2SEBD

X-ray crystal structure of hla-dr4 complexed with a peptide from human collagen ii
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
235
structure length
217
Chain Sequence
SQPDPKPDELHKSSKFTGLMENMKVLYDDNHVSAINVKSIDQFLYFDLIYSIKYDNVRVEFKNKDLADKYKDKYVDVFGANYYYQCYFSKRKTCMYGGVTEHNGNQLDKYRSITVRVFEDGKNLLSFDVQTNKKKVTAQELDYLTRHYLVKNKKLYEFNNSPYETGYIKFIENENSFWYDMMPAPGDKFDQSKYLMMYNDNKMVDSKDVKIEVYLTT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HLA CLASS II HISTOCOMPATIBILITY ANTIGEN
publication title X-ray crystal structure of HLA-DR4 (DRA*0101, DRB1*0401) complexed with a peptide from human collagen II.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Complex (mhc class ii/superantigen)
total genus 67
structure length 217
sequence length 235
ec nomenclature
pdb deposition date 1997-10-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF01123 Stap_Strp_toxin Staphylococcal/Streptococcal toxin, OB-fold domain
D PF02876 Stap_Strp_tox_C Staphylococcal/Streptococcal toxin, beta-grasp domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.110 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 2sebD01
3.10.20.120 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 2sebD02
1PTOH 1PTOF 1JCKB 2NTTA 1DJRD 1BXTA 1S5CD 4RH6A 2Z8LA 1PRTB 1TS3A 2XNAC 1EEID 1CT1D 1D5XC 1L0YB 1SE2A 1XTCD 4UDUC 1LTID 2ICIA 3R8BA 1S5BD 1BCPD 5FK9C 4RHSA 3CHBD 5ELBA 1PZKD 1CHQD 4OHJA 1LT6D 2RDHA 1LLRD 1I4PA 1HA5A 2AQ3B 4L63B 1CHPD 3R2IA 2AQ2B 1EU3A 1ET9A 1HQRD 1L0XB 2NTSA 2SEBD 1ENFA 1B1ZA 1I4HA 3KLSX 1AN8A 1GOZA 1ESFA 4DXFA 2G9HD 3MC0B 1JWUD 1AW7A 1LT3D 1LT5D 1S5FD 5FKAC 1FNWA 2RDGA 1CQVA 3DWAA 2XRSD 3W2DA 1F77A 1EU4A 4C56C 1SE3A 2J4XA 1B44D 1KLGD 1EEFD 2IJ0A 1FGBD 3V05A 5ELFA 1I4QA 3URYA 1PTOD 1SBBB 1RF2D 3DWPA 1LTSD 3EA6A 1JR0D 1BCPC 3TSSA 1LTGD 1PTOC 4RGOS 1V1PB 4O1NA 2TSSA 4Z9CB 3BZDB 1DYQA 1YN5A 1BCPB 1SE4A 1PTOB 1CK1A 2XN9C 1TS2A 3R2TA 1T5XD 2QILA 1XXGA 2WV6D 3DWQA 1S5ED 1V1OA 1HXYD 1LTAD 1PRTF 2QEJC 1LT4D 1EWCA 3GP7A 3BVGA 1MD2D 3OWEB 4ZYSA 1TS4A 1PZJD 1LTBD 1PZID 4RCOA 4DXGA 1JWSD 1QILA 1RD9D 3MFGA 1FD7D 1I4XA 1TY0A 1D6EC 1PYWD 3BYTB 4K6LA 4RFBA 1BCPF 4TSSA 1TS5A 1LTTD 1RDPD 5ELDA 1FNUA 1KTKA 1S5DD 2CHBD 3BVMA 1D5ZC 4RHRA 1JWMD 5TSSA 1HTLD 1LTRD 2XRQD 1EFID 1TY2A 1SJHD 1SXTA 1D5MC 1V1PA 5D3DA 1SJED 1RCVD 1I4GA 1SEBD 3BYYB 2IPKD 4L6TB 1LO5D 1FNVA 3SEBA 1KLUD 1JQYD 1UUPA 4RGNA 1YN3A 1ET6A 5ELCA 3O13A 5I4DA 1I4RA 1PRTD 5D3IB 4RGTA 2R61A 5ELEA 4BWGB 4NZLB 1UNSA 2O2LD 4RGMA 3BVZA 1STEA 3EFXD 1M4VA 2AQ1B 1G8ZD 1PRTC 1YN4A
chains in the Genus database with same CATH superfamily
1JE5A 4LF9Q 2C5CA 4XZ4A 2Q2TA 2Z0SA 4IUNA 4NQLB 2BA0A 5EKLA 1W6KA 1KDBA 1HRJA 2KJ6A 2B2YC 1G91A 2RPVA 4NB3A 2KCCA 2KQ4X 2ZZPB 5E6NA 2XNAC 1B9MA 1EEID 1YQ3B 4ARCA 2PZWA 3PO3B 1HZ6A 1PFDA 4UDUC 2KLCA 2KQ3A 2LHDA 2OF1A 4DV2L 2WKDA 3I7FA 2B3GA 3ZJVA 4OHJA 4LUVA 4RKLA 5A2QL 1MFWA 1V9PA 2MA9B 1XQQA 5IAAC 2K6QA 2PZTA 4RWSC 2NTSA 2BDOA 1IGDA 2KWUB 2ZNVC 1AARA 4QIWB 1KNAA 3GTGB 5EPLA 2LVQA 5C3EB 1TKEA 2Y5BB 1TIID 1LT3D 1QOFA 2B2VA 2ACZB 3H6MA 5LXIB 2HD3A 2XRSD 2N0SB 3VTUA 4NAWA 4XDDA 2E2JH 5GXGB 1U5KA 3DQVA 2J7QB 4AQYL 2MRPA 1HE8A 1PFSA 2A68C 1PTOD 4O42A 3A5UA 4A3EB 3HOVH 4FLHA 3M9BA 2FCSA 2UUBL 1J8CA 1ZXIA 2TSSA 1L2NA 2NVXH 4JI8Q 3VRAB 1NI3A 4II2B 4NW2A 1EM7A 2KWVB 3C0RB 2CHXA 1CK1A 2Z6KA 2N4FA 2FIFA 2JA6G 5C3WA 1BVSA 1SYDA 4WQOB 2CU1A 2K39A 4LMQD 3KYHC 2HCIA 5M3MH 4DV5L 2R93G 1FXTB 2RF4A 5AZFA 1CUKA 4LF7Q 4JPSA 2JX5A 4F8MA 4NAWB 2KVRA 3GTMB 3I2ZA 2VZKD 4ZYSA 4EZLA 1PZJD 2P5ZX 2IGHA 1SB3C 2EDGA 3TBIB 4ZLTF 1HR0Q 3PZ7A 4KSLC 1BQQT 1A2TA 3KF8B 3OG5A 3Q3OC 1R4PB 1Y1WB 3EGRA 4K1RB 1D6EC 2JPHA 1I35A 1VS0A 2VH2A 1HHVA 4GGQA 3CCRA 2IT1A 1F0ZA 3AEDB 1V9JA 2LVPA 4I6NB 1JWMD 5EE3A 4ZKCB 1GD7A 2MUYA 1TBEA 2C7HA 1X3EA 4JBKA 1E3PA 1GO3E 4IPHA 1RODA 4GMVA 4X65L 2YTYA 3TP6A 2JYEA 5F2DA 2WXHA 2F0NA 4LWCA 1B50A 2PNRC 4QCLA 2FINB 2XSCA 1XPRA 2E76C 4YHHL 3UI2A 2L8JA 2WDVB 4DAYB 1K52A 2BT6A 2AKWB 1KRSA 2K7VA 2A6EC 3L0OA 3J7ZC 2DZJA 3APCA 1E90A 2Q2HA 1XPOA 2MJDA 3FKYA 2B2TA 4A3FH 5FJ8G 2B29A 2O2LD 1UE5A 1UAPA 2AQ1B 2KHSA 3DBHB 2VB2X 1WTXA 1RLFA 1X55A 2RDFA 4NY0A 2KCMA 3MZ5A 4A6QA 3RFZB 3BG3A 2VUMG 1ISNA 2YTVA 5CV4A 4LAAA 2R2OA 4AYBG 4DR1L 2KZRA 1EYDA 2MFIA 1P7EA 1YD8U 3H0GB 1WXAA 3DM3A 3IAS1 3T51B 1F9SA 3CWIA 3KWVA 1DM0B 3QOLA 1F2RI 3ULPA 3EJIA 3X3MA 3F2DA 1MVKA 5FLXE 3S1QB 4QIWE 4EUTA 1LABA 2KOLA 3T16A 4F8CB 1MSGA 3MXNA 1JJCB 2AQ2B 2UXDL 4JI7L 1I50H 4F87A 2PJHA 5IWAL 1PH2A 3KLSA 1I4HA 4S0RA 1WX8A 4CQNA 1UE1A 1UWMA 3HOUG 4C4VA 2QGQA 1N33Q 4BBSB 1L1OC 2XEWA 3WOFA 4C3IB 1GUAB 3B6YA 4A3BG 2LJIA 2WXQA 1NSNS 1F2YA 1ZYRC 2A73B 4XX5A 5CR3A 1UWXA 4KIKB 3NS8A 3CC7A 1KRHA 1VQJA 5ELFA 2OEDA 1B4OA 3K7UC 1STNA 3RLOA 2K28A 1DCZA 1R9TB 4B3ML 4CHKA 1K8MA 2PMVA 2XVSA 1RTNA 3TSSA 1LTGD 4KGTA 3LB8C 4ZRKA 1L7YA 1YJIA 1Q1BA 3GZNI 3IHPC 2Z9HA 2SAKA 3DEPA 5JOBA 2MBHA 2N7JA 1GNUA 2O6VD 1PGAA 4B3TQ 1UELA 1TVXA 3QA8A 3ZGZA 1YHQA 4PNYA 2LGSA 4HKQA 3ZW3A 3HOYG 5BMGA 1PH6A 1TWCH 4IUVA 1QF6A 3Q3NC 2A5HA 3A7LA 4OGQC 3BIID 3N9YC 3W1YA 2D0OA 4K5XA 1VQNA 1DOLA 1Q81C 2RDBC 1WGKA 1E8XA 2RR9A 4C4VB 1EWCA 2QDLA 4GKKQ 