1TS3A

H135a mutant of toxic shock syndrome toxin-1 from s. aureus
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
194
structure length
194
Chain Sequence
STNDNIKDLLDWYSSGSDTFTNSEVLDNSLGSMRIKNTDGSISLIIFPSPYYSPAFTKGEKVDLNTKRTKKSQHTSEGTYIHFQISGVTNTEKLPTPIELPLKVKVHGKDSPLKYWPKFDKKQLAISTLDFEIRAQLTQIHGLYRSSDKTGGYWKITMNDGSTYQSDLSKKFEYNTEKPPINIDEIKTIEAEIN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structures of five mutants of toxic shock syndrome toxin-1 with reduced biological activity.
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Toxin
molecule keywords TOXIC SHOCK SYNDROME TOXIN-1
total genus 60
structure length 194
sequence length 194
chains with identical sequence B, C
ec nomenclature
pdb deposition date 1997-10-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02876 Stap_Strp_tox_C Staphylococcal/Streptococcal toxin, beta-grasp domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.110 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1ts3A02
3.10.20.120 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1ts3A01
1GOZA 1PTOC 2Z8LA 1UUPA 1CQVA 1V1PB 1F77A 2O2LD 1V1OA 1FNUA 1MD2D 1PTOD 1HA5A 1M4VA 1PRTD 2QILA 1SXTA 3BYYB 1ET6A 1RCVD 1SJHD 4RGNA 5FKAC 3R2TA 1SE3A 3DWQA 3OWEB 2G9HD 4RGOS 4RFBA 3BYTB 3URYA 2AQ1B 3R2IA 1D5XC 1YN4A 1I4HA 1I4RA 1BCPC 1S5BD 2IPKD 2AQ2B 1SE2A 1YN5A 1TY0A 2R61A 1L0XB 1EWCA 1AN8A 3GP7A 4L6TB 1RD9D 1EEID 1HXYD 1L0YB 1KLUD 1D6EC 1LT6D 1S5DD 1UNSA 4RHRA 1TS2A 1TS3A 4BWGB 2QEJC 1AW7A 5ELFA 4K6LA 1G8ZD 1SJED 4RCOA 1CK1A 4OHJA 1EEFD 2XRQD 1S5CD 2XN9C 5D3IB 1LO5D 1PRTC 1I4GA 1B44D 3SEBA 2XRSD 3CHBD 1SEBD 3DWPA 3KLSX 2CHBD 1I4QA 1LTSD 2RDGA 1D5ZC 4RGTA 2XNAC 1PRTB 5D3DA 2IJ0A 1LT3D 5TSSA 4RGMA 1S5FD 1CT1D 1KLGD 1TS5A 5ELCA 4DXFA 1BXTA 1BCPF 1LTRD 1DYQA 3O13A 1JR0D 2J4XA 1EFID 1PTOB 1KTKA 1T5XD 1FNVA 1FGBD 1LTID 2WV6D 1PRTF 3W2DA 5I4DA 5FK9C 1STEA 1D5MC 1LTBD 3BVGA 2ICIA 1CHQD 1SBBB 1LT4D 4DXGA 2SEBD 4UDUC 3EA6A 1JQYD 1QILA 1JWMD 3EFXD 3TSSA 4RHSA 1CHPD 1LTAD 3MFGA 1PTOF 1S5ED 1BCPD 5ELEA 4ZYSA 2RDHA 1HQRD 2TSSA 1JWSD 3BZDB 1RDPD 1LTTD 3V05A 4RH6A 1YN3A 1DJRD 1EU3A 1I4PA 1ENFA 1PTOH 1ET9A 1EU4A 1V1PA 1LTGD 1LT5D 3BVMA 5ELBA 1PZID 3MC0B 1TS4A 1PZJD 1BCPB 2NTTA 1SE4A 4Z9CB 1TY2A 1XTCD 5ELDA 1ESFA 3BVZA 1PZKD 1JWUD 1XXGA 3R8BA 1FD7D 4C56C 3DWAA 4TSSA 4NZLB 1B1ZA 1I4XA 1LLRD 4L63B 2AQ3B 4O1NA 1PYWD 1HTLD 1RF2D 2NTSA 1FNWA 1JCKB
chains in the Genus database with same CATH superfamily
1GOZA 3VRAB 1MG8A 2FINB 2UU7A 1QVFA 4DR3Q 4XT3B 4OX9L 1GUNA 5IT9L 2JPHA 4HAEA 5G3LF 4PZ7A 1PFMA 4FXGC 1F2RC 1ZP0B 2QHOA 3JC66 1ET6A 2O5IC 1SJHD 4RGNA 3A5UA 5HFYA 2A19A 5J3BA 2OTJA 3CMEA 5FLXc 3NVVA 2AL3A 3HOWG 1WRDB 3IL8A 3DWQA 2IL8A 1QZHA 5EQ0A 4NJ7A 4A3FB 4GXBA 3I4MB 1KH0A 3B2GA 3GTGB 4A3BB 1SR3A 1SIFA 2KQSA 1OQYA 2K01A 3W5OA 4NKLA 2PTLA 3H0GB 2B2TA 1WTRA 4HMIA 1WI0A 4C00A 1EQQA 1WD0A 3ZO5B 2NPTA 2WP9B 1Q82C 1HTOA 2UU9L 1HZAA 4PK1A 1E10A 4YY3Q 1PFBA 4MHEA 3KF8B 2XTIA 1TS3A 4UP7A 4K6LA 3PTFC 2ZEQA 1STNA 1STGA 1C4PA 2PPBC 1PH2A 4GMVA 1WSPA 4HJ7A 1GG3A 2BH2A 4R4IA 1N9WA 1F9JA 1V9JA 4BOZB 4GKKQ 1ZYRC 2W3SA 3DVNV 3HOYB 2BA1A 3UIOB 4BS9A 3MXNA 3I73A 2Z1CA 5CBAE 2DX5B 3ENEA 5AEKB 2XSCA 3VR9B 4WWMA 3MA2B 2GBRA 1IBXA 1VQAA 4R4OA 3S16H 2KX0A 4IOIE 3CCUA 3ZUNA 2R7ZB 4IPDA 1E8XA 1MFWA 3NWTA 2M0AA 1MJCA 3LYYA 2UXCL 1TWGH 3D31A 3PIO3 2DNFA 4IW0A 1T5XD 4JI3L 5C0XJ 2B2YA 3BIID 4ZUJA 1EY9A 2BKFA 2IO1B 2ZTCA 1E8WA 1NI3A 1EY6A 4IFDI 1CA6A 3OSOA 1EL0A 3O65B 4DXGA 1SYCA 5IP7H 5EE9A 2KBNA 4DR1L 4IM0A 4B3RQ 2ASQA 2N9LA 1JQYD 2BT6A 1I5FA 3BDOA 1WXMA 1J7CA 1C3TA 4J6IA 4C3JB 5DEHA 3AU7A 4GN4B 1BF4A 1NBFC 1V81A 1ASZA 2IGHA 3SVMA 1SROA 2B3GA 2I38A 2UYZB 3DBRB 1EUVB 4ZLTF 3ABVB 1HJPA 2LS01 4KGTA 2FIFA 2TSSA 1JWSD 4PMWA 1IL2A 4S17A 3AYHB 3M4QA 1ZXHA 5H92C 1JRPA 1N32L 5GADC 1EU3A 2LXAA 3SD5A 2WB1E 5AJ3L 1TWAB 3P1MA 2FE8A 2XK5B 4YSZB 2PW7A 4DV3L 3KDFA 1FD6A 3DXJC 2JYOA 4GKJQ 4RA8A 1TS4A 2ZW1A 3MZ5A 4EUTA 2K33A 3VR3A 2L1BA 2Q8TA 4EEWA 4DA2A 1S40A 1JC7A 2A68D 1X3EA 2CH4A 3IRBA 1SNDA 2NVXB 4W9IA 3OPOA 2YTVA 4WJQA 4MTNA 2BS4B 3N52A 1XXGA 1JWUD 3WWVA 2F1MA 4R8IA 1JRUA 2G4DB 3EUB2 3TEYA 4IUNA 4C56C 2M2LA 5KEEA 2D3BA 4GLSC 1Q8IA 1U4PA 2KWVB 4TV3A 3OWFA 2R7FA 1A2TA 3TS2A 3L0WB 2N3SA 2DZIA 3Q14C 4HXDA 1NNXA 1A6XA 1TKGA 2WIIB 3QAQA 1C78A 3RCZA 2MGSA 1RFAA 3W9CB 3IT4B 3MJWA 2HCCA 1NBWA 3RN9C 1V49A 4K2LA 2K5QA 1TJEA 3H0GG 1S3SG 2E2DC 3Q6SA 4P16A 1C9FA 1CMXB 1VCBA 2I1KA 4NAMA 1U4LA 1Y8PB 4JI2L 2X8XX 1WTXA 2YLMA 4M01A 3S1RH 3URYA 3R2IA 1N60A 4DXAB 3TBLD 4C3JH 1E8YA 2JXXA 2B8FA 3ND8A 2ZW0A 1SE2A 2KVRA 1FL0A 5EPKA 4WAAA 3GP7A 4N8X1 2D3GA 4G4KA 4ULLA 3QR8A 4XDCA 1WF9A 3I9V1 3SDLC 3N6RA 3PIOA 4UP8A 1TS2A 5IYDH 1YX5B 4LNQA 4BBSB 3IT6B 1QOBA 4ZRQA 3PO3G 1KRTA 2K5NA 5KYIA 2NUCA 5FLMG 5JZEB 4L5TA 5MPOA 5D3IB 4C2MB 1STBA 4A3IG 1JJ2A 1SYEA 3FPPA 1AWDA 5LXIB 3LJ3A 1HFNA 3TP8A 3PF5A 2EY5A 2LGXA 2CHBD 2R92G 4FF3A 3S17H 1Q1BA 2C5CA 5C4JH 4CYEA 1RLFA 5ELCA 4L23A 3WALA 1F2MA 2KA7A 3OIPA 4K5VA 3G7LA 1WZ3A 2ZNVB 4IUQA 4XXEA 1R4MB 4A3EB 4AYBE 1VQNA 1HZBA 1OXUA 3HOZB 1WVLA 3HOWH 3EFUA 3F2UA 3KK7A 5FR3A 3VFKA 2DYOA 2A8VA 4RMAA 5EJWA 4HIKA 