3MC0B

Crystal structure of staphylococcal enterotoxin g (seg) in complex with a mouse t-cell receptor beta chain
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
233
structure length
228
Chain Sequence
QPDPKLDELNKVSDYKSNKGTMGNVMNLYMSPPVEGRGVINSRQFLSHDLIFPIEYKSYNEVKTELENTELANNYKGKKVDIFGVPYFYTCIIPKSENFGGCCMYGGLTFNSSENERDKLITVQVTIDNRQSLGFTITTNKNMVTIQELDYKARHWLTKEKKLYEFDGSAFESGYIKFTEKNNTSFWFDLFPKKELVPFVPYKFLNIYGDNKVVDSKSIKMEVFLNTH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of staphylococcal enterotoxin G (SEG) in complex with a mouse T-cell receptor {beta} chain.
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
molecule keywords variable beta 8.2 mouse T cell receptor
total genus 64
structure length 228
sequence length 233
chains with identical sequence D
ec nomenclature
pdb deposition date 2010-03-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF01123 Stap_Strp_toxin Staphylococcal/Streptococcal toxin, OB-fold domain
B PF02876 Stap_Strp_tox_C Staphylococcal/Streptococcal toxin, beta-grasp domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.110 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 3mc0B02
3.10.20.120 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 3mc0B01
3URYA 3MFGA 3BVMA 1LTRD 1TY0A 3EFXD 2RDHA 2XRSD 4RGNA 4L6TB 4BWGB 1PZJD 1YN4A 1YN5A 4UDUC 1V1PA 1TS4A 1I4QA 4RHSA 5ELFA 1KLUD 1TS5A 1BCPD 1V1PB 1SE4A 2R61A 3R2TA 1CHPD 1PZKD 1EEFD 1PYWD 1UUPA 1AN8A 1XTCD 1S5FD 1L0YB 1V1OA 1KLGD 1S5CD 1D5XC 1ET9A 1LTTD 1S5BD 1JWMD 3DWAA 2TSSA 1SXTA 1EU4A 4C56C 1I4XA 5D3IB 1TS2A 4RFBA 4RGMA 4RHRA 1PRTF 4Z9CB 1KTKA 2AQ3B 2QEJC 1LTAD 3CHBD 1BCPC 4L63B 4ZYSA 4RH6A 4NZLB 3R2IA 2XN9C 5FK9C 4DXGA 1BCPF 1T5XD 3KLSX 3BYYB 5ELEA 1MD2D 1L0XB 2IJ0A 1BXTA 3DWPA 1FNWA 3GP7A 1SE3A 5ELBA 1DYQA 2QILA 1EWCA 3BYTB 3R8BA 3EA6A 1HQRD 1PRTC 1LO5D 1EU3A 2SEBD 1JR0D 1CK1A 1PTOD 1SE2A 1RF2D 1JWSD 3DWQA 4O1NA 3MC0B 1ENFA 1I4RA 1LTSD 1TS3A 2XRQD 1B1ZA 1PRTD 1LT6D 2ICIA 1LTGD 5ELCA 1PTOC 2AQ1B 1LLRD 1XXGA 1D6EC 2RDGA 1FD7D 4TSSA 2AQ2B 3W2DA 1DJRD 1HXYD 1LT5D 1S5ED 5FKAC 2G9HD 5ELDA 1TY2A 1D5MC 2NTSA 1G8ZD 1LTBD 1PTOB 2CHBD 1CQVA 3SEBA 4K6LA 1PTOH 1PTOF 1LTID 4RGTA 1S5DD 1JQYD 3TSSA 2NTTA 1FNUA 1I4HA 1QILA 1PRTB 1RD9D 1ET6A 2J4XA 1GOZA 1LT4D 1EEID 1AW7A 1SJED 2Z8LA 1FGBD 1D5ZC 1M4VA 4DXFA 1SJHD 1B44D 1ESFA 1I4PA 1I4GA 1LT3D 3O13A 1F77A 2WV6D 3BVZA 4OHJA 3V05A 5I4DA 1JWUD 1HA5A 1RCVD 5TSSA 1RDPD 1BCPB 2O2LD 4RGOS 3BZDB 1CHQD 1FNVA 3OWEB 1YN3A 3BVGA 2IPKD 1UNSA 1JCKB 1HTLD 1CT1D 4RCOA 1SEBD 5D3DA 1STEA 2XNAC 1EFID 1PZID 1SBBB
chains in the Genus database with same CATH superfamily
5DCNA 5JAVA 3H94A 3PUWA 3SK5A 4KHPQ 1P1AA 3JW0X 3N9YC 1K0RA 2JYEA 3AM9A 3OTOQ 3S1NB 2KQ7A 1S40A 4R4OA 5C6AA 2MP2B 1T0YA 3K9OB 3N20C 3LX0A 2PCFB 1N63A 4K5XA 1UGJA 3DCGA 1HNXL 2KTFA 2PQAA 1FXTB 2MHVA 4L5TA 4OWTB 2ZNVB 4EOYA 1D3ZA 4CKBA 5I2YA 2NUCA 2K05A 2WAQG 4IOIE 3K7AH 5FLMH 4OIKA 3VR5A 2EMSA 1S5FD 3KDFA 2KJRA 4IPGA 2AL3A 4KZCA 1FCLA 2D62A 5IP9H 2REXA 4FULA 4LDTB 1WJ4A 3G6EA 2TSSA 1T3QA 4J6HA 1IPGA 1E22A 3PV1A 2INDC 4YWGG 3HFZB 2HJ8A 1FYCA 1ZKOA 5K36G 1QQRA 2EVBA 5C3EG 4JYAL 3DUZA 3NG0A 2K8HA 5JJZA 4KGTA 4H0LC 3SHQA 1WR6E 1C4CA 2KTRA 1IW7D 4BY1B 1EO6A 1OEYJ 3NJTA 5L95C 3F1ZA 4FLHA 4B3RQ 1EYDA 2BB5A 4V0BA 5EE9A 4UP8A 3N52A 3I8ZA 4XQJA 2F0FA 2RSOA 1L4DB 3MP9A 4XDDA 3I4NB 4ARIA 4MH0E 3E0EA 1B7YB 1YIJA 2Y5CA 3H7PA 1YQ3B 3AEAB 4GZYC 2DLBA 2L1BA 4MSQB 2XVSA 4B9WA 2XRQD 4FVMA 2CCZA 1NNXA 3FPPA 2NZOA 1B9RA 1OEYA 2WIIB 1GHJA 2NYZD 2EY6A 4LF7L 2JQRB 2VUMG 2DNEA 2MLBA 3IFTA 1NMFA 1WVLA 3AU7A 4WFN3 5G2NA 3SGIA 3EROA 5EGTA 1OTRB 4ZUJA 2BS4B 2LRUA 3NS1A 2RSNA 3EVQA 5FKAC 3HM3A 3CPWA 4FF4A 3ALBA 1DXMA 4DHZB 2Y0SG 4MJSB 2RHQB 3PO2G 3N1ZC 1K83H 3AFQA 1V8CA 4ZRIA 4A3BH 1PYSB 4X64Q 4QAYA 4WAAA 1GUGA 1E0ZA 3HOVH 2WXMA 4JI2L 1ET6A 3EHVA 4DR1Q 3S15B 2WACA 4IZ8A 1N34L 4X3KA 4TKNA 1MBYA 3OMGA 2NBVB 3U7DA 2G4SA 5IIFA 4JI8L 4J1MA 1WJ6A 1B44D 4C3HB 2INPE 2SDFA 1GO3E 2G1EA 2JYTA 2N9EB 4DAPA 1KJTA 5C4XH 2NB0A 4CHTB 1WGGA 2PTLA 3ZNZB 2NPTB 1YHQA 5A2QL 3KLSA 5BN4A 1S4ZA 4X57B 3KVFB 3X23A 4IALA 3U50C 4AYBE 5G5HA 4JWUC 1E10A 3OWEB 1MKHA 1NR2A 1PH2A 1C79A 2RD0A 1HTOA 4QL5A 5FLMG 5JH5C 2XNAC 1AFPA 1EFID 1Q12A 2H5XA 4GNXA 1V49A 3URYA 5M5WB 2KNBA 5BMHA 3K9PB 3RFZB 1UD7A 4A76A 4L6TB 2EXDA 3M9BA 1JJGA 1YN4A 2NWGA 1CZGA 3IKJA 2R2OA 4A20A 2PPHA 1I42A 2KA7A 1L1OB 1RTNA 4P75A 5HI1A 1A6XA 3QWNA 1TS5A 2P5ZX 4YSXB 4C3IH 1SNCA 1NCVA 2CH4A 1BBUA 2NVYB 3FKIH 2F0WA 3GTLB 1CKNA 2BKFA 1FMAD 4DK6C 2KHWB 2IO2B 2LXAA 2LVPA 2HCCA 1B4OA 4JL9A 3F2DA 1JB3A 3DWAA 1STNA 1LTTD 2YEPF 4DNIA 2KCCA 5J39A 2XWJB 2KCTA 1SXTA 4LUOA 3PO3B 5D3IB 2JA8G 1PRTF 4TQ1A 2EY2A 1Q8IA 2PMZE 3BIID 1KRHA 4MACA 2GBRA 3HZXA 1D1KA 4HXDA 1BCPC 4LAAA 2ZJQA 3IL8A 4BS9A 3LNNA 4KK7A 5IYDG 4RKLA 3BS1A 2CW0D 2ZPNA 2PW9A 2LJ5A 5M5YB 2I38A 4DHJD 1C78A 2E2IH 3VH3B 2DNFA 1DYQA 1PFSA 1EWCA 1NYQA 2H88B 2KCNA 1SF0A 3Q3NC 2SEBD 4QGUA 3PO2H 3J7AF 3KF8B 1N32Q 1WYWB 3OIQA 2YU9H 1I4RA 2PLPA 1DOYA 1UEAB 1KD1C 3OLMD 4MSMB 3M4OB 1WXAA 3KQ4A 3AE2B 3QHTA 1F2RC 2EMTA 3Q22A 1ZXHA 4QUFA 2IGHA 1XO3A 3ZNID 2JA8H 2KBNA 1YJNA 3PSIA 4K2KA 4KHZA 5JEAH 