2SEBD

X-ray crystal structure of hla-dr4 complexed with a peptide from human collagen ii
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
235
structure length
217
Chain Sequence
SQPDPKPDELHKSSKFTGLMENMKVLYDDNHVSAINVKSIDQFLYFDLIYSIKYDNVRVEFKNKDLADKYKDKYVDVFGANYYYQCYFSKRKTCMYGGVTEHNGNQLDKYRSITVRVFEDGKNLLSFDVQTNKKKVTAQELDYLTRHYLVKNKKLYEFNNSPYETGYIKFIENENSFWYDMMPAPGDKFDQSKYLMMYNDNKMVDSKDVKIEVYLTT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title X-ray crystal structure of HLA-DR4 (DRA*0101, DRB1*0401) complexed with a peptide from human collagen II.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Complex (mhc class ii/superantigen)
molecule keywords HLA CLASS II HISTOCOMPATIBILITY ANTIGEN
total genus 67
structure length 217
sequence length 235
ec nomenclature
pdb deposition date 1997-10-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF01123 Stap_Strp_toxin Staphylococcal/Streptococcal toxin, OB-fold domain
D PF02876 Stap_Strp_tox_C Staphylococcal/Streptococcal toxin, beta-grasp domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.110 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 2sebD01
3.10.20.120 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 2sebD02
2SEBD 3DWPA 1JQYD 3R2TA 5ELDA 1YN3A 3OWEB 1MD2D 3MC0B 1JWMD 1B1ZA 1EU3A 3GP7A 1FD7D 1LT4D 2QEJC 1EU4A 3BZDB 1LT5D 1I4XA 2Z8LA 1BCPC 1G8ZD 2TSSA 1EEID 1EFID 1JWUD 1RF2D 5ELFA 2XNAC 1ENFA 1EWCA 1HQRD 1PYWD 1TS2A 1V1OA 5ELBA 4RGMA 4OHJA 1CK1A 1PTOB 1SBBB 1KLUD 5D3IB 2CHBD 1S5BD 1PZJD 1SE2A 1PTOC 1SJHD 2XRQD 4DXFA 1TS3A 4L63B 1ET6A 1CQVA 4ZYSA 1F77A 5ELCA 4RGOS 4C56C 1HA5A 5FKAC 1JWSD 3MFGA 1BCPF 1LTTD 2R61A 1LO5D 1SXTA 1D5ZC 1LTGD 1PRTC 1XTCD 1PTOF 2NTTA 3BVGA 1FGBD 1LT3D 1DJRD 4DXGA 1CHPD 1BCPB 1S5FD 1QILA 4RFBA 1S5ED 4RHSA 1S5CD 1LTBD 3R2IA 4L6TB 2AQ2B 4TSSA 1PRTB 1SE4A 1TS4A 5D3DA 1CHQD 1KTKA 1LTID 1D5XC 1L0YB 1I4HA 3TSSA 2IJ0A 3URYA 2AQ1B 3CHBD 3EFXD 1TS5A 4RCOA 1AW7A 1S5DD 4RGTA 3BYYB 5I4DA 2WV6D 4UDUC 4Z9CB 2RDGA 1ET9A 4RGNA 1T5XD 2IPKD 5FK9C 1STEA 3KLSX 1ESFA 1D6EC 1FNUA 4BWGB 1BXTA 1PZKD 3O13A 1LLRD 4RHRA 5TSSA 1EEFD 1TY2A 1I4PA 1PTOH 2J4XA 1HXYD 3DWAA 1PRTF 1RDPD 4RH6A 1GOZA 2QILA 1M4VA 1HTLD 1I4RA 1B44D 1LTSD 1L0XB 1FNVA 1SE3A 1SJED 1V1PA 2ICIA 1D5MC 4NZLB 5ELEA 3EA6A 2G9HD 1CT1D 1PTOD 2XRSD 4O1NA 3SEBA 1SEBD 1YN5A 1PZID 2RDHA 1I4QA 2XN9C 1RD9D 2AQ3B 3BVZA 3DWQA 4K6LA 1BCPD 1XXGA 1LT6D 3BVMA 1AN8A 1TY0A 3R8BA 1FNWA 1UNSA 1LTAD 2NTSA 1I4GA 1KLGD 3W2DA 1PRTD 3BYTB 1RCVD 2O2LD 1JCKB 1DYQA 3V05A 1YN4A 1JR0D 1UUPA 1V1PB 1LTRD
chains in the Genus database with same CATH superfamily
3DOWA 4GU2A 2GBJA 2WX1A 1GPXA 1CFMA 5ISRA 3CMAA 2MQHA 3MVVA 1E3PA 3OWEB 4IUUA 2JA6H 4C3HH 1KH0A 2OT2A 1MVKA 1V9JA 3FAHA 1QOBA 4FJYA 1EQVA 1PFMA 1G6PA 1AFPA 1BUVT 3H3VC 5EDSA 2K05A 2RR9A 3NXWA 1PDXA 3FILB 3M9BA 1I7HA 4RF0A 3PO3B 4PZ8A 2CCZA 1FXIA 4WRDA 3CCLA 3HOYB 4BBSB 1PFNA 1K28A 3GE3C 3W1SC 3KBGA 1AE2A 2WYQA 2GA4B 3GZNI 3NVVA 4RF1A 5KNCA 2QCZA 3W5UB 1W6JA 3RZDB 5C0XI 3C8YA 4KJOA 5J1ZA 5LMUL 1SMYD 4HJ8A 4NPNA 4E71A 2F0EA 1CQVA 4A20A 1KFYB 4JL9A 2WXQA 3A4SC 5ELCA 3RUIB 3DEPA 3GV6A 5D14A 3N1XC 2HD5B 2INPE 5LMNW 4KIKA 4EQPA 1NJIC 1O7LA 1L6UA 2SNSA 1EIGA 3FVQA 3ZW3A 3AE4B 2LGDA 2FE8A 1WR6E 2QGQA 1E7VA 2PTLA 3PZ8A 3U4EG 2KEDA 3QK0A 3FKIH 4DV0Q 1IBLQ 1TWAH 2CVRA 1L5PA 2W54A 1PTOF 3A8IE 2RPVA 3SK4A 3TMPB 1YIWA 1GUSA 4XC2A 4MZ9A 4LF8L 3Q8CA 2KHJA 4A3LG 1SYCA 2F0LA 1XF5L 1DOXA 4IPCA 3MXNA 2UUAQ 3I4MB 2B2WC 3KUZA 4X66L 4B0MA 4IOAA 4A3MH 1WXQA 1ML0D 4XDXA 2WDRB 3GTLH 1Q3LA 2YV5A 2K28A 1JW9D 3OLMD 1UEAB 1C9OA 1X3EA 5GADC 3I91A 4BKTA 4YSXB 3GTMH 1BDOA 2MLBA 1L1OA 5IT9E 3KLRA 1K0SA 5AUIA 3QO2A 2KANA 2MBEA 3ZDMC 3I57A 3S15B 4HMJA 4A93G 1X56A 3ETRA 3NTIA 2RSUA 1B9NA 1T5XD 2HTME 4I7AA 3LB8C 1IGDA 3FHWA 1D6EC 2MO0A 4PMCA 4DR4L 3EC8A 4A3EH 3X3NA 2WXKA 1SNOA 4LW1A 3TQYA 4HPLB 1BXTA 1GUNA 3GTJH 4JI5Q 1WMHB 2CHWA 5D94A 3UF8A 2REXA 4JBMA 4LF6L 4OXPA 4AIMA 3SK6A 5IYCH 2ES2A 3P2BA 3FKIG 2ACZB 4P6VF 1HXYD 2Z4HA 5KIXA 1TWCB 5IGEA 2B2TC 5M3FH 4ALPA 4FXDA 2VH1A 2IL8A 1B44D 5CV7A 2PKOA 3Q3JA 2PZTA 1SYEA 3PO2H 2QJLA 2M4NA 3N1ZC 5BR8L 4KHVA 3NZUA 2EY2A 2VNUD 2YVCA 3RZWC 4X3UA 2BE5D 4IW0A 3EUB2 3VDZA 3V6CB 3N1YC 2JQRB 3ZJYC 5J39A 1OXTA 2I07B 4YIJA 4A3MG 3A9KA 3H94A 1X54A 2F0DA 4A3FH 3L0WB 2EJMA 2JK8A 4JI1L 4KN4C 4S0RA 3S2DB 1KD1C 1BBXC 4LF5L 1NMFA 3ZJTA 2NTSA 2C60A 3W2DA 1NTGA 1QOFA 2EE1A 3TS2A 4DHJB 2JE6I 5FO8B 3ZTCA 2F0IA 3ZYYX 4R4IA 4ZRKA 2EYLA 3RD2A 3VAWA 4AQYQ 1RODA 2KXJA 4HROA 4JWSC 3LWUA 4J6IA 3A4RA 1XMQQ 3RFZB 2N1WA 5G3LF 1LXDA 4HPMB 1J19A 1TIFA 2N0SB 3ZUNA 3MAQA 1R9TB 2K6AA 2DJFC 2A19A 2KYWA 2O2VB 3NUHB 3PV0A 1P3QU 1SLJA 4ARIA 4JI1Q 1FRDA 4KDIC 3T3OA 3C0RB 4HN7A 1VQAA 3L2PA 1F52A 3K7UC 3IAYA 4LF9L 1L2NA 2RSOA 1IBLL 5GAEC 1SGHA 1TT5B 3F1ZA 1KQSA 4PMBA 4R9WA 4DDID 2WXIA 4HKZE 1SYGA 1QUQA 2EY1A 4L63B 3SR1A 3PF4A 1I6HB 1EL0A 1C77A 2J42A 3O65B 2KVMA 3TP6A 3PLUA 4LTUA 2BOSA 1SNDA 2PMZB 4KN7C 2LMCB 3UI3A 1BCPF 1I50B 3MXNB 3PHWB 2L83A 5LL6X 1C79A 4LNFA 3DUZA 1Q82C 4IOIE 4LNQA 3KUCB 4B3ML 1NYRA 1JORA 1PRTC 1U4LA 4BBRG 3HOVB 5DPTA 4KSLC 2E3TA 5I6YA 2K8HA 4OONA 1HZ6A 2CJOA 1YNJD 