4XGAB

Crystal structure of bamb and bama p3-5 complex from e.coli
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
174
structure length
174
Chain Sequence
AEIQQINIVGNHAFTTDELISHFQLRDEVPWWNVVGDRKYQKQKLAGDLETLRSYYLDRGYARFNIDSTQVSLTPDKKGIYVTVNITEGDQYKLSGVEVSGNLAGHSAEIEQLTKIEPGELYNGTKVTKMEDDIKKLLGRYGYAYPRVQSMPEINDADKTVKLRVNVDAGNRFY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural basis for the interaction of BamB with the POTRA3-4 domains of BamA.
pubmed doi rcsb
source organism Escherichia coli (strain k12)
molecule tags Protein binding/membrane protein
molecule keywords Outer membrane protein assembly factor BamB
total genus 52
structure length 174
sequence length 174
ec nomenclature
pdb deposition date 2014-12-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF07244 POTRA Surface antigen variable number repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.310 Alpha Beta Roll Ubiquitin-like (UB roll) membrane protein fhac 4xgaB02
3.10.20.310 Alpha Beta Roll Ubiquitin-like (UB roll) membrane protein fhac 4xgaB01
2MHJA 2X8XX 3OG5A 4QAYA 3NJTA 4C4VA 4K3CA 3MC9A 3Q6BA 4BZAA 2VH2A 4XGAB 2V9HA 4C00A 3EFCA 4PK1A 2QDFA 3MC8A 4K3BA 2QCZA 4C4VB 2VH1A
chains in the Genus database with same CATH superfamily
1XEEA 2DZKA 2INDC 3NZ3A 2Y5CA 2V4IB 3HRDD 4AUQC 1I42A 2K9XA 4DHJB 3U30A 4KX6B 2KLCA 3P4PB 1WJ6A 3APDA 4P1CC 2MBEA 1Q1OA 3I57A 2M56B 2WXOA 2V1YA 3BVGA 3X23A 3LXFA 5KHOA 2QCZA 4MACA 5CX3A 1Q5WB 2K3UA 1YMHE 1LM8B 2DZMA 3UGBB 3EUB2 4OHJA 1T0YA 4K3CA 2X38A 1UGJA 1Q0WB 4XDDA 3QAQA 1I4QA 1WYWB 3QJZA 3DHIC 5IA7A 1WI0A 3ZW3A 2XBBC 3BINA 3RNFC 4AP4C 3Q8AA 3AEDB 3JSVB 2MWSB 1NEKB 2BQQA 2E6XA 1BUIC 4HJKA 4PYZA 1PYWD 4G3XB 2PE6B 4K7WA 2FCMA 1NDDA 2CHWA 2L76A 1L7YA 1L0XB 3DQVA 3L13A 4XGAB 2J0JA 1MFWA 2LHEA 3PZ8A 5BYQA 2NVUI 4OZAA 2KDMA 2A5UA 4GU2A 4YTPB 1ZOYB 3MHSD 3A9KA 4C7ZA 4WJNA 1H8CA 2DHZA 3A4SC 3APCA 1LXDA 3KYDD 4YL8A 1M4VA 3V62A 3TJPA 1FNUA 4MM3A 4EKUA 4MJSA 4HKQA 4HDQA 1JCKB 3APFA 2J0MA 4WWOA 1OEYA 3U8ZA 1D6EC 2LGIA 1VJKA 5IKCM 4A3OA 4C7YA 1SIFA 1NVID 5KHQA 1LO5D 2J42A 1RM6C 4FULA 3PS6A 2DAJA 4E71A 3KYCD 2D07B 4A8XC 2WQYB 4J6IA 2ON8A 1V6EA 2ZPYA 1XLNA 4QAYA 2HTME 5HG2A 4JGHB 3NJTA 1JWUD 2CJNA 1TIFA 2QEJC 4L23A 1WXVA 1HEZE 3R66C 2FIFA 3AE6B 3EGRA 2LXCA 2PMVA 2MJ3A 2K5PA 3M63B 2K6DB 2V4LA 3L17A 3ZLZA 2JRIB 1JW9D 3BY4B 2LVQA 4MGKE 1UNSA 3UINB 1R4NI 2QHOA 3ONSA 2AEHA 1GC7A 2QDFA 4HPPA 3DBHB 1C79A 2WDVB 3WANA 2KNBA 2NBVB 3R3MA 1WR6E 2CHZA 1MVKA 3PVLA 2BW2A 2KACA 1ZKHA 2SEBD 1QOBA 2RPQA 2KX0A 2HJ8A 4XWTA 2N9XA 3P1MA 2ZZPB 2L7RA 1QQRA 1V1PA 2AX5A 4L2YA 5HHDG 1XD3B 4TMAB 2K6QA 1TS4A 2KYWA 4ANUA 2OJRA 4W9IA 2PPHA 4FHKA 2L1AA 1E6EB 3V6EB 2JXTA 2MCNB 2OHFA 1WGGA 4FJVB 1JWMD 2MHJA 1N60A 3CWIA 3K9PB 2DYMA 2KHWB 3AE1B 4XZ4A 4RCOA 2VH2A 2L32A 3MC0B 1JROA 3DBRI 5CTRC 1T0SC 3P4QB 1N63A 1WE6A 1I4XA 2B76B 2JZPA 2I1JA 4FJZA 3OG5A 4ZRQA 1UWMA 1JQ4A 2JWUA 3OAWA 3AEFB 3TMPB 2GBJA 4B0MA 2KMCA 4FLHA 5LLIA 1FCCC 1KJTA 5L95C 3RCZA 1I4HA 3RUIB 4G50A 2BB5A 1N61A 1STEA 2B3AA 1SE3A 1F77A 2L05A 1SEBD 2X8XX 1ZW7A 1OEYJ 2HE7A 1MJDA 2INNE 2MW5A 3U52E 1J7BA 3CF6E 2WDTB 3P4SB 3Q8BA 5CHWA 1VDVA 3ZDTA 1MG8A 4EUTA 4N58A 2N1VA 1I7HA 3TCAA 4FJYA 3UQBA 4S17A 5CHFA 1TZOA 2LUMA 3PZ7A 4MELA 2L0FA 4MGZE 3PLUA 1WMHA 2C9WB 4KGRA 3C0RB 3AEEB 2WXQA 2AQ1B 2WYQA 3QCAA 1V9JA 4RH6A 5G5GA 1P0RA 5DPWA 2MP2A 2KZRA 1PQSA 3NVYA 2KLGA 2V0GA 2MH7A 1WX7A 3ZXVA 3ZJTA 1QOAA 2C7HA 4US8A 1XO3A 2ACZB 3MJWA 4PS8A 5C1ZA 3KWLA 1K53A 4JE3B 2O6VB 1E8XA 3N9YC 4F1SA 2R61A 3KLSX 4DK5A 2KFKA 3Q8FA 2KN5A 1Z2MA 4ACFA 3ZIMA 3N32A 2PJHA 4O1NA 1MHXA 3RI7C 3DVNV 2M19A 2Z59B 3FAHA 1N5WA 3V05A 2IJ0A 3NHEB 1L2NA 3KUDB 1FNVA 5J2RA 2IPKD 1TS2A 2YEPF 1BT0A 1FXAA 