2V9HA

Solution structure of an escherichia coli yaet tandem potra domain
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
154
structure length
154
Chain Sequence
AEGFVVKDIHFEGLQRVAVGAALLSMPVRTGDTVNDEDISNTIRALFATGNFEDVRVLRDGDTLLVQVKERPTIASITFSGNKSVKDDMLKQNLEASGVRVGESLDRTTIADIEKGLEDFYYSVGKYSASVKAVVTPLPRNRVDLKLVFQEGVS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords OUTER MEMBRANE PROTEIN ASSEMBLY FACTOR YAET
publication title Fold and Function of Polypeptide Transport-Associated Domains Responsible for Delivering Unfolded Proteins to Membranes.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Protein binding
total genus 39
structure length 154
sequence length 154
ec nomenclature
pdb deposition date 2007-08-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07244 POTRA Surface antigen variable number repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.310 Alpha Beta Roll Ubiquitin-like (UB roll) membrane protein fhac 2v9hA02
3.10.20.310 Alpha Beta Roll Ubiquitin-like (UB roll) membrane protein fhac 2v9hA01
3Q6BA 2QCZA 3MC9A 3MC8A 4C4VA 4PK1A 2MHJA 2X8XX 2V9HA 2VH2A 2VH1A 3OG5A 3NJTA 4BZAA 4XGAB 4QAYA 3EFCA 4K3BA 4C00A 2QDFA 4C4VB 4K3CA
chains in the Genus database with same CATH superfamily
2OHFA 3AEGB 3HHMA 1T0YA 4MGYE 3AE7B 2O6VD 1P3QU 4GN1A 2NTTA 2GBMA 2KC1A 2NBUA 2K0PA 1YQ3B 3APDA 1MG4A 1IGDA 3O13A 3QC8B 1I4XA 4GDKA 2MBOA 3PO0A 1A5RA 5E6PA 4FULA 2JXTA 1HQRD 1D3ZA 2W3SA 1QLBB 2W9NA 4YWGG 1V1OA 3MHSD 2D3GA 3PRZA 2KN4A 1J7CA 1SB3C 4N59A 2Y5CA 3B1LX 1WR6E 3P4RB 2AL3A 4ANWA 1YIWA 1XCQL 3KW5B 2WXGA 1FXTB 4RF0A 2LUEA 1PQSA 1F77A 3KWLA 2WXLA 2J53A 2JXXA 4MJSB 1P98A 1SGHA 1UGJA 2Z8LA 2Z0DB 4GIVA 1L6UA 2Y3AA 2SEBD 1C9FA 1NI3A 3A4SC 4GLSC 4NAWB 3PGEA 2GBKA 2MX2A 5D3DA 3SD5A 3FILB 5E6OA 4FHKA 5IP4D 2LD9A 2N9PC 3H7PB 3MC9A 4EZJA 3MFGA 1ACCA 1ISNA 1KH0A 2PTLA 4WQOB 5LNK1 1JCKB 1V6EA 3TCAA 4B95A 2O6VA 1GB1A 2WDQB 2Z59B 1RRBA 2LFIA 1WRDB 2KACA 2KMAA 4RM9A 3VTWA 1E8ZA 3AE2B 2LZ6A 1WZ3A 2M56B 3C19A 2KK8A 1H8CA 1FD6A 1PYWD 4HPMB 1M4VA 1J0GA 2MJEA 1LXDA 4LK0M 3RNEC 1TS3A 2RD0A 1SJHD 4MJSA 4NJ6A 1AWDA 1LQBA 1DGJA 4OZCA 1ENFA 1QOBA 4PYUA 1UUPA 4DDID 3TUOA 2FIFA 5JXVA 4WAAA 1FRDA 3EGRA 3VHTC 2PMVA 3TJPA 2FCMA 1YQBA 3AEFB 4IM0A 2YEPF 1D6EC 4YXDB 3W1SA 5EE0A 1YJIA 1L0XB 3H7PA 1VZ7A 2KT7A 3VXWA 2WWZA 4KSKC 1C4CA 1R4NB 4HKQA 1RWSA 4MM3B 1WX7A 1OFFA 2N0SB 2NBVB 4EUTA 3ENEA 3PREA 2DZJA 3AV8A 4KIKB 2BWFA 3E9SA 3A33B 3VR9B 1TS2A 1QF6A 4OVVA 4OVUA 1X1MA 5G5HA 2FNJB 4G50A 3PLUA 2K22A 3N1YC 4REZA 1NENB 1EU3A 1C3TA 2JZ3B 4RMAA 2PPHA 2DBYA 1OQQA 1UBIA 4LTUA 2MHJA 2J52A 3QARA 4G3XB 3VFKA 2FCSA 2MBEA 4HDOA 2BS2B 2K1FA 2N1WA 5FR3A 3RULA 4L2YA 3VTUA 4IG7B 1KLGD 3W5UB 1N5XA 1KLUD 4ITKA 5I4DA 4ZRKA 2PIAA 2JYTA 1LO5D 1KFYB 4O1NA 3VTVA 2CS4A 2OOBB 4XYCA 4A9AA 4GOCA 2ACZB 3M3JA 2GBNA 3AE5B 3L13A 4HJGE 3LXFA 3GOEA 3V3XA 2WHIA 3ONSA 1QILA 2KZRA 2C7HA 2MW5A 3AEEB 2J0MA 4DK5A 4MDKE 1FM0D 3PZ7A 4YSYB 1LM8B 2C60A 4S0RA 1VCBA 2KC2A 3P1MA 1XT9B 2G4DB 2BS3B 2WU5B 2IPKD 2D3AA 4C4VB 4M0WB 2GLSA 2AQ1B 4ZRQA 5L83A 1UWMA 2M19A 2WXPA 1RFKA 5IN7A 4IW0A 2KJ6A 4HLEA 3SR6A 3AE1B 1FNWA 4BZAA 2KDFB 1WZ0A 2MRPA 4WWMA 4FLHA 2CJOA 3N32A 5J17A 4LNFA 1F52A 3JW0X 3EECA 3IBEA 3DCGA 2I1JA 3Q3JA 2UWQA 5TR5A 1Z2MA 2W54A 5IO9A 4A20A 3Q14C 3Q2AC 4WQMA 2LEKA 3RFZB 1KLVA 1F9JA 2L00B 1J8CA 1GC6A 4D2KA 3RNFC 3DHGC 3BVZA 1WGYA 4DXAB 3W2DA 1OEYA 2Y5PA 2CHZA 4KGTA 3ZDTA 2FCQA 4M0WA 2IYDB 2JYEA 4K7UA 2WX1A 3PZDA 2IZVB 2HJ8A 5CTRC 1B9RA 5D7GA 2PE9A 4EKUA 1PUTA 1L5PA 3AEDB 2WXMA 3Q8FA 2NPTB 2KOXA 1FPYA 4RM8A 5C23A 2VRRB 1TS4A 1GOZA 2Q5WD 5H8YE 4TSSA 2WDTB 2DX5B 1I4PA 2HD5B 5MPOA 4AWJA 3DWMA 3W9CB 1E6EB 4KZCA 4EEWA 2HE7A 5FK9C 1OTRB 3CWIA 