3MC0B

Crystal structure of staphylococcal enterotoxin g (seg) in complex with a mouse t-cell receptor beta chain
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
233
structure length
228
Chain Sequence
QPDPKLDELNKVSDYKSNKGTMGNVMNLYMSPPVEGRGVINSRQFLSHDLIFPIEYKSYNEVKTELENTELANNYKGKKVDIFGVPYFYTCIIPKSENFGGCCMYGGLTFNSSENERDKLITVQVTIDNRQSLGFTITTNKNMVTIQELDYKARHWLTKEKKLYEFDGSAFESGYIKFTEKNNTSFWFDLFPKKELVPFVPYKFLNIYGDNKVVDSKSIKMEVFLNTH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords variable beta 8.2 mouse T cell receptor
publication title Crystal structure of staphylococcal enterotoxin G (SEG) in complex with a mouse T-cell receptor {beta} chain.
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
total genus 64
structure length 228
sequence length 233
chains with identical sequence D
ec nomenclature
pdb deposition date 2010-03-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF01123 Stap_Strp_toxin Staphylococcal/Streptococcal toxin, OB-fold domain
B PF02876 Stap_Strp_tox_C Staphylococcal/Streptococcal toxin, beta-grasp domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.110 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 3mc0B02
3.10.20.120 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 3mc0B01
1ET9A 1V1PA 1LTAD 1CHPD 1LT3D 1PRTC 1EEFD 1TS3A 1JWSD 1LTID 1RCVD 1YN4A 1PRTD 1KLUD 4ZYSA 4RGNA 1SE2A 5ELEA 1EFID 1D5ZC 1PRTF 1KLGD 1UNSA 3BVZA 3BYTB 4L6TB 5D3IB 3URYA 2IJ0A 2AQ2B 3W2DA 2O2LD 1MD2D 1S5DD 1PZKD 4L63B 1SE4A 1LTRD 3V05A 1I4HA 1KTKA 2CHBD 2R61A 1JCKB 2XNAC 1TS2A 4RGMA 1AN8A 4UDUC 5FKAC 1EU4A 1JWMD 1XTCD 1HQRD 1FGBD 1CT1D 1PZJD 1SE3A 1V1PB 4BWGB 3TSSA 2SEBD 1TS4A 1I4GA 1V1OA 1FNWA 1HTLD 1SEBD 1SBBB 5ELBA 2ICIA 4RHRA 4C56C 1QILA 1JR0D 1HA5A 1SJED 2IPKD 3DWPA 3GP7A 3R2TA 3KLSX 3OWEB 1AW7A 1D5XC 1SJHD 1HXYD 4RH6A 4TSSA 3DWAA 1DJRD 4O1NA 3MFGA 1PZID 1DYQA 1LLRD 1I4PA 1LTTD 1RD9D 1LO5D 3CHBD 1PTOB 1ENFA 1PTOH 2NTSA 1XXGA 1JQYD 3R2IA 1BCPB 2AQ1B 3BYYB 1I4QA 1LTSD 1JWUD 2G9HD 3BVMA 3O13A 1YN5A 2XRSD 1EEID 1LTGD 1L0YB 5I4DA 1F77A 1PYWD 5FK9C 1I4XA 2RDGA 3BZDB 2NTTA 3BVGA 4RGOS 1B1ZA 1D6EC 3R8BA 1GOZA 3DWQA 1S5FD 1I4RA 3EFXD 1BXTA 4RGTA 4Z9CB 4RFBA 1D5MC 1S5BD 1S5CD 2Z8LA 1B44D 2AQ3B 1ET6A 1T5XD 3EA6A 4DXGA 1PRTB 2WV6D 5ELFA 1CK1A 3MC0B 5ELCA 1PTOC 4DXFA 2TSSA 1BCPC 1SXTA 1EWCA 1RDPD 1FNUA 1PTOD 1LTBD 1STEA 4OHJA 1BCPD 2QEJC 1PTOF 1M4VA 1S5ED 1LT5D 1BCPF 1LT4D 2J4XA 1EU3A 4K6LA 1TY2A 4RCOA 1YN3A 1RF2D 1TY0A 1FD7D 1CQVA 2XRQD 1ESFA 2QILA 4NZLB 1LT6D 5TSSA 4RHSA 1TS5A 3SEBA 1L0XB 5ELDA 1CHQD 2RDHA 1FNVA 1G8ZD 5D3DA 2XN9C 1UUPA
chains in the Genus database with same CATH superfamily
1EY8A 5JH5C 2KDBA 3C1FA 5EE1A 3R3MA 2F0JA 4A76A 1WJUA 1YN4A 3PZDA 4HPMB 3AU5A 1SNCA 2ZJPA 3ZLZA 5ELEA 4B3SL 3BVZA 1LYLA 2VZAA 3IHPC 2GBJA 4ANUA 2GBMA 2O2VA 1GD7A 2LKVA 3T4AC 3VXWA 2WP8J 5E4XA 4OGQC 1FFVA 2Z0EB 4NXNL 2RF4A 3K5LA 2WQYB 3P4SB 1WRIA 3AEFB 4YIJA 3AE8B 2QC8A 2EJFC 1QOBA 4LF8Q 2WB1E 4E71A 3AFPA 1SE4A 1K0RA 2JF5A 4MZ9A 4LNKA 3VRBB 2NYZD 1VMPA 2E2IB 3H0GG 2K1BA 1JCKB 4TQ1A 4N58A 5LXHA 2QDBA 4RF0A 1WTQA 2VL6A 4HSVA 4PK1A 4KGTA 1XLNA 1JROA 1WRDB 3NWTA 1U4MA 4R9WA 1WI5A 3A54A 2KQ3A 3NTIA 3ULLA 5IYBH 2ZCCA 1WY8A 4IW0A 3A9KA 1J7CA 1SNPA 3I73A 1SFOH 1TTNA 5J22A 4FYDA 4IC7B 3W5UB 1ZP0B 3I4NH 2KYWA 2G4DB 1PH4A 4KHPL 2E5LQ 2IBIB 1SDFA 3RZWC 3DWPA 2D07B 1RJTA 3GZNB 4DR6L 3PZ8A 3NG0A 4ZKBB 2PVOD 1K3BC 4LUOA 3SDZA 5IYDH 4L5TA 3HOZG 3K5OA 3L4PA 2B3GA 3NE5B 2CU1A 1H9KA 4TRDA 4O1NA 1Q81C 2XEWA 1PZID 3R66C 2I2YA 3K0YA 4DV7Q 1IYFA 3CCLA 2JA8G 3B9JA 3FRPB 3EGRA 1UWMA 2JA5G 4EZKA 1EY6A 2MW5A 2OT2A 1XNQL 1XXGA 4GU2A 2FHTA 2N1WA 4LUVA 1E8ZA 3HVZA 3E6ZX 1VF7A 2UUCQ 1FIQA 3T1HL 4LWCA 2KLCA 2WIIB 1GUNA 4QB4A 3S2AA 4FXCA 3OPOA 4BA1I 3S16B 3K81C 3G48A 3DDCB 2J42A 4P6VF 1Z6HA 2B2WA 1C9FA 2WGSA 2QGQA 5FLXL 1PH6A 2IWHA 3K58A 2FMMA 4H02A 3HKZG 2EMTA 3KW5B 4M0WB 2EKIA 4IUUA 4V0BA 5KYLA 5KNDA 1IL2A 2Y5BB 3WAPA 4DR5L 1UGMA 2DYBA 5BYSA 1DCZA 4LFBQ 3VR3A 3KWLA 1F2LA 2R7DA 3E9SA 4IJHA 3T53B 3P63A 1BDOA 3TBLD 1SXTA 3FKIG 4ID6A 4P2CB 2PPHA 2WXPA 3A5ZB 4HEA1 4MJSA 4NAMA 1TWCB 1QOHA 4HTHA 4DV2Q 4WIPA 3ZXRA 4OIJA 4IPDA 3MXNB 3J80L 4A3IG 4BY7H 2B29A 3ND8A 3ULPA 2J0KA 2YEPF 3PQIA 1WGKA 3VAWA 3ZYYX 2M2LA 2K04A 3FVQA 4A4IA 1KQSA 2BS2B 2ALYB 2WLBA 4F8CB 2UUAL 1FJGL 4YY3Q 4QY7A 4IZ8A 2RDHA 2RSNA 2JA6H 4A3BH 2JZ3B 5EE0A 3ZVVA 1FGUA 3UIPB 1ICFB 4EUTA 3VTWA 2DX5B 4OIKA 2GN5A 1J7BA 3ZNID 2DENB 2F3VA 1KHIA 1LTID 1V5OA 4ZYSA 2OXPA 1ZDVA 2K39A 2K8HA 3K5MA 3QCAA 1LFDA 1SNDA 1EFID 1SYGA 2JEBI 1HNZL 5DPWA 4B3RQ 2D3BA 2JX5A 2ZNVC 3HFZB 4OWTB 5F2DA 1QB5D 3PO3H 4E3CA 2NN6H 1PQSA 2KUMA 2VQFQ 2DYOA 4XWTA 5IP7H 4DUZL 1HTQA 5H1SE 3D8GA 1Y1WG 3DPDA 2FIFA 1D3ZA 3GQBA 2J7ZA 3PUZA 3VVWB 2CJNA 2BWES 2YTYA 1QVCA 3HS0C 4BS9A 2F0OA 1UZXB 3PIO3 2WU2B 1QZHA 4K3CA 4KDLB 5C5LA 4E6IA 4X57B 2G4SA 4W9EA 3L10B 4GLSC 4JI2L 2F0KA 1NBFC 3W1YA 1FGBD 3NBIA 3CC7A 1HTOA 1NYRA 1Z5SB 1UBIA 2REXA 3B08A 3ETRA 1WMHB 1YNXA 1DOIA 1E2WA 2BWFA 3WOFA 2Z6KC 1DM0B 4O0AA 2R2OA 1YIJA 3QC8B 3P4QB 2F0WA 3RZOH 5ELBA 1P98A 2NBVB 5JEAH 4H0LC 4MELA 2QJLA 2KNBA 5GADC 3DBRB 2RDBC 1MJDA 1N62A 4U673 1SJED 2IPKD 4WFN3 