1TS3A

H135a mutant of toxic shock syndrome toxin-1 from s. aureus
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
194
structure length
194
Chain Sequence
STNDNIKDLLDWYSSGSDTFTNSEVLDNSLGSMRIKNTDGSISLIIFPSPYYSPAFTKGEKVDLNTKRTKKSQHTSEGTYIHFQISGVTNTEKLPTPIELPLKVKVHGKDSPLKYWPKFDKKQLAISTLDFEIRAQLTQIHGLYRSSDKTGGYWKITMNDGSTYQSDLSKKFEYNTEKPPINIDEIKTIEAEIN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structures of five mutants of toxic shock syndrome toxin-1 with reduced biological activity.
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Toxin
molecule keywords TOXIC SHOCK SYNDROME TOXIN-1
total genus 60
structure length 194
sequence length 194
chains with identical sequence B, C
ec nomenclature
pdb deposition date 1997-10-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02876 Stap_Strp_tox_C Staphylococcal/Streptococcal toxin, beta-grasp domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.110 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1ts3A02
3.10.20.120 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1ts3A01
1I4PA 3EFXD 4RHSA 1FGBD 1FNUA 4RGOS 2R61A 1SEBD 1I4XA 3MC0B 1SJHD 3TSSA 1CK1A 1KLUD 1JCKB 1KTKA 2CHBD 4RGTA 1MD2D 1STEA 1LTID 1YN5A 1SE3A 1B1ZA 1D5MC 1RD9D 1V1PB 5TSSA 4RFBA 4RCOA 4ZYSA 5I4DA 1TS4A 1HXYD 4RH6A 1FNWA 5ELCA 2RDGA 4L6TB 2XN9C 1JQYD 2ICIA 1BCPD 1SE4A 1PTOC 2XRSD 1PRTB 1I4GA 1I4QA 3W2DA 1EEID 1LTAD 3BVMA 4NZLB 1BCPF 1ENFA 2SEBD 4TSSA 4C56C 1FNVA 1EWCA 1V1OA 1I4RA 1S5ED 1V1PA 1XTCD 1HTLD 1LLRD 1D5ZC 1S5FD 4O1NA 1S5BD 1TS3A 5FK9C 1ET6A 1ET9A 2Z8LA 1HQRD 1LTRD 1D5XC 4K6LA 1LT5D 1B44D 1CHPD 1CHQD 1CT1D 1JWUD 1QILA 1RF2D 1SJED 3DWPA 3BYYB 1ESFA 5D3IB 3DWQA 1TY0A 1LTBD 1TY2A 1LT6D 1PRTC 2O2LD 3DWAA 2J4XA 1KLGD 1RCVD 1EEFD 3O13A 1XXGA 1EU4A 2XRQD 1GOZA 1T5XD 1JWMD 1PZKD 4RGMA 2IJ0A 2QILA 1JR0D 1YN4A 2NTTA 5FKAC 1S5DD 3V05A 1F77A 1PYWD 1JWSD 4Z9CB 5D3DA 3URYA 1LO5D 2AQ3B 4UDUC 2RDHA 1BCPB 1HA5A 1L0YB 1LTSD 1UNSA 1DJRD 1M4VA 1SE2A 1BCPC 3GP7A 1PTOF 3MFGA 3BVZA 2AQ2B 1LT4D 2TSSA 4OHJA 3R2IA 1LTTD 1D6EC 3R8BA 2AQ1B 5ELDA 1PZJD 3CHBD 1G8ZD 5ELFA 2XNAC 4DXFA 1LTGD 5ELEA 1SXTA 2G9HD 1PZID 2IPKD 1L0XB 1FD7D 1AW7A 1PTOD 1PRTD 3R2TA 4DXGA 2QEJC 3BZDB 1I4HA 3KLSX 1TS5A 1RDPD 1PTOH 1CQVA 1S5CD 1UUPA 3EA6A 4RHRA 1AN8A 1EU3A 1DYQA 3OWEB 1PRTF 5ELBA 1LT3D 1YN3A 4RGNA 1BXTA 2NTSA 2WV6D 1EFID 3BVGA 3BYTB 4BWGB 1TS2A 4L63B 1PTOB 1SBBB 3SEBA
chains in the Genus database with same CATH superfamily
1HUNA 4KVGB 4WJQA 4DAVA 1BBXC 1CMXB 2IO3B 1XCQL 5JPNC 3T3OA 4JOIC 3MC9A 1K8MA 3KF8A 4QY7A 3R7RA 1GHKA 4UP7A 1C9FA 2N9LA 3MAQA 3HOYB 2KWUB 1H8CA 1PFMA 2WXJA 3F1ZA 3HOXH 2GBKA 1MD2D 1HH2P 1AP0A 3VR3A 1D2BA 3T56B 5M5YH 3RN9C 3K5OA 1Y69U 2KA7A 1R9TB 2LRWA 4DR2Q 1GB1A 1NSNS 5E6JA 4ZRIA 3MHBA 3H0GG 4DV2Q 4RKLA 5A35A 5KHOA 2K1BA 2RDGA 1L5PA 2L76A 3BINA 4KSLC 1SNMA 4NP5A 4DR4L 3PO3B 2KZRA 3KF6A 4JQWC 1WSPA 4OZCA 2J53A 1LTAD 4EVOA 2DZIA 3MEFA 1EWCA 3DM3A 1EYCA 4G7HC 4X66L 1GPXA 2C7HA 1NBFC 1J5EL 4DDID 3PIOA 4B3RL 3WIMA 2XWBB 2CJOA 2VZKB 3BJUA 3N52A 2EYMA 2CHWA 1WRIA 2A6EC 4K5VA 4ME5A 5CBEE 4IZ8A 4GDLB 4B0MA 5BR8L 4LK1C 5LMNL 4DAMA 5DM63 2L55A 1Y1WH 2EVBA 2GBMA 2W54A 3VYTA 1TWAB 4XQNA 4LF6Q 4GS3A 4FN2A 3VH3B 3OIQA 4DR6Q 5CV5A 4N9TA 3HFZB 3HOXG 2PQAB 2PZWA 2K7VA 2O6VB 4IFDI 3R3OA 1SIJA 1GC7A 1CKOA 1KRHA 4LK0M 3VUWA 4P72A 3GTOH 2I2YA 4C4VB 1QLBB 4RF0A 1GUAB 1DOXA 1K8GA 3RNBC 1I5FA 1KABA 3W5OA 2M4NA 3DBRI 3AU7A 2HHHL 3S2HH 1HTPA 3ZJUA 4PMCA 5G5HA 1K53A 4N8X1 5FLMG 5K36G 2KJHB 1KC8C 2IGDA 5C23A 1R4NB 4DR2L 1WGDA 5IYBG 2EQSA 1BCPB 3NWSA 1HZBA 1EY4A 2CJNA 1C7YA 4DHZB 3X3NA 5FLXE 4BKSD 5AEKB 2D3GA 3PUZA 2K9XA 1JOKA 1PTOF 2KQSA 2MJ3A 1A3UA 1HCZA 3P7JA 2JUOA 3R8BA 4LF8L 2K6QA 1SSOA 2WKDA 4X64L 4NPSA 4DV7Q 1ZPSA 2A6HC 3ERSX 2GMIC 5CX3A 3ZNGC 1OXTA 4BAXA 1IXRA 3ZRFA 3OSOA 3H0GH 4CDCC 4HCPB 4L1BA 2F0VA 4GDKA 1NCVA 3GE3C 4L5QA 2IPKD 4TV3A 2YU9H 2PPBC 3U4ZA 3R2TA 2JRHA 4I6LB 3U9OA 4C1NI 4EEWA 4J8QA 2SNMA 3J7ZC 3ICEA 4JI1L 2QMTA 4LJZC 1SN8A 4BXXH 4LF7L 2K0PA 4MT5A 1HZCA 2R3ZA 3BYTB 4P73A 1XMQQ 1GNUA 1FCLA 3LWUA 1V9JA 4FXKC 3RI7C 4G50A 4IG7B 2R61A 4HMIA 1L1OA 2L1BA 2ASQA 1PQSA 4RNAA 1STNA 2IGGA 1BO0A 1SROA 3QIJA 3ZJTA 3P4PB 4L2YA 4I65A 2KOXA 4GN1A 3RNGC 5BYRA 3FVQA 4HIMA 1PGAA 4TQ0A 2Q8IB 4JI5L 2O5IC 2DNEA 3C1EA 3FEWX 3DWGC 5KYLA 1WYGA 4A75A 1A63A 1ZOYB 4M01A 3RYTA 2RCNA 3BDLA 5I9OA 3B1LX 1C4AA 2HD3A 4K2KA 1VLBA 2XRSD 4KJNA 1CSPA 5BN5A 1PH8A 4IFDG 4HROA 2QHOA 2PNRC 4R4CA 3SVMA 1BCPF 2Q2UA 2O4XA 4U68A 4XYQA 3AE2B 3SDZA 4JIOU 3TL5A 4LF5L 3ZDTA 1LFDA 5IODA 3SK6A 2GVAA 2X6LA 1KRSA 2BS3B 2E2IH 2L1AA 4OWWB 2R92H 4ZUIA 5C4JH 4AYBG 1WTOA 1OTCA 4I6PA 4QGUA 5IIFA 3U58A 2MP2A 5C4XH 2F0DA 4W9GA 1MJEA 3M4OH 3KUDB 2VH1A 2N78A 3AB9A 3U4EG 1N60A 3EBEA 5M3FB 3AB5A 5ELNA 2EOTA 4KHVA 3EROA 1PH7A 2WYQA 4DR3L 3IAS1 1L2FA 4Q0FA 1VQBA 4JBKA 3NVVA 4BA2I 1AE3A 1V2YA 2FCNA 4HKQA 4LWCA 3B2FA 1KAWA 1KNAA 4JLCA 1V81A 5DCNA 1TWFB 1ZUD2 2LHDA 2RD0A 2M1MA 1EF5A 2JXMB 1X1MA 3RZOH 3CPWA 4KGRA 3C2PA 1VZ6A 4F8CB 5IYDH 3D6WA 4KKSA 4C3HB 1N33Q 3QARA 1CI3M 2NBWB 4MDKE 4OZBA 4ZRPA 2FCMA 2CW0D 3ZDMC 2WB1E 5EBDA 3O65B 2V3NA 4MTNA 1KDAA 1YN4A 