1FFUA 4G57A 1TT5B 2OJWA 3R7QA 4DDGD 1MD2D 1YJWA 4ME3A 1WGRA 3I4MG 4IFDG 2LGXA 5L95C 1JWSD 4DUYL 4LF5Q 1AE3A 1KOTA 4P75A 1EQVA 3CMEA 3ZTCA 1MHWC 4J6HA 2C60A 2PW9A 3ZXRA 1RL2A 2JA6H 5J3BA 1ENCA 2QDBA 3RZOB 1SE8A 5KYIA 4W9JA 3MP9A 2R93H 2JYOA 4Y52H 1J0GA 4BY7G 1VJKA 2FMCA 2K6DB 4XYCA 4WIPA 1EFID 3M4OB 1V1PA 2NUCA 1N6ZA 2A6ED 4KZ0A 2ZTDA 2SNMA 1A15A 3HOWB 2KDFB 4JW0A 3A4RA 2B63H 2E6XA 5GMVA 1O7ZA 3K81C 3HM3A 5JEAJ 2EY5A 2KN5A 4RGTA 2WDQB 4WORA 3I73A 1WM3A 4GIVA 4BAXA 2JWZA 2EIFA 2PEAA 3B2FA 1Q8KA 2RPQA 5AEKB 1PRTC 1CZPA 1JQ4A 2EQSA 3HFZB 4OVVA 2IZVB 2O6VA 2CH4A 1CI3M 4HMJA 2UUBQ 1XNRQ 4BBRH 2K8HA 5EGTA 3NBIA 1E8ZA 4BZAA 1HPCA 3RLNA 1YNNC 1VQ8A 5GADC 1A8VA 2GVBA 4K8IA 5I6WA 4PT5A 1WXVA 1NBFC 3K9PB 1QNUA 3R3OA 1WOCA 1BKBA 2RBMA 5JVG3 1EWYC 2L15A 2E2JB 3NS1A 3I90A 1S5BD 1BCPD 2K50A 5D65A 4UAIA 4WJNA 1U4PA 1T6BX 3SHQA 3PO2G 2DYBA 1SN8A 2HDLA 1EQRA 2NVUI 3ZKJC 3R2IA 2R6GA 4B6WA 4DHJB 1SMXA 1XWEA 4DR4L 3AFPA 5JJLA 1S4ZA 5I9OA 4KDLB 4M8NA 2ZXPA 4XWTA 3WAOA 4DV0Q 3P7JA 1BBWA 3QR8A 1BBXC 3CCVA 1GG3A 2WAQG 2VUMH 2JXTA 2WLBA 3DVGY 1O80A 3WWVA 3PVLA 1ZYRD 1ZDXA 1T5EA 2F0DA 3HIZA 2LMCA 3RMHA 2RMMA 3CSTA 5H8YE 2PYKA 1V1QA 4HJAA 4LCDE 1E7VA 3U8ZA 1SE3A 4DDID 2HTHA 2RHQB 3NTIA 5M3MB 3T1YL 4B95A 1IBXA 1KLGD 1X65A 4KJNA 2IJ0A 4MM3A 1N34L 1GC7A 1PQSA 3VH4B 4BFRA 1TQOA 2ZTCA 1X32A 2FXQA 2ALYB 3I91A 2E2HH 1WZ3A 5LL6X 4X65Q 1WXQA 2VB3X 1NAPA 2IBIB 3BZDB 4TRDA 4JI4L 1HEZE 3A33B 2PZUA 1L2FA 1KFYB 2LVOA 4DR3L 2XN9C 2F0WA 3HS0C 1Q1EA 3HOUH 1XXGA 2UUAL 4GLXA 3ND8A 3APFA 1MGSA 3GTOB 3GTPH 2FUG1 4A3BH 5I2YA 1NMGA 2G9DA 1K3RA 4EX5A 3J81c 4ODGA 4GOPA 5I6YA 1MG4A 1JOKA 3M7NA 2EMTA 3S2DB 5LMUL 1M94A 4TQ1A 2PIAA 4DR1Q 1Q82C 1HNXL 1L6VA 5IY0A 1WTOA 3SFEB 4N9PA 1E9MA 5IP9G 1VRAB 1NVID 4DAMA 1P7FA 1QILA 1RD9D 2ZXRA 3MFGA 2DZIA 3I4NH 4A3FB 4GN1A 1BT0A 3WANA 1UD7A 4NAMA 4ZRZA 3K57A 2RQXA 1P0RA 2NCNA 1TWGH 2K1BA 3FRPB 1YIJA 2ZJDA 2UXDQ 3NHEB 1XTDA 3OSOA 3Q6BA 3G48A 4JI7Q 4EVOA 1A63A 1STYA 4GB9A 1FXAA 2VQFL 3NBHB 5JXVA 2BH8A 2KCTA 2KJXA 3HRZC 2QCPX 4HN7A 2UXBL 3H9DA 3UF8A 3AMZA 4ANVA 2BKFA 4KI0A 3K6OA 2GB1A 3PUVA 3ZO5B 2WB1G 4LTUA 4A93H 2YLMA 2N9PC 3NXWA 1JMCA 2A1AA 3RR5A 1PRTD 5ELEA 3T56B 3PRZA 1Y1VG 1I50B 3A7AB 2E75C 1DXMA 3RD4A 2AL3A 2INNE 4JYAQ 2KHWB 1V80A 3H6NA 4C2MH 4KZCA 1S5CD 1PXUA 2NB0A 3Q24A 4AWJA 4N8X1 2ES2A 4IUTA 3G6EA 2G45B 4A3JG 1WVLA 3ZQ4A 2GN5A 4PQXA 1D5XC 5CBAE 1OGWA 2L32A 2JP1A 2Q5WD 4DK0A 2R7ZG 4ZHOA 5JHAA 2N55A 4NJ7A 2EJFC 1C79A 2W82A 3KYDD 4IOCA 4HR7B 2YTXA 3AU7A 2KA7A 1DZ1A 1E0ZA 1F2RC 5C5MA 3RUIB 3Q0AA 4HPLB 1EQTA 1J7AA 1XX8A 3U9OA 3HOXG 3PZ8A 3V6CB 3M4YA 3J80E 2R7DA 1RRBA 4N9F4 2MW5A 4OZCA 4W9KA 3S24A 3CCEA 2HQLA 4DUYQ 2GOWA 2EE1A 3EBEA 1S5FD 3HOZG 1VQLA 3IFWB 2B2UC 1FNWA 4M01A 3MC8A 3W2DA 5DPRA 2IGDA 4ZOHC 4JCVE 3TQYA 2TMPA 5IGFA 3C19A 3CC2A 3ZNID 2LSSA 3FILA 3IAYA 5IP7H 4G7OC 1EYAA 4APVA 4LJZC 3S2HH 3V05A 2QHOA 1TWAB 4IWOA 2ICEC 5M5WH 2MQHA 1G291 4LNKA 2ZT9C 1JR0D 1TZOA 4A3IH 5IOCA 2CVRA 5BYSA 5J2RA 2V3PA 5LXHA 3UDXA 1G51A 4CDDC 2YEPB 1WTRA 3HKZG 3J7AF 3JVZX 5G5HA 4I7AA 3CCMA 2JK8A 4KY7A 2O2VA 3KUDB 4P1BC 4BOSC 4EZKA 3VA5A 4DV1Q 5CC4A 4A8XC 4ZHPA 2JA6B 1I7HA 3WA0A 3JAMi 1N62A 3V60A 4ULLA 2F0QA 2G1EA 5C6AA 4WJOA 3V61A 3K5NA 2R93B 5BYRA 5LL6S 1A3UA 5EPKA 3PO3H 3IKJA 4P2CB 4O0AA 1V86A 4ZRIA 1VQ7A 3TCAA 3AI5A 3H91A 5KNDA 2CH4W 2NYZD 3EHVA 2NBWB 1TS4A 1PLFA 3NEMA 2B76B 4DPGA 1UH6A 2KX0A 3EVQA 4X64Q 3T13A 3U52E 4F1SA 2BTEA 4BY1G 3MXPA 2BB6A 3IG3A 1WJUA 2PTLA 3GTGH 3J9CA 3A9JA 1K0SA 2M56B 1D5ZC 4GSWA 2O2VB 2Z6BA 1G2SA 1IUEA 1VDZA 4DNTB 3DCGA 1YITA 3PV0A 3V2TA 3L7ZC 4DKAC 2PMZB 2DNEA 5HGTA 1V5TA 4USAA 2ENBA 1I4GA 3BYYB 2NVYH 2AWTA 1K9MC 4J15A 4WJWA 5IP9H 1Z9FA 2NPTB 4HJGE 4EFOA 1V8CA 2N49A 4FHKA 4RGNA 1B3QA 4F88A 4ILWA 1PH1A 1JW9D 1VF7A 5C1ZA 1YJ9A 5JJKA 4QJFA 2M9VA 2R3ZA 2BOSA 3NUCA 2L05A 4MT5A 3CCLA 2M4NA 1YN4A 4P73A 4DFAA 4ZCKA 4JBMA 3S2AA 1V2YA 3MEHA 4RH6A 1OFFA 2VUMB 2I5LX 3A5ZB 2HJ1A 1QZHA 2XK5B 1A0IA 1SE9A 2A69C 4AYBB 1XLOA 1QZEA 2Z4IA 3PO0A 3A9JB 1SNOA 2QW7A 1A70A 4F7ZA 4L5QA 2KNBA 2K75A 3ZLZA 1XMOQ 1WFYA 3E9SA 2NZOA 3RN5A 1RIPA 3U4VA 1MPEA 4JI8L 1YOVB 2IO3B 3GTMH 3RPFC 1LLRD 2E2HB 1QZGA 3QCAA 4FJZA 1Z47A 1Y1VH 1JWBD 1OXVA 3K9OB 2SEBD 1KH0A 2RD0A 2O5JC 2M17A 3JYUA 1C7YA 5AUKA 2E5LL 2L5TA 2IO0B 4B3SQ 1JMLA 2WXFA 4W9EA 1STHA 4MHEA 4DV6L 4R4TA 4LFAQ 2VS1A 2RHSB 4B9KA 3AE8B 3RNGC 1TWFH 3HOUB 1UBIA 3LXFA 4ZYNA 3WALA 4BKSD 4A3JH 1NY4A 4A3BB 3G71A 1ZEQX 3NHHA 1ZE3D 1F9PA 2K32A 4QL5A 1GHKA 4C80A 3M63B 2R7ZH 4HSVA 1B44D 2CFMA 2LXJA 1F2LA 2H4OA 5D14A 4GDKB 4ANUA 3W1SC 2KC1A 3QX1A 2GBKA 4HCPB 1WH3A 3X23A 2G5DA 5IYBH 2K5WA 2KECA 5G2NA 5BYQA 5KRUA 3PS6A 5ISRA 1KXLA 5IIFA 1LTLA 1WI0A 1RAXA 1LACA 3DUZA 2CCZA 1L4ZB 4M1UB 4DR2L 3DWMA 3SDLC 2QIEB 3HOZH 4BA2I 2BKRB 3HOYB 4XWWA 1WYDA 4LUOA 1GUWA 1VQDA 3DXJC 1T0SC 1HTQA 2CKZB 1R4QB 5CHWA 2A6HC 3OOCA 1HR0W 2L83A 3WAMA 1JORA 4JL9A 5E7NA 4PZ8A 2JVCA 1JICA 5BN4A 1GPXA 4LNQA 1GUSA 4LDTD 3I4MB 4MTKA 1NJIC 3KUPA 4M8AA 3E0JA 1KM7A 2KQ7A 1QOAA 2IHFA 5H92C 3S1QH 5K5PA 3AV8A 2F0JA 2F0KA 1NENB 3U7ZA 4LJPB 1TY0A 4MELA 1K8RB 1KF6B 1J19A 1HUNA 1H9SB 1VQ6A 3OJ4B 2LKVA 4C2MB 2PMZE 2B39A 4RHRA 3ZXVA 2LGIA 1KC8C 4BBSH 2OHFA 