2SEBD

X-ray crystal structure of hla-dr4 complexed with a peptide from human collagen ii
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
235
structure length
217
Chain Sequence
b'SQPDPKPDELHKSSKFTGLMENMKVLYDDNHVSAINVKSIDQFLYFDLIYSIKYDNVRVEFKNKDLADKYKDKYVDVFGANYYYQCYFSKRKTCMYGGVTEHNGNQLDKYRSITVRVFEDGKNLLSFDVQTNKKKVTAQELDYLTRHYLVKNKKLYEFNNSPYETGYIKFIENENSFWYDMMPAPGDKFDQSKYLMMYNDNKMVDSKDVKIEVYLTT'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HLA CLASS II HISTOCOMPATIBILITY ANTIGEN
publication title X-ray crystal structure of HLA-DR4 (DRA*0101, DRB1*0401) complexed with a peptide from human collagen II.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Complex (mhc class ii/superantigen)
total genus 67
structure length 217
sequence length 235
ec nomenclature
pdb deposition date 1997-10-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF01123 Stap_Strp_toxin Staphylococcal/Streptococcal toxin, OB-fold domain
D PF02876 Stap_Strp_tox_C Staphylococcal/Streptococcal toxin, beta-grasp domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.110 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 2sebD01
3.10.20.120 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 2sebD02
1LTBD 1PZID 5ELCA 3V05A 1XTCD 2AQ3B 3MFGA 4RGOS 1PTOH 3MC0B 3W2DA 1EU3A 1LTGD 1M4VA 1CHQD 1S5CD 3SEBA 1STEA 1YN3A 1UNSA 1LT5D 1YN4A 4RGMA 1FNUA 1TY0A 5FK9C 5I4DA 1PTOC 1FD7D 1MD2D 2J4XA 3EA6A 1DJRD 4C56C 1LO5D 2RDHA 1LTTD 5ELFA 1PTOB 1RD9D 2XRQD 1S5DD 1BCPF 1LTSD 1ENFA 1HQRD 1QILA 2NTTA 2TSSA 1PZJD 1SJED 1LT4D 1KTKA 1EWCA 1SBBB 4K6LA 1TS2A 1PRTF 1B44D 1V1PB 3O13A 3BYTB 1EEID 1HXYD 2ICIA 4L6TB 1JQYD 1V1PA 1TS3A 3GP7A 1I4GA 1G8ZD 1CHPD 4RHSA 1LTAD 1JWSD 4RCOA 2AQ2B 1SE3A 2NTSA 1AN8A 1LT3D 1EU4A 1I4HA 1RCVD 1RF2D 4RGTA 1D6EC 1XXGA 3BZDB 3R8BA 2IJ0A 1CQVA 1LLRD 1GOZA 5ELBA 4RH6A 1I4QA 4O1NA 2R61A 1LTID 1SXTA 3BVMA 1I4RA 3URYA 1AW7A 1BCPD 5ELDA 2QEJC 1SE2A 3R2TA 4DXFA 4NZLB 3DWAA 4OHJA 1HA5A 1S5BD 1LT6D 3R2IA 1PRTD 2RDGA 2O2LD 1L0YB 5D3DA 2IPKD 4TSSA 5D3IB 1PYWD 4L63B 1KLUD 1D5ZC 1FNVA 1CT1D 1FNWA 1D5XC 4DXGA 1TY2A 1PTOF 1RDPD 1F77A 5TSSA 1JR0D 1JWUD 1SJHD 1EFID 4UDUC 1TS5A 5ELEA 1ESFA 1S5ED 1V1OA 1JWMD 3KLSX 1S5FD 4RHRA 2SEBD 1BCPC 1ET6A 2Z8LA 1EEFD 3CHBD 1FGBD 3DWPA 2XNAC 1BCPB 1BXTA 3OWEB 1PRTC 4RFBA 2WV6D 1T5XD 1CK1A 1LTRD 3BYYB 1PRTB 1UUPA 3EFXD 3TSSA 1KLGD 4RGNA 1B1ZA 1PZKD 3BVGA 5FKAC 1SEBD 2AQ1B 1JCKB 2QILA 3DWQA 1DYQA 1TS4A 4Z9CB 1D5MC 1PTOD 1HTLD 2CHBD 1ET9A 1I4PA 2XRSD 2XN9C 3BVZA 1L0XB 4ZYSA 4BWGB 2G9HD 1YN5A 1I4XA 1SE4A
chains in the Genus database with same CATH superfamily
1VQ5A 4BVUC 1E22A 2RSOA 1B70B 3S2DB 1ILQA 4HLEA 1HNXQ 4BBRB 1U0LA 4FDBA 4R9WA 1GO3E 1G6JA 1CHQD 3OTOL 4W9JA 2EJGC 2KVRA 1PFSA 1PTOC 1BKBA 1FD7D 2B76B 4IUUA 2E75C 4LF8L 2BWFA 2BYFA 4LDTB 4WAFA 5EAYA 1VDVA 2WB1B 4TQ0A 3S1MB 2WS3B 2KZRA 1ZKOA 2N78A 4B0MA 4ID6A 2BA0A 3UE1A 2YYZA 3BU2A 2BDOA 2CU3A 5EPKA 4KZCA 4POGA 1F1HA 2MRPA 2KDMA 1PXUA 2JP1A 3LX0A 1VQ4A 3HOXH 1EIYB 5IYDH 1U4LA 4C3IB 5JHAA 2HIXA 1NNXA 4IFDH 1Y1WB 2EXZA 3FRPB 3RN2A 4G11A 3OG5A 3MHBA 4IUTA 1QG7A 5KIXA 3J80c 2OJRA 4BKSA 2N9KA 2FUHB 4J6HA 3CU7A 1EZ8A 2SDFA 5E6NA 3TP8A 3PRPB 4JBWA 3MWYW 2KWCA 4DHJB 1CHPD 3EBEA 4FJZA 5G2NA 3M4QA 4MHEA 2OEOA 5EE9A 3V2TA 1SR3A 2HDMA 2Y5BB 2AQ2B 2MO1A 1SE3A 1TR5A 2LMCB 1Z5SB 2JYEA 2MP2A 1TWCB 2ASQA 4FN2A 2O5IC 4TKOB 2KQ4X 3ZRFA 3EFCA 4C4VA 2R93H 3W1SC 1DOLA 3CCSA 2F3WA 2N9LA 1EY8A 4R4CA 2KO3A 2WDRB 5FR6A 3HOXG 3TP6A 4L5SA 2G1EA 3QHTA 5E6JA 2W54A 3GTPB 5BMGA 3DWAA 4JI7Q 3RZOB 4A9AA 2JSOA 1WXAA 5CX3A 4HJGE 5E4WC 3PO3B 1HH2P 1SYCA 4YTMB 3AE5B 1X55A 1XPUA 1P1AA 3OJ4B 3LB8C 2I1JA 4KGTA 1K52A 1R4NB 4GN1A 1GUOA 1RTNA 2MJDA 4KD3A 2UXDQ 2QGQA 1TQOA 1HNWQ 2LS01 2K01A 2N7JA 1P98A 2OEDA 4LNOA 4BFRA 1I35A 1MIUA 1V5OA 4JL9A 3CSTA 3I70A 5AZFA 3ZDMC 4HCEA 2ZT9C 3NSWA 1ET6A 5AEKB 4W9LA 1F9SA 3QJZA 4DAYB 2VUMG 2EIFA 1BCPB 3SK8A 1YD8U 2KDIA 3DWGC 3RNBC 4IPHA 4OW0A 4YHHQ 2N7EA 4BKGA 3I3CA 4ZUJA 2IY5B 1JALA 4PS8A 4HPMB 4FLHA 2LWPA 2UUCL 3AE7B 2F3IA 2CR5A 1KLGD 3P4RB 1F9QA 4GLVB 1IBKL 1NYQA 2FUG1 3NZSA 2X69A 2MJ8A 4XYOA 5LL6X 2ZJQA 2FHTA 4I7AA 3TN2A 3A55A 1SSOA 2JA8H 4DR6L 2UXBL 4DNIA 2K4KA 2K1FA 1LQBA 2FCMA 3WAPA 1MKHA 3A9KA 2AWOA 1Q1OA 2XN9C 4LFCQ 3H91A 2BOSA 4J3OD 2F0HA 3ETRA 1C3TA 1T0RC 2K6QA 3IAS1 1J7BA 4KHZA 5L83A 4HJ8A 1E7PB 1FO4A 4DK1A 1YITA 5I9OA 5KNCA 2WX0A 1NCVA 2K8CA 2ZTEA 4R4IA 1VQOA 1GNUA 4K5XA 5G55A 2N0SB 4L2YA 5KRUA 1GPXA 1VQHA 1DCZA 4JBKA 3B6YA 1QLBB 3AE3B 5IYBH 1GUAB 4Q0FA 2NVYB 4LNIA 5IGGA 4ZCKA 4DR2L 5KNDA 1R4MB 4KHPL 2LXAA 4K14A 4K2KA 2OXPA 3ZQ4A 5HGQA 1XMQQ 2NMQA 3I57A 4X62Q 3KF6A 4NXNL 2UUAQ 3C2PA 1JORA 4EOYA 2HIVA 3I72A 4C3HH 3HOYH 4A8XC 1GD7A 3A5UA 4GN3B 2K5QA 4DXAB 1CKNB 2KKCA 1KJTA 2XWJB 3NTIA 4F7XA 1KRHA 1UBIA 1YIWA 3TRZA 2JA6B 1G6ZA 4R4OA 5M3MH 2LFNA 3BZKA 1V8QA 3CCMA 1DOIA 1IGCA 5IYBG 1WJ6A 2EKEC 2Q8RE 2UYZB 4HCNB 4MDKE 1KOTA 2JEBI 1TWFB 4A3GB 2PZUA 3AEBB 4G0NB 2F0FA 1AN8A 2I1KA 3ZNHB 3BJUA 3HOZH 1IYJB 3P7JA 3AULA 2NVQH 4LK0M 1JJGA 4A3DB 4DV7Q 3I4NH 4HMJA 1QCBD 1I4QA 3NTKA 2Q2UA 1RL2A 4QQBX 1AEXA 4DPGA 3AH7A 3A1QA 4MNOA 5ELDA 2JJQA 2VQFL 1VQNA 1PUTA 2M1MA 