1I94L 5C4JH 2UU9Q 1E7PB 3AE2B 3UINB 2ZM6Q 4EE2A 1XMOL 1TR5A 4X62Q 1EYGA 1VQLA 3J7AF 3DBLI 4LNOA 1D5XC 5L83A 4TSSA 3H15A 2HT1A 4LDTB 1NSNS 3JVZX 1YNJC 4M02A 4RA8A 3TCAA 1LLRD 1YNJD 4S3SA 3Q8DA 1T6BX 2EMSA 1LO5D 4LNNA 3S15H 3KDFA 3NPPA 2Q8TA 3RZDB 1WR1A 1SIJA 2DAJA 2E6XA 2KO3A 2M0AA 3AMZA 3HOXH 2W3SA 2OEOA 1TKGA 1R4NB 1YN5A 4HCPB 4J6IA 3FMCA 2O4XA 4FLHA 3OOCA 1SMXA 1FL0A 2R7FA 2BDNA 5CC4A 4C3JB 3R8BA 2NBFA 1RRBA 2R7ZH 3Q3NC 1Q8KA 3DBHI 3Q3MC 3SE0A 4NDXA 4M00A 5EQ0A 4PS8A 3RNGC 2DZKA 1JWAD 3GTQB 4XQNA 3C1EA 3OIQA 4UP9A 3AXCA 1Y14B 3T56B 4ALPA 4V190 5C23A 3S1NH 1HNWL 4DXFA 2ZW0A 3VH4B 3S9WA 1BCPC 4KSKC 1EWCA 1UD7A 2HTHA 4ZYNA 4L1BA 1XWEA 1LTBD 1BCPD 3HK0A 1YJWA 3GTOH 4ZRPA 1VR9A 1S5ED 2F4IA 3RR5A 4KSLC 1UE6A 1Q86C 4ULLA 4KJNA 5C0XH 2K5NA 1V5TA 2Y0SB 2GMIC 3LJ3A 3ER0A 2PPBC 1N34Q 3Q8FA 4XXEA 4BBRB 5C44G 2PMZB 5JPNC 4RHSA 3LWUA 1ENAA 1CHQD 5LL6X 3OTOL 1FNVA 3GDEA 2GVAA 1IP9A 5EBDA 2PJHA 1UUPA 3U2SC 1CHPD 1Y8PB 1F2MA 2L3ZA 4DK1A 1E5WA 5AJ3L 4DN4M 3OJ3A 4B9KA 3MHSD 1O78A 2Q8IB 1WX9A 4S0RA 1KLGD 2V4DA 1STHA 1F2RI 3J9CA 5BR8L 3TREA 1YIWA 3IAM1 4OWXB 1C1YB 3FAHA 2B8GA 1VZ6A 1ZE3D 3M62B 3AN1A 2BE5C 1E2VA 3GE3C 4XT3B 4R8IA 2V4LA 2BE5D 3T3OA 1DOYA 4C3JG 4IOCA 3UQAA 4OEMB 1T0SC 4NJ6A 3NVYA 2HHHL 1K8OA 1CUKA 2D0OA 1A63A 3QARA 1E9MA 3K80C 2JN4A 4Q2JA 4K81A 2MBBB 3VR4A 4F8MA 4KHVA 1C79A 1HR0L 4DR4Q 2QDFA 3CF6E 2ZXOA 5C5MA 1K83H 2BYFA 3KUCB 2MPMA 4GKKL 4R3DA 5LHY1 1QOAA 1VQIA 2Y0SE 3I8ZA 1SFOB 2BA1A 3TS0A 1EQVA 2PMZE 1N5WA 1WXMA 1WE7A 2L8JA 3KWVA 4PT5A 1CI3M 3ZXVA 2F0UA 4C56C 4DAMA 1XCQL 3G6JB 5M5WH 1X32A 2N9KA 4US8A 3GZNI 2R92H 1LV9A 4Y52H 1ZYRC 2KQ7A 4BBRG 3OWEB 4MH0E 4C2MB 2Y5CA 4W9HA 3RLOA 3E56A 1PDXA 1ZYRD 2D9UA 4LW1A 4JOIC 3JAME 4LF4L 3FHWA 2W54A 4MGIE 3M85A 3V96A 1GM5A 2EYPA 2FJ2A 3QJYA 2N4FA 3EN2A 2UWQA 5GAGC 1H9MA 4BBSB 3S24A 2RGFA 4YWMA 4IUPA 5EPKA 2L15A 4HIMA 2IO1B 3PVLA 1RYJA 3SK4A 3TMPB 3LGJA 2YEPB 5IGBA 5JXVA 2KX3A 5FLMH 2XRSD 1OTRB 2BH2A 1L0YB 4PZ6A 2IHEA 1EYAA 4N6EB 1F77A 2WDRB 1A2TA 2HD3A 2L7RA 2VZKD 2NTTA 4LF9Q 1U5KA 4FVMA 1X3FA 2K50A 2L52A 2EZVA 4DHZB 3AU4A 4JPSA 4EEWA 1AP0A 1E7UA 1HZ5A 5HFYA 3IFDA 1O80A 4XX5A 4GNXA 2NBWB 1S5CD 5T1IA 3T13A 1R4MB 2AQ3B 2KFJA 4MSQB 1K0SA 4NY0A 2A69C 1TJEA 1ET6A 3EA6A 3IRBA 2R6GA 3BK2A 2HDMA 1V86A 1WM3A 3D4RA 2K3UA 1MG4A 3KJPA 2ON8A 1A3VA 2D0PA 2L76A 1RDPD 1F52A 4KKSA 1MG8A 4GOPA 1DGSA 4G4KA 4BY7B 4R4IA 3RCZA 1TIFA 4LF5Q 3B6YA 5NUCA 1RL2A 1PUTA 1BCPF 1LABA 2CVRA 2LVPA 1P0RA 2IX0A 3I4LA 2MJDA 4RCOA 5AFWA 1HHVA 2DY7A 1NENB 3VR9B 4DR7Q 2KFKB 2EYFA 3A4RA 1ESFA 1NE3A 1IHZA 5J39A 1VQHA 3SVMA 5L95C 1X3QA 2F0GA 4GLAC 1G291 1KRTA 2SDFA 3C3LA 1I35A 5C0XJ 2HTME 4UY8C 2IO0B 4N9F4 2Z6BA 4IUVA 5HGQA 1EEFD 3UDGA 2OTJA 4PNYA 4P1BC 3NUHB 1WGYA 3IT4B 1WFQA 1VQ8A 4JI7Q 2JQRB 3QR8A 1D5ZC 4K2KA 4QGUA 2MGSA 4IM0A 3CCJA 2HCCA 4H13C 3VTVA 3VUYA 4DHZE 1AZQA 3SR6A 2N0SB 3TEHB 4FJYA 2E2HH 1PGBA 4US9A 2KENA 4NB3A 3U4ZA 1VQGA 1VD2A 1VQCA 4ODGA 1YZ6A 3GB1A 4JI0L 1P9DU 3FP9A 4L63B 3A1QA 5D2MB 4J6HA 2KANA 4DNTB 2MHJA 2B2WC 3Q3FA 5CBAE 3TS2A 1ZDXA 5J2RA 3Q8AA 1M90C 4YY3L 3NTHA 2A5HA 4PZ7A 3PIP3 4KJOA 2J7QB 3A1QB 4A3CH 3SHQA 2W55A 5HI1A 1VDZA 3AEDB 3A9JA 3HIZA 4B6WA 3D0FA 5FLXE 3VYUA 3NEMA 3CMMB 2K5PA 3UQBA 1SAPA 1JICA 2C9OA 2K03A 2BW2A 5C2TB 3UDFA 1GPXA 1ROEA 2PI2A 1SSOA 4JPBW 2ZXRA 4CJ2C 5IY0A 3MA2B 1NMFA 1T3QA 3ZQ4A 5C6AA 4XTCS 1IYJB 1J19A 1XLOA 1F2YA 1KRSA 1N9WA 1ZKHA 3FEWX 2M0XA 4LFCQ 3GP7A 3KQ4A 4WQOB 4HK2A 4JK1C 4BY1G 3MXGA 3N3KB 3APDA 1ILQA 5AUIA 3M4QA 3A7AB 3J80E 2F3WA 1O7LA 1AZPA 2OTLA 3ICEA 1F9PA 2UXDQ 3VUXA 1FXTB 2L12A 2JA8H 1BMLC 4DV4Q 2JA9A 3EUB2 1QUQA 4AIMA 2PE6B 5E6NA 1LTTD 3LYYA 1JQ4A 4XGAB 4GS3A 1IGCA 2MRPA 4GN5A 3Q2AC 4WWPA 2LMCB 1JWUD 5E3FA 1R4NI 2AX5A 1XPRA 5IP9G 1N32Q 3NS8A 2JA7H 1YHQA 1G51A 4IQZA 4JIOU 2BOSA 1WF9A 4JI8Q 1OEYJ 2AWOA 1K9MC 1VF5C 2R7ZB 2N88A 2W82A 4OX9Q 3AE5B 1JOOA 5JJZA 1FXIA 5M3MH 4GKJQ 2UU7A 3JAMi 4QF4A 1PH7A 1D5MC 1HNXL 1QQRA 4EQ5A 2A5UA 4JWSC 1E24A 4B3TL 4R4CA 2MFIA 4EZJA 1XLQA 3EROA 4W9KA 4GDKA 3TUOA 1C8CA 3VTUA 1PTOC 2JT4B 4BBNC 1K50A 2LI5A 1PTOD 2LXKA 2FNJB 4UAIA 3GTOB 4LFAQ 1KM7A 1K3RA 3U50C 4HXDA 4RM8A 1Y8OB 2M8SA 2J0TD 2EIFA 2N3SA 2ZNVB 4M8MA 2MH7A 4YWGG 3SXHA 4P74A 1DGJA 2H89B 2CJOA 3U9SA 1HZAA 2IO3B 4MTNA 4A3GB 1I50H 3ZJYC 4YTPB 2HJ1A 1M1KC 3HOUH 4YT0B 4A3FG 3C46A 4IWPA 3EJIA 2JYOA 2CR5A 3R93A 1PYBA 1V1PA 1ENCA 1XNRQ 2A74C 2FE8A 5CHFA 5KYIA 1T5EA 5JVG3 4LJPB 3D4WA 4KV6A 4ITKA 5AZHA 4L6TB 3URYA 5CV6A 2DHZA 4IUQA 1YJIA 4XZ4A 4REZA 3Q3JA 5D94A 4L8JA 5CGKA 1JRPA 4B95A 2YTVA 2VQEL 4ZRJA 4KIKB 3I90A 2DNEA 5EKLA 4G11A 4HJKA 2BCOA 1D4BA 2WWZA 2JVCA 5M3FG 3H91A 3P4RB 1WTPA 5KGUA 5I9PA 3RPFC 3A8IE 3ITPA 1GNUA 2EQSA 4JI3Q 3H7SA 3P75A 2LGIA 2ZJRA 2N9LA 1UAPA 4OONA 1V81A 2DNFA 2BT6A 4WJQA 2PTLA 2C9WB 3TEXA 1NVID 1HTLD 4WWMA 2RDFA 2F0DA 4PYZA 4FHJA 1STAA 5FJ8G 3AH7A 3CCEA 2MX2A 1EFWA 1JR0D 2KEDA 3UI2A 2R92B 1MIUA 4JW0A 4Y7NH 1KRHA 3IXSA 3F1ZA 3PUYA 2DGYA 4HIOA 1WH3A 1N5XA 1FEHA 2V3PA 3RD4A 4PYUA 1BBXC 2K8CA 1C7YA 3QQ8B 3CPFA 1HZ9A 5BN5A 1PH2A 3BIID 3MJ5A 4J15A 2AWNA 2ZJQA 4KD4A 2DAFA 3PO0A 5E6OA 3GTPH 1PTOH 2VH1A 4CKCA 1BCPB 3JAMc 1YNTE 1D8LA 2KHWB 3BG3A 3NUCA 3DUZA 4B08A 5A2QL 