1QQRA

Crystal structure of streptokinase domain b
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
138
structure length
138
Chain Sequence
IQNQAKSVDVEYTVQFTPLNPDDDFRPGLKLTKLLKTLAIGDTITSQELLAQAQSILNKNHPGYTIYERDSSIVTHDNDIFRTILPMDQEFTYRVKNREQAYRINKKSGLNEEINNTDLISEKYYVLKKGEKPYDPFD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords STREPTOKINASE DOMAIN B
publication title Crystal Structure of Streptokinse Domain B
rcsb
molecule tags Hydrolase activator
total genus 35
structure length 138
sequence length 138
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 1999-06-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02821 Staphylokinase Staphylokinase/Streptokinase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.180 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1qqrA00
1C4PA 1L4ZB 1L4DB 1QQRA 1BMLC
chains in the Genus database with same CATH superfamily
2N0SB 5J2RA 3UIOB 4ITKA 1GAQB 4ANWA 2INDC 3DDCB 4P1CC 2KDFB 2WXGA 2LHDA 3GE8C 2DYOA 4ZRPA 2BS3B 3H7PB 1I4RA 2N9PC 3KYDD 1N6ZA 1OGWA 1WGGA 3VUXA 4FADA 2K5PA 4XZ4A 4DXGA 2KJRA 3ZXRA 3BVGA 2WXFA 3RNEC 3NZUA 1JCKB 4NPNA 4W9EA 5HI1A 4DHZE 1J8CA 1RM6C 4TV3A 1TZOA 3ZJVA 4YT0B 2NS5A 3L17A 2LUMA 2XBBC 4M0WA 2KC2A 5FKAC 1K51A 4O1NA 3V60A 5AUIA 3W2DA 3PLUA 5LXIB 2KQSA 5DPSA 1BT0A 1SE2A 3P1MA 2PE6B 1HXYD 1VZ6A 2IBIB 3Q3FA 2KVRA 4M8MA 1WY8A 2XK5B 4DDGD 2L3ZA 1YN4A 1C77A 1I4PA 1UBIA 4WJPA 4IW0A 2ZNVB 4KGSA 1SIFA 3MHZA 2D07B 1C3TA 4MJSA 1DGJA 4RFBA 1TS5A 3PHXB 2E6XA 4RGOS 3QC8B 1QLBB 3PZ7A 4ZRKA 1VRAB 3VR8B 4XWWA 1H4RA 1Z2MA 3MC0B 3ZNGC 2BTEA 3RT3B 1YN3A 2V3NA 2RGFA 2WXOA 1WJ4A 1MJDA 1WRIA 3QWZB 1MVKA 1R4MI 5D7GA 3AECB 1NYRA 2PVGC 3L08A 3AU4A 1FM0D 2BB5A 5BYSA 2BKFA 2UWQA 1YJIA 3PTFC 5AZFA 1YD8U 2MHJA 1KTKA 4FULA 2J7QB 4M01A 4ANVA 4G50A 3QHTA 1HTOA 2NBVB 4USAA 1ET6A 4ZDVA 1EWCA 2WHIA 2L83A 2W82A 1I35A 1HTQA 2J52A 1T3QA 4G11A 4GOCA 2QSDA 3UIPB 4W9KA 2X38A 1M94A 4XWTA 2MBBB 2ZNVC 2LXAA 2NBWB 4JWSC 2D3GA 1XCTL 3B1LX 1FEHA 4ACFA 4HVBA 1GPXA 1SJHD 5KHOA 3FILB 4II3B 3N30A 2KNBA 5EE9A 4ICUA 4B6WA 3UF8A 2JZ3B 3AEBB 2ON8A 1SSNA 2WXQA 3AEDB 2IO3B 3VUWA 3V6EB 2VH2A 4EUTA 3NVWA 4W9FA 1FIQA 4WWPA 4C00A 2REXA 3APFA 4GLSC 2D2QA 3IG3A 2LGIA 4II2B 2JU6X 3V61A 1VZ7A 2L0FA 5TR5A 3Q69A 4BKSD 3QQ8B 5BYQA 3EA6A 1ZP0B 4DHJD 3A9JA 2EELA 3IBEA 1MPEA 4LDTB 2M0XA 1E7PB 4A55A 4KDIC 5CTRC 2FAZA 1V1PB 3TUOA 1RLFA 1PYWD 1VLBA 1PUTA 2AQ1B 1N5WA 1U4AA 1RFKA 1DOXA 3P42A 4DK5A 4UDUC 1KM7A 1ZOYB 1TKYA 5DCNA 1TY0A 1SE9A 2ACZB 2O6VD 2WXNA 2GLSA 5JHAA 4ZRIA 4GB9A 4HKQA 1PQSA 2Q5WD 3ETRA 1M4VA 3CWIA 3ONSA 1MHHE 3ZTDA 1TGZB 2GBNA 4A3OA 4W9IA 3VFKA 1FRRA 2WDQB 1UELA 1F52A 3TCAA 1FXTB 1VJKA 3V62A 4LK0M 1WM3A 1RRBA 4KKIA 2PW9A 4JIOU 3N20C 3VDZA 3UQAA 4GDKB 5IN7A 1A5RA 1HE8A 2X8XX 3MHSD 1GB1A 3H7SA 5EE3A 1V5OA 2NMQA 2HE7A 3R2TA 4MT5A 1UGJA 2Y5CA 4W9LA 1B9RA 4MH0E 4PT5A 3A33B 3JSVB 4BFRA 2VZKB 3NZSA 2LVQA 1LQBA 2Y3AA 3AM9A 3MTNB 3QCAA 4LNFA 4K81A 2K6DB 2LGSA 5JHBA 1RFAA 4HPMB 2WQYB 2BYEA 4ZRJA 1PGAA 4TMAB 3BZDB 3NY5A 3PHWB 1WGRA 4JE3B 3P4QB 4NAWB 2JF5A 3VAWA 1Q1OA 2FE8A 2JT4B 1N60A 1OTRB 3HM6X 1QILA 3ZJTA 4PYUA 1FCLA 3WA0A 4RNAA 4K7SA 1C4PA 3RNGC 4EZKA 3PPAA 3QJZA 1MG4A 1D4BA 4B0EA 3ZKJC 1F77A 4H2AA 3HIZA 1IGCA 1WE7A 2RDBC 4GN1A 3RCZA 1SE3A 1RYJA 2IDYA 2LHEA 1CJEA 2MP2A 3OWEB 3VXWA 4X57B 4IG7B 3DOWA 3AE2B 2LI5A 2KN4A 5FK9C 3DPDA 4FN2A 3MJ5A 1GG3A 4A6QA 2H89B 3AE1B 3AEEB 1E8YA 5DPWA 1XLPA 1T0SC 3ZRFA 2WXPA 4GMVA 1JWAD 1P1AA 2MQJA 4MDKE 4YSZB 1WGKA 2PJHA 3RPFC 2MW5A 1XEEA 1UUPA 2D11A 5IA7A 2KFJA 2Z59B 3ZJUA 2OHFA 4OVVA 1L6VA 2C5LC 2IO2B 3B08A 1YQBA 1Z5SB 4HCPB 3TEYA 2JQRB 1QZEA 3OAWA 2J4XA 4E3CA 1BXTA 1K53A 2WDRB 1ZGUB 4YSXB 2N9XA 1WGYA 3AMZA 2YEPB 2M1MA 3UINB 1TS2A 3VH4B 3PRMB 2KO3A 4BBNF 4RMAA 1E6EB 3IHPC 4WWMA 2PVOD 3WCQA 1UBQA 1OFFA 1T0QC 4GIVA 2GRIA 4ARIA 3CIRB 1E5WA 4HJKA 5CX3A 4XDCA 2J0MA 4AJYB 4BOSC 4BBNC 2BF8B 1VD2A 2QIEB 1E8ZA 3BY4B 3GB1A 1UH6A 1WMHA 1Q5WB 2N7DA 2BS2B 3MC8A 1OEYA 4W9HA 4S0RA 1EF5A 1WFYA 4B9KA 5J17A 2N7JA 4WH4A 3NZ3A 2DYBA 2FNJB 4B0MA 4ZOHC 1FRDA 1TKEA 1NDDA 4KZ0A 2WWZA 4DBGA 4HDOA 2JWUA 4C7YA 4JL9A 2YEPF 1ET9A 4NY0A 3U8ZA 1FCCC 4J6IA 1SE4A 3PRZA 3FAHA 2J42A 5BO4B 1WM2A 2RPQA 4US9A 2KK8A 4IDIA 4LNNA 2ZPNA 3LYYA 2ZCCA 3AEAB 3L4PA 3I5JC 3U7ZA 2C9WB 2L0TA 2IY1B 1TIFA 3ZLZA 2MBHA 1WYGA 5G55A 2WU2B 2IJ0A 1F2RC 2K6QA 1HA5A 1C4AA 1TS4A 1JQ4A 2KMAA 5G2NA 1DOYA 2JYEA 2D3CA 1T0RC 2SAKA 3ZO5B 4KDLB 5KHQA 4M0WB 5D3DA 2MBOA 1OQYA 4P1BC 2MCNB 1S3SG 1VCBA 2CHXA 1WZ3A 1QOBA 4CQNA 4ANUA 3DVGY 3L0WB 3HHMA 3V3XA 1EM7A 5T8IA 1IPGA 1ACCA 1WRDB 3P4SB 2K9XA 2K3UA 3R8BA 4DXFA 1TTNA 2WXIA 2TSSA 3LJ3A 2DZKA 4N58A 2ZW1A 3A4RA 3AEGB 2ZJDA 3R66C 4HWIB 1ZW7A 2EMSA 2LJ5A 4WJNA 4BAXA 2FBWB 1IUEA 2RSUA 2ZVNA 2DENB 4LNOA 2ZW0A 1C1YB 1KLUD 3U4EG 3W1SA 4G3XB 5AUKA 5LNK1 4ZHOA 2YLMA 4IC7B 1ZUD2 2V9HA 3I63C 3V6CB 3W9CB 4C80A 1N62A 3IVFA 3KQ4A 1E8XA 1D6EC 2LJIA 4M8NA 4EKUA 2IGHA 2K8BA 4OVZA 2FCNA 2NPTB 2WX0A 2XEWA 3J9CA 2IPKD 2KD0A 1ZE3D 3TL5A 2YVCA 4IOIE 1TKGA 2KFKA 4KIKA 3RI7C 1Q10A 2GBRA 3NVVA 4P6VF 3EFUA 5CHVC 5E6NA 2W3SA 4MSQB 4I6LB 