3V05A 1R4MI 3OW2A 4LCDE 4Z9CB 1EYDA 1YJ1A 3B0AA 4TVAB 1N9WA 3FKIH 3L16A 2KFKB 2R93B 2LZ6A 2RDHA 2B8FA 2K01A 5CC4A 3CCSA 2KANA 4P1BC 1ASYA 1TWGH 1EYGA 1A8VA 3X3MA 1Y56A 3H3VH 4E6IA 2KBNA 1PA6A 2E3TA 2KJXA 1PGBA 2KO3A 3B08A 4II2B 1RJTA 1YD8U 3K9PB 4MSMB 1A2TA 1Y14B 4LF6L 1H9RA 1HA6A 1T0SC 4YL8A 1WF9A 5D14A 1Y1VB 3NY5A 4DDGD 4L5RC 2NS5A 2WXKA 1E2VA 3NELA 3ZUNA 1PH6A 1EQRA 4LLGM 3EC8A 3GTPH 1L0XB 2D0PA 4NAMA 2BDNA 4BKGA 3F2DA 4R4TA 4DV0Q 4A8XC 1TS5A 3APFA 4IWOA 1CZPA 1WXQA 4RG1A 3UGBB 2X38A 1PRTF 5GAEC 4FF1A 2RSOA 2NTSA 2RKSA 2JA8H 3U8ZA 4CQNA 1XJVA 4K8JA 3KDFA 1WVLA 3OPOA 2PQEA 4YHHQ 2KAJA 4DK0A 2O6VD 2PVOD 4K2LA 1DXMA 4K0KQ 1WX9A 4RHSA 2MW5A 4DPGA 2VS1A 3K9OB 2YTXA 2WKCA 4H02A 2KC1A 3IL8A 1VMCA 1I94Q 2D2CC 2JE6I 3FKIB 2OT2A 1KF6B 1S3OA 3DHIC 4DQOC 2WB1B 3GV3A 3M7NA 2Q2IA 3ZLZA 1TWGB 2DY7A 3EFCA 2ZZPB 2VZKD 5D94A 1RL2A 3VR9B 4ZRJA 5BN3A 4ZYSA 4X3KA 3DVGX 4ZK9B 3GTLH 4K7SA 2BOSA 4HTHA 3DCGA 4H2AA 2KMAA 1VQ7A 3LWEA 1MSGA 2BS4B 2M0XA 3RLNA 1K83H 3OW7A 2MBQA 5L95C 4C56C 2E2DC 1FNVA 4IJLA 1YQ3B 3A4RA 3KW5B 2EZVA 5FR6A 3Q3JA 2ZCBA 4LUOA 1QUQB 3OWFA 3HKZB 5EQ0A 1UE1A 1EIYB 1WTPA 1ZYRD 1XMOQ 3M4OB 3IFDA 2F3VA 5C0XH 4DV0L 1QZHA 1J19A 4PYUA 2Q2TA 1SJED 3ML9A 3MHZA 3RFZB 1XPUA 5HKHA 1G91A 5D3IB 2MX2A 1FIQA 3K0YA 2H89B 3C1FA 1EM7A 3RD2A 3NENA 3J81i 2HQEA 2UXBL 2FMCA 1PFSA 5JJIA 1EQVA 5C44B 3SK8A 3OAWA 4IM3A 5D7GA 3RMHA 4MNOA 4EZJA 4I7ZC 3O13A 3BZKA 3GTOB 4GKKQ 1MJDA 2W3RA 3NVWA 1J7BA 3TEWA 4JI8L 4UAIA 4A6QA 1FO4A 1E1TA 1TT5B 4ACFA 2RGFA 3PIO3 2NZHA 3A9KA 4P2CB 4P16A 5LLIA 4X66Q 3HOZG 1PV4A 2LJIA 4EX5A 3AE3B 4CBVA 3RNAC 2R93G 3BY4B 3FKIG 4GMVA 1NR2A 1S3SG 4Q5VA 2LXJA 1P8LA 4WWNA 4J6IA 4K8IA 1R4PB 3HOZH 4XQQA 4OGQC 1O80A 1M4VA 2NVYB 1ZXIA 2D10A 5IYBH 1GKHA 2F0HA 3TP7A 1K83B 3TEXA 2PLPA 4HR7B 3M3YB 2LASA 2R7DA 4C3HG 4GKJQ 1Y8OB 2DJGC 2AQ1B 2L12A 1B9RA 1B3QA 2DN8A 3Q2AC 1EZ8A 1HFNA 1H9JA 3N3KB 3MHSD 4KX6B 1QQRA 3RNFC 1OQQA 2BQQA 1ENAA 2BDOA 3AFQA 3AH7A 3E9HA 2UU9L 4DV4Q 4B3TL 4KGSA 5EE1A 4C1NK 1VQAA 1MI2A 5DLQE 1CFMA 2ON8A 2EY5A 2RPVA 4A3FG 4A3IB 1I4HA 2VB2X 3MEHA 4GU2A 4IC7B 4EOYA 1KHIA 5E3FA 1QVFA 3M7GA 4DAPA 3FMCA 3PIP3 4DV4L 1B2TA 4JL9A 5AUKA 5DEHA 3A33B 1EYAA 4BWGB 3NXWA 1L0WA 4DNRB 2I0QA 4A3DH 3NBIA 3I3CA 2LVOA 1OGWA 5HHDG 5C4XG 4GLSC 5J1ZA 2AMCB 4BY1H 4IDIA 5EE0A 3PCOB 4C3IB 4RA8A 3Q8FA 2VUMB 4K1RB 3M4YA 1R9TH 1V8CA 3T13A 1UZXB 2L83A 4MEMA 1I6HB 1ENCA 1JRUA 3LDZE 2EYJA 2BB6A 1O7YA 1K3BC 1B9MA 3NTKA 4WQOB 3S2AA 4RFBA 4R3DA 4RCOA 3RZDB 2DYMA 3OIPA 4PQXA 1F9RA 5FJ8G 3W5VB 4A3CH 2GOWA 3RZWC 5FO8B 1NJIC 1D8LA 2XN9C 2PMVA 1TR5A 3AEVA 3B9JA 4XTCS 3GTJB 1SYGA 2DX5B 3A5UA 4DR7L 3NQTA 1PGXA 2KWVB 3TEZA 2SEBD 2YYZA 2BVCA 3I56A 1N34Q 2NBUA 2QJLA 3CIRB 3KYDD 1RHPA 1EY6A 1X54A 2KECA 1JORA 1ICFB 3ER0A 1DZ1A 1WJ6A 5H92C 4ZHOA 2KUMA 1Y1WB 4KZCA 3I5JC 4YHHL 1M8AA 5JJLA 2B76B 4BVUC 3OMGA 2PI2E 2A8VA 4ZRKA 4IOIE 1J6QA 3J81E 2V4IB 1EIFA 4ULLA 1QILA 4C3JH 5IWAQ 1QOAA 4K3CA 1ESFA 2KTFA 3GV6A 4S17A 3W1GA 3DEPA 1C9OA 3TN2A 3Q69A 3DXJC 2JWZA 1E10A 4N8FA 1WMHB 1MGSA 5C3EH 1O7IA 3AE7B 2K5DA 1K50A 5DAUA 1B9NA 2V3PA 1PLFA 5BYQA 2MUYA 3G48A 4KD3A 3BWUD 1EY9A 1L7YA 4YSYB 4F7ZA 3CU7A 3E0JA 3UIPB 2F3WA 3IXSA 4AH6A 2HCIA 2JA8B 1F52A 3KJOA 3MVVA 1S5DD 2MQJA 1EO6A 1V5OA 4LF7Q 2O2VB 2AKWB 1J7AA 3MFYA 1YBYA 1HR0Q 2ZJRA 2DWQA 3MA2B 2JXXA 4LNQA 1FYCA 2D3AA 2LUMA 3BIID 5T1IA 2INNE 2B8GA 1DOKA 3EIVA 2XIWA 3RNCC 3GP7A 5L83A 1YHQA 5M3MB 5IP7H 1XMOL 3AE6B 2L11A 1FL0A 4XT1B 2Z6KA 3IBEA 4BZAA 3D3RA 2F0MA 5K36H 2PEAA 1A15A 1CSQA 5IOIA 2AL3A 4US8A 5IN7A 1R7SA 1B50A 1A6XA 1Y1VH 3S14B 2LS01 1L2NA 3JVZX 3NZ3A 1X3FA 3OOCA 1M90C 5JVG3 4CHKA 3M9BA 3WA0A 3SFDB 3UI2A 1JOQA 1T6BX 4V0BA 1RODA 5C0XJ 2BB5A 2PW5A 2N7EA 2EXDA 2EXZA 3AE5B 4PS8A 4DXGA 1K0RA 2B63H 2QEJC 3I73A 2FFKB 2Y0SB 3G71A 2KHWB 4DK1A 3UQBA 1SRUA 1YNJD 1CQVA 2HT1A 1TBEA 1J8CA 2JT4B 3V62A 2KX0A 4EQPA 1XTDA 2VQEQ 1FRDA 1WGHA 3F8TA 3RUZA 1SMXA 2MBOA 4BBNC 5CBAE 2WXFA 3PRZA 4ICVA 4ALPA 4L63B 4PZ7A 2MNAA 2DZKA 5C1ZA 4DA2A 1BKBA 1N62A 3N1XC 2M8SA 1BVSA 2WXIA 3ZTDA 3K5MA 3CRKC 3CQZB 4QAYA 1OXVA 1YHAA 4YCWA 5L37A 3MC0B 4BXXG 3TSSA 3DBSA 4OVVA 3RULA 3AEAB 4ILWA 4MH8A 3J80E 4DV3Q 4LUZA 5IT9c 4GNXB 5C44H 2LGDA 2WXHA 5LXHA 3GTKH 4FF4A 1D5MC 3ERQA 4WORA 3DWMA 3ZNZB 4A3CG 5DPTA 3PGZA 3RD4A 2INCC 2K25A 2ZVNA 3V6EB 5D65A 4ASWC 1E0ZA 3I7FA 5ELCA 3GTMH 2ZXRA 3P63A 1A62A 1TKWB 2AWNA 5J22A 4FXDA 2R92B 1Q5WB 3W1SA 4KY6A 1S1QB 1I4QA 2YLMA 3T9LA 1NYQA 2ENBA 1WGYA 1STAA 1ENFA 4TSSA 3KF8B 4KIKB 3FKYA 5LMNQ 3A1QA 2IX0A 3HOUH 1C4QA 1RYJA 2Z4HA 3I70A 5A2QL 1DGJA 2KD0A 2KCTA 1NMGA 3Q8CA 1PFDA 2K03A 3OLMD 5IKCM 5EPKA 5ELOA 2X69A 1VQ6A 2B29A 4XT3B 3STBD 1WTWA 1IGDA 3ABVB 1KLVA 1CT1D 1OO9B 5IP7G 5NUCA 1HR0W 4R9WA 4W9IA 4OXPA 4JBJA 1EQTA 3KYHC 3AEGB 3IAYA 4QB4A 2VW9A 1HTOA 1E24A 1A0IA 3F2CA 1Y1VG 3H6NA 3SR6A 3WDNA 4H44C 1SR3A 2A68D 4DUYQ 2UUCQ 3IT4B 3ZIMA 1TWCH 1E90A 4WJPA 1V8QA 2WB1G 5H1SE 1K51A 2J52A 4XWTA 1PMRA 3DDCB 5LNK1 2ID0A 1SB3C 3DBHI 1DOLA 1PZKD 3PLVA 1F1HA 3SFEB 4LNNA 4UY8C 2E5LL 3QOLA 2BPSA 2NPTA 2M2LA 1KRTA 4AS1A 5EPLA 2FAZA 5M5XH 1E8YA 4GLVB 4BY7G 4LNKA 3D4WA 3JC66 1SGHA 1GD7A 1VQCA 3A9KB 2UUBQ 3VA5A 3H3VC 2C9WB 4XGAB 