2SEBD

X-ray crystal structure of hla-dr4 complexed with a peptide from human collagen ii
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
235
structure length
217
Chain Sequence
SQPDPKPDELHKSSKFTGLMENMKVLYDDNHVSAINVKSIDQFLYFDLIYSIKYDNVRVEFKNKDLADKYKDKYVDVFGANYYYQCYFSKRKTCMYGGVTEHNGNQLDKYRSITVRVFEDGKNLLSFDVQTNKKKVTAQELDYLTRHYLVKNKKLYEFNNSPYETGYIKFIENENSFWYDMMPAPGDKFDQSKYLMMYNDNKMVDSKDVKIEVYLTT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HLA CLASS II HISTOCOMPATIBILITY ANTIGEN
publication title X-ray crystal structure of HLA-DR4 (DRA*0101, DRB1*0401) complexed with a peptide from human collagen II.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Complex (mhc class ii/superantigen)
total genus 67
structure length 217
sequence length 235
ec nomenclature
pdb deposition date 1997-10-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF01123 Stap_Strp_toxin Staphylococcal/Streptococcal toxin, OB-fold domain
D PF02876 Stap_Strp_tox_C Staphylococcal/Streptococcal toxin, beta-grasp domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.110 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 2sebD01
3.10.20.120 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 2sebD02
1S5BD 1SJHD 5D3DA 1EU4A 1SE2A 2NTTA 1YN5A 1V1PB 1SE4A 1FGBD 1PZJD 1CQVA 1RDPD 1CT1D 3BVGA 1D5ZC 1G8ZD 1TS5A 1PTOF 3MC0B 1PTOD 1PZID 1V1OA 2NTSA 3DWPA 4RCOA 1HA5A 1PZKD 1PYWD 1AN8A 3TSSA 1PRTC 2RDGA 3BVMA 1UNSA 1TS3A 1FD7D 1I4PA 1LTID 2QEJC 4ZYSA 1PTOH 3EFXD 5ELCA 1ESFA 3W2DA 1I4XA 1SEBD 4NZLB 1PRTB 4K6LA 3R2TA 4DXFA 1I4HA 1KLUD 1L0XB 1RD9D 1M4VA 1LTAD 1CHPD 1JCKB 3SEBA 5D3IB 4DXGA 1UUPA 1BCPF 2CHBD 1BCPD 1CK1A 1DJRD 2IPKD 4RGTA 1LT5D 1I4QA 4RHSA 2AQ2B 1JR0D 2SEBD 1PTOC 1B1ZA 1D5MC 1GOZA 1HTLD 4BWGB 2ICIA 2O2LD 1QILA 2XNAC 1EWCA 1T5XD 2WV6D 2AQ1B 1PTOB 3BYTB 4L63B 1KLGD 1EEFD 1TS4A 1ET6A 1DYQA 5ELFA 1LLRD 1D5XC 1I4GA 1YN4A 1S5FD 1AW7A 3DWQA 1FNUA 1LO5D 1S5DD 1S5CD 5I4DA 1XTCD 3URYA 1ENFA 1STEA 1TY2A 3BVZA 4RGMA 1JWSD 1LT4D 1LTTD 4Z9CB 3R8BA 1CHQD 1FNWA 2RDHA 4UDUC 1TY0A 1LT6D 1B44D 3V05A 1JWUD 1SE3A 1SBBB 3O13A 1L0YB 1SXTA 5FKAC 1PRTD 2R61A 4RGOS 3R2IA 1BCPB 1F77A 1I4RA 2G9HD 4RHRA 1EU3A 3BZDB 1HXYD 3EA6A 1TS2A 1FNVA 1HQRD 1BXTA 1YN3A 1V1PA 3BYYB 5ELBA 2TSSA 1D6EC 2J4XA 3OWEB 2AQ3B 2QILA 2XRSD 1ET9A 3KLSX 5ELDA 1JQYD 1LTRD 3CHBD 2Z8LA 5TSSA 1SJED 1S5ED 4O1NA 4C56C 4L6TB 4OHJA 4TSSA 1LTBD 5ELEA 1JWMD 1LTGD 2IJ0A 1XXGA 1EFID 3GP7A 4RFBA 1BCPC 4RH6A 1LT3D 1MD2D 1RF2D 5FK9C 2XN9C 2XRQD 1LTSD 1PRTF 1RCVD 1KTKA 4RGNA 3DWAA 3MFGA 1EEID
chains in the Genus database with same CATH superfamily
1ZYRD 3K9PB 4N8FA 4O0AA 2KQ7A 1LABA 2DY7A 2BYFA 4X62L 1CA5A 1BUVT 1NBFC 4KIKB 1HCZA 1U4LA 2JA7B 2K05A 1GC7A 1N5WA 3I70A 3UDFA 2HQEA 2V4LA 3P20A 1PZJD 4UP8A 4C3JH 3CMAA 1BVSA 5IWAL 3BVGA 1HQMC 1GVPA 3CP0A 1WY8A 3UDIA 2WXGA 2ZCBA 2UXBL 4KKIA 3L3OC 3P4SB 1OQYA 1YIJA 3M4OB 3I90A 3MXNB 1TWGB 4FP5D 4NKLA 2GBNA 3UE0A 1WYWB 3W1BA 3N6RA 2Y5BB 1I6VC 5C2TB 5I9OA 5FLMG 2DAJA 4K5WA 2KC1A 1H9KA 1VQCA 2WIIB 3ALBA 1QUQA 5FJ8H 1YQBA 3GTGH 2R93B 4JPBW 3GTKB 2PVOD 4BY7H 2LXKA 1LM0A 3NQIA 5JAVA 4HIDA 3BJUA 5JJKA 1X6OA 3TBLD 4DXFA 1CA6A 4LNKA 2L7RA 1Z9FA 1F2MA 4C3IB 2K5WA 2V0GA 4DU9A 4JVZA 3SEBA 3RN2A 4JI1Q 1D7QA 5E6JA 3LX0A 4M1UB 1XYIA 1L1OC 4IM3A 2EDGA 2O6VD 4KHPL 5IP9G 4YY3L 2KCCA 4JL9A 4FN2A 3K5MA 4LNQA 3OTOQ 1PVOA 2KVZA 3CSTA 5GROA 2XNAC 1X3EA 2WV6D 5IIFA 3HOZG 4HWIB 3S14H 1ET6A 3NELA 1KIXA 4A93H 4HJKA 2IY1B 3H7SA 1WXAA 4LJOB 1ZYRC 3K7AH 2N49A 4N9PA 4WJOA 5JHAA 3N30A 2HCIA 1D1KA 5KEEA 1XLPA 2KC2A 2N8NA 4HJ8A 1C4AA 2VL6A 4NXML 5J18A 1FYCA 2KX3A 2KMCA 2BDOA 4OWWB 1XNRQ 1B9NA 1OXSC 5EBCA 3GTOH 1J5EL 2INDC 5J39A 2JWZA 3VR5A 3F2UA 1GXDC 2NBVB 4EKUA 3AU4A 1BCPB 2GMIC 2ZNVC 1HR0Q 2O2VA 3I4MG 5KNCA 2WXMA 1EYCA 2FJ2A 5ELNA 1FRRA 1TT2A 3DBHI 3PLVA 4AS1A 1HZ6A 2B2VC 4N9TA 4IALA 1YQ4B 3P4RB 5L95C 2V1CC 2L55A 4AYBG 4ZRQA 4HMIA 1PHJA 4K6DA 1E8YA 3HOYB 4IOCA 2CH4W 4FNFA 4P74A 2VW9A 2D5GA 2PPHA 4L6TB 1IGDA 2MQHA 3CC4A 1K51A 1B53A 4I6NB 3EN2A 2WXKA 1HH2P 2Z4IA 3GZNB 4ZDVA 1D4BA 2GVAA 3A0JA 4FJZA 4IDIA 1QCBD 2VUMG 4FJVB 5C4JB 2IX1A 4BFRA 1ACCA 1RCVD 1DCZA 4G7ZC 2JZPA 4ICVA 3VAWA 3ZXRA 4MGIE 2BWES 1TXYA 4LNNA 1JC7A 3A7LA 2JQRB 2WDRB 5I6YA 5C0XJ 3NHEB 5CV5A 1GUWA 3H6NA 3A55A 1N62A 2V1YA 3ONSA 3K59A 2K6AA 2LXJA 2JSOA 1XLOA 1VQ5A 2JY6A 4X3TA 1WD0A 5JPNC 4PMBA 2WYQA 1T0YA 3CCUA 2AEHA 3C3LA 2LFNA 4US9A 5CV7A 1WX7A 3AULA 4OXPA 2X8XX 3P2BA 1PZKD 1VLBA 2EXZA 1NENB 5M5YH 1I94L 3HKSA 1NAPA 3SFDB 4PMWA 5BR8L 1F52A 5IP9H 2PE9A 3PZDA 2L8JA 5G55A 1LTID 4LK1C 1SR3A 4DV7Q 1NVID 3AEEB 2LGIA 3Q3NC 4I6LB 1E3PA 1MI2A 4EFOA 3SK6A 1IXRA 3HOZH 1JOQA 1Q10A 1PQSA 2MBHA 4PT5A 4DQOC 5M3FH 2W9NA 3VUYA 2RCFA 2RGFA 1RD9D 1CZWA 4J8QA 1YJWA 3E6ZX 4L5SA 4UPAA 3SR1A 2EPBA 1IBLL 4U68A 1CK1A 3NHHA 4RHSA 2QCPX 1XD3B 2SEBD 2GBRA 1YJJA 3D32A 2OOBB 1IKLA 5D65A 2OQ0A 3FKIH 3G7LA 4OWXB 4MACA 3TUOA 4ILWA 2EYMA 4ZHOA 2JJQA 4FLHA 5T8IA 2GN5A 4KY6A 4LFAL 3OHXC 1U4RA 4DV1L 5C0XG 2H4OA 1VQLA 2K4KA 5AJ3Q 2BB6A 4JI2L 2HCCA 2WNMA 4DAVA 2AL3A 2WAQG 3FILB 4IUQA 2F0VA 2RQXA 1U4AA 1E8ZA 2D07B 3IT6B 3RZWC 1AH9A 3W1YA 3WA0A 3QO2A 5HI1A 1V8QA 