4QUFA 1L1OB 4B9KA 1A15A 2BYTA 2F0KA 1O80A 1DGSA 4PMCA 4BBSB 3HOWH 3L54A 1SNPA 5IP7G 2AYOB 4NZLB 3P2BA 4J15A 2IPKD 3D4RA 2WWZA 4D2KA 3H0GB 3RUIB 4FA6A 3A4SC 3NWTA 2ZXPA 3WOFA 1SFOB 3KUPA 2VW9A 1QVGA 2L00B 5TSSA 1QZHA 4KIKB 5C3EG 3ICEA 1QVCA 5BO4B 4RNAA 3EJIA 2AHOB 3GZNB 2BTEA 3I4NG 1UH6A 1XPRA 1QF6A 4XDDA 2E2DC 2EPBA 4TQ1A 1I3QH 2MHVA 4XT3B 4KY6A 1B9RA 2AWTA 4CQNA 1KABA 3TJPA 2C5CA 1FEHA 1PDXA 1SF0A 4K8JA 2BGFA 1XNQL 4JOIC 1K9MC 5IOCA 4LF5L 3K81C 2WXJA 4BA2I 2JZZA 2XK5B 5BYSA 3MVVA 2EMTA 4JPBW 3WANA 1KAWA 1RFAA 2ID0A 2IX3A 3EFXD 1NVID 4M8MA 2R7DA 3BVGA 2D11A 4XE0A 1IL2A 3L13A 2H88B 5C4JH 1D2BA 2K32A 2RMMA 1ZDVA 2AUKA 1I6HB 1EY6A 3B1LX 3R93A 2CKZB 4LF9Q 2IGGA 3ZVVA 5L95C 1JQ4A 3A9JB 4LDTD 3CW2C 3PZDA 1FMAD 1SAPA 3FILA 2E6XA 3TEWA 1WXVA 4EX5A 4OVZA 4HKQA 3UF8A 1C48A 3ZNGC 1MHWC 2JA9A 3I4MG 1K51A 2B2VC 2M00A 4CJ2C 1T0QC 5JZEB 3PCOB 4H2AA 3GD7A 2ASBA 1QOHA 2K8BA 3ND9A 3AEDB 4N9F4 3P1HA 4A6QA 1UWVA 1NSNS 1BBWA 2XEWA 4YXDB 1HUMA 3D6WA 3DHIC 4AS1A 4XT1B 2HHHQ 1N6ZA 2Z4HA 1GVPA 3GTKH 1TKEA 3TQYA 3DVGY 1E2ZA 2JWZA 1LT5D 4IPGA 1P3QU 1XMOL 4DHJD 2B8GA 2VNUD 2NCNA 2MBQA 4JOIA 5FK9C 4XGAB 4AYBE 4DR3Q 5IGCA 2K6DB 1V49A 1Q8KA 1HE8A 3EN2A 5FLXE 2YTXA 4YWKA 4EQNA 4AQYQ 1LM8B 4A3BB 4A3LG 1LTSD 4HMIA 3MC9A 1ILPA 2V3NA 1PZJD 1RFKA 3DWMA 3P42A 3ZDTA 4IM2A 2QF7A 5C0XH 1HTOA 2LJIA 5D14A 2F0VA 3B0AA 4IFDI 1PYSB 3DBHI 3H7PB 1B44D 5AUIA 2QHOA 1WF9A 4DDGD 3ULLA 3Q3JA 2NPTB 5IYCH 1XWEA 2F0IA 5BN4A 3RN9C 1OXUA 2BCOA 4JI1L 2B2VA 1WRIA 2WU5B 2OHFA 3LDZE 1WCMH 2C5LC 1T0SC 2I5HA 1XMQL 2D07B 5IP9G 1P16A 1LTAD 1JWSD 4DV0L 1AZPA 2OOBB 1Q86C 2CHZA 2XBBC 1LACA 1SE8A 2E2HB 5JH5C 1EOTA 1EU4A 1WJ4A 2KYWA 1E7ZA 3BZDB 3NUHB 2CW0D 1KRSA 1X6OA 1Q8IA 3IXSA 3D3RA 2EDGA 4H0LC 2GVAA 1WZ0A 1YNTE 4RM9A 1BBXC 1BCPD 3J80L 3WAMA 2ICEC 4ULLA 4XTCS 4S17A 3VXWA 1B9MA 4JI5Q 5KEEA 2AKWB 3GTJB 1HA5A 1ML0D 4KKSA 1EY0A 1YNJC 3I55A 3PVLA 2YU9H 4DBGA 1J6QA 1GUTA 3RZFA 5JAVA 1FNVA 3ABVB 4TKNA 4P1BC 4AJWA 1BO0A 4DXGA 1VQLA 3TEXA 1TZ1A 1N32Q 1RDPD 3I73A 4A75A 4GB9A 1EYAA 1K50A 4K81A 4WORA 1TS5A 4GOPC 1QOBA 4EVOA 1JWMD 2H4OA 2A8VA 3KUZA 2JA5H 3J81j 2KTFA 2LFIA 3A54A 2Z9HA 3DEOA 3M4OB 3FKYA 2KFKB 3QCAA 4J1MA 2EYFA 1WM2A 2XNAC 2WDVB 1YHQA 5FJ8G 5IWAQ 1QOGA 3SFEB 1K0RA 2JPHA 5G5GA 3BYYB 1LGRA 1VQPA 2V3SA 3VTUA 2EYPA 2HE7A 3PPAA 1XT9B 5JJLA 1WWTA 4LJOB 4A3KB 3AB5A 3KW5B 3BS1A 2SNMA 2HD5B 2AQ1B 2L05A 1T5EA 2B2TA 3DWQA 5CR3A 2MNAA 4WJQA 1T3QA 1KLVA 3S1RH 3J81i 4MJSB 1Q82C 1FM0D 3V60A 2SOBA 2KK8A 5HY6A 3QR8A 1M94A 1I4PA 1XLOA 3EVQA 4BXXH 3RD2A 2L4NA 4FNFA 3RR5A 5J3BA 3ZJVA 1E24A 4JI3L 3NHHA 3SE0A 3EQLC 3VAWA 3A8JE 4NMZA 3H15A 2D0PA 1HZBA 1XTCD 2VL6A 4AYBB 3NEMA 4GOPA 4BBNF 3TZUA 2LVPA 4WWPA 2BQQA 4DAMA 3KOJA 4JBMA 3W2DA 3B2FA 1Q1EA 2BF8B 1L4ZB 4A3FB 1SDFA 3MZ5A 1FRRA 4JC0A 2QEXA 3PF5A 4HCPB 2HTME 5E6PA 4HIOA 1UAPA 1ASYA 1QQRA 2PKOA 2B3AA 4ME3A 3ER0A 2V3PA 5IIFA 4XQJA 1IL8A 3H6MA 3L17A 4K3BA 1WY8A 5J1ZA 2ZTCA 3FKIH 4I6PA 2KCNA 1C4QA 1WRDB 4WWMA 2QA4A 1ZXTA 3GE8C 4BXXG 2TSSA 3RMHA 1HFNA 2K25A 2K5NA 2HHHL 1T0YA 4AP4C 4DK5A 4IM3A 3QG1A 2WHIA 3G6EA 3LNNA 4C2MH 5CMDA 2Y5PA 2E76C 2N1VA 2MO0A 1TWGB 5AJ3L 3VRAB 2CHWA 4N59A 3J81c 5A2QL 1YX6B 5JVG3 1TKWB 4DR1Q 3IAYA 1YJNA 4HTHA 1H9RA 2WXNA 3T1YL 4G50A 3HOXB 2J0TD 3DBHB 4PG3A 2YTYA 5BN3A 2E3TA 2D62A 1K0SA 1Y8OB 2VZAA 2PQAA 3D32A 2KMMA 3TP7A 1TGZB 1NTGA 1SYDA 4NAWB 3H6NA 4W9CA 1AWDA 2XTIA 4A3PA 4YCVA 3BDLA 4UPAA 2Z0DB 3E6ZX 3IFWB 2RPQA 4DK3C 2FJ2A 1F52A 4W9IA 3CC4A 4KV6A 3OMGA 1W6JA 5FO7B 4CDEC 2Q2IA 3RLOA 2WXPA 2CKHB 1UEBA 1STNA 1TVXA 3S24A 2R93B 4WJ4A 3ML9A 1FNWA 4YT0B 3PRMB 1K3RA 4A90A 4LUOA 3K58A 1RJTA 3NG0A 4QY7A 2WXGA 1QJOA 2R7ZG 3EUB2 1E90A 3SHQA 4QB4A 3GE3C 4RHRA 4GIVA 1QT9A 4K8IA 4C7ZA 4X66L 4HJKA 5C3XA 3B2GA 1UEAB 1E7VA 2A68D 4GZYC 4A3GG 4X3TA 3OWEB 2C7MB 2GBRA 1SMYC 5CC4A 2LHDA 2ZZPB 1F9JA 1L4DB 1J5EQ 2A73B 5C1ZA 4B3MQ 2HJ8A 1UUPA 4A3DG 3E9IA 2ZM6L 2VZKB 1HTPA 5FKAC 4NAMA 1U4PA 1ZYRD 5ISRA 1Y56A 4OVVA 3EROA 3ONAB 2MUYA 3RNCC 5JVH3 3HOUH 4FXKC 4Z9CB 3S16B 2M56B 4M8NA 1BVSA 3GV3A 3W5UB 5GROA 4DV2L 3BY4B 4J6IA 1FVIA 2J52A 2UUBQ 2XSCA 3H0GG 3PUXA 2E2IH 1NYRA 3CIRB 4OZBA 2O6VB 3SK4A 4NPNA 5AZHA 2HJ1A 4P6VF 3IAM1 5IAAC 1I4XA 4II2B 1OEYJ 1E8XA 1EIHA 1VQBA 3V05A 2K5PA 2N9EB 1CFMA 1QUQA 2JXTA 1PTOH 1OTCA 2JA8B 1IKMA 1L7YA 1KAAA 2G4DB 1STYA 2L12A 4CDCC 2BDNA 3DHGC 3CP0A 4M0WA 4ACFA 2A6EC 4NQLB 4RGMA 1WMHB 3RULA 1J0GA 5T1GA 4C80A 3GTQH 3HOUG 1HCZA 2R92H 2F0NA 1JB7A 3P63A 4HJAA 4HRSA 2ZVOA 4Q5VA 4CDDC 5C0XI 1S4ZA 4GKJQ 5LHY1 1E8ZA 1FJGQ 1U4AA 3I5JC 3E3XA 4IUVA 4MSMB 2UU9Q 3KLRA 4K6LA 2KNBA 3PGZA 3KLSA 4IUMB 3HZXA 1KDCA 2K04A 3O13A 4LF7Q 3Q3FA 4HPPA 1F9PA 3CAMA 3K7UC 1SIFA 2WFWA 4OEMB 5FO9B 1VQGA 1P9DU 5EDSA 3AFPA 3EECA 2PMVA 3O65B 1AZQA 2ZVNA 1WFQA 2KENA 3WAOA 3ND8A 1RIPA 1O7IA 4WJ3M 3CC2A 2WXQA 3AE8B 4C3HB 3HOYB 1FGUA 4PK1A 4DK0A 1PGBA 1RAXA 2K5WA 3MA2B 4ZUIA 2DAJA 2E74C 3LWUA 2R61A 5CV6A 3GDEA 4B9XA 5M3MB 4C7YA 1FRDA 3MHZA 1Q0WB 1DONA 1VQMA 4BY7H 1IZ6A 3L7ZC 3MJWA 3UIOB 1Y8PB 2JF5A 1FL0A 4OIKA 4DR4L 4KGSA 2R7FA 3D6CA 2O5JC 4A3BG 2WU2B 3GOEA 3HOZB 2NVQB 2DUDA 2RHQB 2VB3X 1Q3LA 3I4NB 3K59A 4RA8A 4YL8A 3N52A 5TR5A 1CKMA 1TKYA 2IGDA 2VH1A 3DMUA 3H8HA 