1TS3A

H135a mutant of toxic shock syndrome toxin-1 from s. aureus
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
194
structure length
194
Chain Sequence
STNDNIKDLLDWYSSGSDTFTNSEVLDNSLGSMRIKNTDGSISLIIFPSPYYSPAFTKGEKVDLNTKRTKKSQHTSEGTYIHFQISGVTNTEKLPTPIELPLKVKVHGKDSPLKYWPKFDKKQLAISTLDFEIRAQLTQIHGLYRSSDKTGGYWKITMNDGSTYQSDLSKKFEYNTEKPPINIDEIKTIEAEIN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TOXIC SHOCK SYNDROME TOXIN-1
publication title Structures of five mutants of toxic shock syndrome toxin-1 with reduced biological activity.
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Toxin
total genus 60
structure length 194
sequence length 194
chains with identical sequence B, C
ec nomenclature
pdb deposition date 1997-10-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02876 Stap_Strp_tox_C Staphylococcal/Streptococcal toxin, beta-grasp domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.110 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1ts3A02
3.10.20.120 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1ts3A01
4RHSA 1JCKB 5ELBA 2NTTA 5D3IB 5D3DA 4ZYSA 4NZLB 1PYWD 3W2DA 2RDGA 5ELFA 1RDPD 1V1OA 1PRTF 1HA5A 2AQ1B 1LT4D 1CT1D 1DYQA 1PRTB 4TSSA 2WV6D 1MD2D 3BYYB 2IPKD 1G8ZD 3BZDB 1I4XA 3DWAA 3OWEB 1YN3A 1CQVA 2TSSA 3BVGA 3O13A 1SEBD 1SXTA 1BCPD 1ET9A 1UNSA 1LT6D 1JWUD 1XXGA 1LTID 5TSSA 1L0XB 1LTGD 4RGNA 1HTLD 1ET6A 3R2TA 1STEA 1CK1A 3URYA 1AW7A 1PTOD 4L6TB 4RGTA 1EU3A 1FNVA 4RGMA 1BCPF 1XTCD 1PZJD 1D5XC 5ELCA 2IJ0A 4BWGB 1KTKA 1EEID 1BCPB 1BCPC 1S5ED 3EFXD 1PRTC 1PZKD 1F77A 1PTOF 2RDHA 2XNAC 3SEBA 3TSSA 4DXFA 3KLSX 2XRSD 2CHBD 1B44D 1V1PB 1LT5D 1D6EC 1JQYD 1SJED 1D5MC 5ELDA 1RD9D 4RH6A 1M4VA 1QILA 2ICIA 3BVMA 2XN9C 2Z8LA 1S5FD 1SE2A 1S5CD 2NTSA 1YN5A 4UDUC 1I4PA 1SJHD 1T5XD 5ELEA 3V05A 5I4DA 1YN4A 1EU4A 1PZID 1LTBD 1TS5A 4OHJA 5FKAC 1V1PA 1FGBD 1TS2A 4C56C 1GOZA 4Z9CB 1TS3A 1S5BD 3MC0B 1SBBB 1I4GA 2QILA 1I4QA 3CHBD 1UUPA 1I4RA 1RCVD 1PTOB 1TY0A 1ESFA 1FD7D 1FNWA 1PTOC 4RCOA 2QEJC 1CHPD 1CHQD 1HXYD 2AQ2B 2G9HD 1D5ZC 3MFGA 1EEFD 1JWMD 3BVZA 1DJRD 1TS4A 1LTRD 1TY2A 1SE3A 1FNUA 1HQRD 1LTSD 4DXGA 3R2IA 4RGOS 1I4HA 1B1ZA 2SEBD 2J4XA 4RHRA 1AN8A 1S5DD 4L63B 4RFBA 3GP7A 1LTTD 3BYTB 1LLRD 1JR0D 3EA6A 3R8BA 1ENFA 1JWSD 1BXTA 1LTAD 3DWQA 1EFID 1SE4A 1LO5D 2AQ3B 2XRQD 4O1NA 1KLUD 3DWPA 1KLGD 1PRTD 5FK9C 2R61A 1L0YB 1EWCA 1RF2D 1LT3D 1PTOH 2O2LD 4K6LA
chains in the Genus database with same CATH superfamily
4V190 3K0YA 4KN7C 4BBSH 1OQQA 2HJ1A 2MWSB 4HKZE 3U7ZA 2A6ED 1HH2P 4ZYSA 2KTRB 5BN3A 4A3CH 1MJEA 3MC8A 1O7IA 3Q3OC 2G5DA 3HOZG 1FCCC 4JW0A 1TBEA 1V5OA 2LASA 4QJFA 3AB5A 3ENEA 1FCLA 5KNDA 3PIO3 4DV4Q 2DNFA 4ICVA 2MBEA 1K8RB 3EIVA 5ELOA 1OTRB 2R92B 3PS6A 2J52A 2Z6KA 1H9JA 1NAPA 2NUCA 3GD7A 3HM3A 5FLXL 4UY8C 4ICUA 2VZAA 1P0RA 2LS01 2TSSA 4JV5L 2BCOA 4GKJQ 3QWNA 1A15A 1ET9A 2NZHA 4OL7A 1WGDA 4DR1L 4M00A 1L0XB 5JEAG 3S1RB 2L1AA 2KC1A 2IX0A 3TBIB 1QLBB 1SSOA 3CMEA 4BKGA 4CQNA 1GJZA 3U9SA 1VZ6A 3QR8A 1BCPF 1VQCA 4IWPA 4A3GB 3DBLI 4M01A 1GM5A 2PW9A 2GLSA 1KQSA 3QO2A 3K58A 2MJ3A 2WXPA 5C2TB 1E7PB 2I0QA 3I5JC 3RULA 1DD2A 5C4XG 1P7EA 3NVZA 4MELA 3A9KB 1SMYC 2F4IA 3RR5A 2DBYA 1SNMA 4M1UB 4L1BA 4HLEA 2N1WA 4NKLA 3NP8A 2ICIA 1K8MA 4YHHQ 3I4NG 3AE3B 2LJ5A 1K83B 2E74C 1IYJB 1HZBA 3NWTA 4LJOB 1I4PA 3H7PB 5I4DA 4QY7A 5L83A 3PSIA 4WIPA 5G3LD 1CKNA 4OHJA 2KHWB 1U4LA 2C9OA 4DUZQ 2N8NA 1V86A 4MGYE 2CFMA 4UP8A 1HNWQ 5K36H 4C56C 1MKHA 2UXDQ 1E2VA 5HY6A 2EVBA 2DYOA 2XVSA 1MI2A 5CHVC 3L4PA 3HP3A 5DCNA 3ZJYC 3UDFA 2QMTA 2WXRA 2JA8B 3PTFC 3S16H 5EE3A 2EY1A 3EBEA 4EZJA 3MEFA 4N8FA 1I3QH 4R3DA 1PTOC 3JAMc 5KNBA 2VB2X 3D0FA 1EQRA 4PZ8A 4JI2Q 4WWOA 2EJGC 4QB4A 1G6ZA 4P16A 4C7YA 2MSED 3RZWC 2OQKA 4N9TA 4V0BA 2LVOA 2MX2A 2K03A 5DPRA 2M4NA 1H95A 4LF9Q 2G9HD 1MIUA 3I2ZA 1N5XA 1VR9A 4AQYQ 2Q2UA 1ZUD2 1OXVA 3U4VA 1WZ0A 1EOVA 1QQRA 1HQRD 2KN5A 1PDQA 4PZ6A 2PI2E 1UZXB 5HURA 1EY8A 4A75A 3T1HQ 5ISRA 1LLRD 4A3KH 3EA6A 1HJPA 2DJGC 3BG3A 2BDNA 3AQQA 3VR6A 2M8SA 2DNCA 2N9KA 2NPTA 1YNNC 2WXFA 5BO4B 5GROA 1MG4A 2FCNA 1R4NB 4ZUIA 4GLXA 2XRQD 3HOZB 1EM7A 2IX1A 4IUNA 3GTPB 5IP7H 1KC8C 2KMCA 1Z47A 4OX9L 1HE8A 1PH6A 4JBMA 1VD2A 1L1OA 1I94L 1XNRL 5EE9A 3W1YA 2KQSA 4KHVA 5D3IB 1XD3B 1UEAB 2GOWA 4G7HC 5CX3A 4DHZB 2R7ZG 2LSSA 4N9F4 4W9JA 3AEBB 1PRTF 2Q8RE 4Q5VA 2JJQA 3C2PA 3KOJA 1D1KA 3CC2A 3KDFA 3WAPA 5BN4A 1I42A 5C4JH 2IPKD 1II3A 3NQTA 4ZHPA 2V3PA 1SROA 3U4EG 2KZRA 4LDTD 1OEYA 4A55A 2MFIA 1VQIA 4OELB 1I4XA 1YN3A 2VL6A 2JQOA 1O7LA 2JA7H 1BCPD 1JWUD 4AOFA 2MP2A 1I50H 1EUJA 2JRHA 1CKMA 2YEPB 4LW1A 3AH7A 2JE6I 4NW2A 2UYZB 3ZNID 1EIGA 3FVQA 3ZW3A 3RZOB 4A3BB 2D5DA 2H1EA 1PZJD 4A8XC 3RLOA 1G291 4J1MA 4JI3Q 5C3XA 3DBRI 3Q3NC 4OVZA 3HOXH 4P75A 2N55A 2R2OA 2O2VB 3BS1A 2N7DA 3KBXA 2PJHA 2XWJB 4FLHA 4HTHA 4UP9A 4GDLB 4K1RB 3H91A 4JI4Q 1Q82C 3ZGZA 2KK8A 3MXPA 4JI7L 3DEOA 2NZ1D 1Q3LA 1YEZA 2M9VA 4CDFC 5FLXc 2A6EC 3I57A 3Q0AA 1WZ3A 2OJWA 4P6VF 1C0AA 1YNJD 4NB3A 3KJPA 3J81j 2LVQA 2D2QA 1C4AA 1WX7A 3CQZH 1WGYA 4FHJA 2LY7A 1SIFA 3E0JA 4IFDH 1IXRA 4BOZB 1ZDVA 2EYPA 2RA4A 2A5HA 3UDIA 3PRZA 1E10A 4OO1H 3ONSA 3QIAA 4JBJA 1AZPA 3GTLB 1P98A 2CHXA 4IJHA 