3BVMA

Manipulating the coupled folding and binding process drives affinity maturation in a protein-protein complex
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
235
structure length
226
Chain Sequence
ESQPDPMPDDLHKSSEFTGTMGNMKYLYDDHYVSATKVKSVDKFLAHDLIYNISDKKLKNYDKVKTELLNEDLAKKYKDEVVDVYGSNYYVNCYFGKTCMYGGITKHEGNHFDNGNLQNVLVRVYENKRNTISFEVQTDKKSVTAQELDIKARNFLINKKNLYEFNSSPYETGYIKFIENNGNTFWYDMMPAPGDKFDQSKYLMMYNDNKTVDSKSVKIEVHLTTK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Manipulating the coupled folding and binding process drives affinity maturation in a protein-protein complex
rcsb
source organism Staphylococcus aureus
molecule tags Toxin
molecule keywords Enterotoxin type C-3
total genus 62
structure length 226
sequence length 235
ec nomenclature
pdb deposition date 2008-01-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01123 Stap_Strp_toxin Staphylococcal/Streptococcal toxin, OB-fold domain
A PF02876 Stap_Strp_tox_C Staphylococcal/Streptococcal toxin, beta-grasp domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.110 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 3bvmA02
3.10.20.120 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 3bvmA01
3OWEB 2SEBD 2AQ2B 1JCKB 3BVGA 1JQYD 4RFBA 2QILA 1L0YB 1PZJD 2Z8LA 1S5DD 1CHPD 4DXGA 1YN4A 2RDGA 1HXYD 5TSSA 3KLSX 1KLUD 1LTID 1B1ZA 3CHBD 5ELFA 1BCPB 1SE3A 5ELBA 3DWQA 1LTGD 1PZID 1QILA 1ET9A 1ET6A 2XNAC 1MD2D 5ELEA 4RCOA 3BYYB 3R2IA 1AW7A 1D5XC 1I4XA 1SXTA 1HTLD 1PRTB 3GP7A 1LTTD 4RGOS 2QEJC 2XN9C 1G8ZD 5ELCA 1XTCD 1XXGA 1S5CD 1DYQA 1F77A 1S5ED 1STEA 1V1PB 1B44D 1FNVA 3V05A 1YN3A 1AN8A 1PRTC 1LT3D 1PTOH 5FK9C 4NZLB 1I4RA 1LLRD 2J4XA 1I4HA 1EFID 4DXFA 1EWCA 1V1PA 1GOZA 1UUPA 4L6TB 1PTOB 1EU3A 1CT1D 4ZYSA 1SJHD 3BVZA 1LO5D 1LT4D 3TSSA 1PTOF 1DJRD 1FD7D 1D5MC 1RDPD 3R8BA 1D6EC 1HQRD 4BWGB 3BZDB 4Z9CB 1KTKA 3W2DA 1PTOC 1TY0A 2AQ1B 1I4PA 5FKAC 2WV6D 4C56C 1V1OA 1BXTA 1CHQD 1S5BD 1RCVD 1KLGD 1HA5A 4RGTA 1I4GA 1D5ZC 1S5FD 4L63B 1FNUA 1PRTD 1SEBD 1TS2A 2XRSD 2IJ0A 5I4DA 1ENFA 1FNWA 4RGMA 2NTSA 1I4QA 2TSSA 1EEID 3EA6A 4RHRA 2G9HD 2O2LD 1BCPF 1EEFD 2NTTA 1TS4A 4TSSA 3DWPA 1RF2D 1RD9D 1UNSA 2R61A 3BYTB 1LTAD 1TY2A 1PYWD 1PZKD 1SE2A 3O13A 2CHBD 1TS5A 4K6LA 4UDUC 2ICIA 1CK1A 3MFGA 3SEBA 1M4VA 3MC0B 3EFXD 1T5XD 1SBBB 2RDHA 1LTSD 2XRQD 2AQ3B 4OHJA 1JWSD 5D3DA 1ESFA 3R2TA 1EU4A 4RGNA 1YN5A 3BVMA 3URYA 1BCPC 1LTRD 5ELDA 1JR0D 4O1NA 1PTOD 1BCPD 3DWAA 1LT6D 1LTBD 1TS3A 1SJED 1PRTF 1JWUD 4RHSA 1CQVA 1JWMD 1FGBD 1LT5D 4RH6A 1L0XB 5D3IB 2IPKD 1SE4A
chains in the Genus database with same CATH superfamily
2PNRC 3RZDB 1JCKB 2JP1A 2K22A 4F8MA 1R4NI 1E1OA 2A73B 3QIJA 2OT2A 4XWWA 1BT0A 4BKTA 4YSZB 1VF7A 1QOAA 2QIEB 3KF6A 2QEXA 1GUOA 4WIPA 1FIQA 4RNAA 1VQPA 3KOJA 4YTNB 3KWLA 3NBHB 3L16A 3GTQB 3JAMi 2V3SA 2YTVA 2K03A 1BDOA 2R2OA 4OIJA 5EAYA 4FXCA 1JOKA 3AQQA 2UXDQ 2PVGC 1HZBA 2RCFA 1PQSA 4AQYL 5AFWA 4JI8Q 2PMVA 2JJQA 1J8CA 4RGOS 2UU9Q 2DHZA 4QJFA 1D7QA 3BZCA 1TWHH 5CORA 3D8GA 1L6UA 4IM0A 4JI2L 2IY1B 1TU2B 1DM0B 1V1PB 5I2YA 4LF4Q 3M4YA 1WMHB 1FNVA 1T0RC 1TKEA 3HOUG 2JA6H 4FHJA 2V4DA 5LMNQ 2JRHA 1T9HA 4BOSC 4FADA 5CBEE 1HNWQ 2QJLA 1E7PB 3Q6SA 5AJ3Q 3F2BA 2R7DA 3D4DA 3AU5A 5EE0A 4W9GA 2BS4B 1EU3A 1YNTE 2IY0B 2MBOA 4US9A 4EFOA 5IP7G 3T1YL 1NY4A 1PTOF 4KN7C 3T56B 3U9SA 1PYBA 2SDFA 3TS0A 3IXSA 4NP5A 1LTLA 2KVMA 5E4WC 3IL8A 2ATWA 3B2GA 3PLUA 3TS2A 1Q8KA 2ZXOA 2MJDA 4JI0L 1I4PA 1EY8A 1VQKA 1J7AA 5C3EH 4ZUJA 1IYUA 1VQCA 1CHQD 1TIFA 1IL8A 2LHEA 2Z1CA 2GBJA 1C4QA 4BBSH 1QOGA 4XZ4A 1K83B 3J81E 1E7VA 5E6PA 5M3FG 1VQJA 4ZOHC 3CD6A 3HIZA 3BK1A 1H9SB 1KIXA 5DCNA 5G5HA 2AL3A 4WWNA 2QW7A 4NAWB 2KJXA 4DV3Q 1WVLA 2F0SA 1J5EQ 2A69D 3H3VC 4B6WA 1R4MI 3GV6A 1K8RB 2A1AA 4Q2JA 3RMKC 4C80A 1SSOA 2YV5A 1WR6E 3ULPA 4K8IA 3PTFC 1WGYA 2YLMA 3RFZB 1A3UA 4IUNA 1C76A 1OTRB 3ML8A 3M3JA 1A0IA 1IHZA 1LV9A 1ASZA 1E9MA 3HVZA 1CA5A 2XSCA 2K33A 2KFJA 2WXNA 1C4CA 3W1SA 2A68D 2ICIA 4JL9A 4M0WA 2WAQG 1NBWA 2GA4B 1QB5D 4C3HB 3OAWA 2BDOA 3W1YA 2KT7A 2AKWB 1FD6A 2KK8A 2LJ5A 4K8JA 1YNJC 3SR1A 2MX2A 3LXFA 2RDHA 4QB4A 1Q82C 3HOXH 4N59A 5FJ8G 3OPOA 3PRPB 3MXNA 3H9DA 4GN3B 1BO0A 2IO2B 3OYYA 1BCPC 2K75A 2JX5A 3B08A 4DDGD 3AMZA 2C7MB 4O1NA 3TZDA 3PO3G 2WXIA 2D2QA 4M8MA 1G2TA 4A8XC 2ONQA 3ERSX 2IO0B 3IBEA 1WTWA 5LMUL 2K50A 3S14H 1Q3LA 4UP7A 1TJEA 4LTUA 5BR8L 2VH2A 4C2MB 1YN4A 2DZIA 5EKLA 2AUJD 4KJNA 4OELB 3BY4B 3RN2A 4KHPL 1QWYA 2XVSA 3VYRA 3W1BA 1GAQB 1XNQQ 1S1QB 3AE1B 4N8X1 4II3B 4OZBA 4ZDVA 3J80c 2E6XA 4KKSA 3CC2A 5J2RA 1HR0L 2D11A 1DONA 1QF6A 4HSPA 1FXAA 3AU7A 1B2TA 1I50B 5A2QE 1PFNA 2D3BA 2L0FA 2XNAC 3J81L 2XEWA 3A9KA 3CSTA 4PYUA 5J22A 3OW2A 3ND9A 5M9OA 2V4LA 2IBIB 2J0MA 3R66C 1RODA 3F8TA 5KHOA 5KIXA 1Q1EA 1WE7A 2BYVE 1VQ4A 2JU6X 3QK0A 4XWTA 1STGA 4IOIE 1B8AA 3SD5A 3N1YC 4W9LA 3N1XC 1NEKB 3KBXA 4A3FB 1PTOH 4RF1A 5BN5A 3W1SC 2LGDA 2J4XA 4IO9A 1HNWL 4TQUS 2D5GA 4JLCA 4APVA 5EGTA 2N9LA 4K5WA 5CR3A 2KQSA 3KYDD 3Q3NC 4L6TB 1BVSA 3L3OC 2BE5D 2KACA 3I3CA 5KNDA 3L08A 4XTCS 1KFYB 1SE9A 1TZOA 2WXJA 4LFBL 5D94A 4YCUA 3RN5A 3BU2A 1YIJA 3DBHI 4NY0A 4ANWA 5H1SE 2LRUA 2MNAA 2VY3A 1KTKA 2K1BA 2PI2A 4IUTA 5FO8B 4A3DB 4DNRB 3DDCB 5M5WH 