3B08A

Crystal structure of the mouse hoil1-l-nzf in complex with linear di-ubiquitin
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
151
structure length
151
Chain Sequence
MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Polyubiquitin-C
publication title Specific recognition of linear ubiquitin chains by the Npl4 zinc finger (NZF) domain of the HOIL-1L subunit of the linear ubiquitin chain assembly complex
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein/metal binding protein
total genus 41
structure length 151
sequence length 151
chains with identical sequence D, G, J
ec nomenclature
pdb deposition date 2011-06-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00240 ubiquitin Ubiquitin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 3b08A01
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 3b08A02
5J17A 1WXVA 2PPHA 4NQLB 4ZRKA 4MELA 1Q5WB 1U4AA 4MH0E 1GUAB 1YD8U 3V62A 4J6IA 3ZUNA 1RAXA 2C7MB 5DPTA 2EMSA 3DCGA 2LZ6A 2DYBA 4NNJB 3PHXB 1OQYA 3SU8X 2K6QA 2KTRA 2GBJA 3KYDD 1GC7A 4II2B 1SIFA 2ZPYA 2GBMA 2BPSA 3DVGY 3WIMA 2HE7A 2CHWA 3QWZB 2G45B 5CX3A 1J19A 3VTUA 4FA6A 2MWSB 2KANA 2Z0DB 1QZEA 3ZRCA 4BFRA 3DVNV 4URKA 4TQ0A 2KOXA 5LXHA 2WX1A 4FULA 4BVUC 3RULA 1TBEA 1WM3A 2BYEA 4ICUA 3QCAA 4IM2A 4FJZA 3VFKA 3KW5B 3PGEA 1E90A 1WZ0A 2IO1B 2MX2A 3ZNID 1WZ3A 2HTHA 2OJRA 2N9PC 4KVGB 1E8YA 3PREA 4EZLA 3RD2A 2ZCBA 3EHVA 5G55A 1KM7A 2JXXA 5L95C 4NQKE 2L00B 2BF8B 3PS6A 1KJTA 2DHZA 4LCDE 2V3SA 2DZMA 2HD5B 3HIZA 3M3JA 1C3TA 3DOWA 3VH3B 2N1VA 3RYTA 3PV1A 3DBRI 5D7GA 1YX5B 3ZDTA 2HJ8A 2LVPA 3ZDMC 3WALA 2GBKA 1CMXB 3TCAA 5J2RA 5AZGA 4AUQC 2L0FA 3UQAA 1H8CA 1WH3A 5IAAC 2J0JA 5L83A 2IYDB 1EF5A 2KDIA 3SD5A 2K8BA 3QQ8B 2LASA 4W9KA 2L05A 3UQBA 2FIDA 2N4FA 1E8XA 1Z5SB 2FCSA 2MBHA 3JSVA 4GDLB 2DYMA 1KOTA 1JRUA 3R66C 4MDKE 4BKSA 2YLMA 4DBGA 2LRUA 4I6LB 4LJOB 3ZTDA 4NAWA 4GSWA 4WJPA 4KIKB 2ZPNA 3V6CB 2AL6A 4FBJB 1BT0A 2MW5A 2MP2A 5HKHA 2LVQA 2J0MA 2R2OA 3QJZA 3TL5A 2C5LC 3PHWB 3NHEB 3CF6E 2WWZA 4MEMA 4ZDVA 2LJ5A 2MSED 4TV3A 2JPHA 3M95A 4WWOA 4LDTB 3OAWA 1J8CA 4IC7B 2KXJA 4MSQB 2CU1A 5CHVC 1EO6A 3PTFC 3AU5A 2UWQA 3DBHI 2R2QA 2QHOA 2CS4A 3KUCB 2NR2A 1WFYA 3DBLI 4CHKA 1RFAA 5KHOA 3KUDB 3L10B 2L3ZA 5DCNA 4A20A 4DHZE 2DAJA 3PRPB 1GG3A 2IO0B 3AULA 4HWIB 4KDIC 4B9KA 4BKGA 2KJ6A 2D10A 2LXCA 3OJ4B 3O65B 2RR9A 3LDZE 1WXSA 2KFJA 5JH5C 3RT3B 2GBRA 2ZNVC 1OGWA 3CSFA 3EECA 4W9GA 1D3ZA 4W9LA 4I6PA 4LDTD 3BY4B 1EF1A 2J7QB 4KV2A 3A9KA 4FJVB 2NCNA 3QARA 3ZNHB 1I42A 5KHQA 2LGYA 5LXIB 2KD0A 4DHJB 2WX0A 3AI5A 3L13A 1M94A 1WX9A 2WDTB 4WWNA 4IG7B 1WX8A 3PRMB 1ZW7A 1WM2A 3ALBA 1WMHA 3MHSD 2EMTA 4NJ7A 1WYWB 3PT2B 3APCA 4GU2A 5E6PA 2I1KA 2L7RA 2XK5A 4MSMB 3DQVA 1R4MI 3IVFA 1V80A 1WXAA 2D3GA 2REXA 4FHJA 3NY5A 3ML9A 2V4LA 4EEWA 2A4ZA 5IA7A 4EKUA 2FNJB 4I6NB 2KDFB 4MJSB 4MGKE 2K6DB 1OEYA 3I3TB 1C1YB 3QHTA 4KSKC 4XX5A 4E71A 2DZKA 3ZRFA 3UIPB 1UH6A 4FADA 1LM8B 2XEWA 2MCNB 3IFWB 3H7SA 4DHJD 3UF8A 3H7PA 1V5TA 3JVZX 2KC2A 3B08A 2MBEA 2NPTA 4WAAA 5FR6A 3VVWB 4AJYB 3RUIB 4P7IA 2KHWB 3JSVB 3W1SA 2NS5A 1IYFA 2DX5B 4HLEA 1VD2A 3ML8A 4F7ZA 3DVNU 3CSTA 4BOZB 1WIAA 1L7YA 4BBNC 3PRZA 1V6EA 1WGGA 2JWZA 2NBWB 3QK0A 4RM9A 3SHQA 3OJ3A 2JRHA 4WQOB 3TIXA 2MP2B 4IWQA 2JF5A 3VHTC 4JIOU 3ECIA 3L54A 1YQBA 4GIVA 4W9CA 5GMVA 1VCBA 4W9FA 3TBLD 3NZSA 2O2VA 3L17A 2A5UA 3KYCD 4W9HA 2G3QB 2O6VB 2NVUI 1OTRB 3QIJA 2DENB 3ZNZB 2JY6A 1UD7A 4ANWA 3DPDA 2Z59B 2N7EA 3KUZA 2Z0EB 2IY0B 4IWPA 2M1MA 1WJ6A 2MRPA 3WAOA 1GJZA 4M0WB 1NDDA 1TTNA 1XQQA 1FXTB 2LRWA 4B6WA 5LLIA 2XBBC 2W9NA 2K8HA 2BWES 4FHKA 1LFDA 1ZKHA 3X0WA 2KX3A 3APDA 1Z2MA 4FN2A 2JRIB 2FAZA 5CHFA 3W1SC 3H1UA 2ASQA 1GNUA 3PVLA 4MGYE 2AL3A 2BYVE 3X23A 3JYUA 4AWJA 4BKTA 1WGRA 1V9JA 4RM8A 3VAWA 4M8NA 2O6VD 2KZRA 3ONSA 3VH4B 3IHPC 1P1AA 1Q0WB 4KSLC 2G4SA 1K8RB 4HK2A 3NS8A 2ZZPB 1EUVB 3P2BA 2L8JA 3PPAA 3HHMA 3GZNI 2KJHB 1ZGUB 4XZ4A 3VUXA 2KJRA 2FCQA 1SE9A 1IPGA 2C7HA 2KQ7A 2JT4B 3A1QA 1WMHB 3VQIA 2LD9A 2IBIB 2BKRB 2KO3A 2KQSA 1WR6E 2C60A 2IY1B 2KKCA 4M8MA 4DHZB 4ASWC 1E8ZA 1WJ4A 3VTWA 4WJNA 1UBIA 4GN1A 2M17A 2FCMA 2VRRB 5E6OA 2N9XA 2XK5B 2KVRA 3IG3A 4ANUA 5AEKB 3HM3A 3C0RB 2KTRB 5DPWA 2KC1A 5EDSA 4G11A 1WJUA 1V86A 4JGHB 3U7DA 5DPRA 1UBQA 4K1RB 5CHWA 1Q1OA 4DXAB 3IBEA 3U30A 4PS8A 2D2QA 4EUTA 3VUYA 2M8SA 4GGQA 1UZXB 3EFUA 3H7PB 2ZVNA 4HDOA 5CTRC 3APFA 4K7UA 3DVGX 2GMIC 3VUWA 3QX1A 2KFKA 2V1YA 2BWFA 4B95A 3A4SC 3UIOB 2JZ3B 2LGXA 3ENEA 5D2MB 3SDLC 3WAMA 4FLHA 1WGHA 2MLBA 1H4RA 4WJOA 3N30A 3QA8A 2CR5A 2KDBA 2KTFA 4ZYNA 4KZ0A 5JHBA 4A3PA 1A5RA 2KK8A 3PLVA 4W9EA 2PE9A 4FJYA 3BINA 3EC8A 1P3QU 3VXWA 2M0XA 3ZIMA 2MBQA 3ZTCA 1IP9A 2O2VB 3HM6X 2LI5A 2L0TA 2PE6B 4G3XB 4GDKA 4K7WA 4JQWC 3VDZA 1S1QB 5DPSA 4IM0A 1WE6A 4OVVA 3ZKJC 2RD0A 2MQJA 3A9JA 4GMVA 3ZNGC 5JHAA 1WE7A 4MM3A 3QAQA 4X57B 1V2YA 1S3SG 4W9DA 3LJ3A 2NBVB 1V81A 4EOYA 2MBOA 2ZJDA 2RGFA 2K25A 4TUUA 2FCNA 5AZHA 3H6NA 1WGYA 2B3AA 4HPLB 3WAPA 3V61A 3V6EB 2RSUA 1YIWA 3M62B 4JL9A 3T8MA 3UINB 3Q3JA 4AP4C 2K1FA 4N9F4 4NAWB 3PLUA 1V49A 2ZNVB 3N32A 2IZVB 3AU4A 5E6NA 2DZIA 4PYZA 3R7QA 1X1MA 5C1ZA 3N3KB 2GBNA 2CHXA 2LWPA 3HK0A 4BOSC 4E74A 4DK5A 3JW0X 4DWFA 1WRDB 2KX0A 1F9JA 3WANA 1TGZB 2LVOA 2K39A 1SGHA 3GOEA 3KVFB 4ANXA 3R3MA 1WJNA 4IWOA 4HCNB 3A1QB 2KLGA 1I35A 3ZO5B 1UGMA 2ZEQA 1P98A 1WR1A 1YJ1A 2D11A 3MTNB 4HCPB 3R7RA 4MGZE 2N1WA 1RLFA 2JVCA 3B1LX 3UGBB 5C23A 4GB9A 2FUHB 4BKSD 4LJPB 2N9EB 2N7DA 2JUOA 1R4NI 1XT9B 3S2AA 1WY8A 4NY0A 4XC2A 2GOWA 2KNBA 3TJPA 2JZZA 2KMCA 1J0GA 3MJWA 4MJSA 4IW0A 3WA0A 1KLVA 2ZCCA 3NZUA 1G6JA 1WI0A 2DZJA 2G4DB 2KLCA 4AJWA 4TQ1A 4ANVA 1E5WA 3A4RA 5J18A 3PSEB 2I1JA 3KH0A 1LXDA 3A9KB 3TMPB 3DDCB 2AWTA 3RZWC 1TZ1A 3U8ZA 3PZDA 2KFKB 2YVCA 2PEAA 2PJHA 4HDQA 4NJ6A 2IO3B 1NI2A 1V5OA 3H9DA 4TKNA 4G0NB 4YL8A 4CYEA 3L16A 1GC6A 5D94A 3RCZA 2KDEB 4BBNF 4HXDA 3T9LA 2NBUA 5AZFA 4K7SA 3W1YA 5TR5A 3ZVVA 4PYUA 3V60A 2KMAA 4II3B 5G2NA 1ISNA 1HE8A 2DAFA 3ZW3A 1NBFC 2OOBB 1WX7A 1Y8RC 4IM3A 4GDKB 1E7VA 1P0RA 3ZLZA 3Q3FA 2LXAA 1WXMA 1WF9A 2O6VA 2C7NB 3NOBA 1PQSA 3DBSA 4G50A 2AYOB 2C9WB 2KN5A 2KWUB 2BKFA 1YX6B 2D07B 4KZCA 4ZRIA 4A3OA 2LUEA 4CO7A 1L2NA 2KWCA 3A9JB 4AOFA 1OEYJ 1UELA 4EZJA 1RRBA 1E8WA 3K9PB 1E7UA 2J0KA 2NPTB 4KDLB 1P9DU 3M63B 2BGFA 4JLCA 3L08A 2MBBB 1WGDA 3QC8B 4W9IA 4PS7A 2K8CA 4GDLA 2M4NA 4HVBA 2UYZB 5BO4B 4OVUA 3B0AA 2DYOA 4F8CB 4ZRJA 1XD3B 2FIFA 2KWVB 2L76A 2WYQA 4NPNA 2LGDA 4KIKA 4MGIE 2RPQA 3RZFA 4ICVA 3AXCA 2ZVOA 2BYFA 4WWPA 4E3CA 1MG8A 3A33B 3CMMB 2MA9B 3OLMD 2AEHA 4EZKA 2CHZA 1AARA 3VTVA 3L0WB 3D32A 4F1SA 4GXBA 1T0YA 4GOCA 4RMAA 5JZEB 3K9OB 2Y5BB 4HJKA 1LQBA 4DDGD 2CKHB 5D6JB 4IUMB 4HPMB 4DDID 4EFOA 2IO2B 4PS3A 2EKEC 4WJQA 4K81A 4W9JA
chains in the Genus database with same CATH superfamily
