1QQRA

Crystal structure of streptokinase domain b
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
138
structure length
138
Chain Sequence
IQNQAKSVDVEYTVQFTPLNPDDDFRPGLKLTKLLKTLAIGDTITSQELLAQAQSILNKNHPGYTIYERDSSIVTHDNDIFRTILPMDQEFTYRVKNREQAYRINKKSGLNEEINNTDLISEKYYVLKKGEKPYDPFD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Hydrolase activator
molecule keywords STREPTOKINASE DOMAIN B
publication title Crystal Structure of Streptokinse Domain B
rcsb
total genus 35
structure length 138
sequence length 138
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 1999-06-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02821 Staphylokinase Staphylokinase/Streptokinase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.180 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1qqrA00
1C4PA 1L4DB 1L4ZB 1QQRA 1BMLC
chains in the Genus database with same CATH superfamily
3I63C 3AEAB 1E8YA 1EM7A 1UGJA 2KVZA 5J18A 1BT0A 3BYTB 4WJOA 4HEA1 1N62A 3A1QA 4PYUA 4ACFA 3O65B 1ISNA 3PPAA 1K53A 3DPDA 2KACA 2MJ3A 1UZXB 1FNUA 2CS4A 3AEBB 3A9KA 4DXFA 1JROA 2REXA 4JIOU 4HDOA 4WIPA 2K6QA 5EE3A 2QDFA 2EKIA 2IY0B 4WH4A 4PS8A 4KDLB 2FE8A 4RGTA 4NY0A 4LNFA 2KVRA 2V3NA 3APFA 4JE3B 3TEYA 3UQBA 1LFDA 4EE2A 2WS3B 4KX6B 1JMLA 2HE7A 3BK1A 2J42A 2QHOA 3C19A 3JVZX 3OLMD 2N9XA 3DBRI 2ZW1A 2KFKB 1F2RC 5TSSA 5DPWA 1WJ4A 1IGCA 3GP7A 4R3DA 1VZ6A 3V05A 3WA0A 2WDRB 2BPSA 5H92C 5EE1A 3D32A 3AE7B 3H7PA 2L05A 4RF0A 2N0SB 1F52A 2L3ZA 3HRDD 1F77A 4G0NB 1WXVA 3PSEB 2UU7A 4JL9A 1WGYA 4OW0A 2HD5B 1HE8A 4FJZA 4IWQA 2V9HA 2WXLA 5E6PA 2MJDA 4DHZB 1Q0WB 1E8WA 2WDVB 3ZNID 1ZW7A 1N6ZA 2N9EB 3A33B 3JSVA 2OJRA 3FILA 3ZXVA 5HHDG 2C5LC 4KIKB 1ZOYB 3B2GA 4W9HA 2K8HA 5E6JA 2J52A 5JXVA 5JHBA 1V6EA 4YSXB 1JQ4A 2KLGA 1EU4A 1DOXA 3RNGC 1I4GA 1D6EC 2WXOA 3ALBA 1P9DU 3AE8B 4LNNA 2Q5WD 3U4EG 1NYQA 3ZJTA 3MC9A 5I4DA 4BKSA 1FCLA 3X23A 1DYQA 1QOAA 2WYQA 2B3AA 5LLIA 3ONSA 4MGIE 1T0YA 2LGSA 3TEWA 2N9PC 3AU4A 3Q8EA 5D3DA 4PS7A 2XBBC 3MTNB 3B9JA 4DHJB 2RGFA 3R7QA 1WSPA 3H9DA 2LRWA 2FCNA 2CHWA 2LHDA 3AU5A 4ZHOA 2D11A 3MFGA 2D3GA 1I4XA 2KC2A 2KHWB 3I57A 1WJ6A 4AWJA 4FA6A 3DCGA 3PT2B 1JW9D 1P7EA 4I6PA 4M02A 2L00B 3NVYA 2BBCA 4II3B 2ZJDA 1V1OA 1ZE3D 5AZFA 2QJLA 2Z59B 1L0VB 3AE1B 4AJWA 5G5HA 5FKAC 5C2TB 3U7DA 2RDHA 4YTMB 4HCNB 3SR6A 2DYBA 1E6EB 1K50A 3TIXA 4KGSA 4W9IA 2DZIA 2KO3A 2W55A 4IWOA 4RGNA 2M0XA 2ASQA 4KV2A 3UIOB 3URYA 4K3BA 4KSLC 3V6EB 1R4MI 1R7SA 1L2NA 4KZ0A 2FUHB 1FEHA 3RN9C 2BYVE 2FCSA 1H4RA 3ZNHB 4CYEA 2HJ8A 1V1PA 1L4DB 1T5XD 2WU2B 4L23A 4PT5A 5D3IB 1E0ZA 4HVBA 4WWNA 3M62B 2BB5A 2JYTA 1N63A 2D07B 1RYJA 2A4ZA 4WURA 2IGDA 1V86A 3ZDMC 4TSSA 4ICUA 3QQ8B 4FADA 2RMMA 4KGRA 1ZPSA 2QIEB 3EHVA 1YQ4B 5L83A 3SFEB 1SIJA 4GB9A 4MSMB 3QARA 3TEXA 5DPRA 3PGEA 1IBXB 2MEKA 2EMTA 4IM2A 1L6VA 2CJOA 2WHIA 3L13A 2KOXA 4IW0A 4YSYB 3CIRB 4ZYNA 1QQRA 4RGMA 2R61A 1AN8A 2MA9B 2UYZB 3EC8A 2INPE 2D2QA 1SE4A 1OFFA 2X8XX 4JX1C 2BS3B 2EMSA 5BMIA 1SGHA 2D10A 4EFOA 4ZRQA 1C76A 2IO0B 2LVPA 1F1HA 1MPEA 4JLCA 2WX1A 2M8SA 1FFUA 3L54A 3RNBC 3PVLA 3P63A 3ENEA 3MHSD 3PV1A 4UDUC 1E7PB 1XCQL 4K7UA 3K9PB 3TMPB 2L1AA 3DHHC 5LNK1 3AE2B 3AMZA 3DBRB 3P42A 2GBMA 2GBNA 2MWSB 1WM2A 2I1KA 2BKFA 3OG5A 3IT4B 2JY6A 3BK2A 3HIZA 4RCOA 4BFRA 1TJEA 3GE3C 4XE0A 1WE6A 3M63B 3EFCA 2LI5A 1AARA 2WXFA 5IO9A 2N4FA 2PVOD 2WLBA 1CMXB 1E9MA 3AH7A 1D5XC 3NVVA 1YN4A 1TYGB 3RYTA 1FXIA 2IDYA 1RFAA 2LD9A 3QK0A 4ANXA 2RR9A 1TKGA 2PE9A 2LHEA 2GB1A 2ON8A 2PEAA 3NY5A 3N3KB 2HTME 2PIAA 1LQBA 3VTVA 1ESFA 2YEPB 4JGHB 2BYFA 3W1YA 3LYYA 2DAFA 2NPTA 4GDKA 3N9YC 4RNAA 3W1SC 1P0RA 3KVFB 1ZXHA 1TS5A 2I1JA 4S17A 2N9LA 4NZLB 3JYUA 4BVUC 2ZNVB 2PPHA 1ZXIA 3CF6E 5DCNA 1NI3A 4XDCA 3RD2A 1WX8A 2M0AA 1FD6A 3ZO5B 3H7SA 4ZRKA 2WXPA 2JRIB 1PQSA 1LGRA 1SIFA 2WXQA 4KSKC 2G1EA 5BMGA 2KTFA 2C60A 3WCQA 3BY4B 1MVKA 4W9LA 3N1ZC 4F7ZA 3Q3FA 2FIFA 4LNKA 2DENB 2INNE 3M3JA 2BYEA 2BWES 1YN3A 4M0WA 1A5RA 4E74A 2K6DB 4MT5A 2RPVA 2ZEQA 3H6NA 5FK9C 5FR3A 2NR2A 2DHZA 4FJYA 4MM3B 1XCTL 3C0RB 3UINB 3VUYA 2O6VA 1WYWB 2V0GA 1EUVB 1ET9A 3C8YA 2LVQA 3TL5A 4TKNA 4E71A 1QOGA 3H8HA 1JWSD 2RDGA 1P3QU 1WMHA 5T8IA 4GN1A 1WGHA 2V3SA 3A9JA 4BKGA 1FXAA 4N58A 4MJSA 1SE3A 4TMAB 2C9WB 2MH7A 3VXWA 4GMVA 1WWTA 4WJQA 5LXHA 3ZYYX 4PYZA 2YLMA 3KWVA 1M94A 4HPPA 1RRBA 3P2BA 4B6WA 4OZBA 3VR8B 2KDFB 2GRIA 4HJGE 3W1SA 4IC7B 3N1YC 5L95C 4WAFA 5BMHA 1OQRA 2LUMA 3V6CB 4YL8A 2CU3A 1NI2A 3RNEC 2XK5B 2UWQA 2KTRB 3AEEB 3EFUA 4JPSA 3UQAA 3PLVA 3PHXB 4LLGM 3E9SA 3SD5A 4US8A 3VH4B 3VVWB 4OVZA 4B9KA 4XGAB 4IWPA 1ACCA 5MPOA 3IXSA 3NG0A 4CHKA 1WZ3A 2WXMA 3GS2A 3VAWA 2HDEA 2B76B 3MC8A 4N9F4 4DXGA 3HHMA 5IP4D 5HI1A 1E8XA 5AUIA 2NCNA 1MFWA 2WXHA 1I35A 5CX3A 2GOWA 2N7EA 4F1SA 4JQWC 1BMLC 2M4NA 2BKRB 3T9LA 4AJYB 1J7BA 3P4QB 4ANUA 3EA6A 3B1LX 1L0XB 4BKTA 2J7QB 3N20C 4I6NB 4G11A 3V3XA 1GG3A 1I4PA 4MELA 1UELA 5TR5A 1UUPA 2ZW0A 3ZW3A 1PFDA 4ZRJA 3IFWB 2ONQA 3KW5B 1KFYB 3ZXRA 3GZNI 2G3QB 1VZ7A 2DLBA 3RNCC 1ZDXA 3K9OB 3DWMA 2ZVOA 3N30A 3SEBA 4AS1A 1UWXA 3Q8BA 3VQIA 2PE6B 3DVGX 4IM3A 4AP4C 2KFKA 5IA7A 1SF0A 1JWAD 3KQ4A 3RUIB 2ZZPB 1UWMA 3L17A 1QOBA 3A1QB 