1QQRA

Crystal structure of streptokinase domain b
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
138
structure length
138
Chain Sequence
IQNQAKSVDVEYTVQFTPLNPDDDFRPGLKLTKLLKTLAIGDTITSQELLAQAQSILNKNHPGYTIYERDSSIVTHDNDIFRTILPMDQEFTYRVKNREQAYRINKKSGLNEEINNTDLISEKYYVLKKGEKPYDPFD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Crystal Structure of Streptokinse Domain B
rcsb
molecule tags Hydrolase activator
molecule keywords STREPTOKINASE DOMAIN B
total genus 35
structure length 138
sequence length 138
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 1999-06-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02821 Staphylokinase Staphylokinase/Streptokinase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.180 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1qqrA00
1BMLC 1QQRA 1C4PA 1L4ZB 1L4DB
chains in the Genus database with same CATH superfamily
4FBJB 2HTHA 4GMVA 3RNAC 2KD0A 2KQ7A 2KWCA 3R2IA 4BVUC 4FXCA 3ZGZA 2WQYB 5HKHA 1EWYC 2BQQA 2BTEA 1WIAA 2WXNA 2R61A 1JQ4A 2E6XA 1TBEA 3DBLB 3Q3FA 1LO5D 2C5LC 3MC0B 1AW7A 4IOIE 5BYRA 4I6PA 3W9CB 1UD7A 1GB4A 3KUDB 3TL5A 4ANVA 4P6VF 2L83A 1TYGB 2NBUA 1WZ0A 3VFKA 2SEBD 3I63C 2L1AA 1XCQL 3NZUA 3JSVB 4N58A 2D10A 4KIKA 2J0KA 4NNJB 1FCCC 4WJOA 1EF1A 3Q2AC 2OJWA 1QLBB 2WP9B 2KC1A 4HPPA 1FXTB 4P1CC 1RFKA 1FIQA 2J53A 4HDOA 1V49A 2M8SA 4D2KA 1VZ7A 2Q5WD 2MX2A 2JY6A 1Z2MA 5BYQA 1MHHE 1NBFC 2ON8A 5TSSA 4DHJD 4HWIB 1MVKA 2LXAA 4GN1A 3A1QB 1SIFA 2V9HA 1OEYA 1XQQA 1DOIA 2KHWB 1J7BA 3V60A 4PS8A 3APCA 2MWSB 3L16A 1C4CA 1EF5A 1BT0A 1D3ZA 3DHGC 4A90A 1V1PB 2ZW0A 1MPEA 3N32A 2KFJA 3A9JA 2LHDA 1E9MA 1YJ1A 1ET6A 1MHXA 5CHWA 1WGDA 1WGRA 1UZXB 4F8CB 1V1PA 5AZHA 3T3OA 1R4MI 3GE3C 3FC4A 5G5GA 4ZRPA 1L6UA 2MBHA 2FCMA 3R3MA 1C4PA 5IOIA 3L10B 2JT4B 1IBXB 2JF5A 1SJHD 1SGHA 2L32A 2KZRA 4KV2A 3GS2A 1YJJA 2N7JA 1GUAB 5D3DA 4JLCA 5LXHA 1JWAD 1ZW7A 4RGNA 3Q3JA 3N20C 2Z0DB 3RCZA 2FIDA 3R7RA 3H6NA 4DHZE 2NBVB 4LCDE 2IYDB 4LDTD 3W1YA 2KT7A 2NS5A 4CHKA 3HUIA 1KJTA 4A6QA 1RLFA 3AE2B 1D5ZC 1P1AA 3L54A 1C1YB 4DXFA 2BS4B 2J52A 4BFRA 3BY4B 3PVLA 1PUTA 2IY1B 3H7SA 2IO1B 4IW0A 4YSYB 3MC9A 1WJNA 2RD0A 2QEJC 1MJDA 2A4ZA 2BGFA 3HIZA 1GG3A 1AWDA 1E8YA 2DAFA 1WMHB 1WR6E 3V05A 1L7YA 1BXTA 1IPGA 4G50A 2KKCA 1R4NB 2LGIA 2KYWA 3V6CB 1WX7A 4ZRJA 3DCGA 4JIOU 2L0TA 3AEFB 1F77A 2FCQA 1KFYB 2EKIA 3UQAA 4H2AA 1N62A 1TY2A 2J0JA 2KDMA 2I1JA 2HJ8A 3M3JA 1WGGA 3NY5A 3VUWA 3WIMA 2KLCA 3AE3B 3ZDMC 4II3B 2JXTA 1PQSA 1ZXHA 3PREA 3WA0A 2JRIB 2ZPYA 3ZNHB 5G5HA 2MSED 1UUPA 2KLGA 3PZDA 4FADA 3SFEB 2MBEA 3AU5A 2MCNB 2KJRA 1F0ZA 2LVOA 3RI7C 1HTQA 2K25A 2W9NA 1YN3A 1KLGD 1NYRA 2N1WA 2G4DB 5IKCM 3HVDA 1EU3A 4W9CA 1NI3A 3ZNZB 1J0GA 5HG2A 1K53A 1V86A 4I6NB 1QILA 3VTVA 2EMSA 3U52E 2KFKB 4XZ4A 4BBNC 1L0XB 3VUXA 3SHQA 2ZCCA 5JZEB 3MJ5A 4RGOS 1WGYA 3ONSA 1P3QU 3K9OB 3BINA 2JUOA 3UGBB 1YD8U 3VH4B 2AQ2B 5H92C 4W9FA 1IUEA 1LM8B 3ZRCA 1TS3A 2AQ3B 4KSLC 3OAWA 2N9PC 2WU2B 5T8IA 3ZRFA 2MBQA 3O65B 5HI1A 2WXHA 4HCNB 3LYYA 3U4EG 3I3TB 2ZCBA 4C7ZA 2K6QA 4NY0A 3Q8FA 2AX5A 3PPAA 1E8XA 3T9LA 2RDBC 2ZZPB 3WAOA 2JZZA 2N9LA 3PT2B 3KWLA 2PMVA 1J8CA 1WZ3A 2K8CA 1ZDVA 1L0VB 3L13A 3PO0A 2WGSA 2WXJA 3IBEA 4TUUA 1ACCA 1WXVA 2WX1A 4HROA 3N1YC 4BKTA 5IA7A 3ALBA 5D94A 4FJZA 2IGDA 2H89B 1B1ZA 1M4VA 2K8BA 2NBWB 2Y3AA 5L83A 3M95A 4HVBA 2H88B 4BKGA 2OEDA 3ZYYX 2HE7A 2INPE 1I7HA 1SF0A 2PKOA 3UIOB 3ZDTA 3UF8A 2LUMA 2YEPB 2BB5A 2O2VA 2BYVE 4L2YA 3UIPB 2EELA 3SEBA 4K7WA 2INDC 3E56A 3I9V1 4RF1A 4PYZA 5CTRC 4PK1A 1XLNA 1WXQA 3OWEB 2V3PA 1V97A 1TS4A 2CS4A 1TGZB 3KWVA 3KYCD 1OFFA 1RM6C 2LASA 4DHJB 1I35A 2MH7A 3Q8AA 4FJYA 5IO9A 5HFYA 3CF6E 1JWBD 2L52A 2MW5A 4USAA 2RR9A 4IKGA 4P16A 5C1ZA 4ASWC 4WH4A 3ZNID 1PGXA 1GAQB 2X8XX 4MM3A 2CHZA 1T3QA 4XYCA 2WXQA 4LNNA 4NAWA 1C79A 3L4PA 2MP2B 1TZ1A 5CHFA 2IO0B 1FPYA 2DZMA 4IM0A 3ZTCA 2JWUA 4X57B 3H7PA 4ACFA 1XF5L 2B76B 3A4RA 2DENB 1V80A 4KVGB 2FE8A 2W3RA 2WXLA 1KH0A 2WS3B 2A5UA 2FAZA 4KKJA 1H4RA 1WE6A 2K39A 1C76A 4NZLB 1EUVB 1PFDA 2DBYA 2RPVA 4IWOA 4NQKE 4GSWA 2LRUA 1ISNA 3RNBC 1LGRA 1QOBA 3HHMA 1E0ZA 1N61A 4ZHPA 4MSQB 1U4AA 2JX5A 3P4PB 2RMMA 2DX5B 4ZYSA 2IDYA 1YOVB 5E6OA 4DXGA 3A4SC 2K1FA 4MDKE 4JL9A 3NVYA 4ANUA 4M8MA 1G6JA 2IO2B 2BB6A 2IZVB 4ZRKA 4IDIA 3TUOA 2PJHA 2CHWA 2L0FA 2FCNA 1FM0D 3L08A 1ZDXA 2BT6A 3PRPB 1WE7A 4WJQA 4CYEA 3ZUNA 2EKEC 3VTWA 1GC7A 4JX1C 1XO3A 5LNK1 1YN5A 3NOBA 1UBQA 2GBRA 5D6JB 5C2TB 4FHKA 4RCOA 4FHJA 4XDCA 4HXDA 2CJOA 3SDLC 2KACA 4W9IA 3DBRB 3AEGB 4O1NA 4DWFA 1WR1A 1N60A 3MTNB 2GBMA 2HTME 3APDA 4G11A 4TSSA 2BKRB 1V81A 1FMAD 2IGGA 1E7UA 3HVZA 4W9JA 3JVZX 3TEZA 2J7QB 5CHVC 3RD2A 3URYA 2QHOA 5AUIA 1JALA 2K9XA 3RNFC 1YJIA 5AUKA 3V3XA 5FR6A 1GOZA 1Q1OA 2BYFA 4W9HA 1E7PB 4FJVB 3DVNV 1ESFA 3NZ3A 3VDZA 1UF0A 3Q6BA 1HQRD 1L5PA 5IP4D 1KLVA 2V3SA 3TEYA 1Q10A 3DBSA 2M56B 1VZ8A 1C77A 2DYMA 3VRBB 3I5JC 3KW5B 1WMHA 3SFDB 2M1MA 1BUIC 4DQOC 4AJYB 4BOZB 3KUZA 4A3OA 1AARA 1V2YA 2LI5A 2ZVOA 2LXCA 1V8CA 1R4MB 1MFWA 3LJ3A 2KJHB 5DPRA 4GIVA 2Y5PA 2JVCA 3MP9A 5BO4B 4LLGM 4MGIE 2WXIA 1EM7A 2L00B 2YLMA 2KMAA 4EE2A 2DLBA 4FA6A 1FO4A 2KAJA 1WF9A 3P4SB 