W B;  2AL3 A;  3TJP A;  2K22 A;  1WF9 A;  3HM6 X;  4IWO A;  4OZB A;  3OLM D;  3Q3N C;  4P16 A;  3AE8 B;  1AN8 A;  2XN9 C;  2NBU A;  1C9F A;  3H8H A;  4JE3 B;  2R2Q A;  4KX6 B;  3Q69 A;  4WJN A;  3VH3 B;  4BOS C;  1D6E C;  2ZW1 A;  2LGI A;  4W9I A;  2LMC A;  1TGZ B;  2G4S A;  3B08 A;  5LLI A;  3PTF C;  1V5O A;  2RDB C;  1K8R B;  1HZ6 A;  4ARC A;  3DBS A;  1IGD A;  1I4Q A;  2JWZ A;  3NVY A;  2Z59 B;  2JPH A;  4ZRK A;  1TY2 A;  3P4P B;  4TUU A;  5CX3 A;  2O2V A;  2C7H A;  2BYT A;  4ICU A;  5LXI B;  3QC8 B;  3ABV B;  2IY0 B;  3H7P A;  2MH7 A;  2PTL A;  2RPQ A;  3ZO5 B;  3V6E B;  4K3B A;  3R7R A;  1V1O A;  1F1H A;  3N9Y C;  5C2T B;  4XYC A;  2XK5 A;  3NVV A;  1MVK A;  4ZOH C;  2H89 B;  3W2D A;  4G3X B;  1E8X A;  2KDM A;  1UEL A;  1V5T A;  2LFI A;  3N20 C;  2QJL A;  2IGH A;  3B2F A;  3B0A A;  1WMH A;  2CHX A;  2IY1 B;  3ML8 A;  5JHA A;  4KIK B;  1BXT A;  2MBB B;  4YSX B;  1XCT L;  3AEG B;  3Q14 C;  3N1X C;  4KGS A;  4CYE A;  2PE6 B;  3IFW B;  2BYF A;  1KF6 B;  3ZLZ A;  3GE8 C;  3PZD A;  3E56 A;  3QCA A;  4BBN F;  3URY A;  3VUY A;  2W3S A;  1L0V B;  1L6U A;  2FUG 1;  2PE9 A;  4A55 A;  1UUP A;  1JWM D;  2BTE A;  1DGJ A;  4GGQ A;  2K39 A;  4KZ0 A;  2D3B A;  1QF6 A;  2LJ5 A;  1FD6 A;  2W82 A;  3PHX B;  1VZ6 A;  3CWI A;  2LUE A;  4F8C B;  4K1R B;  4LNK A;  2E3T A;  4ZHO A;  3MC0 B;  4HRO A;  1FEH A;  1P98 A;  1JWB D;  4XDD A;  4B95 A;  2OHF A;  3EUB 2;  2DZK A;  3QHT A;  2KLG A;  4EE2 A;  4HWI B;  1QKZ A;  5C1Z A;  4A20 A;  3P2B A;  4GDK B;  2ON8 A;  3DOW A;  3PGE A;  3IXS A;  3R7Q A;  4A3P A;  2LD9 A;  4NQL B;  1RM6 C;  3DVG Y;  4GU2 A;  4LNI A;  1Q0W B;  3ZKJ C;  3AE9 B;  2QC8 A;  2N7D A;  4RM8 A;  4O1N A;  2ASQ A;  4REZ A;  1L5P A;  4KDI C;  3QQ8 B;  2KZR A;  4OVV A;  1JWS D;  2Q5W D;  1QOF A;  1TS5 A;  1RAX A;  3OJ4 B;  5FKA C;  1DOY A;  3RYT A;  2ZVO A;  3FIL B;  3Q8B A;  4LNF A;  2YEP B;  1T0R C;  4GXB A;  1I4P A;  3R8B A;  2V3S A;  1NYQ A;  5BYQ A;  2N9X A;  1ZUD 2;  3A9K A;  3SR6 A;  2KDE B;  3P4Q B;  4OZC A;  3WAL A;  2WX0 A;  1E6E B;  3IAM 1;  2V4I B;  1EF1 A;  2KWV B;  3WAP A;  5IKC M;  3MP9 A;  4FJZ A;  5AZF A;  3ECI A;  2ZVN A;  4HXD A;  5G5G A;  2JQR B;  1OEY A;  1J7A A;  3ZNI D;  2KQ7 A;  1GNU A;  3ZQ4 A;  1XXG A;  5J18 A;  1HTO A;  2WNM A;  4K3C A;  3HK0 A;  4JL9 A;  1HTQ A;  2JSV X;  1TKY A;  2JZZ A;  1TY0 A;  2DZJ A;  3DPD A;  3KUD B;  3AEA B;  2ZCB A;  1TS4 A;  4GN1 A;  4K7U A;  1JWA D;  1C76 A;  3A4S C;  3UGB B;  2WXN A;  1ET9 A;  2N9E B;  3B9J A;  4ZRJ A;  2L52 A;  1TJE A;  1SEB D;  1PQS A;  4HDQ A;  1S1Q B;  4II3 B;  1F2R C;  2WXP A;  3IHP C;  2WXK A;  2D10 A;  4PYU A;  1P9D U;  3AH7 A;  2JY6 A;  1EO6 A;  2IZV B;  4RH6 A;  1T6B X;  3DWM A;  4N58 A;  3IG3 A;  3WAN A;  2FAZ A;  3KVF B;  1A5R A;  2L3Z A;  2B76 B;  2ZW0 A;  1C78 A;  4AS1 A;  2KYW A;  4BAX A;  2INP E;  3E9S A;  1HXY D;  1ZDV A;  4CO7 A;  1ZKH A;  4BKT A;  4HLE A;  2BB6 A;  4L2Y A;  2BS3 B;  2K5P A;  3OJ3 A;  2KMM A;  3I5J