1TS3A

H135a mutant of toxic shock syndrome toxin-1 from s. aureus
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
194
structure length
194
Chain Sequence
b'STNDNIKDLLDWYSSGSDTFTNSEVLDNSLGSMRIKNTDGSISLIIFPSPYYSPAFTKGEKVDLNTKRTKKSQHTSEGTYIHFQISGVTNTEKLPTPIELPLKVKVHGKDSPLKYWPKFDKKQLAISTLDFEIRAQLTQIHGLYRSSDKTGGYWKITMNDGSTYQSDLSKKFEYNTEKPPINIDEIKTIEAEIN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TOXIC SHOCK SYNDROME TOXIN-1
publication title Structures of five mutants of toxic shock syndrome toxin-1 with reduced biological activity.
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Toxin
total genus 60
structure length 194
sequence length 194
chains with identical sequence B, C
ec nomenclature
pdb deposition date 1997-10-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02876 Stap_Strp_tox_C Staphylococcal/Streptococcal toxin, beta-grasp domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.110 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1ts3A02
3.10.20.120 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1ts3A01
1L0YB 1BCPF 2O2LD 1D6EC 4L63B 1CT1D 1EU4A 3EA6A 1V1PA 4DXGA 1HXYD 1PRTF 1TY2A 1BXTA 1SJED 1JWUD 1I4QA 1GOZA 3DWPA 1FD7D 1PTOH 3DWQA 1LTAD 5D3IB 1RD9D 1JWSD 4NZLB 5ELBA 2SEBD 1B44D 1LT4D 1BCPC 1PTOB 4RCOA 2QILA 1ET9A 1AW7A 1TY0A 1I4PA 1EWCA 1LTGD 2G9HD 1ESFA 3V05A 3EFXD 1S5FD 1JCKB 2AQ1B 2J4XA 2CHBD 4DXFA 5ELEA 1PZJD 1RCVD 1SBBB 5TSSA 1D5ZC 1I4RA 1FNUA 4RHSA 2XRQD 2RDHA 1I4HA 1DJRD 1G8ZD 3BYTB 3OWEB 5FK9C 1CHPD 4RGNA 2QEJC 5ELFA 4RFBA 4RHRA 3R8BA 1FNWA 1TS4A 1FNVA 2TSSA 1B1ZA 3W2DA 1PTOD 1LTID 1M4VA 4K6LA 1S5CD 1S5DD 4RGOS 3MC0B 3O13A 4RGMA 1TS2A 4ZYSA 1PYWD 1UUPA 2AQ3B 1MD2D 1KTKA 1HA5A 1DYQA 1CHQD 2WV6D 3BVZA 4RGTA 1CK1A 1JQYD 3TSSA 1SXTA 3URYA 2XRSD 2XNAC 1PTOF 4UDUC 4TSSA 1I4XA 1PZID 1SEBD 1JWMD 1SE2A 1BCPB 2AQ2B 1T5XD 4L6TB 4BWGB 2NTSA 1PRTB 1SJHD 1TS5A 1TS3A 1AN8A 1D5XC 5ELDA 4OHJA 4C56C 5FKAC 2ICIA 3R2IA 1LTRD 1PTOC 4O1NA 1RDPD 1I4GA 1QILA 2XN9C 1LTSD 2RDGA 3MFGA 2NTTA 5I4DA 3SEBA 3KLSX 2Z8LA 1V1PB 2IPKD 3CHBD 4RH6A 1EU3A 1SE3A 5D3DA 1S5BD 1YN3A 1ET6A 2IJ0A 1BCPD 1CQVA 3BVMA 4Z9CB 1KLUD 1LT6D 1LLRD 1LT3D 1PRTD 1JR0D 1S5ED 1STEA 1EFID 1D5MC 1KLGD 1PZKD 2R61A 1HTLD 3DWAA 1FGBD 3R2TA 1HQRD 5ELCA 1LT5D 1SE4A 1V1OA 1PRTC 3BZDB 1LO5D 3GP7A 1L0XB 1XTCD 1LTTD 3BYYB 1EEFD 1YN4A 1ENFA 1F77A 1UNSA 3BVGA 1LTBD 1YN5A 1RF2D 1EEID 1XXGA
chains in the Genus database with same CATH superfamily
5KEEA 1GAQB 2H4OA 4DV2L 1WTOA 1PGBA 1EIFA 3QK0A 4HRSA 1VMCA 1WTXA 1PRTF 3APCA 1E2VA 2RPQA 2D11A 1SYGA 3S2DH 2NZ1D 4JV5L 4GN3B 3ML9A 1Z9FA 4OEMB 4PNYA 4AUQC 1F2RC 4C3JB 3Q2AC 1FD7D 2B2UA 3PO2G 2ZZPB 2B39A 2BYTA 5D3IB 3U4VA 4JOIC 4I6PA 4DHJD 1SNQA 4RCOA 3U8ZA 4ASWC 1E24A 1CA6A 4A93G 2BB6A 1U4LA 4W9FA 2WQYB 3N32A 4KDLB 2WU2B 4H2AA 4TKNA 2M8SA 3K0XA 4XYCA 1GUOA 2QDFA 2R7ZB 2EXDA 2E2IB 2Y0SE 4R4TA 3KDFA 3K57A 3I3TB 5C3JB 1UE6A 3Q8DA 4PYZA 3FRPB 2KQ7A 4ANXA 3AEAB 1JRPA 2BWES 3DVGY 4S17A 3U4ZA 2ACZB 5C44B 3J81i 2DJGC 1UE1A 4B0MA 4LDTD 2VXWA 4ILWA 4I65A 3VRAB 2ZVOA 3DHIC 4KHPL 1CKMA 1XNQL 3W2DA 1NE3A 1LTID 1FMAD 1AE3A 3PREA 3PUXA 4DV0L 5LNK1 2BS4B 1GG3A 2DWQA 3RULA 1X55A 5ELOA 1WTWA 1N8RC 5ISRA 1Q1EA 2EYPA 3ND8A 3SVMA 1VQNA 3CD6A 4BFRA 1J5EQ 4J8QA 5GROA 2DENB 1Y8PB 3E6ZX 2LMCA 4MGIE 3MVVA 2GN5A 3S17H 1EYDA 1OXUA 2F0EA 1YQBA 2K6QA 4GDLB 3IFDA 2EYHA 5DPSA 1C7YA 1VQLA 3SFEB 2B3GA 1CZWA 1BCPB 4R4QA 2A6EC 3I56A 4OZBA 1TGZB 2AL3A 2HDLA 1Q1OA 2A68C 1Q46A 3OMCA 4FBJB 4NJ7A 4DUYQ 3MXUA 4X66Q 5E7NA 3CF5A 1UWVA 4LK1C 2EIFA 2VQEQ 2K6DB 5FLXL 4IFDH 2I5LX 2DNFA 4LF9L 1GUAB 4LF7Q 4BKTA 3RI7C 1PVOA 4TUUA 1ESRA 5IYDH 3R3MA 2IO2B 1WX9A 2JA8B 2RSUA 1LACA 1PH2A 2WKCA 4OVZA 3IG3A 4EE2A 1L2FA 2ZXRA 4KVGB 1F2LA 4FF1A 1WXSA 1SIJA 4W9CA 4A3MG 4OVUA 3ONAB 5IE8A 1ASYA 4QUFA 1LT3D 2QKIC 4K2KA 4HPLB 1STAA 4EVOA 2E75C 5JVG3 1KLGD 4IFDG 4EGVA 2KC2A 1RWSA 4MN3A 5LMNL 4H44C 4KD4A 4LCDE 3STBC 4J15A 4BY7B 3F1ZA 3PQIA 1WWTA 1YJ1A 2GOWA 3PIOA 5IYDG 1MSHA 5CBEE 2LFNA 3UINB 3UDIA 3PLVA 4GLSC 5EAYA 3HKZE 2SOBA 3PUVA 4X62L 4C3HG 2AX5A 4A3EB 1QVGA 1ZDXA 5FLXE 3NG0A 4IWQA 1ZDVA 1SYCA 4DUZQ 1ZUD2 2JSVX 3DMUA 2HJ8A 2JPHA 4LLGM 1I35A 2B63B 2PYKA 5L95C 3S14B 1CJEA 1TY2A 2JQOA 4ACFA 1CKOA 4ICUA 3RN2A 2Q8TA 3DWQA 2MLBA 2F0TA 4IWPA 1ILPA 1G2TA 3NE5B 5DPTA 4S3SA 1IPGA 1JWSD 3I8ZA 2VUMB 3HRDD 5LXIB 2O6VA 2PIAA 5FR6A 2LRWA 4GNXB 1AW7A 3RT3B 1WTHA 3KF8B 3OIQA 4KI0A 3L13A 1IKLA 3FILB 3ZLZA 2W55A 3KUDB 4KK7A 1WYGA 1CSQA 4PK1A 3GZNI 2EYFA 2WXOA 1RCVD 3UQBA 1GJZA 1N34L 1G91A 2AWTA 4KV6A 1VZ7A 2CHXA 1I6HH 1TWGB 2D10A 2JA7H 3N52A 1O78A 5JJZA 4LF5Q 4YTPB 1A3VA 5BMIA 1Q12A 3H6NA 4ZRKA 3PO3B 2J42A 2LXCA 3GB1A 2JP1A 1FRDA 1QZHA 4P72A 4NKLA 2ZXPA 1NY4A 2ZVNA 5JHBA 2CH4A 5G3LF 1TT5B 4GKJQ 2G9DA 3TEHB 3MC0B 4LFBL 1YI2A 5C3EG 1AARA 4ZK9B 4ZUJA 2MBQA 3HOXH 3ML8A 4DAPA 2RMMA 4LF6Q 2PO4A 3ZO5B 1KLVA 1CK1A 1Q7YC 2JA7G 2LGYA 1UEBA 1RM6C 1AP0A 4FXKC 3URYA 2XEWA 1FO4A 3GTKH 2KECA 2N3SA 2RSOA 3A5UA 4RF0A 3APDA 1RHPA 1I4XA 2B2TA 4XQQA 1PZID 1F1HA 3DOWA 1P98A 4OZCA 5IN7A 1J0GA 4LWCA 1T5XD 3M7NA 2MP2A 2IY0B 3KUZA 1J5EL 4JI6Q 2A5HA 3J9CA 3ENEA 3GTPH 1SJHD 2OTJA 