3RNFC 2RSUA 3KLSX 3ZDTA 4C7ZA 4GDLB 1JWMD 1ZGUB 2BTEA 2VH1A 4XWTA 4CQNA 2DBYA 1OQQA 3EUB2 1P7FA 3ECIA 4W9JA 3W5VB 3PZDA 1JALA 2G4DB 2D5GA 3V60A 4W9EA 2H89B 2LJIA 1JWUD 4RM8A 5AZGA 3KWLA 3W5UB 4KIKA 1G6JA 2IYDB 4RM9A 3SHQA 4AUQC 3DQVA 1H8CA 1QKZA 3ZUNA 3ZJVA 3IBEA 2J0KA 3FKYA 4HPLB 4W9CA 5G55A 4B0EA 5C1ZA 2Y3AA 4WQOB 2I2YA 1WXMA 2AL3A 3NJTA 3NS8A 4M00A 3TEZA 2H88B 3B08A 1V97A 4L2YA 4HRSA 4DQOC 3BINA 3AE5B 1XLPA 3T3NA 1Z2MA 2LXCA 2DZJA 5AEKB 4L1BA 4ASWC 3A4RA 2IBIB 1QZEA 1LM8B 1J19A 2MW5A 3Q8AA 5D6JB 2KAJA 4O1NA 4IKGA 1EO6A 2FUG1 2O2VB 1FNWA 2J0JA 4ZHPA 1I4QA 3AEFB 2X38A 5H8YE 1FCCC 3JSVB 1ZUD2 3R8BA 3EECA 3VR9B 3E56A 1QT9A 2KMMA 3MP9A 1TKYA 1UF0A 1N5WA 3BIID 4URKA 1E10A 1T0RC 2GMIC 1X1MA 4BOZB 4ZOHC 3Q2AC 4NJ6A 1V2YA 4WWPA 3PREA 1GC7A 1SJED 2QC8A 1SBBB 2AQ3B 4OZCA 1PGXA 2V4LA 4KKJA 3NVWA 2KWVB 1Z5SB 5D7GA 4A9AA 1GUAB 1WGDA 1KLUD 3VHTC 4JWSC 4A55A 2ZCCA 4PS3A 3RZWC 1CZPA 3KUCB 2KMCA 2NMQA 2CJNA 1M4VA 4KGTA 2Y5BB 3AB5A 1RM6C 3VDZA 2NTTA 2MBBB 2WX0A 2TSSA 4US9A 1JRUA 2WXNA 3VUWA 1WRIA 1HTOA 3B0AA 3PHWB 2WU5B 3ZKJC 1CQVA 1N60A 2PW9A 4TV3A 4XYCA 4WAAA 2LGIA 1J0GA 2OEDA 4MH0E 4N59A 3RNAC 2JUOA 4RH6A 3QAQA 1YJ1A 5IAAC 1GAQB 4QAYA 2NS5A 1UD7A 2N1VA 2J0MA 1YJIA 2GBJA 4FHJA 4ITKA 3RPFC 3NZ3A 1C1YB 2WXGA 2FBWB 3J9CA 1NVID 4NAWB 2E6XA 3L08A 2E3TA 2ZNVC 3GE8C 3U8ZA 4NNJB 5E6NA 2KDIA 1VR9A 2BS2B 2JPHA 1EWCA 3QIJA 3WAOA 3HM6X 1AYFA 2PLPA 3R7RA 1WR6E 2V1YA 3SU8X 4K81A 4WJNA 3GZNB 3GOEA 3VH3B 2BB6A 2MP2B 4A3OA 4CO7A 3UI3A 4NJCA 3V61A 4NPNA 1NENB 2LFIA 3MJ5A 4ZRIA 2DX5B 2KQSA 4HXDA 1LXDA 4IDIA 1YX6B 2RD0A 3VTWA 3OJ4B 1YOVB 5C3JB 3UF8A 2VZKD 1WM3A 4YSZB 4LTUA 1WXSA 2NBWB 1FXTB 4XC2A 4HKQA 4FULA 1J8CA 2N7DA 2K8CA 5FR6A 1ENFA 3R3MA 5IKCM 2W54A 3I3TB 1TT5B 1DOYA 1HXYD 3HK0A 1T0SC 1IYFA 2AL6A 1EF5A 3Q8CA 4YXDB 4DHZE 3T8MA 1K52A 4FHKA 3APDA 4XX5A 4G3XB 3AE3B 2JVCA 2KXJA 4YTNB 2BT6A 2OJWA 3M95A 3IAS1 1V5OA 1T3QA 2DYMA 5J17A 3AECB 1UBIA 4GU2A 1L5PA 1LO5D 1FNVA 1P1AA 5CTRC 1IPGA 1IP9A 2QEJC 3O13A 3BVZA 2XEWA 3AM9A 2KX0A 3AE4B 2MQJA 2MRPA 1TBEA 3AEDB 1QF6A 3IAM1 3LDZE 2ZPNA 3PLUA 5BYQA 4WJPA 4DXAB 2FIDA 1HZ6A 4KDIC 5G2NA 2PJHA 3R66C 2JXTA 5J2RA 3SFDB 2R2OA 4PK1A 4JWUC 3DHIC 1DOIA 1RLFA 2DWQA 2CHZA 4IM0A 4S0RA 2NPTB 4GDKB 2K25A 2XNAC 1C4AA 1XEEA 4NJ7A 2Z8LA 1F9JA 2MCNB 1CJEA 1C4PA 4C80A 1TS4A 2CHXA 2JRHA 3BVMA 3QHTA 1SE2A 3CWIA 3FC4A 4TQ0A 2W3SA 2KQ4X 5BYSA 2DZMA 2I38A 1WR1A 1YQ3B 4A20A 3PRPB 1E7VA 1YX5B 3RULA 2GBKA 3ML9A 1S1QB 2KC1A 5HG2A 4AQ7A 3KUDB 2MBEA 1DGJA 5CHVC 4FJVB 4K7WA 5HKHA 3TUOA 2WWZA 1VZ8A 1F2RI 4HK2A 2CU1A 2AQ2B 1V49A 4W9GA 2KWDA 3V62A 2XN9C 3P4PB 1C78A 3BVGA 2XK5A 2RDBC 2KTRA 4NAMA 1HA5A 3S2AA 1RFKA 4FN2A 1XD3B 4DWFA 1D5ZC 4XWWA 2K39A 3AN1A 3Q8FA 1MI0A 2K5PA 2CR5A 1WX7A 3A9JB 3NVZA 1J7CA 4EEWA 2KT7A 4HWIB 3ZGZA 1ZKHA 1ZDVA 1E8ZA 1WE7A 1FM0D 2GBRA 2KDBA 2Y5CA 4P7IA 1C3TA 2ICIA 1VJKA 1KTKA 4MH8A 4GXBA 4M8NA 1KLGD 2MJEA 5JHAA 2WQYB 1TS3A 3ZTDA 2JX5A 2MSED 2VZKB 3AULA 1WZ0A 2M17A 3DBHI 1I42A 2DZKA 2K0PA 3H1UA 4M8MA 1R4NI 2L0TA 2KD0A 2IO2B 1I4RA 3CSFA 4BKSD 4C56C 4ARCA 2JF5A 2KFJA 4ANWA 5BYRA 2IGHA 3UIPB 3PRZA 4LK0M 2K22A 1KF6B 4YTPB 1PDXA 3ML8A 3IHPC 2SAKA 4LNOA 1PGAA 4KVGB 1I7HA 3RMKC 1CK1A 3L4PA 3ZLZA 4BZAA 1GB1A 2RPQA 3TCAA 1TS2A 3R2IA 3CMMB 1YN5A 1V8CA 1XF5L 4K7SA 1E5WA 3EGRA 3Q6BA 1UGMA 2D3AA 2C7NB 1N5XA 5IOIA 3PZ7A 1Y56A 4B95A 1FRDA 1C79A 4G50A 4C4VB 2GLSA 3OWEB 4OVUA 2NBVB 4BBNC 3HVDA 4MACA 1YJJA 1I4HA 2BW2A 4GDLA 3L10B 1Q10A 2WNMA 4EUTA 4A8XC 3PTFC 5GXGB 2LMCA 2NTSA 1K8RB 2LGYA 2JWUA 2INCC 1TY2A 3NZUA 1WGRA 4FXCA 4GGQA 4P6VF 1TIFA 2KJHB 4RMAA 3A9KB 1KOTA 2QSDA 5D94A 3T3OA 1MHHE 4OVVA 3L0WB 3WANA 3RFZB 3L16A 1YQBA 2CKHB 4AOFA 3P1MA 3NUHB 3GB1A 3A4SC 2G45B 4REZA 1L7YA 5KHOA 3W9CB 1OQYA 1TZOA 2LUEA 1WRDB 2D3CA 2JZZA 3Q69A 1PYWD 4USAA 1A70A 1ET6A 2AX5A 1WJUA 3MC0B 1NDDA 4X57B 2LASA 3AI5A 2N9KA 2ZPYA 3FAHA 4OHJA 1AWDA 3P4SB 5E6OA 3AE9B 2Z0DB 2VH2A 4HDQA 1VDVA 1B9RA 2INDC 2LGDA 2L83A 3QX1A 4HKZE 3PS6A 2KDEB 4YT0B 1L0YB 3H7PB 2V3PA 2W82A 2O2VA 3BWUD 2KZRA 3ZNGC 2OHFA 1TZ1A 2IO1B 2KQ7A 5GMVA 4RFBA 2YEPF 4WQMA 1OGWA 3QJZA 1V9JA 3RI7C 3OAWA 3KYDD 2WGSA 4HROA 2KANA 2KWCA 1Y8RC 1D4BA 5HFYA 3NOBA 4K1RB 3VUXA 2MBHA 1OEYA 3DBSA 1SSNA 3DVNU 3MJWA 1HQRD 1WXQA 3RT3B 1MHXA 3FILB 4DK5A 3JW0X 4GSWA 3ZRCA 1WY8A 2PVGC 2YVCA 1RWSA 2FAZA 1FO4A 4NQKE 4WWMA 1GB4A 4LNIA 3KYCD 1HTQA 3HUIA 3AXCA 5D2MB 1PUTA 3DVNV 2W3RA 1GJZA 3ABVB 2KJRA 4BOSC 3RCZA 1V80A 1STEA 4NQLB 2KMAA 1FMAD 1VRAB 3ZNZB 1KH0A 3IVFA 3Q3NC 1T0QC 2JZ3B 1NBFC 2L32A 1YNTE 5JZEB 1ZP0B 1XO3A 2NVUI 2PTLA 2KK8A 2BGFA 2HJ1A 1BXTA 2K1FA 3QC8B 3Q3JA 3WIMA 2A5UA 4FLHA 3WAMA 4KKIA 4TQ1A 3DWGC 4HJKA 3TBLD 3N1XC 1V81A 1QLBB 2QMTA 2KJ6A 1VCBA 3R2TA 3RZFA 4C00A 2HTHA 2L52A 2K3UA 2AWTA 4EZLA 4HCPB 2IGGA 1UBQA 1XLNA 1TGZB 5CHWA 1WF9A 4FBJB 2LGXA 2OOBB 1J7AA 3UGBB 2K9XA 1S3SG 2Z0EB 2FCQA 4HPMB 4B0MA 1OTRB 3ZRFA 3ZIMA 4DBGA 1IBXA 2JQRB 4NAWA 3ZTCA 4XZ4A 3LJ3A 2IZVB 4MSQB 3DBHB 1VD2A 3IT6B 2LXAA 3NHEB 1SJHD 1R4NB 2K8BA 4IUMB 4A3PA 2LJ5A 3Q3OC 2WDQB 1WH3A 2J53A 4M01A 3HVZA 4ICVA 4E3CA 3DBLI 2PKOA 2JSVX 2KN4A 1L6UA 1V1PB 