2SEBD

X-ray crystal structure of hla-dr4 complexed with a peptide from human collagen ii
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
235
structure length
217
Chain Sequence
SQPDPKPDELHKSSKFTGLMENMKVLYDDNHVSAINVKSIDQFLYFDLIYSIKYDNVRVEFKNKDLADKYKDKYVDVFGANYYYQCYFSKRKTCMYGGVTEHNGNQLDKYRSITVRVFEDGKNLLSFDVQTNKKKVTAQELDYLTRHYLVKNKKLYEFNNSPYETGYIKFIENENSFWYDMMPAPGDKFDQSKYLMMYNDNKMVDSKDVKIEVYLTT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Complex (mhc class ii/superantigen)
molecule keywords HLA CLASS II HISTOCOMPATIBILITY ANTIGEN
publication title X-ray crystal structure of HLA-DR4 (DRA*0101, DRB1*0401) complexed with a peptide from human collagen II.
pubmed doi rcsb
source organism Homo sapiens
total genus 67
structure length 217
sequence length 235
ec nomenclature
pdb deposition date 1997-10-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF01123 Stap_Strp_toxin Staphylococcal/Streptococcal toxin, OB-fold domain
D PF02876 Stap_Strp_tox_C Staphylococcal/Streptococcal toxin, beta-grasp domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.110 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 2sebD01
3.10.20.120 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 2sebD02
1JCKB 1KTKA 1CT1D 1QILA 2TSSA 1PYWD 3BVMA 5FK9C 1MD2D 1UNSA 5D3DA 1TS2A 4Z9CB 1AW7A 1I4RA 4UDUC 1LTTD 3DWAA 1I4PA 1XXGA 1PTOB 1I4HA 1RDPD 1TY0A 5ELFA 4L6TB 3R8BA 1HXYD 1S5ED 1TY2A 5ELEA 4RGOS 4NZLB 1RF2D 1LTAD 1SXTA 3CHBD 5TSSA 2AQ2B 2IJ0A 1LT5D 1ET9A 1PRTB 4OHJA 4RFBA 1YN4A 1BCPF 1HTLD 1CK1A 1D5MC 1D6EC 1PTOC 4RGNA 1PZID 1PZJD 1BCPD 1SE3A 3MFGA 1LTSD 2AQ1B 4RHRA 1FD7D 2G9HD 1FNUA 4DXFA 1TS4A 1CQVA 1EEFD 1LT3D 2O2LD 3MC0B 3R2IA 4BWGB 3TSSA 1GOZA 1M4VA 3KLSX 1B44D 1D5ZC 3SEBA 1LLRD 3URYA 1TS3A 1EU4A 2QEJC 2QILA 1JR0D 1LTRD 1LT4D 5ELDA 2AQ3B 2XN9C 1ESFA 1FNWA 1PRTC 1DYQA 1I4XA 1DJRD 1SJED 1STEA 1V1OA 3DWQA 1EWCA 1KLGD 2RDHA 4ZYSA 1FNVA 3DWPA 1BXTA 1HQRD 1JWMD 1T5XD 2NTSA 5FKAC 3V05A 4RCOA 1LTID 1V1PB 3EA6A 4O1NA 1YN5A 3OWEB 1CHPD 1JWUD 1B1ZA 1EEID 5I4DA 1LTBD 4RHSA 2XNAC 3W2DA 2CHBD 3O13A 4TSSA 2J4XA 1BCPB 3BZDB 1XTCD 4RGTA 2RDGA 1KLUD 1RD9D 1SBBB 1UUPA 1I4GA 1PTOF 3BYTB 1RCVD 3EFXD 1V1PA 2IPKD 2XRQD 1S5BD 1PTOD 1G8ZD 5ELBA 1JWSD 2SEBD 1HA5A 1SE2A 3BYYB 1ENFA 1L0XB 1PTOH 3BVGA 2R61A 1TS5A 2NTTA 1L0YB 1F77A 1CHQD 1ET6A 1FGBD 4C56C 1EU3A 4L63B 1JQYD 1YN3A 1S5FD 4RGMA 3R2TA 1AN8A 1BCPC 1LT6D 1PRTF 1SJHD 1LO5D 2XRSD 1PZKD 5D3IB 1LTGD 1S5CD 1D5XC 1PRTD 3BVZA 1SE4A 3GP7A 2Z8LA 1SEBD 1I4QA 4DXGA 2WV6D 5ELCA 4K6LA 1S5DD 2ICIA 4RH6A 1EFID
chains in the Genus database with same CATH superfamily
4DAYA 3Q3NC 2E8GA 2HQLA 1H95A 3U30A 1HR0Q 1OEYJ 4HN7A 1FYCA 2DJGC 4R4QA 1QQRA 1N33L 3FKYA 4JIOU 3DM3A 2D9UA 1SGHA 3FAHA 1STNA 2MJ8A 5FLMH 1B2TA 5LL6X 2M56B 3VUWA 4O2DA 1IBXB 3FDTA 1KABA 5E6PA 1B9RA 4TQ1A 2ZCBA 5CV5A 3C0RB 2VL6A 4R4CA 4A20A 4C1NK 1WXSA 3GE8C 3IBEA 1V6EA 2EKEC 1VQHA 3KK7A 2F1MA 4DUZQ 3NS8A 2ZT9C 3FP9A 4E3CA 2OJWA 2J7QB 2W54A 2YTXA 1KDBA 1PH5A 1JROA 4KI0A 5C0XI 3DBLI 1BCPF 3G7LA 5FJ8G 2JX5A 2FNJB 3QWZB 1SE3A 1XLOA 3HOWH 1NR2A 4GN3B 1TS4A 1ZYRC 3HP3A 1OQRA 4REZA 3WIMA 4MN3A 4JI0L 1GPXA 4YWGG 2GVAA 1TQOA 1MJEA 1VZ7A 4JG2A 2ZTEA 3CCQA 3HUIA 4XC2A 1H9MA 1NTGA 2KDEB 5D94A 1ZOYB 3ZVVA 2K5QA 4FHKA 1CA5A 1HE8A 4W9FA 2GLSA 1STAA 1EY8A 1D1IA 1N60A 1ZDXA 4M02A 4JI0Q 2EMSA 1F2MA 4WORA 2WDTB 1O78A 4HJKA 1YJNA 1DONA 1X3EA 4YTPB 2DNEA 3KF6B 4C3IG 1VQ7A 3T1HL 1JWMD 3AU7A 4Y7NH 2QKIC 4BY1G 2EZVA 1L4DB 3K9OB 4RCOA 1I50B 2ES2A 3I55A 2FMCA 2LXAA 1H9SB 3KBXA 2ZJQA 4F87A 3A4RA 4WRDA 3CCLA 5AZHA 1I42A 2KQ7A 4LMQD 3QOLA 1IBKL 2DYBA 3ENEA 2C5CA 2D3GA 3T1HQ 4LJPB 2MBQA 3I63C 4EKUA 1KLUD 5CHWA 5A2QL 2D10A 4YWKA 4JWSC 1I4GA 4MGKE 2O6VB 2UXDL 3EFXD 1IBKQ 1PQSA 4KZ0A 3BU2A 3F2DA 4LFAL 2FCNA 1G6ZA 3D4RA 2EMTA 2VZAA 4KHPQ 4DR2L 1K0RA 1EYAA 2IY0B 5GAEC 4KN4C 3BZCA 1E7PB 2KN4A 4K8JA 4NXNL 2A8VA 5CHFA 2MO0A 1JWBD 4XX5A 3C46A 3FHWA 3R2TA 4LFAQ 2NPTA 2LGXA 2K04A 4B9WA 1STHA 3V62A 4M8MA 1PRTD 2K1FA 5AZFA 1SE4A 1CTMA 1JOOA 1AP0A 4HEA1 1L2FA 5ELCA 4RMAA 4NXNQ 2A6HC 1E7UA 4KTAA 4CGYB 2ICIA 1QNKA 2ZTCA 3B6YA 1JCKB 3NK9A 1KTKA 4FF2A 1FRDA 2XWBB 4W9CA 3CCUA 4DK0A 2R92H 1FCCC 1E8YA 4GOCA 3IFTA 1JRPA 2EDGA 3BS1A 1DOMA 4DR4L 1RRBA 1T3QA 2LUMA 3L9AX 1RLFA 3VTVA 4DR7L 2CKHB 4DV3L 4KY6A 3LNNA 2MFIA 5M5XB 2B2VC 4DV6Q 4A3CH 3VR3A 2O6VD 3P4SB 5IGEA 2K01A 3J80c 1L6UA 2IGDA 2BGFA 4DR4Q 2LI5A 4JC0A 4A3JG 4HWIB 2ALYB 1MKHA 2W82A 4W9DA 1DXMA 3V2TA 1NVID 4HKZE 2DJFC 1TKGA 2IY1B 2KVMA 1G2SA 2N4FA 2WB1G 1WTOA 2A19A 5GQOA 2KT7A 1E3PA 2RBMA 2CWAA 2FUG1 2M19A 2V4IB 3D4WA 5BR8L 3TS0A 3VRAB 1UE5A 4WFN3 1YX5B 2B2UC 4B95A 1K50A 1TKYA 4PMBA 4QF4A 3C2PA 3P42A 3S14B 1M1KC 4A55A 1X9NA 3M3YB 3A9JB 2Z6KC 5JEAH 4A3FH 1AH9A 1SMYD 4JV5L 2JF5A 2JXTA 3B9JA 1WGKA 1LLRD 4CBVA 3ALBA 1K3RA 3W1GA 2N9XA 2LVPA 3JAML 4TQ0A 4K5XA 2WS3B 3KF6A 3VUXA 3AE7B 1MPEA 4P73A 2JZZA 2K8HA 4LF4Q 3PMFA 3T16A 5CV4A 2MJ3A 4JL9A 1I3QB 4BBRG 3H15A 1TWCB 2WAQE 3J81E 1N34L 3P1HA 1E8WA 2YTYA 4OVVA 2Y0SB 1MG8A 4IUVA 4P7IA 1N8RC 2ENBA 4IJLA 2DWQA 1XMOQ 3TL5A 4EE2A 5LXHA 1X55A 5ELOA 3RN9C 1B1ZA 3RNGC 5M5WH 2BS4B 1JWAD 2O6VA 3DQVA 3NTKA 2QGQA 