3HK0A 2KTFA 3JSVB 2V4IB 1VZ8A 4N6EB 3R3MA 4BKSD 2K6DB 3VR8B 2AL6A 3Q8CA 3PV1A 2RMMA 1SJED 2KDIA 1JWAD 2RPVA 1WSPA 1GAQB 1V8CA 5AZGA 5DCNA 1K52A 2A5UA 1WJUA 1H4RA 4DXGA 4B0MA 3VUXA 2G1EA 1EM7A 1XO3A 2VH1A 1GJZA 3NVWA 3TEXA 3M95A 4US8A 1R4MB 2WNMA 3CIRB 4GB9A 4JIOU 1I4HA 4FBJB 4FADA 3IG3A 2MSED 3H1UA 3CF6E 1RLFA 1N60A 4TQ1A 1F2RI 2K39A 3QX1A 1WY8A 3DVNV 3TSSA 3N1ZC 1UGMA 4PS7A 4MSMB 1L2NA 4WJNA 4KX6B 4KVGB 3AM9A 3DBRB 5DPRA 1C4PA 3QJZA 1N6ZA 3AXCA 5L95C 1KTKA 3JSVA 3ZTDA 2KMMA 1OQYA 1AYFA 2RR9A 3BYTB 2YEPB 4GXBA 1RYJA 4FJYA 3T8MA 1WX9A 2L52A 3SDLC 3X0WA 3N3KB 4JE3B 1WRIA 3HIZA 1YNTE 3BYYB 4PT5A 4K3CA 2B3AA 2KJHB 5D6JB 2EMTA 4BKSA 4JWUC 3QHTA 2G9HD 3IFWB 2G3QB 3T3OA 3MC0B 1YMHE 1Q5WB 1JWMD 5HFYA 1FXAA 4LNNA 1A70A 3T3NA 3ZJUA 1QT9A 2LRUA 3RZFA 3PRMB 3LJ3A 2M17A 2D10A 3TL5A 2CU1A 3ZXVA 2C7MB 2QMTA 2IY0B 1LGRA 3AH7A 4CHKA 5IA7A 2MBBB 2N9KA 3AULA 4KKIA 4GDKB 2INPE 3FKYA 1D5MC 5EE1A 2WDVB 3HM3A 2EKIA 3VVWB 2KVZA 2JPHA 1JW9D 4HJKA 3VAWA 4B9KA 1MI0A 4LNIA 4L1BA 1FCCC 1IP9A 3U4EG 1SE4A 1Q1OA 2BQQA 2NR2A 4NQLB 1VDVA 4DQOC 3ZQ4A 3ZJVA 1K50A 1Y8RC 1TGZB 2CU3A 1WXSA 3WAPA 1KJTA 4OHJA 5HHDG 1TYGB 2IGGA 3RI7C 2GBJA 3B08A 4C56C 2BYTA 2LASA 3A1QA 4NAMA 4M8NA 5HKHA 2OEDA 1FNVA 4HROA 1QOFA 3V05A 3ZUNA 1HZ5A 2IBIB 2ONQA 4EZLA 1E5WA 1P7FA 4WWOA 4MH8A 4W9LA 1DOXA 3ZNGC 2Z0EB 5IAAC 3UGBB 4ZHPA 1TKYA 1JQ4A 1WFYA 1QZEA 2ZNVC 3DWGC 3R8BA 2PLPA 2DZIA 4KGSA 3CMMB 2DYMA 2DHZA 1KF6B 2KMCA 5G2NA 2JRHA 2NTSA 3DBLB 2V3SA 2O6VB 2QJLA 3MC8A 4EFOA 2B76B 1F0ZA 1FMAD 4W9GA 3APCA 3DHIC 3P63A 1XCTL 1E0ZA 2BBCA 4G0NB 3LB8C 3DPDA 3ZXRA 4P1CC 3N30A 1BXTA 3EHVA 2K25A 1G6JA 4BFRA 3CSFA 2QILA 4DXFA 2HJ1A 2DYBA 2LWPA 2DZMA 3AE3B 2KXJA 2LGYA 1TKEA 1YOVB 1JROA 1HTQA 2NVUI 2N9EB 4KZ0A 2SAKA 3KWVA 4S17A 2A4ZA 3DOWA 4MGIE 3ZRFA 2C9WB 2AYOB 4M00A 2C5LC 1T0RC 4HPLB 5C3JB 2ZPNA 3OWEB 4II3B 1YJJA 3BK1A 3N20C 2L1AA 3KYCD 1VR9A 1SIFA 2GRIA 4BOSC 2K8HA 2BKRB 3EUB2 4ACFA 4ICUA 2AQ2B 3M62B 3DBHI 1JRPA 2XEWA 2ON8A 1TT5B 3PS6A 2YVCA 2RDHA 3L4PA 2L0FA 4TMAB 2KDBA 2WXRA 2M8SA 3I63C 2BYVE 1I4RA 2J7QB 3Q3NC 1N61A 3N1XC 3P4QB 3S2AA 4W9IA 4JQWC 2LVQA 4K7WA 1GC7A 3AE4B 2LGXA 3HM6X 2XN9C 2L76A 3E56A 2W82A 1ZOYB 3RT3B 3NJTA 2GOWA 4A3PA 1C4AA 2ASQA 3B2FA 4GU2A 4OW0A 3O65B 4DDGD 5BYQA 5BMIA 2KTRA 1SE9A 4CO7A 4E71A 2X8XX 2GI9A 1I35A 1ZPSA 3B9JA 4FN2A 2MA9B 1K51A 1WJ4A 2JT4B 2MBQA 3GZNI 4NJCA 3Q3OC 2XNAC 2LI5A 3VH3B 2QEJC 5D94A 5E6JA 4E74A 4C7YA 2FIDA 3APFA 4HRSA 3R2TA 3ZIMA 3Q3FA 2PEAA 1T6BX 3R7RA 1P9DU 5JH5C 1SIJA 1U4AA 3NUHB 1PGAA 2LJIA 4MH0E 2K8CA 2D07B 2G4SA 2M4NA 4K81A 2PJHA 1IPGA 1EU4A 3LYYA 1UNSA 4OVZA 4WAFA 1WXVA 2L8JA 1XLPA 2PVGC 4GDLA 4P16A 3A9JA 4AP4C 1XLQA 2L83A 2LRWA 5J2RA 3ZW3A 1FNUA 1SEBD 4XDDA 1C77A 1UH6A 2K5PA 3TEZA 3RMKC 5JZEB 1WGRA 1JWBD 3WCQA 3OJ4B 4HK2A 2J0JA 4RF1A 3WANA 1ZGUB 2RPQA 4G11A 3AE9B 1I7HA 3KLSX 3BVGA 1UZXB 2IO1B 3RNGC 5FR6A 2WS3B 4M8MA 3SFDB 1GG3A 4GSWA 2E3TA 1WYGA 4I6NB 2K3UA 2BTEA 1EWCA 3P2BA 2GB1A 4L23A 2GBRA 1PFDA 1TBEA 3UQBA 1E7PB 4RGTA 2KWDA 4M02A 3U2SC 1WF9A 2ZW1A 3PHXB 5G5GA 3KQ4A 3B0AA 4AJWA 2L3ZA 1AARA 4DHZB 3AE6B 4JX1C 2D2QA 3EFUA 2LVOA 2H88B 1M94A 4LNKA 3P42A 1BUIC 4YSXB 3W1SC 4TKNA 4FJZA 2J0KA 1MFWA 2J4XA 1YJ1A 2FAZA 1QKZA 3RUIB 2QIEB 1L4ZB 3TEYA 2QCZA 4USAA 1ZKHA 3UIPB 2V3PA 4IWQA 2LMCA 3HVZA 3EC8A 3IAS1 3ZLZA 2LVPA 2L7RA 3QWZB 3PZ8A 1J19A 1V81A 4JLCA 1MG8A 3R66C 3A4RA 2D3CA 1K53A 3AEBB 3PT2B 4PK1A 2KQ7A 2ZZPB 2DWQA 3V60A 4H2AA 1V5TA 1VD2A 1ZUD2 3C8YA 1WYWB 4W9FA 3SFEB 2MJ3A 4DHZE 4F8CB 2QDFA 2R61A 4BBNF 4HWIB 1IBXB 3IVFA 3VH4B 3ZTCA 2K9XA 4J3OD 3U7DA 1UELA 4WJQA 2JRIB 3ECIA 2N7EA 3EA6A 2KWVB 2WX0A 5TSSA 2LGDA 3V6CB 3WALA 3PRPB 2WLBA 3NZUA 1FO4A 2AEHA 2KLGA 4WWPA 1ZXHA 2WXKA 4AQ7A 3VRBB 1SSNA 2FCNA 4ARIA 4RH6A 