4OZAA 2WXKA 1U4AA 1GPXA 1OEYJ 2BS4B 3I5JC 1SE9A 2WXJA 2L8JA 2DNFA 5CHFA 2LWPA 2KYWA 4P16A 2MP2A 2O6VD 2IPKD 2MBQA 4W9FA 5DPTA 4I6LB 1HEZE 2JYEA 4Q2JA 2IJ0A 4KZCA 2LVOA 2C7MB 1C4CA 4J6IA 3TJPA 3SDLC 1KM7A 1N61A 5AZHA 3AV8A 4DDGD 4MGZE 2FNJB 2PMVA 5EE0A 4A90A 4TUUA 5EDSA 2QCZA 2DAJA 1NEKB 5LXIB 2FCMA 4P1CC 3W2DA 1WJNA 3U52E 2WP9B 1SEBD 1WYGA 1KLVA 2G4SA 3KH0A 4LDTD 3N32A 1EU3A 2LRUA 2NBUA 2AYOB 3AEGB 2WXIA 3VRAB 3APCA 1D3ZA 3U7ZA 1KRHA 1GNUA 1WFYA 3NS1A 1E7UA 2L7RA 1SB3C 4II2B 1XLOA 2IY1B 1SXTA 1XXGA 1L4ZB 2Y5PA 1JCKB 3I9V1 4LCDE 1T6BX 2M19A 1JRPA 3ZQ4A 1TKEA 1BUIC 1UNSA 2N1WA 2AQ1B 5AUKA 1D5MC 4MGYE 3ETRA 2L76A 2GI9A 2BVCA 4K3CA 3AE6B 4ANVA 1F0ZA 4WWOA 3VTUA 4ZYSA 3OJ3A 5EE9A 4F8CB 2MLBA 4DDID 1XQQA 3X0WA 1K51A 4ARIA 2KX3A 4P1BC 1HZ5A 2C7HA 3VFKA 3NRZA 2V4IB 5DPSA 1WGKA 4C7YA 1Q5WB 1UH6A 5IN7A 2WDTB 3U2SC 4H2AA 4XDDA 2JWZA 2MX2A 2ZVNA 2R2QA 3NZSA 3U30A 2KKCA 4MM3A 4RF1A 1WI0A 3DHGC 4YWGG 3P4RB 1B1ZA 3DDCB 1TY0A 3QA8A 4MDKE 4MGKE 3TSSA 2BYTA 1C77A 3VRBB 2LZ6A 2ACZB 2ZCBA 4IOIE 2IO3B 3IG3A 3PZ8A 2DYOA 2W9NA 1YD8U 3HM3A 4BBNF 4W9KA 1FIQA 3QWZB 1FPYA 1QILA 1XT9B 4BAXA 1IUEA 4LJOB 1VLBA 1XLQA 1QOFA 1RAXA 4RGOS 1E90A 4GLSC 1AW7A 2KDMA 5BO4B 2MBOA 3Q14C 4W9DA 4M0WB 2D3BA 3LXFA 1PGBA 2KWUB 2BWFA 1MJDA 3PO0A 4MEMA 1WIAA 2JXXA 2KLCA 4GIVA 2M1MA 2O6VB 2KNBA 1YIWA 3BZDB 2BF8B 1NYRA 5G5GA 2J4XA 1FRRA 1GOZA 2MHJA 3KUZA 2JU6X 3Q3MC 1MG8A 2JT4B 1WMHB 5KHQA 1ROEA 1Q1OA 4IG7B 1TTNA 1WGGA 3PRMB 4EKUA 1WX9A 1KJTA 1FFVA 3BYYB 1YMHE 4HLEA 4MJSB 4EZKA 3MHZA 4EZJA 1C9FA 4A6QA 2VRRB 1WXAA 2AEHA 4N6EB 3B2FA 1EF1A 5JH5C 4GOCA 1R4MB 2SEBD 4J3OD 2BQQA 1IGDA 5C23A 3DVGY 2KN5A 2L0FA 2QILA 2EELA 2EKEC 3DOWA 4LDTB 2JZPA 2G9HD 2M56B 2LEKA 3ZVVA 1V5TA 1EWYC 1GC6A 3ZJUA 4DHJD 4LJPB 3DBLB 4D2KA 1MG4A 2N7JA 1P98A 3WAPA 4ZRPA 3WALA 3QCAA 3CSTA 3LB8C 1JWBD 4ZDVA 4EOYA 2WXRA 4C4VA
chains in the Genus database with same CATH topology
1MVKA 2PVGC 1RWSA 1AYFA 2PLPA 4WWMA 1FO4A 3AEAB 1GB4A 1EM7A 1UGJA 3BYTB 4HEA1 2INNE 3HUIA 1N62A 1YN3A 4M0WA 1PUTA 2RPVA 1K53A 4MT5A 2W3RA 3ABVB 2KACA 2MJ3A 5FK9C 5FR3A 1STEA 1FNUA 3AEBB 4DXFA 1JROA 2BB6A 4MM3B 1XCTL 1FMAD 1VRAB 1KH0A 3UI3A 4WIPA 2V0GA 5EE3A 1ET9A 2EKIA 4NJCA 3C8YA 4WH4A 2L32A 1NENB 2LFIA 3MJ5A 1QOGA 3H8HA 1JWSD 1YNTE 2RDGA 2FE8A 4RGTA 4IDIA 5T8IA 1ZP0B 1XO3A 2PTLA 2V3NA 1FXAA 4JE3B 1BXTA 5C3JB 4N58A 4TMAB 1SE3A 3TEYA 2VZKD 4EE2A 2MH7A 2WS3B 4KX6B 1JMLA 4YSZB 4LTUA 1WWTA 4KKIA 4TQ1A 3BK1A 2J42A 3ZYYX 3DWGC 2ZW1A 1F2RC 4HKQA 3KWVA 1ENFA 5TSSA 2W54A 1QLBB 2QMTA 1IGCA 1DOYA 3GP7A 4R3DA 1VZ6A 4OZBA 3V05A 3VR8B 1HXYD 2GRIA 4HJGE 2WDRB 3W1SA 3R2TA 1EWCA 5H92C 5EE1A 4WAFA 2L52A 5BMHA 1OQRA 2LUMA 2K3UA 3AE7B 2CU3A 3Q8CA 4RF0A 4YXDB 2IGGA 2N0SB 3AEEB 1XLNA 4JPSA 1K52A 3HRDD 1F77A 4LLGM 3E9SA 4US8A 3AE3B 1J7AA 4YTNB 4OVZA 2BT6A 2K9XA 4OW0A 1ACCA 5MPOA 3IXSA 3IAS1 4B0MA 1T3QA 2DYMA 3AECB 2WXLA 2WXMA 2JQRB 1IBXA 3GS2A 2MJDA 2WDVB 2HDEA 2B76B 3IT6B 4DXGA 1SJHD 1L5PA 3FILA 1LO5D 1FNVA 5HI1A 5AUIA 2WDQB 2QEJC 3BVZA 3O13A 2WXHA 3AM9A 2J53A 3AE4B 5HHDG 3AEDB 1ZOYB 3HVZA 3B2GA 1QF6A 3IAM1 2PKOA 2JSVX 5E6JA 2KN4A 2J52A 5JXVA 1L6UA 1BMLC 1V1PB 5BYQA 4OZAA 4YSXB 2WXKA 1JQ4A 1GPXA 1J7BA 1HZ6A 3P4QB 2JXTA 3EA6A 2BS4B 3SFDB 2WXJA 1EU4A 1DOXA 4JWUC 1I4GA 1L0XB 1D6EC 2WXOA 4P16A 3AE8B 1DOIA 2DWQA 2Q5WD 3U4EG 2IPKD 1NYQA 3ZJTA 3V3XA 4GDKB 2XNAC 5I4DA 1FCLA 1HEZE 2JYEA 1I4PA 1C4AA 1DYQA 4Q2JA 1QOAA 1XEEA 2IJ0A 2Z8LA 1UUPA 2ZW0A 1CJEA 1PFDA 1C4CA 1C4PA 4C80A 1TS4A 2ONQA 1KFYB 3BVMA 1SE2A 3TEWA 3CWIA 3FC4A 4TQ0A 2W3SA 2KQ4X 3Q8EA 5D3DA 1N61A 1VZ7A 2DLBA 1ZDXA 5BYSA 3AV8A 3DWMA 2I38A 3SEBA 4AS1A 2PMVA 1YQ3B 1UWXA 3B9JA 5EE0A 4A90A 3Q8BA 1WSPA 3VQIA 4AQ7A 5HG2A 2LHDA 1NEKB 4ZHOA 3MFGA 1SF0A 1JWAD 3KQ4A 1I4XA 3I57A 3W2DA 3U52E 1DGJA 1JW9D 1UWMA 1SEBD 2WP9B 1WYGA 1QOBA 1P7EA 3TUOA 1VZ8A 3NVYA 1F2RI 2BBCA 1V1OA 1ZE3D 2AQ2B 1EU3A 2QJLA 3KLSX 2KWDA 1L0VB 3AEGB 2WXIA 2XN9C 4C7ZA 3P4PB 3AE1B 4GDLB 1C78A 3VRAB 3BVGA 1JWMD 5G5HA 5FKAC 2BTEA 3U7ZA 5C2TB 1KRHA 4NAMA 1HA5A 4XWTA 2RDHA 3NS1A 1RFKA 4YTMB 4CQNA 1D5ZC 3SR6A 4XWWA 1E6EB 1K50A 1SB3C 4KGSA 2DBYA 1XLOA 1OQQA 3AN1A 1SXTA 2W55A 3Q8FA 3EUB2 1MI0A 1P7FA 1XXGA 2K5PA 1L4ZB 2Y5PA 1JCKB 3I9V1 4RGNA 3W5VB 1JALA 1T6BX 1JRPA 2M19A 3ZQ4A 1TKEA 3NVZA 1J7CA 1BUIC 2D5GA 3URYA 1UNSA 3ZGZA 1R7SA 1ZDVA 2H89B 2LJIA 1JWUD 2AQ1B 5AUKA 1FM0D 3KWLA 1D5MC 2Y5CA 1FEHA 3W5UB 2ICIA 3ETRA 1VJKA 1KTKA 4MH8A 2GI9A 3AE6B 1F0ZA 1V1PA 1KLGD 1L4DB 1QKZA 2MJEA 4ZYSA 1T5XD 2WU2B 3ZJVA 4L23A 2WQYB 1TS3A 4PT5A 5D3IB 5EE9A 1E0ZA 2JX5A 2VZKB 4B0EA 1K51A 2BB5A 2Y3AA 4ARIA 2I2YA 2JYTA 1N63A 1HZ5A 3TEZA 1RYJA 2H88B 1V97A 2K0PA 3NRZA 2V4IB 4L2YA 4HRSA 4WURA 1WGKA 2IGDA 4DQOC 4C7YA 3AE5B 1I4RA 1XLPA 4TSSA 4C56C 3T3NA 4ARCA 3U2SC 4H2AA 2RMMA 4KGRA 4XDDA 4L1BA 1ZPSA 5BYRA 2IGHA 2QIEB 1YQ4B 4LK0M 2K22A 3SFEB 1KF6B 4YTPB 1SIJA 1PDXA 3Q8AA 4RF1A 3TEXA 2SAKA 4YWGG 2KAJA 3P4RB 4O1NA 1PGAA 1I7HA 1CK1A 3L4PA 4IKGA 1B1ZA 1GB1A 1IBXB 2MEKA 2FUG1 1FNWA 1TY0A 4ZHPA 1I4QA 3AEFB 1L6VA 2CJOA 1TS2A 3R2IA 3TSSA 2X38A 5H8YE 2BYTA 1C77A 1FCCC 3VRBB 4YSYB 3CIRB 1YN5A 1V8CA 1ZUD2 