4Y7NB 1TT2A 3L3OC 4DU9A 2TMPA 2JX5A 2BT6A 3JAML 1WZ3A 4X65L 2K8CA 5C1ZA 2K25A 4M8NA 4C4VB 3NTKA 5D3DA 3PGZA 4C3IH 4BKSD 2PCFB 4YT0B 1LTID 4OO1I 4QY7A 4DR7L 2LZ6A 2AQ1B 3AULA 1Y1VB 2N55A 1DXMA 4M1UB 3KFUA 3GTKH 4ZHPA 1EF5A 2XBBC 4GOCA 3W1GA 3BYYB 5IGDA 1EY4A 4MTNA 2EVBA 1N32L 2QIEB 3TEHB 1NMGA 3GTPB 1XLOA 3J81E 1WM3A 3Q8AA 4W9IA 1F2LA 5FK9C 1SFOB 3ND8A 5I6WA 2K03A 4DV0L 2N9KA 1KAWA 2KHSA 5FR6A 1WCMH 1TJEA 5CMDA 1KDAA 2LGIA 1E22A 1SYBA 2F0PA 1WY8A 1ZDXA 1PRTF 4DR2Q 4HR7B 2JU6X 1FRRA 3HKSA 2NVTH 4XE0A 1CM9A 3KYDD 2I5LX 3DMUA 3Q6BA 3EA6A 3AEDB 3S1RB 3A56A 4N8X1 3DBRI 1CT1D 4BY7H 4WJQA 5NUCA 2Q8IB 4ME5A 1PH2A 3H8HA 1FJGL 2XK5A 1WGKA 2FXQA 3PTFC 2IY0B 4TKNA 3HIZA 2DZJA 5CV6A 2JT4B 1NAPA 4DK5A 4DV6L 2N88A 1J8IA 4DV4L 4IUQA 1E7UA 1TVXA 3T1YQ 4DQOC 3PSEB 5EE9A 3CMMB 3RCZA 4RG1A 4BBRB 4P74A 1KRHA 3EHVA 4HPPA 1MI2A 5EBCA 4JI5L 5DM73 5M5XB 3F2DA 2GBRA 4NXNQ 4WJWA 1ROEA 1B1ZA 2O6VD 1SNCA 4KHPQ 4G3XB 1BNZA 4DR3Q 4A3DH 3WANA 4GS3A 3DWPA 1IGCA 1HCZA 2PVGC 4A3JG 1CKMA 3ZNHB 3GTLB 2KDBA 4OZAA 2M00A 2G5DA 1DONA 3CQZB 4YWKA 2EKEC 4KSKC 1EFID 2IWHA 1OQYA 3HKZE 1XEEA 4HWIB 1DOIA 4H7BA 1HQRD 1FCLA 1YBYA 1CK1A 2CKZB 2JA7H 2KNBA 1XPUA 1FPYA 4GN5A 4LWCA 4HEDA 4OX9Q 1SE2A 1V1QA 2HQEA 2NBUA 3WOFA 5M5YB 3BIID 3U4VA 5AJ3Q 3TMEA 4A3PA 1N5XA 1B8AA 3ZNZB 4DHZE 5C3EG 3FKYA 5M3FB 4RGOS 3R3MA 2VS1A 4MGYE 1E0ZA 3UDIA 4LUVA 2KQ3A 2VY3A 2JQOA 4CJ1B 5IY0A 3K7AH 4A3DG 3PO2B 4HDOA 3NTHA 4F88A 2R61A 2R93G 3V2TA 4NAWB 2F0UA 4J3OD 4NJ7A 3AN1A 2X69A 4MH0E 4L5RC 3OIQA 4ARCA 2VQFL 4DDGD 1XTCD 2MRPA 2NTTA 1QUQB 2K04A 3HOWH 3BVGA 1E2WA 3G4SA 2C9WB 4JVZA 3RZFA 2MW5A 4TQ0A 1KOTA 1ZEQX 1V8CA 4R8IA 2A68C 2EJGC 3ECIA 2Z0DB 1ZPSA 3AEBB 1SE4A 1SNQA 3BZCA 4J8QA 2IO2B 3DVGX 4KGRA 2PO4A 2JPHA 5C3EB 4W9FA 1IPGA 2PYKA 4A55A 3Q6SA 1HQMC 4B9XA 1VQ6A 2KDEB 5D2MB 5LMNQ 4A90A 3KWLA 3F2UA 3AE6B 5T8IA 4NP5A 5JVG3 4ZK9B 4N9TA 3MXGA 1GHJA 4C3JB 1K3RA 2GBNA 1VQEA 1ILPA 1CZWA 3KLSX 3FRPB 3NY5A 2ZTEA 1Q81C 3DVGY 5J2RA 1HFGA 3PQIA 5BYQA 3NS1A 1ILQA 4AH6A 2F0SA 4DR5Q 2AUJD 2KFKB 3RMKC 3NSWA 1A2UA 5EKIA 2VXWA 1M4VA 1M90C 4GNXB 2BB6A 2YLMA 3APCA 4PYUA 4FF3A 1V1PA 5LXHA 3HEJA 2KOXA 3P1MA 1L0VB 4DUYL 1Y8OB 4N8FA 4GDLB 1I6HH 1XNQL 4DV2Q 1XMQL 2KMAA 3AB5A 4DK0A 4NJ6A 3G6JB 1V80A 4A3CH 4JBWA 1HHVA 2A5UA 3PGEA 4JI7Q 2HDEA 4FXGC 3ULLA 3QCAA 3HOZH 1HRJA 2D07B 2KAJA 3AB9A 1BCPD 3OSOA 2KLCA 2JA7G 2HDMA 3A8KE 4OELB 2NVQH 3HK0A 3BVMA 5CV5A 3TN2A 1LFDA 2ZW1A 4MH8A 4I65A 2LEKA 1SN8A 2K4KA 1YHBA 4L5TA 4NMZA 3C2PA 4IG7B 5HG2A 4YY3Q 1I4GA 4AYBE 3Q14C 3Q23A 1E8ZA 1SIFA 4PS8A 4GN1A 2AWOA 3OOCA 2IYDB 3U4ZA 2N7DA 4TV3A 2Z1CA 5JOBA 3T51B 1XPOA 2K9XA 1IKMA 3B2FA 1PYSB 4KD4A 3GDEA 3EQLC 2I1KA 1X3PA 3I8ZA 5KHOA 2JF5A 2GVAA 3M4OH 3BZDB 3P4SB 1F9QA 3JAME 4FHKA 4QAYA 3LDZE 1NR4A 1Z2MA 5HGTA 4EZKA 2B63H 1J8CA 2LY7A 1JWUD 1WRDB 2JEAI 5A35A 2K6DB 2IHEA 1WTXA 5GMVA 5C0XJ 3W5VB 1BQQT 1PYWD 2GBMA 4AWJA 3GTPH 3STBC 4QUCA 1PTOB 3WWVA 1TWFB 2X6LA 3U2SC 2QCPX 4N58A 4A93B 3PHXB 1UE5A 5FLMG 2DYOA 3IT4B 3CRLC 3UDXA 1G2TA 2WB1G 3HOZG 1BT0A 2ZPYA 4A3JB 4FP5D 3J81L 1WCMB 2JZZA 1YJJA 3HVDA 4FF4A 3EIVA 2B2UA 3PS6A 1HR0Q 4B3RL 1F1HA 2BVCA 4KI0A 1E24A 2JWZA 3L7ZC 4AP4C 2EPBA 4I6LB 4GZYC 1IBXB 1HE8A 3TEWA 4U673 2EMTA 3KUPA 1ZKHA 2IW3A 5G2NA 4XQJA 4KY5A 1J9OA 1OXUA 3A0JA 2OJRA 4PNYA 1BBWA 3HG9A 1IBMQ 3Q3OC 5C4JH 3A55A 4QMGA 2KDFB 5C23A 4WAFA 1T0QC 1I3QB 2CJNA 4JI6L 3VRBB 2EXZA 1NEKB 2QW7A 4IJLA 2ASQA 4F7ZA 1FR3A 1EM7A 4DBGA 1EIFA 2NB0A 3WCQA 2SNMA 1YVCA 4BAXA 3FC4A 5C5MA 4BBRH 4BZAA 4DXAB 1VZ8A 2ZM6L 4TSSA 4K0KL 4DHJD 3MA2B 2HCIA 1EYGA 2WLBA 1YNXA 1S40A 3TIXA 3ENEA 2BDOA 1PVOA 4JBJA 1QZHA 3RNEC 3VA5A 4C2MB 4JIOU 2RSNA 3PUYA 4A3DB 2GI9A 3V61A 3IXSA 4KMUC 3A5UA 2DZMA 1STAA 4R3DA 1QB5D 2AL6A 1SNMA 1OQRA 2NVUI 4CJ0B 5IYDH 3DVNU 4CGYB 1M1KC 1IXRA 5AZHA 5JJLA 2D0PA 3LGJA 3QB3A 4X3TA 5JEAH 1N36L 4A9AA 2KHWB 1PZKD 4LF6Q 3H6MA 2G45B 2A5HA 2IGGA 2UXBL 2K5DA 2OXPA 4CDCC 1EEFD 2VH2A 1RLFA 1ASZA 4US8A 4WWOA 2JA9A 4XT3B 1FFUA 1RDPD 1GOZA 4I6PA 1S72A 5JH5C 2D3CA 4H44C 1JMLA 3V6EB 3RN9C 2LKVA 5M5YH 3OW2A 4GNXC 1N33Q 4W9JA 1OXSC 2A6HD 2PQEA 3KH0A 4EX5A 3NG0A 3H3VI 1Y56A 4C7YA 3NOBA 4B0EA 1SEBD 2AHOB 4AYBG 2E2JB 1YN5A 1YJIA 1JQ4A 2K5PA 1GG3A 1RD9D 3TUOA 1KRTA 1GVPA 4DAMA 4DAYB 1FEHA 4JG2A 1P1AA 4ITKA 1KC8C 1VF5C 1U5KA 3QAQA 4HJGE 3V60A 5I9PA 4KX6B 1PH5A 1GM5A 4EE2A 1TY0A 2V1CC 4CDFC 4LDTB 4FYDA 2DBYA 2K50A 5C44B 3QJYA 1R4MB 3S14H 2JA6G 4PZ6A 3I3TB 4II2B 3DWGC 2OOBB 1JCKB 2B3AA 5CORA 2N49A 3P63A 1N33L 4WJOA 4WJPA 1MSHA 2ZXOA 4DNRB 4J1MA 2J0KA 2SDFA 4FO2A 1F2ZA 4HJ7A 1A6XA 2EYMA 4HXDA 3DCGA 3PO2G 4QL5A 1ACCA 3T4AC 2IDYA 3T53B 2EXDA 1HTOA 4EOYA 1BBUA 3CW2C 3C1FA 4BY1G 2GBKA 4E6IA 2IGDA 1MPEA 2IO3B 3H1UA 1ENFA 4LJPB 2F0MA 4W9EA 3S2AA 3ZTDA 1IYFA 5KGUA 1D4BA 4Y52H 1SDFA 2D3BA 3QG1A 1ZOYB 4JI7L 1RRBA 1WSPA 4WQOB 3FMCA 3OW7A 1CMXB 1T5EA 4LF8Q 2V3NA 4B6WA 4FA6A 4GN3B 2XRQD 1Y14B 2CQOA 3OAWA 4DA2A 4ICVA 4K5XA 4X3KA 3SHLA 4DV3Q 4ANWA 3HOWG 2DUDA 4JYAQ 1QCBD 4L23A 4MELA 4WWNA 2AEHA 4NY0A 1UAPA 4RWSC 1VQOA 2MNAA 4C3HG 5DPSA 3TEYA 2DY8A 2KVZA 1X9NA 1CKOA 4NW2A 1HNZQ 1TWHH 2EYHA 1C1YB 3R66C 3KLWA 1PLFA 3PMFA 3M3YH 2KJ6A 2ONQA 3P75A 5A2QL 2UU9L 1JWAD 3M4YA 1BMLC 4AJWA 5HI1A 