2V9HA

Solution structure of an escherichia coli yaet tandem potra domain
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
154
structure length
154
Chain Sequence
AEGFVVKDIHFEGLQRVAVGAALLSMPVRTGDTVNDEDISNTIRALFATGNFEDVRVLRDGDTLLVQVKERPTIASITFSGNKSVKDDMLKQNLEASGVRVGESLDRTTIADIEKGLEDFYYSVGKYSASVKAVVTPLPRNRVDLKLVFQEGVS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Protein binding
molecule keywords OUTER MEMBRANE PROTEIN ASSEMBLY FACTOR YAET
publication title Fold and Function of Polypeptide Transport-Associated Domains Responsible for Delivering Unfolded Proteins to Membranes.
pubmed doi rcsb
source organism Escherichia coli
total genus 39
structure length 154
sequence length 154
ec nomenclature
pdb deposition date 2007-08-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07244 POTRA Surface antigen variable number repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.310 Alpha Beta Roll Ubiquitin-like (UB roll) membrane protein fhac 2v9hA02
3.10.20.310 Alpha Beta Roll Ubiquitin-like (UB roll) membrane protein fhac 2v9hA01
4C4VB 2MHJA 4C4VA 2V9HA 2QCZA 4BZAA 3Q6BA 4QAYA 4K3BA 4XGAB 2X8XX 3MC8A 4PK1A 3MC9A 2VH2A 2QDFA 3OG5A 4C00A 4K3CA 2VH1A 3NJTA 3EFCA
chains in the Genus database with same CATH superfamily
2FCQA 1D5ZC 2LGYA 4F7ZA 4WJOA 4JQWC 1F1HA 2BS3B 1TBEA 3DBHB 4WAFA 3FC4A 1ZOYB 4NY0A 2MP2A 1PUTA 4HDQA 1JCKB 2LXCA 2JZ3B 3DVNU 2VH2A 2FAZA 4M0WA 4YSYB 2C9WB 4HJKA 3NZ3A 2OEDA 4IM0A 3P2BA 1HZ6A 3ENEA 1BXTA 2IO3B 4DK5A 3VRAB 1C4CA 4ZRJA 3WANA 3TEYA 2NR2A 4HPPA 1KM7A 3ZXRA 1SIFA 2KLGA 2MBQA 3Q3JA 4DDID 1EUVB 1QOFA 1YX6B 1ENFA 4ZHPA 4XDDA 3TIXA 3C8YA 1KLUD 4WQOB 3VUXA 4EE2A 1ESFA 2JSVX 1TYGB 4K3BA 1SEBD 2KD0A 4DQOC 4JE3B 2CS4A 4TSSA 5KHQA 2NTSA 3AE6B 2QIEB 2H89B 3OJ3A 3SFEB 2LUMA 2DZMA 3ZLZA 4W9KA 2GBNA 1XCQL 1PFDA 4W9CA 5E6OA 3CSTA 5HHDG 1VJKA 1N63A 3B2GA 2N9KA 1J7CA 1OQQA 4L1BA 2IPKD 3NY5A 4AJYB 4RH6A 4ARIA 1JQ4A 2IGDA 5D3DA 1E6EB 3H8HA 4PYZA 1AYFA 4K81A 2KMAA 2E3TA 4MSMB 2GBKA 1TTNA 4RGNA 1WM2A 4EFOA 1ACCA 1SE3A 1RFKA 1RRBA 1T3QA 1SF0A 3P4PB 3SHQA 1WXVA 2D5GA 3EGRA 4DXGA 1WXMA 3TBLD 1E7UA 3PZ8A 2LRWA 2IZVB 1J7BA 4K3CA 1MVKA 4GB9A 4L23A 3BYYB 1C79A 5BMIA 1QKZA 2JU6X 1XEEA 1NEKB 3A9KA 2J42A 1I4RA 4ANXA 2AQ3B 3T8MA 2CU3A 1H8CA 2AL3A 5G5HA 2RDGA 4B9KA 1JWSD 2L3ZA 4DBGA 2ASQA 3PT2B 3VTUA 4HCNB 1HTQA 3Q8FA 2PKOA 4KDLB 2KJHB 1UGMA 1TZ1A 1HEZE 1WXSA 2FNJB 2RPVA 2CR5A 1FRDA 2VZKD 1YQ4B 3RUIB 3OAWA 3FAHA 3LYYA 3NZUA 4JWSC 2L32A 3PLVA 5EE9A 2CJNA 1V9JA 1RLFA 2LGIA 2V4IB 3IHPC 1EF1A 3N9YC 5DPWA 4K1RB 5E6PA 3BK2A 1ET6A 1P7FA 4US8A 2J0KA 4HDOA 2IO0B 4NPNA 1N5XA 4KZCA 3V61A 1GNUA 1KFYB 4PS3A 5TR5A 2WXPA 2ZEQA 1JW9D 1L6UA 2Z0DB 3ZJUA 4OZCA 1P3QU 2WHIA 3NVYA 4OVVA 4GGQA 1KH0A 3A9JB 5BO4B 1FFUA 1FM0D 4YSZB 3RT3B 3W1YA 2M1MA 2PE6B 5IKCM 3ML8A 5CHVC 1PYWD 4S0RA 5H92C 2IBIB 4NJ6A 2K5PA 2MX2A 1MG8A 2KTRA 4NNJB 4ZRPA 5FK9C 3CF6E 4A6QA 3VFKA 1WE7A 3UF8A 2YEPF 2WDVB 3SEBA 4IG7B 1GC7A 3DPDA 3QJZA 2QMTA 2BB5A 3R7RA 4MJSB 1YJIA 2ON8A 4NAMA 4OHJA 1H4RA 1YN4A 4IW0A 4WIPA 2D3BA 3RNAC 3HM6X 3L54A 3L08A 1C76A 2JUOA 2KJRA 2MBBB 2XK5A 3A4RA 2QCZA 1UGJA 1YX5B 4HVBA 1T6BX 4WWOA 4P7IA 3DHGC 4WQMA 2MBOA 1F52A 3UQAA 2LJIA 1HZ5A 1RYJA 2KT7A 4JIOU 2UYZB 1FO4A 3NUHB 2NBUA 2CHZA 3IBEA 1KLVA 3BYTB 2HD5B 1C9FA 3O65B 2KACA 4OVUA 1ET9A 1T5XD 3RULA 4YTMB 2QEJC 2N1VA 1JWMD 3V3XA 3EFUA 1QOAA 2DLBA 2Z59B 4N59A 2A4ZA 2ZNVC 2OJWA 2SEBD 3APCA 4RCOA 5D7GA 5AZHA 2M8SA 2OOBB 1L0YB 1Z2MA 3AXCA 3RN9C 4BKTA 2PE9A 2G4SA 3P4SB 3RMKC 3KYCD 2FCSA 3PRPB 4ANVA 1UBIA 3H9DA 3AMZA 3QA8A 3LDZE 4FA6A 2JVCA 4FBJB 2GLSA 1UZXB 1XLOA 1ZDVA 1FMAD 4LDTB 4AWJA 2KNBA 4P16A 2V1YA 4EUTA 4GIVA 1PGXA 1E10A 1I4PA 1YQ3B 2MWSB 3W2DA 1GB4A 1WX9A 3KW5B 