3RZWC 3QARA 2C7MB 2WYQA 5EE1A 1KF6B 3ZLZA 3HM3A 4XC2A 3NVWA 3JYUA 3U8ZA 1WJ6A 3DDCB 2O6VD 4W9GA 3ZXRA 1JWSD 2IGHA 1IBXA 2MEKA 3BK2A 3AEBB 1Y56A 3RYTA 3KLSX 2Z8LA 4IWPA 2HD5B 2MJEA 4LNIA 4L1BA 2PVOD 3AE8B 4YTNB 4XGAB 3RNGC 4K7UA 1QOFA 3B0AA 3C19A 1L2NA 2L76A 3LXFA 2WWZA 2KOXA 4C00A 1IYFA 2G4SA 2CU1A 5DPWA 4M0WB 2LGDA 1MG8A 3DOWA 5GMVA 4PS3A 1YQ3B 2DWQA 1V5OA 1F52A 2GBNA 4MSMB 2KN4A 3N1ZC 1S1QB 5H8YE 4BBNF 2JU6X 1I42A 1FCLA 4ZHOA 2KNBA 4EFOA 1F9JA 2SAKA 2WDRB 4BAXA 2MA9B 1ET9A 3KYDD 1KM7A 4US9A 2KDFB 1SJED 1WM2A 3BWUD 4REZA 4KKIA 5E6NA 2QILA 3P4RB 3RT3B 1JROA 3DBLI 3L0WB 4LNFA 4NQLB 2LGSA 3Q14C 1UELA 2ACZB 3ZJTA 4WQOB 1WXMA 3RFZB 1KLUD 2KQ4X 5IN7A 2KVZA 1ZUD2 4E74A 3AB5A 2W54A 2KVRA 2DYBA 4HKZE 4KSKC 4IWQA 1UNSA 4MEMA 1UH6A 2ICIA 4AOFA 3V61A 2I1KA 4YL8A 3Q8EA 1L4ZB 3GE8C 4JWSC 3ZKJC 1SIJA 1OQQA 3ETRA 4L23A 1K8RB 1I4PA 1K51A 4UDUC 3L17A 5JHBA 1E10A 4GDKB 4HDQA 2N9KA 5BYSA 1VD2A 3VUYA 2QC8A 1I4RA 2N9XA 3OJ4B 2GRIA 2D3GA 4NJ7A 1AYFA 1LXDA 4B9KA 2KTRB 3BYTB 3S2AA 3H7PB 3WANA 4RMAA 4EKUA 1SSNA 4Q2JA 4OZBA 3OG5A 3DQVA 2I38A 3A1QA 1QKZA 3VR8B 2LMCA 3RN9C 2V3NA 3PHWB 2MJDA 1CK1A 3AE1B 4FLHA 4KGRA 1NYQA 1WGHA 5EE0A 1FNWA 2IPKD 2C7HA 3EC8A 1UGJA 1T0QC 2ZVNA 2JZ3B 3EFCA 1S3SG 1FEHA 1WRDB 3GB1A 4RH6A 4QAYA 4WURA 4DHZB 2UWQA 2KXJA 2AEHA 3U2SC 2MBBB 3RZFA 1EWCA 3VH3B 4BZAA 3TEXA 2D3AA 3TEWA 2XBBC 3JSVA 3DVGY 1HE8A 1YX5B 2LZ6A 1FRDA 2LWPA 1E90A 1J19A 1T0RC 3Q3MC 1IGCA 4MACA 1YIWA 2NTTA 2NPTA 2PLPA 4GGQA 1XCTL 1J7AA 1BMLC 4PS7A 3WALA 1TKYA 2E3TA 4TQ0A 2NMQA 4LNOA 2MRPA 5KHQA 4G3XB 1P7FA 2JYTA 4W9EA 1C3TA 4KDIC 2M19A 1XD3B 1P0RA 1XT9B 2PIAA 3OJ3A 3MJWA 3PRMB 4C7YA 2OOBB 3EGRA 4HJKA 2LJ5A 3AMZA 3NS8A 2JWZA 1EU4A 1A70A 2KMCA 4MM3B 3AEEB 4LNKA 2VH1A 5GXGB 2RDHA 3J9CA 3U30A 2R2QA 5E6JA 3C8YA 4TMAB 3AE6B 3AULA 3QK0A 4WWMA 1E6EB 3VVWB 3D32A 1QZEA 4AP4C 4RFBA 2WXKA 5HHDG 4A9AA 4KZ0A 2BS2B 2XK5A 1WXAA 3DVNU 2FIFA 4W9DA 1AN8A 4M00A 2Z0EB 4ZRIA 1WYGA 2HJ1A 3H1UA 1LFDA 3CWIA 1OQYA 1IP9A 3R2TA 2L8JA 1GNUA 4ANWA 1L6VA 4AWJA 1KOTA 2KTRA 2GI9A 3EFUA 2G45B 4HRSA 4CO7A 2J4XA 3BIID 1B9RA 3GZNB 3T3NA 3I57A 2KX3A 2D11A 4I6LB 3Q69A 3NG0A 1VDVA 4K7SA 1JRPA 2ZNVC 3DBHB 2DZKA 4ARIA 3K9PB 2V1YA 3LDZE 4WJNA 4DK5A 2FUHB 3VXWA 3PGEA 3HM6X 1NDDA 4LTUA 4ZRQA 1FFUA 2XNAC 3U7ZA 5BMIA 2N7EA 4RGTA 4S17A 2K3UA 2PVGC 3KUCB 4IM2A 2N1VA 4WJPA 3CMMB 2OHFA 3NHEB 4GDKA 1HZ6A 1GJZA 3U7DA 2GOWA 1VJKA 2DZJA 2FCSA 4KGSA 5DPSA 2WDVB 5C3JB 3NUHB 4W9KA 4JPSA 3WAPA 1P9DU 2LVPA 3M63B 1UWMA 4RM8A 3AV8A 4N59A 4AUQC 4AS1A 2O6VB 2WXFA 1QF6A 1VRAB 4KDLB 2M0AA 4B95A 1P7EA 2EMTA 4PT5A 3X23A 2UU7A 2IJ0A 2WDQB 4II2B 3JW0X 2BWFA 1FXAA 1YMHE 2RDGA 2JQRB 2ZPNA 4N6EB 3ZQ4A 4PYUA 1FFVA 1SBBB 2K5PA 3AEDB 3H8HA 4YXDB 2ZJDA 3WCQA 1WH3A 2IO3B 3NS1A 3ZNGC 3NVVA 4IUMB 3SR6A 2CR5A 5E6PA 1JMLA 3ABVB 2LUEA 3BVMA 2WXOA 3W5VB 2BKFA 2KDIA 2L3ZA 2LFIA 2UYZB 2WXMA 2XN9C 4CQNA 4A3PA 2M4NA 2PE9A 2BWES 4RF0A 2KFKA 4DDID 1N5WA 1QOAA 5J17A 3W1SA 4XE0A 3AN1A 2K22A 3IHPC 1FRRA 2CU3A 3PRZA 3RNCC 1FXIA 4M02A 4WWNA 4HJGE 2V4LA 1TIFA 5D3IB 1Q5WB 4N9F4 4C4VB 1SE2A 4ITKA 2RGFA 3AI5A 3N30A 1PYWD 2ASQA 1JCKB 3ZJUA 1ZPSA 4C56C 1ZOYB 5MPOA 3KH0A 4MELA 4MH0E 3HK0A 2GMIC 3RNEC 4LJPB 2REXA 5LLIA 4C80A 2XK5B 2DAJA 3QIJA 4GB9A 2WXGA 5FK9C 4JWUC 1PDXA 2D5GA 3ZTDA 3DBRI 5EE9A 3IAS1 3ZJVA 1M94A 3Q8CA 1XEEA 2JSVX 2CHXA 1WFYA 3EUB2 4E71A 3IFWB 1I4GA 2X38A 3PTFC 2BF8B 3FILB 2AQ1B 2QIEB 2ZW1A 4BKSA 2NCNA 2PEAA 2KANA 4F1SA 2MHJA 3B1LX 4KGTA 3P4QB 3O13A 2QJLA 4URKA 1JRUA 3X0WA 3IG3A 2WU5B 4EEWA 3PHXB 3TBLD 1NI2A 1NENB 2J0MA 1WYWB 2C9WB 1ZP0B 2KDBA 3QJZA 4LK0M 3P2BA 1ZKHA 3AXCA 4OVZA 4GDLA 4AJWA 4YWGG 3AU4A 1RWSA 4LDTB 2WX0A 5J2RA 1KRHA 3IT4B 3MHZA 4NJCA 1N6ZA 3FILA 2PE6B 4YT0B 2LHEA 4OZCA 3PZ7A 2OJRA 2NR2A 2V0GA 1MI0A 3DBHI 4B6WA 1WGKA 1RAXA 4XDDA 1HEZE 4BOSC 3IAM1 1SXTA 2J42A 2AYOB 3R7QA 1JW9D 1D5XC 2Z59B 1PGAA 2WNMA 2WHIA 4KX6B 5BMGA 5L95C 3UQBA 2M17A 2G3QB 2QCZA 1L4DB 2MP2A 4MJSB 3VTUA 3APFA 4KIKB 5KHOA 5BMHA 1FNVA 4HK2A 4MJSA 1WXSA 2C60A 4WAFA 2G9HD 2MQJA 3DHIC 4GDLB 4J3OD 3PZ8A 3TIXA 3Q3OC 1YQBA 3EA6A 3PS6A 4RGMA 3LB8C 2KK8A 4A20A 2MJ3A 2AL3A 3AH7A 4OHJA 2ZEQA 1HXYD 2I2YA 1SEBD 3V62A 3M62B 3AE9B 4TV3A 3IT6B 3FKYA 2L7RA 2CKHB 1OTRB 3DWMA 2W82A 1F1HA 3IVFA 3QHTA 3QQ8B 3MFGA 1I4HA 1OEYJ 4NJ6A 3TJPA 4US8A 4TQ1A 2D3BA 5LXIB 1QOGA 2YVCA 2N7DA 4NAMA 3R8BA 4MGZE 2W3SA 1SE4A 3ML8A 3Q3NC 3EHVA 2VZKD 3PLVA 2R2OA 3ZIMA 3B2GA 1CJEA 2RSUA 4OVVA 3DVGX 3GOEA 1YX6B 2KN5A 4ZYNA 2LJIA 1XLOA 4GLSC 4M8NA 3VAWA 4BKSD 2G1EA 2PW9A 1K52A 3ZXVA 4LJOB 1FNUA 1VR9A 3HRDD 3NZSA 2INNE 2GBKA 3IXSA 1OGWA 3B9JA 4XWWA 4TKNA 3UINB 5DCNA 1K50A 1QQRA 3AE7B 4HPLB 1CZPA 1LQBA 3N1XC 1ROEA 4ARCA 2VZKB 1A5RA 4GU2A 5AEKB 1SE9A 4HEA1 3PLUA 3E9SA 3AE5B 1DYQA 1RRBA 4HKQA 2O2VB 1V9JA 3KQ4A 1X1MA 2KTFA 5D7GA 3AE4B 3VRAB 1F2RC 2KJ6A 1Z5SB 4K81A 4OVUA 3DWGC 4XX5A 2JPHA 4S0RA 3ZO5B 2LD9A 4F7ZA 3AM9A 2XEWA 1GB1A 4MT5A 1HA5A 2BYEA 2KDEB 1YNTE 1ENFA 3ZW3A 4RM9A 2PPHA 5J18A 3EECA 3TMPB 2LVQA 1TY0A 3QC8B 3ML9A 2B3AA 4HPMB 4ANXA 2DYOA 4OW0A 3ENEA 5D2MB 1STEA 3CIRB 3Q8BA 4ICVA 3QA8A 4EOYA 2INCC 2LGXA 1RFAA 1VLBA 