2WAQB 4ZRIA 1TZOA 3B6YA 1B3AA 2OQKA 2GLSA 3L10B 3MFYA 4KK7A 1CUKA 2CWAA 4LNKA 4GDLA 4DV3L 4MDKE 3U8ZA 2A6EC 3HKZG 1SR3A 4E3CA 3UDGA 4TRDA 2R7ZG 3F2BA 4POFA 1FD6A 2B2YC 3R3OA 3L13A 2O6VB 1OEYA 5E7NA 1TKYA 3EFXD 4RCOA 5M5WB 2OHFA 3PO0A 3X23A 4DWFA 4KKUA 4RGTA 4FLHA 4WWMA 4ZHOA 1UEBA 1V8QA 1PGAA 2KTRB 4B3SQ 1IYUA 1RYJA 2KK8A 2ZCBA 3PRZA 3T1HQ 1IL2A 2IY5B 1YMHE 4KHZA 4JV5L 4ILWA 4IFDH 4HDQA 2D5GA 2WXNA 2NZ1D 1PTOH 4FDBA 4IUVA 2XIWA 4YY3L 3Q2AC 3NBIA 4ANUA 4TQ1A 4H02A 2QILA 1XNQQ 3VTWA 1EY0A 1GUGA 1SYDA 4NZLB 2GVBA 2IX0A 4A3JH 1WYWB 2MBQA 1Z9FA 3D0FA 1E8YA 1Q12A 1SMXA 2J0TD 2NR2A 4NNJB 2MWSB 3VYUA 4DR7Q 4HCEA 4ZKBB 2OEOA 1SSNA 1WH3A 1IW7C 1I4QA 4V0BA 4K6DA 1IUEA 3DWQA 1VZ7A 1FYCA 5JHAA 1STBA 3J7AV 3RNAC 1TR5A 1TXYA 1J7CA 3ML9A 1YQ3B 3K59A 3NVYA 3SXHA 3SE0A 4QJFA 4LCDE 1NYQA 1JICA 5H8YE 2Y0SG 4DR3L 3AE3B 3LX0A 1F2MA 1K9MC 1B7YB 2UXCQ 3AE7B 4JI3Q 2SEBD 2PW5A 1UZXB 4CKBA 3Q24A 1KDBA 1LABA 2RKSA 2NBWB 2WWZA 3PF5A 2UU9Q 4M0WA 4HSVA 1GAQB 5CHFA 1VF7A 1Q0WB 1G8ZD 3RR5A 1EEID 1WOCA 3PIOA 1XPRA 3M7NA 2ZVOA 2HE7A 3QC8B 1EOTA 3JSVB 4WJNA 4WIPA 5C3XA 4HJ9A 3I4LA 3QR8A 1K53A 1K8GA 3Q8BA 5TR5A 3AXCA 4J15A 4RA8A 3S17B 3BG3A 5IT9L 2OCEA 3H15A 2NUCA 1WFYA 2V9HA 3SVMA 4H2AA 2CHBD 4OVUA 2O6VA 4JC0A 1K50A 5FR3A 3M85A 5HKHA 2QDBA 2VZKD 4ZRQA 1UE6A 2N8NA 2D2QA 1C4QA 3NPPA 1UE7A 2E76C 1WJ4A 2K3UA 4D2KA 4WFN3 3A74A 1T9HA 2YU9B 5E4WC 2ZEQA 1WWTA 3N6RA 1QVFA 2GOWA 4RCNA 2YEPB 3NHHA 2NVXB 5IOCA 1N63A 3HM3A 4YCUA 4YL8A 4ANVA 3NUCA 1FGBD 3PT2B 1FL0A 1FVIA 4HIOA 1A70A 1DJRD 1WRIA 2F0JA 1NDDA 2ZM6Q 4ID6A 3V96A 3MJ5A 2MJ3A 2L1BA 1MJCA 2KCTA 1MGSA 1R4NB 1EIYB 2R92G 4M01A 3VR3A 2IO1B 4KGTA 3PIPA 1VQ7A 1WGYA 4FULA 1TKGA 3FP9A 1DD2A 1A2TA 2F0OA 1V2YA 3DWMA 3V62A 1A5RA 3NQIA 3GZNB 3URYA 2RBMA 4ZLTF 4OZBA 1TS5A 3K80C 3ND9A 4YTNB 5I4DA 1OXVA 3K57A 1VQGA 2L12A 3CAMA 2N4FA 3ZRCA 3A7AB 5DLQE 1WVLA 1EWYC 5I9OA 4DV1Q 4ZDVA 5BMHA 1JB3A 2KACA 2HQLA 4XWTA 1Q90A 3RPFC 3ZNID 1TBEA 4RHRA 5BO4B 3J81i 3CCUA 1G91A 3G6EA 1Q1OA 4P2CB 2KENA 3RYTA 4HAEA 1VQDA 1RM6C 3SR6A 3UQAA 2HHHL 2MSED 3A33B 4A3KB 4LF7Q 5JJZA 3EFUA 4DR1L 4JX1C 4CHKA 2QA4A 1WGGA 3MHZA 4FN2A 3DHGC 5J17A 4A6QA 2A6ED 2D10A 3IKJA 3PVLA 3NELA 1FCCC 2XN9C 1FFVA 1VLBA 3ZNGC 2LXCA 3Q3NC 5T1IA 5FLMH 4N59A 2Z6BA 2AKWB 2WINB 4K7UA 1CA6A 3I3CA 5M9OA 3M3YB 3EVQA 3HFZB 2KWDA 5CV4A 4F1SA 1GKHA 1HZCA 1WGRA 3OPOA 1YN4A 3I5JC 4LLGM 4X66Q 4BXXH 2LMCA 2KJHB 1H9SB 4ZUIA 3HOUH 4L8JA 4KY7A 2D0OA 4KLKA 3CPWA 3I4OA 4DR5L 1GUOA 2H4OA 2WDQB 3S1NB 1CKNA 2E2DC 2MBOA 3GP7A 2PVOD 1AARA 2PZUA 2KC2A 1IL8A 4S17A 3BK2A 2FFKB 4BOZB 2FNJB 3K0YA 5ELBA 2Q2HA 3OTOL 2RMMA 4MIUA 4F87A 2RD0A 2PE9A 2O2VA 2F52A 5G5GA 1WZ0A 2F03A 3LXFA 5DCNA 2DENB 1VQBA 2WXOA 5CX3A 5CBAE 1R4NI 2A68D 2F3VA 4HK2A 3W1YA 3MZ5A 2KDMA 2FMCA 1Q8IA 1Y1VG 2BYVE 1DOLA 3JC66 4MTKA 4DV1L 2MEKA 1NI3A 2B39A 2ZT9C 2M1MA 4IN3A 1LO5D 4XDDA 4ZOHC 3KF8B 2ZZPB 3W9CB 1VQCA 4A3EG 4MACA 1F9SA 4MT5A 2KA7A 4JOIA 5KRUA 2DY7A 1B70B 3TP8A 3VH4B 2MBHA 2AWNA 4DV7Q 1WIAA 1YEZA 3TZDA 4LK0M 4AQYL 1S5ED 4PV1C 3GTOB 3DHQA 5BYSA 2B2WA 3TRZA 3ER0A 2WXHA 3GTGB 3NJTA 4AS1A 1RJTA 1K0RA 4C3HB 2OEDA 3U7DA 1VS0A 4IWPA 2CH4A 4N9PA 4BBNF 4UY8C 2UXDQ 4X62Q 4HCPB 2CU1A 1O7IA 4X3SA 2JXTA 2F0TA 2F0NA 2Z9HA 3N52A 1V6EA 2L52A 4P16A 2R7DA 4G57A 5FOBB 1ET9A 2OWOA 1STEA 3TS0A 4DKAC 1L7YA 2NVYH 1WD0A 3PIO3 3RZDH 2KUMA 3S2HB 2NN6I 1Q86C 1WJ6A 4K8JA 4EQ5A 1TY2A 3KDFB 3SK5A 2MA9B 4JW0A 4DR6Q 3ZRFA 1K51A 3WAPA 3K9OB 3QHTA 5G5HA 4S3SA 1MHXA 5GROA 4M00A 4LK1C 3GS2A 3HHMA 2N7JA 2PMVA 5EKKA 5ELEA 2IBIB 1I94Q 1QNKA 3OHXC 2JXXA 3TBIB 1PTOD 3Q0AA 1TKWB 1ZXTA 2JEBI 1Q10A 5IGCA 2DZKA 3AE8B 1TWAB 2NS5A 1PZID 2PQAA 3RNGC 1B9RA 2OQ0A 2R7FA 4P75A 3J7ZC 3R93A 3TZUA 3BVZA 2YU9H 2QKIC 5BR8Q 2IY1B 5AUKA 2MHVA 4K6LA 3PZ7A 4LUZA 4TKOB 2NVXH 1QWYA 2HD3A 2BYTA 1ICFB 3CXCA 3R8BA 3NWSA 2E2HB 4A76A 4OO1H 4A3MB 2KVRA 3BYTB 1PH3A 4FF1A 5CHWA 2JJQA 2BH8A 4BOSC 2Q2IA 2XEWA 1SIJA 3BZKA 2JA5B 4K7SA 3GTMB 4W9GA 1J6QA 4JI4Q 2BWFA 2LD9A 1JQYD 2OTLA 4LF4Q 1FXTB 1GC6A 2JYTA 3P42A 1UBIA 3E56A 5M3FG 2O4XA 2QEJC 3FPUB 1PH1A 3RNFC 4HVBA 1RL2A 4R4QA 2WDVB 5ELFA 2KHIA 3SK8A 1D2BA 3CWIA 1M94A 1SF0A 2KWCA 4HCSA 4OWXB 3AH7A 2K7VA 5CTRC 1YNTE 1X32A 4KY6A 4BKSA 2PNHA 1S5BD 2K5NA 5C2TB 4XYOA 1N8RC 3AMUA 1TIID 1R4MI 2B8FA 1WYDA 2PE6B 1QVGA 2Z6KC 3EROA 1S3OA 5JHBA 2C7NB 2C5CA 2Z0SA 4ZYSA 1UE1A 2AWTA 2K0PA 2A74C 3Q22A 2LRWA 1QT9A 3JW0X 1A63A 2JYEA 1LTTD 4UAIA 2ZNVC 4A3FB 4R8NA 4YSYB 1RTOA 3A8JE 3L16A 2EDGA 3AU4A 1D5ZC 3D3RA 1F0ZA 2A1AA 5GAHC 1E2ZA 2PPBC 2CH4W 2M19A 5J18A 4DV5L 4IALA 2KFKA 4A3GB 2RPQA 1WFQA 3J80i 1CHPD 2EELA 1A15A 1VQKA 4NPSA 3AE1B 1PH9A 4PT5A 2KLGA 3SDLC 4PK1A 2ZJDA 1PV4A 5F2DA 2SAKA 4IZ8A 1CA5A 1QLBB 3I72A 2MP1A 2ATWA 4K5WA 1KRSA 1VDZA 3BINA 2MCNB 1VCBA 5LMUQ 3BK1A 1R9TH 1PQSA 1EUJA 1JT8A 1TKEA 4W9DA 1KAAA 3HUIA 1I6VC 3RN2A 3DDCB 1AW7A 2LGSA 3X0WA 3NZSA 4GLVB 3W5OA 1VQ5A 3D31A 3D32A 2G1EA 1IP9A 1J0GA 4ZUJA 2F0QA 3S24A 3ZGZA 1SMYC 2WIIB 1QZEA 3DM3A 2PPHA 4R1JA 3AE2B 1JROA 4EFOA 3DWAA 2HIXA 1FJGQ 4GLXA 1KF6B 4JYAL 2OJWA 3J80c 1L0XB 3QOLA 4FNFA 4BA1I 3BWUD 2C5LC 2LVQA 1C48A 1WTPA 2QEXA 3IRBA 4JOIC 1I35A 2OF1A 2BQQA 3NVWA 1IHZA 5AEKB 1GB1A 3GTQB 4QUFA 3J7AF 