2V9HA

Solution structure of an escherichia coli yaet tandem potra domain
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
154
structure length
154
Chain Sequence
b'AEGFVVKDIHFEGLQRVAVGAALLSMPVRTGDTVNDEDISNTIRALFATGNFEDVRVLRDGDTLLVQVKERPTIASITFSGNKSVKDDMLKQNLEASGVRVGESLDRTTIADIEKGLEDFYYSVGKYSASVKAVVTPLPRNRVDLKLVFQEGVS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords OUTER MEMBRANE PROTEIN ASSEMBLY FACTOR YAET
publication title Fold and Function of Polypeptide Transport-Associated Domains Responsible for Delivering Unfolded Proteins to Membranes.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Protein binding
total genus 39
structure length 154
sequence length 154
ec nomenclature
pdb deposition date 2007-08-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07244 POTRA Surface antigen variable number repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.310 Alpha Beta Roll Ubiquitin-like (UB roll) membrane protein fhac 2v9hA02
3.10.20.310 Alpha Beta Roll Ubiquitin-like (UB roll) membrane protein fhac 2v9hA01
2QDFA 3MC9A 2X8XX 4C4VA 4BZAA 4K3CA 2VH2A 3MC8A 4XGAB 2V9HA 3EFCA 4C00A 2MHJA 4PK1A 3Q6BA 4K3BA 3OG5A 3NJTA 2VH1A 4QAYA 4C4VB 2QCZA
chains in the Genus database with same CATH superfamily
2WNMA 2KQ4X 4BKTA 1KLVA 3DBLI 3UIOB 1PGBA 4IWOA 1NENB 3DPDA 2IBIB 2N9KA 3EFCA 1SJHD 3V3XA 1T0YA 4MT5A 4M8MA 2JZ3B 2QCZA 2WXLA 1TKYA 3ZO5B 2PMVA 1V1PB 2WS3B 1YIWA 5MPOA 4JE3B 3JSVB 2CU3A 4NQLB 4BKGA 4MJSA 2IYDB 1WXVA 3H7SA 3GOEA 2WLBA 4B0MA 2DYBA 3TMPB 1WXMA 1E7UA 4WAFA 1R4NI 4GLSC 5FR6A 1L0XB 1WMHB 1F1HA 3A33B 1V49A 2BWES 3TEZA 1FRDA 2BYFA 4FHJA 1YD8U 5FK9C 1TJEA 3ZIMA 4GOCA 4WWNA 2DZKA 1IGCA 3PREA 1Q0WB 3DBSA 5DPRA 1GUAB 1ZOYB 2G4SA 4G11A 2WDRB 2KMCA 1EF5A 3P63A 3GE3C 5GXGB 2WDQB 1QOFA 3AEEB 1HZ5A 3T3NA 2NMQA 2K8HA 3PTFC 2X38A 1C76A 4AUQC 4YTNB 2KJHB 5EE3A 3FKYA 2JZPA 3ZXRA 4ITKA 2DYOA 1UWXA 3Q2AC 1XXGA 3ZW3A 1X1MA 2CHZA 1ZP0B 2D3AA 3A1QA 1WXQA 2K8CA 3AE8B 3FAHA 1D5MC 1VLBA 3SU8X 4CYEA 2IJ0A 4A20A 3TEXA 1NYRA 1IP9A 1C9FA 3HK0A 1SE4A 1YJJA 2UYZB 3QK0A 3SEBA 2BVCA 4GDLB 3J9CA 5J18A 4JLCA 1RFAA 2XNAC 4P16A 2K6QA 2N9PC 4NJ6A 3VH4B 2NS5A 1V6EA 2LASA 1ZGUB 3P4PB 2DZMA 2KHWB 2PE9A 1Y56A 3PLUA 1F9JA 3H8HA 3JYUA 2AQ3B 1C4PA 5I4DA 1XCQL 3AB5A 3PRMB 3R2TA 4ZOHC 3KH0A 1GC6A 4XWWA 2WXQA 4YSYB 1YJIA 1JRUA 4M00A 5C1ZA 4BBNF 3OLMD 4X57B 5GMVA 3PZ8A 3W9CB 4XE0A 2CHXA 3PO0A 2EKIA 3A4SC 2C7HA 3AN1A 3KYDD 3RYTA 4IDIA 2J4XA 3MC9A 2KLCA 5JH5C 4W9KA 2IGDA 3QA8A 3ENEA 3PRZA 1ACCA 3K9OB 4GXBA 4ARCA 2RDBC 1WGDA 3KW5B 2E3TA 2DLBA 3V61A 5IA7A 4URKA 1CZPA 3R66C 4IUMB 1TIFA 4FN2A 3ZDMC 5KHOA 3IAM1 1HXYD 4YXDB 1FPYA 3MC8A 4NJ7A 3NS8A 2C5LC 2B76B 4YTMB 2INNE 3N1YC 2WQYB 4RH6A 2WU2B 1YX6B 3P1MA 3A9KB 3B0AA 1I4GA 2IGGA 2N9EB 3Q3JA 5LXIB 1SEBD 2KANA 3ETRA 3CIRB 2HDEA 2DHZA 3NVYA 1L6VA 3Q8CA 1PYWD 3M63B 3AU4A 3DVGX 3KUCB 4FHKA 1FXAA 2JRHA 5E6OA 4GGQA 3BVZA 4XZ4A 2NBWB 3EA6A 4L1BA 5L95C 3B9JA 4IM2A 3NRZA 5HG2A 5BMHA 2J7QB 3ZRFA 3AEDB 2L0FA 1Z5SB 3SHQA 2MEKA 2WU5B 2K25A 2MQJA 2L7RA 3ZDTA 1KTKA 1UELA 2H89B 3E9SA 3DBRB 1HTOA 2DBYA 3LXFA 1HE8A 4K81A 1GOZA 1EO6A 1BUIC 3ZJUA 2QSDA 1FXIA 3M95A 2ZW1A 2AQ2B 2KMAA 1IUEA 3U30A 4L2YA 2WDTB 3JVZX 1KLUD 3WALA 2A5UA 3AE3B 2O2VA 3P42A 3Q8BA 1WYWB 4MDKE 4REZA 2BBCA 2KX3A 4OZBA 3AE5B 5E6JA 3C19A 3SFEB 1WGGA 2O6VA 4ZRIA 3WAOA 5D2MB 4TQ1A 4FBJB 4P7IA 3AECB 3RNAC 2FUG1 1QKZA 3RUIB 3AH7A 2W82A 3VH3B 4TV3A 3PRPB 1WI0A 4YL8A 3WAPA 1P7EA 1FNVA 1OEYJ 2KWDA 3QCAA 1Q1OA 3ZKJC 1P0RA 5FR3A 1NEKB 4ACFA 4HCNB 3PS6A 2WWZA 4E71A 1DOXA 2LFIA 1NBFC 2N7DA 2PTLA 3RNGC 3ZQ4A 2Y5BB 2CJNA 2KT7A 3ZRCA 4ZRJA 3RT3B 3TEYA 3ZTDA 1PFDA 3MHSD 2LUEA 1UF0A 1JWSD 4ICUA 4F7ZA 3ZUNA 1D4BA 2JXXA 1S1QB 2UWQA 