2QC8A 1TS3A 1EQTA 4CDFC 5ELDA 3HOXG 1WYDA 1BO0A 4HKZE 3NPPA 4ZKCB 3P20A 4KGSA 2XBBC 4P6VF 4TRDA 5A2QE 3CCEA 3IBEA 3RNEC 4W9LA 3AECB 4AJYB 2N49A 1LTSD 5CYUA 4QMGA 2V1CC 5GXGB 1V1PB 1F9JA 1VMPA 4YCUA 4XGAB 1HFGA 1WJUA 2KWVB 2F03A 4RG1A 4AYBB 1KRSA 2IJ0A 2X6LA 4WJ3M 1T0SC 1SNDA 3PSIA 4WFN3 4YY3Q 3U58A 5GQOA 3CC2A 5FO8B 2IYDB 3H7PB 1WIAA 1TKYA 5E4XA 1K0RA 1NNXA 3M4PA 4CQNA 1VDZA 3I55A 5CV5A 3T1YL 3W5UB 4ZAIA 1FFVA 2Q8IB 1QUQB 5CC4A 3AU4A 1EY6A 4OWTB 1QJOA 1P16A 2D07B 2CHZA 1F9QA 2A73B 2ON8A 3PV1A 4JI4Q 1UEAB 2N88A 1GJXA 3CCJA 1E1TA 1BBWA 1V5OA 1DZ1A 2M0XA 3EQLC 4LFCL 2DZMA 1YMHE 4DV1Q 4PS8A 1QF6A 3HOUH 4C7YA 1P7EA 3OJ3A 1X6OA 1U4MA 4A3JH 4KKIA 2WU5B 2N7JA 1SRUA 4YWLA 4KGRA 2ALYB 2LASA 4E74A 4C2MH 2L3ZA 1GOZA 3Q0AA 3DWPA 3T56B 4ZKBB 1N33L 4G7OC 1WGKA 3A4RA 3EGRA 4B9WA 3CXCA 4LF4Q 1HPCA 2R92B 1FM0D 2C5LC 2FIFA 2CW0D 1A70A 1FFUA 1VQPA 4PZ8A 3AMUA 2IO1B 2DN8A 4JI1Q 3KH0A 4HKQA 1Z47A 4K8JA 1TY0A 3MC9A 4CGYB 2I1JA 1TZOA 4WJQA 3DQVA 5CORA 2C7HA 1GUGA 4K5VA 3EFXD 1SFOH 1IW7C 4L5TA 2F0HA 1JCKB 5EBDA 2WAQB 4DXFA 5C1ZA 2EELA 1KC8C 3H3VC 2D9UA 1H8CA 1SBBB 1EQVA 3BG3A 1E6EB 1ZGUB 4KJNA 1N6ZA 1I4RA 4NQLB 1PFSA 1Y1VB 3UDGA 5IT9c 5CV9A 1WTQA 4B6WA 4DNIA 1CHPD 3V2TA 3HOYH 1LM8B 4ARCA 2ZTEA 3OWFA 2NVXB 4YIJA 5IT9L 2QDLA 5AUIA 4ZOHC 3IAS1 3E9SA 1TS4A 2TSSA 1CKNA 2LSSA 2CU1A 1XCQL 5BR8Q 4N6EB 4B3TQ 4CO7A 4HJGE 3VQIA 3W5VB 2YTYA 2EY6A 1E22A 2JZ3B 4R4CA 1MSGA 1Y56A 1FCLA 2GRIA 1B53A 2XGTA 5C4XH 2RHQB 4TVAB 3CC4A 1WM3A 1RJTA 1T9HA 5M5XH 4WJOA 3H94A 4GSWA 2FHTA 1VQCA 3T16A 1EM7A 1P7FA 3Q3JA 1RFKA 1JQYD 5G2NA 1O7IA 1EYCA 3BJUA 3HOYG 2K5DA 5DLQE 1Y1WB 1QOAA 3KF6A 4E71A 4U673 4C3IB 4GKJL 4JI0Q 3T8MA 2KOLA 3PIP3 4K1RB 2K5HA 5M3MG 1TWFB 1P0RA 4GS3A 1J6QA 5HY6A 3NQTA 3RUZA 4X3UA 3Q3MC 4MTKA 1HTPA 1CUKA 4ZUIA 2WIIB 4CJ2C 4YL8A 4F7XA 2RA4A 4JPBW 5C4XG 3M63B 4HLEA 3NVWA 2MJ3A 1NYRA 1BR9A 2Z4HA 4ANWA 4OHJA 2V1YA 2P5ZX 5FKAC 4FXDA 2A8VA 2CR5A 3JYUA 4LNQA 2W9NA 1XLQA 1WSPA 4WQOB 1MFWA 3HOWB 1HRJA 1SGHA 2KCTA 4WAFA 3P75A 1HA6A 2QDBA 2JN4A 2NYZD 2FJ2A 3ZNGC 1PFNA 4X64Q 3F2DA 3T1HQ 3TEWA 4P2CB 1EIGA 3CRKC 4HWIB 1T6BX 5M3FH 1SE8A 3V6EB 3ITPA 1MHHE 3S16B 1VF5C 3I7FA 3NSWA 3TIXA 1PH5A 4JX1C 2F0LA 2YTXA 1IBLL 2I46A 4A3FH 5LL6X 2PNRC 1JALA 1PRTD 1QOFA 3M95A 1YZ6A 2PTLA 4XWTA 1B9NA 2EE1A 4X65Q 5LLIA 1HCZA 2NBVB 2WXNA 3I4NH 1NBWA 1I3QH 3VHTC 1W6KA 2A6HC 2M17A 3OIPA 4HJKA 4BAXA 3GTOH 1A2UA 1HZAA 1HNXQ 2YU9B 3M4OH 2IL8A 1WJNA 1VDVA 2H88B 3BVGA 2KDFB 4XX5A 3KDFB 4JI2Q 1N32Q 1YNJD 1EEID 1WGYA 3KWLA 2SDFA 2H89B 2VS1A 2JRIB 4IM0A 1DXMA 2J52A 4G3XB 1TZ1A 4WWOA 2INCC 2QHOA 4E3CA 2K5WA 2FCQA 3R7RA 3AEFB 3MHBA 3N1YC 2F52A 2GI9A 4HMIA 2WXQA 2R93G 1L5PA 3VDZA 4GLVB 2EYJA 4ZYNA 4JI4L 2KLGA 1F2YA 1IKMA 4WJ4A 5DNFA 2MQJA 4GN5A 1WM2A 1A0IA 4HROA 2PZWA 1MKHA 2MJ8A 4DV1L 3AE6B 2L15A 2UXDQ 2N9EB 3K7AH 1I4PA 3JAMc 1EWCA 1LTGD 5AJ3Q 1YHQA 2INPE 3C8YA 3PPAA 3T51B 4LJZC 3VYSA 2ZPNA 3AEBB 4JGHB 4C1NK 5KNCA 1UWXA 3UDFA 3SK8A 4A75A 4V190 2FFKB 2F0JA 1NENB 2Z0DB 4K3CA 2LMCB 5IGFA 3AU7A 4A8XC 1E7VA 1I4HA 2DNEA 2PKOA 2M4NA 4OWWB 5K36H 5M5YB 1HUNA 3D4DA 4LFAQ 2ZM6L 2PLPA 2G45B 2VNUD 3F2CA 2FCNA 3M7GA 3EVQA 1KF6B 4B3SQ 2K03A 3W1SA 1WI0A 5D65A 4FJVB 1F9RA 3DM1A 4XZ4A 1TWCB 4RGOS 2MA9B 5IYBG 2R7DA 5C2TB 3CCMA 5IY0A 4Y7NB 4JI7Q 3QIJA 2CFMA 3T53B 1GUWA 1DGJA 4K7SA 2W82A 2BDNA 2F3IA 5JHAA 2MUYA 1AYFA 3L54A 1SXTA 1VQMA 3VXWA 3ZDTA 4BKSD 3NS1A 1PTOF 1WF9A 4DPGA 2KHJA 1M94A 1WYWB 1PH6A 3UIPB 4HEDA 2KVRA 3VYRA 3NZ3A 1OXTA 2PZUA 5A35A 2XWJB 1XNRQ 3GD7A 3J80c 4PS3A 4IZ8A 1OEYJ 4IUUA 2VB3X 1FXTB 4FXGC 1NR4A 1TU2B 4NDXA 3VTWA 1UAPA 1F2RI 1VQ6A 3ONSA 2WXKA 4MJSA 3R2IA 4RWSC 1V2YA 2KX0A 1D7QA 4KY7A 1V9PA 1HTOA 2KYWA 1UE5A 2XN9C 1X3PA 1BDOA 2LUMA 3L0WB 5EE9A 1SDFA 2YEPF 1XJVA 4CBVA 1O7LA 1H9SA 2WKDA 3GTQB 4RH6A 3GTJH 2KD0A 3IHPC 2GBNA 1GB1A 1TYGB 1C8CA 2KFJA 3ZTDA 1JB3A 3HOZG 1X54A 1U4RA 3MEHA 1L1OC 3VTVA 4EZKA 3MXNA 1VQ4A 3C1FA 2Z6KA 3HVDA 3ZRCA 2Y0SG 5EKIA 4XTCS 1WZ0A 3TREA 2SNMA 1BT0A 4AWJA 3B9JA 3DWAA 1PZKD 1HFNA 1HTLD 4IC7B 3RCZA 2LZ6A 2O6VB 1IXRA 5LMUL 2MHJA 3DBHB 2D3GA 1SE4A 3TZDA 1LO5D 2N4FA 1ONLA 4PT5A 3PO2B 4MGKE 4FN2A 2LHEA 2MBOA 3PHWB 1J8IA 3IAYA 2K52A 1GPXA 5IP9H 5AZFA 4EUTA 2GVBA 4K2LA 2HIXA 1AE2A 3M85A 1KOTA 3DBHI 2L32A 3OYYA 4JQWC 2LXAA 3RUIB 3GS2A 1DOXA 1T3QA 1DOYA 2B2WC 4EKUA 4MDKE 3RLFA 1W3SA 2F0VA 4R9WA 2FCMA 4JI2L 1T0QC 4QAYA 2JT4B 3S2DB 1Y8OB 2KOXA 4M8AA 4NZLB 1R7SA 3DLLA 3KK7A 3R66C 3D4RA 2I0QA 3NUCA 2QILA 1YNND 2E76C 3LX0A 2CS4A 4X3TA 2A1AA 2JXTA 4A3GH 4HMJA 4JV5Q 4IJHA 1BNZA 1MI2A 1DGSA 5G3LD 3QQ8B 4ZCKA 1K0SA 4MELA 5J18A 3P4SB 1XPUA 2WP8J 3TQYA 2EVBA 5AJ3L 1IL2A 2ZCCA 1KDAA 3CSFA 3OW2A 4JI8L 4PMBA 2MP2B 1FNWA 5KHOA 4DV3Q 3HZXA 3J81E 1YNTE 1CSPA 1B8AA 2KWDA 2EMTA 1DOKA 2IHFA 4FXCA 5E6NA 3FKIG 1ICWA 1XLPA 4WORA 4A3GG 3E9IA 2I38A 2NZHA 4QIWE 2N1VA 4RGMA 1LUZA 2CHWA 4I7ZC 4AQYQ 3Q8EA 4JPSA 1PYWD 5JH5C 2AQ3B 3U9SA 1U0LA 1K3RA 1MJEA 3P63A 3CAMA 3RN5A 4KHPQ 2YV5A 3NVVA 4WRDA 4JE3B 3VR2A 3AFPA 3Q6BA 2CQOA 1JWAD 1PUTA 2BT6A 1A2TA 4DV0Q 3QJYA 3J7AV 2L0FA 3U9OA 3ZYYX 4DBGA 3DVNU 4JI7L 5AZGA 4BBRH 3S17B 3TEYA 2GVAA 4O0AA 3IL8A 4BWGB 4DR2L 2LRUA 2WXRA 4W9HA 1EQQA 2KA7A 2KFKA 