1E7PB 2K8CA 2SDFA 4EQNA 4GNXA 3PUVA 1GM5A 2VQFL 1HNXL 2H1EA 1KJTA 1T9HA 1C8CA 2N3SA 3R2IA 3G6EA 1J8IA 2YTVA 4H0LC 2KLCA 3S1QH 3M63B 2UUBL 4IFDH 1II3A 1RKNA 5CMDA 4YT0B 2WXMA 1BUVT 4DV1L 1RTOA 4IUPA 3QO2A 1QNUA 1Q8KA 2JSOA 1PFBA 3N9YC 1QJOA 5JVH3 4LF8Q 2WIIB 1UE5A 3AXCA 4BFRA 3WAPA 1YVCA 3K6OA 1MHHE 2K5QA 3K58A 3TP5A 2PI2A 4IFDJ 4ZDVA 4OVZA 3EA6A 1UH6A 4KZ0A 5BMGA 4A3BB 2D11A 3K81C 4W9CA 4G11A 3TCAA 2YU9B 4IW0A 3HRZC 2JA6H 2NR2A 2WX1A 4IM0A 2UUCL 1V49A 1TS2A 5C44G 1VQDA 2KKCA 5LHY1 3NJTA 1I4PA 2PZTA 1QOFA 4KSKC 2WU2B 1WD0A 5LMNW 2ES2A 4IPHA 3E0EA 1WR1A 1SEBD 3A8IE 1N36Q 1TJEA 5M5XB 3RPFC 4ANVA 2ICEC 1KTKA 1CA5A 2YTYA 1EOVA 2KN5A 1XD3B 3HIZA 5DPSA 3L10B 2VRRB 4OW0A 1XO3A 3S16H 1TS4A 3BU2A 3HS0C 3PRMB 3QJZA 2NYZD 2W9NA 1WZ3A 3LX0A 1JQYD 1QNKA 2LMCB 3OJ3A 1CKMA 4W9EA 4K5WA 1IBKQ 4R1JA 1I4GA 3RNEC 1L6VA 1NE3A 1PYSB 2WGSA 2I07B 4WJWA 5IYCG 2E2JB 4JV5Q 1K8RB 2K3UA 2KDIA 3DM1A 1BF4A 1JICA 4OX9L 1X56A 1LGRA 4V190 1DGSA 2BE5D 1VQHA 5KEEA 3VDYA 3H1UA 1A3TA 4RMFA 2DBYA 2D62A 1E8XA 3DHQA 2NVXB 2NZ1D 3V60A 4DR1Q 2ZT9C 3K5NA 5FR3A 2ZJQA 2WHIA 3JYUA 1HZ9A 3D4DA 3AEFB 3NS8A 3DBLB 2WXOA 2M56B 4GGQA 2OQKA 1W2BA 2UUAQ 2CWAA 2B2WA 2F0TA 1H9SA 4JI3Q 2N49A 2BKRB 3Q0AA 4M8NA 4RF1A 3HOVH 3MXPA 4DFAA 3H94A 4A3JH 2ACZB 2B2YA 4M8MA 4K5XA 4A93G 4A9AA 2EY2A 3U9SA 4DV5Q 3Q3FA 3G7LA 4DHZE 2IO1B 1ZW7A 4M00A 2KHSA 4A90A 3KLSA 2UUAL 1K52A 2N55A 3I72A 1VDVA 2R7ZH 5IP4D 4X3SA 3S17H 4AQ7A 2ZNVC 2HIVA 2QKIC 5E6NA 1KNEA 5JEAH 3DBRB 2IJ0A 2C5LC 2E75C 2NTTA 2JF5A 2ONQA 1Y8NB 4O2DA 2AEHA 1LO5D 3GTLB 1HEZE 2LKVA 1GUTA 1LTSD 4EQOA 3Q8BA 2AUKA 2MHJA 3S24A 1FEHA 4BS9A 3I4LA 2WAQG 4IURA 2JA7H 4IOAA 1M94A 3PUXA 3QK0A 2VH2A 2R93H 1KH0A 1D4BA 3U30A 3JAMc 4GIVA 1TTNA 4H13C 4PS3A 5DPRA 2JP1A 2G1EA 2WQYB 2V1CC 3P20A 3CC7A 2M00A 1XT9B 1G8ZD 2C35B 2FHTA 1GO3E 4OIKA 4HCNB 2WXLA 2MQHA 1TIFA 1HUMA 3CC4A 4C3JG 4JBMA 3AQQA 3PF5A 3IFTA 3U7DA 3CPFA 4DXAB 4A3DB 3G4SA 2SOBA 4RHRA 4UPAA 3P1HA 1I50H 4DR7Q 2A69C 4NZLB 2OEDA 4C3IH 4BBRG 3UIOB 1YZ6A 4RGNA 3GTPB 1IYJB 3K80C 4XC2A 4C7YA 2X8XX 3PO2H 4GZYC 4ITKA 2WP8J 3J80c 1ASZA 1CUKA 3KOJA 3Q8AA 4HDQA 2JYOA 3U7ZA 2J7ZA 1YIJA 5C3WA 1BBWA 4RGOS 1PH4A 4LF9Q 2R92G 3R7QA 2LFNA 4P71A 2Q5WD 2Z6BA 1T3QA 3Q3OC 3L0OA 3GD7A 3PSIA 2F0JA 4J3OD 3EGRA 5GAGC 1UEBA 3AE9B 4GOPB 1NDDA 3L13A 3VTWA 2JN4A 3S15H 1VR9A 3VYRA 3RMKC 3MTSA 3EN2A 2AL6A 2KCMA 1ZXHA 1KXLA 4PNYA 5FOBB 2WDTB 4A3MG 5C4HA 2K5HA 2E74C 2Z0SA 1YJ9A 2PJHA 2ZJDA 4WAAA 4R4OA 2J0KA 4DBGA 2MWSB 3AMUA 1PH9A 2UU7A 2B2UA 1Z9FA 1SNPA 1XMQL 4JI0L 2ZTDA 3TEYA 3ZRCA 4O1NA 1KM7A 3GO5A 1Q1OA 2LWPA 3V3XA 3UDIA 2UU9Q 4B3TQ 1GUSA 3CSTA 1Z5SB 2F0EA 1ZXTA 3Q8EA 2EDGA 1AYFA 4A3LG 2JYEA 3X0WA 4MM3B 2C60A 3P2BA 3HKSA 3UDFA 1RF2D 3JSVB 4NJ6A 3V6CB 2AHOB 1ZE3D 3T1YQ 3K7AB 4QL5A 2XBBC 3MJWA 3CF6E 1LTBD 1TY2A 1JROA 2AYOB 2GRIA 2CU1A 4JI2Q 2REXA 1IW7C 2IDYA 5J2RA 1KLGD 3M62B 3SR1A 1KL9A 3ONSA 2GI9A 2UXCQ 2PIAA 2KEDA 1GOZA 1XNRQ 3A0JA 2KDBA 1JWMD 2F0SA 5JEAJ 1ESRA 5LL6S 2CR5A 3HK0A 1HNZQ 4FBJB 2QILA 1EY8A 3PV0A 4OX9Q 2WINB 1XLOA 5D3DA 3NTHA 2L32A 2LXKA 2EIFA 2H4OA 1VQLA 2RSUA 4JI8Q 1UBIA 1VS0A 4LFCL 2WDRB 1UGJA 2CVRA 3KUCB 2RR9A 1C48A 3GTQH 1UNSA 1SE2A 3SK4A 3NVYA 2IW3A 4AQYQ 4LJOB 2QGQA 2HJ1A 4JPSA 3W1BA 2BYFA 5ELDA 4DUZQ 5M3FH 3NRZA 2V3SA 4HK2A 3KQ4A 1JOOA 1E7UA 4A3KH 1HE8A 2HJ8A 2F0IA 1XLQA 4F8MA 5JHBA 1ZYRC 3DMUA 2WFWA 1T0RC 2FNJB 1UE7A 3HOVG 4G0NB 2Z0EB 5A2QE 4M0WB 2WLBA 4BY7B 4HJ7A 1PTOD 1NBWA 4XDXA 5C0XG 4A3LH 5GQOA 2KDMA 1STBA 3DPDA 1Z2MA 2OJRA 3HUIA 5BYSA 4A3JG 3BK1A 3A4SC 2KDEB 4MTKA 4YSZB 1WX7A 3T3NA 1BXTA 4JI2L 5C3EB 1P98A 2WV6D 3BVGA 1NYRA 4FDBA 4BBSH 4KTAA 2F4VL 3PO2B 2J0MA 3OG5A 4KN7C 2D5DA 3PPAA 1SBBB 2LEKA 2F4IA 5E4XA 1XCTL 1XNRL 4A3MH 3RUIB 4LW1A 4GDLA 1RIPA 5DPWA 2WNMA 5JXVA 5IO9A 4DK6C 1V5TA 1GB4A 4KDIC 4NKLA 1STYA 1HQMC 4DR3Q 1TKYA 5GROA 4HCEA 3W9CB 2RHSB 1RFAA 3S2DH 1EIGA 4A3PA 2WAQE 1K9MC 4II3B 2L3ZA 2W55A 5JJZA 3P4RB 3BG3A 4GSWA 3DOWA 2KQ7A 4EKUA 2DZMA 3WOFA 3EECA 4LJPB 3DQVA 3ZNHB 4HAEA 4KY5A 3W2DA 5M3FG 4A4IA 1P0RA 2L9HA 3OTOQ 1WTVA 2AWTA 1SYCA 3H0GB 2I1KA 2K1FA 3R66C 4WWMA 4HIOA 1V1PA 4APVA 1ZKHA 4DV6L 3JW0X 3ULPA 4C3IG 3M95A 2K8BA 3M3JA 2E76C 4KI0A 3N1YC 3TMPB 1JQ4A 1Z7TA 4R4QA 4MSQB 1O78A 2F3IA 4IKGA 3LJ3A 2X6GA 3RNUA 1VRAB 2D0OA 4ZAIA 1WYDA 2FIDA 3I3TB 4KV2A 4PT5A 1EL0A 4A3JB 1TY0A 3QAQA 2O2LD 2RF4A 4DK3C 4DR5Q 3FPPA 3DWAA 4F87A 1YQBA 2D07B 3E9SA 4KHZA 1F2LA 1U4PA 3VR6A 4IOCA 4KGTA 1F2RI 3A9JB 2V0GA 3VTVA 3PSEB 3D0FA 5FO7B 1SFOB 2LVQA 4MGKE 2UXDL 3P1MA 2IWHA 2KJRA 3A5ZB 1MSHA 3AFPA 4OO1H 4Y52H 3QA8A 1J7CA 2K5VA 4DHJB 1E2ZA 2BA0A 2LVPA 1FJGQ 1EUVB 2RDFA 3TS2A 4JBWA 2NPTB 2RDBC 1CJEA 3M4QA 1ROEA 1U0LA 1QZGA 3UINB 1V43A 4JWSC 4WH4A 5EJWA 2HE7A 4Q2JA 1EWIA 3KWLA 2AX5A 2K5PA 1XYIA 2Q8RE 3J7AV 4NPNA 1F9QA 4F1SA 1QOGA 2TSSA 2PPHA 2YVCA 2BYEA 1F2YA 2C7MB 4B3SQ 2IY0B 3AU4A 4WWPA 4XXEA 3NUHB 5CYUA 1H95A 5KNDA 1UGMA 1U4RA 1SNDA 5C4JB 4IPCA 2PE9A 4I7AA 4IQZA 5COYA 5AUIA 2WACA 2JJQA 3HEJA 1W3SA 1TVXA 1FXIA 3CRLC 1DCZA 4X62Q 1NEKB 3PTFC 5G3LD 1WYWB 2LGSA 1BUIC 1N5XA 5EDSA 3CC2A 4B3SL 2M0AA 4HPMB 2WXPA 4ZCKA 3S14H 5C3JB 3HVZA 4AP4C 1PH5A 4RKBA 4GLXA 1E8WA 2K4KA 4QMGA 2GBNA 1B4OA 3H7PB 