4XGAB

Crystal structure of bamb and bama p3-5 complex from e.coli
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
174
structure length
174
Chain Sequence
AEIQQINIVGNHAFTTDELISHFQLRDEVPWWNVVGDRKYQKQKLAGDLETLRSYYLDRGYARFNIDSTQVSLTPDKKGIYVTVNITEGDQYKLSGVEVSGNLAGHSAEIEQLTKIEPGELYNGTKVTKMEDDIKKLLGRYGYAYPRVQSMPEINDADKTVKLRVNVDAGNRFY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Protein binding/membrane protein
molecule keywords Outer membrane protein assembly factor BamB
publication title Structural basis for the interaction of BamB with the POTRA3-4 domains of BamA.
pubmed doi rcsb
source organism Escherichia coli (strain k12)
total genus 52
structure length 174
sequence length 174
ec nomenclature
pdb deposition date 2014-12-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF07244 POTRA Surface antigen variable number repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.310 Alpha Beta Roll Ubiquitin-like (UB roll) membrane protein fhac 4xgaB02
3.10.20.310 Alpha Beta Roll Ubiquitin-like (UB roll) membrane protein fhac 4xgaB01
4C4VB 3NJTA 3MC9A 3OG5A 4C4VA 4K3CA 2QDFA 3Q6BA 3EFCA 4PK1A 4QAYA 2VH1A 2MHJA 2QCZA 2X8XX 2VH2A 2V9HA 4C00A 3MC8A 4BZAA 4XGAB 4K3BA
chains in the Genus database with same CATH superfamily
2FIFA 1JRUA 2L1AA 3BYTB 2B76B 1D5MC 3DBRI 3RPFC 2C60A 5AUKA 1NYQA 3AU5A 2QIEB 4MM3A 1YJ1A 2Y5PA 3PZDA 4XDDA 1ZDXA 1M94A 3OJ3A 1UD7A 1C77A 4LNNA 4DHZE 4C00A 4AP4C 3HIZA 4BZAA 3AE1B 3BYYB 4C7ZA 2FUHB 2DENB 1QOAA 2REXA 2CJOA 4RNAA 3X23A 3LB8C 1EF1A 4O1NA 1EU3A 1WXSA 3IT4B 2K8BA 3W1YA 4OVZA 1JWAD 4S17A 4KZCA 3AXCA 3ZNID 3RNEC 4JE3B 2WGSA 2WXFA 2BWES 3K9PB 5D3IB 2MWSB 2EMSA 4LCDE 5AZFA 4HRSA 2M0XA 2BF8B 3R66C 2QSDA 1VZ7A 2J0MA 3RNFC 3U8ZA 1WFYA 1AN8A 3PHWB 2CKHB 4K7WA 3TL5A 4C4VB 2WDVB 4WWMA 1SIFA 1C78A 1WGDA 2K8HA 1U4AA 2O2VA 2BGFA 1WWTA 4JWUC 3MJWA 1VLBA 2FIDA 1TS3A 1PQSA 1NEKB 4N9F4 2BW2A 1E9MA 4B0MA 2KJHB 3Q8EA 4YL8A 2W9NA 4W9LA 3DHGC 2HTME 4NJCA 1C3TA 3RCZA 1C4PA 4MJSB 4A20A 3QA8A 2Y5CA 1V6EA 1RYJA 5C23A 4GOCA 2WQYB 1YIWA 5CX3A 2MX2A 4J3OD 2KFKB 1YOVB 3WA0A 3EA6A 3BVMA 4LJPB 3Q69A 1YX6B 2CU3A 1I4RA 1OEYJ 4NPNA 1YN4A 1FFUA 2KYWA 3AULA 2LGXA 4KDLB 1SE9A 1ESFA 3Q14C 4P1BC 1EF5A 3QCAA 1XLNA 3L17A 4BVUC 4MELA 2MLBA 2BS3B 4BOSC 4MGKE 2KTRA 2L8JA 4LNKA 1FNVA 4FBJB 1V1PA 1FNUA 3EECA 3Q3OC 4K3CA 4JWSC 1GB4A 3KW5B 1LQBA 4LNOA 2CS4A 3AE3B 2M56B 5TR5A 1C76A 1GG3A 2AWTA 3GS2A 2HDEA 4GU2A 2JRHA 3V61A 1EO6A 1EWYC 4OZAA 4HJGE 4FN2A 1Z2MA 2UWQA 1F2RC 4FULA 1PYWD 3E56A 3I57A 4BOZB 3L54A 4EZLA 1L0YB 1MG4A 5CHVC 2CR5A 1YQ3B 2NS5A 2RDGA 1SJHD 3WCQA 2R2OA 2KQ7A 3RUIB 1BMLC 1YMHE 1H8CA 4XE0A 3VR8B 3KYCD 1WJNA 1GJZA 2K6QA 3PS6A 2WXJA 1ET9A 2BBCA 1D5ZC 2BYEA 1GAQB 3NJTA 4PS7A 2D3GA 3BINA 2KNBA 4YTNB 5E6PA 4GIVA 1T6BX 2QEJC 1T0RC 2JYEA 4EEWA 3VRAB 3JSVB 3JVZX 4R3DA 3BVZA 1P98A 3KH0A 2UYZB 3SEBA 2KDIA 1T0SC 4PYUA 2DZIA 3BY4B 2DX5B 3WANA 1OQRA 4G3XB 1GUAB 1NI2A 1X1MA 2WXKA 3VQIA 3MHZA 5AEKB 3NVZA 3A9JA 4IM3A 3N3KB 5E6NA 2WWZA 4RFBA 1F0ZA 2NPTB 1IPGA 3UI3A 2KQSA 3RZWC 2WU2B 3A4SC 2V1YA 1WXQA 2MBOA 1UWMA 2J42A 3LXFA 1CK1A 2WHIA 2GB1A 3C0RB 5D2MB 1QOFA 3QHTA 3N1YC 2VRRB 1ROEA 5H8YE 3TEXA 3KLSX 4TMAB 4RMAA 1DOXA 4W9IA 3ZRFA 3RI7C 2KMAA 4FHJA 3KVFB 2M1MA 2SAKA 1V8CA 4M8NA 2K9XA 3N1ZC 1SE4A 5IKCM 5BMIA 1HXYD 2EKEC 2D2QA 4BKSA 3W2DA 2XK5B 1D6EC 2KFKA 3UINB 3ECIA 4GDKA 3B1LX 4EUTA 4B9KA 4MGIE 1PGXA 2Y3AA 1JWUD 4HLEA 1YJIA 2RGFA 2DBYA 1ZW7A 2ZJDA 1IBXB 1AARA 3DBSA 3M62B 3P2BA 1RLFA 1WX8A 2D3BA 3GE3C 1TYGB 2X8XX 2M4NA 3P4QB 4DQOC 2QILA 5DPWA 3WIMA 2N7EA 1JMLA 4K7SA 1D3ZA 4W9DA 4MH8A 2ICIA 3N32A 3AEFB 4NZLB 1TTNA 4LDTD 1JCKB 1UWXA 2D5GA 3DQVA 2LMCA 4EOYA 2SEBD 3VTVA 4ANUA 3O65B 3ZUNA 3H6NA 4A8XC 