4XGAB

Crystal structure of bamb and bama p3-5 complex from e.coli
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
174
structure length
174
Chain Sequence
AEIQQINIVGNHAFTTDELISHFQLRDEVPWWNVVGDRKYQKQKLAGDLETLRSYYLDRGYARFNIDSTQVSLTPDKKGIYVTVNITEGDQYKLSGVEVSGNLAGHSAEIEQLTKIEPGELYNGTKVTKMEDDIKKLLGRYGYAYPRVQSMPEINDADKTVKLRVNVDAGNRFY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Outer membrane protein assembly factor BamB
publication title Structural basis for the interaction of BamB with the POTRA3-4 domains of BamA.
pubmed doi rcsb
source organism Escherichia coli (strain k12)
molecule tags Protein binding/membrane protein
total genus 52
structure length 174
sequence length 174
ec nomenclature
pdb deposition date 2014-12-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF07244 POTRA Surface antigen variable number repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.310 Alpha Beta Roll Ubiquitin-like (UB roll) membrane protein fhac 4xgaB02
3.10.20.310 Alpha Beta Roll Ubiquitin-like (UB roll) membrane protein fhac 4xgaB01
3OG5A 4QAYA 4K3CA 4BZAA 4C4VA 4K3BA 3MC8A 4C00A 3MC9A 2VH2A 2VH1A 3Q6BA 2X8XX 4C4VB 4PK1A 2QCZA 2V9HA 3EFCA 3NJTA 4XGAB 2MHJA 2QDFA
chains in the Genus database with same CATH superfamily
3H9DA 1VJKA 2JXXA 2C5LC 1FCLA 4HJGE 2MQJA 1P7EA 5G2NA 3DVNV 4BKTA 3P42A 2J4XA 1L0YB 2JRHA 3H6NA 2WXGA 1F1HA 3ZNGC 2NPTB 4N9F4 2MRPA 1EWYC 1J7AA 2CHWA 3C0RB 5JZEB 3ZJVA 2R61A 4F1SA 4M00A 3BIID 1YOVB 1TZ1A 1JW9D 4G50A 1Q0WB 4W9HA 3PRPB 3U52E 5BO4B 3IAM1 2GB1A 3I9V1 3PZ8A 3N30A 4AP4C 3P4RB 3AM9A 3PRMB 3P1MA 3VAWA 4MACA 2LXCA 4WURA 2D10A 2V4IB 4MM3A 2CHZA 2IJ0A 1UGJA 1WH3A 2V3PA 2WXNA 2DX5B 3IG3A 4DDID 3DBLB 2QEJC 3I5JC 4FBJB 1LM8B 1QOGA 2ZW0A 2LXAA 3U4EG 4LNIA 3WALA 3L0WB 2WNMA 2FIFA 3WA0A 2FAZA 3UQBA 1UUPA 2KD0A 1IPGA 4KV2A 1GUAB 2D3CA 4LK0M 1HZ5A 3PV1A 3CF6E 1I4HA 4ICUA 3QJZA 1SE9A 3VVWB 2LZ6A 2G1EA 2BS2B 4I6PA 2NBVB 3EECA 3KLSX 4JWSC 1WGGA 3LYYA 2YVCA 3NJTA 4WJQA 3ZLZA 5I4DA 3HK0A 4LNKA 3VXWA 2KVZA 5EE0A 3V3XA 4BKSA 1DOYA 2D3BA 4NAWB 5D2MB 2D3GA 1Y56A 1P1AA 4EKUA 2MW5A 4GDLA 4WQOB 3VFKA 3ZJTA 3VH3B 4BAXA 2M17A 1UF0A 4PYZA 2O6VA 2C7NB 5CHVC 3RCZA 1PYWD 4BKSD 4C4VA 2KWVB 4II2B 5BYRA 3I57A 2G9HD 1AARA 2IY1B 2Z0DB 3ZVVA 1J7CA 3WIMA 4HPPA 1TY0A 1WXMA 3EFCA 2KJHB 4JIOU 4A3PA 1WGKA 3DWMA 2V4LA 2L3ZA 4KZCA 4DBGA 1RFKA 2C7HA 2NBWB 3Q8FA 4AS1A 2A5UA 2J0MA 1GNUA 2D07B 2K0PA 3NVZA 4A9AA 2SAKA 2AQ1B 2KXJA 2JU6X 1ZE3D 1J7BA 3KWVA 1L4ZB 2QIEB 2EKEC 1E0ZA 5DPSA 2INDC 2BB5A 1NI3A 3NOBA 3RNGC 2LVQA 1I7HA 2RDGA 1VD2A 3PTFC 4ZOHC 1CQVA 4IG7B 2BW2A 1TIFA 3PO0A 3RNAC 3M62B 3D32A 4EZLA 4WWPA 2LFIA 1A5RA 4FXCA 3T3NA 2GBRA 2WDVB 2KN4A 2LHDA 4US9A 2JWZA 4LDTB 4HXDA 3AN1A 1OTRB 3HM3A 1ZXIA 3VR8B 2D2QA 1A70A 1NBFC 4MEMA 4RCOA 1R4MB 2MWSB 4YSZB 1SJHD 1E8WA 3OWEB 4NNJB 1T0YA 1XQQA 1D5ZC 3OG5A 3AEAB 2NCNA 1Y8RC 4LNNA 2E3TA 5BMIA 4IW0A 4H2AA 1QKZA 1QOAA 4IWOA 1Q10A 5L95C 4HK2A 4MSQB 4GIVA 2MBQA 2DLBA 2QJLA 2QMTA 3M95A 4PS3A 2KX3A 5T8IA 1M4VA 1R4MI 1TKYA 5E6OA 4ZYNA 4URKA 4IM0A 1JRPA 2M0AA 3RMKC 3VRBB 2JVCA 2N1WA 1JROA 2WX1A 1E8YA 4YSYB 1V2YA 1HTOA 2L76A 3R2IA 2VZKD 1GAQB 4MSMB 1WJ6A 4K3CA 4O1NA 1WF9A 3ML9A 2M56B 2KLGA 4M8MA 4OVVA 1HXYD 2WDQB 2C60A 4ZRKA 1CZPA 1V8CA 1KOTA 1TS4A 1PGBA 3JSVA 2H88B 2ZJDA 3AE1B 3P4PB 1WX7A 4A55A 1ZW7A 4GN1A 2ZW1A 2IYDB 1OQQA 2D11A 2EMSA 4GLSC 4BFRA 1RAXA 4TSSA 1KJTA 2VH1A 2HJ8A 3R2TA 1TJEA 5DPRA 4YWGG 2ZNVB 5AEKB 4K7SA 1WE7A 2N9EB 1I4XA 2KYWA 3FILA 1P3QU 2NMQA 1QOFA 4F7ZA 4XE0A 1YN5A 2TSSA 1IP9A 4B6WA 5EE9A 3N1ZC 2ACZB 2IGDA 4DHJB 1EUVB 1EM7A 3AU5A 5D3DA 2O2VB 2LGYA 4DXGA 1ISNA 4ZDVA 2JZZA 4XGAB 2RPVA 2AEHA 5LXIB 3VH4B 3QX1A 5HG2A 2ZVNA 4JQWC 1IGDA 4AWJA 1C78A 2OEDA 