1OGWA

Synthetic ubiquitin with fluoro-leu at 50 and 67
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
76
structure length
74
Chain Sequence
MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQEDGRTLSDYNIQKESTHLVLRLRGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Cell cycle
molecule keywords UBIQUITIN
publication title Synthesis, Structural and Biological Studies of Ubiquitin Mutants Containing (2S, 4S)-5-Fluoroleucine Residues Strategically Placed in the Hydrophobic Core
pubmed doi rcsb
total genus 19
structure length 74
sequence length 76
ec nomenclature
pdb deposition date 2003-05-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00240 ubiquitin Ubiquitin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 1ogwA00
2DHZA 2KMAA 3ZIMA 2O2VA 4MSQB 4I6LB 3MHSD 1SGHA 4MSMB 3DOWA 4PYZA 1Z5SB 1UBIA 1XD3B 2K8HA 4BBNF 3WAMA 2KJRA 3PLVA 2XEWA 5BO4B 5FR6A 2MX2A 2MCNB 2HTHA 2PJHA 2MBBB 4GDKB 2FAZA 3VQIA 3KUCB 4LDTB 3ZNZB 2JXXA 2KC2A 4IC7B 4W9EA 3VUYA 4FJYA 1ZGUB 2LZ6A 2M4NA 4KV2A 2O6VB 1XT9B 1WMHB 4GDLB 2IO1B 5LXIB 4KIKB 1OQYA 2KQ7A 4G0NB 2JRIB 3SU8X 3M95A 2BKRB 2IO0B 3GOEA 5KHQA 4AWJA 4EEWA 3QC8B 2G45B 3RD2A 3T9LA 4EKUA 2KJHB 3R7RA 4OVUA 5L83A 2EMTA 1KOTA 4K7WA 3A1QB 2JF5A 3UQBA 3R3MA 4F7ZA 1WI0A 1GUAB 3B0AA 2RSUA 3UINB 1H4RA 1UBQA 2N1VA 3PTFC 4GOCA 4RM9A 3PRPB 1G6JA 2K25A 4P7IA 3RZWC 2BYVE 4MJSA 2J0JA 2C60A 4ANUA 4YL8A 2V1YA 1GC6A 2AL6A 3NHEB 2Z0DB 4J6IA 4M8MA 3UIPB 2XK5A 2ZCBA 4FJVB 2KWVB 3KUDB 1P98A 3ZTCA 1ISNA 4DDID 2LRUA 4ANVA 2LD9A 1V5TA 4ANXA 3K9PB 3V61A 4HLEA 4FJZA 2FUHB 1WJUA 1E8WA 1WM2A 4A3OA 1V2YA 4OVVA 3ZO5B 2GBJA 5D6JB 3RT3B 2ZEQA 2MP2A 1UD7A 2NBUA 3BY4B 1ZKHA 2ZNVC 2LVOA 2IO2B 2REXA 2CR5A 3QAQA 1V5OA 3OJ4B 3WALA 2JT4B 4DHZB 4IWOA 4RMAA 2JUOA 2CHWA 1E90A 2D2QA 1R4NI 2JPHA 4K7SA 4WJOA 1AARA 1WR6E 2EMSA 3RCZA 5KHOA 2NR2A 2K8CA 3H6NA 3LJ3A 4NY0A 5AZFA 3BINA 3I3TB 2DAFA 2KO3A 2LGXA 2KX3A 2M0XA 4BBNC 2IYDB 4FN2A 5IAAC 4DXAB 4W9HA 2ZPYA 2HE7A 1Q0WB 5LLIA 1PQSA 4ANWA 3U8ZA 4ASWC 3A9KA 2W9NA 1LXDA 1X1MA 1EF1A 4IWQA 3NY5A 1FXTB 2L0FA 2O2VB 3QX1A 1GNUA 1HE8A 2OJRA 3CSTA 4ICVA 2KN5A 4FADA 3N32A 1L2NA 1LQBA 4JQWC 1Y8RC 2OOBB 3ZLZA 1WE7A 3QIJA 3EFUA 2G3QB 2IY1B 4W9LA 4WQOB 4BKTA 2BYFA 4BFRA 4HXDA 2VRRB 3H9DA 2FCQA 4TUUA 4AJWA 4CO7A 4AOFA 1J8CA 4A20A 3EC8A 2FCMA 3DBLI 3ZW3A 1SE9A 2G4SA 5DCNA 1L7YA 1EUVB 5DPWA 5E6NA 2D07B 2KFKA 3JSVB 1Q5WB 3OAWA 4I6NB 2BWES 5DPTA 3NZUA 3PS6A 4X57B 3DCGA 2N9PC 3PV1A 1K8RB 4ICUA 3LDZE 2D10A 1WZ3A 2MA9B 3HM3A 4JGHB 2LASA 4RM8A 4PS8A 2L05A 2LUEA 4TKNA 2N9EB 1IPGA 2CKHB 4MJSB 4E3CA 3W1SA 4G11A 2LJ5A 2KD0A 4HCPB 3SHQA 2HJ8A 5CTRC 2WWZA 1WGGA 3PREA 2XK5B 1GC7A 1NDDA 3AXCA 3PGEA 5D94A 1TTNA 2BGFA 4GXBA 2G4DB 1UELA 3WIMA 2LGYA 1WJ4A 4MGIE 5JZEB 2KDEB 3L54A 2K39A 3V6EB 3V6CB 2LWPA 3JVZX 2WX0A 2LVQA 4IM2A 2KJ6A 2MP2B 4LDTD 4EUTA 2UWQA 1WFYA 2M8SA 5HKHA 3TCAA 3DVGY 1YX6B 3JSVA 3UQAA 2DZKA 3DDCB 3AULA 2MRPA 3PLUA 4II3B 1SIFA 4GMVA 2O6VD 2N4FA 3D32A 1V86A 3VHTC 2KTRA 1JRUA 3M62B 1WGRA 4IWPA 4W9FA 4M0WB 3KW5B 3PHWB 1RAXA 2NBWB 2PEAA 3CF6E 1E7VA 3A33B 2V3SA 4GIVA 2GBKA 5AZHA 3R7QA 4EZKA 1E7UA 4WJPA 5E6OA 3QHTA 1KM7A 3A4RA 1UZXB 5G2NA 2NPTA 2C7NB 2KXJA 4GU2A 1OGWA 1WM3A 1WYWB 2FIDA 3ZVVA 