3MC0B

Crystal structure of staphylococcal enterotoxin g (seg) in complex with a mouse t-cell receptor beta chain
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
233
structure length
228
Chain Sequence
b'QPDPKLDELNKVSDYKSNKGTMGNVMNLYMSPPVEGRGVINSRQFLSHDLIFPIEYKSYNEVKTELENTELANNYKGKKVDIFGVPYFYTCIIPKSENFGGCCMYGGLTFNSSENERDKLITVQVTIDNRQSLGFTITTNKNMVTIQELDYKARHWLTKEKKLYEFDGSAFESGYIKFTEKNNTSFWFDLFPKKELVPFVPYKFLNIYGDNKVVDSKSIKMEVFLNTH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords variable beta 8.2 mouse T cell receptor
publication title Crystal structure of staphylococcal enterotoxin G (SEG) in complex with a mouse T-cell receptor {beta} chain.
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
total genus 64
structure length 228
sequence length 233
chains with identical sequence D
ec nomenclature
pdb deposition date 2010-03-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF01123 Stap_Strp_toxin Staphylococcal/Streptococcal toxin, OB-fold domain
B PF02876 Stap_Strp_tox_C Staphylococcal/Streptococcal toxin, beta-grasp domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.110 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 3mc0B02
3.10.20.120 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 3mc0B01
5D3DA 1L0YB 3CHBD 1I4GA 1KLUD 1D5MC 4TSSA 3O13A 2O2LD 1JWSD 1TY2A 1PTOB 5I4DA 1RF2D 1PZJD 1PRTF 3BYTB 1V1PA 1PRTD 1V1PB 3DWQA 1LTAD 2AQ1B 3R2IA 3R8BA 1DYQA 1HTLD 1RDPD 3BVMA 3EA6A 1BXTA 1BCPC 1G8ZD 1QILA 1KTKA 1JR0D 3DWAA 1I4RA 5ELCA 2ICIA 1KLGD 1S5FD 1ET6A 1PTOH 1B1ZA 2AQ2B 1JQYD 2WV6D 2NTTA 1HA5A 4Z9CB 1EEID 1YN4A 1EU4A 1I4PA 1CT1D 5D3IB 1L0XB 1TS2A 1AW7A 1GOZA 1LLRD 1YN3A 1B44D 1PTOF 3EFXD 1I4QA 1TS4A 3MFGA 1DJRD 1PTOD 3GP7A 5ELDA 4OHJA 1BCPF 3TSSA 1LTID 3R2TA 3URYA 1BCPD 2AQ3B 5ELEA 1BCPB 5ELBA 3V05A 1FNUA 4RGMA 1FGBD 3BYYB 1RD9D 2QEJC 1I4HA 2XNAC 1SBBB 1AN8A 1SJED 2RDGA 1S5CD 1LT4D 1CHPD 2R61A 1S5DD 4C56C 3BZDB 1FNWA 3BVZA 4K6LA 4DXFA 4L6TB 1D5XC 1PZID 1TS5A 1SE2A 3MC0B 1SE3A 1JCKB 1LTRD 1SJHD 1EWCA 4BWGB 4UDUC 1F77A 2NTSA 1XTCD 3SEBA 1ET9A 2QILA 3OWEB 4RH6A 1CHQD 5TSSA 2G9HD 1FD7D 2XRSD 1D6EC 1D5ZC 2J4XA 1LTGD 2RDHA 1FNVA 2XRQD 3KLSX 4NZLB 1PZKD 1JWUD 1SE4A 1JWMD 1UNSA 4RGTA 4DXGA 1V1OA 1M4VA 2TSSA 2XN9C 1LO5D 1SEBD 1UUPA 2Z8LA 1ESFA 5FK9C 1STEA 2SEBD 3W2DA 1S5BD 5ELFA 1LT5D 2IPKD 1LTTD 1LTBD 1CK1A 1LTSD 1TS3A 4RGNA 1EU3A 1ENFA 4RFBA 1EEFD 1HQRD 4RHSA 4RHRA 3DWPA 1CQVA 1PTOC 1PRTB 2CHBD 1PYWD 1TY0A 1I4XA 1SXTA 1MD2D 1XXGA 4O1NA 1EFID 1HXYD 4ZYSA 1PRTC 4L63B 3BVGA 1LT3D 5FKAC 1RCVD 2IJ0A 4RCOA 1YN5A 1S5ED 4RGOS 1LT6D 1T5XD
chains in the Genus database with same CATH superfamily
1U4AA 2LHEA 3TJPA 3NHHA 4DXAB 1FFUA 4C4VA 1D5MC 5E6NA 2VXWA 5IA7A 1VQGA 1VZ8A 3L4PA 1DONA 3Q6SA 2JX5A 2QDBA 3BYTB 3IL8A 4BBRB 2XK5B 3W9CB 3A33B 1HZ5A 4QIWB 3AB9A 2Z1CA 1MSGA 1GB4A 3GTJB 3T56B 2IO1B 3IXSA 1HTLD 1HE8A 4KKTA 2KACA 1BUVT 4JK1C 3L9AX 4GKJQ 4KK7A 1OXUA 3MA2B 1X3FA 5DLQE 1UE6A 1EO6A 3DBHB 2ICIA 2N0SB 4WJQA 2PW7A 2D11A 5C1ZA 4KY7A 5A2QL 4JYAL 4PT5A 4KY6A 2X6GA 1I3QB 3H6MA 4HLEA 1CT1D 1L0XB 1LLRD 1Q8IA 4A3JH 1UF0A 1Q8KA 5CV7A 4ZKCB 3MFGA 4LF6Q 4LF9Q 4DR5L 1YX6B 2IY1B 1L1OB 2E5LQ 1LQBA 3V96A 4ACFA 1J9OA 2IBIB 3GTPB 4DA2A 1QUQB 1V80A 2CH4W 1MGSA 1VDVA 3HS0C 4LDTB 4II2B 4IUPA 2MJ8A 2B39A 1GC6A 3NZSA 4W9CA 2PCFB 3SK8A 1C9OA 1PYSB 4LNNA 5J2RA 4DNIA 4BBSB 4ODGA 3V6CB 1AN8A 5GAGC 2K75A 1CI3M 3CWIA 4KZ0A 2DWQA 3L16A 4ITKA 4A4IA 3FEWX 5KNDA 5C0XH 2ZJRA 4K6LA 3H94A 4HPMB 1SMYC 1TGZB 4KGTA 3BWUD 2KMMA 3MC0B 3J80L 2JZPA 1O80A 1EF1A 1IHZA 1SJHD 4A3BH 4UDUC 2BB5A 4DK5A 3V62A 4JX1C 1A3TA 3G71A 4AYBB 1M90C 4KIKA 3M7GA 2LS01 2MGSA 1RKNA 4A3MH 4KHVA 1IW7D 1TZOA 2N4FA 2O6VD 1IL2A 4IPDA 3D4DA 2K01A 4A3IH 1V1OA 2ZVNA 4M8AA 4DV7Q 3ML8A 5BMIA 2LXCA 1A5RA 2I1JA 2A69D 2IL8A 4N9TA 4WJ4A 1UGJA 4HCPB 2UU7A 3ZJYC 4AH6A 4JV5L 3OPOA 4K6DA 3CCRA 2BVCA 4AIMA 2D62A 4EQ5A 4GLAC 2EYOA 2ZJDA 3O65B 1BDOA 1L0VB 2DYOA 3S24A 3ZUNA 3GO5A 2WXGA 1LABA 1ICFB 1ENFA 4RHSA 2LZ6A 1VQ5A 4I6NB 2E3TA 2MCNB 2LXKA 3TP7A 3S1NB 3H6NA 4DDID 2GOWA 1EFID 2KENA 4DV6Q 3BDLA 1R4NI 3VUYA 3CKIB 3DVNU 2KFKB 2F0EA 1G51A 3VA7A 4PQXA 2E5LL 1T0QC 2KQSA 3AMZA 4RCOA 4TQ0A 4YCVA 3QIJA 2A5UA 2QEXA 2O4XA 3A0JA 3DVNV 3EQLC 2VRRB 2V3PA 1GXDC 2Z0SA 4GDLB 3QB3A 1FGUA 3BK2A 5H92C 3IFDA 3VTUA 4L5RC 5LMUQ 3G6JB 2QGQA 4JI5L 5BO4B 4B08A 1OQQA 3DM1A 1MJDA 1W6JA 2F0SA 1YQBA 2F0PA 1QZEA 4LLGM 4N58A 4KX6B 1Y69U 2F0FA 4OWTB 3PT2B 4A3PA 2IX3A 1JB3A 1KDCA 1XLNA 3TZUA 3N1YC 1JMCA 4X3UA 4OELB 4GOPB 5C4JH 4WFN3 5HY6A 2E2HH 1H95A 4EX5A 1KXLA 1C77A 2VZKD 3KUPA 2R7DA 4KSKC 4NAWB 3U2SC 1VQLA 3PLVA 2KN5A 3EGRA 3EIVA 1EIFA 1NR4A 1LYLA 2XTIA 4R1JA 5COYA 4ZKBB 5CBAE 5IGCA 1PDXA 4KKIA 5E6PA 4OIKA 1BBWA 1UD7A 1PH2A 1O7YA 2V4LA 3H09A 1VLBA 1CA5A 3CW2C 1HQMC 5IYCG 5DM63 1H9MA 3K9PB 3KBXA 1Y56A 3NOBA 4IC7B 4LFBQ 2YEPF 3HOUG 3PTFC 2R6GA 3ZDMC 2D0PA 3ZYYX 2WDRB 2HHHL 5JEAH 2UXDL 3S1QH 3GD7A 3H91A 2W55A 1X6OA 2F0WA 4XDXA 5DM73 4GMVA 3PCOB 2NB0A 2R61A 2IYDB 4EKUA 2X8XX 4L6TB 2UUCQ 3M3YB 2E76C 2PZTA 3VYUA 4K1RB 1NUCA 2M2LA 2WACA 1I6VC 4DNRB 1PDQA 2CW0D 1F2YA 1WD0A 3M3JA 4I65A 2OJRA 3RI7C 4KDLB 1YHQA 3SEBA 5C23A 