3KWLA 1PQSA 4TQ0A 2MP2B 3AEBB 5C23A 4RGMA 5JHBA 2Y3AA 1T0SC 4AJWA 2KN4A 3CMMB 4GMVA 1UGJA 2MRPA 1YQBA 2XBBC 3B2FA 1JMLA 3KVFB 2WXJA 4II2B 5CHFA 2JZZA 1JW9D 4C00A 2KVRA 1YOVB 2KWVB 2RDHA 2GB1A 3ONSA 2I38A 1N63A 3DBRI 2GBKA 3JW0X 1E6EB 2WP9B 3TJPA 3WA0A 4JWSC 5DPWA 4XX5A 3I57A 4BZAA 3M3JA 4A3OA 4GDKA 5BYRA 1I4QA 3OJ3A 4L23A 2ZJDA 4EE2A 3W5UB 3FILA 2MJEA 2KAJA 1I4PA 1JWUD 2R2OA 1LQBA 2L1AA 3MHZA 2J0JA 3CSFA 3VAWA 3H7PB 4BAXA 2OEDA 1EM7A 4A55A 1GC7A 1GB4A 3C8YA 2PVOD 1ESFA 3TEWA 1F0ZA 1WZ0A 1ROEA 3BINA 3L13A 3UQAA 3VUXA 4W9EA 5JHAA 1AYFA 5FKAC 2L3ZA 2KVZA 2JUOA 1GJZA 1TY0A 4B6WA 4RGNA 3BVGA 2Y5CA 4GB9A 4C80A 5EDSA 5D6JB 3QJZA 5G55A 2MBHA 1P9DU 3KYCD 2XN9C 2RSUA 1V1PA 2DYMA 2FUHB 4NJCA 4NZLB 1J19A 4OZCA 3VTVA 4HKZE 1R4MI 3JSVA 4WH4A 2BS2B 3ZGZA 2MCNB 2CHWA 1M94A 3AEFB 3WAMA 1HTQA 4IC7B 1JWBD 2CR5A 1J7BA 4WQOB 1L5PA 2R61A 2L76A 1TS5A 3QIJA 4N6EB 3RULA 4DK5A 2KTRB 2LI5A 3N1ZC 2YLMA 3A9JB 4OVZA 2JSVX 4I6NB 3QC8B 5DPSA 2KK8A 3HUIA 2V4LA 1XLNA 1SXTA 3HHMA 1P3QU 1CQVA 4OVUA 4KZ0A 1KJTA 1PDXA 3W1SC 1FCCC 1K50A 4B9KA 1PGAA 1TYGB 2IY1B 3HVZA 4ANVA 3EC8A 4RFBA 3MC0B 1WGYA 1ZDXA 2QJLA 1K53A 4DQOC 1LGRA 1I7HA 3BIID 2JX5A 1QT9A 1WWTA 3VR8B 3GP7A 5DPTA 4M01A 4OHJA 1VZ8A 1YQ4B 4DWFA 2RR9A 3MP9A 3I63C 2W3SA 1WX7A 3DVNV 1OQYA 1WX8A 1TY2A 4W9CA 1ENFA 2G9HD 3BVMA 1S3SG 1QOAA 4M0WB 2DNFA 4MEMA 2BTEA 2EMTA 1WR6E 4DHZE 2D10A 3IVFA 2X8XX 2KFKB 4MGIE 2KDBA 2OJRA 4MM3B 3AXCA 1SJED 3UF8A 3ZJTA 3URYA 4K1RB 3Q3FA 3TL5A 4DDID 3IXSA 1E7VA 4GDLA 4ZYSA 2MSED 4XYCA 2KLGA 4WWOA 1CK1A 2WYQA 3PT2B 4PYZA 3AE2B 2KACA 2YVCA 4HPLB 1D6EC 2KX0A 3PHXB 2ASQA 2KOXA 1FFVA 3HM6X 3U7ZA 3LB8C 2LGSA 1WJNA 3APDA 4JPSA 5D3IB 2NBUA 1N62A 1SE9A 2DZIA 3PZ7A 2WX0A 5BO4B 2GMIC 5CHVC 5H92C 2M8SA 2C7MB 4C7ZA 4PT5A 5DCNA 2DWQA 1GPXA 2LWPA 4LNOA 4HLEA 2BW2A 2C7NB 2WXIA 1P98A 1RYJA 5L83A 3PHWB 3I9V1 1FIQA 1JCKB 2MBQA 3VXWA 4J3OD 4D2KA 1XLOA 3RNFC 2JPHA 2EELA 3R8BA 3P4RB 2ZCCA 4BVUC 1T3QA 4ASWC 4ZYNA 1C3TA 3ZNZB 3UI3A 2K9XA 5HI1A 2I1KA 2BYTA 1UZXB 1R7SA 1V86A 1HEZE 3KUZA 5LXHA 1E8ZA 4KIKB 3A9KA 2Y5PA 2WGSA 3GZNB 3OAWA 2RPQA 1YN5A 2K22A 3VTWA 2M19A 2ZNVC 5G2NA 3ZXVA 2FAZA 1WH3A 2D07B 4F1SA 2BYVE 4AP4C 4I6LB 2H88B 1L7YA 4M8NA 1FEHA 3PSEB 1V1OA 1OQQA 4C56C 4IOIE 4A6QA 2REXA 4HCPB 3VFKA 3R7RA 4WIPA 2LUMA 5T8IA 1YX5B 1K51A 1NI3A 4KKIA 2JQRB 3TUOA 2ZNVB 2RD0A 2ONQA 4DXAB 4BKSA 2R2QA 3W2DA 1XLQA 4J6IA 4NAWB 4RMAA 2D3BA 2W55A 2MLBA 4LNFA 1UBIA 2FIFA 3Q8FA 4BFRA 1IGDA 5TR5A 3BK2A 1JRPA 2V1YA 5H8YE 3V6CB 2B3AA 2L32A 4ANUA 3TCAA 1RM6C 1KF6B 1WGKA 1MPEA 1AW7A 2ICIA 3KLSX 4JX1C 3KQ4A 4XC2A 4WWMA 4IWQA 4HK2A 4DXGA 3E56A 3RCZA 4RCOA 2XEWA 3B08A 5AUIA 2W9NA 3Q8AA 3QAQA 1QILA 4K7UA 3ZJVA 1EWCA 4YSZB 2BS4B 4W9HA 3DVGY 1MHXA 1N5WA 4YT0B 2NPTA 3DBHB 4A90A 1HA5A 2KC2A 3K9PB 2D2QA 1MG4A 1Q10A 1VR9A 2NCNA 2ACZB 3BYYB 1FNWA 1C4CA 3GZNI 4TMAB 1P1AA 4N9F4 2LXCA 2N1VA 3QHTA 2V9HA 2ZW0A 3DHIC 1CJEA 4KDIC 4USAA 2LHDA 1I4HA 4W9DA 1QZEA 1E9MA 3ECIA 3PGEA 2LRUA 4YTPB 3Q3OC 3DVNU 2MP2A 1JROA 2Z8LA 1FD6A 2WXKA 2JXTA 4HJKA 2BKRB 4ZRQA 1TT5B 1XQQA 3ALBA 2QILA 3RMKC 2JRIB 2G4DB 4K7WA 1TTNA 2BKFA 2K39A 1E0ZA 3DDCB 2M0AA 4HEA1 2JU6X 4MGKE 2BWFA 3W5VB 2WXPA 3RNEC 2XK5B 3V60A 1SSNA 2NPTB 2Z0DB 3U8ZA 2K5PA 1Y8RC 3PLVA 4H2AA 4FJZA 4NNJB 2LVQA 4PK1A 3T3OA 2BF8B 1ZW7A 2EMSA 2WX1A 3ZTCA 2BB5A 1HQRD 2KN5A 3RN9C 3MTNB 4FLHA 4HRSA 1I4XA 2K3UA 2J42A 2INDC 2HD5B 3Q3MC 2WXGA 3DWGC 4JWUC 1B1ZA 1V8CA 4TSSA 4R3DA 1H4RA 3X23A 4ICVA 2BB6A 3P4SB 4QAYA 3H7PA 3HIZA 3CWIA 1OQRA 4ARIA 1LXDA 1JQ4A 1HZ6A 2GBMA 4DBGA 4N58A 2JVCA 2K8BA 3N30A 4IWPA 1WJUA 3DBHI 3AULA 3DOWA 4A8XC 4EZKA 4E74A 1JWMD 2W54A 3L17A 4HDOA 4IM0A 2WXHA 4W9JA 2ZPYA 4W9GA 1V5TA 2D3GA 1ZDVA 5D3DA 4KV2A 3APCA 1WJ4A 2KYWA 4XDDA 4XDCA 3VVWB 