5DM73 3IVFA 2IGGA 4ZYNA 3ZRCA 4LAAA 4C56C 2PVOD 3HKZB 2L5TA 5JAVA 1S5BD 1BUIC 3DM3A 2ZJPA 2KCNA 2A8VA 3RNCC 4RF0A 2KYWA 5IT9L 2K39A 2G4SA 1N60A 3OLMD 2JA7H 4HJ8A 2B63B 3S1QB 3VFKA 4ACFA 4LFAQ 4KN4C 2HUGA 2YEPB 2V3PA 1PHJA 5C3WA 3GQBA 3NP8A 1OXSC 1Q12A 2D10A 2O2LD 1BCPF 2NZHA 4R3DA 2PE6B 4A3CG 1G6JA 2N55A 4EGVA 5CBAE 4ZHPA 3EIVA 1OFFA 4B08A 5JJIA 1YEZA 4B95A 2PEAA 1D1KA 4A3LG 4KSLC 4R4CA 1EQQA 2J53A 2VZAA 1RTOA 2L0CA 4ICUA 2ZM6L 4BFRA 4PMCA 3L0OA 1IZ6A 4M0WB 2E2IH 4KY5A 5BN3A 1PH6A 4B3TL 2Y0SE 2KWVB 5J39A 3MFGA 3SEBA 2F0TA 3KYHC 1YOVB 1SROA 2KXJA 3ZJTA 1WYWB 4A3DH 2C35B 4IM2A 4JI8L 2WKCA 4A3BB 2NPTB 2PE9A 2JZ3B 3WAPA 2V9HA 3HOXG 3UINB 3R2TA 2CVRA 2WB1E 1R4QB 1SNPA 3TL5A 3DVGY 1EY0A 2JEBI 4I6PA 3ZTDA 4JI2Q 5M3FB 4YT0B 2JSOA 3DHQA 5NUCA 1WX9A 2JEAI 2BPSA 4Y52H 3F2UA 4KGRA 2HCCA 1PFSA 3F2CA 2KUMA 1KF6B 3CCJA 2IPKD 4OONA 2IGHA 4XC2A 5JPMC 4RM8A 2K5QA 2MFIA 1S5DD 2K4KA 5EPKA 4TV3A 1XCTL 2RDGA 4MM3B 1A62A 2NBVB 4UHVA 3HP3A 1EWIA 4P72A 1MKHA 1IKMA 1II3A 2B8FA 1WTQA 2X6LA 4OZAA 2WB1B 4FLHA 3TQYA 3ALBA 1BCPB 4FXDA 1YJNA 2F0VA 3Q23A 3N3KB 2E8GA 2Z4IA 1E6EB 4ZRQA 4DAYB 5IN7A 3EN2A 1ET9A 2KCMA 4EOYA 1A8VA 4JOIC 4CKCA 2Y0SB 2NCNA 5C44B 1ZOYB 5LXHA 2R92B 1Q81C 3DBHB 2ENBA 3RLFA 1YX6B 3FPUB 2Q8IB 3TBIB 2YU9H 2QF7A 2MJ8A 5C3EG 2NVXB 1VLBA 2J0JA 3VR8B 3NELA 1B9RA 3QHTA 2B76B 4CYEA 1W2BA 1XQQA 2MP2A 4DV3L 1K8OA 1NBFC 1BQQT 5C4XH 4DV6L 1ZKHA 4AUQC 4WJOA 1V9PA 1VS0A 1N34Q 1I4HA 3VXWA 4A75A 1NYRA 3CMMB 2BW2A 1V2YA 1VZ7A 3ABVB 2B2YC 3JW0X 4DV6Q 1QUQA 3J7ZC 1FEHA 1LO5D 2WDQB 2J42A 2K5NA 4YL8A 2V4IB 5H92C 1NNXA 3E0EA 1NUCA 3R8BA 3BDLA 4BWGB 4N8FA 2JRIB 2W3RA 1TT2A 1TWFB 3RLOA 4FF2A 2ZPYA 1ZKOA 5CHWA 4HJAA 4A3FG 2Y0SG 2SOBA 1GB4A 3U4VA 4JQWC 2ASBA 1HA6A 3SR6A 2AWOA 4C3JB 4FP5D 4ZRKA 5EKIA 4LK0M 3AECB 4KIKA 5M5XH 5AZFA 4ANXA 2NZ1D 3TEXA 1R4MB 3C46A 3A54A 2JA7B 1ZDVA 3L10B 4KSKC 1CI3M 4A3JH 2KVZA 4BBSB 1KXLA 3RNGC 2WX1A 4MSMB 3JC66 1EEID 2UXBL 5BR8Q 1YI2A 3DVNV 4JI3Q 1V5OA 2NBUA 4I6NB 4AJYB 4GNXB 3WDNA 1N63A 2O6VD 1VQHA 4HDOA 2B8GA 3M4OB 2SNMA 2N9XA 1KAAA 1WXAA 5E1FA 3GOEA 3M95A 1JE4A 4FXKC 4DU9A 1XMQL 2CW0C 3VR3A 2B3AA 2CHXA 3AMUA 4ZUIA 5A2QL 2EZVA 1HH2P 4DUZL 3QA8A 1NVID 3KBGA 2DYMA 2O2VB 3RLNA 2WXOA 3BZKA 1JROA 3S17B 2A5UA 2INNE 2LFIA 4PK1A 3HOWG 3ULLA 2GBNA 4BKGA 2K14A 3P7JA 1ZDXA 1GUTA 1U4MA 1JMLA 1JMCA 1F2YA 1FCCC 4LNIA 4F7XA 3AEBB 1WJNA 4ZRZA 4UPAA 5K36H 1MVKA 1H9RA 2GBRA 2LGSA 2UWQA 2XK5B 1TS3A 1F2LA 4DV0L 3PVLA 3MA2B 2KLGA 3HOWH 2Y5BB 1HTQA 3S1RB 1SGHA 1U9RA 2WKDA 1T6BX 2IHFA 4FJVB 1JB3A 2PMZE 4IOAA 1FFUA 1HTOA 4EQNA 1HEZE 2IW3A 3S14B 1SIFA 1KLUD 1W6KA 2B2TA 1PUTA 4EX5A 2ZXPA 5C3JB 3HKZE 3KQ4A 5D6JB 2WU5B 1V80A 2OEOA 3B2FA 2WXRA 2AL6A 3HVDA 4FHKA 4KD4A 4A3MH 1A2UA 1VMCA 2G45B 2N1VA 3HHMA 5IYDG 3BS1A 4DR2L 3CW2C 1PRTB 3J7AV 1UE1A 1U4PA 1PH8A 2WDRB 4TUUA 2R93H 2C5LC 4J8QA 3FPPA 4XQNA 3PUYA 3AEFB 3Q3FA 4A3PA 5FR3A 4WWPA 2KWDA 3NQTA 3K81C 3NY5A 2CFMA 1B44D 2B2WC 4DR7Q 2NVQB 3CKIB 2A5HA 4OWTB 1EY7A 4NZLB 2FE8A 1NDDA 2AWTA 1I4RA 3OHXC 3I3TB 2I1KA 2VQEQ 4M01A 5E6NA 3GB1A 4WWOA 4C3HH 1UUPA 1EFWA 1H9KA 1PTOB 2KAJA 2R92G 3RNAC 3HOWB 5BYQA 1FJGL 4XQQA 4DR4L 2Z0SA 1DJRD 2KDEB 2L76A 2X69A 3FKIG 4C7ZA 3UIPB 3K8AA 2VNUD 2Y5PA 1E2ZA 3ZJVA 4IJHA 1P7EA 1E24A 1O7ZA 5DEHA 2BGFA 3PLVA 2K7VA 2WAQE 1EY4A 2WV6D 2CWPA 3QC8B 3DLLA 3U2SC 1HZCA 1UE6A 4FF4A 1PFBA 3I4NB 2MP1A 2R93G 2C9WB 3QOJA 2K0PA 2MHVA 2JE6I 2K8HA 1RYJA 1B9MA 3TZUA 1Y8PB 3NHEB 2REXA 1TS2A 4O2DA 4BY7H 1SNDA 4I65A 4HCPB 4UP8A 4BBNC 1ILQA 4OO1G 2Q2TA 1A3VA 5JJZA 3J81c 1NJIC 1X6OA 1VQLA 4WJ3M 4MEMA 5JJLA 3I4MH 1X65A 4EZJA 3VA7A 1TVXA 1Q90A 4AP4C 2NS5A 4C3JG 2KFKA 4WJNA 4GOPB 3HOYH 2MHJA 4HR7B 3P4RB 3JSVB 1LTAD 1Z2MA 4H02A 1TS5A 2PCFB 3GTLH 4DK3C 3OSOA 5FOBB 5IT9c 4DR6Q 2Q5WD 1TBEA 1TWCH 1I3QH 2R6GA 4BY1G 3CWIA 2B2VA 4G7OC 1HHVA 2DYOA 2ZW0A 1GKHA 3SDLC 4C00A 3PQIA 4OO1H 1MG8A 2VW9A 2F4IA 1JWSD 3Q8EA 3RNEC 1I94Q 2JZPA 1AZPA 1V97A 1EQVA 3G71A 2R7FA 1EOVA 1JALA 4LNQA 2GRIA 2LXAA 3FC4A 1WTPA 1I42A 2GB1A 2LGYA 3LB8C 5FLXc 5GADC 5EBDA 4DV1L 3UF8A 2AWNA 5FLXE 1HTPA 2BCOA 4P71A 1CQVA 1FGBD 5EE9A 4EQPA 2NMQA 2N7DA 5C0XJ 3L7ZC 3OWEB 1V9JA 2I46A 3PO3B 2Y5CA 1A15A 1MBYA 2FNJB 2QILA 3L13A 5CV8A 1A5RA 4BAXA 2KKCA 1RFAA 3M4QA 3H6NA 3EQLC 4KLKA 3HRZC 3KUDB 1GUAB 4NXNL 4DR1L 4EEWA 3A56A 1F2MA 1YBYA 2PO4A 4KDIC 4BA1I 1QZGA 2NR2A 2JWUA 4NQLB 5EE1A 3T16A 1H95A 1ZE3D 3AE4B 1LTGD 1MSHA 2A6HC 2QKIC 1ZXIA 2RBMA 1ET6A 2HDLA 3ZXRA 3GD7A 1HFNA 2QDBA 1QNUA 5CC4A 1NE3A 4JBMA 1WM3A 2KWCA 2LGXA 2B2WA 1EZ8A 4G57A 4DWFA 2LMCB 1S40A 1HZ5A 2BA1A 3I4NG 4KTAA 3APDA 3ZNHB 1U4LA 5C44H 4DGZA 3HK0A 4KVGB 4JVZA 5FK9C 3AULA 3R93A 3RUIB 1DOXA 2F1MA 5IYDH 1IUEA 2W3SA 2VQEL 1B9NA 4A3MG 3I90A 4NXML 1WX7A 3BG3A 5C4XB 3P75A 1I7HA 1TR5A 4NAMA 2L32A 2B2UC 5ISRA 1KAWA 3C8YA 3I57A 4F1SA 4A3BH 2N7EA 2WXPA 1Y1VG 2KX0A 4X62Q 1PDXA 2IGDA 4WAAA 2VL6A 4IWPA 3S2HH 5I9OA 3TJPA 3PRMB 5BO4B 3HM3A 2NVQH 1VQFA 5G2NA 2AQ1B 2PQEA 4GOPC 4AH6A 4A9AA 3S15B 1UD7A 4QIWE 4DV4Q 4DUZQ 1IBLQ 3T1HQ 2NVUI 4MGIE 2FXQA 5F2DA 5AJ3L 2HHHL 3ZIMA 2LRWA 2WDVB 3DMUA 3CC4A 1GC6A 4HPMB 4LK1C 3AI5A 4TRDA 4DR6L 2KLCA 2KECA 2O5IC 4W9KA 5M5XB 3FKIB 5DAUA 1FNWA 4HJ7A 3JAMc 2EY5A 2FCMA 