4L2YA 3QIAA 2R7ZB 1SMYC 2LHEA 2QCPX 3Q3OC 3CMMB 1Q1BA 3OPOA 3TS0A 3NVVA 1KC8C 3SFDB 1YJ9A 4JWSC 3SEBA 1WJJA 3SE0A 4ZRPA 1HTPA 5C44H 2RBMA 2FHTA 2MGSA 4W9LA 1I50B 4KD3A 1RKNA 1SB3C 3RI7C 1X6OA 4Q2JA 1LXDA 2E2IB 3PHWB 1H9MA 4WJPA 2JRIB 4R3DA 1N36L 2RPVA 4I6PA 3HIZA 5C0XG 1NEKB 1TJEA 4N59A 4KY5A 3Q3JA 1ESFA 1N32L 5J2RA 1VQ5A 3PMFA 3V05A 1WGYA 2LHDA 1RDPD 2I2YA 3U8ZA 4NJCA 4AUQC 1HZ5A 4IM0A 2O2VB 2BQQA 4FHJA 4WAFA 1GVPA 1D7QA 2NVTH 1ISNA 5C5MA 1STEA 3ZVVA 4NP5A 3RNUA 3IHPC 1VQHA 3F2UA 4BY7H 1YNTE 2KWDA 2PE6B 4KKSA 2QCZA 2GMIC 2L0CA 1UGMA 4A3EB 1YIWA 2DYOA 3NWSA 1XTDA 2HT1A 2NVYH 4CDEC 5C44B 2GI9A 2YTYA 4A3DB 2L32A 1X32A 3T16A 1J9OA 5GAHC 2IT1A 4A3GG 4W9HA 2IHEA 2AYOB 5ELFA 1SN8A 2W9NA 3VUXA 1TT5B 1PGXA 1WFQA 2WS3B 2PQAB 3P4RB 3ZYYX 3AE9B 1XTCD 2ZVOA 4XZ4A 2A6HD 1KLGD 1YNXA 1D5XC 2B2VC 2F0LA 4KN4C 1JWMD 4N8FA 1SMXA 3Q23A 1PH7A 1CA5A 1E2ZA 4L8JA 4M1UB 3DPDA 2B2UA 2H1EA 3NTIA 1M8AA 1KTKA 3VRAB 4CKEA 2QEJC 3UDGA 2FNJB 2OHFA 3EFUA 4B6WA 1TKEA 3ZLZA 3FRPB 3I56A 5A35A 1IBKQ 2GLSA 4IM2A 4W9JA 3TN2A 2L15A 2IJ0A 3HOVB 4FJZA 3CPFA 3T1HQ 1MJEA 3EN2A 2FBWB 5FOBB 3U4EG 5CGKA 3G48A 5EBCA 2BVCA 4OZBA 3TCAA 1VCIA 1KABA 2EOTA 2K9XA 3L0OA 4JE3B 1VS0A 1STHA 2GVBA 2SNSA 2HJ1A 4R4QA 2PO4A 2YTXA 3ERSX 2BTEA 1MJCA 2HHHQ 5C44G 1IKMA 3MTSA 1ZKHA 2VW9A 1K50A 5M3MG 3H7PB 2HIVA 4K8IA 4OO1G 1RYJA 1QNKA 4X3TA 1CI3M 4RKBA 1TWFH 1ZEQX 1JMLA 1UWXA 3BK2A 2VQEQ 1NR4A 2KVMA 1NVID 1DJRD 2K04A 3N30A 5H1SE 5EE0A 2EYLA 3RD4A 5IP4D 4HIOA 2K22A 2I1JA 1EY8A 3RCZA 1F2RI 4GB9A 4BKSD 3HG9A 4BBSH 4DV3L 2WP9B 1HEZE 1Q81C 3Q8DA 3C2PA 4BBRH 1PXUA 1BQQT 1LTID 4KD4A 4HJ5A 1XPOA 1NENB 3PRMB 3MXPA 3KH0A 2K5NA 2ZJDA 4IDIA 3TDQA 3A33B 3I4MG 4DV1L 1JRPA 2YEPB 1SR3A 2VZKD 4KSLC 1BBWA 3IAM1 1WTXA 4LK0M 1EEID 4NQKE 1AW7A 1JRUA 3P42A 2LVOA 3B9JA 4IUQA 2K75A 1WJNA 3NY5A 1DOMA 4LNFA 1MVKA 4X66Q 3D4RA 2KO3A 1H9KA 4YTMB 1LT3D 2GBNA 1F77A 3CQZB 2M0AA 1NTGA 2LRWA 2L0FA 1AEXA 4RGOS 2R92H 3RN2A 2MBQA 2DHZA 4F7ZA 4HPPA 4YWKA 1XF5L 2LZ6A 2JXTA 3HKZB 4B9XA 1SYEA 2GB1A 1UAPA 4MH8A 4MN3A 4A3BG 2LUMA 2DN8A 1L2FA 1K8OA 5IE8A 1YHBA 4QIWE 4KKUA 1S1QB 1XEEA 2E6XA 2JSVX 1FFUA 2CKHB 3WAMA 2AHOB 2KQ4X 3I72A 1IBLL 3TEHB 2IY5B 3MFGA 3J7YW 4DV7Q 2VH1A 4J8QA 1QOFA 1CKOA 4G4KA 2LXKA 1JT8A 3MC8A 5FLXL 3F2CA 4AQYQ 4LW1A 1YITA 4MGZE 4TV3A 2BE5C 3J80L 1U4PA 1I4QA 3HOZG 2PW7A 1L1OA 2HQEA 4I7ZC 3FKIB 1CHPD 2Y5PA 2L00B 4HK2A 4DR4Q 1Y1WB 2D11A 3MXNA 4GN3B 2R93B 2FMCA 2KXJA 2NBFA 1TIFA 3ND8A 1N62A 3NUCA 2HTME 5KNDA 1WTWA 3EGRA 2GRIA 4DA2A 1HQMC 5J18A 2WB1B 2W55A 3RNGC 3VR6A 1WRIA 1WXSA 4UP9A 3KYDD 1IXRA 4GKKL 1K28A 3N1XC 2R92B 3V62A 2KAJA 1IYJB 1V80A 1LTAD 2O5JC 2JWUA 1B2TA 3JSVB 3KYCD 2CR5A 4CDCC 2AX5A 1CKMA 2MPMA 1PH3A 2B63H 5IGCA 1M94A 3X3MA 3QJZA 1BCPF 2D3AA 2KC1A 3CSTA 1MD2D 3I4LA 3GTGH 1IBLQ 3NBHA 3I57A 1KRTA 3K5NA 3HOWB 1ZOYB 4DV2L 3AU4A 4FNFA 3L7ZC 4G7ZC 4JQWC 4ME3A 4GDKA 2JA5B 3AE7B 1PH8A 1ZDXA 1JR0D 1PH6A 1L2NA 2FINB 4GKKQ 1WX8A 3NQTA 3PUYA 3AE5B 1BO0A 2F52A 2WNMA 1EIGA 3V96A 3UE1A 2Z59B 2MFIA 1NBWA 4WQMA 4W9IA 4AH6A 5K5PA 4MGIE 1J6QA 3RNFC 2EYHA 3EFCA 2RDGA 2WYQA 4BBRB 2L3ZA 3S2HB 4GN1A 2MQHA 5BR8Q 1NAPA 1ZGUB 5BO4B 4JGHB 4DAYA 1F9QA 4IFDJ 4Q5VA 4LNOA 1G91A 1IW7C 2JA6H 5JHBA 5F2DA 3PO3G 1LTBD 2L8JA 4JI1Q 2G45B 5HGQA 1PTOF 2RDFA 2RVLA 3CCMA 4H7BA 4A4IA 4J15A 4GNXC 3BWUD 3TSSA 1GC7A 4JVZA 2L4NA 4Q0FA 1OTCA 4K7SA 2KQSA 3W9CB 3ZKJC 3ZIMA 3K0XA 1FRDA 4MT5A 1V6EA 3U58A 3AEBB 1Y56A 4DQOC 2K5VA 3HOZB 4O0AA 4PNYA 2BF8B 3RZOB 1RAXA 2FCNA 1IYUA 5JOBA 2HD5B 2MWSB 3W5VB 1JJ2A 3VYUA 3TMEA 4OVVA 3TEZA 3QARA 1WCMG 3E6ZX 1CM9A 2BYEA 3G6JB 3NVYA 1RJTA 1WWTA 1SYGA 4GLVB 3K0YA 2EE1A 3DBLB 1E9MA 4JI0Q 1N6ZA 1E8ZA 1VRAB 2FAZA 3IAS1 3QCAA 4M00A 1SNQA 1C8CA 2K14A 5CMDA 1YX5B 5BN3A 1XT9B 2UUBQ 1HZ6A 5CC4A 2BGFA 2J42A 1I7HA 4OX9Q 4HDQA 4OVUA 2LWPA 4OELB 4WJ4A 2ATWA 4A3BB 2NCNA 1WSPA 4A3MB 2PI2E 2YV5A 2KWUB 1L7YA 1O78A 4ZUIA 3WA0A 2WDQB 3NUHB 2HUGA 4QUCA 2VZKB 4AWJA 5LXIB 3T1HL 4IUVA 1LTRD 4IUUA 4DV3Q 1P3QU 3V3XA 3F8TA 3Q2AC 1PZJD 1XX8A 1V9JA 1YN5A 2LKVA 4CDFC 3HOUG 2F0NA 2OTJA 4F1SA 1VQOA 4LF5Q 2F0HA 2L83A 1V43A 3HEJA 1KH0A 2EJMA 3P4QB 3E0JA 3LYYA 1G6JA 3NZ3A 3WANA 4HN7A 4YHHL 5IKCM 2BPSA 3HHMA 1NY4A 1TWFB 4WJOA 2YU9B 2BWFA 2KT7A 5EPJA 2B39A 2CHXA 2O6VB 5KGUA 4E74A 5AEKB 3OHXC 1RHPA 2KENA 2JE6I 3BDCA 4JG2A 3DM1A 1PH5A 3S1MB 3E9IA 4IKGA 4PV1C 1I4XA 1YZ6A 2R92G 2D07B 1V97A 4B9KA 1QUQB 3CAMA 3PIO3 3I63C 1HPCA 3C1EA 2GBMA 3NZSA 3OW2A 4I6NB 3PIPA 4RH6A 1L6UA 2XN9C 5IGEA 3A1QA 3GOEA 4II2B 4II3B 1UBIA 2BA0A 5ELEA 4HPMB 4IPDA 4GOPA 4IN3A 4ZCKA 4YHHQ 3GTKH 4ID6A 4FYDA 1XD3B 3AEEB 2NVQB 4DR5L 1KDAA 4HJAA 4JPSA 1HQRD 3U9SA 2KECA 3MXNB 5EDSA 2RSUA 4ZAIA 2IWHA 2EELA 1Z6HA 3AEVA 4O1NA 4YCWA 3A8KE 2K3UA 1EWHA 1XNQL 3T4AC 2H4OA 1OXXK 2GA4B 4GLXA 2V4IB 3M4YA 4JI5Q 4DFAA 4DBGA 2HQLA 1XNRL 1VR9A 2K6QA 4OZCA 4ARCA 2BYVE 3ONAB 4TVAB 1WGKA 3M62B 4W9KA 2ZXOA 1AP0A 1Z47A 1A3VA 1P7EA 2KZRA 4MELA 2EYPA 5IO9A 3I90A 5BR8L 5LHY1 4A3CG 3DBHI 1N36Q 1KRSA 2NPTA 5T8IA 2GN5A 1NI3A 1BR9A 5BN5A 2XIWA 1GKHA 4RMAA 1LGRA 2HTHA 4HEA1 2VS1A 4MDKE 3JC66 1K83B 3W1BA 1QVGA 1EZ8A 2F4VQ 2JP1A 2V1CC 1Y8PB 5LMNL 3I3CA 4DDGD 1H95A 4BY7B 4JOIC 2MJ8A 2F0IA 4KTAA 4IOAA 2DYMA 