1XF5L 1QQRA 2ACZB 4IOIE 2R61A 4RGMA 3R8BA 1AN8A 3PZ8A 3EGRA 3VR9B 2DYOA 3E56A 1QT9A 2KMMA 2INPE 3MP9A 1TKYA 1N5XA 3PZ7A 1SE4A 1N5WA 1Y56A 1OFFA 1FRDA 1C79A 1FIQA 4JX1C 3BIID 1QILA 2BS3B 3OWEB 1E10A 5BMIA 1IUEA 1VLBA 4ZRQA 1C76A 1XLQA 3HVDA 1QOFA 1YJJA 4MACA 1I4HA 2BW2A 4ZOHC 4RGOS 4GLSC 1AW7A 2KDMA 1MPEA 1Q10A 2WNMA 4A8XC 5GXGB 2LMCA 2NTSA 1SJED 2JWUA 1FFUA 1TY2A 3LXFA 1PGBA 1SBBB 2AQ3B 4OZCA 4FXCA 3PO0A 3P63A 4P6VF 1PGXA 4KKJA 3NVWA 4UDUC 1E7PB 1XCQL 2QSDA 5D7GA 4A9AA 1KLUD 2L1AA 5LNK1 3T3OA 1MHHE 3AE2B 3BZDB 3AMZA 3RFZB 4JWSC 1NYRA 3P42A 2J4XA 1FRRA 1GOZA 5G5GA 4A55A 2JU6X 3IT4B 1CZPA 1ROEA 2NMQA 2CJNA 1M4VA 4KGTA 3BK2A 4RCOA 3P1MA 3AB5A 1RM6C 1TJEA 3NUHB 3GB1A 1FFVA 3BYYB 4REZA 1YMHE 4XE0A 2NTTA 3W9CB 2TSSA 1TZOA 3MHZA 4US9A 3Q69A 1PYWD 4USAA 2WXFA 1A70A 2WXNA 1C9FA 1WRIA 1ET6A 2PVOD 2AX5A 2WLBA 1E9MA 3AH7A 3MC0B 4A6QA 1D5XC 3NVVA 4N6EB 1YN4A 3B2FA 1TYGB 1FXIA 2IDYA 2N9KA 2SEBD 2WU5B 4J3OD 1CQVA 3FAHA 1N60A 4OHJA 2PW9A 1TKGA 1AWDA 1IGDA 3P4SB 2LHEA 2GB1A 2LGIA 2ON8A 3AE9B 2OEDA 2QILA 1VDVA 2EELA 2HTME 4N59A 1B9RA 2L83A 4HKZE 2PIAA 2JZPA 2G9HD 1ESFA 2YEPB 2M56B 2LEKA 1L0YB 4RH6A 4YT0B 1GAQB 2V3PA 3LYYA 2W82A 1YJIA 3N9YC 3BWUD 1EWYC 2OHFA 4RNAA 4ITKA 3ZJUA 4RFBA 2YEPF 4WQMA 1ZXHA 1TS5A 3RPFC 3NZ3A 2N9LA 4NZLB 4D2KA 2N7JA 2WXGA 4HROA 4ZRPA 2FBWB 3J9CA 1ZXIA 3LB8C 1JWBD 1NVID 5HFYA 1D4BA 1NI3A 4XDCA 4NAWB 2E6XA 2M0AA 1FD6A 2WXRA 1SSNA 2WXPA 2E3TA 1HQRD 1WXQA 1MHXA 1VR9A 2WXQA 3FILB 2G1EA 5BMGA 2BS2B 3WCQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1C4P A;  1L4D B;  1L4Z B;  1QQR A;  1BML C; 
#chains in the Genus database with same CATH topology
 3I63 C;  3AEA B;  1E8Y A;  1EM7 A;  1UGJ A;  2KVZ A;  5J18 A;  1BT0 A;  3BYT B;  4WJO A;  4HEA 1;  1N62 A;  3A1Q A;  4PYU A;  4ACF A;  3O65 B;  1ISN A;  3PPA A;  1K53 A;  3DPD A;  2KAC A;  2MJ3 A;  1UZX B;  1FNU A;  2CS4 A;  3AEB B;  3A9K A;  4DXF A;  1JRO A;  2REX A;  4JIO U;  4HDO A;  4WIP A;  2K6Q A;  5EE3 A;  2QDF A;  2EKI A;  2IY0 B;  4WH4 A;  4PS8 A;  4KDL B;  2FE8 A;  4RGT A;  4NY0 A;  4LNF A;  2KVR A;  2V3N A;  3APF A;  4JE3 B;  3TEY A;  3UQB A;  1LFD A;  4EE2 A;  2WS3 B;  4KX6 B;  1JML A;  2HE7 A;  3BK1 A;  2J42 A;  2QHO A;  3C19 A;  3JVZ X;  3OLM D;  2N9X A;  3DBR I;  2ZW1 A;  2KFK B;  1F2R C;  5TSS A;  5DPW A;  1WJ4 A;  1IGC A;  3GP7 A;  4R3D A;  1VZ6 A;  3V05 A;  3WA0 A;  2WDR B;  2BPS A;  5H92 C;  5EE1 A;  3D32 A;  3AE7 B;  3H7P A;  2L05 A;  4RF0 A;  2N0S B;  1F52 A;  2L3Z A;  3HRD D;  1F77 A;  4G0N B;  1WXV A;  3PSE B;  2UU7 A;  4JL9 A;  1WGY A;  4OW0 A;  2HD5 B;  1HE8 A;  4FJZ A;  4IWQ A;  2V9H A;  2WXL A;  5E6P A;  2MJD A;  4DHZ B;  1Q0W B;  1E8W A;  2WDV B;  3ZNI D;  1ZW7 A;  1N6Z A;  2N9E B;  3A33 B;  3JSV A;  2OJR A;  3FIL A;  3ZXV A;  5HHD G;  2C5L C;  4KIK B;  1ZOY B;  3B2G A;  4W9H A;  2K8H A;  5E6J A;  2J52 A;  5JXV A;  5JHB A;  1V6E A;  4YSX B;  1JQ4 A;  2KLG A;  1EU4 A;  1DOX A;  3RNG C;  1I4G A;  1D6E C;  2WXO A;  3ALB A;  1P9D U;  3AE8 B;  4LNN A;  2Q5W D;  3U4E G;  1NYQ A;  3ZJT A;  3MC9 A;  5I4D A;  4BKS A;  1FCL A;  3X23 A;  1DYQ A;  1QOA A;  2WYQ A;  2B3A A;  5LLI A;  3ONS A;  4MGI E;  1T0Y A;  2LGS A;  3TEW A;  2N9P C;  3AU4 A;  3Q8E A;  5D3D A;  4PS7 A;  2XBB C;  3MTN B;  3B9J A;  4DHJ B;  2RGF A;  3R7Q A;  1WSP A;  3H9D A;  2LRW A;  2FCN A;  2CHW A;  2LHD A;  3AU5 A;  4ZHO A;  2D11 A;  3MFG A;  2D3G A;  1I4X A;  2KC2 A;  2KHW B;  3I57 A;  1WJ6 A;  4AWJ A;  4FA6 A;  3DCG A;  3PT2 B;  1JW9 D;  1P7E A;  4I6P A;  4M02 A;  2L00 B;  3NVY A;  2BBC A;  4II3 B;  2ZJD A;  1V1O A;  1ZE3 D;  5AZF A;  2QJL A;  2Z59 B;  1L0V B;  3AE1 B;  4AJW A;  5G5H A;  5FKA C;  5C2T B;  3U7D A;  2RDH A;  4YTM B;  4HCN B;  3SR6 A;  2DYB A;  1E6E B;  1K50 A;  3TIX A;  4KGS A;  4W9I A;  2DZI A;  2KO3 A;  2W55 A;  4IWO A;  4RGN A;  2M0X A;  2ASQ A;  4KV2 A;  3UIO B;  3URY A;  4K3B A;  4KSL C;  3V6E B;  1R4M I;  1R7S A;  1L2N A;  4KZ0 A;  2FUH B;  1FEH A;  3RN9 C;  2BYV E;  2FCS A;  1H4R A;  3ZNH B;  4CYE A;  2HJ8 A;  1V1P A;  1L4D B;  1T5X D;  2WU2 B;  4L23 A;  4PT5 A;  5D3I B;  1E0Z A;  4HVB A;  4WWN A;  3M62 B;  2BB5 A;  2JYT A;  1N63 A;  2D07 B;  1RYJ A;  2A4Z A;  4WUR A;  2IGD A;  1V86 A;  3ZDM C;  4TSS A;  4ICU A;  3QQ8 B;  4FAD A;  2RMM A;  4KGR A;  1ZPS A;  2QIE B;  3EHV A;  1YQ4 B;  5L83 A;  3SFE B;  1SIJ A;  4GB9 A;  4MSM B;  3QAR A;  3TEX A;  5DPR A;  3PGE A;  1IBX B;  2MEK A;  2EMT A;  4IM2 A;  1L6V A;  2CJO A;  2WHI A;  3L13 A;  2KOX A;  4IW0 A;  4YSY B;  3CIR B;  4ZYN A;  1QQR A;  4RGM A;  2R61 A;  1AN8 A;  2MA9 B;  2UYZ B;  3EC8 A;  2INP E;  2D2Q A;  1SE4 A;  1OFF A;  2X8X X;  4JX1 C;  2BS3 B;  2EMS A;  5BMI A;  1SGH A;  2D10 A;  4EFO A;  4ZRQ A;  1C76 A;  2IO0 B;  2LVP A;  1F1H A;  1MPE A;  4JLC A;  2WX1 A;  2M8S A;  1FFU A;  3L54 A;  3RNB C;  3PVL A;  3P63 A;  3ENE A;  3MHS D;  3PV1 A;  4UDU C;  1E7P B;  1XCQ L;  4K7U A;  3K9P B;  3TMP B;  2L1A A;  3DHH C;  5LNK 1;  3AE2 B;  3AMZ A;  3DBR B;  3P42 A;  2GBM A;  2GBN A;  2MWS B;  1WM2 A;  2I1K A;  2BKF A;  3OG5 A;  3IT4 