4XGAB

Crystal structure of bamb and bama p3-5 complex from e.coli
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
174
structure length
174
Chain Sequence
AEIQQINIVGNHAFTTDELISHFQLRDEVPWWNVVGDRKYQKQKLAGDLETLRSYYLDRGYARFNIDSTQVSLTPDKKGIYVTVNITEGDQYKLSGVEVSGNLAGHSAEIEQLTKIEPGELYNGTKVTKMEDDIKKLLGRYGYAYPRVQSMPEINDADKTVKLRVNVDAGNRFY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural basis for the interaction of BamB with the POTRA3-4 domains of BamA.
pubmed doi rcsb
source organism Escherichia coli (strain k12)
molecule tags Protein binding/membrane protein
molecule keywords Outer membrane protein assembly factor BamB
total genus 52
structure length 174
sequence length 174
ec nomenclature
pdb deposition date 2014-12-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF07244 POTRA Surface antigen variable number repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.310 Alpha Beta Roll Ubiquitin-like (UB roll) membrane protein fhac 4xgaB02
3.10.20.310 Alpha Beta Roll Ubiquitin-like (UB roll) membrane protein fhac 4xgaB01
3MC8A 4C4VA 2V9HA 4BZAA 3NJTA 4C4VB 2MHJA 4K3BA 4QAYA 4K3CA 4C00A 4PK1A 4XGAB 3MC9A 3Q6BA 2X8XX 3EFCA 3OG5A 2VH2A 2VH1A 2QCZA 2QDFA
chains in the Genus database with same CATH superfamily
3AM9A 4K7SA 1VRAB 1DGJA 1D5XC 1GC7A 4JX1C 1FNWA 1J7AA 1F77A 1BMLC 3ZTDA 2CS4A 5AZHA 3B1LX 2LGYA 1K53A 2LGXA 2DX5B 4IWOA 2MP2A 1DOYA 5DPRA 4AUQC 4KKIA 2KMCA 3VUXA 1U4AA 3CMMB 1ZDXA 3H9DA 4IM3A 4RFBA 2IY0B 3VR9B 4BVUC 2MSED 2PJHA 5I4DA 1FFVA 4ANUA 2ZW1A 5T8IA 1F2RC 2K1FA 3DVNV 1IPGA 4LJPB 2PE6B 3TCAA 5IP4D 2KTFA 2GBJA 4WAFA 3QCAA 5L95C 3ZUNA 1VZ7A 1T0YA 3AE6B 2BYEA 3HK0A 2K9XA 1HZ5A 2M8SA 3AEGB 3HHMA 1XLNA 5IOIA 1TZOA 3V6CB 4YTNB 2DBYA 5DPSA 3AEDB 3N1ZC 2LXCA 2E6XA 4DWFA 1OFFA 2MBQA 2DZJA 2L1AA 2LWPA 3MJ5A 1YIWA 3L08A 2J52A 3QJZA 4M0WA 2KT7A 1E7VA 4G3XB 1UZXB 4UDUC 3V62A 1TY0A 2MP2B 2JYEA 3DBHI 1ZXHA 2QC8A 5D3IB 3FC4A 3MJWA 2JVCA 1SE3A 3CSFA 4MT5A 3T3OA 1ZW7A 1N5XA 2KWUB 2M0XA 4IM0A 3WAPA 1C1YB 3Q8BA 2K22A 4KZ0A 3BYTB 3W9CB 2LRUA 3Q69A 1K50A 1YN4A 2GBMA 4A6QA 1E9MA 3O65B 2B76B 1JWSD 2N7DA 2PMVA 2ACZB 2LZ6A 3GZNI 4N6EB 3ZYYX 1FD6A 4WJNA 2WDTB 2CR5A 3OJ4B 1RAXA 1V97A 1WJUA 1UF0A 4W9LA 4XWWA 3DVGX 3OAWA 3HIZA 4OZCA 2M19A 5HG2A 4US9A 5TR5A 2LGSA 5DPWA 2QSDA 4D2KA 2LRWA 2Z8LA 1RRBA 3CIRB 3EECA 5CTRC 1YJIA 4LTUA 1TJEA 3ZNHB 3A4RA 4WWMA 2K0PA 2WU5B 3HRDD 1YN5A 4W9IA 2K8HA 2D2QA 3SFDB 3ZXRA 1GB4A 2IZVB 4IG7B 3UQAA 4C4VB 2ZPNA 2FCMA 1I4QA 1UUPA 2R2OA 1OEYA 2KLGA 1ENFA 4JIOU 1LQBA 4EFOA 1E5WA 3FAHA 2O6VA 3EFUA 4RGMA 3PLVA 4L2YA 4GDKB 4YL8A 4IKGA 3BYYB 3VH4B 4I6PA 1E8XA 4HXDA 3QWZB 4YT0B 1TT5B 5IN7A 2D3BA 4MSMB 4G50A 3Q3NC 4FJYA 3AE5B 4W9FA 3AE9B 1UELA 3H6NA 4LNIA 2BW2A 2KQ7A 4GDLA 1H4RA 3JYUA 2MHJA 3GE8C 2N9KA 3C0RB 2KN4A 2JSVX 4DXGA 3VR8B 1TY2A 4MGYE 4W9EA 4WWOA 4XWTA 3EUB2 1JWMD 2KQ4X 4F1SA 4KGRA 2KTRB 5IAAC 3WAMA 3P4QB 4XE0A 2RMMA 4G0NB 2UYZB 1D5ZC 2TSSA 1KJTA 2EMTA 5FR3A 3SR6A 1P1AA 4YSZB 4JLCA 2WXLA 4ZYNA 2DLBA 5D3DA 2CJNA 1ISNA 1UBQA 1WXQA 2CU1A 1I4RA 3WAOA 1JALA 2J0JA 2QHOA 5AUIA 2G4SA 2GBRA 1FIQA 5D2MB 3M95A 2HTHA 3C19A 3CF6E 4MGKE 1K51A 2ZCCA 2ZEQA 2C9WB 4A8XC 4A20A 3QIJA 3SDLC 2QEJC 1MFWA 4M01A 4DDID 1S1QB 3B0AA 4I6NB 3AN1A 3VRBB 1T0RC 1ET6A 1WXMA 1WX8A 2KX0A 5JXVA 2KJHB 3DBSA 1PGBA 4XDDA 2CHWA 5GXGB 1AARA 1C76A 1ZOYB 2YVCA 3IT4B 5C2TB 2IJ0A 4ZHOA 2KZRA 3A33B 4PS8A 3L17A 2D10A 1L2NA 2IGHA 1FM0D 3APFA 4TQ1A 3I57A 1WGKA 4C7ZA 3Q6BA 3AMZA 3RULA 3UINB 1C77A 2L3ZA 2IO0B 2AL6A 4JE3B 4W9HA 1JW9D 3RNFC 1EF1A 3PGEA 4J3OD 3A1QA 2IO1B 4FBJB 2FIDA 5AZFA 4TSSA 2WXHA 1WI0A 1VLBA 1R4NB 5LLIA 1SIJA 1CMXB 3H8HA 2NTTA 4YWGG 3U30A 4RCOA 1VJKA 1T5XD 1R4MI 1A5RA 2C60A 4W9KA 3DHHC 3TEYA 2RPVA 