2J4XA 2KJ6A 3CXCA 2UXCL 1B3QA 4LMQD 3TQYA 1FGBD 5IYBH 5C3EB 2DZMA 2K28A 4FP5D 1DONA 4DR2Q 1UEBA 3JAMc 1PYBA 3F2BA 4LNQA 4RM9A 3ER0A 1I4GA 4JI4L 2KFKB 4C3HH 2C9OA 5IP7H 3SK4A 2EQSA 1CUKA 3CRKC 4WH4A 2ZPYA 1VQDA 4JX1C 1KL9A 2BE5D 1VJKA 4PS8A 1IBXB 3WAOA 5G3LD 4DV5Q 2BBCA 3BZDB 1DOIA 4KKJA 5DNFA 1YNJC 2VXWA 5CV8A 2V1YA 4KJOA 4N9TA 2FMMA 3L9AX 3T3NA 3BVGA 3BDLA 4HJ7A 3PVLA 2Q2IA 3PRZA 1E7ZA 1CT1D 1I94L 1EIYB 1WYGA 2TMPA 1E0BA 1F9RA 5HGTA 2C5LC 2W3SA 4U673 3U30A 4EE2A 1E90A 3ML9A 2F0VA 2J0MA 3NXWA 1GUTA 3QR8A 4NJ7A 3OMCA 1TVXA 2XRSD 1K9MC 4XDXA 1BDOA 1HJPA 1H9JA 3H0GB 4BWGB 4ZLTF 1EL0A 1H8CA 1ML0D 4WJQA 1RM6C 1F2LA 4FA6A 4FHKA 2F3WA 2OEOA 1V1PA 3KJPA 3KWLA 3ECIA 4NY0A 1NJIC 3TEWA 1I35A 2D5DA 4BXXH 2E2JH 3E5SA 1SE4A 4FXDA 4A6QA 5E6OA 2I1KA 2MJDA 5IN7A 4FF1A 2R93H 2ON8A 4P2CB 3NRZA 4EQPA 4DF7A 2JPHA 1A62A 2ZCCA 2QHOA 4A3IB 2BH8A 2R2QA 2CQAA 1STGA 1EFWA 1YNJD 2LXJA 2KKCA 4C56C 4DAMA 3MHZA 2BS3B 2QEXA 3RUIB 1C76A 1XQQA 2DZIA 2KWCA 2NZHA 3DLLA 4WURA 4MGKE 2MEKA 2ZVNA 3AB5A 4DV6Q 3V6CB 2WHIA 3V6EB 1IYFA 5JVH3 3K7UC 1ICFB 4ZYSA 2E75C 5C3WA 1VCBA 2KJHB 4NZLB 2B8GA 2KN4A 1WGRA 3W1YA 4BY1G 3JAMi 3CCJA 3Q69A 3BDOA 3KLSX 3IBEA 1KFYB 2QW7A 1K8RB 4P74A 1SE3A 1Y69U 1GXDC 3CF5A 5D14A 3TP8A 1LQBA 1WH3A 1MJDA 3C0RB 4MJSA 4NAWB 1Y1VH 4A3KG 1PRTC 3RYTA 2K1FA 1R7SA 1PTOD 4O42A 1UWMA 3U9OA 2JSOA 1KQSA 3OJ3A 2K6AA 4WIPA 4H2AA 4EX5A 2WAQB 1WX7A 1TWGB 3STBC 4JI5L 3HK0A 4BFRA 1YNNC 1R4QB 1LLRD 3FKIG 4L5SA 1SNOA 3DBRB 2KX3A 4B3TQ 3DBRI 3W2DA 1IBMQ 3CQZH 4A3LH 1S5ED 1MG8A 2Q8RE 2E74C 2KD0A 3AV8A 2VB2X 1MHHE 2OOBB 4NNJB 2Z4IA 4LWCA 3VHTC 2K8CA 1TWAB 3B1LX 2ZT9C 5CV4A 3H91A 3J7ZC 2JA5G 2FCMA 3DVGY 4A3JH 3PV0A 3ZJYC 1H9SA 1SSOA 4RM8A 1MFWA 2KJXA 1STBA 3RD2A 2Z9HA 1J7BA 4KDLB 4EZLA 4OIJA 1O7YA 1IUEA 4FN2A 4X66L 1T0RC 1FNUA 3VTVA 1PRTB 2B3GA 2CHZA 1FFVA 2JUOA 2A6EC 1K52A 3V61A 5C1ZA 3MJWA 1AE2A 3S2DH 3EQLC 3M85A 5H8YE 1IKLA 5FLXE 1ASYA 4NXML 4DK5A 3JAML 2F0SA 1Z9FA 2OCEA 2ZTDA 2KDBA 4M8NA 1TBEA 5C3JB 3EBEA 3X3NA 1HHVA 2SOBA 2YVCA 4S3SA 4U68A 3H3VC 1YN3A 4C7YA 5C4JB 4A3MH 3HGBA 1SIFA 2Q8IB 4HEDA 2FUHB 1BF4A 2F0UA 3KF6A 4YWMA 3AXCA 4R4IA 3LB8C 4I7AA 4M8AA 1FXIA 3QWZB 1IZ6A 1UWVA 4RGNA 3WOEA 2WXNA 3B2FA 3DOWA 3ERQA 3ZDTA 1EY6A 5EAYA 1JOQA 3QB3A 2ALYB 3GDEA 2LASA 2KFKA 4PS3A 3QOLA 3PPAA 2ZM6Q 2VY3A 1VQLA 4YTNB 4OX9L 1OXSC 4FDBA 2E2DC 1D2BA 1LACA 3LJ3A 3R2TA 1GPXA 1SE9A 4HPLB 4BKSA 1DM0B 1JWAD 3M3YH 1SRUA 2M2LA 2D0PA 2RCNA 1EOTA 1PDXA 1PYWD 1AN8A 1T5EA 5M3MB 1AWDA 2K4KA 5GAGC 2NVXH 1J8CA 1WTOA 4F8CB 1F2YA 5CX3A 4A3MG 1FJGL 5C0XJ 4RFBA 1VMCA 4Z9CB 3M4PA 1X1MA 4HIDA 1Z7TA 3U4ZA 2MBEA 2XEWA 1C4QA 5IGDA 3J81c 2WXJA 3QAQA 4NB3A 2KTRB 2PZWA 3W1SC 3VRBB 1I94Q 3T51B 4WWPA 2G3QB 4TQUS 1T5XD 3PZ8A 3BYYB 3J81E 3L10B 3GQBA 4YWLA 4ICVA 1X56A 4KHPL 1U4AA 2VRRB 4K7WA 3T3OA 4GKJL 3KK7A 3A5ZB 3B6YA 2R6GA 3D4WA 4XGAB 2A74C 4A3JG 4MNOA 3UE0A 5AZHA 4X62L 1QCBD 4JK1C 4POFA 5DPTA 1N61A 3G7LA 3KYHC 3U4VA 2JYOA 3RNCC 2MCNB 1YHAA 2K33A 1B1ZA 2V9HA 3PO3H 2EJGC 1JB7A 2Q2UA 5LXHA 2M0XA 3B08A 4XIGS 4DUZQ 1R9TB 1D6EC 3K7AB 1Q7YC 1WXMA 3VR4A 3D0FA 1V9PA 2X38A 1Y8OB 1XYIA 4GU2A 5T1IA 4FXCA 2WU2B 4OEMB 4DUZL 1CSQA 3JAME 3AFPA 1Z2MA 4HJGE 3CMEA 3Q8AA 2L11A 3NP8A 3QG1A 2LFIA 4DV2Q 4GOPB 2RR9A 3D4DA 1QZHA 1WE6A 4AYBB 2K5DA 1E8WA 2IO3B 3A0JA 4QB4A 1K8GA 1FIQA 4KIKB 4PYZA 4R1JA 2J0TD 1YJWA 4UP7A 3MWYW 1PDQA 4H44C 1PFMA 2CKZB 2KEEA 5KYIA 3Q8BA 4GKJQ 1XCQL 3Q8FA 2KX0A 3ZJTA 3B2GA 1CZWA 1N33L 1YD8U 1ZW7A 3ZW3A 4MM3B 4JI7Q 2J7ZA 1SJHD 3J7A5 1X9NA 1JE4A 2WB1E 1VQIA 1KAWA 3LWUA 3R3OA 1PFBA 5KNBA 3AMUA 2R7ZH 3AE3B 2IBIB 4P6VF 4WQOB 5CV9A 5JPMC 5TSSA 5CTRC 5JJIA 3GTQB 2B3AA 2IO0B 5C4XB 2OQKA 2JXXA 3N1YC 5IOIA 5IGFA 2JZZA 3NWTA 5L37A 2DYBA 5AUKA 1IBXA 2IPKD 1JALA 5G3LF 5E1FA 2JF5A 4ANUA 5KHOA 4LNIA 3A7LA 1W2BA 4YL8A 1FR3A 1EYCA 2PYKA 2FXQA 3C1FA 4X62Q 3QQ8B 1KLVA 1YQBA 1SMYD 2QJLA 4RG1A 4K8JA 1JC7A 1QUQA 4BA1I 2VQFL 4XYCA 1Q90A 2AEHA 1DZ1A 2B2WC 2X6GA 3L17A 3N6RA 1A2TA 4IWOA 2F0OA 2WXQA 3RLNA 4P16A 2NS5A 1FGUA 3GTKB 1I3QH 1SFOH 2I5HA 3KWVA 1V1PB 2B2WA 2FJ2A 4QY7A 2JA7G 3M7GA 2KVRA 3JVZX 2ZXRA 3LDZE 4C3IB 1J5EQ 3HOYH 3HOXH 2B8FA 1KF6B 1DCZA 3CCQA 1KM7A 4CBVA 2IY1B 3T53B 1XMOQ 4H13C 2EKEC 2ICEC 2L12A 5C23A 4PZ7A 2XTIA 4LF9L 5M3FH 5LNK1 2IGDA 3Q6SA 3SVMA 2W54A 1VQAA 4LNNA 5D7GA 3FEWX 2JEAI 4DV1Q 2MBBB 5M3MH 2B2UC 2Q2HA 3Q14C 5IT9E 4ZQ3A 1V81A 4DXAB 4DXGA 1DGSA 1ENAA 2N7EA 1W6JA 4ITKA 4JI8Q 3HP3A 1Y1WG 1EY0A 1BVSA 1FNWA 3GS2A 2KHIA 1MHXA 4DR1L 3EECA 4NAWA 1UELA 1EIFA 5CV5A 3AN1A 5H92C 1LABA 4X65L 3PIOA 1XMOL 4FJYA 4W9EA 1SFOB 3E9SA 2BH2A 2RF4A 4TUUA 2JEBI 3M63B 2KLCA 1C9OA 2IDYA 4MTKA 2NN6I 4FBJB 2EZVA 4K3BA 2VUMB 1PH9A 2AUKA 1E8YA 3IAYA 3V2TA 1AE3A 2QF7A 3ZJVA 1E1TA 3M95A 4CO7A 1IBML 2WQYB 4A3GB 4CDDC 3J80c 3TUOA 4HKZE 4G7HC 4DAYB 2KMMA 3FPUB 2O6VD 1RWSA 1A0IA 2WAQE 4HMJA 1OXUA 2C7NB 4HMIA 1KOTA 2BWES 1N5WA 4OO1I 2N9KA 4JLCA 4BA2I 3ZO5B 1PA6A 3UI2A 4YSZB 4JI3Q 2UYZB 2SNMA 5COYA 1N5XA 4L1BA 2WXIA 5G55A 1I4HA 4AJWA 5KNCA 3BINA 4LLGM 1HNXQ 3ZXRA 2EJFC 3CMAA 1N34Q 4RF0A 1KAAA 5CHFA 5L83A 1J5EL 2XK5B 1V5TA 4DXFA 3SK6A 3HKSA 4V190 3DBHB 4FF2A 1CA6A 4I65A 4GN4B 1QT9A 1P8LA 4DV4L 2ZCBA 3KUCB 4LJPB 4OHJA 2PVGC 2BA1A 