2R93H 2KVZA 5I2YA 4XX5A 2L4NA 4PG3A 1SE8A 2MJDA 2PCFB 3SK8A 4DQOC 2ZXOA 3A55A 1A3TA 3CF5A 2AUKA 4OONA 3H7PA 5CX3A 4JWUC 1JICA 2CJNA 2CWPA 4WWNA 1LTAD 3MFGA 4K0KQ 4OVUA 3U50C 1HNZL 1QLBB 3HOXH 5ELEA 2UUAQ 4JBWA 1XPRA 2LGSA 4K7WA 3OTOQ 2D9UA 1EIYB 2RCFA 3V05A 2MP2B 5F2DA 2L3ZA 3NVZA 1WYWB 1ZKHA 3WOEA 2QA4A 4A3IH 1LT5D 2NVTB 2F03A 1YJ1A 2KDIA 4C2MH 3L16A 4H44C 3HOUH 2L00B 4DAVA 4OGQC 2EJFC 2L5TA 1KXLA 3LWUA 2KO3A 1TIID 3FMCA 2K6AA 1TY2A 2O2VB 2K5DA 4YCWA 1KFYB 1MSHA 1VQJA 4DV5Q 4LCDE 3BZKA 3I56A 2K4KA 2P5ZX 3OOCA 2Q2TA 3KVFB 5C3EB 2PQAA 4AOFA 3G48A 4PQXA 5GXGB 1GKHA 2R2QA 2M4NA 1QF6A 2RPQA 3FC4A 3TREA 2ID0A 1B50A 1DONA 1KABA 1TT2A 1PH3A 1MVKA 3VHTC 3HRZC 2KFKB 4FXCA 5CORA 1XT9B 2MH7A 2KN4A 1ZXTA 4KY6A 3IAYA 3PS6A 1A5RA 3QA8A 1KNEA 4DUZL 1YQ3B 3N30A 2MWSB 2DY8A 4IDIA 5DCNA 2PNHA 4EKUA 4FF2A 2AL6A 2VZKB 3IVFA 3JAMc 5M3MG 1X9NA 1PH4A 3M4PA 3UINB 3Q3JA 3M85A 2K8HA 4PS3A 3DCGA 1I4RA 1XNRL 2MPMA 1IBLQ 2N1WA 1CA5A 2R93G 1H9MA 3S14H 3PRMB 3HGBA 3NTIA 4P2CB 3NQTA 2RGFA 3DWGC 3ZTCA 2EOTA 4CBVA 1HXYD 2EY2A 2N9PC 3UIPB 2JA8B 2B2UA 3E6ZX 5BYQA 1E0BA 2N7EA 3J81c 3L4PA 2JQRB 2CCZA 2KEEA 4QJFA 2B63H 4RM9A 3HVZA 2KCMA 3MC8A 2BB6A 1I4GA 3ZRCA 4ICVA 4H02A 3CHBD 3Q8AA 1EOTA 1EZ6A 3PQIA 1QOAA 4X66L 3ZNGC 1BBWA 1WFQA 2RHSB 4QAYA 3KLSX 1T3QA 3BK2A 1UWMA 1EUJA 4JI1L 2N7DA 4FA6A 1PRTB 1J7AA 2ZJQA 3RULA 4HTHA 4KIKB 1SMYD 3R66C 3HFZB 4XTCS 3QHTA 1SYBA 2DENB 3TL5A 2AMCB 2BYVE 4DK1A 3RUZA 1IYUA 1OFFA 4KDIC 5IA7A 3HOZG 2F0SA 2JA7G 1FO4A 3HS0C 3ULJA 1HR0Q 5FLXE 1GC6A 2XVSA 2N8NA 5CV8A 5I4DA 2JP1A 2UXCQ 3WANA 2VL6A 5C1ZA 1TZOA 3GTQB 3QIJA 4R1JA 3T9LA 3QOLA 3VYSA 2NVYB 3VYUA 3ZJYC 3J80L 4DUZQ 2LRUA 5C3JB 1I35A 3L17A 1W2BA 3PO3B 4MGIE 3LB8C 2NMQA 3DHGC 1YNNC 3P2BA 4LNNA 1BVSA 3KF6B 3PGZA 3B0AA 1G6PA 3PRPB 4CO7A 1V1QA 2RMMA 3CQZH 3RZOH 4HJ8A 3CAMA 2EYMA 1PMRA 1YIJA 1WGDA 2RDHA 4FJVB 1R7SA 4B08A 1LGRA 4EOYA 2IO3B 1YN3A 3OJ3A 4LAAA 1IKLA 3Q3MC 3BZCA 1NYRA 1FFUA 2BYTA 2GLSA 4RG1A 3S15B 1YZ6A 5EKKA 4N9PA 3J80i 1NTGA 4M00A 2C9OA 4DUYQ 1P98A 4FJYA 4ABNA 1HR0W 3APDA 1I94Q 1VS0A 2NTTA 4JI1Q 3GO5A 4LWCA 3EJIA 3EVQA 4JIOU 3GD7A 3A4SC 1BO0A 5D7GA 1G91A 3VUYA 2VQFL 3QQ8B 2MJ8A 1XMQQ 2D0PA 3R8BA 4DV1Q 2NBFA 4MH0E 1R4QB 4HKZE 4DV6Q 2CKZB 3EQLC 1NENB 3WAMA 2F0IA 2HQEA 1LLRD 2H5XA 4FP5D 1WMHA 4XYCA 2B63G 5KHQA 1SRUA 3E56A 1MJDA 3NTKA 1JCKB 1ILPA 1CSQA 1L1OA 1SDFA 1QZGA 3GTOB 2KZRA 4QIWE 2XWJB 5HI1A 1IYJB 4W9EA 2J0TD 3VH3B 1D1KA 1VQIA 2KHWB 4R3DA 2KWUB 1VMCA 2MNAA 1R4MI 4DK6C 4LUVA 3A33B 1FR3A 4X3TA 4KIKA 5FJ8G 4F8CB 5EDSA 3T3NA 4YSXB 3KYDD 1LYLA 2GBJA 1E2WA 1SE3A 3A5ZB 2WXGA 4JI2Q 1OQRA 3L9AX 1IHZA 3I4NG 1Q81C 1YN4A 3ER0A 3PF4A 2EXDA 4A3GG 2AEHA 1FM0D 4K81A 2DJGC 2GI9A 5CTRC 2QMTA 4YTPB 3K7UC 2XWBB 2L9HA 1WYDA 2NN6G 5L37A 3PUYA 1VQ7A 3S2HB 2J42A 2KDFB 2NCNA 2UU9Q 3I91A 1F2ZA 3H94A 2A5UA 2VUMG 2I5MX 5LXHA 3AE1B 3DM1A 4A75A 3FVQA 1LT6D 4A3FH 2KFKA 2JA8H 2JSOA 4BWGB 5IWAQ 2QEJC 2QDBA 1K53A 3I4MH 3S15H 2LD9A 4JI5Q 2PJHA 5IE8A 3N1ZC 4NAWB 1WJNA 4ZRKA 1SJED 4ZAIA 5AZHA 2EKIA 5FLMH 3MHBA 1F1HA 2B2YC 1JWAD 2XRQD 4FADA 1LO5D 3VDZA 1D3ZA 1AEXA 2FUHB 1O7YA 4WQOB 4E3CA 2DJFC 4KN4C 3U4VA 1SAPA 2N78A 4JI7Q 1EOVA 1D5ZC 1WGYA 4EE2A 5TSSA 2K22A 3H3VI 2K8CA 1CT1D 1KLGD 3ULPA 1QZEA 2JEAI 1YITA 3D6WA 2KD0A 1WXVA 4KHZA 1DYQA 2H89B 2V3SA 1RKNA 2EY1A 4C1NK 1YBYA 4GOPA 1STYA 3M4YA 2EVBA 3FKIG 4LTUA 4PMBA 5C4XB 2JX5A 2KMAA 4P1CC 1OXVA 3HOYH 2UXBQ 3AE7B 2E2HB 1JOQA 1QVCA 1QWYA 3PZ7A 4NQLB 2ZTEA 1NAPA 2EYFA 5T1GA 4DV4L 3HKZG 4A3GH 1WWTA 1PYSB 5IYCG 2N9EB 1R4NB 2B8GA 5G5GA 2O6VA 3D32A 4KKSA 4IKGA 1B9RA 4N59A 1UGMA 3P4SB 4ZRIA 2PMZE 3NBIA 4KDLB 1HUNA 3UGBB 3AU4A 5EAYA 3U7ZA 3ECIA 2PMZB 3ZW3A 1N33L 3ITPA 1BCPD 3TS0A 1BBXC 4IOAA 2LY7A 1K0SA 3CWIA 2HD3A 4P75A 4HPMB 2MBQA 2ZVOA 2B2WC 4K14A 1J19A 1RJTA 3QC8B 1QOGA 4TKOB 2JZZA 1U4AA 3PO2G 4UHVA 4CJ0B 3AE8B 3VR8B 1AZQA 4A3BG 2L55A 3NHEB 3KDFB 1CZGA 4Q2JA 5M3FG 4XC2A 3V6EB 1DGSA 2K04A 4A3DH 2D11A 2JSVX 4ZRPA 1A3UA 5IYDG 4MACA 2GVBA 1PXUA 3ONSA 4P72A 1FD7D 4EZLA 2YTYA 3VH4B 2CU3A 1SGHA 2FCMA 3ALBA 3QK0A 5FR6A 2X6GA 2EY6A 4WJ3M 2BH8A 4CHTB 1XWEA 5LMUL 2D3CA 4FLHA 4KZCA 5GAHC 2K0PA 2MSED 5FKAC 3SE0A 1VMPA 2R2OA 1XNQL 4G7OC 3DUZA 5GROA 1RAXA 2KQ3A 1HA5A 1SMYC 1FJGL 2O5JC 1EQRA 2A68C 1XPOA 3MAQA 3EGRA 3IXSA 3H3VC 2D62A 3NJTA 2Y0SE 2V9HA 3ZJTA 2EZVA 2QJLA 4A93B 2JWUA 2A73B 2QCPX 3IG3A 4P1BC 4CKCA 2JA9A 1PGBA 3B1LX 4TKNA 3TEXA 3FILB 5HURA 1XJVA 3RN2A 3T1YQ 1UEAB 3MP9A 4IWPA 1M8AA 2I07B 2JA5B 2JF5A 3CXCA 2BE5D 2Z6BA 3GTGH 4A3BH 3QARA 2JA5G 5ELFA 3RT3B 5E6JA 5IP4D 2WINB 4RCOA 4NDXA 4F1SA 3C8YA 4XWTA 5M9OA 4B3TL 1B44D 2ZTDA 1JWBD 2ZPYA 3L10B 1NCVA 1CSPA 4LJZC 2GBMA 4DDID 1X3QA 2VB3X 2IGGA 2BWFA 3ML9A 4OWWB 2HD5B 3APFA 1SN8A 5IGFA 3B08A 4DU9A 5CC4A 3TDQA 1VQKA 1LTRD 2H4OA 1E1OA 3UE1A 1PUTA 1Q90A 4F88A 3JSVB 5BMIA 1B7YB 3KUPA 2DZKA 3FEWX 3S1QH 2YTXA 1OQQA 1K83B 1PTOB 2NBWB 2LHDA 5D65A 2IW3A 2JXTA 5C44G 3RN5A 4AYBG 3BVGA 4JW0A 3RZFA 1D4BA 1CHQD 3K57A 3M63B 3V60A 1SBBB 3C2PA 4DNIA 3K5LA 4M8MA 4UAIA 3D4RA 3WAPA 1H9JA 1QG7A 3J81i 4DV2L 4DV4Q 3HOWB 2BW2A 2KLCA 1X6OA 2KQ7A 3DWMA 1JWMD 1VF7A 4HJGE 1B53A 3ZJUA 1ENCA 1PFNA 4KMUC 2E5LL 1FXIA 3KUDB 4P71A 