3O13A 2A4ZA 2DZIA 3VUYA 1VR9A 3JW0X 3QARA 3RUIB 2GB1A 5FR6A 1P9DU 1QT9A 2L0FA 3D32A 3A9JA 1IYFA 2AEHA 2VZKD 4M8MA 2FNJB 2EKIA 4BOZB 1V1PB 1ZKHA 1FXTB 3CWIA 2HDEA 2MBEA 3RD2A 3MC8A 3W2DA 4A55A 1A70A 2KTRA 4B9KA 4TQ0A 3BINA 1F1HA 3R7RA 1VZ6A 2NBWB 4HPLB 1I4GA 3B9JA 3TL5A 1MG8A 1P3QU 3AH7A 1ZGUB 1QLBB 2LFIA 3X23A 3DWGC 4HJKA 2RDHA 2DAFA 3UQBA 1DOIA 3NVWA 1XLQA 3VHTC 1WF9A 3PZ8A 1WJ6A 4BFRA 2DHZA 2JZZA 2K5PA 3Q3JA 4AWJA 1YN3A 1TBEA 2V1YA 2NCNA 4LNNA 2KAJA 2BYFA 3QAQA 3TEXA 3KUZA 3AEBB 3B2FA 5DPTA 2M4NA 1IBXA 2KMAA 3NZSA 1OQYA 5KHQA 4K81A 2PEAA 5KHOA 1Y56A 3ZJTA 2PVGC 2MLBA 3AE4B 1Q0WB 3KUCB 3VUWA 1LGRA 2X38A 3Q8EA 2K3UA 3EC8A 1JWBD 3ECIA 4ZRQA 1KM7A 3PV1A 2N1VA 3I3TB 4NJ6A 4MJSB 1VCBA 2OEDA 2IBIB 2WLBA 2WXMA 2QJLA 1I35A 2QCZA 2KOXA 4PYZA 1BXTA 4K7UA 3I63C 1WJNA 1QZEA 4REZA 3ZLZA 3QQ8B 3ETRA 2LJ5A 4W9DA 1N62A 4NY0A 4JL9A 3BK1A 1VD2A 2D07B 3ZNGC 1D5MC 2JY6A 1S3SG 4LDTD 5JHAA 2KACA 1ZXIA 2KO3A 1OGWA 4IDIA 2JT4B 2MRPA 1V1PA 3FILB 2CHZA 4TUUA 2QILA 1SGHA 2K25A 4NPNA 1JRUA 5AUKA 1G6JA 2YEPB 3PHWB 4XX5A 1L7YA 4GLSC 3V6EB 5BYQA 4II2B 4QAYA 3PPAA 4RMAA 2N9XA 2ZZPB 2NS5A 1YNTE 1KF6B 4IM2A 4L1BA 3VAWA 3NY5A 4IOIE 2ZVNA 2JU6X 3TIXA 2ASQA 2HTME 2AQ1B 2Z0EB 2H89B 4M8NA 3VTWA 3IFWB 3AEEB 4K3BA 3DCGA 2IDYA 2BKRB 4K7WA 4Q2JA 2KC2A 4HKZE 4MGIE 4DHJB 4RGNA 4ASWC 2NBVB 2RDBC 1YQ3B 2IY1B 2L00B 2N9EB 3DHIC 2BVCA 3ZXVA 1YOVB 1NBFC 4W9JA 4B0EA 2MWSB 2G45B 4WQOB 3P4SB 1MHXA 1VZ8A 3U7DA 1RLFA 4CO7A 3U8ZA 3AE1B 4HLEA 2WXGA 2OOBB 1J8CA 1RM6C 3EFCA 2C7HA 1WGGA 3DBRB 2Y3AA 3RT3B 4XDCA 4NJ7A 4NNJB 1MG4A 2NTSA 2WXJA 3IXSA 5BMGA 2L76A 1E7UA 2WU2B 1F0ZA 4YSYB 4USAA 3N1YC 2DWQA 2DAJA 5AZGA 3P42A 4AOFA 5BMHA 5EE9A 1FNUA 1GAQB 3UIOB 3U4EG 4WJOA 4NQKE 2Q5WD 3OLMD 1Y8RC 3OG5A 1XLPA 1SJED 3BVZA 4AP4C 5D7GA 3RYTA 1N63A 4ZRPA 1ZE3D 4EZJA 4EZLA 3P1MA 2INPE 1E8YA 2PE9A 4LK0M 4LNOA 3Q2AC 2L05A 1BT0A 2JXTA 2BB5A 4MDKE 1T6BX 1R4MB 3M63B 1WMHB 2J42A 3RNGC 2KQSA 3T3NA 1LM8B 2WDVB 1YX6B 1M4VA 3T9LA 4M0WB 2J0MA 4E71A 4WWPA 1WE6A 1XT9B 5BYRA 5E6OA 2WXQA 3W5VB 3GS2A 4HDOA 4HPMB 4P6VF 3RN9C 3DBRI 4IUMB 4YTPB 3PT2B 2KDFB 4DXFA 1F9JA 2JWUA 1UD7A 2KDMA 3NVVA 4EOYA 4P1BC 2LVPA 1NI3A 3IT6B 2BYTA 1PYWD 1L6UA 3AXCA 1XO3A 4KGTA 5C1ZA 4DDGD 2HJ1A 2I2YA 2LJIA 4DHZE 2INNE 2MW5A 2WXNA 1NVID 2D5GA 2JRHA 2MBBB 2V9HA 4GSWA 2D3GA 2HE7A 1IGDA 2MJDA 1WRDB 3PZ7A 5E6JA 2LASA 1WGRA 4N9F4 2IPKD 3VQIA 1KFYB 3MHZA 4LNFA 4EEWA 2KXJA 4XZ4A 4BKSA 1WYWB 4MH8A 2EMSA 3HVZA 3RNAC 4MEMA 3TSSA 1I4XA 1UGJA 3AULA 4S17A 4WJPA 5J17A 1E8ZA 3UF8A 1WXAA 2LEKA 1V9JA 3PSEB 1SIFA 1WJ4A 3M62B 2O6VB 4DQOC 3EGRA 1V2YA 3DVNU 3NHEB 3KYCD 2MJEA 2WS3B 4M02A 3K9OB 2GBNA 2KYWA 3HM3A 5FK9C 2W9NA 2INCC 4OVVA 1WR1A 4P7IA 3PS6A 1E90A 1TYGB 3DPDA 5IO9A 5MPOA 3RFZB 3V3XA 1Q5WB 4KV2A 1QOFA 4HCPB 4XC2A 4C7YA 3ZTCA 1TKEA 4HROA 2QDFA 3GB1A 2MQJA 3ZJVA 1MPEA 2WX1A 4MSQB 3H7PB 3ZGZA 4XYCA 3GP7A 1ET9A 1LXDA 3A9KA 2Z0DB 3J9CA 2DENB 2LI5A 4KKJA 4EUTA 2V4IB 3DOWA 4JGHB 2VH2A 3L0WB 3T8MA 3UIPB 5HHDG 2M1MA 4NQLB 1MHHE 3U2SC 2FCSA 3NZ3A 1FMAD 2M56B 4IC7B 4KGSA 4C56C 4K3CA 3N32A 4AJYB 3X0WA 1QQRA 3KUDB 4LNKA 2N9PC 1K8RB 2FIFA 5D94A 4PT5A 2CHXA 1C78A 2Z59B 4WQMA 2KWDA 1WY8A 4RNAA 4FA6A 4YTMB 3KWVA 2M17A 1VDVA 3NG0A 1GB1A 2MCNB 2FCQA 2OJWA 1SF0A 2Y5PA 4CQNA 4M00A 1L0VB 2JYTA 2GMIC 2K39A 2V3PA 3QHTA 3MC0B 2V3NA 2KK8A 2N1WA 3RCZA 2KDBA 1MVKA 4OW0A 3V61A 4ZRIA 1EO6A 2FUG1 3DQVA 1E6EB 4RM9A 1RWSA 3RI7C 2YLMA 2FE8A 1WSPA 1RFKA 3QC8B 3S2AA 1WYGA 5JHBA 1HEZE 2AX5A 3PREA 1KLUD 2PW9A 2K8BA 2JX5A 3TMPB 4GB9A 1WIAA 2FBWB 1TS5A 4ITKA 1P7FA 1V81A 4LLGM 3B08A 2IGDA 1YMHE 4HRSA 5BYSA 1C3TA 4EZKA 1TGZB 2XK5B 1E10A 1EM7A 4PK1A 4MJSA 2X8XX 2ZPYA 5HI1A 4WH4A 1F2RI 3N3KB 2JPHA 2CJOA 3V60A 5C3JB 1Q1OA 4A90A 5H92C 1UWXA 5CX3A 