1KFYB 2K9XA 3DCGA 2CR5A 1JWAD 1VR9A 3RPFC 1JWBD 1KM7A 1WXVA 4J6IA 2KJ6A 3S2AA 3E56A 2XBBC 1WJUA 5DPTA 3W1SA 2WXQA 1T0RC 4BVUC 4RH6A 3AH7A 2PKOA 3VUXA 1K52A 2HTME 1C76A 5D94A 1WFYA 1MJDA 2NTSA 4J3OD 4RM9A 1XLOA 2DZJA 4EOYA 4GDKA 3V61A 2BBCA 4EFOA 2PE6B 1TS3A 1Q5WB 4FADA 3H7PB 1EF1A 1GC6A 1V5OA 3V60A 3B9JA 3FC4A 1MPEA 4KIKB 2FCSA 2CKHB 5E6JA 4MJSA 1PUTA 3P4SB 3RT3B 3MC0B 2W54A 1C9FA 4C7ZA 5HKHA 3ZDMC 1HZ6A 1FMAD 4G3XB 4Q2JA 1JMLA 3RNBC 2MBBB 4W9FA 2J7QB 4K7UA 2CJOA 1BT0A 3SU8X 4AOFA 3BVMA 1SE3A 1FXAA 1R4NB 2LRWA 3ZRFA 3KUCB 3VDZA 3Q2AC 2V9HA 2INCC 1TBEA 1LGRA 4LLGM 2KWDA 4OZBA 2PIAA 1WZ3A 4GDLB 3ZTCA 2L32A 1Z5SB 3ZO5B 2O6VB 3EC8A 3MJ5A 4ICVA 3P4QB 3KUDB 4DDGD 4D2KA 4AQ7A 3AE2B 3AXCA 1DOXA 4W9DA 1YNTE 2N4FA 3AU4A 4RFBA 1LO5D 5FK9C 1TZOA 4W9IA 1V1PA 3H8HA 4P1BC 4WWOA 1RM6C 4HKQA 4FLHA 3RZFA 3AMZA 1HTQA 2ZPNA 2RDHA 1XLQA 1WMHA 3KQ4A 2N9PC 1CMXB 4M0WA 3SFEB 3C8YA 2E6XA 2DZKA 4XDCA 2WXRA 4FHJA 1UWMA 4LNOA 3OJ4B 4P6VF 4B0MA 4TQ0A 5C3JB 2WP9B 3ZGZA 3PVLA 2RDBC 4XZ4A 2WHIA 3ZUNA 1XLPA 2WWZA 2L83A 4E71A 4A8XC 1XEEA 2JWUA 3A9JB 4W9GA 2Z0EB 3H1UA 2KMAA 1IGCA 2JUOA 4OZCA 2KFJA 4HCNB 1K53A 1NVID 3BZDB 1WWTA 1TTNA 4C56C 2MX2A 1X1MA 4GXBA 4L1BA 1GC7A 1SIJA 4FJVB 1UGMA 3QQ8B 3NUHB 2KT7A 2JZPA 5IN7A 2WXJA 2JYTA 3UGBB 4NQKE 1WXSA 5D3IB 5AUIA 1PDXA 3ZNHB 4PK1A 3QAQA 1E9MA 3DHHC 2IDYA 4IM2A 1ZUD2 4GU2A 5IO9A 3GE8C 1GB1A 1L6VA 3NS1A 2M1MA 3NVYA 1QOBA 3MTNB 1UELA 1SE2A 3Q3NC 4K81A 4TUUA 5JXVA 3RI7C 5J2RA 3BVGA 4IUMB 2N9KA 1V86A 5IKCM 1ZDVA 2OOBB 3QC8B 2Z59B 1YQ4B 3GS2A 1XLNA 2LI5A 2WXKA 1T3QA 1AYFA 2MJEA 2GBMA 3A1QA 3LXFA 4I6NB 4KZ0A 5BMHA 4ANUA 1QQRA 5L83A 1FFUA 5MPOA 1MI0A 2KFKB 3GOEA 2WXOA 3U7ZA 3W2DA 3ZKJC 4OVZA 4A90A 2BKRB 1ROEA 3VTUA 1NI2A 3HHMA 4WAAA 2HDEA 2NBUA 1WJ4A 2ZCCA 4YL8A 5FKAC 3SHQA 4IKGA 3W1YA 3IT6B 3X0WA 1DYQA 1MHXA 2H89B 2M19A 2N1VA 2D3AA 1TYGB 3FILB 1ZP0B 2Y3AA 3DVGX 3NVWA 3MFGA 3W1SC 3TEYA 4MDKE 1NEKB 2BT6A 5EE1A 1UBIA 4ZHPA 2L52A 4ZRQA 1GPXA 1GG3A 4ANXA 3DOWA 4WJNA 2KKCA 3RNEC 1YQBA 1IYFA 2XK5B 1YX6B 3NS8A 4JL9A 1AN8A 4WIPA 4LCDE 5EDSA 2KQ7A 2IBIB 3A9KA 2M0XA 1FNWA 3R7QA 3WCQA 4MELA 1U4AA 2WXHA 1WX8A 2HTHA 3T3OA 1JQ4A 2GBJA 3N32A 1B9RA 2QSDA 4NJ7A 3PLVA 1R7SA 2K8BA 4PS8A 2QC8A 2J42A 5KHQA 4M02A 3OJ3A 1KLVA 1KH0A 4N58A 3UI3A 2RPQA 1N6ZA 3QK0A 1HQRD 4C00A 4GOCA 4IOIE 3BK1A 2KOXA 2YEPB 4YTPB 1JALA 4MT5A 3L08A 2EMTA 2MJ3A 3TJPA 1XXGA 4HKZE 1JCKB 1YD8U 2JY6A 1IBXB 1P7FA 1LXDA 1OEYJ 3BK2A 2NS5A 4AJYB 3B2GA 2I2YA 2KTRA 3V6CB 2BYVE 1FM0D 2NVUI 2ON8A 4IWPA 4L2YA 2V0GA 1FXTB 4B95A 3ZXVA 2AL6A 1UD7A 1I4PA 3U2SC 1T5XD 3Q8CA 1WGDA 5TSSA 2MBHA 2REXA 3RZWC 2AQ2B 3AEBB 2NPTA 2L1AA 1QT9A 2Y5CA 3Q8AA 2PVOD 2J53A 1OGWA 1WM3A 2KJRA 1WYGA 1SGHA 3AV8A 3EUB2 5HHDG 4I6LB 1T0SC 2KDFB 4LTUA 1H8CA 2UYZB 3AEGB 2LJ5A 3ZIMA 2K6QA 2ZPYA 1B1ZA 3VTVA 3ZJUA 3PZ7A 1Z2MA 1LQBA 2RR9A 3AE4B 2D5GA 2UWQA 3ZW3A 1I35A 4GMVA 2G4DB 2BYEA 2LGIA 3IXSA 2WU2B 1S3SG 2VH2A 1K51A 2BPSA 1P0RA 2JSVX 1UNSA 2FUHB 3QA8A 5C2TB 2L8JA 2EKIA 1N60A 1UBQA 4NJ6A 4DXAB 1V1PB 1P98A 1MHHE 1SBBB 2B3AA 3B08A 4YXDB 3B1LX 3HUIA 2BF8B 4W9JA 1SF0A 1WM2A 2L7RA 4IC7B 5DPWA 4BBNC 2W82A 5IOIA 1SXTA 2DHZA 1V81A 1WR6E 3VRAB 3AEFB 2LGSA 3GP7A 4W9LA 3M3JA 4HCPB 1H4RA 4K1RB 2WQYB 2KC2A 3AE7B 1MVKA 4NAWA 4F8CB 4DWFA 3VUYA 2WDTB 1PFDA 5BYQA 1WJNA 4MGIE 3TIXA 3APDA 2G3QB 2K22A 3T9LA 2YEPF 3A33B 2LWPA 2JQRB 4KGSA 1V9JA 3QARA 1E10A 1JWUD 2PE9A 4ZRPA 4EE2A 4TMAB 2KQ4X 4XYCA 2GBKA 3W5VB 4ANWA 1OFFA 1L0XB 4ZYSA 3MJWA 3P63A 1RWSA 3ZRCA 2B76B 2ZVOA 1VCBA 1WI0A 1I4QA 2GLSA 2KTFA 2BKFA 3URYA 2Q5WD 3DBHI 4CYEA 1VRAB 1FRDA 2QCZA 2KDBA 3BVZA 3NRZA 2BS4B 4HJKA 2G4SA 5IAAC 3V05A 4PT5A 2GBNA 2KWCA 2V3NA 5LLIA 4A3OA 1XT9B 3DPDA 1N5XA 4MGZE 4JWUC 1WIAA 3TUOA 3TCAA 1SSNA 3IHPC 