1ZXHA 2AWTA 4E3CA 1VDVA 2MBOA 3IFWB 1UH6A 4EZLA 1E10A 2J0KA 3EHVA 3ZNID 4LCDE 1IBXB 1YQ3B 2LHEA 1H8CA 5IKCM 4DHJD 5TSSA 1TS2A 1NYQA 2JF5A 1YNTE 2KJ6A 2LRWA 1KRHA 1YJ1A 1E8XA 3PV1A 4NY0A 2KC1A 4YWGG 1XCTL 4XWTA 4M02A 3DBLB 1TGZB 1J7CA 2NBVB 1QOBA 1WX9A 2RPVA 2D3CA 3NY5A 5IOIA 3AMZA 4KGTA 3OG5A 3VTUA 5HFYA 3WCQA 3T9LA 3NZUA 2JWUA 2KTRA 1K52A 2KNBA 4ZRPA 2MBBB 2ON8A 3DHGC 1E5WA 1SF0A 1V81A 3A9JA 2GBRA 4AS1A 3AE6B 1WM2A 5IAAC 2MH7A 4RNAA 1F52A 3CSTA 2VRRB 1QOGA 2PE6B 3R2IA 4GU2A 1SE2A 2JYEA 2J53A 3AE9B 4OVVA 2LJ5A 5AUKA 4C4VB 1TBEA 2MX2A 3Q3NC 2K1FA 4EEWA 4NAMA 5LNK1 4BOSC 2WXFA 2LXAA 5JZEB 4FJVB 3Q8EA 1N6ZA 1QQRA 2HTHA 4RM8A 1T6BX 4HPPA 2NVUI 1WGRA 3OWEB 3AV8A 2LGIA 1WSPA 3L08A 4EOYA 5KHQA 4CO7A 4WWPA 3ZNGC 4LJPB 2IO3B 2MJDA 4FULA 2G3QB 1E8WA 1E8YA 2PW9A 2LD9A 1J7AA 2KZRA 1SE3A 2LJIA 4M0WA 2D11A 4LNIA 1J8CA 3NHEB 1ZPSA 4KKJA 1V2YA 2KFKA 4MM3A 4PYUA 2G1EA 4WJNA 4WURA 1L6UA 4OW0A 2AL3A 2FBWB 3R7QA 2OOBB 1MHHE 3KUDB 2QDFA 1B9RA 1WZ3A 2V3PA 1NDDA 2LGDA 3RNCC 3UGBB 4WAAA 3IAS1 1XF5L 2ZVOA 4KSLC 1V80A 4GN1A 1D3ZA 3DHHC 1Z2MA 2GBJA 3BK1A 1OFFA 5EE0A 1SBBB 4AOFA 1BXTA 5J2RA 2HE7A 4MELA 4MSMB 4MSQB 2KD0A 1JWAD 1STEA 1BMLC 4LTUA 4YSXB 2M4NA 4OZAA 2MHJA 1TKEA 2K6DB 4N59A 2DAJA 3RFZB 1TZOA 4RF0A 2A4ZA 1ISNA 1F2RI 3TIXA 4JQWC 1XT9B 2LGYA 4MH0E 1ET6A 1RAXA 1VZ7A 3VUYA 3BY4B 1UWMA 3U4EG 1GG3A 2L8JA 4ZRKA 2WDVB 4LK0M 4KZCA 2KQSA 3MFGA 4W9LA 3UIPB 3N9YC 2VZKD 3N20C 2OJWA 2M1MA 1WRDB 5G5GA 1FCLA 2VH1A 2ZZPB 4ANXA 1C4AA 1EF1A 4EZJA 2KDIA 2HTME 4JL9A 1I42A 2LVOA 2N9LA 2MBEA 2PVGC 4KIKA 5LLIA 1SB3C 1YN3A 4MGYE 1WXAA 3Q69A 2CKHB 5CX3A 1WYGA 3PPAA 2MA9B 2QMTA 3H9DA 2HJ1A 5AZHA 4GSWA 1OEYA 1C1YB 3VQIA 3IT6B 1BT0A 3NOBA 2NTSA 1T0QC 2DZJA 2QHOA 4JIOU 1FRRA 3NVVA 4G50A 2QIEB 1OGWA 4JGHB 1VD2A 5EE1A 2L05A 1KM7A 3FC4A 2AX5A 1C79A 2BYEA 3VRBB 3HM3A 1AWDA 2RMMA 2PPHA 1U4AA 2FE8A 2GRIA 4EFOA 1FMAD 1PUTA 3QX1A 2Q5WD 4FJYA 1XLPA 4MJSB 3LJ3A 3NG0A 3AM9A 1WFYA 2GLSA 1EUVB 3A4RA 4LDTD 4DXFA 2BQQA 2I2YA 1KFYB 4NAWA 4CHKA 1QLBB 2HJ8A 2V3NA 1FFUA 1M4VA 3O65B 1XEEA 3RZWC 1WGHA 1F77A 3L16A 3EFUA 3L0WB 3AE4B 1E90A 2INCC 3PVLA 4BOZB 5E6NA 5HKHA 3VR9B 2EKEC 4HWIB 1E7PB 1GNUA 4PS8A 4LNNA 4P1BC 2I1JA 3PZDA 2L83A 1ZKHA 2FCQA 3NVWA 1G6JA 3N32A 3QWZB 3N1XC 2YEPF 4HVBA 3DWMA 2TSSA 3AEGB 1N61A 3EUB2 4PS3A 3H6NA 2IY0B 3B2GA 2GI9A 1VZ6A 4UDUC 3VUWA 2PLPA 4C7YA 4NPNA 4US8A 1JALA 2Z59B 3VDZA 3BYTB 3A1QB 4FA6A 4ZHOA 4S17A 3ZNHB 1PGXA 4WQMA 3NUHB 3RD2A 3RZFA 2N1WA 3B1LX 2BGFA 3GS2A 4G0NB 2KXJA 2BT6A 2LVPA 1GAQB 4BBNC 2KJRA 3P4QB 1AN8A 2IGHA 2K0PA 2DENB 2WXRA 1MG8A 2PJHA 2QC8A 3W1YA 1TKGA 4HJGE 1EWYC 2C9WB 2IO1B 2FIDA 1XO3A 2ZPNA 2KMMA 3BZDB 4S0RA 4EKUA 2ZEQA 1DOIA 2YEPB 1KLGD 4LJOB 5D7GA 3BWUD 4ZHPA 1V97A 3ZYYX 1WIAA 3NS1A 2RDGA 2BS3B 3U7DA 2WXOA 1V5OA 2AEHA 3WANA 3I3TB 2KQ7A 4WJOA 4I6PA 1IPGA 3SD5A 4K3CA 2PIAA 3EGRA 5AZFA 4B0EA 2XK5A 1UUPA 1CMXB 2KFJA 1ZE3D 2IDYA 2RGFA 3TSSA 2IPKD 2JWZA 4LNKA 2WHIA 4DDGD 1TS3A 2AL6A 4KVGB 1DYQA 4PS7A 2Z0EB 4TUUA 2JYTA 1LFDA 4P1CC 4RGTA 1MJDA 4IM3A 2CU1A 1A5RA 3IBEA 3AE1B 3X0WA 3AU5A 5AZGA 4W9FA 5C2TB 4IG7B 2LEKA 2PEAA 2V3SA 5BYSA 2QEJC 3RPFC 1GB1A 4DHJB 2KWCA 3M62B 1EU3A 2PKOA 1VRAB 1MI0A 2CJOA 4IW0A 3V62A 1UGMA 2OHFA 3VHTC 1WRIA 5IN7A 1WM3A 1D5XC 3L54A 1RLFA 1NVID 2V4IB 1T0RC 1VCBA 3IHPC 2N9XA 2L0TA 3SR6A 1KH0A 1UBQA 1TZ1A 3L4PA 5EE9A 4KSKC 2BPSA 2UU7A 3SDLC 2KO3A 2KDMA 1WXSA 1QF6A 1ZXIA 3AE7B 2ZCBA 1D5ZC 1WE7A 2DAFA 3KWVA 2SEBD 4KGRA 2W3RA 3GB1A 1C78A 5BYQA 1WF9A 1IBXA 3H1UA 3C0RB 2GOWA 1NI2A 3ZLZA 3QARA 1YMHE 1N60A 3RNBC 2N4FA 4MH8A 3DQVA 5G5HA 5CHWA 4O1NA 3NZSA 4HKQA 3IT4B 2ZVNA 4HROA 2J0MA 4NQKE 2IO2B 1ET9A 4Q2JA 4IKGA 2KDFB 2M0XA 1L0YB 4LLGM 2JY6A 4WJQA 4AQ7A 1L0VB 1DGJA 4RGOS 2INPE 2FCNA 2AQ1B 