1N33Q 3WALA 3I70A 2UUAL 1KIXA 3H3VI 1BCPB 4L23A 4C3JH 4JYAQ 2UU7A 5CHWA 2D2CC 2O6VA 4WWOA 5JJKA 4JV5L 1V86A 5KYLA 1C7YA 1IYVA 3A8IE 3VFKA 2K1BA 2NVTB 3AE4B 4KI0A 4DR2L 1QNUA 1BOSA 4KY6A 2K52A 5M3FG 2N1VA 3A5UA 2WXGA 4G11A 4ANVA 3IVFA 2CU1A 2C35B 1WTPA 1SAPA 4PZ6A 3NZUA 2BOSA 3O65B 1H9RA 2D5GA 2F4VL 4A3DH 3D6WA 4JBJA 1GUWA 3GTGB 1RFKA 1T0SC 4HJ8A 1UBQA 4J6IA 4BOSC 3PREA 4URKA 1AZQA 3VA5A 4DR4L 5C2TB 4EZKA 4IPHA 1VF7A 3NK9A 5EE3A 2AWNA 3NQIA 3ULLA 2F0TA 3TZDA 4J3OD 5EPKA 4HTHA 4K5WA 3VDZA 4RF1A 5ELNA 2L9HA 1BT0A 4R8IA 4XYQA 1V2YA 4Y7NH 5DM73 4AQYL 1L0WA 2XWBB 2KMAA 3P4PB 3LXFA 3RR5A 1J0GA 2AQ3B 3FKYA 3E3XA 3A74A 5EJWA 4XT3B 5IYDH 3NVWA 1J8IA 3TRZA 3APCA 1E2VA 1HUNA 1CTMA 5FK9C 1Q1EA 3GD7A 2KDMA 5LLIA 2F1MA 3J81j 1L0XB 3NS8A 3FVQA 3VXWA 5ELBA 5J17A 4A3KB 4XT1B 2WXHA 4EEWA 3ULJA 1FJGQ 4GSWA 2XGTA 1UE7A 2JA8B 1SE2A 2RPQA 2PW5A 2FUG1 3KLWA 4HSPA 2KQ3A 3AB9A 1EF1A 2LEKA 1QG7A 4ZRJA 2V3NA 2R93G 3NPPA 1HZ9A 1Q3LA 4DUYQ 3FHWA 5M9OA 4QQBX 2BYTA 3HOZH 3HOYG 3S17H 4BBSG 2DZJA 4LJZC 4DV5L 1BUVT 4BBRG 2DUDA 4K14A 3HOUB 2KN5A 4DDID 5CBEE 2M00A 4AYBG 2ZJPA 1GUSA 4IO9A 1XMQL 2IX1A 1WRDB 4WORA 2KMCA 3D31A 1SIJA 2BT6A 1YNND 4K5VA 2NR2A 4R8NA 1SYBA 4B3MQ 4APVA 1F1HA 1E7UA 3D8GA 2KACA 1ACCA 4IM3A 4TMAB 1T6BX 3VYRA 3UDXA 3PT2B 1HCZA 2HCIA 2JK8A 2V4DA 3KUDB 5GQOA 2LVQA 5BYRA 2OJRA 2UUCL 1JOOA 3FAHA 5AUIA 1VZ7A 1SNPA 4LTUA 1GOZA 4DR5Q 4X3UA 1TT2A 4IUPA 2Z8LA 3UQAA 3J80E 1D5ZC 2ZTEA 4CJ1B 4ACFA 3UDFA 3JSVA 2WFWA 5E6NA 4NXMQ 1XWEA 2KHJA 4B08A 4A8XC 2B2VA 1EOVA 1OXTA 2ZM6L 2INCC 5E7NA 5DLQE 4W9DA 1GUNA 2VL6A 3VYSA 3HOWG 5EBDA 2PE9A 2DNCA 1EY7A 2FE8A 2UWQA 2CH4W 1FCCC 1XNRQ 2JRHA 3AMZA 4F88A 3D6CA 4OZAA 2NVXB 1IBKL 1EY4A 5D3DA 2D3GA 1B9NA 1M1KC 1ONLA 1JQYD 1RL2A 3KFUA 1F52A 2RDBC 1PLFA 4JIOU 4K1RB 1FD6A 1SE8A 1IL8A 2ZW0A 1C77A 2ACZB 1TY0A 3EFXD 1FXAA 1PGAA 3VH4B 3BY4B 2RDHA 3ENEA 4GS3A 3HRDD 3VVWB 2F0EA 3Q6BA 5FR3A 1N9WA 1FO4A 1AYFA 1XLNA 1CQFA 4RHSA 4IFDI 4O2DA 3GTOB 3A7AB 5C5LA 4Y7NB 3S15H 3A9JB 3IRBA 1ZXTA 2JN4A 1PZKD 2WKDA 2Z4HA 4C1NK 4A3EH 1ZXIA 4RNAA 1Y1WH 5CYUA 3C46A 1VQGA 2HDMA 3WAPA 1DOKA 1EEFD 3M4QA 1L0YB 3GTJH 1RTOA 3L54A 1L4ZB 3GV3A 2ID0A 1E7VA 1UZXB 2L76A 2QKIC 2AWTA 1SSNA 1YMHE 4RHRA 1V8QA 1WYDA 1A8VA 3VR2A 1HA6A 3CCUA 2F4IA 1ENCA 4GLAC 1J19A 2SAKA 4IWPA 3ZQ4A 1X65A 1MG4A 1G51A 4HCSA 3Q24A 3ZNGC 4BVUC 1MI0A 4PZ8A 4EQNA 2QSDA 3VAWA 4ME5A 4ZRKA 4X64L 2UUCQ 2LS01 4JBMA 1WMHB 2MA9B 4E6IA 1LYLA 1OQYA 3PTFC 5ELOA 4K81A 3KLRA 1HR0Q 4RAUC 3VA7A 2ZJRA 3RZWC 3TBLD 1EIHA 4CKCA 3LWEA 4X6AH 2BDNA 4P72A 4YY3L 3HVZA 5IGBA 2A5HA 1WCMB 2AWOA 1WI0A 1W3SA 2DAJA 3I7FA 3K59A 3NELA 3S1QH 1DGJA 3AULA 1U5KA 4X3SA 1TGZB 3TP5A 3APFA 4P1BC 3OJ4B 2RHSB 2WXPA 1PRTD 1SNDA 4A3LG 1LT6D 2EYFA 2A4ZA 2A69D 5KRUA 5IA7A 2CU3A 5JPNC 1M90C 4LF7Q 2FCSA 2AQ1B 2JA6G 3AE6B 3Q8CA 2MW5A 5C4ZA 2W82A 2FFKB 2QMTA 2WP8J 4S17A 4UPAA 2RMMA 3QX1A 4DK0A 5DEHA 3X0WA 1LT5D 1WXQA 3MXUA 2LGYA 4W9CA 4ANWA 4DV0L 2MHJA 3RT3B 2KHSA 4DHJB 1STYA 1YOVB 3FDTA 1G8ZD 1JWBD 3I55A 4MGYE 1TZOA 2N0SB 4LFAL 4P73A 1YEZA 2B63B 1NDDA 1LFDA 1VQ6A 4LUZA 3DHGC 2LD9A 2EY1A 2NTTA 1WTHA 3H6MA 4RA8A 3GO5A 2I07B 2N3SA 4HDOA 4P7IA 3FILB 4A3FB 3K6OA 4HSVA 3HS0C 5IYBG 4GXBA 1ZYRD 2ZZPB 3HUIA 4W9FA 4IJLA 1M4VA 1FL0A 3K58A 5LMUQ 1ZUD2 2OXPA 1EUJA 1QKZA 3O13A 4S0RA 3CP0A 5J1ZA 3M4OH 1GHKA 4ZRQA 4BKGA 1G2SA 1ZE3D 1IGCA 2X69A 5CORA 3DVGX 3ITPA 3I4MB 3V60A 4US8A 1CHQD 4C2MH 1VDVA 2I5MX 2O2VA 2NVUI 3S2HH 2K5HA 1O7IA 1CFMA 5TR5A 2YLMA 4F8MA 4DV0Q 1DOLA 4KKTA 3E9HA 3FMCA 2QDLA 4RCNA 1TYGB 1YQ4B 2JZ3B 3BVMA 2YTVA 2OEDA 3NHEB 1XPUA 4GLSC 5GXGB 2WXKA 2PMZB 4IQZA 1SYFA 4JI3L 3ND9A 4N9PA 1PGBA 3QC8B 1HH2P 1WR1A 3TP6A 1CJEA 4JW0A 4IUTA 5M5XB 4HJKA 5AZFA 1ILQA 2FIFA 1PV4A 4KY7A 2VB3X 3P1MA 3CKIB 1F9SA 1UE5A 4B3SL 1H9SB 4YTPB 1EYGA 3AH7A 1QOGA 1XLOA 1JICA 3ULPA 1HR0L 3MHBA 3S16H 2CVRA 1HNWQ 4LUVA 3SDLC 4DK3C 3R66C 1HTQA 4ASWC 2WB1G 2AUJD 5HKHA 5EE1A 4K0KL 1EU4A 3BJUA 3PIP3 1WTRA 3HKZG 3VYTA 1E1OA 1EZ6A 2KDFB 5GAEC 3N3KB 1GB4A 2JJQA 1SGHA 3H0GH 4EGVA 1VZ6A 1WCMH 3RN9C 2DY8A 3MEFA 3R2IA 3DWMA 3NENA 1J7AA 2LUEA 1QF6A 2WX1A 4MIUA 3DEOA 4R4TA 3DWPA 5CR3A 3GP7A 2KOXA 5C4XG 1Y1VG 4A3KH 1VDZA 1QLBB 2E2HH 3CCRA 4LFCL 1EWYC 1OFFA 2M1MA 4KIKA 2CJOA 1KHIA 2PEAA 2A73B 3WOFA 1XJVA 1F9PA 4K2LA 2JU6X 4PK1A 1D1IA 1W6KA 2WXFA 3ZGZA 1XNQQ 4AOFA 1EQVA 1TS3A 4A3CH 5JHAA 5HG2A 4BKTA 1VQEA 2L0TA 3UIPB 2A1AA 3MJ5A 5BYSA 1X3FA 4LF8Q 2N9XA 5ELCA 2FCQA 2JA6B 3VDYA 1FD7D 4JCVE 5AJ3L 5GADC 3HOUH 3ABVB 2AQ2B 3RZDH 4N6EB 3S1RH 4ICUA 4NKLA 3G71A 1WX9A 3MAQA 2M19A 2WDVB 1I50H 1ASZA 4IJHA 4XQQA 1Q82C 5I6WA 5IWAL 3OAWA 4XTCS 3ZRFA 5DPRA 4DR3L 5I6YA 4A3FH 1PTOB 3CU7A 4MZ9A 4C3IG 2F3VA 1PFNA 1GC6A 2M9VA 1PHJA 1WXVA 2C9WB 3MA2B 2K5PA 1GM5A 2PKOA 1QVFA 5BMIA 1PFDA 1O7LA 1HE8A 3GZNI 1II3A 4A93G 1HFNA 3MTNB 3NEMA 3I4OA 4FO2A 1LT4D 1C0AA 3PSEB 2CQOA 1EUVB 4KX6B 4PT5A 2F0DA 4E3CA 2PPBC 3HKZE 1R4MB 4KN7C 2KANA 2WLBA 3K81C 5C0XH 2JQOA 1A63A 5I4DA 2WV6D 2EYOA 5EKIA 2N9LA 4HVBA 4A3OA 1HA5A 2Y0SB 4NXNL 1ILPA 2LY7A 4AIMA 2F0PA 1HNZL 1CMXB 1WI5A 4RMFA 4B3ML 3A56A 1C48A 4HIMA 2B2TC 3OIPA 2E3TA 3CRLC 3RZFA 5LL6X 3L13A 3ZNHB 4LF6L 4OXPA 3P2BA 5A2QE 2IZVB 2Q5WD 3R3MA 2PQEA 1LUZA 