2JZPA 5FR3A 4NPNA 2FNJB 1GC6A 2CJNA 5AZFA 5TR5A 5I4DA 3VHTC 2KMMA 5C23A 2BBCA 3BZDB 3MC8A 1N5XA 4HCPB 2Y5BB 4JGHB 3RUIB 1NVID 2KX0A 4EZLA 2KWDA 2JYEA 3AECB 4HLEA 1C9FA 1JWUD 1V5TA 4IC7B 2LGYA 1E8ZA 1UGMA 1EO6A 1IGDA 1TKGA 1XLQA 3KVFB 5DPTA 4RNAA 2JRHA 2WXPA 1R4NI 3BYYB 1WI0A 2O6VA 2LRWA 2KWUB 2L05A 1I4XA 4M01A 4B0EA 1XLPA 2VH2A 2N0SB 2D2QA 2BW2A 4WAAA 1TJEA 1QT9A 3MHSD 1YQ4B 4K3CA 4K3BA 4EUTA 1XXGA 4MGYE 4W9LA 4G0NB 3PV1A 2C7NB 4ZDVA 3CSTA 1KTKA 3DHHC 3W1SC 1E7VA 2FBWB 3NRZA 3RMKC 3DPDA 1SE3A 1L0YB 4WWOA 3A9KA 1WRIA 1HZ5A 1C4AA 4YSXB 4P1BC 1WSPA 2FUG1 4C4VA 2QMTA 1RYJA 1T6BX 3N3KB 5G2NA 1D4BA 5EDSA 1ZE3D 2KO3A 2IY0B 3P42A 3BVGA 2Y5CA 2W55A 3QWZB 4P7IA 3P63A 4DXAB 3NVZA 3SD5A 2QDFA 4DBGA 2WXRA 3WAMA 1F2RI 4K1RB 3NJTA 2D3CA 1HTOA 3N9YC 2K6DB 5FKAC 3ZVVA 3P1MA 2DZIA 1TT5B 4MH8A 1JWMD 4WWPA 1CMXB 3R66C 1Q0WB 4EZKA 3TSSA 1FD6A 4YSZB 1C78A 2GBJA 1TKEA 4GOCA 4WQMA 3A9KB 3BVZA 2NVUI 1OQRA 1I4QA 2GLSA 3PSEB 1UWXA 1J7CA 2QSDA 1V1OA 4AQ7A 3A9JB 4YTPB 2TSSA 4R3DA 1P98A 2KWVB 4J6IA 5EE3A 3B08A 2GB1A 2VRRB 3A33B 1TS2A 2N9EB 3VQIA 4JQWC 4IM3A 2JXXA 1N63A 1T0SC 2WDTB 2NPTB 1T0YA 2DHZA 3BK1A 1H8CA 2V4IB 1WM3A 4NAWB 1CQVA 1WJ4A 3QX1A 2MBOA 2K0PA 2KC2A 3FAHA 4FN2A 2AWTA 4EZJA 1VZ6A 2ZNVB 3AEAB 3CSFA 1TS5A 1TZOA 3VR9B 1WX8A 2DNFA 1T5XD 1WJUA 2MLBA 1ZGUB 1WX9A 3C0RB 3T8MA 4XWTA 1E8WA 1SB3C 4WIPA 1MG4A 4DDGD 3GZNI 2BYTA 3QCAA 4MGKE 5CX3A 2YEPF 3RULA 3B2FA 4A55A 1GPXA 1WWTA 1PGBA 4ICUA 3W5UB 2BS3B 2K8HA 4OZAA 1Y8RC 2HDEA 4E3CA 2RPQA 5G55A 2BPSA 2AL6A 5JHAA 4FULA 2IBIB 2M0XA 1E5WA 4B0MA 1DOXA 4IG7B 3W2DA 4A8XC 1DGJA 2D07B 3H9DA 1VCBA 2WLBA 2LEKA 2ONQA 3V6EB 5AZGA 4YTMB 3SU8X 2N4FA 2NTSA 1TTNA 1NEKB 1V6EA 1DOYA 3RPFC 5JH5C 1R7SA 4KZCA 1D5MC 3OLMD 4JE3B 5JXVA 1ZXIA 3GP7A 2BVCA 3UI3A 1UBIA 3ECIA 1YN4A 3TCAA 4M0WA 2KQSA 1D6EC 5IAAC 4GXBA 4ZOHC 3QAQA 2PTLA 1WY8A
chains in the Genus database with same CATH topology
5HFYA 1JWBD 2L52A 4USAA 3B2GA 3R2IA 1IGCA 4FXCA 4IKGA 4MACA 4P16A 1CJEA 3ZGZA 2WQYB 2NTTA 1EWYC 2BTEA 4WH4A 2PLPA 2LJIA 1PGXA 1GAQB 1J7AA 1BMLC 1XCTL 2WXNA 2R61A 1JQ4A 1XLOA 2E6XA 1TKYA 4GLSC 1T3QA 2E3TA 4TQ0A 2G1EA 1LO5D 2PW9A 1K52A 2NMQA 3MC0B 1AW7A 4IOIE 5BYRA 1FNUA 1VR9A 3HRDD 2WXQA 1P7FA 2INNE 2JYTA 3W9CB 1C79A 3L4PA 3IXSA 1GB4A 3B9JA 4XWWA 2M19A 4P6VF 2L83A 1TYGB 2JWUA 1K50A 1QQRA 3AE7B 2SEBD 1XF5L 2B76B 1CZPA 2PIAA 1ROEA 4ARCA 2VZKB 2FE8A 4C7YA 2W3RA 3EGRA 2WXLA 1KH0A 2L1AA 2WS3B 3AMZA 1XCQL 4N58A 1EU4A 1A70A 4MM3B 4KKJA 3AEEB 4HEA1 2RDHA 3J9CA 5GXGB 1C76A 1FCCC 5E6JA 3C8YA 4NZLB 4TMAB 1QLBB 2WP9B 3AE6B 1PFDA 4WWMA 2DBYA 2RPVA 1RFKA 1FIQA 1E6EB 3E9SA 4RFBA 2WXKA 5HHDG 2J53A 3AE5B 4A9AA 2BS2B 1DYQA 1QOBA 4D2KA 4HKQA 1VZ7A 2Q5WD 1E0ZA 1N61A 4ZHPA 3KQ4A 1AN8A 2JX5A 3P4PB 5D7GA 2RMMA 3AE4B 5BYQA 1MHHE 2ON8A 5TSSA 3VRAB 4ZYSA 1WYGA 1MVKA 1F2RC 2IDYA 3CWIA 4DXGA 1DOIA 3NVYA 3R2TA 1J7BA 1L6VA 2BB6A 3DWGC 4IDIA 3TUOA 2GI9A 1FM0D 1C4CA 1ZDXA 2BT6A 4HRSA 2J4XA 3BIID 3AM9A 1B9RA 1GB1A 4MT5A 3T3NA 1HA5A 3I57A 4A90A 1V1PB 2ZW0A 1YNTE 1MPEA 3Q69A 1ENFA 4JX1C 1XO3A 5LNK1 1YN5A 1VDVA 1JRPA 4ARIA 5C2TB 1TY0A 2LHDA 4RCOA 1E9MA 4XDCA 2CJOA 1ET6A 1MHXA 2KACA 4LTUA 4ZRQA 3AEGB 1FFUA 2XNAC 4O1NA 3U7ZA 2DYOA 4OW0A 1N60A 5BMIA 4RGTA 2K3UA 2PVGC 2HTME 1V1PA 3T3OA 1STEA 2OHFA 3CIRB 3Q8BA 3FC4A 5G5GA 4ZRPA 1L6UA 1HZ6A 4TSSA 1VJKA 1C4PA 1FMAD 2IGGA 1VLBA 3HVZA 4KGSA 2JZPA 2WDVB 5FR3A 5C3JB 1IBXB 3TEZA 3NUHB 1SJHD 2CJNA 2L32A 4JPSA 5I4DA 2KMMA 3URYA 3GS2A 1YJJA 2N7JA 5AUIA 2BBCA 3BZDB 5D3DA 1JALA 1JWAD 1UWMA 2K9XA 4RGNA 1YJIA 1N5XA 5AUKA 3V3XA 1GOZA 3AV8A 4N59A 4AS1A 2WXFA 1E7PB 1VRAB 1QF6A 1NVID 3NZ3A 1ESFA 2M0AA 2KWDA 1HQRD 2JYEA 1L5PA 3AECB 3HUIA 3TEYA 1C9FA 1P7EA 1Q10A 1JWUD 4PT5A 4A6QA 2M56B 3AE2B 1IGDA 1TKGA 2IJ0A 1D5ZC 1XLQA 1VZ8A 1C77A 2WDQB 4DXFA 2BS4B 4RNAA 2DYMA 2J52A 2WXPA 3VRBB 2RDGA 1FXAA 1YMHE 2JQRB 3BYYB 4N6EB 1PUTA 3ZQ4A 1FFVA 3SFDB 1I4XA 4YSYB 1BUIC 4B0EA 4DQOC 1XLPA 2QEJC 1SBBB 2K5PA 3AEDB 3H8HA 4YXDB 2N0SB 3WCQA 1AWDA 2BW2A 1TJEA 1QT9A 1YQ4B 3NS1A 3V05A 1BXTA 3NVVA 3SR6A 1XXGA 1JMLA 3ABVB 1V8CA 2LGIA 3BVMA 2WXOA 3W5VB 2LFIA 2WXMA 2XN9C 4CQNA 2Y5PA 3AEFB 3MP9A 1F77A 4LLGM 1KFYB 2EKIA 1KTKA 1N62A 1TY2A 4H2AA 1EM7A 2KDMA 2WXIA 1N5WA 2FBWB 4RF0A 3NRZA 2DLBA 4EE2A 1QOAA 1FO4A 1SE3A 2KAJA 1L0YB 3P4SB 3W1SA 4XE0A 3AN1A 2K22A 1WRIA 1HZ5A 1C4AA 4YSXB 1FRRA 2CU3A 1WSPA 2FUG1 5EE1A 2QMTA 1KF6B 1RYJA 1T6BX 3AE3B 1D4BA 1FXIA 3NVWA 1ZE3D 4HJGE 3P42A 3BVGA 2Y5CA 2JXTA 2W55A 1ZXHA 5D3IB 3P63A 1SE2A 3NVZA 4ITKA 5G5HA 1UUPA 1JWSD 2IGHA 2WXRA 1IBXA 1F2RI 2MEKA 1PYWD 3BK2A 3AEBB 1JCKB 1Y56A 3ZJUA 1ZPSA 3SFEB 3KLSX 3N9YC 5FKAC 4C56C 2Z8LA 1ZOYB 2MJEA 5MPOA 3P1MA 1F0ZA 4L1BA 2PVOD 1JWMD 4MH8A 1YN3A 3AE8B 1KLGD 1NYRA 4YTNB 3TSSA 1FD6A 1QOFA 4YSZB 1C78A 4C80A 3HVDA 1EU3A 1NI3A 1TKEA 2WXGA 3LXFA 5FK9C 5HG2A 1K53A 4JWUC 1PDXA 4WQMA 2D5GA 3BVZA 1OQRA 5EE9A 1I4QA 3IAS1 3ZJVA 1UWXA 1J7CA 3Q8CA 1XEEA 1V1OA 2QSDA 1QILA 2JSVX 4AQ7A 4YTPB 2TSSA 3U52E 3EUB2 4R3DA 1L0XB 1I4GA 1YQ3B 2X38A 3FILB 3MJ5A 4RGOS 5EE3A 2AQ1B 2QIEB 2GB1A 2ZW1A 2DWQA 1TS2A 2KN4A 3VQIA 5H8YE 1N63A 2JU6X 4KGTA 2AQ2B 