2ASQA 3K9OB 3DBHI 1BT0A 3NOBA 3B08A 3H7PA 4IM0A 2M17A 1RRBA 1MG8A 3A9KB 2XBBC 3SD5A 1UGMA 2KKCA 3ZNGC 5E6PA 1R4MI 1RLFA 4G3XB 2JRHA 5CHVC 3ZDMC 1WIAA 2NCNA 3ZNHB 2J0KA 3PZDA 1U4AA 4FHJA 2J0MA 3L10B 1P1AA 4F8CB 2MWSB 4N9F4 4MM3A 1E8ZA 1J19A 5DPRA 3L0WB 4ZRKA 3VH3B 4CYEA 2N7EA 2ZPNA 5JHBA 1J0GA 1UH6A 3Q3FA 3HK0A 1WY8A 2L0TA 5GMVA 2IO3B 3DVNV 3ZRCA 3HM6X 1S1QB 4XX5A 1D3ZA 5CHWA 5JH5C 4HPLB 4NJ7A 3DBSA 2YVCA 4BKSD 3CSFA 3VUXA 1GJZA 3VFKA 4URKA 2DAJA 2KFKB 2CHXA 2ZVOA 2MBEA 3KYDD 3TIXA 1OEYJ 3QA8A 3C0RB 2DYMA 1QZEA 2C7HA 1P3QU 2FNJB 3JW0X 2BPSA 3MTNB 2BWFA 4NNJB 1YQBA 2I1KA 4XC2A 2KMCA 4MGYE 2C7MB 2QHOA 4W9IA 2KZRA 3QARA 4CHKA 2MLBA 1F9JA 4LCDE 4TQ1A 3ZNID 2V4LA 5LXHA 3AU4A 1TZ1A 3IG3A 2UYZB 1WR1A 1LFDA 1NBFC 3UGBB 2L00B 5L95C 5JHAA 4KDIC 2ZCCA 5DPSA 1IYFA 2D3GA 4B6WA 5C1ZA 1I35A 1P9DU 3PT2B 2AWTA 3A4SC 4IM3A 1WF9A 1WGHA 4DHJB 2RGFA 4F1SA 2KDIA 4XZ4A 4DDGD 4MELA 1TBEA 3UIOB 4FA6A 2GOWA 2L8JA 4DHZE 2WDTB 4FBJB 5EDSA 3H7SA 3B1LX 1EF5A 3NS8A 3IHPC 2MW5A 4NPNA 2B3AA 4HVBA 2AYOB 3PVLA 2A4ZA 3EHVA 4AUQC 2ZJDA 2C9WB 2KTRB 3HIZA 5J2RA 3ENEA 5J17A 2GBNA 4BKGA 3A9JA 4HDQA 2KNBA 2WYQA 1M94A 4PS7A 5J18A 2IY0B 4AP4C 2FIFA 2DYOA 2L76A 1WE6A 3DVGX 3QQ8B 2AEHA 3N30A 2DZMA 2Y5BB 5D2MB 1WX7A 1WZ0A 2KWCA 4LJPB 2NPTB 2KTFA 1VCBA 4W9GA 3PRMB 1WH3A 4ZRIA 4WWNA 2K1FA 3WAPA 4G50A 1P0RA 3OJ3A 4GB9A 2KQSA 3DPDA 1V6EA 2MBQA 1WX9A 3KYCD 3H7PB 1NI2A 3APCA 3ML9A 4KZCA 4M8NA 2IZVB 4B95A 2Z0EB 2KLCA 3P2BA 1WXAA 4FULA 4WWPA 3H1UA 2RR9A 3T8MA 2KK8A 2Z59B 3M3JA 3M63B 2DYBA 4EFOA 2MQJA 1TGZB 3V60A 2GBMA 2M1MA 1YD8U 2L3ZA 2D11A 2MBOA 3TL5A 2LGDA 3VTVA 3ONSA 4NAWA 5AEKB 1E8YA 2KWUB 4DK5A 3VTUA 4JLCA 5AZGA 3W1YA 4TQ0A 1WXVA 1E8XA 1XQQA 1CMXB 3QJZA 2CHZA 3VVWB 2GMIC 2K8BA 2KLGA 1VD2A 3JYUA 4ZYNA 2RPQA 1C3TA 3TMPB 4KVGB 3IVFA 2CS4A 4A3PA 1GG3A 1WXMA 3VUWA 3IFWB 4EZLA 4BOZB 1V9JA 5G55A 2IBIB 2PE6B 4NQLB 3O65B 2BKFA 1KJTA 2JZ3B 3KUZA 2NBVB 3PSEB 4KSKC 4E74A 2N9XA 4WAAA 2LRWA 3RUIB 3QWZB 3HHMA 2CU1A 4HDOA 4IUMB 4W9JA 2GBRA 4MDKE 2JZZA 1WRDB 1C1YB 1RFAA 2A5UA 4GN1A 3NZSA 4IW0A 2AL3A 2KX0A 3VXWA 2KOXA 1IP9A 4FLHA 5D7GA 3VTWA 4WJQA 2LXAA 3QCAA 5CHFA 2K6DB 3ECIA 3W1SC 3L13A 4MEMA 3ML8A 1EO6A 3TBLD 1WXSA 3MJWA 4KDLB 1WGDA 3WA0A 2KFJA 2EKEC 3VAWA 5TR5A 1OTRB 1WGYA 1ZW7A 1V80A 4GDKA 4HK2A 4HPMB 3ZTDA 4LJOB 2WX1A 4I6PA 3DQVA 4DBGA 4EZJA 4E71A 4K81A 1WJ6A 2DZJA 4W9KA 2O6VA 1WMHA 4GDLA 2DENB 4K7UA 2RD0A 4DWFA 4KIKA 1A5RA 3Q3JA 2KHWB 5IA7A 3APFA 3UF8A 3EECA 3KVFB 3A9JB 4W9DA 2JVCA 3N3KB 4FHKA 4GGQA 4NQKE 4MGKE 3L17A 2K6QA 4PYUA 3U30A 2ZZPB 1T0YA 3PPAA 3ZKJC 3A1QA 1WX8A 2BF8B 4MH0E 4PS3A 3WANA 4IG7B 3R66C 2LI5A 2FCNA 4MGZE 4NJ6A 1V49A 1WJNA 3X0WA 2JWZA 2BYEA 2R2OA 2N7DA 3DBRI 3AI5A 4II2B 3SDLC 3L08A 3QK0A 1V81A 3RYTA 3GZNI 4TV3A 1S3SG 3OLMD 3RZFA 2L7RA 4EOYA 2PE9A 2MSED 3CMMB 1OEYA 2R2QA 2KVRA 4NAWB 3X23A 3ZDTA 2N1WA 2ZNVB 4DHJD 3ZUNA 4ZRJA 3KH0A 3ALBA 3APDA 4B9KA 2LXCA 3TJPA 1Q1OA 4BKSA 2NS5A 1LM8B 4GSWA 4ZDVA 4JIOU 3RULA 2KANA 2YLMA 1E5WA 3WAOA 4KSLC 4HJKA 4WWOA 2HD5B 3DVNU 3L16A 2KC1A 4KZ0A 1I42A 1KLVA 3VDZA 1YIWA 3VH4B 2LVPA 2JY6A 2KDFB 2PPHA 4AJYB 5C23A 4BOSC 5CX3A 4WJNA 2KDBA 4K1RB 4HWIB 2DZIA 2FCSA 2NVUI 3PRZA 3PHXB 4BVUC 2MBHA 3IBEA 3AU5A 1YJ1A 2DX5B 1YX5B 3ZRFA 2J7QB 4JL9A 2I1JA 2C5LC 1H8CA 3V62A 3S2AA 1Z2MA 4HCNB 3U7DA 4W9CA 2ZVNA