1DGSA 2LSSA 1FM0D 4JI5L 4OX9Q 2K8CA 4LFCL 2LVPA 4JI0Q 2F0GA 3NTHA 4IPGA 5J18A 1STBA 2HD3A 3V2TA 2N49A 3HOYB 4OX9L 1Y69U 3VTVA 4D2KA 4B3RQ 2G9DA 2BWFA 3X23A 2F0UA 3GTLB 3NVVA 2YTYA 3AH7A 1WGRA 1KABA 4K7SA 3AE9B 1Y56A 2EXZA 2LZ6A 3HG9A 2OTJA 1WRDB 4QUFA 1XYIA 1VCBA 1WI0A 2RMMA 2KDFB 2BE5C 2EYPA 2F0FA 4OZCA 2EVBA 3TEWA 1QKZA 1LTSD 1S72A 1C4AA 1V81A 1TWGB 1XX8A 4OHJA 1E8ZA 2DZMA 2L00B 3LYYA 1DXMA 1YJIA 1ONLA 4RGNA 1EZ6A 1YIWA 4DV7Q 4X66Q 2EY6A 4A3IB 1UELA 3MJWA 1GPXA 4X65L 3R3MA 4NPNA 1U0LA 4H44C 1WGDA 2G1EA 1JWMD 2KEDA 2JXXA 4DV7L 1CKMA 3CIRB 3KW5B 1SE4A 3OG5A 2DUDA 4POFA 1JQYD 3VH3B 1TT5B 1WZ0A 3BINA 3UIOB 1QOHA 5M5YH 2KHIA 1E0ZA 4PYZA 4H7BA 1HZ9A 2K6AA 2Q2HA 1WTRA 2CS4A 2I2YA 5HY6A 2RDBC 3WIMA 2OJWA 4LF7Q 3I63C 4WFN3 1WX8A 1WGKA 2OF1A 1FJGQ 4K6DA 4DR4Q 2KJRA 2C9OA 1U5KA 1IPGA 1YQBA 2PPHA 3S1MB 4ODGA 3NUCA 5E4XA 3H15A 1EIYB 4AOFA 1VDVA 3H0GG 3NENA 4J6HA 3H6MA 4HEA1 4XT1B 5IGEA 3GTOB 2M2LA 4MDKE 3CRKC 2K5HA 3UDIA 4X62L 2XN9C 3M4OH 2WS3B 3PZ8A 2O6VB 3C19A 2MW5A 1MFWA 2WACA 2OTLA 3J80E 1VQDA 3VR6A 2K32A 2F0HA 1YN3A 1LT3D 4OVUA 2NVTH 4EZKA 3GZNB 1WTHA 4ME3A 3W5OA 2LXKA 2O6VA 2KCTA 2UUAL 3K0XA 4M1UB 3BDCA 2BF8B 2V1YA 3S17H 2DLBA 2Z6KC 4ZYSA 1E90A 3H0GH 4X64Q 2HIVA 4N6EB 3HFZB 4NDXA 2EY2A 2B2VC 2WXHA 4A3GG 4AS1A 3H09A 3CCMA 3BZDB 3S2HB 1QOFA 1PGBA 2JWZA 1VRAB 4L23A 5G3LD 4B3MQ 1DD2A 4HK2A 2IX1A 5E3FA 3M3YB 3AB9A 4DV4L 1IBLL 2E5LL 1W6JA 3WWVA 4J1MA 1QLBB 1HA5A 3WAOA 1D4BA 4B3ML 1I4GA 1OEYJ 2EJMA 5FO9B 4LF9Q 3W3AA 1PRTD 5LLIA 1BOSA 5IA7A 4L2YA 4IQZA 3OTOQ 2UXCQ 2OQKA 5IYCH 2Z9HA 3ULJA 2JQRB 2E2JH 2A4ZA 3BDOA 3KUPA 4JI1L 2F4VL 2D2CC 4MN3A 3U4ZA 4WRDA 3F2DA 1OQYA 2HTME 4BZAA 3DWPA 5EQ0A 5J1ZA 5C0XI 2HTHA 4XXEA 2MWSB 3RI7C 2R3ZA 5IYBG 2UYZB 1B3QA 3S2AA 2EPBA 1B3AA 3IG3A 1KLVA 4KY6A 2D62A 1A6XA 4YY3L 3N1ZC 3QJZA 4V190 3K6OA 3DBRB 4GKKL 1P0RA 4KJOA 5JEAJ 1C9OA 4LFAL 2L55A 3J80i 3TRZA 1N61A 2EMSA 2VZKD 4MH0E 1GVPA 4R9WA 3EFXD 2K28A 3CF5A 1YNXA 2IO3B 2DAJA 3ONAB 1NYQA 3PCOB 5IYCG 4XDXA 4LF4L 2KQ3A 2Z6BA 2SAKA 4JW0A 3TP6A 1OQQA 2INCC 1C3TA 2H4OA 4X65Q 1XCQL 3K7AH 4F87A 3DEPA 4MM3A 3ZRFA 3QOLA 1K50A 4ARIA 2W82A 4JE3B 3UDFA 3OOCA 3MXPA 2W54A 2NZOA 4X57B 4RKLA 5DPSA 5HGTA 5FLXL 2H89B 2Z8LA 3X0WA 1NTGA 4MNOA 5JJKA 5E6OA 1XF5L 3NVWA 2BOSA 1P3QU 2FUG1 3NTKA 5KYIA 3DCGA 4G0NB 3V3XA 3KLSA 5IGCA 3M7NA 4R4QA 5M3MG 3GTPH 3X3MA 1OGWA 3I55A 3AM9A 1Q46A 3M4PA 1IBMQ 1FRDA 3QB3A 1K8GA 2JVCA 1WCMG 5ELEA 3BYYB 4MZ9A 4A3BG 2N7JA 1EY6A 1SXTA 1AFPA 4LNOA 5J3BA 1TWFH 2EYMA 3I4MB 3GTOH 2QEJC 4DR5Q 4IURA 2L7RA 1F0ZA 1UZXB 2ASQA 1I94L 4FULA 1L1OC 5IOCA 4YWGG 5E6JA 2BS2B 3VRAB 1LABA 2KN5A 4AWJA 4O42A 3MHBA 1SYCA 4RAUC 4DV5Q 4BBRH 3RT3B 4LNNA 3I8ZA 3PIO3 2RA4A 4HKZE 4K14A 4GKJQ 2L52A 1I3QB 1GOZA 5CHVC 3VR5A 4BBNF 2IWHA 2Z0DB 4FJZA 1R4PB 4JI5Q 2CH4W 1EYAA 3HOZG 2QDFA 1STAA 4ALPA 3S1NH 4XYQA 5HURA 2DNCA 3GTJH 5JVH3 4WH4A 2N9EB 5M5WB 1KRSA 2E75C 1WCMB 4JI1Q 2F4VQ 1OTCA 4OWWB 2JA8H 2RDFA 2NUCA 4LJZC 1ZYRC 1VQEA 2PPBC 4L8JA 4DR3L 3PO3H 2I5LX 2CJNA 2HJ1A 5LMNL 1CMXB 4L63B 1PH1A 1BMLC 1V8CA 4YWLA 2K25A 2WLBA 2WXKA 1UBIA 5JXVA 3AB5A 1Z7TA 4AYBB 1STHA 4B3SQ 3I70A 1CZGA 1FVIA 1KQSA 2CCZA 1XPUA 3AE2B 1QT9A 3S1RH 2XWBB 2BA0A 1SN8A 1Y8OB 1TS4A 1MJEA 1KDAA 2N1WA 4EKUA 4UY8C 5HFYA 5GROA 4U68A 1WGHA 3J7A5 3B1LX 1XWEA 3BYTB 3KLWA 1WSPA 1UWMA 5C0XG 1PZKD 3NK9A 3PHXB 2NVTB 3QWZB 4MGKE 3ZTCA 2K52A 3PSIA 4YY3Q 1FGUA 4IJLA 2J7QB 4A3MB 2B63G 2GMIC 3EBEA 2RKSA 1SSNA 3FILB 4NPSA 2KBNA 5M3MB 1WOCA 1HFGA 3GTJB 2DN8A 2PW5A 1IW7D 1V1QA 4LNFA 5EPLA 3S24A 1U4RA 1PFMA 2Q2IA 3NXWA 1WXVA 1W3SA 4I6LB 4IG7B 1AYFA 1SMXA 2RSOA 2I0QA 1SR3A 3H94A 4BBSG 2NN6G 1JJ2A 4DHZB 2KCCA 2ZNVC 5C5MA 4MTKA 4PZ6A 4CDDC 3DBLB 4L5SA 3E9SA 4MGZE 3CF6E 2I5MX 4RFBA 1J5EL 2JA5G 1L0YB 1Z6HA 1UWXA 2CJOA 2M56B 3R7QA 1WZ3A 1N62A 4KV2A 3FP9A 4OVVA 3AE5B 4TQ0A 1YNND 4KKJA 4U673 4BXXH 5AUIA 3KDFB 1VQGA 4WORA 4ZKCB 1R7SA 5ELBA 4IUPA 1E22A 1HPCA 4BY7G 2LVOA 3STBC 1YHAA 3HS0C 3KDFA 3HKZG 2WGSA 3KVFB 3L2PA 1AW7A 2BWES 4LJOB 1HNZL 4KD3A 3H3VH 4PMWA 3H7SA 1RIPA 2EY1A 4CDEC 3OJ3A 3A8JE 1O7YA 2F0KA 5ELCA 1XTCD 4NJCA 3VH4B 1GUWA 1S5ED 1NSNS 1STEA 1NR4A 2N78A 1AN8A 2W55A 4NQKE 3GTPB 4JI6L 4KHPQ 4OGQC 4BBRB 4QIWB 3RZOH 1C9FA 1E7ZA 2UXCL 2MJEA 4A3FH 2E2DC 3CCUA 4L5RC 4KIKB 1A63A 3OMCA 2WDTB 5JVG3 3PREA 2B2TC 4JBWA 3C1EA 3VVWB 2F03A 2BKFA 1D5MC 4B3SL 3RNFC 5LNK1 2VQFL 1WMHA 5CV4A 3IAYA 4URKA 1QG7A 4F8CB 3SK4A 1STNA 1DCZA 1H4RA 1PDQA 4GNXA 1QVGA 3A7AB 4GS3A 1DOMA 1U4AA 4GB9A 2QMTA 2MSED 3K7UC 1SFOH 3PS6A 2NYZD 1WD0A 3SGIA 3F1ZA 1X32A 2F0MA 4WURA 4A93B 1L2FA 3V6CB 2VUMH 2MGSA 4EQOA 4QCLA 1I6HB 2NTSA 1I4QA 1QZHA 3NVYA 3VYUA 3W1GA 2G9HD 4K2KA 2NTTA 3MZ5A 1ACCA 1O7IA 1ISNA 2OOBB 3IAS1 1J7BA 3RZOB 4DNTB 3LWEA 2L8JA 4BS9A 1A3TA 4C1NI 3GTQH 3RNBC 4K6LA 3T53B 1IKLA 4KMUC 5FLMG 5HHDG 3J7AF 2KMAA 2Y3AA 1ENCA 4NXMQ 1MHHE 2MBEA 2B29A 4LLGM 3ICEA 1M4VA 1GG3A 2Q8TA 4GLVB 3DHGC 3QX1A 3AFPA 4ZCKA 4DR1Q 4NXNQ 1OXXK 3MVVA 4CGYB 1Y8RC 2LFNA 2KD0A 1IGCA 1ZGUB 3ER0A 4W9FA 2I07B 4MH8A 2E5LQ 3ZO5B 3HOVG 1ZEQX 1SYDA 1ENAA 2PW7A 4G3XB 2L0TA 1D8LA 1WH3A 4RHSA 4DV5L 2DYBA 2WU2B 2WXFA 4W9IA 5D3IB 1K52A 4XDDA 2HHHQ 3E9IA 4A3EH 5IIFA 1WJ4A 3I72A 2FIFA 1GC7A 5CV7A 2N88A 