3P4QB 3O13A 1FCLA 2QJLA 5H92C 4ZHOA 1IUEA 3BK1A 2SAKA 2V4IB 2WU5B 2WDRB 1TS3A 1ET9A 2AQ3B 1NENB 4US9A 1SJED 1ZP0B 2WU2B 4NAWB 5T8IA 1CQVA 4LK0M 3BWUD 4OVZA 5HI1A 4YWGG 4REZA 1RWSA 4KKIA 2K0PA 2WXHA 2QILA 3FAHA 3LYYA 3P4RB 1KRHA 3U4EG 3IT4B 3MHZA 1JROA 4NJCA 3FILA 4C7ZA 3Q8FA 1VZ6A 2AX5A 3AEAB 4YT0B 2LHEA 4OZCA 3PZ7A 2V0GA 1TS5A 1MI0A 1TZOA 3VR9B 2ACZB 3ZJTA 1WGKA 1T5XD 2N9LA 3RFZB 1KLUD 2KQ4X 4XWTA 4XDDA 1HEZE 3IAM1 1SXTA 2J42A 1ZUD2 1SB3C 3AB5A 4WIPA 2W54A 1JW9D 4HKZE 3KWLA 2BYTA 1D5XC 1UNSA 2PMVA 2YEPF 1PGAA 3B2FA 2ICIA 2WNMA 1ZDVA 1L0VB 4KX6B 3Q8EA 5BMGA 1L4ZB 4A55A 3PO0A 2WXJA 1GPXA 1WWTA 4JWSC 1PGBA 1SIJA 1OQQA 3ETRA 4L23A 1ACCA 1L4DB 3W5UB 1I4PA 1K51A 4HROA 4UDUC 2BS3B 4OZAA 1E10A 2HDEA 4GDKB 5BMHA 1FNVA 2IGDA 2H89B 2N9KA 5BYSA 1B1ZA 1I4RA 1M4VA 4WAFA 2GRIA 4B0MA 2G9HD 4GDLB 1DOXA 4J3OD 1AYFA 3PZ8A 3W2DA 4A8XC 3BYTB 2Y3AA 1DGJA 3EA6A 1SSNA 4Q2JA 2H88B 4OZBA 4RGMA 2OEDA 3ZYYX 2LEKA 2ONQA 2I38A 2WLBA 1QKZA 2INPE 1I7HA 2MJ3A 2LMCA 3LB8C 3VR8B 4YTMB 3AH7A 4OHJA 1SF0A 1HXYD 2PKOA 2V3NA 2MJDA 2NTSA 1CK1A 2LUMA 3AE1B 2I2YA 2YEPB 1SEBD 1NEKB 4KGRA 2BB5A 1DOYA 3RPFC 1R7SA 3AE9B 4L2YA 1NYQA 1D5MC 2EELA 5EE0A 1FNWA 2IPKD 3IT6B 4JE3B 3SEBA 1UGJA 5JXVA 1ZXIA 3DWMA 3E56A 2W82A 3GP7A 3I9V1 4RF1A 3UI3A 1FEHA 3MFGA 3GB1A 4RH6A 4WURA 1I4HA 1XLNA 4US8A 1WXQA 1YN4A 3OWEB 4TQ1A 4M0WA 2V3PA 1V97A 3U2SC 1TS4A 1QOGA 4NAMA 1EWCA 3R8BA 3TEXA 1D6EC 3TEWA 3KWVA 2W3SA 1SE4A 1OFFA 1RM6C 4ZOHC 2VZKD 2MH7A 2PTLA 3Q8AA 1FRDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1BML C;  1QQR A;  1C4P A;  1L4Z B;  1L4D B; 
#chains in the Genus database with same CATH topology
 4FBJ B;  2HTH A;  4GMV A;  3RNA C;  2KD0 A;  2KQ7 A;  2KWC A;  3R2I A;  4BVU C;  4FXC A;  3ZGZ A;  2WQY B;  5HKH A;  1EWY C;  2BQQ A;  2BTE A;  1WIA A;  2WXN A;  2R61 A;  1JQ4 A;  2E6X A;  1TBE A;  3DBL B;  3Q3F A;  1LO5 D;  2C5L C;  3MC0 B;  1AW7 A;  4IOI E;  5BYR A;  4I6P A;  3W9C B;  1UD7 A;  1GB4 A;  3KUD B;  3TL5 A;  4ANV A;  4P6V F;  2L83 A;  1TYG B;  2NBU A;  1WZ0 A;  3VFK A;  2SEB D;  3I63 C;  2L1A A;  1XCQ L;  3NZU A;  3JSV B;  4N58 A;  2D10 A;  4KIK A;  2J0K A;  4NNJ B;  1FCC C;  4WJO A;  1EF1 A;  3Q2A C;  2OJW A;  1QLB B;  2WP9 B;  2KC1 A;  4HPP A;  1FXT B;  4P1C C;  1RFK A;  1FIQ A;  2J53 A;  4HDO A;  1V49 A;  2M8S A;  4D2K A;  1VZ7 A;  2Q5W D;  2MX2 A;  2JY6 A;  1Z2M A;  5BYQ A;  1MHH E;  1NBF C;  2ON8 A;  5TSS A;  4DHJ D;  4HWI B;  1MVK A;  2LXA A;  4GN1 A;  3A1Q B;  1SIF A;  2V9H A;  1OEY A;  1XQQ A;  1DOI A;  2KHW B;  1J7B A;  3V60 A;  4PS8 A;  3APC A;  2MWS B;  3L16 A;  1C4C A;  1EF5 A;  1BT0 A;  1D3Z A;  3DHG C;  4A90 A;  1V1P B;  2ZW0 A;  1MPE A;  3N32 A;  2KFJ A;  3A9J A;  2LHD A;  1E9M A;  1YJ1 A;  1ET6 A;  1MHX A;  5CHW A;  1WGD A;  1WGR A;  1UZX B;  4F8C B;  1V1P A;  5AZH A;  3T3O A;  1R4M I;  3GE3 C;  3FC4 A;  5G5G A;  4ZRP A;  1L6U A;  2MBH A;  2FCM A;  3R3M A;  1C4P A;  5IOI A;  3L10 B;  2JT4 B;  1IBX B;  2JF5 A;  1SJH D;  1SGH A;  2L32 A;  2KZR A;  4KV2 A;  3GS2 A;  1YJJ A;  2N7J A;  1GUA B;  5D3D A;  4JLC A;  5LXH A;  1JWA D;  1ZW7 A;  4RGN A;  3Q3J A;  3N20 C;  2Z0D B;  3RCZ A;  2FID A;  3R7R A;  3H6N A;  4DHZ E;  2NBV B;  4LCD E;  2IYD B;  4LDT D;  3W1Y A;  2KT7 A;  2NS5 A;  4CHK A;  3HUI A;  1KJT A;  4A6Q A;  1RLF A;  3AE2 B;  1D5Z C;  1P1A A;  3L54 A;  1C1Y B;  4DXF A;  2BS4 B;  2J52 A;  4BFR A;  3BY4 B;  3PVL A;  1PUT A;  2IY1 B;  3H7S A;  2IO1 B;  4IW0 A;  4YSY B;  3MC9 A;  1WJN A;  2RD0 A;  2QEJ C;  1MJD A;  2A4Z A;  2BGF A;  3HIZ A;  1GG3 A;  1AWD A;  1E8Y A;  2DAF A;  1WMH B;  1WR6 E;  3V05 A;  1L7Y A;  1BXT A;  1IPG A;  4G50 A;  2KKC A;  1R4N B;  2LGI A;  2KYW A;  3V6C B;  1WX7 A;  4ZRJ A;  3DCG A;  4JIO U;  2L0T A;  3AEF B;  1F77 A;  2FCQ A;  1KFY B;  2EKI A;  3UQA A;  4H2A A;  1N62 A;  1TY2 A;  2J0J A;  2KDM A;  2I1J A;  2HJ8 A;  3M3J A;  1WGG A;  3NY5 A;  3VUW A;  3WIM A;  2KLC A;  3AE3 B;  3ZDM C;  4II3 B;  2JXT A;  1PQS A;  1ZXH A;  3PRE A;  3WA0 A;  2JRI B;  2ZPY A;  3ZNH B;  5G5H A;  2MSE D;  1UUP A;  2KLG A;  3PZD A;  4FAD A;  3SFE B;  2MBE A;  3AU5 A;  2MCN B;  2KJR A;  1F0Z A;  2LVO A;  3RI7 C;  1HTQ A;  2K25 A;  2W9N A;  1YN3 A;  1KLG D;  1NYR A;  2N1W A;  2G4D B;  5IKC M;  3HVD A;  1EU3 A;  4W9C A;  1NI3 A;  3ZNZ B;  1J0G A;  5HG2 A;  1K53 A;  1V86 A;  4I6N B;  1QIL A;  3VTV A;  2EMS A;  3U52 E;  2KFK B;  4XZ4 A;  4BBN C;  1L0X B;  3VUX A;  3SHQ A;  2ZCC A;  5JZE B;  3MJ5 A;  4RGO S;  1WGY A;  3ONS A;  1P3Q U;  3K9O B;  3BIN A;  2JUO A;  3UGB B;  1YD8 U;  3VH4 B;  2AQ2 B;  5H92 C;  4W9F A;  1IUE A;  1LM8 B;  3ZRC A;  1TS3 A;  2AQ3 B;  4KSL C;  3OAW A;  2N9P C;  2WU2 B;  5T8I A;  3ZRF A;  2MBQ A;  3O65 B;  5HI1 A;  2WXH A;  4HCN B;  3LYY A;  3U4E G;  3I3T B;  2ZCB A;  4C7Z A;  2K6Q A;  4NY0 A;  3Q8F A;  2AX5 A;  3PPA A;  1E8X A;  3T9L A;  2RDB C;  2ZZP B;  3WAO A;  2JZZ A;  2N9L A;  3PT2 B;  3KWL A;  2PMV A;  1J8C A;  1WZ3 A;  2K8C A;  1ZDV A;  1L0V B;  3L13 A;  3PO0 A;  2WGS A;  2WXJ A;  3IBE A;  4TUU A;  1ACC A;  1WXV A;  2WX1 A;  4HRO