2IZVB 2W54A 4IM3A 4PYZA 3HRDD 4D2KA 4PK1A 2B3AA 1ESFA 4JGHB 4ZYSA 2KTFA 2Y5BB 1E0ZA 2IO1B 2HJ1A 1P9DU 1BMLC 3ML8A 4HDQA 5C3JB 3DBRB 2MJDA 2BPSA 2MH7A 2WLBA 3Q2AC 4OZCA 4A90A 2LZ6A 3AI5A 1FXIA 2DLBA 3QK0A 3SHQA 4N59A 5HHDG 1WF9A 2INPE 2KHWB 3JW0X 2LGXA 1WWTA 2H88B 1GNUA 1WXQA 3BVZA 2KTRA 4K7UA 3GZNB 1FPYA 3KW5B 5HKHA 1PFDA 4YTNB 1WGHA 5EDSA 2WXHA 2KQ7A 4OVUA 4KGRA 1P7FA 4LNKA 2KWCA 5G5GA 3BVMA 1I4GA 3APDA 3NG0A 2HTME 3WALA 2CHWA 1J7AA 2RD0A 3PGEA 2FIFA 2WXLA 2AL3A 2R61A 1GC6A 1I7HA 4RF1A 2JSVX 1RWSA 1LM8B 2RDHA 2IO0B 1FFUA 3AH7A 3FKYA 5TSSA 2KAJA 2W55A 4EE2A 3M62B 2N1WA 2L05A 2CHZA 2XK5A 3N32A 4AWJA 1VDVA 2L00B 2DX5B 2MBQA 2NVUI 1STEA 2AWTA 1XQQA 4FA6A 3L16A 3TEWA 5CHWA 3CSTA 3Q8FA 2I2YA 5AZGA 2MSED 2N1VA 4US8A 4YTMB 1JRPA 2GMIC 4FXCA 1AWDA 2BWFA 4TKNA 1ROEA 2RPVA 4K3CA 3S2AA 2BVCA 4HROA 3H1UA 3VTVA 5IP4D 2WS3B 4JWUC 2WYQA 2QHOA 4NQKE 1S1QB 3QARA 2JVCA 5JZEB 2DWQA 1YOVB 2V1YA 3BWUD 2ZVOA 3AE5B 3AXCA 2G4DB 3DBHB 4GDLA 1V6EA 4MELA 3KH0A 2LVPA 3U52E 2LVOA 2KWUB 3W1YA 2R2QA 3Q8BA 2EKIA 2DYMA 2OJRA 3AULA 3O13A 3N3KB 1K52A 3OJ3A 3RN9C 2DAFA 4K1RB 4DHZB 2QCZA 4YL8A 2A5UA 1IBXB 1V8CA 1VZ8A 3BYTB 3EGRA 2WGSA 2PE9A 1XD3B 3FILA 4LCDE 3X23A 2MP2B 2BKRB 3C8YA 2G45B 2KOXA 3N9YC 1AW7A 2LASA 1AARA 5LLIA 3DCGA 3PZDA 4WWNA 1MFWA 3K9OB 3DHGC 3ZNID 3QAQA 1KH0A 3Q3JA 4TQ1A 2XNAC 2M19A 5D2MB 3B9JA 3C19A 1LFDA 2IY0B 1TY2A 3RFZB 1E8WA 3PO0A 1MHXA 2KXJA 4DHJB 2LGYA 3TEXA 3VTWA 2PTLA 3EECA 4M00A 4FBJB 5IAAC 4FHJA 5JH5C 4NJ7A 4EZJA 1AN8A 5E6JA 3OG5A 2BB6A 4URKA 2MRPA 1CMXB 2JZZA 3Q8AA 5D94A 5CHFA 2LEKA 3VH3B 3VR9B 1IGDA 3C0RB 3DBLB 2O6VB 1RAXA 1V1PA 3GS2A 3TEZA 3N1ZC 4I6NB 4WQMA 3VQIA 1L0YB 4RF0A 2WXKA 1XT9B 3ZDMC 1UD7A 2BBCA 1T5XD 3RNAC 4A8XC 3M3JA 2L52A 4MGZE 1FO4A 2GB1A 1JWSD 5DPTA 1SGHA 4JLCA 3JYUA 2FUG1 4OZBA 3DWGC 4HEA1 5MPOA 2G1EA 3FC4A 1V97A 1GOZA 3Q8EA 4BKGA 1F0ZA 3OJ4B 2L7RA 2D3AA 1JWBD 3LB8C 2LRUA 3PLVA 2BYTA 2LD9A 2DAJA 3UI3A 4GDKA 4IM2A 3RUIB 4QAYA 2K1FA 1TYGB 1KRHA 3TJPA 4C4VA 4B95A 2L1AA 4TSSA 2I1KA 2QJLA 2C7HA 3APCA 5J18A 3M63B 3JSVA 2KMMA 1SEBD 4S17A 3WAMA 2RDGA 4XGAB 4WAFA 4LTUA 3MJWA 2K39A 1UNSA 1TZ1A 4XYCA 1XLNA 3P63A 1KFYB 5C1ZA 1T0YA 3DHHC 4EFOA 4L2YA 1CK1A 2KDBA 4MM3B 1E90A 1JRUA 3EHVA 4P16A 1WXAA 2ICIA 1F2RI 3MFGA 1P98A 3IXSA 3RMKC 4JPSA 3TSSA 3KUZA 3EUB2 2NBUA 1I4HA 4HJGE 5BYRA 2EMTA 2KJHB 1K50A 2WX1A 4N6EB 2C7MB 4Q2JA 4KV2A 5EE1A 2V4IB 3ZUNA 3SFDB 1GUAB 3HK0A 1R4NB 4EZLA 1ZDVA 4HKZE 3O65B 3CMMB 4XE0A 2V3PA 2OOBB 3H8HA 4A3PA 1I4XA 5D6JB 1WYWB 1WSPA 4WJQA 1IP9A 2ASQA 1SIJA 4NJCA 3AE8B 1SXTA 2FIDA 2DZIA 1D3ZA 3WIMA 3CF6E 2KLCA 3QX1A 2I1JA 1CQVA 3BK1A 3H9DA 4NZLB 4YWGG 5HG2A 3NS8A 2KWVB 1XXGA 1C79A 4CHKA 1WGDA 4IUMB 3SEBA 1JMLA 2KVZA 4YTPB 2FCQA 3IT6B 3A1QA 3RULA 1WXMA 1WX9A 1ENFA 1EF1A 3PT2B 4C56C 4ZYNA 4L1BA 1BUIC 1XCQL 4AQ7A 1UGMA 5H8YE 3GP7A 1YX6B 2KFKB 4E74A 3B0AA 3W5UB 4ASWC 3MP9A 3P2BA 3K9PB 2NTSA 3TIXA 2N9LA 3I57A 3ECIA 4AS1A 2VRRB 4HLEA 1C76A 4GU2A 4GSWA 1L5PA 1V49A 2W9NA 3SDLC 3VRBB 1L4ZB 4AP4C 1LXDA 1Y8RC 2XN9C 4MJSB 2K8HA 1OQRA 1ZXIA 2JY6A 3L10B 2KX0A 1V80A 2PIAA 4W9JA 3AE7B 3RZFA 1XO3A 3RNBC 3W1SC 4EEWA 1MG8A 1N61A 1F9JA 1D5XC 2BT6A 3A9KA 2BGFA 2PLPA 4OHJA 4AJWA 1LO5D 1H8CA 2AYOB 3NS1A 5GXGB 4C7ZA 4J3OD 2RR9A 2KTRB 1A70A 1J0GA 1WJ6A 1G6JA 4HXDA 1FNUA 1UZXB 4LJPB 1P0RA 2CKHB 3N1XC 3KUDB 2AEHA 2E3TA 3P4RB 4MSMB 3R2IA 3WAOA 4YXDB 5FR6A 4ANXA 4RM9A 1TJEA 3GE3C 3T9LA 2QDFA 1P3QU 4KSLC 4CYEA 3M95A 1EUVB 1QT9A 2Y5PA 4K3BA 2IGGA 2O2VA 2I38A 3IAM1 2L32A 5C2TB 1TT5B 4YSYB 2JX5A 3H6NA 2N9EB 1N5XA 1KLGD 3ZDTA 1AYFA 1XLQA 2JRHA 2HD5B 1YJJA 2ONQA 4PS7A 3HVDA 5IO9A 1WX8A 3IFWB 4F1SA 4ZRQA 2JYTA 1E9MA 3QA8A 3RZWC 3DBRI 2LRWA 4M02A 4WURA 1NENB 3NVYA 2KDIA 4KX6B 5E6PA 2GBJA 2MJ3A 3ABVB 1WXSA 1XF5L 4XC2A 3BINA 1E10A 1OQQA 1YIWA 4P7IA 4W9GA 2KJ6A 3BIID 2D5GA 3NUHB 1EO6A 3Q3NC 2LUEA 4AOFA 2AQ2B 3GZNI 2BQQA 4OW0A 2KZRA 4BVUC 4FJZA 2IYDB 3A9JB 3A4SC 2JXTA 3AE4B 3VVWB 1GJZA 3AE6B 4RGMA 2INNE 1UWXA 2CR5A 2MWSB 3H7PA 3Q3OC 5GMVA 2LXCA 1YX5B 1R4MB 4DQOC 4BZAA 4GDLB 2BYFA 1EWYC 4WQOB 2BWES 4LDTD 1PGXA 1B1ZA 3L13A 1YQ4B 3OLMD 2JZPA 2V0GA 2K0PA 2MLBA 2ZZPB 3IT4B 3HM3A 1JROA 2B76B 4KGTA 1DOIA 2NPTA 1PGBA 3WAPA 2HTHA 3MC9A 2J0KA 3ZNZB 3E56A 3U2SC 2PPHA 4MGKE 2KN5A 2N7EA 1FNWA 4JQWC 1WE6A 1KOTA 3PVLA 2NR2A 2OEDA 2K25A 4NQLB 1J19A 2BW2A 1X1MA 3R7QA 4OZAA 4DDID 1FXAA 3AEFB 4FHKA 2AL6A 1YJ1A 1UF0A 2FCSA 3SFEB 2GBKA 2UYZB 1C9FA 4WJOA 1I42A 2V4LA 1NI2A 5E6OA 4KVGB 3BK2A 3QIJA 1KJTA 3W5VB 1FNVA 2AX5A 1V9JA 2JPHA 4LLGM 3KWLA 1EU4A 1Y56A 3IAS1 5FR3A 4K7WA 4WIPA 3ZNHB 4AUQC 3DVNV 2AQ3B 2WXRA 3PS6A 3RYTA 5BMIA 2BS4B 2LWPA 3JVZX 1NBFC 3LXFA 3RNCC 3PZ8A 2G3QB 3DBHI 2HJ8A 2WDVB 1SB3C 3B2GA 1L2NA 3Q14C 4HPPA 3ZTCA 2VZKD 2ZEQA 1TBEA 4RCOA 2JXXA 3ZYYX 1QOAA 1LGRA 4IWOA 3ZVVA 3GOEA 3AB5A 5IKCM 5LXHA 4HPLB 3VTUA 3VRAB 2KC1A 3AN1A 3ZIMA 3ZXVA 1FMAD 1CZPA 2CU3A 1JALA 3DBSA 3R3MA 2GI9A 1SJED 1WR1A 1C4CA 2G4SA 2KWDA 4TUUA 3ZGZA 1FD6A 1IYFA 1ISNA 2M8SA 3NJTA 3AU5A 2RMMA 1MI0A 1GC7A 4PS3A 2MJEA 3ZRCA 2QC8A 2KT7A 1TS3A 2D3BA 2OJWA 1WR6E 2LFIA 5DPRA 4JX1C 3UQBA 2M17A 2QEJC 2N9KA 