5D14A 4DAPA 4Z9CB 4LFBQ 4G50A 1UELA 3RUZA 3MC0B 4L5TA 2ZW1A 3HZXA 5E7NA 1KOTA 3CHBD 1KAAA 2NVXB 5M5WB 4OZAA 1CFMA 1NENB 2VUMG 1K0SA 1E1OA 5HFYA 5EBDA 4UHVA 3WIMA 1WR6E 4HCPB 2C7HA 4ZUJA 3H3VH 2FJ2A 4PT5A 2RSNA 1F2LA 3I4LA 3VR4A 1U4AA 1SR3A 3P7JA 5JOBA 1E9MA 4WAAA 1UAPA 4EQPA 2ZXOA 2X69A 2ZVOA 3J7AV 5C3EG 1WXAA 1TS4A 1TQOA 1R7SA 1VQ8A 4B3MQ 1EY4A 2KN4A 1WFQA 3OW7A 1EF1A 5E6OA 1IKLA 4FYDA 3T1YL 2F0UA 2B2YA 2RF4A 3K5NA 1FYCA 1P9DU 2CH4W 1IYVA 1C78A 4EVOA 4OZCA 1A2UA 1HZ6A 1KJTA 2JSVX 2KNBA 1L2NA 2K5NA 1K8GA 1C4CA 2TMPA 2NVYH 2RDBC 4JI8L 3ZJVA 2H5XA 2RVLA 2MLBA 1S72A 1OXXK 5D65A 5J2RA 3H0GH 1UF0A 1PRTD 3R66C 3TEXA 4ZRQA 3KF6A 1PH2A 4RM9A 2UUCL 1EY6A 1SYEA 2F0IA 3P63A 1JCKB 1YI2A 2G1EA 1NYRA 4OVVA 4G7OC 2BS3B 1RDPD 5A35A 4KGRA 3VYTA 4C3IG 2AQ1B 5CBAE 5DPTA 3SHLA 1OQYA 1ISNA 3DBHB 2BB6A 1RIPA 1HZCA 4WWNA 1HPCA 4R4OA 2VS1A 1HR0L 2KOXA 3VDYA 4JVZA 4W9GA 5GAHC 4DV2Q 2B2TA 1LT6D 3H09A 4A3EG 1LTID 1WM2A 2Z0EB 3IAM1 1E0ZA 3DQVA 1WCMG 1PH3A 1GD7A 4EFOA 4LF6L 2B63G 2ZNVB 4C2MH 1CK1A 5CV5A 5CGKA 4IWOA 1PA6A 3FPPA 2K0PA 1F0ZA 4JOIA 2E5LL 4XQJA 4DAVA 4TMAB 1SNPA 1ZEQX 3M85A 2LXKA 4ZCKA 3Q69A 5KNCA 2OOBB 4YY3L 1AH9A 5KIXA 1E90A 1ILQA 4BY1B 4L5SA 2NVTH 4DXFA 5IP9G 3QA8A 1LM8B 1QJOA 3CCRA 4IC7B 3GTKB 1F9RA 1TIFA 4LF5L 1Q81C 1XO3A 2K14A 1IBMQ 2NVUI 3FC4A 4K0KL 2FNJB 2LRUA 4IZ8A 1STNA 4USAA 3NBIA 3CCUA 5FR6A 5M3FB 3PHXB 2INDC 4IN3A 1YHAA 5FOBB 5E6NA 2MEKA 5ELEA 2NB0A 1YN4A 1YVCA 1K8OA 2YYZA 1PZID 4JLCA 4KSKC 1E7UA 1MG8A 2CS4A 1V2YA 4IPDA 1Y14B 1CSQA 1XMQQ 1VCBA 3GOEA 3N1XC 4GXBA 3T3OA 4U68A 3S2AA 1KAWA 3AE8B 3VDZA 5CBEE 2K25A 1ENCA 1IGCA 5HGQA 2BYTA 1GG3A 2O6VD 4DDID 1UUPA 1WGHA 5A2QE 2MUYA 3K6OA 4KSLC 2ZXPA 3VR8B 2K1BA 1WJ6A 2I46A 2KMAA 2FCQA 1ICFB 1QCBD 4FP5D 4DAYB 3ND8A 3TZUA 2EQSA 3HIZA 3RN9C 4GNXC 1GUSA 2ZXRA 5L95C 2YU9H 3S1QH 3T56B 2JA5G 4K2KA 1X3GA 1A8VA 4JPSA 1EIYB 4DUYQ 1GHJA 2LXAA 5M3MG 1R4NI 2J0KA 4OIKA 3S17H 2BA1A 3NVYA 4CJ2C 4W9HA 1WOCA 4DXGA 4HVBA 4RGOS 1I4HA 3V62A 2KFKA 3CCLA 4FNFA 3NBHA 3PZ7A 4IDIA 3HKSA 2A19A 3PCOB 2F0FA 3BYTB 4QCLA 3HFZB 2DHZA 1Y69U 3RZFA 3N9YC 4A3PA 1C3TA 1F9SA 4C3IB 1LO5D 1VQ5A 3HOUH 3FKIH 1T3QA 4KKJA 3RNUA 5KEEA 1N33Q 1YOVB 2FINB 3OYYA 3RCZA 3ZNHB 4HMIA 4ODGA 2EPBA 1Z5SB 3AE1B 4B08A 2WXOA 1QUQA 4DK3C 1PH1A 2UUAL 1Y8OB 1K50A 1MJCA 2D5GA 5DAUA 5DLQE 4DR7Q 2Q2HA 1U5KA 3J7YW 3PO2G 4OVUA 2LHEA 1YJWA 2KAJA 2WU2B 5FLXE 4A3EB 3A8JE 1SNQA 2NWGA 2KTFA 1HHVA 3NHEB 3IFTA 1SFOB 2N49A 4C3JH 3GTGH 2C7NB 1WCMB 3E5SA 4NPNA 1WH3A 4AH6A 2KDEB 4HIKA 1G8ZD 3IAS1 3DUZA 3PIOA 1LFDA 3B08A 3EHVA 3J9CA 1FJGL 5C3JB 4JI6Q 2IO3B 2WDRB 1WGGA 1SXTA 4ZOHC 3OTOL 2VB3X 4H02A 2A73B 2LWPA 2JX5A 1WSPA 5IOCA 4QF4A 3R7QA 3A1QB 3WAOA 4FF1A 1RTOA 4ALPA 3M3JA 4X3UA 3B9JA 3URYA 2WQYB 3T4AC 4HJGE 1UGJA 1GNUA 2WWZA 3OIQA 2F52A 1PYBA 1GC7A 3TRZA 2OTJA 5KHOA 1PYSB 3IRBA 2EJMA 3SE0A 3K7AB 3SXHA 2JXXA 3KQ4A 1E6EB 1T5EA 2N7EA 1FO4A 5I6WA 3K80C 3ZJUA 5JH5C 2BQQA 2IBIB 2L05A 1PRTC 3SEBA 4YWGG 1L0VB 1SNOA 5CC4A 1CKNB 3N52A 1C76A 4HJAA 1AARA 3Q3MC 5JPNC 3TMPB 1D6EC 4HMJA 2LJIA 3GS2A 2I5LX 5BMGA 4GN5A 2J0JA 1D5MC 2M0XA 2N9XA 2GVBA 2JA9A 1N32L 2K5WA 1DXMA 2VRRB 2W55A 2F0MA 2AUJD 2NTSA 4ASWC 4ABNA 1YX5B 1XTDA 5C5LA 5ELNA 1SJHD 2E76C 1BBUA 3U50C 1U0LA 2J0MA 3UE0A 2BE5C 3S1RH 5K5PA 2JU6X 2LI5A 4FF2A 1KLVA 1TWHB 3M4PA 4H7BA 2B8GA 1WTXA 1CKOA 5FJ8H 3NTHA 4IW0A 4B9KA 3NUCA 1L1OC 4PZ7A 2G3QB 1WI5A 1GUNA 1FR3A 3OHXC 1N6ZA 2JA5B 2ZJDA 2QILA 3GTOH 1Y1WG 5AUIA 1SF0A 2HUGA 3D6WA 5M3MB 3Q22A 3TMEA 1FD7D 4ILWA 3P4RB 3HRDD 1SLJA 1UBQA 2HD3A 3C0RB 4K3BA 3DBLB 1TXYA 5IGBA 1PV4A 1B50A 2BKFA 2NR2A 3HS0C 3AM9A 3NRZA 3UGBB 1E22A 3VTUA 2YTXA 4X65Q 1MHXA 2W54A 1CHQD 4GOPB 4C3HB 2NPTB 3KWVA 4LCDE 4W9LA 4GDLA 4XQNA 1M1KC 1G2TA 1MHHE 2L76A 1LTRD 4R1JA 4NJ7A 3ZQ4A 1N62A 2CCZA 2FFKB 4GS3A 2WNMA 4GDKA 3S9WA 2K01A 4AYBG 4DV7L 1QE6A 4KHPL 1JRPA 2MBBB 3CPWA 4EEWA 4L5RC 2IY1B 3N32A 3Q6SA 4WJ3M 2WX1A 3EUB2 2EOTA 3NG0A 1W6JA 4BOSC 1X54A 4XYQA 1N5WA 1L0WA 1PH5A 1QKZA 1QT9A 1SNCA 2F0SA 2KO3A 4CKBA 1KDCA 3BZKA 3H7SA 4F8CB 1VQBA 4R8NA 2YEPF 3KDFB 2F0PA 2KVRA 3VTVA 3CCSA 4BBRH 2KQ3A 1Q86C 4L2YA 1L0YB 3ZLZA 1RF2D 2WDTB 5AJ3Q 3TS0A 1YQ3B 5I6YA 4CDEC 5GXGB 1PFSA 1DOYA 2WXHA 1WD1A 1F52A 3JVZX 4DV1L 4QIWE 5ELBA 4RKLA 1EYGA 4A3FH 3OLMD 4HN7A 1O80A 1WJJA 1VQKA 2ZEQA 4W9EA 3MEHA 2MP2B 1MGSA 3AFQA 4B3SL 3KUPA 3RNFC 1LT4D 5IE8A 4X3KA 1WJNA 2X38A 4WJOA 2RQXA 1Q46A 1MD2D 3HOVH 1A6XA 3U30A 1B9RA 5LMNQ 4XDXA 2D9UA 5DM73 3CXCA 3I4MH 1NYQA 3T9LA 2B3GA 1FM0D 4MSQB 4XYCA 4CHKA 1B70B 4XGAB 3O13A 1BUIC 1NMGA 2BF8B 3CAMA 2B2VC 5LMUQ 5LL6X 5JJKA 1PUTA 3CC4A 1K73C 4DAMA 1HTPA 3GTJB 2HJ8A 1HRJA 3R3OA 1PQSA 2XSCA 3R93A 1OXSC 1TZ1A 1EY9A 3OIPA 1STYA 2UWQA 1GAQB 2WHIA 4MH0E 4P73A 5I2YA 1V9PA 2JWUA 4A3DH 1WXVA 2BT6A 3F2DA 1QNKA 4UAIA 1VZ8A 3CMAA 1YJ9A 2B29A 2UXCL 5JEAH 4K5WA 5E1FA 1JALA 3ZXRA 1PLFA 2WAQB 1JRUA 4WWMA 2EXDA 3ZNZB 1M4VA 1QILA 4DV6Q 3KLWA 1BF4A 2E2HB 1J6QA 3H8HA 3I9V1 3L0WB 2A69D 3PRPB 3CSTA 3L2PA 1Y1WB 4PS8A 2FBWB 3P20A 1UGMA 3GO5A 4MJSB 4KDLB 1TS5A 2F1MA 2L8JA 3T8MA 4WORA 1NTGA 1STAA 4X3TA 2WP9B 4DHJB 3NUHB 5C4XH 3GE8C 3RFZB 1PH8A 1TS3A 1QVFA 3QAQA 4XYOA 3NS1A 1EO6A 3CCJA 1J5EL 3K5OA 