1DOLA 4YCWA 4NPNA 1G2TA 1SN8A 4HPLB 2MHJA 1BCPB 1YQBA 1XTCD 3A8JE 2BH2A 1Y8PB 1RODA 2Q2HA 1JT8A 3DPDA 2DZKA 3L54A 4R3DA 3TCAA 4GDKA 4BXXH 2B2WA 3VTWA 1JE5A 3NELA 3FKIG 1CKMA 5D65A 2KANA 4HJGE 4LAAA 4DHZB 1R4NI 1L7YA 3SFDB 4ZRQA 5IP7G 2SEBD 3RD4A 3PIO3 2KAJA 3DUZA 2ZM6Q 1BBXC 1Y1WH 4I7ZC 1XNRQ 5M3FB 1UWMA 3PPAA 1TS5A 4RKLA 1F77A 3M4OB 1XCTL 3AQQA 3MEHA 3RN5A 3TP6A 2IGHA 1F9SA 1NCVA 4C2MH 3RMKC 3RZDH 4H02A 2LD9A 3M7NA 1R4QB 1PZKD 4IUTA 4NNJB 2N8NA 2K25A 5C4JB 2PMVA 2N0SB 5M3MB 3PSEB 1RL2A 4DXGA 4AYBG 4H0LC 2I5LX 3GTMH 2JZ3B 1EFID 2A6ED 2HD5B 4IOIE 2R3ZA 2K5WA 4WAFA 5KNCA 2TSSA 1WD0A 5G3LF 2JYOA 3VTUA 3ND8A 5BN5A 3N20C 3GTLB 4EFOA 2D0PA 3OTOL 1TR5A 2IT1A 4EX5A 5KHOA 5IP9H 1VZ6A 1I4PA 2ZVNA 5CV6A 4QMGA 5EKKA 3I4NG 1E5WA 1TY0A 3CMEA 2HDMA 3HOVG 4IC7B 1WR1A 2XEWA 1XEEA 2WXJA 3SHLA 3MC8A 3OTOQ 2K0PA 1YI2A 2QW7A 2IHEA 3ZYYX 3H3VH 3KFUA 1J7BA 2DHZA 4A3BH 5AZGA 4UP8A 4WQOB 3J9CA 1GHKA 2JYEA 3UQBA 2INPE 2QC8A 2VQEQ 1CUKA 4DR3Q 4K8IA 2KN5A 4FDBA 4PS7A 4HIOA 3KDFB 4LNOA 1HQMC 4RG1A 4WJ4A 2RDBC 3CCSA 3BDCA 3LGJA 4YSXB 2YV5A 4B3RL 4XE0A 1GUOA 5DCNA 4CO7A 1IKLA 1VF7A 3PZDA 4F1SA 3FC4A 4OW0A 4EEWA 4B9KA 1ZPSA 2IO2B 4H7BA 4KD4A 4DR6Q 4EZKA 1OXTA 1MBYA 1KIXA 4WJ3M 2SNSA 4Q5VA 5IIFA 1XNQL 3BINA 5JHAA 1STGA 5H92C 3WCQA 3PHWB 4DUYQ 2EYLA 5EJWA 3VYRA 1XLQA 1UELA 1DYQA 5CR3A 1I4XA 4EQOA 3AN1A 2HIVA 2JZPA 3GQBA 3DWQA 4ZLTF 2G45B 1SNQA 3CC4A 4A9AA 2G1EA 4ZRJA 1XNQQ 4CQNA 1NDDA 5CX3A 2R2OA 1N9WA 1E22A 2ZTDA 2JA7B 4QAYA 3J81i 4ACFA 3EA6A 5CMDA 3W1SC 4I7AA 2JU6X 3JW0X 1QOBA 1JWUD 3EROA 1SIJA 4GN1A 4I6NB 1EEID 4G57A 4GLVB 4DR1L 3Q8EA 4IUUA 2CHZA 3DEOA 1N32L 2PLPA 5E6NA 3TZUA 2P5ZX 2BVCA 4V190 1YX6B 4LFCL 4PNYA 1VQOA 2YYZA 3TZDA 3ZXRA 2VH1A 2A1AA 1XLNA 1GG3A 4TUUA 2N9PC 2RSUA 3VVWB 2PEAA 1HPCA 3SK8A 1JJ2A 1R9TB 1N32Q 4ZKCB 2QJLA 3GOEA 3A0JA 1KNAA 3M3YH 2W9NA 1QZGA 3BYYB 1JB7A 4LFCQ 1L4ZB 4L2YA 1DGJA 2EXDA 1VQ9A 2HT1A 4LK1C 1FVIA 4RM9A 2DBYA 2HTME 4TKOB 2KECA 3SK6A 1HR0W 5IT9c 1S5FD 3ML8A 1YNNC 2MP2B 3AYHB 3EN2A 1GNUA 2K03A 1YD8U 4JOIC 1EYCA 4ICUA 5E4WC 3S2DB 4MGYE 2K5DA 3S1QB 3S17B 4K1RB 2RGFA 3HOXB 1TWCH 1W6KA 2JRHA 4KX6B 3MZ5A 1G291 3VXWA 2MWSB 2L0FA 2OT2A 3GDEA 2D62A 5I2YA 4DGZA 3DHHC 5KIXA 1FMAD 2PNRC 4ZK9B 1Z7TA 3EJIA 5EGTA 4ITKA 2B76B 3KQ4A 2I38A 1EWYC 2BYFA 3L08A 4YCVA 1WX9A 4JI2L 4LF8Q 1NYRA 2TMPA 4FLHA 3BVMA 5E4XA 4BS9A 4GLXA 1SFOH 1A3VA 1JORA 2FXQA 3MEFA 5CORA 1IGDA 2INNE 5HI1A 4PK1A 2LMCA 1G6PA 1V2YA 1E6EB 2BPSA 2R93G 3QIAA 4HCSA 4IDIA 4AH6A 1TJEA 1R4MI 4JQWC 3GTOB 5KEEA 5I6YA 1BNZA 3STBC 4TQUS 1S3SG 2OJRA 1TZOA 2OHFA 4ALPA 2N9KA 2KHIA 4P71A 2NVTB 3AM9A 2B8GA 2F3IA 2GOWA 4GOPB 4BY7G 3EFUA 2WXHA 1HUMA 3KDFA 4F7ZA 3I90A 1IXRA 1WZ3A 4P6VF 2WXNA 3QOJA 3S1RH 2NVXB 3DVNU 1D4BA 1X6OA 1LT5D 4KGRA 3B08A 4US8A 3KWVA 4A3IG 2BQQA 1K3BC 1STYA 2CQAA 3A74A 3AV8A 4OO1H 1K0SA 2D5DA 1X32A 2QMTA 2G9HD 3IKJA 5LMNW 3U50C 1TGZB 1L2NA 2BW2A 3NZUA 5M3MH 3TQYA 2Y0SE 2HUGA 4X3SA 1T0QC 1D5ZC 4KDIC 3E0EA 3KUDB 1IL8A 4WWPA 3X23A 2IBIB 1TS3A 2PQEA 4LFBQ 4QIWB 1NR4A 2R2QA 1JMLA 2WDVB 4DU9A 2G3QB 1BBWA 2AWOA 5KNDA 4CDFC 1N36L 3AEEB 4OWTB 4LNIA 3Q8DA 2OEOA 4CJ1B 2ONQA 3TP7A 2R6GA 1ZXHA 1HUNA 3MJ5A 4MTNA 3ZDMC 3RLFA 1YNJC 2J0MA 1AE3A 1BKBA 3U7ZA 3OLMD 4DHZE 4A93G 2B3AA 3AEVA 4JI5L 3I3CA 2F0MA 5C3EG 4O0AA 1TWGH 2Z4IA 1NSNS 3D3RA 3MA2B 2JQOA 3OIPA 1PYSB 2WXFA 4YL8A 4PMWA 4LTUA 1S4ZA 2EJFC 3F8TA 2ZW1A 1O7IA 4NY0A 2ZPNA 3CP0A 3V60A 2BT6A 3HM6X 2KCNA 4AIMA 3AXCA 5M3FG 2JA9A 4JI5Q 2BB5A 2VXWA 3J80L 1WZ0A 3IAM1 4DV2L 1PTOD 2DUDA 3NSWA 1DGSA 2MP2A 3AE5B 4NP5A 1HNZL 3NG0A 5G3LD 1LV9A 3APCA 4B9XA 2WXKA 3AE9B 3ITPA 1KD1C 1C77A 4C56C 4OEMB 2H5XA 3I91A 3K8AA 3PQIA 3E0JA 1HFNA 5IWAL 3PUWA 1HNZQ 1K8MA 2RCFA 3UDGA 4C3IB 5FLXL 5GADC 1A70A 3AU5A 1FCLA 5IE8A 4P2CB 4DNIA 5C44G 4BY1B 3A33B 4WJNA 3DBRB 1H9KA 4A3OA 1TT2A 2E5LL 1E24A 2SOBA 4IOAA 2Q2IA 2QF7A 1PGBA 2JA7H 5IWAQ 2KBNA 4GN4B 2CHXA 4HTHA 1AZPA 3ZIMA 1L1OC 3MXGA 4OZAA 5HY6A 3PF5A 2JT4B 1WYDA 4RWSC 4CKBA 1DOYA 1HFGA 4DDGD 1K8GA 2LJ5A 2KJ6A 2E5LQ 4D2KA 4A3MG 4L5SA 3UI3A 4JBMA 1XQQA 5IGBA 2E2IB 5IGCA 1QKZA 4WJOA 2V3SA 3WA0A 1OEYA 2M9VA 3MXNA 3S16B 3NHEB 4POFA 1UEBA 3KF8B 3UDXA 2ATWA 5JZEB 2WWZA 1LACA 1R9TH 1LTAD 3H7SA 1FL0A 2LKVA 3L10B 3S1MH 5F2DA 4NJCA 2F0HA 3T56B 2KCMA 4WQMA 2MRPA 4GNXC 2K32A 2ZXPA 1IW7D 4K14A 4PQXA 1D5MC 1J0GA 5C2TB 2V3PA 3U9SA 2UUAQ 1MFWA 3MFGA 4LJOB 1UAPA 2M2LA 3U4ZA 3LYYA 3S1QH 3TUOA 2UWQA 3S17H 4ZUIA 2Y5CA 3KUZA 3KLSX 1B44D 3SEBA 4FYDA 2KWDA 4ULLA 5JPMC 3CMMB 3JC66 2ZZPB 5ELDA 1EQQA 1Q8KA 1W2BA 4N59A 4OELB 1KF6B 2F0JA 5A2QE 1E2WA 4O42A 4WWMA 1WFQA 3Q8FA 1P3QU 2RA4A 3N9YC 3G6JB 2RDHA 2Q2TA 3IRBA 2NVQB 2NZ1D 4A3JB 1C4QA 1U5KA 4BKTA 3T13A 2J42A 4IWPA 3PV0A 2AYOB 4DK5A 1UGMA 3HK0A 5FKAC 1ICFB 1QCBD 3GTOH 4M1UB 1SIFA 1YJJA 4KZCA 3I56A 4GDLB 1K73C 1SNDA 2DN8A 1YJ9A 2WB1B 2Q8TA 4X66L 4X57B 1C78A 1VQLA 1VMCA 2XNAC 1HEZE 2IX1A 4E6IA 3NEMA 3UE1A 4HIMA 2KMMA 2D5GA 2QSDA 1VS0A 1SBBB 4OL7A 4EGVA 2XWJB 3BYTB 2D2QA 3APFA 2KEEA 4X66Q 4K5WA 1SE9A 4HCPB 1V1QA 1LM8B 5L83A 4Y52H 3RZFA 4DAPA 3IT6B 4FADA 5LXIB 2LFIA 3E5SA 4QUCA 2KX0A 1L0VB 4HMIA 3SK4A 1WTVA 2WGSA 2KQ3A 2BF8B 1PTOH 3HOXG 3L17A 1VQIA 3PRZA 4M0WA 2D3BA 2K3UA 2E75C 