chains in the Genus database with same CATH superfamily
2LMCA 2O2VA 4MSMB 1XD3B 3WAMA 2KJRA 2J52A 2XEWA 4R3DA 1R4MB 4GDKB 1DOXA 3KUCB 5T8IA 2JXXA 4IC7B 3Q69A 1VDVA 1SBBB 1WMHB 2IO1B 4YTNB 5BYRA 4G0NB 4S17A 3AE1B 1DGJA 1XF5L 2IO0B 1TS3A 5KHQA 2G9HD 3T9LA 2G45B 2KT7A 1IBXA 1WI0A 1JQ4A 3UINB 1UBQA 3PTFC 3PRPB 3CWIA 1KLUD 2K25A 1PDXA 2BYVE 4YL8A 1XXGA 2V1YA 3AEDB 1N61A 4GLSC 3ZTCA 4DDID 4ANVA 1SEBD 1V5TA 3K9PB 4HLEA 2FUHB 1WM2A 4A55A 4OVVA 1Q10A 3RT3B 1FCLA 2DLBA 1UD7A 2WXLA 4OZAA 2ZNVC 1T3QA 1FPYA 2CR5A 2JYTA 3QAQA 3OJ4B 3WALA 4DHZB 5JXVA 2WXKA 4RMAA 1D5XC 1E90A 3AE4B 3E9SA 4K7SA 5KHOA 3H6NA 3BINA 3I3TB 1P7FA 2LGXA 2KX3A 2OEDA 5IAAC 2LUMA 4DXAB 3ZJUA 1Q0WB 3A9KA 2PKOA 1HE8A 2KN5A 2WLBA 1STEA 2BW2A 3RFZB 1FNWA 3QIJA 3EFUA 4N6EB 4YWGG 4BKTA 4D2KA 2BYFA 1I4GA 3RMKC 2WHIA 2FCQA 3DBLI 2G4SA 5DPWA 5E6NA 1Q5WB 3B2FA 4RCOA 1ROEA 1AWDA 4XE0A 3U4EG 2D10A 2MA9B 2Y5CA 2QMTA 2N9EB 3RNBC 4HCPB 3SHQA 2XK5B 5D94A 3EA6A 2E3TA 1QLBB 2K5PA 1V1PA 2JYEA 1ZOYB 2LGYA 4XWWA 2QSDA 4C4VA 2MP2B 1IGCA 3TCAA 3DVGY 3JSVA 2MJ3A 4II3B 1SIFA 4GMVA 2O6VD 3VHTC 3N9YC 1JRUA 4M0WB 3PHWB 3A33B 4EZKA 5AZHA 2GBKA 4WJPA 5E6OA 1KM7A 3AE3B 1JWMD 1UZXB 2NPTA 3H8HA 1WM3A 3HVZA 1N62A 5BYSA 3K9OB 4ITKA 1BT0A 3NOBA 5I4DA 1RRBA 2XBBC 2XN9C 1MI0A 3LB8C 4G3XB 2NCNA 2WXIA 1UNSA 2IGDA 4N9F4 1E8ZA 3VH3B 1SE4A 2N7EA 2Q5WD 5H92C 3Q3FA 3HK0A 5GMVA 1TKYA 3DVNV 1S1QB 5CHWA 1MFWA 1GJZA 3ZXVA 2KFKB 2CHXA 2ZVOA 1P7EA 4MACA 3P4SB 2DYMA 1QZEA 1P3QU 1ZUD2 2FNJB 3IAS1 1B1ZA 2OJWA 4XC2A 2KMCA 4MGYE 2QHOA 3PZ8A 4CHKA 1TKGA 1F9JA 4LCDE 3ZNID 1TZ1A 3IG3A 1WR1A 5L95C 2J42A 1IYFA 2M0AA 4B6WA 2CU3A 3A4SC 1WGHA 3NVVA 2KDIA 4MELA 4FA6A 3MC9A 5HFYA 1SE2A 4FBJB 5IO9A 3N1YC 2M19A 3B1LX 2J53A 2B76B 4NPNA 4HVBA 2AYOB 2LJIA 4DXFA 2C9WB 2GBNA 3A9JA 4HDQA 2ON8A 2FIFA 5EE1A 3VR9B 2L76A 1WE6A 4ARCA 3N30A 1VCBA 2NTTA 2Z8LA 3DPDA 3AE9B 2MJEA 1WX9A 3KYCD 3IT6B 4US9A 2J4XA 3H1UA 2BB5A 2SEBD 3V60A 2GBMA 2M1MA 2L3ZA 1RWSA 2MBOA 2V4IB 3TL5A 4NAWA 5EE0A 3T3OA 4A90A 2SAKA 3W1YA 4L2YA 1NENB 3QJZA 3VVWB 4JWSC 2KLGA 2WGSA 4KKIA 4ZHPA 2DBYA 4ZRPA 3V3XA 1N63A 5G55A 3R8BA 2WXHA 3KUZA 4KSKC 2N9XA 4WAAA 4LNOA 1YJJA 4YT0B 2MHJA 4HDOA 4IUMB 1MVKA 1TIFA 4MDKE 1C1YB 1RFAA 2A5UA 2Y5PA 3VXWA 3BVZA 5AUIA 1OQQA 4JWUC 5CHFA 3ECIA 3W1SC 1FO4A 3MJWA 2V3NA 4XDCA 4OHJA 3WA0A 2KFJA 3VAWA 5TR5A 1ZW7A 1B9RA 2GI9A 1BUIC 3DQVA 3U52E 4DBGA 2DZJA 1XEEA 2CJOA 2DENB 4KIKA 5C2TB 3Q3JA 3APFA 4YTPB 1EWCA 3FKYA 2JVCA 4NQKE 4MH8A 3FILA 3A1QA 1AW7A 3TUOA 4MH0E 1L0VB 5GXGB 1ZE3D 2QC8A 1TKEA 3X0WA 1WJNA 2JWZA 1VR9A 4IOIE 3DBRI 3SDLC 1KTKA 3QK0A 4P1BC 2PE9A 1OEYA 1D6EC 2KVRA 2ZNVB 4DHJD 3ZUNA 3Q3NC 2IDYA 3KH0A 2PW9A 2CJNA 4IDIA 3AEGB 4OW0A 2EELA 1CK1A 4BKSA 2NS5A 1LM8B 4JIOU 2KANA 1E5WA 4KSLC 4HJKA 1JWUD 2MH7A 4KZ0A 2AX5A 1KLVA 3VDZA 1C4CA 2JY6A 1I4PA 2WU2B 5C23A 1MPEA 4US8A 2M56B 3AE6B 3Q3OC 5CX3A 3KWLA 4BVUC 2MBHA 1SE3A 1H8CA 4MSQB 3DBHB 1SGHA 3DOWA 1Z5SB 1EU4A 2K8HA 4WIPA 2HTHA 4LDTB 4RGNA 2KC2A 3C8YA 2LZ6A 1WXQA 4GDLB 2W82A 1CZPA 2JRIB 5HI1A 3SU8X 3M95A 1WWTA 1EWYC 4HEA1 4AWJA 3QC8B 5L83A 1XO3A 2KJHB 3RNGC 1F77A 1JW9D 3AB5A 2JF5A 5HHDG 1T0RC 1MHXA 1GUAB 4RM9A 4J3OD 3P4PB 2ZW1A 