5J17A 1DOYA 4RGNA 1U4AA 2K3UA 3GE8C 3ZUNA 3ZXRA 3E56A 1CK1A 2BYTA 3PHXB 3DBLB 3Q8BA 1GC7A 3FAHA 4II2B 1HTQA 3P4SB 1BUIC 2CHWA 1WGKA 4TSSA 2N9KA 2MWSB 2ON8A 2Z0DB 4BFRA 4URKA 1NYRA 2KOXA 4BVUC 2BYEA 1I4QA 4ICUA 3VFKA 1WZ0A 4KX6B 5MPOA 2HTHA 3P42A 2Y5PA 4KKIA 3PREA 4EZLA 2WDQB 4ITKA 4L2YA 2L32A 2DHZA 2DZMA 3HIZA 1C3TA 3RYTA 3PV1A 3DBRI 1IGCA 3ZDMC 2KWDA 5J2RA 4AUQC 3UQAA 2J0JA 2IYDB 3ETRA 3UQBA 1IBXB 1E8XA 1JRUA 2LRUA 3AB5A 5AUKA 4LJOB 2MW5A 1FNUA 1ZXHA 3TL5A 4RCOA 1A70A 2DBYA 4CQNA 2J53A 2V9HA 3MHZA 1T0RC 3NHEB 3CF6E 1M4VA 4WWOA 2KDMA 1J8CA 4IC7B 2RMMA 5CHVC 3PTFC 3RFZB 4WWMA 1N6ZA 2CS4A 3DBLI 5IKCM 4A20A 1GG3A 4KDIC 4BKGA 1I4XA 3BYTB 4W9LA 4I6PA 1WWTA 2WP9B 2J7QB 4LDTD 4P16A 5EE0A 2VZKD 3QARA 5KHQA 2K0PA 1C77A 5LXIB 3L13A 2WDTB 5JXVA 1WM2A 3GZNB 1UF0A 3RI7C 4NJ7A 2EMTA 1SJHD 1MFWA 2XK5A 5BMHA 3DQVA 1I4RA 5IN7A 3NY5A 3ML9A 1JWUD 4LLGM 1F0ZA 4MGKE 1OEYA 3QHTA 4E71A 2DZKA 3Q3NC 1N62A 2WHIA 2Q5WD 1XLPA 2MBEA 5FR6A 4AJYB 1RM6C 3JSVB 1FXAA 2BT6A 3W1SA 2KMMA 1T6BX 3AH7A 4F7ZA 3CSTA 4BOZB 3PRZA 4RM9A 3QK0A 1C9FA 3L54A 4W9CA 3P4RB 5GMVA 1VCBA 1HZ5A 3NZSA 1QOFA 2YEPF 3KYCD 1HTOA 4W9HA 4HROA 1OTRB 3QIJA 2DENB 4XE0A 1UD7A 1TT5B 4ANWA 2QEJC 2PTLA 3DHIC 3KWLA 2X38A 1YN3A 2BWES 4FHKA 4A55A 4P1BC 5H8YE 2FAZA 3H1UA 2ASQA 2BYVE 4BKTA 4HPPA 4M8NA 3ONSA 3VH4B 3Q8FA 1EUVB 2L8JA 3GZNI 1ZGUB 2FCQA 3ZJVA 2KQ7A 1QOGA 4JWUC 4RGOS 1WMHB 1MHXA 2OEDA 2IY1B 2KKCA 1WJ4A 2M17A 2FCMA 4ANUA 3NVZA 1EM7A 2KTRB 5EDSA 3U7DA 1D6EC 4RGMA 1E0ZA 4DXAB 1PGBA 2WDRB 4PS8A 2D2QA 1VZ8A 4XYCA 2M8SA 2WXJA 2RPVA 3APFA 2BTEA 2CU3A 2GMIC 2V1YA 2SAKA 3A4SC 2BW2A 3UIOB 4FLHA 1DYQA 1UGJA 3QA8A 2CR5A 2KTFA 4ZYNA 4W9EA 1TY0A 1C78A 1IP9A 2O2VB 2LI5A 2PE6B 4JQWC 3VDZA 1JALA 3ZKJC 3VR8B 2RD0A 3ZNGC 3IT6B 1WE7A 1PYWD 3QAQA 3ZQ4A 4XDDA 2MBOA 2LHEA 2K25A 2B3AA 1YIWA 3T8MA 2K1FA 3T3OA 2M56B 4N9F4 4NAWB 3PLUA 4ARIA 3AU4A 3EGRA 3R7QA 3U2SC 4C7ZA 4DK5A 4DWFA 4WQMA 2B76B 2KX0A 3OG5A 1TGZB 1SGHA 4L1BA 3Q3OC 3R3MA 2FE8A 3NRZA 1UGMA 1XLOA 1P98A 1YJ1A 3AEDB 5D3IB 1FPYA 4MGZE 3UGBB 4BKSD 1R7SA 2H89B 3H8HA 4XC2A 1V1PB 3WA0A 3RNGC 1G6JA 1XEEA 1WI0A 3ZXVA 4IDIA 2I1JA 1Q10A 2LEKA 3DHHC 3U8ZA 2KFKB 2YVCA 1NI2A 4YL8A 3C8YA 3VRAB 3CIRB 4CYEA 3KLSX 1N63A 2ZW1A 5BMIA 5TR5A 3ZVVA 1V1OA 3ZYYX 4YSYB 2N0SB 2KMAA 4II3B 5G2NA 2QC8A 3V60A 3ZW3A 3AE8B 3J9CA 1WX7A 3B2FA 4GDKB 1N61A 2W55A 3Q3FA 1WXMA 4O1NA 1MJDA 1PQSA 4G50A 2INNE 4MT5A 2KVZA 4LNFA 2C9WB 2KN5A 2KWUB 2BKFA 4US8A 1YX6B 4A3OA 4ZRIA 4CO7A 1L2NA 3A9JB 4BAXA 2LUMA 3K9PB 4KDLB 2KT7A 4M0WA 4B0EA 1P9DU 3M63B 4C4VB 1JWAD 2MBBB 2JWUA 2LFIA 4PS7A 2M4NA 2GLSA 4K3CA 4OVUA 4S0RA 3NG0A 2FIFA 4MGIE 3AXCA 1MG8A 2MA9B 3OLMD 2CHZA 1AARA 1FCCC 4HJKA 1LQBA 3KQ4A 4HPMB 1XF5L 1FO4A 2PPHA 4JE3B 1N60A 3V62A 1BMLC 1RAXA 5HI1A 1TS3A 2K6QA 2IDYA 1PGXA 2ZPYA 1C76A 2GBMA 2BPSA 3DVGY 2WS3B 3QWZB 3I5JC 1ENFA 1QZEA 3DVNV 2LGIA 2WX1A 4FULA 3RULA 1WM3A 3PGEA 2IO1B 2PLPA 1CZPA 2MX2A 1WZ3A 1ZUD2 2OJRA 2ZCBA 1ZXIA 2WU5B 5C2TB 5L95C 4ZYSA 4RFBA 3EUB2 3MP9A 2V3SA 2HD5B 3VH3B 4DQOC 3Q69A 3ZDTA 1ET9A 3HRDD 5HG2A 1CMXB 4C7YA 1H8CA 4YSZB 4W9KA 2L05A 1Z5SB 2MBHA 3NJTA 3AEEB 3WCQA 3R66C 4BKSA 4DBGA 1CJEA 1FMAD 1UUPA 3ZTDA 3Q3MC 4C80A 2PVOD 2ZPNA 2XN9C 4FBJB 5LNK1 1ESFA 4YTPB 5HKHA 4A6QA 2R2OA 2J0MA 3FILB 2C5LC 3Q8EA 1FFUA 2I38A 2WWZA 4FXCA 2LJ5A 2MSED 4TV3A 2JPHA 1STEA 3NS1A 1SF0A 1LGRA 3URYA 3C19A 1JQ4A 2CU1A 3FKYA 2UWQA 2DWQA 4MM3B 1AYFA 2QMTA 2QHOA 3KUCB 3KUDB 3L10B 2L3ZA 3N20C 4DHZE 2KAJA 1WYGA 2KJ6A 2D10A 3OJ4B 2RR9A 1WXSA 2KFJA 1TKYA 1OGWA 4W9GA 4S17A 3BVMA 5BYRA 4C56C 1TKEA 2WU2B 1SBBB 1WX8A 3PRMB 3MHSD 3PZ8A 1C4CA 4EEWA 1V80A 2D3GA 2REXA 2A4ZA 3Q6BA 2BB6A 4I6NB 1C1YB 2KACA 4XX5A 1Y56A 3HUIA 1DOXA 1LM8B 2XEWA 2MCNB 3IFWB 2IGDA 4A90A 3UF8A 3H7PA 3BVZA 1JMLA 2KC2A 3B08A 2NPTA 4DXGA 2W54A 2DX5B 3DVNU 1L7YA 5H92C 4BBNC 3SHQA 1D5MC 3OJ3A 4PK1A 2JRHA 4IWQA 3VHTC 4JIOU 1YQBA 4W9FA 3TBLD 2MJEA 3L17A 4HKZE 3ZNZB 3AEBB 2Z59B 2N7EA 3KUZA 2Z0EB 2IY0B 4IWPA 2WNMA 2TSSA 2M1MA 1MHHE 4REZA 2D3BA 2MRPA 1GJZA 3IXSA 1TTNA 1XQQA 4B6WA 1FXTB 1Z2MA 2JRIB 5IOIA 3W5UB 1GNUA 4MGYE 1UNSA 2M19A 2MH7A 3X23A 4AWJA 3AE2B 3VAWA 4RM8A 4LNOA 1Q0WB 4KSLC 4HK2A 1J7CA 2ZZPB 3P2BA 3VUXA 1TS2A 4AS1A 1IPGA 2JT4B 4YTNB 1GAQB 1HXYD 2KQSA 4HKQA 3AMZA 1N5WA 2XK5B 2WXPA 3C0RB 5DPWA 3P1MA 1V86A 1R4NB 3ZJUA 2JZPA 4KGSA 5EE1A 4GGQA 4USAA 1UWMA 3RNBC 3Q8CA 3Q14C 2ZVNA 4K7UA 3DVGX 3BVGA 3QX1A 1XLNA 3NUHB 2BWFA 4B95A 3WAMA 4LNNA 3DWMA 5JHBA 3N30A 2WXMA 1QLBB 1A5RA 2KK8A 2LJIA 2PE9A 4FJYA 1QQRA 3BINA 1P3QU 2BS4B 3EC8A 5FKAC 2M0XA 4YTMB 3HM6X 1TYGB 1XCQL 4HRSA 2G1EA 1QT9A 3LB8C 3TUOA 5JHAA 4GMVA 4J3OD 1T5XD 4W9DA 1JRPA 1XXGA 2ZJDA 2RGFA 3V61A 3V6EB 4JL9A 1E9MA 3O13A 3N32A 3AECB 2DZIA 4PYZA 5C1ZA 2LWPA 3BZDB 1FCLA 3JW0X 4IWOA 2KLGA 3ZO5B 2ZEQA 1WR1A 3R7RA 2N1WA 1RLFA 2JVCA 1FRRA 5C23A 4GB9A 4LJPB 2N9EB 2N7DA 1R4NI 1L6UA 4OVZA 2GOWA 3RNAC 3TJPA 1AWDA 1KLVA 2WDVB 2ZCCA 1T0QC 4PT5A 2DZJA 5C3JB 2KLCA 1JCKB 3A9KB 3RZWC 3W2DA 1TZ1A 4M01A 2PEAA 4NJ6A 3AE3B 3Q8AA 4G0NB 1SJED 3L16A 1GC6A 5G5HA 2KDEB 5AZFA 4K7SA 5HHDG 1B1ZA 1YN5A 1SE3A 1NBFC 1Y8RC 5E6JA 4N6EB 1E7VA 3ABVB 4K3BA 2GRIA 2LXAA 1WF9A 1L6VA 1N5XA 5BYQA 2Y3AA 4AOFA 3KWVA 3GS2A 1RRBA 1J7BA 2MEKA 3BIID 2J0KA 4IKGA 4GDLA 1WSPA 3B0AA 2DYOA 4ZRJA 2KWVB 2BB5A 4KIKA 3RZFA 2J4XA 2BYFA 3AE4B 2J42A 3A33B 2VH2A 3CMMB 1C4AA 4HJGE 3L0WB 5JZEB 4RMAA 2WXKA 1JWSD 1I7HA 1L5PA 1PFDA 1YQ3B 2CKHB 5D6JB 4EFOA 2IO2B 2JX5A 1EU3A 4MACA 1WXVA 1D5XC 1MI0A 4NQLB 2D3CA 1Q5WB 4MH0E 1GUAB 1YD8U 4J6IA 2CJNA 3DBHB 2C7MB 5DPTA 3DCGA 2LZ6A 1FM0D 2DYBA 4NNJB 1OQYA 2KTRA 2GBJA 3KYDD 3AEAB 1WXQA 2HE7A 3I9V1 2G45B 1QILA 4NZLB 5CX3A 4RNAA 4XWTA 1J19A 3VTUA 1ZOYB 2KANA 3ZRCA 4AQ7A 2ICIA 4WH4A 1TBEA 1QOBA 4IM2A 3SR6A 4FJZA 1F52A 3KW5B 1E90A 1TS5A 3ZNID 2N9PC 4KVGB 3TEXA 1FNWA 3EHVA 5TSSA 5G55A 1KM7A 4NQKE 3PS6A 4LCDE 4OZCA 1K50A 3BK1A 3M3JA 1YQ4B 2N1VA 1VDVA 4N59A 1YX5B 1R4MB 2HJ8A 5BMGA 2LVPA 3TCAA 5AZGA 2L0FA 3BK2A 1WH3A 5IAAC 3NZ3A 4RF1A 1KRHA 2K8BA 3QQ8B 2FIDA 3SFDB 1SE4A 4ACFA 1P7EA 4MDKE 4NAWA 4GSWA 4WJPA 2AL6A 1HZ6A 1BT0A 2ONQA 2MP2A 3QJZA 3B9JA 2RDBC 4JWSC 1DGJA 3PHWB 4MEMA 3BWUD 3OAWA 1EWCA 3RNCC 5I4DA 2HTME 2WXQA 3AU5A 3DBHI 2R2QA 2K9XA 2NR2A 1WFYA 1TJEA 2KN4A 1VLBA 5KHOA 2CJOA 5DCNA 1V1PA 2OJWA 2L1AA 4B9KA 2LXCA 3O65B 2W82A 4LNIA 2V0GA 5JH5C 3RT3B 3CSFA 3EECA 2NMQA 3BY4B 1QF6A 2NCNA 3T3NA 2LGYA 4DHJB 3AI5A 1OFFA 1M94A 2D5GA 1FEHA 3ALBA 2QSDA 3V05A 1T3QA 1WYWB 2WXGA 4JPSA 3APCA 2I1KA 2L7RA 4MSMB 1R4MI 2K22A 1WXAA 4FHJA 5IA7A 1ZDVA 2FNJB 4MJSB 4KSKC 3ZRFA 3UIPB 1UH6A 4FADA 3H7SA 2INCC 4KGRA 1L0XB 3VVWB 3AE5B 4C4VA 2KHWB 1IYFA 2FBWB 1VD2A 2AX5A 4OZBA 1WIAA 1V6EA 2JWZA 1E6EB 2NBWB 1FNVA 4WQOB 3TIXA 2INDC 2JF5A 4BZAA 4GIVA 3W9CB 2MHJA 2BVCA 2A5UA 4KGTA 2O6VB 4RH6A 3DPDA 3MC0B 1I4GA 3U4EG 1GOZA 2LRWA 5FR3A 2K8HA 1V8CA 1VZ6A 1LFDA 1ZKHA 4FN2A 2K5PA 2W3RA 3W1SC 3B2GA 2AL3A 1RWSA 3HVDA 3JYUA 1WGRA 1C79A 3NVYA 2EKIA 2MJ3A 3IHPC 1P1AA 1FRDA 1K8RB 1E10A 3NS8A 4H2AA 3HHMA 2LMCA 2L83A 2NTSA 1SE9A 1FFVA 3AM9A 3W5VB 3A1QA 3VQIA 1GB4A 2LD9A 2BKRB 3P63A 1WR6E 2V3PA 1RFKA 1KLUD 4MH8A 3VTWA 1WRIA 1UBIA 1AN8A 2AQ3B 1D4BA 2VRRB 2N9XA 3IG3A 2WXRA 2KC1A 2LGSA 4G11A 4JGHB 5DPRA 1UBQA 1Q1OA 1SIJA 4M02A 1CQVA 1FXIA 3EFUA 4RF0A 3H7PB 4HDOA 1I4PA 1K51A 2FUG1 1K52A 3V3XA 3VUWA 3PZ7A 3SDLC 2RDGA 5D2MB 1WGHA 1VRAB 4WJOA 4KZ0A 4A3PA 4XGAB 3VXWA 2MBQA 3ZTCA 1NENB 4G3XB 2VH1A 4OHJA 3N1YC 3AV8A 3TEZA 1S1QB 5BYSA 4IM0A 1WE6A 1YMHE 2HDEA 2SEBD 4MM3A 3PO0A 4X57B 4UDUC 1V2YA 1S3SG 3LJ3A 1V81A 2QCZA 4EOYA 2W3SA 4TUUA 5AZHA 3H6NA 1WGYA 3WAPA 3M62B 3Q3JA 3U7ZA 3GB1A 3L4PA 4DXFA 1V49A 2IZVB 1X1MA 2GBNA 1F2RC 2CHXA 2V3NA 1WRDB 2LVOA 3HVZA 3GOEA 1GB1A 1WJNA 1I35A 1SB3C 1NYQA 3MTNB 4HCPB 2D11A 1TY2A 2INPE 2DLBA 3LXFA 2FUHB 2JUOA 1XT9B 3S2AA 