1Q0WB 3Q3MC 4ARCA 1E8XA 3VUYA 5BMHA 1ROEA 1HE8A 3WAOA 3DBSA 2JX5A 2ZVNA 3UQAA 1JALA 4WWNA 3W1YA 2LGIA 3ETRA 1FRRA 2V1YA 2AX5A 2BF8B 2O2VB 2M0XA 3NVZA 2K6QA 2N7JA 1SXTA 4WIPA 1BMLC 2JUOA 1ZE3D 1IBXA 2JY6A 2XK5A 5CHWA 1RAXA 2PW9A 1ET6A 4YTNB 1E10A 3CSTA 1XD3B 4C00A 1XLOA 4P1BC 1L7YA 1DYQA 4ANUA 2KO3A 2WP9B 4NZLB 4RGMA 4W9DA 2LHEA 4C7ZA 4IKGA 4URKA 4XDCA 2JU6X 4YL8A 5HG2A 1NVID 2DZKA 3KH0A 1GUAB 2RDBC 1T3QA 1VLBA 4FXCA 3I9V1 2LXAA 1JWSD 2CJNA 4Q2JA 3BVMA 1FCLA 1NEKB 3B2GA 4ZRIA 5C2TB 4IM3A 1TIFA 1UWXA 2WXQA 2DLBA 1YX6B 1WXMA 2O2VA 4TV3A 4FA6A 3A1QB 5BYSA 2ZCBA 4KGRA 2ZW0A 3NG0A 1ZW7A 1E90A 1D5ZC 2BB6A 2WDRB 2WU2B 3J9CA 1K8RB 1YN4A 5AEKB 2KLCA 2KFKA 4K7SA 3ZO5B 4ZHOA 3URYA 3PSEB 3H8HA 2BYFA 1HXYD 1WIAA 4HPPA 4MEMA 3FC4A 4LLGM 2BVCA 1DOIA 1WXAA 2ZCCA 1T0QC 2IO3B 1ZDVA 2KDEB 3NVVA 3BK2A 2G45B 2KN5A 2DENB 1WE7A 4BOZB 1NI2A 3KVFB 1EF5A 3RPFC 4XE0A 1JRUA 1UF0A 2KFJA 2W55A 1ZP0B 1R4NI 5DPTA 1IGCA 2IJ0A 2JSVX 3BIID 3MJWA 1WM2A 1WJ6A 4I6PA 3L54A 3RYTA 2IGHA 1KRHA 2WXJA 2WXFA 1GPXA 4IOIE 2DAFA 3V62A 3GB1A 1PDXA 1P0RA 2N1VA 3NOBA 2L32A 2MWSB 2L0TA 3KUZA 3L08A 4LJOB 5BYRA 1WH3A 4ZDVA 3A9KB 4W9EA 4EOYA 1GNUA 4DBGA 2KNBA 1L6VA 1LFDA 3ZKJC 2BPSA 4K1RB 1FFVA 2W3RA 4IM2A 4HEA1 1HZ6A 3ZNID 2H89B 2XBBC 1I4GA 3I57A 3HVDA 3DVGY 3PVLA 2ZPYA 4FHJA 2MP2A 1Z5SB 2VH2A 2D5GA 3OG5A 1TY2A 4F1SA 3WA0A 1OEYJ 2D11A 4QAYA 5JHAA 2BGFA 3NZSA 1B1ZA 5E6NA 2LHDA 3V6EB 5JHBA 2WYQA 4A55A 2K8BA 2BW2A 3K9PB 1JWUD 2KQ4X 4AOFA 2L05A 1DOYA 2QSDA 5DPWA 3M63B 2KAJA 3LDZE 3R7QA 4ZRPA 5LLIA 3TEWA 5T8IA 3RD2A 3TMPB 3BY4B 3PLVA 1S1QB 3UIOB 5IOIA 2WXHA 2FBWB 1MHHE 4IWPA 4F7ZA 1HTOA 1WI0A 2YLMA 3A9KA 5LXHA 4MGKE 2INCC 3R2IA 4P7IA 1TKGA 1PGXA 2BKFA 3UF8A 5EE9A 3L17A 4HXDA 1STEA 2V9HA 3Q8BA 3NVYA 4BKTA 4OZAA 1E8YA 2KTRB 2UYZB 4EE2A 1TS5A 4XX5A 3ZJTA 4JGHB 4IUMB 1NBFC 4EZKA 4CYEA 2MLBA 1WX8A 3IAM1 2FUHB 2KD0A 4HDQA 1YN3A 4KSLC 1EF1A 4DWFA 2HDEA 5GMVA 3UINB 3QK0A 4ZYSA 1C79A 3JYUA 2RGFA 1CJEA 4DHJD 1TZ1A 1WWTA 3DVNU 2LJ5A 4AJYB 1D4BA 3DHHC 2KWCA 2JWUA 4IC7B 2ZEQA 4NQKE 4CQNA 2REXA 1FEHA 4GGQA 3Q8EA 4XGAB 4DHJB 1V80A 5KHQA 2VZKD 4HVBA 3BWUD 2RDGA 2PE6B 4NAWA 2N9XA 3I5JC 1CQVA 3ZVVA 1FXIA 4GDLB 3A9JB 2ZJDA 3FILA 1YQ4B 1N62A 1WJNA 2JF5A 4LDTD 4YSZB 1UBQA 4A8XC 3I3TB 2VZKB 3VRAB 1J7AA 2KKCA 5AUKA 1YX5B 5AUIA 2N9LA 4ZYNA 3D32A 1QOAA 3X23A 2LGSA 3PPAA 1JMLA 3ML8A 2UU7A 5D2MB 4LDTB 3NHEB 3SHQA 3OAWA 3U52E 2BYEA 3VUWA 3IT6B 1OGWA 2INDC 2LUMA 2QC8A 3KUCB 4ZRJA 3QA8A 2KWUB 3AU4A 1WGDA 1V97A 3ALBA 3AI5A 1MPEA 1N5WA 4OZBA 3ZGZA 4W9HA 3AE8B 3WAMA 3MJ5A 4P6VF 2MEKA 5FKAC 1SE3A 2V4LA 1MJDA 2TSSA 3NS8A 1TZOA 2OJWA 3VQIA 3KYDD 2LXCA 3P4PB 2OJRA 4KDLB 1ESFA 1CK1A 2AQ3B 3P4SB 2FE8A 3QIJA 1NYRA 1V9JA 3AECB 4W9CA 1KM7A 4LCDE 3TBLD 4J6IA 1R4MI 1ZXIA 4MM3A 1GB4A 1T0SC 2DAJA 2HTME 4B0EA 1V86A 4GMVA 4PS8A 1AW7A 4KIKA 3ABVB 4XWWA 4ANXA 3RNAC 3DBRI 2NS5A 3NRZA 4B6WA 1V1PB 4UDUC 4M01A 2R2QA 4XZ4A 4RCOA 1T5XD 3C0RB 4YT0B 3GE8C 1NYQA 2WGSA 2JQRB 2R2OA 1RM6C 4NNJB 5AZFA 3VDZA 1HA5A 2Y5BB 3H9DA 3QQ8B 2INNE 4LNOA 1F2RC 2KYWA 3MP9A 4XWTA 4MT5A 3ZDMC 1WXQA 4NY0A 3DBHB 4RGNA 5H92C 1N63A 3JVZX 2NCNA 3NY5A 4YTMB 2MJDA 2MQJA 3K9OB 1AN8A 5CHFA 2JZPA 3SEBA 4FJVB 4JPSA 2MBHA 1ZDXA 3AN1A 2I1KA 1MVKA 2HTHA 1I42A 4AUQC 2IDYA 5AZHA 3MTNB 3ZNZB 2GMIC 1IUEA 4A3OA 1V1PA 1WM3A 2CHXA 2DYOA 1C78A 3IT4B 4ASWC 3Q69A 1Q10A 3DVGX 4E3CA 2ICIA 1WE6A 3RZWC 4C4VA 4LJPB 2NMQA 5C1ZA 3L16A 3RCZA 4BBNC 4N9F4 4WH4A 1J7BA 4PS3A 3GE3C 5G55A 2ZNVB 2KQSA 1F1HA 3QCAA 4US9A 2XK5B 1S3SG 4HCNB 1P1AA 3GZNB 2V3NA 4X57B 1MHXA 3H6NA 5IKCM 2X38A 2BB5A 2FUG1 3AB5A 4MSQB 1E9MA 4ICVA 3ZNHB 3SU8X 1QQRA 4PYZA 3U7ZA 3HRDD 4MACA 2KVRA 1XXGA 2BS4B 2JZZA 2ZVOA 4NPNA 3ZRCA 2I2YA 4YTPB 3AMZA 2RSUA 3H7SA 4I6LB 4TQ0A 4JL9A 