3B08A

Crystal structure of the mouse hoil1-l-nzf in complex with linear di-ubiquitin
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
151
structure length
151
Chain Sequence
MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Signaling protein/metal binding protein
molecule keywords Polyubiquitin-C
publication title Specific recognition of linear ubiquitin chains by the Npl4 zinc finger (NZF) domain of the HOIL-1L subunit of the linear ubiquitin chain assembly complex
pubmed doi rcsb
source organism Homo sapiens
total genus 41
structure length 151
sequence length 151
chains with identical sequence D, G, J
ec nomenclature
pdb deposition date 2011-06-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00240 ubiquitin Ubiquitin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 3b08A01
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 3b08A02
2LD9A 2XK5A 3VTUA 4GMVA 1KJTA 4NY0A 2W9NA 2K8HA 4HDQA 3DCGA 2KTRA 2NCNA 4CHKA 4EFOA 3IVFA 1E7VA 2CHZA 2UYZB 1TZ1A 2DZMA 2KMAA 2DZIA 3HHMA 2L8JA 3ZTCA 1WYWB 2KQ7A 4AWJA 4DWFA 4FADA 1V81A 4MJSB 1PQSA 3ECIA 3A1QA 3L17A 1OEYA 3V61A 4HVBA 5JZEB 3A9KB 1J19A 4J6IA 4WAAA 4FHJA 4I6LB 4ZRJA 2L76A 5LLIA 1IYFA 4HDOA 4FJYA 1P1AA 1WGRA 2C7MB 4KV2A 4M8NA 2M1MA 4PS8A 2MRPA 2MW5A 3KUZA 3OLMD 1C3TA 2ZCBA 5JHBA 2JZ3B 4W9EA 3VUXA 1C1YB 4WQOB 4HXDA 2G4DB 4ZRKA 3VFKA 2KDFB 2MSED 2PEAA 1UD7A 3EC8A 3H6NA 5J17A 2CR5A 2D07B 2FCQA 2ZZPB 3L0WB 4KDLB 4YL8A 2PE6B 4KSKC 3WANA 2MWSB 1LXDA 5CX3A 3TCAA 4KSLC 1IPGA 4MGZE 3X0WA 3KH0A 2GBRA 3DBSA 4WJNA 2KDEB 3VUWA 2C7NB 4GDKB 1YJ1A 4GOCA 3PS6A 1WGYA 2AL3A 5E6NA 2WDTB 4GDLB 3A4SC 2N1VA 3P2BA 2IY0B 3APCA 5AZHA 3W1SC 4K1RB 1WRDB 2DYOA 3PZDA 1UBQA 3IG3A 2AL6A 2BKRB 2HJ8A 3H7PA 5E6OA 3NHEB 3GZNI 4MEMA 4TV3A 4M8MA 4NJ7A 3ALBA 2L0FA 2JXXA 2PJHA 3SDLC 3QJZA 4KIKA 3MHSD 4URKA 4FLHA 3Q3JA 4II3B 1ZW7A 2L05A 1WJNA 2KC1A 3I3TB 5C23A 2DYBA 2KLCA 4W9CA 2KDIA 1UGMA 2XEWA 1OEYJ 3WALA 2V4LA 5CTRC 3H7SA 4LJOB 1RRBA 2B3AA 4IWQA 2KX0A 4BKSA 2MP2A 4FA6A 2NPTB 4OVVA 2KFKA 2GBKA 3PHXB 1D3ZA 1TTNA 3KYCD 2G4SA 2MX2A 4IUMB 1E8XA 2ZPNA 4B95A 4BOSC 3UQAA 4ZRIA 2IO3B 4M0WB 3T9LA 1E8YA 1ZKHA 4ZDVA 3CMMB 4PYZA 2KD0A 5D7GA 2AWTA 3WIMA 1U4AA 1P9DU 3QA8A 4W9DA 2WYQA 2ASQA 2HD5B 2KJRA 3C0RB 2WX1A 1WR1A 2MQJA 2LXAA 5L83A 4ANVA 3DDCB 2O2VA 1GJZA 4W9LA 3IBEA 3DVGY 4OVUA 2K8BA 4GXBA 3V6EB 2FNJB 3NOBA 4GSWA 3ZNGC 2IO1B 3HIZA 3RCZA 2IO2B 1WIAA 2CHWA 3L08A 1XT9B 5TR5A 3ZVVA 2BKFA 2KK8A 1P98A 2CHXA 2BYVE 4FHKA 2LJ5A 4IW0A 4K81A 1WJ6A 1Y8RC 4LCDE 1GC7A 4NNJB 4IM0A 1UH6A 3KUCB 4A3PA 4I6PA 2DZJA 2N9EB 3DVGX 2KWVB 1P0RA 2MBOA 2N9XA 2IBIB 2M4NA 3W1SA 2VRRB 3A9JB 4W9HA 2LXCA 1GNUA 4TQ1A 2C60A 3DPDA 3L16A 4IWPA 1YIWA 3UIOB 2GMIC 4WJPA 5DPTA 4X57B 1H4RA 1JRUA 1RLFA 2JZZA 3KYDD 3QHTA 3M3JA 4GDLA 4HK2A 3ZNZB 5AEKB 2WX0A 1Q0WB 2KJ6A 3HM6X 2OOBB 1SE9A 2KWUB 2N4FA 2LI5A 2BYFA 2M0XA 2REXA 3B08A 4WWOA 3CSFA 3R66C 4HPLB 4DHZB 2LASA 1SIFA 3AULA 4GU2A 2CKHB 5AZFA 4BVUC 4F1SA 4KVGB 4NAWA 3OJ4B 2RD0A 1WMHA 1NDDA 1V49A 3PV1A 5JH5C 4EZKA 5EDSA 3PLVA 2AEHA 4LDTD 1ZGUB 3ZDMC 4KZ0A 1NI2A 4BKGA 4TQ0A 2KANA 2GBNA 3L54A 2DYMA 2ZPYA 3PPAA 2C5LC 1RAXA 3APFA 2LRUA 2L3ZA 3APDA 1WFYA 4G50A 2M8SA 3DBHI 2BWFA 2DZKA 2JY6A 1I35A 4NPNA 2JT4B 1L7YA 3QC8B 4GN1A 4JLCA 4MM3A 3W1YA 5E6PA 3U30A 2KXJA 2Z0DB 3X23A 3BY4B 2L7RA 3VQIA 1WGHA 3QWZB 2KN5A 1E7UA 4II2B 1LM8B 4W9GA 3UGBB 2LVPA 3JSVB 3OAWA 3VUYA 1A5RA 2O6VB 5DPWA 2Z0EB 3QK0A 4BFRA 2N1WA 2K8CA 2BF8B 2XBBC 1WGDA 1J0GA 2RPQA 1WE7A 2FCNA 4AUQC 4B6WA 4CYEA 1WXAA 2XK5B 3QQ8B 1V80A 2N9PC 3KVFB 2N7EA 4K7UA 4WJQA 4WWPA 3TJPA 2MCNB 4LJPB 2LVOA 4PYUA 1EUVB 1KM7A 2KOXA 2FCMA 2LGYA 4AP4C 1GC6A 3DOWA 5JHAA 4LDTB 5LXIB 2RSUA 2FAZA 2L0TA 4MELA 3UQBA 1UZXB 1Z2MA 3JVZX 2J0KA 2AYOB 2KO3A 4WWNA 5C1ZA 2LWPA 3MTNB 1GG3A 3N32A 3ML9A 4CO7A 2KMCA 4JL9A 1WX9A 2FIDA 1M94A 1YQBA 2J0MA 4W9JA 3SD5A 2NS5A 4IWOA 5FR6A 3V6CB 4A3OA 3IFWB 2KVRA 2EKEC 2J0JA 4HWIB 3V62A 4AOFA 2IY1B 3GOEA 3M95A 4P7IA 3ZO5B 4BOZB 3QAQA 1F9JA 1KLVA 2JUOA 4E3CA 2MBQA 2KX3A 1H8CA 4DK5A 1TGZB 2KNBA 2L00B 5KHQA 5L95C 2C9WB 3D32A 2EMTA 3EFUA 4TKNA 5CHVC 3VHTC 4EZJA 1WF9A 1WY8A 3NZUA 3RD2A 4HCNB 3UIPB 3K9PB 1OQYA 2KLGA 1LQBA 2DAFA 2ZVOA 4MJSA 2V1YA 4DDGD 3S2AA 2MBHA 3RZWC 1V2YA 3ML8A 3A9KA 2ZVNA 1X1MA 1WH3A 2OJRA 3AU5A 3R3MA 4MGYE 1XD3B 2I1KA 3VTWA 2WWZA 3PT2B 2A5UA 3H7PB 3OJ3A 2ZEQA 1XQQA 4NJ6A 5J18A 1AARA 2J7QB 3R7RA 3TMPB 2NBWB 3PREA 5BO4B 2IYDB 3PTFC 4RMAA 3V60A 3NS8A 3PGEA 3LJ3A 2MBBB 3QX1A 3WAPA 1WXVA 1P3QU 5G55A 4FN2A 2K39A 1V86A 1EF1A 3PLUA 2KDBA 2BWES 4A20A 2LGXA 4EUTA 3WAOA 1OGWA 2ZNVB 5D94A 1T0YA 2KC2A 4GDKA 3ZUNA 5GMVA 3Q3FA 3VH4B 3MJWA 4FJVB 4ICUA 2NR2A 2CS4A 1VCBA 3PSEB 4WJOA 3VAWA 1E8ZA 4GIVA 4KZCA 3ONSA 3DVNU 2G45B 1SGHA 3VXWA 2PPHA 4MGKE 2BYEA 2O6VD 1BT0A 2FCSA 2GBJA 3VDZA 3BINA 2KKCA 2ZNVC 3ZDTA 4E74A 3PRMB 4I6NB 3L13A 5IA7A 3SHQA 3ZLZA 1WXSA 4JIOU 2D2QA 1V6EA 2D10A 4HLEA 1WZ0A 1RFAA 4KDIC 2R2QA 4HPMB 2KQSA 1YX6B 4IC7B 1K8RB 2JRIB 4XC2A 3CF6E 1G6JA 2O2VB 3VH3B 1TBEA 1KOTA 1WZ3A 3B0AA 4XX5A 1CMXB 2JF5A 3TIXA 2KFJA 1VD2A 2K6DB 4ZYNA 3M63B 1QZEA 4TUUA 4DBGA 2NBUA 2NPTA 2DENB 3JW0X 2BGFA 2V3SA 3RT3B 2NBVB 4RM8A 4ANUA 1HE8A 4FJZA 3KW5B 1YX5B 3NZSA 2UWQA 4MGIE 5DPRA 1I42A 1J8CA 4W9IA 4ANWA 4FBJB 4BBNC 3B1LX 3HK0A 4MSQB 1UBIA 1WX7A 4AJYB 3ZKJC 2MLBA 4DHZE 3ZNHB 4JQWC 4ICVA 3TBLD 3VVWB 2YVCA 1LFDA 2EMSA 3EHVA 2D3GA 3DBRI 4XZ4A 1ISNA 1S3SG 1WXMA 3DBLI 4GB9A 4N9F4 1Q1OA 4K7SA 1EF5A 2GOWA 3QCAA 2DX5B 4NQLB 4DXAB 2I1JA 2LRWA 2YLMA 4DDID 2LGDA 2KTRB 4W9FA 4DHJD 3M62B 3ZIMA 3PRPB 1GUAB 2FIFA 2LUEA 3AI5A 4HCPB 4RM9A 4EOYA 5DCNA 3DQVA 5CHFA 3LDZE 2RGFA 2A4ZA 3PHWB 3PRZA 4JGHB 4EKUA 2Y5BB 2QHOA 3A1QB 4IM3A 3HM3A 2PE9A 4NQKE 2GBMA 4EEWA 2LVQA 1MG8A 2D11A 3KUDB 4W9KA 4IM2A 3U7DA 1V5TA 3R7QA 3RZFA 2K1FA 1WX8A 3UF8A 4NAWB 2KHWB 1WMHB 1R4MI 2IZVB 3SU8X 2FUHB 2N7DA 1L2NA 1WGGA 3A9JA 3TL5A 4MSMB 1WI0A 1E90A 3U8ZA 2MBEA 2DAJA 4BKSD 2ZCCA 2R2OA 2LZ6A 5D2MB 4F7ZA 1WJUA 2CU1A 3VTVA 4G0NB 2G3QB 2K25A 2KWCA 2MA9B 3RUIB 1IP9A 2M17A 4FULA 3WAMA 5IAAC 4B9KA 3PVLA 5CHWA 3QARA 2Z59B 3H1UA 4DHJB 2KZRA 5G2NA 3AXCA 5AZGA 2DHZA 5J2RA 3K9OB 5D6JB 1WM2A 2ZJDA 3QIJA 4G3XB 3EECA 1V5OA 2C7HA 3N3KB 5DPSA 2JVCA 3IHPC 1WM3A 1WR6E 3RYTA 1NBFC 3UINB 4EZLA 1Q5WB 3AU4A 1E8WA 3ZRCA 3CSTA 3H9DA 3ENEA 1UELA 3A33B 4HJKA 4KIKB 3O65B 1EO6A 3DVNV 4GGQA 1FXTB 5KHOA 1E5WA 4MDKE 5HKHA 2NVUI 2HTHA 3ZNID 3N30A 1R4NI 4PS7A 3RULA 4AJWA 4MH0E 1S1QB 2BPSA 3NY5A 2JPHA 4G11A 1OTRB 1WJ4A 3WA0A 4E71A 3ZRFA 2KJHB 2MP2B 2RR9A 3A4RA 4BBNF 4BKTA 5LXHA 2KFKB 3ZTDA 2JRHA 1YD8U 3T8MA 4ASWC 3JSVA 2K6QA 1V9JA 3L10B 1WE6A 2JWZA 4ANXA 1Z5SB 2O6VA 2IO0B 3JYUA 4IG7B 4K7WA 4F8CB 2KTFA 2HE7A 3ZW3A 4PS3A
chains in the Genus database with same CATH superfamily