2DLBA 4ZHPA 3HG9A 2WWZA 4LFBQ 5T8IA 4HIDA 1E9MA 1G2TA 4BKSD 2MQHA 1IZ6A 4DR7L 3H09A 3H6NA 4E71A 1I94L 4ZK9B 2I1JA 4OVZA 3VTWA 1ET9A 4A9AA 1MIUA 1IBMQ 1FXAA 5M3FH 1GUSA 1WJ4A 1MGSA 2VQFQ 5G5HA 2GBKA 2JY6A 3SHLA 4X3SA 2IX1A 4LNOA 1HRJA 3DBHB 4GNXB 2HDLA 4GKKL 3SK4A 3A9JB 4GGQA 4N58A 2HTHA 2PNRC 4A3DB 1UE7A 3K7AH 2BKRB 2KHSA 3VUXA 4BY7G 2PW5A 1HZCA 4DV1L 1BUVT 3AECB 4MSMB 1I4XA 4L63B 2SOBA 4XQNA 1ISNA 3AFQA 2G45B 5COYA 2BDOA 4NMZA 2L12A 3E9HA 3Q8FA 1CQVA 1V1PB 4R4TA 3HOVH 1AP0A 1V1OA 3U8ZA 4DR3L 2LXCA 5M5WH 1OO9B 2F3IA 2QILA 3TRZA 4C80A 5IGCA 1YJJA 4BOSC 4KLKA 5EGTA 3KWVA 5EE1A 4BKSA 5C3EG 5C4XG 3SR6A 3CMMB 4PYZA 4OZBA 4MM3A 3X0WA 2G9HD 3VR6A 1WH3A 5FO7B 3AU5A 5IOCA 2G5DA 3FILA 4B3SQ 3HUIA 4OL7A 3T16A 2F0UA 3DHQA 2HCIA 2I0QA 2MP1A 4OZAA 3SGIA 1RD9D 5NUCA 4HVBA 3HM6X 2VQEL 3DPDA 2N55A 2QGQA 2KWCA 3BWUD 2Z9HA 3S2DH 3AE2B 5CHFA 2Z0SA 3VRBB 1ZGUB 1ZOYB 4BFRA 2BDNA 4A3KG 3S14B 2LSSA 5JJLA 4NQKE 2L0CA 1TU2B 3SEBA 4MGKE 3W1BA 2FNJB 3ZDTA 1YNXA 1N36L 1TTNA 1Y56A 3I4NB 2Q8IB 1EYAA 2ZCBA 4AS1A 5J17A 4DV5L 1A2UA 2JJQA 4MSQB 2CJOA 2CWAA 2B29A 3U4ZA 2XNAC 5I6YA 3MHZA 2XGTA 4C4VA 4P6VF 4KI0A 1B3AA 1Q7YC 2LJIA 2M0XA 2HIVA 4GDLA 1ZEQX 2J4XA 1VF5C 1FPYA 3SK6A 1V5OA 2OQ0A 2F0QA 1A0IA 1QB5D 2KENA 2OQKA 3S17B 1KNAA 1IBKQ 1H95A 4KJNA 3AE6B 1LTID 1PFDA 1YI2A 3GS2A 1F9RA 2BS2B 1VQGA 4TQUS 4NXNL 3ETRA 1J9OA 1ZDVA 2DYBA 4C3IB 1MJEA 4RKLA 2JE6I 3D3RA 2BQQA 1EY8A 4KN7C 5DAUA 2L1AA 5IY0A 3ZNHB 4I7ZC 4HCPB 4DR1Q 1RHPA 4G7ZC 2VUMB 3KJPA 2NN6I 2RBMA 4V0BA 4DN4M 1GHKA 4QY7A 3UQBA 4EZKA 2NVYH 4LNIA 2NBVB 3MC9A 2Y0SB 5IAAC 3CRKC 1XMOQ 1RDPD 3NZSA 3CCMA 3UI3A 4B9WA 2VH1A 1D2BA 3EROA 2LRWA 4GIVA 3BJUA 3NUHB 1FXTB 5FOBB 1NR2A 4ANVA 4UY8C 4DV3Q 4ARIA 4MTKA 5JHBA 4IUTA 2F0DA 3VR2A 1RFKA 4JL9A 4G7HC 3S1NH 1XTCD 5ELDA 3IHPC 3NEMA 3F2CA 3BVZA 1SNPA 4HKQA 1TWCB 3AEDB 1C76A 4C7YA 2B2WA 3DWAA 2LEKA 4NZLB 1E2ZA 1VQ9A 4Y52H 2WKDA 2CHWA 3G6EA 3EIVA 3JYUA 1QVGA 2DGYA 2KN5A 2NB0A 4RF0A 5M3MH 1WI5A 2LVOA 4OX9Q 2WXFA 3PZ8A 3U4EG 3HKSA 1VCIA 3CW2C 1ILQA 5AUKA 4HR7B 1KQSA 4NJCA 1UELA 4M0WA 3S16B 2KQ4X 5IGDA 3HKZB 1DZ1A 4K2KA 3H8HA 3EHVA 1PVOA 2MA9B 4JI4L 1PGAA 3NVYA 4XDDA 4AQ7A 3OWEB 1TKYA 2KT7A 3RD2A 1WY8A 1V43A 1HNZQ 3PSIA 3WCQA 5GAGC 4LUZA 3CRLC 4B9XA 3KLWA 4XQQA 2KC1A 1EWCA 5ELNA 1A70A 2LGDA 1HFGA 4GLVB 1S3OA 2G4SA 4DR4Q 3FRPB 4PS7A 4B3SL 4KD3A 2F0KA 2WP8J 2LUMA 4JOIC 1Y8NB 1E90A 3OMCA 1QQRA 1HQMC 3ZLZA 1ROEA 1QUQB 3I4OA 2F52A 2DYMA 3I72A 2IY5B 3Q3OC 4LLGM 1E22A 4X3UA 1KM7A 3KH0A 4X62L 4DAMA 3SFDB 4BY1G 4K5WA 3DWPA 4A3JB 2BVCA 2BYFA 1RL2A 5KYLA 3V6CB 5M5YB 1E7VA 4A3IB 4GNXA 2SNMA 3R3MA 4GDLB 1C4AA 4A3OA 1KAWA 3AV8A 4RGMA 3SR1A 3N32A 4RNAA 1R4NI 1RWSA 4A4IA 3U2SC 4DNRB 1JE4A 1K8OA 3HOUB 2V0GA 3NBHA 1EIFA 4IJHA 5JJKA 3JW0X 1L4ZB 4LW1A 5IKCM 3VVWB 1FNVA 1QNKA 4AQYL 3ERSX 1A8VA 5C44H 2V3PA 4BKTA 1D5MC 3VXWA 1GUOA 5KNDA 1R9TH 5C23A 1N63A 4LK0M 5HHDG 1CZPA 3SU8X 2PE9A 3A7AB 4UDUC 1CKOA 1P8LA 3FHWA 2J0MA 4NXNQ 2JEBI 2N49A 5C4XH 2ES2A 3EFXD 4LFCQ 1LTLA 1C7YA 1HEZE 1Z6HA 2XBBC 3LX0A 2V4IB 4ACFA 3TJPA 1HE8A 1SFOH 2F0EA 4IUUA 4IUVA 4FVMA 5D6JB 3H9DA 3ZJVA 1T9HA 1G2SA 3V96A 1EY5A 5J22A 3AE4B 1II3A 2K32A 1EIHA 5LL6X 3TP6A 2EELA 2CU1A 3DHHC 2K6DB 2REXA 5EBCA 3V2TA 4ANUA 1PZJD 1FYCA 4RCNA 1NI2A 3RNFC 1Y1VB 2Y3AA 2BE5C 5JPNC 4HSVA 4Z9CB 2ZM6L 3M4OH 3TZUA 4JGHB 5K5PA 3HP3A 2M8SA 4DHZB 1BR9A 4GOPB 2PYKA 2LHEA 3W3AA 4W9DA 2F0HA 3AH7A 2GN5A 2INNE 2L11A 5KNBA 1UAPA 5FO8B 5JVH3 4DR5L 4L5QA 1WE7A 2IZVB 2F0VA 2NWGA 2EDGA 1CTMA 1PTOC 1UUPA 1M1KC 2O2LD 4OVVA 5HG2A 1IKMA 2IDYA 3QO2A 2K52A 3RZWC 3PUWA 4GNXC 1HCZA 4HEDA 3NUCA 2MBOA 2RF4A 1M4VA 2N1VA 3A9JA 4A3PA 5BO4B 2FMMA 1K8AC 3NVWA 1DOYA 5AZFA 4D2KA 1DGJA 1I6HB 4A3EH 2HDMA 2K5PA 3MVVA 4NY0A 1JORA 1UBQA 2EPBA 2Y5PA 2JA6B 1XD3B 2F0FA 1I4HA 1T0RC 2W54A 2QW7A 1WM2A 1GUTA 4GLAC 4JI4Q 2VQEQ 3GTKH 1Y1WB 3M3YB 4FHKA 2DAJA 4MGZE 2KJRA 5J2RA 2R61A 4US8A 1WGHA 1AN8A 1YOVB 3PHXB 1GAQB 3VUWA 4J6HA 4NP5A 2QDLA 2RDBC 1DXMA 1ML0D 2JT4B 1FVIA 5IP9H 5EBDA 4HJKA 3EFCA 5LLIA 1F9PA 1M94A 1QUQA 3C1EA 4GDKA 2F4VQ 4H13C 4C3HB 1ZKOA 2FXQA 2JU6X 3GQBA 1I3QH 4LNKA 4MH8A 1AE2A 1UE1A 2UXDQ 2LFNA 1PRTC 4C7ZA 5IIFA 1QE6A 4RAUC 1JB3A 5E6PA 1TR5A 3EBEA 1Q86C 4JK1C 5DM73 3CIRB 4HCSA 1K28A 4S0RA 1LTSD 4WORA 3PHWB 2KHIA 5IP7G 2RDFA 1MSGA 1R4PB 2O4XA 4RGTA 5D3DA 1KIXA 2IJ0A 4DHJB 2ENBA 4F7XA 2X38A 1XCQL 4L2YA 5E6NA 1EF5A 1SNCA 1AE3A 3EECA 2ICEC 2ZCCA 1BCPF 1ZPSA 1GJZA 5BN4A 4CJ1B 2LVPA 4MN3A 4M8NA 5C3EH 1AYFA 3A9KB 3J7AV 5CGKA 2KMCA 4QL5A 1VQFA 1PH8A 3CCSA 3N3KB 1UWXA 3K9OB 2BA0A 3RMKC 2DHZA 5C3XA 5LMNL 4ILWA 2DZMA 4IPHA 4BBNC 2IGDA 2C7HA 4IN3A 1WGGA 2D2QA 3OJ4B 3RR5A 1EY0A 3GTKB 5CHVC 1SSOA 1I50H 1IL8A 1P1AA 3W5UB 4JC0A 1U0LA 2F3VA 3K58A 4XWWA 4DAPA 4QQBX 1CFMA 3OHXC 4IJLA 5DPTA 2IY0B 2J7ZA 2PZUA 3PPAA 1IGDA 3RLOA 3RNUA 1C77A 3DOWA 1VQ4A 5L95C 1V1PA 5E4XA 3RZDH 2B2UC 2Z0DB 4B0EA 3BK1A 5A2QL 4PV1C 2IY1B 3I63C 1IYFA 3KYHC 3T3OA 1IBXB 2JYTA 2E74C 3CKIB 3WA0A 2KAJA 1WGRA 4A3DG 1PZKD 3S1MB 4Y7NB 3AEAB 4BBNF 4CJ2C 2QSDA 3JVZX 1KAAA 5LNK1 3E0EA 1HUMA 1B1ZA 4X65L 4I7AA 3EN2A 4DV6L 2AQ3B 1L4DB 4JX1C 4MT5A 4AJYB 4O1NA 2JK8A 3UDIA 1OTRB 2A6EC 3ZYYX 1DOXA 3PMFA 4DV7L 4OWXB 