3HVDA 4GB9A 3OWEB 3U50C 2EKIA 3I4MH 3L08A 4ICUA 3HM6X 1V1QA 3U4VA 4LMQD 4CJ0B 1TWCB 1VQNA 3CW2C 1C0AA 1GUWA 5EE3A 1PTOB 4B9KA 3CMAA 4J1MA 3MZ5A 4FJZA 1C77A 3VUYA 4ZKBB 3K5LA 4A3MB 2IGHA 1WR6E 5CV7A 1TWAH 2FBWB 2K39A 1SJHD 2JA5H 2BGFA 2LXCA 3A74A 3S16B 4GN3B 4DUZL 1NNXA 3MXNB 1F2MA 4RAUC 2QEXA 3F2UA 2IL8A 1P3QU 3FRPB 1STEA 2OHFA 2MP1A 2A1AA 4CKBA 2ZXOA 1IL8A 1SE3A 4DR4Q 1MVKA 3DBLI 1S40A 4LFAQ 4FNFA 1RD9D 1MG4A 1TU2B 4X65L 1YEZA 3E3XA 3S15B 3C19A 1OEYA 1SE9A 2PW9A 1TGZB 3AMZA 2Q2HA 4MACA 3J7AF 4AIMA 1L4ZB 1PDXA 2GB1A 2HTME 1NY4A 2B63G 1V6EA 4HKZE 4MGZE 4CYEA 4E71A 5E6PA 4JYAL 4YXDB 3W3AA 4QCLA 2BTEA 3L17A 2LMCA 1AE2A 1YITA 2Y0SE 2GVBA 4LAAA 4ZRZA 1ZDXA 2N4FA 2A69D 1QKZA 4A3EG 4NMZA 2JA7G 2K05A 4RCNA 2XSCA 3I4NH 2KDFB 2KMMA 3VQIA 2KFKA 2A19A 4MELA 5HI1A 2CHXA 4MJSA 2BF8B 3J9CA 4N59A 3NUCA 4ID6A 3T16A 5KNBA 1ET9A 1FGUA 2A4ZA 2FCSA 1JJCB 2EJMA 5C5LA 4G3XB 4A3DG 4BY1B 2ZM6Q 4KK7A 1CHQD 3MJ5A 1QWYA 3BYYB 3K7UC 3NOBA 1A2UA 3PT2B 2N9EB 2NVQB 1E6EB 1G6PA 1PRTC 5HGQA 4XZ4A 1IW7D 3FP9A 4IJHA 2N88A 5M9OA 2FIFA 4MM3A 2R6GA 4KN4C 3TZUA 3APDA 2B2YC 1YJNA 3KK7A 4EZLA 3J81L 1TYGB 1I3QB 1YNNC 4UP9A 4HIDA 2CQAA 4JC0A 4N9PA 2KOLA 2KCNA 3U52E 4JI7Q 4AJYB 4A76A 2ZXPA 4F88A 5CHWA 3H6MA 3LYYA 1AWDA 1JWSD 1OFFA 2K28A 1NAPA 2CU3A 1VQJA 4IO9A 5CV4A 4NW2A 1HHVA 2O6VA 1VQ5A 4DV7L 1B53A 2QIEB 3N32A 4QJFA 2V4DA 5EAYA 4K14A 3AI5A 3TIXA 4C4VA 5AFWA 1CQFA 3BVZA 1X9NA 3B6YA 4KMUC 3T1HQ 3CCRA 2FUG1 1E0BA 1D6EC 2KX3A 2CWPA 3PRPB 2XGTA 3KLWA 2K75A 4HEA1 3HOWB 2KVZA 4HXDA 2VNUD 3QWNA 1VQPA 4A3EB 3ECIA 3K59A 1Q8IA 1LTGD 5ELEA 1LXDA 1SXTA 4LF4Q 2VUMG 3Q3NC 5GAHC 4PV1C 1PZID 4HJ5A 2EYLA 3H09A 1LABA 1U4LA 1QE6A 3BZDB 1ISNA 2CCZA 3QWZB 1JT8A 2KNBA 2C7NB 1V9PA 3FHWA 4YIJA 5ELBA 1XPRA 2B3GA 2NN6I 3UQAA 4LFCQ 2JA5G 2ZPYA 4F7XA 1LT3D 2NZOA 1YN3A 2VL6A 1WTXA 2K5WA 4HLEA 2BKFA 1T0YA 2HDEA 1QT9A 4JI0Q 3H15A 2HCCA 3E5SA 4J15A 3SXHA 3HOYH 3HOYG 5IT9E 2IY5B 1R4NI 5I9PA 1IL2A 2KACA 1CTMA 5JAVA 1WD1A 1FNUA 5FLXc 3S1MH 3S1NH 2G45B 1LYLA 4FADA 2DY8A 4S3SA 1K3RA 1WZ0A 2JRIB 4W9KA 2JYTA 3A56A 2QSDA 3LGJA 5LL6X 2K22A 3EVQA 3PREA 5G3LF 4UP8A 3MXUA 1N61A 3A8JE 1V80A 4W9DA 1WI5A 2JA7B 4FF3A 3APCA 1P1AA 4RM9A 1PTOC 3RR5A 1WM3A 3ZW3A 3WWVA 1PRTB 1HFGA 3V96A 3L0WB 3P4QB 4GNXC 1AH9A 4NXNQ 2RPQA 2C9OA 1SNQA 3WCQA 4M02A 2E8GA 2Z4IA 2K32A 4NDXA 4U673 4CDDC 1DOIA 3SDLC 4A3KG 5DM73 3CCJA 1ET6A 2Z8LA 4XX5A 4PMWA 1UWXA 3PZ7A 4JV5L 4FXCA 5G55A 1LT5D 1B44D 1QCBD 1F0ZA 5IP9H 4GN4B 3CMEA 1L6UA 4WJNA 3ZVVA 1STGA 1ZDVA 2K8HA 4NB3A 4EGVA 1N33L 3J7A5 2N7JA 4DR1L 4D2KA 2WU5B 3PLUA 3PZ8A 3NP8A 2DGYA 4LNIA 2VY3A 1Q82C 1VCIA 1SNOA 4QQBX 2NCNA 3CCEA 5JPMC 5G2NA 3SHLA 1PHJA 2R7ZB 1YNTE 2IHEA 2K6DB 3HM3A 2NB0A 1MI0A 1N34L 1XPOA 3Q6BA 3KF6B 1VQKA 2INDC 4DU9A 2K52A 1WE7A 1TIID 1E7ZA 2OWOA 1PYWD 1P16A 4HJAA 4MGYE 4C00A 1S72A 1JRPA 1OXXK 4CDFC 4A3OA 4OELB 4P6VF 4ANUA 1L0YB 5CORA 5C0XI 1PYBA 1YX6B 3HOZB 2MFIA 5I6YA 3K8AA 2ZNVB 1LV9A 2NBFA 3PHWB 1IBKL 5E7NA 2MJEA 5C4XB 1O7ZA 3W1SC 3AEBB 1PZJD 4RWSC 5C3EG 4KJOA 1IGCA 1VQEA 2DNCA 3GTJH 5M5WH 2KEEA 4HJKA 3KUZA 3G6JB 4NY0A 4X3UA 2KWDA 1ACCA 1LM8B 2EYOA 2KN4A 4P1CC 4DXFA 1F2ZA 3EQLC 3V2TA 4W9LA 1CZWA 1O7LA 1A5RA 3CF5A 5HG2A 5FJ8H 1X6OA 3L7ZC 4YWMA 3S1RB 4C2MB 1N32Q 3UDXA 1YI2A 1IBML 2JVCA 4M0WA 5IA7A 2JEAI 1Q90A 2MEKA 1IBLL 3FC4A 1G2SA 1Q7YC 4K0KL 1S5CD 2KTRB 4HJGE 2QA4A 4G7OC 5C2TB 4YSXB 2IT1A 2MBHA 4OWTB 2I38A 4MHEA 2OJWA 3NSWA 1I94L 3NTIA 1WM2A 3KUPA 3KFUA 1IHZA 5J3BA 5ISRA 4G7ZC 1SIFA 1VMPA 3CCVA 4KV6A 2NVTH 3S1NB 4FO2A 1JWAD 3I2ZA 3T1HL 4JWUC 1PVOA 4NQLB 1NTGA 3QB3A 4XYCA 2CHBD 4X62L 4OEMB 3HG9A 3TDQA 3CSFA 4MGIE 4WRDA 4BBSG 3QG1A 4ZUJA 5JZEB 4Y7NH 4NAWA 2XVSA 3BDCA 1XQQA 1QUQA 2A5HA 2KVRA 3C8YA 1WMHA 4DKAC 3RN5A 3UI3A 2GBJA 2ZTCA 2NN6G 4RH6A 3NHHA 4GDKB 4DK5A 2KCCA 1N5WA 3VR4A 4I6NB 1E2WA 3NPPA 2BT6A 2PYKA 4HJ8A 2E2IB 3OMCA 1L4DB 1WJNA 3WANA 4B0EA 2F0OA 2E2HH 3R93A 2Z9HA 4QIWE 1PFNA 3TQYA 4IWPA 3L2PA 3ZXRA 2O2VA 4HWIB 4X57B 1QVGA 2D3BA 2JA8G 1I4RA 3A7LA 3EFUA 2DNFA 1GAQB 2F0QA 2UXBQ 1XNQL 3TP6A 1IBLQ 1P7FA 1LTRD 3MC8A 2F03A 2MJ8A 3NWTA 4HVBA 2BE5C 1BBUA 2B63B 1G51A 2UXCL 4X65Q 1XX8A 2B39A 2IYDB 1NI3A 4L8JA 2PNHA 2N1VA 1JW9D 4WQMA 4XQJA 1WCMH 1WCMG 2KVMA 2VZAA 4N58A 5IGEA 1G6JA 1LUZA 3C46A 4PG3A 1G6ZA 2D5GA 2KYWA 2XEWA 3W5UB 3IT6B 1VQFA 4IPDA 4X3TA 1C79A 1EZ6A 1K8OA 1I50B 3GTGH 3RT3B 2K5NA 1EY0A 2LRUA 1DOYA 1B70B 1TWHH 4B95A 2J7QB 4JI4Q 4GKKL 2RMMA 4BA1I 1UWMA 1WRDB 2PTLA 2L15A 4A3GH 2RSNA 3L3OC 4ZKCB 1HA5A 4M8AA 2KC2A 5KYIA 4UHVA 2MP2B 1EUJA 1DM0B 2CW0C 2DHZA 2Y5PA 4AOFA 3MFGA 1WFQA 3GDEA 5CV9A 5F2DA 5G5GA 4X6AH 3KWVA 1NMFA 2R7ZG 2B3AA 1BMLC 1KDCA 3P4SB 1KAAA 3I55A 2QDFA 2IY1B 4JOIA 2L00B 3GS2A 4CO7A 2ZW0A 5M5YB 2N0SB 4JW0A 4DUYL 1HRJA 2PVGC 4ZOHC 1YMHE 3TZDA 3IFWB 4HPPA 1PH1A 2WXNA 4XWWA 2NN6H 4GKJL 3U2SC 3DLLA 1XNQQ 4B9WA 1SAPA 2P5ZX 1WOCA 3PQIA 1AW7A 2MPMA 1TZ1A 4DHJD 1ONLA 3VHTC 1PTOH 3HRDD 4JG2A 2LJ5A 2HDLA 1Z47A 2OCEA 4OONA 5EKIA 2NBVB 3ZXVA 1VQ9A 3D31A 2JK8A 1ZGUB 3T4AC 2BW2A 2JZPA 3CWIA 1YJJA 1GC6A 1E22A 2QCZA 4A20A 2MBEA 4BBNF 2K6AA 2FUHB 3QQ8B 1F9JA 3H91A 2NMQA 3EFXD 3J81c 2CS4A 3N6RA 2G3QB 1W6KA 4IUVA 3MWYW 1IBXA 3P42A 4L5TA 