1WZ3A 2V3SA 4ZKCB 1STAA 1Q10A 1WE7A 2NMQA 4HCPB 3RULA 3QOJA 2VQFQ 4W9GA 4I6LB 1WGHA 3OWFA 2JA5H 1L1OC 2ZTCA 4JI0L 2IY0B 2BS2B 3SR1A 2B2YA 2PJHA 4ZYNA 1Y14B 4PQXA 1A3TA 3STBD 3W3AA 1R4MI 1E5WA 2QDBA 1QOBA 4GIVA 1I3QB 5E3FA 3ZJUA 2L5TA 2BCOA 2UXBL 3NTKA 3A9JA 4ILWA 5FO7B 5EQ0A 4XE0A 1A70A 4K7UA 3T9LA 1GJZA 5I9OA 1K53A 1QOAA 4WJWA 4KGRA 4ABNA 5AFWA 1QVCA 5DM63 3AEDB 3TL5A 1ET9A 1TKWB 3S9WA 4LK1C 3NBIA 1AARA 1ROEA 2L7RA 3GB1A 4ZDVA 4JI7L 1TS2A 2CW0C 2QC8A 3S17B 2JVCA 1U4RA 1QJOA 2VZAA 1XPRA 3T56B 1NYRA 1BKBA 4YCUA 2WX0A 5HHDG 4M0WB 3CHBD 4UY8C 4L63B 4DR7Q 2HD3A 1VQMA 4C3HG 1TKGA 4OONA 2MP1A 3TZUA 3MFYA 5IP7G 2X6LA 1MSHA 4EUTA 2N9PC 3DQVA 4IURA 3U7ZA 4HWIB 2F0GA 5HY6A 5J22A 3IXSA 2PZUA 2K8BA 4YXDB 1WF9A 4F7XA 3Q0AA 4ANXA 3BK1A 3CD6A 2F0KA 1EU3A 3NVZA 3M3YB 3QA8A 1OQRA 2MNAA 2Z0DB 1RODA 4QCLA 3VR8B 5CHVC 1VMPA 2A68D 5DPWA 3R93A 2EIFA 2JT4B 2E2HB 4A93H 5NUCA 2GBJA 4HR7B 1TZ1A 1VLBA 2UXBQ 1TQOA 2LFNA 3TEXA 1V5OA 4BBSB 4KZ0A 3AI5A 3QO2A 3AYHB 2VUMH 1TKYA 1OXVA 1JQ4A 1K3BC 1VZ8A 5J3BA 3ICEA 5E6JA 4B0EA 2DGYA 4A3GH 4ZK9B 4FJVB 4DV7L 2Z6KC 1WOCA 4KV6A 1HFGA 1UE1A 2CHBD 3H9DA 4HCNB 2J7QB 3TREA 4BOZB 3DWGC 3J80i 3J7AV 3J9CA 2UUAQ 2N7JA 1F2MA 5D6JB 3W1SA 3AECB 3GTMH 4IUNA 4DR6L 5FJ8G 5C0XI 5E6PA 3HOWH 1QILA 3UI3A 1VQCA 2EYJA 3RPFC 2EDGA 1I5FA 3KUZA 3TJPA 4UHVA 4JBKA 1E6EB 3MVVA 2JWZA 4HJ9A 1C4PA 3L3OC 2OT2A 1IP9A 4X65Q 1B50A 4XYOA 3CF6E 2L52A 5T1GA 1U9RA 2DAFA 2PMVA 1E24A 4KJNA 4JC0A 3H3VH 4LNKA 3BU2A 3L0WB 1SYDA 3KJOA 4JOIA 1EY5A 2MBHA 1P9DU 1XLPA 1RFAA 2KDEB 2KUMA 2K7VA 3PUXA 1P0RA 4EZJA 1CKNB 2BDOA 2EKIA 3L4PA 4N8X1 1SBBB 4NAMA 4GGQA 3DEPA 3HOXG 3BZKA 2F0JA 4NDXA 3A55A 2OQ0A 4LF9Q 3S1NH 4HLEA 2KVZA 4E71A 2A19A 2CFMA 2QDFA 4UAIA 4NMZA 1HR0W 3MC9A 3TEYA 2Z6BA 4AS1A 4LFBL 3QJYA 4LFBQ 5M5XH 5DPSA 3MXGA 2VNUD 2LJIA 1P16A 4HIKA 2HDLA 1OQQA 5IYCH 3H7SA 3SK8A 4HROA 3DBLI 1WZ0A 3PO2B 2YYZA 3S1QB 2HHHL 4HCEA 2IL8A 4B3TL 4DNRB 2HE7A 5GMVA 4BAXA 3S1RB 4C00A 4A3IG 2WDRB 4DAVA 4B3SQ 3ZUNA 3MZ5A 1VQ8A 1DD2A 5I9PA 4RGMA 4A75A 5D65A 4GOPC 3EIVA 2DJFC 2N55A 3ML8A 3DM3A 3J81L 2B29A 1G2TA 1UF0A 4R4CA 5K36H 5HURA 1KDBA 2B63G 1KDCA 4PMBA 3S14B 1KNEA 3RMHA 4RWSC 2K39A 2DZKA 2QILA 4FXGC 2HDEA 4XX5A 4YT0B 3RMKC 5MPOA 1TWCH 1LO5D 2N88A 2GVAA 4P71A 3G4SA 4BBNF 4K6DA 1GD7A 2G5DA 4K0KQ 4A3FG 4GDLB 3D3RA 1U0LA 3N32A 3K5LA 1GJXA 2WKCA 3SU8X 1ENFA 1WJUA 4DV6L 1LTSD 3I73A 3AE1B 2Z6KA 1MIUA 2E76C 1T0QC 5JZEB 5M3FB 5FJ8H 3TS2A 2DBYA 2PNRC 5I2XA 4A9AA 1LTGD 4KGSA 2WXOA 5IAAC 1BUIC 4TSSA 1K73C 4GMVA 3S24A 4PYUA 4QIWB 4WWNA 4A55A 1HXYD 5JEAG 1BMLC 2LGIA 1WTQA 1A15A 1F0ZA 1MPEA 1VQNA 2G9HD 1R4NI 2H89B 3K5MA 1LM8B 2IGGA 1D5MC 2NTSA 2R3ZA 2UXDQ 3EC8A 4MTNA 4K6LA 4C4VA 5JEAJ 2JY6A 4FADA 1TU2B 4KVGB 4IFDG 5C3XA 3VTUA 1OGWA 2RGFA 2G4DB 1WM2A 1WFYA 2NZ1D 1C1YB 1E3PA 4ULLA 2AMCB 3GZNB 3D32A 5IOCA 2LMCB 5IODA 3OW7A 4MM3A 3R7QA 5JJLA 3P63A 3UINB 1N60A 3RLOA 1O7ZA 1I4PA 2LSSA 1PVOA 3CSFA 5LMUL 1NMGA 1U4MA 4WWMA 3VQIA 1VQFA 1HZBA 4NPSA 2O2LD 3GV6A 3P20A 3M7NA 2B2TA 1GUAB 1L5PA 2GOWA 2M17A 1Q5WB 3OYYA 4TRDA 3SFEB 3VR3A 1VQ7A 3DHQA 1X3EA 1X3PA 1QB5D 4KMUC 1UNSA 5CV6A 1VD2A 1SROA 1XLQA 2Z0SA 4CGYB 4YY3Q 1WM3A 1EF5A 3K57A 1WD0A 2D0OA 5D94A 3AQQA 4DN4M 2MH7A 4USAA 3FP9A 5FLXc 2ES2A 1C3TA 4C80A 3C8YA 5CV7A 2CS4A 2B2YC 4F87A 1WMHA 4A3DG 2N49A 2QIEB 1MI2A 3WIMA 5HFYA 2JZPA 3PF5A 3CC4A 3GTOH 4H02A 2M56B 1Q0WB 2AL6A 2WDTB 4NPNA 1KLUD 1BCPD 2LGXA 4XWWA 2R61A 3U2SC 4A93B 1U4LA 1E7PB 4AP4C 4TQ0A 4NW2A 3UQBA 3HOXB 1UUPA 3AU5A 1ZDVA 1EQTA 2FIDA 4LCDE 4PMWA 1V1OA 1HRJA 1S5CD 2WXLA 2CHWA 2DJGC 5EPLA 4DR7L 1Q8KA 4CQNA 2N7DA 1I6HH 3L08A 4IPCA 2N4FA 3P75A 1HNZQ 2NBUA 1BNZA 2OTLA 2MBOA 3PHXB 4C3JG 4K3CA 4LJOB 2I46A 2F03A 1VQBA 2V3PA 4DKAC 5IGGA 4PG3A 1VQPA 5LMNQ 4IG7B 4P1CC 1ESRA 3A8JE 4OGQC 2O5IC 2CWPA 4XC2A 3VTWA 5KHQA 4HRSA 4DPGA 5C4HA 4IOCA 2ASBA 3EA6A 4M01A 3VUWA 2CWAA 4LF4Q 2K01A 4GDKB 3KDFB 3C19A 4C4VB 1LTLA 2B76B 1CSPA 1PMRA 1LM0A 3FILA 3MC0B 5LL6S 3R7RA 4IFDH 3ZTCA 4BBNC 1YVCA 2C60A 2MQJA 3L2PA 1BBXC 4YIJA 3PLUA 3HOYB 3IT6B 1P98A 2UU9L 4OWXB 1TWHB 1Q46A 2N1WA 4M8MA 5BMGA 3U52E 4A3IH 4IW0A 1C9FA 4LF6Q 2MJEA 2BKRB 2K6DB 2K50A 3I9V1 2I0QA 4G50A 4G3XB 5AJ3Q 3W5UB 4JI6L 2Y0SE 1TY2A 2AKWB 1NE3A 2C7MB 3RNEC 3A54A 3NOBA 1EM7A 3IFDA 4NXNQ 1TR5A 2WWZA 3H1UA 1SYCA 2KOLA 3OOCA 2ZW1A 3KBGA 3KUPA 2UU9Q 3IFWB 3ONSA 2PZTA 2IHFA 1RD9D 3CC2A 3NE5B 3UGBB 3SR6A 2PIAA 2IX3A 1SJED 4LFCQ 1S3SG 1JMCA 1GUOA 5EKKA 5ISRA 4XWTA 4YCVA 1E8XA 3TMPB 2D10A 3HRZC 2LGDA 3TBIB 3ZTDA 2R7FA 3KOJA 2ONQA 3ZDMC 2Q2TA 3TP7A 2Y3AA 3RZDB 1V1QA 3ETRA 3H8HA 4XDCA 2UUBL 3OSOA 3HM6X 3GE8C 4LF4L 4N58A 3FC4A 1R4NB 4DUYL 4OL7A 4DR3Q 3I4MH 2DX5B 3AEFB 1IL2A 3JYUA 1F9JA 1TWHH 2OF1A 3I2ZA 4JI2Q 3TIXA 2J53A 3UDIA 2LI5A 4EKUA 2JA7B 5IYCG 2KC2A 4D2KA 1DOXA 2IX0A 1Z5SB 1SEBD 1Y8NB 1QZEA 1ZPSA 4G0NB 1FVIA 1PZID 3KW5B 1GB1A 1Y8RC 1LV9A 4KSKC 4AJYB 3I3TB 2E2JB 4KHVA 3I4NG 2Y5BB 4A3JB 3L16A 1MHWC 2D2QA 2EXZA 4REZA 1FEHA 2MP2A 3S2AA 1YBYA 3BG3A 1NSNS 2JX5A 3PS6A 1PQSA 4B95A 5E4WC 1TS4A 4DNTB 1G6ZA 5M5YH 4L5RC 2PI2A 2V0GA 3P4SB 4IC7B 3AEGB 3NTHA 4BXXG 4FF3A 3DXJC 4QJFA 4QF4A 1I6HB 1MGSA 1VQJA 1IGDA 2ZNVC 1D8LA 3S16B 3SD5A 3LGJA 2NBWB 3A4SC 1B53A 