3SE0A 2N4FA 2Z59B 4K5XA 4RA8A 3M85A 5C1ZA 4LF5Q 5I9PA 1QVFA 2L83A 4HROA 4MT5A 5IODA 3CMAA 3A55A 3VRBB 1B53A 4GKJL 1WXSA 2FIDA 3O65B 1T3QA 3KYCD 3Q2AC 4LFCQ 3DWQA 4CHKA 1PZID 4CDFC 1QQRA 4ARCA 2R7ZH 2YVCA 3SFEB 3V60A 5LMUQ 1NENB 1LYLA 1KRHA 4K81A 4ILWA 4RG1A 1KD1C 1V5TA 5L95C 3TP8A 2INPE 2RPVA 5IKCM 2PIAA 1P8LA 3TMEA 2F3VA 2V1CC 1TWAH 3EGRA 5HG2A 1C1YB 1JWAD 3S15H 2JA7G 2I38A 2OEDA 3ZXVA 4DPGA 2ZTCA 3CCQA 1YJWA 2CHZA 2WX0A 4FXGC 4IPHA 1PRTC 1WFYA 2IX3A 2VS1A 1GM5A 4N9PA 1F2RI 3AE7B 2MQHA 1IBXA 1XMQQ 2JF5A 4GXBA 4XDCA 4C1NK 3PV0A 3J81i 3PIP3 1GD7A 4ZHOA 2WB1G 3PHWB 2F0LA 4BXXG 3AE8B 4A3KG 1HUMA 2LJIA 3I56A 1AP0A 2Z4HA 2HQLA 1VQ7A 1VR9A 2NB0A 1PTOC 2Z6KA 4E6IA 3RCZA 1N32L 4KKUA 2B2YA 1UWVA 2ZJRA 2QSDA 5AZGA 3N52A 3I91A 1JB7A 3UE1A 2KNBA 4ANVA 4RMFA 1BNZA 1QE6A 1E8XA 2EYHA 3TP5A 1N34L 2D3GA 2JK8A 4EQ5A 4KY7A 5IGDA 1L5PA 2XRSD 3PRZA 1NI2A 1XEEA 2UUBL 3PZDA 3IFTA 2DJFC 4IALA 4HIKA 2FINB 3VUXA 3FDTA 3Q69A 3A9JA 3PV1A 2FBWB 3LGJA 3HRDD 4TKNA 1VZ8A 4JOIA 4W9JA 4OWXB 1K0SA 3Q6BA 3DBSA 1Y14B 1DZ1A 3C0RB 2KFKB 3FVQA 2K5DA 1X3QA 3D3RA 4DUYL 5IT9E 1TKYA 3AFQA 4GNXC 4G7ZC 4HJ5A 4P1BC 4LUVA 5C0XH 4R8IA 3K9PB 2WAQB 2CHWA 1CFMA 3I73A 4IZ8A 1Y1WG 5J17A 4KZ0A 5BN4A 1SMYC 4A93G 3MTSA 4RM9A 5ELOA 4R4IA 5IP9H 4A3JB 3G7LA 3EFUA 3N32A 3BIID 2PMZB 3P1HA 4KHZA 4P73A 3JAME 3SFDB 4ANUA 2A68C 5AZHA 3TUOA 1M1KC 1TIID 4HCNB 2VH1A 4RWSC 3MP9A 3ZDTA 2XRQD 2JYEA 5C3XA 3NBIA 4HMIA 1I50H 3KJOA 1YN5A 2BB5A 4DHZE 3URYA 1WRIA 3PMFA 3NTIA 2LEKA 3D31A 3JAML 5K5PA 2M1MA 2YEPF 1GHKA 3DQVA 4P16A 2G5DA 2DX5B 2KDMA 3STBD 1BCPD 2PJHA 1YD8U 3DBLI 3UI3A 5BMGA 2F0WA 3FRPB 4XE0A 5JHAA 4RH6A 4QMGA 3MHZA 3C2PA 5MPOA 4L5QA 1L2NA 2SEBD 2UXBQ 2MH7A 4M00A 1VQIA 4A55A 1LQBA 3DVNU 3CCRA 1B7YB 3MHSD 3VDZA 4CO7A 4A93H 2ZT9C 5TSSA 2HD5B 2AMCB 2F0QA 2IT1A 4M8AA 5C5LA 5C4HA 4OVZA 3SHQA 4WQOB 2K04A 4KX6B 2ZCBA 3VR9B 1IYFA 3CU7A 5GAEC 3KFUA 4X66L 4HPPA 5G3LF 1G51A 4FVMA 4IUUA 4JWUC 1XLOA 3M3YH 1S3OA 2PTLA 3OW7A 1SB3C 2OHFA 3PZ7A 4KV6A 3NOBA 2GLSA 4IFDG 1D5XC 3I2ZA 5IGBA 2ZZPB 4DBGA 3RR5A 2XK5A 4R1JA 4X3SA 3TREA 3DXJC 1BBUA 1LTTD 2KHSA 5EBCA 4LJPB 1E5WA 3N9YC 1UE5A 3TN2A 4DF7A 1FXIA 5C23A 3J7YW 1VQ8A 4JBJA 2CWAA 3M7GA 3FMCA 3K5LA 4QL5A 1XD3B 2KC2A 1DYQA 2N9PC 3MFYA 4FYDA 1N32Q 2L9HA 2JZZA 3KUZA 4K7UA 4CQNA 2MRPA 3N20C 3HGBA 2FHTA 1JC7A 4AQ7A 2RHQB 3P1MA 2LVQA 4YHHL 4BOZB 2IO1B 1E2VA 4LF9L 3TIXA 4DK1A 2LHDA 4JGHB 4YWKA 1MSGA 1OXUA 1SJHD 3T1YQ 1F2ZA 1F1HA 1Y1VH 1TWAB 2PZWA 5DNFA 4LF8Q 1EUJA 2EQSA 4Z9CB 1P9DU 2RCNA 4G7HC 3PF4A 2MO1A 1JOOA 1TY0A 2WYQA 1PV4A 1KRTA 1WTVA 4QGUA 2MLBA 4MJSB 4LF8L 1PH4A 3Q22A 3KF8A 1N33Q 1A70A 2K6QA 2MCNB 1AZQA 4YWMA 1G2SA 3A33B 3Q8DA 3GE8C 1WFQA 3V62A 1WM2A 3GS2A 2EKIA 1HNXQ 2EMTA 4ZRJA 3GE3C 2RR9A 2D0PA 4GLAC 3HUIA 2ZVNA 2RF4A 1VQAA 4WWMA 2SNSA 1DOIA 4RHRA 3Q3JA 5CV5A 4FNFA 1SYFA 3NSWA 5EPJA 4N9F4 3GV3A 3OIPA 4JBKA 3EUB2 4NKLA 1DOLA 5CV9A 2WXQA 3K7AB 3T8MA 1C0AA 1A2TA 1KHIA 3TP7A 2LUMA 4KZCA 1XMOL 4JG2A 2CR5A 4G11A 2EOTA 1FRRA 2HJ8A 1Q86C 4A3LH 4DA2A 1QNKA 3PUZA 4OXPA 5IP9G 3AEGB 3CPFA 1XTDA 4Q5VA 1RWSA 3CC7A 4XYOA 2VQFQ 3GTKH 3QQ8B 4DK0A 1D3ZA 1TWCB 3CXCA 2QA4A 2AQ3B 3J9CA 3U7DA 3Q8FA 4DV2Q 3PO2H 3BVMA 3MEFA 1L6VA 1YHQA 1PFDA 1JR0D 1WJJA 1GUGA 4OEMB 1YJ9A 4AJWA 3HOZB 4A6QA 3NWTA 3A9KB 4P1CC 3W9CB 3TBLD 3DOWA 4YCWA 3KLRA 2AQ2B 2F0EA 3VR4A 2XTIA 2ACZB 2MA9B 2OWOA 3KUCB 5FR6A 2N9KA 1TYGB 5FO7B 1VDZA 4EVOA 1G91A 4L5TA 4A3EB 1FR3A 4P75A 3T51B 5JEAG 1FXTB 3NWSA 2CKHB 2JSVX 1BR9A 5ELFA 1O80A 1SFOB 1CZWA 4ABNA 4FF1A 4WJQA 3T1HL 5CYUA 1E0BA 4QF4A 1N5XA 2E76C 2A74C 5I2XA 1JRUA 1YQ4B 1MD2D 5M3FH 4A3KH 3ZGZA 3I4MG 4K0KL 1MJDA 3APFA 1YITA 2M00A 1IYJB 4KHVA 3AEVA 3IRBA 5CX3A 2MO0A 2BT6A 2AUKA 3NPPA 1F2RC 4NNJB 2CQAA 4PZ7A 3H3VI 1G8ZD 3NS1A 4X6AH 4E3CA 4N58A 2CW0D 3UDXA 3PO2B 3X3NA 4G50A 4GZYC 1TQOA 4YSXB 4DAMA 2FUHB 1YQ3B 1EYDA 4R4OA 1LLRD 2EYJA 1RFKA 2WXLA 3W5UB 4IN3A 4HWIB 1XNRL 4LWCA 4NAWA 2E74C 1AH9A 2LKVA 3U4EG 3BVZA 5DLQE 1JW9D 1LUZA 1RRBA 4DKAC 4GLSC 1P1AA 4HEDA 2GVAA 1IXRA 4GGQA 4IFDJ 3CPWA 1PH9A 4HIDA 2F0JA 3W2DA 2LXJA 1NAPA 3BK2A 3PUVA 1UE7A 1WYDA 4LF6Q 2K5WA 3E9HA 1V1OA 4ITKA 1JT8A 2IYDB 2NVYB 1N33L 4GDLB 2K6DB 3RMHA 1KLGD 2JYTA 4ICVA 2ZTEA 4UAIA 5HGQA 1R9TH 2KTFA 3FKYA 3J81j 5HKHA 1KDCA 1FNUA 1F9SA 2WWZA 4YTPB 1ZPSA 4JI3L 1ENFA 4CBVA 4GIVA 2AYOB 5FJ8H 3A4SC 4XX5A 1WWTA 3K5NA 3RD2A 2BKRB 4EE2A 4RGMA 1K8MA 1PYSB 2JA9A 2WP8J 2BYFA 1L1OB 2GVBA 2PYKA 2ZTDA 4HPLB 4IUMB 2JQOA 2K5VA 1VCIA 3QO2A 1E8YA 3ECIA 1RHPA 1JICA 2ID0A 2K05A 2LY7A 2KO3A 4I7AA 1C79A 1AE3A 2ON8A 3D4WA 3WCQA 1LM0A 3P4PB 2L12A 3VTWA 1NR2A 1Y1WH 2LI5A 2DNFA 2F0OA 4B0MA 1J9OA 4REZA 1Z9FA 3ONSA 3O13A 3DUZA 2ZJQA 2CHBD 5EDSA 2ZVOA 1YNNC 4IWQA 1X3GA 4DR5L 1UGJA 1EYGA 2WXMA 4XIGS 1KJTA 4C4VB 2RQXA 3A7LA 4C3IH 3A74A 4PS3A 3VHTC 3L54A 3P42A 1CZPA 1HJPA 4YSYB 4C3JH 3NHHA 4DV2L 3ERQA 3E0JA 1GUNA 4LUOA 5K36G 1F9JA 1ZUD2 2M17A 3JSVA 1JRPA 4Y7NB 4HAEA 1WXQA 3A9JB 3NZSA 2IL8A 2KC1A 1EO6A 1LT6D 1LTBD 1MG4A 2PQAB 3K58A 4TMAB 1PA6A 1C48A 2UUCL 3MTNB 3NUHB 4DQOC 1SMYD 2DJGC 3SK8A 4HDQA 3RPFC 3GDEA 2BH8A 3SK5A 3HOYG 4B9WA 5IWAL 2GOWA 4ZKBB 3GTKB 5LXIB 1TWGH 4FBJB 1F9RA 1PVOA 1YMHE 1PGAA 1V6EA 1B1ZA 3CHBD 3KF6B 