C;  2DLB A;  4W9K A;  1WYW B;  3CF6 E;  1WE6 A;  1ACC A;  2GBJ A;  4GLS C;  1WFY A;  1XLN A;  4DK5 A;  4ZRI A;  2Z8L A;  4LLG M;  1AWD A;  1SSN A;  3VVW B;  2JRH A;  1V81 A;  3ZNG C;  1KH0 A;  3BK2 A;  1CJE A;  4MSM B;  4C7Z A;  1UWX A;  4JLC A;  4F7Z A;  4HRS A;  2WYQ A;  3AE6 B;  1SBB B;  2WXR A;  2Y5B B;  3DBH I;  4B9K A;  2KNB A;  2UYZ B;  3RCZ A;  1PFD A;  1TS3 A;  4JX1 C;  3CIR B;  2E6X A;  3ENE A;  4GDK A;  2INN E;  3BY4 B;  1L2N A;  4KKJ A;  5L83 A;  1FNV A;  2REX A;  3UIN B;  2BGF A;  4NAM A;  2O2V B;  1T5X D;  4B0E A;  1V9J A;  2I1K A;  2BS4 B;  3BK1 A;  3I57 A;  3DDC B;  4IUM B;  5E6O A;  3PO0 A;  3KYD D;  1ZP0 B;  5AUI A;  1OQQ A;  1WSP A;  1LM8 B;  1T0S C;  2DEN B;  4ZRQ A;  1OQR A;  1GG3 A;  4FHK A;  5IP4 D;  1NI3 A;  2IO1 B;  3QIJ A;  2VZK B;  3X23 A;  3PRE A;  3APF A;  4J3O D;  4XZ4 A;  1MG8 A;  3H9D A;  1UBI A;  3DBL I;  1LGR A;  2GRI A;  4JWU C;  1AAR A;  3FIL A;  1P7F A;  3PLU A;  2MRP A;  2J52 A;  1K50 A;  2L8J A;  2RDG A;  2WU5 B;  3BVZ A;  1ESF A;  2INC C;  3BVG A;  3FAH A;  1SIF A;  2DZM A;  4IM3 A;  1WMH B;  1YD8 U;  5MPO A;  2NTS A;  1V80 A;  4BKS A;  2K3U A;  1E90 A;  2KO3 A;  3R2T A;  2AQ1 B;  2K8B A;  1H8C A;  1WRD B;  1WGH A;  2QIE B;  4EEW A;  1B9R A;  4HDO A;  3VHT C;  2WS3 B;  4XC2 A;  3U4E G;  3V05 A;  3ZRC A;  2M56 B;  1ZXI A;  5G55 A;  4IG7 B;  4M02 A;  3W1Y A;  3VRB B;  4G0N B;  1VZ8 A;  5E6P A;  3PHW B;  2KJH B;  2LUM A;  2WU2 B;  3BII D;  2KTF A;  1DOX A;  4MM3 B;  3LYY A;  3M3J A;  5LNK 1;  5C23 A;  2OJW A;  4RFB A;  1I4X A;  3DHH C;  3VR9 B;  4M01 A;  2TSS A;  1FMA D;  1MFW A;  3MC9 A;  3AM9 A;  3AB5 A;  3P1M A;  2XBB C;  1V1P A;  1SJH D;  5HG2 A;  3P4R B;  1QT9 A;  1ROE A;  1WXQ A;  3PV1 A;  4OW0 A;  3DHG C;  2MBH A;  2WXO A;  4DHJ D;  5D3D A;  2QIL A;  1JML A;  2FBW B;  1RRB A;  1E8Z A;  3R66 C;  3RNF C;  2WGS A;  3SFE B;  2PJH A;  2CJN A;  4EUT A;  4R3D A;  2KVZ A;  3KH0 A;  5DPW A;  5CHW A;  1R4N I;  3PPA A;  2H88 B;  1D3Z A;  5D7G A;  1WRI A;  1NEK B;  1WGK A;  1QIL A;  1M4V A;  1V2Y A;  3UQB A;  2MEK A;  1TIF A;  2ZNV C;  5CTR C;  3V6C B;  1WX9 A;  3IT4 B;  4NNJ B;  2ACZ B;  4HPM B;  2LVO A;  3L16 A;  2V9H A;  4L23 A;  2KWU B;  4JQW C;  4A8X C;  1XEE A;  1GC6 A;  2L7R A;  3P4S B;  3C19 A;  3BYY B;  3A9K B;  3PLV A;  2R2O A;  4C4V A;  1ISN A;  1R4M B;  2I2Y A;  1WGR A;  1EF5 A;  1FRR A;  2BKR B;  4MJS A;  5J2R A;  2M0X A;  2J4X A;  3BZD B;  3BWU D;  2MLB A;  2QEJ C;  3K9P B;  4HJG E;  4FJY A;  4RGM A;  4A6Q A;  1MHX A;  4RF1 A;  4NZL B;  4ICV A;  2JXX A;  4W9H A;  4HJK A;  2MSE D;  4KSL C;  2WQY B;  1GC7 A;  2PW9 A;  2KVR A;  1Q5W B;  3I3T B;  1BML C;  1YQB A;  3EFU A;  3Q2A C;  4KZC A;  1ZW7 A;  3ZTC A;  1C4P A;  4TSS A;  1CMX B;  1LO5 D;  2GB1 A;  1I35 A;  2DNF A;  1YN3 A;  4NPN A;  4EZL A;  1PDX A;  1WJU A;  4JIO U;  4CHK A;  2KX3 A;  2O6V D;  3TEZ A;  3TCA A;  1ZOY B;  2BKF A;  4WAF A;  3TMP B;  1V6E A;  2XNA C;  1XO3 A;  3VDZ A;  3HIZ A;  2J0M