4DXAB 2ONQA 4DK5A 3ZRFA 2GBKA 1BUIC 3BWUD 2GI9A 3TJPA 1NI2A 3DBLI 3AU4A 4OHJA 2MBHA 1GJZA 4KIKA 2BS2B 4GGQA 3PO0A 4NAWA 3JVZX 4F8CB 1GPXA 4FULA 2KFJA 3TBLD 4HK2A 3I5JC 1WGDA 4OZBA 2KANA 4HDQA 2GOWA 2HJ8A 3L4PA 5CHVC 4NZLB 1FRRA 3CSTA 2J4XA 2KJRA 2OHFA 4BKTA 4KDIC 2KVZA 3VVWB 3UI3A 2XN9C 3KW5B 4LDTB 2BWFA 2RPQA 3VRAB 5EDSA 2WNMA 3TEZA 4C00A 1N6ZA 3U7ZA 3QX1A 1WZ3A 1EF5A 4ZDVA 4EKUA 3KWLA 1MJDA 3IG3A 2NMQA 4X57B 1NENB 2L83A 4ACFA 4F7ZA 2PTLA 2G9HD 1KLGD 3AEAB 1K52A 3NVZA 3ML9A 3MHSD 3AE8B 3NOBA 3PRMB 2WXPA 3W1SC 5LXIB 3R2IA 1V80A 1WGHA 1J19A 1T0QC 1Z2MA 4E3CA 4FADA 2AWTA 1FO4A 5G5HA 3RMKC 3H7PA 2NR2A 2W3SA 3PVLA 4TV3A 5CHWA 1V86A 4II3B 1L0YB 2KWCA 1B1ZA 1HE8A 3KLSX 4I6LB 4W9CA 2L52A 3E56A 2FUHB 2Y5CA 4A3OA 2W82A 3RNEC 3ZKJC 1NYQA 2REXA 2RD0A 1KLVA 3LXFA 4NAWB 5BO4B 3A4SC 4PYUA 4JWSC 4BZAA 2FCNA 4FJVB 5D6JB 1HA5A 1JQ4A 3VTUA 1YQ4B 2LGIA 1UGMA 3LDZE 1GOZA 1CQVA 2KLCA 1DYQA 1B9RA 1WM3A 5TSSA 3L54A 4NJCA 3P4RB 2BQQA 2WXFA 2WXOA 3PTFC 1SEBD 2YEPF 2L32A 2WQYB 1FFUA 2LD9A 2PIAA 4HPPA 1IBXB 1XCQL 1C79A 2LVQA 5E6PA 4WAAA 5G55A 1SSNA 2PLPA 3KYDD 3ZIMA 3GE3C 3WCQA 2KVRA 2BGFA 4BOSC 1ACCA 3IBEA 3AU5A 3ZW3A 5C23A 1E0ZA 4GDKA 4N58A 2LMCA 2ZCBA 3RNBC 4O1NA 4GOCA 1SE4A 2B3AA 4PS7A 2N4FA 2L7RA 2NPTA 1LFDA 4BBNF 4FHKA 1SB3C 3VTVA 1V6EA 1N60A 1SJHD 4BBNC 4NAMA 1PGXA 2WXRA 3R8BA 3P63A 3ZJUA 3AE7B 1L5PA 3PRZA 2DZKA 4FLHA 3KQ4A 1PGAA 1IP9A 4ZRKA 1JCKB 2MEKA 2DYOA 1YJ1A 2K8CA 3DWMA 3H7SA 2I1KA 3QA8A 4C4VA 5HKHA 3Q8AA 4GN1A 3W1SA 2JQRB 2AQ3B 3APCA 4ICUA 1I42A 2RSUA 5LNK1 1P7EA 2K6QA 4CHKA 5G5GA 2K6DB 4KSLC 2SAKA 1TS3A 4HVBA 2DYBA 4HJGE 3H1UA 3NS1A 1D3ZA 4R3DA 2R2QA 1N5WA 4MM3B 4ARCA 2ICIA 3V05A 3ENEA 1OEYJ 1C9FA 3A9KB 1UWMA 2C7NB 3WA0A 2ON8A 3ZNZB 1ZP0B 4E74A 3ZQ4A 3MTNB 1FNVA 1HTQA 2J7QB 2G3QB 1M94A 1CJEA 1F52A 1PQSA 4ZYSA 3N20C 4WWNA 1WXSA 4AJWA 2KWVB 3RZWC 3BK2A 5E6NA 1UBIA 1QKZA 1E7PB 4KVGB 4MACA 2XNAC 3VFKA 3HVDA 3LJ3A 2I1JA 3AB5A 4TKNA 2D3AA 4GDLB 1IGCA 2KKCA 2W55A 4MH0E 2WDRB 2KC1A 1TIFA 1ZPSA 3R2TA 2L0TA 3OJ3A 1QOBA 3DBHB 1R4NI 3W5UB 1XXGA 1HXYD 3ZNID 1I4PA 3IAS1 1XF5L 1ROEA 3MP9A 1P98A 3BVGA 3ZRCA 3Q14C 5EE0A 5EE3A 1NDDA 3FKYA 3NS8A 1AYFA 2JF5A 2BT6A 1ESFA 1KRHA 3BY4B 1TZ1A 2CU3A 1C4CA 3Q3OC 1PUTA 1CK1A 4ARIA 1C4AA 2JXXA 5JH5C 2ZNVB 2LXAA 4N59A 2VRRB 3SEBA 2V3SA 4KZCA 1AWDA 1J0GA 1D4BA 5J2RA 1WMHA 5AEKB 2WYQA 4ANXA 3TUOA 1E8WA 1Q10A 2KHWB 3GOEA 4LJOB 4YSXB 1T0SC 3VDZA 1PDXA 3P4PB 4P16A 4YXDB 4DHZB 4WIPA 1WXVA 4AQ7A 4MM3A 3AEFB 3Q3MC 3N1XC 2O2VA 2I38A 3ABVB 3BZDB 1FXIA 2LHEA 1NEKB 4JQWC 1Z5SB 1RFAA 3Q3FA 4G11A 3AV8A 1LO5D 2IO3B 2ZJDA 2PPHA 1EWYC 1MI0A 2NVUI 2LHDA 1EU3A 1SBBB 3TEWA 2M0AA 2BTEA 4PS3A 2O2VB 3HM6X 2V0GA 1JMLA 4K1RB 4IWPA 4KSKC 2FAZA 2AL3A 2MH7A 3P2BA 1OQRA 2BF8B 1QILA 3ALBA 1YD8U 1ZUD2 2KDIA 1JROA 1SXTA 1ZDVA 2KDEB 2N9LA 3HUIA 4GU2A 4OVZA 4J6IA 2D11A 2ZW0A 2WHIA 3U52E 3DHGC 4WJQA 1L6VA 2LGDA 1TS4A 2BS4B 1FPYA 2WXKA 1KOTA 5EE1A 4URKA 1EWCA 2AQ2B 2DZMA 3R3MA 1XEEA 4ZRJA 2WP9B 2BBCA 2DYMA 3IVFA 1YQBA 3PLUA 4S0RA 1V5TA 1FRDA 2J53A 4ANVA 1WWTA 2LUEA 4ANWA 2W3RA 2KX3A 3R7QA 3MC9A 3ZDTA 2G1EA 4AS1A 1IUEA 1H8CA 2RDGA 3PHXB 2PKOA 3N9YC 1X1MA 2BWES 4H2AA 1FCLA 3DDCB 2W54A 1YJJA 3AI5A 3DBLB 1N61A 1KH0A 1HQRD 1SE9A 3W1YA 2GLSA 4OZAA 3FILA 3BVMA 3SHQA 4HKQA 1PFDA 2HD5B 4B0MA 3C8YA 4C80A 2WXIA 4RGTA 3PRPB 3A9JB 4BKSD 2N0SB 5BMIA 1WRIA 4US8A 4ZOHC 2XEWA 1XLOA 4DBGA 1C4PA 4W9GA 4BAXA 1TKYA 1EU4A 5DCNA 3UGBB 3SFEB 1J7CA 3A1QB 2UU7A 3GZNB 3B2GA 2KN5A 1JRPA 2QMTA 2WGSA 4L23A 3NUHB 5G2NA 1R7SA 2N7JA 5LXHA 3MFGA 4RM8A 1J7BA 5JZEB 1OQQA 1TTNA 3EHVA 2QIEB 4GXBA 2H88B 3AECB 1XCTL 3LB8C 2NBUA 3OWEB 5IKCM 3WALA 1WZ0A 5GMVA 4IWQA 4RGOS 2Y5BB 3ZVVA 3SU8X 1WX9A 2IYDB 4A9AA 1GC6A 2PVOD 4CYEA 5J18A 4FHJA 2V4LA 