1SSNA 4KDIC 2D07B 1OTRB 4G11A 3U2SC 1TS5A 2JPHA 2G1EA 1QQRA 5IAAC 3BK1A 2G9HD 3AV8A 1KJTA 3T3OA 2OOBB 1JWSD 2MSED 1FXIA 2IGHA 4L23A 3AE7B 2PEAA 1L7YA 1H4RA 2WXMA 4FJYA 3GZNB 2Y5BB 2L3ZA 4XC2A 4XZ4A 2WX0A 4DXGA 2O6VB 1V80A 5EE3A 2KKCA 1E8XA 2QDFA 4HKZE 5JZEB 2J7QB 1UBQA 2KMMA 4NQKE 1P9DU 3V3XA 4B6WA 3HM6X 1F2RI 3JSVA 1WIAA 4GDLB 1QILA 2MBHA 2KDBA 2Z8LA 1WRIA 3MTNB 5JHBA 3AB5A 3Q8BA 1M4VA 4TQ1A 1I4PA 2JSVX 2JF5A 3ZNGC 1LFDA 4IM0A 5J2RA 2ZNVB 2CJNA 1J7CA 4C7YA 2KMCA 1BT0A 1VZ8A 2L32A 2NPTA 2I38A 2JUOA 2JU6X 5CTRC 3FILB 2QMTA 4NAWB 2NR2A 2RDBC 2MP2A 4KKJA 2E3TA 2VH1A 1WZ0A 3PO0A 3U4EG 5J18A 4DBGA 4A6QA 1C79A 1WGHA 1Y56A 3KUDB 1YN3A 1SJED 2DWQA 2GBKA 4XDCA 3NS8A 4IC7B 1K8RB 1IYFA 1Q1OA 1WJ4A 4MGZE 2XN9C 2HD5B 2R2QA 1PGAA 2FE8A 1N60A 1WJ6A 3P4SB 3ZYYX 1UELA 3CIRB 4TUUA 3I63C 4YTPB 1ZXHA 3FKYA 1PDXA 5C2TB 1KF6B 3OLMD 1HTOA 3EFUA 4W9JA 2G4DB 4LNIA 1NBFC 2BS2B 5LXIB 4ZYNA 4GMVA 4LNFA 2FCSA 1FNWA 3CSTA 1E10A 2KT7A 4ZRKA 4KVGB 3P1MA 1E8WA 2LD9A 1WX9A 3PZ7A 1TKGA 2KLGA 3ZTCA 1Z5SB 3CF6E 3P4PB 5HKHA 3U52E 1FRDA 1HTQA 4IKGA 5IA7A 1E8ZA 1JALA 2WLBA 3R2TA 5AUIA 2LVQA 1MG8A 5G55A 1FMAD 3BWUD 5C1ZA 2EMTA 2ZPYA 1SXTA 2G3QB 4E74A 2J0KA 1VR9A 4YT0B 2JVCA 4IWOA 2OJRA 1TZ1A 4F8CB 1P7FA 2QC8A 2LVOA 3PREA 2WXPA 1WZ3A 2J4XA 4CYEA 1FEHA 4M0WA 3PLVA 3L0WB 2LI5A 1F77A 1EWCA 5KHQA 3I5JC 1L0VB 4KGRA 3N20C 2MA9B 2RR9A 1R4MB 2IO2B 1PUTA 1RFKA 1VRAB 3W5VB 3H7PB 4MGYE 4WJQA 1WXMA 3E9SA 2PJHA 3A9KB 5LXHA 3PHXB 1WGKA 3QAQA 2K39A 3HVZA 2GBNA 2GRIA 2V4LA 2HJ8A 2JX5A 3MP9A 3AE9B 4WQOB 3C19A 4DHZB 4MH0E 2CHXA 3NS1A 4CO7A 4GLSC 2LWPA 4Q2JA 4II2B 3DDCB 4ARCA 1UF0A 3DCGA 1WH3A 1I4XA 3ZRCA 1WGRA 1FM0D 1P0RA 1SF0A 2PPHA 3B0AA 4HCPB 3TBLD 4W9CA 3H8HA 4KZ0A 4KIKB 3NZSA 4USAA 4YWGG 2K8CA 3V6CB 1N61A 3OJ4B 1A70A 3DBLB 4YSYB 2CU1A 4KKIA 3ZXVA 3CMMB 3IFWB 2ZW0A 4DXAB 1SE3A 4EKUA 1HA5A 4HPMB 2KAJA 1VZ6A 5EE1A 2DYBA 2AX5A 1KRHA 3IT6B 2RPQA 4ZRQA 2A5UA 4N6EB 2I2YA 3ETRA 1WYGA 2JZPA 2MH7A 3VRBB 2KANA 3AMZA 1XCQL 1WMHA 4UDUC 3AEEB 3PRPB 2C5LC 1RFAA 1ENFA 5J17A 3DOWA 2RPVA 4K1RB 2N1WA 3KYDD 2BPSA 2BT6A 1VD2A 2D3AA 1C4CA 2MEKA 2N1VA 3PTFC 2KVRA 4IOIE 1L4DB 2ACZB 1CMXB 2BS4B 2RSUA 2L83A 1XLPA 4MT5A 3AM9A 1RAXA 1T0YA 1YN5A 2FCQA 4MSQB 3Q3JA 4IUMB 3H9DA 3WAOA 2WXRA 2ONQA 4ZHOA 3ZLZA 1IP9A 5DPRA 4NJ7A 5D3DA 1NDDA 2JY6A 2AL6A 4FJZA 5BMHA 3QIJA 3SD5A 2WXOA 4YSZB 5BMGA 4IG7B 5HI1A 1I7HA 3JW0X 3OWEB 1QOGA 3VFKA 1TZOA 2FBWB 3R2IA 1JWBD 3MJ5A 4XWWA 2PLPA 2JQRB 1T3QA 1QKZA 1TIFA 4IWPA 3V6EB 1KFYB 2A4ZA 5KHOA 1VJKA 3ZDTA 1S1QB 4M00A 2GBMA 2KLCA 1R7SA 4JLCA 1FIQA 3WALA 3DBRB 3AU4A 3VAWA 3VXWA 2RDHA 1NVID 3DHHC 5G5HA 4FLHA 1N62A 3ZNZB 1FRRA 3OAWA 1FD6A 4EZJA 4WIPA 3HHMA 2ASQA 3RT3B 4M01A 4PT5A 1BXTA 3UIPB 1YD8U 1KOTA 1CJEA 2V3PA 1JW9D 4II3B 1I4GA 3I9V1 2M8SA 4CQNA 2MJEA 4RH6A 3TIXA 2O6VD 1F9JA 4FADA 1F52A 1TKEA 5EE0A 5IOIA 2DYOA 3J9CA 4NQLB 4DWFA 2IYDB 2WP9B 2KO3A 4ASWC 2K3UA 3URYA 3DBHB 3BZDB 2QCZA 3VTWA 1AWDA 3ABVB 2FNJB 1NI3A 1J0GA 1XXGA 3EHVA 3ZO5B 3HUIA 2KWCA 2L0FA 4G0NB 1FXAA 2M17A 2GBRA 3NY5A 4L2YA 3M3JA 4KX6B 1YJJA 3U7DA 1FO4A 3BVGA 3IAS1 2OJWA 4GB9A 2LGSA 5D94A 4KIKA 2N9KA 1T0QC 3AE6B 3ZVVA 1RWSA 2V3NA 2N9LA 4C4VA 3L13A 1OEYA 3LJ3A 4ARIA 1SE2A 2BKRB 3TMPB 5H92C 3RMKC 1L4ZB 2N0SB 3L16A 1DYQA 1I4HA 1SIJA 2PVOD 4C80A 3O13A 2KC1A 4B95A 2XNAC 4NAMA 4MJSA 1DGJA 2W82A 1JQ4A 2K25A 4AUQC 1MHHE 1TS4A 5EE9A 2AQ1B 1TGZB 2LGDA 4TV3A 2PW9A 2L52A 2R61A 2W3RA 3T3NA 1E5WA 2D11A 4W9GA 2K6DB 1E7VA 2Z0DB 1TY2A 4WWOA 1D4BA 3DPDA 5BYSA 2I1JA 3RD2A 3MFGA 1XEEA 4J6IA 3IAM1 1J7AA 4OVUA 1SB3C 2LJ5A 4BKTA 4XWTA 4ZRJA 2ZCBA 2OEDA 3R7RA 3ZKJC 3Q3MC 2ZZPB 4H2AA 4JX1C 2LASA 5E6JA 1IGDA 4TKNA 2KWDA 3NOBA 4WJOA 3ZIMA 1KTKA 2JYTA 4YXDB 4HPLB 2XBBC 3B9JA 2YEPF 1XQQA 2WDTB 2ZVOA 