5F2DA 3W5OA 4UDUC 2K0PA 2ZNVB 2JA7H 3KBXA 3PO2H 1CUKA 3HOWB 2IX1A 5IY0A 2I46A 3OLMD 2RSNA 1DOMA 4L5QA 3SK5A 1IBML 4K0KQ 2LSSA 2M4NA 5DLQE 2FCNA 1C1YB 4N9TA 2K9XA 1GJXA 3JSVB 5C5LA 4YY3L 4BY7G 2MLBA 2JWUA 2V9HA 4DAYA 3M4YA 2KACA 5KNBA 2J53A 4OWWB 1IYFA 2RDFA 1V6EA 1UGJA 3W3AA 4A3CH 4A76A 3M95A 1I3QB 4UP9A 4BOSC 4QF4A 2DLBA 1V9JA 1SE9A 3IVFA 3K5MA 4DHZE 3SDLC 2KUMA 3T51B 4MM3B 3Q2AC 3P75A 5I2XA 4LAAA 1RKNA 3PO2G 2HQEA 4G7ZC 2AEHA 1EM7A 2MSED 1AFPA 5IGFA 1J5EL 4YCWA 4DA2A 2LXJA 2UWQA 3DBSA 3UQBA 2X38A 2G9HD 1Y14B 4B3RL 4DUYQ 3M62B 3C46A 3PUZA 5C4JB 1YJJA 2GBJA 1NI3A 2ON8A 4GN5A 2V4IB 3AV8A 4W9DA 4OXPA 4JI6Q 1A63A 3DBLI 4OWTB 1VDZA 3HKSA 5NUCA 1HZ9A 4KMUC 4NXMQ 2IO3B 3MAQA 2KDEB 3J9CA 1WI0A 3HKZB 2VY3A 4P16A 1GC7A 1STGA 2BS4B 3DOWA 4EGVA 1JRPA 2V4LA 4TUUA 1LXDA 1MD2D 4V0BA 4XDXA 2RDHA 2BPSA 2H89B 1OFFA 1NR4A 2KVMA 5JHBA 2B2UA 1HQRD 4LUVA 2GB1A 2A69C 2YEPB 1I94L 1MI2A 2N49A 4C3JH 3GTKB 2EYJA 5DM63 4A3KG 1XQQA 2C9WB 2JRIB 3NENA 4FHKA 3BDOA 3L0OA 3IL8A 4LMQD 1RTOA 3NVZA 3VR6A 5D6JB 2Y3AA 3MXUA 3BYTB 3MXNA 2MP1A 1T6BX 1ZEQX 3M9BA 4RKLA 5EPLA 1CSPA 2KHSA 1OEYA 4LJZC 2Y5CA 4X65L 1WI5A 2ZJRA 1TJEA 1WTHA 4HROA 1W2BA 1OGWA 1NJIC 4Y7NH 4RHSA 4DV5Q 3C3LA 2L76A 4AYBG 3OHXC 1E10A 2UU9L 3FHWA 1LT3D 4MGKE 5C44H 2LD9A 3CRKC 1UE1A 4EQPA 1D6EC 3I91A 2IWHA 4A3FG 4BS9A 3B9JA 4C3JG 3ERSX 4GDLB 5COYA 2GBNA 1WCMB 2NN6H 3QWZB 1P7EA 2KJHB 3J81L 1DGJA 2EJFC 3VYUA 2DN8A 2RDGA 1KDBA 1L0YB 1KNAA 1K8MA 1TT5B 3TEZA 2VZKD 1VF7A 3T16A 4FULA 1F2YA 2PZWA 1CT1D 4KKJA 4LF4Q 3AYHB 2PE6B 2DYBA 3PV1A 4JE3B 3MEHA 4HDOA 2L8JA 3V6CB 3V62A 3JAME 3NWSA 4DV3Q 1HFGA 2B8FA 4O0AA 1PV4A 1CJEA 2BBCA 3K5OA 1VD2A 2WXFA 4K7SA 2YU9B 3CHBD 1OO9B 2O6VD 3PO0A 1ZXHA 3E9HA 1NAPA 1EQQA 3CCRA 2NN6G 1QE6A 2CWPA 4IURA 5LMUL 3ZIMA 3NY5A 2EY6A 4DHZB 1X3QA 4A3JH 3CF5A 4XQQA 2A5UA 5IYDG 4JI4L 1ACCA 2MWSB 4AH6A 4IFDG 3DBRI 4B3TQ 4QCLA 1K83H 4DV4Q 4US9A 3TREA 3UIPB 1YHBA 2JA5B 2WKDA 3A0JA 2XK5A 4Q2JA 3HIZA 4RKBA 4ZHOA 5M5YH 1RWSA 1OXTA 5H92C 4HIDA 2QMTA 2AL3A 3TEHB 1R4QB 2ZPNA 4XWWA 1J7AA 3V96A 2ALYB 1CMXB 2ZXOA 2FNJB 1JICA 2RDBC 3AU4A 3TCAA 1E5WA 1D1KA 2ZCBA 1ET9A 2BE5D 2PW5A 4BWGB 2R93G 1YN5A 2P5ZX 2YTVA 3G48A 3T1HL 2BKFA 3PGEA 5LXHA 4APVA 1CA5A 3PSIA 4IJHA 1WFYA 5IT9c 4A3JG 2F4VQ 5IO9A 1IKLA 1YMHE 5CYUA 3MFGA 3S1RB 3TMEA 1L6UA 4HJ7A 4FADA 2QIEB 1LTGD 2IGHA 2GI9A 4NY0A 4JI0L 1STEA 1YN3A 3JVZX 4JG2A 1YN4A 1O7ZA 1C9OA 1TY0A 1FFUA 2A6HC 5I4DA 4U673 4WWNA 1D3ZA 4GNXC 2K5VA 1XTDA 4DDID 4REZA 4IFDJ 2L7RA 2DZIA 2Z0SA 1BCPF 2K50A 4X64Q 1Y1VH 1HZCA 1PFMA 3KH0A 3DBLB 3NVVA 3TZDA 1LT4D 3DQVA 3AEFB 4NXML 1KTKA 1EIGA 1Z6HA 3RZDH 3HOVH 2PVGC 1FCLA 1G6PA 4U68A 2DJGC 1N36Q 1JC7A 4RMAA 3ZO5B 3FKIB 2UXCQ 5E6OA 3CMEA 1EWHA 1LYLA 1TS3A 5C4XH 5K36H 2NPTA 4ZYNA 5EE0A 3X3MA 1XD3B 5GQOA 1SGHA 2KC2A 1XLNA 1CSQA 2F0JA 4GS3A 3S1QH 3U9OA 2KMCA 5IGBA 5CHFA 2ZTDA 3SHLA 3OYYA 4GMVA 2JA8G 5ELOA 5IE8A 4OWXB 4C2MB 3HHMA 4MZ9A 4YWLA 2WQYB 1HNXL 1J9OA 1PH5A 4O1NA 4A3MH 3PUWA 1EY9A 5EGTA 2GVBA 5GAHC 4GNXA 3T8MA 4DXFA 1CA6A 4IW0A 3E5SA 2X6GA 2B2WC 4DV5L 3H3VC 2R7ZB 2NVUI 2L3ZA 3RNGC 3R2IA 3ONSA 3HS0C 4BBNC 1H95A 1EYGA 4TSSA 1Z7TA 3QO2A 5C4XG 2KLCA 3HRDD 2FXQA 2ZCCA 1D5ZC 3AMUA 1WR1A 1QWYA 3RCZA 1TY2A 3IRBA 2CQOA 4ALPA 1X54A 4DV1Q 1VQDA 1JR0D 1JROA 4WURA 1Q46A 4IQZA 1QOAA 5A35A 3CCVA 1Z9FA 5I6WA 1OQQA 3A7LA 4CO7A 4LW1A 4RG1A 4DR5Q 1FGBD 3GO5A 2BS2B 2JRHA 2L52A 4ZRKA 5E1FA 4MIUA 4AIMA 3VR3A 5EBCA 3BK1A 1WYDA 3LYYA 3STBD 3W9CB 1KH0A 4P71A 1DZ1A 2LJ5A 4GDKA 3T3NA 2KFKA 1UZXB 4C3HG 1CK1A 3HOYG 4H13C 1B3QA 2IT1A 3KVFB 5DPWA 2QCZA 3NBHA 1M8AA 4KJOA 1PRTB 1YJIA 3SD5A 1HZAA 1PFBA 2NS5A 1K8RB 5IN7A 2F52A 4DV3L 1TYGB 2XVSA 2IY1B 5M3MG 1UD7A 1V9PA 2LGSA 2MH7A 2CVRA 2Z4IA 2M0XA 2B2WA 1V43A 4JW0A 1P7FA 3VTVA 5C3WA 1WGGA 2QC8A 2DYOA 3HOZG 3PLVA 2XRSD 1H9JA 4JI7L 2D10A 5JEAH 4V190 3DBRB 3N9YC 5M5XH 4EEWA 4EKUA 3FAHA 3R7RA 1NEKB 4RGOS 1VQ8A 3HOUB 3MC0B 2K1BA 3R3OA 3HOWG 1DOXA 5M3FH 1EU3A 1H9KA 1PH2A 4JYAQ 2UXDL 3C1EA 1HNWL 4AQ7A 4IUQA 4F8MA 2E2IB 4ODGA 2D3BA 2MP2B 1VZ6A 4X3SA 2EYHA 5LLIA 3DCGA 5JJIA 2F0QA 1NMGA 3VDYA 2FBWB 2MBEA 2MW5A 3R3MA 4XC2A 1BR9A 2K28A 1C4AA 1PTOB 1RD9D 3AE1B 4YHHL 1KIXA 2NTTA 5E4XA 1PGAA 5GMVA 2N4FA 5JEAG 2WXKA 2KEDA 3HM3A 4G3XB 3VR5A 3MHSD 4H02A 1BMLC 4UP7A 5EE1A 3M7NA 3F2BA 1YQ4B 2MHJA 4ZAIA 1V1PB 1WX7A 2PIAA 2UU7A 3GTQB 2FIDA 1HXYD 2R92B 2GOWA 3OSOA 5M3FG 1HHVA 3TUOA 1F2RC 2CJOA 5CV8A 4PQXA 4X64L 3S2HH 2O2VB 3GS2A 4A20A 1YX5B 3E56A 4LFCL 1JMCA 3GTLH 1AE2A 2R3ZA 4WJOA 4M1UB 3ULPA 4MN3A 2DENB 3H1UA 2HUGA 1PH4A 1A62A 3VRBB 3HKZG 4IN3A 2NN6I 3EIVA 2MBBB 3ZXVA 3OPOA 4UY8C 2WXLA 3BVMA 4OONA 1YEZA 3GTMH 3SVMA 1BUVT 2JK8A 3KLWA 3PIP3 3RN5A 1SE2A 5C2TB 3QWNA 4CKEA 2IYDB 4DUZQ 3RNEC 3K6OA 1UE7A 2G5DA 3I90A 4OHJA 1PH1A 3CKIB 5C5MA 4L5RC 1LT6D 1RODA 1X32A 3TS0A 4HWIB 5EKKA 1P8LA 1U4RA 3B08A 1IP9A 5D3IB 5G5HA 2ES2A 1WD0A 2NR2A 1PDQA 4JI8Q 1MSHA 5C4ZA 2C7HA 4NJ6A 5BYQA 3TMPB 5EQ0A 4BZAA 2V4DA 1V86A 4BBRH 3SFDB 3KF8A 1SMXA 4BY7B 4X62L 1EL0A 5ELEA 2UUAL 3JAMi 3I56A 1JE4A 2C60A 2JSVX 1S5FD 4YWGG 2PJHA 2LGIA 2PI2A 2E2JH 4PYUA 4K7WA 3K5LA 4ASWC 4K6DA 5C0XG 4KV2A 4FJVB 3CMMB 4W9HA 3C1FA 4DV1L 1HUNA 5D94A 2B2TC 2L5TA 3RI7C 5K5PA 