3I4NH 1GB4A 4CJ0B 3AMZA 4KX6B 4PNYA 2DY8A 1A2TA 1N34Q 3KBGA 2OWOA 4JIOU 2O5IC 2UXBQ 3FHWA 4A3GG 5NUCA 2XWBB 4A3OA 2LFIA 1EQTA 3DBRB 4AYBB 1M90C 1CHPD 5IYBH 4X6AH 3V6EB 3VHTC 1YNND 2GBJA 2JUOA 3V61A 4DHZE 4DV4L 3E0EA 4LFCQ 4YCVA 4A9AA 1S1QB 1YBYA 1H9SA 2B2TC 2IX3A 4HDQA 4K81A 1NBFC 3GTQH 2NN6H 2EMSA 3B2FA 3KF6B 4MSMB 1UWVA 3FRPB 3IAYA 1JMCA 2BYEA 2JK8A 2C35B 2MHVA 4L63B 1CZGA 4GKJL 4PV1C 1JR0D 5CHFA 2KXJA 2JZZA 3S14B 3Q8BA 4US8A 4B6WA 3HGBA 1FVIA 3Q3JA 4P2CB 2XK5A 2YTYA 1VQJA 1JORA 4IUTA 1Y8PB 2NVXH 3TEYA 3A7AB 1KRTA 3J80c 5FK9C 1TWGH 2E2IH 3AMUA 3H6MA 3RNEC 3I8ZA 1QVGA 5EPLA 2K22A 2MRPA 1U9RA 3SK6A 3KUZA 2KHIA 3AEEB 4FA6A 1WTQA 2ZTDA 2CH4A 2EYJA 1PYWD 5CMDA 4CGYB 3C46A 4DR5Q 2JA8G 4M02A 5COYA 4P71A 3NZ3A 2ZCCA 3VUWA 1Z6HA 3IT6B 1B8AA 3SK4A 4MIUA 4RCNA 4HJ5A 3LNNA 4YHHL 2HT1A 1G6PA 2RMMA 1YQBA 2PZTA 4IKGA 3M3YH 2KC2A 4GKKQ 4J6IA 5EAYA 4YWKA 1UNSA 1SAPA 1YZ6A 3E3XA 1E1TA 2Z4HA 5IAAC 3FMCA 2R7ZH 4DR6Q 1SYGA 3AEFB 4DUZL 3SHQA 1STEA 3H15A 2VQFQ 1HNWL 3AU5A 5EE0A 1JQ4A 2LD9A 2X6LA 3NHHA 2F4VQ 1EU3A 1FNVA 3PLUA 3D3RA 4OZBA 5AZGA 3U4ZA 2RD0A 3VRBB 3HVDA 1IBKQ 5C44G 2AMCB 1IGDA 2VH2A 1HZ9A 1H4RA 4YWMA 2MQJA 3DM3A 3X23A 3EFXD 4JI2L 3NE5B 1E8ZA 1CJEA 2DZMA 3H9DA 2ZCBA 2N0SB 4YSZB 2CHBD 4KI0A 4HWIB 3ABVB 4IPHA 3KYHC 2IL8A 4G7ZC 4LF9L 5C0XI 4RAUC 3DVNV 2R93H 3JSVB 3ZTCA 5C1ZA 4AQYL 5HGTA 1S5FD 2WACA 1XCQL 1NR2A 4LAAA 4XC2A 2DYMA 1LUZA 1Z9FA 3MZ5A 2MJDA 2Z59B 1A3TA 2JP1A 4JK1C 3T1HL 4IFDI 4QIWB 1BQQT 2KQ4X 3OSOA 1K52A 5J1ZA 1A3VA 1I6HH 1Y1VH 1A3UA 3L17A 2I5HA 3PQIA 3TQYA 4HJKA 1TWFB 3A0JA 1NNXA 4R4CA 5CV6A 3TP8A 3OG5A 2MH7A 1I4QA 3J7ZC 1S40A 3DPDA 3A1QA 2MJ8A 1VMCA 1WJUA 1DGSA 4EQNA 4A3BG 1DOMA 1M94A 2QDFA 2GBMA 2KFKB 1RRBA 3NBHB 4A3IH 1FEHA 2Q2TA 2H88B 3Q3FA 3STBC 4NDXA 3QHTA 5KYIA 4GGQA 4E71A 2QA4A 4NXNQ 2QEJC 2KHJA 3H3VI 3OJ4B 4X57B 1W3SA 4G3XB 3VR3A 3L13A 1BUVT 3WOFA 1RYJA 2HTME 4BY7B 2B3AA 4US9A 4EZKA 2FUHB 3QWZB 3ZDMC 3G7LA 1EYDA 5LHY1 4HJ7A 1B1ZA 4A3MH 1JJ2A 1OGWA 1E8YA 4X66Q 3PVLA 4TKNA 2UU9L 3RNGC 2VUMH 2L55A 2KANA 2KEEA 3MFYA 1QUQB 3V96A 3HOWG 1U4PA 2A69C 4A93B 3MTNB 4GLVB 1PH9A 2K3UA 4RMAA 2B76B 1VZ7A 3O65B 1CM9A 5G5HA 2FCSA 5C3EH 5BYSA 2QIEB 4JI3L 3RYTA 1YD8U 3S2HB 1STHA 3UINB 2O4XA 2L1BA 2Y5PA 1NE3A 3L3OC 2EYOA 2IW3A 3TEWA 4CBVA 1FXTB 1HR0W 2R3ZA 3W9CB 1FL0A 3TP6A 3NSWA 1EZ6A 4JI4L 3SFDB 4TUUA 4JI1Q 3S15H 3A5UA 3TL5A 1PHJA 2F0NA 1X1MA 4ZKCB 4A20A 5IGEA 4A76A 3S1MH 4FADA 5IYDH 1IKMA 4A3JG 3ZJTA 2JWZA 5IGGA 3VH3B 1BR9A 3DWAA 3V2TA 1N36Q 4GOPA 3ML8A 3M9BA 5EBCA 2L12A 3PUVA 4R9WA 3PO3G 5C44B 1XXGA 5DM63 3ERSX 1ZKOA 1VF5C 3TDQA 1YIWA 5EJWA 2WKDA 4LF8Q 1IW7D 1D8LA 2GB1A 2WX0A 2JYTA 3R2TA 4LF7L 2KJRA 2M0AA 4LFBL 4Y7NB 3CRKC 3MC9A 1STGA 4NJ6A 3X0WA 3NK9A 4LUOA 4X62Q 1XTCD 2IJ0A 1CTMA 2BH2A 5M5YH 1O78A 1FRRA 5JAVA 4BS9A 3BZCA 3VA7A 1SYDA 2D0OA 1VQDA 2KWCA 1F77A 3CCQA 1CA5A 4JI0Q 4FF3A 3I7FA 4K3CA 3QJZA 1EYAA 5IIFA 4EQOA 3ULLA 3RZDB 5FLMG 4EZLA 2WKCA 4BKSD 2LEKA 1L2FA 3J81i 2B63H 3RUIB 1KIXA 3K9PB 1SYBA 2LXJA 3FAHA 1J19A 3MWYW 2PKOA 4B3ML 3BDLA 1T5XD 3K7UC 2I1KA 1VQ6A 1EU4A 4HJ8A 3F8TA 1N63A 3PV1A 3W5UB 1XPOA 3ZO5B 1ESRA 2F03A 3LDZE 3RN2A 4M8MA 4GLSC 1WTRA 4BBSG 2ASBA 4JL9A 1PFMA 3AI5A 1TS2A 5IP9H 2K39A 2RCNA 2WB1E 2KUMA 3J80E 2LUMA 5AUKA 3LWUA 4WAFA 4IJLA 1XWEA 1VQOA 1UH6A 2D3CA 2XBBC 1XX8A 4MEMA 3GDEA 4GDKB 5HKHA 2BH8A 2K33A 3S24A 3UIOB 1K9MC 4F7ZA 3I91A 4DR2Q 3U7DA 5TR5A 2NVQH 1UE6A 3L7ZC 3HOWB 2KCNA 4BY1G 4MH8A 1EFWA 4LJPB 5IODA 1PXUA 1JOQA 4DBGA 3I90A 5BN5A 3LXFA 4OEMB 4DK1A 1TIID 1NDDA 2K52A 4KKUA 1WIAA 2SEBD 1JOKA 2J4XA 2Z9HA 3MJWA 1Q8KA 2G4DB 2WXKA 1Y8RC 1WTOA 5M3FG 1FIQA 4KGSA 3KFUA 1CUKA 4TRDA 1NJIC 2L00B 2XEWA 3B1LX 2N9LA 1Q0WB 4PYZA 4HSVA 5BYRA 2AKWB 2MCNB 5AFWA 3S1NH 3PGZA 4POFA 2A6HC 4MJSA 2JRIB 1UWXA 1WYWB 1EWCA 2Z0DB 1H9KA 4GMVA 1LT3D 2HIXA 2L15A 5EGTA 3PIP3 3SDZA 2QGQA 2RCFA 1XPRA 2DLBA 3RNBC 4RHSA 4AQ7A 2MP1A 4A3JB 3C3LA 4E74A 1PVOA 4EE2A 4DR3L 1WRIA 2JYEA 4IUPA 3ZNGC 1I94Q 1XNRQ 2DZIA 1ML0D 3PO3B 2PEAA 3Q14C 1C9FA 1CT1D 3BWUD 1IBML 3HOYB 5K36G 4N8X1 5M5XH 2SNSA 3W1SA 2V9HA 2KVMA 3ZIMA 1WX8A 5GMVA 1N61A 2PQAB 4WJPA 3EVQA 4RGNA 2DX5B 4HDOA 2NYZD 3PO2H 2WB1G 1NEKB 3EFUA 5IYCG 2JSOA 4JQWC 1IP9A 1AW7A 2DZJA 1XNQQ 1I7HA 1J8CA 2ZT9C 3QX1A 2VY3A 3D31A 4BWGB 4JGHB 3WA0A 5LNK1 3F2UA 3CCEA 4IOAA 4ARCA 4XE0A 3BDOA 4YTNB 2LZ6A 1B9MA 3Q6BA 2JA6H 1KHIA 1Q90A 1GHKA 1WGRA 4HIDA 1PZKD 2BE5D 4KD4A 2RDHA 2CHZA 3AU7A 3M7NA 2RKSA 2K9XA 4EGVA 3AE5B 3AB9A 3KH0A 2W82A 5J18A 1JQYD 3TIXA 2KX0A 1S3SG 2B2UA 4BBSB 5HG2A 1EY7A 4DUYL 3IFWB 2A4ZA 3BVMA 3Q8FA 5IGCA 4KJNA 1WI0A 1S5CD 1A0IA 3M62B 4K7SA 5MPOA 1IBLQ 1E5WA 3HKZE 1BKBA 1R9TH 1UWMA 1X55A 1F9QA 1V1PA 4NMZA 5C0XJ 2PE9A 2L11A 2FIDA 1HQMC 2D0PA 2F3IA 3HRZC 3TUOA 3NS8A 2BYFA 2B2WC 5JVH3 2FE8A 4NAWA 1VQ4A 2J53A 1EUVB 5JHBA 1BVSA 4K2LA 1N33L 1DZ1A 3NQIA 1H9SB 2K6AA 3J81L 1IW7C 1VQLA 1EWHA 4CKCA 3M63B 3L54A 4ANUA 3RN5A 1XQQA 1BNZA 1FNWA 3E6ZX 3T51B 2I38A 2WDQB 3FILA 3GE3C 4I6NB 4N6EB 1DGJA 3P75A 4IPGA 5M9OA 1IZ6A 4DR7L 3J80i 4FHKA 1NCVA 3UI3A 5G5GA 4B95A 5F2DA 4HR7B 3S2DH 4TQ1A 1S4ZA 4KIKA 3OOCA 3DXJC 2XK5B 4EKUA 4DV0Q 3I3CA 3CMMB 3I63C 4BA1I 1L7YA 4F87A 3WCQA 1UE7A 4IURA 