4N8X1 1I7HA 2PQAB 4RMFA 4QQBX 3Q3OC 3TEXA 4AQ7A 4BBRB 5IYDG 2EIFA 3VRBB 3FVQA 3U8ZA 4E74A 2J0KA 1A2UA 3QG1A 1IGCA 4U68A 3JVZX 4IWQA 3NPPA 1B3AA 2KENA 4MGZE 2CH4A 4KKUA 5E3FA 4K81A 1PH6A 4NAMA 3GTGH 5IKCM 2X8XX 1V9PA 3UIPB 2BOSA 3A1QB 4CDEC 1FIQA 2JK8A 4K7UA 4M00A 1Q86C 1UE7A 5DPWA 3AMUA 1U0LA 2QCPX 3IFWB 3ZNGC 1D3ZA 3PO3G 1TWFB 3L0OA 2M8SA 2XK5B 3FKIB 3IHPC 4LF6L 5FJ8H 5IP4D 2WXMA 4DDID 1TTNA 1BR9A 1IUEA 2LVOA 1NI3A 1HR0L 1F9JA 1VQ8A 1MJDA 1VMPA 1WMHB 2FFKB 3L2PA 3DOWA 3ZNHB 3JAME 1QLBB 3J7AV 3RFZB 4G7OC 5JOBA 1ONLA 1C9OA 4LF6Q 5IN7A 4QIWE 2PMZB 4A3LH 2IHFA 4LDTB 3DWMA 4IM2A 5JXVA 4KGSA 2O2VB 1YN4A 2K1BA 4L23A 4XT1B 5GAHC 2ZNVC 3LB8C 2Z4HA 4PZ8A 5I6WA 1TZ1A 1XF5L 5GMVA 2OCEA 3BJUA 4OXPA 4AYBB 1LTSD 1EIHA 1Y1VG 5J39A 3Q0AA 3O65B 4DUZL 4FF4A 3I5JC 4AJWA 2PW9A 1GOZA 4BY1H 2A68D 3H0GB 4C3HG 2ID0A 2NVUI 2SNMA 3J7YW 3ML9A 3URYA 2O4XA 2LEKA 5BYSA 5EKLA 5COYA 4YWMA 1J8IA 2FE8A 2ZJRA 2J53A 2Y5BB 3CQZB 4IG7B 1LT4D 4FBJB 1PRTC 3KUCB 2J52A 1ENAA 2RHSB 1LTLA 1Y8NB 2PCFB 4A3DG 3DBHI 3CPFA 4DHJD 2MCNB 2GBNA 3BG3A 1GB1A 5JPNC 1EWCA 3CCRA 5C3XA 4NXMQ 3I4NB 4S3SA 2IO3B 3HOVB 3DBLB 3H7PA 3UQAA 4DNTB 1N62A 1ICWA 3H8HA 3DWPA 2IDYA 1HZCA 3A9KA 2F0DA 1CQFA 1A3TA 2VS1A 3FEWX 1H4RA 1KM7A 4K6DA 1JOKA 3TJPA 2IYDB 2L3ZA 1MI2A 3RUZA 2PPHA 4OVZA 3S16H 1PUTA 2YU9H 4I6PA 3R93A 5IODA 3Q3JA 1FFVA 2JVCA 1C9FA 5JJLA 5LMNL 4BZAA 1PH7A 2CHBD 5EBDA 3SR6A 3P1MA 1NY4A 4J15A 4BBNC 3H3VC 3CCEA 1RD9D 3LWUA 1WX8A 4H13C 1KQSA 4A75A 3K6OA 3KOJA 1VZ8A 4GGQA 3OW2A 2F0UA 2B2WC 1G8ZD 3CCJA 5LMNQ 3VDYA 1SYEA 5FOBB 4K0KQ 1MSHA 2R7ZH 3QO2A 3TBIB 3PUYA 3T1YQ 1VQ4A 5K5PA 3RYTA 4G4KA 3GTKB 1WRIA 1EQVA 3S2HH 2PTLA 4TV3A 4MJSB 3RNCC 2L9HA 4ARCA 3S15B 1J19A 1CKOA 1EU3A 4KSKC 4PS8A 2K8CA 3EQLC 4RF0A 1SSOA 3VA7A 1FJGL 5HURA 1II3A 2MPMA 2CHWA 2IZVB 1WTXA 4GLAC 1SMYC 2XSCA 4KHPL 2LGIA 1RYJA 1A62A 1V9JA 2VUMH 1WIAA 4A3JH 4G0NB 5FLMG 2FCSA 2A69D 1KC8C 1NMFA 2K9XA 4IUNA 1WI0A 1EOTA 1FJGQ 1F2RC 4W9IA 3W9CB 4DV7L 4IFDI 4YT0B 2YTVA 3A54A 5JJIA 2ZVOA 1KLVA 1MD2D 3K58A 5IYBG 1CMXB 3KYCD 1KAWA 1EZ8A 4XGAB 3LWEA 4Z9CB 4G11A 5J2RA 4WWNA 1B8AA 2ICEC 4C3JB 3V61A 2J0TD 4DV7Q 1KL9A 3VR6A 1O7ZA 4QCLA 4C80A 4KV2A 3H6NA 5CGKA 5J22A 2KCTA 1RWSA 2WIIB 3NVZA 1J8CA 1MIUA 2PIAA 4GLSC 3L16A 4JW0A 2BA0A 4DV6L 3DM1A 4MHEA 1IBXA 1NAPA 1Z9FA 3JAMi 3H3VI 1WM3A 4LLGM 3S24A 1Q81C 3I72A 3HGBA 5M9OA 4ARIA 1T0YA 4BBRH 1XT9B 3E56A 5DPTA 2DY8A 2AQ1B 2IL8A 3X0WA 4HRSA 1FD7D 4KN7C 5BMGA 2HDEA 3WALA 2H89B 4AWJA 1VQAA 4A3EG 1WJJA 4ZRPA 2PE9A 2L7RA 3HG9A 5BMHA 3TSSA 2EJMA 3CC2A 1EY9A 2G5DA 4JLCA 2WB1E 3KYDD 4ICVA 3ZJTA 2K14A 1QZHA 2R93B 2LRWA 3AE8B 4X64L 1BT0A 3NVVA 3QK0A 1VQEA 4U673 1WGDA 2QHOA 2EXZA 2KX3A 3P4RB 3WAOA 1YZ6A 1EQTA 1FNVA 3VR5A 4DV4Q 3VYSA 2A6EC 3NE5B 2GA4B 2L76A 3PZ7A 3VR8B 3V05A 3OHXC 1F2RI 4BY7B 4A3KG 1X3QA 4X64Q 5IP7H 4PV1C 1YQ3B 2IO1B 4TKNA 3TEYA 4H44C 1V81A 4LF4L 2LASA 4N9F4 4NJ6A 4EUTA 4FJVB 3N32A 1VQ6A 1I6HB 4A3IB 1BUVT 1H8CA 3W5VB 2HHHQ 4YY3L 4XQJA 3W3AA 1IPGA 4KMUC 4BOSC 2MLBA 2QEXA 2B3GA 1X3GA 4WIPA 1XYIA 4MJSA 4F8MA 2GBKA 4XXEA 4BA1I 3M85A 2IPKD 1PXUA 2SDFA 1XMOL 1H9SA 1AYFA 1Q8IA 1SLJA 3A8IE 2VQFL 2LWPA 2R7DA 3RNUA 4YY3Q 2V4DA 5IY0A 2L05A 2NBUA 1SB3C 1GB4A 1TT5B 4FF3A 4CHKA 3ZGZA 4XWTA 1SNCA 2A73B 2HCIA 3RZWC 3CQZH 2OEDA 1LO5D 2VQFQ 4HDOA 2LZ6A 4HKQA 3H94A 4XDDA 3P2BA 1X56A 3R7RA 1SYCA 3M4QA 1WE6A 3ZTDA 1SEBD 4C00A 1VLBA 1TIID 2ZM6L 1UD7A 2JA8B 4B0EA 3HOVH 4A93B 4K6LA 4KV6A 1XNRL 4S17A 3A56A 4TRDA 3D0FA 4I65A 5C3EB 1XCQL 5DPSA 4I6LB 1R4NB 4HLEA 2NBWB 1HNXL 1KDAA 1EF1A 2DYOA 2G4DB 4N9TA 3D31A 3I4MG 4IPCA 5EAYA 2QDFA 2V4LA 3CU7A 3ULJA 1WX7A 2PMZE 3W5OA 3Q2AC 5C1ZA 4KLKA 5IA7A 2L55A 1E1TA 2N1WA 2OWOA 1GC6A 1AFPA 1V80A 3I70A 5D6JB 3F1ZA 5ELFA 1HNXQ 3N6RA 2JP1A 3NXWA 4AYBE 3SDZA 3L3OC 1M90C 2K6DB 3AE1B 2QIEB 3HIZA 3PREA 4K3BA 3VH3B 4A90A 2B39A 2NR2A 1HTOA 1X65A 4RGOS 1BBUA 2AWTA 3TEZA 4JVZA 1SNMA 1OXUA 4NZLB 1IYJB 4MZ9A 3WDNA 1WJ6A 4MM3B 3K5NA 3T3NA 4B3SL 2WDRB 2E6XA 2IJ0A 4OIKA 3A7AB 3GTKH 1UWVA 2HQEA 2G4SA 3H0GG 3QJYA 2Z0SA 1I50H 3HS0C 3FILB 4CHTB 5JEAG 4IM3A 3HOYG 1O7LA 1EO6A 4R4OA 4CDCC 5JVG3 2B2TC 2LGDA 3Q3FA 4P16A 5C44B 1BCPD 2BWES 1U4PA 2B63B 2RPQA 1OXSC 2RD0A 3C19A 2ZJPA 2K22A 2L83A 4PS3A 4AQYL 4B3SQ 1J7AA 4KKTA 4OO1I 1ZW7A 3DLLA 1X3FA 2B29A 5C3WA 2LS01 1MHHE 3ERSX 5C0XG 1XLPA 1K8AC 3AEAB 3IVFA 3NQIA 2QEJC 3TMPB 3F2CA 3H91A 4RF1A 2MHVA 1Z6HA 2VQEL 1O7YA 4DR3L 2VW9A 1QT9A 2XN9C 3RLNA 4CYEA 4AQYQ 4A3MB 2NBVB 1R7SA 1I35A 2KJRA 1AWDA 2ASQA 2WP9B 3J80E 2CCZA 3A9JA 1C7YA 2DNCA 3G71A 4DR6L 5C0XJ 1WGGA 2VZKB 3OSOA 1PDQA 1T5XD 3J7ZC 2DX5B 2FIDA 1E0ZA 4LNKA 1V1PB 4OGQC 3A4SC 3QCAA 3RMHA 2K6AA 4DUYL 1WM2A 2KC2A 2B2YA 1VQMA 3AFPA 4X3TA 4Q0FA 4RHSA 3MHBA 4APVA 3CC7A 4JI1L 1WGYA 3M3JA 4W9JA 4A6QA 1CZGA 1G6JA 2J4XA 2QDLA 5FLXE 2RDGA 4ZUJA 4KJNA 2C9WB 3PSIA 2QCZA 4MEMA 4AUQC 1NE3A 2BYTA 1GUGA 1YHAA 3P4QB 2MJEA 5E6OA 4JI1Q 3GTPB 1LXDA 4P72A 2L0TA 4KKSA 1XMQQ 5M5XH 2EY1A 3L0WB 4MT5A 4Q2JA 2A5HA 1IBML 1U9RA 3H9DA 3DVGY 4GXBA 3EUB2 1JW9D 2EYOA 3AI5A 1LT6D 1SJHD 3SE0A 3CSFA 3Q8BA 3ER0A 4IFDG 5EE0A 1K83B 4GSWA 1NBWA 1FXAA 3TDQA 2JA6B 1HNWL 2R93H 1N63A 5IYCG 1UH6A 3I8ZA 2PE6B 3S9WA 2Z8LA 4DK6C 2VZKD 1X54A 4QY7A 