4ULLA 1JE5A 1HCZA 4A3IH 1RM6C 2C5CA 1X3EA 1UH6A 1GNUA 3B9JA 3N30A 2A6EC 1QILA 4ASWC 4GSWA 4LFBQ 4A4IA 1UAPA 2KENA 4RCOA 1K73C 2QGQA 1EIHA 4X3KA 3VR2A 3DWGC 2WINB 3GZNI 1QUQB 3GP7A 5JZEB 3T3OA 3T3NA 4ZQ3A 1FMAD 1I6VC 3CAMA 4C2MH 4BA2I 1D1IA 4B9XA 4A3GB 2LXCA 4ID6A 1KDBA 2K01A 1C7YA 1VQBA 3I4NH 1F77A 4HVBA 4NW2A 2G4DB 3NBHA 4WJWA 4MIUA 3BWUD 3ZNGC 1MI2A 1ZYRD 1QZEA 3TEHB 1X9NA 1UBQA 2RVLA 5IAAC 3WANA 4XT3B 2XWJB 1N6ZA 5GMVA 4LF7L 3Q8CA 1CQFA 4RCNA 2BYTA 3VDYA 4FJYA 2EJFC 2F52A 4M8NA 1AE2A 2Q2UA 1LT4D 1EYCA 3P63A 5KHQA 3AYHB 2EYLA 3FHWA 3HOZH 4E71A 2X8XX 3S1NB 3U8ZA 4LUZA 1HR0W 3LJ3A 4WQMA 4A3IG 4DXAB 1EF5A 3RNUA 4GN5A 2ZM6Q 4BBRG 2K9XA 3ND8A 2MPMA 1VQ5A 2KWUB 2RD0A 2PZTA 3PUXA 4GMVA 1YJJA 1L4ZB 2KN4A 4KDLB 2J7ZA 1CKOA 2Q8RE 5CGKA 1LM8B 3A5UA 3ETRA 1Q10A 1ZP0B 2R93B 1SEBD 2EDGA 2IJ0A 5I4DA 5KGUA 2BQQA 2FCSA 3SXHA 4HRSA 3IFWB 4X64L 3EA6A 2ICEC 2HQEA 1CSPA 3E3XA 1WCMH 5LL6X 4OW0A 2CU3A 3DEOA 3ZDMC 5DM63 4DHJD 3ZVVA 2YTXA 5BYSA 3CCLA 1UEBA 1C78A 1HNZQ 2MUYA 3VQIA 2B39A 4C3IG 2BS3B 4HN7A 4UDUC 1GJXA 2B63H 3S1QH 1J8IA 2J52A 4B0EA 1K3RA 5A35A 2CQOA 1BF4A 4OO1I 2JA5B 3M63B 5C2TB 3UQAA 1MJCA 1IGDA 4HJKA 2XIWA 1PH3A 1ASYA 3HOVB 3S2DH 2KTRA 2W9NA 4GN4B 3UI2A 1MIUA 2GBKA 4IDIA 1L0VB 3ZKJC 2VUMG 1ESFA 3AEEB 4KGTA 1BKBA 1QJOA 2R7ZB 2ALYB 1TTNA 3L9AX 1AEXA 3DM1A 3PO2G 1PRTF 2IY5B 1HNXL 1Y1VB 3PO0A 4GOCA 1H9JA 1MHXA 4POGA 3HEJA 4DV1Q 3CSFA 1XNRQ 2KANA 2KDBA 3K5OA 2NVXH 2V0GA 3VYSA 4TQ1A 1KM7A 4DK5A 3PIOA 2KZRA 1HXYD 4V0BA 5IGGA 3KLSX 1EWHA 4GU2A 3UE0A 4DR7L 3Q3MC 3VYTA 5IYBH 5KNCA 2EKEC 3AU4A 5D65A 1KC8C 1MI0A 4N9TA 4P74A 1FFVA 1Q8IA 4A3CH 1GUSA 1ROEA 2PLPA 4HJGE 1EIFA 2YYZA 2N8NA 1HE8A 1STYA 2HDMA 4K7WA 3AEAB 1L0WA 4A3KB 4GDKB 1T0YA 3ZJUA 1FL0A 4AYBE 2M9VA 2KOXA 1K8AC 3RZDH 4EUTA 5BMIA 1Q5WB 3I7FA 3GTGH 2N3SA 1UGMA 1PGXA 5CHFA 1Z5SB 1SRUA 2PKOA 4GDKA 2NN6I 2V3NA 1PH7A 5H8YE 4DAPA 1EQRA 4CJ0B 5D2MB 2BDNA 1VMPA 4CDCC 2FFKB 5C4JB 3CQZH 1V1PA 2XGTA 5EJWA 1WD1A 4KKTA 2L05A 2UXDL 1K9MC 4WJPA 3A4RA 1IBML 2BYEA 3U30A 2OXPA 3R7RA 4CKEA 1K53A 2DY7A 2JPHA 2HDEA 2YU9B 4MHEA 1XJVA 1CSQA 4LMQD 4P6VF 2N0SB 3PPAA 1TGZB 2I1JA 3DHHC 2RSUA 1TWHB 1X56A 4PS8A 1BXTA 3EROA 3K5MA 2VRRB 1RCVD 4PV1C 1RLFA 4BKSA 3H7PA 3CCSA 3HKSA 3Q8AA 3ZUNA 1N36L 3K80C 2JY6A 3QARA 4UP9A 1D5ZC 1JJCB 5EKKA 1E2WA 1G6ZA 1BBWA 2EYFA 2E2IB 3T4AC 2K8BA 3H7PB 1YHBA 1R9TB 3MC9A 1N36Q 5M3MH 2QDLA 5DPTA 4NJ6A 3E5SA 2KA7A 5JOBA 1VQMA 4W9DA 1LXDA 4IFDH 4IPCA 4CHTB 1L4DB 1WY8A 5HI1A 1WE6A 3U52E 2O5JC 2VB2X 1JOQA 2KHWB 2E3TA 1SF0A 3VA5A 1H9SA 4FF3A 3K9OB 1WGGA 1YJ1A 2MBQA 1JORA 2F0IA 1F52A 2KEEA 4S0RA 4W9HA 1JQ4A 5G55A 3R3OA 3ZW3A 5I6WA 1G291 3D0FA 3S16H 1JWBD 1SE2A 3C1FA 2TMPA 2FMMA 1M8AA 1EL0A 2C7HA 2KX3A 3MAQA 4GDLA 2FMCA 3ZQ4A 1QCBD 1OO9B 3I4OA 1VQOA 1OXTA 2D0OA 3CCEA 1C77A 4IM3A 3H1UA 5TR5A 1OXVA 3NJTA 2KTRB 2LS01 1T5XD 4YTMB 4BY1B 1Q0WB 3SHLA 5D3DA 2FJ2A 1EU4A 3E6ZX 3LX0A 2LWPA 4US8A 1UF0A 1N9WA 4I7ZC 2JUOA 3EHVA 3S1MH 1SIJA 1HR0Q 3KJPA 3A8IE 1H8CA 2L11A 3FAHA 3JYUA 4HJ9A 1EWYC 2O4XA 3AE6B 2JA8G 4XYCA 1EUVB 2CKZB 3HOUB 3A5ZB 3S9WA 4LNKA 3H8HA 1CUKA 2F0NA 2NBFA 1WF9A 4MSQB 4DXGA 1GJZA 1E7UA 2D5DA 4YXDB 4PZ8A 4S3SA 2DENB 2AHOB 3V61A 2EELA 2G3QB 5GXGB 1P7FA 1CM9A 3TDQA 3S16B 3MJ5A 4X3TA 4YIJA 2AEHA 2D3AA 1V86A 3SVMA 5IE8A 1R4NB 3NE5B 4M02A 4QUCA 1YVCA 2PNHA 5BYRA 4DDID 5C4XG 3RZFA 1HTLD 2VZKB 4HLEA 4CKBA 4JYAQ 3MXGA 1VJKA 1WJUA 1WTOA 1XPOA 2PQAA 1T0QC 2QCZA 2CU1A 4HIOA 3QG1A 2GN5A 3V6EB 3I9V1 3GTGB 2VB3X 3NEMA 5LMNW 3IT6B 1ICFB 1XPRA 3NVZA 3OJ4B 2MP2B 3IHPC 3VTUA 1SYEA 2CH4A 4DAYA 4A3GH 1Y8NB 1X54A 5EE3A 4JK1C 3JVZX 4LDTD 4CJ2C 4BVUC 1V43A 1SLJA 4ZAIA 3D32A 4IWOA 4GLXA 3SK6A 1EF1A 1YNJD 3Q8BA 1CT1D 3QJYA 4HSVA 3DHIC 3Q14C 3RD4A 4P2CB 3NQIA 3WOEA 2A6HD 5JEAH 4JI7Q 1FD7D 1J0GA 1HQRD 2WFWA 3KF8B 3VUWA 5IP7H 4W9EA 3OIQA 4HCEA 1H9MA 1FO4A 1B50A 1I5FA 5D14A 4Y7NH 4IOCA 1IBKQ 3G48A 2D3CA 5LHY1 1GB1A 3L0WB 2F3WA 4DK6C 4IW0A 3V96A 1SYGA 3NS8A 1KNAA 5GAHC 5C4JH 3K59A 2JA6G 1SNMA 3IKJA 4YHHQ 1XMOQ 1PH2A 1M90C 3G4SA 3OMGA 1E10A 4K3BA 2DGYA 1K0RA 3T13A 4S17A 1V8QA 2KOLA 2EE1A 3EFCA 1E1TA 1EOTA 1D2BA 1DGJA 1YX5B 3KH0A 5T1IA 3QWNA 5G5GA 1GHJA 1E3PA 2EXDA 1EIGA 3H0GB 4YCVA 3BJUA 5L37A 4KI0A 5IGFA 4A3DG 1J7CA 3OTOL 3L17A 1ML0D 3NZUA 1I6HH 2VUMB 1ILPA 1NI3A 2JYOA 1RD9D 1ESRA 1SNCA 3L4PA 1WJ6A 2MQJA 1B4OA 4LDTB 2MEKA 1MPEA 3RULA 4ME5A 5JPNC 2D9UA 4GKKQ 3RZWC 5KNBA 2NBWB 3DBRI 2LD9A 3M9BA 5JH5C 4DN4M 1CK1A 4OIKA 3PGZA 2RHSB 3CQZB 4AQYQ 1VF5C 2QHOA 3MC0B 2PZUA 2VXWA 2F0PA 2UU9L 4HMJA 2ZW1A 1DOYA 2KJHB 2KMMA 4DFAA 5KRUA 3K57A 2KVRA 1SNQA 4L1BA 1IL2A 3ML9A 1I35A 1LTRD 2PI2E 3HOVH 5ELDA 3S2DB 1LACA 2FAZA 1HUNA 2QC8A 1FYCA 2NPTA 3EJIA 1ZXTA 3DWAA 1OQRA 2LMCA 1NMGA 3A1QB 2B3GA 5AEKB 1SNOA 3FILA 3GTMH 1P16A 1QVCA 1QOBA 2GBMA 4K2LA 3DPDA 4B3TQ 2JXMB 3PGEA 3D6WA 3A1QA 3K0YA 5KEEA 4F88A 3G6JB 2INDC 1CHPD 4AYBG 1N8RC 2QCPX 4J3OD 4XQJA 4HXDA 1T0SC 1XLPA 1SYBA 3OWFA 4IUQA 1LTID 2UU7A 1SE3A 4DAVA 1VD2A 1WYGA 4MACA 4KGSA 5L83A 2PW9A 1B70B 4PNYA 1IP9A 2FCNA 2JA8B 4IPDA 2WIIB 4H13C 3NZ3A 1BUVT 5C6AA 3GO5A 4JC0A 3P4QB 1V49A 3QAQA 4F7ZA 4ZLTF 2JXTA 3DVGX 4MELA 4K1RB 3CRLC 2JA6B 4JI7L 2IX0A 2M8SA 3NG0A 3P20A 2L1BA 2XBBC 