4KKJA 3U8ZA 1WGHA 4XC2A 3DQVA 5CHVC 2KX0A 5KHOA 1XF5L 2E6XA 3AEAB 3DBLI 3TIXA 4A6QA 4A90A 4C80A 3N9YC 2BT6A 2CHWA 1XLNA 1D5XC 3Q8AA 2NPTA 1SF0A 5BMGA 3T9LA 3L0WB 1FFUA 2JVCA 4K3BA 4TUUA 5HI1A 2EKEC 2MH7A 4JWSC 2KFKB 2IY1B 2CR5A 4WURA 4WJOA 5DPSA 3IXSA 3NS1A 1BT0A 5EE3A 1E8WA 1L0YB 4BKGA 4KV2A 1TY0A 1V2YA 4N58A 3RNCC 2JWZA 2KANA 4WJPA 2KJRA 3MHZA 2PKOA 1IYFA 4NJ7A 5LXIB 4W9KA 1YD8U 1V49A 3KUDB 1WR1A 2WXNA 2CKHB 3NZ3A 4RNAA 1Y56A 1EUVB 4AS1A 4BVUC 5EDSA 3FAHA 1P7EA 3BINA 1QOGA 3BZDB 4ANVA 2EMSA 3GS2A 1E7UA 3OJ3A 1I4QA 2KHWB 1C76A 3EFCA 1WGGA 4IDIA 3ZYYX 1XEEA 5J18A 1HEZE 1WMHB 2J42A 1L0VB 3GP7A 3ML9A 3PHWB 4BAXA 2M0AA 5CX3A 1L4DB 3RNBC 4IWOA 3PTFC 1VRAB 3OLMD 1TTNA 4MELA 1CZPA 3UI3A 5GXGB 1E7VA 3L10B 1SE2A 1R7SA 4II2B 1KOTA 1TJEA 2AWTA 2NBWB 2D3BA 2M1MA 4RFBA 1ET9A 2PVOD 3RN9C 1FIQA 3IHPC 2I38A 4KDIC 2MP2B 3Q6BA 1YN5A 1XQQA 3AU5A 2C7NB 2MCNB 2IGDA 2WXIA 1NDDA 4R3DA 1UD7A 3U30A 3HUIA 4HCPB 3QAQA 3V61A 1OQRA 1PGBA 3W5VB 2WXOA 2QHOA 1VZ6A 1V5OA 1SBBB 2KX3A 1VJKA 1C1YB 5D3IB 1EO6A 2KDMA 2IO2B 1WGKA 1RFAA 2WQYB 4HKZE 5BO4B 2IO0B 2V0GA 1CMXB 1WMHA 4RGOS 3WIMA 2DNFA 1EWYC 2EELA 2BWES 2N7DA 4MGZE 4ZOHC 3DDCB 2N4FA 4W9JA
chains in the Genus database with same CATH topology
3Q6BA 2QCZA 3MC9A 3MC8A 4C4VA 4PK1A 2MHJA 2X8XX 2V9HA 2VH2A 2VH1A 3OG5A 3NJTA 4BZAA 4XGAB 4QAYA 3EFCA 4K3BA 4C00A 2QDFA 4C4VB 4K3CA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3Q6B A;  2QCZ A;  3MC9 A;  3MC8 A;  4C4V A;  4PK1 A;  2MHJ A;  2X8X X;  2V9H A;  2VH2 A;  2VH1 A;  3OG5 A;  3NJT A;  4BZA A;  4XGA B;  4QAY A;  3EFC A;  4K3B A;  4C00 A;  2QDF A;  4C4V B;  4K3C A; 
#chains in the Genus database with same CATH topology
 2OHF A;  3AEG B;  3HHM A;  1T0Y A;  4MGY E;  3AE7 B;  2O6V D;  1P3Q U;  4GN1 A;  2NTT A;  2GBM A;  2KC1 A;  2NBU A;  2K0P A;  1YQ3 B;  3APD A;  1MG4 A;  1IGD A;  3O13 A;  3QC8 B;  1I4X A;  4GDK A;  2MBO A;  3PO0 A;  1A5R A;  5E6P A;  4FUL A;  2JXT A;  1HQR D;  1D3Z A;  2W3S A;  1QLB B;  2W9N A;  4YWG G;  1V1O A;  3MHS D;  2D3G A;  3PRZ A;  2KN4 A;  1J7C A;  1SB3 C;  4N59 A;  2Y5C A;  3B1L X;  1WR6 E;  3P4R B;  2AL3 A;  4ANW A;  1YIW A;  1XCQ L;  3KW5 B;  2WXG A;  1FXT B;  4RF0 A;  2LUE A;  1PQS A;  1F77 A;  3KWL A;  2WXL A;  2J53 A;  2JXX A;  4MJS B;  1P98 A;  1SGH A;  1UGJ A;  2Z8L A;  2Z0D B;  4GIV A;  1L6U A;  2Y3A A;  2SEB D;  1C9F A;  1NI3 A;  3A4S C;  4GLS C;  4NAW B;  3PGE A;  2GBK A;  2MX2 A;  5D3D A;  3SD5 A;  3FIL B;  5E6O A;  4FHK A;  5IP4 D;  2LD9 A;  2N9P C;  3H7P B;  3MC9 A;  4EZJ A;  3MFG A;  1ACC A;  1ISN A;  1KH0 A;  2PTL A;  4WQO B;  5LNK 1;  1JCK B;  1V6E A;  3TCA A;  4B95 A;  2O6V A;  1GB1 A;  2WDQ B;  2Z59 B;  1RRB A;  2LFI A;  1WRD B;  2KAC A;  2KMA A;  4RM9 A;  3VTW A;  1E8Z A;  3AE2 B;  2LZ6 A;  1WZ3 A;  2M56 B;  3C19 A;  2KK8 A;  1H8C A;  1FD6 A;  1PYW D;  4HPM B;  1M4V A;  1J0G A;  2MJE A;  1LXD A;  4LK0 M;  3RNE C;  1TS3 A;  2RD0 A;  1SJH D;  4MJS A;  4NJ6 A;  1AWD A;  1LQB A;  1DGJ A;  4OZC A;  1ENF A;  1QOB A;  4PYU A;  1UUP A;  4DDI D;  3TUO A;  2FIF A;  5JXV A;  4WAA A;  1FRD A;  3EGR A;  3VHT C;  2PMV A;  3TJP A;  2FCM A;  1YQB A;  3AEF B;  4IM0 A;  2YEP F;  1D6E C;  4YXD B;  3W1S A;  5EE0 A;  1YJI A;  1L0X B;  3H7P A;  1VZ7 A;  2KT7 A;  3VXW A;  2WWZ A;  4KSK C;  1C4C A;  1R4N B;  4HKQ A;  1RWS A;  4MM3 B;  1WX7 A;  1OFF A;  2N0S B;  2NBV B;  4EUT A;  3ENE A;  3PRE A;  2DZJ A;  3AV8 A;  4KIK B;  2BWF A;  3E9S A;  3A33 B;  3VR9 B;  1TS2 A;  1QF6 A;  4OVV A;  4OVU A;  1X1M A;  5G5H A;  2FNJ B;  4G50 A;  3PLU A;  2K22 A;  3N1Y C;  4REZ A;  1NEN B;  1EU3 A;  1C3T A;  2JZ3 B;  4RMA A;  2PPH A;  2DBY A;  1OQQ A;  1UBI A;  4LTU A;  2MHJ A;  2J52 A;  3QAR A;  4G3X