1GM5A 2K4KA 1IBMQ 2F4VQ 2N88A 3WAPA 1EZ6A 4OZCA 3PIPA 3P75A 4A3GB 4WURA 4C3JG 3HM3A 4MH0E 3DVGX 1HNWQ 1QILA 4BY7H 5KNBA 2C7NB 3OPOA 3S14H 2LRUA 1ZDVA 4L1BA 2GVBA 2JSVX 1GUNA 1KHIA 1W6JA 3GV6A 3RT3B 1R4PB 1XPRA 3RLOA 2Q2UA 4GIVA 4XWWA 4L5TA 1D7QA 2PNHA 4GKJL 4BKGA 2F0NA 3VDZA 2EYMA 2G9DA 5C5LA 4PMCA 4LF8L 1VQCA 2W55A 2L15A 3CAMA 1KXLA 1I3QH 3ZNZB 3AECB 2CFMA 4ASWC 1JJGA 2KJHB 1V5OA 4MELA 1V8CA 2KVZA 3P4PB 5C4ZA 2ZCCA 1V8QA 3OMGA 3KWLA 3AEBB 4EQ5A 4GKJQ 3ETRA 3QWNA 4OHJA 4GMVA 5DPRA 2I2YA 1E7ZA 1P8LA 1CFMA 1ZXIA 1HTLD 2MJDA 3SR1A 1D6EC 1PTOC 2KYWA 4ZCKA 3GTJB 4RHRA 4CJ2C 1R4MB 2ZXRA 3PHXB 5CTRC 2O2LD 3MC0B 1OXVA 1EY4A 3K81C 4FVMA 4XQQA 3LJ3A 3RNAC 1UGJA 4FXGC 4A93H 2ZJDA 2EPBA 3AE6B 3WOEA 3A5UA 2D2CC 2AUJD 4II2B 5C3EH 1SMXA 2WFWA 4NDXA 2NVYB 1FNWA 1PH2A 2KK8A 5EE1A 4NB3A 2WX1A 3PO3B 1Y14B 1DD2A 3KYHC 2KTRB 2WDQB 1GJZA 2KUMA 5DLQE 3ONSA 1LYLA 4YHHQ 3PO2G 3MWYW 5M3FH 4MACA 3UGBB 1ILQA 1N5XA 2MW5A 3M4OH 3IAYA 1ZP0B 4MH8A 1ESRA 2DZJA 4LFBL 3J80i 5J18A 4YTNB 1YN5A 2AMCB 2CVRA 2UYZB 3U4EG 1ZKOA 1S40A 1Q12A 2DYMA 2VH2A 4OONA 5C4JH 1LTBD 3GS2A 3JYUA 3RPFC 4R1JA 3MC9A 1NMGA 2C9OA 1VQ5A 4ZRIA 1UEAB 5AFWA 1EIYB 3HOZG 2EYFA 1UUPA 3QIJA 2NN6H 1Y1VB 4HJ8A 2EQSA 2WXIA 4WH4A 5C23A 3CW2C 2KMAA 1TBEA 5C44H 3EGRA 3HKZB 1TYGB 2WXLA 4C3HB 1WYGA 5TR5A 3ZLZA 5ELNA 3GTLH 1WY8A 1JWSD 5EKIA 4JGHB 1HZ9A 3DBSA 1ENFA 4FXKC 2I46A 1JB3A 2WXRA 4N58A 1HCZA 2F3WA 1A15A 3MVVA 1K28A 3EVQA 4II3B 3RZOB 2L00B 2DLBA 2JA8G 1IW7C 2N7JA 2LUEA 4A3DB 4L63B 2KWCA 3ECIA 5H8YE 3VR4A 3G6EA 1VQPA 3PV1A 3IFDA 5L95C 4LF5Q 1WWTA 5D3IB 1S5CD 2K05A 4NQKE 4OWXB 1C79A 2C7HA 2LHEA 2ZXOA 3GP7A 2BWFA 3QQ8B 1P7EA 1IYUA 3I57A 1BDOA 1U4MA 4UY8C 2BYVE 1P9DU 3Q69A 5HKHA 2WHIA 1XO3A 2Q8RE 2JA5G 2I1JA 3ZQ4A 3JSVB 5IOCA 3KBGA 2KWUB 2WXQA 3EFCA 3MHZA 2NMQA 3OWFA 5KYLA 3UINB 4HJ7A 1PYBA 1TS2A 5I9PA 4KDLB 2PZTA 4JPSA 4IPGA 1T0SC 2JUOA 3RD2A 1OGWA 1ENCA 1QZEA 2IW3A 3DWAA 5K36G 1VDVA 1BVSA 2WKCA 4YCUA 1EY0A 1RKNA 5LHY1 3LDZE 4RM8A 1TWHB 3TP5A 4LW1A 2RPVA 2EYJA 1B9MA 3OIQA 5DEHA 4UHVA 4C7YA 4EOYA 1JOQA 2B63G 3LX0A 1EWIA 3Q6SA 4JX1C 3K0XA 3N1ZC 2UU7A 4JBKA 3HOUG 2CU3A 3I4LA 2DAJA 1PH8A 1YVCA 1K51A 4QL5A 1NENB 1TIFA 4MNOA 2JWZA 3VQIA 3CRKC 1CK1A 1WXQA 3GE3C 2RDFA 4X3UA 4W9EA 1QNUA 2K28A 1VQNA 1MHWC 2KFKB 2N78A 1B9NA 4ID6A 4OX9L 2JWUA 1FNUA 1EEFD 4GOPA 1LT3D 2N3SA 4BWGB 1S3OA 1B70B 2KZRA 1N6ZA 4KKJA 2KTRA 4DA2A 2IWHA 3IXSA 1NJIC 2F0GA 4HJAA 1JR0D 1QUQB 1WCMG 3KLWA 4HVBA 4OX9Q 1ESFA 4KHVA 2YLMA 3CPWA 4PYUA 2UUAL 5LMUL 4L8JA 1SYBA 3N1YC 4N9PA 2CS4A 2K39A 4P75A 3HVDA 3DHIC 4FNFA 1C0AA 4WJWA 4JPBW 1L5PA 2I5HA 3JAMc 4NAWB 2AX5A 4IPDA 5GXGB 4BOZB 1PH3A 2JXXA 5LMUQ 4PZ7A 4JOIA 4ZOHC 1WE7A 3A5ZB 4XYOA 3S2DH 1Y8RC 2A5UA 3OAWA 3DVNV 2I5MX 3HOXH 3J81j 2N49A 2O5JC 3AEDB 1G91A 1Q5WB 5IYDH 1VJKA 1Y8OB 4WJQA 1WTWA 3OW7A 3R66C 3QR8A 3W1BA 1XPOA 1YJIA 5BMIA 2K5NA 4YIJA 4A3EB 4KIKB 1PFSA 5EPKA 1FO4A 2KOXA 2WNMA 1NEKB 2INDC 1SE2A 2JA6G 2GI9A 2LY7A 1Q10A 1PFMA 2GN5A 4ZHOA 3ZNID 1L1OB 4DAYB 3QARA 1ET6A 3NY5A 4RCNA 1V5TA 3OJ4B 4TMAB 1JQYD 1Q3LA 1F2LA 2I07B 2KJXA 4Y7NB 2GBRA 1AEXA 2AUKA 1PRTF 1D1KA 4A3GG 1C4PA 2JEBI 2NVTH 1CZPA 2NVYH 5JHBA 1YJ1A 2WYQA 5G2NA 1D5XC 2BCOA 4C7ZA 3PO3H 3NZSA 4IALA 4JI6L 2Z0DB 2A68C 1GKHA 2E2JB 2F52A 2NVXH 2WV6D 1TXYA 2BE5D 3GD7A 4A3KB 4POGA 3UIOB 2ACZB 4RH6A 4A4IA 2BH8A 4DV1Q 2DZMA 2KHJA 4BFRA 3WAMA 1GUAB 3QB3A 1P0RA 1YIWA 1V97A 3DHQA 4ODGA 4IW0A 1QJOA 4JI6Q 5J3BA 2PVOD 1FD6A 2W3SA 4DNRB 1XPUA 5GROA 4GNXB 2L1AA 4X3KA 4UDUC 1KFYB 1DOKA 3MFYA 1IBLQ 4CJ0B 4IOCA 1E8ZA 1GJXA 2FIFA 4HCEA 4BBNF 1LQBA 1PA6A 2FUHB 1U4LA 1QOGA 3R8BA 1Y1VH 4ZAIA 1B3QA 1XWEA 1EL0A 5E1FA 3APDA 2QDBA 4HJ5A 5L37A 5BN3A 3H1UA 4C3HH 2PVGC 1A8VA 3PTFC 2H88B 2KFKA 5D2MB 4LF9L 5TSSA 3NS1A 1V86A 5LNK1 4XT3B 2IX0A 3FRPB 3RZOH 2RCNA 2LXKA 3H09A 3DWGC 3I4OA 3I2ZA 3HZXA 2BKFA 2PZUA 3M7GA 3OJ3A 4IO9A 3ICEA 4K3CA 2EKIA 3SHQA 2MEKA 2L5TA 1QUQA 4LF9Q 1EYGA 4LCDE 3KF8A 3ZJUA 3DMUA 2BA1A 3SFEB 3ZTCA 3TP8A 1B4OA 1L0WA 3DXJC 1CSQA 2HD3A 4PG3A 3PIP3 1N61A 4EQPA 3HVZA 3RI7C 2KOLA 4CDDC 1WD1A 2D3AA 4V0BA 1Y69U 2DENB 1HJPA 4UPAA 3I4MB 4IQZA 2WAQB 3WANA 1LTRD 1ROEA 1I6VC 3E6ZX 5DNFA 3AEGB 3PZ8A 3ZO5B 2XGTA 2KQSA 2BDNA 1PFBA 2PPBC 5IAAC 1SAPA 1YHBA 1Q1OA 1DJRD 3R3OA 5KGUA 4GKKQ 3GZNB 4C4VB 1A2TA 3EC8A 3KJPA 1KRSA 5FO7B 4A8XC 1X3PA 1EM7A 1C76A 4BVUC 2A69C 3T4AC 5C4XG 4KJOA 2BYEA 1BXTA 3NENA 3LXFA 1HQRD 3N30A 1GXDC 5BYQA 4WWOA 2CH4W 3K7AB 2N9LA 2RF4A 1WGHA 2WX0A 2N7EA 3N52A 2KWVB 1T9HA 2Z1CA 3B2GA 1E8XA 3PVLA 1TWHH 4C3IH 2CW0D 3IT4B 3OG5A 4AJYB 5GAGC 3K5OA 1M94A 3HKZG 3VHTC 4G7HC 4KIKA 4NXML 4A3FB 3O13A 3HOYB 1M8AA 4ZKBB 4DAVA 3ZKJC 3M4YA 4FJZA 4WAAA 3U2SC 5JJZA 3W5UB 4DKAC 1SNOA 2KMCA 2NPTB 4M01A 1L1OA 1Q1BA 3PF4A 3RNFC 5JH5C 2L12A 1WR6E 5IT9L 4BAXA 2DAFA 4GDLA 1FM0D 3CCMA 1OFFA 1OQYA 1OTRB 2D3CA 3Q8CA 1QWYA 2L8JA 2LXCA 4JBWA 1GC7A 4PT5A 3ZJVA 1F0ZA 4R8IA 2E74C 1E10A 1EYDA 4IN3A 4IUPA 2Q8IB 4BBSG 2R61A 4J6IA 2E2IH 2HCCA 1L0YB 2MBHA 3Q23A 4KY7A 2KTFA 4QJFA 2RKSA 1YN3A 2IX3A 3PLVA 1I5FA 3S2AA 3PGEA 5IYBH 1N33Q 3T51B 5CHVC 3PUVA 4LDTD 2HE7A 2V1YA 2X69A 2WU2B 2WXOA 4LNFA 1CZWA 5M5WB 3PT2B 4K0KL 1YEZA 5EPJA 3PUZA 4MTKA 3T1YL 1MSGA 4K2LA 5HGTA 