3M3JA 4MH8A 4MT5A 3W1YA 3AXCA 4WAFA 4BFRA 3B9JA 1KLGD 3A4RA 1SGHA 1K51A 1MG4A 5E6NA 4ARCA 3IAS1 1AW7A 2MRPA 2V3NA 2K1FA 5D3DA 1V80A 2M0AA 4G0NB 1PGBA 1V5TA 2I2YA 4JIOU 2ZCCA 1EUVB 2WXKA 2KOXA 4FA6A 2RD0A 4K7SA 3L4PA 4NQKE 4N59A 3GZNI 4ZDVA 4RF0A 4YT0B 4HCNB 4JL9A 3N1ZC 3QIJA 3DHGC 3NZUA 1E9MA 3CMMB 1L4ZB 1IGCA 2N0SB 2IO2B 4HEA1 2KWUB 2WDQB 2RSUA 3X0WA 1I35A 4KKJA 1GAQB 5JHBA 4TUUA 4MSQB 3AEAB 2LI5A 2D10A 4RGTA 4WWMA 1BMLC 2REXA 5IAAC 1Q10A 4DDID 2R2OA 1YN4A 2ZPNA 4KV2A 2G9HD 4US9A 2INPE 3IFWB 3VH3B 2ONQA 2KQ7A 3N20C 4HCPB 5L83A 3A1QA 1QOFA 4JWSC 4FXCA 4EOYA 2WHIA 3RZWC 4ZRPA 3ZUNA 3IBEA 5AUIA 4PS7A 1E7PB 2PW9A 2VZKD 2LWPA 4JLCA 2MBHA 3L54A 4H2AA 3Q6BA 1D5ZC 1AWDA 3A9JB 3L08A 3SFEB 4NAWB 5BYSA 3R7QA 5EE9A 1K50A 4DXFA 2EMTA 2VH1A 5E6JA 1EWCA 2KXJA 4URKA 1GG3A 4YSXB 3PV1A 3AU4A 2C5LC 3NVZA 1KRHA 3NZSA 4GMVA 3ENEA 1IUEA 1X1MA 5BMGA 1UWXA 1FFVA 1OFFA 2KC1A 2AL3A 3AN1A 4IM2A 1FM0D 4L1BA 1B9RA 2IY0B 4OW0A 5LXIB 4W9DA 2KJ6A 1WGYA 3Q14C 2G1EA 2N9KA 3NG0A 4IC7B 4K1RB 1WJNA 3DWGC 4ZRKA 2WGSA 2NR2A 3PHWB 4ANWA 1WXQA 3Q3FA 2KANA 2W55A 2W3RA 5FR3A 3WA0A 4IKGA 4A3PA 1XLQA 3A9JA 4MGYE 3NVWA 1YN5A 2PLPA 1N62A 2EELA 2W82A 2WXMA 2DNFA 3DBLB 2AWTA 3TIXA 3VFKA 2LMCA 4IWQA 3NVVA 5HFYA 3GOEA 1YIWA 4DHZB 3TSSA 3UF8A 1SB3C 1VRAB 3BYTB 1B1ZA 4AJWA 1T5XD 4KSLC 1XCTL 5EE0A 4P1BC 2D2QA 3KW5B 2IGHA 2KMMA 2VRRB 3WCQA 5JHAA 4ZRIA 2LGXA 4WQMA 5BMIA 4BVUC 3EHVA 4AOFA 2LRUA 4EZLA 2Y5BB 3Q3JA 2LD9A 1I4PA 4CQNA 4A20A 1WFYA 1WX8A 4ZHOA 1UBQA 1HXYD 4II2B 4XYCA 2BKFA 3UI3A 2L52A 3W5VB 4HDOA 1V1OA 3BVZA 1TYGB 2CU1A 3ZTDA 5IO9A 2WXHA 1FO4A 5AEKB 3DPDA 3AMZA 1V81A 5FK9C 1RLFA 2PTLA 4W9HA 2ZVNA 2JZ3B 4MDKE 2AYOB 3KWVA 4A90A 2ZW0A 1GNUA 4BOZB 4CHKA 2V9HA 1VR9A 1WXAA 3RZFA 3U4EG 1JMLA 2BYEA 5HKHA 4HJGE 2KDEB 5DPSA 2L00B 5EE1A 2UU7A 2BS3B 4KIKA 4HKZE 4E3CA 3U7ZA 3O13A 2SAKA 4ICUA 4PS3A 1PDXA 2BPSA 3DBHI 3H8HA 3W5UB 1FRDA 3AULA 4WURA 1YJIA 5G55A 2J0KA 2KJHB 4CO7A 3RFZB 3IT6B 4TQ0A 3O65B 3H6NA 5GXGB 4KIKB 3HIZA 4WJOA 3IHPC 2JT4B 2D3GA 1QILA 3FKYA 1ZP0B 3A33B 3RD2A 4KGTA 1TY0A 2BGFA 3C19A 1C9FA 2EKEC 1GPXA 1FRRA 4USAA 3DWMA 1K52A 1EU3A 1L5PA 4C4VB 3Q69A 3EECA 3QARA 2KAJA 3PPAA 1S1QB 4RF1A 3UQAA 1YX6B 3ECIA 3AI5A 3CSTA 1WSPA 3MP9A 4REZA 3AEBB 1SXTA 1IBXB 1XLOA 2N9PC 3I3TB 3ML9A 4KZCA 4A55A 1V97A 3E9SA 1SIJA 3L16A 3JW0X 3Q3NC 3QQ8B 3R2TA 2FAZA 2QIEB 2KQSA 2W3SA 1WRDB 2YEPB 4NAMA 3AE5B 3NRZA 2JF5A 2BYVE 2WXJA 5J18A 5T8IA 1N5XA 1P98A 3ZO5B 4DHJD 2FIDA 3OJ4B 1ENFA 1OGWA 3VR8B 3BZDB 1T3QA 4IOIE 4JWUC 4OZCA 4C80A 1BXTA 1HTOA 4ICVA 5IP4D 2D3CA 3FC4A 4DBGA 3TEYA 2CR5A 3H9DA 2XN9C 4GGQA 4IM0A 1F1HA 2M4NA 2Z0DB 4GIVA 1DOXA 4FADA 4OVVA 5CHVC 4BOSC 3GZNB 2LGDA 3Q2AC 4PT5A 4ANXA 2KFJA 5C23A 3TL5A 2VZKB 1E8ZA 1TGZB 1JRUA 2JRHA 4M8NA 4OVUA 2QJLA 3PT2B 3DVGX 4M01A 4PYUA 2KKCA 4HXDA 2YVCA 1J8CA 4JPSA 2ZW1A 1E8YA 4NPNA 2W54A 1C76A 1VCBA 2BTEA 1ZPSA 2DAFA 2J52A 2IO3B 3R7RA 1E0ZA 1EWYC 1MHHE 3ZXRA 2NTTA 1OQYA 2GBKA 1E10A 4F7ZA 3UIOB 1IP9A 4P6VF 2JPHA 3AM9A 2K0PA 2DBYA 1MPEA 3AE4B 3H7SA 1DOYA 1LQBA 3ZRCA 4GDLB 4KKIA 3ALBA 4Q2JA 2WXPA 1KF6B 3VAWA 1GOZA 1I4GA 4NJ7A 4YSYB 5FKAC 2WP9B 4BKSA 1P7EA 3EFCA 2WDRB 4S0RA 1WM3A 1VD2A 4TSSA 3Q8CA 1WZ3A 1ZE3D 3AV8A 5JH5C 2MLBA 2XNAC 1RRBA 3PREA 4LDTD 1FPYA 5IOIA 4BZAA 1ZGUB 1Z5SB 4IG7B 1YD8U 1XLPA 4MSMB 4I6LB 1DGJA 3RNCC 4NAWA 3HM3A 2GBMA 3PTFC 5AZFA 1YQBA 4YXDB 3ABVB 4EEWA 2BYTA 1FNWA 3AH7A 5H8YE 4I6NB 4M0WA 4LDTB 4F8CB 1IGDA 2JZZA 1TKGA 2G45B 2KVZA 1FCLA 4GDKB 1V49A 1IBXA 4LJPB 3MFGA 3W1SC 1VZ6A 1ZXIA 1D3ZA 2O6VD 2A4ZA 2BF8B 3T3OA 2XK5A 1NI3A 1UBIA 3PRMB 3ZGZA 2MA9B 4C4VA 1VZ7A 3EC8A 4GXBA 2FUHB 3ZNHB 1JALA 1D5MC 2BWES 3KH0A 2PKOA 5AUKA 1S3SG 3AE3B 4W9FA 4LTUA 3MJ5A 3DCGA 2OJWA 4FBJB 1YJ1A 2DWQA 2KTRB 1HQRD 