1G6ZA 4JI8Q 1H95A 3ONSA 3PSIA 3T13A 1XLPA 2AQ3B 4MHEA 2FCQA 2ZW0A 5IYBH 1Y8PB 1EQRA 2LFNA 4GKKQ 2K5VA 3VR6A 4Y7NH 5E1FA 2HUGA 3TL5A 3T56B 1XMOL 4LF5Q 1MJDA 3T1HL 3Q3MC 4GLSC 3ML8A 3DBHI 4ABNA 2EYOA 3E6ZX 4P1CC 4B3SL 3CC4A 1XLQA 3TBLD 4YSZB 1YD8U 1G6JA 4JE3B 2FUG1 4C3IB 2F1MA 1YX6B 2MP2B 4YWGG 1JALA 3U9SA 1HR0W 1Z6HA 3GTOH 1IBKQ 2WP8J 3H9DA 1F9RA 1KABA 1Y1VH 3CCVA 2P5ZX 4I7ZC 4DAPA 1V43A 1V97A 3IFTA 1XX8A 1XCQL 5EE3A 2MX2A 2JSOA 5JZEB 1LACA 2R3ZA 3G71A 1SFOH 3OG5A 3AEFB 4DR4Q 3TEZA 3DEOA 3LNNA 4HMIA 2E5LQ 1KNAA 3H7PB 2WXGA 3S9WA 1VQ4A 1SB3C 1SBBB 3U30A 2L0TA 1C8CA 4HLEA 2NMQA 3AEVA 2BS4B 3VYTA 2NVTB 1PZJD 1E5WA 3NQTA 3S2HH 2LS01 1FO4A 3KYCD 3UGBB 2JN4A 3S1RH 1WTRA 1JRUA 1KJTA 5DPRA 3NRZA 2N3SA 3QA8A 1HNXL 2I1JA 2BCOA 2VQFQ 4IO9A 5FKAC 4CDEC 1JRPA 1HJPA 2AL3A 1YJNA 2L15A 3E9SA 3AM9A 1ISNA 3GO5A 1IBXA 3P4PB 3ZKJC 1SYFA 2EY5A 2ZXPA 1EY9A 4JCVE 1WJNA 2BW2A 4AQ7A 4WORA 3V3XA 3LWEA 4IPDA 2KWVB 5FJ8G 3ZIMA 3CPFA 5DNFA 1MFWA 3MXUA 3QX1A 2ZNVB 1LUZA 1YJ1A 2Q2UA 3R2IA 4DK1A 3UINB 3CP0A 1R7SA 1JWBD 4H13C 2C9OA 2M2LA 1KTKA 3QWNA 4PG3A 5FLXE 3TSSA 2INDC 2WACA 3CQZH 2JA5H 1GUTA 1GXDC 2CFMA 3EN2A 4B3RQ 4GGQA 4WWPA 3QARA 1VRAB 2Q8RE 3P1HA 5IYCG 3TCAA 4C1NK 4ZCKA 2R7ZB 4UP7A 2G4SA 2HJ1A 4N9F4 4K2LA 4RGNA 4C80A 1SE8A 3VTUA 2EOTA 3ALBA 1SE9A 1X55A 1LGRA 4C7ZA 1S4ZA 2R93H 3K8AA 1K8OA 3A9JA 1EYAA 3VYRA 4TVAB 4M0WB 3TEXA 4BXXG 4A3GG 4JI0Q 1ZE3D 2L11A 1U9RA 5C3JB 1QOGA 1H9JA 2HHHQ 2Y3AA 2K52A 2M0XA 4FHJA 2PEAA 3H3VH 1XCTL 1UF0A 4BS9A 5C4ZA 2KN5A 3H09A 5AZGA 2WXFA 4U68A 1HEZE 1V49A 2DHZA 2M9VA 2CU3A 2EY6A 2NZHA 1NENB 4L5SA 2BH2A 2ZTCA 4IUPA 2FAZA 3IHPC 1N5WA 3I7FA 3HOWB 2WGSA 4OO1G 1YNJC 1WXMA 1YQ4B 2KT7A 5LNK1 1Y1WG 1EUVB 1XXGA 3BJUA 1A8VA 4FVMA 1LT6D 2G9DA 3KOJA 2L32A 4ZYNA 1UNSA 1JE5A 3E9IA 3AEEB 3BS1A 3RLFA 4A3GH 2LXAA 4K0KQ 3UQBA 4DF7A 5C3EH 2FCSA 2W3SA 2Z4IA 3DHHC 1YX5B 3QJZA 4DR2L 3C46A 2PI2A 2A69C 4OL7A 3KYHC 2UUBL 2PW9A 4KKIA 2JXMB 2FIFA 1N32Q 2ZPNA 1K8AC 2VUMG 3ZXRA 3ERSX 1KL9A 4XX5A 3A9JB 2K75A 2KQSA 1ASYA 3T16A 2NYZD 5CHVC 1WXSA 2RCNA 4CBVA 2EYJA 4A3CG 1VQMA 4JI8L 1NR2A 4LFAL 5D3IB 2IHFA 1EQTA 3L17A 3VXWA 1ZYRD 2WU2B 1OTCA 3N32A 2CQAA 2B29A 1Y1WB 5K36H 4LNIA 1SJHD 4HEA1 4DR1Q 2WX0A 3Q8FA 4BVUC 4XIGS 2LXKA 1F77A 2HIVA 4W9CA 4ZRJA 3FEWX 3MEHA 1XTDA 3CC2A 1JWSD 4B3MQ 1UGMA 4GMVA 2E8GA 1GUAB 2MGSA 3I70A 3RNBC 2WB1B 3HOZB 3WA0A 4KD3A 4HSPA 1KNEA 4XT1B 4XYQA 1SXTA 3EFCA 3KWVA 2NVQB 2K5WA 2I46A 1GD7A 3CCJA 4M02A 3ZXVA 1KDCA 2B76B 2VL6A 5GAGC 3APDA 5CV8A 2NWGA 4WJ4A 4DXGA 1C3TA 2MUYA 4APVA 1S5FD 2ZCCA 3NHEB 4OVVA 4CKCA 2Z6KA 4FADA 2KTFA 2AQ2B 3DBLB 4G0NB 4L2YA 1J7AA 1TS4A 2YEPF 2JA8H 3M4OB 2DGYA 2N7EA 4HJKA 2IJ0A 2FHTA 2B63B 1W6KA 5CV9A 3LJ3A 5IT9c 1GUWA 5G55A 2WB1E 2Q8TA 3M7GA 4CDDC 1Y8NB 4WURA 2WV6D 3OTOQ 2WAQG 5CGKA 5FLXc 1N34L 1JJ2A 2JA6B 1TWFH 4YWMA 1HZ5A 2HT1A 2C35B 3SD5A 3AMZA 2NN6H 3CCMA 2BWES 3SHQA 4DN4M 3P4QB 1H9SA 3H7PA 1PH7A 5FO7B 3M62B 3HVZA 2NBFA 2C7MB 2LGYA 3K9PB 1E7ZA 1LV9A 4NQLB 2DWQA 2N1VA 2F3WA 3CCEA 2UUBQ 1L4ZB 4ICUA 5LHY1 3MHSD 4NDXA 3KW5B 2BKFA 1XO3A 1PH4A 2DX5B 3PRPB 2VQEQ 5M3MH 4C4VA 1PFBA 5IWAQ 1XLNA 2MP2A 2V3SA 2N9XA 2G9HD 4IUNA 3RMHA 2W55A 4EGVA 2K8BA 3IVFA 2KOLA 2XK5B 2EQSA 1YHAA 3K81C 4O1NA 1D7QA 2YYZA 3AI5A 2I2YA 3DHIC 3UDFA 1A3UA 1RAXA 3K5NA 1II3A 3OWFA 1I3QH 2XGTA 4NKLA 1P7EA 5EKLA 3FPPA 2BYEA 2B2YA 4P73A 1V86A 1HUMA 2L55A 2KCMA 2E74C 1EF1A 2NPTB 3WIMA 2INNE 3EGRA 4G4KA 1PRTD 4DV4Q 1VQLA 4GSWA 1E2VA 2XTIA 2JUOA 1QG7A 1YNNC 1V81A 3CMEA 2V4DA 4O0AA 4C2MH 2MJEA 1JOKA 3AV8A 4MGKE 2L9HA 2ASBA 5ELDA 4JI0L 2LFIA 4EEWA 3DBLI 1EU3A 4J6HA 2CR5A 2G3QB 1U4RA 3OYYA 3PREA 2PNRC 1LT5D 1FMAD 2MJDA 1T6BX 1O78A 1KM7A 4QIWB 3MXPA 3J81j 5CYUA 5BMIA 4WAAA 2XNAC 3C3LA 1GO3E 3CSFA 3MEFA 4OHJA 3S15H 1TQOA 2I0QA 2R7ZH 1GHKA 2L0FA 4IDIA 4ZKCB 4DUZL 3NBHA 4ZRPA 2FJ2A 3AEGB 5H1SE 4PMWA 4A3EB 1WE7A 4LNNA 2R93B 4AJYB 1VCIA 2LHDA 2MO1A 2VUMB 1I94L 4XXEA 3Q8DA 1TWCH 4C56C 1JMCA 3KF6B 2PW7A 2E2JH 1K52A 1E90A 3ZJVA 2EYFA 4A3BG 1W3SA 3HOUG 4XWWA 3TJPA 3B08A 4DAVA 2SOBA 3NZ3A 4Q0FA 3T8MA 1AH9A 3E0EA 2L7RA 4QGUA 3D4WA 5C44H 4OIKA 3S14B 2MQJA 1G291 3NP8A 3JYUA 4ACFA 2LGXA 2WQYB 4B9WA 5KYLA 1QILA 4EQNA 1ENCA 1U0LA 4RFBA 5IGGA 3DBRB 3MWYW 4KGSA 3RULA 4A3OA 2OTJA 3S2DH 2KBNA 4L6TB 2UXDL 1E0BA 2WNMA 4MM3A 2K14A 4LF4L 1Q1BA 3ERQA 2BGFA 2M0AA 1D5XC 1VD2A 1I4HA 4KKTA 2D9UA 3D6CA 2IX3A 5JAVA 2N9PC 1S5DD 1KXLA 2B2VA 2KQ4X 2KZRA 3IBEA 2PZWA 3WAOA 3HKZB 1E9MA 5A2QE 5IAAC 2YTYA 3AEAB 1U4AA 3T1YL 2EZVA 1GC7A 2JYOA 1HTPA 1C0AA 2ON8A 3K6OA 3HS0C 5IP4D 1UH6A 4K14A 4X64L 2B2TA 5T1GA 2D11A 5E6OA 1XJVA 1WX9A 3ZJUA 1ESRA 4C1NI 1AZQA 1OFFA 2CW0D 2DLBA 5HURA 4G11A 4W9LA 4A75A 3E0JA 1Y1WH 2H88B 2L05A 5C0XG 4IURA 2F4VQ 5E6JA 5EAYA 2KMCA 1XQQA 2LVOA 2I5HA 3DVNV 4POGA 2KC1A 2JZ3B 1QE6A 1F2RI 5C4XG 3L4PA 1I50H 1O80A 1EY6A 5DAUA 1PFDA 3RD4A 1QVCA 4LFCQ 2RCFA 3BDOA 2KN4A 2RDBC 4IPHA 1WTWA 4RNAA 3VR8B 2IT1A 4EZJA 4G7ZC 1UWXA 1AZPA 1P9DU 1KHIA 3Q8EA 1P7FA 1KLGD 1N34Q 1SROA 3I55A 2QSDA 3L08A 4DK3C 2FCNA 2MBBB 3AE9B 4K81A 2KECA 4LJOB 3ULJA 3VDYA 2BYFA 2FCMA 1NUCA 3VR5A 1BO0A 1M8AA 2KKCA 4KTAA 2AX5A 2HTHA 5M5WH 2XWJB 2KTRA 5C4XB 1MG4A 4JI2Q 1PXUA 4Q5VA 1EWIA 2DNEA 4YHHL 