5IYCG 1TZOA 1EQRA 3PO2B 3Q8DA 2JA7B 4GKKQ 3R7QA 4OX9Q 4G7OC 1WCMG 3P20A 3H9DA 2EE1A 4DV7L 1Y1WH 1TKGA 1YZ6A 1EWIA 2A5HA 5I6YA 3RLFA 2PPBC 1OQYA 1H4RA 1ZP0B 1H8CA 1XPOA 1TS4A 1J8CA 3T13A 3ZJUA 4I65A 3KF6B 4CGYB 3KQ4A 3L9AX 4FO2A 2L0FA 4JGHB 4PNYA 3JW0X 1VCBA 1H9SA 2PE9A 2OJWA 3H7SA 3NELA 2K33A 2EELA 3U50C 1ZXIA 4LJPB 1YJ1A 3LGJA 2PW9A 3N6RA 1N9WA 4L8JA 4MTKA 5M9OA 2GBMA 4JIOU 5CBAE 4E3CA 3CPFA 1L2NA 1IW7D 3GTGH 4CJ1B 1XCQL 1NDDA 1VF5C 5C0XJ 3K5NA 1NBFC 3HEJA 3ZLZA 1E8WA 1LTLA 1VZ8A 1WH3A 2X8XX 1PFNA 1G2SA 3A1QB 2OTLA 5IT9L 2L0TA 1JOOA 1ENFA 1BF4A 1DM0B 1M1KC 2JA5G 2NBWB 2QSDA 3L16A 3HUIA 3VYSA 2D0OA 4PS3A 5GXGB 1FD6A 4F7ZA 3MTNB 1WGYA 1MBYA 5IOIA 4BY1H 1C7YA 5J2RA 1CZWA 4RF1A 3HVDA 1B53A 2LXCA 4OGQC 1YJ9A 2ICIA 5DEHA 4LF9L 3KFUA 1JQYD 3DHHC 1LFDA 4WRDA 1MGSA 5EE3A 5FOBB 1WGDA 4UAIA 2HCIA 4C3JB 1GC6A 3S2AA 4A3EH 1YNXA 5FLMH 1WGRA 4R4QA 3PT2B 3DPDA 4WH4A 4HIKA 4JPSA 2H5XA 3RD4A 2DGYA 4GXBA 2RBMA 2L1BA 1SNMA 2N3SA 4DR7Q 1Q90A 2DZMA 4TQUS 2KDFB 3I3TB 3Q3MC 3ERQA 3HGBA 1VQAA 4FVMA 3OIQA 4NDXA 5LMNQ 3Q23A 3VR8B 2EMSA 2N55A 3C19A 2JZ3B 1I4RA 3A7AB 1AW7A 4L5TA 4GLXA 2NVXH 1KL9A 3R2TA 1V80A 2KC1A 3K9OB 4YSXB 4Y7NB 3RNFC 3M3YH 4G7HC 2RHSB 4IDIA 3VTWA 5ELNA 3ZNID 2JQOA 5CV9A 3MFYA 1PRTD 2HD3A 3SXHA 5C44B 4DR3L 3I9V1 2IHEA 3RZWC 4PZ7A 1SNCA 4A4IA 3BWUD 4AQYL 3FILB 3KWLA 4EZKA 1JRUA 3HG9A 4A3IH 2INCC 2Y0SG 3ITPA 2PYKA 1E6EB 3J80E 4HXDA 1JWUD 4KSKC 4DK6C 3ZJTA 4X3KA 3X3NA 3KJOA 1JE5A 1S5ED 3FKIG 2EQSA 1V1QA 1LM0A 4DUZL 4MSQB 2N88A 2NZHA 4L1BA 4LFAQ 1YBYA 1EEFD 3VR2A 1PA6A 4EQ5A 4KN4C 1VMPA 2NYZD 4BKSD 1WGHA 4DGZA 2LGDA 1IBLQ 2K22A 2ZEQA 4JI8L 3NUCA 4B9WA 1HR0Q 2LVOA 4IJLA 3JSVA 4XZ4A 1LABA 1A5RA 3UI2A 1XJVA 4B95A 4KK7A 3PMFA 1WE6A 1LUZA 2KJ6A 1GKHA 1PZKD 2OT2A 1GB1A 1N62A 1NENB 1K8GA 1IBXA 4CJ0B 4A3IG 2KT7A 3SR6A 3J7ZC 3MEFA 2DAFA 1MFWA 2REXA 1I5FA 3PHXB 4A3JB 1G291 5CV7A 3TL5A 4KGRA 1PTOD 1SLJA 2WXOA 1PH9A 4RM8A 2JA6H 1K83B 4JI5L 3UDGA 3AB9A 1L0XB 2KJRA 1P0RA 2D5GA 2MJ3A 2KX0A 4RF0A 3CQZH 5M5YB 1BQQT 4KKIA 3MC8A 1WTXA 5J18A 4EFOA 1HTQA 1UE5A 1C4PA 2RD0A 1MSGA 2K75A 3GQBA 2B2YC 1WXQA 1E0BA 3QK0A 1N32L 1GHKA 3I2ZA 2M19A 5I9PA 1SRUA 3KUCB 1M4VA 2JU6X 3FC4A 2W55A 3SDZA 1F0ZA 2MA9B 3RMKC 2ZXRA 4P73A 1HNZQ 1BT0A 1EQTA 3EA6A 3CD6A 2MQJA 4N6EB 5IWAL 2FCQA 3CWIA 1ONLA 1VMCA 2R2QA 3J7YW 1N34Q 3H09A 4F1SA 2AL6A 3BIID 2WAQG 3EC8A 3DXJC 4YTPB 3HFZB 3NS1A 1ASZA 3DUZA 2QKIC 3I8ZA 3PIO3 1EWYC 1WX8A 2K7VA 2K05A 4XQNA 1NE3A 4JK1C 4B3SQ 1EF5A 4LF6Q 1GUWA 3APFA 1Y1VB 4M00A 4TRDA 3U4EG 1QNKA 2KEEA 3GP7A 1S3OA 2K52A 4R1JA 1XF5L 1D8LA 2C35B 4HJ5A 1FXIA 3PHWB 3M4PA 3RZDB 3HOVB 2B2YA 4BAXA 2NTSA 2VXWA 2INDC 4ILWA 2CJNA 3KWVA 4FYDA 5G3LD 1I4HA 4I7ZC 4MTNA 1WJJA 1IUEA 1SROA 1GOZA 5IODA 2KN5A 3K0XA 3A33B 2WDQB 3HKZE 5C4XB 5A2QE 2BWES 4WWOA 5BYRA 3UINB 1WTRA 4IPDA 3VUYA 2WKCA 5JJZA 3G6JB 2XIWA 3EGRA 3S1QB 3OWFA 4AUQC 4HSPA 4N9PA 1E1TA 2NWGA 2IO0B 5D3DA 1PYWD 4L63B 2B63H 3P1MA 3TIXA 1QVFA 1D5XC 3RLNA 4XX5A 2K14A 3QOJA 2MJEA 2CW0C 2KCCA 4CDFC 2JVCA 4QJFA 2R92G 3OTOQ 1EUVB 1UWXA 4FXGC 4LLGM 1V1OA 1N5WA 3AECB 3AU5A 3KLSX 2GRIA 3N32A 1BCPC 2WLBA 3NJTA 4GOPB 3R66C 2LMCA 2QW7A 4LF8Q 3HP3A 2RSUA 1EUJA 2PPHA 3PLUA 1DOKA 1U9RA 4N8X1 2EYMA 3PTFC 4WJNA 1PFDA 1GHJA 1NR2A 4LCDE 4DR1L 3NS8A 2OTJA 2WINB 1W3SA 2EY2A 1U5KA 2PCFB 5IA7A 2J0MA 1TWAH 1E8YA 3NP8A 1WGKA 4PT5A 5FLXc 1VZ7A 1GUSA 1W6KA 4LFAL 2MPMA 3PRZA 1AE3A 3NZUA 2B29A 1GXDC 1XEEA 2F0PA 1X3PA 3NBIA 2KMAA 3Q8EA 4KY5A 3KYHC 3ZTCA 2KWDA 3KYCD 3EHVA 3PSEB 1DD2A 4IOAA 4OO1I 5H1SE 3T56B 1PLFA 3QAQA 1B4OA 2W3SA 3W1YA 4QAYA 3PUYA 3S15H 1JOKA 2F0EA 1TBEA 4DQOC 4E74A 4HN7A 3CCQA 3AEAB 2A4ZA 3OW7A 2QDLA 5D2MB 4DV6Q 5GAGC 2VH2A 1VQFA 2EZVA 1XNRQ 1V8CA 2D3AA 2G4SA 2LUMA 4OZAA 1KXLA 1UNSA 3APCA 2B2UC 5M5XB 2DY8A 2OQ0A 1K8AC 2F0MA 1RYJA 2PQAB 3GTJH 3WIMA 2J4XA 3L0WB 1KM7A 1GJZA 3L2PA 4DU9A 1BNZA 2JA7G 1JJCB 1MJCA 3FEWX 3IKJA 3QJYA 4YWMA 5M3FB 3AM9A 1SJED 3HM6X 1E0ZA 4PV1C 4B3ML 1SBBB 4CKBA 3K80C 1VLBA 1Q7YC 2G3QB 5CBEE 4IG7B 5JPMC 4G4KA 4L23A 1TT2A 1STHA 2EVBA 2F0GA 2HDEA 4ICUA 2F0SA 4EQOA 1BBUA 4A3CG 1FCCC 2D2CC 1N34L 2NZ1D 1X3FA 1MG8A 1WJNA 4LWCA 4NW2A 2UUBL 1HJPA 1JJ2A 1VQ7A 1GB4A 3Q14C 2W9NA 2HQLA 1N60A 2IDYA 2W3RA 3F8TA 4MH8A 1SNQA 2KHIA 1RCVD 4WQMA 1IBKQ 3FVQA 2LKVA 4ARCA 3H3VH 1PH3A 4DAPA 1FXTB 1FR3A 1JW9D 4OZCA 1L1OC 1EIFA 2NB0A 3S2HB 4LF6L 4DR6Q 4TMAB 4B08A 4IUNA 2UXBQ 2KOXA 2QEJC 3IT4B 1KHIA 3GTLB 1O78A 4II3B 3CXCA 3Q0AA 3H94A 2V1CC 1V2YA 2ACZB 4S3SA 2CS4A 2EXDA 2I2YA 1A3TA 1S40A 2O2LD 3A4RA 4C00A 2JN4A 3BG3A 4YCUA 4ZRIA 2I07B 3GTOH 1AYFA 3AE9B 2FCSA 1AP0A 1CQFA 2KWVB 3AI5A 1CKNA 2WP8J 4GKJL 1JB3A 3J80i 4ABNA 4QIWE 1FJGL 3GTMB 4GU2A 2Y0SE 5HI1A 2YEPF 1E9MA 1ESFA 4LK1C 4QGUA 4A55A 2GMIC 3QX1A 3F1ZA 4CHTB 2SEBD 4LF7L 2EYLA 1QUQB 1V5TA 4DR2Q 1D7QA 2KQ7A 2NVTH 2KHWB 3U4VA 3M85A 4KHPQ 4KTAA 3NVYA 5HFYA 2XGTA 3MXGA 2KECA 4OELB 4A93H 3D4WA 2A19A 4RFBA 4EZLA 5GAEC 3A56A 1B7YB 4HR7B 5CV5A 2PEAA 5CV4A 4M0WB 4HCSA 3PZ8A 5D65A 3PV0A 1SYFA 4NXNQ 1L1OA 3HRZC 1VQ9A 4YIJA 1HPCA 4CKCA 1WOCA 4K5VA 2E2JB 2BS3B 4FF3A 4USAA 2KWUB 1K73C 3Q3OC 2PMZE 2KLGA 2K6AA 3Q69A 1TWGH 1Z47A 4DAVA 5C44G 2K5DA 2YV5A 4KIKA 2A68C 3NPPA 3WDNA 4MGIE 2RF4A 1KQSA 