1QQRA

Crystal structure of streptokinase domain b
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
138
structure length
138
Chain Sequence
b'IQNQAKSVDVEYTVQFTPLNPDDDFRPGLKLTKLLKTLAIGDTITSQELLAQAQSILNKNHPGYTIYERDSSIVTHDNDIFRTILPMDQEFTYRVKNREQAYRINKKSGLNEEINNTDLISEKYYVLKKGEKPYDPFD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords STREPTOKINASE DOMAIN B
publication title Crystal Structure of Streptokinse Domain B
rcsb
molecule tags Hydrolase activator
total genus 35
structure length 138
sequence length 138
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 1999-06-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02821 Staphylokinase Staphylokinase/Streptokinase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.180 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1qqrA00
1QQRA 1BMLC 1C4PA 1L4DB 1L4ZB
chains in the Genus database with same CATH superfamily
2N0SB 1N5XA 2K0PA 1GC6A 1K53A 2J52A 4P7IA 1GAQB 3B1LX 4TQ0A 2DZJA 4HPPA 1M4VA 2KLCA 1XD3B 2I1KA 5H8YE 3PRPB 3WAMA 1KM7A 4BKSA 1LM8B 1HTOA 3UQBA 4XZ4A 1MPEA 4M01A 3Q14C 2G3QB 3L13A 1D6EC 1WX9A 1ET6A 2L1AA 4KX6B 2R2OA 1A5RA 3QARA 3ABVB 2CHWA 4JIOU 2JRHA 3KUCB 4XYCA 1MHHE 1WM3A 1YJJA 2D5GA 1I4RA 3KUDB 2PTLA 3FKYA 3ZLZA 3AU5A 2EMSA 3WALA 3KVFB 4GOCA 4W9FA 2BWFA 1UGMA 3R7QA 2O6VA 1TS2A 4II2B 4JX1C 2PVOD 1X1MA 2HE7A 3GP7A 4E3CA 3SFDB 2ZNVC 3NVZA 2LD9A 4MJSA 1V86A 1T6BX 2YEPF 3AE8B 3AB5A 2Z59B 4BBNF 4A55A 1G6JA 1F0ZA 5IO9A 1OEYA 1FNUA 3AE9B 2WXHA 2XN9C 3VXWA 1MFWA 2MJ3A 4RMAA 2G1EA 2HTHA 2OEDA 5CX3A 4N9F4 3PRZA 4MH0E 4P16A 2HJ1A 2PJHA 2EKIA 2AX5A 1AWDA 1JWAD 1SE9A 2JPHA 2K22A 2OJWA 2DWQA 1ZGUB 3TMPB 4KKIA 1ENFA 2L8JA 3P2BA 2CHZA 1C1YB 3L08A 1WX7A 4BBNC 3B2GA 1JWMD 1JRUA 3IHPC 4RGTA 1JQ4A 1L0VB 3B08A 2XK5B 2ICIA 4ANVA 4BFRA 5G2NA 5C1ZA 1YJIA 3GB1A 1ZDVA 3J9CA 3HK0A 1YN5A 2N9PC 3L16A 4FULA 1EO6A 3M3JA 4TMAB 1LQBA 2JRIB 4HK2A 4GGQA 4B0MA 3AI5A 2RMMA 2N9LA 1YMHE 3KWLA 5CHWA 1ZDXA 3VVWB 2MW5A 5JXVA 1NI2A 2WXLA 3BVMA 2KMCA 1C4CA 1WRDB 1V5TA 1SF0A 5FR3A 4BOZB 3RULA 1PUTA 2M8SA 4XX5A 2L05A 3IAM1 2DNFA 2FNJB 2B76B 2JX5A 1XLOA 3DVGY 3E9SA 3H8HA 4YSXB 3AU4A 3ETRA 4GDKA 4K3CA 2RR9A 2LUEA 2BB6A 2BYEA 4NAWB 4NZLB 4AP4C 3GS2A 1YN3A 4JWSC 1WIAA 4GIVA 2INNE 1P7EA 2D07B 2MP2B 3I5JC 2JYTA 1GC7A 4OVVA 3ZDTA 4PYZA 5C23A 4A8XC 5HG2A 4ZRKA 1ZE3D 1V5OA 3A1QA 1SJHD 3X23A 2N1VA 4ANUA 3Q8AA 1YQ3B 4GSWA 2KQSA 1E7PB 2OOBB 2M4NA 5IKCM 4I6PA 3K9OB 3RMKC 4MGKE 1EWYC 4NJCA 1YNTE 4WJOA 3JSVB 1IP9A 2N7JA 2KT7A 1I4XA 2IY1B 2QJLA 3DBLB 1UZXB 2M19A 2I2YA 2PLPA 4OZAA 2LGDA 2KKCA 2WXIA 1ZUD2 1EF1A 4CO7A 3BWUD 2TSSA 4DDGD 2D10A 1FXIA 3AE5B 3RYTA 5DPRA 3NS8A 2VZKB 3VTUA 4DHJB 4J3OD 4W9HA 3VUYA 2D3AA 3N1YC 3Q3MC 4OHJA 3MC9A 4M8NA 3TEXA 5BMHA 3NZ3A 4AWJA 4DBGA 3R66C 4CYEA 1V2YA 2L3ZA 4DDID 4HXDA 1HZ6A 3Q69A 1KLVA 1JW9D 1E10A 2G9HD 2EMTA 2KN5A 2KNBA 1IPGA 2QDFA 4LNKA 2CS4A 3CIRB 4RCOA 1NEKB 2W55A 3AMZA 3BVZA 5HHDG 4C7YA 1N60A 1WXVA 2K6QA 2O2VB 2KFKA 2JZZA 4FA6A 2KZRA 3DBHB 1YJ1A 2LASA 1E6EB 4W9IA 5C2TB 1T0YA 4GB9A 1GG3A 1F52A 3Q6BA 4KZCA 2DZKA 2C7HA 2Z0DB 3L10B 3PV1A 1V81A 5EE3A 4C4VA 1U4AA 1WE7A 1C3TA 3X0WA 3HUIA 1HEZE 2GRIA 3ZNZB 4KSKC 2JWUA 1D3ZA 2KJRA 2KWVB 2LRUA 3IVFA 4WWPA 4H2AA 2C7MB 1QILA 1TYGB 1FRRA 3TSSA 1HZ5A 1TY0A 4JWUC 4JL9A 1J7CA 2BKFA 4OZCA 2H89B 2QC8A 3R3MA 5JH5C 4BKSD 4ANXA 1H4RA 4NAMA 4TQ1A 5I4DA 3OJ3A 1Z5SB 2WS3B 1IUEA 3BZDB 4LNIA 2FCMA 2W82A 3BK2A 4EE2A 4P1CC 1TZ1A 2WXGA 3RFZB 3VTWA 3U7DA 2MH7A 1JRPA 2MJEA 1P7FA 2WXNA 2C7NB 1FNWA 1UWXA 2AEHA 1RFAA 3ML9A 1XQQA 5GXGB 3DBRB 4WWNA 1OQRA 2DZMA 3W1YA 4JE3B 1JMLA 1WY8A 4ZRPA 2O6VD 1LXDA 1PDXA 2RDGA 3VTVA 3BVGA 4EZJA 4RF0A 4II3B 4ASWC 3ZIMA 1GOZA 5BYQA 4ZYSA 1OFFA 3VDZA 3VAWA 2ZVOA 3SU8X 3DBSA 3HM6X 1J0GA 2NS5A 4LCDE 2IO2B 1EM7A 2DLBA 4MGYE 2MRPA 3ZTCA 4IM0A 4AJWA 1QOBA 2ZW1A 3PGEA 3B0AA 2MBOA 1RWSA 3AEFB 5DPSA 4XC2A 1E8WA 2BWES 1TS5A 2XEWA 4R3DA 1WWTA 2HD5B 4WJNA 1K8RB 1I35A 2IGDA 3DBLI 4GDLA 5T8IA 3RNBC 1E8ZA 1GB4A 1OGWA 3NY5A 4DXFA 1VR9A 2WXJA 3N3KB 4YTNB 1PGAA 2WWZA 3P4SB 1WRIA 3RT3B 2CJOA 3JVZX 2DYMA 2BTEA 4L2YA 1FNVA 1FXAA 4RM8A 2WXPA 5E6PA 1VD2A 3W5UB 2BS2B 4B9KA 2LGYA 3RUIB 2KQ4X 1L0XB 3DOWA 4XWWA 3V6CB 2CR5A 2ONQA 3VR9B 1P9DU 1L6VA 1C79A 2JZPA 3H7PA 3CF6E 2WQYB 2D3BA 1IYFA 4IC7B 1WXAA 2JSVX 2BYTA 2A4ZA 2DAJA 2QEJC 4HJKA 1FMAD 1WGYA 4IWQA 2R61A 2L00B 4NQLB 2DZIA 1YX5B 3S2AA 3MFGA 4ZOHC 1LFDA 3PTFC 3WAPA 4HCNB 2LWPA 1WMHB 1TKGA 3DBHI 2IZVB 4ZYNA 2KWUB 3U52E 1R4NB 1ACCA 1HA5A 2CU1A 4E74A 5D94A 2C5LC 3WA0A 3KYDD 1NYRA 4FHKA 3TBLD 3DHHC 4OVZA 1IBXA 2K9XA 2WHIA 4AQ7A 4GLSC 5C3JB 3U4EG 1DGJA 2LJIA 2KDMA 2KDIA 3OAWA 3A9JA 1D5MC 2L52A 2KTRA 1WJ6A 1UUPA 4WIPA 1PFDA 3IT6B 1WI0A 5BYRA 2KDFB 2UYZB 2WDRB 1GJZA 1ZXHA 2ZZPB 3ZJUA 3QX1A 1WGHA 4GDKB 5HFYA 1UELA 2UWQA 3SDLC 1J19A 1AARA 3N1ZC 3TJPA 3DBRI 3PHXB 1XLPA 3P42A 1V49A 2LFIA 2RSUA 5KHQA 1TTNA 3NOBA 3R2TA 3Q8EA 1AN8A 1S3SG 2ON8A 3A1QB 3PZDA 2V4IB 3EHVA 5G5HA 2KOXA 1V8CA 3AE7B 3MTNB 5IA7A 5IAAC 1KTKA 3RNGC 3UGBB 4TSSA 4LDTD 3PSEB 4XE0A 2ZJDA 5JZEB 1ZW7A 1QT9A 4YSZB 2ZCBA 4PS7A 3RNFC 1QOGA 5BMIA 1E5WA 