1TS3A

H135a mutant of toxic shock syndrome toxin-1 from s. aureus
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
194
structure length
194
Chain Sequence
STNDNIKDLLDWYSSGSDTFTNSEVLDNSLGSMRIKNTDGSISLIIFPSPYYSPAFTKGEKVDLNTKRTKKSQHTSEGTYIHFQISGVTNTEKLPTPIELPLKVKVHGKDSPLKYWPKFDKKQLAISTLDFEIRAQLTQIHGLYRSSDKTGGYWKITMNDGSTYQSDLSKKFEYNTEKPPINIDEIKTIEAEIN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TOXIC SHOCK SYNDROME TOXIN-1
publication title Structures of five mutants of toxic shock syndrome toxin-1 with reduced biological activity.
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Toxin
total genus 60
structure length 194
sequence length 194
chains with identical sequence B, C
ec nomenclature
pdb deposition date 1997-10-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02876 Stap_Strp_tox_C Staphylococcal/Streptococcal toxin, beta-grasp domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.110 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1ts3A02
3.10.20.120 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1ts3A01
1LLRD 1M4VA 1PRTD 1EEFD 1QILA 4RGNA 1FGBD 1B44D 1EU4A 4RH6A 1D5XC 1BCPC 1HQRD 1JQYD 1LO5D 1PYWD 1BCPD 1S5FD 5ELDA 2QILA 1SJED 1SE3A 3BYYB 1LTRD 1YN3A 3BVGA 1EFID 4UDUC 2RDHA 4OHJA 5FK9C 1FNUA 3BVMA 1D5ZC 1I4QA 1JR0D 1PZID 1RDPD 1PZJD 1L0YB 3W2DA 4ZYSA 1PZKD 2O2LD 1FNVA 1RCVD 1S5CD 1B1ZA 2CHBD 3BYTB 3O13A 3CHBD 1RF2D 5D3DA 4RCOA 1PTOB 1ENFA 1AW7A 1S5DD 1KLGD 3R2TA 1CHQD 1LTAD 3GP7A 1L0XB 2ICIA 5FKAC 1FNWA 2XN9C 1TS3A 1V1OA 2XNAC 1HTLD 1PTOF 1I4XA 1V1PB 5ELBA 1DJRD 4L63B 2AQ1B 1TS5A 1LT5D 1PRTB 4RGTA 4O1NA 1AN8A 5D3IB 1LT4D 2Z8LA 2WV6D 3BVZA 1ESFA 1MD2D 2AQ3B 2NTSA 1CQVA 1FD7D 1SXTA 1YN5A 1LTTD 1UNSA 2TSSA 4NZLB 5ELCA 4RGMA 3DWQA 1D5MC 1JWUD 1S5BD 1SEBD 1PRTF 1TY0A 5ELFA 1F77A 1GOZA 1HXYD 1KTKA 1G8ZD 1KLUD 2IJ0A 1SE4A 1I4GA 3MC0B 1V1PA 1CHPD 1XXGA 1BCPF 2SEBD 1TS4A 1ET6A 1I4PA 1BXTA 5ELEA 3SEBA 1TY2A 1D6EC 4RFBA 4K6LA 5TSSA 3BZDB 3KLSX 3EFXD 4RGOS 1CT1D 2NTTA 4DXGA 2AQ2B 2QEJC 3DWPA 1CK1A 3DWAA 1ET9A 2IPKD 4RHSA 1SJHD 4DXFA 1S5ED 1UUPA 1TS2A 1BCPB 1EU3A 1HA5A 1RD9D 2XRSD 4TSSA 5I4DA 1LT3D 4BWGB 1LTID 1SE2A 1LTSD 1DYQA 1EEID 2G9HD 1YN4A 1JCKB 1PTOC 1STEA 1PTOD 3MFGA 3EA6A 1PTOH 3OWEB 1LT6D 4L6TB 1SBBB 4C56C 2RDGA 3TSSA 1JWMD 4RHRA 3R8BA 2XRQD 1I4HA 1LTGD 1LTBD 1JWSD 1T5XD 1EWCA 1XTCD 4Z9CB 1I4RA 3URYA 3V05A 3R2IA 2J4XA 1PRTC 2R61A
chains in the Genus database with same CATH superfamily
5C0XG 1LLRD 3P4SB 4LF7Q 3RZDB 5IYBG 3S1NB 1R4MB 5EQ0A 2MBBB 4HJ9A 2QDFA 2Y5CA 4DAVA 4FXGC 4A3CH 3AU7A 2HIVA 5LXHA 5BYSA 1JQYD 5C44G 1NENB 1RIPA 1X65A 3I4MB 3K57A 4NPNA 2EMTA 4ZHPA 3L4PA 2BYTA 1KAWA 3FRPB 3EFUA 3QJZA 4YSXB 3K9PB 2PQAB 3RD2A 2F0TA 3AULA 1N34Q 2L8JA 1BNZA 2F4VL 2MHVA 3HOVG 2XK5A 5DEHA 4UPAA 2KCTA 1ROEA 2V4LA 2VL6A 3IT4B 3IFDA 1WY8A 2RQXA 3J80i 4EUTA 2W82A 1XTDA 4DK6C 1B1ZA 4NP5A 2CVRA 1K8MA 1OQYA 3NK9A 3FKIG 1EQVA 1KIXA 5DM73 1I3QB 1TWGB 4A3LH 2JT4B 4FXCA 3ZNGC 4LCDE 4RAUC 1IBXA 2NN6G 3EC8A 5E6OA 1EY4A 5C4ZA 2FIDA 3SR6A 1F9PA 1QNKA 4KD3A 1QKZA 4HTHA 1K83B 3JVZX 1V1PB 2J52A 2W3SA 4C3IH 4IFDH 2RSOA 4A3EG 1FPYA 4QJFA 1TKGA 2BYEA 1IBMQ 1VMPA 4FXKC 2F0OA 1TZ1A 3CC2A 3UIOB 4LNFA 1WTWA 2VZAA 3M63B 2JSVX 2F0EA 3RYTA 2VH2A 2MJEA 4NKLA 3NHHA 3KK7A 3DPDA 3BZCA 3H0GG 2ZTEA 2CHWA 3C0RB 4GIVA 2N55A 2HQEA 4GSWA 2IL8A 1JJGA 2K5PA 4HJ5A 4DHJB 3RN2A 4ANVA 2ON8A 3S14B 5KNCA 2GBRA 4HCPB 3QOJA 1XCTL 1V81A 4RA8A 1PYBA 2KTRB 1TT5B 2R2OA 3GB1A 4MSQB 1PYSB 2QEJC 3VA5A 2Q2TA 3TJPA 4C1NK 4HMJA 2IPKD 5JPMC 1S3SG 2BKRB 3U50C 5J22A 4RF1A 1D2BA 3M4YA 2HT1A 3L0OA 3RNAC 4ZRIA 1TS2A 1XNRL 1NNXA 2K5QA 4X66L 2HD3A 2F4VQ 3CQZH 5M3FH 2MJ8A 1BR9A 1XF5L 4ZUJA 1J19A 1RTNA 3K9OB 3TUOA 5C6AA 1SNPA 2F0MA 5COYA 2DGYA 3QG1A 3AFQA 3U7ZA 4PV1C 2ZPYA 4FJVB 1SROA 1PTOD 3VVWB 3ZNHB 4DR2L 1YIWA 4ZKBB 2NZHA 3R93A 2EYJA 4GS3A 1KM7A 1RAXA 4KGSA 5C0XH 1TWHH 1Y1WH 3OG5A 4QAYA 2PNRC 4H0LC 5GAGC 4GLSC 4K0KL 1JWSD 4HAEA 2M17A 4LNNA 2B3GA 1Z6HA 5C3EG 2FMMA 2J4XA 2NVTH 1HA6A 1V49A 4BS9A 1B9MA 2SDFA 2KBNA 4BBSB 3E9HA 3PUXA 1K0RA 1U5KA 5JJKA 4YXDB 4AWJA 4RH6A 4E6IA 2ZXOA 4GDLB 4OELB 4CDCC 2ZM6L 1STYA 4A3BG 4H02A 1F9QA 1LTRD 3UDXA 2K33A 4UDUC 5FK9C 1AH9A 4ZUIA 1TXYA 2VY3A 2C9OA 4BKSD 4MJSA 1WXAA 5EE3A 4DAPA 1SNMA 2K04A 4UP9A 2NVXH 4ZHOA 5KGUA 4CHTB 2DUDA 1I6HH 3HUIA 3RCZA 3QCAA 1JE4A 5CV5A 2DYOA 2LUEA 2FIFA 1QG7A 2NN6H 4HDOA 3S9WA 3UE1A 3SHLA 5L95C 1XT9B 3SVMA 1RF2D 5IT9c 1L4ZB 4KD4A 1S5DD 2N9LA 1UAPA 1CHQD 2E76C 1VQ5A 3W5VB 4AUQC 1F0ZA 4AH6A 4R4IA 2R2QA 1HFGA 3IBEA 2KJXA 1B53A 3IKJA 1L1OA 4A3IB 2CU3A 1CTMA 4YSYB 5AUKA 5G3LF 4PNYA 1C0AA 2MJ3A 2XTIA 4KZ0A 1MI2A 4HJ8A 1L0WA 4IN3A 4BOSC 2XWJB 1PRTB 2LHDA 5LMUL 2VQFL 4XT3B 1U4RA 4DPGA 3GTMB 1YQ4B 4DR2Q 5IODA 2LJIA 4XIGS 3D31A 1YNND 2JU6X 4NZLB 5IGBA 4B3RL 2F0VA 1KAAA 1DD2A 1SFOH 3EN2A 4J6HA 3APCA 2KKCA 1C77A 5H1SE 2RKSA 5IN7A 4K0KQ 1K53A 4XC2A 1CZGA 5C3XA 4OZCA 1DOYA 4DV7L 2BS3B 1V43A 4QCLA 4A3DG 1X3QA 2NZOA 3HOXB 2KACA 3AU5A 3ICEA 3T1YL 3SEBA 1Q7YC 1WGHA 1XD3B 1KDCA 1A2TA 3BZDB 4CJ2C 4FHKA 4RGOS 3L54A 2DY8A 3WALA 4ICVA 2ZM6Q 2HQLA 4DR4L 1B9RA 4DV6L 3A0JA 3NTIA 4ID6A 3V60A 2PI2A 