1SE3A 2XK5A 4JX1C 4YXDB 2KTRA 2DZMA 3HHMA 2J4XA 1WYWB 4CQNA 1RYJA 1L0YB 2L32A 3P1MA 3V61A 5H92C 1KTKA 4LNOA 4I6LB 1J7CA 2L76A 2BTEA 4KV2A 2MRPA 3KUZA 2HJ1A 1C3TA 2ZCBA 2JZ3B 4WQOB 4YT0B 4HXDA 1C78A 2G4DB 1EWYC 2PEAA 3H6NA 2ZZPB 4YL8A 3DWMA 4ZHOA 5CX3A 2GBRA 3ZJTA 4C7ZA 4GOCA 1C4CA 2WDRB 1XF5L 3PO0A 4TMAB 1SIJA 2IY0B 3APCA 5AZHA 4K1RB 1TJEA 1WRDB 3KLSX 4XDCA 3IG3A 5E6OA 2X38A 2W54A 4S17A 1FXAA 4ACFA 4A9AA 3IT6B 4URKA 1C79A 3Q3JA 3O13A 3E9SA 2M56B 5HFYA 1ZDXA 2XEWA 1OEYJ 3PZ8A 2RMMA 5CTRC 1ZUD2 4LJOB 1TS4A 1T0QC 2KX0A 2NPTB 1MPEA 2JZPA 4M0WB 4R3DA 2B76B 4ZDVA 4PYZA 5D7GA 1P9DU 3QA8A 2ASQA 1NYRA 1ZDVA 2LXAA 5C3JB 3DDCB 3DVGY 2K8BA 2FNJB 3NOBA 3ZNGC 2IO2B 3L08A 5TR5A 1PGXA 3FKYA 2V0GA 4ZHPA 1P98A 2ICIA 2LJ5A 1Y8RC 2L83A 4ZOHC 4NNJB 4IM0A 3KUCB 2DZJA 3DVGX 4M02A 2MBOA 2IBIB 3W1SA 4RCOA 2LXCA 1GNUA 2C60A 1GOZA 2W55A 2BB5A 3ZNZB 4OHJA 2WX0A 2KJ6A 3GE3C 1RM6C 1R4NB 2M0XA 2KAJA 3AE5B 3B08A 4DHZB 2LASA 3AULA 2I2YA 2CKHB 4BVUC 5C2TB 1V49A 3ZDMC 4KZ0A 4BAXA 1HZ5A 3AE1B 1IGDA 3APFA 3EGRA 3ABVB 2L3ZA 4G50A 3DBHI 2DZKA 5IKCM 2DLBA 1I35A 2BS4B 5E6JA 2UU7A 2JT4B 4GN1A 3QC8B 4MM3A 5HI1A 1V97A 3RNFC 2Z0DB 4M0WA 2LVPA 3JSVB 3P4RB 3VUYA 1A5RA 2K8CA 2XBBC 2RPQA 1WE7A 2FCNA 4CYEA 1MJDA 1V80A 4RGOS 3KVFB 2N7EA 3I57A 4WWPA 2LVOA 1VLBA 2QC8A 2R61A 3RNAC 3TEYA 1GC6A 5JHAA 2RSUA 2FAZA 1EM7A 1EU4A 2J0KA 3AE3B 3N32A 1PGAA 1D6EC 1YQBA 3V6CB 2EKEC 2J0JA 3VRAB 1WGKA 2IY1B 4AOFA 4BOZB 1KLVA 1F9JA 2JUOA 2MBQA 3OWEB 1DYQA 3NJTA 4MACA 5CHVC 4EZJA 4RH6A 1WY8A 3RD2A 3RMKC 4HCNB 2LHEA 3K9PB 2WS3B 2V1YA 2WDVB 2MBHA 4A55A 2ZVNA 2OJRA 4MGYE 1XD3B 2I1KA 5D3DA 3VR8B 2AQ3B 3H7PB 1FNVA 1XQQA 4NJ6A 2W3RA 5J18A 1EU3A 2KMMA 3PREA 5BO4B 4YTNB 2IYDB 3PTFC 2WXFA 1WXVA 2FE8A 5G55A 2CJNA 3MC9A 1V86A 3PLUA 2KWDA 5D94A 1ACCA 3ZUNA 3HVZA 4FJVB 3AN1A 2NR2A 3PSEB 1E8ZA 3ONSA 1QT9A 4MGKE 1BT0A 2FCSA 2V4IB 2GBJA 2E6XA 3ZDTA 3L13A 3SHQA 2LGIA 1UWMA 3AE6B 1V6EA 3AE2B 4HLEA 1VDVA 3B2FA 2QCZA 1ET6A 2R2QA 1HTQA 1YX6B 1K8RB 4XC2A 2O2VB 4M01A 1WZ3A 4KGSA 1JROA 4ZYNA 4XYCA 2DENB 2BGFA 2V3SA 5MPOA 5IOIA 3NZSA 5DPRA 2WXPA 1J8CA 4NJCA 4DHZE 3WCQA 3VVWB 3DBRI 4K7SA 4DDID 4DXFA 3PRPB 3U52E 4HCPB 4TSSA 1IGCA 3ZJUA 3DQVA 2RGFA 3T3OA 2Y5BB 3Q8CA 4IM3A 2PE9A 4EEWA 1SSNA 1V5TA 2KQ4X 2G9HD 1WYGA 4RNAA 4EE2A 1QOFA 5G5GA 2WP9B 3DBRB 4JWSC 1E90A 2DAJA 1QLBB 2LZ6A 1C4PA 3C8YA 5D2MB 4HKZE 4P16A 2CU1A 3VTVA 2MA9B 4C56C 4YSXB 1KF6B 3PVLA 1N6ZA 3AV8A 2Z59B 2KZRA 1AN8A 2DHZA 5J2RA 3K9OB 3W5UB 1V5OA 5DPSA 3H8HA 2ON8A 3IHPC 1WR6E 1Q5WB 3AU4A 1TKGA 4KIKB 3DVNV 1N5WA 3BWUD 2NVUI 4PS7A 4A90A 3IAM1 2JPHA 4WQMA 4S0RA 1QOBA 1WJ4A 1MFWA 4AS1A 2H88B 4HRSA 1LO5D 1BMLC 2KFKB 2MEKA 3I63C 4ARCA 4ASWC 3L10B 1QOGA 1WE6A 2JWZA 5BYQA 4F8CB 4D2KA 3JYUA 4K7WA 4AQ7A 1FMAD 3AE9B 3ZW3A 2GRIA 3Q3MC 2W9NA 2K8HA 4HDQA 3DCGA 1UNSA 3EUB2 2KMAA 2L8JA 3ZTCA 4DWFA 1V81A 4MJSB 1L6VA 1ET9A 1ROEA 1OEYA 3A9KB 1J19A 4WAAA 1HXYD 4FHJA 4ZRJA 4FJYA 2JYTA 4RGTA 5EE1A 4HROA 1C1YB 1TIFA 3VFKA 2KDFB 2MSED 1UD7A 3EC8A 4ZYSA 2J53A 1KRHA 3WANA 2MWSB 2CJOA 3DHHC 1IPGA 3KH0A 3DBSA 4WJNA 2C7NB 4GDKB 1YJ1A 2MH7A 1WGYA 2AL3A 5E6NA 2WDTB 1I4HA 1PFDA 3TSSA 2JX5A 2AL6A 1PUTA 4MEMA 1WRIA 4NJ7A 3ALBA 2JXXA 2KVZA 4KIKA 1JRPA 3BZDB 1JMLA 3BYYB 2KC1A 1RFKA 5C23A 2KLCA 4LLGM 4W9CA 4LNIA 4MH8A 1RRBA 1Y56A 3N9YC 2B3AA 4BKSA 2SAKA 4OVVA 2KFKA 3PHXB 1D3ZA 3MHZA 2D3BA 3W5VB 1SEBD 1TTNA 2WXMA 1VJKA 2IO3B 1E8YA 2QIEB 3BIID 4LNFA 2WX1A 2MQJA 5L83A 1P7EA 1GJZA 1T0RC 3IBEA 4HKQA 4GXBA 2PVGC 1E6EB 3RPFC 3RCZA 4REZA 1WIAA 2CHWA 1KLUD 4HPPA 2WXQA 4DXGA 3DHGC 1XLNA 2OJWA 2EKIA 1AYFA 4K81A 1B1ZA 4A3PA 1UH6A 1D5MC 2N9XA 1P0RA 4KKIA 1OFFA 5I4DA 3L16A 4IWPA 3UIOB 1N61A 2HTME 3ZGZA 3M3JA 4HK2A 4HEA1 2KWUB 1MI0A 2LI5A 2K9XA 2REXA 4WWOA 3CSFA 3R66C 1SIFA 4XDDA 5AZFA 4F1SA 3OJ4B 3URYA 5JH5C 4LDTD 5AUIA 2WDQB 1GAQB 3L54A 3PPAA 2VZKB 1RAXA 3RNEC 3P4SB 2M8SA 1SJHD 2INNE 1EWCA 3U30A 2BBCA 3SEBA 3AECB 1WGHA 1C76A 3QWZB 1K53A 4W9GA 4ARIA 3OAWA 4C00A 1L4DB 5DPWA 2BYTA 2BS3B 2N1WA 3QQ8B 1GB1A 4US8A 3ZQ4A 1EUVB 2H89B 3ZXVA 1TYGB 2L0TA 4RGNA 1Z2MA 2AYOB 2KO3A 3E56A 2LWPA 2V3PA 3NZ3A 3T3NA 4CO7A 1IBXA 2FIDA 2Y3AA 2J0MA 3SD5A 4LNNA 1VZ7A 4HJGE 4P7IA 2KN4A 3P63A 1JCKB 2KX3A 1C9FA 2KNBA 1K51A 2L00B 5L95C 2C9WB 2EMTA 4TKNA 1OQYA 2KLGA 4NAMA 1YNTE 2IPKD 4NZLB 3S2AA 3RZWC 3AEGB 1X1MA 1WH3A 3N1XC 1J7BA 1UGJA 3U2SC 5H8YE 2A5UA 2J52A 3OJ3A 2ZEQA 2EELA 1YN5A 2J7QB 3TMPB 3QX1A 3WAPA 1GPXA 3TEWA 4FN2A 1EF1A 4A20A 1FFUA 1N63A 1T0YA 2KC2A 1PDXA 2I38A 2V3NA 3MC8A 3VAWA 2CS4A 1YQ4B 3N20C 2O6VD 3VDZA 3BINA 4E74A 3PRMB 5IA7A 2RPVA 1FEHA 2K22A 3GS2A 1AWDA 2KACA 1HZ6A 2KQSA 2JRIB 1AW7A 3VH3B 1TBEA 3B2GA 3HRDD 1PGBA 3TIXA 2KFJA 1JQ4A 2QILA 1VD2A 2K6DB 4RGMA 2NPTA 4OZCA 4JPSA 1JW9D 1Q10A 4N59A 4H2AA 2WU2B 1I7HA 1N60A 2UWQA 1HQRD 1XCTL 3NS1A 1UBIA 1WX7A 1ZPSA 4GLSC 1SF0A 1LFDA 1DOIA 4YSYB 4XZ4A 1S3SG 4N9F4 1Q1OA 1EF5A 2GI9A 3QCAA 2WXIA 2LGDA 2LUEA 4EOYA 3P4PB 4XWTA 1K52A 2A4ZA 3PHWB 3DBHB 3LYYA 3FAHA 3KUDB 3UF8A 4NAWB 1WMHB 2IZVB 3RNBC 3BK2A 1L2NA 3RI7C 2CU3A 2R2OA 4JE3B 2XNAC 2IDYA 1WJUA 4G0NB 2G3QB 2K25A 2KWCA 2Y5PA 3SFDB 3RUIB 1IP9A 4US9A 4A8XC 4DHJB 5IP4D 3AXCA 5D6JB 2ZJDA 1VRAB 3EECA 3I5JC 1C4AA 5BMGA 4EZLA 3CSTA 3AB5A 1UELA 3A33B 1VR9A 3O65B 1TS2A 4GGQA 1JWUD 3ZNID 3N30A 3VRBB 4AJWA 3R2TA 1S1QB 1JWMD 3Q8FA 3NY5A 4N58A 4C4VB 2ONQA 3ZRFA 1WXQA 2MP2B 2RR9A 3A4RA 4BKTA 5LXHA 1TKYA 1I4GA 2JRHA 1YD8U 1I4QA 3JSVA 1Z5SB 3AE7B 2HE7A 2KTFA 2LD9A 3VTUA 4GMVA 1KJTA 4NY0A 4CHKA 3IVFA 2UYZB 1CZPA 4IKGA 1ZXIA 3ECIA 1WWTA 1TS5A 2IJ0A 2PIAA 4J6IA 1WGRA 4PT5A 4M8NA 1FRDA 1M4VA 2D5GA 4YSZB 5J17A 1XCQL 3TCAA 1LXDA 3LB8C 4KSLC 1L4ZB 3Q8EA 2KDEB 3VUWA 3PS6A 4GDLB 3A4SC 3P2BA 2Z8LA 3PZDA 1JWAD 2BKRB 2HJ8A 3CIRB 3H7PA 3NHEB 3AH7A 1SE4A 2KT7A 1XO3A 2L0FA 5HHDG 3SDLC 3I9V1 1ZW7A 3I3TB 1F0ZA 1TZOA 3ZJVA 2KDIA 1UGMA 4C4VA 2V4LA 3H7SA 4C80A 2SEBD 2W3SA 4OVZA 2MP2A 2LUMA 3TEXA 2X8XX 4OZAA 2MX2A 4BOSC 4ZRIA 1UWXA 1V1OA 3R8BA 2RDBC 3CMMB 2N7JA 4UDUC 3WIMA 1U4AA 3NUHB 3MJ5A 2HD5B 2KJRA 3C0RB 1WR1A 3Q2AC 1E10A 2O2VA 4W9LA 5GXGB 4OVUA 4OZBA 1HTOA 4B0EA 2IO1B 2LMCA 4P1BC 1YMHE 1T0SC 2KK8A 2CHXA 2BYVE 4FHKA 2WNMA 4IW0A 1WJ6A 1V8CA 2MJDA 4KX6B 2N9EB 2KWVB 3A9JB 4W9HA 2K3UA 3DPDA 2GMIC 4WJPA 5DPTA 1H4RA 1FPYA 1JRUA 3QHTA 4GDLA 4LTUA 3Q14C 1Q0WB 3HM6X 2N4FA 2WHIA 5EE3A 1XLQA 2K0PA 2INCC 4WIPA 2BYFA 1QQRA 1P7FA 4K3CA 1RWSA 4KVGB 2RD0A 3RNGC 4EZKA 5EDSA 3MFGA 1ZGUB 4BKGA 1XXGA 3FC4A 2KYWA 2JYEA 2DYMA 2ZPYA 2LRUA 1QKZA 2BWFA 2JY6A 3V3XA 1XLPA 1L7YA 2L7RA 4II2B 1NEKB 1HEZE 2LFIA 3AE8B 2L1AA 2O6VB 2JXTA 4AUQC 1WXAA 2XK5B 2N9PC 4K7UA 1YQ3B 4WJQA 2NTSA 3TJPA 1YN4A 4LJPB 1OQQA 4PYUA 2NTTA 3N1YC 1KM7A 2FCMA 2LGYA 4AP4C 3DOWA 1E7PB 4RF0A 4MELA 2V9HA 4WWNA 1KH0A 3Q3OC 2WXOA 1WX9A 3B9JA 2NS5A 4IWOA 3V62A 1TY2A 3M95A 3ZO5B 3NRZA 3QAQA 3RNCC 2TSSA 1TGZB 2VH2A 3D32A 4O1NA 2VH1A 1TKEA 1WF9A 5IN7A 3NZUA 5IO9A 2DAFA 4MJSA 3NVYA 1CJEA 1FNWA 3ML8A 1D4BA 4ZRPA 3A9KA 3AU5A 3R3MA 4YWGG 2BVCA 1NI3A 1L5PA 5D3IB 3VTWA 2WWZA 1VZ6A 1E0ZA 3R7RA 2DBYA 2GB1A 4XWWA 1F77A 3NS8A 3LJ3A 1P3QU 2K39A 4OW0A 2QDFA 4EUTA 1OGWA 5BYSA 4GDKA 5GMVA 4ICUA 4GIVA 4KZCA 3V05A 2G45B 3VXWA 2PPHA 2BYEA 2KKCA 2ZNVC 5FKAC 1MHHE 3ZLZA 1QOAA 1WXSA 2WGSA 3BVGA 2D10A 3OG5A 3DHIC 4KDIC 1WSPA 1YOVB 4HPMB 4B0MA 4IC7B 1F52A 1F2RI 1G6JA 1SXTA 2XN9C 3AEFB 3B0AA 4XX5A 2QEJC 4TUUA 2NBUA 1ENFA 4P6VF 5LNK1 1STEA 3RT3B 2NBVB 3RFZB 4RM8A 1HE8A 3KW5B 1I42A 5TSSA 4MGIE 3AMZA 1C77A 4W9IA 3GE8C 4FBJB 3B1LX 3KQ4A 2AQ1B 1E9MA 1ESFA 2YVCA 2EMSA 2D3GA 1ISNA 3DBLI 2YEPF 1JWBD 2DX5B 4NQLB 4DXAB 2I1JA 1L0XB 3M62B 2FBWB 3ZIMA 5BMIA 2FIFA 1FD6A 5DCNA 5CHFA 3LDZE 4JGHB 4EKUA 1ZE3D 3A1QB 3HM3A 4YTPB 2OHFA 4W9KA 3U7ZA 4IM2A 3U7DA 3RZFA 2K1FA 4J3OD 1T6BX 4L2YA 1VZ8A 2KHWB 1R4MI 1MHXA 2FUHB 2N7DA 