2ZJPA 2ZM6L 1ZP0B 3AEEB 1I4XA 1HNZL 1WTQA 4GXBA 2K50A 2C5CA 2JA9A 1SDFA 1JCKB 1GVPA 5DNFA 1RAXA 2N8NA 1OQYA 2OTJA 4A3FH 1TKGA 1V86A 1GUGA 1H9SB 1JALA 3FILB 3PV1A 5KGUA 1F2RC 3TBIB 4WAFA 4BBRB 2O5JC 4JPBW 1GJXA 5CV8A 4LDTB 1FNWA 5BO4B 4YTPB 2Y0SG 1B3AA 4CJ1B 2QF7A 3CMMB 5LXIB 1RWSA 5AZGA 5CGKA 2UYZB 4OO1I 2HHHQ 3EHVA 2EY6A 4P74A 3VFKA 4R8NA 2F0UA 2JZ3B 1EWYC 4DF7A 2OTLA 3PO2G 4KD4A 1V1OA 1VQ4A 2XK5A 3Q14C 2ALYB 4WWOA 3GTQB 4KKJA 1IYUA 1UD7A 1HTLD 1K0SA 2V4LA 1TS3A 3AU5A 4RM8A 5GADC 4B6WA 4QUCA 5C3XA 2Z59B 5H8YE 5T8IA 4ARCA 4E74A 3ZNID 1D5XC 4K6LA 1HZAA 1WE6A 2VUMH 4OVUA 3AE8B 5CR3A 3NG0A 1HPCA 4WJOA 1VD2A 1LT6D 1TKEA 4HIKA 3LNNA 4BY7H 1WWTA 4TRDA 4YTMB 4G4KA 3L4PA 3ULLA 1FFVA 5FLXL 1WXSA 2N9KA 5IT9L 2HD5B 4MZ9A 1SYBA 2DYBA 3AV8A 3I63C 4NQKE 1YIWA 1AARA 1OTRB 4IUUA 3GTGB 3IVFA 3QCAA 3RZOB 3NVZA 3PO3H 3VYUA 1CZGA 1F77A 1JB3A 1L1OC 3URYA 1C78A 1NUCA 1JWBD 5D2MB 2L8JA 4UDUC 4A3GB 1VZ8A 1X3PA 2DAJA 1DJRD 1EF1A 3IAM1 2H5XA 2I1JA 4WJ4A 3FILA 3B2GA 2JQOA 3CCMA 4LUVA 1Q81C 3GZNI 2Y3AA 3IKJA 2MCNB 2LD9A 3KLRA 4HSVA 5IGDA 3Q23A 4AUQC 1FM0D 5IGGA 1EFWA 2PKOA 2IHFA 5BMHA 4ZRQA 4JCVE 2F1MA 2ASBA 2EE1A 2TMPA 4WJ3M 2AWOA 3S1RH 2G9HD 2GA4B 2G4SA 4EUTA 5GMVA 1SYEA 5IWAL 1B7YB 3VA7A 4YWGG 1YQ4B 2MO1A 5BR8Q 3Q8DA 3HZXA 4OIJA 1E5WA 1U4AA 1DYQA 1WGRA 4EFOA 3PMFA 1X3QA 3D6CA 4KKUA 2DUDA 3STBC 2CH4W 1T0QC 4K7UA 1AZQA 1ILQA 4IALA 3TJPA 2XWJB 2B2UC 1WX8A 3S17B 3AE1B 2MHVA 2V9HA 1WXVA 1DD2A 2CKHB 2FINB 3NEMA 3A8KE 1X3EA 5KIXA 5HFYA 1FFUA 1YNND 3HOUG 1MJCA 3KYCD 4IUQA 1KLUD 1TWFH 1YJWA 4YY3Q 1FJGL 1E3PA 3H7PA 1HR0L 1J0GA 4A3KB 3RZFA 3VDZA 3VXWA 1RRBA 1CM9A 4FXGC 3VH4B 4C7ZA 2F0FA 4L6TB 4XDCA 4B3MQ 1AEXA 3ND8A 4ANXA 1IYVA 3HOWH 2OEOA 3E56A 4ZLTF 2Z0DB 2AUJD 2KHIA 1PXUA 5KHQA 1QOHA 4KY7A 1LLRD 3LB8C 1S5FD 4J6HA 4BY1G 1VQMA 3NBHA 4USAA 2M17A 4FJVB 2JWUA 1MBYA 1I6VC 3CCUA 2JX5A 4RMAA 4BKTA 1JWUD 3SGIA 2G5DA 4HRSA 2DJFC 2FE8A 3DWPA 2QDBA 4AQYL 1N6ZA 2VB3X 3J80L 5CTRC 2PW7A 5JEAG 1GUNA 1JE4A 4IUNA 3NK9A 1EIHA 1WY8A 4JI7L 3Q3MC 3I90A 3A55A 4P7IA 1BNZA 2HUGA 1Q12A 3MTNB 4K7WA 1WGKA 4KKIA 1HTQA 3VYSA 3T8MA 1RCVD 4QF4A 3S2DB 2K33A 1IUEA 2OXPA 2NVQH 3DVNV 3D8GA 2KXJA 1D3ZA 2CH4A 2MRPA 2RQXA 1T5XD 3PF4A 3SHQA 2N9XA 4RGMA 1YHBA 3TEHB 3WAOA 4AWJA 2D2QA 3IRBA 1PH2A 1X65A 2JA6B 3VRBB 5IOCA 3MXNA 3I4OA 4ABNA 5J39A 4X64Q 2W3SA 4JI5Q 4DV2L 3HOUB 2ZPNA 4URKA 5T1GA 4FLHA 2BA1A 3FDTA 3K57A 5CHFA 3M4PA 1CKNA 3ND9A 4XE0A 4KHPL 3ML8A 2G4DB 4JYAQ 1X3GA 2EYPA 5IGCA 3T1YL 4O0AA 1JB7A 1SYFA 1FPYA 5HY6A 2DAFA 3VR8B 4ZHPA 1D1KA 1K8AC 5AZHA 4OZAA 1WJJA 2MSED 3BK2A 1HZ5A 1PUTA 1U5KA 2FMMA 4OO1G 4FYDA 3S9WA 1MG8A 3HGBA 4NXNL 3M3YH 3CHBD 4M1UB 2Q8TA 4B3RQ 1QF6A 2XNAC 1HNWL 1A3VA 4A3EH 2J42A 1L1OB 2BH2A 4PMBA 1GUOA 2EMSA 4C3JB 4JX1C 2DENB 2N9PC 3HHMA 2L0CA 3HKZE 4A93B 1PRTD 3N1ZC 4PS7A 4JI6L 4POGA 1VQ8A 3PS6A 5I6WA 4EZKA 1TXYA 2INPE 4MH0E 2NWGA 1VQGA 3M85A 1XLNA 2Y5CA 3CKIB 5BN4A 4IWQA 3I4NG 1ZKOA 4CDEC 2GN5A 2NVXH 1VF7A 1E8ZA 2JY6A 3OTOL 3J80i 3SEBA 2EYHA 4GOCA 2I5LX 4AYBB 5CV6A 2I46A 1FGBD 4WIPA 2RHQB 1GXDC 2B2TC 3JSVA 3I4MG 5JOBA 3DBHB 1CK1A 2EYFA 1YOVB 2PE6B 3NE5B 2HIXA 3J7YW 2WDVB 1WH3A 1C76A 1KDBA 2EPBA 4RGTA 1P9DU 1LTID 1VQIA 4IUMB 3S1MB 1Z6HA 3RLFA 4BOSC 2G9DA 2UWQA 2KHJA 4GLAC 4CJ2C 5EBCA 1I3QH 4OL7A 1QB5D 2CHZA 2IO0B 3Q24A 2KT7A 2JZZA 2LUEA 2ICIA 2I5MX 2MLBA 4MIUA 4ODGA 4TMAB 1WTHA 3WOEA 5LMUL 4PK1A 2PMZB 1SLJA 3OHXC 3CP0A 2KJ6A 2L4NA 3KH0A 2BS2B 3JAML 3T53B 4NXMQ 2EY1A 1TQOA 3Q6SA 2QC8A 2ZCCA 2CKZB 2M19A 5TR5A 1XTCD 4B08A 1JJ2A 3BZCA 1WJ4A 1D5ZC 3RLOA 2EMTA 3DHHC 3PUWA 2EJFC 2K14A 3NHEB 3NZSA 1UAPA 3UE1A 4FHJA 3ZO5B 1U9RA 3DVGY 4JI1Q 2EJGC 4C80A 1IZ6A 4CHTB 4PYZA 2PQAA 3ULJA 4DAYA 4YY3L 3H8HA 3UDGA 1JE5A 2WXGA 2MH7A 3LXFA 2E6XA 3NZUA 5E1FA 1IP9A 3PIPA 1EEFD 2RA4A 4N9F4 4A3IH 4WURA 1TWHB 1Y8PB 4YWKA 4C3HH 1LACA 3CCLA 3DVNU 3ZGZA 3I57A 2A73B 4JK1C 1XLPA 3RN2A 3GTKB 3CQZH 3HP3A 4JE3B 4Y7NB 2YEPB 4KLKA 4DV6Q 5EE9A 1KD1C 2QDLA 2GBRA 2WX0A 5C4ZA 3ZTCA 4REZA 2Z1CA 3L9AX 3F2BA 3CCQA 3KVFB 4US9A 2B2WC 4DNTB 4K81A 2CFMA 4GN5A 2IX1A 2AQ2B 1LT4D 1U4MA 3J81j 1WIAA 1MKHA 2LY7A 1A70A 1C4CA 1X55A 4LF5Q 3ZJYC 1E9MA 4OWXB 3RZDH 1WJUA 2L52A 2LGIA 2JXTA 2XTIA 3Q22A 1UWVA 1DONA 1UF0A 2HDMA 4A3BH 1N63A 1FD6A 2YV5A 2Z6KC 1MHWC 4KKTA 3AN1A 5M5WB 2ATWA 1FD7D 4ARIA 1IKLA 1EOTA 4A93H 3A7AB 3CAMA 1HZ6A 1N8RC 3KLSX 4JI3L 1RDPD 2WDQB 3TREA 4XIGS 4B3ML 5HURA 4JVZA 3ZQ4A 3E9IA 5J17A 1RLFA 3SK5A 4DNIA 4W9HA 1NI2A 3AECB 2F0PA 4HCSA 4DGZA 1VZ7A 3ETRA 5AZFA 1PH3A 3OYYA 1WXMA 4BKSA 2A5UA 3TP8A 1SFOH 1UE6A 4DAYB 3TRZA 1AFPA 4XYOA 1LM0A 3H3VI 2A74C 1P7EA 3K7AH 4G57A 2KQ4X 1KQSA 3PVLA 3UF8A 4L5SA 3AYHB 5EKKA 2L0TA 1C1YB 3KBGA 3TBLD 1JC7A 1H9MA 2KQ3A 5IGFA 2KMCA 2KTRA 5IE8A 2L05A 1B1ZA 1EWHA 1BDOA 1YNXA 2ZEQA 5TSSA 3GQBA 4ANWA 2BBCA 1JMCA 5C5MA 1HXYD 2LGYA 4LF4L 4IN3A 4POFA 3A9JA 5M3MG 3SE0A 2FXQA 1IPGA 3JAMi 4TKOB 1BCPD 3UE0A 1SE4A 2UXDQ 3I9V1 3ALBA 2E2HB 1EEID 2FJ2A 3BVMA 3MXGA 2F0LA 2E2JH 4NNJB 5J18A 1STHA 3P75A 1UEAB 2E5LQ 4FHKA 3S1QB 1DOMA 1S5ED 3KBXA 3HKZG 3VRAB 1W6JA 3QR8A 4P75A 4CGYB 1S5BD 3H9DA 5FK9C 1BOSA 2J0TD 1FMAD 3TMEA 1V97A 1HQRD 4YWLA 1OXSC 2MA9B 2F0GA 2KWCA 1CHPD 3I8ZA 