3K81C 4IUTA 1S5CD 4QMGA 1R4MB 2WFWA 1ENFA 1STEA 2R2OA 4HIOA 4DAYB 1SNMA 1EO6A 1SNQA 3A1QB 1K8MA 1F9SA 1O7ZA 2FMCA 3Q69A 1E90A 2FUHB 3LYYA 5EKKA 4EEWA 3A8JE 2BYTA 3PMFA 2AWOA 2RHQB 1HUMA 4DR1Q 4KKUA 5EE0A 4IG7B 4XWTA 4KZ0A 1FL0A 2XWJB 1RYJA 5FR3A 4MNOA 4HKZE 5E4WC 3TP7A 4BVUC 1P98A 2KWVB 1KDBA 4JI6Q 3TMEA 2EY2A 5IT9c 2L52A 2OWOA 1YN3A 2OXPA 4LLGM 2Q8RE 2R7ZG 3NJTA 1Q8IA 2LJIA 2O4XA 1K83H 4QAYA 1XPOA 2CQOA 4JI5Q 3RI7C 1XLQA 2D11A 3CF5A 1TKGA 2MJ8A 3R93A 1C78A 2CJOA 3NS8A 1FFUA 1CKNA 1KAAA 3R7RA 2UUCQ 1NSNS 1NR4A 2OF1A 2AL6A 4M0WA 2K50A 5FK9C 1SMYD 4A3BH 2M9VA 3HG9A 2X38A 2FXQA 1C77A 3RT3B 3KFUA 1IBMQ 3GTLH 2D5DA 2I5LX 1A70A 1PH2A 3B08A 2L12A 1N61A 2W82A 3FEWX 3AEBB 4DV2Q 1KD1C 4GNXA 2ZJQA 2Z6KA 4YTPB 2CHXA 4YHHL 3BDLA 1E10A 2EY1A 1N5XA 4LNOA 4BBSG 3W3AA 1IBKL 2B2WC 3TZDA 1YNJC 2F4IA 1VQMA 3HOVH 4TKNA 4KHVA 1VQIA 2ATWA 1Y69U 2DZMA 1E1TA 4DR2Q 3CAMA 3H7PB 3E0EA 1PV4A 1VF7A 3T16A 3QC8B 1AN8A 5A2QL 1QZGA 1QE6A 4GXBA 3W1SA 4HSVA 3WAPA 1QOBA 1J6QA 3OJ4B 4DV5L 4JCVE 4IFDJ 4LWCA 1YIWA 2FNJB 1ILQA 1TS3A 2E6XA 4K8JA 4YSYB 1ENCA 1KAWA 3S24A 2MBBB 2NZ1D 2KMMA 4G50A 3W2DA 4MDKE 4RF1A 4YXDB 1O7LA 1WVLA 4K6LA 1KDCA 4W9GA 4A3DG 2K8HA 3PO0A 4JWUC 2EKEC 1X3GA 5FO8B 3NVZA 1RHPA 2Y0SB 4CGYB 1Y1VB 1BCPD 4MSMB 1LT5D 4GLVB 1AFPA 1QVFA 1KHIA 1XEEA 2VQEQ 3PREA 1H4RA 3O65B 2NR2A 3ZIMA 2K32A 4JLCA 1LACA 3ZLZA 2RPVA 2K5PA 5JOBA 1ML0D 1SMYC 5GADC 1TJEA 3JAMi 3ZO5B 2QDFA 1DYQA 1MSHA 4RWSC 1RM6C 1VQ7A 1RODA 3I3CA 1NBWA 1ZDVA 2REXA 2NS5A 1VQOA 2QF7A 1S40A 5EKIA 5FLXE 3J80i 2GBKA 1LUZA 2EQSA 2JA9A 4KJNA 4EQNA 4DR6Q 2MP2A 2ZVNA 5IA7A 3K8AA 4WJNA 4NQKE 3U58A 1OGWA 4HKQA 2LD9A 5HGTA 1N36L 5JHBA 1SDFA 1WGGA 2NBWB 3R8BA 1E7PB 1XCTL 2PMZB 2Z9HA 2R7ZH 1XF5L 2NPTB 1HFNA 3A5ZB 3E3XA 1QG7A 3DVNU 1JWUD 4IFDG 2DY8A 2B76B 5BO4B 3VTUA 1DOYA 3QAQA 2NVYH 5GQOA 2FIDA 3DBRB 5FKAC 1WYGA 2PZTA 2R61A 2UUBQ 3V6EB 2J0TD 5C0XI 3RZFA 3H94A 3U4EG 2KJ6A 4RHRA 2EELA 2CCZA 4JBMA 1IKMA 3GOEA 2RSOA 1KRSA 3NE5B 5CC4A 3HUIA 3KLRA 2JA8B 3ND8A 2A69C 3SFEB 1W3SA 2VQFQ 4NNJB 4ZRZA 5LMNL 2M2LA 5K36G 3ZGZA 3UINB 3CU7A 4BBSH 3VR3A 3GP7A 1BCPC 4XTCS 4RF0A 2MBOA 4MTKA 2VRRB 1BQQT 2EJMA 1K53A 4K81A 3PIPA 3NQTA 3DWAA 1A5RA 4EE2A 3M4YA 4KY7A 4KJOA 3Q6SA 3OG5A 4B6WA 1Q82C 2H1EA 2JWUA 3KF8B 4V0BA 1ESRA 1IL8A 2HHHL 3M3YH 2KHSA 1TGZB 3MAQA 4PZ8A 1WR1A 3NTIA 1N32Q 5KNBA 4B3SQ 1I5FA 3B9JA 4GDKB 2H89B 3U7DA 2E2JB 1WRDB 3LDZE 3PV0A 4DN4M 2MX2A 2WDTB 4LUVA 4A3CG 4RCOA 2N0SB 1HA5A 4GSWA 1C4QA 1IZ6A 2DJGC 1UELA 1YJ9A 1NYRA 3M3JA 1X56A 3I9V1 4IQZA 2L0TA 3Q8EA 2DZIA 4DUZL 1IBXA 4XQQA 4JC0A 3J7YW 3UE1A 4EQ5A 2C9WB 5C3EH 3R7QA 1OXXK 4DHZB 1SRUA 1UF0A 5IP7G 3NK9A 1QF6A 3R2TA 2KWDA 2M00A 2NBUA 3ML9A 4JPSA 1SYDA 4NB3A 4ZRKA 1PH8A 4P71A 3DVGX 4A3LG 3L0WB 2UXCQ 2DNFA 4NQLB 4GN4B 3SU8X 4R4OA 4OZAA 4HTHA 4FADA 4JI0L 3W5UB 4BKSA 4H13C 1GUNA 1XNQL 2IX3A 3QJZA 2JA5G 3VH4B 1WM2A 4WJ3M 1V43A 1WCMB 4A9AA 1MGSA 3M4PA 1A0IA 1EY7A 5J22A 2UXDL 4FHJA 1L1OB 1TWAB 2KCMA 4KZCA 4IFDH 5C3WA 1BKBA 1TS4A 3ZKJC 1PXUA 4FXCA 3HRZC 1WOCA 4F8MA 4HROA 3TL5A 5ELFA 1M94A 4PK1A 5BYRA 1YN4A 2LWPA 3IFTA 4H0LC 4FXGC 2NVXB 4A3MB 2N1VA 4G3XB 4TV3A 4A90A 3L7ZC 4MTNA 2OEOA 1K8AC 2E74C 1ASYA 4X64Q 4GOPC 1L0WA 5J17A 2RDHA 3N1ZC 1SYGA 1R4NB 3HIZA 1S3OA 3KBXA 4XQJA 1QOAA 1Z5SB 2DYBA 4FXDA 1T0SC 5K36H 1JQ4A 1E5WA 2E5LL 4A3GG 3BG3A 3ND9A 5AZHA 4AQYL 3BZDB 1GHKA 1KJTA 4ARIA 4KSLC 1JRUA 4YWLA 4LF6L 3VR4A 2A6HD 1DGSA 1H9RA 1RTOA 3EBEA 4A3FB 3AEDB 1PDQA 2KDEB 4G11A 4WWOA 4P1BC 2ZNVB 4C80A 1MHHE 5EDSA 1AE2A 3PZ7A 2QILA 4A3IG 1M90C 4IUUA 1EY6A 5CV9A 4IURA 3RZDH 1IW7D 3OAWA 1I35A 3F2DA 2UU9Q 2B63H 2RPQA 4TSSA 2G5DA 2Z0DB 3DOWA 5M5XH 2Z4HA 1EFID 3PUZA 3Q24A 1BBXC 5IGEA 1LQBA 3KLWA 4OX9L 2QIEB 3GD7A 3QOJA 3L2PA 4JV5L 1H9JA 1I42A 4A3JG 1AP0A 3EFUA 2JXMB 2F0JA 2PKOA 3VA7A 4YTNB 1STBA 1L7YA 4KKTA 4MJSA 1J7CA 1FJGL 3ONAB 4C3HH 1IYJB 1WX9A 2DYOA 2O6VB 2F0QA 5EPJA 2PEAA 2PQAB 3IKJA 3OIPA 4DAPA 3S2DH 3FP9A 1EY0A 1AARA 4JE3B 2DLBA 4AQ7A 2IHEA 3AEGB 1SE9A 1RDPD 4NDXA 1JJGA 3KDFB 2IX0A 2X6GA 4AYBE 2LS01 1VF5C 5IP7H 3K5NA 4GGQA 3NPPA 2LEKA 1N34Q 4L1BA 5JPMC 1XO3A 2KECA 1EWIA 3T3OA 4TUUA 5AZGA 1ZXTA 3GTMB 3JSVB 2R7FA 2K3UA 4KI0A 2L76A 4IKGA 2RDGA 5T1IA 5DNFA 3S16B 4HCSA 5KYLA 3MTNB 4CHKA 1KXLA 2K5HA 3EC8A 1ESFA 1YHAA 1N33L 1N6ZA 5TR5A 1TQOA 4BXXH 4NXNQ 2A6HC 3VDZA 5CR3A 1Y1WB 3S1QB 1K8RB 3HM3A 4MH8A 3P1HA 3WAMA 2I5HA 4EGVA 4ID6A 2F52A 4JI7L 3DWMA 4OVVA 4UP9A 2CHBD 3PO2B 1HR0W 3U9SA 2J7QB 2UYZB 2WS3B 1D1IA 1IW7C 1F9QA 3A7AB 4R9WA 2KFKA 3R3MA 3D31A 2J0KA 5E4XA 3A56A 3PF4A 1JW9D 3PO3B 2C7HA 3S15B 1KDAA 2LMCA 3V62A 5M3MG 2Z6BA 3CMMB 4DV3L 2WXJA 4EZLA 4LF5L 4CJ1B 4LCDE 2DHZA 1FO4A 5C4HA 3U2SC 1C3TA 2RDBC 3Q2AC 3CCRA 1V9JA 2AWNA 2Q8TA 3BZKA 3Q3JA 3ENEA 2XVSA 3HOXH 4A3GH 4LF9Q 2CU3A 1JB7A 4LFBQ 3Q8DA 3Q6BA 1XTCD 4C4VA 1J8IA 1VZ6A 3BVZA 4DUYL 3CCSA 2BS3B 2BBCA 4QY7A 1WTHA 1XX8A 2ZTDA 1TBEA 2K6DB 1B44D 2NYZD 3HOUG 4DR4Q 2QSDA 4A3IH 2KACA 1GUTA 3J81i 3HOWB 2GRIA 1YD8U 4B9XA 1U0LA 2RDFA 2C7MB 1RL2A 3MZ5A 4BOSC 2G9HD 4DV6L 1QJOA 1N8RC 4HCNB 2ACZB 5AUKA 2QJLA 4IM0A 3RUIB 2M19A 1HXYD 5IGCA 2JA7G 1E6EB 1AEXA 2ZCCA 4AIMA 1YNTE 2KN4A 4RMAA 4HLEA 5IWAQ 4A3JH 4MM3B 2JA6G 3RNUA 2WAQE 4EVOA 2Q5WD 