3T8MA 4W9JA 1ET9A 1E0BA 3S2AA 2JA7H 3PHXB 1QOFA 1YBYA 1V97A 5IODA 4IM2A 1JORA 2MLBA 2ALYB 4AQ7A 3SK4A 2NVQH 1B2TA 2YTYA 2J4XA 4W9HA 3MWYW 5DPRA 3MJ5A 2KO3A 1GJZA 2DY8A 3WAMA 4MGIE 2PJHA 4BY1B 2QKIC 2M17A 1NI2A 3HHMA 5C4XG 2GBRA 4DV4L 3IVFA 2DY7A 2JA7B 4NJ6A 2Q5WD 1SMXA 3B1LX 1S5BD 1X3PA 2GBKA 2NVQB 2INPE 2K6DB 5TR5A 3DBRI 4OZCA 3ZXRA 4GNXC 4HJ9A 3I4LA 3M4YA 1B4OA 2BE5C 1GUAB 2LVPA 1WRIA 4HDQA 4YT0B 3CRLC 1ZXIA 1PFMA 2LGSA 3NJTA 4OO1I 5FO8B 1EEFD 2SNSA 2QF7A 2EY5A 4K3BA 3T9LA 2BH8A 4LK1C 4DR7L 3B08A 4C7YA 4W9KA 4UP9A 2RSOA 2FXQA 3CU7A 1Y1VG 4ZYSA 1PRTC 1YJWA 2ZTEA 4RMFA 2WU5B 3PHWB 1OXSC 1K8RB 3S2DB 4ANVA 1S1QB 2A68D 1AFPA 3NRZA 4BVUC 1GAQB 2KANA 5JAVA 3CCQA 5E6JA 4K8IA 3DEPA 4X66L 3SVMA 1SROA 3Q3NC 2BS2B 5C3JB 2EY6A 1X3GA 2X38A 1ZGUB 3N1ZC 5FO7B 4TSSA 3TREA 3P4PB 3QAQA 4C4VB 4POFA 1OXXK 4MIUA 1V5TA 3WIMA 5FR6A 4C1NK 2W3SA 3RULA 4JI6L 4R9WA 3Q8CA 3DUZA 1V8CA 5E6OA 3W1SA 5IT9c 2F3WA 2OQKA 3P75A 3ZVVA 5C5MA 1SNOA 4OEMB 4KJOA 2HD3A 3I90A 4PV1C 3Q3JA 2AL3A 3D3RA 2N55A 2M9VA 1EZ8A 1HTQA 1EUVB 3GTLH 1QZHA 1JQYD 2DAJA 1GM5A 1EEID 2LI5A 1VQPA 2N8NA 1XMQQ 1SYGA 1STGA 4FHJA 3DLLA 1UWMA 2EMTA 4CBVA 3EFXD 2HQLA 1XX8A 2BDOA 4IW0A 1DJRD 1HFNA 3ETRA 1A2TA 2Q2HA 4YCWA 3GTLB 3N20C 5I2YA 4FN2A 2PKOA 4MGKE 4G57A 1NTGA 4P75A 2B2WC 4QMGA 4K5VA 5ELEA 4ICUA 1R9TH 2MPMA 4DQOC 4K2LA 4YY3Q 3V05A 4F8CB 2L7RA 3D8GA 2CU3A 2K8CA 3U50C 2MJDA 2CWPA 3K8AA 4TKOB 5EKLA 4MNOA 4Q2JA 1SFOB 2L55A 4DAPA 1J7AA 5JH5C 1V1QA 1KH0A 1B3QA 4IUMB 3H8HA 4HRSA 2N1WA 4GN5A 1S5DD 1NDDA 1OO9B 4DFAA 3SD5A 4Y7NB 2KVZA 3H0GG 2EIFA 3HOXH 5C5LA 2KKCA 5AUKA 5KEEA 1BUIC 2D3BA 1STYA 2MJ3A 4P16A 3RZOH 2DX5B 2RMMA 2D0OA 1WY8A 4K7WA 1JJ2A 4JI2L 4PMWA 1CKOA 5KRUA 2KCTA 3FKYA 2R2OA 2XVSA 5C3EB 4DR2Q 1CHQD 4KIKB 2A1AA 3HOXB 3CF6E 1UE1A 3TMEA 1ZYRD 3RZOB 3H3VH 3GE3C 2VW9A 2SNMA 1D3ZA 1PV4A 2Y5CA 1UUPA 2PO4A 3J80i 4Q0FA 4DUZQ 3E0EA 1YEZA 5H1SE 1C4PA 3ZXVA 5EQ0A 3Q3OC 1R4QB 3GTQH 4A93B 2J7ZA 1IBKQ 4MM3A 1AZQA 3ZQ4A 2K5QA 1WTPA 1HCZA 2PE6B 3CC2A 4RGNA 5EPJA 4LJOB 3X3MA 4RFBA 4WWNA 4YL8A 4AQYQ 2CQAA 2A6EC 2EY2A 4A3JG 4S17A 5D2MB 2NBWB 4CDFC 3ICEA 1TY0A 1I4XA 5JZEB 1VQDA 3GTQB 1ZKHA 2NVTB 2JRHA 3CPFA 2VB2X 3Q22A 1XMQL 4KD3A 4OO1G 3KWVA 1TWHH 1YNXA 2KCCA 1Q1OA 2F0GA 1FM0D 5T1IA 3HOYH 2LWPA 4MDKE 1RCVD 5C2TB 2IJ0A 1GUTA 1Z6HA 3PO2G 1DD2A 2K0PA 4ZRPA 2L1BA 1V86A 4MHEA 1HR0Q 3J81i 1CKMA 1WR1A 4IWPA 1PHJA 1X55A 3PIOA 2CHZA 1TY2A 2N9EB 2K28A 4WAFA 1AEXA 4S0RA 3MEFA 4EVOA 4HIDA 2J0KA 4RKLA 3STBC 4MSQB 2F3IA 3MXNA 2B3GA 3RN5A 1TWAH 3LYYA 1EQTA 5CV8A 2MO1A 2N78A 2KHWB 2D5DA 3QX1A 4NAMA 3D31A 1XNRL 2LXAA 1X54A 2HCCA 1S5FD 3Q8DA 4KV6A 2QMTA 2HCIA 4G50A 3QR8A 2WXIA 4OWWB 1ENAA 1WM2A 4DR2L 1KNEA 2I5MX 3K5NA 3ALBA 5D3IB 1AZPA 1TS2A 1TKEA 1WH3A 4ZYNA 2N7EA 2L0FA 3W5OA 2PW9A 3NP8A 2PIAA 4B9XA 2LJIA 4MTNA 3M7NA 4R4IA 3UE1A 4JWUC 3UQBA 1FD6A 1P7EA 5M3FG 2L12A 1I50B 5AJ3Q 2GBJA 5EE3A 3R2TA 4A76A 4FYDA 2YYZA 2B76B 4ASWC 4NQKE 1Q7YC 4C3IG 4B3MQ 2K5NA 4Y52H 4KN7C 4FLHA 4E6IA 1TXYA 2LASA 3U4VA 2BCOA 1NBWA 4CJ2C 5HKHA 1D4BA 1S5CD 2EKIA 4YHHQ 5D6JB 2BYVE 3L2PA 3PZ7A 4IG7B 5IO9A 5EDSA 3OG5A 5BR8L 1HR0W 1RRBA 3NUHB 3DBSA 2ZPYA 3I4NB 2WP9B 2ACZB 1ICWA 1X3EA 3AB5A 3NTIA 3U52E 4GN3B 4DR6Q 5FJ8H 4JW0A 4JL9A 4K3CA 1AE2A 3QOJA 3NE5B 1B3AA 2H4OA 1N6ZA 2RVLA 3NTHA 1SDFA 2NVXH 4NY0A 4XWTA 3OWEB 2C7MB 2HDLA 1FO4A 3AEVA 3ZRCA 3VVWB 3EROA 4BKSD 1D5ZC 2WFWA 4FF4A 2CWAA 1K8OA 1SYCA 3S15H 3DCGA 3AE6B 1JWUD 1SE4A 1U4MA 4C1NI 4A3DG 1EF5A 2KWCA 2KWDA 2FCQA 2J0TD 1N32Q 3BINA 1A2UA 2RGFA 1TZ1A 2Z8LA 5FK9C 2Z6BA 2CVRA 5JVH3 1FFVA 2G4DB 5IT9L 3C1EA 4G7OC 1T6BX 3T3NA 1TQOA 3PF5A 4TUUA 5CV5A 3RNFC 1OGWA 1F9SA 3A74A 1WX7A 4RWSC 2F4VQ 2I5HA 4ME5A 3LNNA 2D07B 3NBHA 1XXGA 1Y8NB 2KJRA 3F1ZA 3OW2A 2FUHB 3N6RA 2KYWA 5HI1A 1TWCH 1RYJA 4S3SA 1QJOA 2B2UC 4HEA1 3TP8A 1EOTA 4IPCA 1N34L 1HNXQ 1KHIA 5J1ZA 3S9WA 3RN2A 1NEKB 3FVQA 1PUTA 3E0JA 3EUB2 1SGHA 1CZGA 3OYYA 2JA6H 2MP1A 4REZA 3RNBC 2F0OA 2XSCA 1T0YA 2HTHA 4P71A 2BF8B 3CQZH 3PUZA 1PRTF 3QQ8B 2KTFA 4DUYQ 4DR3Q 1LTAD 2WGSA 4W9GA 1STAA 3KK7A 5C6AA 1B7YB 2EVBA 2WHIA 3VUXA 2JA6B 3R7RA 1BXTA 1BCPC 3BY4B 3ZKJC 3A8KE 2Z4IA 2WWZA 3HEJA 1N36Q 4M0WA 1KLGD 2Q2IA 4JI3L 2E2DC 2ZTDA 2C9WB 4TMAB 1Q1BA 3NWTA 3OSOA 4OGQC 1WRDB 3PZ8A 4A3CG 1MFWA 3IHPC 2E75C 2XBBC 4MGZE 1WF9A 2WX1A 5IKCM 1UAPA 1HZ6A 1YN3A 1YZ6A 4F1SA 3DWGC 1V6EA 3PUWA 1PTOF 3HOZH 4IFDH 2CJNA 2G4SA 3CMMB 2WDTB 2Q8RE 3I73A 3K81C 1O7IA 1N63A 2R3ZA 3M4QA 1XLPA 2LY7A 1OEYJ 1TIID 5IIFA 1F2LA 2NR2A 2A74C 3URYA 4FNFA 4IOCA 4LTUA 3D4RA 1SYEA 4DV5Q 4YIJA 1A15A 1Q5WB 3LX0A 2IO2B 4KGRA 1FNUA 1HH2P 4L8JA 5D65A 2L0CA 1WTVA 1A6XA 1STHA 1V9JA 3QC8B 2EOTA 1N33L 2XNAC 1OQYA 2BDNA 1Q81C 1WJJA 3E3XA 3KBGA 1NYQA 2LUEA 3L3OC 4GIVA 1C79A 4LF5L 4B3TQ 4L1BA 3UE0A 3BVZA 5A35A 1VQEA 4JOIC 4C2MB 3Q3MC 1PZID 4JBMA 1E2VA 4DBGA 1TVXA 2OEDA 4J6IA 2QCZA 4MJSA 5AZGA 3DVGY 2IY5B 1RL2A 2KD0A 3TBLD 2D5GA 1QG7A 1I94L 4X64L 3S16H 3I3TB 3S1RH 2A19A 3PGEA 1X32A 1WR6E 3HK0A 4PS8A 1K8MA 2PPBC 3R93A 2ZNVC 4FJYA 4WQOB 4LNQA 4C3HG 4P1CC 2F0QA 1N5WA 1OQRA 1LO5D 3FPUB 1WOCA 2Z9HA 3S1RB 4DUYL 2IX0A 2VB3X 1QOHA 5C4XB 2KFJA 3X0WA 1DGSA 3A5ZB 3CRKC 1WD1A 1QVGA 2Q2TA 2EJMA 1JQ4A 5M9OA 5KHQA 2IPKD 1SSNA 3HKZG 2KTRA 1EY4A 4MM3B 3EFCA 1ISNA 1MJEA 3SK6A 3L10B 4M1UB 5M5WH 3S2HH 2DBYA 2ZT9C 3HVZA 4NJCA 2JA5H 4DK3C 4JYAQ 3ER0A 3TEHB 1VQ6A 1MD2D 2QDLA 2ZZPB 4IZ8A 4P1BC 4DPGA 3HRZC 4NJ7A 1SIFA 3S17B 1Y1VB 3BVGA 2O5JC 3UI3A 3CSTA 5K36H 2KHSA 4DR5Q 2HIXA 4DR4L 2N7DA 2RCFA 1J0GA 3IKJA 3VH4B 2DYBA 2XWJB 2JA5B 5IP7H 1KM7A 4CHKA 1H9KA 3TS2A 2OTJA 1T5EA 1R4NB 3M95A 3PO3G 1SE9A 1VZ7A 4RH6A 2NPTA 4HXDA 1WWTA 3RNGC 1E10A 2O5IC 1G2TA 1Z47A 1GO3E 1DM0B 5CV6A 1JWSD 3T1HL 2D3AA 1FR3A 5KYLA 2EY1A 2L11A 2BTEA 1BOSA 3WAOA 2K50A 5IWAL 3WANA 4AS1A 1TWGH 4KV2A 3VYSA 1K3BC 5CX3A 3WCQA 3MXNB 3R2IA 2E2IB 1CSQA 4NW2A 1FL0A 4B0MA 1EY0A 4IUQA 4A6QA 1KNAA 5I9PA 2HQEA 4BY7G 4HCNB 2FMMA 1E7ZA 1RHPA 4A3KH 2YU9B 3IBEA 4US8A 1R4PB 2JXMB 3NELA 4NMZA 4BBRH 3HOVG 2Q8TA 2V1YA 1EY7A 4B6WA 3NVZA 1HRJA 1FCCC 3PS6A 2BT6A 4EQPA 1E1TA 2DJGC 1E9MA 2E8GA 2L1AA 3AXCA 4P73A 4A3KB 3NVWA 5G5GA 1KOTA 2B2TA 1XYIA 2Y0SB 4KHPL 3N32A 4MACA 3GTOH 1I3QH 4JV5Q 2PZUA 1EYAA 2JEAI 1EYCA 1VQMA 4P72A 2D3GA 1GVPA 1VQ4A 4H0LC 4ZHPA 2H89B 1OFFA 1QOAA 3AMUA 1D2BA 2PYKA 3AN1A 5AZHA 4DV1L 4BAXA 1YOVB 2MSED 4A20A 1HTPA 4B3RL 2KHIA 2HT1A 3GTPH 1L2FA 2W82A 2ZJPA 2ZW1A 1Y8RC 1PXUA 1P7FA 3GTOB 5GQOA 2LSSA 3UDGA 1NENB 3FRPB 4W9EA 3D4WA 5DNFA 4GKKL 2N7JA 2AYOB 3AYHB 3RZFA 1Y1WG 4II3B 2AHOB 1SN8A 3KYDD 3ZJVA 5CORA 3TEYA 2AUJD 3QWNA 3U7ZA 2R93G 1EWCA 4BBSH 2EXZA 2KJ6A 3HVDA 1L4DB 4LFCQ 3HOWG 1WI0A 2OQ0A 2PMZB 3RR5A 3UDFA 2K5DA 4JI5Q 3P7JA 4O42A 2WXHA 4APVA 2FE8A 3WOFA 4K5WA 2NBVB 1Y14B 2WAQE 2V9HA 5LXHA 2LJ5A 4TQUS 1RWSA 1P1AA 5T8IA 2R2QA 1WYDA 1BVSA 2WS3B 2N49A 2BA0A 3ERSX 3CPWA 5EJWA 1EIYB 1L4ZB 2JZZA 4DHJB 4RKBA 4M01A 5FLMH 2FHTA 3SHQA 3Q24A 2AWOA 1IGDA 4JLCA 1YNNC 4M8NA 2LUMA 1YI2A 2ON8A 2XEWA 2V4IB 3PLUA 1XD3B 5EAYA 1CQVA 5HGTA 3M4OB 5HHDG 5EKKA 3KF8A 3DVGX 1H8CA 3DBRB 1SXTA 4C00A 3NBHB 4JPBW 4YTMB 2R7ZG 4IUNA 2K5HA 2F4IA 2C5LC 5A2QE 2L32A 1VQBA 4F88A 2CJOA 3AH7A 2DHZA 4W9DA 2B2YA 1H9RA 1Q12A 5IYBG 4GOPC 2FINB 2EDGA 4A3EH 3ZIMA 1H4RA 3PO2B 2EYMA 4XT1B 4CJ0B 1I6HH 2L3ZA 3RD2A 4BA1I 3PIO3 3OTOL 5D3DA 3S1NH 2J7QB 3CHBD 2HHHQ 5J3BA 1E2ZA 1C1YB 2LRWA 2BYEA 2MBOA 1YQ4B 2F0UA 2UXDQ 4WRDA 4V190 4HDOA 2N9XA 1QVCA 4HTHA 1XF5L 4A3EB 2WP8J 1V1PA 4LW1A 2VNUD 2PVGC 1J8IA 3EBEA 1I6HB 2B2VC 2K32A 1PFNA 1GHKA 1OXVA 2KOLA 2L15A 1TBEA 1WJ6A 2BKFA 5MPOA 4JBWA 5M5YB 4EZLA 1RIPA 3T13A 1VQ8A 1KRHA 2HUGA 4NDXA 2K1BA 4M0WB 4LFCL 3SFEB 4WH4A 2KDBA 3J80E 3C0RB 3JYUA 4F7ZA 2NTTA 1HA5A 3WAPA 1KAAA 3R3OA 2MWSB 1M94A 4K8JA 1VCIA 5IAAC 3W5UB 1G91A 4R4OA 3TZDA 1TS4A 1LUZA 5FLXc 1LACA 2B2WA 5DPTA 2NN6I 1K9MC 3GP7A 1E8YA 1FVIA 3H7SA 4A3LH 4JI8L 1BCPF 2ID0A 4DV4Q 3J9CA 5M3FB 4C80A 4FADA 3DHGC 1KABA 2JA8H 3P1MA 1R4MB 3MC9A 4HAEA 2XWBB 4C3IB 3RLFA 3BYYB 5IP9G 1YJNA 2H1EA 2RA4A 4DAMA 2M0AA 3OAWA 4ZRKA 1QNUA 1EY8A 2VUMG 4BXXH 2WXMA 3VR9B 4ZLTF 3UIPB 2QCPX 4A3GG 2JF5A 4YWMA 5CGKA 1XPRA 1S4ZA 2K5PA 4LFAL 5E3FA 2B8FA 3K7AB 2J53A 1QKZA 2REXA 2JA8B 3KVFB 3J81E 4DV0Q 1WI5A 4DR7Q 4GSWA 2WXJA 3PV0A 2VS1A 3MXGA 1LGRA 2DNEA 1B70B 3DBLI 1BR9A 4DV2L 1MBYA 4HJ7A 4MJSB 1ILQA 2Z6KC 1A3VA 1VQHA 3LDZE 2VL6A 3VUWA 1QT9A 4A90A 2D2QA 4CO7A 2AEHA 2WXFA 4X66Q 1H9SA 2K33A 4X62L 3I8ZA 5C44H 5JPMC 3TCAA 1P16A 1I42A 2UU9L 3ZNZB 3M3YH 1P3QU 4ZDVA 2H88B 1QE6A 2W9NA 4LNIA 1UNSA 3T3OA 4LF8L 3X23A 4A3DB 3IG3A 4MELA 5EBCA 3S14H 3P1HA 3ZGZA 3A5UA 4JI6Q 5I6YA 5JJZA 4X65Q 3ZTDA 5KNBA 5C44B 5EE1A 1WTOA 4EZKA 4R3DA 1PLFA 1IUEA 1PFDA 2WX0A 2NZOA 4L5SA 2KTRB 1YJ1A 3K0YA 3KUZA 3UDIA 4PG3A 1C3TA 3S14B 3KYHC 4JG2A 4BY1H 3DBHI 1FIQA 3B2FA 1WCMG 2KMAA 3R3MA 1PYWD 3QG1A 1X9NA 2M0XA 4P6VF 4LNKA 1SYBA 4GU2A 1C9FA 3DEOA 1IZ6A 1TIFA 4V0BA 1CZPA 4GB9A 1LT3D 3FMCA 4IFDJ 1JRUA 1D7QA 1XCQL 2UXCL 4PS7A 5IGEA 5LLIA 3ULJA 4HJAA 3DDCB 1K8AC 2K03A 4TRDA 5C4ZA 2DNFA 5DCNA 2MUYA 2KVMA 3ULPA 3TBIB 2NPTB 1LM0A 4FP5D 4RA8A 2INNE 3TEZA 3RNCC 1YJIA 4WAAA 3VA5A 4DHZB 1X56A 1TJEA 1A8VA 2KJXA 1AE3A 3S2DH 1WTHA 5LL6X 1RF2D 1PH5A 3EC8A 3KF6A 3I56A 3U30A 1L2NA 1ASZA 4BOSC 4DV0L 5LMNW 1P9DU 4JVZA 3APCA 1Q86C 3OJ4B 2M00A 1BNZA 3I63C 4CKBA 2WINB 3QCAA 4JI2Q 2MEKA 3NZUA 2VQEL 2GMIC 1VJKA 2MBQA 4DV3L 5G3LF 2KC1A 2V3NA 1WXMA 2WV6D 4LCDE 2X69A 3FHWA 2JP1A 5KIXA 1SNPA 5C0XI 4WJWA 4ANUA 1GOZA 1W3SA 5LMNL 1Q46A 1B50A 3HUIA 2FMCA 3RNEC 4URKA 1C78A 4IURA 1L7YA 5T1GA 2B63G 1UEAB 5M3MG 4A3FG 2KDIA 2Y5PA 4I6LB 3NTKA 2WXOA 4K81A 5JJIA 3UQAA 4B95A 2KCNA 4JI0L 1KIXA 3ONAB 3OWFA 4X65L 3NG0A 2NN6G 3TIXA 2BW2A 1PVOA 2K4KA 3KW5B 3FKIH 1FGBD 2BBCA 2B29A 1J19A 1WXAA 3RCZA 3JW0X 1F9JA 2KVRA 2ZCBA 4C3JG 4B9KA 3MVVA 1HNWL 2KEDA 3S1MH 1IW7C 1SAPA 2EKEC 3CCVA 3ULLA 3RT3B 1RLFA 1U0LA 2EYHA 3CCJA 4QIWE 1FEHA 2A73B 1TT2A 3T53B 2Z59B 1B9NA 2GLSA 3FKIB 4HWIB 3RD4A 2A69C 1ROEA 4HPPA 4HJ8A 3QOLA 2JZ3B 1K73C 1U4PA 3S1MB 3P63A 3H3VC 3OMGA 1SFOH 1DOKA 2WKDA 1SF0A 3PIPA 2JYEA 2E2JH 1GB1A 3C1FA 5EBDA 4LDTD 3RZWC 4Y7NH 1WFYA 2R92G 5HG2A 3KLRA 3I4MH 1FNVA 2EQSA 4ARIA 1PH3A 1PZKD 1JB7A 2HDEA 1QWYA 3D6CA 3ML9A 3QJZA 3KLSA 1Z9FA 4MGYE 4ANWA 1L0WA 3VHTC 3JAMc 1QNKA 2XIWA 1A3UA 5ELOA 3PQIA 1OTRB 4JI4L 1YJJA 1ASYA 2E2JB 5C3EH 1GNUA 5CV4A 1MHXA 4OW0A 4J1MA 4DR1L 3VDYA 4IALA 3I4MB 3UIOB 1IBXA 2JUOA 2WB1B 3HKZB 2UYZB 3A4RA 1AH9A 5IYDH 1XNRQ 1QVFA 4LUZA 