4NJCA 3VR9B 3KUZA 1WGKA 3IVFA 2N9LA 3H7PB 4DWFA 3VH4B 4DQOC 2LVPA 2CHXA 2C7NB 3B08A 3HUIA 2MBQA 2ZNVB 3WAOA 1SE4A 1T0QC 4FN2A 2AQ3B 5BMHA 2GBNA 1YX5B 1ZXHA 1FXTB 2JYEA 3DBRB 2MEKA 2LJ5A 4TQ1A 4RGOS 1F52A 2O2VB 2PVGC 2GOWA 3PGEA 2MJEA 2LRWA 4PK1A 4M00A 3AE2B 3S2AA 2DYOA 5DPTA 3RT3B 4YSZB 3Q3OC 3VDZA 3EA6A 5BYRA 3AE8B 2INCC 5LNK1 2DZIA 3BIID 2CU3A 3ZKJC 1OQRA 1KLVA 2LJIA 2CKHB 2GB1A 2HTHA 2K8HA 5D3IB 1XXGA 4C56C 4ASWC 3B2GA 1V1PB 4LCDE 1C3TA 5J17A 3I5JC 4AS1A 2WXGA 3PRZA 3IT4B 3BK2A 1CMXB 1TKYA 1FEHA 1D4BA 1Y8RC 3VRBB 1L0YB 4ANVA 2LFIA 1XF5L 2KK8A 1IPGA 4GDLA 4HK2A 2L8JA 4ZOHC 1WR1A 4W9LA 3RYTA 3R8BA 2KC2A 2N7JA 3SFDB 1E8WA 4WAAA 4BBNF 2JYTA 5TR5A 1JWSD 2GMIC 3I63C 1WX9A 2WU5B 2WXLA 1WYGA 1L6UA 3GS2A 1DYQA 1ESFA 3SR6A 1C1YB 1FMAD 4XDCA 1GB1A 2WLBA 3MHZA 4M0WB 4HPMB 3NUHB 3AECB 4W9GA 2ASQA 3U7DA 1ISNA 1M94A 3TEWA 2HDEA 5AZHA 2KO3A 3FILA 5C2TB 3TEXA 5D7GA 5D6JB 3ZYYX 1JRPA 3IAM1 3L0WB 4N9F4 3DBSA 1YNTE 1H4RA 1WWTA 4BAXA 4KGSA 5JZEB 5TSSA 1T6BX 2WXIA 2D11A 2KWVB 1ACCA 1CZPA 4BKTA 1ET6A 1ET9A 1SJED 1ZDXA 2N4FA 3RN9C 1WXSA 1AYFA 2I1KA 1QOGA 4GOCA 3V3XA 1SE9A 4B0EA 1SE2A 1QT9A 2L0TA 2RDBC 3VUXA 2BB6A 3AE9B 1R4MB 2XEWA 2PE9A 1NBFC 5DPRA 4ZHPA 4NQLB 4KZ0A 3V61A 3W2DA 2MJDA 3TBLD 4HRSA 1I4RA 4RM8A 3ZNGC 4W9EA 2KVRA 3VUWA 2L3ZA 4UDUC 3JYUA 1TS3A 2AL6A 4I6PA 3NY5A 2AQ2B 1E5WA 5D94A 2RDHA 3CIRB 4HLEA 3VHTC 2NMQA 2QSDA 3V6CB 3JVZX 4IWOA 1E90A 2QC8A 2KD0A 4BKGA 1Y56A 3WAMA 3W9CB 3DDCB 3ZTCA 3NS1A 4R3DA 3H7PA 3TUOA 4B6WA 2KN4A 3P2BA 4LJOB 2KMAA 1U4AA 2K22A 2CJOA 4CYEA 3HVZA 2J7QB 3RNBC 3DVNU 3VVWB 3N1XC 5GMVA 1EF1A 4AWJA 3K9OB 2KT7A 2MX2A 4LNKA 1P1AA 3ZNID 2IY1B 1WZ0A 2R2QA 2LXAA 1AARA 3WIMA 2JSVX 3P63A 2C7MB 4MGIE 2XK5B 1YQ3B 4FHJA 2W9NA 2FCQA 2K8CA 2KJRA 3QX1A 1C4CA 1UELA 1SF0A 1RYJA 1N6ZA 4YWGG 1XCQL 4N6EB 1WY8A 2KDIA 4J3OD 2IBIB 3DHHC 2KTFA 1AN8A 1F2RC 3KUCB 1SBBB 4IWPA 4DXGA 5G5HA 4LNOA 1QLBB 4HVBA 2M0XA 3N3KB 4JQWC 2ICIA 1YN3A 4EFOA 2PEAA 1J19A 3A1QB 3W1SA 1GB4A 3P4RB 1FIQA 3WAPA 2NBWB 1L6VA 2G3QB 2MQJA 2BBCA 4LNNA 2J4XA 1R4MI 2TSSA 2FNJB 1OTRB 3PZDA 1RAXA 2LHDA 1QF6A 1WH3A 1V86A 2UYZB 3N30A 4NZLB 2JVCA 2ZEQA 1SJHD 3BYYB 1VZ8A 2V3SA 4IUMB 4OVZA 4GN1A 3QC8B 3KQ4A 3DBLI 3R2IA 5I4DA 5FR6A 2DX5B 2IO0B 2IGGA 3J9CA 3BVMA 2N7DA 2BT6A 3ML8A 1EU4A 3RNEC 4D2KA 3U2SC 4RNAA 3ETRA 4A6QA 1V5OA 3B1LX 2N9EB 3PSEB 4JX1C 4GSWA 3RNAC 2IO1B 3UIPB 3A9KB 1OQQA 1TJEA 2NCNA 4OZBA 3GB1A 2H88B 2LUEA 1KOTA 2JU6X 4E74A 1CJEA 1WRIA 2GI9A 3IXSA 1PGAA 1JWAD 2JWZA 2KTRA 2NTSA 4MH0E 4RMAA 4IDIA 2M17A 4WQOB 3ZJVA 2BYFA 3LJ3A 1WE7A 4TKNA 1KLUD 1UH6A 2E3TA 2D3BA 2IGDA 1P7FA 2YLMA 2RR9A 4RGNA 1J7AA 4GB9A 2O2VA 1CQVA 4X57B 1V8CA 3KVFB 2LEKA 2BS4B 3HHMA 5LXHA 3VTUA 1WJ4A 2FUG1 4HWIB 2JUOA 2KWCA 3D32A 1WMHB 1RFAA 1KH0A 1HE8A 2J53A 1GUAB 3Q3MC 1LFDA 1PGXA 3H1UA 3GE8C 1TS5A 2KDBA 2PIAA 4LLGM 4B9KA 4AQ7A 1V2YA 3OWEB 3M62B 3URYA 2PVOD 1L0VB 2HJ1A 2IZVB 3SHQA 4RM9A 2JQRB 3N1YC 3VTWA 2RDGA 3I9V1 1P9DU 3GP7A 1FD6A 4IW0A 2DLBA 4RFBA 4WJPA 1YJJA 4ARIA 3IG3A 1E7VA 1WF9A 3PO0A 2ZJDA 3VTVA 2KWDA 1HZ5A 2ZCBA 1F2RI 2JXXA 2LASA 1ZUD2 5HI1A 1QZEA 4DXAB 2D5GA 2WXFA 2EKIA 3SU8X 4IM3A 4KVGB 1DOIA 2ZVOA 1UUPA 1GJZA 3GE3C 3AEGB 5E6PA 2WX1A 2UWQA 1KTKA 2ZNVC 2Y5PA 4K3BA 2NPTA 3LB8C 3AU5A 1YOVB 3B0AA 2OEDA 2D3AA 2JX5A 1VLBA 1R7SA 4M02A 1HTQA 1PFDA 4MJSB 5DCNA 1UD7A 2I38A 1J7CA 3NOBA 3T8MA 1A70A 3TEZA 2DZJA 3VXWA 1E7UA 1QKZA 1WGDA 3MTNB 1TT5B 3LYYA 2N7EA 3NS8A 2QMTA 4NNJB 1HA5A 4ZYNA 2IDYA 3LDZE 3QHTA 4P16A 1C4AA 4GDKA 3PRPB 2MSED 1C4PA 4NJ6A 4ZYSA 2FE8A 1UF0A 2KX3A 3C8YA 3QK0A 2WNMA 4EZJA 2K39A 5JXVA 1FFUA 1WXMA 5G2NA 5AZGA 4WH4A 2NS5A 3M95A 2RMMA 1KFYB 3VQIA 1RWSA 5IN7A 4DHZE 5EE3A 3ZQ4A 3Q8EA 4B95A 1SSNA 2V3PA 2QILA 1IYFA 2G4SA 3DVGY 3ZVVA 3OLMD 