2IHFA 2UXBQ 3RZOH 3A74A 2B2YA 4ZCKA 4A3EB 3HVDA 3Q8AA 1CKMA 1VS0A 5DPTA 1FD6A 2L05A 3BZCA 1LTGD 3N3KB 2V4IB 1OXUA 1MVKA 1EOVA 2KQ4X 4MEMA 3TP6A 2H5XA 1NJIC 3L13A 2HIXA 4JWSC 1V49A 1STNA 1GUAB 2BVCA 3KUDB 4RM9A 4DNTB 3GTJB 4OGQC 4R8NA 2L00B 5LMUL 1SJHD 1SF0A 5D3DA 2F0PA 2K5VA 2M4NA 1G2SA 4J6IA 2G3QB 4C3IG 1E24A 2K39A 2BGFA 2CR5A 1SE2A 5IYDH 1ZP0B 2EMSA 4ZUJA 4JI3L 2KN5A 4JYAL 4MGYE 2H88B 2ZM6L 3CIRB 4A55A 4KHPQ 2LGYA 1SLJA 4DK5A 1V5OA 1CQFA 4P2CB 4L5QA 1X1MA 1MJEA 1Q90A 1V1OA 2G4DB 4WQOB 3DWPA 4DV4L 3H3VI 1GKHA 4ABNA 4OO1I 3MC9A 5JJIA 1HFGA 2GB1A 3HFZB 4WAAA 4H2AA 4W9EA 4XGAB 3ULLA 5GAEC 4R4TA 4N6EB 5HY6A 4FYDA 3S17H 1KLVA 4NAWB 2A4ZA 4EZJA 2BWFA 4K5VA 1GNUA 3MHBA 4C3JB 1YJIA 2CWAA 1HNWL 2Y3AA 3OW2A 2N9EB 1IHZA 1L0XB 2INPE 2IO1B 4CQNA 2KEEA 1YX6B 1WJ6A 4HEA1 2WXLA 3TCAA 4DXGA 1J5EQ 5C1ZA 1UUPA 3GTPH 2DBYA 4ANVA 2LXAA 2WXPA 3FHWA 1JALA 5HG2A 1VQDA 4ASWC 3S1RH 2XSCA 4GDLB 3ZQ4A 3JAMc 2JYEA 1D2BA 4ZKBB 3QJYA 2A1AA 4KKSA 3SK4A 5CMDA 4KDIC 4F8CB 4P6VF 3KYHC 3U50C 3W1GA 3OLMD 3GTGB 1T5XD 2CWPA 3BYTB 4EQPA 2BB5A 4BY7B 1EEFD 1V86A 3WALA 3J80c 1FXAA 3DVNV 3VR9B 2IDYA 4A3KH 3A9KB 4E6IA 4L8JA 4NJ6A 1I4GA 1UZXB 4ANXA 3DDCB 2CS4A 4WRDA 2E2HH 3SHLA 1PGXA 1UD7A 1PH1A 2KHWB 2B2TC 3LNNA 5IGFA 1S72A 2JA7H 1FEHA 1JWSD 1J7BA 2BE5D 3F2CA 3M63B 5CV4A 1PYBA 2L1BA 3NWTA 4L5TA 4M8NA 2JA6H 4HVBA 2V3NA 4LJPB 3E9IA 2DNEA 1O80A 4I7AA 1WMHA 1YOVB 2KTRB 5I2YA 5IOCA 1L0YB 2NCNA 3I7FA 4USAA 4S17A 3Q0AA 3M4OH 3PGEA 2PLPA 5A2QE 1QWYA 2NVTH 2M8SA 3M95A 2VXWA 1K8GA 4XZ4A 3CWIA 2JXTA 1EU3A 1T3QA 2I46A 4GN3B 5FO9B 1C1YB 4MN3A 3K7AB 4R4CA 3DCGA 4C1NK 1Y8NB 2ZW0A 3AEAB 5BMGA 2XIWA 3L54A 4XDXA 1YHQA 4NW2A 4H7BA 1AWDA 1UWXA 4KD3A 2KLCA 1RRBA 3D6CA 4WWMA 4DK3C 3DEPA 1SJED 2AHOB 2KWCA 4C3IH 4CHTB 4O2DA 2MP1A 3GTOB 3S2HH 1R4QB 4RFBA 1SN8A 4BA2I 4P72A 1HTPA 4P73A 1EZ8A 1Q0WB 3IAM1 1JICA 1FRDA 1LTSD 1E2ZA 4X66L 4X3KA 1DOLA 1GB1A 1OXVA 1WTWA 2QCZA 2RA4A 3GV3A 4WQMA 4WJPA 2YTVA 2BS2B 5FR6A 2Q2HA 4FJYA 4HJAA 1ONLA 5IP4D 3KYCD 1F9RA 2NVUI 2BA0A 2DGYA 3VH3B 4YSXB 5AEKB 2LUEA 3UDXA 1HEZE 4JX1C 4JOIA 1R4PB 2MCNB 2L1AA 2WXFA 5IT9L 3AE5B 3VVWB 2ALYB 1JMLA 5IGDA 1A62A 2I5MX 2BE5C 1WH3A 3ZUNA 2KDIA 1DXMA 2K5QA 4U673 3N32A 3H0GG 3ICEA 4Y7NH 1TWFH 3FKYA 4ANUA 1HZCA 3T13A 3OYYA 3GDEA 1Q3LA 3FILA 1PTOH 1XMOL 1GUOA 2OTLA 4BBNC 1HNXL 1SEBD 2JU6X 5FLMH 1Q5WB 3DBLB 5CHVC 2PCFB 4QIWB 1L4ZB 4HJGE 3A1QA 1M4VA 1EYDA 4QCLA 3VTWA 5COYA 3IFDA 1JWBD 1JOKA 1LYLA 1P7EA 5BYSA 1X65A 1ZEQX 4AOFA 3ZJUA 4JI1L 4TQ0A 5M5YB 4P16A 2IO2B 4UY8C 4OZCA 2K14A 2LVOA 4N8X1 4CDEC 3OWFA 2NBFA 3KF6B 3H15A 5M5WH 2LGDA 2TMPA 3OTOL 2ZPNA 1R9TH 3HOZB 1KNEA 5CYUA 1O78A 4WJ4A 5M3FB 1AZPA 3DPDA 2GOWA 2IGGA 3RNAC 3C1FA 3HKZB 1F2RC 3SK8A 2DWQA 4RGMA 3F1ZA 2M0XA 4DV0Q 3QCAA 1CHQD 4B9KA 2VB2X 1WGKA 2KNBA 2V3PA 3P1MA 3FKIB 2A5UA 3W5VB 3IBEA 2OEDA 2K22A 2XBBC 4PYZA 4REZA 1UAPA 1K50A 2Y5CA 4TQUS 4GOPB 2PE6B 2WDQB 4I7ZC 1ILPA 4K2KA 2HD5B 3VHTC 3V2TA 5BN5A 4GLXA 2W54A 4YHHQ 3AU5A 3H1UA 4FDBA 3BK2A 2RSNA 2O2VB 4F87A 1IBKQ 3H6MA 1BXTA 2MRPA 5C44G 2KCTA 1EQTA 4OELB 3NBHB 2BYEA 4B3ML 2K1FA 2TSSA 3I8ZA 4A75A 3D4WA 4JI8L 4DAMA 1YNJD 3OWEB 3P75A 1RLFA 2WXNA 3P42A 3KLSX 3GZNI 3I4MH 4G7HC 1G6JA 4GKKL 2KA7A 2PQEA 4CJ2C 2MWSB 4ALPA 4BBRG 4C56C 1MBYA 4NP5A 1KFYB 5CBAE 2K9XA 2LFIA 4DV5Q 3D0FA 2L32A 3NRZA 1NMFA 2K33A 1F9JA 5L37A 3RNFC 1MG4A 1VQ8A 3DQVA 3EIVA 5AUIA 3VYSA 5GAGC 3Q14C 4B3RL 4IN3A 4IUMB 3VRAB 3IVFA 1LGRA 4BBNF 3ETRA 3CQZH 2CHWA 1S5BD 2ZJRA 1VQKA 2SOBA 3H0GH 5C6AA 2ZTCA 2VUMH 1CMXB 2BQQA 1K83B 2JP1A 3A4SC 2Y0SG 1XPRA 4KGRA 1SE4A 4POFA 1WE7A 1KH0A 2D10A 1DZ1A 3H91A 1TT5B 3JW0X 3DMUA 2PNRC 5C4XG 1D5ZC 3DHGC 1EIGA 1TS5A 3MC0B 2IO3B 2Q2TA 4A3BB 4BZAA 3NG0A 4XT1B 3P4PB 4K3CA 3TN2A 1NCVA 3GTLB 3S1NH 2W3SA 1VCBA 2D3AA 5H1SE 1MIUA 1G2TA 3NY5A 4F7XA 3NTHA 3GQBA 3TSSA 4GN5A 3NZSA 2N9XA 4B3TQ 3CPFA 4K0KQ 3EFXD 1WGRA 3WIMA 4P7IA 4XX5A 3ZDTA 4DR3Q 1KNAA 2L4NA 2J52A 2KXJA 3HOVB 1S1QB 3ITPA 1DOIA 3G6JB 4C2MH 5IODA 3NVVA 2YTXA 1CHPD 3DVGY 5E6OA 2ZXPA 3AQQA 3I73A 1Q1BA 2WXRA 2NPTA 1JOOA 4K7UA 2C5LC 2EXDA 2N9PC 4QL5A 1X55A 4R1JA 3M4QA 1STAA 1C0AA 2CVRA 3I57A 4UHVA 5C3JB 2EVBA 1L2FA 2EE1A 2E75C 2FBWB 2KKCA 2WDVB 3A9JB 1QOHA 2M1MA 2Y5PA 1QILA 3EECA 2B2UC 1R4MI 1PH4A 3G48A 1SMXA 2G4SA 3T8MA 3TQYA 1CTMA 1FR3A 2JA8G 2PMVA 3ML8A 4PNYA 4LJZC 2I0QA 1S5FD 3GB1A 4JK1C 5AJ3L 1HZBA 1H9SB 1GC6A 2A69D 3WWVA 4XYOA 2LRUA 2ONQA 5C0XH 1VQPA 1ASZA 1OQQA 1E7VA 2KOLA 1HJPA 3D4RA 5C44H 3J81c 2KBNA 3EUB2 3T9LA 2KQ3A 3CCJA 2RSUA 2LKVA 5IO9A 3TP8A 2F0FA 4ZK9B 1E22A 1SSNA 1WTVA 4ZRJA 4W9FA 1PRTD 4BBRH 4RGOS 1SIFA 2INNE 5D6JB 2YTYA 1ICWA 3UQBA 4IO9A 3M9BA 1WGYA 3Q8CA 2EYHA 1F77A 5EE3A 3RN5A 3PHXB 4CKEA 1OFFA 4Q5VA 1YBYA 1VQAA 2HHHQ 3A54A 3H9DA 3VQIA 2EYOA 1SGHA 3TS2A 3FAHA 3KF8A 2KANA 2JEAI 4WJQA 2MNAA 3KOJA 4XDCA 1TIID 3AMZA 5J2RA 2R7ZB 1LTRD 3CHBD 2HTME 3RD2A 2EYLA 3UI2A 1PYSB 1S5ED 4HCPB 5I9PA 1VQEA 1Q46A 4O1NA 1X3PA 1TWCH 2NVYB 2Z0SA 3FMCA 2DX5B 1CKNB 1DOKA 2JN4A 3F8TA 1HTOA 3G71A 3I56A 4MSQB 1G91A 5BN4A 4YCUA 4DUZQ 2NVQB 5C4XH 4GKJL 1SB3C 2VB3X 3KUCB 5ELOA 1ZKHA 5KGUA 1Q1EA 3I4NG 4GU2A 2F0KA 3V6CB 4B95A 2B8GA 5DM63 4H02A 3PSIA 3WCQA 1IBML 1VQ4A 1II3A 4GNXB 3MVVA 