3BDCA 2V3PA 3MTNB 3K81C 2K5PA 1J7CA 4Q0FA 1O7YA 1MJCA 2JQRB 3GTMH 2BBCA 5EGTA 1KD1C 1P8LA 2ICIA 4KV2A 4NQKE 2Z0EB 1V1QA 3BY4B 3WAMA 3KJOA 1V80A 4TKOB 1E0ZA 1HZ9A 4IKGA 3BDLA 3CIRB 4L5RC 5EE3A 4P71A 2RDGA 4DK5A 1CM9A 1OTCA 1JOKA 1HNWL 3U30A 4DHZE 2JA6H 3CMEA 1CMXB 1WFQA 1C4CA 4J3OD 2WB1G 5EBCA 4WWMA 4G50A 4BBRG 1IGCA 2BOSA 2DAFA 2FAZA 2KK8A 4IPGA 2JZPA 2QGQA 5IA7A 2SNSA 3ABVB 4ARIA 1XWEA 2D5DA 4LF9Q 3PF4A 4USAA 4A3DG 4IFDI 1S4ZA 5I2YA 5H92C 4URKA 3AB9A 1L0WA 4G7ZC 4FLHA 2L11A 3TZUA 4P75A 4II3B 5C5MA 2BDOA 4MIUA 2C7MB 4W9EA 1CI3M 3QX1A 4FHJA 1KRTA 1WCMH 1LXDA 3JAMi 2O2LD 4EQNA 2O5JC 1C78A 2UU9L 5E6OA 2KENA 2NBFA 1BUIC 4YSYB 3NVYA 3PZ7A 2JVCA 1GC7A 2R2QA 1SMYC 3S9WA 5LMNQ 2GBJA 3FAHA 4A3KH 2NVTH 1SB3C 3GTLH 4JBWA 5HI1A 1ZP0B 2M0AA 4IALA 2J0MA 2QW7A 1CKNB 2MO1A 5C3WA 1GB4A 4EZJA 5I6WA 2GMIC 2W3RA 3P1MA 3EECA 4ID6A 4X62Q 2YLMA 3LB8C 2L83A 2Y5CA 3S15H 2UYZB 3NUHB 1QG7A 2UWQA 5E1FA 1WCMG 3PT2B 5JJKA 5IWAQ 5L37A 2K8CA 3HEJA 1OFFA 4WWNA 2MPMA 1VQ9A 2D3CA 2IHEA 3KLWA 1PZJD 1EY4A 1T0RC 5E6JA 3KF6B 2LXKA 3DHHC 1RLFA 3CCLA 1GXDC 3OWEB 1DJRD 1YNJC 4DK0A 2CU3A 3I3CA 5AZHA 4DAVA 2WXJA 3IXSA 1I6HB 1DM0B 2H1EA 4APVA 2JA7B 1V8CA 2WX0A 2ASQA 5CBAE 2RDBC 4IN3A 3L0OA 1K83H 4GKKL 2E6XA 1S5CD 1U9RA 4GLAC 5GADC 1N34Q 1ENCA 4ZHOA 2JYOA 2RPVA 3A54A 1D4BA 3J80i 3P4PB 3TCAA 1YQ3B 3ZRFA 3A55A 4FADA 2MJEA 4BBNF 2R3ZA 3GOEA 4NAWB 3SK6A 3M4YA 1EWHA 3EC8A 1KTKA 4DV3L 1FJGQ 4ZQ3A 1VCBA 1DYQA 5DM63 4KKSA 2WV6D 3KVFB 3HOXB 5JEAJ 4K14A 3HG9A 1GHJA 1GKHA 2LKVA 3MWYW 2MRPA 3E0EA 4UDUC 3Q8AA 4KZCA 3VUYA 4AQYL 2BGFA 3PMFA 4LFBQ 4C4VA 2VZKD 2WXMA 4JK1C 3GTKB 3LDZE 1EQRA 2DBYA 3AE1B 1E2WA 4GDKA 1QB5D 1WZ3A 2L8JA 4HDOA 1B3AA 1H9MA 1M1KC 3EFUA 3WWVA 4A6QA 1FPYA 2LGSA 1W6JA 4IG7B 4C56C 4S0RA 3GTPB 2NBWB 4X3SA 1VQDA 4CDCC 1PXUA 3K5LA 1RDPD 2KJHB 4EQOA 1AZQA 2BKFA 3DCGA 4KHZA 3N1ZC 2AUJD 4GOPC 1PH1A 4IURA 1EL0A 2IGHA 2EDGA 1SE3A 2UUAL 2CWAA 4ZRPA 5F2DA 2GLSA 4KSKC 4GN4B 4FULA 3HVZA 5TR5A 4XDXA 2A6HD 2IX1A 2ENBA 2EJMA 3PTFC 4C00A 2RVLA 1V86A 2EJFC 2EYLA 2PI2A 1S5ED 2K14A 1IZ6A 4MGYE 1N63A 4A3MH 3G6JB 5I9OA 4Q2JA 4DHJB 5FLXc 1M90C 1LT5D 3V62A 3UIOB 1GM5A 1N5WA 2KBNA 2E2DC 5DAUA 3RZOH 3TDQA 3ALBA 1RTNA 4K7UA 1LTLA 3M4QA 1L0YB 3PUYA 4KJOA 2ONQA 4RF1A 3T1YQ 1EU4A 4I6NB 2LVOA 1VQ5A 5C4ZA 2D2QA 2UXCL 3QARA 3ZDMC 4C3HH 1AH9A 3HOUB 1S1QB 3NY5A 1EUJA 3VDYA 4JOIA 3CCVA 4A3JB 4M8MA 1K53A 4DGZA 4C2MB 2Q8RE 4DN4M 5C3XA 4LFCQ 3C19A 1B2TA 3QIAA 1Q5WB 3CMAA 1YX6B 2EQSA 3FC4A 2O4XA 3EHVA 3V60A 3WCQA 4CHKA 1SAPA 1S5FD 4KTAA 2N7EA 5CV8A 4QQBX 2WX1A 2J4XA 4J6HA 2I1KA 4YSXB 1N33Q 4ICVA 4DAMA 1SFOB 4JBJA 5TSSA 3M3YH 3C1EA 2MH7A 1D5ZC 1X32A 4R4OA 2N9LA 4ANUA 3DVGX 3DBLB 4M02A 3K0YA 3KFUA 2G4SA 1CA5A 3VRBB 3FPUB 3O65B 5IWAL 1T5EA 3B2GA 1ZE3D 1NVID 2KDBA 2MEKA 2GBKA 4GMVA 4BXXH 4O42A 1QZEA 3G6EA 2I5MX 3MZ5A 1X9NA 3HOYB 2EKIA 1PQSA 2Y5BB 1QWYA 3GZNB 1PTOD 1WD1A 4IW0A 4KKUA 4XIGS 3AMZA 1IYVA 2AKWB 2WB1E 3SR1A 1D3ZA 3SDLC 4BY1H 4MJSB 2UU7A 3OG5A 3DBLI 2G1EA 2MBBB 4DA2A 1R4NB 5BYSA 4OW0A 3M3JA 5FLMG 1I42A 1Z6HA 2RCFA 1YNNC 5C4XB 1H9SB 3H09A 1FXAA 5C3EH 5M5XB 2K22A 4GB9A 1SIFA 2JXXA 3SDZA 4GZYC 1Q8KA 2JEAI 4BXXG 3MXNB 3W9CB 3D0FA 4GOCA 4BKSA 4F88A 2K33A 5I6YA 5CTRC 1FJGL 1R4NI 1PH9A 4ZLTF 5I9PA 1MHXA 5E6PA 3X23A 4BY1G 2DNCA 1F9PA 3TN2A 5A2QL 4MT5A 4AOFA 2HQLA 1E7PB 2NWGA 4HR7B 1JORA 2HQEA 1H9KA 1QNUA 4FO2A 2ZW1A 1KH0A 1YIWA 1IYJB 4IPHA 1E7ZA 4BBSB 2G4DB 5G55A 1S40A 3J7AF 3RZFA 4LJOB 2DUDA 1JJGA 1MI0A 1V6EA 2Z8LA 3B08A 2BYFA 1UBQA 1TIID 1P1AA 4HIMA 4JL9A 4NMZA 1KHIA 2OT2A 3HFZB 1P9DU 1V81A 2KJRA 4CKCA 2LJ5A 1KLUD 3L3OC 3NTKA 5M3FB 3AI5A 3NWSA 1PGXA 4PZ7A 4JBKA 3HOVH 3L08A 5K5PA 3I4MH 4A3FB 1SNMA 3H3VH 3GP7A 2JE6I 3I4NB 3BYYB 1I3QB 1IGDA 2ZNVB 3FHWA 5D94A 4RM9A 2CQAA 2F0GA 1ML0D 2H5XA 2UXBL 1YN4A 2EOTA 2L52A 1PFMA 3RZWC 2FUG1 3GTOB 4C3JG 3M4OB 1IBLQ 1GNUA 4N9TA 5C44H 3RLNA 1XQQA 3JSVA 1ZKHA 1V43A 3H1UA 2ID0A 2VW9A 1B4OA 2MGSA 5J3BA 5C5LA 5EKKA 3HOVG 1XO3A 1YOVB 1UF0A 2C9WB 3I4MG 4FJZA 2R7ZG 4JVZA 3CF6E 3ECIA 1OXXK 1RKNA 1JJ2A 1WR6E 3ZGZA 5C0XH 1NMGA 1LT4D 1JRUA 1JE5A 3PUWA 4B9XA 5CHWA 2IO0B 1TKWB 3DHGC 4OO1H 4YTMB 5C4JH 3BK1A 5C44G 1I50H 1JOOA 1M8AA 3AE4B 2DYMA 1GUSA 3GE8C 2I07B 3LYYA 2RSNA 4F1SA 2XTIA 3M62B 1GC6A 3JC66 1EY8A 4A3LH 1F52A 2DYOA 1FRRA 4QL5A 3FPPA 1G8ZD 1RIPA 2LGIA 2K7VA 4HCSA 5C0XG 4IOAA 2KMMA 1WGRA 1TKEA 1FNVA 2QJLA 2KFKB 3ERQA 1XX8A 3NWTA 4LNKA 1E2ZA 4OO1G 1E0BA 4UHVA 1VQHA 1Q10A 1KNEA 2A19A 3ZUNA 3ZW3A 4IUVA 2Q5WD 2JA8H 1G291 1HR0W 3AEGB 3I73A 1UUPA 1VQJA 2ZM6Q 4A3LG 1CHQD 2Z4IA 1PH8A 4DR7Q 4Y52H 2K9XA 4ZRIA 4CDDC 3LGJA 3QB3A 1Q81C 2VH1A 1K52A 1ZYRC 4FF4A 2K1FA 1WI5A 2AHOB 3RNAC 4NW2A 2EYMA 3TP7A 3IFWB 1YD8U 1MBYA 3EUB2 3B1LX 2EY5A 1STNA 1LV9A 3PRMB 2G5DA 2KCNA 3C46A 1NI2A 2X6GA 4RKBA 1SSOA 1TWAH 3H7SA 4PS7A 2J7ZA 3QC8B 5AEKB 4OX9L 3KYHC 5M3MH 2JA8G 3NBHA 1JT8A 1VJKA 1A15A 4IOIE 3CQZB 1X3GA 2F0OA 3K9PB 3KUCB 2V9HA 1N36Q 3H15A 2HUGA 3I4OA 2F4IA 2J7QB 4M0WA 2R7FA 3W1YA 3TL5A 2JY6A 3AE3B 3KLSX 2Q2IA 3H9DA 3QWZB 2KC1A 3UGBB 3WANA 1EU3A 4IPDA 1HZ5A 2GB1A 1OTRB 2BS2B 1STYA 1VZ6A 3DVNV 3MC8A 1QLBB 1ET6A 3GTJB 4ZHPA 4K0KL 2KQSA 3P42A 3W3AA 5EPKA 3EIVA 1VQIA 4KY6A 