3NZSA 4LJOB 1P8LA 4YSXB 3J81E 2PO4A 3OSOA 3ND9A 1NEKB 2KOLA 3DVGY 2VUMG 3KLRA 3M4PA 2SAKA 1YOVB 2K0PA 1JJGA 2BPSA 1CZPA 3DWQA 5MPOA 4AQYQ 1SNQA 5LNK1 2FMCA 4WJPA 3AI5A 3HOYH 1E90A 1JB3A 2Z0SA 4MIUA 5EKIA 4JYAL 1SE9A 3N32A 4AWJA 4CHTB 4K0KL 1LQBA 1WGGA 1WFYA 3NVVA 3DVNU 5GQOA 1MKHA 1KNAA 4J3OD 2QIEB 3I4MG 1FNUA 1CKNA 2K5QA 5KIXA 2CW0C 1PTOF 4BBNF 1PGXA 3QA8A 2EXZA 2R93B 2CW0D 1J9OA 2NZ1D 1BBUA 2DUDA 4TV3A 3S1MH 5C44H 4RAUC 1AARA 1TIID 2I1JA 1JOQA 4K7SA 4NZLB 1LT6D 4NNJB 3VA5A 1GUTA 2I5HA 4LF6L 4XDCA 2KMMA 2I46A 3VR5A 3OMGA 4A3JG 1G6ZA 3ONAB 5JOBA 3ZJTA 4K7WA 2UXCQ 4IALA 4M8NA 4EZLA 1XO3A 2K25A 4BOSC 3UE0A 4NXML 2DZJA 2E2JB 2CWPA 4BKTA 1RCVD 4C4VB 2L4NA 2Z59B 4KGRA 2FFKB 3PIOA 3P42A 1FVIA 1LM0A 1YEZA 4A55A 4C3IH 2I0QA 4WQMA 5J1ZA 5M5XB 4QUCA 3W2DA 3JAML 3M3YB 2CU3A 3N1ZC 3TMEA 3KF6B 4UPAA 1K52A 2B2TA 5IGCA 3M63B 1WTVA 3VR8B 1S5DD 3X3MA 1KJTA 2QMTA 1HJPA 4A3KG 4JOIA 1L1OA 1DXMA 4TKOB 2NB0A 1N6ZA 3A33B 3QWZB 2IHFA 4N9TA 4CQNA 1NTGA 1MPEA 3X0WA 3ZRFA 5I6WA 4UDUC 2DNCA 1V80A 1WJ4A 3GOEA 1QNKA 2Z4IA 4GNXC 4HN7A 1HUNA 1IBMQ 1XT9B 4DUYL 1AEXA 1CT1D 1LM8B 3X23A 1TWFB 4B0EA 1J8CA 2D11A 2C35B 1OXUA 4CBVA 3V60A 4DK6C 1KL9A 1A70A 3S1QH 1GC6A 3CCSA 2JU6X 3M95A 4HDOA 2VZKB 2OQ0A 1TWHH 5T1GA 5FLXc 4HJ7A 4GOPC 2JY6A 1EUVB 3G6EA 3H94A 2ATWA 1HPCA 4YCWA 2O2VB 4ZRKA 1E7VA 2FCMA 5AEKB 4GOCA 2D2QA 4HCNB 1JB7A 3ML8A 1PMRA 1LACA 3AEGB 4YHHQ 2DLBA 3PT2B 3N52A 1IUEA 3CCUA 1CSPA 1YQ3B 1Q90A 2NVTB 1HZCA 1K28A 2F3IA 3M7GA 4BKSA 3KUDB 5EPJA 4I6NB 1X9NA 3KOJA 2WB1G 1QCBD 3NXWA 2FAZA 2K6QA 3AE7B 3H7PA 3Q8EA 1DONA 1PFBA 3J80c 3S2HH 1NI3A 2M9VA 4L5SA 3V3XA 3PREA 4RNAA 3DM3A 2WDVB 1LTSD 3KUPA 2C7HA 1EWYC 1ONLA 1RHPA 4HJ5A 5DNFA 3CPWA 1MSHA 2K6AA 3QX1A 3BZDB 3D4DA 2D3AA 1YJJA 3TN2A 5LMNQ 1FFUA 1ICWA 1TBEA 3ZKJC 3A9KB 2AEHA 2EXDA 3KYCD 3BY4B 4DA2A 4KDIC 3PO2G 3X3NA 2NVXH 2ZPYA 4KX6B 1EIYB 3KLSA 4A3LG 2XBBC 2K22A 3DBSA 5H8YE 5IP4D 4XYCA 3R7RA 4GGQA 1SROA 3RN2A 2G1EA 4A8XC 4HSPA 3G4SA 1A62A 5E7NA 5I9OA 1C9OA 2MP1A 1BNZA 1U4LA 3SK8A 3BJUA 2DBYA 1EQRA 4DV5L 1B3QA 1N36L 4B9WA 3JC66 5BYQA 3J81i 3MFYA 3BDOA 4KK7A 1WZ3A 2IL8A 1FYCA 3W1GA 3Q22A 5C0XI 1VQ4A 4IUTA 3FPUB 1M8AA 4YCUA 3H09A 4F7XA 1FD7D 3NS1A 3OHXC 1IBLQ 1F1HA 1KABA 1X3EA 2JSOA 3I56A 3RUZA 1DOXA 1VQAA 1IL8A 4JBJA 2WKCA 5I2YA 2MA9B 4P1CC 4B3MQ 2O6VA 3PPAA 4JI6L 3CW2C 1B4OA 4FO2A 4C3HB 3ZUNA 4DAPA 2F52A 4IFDH 1OXSC 4OVVA 4TQ0A 4MM3A 1RKNA 2OCEA 2NBUA 3F2UA 1PFNA 2N9XA 4MGYE 2RKSA 3R3OA 3Q0AA 4KKIA 1TWGH 2KVMA 2DZIA 2IX1A 4MTKA 1WD1A 3CQZH 4MJSB 3AEBB 4FDBA 4ME5A 3KYDD 1U4AA 2L0TA 3B2FA 2WXIA 1EIGA 4FXDA 3CCMA 3AULA 2EE1A 2ZW1A 3E5SA 3DM1A 4FJZA 3KLWA 1YX6B 1VQDA 3DEOA 4KKTA 1KFYB 4CO7A 2FCQA 4QL5A 4HMJA 1IBKQ 4O2DA 3KVFB 4DV0L 3DHHC 4DR1L 4W9IA 2BYTA 2KWDA 4M01A 2HD5B 1RFKA 3EQLC 2OOBB 3NENA 2HQLA 4P72A 4KKJA 4G7ZC 1V9PA 2Q2UA 5HGTA 4JV5L 4PQXA 1SSNA 1Y8NB 4A3EH 4A93H 1UWVA 1OGWA 3BWUD 4ANWA 5IT9L 5IGGA 4XIGS 3CRKC 2KTRA 4ZRIA 1GUSA 5D14A 3GTMH 3OLMD 2VNUD 5KEEA 2I1KA 4GDLA 5HG2A 2WXKA 2B2UA 4LAAA 2ZVOA 3TP6A 1B8AA 5JAVA 4A3DB 2ICEC 2RA4A 4II3B 3S2DB 4GLXA 1U9RA 3T8MA 5FR6A 5IWAL 4BOZB 4C3HG 4GLVB 3GTLH 3GTPB 2BVCA 1PTOB 1ENFA 1JALA 2F0MA 1N33Q 1YJ9A 1Q3LA 3H3VH 1IPGA 4PMCA 2A1AA 3ZIMA 1O7YA 1A8VA 3U8ZA 1WCMB 5LMUQ 3VYSA 3I57A 1VQFA 3TP5A 1MHHE 4IKGA 4HJGE 3V62A 2RDGA 2VB3X 2Q2HA 4RGOS 1T0YA 3I63C 1XMQQ 4HIKA 3FDTA 1RIPA 4MGKE 1TGZB 1JJCB 1AH9A 1C4AA 3J81c 5FO9B 3E3XA 3P20A 4LK1C 3UDIA 2CKHB 4C00A 2ZXPA 2NUCA 3GTKB 2BA0A 3NQTA 3A55A 5C4XH 4YWKA 4ZLTF 1CK1A 4G57A 4A3MB 1J5EL 1G6JA 1C4PA 4JE3B 1P1AA 2BS3B 4A9AA 2B63B 4EQOA 4JI1L 4G0NB 1H95A 3V6CB 3AB5A 4DR2Q 3KDFB 2F4VQ 3S17H 2UXBL 4ZHOA 3H6NA 2K14A 2FUG1 4K5VA 5DPSA 3HOVH 3WWVA 4CJ1B 4DR3Q 4NAWA 2ZT9C 2KKCA 2WXRA 3KJOA 4DXAB 2Y5PA 4OZAA 1PYSB 4C1NK 2KTFA 4A3DG 5DEHA 3HOWB 1I6HH 1Z47A 1G2SA 5D7GA 4DV1Q 1CZGA 2EYLA 3VH3B 3VYTA 3PIPA 1YQBA 1SYFA 4H7BA 1R9TH 2GBRA 2QA4A 3WANA 2JE6I 3CC2A 3OIPA 5JPMC 1BUVT 5D3IB 1MI2A 4FP5D 4ARCA 1S3OA 1VQKA 2O2LD 2QKIC 4IFDJ 1MD2D 1C4CA 2ONQA 1WM2A 2ZTDA 1HRJA 4K5XA 2BBCA 1Q7YC 5A2QE 1HUMA 2EYOA 1FXAA 2MJEA 2D2CC 4PZ8A 1B50A 1T9HA 2PZTA 3J81L 1VQOA 3CCVA 4OO1G 1YVCA 5LLIA 3TDQA 4EVOA 2YTXA 2LZ6A 2KN4A 4FA6A 2MCNB 3EVQA 3CMEA 2MO1A 2PE9A 3DVNV 1OXTA 5JVH3 3OG5A 4KY5A 3PRMB 3S1QB 3GV6A 2L55A 1F9JA 2B63G 3D6WA 2IGDA 2N49A 3KF8A 4MT5A 5DM63 1ZKOA 4HVBA 1YX5B 2MQHA 1B9MA 4P71A 1JMCA 2JSVX 1F9QA 2JZPA 3TZDA 4L23A 1QILA 1HTPA 1HA5A 3ZTDA 2G45B 2SNMA 2WXGA 1WTWA 1MJEA 1NJIC 4GN3B 1P3QU 4JX1C 4GMVA 4NMZA 4P73A 5KHQA 1IYUA 1GKHA 2HUGA 2CS4A 4JBMA 4USAA 3T3NA 3DWMA 2KCCA 3L0OA 5IOCA 4ACFA 1A3UA 4QCLA 2LVQA 3NOBA 3QOJA 3K9PB 3EBEA 2D62A 1G2TA 1X54A 1N61A 1E2ZA 1YMHE 4IPGA 2D5GA 3ECIA 1FRDA 2H5XA 2BKRB 1IKLA 2F0QA 3B1LX 2VUMH 1QOGA 5I4DA 4XDXA 5K36H 1WJNA 4OWWB 4IOAA 4MNOA 2WXFA 5FK9C 2D10A 1NUCA 3SFDB 3I4NB 2KC1A 3KYHC 4XYOA 1CFMA 4JI4Q 2Y0SG 4JI5Q 2KHIA 4JLCA 4P16A 1I4RA 1Y1VH 2B2TC 3TP8A 4HKZE 4ZK9B 4BKGA 1C4QA 2HJ8A 2Z8LA 3DQVA 3T1YQ 2EYHA 2KQ4X 1L1OC 5JEAJ 4LF8L 3TRZA 4BXXH 4UP7A 2BKFA 1E3PA 3QWNA 3UGBB 5BMIA 5C3EH 3HUIA 5EGTA 2V3NA 3GS2A 4C80A 1CQFA 3DHGC 1QVGA 5J18A 2R2QA 2IX3A 5AZFA 3K9OB 5AUKA 3DXJC 2L83A 3N30A 3H9DA 4KD3A 4LK0M 