3BVMA

Manipulating the coupled folding and binding process drives affinity maturation in a protein-protein complex
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
235
structure length
226
Chain Sequence
ESQPDPMPDDLHKSSEFTGTMGNMKYLYDDHYVSATKVKSVDKFLAHDLIYNISDKKLKNYDKVKTELLNEDLAKKYKDEVVDVYGSNYYVNCYFGKTCMYGGITKHEGNHFDNGNLQNVLVRVYENKRNTISFEVQTDKKSVTAQELDIKARNFLINKKNLYEFNSSPYETGYIKFIENNGNTFWYDMMPAPGDKFDQSKYLMMYNDNKTVDSKSVKIEVHLTTK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Toxin
molecule keywords Enterotoxin type C-3
publication title Manipulating the coupled folding and binding process drives affinity maturation in a protein-protein complex
rcsb
source organism Staphylococcus aureus
total genus 62
structure length 226
sequence length 235
ec nomenclature
pdb deposition date 2008-01-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01123 Stap_Strp_toxin Staphylococcal/Streptococcal toxin, OB-fold domain
A PF02876 Stap_Strp_tox_C Staphylococcal/Streptococcal toxin, beta-grasp domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.110 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 3bvmA02
3.10.20.120 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 3bvmA01
3EFXD 1EEFD 3MFGA 1B1ZA 1F77A 1SEBD 3R2TA 4Z9CB 1PRTF 2G9HD 1HXYD 3GP7A 1EFID 5ELDA 5I4DA 3BVGA 2Z8LA 4RGMA 1G8ZD 1LT3D 3URYA 3DWQA 1PTOC 1UNSA 1LTRD 1LT4D 4DXFA 1S5FD 1DJRD 3DWPA 4NZLB 1BCPF 1FNVA 1TS2A 4DXGA 1SJHD 1XXGA 1TS4A 1ET9A 1LT5D 1LTSD 1PRTB 2WV6D 1KTKA 1PRTD 3BZDB 1TY2A 1HA5A 3TSSA 1AN8A 2SEBD 1JQYD 2O2LD 1ET6A 1JWMD 4BWGB 1L0YB 2NTSA 1S5CD 3OWEB 1D6EC 1LTGD 1CQVA 1FD7D 1MD2D 2RDHA 4O1NA 4RGTA 1YN4A 4L63B 4ZYSA 1DYQA 1V1OA 3O13A 1PTOF 1BCPB 1JR0D 1TS5A 1JWSD 2NTTA 1EEID 3V05A 1RDPD 1EU4A 1GOZA 4RFBA 5FK9C 1T5XD 1D5MC 1HQRD 3DWAA 4UDUC 4RHSA 3W2DA 1KLGD 1I4RA 2RDGA 1SXTA 1PZKD 1TS3A 1I4PA 3BVZA 3BYTB 3MC0B 1TY0A 1ENFA 1LTAD 1SJED 2CHBD 2J4XA 1PTOB 5ELFA 4C56C 4RGOS 1PTOD 3R2IA 1CHQD 4RHRA 5FKAC 3BYYB 1EU3A 1ESFA 1RF2D 1V1PA 1PZID 2IJ0A 3KLSX 1I4HA 1CK1A 1BCPD 2ICIA 5TSSA 1FNUA 1I4XA 2XN9C 1LLRD 1SE2A 1BXTA 2TSSA 1V1PB 1UUPA 2AQ3B 1SE4A 4RGNA 1FGBD 1M4VA 4RCOA 5ELCA 1LO5D 5ELBA 4TSSA 1CT1D 4K6LA 3BVMA 1SBBB 3EA6A 1PTOH 2XRSD 1LTTD 5D3IB 1S5ED 1YN5A 1D5XC 2QILA 3CHBD 5D3DA 1S5BD 1D5ZC 1B44D 1I4GA 5ELEA 1QILA 1KLUD 2IPKD 4L6TB 1EWCA 1L0XB 3R8BA 1I4QA 1JWUD 4RH6A 1PRTC 1LT6D 2QEJC 2AQ2B 1STEA 2AQ1B 1PZJD 1RD9D 3SEBA 1SE3A 1CHPD 1RCVD 1FNWA 1XTCD 2XNAC 1LTID 2R61A 1LTBD 1PYWD 4OHJA 1HTLD 1S5DD 1AW7A 1YN3A 1BCPC 1JCKB 2XRQD
chains in the Genus database with same CATH superfamily
1SNPA 3PLUA 2C9OA 4A3KG 5C4XH 1N6ZA 1K8RB 1F0ZA 4XYOA 4DV6Q 1VQFA 1YJ1A 4C00A 3AE9B 2EYFA 3CCVA 1CKMA 2A5UA 1TZOA 2HJ1A 2JPHA 1KAWA 1EFID 4JE3B 3MEFA 4X3KA 3UI3A 4JW0A 3BVGA 5J2RA 4ICVA 4MTKA 3AFQA 3FVQA 1Q5WB 4MIUA 1B8AA 1CZGA 3DWQA 3ZJTA 3CSTA 4LNNA 2O6VB 1B3AA 3I91A 2FNJB 3MTNB 4G7ZC 1YNJD 5J18A 5CBAE 5M3MH 2A1AA 2CWAA 2JQRB 1I6VC 1QG7A 1LTSD 5KIXA 2KTFA 3PGEA 1L2FA 3Q8DA 4EQ5A 3RZDB 3H94A 5IO9A 3WA0A 1YX6B 4A8XC 5BYSA 4IUTA 2UXBL 2BS2B 2K75A 2BWES 2A68C 3PSIA 2VZAA 2RDHA 1X65A 3NBHB 2GOWA 2FFKB 4ZYSA 4RG1A 4B95A 4AH6A 2BKFA 5C4HA 3M3YH 2OJWA 2IW3A 4DR1L 1KF6B 4IM2A 2MBOA 2UXBQ 3VR4A 4DA2A 3VR3A 4JI7L 1A6XA 3ULPA 1EY8A 1X3GA 4DR5L 2KECA 4LW1A 4LWCA 2VUMG 5DM63 2I5HA 4MACA 1S72A 3RZDH 2DNEA 4W9FA 5M9OA 5JJLA 2NPTB 3RZWC 1VQCA 2IBIB 1MVKA 1TY0A 1LTAD 4EOYA 1DOYA 2B2YC 3EGRA 1WFYA 2J0MA 1A63A 4PYZA 1WTQA 1IYUA 3CKIB 3Q23A 3ZKJC 4XWWA 2PZTA 4DR5Q 1RF2D 2A8VA 3HOVB 3L54A 2YEPF 4HROA 3EVQA 3KF6A 2HD3A 3D31A 2FCMA 3GB1A 3PO3G 1CZPA 5TSSA 2A69C 1ZDXA 3L0OA 3N6RA 3KUCB 2FUG1 3UF8A 2EKEC 1XWEA 1B2TA 3HHMA 4IJHA 1NVID 3U50C 4WJOA 3NK9A 3A5UA 2GMIC 1YIWA 5JAVA 4KZ0A 4GKKL 3NZUA 3DBLB 4FULA 4PMBA 1ZKOA 4DK6C 3CC2A 4BY1G 3A7LA 3C3LA 1RFKA 3FILA 4WH4A 3GZNI 3L3OC 1XX8A 3A0JA 4DU9A 2DYBA 3AE5B 5JZEB 3K6OA 3HOVH 1YNJC 2KEDA 3EQLC 2ZPYA 1Y69U 5I9PA 1WJ4A 3N30A 2EYJA 4USAA 3X0WA 4V190 2OOBB 3PGZA 2FXQA 2L05A 3WAPA 2D10A 3KYDD 2KDBA 2JA5H 3AMUA 4HJGE 4JOIC 2FAZA 3NTIA 1XLPA 1OTCA 4HDOA 2F3WA 4MZ9A 3MXPA 3Q0AA 2QJLA 3DUZA 3L10B 2VUMB 2WAQE 1SE8A 2JP1A 3PF4A 4KHZA 5E1FA 2XRQD 3U52E 4ME3A 4X3UA 1C4QA 4ANVA 1CSPA 4YCVA 1B1ZA 1YQ3B 2KCMA 2JT4B 2K5DA 2O2VA 3Q3NC 4GXBA 2BTEA 4BBNF 3QB3A 4AIMA 1X56A 2Z59B 1IUEA 1QZEA 4WJPA 1PRTF 5I9OA 2ZW0A 3JSVB 2B2YA 4DR3L 2WHIA 4D2KA 2L32A 4C4VB 1TYGB 1Q82C 4GMVA 1GUWA 1Y56A 1MI2A 1PH4A 3PO3B 1QOGA 2D3BA 3RI7C 1SF0A 2CKZB 3GTPB 3VR5A 2RSOA 1IHZA 2CCZA 3H7PA 5C0XH 4U673 2Z0SA 1ACCA 1LTRD 1LT4D 4MJSB 2I0QA 2ZNVB 1YHBA 4K5XA 1VQ7A 2JA8B 4OXPA 2VUMH 2ZVNA 2M9VA 5IYDH 1SJHD 4DR3Q 2CH4W 4NAWA 4JI1Q 3D32A 2NMQA 1FR3A 4ZOHC 4ODGA 4BY1B 1TT2A 1BKBA 1JQYD 3F1ZA 1CJEA 1SMXA 3Q8EA 2JK8A 2R2OA 4ZKCB 1G91A 2BDNA 2XGTA 2LRWA 2HHHL 3AV8A 4EZKA 1YIJA 1YN4A 3DBRB 3PO3H 3UGBB 1SYBA 3O13A 3GTPH 4KV6A 2KQ3A 3JAME 3KVFB 3ONSA 4DNTB 4JX1C 3DM3A 3H09A 2K5PA 3IT4B 1C3TA 3QX1A 2JA8H 3TEHB 2HIVA 3I4NG 3S1MB 1GM5A 3PHXB 2HHHQ 3OLMD 3R7RA 3EFCA 1UE7A 2V4IB 2KWUB 1FO4A 5HI1A 4JOIA 2L12A 1IW7D 1KLGD 4BS9A 2N55A 1SXTA 2Z4IA 4M8AA 1OQQA 2LASA 4GU2A 2E3TA 3QIJA 2LGYA 2VH2A 2MA9B 