1FL0A 1STEA 4NB3A 1CZGA 1E10A 2K25A 2WDRB 4AH6A 3DWGC 3QO2A 1V1OA 1EZ6A 2PMZE 3BZDB 3RNUA 4DNTB 1U4AA 4MTNA 1ENFA 2MBHA 3PIO3 1SMYD 2BPSA 3NK9A 1QQRA 4NAWA 1BCPF 4DV6L 1N62A 2PVOD 3MA2B 5C23A 2VUMG 4DV5Q 2B2VC 3AXCA 2BW2A 5LMUQ 1ZPSA 4OXPA 2HCIA 5DPRA 4LMQD 2LUEA 3CCUA 1PTOH 3I70A 4XT3B 2DZKA 4RM8A 1V9JA 3ZVVA 1C3TA 2C5CA 4HPPA 2L00B 1YJIA 2E8GA 1YJ9A 2R93H 3A8IE 1EY9A 2K5QA 4EX5A 1Q90A 1JOQA 4LNIA 3TBLD 1SN8A 5IODA 1A3UA 2LGXA 4GIVA 4DFAA 1CZPA 1HEZE 3VAWA 4P7IA 2WXLA 4EOYA 4K8IA 2EXZA 1JQ4A 1PH3A 3Q24A 2JA5H 4EEWA 3L9AX 3IVFA 4C4VB 3AULA 1WTVA 4IUTA 3T13A 1YQ4B 3N30A 1KDCA 3FDTA 4GDKB 4P1BC 4WIPA 2CCZA 2WFWA 2JWZA 4YSZB 2E3TA 5CHFA 1IBKQ 2Z1CA 1HHVA 3PVLA 1KAWA 3OAWA 1SYBA 1DOMA 3I4LA 3W1BA 4A3BB 1ISNA 4ZYSA 3TS2A 4IOCA 4H7BA 5KNBA 1N60A 3HKZB 5FJ8H 4GNXC 3MJWA 5GMVA 4G0NB 2A5UA 3RNGC 4JI8Q 1BOSA 2D62A 5IYBH 3A5ZB 2JA5G 2PVGC 3Q69A 2Z9HA 4K3BA 1OXSC 4TMAB 2WDTB 3L17A 3A1QA 1E3PA 1STGA 3NHEB 5M5WH 1EIHA 5D6JB 1SNPA 1YVCA 4DR5L 5J1ZA 4IFDJ 2FUHB 2DAJA 3APFA 3DPDA 5JEAG 3L4PA 3P4RB 3JW0X 1YBYA 2AWNA 2RCNA 2XIWA 5JVH3 4DR7L 2WWZA 1Z5SB 3AN1A 2I2YA 2OQ0A 1PRTB 4BBRB 1GVPA 5FJ8G 1D5XC 3E5SA 3I5JC 2B3AA 4HJAA 4MNOA 4C7ZA 1QE6A 5T1GA 3AFQA 1LTRD 1PTOC 1TT2A 2L05A 3GTMB 3GO5A 4JG2A 1NJIC 5BN4A 5GAHC 2KTRA 3T9LA 3SEBA 4DR2Q 2ZPYA 4LK0M 3C0RB 1K3BC 1WOCA 3TP6A 3K80C 4N9PA 2ZTCA 4DK3C 2JA6B 1WJ6A 3I2ZA 5KHQA 1N36L 3BVMA 1OQQA 3K5MA 3CC7A 3N6RA 5J22A 1EOTA 2G3QB 3NENA 2OHFA 1F0ZA 1GHKA 2V3SA 1L0VB 3HK0A 4HIOA 3HOZH 2LD9A 2LJIA 3V61A 2UUCL 2BB5A 1HNWQ 2DGYA 4P73A 3VR4A 4XC2A 4NP5A 5JJIA 1FGBD 4FA6A 1HQRD 3KLRA 4LW1A 1WXMA 4HCNB 2RD0A 4JYAQ 2X38A 2W54A 1LTTD 1FXIA 2N78A 2YTVA 3UI3A 1EF5A 2QIEB 2GBRA 2OJRA 1NUCA 3R7QA 1R9TH 2BS3B 3N9YC 1IBXA 4KMUC 2R92G 5JZEB 1QNKA 1TKGA 4R8NA 3JAME 2D0PA 1HXYD 4XE0A 1STHA 2A69C 4PV1C 3ZNID 3PV0A 5J39A 4KX6B 4IJLA 1L6VA 2MJDA 3M9BA 4YCVA 1PYSB 4A3KB 2K5NA 2HT1A 3GTLB 2NVTB 3WA0A 3V96A 3P1HA 4QB4A 4LAAA 2FINB 4FHKA 2SEBD 4W9GA 2CH4W 1S72A 4DV5L 4LNNA 4B3MQ 2UU9Q 1GUTA 1KXLA 1V5TA 4DQOC 2NN6H 1SNOA 5GAGC 2AYOB 1Y1VG 4O2DA 1SE9A 4LUOA 3S15B 2WGSA 1Y8NB 3OTOL 4YT0B 5D2MB 5IGCA 2VZAA 3J81c 1NEKB 2L4NA 4A93B 1E5WA 3X0WA 3J81L 1JW9D 2V0GA 4OWXB 1UH6A 2AMCB 5EKLA 4YTNB 2LY7A 4H13C 3VUXA 1K51A 4UP9A 4A3IH 1I94L 4B9KA 4UP7A 1B1ZA 2BE5C 2NN6G 1QKZA 3DUZA 3BU2A 2D3BA 4BOSC 3RPFC 2NVQH 1XEEA 5BO4B 1YX5B 1HTQA 2QSDA 4YHHQ 2L1BA 5CMDA 3K6OA 4C3IG 1K83B 2DZJA 1VQGA 3FKIH 4NY0A 5IYCG 1X56A 3KJPA 2DLBA 2JZZA 3CU7A 2E2HH 3CKIB 3D3RA 1TWHH 3ICEA 2CKHB 3DHQA 4CJ1B 2WXGA 3U7DA 1J7BA 3A8KE 2F0NA 1IBKL 2ASBA 4A3IG 4GKKQ 3PZ8A 2HHHL 1A62A 2NUCA 5IKCM 3A0JA 1PV4A 3OLMD 2KVZA 1SE2A 2EPBA 5H1SE 2IGDA 3B2FA 2BA1A 2FNJB 4L6TB 3Q3NC 1U4PA 3HOWG 2VH2A 4XWWA 4IUNA 5FO9B 2F0PA 1VR9A 5EQ0A 1JB7A 3BWUD 2KHWB 1AN8A 2WXFA 1XLOA 3S1QH 3GDEA 3HM6X 4JWSC 4KSLC 2IX0A 3J81j 5EJWA 5T8IA 4B3RL 4JIOU 2AL6A 2F4VL 4HJ9A 2WXHA 5KYLA 3FMCA 2XSCA 1WFYA 3RNFC 3U2SC 3HKSA 4OGQC 2NCNA 3JSVB 1RFAA 4Q5VA 1EWYC 1L1OA 2ATWA 2A74C 1UWMA 2BVCA 1OGWA 2F0IA 1KM7A 2K6AA 4R8IA 5JPMC 2OJWA 5CV7A 2CWPA 1PLFA 3S2AA 5EE0A 2IX3A 5KGUA 2B2YC 1MG8A 1C4PA 1O80A 1KRHA 1QZGA 3HHMA 3T4AC 2PW5A 2E5LL 4A3DH 3QHTA 4IPCA 1L0XB 4A3MB 1HNZL 2UUAQ 2OWOA 2Q2TA 1EYAA 1UNSA 4RCNA 3CCSA 3U7ZA 1EWIA 3N1XC 4NNJB 1B7YB 3RZOB 3BK2A 1UGMA 3VA7A 4TQ1A 1K50A 5LXHA 1D8LA 1EZ8A 4LNOA 1JC7A 5M9OA 1YIJA 1R4QB 5IP7H 4B0EA 2B2WA 3S1NH 4JYAL 5C6AA 2KMCA 1TBEA 3MAQA 2Z0SA 4REZA 4JWUC 1HQMC 1TJEA 2MQHA 2IBIB 3WIMA 2UUBL 1IBMQ 1VQAA 3ETRA 4C3HB 4JCVE 3PO0A 3FKYA 1V8QA 2PQAA 5E4WC 1L4ZB 2NVUI 2PW9A 4BOZB 1QOBA 4CDEC 4LUZA 3E9HA 2C9OA 1FVIA 2JU6X 2WDVB 2UXCQ 4W9KA 3BDOA 1FEHA 2J0TD 2INDC 4P74A 4M8NA 4ZRQA 2N9KA 3DEOA 5IP7G 2CHBD 2QCZA 3NQIA 2LGDA 3NELA 4B3ML 1FCCC 4ME5A 4RHSA 4ZRJA 3OMGA 1RTOA 3IRBA 2IDYA 3M3YB 3VR9B 1B9RA 3B0AA 5ELFA 1K73C 3L7ZC 4MH8A 4AYBE 1S3OA 3ND9A 3NS8A 2OQKA 4DNRB 1G6JA 3NBHB 4MM3A 4WURA 1YHBA 1EOVA 2M19A 1KFYB 1HUMA 1C9OA 1S5DD 4G57A 2W3SA 5KRUA 2JA9A 4OL7A 1OQYA 1VCIA 1F9SA 2F0FA 3PCOB 4E6IA 4UY8C 3MP9A 1N5XA 4BY1B 4HSPA 4M0WB 3GTQH 1ZYRD 1K9MC 2BWFA 2JEBI 1HA5A 4NPSA 2K75A 2BCOA 4AS1A 5E3FA 4G7HC 1JJCB 2IGGA 1KNAA 2WXIA 3AYHB 3QOLA 5HURA 2N9PC 1WJJA 4IWOA 2Q2HA 2QCPX 4J6IA 3QG1A 4YHHL 5C3EB 3QR8A 3I57A 2DZIA 3QJZA 1CTMA 1XMOL 2AQ2B 3TS0A 1QVCA 3NHHA 3K9OB 1IYUA 4OONA 4BBNC 3FVQA 2A4ZA 5CV6A 4TQUS 4DV4L 2C7NB 3SE0A 2DY8A 2HD3A 3PLUA 1HR0L 2X8XX 4A3PA 2L76A 1ZW7A 3IKJA 1HZCA 2M56B 3ZTCA 3S2HH 3HRZC 2ZTDA 3ZKJC 1VS0A 1X3FA 1WR1A 3RYTA 1FYCA 4KY5A 4AIMA 2RHSB 2IPKD 2WAQE 5BMGA 2HD5B 3UQAA 2QMTA 3H0GH 3PGZA 1WVLA 2B8FA 3S1MH 4MEMA 1L2NA 2BA0A 4R4IA 1E8YA 1YN3A 1TIFA 5IGDA 4UP8A 1BCPD 4NXML 4NJ6A 1WY8A 2J0KA 1B70B 4LF8Q 2O2VA 4P16A 3EFCA 2PCFB 4LTUA 4OIJA 4BZAA 2OXPA 3TBIB 2K39A 3R2TA 1VQEA 5ELCA 5BYQA 3HOVB 3K59A 1Q8IA 3I4MB 4DAYA 2N55A 3MEFA 3DEPA 3HUIA 3TJPA 1LTBD 3RZDH 1DOIA 2B8GA 1YN5A 1FD6A 3D8GA 3H0GG 1XXGA 1PGAA 2TMPA 5HGTA 2AEHA 4L63B 4IDIA 3EA6A 4DR1L 4EZLA 2LHDA 2E2JH 3F2BA 1V49A 3C2PA 1I4QA 1IP9A 3H3VI 2WYQA 2UXBQ 1XF5L 2RF4A 3UE1A 4BA1I 2WACA 4F8MA 3S24A 4ZDVA 2J53A 1X1MA 3IT6B 2F3WA 1ESFA 1K8RB 2NPTA 1IBML 5EPLA 2AWOA 1PH4A 3PS6A 4L5QA 5C4JB 4QF4A 