3RZWC 1GC6A 2AL6A 4J6IA 3GP7A 2ZCBA 4FJVB 2KWVB 1P98A 1ISNA 1GOZA 4FJZA 1WJUA 1FEHA 1QQRA 5EE3A 3Q6BA 1FMAD 1I4XA 2GBJA 2IO2B 3AM9A 2REXA 1WGKA 2JT4B 3AE2B 5FR3A 2JUOA 2CHWA 1EU3A 4WJOA 4KKJA 1WR6E 3RCZA 2LFIA 3I9V1 3LJ3A 2K8CA 4NY0A 1QKZA 2K9XA 2DAFA 4BBNC 2IYDB 4FN2A 2LEKA 2ZPYA 3UI3A 3LYYA 3U8ZA 1ACCA 4ASWC 2W9NA 4IWQA 1FXTB 2L0FA 2KACA 3TEWA 1N60A 1ZP0B 2K0PA 3CSTA 4C00A 2RDBC 3N32A 1L2NA 4JQWC 1Y8RC 2OOBB 4USAA 4W9LA 1JMLA 3Q14C 3H9DA 4TUUA 4AJWA 3NVWA 1FXIA 1SB3C 4A20A 2FCMA 2QJLA 4CQNA 3ZW3A 5DCNA 1PGBA 2WXNA 4C7ZA 3JSVB 3OAWA 5G5GA 2BWES 1UGJA 2RDHA 5DPTA 2V0GA 3DCGA 2N9PC 4M01A 3PV1A 4QAYA 3URYA 4ICUA 2KN4A 3Q8CA 1WZ3A 3HM3A 3LDZE 4JGHB 4NZLB 1KFYB 4BAXA 1SIJA 1ESFA 2L05A 1IPGA 4MJSB 2LJ5A 2KD0A 2HJ8A 3AXCA 1TTNA 2BQQA 4GXBA 3RNEC 2G4DB 3ABVB 4UDUC 2K39A 3JVZX 1VLBA 4LNIA 4EUTA 2UWQA 2M8SA 4ZRQA 3UQAA 3AULA 4RH6A 1V86A 1WGRA 4IWPA 4W9FA 2FE8A 3KW5B 1RAXA 2NBWB 2PEAA 3CF6E 2E6XA 2V3SA 2D3AA 2W55A 1D5ZC 1FCCC 4XYCA 1C9FA 1I7HA 1VZ6A 2WDVB 2FIDA 3H7PA 4IM0A 1V8CA 1NI3A 1WRIA 3RNAC 3SD5A 2KKCA 3ZNGC 1R4MI 2KWDA 2ONQA 3AEBB 5CHVC 3ZDMC 5AUKA 3ZNHB 2J0KA 1R7SA 2PLPA 4FHJA 4MM3A 1J8CA 2ZPNA 1FM0D 1UH6A 1WY8A 3HM6X 4XX5A 3AN1A 4HPLB 3DBSA 2YVCA 1HTOA 4BKSD 2MBEA 3KYDD 2GB1A 3C0RB 3BZDB 3MP9A 2C7HA 2WXGA 3ETRA 3JW0X 2BPSA 3MTNB 3DWGC 1L5PA 4NNJB 2I1KA 1K50A 3QARA 1TY0A 1KLGD 1AN8A 3AU4A 1NBFC 1FIQA 2L00B 5C1ZA 4ACFA 3PT2B 2AWTA 1WF9A 3U7ZA 2RGFA 4XZ4A 4XDDA 2GOWA 1TS5A 5IN7A 3SFDB 2ZW0A 1EM7A 2PVOD 3NS8A 1FRRA 1ZPSA 3N1XC 4YXDB 2A4ZA 3EHVA 1QF6A 4AUQC 3HIZA 2KTRB 2G1EA 5J2RA 1MHHE 3ENEA 5J17A 1YN4A 1ET9A 2WYQA 4PS7A 2DYOA 2Y5BB 1PGXA 1WX7A 1CJEA 1WZ0A 4TMAB 1N6ZA 2KWCA 2KTFA 1WSPA 5H8YE 4W9GA 1WH3A 1D5MC 3WAPA 1HXYD 1P0RA 3OJ3A 1V6EA 1NI2A 3PZ7A 4KZCA 3P2BA 3T8MA 2GLSA 1GB4A 3TEXA 3M3JA 4HKZE 4EFOA 2MQJA 1TGZB 1FNVA 2LGDA 1JALA 4K3CA 3VTVA 5AZGA 3RNFC 1I4QA 2K8BA 1VD2A 2RPQA 2CS4A 4A3PA 2NMQA 1JWSD 1HZ6A 1GG3A 3VUWA 1L4DB 4EZLA 2IBIB 1XCQL 2PE6B 2R61A 2BKFA 2JZ3B 2NBVB 2XNAC 2X8XX 3RUIB 3QWZB 1R4NB 1TS4A 2INNE 1JWAD 4N59A 2IGHA 3OWEB 1HEZE 4IW0A 2AL3A 2KX0A 1IP9A 5IP4D 5D7GA 4WJQA 3N1ZC 1ET6A 4MEMA 4L23A 1EO6A 2PIAA 4KDLB 4L1BA 4HPMB 4GDKA 4I6PA 1V97A 4W9KA 1WMHA 2RD0A 2KHWB 3HRDD 3R2TA 3N3KB 2KVZA 3BYTB 3DHHC 2BF8B 4PS3A 2TSSA 4IG7B 2AQ2B 3R66C 2LI5A 4MGZE 2WQYB 3OG5A 2R2OA 3AE5B 2N7DA 4II2B 4Q2JA 1S3SG 3OLMD 3RZFA 4EOYA 3CMMB 1VJKA 3X23A 3RN9C 3ALBA 2LXCA 4GSWA 1DOIA 2I2YA 1NYQA 2WXJA 2HD5B 3DVNU 1OFFA 1I42A 1YIWA 2LVPA 3RNCC 4WJNA 2VH2A 2D3CA 4HJGE 3PHXB 1OQRA 3IBEA 1YX5B 2J7QB 2NTSA 3Q8BA 2ACZB 2H89B 2HTME 3V62A 2KMAA 1IGDA 3ZIMA 4I6LB 3MHSD 1I4HA 5HG2A 1UBIA 4BBNF 3PLVA 5FR6A 2MX2A 1PGAA 2FAZA 2X38A 3VQIA 3BWUD 3VUYA 3GS2A 1ZGUB 2M4NA 1FFUA 2O6VB 5LXIB 2BTEA 4S0RA 2JSVX 2KQ7A 5BYQA 4RGOS 3GOEA 1TT5B 3RD2A 2EMTA 4K7WA 3BK2A 3UQBA 3B0AA 1H4RA 2N1VA 4GOCA 3IT4B 3VR8B 2J0JA 1TJEA 4M8MA 4LK0M 2XK5A 4HKQA 2LRUA 2BVCA 3LXFA 4ANXA 2W3RA 3V61A 3AEAB 1V2YA 1BMLC 5E6JA 5D3IB 3ZO5B 1UUPA 5IKCM 5D6JB 2ZEQA 2MP2A 4M00A 1QOFA 3BY4B 4TSSA 1ZKHA 2LVOA 3I63C 4OZBA 3L4PA 3BIID 4IWOA 4M0WA 3CIRB 3P4RB 2WXPA 2K22A 1IUEA 3Q8FA 2NR2A 3VRAB 2KO3A 2LHEA 1SSNA 1PQSA 3P63A 5FKAC 1LXDA 1X1MA 2O2VB 2INPE 2RMMA 1XLPA 3QX1A 1GNUA 3NS1A 