A;  3T8M A;  3AEF B;  3ZW3 A;  2LJI A;  3L10 B;  3EC8 A;  2BPS A;  2WDQ B;  1H4R A;  3KW5 B;  4W9D A;  1FNU A;  1WZ0 A;  1VZ7 A;  2GBR A;  2G45 B;  2AL6 A;  2HTM E;  2ZNV B;  1GAQ B;  3KWL A;  4DHZ B;  3SDL C;  3DVN U;  3TL5 A;  1CK1 A;  1VD2 A;  2JT4 B;  4EFO A;  5D3I B;  1HEZ E;  2N9P C;  2J53 A;  4TKN A;  4Q2J A;  2NCN A;  1WJ6 A;  1WX7 A;  1WGG A;  2YEP F;  2YLM A;  3ZUN A;  1YIW A;  1G6J A;  1TYG B;  1B1Z A;  2AWT A;  3NZS A;  1C1Y B;  3TBL D;  2DAF A;  3VRA B;  2KD0 A;  1WH3 A;  5EE1 A;  2K0P A;  3V60 A;  3FKY A;  4N9F 4;  3ZXV A;  1QOA A;  2JYT A;  3VTV A;  4BBN C;  2DYM A;  4YSZ B;  3V62 A;  3EFC A;  3NOB A;  4ZRP A;  1WM3 A;  1I4H A;  3DHI C;  2X8X X;  4MM3 A;  5BO4 B;  1X1M A;  1WY8 A;  3TEX A;  4PS3 A;  3ZVV A;  3VXW A;  4DXA B;  1SE9 A;  5EE0 A;  3DQV A;  4MAC A;  3AE4 B;  4I6L B;  4E74 A;  1PUT A;  2DBY A;  1WZ3 A;  3QJZ A;  4MEL A;  1NVI D;  5H92 C;  4D2K A;  4ASW C;  1WXS A;  1UZX B;  4EKU A;  1YN4 A;  2D11 A;  2C7N B;  1YN5 A;  2EMT A;  4PS8 A;  4NJ7 A;  5IA7 A;  3GE3 C;  5IOI A;  2N9L A;  1XLP A;  5EDS A;  1Y8R C;  2IPK D;  2M17 A;  3HM3 A;  4P6V F;  3AE3 B;  2M8S A;  3EA6 A;  3U8Z A;  2KJR A;  2MBQ A;  2HD5 B;  4WUR A;  3P42 A;  4YT0 B;  1V97 A;  1Z5S B;  3L08 A;  4RM9 A;  3PRP B;  4C7Y A;  1WIA A;  2NR2 A;  1XD3 B;  5BYS A;  1NBF C;  2W3R A;  3RNG C;  1N5W A;  2D5G A;  4M8N A;  5BMI A;  2KN5 A;  3KUC B;  2AX5 A;  3JSV B;  4LJP B;  1GOZ A;  2L76 A;  2M1M A;  3Q3J A;  5AUK A;  2IYD B;  1L4D B;  1ZDX A;  2M4N A;  2LRU A;  3TEY A;  2QHO A;  2HE7 A;  3AXC A;  3TIX A;  4JGH B;  3VUX A;  4LDT B;  1M94 A;  4IM0 A;  1RFK A;  4PYZ A;  4MGK E;  3L54 A;  4NJC A;  1GB4 A;  1SJE D;  3KQ4 A;  4I6N B;  3ZRF A;  2OJR A;  3APD A;  1TKE A;  4XWW A;  4M0W A;  1MHH E;  2MP2 B;  4DXG A;  2CR5 A;  1T3Q A;  2FE8 A;  2AEH A;  5AZG A;  3Q3O C;  3A9J B;  1Z2M A;  2BT6 A;  2UWQ A;  1KLG D;  2KWC A;  2GOW A;  1N60 A;  2K6Q A;  1BUI C;  3VQI A;  2WP9 B;  4YTP B;  4DBG A;  3QAQ A;  3N1Z C;  3AUL A;  2N4F A;  1V1P B;  1FXI A;  2BBC A;  4BFR A;  3NS8 A;  3RFZ B;  2BF8 B;  1L7Y A;  2L83 A;  2W55 A;  1WJN A;  2HDE A;  3KLS X;  4DWF A;  3EEC A;  2L00 B;  5EE3 A;  2C7M B;  1KM7 A;  3WCQ A;  3KWV A;  1L4Z B;  1OQY A;  2RGF A;  4KSK C;  3ZNH B;  1MJD A;  2ZZP B;  4AJY B;  1N63 A;  1PGB A;  2IDY A;  4AWJ A;  2KMC A;  2J42 A;  1GJZ A;  1WR6 E;  1E7V A;  2CU1 A;  3WA0 A;  4KGT A;  3U7D A;  3ETR A;  3EGR A;  5T8I A;  4I6P A;  1D5Z C;  1YMH E;  4HPL B;  5IAA C;  1E7U A;  2B3A A;  4BOZ B;  4NJ6 A;  2LI5 A;  4ARI A;  1WGD A;  2MHJ A;  4ZHP A;  3OAW A;  1JWU D;  2VRR B;  1VLB A;  3OG5 A;  2BYE A;  2MJ3 A;  3ONS A;  5D94 A;  3DBR B;  4GOC A;  4C56 C;  2LXA A;  4C4V B;  1I7H A;  1OGW A;  2WX1 A;  4MJS B;  2LGS A;  1RYJ A;  1UNS A;  2D3G A;  1VRA B;  3HRD D;  4IW0 A;  4MGZ E;  1JRU A;  3W5V B;  3Q8E A;  2CS4 A;  4M8M A;  3ZDM C;  3LDZ E;  2GBM A;  1Y56 A;  3ZNZ B;  5KHQ A;  4G11 A;  3NZU A;  4FUL A;  2XEW A;  1F0Z A;  4M00 A;  