4HIKA 2JA8B 3U50C 3VFKA 5ELOA 2Y5BB 5BMGA 1I4XA 3L9AX 4REZA 2CWPA 1HNXQ 4HRSA 5MPOA 1SAPA 3GTKB 4DNIA 2B8GA 4NQKE 2O5IC 4YWLA 3ICEA 3X3MA 1QJOA 2RVLA 1GB4A 5IODA 1F9JA 1KLUD 1L1OC 1HR0L 4OWWB 2BS3B 3VUXA 5L83A 3NWTA 2N9LA 3MC9A 1MJEA 2JA8G 2V1YA 4MSQB 3U7ZA 3ZO5B 1HA5A 3KBXA 1EY5A 3H0GH 1YNND 3I73A 2FINB 4UPAA 5M3MB 4BA2I 2HDLA 3RT3B 4ASWC 4IQZA 1C9FA 3Q69A 4DK6C 2XWBB 4BY7B 1W2BA 1NBFC 4GIVA 1RFKA 4MGZE 2D2CC 1K83H 2PI2E 3K0XA 4DAYA 2IGHA 3H91A 4ZRZA 3Q3FA 4LDTD 2BA0A 3RLOA 1IYJB 4DFAA 4NXMQ 2E2IH 1V5OA 2MJ8A 2N78A 4JPBW 3KJOA 2E6XA 2W82A 1BCPB 1JB7A 3KQ4A 4IM3A 4NAWA 4HKQA 3GD7A 3KK7A 4G7OC 1PDQA 1LTBD 1PHJA 4MSMB 1BKBA 1U4MA 4B9KA 2DJGC 3PCOB 3J80E 1F2RC 1CHQD 5IA7A 5M5XH 5KHQA 1HNWQ 5JVH3 1O7YA 3CHBD 1OEYJ 4XTCS 2J52A 5EQ0A 1OO9B 5BN5A 2EIFA 1D1IA 3DQVA 4ANXA 3QIJA 2D62A 4LFBL 1STNA 1VMCA 2RA4A 1EFWA 4HIDA 3J81c 4W9HA 2C7HA 1JJCB 1ESFA 4R4OA 4XQQA 4IWOA 1STHA 2HJ8A 4FJVB 3ABVB 1XD3B 4LF7L 1EYDA 4KDLB 3RNUA 3HGBA 3W3AA 2RGFA 5DEHA 1UBQA 1WXAA 1VQHA 2JA7B 3ULPA 2INCC 4UP8A 3K5LA 2Z59B 3STBD 1TZ1A 1WI5A 3PPAA 1SJED 4A3IB 4F8CB 1CTMA 3W1SA 3GOEA 3PV1A 4GDKB 2VUMH 2F0FA 1H9MA 1XWEA 5DPWA 2JY6A 4KV6A 2WXPA 3NK9A 3J9CA 1GJZA 4TUUA 2RQXA 2K22A 1B2TA 4WQMA 2B3GA 2NBVB 1B50A 3K7AB 1NVID 1C4AA 1T0YA 4GDKA 5H92C 4A3KG 2WXRA 4YHHQ 1EQQA 2GMIC 1E6EB 3IFDA 3N3KB 3W1BA 3RZOB 2W3RA 5KEEA 4KHPL 4OEMB 1V9PA 4PZ7A 1J5EL 1IBKL 4CO7A 2X8XX 2FUHB 3IT6B 3B2GA 3OIPA 3MC8A 3NBHB 3V05A 4DV6Q 2B2VC 1WYGA 1E8WA 5CR3A 5JPNC 4GXBA 4IUMB 2D5DA 1CZGA 2VW9A 3TREA 4EKUA 3RUZA 1EZ8A 3TDQA 1L0WA 1YN3A 1OGWA 1EY8A 1NSNS 2JRIB 3SFDB 4GOPC 1AE3A 3KVFB 1A62A 1FD7D 1JC7A 1HH2P 1LT4D 3VYSA 1KIXA 1T3QA 1PYBA 2Z8LA 5DM63 2CS4A 4JK1C 1IBML 1VQ9A 2BS2B 1QZGA 1Z7TA 4ODGA 1RHPA 4PS7A 1DZ1A 2LI5A 4RGMA 4JI6Q 4C3JH 2KWUB 1X3FA 2WS3B 4FXCA 1STGA 1EIHA 1TTNA 2DAJA 2KDIA 2KMMA 4X65Q 3NENA 1E1OA 4A3KH 3PLVA 1HNWL 4IM0A 3AQQA 4LAAA 2K33A 1WR1A 4DXFA 4IOCA 3KUDB 1ET6A 2YTVA 3J7YW 2Y5CA 3ZLZA 2VZAA 4OGQC 1JOQA 2LSSA 3UIPB 3CC7A 2CKHB 5EBDA 3MFGA 4LNOA 4XZ4A 1L6VA 2I38A 1PH6A 4RAUC 4EVOA 2WXLA 2F4IA 3CF5A 1IKLA 2NN6G 2I5MX 1WXVA 2M56B 3RNCC 1YJWA 4P1BC 4FXKC 2A6HC 1XT9B 3WDNA 5CC4A 2DZIA 3N9YC 3NS8A 4B95A 1ICWA 2FMMA 3AFPA 4JGHB 3VUYA 4ZQ3A 1ZUD2 2L3ZA 1DGJA 1VZ6A 1H9KA 4US9A 3HOUB 1V5TA 2K32A 2WU5B 2F0KA 3CRKC 4KJNA 5IP9H 2GB1A 5M3MG 4C3JG 1PRTB 1WM2A 3MTSA 2BA1A 4K2KA 4N6EB 1HFNA 2D3GA 5IKCM 1YOVB 1CQFA 1CZPA 1PH8A 1R4QB 2EJFC 3KDFA 2A4ZA 1X6OA 3UI2A 4IKGA 5C4XH 2WDTB 3RI7C 4L1BA 1VQ8A 4RMAA 4MEMA 4Z9CB 1XNRQ 3QWZB 1N62A 4GKJL 1Z47A 3GB1A 1AP0A 1HA6A 3IFWB 2IPKD 4II3B 1A0IA 4RKLA 4LFAQ 2UYZB 4JWUC 4AUQC 1FNUA 5E4XA 4DR6L 2DYBA 5FJ8H 1J7BA 4EUTA 4OW0A 1MHWC 3SGIA 1C4CA 1WGDA 5TSSA 1VQIA 1PGBA 3PUVA 4P71A 4A93H 2JZPA 3APFA 4OX9L 4ZAIA 4RH6A 1MKHA 1CJEA 1LM8B 4NAMA 4IFDJ 1HTLD 2MPMA 3D4DA 2B63G 5L37A 4MNOA 1BUIC 1ZDVA 4LF9Q 2ZVNA 4MM3B 5C3WA 3WALA 1MSGA 4FF2A 2XRSD 4JI4L 1KLVA 1SSOA 5KNDA 3VR2A 1IYVA 4GOPA 2R6GA 4DV2L 3OJ3A 3H0GB 2ENBA 1NI2A 2VB3X 5I2XA 3M4PA 2FIDA 3S1MB 2PIAA 3H7SA 3A9KB 3S16B 5BN3A 4BY1B 2V4IB 4QQBX 1K83B 4WJ3M 1ZGUB 5C4JB 2UU7A 3AECB 4IJHA 1FNWA 5J3BA 2O5JC 2LASA 3GTGH 2EKIA 2E2IB 1CI3M 1RCVD 2G4DB 1DYQA 1EO6A 1H9RA 2H89B 4BBNC 4URKA 3VTVA 2L1AA 1ZYRC 1ZW7A 2IO0B 3S1QB 1X65A 5JJIA 1ZXHA 2L00B 2LWPA 4A4IA 1B53A 2RDFA 2UUCL 4B3TQ 1Q8KA 4IUTA 4A3BB 4JLCA 1MD2D 3MC0B 1JWMD 3K5MA 1P98A 3PUXA 5HFYA 4K5VA 5IN7A 4QF4A 3JAMc 1U4PA 5LMNL 3CKIB 2Y0SB 2TSSA 3AU5A 2NVYB 2BTEA 3CCQA 1Q5WB 2GRIA 5K36G 4RM8A 4G50A 1IZ6A 4OIJA 1V1OA 5IP7H 2A73B 2ZXRA 3DM1A 1MI0A 1WJUA 2KD0A 1N60A 5HHDG 4DV5Q 1EYCA 2Q5WD 4QCLA 3OJ4B 1TGZB 4GB9A 3KJPA 1SRUA 2WAQE 5IP9G 2UUAL 5JPMC 3R7RA 1DGSA 1TU2B 3BDCA 2M17A 1NBWA 3M3JA 1A3TA 1HZAA 3GV3A 3KLSA 2IX1A 2LJIA 2QC8A 3GQBA 1YZ6A 5BYRA 5E3FA 4CKEA 4GOPB 3HM6X 4A3IH 5D65A 2NPTA 1DCZA 3GE8C 3M95A 1PMRA 4KKSA 2CHZA 3AE5B 1JE4A 3AYHB 1Q7YC 2X38A 1NCVA 4X57B 4ULLA 1B4OA 4CYEA 3A54A 2E2HH 3IG3A 1SNPA 1L4DB 1B3QA 1N6ZA 5AJ3L 2BPSA 3N30A 5JXVA 4ME3A 1QKZA 3E5SA 3SDZA 4LJZC 5BN4A 3RZOH 2W9NA 1YJ9A 2K5QA 3SFEB 1S5CD 3ZVVA 1QOAA 3HOXH 3I4NH 3UE0A 1WI0A 1QQRA 2JVCA 2WXMA 2KCNA 2WFWA 3D6WA 3K5OA 4BY7G 3CCSA 1R4PB 2MHJA 3IAM1 4E74A 4LMQD 2E5LL 4XDCA 1HUNA 2UXCL 4EQOA 2L76A 1HTQA 4A3IG 2L4NA 2RHQB 2DAFA 2N9EB 2V3PA 2Y5PA 4IFDI 1RKNA 4CHTB 1DOMA 3VR4A 2VB2X 5EPLA 1TYGB 5C44G 1LLRD 1NY4A 2VQEL 1HZBA 4JI2L 1C4PA 1N36Q 3P4RB 4B3TL 2K6QA 3HOVG 1K8RB 2IZVB 5JEAJ 4I6NB 3I56A 2XSCA 4MN3A 2KQ7A 4HJ5A 1D5MC 1BVSA 3TP7A 2UXBQ 3B1LX 3PZDA 4DHZB 2VZKB 1WCMG 1WTOA 3VUWA 3WAMA 4OZCA 4Q2JA 1WGHA 1FXAA 2BBCA 3G7LA 4CJ2C 4IM2A 5IP7G 2B2UC 1NE3A 4BBSG 5J22A 1TWHB 1LYLA 5EPJA 3I2ZA 5EGTA 1FIQA 4K3BA 3I63C 1AN8A 2LUEA 2Q2TA 1F9PA 1X3QA 1LTAD 4NJCA 1XNRL 1STYA 2J53A 4DUYQ 5EPKA 4F8MA 2RHSB 2K5HA 1UUPA 2A69D 2QF7A 1Y8RC 1D3ZA 1DOYA 1OXXK 4MJSB 1H8CA 4X62L 1LTRD 2RF4A 2EMSA 2JRHA 3B0AA 4R4TA 4R4CA 4DV7L 5G3LD 2R2OA 4USAA 3ZDTA 2F4VL 1VQPA 4MGIE 1EU4A 3D4RA 1UELA 3U52E 1O7ZA 1MBYA 1RF2D 1AEXA 1I42A 2BF8B 2BKRB 3C19A 3BDLA 4H0LC 1AWDA 1TS2A 4OWTB 2KO3A 2J7ZA 2K1FA 3A1QA 4OVZA 3G48A 1FM0D 1P8LA 3OMCA 3TP5A 4W9KA 1PTOC 3C1EA 4X6AH 1NNXA 2F0HA 2ZJRA 4MJSA 4BFRA 2LHEA 3U9OA 1TS3A 2UWQA 