2ICIA 3V05A 2OJRA 3P1MA 3W2DA 3ZGZA 1ZDVA 4FADA 1LQBA 3J9CA 4RGMA 3ZLZA 1WE7A 2L32A 2G3QB 1GAQB 2IY1B 2VRRB 3W9CB 4AOFA 2WXMA 3EC8A 1JRPA 1SE9A 1L7YA 1T0QC 1RFKA 4WH4A 1L6UA 2D07B 2KFKA 2QILA 3NG0A 4I6NB 1C78A 2KDMA 3FC4A 3PS6A 4X57B 1K8RB 1IBXB 3HVDA 2LASA 4PS8A 3ZQ4A 2LUEA 4TKNA 4G11A 4YSZB 2WWZA 1WGGA 3PREA 3PGEA 1GC7A 2MJDA 2BGFA 1HTQA 5JZEB 4MGIE 2KDEB 4EE2A 3E56A 2LWPA 3I5JC 2WX0A 2LVQA 4IM2A 1WFYA 2V3PA 4P1CC 4AQ7A 3D32A 3AEEB 4XWTA 1KH0A 4ARIA 4GIVA 3R7QA 1E7UA 4A6QA 4BZAA 3QHTA 5G2NA 4GU2A 2KXJA 1OGWA 4C7YA 2JWUA 3ZVVA 1C4PA 3DBHI 1MG8A 1TY2A 2FBWB 3A9KB 1UGMA 3MJ5A 3PZDA 1U4AA 2J0MA 1A70A 1P1AA 1WYGA 5JHBA 3L0WB 4CYEA 3GZNB 2L0TA 3ZYYX 2IO3B 3SFEB 3ZRCA 4C56C 1D3ZA 2QIEB 4NJ7A 3CSFA 3VUXA 3VFKA 4URKA 2DAJA 4B0MA 2WXOA 2JZPA 4ZOHC 1T6BX 1GB1A 2BWFA 1HA5A 1YQBA 3N20C 4W9IA 1VZ8A 2KZRA 1Y56A 4PK1A 1N5XA 3KLSX 3TSSA 1DOYA 2V4LA 5LXHA 2UYZB 3BVGA 4MT5A 3SEBA 5JHAA 4KDIC 1TZOA 4JPSA 1P9DU 1V1PB 4IM3A 4RGTA 4DHJB 4F1SA 1TBEA 3UIOB 2L8JA 3HUIA 4C4VB 5EDSA 4P6VF 3IHPC 2N0SB 2JU6X 2MW5A 2ZJDA 1SJED 2DNFA 3NVYA 1E10A 2KNBA 1M94A 5J18A 2IY0B 4AP4C 3QQ8B 2AEHA 1FFVA 2DZMA 4LJPB 2NPTB 3PRMB 3AEFB 4WWNA 2K1FA 4G50A 4GB9A 1E9MA 2KQSA 4P16A 3APCA 3ML9A 1YN5A 4M8NA 2IZVB 2Y3AA 3AMZA 4B95A 1L0XB 4FULA 1WXAA 2RR9A 4C80A 2KK8A 4KX6B 3M63B 2DYBA 2D11A 3ZXRA 1D4BA 4DK5A 3VTUA 1LGRA 2WXQA 4TQ0A 3I57A 1TS2A 1YNTE 1XQQA 1CMXB 2CHZA 2GMIC 1C3TA 1J7CA 4WURA 1WXMA 4BOZB 2KAJA 1KJTA 3PSEB 2L1AA 4E74A 2LRWA 5IOIA 4OZCA 1XLNA 1GPXA 2WDRB 3HHMA 4AS1A 1QOGA 4K3BA 4W9JA 2GBRA 2VH1A 1WRDB 4GN1A 2KOXA 3VTWA 3QCAA 1QOAA 2QEJC 3L13A 1WXSA 3AE7B 1QOBA 1WGDA 2BBCA 1KF6B 1OTRB 4HK2A 2WP9B 1V80A 3ZTDA 4EZJA 4E71A 2W3SA 4DXGA 4K81A 2INDC 3W5VB 4GDLA 4DWFA 2RPVA 5G5HA 3UF8A 3KVFB 3A9JB 4W9DA 3DBLB 4GGQA 4MGKE 3L17A 2K6QA 4PYUA 3U30A 1NVID 1T0YA 4YTMB 3C19A 3WANA 4JE3B 1V49A 1E6EB 1L4ZB 1YOVB 3AI5A 3L08A 2K3UA 3RYTA 2L7RA 3U2SC 2MSED 2R2QA 4NAWB 2UU7A 3ZDTA 1K51A 4KGTA 3TJPA 4ZDVA 2YLMA 3MHZA 1C76A 2KQ4X 2KDFB 2PPHA 4AJYB 1RYJA 1ZXHA 2VZKD 2HDEA 3MC8A 2KDBA 4K1RB 2FCSA 3AU5A 1YJ1A 2DX5B 4N58A 3ZRFA 1ZXIA 2I1JA 4DQOC 3RI7C 3S2AA 1L6VA 2OHFA 4HCNB 5MPOA 1PFDA 4W9CA 2ZVNA 2DHZA 1SXTA 4PYZA 2W54A 1MG4A 5BO4B 2MCNB 2BS4B 1CQVA 2PJHA 2MBBB 4NAMA 3ZNZB 4W9EA 4FJYA 4KV2A 1F0ZA 2LHDA 1XT9B 4KIKB 1OQYA 1F2RC 2BKRB 3ZJVA 4EEWA 3R7RA 4OVUA 1KOTA 1YJIA 3FILB 3A1QB 4YSXB 3B2GA 3R3MA 4F7ZA 2RSUA 1F1HA 3EGRA 1J7AA 1G6JA 1PYWD 4P7IA 4MJSA 4ANUA 2C60A 3IXSA 3NHEB 2Z0DB 3BK1A 3UIPB 3BVMA 3KUDB 3GB1A 2LD9A 1MJDA 3P42A 1E8WA 4A3OA 5BMHA 4LNFA 2QDFA 4FXCA 2NBUA 3NJTA 1SF0A 5EE9A 3AECB 3DWMA 3KWVA 3TEYA 1V5OA 2BYTA 1T5XD 3DHIC 3AV8A 4XGAB 2D2QA 2HJ1A 2AQ1B 1R4NI 2JPHA 1K53A 1AARA 2EMSA 5D3DA 5AZFA 2M0XA 4W9HA 2IGGA 2HE7A 1JROA 5LLIA 2GRIA 4ANWA 1E7PB 3BYYB 3ZJTA 2WXFA 1EF1A 3NY5A 2PTLA 4ICVA 1LO5D 1YQ4B 4WQOB 1VZ7A 4HXDA 4BFRA 3TEZA 1JCKB 4CO7A 2PMVA 3GE8C 1EUVB 4WAFA 3NUHB 3NZUA 2BS2B 2QCZA 2AQ3B 4RM8A 2VZKB 4ZYSA 3EFCA 2CKHB 4E3CA 3W1SA 2D3BA 5CTRC 2BS3B 3B9JA 1NDDA 4RFBA 4B0EA 1L0YB 1J7BA 1UELA 3WIMA 1N5WA 2WDQB 1WJ4A 3L54A 1PUTA 3V6EB 3V6CB 2BT6A 2KJ6A 4LDTD 5HKHA 1K52A 4NJCA 1YX6B 2DZKA 3DDCB 2MRPA 3PLUA 4LLGM 2N4FA 3NRZA 2KTRA 3M62B 2N7JA 1FRDA 4YSYB 1E0ZA 2DWQA 3KQ4A 