1QQRA

Crystal structure of streptokinase domain b
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
138
structure length
138
Chain Sequence
IQNQAKSVDVEYTVQFTPLNPDDDFRPGLKLTKLLKTLAIGDTITSQELLAQAQSILNKNHPGYTIYERDSSIVTHDNDIFRTILPMDQEFTYRVKNREQAYRINKKSGLNEEINNTDLISEKYYVLKKGEKPYDPFD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Crystal Structure of Streptokinse Domain B
rcsb
molecule tags Hydrolase activator
molecule keywords STREPTOKINASE DOMAIN B
total genus 35
structure length 138
sequence length 138
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 1999-06-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02821 Staphylokinase Staphylokinase/Streptokinase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.180 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1qqrA00
1L4DB 1L4ZB 1C4PA 1QQRA 1BMLC
chains in the Genus database with same CATH superfamily
3NJTA 1T5XD 1WGKA 3PT2B 1WZ3A 4YTMB 3I63C 3PHWB 3VR8B 4ASWC 4MSMB 1MJDA 2HDEA 3KLSX 1J7BA 3DHHC 1C1YB 2OEDA 1EO6A 3TJPA 3AEFB 3R8BA 3AEEB 4REZA 1RYJA 2KZRA 1WZ0A 2JWUA 1FIQA 3L4PA 4BBNF 4P16A 3DVGY 2BGFA 1HQRD 1WR1A 1I4QA 2DENB 2KQ7A 2DZMA 2JYTA 4FN2A 2V4IB 5JXVA 2X8XX 4G3XB 4L23A 4NQKE 1T6BX 1BMLC 3BVZA 1D5ZC 3IG3A 3DWGC 4C7YA 4HXDA 4A3PA 2A4ZA 3A33B 3RYTA 2DYBA 2DZKA 3N1XC 1VD2A 2BWFA 2M8SA 2ZPNA 1N60A 4MH0E 1WIAA 4HJKA 3Q14C 1FXAA 3NRZA 4W9CA 1H4RA 2ZEQA 3NHEB 4WH4A 1OGWA 2K25A 3JVZX 1QZEA 4IWQA 1WJ6A 3AMZA 4KZ0A 5FR6A 2IY1B 3SEBA 2DZJA 2LVOA 3L17A 4JIOU 2PW9A 1JWMD 1WRDB 1VLBA 2MBEA 3A1QA 1ZXHA 1WGRA 2AL3A 4XZ4A 4S17A 1YN3A 1BUIC 3ZVVA 4B0EA 2DAFA 2V1YA 3W1SA 4ZYNA 2PE9A 4HWIB 2TSSA 2RDBC 2MLBA 3NZSA 2V3SA 3CMMB 4P1CC 3T3NA 3KWVA 1VZ7A 4S0RA 4XGAB 4YTNB 1XLQA 1ISNA 5IP4D 3QHTA 1EU4A 1E7UA 1PGXA 1K50A 5LNK1 2BYEA 2W9NA 3OAWA 4LDTD 3RPFC 4AS1A 1R4NB 3L10B 5KHOA 5IKCM 4K7WA 1X1MA 4ZHPA 3NVVA 1E8YA 2JZPA 3K9OB 4LNNA 1HEZE 1CJEA 2OJWA 5IN7A 1S1QB 2D5GA 2FE8A 5FK9C 3R3MA 1T0QC 3T9LA 3IAM1 1WYWB 4FADA 3TUOA 4GIVA 2MRPA 3ZUNA 3GZNI 2KQ4X 3IT6B 3VAWA 3Q8BA 1KJTA 3Q3JA 3ENEA 4FHJA 5LLIA 4LJPB 4E3CA 2MQJA 1V6EA 3U8ZA 3MJ5A 1A5RA 3NZUA 1SBBB 3DBLI 3NVZA 4WIPA 5EE1A 3AE3B 1DOXA 3SFDB 4TQ1A 3BVGA 3N30A 3SD5A 4M8NA 2GBMA 1GB4A 1HTOA 4LNIA 1UELA 4OVUA 4RCOA 3DQVA 3PSEB 3P4QB 1GOZA 5E6JA 3ZTCA 3GS2A 1MG4A 3VTUA 3EECA 2W3SA 2RDGA 2ZPYA 4DBGA 2KC1A 1P0RA 2RPVA 1E7PB 3H7SA 1CMXB 4EEWA 4WQOB 1TKGA 1NVID 4L1BA 1VCBA 3H8HA 3ML9A 1EUVB 2K0PA 4GB9A 1R4NI 2Y3AA 1XO3A 2K39A 4LNKA 2EMTA 3O13A 2FCMA 1WMHB 3M95A 2D3CA 5GMVA 3V3XA 5IAAC 5CHVC 1C78A 3Q8FA 4IM0A 4US8A 1N5WA 4TMAB 4B0MA 2MJDA 4MSQB 4YL8A 2LGYA 1QOFA 5G5GA 2AX5A 2INCC 4W9JA 1DYQA 4EKUA 2FUHB 1V8CA 2J52A 3N20C 2QIEB 3AE2B 1U4AA 2MP2A 3L13A 2N9KA 4XWTA 4ZRJA 2RD0A 4GN1A 1YX6B 3K9PB 4B95A 2REXA 3ZTDA 2KDMA 2JRHA 4EZLA 4US9A 3ZRFA 1WJNA 4IC7B 5EE0A 1HA5A 1L4DB 1Q0WB 2G9HD 1TS4A 1Q1OA 2BB5A 1I4GA 2LUMA 2VZKB 1QF6A 1ZXIA 2NS5A 3GB1A 3TEWA 1L2NA 1QQRA 2M4NA 1CK1A 2ZCCA 2NCNA 5HG2A 1L0XB 1P9DU 4GOCA 1UD7A 4NAWB 2JWZA 4RF1A 3ZW3A 1C79A 2N9PC 2LD9A 1IBXA 5D6JB 3V62A 4QAYA 5J17A 2MP2B 4BVUC 2L7RA 2K9XA 5JHAA 5CX3A 1IGDA 3Q3NC 4NAWA 1LO5D 1XLNA 1SIFA 4P6VF 3I5JC 4FLHA 1FRRA 1PFDA 1WF9A 1SEBD 2JZZA 4KDLB 2KK8A 5C1ZA 1HE8A 2L32A 2WXKA 2MBBB 1T0RC 4DWFA 2EKIA 1WXSA 2GOWA 3ZNGC 1XT9B 1MI0A 4GU2A 2WDQB 4HDQA 4YSZB 4H2AA 3JSVA 1GJZA 1XF5L 1UWXA 1ZP0B 1F0ZA 1PQSA 4JPSA 4FJYA 4ANWA 3ZYYX 1I35A 2MH7A 2JT4B 1C4CA 2KOXA 3VUXA 2MJ3A 3MJWA 1HZ6A 3PZDA 2N7JA 4AJWA 1OFFA 1FFUA 1TBEA 3GE3C 2WX1A 1IP9A 4RGTA 2ICIA 2K5PA 4E74A 4TQ0A 4N59A 1I4RA 4BKTA 2H88B 3AEDB 1VDVA 4MGZE 2FUG1 2BT6A 2KTFA 4XDCA 2WGSA 5C23A 3PV1A 2N9LA 2YVCA 4II3B 4NPNA 4GXBA 1WGYA 4FJVB 2KMAA 2KYWA 1FFVA 3AEGB 3SDLC 2WP9B 3TEYA 4OZCA 3I57A 3X0WA 4MT5A 3AM9A 1RFKA 1D6EC 2EMSA 2J42A 5AEKB 1XD3B 3VTWA 3H6NA 2ZZPB 1GC7A 2LHDA 3RZFA 1SXTA 3RNEC 1TS5A 2PIAA 3C0RB 1STEA 3U2SC 2DNFA 2PVGC 1NYRA 3Q8CA 1C4PA 4XE0A 4DHZE 1C3TA 4RM9A 2PKOA 4N9F4 1QLBB 4X57B 4RNAA 4KZCA 2CU3A 4NAMA 2BPSA 2BS4B 1E8WA 3NOBA 2EELA 2C7MB 4KSLC 4GSWA 3MTNB 4BOZB 3A9KA 4F7ZA 3SFEB 3R7RA 1PDXA 3N1ZC 2LWPA 2QHOA 2WU2B 3NS1A 3MC8A 3ZNID 1BXTA 1UUPA 3KVFB 2D11A 1WXQA 4GDLB 1VZ6A 2KN5A 4HKZE 1C9FA 4LDTB 2BS3B 4RGOS 1WJUA 2JX5A 1NDDA 4HPMB 4YTPB 4D2KA 3RMKC 3C8YA 4A20A 4CQNA 3RNGC 4DXAB 1P7EA 2YLMA 5EE9A 1RFAA 4KKIA 1QOAA 3RNAC 1J8CA 3EA6A 3Q3FA 2ON8A 1QT9A 2V3NA 1MPEA 2Y5PA 1ZDXA 2GBJA 2B3AA 1FMAD 1IBXB 4ICVA 2FCSA 1WSPA 1TKYA 1C4AA 1QILA 2NMQA 2QCZA 4LNOA 1L0VB 4A9AA 4L2YA 3CIRB 1GG3A 1P7FA 1YNTE 3WIMA 1TZ1A 1PUTA 2ACZB 3H9DA 1I7HA 2BS2B 4WJNA 5BMIA 3ZJVA 1RM6C 2BQQA 2W82A 1VZ8A 2LFIA 1WYGA 3VXWA 2DAJA 3TBLD 2KFKA 3H7PB 2DZIA 5H92C 2VZKD 1YJJA 1T0YA 1F1HA 1V1OA 4I6LB 3HM6X 3RULA 4G50A 2GI9A 4WJPA 4WAAA 3DVNU 3TSSA 2XK5B 1NEKB 1Q10A 3NZ3A 3OG5A 3H1UA 3IVFA 1ZPSA 5HKHA 2MA9B 5TSSA 2JUOA 2O2VB 3AE5B 2LJ5A 4MACA 2I1JA 4K3CA 2HTME 2WXJA 2KJ6A 4MH8A 2IO3B 4OZAA 2HD5B 4KGRA 3HHMA 2SAKA 2JXXA 2LVPA 1WXAA 4M8MA 3OJ3A 5D7GA 5AUIA 3M3JA 4MGYE 1WX8A 1WE6A 2WWZA 4CYEA 2MBHA 3WCQA 5E6PA 4ARIA 1SB3C 2HJ1A 1C76A 3W2DA 3VR9B 3OWEB 2AQ3B 4RFBA 