4ANXA 1P16A 2EYPA 2GVBA 5KNBA 2L0TA 2L5TA 4B9XA 1IYFA 2KC2A 3SD5A 2A5HA 3UQBA 2LUMA 3OIPA 3HOYB 5CV7A 5T8IA 1FEHA 4XC2A 3TREA 2PNHA 3S1MH 3PZ8A 4ARIA 3I4OA 2ZTEA 2QGQA 3AE4B 2AQ3B 1SSNA 5CHFA 4J15A 5E6NA 4L5QA 1Y1WB 1L1OC 3J81i 3DHHC 4OZCA 4M01A 2OWOA 4CDEC 3HK0A 3TCAA 1JOKA 3HOUB 1XCQL 1I4GA 2AMCB 1UD7A 3NBIA 3N52A 3HOYH 1VD2A 2C5CA 3R7QA 1L0XB 3AM9A 2BE5D 4YIJA 1JWUD 3P4SB 2HCIA 3B6YA 2RHSB 4RH6A 1FCCC 1WGKA 1C8CA 3IT6B 4HCEA 4KD3A 1Y1WH 1MJEA 2BT6A 1L0WA 4LJPB 1GC6A 3K80C 1QVFA 1Q8KA 2INDC 2ZJRA 2NVXB 2NS5A 3CMMB 4HEA1 1WTRA 1A15A 4MDKE 1EYAA 3OOCA 1SNOA 1VDVA 1TR5A 2KVMA 1K0SA 4OHJA 4C3HB 1WX7A 3U7ZA 4ID6A 4GLXA 4C80A 3MEHA 3HOUH 3PIP3 1K73C 1WJNA 4YT0B 2JZ3B 5JXVA 4J6IA 3K7UC 5HG2A 5FLXE 2KAJA 4HKQA 1PA6A 2L0FA 1GKHA 4YXDB 1FRDA 2HQEA 3I3TB 3C1EA 2EPBA 2JSOA 2J0KA 4QIWB 4YTMB 3A9JA 2KCNA 4V0BA 4C3JG 3P63A 5KHOA 1IW7C 3IAS1 2WB1E 1G8ZD 3GV3A 2ZJQA 4KIKA 1WMHB 2NVXH 1YQBA 4A3IG 4ZRIA 5IWAL 1EY7A 2K5VA 2K04A 4A3FG 3DWPA 4DAYA 2ZJPA 1SSOA 4WJWA 3HOZG 2F3VA 4C3HH 2G5DA 2XSCA 3A9KA 1XXGA 4GLAC 1FM0D 1ZGUB 2EMTA 1HR0W 3U4EG 1F9SA 2XBBC 3A1QB 2JYTA 4LMQD 1V80A 1L1OA 1HA5A 1LFDA 1Z2MA 2WXIA 3BY4B 5AEKB 3E3XA 2MO0A 1NMFA 5IWAQ 2WYQA 4MNOA 3KDFB 3H15A 1Y14B 3HRZC 1K8GA 1FD7D 1MD2D 5ELOA 4KY7A 1PMRA 1EWYC 2WB1G 1HZAA 4PS3A 5C2TB 3ZTDA 2F0FA 3ZW3A 4PZ7A 3CPFA 2O5IC 3S17B 4KKJA 2JZPA 5L83A 2N7DA 2NZ1D 4Y7NB 2D5GA 1T5EA 2L7RA 2CJNA 2AL6A 4IWPA 1OFFA 1JRPA 2OQKA 3H3VH 1PQSA 4RKBA 2UUBL 1WFQA 2NVTB 4CDDC 3SE0A 1V9JA 1GOZA 2WX1A 3ER0A 4DWFA 2BE5C 4B3ML 3HOWG 3W1YA 2JSVX 4IN3A 3TS2A 4B3RL 4CJ0B 1OXSC 5IY0A 2XWBB 4A3CG 3HEJA 5JJZA 1XT9B 4A3BG 3ZNZB 2DYOA 1N60A 4IJLA 2H5XA 2UUBQ 1FFUA 4NNJB 2NVYB 4DBGA 4B3MQ 5H1SE 2QDFA 3OYYA 2K7VA 3S17H 2SAKA 3IRBA 1IBKL 4Y7NH 4B3RQ 1I4HA 2LVQA 3LNNA 4FXGC 1MG4A 2L83A 1PGAA 2EKIA 4QMGA 1LLRD 4LNOA 2NVTH 1VRAB 5AZHA 3UE0A 5JVG3 4EZJA 1TVXA 4OELB 2MPMA 4A3FB 2ACZB 3RUZA 4QY7A 1Q1OA 2LD9A 2F0LA 5ELCA 1V2YA 1IBKQ 1E8ZA 5KYLA 4XQJA 3CF5A 1LV9A 3MXUA 4UP9A 3VYSA 3WWVA 4DUZL 3I56A 2UUCL 1I7HA 2JVCA 1CI3M 1T0YA 3Q8BA 4TKNA 4JI5L 3K5MA 2LSSA 2NVYH 1S5BD 2YYZA 1IGCA 3I4MB 3TEZA 4L6TB 1HFNA 1G51A 3NWTA 4IPGA 3Q8AA 2PQEA 4P1CC 3W3AA 3D3RA 3CRKC 2NBWB 4FHJA 1VCBA 4G50A 4ZYNA 4CDCC 1ZUD2 4B3TL 4JI5Q 3OHXC 3BDCA 4A3FH 4R8NA 4HKZE 3ND8A 1UEBA 4L5RC 3MA2B 4FF1A 3PO2G 2R93G 2W3RA 2DY7A 2IZVB 4QL5A 1P9DU 2ASQA 1V5OA 4MTNA 4LNKA 4PS7A 3L2PA 2EQSA 3HOWB 2L55A 1VQMA 4LJZC 2ES2A 2KTRA 3FKIB 2C60A 3NWSA 3I5JC 1UZXB 4B3TQ 4XX5A 1EEFD 2EJFC 4K2KA 4A3BB 3I4MH 1CQFA 1SEBD 2M1MA 1QZGA 3JVZX 4LUOA 3H6MA 3GOEA 5J1ZA 4PQXA 3EUB2 3SDZA 3AEFB 4EX5A 2AUJD 3BK2A 2O6VA 4IO9A 3EHVA 2HUGA 5I4DA 3HP3A 2F0NA 4N6EB 2W9NA 2K5QA 2WLBA 4BFRA 3N3KB 1TWHB 3J81j 3QHTA 2EJMA 3HOWH 4H02A 1BDOA 2QW7A 5CR3A 1EIGA 3FKIH 3G6JB 2KJRA 4JYAQ 1SLJA 2Z9HA 4Q0FA 3MVVA 5C6AA 1VQ8A 4A3BH 1B3QA 3I72A 1DGJA 2VZKD 4CKBA 1EM7A 1WX8A 3E56A 3NBHA 3TSSA 5BYRA 3RNCC 1AZQA 1WRDB 4RNAA 3SFEB 5M3FB 4L5SA 2ID0A 4HMIA 1RJTA 4JK1C 2Q8IB 2X6GA 1UBIA 2ZW1A 4ILWA 5F2DA 4DV5Q 2VXWA 1H95A 4CJ1B 3I57A 1DOMA 3MC8A 4GZYC 1JALA 3GO5A 1TWHH 2WKCA 3JC66 1Y1VG 1L6VA 3PO2B 5T1GA 3VQIA 1VQPA 1FPYA 1CM9A 4KGTA 4XZ4A 4KMUC 1PXUA 3MJWA 2CU1A 3V6CB 3DVNU 4CHTB 5IODA 4DV7L 2KENA 2OXPA 3W2DA 1BNZA 2B2UC 1YJIA 1F2YA 3KWVA 1I4PA 4KTAA 2FHTA 4R4OA 2B63G 4B6WA 1O78A 2CHBD 4HR7B 5M3FH 2WP9B 3IAYA 1ENCA 4KKUA 1OGWA 4IWOA 3TMPB 3AYHB 2ZNVC 4EUTA 1NE3A 1T9HA 5C3XA 4XDCA 5LL6S 3VRBB 2KOXA 1E8XA 2M56B 3CCQA 4DV7Q 2JYOA 2RDBC 3ZRFA 3KLSX 1EIHA 1A2TA 1SYGA 1Q81C 3QR8A 3PO2H 3MP9A 5JH5C 3HOXG 4JWSC 4GLVB 4IWQA 4IUUA 4DV0L 1SGHA 1JOQA 2WXGA 3ENEA 3KUDB 5GQOA 3AQQA 1EZ6A 3TMEA 3OJ3A 4P1BC 1E0ZA 3RD4A 3DVNV 3NVZA 1BBUA 1Q7YC 4OZBA 1YNTE 5FR6A 5EGTA 3APFA 4A3DG 1KQSA 2LMCB 2YEPB 3KK7A 4DV0Q 2CVRA 4O2DA 3VH4B 4ANWA 1X32A 1LTLA 3CC4A 4H7BA 2O5JC 4QAYA 1K9MC 3R8BA 4HJ8A 2MLBA 3TUOA 3NZSA 1H9SB 1BMLC 2OCEA 3A56A 3PUXA 1BT0A 2ZVOA 1IBLL 1Y1VB 3TBIB 4A6QA 3K7AB 4LK1C 5IT9E 3SEBA 1N63A 2YLMA 2WIIB 2ZJDA 3PT2B 2V9HA 3DHGC 1EY4A 1E90A 3T8MA 5KYIA 2LVPA 2JU6X 1IBLQ 4GSWA 4BKSD 3EFXD 3TP6A 5JJKA 3BG3A 4QB4A 1JJ2A 3M3JA 1C77A 2Y0SE 4FJVB 1JMCA 3SDLC 4XT3B 3UE1A 2WACA 4UAIA 3CCUA 2HT1A 1SYCA 2E2DC 5AJ3L 2SDFA 3GTKB 2LHDA 2GN5A 2Y5CA 1BR9A 4OONA 3K7AH 3QAQA 2BGFA 4XGAB 1WVLA 3NP8A 3W1BA 4NQLB 3RNBC 1MKHA 3VTVA 2BW2A 1R4MB 4P7IA 4GLSC 4C2MB 4JIOU 4MM3A 4IALA 2NR2A 1FNVA 5AJ3Q 1L4DB 2IO1B 4RA8A 3F2CA 1PRTB 4L8JA 5C44G 4I6PA 1GD7A 1C76A 3S24A 5I2YA 2Y0SG 1AP0A 3QCAA 2C7NB 1NENB 1JWMD 2MJDA 5GROA 2KWVB 4N9F4 3I3CA 4DR6L 3GTKH 2KKCA 3TBLD 5IP4D 4RGTA 2CQOA 4JBJA 1KABA 1PH9A 4MELA 5FO7B 5C23A 5CV5A 5H92C 1A62A 2Q8RE 4RAUC 4WJQA 2NTTA 3GV6A 4K2LA 4C2MH 3MTSA 2NB0A 4RKLA 4DR6Q 2N3SA 2N8NA 2ZT9C 2BYTA 2K5WA 3A8JE 3ECIA 1VQAA 1NI3A 4IUVA 2WKDA 5DPTA 1EOVA 2HDEA 3GTOB 3DDCB 3S16B 4IPHA 3BS1A 1OTRB 3M4QA 2QHOA 3BYTB 2DLBA 4OVZA 2YTVA 2MW5A 1PTOD 5LL6X 1F2ZA 5C4XG 3NXWA 3C2PA 1VQNA 4W9GA 5D65A 3BZKA 3PIPA 1EU3A 1UH6A 3A74A 1SNDA 1ISNA 2IJ0A 3DBLI 4FHKA 1CK1A 4IUMB 3M95A 3CQZB 1ZOYB 3AULA 1Q1EA 4GGQA 3U58A 1SIFA 3K8AA 1X3EA 1F2RI 1JROA 1P98A 3P2BA 5G5GA 3GTOH 3N1ZC 3S16H 5ELBA 3GQBA 3T51B 1NY4A 2DNFA 2IYDB 1R9TB 3TEWA 1VQ5A 2KDMA 5M3MG 