3MC0B

Crystal structure of staphylococcal enterotoxin g (seg) in complex with a mouse t-cell receptor beta chain
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
233
structure length
228
Chain Sequence
QPDPKLDELNKVSDYKSNKGTMGNVMNLYMSPPVEGRGVINSRQFLSHDLIFPIEYKSYNEVKTELENTELANNYKGKKVDIFGVPYFYTCIIPKSENFGGCCMYGGLTFNSSENERDKLITVQVTIDNRQSLGFTITTNKNMVTIQELDYKARHWLTKEKKLYEFDGSAFESGYIKFTEKNNTSFWFDLFPKKELVPFVPYKFLNIYGDNKVVDSKSIKMEVFLNTH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords variable beta 8.2 mouse T cell receptor
publication title Crystal structure of staphylococcal enterotoxin G (SEG) in complex with a mouse T-cell receptor {beta} chain.
pubmed doi rcsb
source organism Mus musculus
total genus 64
structure length 228
sequence length 233
chains with identical sequence D
ec nomenclature
pdb deposition date 2010-03-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF01123 Stap_Strp_toxin Staphylococcal/Streptococcal toxin, OB-fold domain
B PF02876 Stap_Strp_tox_C Staphylococcal/Streptococcal toxin, beta-grasp domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.110 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 3mc0B02
3.10.20.120 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 3mc0B01
4RCOA 1TY2A 3GP7A 1KLUD 3BVMA 4UDUC 1V1PA 1D5ZC 3CHBD 3R8BA 1YN5A 3KLSX 1SJHD 1LTAD 2WV6D 1PTOB 1G8ZD 1FD7D 1AW7A 1JWMD 1PRTC 1LT5D 1B44D 1EU4A 1LT3D 2IJ0A 2J4XA 1KTKA 1I4XA 2QEJC 3MFGA 1SE4A 1S5BD 3BVGA 4Z9CB 4RFBA 1AN8A 1JQYD 1PRTD 3DWPA 3R2TA 1TS5A 1I4PA 1PTOF 1PYWD 2ICIA 5ELEA 1BCPB 1LTTD 4L6TB 1CT1D 1EEID 2AQ1B 4RGTA 1HXYD 1YN4A 2R61A 1PZKD 1JWSD 1EEFD 3OWEB 1RD9D 1FNWA 1EWCA 4NZLB 1BCPF 4O1NA 5ELCA 4RGNA 1CQVA 5ELBA 2AQ2B 3URYA 2NTSA 2RDHA 1D5XC 3BZDB 3BYTB 1V1OA 1LO5D 3O13A 1PRTB 1JWUD 1S5CD 4RHRA 1M4VA 5D3DA 4RGMA 1GOZA 1SXTA 4L63B 3W2DA 1PZID 1PZJD 2AQ3B 1DYQA 4DXFA 1RCVD 2O2LD 2XRSD 1PRTF 1FNUA 2XRQD 1ENFA 1YN3A 1ET9A 1S5ED 1STEA 1LLRD 2IPKD 4BWGB 2QILA 3MC0B 2CHBD 2TSSA 2NTTA 2RDGA 3EA6A 4OHJA 1CHQD 3SEBA 1B1ZA 1SE3A 1UUPA 1ESFA 1I4RA 1PTOH 1L0YB 1SEBD 1ET6A 1CHPD 1D5MC 1I4QA 1FGBD 1TY0A 5I4DA 1KLGD 1I4GA 1T5XD 5ELDA 1CK1A 3DWQA 1JCKB 3BVZA 1FNVA 5TSSA 4RH6A 1XXGA 1I4HA 1JR0D 1SE2A 3V05A 3DWAA 1UNSA 1LTID 1DJRD 1BXTA 2SEBD 5FK9C 1XTCD 1PTOC 2XN9C 1HQRD 4RGOS 4C56C 5ELFA 1V1PB 2Z8LA 1SJED 1EFID 1HA5A 1PTOD 1LT4D 1LTSD 1QILA 4K6LA 1MD2D 1L0XB 1RF2D 1S5FD 1SBBB 3TSSA 2G9HD 1D6EC 1LTRD 1LTGD 5FKAC 1S5DD 4DXGA 5D3IB 1BCPC 4ZYSA 3R2IA 1LTBD 1TS3A 1RDPD 4RHSA 1HTLD 1LT6D 2XNAC 3BYYB 1TS2A 1BCPD 1F77A 3EFXD 4TSSA 1TS4A 1EU3A
chains in the Genus database with same CATH superfamily
1K52A 1G6PA 2OF1A 2J42A 1KFYB 5JAVA 1Q8IA 1STAA 3C19A 1MJCA 3RNAC 1EQVA 1C7YA 3MTSA 2WFWA 3MVVA 4IWOA 2LFIA 3H15A 2JA5G 1WE6A 1OFFA 2N7EA 2E8GA 3GZNB 4FHJA 1HTPA 4A3IH 1L6UA 3SR1A 1C4QA 1I4XA 3FKIH 2D3GA 4NXMQ 4GB9A 1BBUA 1V6EA 2YTXA 4C00A 2VY3A 1II3A 2BOSA 3K58A 1XPUA 3DVNV 4IUQA 5C4ZA 4RKBA 1SE9A 3KYDD 2M00A 4HEA1 2KC1A 4EZLA 3AEGB 3KW5B 3DOWA 1PV4A 3N1YC 1IKMA 3AMZA 2BGFA 2WKDA 2PMVA 3RI7C 3ZDMC 2PNHA 3NVZA 1NY4A 4HAEA 3A74A 1L6VA 2ZTDA 4KV6A 1F9RA 5KNBA 2DJFC 1XPRA 2ZJQA 4A3LH 5M5YB 4A9AA 3U7ZA 1D5XC 4HMIA 4NP5A 2JA7G 4GOPB 5DAUA 1EIGA 4AUQC 3HOUG 2WB1B 3M9BA 4NAWB 1GUOA 1CKOA 2D0PA 4RGMA 4KK7A 4Y52H 3A5UA 1C77A 4GGQA 2M19A 5KRUA 4KZ0A 4L63B 2D62A 4RF0A 4DPGA 4HJAA 4OL7A 2K14A 2GBMA 3PSEB 3C1EA 3PGEA 3SU8X 1A0IA 5DNFA 1TWHH 2O6VB 3RNEC 2LRWA 1Z5SB 2LJIA 1JRUA 2N9PC 4LNFA 4OHJA 3DBLI 3ULLA 4KZCA 4BOZB 1SE3A 2VB3X 2YV5A 1XD3B 2LGDA 4GN4B 2PTLA 5I2XA 4JI6L 1ESFA 2W3RA 3APCA 4YWGG 3VUXA 2WQYB 2Z1CA 3QJYA 2J7ZA 2GBNA 2F0MA 1PH6A 2WLBA 4B3MQ 3Q3JA 1V9JA 1I50B 1GJXA 1YX6B 1Y8OB 1X56A 1FNVA 1EYCA 1D1IA 2LGXA 2AKWB 2FCQA 3GTJB 4RG1A 3K5NA 4V190 2JUOA 2O2VB 3N9YC 3T3NA 3VTWA 1IGCA 1B3AA 3ZTCA 2O6VA 3OTOQ 4DAMA 3B2FA 4YL8A 1PTOC 1B9MA 3DHQA 1EY5A 1GG3A 2FAZA 4RGOS 2K0PA 3V62A 3D8GA 4GN1A 3W1SA 2VUMG 4KHPQ 4AQ7A 4A3MH 1X3GA 3GTKB 5AJ3L 5BR8L 4A3EB 3Q8AA 1ZYRC 1SNCA 4DV1Q 4DV3Q 1N63A 3S2DH 3ABVB 4QQBX 4P7IA 4WJWA 4E71A 4LNIA 5LMNQ 2GLSA 2V4LA 5H1SE 4DR5L 1LM8B 1GB4A 5C3XA 1WGYA 3FAHA 2BA1A 1WTHA 1TS3A 4OZBA 1JWAD 1RDPD 2F0NA 2F4VL 4JI7Q 4DR6L 2Q8RE 2O2VA 1YIJA 5CHVC 3HRDD 3WOEA 4U673 2EOTA 3IFTA 1Q81C 4PZ7A 5FJ8G 2JX5A 1TWAH 3AFQA 2BQQA 2MJDA 4Q5VA 3W5UB 2HD5B 3IBEA 4JYAQ 2SOBA 3CHBD 4OGQC 1PA6A 3LXFA 3U2SC 5M3MB 4EQNA 3L16A 5EKKA 1NI2A 2BYTA 2Y5BB 4A3OA 3H3VI 3SR6A 1DGSA 3UQAA 1SYCA 3ZIMA 4DR7L 5AZHA 3IAS1 2K5QA 4DV4L 4F87A 2QEJC 1RJTA 5LHY1 4A3IG 3CQZH 3F2UA 5HHDG 2CHZA 4CYEA 2JSOA 2QKIC 4P72A 5I9OA 1HNXQ 1VQJA 5G2NA 4ARIA 3FKIG 5IY0A 4FXCA 2W55A 1TT5B 1S4ZA 3ZKJC 3KLSA 3S2HH 2Z59B 3B0AA 1KHIA 2KVMA 2WU5B 3F2DA 2RVLA 2E2DC 3KF6A 3E9HA 4CDFC 4H02A 3K59A 4LK1C 4HSVA 3S1QH 1YQ4B 3A1QB 3RT3B 1L5PA 3HOZH 2ZZPB 1G6ZA 2EMTA 4POFA 3E5SA 2I1JA 4NZLB 3CCEA 1BMLC 5HFYA 2OQ0A 1X32A 2IX3A 2CVRA 3S1NH 4O1NA 1Y69U 3STBC 1XEEA 1BVSA 2KUMA 1RFAA 4DU9A 3A5ZB 2N7JA 1KIXA 1WOCA 2HQEA 3GDEA 1O7ZA 4KTAA 4A3LG 5A2QE 4GKJQ 2IHEA 1IBLQ 3VTVA 4YIJA 1E8WA 3A9JB 2N4FA 1SE8A 1AZQA 2LS01 3N1XC 1T6BX 3KWVA 1QJOA 3N3KB 1SYDA 3GTPH 3K0YA 5D2MB 3UQBA 5AEKB 1JMCA 