4C3IH 1B9NA 4BY7B 1LTRD 2DJFC 3M4QA 1KL9A 3W1GA 2LHEA 5KHOA 3TEXA 5IYCG 3FHWA 5BMIA 2EY6A 4KN7C 1QE6A 1C48A 2EYPA 5L37A 4YTNB 3CP0A 3AN1A 1KQSA 1E7UA 4ICVA 1KLUD 2EJMA 3UQBA 1PV4A 3C3LA 4DK5A 4L8JA 1FIQA 4FADA 1EUVB 4FHJA 1RWSA 1N33L 1EIGA 2HCCA 1F1HA 1PTOF 4AYBE 3J81j 4MIUA 3UQAA 2A69D 1BXTA 4H44C 1ICWA 4FXCA 1ZW7A 3Q8DA 4KKSA 4R8IA 3W5UB 1BDOA 1ENAA 1CA5A 1XTCD 1SE2A 3AXCA 5IE8A 1WR6E 3I9V1 3ML8A 1HZAA 4UP9A 1NYRA 4K0KQ 3S2HB 4BBNC 3ERQA 3PO2B 2JYTA 3B08A 1XLQA 3JSVB 5M5WB 4M0WB 5FO7B 4OZBA 3PUYA 3X3NA 2AQ3B 3RD2A 1EU3A 4JI1L 1Y8NB 1PH7A 3KVFB 3NG0A 3E9IA 1OEYJ 3N3KB 5CV7A 5E6OA 2J42A 2H88B 4ITKA 1Q0WB 2L55A 1K3BC 4EGVA 4EQNA 4KV2A 3ZJUA 2WAQB 1EUJA 3VVWB 1DOXA 4EOYA 4X62Q 3RZOH 4G50A 4GKKL 2OQKA 2F0IA 2KYWA 1F77A 2LGDA 3H1UA 5LNK1 1UEBA 2BDNA 4ZK9B 4ASWC 2KDMA 3AB9A 1PVOA 3M4OH 1G6JA 3QO2A 4LF5L 4FF2A 3HOWH 3ALBA 1WFQA 1YQ4B 3HVDA 2YV5A 4IUUA 1I94Q 4LK0M 2A19A 1WJ6A 2INPE 2D5DA 3T1HL 1NR4A 1HFNA 4HKZE 3UIOB 3ZTDA 2ZJQA 2DJGC 5J17A 3CU7A 2DUDA 3HP3A 3RNEC 4R4CA 3RNUA 1RYJA 3F2CA 4JI6Q 1CJEA 1C4AA 4FJVB 1S5ED 2A6HD 4DR5L 3SK6A 3TJPA 4QY7A 1S3SG 1U9RA 4C1NI 1VR9A 1WSPA 3U2SC 1QUQA 4XQNA 4JI0L 5CV8A 3ND9A 5IT9E 4R4IA 2ASBA 3JW0X 3I5JC 1WYWB 4OWTB 2K52A 4HIMA 5DCNA 3OYYA 1YX6B 2EMSA 2NVYB 2X8XX 1B9RA 3Q8FA 2HIXA 1XNRL 3GV3A 1FGUA 1FD7D 1JB7A 4H7BA 1P3QU 2KO3A 3TMPB 1HH2P 5D94A 2KJRA 1FNUA 5FO9B 2JQRB 2EY2A 3C8YA 3OTOQ 1S5DD 4D2KA 4KD3A 4CHTB 3U7DA 3VRBB 5EE9A 2E5LQ 1YI2A 2WX0A 3DOWA 4JWUC 4DV6Q 1EWIA 2F3IA 1TY2A 2KTRA 2PNHA 3W1SA 4TKOB 2CWPA 3KBXA 3I70A 4X3KA 2EELA 3QQ8B 4ARIA 1XNQQ 1F9JA 4FVMA 2WB1B 1E0BA 3CW2C 5EDSA 5IGDA 2PPHA 2BS2B 3GB1A 1JQYD 2PCFB 1STBA 3DWGC 2ZCCA 1G2TA 5ELNA 1J7CA 4DV0L 1UGJA 2R61A 1YX5B 2J0MA 2V3NA 1K0RA 1UNSA 1Y1VB 1RJTA 1V43A 3LWEA 3QWZB 4IG7B 4N8FA 2FE8A 1DJRD 2HHHQ 4NKLA 3A55A 1FJGQ 1QQRA 3KUZA 4ZDVA 4B08A 4MGKE 1TWFB 3GTOH 2ZCBA 1MSHA 2QKIC 4A3JB 1VQ4A 2J0JA 2RVLA 1V49A 2NMQA 1MI2A 4DR2Q 2EYJA 2KENA 1L0YB 1EFWA 2PQEA 4J1MA 4PYUA 2KDEB 2R7ZB 3NVYA 4GZYC 5ELBA 3S2DH 1BF4A 3MC9A 3M3YH 4A3GG 2D9UA 3S14B 5MPOA 1Q7YC 4G7HC 1X54A 3ZVVA 1TKWB 5KNBA 4YTPB 2WAQE 2AWNA 3HOXB 2C9OA 2INDC 2YYZA 1D4BA 3D3RA 3UDIA 4OO1H 2JA5G 3DBSA 4TVAB 4MZ9A 1QT9A 3HVZA 3A8KE 4BA1I 5EBDA 1IGCA 3E9HA 3HOZB 4IFDI 4HAEA 2NR2A 1QWYA 4NJ6A 4DV4L 3D0FA 3DWAA 1RHPA 2I1KA 1OXUA 1QLBB 1WGDA 1C4CA 3AEBB 4S17A 1E24A 1B8AA 2MX2A 3PZDA 4HLEA 3TREA 4DN4M 2BYEA 3L4PA 1E22A 2Y0SG 1V8QA 3IAM1 2YVCA 4ZKBB 1EF1A 4DUZQ 1V6EA 1CKMA 4H13C 2G3QB 1BCPC 4DNRB 4ICUA 1E7PB 3UINB 4O1NA 4POFA 1YIWA 1VD2A 1VZ8A 3HKZB 4OEMB 5M5XB 2WXRA 1PTOB 4GLVB 2RSUA 2GVAA 4ACFA 3J7AV 3APDA 2CHZA 2MWSB 4JV5L 3AE5B 4YY3Q 2NN6G 3CF5A 4M8MA 3LDZE 4HIKA 2FFKB 4XDXA 4RAUC 1HZ9A 4QUFA 1R4MB 4R9WA 2Z0EB 2DNFA 4YXDB 5FLXc 3NK9A 4KHPQ 3AEGB 3C1FA 3EQLC 2XWJB 1FCCC 1PH4A 4JYAL 4HJ5A 3K0YA 1GUGA 3ENEA 1ZP0B 3VUXA 3H3VH 4K6LA 1IBKQ 1BCPF 4BY1B 4S3SA 3OMCA 3N32A 2UU9Q 4A3PA 2M2LA 3MXNB 2JQOA 3P4QB 2CHBD 4JI1Q 2LUEA 1HUMA 1FD6A 2B2YA 3NVWA 5FLXL 3A9KA 5TSSA 2KCNA 2E74C 3ZDTA 1Y14B 2WB1E 4JWSC 5E6PA 4DHJD 3CPFA 5AJ3Q 1WY8A 4F7XA 2K3UA 4NPSA 4LLGM 1TWAH 4A3DG 1HJPA 4JI2Q 1WMHA 2NVTH 1LO5D 4A3CG 5NUCA 2OEOA 5JH5C 4GN4B 1YQBA 1IL2A 5ELCA 2K05A 1NI2A 4URKA 1YEZA 4A3OA 1WWTA 2L0CA 2BYFA 3N6RA 4DV7Q 3OW2A 2F4VQ 1E2ZA 4RCOA 2QMTA 3H8HA 2LFIA 2EPBA 3TL5A 5EQ0A 3S1MH 2XWBB 3T1HQ 3ULJA 1C4QA 5KGUA 1Q3LA 3RNBC 4GNXC 3DLLA 3MHSD 1TS3A 1QVCA 4RMFA 2CHWA 2JT4B 3TEZA 4REZA 3N30A 3R8BA 2K01A 3L17A 2VZAA 3KLRA 2Q2UA 3GE3C 4CYEA 1SROA 1JOOA 2LJ5A 3A9KB 4DR5Q 4A3LG 2M19A 2IO2B 1KHIA 2KJHB 2KMMA 4JI0Q 1WYGA 5GQOA 4DU9A 4DV1L 1XJVA 2B2WC 3NE5B 2AEHA 2KWCA 3KFUA 2LWPA 4WWPA 3PUZA 4CKEA 4FN2A 1E5WA 4EEWA 1AFPA 1V97A 3I63C 3MHZA 4HDOA 4HVBA 5C5LA 2EVBA 1D3ZA 4YSYB 3P4SB 2F0PA 3VR9B 3PQIA 4C1NK 5M3FG 1JWUD 2AWOA 3I72A 3S1RB 2ZNVB 3ZYYX 1W2BA 4K81A 1MJCA 1VDVA 2OXPA 4HEDA 5C0XG 2BVCA 3HRDD 2MSED 1Y8OB 3D6CA 3D6WA 2FHTA 1VQPA 1WXSA 1Y56A 2MBEA 2Y3AA 5IOIA 2D10A 4JX1C 2I46A 1EWHA 1O78A 4JI5Q 4A3GH 2JEAI 2JRHA 3WIMA 3JAME 2K5DA 3G4SA 1NUCA 3I55A 4GLAC 3HKZE 3A1QA 1LTSD 4X64L 4IZ8A 1SNDA 1CQFA 3AU5A 3QARA 4KVGB 2J52A 2Y5CA 1YJNA 2V1CC 5D6JB 4L5SA 4AUQC 1V1PB 1LGRA 4RKBA 4Z9CB 5FJ8H 4N58A 3VXWA 2KX3A 2EKIA 2ONQA 1D1IA 3MTNB 1TWHB 1SYCA 3ECIA 4K2KA 4GOCA 1H9KA 2DBYA 1CZGA 2NBVB 1T5XD 4POGA 3MFYA 4US8A 4X66L 4MGZE 1A5RA 2KEDA 5CBEE 1PRTF 2K5HA 3AULA 4ZRJA 4GS3A 3N1YC 3CKIB 3K5OA 2KWDA 2O6VB 4OWWB 3KJOA 2PO4A 4C3JG 3IXSA 2I1JA 1CZWA 5CORA 3S17H 1ACCA 2W9NA 3IBEA 3VR5A 5CYUA 2L9HA 2UUCQ 4DWFA 3IL8A 2H5XA 1OTRB 3NZ3A 2VQEQ 1FFVA 4X3SA 2DLBA 5C3JB 1GB1A 3A8IE 1KAWA 4JC0A 1SF0A 4KLKA 3A1QB 3B1LX 2AL6A 4II3B 2KN4A 1RDPD 5ELDA 3M7GA 5IGGA 3P2BA 2NN6H 1WJJA 2SOBA 3TZDA 1XMOL 1EIYB 4L23A 2LASA 3HHMA 1TIFA 1QCBD 4W9GA 2L1BA 3VR6A 1LM8B 1H8CA 5HKHA 1EF5A 1Z2MA 1HZ5A 2XGTA 1CSPA 2MO0A 1KD1C 3DBHI 3DM1A 4DV4Q 2LMCB 2IPKD 4EQPA 1C8CA 3M3YB 3KUCB 3VR2A 5C23A 1K28A 4WQMA 3SEBA 3BDCA 3QIAA 2LXCA 4A75A 4B3SL 1YN3A 1ET6A 5EKIA 3AE6B 4NPNA 4LFAL 4MM3B 3T8MA 4BWGB 3AE9B 1V81A 1LV9A 2N7EA 3T9LA 4PMCA 4RGMA 2L00B 1FMAD 1G8ZD 2OOBB 4MGIE 1C3TA 4Y7NH 1YMHE 1SNMA 2WXLA 3VUYA 1GXDC 3HOYH 4B9XA 1SSOA 3HUIA 4X3TA 3J81L 3MJ5A 4I65A 