3BK2A 4I6PA 3RNBC 4DDGD 3RN9C 3QARA 2KDFB 1WFYA 2KKCA 4UDUC 2QSDA 1ROEA 2KT7A 3AE6B 3QA8A 4N6EB 1XLPA 1WGHA 4URKA 4ANUA 2PLPA 3DHGC 2Y5BB 1JWAD 4JE3B 2WXGA 1K51A 1UWMA 3TMPB 3VH4B 3CWIA 5BYQA 3P1MA 2N1WA 4DDID 2WXMA 1WXVA 4HKQA 2LI5A 1P3QU 2J0MA 4PS3A 2KQSA 2MX2A 1EU3A 4K7UA 3A4SC 3UF8A 1GPXA 2K6DB 4F8CB 1KLVA 1LXDA 1GUAB 2V9HA 2FCQA 3DBRB 2C7NB 3UQAA 1XXGA 4GDLA 2WXHA 5DPRA 2PEAA 1YQ4B 3AU4A 1FCLA 2KFJA 4K3BA 1TT5B 5CTRC 3Q2AC 1ACCA 2WYQA 2ZVOA 1RWSA 1WM2A 2DX5B 2LZ6A 2KN4A 2JY6A 1NBFC 5DPSA 4GMVA 3Q3OC 3ZRCA 3V05A 1A70A 2LXCA 2V0GA 3B2FA 3AECB 1WGGA 4XYCA 2JXTA 4N58A 4ZYSA 3QK0A 2DYOA 3QJZA 2JZ3B 1UGMA 2BKRB 4JQWC 1N63A 3VUYA 4DHJB 1TZOA 1V81A 5BO4B 2CS4A 2WXLA 2AWTA 5JHBA 2BB6A 1GB1A 3JW0X 2N9EB 2PVOD 3ZGZA 4RF0A 4HPLB 2D3GA 5E6OA 2KMMA 4C56C 2CJOA 4G11A 1KRHA 3R7QA 2GBRA 4GGQA 1V97A 3BY4B 3BZDB 2VRRB 2K8BA 3VRAB 2FCNA 3RT3B 1SE2A 3ZLZA 1V1PB 2RR9A 3QWZB 4W9IA 4WAFA 1F52A 2N7EA 2J0KA 2PE6B 3B0AA 1WXMA 3ETRA 3M63B 2CHXA 1V9JA 2MWSB 5CHFA 2AQ1B 4HDOA 1RRBA 1YN4A 4PYZA 2PMVA 2MHJA 3AEAB 3MHZA 1V49A 3KUDB 4AUQC 3DBSA 2L8JA 5GXGB 2KHWB 3W1SC 3AE7B 1G6JA 2M1MA 3EC8A 3O65B 2X38A 4MGKE 2XNAC 4FULA 1TKEA 3LXFA 5MPOA 1F9JA 2MW5A 2KDBA 2KDIA 4I6NB 2XK5A 4IKGA 4LK0M 2JQRB 2LJIA 5AZFA 3ZJTA 3ALBA 2E6XA 5IA7A 2RSUA 4LJOB 5AZHA 3FKYA 1HTQA 1PGBA 3A4RA 2WNMA 2KD0A 3L16A 1AARA 2AEHA 2D3AA 3ZDTA 1F77A 4W9EA 2KO3A 3SR6A 4W9FA 3MHSD 1YD8U 2KTRA 2JSVX 3KYCD 4KDIC 1FNUA 3TEZA 2Q5WD 3LB8C 4G0NB 3WAPA 3U7ZA 3R2IA 3OLMD 3WAMA 3X23A 4AJYB 3FC4A 4BKGA 1L6VA 2L0TA 4PK1A 2NBVB 4DQOC 2M19A 2N9XA 3V60A 2KACA 3JSVB 4IUMB 4ZOHC 2OOBB 3HUIA 1SJED 2ASQA 2NTTA 4W9KA 4KX6B 4DHJD 3JYUA 3LJ3A 2K8CA 4A8XC 2WXNA 2ZNVB 3U7DA 1JWSD 3IAS1 3TEXA 1D5MC 1TGZB 2IGDA 1OQYA 1NI3A 1YJ1A 3KH0A 4RH6A 3EHVA 2QDFA 4TV3A 4WURA 3AE8B 3KYDD 3RNFC 3PHXB 2DBYA 2UU7A 2J7QB 1E6EB 3VFKA 2LGIA 2KTRB 1LQBA 1AN8A 3APCA 1EF5A 1JALA 4W9GA 2CKHB 1MHHE 1M94A 1WH3A 5HI1A 2NBUA 4KV2A 3KQ4A 2KLGA 2KLCA 4IM2A 1C77A 1UBIA 4ZRKA 2G45B 2WDTB 3DDCB 2HJ8A 4M01A 1YX5B 3APDA 3ONSA 1E0ZA 1TY0A 2WXFA 1JW9D 2KJHB 4IG7B 4IDIA 5JZEB 2Z0EB 4NQLB 2J0JA 2KDEB 4HCNB 2IY0B 1FCCC 1CQVA 1UBQA 1Z2MA 2C9WB 3Q3MC 1YN5A 1GC6A 4WWMA 4OZBA 4K1RB 1J7CA 2V3PA 4NJ6A 4PT5A 2MEKA 4PYUA 4W9DA 4C00A 2KFKB 4EZJA 2QMTA 4LLGM 1YOVB 3IT4B 1KTKA 1L7YA 2Z0DB 4LTUA 2LUEA 3AV8A 3DWMA 4FJZA 2BYVE 3BINA 3MFGA 4IWPA 1KOTA 4W9HA 2BKFA 2WDRB 2CJNA 3L0WB 3P4SB 2FNJB 3ZNZB 2XBBC 1TJEA 1IUEA 1I42A 2IJ0A 3RZWC 4ZDVA 2CHZA 1DOIA 2FAZA 1B9RA 3U30A 4GDKB 2WHIA 2OJRA 1TIFA 1IPGA 3W9CB 1ZE3D 3PO0A 2R2OA 2N1VA 2D2QA 1E9MA 1P98A 1UH6A 5D3IB 2O6VA 1WX9A 3EFCA 3T3OA 3H7PA 4HLEA 1JWBD 3LYYA 1KH0A 4TKNA 2UWQA 3T8MA 2IO1B 5T8IA 3TCAA 4WWNA 5BYRA 1P1AA 3BYTB 1XCTL 5HHDG 2I1KA 1HZ5A 3PLUA 3PVLA 2IPKD 2K6QA 3M62B 2BYTA 1SSNA 1E7VA 1I4XA 3QCAA 3VUWA 1F2RI 4AQ7A 3B2GA 2VH1A 2KWUB 3AU5A 4E71A 2IYDB 1LFDA 3DPDA 3WANA 2FBWB 3CSFA 3BVMA 1D4BA 3AULA 1ET9A 3PREA 2WX0A 3V61A 1RAXA 4AP4C 3QC8B 4W9LA 1TY2A 2WLBA 1FRDA 1K53A 3DBHI 3GE8C 2R61A 3RNCC 3V6EB 1JRPA 3VVWB 4MELA 5D94A 2UYZB 2L05A 3DVGX 3DVNV 2GMIC 3ZIMA 1I4HA 2L0FA 3WALA 4AWJA 4RGNA 1XLOA 5AUKA 1SE3A 2LHEA 4YT0B 1PYWD 4WJOA 1YMHE 3VH3B 1YJIA 2JPHA 1KFYB 4BZAA 3ML8A 4GLSC 4ANXA 4C4VA 2BTEA 4HCPB 3N32A 2YEPB 4YSXB 3WA0A 5KHQA 4JWSC 2PTLA 2PJHA 1F2RC 2LVQA 2G4DB 2KWDA 1CZPA 2Z59B 2AYOB 4RGMA 5J18A 4M00A 1J0GA 4O1NA 4RMAA 4BKSA 2K8HA 2M0XA 1ZW7A 3UIPB 1YQ3B 1JROA 3MC9A 3PTFC 5D3DA 2INNE 2LXAA 4ARCA 4OVZA 2BYFA 2XN9C 5EE3A 1IGCA 2DHZA 3MP9A 4CHKA 2NR2A 5JH5C 4MM3A 3BIID 3P42A 4NNJB 1EM7A 2KVZA 3J9CA 4DXFA 1QOBA 1XQQA 3AN1A 3P4RB 3ZKJC 2W54A 1I4PA 1WWTA 1JMLA 1Z5SB 5L83A 1MFWA 3CSTA 5C3JB 3W1YA 1TS3A 2E3TA 1JCKB 4C80A 1UNSA 2NBWB 5D2MB 4A55A 1WR6E 5AZGA 1ZOYB 1E90A 2MBQA 1UZXB 3VRBB 2L1AA 2LASA 2ZVNA 3AE1B 1ET6A 2I38A 2KXJA 1EWCA 2H89B 4A3OA 1XEEA 2C7HA 4M0WB 4GDKA 4M02A 2IGHA 1VJKA 3A9KB 4TSSA 1DOYA 4FBJB 1TTNA 1E8XA 3AI5A 4R3DA 2NVUI 1LGRA 3FILB 5G2NA 2CU1A 3KW5B 1OEYJ 2M0AA 3E56A 4LNFA 2VH2A 1Y8RC 3AE4B 5LXHA 3AH7A 3HVDA 3I9V1 2INPE 4DK5A 1SIJA 2GLSA 2WS3B 2L76A 2O6VB 1R4MI 2N4FA 3L54A 3HIZA 2DLBA 3NVYA 1NI2A 1WMHA 1K8RB 3QIJA 4BKSD 1FXTB 4IW0A 4XWWA 4DHZB 2L00B 4KIKB 1WJ4A 2QEJC 4JWUC 4ZRPA 2MSED 5J2RA 4BOSC 2FIDA 5LXIB 2KX0A 5C2TB 4FHKA 2BVCA 4MJSB 3BYYB 3KUZA 2K1FA 1SE9A 3BK1A 1L4ZB 1DGJA 1VR9A 2C60A 2GBKA 4ITKA 1KM7A 4IWOA 1R4MB 3BWUD 1OTRB 2WDVB 4PS8A 2MBOA 3ABVB 3VTVA 1L0YB 4A90A 4OW0A 3CF6E 1Q5WB 1S3SG 2QC8A 3EFUA 2KNBA 2L3ZA 2LGSA 2O2VA 3W5UB 3ZDMC 2G1EA 4WJQA 4JL9A 2DYMA 4YWGG 1AW7A 3WAOA 1FNVA 1E10A 3D32A 5HFYA 1H8CA 1N61A 2W3RA 5IO9A 3NVWA 3V6CB 4Q2JA 4II2B 3R66C 3ZJUA 3A1QB 1BT0A 2WXQA 4AOFA 3GOEA 2M56B 3OJ4B 5IOIA 1WRIA 1V2YA 3RUIB 1YIWA 3Q6BA 1WY8A 5EDSA 2OHFA 5BYSA 4YSYB 1ZGUB 4XDDA 2BF8B 1UGJA 2RMMA 4B6WA 2LEKA 3Q69A 2INDC 1MHXA 2JU6X 2KWVB 3MC0B 2FIFA 2LMCA 3B08A 2GBNA 3HRDD 3PRPB 2LRWA 2ZW0A 2NTSA 3AEBB 1N6ZA 1FPYA 4HK2A 3PRMB 1J19A 2ZJDA 3QQ8B 1TYGB 4C4VB 3QX1A 1TS2A 3UI3A 2GRIA 1E8ZA 3KWLA 2N0SB 1V5TA 2KX3A 1T3QA 3PGEA 2RPQA 2JRIB 4WWPA 2DWQA 2J4XA 2JF5A 1B1ZA 3W5VB 4CO7A 4ZRIA 2JYEA 1QOGA 2KWCA 2I2YA 