A;  3N1Y C;  4BKT A;  5IA7 A;  3ALB A;  5D94 A;  4FJZ A;  2IGD A;  2H89 B;  1B1Z A;  1M4V A;  2K8B A;  2NBW B;  2Y3A A;  5L83 A;  3M95 A;  4HVB A;  2H88 B;  4BKG A;  2OED A;  3ZYY X;  2HE7 A;  2INP E;  1I7H A;  1SF0 A;  2PKO A;  3UIO B;  3ZDT A;  3UF8 A;  2LUM A;  2YEP B;  2BB5 A;  2O2V A;  2BYV E;  4L2Y A;  3UIP B;  2EEL A;  3SEB A;  4K7W A;  2IND C;  3E56 A;  3I9V 1;  4RF1 A;  4PYZ A;  5CTR C;  4PK1 A;  1XLN A;  1WXQ A;  3OWE B;  2V3P A;  1V97 A;  1TS4 A;  2CS4 A;  1TGZ B;  3KWV A;  3KYC D;  1OFF A;  1RM6 C;  2LAS A;  4DHJ B;  1I35 A;  2MH7 A;  3Q8A A;  4FJY A;  5IO9 A;  5HFY A;  3CF6 E;  1JWB D;  2L52 A;  2MW5 A;  4USA A;  2RR9 A;  4IKG A;  4P16 A;  5C1Z A;  4ASW C;  4WH4 A;  3ZNI D;  1PGX A;  1GAQ B;  2X8X X;  4MM3 A;  2CHZ A;  1T3Q A;  4XYC A;  2WXQ A;  4LNN A;  4NAW A;  1C79 A;  3L4P A;  2MP2 B;  1TZ1 A;  5CHF A;  2IO0 B;  1FPY A;  2DZM A;  4IM0 A;  3ZTC A;  2JWU A;  4X57 B;  3H7P A;  4ACF A;  1XF5 L;  2B76 B;  3A4R A;  2DEN B;  1V80 A;  4KVG B;  2FE8 A;  2W3R A;  2WXL A;  1KH0 A;  2WS3 B;  2A5U A;  2FAZ A;  4KKJ A;  1H4R A;  1WE6 A;  2K39 A;  1C76 A;  4NZL B;  1EUV B;  1PFD A;  2DBY A;  2RPV A;  4IWO A;  4NQK E;  4GSW A;  2LRU A;  1ISN A;  3RNB C;  1LGR A;  1QOB A;  3HHM A;  1E0Z A;  1N61 A;  4ZHP A;  4MSQ B;  1U4A A;  2JX5 A;  3P4P B;  2RMM A;  2DX5 B;  4ZYS A;  2IDY A;  1YOV B;  5E6O A;  4DXG A;  3A4S C;  2K1F A;  4MDK E;  4JL9 A;  3NVY A;  4ANU A;  4M8M A;  1G6J A;  2IO2 B;  2BB6 A;  2IZV B;  4ZRK A;  4IDI A;  3TUO A;  2PJH A;  2CHW A;  2L0F A;  2FCN A;  1FM0 D;  3L08 A;  1ZDX A;  2BT6 A;  3PRP B;  1WE7 A;  4WJQ A;  4CYE A;  3ZUN A;  2EKE C;  3VTW A;  1GC7 A;  4JX1 C;  1XO3 A;  5LNK 1;  1YN5 A;  3NOB A;  1UBQ A;  2GBR A;  5D6J B;  5C2T B;  4FHK A;  4RCO A;  4FHJ A;  4XDC A;  4HXD A;  2CJO A;  3SDL C;  2KAC A;  4W9I A;  3DBR B;  3AEG B;  4O1N A;  4DWF A;  1WR1 A;  1N60 A;  3MTN B;  2GBM A;  2HTM E;  3APD A;  4G11 A;  4TSS A;  2BKR B;  1V81 A;  1FMA D;  2IGG A;  1E7U A;  3HVZ A;  4W9J A;  3JVZ X;  3TEZ A;  2J7Q B;  5CHV C;  3RD2 A;  3URY A;  2QHO A;  5AUI A;  1JAL A;  2K9X A;  3RNF C;  1YJI A;  5AUK A;  3V3X A;  5FR6 A;  1GOZ A;  1Q1O A;  2BYF A;  4W9H A;  1E7P B;  4FJV B;  3DVN V;  1ESF A;  3NZ3 A;  3VDZ A;  1UF0 A;  3Q6B A;  1HQR D;  1L5P A;  5IP4 D;  1KLV A;  2V3S A;  3TEY A;  1Q10 A;  3DBS A;  2M56 B;  1VZ8 A;  1C77 A;  2DYM A;  3VRB B;  3I5J C;  3KW5 B;  1WMH A;  3SFD B;  2M1M A;  1BUI C;  4DQO C;  4AJY B;  4BOZ B;  3KUZ A;  4A3O A;  1AAR A;  1V2Y A;  2LI5 A;  2ZVO A;  2LXC A;  1V8C A;  1R4M B;  1MFW A;  3LJ3 A;  2KJH B;  5DPR A;  4GIV A;  2Y5P A;  2JVC A;  3MP9 A;  5BO4 B;  4LLG M;  4MGI E;  2WXI A;  1EM7 A;  2L00 B;  2YLM A;  2KMA A;  4EE2 A;  2DLB A;  4FA6 A;  1FO4 A;  2KAJ A;  1WF9 A;  3P4S B;  3RZW C;  3QAR A;  2C7M B;  2WYQ A;  5EE1 A;  1KF6 B;  3ZLZ A;  3HM3 A;  4XC2 A;  3NVW A;  3JYU A;  3U8Z A;  1WJ6 A;  3DDC B;  2O6V D;  4W9G A;  3ZXR A;  1JWS D;  2IGH A;  1IBX A;  2MEK A;  3BK2 A;  3AEB B;  1Y56 A;  3RYT A;  3KLS X;  2Z8L A;  4IWP A;  2HD5 B;  2MJE A;  4LNI A;  4L1B A;  2PVO D;  3AE8 B;  4YTN B;  4XGA B;  3RNG C;  4K7U A;  1QOF A;  3B0A A;  3C19 A;  1L2N A;  2L76 A;  3LXF A;  2WWZ A;  2KOX A;  4C00 A;  1IYF A;  2G4S A;  2CU1 A;  5DPW A;  4M0W B;  2LGD A;  1MG8 A;  3DOW A;  5GMV A;  4PS3 A;  1YQ3 B;  2DWQ A;  1V5O A;  1F52 A;  2GBN A;  4MSM B;  2KN4 A;  3N1Z C;  1S1Q B;  5H8Y E;  4BBN F;  2JU6 X;  1I42 A;  1FCL A;  4ZHO A;  2KNB A;  4EFO A;  1F9J A;  2SAK A;  2WDR B;  4BAX A;  2MA9 B;  1ET9 A;  3KYD D;  1KM7 A;  4US9 A;  2KDF B;  1SJE D;  1WM2 A;  3BWU D;  4REZ A;  4KKI A;  5E6N A;  2QIL A;  3P4R B;  3RT3 B;  1JRO A;  3DBL I;  3L0W B;  4LNF A;  4NQL B;  2LGS A;  3Q14 C;  1UEL A;  2ACZ B;  3ZJT A;  4WQO B;  1WXM A;  3RFZ B;  1KLU D;  2KQ4 X;  5IN7 A;  2KVZ A;  1ZUD 2;  4E74 A;  3AB5 A;  2W54 A;  2KVR A;  2DYB A;  4HKZ E;  4KSK C;  4IWQ A;  1UNS A;  4MEM A;  1UH6 A;  2ICI A;  4AOF A;  3V61 A;  2I1K A;  4YL8 A;  3Q8E A;  1L4Z B;  3GE8 C;  4JWS C;  3ZKJ C;  1SIJ A;  1OQQ A;  3ETR A;  4L23 A;  1K8R B;  1I4P A;  1K51 A;  4UDU C;  3L17 A;  5JHB A;  1E10 A;  4GDK B;  4HDQ A;  2N9K A;  5BYS A;  1VD2 A;  3VUY A;  2QC8 A;  1I4R A;  2N9X A;  3OJ4 B;  2GRI A;  2D3G A;  4NJ7 A;  1AYF A;  1LXD A;  4B9K A;  2KTR B;  3BYT B;  3S2A A;  3H7P B;  3WAN A;  4RMA A;  4EKU A;  1SSN A;  4Q2J A;  4OZB A;  3OG5 A;  3DQV A;  2I38 A;  3A1Q A;  1QKZ A;  3VR8 B;  2LMC A;  3RN9 C;  2V3N A;  3PHW B;  2MJD A;  1CK1 A;  3AE1 B;  4FLH A;  4KGR A;  1NYQ A;  1WGH A;  5EE0 A;  1FNW A;  2IPK D;  2C7H A;  3EC8 A;  1UGJ A;  1T0Q C;  2ZVN A;  2JZ3 B;  3EFC A;  1S3S G;  1FEH A;  1WRD B;  3GB1 A;  4RH6 A;  4QAY A;  4WUR A;  4DHZ B;  2UWQ A;  2KXJ A;  2AEH A;  3U2S C;  2MBB B;  3RZF A;  1EWC A;  3VH3 B;  4BZA A;  3TEX A;  2D3A A;  3TEW A;  2XBB C;  3JSV A;  3DVG Y;  1HE8 A;  1YX5 B;  2LZ6 A;  1FRD A;  2LWP A;  1E90 A;  1J19 A;  1T0R C;  3Q3M C;  1IGC A;  4MAC A;  1YIW A;  2NTT A;  2NPT A;  2PLP A;  4GGQ A;  1XCT L;  1J7A A;  1BML C;  4PS7 A;  3WAL A;  1TKY