1Y56A 3AE7B 2KMCA 3CWIA 3FILB 4ACFA 4NAWA 2Y5BB 3FILA 1IYFA 5JZEB 5CHFA 3SU8X 1N61A 2KFJA 2GI9A 2KQSA 2NBWB 4E74A 1YIWA 4MM3B 2AL6A 2WXMA 3H7PA 2W55A 3R2IA 1F9JA 1XF5L 1J7AA 1UBQA 2PPHA 1XO3A 2DNFA 3K9OB 4FJYA 3W1SC 1F2RC 1LGRA 2PTLA 3I3TB 5IA7A 3AM9A 1FXTB 2WXRA 2LI5A 1YN3A 1WZ3A 2JYTA 4J6IA 2L05A 2N0SB 5EE3A 1ISNA 3AEGB 3RNCC 1JWAD 5D6JB 4MGKE 3AE9B 4NJ7A 1L5PA 1BMLC 3QWZB 1FEHA 1VR9A 3ZYYX 2WXGA 4RNAA 2HJ8A 4MH0E 4RGTA 3CSFA 3QQ8B 4E3CA 3RYTA 4L2YA 2DWQA 1Z5SB 3GS2A 5J18A 1EU3A 1BT0A 2MEKA 5CX3A 2AYOB 2KFKA 2GRIA 3AU5A 3DBLI 4N58A 1XCTL 4JGHB 2JWUA 2K25A 1WGRA 3VUYA 2IGGA 2LWPA 2QJLA 2MLBA 4K7UA 2MQJA 3RFZB 2N9LA 1MJDA 2L8JA 3PRMB 4XGAB 4B0EA 4C7YA 4MACA 2O2VB 3MTNB 4II3B 4MSQB 1RAXA 2MBEA 3VHTC 2O2VA 3ZNID 1AW7A 4XC2A 3ZXVA 1T0RC 1K51A 4WURA 1GAQB 4FJZA 1WFYA 5IP4D 2KMMA 1L4ZB 4DHJD 3KLSX 3QARA 2R61A 2PIAA 3CIRB 1K50A 3AU4A 3V62A 3BY4B 3BVGA 1E9MA 2V4LA 4P1CC 4I6NB 1WRDB 3OWEB 2DBYA 3ZW3A 4IWQA 5BYSA 1NI2A 2Z8LA 3IG3A 1MHHE 3I63C 3L10B 3CMMB 3ZVVA 2Y3AA 4TQ1A 4X57B 5T8IA 2BWES 2C5LC 2CU1A 1DOXA 2Q5WD 1V1PB 3OLMD 5MPOA 4OZBA 1GB1A 1V1PA 2N9EB 2WXHA 4PT5A 2W82A 4W9IA 4TV3A 1K8RB 3UGBB 3KUZA 3TMPB 3ZO5B 3HUIA 2CHXA 2KC2A 2LMCA 4II2B 3MHSD 2D3CA 2KHWB 3R7QA 4MEMA 4W9GA 4G50A 4K7WA 2RGFA 1ZE3D 2YLMA 4BAXA 4G3XB 4XWWA 4ZDVA 5BMGA 2W3RA 4ZOHC 3I5JC 1TZOA 4ZYSA 5AUKA 4EZJA 3HK0A 4RMAA 1VZ7A 2K1FA 3IFWB 3PTFC 4WJQA 4WH4A 4ZRQA 1JALA 3QIJA 1V1OA 3WIMA 1XLNA 1C4AA 2FCNA 3V6EB 3ZGZA 2PLPA 1NENB 1QOBA 3QHTA 3PLUA 1FNUA 2LRUA 2J0JA 1OEYJ 3W5VB 1SGHA 2H88B 3KUCB 1UWXA 3KH0A 1FXIA 3HVZA 4EZKA 4FJVB 4JX1C 2GB1A 3QC8B 4XYCA 3N1XC 4FHJA 4LJOB 2M4NA 2KX3A 1VZ6A 3TL5A 5AZGA 4DWFA 3TEWA 4HCPB 3DWMA 4NJCA 2WXNA 4YSXB 2LVOA 2DX5B 3H1UA 3AECB 2DZKA 3PGEA 2KYWA 4C4VB 5TSSA 1RM6C 1WXAA 5IOIA 2WXFA 1V5OA 2KJ6A 1WZ0A 4LNNA 1UUPA 1B9RA 2Z0EB 1TGZB 1ZXIA 2KC1A 3UQBA 1HE8A 2INDC 1ZGUB 2WNMA 3L17A 4ZRKA 4W9DA 3NJTA 4XWTA 2JZPA 3NOBA 1YQBA 1I42A 3VTVA 3UI3A 2SAKA 2NMQA 2M19A 3DVGY 3RNEC 3DCGA 5LXHA 2N7JA 4C80A 2OHFA 5AZFA 2GMIC 1QOGA 3X23A 3MC9A 4ITKA 4KGTA 1CQVA 3IVFA 5BYRA 1E8WA 2INNE 4HKQA 1NYQA 1MG4A 3ZNGC 4IC7B 4AP4C 2LJ5A 4EKUA 3APDA 4MGZE 1Y8RC 1I4QA 5C1ZA 1MI0A 5LNK1 4IKGA 5KHOA 2FBWB 1WWTA 1OQRA 4WWMA 1L4DB 3NVVA 4RFBA 1WXQA 2E6XA 2K22A 2Y5PA 3QCAA 1DGJA 3PV1A 3PSEB 2W54A 2CKHB 3PZDA 3URYA 2KWDA 4C56C 1OFFA 3L16A 4FN2A 1YN5A 3Q3OC 1JROA 3A4SC 1P9DU 3VH4B 4WJNA 2JZZA 1VRAB 1TIFA 2EKIA 2C60A 2AX5A 2KN5A 4BOSC 3T9LA 1WI0A 2KWCA 2ZNVB 4RGMA 2DYBA 1PGAA 4BKSA 1J8CA 5CTRC 2KVRA 2BGFA 4F1SA 3U7ZA 3ZNZB 5HFYA 3NVZA 2JWZA 1V8CA 1SIJA 1I7HA 2NVUI 4ICVA 3AULA 2VH1A 5AUIA 1E90A 2WU2B 4BVUC 2HTME 3WALA 3DBLB 2PEAA 3ETRA 3MFGA 4KGSA 2K8BA 4PYUA 2UU7A 1F0ZA 3R3MA 3ZTCA 4YL8A 4LNIA 4EOYA 4MDKE 3ZQ4A 1LFDA 1TKYA 4KZ0A 1HXYD 1JWBD 3A9JA 3S2AA 5L95C 3AE8B 1DOIA 2C7HA 4B0MA 1NVID 3OG5A 1WGKA 3PZ7A 3U8ZA 1QT9A 1WMHB 2WYQA 5C23A 4A9AA 1A70A 1RWSA 1L0VB 1SB3C 3P4RB 3Q8EA 1WSPA 4A55A 2C7MB 1WRIA 1CK1A 3AEFB 4J3OD 3P42A 1JWUD 4RF0A 2RMMA 3O13A 3VRBB 4A3OA 5FR3A 1VCBA 4GDKB 3UIOB 1SE4A 2N7DA 4MT5A 1N5WA 5G2NA 3U4EG 4IM3A 3WAMA 4GDKA 2HDEA 1YD8U 4PK1A 4AOFA 3DOWA 3PS6A 1UH6A 2N1WA 3MHZA 4MJSA 2N7EA 3ZRCA 4BOZB 2MSED 3Q2AC 4LK0M 3SFDB 3IXSA 1FD6A 3W1SA 3NG0A 1G6JA 3ZIMA 2GOWA 5D2MB 1L6VA 1UWMA 3U52E 1UD7A 1OTRB 2EMTA 4D2KA 3Q69A 4NQLB 1FNWA 2D3AA 4HPMB 3JSVB 4O1NA 4M8NA 1E8YA 2WQYB 4M01A 3QAQA 4TUUA 4HJGE 1F77A 2EMSA 4YWGG 5HI1A 1QQRA 3B08A 5BMHA 4JPSA 2DHZA 1ZDXA 4XX5A 2DYMA 2AQ2B 2WX0A 2VRRB 5D94A 2QHOA 1T0QC 2B3AA 1I4XA 3NS1A 3RNBC 3NVWA 2FUG1 2KQ4X 3Q14C 1QLBB 3PHWB 2BBCA 2DAJA 3B9JA 3KWVA 4F8CB 2RSUA 2AQ1B 3N3KB 4URKA 2O6VB 2WXKA 2ZPYA 2LGSA 2PW9A 1E7PB 3VAWA 2MH7A 2M0XA 1WR1A 4ANWA 2BYEA 2KN4A 1PGBA 4K7SA 1R4MB 4RM8A 