5I9OA 4MSMB 3PCOB 3W1SA 4DA2A 2R92B 2ES2A 4N58A 3ULJA 2EE1A 2K14A 1C3TA 1UUPA 2XK5B 4ME3A 3I4NG 4A3KG 1LV9A 4NW2A 2N1VA 3QWNA 3N32A 4HJGE 3A4RA 1AZPA 1B3AA 1NE3A 1YEZA 1LT3D 5GQOA 2BDNA 2Y5BB 1H8CA 3TQYA 3L0WB 4N9PA 3KFUA 1LFDA 2BPSA 2Z1CA 4PMCA 3S17B 4HIOA 3B1LX 3MFGA 4Q0FA 2FHTA 5C3EH 3EROA 1IBXB 3DHIC 2R7ZH 2HHHL 3NY5A 2V9HA 1K0SA 4TKNA 1NEKB 2CHZA 4YTPB 3TEXA 3R8BA 1WYGA 4YWGG 2V0GA 2NVQB 2ALYB 5M3MH 4X3TA 2KJRA 3V05A 1Q5WB 3U9OA 1H9SA 5IP9G 3PIOA 5HI1A 2ZCCA 2OF1A 4CDEC 2FMCA 3GTJH 5LMUQ 2VQFQ 2KWCA 4M8AA 2B2YC 2RBMA 3HKZG 2B2TA 4DV1L 1IPGA 4IOIE 1PYWD 2KVMA 4X3KA 1WXVA 2K1BA 4C80A 1PV4A 1BCPD 4BY1B 1SJED 5KIXA 1C7YA 1ZXTA 2NPTA 4LDTB 2CCZA 2VNUD 2JQRB 3HM6X 5JVH3 3DVNU 4G0NB 1FNUA 2WXHA 1E9MA 4KKJA 4ZYNA 1D5ZC 1Q86C 1CZPA 4JWSC 1II3A 2HDMA 4O2DA 4DV7Q 3VTWA 2KECA 4I6NB 3D32A 4R4QA 1TIFA 1OEYA 2IY0B 2K01A 3X23A 4CHKA 3FHWA 2YU9H 4EGVA 4DV3L 3F2CA 1FNVA 1JALA 5AJ3L 4DR4Q 3H7SA 4IOCA 4DV6Q 2VZKD 3CMEA 1P0RA 2F0GA 3CSTA 4OO1G 3Q14C 5D7GA 1ENFA 3FPUB 2VW9A 2JA5G 1IYVA 4WWOA 2KQ3A 2F0LA 4L8JA 2K5WA 3GTKB 4WJ4A 5CTRC 2CH4W 1LM0A 3CU7A 1N5WA 3A74A 1PH7A 2OWOA 5IY0A 2VQEL 3HOYH 3B9JA 1PTOF 2A6HD 4C3HB 1UWXA 4NJCA 3NVWA 4PT5A 3CCEA 4BBRB 1OQRA 4Q2JA 4DK5A 1FO4A 4P73A 3KYCD 2KTFA 2JA6G 1K3RA 1V1QA 2N78A 1UEBA 1HEZE 2WDQB 3ETRA 4ITKA 1GJZA 1K3BC 1EYGA 3BVZA 5HG2A 2NTSA 1L0VB 1NY4A 4PYUA 2HHHQ 4DDID 2TSSA 1RYJA 1JWUD 1ENAA 2A68D 5CC4A 1AEXA 5DPRA 1F77A 4WRDA 3I72A 4HXDA 1KTKA 4HJAA 3H9DA 4MACA 4C3JH 3K81C 4DUYL 1V97A 1TTNA 2ZPNA 4JBMA 2WP8J 4GOPA 2RCFA 1C1YB 4ANXA 3MHZA 1ZYRC 4B3TL 2JEAI 3AE2B 1JB7A 2DNCA 1HTQA 3S24A 4NDXA 4QL5A 3DEPA 3TBIB 1J7BA 2WXLA 1B70B 4ICUA 2VRRB 3STBC 4DV1Q 1NMFA 1JB3A 3EFXD 1JRPA 1LGRA 4L23A 4OXPA 2PKOA 1NDDA 2OT2A 3P1MA 4IDIA 4MJSB 3RZFA 1HPCA 3DQVA 1JJ2A 4K8JA 3RULA 3MJWA 3PREA 1ZUD2 4MGIE 2E3TA 3TS0A 1QZHA 1N63A 3D6WA 4OWWB 2RDFA 5IT9E 2PZUA 4B3ML 1JT8A 3PPAA 4LK0M 2R6GA 1AYFA 2IGHA 1GM5A 5AJ3Q 5M5YH 2X38A 2R3ZA 5E3FA 2NWGA 3I91A 1B7YB 2ZTDA 2HDEA 1RL2A 2FUHB 5IP9H 3Q3OC 5D6JB 1L1OB 1DONA 1SNDA 1BUIC 4RMFA 2XVSA 2KJ6A 3W5UB 1JE5A 3HZXA 2DN8A 2VQEQ 5TR5A 3U58A 2WX0A 2H88B 3HRDD 3F2UA 3A56A 3GO5A 1HE8A 1Y1VH 4KY6A 3IFWB 3IVFA 4YTMB 2PW5A 4IJLA 2L5TA 4ZKCB 3D4DA 2AWOA 3P42A 4TVAB 1DOKA 2GA4B 1QILA 2QEXA 4EZLA 5EE9A 1WYDA 1EU4A 1BQQT 1SF0A 4HSPA 4AYBG 3I2ZA 3CAMA 3N6RA 4K6DA 1D5XC 1OTRB 1QNUA 3AU4A 3R66C 4P16A 2WNMA 1WGKA 1ASYA 5C1ZA 2ZJDA 1RWSA 3CXCA 4DR5L 4HEA1 1BO0A 1YN3A 2KC2A 2MP2A 4XDXA 5LXIB 3DVGX 1UGMA 2OQKA 4QB4A 2K6AA 4DGZA 4DUYQ 1C79A 1LXDA 2OQ0A 2EXZA 1ZW7A 2D3AA 1I3QH 4B3TQ 3BDLA 4OO1H 3KUZA 2DLBA 2EOTA 3CQZB 1U9RA 5M3FB 3W2DA 2JA5H 2O6VA 3KWVA 2KOLA 1JQ4A 3PUVA 1RCVD 4HMIA 1JOQA 2NS5A 2CWPA 4P6VF 4QF4A 4UP7A 4LF6Q 2K05A 3PO2G 5GADC 4WQOB 3CP0A 3H6MA 4A93H 1TWHB 1Y1WB 2JA6H 3Q23A 4FA6A 4A76A 4FP5D 3VYTA 4KN7C 1Q82C 3TZUA 4B3MQ 1D7QA 1VDZA 2KN5A 5C44B 3PZ7A 1IW7D 2CJOA 1UF0A 2K3UA 2E2DC 2IHFA 3RNFC 2NVTB 5DCNA 3K5NA 1GB4A 3AEBB 2JXXA 3TP5A 4RGTA 3PSEB 4TUUA 3AEFB 5A2QE 2P5ZX 3OIQA 1LT4D 1SYFA 2PPBC 4I7ZC 5DPTA 1HTOA 3FEWX 1UNSA 2M56B 3V61A 1D4BA 1SRUA 1KRTA 2K6DB 3BJUA 2K1FA 4OVZA 2CWAA 2DY7A 2ZNVC 1GOZA 1WGYA 1H9SB 4RKBA 2KJHB 2KLGA 1CHPD 1BCPF 3NBHA 1UZXB 1B3QA 4X3SA 2AYOB 3QR8A 1ENCA 1NVID 1I6HB 3WAOA 4S3SA 1DCZA 2J42A 3KLSX 4PS3A 2JWZA 1V8QA 2NBVB 4FF1A 1YVCA 1VQPA 1Y69U 1GXDC 1VCBA 1STGA 1E8XA 4KHZA 2L11A 3DWAA 1K28A 3AQQA 4K7WA 1EY7A 1ICWA 2H1EA 3Q3FA 3BU2A 5E4XA 4GDKA 1SMXA 1X9NA 3KWLA 1VQHA 4G4KA 3TDQA 3SHQA 1I94L 5C5LA 2B8FA 2G9HD 4BXXH 1RLFA 2WKDA 2ZXRA 4JG2A 3H0GB 3A9KB 3LDZE 1XPRA 4BBSH 1EY0A 2N88A 1BT0A 1MSGA 1FD6A 2UUAL 2Q8RE 4C56C 1N33L 2KQ4X 3CC7A 1P98A 4OWTB 5IGEA 5I2YA 2VXWA 5AZGA 1LTBD 4QGUA 2DZJA 5IGCA 1EWCA 3G7LA 4IUNA 4PZ7A 1UWVA 2KDFB 3GZNB 3E9IA 5CORA 3M3YH 2K5NA 2FBWB 1U4PA 5HGQA 3D3RA 3BDOA 2DAFA 3AE3B 3NRZA 4G7HC 1G51A 1KLVA 2Z6KC 1FGBD 3C3LA 5H8YE 5IYDH 1YBYA 3TCAA 2EIFA 4NAWA 2F3WA 4JI5L 4WORA 4OWXB 1WI5A 4XWWA 4LF4L 1HNWL 1LABA 4FXDA 1KH0A 2H89B 2WXJA 4APVA 2JP1A 3P20A 4ZRJA 3BVMA 4GOPB 2VUMG 3I55A 1WGGA 3CCJA 2LY7A 5FOBB 1FL0A 3ZYYX 1V8CA 3P4PB 1WX8A 3ND8A 3F1ZA 1X6OA 2M9VA 4XXEA 4GN1A 1PH3A 4EZKA 2NMQA 1Q81C 3UINB 4HEDA 1X32A 3ABVB 2WAQG 1R4NB 3OW2A 1H9MA 1BDOA 2UXCL 2R93H 2EYPA 4GN3B 3MAQA 3BYTB 4HRSA 4RF0A 1GUWA 1UELA 5FLXE 3QB3A 1KLGD 2WB1B 1FR3A 1GUOA 5C3EB 2R7ZB 2C60A 3FKYA 1MJDA 5AUIA 1KDBA 1PHJA 4K5VA 4V0BA 3V6EB 1GAQB 2YTYA 4AQ7A 2JEBI 2YV5A 1EUJA 2F0JA 5M3MB 4XX5A 1OXTA 2M8SA 1I4XA 1DGSA 5JEAJ 1AE3A 1K51A 1QOFA 2N9PC 3WANA 4A3BB 3VYSA 3PRPB 1I94Q 1QOBA 1WX9A 1E2VA 3I3TB 3QAQA 2OJWA 1GUGA 3MWYW 4DNIA 4GN5A 2N0SB 3PGEA 2Z8LA 1A3TA 3AE5B 1MD2D 4B0EA 1C48A 2UUAQ 4J15A 2JXMB 2JA7G 2JZ3B 1I7HA 5IOIA 2GOWA 3GV6A 1CMXB 1V5TA 3GTLH 2WWZA 4EQOA 4DK1A 2SNSA 4KKIA 2HCIA 1JW9D 2VH1A 3DVGY 1G8ZD 3NS8A 4MH0E 4A20A 4DR3L 5T1IA 4GOCA 4X6AH 1F2RC 4B9XA 2O2VB 3GTOB 1G6PA 3M4PA 1PGBA 4YHHL 2YU9B 2BS2B 3VA7A 3DBLI 4JI5Q 4GLVB 4LF4Q 3ZO5B 2NTTA 1HNWQ 2D3CA 4OIKA 4TQ0A 1WFYA 5KYIA 2EMSA 2NB0A 5IO9A 3A4SC 1UWMA 4IC7B 2QIEB 4J1MA 1E7VA 3K7UC 1IGDA 2KWUB 2M0XA 2I5LX 2O6VB 4G57A 3HOYB 2DX5B 2KHWB 4F7ZA 1M90C 4YWKA 2GBMA 3Q8BA 3VYRA 1BMLC 1K8AC 3KF8A 