4UP9A 2A69C 4DXFA 1YJIA 2E2HH 1GKHA 4GN5A 1X55A 2SAKA 4XT3B 2CKHB 5IWAL 3QC8B 3NQTA 1N8RC 2Y5CA 2C5CA 1C79A 4WJ4A 3MC0B 1IGDA 1PGXA 2IO3B 4JGHB 2ZXRA 5J22A 1Z47A 2M9VA 2IX1A 1VQGA 3PT2B 5DM73 4CJ1B 5HG2A 4GNXB 2BS4B 2HTHA 3QA8A 1AP0A 1RAXA 2PPBC 1JW9D 1B70B 4GKKL 1GAQB 3A9JA 3OAWA 4NXNL 2N1WA 1H9MA 1H95A 4G3XB 4S17A 5HI1A 4WWPA 3UE1A 5G5HA 1TWGB 1VS0A 5JOBA 3TP6A 2WDVB 3WA0A 2MW5A 2CR5A 3HIZA 1AZPA 1QVFA 1SIJA 4YWKA 5CHFA 1TR5A 2IGDA 1JR0D 3M4PA 2JZ3B 1UELA 2KEEA 1B4OA 4QF4A 4UPAA 5C23A 3Q3FA 1A15A 4JI0Q 2N0SB 4ZHOA 2CU1A 2EYFA 4KKUA 2UXBL 1EIYB 4IM2A 1GC7A 1CZGA 4FF2A 3IAM1 1HTOA 4M8NA 1L7YA 2PQAB 2MBQA 4N8FA 2JXXA 3LJ3A 2L5TA 4C1NI 4NXML 2WXRA 1EY4A 4A3MG 1VCBA 3JSVB 4K7SA 2B2UC 2CH4W 2KFJA 1L1OA 2K3UA 3EUB2 2OWOA 1S5DD 2B39A 5D3IB 2A4ZA 2WYQA 4KGRA 3R2IA 3N52A 5C0XH 5IGDA 2PZUA 1YQBA 2ICEC 5J17A 4HIKA 4HDOA 1A63A 1WCMH 2BKFA 1EZ6A 4KVGB 1S3OA 1VQOA 1ML0D 4BA2I 2AL6A 4RAUC 1JT8A 2WWZA 2QW7A 3J81c 3RN5A 3ZVVA 4BFRA 1P9DU 2I46A 2PQAA 3BVMA 3DHGC 4FLHA 2AL3A 4YY3Q 1S40A 3F2CA 4I6LB 1PGBA 2B2VC 1BDOA 5IP7H 1GUSA 3KJPA 1SNMA 2VQEQ 4B3SL 2IJ0A 1F2RC 3F2BA 2K8CA 3K7UC 4IPCA 4DHZB 3C3LA 1UE7A 4ANUA 2B3GA 3L3OC 5D94A 1I50H 2XSCA 1YITA 2H89B 2D3BA 2KOLA 1IYUA 3RUIB 1I4PA 3HKSA 4XWTA 2E3TA 5CGKA 2KQ7A 1CSQA 3KYCD 2MO0A 3GTJH 4OELB 3I4MH 5DPWA 4QCLA 1QQRA 4C3HB 4PS3A 4W9HA 3T13A 4GZYC 2V4IB 4IO9A 1P0RA 4M02A 5L95C 1L0VB 1Y1VB 2YEPB 1VF5C 2KK8A 3MJ5A 4HIOA 3HOZG 4FADA 2WXOA 1QOHA 2M2LA 5ELCA 2WDRB 2K5VA 3GTKH 3Q3OC 3M63B 3UI3A 2WXHA 4A3EH 2M4NA 1QZEA 2FCNA 3NVVA 1HNWQ 2EXDA 2PW9A 1YJWA 3T53B 4QMGA 3ICEA 4OO1I 1T0YA 3ONSA 5IP9H 4CBVA 2A5UA 3OTOL 3L13A 4LF5L 2A5HA 5JJIA 2F0QA 4X3SA 1K3BC 4ZUJA 1WGHA 2HJ1A 4RA8A 1AWDA 3LWUA 4MT5A 1STEA 4DV3L 4DV1L 2Q2IA 1VQ7A 3QX1A 4EE2A 1YNJC 1UAPA 1UUPA 1V9PA 2I38A 2PIAA 4IC7B 1HUMA 2D07B 1ET6A 3EVQA 3ER0A 4QJFA 1Q8KA 5KNCA 1FGBD 2PZTA 2XWBB 1V97A 1DCZA 2UUBQ 1VRAB 1JCKB 1GUNA 3AN1A 5CBAE 2K32A 1XXGA 1YNXA 1PVOA 2LY7A 2DNCA 2J0JA 2UU9Q 4IOCA 2F0TA 2CJNA 2I5MX 2CH4A 4JYAL 1TKGA 4JI3L 2IZVB 3W5OA 1N5WA 3I4LA 2D2QA 4DK1A 5FLXL 3H3VH 4KKIA 5BYSA 2F0LA 3TEHB 2F0GA 3Q8EA 3J9CA 1I35A 1HRJA 1EYDA 3Q22A 3PLUA 4PK1A 2EYPA 1A8VA 3RNCC 3HM3A 1PLFA 2GA4B 1M8AA 1MD2D 3PMFA 1VQPA 1HNXL 1QF6A 1NMGA 2Q5WD 4P16A 4ITKA 4K5XA 1X65A 2GN5A 1C8CA 5JJKA 2AWTA 1XO3A 3I3CA 3PSIA 3OIPA 5EKIA 2MFIA 2K52A 3H0GH 5C0XG 1IBMQ 3P75A 4A3BH 2DENB 2LD9A 1KC8C 3RFZB 3N1ZC 1DGJA 1JB3A 1WJ4A 3PIP3 1WCMG 5KEEA 1KH0A 3T16A 4C2MB 4JX1C 3AE4B 2FUG1 3NJTA 1N9WA 1K8MA 1PXUA 2JA7B 5EJWA 4GKJL 3AECB 1N33L 1ZE3D 3J7ZC 5T8IA 2DYMA 5G3LD 2NBFA 3HOUB 5C2TB 2WDQB 2Z0SA 4PMCA 4LFCQ 1LFDA 3UDXA 5IP7G 2NYZD 2KENA 4L23A 5IAAC 1E2ZA 2B2WC 3W3AA 4OEMB 3CC4A 1K8GA 3C46A 1F9JA 1WY8A 1DOKA 4OWWB 4MJSB 4NW2A 3VR6A 4L6TB 3U9SA 1CT1D 4ULLA 4FJVB 3MEFA 2NVTB 3Q14C 1SDFA 4MGIE 2J52A 2KBNA 3CU7A 3TP5A 2OTLA 3I4MG 5D14A 2IGGA 2RCNA 2L9HA 4HN7A 1FNWA 3BDOA 4R9WA 3BZCA 1EWHA 3ZRFA 1EWIA 1MSHA 2L0TA 4GSWA 2GVBA 2FCSA 1O7LA 4WH4A 2DZJA 1ZPSA 3BYTB 2GRIA 1RHPA 3S1RB 4L5RC 1STBA 2WIIB 2HT1A 3UIOB 2RPQA 2IYDB 5E6JA 4A3EG 3I57A 5HKHA 1Q12A 4X64Q 4WFN3 4HJ5A 2INCC 5E6OA 4D2KA 4US8A 5C5MA 1SXTA 3MC9A 4L2YA 3TBIB 1RL2A 3VYTA 1JROA 1VQ9A 4CQNA 5IP9G 1NAPA 4MELA 3B08A 2VUMB 1F9QA 1FXAA 2C9OA 4JWUC 4O42A 2Q2HA 4A55A 2CFMA 4C80A 2B8GA 2RKSA 3ZXVA 4NPSA 1KQSA 3WANA 3I90A 3OPOA 4V0BA 4F1SA 3PF5A 4A4IA 1JRPA 1GUWA 4H44C 1Q1EA 2ZJPA 4JV5Q 5I4DA 1E1OA 2K7VA 3AU7A 4N8X1 2FHTA 1A70A 2BYFA 3AEFB 3B1LX 2EYHA 1X54A 2KTFA 4YWLA 1SE2A 2EXZA 2E2IB 1WSPA 2EY5A 1NR2A 3LNNA 4HMJA 1BXTA 1BKBA 3IRBA 4K2KA 3SHLA 4C3HH 4IDIA 4A76A 2MJ3A 3KUCB 3D4WA 3VYRA 1C0AA 1GUTA 1Y1VH 4P74A 3M4OB 2VQEL 5T1GA 1DD2A 4LW1A 3P4PB 3DM1A 4A3IB 4ZYNA 1GVPA 4RKLA 5J3BA 1S3SG 3S24A 1L0XB 2KC2A 3S2AA 3LB8C 4LWCA 4XIGS 2K6QA 4MACA 4ZYSA 1B50A 2C60A 4N9PA 5C1ZA 4WQMA 3J80c 2LVQA 2NVUI 3E56A 2D5DA 5KYLA 4EZJA 1TS2A 4J1MA 1F77A 3HOVH 1EUVB 3D0FA 5DLQE 1WRDB 3EIVA 3DQVA 4B6WA 2KDIA 4CHTB 2LUMA 3U4ZA 1QB5D 2MH7A 4NJ6A 3H0GG 4A3BG 2WAQB 5IE8A 1WXSA 2FIDA 3OJ3A 4JW0A 1JOKA 2ALYB 3GE3C 4AH6A 2VL6A 3KQ4A 4L5TA 5JEAJ 4IKGA 1ZW7A 2OJRA 2FMMA 1CKNB 1UE6A 2FJ2A 3C1FA 4DV2Q 3WWVA 4OO1H 1UGJA 2LVOA 3TS0A 4YTMB 3M3YH 2RSNA 3JW0X 3L4PA 4Z9CB 3DWGC 3GV6A 3AE6B 1OXVA 1YBYA 1TS5A 3U50C 2EYOA 4RCNA 4KKJA 4J8QA 1ISNA 1EO6A 4EFOA 5J2RA 2JXMB 4KIKA 2F0UA 3FVQA 1WYGA 3AEAB 2Z0DB 1JOOA 4KHVA 1PH8A 1XMQL 1NBWA 2IX0A 3P42A 4M8MA 1JE4A 2N9XA 5CYUA 1TWHB 2L32A 1D3ZA 1VCIA 2NN6I 3AB5A 1QNKA 3RNFC 2J0MA 4JI1Q 1JOQA 1YHAA 1PH2A 1CKNA 2E74C 4LUZA 3HK0A 4KDLB 4TV3A 2GMIC 2AQ2B 1ONLA 1HPCA 3URYA 3DVGY 2NTSA 1B53A 1KRSA 1E3PA 4I6NB 4ZRPA 3UI2A 1E22A 1NJIC 4DWFA 5AJ3Q 3PS6A 1PQSA 5BR8Q 2INNE 3DBRI 2VQFL 1JJ2A 1H9SB 2K04A 2IHFA 4WJQA 2PNRC 2EPBA 1YNNC 1V5TA 2GVAA 1DOLA 3AXCA 3PF4A 2K1BA 2BKRB 1XJVA 3GTMH 1DOMA 4GMVA 4MHEA 4DR5Q 3QG1A 1WTRA 2N7DA 1NEKB 1A2UA 2F0PA 5GAHC 2KJHB 4IFDI 4DR6Q 2J53A 5BMIA 3BDCA 1PRTF 4A75A 2EE1A 3EGRA 3HOWB 1GXDC 1YN3A 3RPFC 4A3MB 4XDXA 2R7DA 3EA6A 4OIJA 1FJGQ 2PEAA 2NPTB 4C2MH 3PO0A 4LJOB 3SEBA 1ENAA 1C1YB 4LK0M 4WJOA 2L83A 3S2DB 3DBSA 4IG7B 2WP9B 3NS1A 1WJUA 1LQBA 1T5XD 2MSED 1D8LA 3BVZA 4DR7Q 1IBML 4DV4Q 1STHA 3RN9C 1RODA 3MTNB 