1MJDA 2LASA 4ZRIA 1G291 2JE6I 3IL8A 2I38A 2WGSA 3AXCA 2BTEA 3ZRFA 1WXMA 1I50H 3L16A 2KJHB 3TP5A 4V190 1QOGA 3T1YL 2DENB 1I3QH 4POGA 1YITA 2PPBC 4K14A 4BBSB 3HHMA 4W9JA 2CKZB 2R92G 3EHVA 1D3ZA 3KUZA 4FF2A 4TRDA 2LXCA 2K01A 2UXDQ 2N4FA 4DBGA 4C7YA 4FBJB 5E6NA 2WXOA 4XXEA 4GZYC 4DR5L 4PYUA 3TEWA 1K3BC 4DR2L 1FXIA 1L1OA 1WJUA 3FVQA 3RNCC 2JZZA 5D2MB 2VH1A 1PRTC 4X6AH 1WZ0A 5F2DA 5AZFA 3L10B 4ZUIA 2JSVX 1QOFA 1FD7D 2YVCA 4ZYSA 1VR9A 4AJYB 4FA6A 4HSPA 3Q8BA 3HRDD 3M3YB 2WXIA 4IW0A 1FCCC 1V81A 4JBWA 2AX5A 4LNIA 1ZXIA 3BS1A 1JE5A 3QR8A 3KWVA 1VQGA 2IYDB 3S9WA 1WYDA 1WFQA 2YU9H 2WHIA 1GB4A 1AZQA 2LHDA 4K2LA 5JEAJ 3D3RA 5H8YE 3CPWA 2KENA 2F0SA 1TIFA 3P63A 4CYEA 2D3BA 1E2WA 1JR0D 4A3DH 3U4VA 1PTOC 2ZZPB 2E5LQ 4J15A 4UP7A 2Q2UA 4HK2A 2NWGA 4HXDA 2D2CC 3AECB 2GA4B 3QWNA 3AFPA 4LF6Q 2J7ZA 2ZTEA 2W55A 1PLFA 4QQBX 2EY5A 2L11A 2PI2A 4DF7A 4A3FG 5C3EB 5IYCG 3GTQH 2UUAQ 2DAFA 3KH0A 2WB1G 4HRSA 3DM3A 1LLRD 3MA2B 1TYGB 1YNNC 5CTRC 2K04A 3DWQA 5EPKA 3MFYA 1VJKA 2UU7A 3PTFC 3NUCA 2WWZA 2EMTA 2B2VA 3DBRI 2BW2A 2PTLA 1RIPA 4FO2A 2MJ3A 2F0LA 1EQQA 1WI5A 1KF6B 4PS8A 4DR6L 3EQLC 5DAUA 5G3LF 5M9OA 5C23A 2D3CA 3MJWA 3VFKA 3CSFA 2LGSA 2FMMA 3L9AX 2HJ8A 1ROEA 1L2NA 3R2IA 1X32A 2KLGA 1FJGQ 3TEXA 4RM8A 1K9MC 1STHA 2O6VA 4JBKA 1FNVA 1HQRD 1NUCA 3F2BA 4KMUC 1HA6A 3J81j 5JEAG 3I4NH 2GVBA 5IY0A 2F0NA 5ELBA 2CH4A 2F03A 1C4CA 3AU7A 3NOBA 3SHQA 1C7YA 1FM0D 2R3ZA 3CCQA 5ELDA 3CF6E 3KDFA 3W5OA 3TRZA 1CZPA 2CKHB 2C9OA 4ICUA 1WTOA 4IOIE 3TREA 1FFVA 1EUJA 3B1LX 1CI3M 4K8IA 2KEDA 2PW5A 3IHPC 1O7YA 3SDZA 2E2IH 2SNSA 3KK7A 4KK7A 3VDYA 2R92H 1PRTF 2K03A 2RVLA 2GBJA 3P4QB 1N33Q 2IBIB 3IRBA 3H8HA 3C19A 3N20C 3QG1A 4C7ZA 3RLNA 3KBGA 5LLIA 4LFCQ 1Y1WG 2IW3A 2ZVOA 1WE6A 4JI7Q 1XMQL 3PT2B 2NTTA 3RZDB 2A8VA 3UI3A 3EFCA 3PO2G 2KOXA 3AV8A 3W9CB 2B63B 2HUGA 2R7DA 2ZW1A 1EYGA 5M5XB 1TKEA 5DPRA 1PTOF 1B9RA 3I91A 1Y56A 2KJRA 1JB3A 3NVWA 4YTMB 2F0WA 1N32L 2ES2A 4X65L 3N52A 3AYHB 5CBEE 3MC8A 3E56A 4ANWA 2RBMA 4PS7A 2C7NB 1HZ9A 1B2TA 3C2PA 4IUPA 5CHFA 5JZEB 1XT9B 4C3HB 3KJPA 1I4PA 4OO1G 3S2DB 4A3CH 4CJ0B 4DR7L 4DUYQ 1UBIA 4RG1A 5GXGB 3E0JA 2EIFA 4LF8Q 3BDCA 4L23A 4DFAA 3DM1A 4A3FH 2FCNA 1NNXA 4YIJA 5IYCH 4BKTA 3HK0A 3KW5B 1UWVA 1P9DU 2JXXA 2JRIB 3I3TB 1SYFA 3OPOA 4BY1G 1JROA 2SAKA 4KSKC 4EUTA 1XPUA 3V61A 2AQ2B 4KV6A 4P75A 2QC8A 1NY4A 4DV6Q 4YT0B 3VYRA 3RFZB 1TU2B 1IGCA 1KL9A 2A68D 4B08A 4A3LH 4DNRB 1EL0A 5IN7A 1EWCA 1TWHH 5LL6X 3T1HL 1KOTA 1KLGD 2F4VQ 4GB9A 2PW7A 3PSEB 3FDTA 2B29A 4JIOU 4K5XA 2BA1A 2JA5H 4MM3A 1A6XA 1JT8A 2DJFC 2KK8A 2VNUD 1R4NI 4YWKA 1BMLC 1LO5D 4LK0M 1UWMA 4R8IA 1S3SG 1TZ1A 1V97A 1BOSA 4IOAA 1FNWA 5IT9E 4BS9A 3AMUA 3MEFA 1SYBA 1YNXA 3QQ8B 3J7AV 1UE5A 1VDVA 1Z6HA 3KLSA 5JXVA 2L5TA 3VUXA 2M17A 4X3UA 1B50A 1HRJA 5LMUQ 1WWTA 1BBUA 3FRPB 4LF7Q 1RFAA 1YEZA 5D94A 2FCMA 4PG3A 1TS2A 3HOXB 4A3GB 4FVMA 1IYVA 2ZM6Q 2MLBA 3JAML 4XWWA 4OZBA 1VZ7A 4LW1A 2LSSA 3Q8FA 4AWJA 4DDGD 4JI4L 2XWBB 3CCMA 2JYTA 2Z8LA 1F2YA 1E9MA 3J80L 2F0MA 5HHDG 3UQAA 4A3IB 1XQQA 3L08A 3AE3B 2B2WA 3MXPA 5ELEA 2KUMA 4APVA 5DM73 1FVIA 2IJ0A 1EY5A 1XXGA 2BKRB 3A4RA 3VXWA 2UU9L 5HKHA 1YZ6A 3ULJA 2BDNA 1VQHA 4S3SA 4LDTB 2N1WA 4L2YA 4QF4A 2J0MA 3RNEC 2A68C 4X62Q 2WP8J 1EEID 2EYPA 3CCVA 1HNWQ 4C3JG 5C4ZA 2MJDA 1PH6A 4A3JB 1GUSA 4NAWA 4E74A 3KJOA 2KTFA 1A2UA 1GHJA 2A6ED 3RZOB 4KIKA 4PS3A 1YN5A 3H3VH 3ZTDA 3DBSA 3UDGA 1J7AA 4OO1H 3TIXA 3CW2C 3U7ZA 1CT1D 4X57B 1Y8PB 3PGZA 2FFKB 4NPNA 3PCOB 1QNUA 4R3DA 4ZHPA 1ZDXA 2KZRA 1TR5A 3MXNA 1PUTA 1XTDA 2W3RA 3AE1B 3L0OA 2G45B 1N34L 4BY7G 1FXTB 4DPGA 4GNXC 2Z6KC 3I72A 4BY1H 1ZKOA 2R93G 4EOYA 3BDOA 5C3XA 1K52A 5ELCA 3S1MH 1AE3A 2KJXA 1ZE3D 4OL7A 1UE1A 1Q1OA 1OQRA 5HFYA 2Y0SE 2IO0B 1NDDA 3I4LA 1DM0B 4NXNL 2L3ZA 1JCKB 1SFOH 2INCC 1C4PA 4YY3Q 2WXHA 3EVQA 1I6HH 1KM7A 3W1SC 2A73B 2ZJPA 3Q22A 2N7DA 1VQFA 4M01A 2KFKB 1B1ZA 3PIO3 3CXCA 3DWGC 4ZKCB 1ENAA 1B3QA 1C79A 1E2VA 1WJJA 2C35B 3S17B 5EKLA 4IUVA 1E8WA 3LWEA 4ZAIA 4ZLTF 1E7UA 2K25A 5C5MA 1V8CA 2LZ6A 1MKHA 2OJWA 3WANA 1TKWB 1HZAA 2ASQA 1HNZL 4HPPA 3RNGC 1H8CA 1X3QA 5M3MH 1GJXA 4NPSA 1FNUA 1GG3A 1S5DD 1VD2A 5KRUA 3IAYA 3WOEA 4C4VB 2A6EC 4NXMQ 3GTPB 3QK0A 1YX5B 1LTTD 2AUKA 2PMZE 4I65A 4LFBL 2PW9A 2F1MA 2D0OA 2F3IA 3LB8C 1J0GA 1LT6D 1IPGA 4W9DA 3O13A 3KYDD 1V1QA 5BN3A 1RFKA 2HT1A 3BINA 5FLXc 4DR4L 2D3GA 2XK5B 5BYQA 1K28A 3ZJTA 4OIJA 1I4RA 4A3KB 2A74C 3CCLA 3HOUH 3VTVA 2JF5A 2HIVA 2E2HB 1C76A 1VMPA 2WLBA 3MEHA 2MUYA 4FF4A 4BA1I 2O5IC 4KX6B 4K7SA 3K6OA 1M1KC 4NMZA 3WOFA 3HOYG 1FIQA 3T3NA 3UIPB 2JA6B 3UGBB 3DBHB 1R7SA 4PQXA 1EM7A 1WJNA 2BYVE 2XGTA 5GAHC 2WU2B 4IJHA 3Q3MC 1L4DB 4RKBA 1A3UA 3ER0A 4A4IA 4HJ5A 2NVTB 3PRPB 4HDQA 5E6PA 4WJWA 5IOIA 3SR6A 1CSQA 4AJWA 2F3WA 5DCNA 4XT3B 4DGZA 1P16A 1XMOQ 3S14B 5G5GA 1HNXQ 1TWGH 3T56B 2NZOA 1PFMA 2O5JC 1VRAB 1VQJA 4IWOA 2ENBA 2ZT9C 2WKDA 3T53B 3VR6A 4A93B 4IJLA 3ZVVA 2MH7A 4Q0FA 3GV6A 3Q23A 1WIAA 4H44C 3C0RB 1VZ8A 2WINB 2R93H 1JORA 4B9WA 1V1PB 4BKSD 3GTKH 2E76C 3PVLA 1LV9A 3SK5A 3S2HB 1DOMA 1WSPA 2EZVA 1E8XA 2BCOA 4R4QA 4M00A 4KV2A 1FMAD 1KRTA 3M62B 2NMQA 1GO3E 4NJCA 2PZUA 2I1JA 4ZRPA 5BMHA 1XJVA 2NTSA 1I94Q 4YCWA 5BR8Q 3ERQA 5LMNW 1EF5A 4EX5A 2L83A 3ZW3A 4LF4L 3KF6A 3VYTA 2K8BA 4XE0A 5GMVA 