3BIID 3IAM1 3NZUA 1FCCC 2KFKA 4DHJD 1WH3A 2DNFA 3VH3B 3RZFA 4BKGA 4WURA 3L13A 1P0RA 3RNCC 1WX7A 3L16A 2C7MB 2WDQB 3M3JA 4RF1A 1RYJA 3JSVA 4KX6B 1UNSA 2C5LC 1GG3A 3K9PB 1V8CA 3L10B 4JPSA 4FN2A 2IGGA 2NPTB 3QK0A 1WM2A 2INDC 1I7HA 3DVGY 1WFYA 2L8JA 4OVUA 1V49A 1YX5B 3JSVB 2OJRA 2GRIA 3ZO5B 1UH6A 3ZDMC 4RH6A 1T3QA 2JRIB 4TMAB 1L4ZB 2BB6A 4A3PA 3EA6A 2KFKB 1QF6A 1I4HA 2WWZA 3Q8CA 3RPFC 3SD5A 1DOXA 3WANA 3AE3B 2MA9B 1JWUD 2KJ6A 4XGAB 1NYRA 4LCDE 1AW7A 4JWUC 5H8YE 1KTKA 2A5UA 2JZPA 1QOAA 1FEHA 2J0KA 4ICVA 2MX2A 2JZ3B 1D6EC 1WE7A 4B95A 2LUMA 5HFYA 1QOGA 1CZPA 3Q8FA 1TKGA 4KDLB 4P1CC 4IW0A 2WX0A 4HWIB 2UWQA 3KH0A 1WGYA 1SE2A 1JWAD 3AE2B 2XK5A 3ONSA 1TS2A 2BYVE 1STEA 2D3CA 1WR6E 4EE2A 3E9SA 1HTOA 2CKHB 2KD0A 3LYYA 2EKEC 3I9V1 4GMVA 3ML8A 1GNUA 4FJZA 1V1OA 2ZNVC 3PZDA 1AN8A 5L83A 4RF0A 2XBBC 3APDA 2RR9A 2VH1A 3NVYA 4HCNB 2LVOA 3KVFB 2MJ3A 1EUVB 3NJTA 2BPSA 2MBOA 3IHPC 1HZ6A 1OTRB 4FXCA 2E3TA 2KNBA 2O6VD 1V5OA 4MELA 3WIMA 2VZKB 5CHFA 4ZHPA 4GIVA 4KIKB 2ZVOA 2JUOA 2BKFA 2R61A 1L0XB 1L4DB 2G4DB 4MGZE 4B6WA 2SEBD 1XQQA 3NRZA 2N7EA 2RGFA 5IA7A 2KMMA 4HEA1 3VXWA 2EELA 1XD3B 2IO2B 3N30A 3R66C 5FKAC 2JWZA 2BS3B 1GUAB 2AYOB 3URYA 1FXAA
chains in the Genus database with same CATH topology
3MC8A 4C4VA 2V9HA 4BZAA 3NJTA 4C4VB 2MHJA 4K3BA 4QAYA 4K3CA 4C00A 4PK1A 4XGAB 3MC9A 3Q6BA 2X8XX 3EFCA 3OG5A 2VH2A 2VH1A 2QCZA 2QDFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3MC8 A;  4C4V A;  2V9H A;  4BZA A;  3NJT A;  4C4V B;  2MHJ A;  4K3B A;  4QAY A;  4K3C A;  4C00 A;  4PK1 A;  4XGA B;  3MC9 A;  3Q6B A;  2X8X X;  3EFC A;  3OG5 A;  2VH2 A;  2VH1 A;  2QCZ A;  2QDF A; 
#chains in the Genus database with same CATH topology
 3AM9 A;  4K7S A;  1VRA B;  1DGJ A;  1D5X C;  1GC7 A;  4JX1 C;  1FNW A;  1J7A A;  1F77 A;  1BML C;  3ZTD A;  2CS4 A;  5AZH A;  3B1L X;  2LGY A;  1K53 A;  2LGX A;  2DX5 B;  4IWO A;  2MP2 A;  1DOY A;  5DPR A;  4AUQ C;  4KKI A;  2KMC A;  3VUX A;  1U4A A;  3CMM B;  1ZDX A;  3H9D A;  4IM3 A;  4RFB A;  2IY0 B;  3VR9 B;  4BVU C;  2MSE D;  2PJH A;  5I4D A;  1FFV A;  4ANU A;  2ZW1 A;  5T8I A;  1F2R C;  2K1F A;  3DVN V;  1IPG A;  4LJP B;  2PE6 B;  3TCA A;  5IP4 D;  2KTF A;  2GBJ A;  4WAF A;  3QCA A;  5L95 C;  3ZUN A;  1VZ7 A;  1T0Y A;  3AE6 B;  2BYE A;  3HK0 A;  2K9X A;  1HZ5 A;  2M8S A;  3AEG B;  3HHM A;  1XLN A;  5IOI A;  1TZO A;  3V6C B;  4YTN B;  2DBY A;  5DPS A;  3AED B;  3N1Z C;  2LXC A;  2E6X A;  4DWF A;  1OFF A;  2MBQ A;  2DZJ A;  2L1A A;  2LWP A;  3MJ5 A;  1YIW A;  3L08 A;  2J52 A;  3QJZ A;  4M0W A;  2KT7 A;  1E7V A;  4G3X B;  1UZX B;  4UDU C;  3V62 A;  1TY0 A;  2MP2 B;  2JYE A;  3DBH I;  1ZXH A;  2QC8 A;  5D3I B;  3FC4 A;  3MJW A;  2JVC A;  1SE3 A;  3CSF A;  4MT5 A;  3T3O A;  1ZW7 A;  1N5X A;  2KWU B;  2M0X A;  4IM0 A;  3WAP A;  1C1Y B;  3Q8B A;  2K22 A;  4KZ0 A;  3BYT B;  3W9C B;  2LRU A;  3Q69 A;  1K50 A;  1YN4 A;  2GBM A;  4A6Q A;  1E9M A;  3O65 B;  2B76 B;  1JWS D;  2N7D A;  2PMV A;  2ACZ B;  2LZ6 A;  3GZN I;  4N6E B;  3ZYY X;  1FD6 A;  4WJN A;  2WDT B;  2CR5 A;  3OJ4 B;  1RAX A;  1V97 A;  1WJU A;  1UF0 A;  4W9L A;  4XWW A;  3DVG X;  3OAW A;  3HIZ A;  4OZC A;  2M19 A;  5HG2 A;  4US9 A;  5TR5 A;  2LGS A;  5DPW A;  2QSD A;  4D2K A;  2LRW A;  2Z8L A;  1RRB A;  3CIR B;  3EEC A;  5CTR C;  1YJI A;  4LTU A;  1TJE A;  3ZNH B;  3A4R A;  4WWM A;  2K0P A;  2WU5 B;  3HRD D;  1YN5 A;  4W9I A;  2K8H A;  2D2Q A;  3SFD B;  3ZXR A;  1GB4 A;  2IZV B;  4IG7 B;  3UQA A;  4C4V B;  2ZPN A;  2FCM A;  1I4Q A;  1UUP A;  2R2O A;  1OEY A;  2KLG A;  1ENF A;  4JIO U;  1LQB A;  4EFO A;  1E5W A;  3FAH A;  2O6V A;  3EFU A;  4RGM A;  3PLV A;  4L2Y A;  4GDK B;  4YL8 A;  4IKG A;  3BYY B;  3VH4 B;  4I6P A;  1E8X A;  4HXD