2M1MA 4N6EB 2MLBA 5E6JA 1E7UA 3TEZA 4E71A 3MJWA 2OJRA 3P1MA 2LXAA 2ZEQA 2WU2B 2ZW0A 4EZKA 4G50A 2GLSA 5L83A 3FILA 3QC8B 2GBNA 3WCQA 4FJVB 3LB8C 1NI3A 4YWGG 1ESFA 1T5XD 4KKJA 2PIAA 2WGSA 3ZXRA 2VRRB 2A5UA 1L7YA 2PPHA 2KQ7A 3DHIC 4LTUA 2MA9B 4HCPB 1FO4A 4IOIE 4KIKA 2WU5B 3DQVA 3QHTA 3RN9C 2PW9A 1OQYA 3AH7A 1WGDA 1FCCC 2CKHB 2K39A 3C19A 2QSDA 2KXJA 3UF8A 2QHOA 2BW2A 2GOWA 1IGDA 3MHZA 3NVYA 3R8BA 2NTTA 2MCNB 3URYA 1GPXA 3O13A 3W1SC 3EUB2 3ZNHB 1UD7A 2WYQA 2W3SA 3QAQA 4AS1A 3KWVA 2KYWA 1MVKA 4FXCA 4W9CA 4HLEA 4BZAA 1SIFA 4ICUA 4MSMB 1UGJA 2VH2A 4F8CB 2K8HA 2BYFA 3SEBA 2N9EB 3M62B 2BF8B 3A4SC 2DHZA 3UQAA 4C4VB 1KOTA 2CHXA 4OW0A 2RDHA 3NVVA 2IO0B 2M56B 2SEBD 3ZW3A 3PREA 4YXDB 4HPMB 3MC8A 2LZ6A 1N5WA 1R4NI 4P1BC 3MHSD 4M8MA 4LK0M 2RDBC 2LGXA 2L0TA 2Y5PA 4MM3B 4L23A 3IT4B 3NS1A 1C77A 2KK8A 3M95A 4RNAA 3A4RA 1TS4A 4J6IA 1LO5D 1YIWA 2V0GA 3KQ4A 3IFWB 3GZNB 4EOYA 1SJED 1R4MB 4GN1A 3UINB 4PS3A 2IPKD 4OVUA 3Q3FA 5AEKB 4XWTA 5J2RA 2KWDA 3T8MA 1V1PB 1QZEA 5KHOA 3AE2B 1PGXA 2W9NA 4MH8A 4YT0B 3GOEA 4IKGA 4ARIA 1FIQA 1N61A 2JF5A 4ANWA 4M0WA 4C7ZA 4MSQB 3AE6B 4W9LA 3PVLA 1UF0A 1H8CA 3V60A 1K51A 1QOAA 4JGHB 5FK9C 4K7SA 1UH6A 1FXTB 3P4RB 1QKZA 1FFUA 1Q5WB 2KO3A 2QCZA 4A6QA 2V1YA 4WAAA 3JW0X 3R2IA 2V3SA 1SE4A 5J18A 3P4PB 2GBRA 3N9YC 2AL6A 2BVCA 4W9GA 2K8BA 2M17A 3L17A 2XK5A 2IYDB 3TCAA 4LLGM 2CU3A 1FD6A 3HVDA 2NPTB 2PE9A 2LVPA 3K9PB 2JXXA 2N7EA 2ACZB 1RLFA 1J7BA 1D4BA 3R7RA 4OZBA 1QOFA 4F7ZA 2G45B 5J17A 1BXTA 4IW0A 2C9WB 3WIMA 4MGZE 3ZRFA 1ZOYB 5D3DA 2KWCA 2D3CA 4HKQA 2AYOB 3A9KB 2V3NA 1TKYA 2L76A 1JWUD 2J0KA 1I4GA 2AWTA 1DOIA 2ZCCA 2MSED 5BMGA 3ONSA 1STEA 4JPSA 3SFEB 3VR8B 2D11A 2JT4B 2WX0A 4NAWA 1VZ7A 1FEHA 4YSYB 1WXSA 2K1FA 4IWOA 4F1SA 1CMXB 2IO3B 4TV3A 4FJYA 2PVGC 3LDZE 1Q1OA 4AUQC 4PK1A 1WZ0A 3ZKJC 3AULA 1EU3A 1CK1A 3N32A 1UNSA 2INPE 1NENB 1K52A 1FCLA 2IJ0A 2VH1A 4S0RA 4PT5A 3NZUA 5E6OA 1WGKA 3H1UA 4NPNA 3KH0A 1YQBA 3IAS1 1N63A 2GBMA 1I42A 3DCGA 1SE3A 2GMIC 4ZRJA 2K5PA 2IO1B 3JSVA 4B0EA 2J42A 3DWGC 4HKZE 1ZKHA 4X57B 2G4DB 2LVQA 5EE9A 3ZVVA 2MHJA 3W2DA 3APDA 3VRAB 3BINA 2C60A 2BS4B 3UI3A 3DHGC 4MELA 1Q10A 1QLBB 1Y8RC 2RPVA 2MJDA 3H7SA 3RNCC 4DHZB 3RCZA 3I57A 2SAKA 3IG3A 5DPWA 1I4HA 1P1AA 2KVZA 4ZHOA 4BAXA 1SBBB 3HHMA 4G3XB 5CHVC 2V4LA 1E0ZA 2N1WA 4ACFA 1KRHA 2UU7A 3GZNI 3H9DA 1R4MI 4KVGB 3MJ5A 1YQ4B 1UWMA 2MX2A 3HM3A 3AM9A 3W5VB 4UDUC 1WGRA 4RGMA 2J7QB 3ZRCA 3SHQA 4KSLC 4W9EA 3ZJTA 3HIZA 1BMLC 1PYWD 2Z0EB 2KX0A 1WX8A 2ZNVB 1KLGD 2AQ3B 3O65B 4ZDVA 1XEEA 1TKEA 2I38A 3HVZA 3L0WB 1J8CA 4EKUA 5BYSA 3Q8CA 3AXCA 3DVNV 3ZUNA 4BVUC 1TBEA 3L4PA 3UIOB 5G5GA 1XXGA 3QK0A 1SB3C 1OEYJ 3AE1B 4FLHA 2ZPYA 2W3RA 4TUUA 2KAJA 2NBWB 3KLSX 5LXHA 2O6VB 2INCC 2YEPB 1SIJA 4MJSB 2Z8LA 3QWZB 3NZSA 3ZNGC 2JQRB 3DVNU 3Q3NC 2WXRA 1CZPA 3ENEA 4ZHPA 3NUHB 5LXIB 3ZQ4A 1F9JA 2JWZA 5H92C 1C78A 3AV8A 1KJTA 1CJEA 2JY6A 1V6EA 2LHDA 4RGNA 1WJ4A 4D2KA 1Z2MA 3A33B 3JYUA 2X8XX 3AE3B 5EE0A 1T0SC 2DENB 4GXBA 1EWCA 4LNFA 1B1ZA 2BQQA 2B3AA 2FUG1 3GE3C 4MEMA 2KN4A 3N30A 5AZFA 1OTRB 2J0MA 4NQKE 4P6VF 1MG8A 1FFVA 3TIXA 2JXTA 4EFOA 3NG0A 4EUTA 4KIKB 2KDBA 4FHJA 2OHFA 4A90A 3TEWA 1KLUD 2KVRA 1I4QA 5L95C 5AZHA 2JZ3B 1E8YA 2KANA 4G11A 2KD0A 4WWMA 1WZ3A 1F2RI 2WXMA 4LJOB 1L4DB 2MBEA 4A20A 4WQMA 2BB5A 4N58A 3QA8A 1ROEA 1GB1A 1B9RA 2PMVA 2KHWB 3CSTA 2QILA 2N4FA 2NBVB 4WURA 3V05A 3NHEB 2WP9B 3ZJVA 4C00A 4AJYB 1L6UA 2WXFA 1A70A 4NJ6A 4ITKA 5HKHA 3OG5A 5MPOA 1FRDA 3RPFC 4KGRA 3RNAC 4XDCA 2EELA 2M0XA 2E3TA 4GMVA 3PRMB 1WE6A 1YD8U 5IOIA 1JCKB 3T9LA 3ZTDA 4NY0A 1Q0WB 1J7AA 2JUOA 2V3PA 4YTMB 3LXFA 5EDSA 3GE8C 4K7UA 1HE8A 4NNJB 3RZFA 1LGRA 3OWEB 2AQ1B 3UIPB 3OLMD 5D2MB 1L4ZB 2KACA 2WNMA 4XDDA 4WJPA 1L5PA 4N59A 2LUMA 1OQQA 1QQRA 1S1QB 5CTRC 1WYWB 3T3NA 3FAHA 3ZGZA 1RYJA 3AE4B 1E90A 4K81A 1F1HA 4MACA 2HTME 4DWFA 1NYQA 3EC8A 4IWPA 2K25A 1WH3A 4K7WA 4HVBA 4M0WB 4XGAB 1E7VA 2WXQA 2KFJA 2N9XA 2G4SA 2H88B 2KX3A 4FBJB 4G0NB 2GI9A 2BGFA 3B9JA 1N6ZA 4MDKE 1UBQA 5BO4B 1C76A 2NTSA 2V9HA 2MWSB 1NDDA 2FBWB 3W1SA 4ICVA 2JVCA 3TEYA 2HJ8A 3ML8A 3HRDD 3H6NA 4AOFA 1WMHA 4W9JA 2NBUA 3AECB 3MP9A 4JQWC 1PGBA 1KF6B 3PZ8A 4C80A 2BT6A 1T3QA 3VUXA 2FUHB 3U30A 2DBYA 4GU2A 4RH6A 3I9V1 2LMCA 3W9CB 3OJ4B 4LDTB 5G55A 3ZNID 1P3QU 3D32A 4B95A 2KFKB 1I7HA 3T3OA 1WM2A 5JHBA 2ASQA 2NR2A 1T0QC 2LEKA 4HJGE 1SXTA 1EUVB 1EF5A 2GBKA 3BY4B 4LJPB 3LYYA 3ZDMC 3B2FA 1WXQA 2X38A 3Q3OC 2WLBA 4Q2JA 4HDQA 5IN7A 2YLMA 1P0RA 3VH4B 2N9KA 5CHFA 1JALA 2NMQA 3CSFA 1JWBD 5E6NA 4ZRIA 3PO0A 4RFBA 2D2QA 4NJ7A 2VZKD 3M63B 4DHJD 3PLUA 1QF6A 3QCAA 3APCA 4KDLB 3QIJA 4USAA 3V3XA 1AW7A 1WSPA 2XNAC 4HWIB 1M94A 1L0YB 4BKTA 3Q3JA 1K50A 3U2SC 4BKGA 1ISNA 3ECIA 3CWIA 1FM0D 1ZP0B 2XBBC 2PE6B 4CQNA 3I63C 3AN1A 3PLVA 4A9AA 1GUAB 3AEDB 4LNOA 5EE1A 2FIFA 4RF1A 2WDVB 4RGOS 4WWOA 1XF5L 5IP4D 1PQSA 2FCSA 1MJDA 4WH4A 1VZ8A 1DYQA 2KJHB 1V80A 1D5ZC 1E9MA 1AYFA 1MG4A 3AEEB 2BBCA 1VDVA 1XCQL 4IUMB 3VRBB 4DQOC 4B6WA 1C4AA 4MGIE 3AEAB 1HQRD 1WR1A 5DCNA 4A3OA 4ARCA 5D3IB 2D3GA 5LLIA 2INDC 1EU4A 1SSNA 4EZLA 2IY0B 1T0RC 2MBHA 3KW5B 2LI5A 4HEA1 4FN2A 5HI1A 2BS3B 2GB1A 4KV2A 3APFA 3N1XC 4GDLB 3SR6A 1N62A 