2DENB 4ZHOA 2K03A 2RA4A 2E5LL 1S5BD 1JROA 3H0GG 4GNXB 2KLGA 2LXCA 2ZEQA 2NN6H 2IYDB 2XK5A 2G9DA 2D3BA 2ASQA 3PZDA 1KNAA 1FPYA 5LMNW 4AQ7A 2EYMA 1Y1VB 2WXRA 2WINB 1A5RA 3I5JC 4YSYB 4DU9A 3Q3MC 5IY0A 5IT9L 2EPBA 1IHZA 4KLKA 3S14H 1HNWL 3QK0A 3RNAC 1NI2A 2A6HC 1TWCB 1TXYA 3BYTB 4JI1L 3R8BA 3KBXA 1S72A 1S3OA 1VQ9A 2LGSA 3DVNU 2L05A 1C4AA 1CK1A 1RRBA 1HZCA 4G7OC 1JWSD 4JI4Q 1NBFC 1SNMA 1B8AA 2X8XX 3HOVG 1MSGA 3WDNA 4ZKBB 1JJCB 2F3IA 3PUVA 1UH6A 2MSED 3CCSA 4G57A 3PCOB 3IT4B 1K8MA 1AH9A 4LFAQ 1Q86C 1ZP0B 4A90A 2UXCQ 3SDZA 2GBKA 2PVOD 3T8MA 2ICIA 4CJ0B 1KXLA 3DHIC 4Y52H 3PZ7A 1PTOC 3DDCB 1PUTA 4KV2A 3CC7A 4HAEA 4B3RL 3UF8A 3GTPH 1HUMA 3DMUA 3RLFA 3CWIA 2DY7A 2L1AA 3DBSA 3GE3C 3E56A 3SXHA 3OTOL 2KK8A 1O80A 3OG5A 2WGSA 3Q3FA 3BZCA 5ELDA 2KFJA 2UXDL 3W1GA 2OJWA 1X3QA 4DHZE 4DGZA 3H09A 3A4RA 3EJIA 2IW3A 1PTOH 1YJIA 3KF8A 1L0VB 1S5DD 1YJ1A 3P1HA 1GNUA 4WRDA 2Q8TA 4GN5A 2K5QA 5FO9B 4OVZA 1TWAH 1B3AA 2N8NA 3EUB2 2JA9A 5CBAE 3PLVA 3K5OA 2KDIA 1I6VC 1N8RC 1EQQA 3I4NH 3M3JA 3K80C 4PMCA 4US9A 3RNBC 4DWFA 1JORA 5DAUA 1FM0D 1WTVA 3CCVA 4DK1A 2LMCA 1NUCA 3VR9B 1K0SA 3UIOB 3VUYA 3NHHA 4ODGA 2A6ED 4CJ2C 4DV4Q 3I91A 4POGA 3RUZA 4IWQA 1RCVD 1G6PA 4QMGA 5IP9G 4XQNA 5JXVA 4OWWB 1F2ZA 2K5WA 5KIXA 2VH2A 4IUMB 4ZOHC 3PGEA 2MO0A 3C3LA 2BB6A 2L55A 2R7DA 3S2DB 1A2UA 1EYAA 5EKLA 1WIAA 3A9KB 4A3PA 3GTPB 2XBBC 5BYQA 1QE6A 2K32A 1ZYRC 1HTLD 2D9UA 4JBWA 1FRRA 3PO0A 1TTNA 3B0AA 1CZPA 1YI2A 1JE5A 4MHEA 3PF4A 2BW2A 2V4LA 1X54A 1G291 2ENBA 2NN6G 4M0WA 4LDTD 4CHKA 1K51A 4CYEA 4C7ZA 4EQOA 1HZAA 4A3EG 4NQLB 1WY8A 2RQXA 1K8AC 3H6NA 1T9HA 3RZOH 1JW9D 4UDUC 1VQKA 3PRPB 1B70B 2A69C 1QOHA 4M02A 4NJ6A 3RN5A 2RCFA 2MJ3A 2Z0EB 1TWGH 4BY7G 2N78A 2KWVB 2PNHA 2OWOA 4GOCA 3CCEA 3DHHC 4HKQA 1B9MA 2C5CA 1P7FA 3AE8B 3CCLA 3QIJA 3GTJB 4OW0A 1EQRA 2E5LQ 1QWYA 1GG3A 2MRPA 5D2MB 1X55A 2J52A 2M4NA 3T1YL 2JXMB 2R7ZG 4PS7A 2KYWA 1ICWA 2A5UA 1E2WA 2HIXA 4WJNA 3CIRB 4FXKC 1OO9B 1Q1OA 1RLFA 1BXTA 3WWVA 3PQIA 2M8SA 2QGQA 3T13A 4ZHPA 1EWIA 3NSWA 1X3GA 5AZGA 4TKOB 2EY5A 2E8GA 5IWAQ 1K3RA 1RF2D 3DVNV 1GAQB 4XXEA 4BY1H 3DWQA 4N9F4 3P7JA 4LF5L 1WGDA 5GROA 2VQEL 1YJJA 2K0PA 3S1MH 2W3RA 5C3EH 3KF6B 4LF8L 4C3JB 2F0MA 3GTLH 2KEDA 3APDA 1XXGA 4DR6Q 1H4RA 4ZRZA 1PH1A 3MEHA 1VF5C 4ALPA 2JA7H 2J0KA 3ZXVA 1J7CA 3A1QB 3J81i 2MUYA 4KDIC 2QA4A 2F0QA 3PGZA 2NVQH 2RKSA 1CQVA 1R9TH 4OO1H 2I5LX 3T1YQ 2DWQA 2ZXPA 1D4BA 2A68C 2KCMA 2C7HA 4RGTA 1WD1A 4GDLA 2CJNA 2J0JA 5E4XA 3GTMB 1R4PB 4WJ3M 3A9KA 2MO1A 3PUZA 2XSCA 1AZPA 4EQ5A 1SLJA 1L6VA 1RIPA 1SDFA 4JPBW 5FR6A 3W5OA 5IT9c 2Z1CA 2WU5B 3IG3A 4MEMA 2D3CA 5FO8B 2BYFA 2K25A 4BZAA 1JOKA 2IO1B 3HVDA 5JVG3 1PH4A 4JI6Q 3H15A 4B0MA 5KEEA 3NBHB 4C1NI 3BVZA 2O4XA 2A8VA 2MX2A 1JWUD 4R9WA 3K8AA 1UE6A 2INNE 1VQ4A 3SHLA 1YX6B 1QZGA 4KKIA 4EFOA 3MHSD 5M5WH 3ZRCA 3Q8EA 1TIID 5C4JH 1FNVA 1XCTL 4L5QA 3CW2C 4C2MB 4JV5Q 1A3UA 1JCKB 1EY9A 4EVOA 1XMQQ 4RCOA 3WCQA 3GTQH 5G5GA
chains in the Genus database with same CATH topology
5JAVA 3H94A 3PUWA 3SK5A 3N9YC 2JYEA 3AM9A 3S1NB 5C6AA 3LX0A 2PCFB 1N63A 4K5XA 1UGJA 2MHVA 4CKBA 5I2YA 2NUCA 2K05A 4IOIE 4OIKA 3VR5A 1S5FD 1FCLA 2D62A 2TSSA 1T3QA 4J6HA 4YWGG 1FYCA 1ZKOA 5K36G 1QQRA 2EVBA 4KGTA 3DUZA 5JJZA 4H0LC 1C4CA 1IW7D 4BY1B 5EE9A 1EYDA 2BB5A 4V0BA 3N52A 3I8ZA 4XQJA 2F0FA 2RSOA 1L4DB 3MP9A 4XDDA 3I4NB 4ARIA 2Y5CA 1YQ3B 3AEAB 4GZYC 2DLBA 2L1BA 2XVSA 4B9WA 2XRQD 4FVMA 3FPPA 1B9RA 2WIIB 1GHJA 2NYZD 2EY6A 2JQRB 2DNEA 3IFTA 1WVLA 3AU7A 4WFN3 2BS4B 3EROA 5EGTA 3NS1A 4ZUJA 4A90A 2RSNA 3EVQA 5FKAC 4FF4A 1DXMA 1V8CA 1GUGA 1E0ZA 2WXMA 1ET6A 3S15B 2WACA 4IZ8A 4X3KA 1MBYA 3OMGA 5IIFA 4J1MA 1B44D 4C3HB 2INPE 2SDFA 2G1EA 2JYTA 4DAPA 2NB0A 4CHTB 2PTLA 5A2QL 3KLSA 5BN4A 1S4ZA 4IALA 5G5HA 1E10A 4JWUC 3OWEB 1NR2A 1C79A 2XNAC 1AFPA 1EFID 1Q12A 3URYA 5M5WB 5BMHA 3RFZB 4L6TB 1YN4A 2NWGA 1CZGA 3IKJA 2KA7A 1RTNA 5HI1A 1A6XA 3QWNA 1TS5A 4YSXB 1SNCA 1NCVA 2NVYB 3GTLB 2F0WA 1FMAD 2HCCA 1B4OA 1JB3A 3DWAA 1STNA 1LTTD 2YEPF 5J39A 2KCCA 2XWJB 3PO3B 1SXTA 5D3IB 1PRTF 4TQ1A 2EY2A 1Q8IA 3BIID 1KRHA 4MACA 3HZXA 1D1KA 1BCPC 4LAAA 3IL8A 4BS9A 3LNNA 4KK7A 4RKLA 3BS1A 2CW0D 2PW9A 5M5YB 2I38A 1C78A 1DYQA 1EWCA 1NYQA 2H88B 2KCNA 1SF0A 2SEBD 3J7AF 3OIQA 1I4RA 2PLPA 1DOYA 1UEAB 3M4OB 3KQ4A 3AE2B 1F2RC 3Q22A 1ZXHA 4QUFA 2IGHA 1XO3A 4K2KA 4KHZA 5JEAH 4L2YA 3QIAA 2R7ZB 1SMYC 2LHEA 2QCPX 1Q1BA 3OPOA 3NVVA 3SFDB 4JWSC 3SEBA 3SE0A 4ZRPA 1HTPA 2RBMA 2FHTA 2MGSA 1I50B 4KD3A 1RKNA 1SB3C 4Q2JA 2E2IB 1H9MA 4R3DA 2RPVA 5C0XG 1NEKB 1TJEA 4N59A 4KY5A 1ESFA 3PMFA 3V05A 2LHDA 1RDPD 2I2YA 4NJCA 1HZ5A 4WAFA 5C5MA 1STEA 4NP5A 3F2UA 2KWDA 1YNTE 4KKSA 2L0CA 4A3EB 2DYOA 3NWSA 5C44B 2GI9A 4A3DB 2L32A 1X32A 3T16A 1J9OA 2IT1A 5ELFA 1PGXA 2WS3B 3P4RB 3ZYYX 3AE9B 1XTCD 2A6HD 1KLGD 2F0LA 1D5XC 2B2VC 4KN4C 1JWMD 3Q23A 1CA5A 1E2ZA 4L8JA 4M1UB 2B2UA 2H1EA 3NTIA 1M8AA 1KTKA 3VRAB 4CKEA 2QEJC 2OHFA 1TKEA 3FRPB 5A35A 3TN2A 2IJ0A 3HOVB 2FBWB 5FOBB 3U4EG 5CGKA 5EBCA 4OZBA 1VCIA 1KABA 2EOTA 2K9XA 4JE3B 1STHA 2SNSA 2PO4A 2BTEA 1IKMA 3MTSA 1K50A 4K8IA 4OO1G 1RYJA 1QNKA 4X3TA 1CI3M 4RKBA 1ZEQX 1JMLA 1UWXA 3BK2A 1NR4A 2KVMA 1NVID 1DJRD 2K04A 5EE0A 2EYLA 3RD4A 2K22A 1EY8A 1F2RI 3HG9A 2WP9B 1HEZE 3C2PA 1PXUA 1BQQT 