4KKJA 2NCNA 2M4NA 1L4DB 2C7NB 2Z8LA 4A20A 1YQ3B 1E7VA 2JRIB 3U7DA 5G5HA 4REZA 4F8CB 4TQ0A 4IM0A 3SR6A 3DQVA 1KLVA 1L0VB 2LMCA 4NAMA 4C4VB 4HK2A 3Q3MC 3T3NA 1K8RB 2CJNA 1VR9A 2KX3A 4FLHA 3DBLI 2M0AA 3Q8CA 2KYWA 1D5MC 3X0WA 1SF0A 4GGQA 1D5ZC 2K22A 2IGDA 3R7RA 5EE0A 2J53A 4F7ZA 3BYYB 4E71A 2FCMA 4I6PA 2BYVE 1WJUA 4FJVB 1SBBB 2QMTA 1WJNA 2WDTB 4CO7A 1HZ6A 1L6UA 1L0XB 4G0NB 1WIAA 5AEKB 1WXVA 4DXAB 1ZXHA 1WMHB 3EC8A 3WANA 1QQRA 3Q6BA 4GXBA 2DZMA 3V05A 2A4ZA 2G9HD 1NVID 3ZQ4A 2JWZA 4FJYA 4BOZB 1IBXA 2FUHB 3EFCA 5HFYA 5IOIA 5C23A 4MEMA 2MX2A 1J7BA 1HQRD 3ALBA 3KVFB 2L76A 2QILA 3RNFC 1Q0WB 4MACA 2KKCA 4ARCA 1J7CA 3B2FA 2NTTA 1L7YA 2KANA 3URYA 2W3RA 3P4PB 4N9F4 3DVGX 1NYQA 1ZDXA 2K8CA 4BKSA 4ICVA 2GOWA 4NNJB 4BKTA 1ZPSA 3DHIC 2SEBD 3SD5A 3NVZA 2V3SA 3TMPB 3VUYA 3NOBA 2ZPYA 2HDEA 1QF6A 2DBYA 2KMCA 4NAWA 5L83A 1WX7A 4HCNB 5I4DA 2O6VA 4WAAA 3KLSX 2CJOA 2KQ4X 5BMGA 3A1QB 1WZ0A 2D10A 4RGTA 4MGIE 4IKGA 1V81A 1E7UA 3PRPB 5AZHA 1GB4A 1FFVA 3PREA 1HZ5A 4MGYE 3TBLD 2INCC 1OEYJ 2M56B 2CS4A 2WP9B 4R3DA 3NRZA 2DNFA 4W9DA 1KF6B 2C60A 3E9SA 1YN5A 1R4NI 4LJOB 3CSFA 4WWOA 3DVNU 1N63A 1UWMA 4PS8A 2PEAA 2WXMA 2L8JA 2R2OA 1PDXA 3U30A 4ZHPA 5H92C 4RGNA 4HRSA 3KUCB 1WI0A 1R7SA 2KDEB 5JXVA 5BMHA 2CU1A 1XLOA 4XDDA 3A9KB 3PSEB 3KYCD 3LDZE 2WU5B 3N1YC 2LGDA 4IWPA 3NHEB 2WXJA 2ZCBA 1V2YA 4EOYA 3VHTC 1V86A 1P7EA 2KLGA 4W9CA 2KACA 4L23A 3UGBB 4KSKC 3I9V1 2UU7A 3L54A 2WNMA 2KDMA 4RM8A 4IWQA 4XX5A 1EU3A 4MM3A 1HEZE 1YNTE 2MBEA 2O2VB 3HVZA 4KIKB 1C78A 4NJ6A 2VH1A 3HUIA 1F1HA 2MEKA 3ML9A 4RH6A 1DYQA 1I4QA 3SU8X 2PKOA 1WH3A 3DWMA 2JUOA 1YMHE 1V1OA 1QOFA 1T6BX 3PV1A 1V5TA 1JW9D 3AV8A 5D3IB 4MH8A 4KZCA 1JWUD 3AE9B 4A9AA 2MA9B 2J0JA 1JWMD 2Z0EB 3ENEA 2DHZA 4DWFA 3D32A 3KWVA 1NEKB 3ZW3A 3T8MA 2PMVA 1NI3A 3AE3B 1ZKHA 2Z0DB 4LNIA 3RD2A 3I3TB 2GBMA 5L95C 3T3OA 1QOGA 2DZJA 2N4FA 1QKZA 2EKEC
chains in the Genus database with same CATH topology
2N0SB 3E56A 2QIEB 4ITKA 3U2SC 1GAQB 3GB1A 1AN8A 1FNWA 5E6JA 2BB6A 2BS2B 2OEDA 2WXGA 2LHDA 3Q8AA 2DYOA 2BW2A 4ZRPA 2BS3B 2LEKA 3VR9B 2N7JA 4OZAA 1I4RA 1IGDA 4WH4A 1FXAA 2K5PA 4DXGA 3NZ3A 3AEFB 3BVGA 1V1PA 3GS2A 4B0MA 3TEZA 4ZOHC 1FRDA 2WXFA 1TKEA 4WQMA 3SFEB 1JCKB 1C9FA 3VQIA 1L0YB 4RF0A 2WXKA 5HI1A 2JWUA 4C7YA 2YEPF 1RM6C 1T5XD 1ET9A 1TZOA 2BBCA 3BK2A 3W5VB 4YT0B 1FNVA 2AX5A 1FCCC 4A8XC 3ZJVA 1SE4A 2L52A 2LUMA 3FAHA 4LLGM 4M0WA 3KWLA 1FO4A 1EU4A 1Y56A 1K51A 2J42A 3IAS1 4O1NA 5FKAC 2GB1A 1JWSD 5FR3A 4US9A 4WIPA 4IDIA 5AUIA 2AQ3B 2WXRA 3W2DA 2FUG1 4OZBA 3LYYA 3DWGC 5BMIA 2BS4B 1SE2A 3AEAB 3L4PA 3LXFA 3P1MA 4HEA1 3U7ZA 3PZ8A 5MPOA 2G1EA 3FC4A 1HXYD 1VZ6A 1V97A 2WDVB 1SB3C 3B2GA 1GOZA 1WYGA 2WU2B 3Q8EA 1YN4A 1C77A 2IJ0A 1F0ZA 1F2RC 1I4PA 2VZKD 1JWBD 1HA5A 3LB8C 4RCOA 3ZYYX 4KGSA 1QOAA 2BYTA 3MHZA 1C4AA 1TS4A 1JQ4A 3AB5A 1DOYA 2JYEA 1DGJA 3UI3A 4RFBA 1TS5A 3VRAB 2SAKA 2E6XA 4RGOS 3AN1A 1TYGB 1QLBB 1KRHA 1FMAD 5D3DA 3PZ7A 1CZPA 1VRAB 3VR8B 4XWWA 2CU3A 1JALA 2L1AA 4TSSA 2QJLA 3MC0B 2BTEA 2GI9A 1SJED 1C4CA 2KWDA 2KMMA 1SEBD 1YN3A 3ZGZA 2V3NA 1FD6A 1QOBA 2WXOA 2RDGA 4CQNA 4WAFA 2RMMA 4LTUA 1MI0A 3V3XA 1WRIA 1MVKA 2MJEA 1EM7A 3AECB 5D7GA 1NYRA 5T8IA 1UNSA 2PVGC 1ACCA 3P4SB 2K9XA 1FM0D 2BB5A 1XLNA 2K3UA 3P63A 1TS3A 5BYSA 1KFYB 2LFIA 1YJIA 4JX1C 3R8BA 4L2YA 1CK1A 2QEJC 2N9KA 4KKJA 4DXFA 4MM3B 1KTKA 2WXIA 1L4DB 4USAA 1ET6A 2Z8LA 4P16A 1YQ3B 1EWCA 2ICIA 2TSSA 1F2RI 2L83A 3MFGA 3IXSA 4JPSA 3TSSA 2W82A 4N58A 5G5HA 2J52A 2ZW1A 3AEGB 4REZA 1T3QA 3EUB2 4TQ0A 2QSDA 3SR6A 2X38A 4XWTA 1L0VB 1I4HA 2LMCA 4NAMA 4HJGE 5BYRA 4JWSC 2FBWB 1XCTL 1IUEA 1FEHA 1K50A 3T3NA 1GPXA 4N6EB 2CJNA 4Q2JA 1SJHD 2ZW0A 1VR9A 1KLUD 3U4EG 3FILB 5EE1A 2V4IB 3W1SA 2M0AA 5AUKA 3Q8CA 5EE9A 5LNK1 1D5MC 1SF0A 3SFDB 4ZHOA 1D5ZC 2K22A 2IGDA 3AEBB 5EE0A 2ON8A 1SSNA 1ZUD2 2J53A 3W9CB 4C80A 1N62A 2WXQA 3BYYB 1ZDVA 4HKZE 3AEDB 4XE0A 2V3PA 3KQ4A 3NVWA 1D6EC 1FIQA 2LJIA 1SBBB 2IGHA 2QMTA 4OVZA 3H8HA 4GLSC 1I4XA 1HZ6A 1L6UA 3J9CA 2IPKD 1ZE3D 1L0XB 1WSPA 4IOIE 1TKGA 1Q10A 2LGIA 3NVVA 1ZXHA 1SIJA 4P6VF 2JU6X 4NJCA 3AE8B 1SXTA 1VZ7A 1QQRA 2W3SA 3Q69A 5BYQA 3EA6A 3V05A 1ZP0B 2G9HD 1NVID 3ZQ4A 2EELA 1MPEA 1IBXA 2W54A 1E7PB 4A55A 5HFYA 3HRDD 1CQVA 1V1PB 3TUOA 1PYWD 1VLBA 3BK1A 4NZLB 4YWGG 1ESFA 1PUTA 5HG2A 4D2KA 4ZYSA 1J7BA 1HQRD 1E0ZA 1XXGA 1C79A 2AQ1B 1N5WA 1RFKA 3SEBA 1JMLA 1BMLC 1DOXA 4YTPB 3P42A 4UDUC 3IT6B 2QILA 5C3JB 2MJDA 2MH7A 2WLBA 4MACA 1ZOYB 4OZCA 1TKYA 4ARCA 1J7CA 4A90A 1ENFA 1TY0A 3B2FA 1FXIA 2DLBA 2ACZB 2NTTA 4C56C 3URYA 2WXNA 4L1BA 2W3RA 3P4PB 1BUIC 1XCQL 4N59A 4HKQA 5HHDG 1NYQA 1ZDXA 2INPE 4AQ7A 2Q5WD 3ETRA 5H8YE 3GP7A 1M4VA 3CWIA 1MHHE 1WWTA 2H88B 3W5UB 1WXQA 1ZPSA 3BVZA 3MP9A 2SEBD 2NTSA 3NVZA 2N9LA 3I57A 4AS1A 1FRRA 2WDQB 1C76A 1PFDA 4YTNB 1L5PA 2HDEA 1QF6A 1VJKA 2WXHA 3VRBB 1L4ZB 2DBYA 4KGRA 4LK0M 1P7FA 2XN9C 1OQRA 1ZXIA 5I4DA 4KKIA 2PW9A 3KLSX 5G5GA 2CJOA 3BVMA 2KQ4X 1I4GA 2PIAA 4GDKB 5BMGA 4RGTA 1GB1A 3AE7B 1XO3A 2HTME 5EE3A 4IKGA 1N61A 1J7AA 1D5XC 2NMQA 2BT6A 1GB4A 1FFVA 3R2TA 4MT5A 1HZ5A 2WXLA 2R61A 1UGJA 2PLPA 2Y5CA 1B9RA 1I7HA 2M56B 4OHJA 4RF1A 2JSVX 4PT5A 2WP9B 1LO5D 4R3DA 1RWSA 3NS1A 