5AUKA 3QJZA 4M02A 2LRWA 4YTPB 1TGZB 2FE8A 4HDOA 4HRSA 2Y3AA 3DDCB 2MBQA 4K3BA 3CMMB 3EFCA 2DYBA 1R7SA 5AZGA 1I4PA 5FR6A 1XCTL 2NCNA 1YX6B 1V9JA 3RZWC 3P4QB 2BKRB 4TKNA 2KLGA 3EECA 1RFKA 4WAFA 2BPSA 2KDEB 1XO3A 2IDYA 4W9DA 3NRZA 2IGHA 2LVOA 2Q5WD 1KH0A 1SE2A 1CQVA 1BT0A 2HDEA 1WGGA 1YOVB 3RI7C 2BYVE 3H7PB 4REZA 1VCBA 5GMVA 2DAFA 1SEBD 3SD5A 1L2NA 3NJTA 2ZVNA 3AEBB 2MP2A 3VH3B 1C4PA 2EKEC 1VJKA 1E8XA 1NVID 2QIEB 4MM3A 1TS3A 3BYYB 4RM9A 3KUZA 1TZOA 2J53A 1ZXIA 2KMAA 1ET9A 1YN4A 4I6LB 1HXYD 2Y5BB 3C0RB 3MC0B 2RGFA 1Y56A 2L0FA 4K1RB 2M0AA 4KDIC 4S17A 2WX1A 4IG7B 3AEGB 1F77A 5JHAA 1RRBA 3E56A 4US8A 3VQIA 3DVGX 3BYTB 2JU6X 3BK1A 1XLNA 2GBJA 2MEKA 2K8CA 4KZ0A 1WXMA 1IBXB 1V1PA 2MQJA 3WANA 1JWSD 3L54A 2FAZA 1WYGA 2JYEA 3V62A 2PKOA 2WDQB 1MI0A 3PHWB 2ZPNA 5AUIA 3WAOA 2IBIB 2RPQA 3VHTC 1D5XC 3A9JB 3EFUA 1RM6C 4O1NA 2KTRB 3TL5A 1VZ6A 4M00A 1GNUA 3TUOA 5LNK1 2L83A 3PZ7A 2PEAA 2KC2A 4IM2A 4KGTA 1UBIA 3U8ZA 2L7RA 4WJQA 3IBEA 3VFKA 5D7GA 3PT2B 2W54A 2CJNA 1ZPSA 4JLCA 4I6NB 2K3UA 2KJ6A 1VLBA 4HROA 1TT5B 2WXKA 4KGSA 2LGSA 4BOSC 5DPTA 2AL3A 1TIFA 3I3TB 4DXAB 1TY2A 3Q8FA 4DXGA 2DX5B 2LXCA 3PS6A 2NPTA 1WJUA 4A3PA 2KMMA 1WF9A 3V61A 3NVWA 2NVUI 2O2VA 3RNEC 4HPLB 4PS8A 3ALBA 3BIID 1JROA 4IDIA 1P98A 4PYUA 2FIDA 4URKA 1WFYA 2QMTA 2I1JA 2E6XA 2R2QA 1KFYB 4WQOB 3A9KA 3LJ3A 3C8YA 1RAXA 4FADA 2IGGA 3VUWA 2AQ2B 4EEWA 1XLQA 3N20C 2REXA 3Q8BA 1DOXA 4IM3A 2L32A 2WXOA 3PPAA 1XT9B 4LNNA 1FPYA 4FJZA 3EA6A 3FILB 1DOYA 2MBBB 4MT5A 2LJ5A 3ZYYX 3DPDA 3KYCD 1V1OA 2WDTB 4YL8A 4US9A 4L1BA 4ZRQA 1HTQA 2RD0A 3DWMA 3V6EB 2KTFA 4W9KA 1IGCA 1SGHA 2Y5CA 3RD2A 3FC4A 3U7ZA 4DHZE 2KC1A 4C56C 1V97A 1WJNA 2DYOA 2J0JA 2FCQA 3ZO5B 5TR5A 1F2RC 5TSSA 3IXSA 1BUIC 4QAYA 1WR6E 2LGIA 3ZXVA 3Q2AC 1NBFC 2LHEA 2J4XA 2K6DB 4DK5A 2N7DA 1VRAB 3EGRA 2FCNA 1TJEA 5D6JB 4CHKA 3P63A 1MHXA 5FKAC 1C9FA 3QQ8B 2YVCA
chains in the Genus database with same CATH topology
2N0SB 1EM7A 1N5XA 2K0PA 1K53A 2DLBA 2J52A 1I7HA 3T3OA 4LLGM 1GAQB 2CU3A 1FD6A 4TQ0A 3HVDA 1QOBA 2ZW1A 2LEKA 1M4VA 2ACZB 1RWSA 3AEFB 1J7BA 1TS5A 1D4BA 4OZBA 1QOFA 4HJGE 1SXTA 4R3DA 5H8YE 1WWTA 1BXTA 2IGDA 3LYYA 5T8IA 3B2FA 1ZOYB 5D3DA 1GB4A 1WXQA 1MPEA 2X38A 2WLBA 4Q2JA 4DXFA 4HKQA 1VR9A 2WXJA 1D6EC 2N9KA 2V3NA 1ET6A 4YTNB 1JALA 2L1AA 1PGAA 1TKYA 2NMQA 1JWUD 4KX6B 1JWBD 1WRIA 3P4SB 2CJOA 2DYMA 1I4GA 3PO0A 4RFBA 3ABVB 2BTEA 1DOIA 4L2YA 1FNVA 5BMGA 1MHHE 2VZKD 1FXAA 1YJJA 2D5GA 2WXPA 1STEA 1QF6A 1I4RA 4JPSA 3SFEB 3VR8B 3W5UB 2BS2B 2PTLA 1VZ7A 1FEHA 4YSYB 2KQ4X 4USAA 3V3XA 1AW7A 1WSPA 2XNAC 1L0XB 4XWWA 1L0YB 2ONQA 2PVGC 3VR9B 1K50A 3U2SC 1L6VA 1C79A 2JZPA 3CWIA 1TS2A 4JX1C 1FM0D 1ZP0B 2PVOD 2WQYB 1EU3A 3GP7A 2JSVX 1CK1A 3SFDB 2BYTA 3NVZA 2QEJC 1UNSA 4CQNA 2INPE 1NENB 1K52A 1FMAD 1T6BX 2YEPF 1FCLA 2IJ0A 3AE8B 2R61A 3AB5A 4PT5A 4A55A 3AN1A 4A9AA 1WGKA 3AEDB 5EE1A 1F0ZA 3MFGA 1FNUA 2WDVB 4RF1A 4ZOHC 3AE9B 2WXHA 2XN9C 4RGOS 2MJ3A 2G1EA 2OEDA 1XF5L 3IAS1 1N63A 4P16A 1TKGA 2EKIA 1SE3A 2AX5A 4WH4A 1VZ8A 1AWDA 1JWAD 2K5PA 2K22A 1DYQA 1D5ZC 2DWQA 4B0EA 3U52E 2J42A 3DWGC 4HKZE 1E9MA 1ACCA 1HA5A 1AYFA 4KKIA 1ENFA 5EE9A 3AEEB 2BBCA 1VDVA 1XCQL 3B2GA 1JWMD 3W2DA 3VRAB 3VRBB 1NYRA 2BS4B 3UI3A 4DQOC 4OVZA 4RGTA 1JQ4A 1Q10A 1L0VB 1QLBB 1IBXA 1C4AA 2MJDA 2RPVA 2K9XA 2ICIA 3AEAB 4AQ7A 1HQRD 4GLSC 1YJIA 3GB1A 3I57A 1ZDVA 3J9CA 4ARCA 2SAKA 5C3JB 5D3IB 1YN5A 1I4HA 1DGJA 3U4EG 2LJIA 2KDMA 1EU4A 1SSNA 4ZHOA 1SBBB 4TMAB 4B0MA 1E0ZA 1D5MC 2L52A 2RMMA 1KRHA 2N9LA 4HEA1 5HI1A 2BS3B 1UUPA 4WIPA 1YMHE 3KWLA 2GB1A 1PFDA 1ZDXA 3IT6B 3MJ5A 1YQ4B 1UWMA 5JXVA 4GDLB 2WXLA 3SR6A 5BYRA 3AM9A 1N62A 5AUKA 3W5VB 4UDUC 4RGMA 2WDRB 3BVMA 4YTPB 1ZXHA 2FE8A 3ZJUA 1C4CA 4HRSA 4GDKB 2Y3AA 1SF0A 5FR3A 3ZJTA 5HFYA 1PUTA 1BMLC 1PYWD 3IAM1 1R7SA 1I4PA 1XCTL 1KLGD 2B76B 2JX5A 1XLOA 2AQ3B 3E9SA 3H8HA 1XEEA 1TKEA 4YSXB 2I38A 3ETRA 3HVZA 5BYSA 3P4QB 3Q8CA 2BB6A 1RFKA 4WAFA 4NAWB 3L4PA 1XO3A 4NZLB 5G5GA 2IDYA 3GS2A 1XXGA 3NRZA 1XLPA 1SB3C 2IGHA 3P42A 1YN3A 2LFIA 2Q5WD 3AE1B 4JWSC 1KH0A 1SE2A 2W3RA 3R2TA 2INNE 1P7EA 1CQVA 3Q8EA 1AN8A 2HDEA 2KAJA 2ON8A 3KLSX 2V4IB 2JYTA 4REZA 5G5HA 1V8CA 3AE7B 2YEPB 1KTKA 4A8XC 5HG2A 1SIJA 1SEBD 1ZE3D 4TSSA 3AEBB 2Z8LA 1SJHD 1C4PA 1VJKA 4XE0A 1NVID 2JQRB 2QIEB 1TS3A 4YSZB 1QT9A 2WXRA 3BYYB 1CZPA 1YQ3B 3Q8AA 1QOGA 4ZHPA 3NUHB 5BMIA 1TZOA 2J53A 3ZQ4A 5H92C 1C78A 1ZXIA 3AV8A 1E7PB 4N6EB 1CJEA 5E6JA 3TEZA 1ET9A 1YN4A 2LHDA 3P1MA 4RGNA 4D2KA 1HXYD 3MC0B 2WU2B 2ZW0A 1Y56A 3AE3B 1EWYC 5EE0A 2M0AA 1YNTE 4NJCA 3FILA 1EWCA 2N7JA 1B1ZA 1I4XA 2FUG1 3AEGB 3WCQA 1F77A 2KN4A 2QJLA 4P6VF 3E56A 4US8A 3VQIA 3LB8C 1FFVA 1NI3A 2JU6X 1XLNA 2JXTA 3BK1A 3BYTB 4YWGG 1ESFA 2M19A 1T5XD 2MEKA 2PIAA 4KKJA 2I2YA 1IBXB 1V1PA 2PLPA 4OZAA 2OHFA 4A90A 3TEWA 1JWSD 1WYGA 2JYEA 2WXIA 1KLUD 1ZUD2 2PKOA 1MI0A 2WDQB 4LTUA 5AUIA 1FO4A 4IOIE 1I4QA 2WU5B 1D5XC 3BWUD 2TSSA 1FXIA 2PW9A 1RM6C 3AE5B 4O1NA 2VZKB 3AH7A 1FCCC 4J3OD 4WWMA 1VZ6A 2QSDA 1F2RI 2WXMA 1L4DB 4OHJA 4WQMA 3TEXA 5BMHA 2BW2A 3NZ3A 3TUOA 2BB5A 5LNK1 2L83A 4N58A 1IGDA 3PZ7A 1HZ6A 3MHZA 3Q69A 3NVYA 1ROEA 1JW9D 3R8BA 1GB1A 2NTTA 1E10A 2G9HD 1B9RA 4KGTA 