4RCNA 3QWZB 1MHHE 2DAFA 1HQRD 2L0TA 1PRTB 1BMLC 1NY4A 2B2UA 2CKHB 5I9OA 2DENB 2WIIB 2L76A 3D6WA 3KF8B 4IO9A 2PI2E 4BFRA 1WZ3A 1WGRA 3FP9A 3T51B 3V2TA 4A93H 2ZCCA 3KUDB 3NSWA 5FLXL 5GADC 1L6VA 2J52A 2XGTA 1O7LA 2M56B 1JW9D 4AYBE 3NVYA 2CHXA 4JGHB 4XWWA 4H44C 3U4ZA 1QB5D 5FO9B 4X57B 3CMEA 3PO3B 2OF1A 1HA6A 3VQIA 1S72A 2EYLA 2UUAL 1JOKA 1I4GA 2NVTH 2MW5A 2RR9A 5CHWA 3R7QA 1QOGA 1YJ9A 1TWFB 3RLNA 4ZRIA 3JSVA 1PTOB 2ONQA 1VMPA 2JQRB 4GDKA 4YSZB 4WORA 1V1PB 1YNJD 3CCLA 3AE4B 1DOLA 2H5XA 4PMCA 1WXVA 1XPUA 5BR8Q 4J15A 4CYEA 4O2DA 2D9UA 4MEMA 2NBFA 1KTKA 1VRAB 3AV8A 5ELCA 3GZNB 2EELA 4WJ3M 4GN1A 2AQ2B 5KHOA 2IO3B 5HURA 4L2YA 1D1IA 2Z0EB 1YD8U 1VQAA 4LNFA 4A9AA 3F2UA 2INCC 4IWOA 2YV5A 2L00B 4OHJA 5C0XG 5M5XH 3NK9A 2HJ1A 4ZUJA 3ND8A 2CW0C 4ZK9B 1RAXA 2KOXA 4AP4C 5C3WA 3RNUA 3IFTA 4RGMA 3SR1A 1HTOA 2WU2B 1JICA 5C0XJ 1XQQA 4MH0E 4AJWA 1WTRA 4A3BG 1JALA 2W3RA 1HNZL 3DQVA 1WGKA 2X6LA 1O7ZA 3GTKB 2CR5A 4YTNB 1IYFA 1CHPD 3QIAA 5M5XB 2M4NA 1V81A 2KA7A 1TR5A 2R7FA 4A3MG 1I50H 2JYOA 2D10A 1ACCA 1EY5A 4QUCA 4A3IG 5DAUA 3OIQA 4DK6C 1CFMA 3I57A 2HD5B 4LWCA 4XQQA 5E1FA 5JJLA 1Y1WB 2A6HD 2ZM6L 3AE2B 3MXUA 4BWGB 3VR2A 4NXNL 2LXJA 3EFUA 1XTCD 3HOWB 1U5KA 1N34Q 2BQQA 1EWHA 3CP0A 1F2ZA 1ZXHA 1H9SB 4YTPB 4AJYB 1V2YA 1E8WA 4XXEA 1XLOA 1GUNA 4GS3A 4G3XB 3N52A 5CV9A 3T1YL 3QJYA 3I4NH 1ZW7A 2EYFA 1SLJA 1JWMD 4RGTA 4XT3B 4DXGA 1JWAD 3AE8B 2ZXPA 1ZDXA 4FXCA 3J7ZC 2IZVB 1SB3C 3MHZA 2ZTCA 3AEAB 3SU8X 1MI0A 2A68C 1ESFA 4QCLA 3UGBB 4HR7B 1G2SA 3KLWA 1U9RA 5JOBA 3W2DA 3ABVB 4NP5A 2JYTA 2F0IA 3AEFB 3LWEA 2BPSA 4B0EA 3ND9A 1LTTD 4ZUIA 4WQMA 2M1MA 2SDFA 3L08A 1F1HA 3L54A 4R8NA 4LJZC 4JI3Q 4E3CA 2NBUA 5CR3A 4CQNA 2AWNA 5BMGA 4EQOA 3NVVA 4BA2I 2OT2A 4O1NA 3OW7A 1WIAA 4DK0A 1F2MA 1EQVA 3QO2A 2V4DA 4NKLA 4ULLA 2R7ZB 3APDA 2KX0A 4OONA 3MTNB 4XDDA 5L83A 3E9HA 2CCZA 3BZKA 1QF6A 4HEDA 2JPHA 3N30A 2G3QB 1Y8OB 2LGXA 3CSFA 3NQTA 2D3CA 4OX9L 3CAMA 3K59A 1LT6D 4G4KA 4IOAA 3MXPA 3K80C 3P2BA 4DHJD 2UUBL 1KLUD 3W1YA 1GUGA 1N9WA 3A7AB 1N33Q 1XNQL 5JJKA 5I4DA 1YX5B 2HE7A 3AEBB 4JIOU 1ESRA 5IOCA 3UDXA 4R4QA 2FCMA 2RF4A 4GN4B 2GVAA 1G6ZA 1IPGA 4QAYA 3KF6B 2QIEB 4KI0A 2AQ1B 4LF5Q 2V3SA 4H02A 3RPFC 1IXRA 1RM6C 2PTLA 3EA6A 1QILA 2JXXA 1M1KC 2FBWB 1KAWA 3KQ4A 4DF7A 4XYOA 1PGAA 4FXDA 4KKJA 1I94Q 2IX1A 3CD6A 4JWSC 4X64Q 3A55A 1F52A 4JC0A 5JEAG 2KHJA 2EPBA 1JROA 1SYDA 1GHJA 4NNJB 1IKMA 4PNYA 1UH6A 2JQOA 5IP4D 1IYVA 1AARA 5JEAJ 3LGJA 3MHBA 5IGBA 2DZJA 1SNCA 4DDGD 3JAML 4JI1L 3J7A5 1LTID 4IM0A 3U4EG 3ZO5B 1FPYA 1SNQA 4XQNA 1S40A 1V49A 3GTGH 4LAAA 1WXSA 1I4HA 1BBUA 3H3VI 1V43A 3V60A 5IT9E 2JA7G 1ZYRC 1LT4D 3Q23A 2K6QA 5IYCH 1EL0A 3P4SB 3PZDA 3TEXA 4HVBA 1LV9A 4B9WA 1VMCA 5BMHA 4XZ4A 3L17A 3I70A 4POGA 1WJ4A 3HOUH 1N5XA 4EZJA 2KCMA 3GTGB 1F9QA 3PUXA 2JY6A 3F2DA 4MH8A 1SE3A 2K1FA 4DAYA 3V6EB 1NNXA 3EN2A 4DR4Q 4K0KL 1NCVA 3VDZA 5JHAA 1IGCA 1NMFA 4BOZB 1UWVA 1JT8A 4FF1A 3SR6A 1G6JA 4PS3A 2KUMA 2G9HD 3NS8A 2C5CA 3I3CA 3HOUB 2A4ZA 3QARA 1KL9A 3PUYA 4C2MH 1LTGD 4CHTB 5KYIA 2RDHA 2XRQD 1Q1EA 2AUKA 4DKAC 1KRSA 5BYQA 3CF5A 1S3SG 3T1HQ 3DHQA 3RNAC 4PMBA 1NAPA 1UE7A 1SMYD 2DNCA 2TSSA 2LGIA 5EGTA 4JE3B 5IWAQ 3SDLC 2FJ2A 4CJ1B 3H9DA 3C19A 2KXJA 4I6PA 1STEA 2BB6A 3F8TA 3IAYA 2WXNA 4FJVB 4WWPA 4JI7L 4R4CA 2KWUB 1LT5D 1NVID 4D2KA 1Q10A 1IBXB 2K04A 1HJPA 1LTSD 2YVCA 1EU3A 2BOSA 2UWQA 2FCNA 2K05A 2KK8A 1N8RC 5GAHC 2RDBC 3T16A 1NBFC 5C4XH 4R8IA 1FXAA 2AX5A 2RD0A 1A0IA 1WJUA 5G55A 3ENEA 1AP0A 2IGDA 5LL6S 4FA6A 3ZJTA 3J81c 1TT5B 1Q90A 2FIFA 4J3OD 1FJGQ 4ZRZA 4FHKA 1KFYB 3AE7B 2L5TA 4KHPQ 1PQSA 5ELFA 4ZAIA 1T5XD 4UHVA 2BYFA 4B3SL 4MTKA 3X3NA 4NXML 2RCNA 2ASBA 1EWYC 2C60A 4ALPA 1IBML 3O13A 4HROA 3S17H 1A63A 2C7HA 1Y1VH 2N1VA 1HUNA 2MQHA 3JSVB 3E9IA 4DV1Q 2LFIA 3AEDB 1HZBA 3P42A 4GDKB 2L4NA 3PSEB 4B3RQ 2W54A 4W9LA 5AFWA 4RF0A 5DPSA 4HCSA 1DYQA 3CMAA 4GKKQ 4OWXB 3J7YW 1D1KA 3NHEB 3MHSD 3CCEA 3CC4A 2UXBQ 2B3AA 2KDFB 2KEEA 1I5FA 3KYCD 1I4PA 4K5XA 2E2IH 2K52A 3I72A 2QJLA 2INDC 1AWDA 2PQEA 3AULA 1SE8A 4ZRJA 5G2NA 5BN4A 3ITPA 2NZ1D 2N3SA 2V1CC 2B63B 2Z0DB 1PFSA 3KFUA 1HPCA 3I2ZA 3PSIA 1HZCA 4A3FB 1YHBA 5EPKA 3HOXG 2YU9H 1L1OC 1XWEA 2DLBA 2WXPA 3DWMA 3Q8EA 2IT1A 2KLCA 3TEWA 2PVOD 2YEPB 3NQIA 4GLSC 5BYRA 2QEJC 3M62B 4OVUA 3VTVA 1SJED 5I2XA 3CCMA 2RDGA 2N9LA 4IDIA 1PH4A 2B8GA 1WGGA 3E9SA 1IBLL 3I5JC 3P4RB 4XE0A 1FNWA 2PNRC 1VQKA 1E7VA 2C7NB 1D5XC 3V3XA 4ICVA 2KX3A 1OEYA 1ZOYB 3NZ3A 1J5EL 4BZAA 1GUWA 1YHAA 1PH7A 1EWIA 2PW5A 1FJGL 2RKSA 2BS3B 4YCUA 1ONLA 4QGUA 5GMVA 2EE1A 4U673 1GG3A 2J42A 1PH9A 4I7AA 3DBLB 4NPNA 3OTOQ 1D6EC 2NCNA 2G9DA 4UY8C 3H0GH 4NZLB 3DXJC 1RTNA 1Z7TA 2XN9C 2YLMA 3NENA 4G0NB 2FNJB 1PA6A 4XYCA 5LNK1 5CMDA 1WGYA 3HOYG 1DOXA 4KHZA 1AYFA 3BZCA 3H0GB 3JVZX 3AFQA 4ZOHC 2VH2A 1E22A 2WNMA 4HMIA 1J8CA 2L9HA 1CSPA 4XIGS 3LWUA 1PGBA 4HJ5A 2UXBL 3APFA 3GQBA 4K2KA 2AWTA 3AEEB 2KN4A 4FF3A 3K5OA 4F7XA 1ZEQX 3M4PA 1K50A 3Q69A 2WYQA 4NPSA 1J7BA 2JRIB 3SHLA 1BT0A 1D8LA 2F0MA 1J6QA 1N62A 2EZVA 3U58A 2AMCB 1E1OA 2NZHA 4JI8Q 1GJXA 5EPLA 1UWXA 1EOVA 1X3QA 4KD4A 3SXHA 4GNXA 3M4OH 2BE5D 3W3AA 1CQFA 4RGOS 3RZDH 3PUVA 3SE0A 3W1BA 3WDNA 4P2CB 3P4QB 4HKZE 1KDBA 1ZUD2 3VR8B 2KMCA 3RUZA 2EJGC 2E6XA 2O2LD 4HMJA 4OO1H 4HPLB 4IFDI 1FRRA 