5GXGB 3NRZA 4C7ZA 2VZKB 1KF6B 4J3OD 2Y3AA 3AM9A 1A70A 2RDHA 3E9SA 1YN5A 1FNUA 1FFUA 3AH7A 5TSSA 2KAJA 2W55A 2WQYB 1N63A 4EE2A 1UWMA 1PGAA 4TMAB 3BZDB 2WXMA 4JE3B 2E3TA 3P4RB 4YXDB 3R2IA 1VDVA 1TJEA 3P4QB 4NAWB 1PDXA 1STEA 2FE8A 4ZHPA 5H92C 1QT9A 1N60A 4RGNA 3TEWA 2Y5PA 1QILA 4HRSA 2IGGA 1R7SA 2I38A 3IAM1 3Q8FA 3ZJTA 2I2YA 2L32A 1FCLA 5JXVA 5BMHA 4US8A 5C2TB 4RNAA 4YTMB 1XLOA 1C4PA 2JX5A 4XDDA 4YSYB 1JRPA 4FXCA 1AWDA 1D4BA 1N5XA 1ROEA 1KLGD 2WU5B 2RPVA 4B0EA 1F77A 4H2AA 1IGCA 2WXJA 4HROA 1AYFA 1XLQA 2WS3B 4JWUC 1SE3A 1YJJA 2ONQA 2DWQA 3HVDA 1P7EA 1RYJA 2IDYA 2LHEA 3BWUD 1CJEA 4ZRQA 3OWEB 2JYTA 1E9MA 2KACA 3AE5B 4L23A 3AE2B 4WURA 1NENB 3I9V1 2KN4A 5FK9C 3NVYA 3MJ5A 4KX6B 2WNMA 2KDMA 2MJ3A 4A6QA 3ABVB 3U52E 1XF5L 1EU3A 2H89B 3AE1B 3AEEB 1HEZE 1XLPA 1YNTE 1E10A 1OQQA 3HVZA 1C78A 3BIID 2D5GA 3Q8BA 2EKIA 2DYMA 3NUHB 2WXPA 1JWAD 3HUIA 2MEKA 4YSZB 1WGKA 4RH6A 3O13A 3RPFC 1DYQA 1I4QA 1K52A 1XEEA 2AQ2B 2PKOA 1UUPA 3DWMA 4OW0A 1YMHE 1V1OA 3ZJUA 1QOFA 2OHFA 1L6VA 1T6BX 2JXTA 1IBXB 1V8CA 3AE4B 1JW9D 3AE6B 4RGMA 3TEYA 2INNE 1VZ8A 1UWXA 2JQRB 3AV8A 3BYTB 3EGRA 2J4XA 5D3IB 4MH8A 3FILA 1BXTA 1K53A 2WDRB 1JWUD 3C8YA 3AE9B 3N9YC 1AW7A 4YSXB 4A9AA 1JWMD 4DQOC 3AMZA 2YEPB 4GDLB 1EWYC 1KH0A 1PGXA 1TS2A 1B1ZA 3KWVA 1YQ4B 1NEKB 4TQ1A 2JZPA 2PMVA 2XNAC 2V0GA 2K0PA 1NI3A 1E6EB 2M19A 4WWMA 2PVOD 3AE3B 3IT4B 3B9JA 1JROA 3WCQA 2B76B 1TY2A 3RFZB 4KGTA 3PO0A 1OFFA 1DOIA 1MHXA 2GRIA 4ARIA 3CIRB 3TEXA 1PGBA 1QOGA 3T3OA 2PTLA 4XDCA 1QKZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1C4P A;  1L4Z B;  1L4D B;  1QQR A;  1BML C; 
#chains in the Genus database with same CATH topology
 2N0S B;  5J2R A;  3UIO B;  4ITK A;  1GAQ B;  4ANW A;  2IND C;  3DDC B;  4P1C C;  2KDF B;  2WXG A;  2LHD A;  3GE8 C;  2DYO A;  4ZRP A;  2BS3 B;  3H7P B;  1I4R A;  2N9P C;  3KYD D;  1N6Z A;  1OGW A;  1WGG A;  3VUX A;  4FAD A;  2K5P A;  4XZ4 A;  4DXG A;  2KJR A;  3ZXR A;  3BVG A;  2WXF A;  3RNE C;  3NZU A;  1JCK B;  4NPN A;  4W9E A;  5HI1 A;  4DHZ E;  1J8C A;  1RM6 C;  4TV3 A;  1TZO A;  3ZJV A;  4YT0 B;  2NS5 A;  3L17 A;  2LUM A;  2XBB C;  4M0W A;  2KC2 A;  5FKA C;  1K51 A;  4O1N A;  3V60 A;  5AUI A;  3W2D A;  3PLU A;  5LXI B;  2KQS A;  5DPS A;  1BT0 A;  1SE2 A;  3P1M A;  2PE6 B;  1HXY D;  1VZ6 A;  2IBI B;  3Q3F A;  2KVR A;  4M8M A;  1WY8 A;  2XK5 B;  4DDG D;  2L3Z A;  1YN4 A;  1C77 A;  1I4P A;  1UBI A;  4WJP A;  4IW0 A;  2ZNV B;  4KGS A;  1SIF A;  3MHZ A;  2D07 B;  1C3T A;  4MJS A;  1DGJ A;  4RFB A;  1TS5 A;  3PHX B;  2E6X A;  4RGO S;  3QC8 B;  1QLB B;  3PZ7 A;  4ZRK A;  1VRA B;  3VR8 B;  4XWW A;  1H4R A;  1Z2M A;  3MC0 B;  3ZNG C;  2BTE A;  3RT3 B;  1YN3 A;  2V3N A;  2RGF A;  2WXO A;  1WJ4 A;  1MJD A;  1WRI A;  3QWZ B;  1MVK A;  1R4M I;  5D7G A;  3AEC B;  1NYR A;  2PVG C;  3L08 A;  3AU4 A;  1FM0 D;  2BB5 A;  5BYS A;  2BKF A;  2UWQ A;  1YJI A;  3PTF C;  5AZF A;  1YD8 U;  2MHJ A;  1KTK A;  4FUL A;  2J7Q B;  4M01 A;  4ANV A;  4G50 A;  3QHT A;  1HTO A;  2NBV B;  4USA A;  1ET6 A;  4ZDV A;  1EWC A;  2WHI A;  2L83 A;  2W82 A;  1I35 A;  1HTQ A;  2J52 A;  1T3Q A;  4G11 A;  4GOC A;  2QSD A;  3UIP B;  4W9K A;  2X38 A;  1M94 A;  4XWT A;  2MBB B;  2ZNV C;  2LXA A;  2NBW B;  4JWS C;  2D3G A;  1XCT L;  3B1L X;  1FEH A;  4ACF A;  4HVB A;  1GPX A;  1SJH D;  5KHO A;  3FIL B;  4II3 B;  3N30 A;  2KNB A;  5EE9 A;  4ICU A;  4B6W A;  3UF8 A;  2JZ3 B;  3AEB B;  2ON8 A;  1SSN A;  2WXQ A;  3AED B;  2IO3 B;  3VUW A;  3V6E B;  2VH2 A;  4EUT A;  3NVW A;  4W9F A;  1FIQ A;  4WWP A;  4C00 A;  2REX A;  3APF A;  4GLS C;  2D2Q A;  3IG3 A;  2LGI A;  4II2 B;  2JU6 X;  3V61 A;  1VZ7 A;  2L0F A;  5TR5 A;  3Q69 A;  4BKS D;  3QQ8 B;  5BYQ A;  3EA6 A;  1ZP0 B;  4DHJ D;  3A9J A;  2EEL A;  3IBE A;  1MPE A;  4LDT B;  2M0X A;  1E7P B;  4A55 A;  4KDI C;  5CTR C;  2FAZ A;  1V1P B;  3TUO A;  1RLF A;  1PYW D;  1VLB A;  1PUT A;  2AQ1 B;  1N5W A;  1U4A A;  1RFK A;  1DOX A;  3P42 A;  4DK5 A;  4UDU C;  1KM7 A;  1ZOY B;  1TKY A;  5DCN A;  1TY0 A;  1SE9 A;  2ACZ B;  2O6V D;  2WXN A;  2GLS A;  5JHA A;  4ZRI A;  4GB9 A;  4HKQ A;  1PQS A;  2Q5W D;  3ETR A;  1M4V A;  3CWI A;  3ONS A;  1MHH E;  3ZTD A;  1TGZ B;  2GBN A;  4A3O A;  4W9I A;  3VFK A;  1FRR A;  2WDQ B;  1UEL A;  1F52 A;  3TCA A;  1FXT B;  1VJK A;  3V62 A;  4LK0 M;  1WM3 A;  1RRB A;  4KKI A;  2PW9 A;  4JIO U;  3N20 C;  3VDZ A;  3UQA A;  4GDK B;  5IN7 A;  1A5R A;  1HE8 A;  2X8X X;  3MHS D;  1GB1 A;  3H7S A;  5EE3 A;  1V5O A;  2NMQ A;  2HE7 A;  3R2T A;  4MT5 A;  1UGJ A;  2Y5C A;  4W9L A;  1B9R A;  4MH0 E;  4PT5 A;  3A33 B;  3JSV B;  4BFR A;  2VZK B;  3NZS A;  2LVQ A;  1LQB A;  2Y3A A;  3AM9 A;  3MTN B;  3QCA A;  4LNF A;  4K81 A;  2K6D B;  2LGS A;  5JHB A;  1RFA A;  4HPM B;  2WQY B;  2BYE A;  4ZRJ A;  1PGA A;  4TMA B;  3BZD B;  3NY5 A;  3PHW B;  1WGR A;  4JE3 B;  3P4Q B;  4NAW B;  2JF5 A;  3VAW A;  1Q1O A;  2FE8 A;  2JT4 B;  1N60 A;  1OTR B;  3HM6 X;  1QIL A;  3ZJT A;  4PYU A;  1FCL A;  3WA0 A;  4RNA A;  4K7S A;  1C4P A;  3RNG C;  4EZK A;  3PPA A;  3QJZ A;  1MG4 A;  1D4B A;  4B0E A;  3ZKJ C;  1F77 A;  4H2A A;  3HIZ A;  1IGC A;  1WE7 A;  2RDB C;  4GN1 A;  3RCZ A;  1SE3 A;  1RYJ A;  2IDY A;  2LHE A;  1CJE A;  2MP2 A;  3OWE B;  3VXW A;  4X57 B;  4IG7 B;  3DOW A;  3AE2 B;  2LI5 A;  2KN4 A;  5FK9 C;  3DPD A;  4FN2 A;  3MJ5 A;  1GG3 A;  4A6Q A;  2H89 B;  3AE1 B;  3AEE B;  1E8Y A;  5DPW A;  1XLP A;  1T0S C;  3ZRF A;  2WXP A;  4GMV A;  1JWA D;  1P1A A;  2MQJ A;  4MDK E;  4YSZ B;  1WGK A;  2PJH A;  3RPF C;  2MW5 A;  1XEE A;  1UUP A;  2D11 A;  5IA7 A;  2KFJ A;  2Z59 B;  3ZJU A;  2OHF A;  4OVV A;  1L6V A;  2C5L C;  2IO2 B;  3B08 A;  1YQB A;  1Z5S B;  4HCP B;  3TEY A;  2JQR B;  1QZE A;  3OAW A;  2J4X A;  4E3C A;  1BXT A;  1K53 A;  2WDR B;  1ZGU B;  4YSX B;  2N9X A;  1WGY A;  3AMZ A;  2YEP B;  2M1M A;  3UIN B;  1TS2 A;  3VH4 B;  3PRM B;  2KO3 A;  4BBN F;  4RMA A;  1E6E B;  3IHP C;  4WWM A;  2PVO D;  3WCQ A;  1UBQ A;  1OFF A;  1T0Q C;  4GIV A;  2GRI A;  4ARI A;  3CIR B;  1E5W A;  4HJK A;  5CX3 A;  4XDC A;  2J0M A;  4AJY B;  4BOS C;  4BBN C;  2BF8 B;  1VD2 A;  2QIE B;  1E8Z A;  3BY4 B;  3GB1 A;  1UH6 A;  1WMH A;  1Q5W B;  2N7D A;  2BS2 B;  3MC8 A;  1OEY A;  4W9H A;  4S0R A;  1EF5 A;  1WFY A;  4B9K A;  5J17 A;  2N7J A;  4WH4 A;  3NZ3 A;  2DYB A;  2FNJ B;  4B0M A;  4ZOH C;  1FRD A;  1TKE A;  1NDD A;  4KZ0 A;  2WWZ A;  4DBG A;  4HDO A;  2JWU A;  4C7Y A;  4JL9 A;  2YEP F;  1ET9 A;  4NY0 A;  3U8Z A;  1FCC C;  4J6I A;  1SE4 A;  3PRZ A;  3FAH A;  2J42 A;  5BO4 B;  1WM2 A;  2RPQ A;  4US9 A;  2KK8 A;  4IDI A;  4LNN A;  2ZPN A;  3LYY A;  2ZCC A;  3AEA B;  3L4P A;  3I5J C;  3U7Z A;  2C9W B;  2L0T A;  2IY1 B;  1TIF A;  3ZLZ A;  2MBH A;  1WYG A;  5G55 A;  2WU2 B;  2IJ0 A;  1F2R C;  2K6Q A;  1HA5 A;  1C4A A;  1TS4 A;  1JQ4 A;  2KMA A;  5G2N A;  1DOY A;  2JYE A;  2D3C A;  1T0R C;  2SAK A;  3ZO5 B;  4KDL B;  5KHQ A;  4M0W B;  5D3D A;  2MBO A;  1OQY A;  4P1B C;  2MCN B;  1S3S G;  1VCB A;  2CHX A;  1WZ3 A;  1QOB A;  4CQN A;  4ANU A;  3DVG Y;  3L0W B;  3HHM A;  3V3X A;  1EM7 A;  5T8I A;  1IPG A;  1ACC A;  1WRD B;  3P4S B;  2K9X A;  2K3U A;  3R8B A;  4DXF A;  1TTN A;  2WXI A;  2TSS A;  3LJ3 A;  2DZK A;  4N58 A;  2ZW1 A;  3A4R A;  3AEG B;  2ZJD A;  3R66 C;  4HWI B;  1ZW7 A;  2EMS A;  2LJ5 A;  4WJN A;  4BAX A;  2FBW B;  1IUE A;  2RSU A;  2ZVN A;  2DEN B;  4LNO A;  2ZW0 A;  1C1Y B;  1KLU D;  3U4E G;  3W1S A;  4G3X B;  5AUK A;  5LNK 1;  4ZHO A;  2YLM A;  4IC7 B;  1ZUD 2;  2V9H A;  3I63 C;  3V6C B;  3W9C B;  4C80 A;  1N62 A;  3IVF A;  3KQ4 A;  1E8X A;  1D6E C;  2LJI A;  4M8N A;  4EKU A;  2IGH A;  2K8B A;  4OVZ A;  2FCN A;  2NPT B;  2WX0 A;  2XEW A;  3J9C A;  2IPK D;  2KD0 A;  1ZE3 D;  3TL5 A;  2YVC A;  4IOI E;  1TKG A;  2KFK A;  4KIK A;  3RI7 C;  1Q10 A;  2GBR A;  3NVV A;  4P6V F;  3EFU A;  5CHV C;  5E6N A;  2W3S A;  4MSQ B;  4I6L B;  2IZV B;  2W54 A;  4IM3 A;  4PYZ A;  3HRD D;  4D2K A;  4PK1 A;  2B3A A;  1ESF A;  4JGH B;  4ZYS A;  2KTF A;  2Y5B B;  1E0Z A;  2IO1 B;  2HJ1 A;  1P9D U;  1BML C;  3ML8 A;  4HDQ A;  5C3J B;  3DBR B;  2MJD A;  2BPS A;  2MH7 A;  2WLB A;  3Q2A C;  4OZC A;  4A90 A;  2LZ6 A;  3AI5 A;  1FXI A;  2DLB A;  3QK0 A;  3SHQ A;  4N59 A;  5HHD G;  1WF9 A;  2INP E;  2KHW B;  3JW0 X;  2LGX A;  1WWT A;  2H88 B;  1GNU A;  1WXQ A;  3BVZ A;  2KTR A;  4K7U A;  3GZN B;  1FPY A;  3KW5 B;  5HKH A;  1PFD A;  4YTN B;  1WGH A;  5EDS A;  2WXH A;  2KQ7 A;  4OVU A;  4KGR A;  1P7F A;  4LNK A;  2KWC A;  5G5G A;  3BVM A;  1I4G A;  3APD A;  3NG0 A;  2HTM E;  3WAL A;  2CHW A;  1J7A A;  2RD0 A;  3PGE A;  2FIF A;  2WXL A;  2AL3 A;  2R61 A;  1GC6 A;  1I7H A;  4RF1 A;  2JSV X;  1RWS A;  1LM8 B;  2RDH A;  2IO0 B;  1FFU A;  3AH7 A;  3FKY A;  5TSS A;  2KAJ A;  2W55 A;  4EE2 A;  3M62 B;  2N1W A;  2L05 A;  2CHZ A;  2XK5 A;  3N32 A;  4AWJ A;  1VDV A;  2L00 B;  2DX5 B;  2MBQ A;  2NVU I;  1STE A;  2AWT A;  1XQQ A;  4FA6 A;  3L16 A;  3TEW A;  5CHW A;  3CST A;  3Q8F A;  2I2Y A;  5AZG A;  2MSE D;  2N1V A;  4US8 A;  4YTM B;  1JRP A;  2GMI C;  4FXC A;  1AWD A;  2BWF A;  4TKN A;  1ROE A;  2RPV A;  4K3C A;  3S2A A;  2BVC A;  4HRO A;  3H1U A;  3VTV A;  5IP4 D;  2WS3 B;  4JWU C;  2WYQ A;  2QHO A;  4NQK E;  1S1Q B;  3QAR A;  2JVC A;  5JZE B;  2DWQ A;  1YOV B;  2V1Y A;  3BWU D;  2ZVO A;  3AE5 B;  3AXC A;  2G4D B;  3DBH B;  4GDL A;  1V6E A;  4MEL A;  3KH0 A;  2LVP A;  3U52 E;  2LVO A;  2KWU B;  3W1Y A;  2R2Q A;  3Q8B A;  2EKI A;  2DYM A;  2OJR A;  3AUL A;  3O13 A;  3N3K B;  1K52 A;  3OJ3 A;  3RN9 C;  2DAF A;  4K1R B;  4DHZ B;  2QCZ A;  4YL8 A;  2A5U A;  1IBX B;  1V8C A;  1VZ8 A;  3BYT B;  3EGR A;  2WGS A;  2PE9 A;  1XD3 B;  3FIL A;  4LCD E;  3X23 A;  2MP2 B;  2BKR B;  3C8Y A;  2G45 B;  2KOX A;  3N9Y C;  1AW7 A;  2LAS A;  1AAR A;  5LLI A;  3DCG A;  3PZD A;  4WWN A;  1MFW A;  3K9O B;  3DHG C;  3ZNI D;  3QAQ A;  1KH0 A;  3Q3J A;  4TQ1 A;  2XNA C;  2M19 A;  5D2M B;  3B9J A;  3C19 A;  1LFD A;  2IY0 B;  1TY2 A;  3RFZ B;  1E8W A;  3PO0 A;  1MHX A;  2KXJ A;  4DHJ B;  2LGY A;  3TEX A;  3VTW A;  2PTL A;  3EEC A;  4M00 A;  4FBJ B;  5IAA C;  4FHJ A;  5JH5 C;  4NJ7 A;  4EZJ A;  1AN8 A;  5E6J A;  3OG5 