4IUPA 1I50B 3A1QB 3MJ5A 5J2RA 2BH2A 5IOCA 3GTGH 1XYIA 2FXQA 2XRQD 2Z6BA 4HJ5A 1HZ6A 3QAQA 1YNXA 4H02A 5C0XI 1SYDA 3GV6A 2K8HA 4RFBA 1XPOA 1G6ZA 2VZKB 1ZEQX 4DR6Q 3NVZA 3S1RH 4AP4C 3LNNA 4LDTB 4AQ7A 4OO1I 1A63A 2WXPA 2L0TA 2LVQA 4WH4A 4K6LA 3LJ3A 2Y3AA 1I6VC 1KABA 1PFDA 3DBSA 4DV7Q 3PGEA 3O13A 3ER0A 1TS2A 2OF1A 3V6CB 4XYOA 4XT1B 1B9MA 5HGQA 2QF7A 1X65A 2KTRB 1MD2D 1HE8A 4DR4L 4L1BA 3RD4A 3Q23A 2VQFL 1UE7A 1YITA 2EJGC 3RR5A 3AQQA 2HDMA 3NJTA 1PHJA 3PIPA 4BKGA 5FLMH 1AEXA 3AH7A 4RA8A 1EF1A 3KWVA 4TSSA 1MJDA 2N0SB 3E56A 3RMHA 3PRPB 4POGA 3A9JA 3F8TA 2B2TC 4KIKA 1UGJA 1XMQQ 2K28A 5T1IA 1TS5A 1LQBA 3NTIA 2F0QA 3A9KA 3DXJC 1TWAB 1RAXA 3Q14C 4HEA1 5J17A 2VL6A 4R1JA 5M3MB 2O5IC 4NAMA 4O1NA 2FMCA 1ICFB 1KL9A 2KNBA 4HJ7A 2EKEC 1SYEA 5COYA 1N61A 4A9AA 4GOPA 1E9MA 3DBRB 3T3NA 1IBXB 5CHVC 1F2ZA 3K5OA 3Q22A 3ZJUA 2WLBA 3EN2A 4C1NI 4OX9Q 3FEWX 1MVKA 2DHZA 4JI3L 4PMWA 4OZAA 2K04A 3L2PA 4MZ9A 1SYFA 3WOEA 5MPOA 5CV4A 2R2OA 1SR3A 4YXDB 4HXDA 1JR0D 1STBA 2PI2E 1EFID 1ROEA 3DBRI 1AWDA 3D32A 4QIWB 3KBGA 3CMMB 2L0CA 2NVYH 3ZJYC 3VA5A 4JI5Q 2F0SA 1GD7A 2K4KA 4LF8L 3Q8BA 2RDHA 2CVRA 3BINA 4KHVA 4EQPA 4K0KQ 4PG3A 2A69D 2IW3A 5LL6S 1FIQA 3KYCD 4L23A 3TEZA 2V4DA 2ICEC 2KAJA 3A8JE 4PMCA 1JROA 2MFIA 1XD3B 2RGFA 4C3JH 4A55A 5KYIA 4HIDA 2MO0A 2RKSA 4U68A 1JWUD 2JF5A 3H91A 2F0MA 1LTAD 3W5OA 1D1IA 5ELBA 3Q3FA 3P7JA 4DV6Q 1PTOB 3OPOA 2ZJQA 2R7ZH 1PDXA 1NI3A 2E2IH 4DDGD 2R93B 3AU5A 3VR3A 1UZXB 2MBEA 4DHZB 2F0KA 4PZ6A 5GAEC 1WXAA 1L7YA 5BYRA 2PNHA 2AQ1B 4X57B 2KT7A 3G48A 3NZUA 4QY7A 3IFTA 1T0YA 2M00A 3PSEB 3BYTB 1WRDB 3ZXVA 3HIZA 2BE5D 2WNMA 1C76A 2YEPB 3R8BA 3AE2B 1X3EA 2B29A 2EY2A 4XXEA 4KKTA 3UDXA 1BBXC 2JA5B 2KTFA 2N7DA 4JLCA 4NXNQ 1MG4A 1WMHA 2BYEA 2GBMA 1WGHA 4K6DA 2PMVA 1M4VA 2K05A 5HKHA 1VQKA 4HPMB 2LFIA 4DWFA 3K7UC 3MXPA 4DK6C 2F0WA 2LS01 4RNAA 3NZSA 1F2MA 3ZXRA 4KD3A 2BF8B 3BS1A 4DR6L 4N58A 4HDQA 2KWCA 4MSMB 3K7AB 5IOIA 1S3SG 4RGTA 2DX5B 3Q3OC 2KVMA 4DUYL 1PH7A 4X66L 1L1OB 2L9HA 2HJ1A 4HTHA 5AFWA 2VQEL 3AE8B 1Y8RC 4DV7L 2NR2A 5DCNA 1QVFA 1H9JA 4LF7L 5M5WB 4AJWA 2KDEB 2PQEA 3CP0A 4US8A 5IP4D 2KEDA 1YJNA 3MXGA 3I63C 4JC0A 1K28A 5EDSA 2GA4B 2F3VA 2ZJPA 1Q86C 1R4MB 5BN3A 4KGTA 1NTGA 3GQBA 4XQJA 1K8GA 2KQ3A 3K8AA 4DR5Q 3CW2C 4POFA 2R6GA 3PRZA 5AUKA 1I4GA 2XWBB 1QILA 5FOBB 1E8XA 2KMAA 4A76A 1XMQL 3IT4B 5HFYA 3R3OA 3SK4A 2FE8A 2EYOA 2EY1A 3CHBD 1G2SA 1R4MI 2MX2A 3VUWA 2RDFA 3CSTA 3D4WA 1RYJA 3A7AB 4F8CB 3OOCA 2V4IB 2HDEA 2PE9A 5KNDA 4Z9CB 3V3XA 1JE4A 2EMSA 3SXHA 4KN7C 1E8ZA 1NYQA 2PPHA 3KUPA 1H4RA 2PQAB 4BA2I 4BY7H 4KDIC 3KW5B 1KQSA 4DUZL 3A7LA 4ODGA 3HOZB 1VQFA 1AZPA 2M1MA 4NPNA 2K01A 3R93A 2KJ6A 1XTCD 1PDQA 4K5XA 2Y0SB 1F77A 2V3NA 1C77A 1SNCA 2KHSA 3HOUG 4A3EH 5CX3A 4A3JG 3AE7B 2KDMA 3RLOA 3NP8A 2MNAA 5HHDG 5KIXA 1D6EC 1EYGA 2B63H 3S14H 2KUMA 1GO3E 1G6PA 1BMLC 2UUCQ 4M00A 2F0DA 2N1WA 1R9TB 3NXWA 2LXJA 4JI5L 1OEYA 2K5VA 1WXQA 5JAVA 2OTLA 4BY7G 1I7HA 1JMLA 2VUMH 1MIUA 3CCRA 2JRHA 2JWUA 2XK5A 4NJCA 3ZJTA 2HTME 2MHVA 4ANVA 2NMQA 4XDCA 4MM3B 4K81A 2VY3A 1B44D 1SMXA 1BCPC 1TVXA 4LF5L 4A3EG 2NBUA 4A90A 1W2BA 3D6WA 1N9WA 4XYQA 3N20C 4RMAA 2B63G 3V05A 4CJ0B 4K7WA 1K8OA 2KX3A 3ZNHB 3NOBA 1WGGA 1A6XA 4WAAA 1TWGH 2JK8A 1DONA 4MHEA 4F7ZA 3PO3H 1K8MA 4QJFA 2LI5A 4X6AH 4RHRA 3VH3B 4BVUC 5IGGA 3A56A 2PPBC 2INNE 4LF6L 2NN6I 4UAIA 4DK1A 3OTOQ 3Q8CA 3UF8A 1J8CA 1B50A 1LABA 4A3IB 4F87A 1VRAB 2JX5A 4BBSH 3W1SC 5IT9E 1U5KA 1QOGA 3LXFA 5EE1A 4N59A 4D2KA 1C4QA 2NVQB 1J19A 1QOHA 3AE9B 3ULPA 4JI6L 4LNFA 4NXNL 3A74A 3NEMA 1I94Q 3FKIB 1E8WA 3PO3G 3BVZA 3MTSA 2N9XA 4XDDA 4A3GB 4DXAB 1VF7A 4BS9A 3AEVA 3OJ4B 3ZJVA 4TQ0A 3TSSA 2E2HB 1VQBA 1SLJA 2XRSD 1TWHB 2XNAC 4HSVA 1SROA 1VQ8A 2FIDA 3RN9C 4FF3A 3OSOA 4HVBA 1VD2A 2KN4A 1XTDA 4DU9A 1WTRA 1SEBD 1JWMD 2O2VB 1KIXA 5NUCA 4GXBA 3L16A 2Z59B 3NBIA 3L10B 4BBSG 2CKZB 2HCCA 3N3KB 5JEAH 2D2CC 2XVSA 2IY5B 1IL8A 4CYEA 1BQQT 4DAYB 4ULLA 3PF5A 2MWSB 1VQ7A 4L5SA 4YY3L 2HHHQ 2K8BA 1QCBD 5LMNW 3S1QB 1VZ8A 2PZTA 3E3XA 3RMKC 4KKJA 1Q0WB 1HH2P 1PFBA 3X3NA 4CKEA 5FO7B 1CQFA 3WOFA 2KLCA 3MFGA 5M3FG 4M1UB 3AEDB 3D6CA 3AM9A 4WWPA 4H0LC 5ELNA 2WHIA 4YWKA 2ZEQA 5I2XA 1WX7A 2L7RA 2NB0A 3I90A 4A3FG 4LUVA 4EFOA 1ILQA 3I4NG 1TQOA 1CQVA 1C48A 2ES2A 1RL2A 2BKRB 2LVPA 4B3RQ 3KYDD 4GDLA 1J7AA 2F4VQ 4FP5D 4PQXA 3HS0C 3AB5A 2Z6KC 4UPAA 3LWEA 2R61A 2WB1B 3K58A 4DR3Q 4RMFA 1XLNA 5D14A 1BUVT 4L2YA 2IY1B 4MACA 3HGBA 1XT9B 3UE0A 2RQXA 5D7GA 1EEFD 1D2BA 3NTHA 3JAML 2NPTB 4V0BA 4MGZE 3TMEA 4ABNA 4AYBG 4A3DB 4LF4L 1RF2D 2D0OA 4OIKA 4HCPB 3A33B 2B2VA 2KHIA 1GUNA 2MCNB 4JI1L 4IUMB 1HZBA 3CWIA 4QUCA 1NAPA 2E5LQ 2R92H 2B76B 4HAEA 1HNZQ 3K5NA 3EROA 3S1NB 2ZT9C 2YYZA 3QWNA 2JJQA 3TP5A 1EUVB 2VB2X 2O6VD 1EY5A 5FR3A 2KCCA 3G4SA 1WTPA 4P1CC 2FCSA 1WJ4A 2LWPA 1IYFA 4YWMA 3Q6SA 3DWMA 1NR2A 4KN4C 1Y14B 1LM0A 2K50A 5CGKA 3CPFA 2ZNVC 5BR8L 4B3TL 2UUBQ 1LGRA 3F2UA 3TRZA 1Y1VH 5K36G 4DF7A 1EY7A 2V4LA 1UELA 5DPWA 2A6ED 4DDID 3H6MA 2NVXH 2KO3A 2RBMA 1E90A 2WS3B 1WCMB 5JJLA 2A68D 5BN5A 4OVVA 3RD2A 2DYBA 3VH4B 1Y69U 2JSOA 2QEJC 3A9JB 2KACA 1CFMA 1II3A 4US9A 5G5GA 1YHAA 4KIKB 2F0UA 4HIKA 4RKLA 4ME3A 3CQZH 4A3CH 1BVSA 3J80L 1ZOYB 2YVCA 1DD2A 3A9KB 3JVZX 2IWHA 1NSNS 2WAQG 