1F52 A;  4TQ0 A;  4USA A;  3N32 A;  3OWE B;  1FXT B;  4G50 A;  2KJ6 A;  3PS6 A;  3QWZ B;  2LHD A;  1KFY B;  2LEK A;  2QDF A;  3JVZ X;  4MDK E;  3AE1 B;  4FHJ A;  3CSF A;  2PLP A;  4ACF A;  4WQM A;  3H6N A;  1IBX A;  2PVG C;  3UIP B;  3SHQ A;  2CJO A;  3U7Z A;  1C4C A;  4RCO A;  1KLV A;  3TEW A;  5DPT A;  4GMV A;  1E10 A;  2ONQ A;  3L17 A;  2NVU I;  2RD0 A;  1PGA A;  1N5X A;  1YQ4 B;  3H7S A;  3DVN V;  3JSV A;  2WXG A;  3SFD B;  3SD5 A;  3ZIM A;  1EU3 A;  1TBE A;  3PSE B;  1FFU A;  2KLC A;  4TMA B;  1D4B A;  4FXC A;  3CMM B;  3IT6 B;  3QAR A;  2JXT A;  4HCN B;  4DDG D;  1OEY J;  2GI9 A;  2ZCC A;  4W9J A;  1GUA B;  1QZE A;  3FC4 A;  1PGX A;  4MSQ B;  1SE3 A;  1TZO A;  2L1A A;  1HE8 A;  3QA8 A;  1YNT E;  1IP9 A;  3N30 A;  3NUH B;  4K7S A;  4MEM A;  4WJQ A;  2JZP A;  3UQA A;  1Q10 A;  3WAO A;  1A70 A;  1FNW A;  2MP2 A;  2JRI B;  2N7J A;  2NBV B;  5D6J B;  4WWP A;  1WWT A;  3A9J A;  5IN7 A;  2N7E A;  2KDF B;  1JRO A;  1TKG A;  1WM2 A;  4IOI E;  4TQ1 A;  5E6J A;  2DYO A;  2RPV A;  3AN1 A;  3A33 B;  3NVW A;  3HVZ A;  2JU6 X;  1YQ3 B;  4XDC A;  5H8Y E;  1C4A A;  1KRH A;  2LVQ A;  2SEB D;  2W9N A;  4YXD B;  2WXF A;  3V3X A;  2DX5 B;  2LWP A;  3QX1 A;  2LGX A;  3D32 A;  4IM2 A;  5TSS A;  3JYU A;  1OTR B;  4NAW A;  1R4M I;  1ZXH A;  1WGY A;  2KTR B;  2FCQ A;  1P0R A;  3B1L X;  4ANU A;  4ANX A;  3RZW C;  4FJV B;  3AMZ A;  3H1U A;  3L4P A;  1LFD A;  2RDH A;  2JVC A;  2W54 A;  4KVG B;  5C3J B;  1SXT A;  3M95 A;  1J0G A;  1E5W A;  3MJ5 A;  3W5U B;  4MGY E;  3DWG C;  2MCN B;  4ZYN A;  2PVO D;  4E3C A;  2KC2 A;  4UDU C;  2NMQ A;  5AEK B;  2K6D B;  1SE4 A;  4NQK E;  1WE7 A;  1UBQ A;  1ET6 A;  3NZ3 A;  1N6Z A;  3NVZ A;  2J0K A;  2N0S B;  4HCP B;  2K8C A;  4X57 B;  3KUZ A;  5LXH A;  2BWE S;  2LVP A;  1ZGU B;  2KOX A;  2WLB A;  4EZJ A;  5JXV A;  3RUI B;  2M0A A;  4E71 A;  2K8H A;  2VZK D;  2CHZ A;  2A5U A;  2V0G A;  2N1V A;  1P1A A;  2L0T A;  2G4D B;  3RD2 A;  2C60 A;  3MC8 A;  4M0W B;  2MJD A;  1VCB A;  2JUO A;  3QK0 A;  4LTU A;  3KYC D;  1J8C A;  2N9K A;  3JW0 X;  2KC1 A;  4ITK A;  2PIA A;  3I9V 1;  1SIJ A;  2A4Z A;  2ZJD A;  1XQQ A;  4PT5 A;  5E6N A;  3N3K B;  1VDV A;  2X38 A;  5J17 A;  2DWQ A;  1YX5 B;  4MH8 A;  3Q8A A;  5GXG B;  4US8 A;  5DPR A;  2CU3 A;  1NDD A;  2LRW A;  3X0W A;  2BS2 B;  1VR9 A;  2KFJ A;  2IBI B;  2V3P A;  2KT7 A;  2IO3 B;  4N59 A;  2RMM A;  2DZI A;  3ZJV A;  4YTM B;  2RR9 A;  3U30 A;  1NI2 A;  2KMA A;  4WWO A;  1I4R A;  3GZN I;  2MBO A;  4YSY B;  4W9C A;  3R2I A;  4HPP A;  4RGT A;  4IWP A;  5BMG A;  4OZA A;  4EOY A;  1EU4 A;  1UF0 A;  1XLO A;  4CQN A;  1DYQ A;  3ZXR A;  4XWT A;  5DPS A;  4QAY A;  2FIF A;  5IO9 A;  3MFG A;  2V1Y A;  3K9O B;  1SB3 C;  1GPX A;  3Q8F A;  2KAN A;  4RGO S;  2NPT B;  1ZE3 D;  3PT2 B;  3IAS 1;  2EKE C;  4WWN A;  2K9X A;  2G3Q B;  1FXA A;  3AED B;  3GZN B;  1PYW D;  1FPY A;  3APC A;  1CZP A;  4FLH A;  4GIV A;  4YTN B;  1Q1O A;  2KN4 A;  4GDL A;  4XGA B;  4MT5 A;  