3URYA 2PMVA 2QILA 5D7GA 2W54A 2CJNA 3O13A 1ZPSA 3CIRB 3EUB2 4RCOA 1GPXA 1NEKB 2K3UA 1VLBA 4HROA 2W3SA 2W55A 3AMZA 3KWVA 4WURA 4AS1A 1MVKA 2WXKA 4FXCA 4KGSA 3V05A 3BVZA 5HHDG 4C7YA 1N60A 2WP9B 3ZJVA 1TY2A 3Q8FA 1UGJA 1L6UA 4DXGA 2WXFA 1A70A 4ITKA 3SEBA 2KMMA 5MPOA 1FRDA 3NVWA 3RPFC 4KGRA 1E6EB 4OW0A 2RDHA 3NVVA 5C2TB 2M56B 4XDCA 2EELA 2SEBD 4YXDB 3BIID 2E3TA 1JROA 5EE3A 1JCKB 1N5WA 4IDIA 4LK0M 1J7AA 2Y5PA 4MM3B 3HUIA 4L23A 1HEZE 2V3PA 3IT4B 4YTMB 2GRIA 3LXFA 2QMTA 1C77A 3NS1A 2E6XA 4RNAA 1KFYB 1TS4A 2JWUA 3OWEB 2AQ1B 3C8YA 1LO5D 2IGGA 4H2AA 1L4ZB 2KACA 2WNMA 2AQ2B 3I9V1 2V0GA 1XLQA 4XDDA 1QILA 1DOXA 3Q8BA 2L32A 2WXOA 1TYGB 3KQ4A 1FRRA 1L5PA 3EA6A 3FILB 4N59A 3TSSA 1HZ5A 1TY0A 1DOYA 2LUMA 1OQQA 1SJED 1QQRA 4JWUC 1J7CA 4MT5A 4OZCA 3ZYYX 2H89B 3T3NA 3FAHA 3ZGZA 4NAMA 1V1OA 4TQ1A 1RYJA 2IPKD 3AE4B 5I4DA 4US9A 4MACA 2HTME 2WS3B 1IUEA 4L1BA 4ZRQA 4XWTA 3BZDB 3DWMA 2KWDA 2W82A 1NYQA 1V1PB 3BK2A 4EE2A 3AE2B 2WXQA 1IGCA 1PGXA 4MH8A 4YT0B 2WXGA 2Y5CA 3RFZB 2H88B 4IKGA 4ARIA 1FIQA 3FC4A 1N61A 3U7ZA 2MH7A 1JRPA 2GI9A 3B9JA 4M0WA 4C56C 1V97A 1P7FA 2MJEA 2WXNA 4C7ZA 1C76A 1FNWA 1UWXA 2NTSA 2DYOA 3AE6B 5GXGB 1OQRA 2FBWB 3W1SA 1F2RC 1K51A 1QOAA 4JE3B 5TSSA 3TEYA 3HRDD 1JMLA 3IXSA 5FK9C 1BUIC 4ZRPA 3P4RB 1PDXA 1QKZA 2LGIA 2RDGA 3AECB 3MP9A 1PGBA 2LHEA 1KF6B 2J4XA 1FFUA 3BVGA 4A6QA 1VRAB 3EGRA 4RF0A 1TJEA 3PZ8A 4C80A 2BT6A 1T3QA 1GOZA 5BYQA 4ZYSA 3P63A 1OFFA 1MHXA 5FKAC 1C9FA 3R2IA 2DBYA 4RH6A 1SE4A 2LMCA 3P4PB 3N9YC 3W9CB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1QQR A;  1BML C;  1C4P A;  1L4D B;  1L4Z B; 
#chains in the Genus database with same CATH topology
 2N0S B;  1N5X A;  2K0P A;  1GC6 A;  1K53 A;  2J52 A;  4P7I A;  1GAQ B;  3B1L X;  4TQ0 A;  2DZJ A;  4HPP A;  1M4V A;  2KLC A;  1XD3 B;  2I1K A;  5H8Y E;  3PRP B;  3WAM A;  1KM7 A;  4BKS A;  1LM8 B;  1HTO A;  3UQB A;  4XZ4 A;  1MPE A;  4M01 A;  3Q14 C;  2G3Q B;  3L13 A;  1D6E C;  1WX9 A;  1ET6 A;  2L1A A;  4KX6 B;  2R2O A;  1A5R A;  3QAR A;  3ABV B;  2CHW A;  4JIO U;  2JRH A;  3KUC B;  4XYC A;  1MHH E;  1WM3 A;  1YJJ A;  2D5G A;  1I4R A;  3KUD B;  2PTL A;  3FKY A;  3ZLZ A;  3AU5 A;  2EMS A;  3WAL A;  3KVF B;  4GOC A;  4W9F A;  2BWF A;  1UGM A;  3R7Q A;  2O6V A;  1TS2 A;  4II2 B;  4JX1 C;  2PVO D;  1X1M A;  2HE7 A;  3GP7 A;  4E3C A;  3SFD B;  2ZNV C;  3NVZ A;  2LD9 A;  4MJS A;  1V86 A;  1T6B X;  2YEP F;  3AE8 B;  3AB5 A;  2Z59 B;  4BBN F;  4A55 A;  1G6J A;  1F0Z A;  5IO9 A;  1OEY A;  1FNU A;  3AE9 B;  2WXH A;  2XN9 C;  3VXW A;  1MFW A;  2MJ3 A;  4RMA A;  2G1E A;  2HTH A;  2OED A;  5CX3 A;  4N9F 4;  3PRZ A;  4MH0 E;  4P16 A;  2HJ1 A;  2PJH A;  2EKI A;  2AX5 A;  1AWD A;  1JWA D;  1SE9 A;  2JPH A;  2K22 A;  2OJW A;  2DWQ A;  1ZGU B;  3TMP B;  4KKI A;  1ENF A;  2L8J A;  3P2B A;  2CHZ A;  1C1Y B;  3L08 A;  1WX7 A;  4BBN C;  3B2G A;  1JWM D;  1JRU A;  3IHP C;  4RGT A;  1JQ4 A;  1L0V B;  3B08 A;  2XK5 B;  2ICI A;  4ANV A;  4BFR A;  5G2N A;  5C1Z A;  1YJI A;  3GB1 A;  1ZDV A;  3J9C A;  3HK0 A;  1YN5 A;  2N9P C;  3L16 A;  4FUL A;  1EO6 A;  3M3J A;  4TMA B;  1LQB A;  2JRI B;  4HK2 A;  4GGQ A;  4B0M A;  3AI5 A;  2RMM A;  2N9L A;  1YMH E;  3KWL A;  5CHW A;  1ZDX A;  3VVW B;  2MW5 A;  5JXV A;  1NI2 A;  2WXL A;  3BVM A;  2KMC A;  1C4C A;  1WRD B;  1V5T A;  1SF0 A;  5FR3 A;  4BOZ B;  3RUL A;  1PUT A;  2M8S A;  4XX5 A;  2L05 A;  3IAM 1;  2DNF A;  2FNJ B;  2B76 B;  2JX5 A;  1XLO A;  3DVG Y;  3E9S A;  3H8H A;  4YSX B;  3AU4 A;  3ETR A;  4GDK A;  4K3C A;  2RR9 A;  2LUE A;  2BB6 A;  2BYE A;  4NAW B;  4NZL B;  4AP4 C;  3GS2 A;  1YN3 A;  4JWS C;  1WIA A;  4GIV A;  2INN E;  1P7E A;  2D07 B;  2MP2 B;  3I5J C;  2JYT A;  1GC7 A;  4OVV A;  3ZDT A;  4PYZ A;  5C23 A;  4A8X C;  5HG2 A;  4ZRK A;  1ZE3 D;  1V5O A;  3A1Q A;  1SJH D;  3X23 A;  2N1V A;  4ANU A;  3Q8A A;  1YQ3 B;  4GSW A;  2KQS A;  1E7P B;  2OOB B;  2M4N A;  5IKC M;  4I6P A;  3K9O B;  3RMK C;  4MGK E;  1EWY C;  4NJC A;  1YNT E;  4WJO A;  3JSV B;  1IP9 A;  2N7J A;  2KT7 A;  1I4X A;  2IY1 B;  2QJL A;  3DBL B;  1UZX B;  2M19 A;  2I2Y A;  2PLP A;  4OZA A;  2LGD A;  2KKC A;  2WXI A;  1ZUD 2;  1EF1 A;  4CO7 A;  3BWU D;  2TSS A;  4DDG D;  2D10 A;  1FXI A;  3AE5 B;  3RYT A;  5DPR A;  3NS8 A;  2VZK B;  3VTU A;  4DHJ B;  4J3O D;  4W9H A;  3VUY A;  2D3A A;  3N1Y C;  3Q3M C;  4OHJ A;  3MC9 A;  4M8N A;  3TEX A;  5BMH A;  3NZ3 A;  4AWJ A;  4DBG A;  3R66 C;  4CYE A;  1V2Y A;  2L3Z A;  4DDI D;  4HXD A;  1HZ6 A;  3Q69 A;  1KLV A;  1JW9 D;  1E10 A;  2G9H D;  2EMT A;  2KN5 A;  2KNB A;  1IPG A;  2QDF A;  4LNK A;  2CS4 A;  3CIR B;  4RCO A;  1NEK B;  2W55 A;  3AMZ A;  3BVZ A;  5HHD G;  4C7Y A;  1N60 A;  1WXV A;  2K6Q A;  2O2V B;  2KFK A;  2JZZ A;  4FA6 A;  2KZR A;  3DBH B;  1YJ1 A;  2LAS A;  1E6E B;  4W9I A;  5C2T B;  1T0Y A;  4GB9 A;  1GG3 A;  1F52 A;  3Q6B A;  4KZC A;  2DZK A;  2C7H A;  2Z0D B;  3L10 B;  3PV1 A;  1V81 A;  5EE3 A;  4C4V A;  1U4A A;  1WE7 A;  1C3T A;  3X0W A;  3HUI A;  1HEZ E;  2GRI A;  3ZNZ B;  4KSK C;  2JWU A;  1D3Z A;  2KJR A;  2KWV B;  2LRU A;  3IVF A;  4WWP