4ICUA 2XBBC 3N30A 4KSKC 3DBRB 3OJ4B 4LNOA 1UELA 2KDFB 4XZ4A 4IWOA 4GMVA 4WJPA 4LCDE 3AE5B 1IBXB 3ZDMC 4WWPA 4MM3A 2C7NB 2NCNA 2CJOA 4OVZA 4LDTD 3PO0A 5JHBA 3HIZA 3PREA 4HKZE 2G45B 3V6CB 1R7SA 2Y5CA 4GOCA 1YMHE 1TS3A 3RI7C 4W9HA 3ZKJC 2JT4B 2LZ6A 3Q8AA 3WCQA 3AE1B 4BBNC 2PVOD 1NDDA 1Q5WB 1BUIC 2UWQA 1R4NI 4W9EA 1IUEA 4IUMB 2GBRA 4TMAB 3MJWA 1WJ4A 1J0GA 1NI3A 1CJEA 1KF6B 3NZSA 2PJHA 4ASWC 1D5MC 2I38A 1SE9A 1YJJA 1TJEA 2HTHA 3VXWA 4QAYA 2BWFA 2YEPB 4N9F4 4AS1A 2WP9B 1FCLA 1AN8A 1WE6A 5IO9A 2G9HD 2IY0B 2ZZPB 2XN9C 1Q0WB 3AE4B 4HXDA 1YOVB 3KUDB 1JRPA 2D3GA 1EO6A 2I2YA 2KDEB 3BVZA 2CHWA 1YNTE 2ICIA 3ALBA 4HPLB 1ZW7A 2B76B 4DXAB 3ECIA 2XEWA 2FUHB 3AH7A 1CMXB 4IDIA 1FFVA 2L7RA 2MJ3A 2L00B 1GG3A 1WX8A 3VVWB 5EE0A 2N4FA 1V49A 3R66C 3U2SC 2KAJA 3RNGC 1NBFC 2G4DB 4RM9A 3ABVB 1P7EA 3TJPA 5L83A 1WGYA 1P0RA 3VH3B 3SDLC 2NPTB 3D32A 1EWCA 2WXQA 2LXAA 3A1QB 3AEDB 4N6EB 4XDCA 5G55A 3DVGX 4TQ0A 1P1AA 2KVZA 4AJWA 3A1QA 1C3TA 1N62A 4AUQC 2V3PA 3BK1A 1N6ZA 1TY2A 1F2RI 1LXDA 2K0PA 4KIKB 2ZVOA 3Q6BA 2WX1A 2IO2B 2M17A 2MCNB 1LO5D 3N32A 3V60A 1SJED 1TKGA 5GMVA 4GDLB 3ZUNA 2WU5B 4EZLA 1N60A 3ZJTA 3ZNHB 2WXIA 3VTWA 4I6PA 3RZWC 2LVPA 4CYEA 2ZVNA 1WJUA 4MELA 3VQIA 3GE8C 3PPAA 1ZUD2 5JHAA 2RR9A 1WJNA 3MP9A 2DAFA 2DENB 5DPSA 4YTNB 3HM3A 5JH5C 1LQBA 3GZNB 1L0XB 3EHVA 2KO3A 3M63B 1WGHA 3IAS1 2JPHA 2W3SA 3DVNV 3AEEB 1VD2A 1ROEA 4P1BC 3TEXA 3BZDB 1VDVA 3NRZA 4KKIA 2MP2B 2NS5A 1ZKHA 1TS2A 1WX7A 1ZP0B 1E0ZA 2KXJA 4M0WB 3IT4B 2WGSA 1DYQA 1R4MI 4G11A 4NZLB 3RPFC 1TY0A 2BKFA 2QC8A 1TS5A 3DBRI 3TEZA 2LHEA 1QF6A 2WXJA 2BYVE 1D4BA 4C4VA 3VR8B 4IOIE 5E6JA 3Q3NC 2D11A 2INCC 2KK8A 3UINB 2KTFA 5E6NA 2DZJA 2BB6A 1KRHA 5FKAC 4DXFA 2MHJA 2I1JA 4E71A 4M8MA 5JXVA 3L4PA 2LD9A 3J9CA 2V9HA 3BIID 3U30A 1V81A 3M3JA 3B1LX 3L13A 1V97A 4BBNF 1YJ1A 3N1ZC 1RFAA 3JYUA 2INPE 2BQQA 3C0RB 1NYRA 1A5RA 4FHKA 1U4AA 3N1YC 4GN1A 1IGDA 4W9FA 4DDGD 2FIFA 1I4HA 2BF8B 2L83A 1E8XA 5DCNA 3AE3B 4BZAA 2K6DB 3WAOA 2G1EA 3DHHC 2LGXA 1AARA 2BTEA 5HG2A 2KDBA 2R2QA 2JYEA 2DYOA 3GP7A 2M0AA 2PMVA 3TUOA 1C77A 2ZJDA 2HE7A 5CHWA 1WH3A 2VZKB 1XT9B 2AEHA 2IDYA 2KLCA 2WDQB 2BVCA 4S17A 5D3IB 2QDFA 1AWDA 1K53A 2K39A 3EUB2 3A9KB 2HJ1A 3U7DA 2L52A 1WGGA 1OEYA 3RNFC 1WYGA 4ARCA 4FULA 4WAAA 4LNKA 3M62B 4HLEA 1WYWB 2JXXA 2ZW0A 5G5GA 1WGDA 2IJ0A 3BVMA 3ONSA 1HQRD 1FPYA 1R4NB 5IN7A 1Q1OA 1V2YA 4HRSA 4LLGM 1XD3B 1M4VA 1Q10A 2W9NA 3ML9A 3MC0B 1TKEA 1WY8A 3VR9B 5BYQA 3T3NA 1KLGD 3MC8A 2G3QB 1V86A 2J52A 4REZA 1VZ8A 1FXAA 5GXGB 5DPRA 4C00A 4CHKA 1C78A 1K52A 3AI5A 2ZCCA 3KYDD 1D6EC 2LUEA 1WR6E 4I6LB 1XQQA 4GXBA 1T0SC 2IO1B 3GE3C 2BYTA 3P4QB 4HK2A 4W9LA 3W9CB 2KANA 1E7VA 2KOXA 1I35A 2ZCBA 1XLPA 2ACZB 2MBHA 4KX6B 2EELA 4C7ZA 3T3OA 2LEKA 4OZAA 4BKSD 4LJPB 1WF9A 3ZTDA 1WMHA 1FIQA 2BPSA 3B2FA 3N20C 3GZNI 5C3JB 1VLBA 2JQRB 2PVGC 4ZYNA 2KKCA 2KDIA 2D10A 3E56A 2KTRB 3Q8BA 2BKRB 4MGIE 5I4DA 4W9JA 1HTOA 3PVLA 3JVZX 3LJ3A 3QK0A 3R8BA 1P98A 3DBHI 2WDTB 3ZDTA 5HKHA 2JXTA 4UDUC 3KWLA 3Q8CA 1CZPA 2QSDA 1LM8B 1JMLA 1GPXA 2KZRA 2MJDA 1GOZA 3TSSA 5EDSA 3P1MA 4DHZE 5EE1A 1E5WA 3RCZA 3WA0A 2JF5A 2XK5B 3FKYA 2KWVB 3LXFA 2K3UA 3JSVA 4YXDB 2IY1B 2AWTA 3LB8C 1B1ZA 3AEBB 5LXIB 1GJZA 4XE0A 4OW0A 4US9A 2LASA 3X0WA 4CO7A 1S1QB 5C2TB 2KQ7A 3RD2A 3SR6A 2K8HA 5J17A 1OQYA 4ANUA 1KTKA 4JLCA 2LVQA 1D5XC 2LFIA 1MHXA 3IT6B 4M00A 3Q3FA 2BT6A 1T0YA 1ZPSA 1PDXA 2ONQA 3NHEB 1WM3A 4A8XC 2NTTA 1MFWA 1FNVA 2QILA 2TSSA 5J2RA 2RDHA 4HROA 4FLHA 3VDZA 2K6QA 4M02A 2ZPNA 4CQNA 4YTPB 4KGRA 4A20A 2O6VA 1WIAA 4HWIB 1V5TA 1FRRA 1M94A 1WJ6A 1SJHD 2REXA 4MH8A 2FE8A 4GSWA 5LLIA 2FIDA 2N9XA 3W5UB 4FXCA 2L76A 2BS2B 1SXTA 1EU4A 2GBMA 2MW5A 2GBJA 1UNSA 2YVCA 3A33B 2V3SA 2XNAC 3APFA 1MPEA 2WLBA 1UF0A 2WS3B 2L1AA 4IM2A 4JWUC 4WWNA 3AB5A 5IAAC 4NAWB 