3Q3OC 1XXGA 1S5CD 1DOKA 1IBKL 5IY0A 4LF6L 2L3ZA 1X3FA 3I4LA 2WQYB 2J0TD 3RUZA 1TKWB 1HZAA 1RAXA 1Y1WB 1CKNB 3MWYW 2HE7A 5T1GA 2DY8A 1IYVA 2L4NA 1LGRA 3IAM1 2F0DA 2KDIA 2M4NA 4K0KQ 4H2AA 3ZNID 1C4PA 3PIPA 4G4KA 1IW7C 3RN9C 2A19A 2FCQA 4B3RL 3MXUA 3TSSA 4RMAA 1G6PA 3FKIH 1CKNA 2A6ED 4FO2A 1RDPD 3H91A 4JIOU 1D6EC 4C3IB 5C3EB 2KQ7A 2A69C 2ZJDA 3HOUH 2BB6A 4W9CA 3WOFA 2R92H 3Q24A 1HZ6A 1PH5A 1PXUA 3LNNA 2RSNA 5C44G 1Q7YC 1ICWA 1VZ6A 3QCAA 2ZNVB 4K3CA 1XLNA 2L15A 3IT4B 1L1OA 2H1EA 4DHJB 3D4RA 1S5FD 1Q1BA 5IOIA 3VUYA 2R7ZG 1IBXB 4IUVA 4PT5A 3J80L 4JI4Q 1MGSA 1KH0A 4DR3Q 4ZRPA 4BKSD 4C7YA 5IP4D 3AV8A 1NCVA 4PMBA 3Q0AA 3HZXA 2TSSA 1M94A 1EY9A 3ZJYC 3ITPA 3CCVA 2WHIA 4II2B 2BBCA 1KL9A 2BH2A 3DWMA 1CA6A 4TSSA 3TMPB 1XNQL 2R61A 2ZEQA 2I5HA 4GOPA 4KKIA 5JHBA 2OQ0A 1PYWD 4FA6A 2DWQA 4P7IA 3AN1A 4CJ1B 3SU8X 1VQNA 1O7LA 3MEHA 1WIAA 3RYTA 2BVCA 4E74A 3PF5A 1AARA 3HOXB 4WAFA 4AIMA 4H0LC 1N5WA 4Q0FA 2B2UA 5IO9A 4MTNA 1SBBB 4R4TA 1L7YA 2O2VA 3ZLZA 2EYOA 5T8IA 3LDZE 4JPSA 4JPBW 3LWUA 4WJ4A 1ZW7A 4HCSA 2IZVB 4JV5L 5CV6A 4A76A 3CMEA 4BY1H 1PTOD 2DBYA 3APCA 5DPRA 3ZNZB 4HKQA 3QIAA 4FN2A 1RJTA 1SJED 5FLMH 4JYAL 1TXYA 1JWUD 5I6YA 4DUYQ 1LT5D 1HQMC 3EECA 4JV5Q 4DR2Q 2OJRA 4PS7A 4J15A 3U9OA 5AUKA 3BVGA 3I5JC 3P4SB 1WTXA 1PZJD 2BTEA 1XLQA 1WXMA 4JX1C 3ENEA 1SE8A 3KWVA 2R2QA 3PSEB 2K5PA 1RL2A 4GN1A 4IC7B 3QR8A 4HIMA 2HCIA 3EC8A 2WNMA 5BMHA 4A3OA 4ZK9B 2HT1A 3SDZA 2LGIA 2LUEA 3TEYA 2KHJA 1PLFA 1FPYA 4IKGA 1EM7A 2Z0EB 3WAMA 4NJ7A 2ZCCA 3TCAA 3U7ZA 3R2IA 2UUCQ 4DV0Q 3T9LA 1I4XA 1RTNA 5E7NA 2KQ4X 1JJGA 2X38A 3P2BA 1T5EA 3D6CA 1C8CA 1Z47A 2MBBB 1HRJA 3AE3B 1ZXHA 4C3HG 5IWAQ 3FEWX 4LF5L 4A3JG 4JI6Q 2J0KA 3A0JA 2JT4B 1FCLA 2AX5A 3MC8A 5KYLA 4JCVE 1UEAB 1GXDC 2M0XA 4O0AA 4HTHA 1F9QA 1MHWC 3V05A 3M62B 1PMRA 1X3PA 4R8NA 3UDGA 2H88B 1OEYA 4ZRIA 2EIFA 4DXFA 1EFID 2HIXA 3PUWA 3NRZA 1Q1OA 4TKOB 1EWCA 1S4ZA 5GQOA 2M19A 4JWSC 4USAA 4B9KA 1GO3E 4MGYE 1K83H 4XGAB 1J6QA 4PG3A 2E2HB 3AXCA 3B6YA 1BBXC 3UQBA 3U58A 4K5VA 1SAPA 3GTMB 4JI4L 2WP9B 4QY7A 4OL7A 5GAGC 4J6IA 2F3IA 4EZLA 1X1MA 5CTRC 3C3LA 3G6EA 2RGFA 2DZKA 2DNEA 5FKAC 4A3EG 3U50C 4RKBA 2H5XA 4X3UA 5C4ZA 4IFDI 3E56A 2JN4A 1EQTA 2NVYH 1K3BC 5LL6S 4RGTA 3CP0A 2P5ZX 2JA5H 2IDYA 1F9PA 1K28A 3IFDA 3WA0A 4FDBA 2WXGA 3PT2B 3UGBB 2X6GA 2IHEA 2NN6H 4C4VA 2KMCA 1LFDA 1EEFD 3KK7A 2MJ3A 1KNEA 1VQ9A 1WI5A 5COYA 1RF2D 2ZXRA 4QQBX 1UNSA 4A20A 3VAWA 4A90A 1TZ1A 1J19A 1O78A 2MBHA 2UUAQ 2D07B 3W5VB 3ZYYX 2K3UA 1XO3A 3TEZA 1TY2A 1AWDA 1CJEA 3WALA 4NB3A 1VQ6A 2ES2A 1TKGA 1CTMA 2DZJA 4MJSA 1KOTA 2E2HH 2ZPNA 4QAYA 2OCEA 2UUBQ 1S3SG 2KJ6A 2EJGC 2DAFA 3N6RA 4LCDE 1RKNA 2E2JB 1XT9B 1EY5A 1K51A 2GI9A 2C60A 1SDFA 2RPQA 3EVQA 2L1AA 3HM6X 2LASA 5M5YB 3B0AA 3AEDB 1P98A 2C7NB 5D7GA 2M0AA 3A8KE 4TVAB 1WR1A 4LW1A 5ELNA 3MXNB 4DNIA 2K1FA 1NMFA 4KK7A 4PQXA 5CMDA 1E8WA 1X55A 4BY7B 4NMZA 5DPWA 1L0XB 1YZ6A 2NWGA
chains in the Genus database with same CATH topology
2PNRC 3RZDB 1JCKB 2JP1A 2K22A 4F8MA 2A73B 2OT2A 4XWWA 4YSZB 1VF7A 1QOAA 2QIEB 4WIPA 1GUOA 1FIQA 4RNAA 4YTNB 3KWLA 3GTQB 2K03A 1BDOA 4OIJA 4FXCA 1JOKA 2PVGC 2PMVA 5AFWA 4RGOS 1L6UA 5CORA 3D8GA 1TU2B 1DM0B 1V1PB 5I2YA 3M4YA 1FNVA 1TKEA 2V4DA 5CBEE 2QJLA 1E7PB 3Q6SA 3D4DA 5EE0A 2BS4B 1EU3A 1YNTE 4US9A 1PTOF 4KN7C 3T56B 3U9SA 2SDFA 3IXSA 4NP5A 2KVMA 5E4WC 3IL8A 3B2GA 2ZXOA 2MJDA 1I4PA 1EY8A 1J7AA 4ZUJA 1IYUA 1CHQD 1IL8A 2LHEA 2Z1CA 1C4QA 1QOGA 1K83B 3J81E 4ZOHC 3BK1A 1H9SB 5G5HA 4NAWB 2KJXA 1WVLA 3H3VC 2F0SA 2A69D 3GV6A 4Q2JA 4C80A 1SSOA 4K8IA 3RFZB 1A3UA 4IUNA 1C76A 1IHZA 1LV9A 1E9MA 3HVZA 1CA5A 2XSCA 2K33A 2WXNA 1C4CA 3W1SA 2A68D 2ICIA 4M0WA 4C3HB 2GA4B 1QB5D 2BDOA 1FD6A 4K8JA 1YNJC 3SR1A 3LXFA 2RDHA 4QB4A 4N59A 3OPOA 3MXNA 1BO0A 1BCPC 2JX5A 3AMZA 4O1NA 3TZDA 2WXIA 1G2TA 4A8XC 2ONQA 1WTWA 1Q3LA 4LTUA 1TJEA 4C2MB 1YN4A 5EKLA 2AUJD 4KJNA 1QWYA 2XVSA 3VYRA 3AE1B 1GAQB 4OZBA 2E6XA 4KKSA 1DONA 1QF6A 4HSPA 1FXAA 3AU7A 1B2TA 1I50B 5A2QE 1PFNA 2XNAC 3J81L 5J22A 3ND9A 5M9OA 1RODA 5KIXA 1Q1EA 2JU6X 4XWTA 1STGA 4IOIE 1NEKB 3KBXA 4A3FB 1PTOH 4RF1A 5BN5A 2J4XA 4TQUS 2D5GA 5EGTA 2N9LA 4K5WA 5CR3A 4L6TB 3L3OC 2BE5D 2KACA 3I3CA 5KNDA 4XTCS 1KFYB 1TZOA 2WXJA 1KTKA 2K1BA 4IUTA 5FO8B 4A3DB 4DNRB 5DM73 2IGGA 4LAAA 4C56C 2PVOD 3HKZB 2L5TA 5JAVA 1S5BD 1BUIC 2KCNA 4RF0A 5IT9L 1N60A 2B63B 3S1QB 4KN4C 2HUGA 2YEPB 2V3PA 5C3WA 3GQBA 3NP8A 1OXSC 1Q12A 2O2LD 1BCPF 4R3DA 2N55A 5CBAE 4EGVA 4ZHPA 1OFFA 4B08A 1D1KA 2J53A 1RTOA 2L0CA 4PMCA 4KY5A 5BN3A 5J39A 3MFGA 3SEBA 2F0TA 3ZJTA 2WKCA 4A3BB 2CVRA 3R2TA 1R4QB 1SNPA 1EY0A 2JEBI 5M3FB 2JSOA 3DHQA 5NUCA 2JEAI 3F2UA 4KGRA 2HCCA 1KF6B 2KUMA 2IPKD 2IGHA 5JPMC 2K5QA 1S5DD 5EPKA 1XCTL 2RDGA 4MM3B 3HP3A 4OZAA 1IKMA 1II3A 2B8FA 1WTQA 2X6LA 2WB1B 1BCPB 4FXDA 2F0VA 3Q23A 4ZRQA 2Z4IA 1E6EB 1ET9A 4CKCA 2Y0SB 5C44B 1ZOYB 2R92B 2ENBA 3RLFA 3FPUB 2Q8IB 3TBIB 2NVXB 2QF7A 2MJ8A 1VLBA 3VR8B 1B9RA 2B76B 1K8OA 1BQQT 1I4HA 1NYRA 2BW2A 1VZ7A 3ABVB 2B2YC 1FEHA 1LO5D 2WDQB 2J42A 2V4IB 5H92C 1NUCA 3R8BA 3BDLA 4BWGB 2W3RA 1TT2A 1TWFB 4FF2A 1ZKOA 2SOBA 1GB4A 3SR6A 1HA6A 2AWOA 4C3JB 4FP5D 5EKIA 4LK0M 3AECB 2NZ1D 3TEXA 3C46A 3A54A 2JA7B 1ZDVA 1CI3M 4BBSB 1EEID 3WDNA 1N63A 2B8GA 3M4OB 2SNMA 1KAAA 5E1FA 