4IC7 B;  4BKG A;  2FUH B;  4OVZ A;  2QMT A;  3Q8C A;  5G2N A;  3W1S C;  2ZPN A;  1E0Z A;  1RWS A;  5JHB A;  4W9E A;  1UH6 A;  2O6V A;  1SE2 A;  1FCC C;  4DXF A;  4RNA A;  5JH5 C;  2HJ1 A;  2LGY A;  1V49 A;  2WDV B;  2Z0D B;  4WJP A;  2GBK A;  1RLF A;  3GS2 A;  4HKQ A;  2K1F A;  1KTK A;  2IGD A;  4A3O A;  3T3O A;  3ZJU A;  1LXD A;  1MPE A;  1IBX B;  1BT0 A;  2HJ8 A;  4HEA 1;  4TV3 A;  3AEB B;  2KTR A;  2Y5C A;  3O13 A;  5FK9 C;  3HUI A;  1P3Q U;  2M19 A;  5G5H A;  1IYF A;  2ZPY A;  3MHZ A;  1ZPS A;  2KQS A;  3GB1 A;  1K53 A;  3MJW A;  4KV2 A;  2VH2 A;  4IWQ A;  2BW2 A;  2OOB B;  2FCN A;  1YOV B;  1K52 A;  1XLQ A;  1T0Q C;  3IVF A;  3T3N A;  1J7B A;  1VJK A;  3R3M A;  1J19 A;  5EE9 A;  3AV8 A;  2MJE A;  1WR1 A;  3RN9 C;  2KXJ A;  3RI7 C;  4WJO A;  2KFK A;  3Q3M C;  2D07 B;  3AEE B;  5HHD G;  2MX2 A;  2WXM A;  2WHI A;  1I42 A;  2MW5 A;  1UWM A;  4LK0 M;  1T0Y A;  2EKI A;  1F9J A;  2Z0E B;  4ZDV A;  2KK8 A;  3C8Y A;  1RFA A;  2WWZ A;  1AW7 A;  1NYR A;  3WIM A;  3LXF A;  1WXM A;  3NY5 A;  3ZYY X;  4AUQ C;  1LQB A;  2R61 A;  4W9G A;  3HHM A;  1QQR A;  2BQQ A;  2SAK A;  4RGN A;  5HI1 A;  1FIQ A;  2VH1 A;  3P63 A;  3IBE A;  1UGM A;  2GMI C;  5FR3 A;  1EWC A;  4ANV A;  4GB9 A;  3BIN A;  2BYV E;  3VTU A;  2JX5 A;  1I4G A;  2AQ3 B;  2WXL A;  5AZH A;  2EMS A;  3M62 B;  3B2G A;  1QLB B;  5BYR A;  1FO4 A;  1XT9 B;  2Y3A A;  3CST A;  1WX8 A;  2KAC A;  1QOB A;  2DAJ A;  3AU4 A;  3RT3 B;  4II2 B;  4AJW A;  1KOT A;  3AEC B;  1SF0 A;  2PEA A;  2JF5 A;  3NHE B;  3L13 A;  1F77 A;  4P7I A;  3ZDT A;  1C3T A;  2LAS A;  2IO2 B;  3RZF A;  2PPH A;  2DHZ A;  3DBR I;  1S3S G;  3SEB A;  1L0Y B;  3ZGZ A;  4NAW B;  1EM7 A;  4WAA A;  3TSS A;  2J0J A;  2MA9 B;  3U52 E;  4XE0 A;  1E7P B;  3NG0 A;  3I63 C;  2NBW B;  1STE A;  3A1Q B;  2WDR B;  1E8Y A;  1TS2 A;  2V4L A;  4C80 A;  3UF8 A;  2IGG A;  2LHE A;  2IO0 B;  1GB1 A;  5I4D A;  1TTN A;  1QOG A;  2G1E A;  5DCN A;  1FFV A;  3PRZ A;  4DDI D;  2NPT A;  3LJ3 A;  1V86 A;  4S0R A;  5CHV C;  1D5M C;  1YJJ A;  2K25 A;  4BVU C;  1IUE A;  2G9H D;  4OVU A;  4DHZ E;  4KIK A;  3VUW A;  3N1Y C;  1UGJ A;  2IJ0 A;  3ALB A;  1JAL A;  4GSW A;  3NS1 A;  4PS7 A;  3RNB C;  2L05 A;  2D2Q A;  4XX5 A;  4WQO B;  3AI5 A;  3SU8 X;  3MHS D;  4K7W A;  3LB8 C;  4DHJ B;  1F2R I;  1E9M A;  3ZJT A;  4MH0 E;  3BYT B;  1WI0 A;  3RMK C;  1JQ4 A;  3VFK A;  1CQV A;  5HKH A;  4AQ7 A;  1C79 A;  2GLS A;  3PZ8 A;  1TZ1 A;  2MWS B;  4BKS D;  4AP4 C;  4WH4 A;  1NEN B;  4F1S A;  1WXA A;  3HVD A;  4LDT D;  4LNO A;  2KHW B;  3U2S C;  4N6E B;  2LGD A;  4J6I A;  4A90 A;  4OHJ A;  3Q3F A;  2KQ4 X;  5TR5 A;  1L6V A;  1FRD A;  2OED A;  4US9 A;  4P1B C;  4YL8 A;  4K81 A;  5JZE B;  3PVL A;  2KKC A;  4W9L A;  1D5X C;  5KHO A;  1WJ4 A;  4RMA A;  1JCK B;  1DOI A;  2BWF A;  4HVB A;  3DCG A;  2QCZ A;  5CHF A;  2RSU A;  1HZ5 A;  3RPF C;  3H7P B;  3V61 A;  1ENF A;  4YWG G;  4JPS A;  4LNN A;  2V3N A;  3VTW A;  2ZEQ A;  5BMH A;  3ZTD A;  3AE2 B;  1WXV A;  2BVC A;  3DBH B;  3RNE C;  4FA6 A;  3VAW A;  2PKO A;  3VH4 B;  1YJI A;  1EUV B;  2L0F A;  3PZ7 A;  4JWS C;  2FNJ B;  2UU7 A;  2L32 A;  2KX0 A;  2XK5 B;  1KLU D;  4NY0 A;  4ZYS A;  2AQ2 B;  1YJ1 A;  1UD7 A;  2PMV A;  3GP7 A; 