1KJTA 1IBXA 1GUAB 1STEA 2O6VD 2KWUB 4H2AA 4P6VF 2J4XA 2JX5A 3SD5A 3PHXB 2R2OA 4HEA1 1ZXHA 2WDRB 1GC6A 3H7PB 2FCMA 4A90A 2RD0A 4BKGA 2X8XX 3WAPA 1I4GA 2LHDA 2I1KA 2JY6A 1XLQA 1C1YB 2V0GA 5FR6A 3QX1A 4GLSC 4A3PA 2RDBC 3NS8A 3JW0X 3KVFB 2BS4B 2RPQA 2MA9B 1HA5A 3BWUD 3EECA 2L0TA 1EM7A 2D2QA 3EC8A 2L0FA 3L0WB 1PQSA 2KDMA 5DPTA 3TCAA 4R3DA 4KVGB 3HVDA 3EA6A 1S3SG 1FCCC 5AEKB 2K9XA 4B95A 1XXGA 4NQKE 4RF1A 1L2NA 2EKEC 3DBSA 3ZRFA 4DHJB 1JRUA 2X38A 1EF5A 3P63A 2LGDA 1TS4A 2KFKB 2BW2A 2N9PC 4TKNA 3DWGC 4BFRA 1E8ZA 1IPGA 4G0NB 1C4PA 1SSNA 2A5UA 3KQ4A 1L7YA 3HHMA 4MGYE 1V80A 4GU2A 1EWYC 3IAM1 3H6NA 3DQVA 2IGHA 3GOEA 4KKJA 2MRPA 3R2TA 3VUWA 2V3NA 2NPTA 4EEWA 1TT5B 3V05A 3H7SA 2BYFA 4AQ7A 1SE2A 4PS7A 3AE2B 3UIPB 4YT0B 3AN1A 4KV2A 1SBBB 2J7QB 2OJRA 1IGCA 2J0MA 2WXOA 3E9SA 1J19A 3PRZA 4ZRIA 3C19A 2WWZA 4Q2JA 1OGWA 4LTUA 4KIKA 5H8YE 2JRHA 3DHIC 4USAA 3RZFA 3GB1A 1X1MA 4KSLC 2KX0A 2MJEA 2J53A 2D07B 4GDLA 1KOTA 1V6EA 4B6WA 3AV8A 1QZEA 3B0AA 4JL9A 1D3ZA 4KDIC 2JRIB 4DHZB 3MJ5A 2M56B 3HRDD 3BINA 3Q3MC 3DDCB 4ZHOA 2NBVB 1IP9A 2IYDB 4LNFA 4IWPA 3I9V1 4PS8A 1QILA 2ZW1A 3AEAB 3M95A 4RGOS 2DZIA 2K8CA 4FADA 2WXLA 1DOYA 3K9PB 3I57A 3EFCA 3ZJVA
chains in the Genus database with same CATH topology
4C4VB 2MHJA 4C4VA 2V9HA 2QCZA 4BZAA 3Q6BA 4QAYA 4K3BA 4XGAB 2X8XX 3MC8A 4PK1A 3MC9A 2VH2A 2QDFA 3OG5A 4C00A 4K3CA 2VH1A 3NJTA 3EFCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4C4V B;  2MHJ A;  4C4V A;  2V9H A;  2QCZ A;  4BZA A;  3Q6B A;  4QAY A;  4K3B A;  4XGA B;  2X8X X;  3MC8 A;  4PK1 A;  3MC9 A;  2VH2 A;  2QDF A;  3OG5 A;  4C00 A;  4K3C A;  2VH1 A;  3NJT A;  3EFC A; 
#chains in the Genus database with same CATH topology
 2FCQ A;  1D5Z C;  2LGY A;  4F7Z A;  4WJO A;  4JQW C;  1F1H A;  2BS3 B;  1TBE A;  3DBH B;  4WAF A;  3FC4 A;  1ZOY B;  4NY0 A;  2MP2 A;  1PUT A;  4HDQ A;  1JCK B;  2LXC A;  2JZ3 B;  3DVN U;  2VH2 A;  2FAZ A;  4M0W A;  4YSY B;  2C9W B;  4HJK A;  3NZ3 A;  2OED A;  4IM0 A;  3P2B A;  1HZ6 A;  3ENE A;  1BXT A;  2IO3 B;  4DK5 A;  3VRA B;  1C4C A;  4ZRJ A;  3WAN A;  3TEY A;  2NR2 A;  4HPP A;  1KM7 A;  3ZXR A;  1SIF A;  2KLG A;  2MBQ A;  3Q3J A;  4DDI D;  1EUV B;  1QOF A;  1YX6 B;  1ENF A;  4ZHP A;  4XDD A;  3TIX A;  3C8Y A;  1KLU D;  4WQO B;  3VUX A;  4EE2 A;  1ESF A;  2JSV X;  1TYG B;  4K3B A;  1SEB D;  2KD0 A;  4DQO C;  4JE3 B;  2CS4 A;  4TSS A;  5KHQ A;  2NTS A;  3AE6 B;  2QIE B;  2H89 B;  3OJ3 A;  3SFE B;  2LUM A;  2DZM A;  3ZLZ A;  4W9K A;  2GBN A;  1XCQ L;  1PFD A;  4W9C A;  5E6O A;  3CST A;  5HHD G;  1VJK A;  1N63 A;  3B2G A;  2N9K A;  1J7C A;  1OQQ A;  4L1B A;  2IPK D;  3NY5 A;  4AJY B;  4RH6 A;  4ARI A;  1JQ4 A;  2IGD A;  5D3D A;  1E6E B;  3H8H A;  4PYZ A;  1AYF A;  4K81 A;  2KMA A;  2E3T A;  4MSM B;  2GBK A;  1TTN A;  4RGN A;  1WM2 A;  4EFO A;  1ACC A;  1SE3 A;  1RFK A;  1RRB A;  1T3Q A;  1SF0 A;  3P4P B;  3SHQ A;  1WXV A;  2D5G A;  3EGR A;  4DXG A;  1WXM A;  3TBL D;  1E7U A;  3PZ8 A;  2LRW A;  2IZV B;  1J7B A;  4K3C A;  1MVK A;  4GB9 A;  4L23 A;  3BYY B;  1C79 A;  5BMI A;  1QKZ A;  2JU6 X;  1XEE A;  1NEK B;  3A9K A;  2J42 A;  1I4R A;  4ANX A;  2AQ3 B;  3T8M A;  2CU3 A;  1H8C A;  2AL3 A;  5G5H A;  2RDG A;  4B9K A;  1JWS D;  2L3Z A;  4DBG A;  2ASQ A;  3PT2 B;  3VTU A;  4HCN B;  1HTQ A;  3Q8F A;  2PKO A;  4KDL B;  2KJH B;  1UGM A;  1TZ1 A;  1HEZ E;  1WXS A;  2FNJ B;  2RPV A;  2CR5 A;  1FRD A;  2VZK D;  1YQ4 B;  3RUI B;  3OAW A;  3FAH A;  3LYY A;  3NZU A;  4JWS C;  2L32 A;  3PLV A;  5EE9 A;  2CJN A;  1V9J A;  1RLF A;  2LGI A;  2V4I B;  3IHP C;  1EF1 A;  3N9Y C;  5DPW A;  4K1R B;  5E6P A;  3BK2 A;  1ET6 A;  1P7F A;  4US8 A;  2J0K A;  4HDO A;  2IO0 B;  4NPN A;  1N5X A;  4KZC A;  3V61 A;  