4IC7B 1L1OA 4FXGC 2CS4A 4A9AA 2IY0B 5JPNC 3RZWC 2WNMA 4PYZA 4HMIA 1JWAD 2HTME 4WWMA 2YU9B 3T53B 2DAFA 4A3CH 4JV5Q 2V3SA 1T3QA 1T0RC 3I4MH 1HZCA 3QB3A 5CV9A 3H09A 1LT6D 5J22A 4IFDH 3H7PA 4GOPB 3MA2B 2CWAA 1HA5A 4ALPA 1WTWA 1A3TA 2F0MA 2WS3B 4AIMA 1VF5C 4RCNA 1VQGA 4B9WA 5M5YH 1ENFA 1R4MI 4X57B 4JIOU 4DA2A 4U673 1J5EQ 3Q3JA 5AZGA 3GTKH 4DXFA 1ROEA 3N1XC 5KNCA 1TYGB 4GN5A 4XT1B 2KFKA 1KRTA 4BY7H 4PZ7A 3DBRB 1LXDA 1VQCA 2KHIA 1N61A 2REXA 3CSFA 4MH0E 2KVMA 4QGUA 2F0SA 4A3LH 2VNUD 3U4ZA 2PPBC 1MG8A 3F8TA 2BYTA 2V9HA 1IPGA 2A74C 4YWLA 1X1MA 1FYCA 1QVFA 2BW2A 4XQQA 4GDLA 1EYCA 1YN5A 4GU2A 4ZRQA 2N9LA 1SE4A 3JC66 4OX9Q 1A2UA 2HE7A 3PT2B 1VCBA 2KDIA 4NXNQ 3EECA 3LNNA 1P98A 4GNXA 3TEYA 2E2IB 2WP8J 5C0XH 2BWFA 1A62A 3QJYA 1C77A 3L0WB 5K36G 2MCNB 1IW7C 2HD5B 3KK7A 1WIAA 5BR8Q 4TMAB 3IFTA 1YJ1A 4KGRA 5C4XG 3DEOA 2ZEQA 5JVH3 2KFKB 3QK0A 4I6LB 3PO2H 3WCQA 1P1AA 4Q0FA 3NWTA 3KF6A 1TR5A 2NVTB 3EFCA 4HPMB 1HTPA 2MGSA 2W55A 3J80c 1C4PA 2R92G 3PGZA 1XEEA 2KDBA 3Q8BA 2BF8B 3QC8B 3VA7A 1K8GA 4RFBA 2IX0A 4DK6C 4XE0A 4TSSA 1K8AC 1HCZA 1WCMG 1LTTD 4LF4Q 1JJGA 1FPYA 5E4WC 4MJSA 4RF1A 3SDZA 3AFQA 2LI5A 3LX0A 3QJZA 3S1MB 4GDLB 4DHZB 4UY8C 4K7UA 4YSZB 4K0KL 4C3JH 3CD6A 2K9XA 2KEEA 2WXGA 2V0GA 3PLVA 3ONSA 1VZ7A 3A54A 1UWVA 2EYMA 5D3DA 1ZXTA 3GD7A 1DOKA 3J80L 4YWMA 1SFOB 2E8GA 4P74A 3BY4B 1CTMA 2RSOA 2QA4A 3FILB 2UXCQ 4C3HG 4AP4C 4IUQA 4K5WA 3DDCB 1PH3A 2VRRB 1PFNA 3AEFB 5HI1A 2I5HA 2BE5D 3NWSA 2EYOA 2MPMA 4X62L 1GUOA 2DY8A 4IURA 2DYMA 4AH6A 2X38A 1WI5A 2L11A 2BCOA 4YIJA 2OWOA 2D3GA 4WAFA 2NTTA 1X56A 5LMNQ 1YNJD 3HKSA 3P20A 2XBBC 2EZVA 1F2ZA 1L0VB 3CMMB 2KLGA 1PRTB 2ZPNA 3CAMA 3VR3A 4MNOA 2HJ8A 3FEWX 2ZJPA 3ULLA 4A3MG 4OVZA 3Q3MC 3RN9C 1HFGA 1I94L 4PMWA 3DHHC 2IDYA 3DHIC 4L5TA 5EKKA 4X66Q 3E0EA 4RG1A 4A3GB 1EY7A 4IPCA 4RM8A 1IYFA 4LF6Q 4BXXG 2MHVA 4QB4A 4WJ4A 4H02A 2ZJRA 1BMLC 1VMPA 2PI2A 1LYLA 3TN2A 4JI6L 4W9LA 2C7NB 3A0JA 3KBGA 4P1CC 2JA5B 4JI3L 2F03A 2FAZA 1SNPA 3KLSX 1S1QB 4CDFC 3MC0B 5J18A 3NTHA 4DR6L 5FKAC 3MXUA 1CKNA 1XMQQ 2N78A 2RDGA 3J81i 1CQVA 3UGBB 5COYA 2HIVA 4A3KG 4M00A 2Y0SB 3TS2A 4JLCA 3DPDA 4X3UA 3D8GA 4QQBX 3VHTC 3S17B 2BWES 2M1MA 4R1JA 1YZ6A 3DVNV 3DWPA 2NBUA 4KK7A 2VY3A 4XGAB 4K8JA 4TQUS 3K59A 1GAQB 2F1MA 2JU6X 3Q2AC 5CX3A 4AJWA 2K5VA 2GA4B 3OTOL 2GI9A 2JA7G 3SK4A 1C78A 3NSWA 4PK1A 1GM5A 1HQMC 3RN2A 3FPUB 5JJZA 1TS2A 3R2TA 1U0LA 4KD4A 1IW7D 1Q8IA 1WGGA 2LS01 2B2VC 1XNQL 1I6VC 1I6HB 4FYDA 4HJ9A 4FBJB 2K03A 1TKYA 2L52A 2MJEA 3X0WA 1NCVA 1MI0A 3P63A 2IX3A 4OO1I 1Q46A 3BVGA 4HJ7A 3S14H 3OWEB 2N9KA 4NMZA 3RZDB 4JBWA 3T4AC 1FXIA 3VR8B 4KN4C 5T8IA 3BJUA 2HHHL 3F1ZA 3CMAA 1X6OA 1FJGL 3E56A 4HCSA 3HOXH 1EYGA 4DHZE 1WGYA 2FCMA 2KBNA 4NP5A 1EIHA 1CA6A 1MJEA 2JSOA 3OWFA 5CV5A 4Y7NB 2KFJA 2Z59B 3RCZA 4XXEA 4BOZB 1WD0A 1KTKA 5CHVC 5K36H 3GTQH 5GAGC 4JE3B 3NZUA 1E1TA 1SMYD 2K5NA 5C4XH 3D4WA 1SJHD 1DGJA 5BO4B 2VXWA 1FM0D 3CCJA 4A3DB 4GKJL 4HCEA 1U4AA 1MHXA 4WAAA 4OVUA 2ZTEA 3A56A 1Q86C 4HROA 1FNVA 2WIIB 3HOVG 2R92H 2MP2A 3VYSA 2DZKA 2LGYA 1YVCA 3SK8A 5JEAG 3Q8CA 5L83A 3K5MA 1JOQA 2F0UA 3AM9A 3I3TB 1ML0D 3MVVA 4B3RL 3DBRI 5DPWA 3GTLB 5M5XH 1RKNA 2QCZA 1WCMH 4AS1A 5M5YB 1PH9A 2JA8G 3BK1A 5IO9A 1PTOH 4LNIA 3ZNGC 5H1SE 3GV6A 4FP5D 3L16A 4YTMB 1K73C 3GTKB 2JWUA 3Q6SA 1SYBA 2CQOA 4E6IA 1N32Q 3Q23A 2B2UA 2KXJA 4IM3A 4YCUA 1ZUD2 5EE0A 4R8NA 4J6IA 4LUZA 4BKSA 4DUZL 2ZXOA 3H3VI 2INCC 2J53A 4FF4A 2UYZB 3Q22A 2ZVOA 4OWXB 3J80i 4RHSA 1C9FA 2ID0A 3KDFA 2EJGC 2R2QA 1TU2B 1KABA 3ZNZB 2IWHA 3ZUNA 5FR3A 2X6LA 4I7ZC 4C3HH 4KHZA 1T0QC 4IJHA 4FF1A 2LEKA 5D2MB 4TKNA 4K3CA 2MP2B 4BY1H 4ANXA 4YY3L 5M3FB 4LF8L 1QJOA 1AEXA 2Y0SE 1BR9A 1Y69U 2K6AA 3UDFA 4A3MH 1OQYA 3ABVB 1SYFA 2Q8IB 4KHPL 1NR2A 3J7A5 1XCTL 2I38A 1EZ6A 2EOTA 2L1AA 4EQ5A 1B2TA 2ON8A 4RM9A 2LD9A 2GBMA 3LGJA 4G0NB 5BN5A 4US9A 1SBBB 2CR5A 4K7WA 4WH4A 2D2QA 1OXXK 2B8FA 1IBKL 1JJ2A 2WP9B 1V5OA 1IBMQ 4UPAA 2QJLA 3AE1B 3WAPA 2UU9L 4NXMQ 1PA6A 2KMCA 3VAWA 1IKLA 1VQOA 3GTJH 2D2CC 3AEVA 2WXNA 3CXCA 3UE1A 4LNOA 3NPPA 5AJ3L 5A2QE 1JC7A 3CCSA 2LY7A 1JRUA 1LTAD 2NZ1D 5KEEA 4A3KH 1C0AA 2BS4B 3M62B 4JI2L 4C3JB 1I42A 2MBBB 1EY0A 5C3XA 4RA8A 1AE2A 3R93A 3TP5A 4HTHA 2PW5A 1OEYA 3L3OC 1O7YA 5DPTA 3SXHA 3OIPA 5IKCM 4ZRPA 4DV7L 1AH9A 2F0GA 2F4VL 4G3XB 3OLMD 3AECB 1OTCA 1XLPA 2WYQA 4DXGA 3ERSX 4Q5VA 3M85A 5HGQA 1TJEA 2JA7H 3EFUA 5ELOA 2L76A 4NJCA 4BBNF 4YSXB 1F52A 1TS5A 1RFAA 2IO1B 3K7AH 1H9MA 4WWOA 2KUMA 2EKEC 1NE3A 1SR3A 1T9HA 2MNAA 4LDTB 3LWUA 3NQIA 4J8QA 5I9PA 3S1RH 1BUIC 2IY5B 2N8NA 1EY4A 3BINA 2WDRB 2WXJA 1ZGUB 4A20A 1R4NB 4JI3Q 5C4HA 1SIJA 3NY5A 2XRQD 2B8GA 2BGFA 4DR6Q 1IBXB 2B3AA 3PLUA 3NENA 4W9HA 1BBUA 2IW3A 2LRUA 3L9AX 4NNJB 3DVGX 3OJ3A 3AB5A 2CJNA 1IL8A 3O13A 4ME5A 1I4RA 3FAHA 1M4VA 1TWHH 1WF9A 4IUMB 1H95A 2F3WA 3TEWA 2D3BA 2F0VA 4HJKA 1YNTE 4RF0A 1P16A 1PH5A 3E6ZX 2Z8LA 5IT9c 1DOIA 2PE9A 1JE4A 2LUMA 4JI5L 3PCOB 4FULA 2WXPA 1WTVA 2ZW1A 3RT3B 5CV6A 4CDCC 1CT1D 1ILQA 3T3OA 2BPSA 1W3SA 3KF8A 2CKHB 4IUPA 5DAUA 2C9WB 3SVMA 1AP0A 5G3LD 4EZJA 4KMUC 1BOSA 5JEAH 4MEMA 1QUQB 1WGHA 3L2PA 2KAJA 4IPDA 2MBQA 2NN6I 4LFCQ 4FXDA 3K5LA 2K0PA 3DHGC 1EIFA 1GJZA 3MTSA 2JA8H 2C7MB 3RNFC 1F9RA 5IT9L 2WU5B 1XPUA 3I4LA 4X6AH 1AN8A 2I5MX 