4JBMA 3Q6BA 2E75C 4II2B 1TYGB 2BCOA 3UF8A 5EKLA 4ZKCB 4BXXG 3RMHA 1MD2D 4KV6A 5C5MA 4DR5Q 4JQWC 2E2IH 1N8RC 2WU2B 1KLVA 3F8TA 1J0GA 3BYYB 3BU2A 4W9LA 2QC8A 4BBSG 5CV9A 4DR2L 1T0SC 1YNJC 5IT9c 4JI6Q 2FBWB 1ICFB 1VQ8A 2K5WA 4U68A 2MLBA 5M5XH 1BT0A 4NJ6A 3E0JA 5I9PA 1GNUA 5BMHA 4APVA 3FKIH 3DQVA 4JCVE 1H4RA 4JPBW 4POFA 2K75A 1X65A 1I50B 5M5WB 2LVQA 5LL6S 1LUZA 1YNJD 1H9SB 5AFWA 3ONAB 3CD6A 4L6TB 3VA5A 2GRIA 1NUCA 1Q3LA 4ZUIA 3J81E 5CV6A 3PO3H 2K03A 4KKIA 3ZKJC 3N20C 3P7JA 1L5PA 4LFBL 3T51B 1G8ZD 4NPSA 1LXDA 1Y14B 1SNMA 1I6VC 5FLXL 3TEWA 3L7ZC 1E24A 2UUCQ 3HIZA 4GS3A 2F4IA 3KLRA 3RD4A 3OG5A 5KIXA 2F4VL 2LUEA 1HA6A 1RIPA 4XYOA 1PH5A 2EXZA 1TKEA 5FO9B 1C9OA 3C46A 2YYZA 2SNSA 5IODA 4K1RB 4U673 4IUMB 1S5FD 2Z6KC 1G6ZA 3OW7A 4K8JA 4O2DA 5DNFA 3H0GH 3GV3A 1PHJA 4N8FA 1HPCA 3VYTA 2WAQG 5JAVA 3HOXB 2CVRA 4JV5Q 2WX1A 2EYOA 4R9WA 4A3FG 1XYIA 5EPJA 1EFID 3I4NH 4PNYA 3J7AF 3HVDA 3PO0A 3P1HA 4LF4Q 4CHKA 1VQMA 3IKJA 3NE5B 1FGBD 1PFSA 1P7FA 5G3LD 3AMUA 4TMAB 2AWTA 4HCEA 4LFCL 4A3LH 1UE5A 4HJ5A 2MHJA 2WXQA 2DWQA 3W1SC 2JXMB 2A6HC 4A3JG 5M5XB 1HZ6A 3ZDMC 4KK7A 1V2YA 2K14A 3AE9B 3NSWA 2RSUA 4Q0FA 5BN5A 4FBJB 1S5ED 1E5WA 1V80A 3A7LA 4ZYSA 1N33Q 1XEEA 2R7ZH 1STAA 2DNEA 2K6QA 3HM3A 4LJPB 4MJSA 2PVOD 3GTLH 3AQQA 3QJYA 3ZIMA 1TWGB 2CQAA 4WJOA 1HZ9A 3E9IA 2ZM6Q 3WAOA 2D2CC 5G55A 4ZQ3A 4DR4L 1EM7A 3Q8CA 2J53A 3M62B 3W1YA 1K73C 2PEAA 4YCUA 3RNBC 4C4VB 4OXPA 5IO9A 1GHJA 4HCNB 4A20A 4WWOA 2ZJRA 3H91A 1FIQA 1XX8A 1A3VA 2JA5H 4LDTB 4FF1A 3EC8A 2R7ZG 2HE7A 2EJMA 2MW5A 1HH2P 4TSSA 2FJ2A 4XYQA 4F7ZA 1EWIA 2KTRA 2OJWA 1TZ1A 3B2FA 2PQAB 3GV6A 4IUPA 1KL9A 1OEYJ 4C3JG 2Z8LA 3S1NB 3Q69A 5JJZA 4DDGD 3Q8BA 1F77A 5K36G 1YJWA 1WX7A 4X6AH 1PTOD 3MTNB 2E2IB 3AI5A 5C2TB 3F2BA 5ELOA 4ODGA 1F2YA 3JAML 5JXVA 3VTVA 1OXTA 2CFMA 3KWLA 1LFDA 4ZDVA 1J5EL 2HHHL 4JBKA 2LMCB 3A9KA 5KGUA 1BBUA 4GDKB 2KYWA 4QB4A 4QUFA 5H1SE 1YMHE 3QWZB 1E1TA 4FULA 2RHQB 4B3ML 4MM3B 1AFPA 4YTNB 3FKIB 3GTJB 2WB1B 1F9QA 3M7GA 2L7RA 2O6VB 1G51A 1S5BD 3BDCA 1F9SA 5DLQE 1XLQA 3PO2H 3J7A5 5EE3A 1HTQA 3K59A 2W55A 2WXLA 2QEXA 3V61A 3D4WA 1IPGA 4A3MB 2WXIA 4W9GA 1MHHE 3T1YL 3HOZH 4PYUA 1L0YB 4RHRA 3HKZE 4K5XA 2KKCA 2NZHA 3PV1A 4YT0B 1C4CA 2LXKA 3NHHA 1C4QA 1N32Q 2B3AA 1EIGA 1GUWA 1IYVA 4QMGA 5JHAA 1T0QC 3Q8EA 5IWAL 4IWOA 4KY7A 3MXNB 3AXCA 1Q8KA 4GOPC 3LXFA 4LFAL 1SEBD 1HNWL 4XGAB 4JI7L 3S1RB 1FFVA 4ZHOA 2RDGA 4XDXA 2PZTA 3KBGA 2K25A 1XCTL 1LT3D 5T1IA 5IYCH 2WXNA 1C79A 1TS5A 3G4SA 1C1YB 1XNQQ 1ZXIA 2GOWA 3CQZB 4ZCKA 3KBXA 5KNCA 2E3TA 1UD7A 1YJNA 3C0RB 4M0WB 1NMGA 1GUAB 1UH6A 1XF5L 2NVUI 2A74C 3QWNA 4ANWA 2KDMA 4JOIA 2J0JA 2EKEC 3M95A 3D4DA 3ZNID 2MJ3A 1XLOA 4CDDC 1XO3A 3DBRI 4LF8Q 3A56A 5BYRA 5FK9C 1F0ZA 3ZRFA 3Q3FA 1W6JA 5EKIA 1HZ5A 1MI2A 2YEPF 3HRDD 1XLNA 3NS1A 3CPWA 1NYQA 4HIMA 1DM0B 1NJIC 2KX3A 2BWES 2ACZB 2N9KA 3DM3A 3HOVB 2ZVNA 1N34L 3U7DA 1BKBA 1XNRQ 1TVXA 2K28A 3A4RA 1MBYA 2J52A 3H7PB 4X57B 2L05A 4ME5A 2V3NA 5IYBG 3CC7A 4RHSA 4HROA 2Q8RE 4A3KB 1JB7A 2SDFA 5C4JB 1I7HA 3PO2B 1B9NA 2B2VC 2LZ6A 4EQNA 2RD0A 2R3ZA 2C9WB 5D94A 3DBSA 4DNTB 2G1EA 1I42A 4A3MH 3CU7A 4DR6Q 5JEAJ 2CHZA 1CQFA 3ND9A 4US9A 4KD4A 1N6ZA 4EZJA 3J9CA 3VAWA 4YWGG 4M8AA 1RYJA 3CCEA 4FJZA 2K5HA 4KJOA 3UI2A 4BA2I 4URKA 3Q0AA 5GQOA 4EFOA 4HEA1 4A93H 4PMCA 1L0WA 2R93B 1GUGA 4AP4C 2DN8A 4X66Q 2KMMA 4GN5A 3PUZA 3NBHB 3Q3NC 1ASYA 1YQ4B 3HHMA 4LFAQ 1WJ6A 2EYLA 1GC7A 3H1UA 1GPXA 1KDCA 5BR8L 1KOTA 4K3CA 2A5HA 2V1CC 3PT2B 2KCNA 1O7IA 5CHWA 1K3BC 3TMPB 1GO3E 5CV7A 4ZRJA 1EY4A 3TZDA 2CS4A 4A6QA 4WURA 1FNUA 1OGWA 1PV4A 2F0MA 1G6JA 4YSYB 4HLEA 2Q2UA 2WXKA 3SFEB 2QIEB 3OYYA 2DY7A 2NVTH 2IHFA 4LF5L 1RCVD 1XLPA 3P20A 2NVXH 2BYEA 5J1ZA 2YU9B 3T53B 3K5NA 2WXOA 1QCBD 4TQ0A 1L2NA 2KEDA 1FJGQ 4RFBA 3U30A 4YCVA 2MO1A 2D0OA 4AUQC 1WTHA 2F0LA 4BY1B 4NPNA 1K3RA 4E6IA 3D6CA 1J5EQ 1SNOA 2HHHQ 4FXDA 2OEDA 3MXGA 1Y1WG 4EQPA 3GTPB 4KTAA 2WLBA 3NWSA 2L83A 1IGCA 3CC4A 2D5DA 3BINA 4XQJA 4JE3B 2WDRB 4YTMB 1EEID 1J8CA 2H88B 1S5DD 4C1NI 1UNSA 1KC8C 2JRHA 1F2RI 2JA6H 3J80c 3TIXA 5A2QE 1TWFH 3ML8A 4FXKC 2LMCA 2W9NA 3H7SA 1QNUA 1X3GA 2EJGC 2XN9C 1WTOA 2WXHA 1N61A 4NAWA 3I90A 5IGEA 3Q22A 3KYCD 3NS8A 3CP0A 3WDNA 1PH7A 1EYCA 2MP2A 1IW7D 3AB9A 1CKNA 4K7SA 4BA1I 3GDEA 1T6BX 3PIP3 4YHHQ 2OJRA 4ASWC 1VQDA 2K3UA 2EIFA 2VB2X 1E6EB 1LQBA 1W6KA 4MELA 4BBRH 5BR8Q 1IXRA 2JZ3B 4K7UA 1K8MA 2UXBL 1VQ5A 3U52E 4A90A 2WU5B 2Z0EB 4ZKBB 3P4PB 5IN7A 2F0GA 2GA4B 4A3EG 4JI0L 3R93A 4WJ4A 1SE9A 4P73A 5CV4A 1IW7C 4LF4L 2LGIA 3CF6E 2BBCA 2KACA 1WE6A 1YJIA 2IX3A 3U58A 3G71A 2FIDA 3AM9A 1LTBD 3FKYA 4BBRG 4DV0L 2H1EA 4HK2A 2AUJD 4KHPL 4A55A 1G291 5M3MB 4QF4A 5HKHA 5C0XH 2NVQB 1QILA 4DWFA 2AYOB 2BS3B 4CDCC 3ZXVA 4JI6L 4OW0A 2XIWA 2OF1A 2ON8A 5BYSA 3DBHI 4IZ8A 2N7JA 1EQVA 1ESRA 5JEAG 1SLJA 2Q2IA 4JI5L 4Q5VA 1UBIA 2Q5WD 2LXJA 2UUBQ 3LWEA 3Q24A 3I8ZA 2LJ5A 4N6EB 5IT9E 4IPGA 1X55A 3CMAA 3AB5A 3NRZA 5H8YE 4KZ0A 4G50A 3CCJA 5J18A 4CGYB 2PW9A 3AE3B 1VQCA 4ZRZA 1FCCC 1WX8A 1YVCA 2J0KA 3CCRA 4B0MA 1KF6B 5IGGA 3GTMB 1E7PB 4WIPA 3I3CA 1X56A 4GB9A 3VR5A 4MJSB 2MFIA 2GBNA 2IO2B 4AJWA 4POGA 3FP9A 2ZJDA 3LDZE 5C5LA 1K51A 2WXMA 2NZOA 5EPLA 2HT1A 2KNBA 1V9PA 5BMGA 2WGSA 1STHA 2JN4A 1H9SA 1HTLD 1RODA 