3HM6X 1EM7A 2Y3AA 4W9KA 2WX0A 3EFUA 3RMKC 2WXRA 3PLVA 1K8RB 1KM7A 1MI0A 3P42A 4XX5A 2FCNA 4XWWA 1R4NB 5D2MB 4GLSC 2EMSA 4HROA 2RGFA 1GC6A 1ZDVA 4A9AA 2GRIA 2LGSA 1EO6A 2OOBB 3QWZB 2N1WA 3MC8A 3T3NA 1WGRA 4WJQA 2NPTB 4YTNB 3BWUD 3SEBA 1UZXB 4W9CA 2GLSA 4WIPA 3VUYA 2CS4A 1F9JA 1NYRA 2Z0EB 1J0GA 2Q5WD 2WWZA 4K7UA 2KDFB 4NY0A 3ZDMC 1PUTA 2JY6A 1HZ6A 1NYQA 4KSKC 3AE7B 2BKRB 3JSVA 3OJ3A 3RPFC 4W9JA 4ZRJA 4M8MA 2Z8LA 1TY2A 2K25A 2GBRA 1WIAA 1A5RA 2KFKB 2MBOA 4LNIA 1UGMA 4P7IA 2RPVA 2WXNA 1TTNA 3T9LA 5C3JB 4K81A 1TZ1A 4MM3B 2HD5B 2WU2B 3DOWA 2LZ6A 3VRAB 1XT9B 4II3B 2WS3B 2BVCA 1NI2A 1CK1A 2LGYA 4WWPA 3SDLC 2MBBB 4DDGD 4WWNA 5BO4B 4ITKA 2MP2B 4KDLB 4BBNC 2M8SA 4XE0A 2FCSA 3FILB 4YTMB 3SD5A 2BS2B 2L83A 5E6OA 1P3QU 2C60A 2IYDB 3CSFA 1G6JA 3ZNZB 1LGRA 2NBUA 1YQ4B 4KDIC 1EF5A 4EZKA 2DENB 3HVDA 1C77A 4MEMA 2DYBA 4TV3A 2G4DB 4LNFA 2H89B 1T0RC 1FXIA 2O6VA 3B2FA 4LK0M 5EDSA 4EE2A 3MC9A 1RFKA 4G11A 2FBWB 3AB5A 3PHXB 1C78A 2KQ4X 1WGHA 1F0ZA 3V60A 3E56A 1ROEA 5H92C 2LVOA 4RGMA 5MPOA 3BK1A 1WJUA 1WM2A 1D5XC 2K8BA 3L10B 4BKSD 3ZRFA 3QA8A 3RULA 4AJYB 1NENB 4C00A 4XC2A 1XQQA 3HK0A 3WALA 4HPLB 1JWBD 2M1MA 3RNGC 1TBEA 1L4DB 1TKEA 2BWFA 3ZJUA
chains in the Genus database with same CATH topology
2MHJA 2X8XX 3OG5A 4QAYA 3NJTA 4C4VA 4K3CA 3MC9A 3Q6BA 4BZAA 2VH2A 4XGAB 2V9HA 4C00A 3EFCA 4PK1A 2QDFA 3MC8A 4K3BA 2QCZA 4C4VB 2VH1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2MHJ A;  2X8X X;  3OG5 A;  4QAY A;  3NJT A;  4C4V A;  4K3C A;  3MC9 A;  3Q6B A;  4BZA A;  2VH2 A;  4XGA B;  2V9H A;  4C00 A;  3EFC A;  4PK1 A;  2QDF A;  3MC8 A;  4K3B A;  2QCZ A;  4C4V B;  2VH1 A; 
#chains in the Genus database with same CATH topology
 1XEE A;  2DZK A;  2IND C;  3NZ3 A;  2Y5C A;  2V4I B;  3HRD D;  4AUQ C;  1I42 A;  2K9X A;  4DHJ B;  3U30 A;  4KX6 B;  2KLC A;  3P4P B;  1WJ6 A;  3APD A;  4P1C C;  2MBE A;  1Q1O A;  3I57 A;  2M56 B;  2WXO A;  2V1Y A;  3BVG A;  3X23 A;  3LXF A;  5KHO A;  2QCZ A;  4MAC A;  5CX3 A;  1Q5W B;  2K3U A;  1YMH E;  1LM8 B;  2DZM A;  3UGB B;  3EUB 2;  4OHJ A;  1T0Y A;  4K3C A;  2X38 A;  1UGJ A;  1Q0W B;  4XDD A;  3QAQ A;  1I4Q A;  1WYW B;  3QJZ A;  3DHI C;  5IA7 A;  1WI0 A;  3ZW3 A;  2XBB C;  3BIN A;  3RNF C;  4AP4 C;  3Q8A A;  3AED B;  3JSV B;  2MWS B;  1NEK B;  2BQQ A;  2E6X A;  1BUI C;  4HJK A;  4PYZ A;  1PYW D;  4G3X B;  2PE6 B;  4K7W A;  2FCM A;  1NDD A;  2CHW A;  2L76 A;  1L7Y A;  1L0X B;  3DQV A;  3L13 A;  4XGA B;  2J0J A;  1MFW A;  2LHE A;  3PZ8 A;  5BYQ A;  2NVU I;  4OZA A;  2KDM A;  2A5U A;  4GU2 A;  4YTP B;  1ZOY B;  3MHS D;  3A9K A;  4C7Z A;  4WJN A;  1H8C A;  2DHZ A;  3A4S C;  3APC A;  1LXD A;  3KYD D;  4YL8 A;  1M4V A;  3V62 A;  3TJP A;  1FNU A;  4MM3 A;  4EKU A;  4MJS A;  4HKQ A;  4HDQ A;  1JCK B;  3APF A;  2J0M A;  4WWO A;  1OEY A;  3U8Z A;  1D6E C;  2LGI A;  1VJK A;  5IKC M;  4A3O A;  4C7Y A;  1SIF A;  1NVI D;  5KHQ A;  1LO5 D;  2J42 A;  1RM6 C;  4FUL A;  3PS6 A;  2DAJ A;  4E71 A;  3KYC D;  2D07 B;  4A8X C;  2WQY B;  4J6I A;  2ON8 A;  1V6E A;  2ZPY A;  1XLN A;  4QAY A;  2HTM E;  5HG2 A;  4JGH B;  3NJT A;  1JWU D;  2CJN A;  1TIF A;  2QEJ C;  4L23 A;  1WXV A;  1HEZ E;  3R66 C;  2FIF A;  3AE6 B;  3EGR A;  2LXC A;  2PMV A;  2MJ3 A;  2K5P A;  3M63 B;  2K6D B;  2V4L A;  3L17 A;  3ZLZ A;  2JRI B;  1JW9 D;  3BY4 B;  2LVQ A;  4MGK E;  1UNS A;  3UIN B;  1R4N I;  2QHO A;  3ONS A;  2AEH A;  1GC7 A;  2QDF A;  4HPP A;  3DBH B;  1C79 A;  2WDV B;  3WAN A;  2KNB A;  2NBV B;  3R3M A;  1WR6 E;  2CHZ A;  1MVK A;  3PVL A;  2BW2 A;  2KAC A;  1ZKH A;  2SEB D;  1QOB A;  2RPQ A;  2KX0 A;  2HJ8 A;  4XWT A;  2N9X A;  3P1M A;  2ZZP B;  2L7R A;  1QQR A;  1V1P A;  2AX5 A;  4L2Y A;  5HHD G;  1XD3 B;  4TMA B;  2K6Q