3PREA 4KSLC 4MM3B 3TBLD 1UH6A 3QWZB 4XX5A 3CSFA 1KLGD 4ZRIA 2MP2A 3GB1A 3SR6A 3UINB 2K8HA 3AI5A 4BZAA 3M63B 3RNFC 3MC8A 2AL3A 3SDLC 1ACCA 4WJPA 2W55A 2WLBA 1JRUA 1I4GA 2LGDA 4YTMB 4ZRJA 4USAA 5DCNA 2IO2B 3DVGY 1HA5A 3AE8B 2DNFA 4HWIB 2BYFA 2RGFA 2WYQA 2KDEB 1FPYA 1CJEA 1WX9A 4KKIA 3PS6A 1JWSD 4HROA 4YT0B 3IFWB 4LJPB 2N7DA 1TS5A 3PGEA 4IWQA 4RF0A 1QLBB 4LDTD 1EWCA 2ONQA 4ACFA 1WY8A 1S1QB 2KDIA 1AW7A 4DHZE 1TY2A 1WXQA 4PYUA 2I1JA 3AE5B 3ZTDA 2KVRA 1C3TA 4K7WA 1TKGA 3DQVA 3QIJA 4C4VB 1E5WA 2EELA 3HVDA 2JXTA 2MHJA 4XWTA 1EU4A 3DBRB 2DYBA 3JVZX 1L7YA 2XN9C 4UDUC 4FULA 2N0SB 1V1OA 1KTKA 2JYEA 5IP4D 4TV3A 2LUMA 2KACA 5AZFA 4XWWA 3PLUA 2CJNA 4TKNA 2LJIA 3N3KB 2INPE 4CQNA 1ET6A 4EEWA 4L23A 1C77A 2KX0A 2DZMA 2W3SA 1SB3C 1WGYA 4XC2A 3DBRI 1MFWA 2CU1A 2GI9A 2JZ3B 2FCQA 1WXAA 4HVBA 2MBOA 1L2NA 4MGKE 1YX5B 1XCTL 5FR3A 1FIQA 3H7SA 4P7IA 1KRHA 4MH8A 2HJ1A 2W9NA 3NZ3A 3JW0X 5E6NA 1C4PA 3SFDB 2NTTA 4HPMB 3TEXA 2BB6A 5JH5C 2Y5BB 1OQRA 1ZOYB 4JPSA 2BYTA 4OZAA 3IT4B 1F2RC 3L13A 1N61A 4A6QA 3X23A 4GGQA 2R2OA 1BMLC 1UZXB 5EE3A 2KTRB 3EA6A 2GMIC 4JGHB 3BY4B 2O2VA 3ZNID 3AE3B 2KN5A 2HD5B 3RD2A 4DHJD 1VZ8A 3AE6B 5J17A 1D3ZA 2AWTA 1VLBA 2WX0A 3NZUA 1GJZA 3UQAA 3L4PA 2J0JA 4M01A 2ICIA 1ZDXA 3Q14C 4HRSA 3IVFA 4TQ1A 3E9SA 1WGHA 3EGRA 4IM3A 4RGMA 1T6BX 3AULA 4DQOC 4E3CA 3MC9A 1E6EB 1FNVA 3KWLA 2N9LA 2FNJB 4P16A 2VZKB 5E6PA 2FIDA 3APCA 4G11A 4N6EB 2MBEA 5H8YE 2MEKA 3O65B 5G55A 3VHTC 2KMCA 2FCNA 3VTWA 3TL5A 2WXPA 3DDCB 3W9CB 2BTEA 1WR1A 1E7PB 1BXTA 1VZ6A 1WYWB 2RD0A 4KDIC 2JRIB 3Q8BA 1F2RI 2K5PA 4X57B 3HIZA 2K1FA 2BVCA 3H7PA 3TEWA 2MLBA 1I4RA 1QILA 2QILA 2PPHA 3JSVB 2BWES 3L10B 4KIKA 1PQSA 3NY5A 1M94A 3QHTA 3ABVB 2XNAC 2MA9B 2DENB 5C23A 3DBLI 2V3SA 5IA7A 3HRDD 2KAJA 2KK8A 1SIFA 4RF1A 3PHXB 3I3TB 4EZKA 3SEBA 2V1YA 1STEA 4K3BA 1TS2A 1IUEA 1V5TA 1YIWA 4FJZA 4ZHOA 2LGXA 4S17A 2RMMA 3GE3C 1XF5L 4WJOA 4E74A 1F77A 5LNK1 1XCQL 2KZRA 4XDDA 4PS7A 2DYOA 1FRRA 1ET9A 2KDMA 1WE6A 4WQMA 3VQIA 3AB5A 2FE8A 1F9JA 5D6JB 2KQSA 4MH0E 3Q8EA 3BINA 2I1KA 1V49A 1K50A 1J8CA 4G0NB 2O6VD 2JF5A 3UIOB 2LEKA 3K9OB 2RSUA 4N59A 1FCCC 3ML8A 3AEDB 3ZNZB 3LDZE 2VRRB 5BYSA 1QF6A 1GB4A 3U8ZA 3KW5B 3EFUA 1WZ0A 1VDVA 2LUEA 3W5UB 3K9PB 2LVOA 2WXLA 4RGOS 3KH0A 2ZEQA 4WH4A 2PMVA 3DHGC 3NG0A 4FJYA 2C7MB 1K8RB 1FO4A 2N7JA 3HM6X 3MP9A 1YN3A 2L0FA 3Q3MC 1SE4A 3CSTA 3RFZB 2MP2B 4GDKB 3OAWA 4JE3B 3A9JA 4C80A 3UF8A 2IGGA 3T8MA 1D5XC 2M4NA 3GZNB 4NPNA 4NZLB 1TT5B 1NDDA 3WAOA 1JWMD 2ZZPB 4B9KA 3KYCD 1YJJA 5C1ZA 1E8ZA 4KSKC 1I42A 3Q3JA 3ZYYX 2A4ZA 2ZCBA 1XO3A 3QCAA 5HI1A 2KNBA 4AUQC 4NQLB 2AX5A 4WWNA 2LHEA 4MJSB 5H92C 4FA6A 3R7RA 5GXGB 3EHVA 3ETRA 3APFA 3GZNI 1KLUD 1SJED 2J52A 1C79A 4P1CC 4KDLB 3CIRB 1PGXA 3PT2B 2L00B 3CMMB 1V80A 2Z8LA 4JLCA 2LVPA 5G5GA 2Y5PA 2FUG1 1RLFA 4W9CA 1ENFA 1C4AA 2BQQA 1UWXA 3N9YC 4HLEA 4ARCA 5KHOA 3PSEB 3O13A 3I63C 4US8A 3ENEA 3VR9B 1N5WA 1L0VB 3WANA 1HEZE 2DBYA 2PTLA 3A4RA 3U30A 3U7DA 1YJ1A 3Q3OC 1RRBA 3DVNU 1C4CA 3KUZA 4RNAA 3UIPB 4ARIA 2MCNB 1PGAA 2PVGC 1V6EA 1FNUA 4MGYE 3LB8C 5GMVA 2GRIA 1FFVA 2DZIA 1ZXHA 2KWUB 3Q6BA 4GSWA 2I38A 2ASQA 1EU3A 1P9DU 2YLMA 1WMHB 1D6EC 2ZNVC 1D4BA 4M0WB 3OLMD 2MH7A 4FHKA 4JX1C 5CX3A 1MG4A 5AZHA 2BS3B 5G5HA 2IY0B 1TGZB 2IZVB 2KHWB 1TKEA 2BGFA 4DK5A 4RMAA 1F0ZA 3ZXRA 3Q69A 1FEHA 2WGSA 5AUKA 4M8NA 3P2BA 4NJCA 4WAFA 2KFKA 1VZ7A 1OQYA 1RYJA 3B0AA 3N20C 2K6DB 3NVVA 1DGJA 1NYRA 3PHWB 3R3MA 1F52A 1LFDA 2HE7A 4BOSC 4OHJA 2WS3B 3RN9C 3ECIA 2IGHA 2L05A 3DBHB 3BYTB 1ZPSA 2MJDA 3TMPB 1YQ3B 1C1YB 3J9CA 2X8XX 1J19A 3DHIC 3BYYB 1FD6A 5D7GA 3TEZA 3A4SC 1V97A 3BWUD 5LXHA 2DWQA 5AZGA 4HPLB 2KO3A 4ASWC 4EUTA 3PPAA 5FR6A 2XK5A 2XEWA 3FAHA 3R66C 2KMMA 3Q3FA 1FXIA 3DWGC 3B2FA 4NAMA 2PW9A 5CHWA 3ZDTA 3DBSA 1YMHE 1MG8A 2IPKD 3C19A 