2JWUA 4ITKA 1WGGA 3SR6A 1XEEA 2JU6X 2MBEA 3DBLB 4BKSD 1UF0A 4KKJA 2N0SB 1ZP0B 3WAMA 5IAAC 4MM3B 2BQQA 1FCCC 5CHWA 2WQYB 3H1UA 5G2NA 1YN3A 1QF6A 4G3XB 2C7HA 3N3KB 3RYTA 1WM3A 4PK1A 3NG0A 3NVZA 4LK0M 1F1HA 3H9DA 1R4MB 3AEEB 3ENEA 5FR3A 2WLBA 2DWQA 4MDKE 2BS2B 3KWVA 2HTHA 1R4NI 4MH0E 1TY0A 1OTRB 4P1CC 3VR9B 2KJHB 4BBNF 3Q6BA 3ZTDA 3U4EG 1V9JA 4M00A 1BUIC 3ETRA 2IGHA 2NCNA 4RFBA 4EFOA 1E7VA 2CHZA 1TZ1A 2DZIA 2LGSA 2KQ7A 4AWJA 4FADA 2AQ2B 1PQSA 3A1QA 3L17A 4HVBA 5JZEB 1SJED 2N9LA 5LLIA 1IYFA 4HDOA 1P1AA 2C7MB 2M1MA 4PS8A 2MW5A 3OLMD 3TEZA 4IDIA 5JHBA 4W9EA 3VUXA 4ZRKA 2CR5A 2D07B 2FCQA 3GP7A 3L0WB 4KDLB 4LNKA 4YTMB 2PE6B 4KSKC 2PLPA 4MGZE 3X0WA 3HVDA 4ZRQA 5EE0A 1N5XA 3SFEB 3IAS1 2N1VA 3W1SC 2QSDA 2RDHA 2DYOA 1UBQA 2D3CA 1SBBB 2MJ3A 3GZNI 4FXCA 1F2RC 4TV3A 4M8MA 2PJHA 3QJZA 3MHSD 2QJLA 4FLHA 4II3B 1CQVA 3UI3A 2L05A 1WJNA 2GLSA 4C7YA 2DYBA 5BMHA 1JALA 5BYRA 3BVMA 3WALA 4IOIE 2HDEA 3C19A 4IWQA 2BB6A 4FA6A 2GBKA 4K3BA 3ZYYX 3KYCD 2G4SA 4IUMB 1E8XA 2LJIA 2ZPNA 4B95A 3UQAA 3GZNB 2M0AA 3T9LA 2YEPB 1NENB 1ZKHA 4USAA 2KD0A 2AWTA 3FILB 4W9DA 2WYQA 2OEDA 4L1BA 4ANVA 2MHJA 4RF1A 3V6EB 4WAFA 1V1PB 2NMQA 3DWGC 4GSWA 3HIZA 1I4PA 1XT9B 3ZVVA 2BKFA 1FCLA 1UUPA 2QMTA 2INDC 4LCDE 1D5ZC 1IUEA 1GC7A 2VZKD 1ZOYB 1FRRA 4I6PA 3AEBB 1KFYB 2M4NA 2VRRB 5AUKA 3AEDB 4TQ1A 1YIWA 4X57B 5AEKB 1RLFA 2JZZA 3KYDD 3Q69A 5HG2A 1FXIA 3EA6A 2OOBB 1SE9A 4Q2JA 2L52A 1R7SA 4HPLB 2MJEA 2Y5CA 4GU2A 2D3AA 4NAWA 3ZXRA 1WMHA 1NDDA 3PV1A 2K5PA 3PLVA 2AEHA 1NI2A 4JWUC 1FNUA 4TQ0A 2KANA 2GBNA 2JSVX 1ZXHA 1HA5A 2M19A 2C5LC 3Q8BA 3APDA 1WFYA 3TUOA 1FFVA 1CK1A 2IGGA 5EE9A 4NPNA 4JLCA 3W1YA 5E6PA 1MG4A 2KXJA 3X23A 3BY4B 3VQIA 2KN5A 1E7UA 1LM8B 1YJIA 2INPE 3UGBB 1GB4A 1JWSD 3FILA 2Z0EB 3QK0A 4BFRA 4WURA 2KDMA 1MVKA 2BF8B 1J0GA 1WGDA 4B6WA 3BYTB 1L6UA 4L23A 2MCNB 2ACZB 2PVOD 1V1PA 2KOXA 2DNFA 4LDTB 5LXIB 3UQBA 1N62A 1FM0D 1UZXB 3JVZX 2AX5A 1T5XD 5C1ZA 2N9KA 3MTNB 1K50A 1GG3A 3ML9A 1KLGD 3W2DA 2KMCA 3IT4B 4JL9A 1M94A 4W9JA 4A3OA 5FR6A 5JXVA 3IFWB 2KVRA 4HWIB 3GOEA 1I4RA 4E3CA 1H8CA 4DK5A 5KHQA 3AM9A 3EFUA 2WXKA 3VHTC 3UIPB 1LQBA 2ZVOA 4DDGD 2WXJA 1D5XC 1V2YA 4N6EB 5G5HA 3PT2B 2RDGA 3MC0B 2WXGA 1AARA 2NBWB 4RMAA 3NVVA 3V60A 3PGEA 2MBBB 1DGJA 3GB1A 4QAYA 1LGRA 3L4PA 2KDBA 2BWES 2LGXA 3WAOA 2W82A 2ZNVB 3AEAB 5FK9C 3Q3FA 3RN9C 3MJWA 3VH4B 1YJJA 2LEKA 2J42A 1VCBA 1DOXA 4WJOA 3DVNU 1SGHA 2PKOA 4XE0A 3BK1A 1FO4A 1BXTA 1NVID 4I6NB 4KGTA 4JIOU 2D2QA 2WU5B 3W9CB 1WZ0A 2WXHA 1RFAA 2IGDA 3IXSA 3CF6E 1KOTA 1CMXB 2JF5A 2ZW0A 3M63B 1QZEA 4DBGA 3JW0X 4ANUA 4FJZA 1YX5B 2ZW1A 4ANWA 4BBNC 3HK0A 2PW9A 4MSQB 4AJYB 3ZKJC 2MLBA 3ZNHB 4JQWC 4ICVA 3TBLD 4WH4A 3P42A 3EHVA 2G1EA 1WXMA 2LHDA 4GB9A 1TS3A 2GOWA 1TT5B 1SB3C 2LRWA 2YLMA 3MP9A 2KTRB 4W9FA 4DHJD 2PMVA 1GUAB 1T3QA 3AI5A 4RM9A 1XLOA 1J7AA 4XGAB 3PRZA 2QHOA 1I4XA 2GBMA 4NQKE 2LVQA 1MG8A 2D11A 4WWMA 3R7QA 5T8IA 1WX8A 3SU8X 1FIQA 3A9JA 3TL5A 4MSMB 3Q8AA 1WI0A 3HUIA 3U8ZA 1NYQA 3EFCA 2ZCCA 4F7ZA 1DOYA 2WXNA 1QILA 2WXLA 1B9RA 1SE2A 4DQOC 1A70A 2M17A 4FULA 3R2IA 4B9KA 3QARA 4MT5A 1PYWD 2JQRB 2FUG1 5AZGA 2BT6A 1WM2A 3QIJA 1OQRA 2JVCA 3UINB 1NBFC 3NVWA 1E8WA 2BW2A 3ZRCA 3P4QB 4HJKA 2PTLA 4KGRA 1EO6A 3PZ7A 1FXTB 5KHOA 1E5WA 5HKHA 3AE4B 3RULA 2WXRA 2BPSA 3BVZA 4BZAA 4G11A 3WA0A 4E71A 2E3TA 1L0VB 1IBXB 3T8MA 2Q5WD 3Q3NC 2K6QA 3CWIA 4ANXA 2O6VA 4IG7B 2IO0B 3J9CA 3LXFA 3N1ZC 4A6QA 3KWLA 4PS3A
chains in the Genus database with same CATH topology
2LD9A 2XK5A 3VTUA 4GMVA 1KJTA 4NY0A 2W9NA 2K8HA 4HDQA 3DCGA 2KTRA 2NCNA 4CHKA 4EFOA 3IVFA 1E7VA 2CHZA 2UYZB 1TZ1A 2DZMA 2KMAA 2DZIA 3HHMA 2L8JA 3ZTCA 1WYWB 2KQ7A 4AWJA 4DWFA 4FADA 1V81A 4MJSB 1PQSA 3ECIA 3A1QA 3L17A 1OEYA 3V61A 4HVBA 5JZEB 3A9KB 1J19A 4J6IA 4WAAA 4FHJA 4I6LB 4ZRJA 2L76A 5LLIA 1IYFA 4HDOA 4FJYA 1P1AA 1WGRA 2C7MB 4KV2A 4M8NA 2M1MA 4PS8A 2MRPA 2MW5A 3KUZA 3OLMD 1C3TA 2ZCBA 5JHBA 2JZ3B 4W9EA 3VUXA 1C1YB 4WQOB 4HXDA 2G4DB 4ZRKA 3VFKA 2KDFB 2MSED 2PEAA 1UD7A 3EC8A 3H6NA 5J17A 2CR5A 2D07B 2FCQA 2ZZPB 3L0WB 4KDLB 4YL8A 2PE6B 4KSKC 3WANA 2MWSB 1LXDA 5CX3A 3TCAA 4KSLC 1IPGA 4MGZE 3X0WA 3KH0A 2GBRA 3DBSA 4WJNA 2KDEB 3VUWA 2C7NB 4GDKB 1YJ1A 4GOCA 3PS6A 1WGYA 2AL3A 5E6NA 2WDTB 4GDLB 3A4SC 2N1VA 3P2BA 2IY0B 3APCA 5AZHA 3W1SC 4K1RB 1WRDB 2DYOA 3PZDA 1UBQA 3IG3A 2AL6A 2BKRB 2HJ8A 3H7PA 5E6OA 3NHEB 3GZNI 4MEMA 4TV3A 4M8MA 4NJ7A 3ALBA 2L0FA 2JXXA 2PJHA 3SDLC 3QJZA 4KIKA 3MHSD 4URKA 4FLHA 3Q3JA 4II3B 1ZW7A 2L05A 1WJNA 2KC1A 3I3TB 5C23A 2DYBA 2KLCA 4W9CA 2KDIA 1UGMA 2XEWA 1OEYJ 3WALA 2V4LA 5CTRC 3H7SA 4LJOB 1RRBA 2B3AA 4IWQA 2KX0A 4BKSA 2MP2A 4FA6A 2NPTB 4OVVA 2KFKA 2GBKA 3PHXB 1D3ZA 1TTNA 3KYCD 2G4SA 2MX2A 4IUMB 1E8XA 2ZPNA 4B95A 4BOSC 3UQAA 4ZRIA 2IO3B 4M0WB 3T9LA 1E8YA 1ZKHA 4ZDVA 3CMMB 4PYZA 2KD0A 5D7GA 2AWTA 3WIMA 1U4AA 1P9DU 3QA8A 4W9DA 2WYQA 2ASQA 2HD5B 2KJRA 3C0RB 2WX1A 1WR1A 2MQJA 2LXAA 5L83A 4ANVA 3DDCB 2O2VA 1GJZA 4W9LA 3IBEA 3DVGY 4OVUA 2K8BA 4GXBA 3V6EB 2FNJB 3NOBA 4GSWA 3ZNGC 2IO1B 3HIZA 3RCZA 2IO2B 1WIAA 2CHWA 3L08A 1XT9B 5TR5A 3ZVVA 2BKFA 2KK8A 1P98A 2CHXA 2BYVE 4FHKA 2LJ5A 4IW0A 4K81A 1WJ6A 1Y8RC 4LCDE 1GC7A 4NNJB 4IM0A 1UH6A 3KUCB 4A3PA 4I6PA 2DZJA 2N9EB 3DVGX 2KWVB 1P0RA 2MBOA 2N9XA 2IBIB 2M4NA 3W1SA 2VRRB 3A9JB 4W9HA 2LXCA 1GNUA 4TQ1A 2C60A 3DPDA 3L16A 4IWPA 1YIWA 3UIOB 2GMIC 4WJPA 5DPTA 4X57B 1H4RA 1JRUA 1RLFA 2JZZA 3KYDD 3QHTA 3M3JA 4GDLA 4HK2A 3ZNZB 5AEKB 2WX0A 1Q0WB 2KJ6A 3HM6X 2OOBB 1SE9A 2KWUB 2N4FA 2LI5A 2BYFA 2M0XA 2REXA 3B08A 4WWOA 3CSFA 3R66C 4HPLB 4DHZB 2LASA 1SIFA 3AULA 4GU2A 2CKHB 5AZFA 4BVUC 4F1SA 4KVGB 4NAWA 3OJ4B 2RD0A 1WMHA 1NDDA 1V49A 3PV1A 5JH5C 4EZKA 5EDSA 3PLVA 2AEHA 4LDTD 1ZGUB 3ZDMC 4KZ0A 1NI2A 4BKGA 4TQ0A 2KANA 2GBNA 3L54A 2DYMA 2ZPYA 3PPAA 2C5LC 1RAXA 3APFA 2LRUA 2L3ZA 3APDA 1WFYA 4G50A 2M8SA 3DBHI 2BWFA 2DZKA 2JY6A 1I35A 4NPNA 2JT4B 1L7YA 3QC8B 4GN1A 4JLCA 4MM3A 3W1YA 5E6PA 3U30A 2KXJA 2Z0DB 3X23A 3BY4B 2L7RA 3VQIA 1WGHA 3QWZB 2KN5A 1E7UA 4II2B 1LM8B 4W9GA 3UGBB 2LVPA 3JSVB 3OAWA 3VUYA 1A5RA 2O6VB 5DPWA 2Z0EB 3QK0A 4BFRA 2N1WA 2K8CA 2BF8B 2XBBC 1WGDA 1J0GA 2RPQA 1WE7A 2FCNA 4AUQC 4B6WA 4CYEA 1WXAA 2XK5B 3QQ8B 1V80A 2N9PC 3KVFB 2N7EA 4K7UA 4WJQA 4WWPA 3TJPA 2MCNB 4LJPB 2LVOA 4PYUA 1EUVB 1KM7A 2KOXA 2FCMA 2LGYA 4AP4C 1GC6A 3DOWA 5JHAA 4LDTB 5LXIB 2RSUA 2FAZA 2L0TA 4MELA 3UQBA 1UZXB 1Z2MA 3JVZX 2J0KA 2AYOB 2KO3A 4WWNA 5C1ZA 2LWPA 3MTNB 1GG3A 3N32A 3ML9A 4CO7A 2KMCA 4JL9A 1WX9A 2FIDA 1M94A 1YQBA 2J0MA 4W9JA 3SD5A 2NS5A 4IWOA 5FR6A 3V6CB 4A3OA 3IFWB 2KVRA 2EKEC 2J0JA 4HWIB 3V62A 4AOFA 2IY1B 3GOEA 3M95A 4P7IA 3ZO5B 4BOZB 3QAQA 1F9JA 1KLVA 2JUOA 4E3CA 2MBQA 2KX3A 1H8CA 4DK5A 1TGZB 2KNBA 2L00B 5KHQA 5L95C 2C9WB 3D32A 2EMTA 3EFUA 4TKNA 5CHVC 3VHTC 4EZJA 1WF9A 1WY8A 3NZUA 3RD2A 4HCNB 3UIPB 3K9PB 1OQYA 2KLGA 1LQBA 2DAFA 2ZVOA 4MJSA 2V1YA 4DDGD 3S2AA 2MBHA 3RZWC 1V2YA 3ML8A 3A9KA 2ZVNA 1X1MA 1WH3A 2OJRA 3AU5A 3R3MA 4MGYE 1XD3B 2I1KA 3VTWA 2WWZA 3PT2B 2A5UA 3H7PB 3OJ3A 2ZEQA 1XQQA 4NJ6A 5J18A 1AARA 2J7QB 3R7RA 3TMPB 2NBWB 3PREA 5BO4B 2IYDB 3PTFC 4RMAA 3V60A 3NS8A 3PGEA 3LJ3A 2MBBB 3QX1A 3WAPA 1WXVA 1P3QU 5G55A 4FN2A 2K39A 1V86A 1EF1A 3PLUA 2KDBA 2BWES 4A20A 2LGXA 4EUTA 3WAOA 1OGWA 2ZNVB 5D94A 1T0YA 2KC2A 4GDKA 3ZUNA 5GMVA 3Q3FA 3VH4B 3MJWA 4FJVB 4ICUA 2NR2A 2CS4A 1VCBA 3PSEB 4WJOA 3VAWA 1E8ZA 