A;  1TS4 A;  2KYW A;  4ANU A;  2OJR A;  4W9I A;  2PPH A;  4FHK A;  2L1A A;  1E6E B;  3V6E B;  2JXT A;  2MCN B;  2OHF A;  1WGG A;  4FJV B;  1JWM D;  2MHJ A;  1N60 A;  3CWI A;  3K9P B;  2DYM A;  2KHW B;  3AE1 B;  4XZ4 A;  4RCO A;  2VH2 A;  2L32 A;  3MC0 B;  1JRO A;  3DBR I;  5CTR C;  1T0S C;  3P4Q B;  1N63 A;  1WE6 A;  1I4X A;  2B76 B;  2JZP A;  2I1J A;  4FJZ A;  3OG5 A;  4ZRQ A;  1UWM A;  1JQ4 A;  2JWU A;  3OAW A;  3AEF B;  3TMP B;  2GBJ A;  4B0M A;  2KMC A;  4FLH A;  5LLI A;  1FCC C;  1KJT A;  5L95 C;  3RCZ A;  1I4H A;  3RUI B;  4G50 A;  2BB5 A;  1N61 A;  1STE A;  2B3A A;  1SE3 A;  1F77 A;  2L05 A;  1SEB D;  2X8X X;  1ZW7 A;  1OEY J;  2HE7 A;  1MJD A;  2INN E;  2MW5 A;  3U52 E;  1J7B A;  3CF6 E;  2WDT B;  3P4S B;  3Q8B A;  5CHW A;  1VDV A;  3ZDT A;  1MG8 A;  4EUT A;  4N58 A;  2N1V A;  1I7H A;  3TCA A;  4FJY A;  3UQB A;  4S17 A;  5CHF A;  1TZO A;  2LUM A;  3PZ7 A;  4MEL A;  2L0F A;  4MGZ E;  3PLU A;  1WMH A;  2C9W B;  4KGR A;  3C0R B;  3AEE B;  2WXQ A;  2AQ1 B;  2WYQ A;  3QCA A;  1V9J A;  4RH6 A;  5G5G A;  1P0R A;  5DPW A;  2MP2 A;  2KZR A;  1PQS A;  3NVY A;  2KLG A;  2V0G A;  2MH7 A;  1WX7 A;  3ZXV A;  3ZJT A;  1QOA A;  2C7H A;  4US8 A;  1XO3 A;  2ACZ B;  3MJW A;  4PS8 A;  5C1Z A;  3KWL A;  1K53 A;  4JE3 B;  2O6V B;  1E8X A;  3N9Y C;  4F1S A;  2R61 A;  3KLS X;  4DK5 A;  2KFK A;  3Q8F A;  2KN5 A;  1Z2M A;  4ACF A;  3ZIM A;  3N32 A;  2PJH A;  4O1N A;  1MHX A;  3RI7 C;  3DVN V;  2M19 A;  2Z59 B;  3FAH A;  1N5W A;  3V05 A;  2IJ0 A;  3NHE B;  1L2N A;  3KUD B;  1FNV A;  5J2R A;  2IPK D;  1TS2 A;  2YEP F;  1BT0 A;  1FXA A;  3M3J A;  4MH8 A;  4MT5 A;  3W1Y A;  3AXC A;  4WAF A;  4BFR A;  3B9J A;  1KLG D;  3A4R A;  1SGH A;  1K51 A;  1MG4 A;  5E6N A;  4ARC A;  3IAS 1;  1AW7 A;  2MRP A;  2V3N A;  2K1F A;  5D3D A;  1V80 A;  2M0A A;  4G0N B;  1PGB A;  1V5T A;  2I2Y A;  4JIO U;  2ZCC A;  1EUV B;  2WXK A;  2KOX A;  4FA6 A;  2RD0 A;  4K7S A;  3L4P A;  4NQK E;  4N59 A;  3GZN I;  4ZDV A;  4RF0 A;  4YT0 B;  4HCN B;  4JL9 A;  3N1Z C;  3QIJ A;  3DHG C;  3NZU A;  1E9M A;  3CMM B;  1L4Z B;  1IGC A;  2N0S B;  2IO2 B;  4HEA 1;  2KWU B;  2WDQ B;  2RSU A;  3X0W A;  1I35 A;  4KKJ A;  1GAQ B;  5JHB A;  4TUU A;  4MSQ B;  3AEA B;  2LI5 A;  2D10 A;  4RGT A;  4WWM A;  1BML C;  2REX A;  5IAA C;  1Q10 A;  4DDI D;  2R2O A;  1YN4 A;  2ZPN A;  4KV2 A;  2G9H D;  4US9 A;  2INP E;  3IFW B;  3VH3 B;  2ONQ A;  2KQ7 A;  3N20 C;  4HCP B;  5L83 A;  3A1Q A;  1QOF A;  4JWS C;  4FXC A;  4EOY A;  2WHI A;  3RZW C;  4ZRP A;  3ZUN A;  3IBE A;  5AUI A;  4PS7 A;  1E7P B;  2PW9 A;  2VZK D;  2LWP A;  4JLC A;  2MBH A;  3L54 A;  4H2A A;  3Q6B A;  1D5Z C;  1AWD A;  3A9J B;  3L08 A;  3SFE B;  4NAW B;  5BYS A;  3R7Q A;  5EE9 A;  1K50 A;  4DXF A;  2EMT A;  2VH1 A;  5E6J A;  1EWC A;  2KXJ A;  4URK A;  1GG3 A;  4YSX B;  3PV1 A;  3AU4 A;  2C5L C;  3NVZ A;  1KRH A;  3NZS A;  4GMV A;  3ENE A;  1IUE A;  1X1M A;  5BMG A;  1UWX A;  1FFV A;  1OFF A;  2KC1 A;  2AL3 A;  3AN1 A;  4IM2 A;  1FM0 D;  4L1B A;  1B9R A;  2IY0 B;  4OW0 A;  5LXI B;  4W9D A;  2KJ6 A;  1WGY A;  3Q14 C;  2G1E A;  2N9K A;  3NG0 A;  4IC7 B;  4K1R B;  1WJN A;  3DWG C;  4ZRK A;  2WGS A;  2NR2 A;  3PHW B;  4ANW A;  1WXQ A;  3Q3F A;  2KAN A;  2W55 A;  2W3R A;  5FR3 A;  3WA0 A;  4IKG A;  4A3P A;  1XLQ A;  3A9J A;  4MGY E;  3NVW A;  1YN5 A;  2PLP A;  1N62 A;  2EEL A;  2W82 A;  2WXM A;  2DNF A;  3DBL B;  2AWT A;  3TIX A;  3VFK A;  2LMC A;  4IWQ A;  3NVV A;  5HFY A;  3GOE A;  1YIW A;  4DHZ B;  3TSS A;  3UF8 A;  1SB3 C;  1VRA B;  3BYT B;  1B1Z A;  4AJW A;  1T5X D;  4KSL C;  1XCT L;  5EE0 A;  4P1B C;  2D2Q A;  3KW5 B;  2IGH A;  2KMM A;  2VRR B;  3WCQ A;  5JHA A;  4ZRI A;  2LGX A;  4WQM A;  