2MJ3A 1L4DB 3L10B 2CS4A 3IG3A 4EUTA 3ZVVA 1K8RB 2V0GA 1SIJA 1R4MB 2O2VB 2GBNA 3NVZA 4F8CB 2MWSB 1DOYA 3AEAB 4KGSA 1P7FA 1WR1A 4C4VA 3QQ8B 3P2BA 2MW5A 2IO0B 2O6VB 3U2SC 1V9JA 1WJ6A 1MVKA 3R3MA 4ZDVA 4II3B 2L00B 3GE8C 4TKNA 3OJ4B 3TBLD 5BMIA 5C3JB 3V6EB 4BKSD 1RWSA 3SFDB 1FXTB 5JXVA 1N5XA 2WXNA 4AWJA 3UQBA 4KDLB 3ML9A 4CQNA 3MJ5A 4XGAB 5D94A 4K7SA 1F2RC 3VRAB 3WIMA 1J0GA 4RM9A 5IO9A 3NJTA 1A70A 1LO5D 4G3XB 3I5JC 4HDQA 4KX6B 1OTRB 1LM8B 1SIFA 5HHDG 2N7JA 1I35A 3HRDD 3RI7C 5AEKB 2VZKB 3DCGA 2LZ6A 3Q14C 2E6XA 3N3KB 1FNUA 2JT4B 3MJWA 3S2AA 3U52E 4W9IA 4A3PA 1YN4A 2M17A 4MACA 4MGZE 1Q5WB 1KOTA 1R4NB 2FCMA 1RFKA 2FNJB 4US9A 3AI5A 3Q6BA 5CTRC 1TS4A 4AJYB 3O13A 4RF1A 2SAKA 2G45B 2LGXA 3V05A 1UD7A 1AARA 5IP4D 3LDZE 4HXDA 3ML8A 2D5GA 1FM0D 2AYOB 2L52A 3W1SA 4HPMB 1L2NA 1C77A 1MFWA 4GDKB 2VH2A 1T5XD 1SGHA 1WE6A 4P6VF 4WJPA 2NTTA 3CF6E 4FXCA 4B95A 4ANWA 1UNSA 2IZVB 3D32A 3FILB 5E6PA 2FCSA 4GIVA 1L4ZB 3T8MA 2KDEB 3APFA 5J17A 4A9AA 3ABVB 1EU4A 2N0SB 4FADA 3NZ3A 1XD3B 2DX5B 1VJKA 1IYFA 1WMHA 1ZUD2 4LDTB 1I4RA 3UINB 2O6VD 2LMCA 2KWUB 1FO4A 1WY8A 2NR2A 2KTFA 2WXMA 4K3BA 5BMGA 1RRBA 3LYYA 4DHZB 3EECA 3HVDA 2M56B 2N7EA 2KKCA 2C60A 2J52A
chains in the Genus database with same CATH topology
2QDFA 3MC9A 2X8XX 4C4VA 4BZAA 4K3CA 2VH2A 3MC8A 4XGAB 2V9HA 3EFCA 4C00A 2MHJA 4PK1A 3Q6BA 4K3BA 3OG5A 3NJTA 2VH1A 4QAYA 4C4VB 2QCZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2QDF A;  3MC9 A;  2X8X X;  4C4V A;  4BZA A;  4K3C A;  2VH2 A;  3MC8 A;  4XGA B;  2V9H A;  3EFC A;  4C00 A;  2MHJ A;  4PK1 A;  3Q6B A;  4K3B A;  3OG5 A;  3NJT A;  2VH1 A;  4QAY A;  4C4V B;  2QCZ A; 
#chains in the Genus database with same CATH topology
 2WNM A;  2KQ4 X;  4BKT A;  1KLV A;  3DBL I;  3UIO B;  1PGB A;  4IWO A;  1NEN B;  3DPD A;  2IBI B;  2N9K A;  3EFC A;  1SJH D;  3V3X A;  1T0Y A;  4MT5 A;  4M8M A;  2JZ3 B;  2QCZ A;  2WXL A;  1TKY A;  3ZO5 B;  2PMV A;  1V1P B;  2WS3 B;  1YIW A;  5MPO A;  4JE3 B;  3JSV B;  2CU3 A;  4NQL B;  4BKG A;  4MJS A;  2IYD B;  1WXV A;  3H7S A;  3GOE A;  2WLB A;  4B0M A;  2DYB A;  3TMP B;  1WXM A;  1E7U A;  4WAF A;  1R4N I;  4GLS C;  5FR6 A;  1L0X B;  1WMH B;  1F1H A;  3A33 B;  1V49 A;  2BWE S;  3TEZ A;  1FRD A;  2BYF A;  4FHJ A;  1YD8 U;  5FK9 C;  1TJE A;  3ZIM A;  4GOC A;  4WWN A;  2DZK A;  1IGC A;  3PRE A;  1Q0W B;  3DBS A;  5DPR A;  1GUA B;  1ZOY B;  2G4S A;  4G11 A;  2WDR B;  2KMC A;  1EF5 A;  3P63 A;  3GE3 C;  5GXG B;  2WDQ B;  1QOF A;  3AEE B;  1HZ5 A;  3T3N A;  2NMQ A;  2K8H A;  3PTF C;  2X38 A;  1C76 A;  4AUQ C;  4YTN B;  2KJH B;  5EE3 A;  3FKY A;  2JZP A;  3ZXR A;  4ITK A;  2DYO A;  1UWX A;  3Q2A C;  1XXG A;  3ZW3 A;  1X1M A;  2CHZ A;  1ZP0 B;  2D3A A;  3A1Q A;  1WXQ A;  2K8C A;  3AE8 B;  3FAH A;  1D5M C;  1VLB A;  3SU8 X;  4CYE A;  2IJ0 A;  4A20 A;  3TEX A;  1NYR A;  1IP9 A;  1C9F A;  3HK0 A;  1SE4 A;  1YJJ A;  2UYZ B;  3QK0 A;  3SEB A;  2BVC A;  4GDL B;  3J9C A;  5J18 A;  4JLC A;  1RFA A;  2XNA C;  4P16 A;  2K6Q A;  2N9P C;  4NJ6 A;  3VH4 B;  2NS5 A;  1V6E A;  2LAS A;  1ZGU B;  3P4P B;  2DZM A;  2KHW B;  2PE9 A;  1Y56 A;  3PLU A;  1F9J A;  3H8H A;  3JYU A;  2AQ3 B;  1C4P A;  5I4D A;  1XCQ L;  3AB5 A;  3PRM B;  3R2T A;  4ZOH C;  3KH0 A;  1GC6 A;  4XWW A;  2WXQ A;  4YSY B;  1YJI A;  1JRU A;  4M00 A;  5C1Z A;  4BBN F;  3OLM D;  4X57 B;  5GMV A;  3PZ8 A;  3W9C B;  4XE0 A;  2CHX A;  3PO0 A;  2EKI A;  3A4S C;  2C7H A;  3AN1 A;  3KYD D;  3RYT A;  4IDI A;  2J4X A;  3MC9 A;  2KLC A;  5JH5 C;  4W9K A;  2IGD A;  3QA8 A;  3ENE A;  3PRZ A;  1ACC A;  3K9O B;  4GXB A;  4ARC A;  2RDB C;  1WGD A;  3KW5 B;  2E3T A;  2DLB A;  3V61 A;  5IA7 A;  4URK A;  1CZP A;  3R66 C;  4IUM B;  1TIF A;  4FN2 A;  3ZDM C;  5KHO