1LTID 4KD4A 1NENB 3MXPA 4IDIA 3TDQA 1JRPA 2YEPB 4LK0M 2VZKD 3IAM1 1WTXA 1EEID 1AW7A 3P42A 3B9JA 4IUQA 1DOMA 1MVKA 3D4RA 1H9KA 4YTMB 1LT3D 1F77A 3CQZB 2M0AA 1AEXA 4RGOS 4MH8A 1XF5L 2JXTA 3HKZB 4B9XA 1SYEA 2GB1A 1UAPA 4MN3A 2LUMA 2DN8A 1K8OA 1XEEA 2JSVX 4KKUA 2E6XA 1FFUA 2KQ4X 3I72A 3MFGA 3J7YW 4J8QA 1QOFA 4G4KA 5FLXL 2BE5C 3J80L 1U4PA 1I4QA 2PW7A 2HQEA 4I7ZC 3FKIB 1CHPD 2Y5PA 1Y1WB 3MXNA 2R93B 2FMCA 2NBFA 3ND8A 1N62A 3NUCA 2HTME 5KNDA 1WTWA 3EGRA 2GRIA 4DA2A 1HQMC 2WB1B 2W55A 3VR6A 1WRIA 2R92B 2KAJA 1LTAD 2O5JC 2JWUA 1B2TA 2AX5A 2MPMA 5IGCA 3X3MA 1BCPF 1MD2D 3I4LA 3NBHA 3I57A 3K5NA 3HOWB 1ZOYB 4FNFA 3L7ZC 4G7ZC 2JA5B 3AE7B 1ZDXA 1JR0D 2FINB 3NQTA 3PUYA 3AE5B 1BO0A 2WNMA 1EIGA 3V96A 4WQMA 5K5PA 2EYHA 2RDGA 4BBRB 3S2HB 1NAPA 4DAYA 1F9QA 4IFDJ 4Q5VA 1G91A 1IW7C 5F2DA 1LTBD 1PTOF 2RDFA 2RVLA 4H7BA 3BWUD 3TSSA 2L4NA 4Q0FA 3W9CB 4MT5A 1FRDA 3AEBB 1Y56A 4DQOC 3HOZB 4PNYA 3RZOB 1IYUA 5JOBA 3W5VB 3VYUA 3TMEA 3TEZA 3E6ZX 1CM9A 3G6JB 3NVYA 1RJTA 1WWTA 1SYGA 3K0YA 2EE1A 1FD6A 1E9MA 3IAS1 1VRAB 1SNQA 1C8CA 5CMDA 5BN3A 1HZ6A 5CC4A 1I7HA 4A3BB 1WSPA 4A3MB 1O78A 4ZUIA 2WDQB 3NUHB 4QUCA 2HUGA 2VZKB 4IUVA 1LTRD 4IUUA 3V3XA 1PZJD 1XX8A 1YN5A 2LKVA 2F0NA 2L83A 2F0HA 1V43A 3HEJA 1KH0A 2EJMA 3P4QB 3E0JA 3LYYA 3NZ3A 4HN7A 1TWFB 2YU9B 5EPJA 2B39A 5KGUA 3OHXC 1RHPA 2JE6I 3BDCA 4IKGA 3DM1A 3S1MB 4PV1C 1I4XA 1V97A 3PIO3 1HPCA 3C1EA 4RH6A 1L6UA 2XN9C 5IGEA 2BA0A 5ELEA 4FYDA 4IN3A 4ID6A 3AEEB 2NVQB 1KDAA 4JPSA 1HQRD 3U9SA 2KECA 4ZAIA 2IWHA 2EELA 1Z6HA 4O1NA 3A8KE 2K3UA 1EWHA 3T4AC 2H4OA 1OXXK 2GA4B 2V4IB 3M4YA 4DFAA 1VR9A 4ARCA 4OZCA 3ONAB 1WGKA 2ZXOA 1AP0A 1Z47A 1A3VA 1P7EA 2EYPA 3I90A 5LHY1 5T8IA 1NI3A 1BR9A 5BN5A 2XIWA 4HEA1 1K83B 1EZ8A 2JP1A 1Y8PB 3I3CA 4BY7B 2MJ8A 2F0IA 4KTAA 2DYMA 2J4XA 4LMQD 5C3EB 1FGBD 2K28A 4FP5D 1DONA 1I4GA 2C9OA 3SK4A 3CRKC 4WH4A 4JX1C 2BE5D 1VJKA 1IBXB 5G3LD 2BBCA 3BZDB 1DOIA 4KKJA 5DNFA 1YNJC 2VXWA 5CV8A 4KJOA 4N9TA 3L9AX 2FMMA 3T3NA 3BVGA 3BDLA 1WYGA 1CT1D 2TMPA 1E0BA 1F9RA 5HGTA 2W3SA 4U673 4EE2A 2F0VA 3NXWA 1GUTA 3OMCA 1TVXA 2XRSD 4XDXA 1BDOA 1H9JA 3H0GB 4BWGB 4ZLTF 1EL0A 1ML0D 1RM6C 1F2LA 2F3WA 2OEOA 1V1PA 3KWLA 3TEWA 2D5DA 3E5SA 1SE4A 4FXDA 4A6QA 2MJDA 4FF1A 2ON8A 4P2CB 3NRZA 4EQPA 4DF7A 4A3IB 2CQAA 1STGA 1YNJD 4C56C 3MHZA 2BS3B 1C76A 4WURA 2MEKA 3AB5A 5JVH3 4ZYSA 2E75C 5C3WA 4NZLB 2B8GA 2KN4A 3Q69A 3BDOA 3KLSX 1KFYB 1SE3A 1Y69U 1GXDC 5D14A 3TP8A 4NAWB 1PRTC 1R7SA 1PTOD 4O42A 1UWMA 3U9OA 2JSOA 4WIPA 2K6AA 4H2AA 2WAQB 1TWGB 1YNNC 1R4QB 1LLRD 1SNOA 3W2DA 1S5ED 2Q8RE 2E74C 3AV8A 2VB2X 1MHHE 2Z4IA 1TWAB 2ZT9C 5CV4A 3H91A 3PV0A 1H9SA 1SSOA 2KJXA 1STBA 1J7BA 4OIJA 1O7YA 1IUEA 1FNUA 1PRTB 1FFVA 2A6EC 1K52A 3EQLC 3M85A 5H8YE 1IKLA 5FLXE 3JAML 2F0SA 5C3JB 3X3NA 1HHVA 2SOBA 4S3SA 4U68A 3H3VC 1YN3A 4C7YA 5C4JB 3HGBA 2Q8IB 4HEDA 1BF4A 2F0UA 3LB8C 4M8AA 1FXIA 4RGNA 3WOEA 2WXNA 3B2FA 3ERQA 1EY6A 1JOQA 3QB3A 3QOLA 4YTNB 1OXSC 1D2BA 2E2DC 1LACA 3R2TA 1GPXA 1DM0B 1JWAD 2M2LA 1EOTA 1PDXA 1PYWD 1AN8A 1T5EA 5M3MB 1AWDA 1WTOA 1F2YA 5C0XJ 4RFBA 1VMCA 4Z9CB 1Z7TA 1C4QA 5IGDA 2WXJA 2PZWA 3VRBB 3T51B 4TQUS 1T5XD 3PZ8A 3BYYB 3J81E 3GQBA 3T3OA 3KK7A 2R6GA 3D4WA 2A74C 1QCBD 4JK1C 1N61A 3G7LA 2JYOA 2K33A 1B1ZA 2EJGC 4XIGS 1R9TB 1D6EC 3K7AB 3VR4A 2X38A 1Y8OB 1XYIA 5T1IA 4FXCA 2WU2B 3JAME 4HJGE 3Q8AA 2L11A 3NP8A 3QG1A 2LFIA 3D4DA 4AYBB 2K5DA 4QB4A 1FIQA 2J0TD 3MWYW 1PDQA 4H44C 1PFMA 3Q8BA 2KEEA 5KYIA 3Q8FA 1XCQL 3ZJTA 3B2GA 1CZWA 4MM3B 2J7ZA 1SJHD 1JE4A 3LWUA 3R3OA 1PFBA 3AMUA 5KNBA 3AE3B 4P6VF 5JPMC 5CV9A 5TSSA 3GTQB 5C4XB 5IGFA 3NWTA 5AUKA 1IBXA 2IPKD 1JALA 5G3LF 5E1FA 3A7LA 1FR3A 1EYCA 2PYKA 3C1FA 1SMYD 2QJLA 4BA1I 4K8JA 1JC7A 1Q90A 1DZ1A 2B2WC 2X6GA 3N6RA 1A2TA 2F0OA 2WXQA 4P16A 3GTKB 3KWVA 1V1PB 2B2WA 2FJ2A 3M7GA 2ZXRA 4C3IB 2B8FA 1KF6B 1DCZA 4CBVA 3T53B 4H13C 2ICEC 2L12A 5LNK1 2IGDA 3Q6SA 3SVMA 2W54A 5D7GA 3FEWX 2JEAI 2B2UC 5IT9E 4ZQ3A 4DXGA 1ENAA 1W6JA 4ITKA 3HP3A 1EY0A 1FNWA 3GS2A 1MHXA 5CV5A 3AN1A 5H92C 1LABA 1SFOB 3E9SA 2JEBI 2IDYA 2NN6I 2EZVA 2VUMB 2AUKA 3IAYA 3V2TA 2QF7A 3ZJVA 2WQYB 4A3GB 3TUOA 4HKZE 4G7HC 2KMMA 3FPUB 1RWSA 1OXUA 4HMJA 4HMIA 1N5WA 4OO1I 2N9KA 4BA2I 4YSZB 3UI2A 2SNMA 5COYA 1N5XA 4L1BA 2WXIA 1I4HA 5KNCA 4LLGM 2EJFC 4RF0A 1KAAA 4DXFA 3SK6A 4V190 4FF2A 1CA6A 4I65A 1QT9A 4OHJA 2PVGC 2BA1A 3I70A 1BCPB 4L23A 2D2CC 5KYLA 1IYVA 3A8IE 2K1BA 2NVTB 3AE4B 4KI0A 1QNUA 1BOSA 4KY6A 2WXGA 1WTPA 1SAPA 2BOSA 1H9RA 2D5GA 3D6WA 1GUWA 3GTGB 1RFKA 1AZQA 3VA5A 5C2TB 1VF7A 3NK9A 5EE3A 2AWNA 3NQIA 4J3OD 2F0TA 3TZDA 5EPKA 4HTHA 4K5WA 4RF1A 2L9HA 4R8IA 4XYQA 5DM73 2XWBB 3P4PB 3LXFA 2AQ3B 5EJWA 4XT3B 3NVWA 1J8IA 1E2VA 1HUNA 1CTMA 5FK9C 1Q1EA 3GD7A 2KDMA 2F1MA 1L0XB 3FVQA 5ELBA 4A3KB 4XT1B 2WXHA 2JA8B 1SE2A 2PW5A 2FUG1 4HSPA 2KQ3A 3AB9A 2LEKA 1QG7A 2V3NA 3NPPA 1Q3LA 5M9OA 2BYTA 4LJZC 1BUVT 3HOUB 4K14A 5CBEE 2M00A 1GUSA 2IX1A 4WORA 3D31A 1SIJA 2BT6A 1YNND 4K5VA 4R8NA 1SYBA 2KACA 3D8GA 1ACCA 4TMAB 1T6BX 3VYRA 1HCZA 2HCIA 2V4DA 5BYRA 1JOOA 3FAHA 5AUIA 1VZ7A 1SNPA 4LTUA 1GOZA 4X3UA 1TT2A 4IUPA 2Z8LA 3J80E 1D5ZC 4CJ1B 4A8XC 1XWEA 4B08A 2B2VA 1OXTA 1GUNA 3VYSA 5EBDA 2DNCA 1EY7A 2FE8A 1FCCC 3AMZA 4F88A 3D6CA 4OZAA 2NVXB 1EY4A 5D3DA 1B9NA 1ONLA 1JQYD 