4L5QA 1X1MA 2EYPA 2F0WA 4B08A 4JQWC 3DBSA 4XQNA 3ITPA 3NE5B 3F2CA 2H1EA 2WXJA 2JA5G 3GTQH 3OMGA 2DNCA 1FGUA 2R92B 2CHXA 4HCNB 1Z5SB 2KEEA 2MFIA 3CIRB 4KKJA 3HRDD 5IGFA 2ICEC 4IFDG 3QQ8B 1TWGB 4PQXA 4UP9A 1QF6A 1YI2A 1Q46A 2R2QA 3DPDA 3UE1A 4K1RB 4PS3A 1LTGD 5K5PA 3QOJA 1VDVA 4KV2A 1E8XA 3VHTC 1HNZL 1A3VA 2JSVX 3DLLA 5GQOA 1WX8A 5GXGB 3IL8A 4LFBQ 2J7QB 1LM0A 1BF4A 3S1MH 2DNFA 5LLIA 2ZJPA 3S16H 4BY1H 4AOFA 5HY6A 5D6JB 4KZCA 3A7LA 3P7JA 5IIFA 2JWUA 2LUMA 3VRAB 4DGZA 3JSVA 2ID0A 2GN5A 2CW0C 3CU7A 1F2YA 2QDFA 2NCNA 3NVZA 2M8SA 5HGQA 3S1QH 5C5LA 1L2FA 4DUZQ 4P72A 3PO3H 3J80L 1HPCA 4A3BH 1WMHA 1WX7A 3HOYH 4BBSH 1WF9A 2D3AA 3L54A 5EE1A 3RLNA 3B9JA 4FJZA 4IWQA 2WHIA 3H6NA 5ELNA 2LJ5A 4X64Q 4BWGB 5D7GA 1VR9A 1PA6A 4C00A 3I90A 2LXJA 2LVPA 2K1BA 4JPSA 2F3IA 1I4PA 2J4XA 2ZTDA 4LUOA 4A3LH 2AYOB 2QMTA 3S17H 3MJWA 2FBWB 1I4RA 4RM9A 1C76A 5FLXL 2PMZE 1AYFA 1VQJA 1QNUA 2ALYB 3U58A 3CF6E 1EZ6A 4YTMB 2UUCQ 1UGJA 2BB5A 1RWSA 3EJIA 3FKIB 2J0MA 1UWVA 1YHQA 2JP1A 3BU2A 2DYMA 2K39A 4TMAB 4XGAB 4UHVA 1K3BC 5FO9B 5IGBA 1PFSA 2Z0EB 3N20C 2YTXA 4QIWE 3P20A 2A8VA 2KFJA 5I2YA 4KVGB 2QDLA 2VRRB 2HCCA 1ZXIA 1VJKA 1J5EQ 5C4HA 3IAS1 3DXJC 3WOEA 1MHHE 1B9MA 1WTQA 4F7XA 3I4MH 3PO3G 3T3NA 2DN8A 3HOYG 1X3GA 5EE0A 1BR9A 4JBKA 1YITA 4KIKB 2E75C 2L8JA 4A3FG 3EBEA 1JR0D 4KZ0A 2AMCB 4K8IA 1HZ9A 1ZP0B 1V1PB 1D1KA 3JAMi 2O2LD 1UD7A 1CSQA 3L0OA 4NXNL 3HOXB 3I4NB 3R2TA 3VH3B 2WKDA 5C0XH 5AFWA 2KJRA 4QB4A 1L1OB 5KNBA 2AUKA 2BDNA 5IWAL 1OQQA 1H4RA 2WP9B 1BCPC 1K73C 4CQNA 1VMPA 4HTHA 3GTJB 3UIOB 1EWCA 2F0GA 1JOOA 2V4LA 2KX0A 4YTPB 3E9HA 4GKKL 3FILA 2J0JA 3M63B 5LXIB 5CBEE 4IC7B 3CD6A 1G51A 4JV5Q 2K01A 2L0CA 1N61A 3H0GG 3R7QA 5LL6S 5IOIA 1E10A 1JJGA 3PUWA 1EY7A 1ONLA 3BY4B 3FDTA 3ONAB 1S1QB 4YCWA 1T0SC 2L5TA 1GNUA 5IO9A 2PJHA 1LQBA 3T9LA 5IYDG 3MHBA 1PUTA 4WH4A 5COYA 2PQAB 3AFQA 4IPGA 4DNTB 1E7PB 5E6NA 5JEAG 1Y69U 2WKCA 3A5ZB 4NXML 4RMFA 1ZKOA 2X6GA 2KX3A 3VVWB 4HIMA 3MTNB 1Q1EA 4BKGA 4GNXA 3HP3A 1C7YA 4PYZA 3QIAA 1S3SG 3KF8A 4C3IG 3MP9A 4FBJB 1LT3D 1EOVA 5EJWA 1RIPA 1XYIA 2ZJQA 3SU8X 3ZQ4A 4YCVA 2MH7A 4O2DA 4TQUS 1T0RC 4RHSA 1D8LA 3K58A 2BE5C 1QOHA 1VQFA 1WTVA 1EWHA 2KJXA 3HRZC 3M4QA 1L0YB 4JI3L 3PRMB 4K3CA 3LYYA 2F0VA 1RTNA 3VQIA 3HOXG 1VQNA 3I4NG 1C78A 1LTLA 4UDUC 1ENAA 3S1NH 2Y0SE 2RDGA 4G7HC 4DPGA 3JVZX 4M8MA 5AZFA 5IE8A 4NB3A 3I4MG 3PIP3 1E1TA 5C6AA 3VA7A 4HJAA 4GN4B 1RFAA 3CCRA 3I9V1 3O13A 1WE6A 1P16A 1G2SA 1K8MA 1WTHA 1CKNB 4LFCL 3VR9B 1N9WA 2LRUA 1MIUA 4GLAC 3DBHB 3HZXA 4RKBA 3PUZA 2QHOA 1FNVA 1LTSD 2ICIA 1SE3A 4A8XC 4EZLA 2KCCA 1OTRB 5E6PA 4YXDB 1PGXA 3RN5A 3SEBA 3HOVH 4P7IA 2R92H 4O42A 1XMOQ 3CSTA 2RDHA 1YQBA 3KF6A 4XYCA 2XVSA 1TWGH 3F8TA 1IW7D 3NEMA 4M8AA 1WD1A 4K7WA 2V0GA 1CSPA 3E3XA 5JJKA 1DOKA 4V190 1GJXA 1UWMA 3J7A5 3EECA 2H5XA 4GKJQ 4AYBB 1I5FA 3A1QB 1DM0B 5L95C 5IYBG 1YIJA 3D8GA 5KYIA 1WJJA 3AU7A 1MG8A 1BOSA 1P0RA 2PLPA 2NZOA
chains in the Genus database with same CATH topology
1GPXA 1CFMA 5ISRA 3MVVA 3OWEB 4IUUA 1KH0A 2OT2A 1MVKA 3FAHA 1QOBA 1EQVA 1PFMA 1AFPA 1BUVT 3H3VC 2K05A 3FILB 3NXWA 1PDXA 1I7HA 4RF0A 3PO3B 1FXIA 4WRDA 3HOYB 4BBSB 1PFNA 3KBGA 2GA4B 3NVVA 4RF1A 5KNCA 3W5UB 1W6JA 3RZDB 5C0XI 3C8YA 4KJOA 5J1ZA 1SMYD 2F0EA 1CQVA 1KFYB 2WXQA 5ELCA 3DEPA 3GV6A 5D14A 2INPE 4EQPA 1L6UA 1O7LA 2SNSA 1EIGA 3FVQA 3AE4B 2FE8A 2PTLA 3PZ8A 3U4EG 2KEDA 2CVRA 1L5PA 2W54A 1PTOF 3A8IE 2RPVA 3SK4A 1GUSA 3Q8CA 1SYCA 2F0LA 1XF5L 1DOXA 3MXNA 3I4MB 2B2WC 4B0MA 1WXQA 1ML0D 4XDXA 2WDRB 1Q3LA 2K28A 1JW9D 1UEAB 3I91A 4YSXB 1BDOA 5IT9E 3KLRA 5AUIA 3QO2A 3I57A 3S15B 4HMJA 3ETRA 3NTIA 1B9NA 1T5XD 2HTME 3LB8C 1IGDA 1D6EC 4PMCA 3X3NA 2WXKA 1SNOA 1BXTA 1GUNA 3SK6A 2ACZB 4P6VF 1HXYD 2Z4HA 5KIXA 1TWCB 5IGEA 2B2TC 4FXDA 2IL8A 1B44D 5CV7A 2PKOA 2PZTA 1SYEA 2QJLA 4KHVA 2EY2A 2VNUD 4X3UA 2BE5D 3EUB2 2JQRB 5J39A 1OXTA 2I07B 4YIJA 3H94A 2F0DA 2EJMA 4KN4C 3S2DB 1BBXC 3ZJTA 2NTSA 3W2DA 1QOFA 2EE1A 2JE6I 5FO8B 2F0IA 3ZYYX 2EYLA 1RODA 4JWSC 4HROA 3LWUA 3RFZB 5G3LF 2N0SB 3MAQA 1R9TB 2K6AA 4ARIA 3NUHB 3PV0A 1FRDA 3T3OA 4HN7A 3IAYA 2RSOA 4PMBA 4R9WA 2WXIA 4HKZE 1SYGA 2EY1A 4L63B 1I6HB 3SR1A 1EL0A 1C77A 2J42A 4LTUA 2KVMA 3TP6A 2BOSA 1SNDA 2PMZB 4KN7C 2LMCB 3UI3A 1BCPF 1I50B 2L83A 5LL6X 1C79A 3DUZA 4IOIE 1NYRA 1JORA 1PRTC 1U4LA 3HOVB 2E3TA 5I6YA 1HZ6A 2CJOA 1YNJD 4Y7NB 1TT2A 3L3OC 4DU9A 2TMPA 2JX5A 2BT6A 3JAML 3NTKA 5D3DA 2PCFB 4YT0B 1LTID 4OO1I 2AQ1B 1Y1VB 2N55A 1DXMA 4M1UB 4ZHPA 3BYYB 5IGDA 1EY4A 2EVBA 2QIEB 3GTPB 1XLOA 3J81E 3Q8AA 1F2LA 5FK9C 1SFOB 3ND8A 5I6WA 2K03A 2N9KA 2KHSA 1TJEA 5CMDA 1KDAA 2LGIA 1SYBA 2F0PA 1ZDXA 1PRTF 4HR7B 2JU6X 1FRRA 4XE0A 1CM9A 3DMUA 3EA6A 3AEDB 3S1RB 3A56A 1CT1D 5NUCA 2Q8IB 4ME5A 3H8HA 1WGKA 5CV6A 1NAPA 2N88A 1J8IA 4IUQA 1TVXA 4DQOC 5EE9A 4BBRB 1KRHA 1MI2A 5EBCA 5DM73 5M5XB 4WJWA 1ROEA 1B1ZA 1SNCA 1BNZA 3DWPA 1IGCA 1HCZA 2PVGC 3GTLB 4OZAA 2M00A 1DONA 3CQZB 1EFID 2IWHA 1XEEA 1DOIA 4H7BA 1HQRD 1FCLA 1CK1A 4HEDA 1SE2A 2HQEA 3WOFA 5M5YB 3BIID 3TMEA 1N5XA 5M3FB 4RGOS 1E0ZA 2KQ3A 4CJ1B 3PO2B 3NTHA 4F88A 2R61A 3V2TA 4NAWB 2F0UA 4J3OD 3AN1A 2X69A 3OIQA 4ARCA 1XTCD 2NTTA 2K04A 3BVGA 1E2WA 4TQ0A 1ZEQX 1V8CA 4R8IA 2A68C 2EJGC 1ZPSA 3AEBB 1SE4A 1SNQA 4J8QA 4KGRA 2PO4A 