B;  2JY6 A;  3BK2 A;  3HIZ A;  4RCO A;  4BFR A;  1TJE A;  3GE3 C;  4XE0 A;  1WE6 A;  3M63 B;  3EFC A;  2LI5 A;  1AAR A;  2WXF A;  5IO9 A;  2N4F A;  2PVO D;  2WLB A;  1CMX B;  1E9M A;  3AH7 A;  1D5X C;  3NVV A;  1YN4 A;  1TYG B;  3RYT A;  1FXI A;  2IDY A;  1RFA A;  2LD9 A;  3QK0 A;  4ANX A;  2RR9 A;  1TKG A;  2PE9 A;  2LHE A;  2GB1 A;  2ON8 A;  2PEA A;  3NY5 A;  3N3K B;  2HTM E;  2PIA A;  1LQB A;  3VTV A;  1ESF A;  2YEP B;  4JGH B;  2BYF A;  3W1Y A;  3LYY A;  2DAF A;  2NPT A;  4GDK A;  3N9Y C;  4RNA A;  3W1S C;  1P0R A;  3KVF B;  1ZXH A;  1TS5 A;  2I1J A;  4S17 A;  2N9L A;  4NZL B;  3JYU A;  4BVU C;  2ZNV B;  2PPH A;  1ZXI A;  3CF6 E;  5DCN A;  1NI3 A;  4XDC A;  3RD2 A;  1WX8 A;  2M0A A;  1FD6 A;  3ZO5 B;  3H7S A;  4ZRK A;  2WXP A;  2JRI B;  1PQS A;  1LGR A;  1SIF A;  2WXQ A;  4KSK C;  2G1E A;  5BMG A;  2KTF A;  2C60 A;  3WCQ A;  3BY4 B;  1MVK A;  4W9L A;  3N1Z C;  4F7Z A;  3Q3F A;  2FIF A;  4LNK A;  2DEN B;  2INN E;  3M3J A;  2BYE A;  2BWE S;  1YN3 A;  4M0W A;  1A5R A;  4E74 A;  2K6D B;  4MT5 A;  2RPV A;  2ZEQ A;  3H6N A;  5FK9 C;  5FR3 A;  2NR2 A;  2DHZ A;  4FJY A;  4MM3 B;  1XCT L;  3C0R B;  3UIN B;  3VUY A;  2O6V A;  1WYW B;  2V0G A;  1EUV B;  1ET9 A;  3C8Y A;  2LVQ A;  3TL5 A;  4TKN A;  4E71 A;  1QOG A;  3H8H A;  1JWS D;  2RDG A;  1P3Q U;  1WMH A;  5T8I A;  4GN1 A;  1WGH A;  2V3S A;  3A9J A;  4BKG A;  1FXA A;  4N58 A;  4MJS A;  1SE3 A;  4TMA B;  2C9W B;  2MH7 A;  3VXW A;  4GMV A;  1WWT A;  4WJQ A;  5LXH A;  3ZYY X;  4PYZ A;  2YLM A;  3KWV A;  1M94 A;  4HPP A;  1RRB A;  3P2B A;  4B6W A;  4OZB A;  3VR8 B;  2KDF B;  2GRI A;  4HJG E;  3W1S A;  4IC7 B;  3N1Y C;  5L95 C;  4WAF A;  5BMH A;  1OQR A;  2LUM A;  3V6C B;  4YL8 A;  2CU3 A;  1NI2 A;  3RNE C;  2XK5 B;  2UWQ A;  2KTR B;  3AEE B;  3EFU A;  4JPS A;  3UQA A;  3PLV A;  3PHX B;  4LLG M;  3E9S A;  3SD5 A;  4US8 A;  3VH4 B;  3VVW B;  4OVZ A;  4B9K A;  4XGA B;  4IWP A;  1ACC A;  5MPO A;  3IXS A;  3NG0 A;  4CHK A;  1WZ3 A;  2WXM A;  3GS2 A;  3VAW A;  2HDE A;  2B76 B;  3MC8 A;  4N9F 4;  4DXG A;  3HHM A;  5IP4 D;  5HI1 A;  1E8X A;  5AUI A;  2NCN A;  1MFW A;  2WXH A;  1I35 A;  5CX3 A;  2GOW A;  2N7E A;  4F1S A;  4JQW C;  1BML C;  2M4N A;  2BKR B;  3T9L A;  4AJY B;  1J7B A;  3P4Q B;  4ANU A;  3EA6 A;  3B1L X;  1L0X B;  4BKT A;  2J7Q B;  3N20 C;  4I6N B;  4G11 A;  3V3X A;  1GG3 A;  1I4P A;  4MEL A;  1UEL A;  5TR5 A;  1UUP A;  2ZW0 A;  3ZW3 A;  1PFD A;  4ZRJ A;  3IFW B;  2ONQ A;  3KW5 B;  1KFY B;  3ZXR A;  3GZN I;  2G3Q B;  1VZ7 A;  2DLB A;  3RNC C;  1ZDX A;  3K9O B;  3DWM A;  2ZVO A;  3N30 A;  3SEB A;  4AS1 A;  1UWX A;  3Q8B A;  3VQI A;  2PE6 B;  3DVG X;  4IM3 A;  4AP4 C;  2KFK A;  5IA7 A;  1SF0 A;  1JWA D;  3KQ4 A;  3RUI B;  2ZZP B;  1UWM A;  3L17 A;  1QOB A;  3A1Q B;  3RNF C;  2RSU A;  3KLS X;  3ZDT A;  4C7Z A;  4GDL B;  1JWM D;  1ZGU B;  2BTE A;  2VH1 A;  4XWT A;  4CQN A;  2DBY A;  1OQQ A;  3EUB 2;  1P7F A;  3ECI A;  4W9J A;  3W5V B;  3PZD A;  1JAL A;  2G4D B;  2D5G A;  3V60 A;  4W9E A;  2H89 B;  2LJI A;  1JWU D;  4RM8 A;  5AZG A;  3KWL A;  3W5U B;  4KIK A;  1G6J A;  2IYD B;  4RM9 A;  3SHQ A;  4AUQ C;  3DQV A;  1H8C A;  1QKZ A;  3ZUN A;  3ZJV A;  3IBE A;  2J0K A;  3FKY A;  4HPL B;  4W9C A;  5G55 A;  4B0E A;  5C1Z A;  2Y3A A;  4WQO B;  2I2Y A;  1WXM A;  2AL3 A;  3NJT A;  3NS8 A;  4M00 A;  3TEZ A;  2H88 B;  3B08 A;  1V97 A;  4L2Y A;  4HRS A;  4DQO C;  3BIN A;  3AE5 B;  1XLP A;  3T3N A;  1Z2M A;  2LXC A;  2DZJ A;  5AEK B;  4L1B A;  4ASW C;  3A4R A;  2IBI B;  1QZE A;  1LM8 B;  1J19 A;  2MW5 A;  3Q8A A;  5D6J B;  2KAJ A;  4O1N A;  4IKG A;  1EO6 A;  2FUG 1;  2O2V B;  1FNW A;  2J0J A;  4ZHP A;  1I4Q A;  3AEF B;  2X38 A;  5H8Y E;  1FCC C;  3JSV B;  1ZUD 2;  3R8B A;  3EEC A;  3VR9 B;  3E56 A;  1QT9 A;  2KMM A;  3MP9 A;  1TKY A;  1UF0 A;  1N5W A;  3BII D;  4URK A;  1E10 A;  1T0R C;  2GMI C;  1X1M A;  4BOZ B;  4ZOH C;  3Q2A C;  4NJ6 A;  1V2Y A;  4WWP A;  3PRE A;  1GC7 A;  1SJE D;  2QC8 A;  1SBB B;  2AQ3 B;  4OZC A;  1PGX A;  2V4L A;  4KKJ A;  3NVW A;  2KWV B;  1Z5S B;  5D7G A;  4A9A A;  1GUA B;  1WGD A;  1KLU D;  3VHT C;  4JWS C;  4A55 A;  2ZCC A;  4PS3 A;  3RZW C;  1CZP A;  3KUC B;  2KMC A;  2NMQ A;  2CJN A;  1M4V A;  4KGT A;  2Y5B B;  3AB5 A;  1RM6 C;  3VDZ A;  2NTT A;  2MBB B;  2WX0 A;  2TSS A;  4US9 A;  1JRU A;  2WXN A;  3VUW A;  1WRI A;  1HTO A;  3B0A A;  3PHW B;  2WU5 B;  3ZKJ C;  1CQV A;  1N60 A;  2PW9 A;  4TV3 A;  4XYC A;  4WAA A;  2LGI A;  1J0G A;  2OED A;  4MH0 E;  4N59 A;  3RNA C;  2JUO A;  4RH6 A;  3QAQ A;  1YJ1 A;  5IAA C;  1GAQ B;  4QAY A;  2NS5 A;  1UD7 A;  2N1V A;  2J0M A;  1YJI A;  2GBJ A;  4FHJ A;  4ITK A;  3RPF C;  3NZ3 A;  1C1Y B;  2WXG A;  2FBW B;  3J9C A;  1NVI D;  4NAW B;  2E6X A;  3L08 A;  2E3T A;  2ZNV C;  3GE8 C;  3U8Z A;  4NNJ B;  5E6N A;  2KDI A;  1VR9 A;  2BS2 B;  2JPH A;  1EWC A;  3QIJ A;  3WAO A;  3HM6 X;  1AYF A;  2PLP A;  3R7R A;  1WR6 E;  2V1Y A;  3SU8 X;  4K81 A;  4WJN A;  3GZN B;  3GOE A;  3VH3 B;  2BB6 A;  2MP2 B;  4A3O A;  4CO7 A;  3UI3 A;  4NJC A;  3V61 A;  4NPN