A;  3QWZ B;  4YT0 B;  1TT5 B;  5IN7 A;  2D3B A;  4MSM B;  4G50 A;  3Q3N C;  4FJY A;  3AE5 B;  4W9F A;  3AE9 B;  1UEL A;  3H6N A;  4LNI A;  2BW2 A;  2KQ7 A;  4GDL A;  1H4R A;  3JYU A;  2MHJ A;  3GE8 C;  2N9K A;  3C0R B;  2KN4 A;  2JSV X;  4DXG A;  3VR8 B;  1TY2 A;  4MGY E;  4W9E A;  4WWO A;  4XWT A;  3EUB 2;  1JWM D;  2KQ4 X;  4F1S A;  4KGR A;  2KTR B;  5IAA C;  3WAM A;  3P4Q B;  4XE0 A;  2RMM A;  4G0N B;  2UYZ B;  1D5Z C;  2TSS A;  1KJT A;  2EMT A;  5FR3 A;  3SR6 A;  1P1A A;  4YSZ B;  4JLC A;  2WXL A;  4ZYN A;  2DLB A;  5D3D A;  2CJN A;  1ISN A;  1UBQ A;  1WXQ A;  2CU1 A;  1I4R A;  3WAO A;  1JAL A;  2J0J A;  2QHO A;  5AUI A;  2G4S A;  2GBR A;  1FIQ A;  5D2M B;  3M95 A;  2HTH A;  3C19 A;  3CF6 E;  4MGK E;  1K51 A;  2ZCC A;  2ZEQ A;  2C9W B;  4A8X C;  4A20 A;  3QIJ A;  3SDL C;  2QEJ C;  1MFW A;  4M01 A;  4DDI D;  1S1Q B;  3B0A A;  4I6N B;  3AN1 A;  3VRB B;  1T0R C;  1ET6 A;  1WXM A;  1WX8 A;  2KX0 A;  5JXV A;  2KJH B;  3DBS A;  1PGB A;  4XDD A;  2CHW A;  5GXG B;  1AAR A;  1C76 A;  1ZOY B;  2YVC A;  3IT4 B;  5C2T B;  2IJ0 A;  4ZHO A;  2KZR A;  3A33 B;  4PS8 A;  3L17 A;  2D10 A;  1L2N A;  2IGH A;  1FM0 D;  3APF A;  4TQ1 A;  3I57 A;  1WGK A;  4C7Z A;  3Q6B A;  3AMZ A;  3RUL A;  3UIN B;  1C77 A;  2L3Z A;  2IO0 B;  2AL6 A;  4JE3 B;  4W9H A;  1JW9 D;  3RNF C;  1EF1 A;  3PGE A;  4J3O D;  3A1Q A;  2IO1 B;  4FBJ B;  2FID A;  5AZF A;  4TSS A;  2WXH A;  1WI0 A;  1VLB A;  1R4N B;  5LLI A;  1SIJ A;  1CMX B;  3H8H A;  2NTT A;  4YWG G;  3U30 A;  4RCO A;  1VJK A;  1T5X D;  1R4M I;  1A5R A;  2C60 A;  4W9K A;  3DHH C;  3TEY A;  2RPV A;  3O13 A;  2A4Z A;  2DZI A;  3VUY A;  1VR9 A;  3JW0 X;  3QAR A;  3RUI B;  2GB1 A;  5FR6 A;  1P9D U;  1QT9 A;  2L0F A;  3D32 A;  3A9J A;  1IYF A;  2AEH A;  2VZK D;  4M8M A;  2FNJ B;  2EKI A;  4BOZ B;  1V1P B;  1ZKH A;  1FXT B;  3CWI A;  2HDE A;  2MBE A;  3RD2 A;  3MC8 A;  3W2D A;  4A55 A;  1A70 A;  2KTR A;  4B9K A;  4TQ0 A;  3BIN A;  1F1H A;  3R7R A;  1VZ6 A;  2NBW B;  4HPL B;  1I4G A;  3B9J A;  3TL5 A;  1MG8 A;  1P3Q U;  3AH7 A;  1ZGU B;  1QLB B;  2LFI A;  3X23 A;  3DWG C;  4HJK A;  2RDH A;  2DAF A;  3UQB A;  1DOI A;  3NVW A;  1XLQ A;  3VHT C;  1WF9 A;  3PZ8 A;  1WJ6 A;  4BFR A;  2DHZ A;  2JZZ A;  2K5P A;  3Q3J A;  4AWJ A;  1YN3 A;  1TBE A;  2V1Y A;  2NCN A;  4LNN A;  2KAJ A;  2BYF A;  3QAQ A;  3TEX A;  3KUZ A;  3AEB B;  3B2F A;  5DPT A;  2M4N A;  1IBX A;  2KMA A;  3NZS A;  1OQY A;  5KHQ A;  4K81 A;  2PEA A;  5KHO A;  1Y56 A;  3ZJT A;  2PVG C;  2MLB A;  3AE4 B;  1Q0W B;  3KUC B;  3VUW A;  1LGR A;  2X38 A;  3Q8E A;  2K3U A;  3EC8 A;  1JWB D;  3ECI A;  4ZRQ A;  1KM7 A;  3PV1 A;  2N1V A;  3I3T B;  4NJ6 A;  4MJS B;  1VCB A;  2OED A;  2IBI B;  2WLB A;  2WXM A;  2QJL A;  1I35 A;  2QCZ A;  2KOX A;  4PYZ A;  1BXT A;  4K7U A;  3I63 C;  1WJN A;  1QZE A;  4REZ A;  3ZLZ A;  3QQ8 B;  3ETR A;  2LJ5 A;  4W9D A;  1N62 A;  4NY0 A;  4JL9 A;  3BK1 A;  1VD2 A;  2D07 B;  3ZNG C;  1D5M C;  2JY6 A;  1S3S G;  4LDT D;  5JHA A;  2KAC A;  1ZXI A;  2KO3 A;  1OGW A;  4IDI A;  2JT4 B;  2MRP A;  1V1P A;  3FIL B;  2CHZ A;  4TUU A;  2QIL A;  1SGH A;  2K25 A;  4NPN A;  1JRU A;  5AUK A;  1G6J A;  2YEP B;  3PHW B;  4XX5 A;  1L7Y A;  4GLS C;  3V6E B;  5BYQ A;  4II2 B;  4QAY A;  3PPA A;  4RMA A;  2N9X A;  2ZZP B;  2NS5 A;  1YNT E;  1KF6 B;  4IM2 A;  4L1B A;  3VAW A;  3NY5 A;  4IOI E;  2ZVN A;  2JU6 X;  3TIX A;  2ASQ A;  2HTM E;  2AQ1 B;  2Z0E B;  2H89 B;  4M8N A;  3VTW A;  3IFW B;  3AEE B;  4K3B A;  3DCG A;  2IDY A;  2BKR B;  4K7W A;  4Q2J A;  2KC2 A;  4HKZ E;  4MGI E;  4DHJ B;  4RGN A;  4ASW C;  2NBV B;  2RDB C;  1YQ3 B;  2IY1 B;  2L00 B;  2N9E B;  3DHI C;  2BVC A;  3ZXV A;  1YOV B;  1NBF C;  4W9J A;  