A;  4H2A A;  2C7M B;  1QIL A;  1TYG B;  1FRR A;  3TSS A;  1HZ5 A;  1TY0 A;  4JWU C;  4JL9 A;  1J7C A;  2BKF A;  4OZC A;  2H89 B;  2QC8 A;  3R3M A;  5JH5 C;  4BKS D;  4ANX A;  1H4R A;  4NAM A;  4TQ1 A;  5I4D A;  3OJ3 A;  1Z5S B;  2WS3 B;  1IUE A;  3BZD B;  4LNI A;  2FCM A;  2W82 A;  3BK2 A;  4EE2 A;  4P1C C;  1TZ1 A;  2WXG A;  3RFZ B;  3VTW A;  3U7D A;  2MH7 A;  1JRP A;  2MJE A;  1P7F A;  2WXN A;  2C7N B;  1FNW A;  1UWX A;  2AEH A;  1RFA A;  3ML9 A;  1XQQ A;  5GXG B;  3DBR B;  4WWN A;  1OQR A;  2DZM A;  3W1Y A;  4JE3 B;  1JML A;  1WY8 A;  4ZRP A;  2O6V D;  1LXD A;  1PDX A;  2RDG A;  3VTV A;  3BVG A;  4EZJ A;  4RF0 A;  4II3 B;  4ASW C;  3ZIM A;  1GOZ A;  5BYQ A;  4ZYS A;  1OFF A;  3VDZ A;  3VAW A;  2ZVO A;  3SU8 X;  3DBS A;  3HM6 X;  1J0G A;  2NS5 A;  4LCD E;  2IO2 B;  1EM7 A;  2DLB A;  4MGY E;  2MRP A;  3ZTC A;  4IM0 A;  4AJW A;  1QOB A;  2ZW1 A;  3PGE A;  3B0A A;  2MBO A;  1RWS A;  3AEF B;  5DPS A;  4XC2 A;  1E8W A;  2BWE S;  1TS5 A;  2XEW A;  4R3D A;  1WWT A;  2HD5 B;  4WJN A;  1K8R B;  1I35 A;  2IGD A;  3DBL I;  4GDL A;  5T8I A;  3RNB C;  1E8Z A;  1GB4 A;  1OGW A;  3NY5 A;  4DXF A;  1VR9 A;  2WXJ A;  3N3K B;  4YTN B;  1PGA A;  2WWZ A;  3P4S B;  1WRI A;  3RT3 B;  2CJO A;  3JVZ X;  2DYM A;  2BTE A;  4L2Y A;  1FNV A;  1FXA A;  4RM8 A;  2WXP A;  5E6P A;  1VD2 A;  3W5U B;  2BS2 B;  4B9K A;  2LGY A;  3RUI B;  2KQ4 X;  1L0X B;  3DOW A;  4XWW A;  3V6C B;  2CR5 A;  2ONQ A;  3VR9 B;  1P9D U;  1L6V A;  1C79 A;  2JZP A;  3H7P A;  3CF6 E;  2WQY B;  2D3B A;  1IYF A;  4IC7 B;  1WXA A;  2JSV X;  2BYT A;  2A4Z A;  2DAJ A;  2QEJ C;  4HJK A;  1FMA D;  1WGY A;  4IWQ A;  2R61 A;  2L00 B;  4NQL B;  2DZI A;  1YX5 B;  3S2A A;  3MFG A;  4ZOH C;  1LFD A;  3PTF C;  3WAP A;  4HCN B;  2LWP A;  1WMH B;  1TKG A;  3DBH I;  2IZV B;  4ZYN A;  2KWU B;  3U52 E;  1R4N B;  1ACC A;  1HA5 A;  2CU1 A;  4E74 A;  5D94 A;  2C5L C;  3WA0 A;  3KYD D;  1NYR A;  4FHK A;  3TBL D;  3DHH C;  4OVZ A;  1IBX A;  2K9X A;  2WHI A;  4AQ7 A;  4GLS C;  5C3J B;  3U4E G;  1DGJ A;  2LJI A;  2KDM A;  2KDI A;  3OAW A;  3A9J A;  1D5M C;  2L52 A;  2KTR A;  1WJ6 A;  1UUP A;  4WIP A;  1PFD A;  3IT6 B;  1WI0 A;  5BYR A;  2KDF B;  2UYZ B;  2WDR B;  1GJZ A;  1ZXH A;  2ZZP B;  3ZJU A;  3QX1 A;  1WGH A;  4GDK B;  5HFY A;  1UEL A;  2UWQ A;  3SDL C;  1J19 A;  1AAR A;  3N1Z C;  3TJP A;  3DBR I;  3PHX B;  1XLP A;  3P42 A;  1V49 A;  2LFI A;  2RSU A;  5KHQ A;  1TTN A;  3NOB A;  3R2T A;  3Q8E A;  1AN8 A;  1S3S G;  2ON8 A;  3A1Q B;  3PZD A;  2V4I B;  3EHV A;  5G5H A;  2KOX A;  1V8C A;  3AE7 B;  3MTN B;  5IA7 A;  5IAA C;  1KTK A;  3RNG C;  3UGB B;  4TSS A;  4LDT D;  3PSE B;  4XE0 A;  2ZJD A;  5JZE B;  1ZW7 A;  1QT9 A;  4YSZ B;  2ZCB A;  4PS7 A;  3RNF C;  1QOG A;  5BMI A;  1E5W A;  2M1M A;  4N6E B;  2MLB A;  5E6J A;  1E7U A;  3TEZ A;  4E71 A;  3MJW A;  2OJR A;  3P1M A;  2LXA A;  2ZEQ A;  2WU2 B;  2ZW0 A;  4EZK A;  4G50 A;  2GLS A;  5L83 A;  3FIL A;  3QC8 B;  2GBN A;  3WCQ A;  4FJV B;  3LB8 C;  1NI3 A;  4YWG G;  1ESF A;  1T5X D;  4KKJ A;  2PIA A;  2WGS A;  3ZXR A;  2VRR B;  2A5U A;  1L7Y A;  2PPH A;  2KQ7 A;  3DHI C;  4LTU A;  2MA9 B;  4HCP B;  1FO4 A;  4IOI E;  4KIK A;  2WU5 B;  3DQV A;  3QHT A;  3RN9 C;  2PW9 A;  1OQY A;  3AH7 A;  1WGD A;  1FCC C;  2CKH B;  2K39 A;  3C19 A;  2QSD A;  2KXJ A;  3UF8 A;  2QHO A;  2BW2 A;  2GOW A;  1IGD A;  3MHZ A;  3NVY A;  3R8B A;  2NTT A;  2MCN B;  3URY A;  1GPX A;  3O13 A;  3W1S C;  3EUB 2;  3ZNH B;  1UD7 A;  2WYQ A;  2W3S A;  3QAQ A;  4AS1 A;  3KWV A;  2KYW A;  1MVK A;  4FXC A;  4W9C A;  4HLE A;  4BZA A;  1SIF A;  4ICU A;  4MSM B;  1UGJ A;  2VH2 A;  4F8C B;  2K8H A;  2BYF A;  3SEB A;  2N9E B;  3M62 B;  2BF8 B;  3A4S C;  2DHZ A;  3UQA A;  4C4V B;  1KOT A;  2CHX A;  4OW0 A;  2RDH A;  3NVV A;  2IO0 B;  2M56 B;  2SEB D;  3ZW3 A;  3PRE A;  4YXD B;  4HPM B;  3MC8 A;  2LZ6 A;  1N5W A;  1R4N I;  4P1B C;  3MHS D;  4M8M A;  4LK0 M;  2RDB C;  2LGX A;  2L0T A;  2Y5P A;  4MM3 B;  4L23 A;  3IT4 B;  3NS1 A;  1C77 A;  2KK8 A;  3M95 A;  4RNA A;  3A4R A;  1TS4 A;  4J6I A;  1LO5 D;  1YIW A;  2V0G A;  3KQ4 A;  3IFW B;  3GZN B;  4EOY A;  1SJE D;  1R4M B;  4GN1 A;  3UIN B;  4PS3 A;  2IPK D;  4OVU A;  3Q3F A;  5AEK B;  4XWT A;  5J2R A;  2KWD A;  3T8M A;  1V1P B;  1QZE A;  5KHO A;  3AE2 B;  1PGX A;  2W9N A;  4MH8 A;  4YT0 B;  3GOE A;  4IKG A;  4ARI A;  1FIQ A;  1N61 A;  2JF5 A;  4ANW A;  4M0W A;  4C7Z A;  4MSQ B;  3AE6 B;  4W9L A;  3PVL A;  1UF0 A;  1H8C A;  3V60 A;  1K51 A;  1QOA A;  4JGH B;  5FK9 C;  4K7S A;  1UH6 A;  1FXT B;  3P4R B;  1QKZ A;  1FFU A;  1Q5W B;  2KO3 A;  2QCZ A;  4A6Q A;  2V1Y A;  4WAA A;  3JW0 X;  3R2I A;  2V3S A;  1SE4 A;  5J18 A;  3P4P B;  2GBR A;  3N9Y C;  2AL6 A;  2BVC A;  4W9G A;  2K8B A;  2M17 A;  3L17 A;  2XK5 A;  2IYD B;  3TCA A;  4LLG M;  2CU3 A;  1FD6 A;  3HVD A;  2NPT B;  2PE9 A;  2LVP A;  3K9P B;  2JXX A;  2N7E A;  2ACZ B;  1RLF A;  1J7B A;  1D4B A;  3R7R A;  4OZB A;  1QOF A;  4F7Z A;  2G45 B;  5J17 A;  1BXT A;  4IW0 A;  2C9W B;  3WIM A;  4MGZ E;  3ZRF A;  1ZOY B;  5D3D