3ZQ4A 2MQJA 2NTTA 1Y8RC 1QOBA 3V05A 5FKAC 1CQVA 2AEHA 3ZGZA 2BTEA 2KX0A 3X0WA 3L10B 2D10A 2QHOA 3BIID 1K53A 4DK5A 1EUVB 5BYRA 2W54A 2WXLA 5AZGA 2IGGA 1ZUD2 3MC0B 2LXCA 4ANXA 1R4NI 5I4DA 5HFYA 3H7SA 5TSSA 2PMVA 4EZKA 1ZOYB 3PSEB 4MDKE 4M8MA 3RNBC 2NVUI 1PFDA 1WR6E 1E7UA 4RGOS 2K22A 3NZ3A 2WXHA 3PRZA 3NVVA 4I6LB 3GP7A 1C1YB 1Q5WB 3KWLA 2V4IB 4TQ0A 1N6ZA 2DYMA 3W1SC 3PZ8A 2J0JA 3AEGB 2LGYA 2LZ6A 3HK0A 4GXBA 2NCNA 3W1SA 2KVZA 2DZMA 3VHTC 3QWZB 1FFVA 1UH6A 1MFWA 3APDA 2KC2A 3A33B 2EELA 3TEWA 3AECB 3LDZE 4JIOU 3VR9B 2KDMA 2K0PA 1WYWB 4WJNA 2JXXA 2KK8A 3AEBB 3AEDB 3R7QA 4MSMB 1LXDA 2PE9A 3A1QB 1OFFA 4JQWC 2LVPA 3HM3A 1WY8A 2O2VB 2NBUA 3K9OB 1A5RA 2LFIA 2WNMA 3L08A 4IW0A 2MBEA 3RFZB 2FCMA 2VZKD 2D3CA 2TSSA 2XK5A 1N5WA 2Z59B 4B0EA 1IUEA 1F1HA 4HKQA 1ACCA 2I1KA 1MHXA 3ZNHB 1E90A 3M63B 1ZXIA 3GB1A 2IY0B 2LEKA 4HXDA 2NBVB 2KZRA 3OG5A 2KDFB 4F7ZA 3JYUA 3QC8B 1IBXA 4ZRPA 2JRIB 2IJ0A 2KN4A 3EFCA 1SBBB 2BB6A 2C9WB 3UF8A 3PVLA 1E8YA 3EGRA 3GE8C 4YSXB 2LHEA 2K5PA 3AE5B 4HK2A 2GLSA 5CHFA 3ML8A 4RGTA 1GOZA 5JXVA 2JZ3B 1L6VA 5BO4B 4E3CA 3PT2B 2LRUA 2N4FA 2H88B 4ACFA 4GSWA 3VH3B 2ZCCA 3DVNU 3CWIA 2LGIA 4AS1A 5FR3A 1JROA 3T8MA 1XCTL 1E6EB 2C7MB 1V1PB 2XEWA 3PLUA 1KLVA 5EDSA 3TJPA 1Q0WB 2AYOB 3PGEA 4GN1A 2IGDA 4HWIB 3VVWB 3GOEA 2C7HA 3BK2A 2L05A 1TJEA 4AQ7A 1XT9B 3B2GA 1HEZE 4RM8A 2BWFA 2L00B 3CSFA 2YVCA 1I42A 4KSKC 1AYFA 3B08A 3IBEA 1TS2A 2O6VA 3APFA 3WAPA 3IVFA 3Q3NC 4DDGD 1MPEA 1V49A 1HZ5A 5GMVA 3RN9C 5MPOA 1WRDB 1J8CA 2PTLA 1UGJA 3MC8A 4P7IA 4G50A 4GDLA 2PIAA 1Q10A 4DHJD 4JGHB 4W9KA 3VUYA 4KGTA 3N30A 2ZNVC 1GB1A 3SU8X 2HJ1A 2V9HA 2WXNA 4FHKA 2KACA 4ICUA 5BYQA 3Q8FA 2MBQA 3DBHI 5G2NA 4AOFA 1I35A 5LLIA 2LHDA 3RYTA 2BYFA 3H1UA 1GC7A 3A9JB 1L0XB 2AQ2B 4NY0A 5AZHA 2NBWB 3FILA 1OGWA 1K51A 2MJDA 4KV2A 4NAWA 4TSSA 3V60A 2J52A 4ZOHC 1GPXA 2B3AA 4P1CC 3A1QA 4BBNC 3AN1A 4EE2A 3Q8CA 1SEBD 3SHQA 4ICVA 1TKYA 3ZTDA 3UQAA 3KQ4A 4AWJA 1WXAA 1UGMA 3ZJVA 3P4RB 5IN7A 1NENB 2VZKB 1LGRA 1WR1A 2MHJA 5JHAA 5CHWA 1OQYA 3D32A 2WXGA 3AI5A 4RF1A 2IPKD 2QJLA 1XO3A 5C3JB 4WAFA 4REZA 4JPSA 4HCNB 4HJKA 4W9EA 1UBIA 2WX1A 3N9YC 3ZDMC 1WGYA 4US8A 1BUIC 3SFDB 2DAJA 2HTHA 2KOXA 2X38A 4ZRIA 2ON8A 2W3SA 5HHDG 4E71A 2NTSA 4GDKB 1YX5B 2KJ6A 5D7GA 4RGNA 2N7DA 2V0GA 1ZPSA 4HDQA 1EM7A 3ZJUA 3AE4B 4XYCA 4CHKA 2IO3B 3VDZA 1WF9A 2RMMA 2N9XA 3VUXA 4XGAB 3AEAB 4US9A 3IG3A 2L76A 1FCLA 4ANVA 1MVKA 4A3OA 4OHJA 1IGCA 4HVBA 2IY1B 2Z0EB 2PVGC 2WDQB 1SGHA 4JL9A 2JWZA 4F1SA 3R8BA 4P16A 2MRPA 3VUWA 2BQQA 2M0AA 1GC6A 1YQBA 2KXJA 3AE8B 4LK0M 1VCBA 2LRWA 3T9LA 2EKIA 2KWUB 2V3SA 5LNK1 1L6UA 1GNUA 2DZJA 2MBBB 3TUOA 2KD0A 4RGMA 1K50A 4MACA 3H7PA 3I3TB 3KUZA 3ML9A 4LLGM 3A9KA 4DXFA 2HE7A 3P63A 4EFOA 2LJIA 5GXGB 1WJUA 1P3QU 2OHFA 1KLUD 2E6XA 2KDEB 1ET6A 4NNJB 1V81A 1EU4A 2DLBA 3A4RA 4FXCA 2LUMA 1ZE3D 2WXIA 3DVGY 3VH4B 4DHJB 2KQ4X 3GZNI 5T8IA 3AE2B 3W9CB 1V86A 2IDYA 2YLMA 3Q6BA 5DPSA 3DVNV 1S3SG 4OVVA 3B2FA 4DDID 1L5PA 3EC8A 2WU5B 2INDC 4AJYB 3RZFA 3N1XC 4X57B 4FA6A 4PK1A 2KFJA 2FCNA 1FXTB 5DCNA 3W5UB 4A3PA 3DWMA 4BAXA 2KWVB 4N58A 2IO0B 2G45B 1ZKHA 2DHZA 1WSPA 1NYRA 2G4SA 3DHIC 4WJPA 2INPE 2L0TA 3TCAA 3NVYA 4K7UA 5D6JB 2MP2B 4OZBA 2Q5WD 4L1BA 4S0RA 1ZGUB 1FPYA 5L95C 4WAAA 3NVWA 3EUB2 3UQBA 3RNCC 1OQQA 2DZKA 3MHSD 3NRZA 4K81A 1QZEA 3FC4A 2MJ3A 5E6OA 2WXQA 2ZW1A 5JH5C 1B1ZA 2GOWA 3DVGX 4OZCA 1UUPA 2LUEA 2PE6B 4HDOA 4YTMB 1UNSA 3ALBA 3RNAC 3M95A 3U30A 2VH2A 3WAMA 3C8YA 3Q8AA 1N5XA 3SFEB 3SR6A 1B9RA 3PV1A 5G5GA 2INCC 1LM8B 4XX5A 5IP4D 4HEA1 2BKFA 2ZPNA 2CHZA 1XLOA 1P1AA 2M19A 1N63A 3IHPC 2YEPB 2INNE 4I6NB 1VDVA 3KWVA 1WXVA 2GMIC 4HROA 3APCA 4ZYSA 1QF6A 1TBEA 1TY0A 4ITKA 2K1FA 3QK0A 2JWUA 4BFRA 3MC9A 2JXTA 4I6PA 1E7PB 2BB5A 3AH7A 3HRDD 1V5OA 1V1OA 1CZPA 2N9PC 3UIOB 2FAZA 