3NP8A 4GNXA 2D11A 2WLBA 2V0GA 1RJTA 5LLIA 2PQAA 2WQYB 4JE3B 1YNXA 3D6WA 4B3TL 2XVSA 3OYYA 3Q6BA 5D3DA 2PO4A 1FXTB 1PH9A 5CC4A 1AW7A 2F0PA 1DOIA 1LTTD 4KHZA 1Q7YC 2ZNVB 1KOTA 1XXGA 2A4ZA 1MI0A 2GBMA 3DCGA 1Y1WB 4XZ4A 2X6GA 3CD6A 3J81c 1IHZA 3HFZB 2K33A 2BKRB 3L4PA 1W3SA 4NMZA 3NBHB 1S5ED 4B3TQ 4C2MB 3HEJA 5ELEA 3RZDB 4A3EH 4A3LG 1S1QB 2ZEQA 2REXA 3A1QA 1CSPA 2NVQH 3PUXA 1E2VA 4X62L 3U9OA 1PRTB 2F03A 2KACA 2XK5A 2YVCA 5J1ZA 3ZRFA 3GTMB 4OIJA 2EYHA 3UE0A 4EQNA 3CMAA 1JRUA 2K8BA 3AB5A 1CKNB 3VR9B 1PZID 5M5YB 1E7VA 1WMHA 4DWFA 2OTLA 5HG2A 2IGGA 4X62Q 2EYPA 2MA9B 1EWHA 2FINB 2E2JH 1M4VA 4UP7A 3K59A 1CA6A 4C4VA 3TIXA 4A3KH 3IG3A 1PGXA 1HZAA 2C60A 3FPPA 1EU4A 4DV5L 4R8NA 4HIKA 2O2VA 5CYUA 4XQNA 2AQ3B 1GD7A 2V9HA 3EECA 3SD5A 4G3XB 1JMCA 3KLSA 3N1XC 2MO1A 4LWCA 3V6CB 1E0BA 1ZKHA 1STEA 4QUFA 1KH0A 3AULA 2CKZB 2JN4A 3HOWG 4A3BB 4QB4A 4DV5Q 3MAQA 4L5RC 2KEDA 1VQJA 4GDKB 3NQTA 2MBEA 3ZXVA 2AWNA 1FXIA 4MSQB 4O1NA 1VCIA 2UXDQ 3SGIA 2M0XA 4IKGA 2CWPA 2UUCL 1IZ6A 2INCC 5G5HA 3WOFA 1WTHA 2OQ0A 1VQDA 4JK1C 1EFWA 1U4AA 3QAQA 3T53B 4DR2Q 3W2DA 4P1BC 1STBA 3Q14C 2B2YC 1VF5C 1FGUA 4KY5A 2EY6A 4NKLA 4HXDA 5C6AA 1E2ZA 3L7ZC 4DV4L 2WXPA 2R7ZG 1ZXTA 2UUCQ 1NNXA 1N5WA 2JYTA 4AS1A 1S5BD 2B8FA 3KUPA 3MJWA 2LHDA 3ZRCA 4A3PA 1VDZA 4FA6A 2K50A 2CJOA 1MJCA 1ZYRD 1EIFA 1TWFH 5IO9A 1QB5D 3BVGA 3FKIH 1PV4A 2HHHL 1E90A 2HTHA 2CQOA 4IM0A 4FO2A 1Z5SB 3PGZA 3I4MH 1EQRA 1BCPC 1Q1EA 3SK5A 1IL2A 4K7WA 3ZW3A 2GB1A 2VUMG 5D7GA 1LTGD 3PO2B 1MGSA 1F9PA 3KLRA 4NPSA 4A76A 3C1EA 4DR7Q 4DV3Q 2KVRA 2PW5A 3D32A 1I4QA 3ONAB 3S1NB 2Z0EB 4WJPA 1YHQA 5G5GA 3CXCA 3EBEA 5C5MA 2VB2X 1C4AA 1SSNA 2KD0A 5BYRA 1UF0A 3K7AH 4IZ8A 3KJOA 3U7DA 4ABNA 3P20A 1OO9B 5FLXc 4JBJA 5T1GA 3NBHA 1QVCA 2M1MA 1JQ4A 1WOCA 2ZPYA 1WJUA 4W9LA 1J9OA 2MGSA 3HOZB 4OVUA 3H0GH 2IO0B 3V3XA 4IUMB 3HOYH 1BUIC 3AH7A 1HH2P 4GU2A 5BR8Q 3RCZA 1I4HA 1RDPD 3K80C 4M8AA 3M62B 4DV0L 1DCZA 4HAEA 1NYQA 3N3KB 2KLCA 4R9WA 2L4NA 4DBGA 2R92G 2V3NA 4RNAA 2L32A 1LM0A 1CKNA 1UE1A 3I4NH 1WF9A 4JV5Q 5C0XH 3CHBD 2FJ2A 4JI7L 1GO3E 4NJ7A 4DV0Q 2BDOA 3C1FA 5EDSA 4RFBA 4A3CG 2CR5A 1Q82C 2JSOA 1HA6A 4HDQA 3M4PA 2WAQG 4LUOA 2KHWB 2MSED 3E9IA 2RMMA 1SFOB 4CKCA 4JI7Q 1T6BX 1MG4A 3Q8AA 5IOIA 1DOXA 3E3XA 5H1SE 2JA5B 2AKWB 4DN4M 2KXJA 1N34Q 4P1CC 2EY2A 2DZIA 2VNUD 2J7ZA 5T1IA 2A6HD 1ZEQX 3I73A 2QILA 4B6WA 1QG7A 5E7NA 2AL6A 3A8KE 2WXGA 2MX2A 3P63A 5T8IA 1JC7A 3GB1A 3R7QA 4BKSD 3K0YA 5AUKA 3I3TB 3OMCA 2MQHA 1RM6C 2AEHA 1D8LA 2DGYA 2Y3AA 3MXUA 3S1RB 4A3FG 3S15H 1RFAA 1K9MC 1F9RA 4S0RA 2NTSA 3SDLC 3VYUA 1OQQA 4IURA 1JICA 3NTIA 1KRHA 3Q24A 1G51A 4MIUA 3EHVA 2E76C 3HOUB 3QX1A 3KVFB 4R4TA 5CBAE 1F2ZA 4RKBA 4N6EB 4TSSA 1PHJA 1EF5A 3BZDB 1TKEA 2RQXA 5JEAJ 3K5MA 2KO3A 4J6HA 3KH0A 1LGRA 4HIDA 4IFDH 4K2KA 2X6LA 3G48A 2LSSA 2F0SA 1J7CA 1PTOF 4HEDA 1RCVD 5IYCH 2XRQD 3PRPB 2UXCL 4BA2I 5M5YH 1VQKA 3U52E 1NUCA 2NN6I 5IGGA 2PYKA 4HSVA 3AE3B 3K9PB 3HRZC 1U4RA 4JI8L 1A63A 4GS3A 4DFAA 1V49A 1WCMB 3NHHA 1ASYA 2HJ1A 5MPOA 4C3JH 2NYZD 2JE6I 2EVBA 2FHTA 3D6CA 1FGBD 1ASZA 3T8MA 4UAIA 3SU8X 4IUQA 2UXCQ 2FAZA 1SDFA 2R7FA 3VUYA 2OQKA 2I0QA 1B7YB 1RTOA 2K7VA 2KA7A 4BXXG 2LMCB 4JI8Q 3ULPA 1B50A 1YITA 1TWGB 2N1VA 2O5IC 1XMQL 1UBQA 2K75A 1PH4A 2F0KA 3BWUD 2F0TA 1K8RB 4F88A 4FXCA 4ANUA 5HFYA 4FN2A 1Y1WG 1WXMA 1CT1D 4BKSA 4EZJA 3BY4B 4W9GA 3VAWA 2KDFB 2K5PA 3RUIB 1AE2A 5FK9C 3IAS1 1GUTA 1F9QA 1UNSA 2B2VA 4G50A 3CCVA 3TEWA 5J17A 1QVGA 2XBBC 4HROA 3CF5A 4E71A 5NUCA 2F4VL 1PLFA 4MDKE 1GVPA 1UZXB 1KRTA 1SE8A 3HHMA 4L6TB 2ASBA 1HXYD 3CF6E 1EOVA 3AB9A 3TMEA 4B3ML 3GTQB 3M95A 2MNAA 1O80A 1WTPA 1C1YB 4B3RQ 1WYWB 3QHTA 5ISRA 2M4NA 2LXJA 3M9BA 2A74C 1KJTA 2Q5WD 4ZQ3A 1SNPA 3EIVA 1CM9A 1C3TA 1TVXA 1ET9A 3OOCA 3TS2A 4K7SA 1UWXA 1RTNA 2J0JA 2B2UA 4B3MQ 5IP9G 1BQQT 4IFDJ 3A55A 3SXHA 3L13A 1PH1A 3Q3MC 5KRUA 2Z6KA 1I94L 4R4IA 3PO2H 2F3VA 4C1NI 1I6HH 4A3IH 1RFKA 4K5VA 1WTQA 1LUZA 1CQVA 5IGDA 1WFYA 4MM3A 3S1NH 3R3MA 2N9EB 4GOPC 2MBBB 4A3BG 4N8FA 2IY5B 3TRZA 1A0IA 3NUHB 3PO0A 2MUYA 3FILA 1KDCA 1I94Q 3MHSD 3E9SA 5I9OA 4XTCS 2RR9A 1P7FA 4DR1Q 5DAUA 1V43A 2WKDA 1V1OA 4KSLC 4AP4C 4ANXA 4EVOA 1DZ1A 1KLGD 1QE6A 3HOZH 2N7DA 4YSYB 2UUBL 3S1MB 3NOBA 4DXAB 2E2HB 5EQ0A 2I1KA 2ZW0A 3ABVB 5FR6A 4MGIE 2EOTA 1IYVA 2RSNA 1EY6A 5IGFA 4ZDVA 4URKA 4JYAL 2CU1A 2KDIA 2KDMA 3DDCB 1JALA 1ML0D 3B1LX 4UP9A 3VFKA 2LJIA 2KCCA 2UUBQ 2JEAI 2JA8H 1XX8A 1YOVB 3MXPA 1WI5A 4YHHL 3J7AF 2NUCA 3RR5A 3ZJYC 1BMLC 1ISNA 2FBWB 4KGTA 4JYAQ 3B0AA 2EY5A 4XDXA 3MP9A 2C35B 5FR3A 1PVOA 4YXDB 1V1PA 3K5LA 3J81L 1XD3B 5I2XA 3BDLA 1NBFC 3KW5B 4ZRKA 3AMZA 1HA5A 3T9LA 3HKSA 2JA5H 1SYFA 1YIJA 2F0WA 4LNQA 2NWGA 4PZ6A 1CHQD 2F0VA 2Z9HA 2OOBB 2KQ4X 4JI2Q 1AN8A 1PFDA 1A5RA 2DNFA 3AE2B 1VQGA 3E9HA 1QOFA 5CBEE 5K36H 5C4XB 3VH4B 1PFNA 1YJWA 1J5EL 3BK2A 4AOFA 3VR2A 4ME3A 2OTJA 1A3UA 1Q0WB 4RGMA 2KLGA 4LNNA 5EBCA 4YTMB 5D14A 3MXNB 1MVKA 4HR7B 2B2TA 3NVWA 3IL8A 1TKWB 3TBLD 2CJNA 5EE9A 3NWTA 1SYDA 2L11A 4LF5L 2B63H 1E9MA 5BO4B 1J5EQ 4FP5D 2HJ8A 4XDCA 2F4IA 1WJNA 5HHDG 1ZUD2 3HOUH 4LJZC 4OZBA 1T0RC 5A35A 1UE6A 1PTOB 4P74A 1TWAB 1DM0B 2SAKA 1WTRA 5AUIA 4YWLA 4GZYC 4X6AH 2WU5B 3QJZA 4HCNB 1GAQB 1TY2A 3ND9A 5EPLA 1K8OA 4A3MH 2Y0SG 3RULA 2MBOA 4HPMB 4LUVA 