3A9JA 1PRTD 4G7HC 4LFAQ 2LVQA 2A8VA 1RODA 4PZ7A 3TQYA 4GZYC 3RZDB 4A3JB 3PO2H 2MX2A 4X3KA 2FFKB 1BBXC 1V5OA 1ZDVA 2IGHA 4CKCA 3MFYA 1JE4A 5ELNA 3G4SA 4DV2Q 3H1UA 2D2CC 4K14A 1GD7A 2BH2A 2L52A 3PGZA 3MJWA 1U4RA 5J39A 1CKNA 4IWQA 4ARCA 3I4NG 1C4QA 1EU4A 3BK1A 4X62Q 2A5HA 1O78A 1K8GA 3K57A 5IN7A 2UU9Q 3WALA 4GLXA 5H8YE 1EQRA 2OWOA 1XMOL 2KWVB 1PTOD 3QK0A 2KBNA 5FR3A 2WAQG 2ATWA 5M5YH 4LF8Q 3HZXA 1DZ1A 4USAA 1ZP0B 1F0ZA 1KRTA 4U68A 3GE8C 2AKWB 3P20A 4IJLA 5D7GA 3OJ3A 1DCZA 5I6WA 5FJ8G 3RMKC 2O6VA 5GAEC 3J81j 3K6OA 4A3BB 2MNAA 2DZKA 2CU1A 4WWMA 1QCBD 2OCEA 2GRIA 4C56C 2I38A 1WYWB 4WURA 4BS9A 2IDYA 4A3MB 5M3FH 3A9KA 3KOJA 2K6AA 4G7ZC 1X1MA 4GKJL 3JAMi 4A3IB 4C3IH 2KQ4X 4RF1A 3HKSA 3TP6A 2KZRA 3J81L 1KJTA 1VQNA 4DAYB 3CC7A 3ERQA 1C76A 4HKQA 2MBEA 2UXCQ 1VS0A 1WE6A 4KMUC 1MHWC 4GOCA 4QL5A 2MFIA 5TSSA 2Z4HA 2C9OA 1SR3A 3K7AH 3CXCA 1E8ZA 1E8XA 3D32A 1HUMA 2I46A 4OVVA 4LF6L 4LF9L 4AOFA 2HDMA 2O2VA 4P7IA 1T9HA 2DZMA 4DNTB 5LHY1 4TQ1A 1UE5A 4DK1A 1PMRA 2LVOA 1B53A 2G5DA 1ZKOA 2KJHB 2PEAA 1EFWA 1ILPA 5AZFA 1C48A 2SEBD 4JQWC 2LFNA 1QQRA 3GOEA 3ZDTA 2KNBA 3PRPB 3A8IE 1OTCA 3N3KB 3Q8AA 1QZGA 2NUCA 2VQEQ 4DV3Q 1E7PB 4A3DH 4KTAA 3AU5A 1G6PA 4KVGB 2JA6G 5ISRA 2FCSA 3OOCA 4LK0M 4O0AA 1MSHA 3HM6X 5LMNQ 1U4LA 1S3OA 2MP2A 2MA9B 3C46A 3AQQA 1VCBA 1UGMA 3WWVA 3C3LA 3IFWB 3EECA 1E6EB 1S5ED 4JI0Q 1JC7A 3PRZA 2AQ3B 5EKIA 4F8MA 2K14A 1L0YB 5C4JB 2E2HB 2L8JA 3A8JE 2A6ED 1SSOA 1LM8B 2EXDA 2IHFA 2MBHA 1K28A 1HNWQ 4DV7L 1X65A 3PF4A 3MC8A 1KF6B 1WZ0A 3J7AV 3I4OA 3F2CA 1SNDA 5LXIB 4KKUA 2JVCA 3R8BA 2CKZB 3HOZG 4IFDG 5DPWA 2B2TC 4FXKC 4XGAB 2KQ3A 4KZCA 1WJNA 4Q5VA 2K8HA 4WIPA 1JR0D 1PH6A 4LF4Q 4MN3A 2HTME 4FULA 1JOQA 3RN9C 4ABNA 3CIRB 2TMPA 1NI3A 3ZW3A 4DV6L 2K5WA 3S1QB 1DOIA 2RBMA 1I4QA 1VF5C 2K25A 2LRUA 3STBD 3AE3B 5BN5A 1EZ6A 2F52A 3HRDD 4JI4Q 3A56A 5K5PA 3KJOA 2DYMA 4KSLC 3K7UC 4LJPB 4M00A 3CCUA 5ELBA 4GXBA 4PYZA 1JOOA 4IQZA 5LMUL 4HIMA 1BF4A 4A3CH 3G6EA 4AWJA 4DR1Q 5CHVC 2DZIA 4L23A 3LXFA 4RM8A 4GGQA 2CS4A 2LEKA 1C0AA 3A1QA 2WXQA 5G5HA 4GLVB 3PVLA 1JMLA 5CBEE 1HHVA 3BZDB 3KDFA 3AECB 2GI9A 4DWFA 2G1EA 5IGGA 2ZVOA 1WFQA 4YSXB 2MRPA 3HM3A 4X3SA 3HIZA 1NSNS 1JCKB 4JBKA 4KLKA 4EFOA 1VQCA 1DGJA 1SRUA 1MVKA 1EY9A 5NUCA 5JHBA 4I7ZC 2RQXA 3C2PA 2UUAQ 3QA8A 3KLSX 1V9PA 3M85A 2F0KA 1N60A 1HZAA 3MEHA 2IWHA 2JA5G 2WXLA 2Y3AA 4LF7Q 2Y0SE 2B2YC 2RSUA 4LFBL 1XJVA 5JVG3 3ONSA 1MKHA 3VTWA 4NQLB 3L0WB 1K83H 4X6AH 5K36G 5AEKB 4J8QA 2CH4A 1K52A 2NWGA 4LUVA 2RDFA 1LTBD 1XO3A 5BYSA 4H13C 5IP7G 2PE9A 4YWLA 3SK5A 4N8FA 1IYJB 4LF4L 1VQOA 3E5SA 1PTOC 4C3HH 2YTXA 2F0NA 4W9FA 1QLBB 2UUCL 1K83B 2Q2UA 1LFDA 4CDCC 3OHXC 1CUKA 4RG1A 1YNTE 2K22A 3CCSA 2ZJQA 3FPPA 4J6HA 3TRZA 3PO0A 4G11A 3BS1A 3NPPA 3AM9A 3MP9A 4PYUA 1MG4A 3U9OA 3L13A 3FC4A 3RYTA 4OZBA 4C3HB 2PMZE 1W6KA 2QW7A 1N61A 2ASQA 3TDQA 1T0RC 4GNXB 1EUJA 2WXKA 5IE8A 4A3KG 3MTSA 1PYBA 3WOEA 2F0JA 1R4MI 1UELA 4BBRG 1HNZQ 5HFYA 3IT4B 2Y0SG 3AU4A 1F2RC 4ILWA 3DOWA 2IO0B 3A9JB 5IOIA 4H7BA 3VYRA 4DN4M 1B9RA 1IYUA 3NXWA 1L5PA 1WGDA 3GTMH 1VZ6A 3RUIB 3PO3H 1RDPD 3BVMA 4R4TA 2ZEQA 4OVZA 2DUDA 3UI2A 1I4RA 4UAIA 1TWFH 2DGYA 2QSDA 3GB1A 3AE9B 2ZM6Q 1PTOH 4PZ8A 2VZAA 4NXNQ 1P98A 5J22A 4HJKA 3ZNID 1R9TB 1WMHA 2JN4A 2WXRA 4LUOA 3DMUA 3A4SC 1YN4A 1CKNB 1EYDA 4XX5A 2I2YA 3GTMB 4N9F4 3U8ZA 4C7ZA 2KDEB 3T1YQ 3NY5A 4OZAA 4IUUA 2I1KA 2PNHA 1XT9B 4A8XC 1WTWA 4BY7H 3DPDA 4HIOA 3LB8C 2BS4B 4LF7L 3KUCB 1RTOA 1P8LA 3W5VB 1VQIA 3AU7A 3U7DA 2PZWA 3VXWA 1BCPD 1LXDA 2L83A 1W2BA 2GA4B 4OL7A 1PFBA 3TN2A 3HOVH 3T4AC 3NS1A 2O6VB 1RD9D 3ZNGC 5J17A 4BBSG 4IPHA 3PREA 3SDZA 4QY7A 1SBBB 3TP5A 1YMHE 1RJTA 4HN7A 2WKCA 1YIJA 4BY7B 4EEWA 2GB1A 1GPXA 1XTDA 4YSYB 5L37A 4ZRQA 4IPGA 4WJOA 1WGHA 2RPVA 3B0AA 3HOVB 3A54A 3A9KB 1CM9A 4DU9A 4K7SA 1WSPA 1WTQA 2IHEA 1TS5A 4HSPA 4EE2A 1SE2A 4BBNC 5DEHA 1FRDA 3ZJUA 1MI2A 4A75A 1JJCB 2ZXOA 4LNOA 1DOMA 3H7PA 1F77A 4EQNA 4AYBG 2NTSA 3GTKH 1NMGA 3D0FA 4CDEC 5FLXE 4OX9Q 2ZXRA 5FLMG 2NMQA 1G291 2XRSD 3RLOA 5JXVA 2OEOA 4KY5A 2F0HA 2UUBQ 1TYGB 4IM3A 1K3RA 4PK1A 2BKRB 1XNQQ 2O2VB 1F9RA 1Y1WH 1M8AA 2RSNA 3L0OA 1CJEA 4JOIA 1WX8A 1VR9A 5IGDA 2R93H 3FILA 4YWGG 2E74C 1TKWB 2OTLA 1PH1A 1STBA 3HOWH 1QOBA 4FDBA 4YY3L 4JCVE 2F1MA 1TWHB 1MIUA 2FIDA 3DM3A 3HOYB 1XCTL 2KECA 3GV3A 1FMAD 1HEZE 4A3EG 2JWZA 3QHTA 1KD1C 3ZTCA 4ID6A 1TS3A 4MSMB 4UP8A 1JWBD 1YIWA 1I35A 1XLQA 1ML0D 3BDCA 3ZNHB 1FXTB 3VFKA 3NWSA 2R93B 2CHBD 2K5VA 2F03A 1II3A 3PMFA 2F0TA 2VH1A 4YXDB 1NJIC 2K3UA 1MPEA 2VZKB 2LMCA 4XDCA 2PQAA 5FKAC 4QJFA 2MP2B 1RFAA 1E24A 2HJ8A 3IAS1 3M9BA 5IGFA 1XEEA 3Q3FA 4IJHA 3NBIA 1VQ7A 4NB3A 2EYJA 4JI1Q 3HP3A 3Q8BA 1ZPSA 3I55A 5FOBB 1WTXA 3R66C 3UF8A 2HIVA 1TWAB 1BO0A 3VR4A 1E5WA 2R7ZH 5CYUA 1E90A 2QDFA 2NVUI 3G7LA 1EIHA 1UBIA 3VR3A 2XK5A 2OJWA 3PPAA 1IKLA 2K8BA 1TU2B 2DJFC 4ME3A 5IYBH 1BQQT 5GROA 4DUZL 3IT6B 2MH7A 5E7NA 1WM3A 5JPNC 2K39A 4A3OA 1IBKL 1VF7A 1KQSA 4IN3A 2KDMA 1MG8A 2LHDA 3I9V1 2I5LX 2MJEA 1STNA 4A3LG 5IY0A 1K0SA 1B8AA 1GUOA 2JEBI 1CA6A 3SFDB 2CQOA 3W1SC 5J18A 4LMQD 4AQYL 2I0QA 4K0KQ 2IY0B 2JT4B 3K9OB 5CC4A 2JA8G 1TTNA 1C4AA 5G3LD 3VRAB 4Z9CB 4KJNA 2VQFQ 3LJ3A 5HGQA 4BXXG 3GV6A 1L1OA 3BIID 2KC2A 1PGXA 4TV3A 5ELDA 1QUQA 2EJFC 1DOYA 2WAQB 