2OJWA 5J18A 2BWFA 2K39A 2UU7A 4EZJA 4BOZB 1WGRA 1BUIC 2KANA 1J0GA 3FKYA 2X38A 1N62A 4KGTA 2FCMA 2AQ3B 2OJRA 2OHFA 2FBWB 1DOIA 2QHOA 1Q1OA 3L16A 4KX6B 4C7YA 3N1XC 1D5MC 2IO3B 1L6UA 2LD9A 3IBEA 4QAYA 3L17A 3VUWA 2PJHA 5CTRC 1YJIA 4GB9A 1IBXA 3N1YC 3PRZA 1ZKHA 3V62A 2WXIA 4ITKA 4DXFA 4B0EA 3A1QB 3JYUA 5TR5A 1NENB 4FN2A 5JHBA 2R2QA 1WRDB 2CU3A 1EF5A 2NR2A 2IO1B 2CHXA 2MSED 2INNE 2K3UA 2N7EA 3KVFB 2JX5A 3WAPA 3RNCC 2IO0B 1WSPA 1YN4A 5BMGA 3RULA 4A20A 3ZQ4A 5JHAA 1G6JA 4LJOB 4KKJA 4NY0A 1SEBD 2WDRB 4REZA 2DAJA 4YSXB 3WAMA 2JPHA 2KC1A 1AWDA 2CS4A 3RYTA 3PZDA 4W9KA 1ZGUB 3AECB 1ESFA 4HDQA 4S0RA 4OW0A 3ALBA 1GOZA 3TSSA 4R3DA 4CO7A 4RGTA 3R8BA 2SEBD 2DYMA 2WU5B 1E8XA 1EO6A 2M8SA 2LMCA 1L5PA 3NHEB 4BKGA 1T0QC 3AEEB 4IDIA 1CK1A 1RFAA 3CWIA 1E7UA 4W9EA 1QZEA 1R4NI 4BBNF 1N63A 3AE9B 4KVGB 2LASA 3A9KB 5CHFA 5HFYA 2LRUA 2GOWA 2PEAA 4LNFA 3V6EB 1OEYA 1E90A 2JT4B 4HEA1 2PLPA 2DAFA 1E7VA 2L0TA 4II3B 3HVZA 3SD5A 4YTNB 4RM8A 4ANVA 1NYQA 3MHSD 4AJWA 2N9XA 2J0KA 3NZSA 1WRIA 1XD3B 2W3RA 2C9WB 3MHZA 2WXFA 4WWMA 4DHZB 1HE8A 3LJ3A 2WXMA 4HDOA 2AYOB 3IAS1 3RUIB 4CHKA 1KF6B 4KGRA 2K25A 3L54A 3ONSA 2KLCA 2G45B 4RGNA 2K8CA 1L4DB 3KYDD 4OVUA 2QDFA
chains in the Genus database with same CATH topology
3OG5A 4QAYA 4K3CA 4BZAA 4C4VA 4K3BA 3MC8A 4C00A 3MC9A 2VH2A 2VH1A 3Q6BA 2X8XX 4C4VB 4PK1A 2QCZA 2V9HA 3EFCA 3NJTA 4XGAB 2MHJA 2QDFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3OG5 A;  4QAY A;  4K3C A;  4BZA A;  4C4V A;  4K3B A;  3MC8 A;  4C00 A;  3MC9 A;  2VH2 A;  2VH1 A;  3Q6B A;  2X8X X;  4C4V B;  4PK1 A;  2QCZ A;  2V9H A;  3EFC A;  3NJT A;  4XGA B;  2MHJ A;  2QDF A; 
#chains in the Genus database with same CATH topology
 3H9D A;  1VJK A;  2JXX A;  2C5L C;  1FCL A;  4HJG E;  2MQJ A;  1P7E A;  5G2N A;  3DVN V;  4BKT A;  3P42 A;  2J4X A;  1L0Y B;  2JRH A;  3H6N A;  2WXG A;  1F1H A;  3ZNG C;  2NPT B;  4N9F 4;  2MRP A;  1EWY C;  1J7A A;  2CHW A;  3C0R B;  5JZE B;  3ZJV A;  2R61 A;  4F1S A;  4M00 A;  3BII D;  1YOV B;  1TZ1 A;  1JW9 D;  4G50 A;  1Q0W B;  4W9H A;  3PRP B;  3U52 E;  5BO4 B;  3IAM 1;  2GB1 A;  3I9V 1;  3PZ8 A;  3N30 A;  4AP4 C;  3P4R B;  3AM9 A;  3PRM B;  3P1M A;  3VAW A;  4MAC A;  2LXC A;  4WUR A;  2D10 A;  2V4I B;  4MM3 A;  2CHZ A;  2IJ0 A;  1UGJ A;  1WH3 A;  2V3P A;  2WXN A;  2DX5 B;  3IG3 A;  4DDI D;  3DBL B;  2QEJ C;  3I5J C;  4FBJ B;  1LM8 B;  1QOG A;  2ZW0 A;  2LXA A;  3U4E G;  4LNI A;  3WAL A;  3L0W B;  2WNM A;  2FIF A;  3WA0 A;  2FAZ A;  3UQB A;  1UUP A;  2KD0 A;  1IPG A;  4KV2 A;  1GUA B;  2D3C A;  4LK0 M;  1HZ5 A;  3PV1 A;  3CF6 E;  1I4H A;  4ICU A;  3QJZ A;  1SE9 A;  3VVW B;  2LZ6 A;  2G1E A;  2BS2 B;  4I6P A;  2NBV B;  3EEC A;  3KLS X;  4JWS C;  1WGG A;  3LYY A;  2YVC A;  3NJT A;  4WJQ A;  3ZLZ A;  5I4D A;  3HK0 A;  4LNK A;  3VXW A;  2KVZ A;  5EE0 A;  3V3X A;  4BKS A;  1DOY A;  2D3B A;  4NAW B;  5D2M B;  2D3G A;  1Y56 A;  1P1A A;  4EKU A;  2MW5 A;  4GDL A;  4WQO B;  3VFK A;  3ZJT A;  3VH3 B;  4BAX A;  2M17 A;  1UF0 A;  4PYZ A;  2O6V A;  2C7N B;  5CHV C;  3RCZ A;  1PYW D;  4BKS D;  4C4V A;  2KWV B;  4II2 B;  5BYR A;  3I57 A;  2G9H D;  1AAR A;  2IY1 B;  2Z0D B;  3ZVV A;  1J7C A;  3WIM A;  4HPP A;  1TY0 A;  1WXM A;  3EFC A;  2KJH B;  4JIO U;  4A3P A;  1WGK A;  3DWM A;  2V4L A;  2L3Z A;  4KZC A;  4DBG A;  1RFK A;  2C7H A;  2NBW B;  3Q8F A;  4AS1 A;  2A5U A;  2J0M A;  1GNU A;  2D07 B;  2K0P A;  3NVZ A;  4A9A A;  2SAK A;  2AQ1 B;  2KXJ A;  2JU6 X;  1ZE3 D;  1J7B A;  3KWV A;  1L4Z B;  2QIE B;  2EKE C;  1E0Z A;  5DPS A;  2IND C;  2BB5 A;  1NI3 A;  3NOB A;  3RNG C;  2LVQ A;  1I7H A;  2RDG A;  1VD2 A;  3PTF C;  4ZOH C;  1CQV A;  4IG7 B;  2BW2 A;  1TIF A;  3PO0 A;  3RNA C;  3M62 B;  3D32 A;  