2GI9A 3ONSA 1ZDVA 4GGQA 1L2NA 4OW0A 2NMQA 2L7RA 2N9EB 3V62A 4URKA 4P6VF 1J19A 2JZZA 4K3BA 1WM3A 1QLBB 1DOIA 3VTUA 4A55A 4A90A 2N7JA 4LJOB 4MM3B 3QQ8B 1YQ4B 4M0WB 2BYTA 3SDLC 1MI0A 2IZVB 1P7EA 1HQRD 2BYVE 2WDRB 3TEYA 2ZEQA 4MEMA 4LTUA 3ZXRA 4KSLC 3QX1A 4N59A 1FCCC 1V97A 2MW5A 3L4PA 1R4MI 1XF5L 4M02A 1HE8A 2J53A 3LYYA 1WX7A 1WGGA 1J7BA 4NJ6A 4W9HA 1ZP0B 4WQMA 2KX3A 4W9FA 1WI0A 2BVCA 2DNFA 4PS8A 1LO5D 1MJDA 3NHEB 5HG2A 1WM2A 4PYZA 1STEA 3ZW3A 1V5TA 3U7ZA 1JWMD 1QT9A 3QJZA 1KH0A 4BKGA 4AJWA 4PS3A 1XD3B 1HZ6A 4WURA 3PRMB 5DPTA 1V2YA 1JRPA 4KGSA 1AW7A 3DBLI 1UZXB 3PPAA 2JT4B 1E0ZA 4FJVB 4C56C 1KM7A 3KUCB 2UU7A 1WE6A 4HPPA 1ISNA 1WMHB 1G6JA 3FAHA 4IDIA 3RNGC 3UGBB 3Q2AC 3Q3FA 3TEZA 2KHWB 1XLQA 1KLGD 2LXAA 2CHWA 1T5XD 2MCNB 4BKSD 4WWPA 5FK9C 1DOYA 2AQ3B 1V9JA 2KJRA 4WWNA 4BBNF 4A9AA 3NUHB 2FUG1 3QARA 4IWQA 3ENEA 3NZUA 3S2AA 2IO1B 2KN5A 1PGBA 4IM2A 2H89B 2PKOA 3IXSA 4ZDVA 2KTFA 3TSSA 1TT5B 2C7NB 1I4QA 4QAYA 1K52A 2ZVNA 3HVDA 1RRBA 2W55A 3R3MA 5IO9A 2AL3A 5FR6A 2KTRB 4RM9A 2IBIB 4WH4A 4RF0A 4ANWA 1C4AA 1RM6C 5L83A 4D2KA 1WE7A 3RULA 3NG0A 1D5XC 2RD0A 4LDTB 3ZJTA 1C9FA 1YNTE 4ZHPA 2DAFA 3P42A 2WS3B 4RCOA 1R4NB 3DWGC 2GBJA 2WYQA
chains in the Genus database with same CATH topology
4C4VB 3NJTA 3MC9A 3OG5A 4C4VA 4K3CA 2QDFA 3Q6BA 3EFCA 4PK1A 4QAYA 2VH1A 2MHJA 2QCZA 2X8XX 2VH2A 2V9HA 4C00A 3MC8A 4BZAA 4XGAB 4K3BA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4C4V B;  3NJT A;  3MC9 A;  3OG5 A;  4C4V A;  4K3C A;  2QDF A;  3Q6B A;  3EFC A;  4PK1 A;  4QAY A;  2VH1 A;  2MHJ A;  2QCZ A;  2X8X X;  2VH2 A;  2V9H A;  4C00 A;  3MC8 A;  4BZA A;  4XGA B;  4K3B A; 
#chains in the Genus database with same CATH topology
 2FIF A;  1JRU A;  2L1A A;  3BYT B;  2B76 B;  1D5M C;  3DBR I;  3RPF C;  2C60 A;  5AUK A;  1NYQ A;  3AU5 A;  2QIE B;  4MM3 A;  1YJ1 A;  2Y5P A;  3PZD A;  4XDD A;  1ZDX A;  1M94 A;  3OJ3 A;  1UD7 A;  1C77 A;  4LNN A;  4DHZ E;  4C00 A;  4AP4 C;  3HIZ A;  4BZA A;  3AE1 B;  3BYY B;  4C7Z A;  2FUH B;  2DEN B;  1QOA A;  2REX A;  2CJO A;  4RNA A;  3X23 A;  3LB8 C;  1EF1 A;  4O1N A;  1EU3 A;  1WXS A;  3IT4 B;  2K8B A;  3W1Y A;  4OVZ A;  1JWA D;  4S17 A;  4KZC A;  3AXC A;  3ZNI D;  3RNE C;  4JE3 B;  2WGS A;  2WXF A;  2BWE S;  3K9P B;  5D3I B;  2MWS B;  2EMS A;  4LCD E;  5AZF A;  4HRS A;  2M0X A;  2BF8 B;  3R66 C;  2QSD A;  1VZ7 A;  2J0M A;  3RNF C;  3U8Z A;  1WFY A;  1AN8 A;  3PHW B;  2CKH B;  4K7W A;  3TL5 A;  4C4V B;  2WDV B;  4WWM A;  1SIF A;  1C78 A;  1WGD A;  2K8H A;  1U4A A;  2O2V A;  2BGF A;  1WWT A;  4JWU C;  3MJW A;  1VLB A;  2FID A;  1TS3 A;  1PQS A;  1NEK B;  4N9F 4;  2BW2 A;  1E9M A;  4B0M A;  2KJH B;  3Q8E A;  4YL8 A;  2W9N A;  4W9L A;  3DHG C;  2HTM E;  4NJC A;  1C3T A;  3RCZ A;  1C4P A;  4MJS B;  4A20 A;  3QA8 A;  2Y5C A;  1V6E A;  1RYJ A;  5C23 A;  4GOC A;  2WQY B;  1YIW A;  5CX3 A;  2MX2 A;  4J3O D;  2KFK B;  1YOV B;  3WA0 A;  3EA6 A;  3BVM A;  4LJP B;  3Q69 A;  1YX6 B;  2CU3 A;  1I4R A;  1OEY J;  4NPN A;  1YN4 A;  1FFU A;  2KYW A;  3AUL A;  2LGX A;  4KDL B;  1SE9 A;  1ESF A;  3Q14 C;  4P1B C;  1EF5 A;  3QCA A;  1XLN A;  3L17 A;  4BVU C;  4MEL A;  2MLB A;  2BS3 B;  4BOS C;  4MGK E;  2KTR A;  2L8J A;  4LNK A;  1FNV A;  4FBJ B;  1V1P A;  1FNU A;  3EEC A;  3Q3O C;  4K3C A;  4JWS C;  1GB4 A;  3KW5 B;  1LQB A;  4LNO A;  2CS4 A;  3AE3 B;  2M56 B;  5TR5 A;  1C76 A;  1GG3 A;  2AWT A;  3GS2 A;  2HDE A;  4GU2 A;  2JRH A;  3V61 A;  1EO6 A;  1EWY C;  4OZA A;  4HJG E;  4FN2 A;  1Z2M A;  2UWQ A;  1F2R C;  4FUL A;  1PYW D;  3E56 A;  3I57 A;  4BOZ B;  3L54 A;  4EZL A;  1L0Y B;  1MG4 A;  5CHV C;  2CR5 A;  1YQ3 B;  2NS5 A;  2RDG A;  1SJH D;  3WCQ A;  2R2O A;  2KQ7 A;  3RUI B;  1BML C;  1YMH E;  