1KDAA 2RHSB 5C3XA 1YITA 1V8QA 2JWUA 3TSSA 3AI5A 3B2GA 3Q0AA 1A70A 3EHVA 1Y8PB 2KT7A 3KH0A 2LD9A 3Q8FA 1HR0L 4N9PA 4QQBX 4BKGA 4K7UA 2AL6A 4BKSA 1E7UA 2PLPA 1YVCA 4JI7Q 1VQJA 3GDEA 3NEMA 4DHZE 4ZCKA 4OXPA 4H2AA 1J7CA 2NS5A 4E74A 3A1QB 3BU2A 2NVXB 3UINB 5C44G 3AEGB 3WA0A 1E2WA 2JE6I 2JK8A 2PI2A 1VQFA 3KDFB 4CDDC 5EE9A 4IUTA 1UBQA 1K53A 3S15B 4ZQ3A 2MQJA 2KAJA 4EOYA 3FDTA 3ZLZA 1TKGA 4RMAA 2V0GA 1C8CA 1LTRD 4RNAA 3KWLA 5IP9H 4N8X1 2ZPNA 4XQJA 4CGYB 4KDIC 4PZ6A 2VUMH 1NR2A 4FJZA 2MHVA 4A3GH 5KGUA 3ECIA 2F0DA 4EUTA 1OXTA 4DGZA 1E0ZA 2FAZA 4QB4A 4B3SQ 4NXMQ 2K9XA 2LGYA 3W1GA 3BG3A 1IBMQ 3RMHA 2CFMA 4BY1G 4JPSA 4ZHOA 3TL5A 4RM9A 2QA4A 1M4VA 3EJIA 2VUMB 4TVAB 1SEBD 1EIGA 5AJ3L 3FAHA 1KC8C 4A3GB 3VRBB 2GBMA 5L95C 4B3ML 3I7FA 1EQQA 3K58A 1TWCB 4CKEA 2JU6X 2N9PC 5C4HA 2BA1A 4MZ9A 1EM7A 3NUCA 3Q14C 4EGVA 3Q6BA 3RFZB 4YHHL 3IAM1 2MO0A 2GVBA 3DWPA 2M19A 3GZNI 4W9IA 1TKYA 2RHQB 4YWKA 1WXQA 1Z5SB 2FUG1 2IGGA 2VQFL 3OLMD 1HXYD 1NYRA 2J0JA 1YNJC 4IOIE 4XYQA 2KFKA 5F2DA 5E4WC 3J80c 4DR6L 3BJUA 3CQZB 1K51A 1RFKA 2GBNA 1IP9A 3F2BA 4HSVA 3A7LA 3VR6A 4US9A 1F2RI 2WQYB 3K5MA 3PV1A 2JA9A 4F87A 1UZXB 4GDLA 4KKSA 2BWFA 2NYZD 1GKHA 3JC66 5E4XA 2RPQA 1YNND 1PH8A 2KQ7A 1CMXB 2EMSA 2ES2A 1WCMH 3JAME 4M02A 1GC7A 1DXMA 4L5TA 2M8SA 1MJCA 2MHJA 2ZW0A 2EYPA 5GXGB 2N88A 3M63B 1PZJD 5D14A 1N32L 2Q8IB 1JE5A 3MZ5A 1VQ9A 5BN3A 3DWQA 2YTVA 4HIKA 1IBLQ 1ENCA 1VDZA 4RAUC 3I91A 1WCMB 2WDQB 2P5ZX 4GOPA 3HOZB 1FXIA 4UPAA 1G8ZD 1NE3A 2WB1E 3HKZE 1Z2MA 2WLBA 1J5EQ 4NAWA 1EYGA 3DWAA 2OHFA 3N9YC 4HJGE 1ET6A 3AE1B 1B1ZA 2F4VL 4A55A 2JSOA 4WJNA 3FKIG 3VYTA 1WMHB 1YQ3B 3BDOA 1C4CA 4IUVA 1I7HA 2WDVB 2ICEC 1AW7A 1WVLA 2DN8A 1CZWA 4QF4A 1B44D 2OXPA 2F0LA 4HCEA 3C8YA 1EY6A 5CTRC 4FXGC 2B2VA 3HG9A 3E56A 1HFGA 4QUFA 1HNXL 2A6HC 2ENBA 4UP7A 3IRBA 2CHWA 1BCPB 2QHOA 3Q2AC 4KN4C 3N1XC 4N59A 4JBJA 3AE5B 1SNMA 2JXTA 2GN5A 1P0RA 3B6YA 2N9KA 3K5LA 2QC8A 1ZE3D 3DHIC 4FVMA 3SGIA 3S16B 4WJPA 1WX9A 1FYCA 3V61A 2B63H 4DR3L 5D94A 1E3PA 1Q82C 1ZXTA 5M3MH 4A3FH 3VAWA 1UEBA 2JSVX 4XTCS 3H15A 2VY3A 3I4MG 4L5QA 3EVQA 3MAQA 2C35B 4DXFA 3ZRFA 2WB1G 4ANXA 2NN6H 4FF2A 2KLGA 2BYTA 1Q0WB 2LGDA 3HFZB 3OIPA 3VH3B 1GUSA 1N36L 2BWES 1WYGA 2J0MA 1SIJA 1K0RA 4C3JH 4FBJB 5C3EG 1FCLA 3H7PB 5M3MB 2QILA 1R7SA 4FO2A 5AUIA 3E6ZX 2L05A 3DHHC 3L7ZC 3PRMB 2LKVA 4OIJA 1FD7D 2PPHA 1H9JA 3K0XA 3U9SA 1Q3LA 1XPOA 1VD2A 2PMVA 5IYDG 1JRPA 4MT5A 1HZ9A 2F3VA 5M5WB 3S2HB 4XC2A 3B9JA 5EE0A 4C3JB 1KLVA 3G48A 4BBNF 4TKNA 4BKTA 1CTMA 2K7VA 4DV5L 4A93G 3OMCA 3FILB 1LTLA 1IL8A 1BKBA 2MBBB 2Z6KA 1T3QA 2OOBB 3TMPB 4DAVA 1JJGA 2R92H 1CK1A 2SOBA 2NVYH 1WE7A 3TUOA 4RHRA 3PIP3 5KNCA 1SYFA 4B3TL 3GS2A 2ZNVB 1F9PA 4E71A 4IKGA 3J7AF 3HGBA 3TS0A 2F0VA 4L63B 2BGFA 4WWOA 2LMCB 2R92B 2PQAB 2JJQA 5CHFA 2I07B 2NVYB 1XMOQ 1A62A 2G45B 1C7YA 1TWGB 4X3TA 1B9MA 2IW3A 1L6UA 2Y5BB 3VR5A 1YN5A 4HK2A 4M8MA 1T0SC 3KJPA 4N6EB 4AUQC 4KGSA 4P74A 2SAKA 3AFPA 3GTJH
chains in the Genus database with same CATH topology
2LHEA 3NHHA 1FFUA 1D5MC 2VXWA 1VZ8A 3L4PA 1DONA 3Q6SA 2JX5A 2QDBA 3BYTB 3IL8A 4BBRB 3W9CB 1HZ5A 4QIWB 3AB9A 2Z1CA 1MSGA 1GB4A 3GTJB 3T56B 3IXSA 1HTLD 4KKTA 2KACA 1BUVT 4JK1C 3L9AX 4KK7A 1OXUA 3MA2B 2ICIA 2N0SB 2PW7A 4KY7A 5A2QL 4PT5A 4KY6A 2X6GA 1I3QB 3H6MA 1CT1D 1L0XB 1LLRD 1Q8IA 5CV7A 4ZKCB 3MFGA 3V96A 1J9OA 3GTPB 4DA2A 1MGSA 1VDVA 3HS0C 4IUPA 2MJ8A 2B39A 2PCFB 3SK8A 4BBSB 4ODGA 1AN8A 1CI3M 3CWIA 2DWQA 4ITKA 3FEWX 5KNDA 5C0XH 4K6LA 3H94A 1SMYC 4KGTA 3BWUD 2KMMA 3MC0B 3J80L 2JZPA 1O80A 1SJHD 1IHZA 4UDUC 2BB5A 4JX1C 1A3TA 4AYBB 3M7GA 2LS01 2MGSA 1RKNA 4KHVA 1IW7D 1TZOA 3D4DA 2K01A 1V1OA 5BMIA 4M8AA 2A69D 2IL8A 4N9TA 1UGJA 3OPOA 4K6DA 2D62A 2EYOA 1BDOA 1L0VB 2DYOA 3GO5A 2WXGA 1LABA 1ENFA 4RHSA 2E3TA 3TP7A 3S1NB 1EFID 3BDLA 3CKIB 2F0EA 3VA7A 4PQXA 3AMZA 4TQ0A 4RCOA 2O4XA 3EQLC 4GDLB 2V3PA 1GXDC 3QB3A 5H92C 3BK2A 3IFDA 3G6JB 4B08A 1OQQA 3DM1A 1W6JA 2F0SA 2F0PA 4LLGM 4N58A 4KX6B 1Y69U 2F0FA 2IX3A 1JB3A 1KDCA 1XLNA 3TZUA 4X3UA 1C77A 4WFN3 2VZKD 3KUPA 4NAWB 3U2SC 3EGRA 4ZKBB 1NR4A 5CBAE 5IGCA 1PDXA 5COYA 1WSPA 4KKIA 4OIKA 1O7YA 3H09A 1VLBA 1CA5A 1HQMC 5DM63 1H9MA 3KBXA 1Y56A 2YEPF 2R6GA 2WDRB 3ZYYX 5JEAH 3GD7A 3H91A 2W55A 5DM73 2F0WA 4XDXA 2NB0A 2R61A 4L6TB 3M3YB 2E76C 2PZTA 3VYUA 1NUCA 2M2LA 2WACA 1I6VC 4DNRB 1PDQA 2CW0D 1F2YA 1WD0A 4I65A 3SEBA 1ET9A 1E0BA 1QOFA 1V97A 5IODA 1JORA 4AQ7A 3SK4A 1B2TA 2J4XA 3MWYW 3MJ5A 2DY8A 4BY1B 2QKIC 2DY7A 2JA7B 2Q5WD 1S5BD 1X3PA 2INPE 2NVQB 4OZCA 3I4LA 3M4YA 1B4OA 2BE5C 1WRIA 4YT0B 3CRLC 1ZXIA 1PFMA 4OO1I 5FO8B 1EEFD 2SNSA 2QF7A 2EY5A 4LK1C 4C7YA 2RSOA 3CU7A 4ZYSA 2WU5B 1PRTC 1OXSC 3S2DB 2A68D 1AFPA 3NRZA 1GAQB 5JAVA 5E6JA 4K8IA 3DEPA 3SVMA 2BS2B 5C3JB 2EY6A 2X38A 5FO7B 4TSSA 3P4PB 1OXXK 4MIUA 4C1NK 2W3SA 4R9WA 3DUZA 1V8CA 3W1SA 2F3WA 3P75A 5C5MA 1SNOA 4KJOA 3I90A 4PV1C 3D3RA 2N55A 2M9VA 1EZ8A 1JQYD 1EEID 1SYGA 1STGA 1UWMA 4CBVA 3EFXD 1XX8A 2BDOA 1DJRD 1HFNA 3ETRA 1A2TA 3GTLB 5I2YA 2PKOA 4G57A 2B2WC 4QMGA 4K5VA 5ELEA 2MPMA 4DQOC 4K2LA 3V05A 3D8GA 2CU3A 2MJDA 4TKOB 5EKLA 4Q2JA 1SFOB 2L55A 4DAPA 1J7AA 1KH0A 3H8HA 4HRSA 1S5DD 1OO9B 4DFAA 4Y7NB 5AUKA 5C5LA 5KEEA 1BUIC 2MJ3A 1STYA 4P16A 2RMMA 4PMWA 5KRUA 2XVSA 5C3EB 1CHQD 