A;  2KWC A;  2D3C A;  4HKQ A;  2AYO B;  3A9K B;  2V3N A;  1TKY A;  2L76 A;  1JWU D;  2J0K A;  1I4G A;  2AWT A;  1DOI A;  2ZCC A;  2MSE D;  5BMG A;  3ONS A;  1STE A;  4JPS A;  3SFE B;  3VR8 B;  2D11 A;  2JT4 B;  2WX0 A;  4NAW A;  1VZ7 A;  1FEH A;  4YSY B;  1WXS A;  2K1F A;  4IWO A;  4F1S A;  1CMX B;  2IO3 B;  4TV3 A;  4FJY A;  2PVG C;  3LDZ E;  1Q1O A;  4AUQ C;  4PK1 A;  1WZ0 A;  3ZKJ C;  3AUL A;  1EU3 A;  1CK1 A;  3N32 A;  1UNS A;  2INP E;  1NEN B;  1K52 A;  1FCL A;  2IJ0 A;  2VH1 A;  4S0R A;  4PT5 A;  3NZU A;  5E6O A;  1WGK A;  3H1U A;  4NPN A;  3KH0 A;  1YQB A;  3IAS 1;  1N63 A;  2GBM A;  1I42 A;  3DCG A;  1SE3 A;  2GMI C;  4ZRJ A;  2K5P A;  2IO1 B;  3JSV A;  4B0E A;  2J42 A;  3DWG C;  4HKZ E;  1ZKH A;  4X57 B;  2G4D B;  2LVQ A;  5EE9 A;  3ZVV A;  2MHJ A;  3W2D A;  3APD A;  3VRA B;  3BIN A;  2C60 A;  2BS4 B;  3UI3 A;  3DHG C;  4MEL A;  1Q10 A;  1QLB B;  1Y8R C;  2RPV A;  2MJD A;  3H7S A;  3RNC C;  4DHZ B;  3RCZ A;  3I57 A;  2SAK A;  3IG3 A;  5DPW A;  1I4H A;  1P1A A;  2KVZ A;  4ZHO A;  4BAX A;  1SBB B;  3HHM A;  4G3X B;  5CHV C;  2V4L A;  1E0Z A;  2N1W A;  4ACF A;  1KRH A;  2UU7 A;  3GZN I;  3H9D A;  1R4M I;  4KVG B;  3MJ5 A;  1YQ4 B;  1UWM A;  2MX2 A;  3HM3 A;  3AM9 A;  3W5V B;  4UDU C;  1WGR A;  4RGM A;  2J7Q B;  3ZRC A;  3SHQ A;  4KSL C;  4W9E A;  3ZJT A;  3HIZ A;  1BML C;  1PYW D;  2Z0E B;  2KX0 A;  1WX8 A;  2ZNV B;  1KLG D;  2AQ3 B;  3O65 B;  4ZDV A;  1XEE A;  1TKE A;  2I38 A;  3HVZ A;  3L0W B;  1J8C A;  4EKU A;  5BYS A;  3Q8C A;  3AXC A;  3DVN V;  3ZUN A;  4BVU C;  1TBE A;  3L4P A;  3UIO B;  5G5G A;  1XXG A;  3QK0 A;  1SB3 C;  1OEY J;  3AE1 B;  4FLH A;  2ZPY A;  2W3R A;  4TUU A;  2KAJ A;  2NBW B;  3KLS X;  5LXH A;  2O6V B;  2INC C;  2YEP B;  1SIJ A;  4MJS B;  2Z8L A;  3QWZ B;  3NZS A;  3ZNG C;  2JQR B;  3DVN U;  3Q3N C;  2WXR A;  1CZP A;  3ENE A;  4ZHP A;  3NUH B;  5LXI B;  3ZQ4 A;  1F9J A;  2JWZ A;  5H92 C;  1C78 A;  3AV8 A;  1KJT A;  1CJE A;  2JY6 A;  1V6E A;  2LHD A;  4RGN A;  1WJ4 A;  4D2K A;  1Z2M A;  3A33 B;  3JYU A;  2X8X X;  3AE3 B;  5EE0 A;  1T0S C;  2DEN B;  4GXB A;  1EWC A;  4LNF A;  1B1Z A;  2BQQ A;  2B3A A;  2FUG 1;  3GE3 C;  4MEM A;  2KN4 A;  3N30 A;  5AZF A;  1OTR B;  2J0M A;  4NQK E;  4P6V F;  1MG8 A;  1FFV A;  3TIX A;  2JXT A;  4EFO A;  3NG0 A;  4EUT A;  4KIK B;  2KDB A;  4FHJ A;  2OHF A;  4A90 A;  3TEW A;  1KLU D;  2KVR A;  1I4Q A;  5L95 C;  5AZH A;  2JZ3 B;  1E8Y A;  2KAN A;  4G11 A;  2KD0 A;  4WWM A;  1WZ3 A;  1F2R I;  2WXM A;  4LJO B;  1L4D B;  2MBE A;  4A20 A;  4WQM A;  2BB5 A;  4N58 A;  3QA8 A;  1ROE A;  1GB1 A;  1B9R A;  2PMV A;  2KHW B;  3CST A;  2QIL A;  2N4F A;  2NBV B;  4WUR A;  3V05 A;  3NHE B;  2WP9 B;  3ZJV A;  4C00 A;  4AJY B;  1L6U A;  2WXF A;  1A70 A;  4NJ6 A;  4ITK A;  5HKH A;  3OG5 A;  5MPO A;  1FRD A;  3RPF C;  4KGR A;  3RNA C;  4XDC A;  2EEL A;  2M0X A;  2E3T A;  4GMV A;  3PRM B;  1WE6 A;  1YD8 U;  5IOI A;  1JCK B;  3T9L A;  3ZTD A;  4NY0 A;  1Q0W B;  1J7A A;  2JUO A;  2V3P A;  4YTM B;  3LXF A;  5EDS A;  3GE8 C;  4K7U A;  1HE8 A;  4NNJ B;  3RZF A;  1LGR A;  3OWE B;  2AQ1 B;  3UIP B;  3OLM D;  5D2M B;  1L4Z B;  2KAC A;  2WNM A;  4XDD A;  4WJP A;  1L5P A;  4N59 A;  2LUM A;  1OQQ A;  1QQR A;  1S1Q B;  5CTR C;  1WYW B;  3T3N A;  3FAH A;  3ZGZ A;  1RYJ A;  3AE4 B;  1E90 A;  4K81 A;  1F1H A;  4MAC A;  2HTM E;  4DWF A;  1NYQ A;  3EC8 A;  4IWP A;  2K25 A;  1WH3 A;  4K7W A;  4HVB A;  4M0W B;  4XGA B;  1E7V A;  2WXQ A;  2KFJ A;  2N9X A;  2G4S A;  2H88 B;  2KX3 A;  4FBJ B;  4G0N B;  2GI9 A;  2BGF A;  3B9J A;  1N6Z A;  4MDK E;  1UBQ A;  5BO4 B;  1C76 A;  2NTS A;  2V9H A;  2MWS B;  1NDD A;  2FBW B;  3W1S A;  4ICV A;  2JVC A;  3TEY A;  2HJ8 A;  3ML8 A;  3HRD D;  3H6N A;  4AOF A;  1WMH A;  4W9J A;  2NBU A;  3AEC B;  3MP9 A;  4JQW C;  1PGB A;  1KF6 B;  3PZ8 A;  4C80 A;  2BT6 A;  1T3Q A;  3VUX A;  2FUH B;  3U30 A;  2DBY A;  4GU2 A;  4RH6 A;  3I9V 1;  2LMC A;  3W9C B;  3OJ4 B;  4LDT B;  5G55 A;  3ZNI D;  1P3Q U;  3D32 A;  4B95 A;  2KFK B;  1I7H A;  3T3O A;  1WM2 A;  5JHB A;  2ASQ A;  2NR2 A;  1T0Q C;  2LEK A;  4HJG E;  1SXT A;  1EUV B;  1EF5 A;  2GBK A;  3BY4 B;  4LJP B;  3LYY A;  3ZDM C;  3B2F A;  1WXQ A;  2X38 A;  3Q3O C;  2WLB A;  4Q2J A;  4HDQ A;  5IN7 A;  2YLM A;  1P0R A;  3VH4 B;  2N9K A;  5CHF A;  1JAL A;  2NMQ A;  3CSF A;  1JWB D;  5E6N A;  4ZRI A;  3PO0 A;  4RFB A;  2D2Q A;  4NJ7 A;  2VZK D;  3M63 B;  4DHJ D;  3PLU A;  1QF6 A;  3QCA A;  3APC A;  4KDL B;  3QIJ A;  4USA A;  3V3X A;  1AW7 A;  1WSP A;  2XNA C;  4HWI B;  1M94 A;  1L0Y B;  4BKT A;  3Q3J A;  1K50 A;  3U2S C;  4BKG A;  1ISN A;  3ECI A;  3CWI A;  1FM0 D;  1ZP0 B;  2XBB C;  2PE6 B;  4CQN A;  3I63 C;  3AN1 A;  3PLV A;  4A9A A;  1GUA B;  3AED B;  4LNO A;  5EE1 A;  2FIF A;  4RF1 A;  2WDV B;  4RGO S;  4WWO A;  1XF5 L;  5IP4 D;  1PQS A;  2FCS A;  1MJD A;  4WH4 A;  1VZ8 A;  1DYQ A;  2KJH B;  1V80 A;  1D5Z C;  1E9M A;  1AYF A;  1MG4 A;  3AEE B;  2BBC A;  1VDV A;  1XCQ L;  4IUM B;  3VRB B;  4DQO C;  4B6W A;  1C4A A;  4MGI E;  3AEA B;  1HQR D;  