A;  1NEN B;  2LFI A;  3MJ5 A;  4ZRI A;  2DX5 B;  2KQS A;  4HXD A;  1LXD A;  4IDI A;  1YX6 B;  2RD0 A;  3VTW A;  3OJ4 B;  1YOV B;  5C3J B;  3UF8 A;  2VZK D;  1WM3 A;  4YSZ B;  4LTU A;  1WXS A;  2NBW B;  1FXT B;  4XC2 A;  4HKQ A;  4FUL A;  1J8C A;  2N7D A;  2K8C A;  5FR6 A;  1ENF A;  3R3M A;  5IKC M;  2W54 A;  3I3T B;  1TT5 B;  1DOY A;  1HXY D;  3HK0 A;  1T0S C;  1IYF A;  2AL6 A;  1EF5 A;  3Q8C A;  4YXD B;  4DHZ E;  3T8M A;  1K52 A;  4FHK A;  3APD A;  4XX5 A;  4G3X B;  3AE3 B;  2JVC A;  2KXJ A;  4YTN B;  2BT6 A;  2OJW A;  3M95 A;  3IAS 1;  1V5O A;  1T3Q A;  2DYM A;  5J17 A;  3AEC B;  1UBI A;  4GU2 A;  1L5P A;  1LO5 D;  1FNV A;  1P1A A;  5CTR C;  1IPG A;  1IP9 A;  2QEJ C;  3O13 A;  3BVZ A;  2XEW A;  3AM9 A;  2KX0 A;  3AE4 B;  2MQJ A;  2MRP A;  1TBE A;  3AED B;  1QF6 A;  3IAM 1;  3LDZ E;  2ZPN A;  3PLU A;  5BYQ A;  4WJP A;  4DXA B;  2FID A;  1HZ6 A;  4KDI C;  5G2N A;  2PJH A;  3R66 C;  2JXT A;  5J2R A;  3SFD B;  2R2O A;  4PK1 A;  4JWU C;  3DHI C;  1DOI A;  1RLF A;  2DWQ A;  2CHZ A;  4IM0 A;  4S0R A;  2NPT B;  4GDK B;  2K25 A;  2XNA C;  1C4A A;  1XEE A;  4NJ7 A;  2Z8L A;  1F9J A;  2MCN B;  1CJE A;  1C4P A;  4C80 A;  1TS4 A;  2CHX A;  2JRH A;  3BVM A;  3QHT A;  1SE2 A;  3CWI A;  3FC4 A;  4TQ0 A;  2W3S A;  2KQ4 X;  5BYS A;  2DZM A;  2I38 A;  1WR1 A;  1YQ3 B;  4A20 A;  3PRP B;  1E7V A;  1YX5 B;  3RUL A;  2GBK A;  3ML9 A;  1S1Q B;  2KC1 A;  5HG2 A;  4AQ7 A;  3KUD B;  2MBE A;  1DGJ A;  5CHV C;  4FJV B;  4K7W A;  5HKH A;  3TUO A;  2WWZ A;  1VZ8 A;  1F2R I;  4HK2 A;  2CU1 A;  2AQ2 B;  1V49 A;  4W9G A;  2KWD A;  3V62 A;  2XN9 C;  3P4P B;  1C78 A;  3BVG A;  2XK5 A;  2RDB C;  2KTR A;  4NAM A;  1HA5 A;  3S2A A;  1RFK A;  4FN2 A;  1XD3 B;  4DWF A;  1D5Z C;  4XWW A;  2K39 A;  3AN1 A;  3Q8F A;  1MI0 A;  2K5P A;  2CR5 A;  1WX7 A;  3A9J B;  3NVZ A;  1J7C A;  4EEW A;  2KT7 A;  4HWI B;  3ZGZ A;  1ZKH A;  1ZDV A;  1E8Z A;  1WE7 A;  1FM0 D;  2GBR A;  2KDB A;  2Y5C A;  4P7I A;  1C3T A;  2ICI A;  1VJK A;  1KTK A;  4MH8 A;  4GXB A;  4M8N A;  1KLG D;  2MJE A;  5JHA A;  2WQY B;  1TS3 A;  3ZTD A;  2JX5 A;  2MSE D;  2VZK B;  3AUL A;  1WZ0 A;  2M17 A;  3DBH I;  1I42 A;  2DZK A;  2K0P A;  3H1U A;  4M8M A;  1R4N I;  2L0T A;  2KD0 A;  2IO2 B;  1I4R A;  3CSF A;  4BKS D;  4C56 C;  4ARC A;  2JF5 A;  2KFJ A;  4ANW A;  5BYR A;  2IGH A;  3UIP B;  3PRZ A;  4LK0 M;  2K22 A;  1KF6 B;  4YTP B;  1PDX A;  3ML8 A;  3IHP C;  2SAK A;  4LNO A;  1PGA A;  4KVG B;  1I7H A;  3RMK C;  1CK1 A;  3L4P A;  3ZLZ A;  4BZA A;  1GB1 A;  2RPQ A;  3TCA A;  1TS2 A;  3R2I A;  3CMM B;  1YN5 A;  1V8C A;  1XF5 L;  4K7S A;  1E5W A;  3EGR A;  3Q6B A;  1UGM A;  2D3A A;  2C7N B;  1N5X A;  5IOI A;  3PZ7 A;  1Y56 A;  4B95 A;  1FRD A;  1C79 A;  4G50 A;  4C4V B;  2GLS A;  3OWE B;  4OVU A;  2NBV B;  4BBN C;  3HVD A;  4MAC A;  1YJJ A;  1I4H A;  2BW2 A;  4GDL A;  3L10 B;  1Q10 A;  2WNM A;  4EUT A;  4A8X C;  3PTF C;  5GXG B;  2LMC A;  2NTS A;  1K8R B;  2LGY A;  2JWU A;  2INC C;  1TY2 A;  3NZU A;  1WGR A;  4FXC A;  4GGQ A;  4P6V F;  1TIF A;  2KJH B;  4RMA A;  3A9K B;  1KOT A;  2QSD A;  5D94 A;  3T3O A;  1MHH E;  4OVV A;  3L0W B;  3WAN A;  3RFZ B;  3L16 A;  1YQB A;  2CKH B;  4AOF A;  3P1M A;  3NUH B;  3GB1 A;  3A4S C;  2G45 B;  4REZ A;  1L7Y A;  5KHO A;  3W9C B;  1OQY A;  1TZO A;  2LUE A;  1WRD B;  2D3C A;  2JZZ A;  3Q69 A;  1PYW D;  4USA A;  1A70 A;  1ET6 A;  2AX5 A;  1WJU A;  3MC0 B;  1NDD A;  4X57 B;  2LAS A;  3AI5 A;  2N9K A;  2ZPY A;  3FAH A;  4OHJ A;  1AWD A;  3P4S B;  5E6O A;  3AE9 B;  2Z0D B;  2VH2 A;  4HDQ A;  1VDV A;  1B9R A;  2IND C;  2LGD A;  2L83 A;  3QX1 A;  4HKZ E;  3PS6 A;  2KDE B;  4YT0 B;  1L0Y B;  3H7P B;  2V3P A;  2W82 A;  2O2V A;  3BWU D;  2KZR A;  3ZNG C;  2OHF A;  1TZ1 A;  2IO1 B;  2KQ7 A;  5GMV A;  4RFB A;  2YEP F;  4WQM A;  1OGW A;  3QJZ A;  1V9J A;  3RI7 C;  3OAW A;  3KYD D;  2WGS A;  4HRO A;  2KAN A;  2KWC A;  1Y8R C;  1D4B A;  5HFY A;  3NOB A;  4K1R B;  3VUX A;  2MBH A;  1OEY A;  3DBS A;  1SSN A;  3DVN U;  3MJW A;  1HQR D;  1WXQ A;  3RT3 B;  1MHX A;  3FIL B;  4DK5 A;  3JW0 X;  4GSW A;  3ZRC A;  1WY8 A;  2PVG C;  2YVC A;  1RWS A;  2FAZ A;  1FO4 A;  4NQK E;  4WWM A;  1GB4 A;  4LNI A;  3KYC D;  1HTQ A;  3HUI A;  3AXC A;  5D2M B;  1PUT A;  3DVN V;  2W3R A;  1GJZ A;  3ABV B;  2KJR A;  4BOS C;  3RCZ A;  1V80 A;  1STE A;  4NQL B;  2KMA A;  1FMA D;  1VRA B;  3ZNZ B;  1KH0 A;  3IVF A;  3Q3N C;  1T0Q C;  2JZ3 B;  1NBF C;  2L32 A;  1YNT E;  5JZE B;  1ZP0 B;  1XO3 A;  2NVU I;  2PTL A;  2KK8 A;  2BGF A;  2HJ1 A;  1BXT A;  2K1F A;  3QC8 B;  3Q3J A;  3WIM A;  2A5U A;  4FLH A;  3WAM A;  4KKI A;  4TQ1 A;  3DWG C;  4HJK A;  3TBL D;  3N1X C;  1V81 A;  1QLB B;  2QMT A;  2KJ6 A;  1VCB A;  3R2T A;  3RZF A;  4C00 A;  2HTH A;  2L52 A;  2K3U A;  2AWT A;  4EZL A;  4HCP B;  2IGG A;  1UBQ A;  1XLN A;  1TGZ B;  5CHW A;  1WF9 A;  4FBJ B;  2LGX A;  2OOB B;  1J7A A;  3UGB B;  2K9X A;  1S3S G;  2Z0E B;  2FCQ A;  4HPM B;  4B0M A;  1OTR B;  3ZRF A;  3ZIM A;  4DBG A;  1IBX A;  2JQR B;  4NAW A;  3ZTC A;  4XZ4 A;  3LJ3 A;  