1OXTA 4JW0A 1K8OA 5M3FG 1EWYC 3CC7A 1N9WA 1N63A 2RMMA 4DHZE 3GE3C 3HKZG 1NE3A 1I7HA 4AUQC 4R4IA 1KABA 1PRTB 3AB5A 1IBLQ 4L5RC 1WXQA 2DZKA 1I4HA 2MSED 5LXHA 4OWTB 3Q3FA 1KC8C 2HTHA 3FKIG 1A3TA 3M7GA 5CHWA 4URKA 4A6QA 1QB5D 1UEAB 2LJ5A 1H9MA 2IPKD 2JEBI 1C9OA 4PZ6A 4A8XC 3NSWA 2BT6A 3DHHC 4GOPA 1GD7A 3BK1A 3X3MA 1Y8OB 2YV5A 4LFAQ 4DV1Q 4CKBA 1TWFB 4Y7NB 4KDLB 4RNAA 3SDLC 4EQOA 4JI2Q 4ACFA 3HP3A 3NZUA 3BIID 1V6EA 2WX0A 1PTOB 4B3MQ 3I63C 3ZNHB 3PRZA 4JI8Q 3EGRA 3ZDMC 5H92C 4ITKA 4M8MA 1QUQB 1QVCA 3NBHA 5KYIA 2Q2IA 1D5XC 4LAAA 4GKKQ 4HJ9A 2L9HA 3K0YA 1A63A 4HN7A 2KWUB 2VZKB 2MQJA 3FPUB 3DUZA 3D6WA 3TBIB 2QA4A 1WXVA 2B3GA 4DAYA 3PRMB 3CD6A 4LDTD 2EJGC 2MHJA 4YSZB 1NTGA 1IYUA 3N9YC 4MELA 4WWPA 4B0EA 3HOYH 4FXKC 2KMAA 3AH7A 4B3RQ 2WKCA 1WMHB 1SXTA 2RHSB 5EPLA 3PLUA 2LI5A 1LTLA 1F2ZA 5M5WB 1R9TB 1CSPA 2KDFB 3N1XC 1DD2A 2PI2E 3PQIA 5C4JH 3FC4A 2HD3A 2CW0D 5FOBB 1WX8A 4KGTA 3J7A5 4HAEA 4TMAB 3D8GA 2WB1E 3BYYB 1STGA 4CKCA 2AYOB 5FO7B 1Z47A 2EY6A 3CRKC 1IYFA 3QOLA 1C48A 4A3BG 1SNOA 1HHVA 3X3NA 3QARA 5J1ZA 5DPSA 3K80C 2F0UA 1HZ5A 2A19A 1E7ZA 1IP9A 1RF2D 4J3OD 4W9IA 3FPPA 1L6VA 4B0MA 3B0AA 3J81L 4G4KA 1CKOA 1G6ZA 3A8IE 3PHWB 2K1BA 2MGSA 4MZ9A 1XNRL 3ZRCA 3MFGA 3LWUA 1GAQB 1JJ2A 1IUEA 4HEDA 5EQ0A 1B70B 3HOVG 2IGDA 2ID0A 2X6LA 3SVMA 3T51B 5JVH3 1E1OA 1MFWA 2J0JA 2JYOA 1A8VA 3I4MB 1L6UA 2QW7A 1HR0L 1YVCA 4XYQA 2K6QA 1Q12A 3M85A 5EE9A 4F1SA 4A3OA 4GS3A 1BT0A 1PDXA 1FGBD 3ZYYX 1YHBA 2PJHA 2KYWA 4A20A 3B2FA 3RUZA 4ZYNA 4CO7A 2VH2A 4II3B 3RD4A 4IPHA 4AYBB 4G7OC 2I07B 3A5UA 1AYFA 2QKIC 1HPCA 4IM2A 4LMQD 1WRIA 4HCEA 3SXHA 1VDZA 4KN7C 5IGBA 1EUVB 3H7PA 4KKJA 5D7GA 3K9OB 3A9JA 1TVXA 3PPAA 4OIKA 1PYWD 1QNKA 2Z1CA 1SYCA 3H3VC 4JGHB 4US8A 5IKCM 3CQZB 3A8KE 3E5SA 1PGBA 3DBLI 3DEOA 1MG8A 3BVMA 2MHVA 2VUMB 3H0GB 2KD0A 2QEXA 2QEJC 5JH5C 1B9MA 5KIXA 3G4SA 1V9PA 1H9SA 2HDLA 2J42A 2FE8A 2HE7A 2M56B 2CW0C 4IUNA 1IL2A 3EROA 1Y1VG 1CJEA 2HDMA 2YLMA 2IZVB 4HDOA 1LTAD 5D3IB 2EOTA 3JYUA 3UIOB 3S1NB 1H95A 1G6PA 2F0OA 5EE1A 3KQ4A 1MHWC 4HPMB 2JX5A 5CGKA 4KN4C 1VQNA 2MO1A 1GOZA 2IY5B 1EIYB 2HDEA 1A3VA 4AP4C 4AH6A 3S2AA 2O2LD 5CV8A 3MXGA 2N55A 4JG2A 2JT4B 3LJ3A 2AQ1B 3DHIC 5IYBG 2OQKA 1T5EA 3NP8A 1ZXHA 3NZ3A 5ISRA 1ZGUB 4HMJA 3ZJVA 1P0RA 1MHXA 3MWYW 1V80A 1NI2A 1PFDA 4GOCA 3PUVA 4C2MB 3TDQA 1N36Q 3NVYA 3C46A 4DV7L 3J7AF 1RWSA 1M8AA 2D0PA 3IAS1 3NENA 1LT4D 4FF1A 4GKJQ 2A5HA 5G3LD 2D9UA 1UGJA 3APDA 1BO0A 3RYTA 3CRLC 3MHSD 1SE3A 4YWGG 5BMIA 4DV0L 2JUOA 3PF5A 1UBQA 3AE8B 4KY5A 1V5TA 5KHQA 2EJFC 3CMEA 2OTJA 2MJEA 3TJPA 2BOSA 2BKFA 4X3SA 4KTAA 3MTSA 4G0NB 4OVUA 2NN6G 2IWHA 1CM9A 2VS1A 1BDOA 2K8CA 4P1CC 5DEHA 1QZHA 3T1YQ 1WD1A 3V96A 3Q3OC 2DNCA 1LM8B 2FAZA 3ERSX 5LMNQ 5C44B 2E8GA 2J4XA 4PZ7A 1CZGA 2WAQB 2AWTA 2KDMA 4ULLA 1E0BA 3J7ZC 3QX1A 1Z2MA 3NUHB 1U5KA 4DR5Q 5CV6A 4M8AA 2V4DA 4E3CA 4XQNA 1NI3A 1PMRA 3K0XA 4W9KA 2I2YA 4BBRB 1F9PA 1KRHA 3ZXVA 4FF3A 2WX1A 1LT3D 1B7YB 2VZAA 1WXSA 1QQRA 3AEFB 4ZOHC 3AI5A 2OHFA 1KTKA 4DR1L 4OEMB 1SNCA 4Y52H 3VA5A 4F88A 3RMHA 3I55A 3VRBB 3ECIA 1B4OA 3HEJA 1ZW7A 1JE4A 2GLSA 1EU4A 2B2YC 4IPDA 2G9DA 2PYKA 4YCVA 1XLNA 2HQLA 4DNIA 1SNDA 4JI6L 4MGZE 5AFWA 3TS0A 4BOZB 1CQVA 1TWCB 4D2KA 2PNHA 2SNMA 4RKLA 3AE6B 4XYCA 1FGUA 1VQ6A 2L0FA 1LXDA 4KD4A 3NWSA 1G8ZD 5J3BA 3DLLA 5IAAC 1PTOD 4GDKA 5C4XB 3QWZB 4WIPA 1Y1VH 4JI5L 2GBMA 1BUIC 2KVRA 4WAFA 3AFQA 2XEWA 4M0WB 5C3EG 4KLKA 5HGQA 2FCQA 4RA8A 3BU2A 1X9NA 5C5LA 2VZKD 4J1MA 3APCA 4NY0A 2UUCL 1HTQA 4CDFC 2RF4A 4OONA 2CJNA 4MT5A 1F0ZA 1Q8KA 2F0TA 4CBVA 1YNND 1X3FA 2YYZA 2Q8IB 3E9HA 1NEKB 3J9CA 1I50B 3JAME 1WF9A 2YEPF 4B3TL 2LY7A 5IYBH 1I3QB 5EAYA 4DV2L 1KLUD 3CC2A 3EJIA 1PFSA 4K0KL 1JJCB 5E3FA 1TKYA 3APFA 4JI0Q 1VQBA 2QMTA 1Y14B 1SSOA 4DR3L 3J80E 4OVZA 5KHOA 1XNQQ 2K7VA 1DJRD 3K7UC 5EJWA 1L0VB 2B2TA 3E9SA 2AMCB 3MHZA 1VMCA 1WTPA 1LFDA 1WCMG 1WZ3A 4IPCA 4IC7B 4II2B 4QUFA 1G51A 4DHJB 2EYFA 4BWGB 1SE8A 2NVQH 2CQAA 3GS2A 3UF8A 1EY8A 4K1RB 4QGUA 2MW5A 2QGQA 1SNPA 4TKOB 5I6WA 2EYJA 2F0EA 1NMGA 4ME5A 4A3MG 2YU9B 1EQRA 3ZJYC 3RNBC 3V3XA 3IFWB 5I4DA 2NN6H 2LUMA 4O42A 1TY2A 2ASBA 5IGGA 4QJFA 3I5JC 5EBDA 1FCLA 4WH4A 4A3DB 2KHJA 2JA8H 1JWAD 4Z9CB 1EYAA 2KHIA 2DYMA 1L5PA 1SROA 1VQ9A 2BPSA 2K0PA 3AN1A 2N88A 3V05A 3K57A 1SBBB 3WAOA 2ICEC 3I4OA 1GM5A 5K5PA 4GLSC 1EY9A 4HJ7A 4AQYQ 3GTQB 2WP9B 3ZNID 2WQYB 5KNDA 2VQEL 3VYUA 1KQSA 1XMQQ 4ZQ3A 2M0AA 4N9F4 1STYA 2FHTA 4RMFA 1U4PA 3PIOA 2QHOA 2K28A 5HURA 4Q2JA 2ZJDA 2NUCA 2B63G 2KAJA 3QIJA 4YWMA 1D6EC 1UE6A 3D4DA 1RAXA 2PZWA 3R66C 2XRSD 1ET9A 2RKSA 2MP2B 2MEKA 2N9KA 1P8LA 4G57A 4X65Q 5E7NA 2KVMA 1WGDA 1LTBD 4OX9Q 1K0SA 3L17A 1VCIA 2R6GA 3RPFC 4JV5Q 4ODGA 4RH6A 1PA6A 3KWLA 4K7WA 3V60A 4DWFA 4C3HG 2E2JH 2XRQD 2L0CA 1WTRA 1EFWA 4DR7Q 2JRHA 1MSGA 2NN6I 3I4NB 4W9LA 3U30A 4MGKE 2UUBL 1SAPA 1OEYJ 1QKZA 2FIFA 4QB4A 3PUWA 2ZEQA 4MHEA 2PQAA 4GLAC 2N78A 2JPHA 4GMVA 2FCSA 4PMCA 1EOTA 4A3PA 1S4ZA 3TEYA 3IT4B 3OIQA 1PH7A 2E2IB 3AEVA 3K58A 4I6PA 3B2GA 5D14A 1B3AA 1UE7A 2RR9A 2VQFL 2NZHA 3OW7A 2R92B 3T1HQ 2OJRA 2L15A 3ZTCA 3HZXA 3JSVA 2JQOA 2K75A 4HPLB 4LNFA 3OJ3A 4BXXG 4E71A 1UEBA 3OSOA 4KVGB 4TQ1A 2ON8A 1BBWA 1OO9B 1WCMH 1OTCA 1UNSA 1P1AA 1J9OA 2N9LA 3AM9A 1RKNA 1TWAH 4WWNA 5JJZA 1ZUD2 