4EZL A;  4WWP A;  2LFI A;  1A5R A;  4FXC A;  3T3N A;  2GBR A;  2WDV B;  2KN4 A;  2LHD A;  4US9 A;  2JWZ A;  4LDT B;  4HXD A;  3AN1 A;  1OTR B;  3HM3 A;  1ZXI A;  3VR8 B;  2D2Q A;  1A70 A;  1NBF C;  4MEM A;  4RCO A;  1R4M B;  2MWS B;  4YSZ B;  1SJH D;  1E8W A;  3OWE B;  4NNJ B;  1T0Y A;  1XQQ A;  1D5Z C;  3OG5 A;  3AEA B;  2NCN A;  1Y8R C;  4LNN A;  2E3T A;  5BMI A;  4IW0 A;  4H2A A;  1QKZ A;  1QOA A;  4IWO A;  1Q10 A;  5L95 C;  4HK2 A;  4MSQ B;  4GIV A;  2MBQ A;  2DLB A;  2QJL A;  2QMT A;  3M95 A;  4PS3 A;  2KX3 A;  5T8I A;  1M4V A;  1R4M I;  1TKY A;  5E6O A;  4ZYN A;  4URK A;  4IM0 A;  1JRP A;  2M0A A;  3RMK C;  3VRB B;  2JVC A;  2N1W A;  1JRO A;  2WX1 A;  1E8Y A;  4YSY B;  1V2Y A;  1HTO A;  2L76 A;  3R2I A;  2VZK D;  1GAQ B;  4MSM B;  1WJ6 A;  4K3C A;  4O1N A;  1WF9 A;  3ML9 A;  2M56 B;  2KLG A;  4M8M A;  4OVV A;  1HXY D;  2WDQ B;  2C60 A;  4ZRK A;  1CZP A;  1V8C A;  1KOT A;  1TS4 A;  1PGB A;  3JSV A;  2H88 B;  2ZJD A;  3AE1 B;  3P4P B;  1WX7 A;  4A55 A;  1ZW7 A;  4GN1 A;  2ZW1 A;  2IYD B;  1OQQ A;  2D11 A;  2EMS A;  4GLS C;  4BFR A;  1RAX A;  4TSS A;  1KJT A;  2VH1 A;  2HJ8 A;  3R2T A;  1TJE A;  5DPR A;  4YWG G;  2ZNV B;  5AEK B;  4K7S A;  1WE7 A;  2N9E B;  1I4X A;  2KYW A;  3FIL A;  1P3Q U;  2NMQ A;  1QOF A;  4F7Z A;  4XE0 A;  1YN5 A;  2TSS A;  1IP9 A;  4B6W A;  5EE9 A;  3N1Z C;  2ACZ B;  2IGD A;  4DHJ B;  1EUV B;  1EM7 A;  3AU5 A;  5D3D A;  2O2V B;  2LGY A;  4DXG A;  1ISN A;  4ZDV A;  2JZZ A;  4XGA B;  2RPV A;  2AEH A;  5LXI B;  3VH4 B;  3QX1 A;  5HG2 A;  2ZVN A;  4JQW C;  1IGD A;  4AWJ A;  1C78 A;  2OED A;  1KFY B;  2K9X A;  3DCG A;  2CR5 A;  1JWA D;  1VR9 A;  3RPF C;  1JWB D;  1KM7 A;  1WXV A;  4J6I A;  2KJ6 A;  3S2A A;  3E56 A;  2XBB C;  1WJU A;  5DPT A;  3W1S A;  2WXQ A;  1T0R C;  4BVU C;  4RH6 A;  3AH7 A;  2PKO A;  3VUX A;  1K52 A;  2HTM E;  1C76 A;  5D94 A;  1WFY A;  1MJD A;  2NTS A;  4J3O D;  4RM9 A;  1XLO A;  2DZJ A;  4EOY A;  4GDK A;  3V61 A;  2BBC A;  4EFO A;  2PE6 B;  1TS3 A;  1Q5W B;  4FAD A;  3H7P B;  1EF1 A;  1GC6 A;  1V5O A;  3V60 A;  3B9J A;  3FC4 A;  1MPE A;  4KIK B;  2FCS A;  2CKH B;  5E6J A;  4MJS A;  1PUT A;  3P4S B;  3RT3 B;  3MC0 B;  2W54 A;  1C9F A;  4C7Z A;  5HKH A;  3ZDM C;  1HZ6 A;  1FMA D;  4G3X B;  4Q2J A;  1JML A;  3RNB C;  2MBB B;  4W9F A;  2J7Q B;  4K7U A;  2CJO A;  1BT0 A;  3SU8 X;  4AOF A;  3BVM A;  1SE3 A;  1FXA A;  1R4N B;  2LRW A;  3ZRF A;  3KUC B;  3VDZ A;  3Q2A C;  2V9H A;  2INC C;  1TBE A;  1LGR A;  4LLG M;  2KWD A;  4OZB A;  2PIA A;  1WZ3 A;  4GDL B;  3ZTC A;  2L32 A;  1Z5S B;  3ZO5 B;  2O6V B;  3EC8 A;  3MJ5 A;  4ICV A;  3P4Q B;  3KUD B;  4DDG D;  4D2K A;  4AQ7 A;  3AE2 B;  3AXC A;  1DOX A;  4W9D A;  1YNT E;  2N4F A;  3AU4 A;  4RFB A;  1LO5 D;  5FK9 C;  1TZO A;  4W9I A;  1V1P A;  3H8H A;  4P1B C;  4WWO A;  1RM6 C;  4HKQ A;  4FLH A;  3RZF A;  3AMZ A;  1HTQ A;  2ZPN A;  2RDH A;  1XLQ A;  1WMH A;  3KQ4 A;  2N9P C;  1CMX B;  4M0W A;  3SFE B;  3C8Y A;  2E6X A;  2DZK A;  4XDC A;  2WXR A;  4FHJ A;  1UWM A;  4LNO A;  3OJ4 B;  4P6V F;  4B0M A;  4TQ0 A;  5C3J B;  2WP9 B;  3ZGZ A;  3PVL A;  2RDB C;  4XZ4 A;  2WHI A;  3ZUN A;  1XLP A;  2WWZ A;  2L83 A;  4E71 A;  4A8X C;  1XEE A;  2JWU A;  3A9J B;  4W9G A;  2Z0E B;  3H1U A;  2KMA A;  1IGC A;  2JUO A;  4OZC A;  2KFJ A;  4HCN B;  1K53 A;  1NVI D;  3BZD B;  1WWT A;  1TTN A;  4C56 C;  2MX2 A;  1X1M A;  4GXB A;  4L1B A;  1GC7 A;  1SIJ A;  4FJV B;  1UGM A;  3QQ8 B;  3NUH B;  2KT7 A;  2JZP A;  5IN7 A;  2WXJ A;  2JYT A;  3UGB B;  4NQK E;  1WXS A;  5D3I B;  5AUI A;  1PDX A;  3ZNH B;  4PK1 A;  3QAQ A;  1E9M A;  3DHH C;  2IDY A;  4IM2 A;  1ZUD 2;  4GU2 A;  5IO9 A;  3GE8 C;  1GB1 A;  1L6V A;  3NS1 A;  2M1M A;  