4B0E A;  2MWS B;  2G45 B;  4WQO B;  3P4S B;  1MHX A;  1VZ8 A;  3U7D A;  1RLF A;  4CO7 A;  3U8Z A;  3AE1 B;  4HLE A;  2WXG A;  2OOB B;  1J8C A;  1RM6 C;  3EFC A;  2C7H A;  1WGG A;  3DBR B;  2Y3A A;  3RT3 B;  4XDC A;  4NJ7 A;  4NNJ B;  1MG4 A;  2NTS A;  2WXJ A;  3IXS A;  5BMG A;  2L76 A;  1E7U A;  2WU2 B;  1F0Z A;  4YSY B;  4USA A;  3N1Y C;  2DWQ A;  2DAJ A;  5AZG A;  3P42 A;  4AOF A;  5BMH A;  5EE9 A;  1FNU A;  1GAQ B;  3UIO B;  3U4E G;  4WJO A;  4NQK E;  2Q5W D;  3OLM D;  1Y8R C;  3OG5 A;  1XLP A;  1SJE D;  3BVZ A;  4AP4 C;  5D7G A;  3RYT A;  1N63 A;  4ZRP A;  1ZE3 D;  4EZJ A;  4EZL A;  3P1M A;  2INP E;  1E8Y A;  2PE9 A;  4LK0 M;  4LNO A;  3Q2A C;  2L05 A;  1BT0 A;  2JXT A;  2BB5 A;  4MDK E;  1T6B X;  1R4M B;  3M63 B;  1WMH B;  2J42 A;  3RNG C;  2KQS A;  3T3N A;  1LM8 B;  2WDV B;  1YX6 B;  1M4V A;  3T9L A;  4M0W B;  2J0M A;  4E71 A;  4WWP A;  1WE6 A;  1XT9 B;  5BYR A;  5E6O A;  2WXQ A;  3W5V B;  3GS2 A;  4HDO A;  4HPM B;  4P6V F;  3RN9 C;  3DBR I;  4IUM B;  4YTP B;  3PT2 B;  2KDF B;  4DXF A;  1F9J A;  2JWU A;  1UD7 A;  2KDM A;  3NVV A;  4EOY A;  4P1B C;  2LVP A;  1NI3 A;  3IT6 B;  2BYT A;  1PYW D;  1L6U A;  3AXC A;  1XO3 A;  4KGT A;  5C1Z A;  4DDG D;  2HJ1 A;  2I2Y A;  2LJI A;  4DHZ E;  2INN E;  2MW5 A;  2WXN A;  1NVI D;  2D5G A;  2JRH A;  2MBB B;  2V9H A;  4GSW A;  2D3G A;  2HE7 A;  1IGD A;  2MJD A;  1WRD B;  3PZ7 A;  5E6J A;  2LAS A;  1WGR A;  4N9F 4;  2IPK D;  3VQI A;  1KFY B;  3MHZ A;  4LNF A;  4EEW A;  2KXJ A;  4XZ4 A;  4BKS A;  1WYW B;  4MH8 A;  2EMS A;  3HVZ A;  3RNA C;  4MEM A;  3TSS A;  1I4X A;  1UGJ A;  3AUL A;  4S17 A;  4WJP A;  5J17 A;  1E8Z A;  3UF8 A;  1WXA A;  2LEK A;  1V9J A;  3PSE B;  1SIF A;  1WJ4 A;  3M62 B;  2O6V B;  4DQO C;  3EGR A;  1V2Y A;  3DVN U;  3NHE B;  3KYC D;  2MJE A;  2WS3 B;  4M02 A;  3K9O B;  2GBN A;  2KYW A;  3HM3 A;  5FK9 C;  2W9N A;  2INC C;  4OVV A;  1WR1 A;  4P7I A;  3PS6 A;  1E90 A;  1TYG B;  3DPD A;  5IO9 A;  5MPO A;  3RFZ B;  3V3X A;  1Q5W B;  4KV2 A;  1QOF A;  4HCP B;  4XC2 A;  4C7Y A;  3ZTC A;  1TKE A;  4HRO A;  2QDF A;  3GB1 A;  2MQJ A;  3ZJV A;  1MPE A;  2WX1 A;  4MSQ B;  3H7P B;  3ZGZ A;  4XYC A;  3GP7 A;  1ET9 A;  1LXD A;  3A9K A;  2Z0D B;  3J9C A;  2DEN B;  2LI5 A;  4KKJ A;  4EUT A;  2V4I B;  3DOW A;  4JGH B;  2VH2 A;  3L0W B;  3T8M A;  3UIP B;  5HHD G;  2M1M A;  4NQL B;  1MHH E;  3U2S C;  2FCS A;  3NZ3 A;  1FMA D;  2M56 B;  4IC7 B;  4KGS A;  4C56 C;  4K3C A;  3N32 A;  4AJY B;  3X0W A;  1QQR A;  3KUD B;  4LNK A;  2N9P C;  1K8R B;  2FIF A;  5D94 A;  4PT5 A;  2CHX A;  1C78 A;  2Z59 B;  4WQM A;  2KWD A;  1WY8 A;  4RNA A;  4FA6 A;  4YTM B;  3KWV A;  2M17 A;  1VDV A;  3NG0 A;  1GB1 A;  2MCN B;  2FCQ A;  2OJW A;  1SF0 A;  2Y5P A;  4CQN A;  4M00 A;  1L0V B;  2JYT A;  2GMI C;  2K39 A;  2V3P A;  3QHT A;  3MC0 B;  2V3N A;  2KK8 A;  2N1W A;  3RCZ A;  2KDB A;  1MVK A;  4OW0 A;  3V61 A;  4ZRI A;  1EO6 A;  2FUG 1;  3DQV A;  1E6E B;  4RM9 A;  1RWS A;  3RI7 C;  2YLM A;  2FE8 A;  1WSP A;  1RFK A;  3QC8 B;  3S2A A;  1WYG A;  5JHB A;  1HEZ E;  2AX5 A;  3PRE A;  1KLU D;  2PW9 A;  2K8B A;  2JX5 A;  3TMP B;  4GB9 A;  1WIA A;  2FBW B;  1TS5 A;  4ITK A;  1P7F A;  1V81 A;  4LLG M;  3B08 A;  2IGD A;  1YMH E;  4HRS A;  5BYS A;  1C3T A;  4EZK A;  1TGZ B;  2XK5 B;  1E10 A;  1EM7 A;  4PK1 A;  4MJS A;  2X8X X;  2ZPY A;  5HI1 A;  4WH4 A;  1F2R I;  3N3K B;  2JPH A;  2CJO A;  3V60 A;  5C3J B;  1Q1O A;  4A90 A;  5H92 C;  1UWX A;  5CX3 A;  4DXA B;  2ONQ A;  4DK5 A;  3ZRF A;  2GBK A;  1BUI C;  3BWU D;  2GI9 A;  3TJP A;  1NI2 A;  3DBL I;  3AU4 A;  4OHJ A;  2MBH A;  1GJZ A;  4KIK A;  2BS2 B;  4GGQ A;  3PO0 A;  4NAW A;  3JVZ X;  4F8C B;  1GPX A;  4FUL A;  2KFJ A;  3TBL