3HOXB 3TMEA 1ZYRD 3RZOB 2SNMA 2Y5CA 1UUPA 2PO4A 4Q0FA 1C4PA 5EQ0A 1R4QB 4A93B 2J7ZA 1AZQA 3ZQ4A 2K5QA 1WTPA 1HCZA 4RGNA 5EPJA 3X3MA 4RFBA 2CQAA 2A6EC 2EY2A 1TY0A 1I4XA 3GTQB 2NVTB 3KWVA 2VB2X 3Q22A 4OO1G 4KD3A 2KCCA 2F0GA 1FM0D 5T1IA 1RCVD 5C2TB 2IJ0A 1GUTA 1Z6HA 1DD2A 2K0PA 4ZRPA 2L1BA 4MHEA 1TY2A 2K28A 4WAFA 1AEXA 4EVOA 4RKLA 3MXNA 3LYYA 1EQTA 5CV8A 2D5DA 4NAMA 3D31A 2HCCA 2QMTA 1S5FD 4KV6A 2HCIA 2WXIA 1ENAA 1KNEA 3K5NA 5D3IB 1AZPA 1TS2A 1TKEA 2PW9A 3NP8A 2PIAA 4B9XA 2LJIA 3M7NA 4JWUC 1FD6A 1P7EA 5EE3A 2L12A 1I50B 3R2TA 2B76B 4FYDA 2YYZA 4C3IG 4KN7C 4E6IA 2BCOA 4CJ2C 1D4BA 1S5CD 2EKIA 3PZ7A 3NUHB 3AB5A 3I4NB 2WP9B 2ACZB 1ICWA 3U52E 3NTIA 3QOJA 3NE5B 1B3AA 2H4OA 2RVLA 3NTHA 1SDFA 4XWTA 3OWEB 2HDLA 1FO4A 3EROA 1D5ZC 4FF4A 1K8OA 1SYCA 3AE6B 1JWUD 1SE4A 1U4MA 4C1NI 2KWDA 2J0TD 1A2UA 2Z8LA 5FK9C 2CVRA 5JVH3 1FFVA 5IT9L 3C1EA 4G7OC 1T6BX 3T3NA 1TQOA 5CV5A 1F9SA 4RWSC 4ME5A 3LNNA 3NBHA 1XXGA 1Y8NB 3N6RA 5HI1A 1RYJA 4S3SA 1QJOA 2B2UC 4HEA1 3TP8A 1EOTA 5J1ZA 3S9WA 1NEKB 3FVQA 1PUTA 3E0JA 3EUB2 4REZA 1CZGA 2MP1A 2F0OA 2XSCA 3PUZA 1PRTF 1LTAD 1STAA 3KK7A 5C6AA 2EVBA 2JA6B 1BXTA 1BCPC 3A8KE 2Z4IA 3HEJA 4TMAB 4M0WA 1KLGD 2E2DC 1Q1BA 3NWTA 3OSOA 4OGQC 3PZ8A 2E75C 1UAPA 1HZ6A 1YN3A 3DWGC 3PUWA 1PTOF 4IFDH 2CJNA 2Q8RE 3I73A 1N63A 2R3ZA 1XLPA 2LY7A 1TIID 5IIFA 1F2LA 4LTUA 2A74C 3URYA 4FNFA 3D4RA 1SYEA 4YIJA 1A15A 3LX0A 4KGRA 1FNUA 4L8JA 5D65A 2L0CA 1WTVA 1A6XA 1STHA 2EOTA 2XNAC 2BDNA 3KBGA 1NYQA 3L3OC 1C79A 4L1BA 3BVZA 5A35A 4C2MB 1PZID 1E2VA 1TVXA 2OEDA 2D5GA 1QG7A 1X32A 1K8MA 2PPBC 3R93A 4C3HG 2F0QA 1N5WA 1OQRA 1LO5D 3FPUB 3S1RB 2IX0A 2VB3X 1QOHA 5C4XB 1WD1A 3CRKC 2EJMA 1JQ4A 5M9OA 2IPKD 1SSNA 1EY4A 4MM3B 3SK6A 4M1UB 2DBYA 2ZT9C 3HVZA 4NJCA 1MD2D 4IZ8A 3HRZC 3S17B 1Y1VB 3BVGA 2O5JC 3UI3A 5K36H 2KHSA 3IKJA 2XWJB 2JA5B 1H9KA 1T5EA 1VZ7A 4RH6A 1WWTA 1E10A 2O5IC 1G2TA 1Z47A 1DM0B 5CV6A 1JWSD 1FR3A 5KYLA 2EY1A 2L11A 2BTEA 1BOSA 4AS1A 3VYSA 3WCQA 2E2IB 3R2IA 4NW2A 4B0MA 1EY0A 4IUQA 4A6QA 1KNAA 5I9PA 2HQEA 2FMMA 1RHPA 2YU9B 4US8A 1R4PB 2JXMB 4NMZA 2Q8TA 1EY7A 3NVZA 1HRJA 1FCCC 2BT6A 4EQPA 1E9MA 2L1AA 4A3KB 3NVWA 5G5GA 2B2TA 1XYIA 2Y0SB 4MACA 2PZUA 1EYAA 2JEAI 1EYCA 4ZHPA 4H0LC 2H89B 1OFFA 1QOAA 3AMUA 1D2BA 2PYKA 3AN1A 1HTPA 2W82A 2ZW1A 1PXUA 1P7FA 3GTOB 1NENB 3FRPB 3D4WA 5DNFA 2N7JA 3ZJVA 5CORA 3TEYA 2AUJD 3QWNA 3U7ZA 1EWCA 2EXZA 3HVDA 1L4DB 2PMZB 2K5DA 3P7JA 4O42A 2WXHA 2FE8A 3WOFA 4K5WA 4TQUS 1RWSA 5T8IA 2WS3B 2BA0A 5EJWA 1L4ZB 4RKBA 2FHTA 3Q24A 2AWOA 1IGDA 1YNNC 2LUMA 2ON8A 2V4IB 1CQVA 5HGTA 3M4OB 5HHDG 5EKKA 3KF8A 1SXTA 4YTMB 4IUNA 2F4IA 2L32A 5A2QE 4F88A 2CJOA 3AH7A 2B2YA 1H9RA 1Q12A 2FINB 2EDGA 3PO2B 2EYMA 4XT1B 4CJ0B 4BA1I 3PIO3 5D3DA 3CHBD 1E2ZA 1YQ4B 2F0UA 4WRDA 4V190 4HTHA 1XF5L 4A3EB 2WP8J 1V1PA 2VNUD 2PVGC 1J8IA 1I6HB 2B2VC 2K32A 1PFNA 1GHKA 1OXVA 2KOLA 5MPOA 4JBWA 5M5YB 3T13A 1KRHA 2HUGA 4NDXA 2K1BA 3SFEB 4WH4A 3J80E 2NTTA 1HA5A 1KAAA 3R3OA 4K8JA 1VCIA 3W5UB 1G91A 3TZDA 1TS4A 1LACA 2B2WA 2NN6I 3GP7A 1BCPF 2ID0A 3J9CA 5M3FB 4C80A 1KABA 3P1MA 4HAEA 2XWBB 4C3IB 3RLFA 3BYYB 2M0AA 2H1EA 2RA4A 1QNUA 1EY8A 2WXMA 3VR9B 4ZLTF 2QCPX 5CGKA 2K5PA 1S4ZA 5E3FA 2B8FA 3K7AB 2J53A 1QKZA 2JA8B 3J81E 2WXJA 3PV0A 3MXGA 2DNEA 1BR9A 1MBYA 1ILQA 1A3VA 1QT9A 2WXFA 1H9SA 2K33A 3I8ZA 5JPMC 2H88B 1QE6A 3T3OA 1UNSA 4A3DB 5EBCA 3ZGZA 3P1HA 5I6YA 5JJZA 5KNBA 5C44B 5EE1A 1WTOA 4R3DA 1PLFA 1IUEA 1PFDA 3K0YA 3S14B 1FIQA 3B2FA 4P6VF 1PYWD 3QG1A 1SYBA 1C9FA 3DEOA 4V0BA 1CZPA 1LT3D 3FMCA 4IFDJ 1XCQL 5IGEA 2K03A 5C4ZA 4TRDA 2MUYA 2KVMA 3TBIB 4FP5D 4RA8A 2INNE 3TEZA 1YJIA 3VA5A 1TJEA 2KJXA 5LL6X 1RF2D 2M00A 1BNZA 3Q8CA 4CKBA 2WINB 2MEKA 1VJKA 5G3LF 2V3NA 2WV6D 2X69A 5KIXA 2JP1A 1SNPA 5C0XI 4WJWA 1GOZA 1B50A 3HUIA 2FMCA 1C78A 4IURA 5T1GA 1UEAB 2Y5PA 3NTKA 2WXOA 2KCNA 3ONAB 3OWFA 2NN6G 2BW2A 1FGBD 2BBCA 4C3JG 3MVVA 2KEDA 1IW7C 1SAPA 2EYHA 1FEHA 2A73B 1TT2A 3T53B 1B9NA 3FKIB 3RD4A 2A69C 1ROEA 3QOLA 3S1MB 1U4PA 3P63A 3H3VC 3OMGA 1DOKA 2WKDA 1SF0A 2JYEA 1GB1A 3C1FA 5EBDA 5HG2A 3KLRA 1FNVA 4ARIA 1PZKD 2HDEA 1QWYA 3D6CA 3KLSA 1QNKA 2XIWA 1A3UA 1YJJA 2E2JB 5CV4A 1MHXA 4OW0A 4J1MA 4IALA 3I4MB 1IBXA 2WB1B 3HKZB 4RCNA 1MHHE 1HQRD 1PRTB 1BMLC 2B2UA 5I9OA 2WIIB 3D6WA 3T51B 3V2TA 3NSWA 5FLXL 2J52A 1L6VA 1O7LA 2M56B 1JW9D 3NVYA 4XWWA 4H44C 1QB5D 5FO9B 3PO3B 2OF1A 1HA6A 3VQIA 2EYLA 1JOKA 1I4GA 1QOGA 1TWFB 1PTOB 2ONQA 1VMPA 2JQRB 4YSZB 4WORA 1V1PB 1YNJD 3AE4B 1DOLA 4PMCA 2D9UA 2NBFA 1KTKA 1VRAB 3AV8A 5ELCA 2EELA 2AQ2B 5HURA 4L2YA 1D1IA 4A9AA 3F2UA 4OHJA 5C0XG 3NK9A 4ZUJA 3ND8A 2CW0C 4ZK9B 5C3WA 3IFTA 4RGMA 3SR1A 2WU2B 1JICA 5C0XJ 1WTRA 1JALA 2W3RA 1WGKA 2X6LA 1O7ZA 3GTKB 4YTNB 1CHPD 3QIAA 5M5XB 2KA7A 1TR5A 2JYOA 1ACCA 1EY5A 4QUCA 5DAUA 3OIQA 1CFMA 3I57A 4XQQA 5E1FA 1Y1WB 2A6HD 3AE2B 3MXUA 4BWGB 3VR2A 1XTCD 3HOWB 1EWHA 1F2ZA 1ZXHA 1H9SB 4YTPB 4XXEA 1XLOA 1GUNA 3N52A 5CV9A 3QJYA 2EYFA 4RGTA 1JWMD 4XT3B 4DXGA 1JWAD 3AE8B 2ZXPA 1ZDXA 4FXCA 1SB3C 3MHZA 3AEAB 1MI0A 2A68C 1ESFA 4QCLA 4HR7B 1G2SA 5JOBA 1U9RA 3W2DA 3ABVB 4NP5A 2JYTA 2F0IA 3AEFB 3LWEA 4B0EA 3ND9A 1LTTD 4ZUIA 4WQMA 2SDFA 4R8NA 4LJZC 5CR3A 4CQNA 2AWNA 5BMGA 4EQOA 3NVVA 4BA2I 2OT2A 4O1NA 3OW7A 4DK0A 1F2MA 1EQVA 3QO2A 2V4DA 