4GIVA 4KZCA 3ONSA 3DVNU 2G45B 1SGHA 3VXWA 2PPHA 4MGKE 2BYEA 2O6VD 1BT0A 2FCSA 2GBJA 3VDZA 3BINA 2KKCA 2ZNVC 3ZDTA 4E74A 3PRMB 4I6NB 3L13A 5IA7A 3SHQA 3ZLZA 1WXSA 4JIOU 2D2QA 1V6EA 2D10A 4HLEA 1WZ0A 1RFAA 4KDIC 2R2QA 4HPMB 2KQSA 1YX6B 4IC7B 1K8RB 2JRIB 4XC2A 3CF6E 1G6JA 2O2VB 3VH3B 1TBEA 1KOTA 1WZ3A 3B0AA 4XX5A 1CMXB 2JF5A 3TIXA 2KFJA 1VD2A 2K6DB 4ZYNA 3M63B 1QZEA 4TUUA 4DBGA 2NBUA 2NPTA 2DENB 3JW0X 2BGFA 2V3SA 3RT3B 2NBVB 4RM8A 4ANUA 1HE8A 4FJZA 3KW5B 1YX5B 3NZSA 2UWQA 4MGIE 5DPRA 1I42A 1J8CA 4W9IA 4ANWA 4FBJB 4BBNC 3B1LX 3HK0A 4MSQB 1UBIA 1WX7A 4AJYB 3ZKJC 2MLBA 4DHZE 3ZNHB 4JQWC 4ICVA 3TBLD 3VVWB 2YVCA 1LFDA 2EMSA 3EHVA 2D3GA 3DBRI 4XZ4A 1ISNA 1S3SG 1WXMA 3DBLI 4GB9A 4N9F4 1Q1OA 4K7SA 1EF5A 2GOWA 3QCAA 2DX5B 4NQLB 4DXAB 2I1JA 2LRWA 2YLMA 4DDID 2LGDA 2KTRB 4W9FA 4DHJD 3M62B 3ZIMA 3PRPB 1GUAB 2FIFA 2LUEA 3AI5A 4HCPB 4RM9A 4EOYA 5DCNA 3DQVA 5CHFA 3LDZE 2RGFA 2A4ZA 3PHWB 3PRZA 4JGHB 4EKUA 2Y5BB 2QHOA 3A1QB 4IM3A 3HM3A 2PE9A 4NQKE 2GBMA 4EEWA 2LVQA 1MG8A 2D11A 3KUDB 4W9KA 4IM2A 3U7DA 1V5TA 3R7QA 3RZFA 2K1FA 1WX8A 3UF8A 4NAWB 2KHWB 1WMHB 1R4MI 2IZVB 3SU8X 2FUHB 2N7DA 1L2NA 1WGGA 3A9JA 3TL5A 4MSMB 1WI0A 1E90A 3U8ZA 2MBEA 2DAJA 4BKSD 2ZCCA 2R2OA 2LZ6A 5D2MB 4F7ZA 1WJUA 2CU1A 3VTVA 4G0NB 2G3QB 2K25A 2KWCA 2MA9B 3RUIB 1IP9A 2M17A 4FULA 3WAMA 5IAAC 4B9KA 3PVLA 5CHWA 3QARA 2Z59B 3H1UA 4DHJB 2KZRA 5G2NA 3AXCA 5AZGA 2DHZA 5J2RA 3K9OB 5D6JB 1WM2A 2ZJDA 3QIJA 4G3XB 3EECA 1V5OA 2C7HA 3N3KB 5DPSA 2JVCA 3IHPC 1WM3A 1WR6E 3RYTA 1NBFC 3UINB 4EZLA 1Q5WB 3AU4A 1E8WA 3ZRCA 3CSTA 3H9DA 3ENEA 1UELA 3A33B 4HJKA 4KIKB 3O65B 1EO6A 3DVNV 4GGQA 1FXTB 5KHOA 1E5WA 4MDKE 5HKHA 2NVUI 2HTHA 3ZNID 3N30A 1R4NI 4PS7A 3RULA 4AJWA 4MH0E 1S1QB 2BPSA 3NY5A 2JPHA 4G11A 1OTRB 1WJ4A 3WA0A 4E71A 3ZRFA 2KJHB 2MP2B 2RR9A 3A4RA 4BBNF 4BKTA 5LXHA 2KFKB 3ZTDA 2JRHA 1YD8U 3T8MA 4ASWC 3JSVA 2K6QA 1V9JA 3L10B 1WE6A 2JWZA 4ANXA 1Z5SB 2O6VA 2IO0B 3JYUA 4IG7B 4K7WA 4F8CB 2KTFA 2HE7A 3ZW3A 4PS3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2LD9 A;  2XK5 A;  3VTU A;  4GMV A;  1KJT A;  4NY0 A;  2W9N A;  2K8H A;  4HDQ A;  3DCG A;  2KTR A;  2NCN A;  4CHK A;  4EFO A;  3IVF A;  1E7V A;  2CHZ A;  2UYZ B;  1TZ1 A;  2DZM A;  2KMA A;  2DZI A;  3HHM A;  2L8J A;  3ZTC A;  1WYW B;  2KQ7 A;  4AWJ A;  4DWF A;  4FAD A;  1V81 A;  4MJS B;  1PQS A;  3ECI A;  3A1Q A;  3L17 A;  1OEY A;  3V61 A;  4HVB A;  5JZE B;  3A9K B;  1J19 A;  4J6I A;  4WAA A;  4FHJ A;  4I6L B;  4ZRJ A;  2L76 A;  5LLI A;  1IYF A;  4HDO A;  4FJY A;  1P1A A;  1WGR A;  2C7M B;  4KV2 A;  4M8N A;  2M1M A;  4PS8 A;  2MRP A;  2MW5 A;  3KUZ A;  3OLM D;  1C3T A;  2ZCB A;  5JHB A;  2JZ3 B;  4W9E A;  3VUX A;  1C1Y B;  4WQO B;  4HXD A;  2G4D B;  4ZRK A;  3VFK A;  2KDF B;  2MSE D;  2PEA A;  1UD7 A;  3EC8 A;  3H6N A;  5J17 A;  2CR5 A;  2D07 B;  2FCQ A;  2ZZP B;  3L0W B;  4KDL B;  4YL8 A;  2PE6 B;  4KSK C;  3WAN A;  2MWS B;  1LXD A;  5CX3 A;  3TCA A;  4KSL C;  1IPG A;  4MGZ E;  3X0W A;  3KH0 A;  2GBR A;  3DBS A;  4WJN A;  2KDE B;  3VUW A;  2C7N B;  4GDK B;  1YJ1 A;  4GOC A;  3PS6 A;  1WGY A;  2AL3 A;  5E6N A;  2WDT B;  4GDL B;  3A4S C;  2N1V A;  3P2B A;  2IY0 B;  3APC A;  5AZH A;  3W1S C;  4K1R B;  1WRD B;  2DYO A;  3PZD A;  1UBQ A;  3IG3 A;  2AL6 A;  2BKR B;  2HJ8 A;  3H7P A;  5E6O A;  3NHE B;  3GZN I;  4MEM A;  4TV3 A;  4M8M A;  4NJ7 A;  3ALB A;  2L0F A;  2JXX A;  2PJH A;  3SDL C;  3QJZ A;  4KIK A;  3MHS D;  4URK A;  4FLH A;  3Q3J A;  4II3 B;  1ZW7 A;  2L05 A;  1WJN A;  2KC1 A;  3I3T B;  5C23 A;  2DYB A;  2KLC A;  4W9C A;  2KDI A;  1UGM A;  2XEW A;  1OEY J;  3WAL A;  2V4L A;  5CTR C;  3H7S A;  4LJO B;  1RRB A;  2B3A A;  4IWQ A;  2KX0 A;  4BKS A;  2MP2 A;  4FA6 A;  2NPT B;  4OVV A;  2KFK A;  2GBK A;  3PHX B;  1D3Z A;  1TTN A;  3KYC D;  2G4S A;  2MX2 A;  4IUM B;  1E8X A;  2ZPN A;  4B95 A;  4BOS C;  3UQA A;  4ZRI A;  2IO3 B;  4M0W B;  3T9L A;  1E8Y A;  1ZKH A;  4ZDV A;  3CMM B;  4PYZ A;  2KD0 A;  5D7G A;  2AWT A;  3WIM A;  1U4A A;  1P9D U;  3QA8 A;  4W9D A;  2WYQ A;  2ASQ A;  2HD5 B;  2KJR A;  3C0R B;  2WX1 A;  1WR1 A;  2MQJ A;  2LXA A;  5L83 A;  4ANV A;  3DDC B;  2O2V A;  1GJZ A;  4W9L A;  3IBE A;  3DVG Y;  4OVU A;  2K8B A;  4GXB A;  3V6E B;  2FNJ B;  3NOB A;  4GSW A;  3ZNG C;  2IO1 B;  3HIZ A;  3RCZ A;  2IO2 B;  1WIA A;  2CHW A;  3L08 A;  1XT9 B;  5TR5 A;  3ZVV A;  2BKF A;  2KK8 A;  1P98 A;  2CHX A;  2BYV E;  4FHK A;  2LJ5 A;  4IW0 A;  4K81 A;  1WJ6 A;  1Y8R C;  4LCD E;  1GC7 A;  4NNJ B;  4IM0 A;  1UH6 A;  3KUC B;  4A3P A;  4I6P A;  2DZJ A;  2N9E B;  3DVG X;  2KWV B;  1P0R A;  2MBO A;  2N9X A;  2IBI B;  2M4N A;  3W1S A;  2VRR B;  3A9J B;  4W9H A;  2LXC A;  1GNU A;  4TQ1 A;  2C60 A;  3DPD A;  3L16 A;  4IWP A;  1YIW A;  3UIO B;  2GMI C;  4WJP A;  5DPT A;  4X57 B;  1H4R A;  1JRU A;  1RLF A;  2JZZ A;  3KYD D;  3QHT A;  3M3J A;  4GDL A;  4HK2 A;  3ZNZ B;  5AEK B;  2WX0 A;  1Q0W B;  2KJ6 A;  3HM6 X;  2OOB B;  1SE9 A;  2KWU B;  2N4F A;  2LI5 A;  2BYF A;  2M0X A;  2REX A;  3B08 A;  4WWO A;  3CSF A;  3R66 C;  4HPL B;  4DHZ B;  2LAS A;  1SIF A;  3AUL A;  4GU2 A;  2CKH B;  5AZF A;  4BVU C;  4F1S A;  4KVG B;  4NAW A;  3OJ4 B;  2RD0 A;  1WMH A;  1NDD A;  1V49 A;  3PV1 A;  5JH5 C;  4EZK A;  5EDS A;  3PLV A;  2AEH A;  4LDT D;  1ZGU B;  3ZDM C;  4KZ0 A;  1NI2 A;  4BKG A;  4TQ0 A;  2KAN A;  2GBN A;  3L54 A;  2DYM A;  2ZPY A;  3PPA A;  2C5L C;  1RAX A;  3APF A;  2LRU A;  2L3Z A;  3APD A;  1WFY A;  4G50 A;  2M8S A;  3DBH I;  2BWF A;  2DZK A;  2JY6 A;  1I35 A;  4NPN A;  2JT4 B;  1L7Y A;  3QC8 B;  4GN1 A;  4JLC A;  4MM3 A;  3W1Y A;  5E6P A;  3U30 A;  2KXJ A;  2Z0D B;  3X23 A;  3BY4 B;  2L7R A;  3VQI A;  1WGH A;  3QWZ B;  2KN5 A;  1E7U A;  4II2 B;  1LM8 B;  4W9G A;  3UGB B;  2LVP A;  3JSV B;  3OAW A;  3VUY A;  1A5R A;  2O6V B;  5DPW A;  2Z0E B;  3QK0 A;  4BFR A;  2N1W A;  2K8C A;  2BF8 B;  2XBB C;  1WGD A;  1J0G A;  2RPQ A;  1WE7 A;  2FCN A;  4AUQ C;  4B6W A;  4CYE A;  1WXA A;  2XK5 B;  3QQ8 B;  1V80 A;  2N9P C;  3KVF B;  2N7E A;  4K7U A;  4WJQ A;  4WWP A;  3TJP A;  2MCN B;  4LJP B;  2LVO A;  4PYU A;  1EUV B;  1KM7 A;  2KOX A;  2FCM A;  2LGY A;  4AP4 C;  1GC6 A;  3DOW A;  5JHA A;  4LDT B;  5LXI B;  2RSU A;  2FAZ A;  2L0T A;  4MEL A;  3UQB A;  1UZX B;  1Z2M A;  3JVZ X;  2J0K A;  2AYO B;  2KO3 A;  4WWN A;  5C1Z A;  2LWP A;  3MTN B;  1GG3 A;  3N32 A;  3ML9 A;  4CO7 A;  2KMC A;  4JL9 A;  1WX9 A;  2FID A;  1M94 A;  1YQB A;  2J0M A;  4W9J A;  3SD5 A;  2NS5 A;  4IWO A;  5FR6 A;  3V6C B;  4A3O A;  3IFW B;  2KVR A;  2EKE C;  2J0J A;  4HWI B;  3V62 A;  4AOF A;  2IY1 B;  3GOE A;  3M95 A;  4P7I A;  3ZO5 B;  4BOZ B;  3QAQ A;  1F9J A;  1KLV A;  2JUO A;  4E3C A;  2MBQ A;  2KX3 A;  1H8C A;  4DK5 A;  1TGZ B;  2KNB A;  2L00 B;  5KHQ A;  5L95 C;  2C9W B;  3D32 A;  2EMT A;  3EFU A;  4TKN A;  5CHV C;  3VHT C;  4EZJ A;  1WF9 A;  1WY8 A;  3NZU A;  3RD2 A;  4HCN B;  3UIP B;  3K9P B;  1OQY A;  2KLG A;  1LQB A;  2DAF A;  2ZVO A;  4MJS A;  2V1Y A;  4DDG D;  3S2A A;  2MBH A;  3RZW C;  1V2Y A;  3ML8 A;  3A9K A;  2ZVN A;  1X1M A;  1WH3 A;  2OJR A;  3AU5 A;  3R3M A;  4MGY E;  1XD3 B;  2I1K A;  3VTW A;  2WWZ A;  3PT2 B;  2A5U A;  3H7P B;  3OJ3 A;  2ZEQ A;  1XQQ A;  4NJ6 A;  5J18 A;  1AAR