3SR1A 1HZAA 3HKSA 4F88A 3RNUA 1ZKHA 3A9JA 4A75A 4C00A 4LF5L 1PTOC 2N9KA 4CJ0B 2BH8A 2FE8A 5G5GA 2B3AA 2ZEQA 2E2IH 5HURA 2QKIC 1YJ1A 2HJ8A 3KW5B 1P8LA 1UE6A 4A3DB 2B2YA 5JPNC 1JWMD 1BUVT 2EY2A 1SNCA 2LWPA 4R4OA 1YOVB 2PW7A 1XPOA 4IOAA 4FLHA 1HUMA 2JZZA 5FR3A 1LYLA 2PPHA 5TSSA 2MO1A 5K36G 4JGHB 4RM8A 3K59A 1M4VA 1VQBA 2F0DA 4RKLA 3DWGC 5LNK1 1EOTA 1G91A 2VUMH 2MBQA 1QB5D 4Y52H 2C5LC 1AWDA 3NELA 2V3NA 2L9HA 2WU2B 3N30A 3LXFA 5G5HA 2MJDA 3EFCA 4IM3A 5IP7H 1FCCC 1IBML 3HFZB 4OL7A 1HZCA 1HUNA 4DR3Q 3ZIMA 3VR5A 3NBHB 1ZEQX 4POFA 4R1JA 4XGAB 4I7AA 4L1BA 1EY8A 3AEVA 3H09A 4YHHQ 4MGZE 2WACA 1FIQA 1IYFA 2KWDA 4BVUC 2AWNA 2F0UA 5FLMH 4PYZA 1EIFA 4FNFA 4BBRH 2PW9A 2G45B 2D11A 2JA8G 2J7QB 1XQQA 5IE8A 2D62A 3TZDA 1XMQL 4B3SQ 1TWCH 1PXUA 1X3GA 4LNQA 3CRKC 3HOUH 2IX3A 3APFA 3OWFA 2M00A 1C4AA 3GP7A 1G2SA 3HGBA 2D5DA 4GKKL 3ER0A 2BGFA 2DYBA 2FCQA 2WHIA 3QA8A 2WFWA 2Q8IB 3I70A 3CD6A 1SB3C 3HKZB 1V1OA 4AS1A 3ERQA 2KX0A 1Y1VB 1PH2A 4LFAL 5D94A 1Q0WB 1DJRD 5EPLA 2Z0SA 2QSDA 1LT5D 4MN3A 4LF5Q 4O1NA 3SK4A 3PLVA 3WIMA 3EUB2 3RMKC 2YTVA 4KJNA 1YNNC 3FP9A 1FEHA 2CKHB 2PVGC 2ICEC 2L1AA 1SMYD 3M7NA 3I9V1 1BBXC 5ELCA 4A90A 3J81E 1ZXHA 1CKNA 3I90A 4F7XA 3B0AA 2F0KA 3H3VC 1KLUD 2Z4IA 1KNAA 1SAPA 1R9TH 1AFPA 1SE4A 3ZDTA 2MQJA 1Q12A 2SEBD 1XEEA 4IUVA 1SIFA 3ECIA 2BDOA 2JA5B 3KH0A 4NAWB 1ET6A 2JA9A 4KY5A 1D6EC 2KLCA 3WCQA 3DHQA 3CIRB 2Z59B 4HKQA 1TKYA 5H92C 1Y14B 1A15A 1L4DB 4HR7B 1KRSA 1HZ5A 2WXPA 2EJMA 2MGSA 4L5QA 2EJFC 2RVLA 1KOTA 1X3FA 5LL6X 2CQOA 2I38A 1E2WA 3PGZA 1J9OA 2MP1A 4A3FH 4A93B 3CCLA 3PO3G 3X0WA 4RHSA 4K2KA 2JA6B 3AEEB 3H15A 1O7LA 5M5WH 1WJNA 2JY6A 3SGIA 2F0SA 4DV0L 3IAS1 2N9XA 3N1ZC 1DYQA 2K75A 4WQMA 3X3NA 3I63C 3SDZA 3A1QA 5J18A 1XMQQ 3UE0A 5KNBA 3VRAB 4JYAL 1U0LA 2IZVB 1SBBB 4GKKQ 1N62A 4AJYB 2OCEA 3CMAA 2Y0SB 1ISNA 2D07B 5IT9L 2AKWB 2OTJA 3APDA 2HE7A 4M8NA 4RNAA 5BYQA 1GO3E 3UDGA 1YNXA 2L4NA 1E10A 2EYHA 4LFAQ 1D8LA 1HTPA 4HCSA 1R4QB 3MFYA 4IPHA 5T1GA 1PFBA 1WTXA 1C8CA 4HCNB 2B2VC 1BVSA 1KNEA 3CF5A 4GZYC 1FYCA 1NJIC 4B9KA 5EGTA 4US9A 1MSHA 3NVZA 4IJHA 1UE7A 1BCPC 1GUNA 1E7ZA 3NZSA 2XIWA 1T0RC 1G291 3MEFA 1WTPA 1A70A 3PO0A 2N4FA 4WIPA 2AL3A 2C7NB 4OHJA 5IOCA 2GRIA 3I7FA 3DBHB 3AYHB 4A3MH 3AE8B 2CH4A 1JR0D 2NCNA 3EJIA 3OLMD 1P3QU 1T3QA 5IYBH 4K81A 3WAMA 3AEAB 1I6VC 3Q69A 2LGSA 2AUKA 1M8AA 1EUVB 4IG7B 5C44H 3MC8A 1DXMA 3U7DA 1A8VA 3T1HQ 3LWEA 5CBAE 3CCMA 4URKA 2BB5A 5J2RA 1WCMG 4MELA 5EPKA 2FCMA 2AEHA 2G9DA 3BZKA 1BBWA 3VR3A 3PZDA 1L0XB 1Q1BA 2BQQA 1QE6A 2WB1E 2A6HC 3GTQH 4AYBB 1HNZQ 3HOVH 2WU5B 3KF8B 1GNUA 1MHWC 4DV0Q 2BT6A 3A9JB 1X3EA 3M3YB 2EQSA 2MW5A 3KBGA 1C76A 3ALBA 4ZDVA 1WXMA 2Z6BA 4WJNA 1YQBA 3M3JA 3FKIH 4JYAQ 3KUPA 2A4ZA 2JQOA 3Q8EA 2A68C 5M9OA 1K52A 1PDXA 4MM3A 2UUCL 5M5XH 2A8VA 2IY5B 3G71A 1DOXA 4XQQA 1XLPA 4FHJA 4EX5A 3GTGH 4JX1C 2EZVA 2D3GA 1MJCA 4EQPA 3A8KE 1VQNA 4OEMB 3L16A 2F0NA 2EVBA 2M0AA 4A3EH 3CPFA 2N49A 4GLXA 4G11A 3S16H 2EKEC 1ESRA 2F0PA 3NXWA 1Y56A 1ILQA 3I73A 4RFBA 5A35A 2R93B 3AB5A 3A7AB 1EO6A 3E3XA 1GKHA 4U68A 3LB8C 1HZ6A 3DWPA 3VUWA 1GD7A 4IZ8A 4IFDJ 1CJEA 4AQYQ 4IM2A 1ET9A 1L2FA 3H0GH 2L12A 4JBWA 1WGDA 1PQSA 5I2XA 4NB3A 4DR6L 4K7UA 3DMUA 3OMCA 1KRHA 3FC4A 2AMCB 2QDLA 4OX9L 1XLNA 2Q2HA 1EYCA 3ZW3A 3K5OA 1O80A 3RMHA 3ONAB 5BN3A 1KL9A 3IL8A 1WJUA 2G1EA 1F2RI 4LJPB 3K58A 3VTVA 2CR5A 2C7HA 4CYEA 4WWPA 2AWTA 3F2DA 4X62Q 4KSKC 3EA6A 1IKMA 1PTOH 5I9PA 2R7FA 4PK1A 4DNRB 2Z6KA 4X64Q 3TEWA 1N8RC 1PFDA 1STBA 1KABA 2KDIA 2RDBC 4S17A 3GTLB 2ASBA 4EVOA 3T8MA 1T0QC 1Q8IA 1I42A 3BG3A 2VB2X 4TMAB 5GAEC 1VDVA 3U2SC 2B63G 2IGDA 3J7ZC 2E8GA 5CV9A 2KX3A 2EYMA 3D8GA 1YJWA 4AIMA 2CKZB 3F8TA 2MNAA 5LMNL 3DDCB 4HIMA 2JPHA 5FO7B 1VQ9A 3PMFA 4ILWA 1LACA 3OMGA 2A5UA 2JF5A 1LO5D 2ZCBA 3EGRA 1CKNB 4DV5L 3PT2B 2DAJA 1S5FD 2NVUI 3UI3A 2EJGC 1KFYB 2UUCQ 2DNFA 1PA6A 2INPE 3GE8C 3D4RA 2NVYB 1FGUA 2B2WC 3J7AF 3NENA 3QQ8B 5LL6S 1XJVA 5E6JA 3VH4B 4EFOA 2WIIB 1Q90A 5LMNW 4YL8A 3VQIA 3NS1A 1NR2A 1HCZA 5IGGA 2JX5A 3EIVA 1L0YB 2Y5PA 5AZFA 3A55A 2O2LD 1V86A 1FVIA 2ZVOA 3PIO3 2CW0D 3VR4A 1B50A 1SYDA 3GZNI 1S5CD 4A3BH 4ANWA 4LJZC 1MHHE 2BTEA 1WR1A 1UE5A 2DJFC 1GVPA 2FXQA 2IY1B 1NR4A 4Y7NH 2UU9L 2E2IB 3AXCA 5FO8B 3W5OA 2LKVA 3WOEA 1MG8A 1NYRA 2WQYB 1YJJA 4DR6Q 1AP0A 5I6WA 4P1CC 3KLSA 1UD7A 2NBWB 4OX9Q 1IW7C 1MG4A 2PZTA 2K4KA 1SE8A 4IWOA 5AZHA 3VH3B 2EY1A 2TMPA 3ML8A 2YTXA 4E3CA 4UAIA 3T51B 3HM3A 3KQ4A 3TL5A 2K28A 3M7GA 3GTOH 4NXML 2VUMB 1E8WA 1VJKA 4YWMA 1HNXQ 1F52A 3PZ8A 3CKIB 2W55A 2WXIA 4OZAA 2RF4A 3OW7A 4W9GA 1R4NI 1EY5A 3VRBB 3BWUD 1OFFA 2N9EB 2WAQB 1E0BA 5IYCG 5JHBA 4UY8C 4KLKA 4DAMA 4JIOU 2JUOA 3RNEC 2L0TA 2UYZB 2KHJA 3DM1A 1TS4A 4BY7G 4W9DA 5LMNQ 1OEYJ 2PCFB 2LGIA 5DPSA 4FVMA 1K50A 1CT1D 1RRBA 4DV5Q 1O78A 1PFMA 4DXGA 2MO0A 4KDLB 4LF8Q 2EYOA 4M02A 3HOUB 1JC7A 1TWCB 3G6JB 4IPGA 1QVGA 1I5FA 4PMWA 3N3KB 2PEAA 3M62B 1PGAA 4DXFA 1NBWA 4WAAA 1GPXA 2GI9A 4P71A 1GHKA 4A3DH 5EE1A 1F2MA 2K03A 3H3VI 1MKHA 1J8CA 1WXQA 2K5HA 1WH3A 5BMHA 3S1MH 2RSNA 1B4OA 2LSSA 1G2TA 4DFAA 2JYEA 5CR3A 2EPBA 4DHZB 3GQBA 4DK0A 1Z47A 2UU9Q 3SK5A 2F0QA 1TGZB 4ZCKA 2K5DA 1IGCA 4C2MH 2MCNB 1SSOA 2CFMA 3I4NH 1FFUA 4A3KH 2INDC 1JWBD 3RUIB 1A63A 1W6JA 2HUGA 2K32A 4KN4C 