1H8C A;  4XE0 A;  3VR8 B;  3KYC D;  1WJN A;  1GJZ A;  2K6Q A;  3PS6 A;  2WXJ A;  1ET9 A;  2BBC A;  1D5Z C;  2BYE A;  1GAQ B;  3NJT A;  4PS7 A;  2D3G A;  3BIN A;  2KNB A;  4YTN B;  5E6P A;  4GIV A;  1T6B X;  2QEJ C;  1T0R C;  2JYE A;  4EEW A;  3VRA B;  3JSV B;  3JVZ X;  4R3D A;  3BVZ A;  1P98 A;  3KH0 A;  2UYZ B;  3SEB A;  2KDI A;  1T0S C;  4PYU A;  2DZI A;  3BY4 B;  2DX5 B;  3WAN A;  1OQR A;  4G3X B;  1GUA B;  1NI2 A;  1X1M A;  2WXK A;  3VQI A;  3MHZ A;  5AEK B;  3NVZ A;  3A9J A;  4IM3 A;  3N3K B;  5E6N A;  2WWZ A;  4RFB A;  1F0Z A;  2NPT B;  1IPG A;  3UI3 A;  2KQS A;  3RZW C;  2WU2 B;  3A4S C;  2V1Y A;  1WXQ A;  2MBO A;  1UWM A;  2J42 A;  3LXF A;  1CK1 A;  2WHI A;  2GB1 A;  3C0R B;  5D2M B;  1QOF A;  3QHT A;  3N1Y C;  2VRR B;  1ROE A;  5H8Y E;  3TEX A;  3KLS X;  4TMA B;  4RMA A;  1DOX A;  4W9I A;  3ZRF A;  3RI7 C;  2KMA A;  4FHJ A;  3KVF B;  2M1M A;  2SAK A;  1V8C A;  4M8N A;  2K9X A;  3N1Z C;  1SE4 A;  5IKC M;  5BMI A;  1HXY D;  2EKE C;  2D2Q A;  4BKS A;  3W2D A;  2XK5 B;  1D6E C;  2KFK A;  3UIN B;  3ECI A;  4GDK A;  3B1L X;  4EUT A;  4B9K A;  4MGI E;  1PGX A;  2Y3A A;  1JWU D;  4HLE A;  1YJI A;  2RGF A;  2DBY A;  1ZW7 A;  2ZJD A;  1IBX B;  1AAR A;  3DBS A;  3M62 B;  3P2B A;  1RLF A;  1WX8 A;  2D3B A;  3GE3 C;  1TYG B;  2X8X X;  2M4N A;  3P4Q B;  4DQO C;  2QIL A;  5DPW A;  3WIM A;  2N7E A;  1JML A;  4K7S A;  1D3Z A;  4W9D A;  4MH8 A;  2ICI A;  3N32 A;  3AEF B;  4NZL B;  1TTN A;  4LDT D;  1JCK B;  1UWX A;  2D5G A;  3DQV A;  2LMC A;  4EOY A;  2SEB D;  3VTV A;  4ANU A;  3O65 B;  3ZUN A;  3H6N A;  4A8X C;  1SSN A;  4KDI C;  2D07 B;  1OTR B;  4G11 A;  3U2S C;  1TS5 A;  2JPH A;  2G1E A;  1QQR A;  5IAA C;  3BK1 A;  2G9H D;  3AV8 A;  1KJT A;  3T3O A;  2OOB B;  1JWS D;  2MSE D;  1FXI A;  2IGH A;  4L23 A;  3AE7 B;  2PEA A;  1L7Y A;  1H4R A;  2WXM A;  4FJY A;  3GZN B;  2Y5B B;  2L3Z A;  4XC2 A;  4XZ4 A;  2WX0 A;  4DXG A;  2O6V B;  1V80 A;  5EE3 A;  2KKC A;  1E8X A;  2QDF A;  4HKZ E;  5JZE B;  2J7Q B;  1UBQ A;  2KMM A;  4NQK E;  1P9D U;  3V3X A;  4B6W A;  3HM6 X;  1F2R I;  3JSV A;  1WIA A;  4GDL B;  1QIL A;  2MBH A;  2KDB A;  2Z8L A;  1WRI A;  3MTN B;  5JHB A;  3AB5 A;  3Q8B A;  1M4V A;  4TQ1 A;  1I4P A;  2JSV X;  2JF5 A;  3ZNG C;  1LFD A;  4IM0 A;  5J2R A;  2ZNV B;  2CJN A;  1J7C A;  4C7Y A;  2KMC A;  1BT0 A;  1VZ8 A;  2L32 A;  2NPT A;  2I38 A;  2JUO A;  2JU6 X;  5CTR C;  3FIL B;  2QMT A;  4NAW B;  2NR2 A;  2RDB C;  2MP2 A;  4KKJ A;  2E3T A;  2VH1 A;  1WZ0 A;  3PO0 A;  3U4E G;  5J18 A;  4DBG A;  4A6Q A;  1C79 A;  1WGH A;  1Y56 A;  3KUD B;  1YN3 A;  1SJE D;  2DWQ A;  2GBK A;  4XDC A;  3NS8 A;  4IC7 B;  1K8R B;  1IYF A;  1Q1O A;  1WJ4 A;  4MGZ E;  2XN9 C;  2HD5 B;  2R2Q A;  1PGA A;  2FE8 A;  1N60 A;  1WJ6 A;  3P4S B;  3ZYY X;  1UEL A;  3CIR B;  4TUU A;  3I63 C;  4YTP B;  1ZXH A;  3FKY A;  1PDX A;  5C2T B;  1KF6 B;  3OLM D;  1HTO A;  3EFU A;  4W9J A;  2G4D B;  4LNI A;  1NBF C;  2BS2 B;  5LXI B;  4ZYN A;  4GMV A;  4LNF A;  2FCS A;  1FNW A;  3CST A;  1E10 A;  2KT7 A;  4ZRK A;  4KVG B;  3P1M A;  1E8W A;  2LD9 A;  1WX9 A;  3PZ7 A;  1TKG A;  2KLG A;  3ZTC A;  1Z5S B;  3CF6 E;  3P4P B;  5HKH A;  3U52 E;  1FRD A;  1HTQ A;  4IKG A;  5IA7 A;  1E8Z A;  1JAL A;  2WLB A;  3R2T A;  5AUI A;  2LVQ A;  1MG8 A;  5G55 A;  1FMA D;  3BWU D;  5C1Z A;  2EMT A;  2ZPY A;  1SXT A;  2G3Q B;  4E74 A;  2J0K A;  1VR9 A;  4YT0 B;  2JVC A;  4IWO A;  2OJR A;  1TZ1 A;  4F8C B;  1P7F A;  2QC8 A;  2LVO A;  3PRE A;  2WXP A;  1WZ3 A;  2J4X A;  4CYE A;  1FEH A;  4M0W A;  3PLV A;  3L0W B;  2LI5 A;  1F77 A;  1EWC A;  5KHQ A;  3I5J C;  1L0V B;  4KGR A;  3N20 C;  2MA9 B;  2RR9 A;  1R4M B;  2IO2 B;  1PUT A;  1RFK A;  1VRA B;  3W5V