3NVY A;  1QOB A;  3MTN B;  1UEL A;  1SE2 A;  3Q3N C;  4K81 A;  4TUU A;  5JXV A;  3RI7 C;  5J2R A;  3BVG A;  4IUM B;  2N9K A;  1V86 A;  5IKC M;  1ZDV A;  2OOB B;  3QC8 B;  2Z59 B;  1YQ4 B;  3GS2 A;  1XLN A;  2LI5 A;  2WXK A;  1T3Q A;  1AYF A;  2MJE A;  2GBM A;  3A1Q A;  3LXF A;  4I6N B;  4KZ0 A;  5BMH A;  4ANU A;  1QQR A;  5L83 A;  1FFU A;  5MPO A;  1MI0 A;  2KFK B;  3GOE A;  2WXO A;  3U7Z A;  3W2D A;  3ZKJ C;  4OVZ A;  4A90 A;  2BKR B;  1ROE A;  3VTU A;  1NI2 A;  3HHM A;  4WAA A;  2HDE A;  2NBU A;  1WJ4 A;  2ZCC A;  4YL8 A;  5FKA C;  3SHQ A;  4IKG A;  3W1Y A;  3IT6 B;  3X0W A;  1DYQ A;  1MHX A;  2H89 B;  2M19 A;  2N1V A;  2D3A A;  1TYG B;  3FIL B;  1ZP0 B;  2Y3A A;  3DVG X;  3NVW A;  3MFG A;  3W1S C;  3TEY A;  4MDK E;  1NEK B;  2BT6 A;  5EE1 A;  1UBI A;  4ZHP A;  2L52 A;  4ZRQ A;  1GPX A;  1GG3 A;  4ANX A;  3DOW A;  4WJN A;  2KKC A;  3RNE C;  1YQB A;  1IYF A;  2XK5 B;  1YX6 B;  3NS8 A;  4JL9 A;  1AN8 A;  4WIP A;  4LCD E;  5EDS A;  2KQ7 A;  2IBI B;  3A9K A;  2M0X A;  1FNW A;  3R7Q A;  3WCQ A;  4MEL A;  1U4A A;  2WXH A;  1WX8 A;  2HTH A;  3T3O A;  1JQ4 A;  2GBJ A;  3N32 A;  1B9R A;  2QSD A;  4NJ7 A;  3PLV A;  1R7S A;  2K8B A;  4PS8 A;  2QC8 A;  2J42 A;  5KHQ A;  4M02 A;  3OJ3 A;  1KLV A;  1KH0 A;  4N58 A;  3UI3 A;  2RPQ A;  1N6Z A;  3QK0 A;  1HQR D;  4C00 A;  4GOC A;  4IOI E;  3BK1 A;  2KOX A;  2YEP B;  4YTP B;  1JAL A;  4MT5 A;  3L08 A;  2EMT A;  2MJ3 A;  3TJP A;  1XXG A;  4HKZ E;  1JCK B;  1YD8 U;  2JY6 A;  1IBX B;  1P7F A;  1LXD A;  1OEY J;  3BK2 A;  2NS5 A;  4AJY B;  3B2G A;  2I2Y A;  2KTR A;  3V6C B;  2BYV E;  1FM0 D;  2NVU I;  2ON8 A;  4IWP A;  4L2Y A;  2V0G A;  1FXT B;  4B95 A;  3ZXV A;  2AL6 A;  1UD7 A;  1I4P A;  3U2S C;  1T5X D;  3Q8C A;  1WGD A;  5TSS A;  2MBH A;  2REX A;  3RZW C;  2AQ2 B;  3AEB B;  2NPT A;  2L1A A;  1QT9 A;  2Y5C A;  3Q8A A;  2PVO D;  2J53 A;  1OGW A;  1WM3 A;  2KJR A;  1WYG A;  1SGH A;  3AV8 A;  3EUB 2;  5HHD G;  4I6L B;  1T0S C;  2KDF B;  4LTU A;  1H8C A;  2UYZ B;  3AEG B;  2LJ5 A;  3ZIM A;  2K6Q A;  2ZPY A;  1B1Z A;  3VTV A;  3ZJU A;  3PZ7 A;  1Z2M A;  1LQB A;  2RR9 A;  3AE4 B;  2D5G A;  2UWQ A;  3ZW3 A;  1I35 A;  4GMV A;  2G4D B;  2BYE A;  2LGI A;  3IXS A;  2WU2 B;  1S3S G;  2VH2 A;  1K51 A;  2BPS A;  1P0R A;  2JSV X;  1UNS A;  2FUH B;  3QA8 A;  5C2T B;  2L8J A;  2EKI A;  1N60 A;  1UBQ A;  4NJ6 A;  4DXA B;  1V1P B;  1P98 A;  1MHH E;  1SBB B;  2B3A A;  3B08 A;  4YXD B;  3B1L X;  3HUI A;  2BF8 B;  4W9J A;  1SF0 A;  1WM2 A;  2L7R A;  4IC7 B;  5DPW A;  4BBN C;  2W82 A;  5IOI A;  1SXT A;  2DHZ A;  1V81 A;  1WR6 E;  3VRA B;  3AEF B;  2LGS A;  3GP7 A;  4W9L A;  3M3J A;  4HCP B;  1H4R A;  4K1R B;  2WQY B;  2KC2 A;  3AE7 B;  1MVK A;  4NAW A;  4F8C B;  4DWF A;  3VUY A;  2WDT B;  1PFD A;  5BYQ A;  1WJN A;  4MGI E;  3TIX A;  3APD A;  2G3Q B;  2K22 A;  3T9L A;  2YEP F;  3A33 B;  2LWP A;  2JQR B;  4KGS A;  1V9J A;  3QAR A;  1E10 A;  1JWU D;  2PE9 A;  4ZRP A;  4EE2 A;  4TMA B;  2KQ4 X;  4XYC A;  2GBK A;  3W5V B;  4ANW A;  1OFF A;  1L0X B;  4ZYS A;  3MJW A;  3P63 A;  1RWS A;  3ZRC A;  2B76 B;  2ZVO A;  1VCB A;  1WI0 A;  1I4Q A;  2GLS A;  2KTF A;  2BKF A;  3URY A;  2Q5W D;  3DBH I;  4CYE A;  1VRA B;  1FRD A;  2QCZ A;  2KDB A;  3BVZ A;  3NRZ A;  2BS4 B;  4HJK A;  2G4S A;  5IAA C;  3V05 A;  4PT5 A;  2GBN A;  2KWC A;  2V3N A;  5LLI A;  4A3O A;  1XT9 B;  3DPD A;  1N5X A;  4MGZ E;  4JWU C;  1WIA A;  3TUO A;  3TCA A;  1SSN A;  3IHP C;  3PRE A;  4KSL C;  4MM3 B;  3TBL D;  1UH6 A;  3QWZ B;  4XX5 A;  3CSF A;  1KLG D;  4ZRI A;  2MP2 A;  3GB1 A;  3SR6 A;  3UIN B;  2K8H A;  3AI5 A;  4BZA A;  3M63 B;  3RNF C;  3MC8 A;  2AL3 A;  3SDL C;  1ACC A;  4WJP A;  2W55 A;  2WLB A;  1JRU