5CTRC 4WIPA 2KVZA 1S72A 4A93G 5LNK1 5IKCM 4P74A 3C0RB 3S9WA 2EOTA 2PZTA 2JY6A 1ZYRC 3CRLC 2VQFQ 2J0KA 3NQTA 1H9MA 3N20C 3SEBA 1MJDA 2AX5A 2IBIB 5EKLA 1E3PA 1OXVA 1NUCA 4GLSC 5MPOA 3OJ3A 4K0KL 1DXMA 4ZDVA 2FFKB 1VQCA 1IPGA 2BH2A 4FHJA 3BZCA 1DJRD 3AE2B 4GGQA 2PTLA 1A0IA 4ANXA 5ELFA 2XRQD 4NB3A 3U30A 4EUTA 2KDBA 3VA5A 4QL5A 1IHZA 1Y8NB 5T8IA 3A9JA 4DV6L 1YHAA 2Q8TA 4EE2A 1XNRL 2VUMH 4WFN3 3GTGB 5H8YE 5AFWA 3NE5B 2IX0A 1TWHH 2WAQE 2KTRB 1VQJA 3SGIA 2LI5A 2ZJDA 3AEVA 3GZNI 3K9PB 1X1MA 5DPTA 4IO9A 1PYBA 4L6TB 1ENAA 1R9TH 3QQ8B 1V1PA 4O2DA 1N33Q 2C7NB 1SNDA 2JE6I 4KKUA 4JLCA 1XNQQ 1YNJD 1CKOA 4LF5Q 2VB2X 2WP9B 3DVGX 5L37A 1O7YA 2MEKA 4FXCA 3DM3A 4OIJA 2N8NA 3A5ZB 4BY1B 2G45B 2O2VA 2SNSA 4DUYL 2Q5WD 3ECIA 1Y69U 3TDQA 1KF6B 4KJNA 1QOFA 1L0WA 3BK2A 3KJPA 4JI6L 4KKTA 1UGMA 1C79A 2ATWA 3M3JA 4ANUA 3Q6BA 1QZGA 3S16H 1MVKA 5CHVC 2DY7A 2M2LA 4A3EB 2I38A 4QIWB 2J7QB 4N8FA 3U52E 2Y0SB 4BKTA 3OAWA 4E71A 3ZGZA 2CH4W 2LEKA 3FPUB 3GB1A 4KDIC 1S5BD 4ZRPA 3KDFB 3MTSA 4ZKBB 2DJFC 3W1SA 2CQAA 1WTWA 3H7PA 4HJ9A 4JI2Q 1JOQA 2LXKA 1WXSA 3NQIA 2KJXA 3ZNZB 3SR1A 1SJHD 1X56A 2NVXB 3J81E 3AMZA 4KZ0A 4CYEA 2MFIA 3M3YB 4ZLTF 1EZ6A 3NRZA 1XMOQ 3E9SA 4ZK9B 2VQEQ 1Y1VG 3OOCA 1NBWA 2TMPA 3F2UA 2HDLA 3NVWA 3ZJYC 1A8VA 3U7DA 3HOVG 2D3CA 2IW3A 4YSYB 4A3IB 2RCFA 2PMZB 2AWNA 5DCNA 1N61A 1T5XD 3UDIA 2BH8A 2OCEA 3FP9A 1VCIA 1WVLA 1EYCA 3UQAA 2IO1B 3UDFA 2Z59B 2RVLA 4W9EA 2B3GA 5FR3A 1B1ZA 3D0FA 1AARA 5K36G 1SEBD 1XLPA 2IY0B 4JI1Q 4JQWC 4LNQA 4HVBA 1V97A 1ZE3D 3PUVA 5LMNW 4H44C 1F2ZA 2CHBD 1SN8A 1I50H 3QIAA 4MT5A 4DV0Q 2XWBB 1Q81C 2CHXA 1D1IA 3MXNB 5DM73 4A3MG 2J42A 2BW2A 1EOVA 1I6VC 1SE4A 3MP9A 1Y8RC 4K1RB 1L5PA 2L9HA 4R8NA 3L3OC 1OXXK 1SYEA 2AQ3B 5IP7H 3KBGA 5FLXL 4LF4L 3PS6A 1J19A 1BUIC 3WA0A 3TS2A 2K5HA 4JCVE 3W1BA 1NY4A 4ZKCB 4WJPA 1B50A 3T9LA 3VYTA 2WACA 1SYBA 2J7ZA 2KCTA 4MGYE 3CQZB 4NP5A 1FNUA 5C3EH 2WAQB 1SIJA 2VS1A 4F87A 4LNFA 3LWEA 3DHQA 1Z2MA 4O42A 3DLLA 3CCJA 2FIFA 5LXIB 1S5DD 1YNNC 4KLKA 3RNUA 2F0WA 1QILA 2MBOA 2I5MX 4MH0E 3S17H 4W9KA 3VH3B 3AQQA 3DDCB 3T3OA 2JEAI 1IGDA 1N63A 4B3TL 4MJSA 4JV5Q 4DV4L 3VQIA 4HIMA 5M5WH 1PRTF 1BDOA 3OW2A 1HR0W 5EPJA 2IHFA 2FE8A 1B8AA 3VFKA 3VVWB 3E0JA 2MX2A 1EEID 1MHHE 1OQRA 3GV6A 1A2UA 3IFTA 2KQ3A 5CGKA 1PH7A 1I7HA 3NOBA 4HSVA 2EJMA 4HDQA 4C1NK 1C9FA 3A8IE 2LUEA 1TU2B 4RCOA 1V81A 4C4VB 3CC7A 2KXJA 4Y52H 3H3VI 3I4LA 3OIPA 2LASA 1QZEA 2F4VL 2L55A 3R8BA 2NUCA 2IJ0A 2WYQA 3W5VB 2LVQA 2KX3A 3I4MH 3U58A 3ZYYX 1EY5A 2FMCA 1LTID 1YI2A 3ML8A 1N33L 1EF1A 3QC8B 3LXFA 4MELA 2LZ6A 2AMCB 3M63B 1HZ6A 5JOBA 3K7AH 4HK2A 1SB3C 1KRTA 3S1NH 4DF7A 1L6VA 5KHQA 1SMYD 4HEDA 5KGUA 2F4IA 4JI3Q 1N8RC 3U2SC 2F0TA 2IL8A 3EFUA 1XLQA 4US8A 5J39A 1PTOF 5EKIA 1K28A 3ULJA 3QARA 4DNTB 3P4SB 4JVZA 3IT6B 4ICVA 2DX5B 1E2WA 4XWTA 4IC7B 1OTRB 3N3KB 4A3LH 4RMFA 4GLAC 4X6AH 1N36L 4HPLB 2E5LQ 2M0AA 4CBVA 2B63B 4FXDA 2UXCL 4KX6B 4FJYA 2MGSA 5T1IA 1KNEA 3ZTDA 2LRUA 2CFMA 2LGXA 3VR9B 1BXTA 4JI2L 3HVZA 4IOIE 4DKAC 4PMBA 4OL7A 2DBYA 3AXCA 4NAWA 4KHVA 4OVUA 3AFQA 1XYIA 3U7ZA 3S14H 4DFAA 4RGNA 5JEAJ 4RWSC 2ENBA 2VQEL 5IP9H 2QILA 1JCKB 5AJ3Q 3S2DH 1DYQA 1GG3A 3A9KB 1HZ5A 2A6ED 1CM9A 3NTHA 1N5XA 4CHKA 4ANWA 2I5LX 2YLMA 2F1MA 2LY7A 3PQIA 1LV9A 1YJWA 2WDTB 1SYGA 4IWQA 1TWAB 3T1YQ 4ARIA 1A2TA 2NBFA 2RKSA 2QDFA 3KK7A 5HURA 5ELCA 1QKZA 4MGZE 2OWOA 4AOFA 1ZKHA 3S1MH 5HGTA 5KHOA 1WXMA 1NI2A 1RLFA 2WX1A 4HEA1 1PMRA 1YOVB 4IKGA 1L0VB 4UP8A 5D7GA 4K5WA 5G3LF 1CTMA 1VQIA 5KYIA 3S15B 4C3IH 4PZ6A 4DR5L 1RRBA 1WYWB 5C4HA 4IWOA 4X57B 4IM0A 1YQBA 4BBRG 2JT4B 2BE5C 4KDLB 3ZKJC 5J17A 1HA6A 5C6AA 3WALA 1FFVA 1TXYA 4GNXB 1F2RI 1WIAA 4R3DA 4B0EA 3UI3A 4KD4A 4RCNA 1EY4A 4NKLA 3VUWA 1NMFA 4OO1H 4I6LB 5FJ8H 3NXWA 1C4CA 3G4SA 1JT8A 1KFYB 1L2FA 2PW7A 1S3SG 2WB1G 4YSZB 3OMCA 2O6VA 1TWCH 1YIJA 2A1AA 3U9SA 1C78A 4X66Q 3VDZA 1HEZE 3Q8CA 1ICWA 1VQ6A 3J7A5 1MHXA 4ZRJA 3D31A 1G2TA 1I4GA 4XYQA 1G8ZD 2KOLA 3TP5A 3JAMc 2ZJPA 3J7AF 2OF1A 4C3IG 2JXXA 4LUZA 5E7NA 1E1OA 1Y1WG 4JV5L 3GTPH 5JJKA 3RZOH 4MACA 3ZUNA 2ZM6Q 3QOLA 1VR9A 3PO3H 4GSWA 4AJYB 1RF2D 2GA4B 2ZW1A 1EFWA 1WMHA 4JX1C 1LLRD 2V1YA 5J22A 3QIJA 3M7GA 4GDKB 5C23A 2WNMA 4F8CB 4ZHPA 1VQEA 2FMMA 4IUPA 2F0DA 3K57A 3NBHB 4OO1G 2KANA 4JYAL 2JZPA 4DV2Q 2CU1A 2PI2E 2EKIA 2QJLA 3I63C 4HAEA 5E3FA 4FF4A 1A6XA 2KFJA 3I7FA 4PZ8A 3NK9A 1PH6A 1SNOA 5GADC 1KLUD 1J7CA 3WWVA 1ENCA 2INPE 2L15A 2KA7A 4AWJA 2K39A 2ZNVC 4YTNB 1F77A 4FF2A 3APDA 3J7AV 3Q3NC 1KDAA 2DHZA 2K3UA 2QCPX 1EQVA 2MCNB 3PO3G 4ITKA 3VHTC 2IO2B 1G51A 1RM6C 1WZ3A 3Q6SA 3F2DA 3IG3A 2FINB 2Z8LA 4K7UA 1ZDXA 4KVGB 4ZRQA 1K53A 3D4DA 1K8OA 3GTOB 3W1GA 2DWQA 4XXEA 2GN5A 2M9VA 4BY1G 2D5DA 2B39A 1PQSA 2L83A 1CI3M 5IGEA 1A70A 2N1WA 4KSLC 3SU8X 3ZXRA 3K0YA 4IALA 3TSSA 2K8HA 1B9NA 4DWFA 4P7IA 1UF0A 3WCQA 4LTUA 3QB3A 3SK6A 4WAAA 1RHPA 5DNFA 2E5LL 2NVTB 2PLPA 4A3EG 1M90C 5FLMG 2WGSA 1SSNA 4BOZB 2M17A 3VH4B 4A93B 1JMLA 2BVCA 4LFBQ 1D5MC 3TBLD 1ZOYB 1VRAB 3BVZA 3STBC 2DZJA 1O7LA 2F3VA 3KUDB 3E0EA 4FF1A 2NVYH 2A69D 4PYZA 3U4ZA 1LTBD 4KN7C 1B2TA 1FXAA 5JPNC 1E2VA 3IBEA 1F2MA 1WSPA 1BOSA 1C8CA 2AUJD 3AE6B 2JXMB 4KI0A 3PIPA 1WR6E 3AN1A 4ANVA 1S5CD 1E7UA 2KN4A 5BMIA 2MBHA 4F88A 4UHVA 4QMGA 4DR4Q 4P75A 3X23A 2R7ZH 