3E0EA 4TQUS 4JBKA 4A75A 1ZXIA 1VQ6A 4YCUA 1JJCB 2LRUA 3T56B 1YJ9A 4JPSA 3VYRA 4XDXA 2F0DA 5C0XI 2WDRB 5FLXL 4FADA 2VW9A 4OL7A 3CQZH 5M5WH 3ZNHB 4EQPA 5JEAH 2ON8A 2PVGC 4URKA 3G71A 4ZRKA 1O7YA 3BZCA 2Q2UA 3KLRA 3U30A 5H8YE 1BOSA 3HRDD 3RZOB 2RHQB 5HHDG 3UDGA 1VQLA 1TWFB 2A68D 2D62A 1R9TH 4ZAIA 1N62A 1C78A 4IW0A 1WSPA 4DK0A 5CC4A 1HTLD 1ZW7A 1MSGA 5IOCA 2R2QA 5T1IA 2IY5B 1GHKA 1JCKB 1H4RA 4HPPA 1VQGA 1ICWA 2REXA 1XNQL 1B50A 3L13A 5JHAA 4HTHA 1LM8B 4HPLB 4DV2L 1X54A 1P7EA 3DXJC 4ZRZA 1CTMA 5ELDA 3E5SA 4DNRB 3U7DA 1YHAA 5EDSA 3GE8C 2JA7B 2LFNA 5D2MB 1W2BA 4X64L 4PZ6A 1GAQB 1SRUA 1JMLA 3D6WA 1HE8A 3CXCA 1LT3D 3KLWA 1CKNA 1H9JA 1XNQQ 3RZOH 2ZEQA 2L11A 4HK2A 4AQ7A 3T3OA 1PTOC 2BDOA 1TWFH 3K81C 4DV2Q 2A6ED 4A3PA 4BKSA 1TS2A 1Q10A 1WR1A 4UPAA 2WXRA 3DBRI 4MEMA 3J9CA 2RF4A 1LT5D 3OW2A 3C8YA 3KDFA 4X64Q 4OX9Q 5AZGA 5JHBA 4IZ8A 1R4NI 1NMGA 1E8YA 3E9HA 2A69D 1PDXA 4AYBG 2HDMA 5TR5A 4DR2Q 1E1TA 1AWDA 3PUZA 3PS6A 1F9PA 4UY8C 2MBEA 3AE3B 2JA7H 4GDLA 4IPDA 2ASBA 5EPLA 1Z7TA 1WM2A 1EYCA 3HOVG 2IGGA 2NZHA 3ML8A 4K8IA 3K0XA 3AFPA 1E22A 3FRPB 4A3GB 5EE9A 4N58A 3M3YB 2QMTA 3P4QB 1RDPD 1PH1A 4FF3A 2KMMA 3D6CA 1V8CA 4TVAB 2K25A 2BCOA 2JA5G 1CA5A 3RD2A 5AZFA 1UWXA 4F7ZA 3NVWA 1Q8IA 3Q8CA 4ZUIA 2V4LA 1NSNS 2NWGA 4HWIB 1ENAA 3A4SC 3VUWA 4MH0E 1VQDA 2D11A 2GBJA 3VA7A 2AWTA 2KD0A 3AEDB 3ZIMA 2V3SA 4F88A 4A3GH 4GN3B 4WORA 2MBBB 3DPDA 2F0EA 1A8VA 4LDTD 1EUJA 2RBMA 4C1NI 1UUPA 2CJOA 3T13A 3RR5A 1XMOL 4II3B 4WQMA 3H1UA 3SXHA 1FGBD 3B2FA 2VS1A 5C0XG 3P4RB 3IFTA 1QUQA 1WD1A 4R4QA 1K52A 3NSWA 1SBBB 5IYDG 1I94L 4PK1A 2MP2B 4GNXC 3DBSA 3AE8B 5EAYA 1U4LA 4AYBB 1JC7A 1L5PA 1XMOQ 4X62L 4DQOC 1DCZA 1PVOA 4JV5L 2A6EC 1VQOA 4MH8A 2K28A 2Q8TA 1V49A 1C9FA 1I4QA 1U0LA 4ZRPA 3RUIB 1VJKA 1GB1A 2K14A 2JF5A 1TKGA 2M19A 2WXHA 2QEXA 4AJYB 1I94Q 2JRIB 2AQ2B 1STEA 2UXDL 1ZKHA 1MHHE 2NVUI 1S3OA 1F9QA 3PIOA 2EOTA 4FF4A 4X62Q 4R4TA 1TKYA 3U2SC 5C3EB 1VQ4A 1Z9FA 4JV5Q 2E75C 1HNWL 2Y3AA 1NAPA 4R3DA 2WXJA 2JA8G 2JA5B 2J42A 4QUCA 3M85A 1HUMA 1RM6C 3J80L 3EC8A 1NR4A 2UXDQ 1RODA 3WOEA 2H1EA 3N9YC 4G11A 1HCZA 1Q0WB 2AYOB 1IBXB 3V60A 2N0SB 1HNWQ 1WXAA 3OMGA 1M8AA 2WXNA 4M8MA 3K5LA 4F7XA 1EQVA 3DBHB 4WAFA 3H3VI 3W9CB 2B8FA 4HSPA 2LS01 1JB3A 1WXQA 4ZRJA 3VXWA 1C7YA 4NXNQ 3LYYA 1ONLA 4X66L 3Q6BA 4M0WA 1FIQA 2MRPA 1UAPA 5C3EH 2LGIA 2MHJA 1WYGA 2KHJA 1GHJA 2RR9A 2WDVB 1ICFB 1YI2A 2PEAA 3ZQ4A 1P7FA 1YJNA 2EE1A 1I5FA 2MFIA 2K6QA 3I63C 3BZDB 5DM73 4X66Q 2MBQA 1Q3LA 1D3ZA 2PMZB 3DLLA 4Q2JA 4LFCL 4PMWA 1GO3E 1TGZB 1ET6A 4KDLB 2F4IA 4NB3A 2E2IB 3H8HA 3KF8B 3DWMA 2JA6B 3QJYA 1HZCA 2KACA 1XYIA 2K22A 2IWHA 1CQVA 4GNXA 1BF4A 4O1NA 2WXKA 1EWIA 5IA7A 2GBNA 3AEEB 3HOYG 1JJGA 3VA5A 4KSLC 2R92B 5GAEC 3AE7B 4JI1L 3GTMB 5BMGA 4LFCQ 2XVSA 3NQIA 5D14A 2Z4HA 4P16A 2BYVE 1K0RA 2C35B 2MSED 1Y1WG 2FINB 2B8GA 2JX5A 3DMUA 2FMCA 4UDUC 3O65B 1QNKA 1I4RA 1N5XA 3TQYA 4R9WA 2E2IH 4C56C 3HFZB 1NEKB 2JA6H 2JXXA 3DQVA 2B2VC 4UP7A 4CKEA 1QOAA 4RHRA 3IL8A 2VQFL 4KJOA 3HOUG 1OQYA 3GTGB 4O0AA 2JA9A 2R92H 3GTMH 3L7ZC 5C3WA 2BKRB 2WS3B 1OO9B 1RWSA 3E0JA 1R4NB 4QIWE 2W82A 5LMUL 2R7DA 2VQFQ 3CW2C 1J7CA 1LACA 2I5LX 1TJEA 5IT9L 1XLNA 1DOXA 3M9BA 3J81E 4C3HG 2WU2B 2N9EB 2DNCA 5CV9A 2XRSD 3GDEA 1PH7A 1HNXL 4GIVA 1YN5A 3IFDA 5LMUQ 3EIVA 2M17A 2BYEA 2YV5A 4LF8L 3GTGH 3DVGY 4I6NB 4J8QA 2A6HC 5E3FA 1WY8A 1KDBA 2EYMA 3Q3FA 5AUIA 1KAAA 1M94A 5BYQA 4NW2A 4DR7L 2DJFC 2GBMA 4M1UB 2YTYA 4DAPA 1HNXQ 1EIYB 2DHZA 3RNGC 3OW7A 3C1FA 3GD7A 2HD5B 1A3VA 2K1FA 1P1AA 4LF8Q 4FVMA 2DBYA 2KNBA 2RMMA 3ETRA 1YITA 1VLBA 4KSKC 1CUKA 3BU2A 3H91A 1MG8A 2A4ZA 4ZQ3A 2Z6BA 3ULLA 1S5DD 4DR7Q 3PZ7A 3ZNID 1BCPC 2CR5A 1N32L 2FMMA 1VS0A 1YNNC 4FLHA 2KDFB 2NN6H 1GJZA 3E6ZX 1XJVA 1K28A 2AUKA 1OQRA 2C7HA 3K5OA 2B2VA 4K8JA 1WE6A 3N1YC 4DV1Q 4DV4L 3TS0A 2IY1B 4RM9A 4DUYL 2NVQB 2VB3X 3P75A 2IX1A 1N32Q 4LCDE 4DAMA 1NUCA 1MJDA 2WAQB 2WDTB 4KX6B 1G291 2G3QB 4ZRQA 1XNRL 2LI5A 2O6VD 1ASZA 1HA6A 3H0GH 5IGFA 4A3EH 1JICA 4A93B 3VTUA 3T3NA 1TU2B 3AEAB 4IM0A 3NUCA 4DV4Q 1OXXK 4DUYQ 1N8RC 2JWUA 1EQTA 4OWWB 4IFDG 2LJIA 3PSEB 1AN8A 2SEBD 2DX5B 1HTOA 4WFN3 1XNRQ 1MBYA 2KFKB 4PS8A 1X9NA 3RNFC 2WXMA 2PI2E 3OWFA 1IYVA 1LTGD 4FO2A 2E74C 4IOAA 1YX5B 2NVQH 2PLPA 1TIID 5FO9B 1M1KC 3GE3C 5DPSA 4NMZA 2MWSB 2ZPNA 3WANA 3BDOA 4KK7A 2QA4A 3T16A 3T4AC 1UWMA 4N59A 3A55A 4K5VA 1V9PA 2V4DA 3G6EA 2AX5A 4FF2A 3UIPB 1BQQT 1BUIC 4A93H 3CU7A 3FPUB 2CHWA 5CGKA 2R7ZG 5FK9C 1KRHA 2PQAB 2BA0A 4H0LC 5HY6A 5KNDA 3OMCA 5E6JA 3UINB 2K03A 3X3MA 3Q24A 1SAPA 1R7SA 1EYGA 1Z5SB 2I1JA 1EZ8A 4FJYA 1T0QC 2F0HA 4CGYB 1SJED 4F8MA 2MUYA 1UE6A 3TZDA 2G1EA 5C5LA 1AH9A 3R2IA 1CHQD 1N5WA 5CBEE 2WGSA 3L08A 3R3OA 5CYUA 5FKAC 2LGXA 4N9PA 3I4MG 4K0KL 1GUAB 4IM3A 4K5WA 2G45B 2GB1A 3VYUA 3AH7A 2ICIA 2L1AA 3VDYA 3MXNB 4DR4L 1E6EB 3JAMc 3DWGC 4U68A 5A2QE 1SE4A 4LNQA 3V61A 2IX3A 2JRHA 1DOLA 2JN4A 4R1JA 1ZDVA 4K0KQ 4R4CA 4YWMA 4YWLA 3P42A 3M7GA 1STAA 4EQOA 4RF1A 1HFGA 1TKEA 3AE2B 4FXKC 3FKIG 1S4ZA 4X57B 4DR4Q 4NY0A 3SK5A 2IDYA 4FA6A 4JI4L 2L4NA 5ELEA 4PYUA 3Q22A 3ZNGC 1DOIA 3VR9B 1L6UA 4PZ8A 1NI2A 2KANA 2QC8A 1B7YB 1K83B 2YU9B 2L9HA 2RVLA 2NZOA 1XPUA 2LWPA 3QOJA 3WALA 3QOLA 1KH0A 1X6OA 4JI4Q 1KL9A 4CO7A 5L95C 2MGSA 4IPCA 2MQHA 2I07B 