2B76B 1E5WA 3B9JA 2XEWA 4HEA1 3C19A 1FXIA 3N9YC 2BBCA 1Y56A 3P63A 1GAQB 3FILA 1V80A 2AQ2B 2KMCA 5CHWA 1WX7A 1L6UA 1KLUD 2JVCA 1HXYD 2A5UA 3GP7A 4MGIE 2M17A 3U4EG 2YEPF 4TUUA 4EE2A 1GNUA 5DPTA 3SHQA 1UF0A 3DHIC 4MEMA 3GZNB 3I3TB 1AYFA 3DBLB 4WWOA 3U52E 2IGGA 2WQYB 4NJ7A 4BBNC 3DBRI 4J6IA 3PZ8A 4FXCA 4KIKA 5E6NA 2LGDA 4NZLB 4KGTA 1M4VA 2PPHA 4XC2A 3RCZA 1WGDA 4MJSA 3PS6A 4IOIE 3ZXVA 3TIXA 3N1YC 3PRZA 1J7AA 1N62A 2CHWA 4EUTA 4LCDE 1OQQA 1D5XC 1FEHA 1ZDVA 3A9JB 4USAA 4ACFA 2LRUA 1PGAA 1ESFA 1YQBA 3Q8AA 3RFZB 2QILA 5FR3A 3ZXRA 4FA6A 3B1LX 4JX1C 5G55A 2LGXA 1SGHA 3UIOB 3EGRA 3IHPC 3IXSA 4NY0A 3R2TA 2EKEC 2K3UA 1V86A 5FKAC 4ZRQA 3EUB2 4DXGA 2D10A 2D07B 4P7IA 2V4LA 2N7DA 1XCQL 4F1SA 3ZO5B 3L08A 1JWUD 1K52A 5BMGA 2GB1A 1D3ZA 4JLCA 4OVVA 1FM0D 2Z8LA 3UGBB 4EOYA 3KUCB 3VQIA 3RI7C 2KC2A 2HE7A 2G3QB 4KVGB 4NJCA 4HVBA 3NUHB 1V1PA 2IDYA 1ZUD2 1WI0A 2RGFA 2BWES 4WQMA 3ECIA 4XX5A 1QKZA 4K81A 1NYQA 1JRUA 2NPTA 4OHJA 3NG0A 2IO0B 3QAQA 2MCNB 3SU8X 4C7ZA 2AL6A 2D3BA 2ONQA 4ZHOA 1RLFA 4B9KA 3N3KB 1SJHD 2NPTB 2K22A 4PS7A 2WXOA 3VHTC 1EF1A 4KSKC 4BAXA 2IO2B 3IFWB 4HRSA 1SE4A 4P1BC 3NY5A 1T0SC 2L83A 3LDZE 4IM3A 5TR5A 4RM8A 5L95C 3S2AA 1MVKA 4ANVA 2RDHA 5H8YE 1AWDA 3PZ7A 3UQBA 4BFRA 4J3OD 1MG8A 1IYFA 5G5HA 1KF6B 1ZKHA 2MJEA 4KGSA 2BW2A 1JQ4A 2WXIA 2HTHA 1L5PA 1NENB 3P2BA 3APFA 4EFOA 2L52A 1KLGD 3HVZA 2O6VD 1EWYC 2ZW1A 3ZNHB 3AB5A 3TL5A 3Q8EA 5BMHA 2IBIB 2KAJA 1R7SA 4HPPA 1N5XA 3AE9B 4MM3B 1FO4A 4HJGE 5I4DA 1OEYA 1OQRA 3HK0A 3URYA 4K7SA 4ICUA 4MDKE 2KANA 1ENFA 5DPWA 4A6QA 4EZKA 2ZNVC 1V5OA 3PPAA 3DBHB 2Y5CA 5DCNA 2KVRA 3UINB 3PLVA 3A9JA 4JGHB 2IZVB 1WE7A 3E9SA 1FNWA 1LM8B 1SF0A 4YXDB 2WXRA 2WXPA 2W55A 2QJLA 2R2QA 3FAHA 3P4PB 2ZCBA 1FD6A 4M0WA 4HROA 3VDZA 3ZQ4A 2CR5A 1VRAB 3AXCA 2KJRA 2J53A 3RD2A 3HM3A 2C5LC 1WM3A 2G4SA 2SEBD 3DOWA 3NS8A 4KKJA 3DCGA 2WU5B 3IBEA
chains in the Genus database with same CATH topology
1FFVA 3BYYB 1T5XD 2JSVX 3AEGB 3BK1A 1L4ZB 1WGKA 1DGJA 1VR9A 2WP9B 4YTMB 3TEYA 4ITKA 1FNUA 4OZCA 3I57A 3TEZA 2Q5WD 4MT5A 3LB8C 3VR8B 3BWUD 2WDVB 3AM9A 1RFKA 1D6EC 2HDEA 2J42A 3ABVB 3U7ZA 3KLSX 3R2IA 1J7BA 1L0YB 4A90A 3FC4A 4OW0A 1L6VA 2OEDA 2LHDA 1SXTA 1TS5A 4DQOC 2PIAA 3AEFB 1STEA 3R8BA 2M19A 3U2SC 3AEEB 2PVGC 1NYRA 4REZA 2KACA 1RYJA 3Q8CA 1C4PA 3W5UB 2G1EA 2JWUA 4ZOHC 4XE0A 1FIQA 3L4PA 3HUIA 1SJED 2PKOA 2NTTA 4P16A 1QLBB 2DYMA 4KX6B 1HQRD 4RNAA 1AW7A 4YWGG 1FNVA 2CU3A 1E10A 4NAMA 1I4QA 5HFYA 4A8XC 2JYTA 1N61A 2WXNA 2V4IB 5JXVA 2W3RA 3NVWA 2BS4B 1JWSD 3IAS1 3TEXA 4Q2JA 4L23A 2EELA 3ZJUA 1T6BX 1D5MC 1BMLC 2IGDA 2WXQA 3BVZA 1D5ZC 3DWGC 4C7YA 1NI3A 3SFEB 1PDXA 2M56B 2WU2B 3NS1A 1WRIA 4RH6A 1BXTA 1UUPA 4WURA 3AE8B 1WXQA 2DBYA 1E6EB 1N60A 4GDLB 2LGIA 1FXAA 1VZ6A 3NRZA 1AN8A 2OHFA 5BYSA 4YSYB 4HKZE 4XDDA 1C9FA 4WH4A 1JALA 1UGJA 2RMMA 3AMZA 2LEKA 3Q69A 1MHHE 2JU6X 1MHXA 3MC0B 2BS3B 4RGOS 2LMCA 3SEBA 2JX5A 3HRDD 5HI1A 4YTPB 2PW9A 4D2KA 2ZW0A 1JWMD 2NTSA 3KQ4A 3C8YA 1C77A 1VLBA 3AEBB 4CQNA 1ZXHA 1P7EA 1TYGB 1YN3A 1BUIC 1TS2A 3UI3A 4B0EA 2GRIA 5EE9A 1E0ZA 1TY0A 4KKIA 3W1SA 2WXFA 1QOAA 1JW9D 2N0SB 3KWLA 3EA6A 2TSSA 4IDIA 2ON8A 1T3QA 1QT9A 2V3NA 1MPEA 2Y5PA 1ZDXA 1FMAD 1IBXB 2DWQA 2J4XA 3T3NA 1WSPA 1B1ZA 1FCCC 1TKYA 3KWVA 1CQVA 3W5VB 1VZ7A 2JYEA 4YTNB 1C4AA 1QOGA 1YN5A 1XLQA 2I2YA 1QILA 2NMQA 2B76B 4WWMA 1EU4A 1L0VB 1PGXA 1K50A 3B9JA 4L2YA 4HEA1 4OZBA 4A9AA 5LNK1 3CIRB 1P7FA 1YNTE 1J7CA 2V3PA 3RPFC 4AS1A 4PT5A 1FXIA 2MEKA 3N9YC 1PUTA 2ACZB 2BBCA 1I7HA 2BS2B 5BMIA 3ZJVA 1Y56A 1RM6C 4ZHPA 3NVVA 3P63A 2JZPA 2W82A 1GAQB 1HEZE 1CJEA 1VZ8A 2AQ2B 1WYGA 2LFIA 2QMTA 3FILA 4LLGM 3IT4B 5FK9C 1KTKA 2D5GA 2FE8A 4LTUA 3AV8A 3DWMA 1L6UA 3MFGA 5H92C 1KLUD 2VZKD 3IAM1 1HXYD 1YJJA 3GP7A 1V1OA 3TUOA 2GI9A 2WDRB 3U4EG 2CJNA 2YEPF 3P4SB 4EE2A 2KQ4X 3IT6B 1TJEA 3Q8BA 3TSSA 1IUEA 1NEKB 1AYFA 1Q10A 2IJ0A 1DOIA 3U52E 3MJ5A 2IGGA 2WQYB 1B9RA 3NZ3A 4GDKB 1SBBB 1ZPSA 3NVZA 5TSSA 3PZ8A 4WIPA 4FXCA 5EE1A 3AE3B 3AE5B 3W9CB 1DOXA 3SFDB 4TQ1A 1ZE3D 3BVGA 3PO0A 4NZLB 4KGTA 4MACA 1E9MA 1M4VA 2HTME 1GB4A 5D3IB 4IOIE 2WXJA 4RCOA 3T3OA 4MH8A 1J7AA 1JWBD 3LYYA 1KH0A 4OZAA 1N62A 4KGRA 1OQQA 3P4QB 1GOZA 1D5XC 1FEHA 2SAKA 5E6JA 5T8IA 1ZDVA 5BYRA 4USAA 1PGAA 1ESFA 3BYTB 3Q8AA 3GS2A 5D7GA 1XCTL 2QILA 5HHDG 1HZ5A 5AUIA 5FR3A 2W3SA 3RFZB 2IPKD 2RDGA 2BYTA 1SSNA 3WCQA 2RPVA 1E7PB 4JX1C 1I4XA 4ARIA 1SB3C 1C76A 3W2DA 3EGRA 3VR9B 3IXSA 1TKGA 1F2RI 4AQ7A 3B2GA 3OWEB 2AQ3B 3R2TA 4RFBA 3BK2A 1NVID 2K3UA 5FKAC 4ZRQA 3EUB2 4L1BA 2QSDA 1ROEA 3H8HA 4UDUC 2FBWB 4DXGA 3AE6B 2K0PA 1XCQL 3BVMA 4N6EB 1D4BA 1JWUD 1ET9A 1XLPA 1K52A 2Y3AA 5BMGA 1XO3A 2GB1A 2PLPA 3O13A 1FM0D 2Z8LA 1JWAD 3VQIA 4JE3B 3V3XA 1TY2A 2WLBA 1K51A 2WXGA 1FRDA 1UWMA 1K53A 1C78A 2R61A 3Q8FA 4US8A 1N5WA 1JRPA 4NJCA 4TMAB 3NUHB 1V1PA 2IDYA 1ZUD2 3CWIA 5BYQA 3P1MA 4B0MA 2MJDA 1I4HA 2WXMA 4HKQA 4WQMA 4RGNA 1XLOA 1QOFA 5G5GA 2AX5A 1QKZA 5AUKA 1SE3A 2LHEA 1DYQA 1NYQA 4YT0B 1EU3A 1PYWD 1V8CA 2J52A 1YMHE 4OHJA 1GPXA 1YJIA 2QIEB 3AE2B 1KFYB 2N9KA 4XWTA 4C7ZA 4GLSC 1XXGA 2BTEA 2ONQA 2WXHA 4ZHOA 1SJHD 2YEPB 1YQ4B 2K22A 4YSXB 1FCLA 2KDMA 4US9A 4JWSC 2PTLA 2WXOA 1F2RC 