4B6WA 1QUQA 1R9TB 2F03A 1XTCD 1YNJD 2K7VA 4KKSA 1E7PB 4LF6L 1KHIA 2ASQA 2KFJA 2Y0SE 2R61A 1ZOYB 3PRMB 1A3UA 2WX1A 5T8IA 4BKSA 3MXPA 2KVZA 1N6ZA 2L0FA 2H5XA 3AFPA 4P74A 2OTLA 4NXMQ 4K7SA 4MM3B 5FLXc 4MTNA 1MGSA 2D9UA 1FRDA 1XMOL 2YVCA 3DHGC 1C78A 4HPMB 1KD1C 2FJ2A 3PHXB 3BVGA 3HEJA 4LF9Q 3HP3A 2WXKA 3H1UA 4A3FB 1YJNA 2AX5A 4W9FA 3PIP3 2FUG1 2RR9A 3L08A 5M5WB 4LNKA 1TZOA 2A19A 2F1MA 4DHJD 1WRDB 3PIPA 2QMTA 3Q3MC 4JVZA 2V4DA 2B39A 3K0YA 5EBDA 4A3GG 3S2DB 1WWTA 2K8BA 2M4NA 4NQLB 2J0JA 4ASWC 4BAXA 4MHEA 3N52A 2KFKA 4DK3C 3AH7A 5D14A 3RI7C 1IHZA 2MHJA 2CHBD 2N3SA 4CBVA 5JOBA 1N60A 4AP4C 2F0IA 5D3DA 1E22A 3NUCA 1VQKA 1TR5A 3R2TA 3JYUA 3JAME 2QGQA 3RNGC 2BW2A 1TBEA 4A4IA 5HHDG 4G7OC 1WTVA 2Z9HA 1X54A 4YIJA 4AJWA 1TS3A 4GN4B 4IW0A 1A62A 3ZXRA 1KXLA 5JVG3 1STHA 4FO2A 4IUTA 4L63B 3I4LA 3UQBA 2KDEB 1W3SA 3IAM1 5E6NA 4FADA 2KDMA 2IW3A 2YYZA 3QX1A 2KA7A 5D3IB 5FJ8G 4C7ZA 1SYEA 4HDQA 4IQZA 1J0GA 1CKOA 2LJ5A 1EZ8A 2GBKA 4MH8A 4CKBA 4R9WA 4RGMA 2DHZA 1MI0A 3NTKA 4DR7L 1Y8PB 1WIAA 5CBEE 1F9JA 4A3MB 4H2AA 4W9IA 3MP9A 2PO4A 3MC0B 1R4MI 1EIGA 4JW0A 2WGSA 4FN2A 2JXTA 3PHWB 5C4JH 2BCOA 1CM9A 5E1FA 1O7IA 4ALPA 3C46A 4M00A 4L2YA 1E2ZA 2RCNA 1XMOQ 5HFYA 3UGBB 2JYOA 2WDVB 4N6EB 4A3JG 1OTCA 1Y8NB 4LLGM 3ZDMC 1VD2A 1XCQL 2MUYA 1QCBD 4CQNA 3R7QA 5C3WA 1VQOA 1PH9A 1T0SC 1S40A 1C4PA 1XPUA 1IL8A 1O7YA 3FVQA 4TSSA 1RD9D 3K7AH 3GTQB 1K8OA 1QQRA 2YLMA 3HOVB 4GU2A 4HJKA 2RHQB 3FILA 1LTID 1IXRA 3ND9A 3DLLA 3WAPA 1EEID 1JROA 4II2B 1MHXA 2JSOA 3W1YA 3FKIB 1I50B 1STAA 3H8HA 3TRZA 2BS4B 3H6NA 2B2VA 1JMLA 1V5OA 2LXJA 2KXJA 3WDNA 2NBFA 5M5XB 2NPTB 1XX8A 2KN4A 1PH1A 3GTGB 2KOXA 3A8IE 1ACCA 4MIUA 3N1YC 1CFMA 4XTCS 4A3EB 1S3OA 1JOOA 1PRTD 3S16B 4RGNA 2LGXA 3HOXG 1B44D 1ZE3D 3GTPH 3TP8A 3P7JA 3PLUA 4DV2L 1WTQA 1HQRD 4JI4L 3SFEB 5NUCA 2KNBA 3M85A 5ELDA 5DM63 2GVBA 4DR7Q 3ONSA 1QZGA 2A5HA 1WD1A 2HDLA 2R92G 4ANUA 1QVCA 1PH5A 2A73B 4OW0A 2DJGC 4DNTB 4IUQA 4GNXC 3S2HH 2CS4A 1RDPD 3NZ3A 2D5GA 1VRAB 4POGA 2ZTCA 3CCQA 1VQMA 2G4SA 1PZKD 3PRZA 4JBJA 2J53A 3MTNB 4YCVA 2FCNA 3ZTCA 4JI7Q 4DN4M 3VDYA 2KCNA 4K14A 3J81c 1YNTE 2DYMA 1PTOB 4P75A 1EWYC 2IX0A 2CHXA 2WDRB 1RM6C 4XYOA 2E2JH 1O7ZA 2D3BA 2K25A 2HIXA 3I57A 1Q8KA 1TWFH 5FJ8H 2WXRA 1VQEA 4WJWA 3J80E 2V1YA 1WMHA 3QIJA 1VZ8A 4KGRA 3GE3C 3RR5A 1ZXIA 3NPPA 1AN8A 3ML9A 3S2AA 1SMYC 3PO2H 1CQVA 3ZQ4A 1E3PA 2OJRA 4BY1G 3CCUA 3Q8AA 3DEOA 1NUCA 1QUQB 1PFSA 2D0PA 1HR0Q 2WXOA 1VR9A 2CJNA 5C3JB 2PNHA 3J81j 2B29A 5BN5A 3VR9B 5IP4D 2O4XA 3EBEA 5BN4A 1V1PA 3NQIA 1WTOA 2K22A 2K9XA 4A3JH 3EECA 1WCMB 3GDEA 3I3CA 1T9HA 2C5CA 4FBJB 4WJ3M 1E8YA 1SNQA 1H9RA 4YWLA 1AZQA 4JI3L 4DV2Q 4JI4Q 1QVFA 3PF5A 1H95A 4WH4A 2D0OA 3CCSA 3HG9A 1TKWB 2AQ2B 3CW2C 4XT1B 4KVGB 4LDTD 3KYDD 3ZNZB 2BA0A 4Y7NB 2MBHA 1CK1A 1J7AA 4MT5A 3UIPB 3MTSA 5JJLA 2A6ED 4LK1C 2IHEA 4WJPA 2CU1A 3ULPA 2WDTB 1OXUA 3IXSA 5I4DA 5BR8L 2AL6A 3TN2A 4BA2I 4M0WA 1NCVA 1ZGUB 4MEMA 3QHTA 4PS7A 5AEKB 4LWCA 2KFKB 4KDIC 4C3HG 2L55A 3HOZG 4IUMB 4NAMA 2KEEA 5I6YA 3TEHB 3OPOA 1YJIA 1E0ZA 1VF7A 4Q5VA 2KT7A 2KTRA 1F2ZA 1STEA 3L17A 1E6EB 3ZRFA 3ZGZA 2XBBC 4II3B 1LT6D 4A3CG 1A2UA 3JC66 3JAMi 4DHZE 2B2TC 3VHTC 3NTHA 5CHVC 1MJEA 2D10A 4EOYA 3GS2A 1E8ZA 3KLWA 2MP2B 3M4OH 1WSPA 4K3CA 3I56A 4PZ6A 1VQDA 1CA5A 2RD0A 1CI3M 2NVYH 4B3SL 4LUOA 1L6UA 1QLBB 3MHSD 1Y8OB 3CRLC 2IO3B 5G2NA 4K2LA 4R4TA 2F0HA 3EQLC 4OONA 4F87A 2B2WA 2K52A 1L7YA 2L52A 2LXCA 2PLPA 2IWHA 3ULLA 2BH2A 3VR2A 2NBUA 2G4DB 5E7NA 4N59A 2LUMA 1SYGA 4PQXA 3QWZB 1CZWA 3C1EA 4A8XC 1DM0B 3VR8B 1X3PA 4YTNB 1OQQA 3HOWG 2QDBA 1TWAH 2EKIA 2KVRA 2XSCA 1IYJB 1K8RB 2GN5A 2JRIB 1GJXA 4GB9A 1NMGA 3AM9A 1PZJD 1H4RA 4DXAB 1SGHA 4NXNL 1QOHA 4JI3Q 1BKBA 3S1MB 3PV1A 4C3IG 4IFDG 2C7MB 3LGJA 2I07B 3KUDB 1V9PA 4KMUC 3O13A 3CHBD 4JI6L 3OSOA 4RCOA 5CYUA 1EOVA 3TP7A 1C9FA 4MZ9A 2JVCA 4LUVA 2ICIA 4C2MB 4U673 1JOKA 5KRUA 4DUZL 3K80C 3I4NB 4A3KB 3FILB 1TVXA 5BR8Q 3RN9C 4ZAIA 2PE6B 3P4RB 3KF6A 2XWBB 1ZPSA 2FFKB 1T0YA 3PVLA 4ZRZA 4FF3A 3HHMA 1Y8RC 2W3RA 4HKZE 3T53B 1P7EA 1VLBA 5IWAL 4USAA 2KQSA 4GOPC 2V3SA 1PUTA 2BWES 1E1OA 3RZWC 4XE0A 1C4QA 5EAYA 3DBSA 1LTLA 2QCZA 4EQ5A 1E90A 2BF8B 3F2BA 4W9HA 1QT9A 4JOIC 1PVOA 3CPWA 1PRTF 5F2DA 2MRPA 5ELFA 2UUBL 2KMMA 4KIKA 2RPVA 1XWEA 2LXKA 4EEWA 1EYDA 2LMCA 4N8FA 1UEAB 2PI2E 1XXGA 2L83A 4P7IA 4GDKB 4IM0A 1TT2A 3CWIA 1DGJA 4K6LA 4QQBX 2ZVNA 5E4WC 4G50A 4DBGA 2JA7H 5JXVA 1N5XA 1HZBA 3DM3A 2VZKB 4LW1A 1YHQA 4V190 2KUMA 3CCVA 2HJ1A 2A74C 1N32L 1Y1WG 5D2MB 2UXBL 1WM3A 3B2GA 1VQFA 1WR6E 4NXNQ 2D2QA 1VQGA 3BY4B 4FYDA 3SDLC 3MXGA 5LLIA 1T5EA 5FO9B 3L7ZC 2E6XA 2WYQA 2LFNA 1JJCB 2NZ1D 3TP6A 4JI6Q 1XLQA 1VQ4A 4W9KA 3U52E 2YEPB 3I8ZA 3P1HA 4HVBA 4A55A 4BY7B 1B8AA 4JI8Q 4DUZQ 4IKGA 4IUUA 2KENA 3T1HL 4LNOA 1X1MA 3RN5A 5C5MA 4O42A 1WMHB 3SE0A 1DZ1A 5DPWA 4HPPA 5GROA 3J7YW 5IWAQ 5C4JB 3S15H 2FNJB 3V62A 4BOZB 3GD7A 3VUYA 5DLQE 1HNZL 4BKGA 4P1BC 3HOWH 4ZK9B 1MVKA 3SD5A 3S2DH 1P16A 4JLCA 1YQ3B 2BE5D 4ULLA 1M1KC 2INCC 2UUBQ 3ZXVA 2RDHA 4LMQD 2JWUA 4S0RA 4R4CA 4F1SA 4K5WA 2KDBA 3V96A 2Z0DB 4DAYA 5K36H 3G4SA 2N7EA 4W9JA 3K7AB 3GV3A 1U4LA 2MPMA 2GVAA 5BMGA 1GC7A 2JZPA 4ZRQA 2CW0C 4OVUA 1GUSA 5IA7A 2KYWA 5EPJA 1OXXK 2E75C 2BKFA 1Q46A 1WTHA 