1CHPD 4IOCA 5I6YA 4IKGA 3ZGZA 1RTNA 3UDXA 2R7ZB 1GUSA 2FCNA 1SNMA 4APVA 1E2ZA 3KYHC 2KJ6A 4M00A 4IFDH 1I50B 4A3JB 3AB9A 1JWAD 3TDQA 2X6LA 3A8IE 4DDID 1KC8C 3DCGA 2K4KA 1R4MI 3S2AA 1YOVB 1K83H 4Z9CB 2KVRA 5M3FG 4S0RA 2YU9H 1KRTA 2JUOA 4K81A 4ASWC 3P1MA 3F8TA 1VZ7A 1HTQA 1L7YA 3KLSA 5IGEA 3NUHB 1Y8NB 1F9JA 4EZLA 2X69A 2K6DB 2UUAL 2ATWA 2CS4A 3SVMA 5BN3A 1YEZA 2R7ZH 2GI9A 2LGSA 3H9DA 2CHZA 2J52A 2F0IA 3K5NA 5AFWA 1I50H 5FLMH 4AJWA 4A3JH 2KUMA 4H44C 5G3LD 3LDZE 2UUAQ 2LGDA 1SDFA 3RT3B 4LNFA 1L0YB 2DYMA 4BXXH 3A8KE 3KFUA 3FAHA 5FLXc 2LHEA 2PJHA 1SFOB 1JRUA 1IP9A 1B9RA 5CX3A 1LXDA 3HZXA 4XE0A 2F0KA 5FO8B 1A5RA 1C4CA 4JYAL 2G9DA 3SR1A 5FR3A 5EE1A 3KF6B 3T1YQ 4K3BA 3EROA 1H9MA 5K36H 1YHQA 1UGMA 1E24A 1F2RC 2D5DA 2KHIA 1PGXA 2GVAA 2Z0EB 4H2AA 1O7ZA 2BH2A 4OVUA 5J17A 4XXEA 2WQYB 4DV5L 5EBDA 2E2JB 1Q12A 4YTNB 2EVBA 1E10A 5E6PA 4DHJB 4W9JA 4MSMB 3PPAA 3QO2A 2SOBA 1QOHA 1SFOH 3LXFA 4JBWA 2JZZA 3DOWA 3G4SA 2ONQA 3W1GA 4RCNA 2CU3A 4GN4B 3FILB 4WWOA 3D8GA 1YD8U 3AI5A 1V1QA 3MXGA 3PIO3 2ALYB 1UEAB 3WOFA 5JOBA 2Q5WD 1KDCA 2NUCA 1C4PA 3CPWA 2DWQA 3B0AA 3HIZA 4IOIE 2TSSA 1V1PB 3PUYA 4BA1I 2V1CC 2E5LL 1M90C 1YMHE 2DAFA 2SNMA 1QVGA 2MP2A 2W54A 2OQ0A 2E2JH 2AL3A 2NPTA 3P20A 1WGRA 3PHWB 1J8CA 1CT1D 1YQ4B 1GC7A 3OG5A 3DEOA 4GOPB 3EA6A 4GN5A 3S9WA 3M62B 1L0VB 4E3CA 1X55A 5J3BA 5CHVC 3RULA 2E5LQ 3BINA 4FXDA 1II3A 1FGUA 4K14A 1D1KA 1SROA 3A33B 3QWZB 2O2VB 2C5LC 4WURA 1WTPA 4P6VF 4L23A 4LJOB 4J6HA 1CZWA 1LT6D 1U9RA 5IYBH 2LZ6A 2IT1A 2IL8A 2VY3A 1PZJD 4X3TA 3U4VA 2L00B 1SE3A 3LWUA 3AXCA 3KQ4A 3CCSA 4DHZB 4I7ZC 3J80i 3H7PB 4XWTA 4YCWA 5IYCH 1LTBD 3VR6A 2LXAA 2MNAA 4KKTA 3RLOA 4DXAB 2C9WB 4KI0A 3Q3OC 3LB8C 1HJPA 2H88B 1CA6A 4CHKA 1QOFA 3D4WA 1PFMA 1FD6A 3V62A 3R2TA 3W5OA 4RM8A 4AUQC 4KN4C 1VR9A 2GLSA 1WI5A 3ZXRA 3GP7A 2F3IA 4NQKE 4C7YA 4IG7B 1PYSB 3CRLC 4HIMA 4QUFA 4OO1H 2Z8LA 4ABNA 2H4OA 4RMFA 5COYA 2DAJA 1C9OA 1V97A 4JWUC 1H8CA 3MC9A 1STHA 1Y8RC 3L0WB 1TWAH 1WIAA 1J8IA 2RSUA 2LVOA 4NZLB 4DFAA 1HTPA 4DXGA 1JWBD 2YTXA 1TIFA 1WJ6A 1WXMA 2KX3A 4OWTB 3AU5A 1SYDA 5MPOA 1ET9A 2UYZB 4US9A 1T0RC 4P2CB 1HRJA 3QJZA 4NJCA 4BKGA 3UI2A 1PGBA 1XQQA 2O2LD 4LF9L 3J7YW 3IHPC 3JSVA 2MP1A 4S3SA 3QC8B 4C4VA 1AARA 4BOZB 1SB3C 1C4AA 1XO3A 1UE1A 4G0NB 4B08A 1UBQA 2KWCA 2NBVB 3FMCA 3LGJA 4MJSA 3RN9C 2EY2A 2WX0A 2EIFA 4LF9Q 3HKZG 5JEAG 3V05A 4TV3A 1IKLA 3JAML 3D0FA 1EU4A 2DJGC 1EL0A 3VR2A 2QSDA 3A4RA 1KNEA 4EFOA 1U5KA 2I38A 1B9MA 4FN2A 1D5MC 1Q46A 2LY7A 3DWAA 2PW9A 4YTPB 4CQNA 4PNYA 1AFPA 1EF5A 1GXDC 3J80c 3J81L 3SR6A 1U4RA 3STBC 3IVFA 1FXAA 1SMYD 4JC0A 2RD0A 3VUYA 1JB7A 2L76A 2XIWA 2DZIA 2O4XA 3AEBB 5KGUA 1LGRA 2P5ZX 4ZDVA 1EWHA 3T53B 2DY8A 2A73B 4DN4M 4EQNA 2KZRA 3OSOA 2WDQB 3CWIA 2D3AA 3ABVB 4OZAA 2LXCA 3ZUNA 2UWQA 1WGDA 5J22A 2WINB 4OGQC 1RAXA 3NHEB 3PLVA 1HZ5A 4JBMA 4ZLTF 1TZ1A 4RGNA 1WCMB 3J7AV 1AE2A 1QOBA 1VCIA 2MJ8A 4RCOA 2D3GA 2LUEA 1FCLA 4KHVA 4TSSA 2PO4A 3VVWB 2D3CA 1MSHA 1TXYA 2RPQA 2K5HA 1QLBB 1D5XC 1E7UA 2XWJB 2INCC 4S17A 3PVLA 3VDZA 5LHY1 4QGUA 2CH4A 3KYCD 2GA4B 2KQ4X 1J19A 2F03A 4K6DA 1C48A 3H3VC 3MWYW 2J7QB 3CAMA 4I65A 3TP8A 3NHHA 5IGDA 4R8IA 1BBXC 2JA7G 1T3QA 4POFA 2LXJA 4HJ7A 5M5WB 1HZBA 3HKZB 4POGA 1DZ1A 1JT8A 1WZ0A 2WNMA 2D2QA 3A9JB 1WCMH 4IC7B 2CW0C 2Z6KA 1JW9D 4JGHB 2NYZD 3VTWA 1KNAA 4HMJA 1JOOA 1XTCD 4KIKB 4WQOB 3TL5A 3Q6SA 1NTGA 3AB5A 3DBHI 2L15A 1QZHA 2N7EA 4G7OC 3WAOA 4MSQB 4XT1B 3RNUA 2XK5B 2ENBA 4GKJQ 4KJNA 4W9LA 2QILA 3RZFA 3A9KB 4A9AA 2DUDA 2E2HB 1C0AA 3MFGA 3HVDA 2KCTA 3T1HL 2Y5BB 1RLFA 1SNCA 1L1OB 2KC1A 3KOJA 4WWPA 2JY6A 1RIPA 1MJCA 1J7AA 2QF7A 2KVZA 3OTOL 1IZ6A 3P7JA 4A3MB 3NG0A 5D6JB 2CQAA 3B9JA 3VYTA 1LM0A 1SMYC 2K33A 3CSFA 1WYWB 3AECB 1HUNA 3T1HQ 4A3GG 3GTJB 3EJIA 4KV2A 5IT9c 1EF1A 3PZDA 3Q2AC 2F0MA 3TEXA 3TP7A 3RN2A 5IP7H 1PH2A 2HCCA 1G2TA 4P75A 1GNUA 3MHBA 5HGQA 3OTOQ 2BS4B 2E2HH 1VF5C 2F0SA 1BVSA 4LAAA 3C19A 2PIAA 2PCFB 3J7ZC 1FJGL 2W55A 5M5XH 4F8CB 1BO0A 4GDKB 4AYBE 2JXTA 2I46A 4A3MH 2BB5A 1D2BA 1WMHA 2PKOA 1G6JA 1PTOF 5L37A 1JR0D 5KEEA 3C0RB 2QDBA 4LUVA 4OX9L 4LF6L 3GTJH 4M8NA 1FJGQ 1GVPA 4YSYB 3KH0A 2F0UA 4HCSA 4B9WA 4W9CA 4DR2L 5A2QL 2ZM6L 4RFBA 3A1QA 3RMKC 4DKAC 3PUWA 3L16A 4TQ0A 3PRPB 3W1SC 4GS3A 1UE5A 3U4ZA 1IL2A 1NDDA 4A3LH 2WWZA 4LF6Q 3HG9A 1ENFA 1WTWA 2BH8A 1V81A 5C4JB 2K52A 4XQNA 2V1YA 3BK1A 2ICEC 1F1HA 3I9V1 1EOTA 2MQJA 5KNCA 2LFIA 3CCLA 3NY5A 1F2MA 2ZM6Q 4C3IH 4HDQA 4BAXA 4WRDA 3MXNA 3OIQA 3SHQA 2A74C 4HSVA 2DZMA 4BBSB 1QWYA 4A76A 3KWLA 3PV0A 2RKSA 3SHLA 1V6EA 2JWZA 2AKWB 2IY0B 2HIXA 5CMDA 1WTHA 1WXSA 5C3EG 1M4VA 3K58A 4OEMB 1NCVA 4GN1A 4OIJA 1E9MA 3IAM1 1UF0A 2M0XA 4K1RB 2X38A 2PW5A 1PFDA 5C4JH 4NJ7A 4PG3A 1VZ6A 5BO4B 5EBCA 2KTRB 1VZ8A 2WP8J 2PZWA 4X65L 2PMZE 2IPKD 3DM1A 1PYBA 5E4WC 4BBSH 1DD2A 2IO0B 2W3SA 2JE6I 1WXVA 3QQ8B 5JPMC 2ZCBA 4M02A 5IP9H 1RFAA 1SYFA 3KBGA 4E71A 1DOKA 3NENA 2IHFA 1AE3A 3I73A 5JJIA 3I70A 1D7QA 2BA1A 4RF0A 1CMXB 2KO3A 4MHEA 4X65Q 2FBWB 2KDEB 1B53A 2K01A 2PI2A 2F0QA 1YJWA 4HPMB 1SE9A 1FXTB 1IKMA 3MZ5A 4DF7A 4JG2A 4QF4A 3I55A 1YN3A 3Q14C 4MN3A 5DAUA 2PPBC 1E8WA 2BWFA 5CTRC 2N1VA 1STNA 3W1SA 2ZXRA 4BA2I 1E2VA 4LK0M 3ICEA 1EUVB 5EKKA 4KKSA 4JI0L 1PUTA 4E74A 2KHSA 2JA6G 1KIXA 3IKJA 1HXYD 3VUXA 1WH3A 