1E7VA 2H88B 2WXRA 3NVZA 3A4RA 2IJ0A 2C7NB 4KGSA 3SR6A 4REZA 1WYWB 2ASQA 2N9LA 1AYFA 3B08A 2M17A 2KYWA 2EKIA 3EUB2 1RLFA 5E6PA 2JRHA 3MFGA 2JQRB 1WIAA 1FD6A 4WWMA 3L10B 3DBRB 4F8CB 2MWSB 2RDGA 4EKUA 3Q3MC 1J19A 5DPRA 4ZRKA 1J0GA 4IKGA 1C79A 4A9AA 1TYGB 3PO0A 5JH5C 1NEKB 2JX5A 1HQRD 1XLQA 2WU5B 3TIXA 1OEYJ 3QA8A 2WS3B 2I38A 3T3NA 1ENFA 2C7MB 1T0SC 4WQMA 3Q8EA 2MLBA 4TQ1A 1LFDA 2INCC 3UGBB 2BB6A 3W5UB 1FNUA 4PT5A 2ZCCA 5DPSA 2D3GA 1I35A 1UWMA 4HPPA 1HZ5A 3WCQA 1V1OA 4DDGD 4DHZE 2WDTB 1VRAB 3H7SA 1EF5A 4JX1C 2L83A 3VRBB 1DYQA 2B3AA 3NZ3A 3PVLA 4O1NA 1YQ3B 1NYRA 4BKGA 3DVGX 1KRHA 5D2MB 4ZRIA 2MBQA 3H7PB 2Z0EB 2KLCA 4WWPA 2Z59B 3RPFC 2V9HA 1YD8U 3ONSA 5AEKB 1M4VA 4MM3B 5FK9C 1E8YA 2KWUB 4JLCA 2LGSA 1XLOA 4ZHOA 1WXVA 4LNNA 1E8XA 1C77A 3JYUA 2JXTA 4H2AA 4ZYNA 3AE8B 3TMPB 4KVGB 3IVFA 2YEPB 3IFWB 1V9JA 4NQLB 3O65B 2MEKA 3AH7A 2PVGC 2CU1A 2FUG1 5C3JB 2JZZA 1YMHE 3NZSA 4FLHA 2LXAA 2YEPF 4RF0A 2K6DB 3ML8A 3TBLD 2EKEC 1WGYA 4M02A 5LNK1 2IPKD 4LJOB 2WX1A 5BMGA 1WJ6A 3GE3C 2O6VA 4K7UA 1A5RA 4RF1A 1C4AA 5IA7A 1F52A 3EECA 3DHGC 3MC0B 4FHKA 4HRSA 2ZZPB 3PPAA 3ZKJC 1RM6C 1JWBD 2D5GA 1WX8A 1I4RA 1SJHD 1ZDXA 4HROA 1QT9A 2FCNA 4NJ6A 1UF0A 4OVZA 2BYEA 2LGIA 2KMMA 4KGRA 2N9KA 1V81A 3GZNI 2L52A 4TV3A 3IAM1 3O13A 3P4QB 2N1WA 4LNKA 4A8XC 3Q8AA 4ZRJA 5BMIA 3Q2AC 3APDA 4B9KA 1F2RI 1Q1OA 5TSSA 3RULA 1XCTL 1YN3A 3WAOA 1QILA 4WWOA 3L16A 2KC1A 3R2IA 4RNAA 4LTUA 3VH4B 1FXAA 4BOSC 2WNMA 4HWIB 2DZIA 2NVUI 3PRZA 1UWXA 4JL9A 2C5LC 3FAHA 1Z2MA 1BXTA 3U7DA
chains in the Genus database with same CATH topology
2DHZA 2KMAA 3ZIMA 2O2VA 4MSQB 4I6LB 3MHSD 1SGHA 4MSMB 3DOWA 4PYZA 1Z5SB 1UBIA 1XD3B 2K8HA 4BBNF 3WAMA 2KJRA 3PLVA 2XEWA 5BO4B 5FR6A 2MX2A 2MCNB 2HTHA 2PJHA 2MBBB 4GDKB 2FAZA 3VQIA 3KUCB 4LDTB 3ZNZB 2JXXA 2KC2A 4IC7B 4W9EA 3VUYA 4FJYA 1ZGUB 2LZ6A 2M4NA 4KV2A 2O6VB 1XT9B 1WMHB 4GDLB 2IO1B 5LXIB 4KIKB 1OQYA 2KQ7A 4G0NB 2JRIB 3SU8X 3M95A 2BKRB 2IO0B 3GOEA 5KHQA 4AWJA 4EEWA 3QC8B 2G45B 3RD2A 3T9LA 4EKUA 2KJHB 3R7RA 4OVUA 5L83A 2EMTA 1KOTA 4K7WA 3A1QB 2JF5A 3UQBA 3R3MA 4F7ZA 1WI0A 1GUAB 3B0AA 2RSUA 3UINB 1H4RA 1UBQA 2N1VA 3PTFC 4GOCA 4RM9A 3PRPB 1G6JA 2K25A 4P7IA 3RZWC 2BYVE 4MJSA 2J0JA 2C60A 4ANUA 4YL8A 2V1YA 1GC6A 2AL6A 3NHEB 2Z0DB 4J6IA 4M8MA 3UIPB 2XK5A 2ZCBA 4FJVB 2KWVB 3KUDB 1P98A 3ZTCA 1ISNA 4DDID 2LRUA 4ANVA 2LD9A 1V5TA 4ANXA 3K9PB 3V61A 4HLEA 4FJZA 2FUHB 1WJUA 1E8WA 1WM2A 4A3OA 1V2YA 4OVVA 3ZO5B 2GBJA 5D6JB 3RT3B 2ZEQA 2MP2A 1UD7A 2NBUA 3BY4B 1ZKHA 2ZNVC 2LVOA 2IO2B 2REXA 2CR5A 3QAQA 1V5OA 3OJ4B 3WALA 2JT4B 4DHZB 4IWOA 4RMAA 2JUOA 2CHWA 1E90A 2D2QA 1R4NI 2JPHA 4K7SA 4WJOA 1AARA 1WR6E 2EMSA 3RCZA 5KHOA 2NR2A 2K8CA 3H6NA 3LJ3A 4NY0A 5AZFA 3BINA 3I3TB 2DAFA 2KO3A 2LGXA 2KX3A 2M0XA 4BBNC 2IYDB 4FN2A 5IAAC 4DXAB 4W9HA 2ZPYA 2HE7A 1Q0WB 5LLIA 1PQSA 4ANWA 3U8ZA 4ASWC 3A9KA 2W9NA 1LXDA 1X1MA 1EF1A 4IWQA 3NY5A 1FXTB 2L0FA 2O2VB 3QX1A 1GNUA 1HE8A 2OJRA 3CSTA 4ICVA 2KN5A 4FADA 3N32A 1L2NA 1LQBA 4JQWC 1Y8RC 2OOBB 3ZLZA 1WE7A 3QIJA 3EFUA 2G3QB 2IY1B 4W9LA 4WQOB 4BKTA 2BYFA 4BFRA 4HXDA 2VRRB 3H9DA 2FCQA 4TUUA 4AJWA 4CO7A 4AOFA 1J8CA 4A20A 3EC8A 2FCMA 3DBLI 3ZW3A 1SE9A 2G4SA 5DCNA 1L7YA 1EUVB 5DPWA 5E6NA 2D07B 2KFKA 3JSVB 1Q5WB 3OAWA 4I6NB 2BWES 5DPTA 3NZUA 