5BMI A;  4BVU C;  3EHV A;  4AOF A;  2LRU A;  4EZL A;  2Y5B B;  3Q3J A;  2LD9 A;  1I4P A;  4CQN A;  4A20 A;  1WFY A;  1WX8 A;  4ZHO A;  1UBQ A;  1HXY D;  4II2 B;  4XYC A;  2BKF A;  3UI3 A;  2L52 A;  3W5V B;  4HDO A;  1V1O A;  3BVZ A;  1TYG B;  2CU1 A;  3ZTD A;  5IO9 A;  2WXH A;  1FO4 A;  5AEK B;  3DPD A;  3AMZ A;  1V81 A;  5FK9 C;  1RLF A;  2PTL A;  4W9H A;  2ZVN A;  2JZ3 B;  4MDK E;  2AYO B;  3KWV A;  4A90 A;  2ZW0 A;  1GNU A;  4BOZ B;  4CHK A;  2V9H A;  1VR9 A;  1WXA A;  3RZF A;  3U4E G;  1JML A;  2BYE A;  5HKH A;  4HJG E;  2KDE B;  5DPS A;  2L00 B;  5EE1 A;  2UU7 A;  2BS3 B;  4KIK A;  4HKZ E;  4E3C A;  3U7Z A;  3O13 A;  2SAK A;  4ICU A;  4PS3 A;  1PDX A;  2BPS A;  3DBH I;  3H8H A;  3W5U B;  1FRD A;  3AUL A;  4WUR A;  1YJI A;  5G55 A;  2J0K A;  2KJH B;  4CO7 A;  3RFZ B;  3IT6 B;  4TQ0 A;  3O65 B;  3H6N A;  5GXG B;  4KIK B;  3HIZ A;  4WJO A;  3IHP C;  2JT4 B;  2D3G A;  1QIL A;  3FKY A;  1ZP0 B;  3A33 B;  3RD2 A;  4KGT A;  1TY0 A;  2BGF A;  3C19 A;  1C9F A;  2EKE C;  1GPX A;  1FRR A;  4USA A;  3DWM A;  1K52 A;  1EU3 A;  1L5P A;  4C4V B;  3Q69 A;  3EEC A;  3QAR A;  2KAJ A;  3PPA A;  1S1Q B;  4RF1 A;  3UQA A;  1YX6 B;  3ECI A;  3AI5 A;  3CST A;  1WSP A;  3MP9 A;  4REZ A;  3AEB B;  1SXT A;  1IBX B;  1XLO A;  2N9P C;  3I3T B;  3ML9 A;  4KZC A;  4A55 A;  1V97 A;  3E9S A;  1SIJ A;  3L16 A;  3JW0 X;  3Q3N C;  3QQ8 B;  3R2T A;  2FAZ A;  2QIE B;  2KQS A;  2W3S A;  1WRD B;  2YEP B;  4NAM A;  3AE5 B;  3NRZ A;  2JF5 A;  2BYV E;  2WXJ A;  5J18 A;  5T8I A;  1N5X A;  1P98 A;  3ZO5 B;  4DHJ D;  2FID A;  3OJ4 B;  1ENF A;  1OGW A;  3VR8 B;  3BZD B;  1T3Q A;  4IOI E;  4JWU C;  4OZC A;  4C80 A;  1BXT A;  1HTO A;  4ICV A;  5IP4 D;  2D3C A;  3FC4 A;  4DBG A;  3TEY A;  2CR5 A;  3H9D A;  2XN9 C;  4GGQ A;  4IM0 A;  1F1H A;  2M4N A;  2Z0D B;  4GIV A;  1DOX A;  4FAD A;  4OVV A;  5CHV C;  4BOS C;  3GZN B;  2LGD A;  3Q2A C;  4PT5 A;  4ANX A;  2KFJ A;  5C23 A;  3TL5 A;  2VZK B;  1E8Z A;  1TGZ B;  1JRU A;  2JRH A;  4M8N A;  4OVU A;  2QJL A;  3PT2 B;  3DVG X;  4M01 A;  4PYU A;  2KKC A;  4HXD A;  2YVC A;  1J8C A;  4JPS A;  2ZW1 A;  1E8Y A;  4NPN A;  2W54 A;  1C76 A;  1VCB A;  2BTE A;  1ZPS A;  2DAF A;  2J52 A;  2IO3 B;  3R7R A;  1E0Z A;  1EWY C;  1MHH E;  3ZXR A;  2NTT A;  1OQY A;  2GBK A;  1E10 A;  4F7Z A;  3UIO B;  1IP9 A;  4P6V F;  2JPH A;  3AM9 A;  2K0P A;  2DBY A;  1MPE A;  3AE4 B;  3H7S A;  1DOY A;  1LQB A;  3ZRC A;  4GDL B;  4KKI A;  3ALB A;  4Q2J A;  2WXP A;  1KF6 B;  3VAW A;  1GOZ A;  1I4G A;  4NJ7 A;  4YSY B;  5FKA C;  2WP9 B;  4BKS A;  1P7E A;  3EFC A;  2WDR B;  4S0R A;  1WM3 A;  1VD2 A;  4TSS A;  3Q8C A;  1WZ3 A;  1ZE3 D;  3AV8 A;  5JH5 C;  2MLB A;  2XNA C;  1RRB A;  3PRE A;  4LDT D;  1FPY A;  5IOI A;  4BZA A;  1ZGU B;  1Z5S B;  4IG7 B;  1YD8 U;  1XLP A;  4MSM B;  4I6L B;  1DGJ A;  3RNC C;  4NAW A;  3HM3 A;  2GBM A;  3PTF C;  5AZF A;  1YQB A;  4YXD B;  3ABV B;  4EEW A;  2BYT A;  1FNW A;  3AH7 A;  5H8Y E;  4I6N B;  4M0W A;  4LDT B;  4F8C B;  1IGD A;  2JZZ A;  1TKG A;  2G45 B;  2KVZ A;  1FCL A;  4GDK B;  1V49 A;  1IBX A;  4LJP B;  3MFG A;  3W1S C;  1VZ6 A;  1ZXI A;  1D3Z A;  2O6V D;  2A4Z A;  2BF8 B;  3T3O A;  2XK5 A;  1NI3 A;  1UBI A;  3PRM B;  3ZGZ A;  2MA9 B;  4C4V A;  1VZ7 A;  3EC8 A;  4GXB A;  2FUH B;  3ZNH B;  1JAL A;  1D5M C;  2BWE S;  3KH0 A;  2PKO A;  5AUK A;  1S3S G;  3AE3 B;  4W9F A;  4LTU A;  3MJ5 A;  3DCG A;  2OJW A;  4FBJ B;  1YJ1 A;  2DWQ A;  2KTR B;  1HQR D;  4NJC A;  3VR9 B;  3KUZ A;  1WGK A;  3IVF A;  2N9L A;  3H7P B;  4DWF A;  3VH4 B;  4DQO C;  2LVP A;  2CHX A;  2C7N B;  3B08 A;  3HUI A;  2MBQ A;  2ZNV B;  3WAO A;  1SE4 A;  1T0Q C;  4FN2 A;  2AQ3 B;  5BMH A;  2GBN A;  1YX5 B;  1ZXH