2EKIA 4JOIC 1I4XA 4NZLB 1YI2A 4HIKA 1F1HA 1PGAA 4QIWE 4UAIA 4J6HA 4LUZA 3K5LA 3VR8B 5LNK1 2C5CA 1F2LA 2NVXH 4A3MH 2KCNA 1HUNA 1YMHE 1BCPF 2N3SA 3GE8C 4RGTA 3KVFB 4LUOA 1I4QA 3PV1A 3PO3G 1T9HA 3G6EA 2LVQA 3NS1A 1D5MC 4DV3Q 4S0RA 3JVZX 1JMCA 4B3SL 4LF5Q 4GIVA 2LHEA 4W9HA 2ICIA 1MPEA 3NEMA 1GPXA 3HOXG 2D2QA 2P5ZX 3TZUA 1OEYA 1P3QU 4OW0A 3ULPA 3ZNGC 2PIAA 1IBXB 4JI4Q 3WDNA 1A15A 3NTKA 1Q81C 2N7JA 1N60A 2UUAL 1AW7A 2WB1B 3HKZE 2GI9A 2E3TA 2LGXA 3PZ8A 3U52E 2DUDA 2N7EA 4BKGA 2F0DA 2OCEA 2PO4A 2XTIA 1C8CA 5JJLA 4IFDI 1GJZA 4MH0E 4RAUC 3PS6A 1BR9A 3HOWG 1E0ZA 1HE8A 3QA8A 2BH2A 2CU1A 4W9CA 3DXJC 1OTRB 3CCEA 2CFMA 4IZ8A 2CHZA 2UXCL 1TWHB 2B8FA 3MJ5A 4DK6C 2X69A 1PFBA 5EGTA 1BNZA 4DA2A 3DHQA 3U9OA 1QVGA 1D8LA 2JA5B 1EF1A 2MBQA 1WGHA 3EA6A 1WR6E 2D62A 3ABVB 1DOXA 5DLQE 5L83A 3AE2B 3RR5A 3TMPB 4A3EG 2JZ3B 1GUGA 2ZXOA 2I1KA 1ISNA 4DK0A 1X54A 2E2DC 2B39A 4ME3A 4JBJA 2AUJD 5JEAH 1WJ4A 2RCNA 1JWMD 1C9FA 1U9RA 3AE9B 5G5HA 1Q7YC 4IWQA 5MPOA 4X64L 3SD5A 3I2ZA 3KUPA 1MD2D 4WURA 3IXSA 1UGMA 4BAXA 5IYDG 1EZ6A 4RGNA 2FINB 1YQ3B 3GTMH 2BS4B 1PH5A 3QB3A 3CKIB 3C8YA 3P7JA 4FULA 2LRWA 4JI3Q 2MA9B 4JYAQ 3R3OA 1DGJA 2JVCA 3GO5A 2DZJA 1WI0A 5NUCA 3S16H 5FLXL 2Z0EB 2QDLA 3MXUA 4XIGS 4DKAC 4LFCL 4N58A 5CX3A 4IPGA 1K3RA 4WORA 2VY3A 2V9HA 4DHJD 2MO0A 3NXWA 1XCQL 1Y1WH 3S1QH 3AB9A 2WXQA 3TEHB 3RMKC 4DV4Q 1JRPA 3OOCA 2HJ1A 4LTUA 1O7IA 3AE4B 2DN8A 1CUKA 2QDBA 2F3VA 1PZID 4CDDC 3PO2H 1T6BX 3RCZA 2IGHA 3C1EA 5CORA 1U4MA 1PH9A 4TVAB 4PV1C 3PUYA 1CFMA 1HNZQ 2F0HA 3PO3H 3HM6X 3S15H 3IG3A 4QUCA 3RN9C 2FUG1 1ZOYB 2IL8A 3N1YC 5G2NA 1EIHA 2B2UA 4GN1A 4MJSB 3JC66 1Z7TA 2WACA 1TZOA 4M02A 3RULA 1W6JA 3STBD 3BY4B 3M7NA 4NJ7A 4RCNA 4LF8L 1QZEA 1K73C 1B8AA 1Q86C 2NB0A 2Z59B 2OT2A 2K5DA 3OMCA 2LVPA 2WU5B 2F0GA 3OMGA 4JQWC 2IY0B 1EY4A 1MJCA 1W2BA 1QLBB 1WTXA 3RLOA 1WM3A 2RD0A 1PH3A 1RJTA 2K52A 4BY1B 4A3KG 2MPMA 4GDLA 5FJ8G 1WFYA 2KO3A 2XK5A 3TEZA 1HTLD 1QT9A 3U4ZA 3HOWH 4KGSA 2MBEA 2BH8A 3J81E 5T1GA 1XWEA 1V2YA 3SE0A 4L63B 2KX0A 3S1MB 1ICFB 2KFJA 3A9KA 3AE7B 1SYEA 3X0WA 2C60A 1P7FA 4WFN3 2F4VL 1J8CA 5JVG3 1PFNA 1F2RI 5DPWA 4IWPA 1SFOB 2ZPYA 4ARCA 2G1EA 3URYA 2V3SA 1I6HB 1Y8RC 2KDBA 3QIAA 3NBIA 1EQVA 3SGIA 3T4AC 4YL8A 4XC2A 4HIMA 1W6KA 4CDCC 2KT7A 4UDUC 5A35A 1TY0A 4DK1A 4A3EH 4A76A 2SDFA 1MI0A 3PIP3 1DONA 2KTRA 2YEPB 3HVZA 4EZKA 1NYQA 3MP9A 5I2XA 3RLFA 4F7ZA 1TTNA 2R2QA 4A93G 5IE8A 2K5NA 1J19A 2LMCB 4N59A 1K0RA 1UH6A 2B3AA 3VUWA 2JK8A 3H09A 4MIUA 2ZXRA 3BWUD 5LHY1 5LXIB 5M3MB 4LF7L 2PVGC 3GTJH 3K5OA 4DXAB 1V1PA 4FHKA 2IT1A 4XDDA 3X23A 3PUXA 5E1FA 2AQ3B 1EIFA 3QHTA 1JQYD 2MFIA 5TSSA 3HS0C 3STBC 3HGBA 3LGJA 4KHZA 1EWHA 1BF4A 4LF9L 1T0QC 2KQSA 4LF4Q 4OHJA 4K3BA 2J53A 3S1RB 1WTQA 1YJ1A 1RTNA 4X66Q 4HR7B 1FPYA 1SIJA 4NAMA 3VR2A 3ZNZB 3L4PA 2XN9C 4C00A 4C1NI 1NR2A 3HOUB 2BF8B 2AKWB 1ZPSA 1YJNA 2F0IA 3A33B 5LL6S 1T0RC 3LXFA 1A2TA 3U8ZA 4DDID 2UWQA 3B6YA
chains in the Genus database with same CATH topology
1ZYRD 1LABA 2DY7A 1CA5A 1BUVT 1HCZA 1U4LA 2JA7B 2K05A 1N5WA 3I70A 2HQEA 3P20A 1PZJD 3BVGA 1HQMC 2WXGA 4KKIA 3L3OC 3P4SB 3M4OB 3I90A 1TWGB 4FP5D 4NKLA 3N6RA 1I6VC 5C2TB 5I9OA 4K5WA 1H9KA 2WIIB 2R93B 3GTKB 2PVOD 5JAVA 3NQIA 4DXFA 1CA6A 1F2MA 4C3IB 2K5WA 2V0GA 4DU9A 3SEBA 5E6JA 3LX0A 4M1UB 1XYIA 2EDGA 2KCCA 3K5MA 2XNAC 5IIFA 2WV6D 1ET6A 1ZYRC 4N9PA 2HCIA 1D1KA 5KEEA 1XLPA 1C4AA 1FYCA 2BDOA 1B9NA 1OXSC 5EBCA 5J39A 3VR5A 3F2UA 1GXDC 1BCPB 2WXMA 5KNCA 1EYCA 2FJ2A 1FRRA 1TT2A 4AS1A 1HZ6A 2B2VC 4N9TA 4IALA 1YQ4B 3P4RB 2L55A 4ZRQA 4HMIA 4K6DA 3HOYB 4FNFA 2D5GA 4L6TB 1IGDA 1K51A 1B53A 2WXKA 2Z4IA 1D4BA 4IDIA 1QCBD 5C4JB 2IX1A 1ACCA 1RCVD 1DCZA 4G7ZC 2JZPA 1JC7A 3A7LA 2JQRB 2WDRB 5I6YA 5C0XJ 5CV5A 1GUWA 3A55A 1N62A 3K59A 2K6AA 2JSOA 1XLOA 4X3TA 1WD0A 5JPNC 4PMBA 3C3LA 2LFNA 4US9A 5CV7A 1PZKD 1VLBA 2EXZA 1NENB 1NAPA 3SFDB 4PMWA 1LTID 4LK1C 1NVID 3AEEB 2LGIA 1MI2A 3SK6A 1JOQA 1Q10A 4DQOC 4PT5A 1RD9D 1CZWA 4J8QA 3E6ZX 3SR1A 2EPBA 4U68A 1CK1A 3NHHA 4RHSA 2QCPX 2SEBD 1YJJA 1IKLA 5D65A 3G7LA 3TUOA 4MACA 4ILWA 2EYMA 4ZHOA 5T8IA 4KY6A 3OHXC 1U4RA 5C0XG 2H4OA 2BB6A 2HCCA 2WNMA 4DAVA 3FILB 4IUQA 2F0VA 2RQXA 3IT6B 3QO2A 5HI1A 1V8QA 4IUTA 4QMGA 1S5CD 1ENFA 1STEA 1SNMA 1SNQA 1K8MA 1F9SA 1O7ZA 2FMCA 3Q69A 3LYYA 5EKKA 3A8JE 2BYTA 2AWOA 3PMFA 1HUMA 4KKUA 5EE0A 4XWTA 2XWJB 1RYJA 5FR3A 4HKZE 5E4WC 3TP7A 1KDBA 3TMEA 2EY2A 2L52A 1YN3A 2OXPA 4LLGM 2Q8RE 1Q8IA 2LJIA 2O4XA 1XLQA 1TKGA 2MJ8A 3R93A 1C78A 2CJOA 1FFUA 1KAAA 1NSNS 1NR4A 2OF1A 4M0WA 5FK9C 1SMYD 2X38A 2M9VA 3HG9A 1C77A 1A70A 2D5DA 2L12A 1N61A 2W82A 3FEWX 3AEBB 4YTPB 3BDLA 1E10A 2EY1A 1N5XA 3W3AA 2B2WC 3TZDA 1YNJC 2F4IA 4KHVA 1Y69U 1VF7A 3T16A 3W1SA 1AN8A 5A2QL 1QE6A 4HSVA 1QOBA 4IFDJ 1ILQA 1TS3A 2E6XA 4K8JA 4YSYB 1ENCA 2NZ1D 2KMMA 3W2DA 4YXDB 4RF1A 1O7LA 1WVLA 4K6LA 1KDCA 3PO0A 4JWUC 5FO8B 3NVZA 1RHPA 2Y0SB 4CGYB 1Y1VB 1BCPD 1LT5D 1AFPA 1XEEA 2K32A 1LACA 2RPVA 2K5PA 5JOBA 1ML0D 1SMYC 1TJEA 1DYQA 1MSHA 4RWSC 1RM6C 1RODA 3I3CA 1ZDVA 2QF7A 5EKIA 5FLXE 4EQNA 4KJNA 4HKQA 5HGTA 1SDFA 3R8BA 1E7PB 1XCTL 2PMZB 1XF5L 1HFNA 1QG7A 1JWUD 4IFDG 2DY8A 2B76B 1DOYA 5FKAC 1WYGA 2PZTA 2R61A 2J0TD 5C0XI 3H94A 3U4EG 4RHRA 2EELA 1IKMA 2RSOA 3NE5B 5CC4A 3HUIA 3KLRA 