2G9HD 1MBYA 2WWZA 1HNWQ 1LT5D 4U68A 4IOIE 4XDCA 4KX6B 4M02A 5DPSA 3T3NA 4K7SA 3MHBA 2NWGA 4B0MA 3UDGA 4DAYA 2UUCL 3SR6A 2W3RA 2FMMA 1RM6C 2J4XA 4NDXA 4H2AA 5LLIA 1DGSA 1EEFD 5IYCH 3GQBA 2VQEL 4DV3Q 1FGBD 1SGHA 3F2UA 1K50A 4PMBA 3QOJA 1CM9A 4IW0A 1WRIA 2K5PA 5DEHA 3EA6A 4A76A 2B63G 2KTRB 2A5UA 1WJNA 2MBOA 4HDQA 5DNFA 4HK2A 4TV3A 3PIOA 1QKZA 4GKJQ 2IL8A 1U4MA 1KAAA 1WTQA 1N36L 3CF6E 1P9DU 3FVQA 2ZVNA 2VL6A 4RMAA 3Q3FA 4OIKA 3TMEA 2F0LA 2IX1A 3H15A 4BBRG 2N1VA 2QC8A 4B3RQ 4IM0A 2JY6A 2AUKA 3L13A 1HXYD 1EOTA 2R7FA 3GTQB 2LXKA 4PV1C 4CJ2C 1VQ5A 2N88A 4P7IA 4K3BA 3PRPB 1WJ4A 5C4XB 2ATWA 1CMXB 2EY1A 2YU9H 1JT8A 3GP7A 1SYEA 2AHOB 3K58A 3S1NB 3AMUA 1SIFA 2R92B 1PZID 1B70B 3HZXA 2Q8RE 4QF4A 3NQTA 1KIXA 3GE8C 4LNNA 3RNAC 3QWNA 3EC8A 1N60A 2FCNA 2Q8TA 1I4XA 4LFBQ 3AH7A 1L0WA 3RI7C 1HZBA 3BDLA 1VQMA 2HQEA 5T1IA 4N9TA 1WCMB 4ZUJA 3ICEA 2KD0A 4DF7A 1X3QA 1NNXA 4HSPA 1WRDB 2WQYB 3R7RA 1SLJA 1JALA 3MEFA 4KIKA 4XQJA 3NTKA 4FF3A 4RNAA 3PUXA 1PDXA 1C9OA 3ZRCA 4CKCA 4YL8A 1UBQA 2JEBI 1JRPA 1YNXA 4LF8Q 1YJJA 4GOPC 3FKIG 1M90C 3CQZH 4IOAA 2DYOA 1EY6A 2Z1CA 3NELA 1SJED 1RCVD 3KLWA 4PZ6A 4QUCA 1ZDVA 3M4PA 1EY9A 2OTLA 4P71A 3PIPA 3VYTA 3PPAA 1VQBA 5C4JB 4B0EA 4C3HB 4JVZA 1FRDA 1J5EL 2WXMA 4ANWA 2LXAA 5C0XI 4OXPA 4JK1C 5E4XA 1QVGA 3DVNU 4NZLB 4MACA 2DAJA 2MEKA 3OPOA 1E2VA 4JPBW 2L7RA 5IN7A 3C1EA 3WOEA 1D7QA 4BS9A 2K33A 3CIRB 4YWGG 4C7ZA 4DK1A 4E3CA 1JCKB 1N5WA 4P6VF 5TR5A 1A3VA 5EJWA 2WXOA 2K25A 4CGYB 2VZKB 2CU3A 2E2IH 5D7GA 2I2YA 3PRMB 1IBLQ 1I3QB 2AMCB 1Z7TA 2WFWA 2A68D 4A3MB 3W3AA 1QB5D 2KC2A 1E7ZA 1MJDA 3BK2A 1I5FA 5DM73 2WDTB 1E8YA 3VYRA 3D32A 3H3VC 3S15H 4KKIA 1TZ1A 3CC4A 4DK3C 2OTJA 1LM0A 3U4EG 1E6EB 1VQEA 1VQHA 3NVZA 2ZM6Q 4OX9L 3HM6X 4G11A 4EKUA 2JXMB 4L63B 1CHPD 4NXNL 1HA6A 2MLBA 4FDBA 1VQKA 1AYFA 3I4NG 3OHXC 3QIJA 4MTNA 3GTJB 1H9JA 2WU2B 4CDEC 1ESFA 5BR8L 1E10A 1G6PA 1PGXA 1ZKHA 4A55A 2SNSA 3VDYA 1FO4A 3F2BA 2L0FA 2WINB 4A3KB 4GN3B 1EU4A 2QSDA 4C56C 2EXDA 4CO7A 3EN2A 4EQOA 2DWQA 2KANA 1SFOH 3GOEA 1IYVA 4HPPA 3U50C 3A8JE 5C44G 4AOFA 4LK1C 1TXYA 3STBC 1RF2D 1ZXHA 1J6QA 3VTVA 4LF4L 2EYHA 4RGOS 4DV2Q 4A93G 5J39A 1R4NI 1ZPSA 3VR4A 5EPJA 2JA7B 1VLBA 1WMHB 4FA6A 4UHVA 2N3SA 2RCFA 2K04A 4HXDA 4P16A 1Z6HA 2KKCA 3K7AB 1Y8RC 3L54A 4L2YA 2D07B 2ZPYA 4BVUC 3DWQA 4XYQA 3ZIMA 4IPGA 1SNCA 1FRRA 3HG9A 2HDMA 2VW9A 1S3OA 3IT4B 4JGHB 3DMUA 3NP8A 1KNEA 4H0LC 4WURA 1XF5L 2D3AA 2BQQA 2QEJC 2L0TA 4TQ0A 1LT4D 3TIXA 3P4RB 4CKBA 4IDIA 3VQIA 2UXCL 4E71A 1XCQL 2F3VA 4ZUIA 3IFDA 2XIWA 1MIUA 4MDKE 3GS2A 1H4RA 2CW0C 4KV6A 1FVIA 2FUHB 4LJOB 3D31A 4AQYQ 2F0FA 3AQQA 5LMNL 3S16H 2FCQA 2YEPF 4OONA 3D4DA 1PYWD 1WTHA 4BKGA 1X3FA 2HUGA 4IKGA 3V3XA 2JA5H 1QNKA 1N63A 5E1FA 1W6JA 3BZCA 4UP8A 3HEJA 2EYLA 3CRLC 5E3FA 4KKTA 5IODA 5JZEB 3QAQA 3OMGA 3W5OA 5KYLA 4KJOA 4XTCS 2WACA 4PS7A 3JAMc 4LF6L 1DD2A 1Q12A 2JZZA 1SXTA 1H9RA 1MKHA 1SYGA 5IP7G 1EL0A 3B0AA 3V62A 2GBRA 1QOGA 3HOVB 2V1YA 4DV5Q 5LMNW 4O2DA 4A3IG 5FOBB 3OAWA 3R66C 3I56A 2NVXB 3IT6B 1HTOA 4KGSA 3NJTA 1STGA 2JA8B 1XMQL 3AE2B 3MXGA 1D5MC 3FC4A 4AJYB 3PSEB 4IALA 2MH7A 2FIDA 3GO5A 1ASYA 1XT9B 3JAML 1TTNA 3RZFA 2UWQA 4J3OD 2C35B 2RSNA 3VTWA 3P1HA 3LYYA 1Z5SB 1N36Q 3B9JA 3FKIH 1I6HH 3ETRA 3TZUA 4JOIC 1IHZA 3PO3G 2Z4HA 2BB5A 3KJPA 2AX5A 3Q8EA 2K14A 5HG2A 5HHDG 5G55A 2E2DC 3U58A 1WTPA 4ABNA 1IKMA 3J81E 1Q5WB 3RZDH 2DY7A 5DLQE 1PGBA 1FL0A 4DGZA 4KY5A 1WR1A 2RKSA 4HIDA 1ET9A 2F0EA 2OQ0A 1PFBA 3FMCA 2IHEA 3G6JB 4YHHQ 1WM2A 2Y5PA 4W9DA 1B7YB 5EAYA 5IGBA 3NBHA 1GOZA 1UE6A 2J0TD 2NVQH 2FBWB 4BKTA 2BE5C 3ZJTA 5C3EG 4KSKC 5JHBA 5CMDA 1J7BA 3PMFA 3HK0A 2GBJA 1ASZA 1YNJC 1TT2A 4FNFA 3IRBA 2ZW0A 3R3MA 3DHQA 1YBYA 1FR3A 4Q2JA 2CJOA 4ZQ3A 3STBD 4ZAIA 2WX1A 4A3DH 1D8LA 1I4QA 3URYA 2Z0DB 1CSQA 3RUZA 2Q2IA 3V96A 1E1OA 1VQIA 1Q90A 1PH8A 5I2XA 1O7IA 5T1GA 4A3EG 2DX5B 3LJ3A 4MSQB 4W9CA 1II3A 2EYFA 2WGSA 3TS0A 5IGCA 4JBJA 3I3CA 3A4SC 2HDEA 1OXSC 3GTLH 1WZ0A 1Y8PB 1BCPB 3H7SA 4GXBA 1XD3B 2NBFA 4L5RC 2N9EB 2WV6D 4LNFA 1GKHA 3N20C 2AUJD 5IWAQ 4IM2A 3L08A 1K8OA 1N8RC 4DAVA 4K6DA 4XT3B 3L10B 1LQBA 4CJ1B 4W9IA 4G4KA 2D3CA 1NTGA 3DBLB 4DXAB 5C44H 1ESRA 2CW0D 3CQZB 5DM63 3VH3B 5M9OA 4JG2A 1L1OB 2JE6I 5GAEC 4GLSC 3TP7A 4KDIC 1E8WA 2KACA 2BYVE 4B3MQ 1Y1WG 1KLVA 1YHAA 1N32L 4A90A 1BNZA 3BDOA 3H7PB 1YNND 2WXIA 1L5PA 3P4PB 2K5QA 4MGYE 4KTAA 3W1BA 5M3FH 1HNZL 2RA4A 3BVMA 2F0OA 3BS1A 4DR7L 1C76A 1NMFA 1B3AA 4IO9A 2E3TA 3RYTA 1HTLD 2KT7A 4YCWA 3J7YW 5C2TB 1K83H 1DONA 3U30A 2JXXA 1QOBA 2BS3B 1VCIA 4V190 1SEBD 1EQQA 2JJQA 3S15B 3QG1A 5HURA 2IYDB 5IYBG 5AUIA 4HWIB 3EIVA 2DNCA 1STAA 4OIJA 1L4DB 5I4DA 1G6ZA 3AE3B 2B2WA 1J9OA 3ZJYC 2I0QA 1N5XA 2IGGA 1AZPA 5E6JA 3PF4A 4N6EB 3BVZA 1STEA 4K14A 1GB4A 2K4KA 1JB3A 2KQSA 3M95A 3CCQA 1TWCB 2GBNA 4IWPA 1PMRA 2D0PA 3QHTA 4LW1A 3A74A 2DENB 3B2GA 1ICFB 2DHZA 4WJ3M 3OW7A 2GRIA 3C2PA 5FLMG 3EUB2 2ICIA 3H0GG 1IBML 5IYDG 1M8AA 4GNXB 2O5IC 5FK9C 1WE7A 4NXML 4AQ7A 3U9SA 1SMYC 1VQAA 3GDEA 1X3GA 1PZKD 1CHQD 1IZ6A 3Q14C 2N7DA 2RDHA 3AU4A 1WD1A 1I4PA 3K80C 3SR1A 3Q69A 2I07B 4MSMB 1HQRD 1L0XB 2M0AA 1WX7A 3ZDMC 4KHVA 1PHJA 1B1ZA 3KF6B 2F4IA 1QOHA 1SRUA 3PREA 3N1ZC 3AEEB 3ZRFA 1AW7A 4OL7A 1WXMA 2N1WA 2KHJA 1D1KA 4WRDA 1BO0A 5GROA 4DAPA 