4ALPA 3G71A 4JI0L 1C4AA 2BYVE 1RODA 4IM2A 2PE6B 3NRZA 1VQOA 4GNXA 2C60A 3AV8A 1E1OA 3T3OA 3KF8A 3KOJA 2FMMA 2KWUB 4OELB 2VRRB 1JICA 1LYLA 3FILA 4M01A 4GOPB 1J9OA 1Y1WH 3LWUA 4C3IH 4YWGG 3BIID 3WAPA 5IYCH 2Y5PA 4GGQA 1A8VA 1TWFH 2HTHA 3QA8A 3PHXB 4B95A 1WX8A 1VLBA 1C0AA 4A3CG 2KQ4X 4IO9A 1YJWA 1A5RA 3J7A5 4IQZA 3STBD 3OHXC 3TP8A 2L5TA 1OXVA 3BZKA 4X64L 3T1HL 5DEHA 4MSQB 1Q1BA 1WXVA 3MHSD 2EZVA 2NS5A 2OEOA 3HOWH 1ZXIA 3VYUA 4CKBA 1C79A 3OW7A 3J7ZC 1Y1WG 4G4KA 5IAAC 3GV3A 2CJOA 2ZCBA 3HP3A 3MFYA 4A3OA 1DOLA 4JBMA 3I72A 3J80E 1XMOQ 2PJHA 3SR6A 2OEDA 1FR3A 4X65L 4QCLA 3U52E 4A20A 1UBIA 5I4DA 3VVWB 3S2HB 4GN1A 4PYUA 3ZQ4A 3CPWA 3G7LA 4G11A 4DV4Q 1E7UA 3S16H 3KBXA 3KQ4A 5H8YE 3RNCC 4K5WA 1X3QA 2DJFC 2L55A 4L8JA 5D3DA 3J7YW 1S5BD 2JXMB 1HNXL 1HR0Q 2J0JA 2K0PA 2MSED 4YCWA 3H0GB 1N32L 1ZXTA 3S1MB 2KN5A 2D3AA 4FF2A 5C4HA 2K32A 1PYBA 2KXJA 4MH0E 4IM3A 4DV2Q 1BF4A 1ZXHA 1KJTA 3HM3A 4FNFA 3EJIA 3X3MA 1IUEA 2YU9H 2D5GA 3ZNZB 2L1AA 3CCQA 2QA4A 5IP9G 4WQMA 1SSNA 1MPEA 5JOBA 1O7ZA 3MHZA 3SHQA 2OCEA 4X3KA 4A4IA 4FDBA 4NXMQ 2KANA 3P2BA 4KZ0A 5JXVA 1EY0A 1YJJA 4DR3L 4W9DA 1Z7TA 5C0XJ 3RZDB 1WE7A 1CT1D 2UXDL 1V1PA 4DXGA 1OO9B 3GE3C 1TR5A 1NCVA 1WD0A 1BXTA 1SJED 2I5HA 2LEKA 2E2JB 2ZJRA 4QGUA 4FJYA 3H7PA 4DKAC 3TMPB 1WMHB 3IAM1 4N8X1 1RD9D 4J1MA 4ZRZA 1ENAA 4A3BH 3B6YA 3E0JA 2JUOA 1EO6A 1XCTL 2N8NA 1L4DB 4DR1Q 1ET9A 4I6LB 1QUQA 3A4SC 4LFAL 2G9HD 3BZCA 1LFDA 2WDQB 3VR8B 1YEZA 2CW0C 5IIFA 2FBWB 4B3SL 2KEEA 3SHLA 2K3UA 3KLSA 2F1MA 2L12A 5ELEA 1XNQQ 4FYDA 1RRBA 2CJNA 3Q8FA 3U4EG 3VFKA 3EBEA 4WJPA 1EIYB 5IO9A 5M5YH 3WAOA 1FNUA 2M2LA 1PA6A 4HK2A 2ZJDA 3D31A 2IT1A 1XPRA 5FK9C 2KJXA 4R3DA 4RGNA 3VR6A 1FGUA 3GTGB 1SF0A 5HG2A 4A3BG 4N9F4 5JPNC 4WJWA 3HKZG 4XQNA 1BBUA 1TWCH 1AFPA 4HN7A 1TXYA 2NZOA 1P3QU 2BQQA 2OOBB 1D1KA 2B2UC 2PMZB 3S1RB 3SFDB 3RFZB 4Y7NH 2JYTA 3U50C 2C35B 2RR9A 1OQRA 1Q82C 5CR3A 1WRIA 1KAAA 1XNRL 3SD5A 2PW7A 3DDCB 4HCEA 3TUOA 3P4QB 1V97A 1WE6A 2IZVB 3ULJA 2KKCA 5L83A 2ZW0A 2HE7A 3H8HA 1NDDA 3TEXA 3WDNA 4EQ5A 2KZRA 1A3TA 4ITKA 1C1YB 3I9V1 1C9FA 3SGIA 3WALA 2DY7A 1G51A 3ULLA 2QEXA 4W9IA 2AUKA 5IGBA 2M9VA 3W1GA 1PMRA 2REXA 4JW0A 3CRLC 3SU8X 3AEEB 2SAKA 2NTSA 4DR4Q 5BMHA 2HIVA 2WP9B 2VQFQ 3I91A 1B3QA 4RAUC 4IUQA 2KDIA 3C3LA 2MW5A 1MHWC 4II2B 4FVMA 3AE5B 4C80A 4N8FA 4LJPB 2JA6G 1TTNA 3QCAA 1ACCA 2JYEA 1ZKOA 5G5HA 1JWBD 5LHY1 1EFWA 3VTUA 3ZIMA 5EPJA 1L6UA 2NTTA 1IHZA 3PZDA 3PUZA 1HJPA 1NBFC 1Q3LA 4B08A 1JMCA 2KCMA 4KLKA 1MGSA 1R4PB 2K1BA 1UD7A 2BTEA 1NMFA 1H9RA 1I5FA 3SK5A 3UI2A 2E74C 2B2YA 3VR5A 2XK5B 2Q2UA 1LT6D 1LLRD 4GU2A 4GLXA 3ERSX 1BKBA 1K8AC 1ASZA 1D5MC 3VYTA 1IW7D 1QT9A 2WINB 3PO2H 1H95A 1WGDA 3FP9A 5IGEA 2BH8A 1PRTC 3DM3A 4HJ8A 4TV3A 4JI3Q 2X69A 3RNBC 2ZXOA 1WH3A 2NVYB 3QOJA 2IO3B 4WJNA 4I7AA 4A93H 5DM73 1Z2MA 1KDBA 4CHTB 2PEAA 4W9JA 2MP1A 1DCZA 4A3KG
chains in the Genus database with same CATH topology
5KEEA 1GAQB 2H4OA 1WTOA 1PGBA 4HRSA 1VMCA 1WTXA 1PRTF 1E2VA 1SYGA 2NZ1D 4PNYA 1F2RC 4C3JB 1FD7D 2B2UA 2B39A 2BYTA 5D3IB 1SNQA 4RCOA 1CA6A 2BB6A 1U4LA 2WQYB 2WU2B 4H2AA 1GUOA 2R7ZB 2E2IB 3K57A 5C3JB 3FRPB 3AEAB 1JRPA 2ACZB 5C44B 4B0MA 2VXWA 4ILWA 4I65A 3VRAB 3W2DA 1LTID 1FMAD 3PUXA 5LNK1 2BS4B 2DWQA 1WTWA 5ISRA 1Q1EA 2EYPA 3ND8A 3SVMA 4J8QA 1Y8PB 3E6ZX 2LMCA 3MVVA 1EYDA 1OXUA 2F0EA 4GDLB 3IFDA 2EYHA 3SFEB 1CZWA 1BCPB 4OZBA 2A6EC 2HDLA 2A68C 3OMCA 3MXUA 4LK1C 5FLXL 4IFDH 1ESRA 2JA8B 1LACA 2WKCA 4OVZA 4EE2A 2ZXRA 1F2LA 4FF1A 1SIJA 3ONAB 4QUFA 1LT3D 2QKIC 4K2KA 1STAA 4EVOA 2E75C 5JVG3 1KLGD 4IFDG 4EGVA 1RWSA 4MN3A 4H44C 4KD4A 1WWTA 4BY7B 1MSHA 5CBEE 2LFNA 4GLSC 2SOBA 3PUVA 4C3HG 2AX5A 4A3EB 1ZDXA 5FLXE 1ZDVA 1SYCA 1ZUD2 2JSVX 3DMUA 4LLGM 2B63B 2PYKA 3S14B 1CJEA 1TY2A 2Q8TA 3DWQA 2F0TA 1ILPA 1G2TA 3NE5B 4S3SA 1JWSD 3I8ZA 2VUMB 3HRDD 2PIAA 1AW7A 3OIQA 4KI0A 1IKLA 3FILB 2W55A 4KK7A 1WYGA 2EYFA 2WXOA 1RCVD 1G91A 4KV6A 1VZ7A 1TWGB 3N52A 1O78A 5JJZA 4YTPB 1A3VA 5BMIA 1Q12A 3PO3B 2J42A 3GB1A 2JP1A 1FRDA 4NKLA 2ZXPA 5G3LF 2G9DA 3MC0B 4ZK9B 4ZUJA 4DAPA 2RMMA 2PO4A 1CK1A 1RM6C 1AP0A 4FXKC 3URYA 1FO4A 2KECA 2RSOA 4RF0A 1RHPA 1I4XA 2B2TA 4XQQA 1PZID 4OZCA 1T5XD 3M7NA 2A5HA 3J9CA 1SJHD 1TS3A 1EQTA 5ELDA 1BO0A 4HKZE 3NPPA 4ZKCB 3P20A 4KGSA 4P6VF 4TRDA 5A2QE 3AECB 1LTSD 5CYUA 4QMGA 5GXGB 1V1PB 1VMPA 1HFGA 2F03A 4AYBB 2IJ0A 2X6LA 1SNDA 4WFN3 5FO8B 1TKYA 5E4XA 4CQNA 1VDZA 5CV5A 3W5UB 4ZAIA 1FFVA 2Q8IB 5CC4A 1EY6A 1QJOA 1F9QA 2A73B 2ON8A 1UEAB 2N88A 1GJXA 1DZ1A 3EQLC 1YMHE 1QF6A 4C7YA 1P7EA 4KKIA 1U4MA 2WU5B 2N7JA 4KGRA 1GOZA 3Q0AA 3DWPA 3T56B 4ZKBB 4G7OC 1WGKA 3EGRA 4B9WA 2R92B 1HPCA 1FM0D 2CW0D 1A70A 1FFUA 3AMUA 2DN8A 4HKQA 1Z47A 4K8JA 1TY0A 4CGYB 1TZOA 5CORA 1GUGA 4K5VA 3EFXD 1IW7C 2F0HA 1JCKB 5EBDA 2WAQB 4DXFA 2EELA 3H3VC 2D9UA 1SBBB 1EQVA 3BG3A 1E6EB 4KJNA 1I4RA 1Y1VB 5CV9A 1WTQA 1CHPD 3V2TA 4ARCA 3OWFA 2NVXB 4YIJA 5IT9L 5AUIA 4ZOHC 3IAS1 3E9SA 1TS4A 2TSSA 1XCQL 4N6EB 4HJGE 3VQIA 3W5VB 2EY6A 1Y56A 1MSGA 1FCLA 2GRIA 1B53A 1RJTA 3H94A 2FHTA 3T16A 1EM7A 1P7FA 1RFKA 1JQYD 1EYCA 2K5DA 1Y1WB 1QOAA 4U673 4C3IB 2KOLA 3PIP3 1TWFB 3RUZA 3NQTA 4X3UA 1HTPA 4ZUIA 2WIIB 4CJ2C 4F7XA 2RA4A 3NVWA 2MJ3A 1NYRA 1BR9A 2Z4HA 4OHJA 5FKAC 4FXDA 1XLQA 1WSPA 3HOWB 1HRJA 4WAFA 3P75A 1HA6A 2QDBA 2NYZD 2FJ2A 1PFNA 3TEWA 4P2CB 1EIGA 3CRKC 1T6BX 3ITPA 1MHHE 3S16B 1VF5C 3NSWA 4JX1C 2F0LA 2I46A 1JALA 5LL6X 2PNRC 4XWTA 1PRTD 1QOFA 2PTLA 1B9NA 2EE1A 1HCZA 2WXNA 1W6KA 2A6HC 3OIPA 1A2UA 1VDVA 2YU9B 2H88B 2IL8A 3BVGA 1YNJD 1EEID 3KWLA 2SDFA 2H89B 1DXMA 2J52A 2K5WA 3AEFB 3MHBA 2GI9A 4HMIA 2WXQA 1L5PA 2EYJA 1F2YA 1IKMA 5DNFA 4HROA 2PZWA 2MJ8A 3AE6B 1I4PA 2INPE 1EWCA 1LTGD 3C8YA 3T51B 3VYSA 4LJZC 3AEBB 4C1NK 5KNCA 1UWXA 3SK8A 4V190 2FFKB 2F0JA 1NENB 2LMCB 5IGFA 3AU7A 4A8XC 1I4HA 2DNEA 2PKOA 5K36H 5M5YB 1HUNA 3D4DA 2PLPA 2VNUD 3M7GA 3EVQA 1KF6B 2K03A 3W1SA 5D65A 1F9RA 3DM1A 1TWCB 4RGOS 5C2TB 4Y7NB 3T53B 1DGJA 1GUWA 2W82A 2BDNA 2MUYA 1AYFA 1SXTA 3NS1A 1PTOF 4HEDA 3VYRA 3NZ3A 1OXTA 2PZUA 5A35A 2XWJB 3GD7A 4IZ8A 4IUUA 2VB3X 4FXGC 1NR4A 1TU2B 4NDXA 1UAPA 1F2RI 2WXKA 3R2IA 4RWSC 4KY7A 2XN9C 1X3PA 1BDOA 2LUMA 5EE9A 1SDFA 2YEPF 4CBVA 1O7LA 1H9SA 2WKDA 3GTQB 4RH6A 1GB1A 1TYGB 1C8CA 1JB3A 3MEHA 1U4RA 3MXNA 3C1FA 3HVDA 5EKIA 4XTCS 2SNMA 3B9JA 3DWAA 1PZKD 1HFNA 1HTLD 1SE4A 3TZDA 1LO5D 1ONLA 4PT5A 3PO2B 2LHEA 1J8IA 3IAYA 1GPXA 4K2LA 3M85A 2L32A 3GS2A 1DOXA 1T3QA 1DOYA 2B2WC 3RLFA 2F0VA 4R9WA 3S2DB 1Y8OB 4M8AA 4NZLB 1R7SA 3KK7A 3D4RA 3NUCA 2QILA 1YNND 2E76C 3LX0A 4X3TA 2JXTA 4HMJA 1BNZA 1MI2A 5G3LD 3P4SB 2WP8J 2EVBA 1KDAA 4PMBA 1FNWA 3HZXA 3J81E 1YNTE 2KWDA 4FXCA 1DOKA 1ICWA 1XLPA 4WORA 2I38A 4RGMA 3Q8EA 4I7ZC 4JPSA 1PYWD 2AQ3B 3U9SA 3P63A 3NVVA 4WRDA 4JE3B 3VR2A 1JWAD 1PUTA 2BT6A 1A2TA 3J7AV 3QJYA 3U9OA 3ZYYX 3S17B 3TEYA 2WXRA 3IL8A 4BWGB 2KA7A 2V3PA 3BDCA 2K5PA 1J7CA 4Q0FA 1O7YA 2JQRB 2BBCA 5EGTA 2ICIA 4TKOB 1E0ZA 4IKGA 3BDLA 3CIRB 5EE3A 2RDGA 1CM9A 1JOKA 1C4CA 4J3OD 4WWMA 5EBCA 1IGCA 2BOSA 2JZPA 2SNSA 3ABVB 4ARIA 1XWEA 2D5DA 4USAA 4IFDI 1S4ZA 5I2YA 5H92C 3AB9A 4G7ZC 2L11A 3TZUA 5C5MA 2BDOA 4MIUA 1CI3M 2O2LD 4EQNA 2O5JC 1C78A 2NBFA 1BUIC 4YSYB 3NVYA 3PZ7A 1SMYC 3S9WA 3FAHA 1SB3C 4JBWA 5HI1A 1ZP0B 2M0AA 4IALA 5C3WA 1GB4A 5I6WA 2W3RA 3P1MA 4ID6A 3LB8C 2L83A 2Y5CA 3NUHB 1QG7A 5E1FA 3HEJA 1OFFA 2MPMA 1PZJD 1EY4A 5E6JA 1GXDC 3OWEB 1DJRD 1YNJC 4DK0A 2CU3A 3I3CA 4DAVA 2WXJA 3IXSA 1I6HB 1DM0B 2H1EA 2JA7B 1V8CA 5CBAE 4IN3A 2E6XA 1S5CD 1U9RA 1ENCA 4ZHOA 2JYOA 2RPVA 3A54A 1D4BA 3P4PB 1YQ3B 3A55A 2MJEA 2R3ZA 4NAWB 3SK6A 3M4YA 1EWHA 1KTKA 4ZQ3A 1DYQA 5DM63 4KKSA 2WV6D 3HOXB 5JEAJ 4K14A 3HG9A 1GHJA 2LKVA 3MWYW 4UDUC 3Q8AA 3PMFA 2VZKD 2WXMA 4JK1C 3GTKB 2DBYA 3AE1B 1E2WA 1QB5D 1B3AA 1H9MA 4A6QA 1W6JA 4C56C 3GTPB 4X3SA 1PXUA 3K5LA 1RDPD 4EQOA 1AZQA 4KHZA 2AUJD 4IURA 1EL0A 2IGHA 2EDGA 1SE3A 4ZRPA 5F2DA 3HVZA 4XDXA 2A6HD 2IX1A 2ENBA 2EJMA 2RVLA 2EJFC 2EYLA 1S5ED 1N63A 3G6JB 5I9OA 4Q2JA 1LT5D 1N5WA 2E2DC 5DAUA 3TDQA 1RTNA 1L0YB 3PUYA 4KJOA 2ONQA 4RF1A 1EU4A 5C4ZA 3HOUB 4A3JB 1K53A 4DGZA 4C2MB 2Q8RE 4DN4M 5C3XA 1B2TA 3QIAA 3FC4A 2O4XA 3WCQA 1SAPA 1S5FD 4KTAA 5CV8A 2J4XA 4J6HA 4YSXB 1SFOB 5TSSA 2MH7A 3C1EA 1D5ZC 1X32A 2N9LA 3K0YA 1CA5A 3VRBB 3FPUB 3B2GA 1T5EA 1ZE3D 1NVID 2MEKA 4O42A 2EKIA 3HOYB 3MZ5A 1QWYA 1PTOD 1WD1A 4KKUA 4XIGS 3AMZA 1IYVA 3SR1A 2G1EA 4DA2A 5BYSA 4OW0A 1Z6HA 5C4XB 1YNNC 1H9SB 3H09A 1FXAA 2K22A 5M5XB 3SDZA 4GZYC 2JEAI 3W9CB 4F88A 2K33A 5I6YA 5I9PA 4ZLTF 1MHXA 2DNCA 1F9PA 3TN2A 5A2QL 4MT5A 1E7PB 2NWGA 4HR7B 1JORA 2HQEA 1H9KA 1QNUA 4FO2A 2ZW1A 1KH0A 4BBSB 3J7AF 1MI0A 2Z8LA 1TIID 4NMZA 2OT2A 4CKCA 1KLUD 3L3OC 3NTKA 5M3FB 3NWSA 1PGXA 5K5PA 4A3FB 1SNMA 3GP7A 2JE6I 3I4NB 3BYYB 1I3QB 1IGDA 2CQAA 2F0GA 1ML0D 1YN4A 2L52A 2EOTA 1PFMA 2FUG1 3GTOB 4C3JG 3M4OB 4N9TA 1V43A 2ID0A 1B4OA 2MGSA 5C5LA 5EKKA 1XO3A 1OXXK 1RKNA 3ZGZA 5C0XH 1LT4D 3PUWA 4B9XA 1TKWB 4OO1H 4YTMB 3BK1A 1JOOA 1M8AA 3AE4B 2DYMA 1GUSA 2I07B 3LYYA 2RSNA 1EY8A 2DYOA 1FRRA 3FPPA 1G8ZD 2LGIA 2K7VA 4HCSA 5C0XG 2KMMA 1TKEA 1FNVA 2QJLA 3ERQA 1XX8A 3NWTA 1E2ZA 4OO1G 1E0BA 1Q10A 1KNEA 4IUVA 2Q5WD 1G291 3AEGB 3I73A 1UUPA 1CHQD 2Z4IA 2K9XA 3QB3A 1K52A 1ZYRC 4FF4A 4NW2A 2EYMA 3TP7A 1MBYA 3EUB2 2EY5A 1STNA 1LV9A 2KCNA 3C46A 2X6GA 4RKBA 1SSOA 2J7ZA 3NBHA 1VJKA 1A15A 4IOIE 3CQZB 2F0OA 2HUGA 2F4IA 4M0WA 3AE3B 3KLSX 1EU3A 1HZ5A 2GB1A 2BS2B 1STYA 1VZ6A 1QLBB 1ET6A 3GTJB 4ZHPA 3P42A 3W3AA 5EPKA 4KY6A 1STEA 1CZGA 1E10A 2WDRB 3DWGC 3QO2A 1V1OA 1EZ6A 3BZDB 4DNTB 1ENFA 3PIO3 1SMYD 3NK9A 1QQRA 1BCPF 2PVOD 1N62A 3MA2B 2B2VC 2BW2A 1ZPSA 2HCIA 4LMQD 1PTOH 3I70A 4XT3B 2C5CA 1YJIA 3A8IE 1EY9A 2K5QA 1Q90A 1JOQA 5IODA 1A3UA 4DFAA 1CZPA 1HEZE 2WXLA 4K8IA 2EXZA 1JQ4A 3Q24A 3L9AX 1WTVA 4IUTA 3T13A 1YQ4B 1KDCA 3FDTA 4GDKB 4WIPA 4YSZB 2E3TA 2Z1CA 1HHVA 1SYBA 1DOMA 3I4LA 4A3BB 4ZYSA 4H7BA 5KNBA 1N60A 3HKZB 1BOSA 2D62A 2PVGC 3Q69A 1OXSC 4TMAB 1STGA 1EIHA 1SNPA 4IFDJ 5J1ZA 5JEAG 3L4PA 3P4RB 2AWNA 2XIWA 5JVH3 3AN1A 2I2YA 1PRTB 4BBRB 1D5XC 3E5SA 4C7ZA 1QE6A 5T1GA 1LTRD 1PTOC 1TT2A 3GTMB 3GO5A 5BN4A 3SEBA 4LK0M 3TP6A 4N9PA 2JA6B 3BVMA 1OQQA 3K5MA 3N6RA 5J22A 1EOTA 2OHFA 1F0ZA 1GHKA 1L0VB 2LJIA 2BB5A 3VR4A 4NP5A 1FGBD 1HQRD 3KLRA 2X38A 2W54A 1LTTD 1FXIA 3UI3A 2QIEB 1NUCA 2BS3B 3N9YC 1IBXA 4KMUC 1QNKA 1TKGA 4R8NA 3JAME 1HXYD 4XE0A 1STHA 2A69C 4PV1C 3PV0A 5J39A 4KX6B 1L6VA 2MJDA 4A3KB 2NVTB 3GTLB 3V96A 3P1HA 4QB4A 4LAAA 2FINB 2SEBD 1GUTA 4DQOC 2NN6H 1SNOA 3S15B 