A;  2BB6 A;  4URK A;  2MRP A;  1CMX B;  2JZZ A;  3Q8A A;  5D94 A;  5CHF A;  2LEK A;  3VH3 B;  3VR9 B;  1IGD A;  3C0R B;  3DBL B;  2O6V B;  1RAX A;  1V1P A;  3GS2 A;  3TEZ A;  3N1Z C;  4I6N B;  4WQM A;  3VQI A;  1L0Y B;  4RF0 A;  2WXK A;  1XT9 B;  3ZDM C;  1UD7 A;  2BBC A;  1T5X D;  3RNA C;  4A8X C;  3M3J A;  2L52 A;  4MGZ E;  1FO4 A;  2GB1 A;  1JWS D;  5DPT A;  1SGH A;  4JLC A;  3JYU A;  2FUG 1;  4OZB A;  3DWG C;  4HEA 1;  5MPO A;  2G1E A;  3FC4 A;  1V97 A;  1GOZ A;  3Q8E A;  4BKG A;  1F0Z A;  3OJ4 B;  2L7R A;  2D3A A;  1JWB D;  3LB8 C;  2LRU A;  3PLV A;  2BYT A;  2LD9 A;  2DAJ A;  3UI3 A;  4GDK A;  4IM2 A;  3RUI B;  4QAY A;  2K1F A;  1TYG B;  1KRH A;  3TJP A;  4C4V A;  4B95 A;  2L1A A;  4TSS A;  2I1K A;  2QJL A;  2C7H A;  3APC A;  5J18 A;  3M63 B;  3JSV A;  2KMM A;  1SEB D;  4S17 A;  3WAM A;  2RDG A;  4XGA B;  4WAF A;  4LTU A;  3MJW A;  2K39 A;  1UNS A;  1TZ1 A;  4XYC A;  1XLN A;  3P63 A;  1KFY B;  5C1Z A;  1T0Y A;  3DHH C;  4EFO A;  4L2Y A;  1CK1 A;  2KDB A;  4MM3 B;  1E90 A;  1JRU A;  3EHV A;  4P16 A;  1WXA A;  2ICI A;  1F2R I;  3MFG A;  1P98 A;  3IXS A;  3RMK C;  4JPS A;  3TSS A;  3KUZ A;  3EUB 2;  2NBU A;  1I4H A;  4HJG E;  5BYR A;  2EMT A;  2KJH B;  1K50 A;  2WX1 A;  4N6E B;  2C7M B;  4Q2J A;  4KV2 A;  5EE1 A;  2V4I B;  3ZUN A;  3SFD B;  1GUA B;  3HK0 A;  1R4N B;  4EZL A;  1ZDV A;  4HKZ E;  3O65 B;  3CMM B;  4XE0 A;  2V3P A;  2OOB B;  3H8H A;  4A3P A;  1I4X A;  5D6J B;  1WYW B;  1WSP A;  4WJQ A;  1IP9 A;  2ASQ A;  1SIJ A;  4NJC A;  3AE8 B;  1SXT A;  2FID A;  2DZI A;  1D3Z A;  3WIM A;  3CF6 E;  2KLC A;  3QX1 A;  2I1J A;  1CQV A;  3BK1 A;  3H9D A;  4NZL B;  4YWG G;  5HG2 A;  3NS8 A;  2KWV B;  1XXG A;  1C79 A;  4CHK A;  1WGD A;  4IUM B;  3SEB A;  1JML A;  2KVZ A;  4YTP B;  2FCQ A;  3IT6 B;  3A1Q A;  3RUL A;  1WXM A;  1WX9 A;  1ENF A;  1EF1 A;  3PT2 B;  4C56 C;  4ZYN A;  4L1B A;  1BUI C;  1XCQ L;  4AQ7 A;  1UGM A;  5H8Y E;  3GP7 A;  1YX6 B;  2KFK B;  4E74 A;  3B0A A;  3W5U B;  4ASW C;  3MP9 A;  3P2B A;  3K9P B;  2NTS A;  3TIX A;  2N9L A;  3I57 A;  3ECI A;  4AS1 A;  2VRR B;  4HLE A;  1C76 A;  4GU2 A;  4GSW A;  1L5P A;  1V49 A;  2W9N A;  3SDL C;  3VRB B;  1L4Z B;  4AP4 C;  1LXD A;  1Y8R C;  2XN9 C;  4MJS B;  2K8H A;  1OQR A;  1ZXI A;  2JY6 A;  3L10 B;  2KX0 A;  1V80 A;  2PIA A;  4W9J A;  3AE7 B;  3RZF A;  1XO3 A;  3RNB C;  3W1S C;  4EEW A;  1MG8 A;  1N61 A;  1F9J A;  1D5X C;  2BT6 A;  3A9K A;  2BGF A;  2PLP A;  4OHJ A;  4AJW A;  1LO5 D;  1H8C A;  2AYO B;  3NS1 A;  5GXG B;  4C7Z A;  4J3O D;  2RR9 A;  2KTR B;  1A70 A;  1J0G A;  1WJ6 A;  1G6J A;  4HXD A;  1FNU A;  1UZX B;  4LJP B;  1P0R A;  2CKH B;  3N1X C;  3KUD B;  2AEH A;  2E3T A;  3P4R B;  4MSM B;  3R2I A;  3WAO A;  4YXD B;  5FR6 A;  4ANX A;  4RM9 A;  1TJE A;  3GE3 C;  3T9L A;  2QDF A;  1P3Q U;  4KSL C;  4CYE A;  3M95 A;  1EUV B;  1QT9 A;  2Y5P A;  4K3B A;  2IGG A;  2O2V A;  2I38 A;  3IAM 1;  2L32 A;  5C2T B;  1TT5 B;  4YSY B;  2JX5 A;  3H6N A;  2N9E B;  1N5X A;  1KLG D;  3ZDT A;  1AYF A;  1XLQ A;  2JRH A;  2HD5 B;  1YJJ A;  2ONQ A;  4PS7 A;  3HVD A;  5IO9 A;  1WX8 A;  3IFW B;  4F1S A;  4ZRQ A;  2JYT A;  1E9M A;  3QA8 A;  3RZW C;  3DBR I;  2LRW A;  4M02 A;  4WUR A;  1NEN B;  3NVY A;  2KDI A;  4KX6 B;  5E6P A;  2GBJ A;  2MJ3 A;  3ABV B;  1WXS A;  1XF5 L;  4XC2 A;  3BIN A;  1E10 A;  1OQQ A;  1YIW A;  4P7I A;  4W9G A;  2KJ6 A;  3BII D;  2D5G A;  3NUH B;  1EO6 A;  3Q3N C;  2LUE A;  4AOF A;  2AQ2 B;  3GZN I;  2BQQ A;  4OW0 A;  2KZR A;  4BVU C;  4FJZ A;  2IYD B;  3A9J B;  3A4S C;  2JXT A;  3AE4 B;  3VVW B;  1GJZ A;  3AE6 B;  4RGM A;  2INN E;  1UWX A;  2CR5 A;  2MWS B;  3H7P A;  3Q3O C;  5GMV A;  2LXC A;  1YX5 B;  1R4M B;  4DQO C;  4BZA A;  4GDL B;  2BYF A;  1EWY C;  4WQO B;  2BWE S;  4LDT D;  1PGX A;  1B1Z A;  3L13 A;  1YQ4 B;  3OLM D;  2JZP A;  2V0G A;  2K0P A;  2MLB A;  2ZZP B;  3IT4 B;  3HM3 A;  1JRO A;  2B76 B;  4KGT A;  1DOI A;  2NPT A;  1PGB A;  3WAP A;  2HTH A;  3MC9 A;  2J0K A;  3ZNZ B;  3E56 A;  3U2S C;  2PPH A;  4MGK E;  2KN5 A;  2N7E A;  1FNW A;  4JQW C;  1WE6 A;  1KOT A;  3PVL A;  2NR2 A;  2OED A;  2K25 A;  4NQL B;  1J19 A;  2BW2 A;  1X1M A;  3R7Q A;  4OZA A;  4DDI D;  1FXA A;  3AEF B;  4FHK A;  2AL6 A;  1YJ1 A;  1UF0 A;  2FCS A;  3SFE B;  2GBK A;  2UYZ B;  1C9F A;  4WJO A;  1I42 A;  2V4L A;  1NI2 A;  5E6O A;  4KVG B;  3BK2 A;  3QIJ A;  1KJT A;  3W5V B;  1FNV A;  2AX5 A;  1V9J A;  2JPH A;  4LLG M;  3KWL A;  1EU4 A;  1Y56 A;  3IAS 1;  5FR3 A;  4K7W A;  4WIP A;  3ZNH B;  4AUQ C;  3DVN V;  2AQ3 B;  2WXR A;  3PS6 A;  3RYT A;  5BMI A;  2BS4 B;  2LWP A;  3JVZ X;  1NBF C;  3LXF A;  3RNC C;  3PZ8 A;  2G3Q B;  3DBH I;  2HJ8 A;  2WDV B;  1SB3 C;  3B2G A;  1L2N A;  3Q14 C;  4HPP A;  3ZTC A;  2VZK D;  2ZEQ A;  1TBE A;  4RCO A;  2JXX A;  3ZYY X;  1QOA A;  1LGR A;  4IWO A;  3ZVV A;  3GOE A;  3AB5 A;  5IKC M;  5LXH A;  4HPL B;  3VTU A;  3VRA B;  2KC1 A;  3AN1 A;  3ZIM A;  3ZXV A;  1FMA D;  1CZP A;  2CU3 A;  1JAL A;  3DBS A;  3R3M A;  2GI9 A;  1SJE D;  1WR1 A;  1C4C A;  2G4S A;  2KWD A;  