A;  1I4G A;  2LGD A;  4YTM B;  4ZRJ A;  4USA A;  5DCN A;  2IO2 B;  3DVG Y;  1HA5 A;  3AE8 B;  2DNF A;  4HWI B;  2BYF A;  2RGF A;  2WYQ A;  2KDE B;  1FPY A;  1CJE A;  1WX9 A;  4KKI A;  3PS6 A;  1JWS D;  4HRO A;  4YT0 B;  3IFW B;  4LJP B;  2N7D A;  1TS5 A;  3PGE A;  4IWQ A;  4RF0 A;  1QLB B;  4LDT D;  1EWC A;  2ONQ A;  4ACF A;  1WY8 A;  1S1Q B;  2KDI A;  1AW7 A;  4DHZ E;  1TY2 A;  1WXQ A;  4PYU A;  2I1J A;  3AE5 B;  3ZTD A;  2KVR A;  1C3T A;  4K7W A;  1TKG A;  3DQV A;  3QIJ A;  4C4V B;  1E5W A;  2EEL A;  3HVD A;  2JXT A;  2MHJ A;  4XWT A;  1EU4 A;  3DBR B;  2DYB A;  3JVZ X;  1L7Y A;  2XN9 C;  4UDU C;  4FUL A;  2N0S B;  1V1O A;  1KTK A;  2JYE A;  5IP4 D;  4TV3 A;  2LUM A;  2KAC A;  5AZF A;  4XWW A;  3PLU A;  2CJN A;  4TKN A;  2LJI A;  3N3K B;  2INP E;  4CQN A;  1ET6 A;  4EEW A;  4L23 A;  1C77 A;  2KX0 A;  2DZM A;  2W3S A;  1SB3 C;  1WGY A;  4XC2 A;  3DBR I;  1MFW A;  2CU1 A;  2GI9 A;  2JZ3 B;  2FCQ A;  1WXA A;  4HVB A;  2MBO A;  1L2N A;  4MGK E;  1YX5 B;  1XCT L;  5FR3 A;  1FIQ A;  3H7S A;  4P7I A;  1KRH A;  4MH8 A;  2HJ1 A;  2W9N A;  3NZ3 A;  3JW0 X;  5E6N A;  1C4P A;  3SFD B;  2NTT A;  4HPM B;  3TEX A;  2BB6 A;  5JH5 C;  2Y5B B;  1OQR A;  1ZOY B;  4JPS A;  2BYT A;  4OZA A;  3IT4 B;  1F2R C;  3L13 A;  1N61 A;  4A6Q A;  3X23 A;  4GGQ A;  2R2O A;  1BML C;  1UZX B;  5EE3 A;  2KTR B;  3EA6 A;  2GMI C;  4JGH B;  3BY4 B;  2O2V A;  3ZNI D;  3AE3 B;  2KN5 A;  2HD5 B;  3RD2 A;  4DHJ D;  1VZ8 A;  3AE6 B;  5J17 A;  1D3Z A;  2AWT A;  1VLB A;  2WX0 A;  3NZU A;  1GJZ A;  3UQA A;  3L4P A;  2J0J A;  4M01 A;  2ICI A;  1ZDX A;  3Q14 C;  4HRS A;  3IVF A;  4TQ1 A;  3E9S A;  1WGH A;  3EGR A;  4IM3 A;  4RGM A;  1T6B X;  3AUL A;  4DQO C;  4E3C A;  3MC9 A;  1E6E B;  1FNV A;  3KWL A;  2N9L A;  2FNJ B;  4P16 A;  2VZK B;  5E6P A;  2FID A;  3APC A;  4G11 A;  4N6E B;  2MBE A;  5H8Y E;  2MEK A;  3O65 B;  5G55 A;  3VHT C;  2KMC A;  2FCN A;  3VTW A;  3TL5 A;  2WXP A;  3DDC B;  3W9C B;  2BTE A;  1WR1 A;  1E7P B;  1BXT A;  1VZ6 A;  1WYW B;  2RD0 A;  4KDI C;  2JRI B;  3Q8B A;  1F2R I;  2K5P A;  4X57 B;  3HIZ A;  2K1F A;  2BVC A;  3H7P A;  3TEW A;  2MLB A;  1I4R A;  1QIL A;  2QIL A;  2PPH A;  3JSV B;  2BWE S;  3L10 B;  4KIK A;  1PQS A;  3NY5 A;  1M94 A;  3QHT A;  3ABV B;  2XNA C;  2MA9 B;  2DEN B;  5C23 A;  3DBL I;  2V3S A;  5IA7 A;  3HRD D;  2KAJ A;  2KK8 A;  1SIF A;  4RF1 A;  3PHX B;  3I3T B;  4EZK A;  3SEB A;  2V1Y A;  1STE A;  4K3B A;  1TS2 A;  1IUE A;  1V5T A;  1YIW A;  4FJZ A;  4ZHO A;  2LGX A;  4S17 A;  2RMM A;  3GE3 C;  1XF5 L;  4WJO A;  4E74 A;  1F77 A;  5LNK 1;  1XCQ L;  2KZR A;  4XDD A;  4PS7 A;  2DYO A;  1FRR A;  1ET9 A;  2KDM A;  1WE6 A;  4WQM A;  3VQI A;  3AB5 A;  2FE8 A;  1F9J A;  5D6J B;  2KQS A;  4MH0 E;  3Q8E A;  3BIN A;  2I1K A;  1V49 A;  1K50 A;  1J8C A;  4G0N B;  2O6V D;  2JF5 A;  3UIO B;  2LEK A;  3K9O B;  2RSU A;  4N59 A;  1FCC C;  3ML8 A;  3AED B;  3ZNZ B;  3LDZ E;  2VRR B;  5BYS A;  1QF6 A;  1GB4 A;  3U8Z A;  3KW5 B;  3EFU A;  1WZ0 A;  1VDV A;  2LUE A;  3W5U B;  3K9P B;  2LVO A;  2WXL A;  4RGO S;  3KH0 A;  2ZEQ A;  4WH4 A;  2PMV A;  3DHG C;  3NG0 A;  4FJY A;  2C7M B;  1K8R B;  1FO4 A;  2N7J A;  3HM6 X;  3MP9 A;  1YN3 A;  2L0F A;  3Q3M C;  1SE4 A;  3CST A;  3RFZ B;  2MP2 B;  4GDK B;  3OAW A;  4JE3 B;  3A9J A;  4C80 A;  3UF8 A;  2IGG A;  3T8M A;  1D5X C;  2M4N A;  3GZN B;  4NPN A;  4NZL B;  1TT5 B;  1NDD A;  3WAO A;  1JWM D;  2ZZP B;  4B9K A;  3KYC D;  1YJJ A;  5C1Z A;  1E8Z A;  4KSK C;  1I42 A;  3Q3J A;  3ZYY X;  2A4Z A;  2ZCB A;  1XO3 A;  3QCA A;  5HI1 A;  2KNB A;  4AUQ C;  4NQL B;  2AX5 A;  4WWN A;  2LHE A;  4MJS B;  5H92 C;  4FA6 A;  3R7R A;  5GXG B;  3EHV A;  3ETR A;  3APF A;  3GZN I;  