5DPRA 2A6EC 1GUAB 4HROA 4USAA 1QLBB 3KDFB 1H9RA 3K8AA 2EYLA 4K1RB 3AQQA 2NVTH 3PHWB 1WFQA 1IW7C 1YJJA 1GB1A 4C3HG 4FA6A 5FR3A 3IAYA 5DPTA 4LFCL 4DNIA 2WS3B 3NZSA 4FF1A 3D6WA 1NNXA 2XGTA 1PFBA 1LTSD 3I2ZA 1Y1VG 4AJWA 1WMHA 1OQQA 3GOEA 3D31A 3U4EG 4P6VF 2I07B 1AH9A 5FLXE 3P7JA 5K36H 3CQZB 1LM0A 2AEHA 3BY4B 2N8NA 4DXGA 4EGVA 1C78A 2LFNA 3S1RH 1X9NA 5EKLA 5GADC 3J7AF 3V3XA 1EOTA 3CMAA 3NZ3A 1NBFC 4EQOA 3S2HB 3HFZB 2LASA 3BYYB 4MIUA 1AE2A 3ZQ4A 3KDFA 4R8NA 2WX0A 4XXEA 3S1QB 1S1QB 3HOVG 4BVUC 1WX9A 2K28A 3PUZA 4W9KA 3DMUA 1UD7A 1F2YA 1NE3A 2IBIB 4W9CA 1D5ZC 3KYHC 1KL9A 3S1NB 1YN5A 2M0AA 3VHTC 5HY6A 4QIWB 5IYBH 3I73A 3H91A 3U4VA 2F0SA 1C4AA 1TVXA 3DVNU 1I7HA 3TZDA 4IQZA 2A8VA 4TRDA 4X64L 1OQRA 2OHFA 1X3QA 1IPGA 3DDCB 4OO1G 2B2TA 1VZ7A 1AN8A 1L2FA 2XIWA 1HUNA 1G6JA 1QOAA 2DJGC 4WWNA 4IUPA 3CCJA 1KM7A 3GTPB 1X3FA 2KWVB 1FFUA 2ON8A 4LLGM 2IY0B 4OONA 4A3GH 4GOCA 4KMUC 5JVH3 2C7NB 2E2IH 3KOJA 4BBRH 4MSMB 1P1AA 3KWLA 3JAMi 1NTGA 1EWCA 1NYQA 3FILA 2KCNA 4OVZA 5G55A 2PMZB 2Y3AA 3A4SC 4AJYB 1CSPA 3BINA 2BPSA 3KLWA 2DGYA 1L0WA 3M4OH 4JV5L 2KXJA 5EPKA 2H1EA 2UXBQ 1CQVA 4PZ8A 1ENCA 1LV9A 2CW0C 1EF1A 2L76A 2IW3A 4TUUA 3ERSX 2R93B 3HVDA 1ZDXA 5LMUL 3ZDTA 1MPEA 3CCRA 2SNMA 1VQAA 4MGZE 1QZGA 3SXHA 2JWUA 4H2AA 1VQKA 4HDQA 3Q6SA 2C7MB 3ZJTA 1W3SA 4JG2A 1R4PB 4DHZE 2PVOD 2CU3A 3EQLC 5C0XI 2JA9A 4NQKE 2XRQD 4WJ3M 3FEWX 1ET9A 2DY7A 1Z6HA 3JVZX 4OW0A 2WXFA 2JU6X 4J3OD 3ZLZA 3CCLA 2ZCCA 1BQQT 3NY5A 2PQEA 2ZXPA 1NDDA 2V1CC 2LJ5A 2D0OA 4R3DA 1D5MC 3V61A 1F9PA 3ZNID 2UU7A 1CK1A 4ZK9B 4HRSA 3DWQA 3H6MA 3IFDA 4KHZA 4JI2Q 1VQIA 4B3SQ 1P3QU 2A73B 2L1BA 1I4HA 2VH2A 3SDLC 1V1QA 1J19A 1WCMB 4NJ7A 4G7ZC 3DPDA 2R2OA 1L2NA 4ZRIA 3M4YA 3RCZA 1MI0A 4PS8A 3MA2B 3NSWA 4BY1B 4ZRQA 2Z6KC 3A0JA 4XQNA 4DV2L 3HGBA 1Q82C 3A8KE 1AYFA 1J9OA 3QO2A 1GO3E 1SGHA 1X3EA 3KUZA 3R7QA 2RMMA 5C3WA 1E8XA 3W1BA 5BYQA 1KD1C 4ACFA 5JPNC 3K5LA 1KJTA 2KHWB 3ZJYC 2ZPNA 2F0JA 1LTRD 3WOFA 1OXTA 2L12A 2F1MA 4GXBA 1M1KC 5K36G 2B3AA 3OSOA 2IGHA 3RUZA 3T9LA 1LT6D 2R3ZA 2RQXA 1TBEA 3EFUA 5IOIA 3QARA 4TSSA 2SDFA 4DV0Q 3PIOA 3I4MB 1AEXA 2NN6H 1TIFA 3PZDA 3WCQA 3RLNA 1ICFB 1VQLA 4A3FH 3DBLB 4DUYL 4HJ8A 3E0EA 4RCOA 2Z4HA 1STYA 3Q8DA 4NDXA 4JI1L 2KDBA 1SNQA 2XK5A 3NEMA 4LF5Q 1YNTE 2PE9A 3A33B 4IOIE 1U4MA 1CTMA 3HOWH 4NAMA 1SJHD 3AB9A 2K4KA 3OJ4B 3NELA 5BN3A 4DN4M 1FD7D 3HKZB 4BBSB 4EQPA 5IYBG 3QB3A 1BO0A 3CW2C 3ULPA 3AYHB 1MIUA 3LDZE 5JEAH 2FE8A 3DEOA 1EY9A 4F8CB 5I2YA 1BT0A 1IP9A 4FF3A 1K53A 2INPE 4IFDH 4EVOA 4L8JA 2NR2A 1BCPB 4YCVA 1IYJB 4DAVA 3VA7A 1MVKA 4IPDA 1M94A 1FJGL 2EZVA 1SYBA 3KF6B 3MZ5A 4A3GG 1B7YB 2ZNVB 1CI3M 1GUGA 2KDEB 4IUVA 1CZWA 4P2CB 2A74C 4BBRG 4JI3Q 4OX9L 3HP3A 4IJHA 1SRUA 1W6KA 3DVGX 1FMAD 1NUCA 1M90C 2RDHA 1HNZQ 5IGGA 1RM6C 2CWAA 1GPXA 1WIAA 1LO5D 3BG3A 5G5GA 4AIMA 2BS3B 3BU2A 3NRZA 1VQBA 1P7EA 2OQKA 4BAXA 4ZKCB 3UDGA 2MBEA 3QQ8B 3KK7A 1XLNA 4YWMA 1R4MI 2NBWB 2WU2B 3I5JC 3U30A 3SDZA 3RNUA 3W9CB 2AQ3B 4ZOHC 2DNFA 1RCVD 3RD2A 4ZRKA 1D2BA 3B2GA 2FNJB 2KJRA 4ALPA 3PIPA 2V0GA 4Q0FA 3VA5A 1NENB 3U7DA 2Q8TA 1I6HB 2WAQG 4KSKC 1TXYA 4KD3A 5EGTA 1WD1A 2N9EB 2WNMA 5DCNA 2A68C 1I4RA 2BH8A 2KACA 4YTPB 1SEBD 1TZOA 3E9SA 1WXQA 1RLFA 4II2B 2I2YA 4H7BA 1R4MB 1N33Q 4LJZC 5HGTA 2LXJA 4XC2A 2WACA 3H7SA 3G48A 4IUUA 1YJNA 3H0GB 1I5FA 4A3BB 2AHOB 3X3MA 2BYEA 1ZEQX 4ODGA 1NVID 1UNSA 1OO9B 1X3PA 4Y7NB 2QHOA 4WWMA 2KLCA 1RTNA 2A6HD 4RWSC 3ZRCA 1K73C 2KDMA 1VF7A 2IY1B 1AFPA 1FPYA 4ZDVA 5FLMH 3QOLA 1HEZE 4IURA 3T4AC 2K33A 1EM7A 1I3QB 5K5PA 2KFKA 3AV8A 3VQIA 2MQHA 3WAOA 1UGMA 4K6LA 4FNFA 2QDBA 5J39A 2NWGA 2R2QA 3P4RB 3OW2A 2G9HD 3QR8A 5IGBA 4K0KL 1WE7A 2R93H 1L1OB 2YYZA 4NQLB 4RHSA 3PGZA 1V2YA 2IL8A 3RLOA 1WXVA 2XNAC 3D4DA 3N30A 2D3CA 1NYRA 2Q2UA 1YOVB 2OEDA 3LYYA 1MBYA 4F8MA 1PH1A 5GMVA 3P2BA 2NN6G 1K50A 2L0FA 2YU9B 3K9OB 4A3FG 4R4QA 3ALBA 2LXKA 2YTVA 2Z6KA 2JN4A 2Q2TA 5DPSA 2WV6D 3G4SA 1PTOB 4UP7A 4A3DH 3HOWG 3FP9A 4ICUA 3VVWB 1PRTC 3N6RA 1EU4A 1SNDA 4MN3A 1VR9A 2I0QA 2NZOA 1SE4A 3AH7A 4LUVA 1JQYD 4FDBA 1IXRA 2BB5A 3G6EA 3PO3B 5JEAG 1FCCC 1I42A 1PYWD 3NENA 3E9IA 1XTDA 3A8IE 4IFDG 1YN4A 2ZXOA 3HEJA 5BO4B 3J7AV 1N32L 2WINB 5EPLA 2NCNA 5GROA 4OXPA 1IL8A 4R8IA 3U8ZA 2D9UA 4DNRB 5IIFA 2E5LQ 3DHIC 4BY1H 1XF5L 1EIFA 2UWQA 1IKLA 4MGKE 4HVBA 1VQDA 2DYBA 1Q1OA 4HWIB 4JI2L 2WAQE 3EHVA 1V1OA 4ILWA 1WTPA 1SMYD 2V9HA 3KJOA 5AZGA 1YJ9A 3HG9A 2Z9HA 4QGUA 1KNEA 3SE0A 1WGGA 3K6OA 3CSTA 3J7YW 1QOBA 2O5JC 2HIXA 2ZEQA 4N9TA 3AE9B 3H94A 1VQ6A 3PHXB 3S1MH 5FLXc 3ML8A 3UDFA 1WD0A 3TRZA 4JQWC 1KABA 3JAML 4M0WA 2O6VD 2IPKD 4JWSC 5LLIA 2CHBD 2JK8A 2N49A 1E7UA 2GB1A 1BUVT 1XWEA 2RA4A 1HE8A 4DR2Q 2ZTEA 2LZ6A 3ML9A 1ZDVA 4S0RA 2K03A 4R4OA 1C76A 3VTUA 4BBSH 4AWJA 4BKTA 2QDLA 1I4QA 5E4WC 4HJ7A 3VXWA 3Q69A 3NVWA 2F0EA 4B08A 4ICVA 4AP4C 3J80i 1A2TA 1V86A 4DV0L 2K01A 3CCUA 5IGEA 4RH6A 3PIO3 2FFKB 2F0OA 3GTLH 1QNUA 2K75A 3HOVB 5IYCH 2X6GA 5JVG3 4XGAB 1DOYA 2V3NA 3EECA 1OEYJ 5E3FA 1PFSA 3TZUA 3CCSA 4DBGA 1KF6B 1CUKA 2PW5A 4GLSC 1XTCD 1PUTA 4BZAA 2E2JH 2HHHQ 4C7YA 2ZVNA 1T5EA 5CC4A 3L2PA 1J8CA 1XMQQ 3K80C 3PUYA 2KNBA 3Q8FA 4XDDA 1LUZA 2NS5A 3OG5A 1PGAA 4NMZA 2BE5D 5FLMG 1RF2D 1S5FD 4EX5A 2CQAA 3M3YB 3SHQA 4W9FA 1TTNA 1YQ3B 2JA8B 2CJOA 