5C3EB 2PYKA 4A55A 3Q6SA 1HQMC 4B9XA 4A90A 3KWLA 3F2UA 3AE6B 5T8IA 4NP5A 5JVG3 4ZK9B 4N9TA 3MXGA 1GHJA 4C3JB 1ILPA 1CZWA 3KLSX 3FRPB 1HFGA 5BYQA 3NS1A 1ILQA 2F0SA 2AUJD 3NSWA 1A2UA 5EKIA 2VXWA 1M4VA 2BB6A 4FF3A 1V1PA 3HEJA 3P1MA 1L0VB 1Y8OB 4GDLB 3AB5A 4DK0A 3G6JB 1HHVA 4JBWA 2HDEA 4FXGC 1HRJA 2KAJA 3AB9A 1BCPD 3OSOA 2HDMA 3A8KE 4MH8A 3BVMA 5CV5A 3TN2A 2ZW1A 4I65A 2LEKA 4NMZA 3C2PA 5HG2A 1I4GA 3Q23A 2AWOA 3OOCA 2Z1CA 5JOBA 3T51B 2K9XA 1IKMA 3B2FA 4KD4A 3EQLC 1X3PA 3I8ZA 3BZDB 3P4SB 1F9QA 3JAME 1NR4A 5HGTA 2LY7A 1JWUD 2JEAI 5A35A 1WTXA 5C0XJ 3W5VB 1BQQT 1PYWD 4QUCA 1PTOB 3U2SC 1TWFB 2X6LA 2QCPX 4N58A 4A93B 2DYOA 3IT4B 3CRLC 1G2TA 4A3JB 4FP5D 3J81L 1WCMB 1YJJA 3HVDA 4FF4A 2B2UA 4KI0A 3L7ZC 2EPBA 4GZYC 1IBXB 3TEWA 4U673 3KUPA 2IW3A 4XQJA 1J9OA 1OXUA 4KY5A 4PNYA 3HG9A 3A55A 4QMGA 4WAFA 1I3QB 2CJNA 3VRBB 2EXZA 1NEKB 1FR3A 1EM7A 2NB0A 2SNMA 3FC4A 5C5MA 1VZ8A 4TSSA 3MA2B 2HCIA 2WLBA 2BDOA 3VA5A 4C2MB 2RSNA 3PUYA 4A3DB 2GI9A 3IXSA 4KMUC 1STAA 4R3DA 1QB5D 1SNMA 1OQRA 4CJ0B 4CGYB 3QB3A 4X3TA 5JEAH 4A9AA 1PZKD 2IGGA 3H6MA 2A5HA 2K5DA 2OXPA 1EEFD 4US8A 4XT3B 1FFUA 1RDPD 1GOZA 4H44C 1JMLA 2LKVA 1OXSC 2A6HD 2PQEA 4C7YA 1Y56A 4B0EA 1SEBD 2E2JB 1YN5A 1YJIA 1JQ4A 2K5PA 1RD9D 3TUOA 1FEHA 4ITKA 4HJGE 1VF5C 5I9PA 4KX6B 4EE2A 1TY0A 4FYDA 2DBYA 5C44B 3QJYA 3DWGC 1JCKB 5CORA 3P63A 1MSHA 2ZXOA 4DNRB 4J1MA 2SDFA 4FO2A 1F2ZA 1A6XA 2EYMA 1ACCA 3T4AC 2IDYA 3T53B 2IGDA 3C1FA 4E6IA 1MPEA 1ENFA 2F0MA 1D4BA 5KGUA 1SDFA 3QG1A 1ZOYB 1WSPA 3FMCA 3OW7A 1T5EA 2V3NA 2XRQD 4DA2A 4K5XA 4X3KA 3SHLA 4L23A 1QCBD 1UAPA 4RWSC 4C3HG 3TEYA 2DY8A 4NW2A 2EYHA 1PLFA 3PMFA 2ONQA 3P75A 5A2QL 1JWAD 3M4YA 1BMLC 5HI1A 2WAQB 1TZOA 1B3AA 3MFYA 4KK7A 2A6EC 4TRDA 1FD6A 2B2YC 3R3OA 1TKYA 3PO0A 3EFXD 4RCOA 5M5WB 2OHFA 4KKUA 4RGTA 4WWMA 4ZHOA 1V8QA 1PGAA 1RYJA 1IYUA 1YMHE 4KHZA 4ILWA 4IFDH 2D5GA 2WXNA 2NZ1D 1PTOH 4IUVA 2XIWA 3NBIA 4TQ1A 2QILA 1EY0A 1GUGA 1SYDA 4NZLB 2IX0A 1Q12A 2J0TD 3VYUA 4HCEA 4ZKBB 2OEOA 1SSNA 1IW7C 1I4QA 4V0BA 4K6DA 1IUEA 3DWQA 1VZ7A 1FYCA 1STBA 3J7AV 1TR5A 1J7CA 1YQ3B 3K59A 3NVYA 3SXHA 3SE0A 1NYQA 1JICA 5H8YE 3AE3B 3LX0A 1F2MA 3AE7B 2SEBD 2PW5A 4CKBA 3Q24A 1KDBA 1LABA 2RKSA 4M0WA 4HSVA 1GAQB 1VF7A 1G8ZD 1EEID 3M7NA 4WIPA 1EOTA 5C3XA 3I4LA 3Q8BA 1K53A 4RA8A 3S17B 3BG3A 5IT9L 2NUCA 3SVMA 4H2AA 2CHBD 5FR3A 1K50A 3M85A 2QDBA 2VZKD 4ZRQA 1C4QA 3NPPA 2E76C 2K3UA 4D2KA 4WFN3 2YU9B 5E4WC 1WWTA 3N6RA 4RCNA 2YEPB 3NHHA 2NVXB 5IOCA 1N63A 3NUCA 1FGBD 1A70A 1DJRD 1WRIA 2F0JA 4ID6A 3V96A 3MJ5A 2MJ3A 2L1BA 1MGSA 3VR3A 4KGTA 1TKGA 1DD2A 1A2TA 2F0OA 3DWMA 3NQIA 3URYA 2RBMA 4ZLTF 4OZBA 1TS5A 3ND9A 4YTNB 5I4DA 1OXVA 3K57A 2L12A 3A7AB 1WVLA 1EWYC 5I9OA 5BMHA 1JB3A 2KACA 4XWTA 1Q90A 3RPFC 4RHRA 1G91A 4P2CB 4HAEA 1RM6C 3SR6A 4A3KB 5JJZA 4JX1C 3MHZA 4A6QA 2A6ED 3IKJA 1FCCC 2XN9C 1FFVA 1VLBA 5T1IA 4N59A 2WINB 1CA6A 3I3CA 5M9OA 3M3YB 3EVQA 2KWDA 5CV4A 3OPOA 1YN4A 4LLGM 2LMCA 1H9SB 4ZUIA 4L8JA 4KY7A 1GUOA 2H4OA 2WDQB 3S1NB 2E2DC 2PVOD 3GP7A 2PZUA 1IL8A 3BK2A 2FFKB 3K0YA 5ELBA 2RMMA 4MIUA 4F87A 5G5GA 2F03A 3LXFA 2WXOA 5CBAE 2A68D 2F3VA 3MZ5A 2KDMA 2FMCA 1Q8IA 1DOLA 2MEKA 1NI3A 2B39A 2ZT9C 4IN3A 1LO5D 4XDDA 4ZOHC 3W9CB 4MACA 1F9SA 4MT5A 2KA7A 5KRUA 2DY7A 3TP8A 2AWNA 3TZDA 1S5ED 4PV1C 3GTOB 3DHQA 5BYSA 2B2WA 2WXHA 3GTGB 4AS1A 1RJTA 4C3HB 2OEDA 4N9PA 4X3SA 2JXTA 2F0TA 2F0NA 3N52A 2L52A 4P16A 4G57A 5FOBB 1ET9A 1STEA 1WD0A 3PIO3 2KUMA 3S2HB 2NN6I 4K8JA 1TY2A 3SK5A 1K51A 5G5HA 4S3SA 1MHXA 4LK1C 3GS2A 2N7JA 2PMVA 5EKKA 5ELEA 1QNKA 3OHXC 3TBIB 1PTOD 3Q0AA 1TKWB 1ZXTA 2JEBI 1Q10A 5IGCA 3AE8B 1TWAB 1PZID 1B9RA 3WCQA 3R93A 3TZUA 3BVZA 2QKIC 5AUKA 2MHVA 4K6LA 3PZ7A 4TKOB 1QWYA 2BYTA 3R8BA 3NWSA 2E2HB 4OO1H 4A3MB 3BYTB 4FF1A 1SIJA 2JA5B 3GTMB 1JQYD 2JYTA 3P42A 3E56A 2O4XA 2QEJC 3FPUB 2WDVB 5ELFA 3SK8A 1D2BA 3CWIA 1SF0A 4HCSA 3AH7A 2K7VA 1YNTE 1X32A 4KY6A 1S5BD 5C2TB 4XYOA 3AMUA 1TIID 2B8FA 3EROA 2C5CA 4ZYSA 2K0PA 2A74C 3Q22A 1QT9A 2JYEA 1LTTD 4UAIA 4A3FB 4R8NA 4YSYB 1RTOA 3A8JE 2EDGA 1D5ZC 3D3RA 1F0ZA 1E2ZA 2PPBC 2M19A 4IALA 4A3GB 2EELA 1CHPD 1A15A 3AE1B 4PT5A 5F2DA 2SAKA 4IZ8A 1CA5A 1QLBB 3I72A 2MP1A 4K5WA 1VDZA 3BK1A 1TKEA 1KAAA 3HUIA 1I6VC 1AW7A 3D31A 2G1EA 4ZUJA 2F0QA 3ZGZA 1SMYC 2WIIB 3AE2B 1JROA 3DWAA 1KF6B 1L0XB 3QOLA 4FNFA 4BA1I 3BWUD 1C48A 1WTPA 2OF1A 3NVWA 1IHZA 1GB1A 3GTQB 4QUFA 3J7AF 1G6ZA 3T13A 1XLPA 2AQ3B 4MHEA 2ZW0A 1Y8PB 2LFNA 3VR6A 5E1FA 2HUGA 3T56B 4GLSC 4ABNA 2EYOA 3E6ZX 1XLQA 4YSZB 4JE3B 2FUG1 4C3IB 2F1MA 4YWGG 1JALA 3U9SA 1Z6HA 2WP8J 1F9RA 1KABA 4I7ZC 4DAPA 1V43A 1V97A 3IFTA 1XX8A 1XCQL 5EE3A 2JSOA 1LACA 2R3ZA 3AEFB 3TEZA 3DEOA 3LNNA 4HMIA 1KNAA 2WXGA 3S9WA 1SB3C 1SBBB 1C8CA 2NMQA 2BS4B 3VYTA 2NVTB 1PZJD 3NQTA 2LS01 1FO4A 1WTRA 3NRZA 2BCOA 5FKAC 1JRPA 3E9SA 3AM9A 3GO5A 1IBXA 3P4PB 1SYFA 2EY5A 2ZXPA 1EY9A 4AQ7A 2BW2A 4WORA 3V3XA 3LWEA 5DNFA 3MXUA 3R2IA 4DK1A 1R7SA 1JWBD 4H13C 2C9OA 2M2LA 1KTKA 3QWNA 5FLXE 3TSSA 2WACA 1GUTA 1GXDC 1VRAB 2Q8RE 3P1HA 4C1NK 2R7ZB 4K2LA 4RGNA 4C80A 2EOTA 4C7ZA 1S4ZA 1K8OA 1EYAA 3VYRA 3TEXA 1ZE3D 2L11A 1U9RA 5C3JB 1QOGA 1H9JA 2Y3AA 1XCTL 4BS9A 5C4ZA 3H09A 2WXFA 4U68A 1HEZE 2M9VA 2CU3A 2EY6A 1NENB 4IUPA 1N5WA 3HOWB 4OO1G 1YNJC 1YQ4B 5LNK1 1XXGA 4FVMA 