4DHZE 2EQSA 2X69A 4R4QA 3M4OB 4I6LB 2AWNA 1E7ZA 1Z5SB 1ACCA 3PREA 4NXMQ 1LABA 4RKBA 4BVUC 2N4FA 1EY7A 1KRHA 3L08A 1JROA 2BOSA 3I70A 1N5XA 2WXJA 4HDOA 3L0OA 2EYJA 3SHQA 3R2TA 2Y5CA 1RTNA 1WCMH 3CPFA 3K0YA 2WHIA 4WJNA 3HOVG 4KSKC 2A6ED 4WFN3 4HRSA 4BY1H 1MHWC 3AEEB 1TWAH 1D7QA 3HZXA 1XMOL 1GM5A 3P4RB 4WJPA 3UDXA 1ZW7A 2IPKD 3RNAC 2Y0SG 4M1UB 1NSNS 4JBJA 5C44B 2VNUD 1E2VA 3HOUG 3GTPH 1L0XB 3J81j 2KFJA 4MIUA 1VQHA 3HOYG 2TMPA 4BY7H 4C3IH 3CSFA 1IBLL 4XE0A 1VZ7A 2L52A 2F0TA 2JA8G 4LF6L 2E2JB 3NPPA 1L7YA 2VRRB 1D8LA 1H9RA 2WFWA 2ZNVC 2KCCA 1L2FA 1RM6C 3SDZA 1KJTA 4R8NA 2DUDA 1SFOB 2R92B 3J81L 3A1QB 2JRIB 2V1YA 3QCAA 3RLFA 1HNXQ 1NDDA 4WQMA 3C3LA 1YD8U 3I57A 2WYQA 1XPUA 4E74A 3H15A 2OXPA 2LWPA 3PGEA 2D10A 2LFIA 1Z9FA 3MTSA 4F8MA 3IAM1 2AHOB 1WIAA 2WXPA 1OXXK 3A74A 3QJZA 1BXTA 4LF7Q 3A8KE 3I4MG 1FMAD 1VZ6A 1GJXA 5IYBH 1PDQA 1C48A 2IX0A 1JR0D 4IFDH 1TWCH 4IO9A 1QKZA 2FAZA 2IWHA 3E5SA 1YIWA 3ERQA 3ZVVA 4A3MG 5JOBA 3HOXG 3TEZA 2Z59B 2RQXA 1BNZA 1B8AA 5KRUA 4NXML 5JJIA 5CV5A 3X3NA 4CDEC 2DNCA 1WTQA 3RYTA 4IFDJ 3MFYA 2K8BA 3C1FA 3QOJA 2ZXRA 3QIAA 1VQEA 4RM8A 3EA6A 3KF8A 3K7AB 4LUOA 4HN7A 4DV0Q 4BBSH 1VRAB 4H7BA 2K39A 3MJ5A 2NBUA 2HJ1A 3DBLI 2WKCA 2KTRB 4B3MQ 3AN1A 3VTUA 4BY7B 4OO1I 2HIXA 1Y8RC 2HDEA 1T5EA 1B3QA 1F52A 1Q5WB 5TR5A 2KJXA 1I4PA 1P3QU 2W82A 3RNGC 3ZGZA 2JYEA 2E2HH 3R7RA 2L76A 5ELBA 2MJEA 4DGZA 4KKTA 1BCPB 1EZ8A 4A3GB 2V4LA 2R92H 2M9VA 2JQOA 1YHBA 1PH1A 2HQLA 2R7DA 4J1MA 2KK8A 4JPSA 1UZXB 3KQ4A 2PI2E 1AARA 5AUIA 1IP9A 4GU2A 2K50A 3RZOB 2D5GA 2OCEA 3STBD 2KJHB 1VQPA 3S2AA 4REZA 4GLXA 3DVGY 2M1MA 3S24A 2KVMA 4M02A 4A3JH 2PLPA 2F0JA 4NB3A 1SYDA 4YXDB 5I9OA 1PRTD 1SXTA 4JI3Q 1X1MA 4I6PA 1IUEA 1VLBA 4II3B 4GN1A 4USAA 2ZPNA 3H6MA 1O80A 3S9WA 1VQOA 1QT9A 2PMVA 1JE5A 3SK5A 4A3CG 2AQ1B 4UPAA 1Q1OA 1DOMA 1K8RB 1O7ZA 4B3RL 5CBEE 4FF4A 3TBIB 1JJGA 3ZQ4A 3A8JE 4HSPA 3BG3A 2G9DA 4K8IA 3B9JA 1Q1EA 4RWSC 3I55A 1SIJA 1N34Q 2Q2HA 2RA4A 3U9OA 2UWQA 3E3XA 4H2AA 1S1QB 4TQ1A 1VJKA 3C19A 4G11A 1H8CA 1WFYA 1Q10A 2ALYB 4LK1C 3S1QB 1D6EC 4DPGA 1WJJA 2I2YA 3OIQA 2HUGA 3K0XA 2BF8B 3L2PA 4DR6L 3HK0A 2MEKA 3J7YW 3ZNZB 4ICUA 1GB4A 2V4DA 4BKGA 4OHJA 2KHJA 1EEFD 3I2ZA 4LF6Q 2L15A 2Z4HA 4AYBB 2FCNA 4PS8A 1WZ0A 1DD2A 2IT1A 2XEWA 4B95A 1Z2MA 2A1AA 3NY5A 1P7EA 2EYHA 2L8JA 1KHIA 2Y5BB 3RZDB 2MQJA 4PZ8A 3IBEA 4IG7B 3A0JA 2K9XA 1HNXL 1KD1C 1JT8A 3S2HH 4IOCA 1Y1VH 2E6XA 1IBKL 2JA6G 2MO0A 4W9KA 2PI2A 1X32A 2PZWA 3PLUA 4OEMB 2E76C 2JZPA 4YWKA 1F2LA 3FPUB 1J6QA 5E4WC 1WJUA 5HGQA 4OIKA 4LF7L 1HR0L 1A15A 2KOLA 1TKWB 4BAXA 4A3LG 5C3WA 4FDBA 1L6VA 2NS5A 4ANXA 4MDKE 3WOFA 1HHVA 2IO0B 1TQOA 4BXXH 1L6UA 3VQIA 3T1HQ 3RLNA 4KHPQ 1DOKA 3OW2A 2OWOA 3K80C 1V6EA 3PZDA 1EYGA 4KSLC 2A6HD 3TSSA 1Z47A 3H3VH 1YX6B 5BN3A 1O78A 3KW5B 4LDTD 3N1YC 2B39A 5LMNW 3X3MA 1JJCB 3AEBB 1BDOA 2WX0A 4JYAL 1OXSC 1W3SA 1GD7A 3BS1A 1X3FA 1I6HH 1VD2A 4XZ4A 1EO6A 4RH6A 2PKOA 3K5MA 1PTOH 1K83H 3CCLA 1CM9A 2K1FA 3UQAA 2OT2A 1VQBA 2RSNA 2DBYA 4KGSA 4K3BA 3RNCC 1TWHB 2VZKD 1B9MA 5DM63 2FCSA 2ATWA 3DVGX 4KVGB 1Q12A 5E1FA 1N36Q 3OLMD 1WXAA 3DVNU 2VZAA 3J7ZC 1J7BA 3PRZA 2OOBB 1ESFA 3VR4A 4OZCA 1OEYA 2M19A 1HNWQ 2X6LA 4C3HH 3MHSD 1VZ8A 3A1QA 1WCMG 2EMTA 4BZAA 2ZT9C 4HWIB 4ARCA 3VYRA 5FJ8H 1VDVA 4TVAB 1PYWD 2JWZA 3T13A 3I7FA 3J80E 5AZGA 3KUCB 3NG0A 1GB1A 4X64L 1P0RA 2BPSA 2YEPB 5EE0A 4FNFA 2G3QB 3NELA 4B9KA 3UDFA 1UE6A 3OMGA 5DPWA 1X3PA 4RF1A 2RKSA 2YV5A 5M3FB 4V190 2FUG1 1Y1VG 1NR4A 4L5RC 4EGVA 4JI0Q 3KLSA 3PVLA 2KANA 3PV0A 2INDC 1DOIA 3NZUA 4DR2Q 4RGOS 1K52A 2DAFA 3PUVA 1D5XC 4CKEA 3F2DA 2KWDA 3AEVA 2K7VA 1QOHA 4DV2Q 1U9RA 3DLLA 4WRDA 1GXDC 5E3FA 3CSTA 2J7QB 1TY0A 1JALA 3BDLA 3IFTA 4IALA 2CH4W 2HJ8A 3AMZA 2NZ1D 2B2VA 3NQIA 4I65A 2ZJPA 4A76A 3DHIC 3N1XC 3L3OC 2W3RA 3PLVA 2FHTA 2N88A 4O0AA 2YU9H 2JA7B 2BB5A 3OTOL 2MX2A 2O2VA 4JWSC 1Z7TA 4DR7Q 1NY4A 2FMCA 4YIJA 3ZTDA 5J39A 4DKAC 1YEZA 4GSWA 2OEOA 5KHOA 1GVPA 2VXWA 2CHXA 1TXYA 3GZNI 2OHFA 4WH4A 1WOCA 3W1SA 4YWLA 5JEAH 1NEKB 3KFUA 4MEMA 1I4QA 2JUOA 3K5OA 2VUMH 2N9XA 1DOLA 1PQSA 2KDEB 1WR6E 1ENAA 4X64Q 2B2TC 1VQLA 4DXFA 1FRRA 2PO4A 1WYGA 2RPVA 3V62A 3GE3C 2E8GA 4I6NB 1L1OC 1OTCA 1Q46A 2WACA 4Y7NH 4HJAA 4L1BA 2QF7A 5I6WA 5ISRA 1YQBA 5IGBA 3RI7C 5JPMC 3W2DA 4O42A 1PGXA 3A8IE 5G2NA 3WIMA 4N9F4 4N9TA 1PH9A 3APCA 1S4ZA 3RNEC 3RFZB 3MEFA 5I2XA 3DMUA 4LF5Q 1UF0A 3P63A 3Q23A 1UGJA 5GAEC 3STBC 4IPCA 4CDFC 1SF0A 2CR5A 1P16A 1U4RA 2KDBA 4JG2A 4NNJB 4IWQA 1ZUD2 3SXHA 2PE6B 5LMNQ 4DHJD 2KUMA 4X3KA 1MG4A 2B63B 4KHVA 1PTOF 4EQ5A 4IURA 1WMHB 1BQQT 4ZOHC 1K8GA 3NP8A 3IAS1 1AH9A 3KF6A 4TUUA 3BZDB 2JA7H 1TIFA 2F3WA 3RPFC 5K36H 4L8JA 4ME3A 3DEPA 2MRPA 1K0RA 2BGFA 1DJRD 2Z4IA 2RCNA 2E5LQ 1C0AA 2WS3B 1LTGD 1E8ZA 4DUYL 2LI5A 2N0SB 1O7LA 4FO2A 3L54A 1JW9D 1PLFA 1SB3C 2KJ6A 1K50A 3Q2AC 1PZID 4DK0A 2M00A 1J8IA 4ALPA 2WB1G 2AKWB 1SE4A 1BMLC 2IHEA 2ZXPA 4EX5A 1E0ZA 1KDAA 1PYBA 3U9SA 5D14A 2LASA 3TUOA 2C7MB 2WNMA 1CI3M 2RR9A 4PT5A 4X65Q 3K81C 1JOOA 2GMIC 2PQEA 4KGRA 1U5KA 3A54A 3M9BA 2MCNB 2KCTA 2DZJA 3F1ZA 3L13A 1EWHA 4J15A 3ULLA 2C60A 3GE8C 1RRBA 2NTSA 3KOJA 3W5VB 1C8CA 1WTVA 2D07B 5IP9G 2EE1A 4KV2A 1U4MA 2WXRA 5C0XG 3DEOA 3M7NA 1D1IA 3VDYA 3TEHB 1L1OB 2NPTB 3AEGB 