2GBKA 1HZ6A 1WGYA 2FIDA 1JE5A 4GOCA 4HIKA 1C1YB 3RNAC 3PF5A 4GOPC 1A3UA 4RGMA 5C4ZA 1X3FA 2LKVA 3F2BA 4JI2L 2R92G 2JYEA 3EFUA 2B39A 3ZJUA 4JI0Q 3APCA 4IUNA 1GUGA 3W5VB 2EELA 1P8LA 1VQ9A 1TS4A 3J7A5 1G6ZA 4BBRB 1VQEA 1ESRA 1ZP0B 3KW5B 5C5MA 1X1MA 4JLCA 5DPWA 1PRTD 4A3KB 2Z0DB 4DR1Q 2KEEA 4NXNL 4JI2Q 4F87A 5FJ8G 2JEAI 1C79A 3CIRB 1JE4A 1IYJB 1PLFA 1VDZA 4BWGB 4JI7Q 2KXJA 3RPFC 3B2GA 5LLIA 3OWEB 4JVZA 3I8ZA 1F52A 3LJ3A 4MGYE 3WCQA 1KHIA 2KCCA 5DPRA 2KLCA 4HCPB 3TEYA 2JXMB 1DYQA 4II2B 4UP8A 2PVOD 3E9IA 1FYCA 4YSXB 2HDLA 4WIPA 5G2NA 3SK4A 1NBWA 5I6WA 5J39A 1K3RA 5KHQA 3DHQA 1W6JA 2JJQA 2CWPA 5M5YB 4REZA 4ZHOA 4BBRH 1Y8OB 1B70B 1DXMA 4IQZA 4NP5A 4HJ5A 1ZXHA 2X8XX 2A6HD 3PRMB 4A3KH 5JEAJ 4A90A 2QKIC 1V86A 3LX0A 5LXIB 2EY6A 4W9IA 2VB2X 1WRIA 2CFMA 3KUZA 5D7GA 3ZDTA 5D94A 3MAQA 3RN5A 3S14B 3ZYYX 4LNIA 4XDDA 2ZTCA 3BYYB 4BKTA 4GKKQ 1MI0A 3UDIA 2AWNA 4MGKE 1V1PA 2MH7A 3ONAB 4NXML 2NN6G 5GXGB 4OIKA 2Q2TA 2BPSA 2BF8B 4CKCA 4IFDI 2AEHA 1BCPD 2KJXA 1RL2A 2NBUA 4US8A 1FNUA 2XN9C 4FYDA 3A5ZB 5M5YH 1YNND 4XIGS 3NVVA 5K5PA 3HGBA 4GOPA 2NCNA 1XPRA 1XD3B 4MT5A 1Z47A 4A55A 3SU8X 1LO5D 3ZXVA 4NXMQ 4RWSC 3BVMA 3RYTA 2J7ZA 3FKYA 3H0GG 4A3EG 1PH5A 2F0OA 1STGA 1WE7A 3ML9A 2RSNA 1E0BA 4ICUA 3S14H 3CHBD 3UIOB 1D1IA 2N1WA 1QILA 1QNUA 1S3SG 5FOBB 1F9RA 3ERQA 4CJ2C 4LF5L 4CBVA 5IGCA 2FIFA 4AP4C 4W9HA 4BBNC 3GTQB 3OAWA 5G55A 2CHXA 3S1NB 1PRTC 4KD4A 1H9KA 3D4DA 3F2DA 1EY0A 4DDGD 2M4NA 4UHVA 3HKSA 4I7AA 3ITPA 3Q3MC 2J0JA 2WAQG 4LF5Q 3QA8A 4LTUA 3FEWX 2FCSA 3ZJVA 3AEGB 2N49A 1FXIA 1KFYB 2LMCA 1DONA 1T6BX 4MM3B 4A93G 5FJ8H 1AW7A 2V0GA 3CF6E 4KN7C 4PV1C 5DCNA 2OTJA 4OWXB 3OJ4B 3PO0A 1OXUA 3EBEA 4PMCA 5BMIA 1F77A 1H9SA 5LMNW 1I42A 1K8MA 3V96A 3GS2A 4MGIE 4HRSA 5LXHA 5EE0A 3GTQH 1IPGA 4EVOA 3S1NH 3IFWB 1K8AC 3AN1A 4K7WA 2RQXA 4ALPA 3ZJYC 4J3OD 2D9UA 2L1BA 2K05A 3CP0A 2MJEA 4DXFA 1Q86C 3WDNA 4DK1A 2J0TD 1BCPF 1H9RA 4BY7G 4Q5VA 1MHXA 2M00A 1WWTA 1B4OA 4BY1H 1I6HB 2VZKB 2KJHB 2WV6D 3Q8FA 4BZAA 3H0GB 4DK3C 1TQOA 4A3EB 4DV1L 2KDIA 4G57A 4NJ6A 1SNQA 2R3ZA 1VQKA 2B29A 2K8BA 5IN7A 2VNUD 2UXCL 4LUZA 4C1NK 3R93A 4HLEA 4MGZE 4A4IA 5CHWA 1MFWA 2ZCCA 1TS5A 3JAMi 5EPJA 3VH3B 4DPGA 1VF7A 4KY6A 3WIMA 3DEPA 4L5TA 1RRBA 4YL8A 2QCZA 4YY3L 3KJOA 4KZCA 1V43A 2UXCQ 4W9DA 4EKUA 5IE8A 5DNFA 4WWMA 1ZXTA 1I6HH 5CV6A 1W6KA 3B1LX 2FCQA 2LXKA 4JI8L 1PHJA 4Y52H 1LQBA 1XCTL 2K1BA 3NQTA 3CC7A 1IGDA 3SFDB 2HJ8A 1F2LA 3DHIC 4K3CA 4YY3Q 2BYFA 3RFZB 2EDGA 2OHFA 1PFNA 2K5NA 1I3QB 4G4KA 5EE3A 4BVUC 3L4PA 4G3XB 3VAWA 3ND9A 4JI8Q 2D07B 1ML0D 3CD6A 2D0OA 1AYFA 4KVGB 1D4BA 3I4NB 1I4XA 2K50A 2OF1A 4XYQA 1KM7A 4FXCA 5HKHA 1MHWC 3PMFA 1MIUA 1TT5B 3V3XA 1VQIA 2F0WA 4BY7B 4F1SA 3MHSD 2V3PA 1IBML 3ZTCA 1Z6HA 5IAAC 1BUVT 3NJTA 3ERSX 5FLMG 3NS8A 4A3JG 1S5ED 1QE6A 4QQBX 1YVCA 2EXZA 4OO1I 2MJ3A 3FC4A 3K9OB 4B0EA 4HVBA 3K0YA 1I3QH 2D2CC 4LFAL 3PTFC 1HPCA 3VFKA 3N20C 5LNK1 1IBMQ 2DZKA 2RDFA 1NYRA 1E3PA 1RTOA 4BXXG 3TZUA 3I4NH 4ANUA 2EXDA 3U8ZA 2AQ1B 3GZNB 2F4VL 1B9NA 4BY7H 1R4PB 4LFAQ 2XK5A 1SIJA 4L2YA 4KLKA 3B08A 2KBNA 3VRAB 3NPPA 2PTLA 4HJ9A 2XNAC 1ILQA 1CKNB 4XTCS 1O80A 3PREA 4AS1A 3FPPA 5K36G 2VL6A 3J81c 1J6QA 1WJUA 3N1XC 3NOBA 5EKLA 4TKOB 3CCEA 2HQLA 3UDFA 4HJAA 4ITKA 3CCMA 4N9TA 3I7FA 5C0XJ 2F4VQ 3S1QB 1R4QB 1K8OA 2K0PA 2K8HA 3G48A 5E6OA 1FL0A 1WGHA 3HM3A 4G7HC 2EZVA 4WJNA 1SN8A 2F52A 1N61A 2RCFA 3Q69A 4ACFA 1KLVA 2EY1A 1U4PA 3F2UA 2KOLA 2K8CA 2WXPA 5BR8L 1TTNA 3L17A 4GDLB 3RCZA 5HGTA 3URYA 1EY9A 3PUVA 1WYDA 2EYOA 1DJRD 4YHHL 3JW0X 1E7PB 2HE7A 2DGYA 2KMAA 1X3PA 3CMAA 3AMZA 4I6LB 3S1QH 1KTKA 4FDBA 5BR8Q 4DAVA 2N9XA 3LWEA 5GAHC 1AZPA 1W3SA 1HHVA 4GDKA 2IGHA 1Y8PB 3I2ZA 5A35A 1A70A 4WWNA 2KYWA 2FUHB 2NTSA 2OEDA 4YHHQ 1XF5L 1D6EC 1J0GA 2EJGC 3KJPA 1OXVA 2N88A 2H89B 5CV8A 4YSZB 3AU7A 4C3JB 5ISRA 4L63B 2I1KA 1E5WA 2N9KA 4HCNB 2M0AA 4A3IB 2G4SA 2I2YA 3KUPA 3HOZB 2B3AA 2FE8A 2K39A 5IYBG 4LLGM 1NYQA 3AU4A 2OTLA 4ZKBB 3J7AF 4KHPL 1U4AA 3NZ3A 4JI3L 3K59A 2B76B 4HXDA 4A20A 5E4XA 1Q1BA 1X3QA 2RPVA 1HQRD 3PRZA 4RHSA 3SK8A 1ASYA 3X23A 2TMPA 4N8FA 3A54A 4DHZE 3SGIA 2K6AA 1WF9A 2Y5PA 1TS3A 4AOFA 1D8LA 5IYCG 1QUQB 4XQQA 4CDFC 1L4ZB 2J4XA 2IO2B 2KX0A 1PTOB 3RNEC 4RGOS 2C7MB 1XPOA 4KHPQ 4C3JH 3T1YL 4JI3Q 4JL9A 2WB1B 2IGDA 5BN4A 2HTME 4DUZQ 2UUCQ 1XLQA 4A3IH 1K51A 2F0JA 1J5EL 3HOZH 1HEZE 2N9PC 4TMAB 1RKNA 1SE2A 1BXTA 4HIDA 2F0PA 1YJJA 4OO1G 5IGBA 1ZE3D 4YWGG 5IOIA 1FVIA 4FNFA 3KBXA 4IDIA 2VRRB 4NPSA 1DGSA 1I35A 2L52A 5HURA 3V6EB 4AQYL 2K9XA 1PTOH 2ZXPA 1J5EQ 1LTTD 5D3IB 3RLFA 4LFBL 5D3DA 2WXFA 4P72A 1WTVA 5BN5A 2F0TA 1GG3A 1PFBA 4BOSC 1CKOA 1KD1C 4AQYQ 1QCBD 1GPXA 4LFBQ 1EFWA 2WXLA 1RD9D 1MPEA 4M0WB 1V8QA 4ZK9B 2MHVA 3J80E 2AHOB 4HN7A 4A3CH 4WJ4A 1QF6A 1LTID 1O7LA 2R61A 2CKHB 3BDLA 3OPOA 2DENB 4H13C 3QG1A 4FJZA 3T9LA 2EMSA 3DVGX 5CV4A 3E9SA 2KWDA 2G9HD 1P3QU 1QT9A 5G3LF 4N8X1 1N33L 4CYEA 2NBFA 1SR3A 5IIFA 1WM3A 2VQEL 5ELNA 1E2WA 1LUZA 4GNXB 2LEKA 5C1ZA 3STBD 2MX2A 2UU9L 2R93B 1ZYRD 2MCNB 2AWOA 1S5FD 1A2UA 2L3ZA 2KFJA 1N34L 1N33Q 1TWAB 2JQOA 1OEYJ 2BBCA 2F0VA 3IXSA 3NEMA 2VQEQ 1IBXA 1PH8A 2BS3B 4K7SA 3ZO5B 1TY2A 1KOTA 1QJOA 1EQQA 2UU9Q 1E7ZA 1ZEQX 4X3SA 5LMNL 3MHZA 1VQHA 1WJJA 2E76C 5JVH3 3H7SA 4NAWB 1S5CD 2F1MA 1N34Q 