1WY8A 3IAM1 2KMCA 3MJWA 1NI3A 2MJDA 2G4DB 4LTUA 4TQ1A 4ANVA 1E5WA 4HEA1 1K53A 2GI9A 2QILA 3TMPB 2AWTA 3PZDA 2J52A 2PKOA 2IO3B 1T0SC 3H9DA 3NVVA 1NEKB 2JQRB 3AE9B 4BBNF 4RGTA 4HXDA 3W1YA 4M00A 4PYUA 1ISNA 2OOBB 1KF6B 4IM3A 2ACZB 1PUTA 1EU4A 1P0RA 3ZLZA 2PMVA 3LYYA 2C7NB 3NOBA 1YJIA 3RNEC 3MFGA 2AYOB 4GLSC 2D07B 4KZCA 1OEYJ 2IJ0A 1YNTE 4JLCA 1SSNA 1YOVB 1IBXA 1WGDA 2K8CA 2QDFA 2BQQA 1JW9D 5BO4B 4HVBA 4F8CB 1XD3B 2L76A 2LGDA 3IAS1 1L4DB 3Q2AC 4ICVA 4NJCA 4E3CA 5EE9A 4EZKA 4YSXB 3D32A 4GXBA 1T0YA 4GOCA 1L4ZB 2Y5BB 1AW7A 4DDGD 4DDID 3AEGB 4KKJA 2LHDA 4WJQA 4K81A 4W9JA 4ZRKA 4MELA 4A9AA 1DOIA 2EMSA 3SU8X 1SIFA 1KTKA 1XLQA 1ET6A 3WIMA 2NTTA 2N9LA 4FA6A 4WIPA 1ZDXA 4TQ0A 5LXHA 2R61A 1YN4A 3FC4A 2WXLA 3QCAA 2QIEB 1VJKA 2IPKD 1E8YA 3RD2A 3OWEB 2PW9A 4QAYA 2JXXA 2L00B 2BF8B 3U52E 1KJTA 1TZOA 2KQ4X 2RDHA 3DOWA 5AUIA 2HJ1A 2Z8LA 5D7GA 4C00A 4A8XC 1LO5D 3RNFC 3WALA 2GBKA 2WXFA 2QJLA 1JWBD 5L83A 1EF5A 2KDIA 3SD5A 3GE3C 2LASA 1KH0A 2N4FA 3I63C 2FCSA 3JSVA 4GDLB 2DYMA 1KOTA 2YLMA 1JROA 4ZOHC 4I6LB 2N7JA 4KIKB 3V6CB 5G5GA 2LVQA 3N9YC 4ZHOA 2KYWA 2JYEA 2M0AA 2JXTA 5T8IA 3RPFC 4ZDVA 2WXOA 3M95A 4TMAB 4LDTB 2VZKB 2WXIA 2KXJA 4MSQB 4ZRQA 1EO6A 2UU7A 1QOAA 1ZE3D 4CHKA 2L52A 1RFAA 2DAJA 2JYTA 3PRPB 2IO0B 3AULA 4HWIB 2E3TA 3LDZE 4YXDB 3VRBB 2I2YA 2V4IB 2GBRA 2ZNVC 1D3ZA 2AQ2B 4ARCA 3R2TA 1EF1A 4KV2A 3A9KA 4FJVB 3ZNHB 4D2KA 1I42A 1JWMD 2KD0A 2WX0A 1TIFA 1WX9A 4WWNA 4Q2JA 4IG7B 2IGHA 2EELA 1ZW7A 1WMHA 4YWGG 1ROEA 1E7PB 1HQRD 2X8XX 1MG4A 1ACCA 3PT2B 2WXNA 1SEBD 4GU2A 5E6PA 4ZRPA 4JX1C 3IVFA 2IGGA 2V4LA 4EKUA 2KDFB 2K6DB 3I3TB 3AE1B 2H88B 4DHJD 1V5TA 3JVZX 4WAAA 3RUIB 3AE7B 4P7IA 2NS5A 4HLEA 3ML8A 5D3DA 1F2RI 5HFYA 1WGGA 3EFCA 2MP2B 4YT0B 2YEPB 3ECIA 3DWGC 1C4PA 1XO3A 2O2VA 2G3QB 2NVUI 2JY6A 3N1ZC 1WJ6A 3WAOA 1QKZA 1NDDA 4M0WB 5LLIA 2XBBC 1EWYC 2W9NA 2ZW0A 1KFYB 3X0WA 2KX3A 3APDA 3ZJTA 5CHFA 3PVLA 3N1XC 3P4QB 3DHGC 2DNFA 2OHFA 3MC8A 1V9JA 4WURA 2O6VD 2BS2B 2KZRA 4N58A 2G4SA 3AEFB 3PPAA 3AE6B 2KJHB 4XZ4A 2KJRA 1F77A 2C7HA 1V97A 1ZP0B 2IBIB 2KO3A 2C60A 4EE2A 4M8MA 1YJJA 4DHZB 4ASWC 1E8ZA 1HA5A 5EE3A 5GXGB 4WJNA 4GN1A 1SXTA 5E6OA 5AEKB 2KVRA 2Y5CA 3HM3A 1WJUA 3EA6A 2D3AA 4K1RB 4NAMA 2WGSA 5CHWA 3IBEA 2E6XA 3U30A 4EUTA 3VUYA 5IO9A 1UZXB 1D5ZC 3TEWA 5CTRC 1MPEA 2KFKA 3TSSA 1FD6A 2JZ3B 2LGXA 3ENEA 2WQYB 2BS3B 2JSVX 2MLBA 1H4RA 4P6VF 2KDBA 4XDCA 3PLVA 2PIAA 4OW0A 3ZIMA 3R2IA 3TEYA 2L0TA 4GDKA 4K7WA 3RMKC 5DPSA 4P1CC 4OVVA 3NVWA 2WXHA 2MQJA 3A9JA 1TS4A 1RYJA 5FK9C 2NBVB 2FCNA 4HPLB 2RSUA 3UINB 4AP4C 4L23A 3ZGZA 1XCTL 2ZNVB 5E6NA 4US9A 1PDXA 2BBCA 3RN9C 3E9SA 3N3KB 1F1HA 1SE2A 3HK0A 4BOSC 4E74A 4ZHPA 1KLGD 1NVID 1F9JA 3WANA 2K39A 3KVFB 2AQ1B 4ANXA 4HCNB 2GB1A 3A1QB 3GP7A 3MC9A 2XNAC 3B1LX 1I4HA 1L0VB 3BYYB 3I57A 3IT4B 1BXTA 1TKGA 4NY0A 2KNBA 2JZZA 1J0GA 4MJSA 4B0MA 3AN1A 4IW0A 1IGDA 3NZUA 4AJWA 2JU6X 3A4RA 1VZ7A 5J18A 3PSEB 1L0YB 3KH0A 4LK0M 1PGAA 4IOIE 1LXDA 3DDCB 2PJHA 4HDQA 1V5OA 4TKNA 1HEZE 5D94A 3RCZA 4R3DA 3T9LA 2NBUA 1B9RA 4OZAA 1HE8A 2DAFA 1MVKA 2O6VA 3SFEB 3DBRB 3DBSA 3R8BA 1VR9A 1GPXA 1OQRA 3UI3A 2LUEA 5IP4D 2KWCA 3SEBA 3VR9B 4EZJA 1UELA 2PVGC 4LNKA 1E8WA 3MJ5A 1FIQA 1E7UA 2NPTB 2BGFA 3L08A 3QC8B 4W9IA 2UYZB 2WYQA 2G9HD 4NPNA 1J7AA 2RPQA 4WWPA 2ZVOA 1P7FA 3FILA 4WAFA 2AEHA 1OQQA 1UWXA 3CWIA 1IUEA 3P4PB 1ZPSA 3VTVA 4F1SA 4XWWA 3K9OB 2WLBA 4IUMB 4PS3A 2EKEC
chains in the Genus database with same CATH topology
5J17A 1WXVA 2PPHA 4NQLB 4ZRKA 4MELA 1Q5WB 1U4AA 4MH0E 1GUAB 1YD8U 3V62A 4J6IA 3ZUNA 1RAXA 2C7MB 5DPTA 2EMSA 3DCGA 2LZ6A 2DYBA 4NNJB 3PHXB 1OQYA 3SU8X 2K6QA 2KTRA 2GBJA 3KYDD 1GC7A 4II2B 1SIFA 2ZPYA 2GBMA 2BPSA 3DVGY 3WIMA 2HE7A 2CHWA 3QWZB 2G45B 5CX3A 1J19A 3VTUA 4FA6A 2MWSB 2KANA 2Z0DB 1QZEA 3ZRCA 4BFRA 3DVNV 4URKA 4TQ0A 2KOXA 5LXHA 2WX1A 4FULA 4BVUC 3RULA 1TBEA 1WM3A 2BYEA 4ICUA 3QCAA 4IM2A 4FJZA 3VFKA 3KW5B 3PGEA 1E90A 1WZ0A 2IO1B 2MX2A 3ZNID 1WZ3A 2HTHA 2OJRA 2N9PC 4KVGB 1E8YA 3PREA 4EZLA 3RD2A 2ZCBA 3EHVA 5G55A 1KM7A 2JXXA 5L95C 4NQKE 2L00B 2BF8B 3PS6A 1KJTA 2DHZA 4LCDE 2V3SA 2DZMA 2HD5B 3HIZA 3M3JA 1C3TA 3DOWA 3VH3B 2N1VA 3RYTA 3PV1A 3DBRI 5D7GA 1YX5B 3ZDTA 2HJ8A 2LVPA 3ZDMC 3WALA 2GBKA 1CMXB 3TCAA 5J2RA 5AZGA 4AUQC 2L0FA 3UQAA 1H8CA 1WH3A 5IAAC 2J0JA 5L83A 2IYDB 1EF5A 2KDIA 3SD5A 2K8BA 3QQ8B 2LASA 4W9KA 2L05A 3UQBA 2FIDA 2N4FA 1E8XA 1Z5SB 2FCSA 2MBHA 3JSVA 4GDLB 2DYMA 1KOTA 1JRUA 3R66C 4MDKE 4BKSA 2YLMA 4DBGA 2LRUA 4I6LB 4LJOB 3ZTDA 4NAWA 4GSWA 4WJPA 4KIKB 2ZPNA 3V6CB 2AL6A 4FBJB 1BT0A 2MW5A 2MP2A 5HKHA 2LVQA 2J0MA 2R2OA 3QJZA 3TL5A 2C5LC 3PHWB 3NHEB 3CF6E 2WWZA 4MEMA 4ZDVA 2LJ5A 2MSED 4TV3A 2JPHA 3M95A 4WWOA 4LDTB 3OAWA 1J8CA 4IC7B 2KXJA 4MSQB 2CU1A 5CHVC 1EO6A 3PTFC 3AU5A 2UWQA 3DBHI 2R2QA 2QHOA 2CS4A 3KUCB 2NR2A 1WFYA 3DBLI 4CHKA 1RFAA 5KHOA 3KUDB 3L10B 2L3ZA 5DCNA 4A20A 4DHZE 2DAJA 3PRPB 1GG3A 2IO0B 3AULA 4HWIB 4KDIC 4B9KA 4BKGA 2KJ6A 2D10A 2LXCA 3OJ4B 3O65B 2RR9A 3LDZE 1WXSA 2KFJA 5JH5C 3RT3B 2GBRA 2ZNVC 1OGWA 3CSFA 3EECA 4W9GA 1D3ZA 4W9LA 4I6PA 4LDTD 3BY4B 1EF1A 2J7QB 4KV2A 3A9KA 4FJVB 2NCNA 3QARA 3ZNHB 1I42A 5KHQA 2LGYA 5LXIB 2KD0A 4DHJB 2WX0A 3AI5A 3L13A 1M94A 1WX9A 2WDTB 4WWNA 4IG7B 1WX8A 3PRMB 1ZW7A 1WM2A 3ALBA 1WMHA 3MHSD 2EMTA 4NJ7A 1WYWB 3PT2B 3APCA 4GU2A 5E6PA 2I1KA 2L7RA 2XK5A 4MSMB 3DQVA 1R4MI 3IVFA 1V80A 1WXAA 2D3GA 2REXA 4FHJA 3NY5A 3ML9A 2V4LA 4EEWA 2A4ZA 5IA7A 4EKUA 2FNJB 4I6NB 2KDFB 4MJSB 4MGKE 2K6DB 1OEYA 3I3TB 1C1YB 3QHTA 4KSKC 4XX5A 4E71A 2DZKA 3ZRFA 3UIPB 1UH6A 4FADA 1LM8B 2XEWA 2MCNB 3IFWB 3H7SA 4DHJD 3UF8A 3H7PA 1V5TA 3JVZX 2KC2A 3B08A 2MBEA 2NPTA 4WAAA 5FR6A 3VVWB 4AJYB 3RUIB 4P7IA 2KHWB 3JSVB 3W1SA 2NS5A 1IYFA 2DX5B 4HLEA 1VD2A 3ML8A 4F7ZA 3DVNU 3CSTA 4BOZB 1WIAA 1L7YA 4BBNC 3PRZA 1V6EA 1WGGA 2JWZA 2NBWB 3QK0A 4RM9A 3SHQA 3OJ3A 2JRHA 4WQOB 3TIXA 2MP2B 4IWQA 2JF5A 3VHTC 4JIOU 3ECIA 3L54A 1YQBA 4GIVA 4W9CA 5GMVA 1VCBA 4W9FA 3TBLD 3NZSA 2O2VA 3L17A 2A5UA 3KYCD 4W9HA 2G3QB 2O6VB 2NVUI 1OTRB 3QIJA 2DENB 3ZNZB 2JY6A 1UD7A 4ANWA 3DPDA 2Z59B 2N7EA 3KUZA 2Z0EB 2IY0B 4IWPA 2M1MA 1WJ6A 2MRPA 3WAOA 1GJZA 4M0WB 1NDDA 1TTNA 1XQQA 1FXTB 2LRWA 4B6WA 5LLIA 2XBBC 2W9NA 2K8HA 2BWES 4FHKA 1LFDA 1ZKHA 3X0WA 2KX3A 3APDA 1Z2MA 4FN2A 2JRIB 2FAZA 5CHFA 3W1SC 3H1UA 2ASQA 1GNUA 3PVLA 4MGYE 2AL3A 2BYVE 3X23A 3JYUA 4AWJA 4BKTA 1WGRA 1V9JA 4RM8A 3VAWA 4M8NA 2O6VD 2KZRA 3ONSA 3VH4B 3IHPC 1P1AA 1Q0WB 4KSLC 2G4SA 1K8RB 4HK2A 3NS8A 2ZZPB 1EUVB 3P2BA 2L8JA 3PPAA 3HHMA 3GZNI 2KJHB 1ZGUB 4XZ4A 3VUXA 2KJRA 2FCQA 1SE9A 1IPGA 2C7HA 2KQ7A 2JT4B 3A1QA 1WMHB 3VQIA 2LD9A 2IBIB 2BKRB 2KO3A 2KQSA 1WR6E 2C60A 2IY1B 2KKCA 4M8MA 4DHZB 4ASWC 1E8ZA 1WJ4A 3VTWA 4WJNA 1UBIA 4GN1A 2M17A 2FCMA 2VRRB 5E6OA 2N9XA 2XK5B 2KVRA 3IG3A 4ANUA 5AEKB 3HM3A 3C0RB 2KTRB 5DPWA 2KC1A 5EDSA 4G11A 1WJUA 1V86A 4JGHB 3U7DA 5DPRA 1UBQA 4K1RB 5CHWA 1Q1OA 4DXAB 3IBEA 3U30A 4PS8A 2D2QA 4EUTA 3VUYA 2M8SA 4GGQA 1UZXB 3EFUA 3H7PB 2ZVNA 4HDOA 5CTRC 3APFA 4K7UA 3DVGX 2GMIC 3VUWA 3QX1A 2KFKA 2V1YA 2BWFA 4B95A 3A4SC 3UIOB 2JZ3B 2LGXA 3ENEA 5D2MB 3SDLC 3WAMA 4FLHA 1WGHA 2MLBA 1H4RA 4WJOA 3N30A 3QA8A 2CR5A 2KDBA 2KTFA 4ZYNA 4KZ0A 5JHBA 4A3PA 1A5RA 2KK8A 3PLVA 4W9EA 2PE9A 4FJYA 3BINA 3EC8A 1P3QU 3VXWA 2M0XA 3ZIMA 2MBQA 3ZTCA 1IP9A 2O2VB 3HM6X 2LI5A 2L0TA 2PE6B 4G3XB 4GDKA 4K7WA 4JQWC 3VDZA 