1JE4A 4FXKC 4DU9A 2CW0C 3VR3A 3AMUA 4ZUIA 5A2QL 2EZVA 1NVID 3KBGA 2DYMA 2WXOA 1JROA 3S17B 2LFIA 2INNE 3P7JA 1ZDXA 1GUTA 1U4MA 1JMLA 1F2YA 1FCCC 4F7XA 3AEBB 4ZRZA 5K36H 1MVKA 1H9RA 1TS3A 1F2LA 3MA2B 3S1RB 1U9RA 2WKDA 1T6BX 1JB3A 1FFUA 4EQNA 1HEZE 2IW3A 3S14B 1KLUD 1W6KA 2B2TA 1PUTA 2ZXPA 5C3JB 3KQ4A 2WU5B 2OEOA 3B2FA 2WXRA 3HVDA 4KD4A 1A2UA 1VMCA 3BS1A 3J7AV 1PRTB 2WDRB 1U4PA 4J8QA 3FPPA 4XQNA 3PUYA 3AEFB 5FR3A 2KWDA 3NQTA 1B44D 2B2WC 2NVQB 3CKIB 2A5HA 1EY7A 4NZLB 2FE8A 1I4RA 3OHXC 3GB1A 1UUPA 1H9KA 1PTOB 2KAJA 3HOWB 5BYQA 4XQQA 1DJRD 2X69A 4C7ZA 2VNUD 2Y5PA 1E2ZA 3ZJVA 1P7EA 1O7ZA 5DEHA 2K7VA 1EY4A 2WV6D 3U2SC 4FF4A 2K0PA 1PFBA 3I4NB 2MP1A 3QOJA 2MHVA 2JE6I 1RYJA 1B9MA 3TZUA 1Y8PB 1TS2A 1SNDA 4I65A 1ILQA 4OO1G 1A3VA 5JJZA 3VA7A 1TVXA 1Q90A 4C3JG 3P4RB 4HR7B 1LTAD 1TS5A 2PCFB 5FOBB 3OSOA 2Q5WD 2R6GA 3CWIA 2B2VA 4G7OC 1HHVA 2DYOA 2ZW0A 4OO1H 2F4IA 1JWSD 3Q8EA 2JZPA 1AZPA 1V97A 1EQVA 1JALA 2GRIA 3FC4A 1WTPA 2GB1A 3LB8C 5EBDA 2AWNA 5FLXE 1HTPA 2BCOA 1CQVA 1FGBD 5EE9A 4EQPA 2NMQA 5C0XJ 3L7ZC 3OWEB 2I46A 3PO3B 2Y5CA 1A15A 1MBYA 2QILA 5CV8A 3EQLC 3HRZC 3A56A 1F2MA 2PO4A 4BA1I 2JWUA 5EE1A 3T16A 1ZE3D 3AE4B 1LTGD 1MSHA 2A6HC 2QKIC 1ZXIA 2RBMA 1ET6A 2HDLA 3GD7A 1HFNA 2QDBA 1QNUA 5CC4A 2B2WA 1EZ8A 4G57A 2LMCB 1HZ5A 2BA1A 4KTAA 1U4LA 4DGZA 5FK9C 1DOXA 3R93A 2F1MA 1IUEA 2W3SA 1B9NA 3I90A 3BG3A 5C4XB 3P75A 1I7HA 1TR5A 4NAMA 2L32A 2B2UC 5ISRA 3C8YA 3I57A 2WXPA 1PDXA 2IGDA 5I9OA 2AQ1B 2PQEA 4A9AA 3S15B 5F2DA 2WDVB 3DMUA 4LK1C 4TRDA 2KECA 2O5IC 5M5XB 3FKIB 5DAUA 1FNWA 2EY5A 1FM0D 2F0GA 3NTHA 1STBA 3V2TA 3HOYB 1Y69U 4D2KA 2G9DA 2F0UA 3GTLB 3NVVA 3AH7A 1KABA 3AE9B 1Y56A 2EXZA 3HG9A 4QUFA 1XYIA 2RMMA 2BE5C 2EYPA 2F0FA 4OZCA 2EVBA 1QKZA 1LTSD 1C4AA 1TWGB 1XX8A 4OHJA 3LYYA 1DXMA 1YJIA 1ONLA 4RGNA 1EZ6A 4A3IB 2EY6A 1GPXA 4H44C 2G1EA 1JWMD 2KEDA 3CIRB 1SE4A 1JQYD 1QOHA 1E0ZA 4H7BA 2K6AA 1WTRA 2I2YA 4WFN3 1WGKA 2OF1A 4K6DA 4N6EB 2C9OA 3S1MB 4ODGA 3NUCA 5E4XA 1VDVA 4J6HA 3H6MA 4HEA1 4XT1B 5IGEA 3GTOB 2M2LA 3CRKC 2WS3B 2XN9C 3PZ8A 2WACA 3J80E 3VR6A 2K32A 2F0HA 1YN3A 1LT3D 4M1UB 3BDCA 2DLBA 4ZYSA 4NDXA 2EY2A 2B2VC 2WXHA 4AS1A 3H09A 3BZDB 3S2HB 1QOFA 1PGBA 1VRAB 4L23A 5G3LD 1DD2A 2IX1A 5E3FA 3M3YB 3AB9A 1QLBB 1W6JA 4J1MA 1D4BA 1HA5A 1I4GA 2EJMA 5FO9B 3W3AA 1PRTD 1BOSA 4L2YA 4IQZA 2JQRB 3BDOA 3KUPA 2D2CC 4MN3A 4WRDA 2HTME 3DWPA 5EQ0A 5J1ZA 5C0XI 4XXEA 2R3ZA 2EPBA 1B3AA 4KY6A 2D62A 1A6XA 4V190 3K6OA 4KJOA 5JEAJ 1N61A 2VZKD 2L55A 4R9WA 3EFXD 2K28A 3ONAB 1NYQA 4XDXA 2KQ3A 2SAKA 3TP6A 1OQQA 2H4OA 1XCQL 4F87A 3DEPA 3QOLA 1K50A 2W82A 4JE3B 3OOCA 3MXPA 2W54A 4RKLA 5HGTA 5FLXL 2H89B 2Z8LA 1XF5L 3NVWA 2BOSA 2FUG1 3NTKA 5KYIA 3V3XA 3KLSA 5IGCA 3M7NA 3X3MA 3AM9A 1FRDA 3QB3A 5ELEA 3BYYB 2N7JA 1EY6A 1SXTA 1AFPA 2EYMA 3I4MB 2QEJC 4IURA 1F0ZA 5IOCA 4YWGG 5E6JA 2BS2B 3VRAB 1LABA 3MHBA 4O42A 1SYCA 4RAUC 3I8ZA 3PIO3 2RA4A 4HKZE 4K14A 2L52A 1I3QB 1GOZA 3VR5A 2IWHA 1R4PB 1EYAA 1STAA 4XYQA 5HURA 2DNCA 5JVH3 4WH4A 5M5WB 2E75C 1WCMB 2RDFA 2NUCA 4LJZC 1ZYRC 2PPBC 4L8JA 2CJNA 4L63B 1BMLC 1V8CA 2WLBA 2WXKA 5JXVA 3AB5A 1Z7TA 4AYBB 1STHA 3I70A 1CZGA 3AE2B 1QT9A 2XWBB 2BA0A 1Y8OB 1TS4A 1KDAA 5HFYA 4U68A 1XWEA 3BYTB 1WSPA 1UWMA 5C0XG 1PZKD 3NK9A 2NVTB 4A3MB 3FILB 2RKSA 1SSNA 5M3MB 1HFGA 3GTJB 2DN8A 2PW5A 1IW7D 5EPLA 1U4RA 1PFMA 3NXWA 1AYFA 2RSOA 3H94A 2NN6G 2KCCA 5C5MA 3E9SA 4RFBA 1L0YB 1Z6HA 1UWXA 2CJOA 2M56B 1N62A 3AE5B 4TQ0A 1YNND 4KKJA 4U673 5AUIA 4WORA 4ZKCB 1R7SA 5ELBA 4IUPA 1HPCA 3HS0C 1AW7A 4KD3A 4PMWA 2EY1A 3A8JE 1O7YA 2F0KA 5ELCA 1XTCD 4NJCA 1GUWA 1S5ED 1NSNS 1STEA 1NR4A 1AN8A 2W55A 3GTPB 4OGQC 4BBRB 4QIWB 1C9FA 2MJEA 2E2DC 3OMCA 5JVG3 2B2TC 4JBWA 3C1EA 2F03A 1D5MC 5LNK1 5CV4A 3IAYA 1QG7A 3SK4A 1STNA 1DCZA 1PDQA 3A7AB 1DOMA 2QMTA 2NYZD 1WD0A 1X32A 2F0MA 4WURA 4A93B 1I6HB 2MGSA 4EQOA 4QCLA 2NTSA 1I4QA 3NVYA 3VYUA 2G9HD 4K2KA 2NTTA 3MZ5A 1ACCA 3IAS1 1J7BA 3RZOB 4DNTB 3LWEA 4BS9A 1A3TA 4C1NI 4K6LA 3T53B 1IKLA 4KMUC 5HHDG 3J7AF 2Y3AA 1ENCA 1MHHE 4LLGM 1M4VA 2Q8TA 1OXXK 3MVVA 4CGYB 2LFNA 1IGCA 2I07B 4MH8A 1ZEQX 1SYDA 1ENAA 2PW7A 4RHSA 2WXFA 2WU2B 5D3IB 1K52A 4XDDA 5IIFA 3I72A 5CV7A 2N88A 3SE0A 4K5XA 4RA8A 3M85A 5I9PA 2L83A 4HROA 4MT5A 5IODA 3A55A 3VRBB 1B53A 1T3QA 3DWQA 1PZID 1QQRA 4ARCA 3SFEB 1NENB 1KRHA 4ILWA 3TP8A 2INPE 2RPVA 2PIAA 3TMEA 2F3VA 3EGRA 5HG2A 1JWAD 2I38A 2OEDA 4FXGC 1PRTC 2IX3A 1F2RI 4N9PA 3AE7B 1IBXA 4XDCA 4C1NK 3PV0A 3PIP3 4ZHOA 2F0LA 3AE8B 1HUMA 2LJIA 1AP0A 2Z4HA 1VR9A 2NB0A 1PTOC 4E6IA 4KKUA 2B2YA 2QSDA 3N52A 3I91A 1BNZA 1QE6A 2EYHA 3TP5A 1L5PA 4KY7A 5IGDA 2XRSD 1XEEA 3IFTA 4IALA 2FINB 3FDTA 3Q69A 2FBWB 3HRDD 1VZ8A 1DZ1A 3FVQA 2K5DA 1X3QA 3D3RA 5IT9E 1TKYA 4G7ZC 5C0XH 4R8IA 2WAQB 1CFMA 3I73A 4IZ8A 5BN4A 1SMYC 3MTSA 4A3JB 3G7LA 3BIID 2PMZB 3P1HA 3JAME 4KHZA 3SFDB 2A68C 3TUOA 1TIID 4RWSC 3MP9A 2XRQD 2JYEA 5C3XA 3NBIA 4HMIA 1YN5A 2BB5A 3URYA 1WRIA 3PMFA 3NTIA 2LEKA 3D31A 3JAML 5K5PA 2YEPF 1GHKA 4P16A 2KDMA 1BCPD 3UI3A 5BMGA 2F0WA 3FRPB 4XE0A 4RH6A 4QMGA 3MHZA 3C2PA 5MPOA 2SEBD 2MH7A 4A55A 2ZT9C 5TSSA 2F0QA 2IT1A 4M8AA 5C5LA 5C4HA 4OVZA 2K04A 4KX6B 3VR9B 3CU7A 5G3LF 4FVMA 4IUUA 4JWUC 1XLOA 2PTLA 3OW7A 1SB3C 2OHFA 3PZ7A 4KV6A 4IFDG 1D5XC 5IGBA 4X3SA 