2JA8B 3ND8A 2A69C 3SFEB 4ZRZA 2M2LA 5K36G 3ZGZA 3CU7A 3VR3A 3GP7A 1BCPC 4XTCS 4RF0A 1BQQT 2EJMA 1K53A 3NQTA 3DWAA 4EE2A 3M4YA 4KY7A 4KJOA 3Q6SA 2H1EA 2JWUA 4V0BA 1ESRA 1IL8A 2KHSA 3MAQA 3NTIA 5KNBA 3B9JA 4GDKB 2H89B 2E2JB 3PV0A 4DN4M 2N0SB 4RCOA 1HA5A 1C4QA 1NYRA 3I9V1 4IQZA 3Q8EA 1IBXA 4XQQA 3J7YW 1OXXK 3NK9A 1QF6A 3R2TA 2KWDA 2M00A 4JPSA 1SYDA 4OZAA 4HTHA 3W5UB 4H13C 1GUNA 2IX3A 1V43A 1WCMB 4A9AA 1MGSA 5J22A 1EY7A 1TWAB 4IFDH 5C3WA 1TS4A 1PXUA 4FXCA 3HRZC 4F8MA 4HROA 5ELFA 5BYRA 1YN4A 3IFTA 4H0LC 4FXGC 2NVXB 4A3MB 4A90A 3L7ZC 2OEOA 2E74C 2RDHA 1SYGA 3KBXA 4XQJA 1QOAA 4FXDA 5K36H 1JQ4A 3BG3A 3ND9A 3BZDB 1GHKA 4ARIA 3VR4A 2A6HD 1H9RA 1RTOA 4A3FB 3AEDB 1PDQA 4C80A 1MHHE 3PZ7A 2QILA 4IUUA 1EY6A 5CV9A 4IURA 1IW7D 4TSSA 2Z4HA 1EFID 3PUZA 3Q24A 1BBXC 5IGEA 2QIEB 3GD7A 3QOJA 1H9JA 1AP0A 2JXMB 2F0JA 2PKOA 3VA7A 4YTNB 1STBA 4KKTA 1J7CA 3ONAB 2DYOA 2F0QA 5EPJA 3IKJA 4DAPA 3OIPA 1EY0A 4JE3B 2DLBA 4AQ7A 3AEGB 1RDPD 4NDXA 2IX0A 2X6GA 2LS01 1VF5C 3K5NA 3NPPA 2LEKA 4L1BA 5JPMC 1XO3A 2KECA 3T3OA 1ZXTA 3GTMB 2K3UA 4KI0A 4IKGA 2RDGA 5T1IA 5DNFA 3S16B 4HCSA 5KYLA 1ESFA 1TQOA 2A6HC 5CR3A 1Y1WB 3S1QB 4MH8A 3P1HA 3DWMA 4EGVA 4ID6A 2CHBD 3PO2B 3U9SA 2WS3B 1D1IA 1IW7C 1F9QA 3A7AB 4R9WA 3D31A 5E4XA 3A56A 1JW9D 3PO3B 3S15B 1KDAA 2LMCA 2WXJA 4CJ1B 1FO4A 5C4HA 3U2SC 2AWNA 2Q8TA 2XVSA 2CU3A 1XTCD 1J8IA 1VZ6A 3BVZA 2BS3B 2BBCA 1XX8A 2QSDA 1B44D 2NYZD 2KACA 1GUTA 2GRIA 3HOWB 4B9XA 2RDFA 3MZ5A 2G9HD 1QJOA 2ACZB 5AUKA 2QJLA 2M19A 1HXYD 5IGCA 1E6EB 1AEXA 1YNTE 2KN4A 4MM3B 4EVOA 2Q5WD 4A3EB 2B2YA 3HVDA 3Q8AA 1FD6A 1LTGD 2V4IB 1OXUA 1MVKA 2KQ4X 3TP6A 4JWSC 1STNA 4DNTB 3GTJB 4OGQC 4R8NA 1SJHD 1SF0A 5D3DA 2F0PA 1G2SA 4C3IG 1SE2A 1ZP0B 4ZUJA 2H88B 3CIRB 4A55A 1CQFA 4P2CB 1Q90A 1V1OA 3DWPA 4ABNA 4OO1I 1HFGA 2GB1A 4H2AA 4N6EB 4FYDA 4NAWB 4K5VA 3MHBA 4C3JB 1YJIA 2Y3AA 1IHZA 1L0XB 2INPE 4CQNA 2KEEA 4HEA1 2WXLA 4DXGA 1UUPA 2DBYA 2WXPA 1JALA 5HG2A 2XSCA 4GDLB 3ZQ4A 2JYEA 1D2BA 4ZKBB 3QJYA 4KKSA 3SK4A 5CMDA 4P6VF 3GTGB 1T5XD 3BYTB 4EQPA 2BB5A 4BY7B 1EEFD 1FXAA 3VR9B 2IDYA 4E6IA 4L8JA 1I4GA 4WRDA 3SHLA 1PGXA 2B2TC 3LNNA 5IGFA 1FEHA 1JWSD 1J7BA 2BE5D 5CV4A 2L1BA 3NWTA 2V3NA 2DNEA 1O80A 5I2YA 5IOCA 1L0YB 4USAA 3Q0AA 2PLPA 5A2QE 1QWYA 2VXWA 3CWIA 2JXTA 1EU3A 1T3QA 2I46A 5FO9B 4MN3A 3K7AB 4C1NK 1Y8NB 2ZW0A 3AEAB 5BMGA 2XIWA 4XDXA 4NW2A 4H7BA 1AWDA 1UWXA 4KD3A 3D6CA 4WWMA 3DEPA 1SJED 4CHTB 2MP1A 3GTOB 1R4QB 4RFBA 4BA2I 1HTPA 1EZ8A 3IAM1 1JICA 1FRDA 1LTSD 1E2ZA 4X3KA 1DOLA 1GB1A 1OXVA 1WTWA 2RA4A 3GV3A 4WQMA 2BS2B 1ONLA 1F9RA 2BA0A 4YSXB 1HEZE 4JX1C 1R4PB 2L1AA 2WXFA 5IT9L 3AE5B 1JMLA 5IGDA 2BE5C 1DXMA 2K5QA 4U673 3T13A 1Q3LA 3FILA 1PTOH 1GUOA 1SEBD 2JU6X 2PCFB 4QIWB 1L4ZB 4HJGE 1M4VA 1EYDA 4QCLA 5COYA 3IFDA 1JWBD 1JOKA 1P7EA 5BYSA 1ZEQX 3ZJUA 4TQ0A 5M5YB 4P16A 4OZCA 3OWFA 2NBFA 2TMPA 3HOZB 1KNEA 5CYUA 1O78A 5M3FB 1AZPA 2IGGA 3C1FA 3HKZB 1F2RC 3SK8A 2DWQA 4RGMA 1CHQD 2VB2X 1WGKA 2V3PA 3W5VB 3P1MA 3FKIB 2OEDA 2K22A 4REZA 1UAPA 1K50A 2Y5CA 4TQUS 2WDQB 4I7ZC 1ILPA 4K2KA 3V2TA 5BN5A 2W54A 3BK2A 2RSNA 4F87A 3H6MA 1BXTA 1EQTA 2TSSA 3I8ZA 3D4WA 1YNJD 3OWEB 3P75A 2WXNA 3P42A 3KLSX 4G7HC 2KA7A 2PQEA 4CJ2C 4C56C 1MBYA 4NP5A 1KFYB 5CBAE 2K9XA 2LFIA 2L32A 3NRZA 2K33A 5AUIA 3VYSA 4IN3A 3VRAB 3ETRA 1S5BD 2SOBA 5C6AA 1K83B 2JP1A 4KGRA 1SE4A 1KH0A 1DZ1A 3H91A 3DMUA 2PNRC 1D5ZC 1EIGA 1TS5A 3MC0B 4A3BB 3P4PB 4XT1B 3TN2A 1NCVA 3GTLB 2W3SA 1G2TA 4F7XA 3NTHA 3GQBA 3TSSA 3EFXD 1KNAA 2L4NA 2J52A 3HOVB 3ITPA 1DOIA 3G6JB 3NVVA 5IODA 1CHPD 2ZXPA 1Q1BA 3I73A 2WXRA 1JOOA 1STAA 2CVRA 3I57A 5C3JB 2EVBA 2FBWB 2E75C 2EE1A 2WDVB 1QOHA 2Y5PA 1QILA 2B2UC 1CTMA 1FR3A 2PMVA 4PNYA 4LJZC 3GB1A 1S5FD 4JK1C 1H9SB 2A69D 4XYOA 2ONQA 5C0XH 1OQQA 2KOLA 3D4RA 3EUB2 2KQ3A 2LKVA 3TP8A 2F0FA 4ZK9B 1SSNA 1WTVA 1PRTD 4RGOS 2INNE 1ICWA 3Q8CA 2EYHA 1F77A 5EE3A 4CKEA 1OFFA 4Q5VA 3A54A 3VQIA 2EYOA 3FAHA 3KF8A 2JEAI 4XDCA 1TIID 3AMZA 2R7ZB 1LTRD 3CHBD 2HTME 2EYLA 3UI2A 1S5ED 5I9PA 4O1NA 1X3PA 2NVYB 3FMCA 1DOKA 1G91A 5BN4A 2NVQB 1SB3C 2VB3X 5KGUA 1Q1EA 2F0KA 2B8GA 5DM63 3WCQA 1II3A 3MVVA 1G291 2JE6I 3IL8A 2I38A 2BTEA 3TP5A 4V190 1QOGA 2PPBC 4K14A 4BBSB 4FF2A 4TRDA 2K01A 4C7YA 2WXOA 4XXEA 4GZYC 3TEWA 1FXIA 3FVQA 1PRTC 5F2DA 4ZUIA 2JSVX 1QOFA 1FD7D 4ZYSA 1VR9A 4HSPA 3Q8BA 3HRDD 3M3YB 2WXIA 1FCCC 4JBWA 2AX5A 1ZXIA 3BS1A 3KWVA 3S9WA 1GB4A 1AZQA 2LHDA 4K2LA 5JEAJ 3D3RA 5H8YE 2F0SA 3P63A 1E2WA 1JR0D 1PTOC 2NWGA 2D2CC 3AECB 2GA4B 3QWNA 2J7ZA 2W55A 1PLFA 2EY5A 2L11A 4DF7A 5C3EB 4HRSA 1LLRD 3MA2B 1TYGB 1YNNC 2K04A 3DWQA 5EPKA 3MFYA 1VJKA 3NUCA 2B2VA 2BW2A 2PTLA 4FO2A 2MJ3A 2F0LA 1KF6B 3EQLC 5DAUA 5G3LF 5M9OA 2FMMA 3L9AX 1ROEA 3R2IA 1X32A 3TEXA 1STHA 1FNVA 1HQRD 1NUCA 4KMUC 1HA6A 5JEAG 2F0NA 5ELBA 2F03A 1C4CA 3AU7A 1FM0D 2R3ZA 5ELDA 1CZPA 2C9OA 1WTOA 4IOIE 1FFVA 1CI3M 4K8IA 2KEDA 2PW5A 1O7YA 3SDZA 2SNSA 3KK7A 4KK7A 1PRTF 2K03A 2RVLA 3P4QB 3H8HA 3QG1A 4C7ZA 3KBGA 2IW3A 2NTTA 3RZDB 3UI3A 3AV8A 3W9CB 2B63B 2HUGA 2ZW1A 1TKEA 5M5XB 1PTOF 1B9RA 3I91A 1Y56A 3NVWA 1JB3A 4YTMB 2F0WA 3N52A 5CBEE 3E56A 2RBMA 1B2TA 3C2PA 4IUPA 4C3HB 1I4PA 4OO1G 3S2DB 4CJ0B 5GXGB 3E0JA 4L23A 3BDCA 4DFAA 3DM1A 4YIJA 1SYFA 3OPOA 1JROA 2SAKA 2AQ2B 4KV6A 4YT0B 3VYRA 