4P7IA 3TP5A 1JMLA 1RTOA 2QKIC 3GZNB 1UEBA 1V5TA 2MBHA 4AQYQ 4IFDG 4LMQD 3BYTB 3K6OA 1SYGA 4RMFA 5D2MB 3R7QA 2WAQE 1V97A 1B4OA 4PZ6A 5CYUA 3HEJA 4K0KL 1TBEA 5HGTA 1BCPC 2RVLA 3ICEA 1NE3A 4OO1G 1YN5A 2FCQA 5C6AA 3CC2A 4G57A 5IOIA 4GKJL 1EF1A 3GB1A 4B3TQ 1B70B 4A8XC 3BY4B 4LJOB 1N5WA 4C3IG 3NTHA 1CK1A 1ICWA 3PSEB 2VW9A 2KECA 4DAYA 1L0VB 1EQTA 2XRSD 1WTWA 3GTLB 3IFDA 3V3XA 4WAFA 4W9JA 1K9MC 3PUXA 3FDTA 1X54A 4P74A 2MHVA 2WQYB 3X23A 2NN6H 3T8MA 2KOXA 4JV5L 4H0LC 1SMXA 4K6DA 1WGKA 2K05A 4IC7B 1JMCA 1NMFA 3O13A 3P75A 4LF9Q 3GOEA 1FEHA 2A4ZA 5LMUQ 4MNOA 1AZPA 2ASBA 3DBLB 2INCC 2INPE 4DFAA 2OTLA 2L0TA 3IFWB 1STEA 2MUYA 4W9FA 1CJEA 2VS1A 2SEBD 2I5LX 3ZXRA 2F0NA 3JAME 3S1MH 1SYFA 2HTME 1WD1A 3R3OA 1WR1A 3K9PB 3KUZA 3AE5B 1ZYRD 1WTPA 2LGYA 1YNTE 4AH6A 2KXJA 4KX6B 3TMEA 4JYAQ 1HQRD 4DK5A 3NOBA 1LTTD 1BUIC 1T0YA 2NVQH 3QX1A 3LNNA 5JH5C 3TQYA 4G0NB 1BOSA 1ENFA 3AULA 1EU4A 1MKHA 3N9YC 3PCOB 5DPRA 5LHY1 1YJ9A 3BVMA 4EVOA 1M90C 1IBML 2CKHB 1V8QA 1PH6A 2KC2A 2SAKA 1E3PA 1KRSA 2R6GA 4J8QA 4OO1H 1A62A 1R9TB 5AJ3Q 4MZ9A 2WDVB 1SNQA 5CR3A 1LM8B 2KTFA 1ONLA 2A69C 1ZE3D 1XTDA 5L83A 3K8AA 4HJ9A 2GB1A 1EYDA 4DV7Q 1NVID 4IM3A 1N62A 2MBEA 5E7NA 3Q8DA 3JSVA 4FHJA 4QIWB 1YNND 1V86A 1YHQA 2GVAA 1VDZA 1S72A 2AWOA 3MEHA 1LV9A 1FNWA 2I5HA 2WDQB 3DDCB 4TRDA 1V8CA 1XQQA 2KLGA 3D0FA 4F87A 2PPHA 4CKBA 2VH2A 4WWPA 4HIOA 2AX5A 2F0WA 2Z6KA 4HMJA 1HTPA 4G3XB 4BBRB 1CZWA 4AIMA 4L5SA 1SSNA 1WX9A 3OAWA 4B6WA 2I46A 4DF7A 3VA7A 1QOFA 5JVG3 1CKMA 2NYZD 3LGJA 1VQ6A 2EMSA 4W9HA 4XIGS 4YWMA 2CW0C 4S3SA 2O6VD 3P4QB 2AQ2B 4YY3L 3QB3A 3FAHA 5HY6A 3T1HL 5DPSA 3TN2A 4EQOA 3I4LA 2BTEA 5C4ZA 4OWTB 4KKUA 3E9SA 4JLCA 2K1BA 2WDTB 2M17A 4NW2A 3AEFB 4DK3C 1KLUD 3P42A 2UUBL 3TP7A 2UUCL 4HPPA 5E6OA 1AW7A 2WAQB 4DAYB 3MXPA 4JVZA 2QDFA 4A3KH 1ZDXA 1WXSA 3T56B 4J3OD 2CW0D 2C7NB 1S5CD 1Y8OB 1MI0A 1QJOA 4FYDA 2EYPA 4IQZA 5A35A 1JQ4A 1TT5B 4ID6A 4UP9A 3PIPA 2IBIB 3RUIB 4OIJA 2L32A 1WXQA 4JI8L 4QGUA 2QCZA 3GTQH 1DCZA 1Y1WH 3M3YH 4X62Q 4QCLA 1WM3A 2YVCA 2L0FA 2NR2A 2ZZPB 3TCAA 2JVCA 4XT1B 4GOCA 2F0OA 1MHXA 4R4CA 1MPEA 3KJOA 1P9DU 3CCVA 1FCLA 3GTMH 1LM0A 3UDGA 4LF8L 4A3CH 1WRIA 2MBBB 2RSOA 1PDXA 4ZYNA 1KTKA 3NXWA 3T4AC 2IYDB 5C0XI 2LKVA 1PRTF 2WV6D 1FGUA 2PIAA 4LF9L 4OELB 1I3QB 5CMDA 1Y69U 2ICIA 3I3TB 4HDQA 2M56B 1CKNB 1LT4D 3UE0A 4YL8A 2D3AA 4CQNA 4GN3B 5M5YH 3CCQA 4WJWA 3D8GA 3S2DB 1E7UA 1TGZB 1YHAA 1CHPD 4IM2A 2UUAL 4C3HG 2K5VA 3NZ3A 1EFWA 1WCMB 2FFKB 3W1GA 1CUKA 1LACA 2UXDL 3JAMi 3G6JB 2CQOA 3QG1A 1JOKA 4ITKA 2F0PA 2PVGC 3MXUA 1VR9A 1FRDA 3MC0B 2C35B 4A93G 1KDBA 1B2TA 4HPLB 4YHHL 4DBGA 1EWYC 4JI8Q 2XK5A 1A63A 2B76B 2ONQA 4GZYC 3GTOH 4KY5A 4LNFA 2VY3A 4AWJA 3MWYW 5C4HA 5GMVA 3B6YA 2E2JH 2C5LC 1H9KA 3AFPA 1TWFB 2A69D 4QUCA 3GTJH 1XMQL 3I5JC 4MGYE 1Q0WB 4W9CA 1PA6A 1TWHH 3NK9A 4KKJA 1UWVA 3M3JA 1RF2D 4FN2A 3NENA
chains in the Genus database with same CATH topology
1GOZA 3VRAB 2FINB 4XT3B 1GUNA 5IT9L 4HAEA 5G3LF 1PFMA 4FXGC 1F2RC 1ZP0B 1ET6A 2O5IC 1SJHD 4RGNA 5HFYA 3NVVA 3IL8A 3DWQA 2IL8A 5EQ0A 4A3FB 3I4MB 1KH0A 3B2GA 3GTGB 4A3BB 2K01A 2PTLA 4NKLA 3H0GB 2B2TA 1WTRA 4HMIA 1WD0A 2WP9B 1E10A 1PFBA 4MHEA 1TS3A 4K6LA 1STNA 1STGA 1C4PA 2PPBC 1WSPA 1ZYRC 2W3SA 3HOYB 2BA1A 4BS9A 3MXNA 3I73A 2Z1CA 5CBAE 2XSCA 3VR9B 4WWMA 3MA2B 1IBXA 4IOIE 2R7ZB 3NWTA 2M0AA 3LYYA 3D31A 3PIO3 1T5XD 5C0XJ 2B2YA 3BIID 4ZUJA 1EY9A 1NI3A 1EY6A 4IFDI 1CA6A 3OSOA 1EL0A 4DXGA 1SYCA 5EE9A 2N9LA 1JQYD 2BT6A 3BDOA 1J7CA 4C3JB 5DEHA 3AU7A 1BF4A 5BYRA 2IGHA 3SVMA 2I38A 4ZLTF 3ABVB 2LS01 4KGTA 2TSSA 1JWSD 4PMWA 1ZXHA 5H92C 1JRPA 1EU3A 1TWAB 3P1MA 2FE8A 4YSZB 2PW7A 1FD6A 3DXJC 2JYOA 2ZW1A 4RA8A 1TS4A 3MZ5A 2K33A 3VR3A 2L1BA 2Q8TA 4DA2A 2NVXB 1JC7A 2A68D 1SNDA 3OPOA 2BS4B 3N52A 1XXGA 1JWUD 4R8IA 2F1MA 3EUB2 3TEYA 4IUNA 4C56C 2M2LA 5KEEA 4GLSC 1U4PA 1Q8IA 3OWFA 1A2TA 1A6XA 1TKGA 2WIIB 1C78A 2MGSA 3W9CB 3IT4B 2HCCA 4K2LA 2K5QA 1TJEA 4P16A 1C9FA 2E2DC 3Q6SA 4NAMA 1U4LA 1Y8PB 1WTXA 3URYA 3R2IA 1N60A 2ZW0A 2B8FA 3ND8A 1SE2A 5EPKA 3GP7A 4G4KA 4ULLA 4XDCA 3I9V1 3N6RA 1TS2A 4BBSB 3IT6B 1QOBA 4ZRQA 5KYIA 2NUCA 5MPOA 5D3IB 4C2MB 1STBA 1SYEA 3FPPA 1AWDA 1HFNA 3TP8A 2EY5A 2CHBD 4FF3A 1Q1BA 2C5CA 5ELCA 4L23A 1F2MA 2KA7A 3OIPA 4K5VA 3G7LA 4IUQA 4XXEA 4A3EB 3HOZB 1OXUA 1WVLA 3F2UA 3KK7A 5FR3A 2DYOA 5EJWA 5I2YA 2L4NA 2MJDA 2PCFB 3SK8A 4DQOC 2ZXOA 3A55A 1A3TA 2AUKA 4JWUC 1JICA 2CJNA 1LTAD 3MFGA 1QLBB 5ELEA 4JBWA 2D9UA 3V05A 5F2DA 3NVZA 3WOEA 1LT5D 2NVTB 2F03A 4H44C 2N0SB 4DAVA 2EJFC 4OGQC 2L5TA 3LWUA 1TIID 3FMCA 2K6AA 1TY2A 2K5DA 1KFYB 1MSHA 3OOCA 5C3EB 4PQXA 5GXGB 1QF6A 3FC4A 2ID0A 1B50A 1DONA 1KABA 1TT2A 1MVKA 3HRZC 4FXCA 5CORA 2MH7A 2KN4A 1ZXTA 4KY6A 3IAYA 1KNEA 1YQ3B 2DY8A 4IDIA 4FF2A 2VZKB 3M85A 1I4RA 2MPMA 1CA5A 1H9MA 3HGBA 3NTIA 4P2CB 3NQTA 3DWGC 2EOTA 4CBVA 1HXYD 2EY2A 2JA8B 2B2UA 3E6ZX 5BYQA 1E0BA 3L4PA 2JQRB 2KEEA 3HVZA 2BB6A 1I4GA 3CHBD 3Q8AA 1EOTA 1EZ6A 1QOAA 3KLSX 1T3QA 3BK2A 1UWMA 1PRTB 1J7AA 4HTHA 1SMYD 4XTCS 1SYBA 4DK1A 3RUZA 1IYUA 1OFFA 2F0SA 1FO4A 3HS0C 5FLXE 2XVSA 5CV8A 5I4DA 2JP1A 1TZOA 3GTQB 3QOLA 3VYSA 2NVYB 3VYUA 3J80L 5C3JB 3PO3B 3LB8C 2NMQA 1YNNC 2RMMA 2EYMA 1PMRA 2RDHA 1R7SA 4B08A 1YN3A 4LAAA 1IKLA 