4BBSB 1RF2D 4CKEA 3UF8A 3AFQA 3NTHA 4W9KA 3G4SA 1SXTA 2VY3A 2WINB 1FRRA 3TREA 2QA4A 2JXMB 2C7MB 3TN2A 2MP1A 1MHXA 1WCMH 3I9V1 4XIGS 1E1OA 5C3JB 1BO0A 2PJHA 4DAMA 1ACCA 1EY7A 3NWSA 4RGNA 2FCMA 2E3TA 1YNND 3GTGB 1N36Q 2NB0A 4FXDA 2L52A 2YEPF 2BS3B 4H2AA 4DPGA 1IKMA 1XTDA 4DXFA 4OWWB 2DY7A 2UXBL 1WRDB 1HRJA 3R2IA 2PKOA 2ON8A 4XYCA 3V6EB 2JY6A 1SR3A 5JAVA 1ZGUB 4KK7A 4RAUC 4RA8A 2VB3X 1HZ5A 1L6VA 2UU9L 1YBYA 4X65L 4FF1A 3NJTA 1GHJA 3PLUA 4YSZB 2E2DC 1WXAA 4L5QA 3GTPH 1FR3A 3GO5A 2KDBA 5BN4A 2UXBQ 2NZHA 1WXVA 1SJED 4OO1G 1P16A 4HMJA 5IT9E 3UDIA 2BE5C 1Y56A 2RSOA 1LFDA 2NCNA 3NVYA 4QGUA 2UU9Q 4X65Q 1T5EA 3MTNB 3W1SA 1D2BA 5M3MG 4ANWA 2Z59B 2NBFA 3FMCA 4ZYNA 2KKCA 1LTID 3STBD 1YQ4B 4B0MA 1K83H 4DV2Q 3GTQH 2JA6H 3NZ3A 4US9A 1F52A 5I4DA 4XYQA 2M17A 2NN6G 1WH3A 4JI3L 3CSTA 3RNEC 2XIWA 4LK0M 4M0WB 1TU2B 1RHPA 1VQFA 1K52A 1VR9A 1BOSA 1PGAA 1WJ4A 5HGQA 4A3GH 1J6QA 1H9JA 1C4CA 3DBRI 3RNBC 2Z6BA 3U4VA 1Q46A 2L1BA 1NI2A 4JI4L 5FO9B 2LGSA 2PI2A 4TVAB 1EIGA 4JI3Q 2NS5A 3BIID 4HSPA 2RVLA 2V1CC 2Y5PA 1QOAA 1ILPA 4F8CB 4ME5A 1QF6A 1OXXK 2K5VA 4FULA 4MSMB 5KYIA 4JI4Q 2WP8J 4ZHPA 2JPHA 1SF0A 3X3NA 3AEFB 3M63B 2KHSA 2GMIC 3HOWB 4ANVA 2YU9B 2JJQA 4GB9A 1HTPA 1GUWA 3T3OA 3BVZA 1S72A 1SYGA 4J8QA 1AARA 2BS2B 2EELA 1QVFA 2F0OA 2GBJA 2K6QA 3NUCA 2E2HH 1YMHE 4NW2A 5AJ3L 4EZLA 1S5DD 4FJYA 5JJKA 2HIXA 3I7FA 1YNJD 3VYTA 1FFUA 3PRMB 3QA8A 1EY5A 4HJ9A 2XTIA 3GTJH 1PYWD 3HRDD 2HDLA 4J3OD 2EJGC 2OXPA 2F0FA 3MTSA 2C5LC 4IWOA 1F1HA 2R7ZB 1I4RA 5AJ3Q 5JVH3 5KHQA 1XJVA 3K7UC 4G7ZC 5DM63 3D8GA 3CRLC 3U58A 2KNBA 4USAA 3P7JA 3S2HB 1WVLA 2MQJA 4DV1L 1WGRA 1ZE3D 1PMRA 2L0CA 3ULLA 1VD2A 2H4OA 2LFNA 1GUSA 4PYZA 3JSVA 2CW0C 1BF4A 2JA7G 4IPHA 2F0QA 3F2UA 1RIPA 5E6JA 1KAAA 2PZWA 3NRZA 3QC8B 3D4DA 2WACA 2AQ2B 2LVQA 4FHJA 1HHVA 5CV7A 2KC1A 1IBLL 1C8CA 2VUMB 3PCOB 4J1MA 3BZKA 4DK3C 1A6XA 2M00A 2KFJA 3C3LA 4DF7A 3ZUNA 5LL6S 3RN2A 1P1AA 1PZJD 5C4HA 2GRIA 2D07B 1FEHA 4KKIA 5EE3A 4DR5L 1X1MA 2VRRB 3H7PB 5CV8A 5C4XH 1VCBA 3BK1A 3J7A5 3A7LA 3W1YA 3NBIA 3A9KB 1IP9A 3PIOA 4HPPA 3CIRB 4LF7L 2W3RA 3ZDTA 2OF1A 3H6MA 1FPYA 2X38A 4DR5Q 3UI2A 3VA5A 3SVMA 2K5HA 2BTEA 1SROA 1QOHA 3AE4B 2AHOB 4GN5A 3V96A 1CJEA 3DEPA 1CI3M 2LGYA 3GV3A 2F0LA 4ZYSA 4ZRZA 4LF7Q 2NZOA 3WWVA 2K52A 4A3DH 4JWUC 1TWAH 1Z47A 1PDXA 2R92B 1Z2MA 5AEKB 1JJCB 4NQLB 1VRAB 3CWIA 3OWEB 2N55A 1CHPD 1UBIA 5DM73 2BBCA 2FCQA 2F0IA 4B08A 4BBSH 1EUJA 1OTCA 3TEHB 4GKKL 1EUVB 3PS6A 2RHQB 2F0EA 1SRUA 2EE1A 2PI2E 4RGTA 2D0OA 2PW7A 1LABA 2H1EA 1HZBA 1P98A 4DQOC 2YEPB 1VQBA 4DK1A 4NAWA 3ERQA 1K53A 1WSPA 4W9HA 1YNTE 3B2FA 2M0AA 5ELBA 3UDFA 4JCVE 2MH7A 1JE4A 3Q22A 1L0XB 1F2YA 4LUZA 2BB6A 1KNEA 3AU4A 4KVGB 1IYFA 4DHJB 1C48A 2AL3A 4HK2A 2NTTA 1HTQA 3HKZE 1HZ6A 1RAXA 4ILWA 2XRSD 5CV9A 1H9RA 5FO8B 2JRIB 1Q90A 2JQRB 1AZQA 2FMMA 3C8YA 3DHGC 4F7XA 3K57A 3F2BA 4M8NA 4IJHA 3X3MA 1B53A 5G55A 3FPUB 3DBHB 4KD3A 3CKIB 3BDOA 3GZNI
chains in the Genus database with same CATH topology
4DAYA 4HN7A 1FYCA 1QQRA 2D9UA 3FAHA 1STNA 2MJ8A 1B2TA 5LL6X 2M56B 1IBXB 3FDTA 1KABA 1B9RA 4TQ1A 5CV5A 4C1NK 3KK7A 2F1MA 2ZT9C 2W54A 1KDBA 1JROA 4KI0A 5C0XI 1BCPF 3G7LA 2JX5A 1SE3A 1XLOA 1NR2A 1TS4A 1ZYRC 3HP3A 1OQRA 4REZA 4MN3A 1GPXA 1TQOA 1VZ7A 3HUIA 1H9MA 1ZOYB 2K5QA 1CA5A 1STAA 1EY8A 1D1IA 1N60A 1ZDXA 1F2MA 4WORA 1O78A 1DONA 4YTPB 2DNEA 4C3IG 1JWMD 3AU7A 2EZVA 2QKIC 1L4DB 4RCOA 1I50B 2FMCA 1H9SB 3KBXA 4F87A 4WRDA 4LMQD 3QOLA 2C5CA 1KLUD 5A2QL 4JWSC 1I4GA 3EFXD 1G6ZA 3D4RA 1EYAA 4KN4C 1E7PB 2KN4A 4K8JA 1JWBD 3C46A 3R2TA 2K04A 4B9WA 1STHA 1PRTD 1SE4A 1CTMA 1JOOA 1AP0A 4HEA1 5ELCA 2A6HC 4KTAA 4CGYB 2ICIA 1QNKA 3NK9A 1JCKB 1FRDA 1KTKA 4FF2A 2XWBB 4DK0A 1FCCC 3IFTA 1JRPA 2EDGA 3BS1A 1DOMA 1T3QA 2LUMA 3L9AX 4KY6A 3LNNA 5M5XB 2B2VC 3VR3A 3P4SB 5IGEA 2K01A 1L6UA 2IGDA 2W82A 1DXMA 3V2TA 1NVID 4HKZE 1TKGA 2KVMA 1G2SA 1WTOA 2RBMA 2FUG1 2M19A 2V4IB 3D4WA 3VRAB 4WFN3 2B2UC 1K50A 1TKYA 4PMBA 4QF4A 3C2PA 3P42A 3S14B 4A55A 3M3YB 5JEAH 1SMYD 2JXTA 3B9JA 1WGKA 1LLRD 4CBVA 4TQ0A 3JAML 4K5XA 2WS3B 3AE7B 1MPEA 3PMFA 3T16A 5CV4A 2MJ3A 1I3QB 1TWCB 3J81E 3P1HA 2Y0SB 4IUVA 2ENBA 4EE2A 2DWQA 1B1ZA 2BS4B 1JWAD 3NTKA 1DOLA 1G2TA 1BCPB 1XTCD 3A8JE 1Y8PB 1RODA 4R3DA 2B2WA 5D65A 4HJGE 4LAAA 3SFDB 4ZRQA 3PIO3 2SEBD 3RD4A 2KAJA 3DUZA 1BBXC 4I7ZC 5M3FB 1UWMA 1TS5A 4RKLA 1F77A 3M4OB 1XCTL 3MEHA 3TP6A 2IGHA 1F9SA 1NCVA 3M7NA 1R4QB 1PZKD 4IUTA 5C4JB 2PMVA 2N0SB 5M3MB 4DXGA 4H0LC 1EFID 2A6ED 4IOIE 2R3ZA 2K5WA 4WAFA 5KNCA 2TSSA 1WD0A 5G3LF 2JYOA 3ND8A 5BN5A 3GTLB 1TR5A 2IT1A 1VZ6A 1I4PA 5CV6A 4QMGA 5EKKA 1TY0A 2HDMA 1XEEA 2WXJA 3SHLA 2K0PA 3ZYYX 1J7BA 3J9CA 1GHKA 2JYEA 2INPE 4K8IA 1HQMC 4YSXB 3BDCA 4XE0A 1GUOA 1IKLA 1VF7A 3FC4A 4OW0A 1ZPSA 4H7BA 4KD4A 1OXTA 1MBYA 2SNSA 4Q5VA 5IIFA 1STGA 5H92C 3WCQA 2EYLA 5EJWA 3VYRA 1XLQA 1DYQA 5CR3A 1I4XA 4EQOA 3AN1A 2JZPA 3GQBA 3DWQA 4ZLTF 1SNQA 4A9AA 2G1EA 4CQNA 2JA7B 3EA6A 5CMDA 2JU6X 1QOBA 1JWUD 3EROA 1SIJA 1EEID 4G57A 3Q8EA 4IUUA 3DEOA 2PLPA 3TZUA 4V190 4PNYA 2YYZA 3TZDA 1XLNA 1HPCA 3SK8A 1R9TB 2QJLA 4ZKCB 1KNAA 3BYYB 1L4ZB 4L2YA 1DGJA 4LK1C 2DBYA 2HTME 4TKOB 2KECA 3SK6A 1S5FD 1YNNC 2K03A 1EYCA 5E4WC 3S2DB 2K5DA 3S1QB 3S17B 3HOXB 1W6KA 4KX6B 3MZ5A 1G291 2OT2A 5I2YA 