4TUU A;  3ZGZ A;  1FD6 A;  1IYF A;  1ISN A;  2M8S A;  3NJT A;  3AU5 A;  2RMM A;  1MI0 A;  1GC7 A;  4PS3 A;  2MJE A;  3ZRC A;  2QC8 A;  2KT7 A;  1TS3 A;  2D3B A;  2OJW A;  1WR6 E;  2LFI A;  5DPR A;  4JX1 C;  3UQB A;  2M17 A;  2QEJ C;  2N9K A;  4KKJ A;  2NCN A;  2M4N A;  1L4D B;  2C7N B;  2Z8L A;  4A20 A;  1YQ3 B;  1E7V A;  2JRI B;  3U7D A;  5G5H A;  4REZ A;  4F8C B;  4TQ0 A;  4IM0 A;  3SR6 A;  3DQV A;  1KLV A;  1L0V B;  2LMC A;  4NAM A;  4C4V B;  4HK2 A;  3Q3M C;  3T3N A;  1K8R B;  2CJN A;  1VR9 A;  2KX3 A;  4FLH A;  3DBL I;  2M0A A;  3Q8C A;  2KYW A;  1D5M C;  3X0W A;  1SF0 A;  4GGQ A;  1D5Z C;  2K22 A;  2IGD A;  3R7R A;  5EE0 A;  2J53 A;  4F7Z A;  3BYY B;  4E71 A;  2FCM A;  4I6P A;  2BYV E;  1WJU A;  4FJV B;  1SBB B;  2QMT A;  1WJN A;  2WDT B;  4CO7 A;  1HZ6 A;  1L6U A;  1L0X B;  4G0N B;  1WIA A;  5AEK B;  1WXV A;  4DXA B;  1ZXH A;  1WMH B;  3EC8 A;  3WAN A;  1QQR A;  3Q6B A;  4GXB A;  2DZM A;  3V05 A;  2A4Z A;  2G9H D;  1NVI D;  3ZQ4 A;  2JWZ A;  4FJY A;  4BOZ B;  1IBX A;  2FUH B;  3EFC A;  5HFY A;  5IOI A;  5C23 A;  4MEM A;  2MX2 A;  1J7B A;  1HQR D;  3ALB A;  3KVF B;  2L76 A;  2QIL A;  3RNF C;  1Q0W B;  4MAC A;  2KKC A;  4ARC A;  1J7C A;  3B2F A;  2NTT A;  1L7Y A;  2KAN A;  3URY A;  2W3R A;  3P4P B;  4N9F 4;  3DVG X;  1NYQ A;  1ZDX A;  2K8C A;  4BKS A;  4ICV A;  2GOW A;  4NNJ B;  4BKT A;  1ZPS A;  3DHI C;  2SEB D;  3SD5 A;  3NVZ A;  2V3S A;  3TMP B;  3VUY A;  3NOB A;  2ZPY A;  2HDE A;  1QF6 A;  2DBY A;  2KMC A;  4NAW A;  5L83 A;  1WX7 A;  4HCN B;  5I4D A;  2O6V A;  4WAA A;  3KLS X;  2CJO A;  2KQ4 X;  5BMG A;  3A1Q B;  1WZ0 A;  2D10 A;  4RGT A;  4MGI E;  4IKG A;  1V81 A;  1E7U A;  3PRP B;  5AZH A;  1GB4 A;  1FFV A;  3PRE A;  1HZ5 A;  4MGY E;  3TBL D;  2INC C;  1OEY J;  2M56 B;  2CS4 A;  2WP9 B;  4R3D A;  3NRZ A;  2DNF A;  4W9D A;  1KF6 B;  2C60 A;  3E9S A;  1YN5 A;  1R4N I;  4LJO B;  3CSF A;  4WWO A;  3DVN U;  1N63 A;  1UWM A;  4PS8 A;  2PEA A;  2WXM A;  2L8J A;  2R2O A;  1PDX A;  3U30 A;  4ZHP A;  5H92 C;  4RGN A;  4HRS A;  3KUC B;  1WI0 A;  1R7S A;  2KDE B;  5JXV A;  5BMH A;  2CU1 A;  1XLO A;  4XDD A;  3A9K B;  3PSE B;  3KYC D;  3LDZ E;  2WU5 B;  3N1Y C;  2LGD A;  4IWP A;  3NHE B;  2WXJ A;  2ZCB A;  1V2Y A;  4EOY A;  3VHT C;  1V86 A;  1P7E A;  2KLG A;  4W9C A;  2KAC A;  4L23 A;  3UGB B;  4KSK C;  3I9V 1;  2UU7 A;  3L54 A;  2WNM A;  2KDM A;  4RM8 A;  4IWQ A;  4XX5 A;  1EU3 A;  4MM3 A;  1HEZ E;  1YNT E;  2MBE A;  2O2V B;  3HVZ A;  4KIK B;  1C78 A;  4NJ6 A;  2VH1 A;  3HUI A;  1F1H A;  2MEK A;  3ML9 A;  4RH6 A;  1DYQ A;  1I4Q A;  3SU8 X;  2PKO A;  1WH3 A;  3DWM A;  2JUO A;  1YMH E;  1V1O A;  1QOF A;  1T6B X;  3PV1 A;  1V5T A;  1JW9 D;  3AV8 A;  5D3I B;  4MH8 A;  4KZC A;  1JWU D;  3AE9 B;  4A9A A;  2MA9 B;  2J0J A;  1JWM D;  2Z0E B;  3ENE A;  2DHZ A;  4DWF A;  3D32 A;  3KWV A;  1NEK B;  3ZW3 A;  3T8M A;  2PMV A;  1NI3 A;  3AE3 B;  1ZKH A;  2Z0D B;  4LNI A;  3RD2 A;  3I3T B;  2GBM A;  5L95 C;  3T3O A;  1QOG A;  2DZJ A;  2N4F A;  1QKZ A;  2EKE C; 
#chains in the Genus database with same CATH homology
 2N0S B;  3E56 A;  2QIE B;  4ITK A;  3U2S C;  1GAQ B;  3GB1 A;  1AN8 A;  1FNW A;  5E6J A;  2BB6 A;  2BS2 B;  2OED A;  2WXG A;  2LHD A;  3Q8A A;  2DYO A;  2BW2 A;  4ZRP A;  2BS3 B;  2LEK A;  3VR9 B;  2N7J A;  4OZA A;  1I4R A;  1IGD A;  4WH4 A;  1FXA A;  2K5P A;  4DXG A;  3NZ3 A;  3AEF B;  3BVG A;  1V1P A;  3GS2 A;  4B0M A;  3TEZ A;  4ZOH C;  1FRD A;  2WXF A;  1TKE A;  4WQM A;  3SFE B;  1JCK B;  1C9F A;  3VQI A;  1L0Y B;  4RF0 A;  2WXK A;  5HI1 A;  2JWU A;  4C7Y A;  2YEP F;  1RM6 C;  1T5X D;  1ET9 A;  1TZO A;  2BBC A;  3BK2 A;  3W5V B;  4YT0 B;  1FNV A;  2AX5 A;  1FCC C;  4A8X C;  3ZJV A;  1SE4 A;  2L52 A;  2LUM A;  3FAH A;  4LLG M;  4M0W A;  3KWL A;  1FO4 A;  1EU4 A;  1Y56 A;  1K51 A;  2J42 A;  3IAS 1;  4O1N A;  5FKA C;  2GB1 A;  1JWS D;  5FR3 A;  4US9 A;  4WIP A;  4IDI A;  5AUI A;  2AQ3 B;  2WXR A;  3W2D A;  2FUG 1;  4OZB A;  3LYY A;  3DWG C;  5BMI A;  2BS4 B;  1SE2 A;  3AEA B;  3L4P A;  3LXF A;  3P1M A;  4HEA 1;  3U7Z A;  3PZ8 A;  5MPO A;  2G1E A;  3FC4 A;  1HXY D;  1VZ6 A;  1V97 A;  2WDV B;  1SB3 C;  3B2G A;  1GOZ A;  1WYG A;  2WU2 B;  3Q8E A;  1YN4 A;  1C77 A;  2IJ0 A;  1F0Z A;  1F2R C;  1I4P A;  2VZK D;  1JWB D;  1HA5 A;  3LB8 C;  4RCO A;  3ZYY X;  4KGS A;  1QOA A;  2BYT A;  3MHZ A;  1C4A A;  1TS4 A;  1JQ4 A;  3AB5 A;  1DOY A;  2JYE A;  1DGJ A;  3UI3 A;  4RFB A;  1TS5 A;  3VRA B;  2SAK A;  2E6X A;  4RGO S;  3AN1 A;  1TYG B;  1QLB B;  1KRH A;  1FMA D;  5D3D A;  3PZ7 A;  1CZP A;  1VRA B;  3VR8 B;  4XWW A;  2CU3 A;  1JAL A;  2L1A A;  4TSS A;  2QJL A;  3MC0 B;  2BTE A;  2GI9 A;  1SJE D;  1C4C A;  2KWD A;  2KMM A;  1SEB D;  1YN3 A;  3ZGZ A;  2V3N A;  1FD6 A;  1QOB A;  2WXO A;  2RDG A;  4CQN A;  4WAF A;  2RMM A;  4LTU A;  1MI0 A;  3V3X A;  1WRI A;  1MVK A;  2MJE A;  1EM7 A;  3AEC B;  5D7G A;  1NYR A;  5T8I A;  1UNS A;  2PVG C;  1ACC A;  3P4S B;  2K9X A;  1FM0 D;  2BB5 A;  1XLN A;  2K3U A;  3P63 A;  1TS3 A;  5BYS A;  1KFY B;  2LFI A;  1YJI A;  