A;  3IAM 1;  1HXY D;  4YXD B;  1FPY A;  3MC8 A;  4NJ7 A;  3NS8 A;  2C5L C;  2B76 B;  4YTM B;  2INN E;  3N1Y C;  2WQY B;  4RH6 A;  2WU2 B;  1YX6 B;  3P1M A;  3A9K B;  3B0A A;  1I4G A;  2IGG A;  2N9E B;  3Q3J A;  5LXI B;  1SEB D;  2KAN A;  3ETR A;  3CIR B;  2HDE A;  2DHZ A;  3NVY A;  1L6V A;  3Q8C A;  1PYW D;  3M63 B;  3AU4 A;  3DVG X;  3KUC B;  4FHK A;  1FXA A;  2JRH A;  5E6O A;  4GGQ A;  3BVZ A;  4XZ4 A;  2NBW B;  3EA6 A;  4L1B A;  5L95 C;  3B9J A;  4IM2 A;  3NRZ A;  5HG2 A;  5BMH A;  2J7Q B;  3ZRF A;  3AED B;  2L0F A;  1Z5S B;  3SHQ A;  2MEK A;  2WU5 B;  2K25 A;  2MQJ A;  2L7R A;  3ZDT A;  1KTK A;  1UEL A;  2H89 B;  3E9S A;  3DBR B;  1HTO A;  2DBY A;  3LXF A;  1HE8 A;  4K81 A;  1GOZ A;  1EO6 A;  1BUI C;  3ZJU A;  2QSD A;  1FXI A;  3M95 A;  2ZW1 A;  2AQ2 B;  2KMA A;  1IUE A;  3U30 A;  4L2Y A;  2WDT B;  3JVZ X;  1KLU D;  3WAL A;  2A5U A;  3AE3 B;  2O2V A;  3P42 A;  3Q8B A;  1WYW B;  4MDK E;  4REZ A;  2BBC A;  2KX3 A;  4OZB A;  3AE5 B;  5E6J A;  3C19 A;  3SFE B;  1WGG A;  2O6V A;  4ZRI A;  3WAO A;  5D2M B;  4TQ1 A;  4FBJ B;  4P7I A;  3AEC B;  3RNA C;  2FUG 1;  1QKZ A;  3RUI B;  3AH7 A;  2W82 A;  3VH3 B;  4TV3 A;  3PRP B;  1WI0 A;  4YL8 A;  3WAP A;  1P7E A;  1FNV A;  1OEY J;  2KWD A;  3QCA A;  1Q1O A;  3ZKJ C;  1P0R A;  5FR3 A;  1NEK B;  4ACF A;  4HCN B;  3PS6 A;  2WWZ A;  4E71 A;  1DOX A;  2LFI A;  1NBF C;  2N7D A;  2PTL A;  3RNG C;  3ZQ4 A;  2Y5B B;  2CJN A;  2KT7 A;  3ZRC A;  4ZRJ A;  3RT3 B;  3TEY A;  3ZTD A;  1PFD A;  3MHS D;  2LUE A;  1UF0 A;  1JWS D;  4ICU A;  4F7Z A;  3ZUN A;  1D4B A;  2JXX A;  1S1Q B;  2UWQ A;  3KWL A;  1PQS A;  4TQ0 A;  2MP2 B;  3AEB B;  5C23 A;  4RGM A;  5JHB A;  2Y3A A;  1T0S C;  4AJW A;  2KN4 A;  3CMM B;  4GMV A;  1UGJ A;  2MRP A;  1YQB A;  2XBB C;  3B2F A;  1JML A;  3KVF B;  2WXJ A;  4II2 B;  5CHF A;  2JZZ A;  1JW9 D;  4C00 A;  2KVR A;  1YOV B;  2KWV B;  2RDH A;  2GB1 A;  3ONS A;  2I38 A;  1N63 A;  3DBR I;  2GBK A;  3JW0 X;  1E6E B;  2WP9 B;  3TJP A;  3WA0 A;  4JWS C;  5DPW A;  4XX5 A;  3I57 A;  4BZA A;  3M3J A;  4A3O A;  4GDK A;  5BYR A;  1I4Q A;  3OJ3 A;  4L23 A;  2ZJD A;  4EE2 A;  3W5U B;  3FIL A;  2MJE A;  2KAJ A;  1I4P A;  1JWU D;  2R2O A;  1LQB A;  2L1A A;  3MHZ A;  2J0J A;  3CSF A;  3VAW A;  3H7P B;  4BAX A;  2OED A;  1EM7 A;  4A55 A;  1GC7 A;  1GB4 A;  3C8Y A;  2PVO D;  1ESF A;  3TEW A;  1F0Z A;  1WZ0 A;  1ROE A;  3BIN A;  3L13 A;  3UQA A;  3VUX A;  4W9E A;  5JHA A;  1AYF A;  5FKA C;  2L3Z A;  2KVZ A;  2JUO A;  1GJZ A;  1TY0 A;  4B6W A;  4RGN A;  3BVG A;  2Y5C A;  4GB9 A;  4C80 A;  5EDS A;  5D6J B;  3QJZ A;  5G55 A;  2MBH A;  1P9D U;  3KYC D;  2XN9 C;  2RSU A;  1V1P A;  2DYM A;  2FUH B;  4NJC A;  4NZL B;  1J19 A;  4OZC A;  3VTV A;  4HKZ E;  1R4M I;  3JSV A;  4WH4 A;  2BS2 B;  3ZGZ A;  2MCN B;  2CHW A;  1M94 A;  3AEF B;  3WAM A;  1HTQ A;  4IC7 B;  1JWB D;  2CR5 A;  1J7B A;  4WQO B;  1L5P A;  2R61 A;  2L76 A;  1TS5 A;  3QIJ A;  4N6E B;  3RUL A;  4DK5 A;  2KTR B;  2LI5 A;  3N1Z C;  2YLM A;  3A9J B;  4OVZ A;  2JSV X;  4I6N B;  3QC8 B;  5DPS A;  2KK8 A;  3HUI A;  2V4L A;  1XLN A;  1SXT A;  3HHM A;  1P3Q U;  1CQV A;  4OVU A;  4KZ0 A;  1KJT A;  1PDX A;  3W1S C;  1FCC C;  1K50 A;  4B9K A;  1PGA A;  1TYG B;  2IY1 B;  3HVZ A;  4ANV A;  3EC8 A;  4RFB A;  3MC0 B;  1WGY A;  1ZDX A;  2QJL A;  1K53 A;  4DQO C;  1LGR A;  1I7H A;  3BII D;  2JX5 A;  1QT9 A;  1WWT A;  3VR8 B;  3GP7 A;  5DPT A;  4M01 A;  4OHJ A;  1VZ8 A;  1YQ4 B;  4DWF A;  2RR9 A;  3MP9 A;  3I63 C;  2W3S A;  1WX7 A;  3DVN V;  1OQY A;  1WX8 A;  1TY2 A;  4W9C A;  1ENF A;  2G9H D;  3BVM A;  1S3S G;  1QOA A;  4M0W B;  2DNF A;  4MEM A;  2BTE A;  2EMT A;  1WR6 E;  4DHZ E;  2D10 A;  3IVF A;  2X8X X;  