1C77A 2Z6BA 1STBA 1FPYA 2N9PC 1LO5D 3K8AA 4RAUC 3A8KE 4TV3A 1C0AA 5LL6S 1MJEA 1VS0A 4MM3A 2DNCA 4S0RA 2PQEA 3RUZA 4ZRZA 2MQHA 1EWCA 1EO6A 4GKKL 2YVCA 1Q1BA 4OX9L 3JC66 1TS2A 1TWFH 4A3GH 1WYGA 5EBDA 3VUXA 5C3JB 4EZJA 3CCUA 4FP5D 1IBMQ 1VJKA 4TVAB 3AEGB 2HCCA 3ALBA 2NBUA 3RT3B 1X3EA 4XDCA 4A3DH 1AH9A 5AUKA 2NZOA 4YY3Q 5IT9E 2BT6A 4URKA 3KF8B 4IZ8A 1F2LA 4R8IA 1A3VA 2JX5A 2CWAA 1JWAD 3PREA 1PGXA 2JQRB 4FBJB 2VUMB 4M02A 1U4MA 4NNJB 3UE0A 4BBSH 1ROEA 1TWHB 2KAJA 2WXMA 2ONQA 3RPFC 1KD1C 5AZGA 1K3BC 1A3UA 1UE6A 1XXGA 4RGTA 3CSFA 3H0GH 1R9TB 2JA6G 4ZQ3A 4NJCA 3MXPA 1SFOH 3C8YA 1ICFB 1QB5D 1ZPSA 2RGFA 2RCNA 3P4PB 4W9GA 3U8ZA 5KYLA 2Z6KC 3PF4A 2Z0EB 2EY5A 1IXRA 2RR9A 3P4QB 4B3RQ 1C76A 3HK0A 2N9XA 2O4XA 1WX9A 1GM5A 2W82A 3N1YC 3RFZB 1S1QB 1R7SA 1UELA 3L08A 1ZGUB 4GOCA 3WOEA 4BBSG 4IWPA 4LNKA 3FMCA 2CCZA 2F0OA 1EFID 1H9SB 3F2CA 2LHEA 2INNE 4R4TA 5DPRA 2JYOA 2QDBA 5I2YA 2F0UA 4XIGS 1VQKA 3CF6E 3N1XC 2Q2HA 3DWPA 5BR8Q 1MG4A 3BINA 3DM1A 1I6HH 2GBKA 4P2CB 3LJ3A 2GLSA 2D9UA 1TIID 4QUCA 3BDCA 2WV6D 3ZW3A 1R4PB 1I94Q 2JUOA 2Z1CA 4GDLA 4WJWA 2J0JA 1EY7A 3A74A 2N7DA 2WXRA 5FO8B 1WTQA 2CH4A 3G7LA 1WE7A 1STAA 4J8QA 4DR7L 4LNNA 4MEMA 1GUGA 5HG2A 2Z6KA 4A3MB 3CCEA 4HKZE 3I4OA 2Q2TA 4DNRB 1JWBD 3Q24A 5LMNL 4DN4M 3AEEB 3UGBB 2JYTA 4X65Q 2LRWA 3RNAC 2A6HD 2BYEA 1HTLD 3FDTA 1UBQA 1MI0A 2PNRC 1FYCA 2HT1A 1ZUD2 2EY1A 3N30A 4E6IA 1WTOA 2L32A 2ZW0A 1B3AA 3VA7A 1YQ3B 1PZID 4IPCA 2K03A 3DVNU 2BA1A 3IFDA 4A3BH 1FIQA 5JXVA 4PS7A 1UWMA 1HQMC 1QNUA 2L0CA 4LFBL 1I50B 1G91A 1Q5WB 4N58A 2B63G 2KBNA 3VR4A 3TEYA 3ZRCA 1X9NA 5DAUA 4C56C 1GAQB 4NJ7A 4P1CC 1Q12A 1LTTD 2R6GA 1TTNA 2KHJA 3FPPA 1TIFA 1IBLL 2DYMA 1HRJA 4K2LA 3UDXA 1WJUA 3L10B 2M8SA 2V0GA 1HR0L 4M8AA 3MJ5A 4X3UA 4K3CA 2NBVB 3NHEB 2I0QA 5CHWA 1XX8A 2C9OA 3CCLA 5CORA 5C3EB 2E2HH 2ZPYA 2WB1E 2PNHA 2DNFA 4WQOB 1DOYA 3V3XA 1IW7C 2KTRA 2BYVE 4PMWA 4P72A 5LMUQ 3TBIB 2FAZA 2LGYA 3S17B 2RPVA 1WM3A 2X6LA 4JI4Q 2WIIB 3VYRA 1EYDA 2R2OA 1PVOA 3RYTA 5IGDA 5M5WB 4ZOHC 1IYUA 3V61A 3T53B 5IP4D 3AE4B 3T4AC 2D3GA 2PVOD 2KCMA 5BN5A 1CQVA 4JWUC 2A74C 5ELBA 4RH6A 2WXIA 3Q8BA 1ESRA 3G71A 1R4NI 3DVNV 1CZGA 1D4BA 1SXTA 3Q8FA 3URYA 2RQXA 2DNEA 3JYUA 5HHDG 4C1NI 2KD0A 1I42A 3JAML 1CZPA 2G9DA 1IBXB 1Q10A 3T1HQ 1WTVA 1HNZL 1XO3A 1PH8A 2Q8IB 2IZVB 2KQSA 4I6NB 5DPSA 3M4OH 1GUNA 5EJWA 1KC8C 1PHJA 3I4MB 3Q22A 3KDFA 2DZKA 3NZ3A 4M01A 4GN4B 2BKRB 3Q8AA 4XYCA 4B6WA 1J8IA 1ISNA 3IHPC 1X3GA 3K7AB 2UUCQ 1MPEA 3S1NB 4JI0Q 1XCTL 2SAKA 2E8GA 2OQKA 5BMHA 1YNND 4A3KH 2L1AA 5HKHA 2D2QA 4B3SL 2L11A 2F03A 2VRRB 4KY7A 3KYDD 3CPWA 1OXSC 1PRTC 1II3A 4IOCA 1X65A 1LTRD 1F9RA 4BA1I 3N1ZC 2EYOA 3AU7A 3CMAA 4ME5A 3D8GA 4W9FA 3DEPA 4JWSC 2HTHA 3PIOA 1T9HA 4H7BA 5BR8L 1YVCA 1IYVA 4POFA 2F0LA 2H1EA 2PO4A 4G57A 4NPSA 2RA4A 2BB5A 1ZW7A 2BB6A 4NQKE 3PZ7A 3X0WA 4A3FH 3QA8A 3S14B 3ENEA 4ZYSA 1WD1A 3L4PA 3V6EB 4A3OA 2WXHA 4JBJA 1R4MI 1WTPA
chains in the Genus database with same CATH topology
2RSOA 3S2DB 1ILQA 4BBRB 4R9WA 1CHQD 2EJGC 1PTOC 1FD7D 4IUUA 2E75C 4WAFA 1VDVA 2WB1B 4TQ0A 3S1MB 2WS3B 1ZKOA 4B0MA 4ID6A 2BA0A 2YYZA 2BDOA 2CU3A 5EPKA 2KDMA 1PXUA 2JP1A 3LX0A 1U4LA 4C3IB 4IFDH 1Y1WB 2EXZA 3FRPB 3MHBA 4IUTA 1QG7A 5KIXA 2N9KA 4J6HA 3CU7A 1EZ8A 2SDFA 3TP8A 4JBWA 3MWYW 1CHPD 4MHEA 2OEOA 5EE9A 3V2TA 2HDMA 2AQ2B 1SE3A 1TR5A 2LMCB 2JYEA 1TWCB 2O5IC 4TKOB 2KQ4X 1DOLA 2F3WA 2N9LA 1EY8A 2WDRB 3TP6A 5E6JA 2G1EA 2W54A 3GTPB 5BMGA 3DWAA 3RZOB 4A9AA 2JSOA 4HJGE 5E4WC 3PO3B 1SYCA 4YTMB 3AE5B 3LB8C 4KGTA 1K52A 1GUOA 1RTNA 2MJDA 4KD3A 1TQOA 2LS01 2K01A 2N7JA 2OEDA 3I70A 4HCEA 2ZT9C 3NSWA 1ET6A 1F9SA 3DWGC 3SK8A 1BCPB 4OW0A 3I3CA 4ZUJA 1JALA 3AE7B 1KLGD 3P4RB 1F9QA 1NYQA 2FUG1 2X69A 2MJ8A 4XYOA 5LL6X 2FHTA 3TN2A 3A55A 1SSOA 2AWOA 2XN9C 3H91A 2BOSA 4J3OD 2F0HA 3ETRA 3IAS1 1J7BA 4KHZA 1E7PB 1FO4A 4DK1A 5I9OA 5KNCA 1NCVA 1GPXA 4K5XA 2N0SB 4L2YA 5KRUA 1DCZA 1QLBB 3AE3B 4Q0FA 2NVYB 5IGGA 5KNDA 4K14A 4K2KA 2OXPA 3ZQ4A 2NMQA 3I57A 1JORA 3C2PA 3I72A 4A8XC 2K5QA 2XWJB 3NTIA 4F7XA 1KRHA 2JA6B 1G6ZA 2LFNA 1IGCA 1V8QA 1DOIA 4L23A 2Q8RE 2JEBI 1TWFB 4A3GB 2PZUA 3AEBB 2F0FA 1AN8A 3P7JA 4LK0M 4A3DB 4HMJA 1QCBD 1I4QA 3NTKA 3AH7A 1AEXA 5ELDA 1PUTA 4QUFA 2BYTA 1A15A 2F0KA 1O80A 4PMCA 4BBSB 4NZLB 1SNPA 2IPKD 3D4RA 4D2KA 3H0GB 3NWTA 2ZXPA 3WOFA 1SFOB 3KUPA 5TSSA 4RNAA 3EJIA 2BTEA 1QF6A 4XDDA 2E2DC 2EPBA 4TQ1A 2MHVA 4XT3B 4KY6A 1B9RA 4CQNA 1KABA 2C5CA 1FEHA 1PDXA 1SF0A 4K8JA 5IOCA 2WXJA 4BA2I 5BYSA 3MVVA 2ID0A 2IX3A 3EFXD 1NVID 3BVGA 4XE0A 2H88B 1D2BA 2K32A 2RMMA 1ZDVA 2AUKA 1I6HB 1EY6A 3R93A 1JQ4A 2IGGA 1FMAD 1SAPA 3FILA 2E6XA 3TEWA 4OVZA 4HKQA 1C48A 1K51A 2B2VC 2M00A 4CJ2C 4H2AA 3GD7A 1QOHA 3AEDB 3ND9A 3P1HA 4A6QA 1NSNS 4YXDB 1HUMA 3D6WA 4AS1A 4XT1B 2Z4HA 1TKEA 1E2ZA 1LT5D 2B8GA 2VNUD 5FK9C 5IGCA 5FLXE 4EQNA 4A3BB 1LTSD 4HMIA 1ILPA 2V3NA 1PZJD 1RFKA 3DWMA 3P42A 2QF7A 5C0XH 2LJIA 5D14A 2F0VA 4IFDI 1B44D 5AUIA 1XWEA 2F0IA 5BN4A 1OXUA 2BCOA 2B2VA 1WRIA 2WU5B 2OHFA 1LTAD 1JWSD 1AZPA 1LACA 2E2HB 1EOTA 1EU4A 3BZDB 3NUHB 2CW0D 1Q8IA 3IXSA 3D3RA 2EDGA 4H0LC 1YNTE 1BBXC 1BCPD 3J80L 2ICEC 4ULLA 4XTCS 1B9MA 5KEEA 3GTJB 1HA5A 1ML0D 4KKSA 1EY0A 1YNJC 1GUTA 5JAVA 1FNVA 3ABVB 1BO0A 4DXGA 3TEXA 1RDPD 3I73A 