1S1QB 5DPSA 4IM0A 1WE6A 4OVVA 3ZKJC 2RD0A 2MQJA 3A9JA 4GMVA 3ZNGC 5JHAA 1WE7A 4MM3A 3QAQA 4X57B 1V2YA 1S3SG 4W9DA 3LJ3A 2NBVB 1V81A 4EOYA 2MBOA 2ZJDA 2RGFA 2K25A 4TUUA 2FCNA 5AZHA 3H6NA 1WGYA 2B3AA 4HPLB 3WAPA 3V61A 3V6EB 2RSUA 1YIWA 3M62B 4JL9A 3T8MA 3UINB 3Q3JA 4AP4C 2K1FA 4N9F4 4NAWB 3PLUA 1V49A 2ZNVB 3N32A 2IZVB 3AU4A 5E6NA 2DZIA 4PYZA 3R7QA 1X1MA 5C1ZA 3N3KB 2GBNA 2CHXA 2LWPA 3HK0A 4BOSC 4E74A 4DK5A 3JW0X 4DWFA 1WRDB 2KX0A 1F9JA 3WANA 1TGZB 2LVOA 2K39A 1SGHA 3GOEA 3KVFB 4ANXA 3R3MA 1WJNA 4IWOA 4HCNB 3A1QB 2KLGA 1I35A 3ZO5B 1UGMA 2ZEQA 1P98A 1WR1A 1YJ1A 2D11A 3MTNB 4HCPB 3R7RA 4MGZE 2N1WA 1RLFA 2JVCA 3B1LX 3UGBB 5C23A 4GB9A 2FUHB 4BKSD 4LJPB 2N9EB 2N7DA 2JUOA 1R4NI 1XT9B 3S2AA 1WY8A 4NY0A 4XC2A 2GOWA 2KNBA 3TJPA 2JZZA 2KMCA 1J0GA 3MJWA 4MJSA 4IW0A 3WA0A 1KLVA 2ZCCA 3NZUA 1G6JA 1WI0A 2DZJA 2G4DB 2KLCA 4AJWA 4TQ1A 4ANVA 1E5WA 3A4RA 5J18A 3PSEB 2I1JA 3KH0A 1LXDA 3A9KB 3TMPB 3DDCB 2AWTA 3RZWC 1TZ1A 3U8ZA 3PZDA 2KFKB 2YVCA 2PEAA 2PJHA 4HDQA 4NJ6A 2IO3B 1NI2A 1V5OA 3H9DA 4TKNA 4G0NB 4YL8A 4CYEA 3L16A 1GC6A 5D94A 3RCZA 2KDEB 4BBNF 4HXDA 3T9LA 2NBUA 5AZFA 4K7SA 3W1YA 5TR5A 3ZVVA 4PYUA 3V60A 2KMAA 4II3B 5G2NA 1ISNA 1HE8A 2DAFA 3ZW3A 1NBFC 2OOBB 1WX7A 1Y8RC 4IM3A 4GDKB 1E7VA 1P0RA 3ZLZA 3Q3FA 2LXAA 1WXMA 1WF9A 2O6VA 2C7NB 3NOBA 1PQSA 3DBSA 4G50A 2AYOB 2C9WB 2KN5A 2KWUB 2BKFA 1YX6B 2D07B 4KZCA 4ZRIA 4A3OA 2LUEA 4CO7A 1L2NA 2KWCA 3A9JB 4AOFA 1OEYJ 1UELA 4EZJA 1RRBA 1E8WA 3K9PB 1E7UA 2J0KA 2NPTB 4KDLB 1P9DU 3M63B 2BGFA 4JLCA 3L08A 2MBBB 1WGDA 3QC8B 4W9IA 4PS7A 2K8CA 4GDLA 2M4NA 4HVBA 2UYZB 5BO4B 4OVUA 3B0AA 2DYOA 4F8CB 4ZRJA 1XD3B 2FIFA 2KWVB 2L76A 2WYQA 4NPNA 2LGDA 4KIKA 4MGIE 2RPQA 3RZFA 4ICVA 3AXCA 2ZVOA 2BYFA 4WWPA 4E3CA 1MG8A 3A33B 3CMMB 2MA9B 3OLMD 2AEHA 4EZKA 2CHZA 1AARA 3VTVA 3L0WB 3D32A 4F1SA 4GXBA 1T0YA 4GOCA 4RMAA 5JZEB 3K9OB 2Y5BB 4HJKA 1LQBA 4DDGD 2CKHB 5D6JB 4IUMB 4HPMB 4DDID 4EFOA 2IO2B 4PS3A 2EKEC 4WJQA 4K81A 4W9JA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5J17 A;  1WXV A;  2PPH A;  4NQL B;  4ZRK A;  4MEL A;  1Q5W B;  1U4A A;  4MH0 E;  1GUA B;  1YD8 U;  3V62 A;  4J6I A;  3ZUN A;  1RAX A;  2C7M B;  5DPT A;  2EMS A;  3DCG A;  2LZ6 A;  2DYB A;  4NNJ B;  3PHX B;  1OQY A;  3SU8 X;  2K6Q A;  2KTR A;  2GBJ A;  3KYD D;  1GC7 A;  4II2 B;  1SIF A;  2ZPY A;  2GBM A;  2BPS A;  3DVG Y;  3WIM A;  2HE7 A;  2CHW A;  3QWZ B;  2G45 B;  5CX3 A;  1J19 A;  3VTU A;  4FA6 A;  2MWS B;  2KAN A;  2Z0D B;  1QZE A;  3ZRC A;  4BFR A;  3DVN V;  4URK A;  4TQ0 A;  2KOX A;  5LXH A;  2WX1 A;  4FUL A;  4BVU C;  3RUL A;  1TBE A;  1WM3 A;  2BYE A;  4ICU A;  3QCA A;  4IM2 A;  4FJZ A;  3VFK A;  3KW5 B;  3PGE A;  1E90 A;  1WZ0 A;  2IO1 B;  2MX2 A;  3ZNI D;  1WZ3 A;  2HTH A;  2OJR A;  2N9P C;  4KVG B;  1E8Y A;  3PRE A;  4EZL A;  3RD2 A;  2ZCB A;  3EHV A;  5G55 A;  1KM7 A;  2JXX A;  5L95 C;  4NQK E;  2L00 B;  2BF8 B;  3PS6 A;  1KJT A;  2DHZ A;  4LCD E;  2V3S A;  2DZM A;  2HD5 B;  3HIZ A;  3M3J A;  1C3T A;  3DOW A;  3VH3 B;  2N1V A;  3RYT A;  3PV1 A;  3DBR I;  5D7G A;  1YX5 B;  3ZDT A;  2HJ8 A;  2LVP A;  3ZDM C;  3WAL A;  2GBK A;  1CMX B;  3TCA A;  5J2R A;  5AZG A;  4AUQ C;  2L0F A;  3UQA A;  1H8C A;  1WH3 A;  5IAA C;  2J0J A;  5L83 A;  2IYD B;  1EF5 A;  2KDI A;  3SD5 A;  2K8B A;  3QQ8 B;  2LAS A;  4W9K A;  2L05 A;  3UQB A;  2FID A;  2N4F A;  1E8X A;  1Z5S B;  2FCS A;  2MBH A;  3JSV A;  4GDL B;  2DYM A;  1KOT A;  1JRU A;  3R66 C;  4MDK E;  4BKS A;  2YLM A;  4DBG A;  2LRU A;  4I6L B;  4LJO B;  3ZTD A;  4NAW A;  4GSW A;  4WJP A;  4KIK B;  2ZPN A;  3V6C B;  2AL6 A;  4FBJ B;  1BT0 A;  2MW5 A;  2MP2 A;  5HKH A;  2LVQ A;  2J0M A;  2R2O A;  3QJZ A;  3TL5 A;  2C5L C;  3PHW B;  3NHE B;  3CF6 E;  2WWZ A;  4MEM A;  4ZDV A;  2LJ5 A;  2MSE D;  4TV3 A;  2JPH A;  3M95 A;  4WWO A;  4LDT B;  3OAW A;  1J8C A;  4IC7 B;  2KXJ A;  4MSQ B;  2CU1 A;  5CHV C;  1EO6 A;  3PTF C;  3AU5 A;  2UWQ A;  3DBH I;  2R2Q A;  2QHO A;  2CS4 A;  3KUC B;  2NR2 A;  1WFY A;  3DBL I;  4CHK A;  1RFA A;  5KHO A;  3KUD B;  3L10 B;  2L3Z A;  5DCN A;  4A20 A;  4DHZ E;  2DAJ A;  3PRP B;  1GG3 A;  2IO0 B;  3AUL A;  4HWI B;  4KDI C;  4B9K A;  4BKG A;  2KJ6 A;  2D10 A;  2LXC A;  3OJ4 B;  3O65 B;  2RR9 A;  3LDZ E;  1WXS A;  2KFJ A;  5JH5 C;  3RT3 B;  2GBR A;  2ZNV C;  1OGW A;  3CSF A;  3EEC A;  4W9G A;  1D3Z A;  4W9L A;  4I6P A;  4LDT D;  3BY4 B;  1EF1 A;  2J7Q B;  4KV2 A;  3A9K A;  4FJV B;  2NCN A;  3QAR A;  3ZNH B;  1I42 A;  5KHQ A;  2LGY A;  5LXI B;  2KD0 A;  4DHJ B;  2WX0 A;  3AI5 A;  3L13 A;  1M94 A;  1WX9 A;  2WDT B;  4WWN A;  4IG7 B;  1WX8 A;  3PRM B;  1ZW7 A;  1WM2 A;  3ALB A;  1WMH A;  3MHS D;  2EMT A;  4NJ7 A;  1WYW B;  3PT2 B;  3APC A;  4GU2 A;  5E6P A;  2I1K A;  2L7R A;  2XK5 A;  4MSM B;  3DQV A;  1R4M I;  3IVF A;  1V80 A;  1WXA A;  2D3G A;  2REX A;  4FHJ A;  3NY5 A;  3ML9 A;  2V4L A;  4EEW A;  2A4Z A;  5IA7 A;  4EKU A;  2FNJ B;  4I6N B;  2KDF B;  4MJS B;  4MGK E;  2K6D B;  1OEY A;  3I3T B;  1C1Y B;  3QHT A;  4KSK C;  4XX5 A;  4E71 A;  2DZK A;  3ZRF A;  3UIP B;  1UH6 A;  4FAD A;  1LM8 B;  2XEW A;  2MCN B;  3IFW B;  3H7S A;  4DHJ D;  3UF8 A;  3H7P A;  1V5T A;  3JVZ X;  2KC2 A;  3B08 A;  2MBE A;  2NPT A;  4WAA A;  5FR6 A;  3VVW B;  4AJY B;  3RUI B;  4P7I A;  2KHW B;  3JSV B;  3W1S A;  2NS5 A;  1IYF A;  2DX5 B;  4HLE A;  1VD2 A;  3ML8 A;  4F7Z A;  3DVN U;  3CST A;  4BOZ B;  1WIA A;  1L7Y A;  4BBN C;  3PRZ A;  1V6E A;  1WGG A;  2JWZ A;  2NBW B;  3QK0 A;  4RM9 A;  3SHQ A;  3OJ3 A;  2JRH A;  4WQO B;  3TIX A;  2MP2 B;  4IWQ A;  2JF5 A;  3VHT C;  4JIO U;  3ECI A;  3L54 A;  1YQB A;  4GIV A;  4W9C A;  5GMV A;  1VCB A;  4W9F A;  3TBL D;  3NZS A;  2O2V A;  3L17 A;  2A5U A;  3KYC D;  4W9H A;  2G3Q B;  2O6V B;  2NVU I;  1OTR B;  3QIJ A;  2DEN B;  3ZNZ B;  2JY6 A;  1UD7 A;  4ANW A;  3DPD A;  2Z59 B;  2N7E A;  3KUZ A;  2Z0E B;  2IY0 B;  4IWP A;  2M1M A;  1WJ6 A;  2MRP A;  3WAO A;  1GJZ A;  4M0W B;  1NDD A;  1TTN A;  1XQQ A;  1FXT B;  2LRW A;  4B6W A;  5LLI A;  2XBB C;  2W9N A;  2K8H A;  2BWE S;  4FHK A;  1LFD A;  1ZKH A;  3X0W A;  2KX3 A;  3APD A;  1Z2M A;  4FN2 A;  2JRI B;  2FAZ A;  5CHF A;  3W1S C;  3H1U A;  2ASQ A;  1GNU A;  3PVL A;  4MGY E;  2AL3 A;  2BYV E;  3X23 A;  3JYU A;  4AWJ A;  4BKT A;  1WGR A;  1V9J A;  4RM8 A;  3VAW A;  4M8N A;  2O6V D;  2KZR A;  3ONS A;  3VH4 B;  3IHP C;  1P1A A;  1Q0W B;  4KSL C;  2G4S A;  1K8R B;  4HK2 A;  3NS8 A;  2ZZP B;  1EUV B;  3P2B A;  2L8J A;  3PPA A;  3HHM A;  3GZN I;  2KJH B;  1ZGU B;  4XZ4 A;  3VUX A;  2KJR A;  2FCQ A;  1SE9 A;  1IPG A;  2C7H A;  2KQ7 A;  2JT4 B;  3A1Q A;  1WMH B;  3VQI A;  2LD9 A;  2IBI B;  2BKR B;  2KO3 A;  2KQS A;  1WR6 E;  2C60 A;  2IY1 B;  2KKC A;  4M8M A;  4DHZ B;  4ASW C;  1E8Z A;  1WJ4 A;  3VTW A;  4WJN A;  1UBI A;  4GN1 A;  2M17 A;  2FCM A;  2VRR B;  5E6O A;  2N9X A;  2XK5 B;  2KVR A;  3IG3 A;  4ANU A;  5AEK B;  3HM3 A;  3C0R B;  2KTR B;  5DPW A;  2KC1 A;  5EDS A;  4G11 A;  1WJU A;  1V86 A;  4JGH B;  3U7D A;  5DPR A;  1UBQ A;  4K1R B;  5CHW A;  1Q1O A;  4DXA B;  3IBE A;  3U30 A;  4PS8 A;  2D2Q A;  4EUT A;  3VUY A;  2M8S A;  4GGQ A;  1UZX B;  3EFU A;  3H7P B;  2ZVN A;  4HDO A;  5CTR C;  3APF A;  4K7U A;  3DVG X;  2GMI C;  3VUW A;  