B;  3VFK A;  2FCS A;  2MBE A;  4HDO A;  2BS2 B;  2K1F A;  2N1W A;  5FR3 A;  3RUL A;  4L2Y A;  3VTU A;  4IG7 B;  1KLG D;  3W5U B;  1N5X A;  1KLU D;  4ITK A;  5I4D A;  4ZRK A;  2PIA A;  2JYT A;  1LO5 D;  1KFY B;  4O1N A;  3VTV A;  2CS4 A;  2OOB B;  4XYC A;  4A9A A;  4GOC A;  2ACZ B;  3M3J A;  2GBN A;  3AE5 B;  3L13 A;  4HJG E;  3LXF A;  3GOE A;  3V3X A;  2WHI A;  3ONS A;  1QIL A;  2KZR A;  2C7H A;  2MW5 A;  3AEE B;  2J0M A;  4DK5 A;  4MDK E;  1FM0 D;  3PZ7 A;  4YSY B;  1LM8 B;  2C60 A;  4S0R A;  1VCB A;  2KC2 A;  3P1M A;  1XT9 B;  2G4D B;  2BS3 B;  2WU5 B;  2IPK D;  2D3A A;  4C4V B;  4M0W B;  2GLS A;  2AQ1 B;  4ZRQ A;  5L83 A;  1UWM A;  2M19 A;  2WXP A;  1RFK A;  5IN7 A;  4IW0 A;  2KJ6 A;  4HLE A;  3SR6 A;  3AE1 B;  1FNW A;  4BZA A;  2KDF B;  1WZ0 A;  2MRP A;  4WWM A;  4FLH A;  2CJO A;  3N32 A;  5J17 A;  4LNF A;  1F52 A;  3JW0 X;  3EEC A;  3IBE A;  3DCG A;  2I1J A;  3Q3J A;  2UWQ A;  5TR5 A;  1Z2M A;  2W54 A;  5IO9 A;  4A20 A;  3Q14 C;  3Q2A C;  4WQM A;  2LEK A;  3RFZ B;  1KLV A;  1F9J A;  2L00 B;  1J8C A;  1GC6 A;  4D2K A;  3RNF C;  3DHG C;  3BVZ A;  1WGY A;  4DXA B;  3W2D A;  1OEY A;  2Y5P A;  2CHZ A;  4KGT A;  3ZDT A;  2FCQ A;  4M0W A;  2IYD B;  2JYE A;  4K7U A;  2WX1 A;  3PZD A;  2IZV B;  2HJ8 A;  5CTR C;  1B9R A;  5D7G A;  2PE9 A;  4EKU A;  1PUT A;  1L5P A;  3AED B;  2WXM A;  3Q8F A;  2NPT B;  2KOX A;  1FPY A;  4RM8 A;  5C23 A;  2VRR B;  1TS4 A;  1GOZ A;  2Q5W D;  5H8Y E;  4TSS A;  2WDT B;  2DX5 B;  1I4P A;  2HD5 B;  5MPO A;  4AWJ A;  3DWM A;  3W9C B;  1E6E B;  4KZC A;  4EEW A;  2HE7 A;  5FK9 C;  1OTR B;  3CWI A;  3HK0 A;  2KTF A;  3JSV B;  2V4I B;  1VZ8 A;  4N6E B;  3R3M A;  4BKS D;  2K6D B;  3VR8 B;  2AL6 A;  3Q8C A;  3PV1 A;  2RMM A;  1SJE D;  2KDI A;  1JWA D;  2RPV A;  1WSP A;  1GAQ B;  1V8C A;  5AZG A;  5DCN A;  1K52 A;  2A5U A;  1WJU A;  1H4R A;  4DXG A;  4B0M A;  3VUX A;  2G1E A;  1EM7 A;  1XO3 A;  2VH1 A;  1GJZ A;  3NVW A;  3TEX A;  3M95 A;  4US8 A;  1R4M B;  2WNM A;  3CIR B;  4GB9 A;  4JIO U;  1I4H A;  4FBJ B;  4FAD A;  3IG3 A;  2MSE D;  3H1U A;  3CF6 E;  1RLF A;  1N60 A;  4TQ1 A;  1F2R I;  2K39 A;  3QX1 A;  1WY8 A;  3DVN V;  3TSS A;  3N1Z C;  1UGM A;  4PS7 A;  4MSM B;  1L2N A;  4WJN A;  4KX6 B;  4KVG B;  3AM9 A;  3DBR B;  5DPR A;  1C4P A;  3QJZ A;  1N6Z A;  3AXC A;  5L95 C;  1KTK A;  3JSV A;  3ZTD A;  2KMM A;  1OQY A;  1AYF A;  2RR9 A;  3BYT B;  2YEP B;  4GXB A;  1RYJ A;  4FJY A;  3T8M A;  1WX9 A;  2L52 A;  3SDL C;  3X0W A;  3N3K B;  4JE3 B;  1WRI A;  3HIZ A;  1YNT E;  3BYY B;  4PT5 A;  4K3C A;  2B3A A;  2KJH B;  5D6J B;  2EMT A;  4BKS A;  4JWU C;  3QHT A;  2G9H D;  3IFW B;  2G3Q B;  3T3O A;  3MC0 B;  1YMH E;  1Q5W B;  1JWM D;  5HFY A;  1FXA A;  4LNN A;  1A70 A;  3T3N A;  3ZJU A;  1QT9 A;  2LRU A;  3RZF A;  3PRM B;  3LJ3 A;  2M17 A;  2D10 A;  3TL5 A;  2CU1 A;  3ZXV A;  2C7M B;  2QMT A;  2IY0 B;  1LGR A;  3AH7 A;  4CHK A;  5IA7 A;  2MBB B;  2N9K A;  3AUL A;  4KKI A;  4GDK B;  2INP E;  3FKY A;  1D5M C;  5EE1 A;  2WDV B;  3HM3 A;  2EKI A;  3VVW B;  2KVZ A;  2JPH A;  1JW9 D;  4HJK A;  3VAW A;  4B9K A;  1MI0 A;  4LNI A;  4L1B A;  1FCC C;  1IP9 A;  3U4E G;  1SE4 A;  1Q1O A;  2BQQ A;  2NR2 A;  4NQL B;  1VDV A;  4DQO C;  3ZQ4 A;  3ZJV A;  1K50 A;  1Y8R C;  1TGZ B;  2CU3 A;  1WXS A;  3WAP A;  1KJT A;  4OHJ A;  5HHD G;  1TYG B;  2IGG A;  3RI7 C;  2GBJ A;  3B08 A;  4C56 C;  2BYT A;  2LAS A;  3A1Q A;  4NAM A;  4M8N A;  5HKH A;  2OED A;  1FNV A;  4HRO A;  1QOF A;  3V05 A;  3ZUN A;  1HZ5 A;  2IBI B;  2ONQ A;  4EZL A;  1E5W A;  1P7F A;  4WWO A;  4MH8 A;  4W9L A;  1DOX A;  3ZNG C;  2Z0E B;  5IAA C;  3UGB B;  4ZHP A;  1TKY A;  1JQ4 A;  1WFY A;  1QZE A;  2ZNV C;  3DWG C;  3R8B A;  2PLP