2KFK B;  4MGI E;  2KDB A;  2OJR A;  4MM3 B;  3AXC A;  1SJE D;  3UF8 A;  3ZJT A;  3URY A;  4K1R B;  3Q3F A;  3TL5 A;  4DDI D;  3IXS A;  1E7V A;  4GDL A;  4ZYS A;  2MSE D;  4XYC A;  2KLG A;  4WWO A;  1CK1 A;  2WYQ A;  3PT2 B;  4PYZ A;  3AE2 B;  2KAC A;  2YVC A;  4HPL B;  1D6E C;  2KX0 A;  3PHX B;  2ASQ A;  2KOX A;  1FFV A;  3HM6 X;  3U7Z A;  3LB8 C;  2LGS A;  1WJN A;  3APD A;  4JPS A;  5D3I B;  2NBU A;  1N62 A;  1SE9 A;  2DZI A;  3PZ7 A;  2WX0 A;  5BO4 B;  2GMI C;  5CHV C;  5H92 C;  2M8S A;  2C7M B;  4C7Z A;  4PT5 A;  5DCN A;  2DWQ A;  1GPX A;  2LWP A;  4LNO A;  4HLE A;  2BW2 A;  2C7N B;  2WXI A;  1P98 A;  1RYJ A;  5L83 A;  3PHW B;  3I9V 1;  1FIQ A;  1JCK B;  2MBQ A;  3VXW A;  4J3O D;  4D2K A;  1XLO A;  3RNF C;  2JPH A;  2EEL A;  3R8B A;  3P4R B;  2ZCC A;  4BVU C;  1T3Q A;  4ASW C;  4ZYN A;  1C3T A;  3ZNZ B;  3UI3 A;  2K9X A;  5HI1 A;  2I1K A;  2BYT A;  1UZX B;  1R7S A;  1V86 A;  1HEZ E;  3KUZ A;  5LXH A;  1E8Z A;  4KIK B;  3A9K A;  2Y5P A;  2WGS A;  3GZN B;  3OAW A;  2RPQ A;  1YN5 A;  2K22 A;  3VTW A;  2M19 A;  2ZNV C;  5G2N A;  3ZXV A;  2FAZ A;  1WH3 A;  2D07 B;  4F1S A;  2BYV E;  4AP4 C;  4I6L B;  2H88 B;  1L7Y A;  4M8N A;  1FEH A;  3PSE B;  1V1O A;  1OQQ A;  4C56 C;  4IOI E;  4A6Q A;  2REX A;  4HCP B;  3VFK A;  3R7R A;  4WIP A;  2LUM A;  5T8I A;  1YX5 B;  1K51 A;  1NI3 A;  4KKI A;  2JQR B;  3TUO A;  2ZNV B;  2RD0 A;  2ONQ A;  4DXA B;  4BKS A;  2R2Q A;  3W2D A;  1XLQ A;  4J6I A;  4NAW B;  4RMA A;  2D3B A;  2W55 A;  2MLB A;  4LNF A;  1UBI A;  2FIF A;  3Q8F A;  4BFR A;  1IGD A;  5TR5 A;  3BK2 A;  1JRP A;  2V1Y A;  5H8Y E;  3V6C B;  2B3A A;  2L32 A;  4ANU A;  3TCA A;  1RM6 C;  1KF6 B;  1WGK A;  1MPE A;  1AW7 A;  2ICI A;  3KLS X;  4JX1 C;  3KQ4 A;  4XC2 A;  4WWM A;  4IWQ A;  4HK2 A;  4DXG A;  3E56 A;  3RCZ A;  4RCO A;  2XEW A;  3B08 A;  5AUI A;  2W9N A;  3Q8A A;  3QAQ A;  1QIL A;  4K7U A;  3ZJV A;  1EWC A;  4YSZ B;  2BS4 B;  4W9H A;  3DVG Y;  1MHX A;  1N5W A;  4YT0 B;  2NPT A;  3DBH B;  4A90 A;  1HA5 A;  2KC2 A;  3K9P B;  2D2Q A;  1MG4 A;  1Q10 A;  1VR9 A;  2NCN A;  2ACZ B;  3BYY B;  1FNW A;  1C4C A;  3GZN I;  4TMA B;  1P1A A;  4N9F 4;  2LXC A;  2N1V A;  3QHT A;  2V9H A;  2ZW0 A;  3DHI C;  1CJE A;  4KDI C;  4USA A;  2LHD A;  1I4H A;  4W9D A;  1QZE A;  1E9M A;  3ECI A;  3PGE A;  2LRU A;  4YTP B;  3Q3O C;  3DVN U;  2MP2 A;  1JRO A;  2Z8L A;  1FD6 A;  2WXK A;  2JXT A;  4HJK A;  2BKR B;  4ZRQ A;  1TT5 B;  1XQQ A;  3ALB A;  2QIL A;  3RMK C;  2JRI B;  2G4D B;  4K7W A;  1TTN A;  2BKF A;  2K39 A;  1E0Z A;  3DDC B;  2M0A A;  4HEA 1;  2JU6 X;  4MGK E;  2BWF A;  3W5V B;  2WXP A;  3RNE C;  2XK5 B;  3V60 A;  1SSN A;  2NPT B;  2Z0D B;  3U8Z A;  2K5P A;  1Y8R C;  3PLV A;  4H2A A;  4FJZ A;  4NNJ B;  2LVQ A;  4PK1 A;  3T3O A;  2BF8 B;  1ZW7 A;  2EMS A;  2WX1 A;  3ZTC A;  2BB5 A;  1HQR D;  2KN5 A;  3RN9 C;  3MTN B;  4FLH A;  4HRS A;  1I4X A;  2K3U A;  2J42 A;  2IND C;  2HD5 B;  3Q3M C;  2WXG A;  3DWG C;  4JWU C;  1B1Z A;  1V8C A;  4TSS A;  4R3D A;  1H4R A;  3X23 A;  4ICV A;  2BB6 A;  3P4S B;  4QAY A;  3H7P A;  3HIZ A;  3CWI A;  1OQR A;  4ARI A;  1LXD A;  1JQ4 A;  1HZ6 A;  2GBM A;  4DBG A;  4N58 A;  2JVC A;  2K8B A;  3N30 A;  4IWP A;  1WJU A;  3DBH I;  3AUL A;  3DOW A;  4A8X C;  4EZK A;  4E74 A;  1JWM D;  2W54 A;  3L17 A;  4HDO A;  4IM0 A;  2WXH A;  4W9J A;  2ZPY A;  4W9G A;  1V5T A;  2D3G A;  1ZDV A;  5D3D A;  4KV2 A;  3APC A;  1WJ4 A;  2KYW A;  4XDD A;  4XDC A;  3VVW B;  1ZXH A;  2AWT A;  4E3C A;  1VDV A;  2MBO A;  3IFW B;  1UH6 A;  4EZL A;  1E10 A;  2J0K A;  3EHV A;  3ZNI D;  4LCD E;  1IBX B;  1YQ3 B;  2LHE A;  1H8C A;  5IKC M;  4DHJ D;  5TSS A;  1TS2 A;  1NYQ A;  2JF5 A;  1YNT E;  2KJ6 A;  2LRW