4PYZA 1YVCA 5HGQA 2EIFA 2KZRA 4O2DA 3GO5A 2R93G 2P5ZX 4A3CH 1BCPD 1U5KA 2EMSA 2VQFQ 5C4JH 1HHVA 2QA4A 3N20C 2CHXA 3GS2A 3VR8B 3CRLC 3OMGA 3I4NH 2RD0A 3VR3A 2ID0A 1ASYA 2JE6I 2KQ4X 3ONAB 2JEAI 1WXAA 3MXGA 2Z4IA 4J6HA 3R8BA 4DFAA 4XYOA 1SFOB 1HNZL 2R92H 2KKCA 3MEHA 1E0BA 4LCDE 4W9IA 2QDFA 1AARA 1MGSA 1G8ZD 2EJMA 1I6HH 4HTHA 3LWEA 2WX1A 2JA6B 2D10A 4Q2JA 1Q5WB 1GJZA 5EE1A 4LF7Q 4A3DG 4FXDA 4N9F4 3SK5A 5M5WB 5LNK1 2M0XA 3MC8A 1EWYC 3MFYA 4TMAB 4KSLC 2HQLA 1UE5A 5ELEA 3I8ZA 3X3NA 4LF6Q 3GTMB 1EUJA 3QWNA 4LDTB 3V60A 1LACA 2K5HA 5D65A 1EEID 3V96A 2LI5A 5BMHA 4LUOA 4B9KA 2NVQB 2JYTA 1F2RI 2BDNA 5IP4D 3M95A 1RD9D 4Y7NH 1SROA 4L5QA 4IZ8A 1BUIC 4ANVA 4RMFA 4PNYA 4AYBG 2OEOA 1RTOA 2KCMA 3F1ZA 5T1IA 1QG7A 5E1FA 5IT9L 3PUWA 1WYWB 3FKYA 1I3QH 5KGUA 4BY1G 2V1YA 1PHJA 3SK6A 4O0AA 3RLFA 4AQYL 3BZDB 3E0JA 4PT5A 1DONA 1TJEA 2YTYA 2B2UA 5I6YA 2NVXB 5EBDA 4QIWE 4HPMB 1H9JA 5G3LF 4JOIC 3PUVA 2A19A 3HOYB 4X3UA 4ZCKA 2JYOA 2XRSD 1TIID 4W9LA 2PVGC 4IN3A 4KY6A 2N55A 2DLBA 2YU9H 2WXQA 3QOJA 4P1BC 4PQXA 2RDGA 1QKZA 1TWFH 2HTME 3A4RA 4KGTA 1JQ4A 3A54A 1PTOH 4FJZA 2B2VA 1E90A 1IL2A 1T0RC 4IM0A 3FPUB 4UAIA 5D7GA 2AMCB 4MZ9A 3LGJA 1TY0A 4N58A 2KJ6A 4XZ4A 1CA5A 2PMZE 3HKZG 2DY8A 2AUKA 4BBSG 1QWYA 2MLBA 4GLXA 2L1AA 4JI4Q 3PO3H 2R6GA 2XTIA 4IOAA 2AWOA 1VQ4A 2MHJA 5IYCG 2X8XX 1Y56A 3NUHB 1B3QA 4IUNA 4C3JB 2RDBC 2JSVX 4IW0A 1DXMA 3DEPA 4MNOA 1VDZA 3Q23A 5ELNA 4LFBQ 3QHTA 4LNNA 1XLQA 2Z8LA 2MO1A 1YIWA 4YCUA 2KWUB 1PTOD 2QIEB 4GIVA 1QILA 1EQTA 4XT1B 2EVBA 1WF9A 4A6QA 4DV6Q 4LAAA 4YSZB 2O5IC 3EN2A 5CHWA 2OXPA 1HZBA 5CV5A 5E6NA 4GDKB 1ZYRD 3HRZC 4UY8C 4TQ1A 3ZXRA 4GLVB 5LMUQ 2Y5PA 3WDNA 3CRKC 4KDIC 2BWES 4A3GB 3RNGC 4PMWA 2RSOA 3AULA 1F2ZA 4A3CG 4OVUA 5C44H 4BBRB 2E5LL 2G4SA 3NTHA 1QUQB 4CKBA 1WTVA 1P7FA 1FEHA 1YI2A 2OJWA 3R3MA 2BT6A 4KX6B 1YMHE 3I4NG 1EQQA 3G6JB 3DM3A 4PG3A 1Y8RC 1LXDA 3Q2AC 3L0OA 2R92G 4DUZQ 4AYBE 2H88B 4GDKA 3VDYA 3K9PB 4FO2A 3QIJA 4DK3C 1N60A 3ND8A 5FO8B 3NBIA 4ASWC 4JBWA 3MAQA 2WXLA 1E7VA 1XMOL 1Q1BA 4KJOA 3CXCA 1WVLA 4GN3B 2AQ1B 3G71A 1UEAB 2IO1B 4EKUA 1MHXA 1WGKA 1QUQA 1WI0A 1XQQA 2KO3A 1JWSD 4KIKB 3M3JA 2I5LX 3Q6BA 1MHHE 3S9WA 4HJGE 4A20A 4TQ0A 1U4LA 2IWHA 4DR2L 4FN2A 1I94Q 5M9OA 3FDTA 4G57A 3A7LA 4XYQA 3N32A 4LTUA 3AE2B 3K81C 4R4TA 2AYOB 1DZ1A 1GD7A 4NPNA 3STBD 2DN8A 2CHWA 2F0WA 3DBHI 2YEPF 2K6AA 1XCTL 4LFAQ 1F9SA 5M5XH 2JA8H 4RHRA 1HZ6A 4HCPB 1SIFA 3HKZE 1GOZA 3DLLA 2BW2A 2PW7A 1K83B 5ELOA 3VR2A 4POGA 3VR4A 3GTQB 2LWPA 4I65A 1IBXB 3GV3A 1DYQA 2HHHL 4ZAIA 5JXVA 4DK0A 5MPOA 2DZKA 3C8YA 4DR1L 2ENBA 2D5GA 2A69D 3MXUA 3S15B 4FBJB 2MP1A 4DUYQ 2YVCA 1CHQD 1SFOH 2N3SA 4MGYE 1QT9A 3ZW3A 1PH7A 2DNEA 3ULJA 4B9XA 1CHPD 2JA6H 4DXAB 1FXTB 4ME5A 3LX0A 4NNJB 4FYDA 1PH4A 3JAME 5ELDA 1FL0A 3NZUA 3UIPB 2ASQA 5M5WH 2DAJA 2DBYA 1Z9FA 2QCZA 1SYGA 1YHBA 2PI2A 2LUEA 2B2WA 3D3RA 3OHXC 4XE0A 4NJCA 1IBXA 1E2VA 2CS4A 1NMFA 1R4NI 3AE1B 1B8AA 2M56B 2PLPA 4IALA 3U9OA 4A3FB 4JOIA 3PO3G 3T56B 4QAYA 1ZP0B 5EPJA 2SEBD 1SYEA 1S72A 2NVQH 3Q3MC 2MJEA 3GTOB 2NUCA 3R93A 4C56C 1V1PB 1ZGUB 5KHOA 4LF9L 1MSGA 2Q8IB 4LF7L 1C48A 3DBRB 4YCWA 2KN5A 2NVYH 3TSSA 4OX9Q 1D6EC 1D1KA 1R4NB 3I70A 1WMHB 4LF6L 3FC4A 1N36Q 1E6EB 1JICA 4DAPA 3J80L 4DA2A 5C4XB 3L10B 2EY2A 2NVXH 5BN4A 1C4PA 2E6XA 5LXIB 3NUCA 3BS1A 1STGA 1YD8U 5BN5A 4LDTD 3SFEB 3EFXD 2TMPA 2M17A 5EE0A 3TEZA 1HFGA 5A2QL 3HOYH 3HS0C 1UWXA 2FUHB 1G91A 3L0WB 2WXMA 5C44G 4JC0A 1V1PA 4K3CA 1U4PA 4W9DA 4M00A 2K8HA 5C5LA 4PZ6A 2L11A 2FMCA 2NMQA 4GOPC 4JPSA 1FXIA 3RZFA 4S3SA 1LT5D 2L7RA 5C3JB 1EFWA 1J8IA 2VZKB 3R3OA 1LT3D 2J4XA 1KTKA 2DAFA 1WH3A 4ZRZA 2RHSB 1E0ZA 1VZ6A 4J15A 3CD6A 2N1VA 5CMDA 2ICIA 5M3FB 2MBHA 2I5HA 4C1NK 4DR3L 2F0DA 2ZM6Q 2O4XA 4YSXB 3AE3B 1UBIA 4H0LC 2KT7A 1ACCA 2EY6A 1N6ZA 1NI3A 4B3TL 3W1SC 3TMEA 2KHIA 1WM3A 2R7FA 2ES2A 4C3JH 3PVLA 4WURA 1TWCH 1EOVA 3D32A 3FILB 3EBEA 5ELBA 1YHQA 4X57B 2FINB 2WDTB 2X69A 1J6QA 3CP0A 3VRBB 4JI4L 2JQRB 3O13A 2QMTA 1P98A 1FRRA 1N34L 2B8FA 1S5CD 1E7ZA 2C7HA 3TBLD 4KN7C 1IZ6A 5LL6X 3VUWA 1K51A 2F3WA 3W1GA 4K0KQ 5IT9E 3I3TB 2JA8G 1MJEA 4UHVA 3WALA 1XNRQ 4KJNA 4LFBL 4HCNB 3S16B 3S14B 4WORA 2MX2A 4MH8A 3F8TA 3A55A 1OQYA 3CWIA 1WXMA 3BZKA 4I7ZC 4HPLB 4DV6L 3VR9B 2NTTA 2MA9B 3I91A 1P8LA 1WJ6A 3CMEA 3Q8CA 2EJFC 3U58A 4R4CA 1KDAA 2HJ8A 1L0YB 2K5WA 2AX5A 1J7CA 1YNJD 4LNQA 1ZUD2 2ZJDA 1KLGD 2D11A 2I1KA 4FP5D 4EQ5A 5KNDA 1QVGA 2JA6G 5J18A 1U0LA 2JT4B 1E7PB 1QE6A 4WJPA 4P75A 3T51B 2K8BA 4I7AA 2L3ZA 1TT2A 2WXNA 3WAMA 2ZNVC 1EY7A 2OT2A 2C9WB 4JI8L 4AS1A 3DWAA 4IJLA 2BCOA 2FBWB 1K8AC 5KIXA 3AE7B 1DOXA 3AE5B 2F3VA 5IYDH 4MH0E 5L83A 3VYSA 3HOXH 1WR1A 2BVCA 3RYTA 4A90A 2RR9A 4DUZL 1N32Q 5A35A 3TUOA 4B0MA 1HA5A 4A3DB 2LMCA 3NK9A 1WJJA 2EYJA 3V2TA 4RNAA 2EYMA 3UE0A 4BS9A 1F1HA 1SBBB 2WP8J 2JF5A 2W9NA 4K81A 4XQQA 1WTOA 4TVAB 2PPHA 5I9PA 1VMCA 1WTQA 1WFYA 2JWZA 3CPWA 4A3JH 2LGYA 1G2SA 1ICWA 3TREA 1HTLD 1LYLA 3DXJC 3H9DA 4N59A 4B0EA 3H3VC 2Z6BA 1FRDA 3NHEB 1K83H 3GTQH 1CZPA 2LSSA 2CKZB 2MBBB 3IHPC 1I94L 4YSYB 3J81i 2B29A 2MCNB 3APFA 2G4DB 4AYBB 4X6AH 1SB3C 3TEYA 4R4IA 1MHWC 4WAFA 3R66C 4ZKBB 3HOYG 5KHQA 3T1HL 2V3PA 4XDCA 2INDC 3QAQA 3UF8A 3S15H 1N5XA 2XK5B 2L4NA 3TS2A 4JL9A 1SR3A 3AE8B 2J0TD 4MTKA 3APDA 1Y8PB 