3RFZB 1TU2B 1IGCA 2A68D 4B08A 4DNRB 1EL0A 1EWCA 5LL6X 1KLGD 2PW7A 3FDTA 4K5XA 2BA1A 1A6XA 2VNUD 1BMLC 1LO5D 4LK0M 1UWMA 4R8IA 1V97A 1BOSA 1FNWA 5IT9E 4BS9A 3AMUA 1SYBA 3J7AV 1VDVA 1Z6HA 3KLSA 5JXVA 2L5TA 4X3UA 1B50A 1HRJA 1WWTA 3FRPB 1TS2A 3HOXB 4A3GB 4FVMA 1IYVA 4XWWA 3JAML 4OZBA 1VZ7A 3Q8FA 2XWBB 2JYTA 2Z8LA 1F2YA 1E9MA 3J80L 2F0MA 5HHDG 4A3IB 3AE3B 2B2WA 3MXPA 5ELEA 2KUMA 5DM73 2IJ0A 1EY5A 1XXGA 2BDNA 4S3SA 4L2YA 4QF4A 2A68C 2WP8J 1EEID 2EYPA 2MJDA 4C3JG 5C4ZA 4A3JB 1GUSA 1A2UA 1GHJA 2A6ED 3RZOB 1YN5A 1J7AA 4OO1H 3U7ZA 1CT1D 1Y8PB 2FFKB 1QNUA 4R3DA 4ZHPA 1ZDXA 2W3RA 1TR5A 3MXNA 1PUTA 3AE1B 3I72A 1ZKOA 3BDOA 5C3XA 1K52A 5ELCA 2KJXA 1ZE3D 4OL7A 1OQRA 5HFYA 3I4LA 1DM0B 1JCKB 1C4PA 2WXHA 3EVQA 2A73B 3Q22A 1B1ZA 3PIO3 3DWGC 4ZKCB 1ENAA 1C79A 1E2VA 3S17B 5EKLA 4IUVA 3LWEA 4ZAIA 4ZLTF 5C5MA 1V8CA 1TKWB 1X3QA 1GJXA 1FNUA 1S5DD 5KRUA 3IAYA 3WOEA 2A6EC 3GTPB 1LTTD 2AUKA 4I65A 2PW9A 2F1MA 3LB8C 1LT6D 3O13A 5BN3A 1RFKA 5BYQA 3ZJTA 4OIJA 1I4RA 4A3KB 2A74C 2E2HB 1C76A 1VMPA 2WLBA 3MEHA 2MUYA 4FF4A 4BA1I 2O5IC 4KX6B 3K6OA 4NMZA 3WOFA 1FIQA 3T3NA 2JA6B 1R7SA 4PQXA 1EM7A 2WU2B 1L4DB 4RKBA 1A3UA 2NVTB 3SR6A 4WJWA 2F3WA 4XT3B 4DGZA 3S14B 5G5GA 3T56B 1VRAB 1PFMA 2O5JC 3VR6A 2ENBA 2ZT9C 2WKDA 3T53B 4A93B 2MH7A 4Q0FA 3GV6A 3Q23A 4H44C 1VZ8A 2WINB 1JORA 4B9WA 1V1PB 2E76C 1LV9A 3SK5A 3S2HB 1DOMA 1WSPA 2EZVA 2BCOA 1FMAD 4ZRPA 2NMQA 4NJCA 5BMHA 2PZUA 2NTSA 3ERQA 2L83A 3VYTA 4XE0A 1OXTA 1K8OA 1EWYC 1N63A 2RMMA 1I7HA 1KABA 1PRTB 3AB5A 1WXQA 1I4HA 1A3TA 3M7GA 4A6QA 1QB5D 1UEAB 1H9MA 2IPKD 2JEBI 4A8XC 3NSWA 2BT6A 3BK1A 3X3MA 1Y8OB 4CKBA 1TWFB 4Y7NB 4RNAA 4EQOA 3HP3A 3BIID 1PTOB 3EGRA 5H92C 4ITKA 3NBHA 5KYIA 1D5XC 4LAAA 2L9HA 3K0YA 4HN7A 2VZKB 3FPUB 3DUZA 3D6WA 3TBIB 4DAYA 2EJGC 4YSZB 1IYUA 3N9YC 4B0EA 3AH7A 4FXKC 2WKCA 1SXTA 5EPLA 5M5WB 1F2ZA 1R9TB 1DD2A 3FC4A 5FOBB 2CW0D 4KGTA 4HAEA 4TMAB 3D8GA 3BYYB 1STGA 4CKCA 5FO7B 1Z47A 2EY6A 3CRKC 1C48A 3QOLA 1SNOA 1HHVA 3X3NA 5J1ZA 2F0UA 1HZ5A 1RF2D 4J3OD 3FPPA 1L6VA 4B0MA 3J81L 4G4KA 1G6ZA 3A8IE 2K1BA 2MGSA 3MFGA 3LWUA 1GAQB 1IUEA 4HEDA 5EQ0A 2IGDA 2ID0A 2X6LA 3SVMA 3T51B 5JVH3 2JYOA 3I4MB 1L6UA 4XYQA 1Q12A 3M85A 5EE9A 1PDXA 1FGBD 3ZYYX 3B2FA 3RUZA 3RD4A 4AYBB 4G7OC 2I07B 1AYFA 2QKIC 1HPCA 4LMQD 1WRIA 4HCEA 3SXHA 1VDZA 4KN7C 5IGBA 4KKJA 5D7GA 1TVXA 4US8A 4OIKA 1PYWD 1QNKA 2Z1CA 1SYCA 3H3VC 3CQZB 3A8KE 3E5SA 1PGBA 3DEOA 3BVMA 2MHVA 2VUMB 3H0GB 2QEJC 1B9MA 5KIXA 1H9SA 2HDLA 2J42A 2FE8A 2M56B 2CW0C 4IUNA 3EROA 1CJEA 2HDMA 1LTAD 5D3IB 2EOTA 3S1NB 2F0OA 5EE1A 3KQ4A 2JX5A 5CGKA 4KN4C 2HDEA 1GOZA 1A3VA 2O2LD 5CV8A 3MXGA 2N55A 2AQ1B 1ZXHA 1T5EA 3NP8A 3NZ3A 5ISRA 4HMJA 3ZJVA 1MHXA 3MWYW 1PFDA 3PUVA 4C2MB 3TDQA 3NVYA 3C46A 3J7AF 1RWSA 1M8AA 3IAS1 1LT4D 4FF1A 2A5HA 5G3LD 2D9UA 1UGJA 1BO0A 3CRLC 4YWGG 1SE3A 5BMIA 3AE8B 4KY5A 2EJFC 2MJEA 2BOSA 4X3SA 4KTAA 3MTSA 2NN6G 2IWHA 1CM9A 1BDOA 5DEHA 1WD1A 3V96A 2DNCA 5C44B 2J4XA 1CZGA 2WAQB 2KDMA 4ULLA 1E0BA 3NUHB 5CV6A 4M8AA 2V4DA 4XQNA 1NI3A 1PMRA 2I2YA 4BBRB 1F9PA 1KRHA 4FF3A 1LT3D 1QQRA 3AEFB 4ZOHC 2OHFA 1KTKA 1SNCA 3VA5A 4F88A 3RMHA 3VRBB 1B4OA 3HEJA 1JE4A 1EU4A 2B2YC 2G9DA 2PYKA 1XLNA 1SNDA 5AFWA 1CQVA 1TWCB 4D2KA 2SNMA 4RKLA 3AE6B 4KD4A 3NWSA 1G8ZD 1PTOD 5C4XB 4WIPA 1BUIC 4WAFA 4RA8A 5C5LA 2VZKD 4J1MA 2CJNA 4MT5A 1F0ZA 2F0TA 4CBVA 1YNND 2YYZA 2Q8IB 1NEKB 3J9CA 1I50B 3JAME 2YEPF 2LY7A 1I3QB 1KLUD 3EJIA 1TKYA 5E3FA 2QMTA 1SSOA 4OVZA 3J80E 2K7VA 1DJRD 1L0VB 5EJWA 3E9SA 2B2TA 3MHZA 1VMCA 1WTPA 4QUFA 2EYFA 4BWGB 2CQAA 3GS2A 1EY8A 1SNPA 4TKOB 5I6WA 2EYJA 2F0EA 4ME5A 2YU9B 3V3XA 5I4DA 2NN6H 2LUMA 4O42A 1TY2A 5IGGA 5EBDA 4WH4A 4A3DB 1JWAD 4Z9CB 1EYAA 2DYMA 1L5PA 2K0PA 3AN1A 2N88A 3V05A 3K57A 1SBBB 2ICEC 5K5PA 4GLSC 1EY9A 3GTQB 2WP9B 2WQYB 5KNDA 3VYUA 4ZQ3A 2M0AA 1STYA 2FHTA 1U4PA 2K28A 5HURA 4Q2JA 2NUCA 2KAJA 1D6EC 3D4DA 2PZWA 2XRSD 1ET9A 2RKSA 2MEKA 2N9KA 4G57A 2KVMA 1LTBD 1VCIA 2R6GA 3RPFC 4ODGA 4RH6A 3KWLA 4C3HG 2XRQD 2L0CA 1WTRA 1MSGA 2NN6I 3I4NB 1SAPA 1QKZA 4QB4A 3PUWA 4MHEA 4PMCA 1EOTA 1S4ZA 3TEYA 3IT4B 3OIQA 2E2IB 3K58A 3B2GA 5D14A 1B3AA 2R92B 3OW7A 3HZXA 3OSOA 4TQ1A 2ON8A 1OO9B 2N9LA 1UNSA 1J9OA 3AM9A 1RKNA 5JJZA 1ZUD2 2EKIA 1I4XA 4NZLB 1PGAA 3VR8B 4UAIA 4J6HA 3K5LA 5LNK1 2C5CA 1F2LA 2KCNA 1HUNA 1YMHE 1BCPF 4RGTA 1I4QA 3NS1A 1D5MC 2LHEA 2ICIA 1MPEA 1GPXA 3TZUA 4OW0A 2PIAA 1IBXB 3WDNA 1A15A 3NTKA 2N7JA 1N60A 1AW7A 2WB1B 2GI9A 2E3TA 3PZ8A 3U52E 2F0DA 2PO4A 1C8CA 4IFDI 4RAUC 1BR9A 1E0ZA 3DXJC 4IZ8A 1TWHB 2B8FA 3MJ5A 2X69A 1PFBA 5EGTA 1BNZA 4DA2A 3DHQA 3U9OA 2JA5B 3ABVB 3EA6A 2D62A 1DOXA 3AE2B 1GUGA 2ZXOA 4DK0A 2E2DC 2B39A 2AUJD 5JEAH 1JWMD 1C9FA 1U9RA 3AE9B 5G5HA 5MPOA 3KUPA 1MD2D 4WURA 3IXSA 1EZ6A 4RGNA 2FINB 1YQ3B 2BS4B 3QB3A 3CKIB 3C8YA 3P7JA 3R3OA 1DGJA 3GO5A 5NUCA 5FLXL 3MXUA 4XIGS 4N58A 4WORA 1XCQL 3NXWA 3AB9A 2WXQA 1JRPA 3OOCA 4LTUA 3AE4B 2DN8A 2QDBA 2F3VA 1PZID 1T6BX 2IGHA 3C1EA 5CORA 1U4MA 4PV1C 3PUYA 1CFMA 2F0HA 4QUCA 2FUG1 1ZOYB 2IL8A 1EIHA 2B2UA 1Z7TA 2WACA 1TZOA 1W6JA 3M7NA 4RCNA 2NB0A 2OT2A 2K5DA 3OMCA 2WU5B 2F0GA 3OMGA 1EY4A 1QLBB 1WTXA 1RJTA 4BY1B 1FCLA 2MPMA 3TEZA 1HTLD 1QT9A 4KGSA 3J81E 5T1GA 1XWEA 3SE0A 4L63B 3S1MB 3AE7B 1SYEA 1P7FA 4WFN3 5JVG3