A;  1FXT B;  2JYE A;  3DBR B;  2MEK A;  2LJ5 A;  4TQ1 A;  4RGO S;  1F52 A;  2O2V B;  2PVG C;  2GOW A;  3PGE A;  2MJE A;  2LRW A;  4PK1 A;  4M00 A;  3AE2 B;  3S2A A;  2DYO A;  5DPT A;  3RT3 B;  4YSZ B;  3Q3O C;  3VDZ A;  3EA6 A;  5BYR A;  3AE8 B;  2INC C;  5LNK 1;  2DZI A;  3BII D;  2CU3 A;  3ZKJ C;  1OQR A;  1KLV A;  2LJI A;  2CKH B;  2GB1 A;  2HTH A;  2K8H A;  5D3I B;  1XXG A;  4C56 C;  4ASW C;  3B2G A;  1V1P B;  4LCD E;  1C3T A;  5J17 A;  3I5J C;  4AS1 A;  2WXG A;  3PRZ A;  3IT4 B;  3BK2 A;  1CMX B;  1TKY A;  1FEH A;  1D4B A;  1Y8R C;  3VRB B;  1L0Y B;  4ANV A;  2LFI A;  1XF5 L;  2KK8 A;  1IPG A;  4GDL A;  4HK2 A;  2L8J A;  4ZOH C;  1WR1 A;  4W9L A;  3RYT A;  3R8B A;  2KC2 A;  2N7J A;  3SFD B;  1E8W A;  4WAA A;  4BBN F;  2JYT A;  5TR5 A;  1JWS D;  2GMI C;  3I63 C;  1WX9 A;  2WU5 B;  2WXL A;  1WYG A;  1L6U A;  3GS2 A;  1DYQ A;  1ESF A;  3SR6 A;  1C1Y B;  1FMA D;  4XDC A;  1GB1 A;  2WLB A;  3MHZ A;  4M0W B;  4HPM B;  3NUH B;  3AEC B;  4W9G A;  2ASQ A;  3U7D A;  1ISN A;  1M94 A;  3TEW A;  2HDE A;  5AZH A;  2KO3 A;  3FIL A;  5C2T B;  3TEX A;  5D7G A;  5D6J B;  3ZYY X;  1JRP A;  3IAM 1;  3L0W B;  4N9F 4;  3DBS A;  1YNT E;  1H4R A;  1WWT A;  4BAX A;  4KGS A;  5JZE B;  5TSS A;  1T6B X;  2WXI A;  2D11 A;  2KWV B;  1ACC A;  1CZP A;  4BKT A;  1ET6 A;  1ET9 A;  1SJE D;  1ZDX A;  2N4F A;  3RN9 C;  1WXS A;  1AYF A;  2I1K A;  1QOG A;  4GOC A;  3V3X A;  1SE9 A;  4B0E A;  1SE2 A;  1QT9 A;  2L0T A;  2RDB C;  3VUX A;  2BB6 A;  3AE9 B;  1R4M B;  2XEW A;  2PE9 A;  1NBF C;  5DPR A;  4ZHP A;  4NQL B;  4KZ0 A;  3V61 A;  3W2D A;  2MJD A;  3TBL D;  4HRS A;  1I4R A;  4RM8 A;  3ZNG C;  4W9E A;  2KVR A;  3VUW A;  2L3Z A;  4UDU C;  3JYU A;  1TS3 A;  2AL6 A;  4I6P A;  3NY5 A;  2AQ2 B;  1E5W A;  5D94 A;  2RDH A;  3CIR B;  4HLE A;  3VHT C;  2NMQ A;  2QSD A;  3V6C B;  3JVZ X;  4IWO A;  1E90 A;  2QC8 A;  2KD0 A;  4BKG A;  1Y56 A;  3WAM A;  3W9C B;  3DDC B;  3ZTC A;  3NS1 A;  4R3D A;  3H7P A;  3TUO A;  4B6W A;  2KN4 A;  3P2B A;  4LJO B;  2KMA A;  1U4A A;  2K22 A;  2CJO A;  4CYE A;  3HVZ A;  2J7Q B;  3RNB C;  3DVN U;  3VVW B;  3N1X C;  5GMV A;  1EF1 A;  4AWJ A;  3K9O B;  2KT7 A;  2MX2 A;  4LNK A;  1P1A A;  3ZNI D;  2IY1 B;  1WZ0 A;  2R2Q A;  2LXA A;  1AAR A;  3WIM A;  2JSV X;  3P63 A;  2C7M B;  4MGI E;  2XK5 B;  1YQ3 B;  4FHJ A;  2W9N A;  2FCQ A;  2K8C A;  2KJR A;  3QX1 A;  1C4C A;  1UEL A;  1SF0 A;  1RYJ A;  1N6Z A;  4YWG G;  1XCQ L;  4N6E B;  1WY8 A;  2KDI A;  4J3O D;  2IBI B;  3DHH C;  2KTF A;  1AN8 A;  1F2R C;  3KUC B;  1SBB B;  4IWP A;  4DXG A;  5G5H A;  4LNO A;  1QLB B;  4HVB A;  2M0X A;  3N3K B;  4JQW C;  2ICI A;  1YN3 A;  4EFO A;  2PEA A;  1J19 A;  3A1Q B;  3W1S A;  1GB4 A;  3P4R B;  1FIQ A;  3WAP A;  2NBW B;  1L6V A;  2G3Q B;  2MQJ A;  2BBC A;  4LNN A;  2J4X A;  1R4M I;  2TSS A;  2FNJ B;  1OTR B;  3PZD A;  1RAX A;  2LHD A;  1QF6 A;  1WH3 A;  1V86 A;  2UYZ B;  3N30 A;  4NZL B;  2JVC A;  2ZEQ A;  1SJH D;  3BYY B;  1VZ8 A;  2V3S A;  4IUM B;  4OVZ A;  4GN1 A;  3QC8 B;  3KQ4 A;  3DBL I;  3R2I A;  5I4D A;  5FR6 A;  2DX5 B;  2IO0 B;  2IGG A;  3J9C A;  3BVM A;  2N7D A;  2BT6 A;  3ML8 A;  1EU4 A;  3RNE C;  4D2K A;  3U2S C;  4RNA A;  3ETR A;  4A6Q A;  1V5O A;  3B1L X;  2N9E B;  3PSE B;  4JX1 C;  4GSW A;  3RNA C;  2IO1 B;  3UIP B;  3A9K B;  1OQQ A;  1TJE A;  2NCN A;  4OZB A;  3GB1 A;  2H88 B;  2LUE A;  1KOT A;  2JU6 X;  4E74 A;  1CJE A;  1WRI A;  2GI9 A;  3IXS A;  1PGA A;  1JWA D;  2JWZ A;  2KTR A;  2NTS A;  4MH0 E;  4RMA A;  4IDI A;  2M17 A;  4WQO B;  3ZJV A;  2BYF A;  3LJ3 A;  1WE7 A;  4TKN A;  1KLU D;  1UH6 A;  2E3T A;  2D3B A;  2IGD A;  1P7F A;  2YLM A;  2RR9 A;  4RGN A;  1J7A A;  4GB9 A;  2O2V A;  1CQV A;  