1B44D 4LFAL 2JZPA 1PFNA 5IODA 3RZOH 2QJLA 2JZZA 4X3KA 4C3IH 1PH9A 2G5DA 2W3SA 2YLMA 4FULA 4LF8L 4A3KH 2V3SA 1ZKHA 4WIPA 2ZJRA 4WWOA 4X3TA 1NCVA 4BY7B 5F2DA 4K5VA 3Q24A 1QCBD 5AUIA 4X66L 3S1MB 4MM3B 2HE7A 3AU5A 3VAWA 5CTRC 1PZKD 1EEFD 1L4DB 2FCMA 4JIOU 3Q0AA 4BA1I 4GNXC 1FR3A 1H8CA 4FF4A 1BF4A 4K3BA 3PRPB 4QL5A 3GTOH 2F4IA 1Q10A 1MKHA 1GHKA 2C5LC 3IXSA 4RGNA 4C3JG 2WXPA 4GOPA 1RYJA 1L1OC 5H92C 1Y14B 2LVPA 2L8JA 4NAWA 2D2CC 2JXTA 5IO9A 3RMHA 3HUIA 1JE5A 2F0IA 2HCCA 4OIKA 1X6OA 1KOTA 3A56A 3RZDB 2L55A 4IUTA 5LMNW 4G7HC 3OW7A 4QY7A 3GTLB 5C4XH 3HHMA 4JLCA 2LKVA 3TN2A 2UXDQ 1A3TA 3W2DA 4MM3A 2X38A 3K0XA 4JVZA 2B63B 1T3QA 5JHBA 2O2LD 3CF6E 1KLVA 3QWZB 2E2JB 4DQOC 4GLAC 2KQSA 1LLRD 5CV4A 3CCQA 1CM9A 2JJQA 2QEXA 1K9MC 3CIRB 1NSNS 2E75C 3X0WA 5CORA 2LGSA 4E3CA 1N36L 2BA0A 4II3B 2DZMA 1PMRA 2KX0A 1SAPA 2M8SA 4JCVE 4HJKA 1TZ1A 4CHKA 1FGUA 4BBNF 2QGQA 2JEBI 5I6WA 4G7OC 4FXGC 1WTXA 5M3FH 2DYOA 4KY7A 5C4JB 1WM2A 2VZAA 4CKEA 1ILQA 1F2MA 2KCTA 4OWTB 3I4NB 3W5VB 2JRHA 4DHJB 1A62A 3PRZA 1IHZA 1Y1WH 1WR6E 2UXCQ 2R92B 2JVCA 3AM9A 4LNOA 4DV5Q 5TR5A 1ZXHA 5IYDG 1O7IA 1EFID 4A93B 1VLBA 1R9TH 2IT1A 4ZQ3A 3HOXG 1CMXB 1HZ5A 3H1UA 4LJPB 3G7LA 1B9NA 5GAGC 4QUCA 3RN2A 2KFKB 1U4AA 2QSDA 1KRHA 2VZKD 1MFWA 3B9JA 1LTGD 4M1UB 5FKAC 1GHJA 3H8HA 2EJGC 3UDIA 2ZM6L 5KYIA 5IGCA 3ZGZA 4AQYQ 2PYKA 5CR3A 5C4HA 4JBJA 3E3XA 1PDQA 2EKEC 4ABNA 2EKIA 4GS3A 3AI5A 4LNKA 3A8JE 4R1JA 5IGFA 4A3JG 2JPHA 1EY6A 1EU3A 1TS4A 2N88A 5C3EH 1E8ZA 1WGDA 2KYWA 3DHHC 2K5NA 5JJZA 5COYA 3K7AH 3MHSD 5NUCA 1VQEA 3RULA 3GD7A 3S16H 1O78A 3PTFC 3K5MA 2KA7A 1OXXK 3MXPA 3J80E 1J5EQ 2MPMA 3CKIB 3M7GA 2UUCL 3S14H 3H6NA 4ZHPA 2R7ZB 2WKCA 1JB7A 2PJHA 3KUDB 1VJKA 5D6JB 1LTAD 1K8OA 3BIID 4HR7B 3ZNHB 4IPHA 1AW7A 1KAWA 1LGRA 3JYUA 3SD5A 3VDZA 2JQOA 1IYFA 3SK4A 2GI9A 1F52A 3PZ7A 2DZIA 3BVGA 2QF7A 3MWYW 3NQIA 5ISRA 4DR4Q 3CCMA 3ZNGC 1VMPA 1BNZA 3ZYYX 4C3IG 1XNRL 1RIPA 4PYUA 2ZW1A 5EDSA 1LABA 4A3KG 2L52A 3A1QA 1LTTD 4XTCS 1K8RB 5H8YE 2IY5B 4RGTA 2GBKA 1CA6A 4HKZE 1KAAA 1Q90A 2R61A 1VQ5A 3AFPA 3OWEB 5FR6A 4N6EB 3RR5A 3JAMc 4IWQA 4LF4L 3X23A 2HDMA 4X65L 2RSUA 3I72A 2F0KA 2VH1A 5EE9A 1N62A 2G1EA 5JJLA 1CQFA 1TWFB 4JK1C 4IM3A 3M4QA 1VQFA 1HR0W 1OXUA 2KVZA 3L08A 3TEWA 4K6DA 3SGIA 2LEKA 3FMCA 5L37A 4YHHQ 1BOSA 3PO2B 1JWUD 2VNUD 2RPVA 3MP9A 1WGRA 1GC6A 3GB1A 2WHIA 3O65B 2K9XA 1TKWB 1J7BA 1YNND 1PZID 3B6YA 5C4XG 3ZJUA 2PO4A 1MJDA 2DX5B 1FNUA 1HR0Q 3GQBA 1ENFA 3RZWC 3VUYA 2LGIA 5IKCM 1FD6A 1E24A 1W6JA 2RCFA 2DUDA 3I7FA 4GNXA 1FFVA 2RBMA 3ECIA 4M0WB 3ITPA 1B1ZA 2F03A 1XLOA 2L00B 5M5YH 3Q8BA 1T0QC 1U9RA 2F0VA 3MXNB 4MTNA 1AE3A 2WXGA 4HLEA 4KKTA 3P20A 2A1AA 2ASBA 3EC8A 4YXDB 5TSSA 1UWVA 4RF1A 4KI0A 2PZWA 2F52A 2IDYA 1JORA 1HFNA 4FJYA 2NZHA 4DV7Q 3UINB 4E74A 3PV0A 2M1MA 4F7ZA 4BY7H 1XLPA 2B2YC 2JP1A 3NHHA 4CDDC 5C44B 3NTKA 2Y0SG 5M3FG 2BTEA 1XMOQ 2A6ED 4M8AA 5FK9C 1ILPA 2G9DA 3MJWA 1HQRD 3IL8A 2PI2E 3JSVA 2ONQA 1SYFA 3SVMA 1VD2A 1LT4D 3AEBB 1Y1WG 3MXNA 3ZO5B 3CCVA 1IW7D 1SNPA 2BS2B 2DWQA 3PREA 3VFKA 2F3IA 2XVSA 4NKLA 3L54A 2E76C 2ACZB 3S17B 2XWJB 3GE8C 1VQHA 1Q3LA 2CCZA 3IFWB 3A7AB 3NVYA 1WTWA 2AUJD 4BOSC 3RZDH 4US9A 3E6ZX 2WXJA 4HKQA 2BWFA 3EFCA 5LXHA 2K25A 3NWSA 4URKA 3UGBB 1ZXTA 1XNQQ 5DM63 2W82A 2ZT9C 2B63H 4ZRJA 5AUKA 1VZ8A 4F88A 5C3EG 4W9GA 1JWBD 3PLVA 1TU2B 4GU2A 1SSOA 3OLMD 4ZUIA 3KLSX 5GAEC 3TP8A 1HZCA 4B3ML 2KMMA 2KTRB 4ZLTF 2ZW0A 4I6PA 5IT9c 2MBOA 4YTNB 1JWMD 4DR1Q 1O7YA 3EROA 2K05A 4DGZA 5IN7A 2JYEA 4K7WA 3PV1A 2KAJA 4WQOB 1S5BD 4K14A 2K5PA 1EIHA 4RFBA 4BKSA 4HSPA 3EJIA 5M5XB 4B3RQ 2UXDL 4IUMB 1Q7YC 3CAMA 3BJUA 1EYGA 2BH2A 1PYSB 3I55A 1E2WA 4CDCC 2J0KA 3L17A 4K8IA 2MRPA 2X6LA 2KWCA 3QJZA 1HH2P 2MUYA 2VRRB 2RHQB 4KHPL 2HUGA 3J81L 1I6VC 2AWNA 2F0HA 3RD4A 4HCSA 2NB0A 3T1YQ 1SSNA 1UZXB 2KTRA 1ZKOA 4G4KA 1BCPF 3NE5B 5LMNL 5M3MH 2K5DA 1XPOA 3BWUD 3ZTDA 4A93H 3AU4A 4IPGA 2GBRA 1C4CA 5AZFA 4TKOB 4JI7L 3CC7A 4LF9Q 2KHJA 3ENEA 1FIQA 1K0RA 1PRTB 2CW0D 1UEBA 4BXXH 1D4BA 4DNTB 2LHEA 2KEDA 1M4VA 1JMLA 5GXGB 3QK0A 4ANWA 1WX8A 1CKMA 1V81A 2HIVA 2KQ3A 1IBKQ 5CV7A 2KMAA 1MI2A 2XEWA 2UYZB 4REZA 3ZJVA 1V80A 1PZJD 4K2LA 1B2TA 2KMCA 3W1YA 5HURA 2BB6A 2UXCL 2JA5B 4DV5L 4DHJD 4EZKA 1DM0B 1YZ6A 4HIDA 2FIFA 1OTRB 4RM9A 3RNBC 3U52E 4M01A 2Y0SE 2L05A 4JE3B 4MDKE 2OCEA 1V43A 2KHSA 2R7ZH 1BR9A 3VH3B 2H4OA 1RRBA 5EBCA 3TP7A 1ZXIA 2NVYB 1VDVA 1QZHA 2WXIA 1Z2MA 1X1MA 4WJNA 2K6DB 3QIAA 4MSQB 1BBWA 3VR5A 1OTCA 1E1TA 2OTJA 2BYVE 2PCFB 1IYVA 2WB1G 4G0NB 3DWMA 3AMUA 3KFUA 1SNOA 1J5EL 1DJRD 3NPPA 1G2TA 4K7UA 3ZNZB 1R7SA 3I4OA 1A3VA 4DR3Q 4BY7G 1OEYA 2BBCA 4P71A 2XN9C 4X62Q 1PDXA 4QB4A 3TL5A 3ERQA 3NTIA 1IBLL 4B3TQ 3MHZA 1EY0A 3VYUA 1VQMA 4DR4L 4FVMA 4B9WA 4XX5A 4CDEC 1EZ8A 3KF8B 1U4RA 1H9KA 4KY5A 4HJ9A 1NR4A 3NOBA 1TWGH 1LTBD 4MEMA 3PO2H 1EY8A 5DEHA 3VRAB 4K5WA 1C9OA 1HCZA 2Z0EB 1HA6A 1HZAA 4QUFA 1N34Q 1PH5A 3C0RB 3TDQA 3P63A 2KX3A 4HXDA 3HVZA 2B2YA 3CF5A 1RWSA 3TEXA 2VB2X 5EAYA 4JI5Q 2CWPA 3M7NA 4UDUC 1TWCB 2B63G 2EQSA 3I9V1 1CFMA 1VQNA 1SN8A 1TGZB 4A8XC 4YHHL 1J0GA 1A6XA 1L4ZB 2ZPYA 2REXA 3KF8A 2G45B 1W2BA 2JY6A 4OZCA 4OZAA 4DK6C 1EYAA 2QC8A 3MFGA 1UE1A 3BK1A 1G51A 3L9AX 1Q46A 4C4VB 3DWPA 2MNAA 3R2TA 1Y8NB 3AEEB 2KANA 4MJSA 4DK5A 