D;  4HK2 A;  3I5J C;  1WGD A;  4OZB A;  2KAN A;  4HDQ A;  2GOW A;  2HJ8 A;  3L4P A;  5CHV C;  4NZL B;  1FRR A;  3CST A;  2J4X A;  2KJR A;  2OHF A;  4BKT A;  4KDI C;  2KVZ A;  3VVW B;  3UI3 A;  2XN9 C;  3KW5 B;  4LDT B;  2BWF A;  2RPQ A;  3VRA B;  5EDS A;  2WNM A;  3TEZ A;  4C00 A;  1N6Z A;  3U7Z A;  3QX1 A;  1WZ3 A;  1EF5 A;  4ZDV A;  4EKU A;  3KWL A;  1MJD A;  3IG3 A;  2NMQ A;  4X57 B;  1NEN B;  2L83 A;  4ACF A;  4F7Z A;  2PTL A;  2G9H D;  1KLG D;  3AEA B;  1K52 A;  3NVZ A;  3ML9 A;  3MHS D;  3AE8 B;  3NOB A;  3PRM B;  2WXP A;  3W1S C;  5LXI B;  3R2I A;  1V80 A;  1WGH A;  1J19 A;  1T0Q C;  1Z2M A;  4E3C A;  4FAD A;  2AWT A;  1FO4 A;  5G5H A;  3RMK C;  3H7P A;  2NR2 A;  2W3S A;  3PVL A;  4TV3 A;  5CHW A;  1V86 A;  4II3 B;  1L0Y B;  2KWC A;  1B1Z A;  1HE8 A;  3KLS X;  4I6L B;  4W9C A;  2L52 A;  3E56 A;  2FUH B;  2Y5C A;  4A3O A;  2W82 A;  3RNE C;  3ZKJ C;  1NYQ A;  2REX A;  2RD0 A;  1KLV A;  3LXF A;  4NAW B;  5BO4 B;  3A4S C;  4PYU A;  4JWS C;  4BZA A;  2FCN A;  4FJV B;  5D6J B;  1HA5 A;  1JQ4 A;  3VTU A;  1YQ4 B;  2LGI A;  1UGM A;  3LDZ E;  1GOZ A;  1CQV A;  2KLC A;  1DYQ A;  1B9R A;  1WM3 A;  5TSS A;  3L54 A;  4NJC A;  3P4R B;  2BQQ A;  2WXF A;  2WXO A;  3PTF C;  1SEB D;  2YEP F;  2L32 A;  2WQY B;  1FFU A;  2LD9 A;  2PIA A;  4HPP A;  1IBX B;  1XCQ L;  1C79 A;  2LVQ A;  5E6P A;  4WAA A;  5G55 A;  1SSN A;  2PLP A;  3KYD D;  3ZIM A;  3GE3 C;  3WCQ A;  2KVR A;  2BGF A;  4BOS C;  1ACC A;  3IBE A;  3AU5 A;  3ZW3 A;  5C23 A;  1E0Z A;  4GDK A;  4N58 A;  2LMC A;  2ZCB A;  3RNB C;  4O1N A;  4GOC A;  1SE4 A;  2B3A A;  4PS7 A;  2N4F A;  2L7R A;  2NPT A;  1LFD A;  4BBN F;  4FHK A;  1SB3 C;  3VTV A;  1V6E A;  1N60 A;  1SJH D;  4BBN C;  4NAM A;  1PGX A;  2WXR A;  3R8B A;  3P63 A;  3ZJU A;  3AE7 B;  1L5P A;  3PRZ A;  2DZK A;  4FLH A;  3KQ4 A;  1PGA A;  1IP9 A;  4ZRK A;  1JCK B;  2MEK A;  2DYO A;  1YJ1 A;  2K8C A;  3DWM A;  3H7S A;  2I1K A;  3QA8 A;  4C4V A;  5HKH A;  3Q8A A;  4GN1 A;  3W1S A;  2JQR B;  2AQ3 B;  3APC A;  4ICU A;  1I42 A;  2RSU A;  5LNK 1;  1P7E A;  2K6Q A;  4CHK A;  5G5G A;  2K6D B;  4KSL C;  2SAK A;  1TS3 A;  4HVB A;  2DYB A;  4HJG E;  3H1U A;  3NS1 A;  1D3Z A;  4R3D A;  2R2Q A;  1N5W A;  4MM3 B;  4ARC A;  2ICI A;  3V05 A;  3ENE A;  1OEY J;  1C9F A;  3A9K B;  1UWM A;  2C7N B;  3WA0 A;  2ON8 A;  3ZNZ B;  1ZP0 B;  4E74 A;  3ZQ4 A;  3MTN B;  1FNV A;  1HTQ A;  2J7Q B;  2G3Q B;  1M94 A;  1CJE A;  1F52 A;  1PQS A;  4ZYS A;  3N20 C;  4WWN A;  1WXS A;  4AJW A;  2KWV B;  3RZW C;  3BK2 A;  5E6N A;  1UBI A;  1QKZ A;  1E7P B;  4KVG B;  4MAC A;  2XNA C;  3VFK A;  3HVD A;  3LJ3 A;  2I1J A;  3AB5 A;  4TKN A;  2D3A A;  4GDL B;  1IGC A;  2KKC A;  2W55 A;  4MH0 E;  2WDR B;  2KC1 A;  1TIF A;  1ZPS A;  3R2T A;  2L0T A;  3OJ3 A;  1QOB A;  3DBH B;  1R4N I;  3W5U B;  1XXG A;  1HXY D;  3ZNI D;  1I4P A;  3IAS 1;  1XF5 L;  1ROE A;  3MP9 A;  1P98 A;  3BVG A;  3ZRC A;  3Q14 C;  5EE0 A;  5EE3 A;  1NDD A;  3FKY A;  3NS8 A;  1AYF A;  2JF5 A;  2BT6 A;  1ESF A;  1KRH A;  3BY4 B;  1TZ1 A;  2CU3 A;  1C4C A;  3Q3O C;  1PUT A;  1CK1 A;  4ARI A;  1C4A A;  2JXX A;  5JH5 C;  2ZNV B;  2LXA A;  4N59 A;  2VRR B;  3SEB A;  2V3S A;  4KZC A;  1AWD A;  1J0G A;  1D4B A;  5J2R A;  1WMH A;  5AEK B;  2WYQ A;  4ANX A;  3TUO A;  1E8W A;  1Q10 A;  2KHW B;  3GOE A;  4LJO B;  4YSX B;  1T0S C;  3VDZ A;  1PDX A;  3P4P B;  4P16 A;  4YXD B;  4DHZ B;  4WIP A;  1WXV A;  4AQ7 A;  4MM3 A;  3AEF B;  3Q3M C;  3N1X C;  2O2V A;  2I38 A;  3ABV B;  3BZD B;  1FXI A;  2LHE A;  1NEK B;  4JQW C;  1Z5S B;  1RFA A;  3Q3F A;  4G11 A;  3AV8 A;  1LO5 D;  2IO3 B;  2ZJD A;  2PPH A;  1EWY C;  1MI0 A;  2NVU I;  2LHD A;  1EU3 A;  1SBB B;  3TEW A;  2M0A A;  