4JX1 C;  3R8B A;  4L2Y A;  1CK1 A;  2QEJ C;  2N9K A;  4KKJ A;  4DXF A;  4MM3 B;  1KTK A;  2WXI A;  1L4D B;  4USA A;  1ET6 A;  2Z8L A;  4P16 A;  1YQ3 B;  1EWC A;  2ICI A;  2TSS A;  1F2R I;  2L83 A;  3MFG A;  3IXS A;  4JPS A;  3TSS A;  2W82 A;  4N58 A;  5G5H A;  2J52 A;  2ZW1 A;  3AEG B;  4REZ A;  1T3Q A;  3EUB 2;  4TQ0 A;  2QSD A;  3SR6 A;  2X38 A;  4XWT A;  1L0V B;  1I4H A;  2LMC A;  4NAM A;  4HJG E;  5BYR A;  4JWS C;  2FBW B;  1XCT L;  1IUE A;  1FEH A;  1K50 A;  3T3N A;  1GPX A;  4N6E B;  2CJN A;  4Q2J A;  1SJH D;  2ZW0 A;  1VR9 A;  1KLU D;  3U4E G;  3FIL B;  5EE1 A;  2V4I B;  3W1S A;  2M0A A;  5AUK A;  3Q8C A;  5EE9 A;  5LNK 1;  1D5M C;  1SF0 A;  3SFD B;  4ZHO A;  1D5Z C;  2K22 A;  2IGD A;  3AEB B;  5EE0 A;  2ON8 A;  1SSN A;  1ZUD 2;  2J53 A;  3W9C B;  4C80 A;  1N62 A;  2WXQ A;  3BYY B;  1ZDV A;  4HKZ E;  3AED B;  4XE0 A;  2V3P A;  3KQ4 A;  3NVW A;  1D6E C;  1FIQ A;  2LJI A;  1SBB B;  2IGH A;  2QMT A;  4OVZ A;  3H8H A;  4GLS C;  1I4X A;  1HZ6 A;  1L6U A;  3J9C A;  2IPK D;  1ZE3 D;  1L0X B;  1WSP A;  4IOI E;  1TKG A;  1Q10 A;  2LGI A;  3NVV A;  1ZXH A;  1SIJ A;  4P6V F;  2JU6 X;  4NJC A;  3AE8 B;  1SXT A;  1VZ7 A;  1QQR A;  2W3S A;  3Q69 A;  5BYQ A;  3EA6 A;  3V05 A;  1ZP0 B;  2G9H D;  1NVI D;  3ZQ4 A;  2EEL A;  1MPE A;  1IBX A;  2W54 A;  1E7P B;  4A55 A;  5HFY A;  3HRD D;  1CQV A;  1V1P B;  3TUO A;  1PYW D;  1VLB A;  3BK1 A;  4NZL B;  4YWG G;  1ESF A;  1PUT A;  5HG2 A;  4D2K A;  4ZYS A;  1J7B A;  1HQR D;  1E0Z A;  1XXG A;  1C79 A;  2AQ1 B;  1N5W A;  1RFK A;  3SEB A;  1JML A;  1BML C;  1DOX A;  4YTP B;  3P42 A;  4UDU C;  3IT6 B;  2QIL A;  5C3J B;  2MJD A;  2MH7 A;  2WLB A;  4MAC A;  1ZOY B;  4OZC A;  1TKY A;  4ARC A;  1J7C A;  4A90 A;  1ENF A;  1TY0 A;  3B2F A;  1FXI A;  2DLB A;  2ACZ B;  2NTT A;  4C56 C;  3URY A;  2WXN A;  4L1B A;  2W3R A;  3P4P B;  1BUI C;  1XCQ L;  4N59 A;  4HKQ A;  5HHD G;  1NYQ A;  1ZDX A;  2INP E;  4AQ7 A;  2Q5W D;  3ETR A;  5H8Y E;  3GP7 A;  1M4V A;  3CWI A;  1MHH E;  1WWT A;  2H88 B;  3W5U B;  1WXQ A;  1ZPS A;  3BVZ A;  3MP9 A;  2SEB D;  2NTS A;  3NVZ A;  2N9L A;  3I57 A;  4AS1 A;  1FRR A;  2WDQ B;  1C76 A;  1PFD A;  4YTN B;  1L5P A;  2HDE A;  1QF6 A;  1VJK A;  2WXH A;  3VRB B;  1L4Z B;  2DBY A;  4KGR A;  4LK0 M;  1P7F A;  2XN9 C;  1OQR A;  1ZXI A;  5I4D A;  4KKI A;  2PW9 A;  3KLS X;  5G5G A;  2CJO A;  3BVM A;  2KQ4 X;  1I4G A;  2PIA A;  4GDK B;  5BMG A;  4RGT A;  1GB1 A;  3AE7 B;  1XO3 A;  2HTM E;  5EE3 A;  4IKG A;  1N61 A;  1J7A A;  1D5X C;  2NMQ A;  2BT6 A;  1GB4 A;  1FFV A;  3R2T A;  4MT5 A;  1HZ5 A;  2WXL A;  2R61 A;  1UGJ A;  2PLP A;  2Y5C A;  1B9R A;  1I7H A;  2M56 B;  4OHJ A;  4RF1 A;  2JSV X;  4PT5 A;  2WP9 B;  1LO5 D;  4R3D A;  1RWS A;  3NS1 A;  5GXG B;  3NRZ A;  4C7Z A;  2VZK B;  1KF6 B;  4J3O D;  2Y3A A;  3AM9 A;  1A70 A;  2RDH A;  3E9S A;  1YN5 A;  1FNU A;  1FFU A;  3AH7 A;  5TSS A;  2KAJ A;  2W55 A;  2WQY B;  1N63 A;  4EE2 A;  1UWM A;  1PGA A;  4TMA B;  3BZD B;  2WXM A;  4JE3 B;  2E3T A;  3P4R B;  4YXD B;  3R2I A;  1VDV A;  1TJE A;  3P4Q B;  4NAW B;  1PDX A;  1STE A;  2FE8 A;  4ZHP A;  5H92 C;  1QT9 A;  1N60 A;  4RGN A;  3TEW A;  2Y5P A;  1QIL A;  4HRS A;  2IGG A;  1R7S A;  2I38 A;  3IAM 1;  3Q8F A;  3ZJT A;  2I2Y A;  2L32 A;  1FCL A;  5JXV A;  5BMH A;  4US8 A;  5C2T B;  4RNA A;  4YTM B;  1XLO A;  1C4P A;  2JX5 A;  4XDD A;  4YSY B;  1JRP A;  4FXC A;  1AWD A;  1D4B A;  1N5X A;  1ROE A;  1KLG D;  2WU5 B;  2RPV A;  4B0E A;  1F77 A;  4H2A A;  1IGC A;  2WXJ A;  4HRO A;  1AYF A;  1XLQ A;  2WS3 B;  4JWU C;  1SE3 A;  1YJJ A;  2ONQ A;  2DWQ A;  3HVD A;  1P7E A;  1RYJ A;  2IDY A;  2LHE A;  3BWU D;  1CJE A;  4ZRQ A;  3OWE B;  2JYT A;  1E9M A;  2KAC A;  3AE5 B;  4L23 A;  3AE2 B;  4WUR A;  1NEN B;  3I9V 1;  2KN4 A;  5FK9 C;  3NVY A;  3MJ5 A;  4KX6 B;  2WNM A;  2KDM A;  2MJ3 A;  4A6Q A;  3ABV B;  3U52 E;  1XF5 L;  1EU3 A;  2H89 B;  3AE1 B;  3AEE B;  1HEZ E;  1XLP A;  1YNT E;  1E10 A;  1OQQ A;  3HVZ A;  1C78 A;  3BII D;  2D5G A;  3Q8B A;  2EKI A;  2DYM A;  3NUH B;  2WXP A;  1JWA D;  3HUI A;  2MEK A;  4YSZ B;  1WGK A;  4RH6 A;  3O13 A;  3RPF C;  1DYQ A;  1I4Q A;  1K52 A;  1XEE A;  2AQ2 B;  2PKO A;  1UUP A;  3DWM A;  4OW0 A;  1YMH E;  1V1O A;  3ZJU A;  1QOF A;  2OHF A;  1L6V A;  1T6B X;  2JXT A;  1IBX B;  1V8C A;  3AE4 B;  1JW9 D;  3AE6 B;  4RGM A;  3TEY A;  2INN E;  1VZ8 A;  1UWX A;  2JQR B;  3AV8 A;  3BYT B;  3EGR A;  2J4X A;  5D3I B;  4MH8 A;  3FIL A;  1BXT A;  1K53 A;  2WDR B;  1JWU D;  3C8Y A;  3AE9 B;  3N9Y C;  1AW7 A;  4YSX B;  4A9A A;  1JWM D;  4DQO C;  3AMZ A;  2YEP B;  4GDL B;  1EWY C;  1KH0 A;  1PGX A;  1TS2 A;  1B1Z A;  3KWV A;  1YQ4 B;  1NEK B;  4TQ1 A;  2JZP A;  2PMV A;  2XNA C;  2V0G A;  2K0P A;  1NI3 A;  1E6E B;  2M19 A;  4WWM A;  2PVO D;  3AE3 B;  3IT4 B;  3B9J A;  1JRO A;  3WCQ A;  2B76 B;  1TY2 A;  3RFZ B;  4KGT A;  3PO0 A;  1OFF A;  1DOI A;  1MHX A;  2GRI A;  4ARI A;  3CIR B;  3TEX A;  1PGB A;  1QOG A;  3T3O A;  2PTL A;  4XDC A;  1QKZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...