1QVCA 1PTOF 1DOIA 4JI0L 2KWDA 1UH6A 3KBGA 1HR0L 2UUAQ 1TYGB 3HZXA 3JC66 4PMBA 1HXYD 3K57A 2GBJA 4W9EA 4B95A 2PE6B 3ND9A 1TKEA 4G50A 4BBNC 2D3AA 3DCGA 3I63C 4JI8Q 3V6EB 3GTGB 4LMQD 3FPPA 1FVIA 4ID6A 3PQIA 5CX3A 3ETRA 3OOCA 3IG3A 2LXCA 4DDID 5CBEE 5M3MG 3PPAA 3TIXA 4F7XA 5J1ZA 1Q86C 1HZ9A 1VQ8A 1RFKA 3TCAA 4FXKC 5EQ0A 4A93G 5JPMC 1OGWA 4C4VA 1G291 1O80A 4FHKA 2K22A 4DV7L 3S17H 2KECA 3NWTA 4CJ2C 3M62B 1Q0WB 1WYDA 2MGSA 1WJNA 5C6AA 2HDLA 2WXKA 3IVFA 1XCQL 3AEDB 1ROEA 4BXXG 4EEWA 1FCLA 3D6CA 2JRIB 4YY3L 2WB1E 1EL0A 4K8JA 4KLKA 1SF0A 2SNSA 1PYBA 1PH3A 2K39A 5FO7B 2HD3A 3HOXB 4U68A 2KN4A 3IKJA 3IT6B 1FYCA 3OMCA 3PZ8A 3PRMB 4YT0B 1Z7TA 4CGYB 4KKSA 3VH4B 5BYRA 1KNAA 1TQOA 4DAYB 2QCPX 3IT4B 1GNUA 3KLRA 1F2LA 3FKIB 3D4RA 1TKYA 2EELA 2B2TC 3T1HQ 3R7RA 2L0CA 2R7ZG 3CSFA 5JZEB 4NY0A 1V8CA 1BBXC 1YJ1A 4EUTA 2A68D 4A3JB 4BKSD 2MWSB 1V49A 5IOCA 3CPFA 2EY1A 1XNQL 1KXLA 4OWXB 3OYYA 3K5OA 4LF8Q 1E10A 2A6HC 3OWFA 5LL6S 2KLGA 3NS8A 1WWTA 1K3RA 1V8QA 4X66Q 1EF5A 2ZCBA 4DAYA 1HNWL 4UP8A 5ELFA 1N61A 3DBHB 1SJED 3P4QB 1K28A 2GOWA 1E8YA 2RF4A 4L1BA 3RMKC 3V6CB 4IFDJ 4W9JA 4B3RL 1F0ZA 5AFWA 5GQOA 3RZOB 2KOXA 1K0SA 1JC7A 5CV8A 4C3IB 1IUEA 2NBVB 4JI6Q 2V4DA 1VQCA 4A3KB 1E9MA 1T9HA 2VXWA 4PV1C 4APVA 4KGSA 4DDGD 3CC2A 3A9KB 4ANXA 3J81j 1H4RA 3SFDB 2N78A 3HM6X 1KRTA 3PO2G 2LRUA 2PKOA 4AOFA 4TQUS 3T1YL 5IA7A 1UF0A 1FO4A 4L5SA 3SK8A 3NBHB 2CQOA 1ZOYB 1C9FA 2J7QB 1TY2A 3GP7A 1KLUD 2KD0A 5JHAA 2JA5H 2IO0B 2N9KA 4HPPA 1OXSC 3H7PB 2N9LA 4ME3A 1QOGA 1WZ0A 4C7ZA 4H13C 2B76B 5BMGA 2UUBL 3MHBA 3WIMA 1GM5A 4GDLB 3WAPA 1XX8A 4XQJA 4G11A 2KDFB 5FOBB 2UU9L 1XT9B 5FO9B 2ZVOA 1PRTD 3FHWA 1E5WA 1ASZA 4ARCA 1IBKL 4P1CC 3A9KA 2ZTCA 5EE3A 1R4QB 2OOBB 1SLJA 4CO7A 2F0FA 1WI5A 1XYIA 4HIMA 3NG0A 3NBHA 1P16A 2F4VQ 2KVRA 2VS1A 3DUZA 5CV9A 1PFDA 1C3TA 3H7PA 2KJXA 3J7A5 4PS7A 3KUPA 4JPBW 3BDLA 1SMYC 2ATWA 2JA7H 4TKNA 1JALA 4GDLA 5E6PA 3I56A 1STNA 2WGSA 3BK2A 3HOUH 4BKGA 4EOYA 1H9SA 1HJPA 4HK2A 3J81E 1CJEA 3QCAA 4P73A 3KBXA 1WRIA 2EDGA 3NXWA 3FRPB 4WAAA 3AEVA 5D3DA 1A3UA 2MJ8A 2HDEA 2RGFA 2RDFA 3P4SB 2Y0SB 4KV2A 2K50A 3P1HA 1TWAB 2MP2B 4CKCA 4X62L 2DHZA 2LHDA 2IO2B 3KVFB 4NB3A 5CV6A 5E4XA 1MG8A 4CJ0B 3M85A 2XBBC 1KDCA 1A5RA 3P1MA 2NPTA 1S5ED 3PCOB 1Y1WB 4XYCA 3T3OA 4BWGB 2QILA 1UWMA 1YEZA 3TJPA 3CMMB 2TSSA 4DF7A 2G3QB 4J6IA 1R9TB 3KH0A 4RM8A 1YX5B 2H5XA 5E7NA 4E6IA 2UUCQ 2KCCA 2HCIA 2VW9A 1EQRA 1I4GA 4WRDA 2LXAA 1LTLA 4KN4C 1V5OA 1ESRA 1T0SC 4XWWA 2MP2A 4JBMA 1QOFA 2K1FA 2BF8B 3H09A 1FM0D 5C3EB 4JI5L 3V05A 1KDBA 3PUXA 1PFMA 3HOZB 4HEDA 1B9RA 1LTID 3K7AB 3TMPB 2NZ1D 4JBKA 2VUMH 4DKAC 3NP8A 4KD4A 2NBUA 4A3PA 4IWPA 2BE5C 2W54A 3ZUNA 3T8MA 1MG4A 1HTQA 2MQJA 1D7QA 3GTGH 3L7ZC 5IWAQ 2L15A 4LF4Q 1JJCB 4X65Q 5C0XJ 1WZ3A 2LMCB 3Q3NC 4OVVA 2FXQA 5JH5C 3OIQA 4HCEA 1BCPC 2MEKA 3TQYA 4GKKQ 1JJGA 2C35B 2UUAL 2MHVA 1WX7A 3GZNI 4NXNQ 1RKNA 5FJ8H 1J7AA 1SMXA 2E2HB 1UBQA 4RMAA 2BDOA 3C2PA 1HQMC
chains in the Genus database with same CATH topology
1K52A 2J42A 2OF1A 1KFYB 5JAVA 1Q8IA 1STAA 1EQVA 3MTSA 3MVVA 2LFIA 1OFFA 1HTPA 1L6UA 3SR1A 1C4QA 1I4XA 1II3A 2BOSA 3K58A 4IUQA 5C4ZA 4RKBA 2M00A 4HEA1 3AEGB 1IKMA 3AMZA 2WKDA 2PMVA 3NVZA 4HAEA 1L6VA 4KV6A 1F9RA 5KNBA 5M5YB 4A9AA 3U7ZA 1D5XC 4HMIA 4NP5A 5DAUA 1EIGA 2WB1B 4NAWB 1GUOA 4RGMA 4KK7A 1C77A 2M19A 5KRUA 4L63B 2D62A 4RF0A 4OL7A 3C1EA 5DNFA 2LJIA 4OHJA 1SE3A 2VB3X 2PTLA 5I2XA 2W3RA 1ESFA 4YWGG 2WQYB 2Z1CA 3QJYA 2J7ZA 2F0MA 2WLBA 1I50B 1GJXA 1Y8OB 1FNVA 1EYCA 1D1IA 3GTJB 3K5NA 4V190 3N9YC 3T3NA 1IGCA 1B3AA 3B2FA 1PTOC 1B9MA 3DHQA 1EY5A 2K0PA 4RGOS 3W1SA 3D8GA 4AQ7A 3GTKB 4A3EB 3Q8AA 1ZYRC 1SNCA 1N63A 3ABVB 4WJWA 1GB4A 5C3XA 3FAHA 2BA1A 1TS3A 4OZBA 1JWAD 1RDPD 2F0NA 2Q8RE 3HRDD 3WOEA 4U673 2EOTA 3IFTA 2JX5A 2MJDA 4Q5VA 3W5UB 2SOBA 3CHBD 4OGQC 3LXFA 3U2SC 5M3MB 4EQNA 5EKKA 2BYTA 3SR6A 1SYCA 3IAS1 2K5QA 4F87A 2QEJC 1RJTA 5LHY1 5HHDG 3F2UA 2JSOA 2QKIC 5I9OA 4ARIA 4FXCA 2W55A 1S4ZA 3KLSA 2KVMA 2WU5B 2RVLA 2E2DC 1YQ4B 3K59A 4LK1C 4HSVA 1L5PA 1G6ZA 3E5SA 4NZLB 1BMLC 5HFYA 1X32A 2IX3A 2CVRA 4O1NA 1Y69U 1XEEA 2KUMA 4DU9A 2N7JA 2HQEA 1O7ZA 4KTAA 5A2QE 4YIJA 1AZQA 2LS01 1T6BX 3KWVA 1QJOA 1SYDA 3K0YA 2A69C 4DXFA 1YJIA 2SAKA 4XT3B 3NQTA 2Y5CA 2C5CA 1C79A 1PGXA 3MC0B 1IGDA 2ZXRA 5J22A 1Z47A 2M9VA 2IX1A 5DM73 4CJ1B 5HG2A 2BS4B 1AP0A 2PPBC 1JW9D 1GAQB 1H9MA 5HI1A 5G5HA 1TWGB 5JOBA 3TP6A 2WDVB 1AZPA 1SIJA 1TR5A 2IGDA 1JR0D 2KEEA 1B4OA 4QF4A 4ZHOA 1A15A 2N0SB 2EYFA 4KKUA 1CZGA 4FF2A 3IAM1 2L5TA 4C1NI 2WXRA 1EY4A 2B2UC 2K3UA 3EUB2 1S5DD 2B39A 5D3IB 4KGRA 3R2IA 3N52A 5C0XH 5IGDA 2PZUA 2ICEC 1EZ6A 1ML0D 4BA2I 4RAUC 2I46A 3BVMA 1PGBA 2B2VC 1BDOA 1GUSA 1SNMA 2IJ0A 1F2RC 3C3LA 3L3OC 2XSCA 2H89B 2KOLA 1IYUA 1I4PA 4XWTA 2E3TA 5CGKA 4QCLA 1QQRA 4C3HB 3T13A 4GZYC 2V4IB 1L0VB 1Y1VB 2YEPB 1VF5C 3MJ5A 2WXOA 1QOHA 2M2LA 5ELCA 2WDRB 3UI3A 2WXHA 3NVVA 2PW9A 3T53B 4QMGA 4OO1I 4CBVA 2A5HA 2F0QA 4X3SA 4ZUJA 4RA8A 1AWDA 3LWUA 4MT5A 1STEA 4EE2A 1YNJC 1UAPA 1UUPA 2I38A 2PIAA 1HUMA 1ET6A 3EVQA 5KNCA 1FGBD 2PZTA 2XWBB 1V97A 1DCZA 1VRAB 1JCKB 1GUNA 3AN1A 5CBAE 2K32A 1XXGA 2LY7A 2DNCA 2CJNA 2F0TA 1TKGA 1N5WA 3I4LA 4DK1A 5FLXL 4KKIA 5BYSA 2F0LA 2F0GA 3Q8EA 3J9CA 1HRJA 1EYDA 3Q22A 2EYPA 1PLFA 