1EYAA 1K50A 4WORA 1TS5A 1QOBA 4EVOA 1JWMD 2H4OA 2LFIA 3A54A 3DEOA 3M4OB 4J1MA 2EYFA 2WDVB 2XNAC 1QOGA 3SFEB 5G5GA 3BYYB 2EYPA 1WWTA 4A3KB 3AB5A 3BS1A 2SNMA 2AQ1B 1T5EA 2B2TA 3DWQA 5CR3A 1T3QA 1FM0D 2SOBA 1I4PA 1XLOA 3EVQA 2L4NA 4FNFA 3ZJVA 3NHHA 3SE0A 3EQLC 3A8JE 4NMZA 4AYBB 1XTCD 3TZUA 3B2FA 3W2DA 1Q1EA 1L4ZB 4A3FB 1SDFA 3MZ5A 1FRRA 2HTME 1UAPA 1QQRA 2PKOA 2V3PA 5IIFA 4XQJA 1IL8A 3H6MA 5J1ZA 2KCNA 1C4QA 4WWMA 1ZXTA 2TSSA 3RMHA 1HFNA 3QG1A 3LNNA 5CMDA 2Y5PA 2E76C 1TWGB 3VRAB 4N59A 5A2QL 5JVG3 1TKWB 3IAYA 4HTHA 1H9RA 2WXNA 3HOXB 2J0TD 5BN3A 2E3TA 2D62A 1Y8OB 2KMMA 3TP7A 1SYDA 4NAWB 1AWDA 3BDLA 3E6ZX 2FJ2A 4KV6A 3OMGA 1W6JA 5FO7B 2WXPA 1STNA 1TVXA 2R93B 1FNWA 4YT0B 4A90A 3K58A 1RJTA 2WXGA 1QJOA 3EUB2 4QB4A 4RHRA 1QT9A 4K8IA 4C7ZA 5C3XA 3B2GA 1UEAB 2A68D 4GZYC 4X3TA 3OWEB 1SMYC 5CC4A 2LHDA 1L4DB 2A73B 1UUPA 2VZKB 1HTPA 5FKAC 4NAMA 1U4PA 1ZYRD 5ISRA 1Y56A 3EROA 3ONAB 2MUYA 5JVH3 3S16B 4FXKC 4Z9CB 2M56B 3GV3A 3W5UB 2J52A 2XSCA 3PUXA 1NYRA 3CIRB 4OZBA 3SK4A 4P6VF 3IAM1 1I4XA 1EIHA 3V05A 2K5PA 1CFMA 2JXTA 1PTOH 2JA8B 1IKMA 1KAAA 1STYA 2L12A 2BDNA 4M0WA 2A6EC 4RGMA 5T1GA 4C80A 1HCZA 2F0NA 3P63A 4HRSA 4Q5VA 5C0XI 1S4ZA 5LHY1 4IUVA 3KLRA 4K6LA 3KLSA 3HZXA 1KDCA 2K04A 3O13A 1F9PA 5FO9B 2PMVA 1AZQA 3ND8A 3AE8B 2WXQA 4C3HB 3HOYB 4DK0A 1PGBA 2K5WA 3MA2B 4ZUIA 2E74C 3LWUA 2R61A 5CV6A 4B9XA 5M3MB 4C7YA 1FRDA 3MHZA 1DONA 3L7ZC 1Y8PB 4OIKA 4KGSA 3D6CA 2O5JC 2WU2B 3HOZB 2NVQB 2VB3X 1Q3LA 3I4NB 3K59A 4RA8A 3N52A 1TKYA 2IGDA 3DMUA 3H8HA 5F2DA 4UDUC 2K0PA 3KBXA 3HOWB 2IX1A 2I46A 2RSNA 1DOMA 3SK5A 2K9XA 4N9TA 1GJXA 5C5LA 2JWUA 4DAYA 3M4YA 2KACA 5KNBA 2J53A 2RDFA 1UGJA 3W3AA 1I3QB 4QF4A 2DLBA 3K5MA 2KUMA 3T51B 4MM3B 3P75A 5I2XA 4LAAA 1RKNA 2HQEA 4G7ZC 1EM7A 1AFPA 5IGFA 4DA2A 2X38A 2G9HD 3C46A 3PUZA 5C4JB 1YJJA 1NI3A 2ON8A 2V4IB 3AV8A 1VDZA 5NUCA 4KMUC 3MAQA 3J9CA 4P16A 3HKZB 1STGA 2BS4B 4EGVA 1JRPA 1MD2D 4V0BA 4XDXA 2RDHA 2H89B 1OFFA 1NR4A 2KVMA 2B2UA 1HQRD 2GB1A 2A69C 2YEPB 1MI2A 3GTKB 2EYJA 5DM63 3BDOA 3IL8A 4LMQD 1RTOA 3NVZA 3VR6A 2Y3AA 3MXUA 3BYTB 3MXNA 2MP1A 1T6BX 1ZEQX 4RKLA 5EPLA 2KHSA 4LJZC 2Y5CA 1TJEA 4HROA 4RHSA 3C3LA 3OHXC 1E10A 1LT3D 3CRKC 4EQPA 1D6EC 3I91A 2IWHA 4BS9A 3B9JA 4C3JG 4GDLB 5COYA 1WCMB 2NN6H 1P7EA 3J81L 1DGJA 2EJFC 3VYUA 2DN8A 2RDGA 1KDBA 1L0YB 1KNAA 1K8MA 3TEZA 2VZKD 1VF7A 3T16A 1F2YA 2PZWA 1CT1D 4KKJA 4JE3B 3MEHA 3JAME 3NWSA 2WXFA 1HFGA 2B8FA 2BBCA 1CJEA 3K5OA 2YU9B 3CHBD 1OO9B 3PO0A 1ZXHA 1NAPA 2NN6G 1QE6A 4IURA 2EY6A 1X3QA 4XQQA 1ACCA 4IFDG 4QCLA 4US9A 2JA5B 2WKDA 4Q2JA 4ZHOA 4RKBA 1RWSA 1OXTA 5H92C 2QMTA 4XWWA 1R4QB 1J7AA 3V96A 2ZXOA 1JICA 1D1KA 1ET9A 2BE5D 2PW5A 4BWGB 1YN5A 1CA5A 1IKLA 1YMHE 5CYUA 3MFGA 3S1RB 3TMEA 1L6UA 2QIEB 1LTGD 2IGHA 2GI9A 1STEA 1YN3A 1YN4A 1O7ZA 1TY0A 1FFUA 2A6HC 5I4DA 4U673 4REZA 4IFDJ 1BCPF 1PFMA 3NVVA 3TZDA 1LT4D 3AEFB 1KTKA 1EIGA 1Z6HA 2PVGC 1FCLA 4U68A 1JC7A 3FKIB 1EWHA 1TS3A 5K36H 5EE0A 3X3MA 1XLNA 2F0JA 3U9OA 5IGBA 3SHLA 4C2MB 2WQYB 1J9OA 4O1NA 3PUWA 1EY9A 5EGTA 4DXFA 1CA6A 3E5SA 2X6GA 2B2WC 2R7ZB 3H3VC 3R2IA 3HS0C 4TSSA 1Z7TA 3QO2A 3HRDD 1D5ZC 3AMUA 1QWYA 1TY2A 1JR0D 1JROA 4WURA 4IQZA 1QOAA 5A35A 5I6WA 1OQQA 3A7LA 1FGBD 3GO5A 2BS2B 2L52A 5E1FA 4MIUA 3VR3A 5EBCA 3BK1A 3LYYA 3W9CB 1KH0A 1DZ1A 3T3NA 4C3HG 1CK1A 4H13C 2IT1A 3NBHA 1M8AA 4KJOA 1PRTB 1YJIA 1PFBA 1TYGB 2XVSA 2MH7A 2CVRA 2Z4IA 2B2WA 1V43A 1P7FA 5C3WA 2DYOA 2XRSD 1H9JA 5JEAH 4V190 3N9YC 3FAHA 1NEKB 4RGOS 3HOUB 3MC0B 2K1BA 3R3OA 1DOXA 1EU3A 1H9KA 3C1EA 4AQ7A 4IUQA 4F8MA 2E2IB 4ODGA 1VZ6A 4X3SA 2EYHA 2F0QA 2FBWB 1BR9A 2K28A 1C4AA 1PTOB 1RD9D 3AE1B 2NTTA 5E4XA 1PGAA 2WXKA 5JEAG 2KEDA 3VR5A 1BMLC 5EE1A 3M7NA 1YQ4B 4ZAIA 1V1PB 2PIAA 3GTQB 1HXYD 2R92B 3OSOA 1HHVA 3TUOA 1F2RC 2CJOA 5CV8A 4PQXA 3GS2A 3E56A 2R3ZA 4M1UB 4MN3A 2HUGA 3VRBB 4IN3A 2NN6I 3OPOA 2WXLA 3BVMA 3SVMA 1BUVT 5C2TB 3PIP3 1SE2A 3QWNA 4CKEA 3K6OA 4OHJA 3I90A 5C5MA 3CKIB 1LT6D 1RODA 1X32A 5EKKA 1U4RA 5D3IB 5G5HA 1WD0A 1PDQA 1MSHA 5C4ZA 1GB1A 5BYQA 5EQ0A 2V4DA 3SFDB 3KF8A 4BY7B 1EL0A 5ELEA 1JE4A 2JSVX 1S5FD 4YWGG 2LGIA 3K5LA 4K6DA 5C0XG 3C1FA 1HUNA 2B2TC 2L5TA 5K5PA 1TZOA 3PO2B 2JA7B 4G7OC 3P20A 2EE1A 1TKGA 2B76B 2A5HA 2PPBC 5I6YA 3RLFA 1ZP0B 1TS4A 3T13A 3ZJUA 4I65A 4CGYB 3KQ4A 3L9AX 4FO2A 4PNYA 1H9SA 2K33A 2EELA 1ZXIA 2PW9A 3N6RA 4L8JA 5M9OA 5CBAE 1IW7D 4CJ1B 1XCQL 1VF5C 5C0XJ 3K5NA 3HEJA 1VZ8A 1PFNA 1G2SA 5IT9L 1JOOA 1ENFA 1BF4A 1DM0B 2QSDA 3HUIA 3VYSA 1FD6A 5GXGB 1MBYA 1CZWA 4RF1A 3HVDA 1B53A 4OGQC 2ICIA 5DEHA 1JQYD 4WRDA 1MGSA 5EE3A 5FOBB 4UAIA 2HCIA 4C3JB 4WH4A 4JPSA 3RD4A 2RBMA 2L1BA 1SNMA 1Q90A 4TQUS 3ERQA 3HGBA 4FVMA 4NDXA 3OIQA 3VR8B 3Q23A 2N55A 1I4RA 3A7AB 1AW7A 3R2TA 4YSXB 4Y7NB 4G7HC 4IDIA 5C44B 5CV9A 3MFYA 1PRTD 3SXHA 3I9V1 1SNCA 3BWUD 3FILB 3KWLA 3HG9A 3ITPA 1E6EB 2PYKA 3J80E 1JWUD 3ZJTA 4X3KA 3X3NA 1S5ED 2N88A 4L1BA 1EEFD 3VR2A 4KN4C 1VMPA 2NYZD 4DGZA 2K22A 3NUCA 4B9WA 1LABA 3UI2A 4KK7A 3PMFA 1PZKD 2OT2A 1N62A 1NENB 1IBXA 4CJ0B 3SR6A 4A3JB 1G291 5CV7A 4KGRA 1PTOD 2WXOA 1K83B 3AB9A 1L0XB 2MJ3A 2D5GA 4RF0A 5M5YB 1BQQT 4KKIA 1WTXA 1C4PA 1MSGA 3GQBA 2B2YC 1WXQA 1E0BA 1GHKA 2M19A 5I9PA 1M4VA 2JU6X 3FC4A 2W55A 3SDZA 1F0ZA 2ZXRA 1EQTA 3EA6A 4N6EB 3CWIA 1ONLA 