A;  1KRH A;  1YJ1 A;  1E8X A;  3PV1 A;  4NY0 A;  2KC1 A;  4YWG G;  1XCT L;  4XWT A;  4M02 A;  3DBL B;  1TGZ B;  1J7C A;  2NBV B;  1QOB A;  1WX9 A;  2RPV A;  2D3C A;  3NY5 A;  5IOI A;  3AMZ A;  4KGT A;  3OG5 A;  3VTU A;  5HFY A;  3WCQ A;  3T9L A;  3NZU A;  2JWU A;  2KTR A;  1K52 A;  2KNB A;  4ZRP A;  2MBB B;  2ON8 A;  3DHG C;  1E5W A;  1SF0 A;  1V81 A;  3A9J A;  2GBR A;  4AS1 A;  3AE6 B;  1WM2 A;  5IAA C;  2MH7 A;  4RNA A;  1F52 A;  3CST A;  2VRR B;  1QOG A;  2PE6 B;  3R2I A;  4GU2 A;  1SE2 A;  2JYE A;  2J53 A;  3AE9 B;  4OVV A;  2LJ5 A;  5AUK A;  4C4V B;  1TBE A;  2MX2 A;  3Q3N C;  2K1F A;  4EEW A;  4NAM A;  5LNK 1;  4BOS C;  2WXF A;  2LXA A;  5JZE B;  4FJV B;  3Q8E A;  1N6Z A;  1QQR A;  2HTH A;  4RM8 A;  1T6B X;  4HPP A;  2NVU I;  1WGR A;  3OWE B;  3AV8 A;  2LGI A;  1WSP A;  3L08 A;  4EOY A;  5KHQ A;  4CO7 A;  4WWP A;  3ZNG C;  4LJP B;  2IO3 B;  2MJD A;  4FUL A;  2G3Q B;  1E8W A;  1E8Y A;  2PW9 A;  2LD9 A;  1J7A A;  2KZR A;  1SE3 A;  2LJI A;  4M0W A;  2D11 A;  4LNI A;  1J8C A;  3NHE B;  1ZPS A;  4KKJ A;  1V2Y A;  2KFK A;  4MM3 A;  4PYU A;  2G1E A;  4WJN A;  4WUR A;  1L6U A;  4OW0 A;  2AL3 A;  2FBW B;  3R7Q A;  2OOB B;  1MHH E;  3KUD B;  2QDF A;  1B9R A;  1WZ3 A;  2V3P A;  1NDD A;  2LGD A;  3RNC C;  3UGB B;  4WAA A;  3IAS 1;  1XF5 L;  2ZVO A;  4KSL C;  1V80 A;  4GN1 A;  1D3Z A;  3DHH C;  1Z2M A;  2GBJ A;  3BK1 A;  1OFF A;  5EE0 A;  1SBB B;  4AOF A;  1BXT A;  5J2R A;  2HE7 A;  4MEL A;  4MSM B;  4MSQ B;  2KD0 A;  1JWA D;  1STE A;  1BML C;  4LTU A;  4YSX B;  2M4N A;  4OZA A;  2MHJ A;  1TKE A;  2K6D B;  4N59 A;  2DAJ A;  3RFZ B;  1TZO A;  4RF0 A;  2A4Z A;  1ISN A;  1F2R I;  3TIX A;  4JQW C;  1XT9 B;  2LGY A;  4MH0 E;  1ET6 A;  1RAX A;  1VZ7 A;  3VUY A;  3BY4 B;  1UWM A;  3U4E G;  1GG3 A;  2L8J A;  4ZRK A;  2WDV B;  4LK0 M;  4KZC A;  2KQS A;  3MFG A;  4W9L A;  3UIP B;  3N9Y C;  2VZK D;  3N20 C;  2OJW A;  2M1M A;  1WRD B;  5G5G A;  1FCL A;  2VH1 A;  2ZZP B;  4ANX A;  1C4A A;  1EF1 A;  4EZJ A;  2KDI A;  2HTM E;  4JL9 A;  1I42 A;  2LVO A;  2N9L A;  2MBE A;  2PVG C;  4KIK A;  5LLI A;  1SB3 C;  1YN3 A;  4MGY E;  1WXA A;  3Q69 A;  2CKH B;  5CX3 A;  1WYG A;  3PPA A;  2MA9 B;  2QMT A;  3H9D A;  2HJ1 A;  5AZH A;  4GSW A;  1OEY A;  1C1Y B;  3VQI A;  3IT6 B;  1BT0 A;  3NOB A;  2NTS A;  1T0Q C;  2DZJ A;  2QHO A;  4JIO U;  1FRR A;  3NVV A;  4G50 A;  2QIE B;  1OGW A;  4JGH B;  1VD2 A;  5EE1 A;  2L05 A;  1KM7 A;  3FC4 A;  2AX5 A;  1C79 A;  2BYE A;  3VRB B;  3HM3 A;  1AWD A;  2RMM A;  2PPH A;  1U4A A;  2FE8 A;  2GRI A;  4EFO A;  1FMA D;  1PUT A;  3QX1 A;  2Q5W D;  4FJY A;  1XLP A;  4MJS B;  3LJ3 A;  3NG0 A;  3AM9 A;  1WFY A;  2GLS A;  1EUV B;  3A4R A;  4LDT D;  4DXF A;  2BQQ A;  2I2Y A;  1KFY B;  4NAW A;  4CHK A;  1QLB B;  2HJ8 A;  2V3N A;  1FFU A;  1M4V A;  3O65 B;  1XEE A;  3RZW C;  1WGH A;  1F77 A;  3L16 A;  3EFU A;  3L0W B;  3AE4 B;  1E90 A;  2INC C;  3PVL A;  4BOZ B;  5E6N A;  5HKH A;  3VR9 B;  2EKE C;  4HWI B;  1E7P B;  1GNU A;  4PS8 A;  4LNN A;  4P1B C;  2I1J A;  3PZD A;  2L83 A;  1ZKH A;  2FCQ A;  3NVW A;  1G6J A;  3N32 A;  3QWZ B;  3N1X C;  2YEP F;  4HVB A;  3DWM A;  2TSS A;  3AEG B;  1N61 A;  3EUB 2;  4PS3 A;  3H6N A;  2IY0 B;  3B2G A;  2GI9 A;  1VZ6 A;  4UDU C;  3VUW A;  2PLP A;  4C7Y A;  4NPN A;  4US8 A;  1JAL A;  2Z59 B;  3VDZ A;  3BYT B;  3A1Q B;  4FA6 A;  4ZHO A;  4S17 A;  3ZNH B;  1PGX A;  4WQM A;  3NUH B;  3RD2 A;  3RZF A;  2N1W A;  3B1L X;  2BGF A;  3GS2 A;  4G0N B;  2KXJ A;  2BT6 A;  2LVP A;  1GAQ B;  4BBN C;  2KJR A;  3P4Q B;  1AN8 A;  2IGH A;  2K0P A;  2DEN B;  2WXR A;  1MG8 A;  2PJH A;  2QC8 A;  3W1Y A;  1TKG A;  4HJG E;  1EWY C;  2C9W B;  2IO1 B;  2FID A;  1XO3 A;  2ZPN A;  