3MXUA 4O0AA 4JI1L 3UDFA 1IBKL 2D2CC 3W1BA 1EQRA 4ZLTF 3K8AA 1LTAD 4A6QA 5GAHC 1N32Q 1FNWA 2V4IB 3PUZA 2LRUA 4M0WB 5EKIA 1PH8A 3J7AV 5C4XG 1NSNS 2UXBQ 4G7ZC 3RUZA 4IFDI 1PH6A 4RMAA 1FJGL 4QY7A 2BVCA 3ERSX 4AQYL 2O5JC 3C2PA 2MFIA 4QIWB 4KHVA 2AQ1B 1E5WA 1KJTA 2RMMA 4D2KA 3L9AX 2JA8H 3DXJC 3GTPB 4NY0A 4XYCA 3JAML 2AQ3B 2X6GA 5CMDA 1PGXA 1SE9A 2MEKA 5BO4B 1LTTD 3T3NA 1Q10A 4WJQA 2A69D 1AARA 3DWQA 4MGYE 2WS3B 3N1XC 4X62L 1IZ6A 4A3GB 2MQHA 2INNE 2W9NA 5CX3A 4N9F4 1WE7A 3U4VA 1EQQA 3S1RH 5KYLA 4DF7A 4X64L 3S2HB 5GMVA 3TBLD 3ZKJC 3IAYA 4FDBA 3AI5A 1I4PA 1YITA 4J8QA 3BK2A 3OHXC 2I5HA 3WOFA 3NWSA 2LVPA 3Q0AA 4KZCA 3CC4A 2LGYA 2SNMA 2LASA 2K8HA 3RFZB 1WZ0A 1L6VA 2L76A 1Z7TA 1QJOA 5D65A 3LYYA 3ZJUA 2FINB 3AMUA 4FF2A 1DOIA 2IO2B 1CA6A 3DOWA 2KQ7A 2WB1G 3NUHB 2R7ZG 1I50H 1SJHD 2E2JB 2XEWA 1CKMA 1VMCA 3A8JE 1S5ED 2ZXPA 1EU3A 4JK1C 4TRDA 2IYDB 1YZ6A 1TWFB 1OXSC 5M3MG 1K8GA 1HJPA 2IGGA 5JHAA 2E2HH 4RWSC 3KJPA 1SE2A 3HIZA 1LTSD 2A1AA 1F9SA 4JI1Q 1IBKQ 1IL2A 2WXMA 4HROA 5C0XI 3CMMB 5EBCA 5A2QL 5DNFA 4XQJA 1LQBA 3PO2B 1GG3A 3O65B 4KK7A 3PO3H 1N61A 4M01A 3AB9A 4M1UB 1HHVA 2LS01 3BIID 1WOCA 3PF4A 4J6IA 3CF6E 1S72A 3TSSA 3KF6B 5IIFA 1C9OA 3L10B 4US8A 1LTGD 1YNJC 1STNA 1Z2MA 4N9TA 1FJGQ 2B2UC 3U4ZA 5JZEB 3A33B 3ZJTA 2PIAA 1SDFA 3R2IA 3DWMA 5C4HA 4ARIA 4A3JB 3RT3B 1RTOA 3E0EA 1X55A 2LEKA 3DBRB 1WD0A 1FMAD 3T3OA 1NAPA 3QK0A 4GNXA 1P7FA 4YT0B 4DQOC 1VQIA 3OOCA 3JAMc 3CCRA 1XNRQ 3DBLB 1X56A 4X66Q 3I4OA 2JRHA 1SE3A 4KIKB 2HTHA 3AE4B 4L5TA 5E6PA 2LMCB 1YHBA 3R3MA 1VS0A 1WVLA 1HNXL 2F3IA 2OEDA 1PZID 2F0FA 4WWNA 3AV8A 1J5EL 3HOYG 3Q8CA 2NN6I 4BBNF 4NMZA 3G6EA 4ZYSA 3K5LA 2PE9A 2H4OA 2O5IC 3ITPA 1Q1OA 2F52A 2M19A 5C4XH 3S1QB 3AMZA 2FCSA 1KDAA 1EL0A 3C8YA 3A5UA 3Q8FA 3R7RA 4JV5L 3MEHA 1WGRA 4KI0A 5FKAC 3E9SA 1NI3A 2PVOD 4P72A 2O6VD 3TMEA 1XYIA 5JH5C 3TREA 3IG3A 3M4OB 1NYQA 1V80A 1ONLA 4LF8L 3J81i 2Q2IA 2XNAC 1HTLD 3K6OA 4H7BA 2JN4A 4C3JG 4KGTA 2EDGA 4MTKA 5ELBA 2G3QB 2DZKA 4GGQA 1W6KA 2BA1A 3DUZA 1SLJA 4E71A 4LNIA 5JAVA 3T9LA 4HLEA 3LJ3A 3TIXA 1WCMH 2L3ZA 4ZRPA 1YD8U 3W1GA 2WV6D 5C0XJ 1ESFA 1ZP0B 4REZA 5CHWA 1FD7D 2IO1B 4BA1I 1GUAB 4GMVA 4BKTA 5ISRA 4NJ7A 1TY0A 2PZWA 1WI0A 2AUJD 4FJZA 3DHHC 3R3OA 3NZUA 3VXWA 3T4AC 2C35B 3KJOA 3J80L 3SXHA 2MLBA 1TWAB 2M2LA 2BWFA 1Q1EA 1SYBA 3H91A 1XO3A 4HK2A 4B0MA 2N8NA 4HIDA 4KHPL 2Q2UA 2K50A 1FFVA 1YX5B 1TY2A 4CDFC 2I0QA 3NHEB 2OXPA 2NR2A 1HFNA 2N7JA 4L5SA 3HKZE 4W9LA 1F2YA 3FPPA 2K0PA 3A1QB 3ENEA 3V2TA 1EYAA 4FF4A 3RZOH 3H94A 2WKCA 4C4VA 4DAYB 5FLXL 1T6BX 4XQNA 2IT1A 1KQSA 4IURA 3SK8A 5HY6A 4KY7A 3NJTA 3D4WA 1J5EQ 1SNOA 3IHPC 4LFCL 3I4MG 1TQOA 2NUCA 4EE2A 3U8ZA 4LF9L 2IDYA 4LUZA 1NTGA 2OHFA 1Y1VG 1SSNA 1CSQA 2KHSA 4B3RQ 1FRRA 1JWAD 3AEDB 3H3VH 3L13A 3QOLA 4K5XA 3AN1A 1JCKB 2G5DA 3M4QA 3NBIA 2KEDA 2IBIB 4JV5Q 4LJOB 3Q6SA 3HRZC 3FAHA 3MC9A 1J7CA 4I6LB 2HTME 3T1YQ 2DBYA 4M8MA 3TEZA 1FXIA 4UHVA 3J9CA 2PYKA 3B2FA 3LNNA 3CSFA 1PRTC 1IP9A 1D3ZA 4CKCA 4EQNA 3E5SA 1EIYB 1YHAA 3UDIA 3NSWA 1U4AA 3A9KA 2JA7B 1LM8B 1F9RA 3HVZA 1ZKOA 5IKCM 1WM2A 1PH4A 3AE6B 2KMAA 2I46A 4EKUA 5HGTA 2DWQA 2DZIA 2LZ6A 3HOZB 3AEGB 3MVVA 2PQEA 1EY9A 2ZT9C 3UQAA 1SYCA 2B63H 4A93G 4ARCA 3Q8DA 3J80c 3Q3NC 1BF4A 1VZ6A 2QC8A 3SU8X 2QHOA 3AECB 4KSLC 5JEAG 4KHPQ 1ILPA 2KCCA 1IKLA 2GB1A 1EFWA 3Q22A 4KV6A 1QOGA 4RCNA 1SIJA 2WXGA 1SR3A 2GBNA 4JI0L 5CHFA 1QF6A 1AW7A 4TQUS 2KC1A 5EKKA 2LGDA 3H7PA 3PQIA 3N20C 2R7DA 1C4CA 4TQ1A 2XN9C 3U30A 3ZUNA 3HVDA 1UGJA 2J0TD 1JICA 1SN8A 2PMZB 3OIPA 2Y0SG 3Q24A 2RA4A 2X6LA 3A7LA 4LFCQ 2HD5B 2RPQA 1A3VA 4PMBA 1V9JA 4XZ4A 3OTOL 3C19A 1RFKA 4JOIA 3BINA 2LD9A 2Q8TA 2L0CA 1ZDXA 4JI2L 1FM0D 2ZZPB 2WXFA 5J17A 1K73C 3S15B 3NVYA 3W9CB 5AFWA 5C23A 4WWMA 4K1RB 4ODGA 4QIWE 3HOWB 3WA0A 5CV8A 4JPBW 1RFAA 2RHSB 1EZ6A 3SFDB 1S5BD 4JPSA 2LFIA 2ACZB 3OJ4B 1A0IA 2ZW0A 5C2TB 5EJWA 4X57B 4J3OD 3KVFB 4DV3Q 2BYFA 4RG1A 1OO9B 4KTAA 4C3IB 4G3XB 3FDTA 3QO2A 3KDFA 5KEEA 5CGKA 2FAZA 2ZNVB 3MA2B 1S1QB 2L32A 4ME5A 4CDDC 1R4PB 4GNXB 4YCUA 3RZDH 3KOJA 3S1NH 1EF1A 4IWQA 5KNDA 3ZJYC 2K5VA 2QCPX 1VZ7A 3T56B 3I4MH 4BXXG 4UP8A 4AYBE 1E7UA 4TKOB 2J0KA 3BK1A 1RHPA 4CO7A 5HKHA 5IYCH 4BBSG 1YIJA 4JWUC 2A6EC 1EWIA 3AE1B 1WYWB 1GC6A 4JE3B 1QWYA 1MFWA 2I2YA 2DENB 3M9BA 1HA5A 2QJLA 2XRSD 4BY7H 3D0FA 2O2VA 3ZLZA 4GKJL 2REXA 2LHEA 5J3BA 1BBUA 1IYUA 5DAUA 3VR6A 1MIUA 2K39A 3U4EG 4DDGD 4BWGB 2KHIA 5LHY1 4WJOA 1HH2P 2GLSA 2JA8B 3X3MA 4P2CB 1B9NA 2ZW1A 4WURA 5IYDG 4JI0Q 4FULA 2QF7A 1W2BA 1Z5SB 2LRWA 2I1JA 2LI5A 1TWGH 4IWPA 1ZDVA 3P2BA 4JI7L 4RHRA 3J81L 1WJ6A 3BDCA 2DZMA 3JSVA 2JYTA 4NQKE 4AOFA 1TYGB 4BFRA 1N36L 1WF9A 2KZRA 1AE2A 4NNJB 1T5XD 3OTOQ 3S1RB 2MBEA 3NQTA 5EKLA 1G6ZA 1K83H 2ONQA 4XDDA 2EYFA 4JI2Q 5EE0A 2AHOB 1A5RA 1V2YA 1U4MA 1EF5A 3PUWA 2PJHA 5BYRA 4XWTA 4A3IG 1K9MC 2PTLA 1YI2A 3VFKA 4DWFA 2IX1A 5CV4A 1CQFA 2DNEA 4H44C 1WJ4A 1LUZA 2R93G 3TS2A 3LX0A 1E24A 2QILA 1YMHE 3GOEA 3TEYA 5JEAH 4OVVA 3Q2AC 4IUPA 1P9DU 1EFID 4OO1I 2Z0EB 3LWUA 1I4QA 1QOAA 1JORA 3WWVA 1RJTA 4DV4L 2EY6A 4KKUA 2J0MA 3V6CB 3S14H 4K3BA 4MDKE 3OYYA 3DVNV 2ATWA 2E2HB 2OEOA 1HR0L 4XDCA 4PZ8A 1UBIA 1WZ3A 3RNBC 4H13C 1EQTA 4C4VB 3EHVA 2ENBA 1VF5C 2Z4HA 1MPEA 1FXTB 1M94A 3PO3B 2KD0A 