4R4QA 4JI6L 4MHEA 1RL2A 3JSVA 2E2JH 4LJZC 3GV3A 4P7IA 3QJYA 2N9PC 3ZRFA 2SOBA 2DN8A 5EQ0A 4KHZA 4ANXA 1EF5A 3MXUA 4PMCA 4DV5L 1NY4A 5C0XG 2E2DC 2WP8J 4KKTA 3GB1A 3Q8DA 2EZVA 1OEYJ 1MVKA 2Z6KC 3K5LA 4JWSC 3DEPA 2C5LC 2MA9B 2NTTA 4LK0M 2K04A 1D1IA 2N3SA 4DPGA 3ICEA 5ELFA 1J7BA 5H92C 2L32A 1ZPSA 2OHFA 2N4FA 3SD5A 4R4TA 3WANA 5BMIA 4IFDG 1MPEA 1WYDA 2Z1CA 4FJZA 5T8IA 3S16B 2WXGA 1AE2A 1WRDB 3NPPA 2G4SA 5CHWA 3NZSA 2WB1B 4B3RQ 3BZDB 1E2ZA 4C3HG 4DGZA 1H9RA 2E75C 2WAQE 3HKZG 4K7UA 2K75A 1CZWA 1LABA 2AHOB 3DMUA 4A6QA 3M7GA 4ACFA 1O7YA 1HR0Q 3ML9A 1I6VC 3SVMA 4IPCA 3AEAB 3UDXA 1JMLA 2KQ7A 1WGKA 4FF4A 3M4OH 2INNE 4LDTB 4FBJB 2QSDA 1G91A 1B3AA 3IT4B 3Q8AA 4A3KB 4XQQA 4KK7A 1KTKA 3ZYYX 1PFBA 3CCVA 1BCPB 1NR4A 4QUFA 4FJYA 4WFN3 3OW2A 3CC7A 3T16A 4J8QA 2WXQA 4DV3Q 4JYAQ 3DHQA 3J7AF 2M19A 1L5PA 1FD6A 3GTMH 4XZ4A 4X65L 1SJED 1EY0A 1TWAH 4J6HA 1TT5B 1GPXA 2PQEA 3FDTA 3OPOA 1V43A 2CW0D 4AYBE 2LRWA 4N58A 5E4WC 1SE2A 1YQ4B 2PLPA 2K6DB 1QZGA 1Q5WB 1HNXQ 3H0GG 3DVNU 5LXHA 3MXGA 1AWDA 4B3TQ 2WU5B 3NENA 2FMMA 4IO9A 1SNDA 3G48A 5C4JB 1KL9A 4JC0A 1X56A 2FAZA 1K51A 1WM3A 5GQOA 2V4LA 4WJWA 4KMUC 2IZVB 2V3SA 5C6AA 4GN1A 5D7GA 1GUTA 3W5OA 1S5BD 3EN2A 1GUAB 2K4KA 2K5HA 5JJZA 5I9PA 1VQNA 3TJPA 2JVCA 2UUBQ 3PGEA 1KDBA 2VNUD 2K8HA 3N20C 1WWTA 2D3GA 4CKEA 3DWMA 3P4PB 1Z7TA 3KF8A 1TKEA 2QJLA 2K1FA 4F8MA 4WWPA 5IT9L 2R92H 5D2MB 1KNEA 3MVVA 1RWSA 3AV8A 1VQFA 2OQ0A 5JXVA 3AE7B 2DY7A 2WIIB 5CORA 3HOXB 2PE6B 4K5VA 4XTCS 1H8CA 4GOPC 2INPE 2IY0B 2MHJA 4H13C 2NBFA 1PMRA 5LMNL 2D07B 2WAQG 2JY6A 4FULA 3B2GA 2JQRB 3VQIA 1LTSD 3NEMA 4ZDVA 1RJTA 1BDOA 2NN6I 1A63A 3T3NA 1KDAA 1VQHA 1SIJA 4YL8A 4ME3A 3VH4B 5LMUL 4WURA 4C1NK 4A3GH 4GLAC 4OGQC 4Q2JA 1BXTA 1L4ZB 3CQZB 3J81c 2ICEC 3J80L 2PPHA 3NXWA 1Q1BA 3VAWA 1GC6A 1D7QA 2CWPA 2EY2A 1JJCB 1KXLA 1VJKA 4YT0B 5D3DA 3HKZB 3Q8EA 1MI0A 2VQEQ 2ZJQA 1FXAA 3N6RA 1K83H 2NS5A 4JBKA 5JJLA 3NTKA 3U52E 4TSSA 1PRTB 2HDMA 3AXCA 1PDXA 2WV6D 2C7MB 1T9HA 2P5ZX 4RKBA 3RNCC 1JJGA 2UU7A 4DV6L 3VR2A 4GIVA 3GZNB 1R4PB 2A74C 2LXCA 3BVGA 2OF1A 1KD1C 5AEKB 4WJ4A 1DM0B 2CVRA 4HEDA 1QOHA 4YTMB 1JB7A 4DQOC 4JWUC 3QOLA 1GO3E 2JA8H 1XLNA 4HRSA 1OO9B 2LKVA 1QNUA 1TTNA 4S17A 4XX5A 1EWYC 1O7ZA 1NMFA 1GUGA 2MO0A 4HEA1 1LV9A 1TZOA 1EEID 2F0LA 2KCMA 2NVYB 1KH0A 1PGXA 4RM8A 1HZ5A 2G45B 1OXTA 2PNHA 1S5ED 4KJOA 1SMXA 1VCIA 3SR1A 5KYLA 1QZHA 4MM3A 1XJVA 2SAKA 3H0GB 2UXBL 1YJIA 3DHIC 1VQAA 4KKSA 2DNEA 3TSSA 5JPMC 1K53A 1TJEA 3KW5B 2A68D 1DCZA 3K81C 2QDBA 1HNZQ 1LQBA 4P72A 3CWIA 2KYWA 1Q8IA 4NXMQ 4XWWA 1UE1A 5T1IA 1HEZE 2LHDA 4HXDA 3HOUG 1B3QA 2HQEA 1N32Q 4LF4Q 3IBEA 3MJ5A 3PT2B 4DFAA 3HOZH 4AJWA 3GTPH 2F0KA 5FKAC 3VTWA 3M4QA 3STBD 2GA4B 2M00A 1NUCA 3G4SA 2RHQB 2CKZB 4OWTB 1C79A 2ACZB 1WE7A 3A9JB 1QB5D 4HJ9A 1IYFA 1KRHA 4E3CA 3NTIA 2PQAA 3CRLC 1TWCB 3D6CA 4MTKA 4DNTB 2KJ6A 2YLMA 1YMHE 2JN4A 3TBLD 3H94A 4C3JG 2RBMA 3MA2B 2ZW0A 1TKYA 2LGDA 1E2WA 4C2MB 1IYUA 3RLFA 1F9PA 4JI5Q 4QGUA 1E8WA 5D6JB 1XMOQ 3D8GA 1WFYA 3ZRCA 4OWWB 2EJFC 2B2YC 4DR5L 4LFAQ 3DOWA 4C80A 1HXYD 2W3SA 2O6VB 3KVFB 5EKKA 5I9OA 3W1SC 2R7FA 1XLPA 1YNXA 2AWNA 4LTUA 2F3WA 1DJRD 2KEDA 2QF7A 1E7VA 2NVTB 4IUQA 4YIJA 2F0HA 4JX1C 4AIMA 4GZYC 4J3OD 1PH4A 3R2IA 2ZVNA 4AWJA 1F2YA 2WLBA 1L6UA 3RZOH 4A3BH 4GKKL 2EYHA 3GP7A 2CW0C 2K05A 3L10B 2QKIC 3HM6X 1ENFA 3QARA 5LXIB 4DR6L 3AEDB 4DV7Q 4I7ZC 4ZRPA 3DWQA 2VQFL 4M8AA 1EFID 2AQ3B 1KLUD 3DWPA 3NVWA 4D2KA 3H6NA 3CP0A 2F4VL 3K0XA 5IT9c 1YHBA 4CDCC 3A8KE 2R7DA 1SSNA 1WXMA 2Y3AA 1K28A 1AP0A 2CU3A 2NZOA 2KX3A 3DLLA 4NZLB 2B2UC 5FO7B 2MBHA 5BR8Q 5H8YE 3U9OA 3HOWH 5DPWA 1FPYA 1E3PA 2D2CC 4JPBW 1PFDA 3EQLC 2XTIA 4KY6A 1QF6A 4LNKA 2QDLA 1X32A 4PYUA 3TCAA 4JOIC 1UEBA 3BINA 3CSFA 2YU9B 3GTLH 2KJHB 3S1QB 2ON8A 2WXLA 1HCZA 3PSEB 2IDYA 4BY7G 3AEGB 3AN1A 1KF6B 4LNNA 1SEBD 1AZQA 3ULJA 2R6GA 1XLQA 5IOIA 1P1AA 1DOIA 3MP9A 1MSGA 5M5WH 2I5MX 1BT0A 3S17B 3C8YA 3GQBA 1SE8A 2AUKA 2GBNA 1LACA 1ET6A 1WXQA 2KLCA 3ECIA 4DDGD 3NVVA 3MAQA 1V6EA 4CYEA 4RGMA 4REZA 2KHSA 3IKJA 1KABA 1A70A 3SR6A 1IBXB 3TEHB 2M56B 2KDFB 2GI9A 2D3AA 4DR4Q 4NJCA 2OT2A 3HOUB 3FKIB 5G3LF 3VUXA 2ZM6Q 1UE5A 3A56A 2HTHA 1BOSA 2OXPA 2Z4IA 4K8IA 1OXUA 1V1PB 4NXNL 1EIFA 3W1BA 3CD6A 1ILPA 4QUCA 5DNFA 1WY8A 1BBXC 1FFVA 4RF0A 4HKQA 1BO0A 2UXCQ 2Q5WD 3I73A 4DK0A 2AL6A 2XN9C 2Z8LA 4H2AA 1JC7A 4NAWB 4YTPB 1VDVA 4UDUC 4FDBA 4FJVB 4BBRG 2FCMA 1B53A 3GTGB 4C3JB 2UXDL 1F9JA 4ZRZA 4P1BC 2IWHA 2C5CA 4DNRB 2V4DA 2ATWA 1CI3M 2QW7A 2BKRB 3FILB 1R4MB 1WTWA 4ZRJA 3J81E 5C4HA 4A3FG 4M8NA 2CQAA 4OIJA 1Q1OA 2GMIC 1GOZA 4W9KA 1JICA 2MPMA 2BB5A 3HVZA 4LWCA 2EY6A 2N88A 1SBBB 5IWAQ 5FLMH 2L83A 4KIKB 1TYGB 1B2TA 1RODA 1L6VA 1I4RA 4M0WB 4X64Q 4NNJB 2K5QA 2A8VA 2HIVA 1TY0A 1S3OA 4GN3B 2AEHA 4GSWA 3APDA 3I4MG 2DENB 2QC8A 1IL8A 4W9IA 2YTVA 4APVA 2LVPA 2KECA 4PQXA 1F1HA 1XCTL 2F0DA 4JI1L 4A3LG 3ULPA 3D4DA 2VZKB 5FR3A 1D3ZA 3MFGA 3APFA 1EEFD 3DM1A 1P8LA 2JYOA 1K8AC 1HZAA 3BVZA 2A6HD 2BBCA 3ZXVA 3DBSA 3MHSD 5JZEB 1DOXA 2A68C 1IPGA 1J8IA 1J0GA 4BXXG 1KM7A 3C1EA 1N36L 4GNXA 5J39A 2HHHQ 1AN8A 4HPMB 4OO1I 4JE3B 5JHAA 4FXDA 2V0GA 4Q0FA 2L0TA 4QL5A 3AE4B 2YVCA 3Q8CA 4LNFA 2MBOA 4A3DG 4LF8L 1L4DB 3RPFC 1X3EA 1LTAD 1EIHA 1MJDA 2K32A 3RT3B 