B;  3H7P B;  4MGY E;  4WJQ A;  1WXM A;  3E9S A;  2PJH A;  3A9K B;  5LXH A;  3PHX B;  1WGK A;  3QAQ A;  2K39 A;  3HVZ A;  2GBN A;  2GRI A;  2V4L A;  2HJ8 A;  2JX5 A;  3MP9 A;  3AE9 B;  4WQO B;  3C19 A;  4DHZ B;  4MH0 E;  2CHX A;  3NS1 A;  4CO7 A;  4GLS C;  2LWP A;  4Q2J A;  4II2 B;  3DDC B;  4ARC A;  1UF0 A;  3DCG A;  1WH3 A;  1I4X A;  3ZRC A;  1WGR A;  1FM0 D;  1P0R A;  1SF0 A;  2PPH A;  3B0A A;  4HCP B;  3TBL D;  4W9C A;  3H8H A;  4KZ0 A;  4KIK B;  3NZS A;  4USA A;  4YWG G;  2K8C A;  3V6C B;  1N61 A;  3OJ4 B;  1A70 A;  3DBL B;  4YSY B;  2CU1 A;  4KKI A;  3ZXV A;  3CMM B;  3IFW B;  2ZW0 A;  4DXA B;  1SE3 A;  4EKU A;  1HA5 A;  4HPM B;  2KAJ A;  1VZ6 A;  5EE1 A;  2DYB A;  2AX5 A;  1KRH A;  3IT6 B;  2RPQ A;  4ZRQ A;  2A5U A;  4N6E B;  2I2Y A;  3ETR A;  1WYG A;  2JZP A;  2MH7 A;  3VRB B;  2KAN A;  3AMZ A;  1XCQ L;  1WMH A;  4UDU C;  3AEE B;  3PRP B;  2C5L C;  1RFA A;  1ENF A;  5J17 A;  3DOW A;  2RPV A;  4K1R B;  2N1W A;  3KYD D;  2BPS A;  2BT6 A;  1VD2 A;  2D3A A;  1C4C A;  2MEK A;  2N1V A;  3PTF C;  2KVR A;  4IOI E;  1L4D B;  2ACZ B;  1CMX B;  2BS4 B;  2RSU A;  2L83 A;  1XLP A;  4MT5 A;  3AM9 A;  1RAX A;  1T0Y A;  1YN5 A;  2FCQ A;  4MSQ B;  3Q3J A;  4IUM B;  3H9D A;  3WAO A;  2WXR A;  2ONQ A;  4ZHO A;  3ZLZ A;  1IP9 A;  5DPR A;  4NJ7 A;  5D3D A;  1NDD A;  2JY6 A;  2AL6 A;  4FJZ A;  5BMH A;  3QIJ A;  3SD5 A;  2WXO A;  4YSZ B;  5BMG A;  4IG7 B;  5HI1 A;  1I7H A;  3JW0 X;  3OWE B;  1QOG A;  3VFK A;  1TZO A;  2FBW B;  3R2I A;  1JWB D;  3MJ5 A;  4XWW A;  2PLP A;  2JQR B;  1T3Q A;  1QKZ A;  1TIF A;  4IWP A;  3V6E B;  1KFY B;  2A4Z A;  5KHO A;  1VJK A;  3ZDT A;  1S1Q B;  4M00 A;  2GBM A;  2KLC A;  1R7S A;  4JLC A;  1FIQ A;  3WAL A;  3DBR B;  3AU4 A;  3VAW A;  3VXW A;  2RDH A;  1NVI D;  3DHH C;  5G5H A;  4FLH A;  1N62 A;  3ZNZ B;  1FRR A;  3OAW A;  1FD6 A;  4EZJ A;  4WIP A;  3HHM A;  2ASQ A;  3RT3 B;  4M01 A;  4PT5 A;  1BXT A;  3UIP B;  1YD8 U;  1KOT A;  1CJE A;  2V3P A;  1JW9 D;  4II3 B;  1I4G A;  3I9V 1;  2M8S A;  4CQN A;  2MJE A;  4RH6 A;  3TIX A;  2O6V D;  1F9J A;  4FAD A;  1F52 A;  1TKE A;  5EE0 A;  5IOI A;  2DYO A;  3J9C A;  4NQL B;  4DWF A;  2IYD B;  2WP9 B;  2KO3 A;  4ASW C;  2K3U A;  3URY A;  3DBH B;  3BZD B;  2QCZ A;  3VTW A;  1AWD A;  3ABV B;  2FNJ B;  1NI3 A;  1J0G A;  1XXG A;  3EHV A;  3ZO5 B;  3HUI A;  2KWC A;  2L0F A;  4G0N B;  1FXA A;  2M17 A;  2GBR A;  3NY5 A;  4L2Y A;  3M3J A;  4KX6 B;  1YJJ A;  3U7D A;  1FO4 A;  3BVG A;  3IAS 1;  2OJW A;  4GB9 A;  2LGS A;  5D94 A;  4KIK A;  2N9K A;  1T0Q C;  3AE6 B;  3ZVV A;  1RWS A;  2V3N A;  2N9L A;  4C4V A;  3L13 A;  1OEY A;  3LJ3 A;  4ARI A;  1SE2 A;  2BKR B;  3TMP B;  5H92 C;  3RMK C;  1L4Z B;  2N0S B;  3L16 A;  1DYQ A;  1I4H A;  1SIJ A;  2PVO D;  4C80 A;  3O13 A;  2KC1 A;  4B95 A;  2XNA C;  4NAM A;  4MJS A;  1DGJ A;  2W82 A;  1JQ4 A;  2K25 A;  4AUQ C;  1MHH E;  1TS4 A;  5EE9 A;  2AQ1 B;  1TGZ B;  2LGD A;  4TV3 A;  2PW9 A;  2L52 A;  2R61 A;  2W3R A;  3T3N A;  1E5W A;  2D11 A;  4W9G A;  2K6D B;  1E7V A;  2Z0D B;  1TY2 A;  4WWO A;  1D4B A;  3DPD A;  5BYS A;  2I1J A;  3RD2 A;  3MFG A;  1XEE A;  4J6I A;  3IAM 1;  1J7A A;  4OVU A;  1SB3 C;  2LJ5 A;  4BKT A;  4XWT A;  4ZRJ A;  2ZCB A;  2OED A;  3R7R A;  3ZKJ C;  3Q3M C;  2ZZP B;  4H2A A;  4JX1 C;  2LAS A;  5E6J A;  1IGD A;  4TKN A;  2KWD A;  3NOB A;  4WJO A;  3ZIM A;  1KTK A;  2JYT A;  4YXD B;  4HPL B;  2XBB C;  3B9J A;  2YEP F;  1XQQ A;  2WDT B;  2ZVO A;  3ZQ4 A;  2MQJ A;  2NTT A;  1Y8R C;  1QOB A;  3V05 A;  5FKA C;  1CQV A;  2AEH A;  3ZGZ A;  2BTE A;  2KX0 A;  3X0W A;  3L10 B;  2D10 A;  2QHO A;  3BII D;  1K53 A;  4DK5 A;  1EUV B;  5BYR A;  2W54 A;  2WXL A;  5AZG A;  2IGG A;  1ZUD 2;  3MC0 