1ACCA 2KWDA 5EE0A 1CZPA 1RWSA 1HA5A 1L4DB 2KN4A 4RGMA 4O1NA 3V05A 1A70A 2G9HD 4HRSA 1SE4A 2V0GA 1TS4A 3B2FA 2BB5A 1I4GA 3AECB 2LUMA 2VZKB 2L83A 1YQ3B 1JROA 1QF6A 1ZXIA 2JXTA 5D3DA 4N58A 4ZYSA 2INNE 4ARCA 3GB1A 2DYOA 4OVZA 2XN9C 5EE3A 3TEWA 1IGCA 1MVKA 3MP9A 2RDHA 1N63A 1QQRA 5H8YE 1CK1A 1TZOA 1AWDA 3PZ7A 5HG2A 1L0XB 3BIID 3P42A 2WXLA 1EM7A 4NAWB 3J9CA 4J3OD 2BB6A 1GB1A 4DXFA 5G5HA 1QOBA 1KF6B 3AN1A 4RF1A 3P4RB 2W54A 3ZGZA 2MJEA 2PVOD 4KGSA 1C79A 2BW2A 1I4PA 1WWTA 1JQ4A 1JMLA 4RF0A 2WXIA 1L5PA 1IBXA 5C3JB 1NENB 2KMMA 4C56C 1TS3A 2E3TA 1JCKB 2K9XA 4C80A 1IGDA 2CJOA 1UNSA 1LO5D 1XLNA 1KRHA 4P6VF 2L52A 4A55A 1FRRA 1ZOYB 1V97A 1KLGD 3HVZA 1PFDA 3BZDB 3VRBB 1SEBD 2L1AA 1EWYC 2ZW1A 3AB5A 3VRAB 3AE1B 1ET6A 2I38A 1SE2A 3Q8EA 1EWCA 2H89B 2L32A 1XEEA 2WXKA 1V1PB 2EKIA 5BMHA 4WAFA 2KAJA 1R7SA 1MI0A 1N5XA 3AE9B 4MM3B 1FO4A 2IGHA 3ETRA 1VJKA 4HJGE 5I4DA 1OQRA 2WDQB 4TSSA 4YSZB 3URYA 1DOYA 4H2AA 2AQ1B 4R3DA 1ENFA 1XF5L 1YN4A 3FILB 2PMVA 3AEAB 1UWXA 1ZP0B 3MHZA 4A6QA 1F0ZA 4JPSA 5GXGB 2M0AA 3E56A 3AE7B 3ZYYX 2Y5CA 2MH7A 1C4CA 2MJ3A 3AE4B 2X38A 1HZ6A 2XNAC 3AH7A 3HVDA 3I9V1 1TKEA 2INPE 3LXFA 5MPOA 1SIJA 2N7JA 2WS3B 3E9SA 1FNWA 1OFFA 1FFUA 1SF0A 2WXRA 4YXDB 2WXPA 2W55A 2QJLA 2DLBA 3FAHA 3NVYA 3P4PB 4IKGA 4RGTA 1FD6A 4M0WA 4LK0M 4HROA 2JQRB 2ICIA 2K5PA 2LJIA 3ZQ4A 4N59A 4TQ0A 3ZJTA 2E6XA 4XWWA 1VRAB 1I4RA 2H88B 2J53A 1VDVA 3AEDB 1PGBA 2FUG1 2WNMA 2QEJC 2BT6A 4JWUC 4XDCA 4ZRPA 2SEBD 2N9LA 4KKJA 1F77A 2WU5B 5C2TB 3SR6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1L4D B;  1L4Z B;  1C4P A;  1QQR A;  1BML C; 
#chains in the Genus database with same CATH topology
 3NJT A;  1T5X D;  1WGK A;  3PT2 B;  1WZ3 A;  4YTM B;  3I63 C;  3PHW B;  3VR8 B;  4ASW C;  4MSM B;  1MJD A;  2HDE A;  3KLS X;  1J7B A;  3DHH C;  1C1Y B;  2OED A;  1EO6 A;  3TJP A;  3AEF B;  3R8B A;  3AEE B;  4REZ A;  1RYJ A;  2KZR A;  1WZ0 A;  2JWU A;  1FIQ A;  3L4P A;  4BBN F;  4P16 A;  3DVG Y;  2BGF A;  1HQR D;  1WR1 A;  1I4Q A;  2DEN B;  2KQ7 A;  2DZM A;  2JYT A;  4FN2 A;  2V4I B;  5JXV A;  2X8X X;  4G3X B;  4L23 A;  4NQK E;  1T6B X;  1BML C;  3BVZ A;  1D5Z C;  3IG3 A;  3DWG C;  4C7Y A;  4HXD A;  4A3P A;  2A4Z A;  3A33 B;  3RYT A;  2DYB A;  2DZK A;  3N1X C;  1VD2 A;  2BWF A;  2M8S A;  2ZPN A;  1N60 A;  4MH0 E;  1WIA A;  4HJK A;  3Q14 C;  1FXA A;  3NRZ A;  4W9C A;  1H4R A;  2ZEQ A;  3NHE B;  4WH4 A;  1OGW A;  2K25 A;  3JVZ X;  1QZE A;  4IWQ A;  1WJ6 A;  3AMZ A;  4KZ0 A;  5FR6 A;  2IY1 B;  3SEB A;  2DZJ A;  2LVO A;  3L17 A;  4JIO U;  2PW9 A;  1JWM D;  1WRD B;  1VLB A;  2MBE A;  3A1Q A;  1ZXH A;  1WGR A;  2AL3 A;  4XZ4 A;  4S17 A;  1YN3 A;  1BUI C;  3ZVV A;  4B0E A;  2DAF A;  2V1Y A;  3W1S A;  4ZYN A;  2PE9 A;  4HWI B;  2TSS A;  2RDB C;  2MLB A;  3NZS A;  2V3S A;  3CMM B;  4P1C C;  3T3N A;  3KWV A;  1VZ7 A;  4S0R A;  4XGA B;  4YTN B;  1XLQ A;  1ISN A;  5IP4 D;  3QHT A;  1EU4 A;  1E7U A;  1PGX A;  1K50 A;  5LNK 1;  2BYE A;  2W9N A;  3OAW A;  4LDT D;  3RPF C;  4AS1 A;  1R4N B;  3L10 B;  5KHO A;  5IKC M;  4K7W A;  1X1M A;  4ZHP A;  3NVV A;  1E8Y A;  2JZP A;  3K9O B;  4LNN A;  1HEZ E;  1CJE A;  2OJW A;  5IN7 A;  1S1Q B;  2D5G A;  2FE8 A;  5FK9 C;  3R3M A;  1T0Q C;  3T9L A;  3IAM 1;  1WYW B;  4FAD A;  3TUO A;  4GIV A;  2MRP A;  3ZUN A;  3GZN I;  2KQ4 X;  3IT6 B;  3VAW A;  3Q8B A;  1KJT A;  3Q3J A;  3ENE A;  4FHJ A;  5LLI A;  4LJP B;  4E3C A;  2MQJ A;  1V6E A;  3U8Z A;  3MJ5 A;  1A5R A;  3NZU A;  1SBB B;  3DBL I;  3NVZ A;  4WIP A;  5EE1 A;  3AE3 B;  1DOX A;  3SFD B;  4TQ1 A;  3BVG A;  3N30 A;  3SD5 A;  4M8N A;  2GBM A;  1GB4 A;  1HTO A;  4LNI A;  1UEL A;  4OVU A;  4RCO A;  3DQV A;  3PSE B;  3P4Q B;  1GOZ A;  5E6J A;  3ZTC A;  3GS2 A;  1MG4 A;  3VTU A;  3EEC A;  2W3S A;  2RDG A;  2ZPY A;  4DBG A;  2KC1 A;  1P0R A;  2RPV A;  1E7P B;  3H7S A;  1CMX B;  4EEW A;  4WQO B;  1TKG A;  1NVI D;  4L1B A;  1VCB A;  3H8H A;  3ML9 A;  1EUV B;  2K0P A;  4GB9 A;  1R4N I;  2Y3A A;  1XO3 A;  2K39 A;  4LNK A;  2EMT A;  3O13 A;  2FCM A;  1WMH B;  3M95 A;  2D3C A;  5GMV A;  3V3X A;  5IAA C;  5CHV C;  1C78 A;  3Q8F A;  4IM0 A;  4US8 A;  1N5W A;  4TMA B;  4B0M A;  2MJD A;  4MSQ B;  4YL8 A;  2LGY A;  1QOF A;  5G5G A;  2AX5 A;  2INC C;  4W9J A;  1DYQ A;  4EKU A;  2FUH B;  1V8C A;  2J52 A;  3N20 C;  2QIE B;  3AE2 B;  1U4A A;  2MP2 A;  3L13 A;  2N9K A;  4XWT A;  4ZRJ A;  2RD0 A;  4GN1 A;  1YX6 B;  3K9P B;  4B95 A;  2REX A;  3ZTD A;  2KDM A;  2JRH A;  4EZL A;  4US9 A;  3ZRF A;  1WJN A;  4IC7 B;  5EE0 A;  1HA5 A;  1L4D B;  1Q0W B;  2G9H D;  1TS4 A;  1Q1O A;  2BB5 A;  1I4G A;  2LUM A;  2VZK B;  1QF6 A;  1ZXI A;  2NS5 A;  3GB1 A;  3TEW A;  1L2N A;  1QQR A;  2M4N A;  1CK1 A;  2ZCC A;  2NCN A;  5HG2 A;  1L0X B;  1P9D U;  4GOC A;  1UD7 A;  4NAW B;  2JWZ A;  4RF1 A;  3ZW3 A;  1C79 A;  2N9P C;  2LD9 A;  1IBX A;  5D6J B;  3V62 A;  4QAY A;  5J17 A;  2MP2 B;  4BVU C;  2L7R A;  2K9X A;  5JHA A;  5CX3 A;  1IGD A;  3Q3N C;  4NAW A;  1LO5 D;  1XLN A;  1SIF A;  4P6V F;  3I5J C;  4FLH A;  1FRR A;  1PFD A;  1WF9 A;  1SEB D;  2JZZ A;  4KDL