A;  2J7Q B;  3R7R A;  3TMP B;  2NBW B;  3PRE A;  5BO4 B;  2IYD B;  3PTF C;  4RMA A;  3V60 A;  3NS8 A;  3PGE A;  3LJ3 A;  2MBB B;  3QX1 A;  3WAP A;  1WXV A;  1P3Q U;  5G55 A;  4FN2 A;  2K39 A;  1V86 A;  1EF1 A;  3PLU A;  2KDB A;  2BWE S;  4A20 A;  2LGX A;  4EUT A;  3WAO A;  1OGW A;  2ZNV B;  5D94 A;  1T0Y A;  2KC2 A;  4GDK A;  3ZUN A;  5GMV A;  3Q3F A;  3VH4 B;  3MJW A;  4FJV B;  4ICU A;  2NR2 A;  2CS4 A;  1VCB A;  3PSE B;  4WJO A;  3VAW A;  1E8Z A;  4GIV A;  4KZC A;  3ONS A;  3DVN U;  2G45 B;  1SGH A;  3VXW A;  2PPH A;  4MGK E;  2BYE A;  2O6V D;  1BT0 A;  2FCS A;  2GBJ A;  3VDZ A;  3BIN A;  2KKC A;  2ZNV C;  3ZDT A;  4E74 A;  3PRM B;  4I6N B;  3L13 A;  5IA7 A;  3SHQ A;  3ZLZ A;  1WXS A;  4JIO U;  2D2Q A;  1V6E A;  2D10 A;  4HLE A;  1WZ0 A;  1RFA A;  4KDI C;  2R2Q A;  4HPM B;  2KQS A;  1YX6 B;  4IC7 B;  1K8R B;  2JRI B;  4XC2 A;  3CF6 E;  1G6J A;  2O2V B;  3VH3 B;  1TBE A;  1KOT A;  1WZ3 A;  3B0A A;  4XX5 A;  1CMX B;  2JF5 A;  3TIX A;  2KFJ A;  1VD2 A;  2K6D B;  4ZYN A;  3M63 B;  1QZE A;  4TUU A;  4DBG A;  2NBU A;  2NPT A;  2DEN B;  3JW0 X;  2BGF A;  2V3S A;  3RT3 B;  2NBV B;  4RM8 A;  4ANU A;  1HE8 A;  4FJZ A;  3KW5 B;  1YX5 B;  3NZS A;  2UWQ A;  4MGI E;  5DPR A;  1I42 A;  1J8C A;  4W9I A;  4ANW A;  4FBJ B;  4BBN C;  3B1L X;  3HK0 A;  4MSQ B;  1UBI A;  1WX7 A;  4AJY B;  3ZKJ C;  2MLB A;  4DHZ E;  3ZNH B;  4JQW C;  4ICV A;  3TBL D;  3VVW B;  2YVC A;  1LFD A;  2EMS A;  3EHV A;  2D3G A;  3DBR I;  4XZ4 A;  1ISN A;  1S3S G;  1WXM A;  3DBL I;  4GB9 A;  4N9F 4;  1Q1O A;  4K7S A;  1EF5 A;  2GOW A;  3QCA A;  2DX5 B;  4NQL B;  4DXA B;  2I1J A;  2LRW A;  2YLM A;  4DDI D;  2LGD A;  2KTR B;  4W9F A;  4DHJ D;  3M62 B;  3ZIM A;  3PRP B;  1GUA B;  2FIF A;  2LUE A;  3AI5 A;  4HCP B;  4RM9 A;  4EOY A;  5DCN A;  3DQV A;  5CHF A;  3LDZ E;  2RGF A;  2A4Z A;  3PHW B;  3PRZ A;  4JGH B;  4EKU A;  2Y5B B;  2QHO A;  3A1Q B;  4IM3 A;  3HM3 A;  2PE9 A;  4NQK E;  2GBM A;  4EEW A;  2LVQ A;  1MG8 A;  2D11 A;  3KUD B;  4W9K A;  4IM2 A;  3U7D A;  1V5T A;  3R7Q A;  3RZF A;  2K1F A;  1WX8 A;  3UF8 A;  4NAW B;  2KHW B;  1WMH B;  1R4M I;  2IZV B;  3SU8 X;  2FUH B;  2N7D A;  1L2N A;  1WGG A;  3A9J A;  3TL5 A;  4MSM B;  1WI0 A;  1E90 A;  3U8Z A;  2MBE A;  2DAJ A;  4BKS D;  2ZCC A;  2R2O A;  2LZ6 A;  5D2M B;  4F7Z A;  1WJU A;  2CU1 A;  3VTV A;  4G0N B;  2G3Q B;  2K25 A;  2KWC A;  2MA9 B;  3RUI B;  1IP9 A;  2M17 A;  4FUL A;  3WAM A;  5IAA C;  4B9K A;  3PVL A;  5CHW A;  3QAR A;  2Z59 B;  3H1U A;  4DHJ B;  2KZR A;  5G2N A;  3AXC A;  5AZG A;  2DHZ A;  5J2R A;  3K9O B;  5D6J B;  1WM2 A;  2ZJD A;  3QIJ A;  4G3X B;  3EEC A;  1V5O A;  2C7H A;  3N3K B;  5DPS A;  2JVC A;  3IHP C;  1WM3 A;  1WR6 E;  3RYT A;  1NBF C;  3UIN B;  4EZL A;  1Q5W B;  3AU4 A;  1E8W A;  3ZRC A;  3CST A;  3H9D A;  3ENE A;  1UEL A;  3A33 B;  4HJK A;  4KIK B;  3O65 B;  1EO6 A;  3DVN V;  4GGQ A;  1FXT B;  5KHO A;  1E5W A;  4MDK E;  5HKH A;  2NVU I;  2HTH A;  3ZNI D;  3N30 A;  1R4N I;  4PS7 A;  3RUL A;  4AJW A;  4MH0 E;  1S1Q B;  2BPS A;  3NY5 A;  2JPH A;  4G11 A;  1OTR B;  1WJ4 A;  3WA0 A;  4E71 A;  3ZRF A;  2KJH B;  2MP2 B;  2RR9 A;  3A4R A;  4BBN F;  4BKT A;  5LXH A;  2KFK B;  3ZTD A;  2JRH A;  1YD8 U;  3T8M A;  4ASW C;  3JSV A;  2K6Q A;  1V9J A;  3L10 B;  1WE6 A;  2JWZ A;  4ANX A;  1Z5S B;  2O6V A;  2IO0 B;  3JYU A;  4IG7 B;  4K7W A;  4F8C B;  2KTF A;  2HE7 A;  3ZW3 A;  4PS3 A; 
#chains in the Genus database with same CATH topology
 1SE3 A;  2XK5 A;  4JX1 C;  4YXD B;  2KTR A;  2DZM A;  3HHM A;  2J4X A;  1WYW B;  4CQN A;  1RYJ A;  1L0Y B;  2L32 A;  3P1M A;  3V61 A;  5H92 C;  1KTK A;  4LNO A;  4I6L B;  1J7C A;  2L76 A;  2BTE A;  4KV2 A;  2MRP A;  3KUZ A;  2HJ1 A;  1C3T A;  2ZCB A;  2JZ3 B;  4WQO B;  4YT0 B;  4HXD A;  1C78 A;  2G4D B;  1EWY C;  2PEA A;  3H6N A;  2ZZP B;  4YL8 A;  3DWM A;  4ZHO A;  5CX3 A;  2GBR A;  3ZJT A;  4C7Z A;  4GOC A;  1C4C A;  2WDR B;  1XF5 L;  3PO0 A;  4TMA B;  1SIJ A;  2IY0 B;  3APC A;  5AZH A;  4K1R B;  1TJE A;  1WRD B;  3KLS X;  4XDC A;  3IG3 A;  5E6O A;  2X38 A;  2W54 A;  4S17 A;  1FXA A;  4ACF A;  4A9A A;  3IT6 B;  4URK A;  1C79 A;  3Q3J A;  3O13 A;  3E9S A;  2M56 B;  5HFY A;  1ZDX A;  2XEW A;  1OEY J;  3PZ8 A;  2RMM A;  5CTR C;  1ZUD 2;  4LJO B;  1TS4 A;  1T0Q C;  2KX0 A;  2NPT B;  1MPE A;  2JZP A;  4M0W B;  4R3D A;  2B76 B;  4ZDV A;  4PYZ A;  5D7G A;  1P9D U;  3QA8 A;  2ASQ A;  1NYR A;  1ZDV A;  2LXA A;  5C3J B;  3DDC B;  3DVG Y;  2K8B A;  2FNJ B;  3NOB A;  3ZNG C;  2IO2 B;  3L08 A;  5TR5 A;  1PGX A;  3FKY A;  2V0G A;  4ZHP A;  1P98 A;  2ICI A;  2LJ5 A;  1Y8R C;  2L83 A;  4ZOH C;  4NNJ B;  4IM0 A;  3KUC B;  2DZJ A;  3DVG X;  4M02 A;  2MBO A;  2IBI B;  3W1S A;  4RCO A;  2LXC A;  1GNU A;  2C60 A;  1GOZ A;  2W55 A;  2BB5 A;  3ZNZ B;  4OHJ A;  2WX0 A;  2KJ6 A;  3GE3 C;  1RM6 C;  1R4N B;  2M0X A;  2KAJ A;  3AE5 B;  3B08 A;  4DHZ B;  2LAS A;  3AUL A;  2I2Y A;  2CKH B;  4BVU C;  5C2T B;  1V49 A;  3ZDM C;  4KZ0 A;  4BAX A;  1HZ5 A;  3AE1 B;  1IGD A;  3APF A;  3EGR A;  3ABV B;  2L3Z A;  4G50 A;  3DBH I;  2DZK A;  5IKC M;  2DLB A;  1I35 A;  2BS4 B;  5E6J A;  2UU7 A;  2JT4 B;  4GN1 A;  3QC8 B;  4MM3 A;  5HI1 A;  1V97 A;  3RNF C;  2Z0D B;  4M0W A;  2LVP A;  3JSV B;  3P4R B;  3VUY A;  1A5R A;  2K8C A;  2XBB C;  2RPQ A;  1WE7 A;  2FCN A;  4CYE A;  1MJD A;  1V80 A;  4RGO S;  3KVF B;  2N7E A;  3I57 A;  4WWP A;  2LVO A;  1VLB A;  2QC8 A;  2R61 A;  3RNA C;  3TEY A;  1GC6 A;  5JHA A;  2RSU A;  2FAZ A;  1EM7 A;  1EU4 A;  2J0K A;  3AE3 B;  3N32 A;  1PGA A;  1D6E C;  1YQB A;  3V6C B;  2EKE C;  2J0J A;  3VRA B;  1WGK A;  2IY1 B;  4AOF A;  4BOZ B;  1KLV A;  1F9J A;  2JUO A;  2MBQ A;  3OWE B;  1DYQ A;  3NJT A;  4MAC A;  5CHV C;  4EZJ A;  4RH6 A;  1WY8 A;  3RD2 A;  3RMK C;  4HCN B;  2LHE A;  3K9P B;  2WS3 B;  2V1Y A;  2WDV B;  2MBH A;  4A55 A;  2ZVN A;  2OJR A;  4MGY E;  1XD3 B;  2I1K A;  5D3D A;  3VR8 B;  2AQ3 B;  3H7P B;  1FNV A;  1XQQ A;  4NJ6 A;  2W3R A;  5J18 A;  1EU3 A;  2KMM A;  3PRE A;  5BO4 B;  4YTN B;  2IYD B;  3PTF C;  2WXF A;  1WXV A;  2FE8 A;  5G55 A;  2CJN A;  3MC9 A;  1V86 A;  3PLU A;  2KWD A;  5D94 A;  1ACC A;  3ZUN A;  3HVZ A;  4FJV B;  3AN1 A;  2NR2 A;  3PSE B;  1E8Z A;  3ONS A;  1QT9 A;  4MGK E;  1BT0 A;  2FCS A;  2V4I B;  2GBJ A;  2E6X A;  3ZDT A;  3L13 A;  3SHQ A;  2LGI A;  1UWM A;  3AE6 B;  1V6E A;  3AE2 B;  4HLE A;  1VDV A;  3B2F A;  2QCZ A;  1ET6 A;  2R2Q A;  1HTQ A;  1YX6 B;  1K8R B;  4XC2 A;  2O2V B;  4M01 A;  1WZ3 A;  4KGS A;  1JRO A;  4ZYN A;  4XYC A;  2DEN B;  2BGF A;  2V3S A;  5MPO A;  5IOI A;  3NZS A;  5DPR A;  2WXP A;  1J8C A;  4NJC A;  4DHZ E;  3WCQ A;  3VVW B;  3DBR I;  4K7S A;  4DDI D;  4DXF A;  3PRP B;  3U52 E;  4HCP B;  4TSS A;  1IGC A;  3ZJU A;  3DQV A;  2RGF A;  3T3O A;  2Y5B B;  3Q8C A;  4IM3 A;  2PE9 A;  4EEW A;  1SSN A;  1V5T A;  2KQ4 X;  2G9H D;  1WYG A;  4RNA A;  4EE2 A;  1QOF A;  5G5G A;  2WP9 B;  3DBR B;  4JWS C;  1E90 A;  2DAJ A;  1QLB B;  2LZ6 A;  1C4P A;  3C8Y A;  5D2M B;  4HKZ E;  4P16 A;  2CU1 A;  3VTV A;  2MA9 B;  4C56 C;  4YSX B;  1KF6 B;  3PVL A;  1N6Z A;  3AV8 A;  2Z59 B;  2KZR A;  1AN8 A;  2DHZ A;  5J2R A;  3K9O B;  3W5U B;  1V5O A;  5DPS