2MBOA 4JC0A 2E5LL 4DU9A 1WX7A 4PS8A 3K0XA 2NVXB 4ACFA 1HR0W 1VQ7A 2VS1A 4GKJQ 3NVVA 4A3GH 1EIHA 3AE7B 4HJ7A 3PTFC 1L2NA 1DOLA 3FMCA 4LFBL 4HSVA 4DR5Q 5ELNA 2RSUA 3PV0A 4ZRKA 1D1IA 3MXNA 4X3UA 1GHJA 3NOBA 3A54A 4E74A 1L1OC 1CUKA 2B8GA 4YY3L 2HCCA 4IO9A 1WE6A 3P75A 1EWHA 2CQAA 2QW7A 3B08A 1VCIA 1N36Q 2UU7A 4C1NI 2JJQA 1I4GA 4X65L 4PG3A 2PQAA 1ZYRD 4XYQA 1EY6A 1YX6B 3Q3JA 4KX6B 5J1ZA 2WINB 1TJEA 3QARA 4QUCA 4EZJA 3VYUA 2MA9B 1XLOA 3STBD 1D1KA 4IPDA 1SFOB 5C4XB 1H9KA 4HN7A 4NJ6A 4BBNC 1KC8C 2JK8A 3DBHI 3HS0C 3Q6BA 4OIJA 2MX2A 4B95A 5MPOA 1HRJA 3IRBA 2IO0B 1PMRA 2MH7A 2LVOA 1WJJA 3E0JA 2YEPF 3VUXA 3KBXA 2L1BA 1OXVA 4DR1L 3MJ5A 1VQJA 1FCLA 2KAJA 4DV4Q 1IUEA 4WAFA 3M95A 3A5ZB 3D6CA 5CV7A 2EY5A 5FR6A 2ZJQA 1R7SA 1UH6A 4R3DA 1S4ZA 1TIID 3J7A5 1J8IA 3HK0A 4W9EA 2B2UA 3W1SC 3QJYA 1BOSA 2WAQE 1YN4A 1YJ9A 3H7PB 4JCVE 2PMVA 1L5PA 1RKNA 4MNOA 3G48A 2E74C 1WFQA 5IAAC 3OAWA 5K5PA 4CGYB 2MSED 4KV2A 2KO3A 2ZJRA 4BZAA 2L05A 1Q3LA 2E5LQ 2K8CA 4K8IA 2KK8A 1XNQL 4YSZB 2L7RA 5IP7G 4N8X1 4A3IH 5KHQA 1GB1A 3NP8A 2WLBA 2F3VA 3EVQA 2JE6I 3URYA 2SAKA 1I4RA 2X69A 3SK6A 1F1HA 1A6XA 5EDSA 4FJYA 4LFBQ 3NWTA 4IALA 2QA4A 2I1KA 3AE9B 1EEFD 2EXDA 3KLRA 2GBJA 3L3OC 5L83A 4OGQC 1UE1A 2KWVB 3RLOA 4HIKA 3GTMH 2LVQA 4ZOHC 1UBQA 4WFN3 2BYVE 3P4QB 5FLMG 2L00B 3IFTA 2BE5C 2KCMA 4BBRG 4YY3Q 3NG0A 1MBYA 3RLNA 1QZEA 4JBKA 2EELA 3BYYB 3VAWA 3S1QH 3RZOB 2UXDL 1Z9FA 1P1AA 2LXAA 3HOUG 3KDFB 2KMCA 1HQMC 2X8XX 4RM9A 3RD4A 4TV3A 2N1WA 2V3PA 1IBLL 3N9YC 4X65Q 3GTJB 3IT6B 3OJ3A 3QC8B 3U9SA 4HPLB 1N9WA 4C7YA 3HOXH 4JQWC 1PLFA 2VB3X 5G55A 4A9AA 1WXSA 3E56A 1N33Q 3E6ZX 3RNCC 1VQCA 3K5MA 1JMCA 3NEMA 5IGDA 1NBFC 3P63A 2K6QA 2EYLA 2UWQA 5L37A 4B9WA 1TKEA 2WXQA 2R92H 3DBRI 4DR1Q 4YCWA 1VQ6A 2WP9B 4F8CB 1H9JA 3B6YA 2MWSB 3T16A 2OOBB 4OZBA 3W3AA 5BMIA 2B76B 3QIAA 4IPCA 5JJZA 4I6PA 2NYZD 3ZNID 2PMZE 2XGTA 1WRIA 3ZRCA 5J39A 4A3LG 1TS5A 2F4IA 1E1TA 4R8NA 4MGKE 4LF7L 4ABNA 3DCGA 1VQLA 3S17H 4F8MA 2GMIC 4ZQ3A 2SOBA 3VTUA 2BOSA 1YN5A 1SXTA 2A69C 3VDZA 4HCEA 3JSVB 1B2TA 1XNQQ 4R8IA 4GDLA 1D5MC 1SEBD 3I5JC 1CSPA 4HWIB 3RPFC 1ICFB 1VQAA 2L15A 2NVQH 1HXYD 3UI2A 1J6QA 1JRUA 3T13A 2IJ0A 4A3FG 2B63B 3KYHC 2UXCQ 2Q5WD 4LTUA 3MHBA 4LAAA 3ZJVA 1N34L 3UF8A 1OGWA 4JI8L 1RODA 2C9WB 3PSIA 1BXTA 5ELEA 2RGFA 2ID0A 2KANA 4A3PA 2WXNA 1ML0D 1I35A 3C1FA 4BY1H 1TU2B 2UXDQ 4C3JB 1NI2A 5KHOA 5IGFA 4KKTA 1IBLQ 2BB6A 1HZ9A 1VQ8A 4NPSA 1FXAA 3JW0X 3PUYA 1BCPB 3ZVVA 2J7ZA 2F0WA 2Y3AA 2M1MA 1PDQA 4DKAC 1EM7A 4JL9A 2ZJPA 3L2PA 4B08A 2BBCA 3ZTDA 1PFNA 4I65A 4A3OA 4GLAC 4QMGA 5GXGB 1KF6B 4QUFA 2V1CC 5G3LD 1GUTA 2I5MX 4L5RC 1V6EA 3OWEB 5M3FG 1WTRA 4L6TB 3RLFA 3PS6A 3MZ5A 4CJ1B 3GTKH 2N7DA 2RDGA 4W9CA 5JJIA 4CKEA 1F2LA 4KJOA 4GXBA 3V3XA 2XRQD 1I4HA 3BS1A 3TMPB 2W54A 3NE5B 4C3HH 1G6JA 1DOMA 4Z9CB 4A3MG 1ASZA 3HOZH 5M5YB 3KUCB 3MXNB 5ELOA 5CV6A
chains in the Genus database with same CATH topology
5C0XG 1LLRD 3P4SB 3RZDB 3S1NB 5EQ0A 2Y5CA 4DAVA 4FXGC 3AU7A 5BYSA 1JQYD 1NENB 3I4MB 3K57A 4ZHPA 3L4PA 2BYTA 3FRPB 4YSXB 2F0TA 1BNZA 2MHVA 5DEHA 1ROEA 3IT4B 3IFDA 2RQXA 2W82A 1B1ZA 4NP5A 2CVRA 1K8MA 3NK9A 1EQVA 5DM73 1I3QB 1TWGB 4FXCA 4RAUC 1IBXA 2NN6G 1EY4A 5C4ZA 3SR6A 1F9PA 1QNKA 4KD3A 1QKZA 4HTHA 1K83B 1V1PB 2J52A 2W3SA 4IFDH 2RSOA 1TKGA 1VMPA 4FXKC 2F0OA 1WTWA 2JSVX 2F0EA 2MJEA 4NKLA 3NHHA 3KK7A 2N55A 2HQEA 2IL8A 2K5PA 2ON8A 3S14B 5KNCA 3QOJA 1XCTL 4RA8A 2QEJC 3VA5A 4C1NK 4HMJA 2IPKD 5JPMC 4RF1A 5J22A 1D2BA 3M4YA 1TS2A 2K5QA 2MJ8A 1BR9A 1XF5L 4ZUJA 1RTNA 3TUOA 5C6AA 1SNPA 2F0MA 5COYA 3QG1A 3U7ZA 4PV1C 1PTOD 4ZKBB 3R93A 2EYJA 4KGSA 5C0XH 2PNRC 4H0LC 4GLSC 1JWSD 4HAEA 1Z6HA 2FMMA 2J4XA 1HA6A 4BS9A 1B9MA 2SDFA 4BBSB 3PUXA 4YXDB 4RH6A 4E6IA 2ZXOA 4GDLB 1STYA 1F9QA 1LTRD 2K33A 4UDUC 5FK9C 4ZUIA 2C9OA 5EE3A 4DAPA 1SNMA 2K04A 4ZHOA 5KGUA 4CHTB 3HUIA 1JE4A 5CV5A 2DYOA 1QG7A 2NN6H 3S9WA 3SHLA 3SVMA 1RF2D 1L4ZB 4KD4A 1S5DD 2N9LA 1UAPA 1CHQD 2E76C 3W5VB 1F0ZA 1HFGA 2KJXA 1B53A 3IKJA 5AUKA 4A3IB 2CU3A 1CTMA 4YSYB 5G3LF 4PNYA 2MJ3A 1MI2A 4IN3A 2XWJB 1PRTB 2LHDA 4XT3B 1U4RA 3GTMB 1YQ4B 2LJIA 5IODA 4XIGS 3D31A 1YNND 2JU6X 4NZLB 5IGBA 2F0VA 1KAAA 1DD2A 4J6HA 1C77A 2RKSA 1K53A 1CZGA 5C3XA 4OZCA 1DOYA 2BS3B 1V43A 4QCLA 1X3QA 3HOXB 2KACA 3SEBA 1KDCA 1A2TA 3BZDB 4CJ2C 4RGOS 2DY8A 1B9RA 3NTIA 4ID6A 5I9OA 3W1SA 4DA2A 2R92B 4N58A 2EE1A 1UUPA 1LV9A 4NW2A 4HJGE 3QWNA 1AZPA 1B3AA 1LT3D 2BDNA 4N9PA 2Z1CA 4PMCA 3S17B 3MFGA 4Q0FA 2FHTA 3EROA 1IBXB 1NEKB 4YTPB 3TEXA 3R8BA 1WYGA 4YWGG 2V0GA 2NVQB 4X3TA 3V05A 3U9OA 1H9SA 5HI1A 2OF1A 2FMCA 4M8AA 2B2YC 2RBMA 2B2TA 4IOIE 1PYWD 2KVMA 4X3KA 4C80A 2K1BA 1BCPD 4BY1B 1SJED 5KIXA 1ZXTA 2VNUD 2JQRB 5JVH3 1FNUA 2WXHA 1E9MA 4KKJA 1D5ZC 1CZPA 4JWSC 1II3A 2HDMA 2KECA 2K01A 4EGVA 1FNVA 1JALA 2VZKD 2F0GA 4OO1G 5D7GA 1ENFA 3FPUB 1IYVA 2KQ3A 2F0LA 4L8JA 2K5WA 3GTKB 3CU7A 1N5WA 3B9JA 1PTOF 2A6HD 4C3HB 1UWXA 4NJCA 3NVWA 4PT5A 4BBRB 1OQRA 4Q2JA 1FO4A 4ITKA 3ETRA 1HEZE 2WDQB 3BVZA 5HG2A 2NTSA 1L0VB 2TSSA 1RYJA 1JWUD 1ENAA 2A68D 5CC4A 1AEXA 1F77A 4WRDA 3I72A 4MACA 1KTKA 1V97A 2WP8J 3MHZA 1ZYRC 2JEAI 3AE2B 2DNCA 3TBIB 4NDXA 3DEPA 1J7BA 2WXLA 1JB3A 3EFXD 1JRPA 4L23A 2PKOA 2OT2A 3P1MA 4IDIA 1HPCA 4K8JA 1ZUD2 