2A6ED 4PZ8A 1EQQA 4R4IA 3D32A 1AZPA 4W9JA 4PZ6A 3PO3G 2D9UA 3TS0A 2VQFQ 4QUFA 1HNXQ 1BQQT 4KDLB 3DWQA 5AJ3L 1I6HH 1ILPA 1MIUA 2K04A 2J4XA 2EKEC 4ZYNA 1KFYB 4AJWA 1KOTA 1C3TA 5IAAC 2PZUA 4FP5D 1D1IA 4DV1Q 2B2VA 1OQRA 2A68C 1HNWQ 2JA5B 1QZEA 1EU4A 2F52A 4FF2A 2OQ0A 2EELA 2IZVB 4JGHB 3BS1A 1D7QA 3OJ4B 3N20C 4KIKA 5IYDG 3ONAB 1YX5B 2WXRA 1NENB 3H7SA 2JEBI 1S4ZA 4A3IG 4HEDA 1WCMB 4A3FB 3MP9A 2OF1A 1Q1BA 3QIAA 5FKAC 3N30A 1LTLA 4NXML 1J5EQ 3DEOA 1R4QB 3E6ZX 5JH5C 1VDZA 2AQ3B 2LI5A 3BDOA 4LFBQ 3PO0A 1Q86C 2W82A 2CQOA 4YCUA 4NAWB 1EY5A 1I7HA 1H9KA 2N7DA 1BCPC 5MPOA 5IY0A 2F0KA 5IP9G 4BOZB 3DHGC 4OHJA 3VVWB 2BYVE 4DR6L 4ME3A 1XF5L 2IX3A 4YCVA 1GG3A 1EY7A 4CKCA 1Q0WB 3I91A 2LHEA 3KJPA 1BR9A 2BCOA 1HJPA 2MJDA 2V1YA 2A6HD 5ELFA 1E7VA 2KLGA 3TUOA 4NJCA 1TZOA 3C3LA 2NVUI 2DLBA 3GTMB 1MPEA 4IM2A 4L23A 1FXAA 1K28A 1SNCA 2ZW1A 3IG3A 1FRRA 2HTHA 2L0FA 1FCCC 4TKNA 2PMZE 2RBMA 1UUPA 3FPUB 5IGBA 2R2QA 4LDTD 5AJ3Q 1BT0A 4S0RA 3S2HB 5LMUQ 1Y1WG 2SNSA 2KENA 1QG7A 3K0XA 2QCPX 1Y8RC 1EFID 3VTUA 2D3CA 1FXTB 5IYCH 4MJSB 2WAQB 4EE2A 1WFYA 4HSPA 3VR2A 2JSVX 1SE8A 4LNFA 2KFJA 3SU8X 3WAMA 3QHTA 3VAWA 2LSSA 2LXAA 2ZVOA 5M3MH 3AE4B 1G291 1I35A 3CD6A 2F4VQ 5K5PA 3HOXB 1SF0A 2KK8A 2BWES 5KRUA 1YNJC 1YN5A 3ZKJC 2ZTEA 1T5EA 3QOJA 3JAME 1I42A 5EPJA 4TQUS 2BWFA 2WWZA 3VUXA 4AYBE 3PHXB 2LGXA 2PO4A 4FA6A 1V1PB 1SSNA 1NR4A 5I4DA 3X23A 4BBRH 4H7BA 2MO0A 5JHAA 3ITPA 4DV5L 1IBMQ 4YTNB 4DN4M 2VXWA 2JU6X 1J9OA 1JMLA 1Q3LA 2F0NA 1NVID 1GJZA 4IUTA 5I2XA 2L7RA 4EQ5A 2JA6G 3EJIA 2BYTA 3NQIA 4HPLB 1YJIA 1ICWA 1WGGA 3AULA 1VJKA 2DYOA 2MBBB 4LNOA 4IPGA 4XDDA 1VQOA 4BBSB 2RVLA 1L0VB 4FVMA 4E3CA 5HGTA 1E1OA 3I4NB 4A3GG 4KHPQ 2MGSA 2WXQA 3ZYYX 3GZNB 3R3MA 3NBHB 4R8IA 1CA6A 1IYFA 3C0RB 2R7FA 3NS1A 4DWFA 4A3BG 1PDQA 2SAKA 1WI0A 3GOEA 4FJYA 2N1WA 4TQ1A 2PCFB 3DUZA 3D4RA 5EKLA 5FO9B 2R2OA 1B8AA 2VQEL 4GOPA 1MHXA 5KNCA 1FR3A 1F9PA 2J0JA 2QW7A 2H88B 3RCZA 1XXGA 3HOVB 3A54A 2GLSA 1R4MB 3FAHA 4TUUA 3ZJVA 1RTNA 2XRQD 5BMIA 5I2YA 5C6AA 3PUYA 4DR5L 4LTUA 1Q1EA 1N32L 4JI6Q 1X32A 3I4MB 2DZJA 1IBXB 1OEYJ 3PGEA 1JR0D 3GE8C 1C4PA 1LQBA 5EGTA 3IHPC 3VR5A 1QOBA 1H4RA 2B2TA 4DV3L 3PZDA 4MN3A 2IBIB 3CXCA 2BH8A 3SD5A 4K6DA 3QC8B 1OXUA 4LFAL 2B2VC 4K3BA 2Y5BB 1QVCA 1KIXA 5E6OA 3WALA 1ZEQX 3L54A 3V61A 4NJ7A 1UBQA 5CHVC 1CKNB 1K73C 1ML0D 1LTTD 1TT2A 2NUCA 5FLMH 1SMYD 1N36L 4LF9L 1Q10A 3A1QB 3AEDB 4O42A 1Q46A 5JJKA 5E4WC 1MFWA 5D6JB 3W1YA 2NVYH 4HMJA 4C2MH 2RCFA 5GXGB 1IKMA 2FCQA 2HQLA 3GB1A 1XWEA 4HN7A 1XEEA 1VF5C 3T51B 2YEPF 4HJ9A 1GHJA 2XK5B 1FVIA 1VCBA 1RM6C 1SMYC 4ZQ3A 2IO2B 3HOWG 3AM9A 4A55A 2L5TA 1WTRA 1M1KC 2I5HA 1RFKA 3QJYA 4QIWB 2JQRB 3KDFB 3QX1A 3EUB2 3ENEA 2LFIA 4N6EB 1SYDA 1AN8A 4WFN3 1EU3A 4HDOA 2WP9B 2NVTB 4FULA 4JI4L 1F9SA 1UELA 2OOBB 2JPHA 2M9VA 1JJGA 4GOPC 4B9XA 4LFBL 2WS3B 4CKEA 1G2TA 4W9FA 2F0WA 1WXAA
chains in the Genus database with same CATH topology
1HUNA 4DAVA 1BBXC 1XCQL 5JPNC 3T3OA 1K8MA 3KF8A 1GHKA 1C9FA 2N9LA 3MAQA 3HOYB 1PFMA 2WXJA 1MD2D 1AP0A 3VR3A 1D2BA 3T56B 3K5OA 1Y69U 2KA7A 1R9TB 1GB1A 1NSNS 5E6JA 3MHBA 4RKLA 5A35A 2K1BA 2RDGA 1L5PA 1SNMA 4NP5A 3PO3B 1WSPA 4OZCA 2J53A 1LTAD 4EVOA 1EWCA 1EYCA 4G7HC 1GPXA 2XWBB 2CJOA 2VZKB 3N52A 2EYMA 1WRIA 2A6EC 4K5VA 4ME5A 5CBEE 4IZ8A 4GDLB 4B0MA 4LK1C 5DM63 2L55A 2EVBA 2W54A 3VYTA 1TWAB 4XQNA 3OIQA 5CV5A 4N9TA 2PZWA 2K7VA 4IFDI 3R3OA 1KRHA 4LK0M 2I2YA 1QLBB 4RF0A 1DOXA 1KABA 3AU7A 1HTPA 3ZJUA 4PMCA 5G5HA 1K53A 5K36G 2IGDA 1BCPB 3NWSA 1EY4A 2CJNA 3X3NA 5FLXE 3PUZA 2K9XA 1JOKA 1PTOF 2MJ3A 1A3UA 1HCZA 3P7JA 3R8BA 1SSOA 2WKDA 1ZPSA 2A6HC 1OXTA 3OSOA 4L1BA 2F0VA 1NCVA 2IPKD 2PPBC 3R2TA 3U9OA 4C1NI 4J8QA 2SNMA 2QMTA 4LJZC 2K0PA 4MT5A 2R3ZA 3BYTB 1FCLA 3LWUA 4FXKC 2R61A 4HMIA 2L1BA 4RNAA 1STNA 2IGGA 1BO0A 3ZJTA 3P4PB 4L2YA 4I65A 5BYRA 3FVQA 1PGAA 4TQ0A 2Q8IB 2O5IC 2DNEA 3C1EA 3FEWX 3DWGC 5KYLA 1WYGA 1ZOYB 3BDLA 5I9OA 1C4AA 4K2KA 1VLBA 2XRSD 4KJNA 5BN5A 4IFDG 4HROA 2PNRC 3SVMA 1BCPF 2O4XA 4U68A 4XYQA 3AE2B 3SDZA 5IODA 3SK6A 2BS3B 2X6LA 2L1AA 4ZUIA 1WTOA 5IIFA 2F0DA 3AB9A 3U4EG 1N60A 5M3FB 3AB5A 2EOTA 4KHVA 3EROA 3IAS1 4Q0FA 3NVVA 4BA2I 4HKQA 3B2FA 1KNAA 1TWFB 1ZUD2 2LHDA 2JXMB 4KGRA 3C2PA 1VZ6A 3D6WA 4KKSA 4C3HB 1CI3M 4OZBA 4ZRPA 2CW0D 5EBDA 2V3NA 1KDAA 1YN4A 3V05A 4Z9CB 1EYDA 2R93B 2RDHA 2B8FA 2K01A 5CC4A 1Y56A 3X3MA 2E3TA 4E6IA 2KJXA 1PGBA 1RJTA 1A2TA 1H9RA 1HA6A 5D14A 1Y1VB 2WXKA 1E2VA 4LLGM 1L0XB 4NAMA 2BDNA 4A8XC 1TS5A 1CZPA 1WXQA 2X38A 1PRTF 4FF1A 2RSOA 2NTSA 2RKSA 4CQNA 4K8JA 1WVLA 3OPOA 2PQEA 2KAJA 4DK0A 2PVOD 4K2LA 1DXMA 4RHSA 2WKCA 3IL8A 1VMCA 2D2CC 2JE6I 3FKIB 2OT2A 1KF6B 4DQOC 2WB1B 3GV3A 3M7NA 1TWGB 2DY7A 3VR9B 2VZKD 5BN3A 4ZYSA 4X3KA 4ZK9B 2BOSA 4HTHA 4H2AA 3LWEA 1MSGA 2BS4B 3OW7A 4C56C 2E2DC 1FNVA 1YQ3B 2EZVA 3OWFA 3HKZB 5EQ0A 1WTPA 1ZYRD 3M4OB 3IFDA 2F3VA 5C0XH 1SJED 3MHZA 3RFZB 1G91A 5D3IB 1FIQA 3K0YA 2H89B 3C1FA 1EM7A 2HQEA 2FMCA 1EQVA 5C44B 3SK8A 5D7GA 3RMHA 4I7ZC 3O13A 3GTOB 2W3RA 3NVWA 1J7BA 3TEWA 4UAIA 4A6QA 1FO4A 3PIO3 4P16A 4P2CB 2LJIA 3AE3B 4CBVA 1NR2A 4Q5VA 4K8IA 1R4PB 4XQQA 4OGQC 1O80A 1M4VA 2NVYB 1ZXIA 2F0HA 3TP7A 1K83B 3TEXA 2PLPA 4HR7B 3M3YB 4C3HG 1Y8OB 2AQ1B 2L12A 1B9RA 2DN8A 1EZ8A 