#chains in the Genus database with same CATH homology
 4ASW C;  4M0W B;  1WXS A;  1UZX B;  5GMV A;  1PQS A;  4EKU A;  3AU5 A;  2D11 A;  4HDQ A;  4W9F A;  1S1Q B;  1VCB A;  2C7N B;  2KDB A;  4II3 B;  2C5L C;  2JUO A;  4W9H A;  3QK0 A;  2HTH A;  4URK A;  2EMT A;  3KYC D;  4PS8 A;  1J8C A;  3IHP C;  3JW0 X;  2KC1 A;  2D10 A;  4NJ7 A;  4LJO B;  4PYU A;  5IA7 A;  1P9D U;  2A4Z A;  3WAM A;  2ZJD A;  1XQQ A;  1EO6 A;  2JY6 A;  2N1W A;  5E6N A;  2IZV B;  3N3K B;  4LCD E;  2DYB A;  3IG3 A;  5J17 A;  5EDS A;  1Y8R C;  2M17 A;  3HM3 A;  1YX5 B;  3WAN A;  2FAZ A;  3KVF B;  4ANW A;  1A5R A;  4GDL B;  2L3Z A;  2M8S A;  3U8Z A;  2KJR A;  2MBQ A;  5DPR A;  2LXC A;  2HD5 B;  1NDD A;  1Z5S B;  3L08 A;  4RM9 A;  3W1S A;  3PRP B;  2LRW A;  1WIA A;  2NR2 A;  1XD3 B;  2MQJ A;  3X0W A;  1NBF C;  4CO7 A;  1ZKH A;  4BKT A;  4HLE A;  2KFJ A;  4M8N A;  4FAD A;  2IBI B;  4FBJ B;  3OJ3 A;  2KN5 A;  3PRM B;  2IO3 B;  3M63 B;  2O6V B;  4FN2 A;  2DZI A;  4W9K A;  1WYW B;  3KUC B;  3CF6 E;  4AOF A;  1SGH A;  3JSV B;  4LJP B;  3RUL A;  2RR9 A;  3U30 A;  1NI2 A;  2KMA A;  3O65 B;  4WWO A;  1WE6 A;  2L76 A;  2GBJ A;  2M1M A;  2MBO A;  3GZN I;  4W9C A;  3Q3J A;  2IYD B;  1WFY A;  4DK5 A;  4IWP A;  2M4N A;  2LRU A;  4ZRI A;  3EHV A;  1YX6 B;  4EOY A;  2QHO A;  2HE7 A;  3AXC A;  5FR6 A;  3TIX A;  3VVW B;  2I1J A;  2JRH A;  2LZ6 A;  3MTN B;  1V81 A;  5DPS A;  3ZNG C;  2MBE A;  4JGH B;  3VUX A;  4B6W A;  2WDT B;  2FIF A;  4MSM B;  1E8W A;  4LDT B;  1M94 A;  2V1Y A;  4JLC A;  4F7Z A;  4IM0 A;  2AYO B;  4PYZ A;  4MGK E;  3L54 A;  2WYQ A;  3ML9 A;  4HK2 A;  4I6N B;  2Y5B B;  3DBH I;  3K9O B;  4B9K A;  3ZRF A;  2OJR A;  2KAN A;  2KNB A;  5D2M B;  2UYZ B;  3APD A;  3RCZ A;  2FCS A;  3S2A A;  2YVC A;  3A1Q A;  2NPT B;  2FID A;  3C0R B;  3PT2 B;  3ENE A;  4GDK A;  3BY4 B;  1L2N A;  2MP2 B;  2CR5 A;  2EKE C;  4WWN A;  5L83 A;  2G3Q B;  1IPG A;  2AEH A;  5AZG A;  2REX A;  3UIN B;  2BGF A;  3A9J B;  1Z2M A;  2KDI A;  4A20 A;  3APC A;  2O2V B;  2UWQ A;  2KWC A;  4FLH A;  1V9J A;  2GOW A;  1KJT A;  2I1K A;  4GIV A;  2CKH B;  2K6Q A;  1Q1O A;  4EZK A;  3DDC B;  4GDL A;  1U4A A;  4IUM B;  5E6O A;  3VQI A;  3KYD D;  4DBG A;  3QAQ A;  3AUL A;  1LM8 B;  2N4F A;  4BFR A;  2DEN B;  2CHW A;  4IC7 B;  3NS8 A;  4BKG A;  2FUH B;  3DVG X;  1GG3 A;  2KFK B;  2BF8 B;  4FHK A;  4KDL B;  2IO1 B;  1L7Y A;  3T9L A;  3QIJ A;  2GBN A;  3A4R A;  3X23 A;  3PRE A;  1WJN A;  3L0W B;  5G2N A;  3W1S C;  3APF A;  4MGI E;  4XZ4 A;  2ZPN A;  3GOE A;  1MG8 A;  5JHB A;  4DWF A;  3EEC A;  2L00 B;  5L95 C;  4W9E A;  1UH6 A;  2C7M B;  3H9D A;  1KM7 A;  1UBI A;  2O6V A;  2JZ3 B;  3DBL I;  2FCM A;  1OQY A;  1AAR A;  2RGF A;  4KSK C;  3ZNH B;  2J7Q