2E3TA 1N63A 3D6WA 2RDFA 5IT9E 2PZUA 4LK0M 2R6GA 1AYFA 2IGHA 2X38A 2R3ZA 5E3FA 2NWGA 3I91A 2HDEA 1DONA 1SNDA 1BUIC 2XVSA 3W5UB 3HZXA 2DN8A 2H88B 3HRDD 3F2UA 3A56A 3GO5A 4YTMB 4KY6A 2PW5A 2L5TA 4ZKCB 3D4DA 2AWOA 3P42A 1DOKA 2GA4B 1QILA 5EE9A 1SF0A 1EU4A 1BQQT 4HSPA 3N6RA 4K6DA 4P16A 1D5XC 1QNUA 2WNMA 1WGKA 1RWSA 4HEA1 1BO0A 1YN3A 4XDXA 4QB4A 2K6AA 4DGZA 1C79A 2EXZA 3BDLA 4OO1H 2DLBA 2EOTA 3CQZB 1U9RA 5M3FB 3W2DA 3KWVA 2KOLA 1JQ4A 3PUVA 1RCVD 4HMIA 1JOQA 4P6VF 4QF4A 2K05A 3H6MA 1TWHB 1Y1WB 3Q23A 4FP5D 3VYTA 4KN7C 3TZUA 1VDZA 3PZ7A 5C44B 1IW7D 2CJOA 2K3UA 2E2DC 2NVTB 3K5NA 1GB4A 3AEBB 3TP5A 4RGTA 3AEFB 5A2QE 3OIQA 1LT4D 1SYFA 2PPBC 4I7ZC 3FEWX 1UNSA 2M56B 1D4BA 4OVZA 2DY7A 1GOZA 1H9SB 4RKBA 1CHPD 1BCPF 3NBHA 4X3SA 1ENCA 1NVID 1I6HB 4S3SA 1DCZA 2J42A 3KLSX 1V8QA 4FF1A 1Y69U 1GXDC 1STGA 4KHZA 2L11A 3DWAA 1EY7A 1ICWA 2H1EA 5E4XA 3KWLA 4G4KA 3TDQA 5C5LA 2B8FA 2G9HD 2WKDA 2ZXRA 3H0GB 1EY0A 2N88A 1MSGA 1FD6A 2Q8RE 4C56C 2KQ4X 5IGEA 5I2YA 2VXWA 1LTBD 5IGCA 1EWCA 3G7LA 4IUNA 5CORA 2FBWB 1U4PA 3AE3B 3D3RA 3BDOA 3NRZA 4G7HC 1FGBD 3C3LA 5H8YE 2F3WA 4WORA 4XWWA 1LABA 4FXDA 1KH0A 2H89B 2WXJA 2JP1A 3P20A 3BVMA 2LY7A 5FOBB 3ZYYX 1V8CA 3P4PB 3ND8A 2M9VA 4XXEA 2NMQA 4HEDA 1X32A 3ABVB 1H9MA 1BDOA 2EYPA 3MAQA 3BYTB 4HRSA 4RF0A 1GUWA 5FLXE 3QB3A 1KLGD 2WB1B 1FR3A 1GUOA 5C3EB 2R7ZB 5AUIA 1KDBA 4K5VA 4V0BA 1GAQB 4AQ7A 2JEBI 5M3MB 2F0JA 1OXTA 1I4XA 5JEAJ 1K51A 1QOFA 4A3BB 3VYSA 1QOBA 1E2VA 1GUGA 3MWYW 2N0SB 2Z8LA 1A3TA 3AE5B 1MD2D 4B0EA 1C48A 2JXMB 1I7HA 3GV6A 4EQOA 4DK1A 2SNSA 4KKIA 2HCIA 1JW9D 1G8ZD 5T1IA 1F2RC 4B9XA 3GTOB 1PGBA 2YU9B 2BS2B 3VA7A 2NTTA 4OIKA 4TQ0A 5KYIA 2NB0A 1UWMA 2QIEB 4J1MA 1IGDA 4G57A 3HOYB 3Q8BA 3VYRA 1BMLC 3KF8A 3SR1A 4F88A 1PTOC 2N9KA 4CJ0B 2FE8A 5G5GA 5HURA 2QKIC 4A3DB 2B2YA 5JPNC 1JWMD 1BUVT 2EY2A 1SNCA 2PW7A 1HUMA 5FR3A 5TSSA 5K36G 3K59A 1M4VA 2F0DA 4RKLA 3DWGC 5LNK1 1EOTA 1G91A 1QB5D 1AWDA 2WU2B 2V3NA 2L9HA 3LXFA 5G5HA 2MJDA 1FCCC 1HUNA 4OL7A 3VR5A 1ZEQX 4L1BA 1EY8A 3H09A 2WACA 1FIQA 2KWDA 2AWNA 2F0UA 4FNFA 2PW9A 2D62A 3TZDA 1PXUA 3CRKC 3GB1A 2IX3A 3OWFA 2M00A 1C4AA 3GP7A 1G2SA 3HGBA 2D5DA 2Q8IB 3I70A 1SB3C 3HKZB 1V1OA 4AS1A 3ERQA 1Y1VB 1DJRD 5EPLA 2QSDA 1LT5D 4MN3A 4O1NA 3SK4A 3EUB2 2PVGC 4KJNA 1YNNC 1FEHA 2ICEC 2L1AA 1SMYD 3M7NA 3I9V1 1BBXC 5ELCA 4A90A 3J81E 1ZXHA 3I90A 4F7XA 2F0KA 3H3VC 1KLUD 2Z4IA 1KNAA 1SAPA 1AFPA 1SE4A 1Q12A 2SEBD 1XEEA 4IUVA 4NAWB 2BDOA 2JA5B 1ET6A 4KY5A 1D6EC 3WCQA 3DHQA 3CIRB 4HKQA 1TKYA 5H92C 1A15A 1L4DB 4HR7B 1HZ5A 2WXPA 2EJMA 2MGSA 2EJFC 2RVLA 5LL6X 2I38A 1E2WA 1J9OA 2MP1A 4A93B 4RHSA 4K2KA 2JA6B 3AEEB 1O7LA 2F0SA 3IAS1 1DYQA 4WQMA 3X3NA 3SDZA 5KNBA 3VRAB 1SBBB 1N62A 2Y0SB 5IT9L 4RNAA 5BYQA 2L4NA 1E10A 2EYHA 1HTPA 4HCSA 1R4QB 3MFYA 5T1GA 1PFBA 1WTXA 1C8CA 2B2VC 4GZYC 1KNEA 1FYCA 5EGTA 4US9A 1MSHA 3NVZA 1BCPC 1GUNA 2XIWA 1G291 1WTPA 1A70A 3PO0A 4WIPA 4OHJA 5IOCA 2GRIA 3AE8B 1JR0D 3EJIA 1T3QA 3AEAB 1I6VC 3Q69A 2AUKA 1M8AA 1DXMA 3LWEA 5CBAE 2BB5A 5EPKA 2G9DA 3VR3A 1L0XB 1Q1BA 1QE6A 2A6HC 2WU5B 4AYBB 2BT6A 3M3YB 3KBGA 1C76A 3KUPA 3Q8EA 2A68C 5M9OA 1K52A 1PDXA 1DOXA 4XQQA 1XLPA 4JX1C 2EZVA 4EQPA 3A8KE 2F0NA 2EVBA 2M0AA 1ESRA 2F0PA 3NXWA 1Y56A 1ILQA 3I73A 4RFBA 5A35A 2R93B 3AB5A 3A7AB 4U68A 3LB8C 1HZ6A 3DWPA 4IZ8A 4IFDJ 1CJEA 1ET9A 2L12A 4JBWA 5I2XA 3DMUA 3OMCA 1KRHA 3FC4A 1XLNA 1EYCA 3K5OA 1O80A 3RMHA 3ONAB 5BN3A 3IL8A 2G1EA 1F2RI 3K58A 3EA6A 1IKMA 1PTOH 5I9PA 4DNRB 3TEWA 1PFDA 1STBA 1KABA 3GTLB 4EVOA 1Q8IA 3BG3A 2VB2X 4TMAB 1VDVA 3U2SC 2IGDA 5CV9A 2EYMA 3D8GA 5FO7B 3PMFA 4ILWA 1LACA 3OMGA 3EGRA 1LO5D 3UI3A 1S5FD 2EJGC 1KFYB 2INPE 3D4RA 2NVYB 2B2WC 3J7AF 5LL6S 5E6JA 2WIIB 1Q90A 3VQIA 3NS1A 1NR2A 1HCZA 5IGGA 2JX5A 2Y5PA 1L0YB 3A55A 2O2LD 3PIO3 2CW0D 3VR4A 1B50A 1SYDA 1S5CD 4LJZC 1MHHE 2BTEA 1NR4A 2E2IB 5FO8B 2LKVA 3WOEA 1NYRA 2WQYB 1YJJA 1AP0A 5I6WA 3KLSA 1IW7C 2PZTA 2EY1A 2TMPA 4UAIA 3T51B 3KQ4A 2K28A 3M7GA 2VUMB 1VJKA 3PZ8A 3CKIB 2W55A 2WXIA 4OZAA 3OW7A 1EY5A 3VRBB 3BWUD 1OFFA 2WAQB 1E0BA 3DM1A 1TS4A 2PCFB 2LGIA 4FVMA 1K50A 1CT1D 1O78A 1PFMA 4DXGA 2EYOA 3HOUB 1JC7A 1TWCB 3G6JB 4PMWA 1PGAA 4DXFA 1GPXA 2GI9A 1GHKA 5EE1A 1F2MA 2K03A 1WXQA 5BMHA 2RSNA 1B4OA 1G2TA 2JYEA 4DFAA 5CR3A 2EPBA 3GQBA 4DK0A 1Z47A 3SK5A 2F0QA 2K5DA 1IGCA 1SSOA 1FFUA 1JWBD 1W6JA 2HUGA 4KN4C 2K32A 1R9TB 2F03A 1XTCD 1YNJD 2K7VA 4KKSA 1E7PB 2R61A 1ZOYB 1A3UA 5T8IA 3MXPA 4MM3B 1MGSA 2D9UA 1FRDA 1C78A 2FJ2A 3BVGA 3HEJA 3HP3A 2WXKA 4A3FB 2AX5A 3PIP3 2FUG1 5M5WB 1TZOA 2F1MA 2QMTA 2V4DA 2B39A 3K0YA 5EBDA 3S2DB 1WWTA 4MHEA 3N52A 3AH7A 5D14A 1IHZA 2CHBD 4CBVA 5JOBA 1N60A 2F0IA 5D3DA 3NUCA 1TR5A 3R2TA 3JAME 2BW2A 5HHDG 4G7OC 1WTVA 4YIJA 1TS3A 5JVG3 1STHA 4FO2A 4IUTA 4L63B 3I4LA 3IAM1 2KDMA 2IW3A 2YYZA 2KA7A 5D3IB 4C7ZA 1SYEA 4IQZA 4MH8A 1EZ8A 4CKBA 4R9WA 4RGMA 1MI0A 3NTKA 1Y8PB 5CBEE 4A3MB 4H2AA 3MP9A 2PO4A 3MC0B 1EIGA 2JXTA 2BCOA 1CM9A 5E1FA 3C46A 4L2YA 1E2ZA 5HFYA 2JYOA 2WDVB 4N6EB 1Y8NB 4LLGM 1XCQL 2MUYA 1QCBD 4CQNA 5C3WA 1C4PA 1IL8A 1O7YA 3FVQA 4TSSA 1RD9D 1K8OA 3GTQB 1QQRA 3HOVB 3FILA 1LTID 3ND9A 1EEID 1JROA 1MHXA 2JSOA 3FKIB 1I50B 1STAA 3H8HA 2BS4B 2B2VA 1JMLA 3WDNA 2NBFA 5M5XB 1XX8A 2KN4A 3GTGB 3A8IE 1ACCA 