A;  3H8H A;  2ON8 A;  3IHP C;  1WR6 E;  1Q5W B;  3AU4 A;  1TKG A;  4KIK B;  3DVN V;  1N5W A;  3BWU D;  2NVU I;  4PS7 A;  4A90 A;  3IAM 1;  2JPH A;  4WQM A;  4S0R A;  1QOB A;  1WJ4 A;  1MFW A;  4AS1 A;  2H88 B;  4HRS A;  1LO5 D;  1BML C;  2KFK B;  2MEK A;  3I63 C;  4ARC A;  4ASW C;  3L10 B;  1QOG A;  1WE6 A;  2JWZ A;  5BYQ A;  4F8C B;  4D2K A;  3JYU A;  4K7W A;  4AQ7 A;  1FMA D;  3AE9 B;  3ZW3 A;  2GRI A;  3Q3M C;  2W9N A;  2K8H A;  4HDQ A;  3DCG A;  1UNS A;  3EUB 2;  2KMA A;  2L8J A;  3ZTC A;  4DWF A;  1V81 A;  4MJS B;  1L6V A;  1ET9 A;  1ROE A;  1OEY A;  3A9K B;  1J19 A;  4WAA A;  1HXY D;  4FHJ A;  4ZRJ A;  4FJY A;  2JYT A;  4RGT A;  5EE1 A;  4HRO A;  1C1Y B;  1TIF A;  3VFK A;  2KDF B;  2MSE D;  1UD7 A;  3EC8 A;  4ZYS A;  2J53 A;  1KRH A;  3WAN A;  2MWS B;  2CJO A;  3DHH C;  1IPG A;  3KH0 A;  3DBS A;  4WJN A;  2C7N B;  4GDK B;  1YJ1 A;  2MH7 A;  1WGY A;  2AL3 A;  5E6N A;  2WDT B;  1I4H A;  1PFD A;  3TSS A;  2JX5 A;  2AL6 A;  1PUT A;  4MEM A;  1WRI A;  4NJ7 A;  3ALB A;  2JXX A;  2KVZ A;  4KIK A;  1JRP A;  3BZD B;  1JML A;  3BYY B;  2KC1 A;  1RFK A;  5C23 A;  2KLC A;  4LLG M;  4W9C A;  4LNI A;  4MH8 A;  1RRB A;  1Y56 A;  3N9Y C;  2B3A A;  4BKS A;  2SAK A;  4OVV A;  2KFK A;  3PHX B;  1D3Z A;  3MHZ A;  2D3B A;  3W5V B;  1SEB D;  1TTN A;  2WXM A;  1VJK A;  2IO3 B;  1E8Y A;  2QIE B;  3BII D;  4LNF A;  2WX1 A;  2MQJ A;  5L83 A;  1P7E A;  1GJZ A;  1T0R C;  3IBE A;  4HKQ A;  4GXB A;  2PVG C;  1E6E B;  3RPF C;  3RCZ A;  4REZ A;  1WIA A;  2CHW A;  1KLU D;  4HPP A;  2WXQ A;  4DXG A;  3DHG C;  1XLN A;  2OJW A;  2EKI A;  1AYF A;  4K81 A;  1B1Z A;  4A3P A;  1UH6 A;  1D5M C;  2N9X A;  1P0R A;  4KKI A;  1OFF A;  5I4D A;  3L16 A;  4IWP A;  3UIO B;  1N61 A;  2HTM E;  3ZGZ A;  3M3J A;  4HK2 A;  4HEA 1;  2KWU B;  1MI0 A;  2LI5 A;  2K9X A;  2REX A;  4WWO A;  3CSF A;  3R66 C;  1SIF A;  4XDD A;  5AZF A;  4F1S A;  3OJ4 B;  3URY A;  5JH5 C;  4LDT D;  5AUI A;  2WDQ B;  1GAQ B;  3L54 A;  3PPA A;  2VZK B;  1RAX A;  3RNE C;  3P4S B;  2M8S A;  1SJH D;  2INN E;  1EWC A;  3U30 A;  2BBC A;  3SEB A;  3AEC B;  1WGH A;  1C76 A;  3QWZ B;  1K53 A;  4W9G A;  4ARI A;  3OAW A;  4C00 A;  1L4D B;  5DPW A;  2BYT A;  2BS3 B;  2N1W A;  3QQ8 B;  1GB1 A;  4US8 A;  3ZQ4 A;  1EUV B;  2H89 B;  3ZXV A;  1TYG B;  2L0T A;  4RGN A;  1Z2M A;  2AYO B;  2KO3 A;  3E56 A;  2LWP A;  2V3P A;  3NZ3 A;  3T3N A;  4CO7 A;  1IBX A;  2FID A;  2Y3A A;  2J0M A;  3SD5 A;  4LNN A;  1VZ7 A;  4HJG E;  4P7I A;  2KN4 A;  3P63 A;  1JCK B;  2KX3 A;  1C9F A;  2KNB A;  1K51 A;  2L00 B;  5L95 C;  2C9W B;  2EMT A;  4TKN A;  1OQY A;  2KLG A;  4NAM A;  1YNT E;  2IPK D;  4NZL B;  3S2A A;  3RZW C;  3AEG B;  1X1M A;  1WH3 A;  3N1X C;  1J7B A;  1UGJ A;  3U2S C;  5H8Y E;  2A5U A;  2J52 A;  3OJ3 A;  2ZEQ A;  2EEL A;  1YN5 A;  2J7Q B;  3TMP B;  3QX1 A;  3WAP A;  1GPX A;  3TEW A;  4FN2 A;  1EF1 A;  4A20 A;  1FFU A;  1N63 A;  1T0Y A;  2KC2 A;  1PDX A;  2I38 A;  2V3N A;  3MC8 A;  3VAW A;  2CS4 A;  1YQ4 B;  3N20 C;  2O6V D;  3VDZ A;  3BIN A;  4E74 A;  3PRM B;  5IA7 A;  2RPV A;  1FEH A;  2K22 A;  3GS2 A;  1AWD A;  2KAC A;  1HZ6 A;  2KQS A;  2JRI B;  1AW7 A;  3VH3 B;  1TBE A;  3B2G A;  3HRD D;  1PGB A;  3TIX A;  2KFJ A;  1JQ4 A;  2QIL A;  1VD2 A;  2K6D B;  4RGM A;  2NPT A;  4OZC A;  4JPS A;  1JW9 D;  1Q10 A;  4N59 A;  4H2A A;  2WU2 B;  1I7H A;  1N60 A;  2UWQ A;  1HQR D;  1XCT L;  3NS1 A;  1UBI A;  1WX7 A;  1ZPS A;  4GLS C;  1SF0 A;  1LFD A;  1DOI A;  4YSY B;  4XZ4 A;  1S3S G;  4N9F 4;  1Q1O A;  1EF5 A;  2GI9 A;  3QCA A;  2WXI A;  2LGD A;  2LUE A;  4EOY A;  3P4P B;  4XWT A;  1K52 A;  2A4Z A;  3PHW B;  3DBH B;  3LYY A;  3FAH A;  3KUD B;  3UF8 A;  4NAW B;  1WMH B;  2IZV B;  3RNB C;  3BK2 A;  1L2N A;  3RI7 C;  2CU3 A;  2R2O A;  4JE3 B;  2XNA C;  2IDY A;  1WJU A;  4G0N B;  2G3Q B;  2K25 A;  2KWC A;  2Y5P A;  3SFD B;  3RUI B;  1IP9 A;  4US9 A;  4A8X C;  4DHJ B;  5IP4 D;  3AXC A;  5D6J B;  2ZJD A;  1VRA B;  3EEC A;  3I5J C;  1C4A A;  5BMG A;  4EZL A;  3CST A;  3AB5 A;  1UEL A;  3A33 B;  1VR9 A;  3O65 B;  1TS2 A;  4GGQ A;  1JWU D;  3ZNI D;  3N30 A;  3VRB B;  4AJW A;  3R2T A;  1S1Q B;  1JWM D;  3Q8F A;  3NY5 A;  4N58 A;  4C4V B;  2ONQ A;  3ZRF A;  1WXQ A;  2MP2 B;  2RR9 A;  3A4R A;  4BKT A;  5LXH A;  1TKY A;  1I4G A;  2JRH A;  1YD8 U;  1I4Q A;  3JSV A;  1Z5S B;  3AE7 B;  2HE7 A;  2KTF A;  2LD9 A;  3VTU A;  4GMV A;  1KJT A;  4NY0 A;  4CHK A;  3IVF A;  2UYZ B;  1CZP A;  4IKG A;  1ZXI A;  3ECI A;  1WWT A;  1TS5 A;  2IJ0 A;  2PIA A;  4J6I A;  1WGR A;  4PT5 A;  4M8N A;  1FRD A;  1M4V A;  2D5G A;  4YSZ B;  5J17 A;  1XCQ L;  3TCA A;  1LXD A;  3LB8 C;  4KSL C;  1L4Z B;  3Q8E A;  2KDE B;  3VUW A;  3PS6 A;  4GDL B;  3A4S C;  3P2B A;  2Z8L A;  3PZD A;  1JWA D;  2BKR B;  2HJ8 A;  3CIR B;  3H7P A;  3NHE B;  3AH7 A;  1SE4 A;  2KT7 A;  1XO3 A;  2L0F A;  5HHD G;  3SDL C;  3I9V 1;  1ZW7 A;  3I3T B;  1F0Z A;  1TZO A;  3ZJV A;  2KDI A;  1UGM A;  4C4V A;  2V4L A;  3H7S A;  4C80 A;  2SEB D;  2W3S A;  4OVZ A;  2MP2 A;  2LUM A;  3TEX A;  2X8X X;  4OZA A;  2MX2 A;  4BOS C;  4ZRI A;  1UWX A;  1V1O A;  3R8B A;  2RDB C;  3CMM B;  2N7J A;  4UDU C;  3WIM A;  1U4A A;  3NUH B;  3MJ5 A;  2HD5 B;  2KJR A;  3C0R B;  1WR1 A;  3Q2A C;  1E10 A;  2O2V A;  4W9L A;  5GXG B;  4OVU A;  4OZB A;  1HTO A;  4B0E A;  2IO1 B;  2LMC A;  4P1B C;  1YMH E;  1T0S C;  2KK8 A;  2CHX A;  2BYV E;  4FHK A;  2WNM A;  4IW0 A;  1WJ6 A;  1V8C A;  2MJD A;  4KX6 B;  2N9E B;  2KWV B;  3A9J B;  4W9H A;  2K3U A;  3DPD A;  2GMI C;  4WJP A;  5DPT A;  1H4R A;  1FPY A;  1JRU A;  3QHT A;  4GDL A;  4LTU A;  3Q14 C;  1Q0W B;  3HM6 X;  2N4F A;  2WHI A;  5EE3 A;  1XLQ A;  2K0P A;  2INC C;  4WIP A;  2BYF A;  1QQR A;  1P7F A;  4K3C A;  1RWS A;  4KVG B;  2RD0 A;  3RNG C;  4EZK A;  5EDS A;  3MFG A;  1ZGU B;  4BKG A;  1XXG A;  3FC4 A;  2KYW A;  2JYE A;  2DYM A;  2ZPY A;  2LRU A;  1QKZ A;  2BWF A;  2JY6 A;  3V3X A;  1XLP A;  1L7Y A;  2L7R A;  4II2 B;  1NEK B;  1HEZ E;  2LFI A;  3AE8 B;  2L1A A;  2O6V B;  2JXT A;  4AUQ C;  1WXA A;  2XK5 B;  2N9P C;  4K7U A;  1YQ3 B;  4WJQ A;  2NTS A;  3TJP A;  1YN4 A;  4LJP B;  1OQQ A;  4PYU A;  2NTT A;  3N1Y C;  1KM7 A;  2FCM A;  2LGY A;  4AP4 C;  3DOW A;  1E7P B;  4RF0 A;  4MEL A;  2V9H A;  4WWN A;  1KH0 A;  3Q3O C;  2WXO A;  1WX9 A;  3B9J A;  2NS5 A;  4IWO A;  3V62 A;  1TY2 A;  3M95 A;  3ZO5 B;  3NRZ A;  3QAQ A;  3RNC C;  2TSS A;  1TGZ B;  2VH2 A;  3D32 A;  4O1N A;  2VH1 A;  1TKE A;  1WF9 A;  5IN7 A;  3NZU A;  5IO9 A;  2DAF A;  4MJS A;  3NVY A;  1CJE A;  1FNW A;  3ML8 A;  1D4B A;  4ZRP A;  3A9K A;  3AU5 A;  3R3M A;  4YWG G;  2BVC A;  1NI3 A;  1L5P A;  5D3I B;  3VTW A;  2WWZ A;  1VZ6 A;  1E0Z A;  3R7R A;  2DBY A;  2GB1 A;  4XWW A;  1F77 A;  3NS8 A;  3LJ3 A;  1P3Q U;  2K39 A;  4OW0 A;  2QDF A;  4EUT A;  1OGW A;  5BYS A;  4GDK A;  5GMV A;  4ICU A;  4GIV A;  4KZC A;  3V05 A;  2G45 B;  3VXW A;  2PPH A;  2BYE A;  2KKC A;  2ZNV C;  5FKA C;  1MHH E;  3ZLZ A;  1QOA A;  1WXS A;  2WGS A;  3BVG A;  2D10 A;  3OG5 A;  3DHI C;  4KDI C;  1WSP A;  1YOV B;  4HPM B;  4B0M A;  4IC7 B;  1F52 A;  1F2R I;  1G6J A;  1SXT A;  2XN9 C;  3AEF B;  3B0A A;  4XX5 A;  2QEJ C;  4TUU A;  2NBU A;  1ENF