3PS6A 4X57B 3DCGA 2N9PC 3PV1A 1K8RB 4ICUA 3LDZE 2D10A 1WZ3A 2MA9B 3HM3A 4JGHB 2LASA 4RM8A 4PS8A 2L05A 2LUEA 4TKNA 2N9EB 1IPGA 2CKHB 4MJSB 4E3CA 3W1SA 4G11A 2LJ5A 2KD0A 4HCPB 3SHQA 2HJ8A 5CTRC 2WWZA 1WGGA 3PREA 2XK5B 1GC7A 1NDDA 3AXCA 3PGEA 5D94A 1TTNA 2BGFA 4GXBA 2G4DB 1UELA 3WIMA 2LGYA 1WJ4A 4MGIE 5JZEB 2KDEB 3L54A 2K39A 3V6EB 3V6CB 2LWPA 3JVZX 2WX0A 2LVQA 4IM2A 2KJ6A 2MP2B 4LDTD 4EUTA 2UWQA 1WFYA 2M8SA 5HKHA 3TCAA 3DVGY 1YX6B 3JSVA 3UQAA 2DZKA 3DDCB 3AULA 2MRPA 3PLUA 4II3B 1SIFA 4GMVA 2O6VD 2N4FA 3D32A 1V86A 3VHTC 2KTRA 1JRUA 3M62B 1WGRA 4IWPA 4W9FA 4M0WB 3KW5B 3PHWB 1RAXA 2NBWB 2PEAA 3CF6E 1E7VA 3A33B 2V3SA 4GIVA 2GBKA 5AZHA 3R7QA 4EZKA 1E7UA 4WJPA 5E6OA 3QHTA 1KM7A 3A4RA 1UZXB 5G2NA 2NPTA 2C7NB 2KXJA 4GU2A 1OGWA 1WM3A 1WYWB 2FIDA 3ZVVA 2ASQA 3K9OB 3DBHI 1BT0A 3NOBA 3B08A 3H7PA 4IM0A 2M17A 1RRBA 1MG8A 3A9KB 2XBBC 3SD5A 1UGMA 2KKCA 3ZNGC 5E6PA 1R4MI 1RLFA 4G3XB 2JRHA 5CHVC 3ZDMC 1WIAA 2NCNA 3ZNHB 2J0KA 3PZDA 1U4AA 4FHJA 2J0MA 3L10B 1P1AA 4F8CB 2MWSB 4N9F4 4MM3A 1E8ZA 1J19A 5DPRA 3L0WB 4ZRKA 3VH3B 4CYEA 2N7EA 2ZPNA 5JHBA 1J0GA 1UH6A 3Q3FA 3HK0A 1WY8A 2L0TA 5GMVA 2IO3B 3DVNV 3ZRCA 3HM6X 1S1QB 4XX5A 1D3ZA 5CHWA 5JH5C 4HPLB 4NJ7A 3DBSA 2YVCA 4BKSD 3CSFA 3VUXA 1GJZA 3VFKA 4URKA 2DAJA 2KFKB 2CHXA 2ZVOA 2MBEA 3KYDD 3TIXA 1OEYJ 3QA8A 3C0RB 2DYMA 1QZEA 2C7HA 1P3QU 2FNJB 3JW0X 2BPSA 3MTNB 2BWFA 4NNJB 1YQBA 2I1KA 4XC2A 2KMCA 4MGYE 2C7MB 2QHOA 4W9IA 2KZRA 3QARA 4CHKA 2MLBA 1F9JA 4LCDE 4TQ1A 3ZNID 2V4LA 5LXHA 3AU4A 1TZ1A 3IG3A 2UYZB 1WR1A 1LFDA 1NBFC 3UGBB 2L00B 5L95C 5JHAA 4KDIC 2ZCCA 5DPSA 1IYFA 2D3GA 4B6WA 5C1ZA 1I35A 1P9DU 3PT2B 2AWTA 3A4SC 4IM3A 1WF9A 1WGHA 4DHJB 2RGFA 4F1SA 2KDIA 4XZ4A 4DDGD 4MELA 1TBEA 3UIOB 4FA6A 2GOWA 2L8JA 4DHZE 2WDTB 4FBJB 5EDSA 3H7SA 3B1LX 1EF5A 3NS8A 3IHPC 2MW5A 4NPNA 2B3AA 4HVBA 2AYOB 3PVLA 2A4ZA 3EHVA 4AUQC 2ZJDA 2C9WB 2KTRB 3HIZA 5J2RA 3ENEA 5J17A 2GBNA 4BKGA 3A9JA 4HDQA 2KNBA 2WYQA 1M94A 4PS7A 5J18A 2IY0B 4AP4C 2FIFA 2DYOA 2L76A 1WE6A 3DVGX 3QQ8B 2AEHA 3N30A 2DZMA 2Y5BB 5D2MB 1WX7A 1WZ0A 2KWCA 4LJPB 2NPTB 2KTFA 1VCBA 4W9GA 3PRMB 1WH3A 4ZRIA 4WWNA 2K1FA 3WAPA 4G50A 1P0RA 3OJ3A 4GB9A 2KQSA 3DPDA 1V6EA 2MBQA 1WX9A 3KYCD 3H7PB 1NI2A 3APCA 3ML9A 4KZCA 4M8NA 2IZVB 4B95A 2Z0EB 2KLCA 3P2BA 1WXAA 4FULA 4WWPA 3H1UA 2RR9A 3T8MA 2KK8A 2Z59B 3M3JA 3M63B 2DYBA 4EFOA 2MQJA 1TGZB 3V60A 2GBMA 2M1MA 1YD8U 2L3ZA 2D11A 2MBOA 3TL5A 2LGDA 3VTVA 3ONSA 4NAWA 5AEKB 1E8YA 2KWUB 4DK5A 3VTUA 4JLCA 5AZGA 3W1YA 4TQ0A 1WXVA 1E8XA 1XQQA 1CMXB 3QJZA 2CHZA 3VVWB 2GMIC 2K8BA 2KLGA 1VD2A 3JYUA 4ZYNA 2RPQA 1C3TA 3TMPB 4KVGB 3IVFA 2CS4A 4A3PA 1GG3A 1WXMA 3VUWA 3IFWB 4EZLA 4BOZB 1V9JA 5G55A 2IBIB 2PE6B 4NQLB 3O65B 2BKFA 1KJTA 2JZ3B 3KUZA 2NBVB 3PSEB 4KSKC 4E74A 2N9XA 4WAAA 2LRWA 3RUIB 3QWZB 3HHMA 2CU1A 4HDOA 4IUMB 4W9JA 2GBRA 4MDKE 2JZZA 1WRDB 1C1YB 1RFAA 2A5UA 4GN1A 3NZSA 4IW0A 2AL3A 2KX0A 3VXWA 2KOXA 1IP9A 4FLHA 5D7GA 3VTWA 4WJQA 2LXAA 3QCAA 5CHFA 2K6DB 3ECIA 3W1SC 3L13A 4MEMA 3ML8A 1EO6A 3TBLD 1WXSA 3MJWA 4KDLB 1WGDA 3WA0A 2KFJA 2EKEC 3VAWA 5TR5A 1OTRB 1WGYA 1ZW7A 1V80A 4GDKA 4HK2A 4HPMB 3ZTDA 4LJOB 2WX1A 4I6PA 3DQVA 4DBGA 4EZJA 4E71A 4K81A 1WJ6A 2DZJA 4W9KA 2O6VA 1WMHA 4GDLA 2DENB 4K7UA 2RD0A 4DWFA 4KIKA 1A5RA 3Q3JA 2KHWB 5IA7A 