B;  2LXC A;  4ANX A;  1R4N I;  5I4D A;  5HFY A;  3H7S A;  5TSS A;  2PMV A;  4EZK A;  1ZOY B;  3PSE B;  4MDK E;  4M8M A;  3RNB C;  2NVU I;  1PFD A;  1WR6 E;  1E7U A;  4RGO S;  2K22 A;  3NZ3 A;  2WXH A;  3PRZ A;  3NVV A;  4I6L B;  3GP7 A;  1C1Y B;  1Q5W B;  3KWL A;  2V4I B;  4TQ0 A;  1N6Z A;  2DYM A;  3W1S C;  3PZ8 A;  2J0J A;  3AEG B;  2LGY A;  2LZ6 A;  3HK0 A;  4GXB A;  2NCN A;  3W1S A;  2KVZ A;  2DZM A;  3VHT C;  3QWZ B;  1FFV A;  1UH6 A;  1MFW A;  3APD A;  2KC2 A;  3A33 B;  2EEL A;  3TEW A;  3AEC B;  3LDZ E;  4JIO U;  3VR9 B;  2KDM A;  2K0P A;  1WYW B;  4WJN A;  2JXX A;  2KK8 A;  3AEB B;  3AED B;  3R7Q A;  4MSM B;  1LXD A;  2PE9 A;  3A1Q B;  1OFF A;  4JQW C;  2LVP A;  3HM3 A;  1WY8 A;  2O2V B;  2NBU A;  3K9O B;  1A5R A;  2LFI A;  2WNM A;  3L08 A;  4IW0 A;  2MBE A;  3RFZ B;  2FCM A;  2VZK D;  2D3C A;  2TSS A;  2XK5 A;  1N5W A;  2Z59 B;  4B0E A;  1IUE A;  1F1H A;  4HKQ A;  1ACC A;  2I1K A;  1MHX A;  3ZNH B;  1E90 A;  3M63 B;  1ZXI A;  3GB1 A;  2IY0 B;  2LEK A;  4HXD A;  2NBV B;  2KZR A;  3OG5 A;  2KDF B;  4F7Z A;  3JYU A;  3QC8 B;  1IBX A;  4ZRP A;  2JRI B;  2IJ0 A;  2KN4 A;  3EFC A;  1SBB B;  2BB6 A;  2C9W B;  3UF8 A;  3PVL A;  1E8Y A;  3EGR A;  3GE8 C;  4YSX B;  2LHE A;  2K5P A;  3AE5 B;  4HK2 A;  2GLS A;  5CHF A;  3ML8 A;  4RGT A;  1GOZ A;  5JXV A;  2JZ3 B;  1L6V A;  5BO4 B;  4E3C A;  3PT2 B;  2LRU A;  2N4F A;  2H88 B;  4ACF A;  4GSW A;  3VH3 B;  2ZCC A;  3DVN U;  3CWI A;  2LGI A;  4AS1 A;  5FR3 A;  1JRO A;  3T8M A;  1XCT L;  1E6E B;  2C7M B;  1V1P B;  2XEW A;  3PLU A;  1KLV A;  5EDS A;  3TJP A;  1Q0W B;  2AYO B;  3PGE A;  4GN1 A;  2IGD A;  4HWI B;  3VVW B;  3GOE A;  2C7H A;  3BK2 A;  2L05 A;  1TJE A;  4AQ7 A;  1XT9 B;  3B2G A;  1HEZ E;  4RM8 A;  2BWF A;  2L00 B;  3CSF A;  2YVC A;  1I42 A;  4KSK C;  1AYF A;  3B08 A;  3IBE A;  1TS2 A;  2O6V A;  3APF A;  3WAP A;  3IVF A;  3Q3N C;  4DDG D;  1MPE A;  1V49 A;  1HZ5 A;  5GMV A;  3RN9 C;  5MPO A;  1WRD B;  1J8C A;  2PTL A;  1UGJ A;  3MC8 A;  4P7I A;  4G50 A;  4GDL A;  2PIA A;  1Q10 A;  4DHJ D;  4JGH B;  4W9K A;  3VUY A;  4KGT A;  3N30 A;  2ZNV C;  1GB1 A;  3SU8 X;  2HJ1 A;  2V9H A;  2WXN A;  4FHK A;  2KAC A;  4ICU A;  5BYQ A;  3Q8F A;  2MBQ A;  3DBH I;  5G2N A;  4AOF A;  1I35 A;  5LLI A;  2LHD A;  3RYT A;  2BYF A;  3H1U A;  1GC7 A;  3A9J B;  1L0X B;  2AQ2 B;  4NY0 A;  5AZH A;  2NBW B;  3FIL A;  1OGW A;  1K51 A;  2MJD A;  4KV2 A;  4NAW A;  4TSS A;  3V60 A;  2J52 A;  4ZOH C;  1GPX A;  2B3A A;  4P1C C;  3A1Q A;  4BBN C;  3AN1 A;  4EE2 A;  3Q8C A;  1SEB D;  3SHQ A;  4ICV A;  1TKY A;  3ZTD A;  3UQA A;  3KQ4 A;  4AWJ A;  1WXA A;  1UGM A;  3ZJV A;  3P4R B;  5IN7 A;  1NEN B;  2VZK B;  1LGR A;  1WR1 A;  2MHJ A;  5JHA A;  5CHW A;  1OQY A;  3D32 A;  2WXG A;  3AI5 A;  4RF1 A;  2IPK D;  2QJL A;  1XO3 A;  5C3J B;  4WAF A;  4REZ A;  4JPS A;  4HCN B;  4HJK A;  4W9E A;  1UBI A;  2WX1 A;  3N9Y C;  3ZDM C;  1WGY A;  4US8 A;  1BUI C;  3SFD B;  2DAJ A;  2HTH A;  2KOX A;  2X38 A;  4ZRI A;  2ON8 A;  2W3S A;  5HHD G;  4E71 A;  2NTS A;  4GDK B;  1YX5 B;  2KJ6 A;  5D7G A;  4RGN A;  2N7D A;  2V0G A;  1ZPS A;  4HDQ A;  1EM7 A;  3ZJU A;  3AE4 B;  4XYC A;  4CHK A;  2IO3 B;  3VDZ A;  1WF9 A;  2RMM A;  2N9X A;  3VUX A;  4XGA B;  3AEA B;  4US9 A;  3IG3 A;  2L76 A;  1FCL A;  4ANV A;  1MVK A;  4A3O A;  4OHJ A;  1IGC A;  4HVB A;  2IY1 B;  2Z0E B;  2PVG C;  2WDQ B;  1SGH A;  4JL9 A;  2JWZ A;  4F1S A;  3R8B A;  4P16 A;  2MRP A;  3VUW A;  2BQQ A;  2M0A A;  1GC6 A;  1YQB A;  2KXJ A;  3AE8 B;  4LK0 M;  1VCB A;  2LRW A;  3T9L A;  2EKI A;  2KWU B;  2V3S A;  5LNK 1;  1L6U A;  1GNU A;  2DZJ A;  2MBB B;  3TUO A;  2KD0 A;  4RGM A;  1K50 A;  4MAC A;  3H7P A;  3I3T B;  3KUZ A;  