1VMCA 3J7YW 3H09A 3BIID 3DXJC 4YTPB 3NS1A 3DUZA 2QKIC 3I8ZA 3PIO3 1EWYC 2K7VA 2K05A 4XQNA 4JK1C 1GUWA 1Y1VB 4TRDA 3U4EG 1QNKA 2KEEA 3GP7A 1XF5L 1FXIA 3RZDB 3HOVB 2B2YA 2NTSA 2VXWA 4ILWA 2CJNA 3KWVA 4FYDA 5G3LD 1I4HA 4I7ZC 1IUEA 1GOZA 5IODA 2WDQB 5C4XB 5A2QE 5BYRA 1WTRA 2WKCA 5JJZA 3G6JB 2XIWA 3EGRA 3S1QB 3OWFA 4HSPA 4N9PA 2NWGA 5D3DA 1PYWD 4L63B 3P1MA 1D5XC 3QOJA 2MJEA 2CW0C 2KCCA 1UWXA 4LLGM 4FXGC 1V1OA 1N5WA 3AECB 3KLSX 2GRIA 1BCPC 2WLBA 2LMCA 3HP3A 1DOKA 1U9RA 2EYMA 1PFDA 1GHJA 1NR2A 2WINB 2EY2A 2PCFB 3NP8A 1WGKA 4PT5A 1VZ7A 1GUSA 1W6KA 2MPMA 1GXDC 1XEEA 2F0PA 1X3PA 3NBIA 3Q8EA 4KY5A 2KWDA 1DD2A 4OO1I 3T56B 1PLFA 1B4OA 2W3SA 3PUYA 1JOKA 2F0EA 4DQOC 4HN7A 3AEAB 3OW7A 1V8CA 2EZVA 2LUMA 4OZAA 1UNSA 2B2UC 5M5XB 2DY8A 2F0MA 1RYJA 2J4XA 4DU9A 1BNZA 3FEWX 3IKJA 3QJYA 5M3FB 3AM9A 1E0ZA 1SJED 4PV1C 1SBBB 4CKBA 1VLBA 5CBEE 5JPMC 4G4KA 1TT2A 1STHA 2EVBA 2F0GA 2HDEA 2F0SA 4EQOA 1FCCC 2D2CC 2NZ1D 4NW2A 1GB4A 1N60A 2IDYA 2W3RA 4MH8A 1SNQA 1RCVD 4WQMA 3FVQA 2LKVA 4ARCA 4DAPA 1FR3A 1JW9D 4OZCA 2NB0A 3S2HB 4TMAB 4B08A 4IUNA 2QEJC 3IT4B 3GTLB 1O78A 3Q0AA 2ACZB 3H94A 4S3SA 2I2YA 1A3TA 2O2LD 3BG3A 2I07B 1AYFA 3AE9B 1AP0A 1CQFA 2WP8J 1JB3A 4ABNA 3GTMB 5HI1A 2YEPF 1E9MA 1ESFA 4LK1C 4A55A 4CHTB 2SEBD 2EYLA 3M85A 4KTAA 3NVYA 5HFYA 3MXGA 2KECA 3D4WA 4RFBA 3A56A 4HR7B 5CV5A 5CV4A 4HCSA 3PZ8A 5D65A 3PV0A 1SYFA 3HRZC 4YIJA 1HPCA 4CKCA 4K5VA 2E2JB 2BS3B 4FF3A 4USAA 2K6AA 3Q69A 1Z47A 4DAVA 2K5DA 2A68C 3NPPA 3WDNA 4WIPA 5LNK1 3S9WA 2EOTA 2PZTA 1ZYRC 3CRLC 3NQTA 1H9MA 3SEBA 2AX5A 5EKLA 1OXVA 1NUCA 4GLSC 5MPOA 1DXMA 2FFKB 3AE2B 1DJRD 2PTLA 5ELFA 2XRQD 3VA5A 1IHZA 1Y8NB 5T8IA 4EE2A 2Q8TA 5H8YE 4WFN3 3GTGB 5AFWA 3NE5B 2IX0A 4L6TB 1ENAA 1V1PA 1SNDA 2JE6I 4KKUA 1YNJD 2VB2X 2WP9B 2MEKA 1O7YA 4FXCA 4OIJA 2Q5WD 4BY1B 2SNSA 1Y69U 3TDQA 1KF6B 4KJNA 1QOFA 3BK2A 4KKTA 1C79A 1MVKA 2DY7A 2M2LA 4A3EB 2I38A 4QIWB 3U52E 2Y0SB 3ZGZA 2LEKA 3FPUB 3GB1A 1S5BD 4ZRPA 4ZKBB 3MTSA 3W1SA 2CQAA 1WTWA 1JOQA 3NQIA 2KJXA 3SR1A 1SJHD 2NVXB 3J81E 3AMZA 3M3YB 4ZLTF 1EZ6A 3NRZA 3E9SA 4ZK9B 3OOCA 2TMPA 3F2UA 2HDLA 3NVWA 2IW3A 4YSYB 4A3IB 2PMZB 2AWNA 1N61A 1T5XD 1VCIA 1WVLA 1EYCA 2RVLA 5FR3A 1B1ZA 5K36G 1SEBD 1XLPA 1V97A 1ZE3D 3PUVA 4H44C 1F2ZA 2CHBD 3QIAA 4MT5A 2XWBB 1D1IA 5DM73 2J42A 2BW2A 1I6VC 1SE4A 3MP9A 1L5PA 2L9HA 4R8NA 3L3OC 1OXXK 1SYEA 2AQ3B 5FLXL 3KBGA 1BUIC 4ZKCB 1B50A 3VYTA 2WACA 1SYBA 2J7ZA 3CQZB 4NP5A 1FNUA 2WAQB 1SIJA 4F87A 3LWEA 3DHQA 4O42A 1S5DD 1YNNC 2F0WA 1QILA 3T3OA 2JEAI 1IGDA 1N63A 3VQIA 1PRTF 1BDOA 5EPJA 2FE8A 3E0JA 1EEID 1MHHE 1OQRA 3GV6A 1A2UA 3IFTA 2KQ3A 5CGKA 1I7HA 4HSVA 2EJMA 4C1NK 1C9FA 3A8IE 1TU2B 4RCOA 3I4LA 3OIPA 2L55A 3R8BA 2NUCA 2IJ0A 3W5VB 3ZYYX 1EY5A 2FMCA 1LTID 3LXFA 1HZ6A 5JOBA 1SB3C 4DF7A 1L6VA 1SMYD 4HEDA 5KGUA 2F4IA 3U2SC 2F0TA 2IL8A 1XLQA 4US8A 5J39A 1PTOF 5EKIA 4DNTB 3P4SB 3IT6B 4XWTA 1E2WA 2M0AA 4CBVA 2B63B 4FXDA 4KX6B 2MGSA 5T1IA 1KNEA 3VR9B 1BXTA 3HVZA 4IOIE 4PMBA 4OL7A 2DBYA 4KHVA 1XYIA 3U7ZA 4DFAA 4RGNA 5JEAJ 4RWSC 2ENBA 2QILA 1JCKB 1DYQA 1HZ5A 2A6ED 1CM9A 3NTHA 1N5XA 2F1MA 2LY7A 1LV9A 1SYGA 1TWAB 4ARIA 1A2TA 2NBFA 2RKSA 3KK7A 5HURA 5ELCA 1QKZA 5HGTA 4HEA1 1PMRA 4IKGA 1L0VB 5D7GA 4K5WA 5G3LF 1CTMA 5KYIA 3S15B 5C4HA 2BE5C 1HA6A 5C6AA 1FFVA 1F2RI 4B0EA 4R3DA 3UI3A 4KD4A 4RCNA 1EY4A 4NKLA 4OO1H 3NXWA 1C4CA 1KFYB 2PW7A 4YSZB 3OMCA 3U9SA 1C78A 1HEZE 3Q8CA 1ICWA 1MHXA 3D31A 1G2TA 1I4GA 4XYQA 1G8ZD 2KOLA 3TP5A 3J7AF 2OF1A 4C3IG 4MACA 3QOLA 1VR9A 1RF2D 2GA4B 2ZW1A 4JX1C 1LLRD 5J22A 4GDKB 3M7GA 2WNMA 4ZHPA 2FMMA 4IUPA 2F0DA 3K57A 4OO1G 2JZPA 2EKIA 2QJLA 4HAEA 5E3FA 4FF4A 1A6XA 3NK9A 1SNOA 1KLUD 1J7CA 1ENCA 2INPE 2KA7A 4YTNB 1F77A 4FF2A 3J7AV 1KDAA 2K3UA 2QCPX 1EQVA 4ITKA 1RM6C 3Q6SA 2FINB 2Z8LA 1ZDXA 4ZRQA 1K53A 3D4DA 1K8OA 3GTOB 2DWQA 4XXEA 2M9VA 2D5DA 2B39A 2L83A 1CI3M 5IGEA 1A70A 3K0YA 4IALA 3TSSA 1B9NA 3WCQA 4LTUA 3QB3A 3SK6A 1RHPA 5DNFA 2NVTB 2PLPA 1SSNA 4A93B 1JMLA 1D5MC 1ZOYB 1VRAB 3BVZA 1O7LA 2F3VA 4FF1A 2A69D 1LTBD 4KN7C 1B2TA 1FXAA 5JPNC 1E2VA 1F2MA 1WSPA 1BOSA 1C8CA 2AUJD 3AE6B 2JXMB 4KI0A 3AN1A 1S5CD 2KN4A 5BMIA 4F88A 4QMGA 1C77A 1STBA 1LO5D 4RAUC 3A8KE 5LL6S 2DNCA 3RUZA 2PQEA 4ZRZA 1EWCA 1Q1BA 1TS2A 1WYGA 5EBDA 5C3JB 4FP5D 1VJKA 3AEGB 2HCCA 4XDCA 5AUKA 5IT9E 2BT6A 4IZ8A 4R8IA 1F2LA 1A3VA 2JX5A 1JWAD 1PGXA 2JQRB 2VUMB 1U4MA 1ROEA 1TWHB 2KAJA 2WXMA 2ONQA 3RPFC 1A3UA 4RGTA 1XXGA 1R9TB 4ZQ3A 4NJCA 3MXPA 3C8YA 1QB5D 1ZPSA 3P4PB 5KYLA 2EY5A 3P4QB 1C76A 2O4XA 2W82A 3RFZB 1R7SA 3WOEA 3FMCA 2F0OA 1EFID 1H9SB 2LHEA 2INNE 2JYOA 2QDBA 5I2YA 2F0UA 4XIGS 3DWPA 3DM1A 4P2CB 2D9UA 1TIID 4QUCA 3BDCA 2WV6D 1R4PB 2Z1CA 4WJWA 1EY7A 2WXRA 5FO8B 1WTQA 3G7LA 1STAA 4J8QA 5HG2A 1GUGA 4A3MB 4HKZE 4DNRB 1JWBD 3Q24A 4DN4M 3AEEB 2JYTA 2A6HD 1HTLD 3FDTA 1MI0A 2PNRC 1FYCA 1ZUD2 2EY1A 4E6IA 1WTOA 2L32A 2ZW0A 1B3AA 3VA7A 1YQ3B 1PZID 2K03A 2BA1A 3IFDA 1FIQA 5JXVA 1UWMA 1HQMC 1QNUA 2L0CA 1G91A 1I50B 4N58A 3VR4A 3TEYA 5DAUA 4C56C 1GAQB 1Q12A 1LTTD 2R6GA 3FPPA 2DYMA 1HRJA 4K2LA 2V0GA 3MJ5A 4M8AA 4X3UA 1XX8A 2C9OA 5CORA 5C3EB 1DOYA 3V3XA 1IW7C 4PMWA 3TBIB 3S17B 2RPVA 2X6LA 2WIIB 3VYRA 1EYDA 5IGDA 5M5WB 4ZOHC 1IYUA 3T53B 3AE4B 3T4AC 2PVOD 5BN5A 1CQVA 4JWUC 2A74C