1GNU A;  1KFY B;  4PS3 A;  5TR5 A;  2WXP A;  2ZEQ A;  1JW9 D;  1L6U A;  2Z0D B;  3ZJU A;  4OZC A;  1P3Q U;  2WHI A;  3NVY A;  4OVV A;  4GGQ A;  1KH0 A;  3A9J B;  5BO4 B;  1FFU A;  1FM0 D;  4YSZ B;  3RT3 B;  3W1Y A;  2M1M A;  2PE6 B;  5IKC M;  3ML8 A;  5CHV C;  1PYW D;  4S0R A;  5H92 C;  2IBI B;  4NJ6 A;  2K5P A;  2MX2 A;  1MG8 A;  2KTR A;  4NNJ B;  4ZRP A;  5FK9 C;  3CF6 E;  4A6Q A;  3VFK A;  1WE7 A;  3UF8 A;  2YEP F;  2WDV B;  3SEB A;  4IG7 B;  1GC7 A;  3DPD A;  3QJZ A;  2QMT A;  2BB5 A;  3R7R A;  4MJS B;  1YJI A;  2ON8 A;  4NAM A;  4OHJ A;  1H4R A;  1YN4 A;  4IW0 A;  4WIP A;  2D3B A;  3RNA C;  3HM6 X;  3L54 A;  3L08 A;  1C76 A;  2JUO A;  2KJR A;  2MBB B;  2XK5 A;  3A4R A;  2QCZ A;  1UGJ A;  1YX5 B;  4HVB A;  1T6B X;  4WWO A;  4P7I A;  3DHG C;  4WQM A;  2MBO A;  1F52 A;  3UQA A;  2LJI A;  1HZ5 A;  1RYJ A;  2KT7 A;  4JIO U;  2UYZ B;  1FO4 A;  3NUH B;  2NBU A;  2CHZ A;  3IBE A;  1KLV A;  3BYT B;  2HD5 B;  1C9F A;  3O65 B;  2KAC A;  4OVU A;  1ET9 A;  1T5X D;  3RUL A;  4YTM B;  2QEJ C;  2N1V A;  1JWM D;  3V3X A;  3EFU A;  1QOA A;  2DLB A;  2Z59 B;  4N59 A;  2A4Z A;  2ZNV C;  2OJW A;  2SEB D;  3APC A;  4RCO A;  5D7G A;  5AZH A;  2M8S A;  2OOB B;  1L0Y B;  1Z2M A;  3AXC A;  3RN9 C;  4BKT A;  2PE9 A;  2G4S A;  3P4S B;  3RMK C;  3KYC D;  2FCS A;  3PRP B;  4ANV A;  1UBI A;  3H9D A;  3AMZ A;  3QA8 A;  3LDZ E;  4FA6 A;  2JVC A;  4FBJ B;  2GLS A;  1UZX B;  1XLO A;  1ZDV A;  1FMA D;  4LDT B;  4AWJ A;  2KNB A;  4P16 A;  2V1Y A;  4EUT A;  4GIV A;  1PGX A;  1E10 A;  1I4P A;  1YQ3 B;  2MWS B;  3W2D A;  1GB4 A;  1WX9 A;  3KW5 B;  1Y56 A;  3AE7 B;  2KMC A;  3CWI A;  3FIL B;  4ACF A;  4NAW A;  2Y5B B;  3FIL A;  1IYF A;  5JZE B;  5CHF A;  3SU8 X;  1N61 A;  2KFJ A;  2GI9 A;  2KQS A;  2NBW B;  4E74 A;  1YIW A;  4MM3 B;  2AL6 A;  2WXM A;  3H7P A;  2W55 A;  3R2I A;  1F9J A;  1XF5 L;  1J7A A;  1UBQ A;  2PPH A;  1XO3 A;  2DNF A;  3K9O B;  4FJY A;  3W1S C;  1F2R C;  1LGR A;  2PTL A;  3I3T B;  5IA7 A;  3AM9 A;  1FXT B;  2WXR A;  2LI5 A;  1YN3 A;  1WZ3 A;  2JYT A;  4J6I A;  2L05 A;  2N0S B;  5EE3 A;  1ISN A;  3AEG B;  3RNC C;  1JWA D;  5D6J B;  4MGK E;  3AE9 B;  4NJ7 A;  1L5P A;  1BML C;  3QWZ B;  1FEH A;  1VR9 A;  3ZYY X;  2WXG A;  4RNA A;  2HJ8 A;  4MH0 E;  4RGT A;  3CSF A;  3QQ8 B;  4E3C A;  3RYT A;  4L2Y A;  2DWQ A;  1Z5S B;  3GS2 A;  5J18 A;  1EU3 A;  1BT0 A;  2MEK A;  5CX3 A;  2AYO B;  2KFK A;  2GRI A;  3AU5 A;  3DBL I;  4N58 A;  1XCT L;  4JGH B;  2JWU A;  2K25 A;  1WGR A;  3VUY A;  2IGG A;  2LWP A;  2QJL A;  2MLB A;  4K7U A;  2MQJ A;  3RFZ B;  2N9L A;  1MJD A;  2L8J A;  3PRM B;  4XGA B;  4B0E A;  4C7Y A;  4MAC A;  2O2V B;  3MTN B;  4II3 B;  4MSQ B;  1RAX A;  2MBE A;  3VHT C;  2O2V A;  3ZNI D;  1AW7 A;  4XC2 A;  3ZXV A;  1T0R C;  1K51 A;  4WUR A;  1GAQ B;  4FJZ A;  1WFY A;  5IP4 D;  2KMM A;  1L4Z B;  4DHJ D;  3KLS X;  3QAR A;  2R61 A;  2PIA A;  3CIR B;  1K50 A;  3AU4 A;  3V62 A;  3BY4 B;  3BVG A;  1E9M A;  2V4L A;  4P1C C;  4I6N B;  1WRD B;  3OWE B;  2DBY A;  3ZW3 A;  4IWQ A;  5BYS A;  1NI2 A;  2Z8L A;  3IG3 A;  1MHH E;  3I63 C;  3L10 B;  3CMM B;  3ZVV A;  2Y3A A;  4TQ1 A;  4X57 B;  5T8I A;  2BWE S;  2C5L C;  2CU1 A;  1DOX A;  2Q5W D;  1V1P B;  3OLM D;  5MPO A;  4OZB A;  1GB1 A;  1V1P A;  2N9E B;  2WXH A;  4PT5 A;  2W82 A;  4W9I A;  4TV3 A;  1K8R B;  3UGB B;  3KUZ A;  3TMP B;  3ZO5 B;  3HUI A;  2CHX A;  2KC2 A;  2LMC A;  4II2 B;  3MHS D;  2D3C A;  2KHW B;  3R7Q A;  4MEM A;  4W9G A;  4G50 A;  4K7W A;  2RGF A;  1ZE3 D;  2YLM A;  4BAX A;  4G3X B;  4XWW A;  4ZDV A;  5BMG A;  2W3R A;  4ZOH C;  3I5J C;  1TZO A;  4ZYS A;  5AUK A;  4EZJ A;  3HK0 A;  4RMA A;  1VZ7 A;  2K1F A;  3IFW B;  3PTF C;  4WJQ A;  4WH4 