3ML9 A;  4LLG M;  3A9K A;  4DXF A;  2HE7 A;  3P63 A;  4EFO A;  2LJI A;  5GXG B;  1WJU A;  1P3Q U;  2OHF A;  1KLU D;  2E6X A;  2KDE B;  1ET6 A;  4NNJ B;  1V81 A;  1EU4 A;  2DLB A;  3A4R A;  4FXC A;  2LUM A;  1ZE3 D;  2WXI A;  3DVG Y;  3VH4 B;  4DHJ B;  2KQ4 X;  3GZN I;  5T8I A;  3AE2 B;  3W9C B;  1V86 A;  2IDY A;  2YLM A;  3Q6B A;  5DPS A;  3DVN V;  1S3S G;  4OVV A;  3B2F A;  4DDI D;  1L5P A;  3EC8 A;  2WU5 B;  2IND C;  4AJY B;  3RZF A;  3N1X C;  4X57 B;  4FA6 A;  4PK1 A;  2KFJ A;  2FCN A;  1FXT B;  5DCN A;  3W5U B;  4A3P A;  3DWM A;  4BAX A;  2KWV B;  4N58 A;  2IO0 B;  2G45 B;  1ZKH A;  2DHZ A;  1WSP A;  1NYR A;  2G4S A;  3DHI C;  4WJP A;  2INP E;  2L0T A;  3TCA A;  3NVY A;  4K7U A;  5D6J B;  2MP2 B;  4OZB A;  2Q5W D;  4L1B A;  4S0R A;  1ZGU B;  1FPY A;  5L95 C;  4WAA A;  3NVW A;  3EUB 2;  3UQB A;  3RNC C;  1OQQ A;  2DZK A;  3MHS D;  3NRZ A;  4K81 A;  1QZE A;  3FC4 A;  2MJ3 A;  5E6O A;  2WXQ A;  2ZW1 A;  5JH5 C;  1B1Z A;  2GOW A;  3DVG X;  4OZC A;  1UUP A;  2LUE A;  2PE6 B;  4HDO A;  4YTM B;  1UNS A;  3ALB A;  3RNA C;  3M95 A;  3U30 A;  2VH2 A;  3WAM A;  3C8Y A;  3Q8A A;  1N5X A;  3SFE B;  3SR6 A;  1B9R A;  3PV1 A;  5G5G A;  2INC C;  1LM8 B;  4XX5 A;  5IP4 D;  4HEA 1;  2BKF A;  2ZPN A;  2CHZ A;  1XLO A;  1P1A A;  2M19 A;  1N63 A;  3IHP C;  2YEP B;  2INN E;  4I6N B;  1VDV A;  3KWV A;  1WXV A;  2GMI C;  4HRO A;  3APC A;  4ZYS A;  1QF6 A;  1TBE A;  1TY0 A;  4ITK A;  2K1F A;  3QK0 A;  2JWU A;  4BFR A;  3MC9 A;  2JXT A;  4I6P A;  1E7P B;  2BB5 A;  3AH7 A;  3HRD D;  1V5O A;  1V1O A;  1CZP A;  2N9P C;  3UIO B;  2FAZ A;  2GI9 A;  3ONS A;  1ZDV A;  4GGQ A;  1L2N A;  4OW0 A;  2NMQ A;  2L7R A;  2N9E B;  3V62 A;  4URK A;  4P6V F;  1J19 A;  2JZZ A;  4K3B A;  1WM3 A;  1QLB B;  1DOI A;  3VTU A;  4A55 A;  4A90 A;  2N7J A;  4LJO B;  4MM3 B;  3QQ8 B;  1YQ4 B;  4M0W B;  2BYT A;  3SDL C;  1MI0 A;  2IZV B;  1P7E A;  1HQR D;  2BYV E;  2WDR B;  3TEY A;  2ZEQ A;  4MEM A;  4LTU A;  3ZXR A;  4KSL C;  3QX1 A;  4N59 A;  1FCC C;  1V97 A;  2MW5 A;  3L4P A;  1R4M I;  1XF5 L;  4M02 A;  1HE8 A;  2J53 A;  3LYY A;  1WX7 A;  1WGG A;  1J7B A;  4NJ6 A;  4W9H A;  1ZP0 B;  4WQM A;  2KX3 A;  4W9F A;  1WI0 A;  2BVC A;  2DNF A;  4PS8 A;  1LO5 D;  1MJD A;  3NHE B;  5HG2 A;  1WM2 A;  4PYZ A;  1STE A;  3ZW3 A;  1V5T A;  3U7Z A;  1JWM D;  1QT9 A;  3QJZ A;  1KH0 A;  4BKG A;  4AJW A;  4PS3 A;  1XD3 B;  1HZ6 A;  4WUR A;  3PRM B;  5DPT A;  1V2Y A;  1JRP A;  4KGS A;  1AW7 A;  3DBL I;  1UZX B;  3PPA A;  2JT4 B;  1E0Z A;  4FJV B;  4C56 C;  1KM7 A;  3KUC B;  2UU7 A;  1WE6 A;  4HPP A;  1ISN A;  1WMH B;  1G6J A;  3FAH A;  4IDI A;  3RNG C;  3UGB B;  3Q2A C;  3Q3F A;  3TEZ A;  2KHW B;  1XLQ A;  1KLG D;  2LXA A;  2CHW A;  1T5X D;  2MCN B;  4BKS D;  4WWP A;  5FK9 C;  1DOY A;  2AQ3 B;  1V9J A;  2KJR A;  4WWN A;  4BBN F;  4A9A A;  3NUH B;  2FUG 1;  3QAR A;  4IWQ A;  3ENE A;  3NZU A;  3S2A A;  2IO1 B;  2KN5 A;  1PGB A;  4IM2 A;  2H89 B;  2PKO A;  3IXS A;  4ZDV A;  2KTF A;  3TSS A;  1TT5 B;  2C7N B;  1I4Q A;  4QAY A;  1K52 A;  2ZVN A;  3HVD A;  1RRB A;  2W55 A;  3R3M A;  5IO9 A;  2AL3 A;  5FR6 A;  2KTR B;  4RM9 A;  2IBI B;  4WH4 A;  4RF0 A;  4ANW A;  1C4A A;  1RM6 C;  5L83 A;  4D2K A;  1WE7 A;  3RUL A;  3NG0 A;  1D5X C;  2RD0 A;  4LDT B;  3ZJT A;  1C9F A;  1YNT E;  4ZHP A;  2DAF A;  3P42 A;  2WS3 B;  4RCO A;  1R4N B;  3DWG C;  2GBJ A;  2WYQ A; 
#chains in the Genus database with same CATH homology
 4C4V B;  3NJT A;  3MC9 A;  3OG5 A;  4C4V A;  4K3C A;  2QDF A;  3Q6B A;  3EFC A;  4PK1 A;  4QAY A;  2VH1 A;  2MHJ A;  2QCZ A;  2X8X X;  2VH2 A;  2V9H A;  4C00 A;  3MC8 A;  4BZA A;  4XGA B;  4K3B A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...