4BY1H 3VR9B 4AS1A 1MHWC 3KK7A 3Q24A 4X62L 1QVCA 3AU4A 3GTKH 5JJIA 4GU2A 2MBQA 3GZNI 3V6CB 4YWLA 4ME5A 3WWVA 2VH1A 3ZTDA 3GTOB 2ASQA 4JI0L 4IUMB 4L8JA 5M3FH 2DZKA 2MO1A 2F0WA 5CV4A 4N59A 2KOLA 2KFJA 2LFNA 2KACA 4H44C 2L4NA 1LM0A 2KD0A 3LWEA 3C19A 3NELA 4RF1A 4CDDC 5KRUA 4N9PA 2DGYA 2RPQA 3F2CA 3LX0A 2ZJPA 1AEXA 1WR1A 1K3RA 3OWEB 1JWAD 4KZ0A 2I1JA 5IP4D 2DYBA 2OEOA 4KLKA 1RM6C 1LTLA 2EYLA 5T1GA 5TSSA 1PGBA 3F1ZA 4OXPA 4LUZA 4HK2A 2KA7A 1SYFA 1K3BC 2QCPX 5EKIA 2F3VA 2ALYB 3PUXA 3KWLA 3H1UA 4CO7A 3JYUA 1ONLA 1ZYRC 2BWFA 2GN5A 4L6TB 1GXDC 1CQFA 1RTNA 4RGTA 5IYBG 3OMGA 4IG7B 4IQZA 2ZZPB 2HCCA 3ITPA 3A4SC 5C3WA 4LMQD 3WDNA 2F0JA 2PZUA 1AFPA 1VQGA 5AZHA 4PS3A 2NN6G 4A90A 4O2DA 4BBRB 4ITKA 3TN2A 4R8IA 2RR9A 3TZDA 3MHZA 1B44D 3K57A 4DR2L 4IOCA 3BK2A 1RD9D 4RH6A 5CR3A 3M95A 4DK6C 1FMAD 5IYCH 4A3FB 4K8JA 3AULA 3EC8A 1T0QC 3ERQA 2FXQA 2AWOA 5GAGC 3UF8A 3HOYG 4JV5Q 1ZXHA 3PZ8A 3KF8B 1JB3A 4C3IH 2LGXA 5EDSA 1Y56A 1AE3A 4DR1Q 3HOVB 2ES2A 3F2BA 1XEEA 4MGIE 2R2QA 1ZOYB 4EUTA 4I6PA 3KLSA 3I4MB 1FGBD 4CHTB 1G6JA 3UIPB 3NJTA 1F2RI 2PMZB 4P1CC 2LGSA 4ZAIA 4KY7A 4AP4C 5IT9E 2HE7A 1FRDA 2DWQA 2CJOA 2H89B 1VRAB 4W9CA 4C4VB 4RA8A 3E56A 2L5TA 4RMFA 3PUWA 4A3EH 2J7QB 5CYUA 2RDFA 1PTOB 3A7LA 1SFOH 1WCMH 3L16A 4GN4B 2KT7A 3X3NA 1VDZA 1NVID 4K14A 2Y5BB 2VXWA 4PMBA 1ROEA 1DONA 5GAEC 2VW9A 2CU1A 1D5ZC 4BBNF 2PW5A 4NAMA 4C00A 4A3DB 2MGSA 4ZLTF 4JBWA 3UE1A 1SE3A 3PREA 3G71A 3A8IE 2K5PA 1VQPA 4HPPA 2ZPNA 2JPHA 4A3CG 1E24A 4BFRA 3UDGA 4LNIA 3AEVA 1LXDA 2BS4B 3AECB 2L7RA 3I56A 4UP7A 5G55A 4QQBX 2UU9Q 3K7AH 3A55A 1DOKA 1ZXTA 3QC8B 1XNQL 2M2LA 1VQ9A 2GVAA 2R61A 2A1AA 1WE6A 2AL3A 2R93G 1M8AA 5C4XB 3A9JA 3QIJA 1VQMA 3SDLC 4F1SA 4HCNB 2NBWB 1X3PA 2Q8IB 5LLIA 3HEJA 2BYVE 3I4NB 2IHEA 2BOSA 2K7VA 3CF6E 4XWTA 2EKEC 1I5FA 4KDIC 2FHTA 4KV6A 4HIMA 2JEAI 4TQ0A 4DV2L 1TWHH 4PG3A 1Q10A 4KTAA 4ZQ3A 1NBWA 1QWYA 1Y1VG 5C0XH 2W9NA 1TKWB 2MJEA 1D4BA 3AE2B 3VUYA 2LMCA 4BA2I 1IBLL 1TU2B 2O6VA 3D32A 2CHWA 2JA5H 1C7YA 2WS3B 4MM3B 5AZFA 4RWSC 1LTGD 4UPAA 2FIFA 2HDEA 5IO9A 1B4OA 2L9HA 3MTSA 3GTQB 2BTEA 5M3MH 2V3NA 1HTLD 4A3IG 3RI7C 3A5ZB 4JG2A 4W9DA 1G51A 4FXKC 1J7AA 1WMHA 2V4IB 3JC66 2WXNA 3L08A 4RG1A 1NI2A 2KDBA 4OX9Q 1YIJA 2K50A 2X6GA 2F0GA 2KCTA 4LF7Q 2BW2A 3ZDTA 1W6KA 4ARIA 2B2VA 2CR5A 2BVCA 4C3HH 4HAEA 1GVPA 2NCNA 3U2SC 2L3ZA 4A3MG 1GUOA 2E2IB 1G2SA 1TWGB 1XLOA 3PHWB 3PF5A 1LT5D 1C77A 3NWSA 1R4MI 1JOOA 1C4QA 1Q12A 5ELDA 3G6EA 1FFUA 1SDFA 1STBA 1ZXIA 4KD3A 3UQBA 4HCSA 2PCFB 2PNRC 3KLRA 4DV0L 1OTCA 4FN2A 1V5TA 4ID6A 1XMQL 2V1YA 2PO4A 4HCEA 4OWXB 1E8XA 2KMMA 3P4SB 2ZNVC 4K6DA 2K5VA 1GUWA 3FPUB 4MN3A 1W2BA 3FP9A 1SYCA 3M3YB 2ZJRA 4LUVA 2N1VA 2WINB 4P74A 5KGUA 2R7ZB 1V49A 4HIOA 4IOIE 1RFKA 1X3FA 5IYDG 1T6BX 4A3KG 4RCOA 4FXGC 2KENA 5LMNW 1VQEA 1IBXA 5FO9B 3MXNB 2RGFA 4JI7Q 2BA0A 3KJOA 2EE1A 1Z2MA 3OAWA 3V3XA 2XGTA 3PUZA 3AE6B 3EFCA 3NOBA 5IP7G 4I6LB 1RAXA 1QOGA 2KBNA 4G4KA 3TREA 2C9WB 3E9SA 4B3RL 3NZUA 5E6PA 4PMWA 3GTJH 4BAXA 3QOJA 3DVGX 2N78A 4XT1B 1J7CA 4XDDA 2R93B 1ACCA 1Q7YC 4ZK9B 3LJ3A 3J7A5 2Y0SE 4WRDA 3G6JB 3RMHA 3DHHC 3P4QB 1ZE3D 2WDVB 1GB1A 2WFWA 2QEXA 3IG3A 3LYYA 1AYFA 1P16A 1TWCH 1HFNA 1SE4A 1HTQA 4S3SA 4IFDJ 1MBYA 1KLGD 2WGSA 5G2NA 4R4IA 5C23A 2CWAA 2JA7G 1YNTE 1JROA 1I6HB 2D11A 1Y1VB 2JZPA 2CJNA 3PRMB 3L9AX 1U4RA 2E2HH 2KDIA 2RDGA 2H4OA 2L0CA 3OMCA 4DV3L 3JAME 4JYAL 4M0WA 1EWIA 1ZDXA 4HSPA 3HUIA 1DYQA 3AFPA 1Y1WH 4DR3Q 2KWDA 3RD4A 2MQHA 3VR5A 2IGHA 4BZAA 4A3IB 2PIAA 1MSHA 3HOXG 2M17A 1B7YB 1EOTA 1N8RC 4C7ZA 1VF7A 3T1YQ 1WYGA 2B39A 1HNXL 3P42A 2RSOA 3HG9A 4B3TL 4NY0A 2KTRA 3RNAC 2HCIA 4JI8Q 5CV8A 3QK0A 2NMQA 4K5XA 3KUCB 4GOCA 4A3MB 4O0AA 1V9JA 2YV5A 2OEDA 2G9DA 4JCVE 4URKA 2VUMB 4C1NI 2MNAA 4TV3A 2REXA 4LLGM 1ZP0B 1D5XC 4XIGS 2UUBL 2UUCQ 4DWFA 2Z6BA 4I7AA 1F2MA 3TS2A 4ZKBB 1WXSA 1BCPC 3SK5A 5KHQA 1CSPA 1EZ8A 2EELA 2GBKA 1I3QB 2D62A 2A5UA 1ASYA 4OO1G 1EYCA 5C3EB 1LGRA 4L23A 2DAJA 3RD2A 1HA6A 3KLSX 4W9FA 3ZVVA 2WXIA 4BVUC 3TEZA 3QG1A 2DAFA 4B9XA 4NQLB 4DHJD 2F0VA 2RHSB 1HUMA 3MHBA 4MGKE 4BKTA 1X3QA 2MW5A 3S14H 5J22A 3OWFA 3S15B 5IA7A 1YHQA 5IGDA 1D2BA 1HUNA 1LTBD 2Y0SG 3S1MB 1XF5L 2HQLA 2KJXA 3A9KA 4DKAC 4KV2A 4RNAA 4LF6Q 2I2YA 1V1QA 1DOLA 3CW2C 3R7RA 1K0RA 3OJ3A 1C8CA 3IL8A 2E5LQ 3PUYA 4IM2A 1JWBD 3QB3A 1UD7A 1YJ1A 1TR5A 1E7ZA 2Z0SA 3P1HA 1YNJC 2K6QA 2GBRA 2E3TA 3VYRA 3H7PA 1X9NA 2J7ZA 2XIWA 2N7JA 1SB3C 1WD0A 1EY5A 4X3SA 3KYDD 5BYQA 1X6OA 1ESFA 3A74A 4F7XA 1XPUA 4YY3Q 4GNXB 3T53B 2K5DA 3UI2A 1SE9A 1TKGA 5CTRC 1KNAA 2VQEL 3I3TB 3HHMA 1HFGA 2IGGA 4DK5A 2JF5A 4LF5Q 3VXWA 1NI3A 5M5YB 4QMGA 5IY0A 3EECA 1SRUA 3I4OA 2IHFA 4K0KQ 1JWMD 1P7FA 4G11A 4G0NB 3E9HA 3U8ZA 1TY2A 2RPVA 5I2XA 1N60A 3IHPC 1C48A 3K5MA 2RSUA 5DPSA 4YSXB 2KCCA 4DN4M 3DCGA 3VFKA 3WAMA 5IN7A 2B63B 4RFBA 2JA7B 3CPFA 1PGAA 5IKCM 3CF5A 4WQOB 1I50B 2JA6G 1JWSD 4LNQA 3CCMA 3SGIA 2WYQA 5AJ3L 3SU8X 2PPBC 2IGDA 3C1FA 4MZ9A 1EQVA 1ENAA 4FO2A 1CMXB 4B0EA 3TP7A 1P3QU 2Q2IA 3PF4A 2QHOA 3B0AA 5LL6S 5D94A 1QG7A 2JEBI 4PS7A 2WXJA 4DV5Q 3AYHB 3U58A 4IUUA 1WTHA 3P1MA 4C4VA 4U673 1V1OA 1YITA 1HA5A 1ZGUB 2FMCA 1FXIA 3SFEB 4IALA 4BBNC 1HNZL 3BDCA 1YX6B 2O5JC 2B8FA 3EJIA 4HPLB 1WTPA 2IO2B 1IHZA 4NXML 2CKHB 