A;  2DZI A;  4KGS A;  3CMM B;  2DYM A;  2DHZ A;  1KF6 B;  2KMC A;  5G2N A;  2JRH A;  2NTS A;  3DBL B;  2V3S A;  2O6V B;  2QJL A;  3MC8 A;  4EFO A;  2B76 B;  1F0Z A;  1FMA D;  4W9G A;  3APC A;  3DHI C;  3P63 A;  1XCT L;  1E0Z A;  2BBC A;  4G0N B;  3LB8 C;  3DPD A;  3ZXR A;  4P1C C;  3N30 A;  1BXT A;  3EHV A;  2K25 A;  1G6J A;  4BFR A;  3CSF A;  2QIL A;  4DXF A;  2HJ1 A;  2DYB A;  2LWP A;  2DZM A;  3AE3 B;  2KXJ A;  2LGY A;  1TKE A;  1YOV B;  1JRO A;  1HTQ A;  2NVU I;  2N9E B;  4KZ0 A;  2SAK A;  3KWV A;  4S17 A;  2A4Z A;  3DOW A;  4MGI E;  3ZRF A;  2C9W B;  2AYO B;  4M00 A;  2C5L C;  1T0R C;  4HPL B;  5C3J B;  2ZPN A;  3OWE B;  4II3 B;  1YJJ A;  3BK1 A;  3N20 C;  2L1A A;  3KYC D;  1VR9 A;  1SIF A;  2GRI A;  4BOS C;  2K8H A;  2BKR B;  3EUB 2;  4ACF A;  4ICU A;  2AQ2 B;  3M62 B;  3DBH I;  1JRP A;  2XEW A;  2ON8 A;  1TT5 B;  3PS6 A;  2YVC A;  2RDH A;  3L4P A;  2L0F A;  4TMA B;  2KDB A;  2WXR A;  2M8S A;  3I63 C;  2BYV E;  1I4R A;  2J7Q B;  3Q3N C;  1N61 A;  3N1X C;  3P4Q B;  3S2A A;  4W9I A;  4JQW C;  2LVQ A;  4K7W A;  1GC7 A;  3AE4 B;  2LGX A;  3HM6 X;  2XN9 C;  2L76 A;  3E56 A;  2W82 A;  1ZOY B;  3RT3 B;  3NJT A;  2GOW A;  4A3P A;  1C4A A;  2ASQ A;  3B2F A;  4GU2 A;  4OW0 A;  3O65 B;  4DDG D;  5BYQ A;  5BMI A;  2KTR A;  1SE9 A;  4CO7 A;  4E71 A;  2X8X X;  2GI9 A;  1I35 A;  1ZPS A;  3B9J A;  4FN2 A;  2MA9 B;  1K51 A;  1WJ4 A;  2JT4 B;  2MBQ A;  3GZN I;  4NJC A;  3Q3O C;  2XNA C;  2LI5 A;  3VH3 B;  2QEJ C;  5D94 A;  5E6J A;  4E74 A;  4C7Y A;  2FID A;  3APF A;  4HRS A;  3R2T A;  3ZIM A;  3Q3F A;  2PEA A;  1T6B X;  3R7R A;  1P9D U;  5JH5 C;  1SIJ A;  1U4A A;  3NUH B;  1PGA A;  2LJI A;  4MH0 E;  2K8C A;  2D07 B;  2G4S A;  2M4N A;  4K81 A;  2PJH A;  1IPG A;  1EU4 A;  3LYY A;  1UNS A;  4OVZ A;  4WAF A;  1WXV A;  2L8J A;  1XLP A;  2PVG C;  4GDL A;  4P16 A;  3A9J A;  4AP4 C;  1XLQ A;  2L83 A;  2LRW A;  5J2R A;  3ZW3 A;  1FNU A;  1SEB D;  4XDD A;  1C77 A;  1UH6 A;  2K5P A;  3TEZ A;  3RMK C;  5JZE B;  1WGR A;  1JWB D;  3WCQ A;  3OJ4 B;  4HK2 A;  2J0J A;  4RF1 A;  3WAN A;  1ZGU B;  2RPQ A;  4G11 A;  3AE9 B;  1I7H A;  3KLS X;  3BVG A;  1UZX B;  2IO1 B;  3RNG C;  5FR6 A;  2WS3 B;  4M8M A;  3SFD B;  1GG3 A;  4GSW A;  2E3T A;  1WYG A;  4I6N B;  2K3U A;  2BTE A;  1EWC A;  3P2B A;  2GB1 A;  4L23 A;  2GBR A;  1PFD A;  1TBE A;  3UQB A;  1E7P B;  4RGT A;  2KWD A;  4M02 A;  3U2S C;  1WF9 A;  2ZW1 A;  3PHX B;  5G5G A;  3KQ4 A;  3B0A A;  4AJW A;  2L3Z A;  1AAR A;  4DHZ B;  3AE6 B;  4JX1 C;  2D2Q A;  3EFU A;  2LVO A;  2H88 B;  1M94 A;  4LNK A;  3P42 A;  1BUI C;  4YSX B;  3W1S C;  4TKN A;  4FJZ A;  2J0K A;  1MFW A;  2J4X A;  1YJ1 A;  2FAZ A;  1QKZ A;  3RUI B;  2QIE B;  1L4Z B;  3TEY A;  2QCZ A;  4USA A;  1ZKH A;  3UIP B;  2V3P A;  4IWQ A;  2LMC A;  3HVZ A;  3EC8 A;  3IAS 1;  3ZLZ A;  2LVP A;  2L7R A;  3QWZ B;  3PZ8 A;  1J19 A;  1V81 A;  4JLC A;  1MG8 A;  3R66 C;  3A4R A;  2D3C A;  1K53 A;  3AEB B;  3PT2 B;  4PK1 A;  2KQ7 A;  2ZZP B;  2DWQ A;  3V60 A;  4H2A A;  1V5T A;  1VD2 A;  1ZUD 2;  3C8Y A;  1WYW B;  4W9F A;  3SFE B;  2MJ3 A;  4DHZ E;  4F8C B;  2QDF A;  2R61 A;  4BBN F;  4HWI B;  1IBX B;  3IVF A;  3VH4 B;  3ZTC A;  2K9X A;  4J3O D;  3U7D A;  1UEL A;  4WJQ A;  2JRI B;  3ECI A;  2N7E A;  3EA6 A;  2KWV B;  2WX0 A;  5TSS A;  2LGD A;  3V6C B;  3WAL A;  3PRP B;  2WLB A;  3NZU A;  1FO4 A;  2AEH A;  2KLG A;  4WWP A;  1ZXH A;  2WXK A;  4AQ7 A;  3VRB B;  1SSN A;  2FCN A;  4ARI A;  4RH6 A;  1Q0W B;  3Q3M C;  4ARC A;  1E8X A;  3VUY A;  5BMH A;  1ROE A;  1HE8 A;  3WAO A;  3DBS A;  2JX5 A;  2ZVN A;  3UQA A;  1JAL A;  4WWN A;  3W1Y A;  2LGI A;  3ETR A;  1FRR A;  2V1Y A;  2AX5 A;  2BF8 B;  2O2V B;  2M0X A;  3NVZ A;  