2BTE A;  4PS3 A;  2O2V B;  3HM6 X;  2V0G A;  1JML A;  4K1R B;  4IWP A;  4KSK C;  2FAZ A;  2AL3 A;  2MH7 A;  3P2B A;  1OQR A;  2BF8 B;  1QIL A;  3ALB A;  1YD8 U;  1ZUD 2;  2KDI A;  1JRO A;  1SXT A;  1ZDV A;  2KDE B;  2N9L A;  3HUI A;  4GU2 A;  4OVZ A;  4J6I A;  2D11 A;  2ZW0 A;  2WHI A;  3U52 E;  3DHG C;  4WJQ A;  1L6V A;  2LGD A;  1TS4 A;  2BS4 B;  1FPY A;  2WXK A;  1KOT A;  5EE1 A;  4URK A;  1EWC A;  2AQ2 B;  2DZM A;  3R3M A;  1XEE A;  4ZRJ A;  2WP9 B;  2BBC A;  2DYM A;  3IVF A;  1YQB A;  3PLU A;  4S0R A;  1V5T A;  1FRD A;  2J53 A;  4ANV A;  1WWT A;  2LUE A;  4ANW A;  2W3R A;  2KX3 A;  3R7Q A;  3MC9 A;  3ZDT A;  2G1E A;  4AS1 A;  1IUE A;  1H8C A;  2RDG A;  3PHX B;  2PKO A;  3N9Y C;  1X1M A;  2BWE S;  4H2A A;  1FCL A;  3DDC B;  2W54 A;  1YJJ A;  3AI5 A;  3DBL B;  1N61 A;  1KH0 A;  1HQR D;  1SE9 A;  3W1Y A;  2GLS A;  4OZA A;  3FIL A;  3BVM A;  3SHQ A;  4HKQ A;  1PFD A;  2HD5 B;  4B0M A;  3C8Y A;  4C80 A;  2WXI A;  4RGT A;  3PRP B;  3A9J B;  4BKS D;  2N0S B;  5BMI A;  1WRI A;  4US8 A;  4ZOH C;  2XEW A;  1XLO A;  4DBG A;  1C4P A;  4W9G A;  4BAX A;  1TKY A;  1EU4 A;  5DCN A;  3UGB B;  3SFE B;  1J7C A;  3A1Q B;  2UU7 A;  3GZN B;  3B2G A;  2KN5 A;  1JRP A;  2QMT A;  2WGS A;  4L23 A;  3NUH B;  5G2N A;  1R7S A;  2N7J A;  5LXH A;  3MFG A;  4RM8 A;  1J7B A;  5JZE B;  1OQQ A;  1TTN A;  3EHV A;  2QIE B;  4GXB A;  2H88 B;  3AEC B;  1XCT L;  3LB8 C;  2NBU A;  3OWE B;  5IKC M;  3WAL A;  1WZ0 A;  5GMV A;  4IWQ A;  4RGO S;  2Y5B B;  3ZVV A;  3SU8 X;  1WX9 A;  2IYD B;  4A9A A;  1GC6 A;  2PVO D;  4CYE A;  5J18 A;  4FHJ A;  2V4L A;  3BII D;  3IAM 1;  3NZU A;  1FCC C;  2KFK A;  4DHJ D;  1WH3 A;  2DNF A;  3VH3 B;  3RZF A;  4BKG A;  4WUR A;  3L13 A;  1P0R A;  3RNC C;  1WX7 A;  3L16 A;  2C7M B;  2WDQ B;  3M3J A;  4RF1 A;  1RYJ A;  3JSV A;  4KX6 B;  1UNS A;  2C5L C;  1GG3 A;  3K9P B;  1V8C A;  3L10 B;  4JPS A;  4FN2 A;  2IGG A;  2NPT B;  3QK0 A;  1WM2 A;  2IND C;  1I7H A;  3DVG Y;  1WFY A;  2L8J A;  4OVU A;  1V49 A;  1YX5 B;  3JSV B;  2OJR A;  2GRI A;  3ZO5 B;  1UH6 A;  3ZDM C;  4RH6 A;  1T3Q A;  2JRI B;  4TMA B;  1L4Z B;  2BB6 A;  4A3P A;  3EA6 A;  2KFK B;  1QF6 A;  1I4H A;  2WWZ A;  3Q8C A;  3RPF C;  3SD5 A;  1DOX A;  3WAN A;  3AE3 B;  2MA9 B;  1JWU D;  2KJ6 A;  4XGA B;  1NYR A;  4LCD E;  1AW7 A;  4JWU C;  5H8Y E;  1KTK A;  2A5U A;  2JZP A;  1QOA A;  1FEH A;  2J0K A;  4ICV A;  2MX2 A;  2JZ3 B;  1D6E C;  1WE7 A;  4B95 A;  2LUM A;  5HFY A;  1QOG A;  1CZP A;  3Q8F A;  1TKG A;  4KDL B;  4P1C C;  4IW0 A;  2WX0 A;  4HWI B;  2UWQ A;  3KH0 A;  1WGY A;  1SE2 A;  1JWA D;  3AE2 B;  2XK5 A;  3ONS A;  1TS2 A;  2BYV E;  1STE A;  2D3C A;  1WR6 E;  4EE2 A;  3E9S A;  1HTO A;  2CKH B;  2KD0 A;  3LYY A;  2EKE C;  3I9V 1;  4GMV A;  3ML8 A;  1GNU A;  4FJZ A;  1V1O A;  2ZNV C;  3PZD A;  1AN8 A;  5L83 A;  4RF0 A;  2XBB C;  3APD A;  2RR9 A;  2VH1 A;  3NVY A;  4HCN B;  2LVO A;  3KVF B;  2MJ3 A;  1EUV B;  3NJT A;  2BPS A;  2MBO A;  3IHP C;  1HZ6 A;  1OTR B;  4FXC A;  2E3T A;  2KNB A;  2O6V D;  1V5O A;  4MEL A;  3WIM A;  2VZK B;  5CHF A;  4ZHP A;  4GIV A;  4KIK B;  2ZVO A;  2JUO A;  2BKF A;  2R61 A;  1L0X B;  1L4D B;  2G4D B;  4MGZ E;  4B6W A;  2SEB D;  1XQQ A;  3NRZ A;  2N7E A;  2RGF A;  5IA7 A;  2KMM A;  4HEA 1;  3VXW A;  2EEL A;  1XD3 B;  2IO2 B;  3N30 A;  3R66 C;  5FKA C;  2JWZ A;  2BS3 B;  1GUA B;  2AYO B;  3URY A;  1FXA A; 
#chains in the Genus database with same CATH homology
 3MC8 A;  4C4V A;  2V9H A;  4BZA A;  3NJT A;  4C4V B;  2MHJ A;  4K3B A;  4QAY A;  4K3C A;  4C00 A;  4PK1 A;  4XGA B;  3MC9 A;  3Q6B A;  2X8X X;  3EFC A;  3OG5 A;  2VH2 A;  2VH1 A;  2QCZ A;  2QDF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...