1YN3A 1S4ZA 5IYCH 2KVRA 4X66Q 3M4OH 3NRZA 2NPTA 1F9SA 2MWSB 2ZTCA 2KWCA 1TS5A 4KTAA 2JXTA 1YITA 5CBEE 2E5LL 1Q82C 3GTGH 1JE4A 2XVSA 3HVDA 1B70B 3WAMA 2FBWB 2ACZB 1CA6A 1S72A 1V6EA 1WZ0A 4RMAA 1MVKA 2K01A 5CV7A 1X3GA 4GNXB 1Z7TA 1DZ1A 2PVGC 2ZPNA 1VQ5A 4UHVA 1ZOYB 3ONSA 4W9JA 4BKSD 3HRDD 2QF7A 4DV6Q 4DV7L 4AQ7A 2UUBQ 3K7AH 4FNFA 2XTIA 2C5LC 5IYBG 4AP4C 1TWGB 4K2LA 3AE3B 4WJ4A 1IW7C 3CQZB 2PNRC 1K8RB 4GOPB 3S14H 1IW7D 3VYRA 4DV3Q 2UUCL 4JBWA 3I4NG 1C76A 2MQJA 3K5NA 5DPRA 1G6PA 1BUIC 1TKWB 4XQJA 3CP0A 1SYCA 1VRAB 2WXNA 3FC4A 4D2KA 5BN4A 5IYDG 2JA6B 4A3BB 3ABVB 4A3OA 1AN8A 3NHEB 1E8WA 3BZCA 2KMAA 5FKAC 3GTJH 1EU4A 1JWMD 2KZRA 4QAYA 2JXMB 4BBSG 4WJOA 3TEWA 1EOTA 1VQMA 2G5DA 2C60A 4LFBL 1TKEA 1EY7A 1WGHA 2KN5A 4KKUA 1BOSA 2WXLA 1TQOA 3I91A 1RAXA 2PLPA 1AWDA 3N20C 3PO3B 3BDLA 4F88A 2EELA 4A3EB 2LWPA 4IWOA 4IDIA 3F2DA 4DV2L 5ELOA 5LXIB 4QUFA 1V2YA 1WD0A 2LRWA 3I9V1 1EIHA 1Y69U 4YWLA 1JRUA 1EQQA 1FR3A 3H0GH 3VFKA 5EKKA 1MGSA 3CU7A 2NS5A 4NQKE 1UELA 3MFGA 1HA6A 4L5RC 4B3SQ 1FPYA 1GXDC 5CMDA 3E0JA 3MXUA 2VW9A 3A5UA 3BK1A 3QO2A 2MSED 4MDKE 1H9JA 1V43A 1QNUA 1G91A 2EYMA 3D3RA 1P7FA 2OEDA 2KBNA 4WRDA 2R3ZA 3CMAA 1ZUD2 1S40A 4OL7A 4NXNQ 2O6VD 2EPBA 2XIWA 2QEXA 2WXJA 3A9JB 4IOIE 4APVA 3K6OA 4BY7G 2EJGC 2MLBA 1PYWD 3CXCA 4X64Q 1EWIA 3RZOB 1P7EA 2HDEA 3NSWA 3BVGA 4FULA 4RWSC 3D32A 4HEDA 4M8AA 4B3RL 1K51A 1NI2A 3ZJUA 5C4JB 1V97A 3W9CB 3HOZH 3U4EG 4FF3A 2VQFL 2V3SA 4Z9CB 3T16A 3ZW3A 4FN2A 1S5BD 2EDGA 4A3BG 4HPLB 3O65B 3SFEB 1V9JA 1F0ZA 4OO1I 2JA5H 5C4XB 1KAAA 3IL8A 4DF7A 4MEMA 2MNAA 2MP2A 1WGRA 3STBC 3S15B 1KOTA 1QUQB 3STBD 3HOXB 3CC4A 5K5PA 3DLLA 4KHPQ 1WI0A 4DR6Q 2J4XA 2KAJA 3CWIA 5HURA 3PO3G 2OJRA 3VRAB 1XQQA 3HOVB 2Z9HA 3V6EB 5DM73 2AHOB 5IP7G 3MC9A 3EHVA 3OAWA 4DNRB 1L2FA 2WAQB 1VS0A 1EM7A 5E1FA 2IYDB 2E2IH 2JP1A 5IGEA 1RWSA 2BF8B 2GVBA 2UU9L 1GUGA 1GJXA 2ZM6L 1XNQQ 5CX3A 3T9LA 1QZEA 1CZWA 2VB2X 2HQEA 4X62L 1EF5A 2JUOA 2OHFA 1I6HB 2QW7A 5IT9E 1JWSD 2B2UC 1YHBA 3T1HQ 5FO7B 3S1NB 1UF0A 3FKIH 2IGHA 2LVOA 1PH3A 4GXBA 1WSPA 1R9TB 3OWFA 1WXAA 1UNSA 4A3IH 3L16A 2Q8RE 2TMPA 5LL6S 4GDKB 4W9CA 2CFMA 2PI2E 1TWAH 4RCNA 4EQPA 3MVVA 5JEAG 5BMGA 1FRRA 3Q23A 4URKA 3AYHB 4FF4A 5EJWA 3M3JA 4DR5Q 1B9NA 4ZDVA 5G2NA 2NWGA 4MHEA 1H9RA 1U4PA 3ERSX 4PV1C 1SYBA 3W1BA 4PS3A 1IKMA 2WX1A 4HR7B 3HKSA 1E8YA 3ERQA 5KNBA 3U52E 3HGBA 3Q6SA 1WE6A 1C48A 1WTOA 4HROA 2O5IC 1BT0A 2B2YA 1W6KA 1YBYA 3MC8A 1V1PB 2LGXA 4H44C 3EFUA 3LB8C 4X3SA 3D6CA 4DDID 1RM6C 1PFMA 1SIFA 2UUAQ 1FJGQ 4LTUA 2LGDA 3L3OC 2WAQE 3H6MA 2KDEB 3PGEA 3L2PA 5D6JB 1Y1WH 1Q10A 3EECA 3LDZE 4ZRZA 2IT1A 3KLSX 2AL6A 2R7ZG 3VQIA 1SYDA 1DOKA 1AW7A 3NTKA 2WAQG 1GUWA 1VMCA 4ZQ3A 3VR6A 4C1NI 1ILPA 2INDC 1VCBA 1ZPSA 2WNMA 4NQLB 2A68C 1N34L 2KA7A 3GD7A 4RF1A 2A68D 1HNZQ 3B0AA 2IY1B 4NKLA 1K83B 3CHBD 4JCVE 4I65A 1SRUA 3TEYA 2KJRA 2AMCB 2KWVB 3IT6B 2K1FA 3NK9A 1K73C 3BVMA 5BN3A 1UE1A 2KWUB 4DUZQ 2WU5B 1RFAA 3PSIA 2GLSA 5EDSA 1LTLA 1GHKA 3CIRB 2NVQH 1KD1C 1IGDA 1H8CA 4ZOHC 2W3RA 2H1EA 5C0XG 5M5WB 1XJVA 4X3UA 4AOFA 4H2AA 1O7ZA 1Y1VB 2MBHA 2JRIB 3QIAA 2WP9B 2AUJD 3MZ5A 4JI2Q 2M1MA 3ZNHB 4DK0A 4A3GG 2YU9H 3A8JE 1KDAA 2B2VA 2JZZA 1EYDA 2VXWA 4DXGA 5JJIA 1EL0A 1V49A 2YVCA 3ALBA 5TR5A 4DU9A 1X65A 2KEEA 3J7A5 5GROA 4JGHB 3ZO5B 4DR4L 1GHJA 5C3XA 3NWSA 5LMNW 4FHKA 1M4VA 1I94Q 5JHAA 4X3KA 1LT5D 1VQBA 1XMOQ 4M1UB 4PMWA 1SNOA 4ZCKA 3M4OB 1NNXA 2K5DA 3I55A 1FM0D 4KHZA 1HEZE 2VY3A 5KRUA 1L5PA 4WJ3M 3NZUA 3ZGZA 1QJOA 2K75A 4K8JA 4YL8A 2XWJB 3NELA 4C7ZA 4DPGA 3FILA 4X65Q 1PGAA 4LNFA 1A5RA 2F0HA 1LTAD 1A6XA 1TS3A 1X56A 1CJEA 4IFDI 4MSMB 2F0LA 1NAPA 1KLUD 1D1IA 1SE2A 1WTHA 2K7VA 4N9PA 3M7NA 4LF7Q 2F0TA 1V1QA 2PEAA 3P2BA 4R4OA 2KK8A 4PG3A 3AE1B 3GO5A 4GB9A 2W9NA 5J3BA 2RMMA 1KF6B 2DZMA 3RZFA 3OJ4B 1CKNB 1EQTA 2DY8A 2EY1A 3S14B 5J17A 3KFUA 5IN7A 3AE4B 1UEBA 2J52A 2R92G 4EX5A 1SE8A 4X66L 4LF9L 3J81j 4UP8A 1HNWQ 3CF5A 2EY2A 2L0FA 1PHJA 4HJAA 2I38A 3JSVA 4IJLA 2RR9A 1SNMA 5IO9A 2BS4B 1EYCA 5EE9A 4BA2I 5C3JB 1UH6A 1J7AA 3NY5A 1I4GA 3DCGA 2LFIA 4AUQC 1FNWA 5FLMG 1FO4A 1WOCA 2PYKA 1HFGA 2ICIA 1C78A 1OO9B 2NN6I 4RHRA 3OTOQ 4C3JH 2JEAI 5DLQE 2E2HB 2WXMA 3QK0A 1FMAD 1TZOA 4LF5L 2B39A 1GUAB 1Q1EA 1Q5WB 1UBQA 1WXQA 1CMXB 3G7LA 3N9YC 4LLGM 4ARIA 5CHWA 4FF1A 4HRSA 3CCQA 1PV4A 1XLPA 3VR2A 3IFTA 4RH6A 2Z0DB 2EY6A 4DR7L 3GTQH 1OFFA 3WA0A 3ZNZB 5AJ3Q 2OQKA 2IDYA 4WURA 1L1OB 1MSGA 2WKDA 4A6QA 4R1JA 5BR8Q 3DVGX 2N9PC 2J53A 1QZGA 3H1UA 3H3VI 4NPSA 1JQYD 3R2IA 4ICVA 2LSSA 3R7QA 1I4QA 1VQNA 1J6QA 4WJWA 2EJMA 1LTGD 1QWYA 1S1QB 2GB1A 2GBNA 1GB1A 3I3TB 4JI7L 1HE8A 4FADA 5HY6A 3PF5A 1QLBB 2CWAA 2R93G 2XGTA 1B1ZA 1D6EC 4LNQA 5GMVA 1OQYA 1GOZA 4BBRH 1IYVA 1S5FD 3HOZB 1HR0Q 3K59A 2A8VA 4RFBA 1ASZA 4GKKQ 1B44D 2JA8B 2JA5B 1T5XD 3LX0A 2WV6D 3TZUA 3MC0B 5L37A 3PUWA 1R4PB 3P7JA 1MJCA 3PMFA 2LY7A 3H7PB 3PTFC 2QCPX 2E8GA 2QEJC 5CV9A 1WR6E 2ASBA 2JA7B 2PNHA 1QVFA 2XWBB 4K6LA 2LUMA 3I4OA 4RG1A 4NJ7A 4YTMB 1KNEA 2PQAA 2XRQD 3CCRA 3OW7A 1BO0A 4LF4Q 4X64L 1KXLA 1PFSA 3HKZB 2D3CA 2KDMA 3C0RB 2PQAB 5M3MB 2X6LA 1BR9A 4LFCL 2L32A 5GXGB 5DPTA 2KT7A 3W5OA 1ET9A 2LS01 1WYDA 1EF1A 3RNEC 4MACA 5HKHA 1PRTC 3VDYA 3PV1A 4A3CG 2UXDL 3FKIB 1PRTD 5EBCA 3RMKC 4B0MA 4DV4L 3CKIB 2HDLA 1A3TA 