A;  4P6V F;  5LNK 1;  1STE A;  3RT3 B;  2NBV B;  3RFZ B;  4RM8 A;  1HE8 A;  3KW5 B;  1I42 A;  5TSS A;  4MGI E;  3AMZ A;  1C77 A;  4W9I A;  3GE8 C;  4FBJ B;  3B1L X;  3KQ4 A;  2AQ1 B;  1E9M A;  1ESF A;  2YVC A;  2EMS A;  2D3G A;  1ISN A;  3DBL I;  2YEP F;  1JWB D;  2DX5 B;  4NQL B;  4DXA B;  2I1J A;  1L0X B;  3M62 B;  2FBW B;  3ZIM A;  5BMI A;  2FIF A;  1FD6 A;  5DCN A;  5CHF A;  3LDZ E;  4JGH B;  4EKU A;  1ZE3 D;  3A1Q B;  3HM3 A;  4YTP B;  2OHF A;  4W9K A;  3U7Z A;  4IM2 A;  3U7D A;  3RZF A;  2K1F A;  4J3O D;  1T6B X;  4L2Y A;  1VZ8 A;  2KHW B;  1R4M I;  1MHX A;  2FUH B;  2N7D A;  2JWU A;  4ITK A;  1WGG A;  3SR6 A;  1XEE A;  2JU6 X;  2MBE A;  3DBL B;  4BKS D;  1UF0 A;  4KKJ A;  2N0S B;  1ZP0 B;  3WAM A;  5IAA C;  4MM3 B;  2BQQ A;  1FCC C;  5CHW A;  2WQY B;  3H1U A;  5G2N A;  1YN3 A;  1QF6 A;  4G3X B;  2C7H A;  3N3K B;  3RYT A;  1WM3 A;  4PK1 A;  3NG0 A;  3NVZ A;  4LK0 M;  1F1H A;  3H9D A;  1R4M B;  3AEE B;  3ENE A;  5FR3 A;  2WLB A;  2DWQ A;  4MDK E;  2BS2 B;  3KWV A;  2HTH A;  1R4N I;  4MH0 E;  1TY0 A;  1OTR B;  4P1C C;  3VR9 B;  2KJH B;  4BBN F;  3Q6B A;  3ZTD A;  3U4E G;  1V9J A;  4M00 A;  1BUI C;  3ETR A;  2IGH A;  2NCN A;  4RFB A;  4EFO A;  1E7V A;  2CHZ A;  1TZ1 A;  2DZI A;  2LGS A;  2KQ7 A;  4AWJ A;  4FAD A;  2AQ2 B;  1PQS A;  3A1Q A;  3L17 A;  4HVB A;  5JZE B;  1SJE D;  2N9L A;  5LLI A;  1IYF A;  4HDO A;  1P1A A;  2C7M B;  2M1M A;  4PS8 A;  2MW5 A;  3OLM D;  3TEZ A;  4IDI A;  5JHB A;  4W9E A;  3VUX A;  4ZRK A;  2CR5 A;  2D07 B;  2FCQ A;  3GP7 A;  3L0W B;  4KDL B;  4LNK A;  4YTM B;  2PE6 B;  4KSK C;  2PLP A;  4MGZ E;  3X0W A;  3HVD A;  4ZRQ A;  5EE0 A;  1N5X A;  3SFE B;  3IAS 1;  2N1V A;  3W1S C;  2QSD A;  2RDH A;  2DYO A;  1UBQ A;  2D3C A;  1SBB B;  2MJ3 A;  3GZN I;  4FXC A;  1F2R C;  4TV3 A;  4M8M A;  2PJH A;  3QJZ A;  3MHS D;  2QJL A;  4FLH A;  4II3 B;  1CQV A;  3UI3 A;  2L05 A;  1WJN A;  2GLS A;  4C7Y A;  2DYB A;  5BMH A;  1JAL A;  5BYR A;  3BVM A;  3WAL A;  4IOI E;  2HDE A;  3C19 A;  4IWQ A;  2BB6 A;  4FA6 A;  2GBK A;  4K3B A;  3ZYY X;  3KYC D;  2G4S A;  4IUM B;  1E8X A;  2LJI A;  2ZPN A;  4B95 A;  3UQA A;  3GZN B;  2M0A A;  3T9L A;  2YEP B;  1NEN B;  1ZKH A;  4USA A;  2KD0 A;  2AWT A;  3FIL B;  4W9D A;  2WYQ A;  2OED A;  4L1B A;  4ANV A;  2MHJ A;  4RF1 A;  3V6E B;  4WAF A;  1V1P B;  2NMQ A;  3DWG C;  4GSW A;  3HIZ A;  1I4P A;  1XT9 B;  3ZVV A;  2BKF A;  1FCL A;  1UUP A;  2QMT A;  2IND C;  4LCD E;  1D5Z C;  1IUE A;  1GC7 A;  2VZK D;  1ZOY B;  1FRR A;  4I6P A;  3AEB B;  1KFY B;  2M4N A;  2VRR B;  5AUK A;  3AED B;  4TQ1 A;  1YIW A;  4X57 B;  5AEK B;  1RLF A;  2JZZ A;  3KYD D;  3Q69 A;  5HG2 A;  1FXI A;  3EA6 A;  2OOB B;  1SE9 A;  4Q2J A;  2L52 A;  1R7S A;  4HPL B;  2MJE A;  2Y5C A;  4GU2 A;  2D3A A;  4NAW A;  3ZXR A;  1WMH A;  1NDD A;  3PV1 A;  2K5P A;  3PLV A;  2AEH A;  1NI2 A;  4JWU C;  1FNU A;  4TQ0 A;  2KAN A;  2GBN A;  2JSV X;  1ZXH A;  1HA5 A;  2M19 A;  2C5L C;  3Q8B A;  3APD A;  1WFY A;  3TUO A;  1FFV A;  1CK1 A;  2IGG A;  5EE9 A;  4NPN A;  4JLC A;  3W1Y A;  5E6P A;  1MG4 A;  2KXJ A;  3X23 A;  3BY4 B;  3VQI A;  2KN5 A;  1E7U A;  1LM8 B;  1YJI A;  2INP E;  3UGB B;  1GB4 A;  1JWS D;  3FIL A;  2Z0E B;  3QK0 A;  4BFR A;  4WUR A;  2KDM A;  1MVK A;  2BF8 B;  1J0G A;  1WGD A;  4B6W A;  3BYT B;  1L6U A;  4L23 A;  2MCN B;  2ACZ B;  2PVO D;  1V1P A;  2KOX A;  2DNF A;  4LDT B;  5LXI B;  3UQB A;  1N62 A;  1FM0 D;  1UZX B;  3JVZ X;  2AX5 A;  1T5X D;  5C1Z A;  2N9K A;  3MTN B;  1K50 A;  1GG3 A;  3ML9 A;  1KLG D;  3W2D A;  2KMC A;  3IT4 B;  4JL9 A;  1M94 A;  4W9J A;  4A3O A;  5FR6 A;  5JXV A;  3IFW B;  2KVR A;  4HWI B;  3GOE A;  1I4R A;  4E3C A;  1H8C A;  4DK5 A;  5KHQ A;  3AM9 A;  3EFU A;  2WXK A;  3VHT C;  3UIP B;  1LQB A;  2ZVO A;  4DDG D;  2WXJ A;  1D5X C;  1V2Y A;  4N6E B;  5G5H A;  3PT2 B;  2RDG A;  3MC0 B;  2WXG A;  1AAR A;  2NBW B;  4RMA A;  3NVV A;  3V60 A;  3PGE A;  2MBB B;  1DGJ A;  3GB1 A;  4QAY A;  1LGR A;  3L4P A;  2KDB A;  2BWE S;  2LGX A;  3WAO A;  2W82 A;  2ZNV B;  3AEA B;  5FK9 C;  3Q3F A;  3RN9 C;  3MJW A;  3VH4 B;  1YJJ A;  2LEK A;  2J42 A;  1VCB A;  1DOX A;  4WJO A;  3DVN U;  1SGH A;  2PKO A;  4XE0 A;  3BK1 A;  1FO4 A;  1BXT A;  1NVI D;  4I6N B;  4KGT A;  4JIO U;  2D2Q A;  2WU5 B;  3W9C B;  1WZ0 A;  2WXH A;  1RFA A;  2IGD A;  3IXS A;  3CF6 E;  1KOT A;  1CMX B;  2JF5 A;  2ZW0 A;  3M63 B;  1QZE A;  4DBG A;  3JW0 X;  4ANU A;  4FJZ A;  1YX5 B;  2ZW1 A;  4ANW A;  4BBN C;  3HK0 A;  2PW9 A;  4MSQ B;  4AJY B;  3ZKJ C;  2MLB A;  3ZNH B;  4JQW C;  4ICV A;  3TBL D;  4WH4 A;  3P42 A;  3EHV A;  2G1E A;  1WXM A;  2LHD A;  4GB9 A;  1TS3 A;  2GOW A;  1TT5 B;  1SB3 C;  2LRW A;  2YLM A;  3MP9 A;  2KTR B;  4W9F A;  4DHJ D;  2PMV A;  1GUA B;  1T3Q A;  3AI5 A;  4RM9 A;  1XLO A;  1J7A A;  4XGA B;  3PRZ A;  2QHO A;  1I4X A;  2GBM A;  4NQK E;  2LVQ A;  1MG8 A;  2D11 A;  4WWM A;  3R7Q A;  5T8I A;  1WX8 A;  3SU8 X;  1FIQ A;  3A9J A;  3TL5 A;  4MSM B;  3Q8A A;  1WI0 A;  3HUI A;  3U8Z A;  1NYQ A;  3EFC A;  2ZCC A;  4F7Z A;  1DOY A;  2WXN A;  1QIL A;  2WXL A;  1B9R A;  1SE2 A;  4DQO C;  1A70 A;  2M17 A;  4FUL A;  3R2I A;  4B9K A;  3QAR A;  4MT5 A;  1PYW D;  2JQR B;  2FUG 1;  5AZG A;  2BT6 A;  1WM2 A;  3QIJ A;  1OQR A;  2JVC A;  3UIN B;  1NBF C;  3NVW A;  1E8W A;  2BW2 A;  3ZRC A;  3P4Q B;  4HJK A;  2PTL A;  4KGR A;  1EO6 A;  3PZ7 A;  1FXT B;  5KHO A;  1E5W A;  5HKH A;  3AE4 B;  3RUL A;  2WXR A;  2BPS A;  3BVZ A;  4BZA A;  4G11 A;  3WA0 A;  4E71 A;  2E3T A;  1L0V B;  1IBX B;  3T8M A;  2Q5W D;  3Q3N C;  2K6Q A;  3CWI A;  4ANX A;  2O6V A;  4IG7 B;  2IO0 B;  3J9C A;  3LXF A;  3N1Z C;  4A6Q A;  3KWL A;  4PS3 A; 
#chains in the Genus database with same CATH homology
 2LD9 A;  2XK5 A;  3VTU A;  4GMV A;  1KJT A;  4NY0 A;  2W9N A;  2K8H A;  4HDQ A;  3DCG A;  2KTR A;  2NCN A;  4CHK A;  4EFO A;  3IVF A;  1E7V A;  2CHZ A;  2UYZ B;  1TZ1 A;  2DZM A;  2KMA A;  2DZI A;  3HHM A;  2L8J A;  3ZTC A;  1WYW B;  2KQ7 A;  4AWJ A;  4DWF A;  4FAD A;  1V81 A;  4MJS B;  1PQS A;  3ECI A;  3A1Q A;  3L17 A;  1OEY A;  3V61 A;  4HVB A;  5JZE B;  3A9K B;  1J19 A;  4J6I A;  4WAA A;  4FHJ A;  4I6L B;  4ZRJ A;  2L76 A;  5LLI A;  1IYF A;  4HDO A;  4FJY A;  1P1A A;  1WGR A;  2C7M B;  4KV2 A;  4M8N A;  2M1M A;  4PS8 A;  2MRP A;  2MW5 A;  3KUZ A;  3OLM D;  1C3T A;  2ZCB A;  5JHB A;  2JZ3 B;  4W9E A;  3VUX A;  1C1Y B;  4WQO B;  4HXD A;  2G4D B;  4ZRK A;  3VFK A;  2KDF B;  2MSE D;  2PEA A;  1UD7 A;  3EC8 A;  3H6N A;  5J17 A;  2CR5 A;  2D07 B;  2FCQ A;  2ZZP B;  3L0W B;  4KDL B;  4YL8 A;  2PE6 B;  4KSK C;  3WAN A;  2MWS B;  1LXD A;  5CX3 A;  3TCA A;  4KSL C;  1IPG A;  4MGZ E;  3X0W A;  3KH0 A;  2GBR A;  3DBS A;  4WJN A;  2KDE B;  3VUW A;  2C7N B;  4GDK B;  1YJ1 A;  4GOC A;  3PS6 A;  1WGY A;  2AL3 A;  5E6N A;  2WDT B;  4GDL B;  3A4S C;  2N1V A;  3P2B A;  2IY0 B;  3APC A;  5AZH A;  3W1S C;  4K1R B;  1WRD B;  2DYO A;  3PZD A;  1UBQ A;  3IG3 A;  2AL6 A;  2BKR B;  2HJ8 A;  3H7P A;  5E6O A;  3NHE B;  3GZN I;  4MEM A;  4TV3 A;  4M8M A;  4NJ7 A;  3ALB A;  2L0F A;  2JXX A;  2PJH A;  3SDL C;  3QJZ A;  4KIK A;  3MHS D;  4URK A;  4FLH A;  3Q3J A;  4II3 B;  1ZW7 A;  2L05 A;  1WJN