4NKLA 4ULLA 2R7ZB 4XDDA 1QF6A 4HEDA 1Y8OB 3NQTA 3K59A 1LT6D 4G4KA 3MXPA 1KLUD 1GUGA 3A7AB 5I4DA 3AEBB 1ESRA 5IOCA 1G6ZA 2QIEB 4KI0A 2AQ1B 3RPFC 1RM6C 2PTLA 3EA6A 1QILA 3KQ4A 2FBWB 4DF7A 4XYOA 1PGAA 4FXDA 4KKJA 2IX1A 4JWSC 3A55A 5JEAG 2EPBA 1JROA 1SYDA 1GHJA 1IKMA 4PNYA 1IYVA 5JEAJ 3MHBA 5IGBA 1SNCA 3JAML 1LTID 3U4EG 1SNQA 4XQNA 4LAAA 1I4HA 1V43A 5IT9E 3P4SB 1ZYRC 1LT4D 3Q23A 1EL0A 1LV9A 4B9WA 1VMCA 5BMHA 3I70A 1N5XA 3GTGB 1F9QA 3PUXA 4MH8A 1SE3A 4DAYA 1NCVA 1IGCA 3SR6A 4FF1A 2KUMA 2G9HD 2C5CA 3I3CA 3HOUB 3PUYA 5KYIA 1LTGD 4CHTB 2RDHA 2XRQD 1Q1EA 2AUKA 5BYQA 3DHQA 4PMBA 1NAPA 2DNCA 1SMYD 2TSSA 2LGIA 4JE3B 5EGTA 2FJ2A 4CJ1B 1STEA 2BB6A 3IAYA 2WXNA 1LT5D 1NVID 4D2KA 1Q10A 1IBXB 2K04A 1LTSD 1EU3A 2BOSA 2K05A 3T16A 4R8IA 1FXAA 2AX5A 1AP0A 2IGDA 5LL6S 3ZJTA 1Q90A 4J3OD 4ZRZA 1KFYB 3AE7B 2L5TA 5ELFA 4ZAIA 1T5XD 3X3NA 1EWYC 3O13A 4HROA 1HUNA 2LFIA 3AEDB 3P42A 4GDKB 2L4NA 2W54A 5AFWA 4RF0A 4HCSA 1DYQA 3J7YW 1D1KA 2KEEA 1I4PA 4K5XA 3I72A 2QJLA 1AWDA 2PQEA 5BN4A 3ITPA 2NZ1D 2B63B 1HPCA 4A3FB 2WXPA 5EPKA 3DWMA 1XWEA 2DLBA 3Q8EA 2IT1A 3TEWA 2PVOD 2YEPB 3NQIA 4GLSC 5BYRA 2QEJC 1SJED 5I2XA 2RDGA 2N9LA 4IDIA 2B8GA 3E9SA 3P4RB 4XE0A 1FNWA 2PNRC 1D5XC 3V3XA 3NZ3A 1ZOYB 1GUWA 2PW5A 2RKSA 2BS3B 1ONLA 2EE1A 4U673 2J42A 1D6EC 2G9DA 4NZLB 3DXJC 1RTNA 1Z7TA 2XN9C 5LNK1 5CMDA 1DOXA 4KHZA 1AYFA 3H0GB 4ZOHC 2WNMA 4HMIA 2L9HA 4XIGS 3LWUA 1PGBA 3GQBA 4K2KA 3AEEB 2KN4A 4FF3A 3K5OA 4F7XA 1ZEQX 3Q69A 1K50A 1J7BA 3SHLA 2F0MA 1N62A 2EZVA 1GJXA 5EPLA 1UWXA 1X3QA 4KD4A 3SXHA 2BE5D 3W3AA 1CQFA 4RGOS 3PUVA 3SE0A 3WDNA 3P4QB 4P2CB 4HKZE 3VR8B 1KDBA 1ZUD2 3RUZA 2EJGC 2E6XA 2O2LD 4HMJA 4OO1H 4IFDI 1FRRA 1PRTD 4G7HC 1RODA 4GZYC 3RZDB 4A3JB 4X3KA 2FFKB 1BBXC 1ZDVA 2IGHA 4CKCA 3MFYA 1JE4A 2D2CC 4K14A 2L52A 1U4RA 5J39A 4ARCA 1C4QA 1EU4A 3BK1A 2A5HA 1O78A 3K57A 5H8YE 1PTOD 5FR3A 3HZXA 1DZ1A 4USAA 1ZP0B 1F0ZA 4U68A 5D7GA 3P20A 1DCZA 5I6WA 3K6OA 4A3BB 4WWMA 1QCBD 2GRIA 4C56C 2I38A 4WURA 4BS9A 2IDYA 4A3MB 2K6AA 4G7ZC 4A3IB 2KQ4X 4RF1A 3TP6A 3J81L 3ERQA 1C76A 4HKQA 4KMUC 5TSSA 2Z4HA 2C9OA 1HUMA 2I46A 2HDMA 4DNTB 5LHY1 4TQ1A 4DK1A 1PMRA 1B53A 1ZKOA 1ILPA 1C48A 2SEBD 2LFNA 1QQRA 3A8IE 3Q8AA 2NUCA 1E7PB 4KTAA 5ISRA 3OOCA 4LK0M 1MSHA 1U4LA 3C46A 3C3LA 1E6EB 1S5ED 1JC7A 5EKIA 2AQ3B 4F8MA 5C4JB 1L0YB 2E2HB 3A8JE 2A6ED 1SSOA 1KF6B 3J7AV 1SNDA 4KKUA 3R8BA 4IFDG 2B2TC 4FXKC 2KQ3A 4Q5VA 4WIPA 1JR0D 4MN3A 2HTME 1JOQA 4ABNA 3CIRB 2TMPA 1NI3A 2K5WA 3S1QB 1DOIA 2RBMA 1I4QA 1VF5C 3AE3B 5BN5A 1EZ6A 3HRDD 5K5PA 3A56A 2DYMA 5ELBA 1JOOA 4IQZA 1BF4A 4L23A 3LXFA 2LEKA 2WXQA 5G5HA 1JMLA 5CBEE 1HHVA 3BZDB 3AECB 2GI9A 2G1EA 5IGGA 4YSXB 4X3SA 1NSNS 1JCKB 1DGJA 1MVKA 1EY9A 5NUCA 4I7ZC 2RQXA 3C2PA 3KLSX 3M85A 2F0KA 1N60A 2IWHA 3MEHA 2WXLA 2Y3AA 2B2YC 5JVG3 5K36G 4J8QA 1K52A 2NWGA 2RDFA 1LTBD 1XO3A 5BYSA 4H13C 3SK5A 3E5SA 1PTOC 2F0NA 1QLBB 1K83B 1YNTE 3OHXC 2K22A 3FPPA 4J6HA 3PO0A 3BS1A 3NPPA 3AM9A 3MP9A 3U9OA 3FC4A 4OZBA 4C3HB 1W6KA 1N61A 3TDQA 2WXKA 3MTSA 3WOEA 2F0JA 5HFYA 3IT4B 1F2RC 4ILWA 4H7BA 3VYRA 4DN4M 1B9RA 1IYUA 3NXWA 1L5PA 1VZ6A 1RDPD 3BVMA 4OVZA 3UI2A 1I4RA 4UAIA 3GB1A 2QSDA 3AE9B 1PTOH 5J22A 1R9TB 2WXRA 2I2YA 3DMUA 1YN4A 1EYDA 3GTMB 4C7ZA 4A8XC 4OZAA 4IUUA 1WTWA 3LB8C 2BS4B 3W5VB 1RTOA 3AU7A 2PZWA 1BCPD 2L83A 2GA4B 4OL7A 1PFBA 3TN2A 3T4AC 3NS1A 1RD9D 3SDZA 1SBBB 3TP5A 1YMHE 1RJTA 4HN7A 2WKCA 4BY7B 2GB1A 4YSYB 4ZRQA 2RPVA 3HOVB 3A54A 1CM9A 4DU9A 1WTQA 1TS5A 4HSPA 4EE2A 1SE2A 5DEHA 1FRDA 3ZJUA 1MI2A 2ZXOA 1DOMA 1F77A 4EQNA 2NTSA 5FLXE 2ZXRA 2NMQA 1G291 2XRSD 5JXVA 2OEOA 4KY5A 2F0HA 1TYGB 1F9RA 1M8AA 2RSNA 1CJEA 1VR9A 5IGDA 3FILA 4YWGG 2E74C 1TKWB 1STBA 1QOBA 2F1MA 1TWHB 3HOYB 1XCTL 2KECA 3GV3A 1FMAD 1HEZE 4ID6A 1TS3A 1JWBD 1XLQA 1ML0D 3BDCA 3NWSA 2R93B 2CHBD 2F03A 1II3A 3PMFA 2F0TA 4YXDB 2K3UA 2VZKB 1MPEA 4XDCA 2LMCA 5FKAC 3IAS1 5IGFA 1XEEA 2EYJA 3Q8BA 3HP3A 1ZPSA 1WTXA 5FOBB 1TWAB 1BO0A 3VR4A 5CYUA 3G7LA 1EIHA 3VR3A 1IKLA 1TU2B 1BQQT 3IT6B 2MH7A 5JPNC 1VF7A 4IN3A 2KDMA 2LHDA 3I9V1 2MJEA 1STNA 1GUOA 2JEBI 1CA6A 3SFDB 4LMQD 5CC4A 3VRAB 1C4AA 5G3LD 4Z9CB 4KJNA 3GV6A 3BIID 1PGXA 5ELDA 2EJFC 1DOYA 2WAQB 1KDAA 2JWUA 5C3XA 3B2GA 1V8QA 4A90A 3TSSA 3Q0AA 1A70A 1Y8PB 3Q8FA 4N9PA 2PLPA 4H2AA 1J7CA 2NVXB 3AEGB 1E2WA 2JE6I 5EE9A 4IUTA 1K53A 3S15B 4ZQ3A 2KAJA 3FDTA 1TKGA 2V0GA 1C8CA 1LTRD 4RNAA 3KWLA 4XQJA 4CGYB 1NR2A 2MHVA 5KGUA 2F0DA 1OXTA 4DGZA 1E0ZA 4QB4A 2K9XA 3BG3A 3RMHA 4JPSA 4ZHOA 1M4VA 3EJIA 2VUMB 1SEBD 1EIGA 3FAHA 4A3GB 3VRBB 3K58A 1TWCB 4CKEA 2JU6X 5C4HA 2BA1A 1EM7A 3NUCA 4EGVA 3RFZB 3IAM1 3DWPA 2M19A 1TKYA 2FUG1 1WXQA 2IGGA 1HXYD 1NYRA 1YNJC 4IOIE 4XYQA 3TEXA 5F2DA 5E4WC 1K51A 1GPXA 3CQZB 1RFKA 4US9A 4HSVA 3A7LA 3VR6A 1F2RI 2WQYB 3K5MA 4F87A 4KKSA 2NYZD 5E4XA 1YNND 3JAME 1DXMA 2ZW0A 2EYPA 5GXGB 2N88A 1PZJD 5D14A 2Q8IB 3MZ5A 5BN3A 3DWQA 1ENCA 1VDZA 4RAUC 3I91A 1WCMB 2WDQB 3HOZB 1FXIA 1G8ZD 2WLBA 2OHFA 3DWAA 3N9YC 4HJGE 1ET6A 3AE1B 1B1ZA 4A55A 2JSOA 3VYTA 1YQ3B 3BDOA 1C4CA 4IUVA 1I7HA 2WDVB 2ICEC 1AW7A 1WVLA 2DN8A 1CZWA 4QF4A 1B44D 2OXPA 2F0LA 4HCEA 3C8YA 1EY6A 4FXGC 2B2VA 3HG9A 3E56A 1HFGA 4QUFA 2A6HC 2ENBA 1BCPB 4KN4C 4N59A 3AE5B 1SNMA 2JXTA 2N9KA 3K5LA 1ZE3D 4FVMA 3S16B 1FYCA 1ZXTA