1HFNA 1H9JA 4KX6B 1QQRA 1OQQA 3AH7A 1ENAA 2BDOA 4KGSA 5EE1A 4C1NK 1MI2A 1CFMA 2ON8A 2EY5A 2RPVA 4A3IB 1I4HA 2VB2X 3MEHA 5E3FA 3M7GA 4DAPA 3FMCA 3PIP3 1B2TA 5AUKA 5DEHA 1EYAA 4BWGB 3NXWA 4DNRB 3NBIA 3I3CA 5HHDG 4GLSC 5J1ZA 4IDIA 5EE0A 4C3IB 4RA8A 3Q8FA 2VUMB 3M4YA 1V8CA 3T13A 2L83A 1I6HB 1ENCA 2EYJA 2BB6A 1O7YA 3NTKA 1B9MA 4RFBA 4R3DA 4RCOA 3RZDB 2DYMA 3OIPA 4PQXA 1F9RA 3W5VB 5FO8B 2XN9C 2PMVA 1TR5A 3B9JA 4XTCS 3GTJB 1SYGA 3NQTA 1PGXA 3TEZA 2SEBD 2YYZA 3CIRB 2QJLA 1RHPA 1EY6A 2KECA 1JORA 1DZ1A 4ZHOA 2KUMA 1Y1WB 1M8AA 2B76B 3OMGA 4IOIE 3J81E 2V4IB 4ULLA 1QILA 1QOAA 1ESFA 3GV6A 3DEPA 3TN2A 3Q69A 3DXJC 1E10A 1MGSA 3AE7B 2K5DA 1K50A 5DAUA 1B9NA 2V3PA 1PLFA 5BYQA 2MUYA 4KD3A 3BWUD 1EY9A 4YSYB 3CU7A 3E0JA 2F3WA 3IXSA 2HCIA 2JA8B 3MVVA 1S5DD 1J7AA 3MFYA 2DWQA 3MA2B 3BIID 1FYCA 2LUMA 5T1IA 2INNE 2B8GA 1DOKA 2XIWA 3GP7A 5M3MB 3AE6B 2L11A 4XT1B 2F0MA 3D3RA 5K36H 1A15A 4US8A 1R7SA 1B50A 1A6XA 3S14B 2LS01 3NZ3A 3OOCA 5JVG3 3SFDB 3UI2A 1JOQA 1T6BX 4V0BA 1RODA 5C0XJ 2BB5A 2PW5A 3AE5B 2EXZA 4DXGA 2QEJC 3I73A 2FFKB 2Y0SB 4DK1A 1YNJD 1CQVA 4EQPA 1FRDA 3RUZA 5CBAE 2WXFA 4L63B 4DA2A 1N62A 2WXIA 3K5MA 3CRKC 3CQZB 1OXVA 3MC0B 3TSSA 3AEAB 4ILWA 4MH8A 3J80E 2WXHA 4FF4A 1D5MC 3ERQA 4WORA 3DWMA 3RD4A 5D65A 1E0ZA 5ELCA 2ZXRA 3P63A 2AWNA 1TKWB 5J22A 4FXDA 2R92B 3W1SA 4KY6A 1I4QA 1NYQA 2ENBA 1STAA 1ENFA 4TSSA 2IX0A 1C4QA 1RYJA 2Z4HA 3I70A 5A2QL 1DGJA 3Q8CA 1PFDA 2K03A 5EPKA 2X69A 4XT3B 1WTWA 1IGDA 3ABVB 1CT1D 1OO9B 5NUCA 4R9WA 1EQTA 3AEGB 3IAYA 4QB4A 3SR6A 3WDNA 4H44C 2A68D 3IT4B 1V8QA 1K51A 2J52A 4XWTA 1PMRA 5LNK1 2ID0A 1SB3C 1DOLA 1PZKD 3SFEB 3QOLA 2M2LA 4AS1A 5EPLA 3D4WA 3H3VC 3VA5A 1E7PB 2SDFA 4EQNA 3PUVA 2H1EA 1C8CA 3R2IA 1J8IA 4H0LC 4IFDH 1II3A 1RKNA 5CMDA 4YT0B 2WXMA 1BUVT 1RTOA 4IUPA 3QO2A 1QNUA 2JSOA 1PFBA 3N9YC 1QJOA 5JVH3 2WIIB 3K6OA 1MHHE 2K5QA 3K58A 3TP5A 4IFDJ 4OVZA 3EA6A 5BMGA 4A3BB 2YU9B 3HRZC 1TS2A 5LHY1 1I4PA 2PZTA 1QOFA 2WU2B 1WD0A 1SEBD 3A8IE 1TJEA 5M5XB 3RPFC 2ICEC 1KTKA 1CA5A 4OW0A 1XO3A 1TS4A 3HS0C 2NYZD 3LX0A 1JQYD 1QNKA 2LMCB 4K5WA 1I4GA 1L6VA 4NZLB 2I07B 4WJWA 2K3UA 2E2JB 3DM1A 1BF4A 1JICA 4V190 2BE5D 5KEEA 1A3TA 2DBYA 2D62A 3DHQA 2NVXB 2NZ1D 2ZT9C 3K5NA 5FR3A 3D4DA 3AEFB 2WXOA 2M56B 2B2WA 2F0TA 1H9SA 4RF1A 3Q0AA 3MXPA 4DFAA 3H94A 2ACZB 2B2YA 4K5XA 4A9AA 2EY2A 3U9SA 3G7LA 4A90A 2KHSA 3KLSA 1K52A 2N55A 3I72A 1VDVA 4X3SA 4AQ7A 2QKIC 1KNEA 5JEAH 2IJ0A 2E75C 2NTTA 2ONQA 1Y8NB 1LO5D 3GTLB 1HEZE 2LKVA 1GUTA 1LTSD 4EQOA 3Q8BA 2AUKA 1FEHA 4BS9A 3I4LA 4IURA 3PUXA 1KH0A 1D4BA 4H13C 2JP1A 2G1EA 2WQYB 3P20A 2M00A 1G8ZD 2FHTA 4OIKA 2WXLA 1HUMA 4C3JG 3IFTA 4A3DB 2SOBA 4RHRA 3P1HA 2A69C 2OEDA 4RGNA 3GTPB 4C7YA 4ITKA 4GZYC 2WP8J 3Q8AA 2JYOA 3U7ZA 2J7ZA 5C3WA 4RGOS 2LFNA 2Q5WD 1T3QA 3GD7A 2F0JA 4J3OD 3EGRA 3AE9B 1VR9A 3VYRA 3MTSA 1ZXHA 4PNYA 5FOBB 5C4HA 2E74C 3AMUA 2B2UA 1SNPA 3TEYA 4O1NA 3GO5A 3V3XA 3Q8EA 1GUSA 2F0EA 1ZXTA 2EDGA 1AYFA 2JYEA 4MM3B 1RF2D 1ZE3D 3K7AB 1LTBD 1TY2A 1JROA 2GRIA 1IW7C 2IDYA 1KLGD 3SR1A 2GI9A 2PIAA 2KEDA 1GOZA 1JWMD 2F0SA 5JEAJ 1ESRA 5LL6S 2QILA 1EY8A 3PV0A 2WINB 1XLOA 5D3DA 3NTHA 2L32A 2H4OA 2WDRB 1UGJA 2CVRA 1C48A 1UNSA 1SE2A 3SK4A 3NVYA 2IW3A 4JPSA 5ELDA 3NRZA 3KQ4A 1JOOA 2F0IA 1XLQA 4F8MA 1ZYRC 3DMUA 5A2QE 2WLBA 4BY7B 1PTOD 4XDXA 5C0XG 2KDMA 1STBA 3HUIA 5BYSA 3BK1A 4YSZB 3T3NA 1BXTA 5C3EB 2WV6D 3BVGA 1NYRA 4KTAA 3PO2B 4KN7C 2D5DA 1SBBB 2LEKA 2F4IA 5E4XA 1XCTL 2WNMA 5JXVA 1GB4A 4NKLA 1STYA 1HQMC 1TKYA 4HCEA 3W9CB 1EIGA 2W55A 3P4RB 5JJZA 3BG3A 3WOFA 4HAEA 4KY5A 3W2DA 2L9HA 1WTVA 1SYCA 3H0GB 4WWMA 1V1PA 4C3IG 2E76C 4KI0A 1JQ4A 1Z7TA 1O78A 4IKGA 2X6GA 1VRAB 4ZAIA 4PT5A 1EL0A 4A3JB 1TY0A 2O2LD 3FPPA 3DWAA 4F87A 3E9SA 4KHZA 1F2LA 1U4PA 3VR6A 4KGTA 2V0GA 1F2RI 5FO7B 1SFOB 3P1MA 2IWHA 1MSHA 4OO1H 1J7CA 1E2ZA 2BA0A 2RDFA 4JBWA 1CJEA 1ROEA 1V43A 4JWSC 4WH4A 5EJWA 4Q2JA 3KWLA 2AX5A 2K5PA 1XYIA 2Q8RE 3J7AV 1F9QA 1QOGA 2TSSA 1F2YA 4XXEA 3NUHB 5CYUA 5KNDA 1U4RA 1SNDA 5C4JB 4IQZA 5COYA 5AUIA 2WACA 3HEJA 1TVXA 1FXIA 3CRLC 1DCZA 1NEKB 5G3LD 1BUIC 1N5XA 2M0AA 2WXPA 5C3JB 3HVZA 4RKBA 4QMGA 3HVDA 1B4OA 3OWEB 2EKIA 4LMQD 4CJ0B 1TWCB 1GUWA 5EE3A 1PTOB 4J1MA 3MZ5A 1C77A 4ZKBB 3K5LA 4A3MB 2IGHA 5CV7A 2FBWB 1SJHD 3S16B 1F2MA 4RAUC 3F2UA 2IL8A 3FRPB 1STEA 2OHFA 2MP1A 4CKBA 1MVKA 2ZXOA 1IL8A 1SE3A 5H92C 4FNFA 1RD9D 1TU2B 3S15B 2PW9A 3AMZA 4MACA 3J7AF 2GB1A 1L4ZB 1PDXA 2HTME 4HKZE 4YXDB 3W3AA 4QCLA 2BTEA 2LMCA 1ZDXA 4LAAA 4ZRZA 2A69D 1QKZA 4NMZA 2KMMA 2K05A 4RCNA 2XSCA 3VQIA 5HI1A 3J9CA 4N59A 3NUCA 4ID6A 5KNBA 3T16A 1ET9A 2EJMA 5C5LA 4BY1B 4KK7A 1CHQD 3MJ5A 1QWYA 3BYYB 1A2UA 2NVQB 1E6EB 1PRTC 1IW7D 2N88A 5M9OA 2R6GA 4KN4C 3TZUA 2B2YC 3KK7A 3J81L 1TYGB 1I3QB 1YNNC 2CQAA 4N9PA 2KOLA 2KCNA 3U52E 2ZXPA 4F88A 3H6MA 3LYYA 1AWDA 1JWSD 1OFFA 2K28A 1NAPA 2CU3A 5CV4A 4NW2A 1HHVA 2QIEB 1B53A 2V4DA 4K14A 5AFWA 1CQFA 3BVZA 4KMUC 2FUG1 1E0BA 1D6EC 4HEA1 3HOWB 2VNUD 3QWNA 4A3EB 3K59A 1Q8IA 1LTGD 5ELEA 1SXTA 4PV1C 1PZID 2EYLA 3H09A 1LABA 1U4LA 1QE6A 3BZDB 4YIJA 5ELBA 2NN6I 4F7XA 1LT3D 1YN3A 1WTXA 2K5WA 2HDEA 1QT9A 2HCCA 3E5SA 3SXHA 2KACA 5IT9E 5I9PA 1CTMA 5JAVA 1WD1A 1FNUA 2DY8A 4S3SA 2JYTA 3A56A 2QSDA 5LL6X 2K22A 3EVQA 5G3LF 3MXUA 