A;  4ZRQ A;  1JAL A;  3QIJ A;  1V1O A;  3WIM A;  1XLN A;  1C4A A;  2FCN A;  3V6E B;  3ZGZ A;  2PLP A;  1NEN B;  1QOB A;  3QHT A;  3PLU A;  1FNU A;  2LRU A;  2J0J A;  1OEY J;  3W5V B;  1SGH A;  2H88 B;  3KUC B;  1UWX A;  3KH0 A;  1FXI A;  3HVZ A;  4EZK A;  4FJV B;  4JX1 C;  2GB1 A;  3QC8 B;  4XYC A;  3N1X C;  4FHJ A;  4LJO B;  2M4N A;  2KX3 A;  1VZ6 A;  3TL5 A;  5AZG A;  4DWF A;  3TEW A;  4HCP B;  3DWM A;  4NJC A;  2WXN A;  4YSX B;  2LVO A;  2DX5 B;  3H1U A;  3AEC B;  2DZK A;  3PGE A;  2KYW A;  4C4V B;  5TSS A;  1RM6 C;  1WXA A;  5IOI A;  2WXF A;  1V5O A;  2KJ6 A;  1WZ0 A;  4LNN A;  1UUP A;  1B9R A;  2Z0E B;  1TGZ B;  1ZXI A;  2KC1 A;  3UQB A;  1HE8 A;  2IND C;  1ZGU B;  2WNM A;  3L17 A;  4ZRK A;  4W9D A;  3NJT A;  4XWT A;  2JZP A;  3NOB A;  1YQB A;  1I42 A;  3VTV A;  3UI3 A;  2SAK A;  2NMQ A;  2M19 A;  3DVG Y;  3RNE C;  3DCG A;  5LXH A;  2N7J A;  4C80 A;  2OHF A;  5AZF A;  2GMI C;  1QOG A;  3X23 A;  3MC9 A;  4ITK A;  4KGT A;  1CQV A;  3IVF A;  5BYR A;  1E8W A;  2INN E;  4HKQ A;  1NYQ A;  1MG4 A;  3ZNG C;  4IC7 B;  4AP4 C;  2LJ5 A;  4EKU A;  3APD A;  4MGZ E;  1Y8R C;  1I4Q A;  5C1Z A;  1MI0 A;  5LNK 1;  4IKG A;  5KHO A;  2FBW B;  1WWT A;  1OQR A;  4WWM A;  1L4D B;  3NVV A;  4RFB A;  1WXQ A;  2E6X A;  2K22 A;  2Y5P A;  3QCA A;  1DGJ A;  3PV1 A;  3PSE B;  2W54 A;  2CKH B;  3PZD A;  3URY A;  2KWD A;  4C56 C;  1OFF A;  3L16 A;  4FN2 A;  1YN5 A;  3Q3O C;  1JRO A;  3A4S C;  1P9D U;  3VH4 B;  4WJN A;  2JZZ A;  1VRA B;  1TIF A;  2EKI A;  2C60 A;  2AX5 A;  2KN5 A;  4BOS C;  3T9L A;  1WI0 A;  2KWC A;  2ZNV B;  4RGM A;  2DYB A;  1PGA A;  4BKS A;  1J8C A;  5CTR C;  2KVR A;  2BGF A;  4F1S A;  3U7Z A;  3ZNZ B;  5HFY A;  3NVZ A;  2JWZ A;  1V8C A;  1SIJ A;  1I7H A;  2NVU I;  4ICV A;  3AUL A;  2VH1 A;  5AUI A;  1E90 A;  2WU2 B;  4BVU C;  2HTM E;  3WAL A;  3DBL B;  2PEA A;  3ETR A;  3MFG A;  4KGS A;  2K8B A;  4PYU A;  2UU7 A;  1F0Z A;  3R3M A;  3ZTC A;  4YL8 A;  4LNI A;  4EOY A;  4MDK E;  3ZQ4 A;  1LFD A;  1TKY A;  4KZ0 A;  1HXY D;  1JWB D;  3A9J A;  3S2A A;  5L95 C;  3AE8 B;  1DOI A;  2C7H A;  4B0M A;  1NVI D;  3OG5 A;  1WGK A;  3PZ7 A;  3U8Z A;  1QT9 A;  1WMH B;  2WYQ A;  5C23 A;  4A9A A;  1A70 A;  1RWS A;  1L0V B;  1SB3 C;  3P4R B;  3Q8E A;  1WSP A;  4A55 A;  2C7M B;  1WRI A;  1CK1 A;  3AEF B;  4J3O D;  3P42 A;  1JWU D;  4RF0 A;  2RMM A;  3O13 A;  3VRB B;  4A3O A;  5FR3 A;  1VCB A;  4GDK B;  3UIO B;  1SE4 A;  2N7D A;  4MT5 A;  1N5W A;  5G2N A;  3U4E G;  4IM3 A;  3WAM A;  4GDK A;  2HDE A;  1YD8 U;  4PK1 A;  4AOF A;  3DOW A;  3PS6 A;  1UH6 A;  2N1W A;  3MHZ A;  4MJS A;  2N7E A;  3ZRC A;  4BOZ B;  2MSE D;  3Q2A C;  4LK0 M;  3SFD B;  3IXS A;  1FD6 A;  3W1S A;  3NG0 A;  1G6J A;  3ZIM A;  2GOW A;  5D2M B;  1L6V A;  1UWM A;  3U52 E;  1UD7 A;  1OTR B;  2EMT A;  4D2K A;  3Q69 A;  4NQL B;  1FNW A;  2D3A A;  4HPM B;  3JSV B;  4O1N A;  4M8N A;  1E8Y A;  2WQY B;  4M01 A;  3QAQ A;  4TUU A;  4HJG E;  1F77 A;  2EMS A;  4YWG G;  5HI1 A;  1QQR A;  3B08 A;  5BMH A;  4JPS A;  2DHZ A;  1ZDX A;  4XX5 A;  2DYM A;  2AQ2 B;  2WX0 A;  2VRR B;  5D94 A;  2QHO A;  1T0Q C;  2B3A A;  1I4X A;  3NS1 A;  3RNB C;  3NVW A;  2FUG 1;  2KQ4 X;  3Q14 C;  1QLB B;  3PHW B;  2BBC A;  2DAJ A;  3B9J A;  3KWV A;  4F8C B;  2RSU A;  2AQ1 B;  3N3K B;  4URK A;  2O6V B;  2WXK A;  2ZPY A;  2LGS A;  2PW9 A;  1E7P B;  3VAW A;  2MH7 A;  2M0X A;  1WR1 A;  4ANW A;  2BYE A;  2KN4 A;  1PGB A;  4K7S A;  1R4M B;  4RM8 A;  4ICU A;  2XBB C;  3N30 A;  4KSK C;  3DBR B;  3OJ4 B;  4LNO A;  1UEL A;  2KDF B;  4XZ4 A;  4IWO A;  4GMV A;  4WJP A;  4LCD E;  3AE5 B;  1IBX B;  3ZDM C;  4WWP A;  4MM3 A;  2C7N B;  2NCN A;  2CJO A;  4OVZ A;  4LDT D;  3PO0 A;  5JHB A;  3HIZ A;  3PRE A;  4HKZ E;  2G45 B;  3V6C B;  1R7S A;  2Y5C A;  4GOC A;  1YMH E;  1TS3 A;  3RI7 C;  4W9H A;  3ZKJ C;  2JT4 B;  2LZ6 A;  3Q8A A;  3WCQ A;  3AE1 B;  4BBN C;  2PVO D;  1NDD A;  1Q5W B;  1BUI C;  2UWQ A;  1R4N I;  4W9E A;  1IUE A;  4IUM B;  2GBR A;  4TMA B;  3MJW A;  1WJ4 A;  1J0G A;  1NI3 A;  1CJE A;  1KF6 B;  3NZS A;  2PJH A;  4ASW C;  1D5M C;  2I38 A;  1SE9 A;  1YJJ A;  1TJE A;  2HTH A;  3VXW A;  4QAY A;  2BWF A;  2YEP B;  4N9F 4;  4AS1 A;  2WP9 B;  1FCL A;  1AN8 A;  1WE6 A;  5IO9 A;  2G9H D;  2IY0 B;  2ZZP B;  2XN9 C;  1Q0W B;  3AE4 B;  4HXD A;  1YOV B;  3KUD B;  1JRP A;  2D3G A;  1EO6 A;  2I2Y A;  2KDE B;  3BVZ A;  2CHW A;  1YNT E;  2ICI A;  3ALB A;  4HPL B;  1ZW7 A;  2B76 B;  4DXA B;  3ECI A;  2XEW A;  2FUH B;  3AH7 A;  1CMX B;  4IDI A;  1FFV A;  2L7R A;  2MJ3 A;  2L00 B;  1GG3 A;  1WX8 A;  3VVW B;  5EE0 A;  2N4F A;  1V49 A;  3R66 C;  3U2S C;  2KAJ A;  3RNG C;  1NBF C;  2G4D B;  4RM9 A;  3ABV B;  1P7E A;  3TJP A;  5L83 A;  1WGY A;  1P0R A;  3VH3 B;  3SDL C;  2NPT B;  3D32 A;  1EWC A;  2WXQ A;  2LXA A;  3A1Q B;  3AED B;  4N6E B;  4XDC A;  5G55 A;  3DVG X;  4TQ0 A;  1P1A A;  2KVZ A;  4AJW A;  3A1Q A;  1C3T A;  1N62 A;  4AUQ C;  2V3P A;  3BK1 A;  1N6Z A;  1TY2 A;  1F2R I;  1LXD A;  2K0P A;  4KIK B;  2ZVO A;  3Q6B A;  2WX1 A;  2IO2 B;  2M17 A;  2MCN B;  1LO5 D;  3N32 A;  3V60 A;  1SJE D;  1TKG A;  5GMV A;  4GDL B;  3ZUN A;  2WU5 B;  4EZL A;  1N60 A;  3ZJT A;  3ZNH B;  2WXI A;  3VTW A;  4I6P A;  3RZW C;  2LVP A;  4CYE A;  2ZVN A;  1WJU A;  4MEL A;  3VQI A;  3GE8 C;  3PPA A;  1ZUD 2;  5JHA A;  2RR9 A;  1WJN A;  3MP9 A;  2DAF A;  2DEN B;  5DPS A;  4YTN B;  3HM3 A;  5JH5 C;  1LQB A;  3GZN B;  1L0X B;  3EHV A;  2KO3 A;  3M63 B;  1WGH A;  3IAS 1;  2JPH A;  2W3S A;  3DVN V;  3AEE B;  1VD2 A;  1ROE A;  4P1B C;  3TEX A;  3BZD B;  1VDV A;  3NRZ A;  4KKI A;  2MP2 B;  2NS5 A;  1ZKH A;  1TS2 A;  1WX7 A;  1ZP0 B;  1E0Z A;  2KXJ A;  4M0W B;  3IT4 B;  2WGS A;  1DYQ A;  1R4M I;  4G11 A;  4NZL B;  3RPF C;  1TY0 A;  2BKF A;  2QC8 A;  1TS5 A;  3DBR I;  3TEZ A;  2LHE A;  1QF6 A;  2WXJ A;  2BYV E;  1D4B A;  4C4V A;  3VR8 B;  4IOI E;  5E6J A;  3Q3N C;  2D11 A;  2INC C;  2KK8 A;  3UIN B;  2KTF A;  5E6N A;  2DZJ A;  2BB6 A;  1KRH A;  5FKA C;  4DXF A;  2MHJ A;  2I1J A;  4E71 A;  4M8M A;  5JXV A;  3L4P A;  2LD9 A;  3J9C A;  2V9H A;  3BII D;  3U30 A;  1V81 A;  3M3J A;  3B1L X;  3L13 A;  1V97 A;  4BBN F;  1YJ1 A;  3N1Z C;  1RFA A;  3JYU A;  2INP E;  2BQQ A;  3C0R B;  1NYR A;  1A5R A;  4FHK A;  1U4A A;  3N1Y C;  4GN1 A;  1IGD A;  4W9F A;  4DDG D;  2FIF A;  1I4H A;  2BF8 B;  2L83 A;  1E8X A;  5DCN A;  3AE3 B;  4BZA A;  2K6D B;  3WAO A;  2G1E A;  3DHH C;  2LGX A;  1AAR A;  2BTE A;  5HG2 A;  2KDB A;  2R2Q A;  2JYE A;  2DYO A;  3GP7 A;  2M0A A;  2PMV A;  3TUO A;  1C77 A;  2ZJD A;  2HE7 A;  5CHW A;  1WH3 A;  2VZK B;  1XT9 B;  2AEH A;  2IDY A;  2KLC A;  2WDQ B;  2BVC A;  4S17 A;  5D3I B;  2QDF A;  1AWD A;  1K53 A;  2K39 A;  3EUB 2;  3A9K B;  2HJ1 A;  3U7D A;  2L52 A;  1WGG A;  1OEY A;  3RNF C;  1WYG A;  4ARC A;  4FUL A;  4WAA A;  4LNK A;  3M62 B;  4HLE A;  1WYW B;  2JXX A;  2ZW0 A;  5G5G A;  1WGD A;  2IJ0 A;  3BVM A;  3ONS A;  1HQR D;  1FPY A;  1R4N B;  5IN7 A;  1Q1O A;  1V2Y A;  4HRS A;  4LLG M;  1XD3 B;  1M4V A;  1Q10 A;  2W9N A;  3ML9 A;  3MC0 B;  1TKE A;  1WY8 A;  3VR9 B;  5BYQ A;  3T3N A;  1KLG D;  3MC8 A;  2G3Q B;  1V86 A;  2J52 A;  4REZ A;  1VZ8 A;  1FXA A;  5GXG B;  5DPR A;  4C00 A;  4CHK A;  1C78 A;  1K52 A;  3AI5 A;  2ZCC A;  3KYD D;  1D6E C;  2LUE A;  1WR6 E;  4I6L B;  1XQQ A;  4GXB A;  1T0S C;  2IO1 B;  3GE3 C;  2BYT A;  3P4Q B;  4HK2 A;  4W9L A;  3W9C B;  2KAN A;  1E7V A;  2KOX A;  1I35 A;  