1Y8NB 4YT0B 5IGCA 1NEKB 2L4NA 4A93B 3J81L 1JW9D 2V0GA 5EKLA 4YTNB 2LY7A 4H13C 1K51A 1B1ZA 2BE5C 2NN6G 1QKZA 3DUZA 3RPFC 1XEEA 2QSDA 2L1BA 5CMDA 3K6OA 4C3IG 1K83B 2DLBA 3CU7A 3CKIB 3D3RA 3DHQA 4CJ1B 2WXGA 1J7BA 3A8KE 2F0NA 3PZ8A 2NUCA 1SE2A 2EPBA 2IGDA 3B2FA 2BA1A 4L6TB 1U4PA 4XWWA 4IUNA 5FO9B 2F0PA 1VR9A 5EQ0A 3BWUD 1AN8A 2WXFA 1XLOA 4JWSC 2IX0A 5EJWA 5T8IA 2WXHA 5KYLA 3FMCA 2XSCA 3U2SC 4OGQC 4Q5VA 1EWYC 2A74C 1UWMA 2F0IA 2K6AA 4R8IA 5JPMC 5CV7A 1PLFA 5EE0A 2IX3A 5KGUA 2B2YC 1C4PA 1O80A 1KRHA 3T4AC 2PW5A 1L0XB 4A3MB 1EYAA 1UNSA 4RCNA 3U7ZA 3RZOB 3BK2A 3VA7A 4TQ1A 1K50A 1EZ8A 1JC7A 5M9OA 1R4QB 4B0EA 2B2WA 5C6AA 3MAQA 4REZA 4JWUC 1HQMC 1TJEA 3ETRA 4C3HB 3PO0A 1V8QA 5E4WC 1L4ZB 2PW9A 1QOBA 2C9OA 2WDVB 2JU6X 3BDOA 1FEHA 2J0TD 4ZRQA 2N9KA 3DEOA 2CHBD 3NQIA 1FCCC 4ME5A 4RHSA 3OMGA 1RTOA 2IDYA 3M3YB 3VR9B 1B9RA 5ELFA 4MH8A 3L7ZC 3ND9A 4DNRB 4WURA 2M19A 1KFYB 1HUMA 1S5DD 4G57A 2W3SA 5KRUA 4OL7A 1VCIA 1F9SA 2F0FA 4E6IA 4XDCA 3MP9A 1N5XA 4BY1B 4HSPA 1ZYRD 2JEBI 1HA5A 2BCOA 4AS1A 5E3FA 4G7HC 2WXIA 2IGGA 1KNAA 3QOLA 5HURA 2QCPX 3QG1A 5C3EB 3I57A 1CTMA 2AQ2B 3NHHA 1IYUA 3FVQA 5CV6A 4TQUS 3SE0A 2DY8A 3IKJA 2M56B 3HRZC 1FYCA 4KY5A 2IPKD 5BMGA 2QMTA 1WVLA 2B8FA 2BA0A 1YN3A 5IGDA 1BCPD 4P16A 2PCFB 4LTUA 4OIJA 2OXPA 3TBIB 3R2TA 5ELCA 5BYQA 3HOVB 3K59A 1Q8IA 3I4MB 4DAYA 2N55A 3DEPA 3HUIA 1LTBD 1DOIA 1FD6A 2B8GA 1YN5A 3D8GA 1XXGA 1PGAA 2TMPA 5HGTA 4L63B 4IDIA 3EA6A 2LHDA 3C2PA 1I4QA 1XF5L 4BA1I 2WACA 4F8MA 2J53A 3IT6B 2F3WA 1ESFA 5EPLA 2AWOA 5C4JB 4QF4A 4IUPA 1I50B 3MJ5A 5IOCA 1XYIA 2XRQD 1HZ6A 5C0XI 1SYDA 3GV6A 4RFBA 1G6ZA 2VZKB 1ZEQX 3NVZA 3LNNA 4AQ7A 4OO1I 2WXPA 4WH4A 4K6LA 2Y3AA 1I6VC 1KABA 1PFDA 3O13A 1TS2A 2OF1A 4XYOA 4XT1B 1B9MA 2QF7A 1MD2D 4L1BA 3RD4A 3Q23A 2EJGC 2HDMA 1AEXA 3AH7A 4RA8A 3KWVA 4TSSA 2N0SB 3E56A 3RMHA 2B2TC 1UGJA 2K28A 5T1IA 1TS5A 3NTIA 2F0QA 3DXJC 1TWAB 4HEA1 2O5IC 5M3MB 4NAMA 4O1NA 2FMCA 1SYEA 5COYA 1N61A 4A9AA 1E9MA 3T3NA 1IBXB 1F2ZA 3K5OA 3Q22A 3ZJUA 2WLBA 4C1NI 3FEWX 1MVKA 4PMWA 4OZAA 2K04A 3WOEA 1SYFA 5MPOA 5CV4A 4YXDB 1JR0D 1STBA 1EFID 1ROEA 1AWDA 4QIWB 3KBGA 2L0CA 3VA5A 2F0SA 3Q8BA 2RDHA 2CVRA 4KHVA 4EQPA 5LL6S 2A69D 2IW3A 1FIQA 4L23A 3TEZA 2V4DA 2ICEC 2KAJA 3A8JE 4PMCA 1JROA 4A55A 5KYIA 2RKSA 4U68A 1JWUD 3H91A 2F0MA 1LTAD 1D1IA 5ELBA 3P7JA 1PTOB 3OPOA 1PDXA 1NI3A 2R93B 3VR3A 2F0KA 5BYRA 2AQ1B 3IFTA 2M00A 3BYTB 2BE5D 2WNMA 1C76A 2YEPB 3R8BA 3AE2B 4XXEA 2EY2A 1BBXC 2JA5B 4KKTA 4K6DA 2PMVA 1M4VA 2K05A 2LFIA 3MXPA 2F0WA 2LS01 4RNAA 1F2MA 4KD3A 3BS1A 4N58A 3K7AB 4RGTA 2KVMA 2L9HA 4HTHA 5AFWA 3AE8B 1H9JA 5M5WB 2PQEA 4US8A 2KEDA 3MXGA 2GA4B 2F3VA 5BN3A 4KGTA 3GQBA 4XQJA 2KQ3A 2R6GA 5AUKA 1I4GA 2XWBB 1QILA 5FOBB 3IT4B 5HFYA 3R3OA 3SK4A 2FE8A 2EYOA 2EY1A 3CHBD 1G2SA 2RDFA 3D4WA 1RYJA 3A7AB 3OOCA 2V4IB 2HDEA 5KNDA 4Z9CB 3V3XA 1JE4A 3SXHA 4KN7C 1NYQA 3KUPA 4BA2I 3A7LA 4ODGA 3HOZB 1AZPA 2K01A 3R93A 1XTCD 1PDQA 4K5XA 2Y0SB 1F77A 2V3NA 1C77A 1SNCA 2KHSA 3AE7B 2KDMA 3NP8A 5HHDG 5KIXA 1D6EC 2KUMA 1BMLC 2F0DA 1R9TB 3NXWA 1WXQA 5JAVA 1I7HA 1JMLA 2JWUA 4NJCA 3ZJTA 2HTME 2MHVA 2NMQA 4MM3B 1B44D 1BCPC 1TVXA 4A90A 3D6WA 4XYQA 3V05A 4CJ0B 1K8OA 1A6XA 1DONA 4MHEA 1K8MA 4RHRA 5IGGA 3A56A 2PPBC 2INNE 2NN6I 4UAIA 4DK1A 3Q8CA 1B50A 1LABA 4A3IB 4F87A 1VRAB 2JX5A 5IT9E 1QOGA 3LXFA 5EE1A 4N59A 4D2KA 1C4QA 2NVQB 1QOHA 3AE9B 3FKIB 3BVZA 3MTSA 4XDDA 3ZJVA 4A3GB 1VF7A 4BS9A 4TQ0A 3TSSA 2E2HB 2XRSD 1TWHB 2XNAC 4HSVA 4FF3A 3OSOA 2KN4A 4DU9A 1WTRA 1SEBD 1JWMD 5NUCA 3NBIA 2HCCA 5JEAH 2D2CC 2XVSA 1IL8A 1BQQT 4ULLA 1QCBD 3S1QB 1VZ8A 2PZTA 4KKJA 1PFBA 3X3NA 4CKEA 5FO7B 1CQFA 3WOFA 3AEDB 3MFGA 3AM9A 4M1UB 3D6CA 4H0LC 5I2XA 2NB0A 3I90A 1ILQA 1TQOA 1CQVA 1C48A 1J7AA 4FP5D 4PQXA 3HS0C 3AB5A 3LWEA 2R61A 2WB1B 3K58A 1XLNA 5D14A 1BUVT 4L2YA 4MACA 3HGBA 2RQXA 5D7GA 1EEFD 1D2BA 3NTHA 3JAML 4V0BA 3TMEA 4ABNA 4A3DB 1RF2D 4OIKA 2B2VA 1GUNA 3CWIA 4QUCA 1NAPA 2B76B 4HAEA 3K5NA 3EROA 3S1NB 2ZT9C 2YYZA 3QWNA 3TP5A 2VB2X 1EY5A 5FR3A 2KCCA 1WTPA 3Q6SA 3DWMA 1NR2A 4KN4C 5CGKA 3F2UA 5K36G 4DF7A 1EY7A 2A6ED 3H6MA 2WS3B 2RBMA 1WCMB 2A68D 5BN5A 1Y69U 2JSOA 2QEJC 2KACA 1CFMA 1II3A 4US9A 5G5GA 2F0UA 4RKLA 3J80L 1ZOYB 1DD2A 2IWHA 1NSNS 1C4AA 1RODA 3NRZA 3AV8A 3T3OA 3KF8A 2FMMA 1JICA 3FILA 1J9OA 3LWUA 4YWGG 3BIID 2Y5PA 1VLBA 2KQ4X 4IQZA 3OHXC 3TP8A 2L5TA 1OXVA 5DEHA 1Q1BA 2EZVA 2OEOA 1ZXIA 3VYUA 4CKBA 1C79A 3OW7A 4G4KA 3GV3A 2CJOA 3HP3A 3MFYA 1DOLA 3SR6A 3I72A 3J80E 3U52E 2OEDA 1FR3A 4QCLA 5I4DA 3S2HB 3ZQ4A 3G7LA 3KQ4A 3KBXA 5H8YE 4K5WA 1X3QA 2L55A 4L8JA 5D3DA 3J7YW 1S5BD 2JXMB 2K0PA 3H0GB 1ZXTA 3S1MB 4FF2A 5C4HA 2K32A 1BF4A 1ZXHA 4FNFA 3EJIA 3X3MA 1IUEA 2D5GA 2L1AA 4WQMA 1SSNA 1MPEA 5JOBA 1O7ZA 3MHZA 4X3KA 5JXVA 1EY0A 1YJJA 1Z7TA 5C0XJ 3RZDB 1CT1D 1V1PA 4DXGA 1OO9B 1TR5A 1NCVA 1WD0A 1BXTA 1SJED 2LEKA 2E2JB 3IAM1 1RD9D 4J1MA 4ZRZA 1ENAA 3E0JA 1XCTL 1L4DB 1ET9A 2G9HD 3VR8B 2WDQB 2CW0C 5IIFA 2FBWB 2KEEA 3SHLA 2K3UA 3KLSA 2F1MA 2L12A 5ELEA 4FYDA 2CJNA 3Q8FA 3U4EG 1FNUA 2M2LA 3D31A 2IT1A 5FK9C 2KJXA 4R3DA 4RGNA 3VR6A 3GTGB 5HG2A 1SF0A 5JPNC 4WJWA 4XQNA 1AFPA 4HN7A 1D1KA 2B2UC 2PMZB 3S1RB 3SFDB 3RFZB 2JYTA 1OQRA 5CR3A 1WRIA 1KAAA 2PW7A 4HCEA 3TUOA 3P4QB