2IYDB 2D10A 4YSYB 2EXZA 1X65A 3H3VC 3D4RA 2J0TD 3RMKC 2NVQB 2JXTA 4II2B 3R3MA 4LF4L 2LGYA 1TWFH 3JAMi 3KUDB 4IWQA 5C5MA 1WX9A 2EIFA 1V80A 3LB8C 5FO8B 2EDGA 3X3MA 1VLBA 3PLVA 2AWTA 2WXMA 4MDKE 4QAYA 1IL2A 1KRSA 4G57A 5ELCA 1C4PA 3V60A 3LGJA 2PMVA 2PVOD 5GADC 4A93G 1T0RC 2V1CC 4WH4A 3ETRA 2UUAQ 2KWVB 4JI5L 3VYSA 2QCZA 2VZKD 4BY7H 4KZCA 3S1NB 1XMOL 1FGUA 2XNAC 2AYOB 1PTOF 3QCAA 3VRAB 2KVZA 4MGZE 2XRSD 3UQAA 2IT1A 4LFAL 1RLFA 2Y0SB 4CJ1B 4LK1C 2D3BA 3QQ8B 2EMTA 2AX5A 4IM0A 4S0RA 1U4MA 5EPJA 3ZUNA 2JZ3B 1OFFA 2M1MA 4MNOA 5L37A 4L5QA 4HROA 2EYFA 1FJGQ 1PH7A 4A93H 2O2VA 3PPAA 2E8GA 2NBVB 3V05A 4B0MA 3OTOQ 2N9EB 4IUVA 2GRIA 3ER0A 4DNIA 2EKIA 4MTNA 5M5XB 2NBUA 5E6JA 3S2HH 1L1OB 3BY4B 1A62A 4XXEA 4WQMA 2BS2B 1E0BA 4YCUA 4DF7A 4MT5A 1N34L 3T13A 2ID0A 3APCA 4KGTA 1BBWA 2L52A 3W1GA 2PW7A 1RCVD 3PO2B 1SGHA 4KY5A 3DBHI 2BDOA 1CA6A 1V8QA 1UBIA 5HHDG 4LFCL 5BR8L 3HK0A 1VMPA 1F2RC 3DVGY 4ZHOA 4KVGB 1PFNA 3E9IA 5J17A 2AQ2B 3DHGC 3FKIG 1GJXA 3N1YC 5C44H 2JA6B 3ZKJC 1JE5A 4TKOB 1BMLC 2KDMA 1RFAA 1KFYB 4XT3B 1FNUA 4YXDB 1SN8A 2K8BA 4ZRIA 2IO1B 4RHRA 4Y7NH 1WVLA 1YJNA 3A4RA 1T0SC 4I65A 5JVG3 2BPSA 2ONQA 3R8BA 1B9NA 3NY5A 4KKIA 2SNMA 4TQUS 1R9TB 1XYIA 1JW9D 2HDLA 2F0OA 4II3B 4A3LH 5HI1A 1H9MA 3L0OA 4ANWA 4Y52H 1PTOH 4EX5A 2O2LD 4K6LA 4WJQA 1SMYD 3RZDH 4DR4L 3ONAB 2LMCB 4BXXH 3CU7A 4E6IA 1EL0A 3W2DA 5IGFA 1I35A 3EROA 4ULLA 2ZM6L 4DU9A 1JE4A 4K7WA 2SDFA 2J42A 1JT8A 3GV6A 1CZPA 2PVGC 5E3FA 5CV7A 2PZWA 4DA2A 3BYYB 1ZYRD 4NP5A 4AJYB 5E4XA 1WMHB 1RKNA 3VYUA 3MXNA 4KN4C 2I07B 1EQQA 1QOBA 1ZW7A 2OJRA 4F88A 2LGIA 1CQVA 2JXMB 5J3BA 5EKLA 4KHPQ 3S2DB 2FUG1 3FEWX 4OONA 5CV9A 3BIID 5BMHA 2E6XA 3DDCB 3SK8A 1R4QB 2INCC 4NQKE 1C9OA 2OTLA 1HTOA 2PTLA 2R92G 3IVFA 1GKHA 1TVXA 1IBKL 1PTOD 3N3KB 1V81A 5IWAL 3BK1A 2BWES 2E2JB 3PIPA 3W3AA 3PZDA 1QOFA 3K8AA 2PMZE 3I55A 1Q1EA 4X64L 4POGA 1QOAA 3FKYA 3KYCD 4IM3A 3ND9A 4DV1Q 1OQRA 3IFDA 1WJ4A 1XT9B 1F2ZA 4MACA 1WF9A 2KKCA 2PYKA 4B3SQ 5FJ8G 2DJFC 3CKIB 4YCWA 3JAML 1WTVA 1TGZB 4DXAB 3B6YA 4EQ5A 1YJJA 3VA5A 3DWGC 1YN5A 4FVMA 5DEHA 1V8CA 2EY5A 2CQOA 2F0TA 3BU2A 3N1ZC 3I70A 3JW0X 4ZRKA 3BJUA 1ZKHA 2HHHL 4GB9A 1A5RA 2PI2A 3IXSA 2IY5B 3CIRB 2ENBA 3VVWB 4B9WA 2K28A 4PK1A 2EYMA 3Q23A 1ASZA 2DUDA 4A3JH 1LYLA 1TT2A 4ANVA 4NPSA 1RHPA 3ALBA 4O42A 1I4GA 4EOYA 4TVAB 2ZTCA 4XDCA 3PO3H 1C1YB 5H1SE 3PO0A 4OW0A 1MFWA 3RLNA 3M4OB 2L0FA 2Y5CA 2ZTEA 3HOYH 2ZPYA 3TP5A 2KWUB 5EE1A 5A2QL 1VS0A 1V97A 3EGRA 2B2WA 3A54A 1NSNS 3K59A 2JT4B 3N30A 4J15A 4ZYNA 2HD5B 4X66L 1IUEA 3Q2AC 2W3RA 4AUQC 2X8XX 4A4IA 5JEAJ 3GTMB 2F0EA 3PV0A 3M4YA 4DAYA 2K8CA 1ICWA 4H0LC 2KLGA 1S5DD 1TWAB 2Q8TA 4FXCA 2OCEA 3P2BA 1Y8NB 3WALA 1LTTD 3K9OB 3WOEA 2IO0B 2LUEA 4LNOA 1J9OA 3I72A 2C60A 2BGFA 3HOVG 1N9WA 3W5VB 4WJNA 1T0YA 2F0QA 4O1NA 1QZEA 1J5EQ 1VQ7A 5EPKA 4BKSA 3PMFA 3A33B 5C4ZA 3D4WA 3AE9B
chains in the Genus database with same CATH topology
4V190 3K0YA 4KN7C 4HKZE 1OQQA 3U7ZA 2A6ED 4ZYSA 5BN3A 1FCCC 3AB5A 1FCLA 5KNDA 3PIO3 2R92B 2J52A 1H9JA 1NAPA 2NUCA 3GD7A 5FLXL 2LS01 2TSSA 2BCOA 3QWNA 1A15A 1ET9A 4OL7A 1L0XB 5JEAG 3S1RB 2L1AA 2IX0A 3TBIB 1QLBB 1SSOA 4CQNA 3U9SA 1VZ6A 1BCPF 4A3GB 2PW9A 3QO2A 3K58A 2MJ3A 2WXPA 5C2TB 1E7PB 1DD2A 1P7EA 3NVZA 1SMYC 2F4IA 2DBYA 1SNMA 4M1UB 4L1BA 4NKLA 3NP8A 2ICIA 1K8MA 3AE3B 1K83B 2E74C 3NWTA 1I4PA 5I4DA 4WIPA 5G3LD 4OHJA 1U4LA 2C9OA 5K36H 4C56C 1E2VA 2EVBA 2DYOA 2XVSA 1MI2A 3L4PA 3HP3A 2QMTA 2WXRA 2JA8B 5EE3A 2EY1A 4R3DA 1PTOC 5KNBA 2VB2X 2EJGC 4QB4A 1G6ZA 4P16A 4C7YA 4N9TA 4V0BA 2K03A 2G9HD 1N5XA 1VR9A 1ZUD2 1OXVA 1QQRA 1HQRD 1PDQA 5HURA 1EY8A 5ISRA 1LLRD 3EA6A 3BG3A 2BDNA 3VR6A 2WXFA 2DNCA 2N9KA 1YNNC 4ZUIA 2XRQD 3HOZB 1EM7A 2IX1A 4IUNA 3GTPB 1Z47A 5EE9A 4KHVA 5D3IB 1UEAB 4G7HC 3AEBB 1PRTF 2Q8RE 4Q5VA 3C2PA 1D1KA 5BN4A 2IPKD 1II3A 3NQTA 4ZHPA 2V3PA 3U4EG 4A55A 1I4XA 1YN3A 1O7LA 1BCPD 1JWUD 2YEPB 3AH7A 2JE6I 4NW2A 1EIGA 3FVQA 3RZOB 4A3BB 2D5DA 2H1EA 1PZJD 4A8XC 1G291 4J1MA 5C3XA 4OVZA 2N55A 3BS1A 3KBXA 2XWJB 4HTHA 4GDLB 3H91A 3ZGZA 3MXPA 3DEOA 2NZ1D 1Q3LA 2M9VA 2A6EC 3I57A 3Q0AA 4P6VF 1YNJD 1C4AA 2LY7A 3E0JA 4IFDH 1ZDVA 2EYPA 2RA4A 2A5HA 1E10A 4OO1H 3QIAA 1AZPA 3GTLB 4DAPA 5D14A 4Z9CB 3RUZA 3MC0B 2ZW1A 3HZXA 3CHBD 1KAAA 2NVXB 5M5WB 4OZAA 1CFMA 1NENB 5HFYA 5EBDA 4ZUJA 2FJ2A 4PT5A 2RSNA 1F2LA 3I4LA 3VR4A 3P7JA 5JOBA 1E9MA 1UAPA 4EQPA 2ZXOA 2X69A 3J7AV 1TS4A 1TQOA 1R7SA 1EY4A 2KN4A 3OW7A 1IKLA 4FYDA 2F0UA 2B2YA 3K5NA 1FYCA 1IYVA 1C78A 4EVOA 4OZCA 1A2UA 1HZ6A 2JSVX 1C4CA 2TMPA 3ZJVA 2RVLA 1OXXK 5D65A 1PRTD 3TEXA 4ZRQA 1EY6A 1SYEA 2F0IA 3P63A 1JCKB 2G1EA 1NYRA 4G7OC 2BS3B 1RDPD 5A35A 4KGRA 3VYTA 4C3IG 2AQ1B 5CBAE 3SHLA 2BB6A 1HPCA 2B2TA 1LT6D 3H09A 3IAM1 1LTID 1E0ZA 1CK1A 5CV5A 5CGKA 1F0ZA 3FPPA 2K0PA 4TMAB 4XQJA 4DAVA 1SNPA 1ZEQX 3M85A 3Q69A 5KNCA 5KIXA 1ILQA 4BY1B 4DXFA 1QJOA 3GTKB 1F9RA 1XO3A 3FC4A 4IZ8A 1STNA 4USAA 3NBIA 5M3FB 4IN3A 5FOBB 2MEKA 5ELEA 2NB0A 1YN4A 1K8OA 2YYZA 1PZID 3T3OA 4U68A 3AE8B 5CBEE 1ENCA 1IGCA 2BYTA 1UUPA 5A2QE 2MUYA 3K6OA 2ZXPA 3VR8B 2K1BA 2I46A 1QCBD 4FP5D 3ND8A 3TZUA 1GUSA 2ZXRA 3T56B 4K2KA 4JPSA 1GHJA 4OIKA 3NVYA 2BA1A 4CJ2C 4DXGA 4RGOS 1I4HA 4FNFA 3NBHA 3PZ7A 4IDIA 2F0FA 3BYTB 4QCLA 