3QX1 A;  2KFK A;  2V1Y A;  2BWF A;  4B95 A;  3A4S C;  3UIO B;  2JZ3 B;  2LGX A;  3ENE A;  5D2M B;  3SDL C;  3WAM A;  4FLH A;  1WGH A;  2MLB A;  1H4R A;  4WJO A;  3N30 A;  3QA8 A;  2CR5 A;  2KDB A;  2KTF A;  4ZYN A;  4KZ0 A;  5JHB A;  4A3P A;  1A5R A;  2KK8 A;  3PLV A;  4W9E A;  2PE9 A;  4FJY A;  3BIN A;  3EC8 A;  1P3Q U;  3VXW A;  2M0X A;  3ZIM A;  2MBQ A;  3ZTC A;  1IP9 A;  2O2V B;  3HM6 X;  2LI5 A;  2L0T A;  2PE6 B;  4G3X B;  4GDK A;  4K7W A;  4JQW C;  3VDZ A;  1S1Q B;  5DPS A;  4IM0 A;  1WE6 A;  4OVV A;  3ZKJ C;  2RD0 A;  2MQJ A;  3A9J A;  4GMV A;  3ZNG C;  5JHA A;  1WE7 A;  4MM3 A;  3QAQ A;  4X57 B;  1V2Y A;  1S3S G;  4W9D A;  3LJ3 A;  2NBV B;  1V81 A;  4EOY A;  2MBO A;  2ZJD A;  2RGF A;  2K25 A;  4TUU A;  2FCN A;  5AZH A;  3H6N A;  1WGY A;  2B3A A;  4HPL B;  3WAP A;  3V61 A;  3V6E B;  2RSU A;  1YIW A;  3M62 B;  4JL9 A;  3T8M A;  3UIN B;  3Q3J A;  4AP4 C;  2K1F A;  4N9F 4;  4NAW B;  3PLU A;  1V49 A;  2ZNV B;  3N32 A;  2IZV B;  3AU4 A;  5E6N A;  2DZI A;  4PYZ A;  3R7Q A;  1X1M A;  5C1Z A;  3N3K B;  2GBN A;  2CHX A;  2LWP A;  3HK0 A;  4BOS C;  4E74 A;  4DK5 A;  3JW0 X;  4DWF A;  1WRD B;  2KX0 A;  1F9J A;  3WAN A;  1TGZ B;  2LVO A;  2K39 A;  1SGH A;  3GOE A;  3KVF B;  4ANX A;  3R3M A;  1WJN A;  4IWO A;  4HCN B;  3A1Q B;  2KLG A;  1I35 A;  3ZO5 B;  1UGM A;  2ZEQ A;  1P98 A;  1WR1 A;  1YJ1 A;  2D11 A;  3MTN B;  4HCP B;  3R7R A;  4MGZ E;  2N1W A;  1RLF A;  2JVC A;  3B1L X;  3UGB B;  5C23 A;  4GB9 A;  2FUH B;  4BKS D;  4LJP B;  2N9E B;  2N7D A;  2JUO A;  1R4N I;  1XT9 B;  3S2A A;  1WY8 A;  4NY0 A;  4XC2 A;  2GOW A;  2KNB A;  3TJP A;  2JZZ A;  2KMC A;  1J0G A;  3MJW A;  4MJS A;  4IW0 A;  3WA0 A;  1KLV A;  2ZCC A;  3NZU A;  1G6J A;  1WI0 A;  2DZJ A;  2G4D B;  2KLC A;  4AJW A;  4TQ1 A;  4ANV A;  1E5W A;  3A4R A;  5J18 A;  3PSE B;  2I1J A;  3KH0 A;  1LXD A;  3A9K B;  3TMP B;  3DDC B;  2AWT A;  3RZW C;  1TZ1 A;  3U8Z A;  3PZD A;  2KFK B;  2YVC A;  2PEA A;  2PJH A;  4HDQ A;  4NJ6 A;  2IO3 B;  1NI2 A;  1V5O A;  3H9D A;  4TKN A;  4G0N B;  4YL8 A;  4CYE A;  3L16 A;  1GC6 A;  5D94 A;  3RCZ A;  2KDE B;  4BBN F;  4HXD A;  3T9L A;  2NBU A;  5AZF A;  4K7S A;  3W1Y A;  5TR5 A;  3ZVV A;  4PYU A;  3V60 A;  2KMA A;  4II3 B;  5G2N A;  1ISN A;  1HE8 A;  2DAF A;  3ZW3 A;  1NBF C;  2OOB B;  1WX7 A;  1Y8R C;  4IM3 A;  4GDK B;  1E7V A;  1P0R A;  3ZLZ A;  3Q3F A;  2LXA A;  1WXM A;  1WF9 A;  2O6V A;  2C7N B;  3NOB A;  1PQS A;  3DBS A;  4G50 A;  2AYO B;  2C9W B;  2KN5 A;  2KWU B;  2BKF A;  1YX6 B;  2D07 B;  4KZC A;  4ZRI A;  4A3O A;  2LUE A;  4CO7 A;  1L2N A;  2KWC A;  3A9J B;  4AOF A;  1OEY J;  1UEL A;  4EZJ A;  1RRB A;  1E8W A;  3K9P B;  1E7U A;  2J0K A;  2NPT B;  4KDL B;  1P9D U;  3M63 B;  2BGF A;  4JLC A;  3L08 A;  2MBB B;  1WGD A;  3QC8 B;  4W9I A;  4PS7 A;  2K8C A;  4GDL A;  2M4N A;  4HVB A;  2UYZ B;  5BO4 B;  4OVU A;  3B0A A;  2DYO A;  4F8C B;  4ZRJ A;  1XD3 B;  2FIF A;  2KWV B;  2L76 A;  2WYQ A;  4NPN A;  2LGD A;  4KIK A;  4MGI E;  2RPQ A;  3RZF A;  4ICV A;  3AXC A;  2ZVO A;  2BYF A;  4WWP A;  4E3C A;  1MG8 A;  3A33 B;  3CMM B;  2MA9 B;  3OLM D;  2AEH A;  4EZK A;  2CHZ A;  1AAR A;  3VTV A;  3L0W B;  3D32 A;  4F1S A;  4GXB A;  1T0Y A;  4GOC A;  4RMA A;  5JZE B;  3K9O B;  2Y5B B;  4HJK A;  1LQB A;  4DDG D;  2CKH B;  5D6J B;  4IUM B;  4HPM B;  4DDI D;  4EFO A;  2IO2 B;  4PS3 A;  2EKE C;  4WJQ A;  4K81 A;  4W9J A; 
#chains in the Genus database with same CATH topology
 5J17 A;  1DOY A;  4RGN A;  1U4A A;  2K3U A;  3GE8 C;  3ZUN A;  3ZXR A;  3E56 A;  1CK1 A;  2BYT A;  3PHX B;  3DBL B;  3Q8B A;  1GC7 A;  3FAH A;  4II2 B;  1HTQ A;  3P4S B;  1BUI C;  2CHW A;  1WGK A;  4TSS A;  2N9K A;  2MWS B;  2ON8 A;  2Z0D B;  4BFR A;  4URK A;  1NYR A;  2KOX A;  4BVU C;  2BYE A;  1I4Q A;  4ICU A;  3VFK A;  1WZ0 A;  4KX6 B;  5MPO A;  2HTH A;  3P42 A;  2Y5P A;  4KKI A;  3PRE A;  4EZL A;  2WDQ B;  4ITK A;  4L2Y A;  2L32 A;  2DHZ A;  2DZM A;  3HIZ A;  1C3T A;  3RYT A;  3PV1 A;  3DBR I;  1IGC A;  3ZDM C;  2KWD A;  5J2R A;  4AUQ C;  3UQA A;  2J0J A;  2IYD B;  3ETR A;  3UQB A;  1IBX B;  1E8X A;  1JRU A;  2LRU A;  3AB5 A;  5AUK A;  4LJO B;  2MW5 A;  1FNU A;  1ZXH A;  3TL5 A;  4RCO A;  1A70 A;  2DBY A;  4CQN A;  2J53 A;  2V9H A;  3MHZ A;  1T0R C;  3NHE B;  3CF6 E;  1M4V A;  4WWO A;  2KDM A;  1J8C A;  4IC7 B;  2RMM A;  5CHV C;  3PTF C;  3RFZ B;  4WWM A;  1N6Z A;  2CS4 A;  3DBL I;  5IKC M;  4A20 A;  1GG3 A;  4KDI C;  4BKG A;  1I4X A;  3BYT B;  4W9L A;  4I6P A;  1WWT A;  2WP9 B;  2J7Q B;  4LDT D;  4P16 A;  5EE0 A;  2VZK D;  3QAR A;  5KHQ A;  2K0P A;  1C77 A;  5LXI B;  3L13 A;  2WDT B;  5JXV A;  1WM2 A;  3GZN B;  1UF0 A;  3RI7 C;  4NJ7 A;  2EMT A;  1SJH D;  1MFW A;  2XK5 A;  5BMH A;  3DQV A;  1I4R A;  5IN7 A;  3NY5 A;  3ML9 A;  1JWU D;  4LLG M;  1F0Z A;  4MGK E;  1OEY A;  3QHT A;  4E71 A;  2DZK A;  3Q3N C;  1N62 A;  2WHI A;  2Q5W D;  1XLP A;  2MBE A;  5FR6 A;  4AJY B;  1RM6 C;  3JSV B;  1FXA A;  2BT6 A;  3W1S A;  2KMM A;  1T6B X;  3AH7 A;  4F7Z A;  3CST A;  4BOZ B;  3PRZ A;  4RM9 A;  3QK0 A;  1C9F A;  3L54 A;  4W9C A;  3P4R B;  5GMV A;  1VCB A;  1HZ5 A;  3NZS A;  1QOF A;  2YEP F;  3KYC D;  1HTO A;  4W9H A;  4HRO A;  1OTR B;  3QIJ A;  2DEN B;  4XE0 A;  1UD7 A;  1TT5 B;  4ANW A;  2QEJ C;  2PTL A;  3DHI C;  3KWL A;  2X38 A;  1YN3 A;  2BWE S;  4FHK A;  4A55 A;  4P1B C;  5H8Y E;  2FAZ A;  3H1U A;  2ASQ A;  2BYV E;  4BKT A;  4HPP A;  4M8N A;  3ONS A;  3VH4 B;  3Q8F A;  1EUV B;  2L8J A;  3GZN I;  1ZGU B;  2FCQ A;  3ZJV A;  2KQ7 A;  1QOG A;  4JWU C;  4RGO S;  1WMH B;  1MHX A;  2OED A;  2IY1 B;  2KKC A;  1WJ4 A;  2M17 A;  2FCM A;  4ANU A;  3NVZ A;  1EM7 A;  2KTR B;  5EDS A;  3U7D A;  1D6E C;  4RGM A;  1E0Z A;  4DXA B;  1PGB A;  2WDR B;  4PS8 A;  2D2Q A;  1VZ8 A;  4XYC A;  2M8S A;  2WXJ A;  2RPV A;  3APF A;  2BTE A;  2CU3 A;  2GMI C;  2V1Y A;  2SAK A;  3A4S C;  2BW2 A;  3UIO B;  4FLH A;  1DYQ A;  1UGJ A;  3QA8 A;  2CR5 A;  2KTF A;  4ZYN A;  4W9E A;  1TY0 A;  1C78 A;  1IP9 A;  2O2V B;  2LI5 A;  2PE6 B;  4JQW C;  3VDZ A;  1JAL A;  3ZKJ C;  3VR8 B;  2RD0 A;  3ZNG C;  3IT6 B;  1WE7 A;  1PYW D;  3QAQ A;  3ZQ4 A;  4XDD A;  2MBO A;  2LHE A;  2K25 A;  2B3A A;  1YIW A;  3T8M A;  2K1F A;  3T3O A;  2M56 B;  4N9F 4;  4NAW B;  3PLU A;  4ARI A;  3AU4 A;  3EGR A;  3R7Q A;  3U2S C;  4C7Z A;  4DK5 A;  4DWF A;  4WQM A;  2B76 B;  2KX0 A;  3OG5 A;  1TGZ B;  1SGH A;  4L1B A;  3Q3O C;  3R3M A;  2FE8 A;  3NRZ A;  1UGM A;  1XLO A;  1P98 A;  1YJ1 A;  3AED B;  5D3I B;  1FPY A;  4MGZ E;  3UGB B;  4BKS D;  1R7S A;  2H89 B;  3H8H A;  4XC2 A;  1V1P B;  3WA0 A;  3RNG C;  1G6J A;  1XEE A;  1WI0 A;  3ZXV A;  4IDI A;  2I1J A;  1Q10 A;  2LEK A;  3DHH C;  3U8Z A;  2KFK B;  2YVC A;  1NI2 A;  4YL8 A;  3C8Y A;  3VRA B;  3CIR B;  4CYE A;  3KLS X;  1N63 A;  2ZW1 A;  5BMI A;  5TR5 A;  3ZVV A;  1V1O A;  3ZYY X;  4YSY B;  2N0S B;  2KMA A;  4II3 B;  5G2N A;  2QC8 A;  3V60 A;  3ZW3 A;  3AE8 B;  3J9C A;  1WX7 A;  3B2F A;  4GDK B;  1N61 A;  2W55 A;  3Q3F A;  1WXM A;  4O1N A;  1MJD A;  1PQS A;  4G50 A;  2INN E;  4MT5 A;  2KVZ A;  4LNF A;  2C9W B;  2KN5 A;  2KWU B;  2BKF A;  4US8 A;  1YX6 B;  4A3O A;  4ZRI A;  4CO7 A;  1L2N A;  3A9J