1C1YB 1TKGA 4BBSG 2NPTA 4C3IG 4CBVA 2WXKA 2WHIA 1N9WA 1S72A 1KDAA 2HT1A 1F2MA 2JRIB 3E5SA 3KH0A 1VMCA 4MJSB 4QAYA 4FO2A 3TDQA 3UIPB 1GC6A 5JJIA 3SGIA 1VZ6A 1FCLA 2N9XA 2GLSA 5EBCA 2LRWA 2H1EA 4PS3A 1OQQA 2B63B 2MO1A 4LF9L 3SU8X 2PW7A 4IN3A 3S9WA 2F0HA 1XYIA 2JF5A 1OXTA 4OW0A 2RGFA 3PSIA 1M1KC 3S16B 2G4SA 2X6GA 4WJPA 2WKCA 2XK5A 1DOYA 1K51A 5JAVA 5C3EH 3P75A 1A6XA 3W5VB 3SK5A 4W9FA 4BBRB 4NQKE 5KHQA 1FEHA 1V1OA 1BUVT 2QEXA 4DR4Q 4WJQA 1NYQA 2K22A 3KQ4A 4JOIA 5FR6A 3KWLA 2AYOB 2BA1A 1SSNA 5JPMC 2PVGC 1PUTA 2L4NA 1CFMA 1NEKB 4A3EH 2L3ZA 3SFDB 1K53A 1IXRA 2DN8A 2M8SA 4TUUA 3T1YQ 4IQZA 2C5LC 3BZKA 2O4XA 1LTBD 1N34Q 4R3DA 3TBLD 5HY6A 1WE6A 3AE7B 1WX9A 4K5VA 1RTOA 2M0XA 3BYTB 2W54A 2PVOD 2QDFA 4JI4Q 4GDKA 1GUTA 2CQAA 2J7ZA 3M3JA 3NZSA 3EROA 1X9NA 3C46A 4N59A 4DR3Q 2L12A 2D5GA 5AZHA 3NOBA 2UUAQ 3FKIB 1LUZA 1RFKA 4LFCL 2LFNA 1CKNB 1AWDA 4L6TB 1U4LA 2PQAA 3HOWG 2GMIC 1IP9A 3ZNHB 4IFDJ 3PGEA 1PYBA 1UGMA 4XYOA 1U4RA 5D3IB 1SDFA 4P72A 1GVPA 5KIXA 5LMUQ 1Y1WH 5CGKA 1QG7A 2QF7A 1HNWL 3EFXD 1HNXQ 2A4ZA 5CHFA 4R4QA 2KOXA 3PIO3 1ILPA 3TP8A 2KVZA 3P42A 4C00A 1OQRA 3FP9A 2NVQB 2Z6KC 4LF7L 1E2WA 4DV3L 2RCNA 1ZKOA 3GTPB 1O7LA 1GHJA 1YHBA 1KDCA 2MJ8A 1D2BA 2K8BA 2FNJB 4K2LA 4PS8A 1T0YA 3CPWA 4JQWC 2W3SA 4XIGS 2FJ2A 1S40A 3NVVA 1LTID 2A8VA 1HR0L 1VQ9A 3E3XA 2OT2A 4WFN3 1EOVA 1PDQA 3CHBD 4YT0B 3RNCC 2VQFQ 1EZ8A 3VYUA 3S1NH 4KKUA 1PFMA 4HIOA 2NS5A 1AZQA 3PHXB 4EE2A 4I6PA 1NBWA 2UXBQ 5IA7A 1IYUA 3ER0A 1H9SA 5A35A 1ZOYB 2BBCA 4FJYA 3V6EB 2V4DA 1PYSB 3CCUA 3I4NB 2H89B 3BU2A 2IY1B 2PQAB 3FDTA 1Q1OA 2JZPA 2LZ6A 3DBLI 5CTRC 2JUOA 4HJ8A 4HCNB 4XC2A 5HFYA 1TWGB 3CRKC 5BN3A 1R7SA 2PLPA 2OJRA 1UEAB 3PTFC 1J8IA 1OO9B 5FO8B 1B53A 1LFDA 3KOJA 4PG3A 3RULA 5FLMH 3H0GH 5C0XJ 3I4OA 4L1BA 5IYDH 2MJ3A 1HNZQ 2D11A 5M3MG 3HGBA 3TUOA 5C4ZA 4DR7Q 2X69A 4OZAA 2JN4A 5C44B 4KKJA 4LFBL 1VQFA 5C4JH 2K1FA 4A93B 3RMKC 1PTOC 1SNQA 3TEHB 5EE1A 2PKOA 2UU7A 3MWYW 3AEAB 3PUWA 3PV1A 1SAPA 2J0KA 1DYQA 3FPPA 3PIP3 4HEA1 4MH8A 4DQOC 2B2TC 2DGYA 2JZ3B 3AE4B 2V4LA 4MN3A 4ID6A 3VDZA 4IWQA 5G5GA 4A4IA 2F52A 1IYJB 2QILA 3SE0A 2VH1A 3PHWB 2V4IB 3KYCD 1I3QH 3G7LA 3JSVA 3NUHB 2MP1A 1EO6A 4M0WA 3AYHB 3SHLA 3VFKA 2MHJA 4IJLA 2DZMA 1JROA 5LHY1 1K83B 1ONLA 3D4RA 4E74A 5J1ZA 5BMHA 1R9TH 1NDDA 3K0XA 3ONAB 1TGZB 2ASQA 2MQJA 4BXXH 4QMGA 3Q8AA 1UF0A 2G4DB 3MJWA 2SDFA 3KDFB 1EY5A 4YCVA 3ITPA 2F0TA 4OELB 4YWKA 2D62A 4A3FG 2PI2E 2NZHA 1IBLL 2BH2A 2KTFA 5IP4D 2PE6B 3MAQA 3BWUD 4OO1G 2KMAA 3SD5A 3ML9A 5G3LF 5GAHC 3I57A 4DBGA 3H94A 2JSVX 5AFWA 5IGEA 3W9CB 3TRZA 4DNIA 1P8LA 1GUNA 2K8CA 4FXKC 1DOMA 1CKOA 3GZNB 4C7YA 4G7ZC 2JA9A 2EXZA 4V0BA 3UI3A 1XO3A 1GJXA 1Q10A 1UZXB 3OIQA 3RLFA 2ZM6L 3P1MA 1F9QA 3NRZA 2XTIA 4R4OA 1X3PA 2OCEA 1UE7A 3KW5B 4B3TL 1KJTA 3IVFA 1XLNA 1UUPA 4A3IB 2KK8A 3I8ZA 3WDNA 3PF5A 4WWNA 4CJ0B 4HRSA 2M00A 3K8AA 4KY6A 3VUWA 3O65B 1MHHE 3N52A 1L6UA 1EY8A 4UP7A 3UE0A
chains in the Genus database with same CATH topology
2C5CA 4IUNA 2BA0A 5EKLA 1W6KA 1KDBA 1HRJA 2RPVA 2B2YC 1G91A 2KCCA 2KQ4X 2XNAC 1B9MA 1EEID 1YQ3B 4ARCA 2PZWA 3PO3B 1HZ6A 1PFDA 4UDUC 2KQ3A 2LHDA 2OF1A 2WKDA 3ZJVA 4OHJA 4RKLA 5A2QL 2PZTA 4RWSC 2NTSA 2BDOA 1IGDA 4QIWB 1KNAA 3GTGB 5EPLA 5C3EB 1TKEA 1TIID 1LT3D 1QOFA 2B2VA 2ACZB 3H6MA 2XRSD 2N0SB 4XDDA 5GXGB 2A68C 1PTOD 4O42A 4A3EB 1ZXIA 2TSSA 3VRAB 1NI3A 4NW2A 1EM7A 1CK1A 5C3WA 1SYDA 4LMQD 2HCIA 4JPSA 2JX5A 4F8MA 4NAWB 3GTMB 2VZKD 4ZYSA 1PZJD 2IGHA 1SB3C 2EDGA 3TBIB 4ZLTF 3PZ7A 1BQQT 1A2TA 1R4PB 1Y1WB 3EGRA 1D6EC 1HHVA 1F0ZA 2IT1A 3AEDB 1JWMD 5EE3A 4ZKCB 2MUYA 1RODA 3TP6A 2JYEA 5F2DA 2WXHA 2F0NA 1B50A 2PNRC 4QCLA 2FINB 2XSCA 2E76C 3UI2A 2WDVB 1K52A 2BT6A 2K7VA 2A6EC 2MJDA 2B2TA 2O2LD 1UAPA 2AQ1B 2KHSA 2VB2X 1WTXA 2RDFA 3MZ5A 4A6QA 3RFZB 3BG3A 5CV4A 4LAAA 1EYDA 1P7EA 3H0GB 3IAS1 3T51B 1F9SA 3CWIA 3KWVA 1DM0B 3QOLA 1F2RI 3EJIA 3X3MA 1MVKA 5FLXE 3S1QB 1LABA 3T16A 2KOLA 1MSGA 3MXNA 2AQ2B 4F87A 3KLSA 1I4HA 4CQNA 1UWMA 4BBSB 3WOFA 4C3IB 2LJIA 2WXQA 1NSNS 1F2YA 1ZYRC 2A73B 5CR3A 1UWXA 1KRHA 5ELFA 2OEDA 1B4OA 1STNA 2K28A 1DCZA 1R9TB 1K8MA 2PMVA 2XVSA 1RTNA 3TSSA 1LTGD 4KGTA 3LB8C 1YJIA 1Q1BA 2SAKA 3DEPA 5JOBA 2N7JA 1PGAA 1TVXA 3ZGZA 4PNYA 4HKQA 5BMGA 1QF6A 4IUVA 2A5HA 3A7LA 4OGQC 3BIID 3N9YC 4K5XA 1DOLA 1WGKA 1EWCA 1FFUA 4G57A 1MD2D 4IFDG 1JWSD 1EQVA 4J6HA 2PW9A 1ENCA 2QDBA 3RZOB 5KYIA 3MP9A 2JYOA 1VJKA 2FMCA 4WIPA 1EFID 3M4OB 1V1PA 2NUCA 2A6ED 2SNMA 1A15A 3HOWB 2E6XA 1O7ZA 5JEAJ 2EY5A 4RGTA 2WDQB 4WORA 3I73A 3B2FA 1JQ4A 1PRTC 1CZPA 1CI3M 4HMJA 5EGTA 3NBIA 1HPCA 1YNNC 4K8IA 4PT5A 5I6WA 3TEWA 1QNUA 3R3OA 2RBMA 5JVG3 1EWYC 2E2JB 3NS1A 3I90A 1S5BD 1BCPD 5D65A 4UAIA 1U4PA 1T6BX 2HDLA 3R2IA 2R6GA 1XWEA 1S4ZA 5I9OA 2ZXPA 4XWTA 3P7JA 1BBXC 2WLBA 2JXTA 1O80A 1ZYRD 1ZDXA 1T5EA 2F0DA 2LMCA 3RMHA 2RMMA 5H8YE 2PYKA 1SE3A 3NTIA 5M3MB 1IBXA 1KLGD 4KJNA 2IJ0A 1TQOA 1X32A 3I91A 5LL6X 1WXQA 2VB3X 1NAPA 3BZDB 4TRDA 1HEZE 2PZUA 1KFYB 2XN9C 2F0WA 3HS0C 1Q1EA 1XXGA 3ND8A 1MGSA 3GTOB 2FUG1 5I2YA 2G9DA 4ODGA 5I6YA 1JOKA 3M7NA 3S2DB 4TQ1A 2PIAA 1L6VA 1WTOA 3SFEB 4N9PA 1E9MA 1VRAB 1NVID 1P7FA 1QILA 1RD9D 2ZXRA 3MFGA 4A3FB 4NAMA 4ZRZA 3K57A 2RQXA 2K1BA 3FRPB 3OSOA 4EVOA 1STYA 1FXAA 5JXVA 2KJXA 3HRZC 2QCPX 