2GA4B 1M8AA 1MD2D 3PMFA 1QF6A 2Q5WD 4P16A 4ITKA 4K5XA 1C8CA 1XO3A 3I3CA 5EKIA 3OIPA 5C0XG 3P75A 3RFZB 1DGJA 1JB3A 3PIP3 5KEEA 1KH0A 3T16A 4C2MB 4JX1C 3AE4B 2FUG1 1K8MA 1PXUA 2JA7B 5EJWA 3AECB 1ZE3D 5T8IA 2DYMA 5G3LD 2NBFA 3HOUB 5C2TB 2WDQB 4PMCA 2NYZD 4L23A 1E2ZA 2B2WC 3W3AA 3C46A 1DOKA 4NW2A 3VR6A 4L6TB 3U9SA 1CT1D 4ULLA 2NVTB 1SDFA 2J52A 3CU7A 3TP5A 5D14A 2IGGA 2L9HA 4HN7A 1FNWA 3BDOA 4R9WA 1EWHA 1MSHA 1O7LA 4WH4A 1ZPSA 3BYTB 2GRIA 1RHPA 3S1RB 1STBA 2WIIB 5E6JA 3I57A 1Q12A 4WFN3 4D2KA 4US8A 5C5MA 1SXTA 4L2YA 3TBIB 3VYTA 1JROA 4CQNA 1NAPA 2VUMB 1F9QA 1FXAA 2C9OA 4JWUC 4O42A 4A55A 4C80A 2B8GA 2RKSA 3I90A 3OPOA 4V0BA 1JRPA 1GUWA 4H44C 1Q1EA 5I4DA 2K7VA 3AU7A 2FHTA 1A70A 3AEFB 2EYHA 1SE2A 2EXZA 2E2IB 1WSPA 2EY5A 1NR2A 3LNNA 4HMJA 1BXTA 4K2KA 3SHLA 4IDIA 2MJ3A 3D4WA 3VYRA 1GUTA 3M4OB 5T1GA 1DD2A 3P4PB 3DM1A 4A3IB 4RKLA 1L0XB 3LB8C 4XIGS 4MACA 4ZYSA 1B50A 4N9PA 4WQMA 3E56A 2D5DA 5KYLA 1TS2A 4J1MA 1F77A 4CHTB 2LUMA 1QB5D 2MH7A 2WAQB 1JOKA 3KQ4A 5JEAJ 4IKGA 2FMMA 3C1FA 4OO1H 2FJ2A 1UGJA 4YTMB 2RSNA 3L4PA 4Z9CB 3DWGC 3GV6A 3AE6B 1OXVA 1TS5A 2EYOA 4RCNA 4KKJA 4J8QA 2JXMB 2F0UA 3FVQA 1WYGA 3AEAB 1JOOA 4KHVA 3P42A 2IX0A 1JE4A 5CYUA 1TWHB 2L32A 1VCIA 2NN6I 3AB5A 1QNKA 1JOQA 2E74C 2AQ2B 1ONLA 1HPCA 3URYA 2NTSA 1B53A 4ZRPA 3UI2A 2INNE 1H9SB 2K04A 2PNRC 2EPBA 1YNNC 1DOLA 2K1BA 1DOMA 4MHEA 1WTRA 3QG1A 1NEKB 1A2UA 2F0PA 4IFDI 2J53A 5BMIA 3BDCA 1PRTF 2EE1A 3EGRA 3HOWB 1GXDC 1YN3A 4A3MB 4XDXA 3EA6A 4OIJA 3PO0A 3SEBA 1ENAA 4LK0M 2L83A 3S2DB 2WP9B 3NS1A 1T5XD 3BVZA 1STHA 1RODA 2A6EC 4USAA 4HROA 1QLBB 1H9RA 2EYLA 1IW7C 1YJJA 1GB1A 4C3HG 5FR3A 3IAYA 2WS3B 4WWMA 4FF1A 3D6WA 1PFBA 1LTSD 1OQQA 3D31A 3U4EG 4P6VF 2I07B 5FLXE 3P7JA 5K36H 3CQZB 3Q8CA 3RPFC 4DXGA 4EGVA 1C78A 2LFNA 5EKLA 3J7AF 3V3XA 1EOTA 3NZ3A 4EQOA 3S2HB 3ZQ4A 3BYYB 4MIUA 4R8NA 4XXEA 3S1QB 2K28A 3PUZA 3DMUA 1F2YA 1D5ZC 3S1NB 1YN5A 2M0AA 4QIWB 3I73A 3H91A 2F0SA 1C4AA 1TVXA 1I7HA 3TZDA 4IQZA 2OHFA 4TRDA 1OQRA 1X3QA 4OO1G 2B2TA 1VZ7A 1AN8A 2XIWA 1HUNA 1QOAA 4IUPA 3GTPB 1FFUA 2ON8A 4LLGM 4KMUC 5JVH3 3KWLA 1EWCA 1NYQA 3FILA 2KCNA 4OVZA 2PMZB 2Y3AA 5EPKA 2H1EA 1CQVA 1ENCA 1LV9A 2CW0C 2IW3A 2R93B 3HVDA 1ZDXA 1MPEA 2SNMA 3SXHA 2JWUA 4H2AA 3Q6SA 3ZJTA 1R4PB 2PVOD 2CU3A 3EQLC 5C0XI 2XRQD 3FEWX 1ET9A 2DY7A 1Z6HA 4OW0A 2WXFA 2JU6X 4J3OD 1BQQT 2PQEA 2ZXPA 4R3DA 1D5MC 1F9PA 4HRSA 1CK1A 4ZK9B 3DWQA 3H6MA 3IFDA 4KHZA 2A73B 2L1BA 1I4HA 1WCMB 4G7ZC 3M4YA 1MI0A 3MA2B 3NSWA 4BY1B 4ZRQA 4XQNA 3HGBA 1AYFA 3A8KE 1J9OA 3QO2A 2RMMA 5C3WA 5BYQA 5JPNC 3K5LA 2F0JA 1LTRD 3WOFA 1OXTA 2L12A 2F1MA 5K36G 3OSOA 2IGHA 3RUZA 1LT6D 2R3ZA 2RQXA 4TSSA 2SDFA 3I4MB 1AEXA 2NN6H 4RCOA 2Z4HA 1STYA 4NDXA 1SNQA 1YNTE 1U4MA 1CTMA 4NAMA 1SJHD 3AB9A 5BN3A 4DN4M 1FD7D 3HKZB 4BBSB 4EQPA 3QB3A 1BO0A 5JEAH 2FE8A 3DEOA 1EY9A 5I2YA 4FF3A 1K53A 2INPE 4IFDH 4EVOA 4L8JA 1BCPB 4DAVA 3VA7A 1MVKA 2EZVA 1SYBA 3MZ5A 1CI3M 1GUGA 4IUVA 1CZWA 4P2CB 2A74C 3HP3A 1W6KA 1FMAD 1NUCA 2RDHA 5IGGA 1RM6C 1GPXA 1LO5D 3BG3A 5G5GA 2BS3B 3NRZA 1P7EA 4ZKCB 3KK7A 1XLNA 2WU2B 3W9CB 3SDZA 2AQ3B 4ZOHC 1RCVD 1D2BA 3B2GA 2V0GA 4Q0FA 3VA5A 1NENB 2Q8TA 1I6HB 4KD3A 5EGTA 1WD1A 2WNMA 2A68C 1I4RA 2KACA 4YTPB 1SEBD 1TZOA 3E9SA 1WXQA 2I2YA 4H7BA 4LJZC 5HGTA 2WACA 4IUUA 3H0GB 4A3BB 3X3MA 1ZEQX 4ODGA 1NVID 1UNSA 1OO9B 1X3PA 4Y7NB 1RTNA 2A6HD 4RWSC 2KDMA 1VF7A 1AFPA 3QOLA 1HEZE 4IURA 3T4AC 2K33A 1EM7A 1I3QB 5K5PA 3AV8A 3VQIA 4K6LA 4FNFA 2QDBA 5J39A 2NWGA 3P4RB 2G9HD 5IGBA 2YYZA 4RHSA 2IL8A 2XNAC 3D4DA 1NYRA 2OEDA 3LYYA 1MBYA 4F8MA 2NN6G 1K50A 2YU9B 2WV6D 1PTOB 1PRTC 3N6RA 1EU4A 1SNDA 4MN3A 1VR9A 1SE4A 3AH7A 2BB5A 1JQYD 3PO3B 5JEAG 1FCCC 1PYWD 3A8IE 4IFDG 1YN4A 2ZXOA 3HEJA 3J7AV 2WINB 5EPLA 1IL8A 4R8IA 2D9UA 4DNRB 5IIFA 1XF5L 1IKLA 1V1OA 4ILWA 1WTPA 1SMYD 3HG9A 1KNEA 3SE0A 3K6OA 3J7YW 1QOBA 2O5JC 4N9TA 3AE9B 3H94A 1WD0A 1KABA 3JAML 4M0WA 2IPKD 4JWSC 2CHBD 2GB1A 1BUVT 1XWEA 2RA4A 1ZDVA 2K03A 1C76A 1I4QA 5E4WC 3Q69A 3NVWA 2F0EA 4B08A 1A2TA 2K01A 5IGEA 4RH6A 3PIO3 2FFKB 2F0OA 3HOVB 1QNUA 5JVG3 2X6GA 1DOYA 2V3NA 5E3FA 3TZUA 1KF6B 2PW5A 4GLSC 1XTCD 1PUTA 4C7YA 1T5EA 5CC4A 3PUYA 3Q8FA 4XDDA 1PGAA 4NMZA 2BE5D 1RF2D 1S5FD 2CQAA 3M3YB 2CJOA 1YQ3B 2JA8B 3GO5A 1BCPD 1HHVA 3GS2A 3VR8B 3CRLC 3OMGA 3VR3A 2ID0A 2JE6I 2KQ4X 3ONAB 2JEAI 3WCQA 3MXGA 2Z4IA 4J6HA 3R8BA 4DFAA 4XYOA 1SFOB 3MEHA 1E0BA 1MGSA 1G8ZD 2EJMA 4HTHA 3LWEA 2JA6B 4Q2JA 5EE1A 4FXDA 3SK5A 5M5WB 5LNK1 1EWYC 3MFYA 4TMAB 3X3NA 5ELEA 3I8ZA 3GTMB 3QWNA 1LACA 5D65A 1EEID 3V96A 5BMHA 2NVQB 2JYTA 1F2RI 2BDNA 1RD9D 4IZ8A 1BUIC 4PNYA 2OEOA 1RTOA 5T1IA 1QG7A 5E1FA 5IT9L 3PUWA 5KGUA 3SK6A 3RLFA 3BZDB 3E0JA 4PT5A 1DONA 1TJEA 2B2UA 5I6YA 2NVXB 5EBDA 1H9JA 5G3LF 3PUVA 3HOYB 4X3UA 2JYOA 2XRSD 1TIID 2PVGC 4IN3A 4KY6A 2N55A 2DLBA 2WXQA 3QOJA 4PQXA 2RDGA 1QKZA 2HTME 4KGTA 1JQ4A 3A54A 1PTOH 2B2VA 5D7GA 3FPUB 4UAIA 1TY0A 4N58A 1CA5A 2DY8A 2AUKA 1QWYA 2L1AA 2R6GA 2AWOA 1Y56A 3NUHB 4IUNA 4C3JB 2JSVX 1DXMA 3DEPA 3Q23A 1VDZA 1XLQA 2Z8LA 2QIEB 1PTOD 1QILA 1EQTA 4XT1B 2EVBA 4A6QA 4LAAA 4YSZB 2O5IC 2OXPA 5CV5A 4GDKB 1ZYRD 3HRZC 4TQ1A 2Y5PA 3WDNA 3CRKC 4A3GB 4PMWA 2RSOA 1F2ZA 4BBRB 3NTHA 4CKBA 1P7FA 1WTVA 4KX6B 1FEHA 2BT6A 1YMHE 3G6JB 2H88B 4FO2A 