1Y69U 3N9YC 1F9SA 4C3IB 1LO5D 1T3QA 4KKJA 5KEEA 2FINB 4HMIA 4ODGA 2EPBA 3AE1B 4B08A 2WXOA 1K50A 1Y8OB 2D5GA 5DAUA 3J7YW 2LHEA 2KAJA 2WU2B 5FLXE 4A3EB 3A8JE 1SNQA 2NWGA 1HHVA 3IFTA 1SFOB 1WCMB 3E5SA 1G8ZD 3IAS1 3DUZA 3J9CA 5C3JB 2WDRB 1SXTA 4ZOHC 2VB3X 2A73B 2JX5A 1WSPA 5IOCA 4QF4A 4FF1A 1RTOA 4X3UA 3B9JA 3URYA 2WQYB 3T4AC 4HJGE 1UGJA 3OIQA 2EJMA 3SE0A 3K7AB 3SXHA 3KQ4A 1FO4A 1E6EB 1T5EA 3ZJUA 5I6WA 1PRTC 3SEBA 4YWGG 1L0VB 1SNOA 5CC4A 3N52A 1C76A 5JPNC 1D6EC 4HMJA 2LJIA 3GS2A 5BMGA 1D5MC 2K5WA 1DXMA 2W55A 2F0MA 2AUJD 2NTSA 4ABNA 5C5LA 1SJHD 2E76C 2BE5C 2JU6X 5K5PA 4FF2A 1TWHB 4H7BA 2B8GA 1WTXA 3NTHA 3NUCA 1GUNA 1FR3A 3OHXC 2JA5B 2QILA 5AUIA 1SF0A 2HUGA 3D6WA 5M3MB 3Q22A 3TMEA 1FD7D 4ILWA 3P4RB 3HRDD 5IGBA 1B50A 3HS0C 3AM9A 3NRZA 2W54A 1MHXA 1CHQD 4C3HB 3KWVA 4XQNA 1G2TA 1MHHE 1LTRD 3ZQ4A 1N62A 2FFKB 2WNMA 3S9WA 2K01A 1QE6A 1JRPA 3Q6SA 3EUB2 2EOTA 1W6JA 4XYQA 1N5WA 1QKZA 1QT9A 1SNCA 2F0SA 4CKBA 1KDCA 4R8NA 2YEPF 2F0PA 2KQ3A 4L2YA 1L0YB 1RF2D 1YQ3B 5GXGB 1DOYA 5I6YA 2WXHA 1WD1A 5ELBA 4RKLA 4HN7A 1O80A 3MEHA 1MGSA 3KUPA 1LT4D 4X3KA 2X38A 2RQXA 1MD2D 1A6XA 1B9RA 4XDXA 2D9UA 5DM73 1NYQA 1FM0D 3O13A 1BUIC 2B2VC 5LL6X 1PUTA 1HTPA 3GTJB 1HRJA 3R3OA 2XSCA 3R93A 1OXSC 1EY9A 3OIPA 1STYA 1GAQB 5I2YA 2JWUA 2BT6A 1QNKA 4UAIA 1VZ8A 5JEAH 4K5WA 5E1FA 1JALA 1PLFA 2WAQB 4WWMA 1M4VA 1QILA 1BF4A 2E2HB 3H8HA 3I9V1 2A69D 1Y1WB 2FBWB 3P20A 3GO5A 1TS5A 2F1MA 4WORA 1STAA 4X3TA 2WP9B 3NUHB 3RFZB 1TS3A 4XYOA 3NS1A 3K5OA 1GB4A 4CJ0B 3AMZA 4KX6B 4PNYA 2DY8A 1A2TA 3KBGA 2O5IC 5NUCA 2XWBB 2LFIA 1EQTA 4AYBB 1CHPD 1YNND 4A9AA 1H9SA 2B2TC 2IX3A 2NN6H 3B2FA 3FRPB 3IAYA 4L63B 2MHVA 1CZGA 4PV1C 1JR0D 3S14B 3Q8BA 4US8A 3HGBA 4P2CB 1JORA 4IUTA 1Y8PB 3TEYA 3A7AB 5FK9C 3AMUA 3H6MA 3I8ZA 5EPLA 2K22A 1U9RA 3SK6A 3AEEB 1WTQA 3C46A 5CMDA 2EYJA 1PYWD 4CGYB 5COYA 3NZ3A 1Z6HA 3IT6B 3SK4A 4MIUA 4RCNA 3LNNA 2RMMA 2PZTA 4IKGA 1UNSA 1SAPA 2Z4HA 3FMCA 1SYGA 3AEFB 1STEA 5EE0A 1JQ4A 2X6LA 3NHHA 1EU3A 1FNVA 3D3RA 4OZBA 3VRBB 3HVDA 1IGDA 3EFXD 3NE5B 1CJEA 2N0SB 4YSZB 2CHBD 4KI0A 3ABVB 2IL8A 4G7ZC 5C0XI 4RAUC 5HGTA 1S5FD 2WACA 1XCQL 1NR2A 4LAAA 2DYMA 3MZ5A 2MJDA 1A3TA 2JP1A 4JK1C 4IFDI 4QIWB 1BQQT 2KQ4X 3OSOA 1K52A 5J1ZA 1A3VA 1A3UA 1TWFB 5CV6A 3TP8A 2MH7A 1I4QA 2MJ8A 1VMCA 4EQNA 1DOMA 2H88B 1FEHA 4NDXA 5KYIA 2QEJC 3VR3A 1BUVT 3WOFA 1RYJA 2HTME 4BY7B 4US9A 3G7LA 1EYDA 5LHY1 1B1ZA 2L55A 2KEEA 3MFYA 3V96A 1U4PA 2A69C 4A93B 2K3UA 2B76B 1VZ7A 5G5HA 1CM9A 5BYSA 2QIEB 3S2HB 1STHA 2O4XA 2L1BA 2Y5PA 3L3OC 2EYOA 2IW3A 3TEWA 4CBVA 2R3ZA 3W9CB 3TP6A 3SFDB 3NSWA 1EZ6A 2F0NA 4ZKCB 5IGEA 3ZJTA 1IKMA 5IGGA 1BR9A 3DWAA 3V2TA 5EBCA 2L12A 3PUVA 4R9WA 5C44B 1XXGA 5DM63 1ZKOA 1VF5C 3TDQA 5EJWA 2WKDA 2GB1A 1IW7D 2JYTA 3R2TA 2M0AA 4Y7NB 3CRKC 1STGA 3NK9A 1XTCD 2IJ0A 1CTMA 1O78A 1FRRA 5JAVA 4BS9A 3VA7A 1SYDA 1F77A 1CA5A 4FF3A 1EYAA 5IIFA 4EQOA 3RZDB 2WKCA 2LEKA 1SYBA 3FAHA 3MWYW 2PKOA 3BDLA 1T5XD 1EU4A 1N63A 3W5UB 1ESRA 2F03A 4GLSC 1WTRA 1PFMA 1TS2A 2KUMA 3J80E 2LUMA 5AUKA 3LWUA 4WAFA 1XWEA 1XX8A 4GDKB 2K33A 3I91A 3HOWB 3L7ZC 2KCNA 4MH8A 5IODA 1PXUA 1JOQA 3I90A 5BN5A 3LXFA 4DK1A 1TIID 4KKUA 2SEBD 1JOKA 2J4XA 2WXKA 1WTOA 1FIQA 4KGSA 4TRDA 2N9LA 4HSVA 5BYRA 5AFWA 2A6HC 1UWXA 1EWCA 1H9KA 1LT3D 5EGTA 2DLBA 3PIP3 3SDZA 4AQ7A 4RHSA 2MP1A 4A3JB 3C3LA 4EE2A 1WRIA 2JYEA 4IUPA 1ML0D 3PO3B 1C9FA 1CT1D 3BWUD 3HOYB 5K36G 2SNSA 3W1SA 2KVMA 1N61A 3EVQA 4RGNA 2NYZD 1NEKB 2JSOA 1AW7A 1I7HA 2ZT9C 3D31A 4BWGB 5LNK1 3F2UA 4ARCA 4XE0A 3BDOA 4YTNB 1B9MA 1Q90A 1GHKA 1PZKD 2BE5D 4KD4A 2RDHA 3AE5B 3AU7A 3M7NA 2RKSA 2K9XA 4EGVA 3AB9A 2W82A 1JQYD 2B2UA 4BBSB 5HG2A 1EY7A 3BVMA 3Q8FA 5IGCA 4KJNA 1S5CD 5MPOA 1UWMA 1F9QA 1V1PA 4NMZA 5C0XJ 2L11A 1HQMC 3HRZC 3TUOA 2B2WC 5JVH3 2FE8A 2J53A 4K2LA 1DZ1A 3NQIA 1H9SB 2K6AA 3J81L 1IW7C 1EWHA 4CKCA 1BNZA 1FNWA 3E6ZX 3T51B 2I38A 2WDQB 3FILA 4N6EB 1DGJA 3P75A 5M9OA 1NCVA 3UI3A 5G5GA 5F2DA 4HR7B 4TQ1A 1S4ZA 3OOCA 3DXJC 3I3CA 4BA1I 4F87A 3WCQA 4IURA 4MHEA 4LJZC 3GV3A 3QJYA 2SOBA 2DN8A 5EQ0A 4KHZA 3MXUA 4PMCA 5C0XG 2E2DC 2WP8J 4KKTA 3GB1A 2EZVA 1MVKA 3K5LA 4JWSC 3DEPA 4LK0M 2NTTA 2K04A 1D1IA 5ELFA 1J7BA 5H92C 2L32A 1ZPSA 2OHFA 5BMIA 4IFDG 1MPEA 5T8IA 2Z1CA 3S16B 2WXGA 3NPPA 2WB1B 3BZDB 1E2ZA 4C3HG 4DGZA 1H9RA 2E75C 1CZWA 1LABA 3DMUA 3M7GA 1O7YA 1I6VC 3SVMA 3AEAB 1JMLA 1WGKA 4FF4A 2INNE 2QSDA 1G91A 1B3AA 3IT4B 3Q8AA 4A3KB 4XQQA 4KK7A 1KTKA 3ZYYX 1PFBA 1BCPB 1NR4A 4QUFA 4WFN3 3T16A 4J8QA 2WXQA 2M19A 3DHQA 3J7AF 1L5PA 1FD6A 1SJED 1EY0A 4J6HA 1GPXA 2PQEA 3FDTA 3OPOA 1V43A 2CW0D 4N58A 5E4WC 1SE2A 1YQ4B 2PLPA 3MXGA 1AWDA 2WU5B 2FMMA 1SNDA 5C4JB 1K51A 4WJWA 4KMUC 5C6AA 5D7GA 1GUTA 1S5BD 5JJZA 5I9PA 1KDBA 2VNUD 1WWTA 4CKEA 3DWMA 3P4PB 1Z7TA 3KF8A 1TKEA 2QJLA 4F8MA 5IT9L 1KNEA 3MVVA 1RWSA 3AV8A 5JXVA 3AE7B 2DY7A 2WIIB 5CORA 3HOXB 4K5VA 4XTCS 2INPE 4H13C 2NBFA 1PMRA 3VQIA 3B2GA 2JQRB 1LTSD 1RJTA 1BDOA 2NN6I 3T3NA 1KDAA 1SIJA 4WURA 4C1NK 4OGQC 4Q2JA 1BXTA 1L4ZB 3CQZB 2ICEC 3J80L 3NXWA 1Q1BA 2EY2A 1VJKA 4YT0B 5D3DA 3HKZB 3Q8EA 1MI0A 1FXAA 3N6RA 3U52E 3NTKA 4TSSA 1PRTB 2HDMA 1PDXA 2WV6D 4RKBA 3VR2A 1R4PB 2A74C 3BVGA 2OF1A 1DM0B 2CVRA 4HEDA 1QOHA 4YTMB 4DQOC 4JWUC 3QOLA 1XLNA 4HRSA 1OO9B 