B;  2KK8 A;  5C1Z A;  1HE8 A;  2L32 A;  2WXK A;  2MBB B;  1T0R C;  4DWF A;  2EKI A;  1WXS A;  2GOW A;  3ZNG C;  1XT9 B;  1MI0 A;  4GU2 A;  2WDQ B;  4HDQ A;  4YSZ B;  4H2A A;  3JSV A;  1GJZ A;  1XF5 L;  1UWX A;  1ZP0 B;  1F0Z A;  1PQS A;  4JPS A;  4FJY A;  4ANW A;  3ZYY X;  1I35 A;  2MH7 A;  2JT4 B;  1C4C A;  2KOX A;  3VUX A;  2MJ3 A;  3MJW A;  1HZ6 A;  3PZD A;  2N7J A;  4AJW A;  1OFF A;  1FFU A;  1TBE A;  3GE3 C;  2WX1 A;  1IP9 A;  4RGT A;  2ICI A;  2K5P A;  4E74 A;  4TQ0 A;  4N59 A;  1I4R A;  4BKT A;  2H88 B;  3AED B;  1VDV A;  4MGZ E;  2FUG 1;  2BT6 A;  2KTF A;  4XDC A;  2WGS A;  5C23 A;  3PV1 A;  2N9L A;  2YVC A;  4II3 B;  4NPN A;  4GXB A;  1WGY A;  4FJV B;  2KMA A;  2KYW A;  1FFV A;  3AEG B;  3SDL C;  2WP9 B;  3TEY A;  4OZC A;  3I57 A;  3X0W A;  4MT5 A;  3AM9 A;  1RFK A;  1D6E C;  2EMS A;  2J42 A;  5AEK B;  1XD3 B;  3VTW A;  3H6N A;  2ZZP B;  1GC7 A;  2LHD A;  3RZF A;  1SXT A;  3RNE C;  1TS5 A;  2PIA A;  3C0R B;  1STE A;  3U2S C;  2DNF A;  2PVG C;  1NYR A;  3Q8C A;  1C4P A;  4XE0 A;  4DHZ E;  1C3T A;  4RM9 A;  2PKO A;  4N9F 4;  1QLB B;  4X57 B;  4RNA A;  4KZC A;  2CU3 A;  4NAM A;  2BPS A;  2BS4 B;  1E8W A;  3NOB A;  2EEL A;  2C7M B;  4KSL C;  4GSW A;  3MTN B;  4BOZ B;  3A9K A;  4F7Z A;  3SFE B;  3R7R A;  1PDX A;  3N1Z C;  2LWP A;  2QHO A;  2WU2 B;  3NS1 A;  3MC8 A;  3ZNI D;  1BXT A;  1UUP A;  3KVF B;  2D11 A;  1WXQ A;  4GDL B;  1VZ6 A;  2KN5 A;  4HKZ E;  1C9F A;  4LDT B;  2BS3 B;  4RGO S;  1WJU A;  2JX5 A;  1NDD A;  4HPM B;  4YTP B;  4D2K A;  3RMK C;  3C8Y A;  4A20 A;  4CQN A;  3RNG C;  4DXA B;  1P7E A;  2YLM A;  5EE9 A;  1RFA A;  4KKI A;  1QOA A;  3RNA C;  1J8C A;  3EA6 A;  3Q3F A;  2ON8 A;  1QT9 A;  2V3N A;  1MPE A;  2Y5P A;  1ZDX A;  2GBJ A;  2B3A A;  1FMA D;  1IBX B;  4ICV A;  2FCS A;  1WSP A;  1TKY A;  1C4A A;  1QIL A;  2NMQ A;  2QCZ A;  4LNO A;  1L0V B;  4A9A A;  4L2Y A;  3CIR B;  1GG3 A;  1P7F A;  1YNT E;  3WIM A;  1TZ1 A;  1PUT A;  2ACZ B;  3H9D A;  1I7H A;  2BS2 B;  4WJN A;  5BMI A;  3ZJV A;  1RM6 C;  2BQQ A;  2W82 A;  1VZ8 A;  2LFI A;  1WYG A;  3VXW A;  2DAJ A;  3TBL D;  2KFK A;  3H7P B;  2DZI A;  5H92 C;  2VZK D;  1YJJ A;  1T0Y A;  1F1H A;  1V1O A;  4I6L B;  3HM6 X;  3RUL A;  4G50 A;  2GI9 A;  4WJP A;  4WAA A;  3DVN U;  3TSS A;  2XK5 B;  1NEK B;  1Q10 A;  3NZ3 A;  3OG5 A;  3H1U A;  3IVF A;  1ZPS A;  5HKH A;  2MA9 B;  5TSS A;  2JUO A;  2O2V B;  3AE5 B;  2LJ5 A;  4MAC A;  2I1J A;  4K3C A;  2HTM E;  2WXJ A;  2KJ6 A;  4MH8 A;  2IO3 B;  4OZA A;  2HD5 B;  4KGR A;  3HHM A;  2SAK A;  2JXX A;  2LVP A;  1WXA A;  4M8M A;  3OJ3 A;  5D7G A;  5AUI A;  3M3J A;  4MGY E;  1WX8 A;  1WE6 A;  2WWZ A;  4CYE A;  2MBH A;  3WCQ A;  5E6P A;  4ARI A;  1SB3 C;  2HJ1 A;  1C76 A;  3W2D A;  3VR9 B;  3OWE B;  2AQ3 B;  4RFB A;  3BK2 A;  4I6P A;  3RNB C;  4DDG D;  3RN9 C;  3QAR A;  2KDF B;  1WFY A;  2KKC A;  4UDU C;  2QSD A;  1ROE A;  2KT7 A;  3AE6 B;  3QA8 A;  4N6E B;  1XLP A;  1WGH A;  4URK A;  4ANU A;  2PLP A;  3DHG C;  2Y5B B;  1JWA D;  4JE3 B;  2WXG A;  1K51 A;  1UWM A;  3TMP B;  3VH4 B;  3CWI A;  5BYQ A;  3P1M A;  2N1W A;  4DDI D;  2WXM A;  1WXV A;  4HKQ A;  2LI5 A;  1P3Q U;  2J0M A;  4PS3 A;  2KQS A;  2MX2 A;  1EU3 A;  4K7U A;  3A4S C;  3UF8 A;  1GPX A;  2K6D B;  4F8C B;  1KLV A;  1LXD A;  1GUA B;  2V9H A;  2FCQ A;  3DBR B;  2C7N B;  3UQA A;  1XXG A;  4GDL A;  2WXH A;  5DPR A;  2PEA A;  1YQ4 B;  3AU4 A;  1FCL A;  2KFJ A;  4K3B A;  1TT5 B;  5CTR C;  3Q2A C;  1ACC A;  2WYQ A;  2ZVO A;  1RWS A;  1WM2 A;  2DX5 B;  2LZ6 A;  2KN4 A;  2JY6 A;  1NBF C;  5DPS A;  4GMV A;  3Q3O C;  3ZRC A;  3V05 A;  1A70 A;  2LXC A;  2V0G A;  3B2F A;  3AEC B;  1WGG A;  4XYC A;  2JXT A;  4N58 A;  4ZYS A;  3QK0 A;  2DYO A;  3QJZ A;  2JZ3 B;  1UGM A;  2BKR B;  4JQW C;  1N63 A;  3VUY A;  4DHJ B;  1TZO A;  1V81 A;  5BO4 B;  2CS4 A;  2WXL A;  2AWT A;  5JHB A;  2BB6 A;  1GB1 A;  3JW0 X;  2N9E B;  2PVO D;  3ZGZ A;  4RF0 A;  4HPL B;  2D3G A;  5E6O A;  2KMM A;  4C56 C;  2CJO A;  4G11 A;  1KRH A;  3R7Q A;  2GBR A;  4GGQ A;  1V97 A;  3BY4 B;  3BZD B;  2VRR B;  2K8B A;  3VRA B;  2FCN A;  3RT3 B;  1SE2 A;  3ZLZ A;  1V1P B;  2RR9 A;  3QWZ B;  4W9I A;  4WAF A;  1F52 A;  2N7E A;  2J0K A;  2PE6 B;  3B0A A;  1WXM A;  3ETR A;  3M63 B;  2CHX A;  1V9J A;  2MWS B;  5CHF A;  2AQ1 B;  4HDO A;  1RRB A;  1YN4 A;  4PYZ A;  2PMV A;  2MHJ A;  3AEA B;  3MHZ A;  1V49 A;  3KUD B;  4AUQ C;  3DBS A;  2L8J A;  5GXG B;  2KHW B;  3W1S C;  3AE7 B;  1G6J A;  2M1M A;  3EC8 A;  3O65 B;  2X38 A;  4MGK E;  2XNA C;  4FUL A;  1TKE A;  3LXF A;  5MPO A;  1F9J A;  2MW5 A;  2KDB A;  2KDI A;  4I6N B;  2XK5 A;  4IKG A;  4LK0 M;  2JQR B;  2LJI A;  5AZF A;  3ZJT A;  3ALB A;  2E6X A;  5IA7 A;  2RSU A;  4LJO B;  5AZH A;  3FKY A;  1HTQ A;  1PGB A;  3A4R A;  2WNM A;  2KD0 A;  3L16 A;  1AAR A;  2AEH A;  2D3A A;  3ZDT A;  1F77 A;  4W9E A;  2KO3 A;  3SR6 A;  4W9F A;  3MHS D;  1YD8 U;  2KTR A;  2JSV X;  3KYC D;  4KDI C;  1FNU A;  3TEZ A;  2Q5W D;  3LB8 C;  4G0N B;  3WAP A;  3U7Z A;  3R2I A;  3OLM D;  3WAM A;  3X23 A;  4AJY B;  3FC4 