1N61A 3A8JE 2JA7B 4FF3A 1PTOC 1PRTB 1HFGA 3V96A 3P4QB 2C9OA 1SNQA 3WCQA 2Z4IA 2K32A 4NDXA 4U673 1DOIA 5DM73 1ET6A 2Z8LA 4PMWA 1UWXA 3PZ7A 4FXCA 1LT5D 1B44D 1QCBD 1F0ZA 1L6UA 1STGA 1ZDVA 4EGVA 2N7JA 4D2KA 2WU5B 3PZ8A 3NP8A 1VCIA 1SNOA 5JPMC 3SHLA 2R7ZB 1YNTE 2NB0A 1MI0A 4DU9A 1TIID 1PYWD 1JRPA 1OXXK 4P6VF 1L0YB 5CORA 5C0XI 3HOZB 5I6YA 1LV9A 2NBFA 2MJEA 5C4XB 1O7ZA 3AEBB 1PZJD 4RWSC 4KJOA 1IGCA 2DNCA 2KEEA 3G6JB 4X3UA 2KWDA 1ACCA 2KN4A 2EYOA 4DXFA 1F2ZA 3EQLC 3V2TA 1CZWA 1O7LA 5HG2A 3L7ZC 3S1RB 4C2MB 4M0WA 2JEAI 1Q90A 2MEKA 3FC4A 1G2SA 4HJGE 1S5CD 4G7OC 5C2TB 4YSXB 2IT1A 2I38A 4MHEA 3NSWA 3NTIA 3KUPA 1IHZA 5ISRA 4G7ZC 1VMPA 4KV6A 3S1NB 4FO2A 1JWAD 4JWUC 3QB3A 2CHBD 3HG9A 3TDQA 4WRDA 3QG1A 4ZUJA 2XVSA 3BDCA 2A5HA 3C8YA 3UI3A 2NN6G 4RH6A 3NHHA 4GDKB 2KCCA 1N5WA 3VR4A 1E2WA 3NPPA 2BT6A 2PYKA 1L4DB 2E2IB 3OMCA 4B0EA 2F0OA 3R93A 1PFNA 1I4RA 3A7LA 1GAQB 2F0QA 3TP6A 1P7FA 1LTRD 2F03A 2MJ8A 3NWTA 2BE5C 2B63B 1XX8A 2B39A 1NI3A 4L8JA 1JW9D 4WQMA 4XQJA 2KVMA 4N58A 5IGEA 3C46A 1G6ZA 2D5GA 3W5UB 3IT6B 4X3TA 1C79A 1EZ6A 1K8OA 1I50B 1EY0A 1DOYA 2RMMA 4BA1I 1UWMA 2PTLA 2RSNA 3L3OC 4ZKCB 1HA5A 4M8AA 5KYIA 1DM0B 2CW0C 2Y5PA 3MFGA 5CV9A 5F2DA 5G5GA 3KWVA 1BMLC 1KDCA 3P4SB 1KAAA 3GS2A 2ZW0A 5M5YB 2N0SB 1HRJA 2PVGC 4ZOHC 1YMHE 3TZDA 2WXNA 4XWWA 2NN6H 3U2SC 4B9WA 1SAPA 1AW7A 2MPMA 1ONLA 1PTOH 3HRDD 2HDLA 1Z47A 5EKIA 3D31A 2BW2A 3T4AC 2JZPA 3CWIA 1YJJA 2K6AA 2NMQA 3H91A 3EFXD 3N6RA 1W6KA 4IUVA 3MWYW 1IBXA 3P42A 1ZP0B 3AEEB 1I4XA 1WTQA 2C5CA 1SDFA 1JCKB 5DNFA 1TKGA 3FILB 1GUGA 1H9SB 1JALA 4WAFA 5KGUA 1F2RC 3TBIB 4BBRB 2O5JC 1GJXA 5CV8A 1FNWA 4YTPB 1B3AA 4CJ1B 2QF7A 1RWSA 5CGKA 4OO1I 2EY6A 4R8NA 2F0UA 1EWYC 4DF7A 1V1OA 4KD4A 3GTQB 4KKJA 1IYUA 1HTLD 1TS3A 4QUCA 5C3XA 5H8YE 5T8IA 4ARCA 1D5XC 4K6LA 3AE8B 5CR3A 1HPCA 1LT6D 1TKEA 3LNNA 1WWTA 4TRDA 4YTMB 4G4KA 3L4PA 1FFVA 5FLXL 2N9KA 5IT9L 1SYBA 3AV8A 4IUUA 3GTGB 3RZOB 3NVZA 3VYUA 1CZGA 1F77A 1JB3A 3URYA 1C78A 1NUCA 1JWBD 4UDUC 4A3GB 1VZ8A 1X3PA 1DJRD 3IAM1 3FILA 3B2GA 2Y3AA 3IKJA 3KLRA 4HSVA 5IGDA 3Q23A 1FM0D 5IGGA 2PKOA 5BMHA 4ZRQA 2F1MA 2EE1A 2TMPA 2AWOA 2G9HD 2GA4B 1SYEA 3VA7A 4YWGG 1YQ4B 3HZXA 4OIJA 1DYQA 3PMFA 1X3QA 3D6CA 4KKUA 1AZQA 1ILQA 4IALA 2XWJB 2B2UC 3S17B 3AE1B 2MHVA 1DD2A 2FINB 3A8KE 5KIXA 5HFYA 1FFUA 1YNND 4IUQA 1KLUD 4A3KB 1CM9A 4FXGC 4C7ZA 2F0FA 4L6TB 4XDCA 1AEXA 3ND8A 1IYVA 2OEOA 3E56A 4ZLTF 2AUJD 1PXUA 1QOHA 4KY7A 1LLRD 3LB8C 1S5FD 4J6HA 3NBHA 4USAA 2JWUA 1MBYA 1I6VC 2JX5A 1JWUD 4HRSA 2FE8A 3DWPA 2QDBA 2VB3X 3J80L 2PW7A 5JEAG 1GUNA 1JE4A 4IUNA 3NK9A 1EIHA 3I90A 3A55A 1BNZA 2HUGA 1Q12A 1WGKA 4KKIA 3VYSA 1RCVD 4QF4A 3S2DB 2K33A 1IUEA 2OXPA 3D8GA 2RQXA 1T5XD 4RGMA 2JA6B 3VRBB 5IOCA 3MXNA 4ABNA 5J39A 2W3SA 3HOUB 5T1GA 2BA1A 3FDTA 3K57A 3ND9A 4XE0A 2EYPA 5IGCA 3VR8B 1SYFA 4ZHPA 1D1KA 4OZAA 3BK2A 1HZ5A 1PUTA 4FYDA 2FMMA 4OO1G 3S9WA 3HGBA 3CHBD 4M1UB 2Q8TA 1QF6A 2XNAC 1A3VA 2J42A 4PMBA 1GUOA 4C3JB 4JX1C 2L0CA 4A93B 1PRTD 5I6WA 2INPE 2NWGA 3M85A 1XLNA 2Y5CA 3CKIB 5BN4A 1ZKOA 1VF7A 3SEBA 2EYHA 4AYBB 5CV6A 2I46A 1FGBD 4WIPA 1GXDC 2B2TC 5JOBA 1CK1A 2EYFA 3NE5B 3J7YW 2WDVB 1C76A 1KDBA 2EPBA 4RGTA 1LTID 3S1MB 1Z6HA 3RLFA 2G9DA 4CJ2C 5EBCA 4OL7A 1QB5D 3Q24A 2ICIA 4MIUA 4ODGA 4TMAB 3WOEA 2PMZB 3OHXC 2L4NA 2BS2B 3JAML 3T53B 2EY1A 1TQOA 3Q6SA 2M19A 1XTCD 4B08A 1D5ZC 3PUWA 2EJFC 1UAPA 1U9RA 2EJGC 4C80A 4CHTB 4DAYA 3H8HA 2WXGA 2MH7A 3LXFA 2E6XA 5E1FA 1EEFD 2RA4A 4WURA 1TWHB 1Y8PB 1LACA 3ZGZA 3I57A 2A73B 4JK1C 1XLPA 3GTKB 3HP3A 4JE3B 4Y7NB 2YEPB 5EE9A 5C4ZA 4REZA 2Z1CA 3L9AX 4US9A 2B2WC 4DNTB 2IX1A 2AQ2B 1LT4D 1U4MA 2LY7A 1A70A 1C4CA 1E9MA 2L52A 2LGIA 2JXTA 3Q22A 1DONA 2HDMA 1N63A 1FD6A 3AN1A 4KKTA 5M5WB 1FD7D 4ARIA 1IKLA 1EOTA 1HZ6A 3A7AB 3KLSX 1RDPD 2WDQB 4XIGS 5HURA 3ZQ4A 3SK5A 3AECB 2F0PA 4HCSA 4DGZA 1VZ7A 3ETRA 3TP8A 1AFPA 4XYOA 2A74C 1P7EA 4G57A 2KQ4X 5EKKA 3KBGA 1JC7A 1H9MA 2KQ3A 5IGFA 3FAHA 1B1ZA 1EWHA 1BDOA 5TSSA 3GQBA 2BBCA 5C5MA 1HXYD 4IN3A 3SE0A 4TKOB 1BCPD 1SE4A 3I9V1 2E2HB 1EEID 2FJ2A 3BVMA 3MXGA 2F0LA 1STHA 3P75A 1UEAB 3S1QB 1DOMA 1S5ED 3KBXA 3VRAB 1W6JA 4CGYB 1S5BD 5FK9C 1BOSA 2J0TD 1FMAD 3TMEA 1V97A 1HQRD 1OXSC 2F0GA 1CHPD 3I8ZA 2A6ED 1AZPA 2D9UA 4QUFA 1BQQT 3DWQA 1ILPA 2K04A 2J4XA 1KFYB 2PZUA 4FP5D 1D1IA 1OQRA 2B2VA 1SIJA 2A68C 2EELA 2JA5B 1EU4A 4FF2A 3BS1A 2WXRA 3ONAB 1NENB 3MP9A 2JEBI 1S4ZA 4A3FB 4HEDA 1WCMB 2OF1A 1Q1BA 3QIAA 5FKAC 3DEOA 1R4QB 3E6ZX 1VDZA 2AQ3B 3BDOA 3PO0A 2W82A 4NAWB 1EY5A 1I7HA 1H9KA 1BCPC 5MPOA 2F0KA 4OHJA 1XF5L 2IX3A 1EY7A 4CKCA 3I91A 2LHEA 1BR9A 2BCOA 2MJDA 2A6HD 5ELFA 3TUOA 4NJCA 1TZOA 3C3LA 2DLBA 3GTMB 1MPEA 4L23A 1FXAA 1SNCA 2ZW1A 1FRRA 1FCCC 2RBMA 1UUPA 3FPUB 5IGBA 3S2HB 2SNSA 1QG7A 2QCPX 1EFID 2WAQB 4EE2A 4HSPA 3VR2A 2JSVX 3AE4B 1G291 5K5PA 3HOXB 1SF0A 5KRUA 1YNJC 1YN5A 3QOJA 1T5EA 3JAME 5EPJA 4TQUS 2PO4A 1V1PB 1SSNA 1NR4A 5I4DA 4H7BA 3ITPA 4YTNB 4DN4M 2VXWA 2JU6X 1J9OA 1JMLA 1Q3LA 2F0NA 1NVID 4IUTA 5I2XA 3EJIA 2BYTA 3NQIA 1YJIA 1ICWA 1VJKA 2DYOA 4XDDA 4BBSB 2RVLA 1L0VB 4FVMA 5HGTA 3I4NB 2MGSA 2WXQA 3ZYYX 4R8IA 1CA6A 3NS1A 1PDQA 2SAKA 4TQ1A 2PCFB 3DUZA 3D4RA 5EKLA 5FO9B 1MHXA 5KNCA 1FR3A 1F9PA 2H88B 1XXGA 3HOVB 3A54A 3ZJVA 1RTNA