1W6JA 5CORA 2MJ3A 3H3VC 1KDCA 2NVUI 4A3IB 3L17A 4DHJD 2F0NA 2ZEQA 1TWAB 5IT9c 4Q0FA 2D3GA 2K52A 2RBMA 2BYVE 1N32L 2BH8A 2B3AA 2RPQA 4POFA 5KHOA 3ZDMC 1CKMA 1YQ4B 2PZUA 4C2MH 5A35A 4PS7A 1AE2A 4TVAB 3RN5A 4YCVA 2FCNA 1LTRD 4ZAIA 4JI8L 5JJKA 2A6HC 2NMQA 1I4HA 2F0IA 1I50B 4EKUA 1HCZA 3NP8A 2M17A 1ZEQX 1SYEA 3HOUB 2A6HD 3TL5A 4ZHPA 2IO2B 3RNFC 1JW9D 1GUOA 4OX9L 3F8TA 4BBSH 1L4DB 4GKJL 1ML0D 1TYGB 3UIOB 2Z4HA 1XYIA 2K28A 4CDCC 2O6VB 4YSYB 4JVZA 1II3A 4LCDE 4RKBA 3GE8C 5IOIA 2RSUA 3MP9A 4HKQA 2CCZA 2B8FA 2E74C 1RTNA 2K05A 4QJFA 1SBBB 2JA7G 3RNAC 4WAAA 4MM3B 3HKZE 1GB4A 2NCNA 3ZJVA 4M0WA 2PQEA 4TMAB 1Y1WB 3MTSA 3QB3A 4LFAL 3IKJA 1DOLA 1PH1A 4ASWC 2BGFA 1E0ZA 4BVUC 4DBGA 1PH8A 3BINA 3KK7A 1NYQA 3ZDTA 3MHZA 2J0JA 3CSFA 2LUEA 1E7ZA 5M3MG 1E0BA 4ANVA 3KUZA 2PW7A 5I2XA 1DYQA 1L6UA 1Z2MA 4DAYA 3AU7A 1R4QB 3MXNA 2PW5A 2JWZA 1Y56A 5G55A 2KOXA 4K1RB 4DAYB 4X3TA 3WIMA 1L6VA 3MTNB 4W9LA 1XNRL 3UDXA 1YI2A 2LFNA 1NMGA 3SGIA 2KCMA 4JI0Q 1IBXA 2KCNA 3J7ZC 3RNCC 1K8GA 2XSCA 3AFQA 3PUXA 2NVQB 4DQOC 1I4XA 1WGDA 1EY4A 3AE6B 1I5FA 5FO8B 4XWWA 2WS3B 3ZTCA 1IBXB 1ESRA 4K14A 4BY1H 2OJWA 4Y7NB 1A0IA 3EFXD 5IODA 2KLGA 1BXTA 1VQEA 1A15A 2LRUA 2YU9B 5ISRA 4KVGB 2KTRB 3HOUG 4ZKCB 1QE6A 4A75A 2AKWB 5CV8A 1EO6A 2INNE 2YV5A 1I42A 1ISNA 4GDLB 4K5WA 2NZHA 3IAS1 2F0VA 2I5MX 4P75A 3IFWB 5IP9H 2AUKA 3M9BA 1MI0A 3RNBC 2B2YC 4FXGC 4JI3L 3V2TA 1EOVA 4EFOA 1TY0A 3TQYA 3HEJA 1S3SG 2QILA 2A73B 3AEAB 4XE0A 2WXQA 2JRHA 1G8ZD 5D3DA 1DD2A 1L0VB 3HOYB 2KXJA 2KJ6A 1BBWA 1NCVA 2XN9C 1HFNA 1WMHA 1ZW7A 2DJGC 4WWNA 1KIXA 4W9DA 3RUIB 3A56A 4I6PA 2X69A 3OYYA 1WTRA 4R4TA 1PRTF 4R8NA 4ZUIA 3UE1A 2LD9A 2E75C 4EOYA 2ZJDA 5ELNA 4NPNA 4GN4B 3ENEA 3RLNA 1JORA 1JWBD 2L11A 2E3TA 2N8NA 2AQ2B 4NW2A 2OF1A 1EUJA 3PHWB 3S1MB 4JC0A 5C44B 2N55A 1D2BA 1HNXQ 3RULA 4OW0A 2KECA 3H8HA 4B3TQ 2FUHB 3EIVA 3APFA 1ZXIA 1TVXA 2EYJA 4GN1A 1F9RA 4A3FH 1E1TA 1KTKA 1STGA 3WDNA 2IY0B 1TXYA 2XNAC 5IGDA 2N9EB 4NAWB 4AQYL 1Q8IA 3AE9B 1X1MA 4HWIB 3EFCA 4WWOA 3L13A 3BU2A 4X65L 1XTCD 4HJ8A 4O42A 3APCA 2B2VC 2BB5A 4GIVA 2A19A 5FR3A 2K5HA 3RNUA 1SE3A 2SEBD 2M19A 1V1OA 4KZ0A 4F7ZA 4G50A 3KBGA 3E0EA 4C3IB 1LUZA 1SEBD 4LF7L 3N1XC 3GV3A 1WCMG 3I7FA 5M9OA 2QSDA 5JZEB 1Q1OA 3K8AA 3R2TA 3AM9A 3AEVA 1C3TA 4JBKA 4I7ZC 1WVLA 1SJHD 2FXQA 2K33A 1B9RA 4ICUA 3DWAA 5M3FH 3AV8A 1MBYA 1N8RC 1IXRA 3HOYG 5KNCA 3IBEA 4F1SA 2SNSA 2KVZA 2KJHB 1C0AA 1RD9D 1WTXA 2MO0A 2UXCL 3TP7A 1BVSA 4QQBX 1M94A 4QMGA 4A3MG 3U30A 4L2YA 2EVBA 1JT8A 3O13A 4OZCA 2BB6A 2DJFC 1EEID 1ASYA 5FJ8H 3I5JC 2N7JA 2VRRB 1H9SA 5EPLA 2VQEQ 1TWHB 2KDIA 3KH0A 2PMVA 1MHXA 1H9SB 1LGRA 1SMYC 2XK5A 3HG9A 3KF8B 5GAEC 4A20A 4A3GH 2RHQB 3L08A 1XTDA 1SMYD 4KY6A 1JJ2A 1UWXA 4IG7B 2XK5B 2L9HA 4R4QA 3VDZA 3SK6A 2F0PA 4IWQA 3A0JA 3IAYA 4B9XA 2NVYH 3B2GA 4BZAA 3HOWG 4OVZA 3S2HB 2LHEA 2M4NA 3BDCA 3RLFA 1CA5A 3NHHA 3U7DA 2GRIA 1GC7A 1F2ZA 4IURA 2LASA 2LXCA 2RCNA 1IBML 1E10A 3UF8A 3G71A 1LT4D 1B53A 4C3IG 1LXDA 2GBKA 4AJWA 1EU3A 3JYUA 2EY5A 2JQOA 4FBJB 1SLJA 3QIJA 3DOWA 1CQVA 5TSSA 3SEBA 3U4VA 1WIAA 1BF4A 2X38A 4KY7A 2KMCA 3QOLA 1CKOA 2IY5B 4DWFA 4OELB 2RCFA 5C4ZA 2NVXB 3RFZB 3W3AA 2MJ8A 4A90A 1WX7A 1QOFA 2N7EA 3ULJA 4YHHL 3MEHA 4ABNA 4KGSA 2PZWA 3NQIA 5C4HA 1I3QH 1DOMA 1TT5B 4XC2A 3I4MH 4RGNA 3OW2A 4I7AA 2IW3A 2A4ZA 2WACA 4MH8A 5I6YA 1HZBA 2CQAA 4GZYC 3I70A 3NVWA 4KMUC 4KN7C 4YXDB 4ZUJA 5G5GA 2IJ0A 3PS6A 4HMIA 5E6PA 4A3PA 1P16A 4JL9A 3W1SA 3TIXA 2WFWA 3K7UC 2F0EA 1VLBA 1SR3A 4JYAQ 4A3JH 5CR3A 3ZRCA 4K0KQ 5LMNL 2SOBA 2NPTB 3HZXA 3RMHA 2X8XX 5CV4A 2X6GA 1KH0A 4G7OC 1ZXTA 1YJNA 4DNIA 2L0CA 2K9XA 2LXAA 1HQRD 3PLVA 1QF6A 2QHOA 5DCNA 3BZKA 3OMCA 3P4PB 1F2RC 4RMFA 1PLFA 5M5YH 3U7ZA 1WX8A 2A6EC 4N8X1 2WINB 3LNNA 1YHAA 4J8QA 1XEEA 1U0LA 3AB9A 2A6ED 4LF6Q 4A3KH 2CKZB 2V4IB 3DMUA 2G3QB 2MBQA 3SHLA 2GA4B 1VCIA 4TQUS 3HHMA 5JHBA 1KAWA 1EY0A 3DEPA 4IUNA 1EZ8A 2ES2A 4LUZA 3SR1A 3U58A 1I7HA 4NXMQ 4YTNB 3SDLC 2AL3A 1IZ6A 1JOKA 4CDDC 3WCQA 3S1RH 1PVOA 3I2ZA 3MWYW 1IBLL 4FJVB 2PKOA 3WOEA 2KHJA 4TKNA 2A69D 5CYUA 1I4PA 4XYQA 4CJ0B 1VQPA 2VS1A 3C2PA 5HHDG 1JE5A 2KHSA 1CTMA 2M56B 4B3ML 3TBIB 4DK5A 4W9GA 3BYYB 3A4SC 2E2DC 3L54A 1VJKA 2KFKA 2R93H 1YNNC 1Q0WB 4CYEA 2Z1CA 1VDVA 1YNND 2KCTA 3P1MA 4A93B 1KDBA 3W5VB 3QHTA 4BY1B 1ACCA 4IPHA 2E76C 2ENBA 2L1BA 3T51B 4WORA 1D1KA 4PMBA 1PXUA 3GTMB 4RGTA 1NR4A 3M4YA 3C8YA 3PRPB 3NVZA 3PF4A 5BO4B 4DUYQ 3Q3OC 1OXXK 3NJTA 1WXVA 3DHIC 1OQRA 1H4RA 1N60A 2E2JH 1PRTB 5IGFA 1EZ6A 4K3BA 2FINB 2LGSA 1UE7A 5ELCA 3U9OA 4AS1A 3GTLB 4IFDG 1PH9A 2WXHA 3A74A 1C77A 1AFPA 4DHJB 3RI7C 1NDDA 4HIDA 1IBKL 5M5XH 4X6AH 3K0XA 3M3YH 1CM9A 3QAQA 2NZOA 4HPPA 4AH6A 2PW9A 1TZ1A 1Z9FA 2ZTEA 4CGYB 2YLMA 3PSEB 1X55A 1SF0A 2DYMA 3PO2H 2MEKA 3CSTA 1L2NA 2N1VA 3MHBA 1TU2B 1VQ9A 1STNA 4A3LH 2INCC 2MBEA 3HM6X 3P1HA 3RT3B 2JA6G 1MHWC 4NJCA 1SN8A 3PV0A 3Q14C 4RM9A 1O7IA 5EAYA 2EKEC 2LHDA 2H88B 2HIVA 1E1OA 1MFWA 2AWTA 1TWFH 3VA7A 1GAQB 3L7ZC 5COYA 2BQQA 4MN3A 1STYA 4FXKC 5D65A 1W2BA 1W3SA 2LXJA 1CSQA 4KV2A 1RLFA 5H92C 2MP2B 1ZXHA 2LJ5A 2N78A 3S17B 1N33L 2KD0A 3AECB 3DBRI 3TEZA 1GO3E 1PH5A 1WYWB 1PZKD 4A3EG 4A93G 2NN6G 2JJQA 5LMUL 2RD0A 3PHXB 2DN8A 1WYGA 4RKLA 3N1YC 1BQQT 1OQQA 2Q2IA 3AEEB 3F2CA 4A3FB 3RYTA 2NVTH 