2KMM A;  3BZD B;  4S0R A;  4EKU A;  2ZEQ A;  1DOI A;  2YEP B;  1KLG D;  4LJO B;  5D7G A;  3BWU D;  4ZHP A;  1V97 A;  3ZYY X;  1WIA A;  3NS1 A;  2RDG A;  2BS3 B;  3U7D A;  2WXO A;  1V5O A;  2AEH A;  3WAN A;  3I3T B;  2KQ7 A;  4WJO A;  4I6P A;  1IPG A;  3SD5 A;  4K3C A;  2PIA A;  3EGR A;  5AZF A;  4B0E A;  2XK5 A;  1UUP A;  1CMX B;  2KFJ A;  1ZE3 D;  2IDY A;  2RGF A;  3TSS A;  2IPK D;  2JWZ A;  4LNK A;  2WHI A;  4DDG D;  1TS3 A;  2AL6 A;  4KVG B;  1DYQ A;  4PS7 A;  2Z0E B;  4TUU A;  2JYT A;  1LFD A;  4P1C C;  4RGT A;  1MJD A;  4IM3 A;  2CU1 A;  1A5R A;  3IBE A;  3AE1 B;  3X0W A;  3AU5 A;  5AZG A;  4W9F A;  5C2T B;  4IG7 B;  2LEK A;  2PEA A;  2V3S A;  5BYS A;  2QEJ C;  3RPF C;  1GB1 A;  4DHJ B;  2KWC A;  3M62 B;  1EU3 A;  2PKO A;  1VRA B;  1MI0 A;  2CJO A;  4IW0 A;  3V62 A;  1UGM A;  2OHF A;  3VHT C;  1WRI A;  5IN7 A;  1WM3 A;  1D5X C;  3L54 A;  1RLF A;  1NVI D;  2V4I B;  1T0R C;  1VCB A;  3IHP C;  2N9X A;  2L0T A;  3SR6 A;  1KH0 A;  1UBQ A;  1TZ1 A;  3L4P A;  5EE9 A;  4KSK C;  2BPS A;  2UU7 A;  3SDL C;  2KO3 A;  2KDM A;  1WXS A;  1QF6 A;  1ZXI A;  3AE7 B;  2ZCB A;  1D5Z C;  1WE7 A;  2DAF A;  3KWV A;  2SEB D;  4KGR A;  2W3R A;  3GB1 A;  1C78 A;  5BYQ A;  1WF9 A;  1IBX A;  3H1U A;  3C0R B;  2GOW A;  1NI2 A;  3ZLZ A;  3QAR A;  1YMH E;  1N60 A;  3RNB C;  2N4F A;  4MH8 A;  3DQV A;  5G5H A;  5CHW A;  4O1N A;  3NZS A;  4HKQ A;  3IT4 B;  2ZVN A;  4HRO A;  2J0M A;  4NQK E;  2IO2 B;  1ET9 A;  4Q2J A;  4IKG A;  2KDF B;  2M0X A;  1L0Y B;  4LLG M;  2JY6 A;  4WJQ A;  4AQ7 A;  1L0V B;  1DGJ A;  4RGO S;  2INP E;  2FCN A;  2AQ1 B;  2MJ3 A;  1L4D B;  3L10 B;  2CS4 A;  3IG3 A;  4EUT A;  3ZVV A;  1K8R B;  2V0G A;  1SIJ A;  1R4M B;  2O2V B;  2GBN A;  3NVZ A;  4F8C B;  2MWS B;  1DOY A;  3AEA B;  4KGS A;  1P7F A;  1WR1 A;  4C4V A;  3QQ8 B;  3P2B A;  2MW5 A;  2IO0 B;  2O6V B;  3U2S C;  1V9J A;  1WJ6 A;  1MVK A;  3R3M A;  4ZDV A;  4II3 B;  2L00 B;  3GE8 C;  4TKN A;  3OJ4 B;  3TBL D;  5BMI A;  5C3J B;  3V6E B;  4BKS D;  1RWS A;  3SFD B;  1FXT B;  5JXV A;  1N5X A;  2WXN A;  4AWJ A;  3UQB A;  4KDL B;  3ML9 A;  4CQN A;  3MJ5 A;  4XGA B;  5D94 A;  4K7S A;  1F2R C;  3VRA B;  3WIM A;  1J0G A;  4RM9 A;  5IO9 A;  3NJT A;  1A70 A;  1LO5 D;  4G3X B;  3I5J C;  4HDQ A;  4KX6 B;  1OTR B;  1LM8 B;  1SIF A;  5HHD G;  2N7J A;  1I35 A;  3HRD D;  3RI7 C;  5AEK B;  2VZK B;  3DCG A;  2LZ6 A;  3Q14 C;  2E6X A;  3N3K B;  1FNU A;  2JT4 B;  3MJW A;  3S2A A;  3U52 E;  4W9I A;  4A3P A;  1YN4 A;  2M17 A;  4MAC A;  4MGZ E;  1Q5W B;  1KOT A;  1R4N B;  2FCM A;  1RFK A;  2FNJ B;  4US9 A;  3AI5 A;  3Q6B A;  5CTR C;  1TS4 A;  4AJY B;  3O13 A;  4RF1 A;  2SAK A;  2G45 B;  2LGX A;  3V05 A;  1UD7 A;  1AAR A;  5IP4 D;  3LDZ E;  4HXD A;  3ML8 A;  2D5G A;  1FM0 D;  2AYO B;  2L52 A;  3W1S A;  4HPM B;  1L2N A;  1C77 A;  1MFW A;  4GDK B;  2VH2 A;  1T5X D;  1SGH A;  1WE6 A;  4P6V F;  4WJP A;  2NTT A;  3CF6 E;  4FXC A;  4B95 A;  4ANW A;  1UNS A;  2IZV B;  3D32 A;  3FIL B;  5E6P A;  2FCS A;  4GIV A;  1L4Z B;  3T8M A;  2KDE B;  3APF A;  5J17 A;  4A9A A;  3ABV B;  1EU4 A;  2N0S B;  4FAD A;  3NZ3 A;  1XD3 B;  2DX5 B;  1VJK A;  1IYF A;  1WMH A;  1ZUD 2;  4LDT B;  1I4R A;  3UIN B;  2O6V D;  2LMC A;  2KWU B;  1FO4 A;  1WY8 A;  2NR2 A;  2KTF A;  2WXM A;  4K3B A;  5BMG A;  1RRB A;  3LYY A;  4DHZ B;  3EEC A;  3HVD A;  2M56 B;  2N7E A;  2KKC A;  2C60 A;  2J52 A; 
#chains in the Genus database with same CATH homology
 2QDF A;  3MC9 A;  2X8X X;  4C4V A;  4BZA A;  4K3C A;  2VH2 A;  3MC8 A;  4XGA B;  2V9H A;  3EFC A;  4C00 A;  2MHJ A;  4PK1 A;  3Q6B A;  4K3B A;  3OG5 A;  3NJT A;  2VH1 A;  4QAY A;  4C4V B;  2QCZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...