A;  2E3T A;  4TQ0 A;  2NMQ A;  4LNO A;  2MRP A;  5KHQ A;  4G3X B;  1P7F A;  2JYT A;  4W9E A;  1C3T A;  4KDI C;  2M19 A;  1XD3 B;  1P0R A;  1XT9 B;  2PIA A;  3OJ3 A;  3MJW A;  3PRM B;  4C7Y A;  2OOB B;  3EGR A;  4HJK A;  2LJ5 A;  3AMZ A;  3NS8 A;  2JWZ A;  1EU4 A;  1A70 A;  2KMC A;  4MM3 B;  3AEE B;  4LNK A;  2VH1 A;  5GXG B;  2RDH A;  3J9C A;  3U30 A;  2R2Q A;  5E6J A;  3C8Y A;  4TMA B;  3AE6 B;  3AUL A;  3QK0 A;  4WWM A;  1E6E B;  3VVW B;  3D32 A;  1QZE A;  4AP4 C;  4RFB A;  2WXK A;  5HHD G;  4A9A A;  4KZ0 A;  2BS2 B;  2XK5 A;  1WXA A;  3DVN U;  2FIF A;  4W9D A;  1AN8 A;  4M00 A;  2Z0E B;  4ZRI A;  1WYG A;  2HJ1 A;  3H1U A;  1LFD A;  3CWI A;  1OQY A;  1IP9 A;  3R2T A;  2L8J A;  1GNU A;  4ANW A;  1L6V A;  4AWJ A;  1KOT A;  2KTR A;  2GI9 A;  3EFU A;  2G45 B;  4HRS A;  4CO7 A;  2J4X A;  3BII D;  1B9R A;  3GZN B;  3T3N A;  3I57 A;  2KX3 A;  2D11 A;  4I6L B;  3Q69 A;  3NG0 A;  1VDV A;  4K7S A;  1JRP A;  2ZNV C;  3DBH B;  2DZK A;  4ARI A;  3K9P B;  2V1Y A;  3LDZ E;  4WJN A;  4DK5 A;  2FUH B;  3VXW A;  3PGE A;  3HM6 X;  1NDD A;  4LTU A;  4ZRQ A;  1FFU A;  2XNA C;  3U7Z A;  5BMI A;  2N7E A;  4RGT A;  4S17 A;  2K3U A;  2PVG C;  3KUC B;  4IM2 A;  2N1V A;  4WJP A;  3CMM B;  2OHF A;  3NHE B;  4GDK A;  1HZ6 A;  1GJZ A;  3U7D A;  2GOW A;  1VJK A;  2DZJ A;  2FCS A;  4KGS A;  5DPS A;  2WDV B;  5C3J B;  3NUH B;  4W9K A;  4JPS A;  3WAP A;  1P9D U;  2LVP A;  3M63 B;  1UWM A;  4RM8 A;  3AV8 A;  4N59 A;  4AUQ C;  4AS1 A;  2O6V B;  2WXF A;  1QF6 A;  1VRA B;  4KDL B;  2M0A A;  4B95 A;  1P7E A;  2EMT A;  4PT5 A;  3X23 A;  2UU7 A;  2IJ0 A;  2WDQ B;  4II2 B;  3JW0 X;  2BWF A;  1FXA A;  1YMH E;  2RDG A;  2JQR B;  2ZPN A;  4N6E B;  3ZQ4 A;  4PYU A;  1FFV A;  1SBB B;  2K5P A;  3AED B;  3H8H A;  4YXD B;  2ZJD A;  3WCQ A;  1WH3 A;  2IO3 B;  3NS1 A;  3ZNG C;  3NVV A;  4IUM B;  3SR6 A;  2CR5 A;  5E6P A;  1JML A;  3ABV B;  2LUE A;  3BVM A;  2WXO A;  3W5V B;  2BKF A;  2KDI A;  2L3Z A;  2LFI A;  2UYZ B;  2WXM A;  2XN9 C;  4CQN A;  4A3P A;  2M4N A;  2PE9 A;  2BWE S;  4RF0 A;  2KFK A;  4DDI D;  1N5W A;  1QOA A;  5J17 A;  3W1S A;  4XE0 A;  3AN1 A;  2K22 A;  3IHP C;  1FRR A;  2CU3 A;  3PRZ A;  3RNC C;  1FXI A;  4M02 A;  4WWN A;  4HJG E;  2V4L A;  1TIF A;  5D3I B;  1Q5W B;  4N9F 4;  4C4V B;  1SE2 A;  4ITK A;  2RGF A;  3AI5 A;  3N30 A;  1PYW D;  2ASQ A;  1JCK B;  3ZJU A;  1ZPS A;  4C56 C;  1ZOY B;  5MPO A;  3KH0 A;  4MEL A;  4MH0 E;  3HK0 A;  2GMI C;  3RNE C;  4LJP B;  2REX A;  5LLI A;  4C80 A;  2XK5 B;  2DAJ A;  3QIJ A;  4GB9 A;  2WXG A;  5FK9 C;  4JWU C;  1PDX A;  2D5G A;  3ZTD A;  3DBR I;  5EE9 A;  3IAS 1;  3ZJV A;  1M94 A;  3Q8C A;  1XEE A;  2JSV X;  2CHX A;  1WFY A;  3EUB 2;  4E71 A;  3IFW B;  1I4G A;  2X38 A;  3PTF C;  2BF8 B;  3FIL B;  2AQ1 B;  2QIE B;  2ZW1 A;  4BKS A;  2NCN A;  2PEA A;  2KAN A;  4F1S A;  2MHJ A;  3B1L X;  4KGT A;  3P4Q B;  3O13 A;  2QJL A;  4URK A;  1JRU A;  3X0W A;  3IG3 A;  2WU5 B;  4EEW A;  3PHX B;  3TBL D;  1NI2 A;  1NEN B;  2J0M A;  1WYW B;  2C9W B;  1ZP0 B;  2KDB A;  3QJZ A;  4LK0 M;  3P2B A;  1ZKH A;  3AXC A;  4OVZ A;  4GDL A;  4AJW A;  4YWG G;  3AU4 A;  1RWS A;  4LDT B;  2WX0 A;  5J2R A;  1KRH A;  3IT4 B;  3MHZ A;  4NJC A;  1N6Z A;  3FIL A;  2PE6 B;  4YT0 B;  2LHE A;  4OZC A;  3PZ7 A;  2OJR A;  2NR2 A;  2V0G A;  1MI0 A;  3DBH I;  4B6W A;  1WGK A;  1RAX A;  4XDD A;  1HEZ E;  4BOS C;  3IAM 1;  1SXT A;  2J42 A;  2AYO B;  3R7Q A;  1JW9 D;  1D5X C;  2Z59 B;  1PGA A;  2WNM A;  2WHI A;  4KX6 B;  5BMG A;  5L95 C;  3UQB A;  2M17 A;  2G3Q B;  2QCZ A;  1L4D B;  2MP2 A;  4MJS B;  3VTU A;  3APF A;  4KIK B;  5KHO A;  5BMH A;  1FNV A;  4HK2 A;  4MJS A;  1WXS A;  2C60 A;  4WAF A;  2G9H D;  2MQJ A;  3DHI C;  4GDL B;  4J3O D;  3PZ8 A;  3TIX A;  3Q3O C;  1YQB A;  3EA6 A;  3PS6 A;  4RGM A;  3LB8 C;  2KK8 A;  4A20 A;  2MJ3 A;  2AL3 A;  3AH7 A;  4OHJ A;  2ZEQ A;  1HXY D;  2I2Y A;  1SEB D;  3V62 A;  3M62 B;  3AE9 B;  4TV3 A;  3IT6 B;  3FKY A;  2L7R A;  2CKH B;  1OTR B;  3DWM A;  2W82 A;  1F1H A;  3IVF A;  3QHT A;  3QQ8 B;  3MFG A;  1I4H A;  1OEY J;  4NJ6 A;  3TJP A;  4US8 A;  4TQ1 A;  2D3B A;  5LXI B;  1QOG A;  2YVC A;  2N7D A;  4NAM A;  3R8B A;  4MGZ E;  2W3S A;  1SE4 A;  3ML8 A;  3Q3N C;  3EHV A;  2VZK D;  3PLV A;  2R2O A;  3ZIM A;  3B2G A;  1CJE A;  2RSU A;  4OVV A;  3DVG X;  3GOE A;  1YX6 B;  2KN5 A;  4ZYN A;  2LJI A;  1XLO A;  4GLS C;  4M8N A;  3VAW A;  4BKS D;  2G1E A;  2PW9 A;  1K52 A;  3ZXV A;  4LJO B;  1FNU A;  1VR9 A;  3HRD D;  3NZS A;  2INN E;  2GBK A;  3IXS A;  1OGW A;  3B9J A;  4XWW A;  4TKN A;  3UIN B;  5DCN A;  1K50 A;  1QQR A;  3AE7 B;  4HPL B;  1CZP A;  1LQB A;  3N1X C;  1ROE A;  4ARC A;  2VZK B;  1A5R A;  4GU2 A;  5AEK B;  1SE9 A;  4HEA 1;  3PLU A;  3E9S A;  3AE5 B;  1DYQ A;  1RRB A;  4HKQ A;  2O2V B;  1V9J A;  3KQ4 A;  1X1M A;  2KTF A;  5D7G A;  3AE4 B;  3VRA B;  1F2R C;  2KJ6 A;  1Z5S B;  4K81 A;  4OVU A;  3DWG C;  4XX5 A;  2JPH A;  4S0R A;  3ZO5 B;  2LD9 A;  4F7Z A;  3AM9 A;  2XEW A;  1GB1 A;  4MT5 A;  1HA5 A;  2BYE A;  2KDE B;  1YNT E;  