1UEAB 2K32A 2CHBD 3QG1A 2R61A 4POGA 1L7YA 4JWUC 3LWEA 4RGMA 1XMQL 5C1ZA 2GI9A 2EOTA 2LGYA 3I3CA 2QDLA 4DV5Q 2PCFB 1N36Q 2Q2TA 1XCTL 2LMCA 2WXOA 2G9DA 1Q12A 2N7DA 1JC7A 2CHWA 2QCZA 3IG3A 5CHVC 2JYEA 1V8QA 3TSSA 1VQ7A 1R7SA 1E8XA 1HQMC 3PGZA 1QG7A 2L1AA 2UYZB 1STBA 4XT1B 4F87A 3DHQA 2V0GA 3RD2A 5C3WA 3SU8X 2CQOA 1A2UA 1EY9A 2MBOA 2WHIA 3DWGC 4DR2L 2F4VL 1AE3A 4J1MA 3AMUA 1PFDA 4JI6Q 1J0GA 2KQSA 1HXYD 3WAOA 5M3FB 2F0FA 3J7YW 4DR3L 1EWHA 4IN3A 1B2TA 3MXPA 1FCCC 1UGJA 1ZGUB 2INPE 2KACA 1NY4A 4CKEA 1EIFA 5C4XG 3ML9A 2BTEA 2NTSA 4LJZC 2AQ1B 3MEFA 2C7MB 3HM3A 2M00A 3FKYA 2G9HD 3AQQA 2MHVA 3HOXG 2ZZPB 2HCIA 4DV1L 3EC8A 3Q8BA 5BYRA 1YD8U 5GAHC 3S16H 3I72A 4BFRA 2JWUA 2Y3AA 4WAFA 3HOVG 1HZ6A 1VZ8A 3PZ7A 4GSWA 1NBWA 1WXSA 4CDFC 4KI0A 1D7QA 5G3LD 3A8KE 2L00B 2WDQB 3UI3A 4MGZE 4LDTD 2FCSA 3Q8CA 3E9IA 4DV0Q 4DR1Q 3MAQA 3Q24A 1K53A 4HCSA 2F03A 2IGGA 2JYTA 4C3HH 4HDQA 5ELFA 2NVYB 4TUUA 2Z6KA 4DGZA 2TSSA 3CAMA 4LMQD 4JV5Q 1OTCA 1AYFA 1STEA 1X6OA 5IE8A 1TWCH 3L0WB 4S17A 4FF2A 1YJ1A 2F0SA 2VUMB 1SB3C 3LXFA 4AYBB 4LNIA 2CHZA 1TY2A 4CKBA 1HR0W 4CHKA 1RF2D 4KIKA 2V1CC 4KN4C 2I5LX 2IZVB 2L5TA 4K7UA 5E6JA 4KZCA 1T0RC 5BMHA 4IO9A 2ZCBA 4OZBA 1L0XB 5IWAQ 1TT2A 5IAAC 4I6LB 4WH4A 2K4KA 1RODA 1LT3D 2FIDA 3PRZA 1I3QB 2KC2A 3I4MB 4IM2A 4ZRQA 2JXXA 3MJWA 5C3EB 3E9HA 1QT9A 2V9HA 2WX0A 2RPVA 4ANXA 1UE5A 3BYTB 3L9AX 1L4ZB 1GG3A 3K57A 5DAUA 1WWTA 4IUMB 1XPUA 2LEKA 3TJPA 1WJ6A 4E74A 2VH2A 4ILWA 4JG2A 1L0WA 4G7HC 3WALA 2K5WA 1Y8RC 4A3JB 3CD6A 4N59A 4G3XB 3A7LA 3V05A 2RQXA 4EGVA 3QJZA 3GTGB 1JMLA 1OEYA 1TS2A 4JI4L 2K5VA 4A3DH 1J5EQ 4YSZB 4JI5L 3S2DH 3HP3A 5FOBB 2K6DB 4C7YA 2ZVNA 4P7IA 4JI1Q 1E22A 4HJ9A 2OWOA 1WJJA 3FILB 3V61A 4AJYB 2UXBQ 3T1YL 2K8BA 1PZJD 4AYBE 3N6RA 4BWGB 1Q46A 4L5QA 4QIWB 4Q5VA 1TS4A 2JPHA 1K8MA 3K7AB 5M5YB 1RTOA 4W9FA 1WCMH 3RN9C 1X3PA 2RHSB 1K8AC 3F2BA 5AZGA 3NZ3A 4AYBG 5K36G 1QKZA 2KX0A 5IIFA 4A3KB 3J7AV 4IPCA 2BYEA 5CTRC 1Q1BA 3J80i 1XX8A 3DBLB 2D5DA 2C5CA 3FPPA 1PDQA 1Y1VG 1R4MI 2KDFB 4OVUA 2HE7A 3PCOB 3S1RB 4IM3A 3NBHA 2JK8A 1DJRD 5CV5A 1J8IA 2C7NB 1OXVA 3GTKH 1FCLA 4DAVA 1XD3B 4OO1H 1N63A 1BKBA 3PUVA 4OXPA 2GOWA 4BXXG 3GTJB 1PA6A 3NBHB 5EE3A 4A3MH 2H4OA 1B7YB 3SK5A 3RZDH 1E6EB 3JSVB 1U4RA 4K6DA 4NP5A 5C3EG 2B63H 5G5HA 3KBXA 1GJZA 2YYZA 1EY5A 1B3AA 4U68A 1VQ6A 4K8IA 4HCEA 1FD6A 3PLUA 2WDTB 4DV6L 4CDEC 2UUBL 2CHXA 4ME3A 5IYCG 1KLVA 4WJNA 4DFAA 4XDDA 2PIAA 1NR2A 3HRZC 1SGHA 4HAEA 2RSOA 3DBHB 1T0QC 3IVFA 2ID0A 2NR2A 3H0GB 2Q5WD 2RVLA 2WYQA 4JQWC 4DDGD 1I6VC 4EQNA 4DV3L 4II2B 3W1SC 4C4VA 2CH4W 2DWQA 2WB1B 4N8FA 2KJXA 3CRLC 5G3LF 3Q6BA 2HIXA 3JW0X 3VHTC 4QIWE 3HOWH 2I07B 2J0MA 2LJIA 2MUYA 3C19A 1HH2P 5JJLA 3KF6A 2BDOA 1GVPA 4OHJA 4XQQA 5E4WC 5IA7A 3Q69A 2F1MA 5T8IA 1TKYA 1XPOA 3D31A 1KC8C 2HHHQ 3BS1A 3VUWA 2AYOB 4DKAC 2O5JC 4DK3C 4BAXA 4KLKA 3PO2B 1VZ7A 2ASQA 2L05A 5ELDA 1XF5L 2V1YA 1VQJA 3ZNGC 5IKCM 2B76B 2CH4A 2P5ZX 3SD5A 4HLEA 1V8CA
chains in the Genus database with same CATH topology
1EY8A 3C1FA 5EE1A 2F0JA 1YN4A 1SNCA 5ELEA 3BVZA 2LKVA 3T4AC 2WP8J 5E4XA 4OGQC 1FFVA 3K5LA 2WQYB 3P4SB 1WRIA 3AEFB 4YIJA 3AE8B 2EJFC 1QOBA 1SE4A 3VRBB 2NYZD 1VMPA 2E2IB 2K1BA 1JCKB 4TQ1A 4N58A 2QDBA 4RF0A 1WTQA 4HSVA 4KGTA 1XLNA 1JROA 3NWTA 1U4MA 4R9WA 3A54A 2KQ3A 3NTIA 1J7CA 1SNPA 3I73A 5J22A 4FYDA 3W5UB 1ZP0B 1SDFA 3DWPA 1RJTA 3PZ8A 4ZKBB 2PVOD 3SDZA 3K5OA 3L4PA 3NE5B 1H9KA 4TRDA 4O1NA 1PZID 2I2YA 3K0YA 3B9JA 3FRPB 3EGRA 1UWMA 1EY6A 2OT2A 1XXGA 2FHTA 3HVZA 3E6ZX 1VF7A 1FIQA 4QB4A 2WIIB 1GUNA 4FXCA 3OPOA 4BA1I 3S16B 2J42A 4P6VF 1Z6HA 2B2WA 1C9FA 5FLXL 2IWHA 3K58A 2FMMA 2EKIA 4IUUA 4V0BA 5KYLA 5KNDA 5BYSA 1DCZA 3VR3A 3KWLA 1F2LA 3E9SA 3T53B 3P63A 1BDOA 1SXTA 4ID6A 4P2CB 2WXPA 4HEA1 4WIPA 4NAMA 1TWCB 1QOHA 4HTHA 4OIJA 3J80L 3ND8A 2YEPF 1WGKA 3ZYYX 2M2LA 2K04A 3FVQA 2BS2B 2WLBA 4IZ8A 2RDHA 2RSNA 5EE0A 4OIKA 1J7BA 2F3VA 1LTID 4ZYSA 2OXPA 1ZDVA 3K5MA 1SNDA 1EFID 1SYGA 2JEBI 2JX5A 5F2DA 1QB5D 2NN6H 2KUMA 2DYOA 4XWTA 3D8GA 3GQBA 2J7ZA 3PUZA 2CJNA 2WU2B 3HS0C 4BS9A 4DQOC 2F0OA 3PIO3 5C5LA 4E6IA 4GLSC 2F0KA 1FGBD 3NBIA 1NYRA 3ETRA 1DOIA 1E2WA 3WOFA 1DM0B 3P4QB 2F0WA 5ELBA 5JEAH 4H0LC 2QJLA 1N62A 4U673 1SJED 2IPKD 4WFN3 1E7PB 1GB1A 3AE2B 4EE2A 1TR5A 3J7AF 1D5XC 4TSSA 1NSNS 1YNJC 4RA8A 1LLRD 1YNJD 4S3SA 1T6BX 1LO5D 3NPPA 3RZDB 2Q8TA 2E6XA 1SIJA 2M0AA 3AMZA 2W3SA 2OEOA 1TKGA 1YN5A 3FMCA 2O4XA 3OOCA 2BDNA 5CC4A 4C3JB 3R8BA 2NBFA 3SE0A 4NDXA 5EQ0A 1JWAD 3GTQB 4XQNA 3C1EA 3OIQA 3T56B 4V190 4DXFA 2ZW0A 3S9WA 1BCPC 1EWCA 4L1BA 1XWEA 1LTBD 1BCPD 4ZRPA 1VR9A 1S5ED 2F4IA 4ULLA 4KJNA 5C0XH 2Y0SB 2PPBC 3Q8FA 4XXEA 4BBRB 2PMZB 5JPNC 4RHSA 3LWUA 1ENAA 1CHQD 5LL6X 1FNVA 5EBDA 1UUPA 3U2SC 1CHPD 1Y8PB 1F2MA 4DK1A 4DN4M 1O78A 2Q8IB 1KLGD 2V4DA 1STHA 1F2RI 3J9CA 3IAM1 3FAHA 2B8GA 1VZ6A 1ZE3D 3AN1A 2BE5C 1E2VA 3T3OA 4XT3B 4R8IA 1DOYA 2BE5D 4C3JG 3NVYA 1K8OA 1E9MA 4Q2JA 3VR4A 4F8MA 4KHVA 1C79A 2ZXOA 5C5MA 2MPMA 4R3DA 5LHY1 1QOAA 3I8ZA 1SFOB 2BA1A 1N5WA 1EQVA 3KWVA 4PT5A 1CI3M 2F0UA 4C56C 1XCQL 3G6JB 2N9KA 1X32A 4US8A 1LV9A 1ZYRC 3OWEB 4C2MB 2Y5CA 3E56A 1PDXA 1ZYRD 2D9UA 3JAME 2W54A 3M85A 3V96A 2EYPA 2FJ2A 3QJYA 1H9MA 4BBSB 4IUPA 5EPKA 1RYJA 3SK4A 2YEPB 5IGBA 5JXVA 2XRSD 1L0YB 