1WR1 A;  5DCN A;  4A3O A;  4ARC A;  5D3I B;  2D3G A;  5LLI A;  2IND C;  1EU4 A;  1SSN A;  4EZL A;  2IY0 B;  1T0R C;  2MBH A;  3KW5 B;  2LI5 A;  4HEA 1;  4FN2 A;  5HI1 A;  2BS3 B;  2GB1 A;  4KV2 A;  3APF A;  3N1X C;  4GDL B;  3SR6 A;  1N62 A;  5AUK A;  3QJZ A;  4M02 A;  2LRW A;  4YTP B;  1TGZ B;  2FE8 A;  4HDO A;  4HRS A;  2Y3A A;  3DDC B;  2MBQ A;  4K3B A;  3CMM B;  3EFC A;  2DYB A;  1R7S A;  5AZG A;  1I4P A;  5FR6 A;  1XCT L;  2NCN A;  1YX6 B;  1V9J A;  3RZW C;  3P4Q B;  2BKR B;  4TKN A;  2KLG A;  3EEC A;  1RFK A;  4WAF A;  2BPS A;  2KDE B;  1XO3 A;  2IDY A;  4W9D A;  3NRZ A;  2IGH A;  2LVO A;  2Q5W D;  1KH0 A;  1SE2 A;  1CQV A;  1BT0 A;  2HDE A;  1WGG A;  1YOV B;  3RI7 C;  2BYV E;  3H7P B;  4REZ A;  1VCB A;  5GMV A;  2DAF A;  1SEB D;  3SD5 A;  1L2N A;  3NJT A;  2ZVN A;  3AEB B;  2MP2 A;  3VH3 B;  1C4P A;  2EKE C;  1VJK A;  1E8X A;  1NVI D;  2QIE B;  4MM3 A;  1TS3 A;  3BYY B;  4RM9 A;  3KUZ A;  1TZO A;  2J53 A;  1ZXI A;  2KMA A;  1ET9 A;  1YN4 A;  4I6L B;  1HXY D;  2Y5B B;  3C0R B;  3MC0 B;  2RGF A;  1Y56 A;  2L0F A;  4K1R B;  2M0A A;  4KDI C;  4S17 A;  2WX1 A;  4IG7 B;  3AEG B;  1F77 A;  5JHA A;  1RRB A;  3E56 A;  4US8 A;  3VQI A;  3DVG X;  3BYT B;  2JU6 X;  3BK1 A;  1XLN A;  2GBJ A;  2MEK A;  2K8C A;  4KZ0 A;  1WXM A;  1IBX B;  1V1P A;  2MQJ A;  3WAN A;  1JWS D;  3L54 A;  2FAZ A;  1WYG A;  2JYE A;  3V62 A;  2PKO A;  2WDQ B;  1MI0 A;  3PHW B;  2ZPN A;  5AUI A;  3WAO A;  2IBI B;  2RPQ A;  3VHT C;  1D5X C;  3A9J B;  3EFU A;  1RM6 C;  4O1N A;  2KTR B;  3TL5 A;  1VZ6 A;  4M00 A;  1GNU A;  3TUO A;  5LNK 1;  2L83 A;  3PZ7 A;  2PEA A;  2KC2 A;  4IM2 A;  4KGT A;  1UBI A;  3U8Z A;  2L7R A;  4WJQ A;  3IBE A;  3VFK A;  5D7G A;  3PT2 B;  2W54 A;  2CJN A;  1ZPS A;  4JLC A;  4I6N B;  2K3U A;  2KJ6 A;  1VLB A;  4HRO A;  1TT5 B;  2WXK A;  4KGS A;  2LGS A;  4BOS C;  5DPT A;  2AL3 A;  1TIF A;  3I3T B;  4DXA B;  1TY2 A;  3Q8F A;  4DXG A;  2DX5 B;  2LXC A;  3PS6 A;  2NPT A;  1WJU A;  4A3P A;  2KMM A;  1WF9 A;  3V61 A;  3NVW A;  2NVU I;  2O2V A;  3RNE C;  4HPL B;  4PS8 A;  3ALB A;  3BII D;  1JRO A;  4IDI A;  1P98 A;  4PYU A;  2FID A;  4URK A;  1WFY A;  2QMT A;  2I1J A;  2E6X A;  2R2Q A;  1KFY B;  4WQO B;  3A9K A;  3LJ3 A;  3C8Y A;  1RAX A;  4FAD A;  2IGG A;  3VUW A;  2AQ2 B;  4EEW A;  1XLQ A;  3N20 C;  2REX A;  3Q8B A;  1DOX A;  4IM3 A;  2L32 A;  2WXO A;  3PPA A;  1XT9 B;  4LNN A;  1FPY A;  4FJZ A;  3EA6 A;  3FIL B;  1DOY A;  2MBB B;  4MT5 A;  2LJ5 A;  3ZYY X;  3DPD A;  3KYC D;  1V1O A;  2WDT B;  4YL8 A;  4US9 A;  4L1B A;  4ZRQ A;  1HTQ A;  2RD0 A;  3DWM A;  3V6E B;  2KTF A;  4W9K A;  1IGC A;  1SGH A;  2Y5C A;  3RD2 A;  3FC4 A;  3U7Z A;  4DHZ E;  2KC1 A;  4C56 C;  1V97 A;  1WJN A;  2DYO A;  2J0J A;  2FCQ A;  3ZO5 B;  5TR5 A;  1F2R C;  5TSS A;  3IXS A;  1BUI C;  4QAY A;  1WR6 E;  2LGI A;  3ZXV A;  3Q2A C;  1NBF C;  2LHE A;  2J4X A;  2K6D B;  4DK5 A;  2N7D A;  1VRA B;  3EGR A;  2FCN A;  1TJE A;  5D6J B;  4CHK A;  3P63 A;  1MHX A;  5FKA C;  1C9F A;  3QQ8 B;  2YVC A; 
#chains in the Genus database with same CATH homology
 2N0S B;  1EM7 A;  1N5X A;  2K0P A;  1K53 A;  2DLB A;  2J52 A;  1I7H A;  3T3O A;  4LLG M;  1GAQ B;  2CU3 A;  1FD6 A;  4TQ0 A;  3HVD A;  1QOB A;  2ZW1 A;  2LEK A;  1M4V A;  2ACZ B;  1RWS A;  3AEF B;  1J7B A;  1TS5 A;  1D4B A;  4OZB A;  1QOF A;  4HJG E;  1SXT A;  4R3D A;  5H8Y E;  1WWT A;  1BXT A;  2IGD A;  3LYY A;  5T8I A;  3B2F A;  1ZOY B;  5D3D A;  1GB4 A;  1WXQ A;  1MPE A;  2X38 A;  2WLB A;  4Q2J A;  4DXF A;  4HKQ A;  1VR9 A;  2WXJ A;  1D6E C;  2N9K A;  2V3N A;  1ET6 A;  4YTN B;  1JAL A;  2L1A A;  1PGA A;  1TKY A;  2NMQ A;  1JWU D;  4KX6 B;  1JWB D;  1WRI A;  3P4S B;  2CJO A;  2DYM A;  1I4G A;  3PO0 A;  4RFB A;  3ABV B;  2BTE A;  1DOI A;  4L2Y A;  1FNV A;  5BMG A;  1MHH E;  2VZK D;  1FXA A;  1YJJ A;  2D5G A;  2WXP A;  1STE A;  1QF6 A;  1I4R A;  4JPS A;  3SFE B;  3VR8 B;  3W5U B;  2BS2 B;  2PTL A;  1VZ7 A;  1FEH A;  4YSY B;  2KQ4 X;  4USA A;  3V3X A;  1AW7 A;  1WSP A;  2XNA C;  1L0X B;  4XWW A;  1L0Y B;  2ONQ A;  2PVG C;  3VR9 B;  1K50 A;  3U2S C;  1L6V A;  1C79 A;  2JZP A;  3CWI A;  1TS2 A;  4JX1 C;  1FM0 D;  1ZP0 B;  2PVO D;  2WQY B;  1EU3 A;  3GP7 A;  2JSV X;  1CK1 A;  3SFD B;  2BYT A;  3NVZ A;  2QEJ C;  1UNS A;  4CQN A;  2INP E;  1NEN B;  1K52 A;  1FMA D;  1T6B X;  2YEP F;  1FCL A;  2IJ0 A;  3AE8 B;  2R61 A;  3AB5 A;  4PT5 A;  4A55 A;  3AN1 A;  4A9A A;  1WGK A;  3AED B;  5EE1 A;  1F0Z A;  3MFG A;  1FNU A;  2WDV B;  4RF1 A;  4ZOH C;  3AE9 B;  2WXH A;  2XN9 C;  4RGO S;  2MJ3 A;  2G1E A;  2OED A;  1XF5 L;  3IAS 1;  1N63 A;  4P16 A;  1TKG A;  2EKI A;  1SE3 A;  2AX5 A;  4WH4 A;  1VZ8 A;  1AWD A;  1JWA D;  2K5P A;  2K22 A;  1DYQ A;  1D5Z C;  2DWQ A;  4B0E A;  3U52 E;  2J42 A;  3DWG C;  4HKZ E;  1E9M A;  1ACC A;  1HA5 A;  1AYF A;  4KKI A;  1ENF A;  5EE9 A;  3AEE B;  2BBC A;  1VDV A;  1XCQ L;  3B2G A;  1JWM D;  3W2D A;  3VRA B;  3VRB B;  1NYR A;  2BS4 B;  3UI3 A;  4DQO C;  4OVZ A;  4RGT A;  1JQ4 A;  1Q10 A;  1L0V B;  1QLB B;  1IBX A;  1C4A A;  