1LT6D 2G9DA 2L32A 1UNSA 3AEEB 3BS1A 3RLFA 4DF7A 2W3SA 2Z4IA 3C46A 2A69C 4OL7A 2PW9A 4KKIA 2JXMB 3T16A 2NYZD 4CBVA 2EYJA 1NR2A 5D3IB 1EQTA 1ZYRD 2WU2B 2CQAA 1Y1WB 5K36H 1SJHD 4HEA1 3Q8FA 4XIGS 1F77A 3FEWX 3MEHA 1JWSD 2MGSA 3I70A 2WB1B 3HOZB 4KD3A 4HSPA 1KNEA 4XT1B 4XYQA 1SXTA 3KWVA 2NVQB 2K5WA 2I46A 1KDCA 2B76B 5CV8A 2NWGA 4DXGA 2MUYA 1S5FD 4CKCA 2AQ2B 4L2YA 1J7AA 1TS4A 2YEPF 3M4OB 2IJ0A 2FHTA 2B63B 1W6KA 5CV9A 1GUWA 2Q8TA 3M7GA 4WURA 1Y8NB 2WV6D 5CGKA 2JA6B 1HZ5A 3AMZA 2NN6H 4DN4M 3P4QB 1H9SA 5FO7B 3HVZA 2NBFA 1LV9A 2DWQA 2F3WA 1L4ZB 5LHY1 4NDXA 1XO3A 1PFBA 1XLNA 2G9HD 4IUNA 3RMHA 2W55A 4EGVA 2KOLA 4O1NA 2YYZA 2I2YA 1A3UA 3K5NA 1II3A 3OWFA 4NKLA 1P7EA 5EKLA 3FPPA 2B2YA 1HUMA 2L55A 2E74C 2INNE 3EGRA 4G4KA 1PRTD 1E2VA 1QG7A 1YNNC 2V4DA 2MJEA 1JOKA 3AV8A 2L9HA 5ELDA 2LFIA 1EU3A 4J6HA 1U4RA 2PNRC 1LT5D 1FMAD 2MJDA 1T6BX 1O78A 4QIWB 3MXPA 5CYUA 5BMIA 2XNAC 3C3LA 4OHJA 1TQOA 1GHKA 4ZRPA 4IDIA 4ZKCB 3NBHA 2FJ2A 3AEGB 4PMWA 4A3EB 2R93B 1VCIA 2LHDA 2VUMB 4XXEA 4C56C 2PW7A 1K52A 3ZJVA 2EYFA 4XWWA 4DAVA 2SOBA 3NZ3A 4Q0FA 3D4WA 4OIKA 3S14B 1G291 3NP8A 2WQYB 4B9WA 5KYLA 1QILA 4EQNA 1ENCA 4RFBA 5IGGA 4KGSA 3MWYW 4L6TB 2WNMA 1E0BA 1Q1BA 3ERQA 2M0AA 1D5XC 1I4HA 4KKTA 2D9UA 3D6CA 2IX3A 5JAVA 1S5DD 2KQ4X 2B2VA 2PZWA 3HKZB 1E9MA 5A2QE 3AEAB 2EZVA 2JYOA 1HTPA 2ON8A 3K6OA 3HS0C 4K14A 2B2TA 5T1GA 3ZJUA 1ESRA 4C1NI 1AZQA 1OFFA 2CW0D 2DLBA 5HURA 3E0JA 2H88B 5C0XG 4IURA 5E6JA 1QE6A 1F2RI 3L4PA 1O80A 1EY6A 5DAUA 1PFDA 3RD4A 3BDOA 2KN4A 1WTWA 4RNAA 3VR8B 2IT1A 4G7ZC 1UWXA 1AZPA 3Q8EA 1P7FA 1KLGD 2QSDA 3AE9B 2KECA 1NUCA 3VR5A 1BO0A 1M8AA 4KTAA 2AX5A 2XWJB 5C4XB 1PXUA 4Q5VA 2DNEA 2JA8B 5BMGA 1I4XA 3L9AX 4REZA 4HRSA 5MPOA 1SAPA 3GTKB 2B8GA 2O5IC 3X3MA 1QJOA 2RVLA 1GB4A 5IODA 1KLUD 2BS3B 3NWTA 2N9LA 3U7ZA 1HA5A 3KBXA 1EY5A 1YNND 3I73A 2FINB 5M3MB 4BA2I 2HDLA 1C9FA 4IQZA 3Q69A 2XWBB 4BY7B 1RFKA 2D2CC 2IGHA 4DAYA 3H91A 4ZRZA 2BA0A 4DFAA 2MJ8A 2E6XA 2W82A 3KQ4A 1BCPB 4HKQA 3GD7A 3KK7A 4G7OC 1PDQA 1LTBD 1U4MA 3J80E 1F2RC 1CHQD 5JVH3 1O7YA 3CHBD 4XTCS 2J52A 5EQ0A 1OO9B 5BN5A 1D1IA 2D62A 1STNA 1VMCA 2RA4A 1ESFA 4XQQA 1STHA 3ABVB 1EYDA 3HGBA 3W3AA 5DEHA 2JA7B 3K5LA 1SJED 4A3IB 1CTMA 3W1SA 4GDKB 2F0FA 1H9MA 1XWEA 3J9CA 4KV6A 2WXPA 3NK9A 2RQXA 2K22A 1B2TA 4WQMA 1B50A 3K7AB 1NVID 1C4AA 5H92C 2WXRA 1E6EB 3IFDA 3RZOB 2W3RA 5KEEA 3IT6B 3B2GA 3OIPA 3V05A 2B2VC 1WYGA 5JPNC 5CR3A 2D5DA 1CZGA 3RUZA 1EZ8A 3TDQA 1YN3A 1EY8A 1NSNS 3SFDB 1FD7D 1JC7A 1LT4D 3VYSA 1T3QA 2Z8LA 5DM63 4JK1C 2BS2B 1Z7TA 4ODGA 1RHPA 1DZ1A 4RGMA 4FXCA 2WS3B 1STGA 1EIHA 2KMMA 4LAAA 2K33A 4DXFA 1ET6A 3J7YW 2Y5CA 4OGQC 1JOQA 5EBDA 3MFGA 1L6VA 2I38A 4RAUC 4EVOA 2WXLA 2F4IA 1IKLA 2NN6G 2M56B 4FXKC 2A6HC 3WDNA 5CC4A 3N9YC 1ICWA 2FMMA 4ZQ3A 1ZUD2 1DGJA 1VZ6A 1H9KA 4US9A 3HOUB 2K32A 2WU5B 2F0KA 3CRKC 4KJNA 2GB1A 4C3JG 1PRTB 3MTSA 2BA1A 4K2KA 4N6EB 1HFNA 1CQFA 1CZPA 1R4QB 2EJFC 3UI2A 4IKGA 4L1BA 4Z9CB 1N62A 3GB1A 1Z47A 1AP0A 1HA6A 2IPKD 4RKLA 4JWUC 1FNUA 5E4XA 1J7BA 4OW0A 1C4CA 5TSSA 1PGBA 3PUVA 2JZPA 4ZAIA 4RH6A 1CJEA 4NAMA 4IFDJ 1HTLD 2MPMA 3D4DA 1BUIC 1ZDVA 4MM3B 5C3WA 1MSGA 4FF2A 2XRSD 1SSOA 5KNDA 3VR2A 1IYVA 2R6GA 3H0GB 2ENBA 2VB3X 5I2XA 2PIAA 3S1MB 3S16B 5BN3A 4BY1B 2V4IB 4LK0M 1K83B 3AECB 5C4JB 1FNWA 2O5JC 2EKIA 2E2IB 1CI3M 1RCVD 1DYQA 2H89B 1H9RA 2L1AA 1ZYRC 3S1QB 1ZXHA 1B53A 2RDFA 4IUTA 4A3BB 1MD2D 3MC0B 1JWMD 3K5MA 3PUXA 5HFYA 4K5VA 4QF4A 1U4PA 3CKIB 2Y0SB 2TSSA 2BTEA 2NVYB 2GRIA 5K36G 4OIJA 1V1OA 2A73B 2ZXRA 3DM1A 1MI0A 1N60A 5HHDG 1EYCA 2Q5WD 4QCLA 5JPMC 1TU2B 3BDCA 1A3TA 2IX1A 3GV3A 3KLSA 2LJIA 3GQBA 5BYRA 5E3FA 4CKEA 5D65A 1DCZA 1PMRA 4KKSA 3AE5B 1JE4A 2X38A 1NCVA 4ULLA 1B4OA 3A54A 1SNPA 1L4DB 5JXVA 1QKZA 3E5SA 3SDZA 4LJZC 5BN4A 3SFEB 2K5QA 1S5CD 1QOAA 1QQRA 2WXMA 2KCNA 3D6WA 3K5OA 1R4PB 3IAM1 4LMQD 4XDCA 1HUNA 4EQOA 2L4NA 2V3PA 2Y5PA 4IFDI 1RKNA 4CHTB 1DOMA 3VR4A 2VB2X 5EPLA 1TYGB 1LLRD 3P4RB 1C4PA 5JEAJ 2XSCA 4MN3A 1D5MC 3TP7A 2VZKB 1WTOA 4OZCA 4Q2JA 1FXAA 2BBCA 3G7LA 4CJ2C 2B2UC 5J22A 1TWHB 1FIQA 5EPJA 5EGTA 1AN8A 1F9PA 1X3QA 1LTAD 4NJCA 1STYA 2J53A 5EPKA 4F8MA 1UUPA 2A69D 2QF7A 1DOYA 1OXXK 1LTRD 5G3LD 4USAA 1EU4A 3D4RA 3U52E 1O7ZA 1MBYA 1RF2D 1AEXA 3BDLA 4H0LC 1AWDA 1TS2A 2J7ZA 4OVZA 1FM0D 3OMCA 3TP5A 1PTOC 3C1EA 2F0HA 2LHEA 3U9OA 1TS3A 2EYPA 2F0WA 4B08A 4XQNA 3ITPA 3NE5B 2H1EA 2WXJA 3OMGA 2DNCA 2R92B 4KKJA 3CIRB 2KEEA 3HRDD 5IGFA 2ICEC 4IFDG 1TWGB 4PQXA 1QF6A 1LTGD 5K5PA 3QOJA 1VDVA 1A3VA 2JSVX 5GXGB 3IL8A 1BF4A 3A7LA 3P7JA 5IIFA 2JWUA 2LUMA 3VRAB 4DGZA 2ID0A 2CW0C 3CU7A 1F2YA 3NVZA 5C5LA 3J80L 1HPCA 5EE1A 3B9JA 4BWGB 5D7GA 1VR9A 3I90A 2K1BA 4JPSA 1I4PA 2J4XA 2QMTA 2FBWB 1I4RA 1C76A 5FLXL 1AYFA 1QNUA 1EZ6A 4YTMB 1UGJA 2BB5A 1RWSA 3EJIA 3FKIB 4TMAB 2DYMA 2JP1A 5IGBA 5FO9B 3P20A 5I2YA 2HCCA 1ZXIA 1VJKA 5C4HA 3IAS1 3DXJC 3WOEA 1MHHE 1B9MA 1WTQA 4F7XA 3T3NA 2DN8A 5EE0A 1BR9A 2E75C 1JR0D 1ZP0B 4K8IA 1V1PB 1D1KA 2O2LD 3HOXB 3I4NB 3R2TA 2WKDA 5C0XH 5AFWA 4QB4A 5KNBA 2AUKA 2BDNA 1OQQA 2WP9B 1BCPC 4CQNA 1VMPA 4HTHA 3GTJB 1EWCA 2F0GA 1JOOA 4YTPB 3FILA 5CBEE 2K01A 2L0CA 1N61A 5LL6S 1E10A 3PUWA 1EY7A 1ONLA 3FDTA 3ONAB 2L5TA 3MHBA 1PUTA 4WH4A 5COYA 4DNTB 1E7PB 5JEAG 1Y69U 2WKCA 1ZKOA 2X6GA