3DXJC 1LTTD 2KHSA 5EBCA 3N9YC 3TN2A 4DF7A 1FXIA 3J7YW 3M7GA 3FMCA 3K5LA 1DYQA 3MFYA 4FYDA 2L9HA 4CQNA 3HGBA 2FHTA 1JC7A 4AQ7A 3P1MA 1E2VA 4DK1A 2LHDA 1MSGA 1OXUA 1SJHD 1F2ZA 1TWAB 2PZWA 5DNFA 4Z9CB 4G7HC 1JOOA 1TY0A 1WTVA 3Q22A 3KF8A 1A70A 1AZQA 1G2SA 3GS2A 2EKIA 3HUIA 4WWMA 2SNSA 1DOIA 4RHRA 5CV5A 4FNFA 1SYFA 3NSWA 5EPJA 3GV3A 3OIPA 3EUB2 4NKLA 1DOLA 5CV9A 2WXQA 3K7AB 1A2TA 3TP7A 2LUMA 2EOTA 1FRRA 4DA2A 1QNKA 3PUZA 3AEGB 4Q5VA 1RWSA 4XYOA 4DK0A 1TWCB 2AQ3B 3J9CA 3Q8FA 3BVMA 1L6VA 1PFDA 1JR0D 1GUGA 3HOZB 4A6QA 3NWTA 3W9CB 3KLRA 2AQ2B 2F0EA 3VR4A 2ACZB 2N9KA 1TYGB 5FO7B 1VDZA 4EVOA 1G91A 4A3EB 1FR3A 3T51B 5JEAG 3NWSA 2JSVX 1BR9A 5ELFA 1O80A 1SFOB 1CZWA 4ABNA 4FF1A 5CYUA 1E0BA 4QF4A 1N5XA 2E76C 2A74C 5I2XA 1YQ4B 1MD2D 3ZGZA 2M00A 4KHVA 2BT6A 2AUKA 3NPPA 1F2RC 2CQAA 1G8ZD 3NS1A 4N58A 2CW0D 3PO2B 3X3NA 4GZYC 1TQOA 4YSXB 1YQ3B 1EYDA 1LLRD 2EYJA 1RFKA 2WXLA 3W5UB 4IN3A 2E74C 2LKVA 3U4EG 3BVZA 1JW9D 4GLSC 4HEDA 4IFDJ 2F0JA 3W2DA 1NAPA 3BK2A 3PUVA 2K5WA 4ITKA 1V1OA 2NVYB 4GDLB 3RMHA 1KLGD 2JYTA 4UAIA 1KDCA 1FNUA 1F9SA 4YTPB 1ZPSA 1ENFA 4CBVA 3TEWA 1WWTA 3K5NA 4EE2A 4RGMA 1K8MA 2WP8J 2PYKA 1VCIA 3QO2A 1RHPA 1JICA 2ID0A 2K05A 2LY7A 1C79A 2ON8A 3WCQA 3D4WA 3P4PB 2L12A 1NR2A 2F0OA 4B0MA 1J9OA 4REZA 3O13A 3DUZA 2CHBD 1YNNC 1UGJA 2WXMA 4XIGS 2RQXA 3A7LA 3P42A 1CZPA 4YSYB 3NHHA 3ERQA 3E0JA 1GUNA 1ZUD2 5K36G 1JRPA 4Y7NB 4HAEA 1WXQA 2IL8A 1LT6D 1LTBD 3K58A 4TMAB 1C48A 3NUHB 4DQOC 1SMYD 3SK8A 3RPFC 3SK5A 4B9WA 4ZKBB 3GTKB 1F9RA 1YMHE 1PGAA 1B1ZA 3CHBD 4ULLA 1HCZA 1RM6C 2C5CA 4ARIA 3B9JA 2A6EC 1QILA 1UAPA 4RCOA 1EIHA 3DWGC 4X3KA 3VR2A 2WINB 3GP7A 3T3OA 3T3NA 4ZQ3A 1FMAD 1I6VC 4BA2I 1D1IA 4B9XA 4A3GB 4ID6A 1KDBA 2K01A 1F77A 4NW2A 3NBHA 4WJWA 4MIUA 3BWUD 1MI2A 1ZYRD 2RVLA 4XT3B 2XWJB 3Q8CA 1CQFA 4RCNA 2BYTA 2EJFC 1LT4D 1EYCA 3P63A 2EYLA 3S1NB 4WQMA 2K9XA 3ND8A 2MPMA 2PZTA 3PUXA 1YJJA 1L4ZB 2KN4A 2J7ZA 2Q8RE 5CGKA 3ETRA 1Q10A 1ZP0B 2R93B 1SEBD 2EDGA 2IJ0A 5I4DA 5KGUA 3SXHA 4HRSA 3EA6A 2ICEC 2HQEA 5LL6X 4OW0A 2CU3A 3DEOA 5DM63 5BYSA 1C78A 3VQIA 2MUYA 2B39A 4C3IG 2BS3B 4HN7A 4UDUC 1GJXA 1J8IA 2J52A 4B0EA 5A35A 1BF4A 4OO1I 5C2TB 2JA5B 1IGDA 2XIWA 3HOVB 3UI2A 4IDIA 1L0VB 1ESFA 3AEEB 4KGTA 1QJOA 2R7ZB 3L9AX 1AEXA 3DM1A 1PRTF 1Y1VB 3PO0A 1H9JA 1MHXA 3HEJA 3K5OA 2V0GA 3VYSA 4TQ1A 1HXYD 4V0BA 5IGGA 3KLSX 1EWHA 3VYTA 5KNCA 5D65A 1MI0A 4N9TA 1FFVA 1ROEA 1Q8IA 2PLPA 1GUSA 4HJGE 2YYZA 1STYA 2HDMA 3AEAB 4A3KB 4GDKB 3ZJUA 2M9VA 5BMIA 1PGXA 2PKOA 2NN6I 2V3NA 5H8YE 4DAPA 4CJ0B 2BDNA 1VMPA 2FFKB 5C4JB 1V1PA 5EJWA 1WD1A 4KKTA 2OXPA 4CKEA 1K53A 2DY7A 2HDEA 2YU9B 4MHEA 4LMQD 4P6VF 2N0SB 4YT0B 1TWHB 1BXTA 3EROA 3K5MA 1RCVD 4PV1C 3Q8AA 1D5ZC 5EKKA 1E2WA 1G6ZA 2EYFA 2E2IB 3T4AC 1R9TB 3E5SA 2KA7A 5JOBA 4IFDH 4CHTB 1L4DB 5HI1A 3U52E 2O5JC 2VB2X 1JOQA 2E3TA 1SF0A 3VA5A 1H9SA 4FF3A 1JORA 2F0IA 2KEEA 1JQ4A 3R3OA 5I6WA 1G291 1JWBD 1SE2A 3C1FA 2TMPA 2FMMA 1M8AA 1EL0A 3ZQ4A 3MAQA 2FMCA 1QCBD 1OO9B 1C77A 1OXTA 1OXVA 2LS01 1T5XD 4YTMB 4BY1B 3SHLA 5D3DA 2FJ2A 1EU4A 3E6ZX 3LX0A 4US8A 4I7ZC 1SIJA 3A8IE 2L11A 3FAHA 1EWYC 2O4XA 3AE6B 3HOUB 3S9WA 3H8HA 2F0NA 2NBFA 4DXGA 2D5DA 4YXDB 4S3SA 2EELA 5GXGB 1P7FA 1CM9A 3TDQA 3S16B 3MJ5A 4X3TA 4YIJA 3SVMA 3NE5B 4QUCA 5BYRA 1HTLD 2VZKB 4CKBA 3MXGA 1VJKA 1WTOA 3QG1A 3I9V1 3GTGB 2VB3X 3IT6B 3NVZA 1SYEA 4DAYA 1Y8NB 5EE3A 4JK1C 4CJ2C 1V43A 4ZAIA 3SK6A 1YNJD 3Q8BA 1CT1D 3QJYA 4HSVA 3RD4A 4P2CB 3NQIA 3WOEA 2A6HD 5JEAH 1FD7D 1HQRD 1FO4A 3OIQA 4HCEA 1H9MA 1B50A 5D14A 5LHY1 1GB1A 2F3WA 3V96A 1SYGA 1KNAA 3K59A 1SNMA 3IKJA 3OMGA 1E10A 3T13A 1V8QA 2KOLA 2EE1A 1EOTA 1D2BA 1DGJA 5T1IA 3QWNA 5G5GA 1GHJA 1EIGA 3H0GB 4KI0A 5IGFA 1J7CA 1ML0D 2VUMB 1ILPA 1NI3A 2JYOA 1RD9D 1ESRA 1SNCA 3L4PA 1B4OA 2MEKA 1MPEA 4ME5A 5JPNC 2D9UA 5KNBA 4DN4M 1CK1A 4OIKA 3CQZB 1VF5C 3MC0B 2PZUA 2VXWA 2F0PA 2ZW1A 4HMJA 1DOYA 2KMMA 4DFAA 5KRUA 3K57A 1SNQA 4L1BA 1LTRD 3S2DB 5ELDA 1LACA 1HUNA 1FYCA 3EJIA 1ZXTA 3DWAA 1OQRA 2LMCA 1SNOA 3FILA 1QOBA 4K2LA 2JXMB 3D6WA 3K0YA 5KEEA 4F88A 3G6JB 1CHPD 4J3OD 2QCPX 4XQJA 1XLPA 1SYBA 3OWFA 4IUQA 1LTID 1SE3A 4DAVA 1WYGA 4MACA 4KGSA 2PW9A 4PNYA 2JA8B 2WIIB 4H13C 3NZ3A 1BUVT 5C6AA 3GO5A 3P4QB 4ZLTF 2JXTA 3CRLC 2JA6B 2IX0A 3P20A 2L1BA 1XXGA 1S5CD 1DOKA 3I4LA 2WQYB 2J0TD 3RUZA 1TKWB 1Y1WB 3MWYW 5T1GA 2DY8A 1IYVA 2L4NA 3IAM1 2F0DA 4H2AA 1C4PA 4G4KA 1IW7C 3MXUA 3TSSA 2A6ED 4FO2A 1RDPD 3H91A 1D6EC 4C3IB 5C3EB 2A69C 2BB6A 3WOFA 3Q24A 1HZ6A 1PXUA 3LNNA 2RSNA 1ICWA 1VZ6A 1XLNA 3IT4B 2H1EA 3D4RA 1S5FD 1Q1BA 1IBXB 4IUVA 4PT5A 3J80L 1MGSA 1KH0A 4ZRPA 4C7YA 3AV8A 1NCVA 4PMBA 3Q0AA 3HZXA 2TSSA 1EY9A 3ITPA 2BBCA 3DWMA 1CA6A 4TSSA 2R61A 4KKIA 1PYWD 2DWQA 3AN1A 4CJ1B 1O7LA 3MEHA 4WAFA 3HOXB 4H0LC 1N5WA 4Q0FA 2B2UA 1SBBB 2EYOA 5T8IA 4JPSA 3LWUA 4HCSA 5CV6A 2DBYA 1PTOD 4HKQA 3QIAA 1RJTA 1SJED 5I6YA 1JWUD 1LT5D 1HQMC 3U9OA 5AUKA 3BVGA 3P4SB 1WTXA 1PZJD 2BTEA 1XLQA 4JX1C 3KWVA 2K5PA 2HCIA 2WNMA 5BMHA 4ZK9B 2LGIA 3SDZA 3TEYA 1PLFA 4IKGA 1EM7A 3U7ZA 3R2IA 1I4XA 1RTNA 2X38A 2KQ4X 1T5EA 3D6CA 1C8CA 1Z47A 1HRJA 3AE3B 1ZXHA 4C3HG 3FEWX 1FCLA 2AX5A 5KYLA 1UEAB 1GXDC 4HTHA 1F9QA 3V05A 1PMRA 1X3PA 4R8NA 2H88B 4DXFA 1EFID 3PUWA 3NRZA 4TKOB 1EWCA 1S4ZA 4JWSC 2M19A 4USAA 2E2HB