1NYRA 1FFUA 2BYTA 3S15B 5EKKA 4N9PA 2C9OA 4ABNA 2NTTA 3GO5A 3EJIA 3EVQA 3GD7A 5D7GA 1BO0A 1G91A 2MJ8A 3R8BA 2NBFA 1R4QB 4HKZE 3EQLC 1NENB 2F0IA 2HQEA 1LLRD 4FP5D 3E56A 1JCKB 3NTKA 1ILPA 1SDFA 3GTOB 2XWJB 5HI1A 2J0TD 1D1KA 4R3DA 1VMCA 1FR3A 4X3TA 3T3NA 4YSXB 1E2WA 1SE3A 2WXGA 1OQRA 3L9AX 1IHZA 1YN4A 1FM0D 2GI9A 4YTPB 2QMTA 2XWBB 2L9HA 2NN6G 2J42A 3PUYA 3S2HB 3I91A 1F2ZA 3H94A 3AE1B 3DM1A 3FVQA 1LT6D 2JSOA 4BWGB 2QEJC 2QDBA 1K53A 4NAWB 1SJED 4ZAIA 2EKIA 3MHBA 2B2YC 1JWAD 2XRQD 1LO5D 1AEXA 1O7YA 4KN4C 1SAPA 4EE2A 1D5ZC 5TSSA 2K22A 1CT1D 1KLGD 2JEAI 3D6WA 4KHZA 1DYQA 2H89B 1RKNA 2EY1A 4C1NK 4LTUA 1STYA 3M4YA 2EVBA 4PMBA 5C4XB 2JX5A 1OXVA 3AE7B 2E2HB 1JOQA 1QWYA 3PZ7A 1NAPA 2EYFA 5T1GA 1WWTA 5G5GA 2B8GA 4KKSA 4IKGA 1B9RA 4N59A 3P4SB 3NBIA 1HUNA 3U7ZA 2PMZB 3ITPA 1BCPD 1BBXC 2LY7A 3CWIA 2B2WC 4K14A 1RJTA 1QOGA 4TKOB 3AE8B 4CJ0B 3VR8B 1AZQA 2L55A 1CZGA 4Q2JA 2K04A 2JSVX 4ZRPA 1A3UA 4MACA 1PXUA 1FD7D 2CU3A 2X6GA 2EY6A 4CHTB 1XWEA 2K0PA 5FKAC 3SE0A 1VMPA 4G7OC 3DUZA 2KQ3A 1HA5A 1SMYC 2O5JC 2A68C 3MAQA 3EGRA 3IXSA 3H3VC 2D62A 3ZJTA 2EZVA 2QJLA 4A93B 2JWUA 2A73B 2QCPX 4CKCA 1PGBA 3TEXA 3FILB 5HURA 1UEAB 3MP9A 1M8AA 2I07B 2JA5B 2BE5D 5ELFA 5E6JA 2WINB 4RCOA 4NDXA 3C8YA 4XWTA 5M9OA 1B44D 1JWBD 1NCVA 4LJZC 1X3QA 2VB3X 2IGGA 5IGFA 4DU9A 5CC4A 3TDQA 1LTRD 2H4OA 1PUTA 1Q90A 4F88A 5BMIA 3KUPA 3FEWX 1OQQA 1K83B 1PTOB 2LHDA 5D65A 2IW3A 2JXTA 1D4BA 3BVGA 1CHQD 3K57A 1SBBB 3C2PA 3K5LA 4UAIA 3D4RA 1H9JA 1QG7A 3DWMA 3HOWB 2BW2A 3ZJUA 4HJGE 1JWMD 1VF7A 1B53A 1ENCA 1PFNA 4KMUC 1FXIA 2DLBA 4ZHPA 3HG9A 5T8IA 1E9MA 1G2TA 3H09A 4ZK9B 4OVZA 1ET9A 4A9AA 1FXAA 1GUSA 1MGSA 5G5HA 3SHLA 4X3SA 2IX1A 1HRJA 2HDLA 3SK4A 4N58A 2PNRC 4A3DB 2KHSA 2PW5A 1BUVT 3AECB 1I4XA 4L63B 2SOBA 4XQNA 5COYA 2BDOA 4NMZA 2L12A 3Q8FA 1CQVA 1V1PB 1AP0A 1V1OA 1OO9B 2QILA 4C80A 5IGCA 1YJJA 5EE1A 5EGTA 3KWVA 3SR6A 4OZBA 2G9HD 3VR6A 5FO7B 5IOCA 3FILA 3HUIA 4OL7A 3T16A 2F0UA 3DHQA 2HCIA 4OZAA 2MP1A 1RD9D 5NUCA 2N55A 3BWUD 3AE2B 3VRBB 1ZOYB 2BDNA 3S14B 2L0CA 1TU2B 3SEBA 1Y56A 3I4NB 2Q8IB 1EYAA 4AS1A 1A2UA 2CJOA 2XNAC 5I6YA 3MHZA 4P6VF 4KI0A 1B3AA 2LJIA 1ZEQX 2J4XA 1VF5C 3SK6A 2F0QA 1QB5D 3S17B 3AE6B 1KNAA 4KJNA 1LTID 1PFDA 3GS2A 1F9RA 2BS2B 4TQUS 3ETRA 1J9OA 1ZDVA 4C3IB 4RKLA 2JE6I 3D3RA 1EY8A 4KN7C 5DAUA 2L1AA 4I7ZC 1RHPA 4G7ZC 2VUMB 2NN6I 4V0BA 2RBMA 4DN4M 1GHKA 2Y0SB 3CRKC 1RDPD 3UI3A 4B9WA 1D2BA 3EROA 3NUHB 5FOBB 1NR2A 4ARIA 2F0DA 4IUTA 3VR2A 1RFKA 4G7HC 1XTCD 5ELDA 3BVZA 1SNPA 4HKQA 1TWCB 3AEDB 1C76A 4C7YA 2B2WA 3DWAA 2LEKA 4NZLB 1E2ZA 2WKDA 2NB0A 4RF0A 2WXFA 3PZ8A 3U4EG 1VCIA 1ILQA 5AUKA 4HR7B 4NJCA 4M0WA 3S16B 2KQ4X 5IGDA 3HKZB 1DZ1A 4K2KA 3H8HA 1PGAA 3NVYA 4XDDA 4AQ7A 3OWEB 1TKYA 1V43A 3WCQA 3CRLC 4B9XA 4XQQA 1EWCA 1A70A 1HFGA 3FRPB 4KD3A 2F0KA 2WP8J 2LUMA 1Y8NB 3OMCA 1QQRA 1HQMC 1ROEA 2DYMA 3I72A 4LLGM 4X3UA 3SFDB 4K5WA 3DWPA 4A3JB 5KYLA 5M5YB 4A3IB 2SNMA 4GDLB 1C4AA 3AV8A 4RGMA 3SR1A 4RNAA 1RWSA 3U2SC 4DNRB 1JE4A 1K8OA 3HOUB 2V0GA 3NBHA 1L4ZB 1FNVA 1QNKA 2V3PA 1D5MC 1GUOA 5KNDA 1N63A 4LK0M 5HHDG 1CZPA 3A7AB 4UDUC 2JEBI 3EFXD 1HEZE 1Z6HA 3LX0A 2V4IB 2F0EA 4IUUA 4IUVA 4FVMA 3ZJVA 1G2SA 3V96A 1EY5A 5J22A 3AE4B 1II3A 2K32A 1EIHA 5LL6X 3TP6A 2EELA 5EBCA 3V2TA 1PZJD 1FYCA 4RCNA 1Y1VB 2Y3AA 2BE5C 5JPNC 4HSVA 4Z9CB 3TZUA 5K5PA 3HP3A 1BR9A 2PYKA 2LHEA 3W3AA 2F0HA 3AH7A 2INNE 2L11A 5KNBA 1UAPA 5FO8B 5JVH3 2F0VA 2NWGA 2EDGA 1CTMA 1PTOC 1UUPA 2O2LD 5HG2A 1IKMA 2IDYA 3QO2A 3PUWA 1HCZA 4HEDA 3NUCA 1M4VA 2FMMA 1DOYA 3NVWA 4D2KA 1DGJA 1I6HB 2HDMA 2K5PA 3MVVA 1JORA 2EPBA 2Y5PA 2JA6B 2F0FA 1I4HA 2W54A 1GUTA 1Y1WB 3M3YB 2R61A 4US8A 1AN8A 1GAQB 4J6HA 4NP5A 1DXMA 1ML0D 5EBDA 1F9PA 3C1EA 2JU6X 4H13C 4C3HB 1ZKOA 3GQBA 4MH8A 2LFNA 1PRTC 4C7ZA 5IIFA 1QE6A 4RAUC 1JB3A 1TR5A 4JK1C 5DM73 3CIRB 4HCSA 1LTSD 4WORA 2RDFA 1MSGA 1R4PB 2O4XA 4RGTA 5D3DA 2IJ0A 2ENBA 4F7XA 2X38A 1XCQL 4L2YA 1SNCA 2ICEC 1BCPF 1ZPSA 5BN4A 4CJ1B 4MN3A 1AYFA 3J7AV 5CGKA 1UWXA 2BA0A 5C3XA 4ILWA 2IGDA 4IN3A 1EY0A 3GTKB 1SSOA 1IL8A 3W5UB 2F3VA 3K58A 4XWWA 4DAPA 1CFMA 3OHXC 2J7ZA 2PZUA 1IGDA 1C77A 1V1PA 5E4XA 4B0EA 2B2UC 3BK1A 5A2QL 4PV1C 3T3OA 1IBXB 2JYTA 2E74C 3CKIB 2KAJA 1PZKD 3S1MB 4Y7NB 3AEAB 4CJ2C 2QSDA 1KAAA 5LNK1 1HUMA 1B1ZA 1L4DB 4MT5A 4JX1C 2AQ3B 4O1NA 2A6EC 3ZYYX 1DOXA 3PMFA 2E75C 1TYGB 2BCOA 5EKLA 4ZKCB 3RMHA 1MD2D 4KV6A 5C5MA 2WU2B 3BYYB 5CV9A 1YNJC 2FBWB 2K5WA 4U68A 3E0JA 5I9PA 5BMHA 5M5WB 1I50B 5LL6S 1YNJD 1H9SB 5AFWA 3ONAB 4L6TB 3VA5A 2GRIA 1NUCA 1Q3LA 4ZUIA 3J81E 5CV6A 2K03A 4KKIA 3P7JA 1L5PA 3T51B 1G8ZD 1SNMA 1I6VC 5FLXL 3TEWA 3L7ZC 2F4IA 3KLRA 3RD4A 5KIXA 1HA6A 4XYOA 2EXZA 1TKEA 5FO9B 3C46A 2YYZA 2SNSA 5IODA 4U673 1S5FD 1G6ZA 3OW7A 4K8JA 5DNFA 3GV3A 3HOXB 3VYTA 1HPCA 5JAVA 2CVRA 2EYOA 4R9WA 1XYIA 5EPJA 1EFID 4PNYA 3J7AF 3HVDA 3PO0A 3P1HA 3IKJA 3NE5B 1FGBD 1P7FA 5G3LD 3AMUA 4TMAB 4HCEA 2WXQA 2DWQA 2JXMB 2A6HC 5M5XB 1HZ6A 4KK7A 3AE9B 3NSWA 4Q0FA 5BN5A 1S5ED 1XEEA 3A7LA 4ZYSA 1STAA 2DNEA 2PVOD 3QJYA 1TWGB 2CQAA 2D2CC 4ZQ3A 1EM7A 3Q8CA 2J53A 1GHJA 3H91A 1FIQA 1XX8A 1A3VA 4FF1A 2EJMA 4TSSA 2FJ2A 4XYQA 3B2FA 3GV6A 4IUPA 4C3JG 2Z8LA 3S1NB 3Q69A 5JJZA 3Q8BA 1F77A 5K36G 1PTOD 2E2IB 5C2TB 4ODGA 1F2YA 3JAML 