2D62A 4DGZA 5KIXA 1FMAD 2PNRC 4ZK9B 1Z7TA 3EJIA 5EGTA 4ITKA 2B76B 3KQ4A 2I38A 1EWYC 1NYRA 2TMPA 3BVMA 5E4XA 4BS9A 1JORA 1A3VA 5CORA 5HI1A 1IGDA 2INNE 2LMCA 1E6EB 3QIAA 4HCSA 4IDIA 1TJEA 3GTOB 5KEEA 5I6YA 1BNZA 4TQUS 1TZOA 2OHFA 2N9KA 2NVTB 3AM9A 2B8GA 2WXHA 1HUMA 3I90A 4P6VF 2WXNA 3QOJA 2NVXB 1D4BA 1LT5D 4KGRA 4US8A 3KWVA 1STYA 2CQAA 3AV8A 4OO1H 2D5DA 1X32A 2QMTA 2G9HD 3IKJA 2BW2A 4X3SA 2HUGA 1D5ZC 1IL8A 1TS3A 2PQEA 4QIWB 1NR4A 1JMLA 2WDVB 4DU9A 2AWOA 5KNDA 3AEEB 2OEOA 4CJ1B 2ONQA 3TP7A 2R6GA 1ZXHA 1HUNA 3MJ5A 3RLFA 1YNJC 3U7ZA 3I3CA 2F0MA 2Z4IA 1NSNS 3D3RA 3MA2B 3OIPA 2WXFA 4PMWA 4LTUA 1S4ZA 2EJFC 2ZW1A 2BT6A 2KCNA 2BB5A 2VXWA 3J80L 3IAM1 1PTOD 3NSWA 3AE5B 4NP5A 5G3LD 1LV9A 4B9XA 2WXKA 3AE9B 3ITPA 1C77A 4C56C 3I91A 3E0JA 1HFNA 3PUWA 1K8MA 4C3IB 5FLXL 1A70A 1FCLA 4P2CB 4BY1B 1H9KA 1TT2A 2SOBA 2QF7A 1PGBA 4HTHA 1AZPA 3MXGA 4OZAA 4CKBA 4RWSC 1DOYA 1HFGA 4D2KA 3UI3A 5IGBA 2E2IB 5IGCA 1QKZA 2M9VA 3MXNA 3S16B 1LACA 1LTAD 2LKVA 5F2DA 4NJCA 2F0HA 3T56B 4WQMA 2K32A 2ZXPA 1IW7D 4K14A 4PQXA 1D5MC 5C2TB 2V3PA 3U9SA 3MFGA 1UAPA 2M2LA 3LYYA 3TUOA 4ZUIA 2Y5CA 3KLSX 1B44D 3SEBA 4FYDA 2KWDA 4ULLA 5JPMC 5ELDA 4N59A 1KF6B 2F0JA 5A2QE 1E2WA 4O42A 4WWMA 3Q8FA 2RA4A 3N9YC 3G6JB 2RDHA 2NVQB 2NZ1D 4A3JB 1C4QA 3T13A 2J42A 3PV0A 5FKAC 1QCBD 4M1UB 1YJJA 4GDLB 1SNDA 2DN8A 2WB1B 2Q8TA 1C78A 1VMCA 2XNAC 1HEZE 2IX1A 4E6IA 2KMMA 2D5GA 2QSDA 1SBBB 4OL7A 4EGVA 2XWJB 3BYTB 2KEEA 4K5WA 4DAPA 3IT6B 2LFIA 3E5SA 4QUCA 1L0VB 3SK4A 4HMIA 1WTVA 2KQ3A 1PTOH 4M0WA 2K3UA 2E75C 1I7HA 4AQ7A 3TEXA 4BBRB 3VRBB 3FVQA 1A2UA 3QG1A 1IGCA 4U68A 3NPPA 1B3AA 5E3FA 4KKUA 4NAMA 2BOSA 1FIQA 3AMUA 2QCPX 1TWFB 3FKIB 2WXMA 1BR9A 1IUEA 1NI3A 1VMPA 2FFKB 3JAME 1QLBB 3J7AV 3RFZB 4G7OC 5JOBA 1ONLA 2PMZB 3DWMA 5JXVA 4KGSA 1YN4A 2K1BA 4L23A 4XT1B 3LB8C 2Z4HA 5I6WA 1XF5L 4AYBB 1LTSD 1EIHA 5J39A 3Q0AA 4FF4A 2PW9A 1GOZA 4US9A 2A68D 3H0GB 4C3HG 2ID0A 2SNMA 3J7YW 3URYA 2O4XA 2LEKA 5BYSA 5EKLA 5COYA 1J8IA 2FE8A 2J53A 3CQZB 1LT4D 1PRTC 2J52A 1ENAA 1Y8NB 2PCFB 3BG3A 1GB1A 5JPNC 1EWCA 3I4NB 5C3XA 4AS1A 4S3SA 3HOVB 4DNTB 1N62A 1ICWA 3H8HA 3DWPA 2IDYA 2F0DA 1CQFA 1A3TA 3FEWX 4K6DA 1JOKA 1MI2A 3RUZA 4OVZA 1PUTA 3R93A 5IODA 1FFVA 1C9FA 2CHBD 5EBDA 3SR6A 3P1MA 3H3VC 1RD9D 3LWUA 4H13C 3K6OA 1VZ8A 2F0UA 2B2WC 1G8ZD 1SYEA 5FOBB 1MSHA 3QO2A 3TBIB 3PUYA 5K5PA 4G4KA 3GTKB 1WRIA 1EQVA 4ARCA 2PTLA 2L9HA 3S15B 1EU3A 3EQLC 4RF0A 1SSOA 3VA7A 5HURA 1II3A 2MPMA 1WTXA 1SMYC 2XSCA 2LGIA 1RYJA 2A69D 2K9XA 4IUNA 1EOTA 1F2RC 3W9CB 4IFDI 4YT0B 3A54A 1MD2D 3K58A 1EZ8A 3LWEA 4Z9CB 2ICEC 4C3JB 2J0TD 3VR6A 1O7ZA 4QCLA 4C80A 5CGKA 5J22A 1RWSA 2WIIB 3NVZA 2PIAA 4GLSC 2BA0A 3DM1A 4MHEA 1IBXA 1NAPA 4LLGM 3I72A 3HGBA 5M9OA 4ARIA 3E56A 2DY8A 2AQ1B 2IL8A 4HRSA 1FD7D 4KN7C 5BMGA 2HDEA 2H89B 4ZRPA 5BMHA 3HG9A 3TSSA 2EJMA 1EY9A 3ZJTA 2R93B 3AE8B 3NVVA 4U673 2EXZA 3P4RB 1EQTA 1FNVA 3VR5A 3VYSA 2A6EC 3NE5B 2GA4B 3PZ7A 3VR8B 3V05A 3OHXC 1F2RI 4BY7B 1X3QA 4PV1C 1YQ3B 3TEYA 4H44C 1I6HB 4A3IB 1BUVT 3W5VB 4XQJA 3W3AA 4KMUC 4WIPA 1XYIA 4F8MA 4XDDA 4XXEA 4BA1I 3M85A 2IPKD 1PXUA 2SDFA 1AYFA 1H9SA 1Q8IA 3A8IE 2V4DA 1SB3C 1GB4A 4FF3A 3ZGZA 4XWTA 1SNCA 2A73B 2HCIA 2OEDA 1LO5D 4HKQA 3H94A 1SYCA 1SEBD 1VLBA 1TIID 2JA8B 4B0EA 4A93B 4K6LA 4KV6A 3A56A 4TRDA 5C3EB 4I65A 1XCQL 2DYOA 1KDAA 4N9TA 3D31A 3CU7A 2L55A 1AFPA 3I70A 5ELFA 3N6RA 2JP1A 3NXWA 4YWGG 3SDZA 3L3OC 3AE1B 4A90A 2QIEB 2B39A 4RGOS 3TEZA 1SNMA 1OXUA 4NZLB 3WDNA 4MM3B 3K5NA 3T3NA 2WDRB 2E6XA 2IJ0A 4OIKA 3A7AB 2HQEA 3FILB 3QJYA 3HS0C 4CHTB 5JEAG 1O7LA 4P16A 5JVG3 2B2TC 5C44B 1BCPD 1U4PA 2B63B 1OXSC 2L83A 2K22A 1J7AA 4KKTA 4OO1I 5C3WA 2LS01 1MHHE 1XLPA 5C0XG 3AEAB 3NQIA 2QEJC 3H91A 2MHVA 1Z6HA 1O7YA 1QT9A 2XN9C 4A3MB 1R7SA 1AWDA 2WP9B 3J80E 2DNCA 5C0XJ 1E0ZA 2VZKB 3OSOA 1PDQA 1T5XD 1V1PB 4OGQC 3RMHA 2K6AA 2B2YA 4X3TA 4Q0FA 4RHSA 3MHBA 4A6QA 1CZGA 2J4XA 5FLXE 2RDGA 4ZUJA 4KJNA 2BYTA 1GUGA 3P4QB 2MJEA 3GTPB 4KKSA 2EY1A 4MT5A 4Q2JA 2A5HA 1U9RA 3EUB2 1JW9D 2EYOA 1LT6D 1SJHD 3SE0A 3Q8BA 5EE0A 4IFDG 1K83B 1FXAA 3TDQA 2JA6B 1N63A 3I8ZA 3S9WA 2Z8LA 2VZKD 2N88A 1EZ6A 4OZCA 3P75A 4A3GB 4WURA 4C3JG 1QILA 5KNBA 3OPOA 1ZDVA 4L1BA 2JSVX 1GUNA 1W6JA 3GV6A 1R4PB 4XWWA 2F0NA 2EYMA 2G9DA 5C5LA 4PMCA 2W55A 3AECB 1V8CA 3P4PB 5C4ZA 1V8QA 3OMGA 3KWLA 3AEBB 3ETRA 3QWNA 4OHJA 2I2YA 1CFMA 1ZXIA 1HTLD 2MJDA 3SR1A 1D6EC 1PTOC 3GTJB 4RHRA 4CJ2C 2ZXRA 2O2LD 3MC0B 1OXVA 1EY4A 4FVMA 4XQQA 1UGJA 4FXGC 2EPBA 3AE6B 3WOEA 2D2CC 2AUJD 4NDXA 2NVYB 1FNWA 5EE1A 3PO3B 1DD2A 2WDQB 2KUMA 4MACA 3MWYW 1ILQA 1N5XA 3IAYA 1ZP0B 4MH8A 1ESRA 4YTNB 1YN5A 3U4EG 2CVRA 1ZKOA 1Q12A 2DYMA 3GS2A 1LTBD 3RPFC 2C9OA 1UEAB 5AFWA 2EYFA 1UUPA 2NN6H 1Y1VB 2WXIA 4WH4A 3EGRA 3HKZB 1TYGB 2WXLA 4C3HB 1WYGA 1JWSD 5EKIA 1ENFA 4FXKC 2I46A 1JB3A 2WXRA 4N58A 1HCZA 2F3WA 1A15A 3EVQA 3MVVA 3RZOB 2DLBA 2N7JA 1IW7C 4A3DB 4L63B 5H8YE 3VR4A 3IFDA 1WWTA 5D3IB 1S5CD 2K05A 1C79A 2LHEA 2ZXOA 3GP7A 1P7EA 1IYUA 3I57A 1BDOA 1U4MA 3Q69A 1XO3A 2Q8RE 3ZQ4A 5IOCA 3KBGA 2WXQA 3MHZA 2NMQA 3OWFA 5KYLA 1TS2A 5I9PA 2PZTA 4JPSA 1ENCA 2IW3A 3DWAA 5K36G 1VDVA 2WKCA 1EY0A 1RKNA 5LHY1 1TWHB 3TP5A 2RPVA 2EYJA 1B9MA 3OIQA 5DEHA 4C7YA 1JOQA 3LX0A 3Q6SA 4JX1C 2CU3A 3I4LA 1K51A 1NENB 