1N60A 3ND8A 5FO8B 3NBIA 4JBWA 3MAQA 2WXLA 1Q1BA 4KJOA 1WVLA 2AQ1B 1UEAB 1MHXA 1WGKA 1JWSD 1MHHE 3S9WA 4HJGE 4TQ0A 1U4LA 2IWHA 5M9OA 3FDTA 4G57A 3A7LA 4XYQA 4LTUA 3AE2B 1DZ1A 2DN8A 2F0WA 2YEPF 2K6AA 1XCTL 1F9SA 1HZ6A 4RHRA 1GOZA 2BW2A 2PW7A 1K83B 3VR2A 3GTQB 3VR4A 4I65A 1IBXB 3GV3A 1DYQA 4ZAIA 5JXVA 4DK0A 5MPOA 3C8YA 2ENBA 2D5GA 2A69D 3MXUA 3S15B 2MP1A 1CHQD 1QT9A 2DNEA 4B9XA 1CHPD 4ME5A 3LX0A 4FYDA 3JAME 5ELDA 2DBYA 1SYGA 2B2WA 3D3RA 3OHXC 4XE0A 4NJCA 1IBXA 1E2VA 3AE1B 2M56B 2PLPA 4IALA 3U9OA 4A3FB 3T56B 1ZP0B 5EPJA 2SEBD 1SYEA 2MJEA 3GTOB 2NUCA 3R93A 4C56C 1V1PB 1MSGA 2Q8IB 1C48A 3TSSA 1D6EC 1D1KA 3I70A 3FC4A 1E6EB 1JICA 4DAPA 3J80L 4DA2A 5C4XB 2EY2A 5BN4A 1C4PA 2E6XA 3NUCA 3BS1A 1STGA 3SFEB 5BN5A 3EFXD 2TMPA 5EE0A 3TEZA 1HFGA 5A2QL 3HS0C 1UWXA 1G91A 2WXMA 1V1PA 1U4PA 5C5LA 2NMQA 2L11A 2FMCA 4JPSA 1FXIA 4S3SA 1LT5D 5C3JB 1J8IA 2VZKB 3R3OA 1LT3D 2J4XA 1KTKA 4ZRZA 1E0ZA 1VZ6A 5CMDA 2ICIA 5M3FB 4C1NK 4YSXB 2F0DA 2O4XA 3AE3B 4H0LC 1ACCA 2EY6A 1NI3A 3TMEA 4WURA 3FILB 5ELBA 2FINB 2X69A 3VRBB 2JQRB 3O13A 2QMTA 1FRRA 2B8FA 1S5CD 4KN7C 5LL6X 1K51A 2F3WA 5IT9E 4KJNA 3S16B 3S14B 4WORA 4MH8A 3A55A 3CWIA 4I7ZC 3VR9B 2NTTA 3I91A 2EJFC 1KDAA 1L0YB 2K5WA 2AX5A 1J7CA 1YNJD 1ZUD2 1KLGD 4FP5D 5KNDA 1E7PB 1QE6A 3T51B 2WXNA 1TT2A 1EY7A 2OT2A 4AS1A 3DWAA 2BCOA 2FBWB 3AE7B 5KIXA 1DOXA 3AE5B 2F3VA 3VYSA 4A90A 5A35A 3TUOA 4B0MA 1HA5A 4A3DB 2LMCA 3NK9A 4RNAA 2EYJA 3V2TA 2EYMA 4BS9A 1SBBB 2WP8J 4XQQA 1WTOA 5I9PA 1VMCA 1WTQA 3VRAB 1G2SA 1ICWA 4N59A 1HTLD 4B0EA 3DXJC 3H3VC 1FRDA 1CZPA 4YSYB 3TEYA 4AYBB 1SB3C 4WAFA 4ZKBB 4XDCA 2V3PA 1N5XA 2L4NA 3AE8B 2J0TD 1Y8PB 1B44D 2JZPA 1PFNA 5IODA 2QJLA 4X3KA 2W3SA 4WIPA 4X3TA 1NCVA 4BY7B 5F2DA 4K5VA 3Q24A 1QCBD 5AUIA 3S1MB 4MM3B 1PZKD 1EEFD 1L4DB 3Q0AA 4BA1I 1FR3A 4FF4A 1BF4A 1Q10A 2F4IA 3IXSA 1GHKA 4RGNA 4C3JG 2WXPA 1RYJA 5H92C 2D2CC 2JXTA 3RMHA 3HUIA 2F0IA 2HCCA 4OIKA 3A56A 3RZDB 2L55A 4IUTA 3GTLB 4G7HC 3OW7A 2LKVA 3TN2A 1A3TA 3W2DA 2X38A 2B63B 1T3QA 2O2LD 4DQOC 2E2JB 1LLRD 5CV4A 1CM9A 3CIRB 1NSNS 2E75C 5CORA 2BA0A 1PMRA 1SAPA 2JEBI 5I6WA 4G7OC 4FXGC 1WTXA 2DYOA 4KY7A 5C4JB 4CKEA 1ILQA 1F2MA 3I4NB 3W5VB 1IHZA 3AM9A 2R92B 1ZXHA 4A93B 1VLBA 1EFID 2IT1A 4ZQ3A 1HZ5A 3G7LA 1B9NA 3B9JA 4QUCA 2QSDA 2VZKD 1KRHA 1LTGD 4M1UB 5FKAC 1GHJA 3H8HA 2EJGC 5KYIA 5IGCA 3ZGZA 2PYKA 5CR3A 5C4HA 1PDQA 4ABNA 2EKIA 3A8JE 5IGFA 1EY6A 1EU3A 1TS4A 2N88A 5JJZA 5COYA 5NUCA 3GD7A 1O78A 3K5MA 2KA7A 1OXXK 3MXPA 3J80E 4IOIE 2MPMA 3CKIB 3M7GA 4ZHPA 2R7ZB 2WKCA 1VJKA 1LTAD 1K8OA 3BIID 4HR7B 1AW7A 3SK4A 2GI9A 3PZ7A 3BVGA 2QF7A 3MWYW 3NQIA 5ISRA 1VMPA 1BNZA 3ZYYX 4C3IG 2ZW1A 1LABA 2L52A 5H8YE 1LTTD 4XTCS 4RGTA 1CA6A 4HKZE 1KAAA 1Q90A 2R61A 3OWEB 4N6EB 2HDMA 5EE9A 3I72A 2F0KA 1N62A 2G1EA 1CQFA 1TWFB 4JK1C 1OXUA 3TEWA 4K6DA 2LEKA 3FMCA 1BOSA 3PO2B 1JWUD 2VNUD 2RPVA 3MP9A 3GB1A 2K9XA 1TKWB 1J7BA 1YNND 1PZID 3ZJUA 2PO4A 1FNUA 3GQBA 1ENFA 1FD6A 2LGIA 1W6JA 1FFVA 2RBMA 3ITPA 1B1ZA 2F03A 1XLOA 3Q8BA 1U9RA 2F0VA 2WXGA 4KKTA 3P20A 4YXDB 5TSSA 4RF1A 4KI0A 2PZWA 2IDYA 1JORA 1HFNA 3PV0A 1XLPA 2B2YC 2JP1A 3NHHA 5C44B 3NTKA 2BTEA 1ILPA 2A6ED 4M8AA 5FK9C 2G9DA 1HQRD 3IL8A 2ONQA 1SYFA 3SVMA 1LT4D 3AEBB 3MXNA 1IW7D 1SNPA 2BS2B 2DWQA 2XVSA 4NKLA 2E76C 2ACZB 3S17B 2XWJB 1Q3LA 3A7AB 3NVYA 1WTWA 2AUJD 4US9A 3E6ZX 2WXJA 4HKQA 3NWSA 1ZXTA 2W82A 5DM63 5AUKA 2ZT9C 1VZ8A 4F88A 1JWBD 1TU2B 1SSOA 4ZUIA 3KLSX 2KMMA 3TP8A 2ZW0A 4ZLTF 4YTNB 1JWMD 1O7YA 3EROA 2K05A 4DGZA 2JYEA 2KAJA 1S5BD 4K14A 2K5PA 1EIHA 4RFBA 4HSPA 3EJIA 5M5XB 1E2WA 4K8IA 2X6LA 2MUYA 2HUGA 3J81L 1I6VC 2AWNA 2F0HA 3RD4A 4HCSA 2NB0A 1SSNA 1ZKOA 4G4KA 1BCPF 3NE5B 2K5DA 3BWUD 1C4CA 4TKOB 1FIQA 1PRTB 2CW0D 1D4BA 4DNTB 2LHEA 2KEDA 1M4VA 1JMLA 5GXGB 2KQ3A 5CV7A 4REZA 1MI2A 3ZJVA 1PZJD 4K2LA 1B2TA 5HURA 2BB6A 2JA5B 1DM0B 3U52E 4JE3B 1V43A 2KHSA 1BR9A 2H4OA 5EBCA 3TP7A 1ZXIA 2NVYB 1VDVA 2WXIA 3QIAA 3VR5A 2PCFB 1IYVA 3DWMA 3AMUA 1SNOA 1DJRD 3NPPA 1G2TA 1R7SA 1A3VA 2BBCA 2XN9C 1PDXA 4QB4A 3ERQA 3NTIA 3MHZA 1EY0A 3VYUA 4FVMA 4B9WA 1EZ8A 1U4RA 1H9KA 4KY5A 1NR4A 1LTBD 1EY8A 5DEHA 4K5WA 1HCZA 1HA6A 4QUFA 3TDQA 3P63A 3HVZA 2B2YA 1RWSA 3TEXA 2VB2X 3M7NA 4UDUC 1TWCB 3I9V1 1CFMA 4A8XC 1A6XA 1L4ZB 4OZCA 3KF8A 4OZAA 1EYAA 3MFGA 3BK1A 3L9AX 3DWPA 3R2TA 1Y8NB 3AEEB 1PTOF 1DOIA 2KWDA 3KBGA 1TYGB 3HZXA 4PMBA 1HXYD 3K57A 3ND9A 1TKEA 3GTGB 4LMQD 3FPPA 4ID6A 3ETRA 3OOCA 5CBEE 4F7XA 5J1ZA 1RFKA 4FXKC 5EQ0A 5JPMC 1G291 1O80A 2K22A 2KECA 3NWTA 4CJ2C 2MGSA 5C6AA 2HDLA 2WXKA 1XCQL 3AEDB 1ROEA 1FCLA 3D6CA 1EL0A 4K8JA 1SF0A 2SNSA 5FO7B 3HOXB 2KN4A 4U68A 3IT6B 3IKJA 3PZ8A 1FYCA 3OMCA 4YT0B 1Z7TA 4CGYB 4KKSA 5BYRA 1KNAA 1TQOA 2QCPX 3IT4B 1F2LA 3KLRA 3FKIB 3D4RA 1TKYA 2EELA 2B2TC 2L0CA 1V8CA 1BBXC 2A68D 4A3JB 5IOCA 2EY1A 3K5OA 1E10A 2A6HC 3OWFA 5LL6S 1WWTA 1V8QA 4DAYA 1N61A 5ELFA 1SJED 3P4QB 4L1BA 4IFDJ 1F0ZA 5AFWA 3RZOB 1JC7A 5CV8A 4C3IB 1IUEA 2V4DA 4A3KB 1E9MA 2VXWA 4PV1C 4KGSA 3SFDB 2PKOA 4TQUS 1FO4A 3SK8A 1ZOYB 1C9FA 1TY2A 3GP7A 1KLUD 2N9KA 1OXSC 2N9LA 1QOGA 4C7ZA 4H13C 2B76B 5BMGA 3MHBA 4GDLB 1XX8A 4XQJA 5FOBB 5FO9B 1PRTD 4ARCA 5EE3A 1R4QB 2F0FA 1XYIA 3NBHA 3DUZA 5CV9A 1PFDA 2KJXA 3KUPA 3BDLA 1SMYC 1JALA 1STNA 3BK2A 1H9SA 3J81E 1CJEA