4N6EB 1EYAA 1F77A 2WDRB 1A2TA 2VZKD 2NTTA 4FVMA 2L52A 2EZVA 4JPSA 1AP0A 1HZ5A 5HFYA 3IFDA 1O80A 1S5CD 5T1IA 3T13A 2AQ3B 2A69C 1TJEA 1ET6A 3EA6A 2R6GA 3BK2A 2HDMA 3D4RA 2K3UA 2ON8A 1A3VA 1RDPD 4KKSA 4G4KA 4BY7B 5NUCA 1PUTA 4YTMB 1BCPF 1LABA 2CVRA 2MJDA 2IX0A 3I4LA 4RCOA 5AFWA 1HHVA 2DY7A 1NENB 3VR9B 2EYFA 1ESFA 1IHZA 5J39A 3SVMA 1X3QA 2F0GA 1G291 3C3LA 2SDFA 5C0XJ 2HTME 4IUVA 1EEFD 4PNYA 3NUHB 3IT4B 2JQRB 1D5ZC 4K2KA 2MGSA 2HCCA 4H13C 1AZQA 3SR6A 2N0SB 1PGBA 4US9A 4ODGA 3GB1A 4L63B 4J6HA 4DNTB 2B2WC 5CBAE 1ZDXA 3Q8AA 3PIP3 3NTHA 2A5HA 4KJOA 2W55A 5HI1A 1VDZA 3AEDB 5FLXE 3VYUA 2K5PA 1SAPA 1JICA 2C9OA 2K03A 2BW2A 5C2TB 1GPXA 1ROEA 1SSOA 2ZXRA 4CJ2C 3MA2B 1T3QA 3ZQ4A 5C6AA 4XTCS 1XLOA 1F2YA 3FEWX 3KQ4A 3GP7A 4JK1C 3MXGA 1ILQA 5AUIA 3A7AB 3J80E 2F3WA 1O7LA 1AZPA 1F9PA 2L12A 1BMLC 3EUB2 1LTTD 3LYYA 1JQ4A 1IGCA 2LMCB 1JWUD 5E3FA 2AX5A 4IQZA 2BOSA 2AWOA 2R7ZB 1VF5C 2N88A 2W82A 3AE5B 1JOOA 5JJZA 1FXIA 4QF4A 1QQRA 1D5MC 4JWSC 1XLQA 3EROA 3TUOA 1C8CA 1PTOC 1K50A 1PTOD 4UAIA 3GTOB 1Y8OB 2J0TD 2MH7A 4YWGG 3SXHA 1DGJA 2H89B 2CJOA 3U9SA 4A3GB 4YTPB 4YT0B 3C46A 3EJIA 2JYOA 3R93A 1V1PA 1ENCA 2FE8A 2A74C 5KYIA 1T5EA 5JVG3 3D4WA 4KV6A 4ITKA 4L6TB 3URYA 5CV6A 4IUQA 1YJIA 4REZA 4L8JA 5CGKA 1JRPA 3I90A 2DNEA 5EKLA 2BCOA 1D4BA 3H91A 3P4RB 1WTPA 5KGUA 5I9PA 3RPFC 3A8IE 3ITPA 3P75A 2LGIA 2N9LA 1UAPA 2BT6A 2PTLA 3TEXA 1NVID 1HTLD 4WWMA 2RDFA 2F0DA 1STAA 3AH7A 1JR0D 2KEDA 3UI2A 2R92B 1KRHA 3IXSA 3PUYA 1N5XA 1FEHA 2V3PA 3RD4A 1BBXC 5BN5A 3BIID 3MJ5A 2AWNA 3PO0A 4KD4A 1PTOH 4CKCA 1BCPB 1YNTE 3BG3A 3NUCA 3DUZA 4B08A 5A2QL 4YSXB 3J81E 2PO4A 3OSOA 3ND9A 1NEKB 2KOLA 3KLRA 2SAKA 2K0PA 1CZPA 3DWQA 5MPOA 1SNQA 5LNK1 2FMCA 1JB3A 4MIUA 5EKIA 4CHTB 3NVVA 1KNAA 4J3OD 2QIEB 1FNUA 5KIXA 2K5QA 2CW0C 1PTOF 1PGXA 2EXZA 2R93B 2CW0D 1J9OA 2NZ1D 4RAUC 1TIID 4NZLB 1JOQA 1LT6D 3VA5A 1GUTA 4XDCA 2KMMA 2I46A 3VR5A 3OMGA 1G6ZA 3ONAB 5JOBA 3ZJTA 4IALA 1XO3A 2E2JB 1RCVD 2L4NA 4KGRA 2FFKB 3P42A 4A55A 4WQMA 5J1ZA 5M5XB 4QUCA 3W2DA 3JAML 3M3YB 2CU3A 3TMEA 3VR8B 1K52A 2B2TA 5IGCA 1WTVA 1S5DD 3X3MA 2QMTA 1DXMA 4TKOB 2NB0A 4N9TA 4CQNA 1MPEA 5I6WA 4UDUC 2DNCA 1QNKA 2Z4IA 4HN7A 1HUNA 1AEXA 1CT1D 1TWFB 4B0EA 1OXUA 4CBVA 1A70A 2JU6X 2VZKB 5T1GA 3H94A 1HPCA 1PMRA 1LACA 3AEGB 2DLBA 3N52A 1IUEA 1YQ3B 1Q90A 2NVTB 3M7GA 5EPJA 3NXWA 1QCBD 3AE7B 3Q8EA 1DONA 1PFBA 1NI3A 2M9VA 3V3XA 4RNAA 2WDVB 1LTSD 3KUPA 1EWYC 1ONLA 1RHPA 5DNFA 1MSHA 2K6AA 3BZDB 3D4DA 1YJJA 3TN2A 1FFUA 1ICWA 4DA2A 3X3NA 4KX6B 3KLSA 5H8YE 2K22A 2G1EA 4A8XC 4HSPA 5I9OA 2MP1A 1BNZA 1U4LA 3SK8A 2DBYA 4B9WA 5BYQA 3MFYA 3BDOA 4KK7A 2IL8A 1FYCA 3Q22A 5C0XI 4IUTA 3FPUB 1M8AA 3H09A 4F7XA 1FD7D 3NS1A 3OHXC 1KABA 2JSOA 3RUZA 1DOXA 1IL8A 2WKCA 5I2YA 1B4OA 4FO2A 4C3HB 4DAPA 4IFDH 1OXSC 4TQ0A 1RKNA 3F2UA 1PFNA 2RKSA 3R3OA 3Q0AA 4KKIA 2KVMA 2IX1A 1WD1A 3AEBB 4ME5A 3B2FA 2WXIA 1EIGA 4FXDA 2EE1A 2ZW1A 3E5SA 3DM1A 3DEOA 4KKTA 1KFYB 4HMJA 2BYTA 2KWDA 1RFKA 3EQLC 4KKJA 4G7ZC 5HGTA 4PQXA 1SSNA 1Y8NB 3BWUD 5IT9L 5IGGA 4XIGS 3CRKC 1GUSA 5D14A 2VNUD 5KEEA 5HG2A 2WXKA 2B2UA 4LAAA 3TP6A 5JAVA 4A3DB 2ICEC 2RA4A 3S2DB 1U9RA 4C3HG 3GTPB 1PTOB 1ENFA 1JALA 2F0MA 1Q3LA 4PMCA 1O7YA 1WCMB 3VYSA 3I57A 3TP5A 1MHHE 4IKGA 4HJGE 2RDGA 2VB3X 4RGOS 3FDTA 1C4AA 5FO9B 3P20A 4LK1C 2ZXPA 2NUCA 3GTKB 2BA0A 3NQTA 3A55A 4ZLTF 1CK1A 4G57A 4A3MB 1C4PA 4JE3B 4A9AA 2BS3B 2B63B 4EQOA 3AB5A 4ZHOA 2FUG1 4K5VA 4CJ1B 2ZT9C 2WXRA 2Y5PA 4OZAA 4C1NK 5DEHA 3HOWB 1Z47A 1G2SA 5D7GA 1CZGA 2EYLA 3VYTA 1SYFA 4H7BA 2JE6I 3OIPA 5JPMC 1BUVT 5D3IB 1MI2A 4FP5D 4ARCA 2O2LD 2QKIC 4IFDJ 1MD2D 1C4CA 2ONQA 1HRJA 4K5XA 2BBCA 5A2QE 1HUMA 2EYOA 1FXAA 2MJEA 2D2CC 1B50A 2PZTA 3J81L 4OO1G 3TDQA 4EVOA 2KN4A 3EVQA 1OXTA 5JVH3 4KY5A 3S1QB 3GV6A 2L55A 3D6WA 2IGDA 3KF8A 4MT5A 5DM63 1ZKOA 1B9MA 2JSVX 1F9QA 2JZPA 3TZDA 4L23A 1QILA 1HTPA 1HA5A 2SNMA 2WXGA 1WTWA 4JX1C 4NMZA 1IYUA 3T3NA 2HUGA 4USAA 3DWMA 2KCCA 5IOCA 1A3UA 4QCLA 3QOJA 2D62A 1G2TA 1N61A 1E2ZA 1YMHE 2D5GA 1FRDA 1IKLA 2F0QA 1QOGA 5I4DA 4XDXA 5K36H 2WXFA 5FK9C 1NUCA 3SFDB 3I4NB 4XYOA 1CFMA 4P16A 1I4RA 3TP8A 2B2TC 4HKZE 4ZK9B 1C4QA 2Z8LA 2EYHA 2KQ4X 5JEAJ 3QWNA 5BMIA 3HUIA 5EGTA 2V3NA 3GS2A 4C80A 1CQFA 2IX3A 5AUKA 3DXJC 2L83A 4KD3A 4LK0M 1YN3A 1S4ZA 3NRZA 1F9SA 1TS5A 4KTAA 2JXTA 5CBEE 1JE4A 2XVSA 3HVDA 2FBWB 2ACZB 1CA6A 1MVKA 2K01A 5CV7A 1Z7TA 1DZ1A 2PVGC 1ZOYB 3HRDD 2QF7A 4AQ7A 4FNFA 1TWGB 4K2LA 3AE3B 1IW7C 3CQZB 2PNRC 1IW7D 3VYRA 4JBWA 1C76A 3K5NA 1BUIC 1TKWB 4XQJA 1VRAB 1SYCA 2WXNA 3FC4A 4D2KA 5BN4A 2JA6B 4A3BB 3ABVB 1AN8A 5FKAC 1EU4A 1JWMD 2JXMB 3TEWA 1EOTA 1TKEA 1EY7A 4KKUA 1BOSA 2WXLA 1TQOA 3I91A 2PLPA 1AWDA 3PO3B 3BDLA 4F88A 2EELA 4A3EB 4IDIA 4QUFA 1WD0A 3I9V1 1EIHA 1Y69U 1FR3A 5EKKA 1MGSA 3CU7A 3MFGA 1HA6A 1GXDC 5CMDA 3E0JA 3MXUA 3BK1A 3QO2A 1H9JA 1V43A 1QNUA 1G91A 2EYMA 3D3RA 1P7FA 2OEDA 4WRDA 2R3ZA 1ZUD2 4OL7A 2EPBA 2XIWA 2WXJA 4IOIE 3K6OA 2EJGC 1PYWD 3RZOB 2HDEA 1P7EA 3NSWA 3BVGA 4RWSC 4HEDA 4M8AA 1K51A 3ZJUA 5C4JB 1V97A 3W9CB 3U4EG 4FF3A 4Z9CB 3T16A 1S5BD 2EDGA 3SFEB 1F0ZA 4OO1I 5C4XB 1KAAA 3IL8A 4DF7A 3S15B 3HOXB 5K5PA 2J4XA 2KAJA 3CWIA 5HURA 3VRAB 3HOVB 5DM73 4DNRB 2WAQB 1EM7A 5E1FA 2JP1A 5IGEA 1RWSA 1GUGA 1GJXA 1CZWA 2VB2X 2HQEA 2OHFA 