4HN7A 3AMZA 4KI0A 3K6OA 2GB1A 3PUVA 4LTUA 3NXWA 1PRTD 5ELEA 3T56B 1I50B 3A7AB 2E75C 1DXMA 3RD4A 2INNE 1S5CD 1PXUA 2NB0A 3Q24A 4IUTA 1WVLA 3ZQ4A 4PQXA 1D5XC 5CBAE 2L32A 2JP1A 2Q5WD 4DK0A 4ZHOA 2N55A 2EJFC 1C79A 2W82A 4HR7B 3AU7A 2KA7A 1DZ1A 1E0ZA 1F2RC 5C5MA 3Q0AA 1EQTA 1J7AA 1XX8A 3U9OA 3PZ8A 3M4YA 3J80E 4OZCA 2EE1A 1S5FD 2B2UC 1FNWA 3W2DA 2IGDA 4ZOHC 2TMPA 5IGFA 3FILA 3IAYA 4G7OC 1EYAA 4LJZC 3V05A 1TWAB 2ICEC 1G291 2ZT9C 1JR0D 1TZOA 5IOCA 2CVRA 5BYSA 2V3PA 2YEPB 1WTRA 3J7AF 5G5HA 4KY7A 3VA5A 5CC4A 4A8XC 4ZHPA 2JA6B 1I7HA 1N62A 4ULLA 2F0QA 2G1EA 5C6AA 3K5NA 2R93B 5BYRA 5LL6S 1A3UA 5EPKA 3IKJA 4P2CB 3H91A 5KNDA 2NYZD 1TS4A 1PLFA 2B76B 3EVQA 3U52E 3T13A 2BTEA 2BB6A 3MXPA 3J9CA 2PTLA 2M56B 1D5ZC 1G2SA 1IUEA 1VDZA 4DNTB 3PV0A 3V2TA 3L7ZC 2PMZB 2DNEA 5HGTA 4USAA 2ENBA 1I4GA 3BYYB 4WJWA 4HJGE 1V8CA 4RGNA 4F88A 4ILWA 1JW9D 1VF7A 2M9VA 2R3ZA 2BOSA 3NUCA 4MT5A 1YN4A 4DFAA 3MEHA 4RH6A 1OFFA 2VUMB 3TEXA 2A69C 4AYBB 1XLOA 2Z4IA 3PO0A 1SNOA 1A70A 3E9SA 1MPEA 3RPFC 1LLRD 2E2HB 1Z47A 1JWBD 1OXVA 2SEBD 1KH0A 5AUKA 2O5JC 2L5TA 1JMLA 2WXFA 1STHA 4MHEA 3AE8B 3HOUB 3LXFA 4A3BB 1ZEQX 3NHHA 1ZE3D 1F9PA 2K32A 1GHKA 4C80A 4HSVA 1B44D 4GDKB 1F2LA 2H4OA 5D14A 2K5WA 2KECA 5BYQA 5KRUA 5ISRA 5IIFA 1LACA 3DUZA 1L4ZB 4M1UB 3DWMA 2QIEB 4XWWA 4BA2I 3HOYB 1GUWA 3DXJC 1R4QB 2A6HC 3OOCA 2L83A 1JORA 1GPXA 1JICA 5BN4A 1GUSA 3I4MB 3KUPA 4M8AA 3E0JA 1QOAA 5H92C 5K5PA 3AV8A 2F0JA 2F0KA 1NENB 3U7ZA 1TY0A 1KF6B 1HUNA 1H9SB 2LKVA 4C2MB 2B39A 4RHRA 2LGIA 2OHFA 1B9NA 4BY7B 1LTRD 2LHEA 5BMIA 2EY6A 4KN7C 1QE6A 1C48A 2EYPA 4YTNB 3AN1A 1KLUD 2EJMA 3C3LA 4L8JA 1FIQA 1RWSA 1EIGA 2HCCA 1PTOF 4MIUA 2A69D 1BXTA 4H44C 1ICWA 4FXCA 4KKSA 4R8IA 3W5UB 1BDOA 1ENAA 1CA5A 1XTCD 1SE2A 3I9V1 1NYRA 3S2HB 3ERQA 3PO2B 2JYTA 1XLQA 5M5WB 5FO7B 4OZBA 3PUYA 3X3NA 2AQ3B 1EU3A 1Y8NB 5CV7A 2J42A 2H88B 4ITKA 2L55A 4EGVA 3ZJUA 4EQNA 1DOXA 2WAQB 5LNK1 2F0IA 1F77A 2BDNA 4ZK9B 2KDMA 3AB9A 3QO2A 4FF2A 1YQ4B 3HVDA 4IUUA 4LK0M 2INPE 2D5DA 1HFNA 1NR4A 4HKZE 3CU7A 3HP3A 1RYJA 1CJEA 1C4AA 1S5ED 2A6HD 3SK6A 3U2SC 1U9RA 4C1NI 1VR9A 1WSPA 4XQNA 5CV8A 3ND9A 5IT9E 2NVYB 1B9RA 3Q8FA 3GV3A 1FD7D 4H7BA 1FNUA 5FO9B 2JQRB 2EY2A 3C8YA 1S5DD 4D2KA 4KD3A 4CHTB 3VRBB 5EE9A 4JWUC 1TY2A 3W1SA 4TKOB 3KBXA 4X3KA 3I70A 2EELA 4ARIA 2WB1B 1E0BA 4FVMA 5IGDA 2BS2B 3GB1A 1JQYD 2PCFB 1STBA 3DWGC 1G2TA 1UGJA 1J7CA 2R61A 2V3NA 1UNSA 1Y1VB 1RJTA 1V43A 3LWEA 2FE8A 1DJRD 4NKLA 3A55A 1QQRA 4B08A 1TWFB 1MSHA 2QKIC 4A3JB 2NMQA 2RVLA 1MI2A 2EYJA 1L0YB 2PQEA 4J1MA 3NVYA 2R7ZB 4GZYC 5ELBA 1BF4A 3S14B 2D9UA 5MPOA 4G7HC 1TKWB 5KNBA 4YTPB 2AWNA 3HOXB 2C9OA 2YYZA 1D4BA 3D3RA 4OO1H 1QT9A 3HVZA 3A8KE 4BA1I 5EBDA 1IGCA 3HOZB 4IFDI 4HAEA 1QWYA 3DWAA 1RHPA 1OXUA 1QLBB 3AEBB 1C4CA 4DN4M 3L4PA 1V8QA 3IAM1 4ZKBB 4H13C 1BCPC 4DNRB 1E7PB 4O1NA 1VZ8A 3HKZB 5M5XB 2WXRA 1PTOB 3J7AV 3AE5B 2NN6G 2FFKB 4XDXA 4RAUC 4QUFA 4R9WA 4YXDB 3NK9A 3AEGB 3C1FA 3EQLC 2XWJB 1FCCC 3K0YA 1GUGA 1ZP0B 4K6LA 1BCPF 4BY1B 4S3SA 3OMCA 2M2LA 3P4QB 2CHBD 1HUMA 1FD6A 2B2YA 3NVWA 5FLXL 5TSSA 2KCNA 2E74C 4JWSC 4F7XA 2K3UA 4LLGM 1LO5D 5NUCA 2OEOA 5ELCA 2K05A 1WWTA 2L0CA 3N6RA 2QMTA 1E2ZA 4RCOA 3H8HA 2LFIA 2EPBA 5EQ0A 2XWBB 5KGUA 1C4QA 1Q3LA 1TS3A 3TEZA 4REZA 3R8BA 2K01A 3KLRA 1JOOA 2M19A 2KMMA 1WYGA 4DU9A 2B2WC 3NE5B 3PUZA 4CKEA 1AFPA 1V97A 3MHZA 5C5LA 2EVBA 4YSYB 3P4SB 2F0PA 3VR9B 4C1NK 1JWUD 2AWOA 3I72A 3S1RB 3ZYYX 1VDVA 2OXPA 4HEDA 5C0XG 3HRDD 1Y8OB 3D6CA 3D6WA 2FHTA 2Y3AA 1Y56A 4JX1C 2I46A 1EWHA 1O78A 2JEAI 3JAME 2K5DA 1NUCA 1LTSD 4IZ8A 1SNDA 1CQFA 2J52A 2Y5CA 1V1PB 4RKBA 4Z9CB 4N58A 2EKIA 2ONQA 1D1IA 1TWHB 1SYCA 4K2KA 1H9KA 2DBYA 1CZGA 1T5XD 3MFYA 4US8A 2KEDA 5CBEE 1PRTF 3CKIB 3K5OA 2KWDA 2PO4A 4C3JG 3IXSA 1CZWA 5CORA 1ACCA 3VR5A 5CYUA 2L9HA 3IL8A 3NZ3A 1FFVA 4X3SA 2DLBA 5C3JB 1GB1A 3A8IE 1SF0A 2KN4A 1RDPD 5ELDA 3M7GA 5IGGA 2NN6H 2SOBA 3TZDA 4L23A 1QCBD 2L1BA 3VR6A 1HZ5A 3DM1A 2LMCB 2IPKD 4EQPA 1C8CA 3M3YB 3VR2A 4WQMA 3SEBA 3BDCA 3QIAA 1IBXB 1YN3A 3AE6B 1ET6A 5EKIA 4MM3B 4BWGB 3AE9B 1LV9A 4PMCA 4RGMA 1FMAD 1G8ZD 1YMHE 1SNMA 2WXLA 1GXDC 4B9XA 1SSOA 3HUIA 4X3TA 3J81L 3MJ5A 4I65A 4FXGC 4A9AA 5JPNC 2WNMA 4HMIA 1JWAD 2HTME 4WWMA 2YU9B 3T53B 1T3QA 3QB3A 5J22A 5CV9A 3H09A 1LT6D 4IFDH 3MA2B 1HA5A 1WTWA 1A3TA 2F0MA 2WS3B 1VF5C 4RCNA 4B9WA 1ENFA 4DA2A 4U673 4DXFA 1ROEA 5KNCA 4XT1B 1N61A 2KVMA 2F0SA 2VNUD 2PPBC 2BYTA 2A74C 1FYCA 2BW2A 4XQQA 1EYCA 1YN5A 4ZRQA 2N9LA 1SE4A 1A2UA 3LNNA 3TEYA 2E2IB 2WP8J 5C0XH 1C77A 3QJYA 5K36G 1IW7C 3KK7A 4TMAB 3IFTA 4KGRA 3DEOA 5JVH3 3WCQA 4Q0FA 3NWTA 1TR5A 2NVTB 1HTPA 2MGSA 2W55A 1C4PA 1XEEA 3Q8BA 3VA7A 4RFBA 2IX0A 4XE0A 4TSSA 1HCZA 4RF1A 1LTTD 5E4WC 3SDZA 3LX0A 3S1MB 4GDLB 4YSZB 2K9XA 2KEEA 2WXGA 2V0GA 1VZ7A 3A54A 3J80L 2EYMA 5D3DA 1ZXTA 3GD7A 1DOKA 1SFOB 1CTMA 2RSOA 3FILB 4C3HG 4IUQA 4K5WA 5HI1A 1PFNA 3AEFB 2BE5D 3NWSA 2EYOA 2MPMA 2X38A 1GUOA 2DY8A 4IURA 2DYMA 2L11A 2BCOA 4YIJA 4WAFA 2NTTA 1YNJD 3P20A 2EZVA 1F2ZA 1L0VB 1PRTB 3VR3A 3FEWX 4OVZA 1HFGA 4PMWA 2IDYA 5EKKA 4A3GB 1EY7A 2MHVA 4QB4A 1BMLC 1VMPA 3TN2A 3KBGA 2JA5B 2F03A 1SNPA 3KLSX 3MC0B 3NTHA 5FKAC 3MXUA 2RDGA 1CQVA 5COYA 2Y0SB 4X3UA 3D8GA 3S17B 3DWPA 4KK7A 4K8JA 4TQUS 3K59A 1GAQB 2F1MA 2JU6X 2GA4B 