2ZCB A;  1XLP A;  2ACZ B;  2MBH A;  4KX6 B;  2EEL A;  4C7Z A;  3T3O A;  2LEK A;  4OZA A;  4BKS D;  4LJP B;  1WF9 A;  3ZTD A;  1WMH A;  1FIQ A;  2BPS A;  3B2F A;  3N20 C;  3GZN I;  5C3J B;  1VLB A;  2JQR B;  2PVG C;  4ZYN A;  2KKC A;  2KDI A;  2D10 A;  3E56 A;  2KTR B;  3Q8B A;  2BKR B;  4MGI E;  5I4D A;  4W9J A;  1HTO A;  3PVL A;  3JVZ X;  3LJ3 A;  3QK0 A;  3R8B A;  1P98 A;  3DBH I;  2WDT B;  3ZDT A;  5HKH A;  2JXT A;  4UDU C;  3KWL A;  3Q8C A;  1CZP A;  2QSD A;  1LM8 B;  1JML A;  1GPX A;  2KZR A;  2MJD A;  1GOZ A;  3TSS A;  5EDS A;  3P1M A;  4DHZ E;  5EE1 A;  1E5W A;  3RCZ A;  3WA0 A;  2JF5 A;  2XK5 B;  3FKY A;  2KWV B;  3LXF A;  2K3U A;  3JSV A;  4YXD B;  2IY1 B;  2AWT A;  3LB8 C;  1B1Z A;  3AEB B;  5LXI B;  1GJZ A;  4XE0 A;  4OW0 A;  4US9 A;  2LAS A;  3X0W A;  4CO7 A;  1S1Q B;  5C2T B;  2KQ7 A;  3RD2 A;  3SR6 A;  2K8H A;  5J17 A;  1OQY A;  4ANU A;  1KTK A;  4JLC A;  2LVQ A;  1D5X C;  2LFI A;  1MHX A;  3IT6 B;  4M00 A;  3Q3F A;  2BT6 A;  1T0Y A;  1ZPS A;  1PDX A;  2ONQ A;  3NHE B;  1WM3 A;  4A8X C;  2NTT A;  1MFW A;  1FNV A;  2QIL A;  2TSS A;  5J2R A;  2RDH A;  4HRO A;  4FLH A;  3VDZ A;  2K6Q A;  4M02 A;  2ZPN A;  4CQN A;  4YTP B;  4KGR A;  4A20 A;  2O6V A;  1WIA A;  4HWI B;  1V5T A;  1FRR A;  1M94 A;  1WJ6 A;  1SJH D;  2REX A;  4MH8 A;  2FE8 A;  4GSW A;  5LLI A;  2FID A;  2N9X A;  3W5U B;  4FXC A;  2L76 A;  2BS2 B;  1SXT A;  1EU4 A;  2GBM A;  2MW5 A;  2GBJ A;  1UNS A;  2YVC A;  3A33 B;  2V3S A;  2XNA C;  3APF A;  1MPE A;  2WLB A;  1UF0 A;  2WS3 B;  2L1A A;  4IM2 A;  4JWU C;  4WWN A;  3AB5 A;  5IAA C;  4NAW B;  1KJT A;  1IBX A;  1GUA B;  1STE A;  2O6V D;  2KWU B;  4H2A A;  4P6V F;  2J4X A;  2JX5 A;  3SD5 A;  3PHX B;  2R2O A;  4HEA 1;  1ZXH A;  2WDR B;  1GC6 A;  3H7P B;  2FCM A;  4A90 A;  2RD0 A;  4BKG A;  2X8X X;  3WAP A;  1I4G A;  2LHD A;  2I1K A;  2JY6 A;  1XLQ A;  1C1Y B;  2V0G A;  5FR6 A;  3QX1 A;  4GLS C;  4A3P A;  2RDB C;  3NS8 A;  3JW0 X;  3KVF B;  2BS4 B;  2RPQ A;  2MA9 B;  1HA5 A;  3BWU D;  3EEC A;  2L0T A;  1EM7 A;  2D2Q A;  3EC8 A;  2L0F A;  3L0W B;  1PQS A;  2KDM A;  5DPT A;  3TCA A;  4R3D A;  4KVG B;  3HVD A;  3EA6 A;  1S3S G;  1FCC C;  5AEK B;  2K9X A;  4B95 A;  1XXG A;  4NQK E;  4RF1 A;  1L2N A;  2EKE C;  3DBS A;  3ZRF A;  4DHJ B;  1JRU A;  2X38 A;  1EF5 A;  3P63 A;  2LGD A;  1TS4 A;  2KFK B;  2BW2 A;  2N9P C;  4TKN A;  3DWG C;  4BFR A;  1E8Z A;  1IPG A;  4G0N B;  1C4P A;  1SSN A;  2A5U A;  3KQ4 A;  1L7Y A;  3HHM A;  4MGY E;  1V80 A;  4GU2 A;  1EWY C;  3IAM 1;  3H6N A;  3DQV A;  2IGH A;  3GOE A;  4KKJ A;  2MRP A;  3R2T A;  3VUW A;  2V3N A;  2NPT A;  4EEW A;  1TT5 B;  3V05 A;  3H7S A;  2BYF A;  4AQ7 A;  1SE2 A;  4PS7 A;  3AE2 B;  3UIP B;  4YT0 B;  3AN1 A;  4KV2 A;  1SBB B;  2J7Q B;  2OJR A;  1IGC A;  2J0M A;  2WXO A;  3E9S A;  1J19 A;  3PRZ A;  4ZRI A;  3C19 A;  2WWZ A;  4Q2J A;  1OGW A;  4LTU A;  4KIK A;  5H8Y E;  2JRH A;  3DHI C;  4USA A;  3RZF A;  3GB1 A;  1X1M A;  4KSL C;  2KX0 A;  2MJE A;  2J53 A;  2D07 B;  4GDL A;  1KOT A;  1V6E A;  4B6W A;  3AV8 A;  1QZE A;  3B0A A;  4JL9 A;  1D3Z A;  4KDI C;  2JRI B;  4DHZ B;  3MJ5 A;  2M56 B;  3HRD D;  3BIN A;  3Q3M C;  3DDC B;  4ZHO A;  2NBV B;  1IP9 A;  2IYD B;  4LNF A;  4IWP A;  3I9V 1;  4PS8 A;  1QIL A;  2ZW1 A;  3AEA B;  3M95 A;  4RGO S;  2DZI A;  2K8C A;  4FAD A;  2WXL A;  1DOY A;  3K9P B;  3I57 A;  3EFC A;  3ZJV A; 
#chains in the Genus database with same CATH homology
 4C4V B;  2MHJ A;  4C4V A;  2V9H A;  2QCZ A;  4BZA A;  3Q6B A;  4QAY A;  4K3B A;  4XGA B;  2X8X X;  3MC8 A;  4PK1 A;  3MC9 A;  2VH2 A;  2QDF A;  3OG5 A;  4C00 A;  4K3C A;  2VH1 A;  3NJT A;  3EFC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...