A;  4BKG A;  1L6V A;  2L0T A;  4PK1 A;  2NBV B;  4DQO C;  2M19 A;  2N9X A;  3V60 A;  2KAC A;  3JSV B;  4IUM B;  4ZOH C;  2OOB B;  3HUI A;  1SJE D;  2ASQ A;  2NTT A;  4W9K A;  4KX6 B;  4DHJ D;  3JYU A;  3LJ3 A;  2K8C A;  4A8X C;  2WXN A;  2ZNV B;  3U7D A;  1JWS D;  3IAS 1;  3TEX A;  1D5M C;  1TGZ B;  2IGD A;  1OQY A;  1NI3 A;  1YJ1 A;  3KH0 A;  4RH6 A;  3EHV A;  2QDF A;  4TV3 A;  4WUR A;  3AE8 B;  3KYD D;  3RNF C;  3PHX B;  2DBY A;  2UU7 A;  2J7Q B;  1E6E B;  3VFK A;  2LGI A;  2KTR B;  1LQB A;  1AN8 A;  3APC A;  1EF5 A;  1JAL A;  4W9G A;  2CKH B;  1MHH E;  1M94 A;  1WH3 A;  5HI1 A;  2NBU A;  4KV2 A;  3KQ4 A;  2KLG A;  2KLC A;  4IM2 A;  1C77 A;  1UBI A;  4ZRK A;  2G45 B;  2WDT B;  3DDC B;  2HJ8 A;  4M01 A;  1YX5 B;  3APD A;  3ONS A;  1E0Z A;  1TY0 A;  2WXF A;  1JW9 D;  2KJH B;  4IG7 B;  4IDI A;  5JZE B;  2Z0E B;  4NQL B;  2J0J A;  2KDE B;  4HCN B;  2IY0 B;  1FCC C;  1CQV A;  1UBQ A;  1Z2M A;  2C9W B;  3Q3M C;  1YN5 A;  1GC6 A;  4WWM A;  4OZB A;  4K1R B;  1J7C A;  2V3P A;  4NJ6 A;  4PT5 A;  2MEK A;  4PYU A;  4W9D A;  4C00 A;  2KFK B;  4EZJ A;  2QMT A;  4LLG M;  1YOV B;  3IT4 B;  1KTK A;  1L7Y A;  2Z0D B;  4LTU A;  2LUE A;  3AV8 A;  3DWM A;  4FJZ A;  2BYV E;  3BIN A;  3MFG A;  4IWP A;  1KOT A;  4W9H A;  2BKF A;  2WDR B;  2CJN A;  3L0W B;  3P4S B;  2FNJ B;  3ZNZ B;  2XBB C;  1TJE A;  1IUE A;  1I42 A;  2IJ0 A;  3RZW C;  4ZDV A;  2CHZ A;  1DOI A;  2FAZ A;  1B9R A;  3U30 A;  4GDK B;  2WHI A;  2OJR A;  1TIF A;  1IPG A;  3W9C B;  1ZE3 D;  3PO0 A;  2R2O A;  2N1V A;  2D2Q A;  1E9M A;  1P98 A;  1UH6 A;  5D3I B;  2O6V A;  1WX9 A;  3EFC A;  3T3O A;  3H7P A;  4HLE A;  1JWB D;  3LYY A;  1KH0 A;  4TKN A;  2UWQ A;  3T8M A;  2IO1 B;  5T8I A;  3TCA A;  4WWN A;  5BYR A;  1P1A A;  3BYT B;  1XCT L;  5HHD G;  2I1K A;  1HZ5 A;  3PLU A;  3PVL A;  2IPK D;  2K6Q A;  3M62 B;  2BYT A;  1SSN A;  1E7V A;  1I4X A;  3QCA A;  3VUW A;  1F2R I;  4AQ7 A;  3B2G A;  2VH1 A;  2KWU B;  3AU5 A;  4E71 A;  2IYD B;  1LFD A;  3DPD A;  3WAN A;  2FBW B;  3CSF A;  3BVM A;  1D4B A;  3AUL A;  1ET9 A;  3PRE A;  2WX0 A;  3V61 A;  1RAX A;  4AP4 C;  3QC8 B;  4W9L A;  1TY2 A;  2WLB A;  1FRD A;  1K53 A;  3DBH I;  3GE8 C;  2R61 A;  3RNC C;  3V6E B;  1JRP A;  3VVW B;  4MEL A;  5D94 A;  2UYZ B;  2L05 A;  3DVG X;  3DVN V;  2GMI C;  3ZIM A;  1I4H A;  2L0F A;  3WAL A;  4AWJ A;  4RGN A;  1XLO A;  5AUK A;  1SE3 A;  2LHE A;  4YT0 B;  1PYW D;  4WJO A;  1YMH E;  3VH3 B;  1YJI A;  2JPH A;  1KFY B;  4BZA A;  3ML8 A;  4GLS C;  4ANX A;  4C4V A;  2BTE A;  4HCP B;  3N32 A;  2YEP B;  4YSX B;  3WA0 A;  5KHQ A;  4JWS C;  2PTL A;  2PJH A;  1F2R C;  2LVQ A;  2G4D B;  2KWD A;  1CZP A;  2Z59 B;  2AYO B;  4RGM A;  5J18 A;  4M00 A;  1J0G A;  4O1N A;  4RMA A;  4BKS A;  2K8H A;  2M0X A;  1ZW7 A;  3UIP B;  1YQ3 B;  1JRO A;  3MC9 A;  3PTF C;  5D3D A;  2INN E;  2LXA A;  4ARC A;  4OVZ A;  2BYF A;  2XN9 C;  5EE3 A;  1IGC A;  2DHZ A;  3MP9 A;  4CHK A;  2NR2 A;  5JH5 C;  4MM3 A;  3BII D;  3P42 A;  4NNJ B;  1EM7 A;  2KVZ A;  3J9C A;  4DXF A;  1QOB A;  1XQQ A;  3AN1 A;  3P4R B;  3ZKJ C;  2W54 A;  1I4P A;  1WWT A;  1JML A;  1Z5S B;  5L83 A;  1MFW A;  3CST A;  5C3J B;  3W1Y A;  1TS3 A;  2E3T A;  1JCK B;  4C80 A;  1UNS A;  2NBW B;  5D2M B;  4A55 A;  1WR6 E;  5AZG A;  1ZOY B;  1E90 A;  2MBQ A;  1UZX B;  3VRB B;  2L1A A;  2LAS A;  2ZVN A;  3AE1 B;  1ET6 A;  2I38 A;  2KXJ A;  1EWC A;  2H89 B;  4A3O A;  1XEE A;  2C7H A;  4M0W B;  4GDK A;  4M02 A;  2IGH A;  1VJK A;  3A9K B;  4TSS A;  1DOY A;  4FBJ B;  1TTN A;  1E8X A;  3AI5 A;  4R3D A;  2NVU I;  1LGR A;  3FIL B;  5G2N A;  2CU1 A;  3KW5 B;  1OEY J;  2M0A A;  3E56 A;  4LNF A;  2VH2 A;  1Y8R C;  3AE4 B;  5LXH A;  3AH7 A;  3HVD A;  3I9V 1;  2INP E;  4DK5 A;  1SIJ A;  2GLS A;  2WS3 B;  2L76 A;  2O6V B;  1R4M I;  2N4F A;  3L54 A;  3HIZ A;  2DLB A;  3NVY A;  1NI2 A;  1WMH A;  1K8R B;  3QIJ A;  4BKS D;  1FXT B;  4IW0 A;  4XWW A;  4DHZ B;  2L00 B;  4KIK B;  1WJ4 A;  2QEJ C;  4JWU C;  4ZRP A;  2MSE D;  5J2R A;  4BOS C;  2FID A;  5LXI B;  2KX0 A;  5C2T B;  4FHK A;  2BVC A;  4MJS B;  3BYY B;  3KUZ A;  2K1F A;  1SE9 A;  3BK1 A;  1L4Z B;  1DGJ A;  1VR9 A;  2C60 A;  2GBK A;  4ITK A;  1KM7 A;  4IWO A;  1R4M B;  3BWU D;  1OTR B;  2WDV B;  4PS8 A;  2MBO A;  3ABV B;  3VTV A;  1L0Y B;  4A90 A;  4OW0 A;  3CF6 E;  1Q5W B;  1S3S G;  2QC8 A;  3EFU A;  2KNB A;  2L3Z A;  2LGS A;  2O2V A;  3W5U B;  3ZDM C;  2G1E A;  4WJQ A;  4JL9 A;  2DYM A;  4YWG G;  1AW7 A;  3WAO A;  1FNV A;  1E10 A;  3D32 A;  5HFY A;  1H8C A;  1N61 A;  2W3R A;  5IO9 A;  3NVW A;  3V6C B;  4Q2J A;  4II2 B;  3R66 C;  3ZJU A;  3A1Q B;  1BT0 A;  2WXQ A;  4AOF A;  3GOE A;  2M56 B;  3OJ4 B;  5IOI A;  1WRI A;  1V2Y A;  3RUI B;  1YIW A;  3Q6B A;  1WY8 A;  5EDS A;  2OHF A;  5BYS A;  4YSY B;  1ZGU B;  4XDD A;  2BF8 B;  1UGJ A;  2RMM A;  4B6W A;  2LEK A;  3Q69 A;  2IND C;  1MHX A;  2JU6 X;  2KWV B;  3MC0 B;  2FIF A;  2LMC A;  3B08 A;  2GBN A;  3HRD D;  3PRP B;  2LRW A;  2ZW0 A;  2NTS A;  3AEB B;  1N6Z A;  1FPY A;  4HK2 A;  3PRM B;  1J19 A;  2ZJD A;  