B;  4BAX A;  2LUM A;  3K9P B;  4KDL B;  2KT7 A;  4M0W A;  4B0E A;  1P9D U;  3M63 B;  4C4V B;  1JWA D;  2MBB B;  2JWU A;  2LFI A;  4PS7 A;  2M4N A;  2GLS A;  4K3C A;  4OVU A;  4S0R A;  3NG0 A;  2FIF A;  4MGI E;  3AXC A;  1MG8 A;  2MA9 B;  3OLM D;  2CHZ A;  1AAR A;  1FCC C;  4HJK A;  1LQB A;  3KQ4 A;  4HPM B;  1XF5 L;  1FO4 A;  2PPH A;  4JE3 B;  1N60 A;  3V62 A;  1BML C;  1RAX A;  5HI1 A;  1TS3 A;  2K6Q A;  2IDY A;  1PGX A;  2ZPY A;  1C76 A;  2GBM A;  2BPS A;  3DVG Y;  2WS3 B;  3QWZ B;  3I5J C;  1ENF A;  1QZE A;  3DVN V;  2LGI A;  2WX1 A;  4FUL A;  3RUL A;  1WM3 A;  3PGE A;  2IO1 B;  2PLP A;  1CZP A;  2MX2 A;  1WZ3 A;  1ZUD 2;  2OJR A;  2ZCB A;  1ZXI A;  2WU5 B;  5C2T B;  5L95 C;  4ZYS A;  4RFB A;  3EUB 2;  3MP9 A;  2V3S A;  2HD5 B;  3VH3 B;  4DQO C;  3Q69 A;  3ZDT A;  1ET9 A;  3HRD D;  5HG2 A;  1CMX B;  4C7Y A;  1H8C A;  4YSZ B;  4W9K A;  2L05 A;  1Z5S B;  2MBH A;  3NJT A;  3AEE B;  3WCQ A;  3R66 C;  4BKS A;  4DBG A;  1CJE A;  1FMA D;  1UUP A;  3ZTD A;  3Q3M C;  4C80 A;  2PVO D;  2ZPN A;  2XN9 C;  4FBJ B;  5LNK 1;  1ESF A;  4YTP B;  5HKH A;  4A6Q A;  2R2O A;  2J0M A;  3FIL B;  2C5L C;  3Q8E A;  1FFU A;  2I38 A;  2WWZ A;  4FXC A;  2LJ5 A;  2MSE D;  4TV3 A;  2JPH A;  1STE A;  3NS1 A;  1SF0 A;  1LGR A;  3URY A;  3C19 A;  1JQ4 A;  2CU1 A;  3FKY A;  2UWQ A;  2DWQ A;  4MM3 B;  1AYF A;  2QMT A;  2QHO A;  3KUC B;  3KUD B;  3L10 B;  2L3Z A;  3N20 C;  4DHZ E;  2KAJ A;  1WYG A;  2KJ6 A;  2D10 A;  3OJ4 B;  2RR9 A;  1WXS A;  2KFJ A;  1TKY A;  1OGW A;  4W9G A;  4S17 A;  3BVM A;  5BYR A;  4C56 C;  1TKE A;  2WU2 B;  1SBB B;  1WX8 A;  3PRM B;  3MHS D;  3PZ8 A;  1C4C A;  4EEW A;  1V80 A;  2D3G A;  2REX A;  2A4Z A;  3Q6B A;  2BB6 A;  4I6N B;  1C1Y B;  2KAC A;  4XX5 A;  1Y56 A;  3HUI A;  1DOX A;  1LM8 B;  2XEW A;  2MCN B;  3IFW B;  2IGD A;  4A90 A;  3UF8 A;  3H7P A;  3BVZ A;  1JML A;  2KC2 A;  3B08 A;  2NPT A;  4DXG A;  2W54 A;  2DX5 B;  3DVN U;  1L7Y A;  5H92 C;  4BBN C;  3SHQ A;  1D5M C;  3OJ3 A;  4PK1 A;  2JRH A;  4IWQ A;  3VHT C;  4JIO U;  1YQB A;  4W9F A;  3TBL D;  2MJE A;  3L17 A;  4HKZ E;  3ZNZ B;  3AEB B;  2Z59 B;  2N7E A;  3KUZ A;  2Z0E B;  2IY0 B;  4IWP A;  2WNM A;  2TSS A;  2M1M A;  1MHH E;  4REZ A;  2D3B A;  2MRP A;  1GJZ A;  3IXS A;  1TTN A;  1XQQ A;  4B6W A;  1FXT B;  1Z2M A;  2JRI B;  5IOI A;  3W5U B;  1GNU A;  4MGY E;  1UNS A;  2M19 A;  2MH7 A;  3X23 A;  4AWJ A;  3AE2 B;  3VAW A;  4RM8 A;  4LNO A;  1Q0W B;  4KSL C;  4HK2 A;  1J7C A;  2ZZP B;  3P2B A;  3VUX A;  1TS2 A;  4AS1 A;  1IPG A;  2JT4 B;  4YTN B;  1GAQ B;  1HXY D;  2KQS A;  4HKQ A;  3AMZ A;  1N5W A;  2XK5 B;  2WXP A;  3C0R B;  5DPW A;  3P1M A;  1V86 A;  1R4N B;  3ZJU A;  2JZP A;  4KGS A;  5EE1 A;  4GGQ A;  4USA A;  1UWM A;  3RNB C;  3Q8C A;  3Q14 C;  2ZVN A;  4K7U A;  3DVG X;  3BVG A;  3QX1 A;  1XLN A;  3NUH B;  2BWF A;  4B95 A;  3WAM A;  4LNN A;  3DWM A;  5JHB A;  3N30 A;  2WXM A;  1QLB B;  1A5R A;  2KK8 A;  2LJI A;  2PE9 A;  4FJY A;  1QQR A;  3BIN A;  1P3Q U;  2BS4 B;  3EC8 A;  5FKA C;  2M0X A;  4YTM B;  3HM6 X;  1TYG B;  1XCQ L;  4HRS A;  2G1E A;  1QT9 A;  3LB8 C;  3TUO A;  5JHA A;  4GMV A;  4J3O D;  1T5X D;  4W9D A;  1JRP A;  1XXG A;  2ZJD A;  2RGF A;  3V61 A;  3V6E B;  4JL9 A;  1E9M A;  3O13 A;  3N32 A;  3AEC B;  2DZI A;  4PYZ A;  5C1Z A;  2LWP A;  3BZD B;  1FCL A;  3JW0 X;  4IWO A;  2KLG A;  3ZO5 B;  2ZEQ A;  1WR1 A;  3R7R A;  2N1W A;  1RLF A;  2JVC A;  1FRR A;  5C23 A;  4GB9 A;  4LJP B;  2N9E B;  2N7D A;  1R4N I;  1L6U A;  4OVZ A;  2GOW A;  3RNA C;  3TJP A;  1AWD A;  1KLV A;  2WDV B;  2ZCC A;  1T0Q C;  4PT5 A;  2DZJ A;  5C3J B;  2KLC A;  1JCK B;  3A9K B;  3RZW C;  3W2D A;  1TZ1 A;  4M01 A;  2PEA A;  4NJ6 A;  3AE3 B;  3Q8A A;  4G0N B;  1SJE D;  3L16 A;  1GC6 A;  5G5H A;  2KDE B;  5AZF A;  4K7S A;  5HHD G;  1B1Z A;  1YN5 A;  1SE3 A;  1NBF C;  1Y8R C;  5E6J A;  4N6E B;  1E7V A;  3ABV B;  4K3B A;  2GRI A;  2LXA A;  1WF9 A;  1L6V A;  1N5X A;  5BYQ A;  2Y3A A;  4AOF A;  3KWV A;  3GS2 A;  1RRB A;  1J7B A;  2MEK A;  3BII D;  2J0K A;  4IKG A;  4GDL A;  1WSP A;  3B0A A;  2DYO A;  4ZRJ A;  2KWV B;  2BB5 A;  4KIK A;  3RZF A;  2J4X A;  2BYF A;  3AE4 B;  2J42 A;  3A33 B;  2VH2 A;  3CMM B;  1C4A A;  4HJG E;  3L0W B;  5JZE B;  4RMA A;  2WXK A;  1JWS D;  1I7H A;  1L5P A;  1PFD A;  1YQ3 B;  2CKH B;  5D6J B;  4EFO A;  2IO2 B;  2JX5 A;  1EU3 A;  4MAC A;  1WXV A;  1D5X C;  1MI0 A;  4NQL B;  2D3C A;  1Q5W B;  4MH0 E;  1GUA B;  1YD8 U;  4J6I A;  2CJN A;  3DBH B;  2C7M B;  5DPT A;  3DCG A;  2LZ6 A;  1FM0 D;  2DYB A;  4NNJ B;  1OQY A;  2KTR A;  2GBJ A;  3KYD D;  3AEA B;  1WXQ A;  2HE7 A;  3I9V 1;  2G45 B;  1QIL A;  4NZL B;  5CX3 A;  4RNA A;  4XWT A;  1J19 A;  3VTU A;  1ZOY B;  2KAN A;  3ZRC A;  4AQ7 A;  2ICI A;  4WH4 A;  1TBE A;  1QOB A;  4IM2 A;  3SR6 A;  4FJZ A;  1F52 A;  3KW5 B;  1E90 A;  1TS5 A;  3ZNI D;  2N9P C;  4KVG B;  3TEX A;  1FNW A;  3EHV A;  5TSS A;  5G55 A;  1KM7 A;  4NQK E;  3PS6 A;  4LCD E;  4OZC A;  1K50 A;  3BK1 A;  3M3J A;  1YQ4 B;  2N1V A;  1VDV A;  4N59 A;  1YX5 B;  1R4M B;  2HJ8 A;  5BMG A;  2LVP A;  3TCA A;  5AZG A;  2L0F A;  3BK2 A;  1WH3 A;  5IAA C;  3NZ3 A;  4RF1 A;  1KRH A;  2K8B A;  3QQ8 B;  2FID A;  3SFD B;  1SE4 A;  4ACF A;  1P7E A;  4MDK E;  4NAW A;  4GSW A;  4WJP A;  2AL6 A;  1HZ6 A;  1BT0 A;  2ONQ A;  2MP2 A;  3QJZ A;  3B9J A;  2RDB C;  4JWS C;  1DGJ A;  3PHW B;  4MEM A;  3BWU D;  3OAW A;  1EWC A;  3RNC C;  5I4D A;  2HTM E;  2WXQ A;  3AU5 A;  3DBH I;  2R2Q A;  2K9X A;  2NR2 A;  1WFY A;  1TJE A;  2KN4 A;  1VLB A;  5KHO A;  2CJO A;  5DCN A;  1V1P A;  2OJW A;  2L1A A;  4B9K A;  2LXC A;  3O65 B;  2W82 A;  4LNI A;  2V0G A;  5JH5 C;  3RT3 B;  3CSF A;  3EEC A;  2NMQ A;  3BY4 B;  1QF6 A;  2NCN A;  3T3N A;  2LGY A;  4DHJ B;  3AI5 A;  1OFF A;  1M94 A;  2D5G A;  1FEH A;  3ALB A;  2QSD A;  3V05 A;  1T3Q A;  1WYW B;  2WXG A;  4JPS A;  3APC A;  2I1K A;  2L7R A;  4MSM B;  1R4M I;  2K22 A;  1WXA A;  4FHJ A;  5IA7 A;  1ZDV A;  2FNJ B;  4MJS B;  4KSK C;  3ZRF A;  3UIP B;  1UH6 A;  4FAD A;  3H7S A;  2INC C;  4KGR A;  1L0X B;  3VVW B;  3AE5 B;  4C4V A;  2KHW B;  1IYF A;  2FBW B;  1VD2 A;  2AX5 A;  4OZB A;  1WIA A;  1V6E A;  2JWZ A;  1E6E B;  2NBW B;  1FNV A;  4WQO B;  3TIX A;  2IND C;  2JF5 A;  4BZA A;  4GIV A;  3W9C B;  2MHJ A;  2BVC A;  2A5U A;  4KGT A;  2O6V B;  4RH6 A;  3DPD A;  3MC0 B;  1I4G A;  3U4E G;  1GOZ A;  2LRW A;  5FR3 A;  2K8H A;  1V8C A;  1VZ6 A;  1LFD A;  1ZKH A;  4FN2 A;  2K5P A;  2W3R A;  3W1S C;  3B2G A;  2AL3 A;  1RWS A;  3HVD A;  3JYU A;  1WGR A;  1C79 A;  3NVY A;  2EKI A;  2MJ3 A;  3IHP C;  1P1A A;  1FRD A;  1K8R B;  1E10 A;  3NS8 A;  4H2A A;  3HHM A;  2LMC A;  2L83 A;  2NTS A;  1SE9 A;  1FFV A;  3AM9 A;  3W5V B;  3A1Q A;  3VQI A;  1GB4 A;  2LD9 A;  2BKR B;  3P63 A;  1WR6 E;  2V3P A;  1RFK A;  1KLU D;  4MH8 A;  3VTW A;  1WRI A;  1UBI A;  1AN8 A;  2AQ3 B;  1D4B A;  2VRR B;  2N9X A;  3IG3 A;  2WXR A;  2KC1 A;  2LGS A;  4G11 A;  4JGH B;  5DPR A;  1UBQ A;  1Q1O A;  1SIJ A;  4M02 A;  1CQV A;  1FXI A;  3EFU A;  4RF0 A;  3H7P B;  4HDO A;  1I4P A;  1K51 A;  2FUG 1;  1K52 A;  3V3X A;  3VUW A;  3PZ7 A;  3SDL C;  2RDG A;  5D2M B;  1WGH A;  1VRA B;  4WJO A;  4KZ0 