2IZV B;  4MSQ B;  3DBH B;  1VD2 A;  3IT6 B;  2LXA A;  3NHE B;  1SJH D;  1R4N B;  2K8B A;  4IUM B;  4A3P A;  2LJ5 A;  3Q3O C;  2WDQ B;  1WH3 A;  2J53 A;  4M01 A;  3HVZ A;  4ICV A;  4E3C A;  3DBL I;  2PKO A;  2JSV X;  2KN4 A;  1L6U A;  1V1P B;  4OZA A;  2WXK A;  1U4A A;  1GPX A;  1OEY J;  2BS4 B;  3I5J C;  1SE9 A;  2WXJ A;  2L8J A;  2DNF A;  5CHF A;  2LWP A;  2KYW A;  4P16 A;  2MP2 A;  2O6V D;  2IPK D;  2MBQ A;  4W9F A;  5DPT A;  4I6L B;  1HEZ E;  2JYE A;  4Q2J A;  2IJ0 A;  4KZC A;  2LVO A;  2C7M B;  1C4C A;  4J6I A;  3TJP A;  3SDL C;  1KM7 A;  1N61 A;  5AZH A;  3AV8 A;  4DDG D;  4MGZ E;  2FNJ B;  2PMV A;  5EE0 A;  4A90 A;  4TUU A;  5EDS A;  2QCZ A;  2DAJ A;  1NEK B;  5LXI B;  2FCM A;  4P1C C;  3W2D A;  1WJN A;  3U52 E;  2WP9 B;  1SEB D;  1WYG A;  1KLV A;  2G4S A;  3KH0 A;  4LDT D;  3N32 A;  1EU3 A;  2LRU A;  2NBU A;  2AYO B;  3AEG B;  2WXI A;  3VRA B;  3APC A;  1D3Z A;  3U7Z A;  1KRH A;  1GNU A;  1WFY A;  3NS1 A;  1E7U A;  2L7R A;  1SB3 C;  4II2 B;  1XLO A;  2IY1 B;  1SXT A;  1XXG A;  1L4Z B;  2Y5P A;  1JCK B;  3I9V 1;  4LCD E;  1T6B X;  2M19 A;  1JRP A;  3ZQ4 A;  1TKE A;  1BUI C;  1UNS A;  2N1W A;  2AQ1 B;  5AUK A;  1D5M C;  4MGY E;  3ETR A;  2L76 A;  2GI9 A;  2BVC A;  4K3C A;  3AE6 B;  4ANV A;  1F0Z A;  4WWO A;  3VTU A;  4ZYS A;  3OJ3 A;  5EE9 A;  4F8C B;  2MLB A;  4DDI D;  1XQQ A;  3X0W A;  1K51 A;  4ARI A;  2KX3 A;  4P1B C;  1HZ5 A;  2C7H A;  3VFK A;  3NRZ A;  2V4I B;  5DPS A;  1WGK A;  4C7Y A;  1Q5W B;  1UH6 A;  5IN7 A;  2WDT B;  3U2S C;  4H2A A;  4XDD A;  2JWZ A;  2MX2 A;  2ZVN A;  2R2Q A;  3NZS A;  3U30 A;  2KKC A;  4MM3 A;  4RF1 A;  1WI0 A;  3DHG C;  4YWG G;  3P4R B;  1B1Z A;  3DDC B;  1TY0 A;  3QA8 A;  4MDK E;  4MGK E;  3TSS A;  2BYT A;  1C77 A;  3VRB B;  2LZ6 A;  2ACZ B;  2ZCB A;  4IOI E;  2IO3 B;  3IG3 A;  3PZ8 A;  2DYO A;  2W9N A;  1YD8 U;  3HM3 A;  4BBN F;  4W9K A;  1FIQ A;  3QWZ B;  1FPY A;  1QIL A;  1XT9 B;  4BAX A;  1IUE A;  4LJO B;  1VLB A;  1XLQ A;  1QOF A;  1RAX A;  4RGO S;  1E90 A;  4GLS C;  1AW7 A;  2KDM A;  5BO4 B;  2MBO A;  3Q14 C;  4W9D A;  4M0W B;  2D3B A;  3LXF A;  1PGB A;  2KWU B;  2BWF A;  1MJD A;  3PO0 A;  4MEM A;  1WIA A;  2JXX A;  2KLC A;  4GIV A;  2M1M A;  2O6V B;  2KNB A;  1YIW A;  3BZD B;  2BF8 B;  1NYR A;  5G5G A;  2J4X A;  1FRR A;  1GOZ A;  2MHJ A;  3KUZ A;  2JU6 X;  3Q3M C;  1MG8 A;  2JT4 B;  1WMH B;  5KHQ A;  1ROE A;  1Q1O A;  4IG7 B;  1TTN A;  1WGG A;  3PRM B;  4EKU A;  1WX9 A;  1KJT A;  1FFV A;  3BYY B;  1YMH E;  4HLE A;  4MJS B;  4EZK A;  3MHZ A;  4EZJ A;  1C9F A;  4A6Q A;  2VRR B;  1WXA A;  2AEH A;  4N6E B;  3B2F A;  1EF1 A;  5JH5 C;  4GOC A;  1R4M B;  2SEB D;  4J3O D;  2BQQ A;  1IGD A;  5C23 A;  3DVG Y;  2KN5 A;  2L0F A;  2QIL A;  2EEL A;  2EKE C;  3DOW A;  4LDT B;  2JZP A;  2G9H D;  2M56 B;  2LEK A;  3ZVV A;  1V5T A;  1EWY C;  1GC6 A;  3ZJU A;  4DHJ D;  4LJP B;  3DBL B;  4D2K A;  1MG4 A;  2N7J A;  1P98 A;  3WAP A;  4ZRP A;  3WAL A;  3QCA A;  3CST A;  3LB8 C;  1JWB D;  4ZDV A;  4EOY A;  2WXR A;  4C4V A; 
#chains in the Genus database with same CATH homology
 1MVK A;  2PVG C;  1RWS A;  1AYF A;  2PLP A;  4WWM A;  1FO4 A;  3AEA B;  1GB4 A;  1EM7 A;  1UGJ A;  3BYT B;  4HEA 1;  2INN E;  3HUI A;  1N62 A;  1YN3 A;  4M0W A;  1PUT A;  2RPV A;  1K53 A;  4MT5 A;  2W3R A;  3ABV B;  2KAC A;  2MJ3 A;  5FK9 C;  5FR3 A;  1STE A;  1FNU A;  3AEB B;  4DXF A;  1JRO A;  2BB6 A;  4MM3 B;  1XCT L;  1FMA D;  1VRA B;  1KH0 A;  3UI3 A;  4WIP A;  2V0G A;  5EE3 A;  1ET9 A;  2EKI A;  4NJC A;  3C8Y A;  4WH4 A;  2L32 A;  1NEN B;  2LFI A;  3MJ5 A;  1QOG A;  3H8H A;  1JWS D;  1YNT E;  2RDG A;  2FE8 A;  4RGT A;  4IDI A;  5T8I A;  1ZP0 B;  1XO3 A;  2PTL A;  2V3N A;  1FXA A;  4JE3 B;  1BXT A;  5C3J B;  4N58 A;  4TMA B;  1SE3 A;  3TEY A;  2VZK D;  4EE2 A;  2MH7 A;  2WS3 B;  4KX6 B;  1JML A;  4YSZ B;  4LTU A;  1WWT A;  4KKI A;  4TQ1 A;  3BK1 A;  2J42 A;  3ZYY X;  3DWG C;  2ZW1 A;  1F2R C;  4HKQ A;  3KWV A;  1ENF A;  5TSS A;  2W54 A;  1QLB B;  2QMT A;  1IGC A;  1DOY A;  3GP7 A;  4R3D A;  1VZ6 A;  4OZB A;  3V05 A;  3VR8 B;  1HXY D;  2GRI A;  4HJG E;  2WDR B;  3W1S A;  3R2T A;  1EWC A;  5H92 C;  5EE1 A;  4WAF A;  2L52 A;  5BMH A;  1OQR A;  2LUM A;  2K3U A;  3AE7 B;  2CU3 A;  3Q8C A;  4RF0 A;  4YXD B;  2IGG A;  2N0S B;  3AEE B;  1XLN A;  4JPS A;  1K52 A;  3HRD D;  1F77 A;  4LLG M;  3E9S A;  4US8 A;  3AE3 B;  1J7A A;  4YTN B;  4OVZ A;  2BT6 A;  2K9X A;  4OW0 A;  1ACC A;  5MPO A;  3IXS A;  3IAS 1;  4B0M A;  1T3Q A;  2DYM A;  3AEC B;  2WXL A;  2WXM A;  2JQR B;  1IBX A;  3GS2 A;  2MJD A;  2WDV B;  2HDE A;  2B76 B;  3IT6 B;  4DXG A;  1SJH D;  1L5P A;  3FIL A;  1LO5 D;  1FNV A;  5HI1 A;  5AUI A;  2WDQ B;  2QEJ C;  3BVZ A;  3O13 A;  2WXH A;  3AM9 A;  2J53 A;  3AE4 B;  5HHD G;  3AED B;  1ZOY B;  3HVZ A;  3B2G A;  1QF6 A;  3IAM 1;  2PKO A;  2JSV X;  5E6J A;  2KN4 A;  2J52 A;  5JXV A;  1L6U A;  1BML C;  1V1P B;  5BYQ A;  4OZA A;  4YSX B;  2WXK A;  1JQ4 A;  1GPX A;  1J7B A;  1HZ6 A;  3P4Q B;  2JXT A;  3EA6 A;  2BS4 B;  3SFD B;  2WXJ A;  1EU4 A;  