3QQ8 B;  1TYG B;  4C4V B;  3QX1 A;  1TS2 A;  3UI3 A;  2GRI A;  1E8Z A;  3KWL A;  2N0S B;  1V5T A;  2KX3 A;  1T3Q A;  3PGE A;  2RPQ A;  2JRI B;  4WWP A;  2DWQ A;  2J4X A;  2JF5 A;  1B1Z A;  3W5V B;  4CO7 A;  4ZRI A;  2JYE A;  1QOG A;  2KWC A;  2I2Y A;  2B76 B;  1E5W A;  3B9J A;  2XEW A;  4HEA 1;  3C19 A;  1FXI A;  3N9Y C;  2BBC A;  1Y56 A;  3P63 A;  1GAQ B;  3FIL A;  1V80 A;  2AQ2 B;  2KMC A;  5CHW A;  1WX7 A;  1L6U A;  1KLU D;  2JVC A;  1HXY D;  2A5U A;  3GP7 A;  4MGI E;  2M17 A;  3U4E G;  2YEP F;  4TUU A;  4EE2 A;  1GNU A;  5DPT A;  3SHQ A;  1UF0 A;  3DHI C;  4MEM A;  3GZN B;  3I3T B;  1AYF A;  3DBL B;  4WWO A;  3U52 E;  2IGG A;  2WQY B;  4NJ7 A;  4BBN C;  3DBR I;  4J6I A;  3PZ8 A;  4FXC A;  4KIK A;  5E6N A;  2LGD A;  4NZL B;  4KGT A;  1M4V A;  2PPH A;  4XC2 A;  3RCZ A;  1WGD A;  4MJS A;  3PS6 A;  4IOI E;  3ZXV A;  3TIX A;  3N1Y C;  3PRZ A;  1J7A A;  1N62 A;  2CHW A;  4EUT A;  4LCD E;  1OQQ A;  1D5X C;  1FEH A;  1ZDV A;  3A9J B;  4USA A;  4ACF A;  2LRU A;  1PGA A;  1ESF A;  1YQB A;  3Q8A A;  3RFZ B;  2QIL A;  5FR3 A;  3ZXR A;  4FA6 A;  3B1L X;  4JX1 C;  5G55 A;  2LGX A;  1SGH A;  3UIO B;  3EGR A;  3IHP C;  3IXS A;  4NY0 A;  3R2T A;  2EKE C;  2K3U A;  1V86 A;  5FKA C;  4ZRQ A;  3EUB 2;  4DXG A;  2D10 A;  2D07 B;  4P7I A;  2V4L A;  2N7D A;  1XCQ L;  4F1S A;  3ZO5 B;  3L08 A;  1JWU D;  1K52 A;  5BMG A;  2GB1 A;  1D3Z A;  4JLC A;  4OVV A;  1FM0 D;  2Z8L A;  3UGB B;  4EOY A;  3KUC B;  3VQI A;  3RI7 C;  2KC2 A;  2HE7 A;  2G3Q B;  4KVG B;  4NJC A;  4HVB A;  3NUH B;  1V1P A;  2IDY A;  1ZUD 2;  1WI0 A;  2RGF A;  2BWE S;  4WQM A;  3ECI A;  4XX5 A;  1QKZ A;  4K81 A;  1NYQ A;  1JRU A;  2NPT A;  4OHJ A;  3NG0 A;  2IO0 B;  3QAQ A;  2MCN B;  3SU8 X;  4C7Z A;  2AL6 A;  2D3B A;  2ONQ A;  4ZHO A;  1RLF A;  4B9K A;  3N3K B;  1SJH D;  2NPT B;  2K22 A;  4PS7 A;  2WXO A;  3VHT C;  1EF1 A;  4KSK C;  4BAX A;  2IO2 B;  3IFW B;  4HRS A;  1SE4 A;  4P1B C;  3NY5 A;  1T0S C;  2L83 A;  3LDZ E;  4IM3 A;  5TR5 A;  4RM8 A;  5L95 C;  3S2A A;  1MVK A;  4ANV A;  2RDH A;  5H8Y E;  1AWD A;  3PZ7 A;  3UQB A;  4BFR A;  4J3O D;  1MG8 A;  1IYF A;  5G5H A;  1KF6 B;  1ZKH A;  2MJE A;  4KGS A;  2BW2 A;  1JQ4 A;  2WXI A;  2HTH A;  1L5P A;  1NEN B;  3P2B A;  3APF A;  4EFO A;  2L52 A;  1KLG D;  3HVZ A;  2O6V D;  1EWY C;  2ZW1 A;  3ZNH B;  3AB5 A;  3TL5 A;  3Q8E A;  5BMH A;  2IBI B;  2KAJ A;  1R7S A;  4HPP A;  1N5X A;  3AE9 B;  4MM3 B;  1FO4 A;  4HJG E;  5I4D A;  1OEY A;  1OQR A;  3HK0 A;  3URY A;  4K7S A;  4ICU A;  4MDK E;  2KAN A;  1ENF A;  5DPW A;  4A6Q A;  4EZK A;  2ZNV C;  1V5O A;  3PPA A;  3DBH B;  2Y5C A;  5DCN A;  2KVR A;  3UIN B;  3PLV A;  3A9J A;  4JGH B;  2IZV B;  1WE7 A;  3E9S A;  1FNW A;  1LM8 B;  1SF0 A;  4YXD B;  2WXR A;  2WXP A;  2W55 A;  2QJL A;  2R2Q A;  3FAH A;  3P4P B;  2ZCB A;  1FD6 A;  4M0W A;  4HRO A;  3VDZ A;  3ZQ4 A;  2CR5 A;  1VRA B;  3AXC A;  2KJR A;  2J53 A;  3RD2 A;  3HM3 A;  2C5L C;  1WM3 A;  2G4S A;  2SEB D;  3DOW A;  3NS8 A;  4KKJ A;  3DCG A;  2WU5 B;  3IBE A; 
#chains in the Genus database with same CATH homology
 1FFV A;  3BYY B;  1T5X D;  2JSV X;  3AEG B;  3BK1 A;  1L4Z B;  1WGK A;  1DGJ A;  1VR9 A;  2WP9 B;  4YTM B;  3TEY A;  4ITK A;  1FNU A;  4OZC A;  3I57 A;  3TEZ A;  2Q5W D;  4MT5 A;  3LB8 C;  3VR8 B;  3BWU D;  2WDV B;  3AM9 A;  1RFK A;  1D6E C;  2HDE A;  2J42 A;  3ABV B;  3U7Z A;  3KLS X;  3R2I A;  1J7B A;  1L0Y B;  4A90 A;  3FC4 A;  4OW0 A;  1L6V A;  2OED A;  2LHD A;  1SXT A;  1TS5 A;  4DQO C;  2PIA A;  3AEF B;  1STE A;  3R8B A;  2M19 A;  3U2S C;  3AEE B;  2PVG C;  1NYR A;  4REZ A;  2KAC A;  1RYJ A;  3Q8C A;  1C4P A;  3W5U B;  2G1E A;  2JWU A;  4ZOH C;  4XE0 A;  1FIQ A;  3L4P A;  3HUI A;  1SJE D;  2PKO A;  2NTT A;  4P16 A;  1QLB B;  2DYM A;  4KX6 B;  1HQR D;  4RNA A;  1AW7 A;  4YWG G;  1FNV A;  2CU3 A;  1E10 A;  4NAM A;  1I4Q A;  5HFY A;  4A8X C;  2JYT A;  1N61 A;  2WXN A;  2V4I B;  5JXV A;  2W3R A;  3NVW A;  2BS4 B;  1JWS D;  3IAS 1;  3TEX A;  4Q2J A;  4L23 A;  2EEL A;  3ZJU A;  1T6B X;  1D5M C;  1BML C;  2IGD A;  2WXQ A;  3BVZ A;  1D5Z C;  3DWG C;  4C7Y A;  1NI3 A;  3SFE B;  1PDX A;  2M56 B;  2WU2 B;  3NS1 A;  1WRI A;  4RH6 A;  1BXT A;  1UUP A;  4WUR A;  3AE8 B;  1WXQ A;  2DBY A;  1E6E B;  1N60 A;  4GDL B;  2LGI A;  1FXA A;  1VZ6 A;  3NRZ A;  1AN8 A;  2OHF A;  5BYS A;  4YSY B;  4HKZ E;  4XDD A;  1C9F A;  4WH4 A;  1JAL A;  1UGJ A;  2RMM A;  3AMZ A;  2LEK A;  3Q69 A;  1MHH E;  2JU6 X;  1MHX A;  3MC0 B;  2BS3 B;  4RGO S;  2LMC A;  3SEB A;  2JX5 A;  3HRD D;  5HI1 A;  4YTP B;  2PW9 A;  4D2K A;  2ZW0 A;  1JWM D;  2NTS A;  3KQ4 A;  3C8Y A;  1C77 A;  1VLB A;  3AEB B;  4CQN A;  1ZXH A;  1P7E A;  1TYG B;  1YN3 A;  1BUI C;  1TS2 A;  3UI3 A;  4B0E A;  2GRI A;  5EE9 A;  1E0Z A;  1TY0 A;  4KKI A;  3W1S A;  2WXF A;  1QOA A;  1JW9 D;  2N0S B;  3KWL A;  3EA6 A;  2TSS A;  4IDI A;  2ON8 A;  1T3Q A;  1QT9 A;  2V3N A;  1MPE A;  2Y5P A;  1ZDX A;  1FMA D;  1IBX B;  2DWQ A;  2J4X A;  3T3N A;  1WSP A;  1B1Z A;  1FCC C;  1TKY A;  3KWV A;  1CQV A;  3W5V B;  1VZ7 A;  