2K6Q A;  2N7J A;  1SXT A;  4WIP A;  1BML C;  2JUO A;  1ZE3 D;  1IBX A;  2JY6 A;  2XK5 A;  5CHW A;  1RAX A;  2PW9 A;  1ET6 A;  4YTN B;  1E10 A;  3CST A;  1XD3 B;  4C00 A;  1XLO A;  4P1B C;  1L7Y A;  1DYQ A;  4ANU A;  2KO3 A;  2WP9 B;  4NZL B;  4RGM A;  4W9D A;  2LHE A;  4C7Z A;  4IKG A;  4URK A;  4XDC A;  2JU6 X;  4YL8 A;  5HG2 A;  1NVI D;  2DZK A;  3KH0 A;  1GUA B;  2RDB C;  1T3Q A;  1VLB A;  4FXC A;  3I9V 1;  2LXA A;  1JWS D;  2CJN A;  4Q2J A;  3BVM A;  1FCL A;  1NEK B;  3B2G A;  4ZRI A;  5C2T B;  4IM3 A;  1TIF A;  1UWX A;  2WXQ A;  2DLB A;  1YX6 B;  1WXM A;  2O2V A;  4TV3 A;  4FA6 A;  3A1Q B;  5BYS A;  2ZCB A;  4KGR A;  2ZW0 A;  3NG0 A;  1ZW7 A;  1E90 A;  1D5Z C;  2BB6 A;  2WDR B;  2WU2 B;  3J9C A;  1K8R B;  1YN4 A;  5AEK B;  2KLC A;  2KFK A;  4K7S A;  3ZO5 B;  4ZHO A;  3URY A;  3PSE B;  3H8H A;  2BYF A;  1HXY D;  1WIA A;  4HPP A;  4MEM A;  3FC4 A;  4LLG M;  2BVC A;  1DOI A;  1WXA A;  2ZCC A;  1T0Q C;  2IO3 B;  1ZDV A;  2KDE B;  3NVV A;  3BK2 A;  2G45 B;  2KN5 A;  2DEN B;  1WE7 A;  4BOZ B;  1NI2 A;  3KVF B;  1EF5 A;  3RPF C;  4XE0 A;  1JRU A;  1UF0 A;  2KFJ A;  2W55 A;  1ZP0 B;  1R4N I;  5DPT A;  1IGC A;  2IJ0 A;  2JSV X;  3BII D;  3MJW A;  1WM2 A;  1WJ6 A;  4I6P A;  3L54 A;  3RYT A;  2IGH A;  1KRH A;  2WXJ A;  2WXF A;  1GPX A;  4IOI E;  2DAF A;  3V62 A;  3GB1 A;  1PDX A;  1P0R A;  2N1V A;  3NOB A;  2L32 A;  2MWS B;  2L0T A;  3KUZ A;  3L08 A;  4LJO B;  5BYR A;  1WH3 A;  4ZDV A;  3A9K B;  4W9E A;  4EOY A;  1GNU A;  4DBG A;  2KNB A;  1L6V A;  1LFD A;  3ZKJ C;  2BPS A;  4K1R B;  1FFV A;  2W3R A;  4IM2 A;  4HEA 1;  1HZ6 A;  3ZNI D;  2H89 B;  2XBB C;  1I4G A;  3I57 A;  3HVD A;  3DVG Y;  3PVL A;  2ZPY A;  4FHJ A;  2MP2 A;  1Z5S B;  2VH2 A;  2D5G A;  3OG5 A;  1TY2 A;  4F1S A;  3WA0 A;  1OEY J;  2D11 A;  4QAY A;  5JHA A;  2BGF A;  3NZS A;  1B1Z A;  5E6N A;  2LHD A;  3V6E B;  5JHB A;  2WYQ A;  4A55 A;  2K8B A;  2BW2 A;  3K9P B;  1JWU D;  2KQ4 X;  4AOF A;  2L05 A;  1DOY A;  2QSD A;  5DPW A;  3M63 B;  2KAJ A;  3LDZ E;  3R7Q A;  4ZRP A;  5LLI A;  3TEW A;  5T8I A;  3RD2 A;  3TMP B;  3BY4 B;  3PLV A;  1S1Q B;  3UIO B;  5IOI A;  2WXH A;  2FBW B;  1MHH E;  4IWP A;  4F7Z A;  1HTO A;  1WI0 A;  2YLM A;  3A9K A;  5LXH A;  4MGK E;  2INC C;  3R2I A;  4P7I A;  1TKG A;  1PGX A;  2BKF A;  3UF8 A;  5EE9 A;  3L17 A;  4HXD A;  1STE A;  2V9H A;  3Q8B A;  3NVY A;  4BKT A;  4OZA A;  1E8Y A;  2KTR B;  2UYZ B;  4EE2 A;  1TS5 A;  4XX5 A;  3ZJT A;  4JGH B;  4IUM B;  1NBF C;  4EZK A;  4CYE A;  2MLB A;  1WX8 A;  3IAM 1;  2FUH B;  2KD0 A;  4HDQ A;  1YN3 A;  4KSL C;  1EF1 A;  4DWF A;  2HDE A;  5GMV A;  3UIN B;  3QK0 A;  4ZYS A;  1C79 A;  3JYU A;  2RGF A;  1CJE A;  4DHJ D;  1TZ1 A;  1WWT A;  3DVN U;  2LJ5 A;  4AJY B;  1D4B A;  3DHH C;  2KWC A;  2JWU A;  4IC7 B;  2ZEQ A;  4NQK E;  4CQN A;  2REX A;  1FEH A;  4GGQ A;  3Q8E A;  4XGA B;  4DHJ B;  1V80 A;  5KHQ A;  2VZK D;  4HVB A;  3BWU D;  2RDG A;  2PE6 B;  4NAW A;  2N9X A;  3I5J C;  1CQV A;  3ZVV A;  1FXI A;  4GDL B;  3A9J B;  2ZJD A;  3FIL A;  1YQ4 B;  1N62 A;  1WJN A;  2JF5 A;  4LDT D;  4YSZ B;  1UBQ A;  4A8X C;  3I3T B;  2VZK B;  3VRA B;  1J7A A;  2KKC A;  5AUK A;  1YX5 B;  5AUI A;  2N9L A;  4ZYN A;  3D32 A;  1QOA A;  3X23 A;  2LGS A;  3PPA A;  1JML A;  3ML8 A;  2UU7 A;  5D2M B;  4LDT B;  3NHE B;  3SHQ A;  3OAW A;  3U52 E;  2BYE A;  3VUW A;  3IT6 B;  1OGW A;  2IND C;  2LUM A;  2QC8 A;  3KUC B;  4ZRJ A;  3QA8 A;  2KWU B;  3AU4 A;  1WGD A;  1V97 A;  3ALB A;  3AI5 A;  1MPE A;  1N5W A;  4OZB A;  3ZGZ A;  4W9H A;  3AE8 B;  3WAM A;  3MJ5 A;  4P6V F;  2MEK A;  5FKA C;  1SE3 A;  2V4L A;  1MJD A;  2TSS A;  3NS8 A;  1TZO A;  2OJW A;  3VQI A;  3KYD D;  2LXC A;  3P4P B;  2OJR