1I6HB 5IT9E 1JWSD 2B2UC 3S1NB 5FO7B 2IGHA 1WSPA 1R9TB 3OWFA 1UNSA 2Q8RE 2TMPA 5LL6S 4GDKB 4RCNA 4EQPA 3MVVA 5JEAG 5BMGA 1FRRA 3Q23A 4FF4A 5EJWA 1B9NA 2NWGA 4MHEA 1H9RA 1U4PA 4PV1C 1SYBA 1IKMA 4HR7B 3ERQA 5KNBA 3U52E 3HGBA 3Q6SA 1C48A 1WTOA 4HROA 2O5IC 2B2YA 1W6KA 1V1PB 4H44C 3LB8C 4X3SA 3D6CA 1RM6C 1PFMA 4LTUA 3L3OC 3H6MA 1Q10A 4ZRZA 2IT1A 3KLSX 3VQIA 1SYDA 1DOKA 1AW7A 3NTKA 1GUWA 1VMCA 4ZQ3A 3VR6A 4C1NI 1ILPA 2WNMA 1ZPSA 2A68C 2KA7A 3GD7A 4RF1A 2A68D 4NKLA 1K83B 3CHBD 4I65A 3TEYA 3IT6B 3NK9A 3BVMA 5BN3A 2WU5B 1GHKA 3CIRB 1IGDA 4ZOHC 2W3RA 2H1EA 5C0XG 5M5WB 4X3UA 4H2AA 1O7ZA 1Y1VB 3QIAA 2WP9B 2AUJD 3MZ5A 4DK0A 3A8JE 1KDAA 2B2VA 1EYDA 2VXWA 4DXGA 1EL0A 4DU9A 2KEEA 1GHJA 5C3XA 3NWSA 1M4VA 4X3KA 1LT5D 4M1UB 4PMWA 1SNOA 3M4OB 1FM0D 2K5DA 4KHZA 1HEZE 5KRUA 1L5PA 3ZGZA 1QJOA 4K8JA 2XWJB 4C7ZA 3FILA 1PGAA 2F0HA 1LTAD 1A6XA 1TS3A 1CJEA 4IFDI 2F0LA 1NAPA 1KLUD 1D1IA 1SE2A 2K7VA 3M7NA 4N9PA 2F0TA 3AE1B 3GO5A 2RMMA 1KF6B 1EQTA 2DY8A 2EY1A 3S14B 3AE4B 2J52A 2EY2A 2I38A 1SNMA 2BS4B 1EYCA 5EE9A 4BA2I 5C3JB 1J7AA 1I4GA 2LFIA 1FNWA 1FO4A 2PYKA 1HFGA 2ICIA 1C78A 1OO9B 2NN6I 4RHRA 2JEAI 2E2HB 2WXMA 1FMAD 1TZOA 2B39A 3N9YC 1Q1EA 1WXQA 4LLGM 3G7LA 4ARIA 4FF1A 4HRSA 1XLPA 3VR2A 3IFTA 4RH6A 2EY6A 1OFFA 2IDYA 4WURA 1MSGA 2WKDA 4A6QA 2J53A 1JQYD 3R2IA 1I4QA 4WJWA 2EJMA 1LTGD 1QWYA 2GB1A 1QLBB 1B1ZA 1D6EC 1GOZA 1IYVA 1S5FD 3HOZB 3K59A 4RFBA 1B44D 2JA8B 2JA5B 1T5XD 3LX0A 2WV6D 3TZUA 3MC0B 3PUWA 1R4PB 3P7JA 3PMFA 2LY7A 2QCPX 2QEJC 5CV9A 2JA7B 2XWBB 4K6LA 2LUMA 1KNEA 2XRQD 3OW7A 1BO0A 3HKZB 2KDMA 5M3MB 2X6LA 1BR9A 2L32A 5GXGB 1ET9A 2LS01 4MACA 1PRTC 3FKIB 1PRTD 5EBCA 4B0MA 2MJ3A 3CKIB 2HDLA 1A3TA 1W6JA 5CORA 3H3VC 1KDCA 4A3IB 2F0NA 1TWAB 4Q0FA 2RBMA 1YQ4B 2PZUA 5A35A 1LTRD 4ZAIA 2A6HC 2NMQA 1I4HA 2F0IA 1I50B 1HCZA 3NP8A 1ZEQX 1SYEA 3HOUB 2A6HD 4ZHPA 1JW9D 1GUOA 1L4DB 1ML0D 1TYGB 2Z4HA 1XYIA 2K28A 4YSYB 1II3A 4RKBA 3MP9A 4HKQA 2B8FA 2E74C 1RTNA 2K05A 1SBBB 4MM3B 1GB4A 3ZJVA 4M0WA 2PQEA 4TMAB 1Y1WB 3MTSA 3QB3A 3IKJA 1DOLA 1E0ZA 3KK7A 1NYQA 3MHZA 1E0BA 2PW7A 5I2XA 1DYQA 1L6UA 4DAYA 3AU7A 1R4QB 3MXNA 2PW5A 1Y56A 4X3TA 1L6VA 2LFNA 1IBXA 2KCNA 2XSCA 3PUXA 2NVQB 1I4XA 1EY4A 3AE6B 5FO8B 4XWWA 2WS3B 1IBXB 1ESRA 4K14A 4Y7NB 5IODA 3EFXD 1BXTA 1A15A 2YU9B 5ISRA 4ZKCB 1QE6A 5CV8A 2INNE 4GDLB 4K5WA 3IAS1 2F0VA 2AUKA 1MI0A 2B2YC 4FXGC 3V2TA 1TY0A 3HEJA 2QILA 2A73B 3AEAB 4XE0A 2WXQA 1G8ZD 5D3DA 1DD2A 1L0VB 3HOYB 1NCVA 2XN9C 1HFNA 3A56A 2X69A 1WTRA 4R8NA 1PRTF 4ZUIA 2E75C 1JORA 1JWBD 2L11A 2E3TA 2AQ2B 4NW2A 2OF1A 3S1MB 5C44B 2N55A 1D2BA 4OW0A 2KECA 3H8HA 1ZXIA 1TVXA 2EYJA 1F9RA 1KTKA 1STGA 3WDNA 2XNAC 5IGDA 4NAWB 1Q8IA 3AE9B 1XTCD 4O42A 2B2VC 2BB5A 5FR3A 1SE3A 2SEBD 2M19A 1V1OA 3KBGA 4C3IB 1SEBD 3GV3A 5M9OA 2QSDA 3R2TA 3AM9A 4I7ZC 1WVLA 1SJHD 1B9RA 2K33A 3DWAA 3AV8A 1MBYA 5KNCA 2SNSA 1RD9D 1WTXA 3TP7A 4QMGA 4L2YA 2EVBA 4OZCA 3O13A 2BB6A 1EEID 2N7JA 1H9SA 5EPLA 1TWHB 2PMVA 1MHXA 1H9SB 1SMYC 3HG9A 1SMYD 4KY6A 1UWXA 2L9HA 3SK6A 2F0PA 3IAYA 4B9XA 3B2GA 4OVZA 3S2HB 2LHEA 3BDCA 3RLFA 1CA5A 3NHHA 2GRIA 1F2ZA 4IURA 1E10A 1LT4D 1B53A 4C3IG 1EU3A 2EY5A 1CQVA 5TSSA 3SEBA 1BF4A 2X38A 4KY7A 3QOLA 2NVXB 5C4ZA 3RFZB 3W3AA 2MJ8A 4A90A 1QOFA 3MEHA 4ABNA 4KGSA 2PZWA 3NQIA 5C4HA 1DOMA 4RGNA 2IW3A 2WACA 4MH8A 5I6YA 2CQAA 4GZYC 3I70A 3NVWA 4KMUC 4KN7C 4YXDB 4ZUJA 5G5GA 2IJ0A 4HMIA 3W1SA 2F0EA 1VLBA 5CR3A 2SOBA 3HZXA 3RMHA 5CV4A 2X6GA 1KH0A 4G7OC 1ZXTA 2L0CA 2K9XA 1HQRD 1QF6A 3OMCA 3P4PB 1F2RC 1PLFA 3U7ZA 2A6EC 2WINB 3LNNA 4J8QA 1XEEA 3AB9A 2A6ED 2V4IB 3DMUA 3SHLA 2GA4B 1VCIA 4TQUS 1I7HA 1EY0A 3DEPA 4IUNA 1EZ8A 4YTNB 3SR1A 1JOKA 3WCQA 3MWYW 2PKOA 3WOEA 2A69D 5CYUA 1I4PA 4XYQA 4CJ0B 3C2PA 5HHDG 2KHSA 1CTMA 2M56B 3TBIB 3BYYB 2E2DC 1VJKA 1YNNC 2Z1CA 1VDVA 1YNND 3P1MA 4A93B 1KDBA 3W5VB 4BY1B 1ACCA 2E76C 2ENBA 2L1BA 3T51B 4WORA 1D1KA 4PMBA 1PXUA 3GTMB 4RGTA 1NR4A 3M4YA 3C8YA 3NVZA 1OXXK 1OQRA 1N60A 1PRTB 5IGFA 1EZ6A 2FINB 5ELCA 3U9OA 4AS1A 3GTLB 4IFDG 2WXHA 1C77A 1AFPA 1CM9A 2PW9A 4CGYB 1SF0A 2DYMA 2MEKA 3MHBA 1TU2B 1STNA 3P1HA 4NJCA 3PV0A 2LHDA 2H88B 3VA7A 1GAQB 3L7ZC 5COYA 4MN3A 1STYA 4FXKC 5D65A 5H92C 1ZXHA 3S17B 3AECB 3TEZA 1PZKD 2NN6G 2DN8A 1WYGA 4RKLA 1BQQT 1OQQA 3AEEB 4A3FB 4JWUC 1UEAB 2K32A 2CHBD 3QG1A 2R61A 3LWEA 4RGMA 2GI9A 2EOTA 3I3CA 1XCTL 2PCFB 2LMCA 2WXOA 2G9DA 1Q12A 1JC7A 2JYEA 1V8QA 3TSSA 1R7SA 1HQMC 1QG7A 2L1AA 1STBA 4XT1B 4F87A 3DHQA 2V0GA 5C3WA 1A2UA 1EY9A 3DWGC 4J1MA 3AMUA 1PFDA 1HXYD 5M3FB 2F0FA 3J7YW 1EWHA 4IN3A 1B2TA 3MXPA 1FCCC 1UGJA 2KACA 2INPE 4CKEA 2BTEA 2NTSA 4LJZC 2AQ1B 2M00A 2G9HD 2MHVA 2HCIA 3Q8BA 5BYRA 3I72A 2JWUA 2Y3AA 4WAFA 1HZ6A 1VZ8A 3PZ7A 4KI0A 5G3LD 3A8KE 3UI3A 2WDQB 3Q8CA 3MAQA 3Q24A 1K53A 4HCSA 2F03A 2IGGA 2JYTA 5ELFA 2NVYB 4DGZA 2TSSA 4LMQD 1AYFA 1STEA 4FF2A 2F0SA 2VUMB 1SB3C 3LXFA 4AYBB 1TY2A 4CKBA 1RF2D 4KN4C 2L5TA 5E6JA 5BMHA 4OZBA 1L0XB 1TT2A 4WH4A 1RODA 1LT3D 1I3QB 3I4MB 4ZRQA 5C3EB 1QT9A 2RPVA 3BYTB 3L9AX 1L4ZB 3K57A 5DAUA 1WWTA 2LEKA 4ILWA 4G7HC 2K5WA 4A3JB 4N59A 3A7LA 3V05A 2RQXA 4EGVA 3GTGB 1JMLA 1TS2A 4YSZB 3HP3A 5FOBB 4C7YA 3FILB 1PZJD 4BWGB 3N6RA 4QIWB 4Q5VA 1TS4A 1K8MA 3K7AB 5M5YB 1RTOA 1X3PA 3NZ3A 5K36G 1QKZA 5IIFA 4A3KB 3J7AV 1Q1BA