2JYE A;  4YTN B;  1C4A A;  1QOG A;  1YN5 A;  1XLQ A;  2I2Y A;  1QIL A;  2NMQ A;  2B76 B;  4WWM A;  1EU4 A;  1L0V B;  1PGX A;  1K50 A;  3B9J A;  4L2Y A;  4HEA 1;  4OZB A;  4A9A A;  5LNK 1;  3CIR B;  1P7F A;  1YNT E;  1J7C A;  2V3P A;  3RPF C;  4AS1 A;  4PT5 A;  1FXI A;  2MEK A;  3N9Y C;  1PUT A;  2ACZ B;  2BBC A;  1I7H A;  2BS2 B;  5BMI A;  3ZJV A;  1Y56 A;  1RM6 C;  4ZHP A;  3NVV A;  3P63 A;  2JZP A;  2W82 A;  1GAQ B;  1HEZ E;  1CJE A;  1VZ8 A;  2AQ2 B;  1WYG A;  2LFI A;  2QMT A;  3FIL A;  4LLG M;  3IT4 B;  5FK9 C;  1KTK A;  2D5G A;  2FE8 A;  4LTU A;  3AV8 A;  3DWM A;  1L6U A;  3MFG A;  5H92 C;  1KLU D;  2VZK D;  3IAM 1;  1HXY D;  1YJJ A;  3GP7 A;  1V1O A;  3TUO A;  2GI9 A;  2WDR B;  3U4E G;  2CJN A;  2YEP F;  3P4S B;  4EE2 A;  2KQ4 X;  3IT6 B;  1TJE A;  3Q8B A;  3TSS A;  1IUE A;  1NEK B;  1AYF A;  1Q10 A;  2IJ0 A;  1DOI A;  3U52 E;  3MJ5 A;  2IGG A;  2WQY B;  1B9R A;  3NZ3 A;  4GDK B;  1SBB B;  1ZPS A;  3NVZ A;  5TSS A;  3PZ8 A;  4WIP A;  4FXC A;  5EE1 A;  3AE3 B;  3AE5 B;  3W9C B;  1DOX A;  3SFD B;  4TQ1 A;  1ZE3 D;  3BVG A;  3PO0 A;  4NZL B;  4KGT A;  4MAC A;  1E9M A;  1M4V A;  2HTM E;  1GB4 A;  5D3I B;  4IOI E;  2WXJ A;  4RCO A;  3T3O A;  4MH8 A;  1J7A A;  1JWB D;  3LYY A;  1KH0 A;  4OZA A;  1N62 A;  4KGR A;  1OQQ A;  3P4Q B;  1GOZ A;  1D5X C;  1FEH A;  2SAK A;  5E6J A;  5T8I A;  1ZDV A;  5BYR A;  4USA A;  1PGA A;  1ESF A;  3BYT B;  3Q8A A;  3GS2 A;  5D7G A;  1XCT L;  2QIL A;  5HHD G;  1HZ5 A;  5AUI A;  5FR3 A;  2W3S A;  3RFZ B;  2IPK D;  2RDG A;  2BYT A;  1SSN A;  3WCQ A;  2RPV A;  1E7P B;  4JX1 C;  1I4X A;  4ARI A;  1SB3 C;  1C76 A;  3W2D A;  3EGR A;  3VR9 B;  3IXS A;  1TKG A;  1F2R I;  4AQ7 A;  3B2G A;  3OWE B;  2AQ3 B;  3R2T A;  4RFB A;  3BK2 A;  1NVI D;  2K3U A;  5FKA C;  4ZRQ A;  3EUB 2;  4L1B A;  2QSD A;  1ROE A;  3H8H A;  4UDU C;  2FBW B;  4DXG A;  3AE6 B;  2K0P A;  1XCQ L;  3BVM A;  4N6E B;  1D4B A;  1JWU D;  1ET9 A;  1XLP A;  1K52 A;  2Y3A A;  5BMG A;  1XO3 A;  2GB1 A;  2PLP A;  3O13 A;  1FM0 D;  2Z8L A;  1JWA D;  3VQI A;  4JE3 B;  3V3X A;  1TY2 A;  2WLB A;  1K51 A;  2WXG A;  1FRD A;  1UWM A;  1K53 A;  1C78 A;  2R61 A;  3Q8F A;  4US8 A;  1N5W A;  1JRP A;  4NJC A;  4TMA B;  3NUH B;  1V1P A;  2IDY A;  1ZUD 2;  3CWI A;  5BYQ A;  3P1M A;  4B0M A;  2MJD A;  1I4H A;  2WXM A;  4HKQ A;  4WQM A;  4RGN A;  1XLO A;  1QOF A;  5G5G A;  2AX5 A;  1QKZ A;  5AUK A;  1SE3 A;  2LHE A;  1DYQ A;  1NYQ A;  4YT0 B;  1EU3 A;  1PYW D;  1V8C A;  2J52 A;  1YMH E;  4OHJ A;  1GPX A;  1YJI A;  2QIE B;  3AE2 B;  1KFY B;  2N9K A;  4XWT A;  4C7Z A;  4GLS C;  1XXG A;  2BTE A;  2ONQ A;  2WXH A;  4ZHO A;  1SJH D;  2YEP B;  1YQ4 B;  2K22 A;  4YSX B;  1FCL A;  2KDM A;  4US9 A;  4JWS C;  2PTL A;  2WXO A;  1F2R C;  1ACC A;  2KWD A;  5EE0 A;  1CZP A;  1RWS A;  1HA5 A;  1L4D B;  2KN4 A;  4RGM A;  4O1N A;  3V05 A;  1A70 A;  2G9H D;  4HRS A;  1SE4 A;  2V0G A;  1TS4 A;  3B2F A;  2BB5 A;  1I4G A;  3AEC B;  2LUM A;  2VZK B;  2L83 A;  1YQ3 B;  1JRO A;  1QF6 A;  1ZXI A;  2JXT A;  5D3D A;  4N58 A;  4ZYS A;  2INN E;  4ARC A;  3GB1 A;  2DYO A;  4OVZ A;  2XN9 C;  5EE3 A;  3TEW A;  1IGC A;  1MVK A;  3MP9 A;  2RDH A;  1N63 A;  1QQR A;  5H8Y E;  1CK1 A;  1TZO A;  1AWD A;  3PZ7 A;  5HG2 A;  1L0X B;  3BII D;  3P42 A;  2WXL A;  1EM7 A;  4NAW B;  3J9C A;  4J3O D;  2BB6 A;  1GB1 A;  4DXF A;  5G5H A;  1QOB A;  1KF6 B;  3AN1 A;  4RF1 A;  3P4R B;  2W54 A;  3ZGZ A;  2MJE A;  2PVO D;  4KGS A;  1C79 A;  2BW2 A;  1I4P A;  1WWT A;  1JQ4 A;  1JML A;  4RF0 A;  2WXI A;  1L5P A;  1IBX A;  5C3J B;  1NEN B;  2KMM A;  4C56 C;  1TS3 A;  2E3T A;  1JCK B;  2K9X A;  4C80 A;  1IGD A;  2CJO A;  1UNS A;  1LO5 D;  1XLN A;  1KRH A;  4P6V F;  2L52 A;  4A55 A;  1FRR A;  1ZOY B;  1V97 A;  1KLG D;  3HVZ A;  1PFD A;  3BZD B;  3VRB B;  1SEB D;  2L1A A;  1EWY C;  2ZW1 A;  3AB5 A;  3VRA B;  3AE1 B;  1ET6 A;  2I38 A;  1SE2 A;  3Q8E A;  1EWC A;  2H89 B;  2L32 A;  1XEE A;  2WXK A;  1V1P B;  2EKI A;  5BMH A;  4WAF A;  2KAJ A;  1R7S A;  1MI0 A;  1N5X A;  3AE9 B;  4MM3 B;  1FO4 A;  2IGH A;  3ETR A;  1VJK A;  4HJG E;  5I4D A;  1OQR A;  2WDQ B;  4TSS A;  4YSZ B;  3URY A;  1DOY A;  4H2A A;  2AQ1 B;  4R3D A;  1ENF A;  1XF5 L;  1YN4 A;  3FIL B;  2PMV A;  3AEA B;  1UWX A;  1ZP0 B;  3MHZ A;  4A6Q A;  1F0Z A;  4JPS A;  5GXG B;  2M0A A;  3E56 A;  3AE7 B;  3ZYY X;  2Y5C A;  2MH7 A;  1C4C A;  2MJ3 A;  3AE4 B;  2X38 A;  1HZ6 A;  2XNA C;  3AH7 A;  3HVD A;  3I9V 1;  1TKE A;  2INP E;  3LXF A;  5MPO A;  1SIJ A;  2N7J A;  2WS3 B;  3E9S A;  1FNW A;  1OFF A;  1FFU A;  1SF0 A;  2WXR A;  4YXD B;  2WXP A;  2W55 A;  2QJL A;  2DLB A;  3FAH A;  3NVY A;  3P4P B;  4IKG A;  4RGT A;  1FD6 A;  4M0W A;  4LK0 M;  4HRO A;  2JQR B;  2ICI A;  2K5P A;  2LJI A;  3ZQ4 A;  4N59 A;  4TQ0 A;  3ZJT A;  2E6X A;  4XWW A;  1VRA B;  1I4R A;  2H88 B;  2J53 A;  1VDV A;  3AED B;  1PGB A;  2FUG 1;  2WNM A;  2QEJ C;  2BT6 A;  4JWU C;  4XDC A;  4ZRP A;  2SEB D;  2N9L A;  4KKJ A;  1F77 A;  2WU5 B;  5C2T B;  3SR6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...