2MJD A;  2RPV A;  2K9X A;  2ICI A;  3AEA B;  4AQ7 A;  1HQR D;  4GLS C;  1YJI A;  3GB1 A;  3I57 A;  1ZDV A;  3J9C A;  4ARC A;  2SAK A;  5C3J B;  5D3I B;  1YN5 A;  1I4H A;  1DGJ A;  3U4E G;  2LJI A;  2KDM A;  1EU4 A;  1SSN A;  4ZHO A;  1SBB B;  4TMA B;  4B0M A;  1E0Z A;  1D5M C;  2L52 A;  2RMM A;  1KRH A;  2N9L A;  4HEA 1;  5HI1 A;  2BS3 B;  1UUP A;  4WIP A;  1YMH E;  3KWL A;  2GB1 A;  1PFD A;  1ZDX A;  3IT6 B;  3MJ5 A;  1YQ4 B;  1UWM A;  5JXV A;  4GDL B;  2WXL A;  3SR6 A;  5BYR A;  3AM9 A;  1N62 A;  5AUK A;  3W5V B;  4UDU C;  4RGM A;  2WDR B;  3BVM A;  4YTP B;  1ZXH A;  2FE8 A;  3ZJU A;  1C4C A;  4HRS A;  4GDK B;  2Y3A A;  1SF0 A;  5FR3 A;  3ZJT A;  5HFY A;  1PUT A;  1BML C;  1PYW D;  3IAM 1;  1R7S A;  1I4P A;  1XCT L;  1KLG D;  2B76 B;  2JX5 A;  1XLO A;  2AQ3 B;  3E9S A;  3H8H A;  1XEE A;  1TKE A;  4YSX B;  2I38 A;  3ETR A;  3HVZ A;  5BYS A;  3P4Q B;  3Q8C A;  2BB6 A;  1RFK A;  4WAF A;  4NAW B;  3L4P A;  1XO3 A;  4NZL B;  5G5G A;  2IDY A;  3GS2 A;  1XXG A;  3NRZ A;  1XLP A;  1SB3 C;  2IGH A;  3P42 A;  1YN3 A;  2LFI A;  2Q5W D;  3AE1 B;  4JWS C;  1KH0 A;  1SE2 A;  2W3R A;  3R2T A;  2INN E;  1P7E A;  1CQV A;  3Q8E A;  1AN8 A;  2HDE A;  2KAJ A;  2ON8 A;  3KLS X;  2V4I B;  2JYT A;  4REZ A;  5G5H A;  1V8C A;  3AE7 B;  2YEP B;  1KTK A;  4A8X C;  5HG2 A;  1SIJ A;  1SEB D;  1ZE3 D;  4TSS A;  3AEB B;  2Z8L A;  1SJH D;  1C4P A;  1VJK A;  4XE0 A;  1NVI D;  2JQR B;  2QIE B;  1TS3 A;  4YSZ B;  1QT9 A;  2WXR A;  3BYY B;  1CZP A;  1YQ3 B;  3Q8A A;  1QOG A;  4ZHP A;  3NUH B;  5BMI A;  1TZO A;  2J53 A;  3ZQ4 A;  5H92 C;  1C78 A;  1ZXI A;  3AV8 A;  1E7P B;  4N6E B;  1CJE A;  5E6J A;  3TEZ A;  1ET9 A;  1YN4 A;  2LHD A;  3P1M A;  4RGN A;  4D2K A;  1HXY D;  3MC0 B;  2WU2 B;  2ZW0 A;  1Y56 A;  3AE3 B;  1EWY C;  5EE0 A;  2M0A A;  1YNT E;  4NJC A;  3FIL A;  1EWC A;  2N7J A;  1B1Z A;  1I4X A;  2FUG 1;  3AEG B;  3WCQ A;  1F77 A;  2KN4 A;  2QJL A;  4P6V F;  3E56 A;  4US8 A;  3VQI A;  3LB8 C;  1FFV A;  1NI3 A;  2JU6 X;  1XLN A;  2JXT A;  3BK1 A;  3BYT B;  4YWG G;  1ESF A;  2M19 A;  1T5X D;  2MEK A;  2PIA A;  4KKJ A;  2I2Y A;  1IBX B;  1V1P A;  2PLP A;  4OZA A;  2OHF A;  4A90 A;  3TEW A;  1JWS D;  1WYG A;  2JYE A;  2WXI A;  1KLU D;  1ZUD 2;  2PKO A;  1MI0 A;  2WDQ B;  4LTU A;  5AUI A;  1FO4 A;  4IOI E;  1I4Q A;  2WU5 B;  1D5X C;  3BWU D;  2TSS A;  1FXI A;  2PW9 A;  1RM6 C;  3AE5 B;  4O1N A;  2VZK B;  3AH7 A;  1FCC C;  4J3O D;  4WWM A;  1VZ6 A;  2QSD A;  1F2R I;  2WXM A;  1L4D B;  4OHJ A;  4WQM A;  3TEX A;  5BMH A;  2BW2 A;  3NZ3 A;  3TUO A;  2BB5 A;  5LNK 1;  2L83 A;  4N58 A;  1IGD A;  3PZ7 A;  1HZ6 A;  3MHZ A;  3Q69 A;  3NVY A;  1ROE A;  1JW9 D;  3R8B A;  1GB1 A;  2NTT A;  1E10 A;  2G9H D;  1B9R A;  4KGT A;  3URY A;  2PMV A;  2QIL A;  5D7G A;  2W54 A;  2CJN A;  3O13 A;  1ZPS A;  3CIR B;  3EUB 2;  4RCO A;  1GPX A;  1NEK B;  2K3U A;  1VLB A;  4HRO A;  2W3S A;  2W55 A;  3AMZ A;  3KWV A;  4WUR A;  4AS1 A;  1MVK A;  2WXK A;  4FXC A;  4KGS A;  3V05 A;  3BVZ A;  5HHD G;  4C7Y A;  1N60 A;  2WP9 B;  3ZJV A;  1TY2 A;  3Q8F A;  1UGJ A;  1L6U A;  4DXG A;  2WXF A;  1A70 A;  4ITK A;  3SEB A;  2KMM A;  5MPO A;  1FRD A;  3NVW A;  3RPF C;  4KGR A;  1E6E B;  4OW0 A;  2RDH A;  3NVV A;  5C2T B;  2M56 B;  4XDC A;  2EEL A;  2SEB D;  4YXD B;  3BII D;  2E3T A;  1JRO A;  5EE3 A;  1JCK B;  1N5W A;  4IDI A;  4LK0 M;  1J7A A;  2Y5P A;  4MM3 B;  3HUI A;  4L23 A;  1HEZ E;  2V3P A;  3IT4 B;  4YTM B;  2GRI A;  3LXF A;  2QMT A;  1C77 A;  3NS1 A;  2E6X A;  4RNA A;  1KFY B;  1TS4 A;  2JWU A;  3OWE B;  2AQ1 B;  3C8Y A;  1LO5 D;  2IGG A;  4H2A A;  1L4Z B;  2KAC A;  2WNM A;  2AQ2 B;  3I9V 1;  2V0G A;  1XLQ A;  4XDD A;  1QIL A;  1DOX A;  3Q8B A;  2L32 A;  2WXO A;  1TYG B;  3KQ4 A;  1FRR A;  1L5P A;  3EA6 A;  3FIL B;  4N59 A;  3TSS A;  1HZ5 A;  1TY0 A;  1DOY A;  2LUM A;  1OQQ A;  1SJE D;  1QQR A;  4JWU C;  1J7C A;  4MT5 A;  4OZC A;  3ZYY X;  2H89 B;  3T3N A;  3FAH A;  3ZGZ A;  4NAM A;  1V1O A;  4TQ1 A;  1RYJ A;  2IPK D;  3AE4 B;  5I4D A;  4US9 A;  4MAC A;  2HTM E;  2WS3 B;  1IUE A;  4L1B A;  4ZRQ A;  4XWT A;  3BZD B;  3DWM A;  2KWD A;  2W82 A;  1NYQ A;  1V1P B;  3BK2 A;  4EE2 A;  3AE2 B;  2WXQ A;  1IGC A;  1PGX A;  4MH8 A;  4YT0 B;  2WXG A;  2Y5C A;  3RFZ B;  2H88 B;  4IKG A;  4ARI A;  1FIQ A;  3FC4 A;  1N61 A;  3U7Z A;  2MH7 A;  1JRP A;  2GI9 A;  3B9J A;  4M0W A;  4C56 C;  1V97 A;  1P7F A;  2MJE A;  2WXN A;  4C7Z A;  1C76 A;  1FNW A;  1UWX A;  2NTS A;  2DYO A;  3AE6 B;  5GXG B;  1OQR A;  2FBW B;  3W1S A;  1F2R C;  1K51 A;  1QOA A;  4JE3 B;  5TSS A;  3TEY A;  3HRD D;  1JML A;  3IXS A;  5FK9 C;  1BUI C;  4ZRP A;  3P4R B;  1PDX A;  1QKZ A;  2LGI A;  2RDG A;  3AEC B;  3MP9 A;  1PGB A;  2LHE A;  1KF6 B;  2J4X A;  1FFU A;  3BVG A;  4A6Q A;  1VRA B;  3EGR A;  4RF0 A;  1TJE A;  3PZ8 A;  4C80 A;  2BT6 A;  1T3Q A;  1GOZ A;  5BYQ A;  4ZYS A;  3P63 A;  1OFF A;  1MHX A;  5FKA C;  1C9F A;  3R2I A;  2DBY A;  4RH6 A;  1SE4 A;  2LMC A;  3P4P B;  3N9Y C;  3W9C B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...