B;  2ZZP B;  3PLU A;  5JH5 C;  2MRP A;  4AJY B;  2LGY A;  2NS5 A;  2L8J A;  3UIO B;  1V49 A;  2C9W B;  2Z0D B;  2AL3 A;  2GBK A;  4WJP A;  3TJP A;  1RLF A;  1WF9 A;  3HM6 X;  4AWJ A;  4IWO A;  1SIF A;  2DZM A;  2K1F A;  2KMC A;  1WMH B;  4IM3 A;  1YD8 U;  3OLM D;  4A3O A;  1GJZ A;  1WR6 E;  1V80 A;  1E7V A;  1LXD A;  2CU1 A;  4BKS A;  3WA0 A;  2KO3 A;  1E90 A;  3U7D A;  2NBU A;  1BT0 A;  2K8B A;  1H8C A;  1WRD B;  1WGH A;  2HJ8 A;  2R2Q A;  4I6P A;  4TV3 A;  4EEW A;  2KTR A;  4HPL B;  4WJN A;  3VH3 B;  4BOS C;  4HDO A;  3VHT C;  5IAA C;  1P3Q U;  4XC2 A;  1E7U A;  2B3A A;  4BOZ B;  4NJ6 A;  3ZRC A;  2LI5 A;  1IYF A;  1WGD A;  4W9I A;  5G55 A;  1TGZ B;  4IG7 B;  2G4S A;  2ZPY A;  3B08 A;  3OAW A;  5LLI A;  3PTF C;  1V5O A;  2VRR B;  3W1Y A;  4G0N B;  2KQS A;  2BYE A;  1K8R B;  5E6P A;  3MJW A;  3DBS A;  4KV2 A;  3PHW B;  2KJH B;  3ONS A;  4IWQ A;  2JWZ A;  2KTF A;  5D94 A;  4GOC A;  2Z59 B;  2JPH A;  2OOB B;  4ZRK A;  2LXA A;  3M3J A;  4TUU A;  5CX3 A;  2O2V A;  2FCN A;  5C23 A;  2C7H A;  1OGW A;  2WX1 A;  4MJS B;  4ICU A;  5LXI B;  3QC8 B;  2D3G A;  3IVF A;  2IY0 B;  3H7P A;  3R3M A;  1J19 A;  2XBB C;  4IW0 A;  2RPQ A;  4MGZ E;  1JRU A;  2CS4 A;  1WR1 A;  4M8M A;  3ZO5 B;  2KXJ A;  3ZDM C;  4WJO A;  2KFK A;  3LDZ E;  3PV1 A;  3V6E B;  2GBM A;  3R7R A;  3ZNZ B;  2D07 B;  5KHQ A;  4G11 A;  3NZU A;  4FUL A;  2XEW A;  2MBH A;  2MX2 A;  1I42 A;  4TQ0 A;  2MW5 A;  4DHJ D;  3N32 A;  2XK5 A;  1T0Y A;  1FXT B;  1RRB A;  1F9J A;  1E8Z A;  2Z0E B;  4G50 A;  2KK8 A;  4ZDV A;  3R66 C;  2KJ6 A;  3PS6 A;  3QWZ B;  1RFA A;  4G3X B;  2WWZ A;  3JVZ X;  4MDK E;  1E8X A;  2PJH A;  3WIM A;  1WXM A;  3NY5 A;  4AUQ C;  4EUT A;  4FHJ A;  1UEL A;  1V5T A;  3CSF A;  3KH0 A;  1LQB A;  5DPW A;  5CHW A;  4W9G A;  3HHM A;  1R4N I;  3PPA A;  3B0A A;  5D7G A;  1WMH A;  1D3Z A;  2CHX A;  2IY1 B;  3ML8 A;  5JHA A;  4KIK B;  2MBB B;  3IBE A;  1UGM A;  2GMI C;  4ANV A;  3H6N A;  4GB9 A;  3BIN A;  2BYV E;  1V2Y A;  3UQB A;  3UIP B;  2ZNV C;  5CTR C;  3VTU A;  4CYE A;  2PE6 B;  3IFW B;  2BYF A;  3SHQ A;  3V6C B;  3ZLZ A;  1WX9 A;  3PZD A;  4NNJ B;  4HPM B;  5AZH A;  2LVO A;  3QCA A;  3L16 A;  2EMS A;  4BBN F;  1KLV A;  3M62 B;  5DPT A;  4GMV A;  1XT9 B;  3VUY A;  3CST A;  1WX8 A;  3L17 A;  2KWU B;  2DAJ A;  3AU4 A;  3RT3 B;  4JQW C;  2NVU I;  4II2 B;  1GC6 A;  4AJW A;  2L7R A;  2PE9 A;  1KOT A;  2PEA A;  2RD0 A;  3H7S A;  4GGQ A;  2JF5 A;  3DVN V;  2K39 A;  3NHE B;  3A9K B;  3L13 A;  3PLV A;  2R2O A;  4KZ0 A;  4P7I A;  3JSV A;  3ZDT A;  1C3T A;  3SD5 A;  2LJ5 A;  1ISN A;  2LAS A;  3ZIM A;  2IO2 B;  1TBE A;  3RZF A;  3PHX B;  1WGR A;  2PPH A;  3PSE B;  2DHZ A;  3DBR I;  1EF5 A;  2BKR B;  2KLC A;  1S3S G;  2LUE A;  4MJS A;  3CMM B;  4NAW B;  4F8C B;  4WAA A;  5J2R A;  4K1R B;  2J0J A;  2M0X A;  3QAR A;  2MA9 B;  4HCN B;  4DDG D;  1OEY J;  2ZCC A;  2MLB A;  4W9J A;  1P98 A;  1GUA B;  3K9P B;  1QZE A;  4B95 A;  2DZK A;  2NBW B;  4FJY