1DOX A;  4JWU C;  1I4G A;  1L0X B;  1D6E C;  2WXO A;  4P16 A;  3AE8 B;  1DOI A;  2DWQ A;  2Q5W D;  3U4E G;  2IPK D;  1NYQ A;  3ZJT A;  3V3X A;  4GDK B;  2XNA C;  5I4D A;  1FCL A;  1HEZ E;  2JYE A;  1I4P A;  1C4A A;  1DYQ A;  4Q2J A;  1QOA A;  1XEE A;  2IJ0 A;  2Z8L A;  1UUP A;  2ZW0 A;  1CJE A;  1PFD A;  1C4C A;  1C4P A;  4C80 A;  1TS4 A;  2ONQ A;  1KFY B;  3BVM A;  1SE2 A;  3TEW A;  3CWI A;  3FC4 A;  4TQ0 A;  2W3S A;  2KQ4 X;  3Q8E A;  5D3D A;  1N61 A;  1VZ7 A;  2DLB A;  1ZDX A;  5BYS A;  3AV8 A;  3DWM A;  2I38 A;  3SEB A;  4AS1 A;  2PMV A;  1YQ3 B;  1UWX A;  3B9J A;  5EE0 A;  4A90 A;  3Q8B A;  1WSP A;  3VQI A;  4AQ7 A;  5HG2 A;  2LHD A;  1NEK B;  4ZHO A;  3MFG A;  1SF0 A;  1JWA D;  3KQ4 A;  1I4X A;  3I57 A;  3W2D A;  3U52 E;  1DGJ A;  1JW9 D;  1UWM A;  1SEB D;  2WP9 B;  1WYG A;  1QOB A;  1P7E A;  3TUO A;  1VZ8 A;  3NVY A;  1F2R I;  2BBC A;  1V1O A;  1ZE3 D;  2AQ2 B;  1EU3 A;  2QJL A;  3KLS X;  2KWD A;  1L0V B;  3AEG B;  2WXI A;  2XN9 C;  4C7Z A;  3P4P B;  3AE1 B;  4GDL B;  1C78 A;  3VRA B;  3BVG A;  1JWM D;  5G5H A;  5FKA C;  2BTE A;  3U7Z A;  5C2T B;  1KRH A;  4NAM A;  1HA5 A;  4XWT A;  2RDH A;  3NS1 A;  1RFK A;  4YTM B;  4CQN A;  1D5Z C;  3SR6 A;  4XWW A;  1E6E B;  1K50 A;  1SB3 C;  4KGS A;  2DBY A;  1XLO A;  1OQQ A;  3AN1 A;  1SXT A;  2W55 A;  3Q8F A;  3EUB 2;  1MI0 A;  1P7F A;  1XXG A;  2K5P A;  1L4Z B;  2Y5P A;  1JCK B;  3I9V 1;  4RGN A;  3W5V B;  1JAL A;  1T6B X;  1JRP A;  2M19 A;  3ZQ4 A;  1TKE A;  3NVZ A;  1J7C A;  1BUI C;  2D5G A;  3URY A;  1UNS A;  3ZGZ A;  1R7S A;  1ZDV A;  2H89 B;  2LJI A;  1JWU D;  2AQ1 B;  5AUK A;  1FM0 D;  3KWL A;  1D5M C;  2Y5C A;  1FEH A;  3W5U B;  2ICI A;  3ETR A;  1VJK A;  1KTK A;  4MH8 A;  2GI9 A;  3AE6 B;  1F0Z A;  1V1P A;  1KLG D;  1L4D B;  1QKZ A;  2MJE A;  4ZYS A;  1T5X D;  2WU2 B;  3ZJV A;  4L23 A;  2WQY B;  1TS3 A;  4PT5 A;  5D3I B;  5EE9 A;  1E0Z A;  2JX5 A;  2VZK B;  4B0E A;  1K51 A;  2BB5 A;  2Y3A A;  4ARI A;  2I2Y A;  2JYT A;  1N63 A;  1HZ5 A;  3TEZ A;  1RYJ A;  2H88 B;  1V97 A;  2K0P A;  3NRZ A;  2V4I B;  4L2Y A;  4HRS A;  4WUR A;  1WGK A;  2IGD A;  4DQO C;  4C7Y A;  3AE5 B;  1I4R A;  1XLP A;  4TSS A;  4C56 C;  3T3N A;  4ARC A;  3U2S C;  4H2A A;  2RMM A;  4KGR A;  4XDD A;  4L1B A;  1ZPS A;  5BYR A;  2IGH A;  2QIE B;  1YQ4 B;  4LK0 M;  2K22 A;  3SFE B;  1KF6 B;  4YTP B;  1SIJ A;  1PDX A;  3Q8A A;  4RF1 A;  3TEX A;  2SAK A;  4YWG G;  2KAJ A;  3P4R B;  4O1N A;  1PGA A;  1I7H A;  1CK1 A;  3L4P A;  4IKG A;  1B1Z A;  1GB1 A;  1IBX B;  2MEK A;  2FUG 1;  1FNW A;  1TY0 A;  4ZHP A;  1I4Q A;  3AEF B;  1L6V A;  2CJO A;  1TS2 A;  3R2I A;  3TSS A;  2X38 A;  5H8Y E;  2BYT A;  1C77 A;  1FCC C;  3VRB B;  4YSY B;  3CIR B;  1YN5 A;  1V8C A;  1ZUD 2;  1XF5 L;  1QQR A;  2ACZ B;  4IOI E;  2R61 A;  4RGM A;  3R8B A;  1AN8 A;  3PZ8 A;  3EGR A;  3VR9 B;  2DYO A;  3E56 A;  1QT9 A;  2KMM A;  2INP E;  3MP9 A;  1TKY A;  1N5X A;  3PZ7 A;  1SE4 A;  1N5W A;  1Y56 A;  1OFF A;  1FRD A;  1C79 A;  1FIQ A;  4JX1 C;  3BII D;  1QIL A;  2BS3 B;  3OWE B;  1E10 A;  5BMI A;  1IUE A;  1VLB A;  4ZRQ A;  1C76 A;  1XLQ A;  3HVD A;  1QOF A;  1YJJ A;  4MAC A;  1I4H A;  2BW2 A;  4ZOH C;  4RGO S;  4GLS C;  1AW7 A;  2KDM A;  1MPE A;  1Q10 A;  2WNM A;  4A8X C;  5GXG B;  2LMC A;  2NTS A;  1SJE D;  2JWU A;  1FFU A;  1TY2 A;  3LXF A;  1PGB A;  1SBB B;  2AQ3 B;  4OZC A;  4FXC A;  3PO0 A;  3P63 A;  4P6V F;  1PGX A;  4KKJ A;  3NVW A;  4UDU C;  1E7P B;  1XCQ L;  2QSD A;  5D7G A;  4A9A A;  1KLU D;  2L1A A;  5LNK 1;  3T3O A;  1MHH E;  3AE2 B;  3BZD B;  3AMZ A;  3RFZ B;  4JWS C;  1NYR A;  3P42 A;  2J4X A;  1FRR A;  1GOZ A;  5G5G A;  4A55 A;  2JU6 X;  3IT4 B;  1CZP A;  1ROE A;  2NMQ A;  2CJN A;  1M4V A;  4KGT A;  3BK2 A;  4RCO A;  3P1M A;  3AB5 A;  1RM6 C;  1TJE A;  3NUH B;  3GB1 A;  1FFV A;  3BYY B;  4REZ A;  1YMH E;  4XE0 A;  2NTT A;  3W9C B;  2TSS A;  1TZO A;  3MHZ A;  4US9 A;  3Q69 A;  1PYW D;  4USA A;  2WXF A;  1A70 A;  2WXN A;  1C9F A;  1WRI A;  1ET6 A;  2PVO D;  2AX5 A;  2WLB A;  1E9M A;  3AH7 A;  3MC0 B;  4A6Q A;  1D5X C;  3NVV A;  4N6E B;  1YN4 A;  3B2F A;  1TYG B;  1FXI A;  2IDY A;  2N9K A;  2SEB D;  2WU5 B;  4J3O D;  1CQV A;  3FAH A;  1N60 A;  4OHJ A;  2PW9 A;  1TKG A;  1AWD A;  1IGD A;  3P4S B;  2LHE A;  2GB1 A;  2LGI A;  2ON8 A;  3AE9 B;  2OED A;  2QIL A;  1VDV A;  2EEL A;  2HTM E;  4N59 A;  1B9R A;  2L83 A;  4HKZ E;  2PIA A;  2JZP A;  2G9H D;  1ESF A;  2YEP B;  2M56 B;  2LEK A;  1L0Y B;  4RH6 A;  4YT0 B;  1GAQ B;  2V3P A;  3LYY A;  2W82 A;  1YJI A;  3N9Y C;  3BWU D;  1EWY C;  2OHF A;  4RNA A;  4ITK A;  3ZJU A;  4RFB A;  2YEP F;  4WQM A;  1ZXH A;  1TS5 A;  3RPF C;  3NZ3 A;  2N9L A;  4NZL B;  4D2K A;  2N7J A;  2WXG A;  4HRO A;  4ZRP A;  2FBW B;  3J9C A;  1ZXI A;  3LB8 C;  1JWB D;  1NVI D;  5HFY A;  1D4B A;  1NI3 A;  4XDC A;  4NAW B;  2E6X A;  2M0A A;  1FD6 A;  2WXR A;  1SSN A;  2WXP A;  2E3T A;  1HQR D;  1WXQ A;  1MHX A;  1VR9 A;  2WXQ A;  3FIL B;  2G1E A;  5BMG A;  2BS2 B;  3WCQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...