1PH3A 4EGVA 1GJXA 3EECA 4FP5D 4R4IA 4OVVA 3VR8B 4NPNA 1V1OA 3TJPA 2F0GA 5IKCM 2R93H 1JWSD 3QARA 4EEWA 5LMNQ 4NAMA 1JQ4A 2EY5A 2QIEB 5BMHA 3MJ5A 1K50A 1SYEA 1PH6A 4TUUA 3EN2A 2BQQA 2A19A 3HUIA 3HKZE 2KK8A 1AEXA 1WCMG 5HFYA 2L8JA 1T5XD 1ILPA 3M63B 1VMPA 4B9KA 3KF8A 2DZJA 1PZKD 1K3BC 3MC0B 3HM6X 1TKWB 4P71A 3A7AB 3APDA 3U9SA 2CW0D 3L9AX 2KLGA 4HEDA 4RMAA 2R6GA 1FRRA 2N4FA 2QDLA 3NE5B 5DLQE 1KRSA 3TRZA 4IFDJ 1RYJA 1V5TA 1ESFA 1E7VA 2KN5A 3ALBA 4HJKA 1FFVA 5GAGC 2Z6KC 4AWJA 2WXOA 1N36L 4LDTB 2QCPX 4HIOA 3H6NA 2WU5B 2ZZPB 3GTLB 3ZRCA 3AE1B 1WGGA 2IO3B 4DK5A 4C7ZA 2KN4A 2K3UA 1WI0A 4K6LA 4ULLA 2RGFA 5EQ0A 1IL8A 5GMVA 4KGRA 2B63B 2DN8A 2GRIA 1N36Q 2J53A 4ZCKA 5IP7G 1LABA 1XEEA 2PPHA 4XYCA 1YZ6A 1TWCB 1ZYRC 2B2UA 4DV3L 3BWUD 3HVZA 5JPNC 1TBEA 4W9EA 1WTXA 1S40A 3IBEA 2VH1A 2YVCA 3V2TA 1KXLA 3NRZA 1Y1VH 4X6AH 1G6PA 4QJFA 4L1BA 3NTKA 2MO1A 2LJ5A 1WZ3A 3HOXB 2Q2HA 2QEJC 5AUKA 4A3MG 3GTLH 1XMQL 5E7NA 1EQRA 4PT5A 4DV3Q 4W9KA 1UGJA 3WAMA 3TN2A 2KHWB 3C46A 1YBYA 1RCVD 1FNWA 4P73A 3CMEA 4IUQA 4K7UA 1TWGB 3TIXA 4ZUJA 3N32A 3W5UB 1PFSA 2B63H 1PYWD 3G7LA 3U9OA 1XTDA 1A3TA 3ZVVA 3ZLZA 4LF4L 1HQMC 4A3DB 1TWCH 1XMQQ 5CORA 2B3GA 4YWKA 1O7IA 4DNIA 4E6IA 2GBRA 2KQ7A 1A0IA 1GUNA 3P1HA 4A3LG 2KT7A 3PCOB 2ZXOA 2N7JA 2D0PA 3NELA 2PW7A 1S1QB 3X3NA 2PYKA 2XTIA 2V3NA 3HOXH 4KGSA 1JORA 1QB5D 3CCRA 2OJRA 1VMCA 2FJ2A 4C3IG 1HNZL 2I5MX 1LYLA 4LF4Q 4KDIC 1NNXA 1J7BA 4GKJL 2PNRC 3UQAA 1YNXA 3M4OB 2PE6B 2B2TC 2M2LA 1TWGH 1DM0B 1UNSA 3FP9A 1NR2A 5NUCA 2XEWA 4TRDA 3RLNA 4B3SL 4GB9A 1WR6E 1QQRA 1HR0L 4A3DH 2G4DB 1EO6A 1UWVA 1HNZQ 3CCJA 1PV4A 4DAYB 1CFMA 5DEHA 3S1RB 1WX9A 3S2DB 2N9LA 2B2WC 3D4RA 1P0RA 1ROEA 4KKIA 2BVCA 5EKIA 3TP5A 2M8SA 5EPKA 1E1OA 1WD0A 3IG3A 5KRUA 2KQSA 2SNSA 3R3MA 4DGZA 5IGGA 4B3SQ 1L2NA 4J1MA 4JI6L 1ZPSA 1HR0Q 5GADC 4JPBW 5M5XB 2EYHA 2PZUA 3NTHA 1BCPB 2BOSA 1HH2P 1WOCA 1K53A 3M4OH 3PV1A 4BBSG 2INPE 3Q3JA 3BIID 2ZTDA 4FBJB 1EEID 5G5HA 2R7FA 5IP9G 3QIAA 3M4PA 5EJWA 1RHPA 1STBA 1VQBA 3I90A 4ME5A 4JI6Q 4O42A 4WJ3M 4JCVE 2JEBI 1Q90A 5C44B 1FMAD 1MGSA 3S1RH 4WAAA 4NDXA 3S2DH 2E8GA 2Y0SB 2RDGA 1IXRA 1N9WA 2Q2IA 1UELA 3BVZA 2KFKA 3FHWA 1J9OA 1STYA 4HAEA 1NJIC 1EYDA 5ELFA 3JYUA 4DHJD 3S15B 1GB4A 3S2HB 1WTOA 3M4YA 2L0CA 2RCNA 1OEYA 3NVYA 4NKLA 4B0MA 1PZID 4C3IB 1QVCA 2UU7A 1HZ9A 3ULJA 3M7NA 3QK0A 2IHEA 3VHTC 3SK6A 5I2XA 2INNE 3PQIA 2WFWA 1NBFC 1EY5A 3FDTA 2PQAA 2BB6A 5C44H 3K9PB 1KJTA 2KMCA 1EY6A 3I4LA 2B2TA 3K57A 1OXTA 4LF7L 2E6XA 3NS1A 4QCLA 4ZHPA 3BJUA 2RA4A 5C3JB 2EYLA 4OW0A 2Z1CA 3S15H 2PMVA 4A3OA 2MEKA 2HTHA 3S2HH 2KA7A 1D5ZC 1B44D 1VQJA 5C4XB 2OEOA 4KY5A 4ARCA 1KLUD 1EWCA 2B2WA 2IX0A 4LF7Q 1U4MA 1G2SA 3ZDMC 4P74A 3RMHA 1PDQA 2K32A 4IURA 1QKZA 1T0SC 4TQ1A 3R66C 2MBHA 1BBWA 4JQWC 1CSQA 3QWNA 2WXQA 4EE2A 2PE9A 3P4PB 4DV6L 3MFYA 3AEVA 1GUOA 3AE6B 2N78A 2OT2A 3HS0C 4IUPA 2NN6I 5M3MB 1KDAA 4BBRG 1XLOA 1GUTA 1EIFA
chains in the Genus database with same CATH topology
1SNPA 2C9OA 1F0ZA 4XYOA 3AE9B 2EYFA 1TZOA 1EFID 4JE3B 4X3KA 3UI3A 3BVGA 3FVQA 4MIUA 3ZJTA 1CZGA 3DWQA 1B3AA 3I91A 4G7ZC 1YNJD 5CBAE 2JQRB 1I6VC 1QG7A 1LTSD 5KIXA 3RZDB 3H94A 4A8XC 5BYSA 4IUTA 2BS2B 2A68C 2RDHA 2FFKB 4ZYSA 5C4HA 2IW3A 1KF6B 3VR4A 4DA2A 3VR3A 1A6XA 1EY8A 2KECA 4MACA 5DM63 2DNEA 5M9OA 1DOYA 1MVKA 1TY0A 1LTAD 2B2YC 3EGRA 1WTQA 1IYUA 3CKIB 3Q23A 4XWWA 2PZTA 1RF2D 3HOVB 2YEPF 4HROA 3EVQA 3D31A 3GB1A 1CZPA 5TSSA 2A69C 1ZDXA 3N6RA 2FUG1 1XWEA 1B2TA 1NVID 3NK9A 5JAVA 4PMBA 1ZKOA 3A7LA 3C3LA 1RFKA 3FILA 4WH4A 3L3OC 1XX8A 4DU9A 3AE5B 3K6OA 1YNJC 2KEDA 3EQLC 1Y69U 5I9PA 2EYJA 4USAA 4V190 3AMUA 4HJGE 3NTIA 1XLPA 2F3WA 3MXPA 3Q0AA 2QJLA 3DUZA 2VUMB 2JP1A 4KHZA 5E1FA 2XRQD 3U52E 4X3UA 1C4QA 1YQ3B 1B1ZA 2BTEA 2K5DA 3QB3A 1IUEA 1PRTF 5I9OA 2ZW0A 2B2YA 4D2KA 2L32A 1TYGB 1GUWA 1Y56A 1MI2A 1QOGA 3PO3B 1SF0A 3GTPB 3VR5A 2RSOA 1IHZA 5C0XH 4U673 1ACCA 1LTRD 1LT4D 4K5XA 2JA8B 2M9VA 1SJHD 2NMQA 1FR3A 4ZOHC 4ODGA 4BY1B 1TT2A 1JQYD 1CJEA 3Q8EA 4ZKCB 1G91A 2BDNA 3AV8A 1YN4A 1SYBA 3O13A 4KV6A 2KQ3A 3JAME 4DNTB 4JX1C 2K5PA 3H09A 3IT4B 3S1MB 2V4IB 1FO4A 5HI1A 2L12A 1IW7D 1KLGD 4BS9A 2N55A 1SXTA 2Z4IA 4M8AA 1OQQA 2E3TA 2EYPA 5KNBA 2L5TA 4B9XA 2A5HA 3OIPA 3HOYB 5CV7A 5T8IA 1FEHA 3PZ8A 4ARIA 3AE4B 2AQ3B 1SSNA 1Y1WB 4OZCA 1JOKA 3HOUB 1XCQL 1I4GA 3NBIA 3N52A 2C5CA 1L0XB 3AM9A 2BE5D 4YIJA 1JWUD 3P4SB 2HCIA 4RH6A 1FCCC 1WGKA 1C8CA 3IT6B 4HCEA 4KD3A 2BT6A 2NVXB 4HEA1 1WTRA 1A15A 1EYAA 3OOCA 1SNOA 1VDVA 1TR5A 2KVMA 3U7ZA 4OHJA 4C3HB 4ID6A 4C80A 3MEHA 4YT0B 3PIP3 5JXVA 5HG2A 5FLXE 2KAJA 4HKQA 4YXDB 1FRDA 2HQEA 3C1EA 2EPBA 2JSOA 4QIWB 4YTMB 2KCNA 4V0BA 4C3JG 3P63A 1IW7C 3IAS1 1G8ZD 3GV3A 1EY7A 2K04A 3DWPA 4DAYA 1SSOA 4WJWA 2F3VA 2XSCA 1XXGA 1FM0D 3U4EG 1F9SA 2JYTA 4LMQD 1HA5A 2WXIA 3HRZC 1FD7D 1MD2D 4KY7A 1PMRA 1EWYC 5C2TB 2F0FA 2O5IC 3S17B 4KKJA 2JZPA 2NZ1D 4Y7NB 2D5GA 1T5EA 2CJNA 1OFFA 1JRPA 4RKBA 2NVTB 3SE0A 1GOZA 2BE5C 2JSVX 4IN3A 4CJ0B 1OXSC 2XWBB 3HEJA 5JJZA 2DYOA 1N60A 1FFUA 2NVYB 2K7VA 2SAKA 1I4HA 3LNNA 4FXGC 2L83A 1PGAA 2EKIA 4QMGA 1LLRD 1VRAB 5JVG3 1TVXA 2MPMA 4A3FB 2ACZB 3RUZA 2F0LA 5ELCA 5KYLA 4XQJA 1LV9A 3MXUA 3VYSA 1I7HA 1CI3M 3Q8BA 3K5MA 1S5BD 2YYZA 1IGCA 3I4MB 3TEZA 4L6TB 1HFNA 3NWTA 3Q8AA 2PQEA 