4X57 B;  1V8C A;  3KVF B;  2LEK A;  2BS4 B;  3HHM A;  5LXH A;  3VTU A;  1WJ4 A;  2FUG 1;  4HWI B;  2JUO A;  2KWC A;  3D32 A;  1WMH B;  1RFA A;  1KH0 A;  1HE8 A;  2J53 A;  1GUA B;  3Q3M C;  1LFD A;  1PGX A;  3H1U A;  3GE8 C;  1TS5 A;  2KDB A;  2PIA A;  4LLG M;  4B9K A;  4AQ7 A;  1V2Y A;  3OWE B;  3M62 B;  3URY A;  2PVO D;  1L0V B;  2HJ1 A;  2IZV B;  3SHQ A;  4RM9 A;  2JQR B;  3N1Y C;  3VTW A;  2RDG A;  3I9V 1;  1P9D U;  3GP7 A;  1FD6 A;  4IW0 A;  2DLB A;  4RFB A;  4WJP A;  1YJJ A;  4ARI A;  3IG3 A;  1E7V A;  1WF9 A;  3PO0 A;  2ZJD A;  3VTV A;  2KWD A;  1HZ5 A;  2ZCB A;  1F2R I;  2JXX A;  2LAS A;  1ZUD 2;  5HI1 A;  1QZE A;  4DXA B;  2D5G A;  2WXF A;  2EKI A;  3SU8 X;  4IM3 A;  4KVG B;  1DOI A;  2ZVO A;  1UUP A;  1GJZ A;  3GE3 C;  3AEG B;  5E6P A;  2WX1 A;  2UWQ A;  1KTK A;  2ZNV C;  2Y5P A;  4K3B A;  2NPT A;  3LB8 C;  3AU5 A;  1YOV B;  3B0A A;  2OED A;  2D3A A;  2JX5 A;  1VLB A;  1R7S A;  4M02 A;  1HTQ A;  1PFD A;  4MJS B;  5DCN A;  1UD7 A;  2I38 A;  1J7C A;  3NOB A;  3T8M A;  1A70 A;  3TEZ A;  2DZJ A;  3VXW A;  1E7U A;  1QKZ A;  1WGD A;  3MTN B;  1TT5 B;  3LYY A;  2N7E A;  3NS8 A;  2QMT A;  4NNJ B;  1HA5 A;  4ZYN A;  2IDY A;  3LDZ E;  3QHT A;  4P16 A;  1C4A A;  4GDK A;  3PRP B;  2MSE D;  1C4P A;  4NJ6 A;  4ZYS A;  2FE8 A;  1UF0 A;  2KX3 A;  3C8Y A;  3QK0 A;  2WNM A;  4EZJ A;  2K39 A;  5JXV A;  1FFU A;  1WXM A;  5G2N A;  5AZG A;  4WH4 A;  2NS5 A;  3M95 A;  2RMM A;  1KFY B;  3VQI A;  1RWS A;  5IN7 A;  4DHZ E;  5EE3 A;  3ZQ4 A;  3Q8E A;  4B95 A;  1SSN A;  2V3P A;  2QIL A;  1IYF A;  2G4S A;  3DVG Y;  3ZVV A;  3OLM D;  3HM6 X;  1EM7 A;  2Y3A A;  4W9K A;  2WX0 A;  3EFU A;  3RMK C;  2WXR A;  3PLV A;  1K8R B;  1KM7 A;  1MI0 A;  3P42 A;  4XX5 A;  2FCN A;  4XWW A;  1R4N B;  5D2M B;  4GLS C;  2EMS A;  4HRO A;  2RGF A;  1GC6 A;  1ZDV A;  4A9A A;  2GRI A;  2LGS A;  1EO6 A;  2OOB B;  3QWZ B;  2N1W A;  3MC8 A;  3T3N A;  1WGR A;  4WJQ A;  2NPT B;  4YTN B;  3BWU D;  3SEB A;  1UZX B;  4W9C A;  2GLS A;  4WIP A;  3VUY A;  2CS4 A;  1F9J A;  1NYR A;  2Z0E B;  1J0G A;  2Q5W D;  2WWZ A;  4K7U A;  2KDF B;  4NY0 A;  3ZDM C;  1PUT A;  2JY6 A;  1HZ6 A;  1NYQ A;  4KSK C;  3AE7 B;  2BKR B;  3JSV A;  3OJ3 A;  3RPF C;  4W9J A;  4ZRJ A;  4M8M A;  2Z8L A;  1TY2 A;  2K25 A;  2GBR A;  1WIA A;  1A5R A;  2KFK B;  2MBO A;  4LNI A;  1UGM A;  4P7I A;  2RPV A;  2WXN A;  1TTN A;  3T9L A;  5C3J B;  4K81 A;  1TZ1 A;  4MM3 B;  2HD5 B;  2WU2 B;  3DOW A;  2LZ6 A;  3VRA B;  1XT9 B;  4II3 B;  2WS3 B;  2BVC A;  1NI2 A;  1CK1 A;  2LGY A;  4WWP A;  3SDL C;  2MBB B;  4DDG D;  4WWN A;  5BO4 B;  4ITK A;  2MP2 B;  4KDL B;  4BBN C;  2M8S A;  4XE0 A;  2FCS A;  3FIL B;  4YTM B;  3SD5 A;  2BS2 B;  2L83 A;  5E6O A;  1P3Q U;  2C60 A;  2IYD B;  3CSF A;  1G6J A;  3ZNZ B;  1LGR A;  2NBU A;  1YQ4 B;  4KDI C;  1EF5 A;  4EZK A;  2DEN B;  3HVD A;  1C77 A;  4MEM A;  2DYB A;  4TV3 A;  2G4D B;  4LNF A;  2H89 B;  1T0R C;  1FXI A;  2O6V A;  3B2F A;  4LK0 M;  5EDS A;  4EE2 A;  3MC9 A;  1RFK A;  4G11 A;  2FBW B;  3AB5 A;  3PHX B;  1C78 A;  2KQ4 X;  1WGH A;  1F0Z A;  3V60 A;  3E56 A;  1ROE A;  5H92 C;  2LVO A;  4RGM A;  5MPO A;  3BK1 A;  1WJU A;  1WM2 A;  1D5X C;  2K8B A;  3L10 B;  4BKS D;  3ZRF A;  3QA8 A;  3RUL A;  4AJY B;  1NEN B;  4C00 A;  4XC2 A;  1XQQ A;  3HK0 A;  3WAL A;  4HPL B;  1JWB D;  2M1M A;  3RNG C;  1TBE A;  1L4D B;  1TKE A;  2BWF A;  3ZJU A; 
#chains in the Genus database with same CATH homology
 2MHJ A;  2X8X X;  3OG5 A;  4QAY A;  3NJT A;  4C4V A;  4K3C A;  3MC9 A;  3Q6B A;  4BZA A;  2VH2 A;  4XGA B;  2V9H A;  4C00 A;  3EFC A;  4PK1 A;  2QDF A;  3MC8 A;  4K3B A;  2QCZ A;  4C4V B;  2VH1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...