5JXVA 1OXTA 3KWLA 2LMCB 5KGUA 4GDKB 4QB4A 4QUFA 1YMHE 4MM3B 4YTNB 1AFPA 3FKIB 3GTJB 2WB1B 1F9QA 3M7GA 1S5BD 3BDCA 1F9SA 1XLQA 5EE3A 3K59A 2W55A 2WXLA 3D4WA 2WXIA 4A3MB 1MHHE 1L0YB 4RHRA 4K5XA 4YT0B 1C4CA 3NHHA 1C4QA 1EIGA 1GUWA 1IYVA 4QMGA 3Q8EA 4KY7A 3LXFA 1SEBD 3S1RB 1FFVA 4ZHOA 2RDGA 4XDXA 2PZTA 3KBGA 1XCTL 1LT3D 5T1IA 2WXNA 1C79A 1TS5A 1ZXIA 3CQZB 5KNCA 3KBXA 2E3TA 1XF5L 2A74C 3QWNA 2KDMA 3D4DA 2MJ3A 1XLOA 1XO3A 3A56A 1F0ZA 5FK9C 1W6JA 5EKIA 1HZ5A 1MI2A 2YEPF 3HRDD 1XLNA 3NS1A 1NYQA 1DM0B 2ACZB 2N9KA 3HOVB 1TVXA 2K28A 1MBYA 2J52A 4ME5A 2V3NA 2BTEA 4RHSA 4HROA 2Q8RE 4A3KB 2SDFA 5C4JB 1I7HA 3PO2B 1B9NA 2B2VC 4EQNA 2R3ZA 4DNTB 2G1EA 3CU7A 5JEAJ 1CQFA 3ND9A 4US9A 4KD4A 3J9CA 4YWGG 4M8AA 1RYJA 4KJOA 3UI2A 4BA2I 3Q0AA 4HEA1 4PMCA 2R93B 1GUGA 2DN8A 2KMMA 3PUZA 1YQ4B 2EYLA 1GPXA 1KDCA 2A5HA 2KCNA 5CV7A 1EY4A 3TZDA 4A6QA 4WURA 1FNUA 2F0MA 4YSYB 2WXKA 3SFEB 2QIEB 2DY7A 1RCVD 1XLPA 3P20A 5J1ZA 2YU9B 3T53B 3K5NA 2WXOA 1QCBD 4TQ0A 2KEDA 4RFBA 2F0LA 4BY1B 4E6IA 3D6CA 1SNOA 4FXDA 2OEDA 3MXGA 4EQPA 3GTPB 4KTAA 2WLBA 3NWSA 2L83A 1IGCA 2D5DA 4XQJA 4JE3B 2WDRB 4YTMB 1EEID 2H88B 1S5DD 4C1NI 1UNSA 1F2RI 5A2QE 4FXKC 2LMCA 1QNUA 2EJGC 2XN9C 1WTOA 2WXHA 1N61A 3I90A 5IGEA 3Q22A 3WDNA 1EYCA 1IW7D 3AB9A 4BA1I 1T6BX 3PIP3 2K3UA 2VB2X 1E6EB 1W6KA 1K8MA 3U52E 4A90A 2WU5B 4ZKBB 3P4PB 2F0GA 2GA4B 3R93A 5CV4A 1IW7C 2LGIA 2BBCA 2KACA 1YJIA 2IX3A 3AM9A 1LTBD 2H1EA 2AUJD 4A55A 1G291 5M3MB 4QF4A 5C0XH 2NVQB 1QILA 2BS3B 4OW0A 2XIWA 2OF1A 2ON8A 5BYSA 4IZ8A 2N7JA 1EQVA 1ESRA 5JEAG 4Q5VA 2Q5WD 3LWEA 3Q24A 3I8ZA 4N6EB 5IT9E 3AB5A 3NRZA 5H8YE 4CGYB 2PW9A 3AE3B 4ZRZA 1FCCC 4B0MA 1KF6B 5IGGA 3GTMB 1E7PB 4WIPA 3I3CA 3VR5A 5C5LA 1K51A 2WXMA 5EPLA 5BMGA 1STHA 1H9SA 1HTLD 1RODA 2X69A 3M4OB 2AWNA 1ACCA 1LABA 4RKBA 1EY7A 1KRHA 1JROA 2BOSA 3I70A 1N5XA 2WXJA 2EYJA 3R2TA 2Y5CA 1RTNA 3K0YA 2A6ED 4WFN3 4HRSA 3AEEB 3HZXA 3P4RB 2IPKD 4M1UB 1NSNS 5C44B 2VNUD 1E2VA 1L0XB 4MIUA 2TMPA 4XE0A 1VZ7A 2L52A 2F0TA 2E2JB 3NPPA 1H9RA 2KCCA 1RM6C 3SDZA 4R8NA 1SFOB 2R92B 3J81L 3RLFA 4WQMA 3C3LA 3I57A 2OXPA 2LFIA 3MTSA 4F8MA 3IAM1 2WXPA 1OXXK 1BXTA 1FMAD 3A8KE 1VZ6A 1GJXA 1PDQA 1C48A 2IX0A 1JR0D 4IFDH 1QKZA 2IWHA 3E5SA 3ERQA 5JOBA 3TEZA 2RQXA 1BNZA 5KRUA 5CV5A 3X3NA 1WTQA 2DNCA 4IFDJ 3MFYA 3C1FA 3QOJA 2ZXRA 3QIAA 3EA6A 3KF8A 3K7AB 4HN7A 1VRAB 4H7BA 3MJ5A 2WKCA 3AN1A 4BY7B 4OO1I 2HDEA 1T5EA 2KJXA 1I4PA 2W82A 3ZGZA 2JYEA 5ELBA 2MJEA 4DGZA 4KKTA 1BCPB 1EZ8A 4A3GB 2M9VA 4J1MA 4JPSA 3KQ4A 5AUIA 3RZOB 2D5GA 4REZA 2KVMA 2PLPA 2F0JA 1SYDA 4YXDB 5I9OA 1PRTD 1SXTA 1IUEA 1VLBA 4USAA 3H6MA 1O80A 3S9WA 1QT9A 2PMVA 3SK5A 2AQ1B 1DOMA 1O7ZA 5CBEE 4FF4A 3TBIB 3ZQ4A 3A8JE 4HSPA 3BG3A 2G9DA 4K8IA 3B9JA 1Q1EA 4RWSC 1SIJA 2RA4A 3U9OA 4H2AA 4TQ1A 1VJKA 1Q10A 3S1QB 4LK1C 1D6EC 2I2YA 3OIQA 2HUGA 1GB4A 2MEKA 3J7YW 2V4DA 4OHJA 1EEFD 4AYBB 2Z4HA 1DD2A 2IT1A 1P7EA 2EYHA 3RZDB 2K9XA 2E6XA 1X32A 2PZWA 2E76C 2JZPA 1F2LA 3FPUB 5E4WC 4OIKA 1A15A 2KOLA 1TKWB 5C3WA 1L6VA 3WOFA 1HHVA 1TQOA 1L6UA 3VQIA 1DOKA 2A6HD 3TSSA 1Z47A 5BN3A 1O78A 2B39A 3AEBB 3X3MA 1BDOA 1OXSC 3BS1A 4RH6A 2PKOA 3K5MA 1PTOH 1CM9A 2OT2A 2RSNA 2DBYA 4KGSA 1TWHB 2VZKD 1B9MA 5DM63 1Q12A 5E1FA 1J7BA 1ESFA 3VR4A 4OZCA 2M19A 2X6LA 1VZ8A 2ZT9C 4ARCA 3VYRA 1VDVA 1PYWD 3T13A 3J80E 1GB1A 2YEPB 5EE0A 4FNFA 3OMGA 1X3PA 4RF1A 2RKSA 5M3FB 4V190 2FUG1 1NR4A 4EGVA 3KLSA 3PV0A 1DOIA 4RGOS 1K52A 3PUVA 1D5XC 4CKEA 2KWDA 2K7VA 1QOHA 1U9RA 4WRDA 1GXDC 5E3FA 1TY0A 1JALA 3BDLA 3IFTA 4IALA 3AMZA 2NZ1D 2B2VA 3NQIA 4I65A 3L3OC 2W3RA 2FHTA 2N88A 2JA7B 2BB5A 4JWSC 1Z7TA 2FMCA 4YIJA 5J39A 2OEOA 2VXWA 2OHFA 4WH4A 3W1SA 5JEAH 1NEKB 1I4QA 3K5OA 1DOLA 1ENAA 2B2TC 4DXFA 1FRRA 2PO4A 1WYGA 2RPVA 2WACA 4L1BA 2QF7A 5I6WA 5ISRA 5IGBA 5JPMC 3W2DA 4O42A 1PGXA 3A8IE 4N9TA 1S4ZA 3RFZB 5I2XA 3DMUA 3P63A 3Q23A 1UGJA 1SF0A 1U4RA 1ZUD2 3SXHA 2KUMA 4X3KA 2B63B 4KHVA 1PTOF 4IURA 1BQQT 4ZOHC 3NP8A 3IAS1 3BZDB 2F3WA 3RPFC 5K36H 4L8JA 3DEPA 1DJRD 2Z4IA 2WS3B 1LTGD 1O7LA 4FO2A 1JW9D 1PLFA 1SB3C 1K50A 1PZID 4DK0A 2M00A 1J8IA 1SE4A 1BMLC 2ZXPA 1E0ZA 1KDAA 3U9SA 5D14A 3TUOA 2WNMA 1CI3M 4PT5A 1JOOA 2PQEA 4KGRA 3A54A 1EWHA 2NTSA 3W5VB 1C8CA 1WTVA 2EE1A 1U4MA 2WXRA 5C0XG 3DEOA 3M7NA 1D1IA 3AEGB 3TP5A 1JMLA 1RTOA 2QKIC 4IFDG 4LMQD 3BYTB 3K6OA 1SYGA 1V97A 1B4OA 5CYUA 3HEJA 5HGTA 1BCPC 2RVLA 1YN5A 4OO1G 5C6AA 4G57A 3GB1A 4A8XC 1N5WA 4C3IG 3NTHA 1CK1A 1ICWA 2KECA 4DAYA 1L0VB 1EQTA 2XRSD 1WTWA 3GTLB 3IFDA 3V3XA 4WAFA 3PUXA 3FDTA 2MHVA 2WQYB 2NN6H 4H0LC 4K6DA 1WGKA 2K05A 3P75A 3O13A 1FEHA 1AZPA 2INPE 4DFAA 1STEA 2MUYA 1CJEA 2SEBD 2F0NA 3JAME 1SYFA 2HTME 1WD1A 3R3OA 3AE5B 1ZYRD 1WTPA 1YNTE 4KX6B 3TMEA 1HQRD 1LTTD 1BUIC 3LNNA 1BOSA 1ENFA 3N9YC 1EU4A 5LHY1 3BVMA 4EVOA 2SAKA 1V8QA 2R6GA 4J8QA 4OO1H 1R9TB 2WDVB 1SNQA 5CR3A 1ONLA 2A69C 1ZE3D 2GB1A 1EYDA 1NVID 1N62A 4QIWB 1YNND 1VDZA 2AWOA 3MEHA 1LV9A 1FNWA 2WDQB 4TRDA 1V8CA 4F87A 4CKBA 2AX5A 2F0WA 4HMJA 1HTPA 4BBRB 1CZWA 1SSNA 2I46A 4DF7A 3VA7A 1QOFA 5JVG3 2NYZD 4XIGS 2CW0C 4S3SA 3P4QB 2AQ2B 3QB3A 3FAHA 3TN2A 4EQOA 3I4LA 5C4ZA 4KKUA 3E9SA 2K1BA 4NW2A 3AEFB 1KLUD 3P42A 3TP7A 1AW7A 2WAQB 3MXPA 1ZDXA 3T56B 4J3OD 2CW0D 1S5CD 1Y8OB 1MI0A 1QJOA 4FYDA