2GI9A 3SK4A 1C78A 3NSWA 1HQMC 3FPUB 5JJZA 1TS2A 3R2TA 4KD4A 1IW7D 1Q8IA 2LS01 2B2VC 1I6VC 1I6HB 4FYDA 2K03A 1TKYA 2L52A 2MJEA 1NCVA 1MI0A 3P63A 2IX3A 4OO1I 3BVGA 3OWEB 2N9KA 4NMZA 3RZDB 4JBWA 3T4AC 1FXIA 3VR8B 4KN4C 5T8IA 3E56A 4HCSA 4NP5A 1EIHA 1CA6A 2JSOA 3OWFA 5CV5A 4Y7NB 4XXEA 1WD0A 1KTKA 5K36H 4JE3B 1SMYD 3D4WA 1SJHD 1DGJA 2VXWA 1FM0D 4A3DB 4HCEA 1MHXA 4HROA 3A56A 4L1BA 1FNVA 2WIIB 3VYSA 3SK8A 5JEAG 3Q8CA 3K5MA 1JOQA 2F0UA 3AM9A 1ML0D 3MVVA 3GTLB 4AS1A 1RKNA 5M5YB 3BK1A 1PTOH 3GV6A 4FP5D 4YTMB 3GTKB 2JWUA 3Q6SA 1SYBA 4E6IA 3Q23A 2B2UA 1ZUD2 5EE0A 4R8NA 2ZXOA 2J53A 4FF4A 3Q22A 4RHSA 1C9FA 2ID0A 2EJGC 1TU2B 1KABA 2IWHA 5FR3A 2X6LA 4I7ZC 4KHZA 4FF1A 2LEKA 5M3FB 1QJOA 1AEXA 1BR9A 1Y69U 2K6AA 3ABVB 1SYFA 2Q8IB 1NR2A 1XCTL 2I38A 1EZ6A 2EOTA 2L1AA 1B2TA 2ON8A 4US9A 5BN5A 1SBBB 4WH4A 1OXXK 2B8FA 2WP9B 3AE1B 2QJLA 1IKLA 2D2CC 2WXNA 3NPPA 5A2QE 1JC7A 2LY7A 1LTAD 2NZ1D 5KEEA 2BS4B 4C3JB 1EY0A 5C3XA 4RA8A 3R93A 3TP5A 4HTHA 2PW5A 3L3OC 1O7YA 3SXHA 3OIPA 4ZRPA 2F0GA 3AECB 1XLPA 4DXGA 4Q5VA 3M85A 1TJEA 4YSXB 4NJCA 1TS5A 1H9MA 2KUMA 3LWUA 3NQIA 4J8QA 5I9PA 1BUIC 1EY4A 2WDRB 2WXJA 5C4HA 1SIJA 2XRQD 2B8GA 2IW3A 3L9AX 3AB5A 2CJNA 1IL8A 3O13A 4ME5A 1I4RA 3FAHA 1M4VA 2F3WA 2F0VA 1YNTE 4RF0A 3E6ZX 2Z8LA 1DOIA 1JE4A 2LUMA 2WXPA 1WTVA 2ZW1A 5CV6A 1CT1D 1ILQA 3T3OA 3KF8A 4IUPA 5DAUA 3SVMA 1AP0A 5G3LD 4KMUC 1BOSA 5JEAH 2KAJA 2NN6I 4FXDA 3K5LA 2K0PA 3MTSA 1F9RA 5IT9L 2WU5B 3I4LA 1AN8A 2G9HD 1MBYA 1LT5D 4U68A 4IOIE 4XDCA 4KX6B 3T3NA 3MHBA 2NWGA 4B0MA 4DAYA 3SR6A 2W3RA 2FMMA 1RM6C 2J4XA 4NDXA 4H2AA 1EEFD 3GQBA 1FGBD 3F2UA 1K50A 4PMBA 3QOJA 1CM9A 1WRIA 2K5PA 5DEHA 3EA6A 5DNFA 1QKZA 2IL8A 1U4MA 1KAAA 1WTQA 3FVQA 4OIKA 3TMEA 2F0LA 2IX1A 2AUKA 1HXYD 1EOTA 3GTQB 4PV1C 4CJ2C 2N88A 5C4XB 2EY1A 3GP7A 1SYEA 3K58A 3S1NB 3AMUA 2R92B 1PZID 3HZXA 2Q8RE 4QF4A 3NQTA 3QWNA 1N60A 2Q8TA 1I4XA 3AH7A 3BDLA 2HQEA 5T1IA 4N9TA 1WCMB 4ZUJA 4DF7A 1X3QA 4HSPA 2WQYB 1JALA 4XQJA 3NTKA 4FF3A 4RNAA 3PUXA 1PDXA 4CKCA 2JEBI 1JRPA 1YJJA 2DYOA 1EY6A 2Z1CA 1SJED 1RCVD 4QUCA 1ZDVA 1EY9A 3VYTA 5C4JB 4B0EA 4C3HB 1FRDA 2WXMA 5C0XI 4JK1C 5E4XA 4NZLB 4MACA 2MEKA 3OPOA 1E2VA 3WOEA 3C1EA 4BS9A 2K33A 3CIRB 4YWGG 4C7ZA 4DK1A 1JCKB 1N5WA 4P6VF 1A3VA 5EJWA 2WXOA 2VZKB 4CGYB 2CU3A 5D7GA 2I2YA 1I3QB 1Z7TA 2A68D 4A3MB 3W3AA 1QB5D 3BK2A 5DM73 3VYRA 3H3VC 4KKIA 3U4EG 1E6EB 3NVZA 2JXMB 4L63B 1CHPD 1HA6A 1AYFA 3OHXC 3GTJB 1H9JA 2WU2B 1E10A 1ESFA 1PGXA 4A55A 2SNSA 1FO4A 2WINB 4A3KB 1EU4A 2QSDA 4C56C 4EQOA 2DWQA 1IYVA 3A8JE 4LK1C 1RF2D 1ZXHA 2EYHA 4RGOS 5J39A 1ZPSA 3VR4A 5EPJA 2JA7B 1VLBA 2K04A 4P16A 1Z6HA 3K7AB 4L2YA 3DWQA 4XYQA 1SNCA 1FRRA 3HG9A 2HDMA 3IT4B 3DMUA 3NP8A 1KNEA 4H0LC 4WURA 1XF5L 4TQ0A 2QEJC 1LT4D 3P4RB 4CKBA 4IDIA 3VQIA 1XCQL 2F3VA 4ZUIA 3IFDA 2XIWA 3GS2A 2CW0C 4KV6A 3D31A 2F0FA 2YEPF 3D4DA 1PYWD 2HUGA 4IKGA 3V3XA 1QNKA 1N63A 5E1FA 1W6JA 5E3FA 3HEJA 2EYLA 3CRLC 4KKTA 5IODA 3OMGA 5KYLA 4KJOA 4XTCS 2WACA 1DD2A 1Q12A 1SXTA 1H9RA 1SYGA 1EL0A 1QOGA 3HOVB 5FOBB 2NVXB 3IT6B 4KGSA 1STGA 2JA8B 3AE2B 3MXGA 1D5MC 3FC4A 4IALA 2MH7A 3GO5A 3JAML 4J3OD 2RSNA 3P1HA 3LYYA 3B9JA 3ETRA 3TZUA 1IHZA 2Z4HA 2BB5A 3Q8EA 2AX5A 5HG2A 5HHDG 2E2DC 1WTPA 4ABNA 1IKMA 3J81E 2DY7A 1PGBA 4DGZA 4KY5A 2RKSA 1ET9A 2F0EA 1PFBA 3FMCA 3G6JB 2Y5PA 5IGBA 3NBHA 1GOZA 2J0TD 2FBWB 3ZJTA 2BE5C 5CMDA 1J7BA 3PMFA 1YNJC 1TT2A 4FNFA 2ZW0A 4Q2JA 3DHQA 1FR3A 2CJOA 4ZQ3A 4ZAIA 1I4QA 3URYA 3RUZA 3V96A 1Q90A 5I2XA 5T1GA 1II3A 2EYFA 5IGCA 3I3CA 2HDEA 1OXSC 1Y8PB 1BCPB 2NBFA 2WV6D 2AUJD 1K8OA 4DAVA 4K6DA 4XT3B 4CJ1B 4G4KA 1ESRA 2CW0D 3CQZB 5DM63 5M9OA 2JE6I 4GLSC 3TP7A 2KACA 4A90A 1BNZA 3BDOA 1YNND 2WXIA 1L5PA 3P4PB 2K5QA 4KTAA 2RA4A 3BVMA 2F0OA 3BS1A 1C76A 1B3AA 2E3TA 1HTLD 3J7YW 5C2TB 1DONA 1QOBA 2BS3B 1VCIA 4V190 1SEBD 3S15B 3QG1A 5HURA 5AUIA 1L4DB 2DNCA 1STAA 4OIJA 3AE3B 5I4DA 1G6ZA 2B2WA 1J9OA 1N5XA 5E6JA 2IGGA 1AZPA 4N6EB 3BVZA 1STEA 4K14A 1GB4A 1JB3A 1TWCB 1PMRA 3B2GA 2GRIA 3OW7A 3C2PA 3EUB2 2ICIA 1M8AA 2O5IC 4AQ7A 5FK9C 3U9SA 1SMYC 1PZKD 1CHQD 2RDHA 1WD1A 1I4PA 3SR1A 3Q69A 2I07B 1HQRD 1L0XB 2M0AA 4KHVA 1B1ZA 2F4IA 1QOHA 3AEEB 1AW7A 4OL7A 4WRDA 1D1KA 1TKGA 1BO0A 4DAPA 4C3IG 4CBVA 2WXKA 1KDAA 1F2MA 3E5SA 1VMCA 4FO2A 3TDQA 1VZ6A 1FCLA 5EBCA 2H1EA 1OQQA 2B63B 2PW7A 4IN3A 3S9WA 2F0HA 1XYIA 1OXTA 4OW0A 3S16B 2X6GA 2WKCA 1DOYA 1K51A 5JAVA 3P75A 1A6XA 3W5VB 3SK5A 4BBRB 1FEHA 1V1OA 1BUVT 1NYQA 2K22A 3KQ4A 3KWLA 2BA1A 1SSNA 5JPMC 2PVGC 1PUTA 2L4NA 1CFMA 1NEKB 3SFDB 1K53A 2DN8A 4IQZA 2O4XA 1LTBD 4R3DA 3AE7B 4K5VA 1RTOA 3BYTB 2W54A 2PVOD 1GUTA 2CQAA 2J7ZA 3EROA 4N59A 3C46A 2L12A 2D5GA 3FKIB 1RFKA 2LFNA 1AWDA 4L6TB 1U4LA 4IFDJ 4XYOA 1U4RA 5D3IB 1SDFA 5KIXA 1TYGB 5CGKA 1QG7A 2QF7A 3EFXD 3PIO3 1ILPA 3TP8A 3P42A 1OQRA 2NVQB 1E2WA 1ZKOA 3GTPB 1O7LA 1GHJA 2MJ8A 1KDCA 1D2BA 4K2LA 2W3SA 4XIGS 2FJ2A 3NVVA 1LTID 2OT2A 4WFN3 1PDQA 3CHBD 4YT0B 1EZ8A 3VYUA 4EE2A 4KKUA 1PFMA 1AZQA 1IYUA 1H9SA 5A35A 1ZOYB 2BBCA 2V4DA 3I4NB 2H89B 3FDTA 2JZPA 5HFYA 1TWGB 3CRKC 5BN3A 1R7SA 2PLPA 1UEAB 1J8IA 1OO9B 5FO8B 1B53A 5C0XJ 2MJ3A 3TUOA 3HGBA 5C4ZA 2X69A 4OZAA 5C44B 4KKJA 4A93B 1PTOC 1SNQA 5EE1A 2PKOA 3AEAB 3MWYW 4HEA1 3PUWA 4MH8A 1SAPA 4DQOC 1DYQA 3FPPA 3PIP3