3W3AA 3D3RA 3CRKC 1ZUD2 3OHXC 3BDCA 4R8NA 4HKZE 3ND8A 4FF1A 3MA2B 2W3RA 2DY7A 3HOWB 2L55A 4LJZC 3FKIB 3NWSA 1EEFD 2EJFC 4K2KA 4A3BB 1CQFA 1SEBD 3H6MA 5J1ZA 4PQXA 3EUB2 3SDZA 3AEFB 2AUJD 3BK2A 2HUGA 5I4DA 3HP3A 2F0NA 4N6EB 2K5QA 2WLBA 1TWHB 2EJMA 1BDOA 5CR3A 1EIGA 3G6JB 4Q0FA 2VZKD 5C6AA 3MVVA 1DGJA 3I72A 5BYRA 4CKBA 1EM7A 3E56A 3NBHA 3TSSA 1AZQA 4RNAA 3SFEB 5M3FB 2ID0A 4HMIA 1RJTA 4JK1C 2Q8IB 2X6GA 2ZW1A 4ILWA 5F2DA 2VXWA 4CJ1B 3I57A 1DOMA 4GZYC 1JALA 3GO5A 2WKCA 1L6VA 3PO2B 5T1GA 3VQIA 1CM9A 4KGTA 4KMUC 1PXUA 4CHTB 5IODA 2OXPA 3W2DA 1BNZA 1YJIA 2B2UC 1F2YA 3KWVA 1I4PA 4KTAA 2FHTA 1O78A 2CHBD 4HR7B 2WP9B 3IAYA 1ENCA 4KKUA 5C3XA 4XDCA 5LL6S 3VRBB 2M56B 2JYOA 3KLSX 1EIHA 1A2TA 1SYGA 3MP9A 4JWSC 4IUUA 2WXGA 1JOQA 1EZ6A 3TMEA 1E0ZA 3RD4A 3NVZA 4OZBA 1YNTE 5EGTA 2YEPB 2LMCB 3KK7A 2CVRA 1X32A 4H7BA 2O5JC 3R8BA 3TUOA 1H9SB 1BMLC 3A56A 3PUXA 1Y1VB 3TBIB 4A6QA 3K7AB 4LK1C 5IT9E 3SEBA 1N63A 2WIIB 1EY4A 5KYIA 2JU6X 3EFXD 3TP6A 3BG3A 4QB4A 1C77A 4XT3B 2WACA 4UAIA 3GTKB 1SYCA 2E2DC 2SDFA 2LHDA 2Y5CA 1BR9A 1WVLA 3NP8A 2BW2A 4C2MB 4IALA 1FNVA 1L4DB 4RA8A 1PRTB 4L8JA 1C76A 5I2YA 1AP0A 1NENB 1JWMD 2MJDA 3I3CA 4RGTA 1KABA 5FO7B 5CV5A 5H92C 2Q8RE 4RAUC 2NTTA 3GV6A 4K2LA 3MTSA 2NB0A 4RKLA 2ZT9C 2BYTA 2K5WA 3A8JE 1NI3A 4IUVA 2WKDA 2HDEA 3GTOB 3S16B 3BS1A 3BYTB 2DLBA 4OVZA 1PTOD 5LL6X 1F2ZA 3NXWA 3C2PA 5D65A 1EU3A 1SNDA 2IJ0A 1CK1A 3CQZB 1ZOYB 1Q1EA 1F2RI 1JROA 5G5GA 5ELBA 3GQBA 3T51B 3TEWA 1R9TB 2KDMA 4TQUS 1ZXIA 3T56B 4JPSA 3VYRA 4XDXA 2F0DA 5C0XI 2WDRB 5FLXL 4OL7A 4EQPA 5JEAH 2ON8A 2PVGC 1O7YA 3KLRA 5H8YE 1BOSA 3HRDD 3RZOB 5HHDG 1TWFB 2A68D 2D62A 4ZAIA 1N62A 1C78A 1WSPA 4DK0A 5CC4A 1HTLD 1MSGA 5IOCA 5T1IA 1GHKA 1JCKB 1ICWA 1B50A 4HTHA 1P7EA 3DXJC 4ZRZA 1CTMA 5ELDA 3E5SA 4DNRB 2JA7B 2LFNA 1GAQB 1JMLA 3D6WA 1LT3D 4AQ7A 1H9JA 2L11A 3T3OA 1PTOC 2BDOA 2A6ED 1TS2A 1Q10A 2WXRA 3J9CA 1LT5D 3C8YA 4IZ8A 1PDXA 2A69D 2HDMA 1AWDA 3PUZA 1F9PA 3AE3B 5EPLA 1Z7TA 2IGGA 1EYCA 4K8IA 3FRPB 4A3GB 5EE9A 4N58A 3M3YB 2QMTA 3P4QB 1RDPD 4FF3A 2KMMA 3D6CA 1V8CA 2BCOA 1CA5A 1UWXA 3NVWA 1Q8IA 3Q8CA 4ZUIA 1NSNS 2NWGA 1ENAA 3VA7A 3AEDB 4F88A 4WORA 2F0EA 2RBMA 4C1NI 1UUPA 2CJOA 3T13A 4WQMA 3SXHA 1FGBD 3B2FA 5C0XG 3P4RB 3IFTA 1WD1A 1K52A 3NSWA 1SBBB 3AE8B 1U4LA 4AYBB 1JC7A 1L5PA 4DQOC 1DCZA 2A6EC 4MH8A 2K28A 2Q8TA 1C9FA 1I4QA 4ZRPA 1VJKA 1GB1A 2M19A 1TKGA 2WXHA 2AQ2B 1STEA 1MHHE 1F9QA 4FF4A 2EOTA 1TKYA 3U2SC 5C3EB 2E75C 2Y3AA 4R3DA 1NAPA 2WXJA 2JA5B 2J42A 4QUCA 3M85A 1HUMA 1RM6C 3J80L 1NR4A 1RODA 3WOEA 2H1EA 3N9YC 1HCZA 1IBXB 2N0SB 3OMGA 1M8AA 2WXNA 3K5LA 4F7XA 1EQVA 4WAFA 3W9CB 2B8FA 4HSPA 2LS01 1JB3A 1WXQA 4M0WA 3LYYA 1ONLA 1FIQA 1UAPA 2LGIA 1WYGA 1GHJA 2WDVB 3ZQ4A 1P7FA 2EE1A 3BZDB 5DM73 1Q3LA 2PMZB 4Q2JA 4PMWA 1ET6A 2F4IA 2E2IB 3H8HA 3DWMA 2JA6B 3QJYA 2KACA 1XYIA 2K22A 2IWHA 1CQVA 1BF4A 2WXKA 4O1NA 3AEEB 3VA5A 2R92B 3AE7B 5BMGA 3GTMB 2XVSA 3NQIA 5D14A 2Z4HA 4P16A 2FINB 2B8GA 2JX5A 3DMUA 2FMCA 4UDUC 1QNKA 1I4RA 1N5XA 4R9WA 4C56C 1NEKB 2B2VC 4CKEA 1QOAA 4RHRA 3IL8A 4KJOA 3GTGB 3L7ZC 5C3WA 2WS3B 1OO9B 1RWSA 3E0JA 2W82A 1J7CA 1LACA 1TJEA 5IT9L 1XLNA 1DOXA 3J81E 4C3HG 2WU2B 2DNCA 5CV9A 2XRSD 1YN5A 3IFDA 4J8QA 2A6HC 5E3FA 1KDBA 2EYMA 5AUIA 1KAAA 5BYQA 4NW2A 4M1UB 4DAPA 3OW7A 3C1FA 3GD7A 1A3VA 4FVMA 2DBYA 2RMMA 3ETRA 1VLBA 3H91A 4ZQ3A 1S5DD 3PZ7A 1BCPC 2FMMA 1YNNC 2NN6H 3E6ZX 2AUKA 1OQRA 3K5OA 2B2VA 4K8JA 2NVQB 2VB3X 3P75A 2IX1A 1NUCA 2WAQB 4KX6B 1G291 4ZRQA 1HA6A 5IGFA 1JICA 4A93B 3T3NA 1TU2B 3AEAB 3NUCA 1OXXK 2JWUA 1EQTA 4IFDG 2LJIA 1AN8A 2SEBD 4WFN3 1MBYA 2WXMA 3OWFA 1IYVA 1LTGD 4FO2A 2E74C 2PLPA 1TIID 5FO9B 4NMZA 3BDOA 4KK7A 3T16A 3T4AC 1UWMA 4N59A 3A55A 4K5VA 2V4DA 2AX5A 4FF2A 1BQQT 1BUIC 3CU7A 3FPUB 5CGKA 5FK9C 1KRHA 2BA0A 5KNDA 4H0LC 5E6JA 3OMCA 2K03A 3X3MA 3Q24A 1SAPA 1R7SA 1EZ8A 4F8MA 4CGYB 2F0HA 1SJED 2MUYA 3TZDA 2G1EA 5C5LA 3R2IA 1CHQD 1N5WA 5CBEE 3R3OA 5CYUA 5FKAC 4N9PA 4K5WA 2GB1A 3VYUA 3AH7A 2ICIA 2L1AA 1E6EB 3DWGC 4U68A 5A2QE 1SE4A 2IX3A 1DOLA 1ZDVA 3P42A 3M7GA 1STAA 4EQOA 4RF1A 1HFGA 1TKEA 3AE2B 4FXKC 1S4ZA 3SK5A 2IDYA 2L4NA 5ELEA 3Q22A 1DOIA 3VR9B 1L6UA 1K83B 2YU9B 2L9HA 2RVLA 3QOJA 3QOLA 1KH0A 2MGSA 2I07B 1CHPD 5I6YA 4IKGA 3ZGZA 1RTNA 2R7ZB 1GUSA 1SNMA 1E2ZA 4IFDH 1I50B 4A3JB 3AB9A 1JWAD 3TDQA 2X6LA 3A8IE 4Z9CB 3P1MA 1VZ7A 3KLSA 5IGEA 3NUHB 1Y8NB 2X69A 3SVMA 5BN3A 2GI9A 2J52A 2F0IA 3K5NA 5AFWA 2KUMA 4H44C 5G3LD 1SDFA 1L0YB 2DYMA 3A8KE 3FAHA 2LHEA 1SFOB 1B9RA 3HZXA 4XE0A 2F0KA 5FO8B 1C4CA 2G9DA 3SR1A 5FR3A 5EE1A 3EROA 1H9MA 5K36H 1F2RC 2D5DA 1PGXA 4H2AA 1O7ZA 4XXEA 2WQYB 5EBDA 2E2JB 1Q12A 4YTNB 2EVBA 1E10A 3QO2A 2SOBA 1QOHA 3LXFA 4JBWA 2ONQA 4RCNA 2CU3A 3FILB 3D8GA 3MXGA 3PIO3 1UEAB 3WOFA 5JOBA 2Q5WD 1KDCA 2NUCA 1C4PA 2DWQA 4IOIE 2TSSA 1V1PB 3PUYA 4BA1I 1YMHE 2SNMA 2W54A 3P20A 1CT1D 1YQ4B 3DEOA 3EA6A 3S9WA 1L0VB 4FXDA 1II3A 4K14A 1D1KA 4WURA 1WTPA 4P6VF 4L23A 4J6HA 1CZWA 1LT6D 1U9RA 2IT1A 2IL8A 4X3TA 1PZJD 1SE3A 3LWUA 3KQ4A 4I7ZC 4XWTA 1LTBD 3VR6A 4KKTA 4KI0A 3LB8C 2H88B 1CA6A 1QOFA 3D4WA 1PFMA 1FD6A 3R2TA 4KN4C 1VR9A 3GP7A 4C7YA 3CRLC 4QUFA 4OO1H 2Z8LA 4ABNA 2H4OA 5COYA 1V97A 4JWUC 1STHA 1J8IA 4NZLB 4DFAA 1HTPA 4DXGA 1JWBD 5MPOA 1SYDA 1ET9A 4US9A 