1PLFA 1IL8A 2ZW0A 1C77A 2ACZB 1TY0A 3EFXD 1FXAA 1PGAA 2RDHA 3HRDD 2F0EA 5FR3A 1FO4A 1AYFA 1XLNA 1CQFA 4RHSA 4IFDI 3GTOB 3A7AB 5C5LA 4Y7NB 1ZXTA 2Z4HA 1PZKD 2WKDA 4C1NK 1ZXIA 4RNAA 5CYUA 3C46A 2HDMA 1DOKA 1EEFD 1L0YB 1RTOA 1L4ZB 2ID0A 3GV3A 2QKIC 1SSNA 1YMHE 4RHRA 1V8QA 1HA6A 3VR2A 2SAKA 2F4IA 1ENCA 3ZQ4A 3Q24A 4HCSA 1MI0A 4EQNA 2QSDA 4ME5A 2LS01 4E6IA 3KLRA 4RAUC 3VA7A 1EIHA 4CKCA 3LWEA 2BDNA 3HVZA 5IGBA 2A5HA 1WCMB 2AWOA 3K59A 1DGJA 4X3SA 3TP5A 2WXPA 1PRTD 1SNDA 1LT6D 2EYFA 2A69D 5KRUA 2CU3A 5JPNC 2AQ1B 3Q8CA 3AE6B 5C4ZA 2W82A 2FFKB 2QMTA 2WP8J 2RMMA 4DK0A 5DEHA 1LT5D 1WXQA 3MXUA 2KHSA 1STYA 3FDTA 1G8ZD 1JWBD 1TZOA 2N0SB 2B63B 2EY1A 2NTTA 3H6MA 4RA8A 3GO5A 2I07B 3FILB 4A3FB 3K6OA 4HSVA 3HS0C 1ZYRD 3HUIA 1M4VA 3K58A 1ZUD2 2OXPA 1QKZA 3O13A 5J1ZA 4ZRQA 1GHKA 1G2SA 1ZE3D 1IGCA 2X69A 5CORA 3ITPA 3I4MB 4US8A 1CHQD 1VDVA 1CFMA 4F8MA 1DOLA 4KKTA 3FMCA 4RCNA 1TYGB 1YQ4B 3BVMA 2OEDA 4GLSC 5GXGB 2WXKA 2PMZB 4IQZA 1SYFA 3ND9A 4N9PA 1PGBA 3TP6A 1CJEA 4IUTA 5M5XB 1ILQA 4KY7A 2VB3X 3P1MA 3CKIB 1F9SA 1H9SB 4YTPB 3AH7A 1QOGA 1XLOA 1JICA 3MHBA 2CVRA 2AUJD 5EE1A 1EU4A 3PIP3 1WTRA 3VYTA 1EZ6A 1GB4A 4EGVA 1VZ6A 2DY8A 3R2IA 3DWMA 1J7AA 1QF6A 4MIUA 3DEOA 3DWPA 5CR3A 3GP7A 1QLBB 1VDZA 1EWYC 1OFFA 2CJOA 2A73B 3WOFA 1F9PA 4K2LA 2JU6X 1D1IA 1W6KA 2WXFA 3ZGZA 1EQVA 1TS3A 5HG2A 3MJ5A 5BYSA 5ELCA 2JA6B 1FD7D 3ABVB 2AQ2B 4N6EB 4NKLA 3MAQA 2M19A 2WDVB 4XQQA 5I6WA 4XTCS 5I6YA 1PTOB 3CU7A 4C3IG 2F3VA 1PFNA 2M9VA 2K5PA 3MA2B 2PKOA 5BMIA 1PFDA 1O7LA 1II3A 1HFNA 4FO2A 1LT4D 4KX6B 4PT5A 2F0DA 2PPBC 4KN7C 2WLBA 5C0XH 5I4DA 2WV6D 2EYOA 5EKIA 2N9LA 1HA5A 2Y0SB 1ILPA 2LY7A 2F0PA 3A56A 1C48A 2B2TC 3OIPA 2E3TA 3CRLC 5LL6X 5A2QE 2Q5WD 2PQEA 4ZKCB 1STAA 1Q10A 2NMQA 3QOJA 3OWFA 2BS2B 3SR1A 2B2YA 4PQXA 1A3TA 3W3AA 2QDBA 1QOBA 3ZJUA 1I3QB 5E3FA 2L5TA 2BCOA 3NTKA 4ILWA 5FO7B 5EQ0A 4XE0A 1A70A 5I9OA 1K53A 1QOAA 4WJWA 4KGRA 4ABNA 5AFWA 5DM63 3AEDB 1ET9A 1TKWB 3S9WA 4LK1C 3NBIA 1ROEA 3GB1A 1TS2A 2CW0C 3S17B 1U4RA 1QJOA 3T56B 1NYRA 5HHDG 3CHBD 4L63B 4C3HG 1TKGA 3TZUA 2MP1A 3MFYA 2X6LA 1MSHA 4IURA 3U7ZA 2F0GA 5J22A 3IXSA 2PZUA 4YXDB 4F7XA 3Q0AA 3BK1A 2F0KA 1EU3A 3NVZA 3M3YB 1OQRA 1RODA 4QCLA 3VR8B 1VMPA 2A68D 3R93A 2E2HB 5NUCA 4HR7B 1VLBA 3TEXA 1TQOA 2LFNA 4BBSB 3QO2A 1TKYA 1OXVA 1JQ4A 1VZ8A 4B0EA 5E6JA 4ZK9B 1HFGA 2CHBD 4KV6A 3DWGC 3J7AV 3J9CA 2N7JA 1F2MA 3W1SA 3AECB 4IUNA 5C0XI 3UI3A 1QILA 2EYJA 3RPFC 2EDGA 1E6EB 3MVVA 1C4PA 3L3OC 2OT2A 1B50A 4XYOA 2L52A 5T1GA 1U9RA 2PMVA 4KJNA 1SYDA 1EY5A 1XLPA 2KUMA 2K7VA 3PUXA 2BDOA 2EKIA 3L4PA 1SBBB 4NAMA 3DEPA 2F0JA 4NDXA 3A55A 4UAIA 4NMZA 3TEYA 4AS1A 3QJYA 3MXGA 2VNUD 2LJIA 2HDLA 1OQQA 3SK8A 4HROA 3PO2B 2YYZA 3S1QB 4HCEA 2IL8A 4DNRB 3S1RB 2WDRB 4DAVA 3MZ5A 1DD2A 5I9PA 4RGMA 5D65A 2N55A 3J81L 1G2TA 5K36H 5HURA 1KDBA 1KDCA 4PMBA 3S14B 1KNEA 3RMHA 4RWSC 4YT0B 2QILA 4FXGC 2HDEA 5MPOA 2N88A 1LO5D 4K6DA 4GDLB 3D3RA 3K5LA 1GJXA 2WKCA 1ENFA 1LTSD 3I73A 3AE1B 2E76C 5M3FB 2DBYA 2PNRC 5I2XA 4A9AA 1LTGD 4KGSA 2WXOA 1BUIC 4TSSA 4QIWB 4A55A 1HXYD 5JEAG 1BMLC 2LGIA 1WTQA 1A15A 1F0ZA 1MPEA 2G9HD 2H89B 3K5MA 2IGGA 1D5MC 2NTSA 2R3ZA 4K6LA 5JEAJ 1TU2B 4IFDG 5C3XA 2NZ1D 4ULLA 5IOCA 2LMCB 5IODA 3OW7A 3P63A 1N60A 1O7ZA 1I4PA 4WWMA 1U4MA 3VQIA 2O2LD 3GV6A 3P20A 3M7NA 2B2TA 1L5PA 4TRDA 3SFEB 3VR3A 3DHQA 1X3PA 1QB5D 4KMUC 1UNSA 5CV6A 1XLQA 4CGYB 3K57A 1WD0A 4DN4M 2MH7A 4USAA 4C80A 3C8YA 5CV7A 2B2YC 4F87A 2QIEB 1MI2A 5HFYA 2JZPA 2M56B 1KLUD 1BCPD 4XWWA 2R61A 3U2SC 4A93B 1U4LA 1E7PB 4TQ0A 4NW2A 3HOXB 1UUPA 1ZDVA 1EQTA 4PMWA 1V1OA 1HRJA 1S5CD 2WXLA 5EPLA 4CQNA 3P75A 1BNZA 4C3JG 2I46A 2F03A 2V3PA 5IGGA 1ESRA 3A8JE 4OGQC 2O5IC 4HRSA 5C4HA 3EA6A 4GDKB 2K01A 2B76B 1PMRA 3FILA 3MC0B 5LL6S 4IFDH 1BBXC 4YIJA 3HOYB 3IT6B 5BMGA 1TWHB 3U52E 1C9FA 2MJEA 3I9V1 3W5UB 1TY2A 3A54A 1EM7A 3IFDA 1TR5A 1SYCA 2KOLA 3OOCA 2ZW1A 3KBGA 3KUPA 2PZTA 1RD9D 3NE5B 3SR6A 2PIAA 2IX3A 1SJED 1GUOA 5EKKA 5ISRA 4XWTA 3HRZC 3TBIB 2ONQA 3TP7A 2Y3AA 3RZDB 3ETRA 3H8HA 4XDCA 3OSOA 4N58A 3FC4A 4OL7A 3AEFB 2OF1A 2J53A 2JA7B 4D2KA 1DOXA 2IX0A 1SEBD 1Y8NB 1ZPSA 1PZID 1GB1A 1LV9A 2E2JB 4KHVA 4A3JB 4REZA 2EXZA 1FEHA 3BG3A 1NSNS 2JX5A 5E4WC 1TS4A 4DNTB 1G6ZA 2V0GA 3P4SB 3AEGB 3NTHA 4FF3A 3DXJC 4QF4A 1I6HB 1MGSA 1IGDA 3S16B 1B53A 4ZHOA 2K03A 2RA4A 1JROA 1S5BD 2NN6H 2G9DA 1KNAA 4AQ7A 2EYMA 1Y1VB 2WXRA 2WINB 4YSYB 4DU9A 5IT9L 2EPBA 1IHZA 2A6HC 1TWCB 3BYTB 3R8BA 3KBXA 1C4AA 1CK1A 4G7OC 1JWSD 1SNMA 1MSGA 3WDNA 4ZKBB 3PUVA 4G57A 3IT4B 1K8MA 1ZP0B 2PVOD 3SDZA 2ICIA 4CJ0B 3PZ7A 1PTOC 1PUTA 4HAEA 3CWIA 1HUMA 3DMUA 3RLFA 2DY7A 2L1AA 3E56A 3SXHA 1O80A 5ELDA 1X3QA 4DGZA 3H09A 3EJIA 2IW3A 1PTOH 1YJIA 3KF8A 1L0VB 1S5DD 3P1HA 4WRDA 2Q8TA 2K5QA 5FO9B 4OVZA 1B3AA 3EUB2 5CBAE 3K5OA 1I6VC 4US9A 4PMCA 1JORA 5DAUA 1FM0D 1WTVA 4DK1A 2LMCA 1NUCA 3VR9B 3NHHA 4ODGA 2A6ED 4CJ2C 3I91A 3RUZA 1RCVD 5JXVA 4QMGA 4XQNA 1F2ZA 2K5WA 5KIXA 4ZOHC 3C3LA 2BB6A 2L55A 3S2DB 1A2UA 1EYAA 5EKLA 3GTPB 5BYQA 1QE6A 2K32A 1ZYRC 1HTLD 2D9UA 4JBWA 1FRRA 3PO0A 1CZPA 4MHEA 2BW2A 1G291 2ENBA 2NN6G 4M0WA 1K51A 4C7ZA 4EQOA 2RQXA 1JW9D 4UDUC 2A69C 1QOHA 2MJ3A 4HKQA 1B9MA 2C5CA 1P7FA 3AE8B 3GTJB 4OW0A 1QWYA 2J52A 2JXMB 1ICWA 1E2WA 3CIRB 4FXKC 1OO9B