A;  4A3P A;  4XGA B;  3VXW A;  2MBQ A;  3ZTC A;  1NEN B;  4G3X B;  2VH1 A;  4OHJ A;  3N1Y C;  3AV8 A;  3TEZ A;  1S1Q B;  5BYS A;  4IM0 A;  1WE6 A;  1YMH E;  2HDE A;  2SEB D;  4MM3 A;  3PO0 A;  4X57 B;  4UDU C;  1V2Y A;  1S3S G;  3LJ3 A;  1V81 A;  2QCZ A;  4EOY A;  2W3S A;  4TUU A;  5AZH A;  3H6N A;  1WGY A;  3WAP A;  3M62 B;  3Q3J A;  3U7Z A;  3GB1 A;  3L4P A;  4DXF A;  1V49 A;  2IZV B;  1X1M A;  2GBN A;  1F2R C;  2CHX A;  2V3N A;  1WRD B;  2LVO A;  3HVZ A;  3GOE A;  1GB1 A;  1WJN A;  1I35 A;  1SB3 C;  1NYQ A;  3MTN B;  4HCP B;  2D11 A;  1TY2 A;  2INP E;  2DLB A;  3LXF A;  2FUH B;  2JUO A;  1XT9 B;  3S2A A;  1WY8 A;  3IAM 1;  2KMC A;  3MJW A;  1NI3 A;  2MJD A;  2G4D B;  4LTU A;  4TQ1 A;  4ANV A;  1E5W A;  4HEA 1;  1K53 A;  2GI9 A;  2QIL A;  3TMP B;  2AWT A;  3PZD A;  2J52 A;  2PKO A;  2IO3 B;  1T0S C;  3H9D A;  3NVV A;  1NEK B;  2JQR B;  3AE9 B;  4BBN F;  4RGT A;  4HXD A;  3W1Y A;  4M00 A;  4PYU A;  1ISN A;  2OOB B;  1KF6 B;  4IM3 A;  2ACZ B;  1PUT A;  1EU4 A;  1P0R A;  3ZLZ A;  2PMV A;  3LYY A;  2C7N B;  3NOB A;  1YJI A;  3RNE C;  3MFG A;  2AYO B;  4GLS C;  2D07 B;  4KZC A;  1OEY J;  2IJ0 A;  1YNT E;  4JLC A;  1SSN A;  1YOV B;  1IBX A;  1WGD A;  2K8C A;  2QDF A;  2BQQ A;  1JW9 D;  5BO4 B;  4HVB A;  4F8C B;  1XD3 B;  2L76 A;  2LGD A;  3IAS 1;  1L4D B;  3Q2A C;  4ICV A;  4NJC A;  4E3C A;  5EE9 A;  4EZK A;  4YSX B;  3D32 A;  4GXB A;  1T0Y A;  4GOC A;  1L4Z B;  2Y5B B;  1AW7 A;  4DDG D;  4DDI D;  3AEG B;  4KKJ A;  2LHD A;  4WJQ A;  4K81 A;  4W9J A;  4ZRK A;  4MEL A;  4A9A A;  1DOI A;  2EMS A;  3SU8 X;  1SIF A;  1KTK A;  1XLQ A;  1ET6 A;  3WIM A;  2NTT A;  2N9L A;  4FA6 A;  4WIP A;  1ZDX A;  4TQ0 A;  5LXH A;  2R61 A;  1YN4 A;  3FC4 A;  2WXL A;  3QCA A;  2QIE B;  1VJK A;  2IPK D;  1E8Y A;  3RD2 A;  3OWE B;  2PW9 A;  4QAY A;  2JXX A;  2L00 B;  2BF8 B;  3U52 E;  1KJT A;  1TZO A;  2KQ4 X;  2RDH A;  3DOW A;  5AUI A;  2HJ1 A;  2Z8L A;  5D7G A;  4C00 A;  4A8X C;  1LO5 D;  3RNF C;  3WAL A;  2GBK A;  2WXF A;  2QJL A;  1JWB D;  5L83 A;  1EF5 A;  2KDI A;  3SD5 A;  3GE3 C;  2LAS A;  1KH0 A;  2N4F A;  3I63 C;  2FCS A;  3JSV A;  4GDL B;  2DYM A;  1KOT A;  2YLM A;  1JRO A;  4ZOH C;  4I6L B;  2N7J A;  4KIK B;  3V6C B;  5G5G A;  2LVQ A;  3N9Y C;  4ZHO A;  2KYW A;  2JYE A;  2M0A A;  2JXT A;  5T8I A;  3RPF C;  4ZDV A;  2WXO A;  3M95 A;  4TMA B;  4LDT B;  2VZK B;  2WXI A;  2KXJ A;  4MSQ B;  4ZRQ A;  1EO6 A;  2UU7 A;  1QOA A;  1ZE3 D;  4CHK A;  2L52 A;  1RFA A;  2DAJ A;  2JYT A;  3PRP B;  2IO0 B;  3AUL A;  4HWI B;  2E3T A;  3LDZ E;  4YXD B;  3VRB B;  2I2Y A;  2V4I B;  2GBR A;  2ZNV C;  1D3Z A;  2AQ2 B;  4ARC A;  3R2T A;  1EF1 A;  4KV2 A;  3A9K A;  4FJV B;  3ZNH B;  4D2K A;  1I42 A;  1JWM D;  2KD0 A;  2WX0 A;  1TIF A;  1WX9 A;  4WWN A;  4Q2J A;  4IG7 B;  2IGH A;  2EEL A;  1ZW7 A;  1WMH A;  4YWG G;  1ROE A;  1E7P B;  1HQR D;  2X8X X;  1MG4 A;  1ACC A;  3PT2 B;  2WXN A;  1SEB D;  4GU2 A;  5E6P A;  4ZRP A;  4JX1 C;  3IVF A;  2IGG A;  2V4L A;  4EKU A;  2KDF B;  2K6D B;  3I3T B;  3AE1 B;  2H88 B;  4DHJ D;  1V5T A;  3JVZ X;  4WAA A;  3RUI B;  3AE7 B;  4P7I A;  2NS5 A;  4HLE A;  3ML8 A;  5D3D A;  1F2R I;  5HFY A;  1WGG A;  3EFC A;  2MP2 B;  4YT0 B;  2YEP B;  3ECI A;  3DWG C;  1C4P A;  1XO3 A;  2O2V A;  2G3Q B;  2NVU I;  2JY6 A;  3N1Z C;  1WJ6 A;  3WAO A;  1QKZ A;  1NDD A;  4M0W B;  5LLI A;  2XBB C;  1EWY C;  2W9N A;  2ZW0 A;  1KFY B;  3X0W A;  2KX3 A;  3APD A;  3ZJT A;  5CHF A;  3PVL A;  3N1X C;  3P4Q B;  3DHG C;  2DNF A;  2OHF A;  3MC8 A;  1V9J A;  4WUR A;  2O6V D;  2BS2 B;  2KZR A;  4N58 A;  2G4S A;  3AEF B;  3PPA A;  3AE6 B;  2KJH B;  4XZ4 A;  2KJR A;  1F77 A;  2C7H A;  1V97 A;  1ZP0 B;  2IBI B;  2KO3 A;  2C60 A;  4EE2 A;  4M8M A;  1YJJ A;  4DHZ B;  4ASW C;  1E8Z A;  1HA5 A;  5EE3 A;  5GXG B;  4WJN A;  4GN1 A;  1SXT A;  5E6O A;  5AEK B;  2KVR A;  2Y5C A;  3HM3 A;  1WJU A;  3EA6 A;  2D3A A;  4K1R B;  4NAM A;  2WGS A;  5CHW A;  3IBE A;  2E6X A;  3U30 A;  4EUT A;  3VUY A;  5IO9 A;  1UZX B;  1D5Z C;  3TEW A;  5CTR C;  1MPE A;  2KFK A;  3TSS A;  1FD6 A;  2JZ3 B;  2LGX A;  3ENE A;  2WQY B;  2BS3 B;  2JSV X;  2MLB A;  1H4R A;  4P6V F;  2KDB A;  4XDC A;  3PLV A;  2PIA A;  4OW0 A;  3ZIM A;  3R2I A;  3TEY A;  2L0T A;  4GDK A;  4K7W A;  3RMK C;  5DPS A;  4P1C C;  4OVV A;  3NVW A;  2WXH A;  2MQJ A;  3A9J A;  1TS4 A;  1RYJ A;  5FK9 C;  2NBV B;  2FCN A;  4HPL B;  2RSU A;  3UIN B;  4AP4 C;  4L23 A;  3ZGZ A;  1XCT L;  2ZNV B;  5E6N A;  4US9 A;  1PDX A;  2BBC A;  3RN9 C;  3E9S A;  3N3K B;  1F1H A;  1SE2 A;  3HK0 A;  4BOS C;  4E74 A;  4ZHP A;  1KLG D;  1NVI D;  1F9J A;  3WAN A;  2K39 A;  3KVF B;  2AQ1 B;  4ANX A;  4HCN B;  2GB1 A;  3A1Q B;  3GP7 A;  3MC9 A;  2XNA C;  3B1L X;  1I4H A;  1L0V B;  3BYY B;  3I57 A;  3IT4 B;  1BXT A;  1TKG A;  4NY0 A;  2KNB A;  2JZZ A;  1J0G A;  4MJS A;  4B0M A;  3AN1 A;  4IW0 A;  1IGD A;  3NZU A;  4AJW A;  2JU6 X;  3A4R A;  1VZ7 A;  5J18 A;  3PSE B;  1L0Y B;  3KH0 A;  4LK0 M;  1PGA A;  4IOI E;  1LXD A;  3DDC B;  2PJH A;  4HDQ A;  1V5O A;  4TKN A;  1HEZ E;  5D94 A;  3RCZ A;  4R3D A;  3T9L A;  2NBU A;  1B9R A;  4OZA A;  1HE8 A;  2DAF A;  1MVK A;  2O6V A;  3SFE B;  3DBR B;  3DBS A;  3R8B A;  1VR9 A;  1GPX A;  1OQR A;  3UI3 A;  2LUE A;  5IP4 D;  2KWC A;  3SEB A;  3VR9 B;  4EZJ A;  1UEL A;  2PVG C;  4LNK A;  1E8W A;  3MJ5 A;  1FIQ A;  1E7U A;  2NPT B;  2BGF A;  3L08 A;  3QC8 B;  4W9I A;  2UYZ B;  2WYQ A;  2G9H D;  4NPN A;  1J7A A;  2RPQ A;  4WWP A;  2ZVO A;  1P7F A;  3FIL A;  4WAF A;  2AEH A;  1OQQ A;  1UWX A;  3CWI A;  1IUE A;  3P4P B;  1ZPS A;  3VTV A;  4F1S A;  4XWW A;  3K9O B;  2WLB A;  4IUM B;  4PS3 A;  2EKE C; 
#chains in the Genus database with same CATH homology
 5J17 A;  1WXV A;  2PPH A;  4NQL B;  4ZRK A;  4MEL A;  1Q5W B;  1U4A A;  4MH0 E;  1GUA B;  1YD8 U;  3V62 A;  4J6I A;  3ZUN A;  1RAX A;  2C7M B;  5DPT A;  2EMS A;  3DCG A;  2LZ6 A;  2DYB A;  4NNJ B;  3PHX B;  1OQY A;  3SU8 X;  2K6Q A;  2KTR A;  2GBJ A;  3KYD D;  1GC7 A;  4II2 B;  1SIF A;  2ZPY A;  2GBM A;  2BPS A;  3DVG Y;  3WIM A;  2HE7 A;  2CHW A;  3QWZ B;  2G45 B;  5CX3 A;  1J19 A;  3VTU A;  4FA6 A;  2MWS B;  2KAN A;  2Z0D B;  1QZE A;  3ZRC A;  4BFR A;  3DVN V;  4URK A;  4TQ0 A;  2KOX A;  5LXH A;  2WX1 A;  4FUL A;  4BVU C;  3RUL A;  1TBE A;  1WM3 A;  2BYE A;  4ICU A;  3QCA A;  4IM2 A;  4FJZ A;  3VFK A;  3KW5 B;  3PGE A;  1E90 A;  1WZ0 A;  2IO1 B;  2MX2 A;  3ZNI D;  1WZ3 A;  2HTH A;  2OJR A;  2N9P C;  4KVG B;  1E8Y A;  3PRE A;  4EZL A;  3RD2 A;  2ZCB A;  3EHV A;  5G55 A;  1KM7 A;  2JXX A;  5L95 C;  4NQK E;  2L00 B;  2BF8 B;  3PS6 A;  1KJT A;  2DHZ A;  4LCD E;  2V3S A;  2DZM A;  2HD5 B;  3HIZ A;  3M3J A;  1C3T A;  3DOW A;  3VH3 B;  2N1V A;  3RYT A;  3PV1 A;  3DBR I;  5D7G A;  1YX5 B;  3ZDT A;  2HJ8 A;  2LVP A;  3ZDM C;  3WAL A;  2GBK A;  1CMX B;  3TCA A;  5J2R A;  5AZG A;  4AUQ C;  2L0F A;  3UQA A;  1H8C A;  1WH3 A;  5IAA C;  2J0J A;  5L83 A;  2IYD B;  1EF5 A;  2KDI A;  3SD5 A;  2K8B A;  3QQ8 B;  2LAS A;  4W9K A;  2L05 A;  3UQB A;  2FID A;  2N4F A;  1E8X A;  1Z5S B;  2FCS A;  2MBH A;  3JSV A;  4GDL B;  2DYM A;  1KOT A;  1JRU A;  3R66 C;  4MDK E;  4BKS A;  2YLM A;  4DBG A;  