A;  2KC1 A;  3I3T B;  5C23 A;  2DYB A;  2KLC A;  4W9C A;  2KDI A;  1UGM A;  2XEW A;  1OEY J;  3WAL A;  2V4L A;  5CTR C;  3H7S A;  4LJO B;  1RRB A;  2B3A A;  4IWQ A;  2KX0 A;  4BKS A;  2MP2 A;  4FA6 A;  2NPT B;  4OVV A;  2KFK A;  2GBK A;  3PHX B;  1D3Z A;  1TTN A;  3KYC D;  2G4S A;  2MX2 A;  4IUM B;  1E8X A;  2ZPN A;  4B95 A;  4BOS C;  3UQA A;  4ZRI A;  2IO3 B;  4M0W B;  3T9L A;  1E8Y A;  1ZKH A;  4ZDV A;  3CMM B;  4PYZ A;  2KD0 A;  5D7G A;  2AWT A;  3WIM A;  1U4A A;  1P9D U;  3QA8 A;  4W9D A;  2WYQ A;  2ASQ A;  2HD5 B;  2KJR A;  3C0R B;  2WX1 A;  1WR1 A;  2MQJ A;  2LXA A;  5L83 A;  4ANV A;  3DDC B;  2O2V A;  1GJZ A;  4W9L A;  3IBE A;  3DVG Y;  4OVU A;  2K8B A;  4GXB A;  3V6E B;  2FNJ B;  3NOB A;  4GSW A;  3ZNG C;  2IO1 B;  3HIZ A;  3RCZ A;  2IO2 B;  1WIA A;  2CHW A;  3L08 A;  1XT9 B;  5TR5 A;  3ZVV A;  2BKF A;  2KK8 A;  1P98 A;  2CHX A;  2BYV E;  4FHK A;  2LJ5 A;  4IW0 A;  4K81 A;  1WJ6 A;  1Y8R C;  4LCD E;  1GC7 A;  4NNJ B;  4IM0 A;  1UH6 A;  3KUC B;  4A3P A;  4I6P A;  2DZJ A;  2N9E B;  3DVG X;  2KWV B;  1P0R A;  2MBO A;  2N9X A;  2IBI B;  2M4N A;  3W1S A;  2VRR B;  3A9J B;  4W9H A;  2LXC A;  1GNU A;  4TQ1 A;  2C60 A;  3DPD A;  3L16 A;  4IWP A;  1YIW A;  3UIO B;  2GMI C;  4WJP A;  5DPT A;  4X57 B;  1H4R A;  1JRU A;  1RLF A;  2JZZ A;  3KYD D;  3QHT A;  3M3J A;  4GDL A;  4HK2 A;  3ZNZ B;  5AEK B;  2WX0 A;  1Q0W B;  2KJ6 A;  3HM6 X;  2OOB B;  1SE9 A;  2KWU B;  2N4F A;  2LI5 A;  2BYF A;  2M0X A;  2REX A;  3B08 A;  4WWO A;  3CSF A;  3R66 C;  4HPL B;  4DHZ B;  2LAS A;  1SIF A;  3AUL A;  4GU2 A;  2CKH B;  5AZF A;  4BVU C;  4F1S A;  4KVG B;  4NAW A;  3OJ4 B;  2RD0 A;  1WMH A;  1NDD A;  1V49 A;  3PV1 A;  5JH5 C;  4EZK A;  5EDS A;  3PLV A;  2AEH A;  4LDT D;  1ZGU B;  3ZDM C;  4KZ0 A;  1NI2 A;  4BKG A;  4TQ0 A;  2KAN A;  2GBN A;  3L54 A;  2DYM A;  2ZPY A;  3PPA A;  2C5L C;  1RAX A;  3APF A;  2LRU A;  2L3Z A;  3APD A;  1WFY A;  4G50 A;  2M8S A;  3DBH I;  2BWF A;  2DZK A;  2JY6 A;  1I35 A;  4NPN A;  2JT4 B;  1L7Y A;  3QC8 B;  4GN1 A;  4JLC A;  4MM3 A;  3W1Y A;  5E6P A;  3U30 A;  2KXJ A;  2Z0D B;  3X23 A;  3BY4 B;  2L7R A;  3VQI A;  1WGH A;  3QWZ B;  2KN5 A;  1E7U A;  4II2 B;  1LM8 B;  4W9G A;  3UGB B;  2LVP A;  3JSV B;  3OAW A;  3VUY A;  1A5R A;  2O6V B;  5DPW A;  2Z0E B;  3QK0 A;  4BFR A;  2N1W A;  2K8C A;  2BF8 B;  2XBB C;  1WGD A;  1J0G A;  2RPQ A;  1WE7 A;  2FCN A;  4AUQ C;  4B6W A;  4CYE A;  1WXA A;  2XK5 B;  3QQ8 B;  1V80 A;  2N9P C;  3KVF B;  2N7E A;  4K7U A;  4WJQ A;  4WWP A;  3TJP A;  2MCN B;  4LJP B;  2LVO A;  4PYU A;  1EUV B;  1KM7 A;  2KOX A;  2FCM A;  2LGY A;  4AP4 C;  1GC6 A;  3DOW A;  5JHA A;  4LDT B;  5LXI B;  2RSU A;  2FAZ A;  2L0T A;  4MEL A;  3UQB A;  1UZX B;  1Z2M A;  3JVZ X;  2J0K A;  2AYO B;  2KO3 A;  4WWN A;  5C1Z A;  2LWP A;  3MTN B;  1GG3 A;  3N32 A;  3ML9 A;  4CO7 A;  2KMC A;  4JL9 A;  1WX9 A;  2FID A;  1M94 A;  1YQB A;  2J0M A;  4W9J A;  3SD5 A;  2NS5 A;  4IWO A;  5FR6 A;  3V6C B;  4A3O A;  3IFW B;  2KVR A;  2EKE C;  2J0J A;  4HWI B;  3V62 A;  4AOF A;  2IY1 B;  3GOE A;  3M95 A;  4P7I A;  3ZO5 B;  4BOZ B;  3QAQ A;  1F9J A;  1KLV A;  2JUO A;  4E3C A;  2MBQ A;  2KX3 A;  1H8C A;  4DK5 A;  1TGZ B;  2KNB A;  2L00 B;  5KHQ A;  5L95 C;  2C9W B;  3D32 A;  2EMT A;  3EFU A;  4TKN A;  5CHV C;  3VHT C;  4EZJ A;  1WF9 A;  1WY8 A;  3NZU A;  3RD2 A;  4HCN B;  3UIP B;  3K9P B;  1OQY A;  2KLG A;  1LQB A;  2DAF A;  2ZVO A;  4MJS A;  2V1Y A;  4DDG D;  3S2A A;  2MBH A;  3RZW C;  1V2Y A;  3ML8 A;  3A9K A;  2ZVN A;  1X1M A;  1WH3 A;  2OJR A;  3AU5 A;  3R3M A;  4MGY E;  1XD3 B;  2I1K A;  3VTW A;  2WWZ A;  3PT2 B;  2A5U A;  3H7P B;  3OJ3 A;  2ZEQ A;  1XQQ A;  4NJ6 A;  5J18 A;  1AAR A;  2J7Q B;  3R7R A;  3TMP B;  2NBW B;  3PRE A;  5BO4 B;  2IYD B;  3PTF C;  4RMA A;  3V60 A;  3NS8 A;  3PGE A;  3LJ3 A;  2MBB B;  3QX1 A;  3WAP A;  1WXV A;  1P3Q U;  5G55 A;  4FN2 A;  2K39 A;  1V86 A;  1EF1 A;  3PLU A;  2KDB A;  2BWE S;  4A20 A;  2LGX A;  4EUT A;  3WAO A;  1OGW A;  2ZNV B;  5D94 A;  1T0Y A;  2KC2 A;  4GDK A;  3ZUN A;  5GMV A;  3Q3F A;  3VH4 B;  3MJW A;  4FJV B;  4ICU A;  2NR2 A;  2CS4 A;  1VCB A;  3PSE B;  4WJO A;  3VAW A;  1E8Z A;  4GIV A;  4KZC A;  3ONS A;  3DVN U;  2G45 B;  1SGH A;  3VXW A;  2PPH A;  4MGK E;  2BYE A;  2O6V D;  1BT0 A;  2FCS A;  2GBJ A;  3VDZ A;  3BIN A;  2KKC A;  2ZNV C;  3ZDT A;  4E74 A;  3PRM B;  4I6N B;  3L13 A;  5IA7 A;  3SHQ A;  3ZLZ A;  1WXS A;  4JIO U;  2D2Q A;  1V6E A;  2D10 A;  4HLE A;  1WZ0 A;  1RFA A;  4KDI C;  2R2Q A;  4HPM B;  2KQS A;  1YX6 B;  4IC7 B;  1K8R B;  2JRI B;  4XC2 A;  3CF6 E;  1G6J A;  2O2V B;  3VH3 B;  1TBE A;  1KOT A;  1WZ3 A;  3B0A A;  4XX5 A;  1CMX B;  2JF5 A;  3TIX A;  2KFJ A;  1VD2 A;  2K6D B;  4ZYN A;  3M63 B;  1QZE A;  4TUU A;  4DBG A;  2NBU A;  2NPT A;  2DEN B;  3JW0 X;  2BGF A;  2V3S A;  3RT3 B;  2NBV B;  4RM8 A;  4ANU A;  1HE8 A;  4FJZ A;  3KW5 B;  1YX5 B;  3NZS A;  2UWQ A;  4MGI E;  5DPR A;  1I42 A;  1J8C A;  4W9I A;  4ANW A;  4FBJ B;  4BBN C;  3B1L X;  3HK0 A;  4MSQ B;  1UBI A;  1WX7 A;  4AJY B;  3ZKJ C;  2MLB A;  4DHZ E;  3ZNH B;  4JQW C;  4ICV A;  3TBL D;  3VVW B;  2YVC A;  1LFD A;  2EMS A;  3EHV A;  2D3G A;  3DBR I;  4XZ4 A;  1ISN A;  1S3S G;  1WXM A;  3DBL I;  4GB9 A;  4N9F 4;  1Q1O A;  4K7S A;  1EF5 A;  2GOW A;  3QCA A;  2DX5 B;  4NQL B;  4DXA B;  2I1J A;  2LRW A;  2YLM A;  4DDI D;  2LGD A;  2KTR B;  4W9F A;  4DHJ D;  3M62 B;  3ZIM A;  3PRP B;  1GUA B;  2FIF A;  2LUE A;  3AI5 A;  4HCP B;  4RM9 A;  4EOY A;  5DCN A;  3DQV A;  5CHF A;  3LDZ E;  2RGF A;  2A4Z A;  3PHW B;  3PRZ A;  4JGH B;  4EKU A;  2Y5B B;  2QHO A;  3A1Q B;  4IM3 A;  3HM3 A;  2PE9 A;  4NQK E;  2GBM A;  4EEW A;  2LVQ A;  1MG8 A;  2D11 A;  3KUD B;  4W9K A;  4IM2 A;  3U7D A;  1V5T A;  3R7Q A;  3RZF A;  2K1F A;  1WX8 A;  3UF8 A;  4NAW B;  2KHW B;  1WMH B;  1R4M I;  2IZV B;  3SU8 X;  2FUH B;  2N7D A;  1L2N A;  1WGG A;  3A9J A;  3TL5 A;  4MSM B;  1WI0 A;  1E90 A;  3U8Z A;  2MBE A;  2DAJ A;  4BKS D;  2ZCC A;  2R2O A;  2LZ6 A;  5D2M B;  4F7Z A;  1WJU A;  2CU1 A;  3VTV A;  4G0N B;  2G3Q B;  2K25 A;  2KWC A;  2MA9 B;  3RUI B;  1IP9 A;  2M17 A;  4FUL A;  3WAM A;  5IAA C;  4B9K A;  3PVL A;  5CHW A;  3QAR A;  2Z59 B;  3H1U A;  4DHJ B;  2KZR A;  5G2N A;  3AXC A;  5AZG A;  2DHZ A;  5J2R A;  3K9O B;  5D6J B;  1WM2 A;  2ZJD A;  3QIJ A;  4G3X B;  3EEC A;  1V5O A;  2C7H A;  3N3K B;  5DPS A;  2JVC A;  3IHP C;  1WM3 A;  1WR6 E;  3RYT A;  1NBF C;  3UIN B;  4EZL A;  1Q5W B;  3AU4 A;  1E8W A;  3ZRC A;  3CST A;  3H9D A;  3ENE A;  1UEL A;  3A33 B;  4HJK A;  4KIK B;  3O65 B;  1EO6 A;  3DVN V;  4GGQ A;  1FXT B;  5KHO A;  1E5W A;  4MDK E;  5HKH A;  2NVU I;  2HTH A;  3ZNI D;  3N30 A;  1R4N I;  4PS7 A;  3RUL A;  4AJW A;  4MH0 E;  1S1Q B;  2BPS A;  3NY5 A;  2JPH A;  4G11 A;  1OTR B;  1WJ4 A;  3WA0 A;  4E71 A;  3ZRF A;  2KJH B;  2MP2 B;  2RR9 A;  3A4R A;  4BBN F;  4BKT A;  5LXH A;  2KFK B;  3ZTD A;  2JRH A;  1YD8 U;  3T8M A;  4ASW C;  3JSV A;  2K6Q A;  1V9J A;  3L10 B;  1WE6 A;  2JWZ A;  4ANX A;  1Z5S B;  2O6V A;  2IO0 B;  3JYU A;  4IG7 B;  4K7W A;  4F8C B;  2KTF A;  2HE7 A;  3ZW3 A;  4PS3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...