A;  4MSQ B;  3QHT A;  2KLG A;  1HE8 A;  3QA8 A;  3A1Q B;  4HWI B;  5C1Z A;  1IP9 A;  3N30 A;  2JXX A;  1E8Y A;  3P2B A;  4GDK B;  4HJK A;  4ICV A;  4K7S A;  2V4L A;  3DOW A;  3PGE A;  3UF8 A;  2IO0 B;  2MSE D;  3R7Q A;  4MEM A;  4WJQ A;  2LD9 A;  4KSL C;  1TTN A;  4A3P A;  4NQL B;  1GC7 A;  3DVG Y;  5DCN A;  3UQA A;  2KVR A;  1Q5W B;  4GU2 A;  3I3T B;  3PRZ A;  1Q0W B;  4DDI D;  3WAO A;  2NPT A;  3LJ3 A;  1V86 A;  3ZKJ C;  1YQB A;  5CHV C;  3EFU A;  2N7D A;  2MP2 A;  1ZW7 A;  2JRI B;  4KZC A;  4RM8 A;  2NBV B;  3ZTC A;  2K25 A;  5D6J B;  2ASQ A;  4WWP A;  4BVU C;  3A9J A;  1CMX B;  4OVU A;  2N7E A;  4DHZ E;  4KDI C;  2KDF B;  3QQ8 B;  4KIK A;  1I35 A;  3VUW A;  2KZR A;  1WM2 A;  4TQ1 A;  4OVV A;  2DYO A;  3ALB A;  4GSW A;  3A33 B;  1RAX A;  4NPN A;  4EZL A;  4PS7 A;  3OJ4 B;  1WJU A;  4JIO U;  4CHK A;  2L05 A;  2KX3 A;  2D2Q A;  2O6V D;  3RYT A;  4XX5 A;  4WQO B;  3AI5 A;  3TCA A;  2ZVO A;  3SU8 X;  2BKF A;  3MHS D;  4K7W A;  3TMP B;  4DHJ B;  4GXB A;  1V6E A;  3VDZ A;  2LVQ A;  2J0M A;  3HIZ A;  3T8M A;  3ZW3 A;  4MH0 E;  2V3S A;  3EC8 A;  2BPS A;  3L10 B;  2W9N A;  2N9X A;  1WI0 A;  3A9K A;  1H4R A;  3KW5 B;  2DX5 B;  4W9D A;  1WZ0 A;  2KDE B;  2LWP A;  3VFK A;  3QX1 A;  2LGX A;  2GBR A;  2G45 B;  3D32 A;  5HKH A;  2AL6 A;  2ZNV B;  4IM2 A;  3WAL A;  4DHZ B;  2WX0 A;  3SDL C;  1TZ1 A;  2MWS B;  3JYU A;  1EF1 A;  1OTR B;  4NAW A;  3DVN U;  3TL5 A;  1R4M I;  4AP4 C;  4BKS D;  2KWV B;  4F1S A;  1WGY A;  3WAP A;  1WXA A;  1VD2 A;  2KTR B;  2FCQ A;  2JT4 B;  1P0R A;  4FJZ A;  4EFO A;  3B1L X;  4LDT D;  5AZF A;  4ANU A;  2KHW B;  4ANX A;  2N9P C;  2LGD A;  3ECI A;  4FJV B;  4J6I A;  3RZW C;  3H1U A;  1LFD A;  2ZVN A;  3Q3F A;  4HXD A;  2JVC A;  4TKN A;  5TR5 A;  2NCN A;  4KVG B;  1WJ6 A;  1WX7 A;  1WGG A;  4K81 A;  2YLM A;  4YL8 A;  3ZUN A;  5JZE B;  1YIW A;  1OEY A;  1G6J A;  3ZNI D;  3M95 A;  2KQ7 A;  3PVL A;  2KKC A;  1E5W A;  1J0G A;  2AWT A;  4W9L A;  4MGY E;  5KHO A;  3NZS A;  1C1Y B;  2MCN B;  3TBL D;  1WJ4 A;  1GNU A;  2DAF A;  4RMA A;  2KD0 A;  1WH3 A;  4ZYN A;  4E3C A;  5J18 A;  2KC2 A;  2BWF A;  3V60 A;  4N9F 4;  4HVB A;  3DCG A;  5AEK B;  2K6D B;  5CHF A;  3VTV A;  2DYM A;  2RSU A;  4BBN C;  3HK0 A;  4JL9 A;  4NQK E;  1WE7 A;  1UBQ A;  3V62 A;  2JZZ A;  3H7P B;  2J0K A;  3NOB A;  4HCP B;  1WM3 A;  2DZJ A;  2K8C A;  4X57 B;  3KUZ A;  3V61 A;  5LXH A;  2BWE S;  2LVP A;  3DPD A;  3KUD B;  4MM3 A;  2ZCB A;  1ZGU B;  4GN1 A;  5BO4 B;  3VTW A;  1X1M A;  2KOX A;  1WY8 A;  2ZEQ A;  4PS3 A;  4K7U A;  3ZVV A;  4EZJ A;  3ZTD A;  3RUI B;  3VXW A;  4DXA B;  1WXV A;  3A4S C;  4FA6 A;  3VAW A;  4E71 A;  3UGB B;  3VH4 B;  1EUV B;  1SE9 A;  2K8H A;  2L0F A;  2CHZ A;  2A5U A;  3DQV A;  2N9E B;  2FNJ B;  4I6L B;  2N1V A;  4E74 A;  1P1A A;  1WZ3 A;  2KX0 A;  2XK5 B;  3QJZ A;  4MEL A;  4ZRJ A;  4NY0 A;  1YJ1 A;  2L0T A;  1UD7 A;  2G4D B;  3RD2 A;  2C60 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...