2LRU A;  4I6L B;  4LJO B;  3ZTD A;  4NAW A;  4GSW A;  4WJP A;  4KIK B;  2ZPN A;  3V6C B;  2AL6 A;  4FBJ B;  1BT0 A;  2MW5 A;  2MP2 A;  5HKH A;  2LVQ A;  2J0M A;  2R2O A;  3QJZ A;  3TL5 A;  2C5L C;  3PHW B;  3NHE B;  3CF6 E;  2WWZ A;  4MEM A;  4ZDV A;  2LJ5 A;  2MSE D;  4TV3 A;  2JPH A;  3M95 A;  4WWO A;  4LDT B;  3OAW A;  1J8C A;  4IC7 B;  2KXJ A;  4MSQ B;  2CU1 A;  5CHV C;  1EO6 A;  3PTF C;  3AU5 A;  2UWQ A;  3DBH I;  2R2Q A;  2QHO A;  2CS4 A;  3KUC B;  2NR2 A;  1WFY A;  3DBL I;  4CHK A;  1RFA A;  5KHO A;  3KUD B;  3L10 B;  2L3Z A;  5DCN A;  4A20 A;  4DHZ E;  2DAJ A;  3PRP B;  1GG3 A;  2IO0 B;  3AUL A;  4HWI B;  4KDI C;  4B9K A;  4BKG A;  2KJ6 A;  2D10 A;  2LXC A;  3OJ4 B;  3O65 B;  2RR9 A;  3LDZ E;  1WXS A;  2KFJ A;  5JH5 C;  3RT3 B;  2GBR A;  2ZNV C;  1OGW A;  3CSF A;  3EEC A;  4W9G A;  1D3Z A;  4W9L A;  4I6P A;  4LDT D;  3BY4 B;  1EF1 A;  2J7Q B;  4KV2 A;  3A9K A;  4FJV B;  2NCN A;  3QAR A;  3ZNH B;  1I42 A;  5KHQ A;  2LGY A;  5LXI B;  2KD0 A;  4DHJ B;  2WX0 A;  3AI5 A;  3L13 A;  1M94 A;  1WX9 A;  2WDT B;  4WWN A;  4IG7 B;  1WX8 A;  3PRM B;  1ZW7 A;  1WM2 A;  3ALB A;  1WMH A;  3MHS D;  2EMT A;  4NJ7 A;  1WYW B;  3PT2 B;  3APC A;  4GU2 A;  5E6P A;  2I1K A;  2L7R A;  2XK5 A;  4MSM B;  3DQV A;  1R4M I;  3IVF A;  1V80 A;  1WXA A;  2D3G A;  2REX A;  4FHJ A;  3NY5 A;  3ML9 A;  2V4L A;  4EEW A;  2A4Z A;  5IA7 A;  4EKU A;  2FNJ B;  4I6N B;  2KDF B;  4MJS B;  4MGK E;  2K6D B;  1OEY A;  3I3T B;  1C1Y B;  3QHT A;  4KSK C;  4XX5 A;  4E71 A;  2DZK A;  3ZRF A;  3UIP B;  1UH6 A;  4FAD A;  1LM8 B;  2XEW A;  2MCN B;  3IFW B;  3H7S A;  4DHJ D;  3UF8 A;  3H7P A;  1V5T A;  3JVZ X;  2KC2 A;  3B08 A;  2MBE A;  2NPT A;  4WAA A;  5FR6 A;  3VVW B;  4AJY B;  3RUI B;  4P7I A;  2KHW B;  3JSV B;  3W1S A;  2NS5 A;  1IYF A;  2DX5 B;  4HLE A;  1VD2 A;  3ML8 A;  4F7Z A;  3DVN U;  3CST A;  4BOZ B;  1WIA A;  1L7Y A;  4BBN C;  3PRZ A;  1V6E A;  1WGG A;  2JWZ A;  2NBW B;  3QK0 A;  4RM9 A;  3SHQ A;  3OJ3 A;  2JRH A;  4WQO B;  3TIX A;  2MP2 B;  4IWQ A;  2JF5 A;  3VHT C;  4JIO U;  3ECI A;  3L54 A;  1YQB A;  4GIV A;  4W9C A;  5GMV A;  1VCB A;  4W9F A;  3TBL D;  3NZS A;  2O2V A;  3L17 A;  2A5U A;  3KYC D;  4W9H A;  2G3Q B;  2O6V B;  2NVU I;  1OTR B;  3QIJ A;  2DEN B;  3ZNZ B;  2JY6 A;  1UD7 A;  4ANW A;  3DPD A;  2Z59 B;  2N7E A;  3KUZ A;  2Z0E B;  2IY0 B;  4IWP A;  2M1M A;  1WJ6 A;  2MRP A;  3WAO A;  1GJZ A;  4M0W B;  1NDD A;  1TTN A;  1XQQ A;  1FXT B;  2LRW A;  4B6W A;  5LLI A;  2XBB C;  2W9N A;  2K8H A;  2BWE S;  4FHK A;  1LFD A;  1ZKH A;  3X0W A;  2KX3 A;  3APD A;  1Z2M A;  4FN2 A;  2JRI B;  2FAZ A;  5CHF A;  3W1S C;  3H1U A;  2ASQ A;  1GNU A;  3PVL A;  4MGY E;  2AL3 A;  2BYV E;  3X23 A;  3JYU A;  4AWJ A;  4BKT A;  1WGR A;  1V9J A;  4RM8 A;  3VAW A;  4M8N A;  2O6V D;  2KZR A;  3ONS A;  3VH4 B;  3IHP C;  1P1A A;  1Q0W B;  4KSL C;  2G4S A;  1K8R B;  4HK2 A;  3NS8 A;  2ZZP B;  1EUV B;  3P2B A;  2L8J A;  3PPA A;  3HHM A;  3GZN I;  2KJH B;  1ZGU B;  4XZ4 A;  3VUX A;  2KJR A;  2FCQ A;  1SE9 A;  1IPG A;  2C7H A;  2KQ7 A;  2JT4 B;  3A1Q A;  1WMH B;  3VQI A;  2LD9 A;  2IBI B;  2BKR B;  2KO3 A;  2KQS A;  1WR6 E;  2C60 A;  2IY1 B;  2KKC A;  4M8M A;  4DHZ B;  4ASW C;  1E8Z A;  1WJ4 A;  3VTW A;  4WJN A;  1UBI A;  4GN1 A;  2M17 A;  2FCM A;  2VRR B;  5E6O A;  2N9X A;  2XK5 B;  2KVR A;  3IG3 A;  4ANU A;  5AEK B;  3HM3 A;  3C0R B;  2KTR B;  5DPW A;  2KC1 A;  5EDS A;  4G11 A;  1WJU A;  1V86 A;  4JGH B;  3U7D A;  5DPR A;  1UBQ A;  4K1R B;  5CHW A;  1Q1O A;  4DXA B;  3IBE A;  3U30 A;  4PS8 A;  2D2Q A;  4EUT A;  3VUY A;  2M8S A;  4GGQ A;  1UZX B;  3EFU A;  3H7P B;  2ZVN A;  4HDO A;  5CTR C;  3APF A;  4K7U A;  3DVG X;  2GMI C;  3VUW A;  3QX1 A;  2KFK A;  2V1Y A;  2BWF A;  4B95 A;  3A4S C;  3UIO B;  2JZ3 B;  2LGX A;  3ENE A;  5D2M B;  3SDL C;  3WAM A;  4FLH A;  1WGH A;  2MLB A;  1H4R A;  4WJO A;  3N30 A;  3QA8 A;  2CR5 A;  2KDB A;  2KTF A;  4ZYN A;  4KZ0 A;  5JHB A;  4A3P A;  1A5R A;  2KK8 A;  3PLV A;  4W9E A;  2PE9 A;  4FJY A;  3BIN A;  3EC8 A;  1P3Q U;  3VXW A;  2M0X A;  3ZIM A;  2MBQ A;  3ZTC A;  1IP9 A;  2O2V B;  3HM6 X;  2LI5 A;  2L0T A;  2PE6 B;  4G3X B;  4GDK A;  4K7W A;  4JQW C;  3VDZ A;  1S1Q B;  5DPS A;  4IM0 A;  1WE6 A;  4OVV A;  3ZKJ C;  2RD0 A;  2MQJ A;  3A9J A;  4GMV A;  3ZNG C;  5JHA A;  1WE7 A;  4MM3 A;  3QAQ A;  4X57 B;  1V2Y A;  1S3S G;  4W9D A;  3LJ3 A;  2NBV B;  1V81 A;  4EOY A;  2MBO A;  2ZJD A;  2RGF A;  2K25 A;  4TUU A;  2FCN A;  5AZH A;  3H6N A;  1WGY A;  2B3A A;  4HPL B;  3WAP A;  3V61 A;  3V6E B;  2RSU A;  1YIW A;  3M62 B;  4JL9 A;  3T8M A;  3UIN B;  3Q3J A;  4AP4 C;  2K1F A;  4N9F 4;  4NAW B;  3PLU A;  1V49 A;  2ZNV B;  3N32 A;  2IZV B;  3AU4 A;  5E6N A;  2DZI A;  4PYZ A;  3R7Q A;  1X1M A;  5C1Z A;  3N3K B;  2GBN A;  2CHX A;  2LWP A;  3HK0 A;  4BOS C;  4E74 A;  4DK5 A;  3JW0 X;  4DWF A;  1WRD B;  2KX0 A;  1F9J A;  3WAN A;  1TGZ B;  2LVO A;  2K39 A;  1SGH A;  3GOE A;  3KVF B;  4ANX A;  3R3M A;  1WJN A;  4IWO A;  4HCN B;  3A1Q B;  2KLG A;  1I35 A;  3ZO5 B;  1UGM A;  2ZEQ A;  1P98 A;  1WR1 A;  1YJ1 A;  2D11 A;  3MTN B;  4HCP B;  3R7R A;  4MGZ E;  2N1W A;  1RLF A;  2JVC A;  3B1L X;  3UGB B;  5C23 A;  4GB9 A;  2FUH B;  4BKS D;  4LJP B;  2N9E B;  2N7D A;  2JUO A;  1R4N I;  1XT9 B;  3S2A A;  1WY8 A;  4NY0 A;  4XC2 A;  2GOW A;  2KNB A;  3TJP A;  2JZZ A;  2KMC A;  1J0G A;  3MJW A;  4MJS A;  4IW0 A;  3WA0 A;  1KLV A;  2ZCC A;  3NZU A;  1G6J A;  1WI0 A;  2DZJ A;  2G4D B;  2KLC A;  4AJW A;  4TQ1 A;  4ANV A;  1E5W A;  3A4R A;  5J18 A;  3PSE B;  2I1J A;  3KH0 A;  1LXD A;  3A9K B;  3TMP B;  3DDC B;  2AWT A;  3RZW C;  1TZ1 A;  3U8Z A;  3PZD A;  2KFK B;  2YVC A;  2PEA A;  2PJH A;  4HDQ A;  4NJ6 A;  2IO3 B;  1NI2 A;  1V5O A;  3H9D A;  4TKN A;  4G0N B;  4YL8 A;  4CYE A;  3L16 A;  1GC6 A;  5D94 A;  3RCZ A;  2KDE B;  4BBN F;  4HXD A;  3T9L A;  2NBU A;  5AZF A;  4K7S A;  3W1Y A;  5TR5 A;  3ZVV A;  4PYU A;  3V60 A;  2KMA A;  4II3 B;  5G2N A;  1ISN A;  1HE8 A;  2DAF A;  3ZW3 A;  1NBF C;  2OOB B;  1WX7 A;  1Y8R C;  4IM3 A;  4GDK B;  1E7V A;  1P0R A;  3ZLZ A;  3Q3F A;  2LXA A;  1WXM A;  1WF9 A;  2O6V A;  2C7N B;  3NOB A;  1PQS A;  3DBS A;  4G50 A;  2AYO B;  2C9W B;  2KN5 A;  2KWU B;  2BKF A;  1YX6 B;  2D07 B;  4KZC A;  4ZRI A;  4A3O A;  2LUE A;  4CO7 A;  1L2N A;  2KWC A;  3A9J B;  4AOF A;  1OEY J;  1UEL A;  4EZJ A;  1RRB A;  1E8W A;  3K9P B;  1E7U A;  2J0K A;  2NPT B;  4KDL B;  1P9D U;  3M63 B;  2BGF A;  4JLC A;  3L08 A;  2MBB B;  1WGD A;  3QC8 B;  4W9I A;  4PS7 A;  2K8C A;  4GDL A;  2M4N A;  4HVB A;  2UYZ B;  5BO4 B;  4OVU A;  3B0A A;  2DYO A;  4F8C B;  4ZRJ A;  1XD3 B;  2FIF A;  2KWV B;  2L76 A;  2WYQ A;  4NPN A;  2LGD A;  4KIK A;  4MGI E;  2RPQ A;  3RZF A;  4ICV A;  3AXC A;  2ZVO A;  2BYF A;  4WWP A;  4E3C A;  1MG8 A;  3A33 B;  3CMM B;  2MA9 B;  3OLM D;  2AEH A;  4EZK A;  2CHZ A;  1AAR A;  3VTV A;  3L0W B;  3D32 A;  4F1S A;  4GXB A;  1T0Y A;  4GOC A;  4RMA A;  5JZE B;  3K9O B;  2Y5B B;  4HJK A;  1LQB A;  4DDG D;  2CKH B;  5D6J B;  4IUM B;  4HPM B;  4DDI D;  4EFO A;  2IO2 B;  4PS3 A;  2EKE C;  4WJQ A;  4K81 A;  4W9J A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...