A;  4KDL B;  1ESF A;  1CK1 A;  2AQ3 B;  3P4S B;  2FE8 A;  3QIJ A;  1NYR A;  1V9J A;  3AEC B;  4W9C A;  1KM7 A;  4LCD E;  3TBL D;  4J6I A;  1R4M I;  1ZXI A;  4MM3 A;  1GB4 A;  1T0S C;  2DAJ A;  2HTM E;  4B0E A;  1V86 A;  4GMV A;  4PS8 A;  1AW7 A;  4KIK A;  3ABV B;  4XWW A;  4ANX A;  3RNA C;  3DBR I;  2NS5 A;  3NRZ A;  4B6W A;  1V1P B;  4UDU C;  4M01 A;  2R2Q A;  4XZ4 A;  4RCO A;  1T5X D;  3C0R B;  4YT0 B;  3GE8 C;  1NYQ A;  2WGS A;  2JQR B;  2R2O A;  1RM6 C;  4NNJ B;  5AZF A;  3VDZ A;  1HA5 A;  2Y5B B;  3H9D A;  3QQ8 B;  2INN E;  4LNO A;  1F2R C;  2KYW A;  3MP9 A;  4XWT A;  4MT5 A;  3ZDM C;  1WXQ A;  4NY0 A;  3DBH B;  4RGN A;  5H92 C;  1N63 A;  3JVZ X;  2NCN A;  3NY5 A;  4YTM B;  2MJD A;  2MQJ A;  3K9O B;  1AN8 A;  5CHF A;  2JZP A;  3SEB A;  4FJV B;  4JPS A;  2MBH A;  1ZDX A;  3AN1 A;  2I1K A;  1MVK A;  2HTH A;  1I42 A;  4AUQ C;  2IDY A;  5AZH A;  3MTN B;  3ZNZ B;  2GMI C;  1IUE A;  4A3O A;  1V1P A;  1WM3 A;  2CHX A;  2DYO A;  1C78 A;  3IT4 B;  4ASW C;  3Q69 A;  1Q10 A;  3DVG X;  4E3C A;  2ICI A;  1WE6 A;  3RZW C;  4C4V A;  4LJP B;  2NMQ A;  5C1Z A;  3L16 A;  3RCZ A;  4BBN C;  4N9F 4;  4WH4 A;  1J7B A;  4PS3 A;  3GE3 C;  5G55 A;  2ZNV B;  2KQS A;  1F1H A;  3QCA A;  4US9 A;  2XK5 B;  1S3S G;  4HCN B;  1P1A A;  3GZN B;  2V3N A;  4X57 B;  1MHX A;  3H6N A;  5IKC M;  2X38 A;  2BB5 A;  2FUG 1;  3AB5 A;  4MSQ B;  1E9M A;  4ICV A;  3ZNH B;  3SU8 X;  1QQR A;  4PYZ A;  3U7Z A;  3HRD D;  4MAC A;  2KVR A;  1XXG A;  2BS4 B;  2JZZ A;  2ZVO A;  4NPN A;  3ZRC A;  2I2Y A;  4YTP B;  3AMZ A;  2RSU A;  3H7S A;  4I6L B;  4TQ0 A;  4JL9 A;  4KKJ A;  3U8Z A;  1WGH A;  4XC2 A;  3DQV A;  5CHV C;  2KX0 A;  5KHO A;  1XF5 L;  2E6X A;  3AEA B;  3DBL I;  3TIX A;  4A6Q A;  4A90 A;  4C80 A;  3N9Y C;  2BT6 A;  2CHW A;  1XLN A;  1D5X C;  3Q8A A;  2NPT A;  1SF0 A;  5BMG A;  3T9L A;  3L0W B;  1FFU A;  2JVC A;  4K3B A;  4TUU A;  5HI1 A;  2EKE C;  2MH7 A;  4JWS C;  2KFK B;  2IY1 B;  2CR5 A;  4WUR A;  4WJO A;  5DPS A;  3IXS A;  3NS1 A;  1BT0 A;  5EE3 A;  1E8W A;  1L0Y B;  4BKG A;  4KV2 A;  1TY0 A;  1V2Y A;  4N58 A;  3RNC C;  2JWZ A;  2KAN A;  4WJP A;  2KJR A;  3MHZ A;  2PKO A;  1IYF A;  4NJ7 A;  5LXI B;  4W9K A;  1YD8 U;  1V49 A;  3KUD B;  1WR1 A;  2WXN A;  2CKH B;  3NZ3 A;  4RNA A;  1Y56 A;  1EUV B;  4AS1 A;  4BVU C;  5EDS A;  3FAH A;  1P7E A;  3BIN A;  1QOG A;  3BZD B;  4ANV A;  2EMS A;  3GS2 A;  1E7U A;  3OJ3 A;  1I4Q A;  2KHW B;  1C76 A;  3EFC A;  1WGG A;  4IDI A;  3ZYY X;  1XEE A;  5J18 A;  1HEZ E;  1WMH B;  2J42 A;  1L0V B;  3GP7 A;  3ML9 A;  3PHW B;  4BAX A;  2M0A A;  5CX3 A;  1L4D B;  3RNB C;  4IWO A;  3PTF C;  1VRA B;  3OLM D;  1TTN A;  4MEL A;  1CZP A;  3UI3 A;  5GXG B;  1E7V A;  3L10 B;  1SE2 A;  1R7S A;  4II2 B;  1KOT A;  1TJE A;  2AWT A;  2NBW B;  2D3B A;  2M1M A;  4RFB A;  1ET9 A;  2PVO D;  3RN9 C;  1FIQ A;  3IHP C;  2I38 A;  4KDI C;  2MP2 B;  3Q6B A;  1YN5 A;  1XQQ A;  3AU5 A;  2C7N B;  2MCN B;  2IGD A;  2WXI A;  1NDD A;  4R3D A;  1UD7 A;  3U30 A;  3HUI A;  4HCP B;  3QAQ A;  3V61 A;  1OQR A;  1PGB A;  3W5V B;  2WXO A;  2QHO A;  1VZ6 A;  1V5O A;  1SBB B;  2KX3 A;  1VJK A;  1C1Y B;  5D3I B;  1EO6 A;  2KDM A;  2IO2 B;  1WGK A;  1RFA A;  2WQY B;  4HKZ E;  5BO4 B;  2IO0 B;  2V0G A;  1CMX B;  1WMH A;  4RGO S;  3WIM A;  2DNF A;  1EWY C;  2EEL A;  2BWE S;  2N7D A;  4MGZ E;  4ZOH C;  3DDC B;  2N4F A;  4W9J A; 
#chains in the Genus database with same CATH homology
 3Q6B A;  2QCZ A;  3MC9 A;  3MC8 A;  4C4V A;  4PK1 A;  2MHJ A;  2X8X X;  2V9H A;  2VH2 A;  2VH1 A;  3OG5 A;  3NJT A;  4BZA A;  4XGA B;  4QAY A;  3EFC A;  4K3B A;  4C00 A;  2QDF A;  4C4V B;  4K3C A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...