4P2CB 1HRJA 4NJCA 3UI2A 1PGBA 2O2LD 3J7YW 2MP1A 4S3SA 1SB3C 1C4AA 1XO3A 4B08A 3FMCA 2EY2A 5JEAG 3V05A 1IKLA 3JAML 1EU4A 2QSDA 1EL0A 3VR2A 1KNEA 2I38A 1B9MA 4CQNA 1D5MC 2LY7A 3DWAA 2PW9A 4YTPB 4PNYA 1AFPA 1GXDC 3J81L 3SR6A 1U4RA 1FXAA 1SMYD 2XIWA 2O4XA 3AEBB 5KGUA 1EWHA 3T53B 2DY8A 2A73B 4DN4M 4EQNA 3OSOA 2WDQB 3CWIA 3ABVB 4OZAA 5J22A 2WINB 4OGQC 1HZ5A 4ZLTF 4RGNA 1WCMB 3J7AV 1QOBA 1VCIA 2MJ8A 4RCOA 1FCLA 4KHVA 4TSSA 2PO4A 1MSHA 1QLBB 1D5XC 2XWJB 5LHY1 2GA4B 2KQ4X 2F03A 4K6DA 1C48A 3H3VC 3MWYW 1T3QA 4I65A 3TP8A 3NHHA 5IGDA 4R8IA 1BBXC 4GLSC 5M5WB 3HKZB 2WNMA 1DZ1A 2CW0C 1JW9D 2NYZD 1KNAA 4HMJA 1JOOA 1XTCD 3Q6SA 3AB5A 4G7OC 4XT1B 4A9AA 2ENBA 4KJNA 2QILA 2E2HB 3MFGA 3HVDA 1SNCA 1J7AA 2QF7A 3P7JA 4A3MB 2CQAA 3B9JA 3VYTA 1SMYC 2K33A 3AECB 1HUNA 3GTJB 3EJIA 2F0MA 3TEXA 3TP7A 2HCCA 1G2TA 3MHBA 2BS4B 1VF5C 2F0SA 4LAAA 2PIAA 2PCFB 2W55A 1BO0A 4GDKB 2JXTA 2I46A 2BB5A 1D2BA 2PKOA 1PTOF 1JR0D 5KEEA 2QDBA 4YSYB 2F0UA 4HCSA 4B9WA 5A2QL 4RFBA 3PUWA 4TQ0A 3HG9A 1ENFA 1WTWA 3I9V1 5C4JB 4XQNA 3BK1A 2ICEC 1EOTA 5KNCA 2LFIA 1F2MA 4WRDA 3MXNA 3OIQA 2A74C 4HSVA 4BBSB 1QWYA 3KWLA 3PV0A 2RKSA 3SHLA 5CMDA 1M4VA 3K58A 1NCVA 4OIJA 1E9MA 3IAM1 2X38A 2PW5A 1PFDA 1VZ6A 5EBCA 1VZ8A 2WP8J 2PZWA 2IPKD 3DM1A 5E4WC 1DD2A 2W3SA 2JE6I 5JPMC 1SYFA 3KBGA 1DOKA 3I73A 3I70A 2BA1A 4RF0A 4MHEA 2FBWB 1B53A 2K01A 2F0QA 1IKMA 3MZ5A 4DF7A 4QF4A 1YN3A 4MN3A 5DAUA 2PPBC 1STNA 3W1SA 2ZXRA 4BA2I 1E2VA 4LK0M 1PUTA 5EKKA 4KKSA 2KHSA 3IKJA 1HXYD 1HZ6A 1A3UA 4RGMA 5C4ZA 2LKVA 2JYEA 2B39A 3ZJUA 4IUNA 1GUGA 3W5VB 2EELA 1TS4A 1G6ZA 4BBRB 1ESRA 1ZP0B 5C5MA 1PRTD 4A3KB 2KEEA 3CIRB 4F87A 1C79A 2JEAI 1JE4A 1PLFA 1VDZA 4BWGB 3RPFC 3B2GA 3OWEB 3I8ZA 3WCQA 2KCCA 3TEYA 2JXMB 1DYQA 2PVOD 1FYCA 4YSXB 2HDLA 4WIPA 3SK4A 5I6WA 5J39A 3DHQA 1W6JA 5M5YB 4REZA 4ZHOA 1Y8OB 1ZXHA 1DXMA 4IQZA 4NP5A 2A6HD 4A90A 5JEAJ 2QKIC 3LX0A 2EY6A 2VB2X 1WRIA 5D7GA 3MAQA 3S14B 3ZYYX 4XDDA 3BYYB 1MI0A 2AWNA 1V1PA 2MH7A 3ONAB 2NN6G 5GXGB 4OIKA 4CKCA 4IFDI 1BCPD 2KJXA 4US8A 1FNUA 2XN9C 4FYDA 1YNND 4XIGS 3NVVA 5K5PA 3HGBA 4MT5A 1Z47A 4A55A 1LO5D 4RWSC 3BVMA 2J7ZA 2F0OA 1STGA 2RSNA 1E0BA 3CHBD 1D1IA 1QILA 1QNUA 5FOBB 1F9RA 3ERQA 4CJ2C 4CBVA 5IGCA 3GTQB 3S1NB 1PRTC 4KD4A 1H9KA 3D4DA 1EY0A 3ITPA 4LTUA 3FEWX 3ZJVA 3AEGB 1FXIA 1KFYB 2LMCA 1DONA 1T6BX 4MM3B 1AW7A 2V0GA 4KN7C 4PV1C 3PO0A 1OXUA 5BMIA 4PMCA 1F77A 1H9SA 1K8MA 3V96A 3GS2A 4HRSA 5EE0A 4EVOA 3AN1A 2RQXA 4J3OD 2D9UA 2L1BA 2K05A 2MJEA 4DXFA 3WDNA 4DK1A 2J0TD 1BCPF 1H9RA 4Q5VA 1MHXA 2M00A 1WWTA 1B4OA 1I6HB 2VZKB 2WV6D 3Q8FA 3H0GB 1TQOA 4A3EB 4G57A 1SNQA 2R3ZA 2VNUD 4C1NK 3R93A 1TS5A 5EPJA 1VF7A 4KY6A 3DEPA 1V43A 5DNFA 4WWMA 1ZXTA 5CV6A 1W6KA 1XCTL 2K1BA 3NQTA 1IGDA 3SFDB 1F2LA 3RFZB 2EDGA 2OHFA 1PFNA 1I3QB 4G4KA 5EE3A 3L4PA 3ND9A 1ML0D 1AYFA 1D4BA 3I4NB 1I4XA 2OF1A 4XYQA 4FXCA 3PMFA 3V3XA 2F0WA 4BY7B 2V3PA 1Z6HA 1BUVT 1S5ED 1QE6A 2MJ3A 2EXZA 4OO1I 3FC4A 4B0EA 3K0YA 2D2CC 1HPCA 5LNK1 2RDFA 1NYRA 1RTOA 3TZUA 2AQ1B 1B9NA 1R4PB 4L2YA 3VRAB 1SIJA 3NPPA 2PTLA 4AS1A 2XNAC 1ILQA 4XTCS 1O80A 3FPPA 5K36G 5EKLA 4TKOB 4ITKA 3S1QB 4N9TA 1K8OA 5C0XJ 2K0PA 1R4QB 4G7HC 2EZVA 1N61A 3Q69A 2EY1A 1U4PA 3F2UA 2KOLA 2WXPA 4GDLB 5HGTA 3URYA 1EY9A 3PUVA 2EYOA 1DJRD 1E7PB 1X3PA 3AMZA 1KTKA 4DAVA 3LWEA 1AZPA 1HHVA 2IGHA 1Y8PB 5A35A 1A70A 2OEDA 2NTSA 1XF5L 1D6EC 2EJGC 1OXVA 2N88A 2H89B 5CV8A 4YSZB 3AU7A 4C3JB 5ISRA 4L63B 2N9KA 2M0AA 4A3IB 2I2YA 3KUPA 3HOZB 4LLGM 2FE8A 1NYQA 3NZ3A 4ZKBB 3J7AF 3K59A 2B76B 5E4XA 1Q1BA 1X3QA 2RPVA 1HQRD 4RHSA 3SK8A 2TMPA 3A54A 2Y5PA 2K6AA 1TS3A 4XQQA 1L4ZB 2J4XA 1PTOB 4RGOS 2WB1B 2IGDA 5BN4A 2HTME 1XLQA 1K51A 2F0JA 1HEZE 4TMAB 1RKNA 1SE2A 1BXTA 2F0PA 1YJJA 4OO1G 5IGBA 1ZE3D 4YWGG 4FNFA 3KBXA 4IDIA 2L52A 5HURA 2K9XA 1PTOH 2ZXPA 1LTTD 5D3IB 3RLFA 5D3DA 2WXFA 1WTVA 5BN5A 2F0TA 1PFBA 1QCBD 1GPXA 2WXLA 1RD9D 1MPEA 1V8QA 4ZK9B 2MHVA 3J80E 4HN7A 1QF6A 1LTID 1O7LA 2R61A 3BDLA 3OPOA 4H13C 3QG1A 5CV4A 3E9SA 2KWDA 2G9HD 1QT9A 5G3LF 2NBFA 5IIFA 1E2WA 2LEKA 2R93B 1ZYRD 2AWOA 1S5FD 1A2UA 1TWAB 2BBCA 2F0VA 3IXSA 1IBXA 2BS3B 1TY2A 1QJOA 1ZEQX 4X3SA 3MHZA 2E76C 5JVH3 4NAWB 1S5CD 2F1MA 4EGVA 1GJXA 4FP5D 3VR8B 1V1OA 2F0GA 1JWSD 4NAMA 1JQ4A 2EY5A 2QIEB 5BMHA 3MJ5A 1K50A 1SYEA 3HUIA 1AEXA 5HFYA 1T5XD 1ILPA 1VMPA 3KF8A 1PZKD 3MC0B 1TKWB 3A7AB 3U9SA 2CW0D 3L9AX 4HEDA 2R6GA 1FRRA 3NE5B 1RYJA 4IFDJ 1ESFA 1FFVA 2WXOA 2QCPX 2WU5B 3GTLB 3AE1B 4C7ZA 2KN4A 2K3UA 4K6LA 4ULLA 5EQ0A 1IL8A 4KGRA 2B63B 2DN8A 2GRIA 2J53A 1LABA 1XEEA 1TWCB 1ZYRC 2B2UA 3BWUD 3HVZA 5JPNC 1WTXA 3V2TA 3NRZA 4L1BA 3NTKA 3HOXB 2QEJC 5AUKA 4PT5A 1UGJA 3TN2A 3C46A 1RCVD 1FNWA 4IUQA 1TWGB 4ZUJA 3W5UB 1PYWD 3G7LA 3U9OA 1A3TA 1HQMC 4A3DB 5CORA 2LUMA 4E6IA 1GUNA 3P1HA 2ZXOA 2N7JA 2PW7A 3X3NA 2PYKA 2V3NA 4KGSA 1JORA 1QB5D 1VMCA 2FJ2A 4C3IG 1J7BA 2PNRC 3M4OB 2B2TC 2M2LA 1DM0B 1UNSA 1NR2A 5NUCA 4TRDA 1QQRA 3S1RB 1CFMA 5DEHA 2N9LA 3S2DB 4KKIA 2B2WC 3D4RA 1ROEA 5EKIA 3TP5A 5EPKA 1WD0A 5KRUA 2SNSA 4DGZA 5IGGA 4J1MA 1ZPSA 5M5XB 2EYHA 2PZUA 3NTHA 1BCPB 2BOSA 1K53A 2INPE 3BIID 1EEID 5G5HA 3QIAA 5EJWA 1RHPA 1STBA 3I90A 4ME5A 4O42A 2JEBI 1Q90A 5C44B 1FMAD 1MGSA 4NDXA 2Y0SB 2RDGA 3BVZA 4HAEA 1J9OA 1STYA 1EYDA 5ELFA 3S15B 1GB4A 3S2HB