1ENF A;  3ZW3 A;  4RM9 A;  2PPH A;  5J18 A;  3EEC A;  3TMP B;  2LVQ A;  1TY0 A;  3QC8 B;  3ML9 A;  2B3A A;  4HPM B;  4ANX A;  2DYO A;  4OW0 A;  3ENE A;  5D2M B;  1STE A;  3CIR B;  3Q8B A;  4ICV A;  3QA8 A;  4EOY A;  2INC C;  2LGX A;  1RFA A;  1VLB A;  2JZP A;  5FR3 A;  4NPN A;  2FNJ B;  1GC6 A;  2CJN A;  5AZF A;  5TR5 A;  5I4D A;  3VHT C;  2KMM A;  5C23 A;  2BBC A;  3BZD B;  3MC8 A;  1N5X A;  4HCP B;  2Y5B B;  4JGH B;  3RUI B;  1NVI D;  2KX0 A;  4EZL A;  2KWD A;  2JYE A;  3AEC B;  4HLE A;  1C9F A;  1JWU D;  1V5T A;  4IC7 B;  2LGY A;  1E8Z A;  1UGM A;  1EO6 A;  1IGD A;  1TKG A;  1XLQ A;  3KVF B;  5DPT A;  4RNA A;  2JRH A;  2WXP A;  1R4N I;  3BYY B;  1WI0 A;  2O6V A;  2LRW A;  2KWU B;  2L05 A;  1I4X A;  4M01 A;  4B0E A;  1XLP A;  2VH2 A;  2N0S B;  2D2Q A;  2BW2 A;  4WAA A;  1TJE A;  1QT9 A;  3MHS D;  1YQ4 B;  4K3C A;  4K3B A;  4EUT A;  1XXG A;  4MGY E;  4W9L A;  4G0N B;  3PV1 A;  2C7N B;  4ZDV A;  3CST A;  1KTK A;  3DHH C;  3W1S C;  1E7V A;  2FBW B;  3NRZ A;  3RMK C;  3DPD A;  1SE3 A;  1L0Y B;  4WWO A;  3A9K A;  1WRI A;  1HZ5 A;  1C4A A;  4YSX B;  4P1B C;  1WSP A;  2FUG 1;  4C4V A;  2QMT A;  1RYJ A;  1T6B X;  3N3K B;  5G2N A;  1D4B A;  5EDS A;  1ZE3 D;  2KO3 A;  2IY0 B;  3P42 A;  3BVG A;  2Y5C A;  2W55 A;  3QWZ B;  4P7I A;  3P63 A;  4DXA B;  3NVZ A;  3SD5 A;  2QDF A;  4DBG A;  2WXR A;  3WAM A;  1F2R I;  4K1R B;  3NJT A;  2D3C A;  1HTO A;  3N9Y C;  2K6D B;  5FKA C;  3ZVV A;  3P1M A;  2DZI A;  1TT5 B;  4MH8 A;  1JWM D;  4WWP A;  1CMX B;  3R66 C;  1Q0W B;  4EZK A;  3TSS A;  1FD6 A;  4YSZ B;  1C78 A;  2GBJ A;  1TKE A;  4GOC A;  4WQM A;  3A9K B;  3BVZ A;  2NVU I;  1OQR A;  1I4Q A;  2GLS A;  3PSE B;  1UWX A;  1J7C A;  2QSD A;  1V1O A;  4AQ7 A;  3A9J B;  4YTP B;  2TSS A;  4R3D A;  1P98 A;  2KWV B;  4J6I A;  5EE3 A;  3B08 A;  2GB1 A;  2VRR B;  3A33 B;  1TS2 A;  2N9E B;  3VQI A;  4JQW C;  4IM3 A;  2JXX A;  1N63 A;  1T0S C;  2WDT B;  2NPT B;  1T0Y A;  2DHZ A;  3BK1 A;  1H8C A;  2V4I B;  1WM3 A;  4NAW B;  1CQV A;  1WJ4 A;  3QX1 A;  2MBO A;  2K0P A;  2KC2 A;  3FAH A;  4FN2 A;  2AWT A;  4EZJ A;  1VZ6 A;  2ZNV B;  3AEA B;  3CSF A;  1TS5 A;  1TZO A;  3VR9 B;  1WX8 A;  2DNF A;  1T5X D;  1WJU A;  2MLB A;  1ZGU B;  1WX9 A;  3C0R B;  3T8M A;  4XWT A;  1E8W A;  1SB3 C;  4WIP A;  1MG4 A;  4DDG D;  3GZN I;  2BYT A;  3QCA A;  4MGK E;  5CX3 A;  2YEP F;  3RUL A;  3B2F A;  4A55 A;  1GPX A;  1WWT A;  1PGB A;  4ICU A;  3W5U B;  2BS3 B;  2K8H A;  4OZA A;  1Y8R C;  2HDE A;  4E3C A;  2RPQ A;  5G55 A;  2BPS A;  2AL6 A;  5JHA A;  4FUL A;  2IBI B;  2M0X A;  1E5W A;  4B0M A;  1DOX A;  4IG7 B;  3W2D A;  4A8X C;  1DGJ A;  2D07 B;  3H9D A;  1VCB A;  2WLB A;  2LEK A;  2ONQ A;  3V6E B;  5AZG A;  4YTM B;  3SU8 X;  2N4F A;  2NTS A;  1TTN A;  1NEK B;  1V6E A;  1DOY A;  3RPF C;  5JH5 C;  1R7S A;  4KZC A;  1D5M C;  3OLM D;  4JE3 B;  5JXV A;  1ZXI A;  3GP7 A;  2BVC A;  3UI3 A;  1UBI A;  3ECI A;  1YN4 A;  3TCA A;  4M0W A;  2KQS A;  1D6E C;  5IAA C;  4GXB A;  4ZOH C;  3QAQ A;  2PTL A;  1WY8 A; 
#chains in the Genus database with same CATH homology
 5HFY A;  1JWB D;  2L52 A;  4USA A;  3B2G A;  3R2I A;  1IGC A;  4FXC A;  4IKG A;  4MAC A;  4P16 A;  1CJE A;  3ZGZ A;  2WQY B;  2NTT A;  1EWY C;  2BTE A;  4WH4 A;  2PLP A;  2LJI A;  1PGX A;  1GAQ B;  1J7A A;  1BML C;  1XCT L;  2WXN A;  2R61 A;  1JQ4 A;  1XLO A;  2E6X A;  1TKY A;  4GLS C;  1T3Q A;  2E3T A;  4TQ0 A;  2G1E A;  1LO5 D;  2PW9 A;  1K52 A;  2NMQ A;  3MC0 B;  1AW7 A;  4IOI E;  5BYR A;  1FNU A;  1VR9 A;  3HRD D;  2WXQ A;  1P7F A;  2INN E;  2JYT A;  3W9C B;  1C79 A;  3L4P A;  3IXS A;  1GB4 A;  3B9J A;  4XWW A;  2M19 A;  4P6V F;  2L83 A;  1TYG B;  2JWU A;  1K50 A;  1QQR A;  3AE7 B;  2SEB D;  1XF5 L;  2B76 B;  1CZP A;  2PIA A;  1ROE A;  4ARC A;  2VZK B;  2FE8 A;  4C7Y A;  2W3R A;  3EGR A;  2WXL A;  1KH0 A;  2L1A A;  2WS3 B;  3AMZ A;  1XCQ L;  4N58 A;  1EU4 A;  1A70 A;  4MM3 B;  4KKJ A;  3AEE B;  4HEA 1;  2RDH A;  3J9C A;  5GXG B;  1C76 A;  1FCC C;  5E6J A;  3C8Y A;  4NZL B;  4TMA B;  1QLB B;  2WP9 B;  3AE6 B;  1PFD A;  4WWM A;  2DBY A;  2RPV A;  1RFK A;  1FIQ A;  1E6E B;  3E9S A;  4RFB A;  2WXK A;  5HHD G;  2J53 A;  3AE5 B;  4A9A A;  2BS2 B;  1DYQ A;  1QOB A;  4D2K A;  4HKQ A;  1VZ7 A;  2Q5W D;  1E0Z A;  1N61 A;  4ZHP A;  3KQ4 A;  1AN8 A;  2JX5 A;  3P4P B;  5D7G A;  2RMM A;  3AE4 B;  5BYQ A;  1MHH E;  2ON8 A;  5TSS A;  3VRA B;  4ZYS A;  1WYG A;  1MVK A;  1F2R C;  2IDY A;  3CWI A;  4DXG A;  1DOI A;  3NVY A;  3R2T A;  1J7B A;  1L6V A;  2BB6 A;  3DWG C;  4IDI A;  3TUO A;  2GI9 A;  1FM0 D;  1C4C A;  1ZDX A;  2BT6 A;  4HRS A;  2J4X A;  3BII D;  3AM9 A;  1B9R A;  1GB1 A;  4MT5 A;  3T3N A;  1HA5 A;  3I57 A;  4A90 A;  1V1P B;  2ZW0 A;  1YNT E;  1MPE A;  3Q69 A;  1ENF A;  4JX1 C;  1XO3 A;  5LNK 1;  1YN5 A;  1VDV A;  1JRP A;  4ARI A;  5C2T B;  1TY0 A;  2LHD A;  4RCO A;  1E9M A;  4XDC A;  2CJO A;  1ET6 A;  1MHX A;  2KAC A;  4LTU A;  4ZRQ A;  3AEG B;  1FFU A;  2XNA C;  4O1N A;  3U7Z A;  2DYO A;  4OW0 A;  1N60 A;  5BMI A;  4RGT A;  2K3U A;  2PVG C;  