2LKVA 1QNUA 1EWYC 1O7ZA 1GUGA 4HEA1 1LV9A 1TZOA 1EEID 2F0LA 2NVYB 1KH0A 1PGXA 1HZ5A 1OXTA 1S5ED 4KJOA 3SR1A 1VCIA 5KYLA 2SAKA 3H0GB 1YJIA 4KKSA 3TSSA 2DNEA 5JPMC 1K53A 1TJEA 2A68D 1DCZA 2QDBA 3CWIA 1Q8IA 4XWWA 5T1IA 1HEZE 2LHDA 2HQEA 3MJ5A 4DFAA 2F0KA 5FKAC 2GA4B 2M00A 1NUCA 1C79A 2ACZB 1QB5D 1KRHA 3NTIA 4DNTB 3CRLC 1TWCB 3D6CA 1YMHE 3H94A 4C3JG 2RBMA 3MA2B 2ZW0A 1TKYA 1E2WA 4C2MB 1IYUA 3RLFA 1F9PA 3D8GA 2EJFC 2B2YC 4C80A 1HXYD 2W3SA 5EKKA 5I9OA 1XLPA 2AWNA 4LTUA 2F3WA 1DJRD 2KEDA 2QF7A 4JX1C 2NVTB 4IUQA 4YIJA 2F0HA 4GZYC 4J3OD 3R2IA 1F2YA 2WLBA 1L6UA 2EYHA 3GP7A 2CW0C 2K05A 2QKIC 1ENFA 3AEDB 4I7ZC 4ZRPA 3DWQA 4M8AA 1EFID 2AQ3B 1KLUD 3DWPA 3NVWA 4D2KA 1SSNA 3A8KE 2Y3AA 1AP0A 2CU3A 4NZLB 2B2UC 5FO7B 5H8YE 3U9OA 2D2CC 1PFDA 3EQLC 4KY6A 1QF6A 1X32A 2YU9B 2ON8A 3S1QB 2WXLA 1HCZA 2IDYA 3AEGB 3AN1A 1KF6B 1SEBD 1AZQA 2R6GA 1XLQA 1DOIA 3MP9A 1MSGA 4YTPB 3S17B 3C8YA 3GQBA 2AUKA 1LACA 1ET6A 1WXQA 3NVVA 3MAQA 4RGMA 4REZA 2KHSA 3IKJA 1KABA 1A70A 3SR6A 1IBXB 2M56B 2GI9A 4NJCA 2OT2A 3HOUB 3FKIB 5G3LF 3A56A 1BOSA 2OXPA 2Z4IA 4K8IA 1OXUA 1V1PB 1ILPA 4RF0A 4QUCA 5DNFA 1BBXC 1FFVA 4HKQA 1BO0A 2Q5WD 3I73A 4DK0A 2XN9C 2Z8LA 4H2AA 1JC7A 4NAWB 1VDVA 4UDUC 1B53A 3GTGB 4C3JB 4ZRZA 2IWHA 2C5CA 4DNRB 2V4DA 3FILB 1CI3M 1WTWA 3J81E 5C4HA 2CQAA 4OIJA 1GOZA 1JICA 2MPMA 2BB5A 3HVZA 2EY6A 2N88A 1SBBB 2L83A 1TYGB 1B2TA 1RODA 1L6VA 1I4RA 2K5QA 1TY0A 1IL8A 2KECA 4PQXA 1XCTL 2F0DA 2VZKB 3D4DA 5FR3A 3MFGA 1EEFD 3DM1A 2JYOA 3BVZA 2A6HD 2BBCA 1DOXA 2A68C 1J8IA 3C1EA 5J39A 1AN8A 4JE3B 4OO1I 4FXDA 2V0GA 4Q0FA 3AE4B 3Q8CA 1L4DB 3RPFC 1LTAD 1EIHA 2K32A 3VR9B 4AS1A 3KK7A 3Q24A 4ME5A 3GTOB 4L8JA 2F0WA 5CV4A 4N59A 2KOLA 2LFNA 2KACA 4H44C 2L4NA 3LWEA 4RF1A 5KRUA 4N9PA 3LX0A 1AEXA 3OWEB 1JWAD 2OEOA 1RM6C 5T1GA 2EYLA 1PGBA 5TSSA 2KA7A 1SYFA 3KWLA 2QCPX 5EKIA 2F3VA 3PUXA 1ONLA 1ZYRC 4L6TB 1GXDC 1CQFA 1RTNA 4RGTA 3OMGA 4IQZA 2HCCA 3ITPA 5C3WA 4LMQD 3WDNA 2F0JA 2PZUA 1AFPA 2NN6G 4A90A 4BBRB 4ITKA 3TN2A 4R8IA 3TZDA 3MHZA 1B44D 3K57A 3BK2A 1RD9D 4RH6A 5CR3A 1FMAD 4A3FB 4K8JA 3ERQA 2AWOA 3PZ8A 1ZXHA 1JB3A 1Y56A 3HOVB 1XEEA 1ZOYB 3KLSA 3I4MB 1FGBD 4CHTB 1F2RI 2PMZB 4ZAIA 4KY7A 5IT9E 1FRDA 2DWQA 2CJOA 2H89B 1VRAB 4RA8A 3E56A 2L5TA 3PUWA 5CYUA 2RDFA 1PTOB 3A7LA 3X3NA 1VDZA 1NVID 4K14A 2VXWA 4PMBA 1ROEA 1DONA 1D5ZC 2PW5A 4NAMA 4A3DB 2MGSA 4ZLTF 4JBWA 1SE3A 3A8IE 2K5PA 2BS4B 3AECB 3A55A 1DOKA 1ZXTA 2M2LA 2R61A 1M8AA 5C4XB 1X3PA 2Q8IB 3HEJA 3I4NB 2BOSA 2K7VA 4XWTA 4TQ0A 2FHTA 4KV6A 2JEAI 1Q10A 4KTAA 4ZQ3A 1QWYA 5C0XH 1TKWB 2MJEA 1D4BA 3AE2B 2LMCA 4BA2I 1TU2B 2WS3B 4MM3B 4RWSC 1LTGD 2HDEA 1B4OA 2L9HA 3MTSA 3GTQB 2BTEA 2V3NA 1HTLD 1J7AA 4FXKC 2V4IB 2WXNA 2X6GA 2F0GA 2BW2A 1W6KA 4ARIA 2B2VA 4HAEA 3U2SC 1GUOA 2E2IB 1G2SA 1TWGB 1XLOA 1LT5D 1C77A 3NWSA 1JOOA 1C4QA 1Q12A 5ELDA 1FFUA 1SDFA 1STBA 1ZXIA 4KD3A 4HCSA 2PCFB 2PNRC 3KLRA 4ID6A 2PO4A 4HCEA 2KMMA 3P4SB 4K6DA 1GUWA 3FPUB 4MN3A 1SYCA 3M3YB 2WINB 5KGUA 2R7ZB 4IOIE 1RFKA 1T6BX 4RCOA 4FXGC 1IBXA 5FO9B 2BA0A 2EE1A 3V3XA 3PUZA 3AE6B 1QOGA 4G4KA 3E9SA 4PMWA 3QOJA 4XT1B 1J7CA 4XDDA 2R93B 1ACCA 4ZK9B 4WRDA 3G6JB 3RMHA 3P4QB 1ZE3D 2WDVB 1GB1A 3LYYA 1AYFA 1HFNA 1SE4A 4S3SA 4IFDJ 1MBYA 1KLGD 1YNTE 1JROA 1I6HB 2JZPA 1Y1VB 2CJNA 3L9AX 1U4RA 2RDGA 2H4OA 2L0CA 3OMCA 4M0WA 3JAME 3HUIA 1ZDXA 4HSPA 1DYQA 2KWDA 3RD4A 3VR5A 2IGHA 4A3IB 2PIAA 1MSHA 1EOTA 4C7ZA 1VF7A 1WYGA 2B39A 3P42A 2RSOA 3HG9A 2HCIA 5CV8A 2NMQA 4K5XA 4A3MB 2OEDA 2G9DA 2VUMB 4C1NI 4LLGM 1ZP0B 1D5XC 4XIGS 1F2MA 4ZKBB 1BCPC 3SK5A 1EZ8A 2EELA 1I3QB 2D62A 4L23A 4OO1G 1EYCA 5C3EB 1HA6A 3KLSX 2WXIA 3TEZA 3QG1A 4B9XA 2F0VA 1HUMA 3MHBA 1X3QA 5J22A 3OWFA 3S15B 5IGDA 1D2BA 1HUNA 1LTBD 3S1MB 1XF5L 2KJXA 4RNAA 2I2YA 1DOLA 1C8CA 3IL8A 3PUYA 1JWBD 3QB3A 1TR5A 3P1HA 1YNJC 2E3TA 3VYRA 2J7ZA 2XIWA 2N7JA 1SB3C 1WD0A 1EY5A 4X3SA 5BYQA 1ESFA 4F7XA 3T53B 2K5DA 3UI2A 1TKGA 1KNAA 1HFGA 2IGGA 1NI3A 5M5YB 4QMGA 1JWMD 1P7FA 1TY2A 2RPVA 5I2XA 1N60A 4YSXB 1C48A 3K5MA 2KCCA 4DN4M 2B63B 4RFBA 2JA7B 1PGAA 1I50B 1JWSD 2PPBC 2IGDA 3C1FA 1EQVA 1ENAA 4FO2A 4B0EA 3TP7A 5LL6S 1QG7A 2JEBI 2WXJA 4IUUA 3P1MA 4U673 1V1OA 1HA5A 2FMCA 1FXIA 3SFEB 4IALA 3BDCA 2O5JC 2B8FA 3EJIA 1WTPA 1IHZA 4YSYB 2EXZA 3H3VC 3D4RA 2J0TD 2NVQB 2JXTA 5C5MA 3LB8C 5FO8B 2EDGA 3X3MA 1VLBA 2WXMA 4G57A 5ELCA 1C4PA 2PMVA 2PVOD 4WH4A 3ETRA 3VYSA 2VZKD 3S1NB 2XNAC 1PTOF 3VRAB 2XRSD 2IT1A 2Y0SB 4CJ1B 4LK1C 2AX5A 1U4MA 5EPJA 1OFFA 4HROA 2EYFA 3V05A 4B0MA 4IUVA 2GRIA 2EKIA 5M5XB 5E6JA 4XXEA 4WQMA 2BS2B 1E0BA 4DF7A 4MT5A 3T13A 2ID0A 4KGTA 2L52A 2PW7A 1RCVD 3PO2B 4KY5A 2BDOA 1CA6A 1V8QA 5HHDG 1VMPA 1F2RC 4ZHOA 1PFNA 2AQ2B 1GJXA 2JA6B 4TKOB 1BMLC 2KDMA 1KFYB 4XT3B 1FNUA 4YXDB 4RHRA 1WVLA 4I65A 5JVG3 2ONQA 3R8BA 1B9NA 4KKIA 2SNMA 4TQUS 1R9TB 1XYIA 1JW9D 2HDLA 2F0OA 5HI1A 1H9MA 1PTOH 2O2LD 4K6LA 1SMYD 3ONAB 2LMCB 3CU7A 4E6IA 1EL0A 3W2DA 5IGFA 3EROA 4ULLA 4DU9A 1JE4A 2SDFA 2J42A 3GV6A 1CZPA 2PVGC 5E3FA 5CV7A 2PZWA 4DA2A 3BYYB 1ZYRD 4NP5A 5E4XA 1RKNA 3VYUA 3MXNA 4KN4C 2I07B 1QOBA 4F88A 2LGIA 1CQVA 2JXMB 5EKLA 3S2DB 2FUG1 3FEWX 5BMHA 5CV9A 3BIID 2E6XA 3SK8A 1R4QB 2PTLA 1TVXA 1PTOD 3BK1A 2E2JB 3W3AA 1QOFA 1Q1EA 1QOAA 3ND9A 1OQRA 3IFDA 1F2ZA