1KLU D;  1SJE D;  2J52 A;  1C79 A;  4P1C C;  4KDL B;  3CIR B;  1PGX A;  3PT2 B;  2L00 B;  3CMM B;  1V80 A;  2Z8L A;  4JLC A;  2LVP A;  5G5G A;  2Y5P A;  2FUG 1;  1RLF A;  4W9C A;  1ENF A;  1C4A A;  2BQQ A;  1UWX A;  3N9Y C;  4HLE A;  4ARC A;  5KHO A;  3PSE B;  3O13 A;  3I63 C;  4US8 A;  3ENE A;  3VR9 B;  1N5W A;  1L0V B;  3WAN A;  1HEZ E;  2DBY A;  2PTL A;  3A4R A;  3U30 A;  3U7D A;  1YJ1 A;  3Q3O C;  1RRB A;  3DVN U;  1C4C A;  3KUZ A;  4RNA A;  3UIP B;  4ARI A;  2MCN B;  1PGA A;  2PVG C;  1V6E A;  1FNU A;  4MGY E;  3LB8 C;  5GMV A;  2GRI A;  1FFV A;  2DZI A;  1ZXH A;  2KWU B;  3Q6B A;  4GSW A;  2I38 A;  2ASQ A;  1EU3 A;  1P9D U;  2YLM A;  1WMH B;  1D6E C;  2ZNV C;  1D4B A;  4M0W B;  3OLM D;  2MH7 A;  4FHK A;  4JX1 C;  5CX3 A;  1MG4 A;  5AZH A;  2BS3 B;  5G5H A;  2IY0 B;  1TGZ B;  2IZV B;  2KHW B;  1TKE A;  2BGF A;  4DK5 A;  4RMA A;  1F0Z A;  3ZXR A;  3Q69 A;  1FEH A;  2WGS A;  5AUK A;  4M8N A;  3P2B A;  4NJC A;  4WAF A;  2KFK A;  1VZ7 A;  1OQY A;  1RYJ A;  3B0A A;  3N20 C;  2K6D B;  3NVV A;  1DGJ A;  1NYR A;  3PHW B;  3R3M A;  1F52 A;  1LFD A;  2HE7 A;  4BOS C;  4OHJ A;  2WS3 B;  3RN9 C;  3ECI A;  2IGH A;  2L05 A;  3DBH B;  3BYT B;  1ZPS A;  2MJD A;  3TMP B;  1YQ3 B;  1C1Y B;  3J9C A;  2X8X X;  1J19 A;  3DHI C;  3BYY B;  1FD6 A;  5D7G A;  3TEZ A;  3A4S C;  1V97 A;  3BWU D;  5LXH A;  2DWQ A;  5AZG A;  4HPL B;  2KO3 A;  4ASW C;  4EUT A;  3PPA A;  5FR6 A;  2XK5 A;  2XEW A;  3FAH A;  3R66 C;  2KMM A;  3Q3F A;  1FXI A;  3DWG C;  3B2F A;  4NAM A;  2PW9 A;  5CHW A;  3ZDT A;  3DBS A;  1YMH E;  1MG8 A;  2IPK D;  3C19 A;  2OJW A;  5J18 A;  2BWF A;  2K39 A;  2UU7 A;  4EZJ A;  4BOZ B;  1WGR A;  1BUI C;  2KAN A;  1J0G A;  3FKY A;  2X38 A;  1N62 A;  4KGT A;  2FCM A;  2AQ3 B;  2OJR A;  2OHF A;  2FBW B;  1DOI A;  2QHO A;  1Q1O A;  3L16 A;  4KX6 B;  4C7Y A;  3N1X C;  1D5M C;  2IO3 B;  1L6U A;  2LD9 A;  3IBE A;  4QAY A;  3L17 A;  3VUW A;  2PJH A;  5CTR C;  1YJI A;  4GB9 A;  1IBX A;  3N1Y C;  3PRZ A;  1ZKH A;  3V62 A;  2WXI A;  4ITK A;  4DXF A;  4B0E A;  3A1Q B;  3JYU A;  5TR5 A;  1NEN B;  4FN2 A;  5JHB A;  2R2Q A;  1WRD B;  2CU3 A;  1EF5 A;  2NR2 A;  2IO1 B;  2CHX A;  2MSE D;  2INN E;  2K3U A;  2N7E A;  3KVF B;  2JX5 A;  3WAP A;  3RNC C;  2IO0 B;  1WSP A;  1YN4 A;  5BMG A;  3RUL A;  4A20 A;  3ZQ4 A;  5JHA A;  1G6J A;  4LJO B;  4KKJ A;  4NY0 A;  1SEB D;  2WDR B;  4REZ A;  2DAJ A;  4YSX B;  3WAM A;  2JPH A;  2KC1 A;  1AWD A;  2CS4 A;  3RYT A;  3PZD A;  4W9K A;  1ZGU B;  3AEC B;  1ESF A;  4HDQ A;  4S0R A;  4OW0 A;  3ALB A;  1GOZ A;  3TSS A;  4R3D A;  4CO7 A;  4RGT A;  3R8B A;  2SEB D;  2DYM A;  2WU5 B;  1E8X A;  1EO6 A;  2M8S A;  2LMC A;  1L5P A;  3NHE B;  4BKG A;  1T0Q C;  3AEE B;  4IDI A;  1CK1 A;  1RFA A;  3CWI A;  1E7U A;  4W9E A;  1QZE A;  1R4N I;  4BBN F;  1N63 A;  3AE9 B;  4KVG B;  2LAS A;  3A9K B;  5CHF A;  5HFY A;  2LRU A;  2GOW A;  2PEA A;  4LNF A;  3V6E B;  1OEY A;  1E90 A;  2JT4 B;  4HEA 1;  2PLP A;  2DAF A;  1E7V A;  2L0T A;  4II3 B;  3HVZ A;  3SD5 A;  4YTN B;  4RM8 A;  4ANV A;  1NYQ A;  3MHS D;  4AJW A;  2N9X A;  2J0K A;  3NZS A;  1WRI A;  1XD3 B;  2W3R A;  2C9W B;  3MHZ A;  2WXF A;  4WWM A;  4DHZ B;  1HE8 A;  3LJ3 A;  2WXM A;  4HDO A;  2AYO B;  3IAS 1;  3RUI B;  4CHK A;  1KF6 B;  4KGR A;  2K25 A;  3L54 A;  3ONS A;  2KLC A;  2G45 B;  4RGN A;  2K8C A;  1L4D B;  3KYD D;  4OVU A;  2QDF A; 
#chains in the Genus database with same CATH homology
 3OG5 A;  4QAY A;  4K3C A;  4BZA A;  4C4V A;  4K3B A;  3MC8 A;  4C00 A;  3MC9 A;  2VH2 A;  2VH1 A;  3Q6B A;  2X8X X;  4C4V B;  4PK1 A;  2QCZ A;  2V9H A;  3EFC A;  3NJT A;  4XGA B;  2MHJ A;  2QDF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...