2HTM E;  1V1P A;  3T3O A;  1STE A;  2OHF A;  3CIR B;  3Q8B A;  3FC4 A;  5G5G A;  4ZRP A;  1L6U A;  1HZ6 A;  4TSS A;  1VJK A;  1C4P A;  1FMA D;  2IGG A;  1VLB A;  3HVZ A;  4KGS A;  2JZP A;  2WDV B;  5FR3 A;  5C3J B;  1IBX B;  3TEZ A;  3NUH B;  1SJH D;  2CJN A;  2L32 A;  4JPS A;  5I4D A;  2KMM A;  3URY A;  3GS2 A;  1YJJ A;  2N7J A;  5AUI A;  2BBC A;  3BZD B;  5D3D A;  1JAL A;  1JWA D;  1UWM A;  2K9X A;  4RGN A;  1YJI A;  1N5X A;  5AUK A;  3V3X A;  1GOZ A;  3AV8 A;  4N59 A;  4AS1 A;  2WXF A;  1E7P B;  1VRA B;  1QF6 A;  1NVI D;  3NZ3 A;  1ESF A;  2M0A A;  2KWD A;  1HQR D;  2JYE A;  1L5P A;  3AEC B;  3HUI A;  3TEY A;  1C9F A;  1P7E A;  1Q10 A;  1JWU D;  4PT5 A;  4A6Q A;  2M56 B;  3AE2 B;  1IGD A;  1TKG A;  2IJ0 A;  1D5Z C;  1XLQ A;  1VZ8 A;  1C77 A;  2WDQ B;  4DXF A;  2BS4 B;  4RNA A;  2DYM A;  2J52 A;  2WXP A;  3VRB B;  2RDG A;  1FXA A;  1YMH E;  2JQR B;  3BYY B;  4N6E B;  1PUT A;  3ZQ4 A;  1FFV A;  3SFD B;  1I4X A;  4YSY B;  1BUI C;  4B0E A;  4DQO C;  1XLP A;  2QEJ C;  1SBB B;  2K5P A;  3AED B;  3H8H A;  4YXD B;  2N0S B;  3WCQ A;  1AWD A;  2BW2 A;  1TJE A;  1QT9 A;  1YQ4 B;  3NS1 A;  3V05 A;  1BXT A;  3NVV A;  3SR6 A;  1XXG A;  1JML A;  3ABV B;  1V8C A;  2LGI A;  3BVM A;  2WXO A;  3W5V B;  2LFI A;  2WXM A;  2XN9 C;  4CQN A;  2Y5P A;  3AEF B;  3MP9 A;  1F77 A;  4LLG M;  1KFY B;  2EKI A;  1KTK A;  1N62 A;  1TY2 A;  4H2A A;  1EM7 A;  2KDM A;  2WXI A;  1N5W A;  2FBW B;  4RF0 A;  3NRZ A;  2DLB A;  4EE2 A;  1QOA A;  1FO4 A;  1SE3 A;  2KAJ A;  1L0Y B;  3P4S B;  3W1S A;  4XE0 A;  3AN1 A;  2K22 A;  1WRI A;  1HZ5 A;  1C4A A;  4YSX B;  1FRR A;  2CU3 A;  1WSP A;  2FUG 1;  5EE1 A;  2QMT A;  1KF6 B;  1RYJ A;  1T6B X;  3AE3 B;  1D4B A;  1FXI A;  3NVW A;  1ZE3 D;  4HJG E;  3P42 A;  3BVG A;  2Y5C A;  2JXT A;  2W55 A;  1ZXH A;  5D3I B;  3P63 A;  1SE2 A;  3NVZ A;  4ITK A;  5G5H A;  1UUP A;  1JWS D;  2IGH A;  2WXR A;  1IBX A;  1F2R I;  2MEK A;  1PYW D;  3BK2 A;  3AEB B;  1JCK B;  1Y56 A;  3ZJU A;  1ZPS A;  3SFE B;  3KLS X;  3N9Y C;  5FKA C;  4C56 C;  2Z8L A;  1ZOY B;  2MJE A;  5MPO A;  3P1M A;  1F0Z A;  4L1B A;  2PVO D;  1JWM D;  4MH8 A;  1YN3 A;  3AE8 B;  1KLG D;  1NYR A;  4YTN B;  3TSS A;  1FD6 A;  1QOF A;  4YSZ B;  1C78 A;  4C80 A;  3HVD A;  1EU3 A;  1NI3 A;  1TKE A;  2WXG A;  3LXF A;  5FK9 C;  5HG2 A;  1K53 A;  4JWU C;  1PDX A;  4WQM A;  2D5G A;  3BVZ A;  1OQR A;  5EE9 A;  1I4Q A;  3IAS 1;  3ZJV A;  1UWX A;  1J7C A;  3Q8C A;  1XEE A;  1V1O A;  2QSD A;  1QIL A;  2JSV X;  4AQ7 A;  4YTP B;  2TSS A;  3U52 E;  3EUB 2;  4R3D A;  1L0X B;  1I4G A;  1YQ3 B;  2X38 A;  3FIL B;  3MJ5 A;  4RGO S;  5EE3 A;  2AQ1 B;  2QIE B;  2GB1 A;  2ZW1 A;  2DWQ A;  1TS2 A;  2KN4 A;  3VQI A;  5H8Y E;  1N63 A;  2JU6 X;  4KGT A;  2AQ2 B;  3P4Q B;  3O13 A;  1FCL A;  2QJL A;  5H92 C;  4ZHO A;  1IUE A;  3BK1 A;  2SAK A;  2V4I B;  2WU5 B;  2WDR B;  1TS3 A;  1ET9 A;  2AQ3 B;  1NEN B;  4US9 A;  1SJE D;  1ZP0 B;  2WU2 B;  4NAW B;  5T8I A;  1CQV A;  4LK0 M;  3BWU D;  4OVZ A;  5HI1 A;  4YWG G;  4REZ A;  1RWS A;  4KKI A;  2K0P A;  2WXH A;  2QIL A;  3FAH A;  3LYY A;  3P4R B;  1KRH A;  3U4E G;  3IT4 B;  3MHZ A;  1JRO A;  4NJC A;  3FIL A;  4C7Z A;  3Q8F A;  1VZ6 A;  2AX5 A;  3AEA B;  4YT0 B;  2LHE A;  4OZC A;  3PZ7 A;  2V0G A;  1TS5 A;  1MI0 A;  1TZO A;  3VR9 B;  2ACZ B;  3ZJT A;  1WGK A;  1T5X D;  2N9L A;  3RFZ B;  1KLU D;  2KQ4 X;  4XWT A;  4XDD A;  1HEZ E;  3IAM 1;  1SXT A;  2J42 A;  1ZUD 2;  1SB3 C;  3AB5 A;  4WIP A;  2W54 A;  1JW9 D;  4HKZ E;  3KWL A;  2BYT A;  1D5X C;  1UNS A;  2PMV A;  2YEP F;  1PGA A;  3B2F A;  2ICI A;  2WNM A;  1ZDV A;  1L0V B;  4KX6 B;  3Q8E A;  5BMG A;  1L4Z B;  4A55 A;  3PO0 A;  2WXJ A;  1GPX A;  1WWT A;  4JWS C;  1PGB A;  1SIJ A;  1OQQ A;  3ETR A;  4L23 A;  1ACC A;  1L4D B;  3W5U B;  1I4P A;  1K51 A;  4HRO A;  4UDU C;  2BS3 B;  4OZA A;  1E10 A;  2HDE A;  4GDK B;  5BMH A;  1FNV A;  2IGD A;  2H89 B;  2N9K A;  5BYS A;  1B1Z A;  1I4R A;  1M4V A;  4WAF A;  2GRI A;  4B0M A;  2G9H D;  4GDL B;  1DOX A;  4J3O D;  1AYF A;  3PZ8 A;  3W2D A;  4A8X C;  3BYT B;  2Y3A A;  1DGJ A;  3EA6 A;  1SSN A;  4Q2J A;  2H88 B;  4OZB A;  4RGM A;  2OED A;  3ZYY X;  2LEK A;  2ONQ A;  2I38 A;  2WLB A;  1QKZ A;  2INP E;  1I7H A;  2MJ3 A;  2LMC A;  3LB8 C;  3VR8 B;  4YTM B;  3AH7 A;  4OHJ A;  1SF0 A;  1HXY D;  2PKO A;  2V3N A;  2MJD A;  2NTS A;  1CK1 A;  2LUM A;  3AE1 B;  2I2Y A;  2YEP B;  1SEB D;  1NEK B;  4KGR A;  2BB5 A;  1DOY A;  3RPF C;  1R7S A;  3AE9 B;  4L2Y A;  1NYQ A;  1D5M C;  2EEL A;  5EE0 A;  1FNW A;  2IPK D;  3IT6 B;  4JE3 B;  3SEB A;  1UGJ A;  5JXV A;  1ZXI A;  3DWM A;  3E56 A;  2W82 A;  3GP7 A;  3I9V 1;  4RF1 A;  3UI3 A;  1FEH A;  3MFG A;  3GB1 A;  4RH6 A;  4WUR A;  1I4H A;  1XLN A;  4US8 A;  1WXQ A;  1YN4 A;  3OWE B;  4TQ1 A;  4M0W A;  2V3P A;  1V97 A;  3U2S C;  1TS4 A;  1QOG A;  4NAM A;  1EWC A;  3R8B A;  3TEX A;  1D6E C;  3TEW A;  3KWV A;  2W3S A;  1SE4 A;  1OFF A;  1RM6 C;  4ZOH C;  2VZK D;  2MH7 A;  2PTL A;  3Q8A A;  1FRD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...