4MIUA 1CFMA 4XTCS 4A3EB 1JOOA 1PRTD 3S16B 4RGNA 1B44D 1ZE3D 3TP8A 3P7JA 1WTQA 1HQRD 3SFEB 5NUCA 3M85A 5ELDA 5DM63 2A5HA 1WD1A 2HDLA 2A73B 4OW0A 4DNTB 4IUQA 1RDPD 3NZ3A 2D5GA 1VRAB 1PZKD 2J53A 4DN4M 2KCNA 4K14A 1YNTE 2DYMA 1PTOB 1EWYC 2IX0A 2WDRB 1RM6C 4XYOA 1O7ZA 3I57A 2WXRA 4WJWA 3J80E 1VZ8A 4KGRA 1ZXIA 3NPPA 1AN8A 1SMYC 1CQVA 3ZQ4A 3Q8AA 3DEOA 1NUCA 2WXOA 1VR9A 2CJNA 5C3JB 5BN5A 3VR9B 2O4XA 5BN4A 1V1PA 3NQIA 1WTOA 2K22A 2K9XA 1WCMB 3I3CA 2C5CA 1SNQA 1H9RA 1AZQA 4WH4A 3HG9A 1TKWB 2AQ2B 4XT1B 2BA0A 4Y7NB 1CK1A 1J7AA 4MT5A 3MTSA 2A6ED 4LK1C 1OXUA 3IXSA 5I4DA 3TN2A 4BA2I 4M0WA 1NCVA 4C3HG 2L55A 4NAMA 2KEEA 5I6YA 3OPOA 1YJIA 1E0ZA 1VF7A 4Q5VA 1F2ZA 1STEA 1E6EB 3ZGZA 1LT6D 1A2UA 2B2TC 3NTHA 3GS2A 1WSPA 1CA5A 1CI3M 1L6UA 1QLBB 1Y8OB 3CRLC 4K2LA 4F87A 2F0HA 3EQLC 2PLPA 2B2WA 2L52A 2IWHA 3VR2A 4N59A 2LUMA 1SYGA 4PQXA 1CZWA 3C1EA 4A8XC 1DM0B 3VR8B 1X3PA 4YTNB 1OQQA 2QDBA 2EKIA 2XSCA 1GJXA 3AM9A 1PZJD 1QOHA 3S1MB 4C3IG 4IFDG 2I07B 4KMUC 3O13A 3CHBD 3OSOA 4RCOA 5CYUA 3TP7A 1C9FA 2ICIA 4C2MB 4U673 1JOKA 5KRUA 3I4NB 3FILB 4A3KB 1TVXA 4ZAIA 3P4RB 2XWBB 1ZPSA 2FFKB 4ZRZA 4FF3A 2W3RA 4HKZE 3T53B 1P7EA 1VLBA 4USAA 1PUTA 4XE0A 1C4QA 1QT9A 1PRTF 5F2DA 5ELFA 2KMMA 2RPVA 1XWEA 1EYDA 2LMCA 1UEAB 1XXGA 2L83A 4GDKB 1TT2A 3CWIA 1DGJA 4K6LA 5E4WC 5JXVA 1N5XA 2VZKB 4V190 2KUMA 2A74C 3B2GA 4FYDA 3MXGA 1T5EA 5FO9B 3L7ZC 2E6XA 2LFNA 2NZ1D 3TP6A 1XLQA 3U52E 2YEPB 3I8ZA 3P1HA 4BY7B 4IKGA 4IUUA 5C5MA 4O42A 3SE0A 1DZ1A 3J7YW 5C4JB 3GD7A 4ZK9B 1MVKA 1YQ3B 2BE5D 4ULLA 2RDHA 4LMQD 2JWUA 4K5WA 3V96A 4DAYA 5K36H 3K7AB 3GV3A 1U4LA 2MPMA 5BMGA 2JZPA 4ZRQA 2CW0C 1GUSA 5EPJA 1OXXK 2E75C 3MXUA 2D2CC 4ZLTF 1LTAD 4A6QA 2V4IB 1FNWA 3PUZA 5EKIA 3J7AV 1NSNS 4G7ZC 3RUZA 4IFDI 2O5JC 3C2PA 4QIWB 4KHVA 2AQ1B 2RMMA 4D2KA 3L9AX 3DXJC 3GTPB 3JAML 2AQ3B 2X6GA 5CMDA 1PGXA 2MEKA 3T3NA 1LTTD 1Q10A 2A69D 3DWQA 2WS3B 4A3GB 2INNE 5KYLA 4DF7A 3S2HB 3IAYA 1I4PA 3BK2A 4J8QA 3OHXC 3WOFA 3NWSA 3Q0AA 2SNMA 3RFZB 1L6VA 1Z7TA 1QJOA 5D65A 3LYYA 3ZJUA 2FINB 3AMUA 4FF2A 1DOIA 1CA6A 3NUHB 1SJHD 2E2JB 1VMCA 3A8JE 1S5ED 2ZXPA 4TRDA 1EU3A 4JK1C 1TWFB 1OXSC 2IGGA 4RWSC 1SE2A 1LTSD 1F9SA 2WXMA 4HROA 5C0XI 5EBCA 5A2QL 5DNFA 4XQJA 3PO2B 4KK7A 1N61A 3AB9A 4M1UB 1HHVA 2LS01 3BIID 3TSSA 5IIFA 4US8A 1LTGD 1YNJC 1STNA 4N9TA 2B2UC 3ZJTA 2PIAA 1SDFA 3R2IA 3DWMA 5C4HA 4ARIA 4A3JB 1RTOA 2LEKA 1WD0A 1FMAD 3T3OA 1NAPA 1P7FA 4YT0B 4DQOC 3OOCA 1SE3A 3AE4B 2LMCB 1WVLA 2OEDA 1PZID 2F0FA 3AV8A 3Q8CA 2NN6I 4NMZA 3K5LA 4ZYSA 2H4OA 2O5IC 3ITPA 2M19A 3S1QB 3AMZA 1KDAA 1EL0A 3C8YA 3Q8FA 3MEHA 4KI0A 5FKAC 3E9SA 1NI3A 2PVOD 3TMEA 1XYIA 3M4OB 1NYQA 1ONLA 2XNAC 3K6OA 1HTLD 4H7BA 4C3JG 4KGTA 2EDGA 5ELBA 1W6KA 2BA1A 3DUZA 5JAVA 4ZRPA 4REZA 2WV6D 5C0XJ 1ESFA 1ZP0B 1FD7D 4BA1I 5ISRA 1TY0A 2PZWA 2AUJD 3R3OA 3T4AC 3J80L 3SXHA 1TWAB 2M2LA 1Q1EA 1SYBA 3H91A 1XO3A 4B0MA 1FFVA 1TY2A 2OXPA 1HFNA 2N7JA 1F2YA 3FPPA 2K0PA 3V2TA 1EYAA 4FF4A 3H94A 2WKCA 5FLXL 1T6BX 4XQNA 2IT1A 4IURA 3SK8A 4KY7A 3D4WA 1SNOA 4EE2A 1TQOA 2NUCA 2IDYA 2OHFA 1SSNA 2KHSA 1FRRA 1JWAD 3AEDB 3QOLA 4K5XA 3AN1A 1JCKB 3NBIA 2KEDA 3Q6SA 3HRZC 3FAHA 1J7CA 2HTME 2DBYA 3TEZA 1FXIA 3J9CA 2PYKA 3B2FA 3LNNA 1PRTC 4CKCA 4EQNA 3E5SA 3NSWA 2JA7B 1F9RA 3HVZA 1ZKOA 3AE6B 2I46A 5HGTA 2DWQA 3HOZB 3AEGB 3MVVA 2PQEA 1EY9A 2ZT9C 1SYCA 4ARCA 1BF4A 1VZ6A 3AECB 5JEAG 1ILPA 2KCCA 1IKLA 2GB1A 3Q22A 4KV6A 1QOGA 4RCNA 1SIJA 2WXGA 1QF6A 1AW7A 4TQUS 5EKKA 1C4CA 4TQ1A 2XN9C 3HVDA 1UGJA 2J0TD 1JICA 2PMZB 3Q24A 3OIPA 2RA4A 2X6LA 3A7LA 1A3VA 4PMBA 1RFKA 2Q8TA 2L0CA 1ZDXA 1FM0D 2WXFA 3NVYA 3S15B 3W9CB 5AFWA 4WWMA 4ODGA 3HOWB 5CV8A 1EZ6A 3SFDB 1S5BD 4JPSA 2LFIA 2ACZB 2ZW0A 5C2TB 5EJWA 4J3OD 1OO9B 4KTAA 4C3IB 3FDTA 3QO2A 5KEEA 5CGKA 3MA2B 2L32A 4ME5A 1R4PB 5KNDA 1VZ7A 2QCPX 3T56B 3BK1A 4TKOB 1RHPA 4JWUC 2A6EC 3AE1B 4JE3B 1QWYA 2I2YA 2QJLA 1HA5A 2XRSD 2LHEA 1IYUA 5DAUA 3VR6A 3U4EG 4BWGB 5LHY1 2JA8B 3X3MA 4P2CB 1B9NA 2ZW1A 4WURA 2QF7A 1ZDVA 4RHRA 3J81L 3BDCA 2JYTA 1TYGB 1T5XD 3S1RB 3NQTA 5EKLA 1G6ZA 4XDDA 2ONQA 5EE0A 2EYFA 1U4MA 5BYRA 3PUWA 4XWTA 2PTLA 2IX1A 5CV4A 1CQFA 2DNEA 4H44C 1YMHE 3LX0A 2QILA 3TEYA 5JEAH 4IUPA 1EFID 4OO1I 3LWUA 1I4QA 1QOAA 1JORA 1RJTA 2EY6A 4KKUA 2E2HB 2OEOA 4XDCA 4H13C 1EQTA 2ENBA 1VF5C 2Z4HA 1MPEA 3PO3B 4DU9A 2NVXB 3NVVA 1EIHA 3AE7B 1DOLA 3FMCA 4HSVA 3PV0A 1D1IA 3MXNA 4X3UA 1GHJA 3A54A 2B8GA 2HCCA 1EWHA 2CQAA 3P75A 1VCIA 4C1NI 1I4GA 4KX6B 4XYQA 1ZYRD 1EY6A 5J1ZA 2WINB 1TJEA 4QUCA 3VYUA 1XLOA 1D1KA 1SFOB 5C4XB 1H9KA 4HN7A 3HS0C 4OIJA 5MPOA 1HRJA 1PMRA 2MH7A 3E0JA 2YEPF 3KBXA 2L1BA 1OXVA 3MJ5A 1FCLA 2KAJA 1IUEA 4WAFA 3D6CA 5CV7A 2EY5A 1R7SA 4R3DA 1S4ZA 1TIID 1J8IA 2B2UA 3QJYA 1BOSA 1YN4A 2PMVA 1L5PA 1RKNA 2E74C 5K5PA 4CGYB 1Q3LA 4K8IA 4YSZB 1GB1A 3NP8A 2WLBA 2F3VA 3EVQA 2JE6I 3URYA 2SAKA 1I4RA 2X69A 3SK6A 1A6XA 3NWTA 4IALA 3AE9B 1EEFD 3KLRA 3L3OC 4OGQC 4ZOHC 4WFN3 3P4QB 3IFTA 2BE5C 1MBYA 2EELA 3BYYB 3RZOB 1HQMC 3RD4A 2V3PA 3N9YC 3IT6B 3GTJB 3U9SA 4C7YA 1PLFA 2VB3X 4A9AA 3E56A 3E6ZX 3K5MA 5IGDA 3P63A 2EYLA 4B9WA 1TKEA 2WXQA 2WP9B 1H9JA 3T16A 4OZBA 3W3AA 5BMIA 2B76B 3QIAA 5JJZA 2NYZD 1WRIA 5J39A 1TS5A 2F4IA 4R8NA 4ABNA 4F8MA 2SOBA 2BOSA 1YN5A 1SXTA 2A69C