3VQIA 3CRKC 1CK1A 1WXQA 2RDFA 4X3UA 1QNUA 2K28A 1B9NA 4ID6A 2JWUA 1FNUA 1EEFD 1LT3D 4BWGB 4KKJA 4DA2A 2IWHA 3IXSA 2F0GA 1JR0D 1ESFA 4KHVA 4L8JA 1SYBA 4N9PA 3HVDA 4FNFA 4WJWA 1L5PA 4NAWB 2AX5A 5GXGB 4ZOHC 4XYOA 2O5JC 3AEDB 1G91A 1VJKA 1Y8OB 1WTWA 3OW7A 1YJIA 5BMIA 4YIJA 4A3EB 5EPKA 1FO4A 2WNMA 1NEKB 1SE2A 2GI9A 2LY7A 1Q10A 1PFMA 4ZHOA 1ET6A 4RCNA 4TMAB 1JQYD 1Q3LA 1F2LA 2I07B 2KJXA 4Y7NB 1AEXA 2AUKA 1PRTF 1D1KA 1C4PA 2JEBI 1CZPA 1D5XC 2BCOA 4C7ZA 4IALA 2A68C 2E2JB 2WV6D 2BE5D 3GD7A 4A3KB 2ACZB 4RH6A 3QB3A 1V97A 3DHQA 4ODGA 1QJOA 2PVOD 1FD6A 2W3SA 4DNRB 2L1AA 4X3KA 4UDUC 1KFYB 1DOKA 3MFYA 4CJ0B 1GJXA 4HCEA 1U4LA 1QOGA 3R8BA 4ZAIA 1EL0A 1XWEA 5E1FA 2QDBA 5BN3A 2PVGC 2H88B 5TSSA 3NS1A 5LNK1 4XT3B 2IX0A 3FRPB 3H09A 3DWGC 3HZXA 2PZUA 3M7GA 2EKIA 2MEKA 2L5TA 3KF8A 3ZJUA 3DMUA 2BA1A 3SFEB 3TP8A 1B4OA 3DXJC 3PIP3 1N61A 4EQPA 3HVZA 2KOLA 1WD1A 4V0BA 1Y69U 3I4MB 4IQZA 2WAQB 1LTRD 1ROEA 1I6VC 3E6ZX 5DNFA 3AEGB 3PZ8A 2BDNA 1PFBA 2PPBC 1SAPA 1DJRD 3R3OA 5KGUA 1A2TA 5FO7B 4A8XC 1X3PA 1EM7A 1C76A 2A69C 3T4AC 4KJOA 1BXTA 3LXFA 1HQRD 1GXDC 5BYQA 3K7AB 2N9LA 3N52A 2Z1CA 3B2GA 2CW0D 3IT4B 3K5OA 4G7HC 4A3FB 3O13A 3HOYB 1M8AA 4ZKBB 4DAVA 3M4YA 3W5UB 3U2SC 5JJZA 1SNOA 1Q1BA 2L12A 5IT9L 1FM0D 1OFFA 3Q8CA 1QWYA 4JBWA 4PT5A 3ZJVA 1F0ZA 4R8IA 2E74C 1E10A 1EYDA 4IN3A 4IUPA 2Q8IB 2R61A 2HCCA 1L0YB 3Q23A 4KY7A 2RKSA 1YN3A 2IX3A 3T51B 3PUVA 2X69A 2WU2B 2WXOA 1CZWA 5M5WB 5EPJA 3PUZA 1MSGA 4K2LA 5HGTA 3NP8A 2WLBA 2V0GA 1RJTA 2WQYB 4JE3B 3D6WA 2XVSA 5D3DA 2PO4A 5CC4A 1AW7A 2F0PA 1DOIA 1LTTD 4KHZA 1XXGA 1MI0A 1Y1WB 2X6GA 1IHZA 2K33A 3L4PA 4NMZA 1S5ED 4C2MB 3HEJA 5ELEA 3RZDB 3PUXA 1E2VA 3U9OA 1PRTB 2F03A 2KACA 5J1ZA 3GTMB 4OIJA 2EYHA 4EQNA 3VR9B 3AB5A 1PZID 5M5YB 5HG2A 2IGGA 2EYPA 1EWHA 2FINB 1M4VA 3K59A 1CA6A 1PGXA 3FPPA 1EU4A 4R8NA 5CYUA 4XQNA 2AQ3B 3KLSA 1E0BA 1STEA 4QUFA 1KH0A 4A3BB 4QB4A 3MAQA 2KEDA 4GDKB 3NQTA 2AWNA 1FXIA 4O1NA 1VCIA 4IKGA 5G5HA 3WOFA 4JK1C 3T53B 3W2DA 1STBA 2B2YC 1VF5C 4KY5A 4NKLA 2EY6A 5C6AA 1E2ZA 3L7ZC 2WXPA 1ZXTA 1N5WA 2JYTA 1S5BD 2B8FA 3KUPA 2LHDA 1VDZA 2CJOA 1ZYRD 1QB5D 3BVGA 4FO2A 1BCPC 1Q1EA 3SK5A 2GB1A 5D7GA 1LTGD 3PO2B 1MGSA 1F9PA 3KLRA 3C1EA 2PW5A 1I4QA 3ONAB 3S1NB 5G5GA 5C5MA 2VB2X 1C4AA 1SSNA 5BYRA 4IZ8A 4ABNA 3P20A 1OO9B 5T1GA 3NBHA 1JQ4A 3V3XA 1J9OA 2MGSA 3HOZB 1BUIC 3AH7A 1I4HA 1RDPD 4M8AA 1DCZA 4HAEA 1NYQA 4R9WA 2L4NA 2V3NA 4RNAA 2L32A 5C0XH 3CHBD 2FJ2A 2BDOA 3C1FA 4RFBA 2JSOA 1HA6A 2RMMA 1SFOB 4CKCA 1T6BX 3Q8AA 1DOXA 2JA5B 4DN4M 2EY2A 2VNUD 2J7ZA 5T1IA 2A6HD 1ZEQX 3I73A 2QILA 1QG7A 3A8KE 2WXGA 3P63A 5T8IA 1JC7A 3GB1A 3K0YA 5AUKA 3OMCA 1RM6C 2Y3AA 3MXUA 3S1RB 1F9RA 2NTSA 3VYUA 1OQQA 4IURA 1JICA 3NTIA 1KRHA 3Q24A 4MIUA 2E76C 3HOUB 5CBAE 1F2ZA 4RKBA 4N6EB 4TSSA 3BZDB 1TKEA 2RQXA 5JEAJ 3K5MA 4J6HA 4IFDH 4K2KA 2X6LA 2F0SA 1J7CA 1PTOF 4HEDA 1RCVD 2XRQD 4BA2I 3U52E 1NUCA 2NN6I 5IGGA 2PYKA 4HSVA 3AE3B 3HRZC 1U4RA 4RF1A 5MPOA 4DFAA 1WCMB 3NHHA 2NYZD 2JE6I 2EVBA 2FHTA 3D6CA 1FGBD 4UAIA 4IUQA 1SDFA 1RTOA 2K7VA 2KA7A 2LMCB 1B50A 1TWGB 2O5IC 2F0KA 3BWUD 2F0TA 4F88A 4FXCA 5HFYA 1CT1D 2K5PA 5FK9C 3IAS1 1GUTA 1F9QA 1UNSA 2B2VA 3TEWA 4HROA 5NUCA 1PLFA 4L6TB 1HXYD 3AB9A 3TMEA 3GTQB 1O80A 1WTPA 5ISRA 2A74C 2Q5WD 4ZQ3A 1SNPA 1CM9A 1TVXA 1ET9A 3OOCA 1UWXA 1RTNA 2B2UA 4IFDJ 1BQQT 3A55A 3SXHA 5KRUA 2F3VA 4C1NI 1RFKA 4K5VA 1WTQA 1CQVA 5IGDA 3NUHB 3PO0A 2MUYA 3FILA 1KDCA 3E9SA 5I9OA 4XTCS 1P7FA 5DAUA 1V43A 2WKDA 1V1OA 4EVOA 1DZ1A 1KLGD 1QE6A 4YSYB 3S1MB 2E2HB 5EQ0A 2ZW0A 3ABVB 2EOTA 1IYVA 2RSNA 1EY6A 5IGFA 2KDMA 1JALA 1ML0D 2LJIA 2KCCA 2JEAI 1XX8A 3MXPA 3J7AF 2NUCA 1BMLC 2FBWB 4KGTA 2EY5A 4XDXA 3MP9A 5FR3A 4YXDB 1V1PA 3K5LA 3J81L 5I2XA 3BDLA 3AMZA 1HA5A 1SYFA 2F0WA 2NWGA 1CHQD 2F0VA 2KQ4X 1AN8A 1PFDA 3AE2B 1QOFA 5CBEE 5K36H 5C4XB 1PFNA 3BK2A 3VR2A 1A3UA 4RGMA 5EBCA 4YTMB 5D14A 1MVKA 4HR7B 2B2TA 3NVWA 3IL8A 1TKWB 2CJNA 5EE9A 3NWTA 1SYDA 2L11A 1E9MA 4XDCA 4FP5D 2F4IA 5HHDG 1ZUD2 4LJZC 4OZBA 5A35A 1PTOB 1TWAB 1DM0B 2SAKA 1WTRA 5AUIA 4GZYC 2WU5B 1GAQB 1TY2A 3ND9A 5EPLA 1K8OA 4BBSB 1RF2D 4CKEA 3NTHA 1SXTA 2WINB 1FRRA 2JXMB 3TN2A 2MP1A 1MHXA 3I9V1 4XIGS 5C3JB 1BO0A 1ACCA 1EY7A 3NWSA 4RGNA 2E3TA 1YNND 3GTGB 4FXDA 2NB0A 2L52A 2YEPF 4H2AA 2BS3B 1IKMA 4DXFA 2DY7A 1HRJA 3R2IA 2PKOA 2ON8A 5JAVA 4KK7A 4RAUC 4RA8A 2VB3X 1HZ5A 1L6VA 4FF1A 1GHJA 4YSZB 2E2DC 1FR3A 3GO5A 5BN4A 1SJED 4OO1G 4HMJA 5IT9E 2BE5C 1Y56A 2RSOA 3NVYA 1T5EA 3W1SA 1D2BA 2NBFA 3FMCA 1LTID 1YQ4B 4B0MA 3NZ3A 5I4DA 4XYQA 2NN6G 2XIWA 4LK0M 1TU2B 1RHPA 1K52A 1VR9A 1BOSA 1PGAA 1H9JA 1C4CA 2L1BA 5FO9B 1EIGA 3BIID 4HSPA 2RVLA 2Y5PA 1QOAA 1ILPA 4ME5A 1QF6A 1OXXK 5KYIA 2WP8J 4ZHPA 3AEFB 1SF0A 3X3NA 2KHSA 3HOWB 2YU9B 1HTPA 1GUWA 3T3OA 3BVZA 1SYGA 4J8QA 2BS2B 2EELA 2F0OA 3NUCA 1YMHE 4NW2A 1S5DD 1YNJD 3VYTA 1FFUA 1EY5A 3HRDD 1PYWD 2HDLA 4J3OD 2EJGC 2OXPA 2F0FA 3MTSA 2R7ZB 1I4RA 5JVH3 4G7ZC 5DM63 3D8GA 3CRLC 4USAA 3P7JA 3S2HB 1WVLA 1ZE3D 1PMRA 2L0CA 2H4OA 2LFNA 1GUSA 2CW0C 1BF4A 2F0QA 3F2UA 5E6JA 1KAAA 2PZWA 3NRZA 3D4DA 2WACA 2AQ2B 1HHVA 5CV7A 1C8CA 2VUMB 4J1MA 1A6XA 2M00A 3C3LA 4DF7A 5LL6S 1PZJD 5C4HA 2GRIA 5EE3A 1FEHA 4KKIA 5CV8A 3BK1A 3A7LA 3NBIA 3CIRB 2W3RA 2OF1A 3H6MA 2X38A 2BTEA 3UI2A 3VA5A