3APFA 3UF8A 3EECA 3KVFB 3A9JB 4W9DA 2JVCA 3N3KB 4FHKA 4GGQA 4NQKE 4MGKE 3L17A 2K6QA 4PYUA 3U30A 2ZZPB 1T0YA 3PPAA 3ZKJC 3A1QA 1WX8A 2BF8B 4MH0E 4PS3A 3WANA 4IG7B 3R66C 2LI5A 2FCNA 4MGZE 4NJ6A 1V49A 1WJNA 3X0WA 2JWZA 2BYEA 2R2OA 2N7DA 3DBRI 3AI5A 4II2B 3SDLC 3L08A 3QK0A 1V81A 3RYTA 3GZNI 4TV3A 1S3SG 3OLMD 3RZFA 2L7RA 4EOYA 2PE9A 2MSED 3CMMB 1OEYA 2R2QA 2KVRA 4NAWB 3X23A 3ZDTA 2N1WA 2ZNVB 4DHJD 3ZUNA 4ZRJA 3KH0A 3ALBA 3APDA 4B9KA 2LXCA 3TJPA 1Q1OA 4BKSA 2NS5A 1LM8B 4GSWA 4ZDVA 4JIOU 3RULA 2KANA 2YLMA 1E5WA 3WAOA 4KSLC 4HJKA 4WWOA 2HD5B 3DVNU 3L16A 2KC1A 4KZ0A 1I42A 1KLVA 3VDZA 1YIWA 3VH4B 2LVPA 2JY6A 2KDFB 2PPHA 4AJYB 5C23A 4BOSC 5CX3A 4WJNA 2KDBA 4K1RB 4HWIB 2DZIA 2FCSA 2NVUI 3PRZA 3PHXB 4BVUC 2MBHA 3IBEA 3AU5A 1YJ1A 2DX5B 1YX5B 3ZRFA 2J7QB 4JL9A 2I1JA 2C5LC 1H8CA 3V62A 3S2AA 1Z2MA 4HCNB 3U7DA 4W9CA 2ZVNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2DHZ A;  2KMA A;  3ZIM A;  2O2V A;  4MSQ B;  4I6L B;  3MHS D;  1SGH A;  4MSM B;  3DOW A;  4PYZ A;  1Z5S B;  1UBI A;  1XD3 B;  2K8H A;  4BBN F;  3WAM A;  2KJR A;  3PLV A;  2XEW A;  5BO4 B;  5FR6 A;  2MX2 A;  2MCN B;  2HTH A;  2PJH A;  2MBB B;  4GDK B;  2FAZ A;  3VQI A;  3KUC B;  4LDT B;  3ZNZ B;  2JXX A;  2KC2 A;  4IC7 B;  4W9E A;  3VUY A;  4FJY A;  1ZGU B;  2LZ6 A;  2M4N A;  4KV2 A;  2O6V B;  1XT9 B;  1WMH B;  4GDL B;  2IO1 B;  5LXI B;  4KIK B;  1OQY A;  2KQ7 A;  4G0N B;  2JRI B;  3SU8 X;  3M95 A;  2BKR B;  2IO0 B;  3GOE A;  5KHQ A;  4AWJ A;  4EEW A;  3QC8 B;  2G45 B;  3RD2 A;  3T9L A;  4EKU A;  2KJH B;  3R7R A;  4OVU A;  5L83 A;  2EMT A;  1KOT A;  4K7W A;  3A1Q B;  2JF5 A;  3UQB A;  3R3M A;  4F7Z A;  1WI0 A;  1GUA B;  3B0A A;  2RSU A;  3UIN B;  1H4R A;  1UBQ A;  2N1V A;  3PTF C;  4GOC A;  4RM9 A;  3PRP B;  1G6J A;  2K25 A;  4P7I A;  3RZW C;  2BYV E;  4MJS A;  2J0J A;  2C60 A;  4ANU A;  4YL8 A;  2V1Y A;  1GC6 A;  2AL6 A;  3NHE B;  2Z0D B;  4J6I A;  4M8M A;  3UIP B;  2XK5 A;  2ZCB A;  4FJV B;  2KWV B;  3KUD B;  1P98 A;  3ZTC A;  1ISN A;  4DDI D;  2LRU A;  4ANV A;  2LD9 A;  1V5T A;  4ANX A;  3K9P B;  3V61 A;  4HLE A;  4FJZ A;  2FUH B;  1WJU A;  1E8W A;  1WM2 A;  4A3O A;  1V2Y A;  4OVV A;  3ZO5 B;  2GBJ A;  5D6J B;  3RT3 B;  2ZEQ A;  2MP2 A;  1UD7 A;  2NBU A;  3BY4 B;  1ZKH A;  2ZNV C;  2LVO A;  2IO2 B;  2REX A;  2CR5 A;  3QAQ A;  1V5O A;  3OJ4 B;  3WAL A;  2JT4 B;  4DHZ B;  4IWO A;  4RMA A;  2JUO A;  2CHW A;  1E90 A;  2D2Q A;  1R4N I;  2JPH A;  4K7S A;  4WJO A;  1AAR A;  1WR6 E;  2EMS A;  3RCZ A;  5KHO A;  2NR2 A;  2K8C A;  3H6N A;  3LJ3 A;  4NY0 A;  5AZF A;  3BIN A;  3I3T B;  2DAF A;  2KO3 A;  2LGX A;  2KX3 A;  2M0X A;  4BBN C;  2IYD B;  4FN2 A;  5IAA C;  4DXA B;  4W9H A;  2ZPY A;  2HE7 A;  1Q0W B;  5LLI A;  1PQS A;  4ANW A;  3U8Z A;  4ASW C;  3A9K A;  2W9N A;  1LXD A;  1X1M A;  1EF1 A;  4IWQ A;  3NY5 A;  1FXT B;  2L0F A;  2O2V B;  3QX1 A;  1GNU A;  1HE8 A;  2OJR A;  3CST A;  4ICV A;  2KN5 A;  4FAD A;  3N32 A;  1L2N A;  1LQB A;  4JQW C;  1Y8R C;  2OOB B;  3ZLZ A;  1WE7 A;  3QIJ A;  3EFU A;  2G3Q B;  2IY1 B;  4W9L A;  4WQO B;  4BKT A;  2BYF A;  4BFR A;  4HXD A;  2VRR B;  3H9D A;  2FCQ A;  4TUU A;  4AJW A;  4CO7 A;  4AOF A;  1J8C A;  4A20 A;  3EC8 A;  2FCM A;  3DBL I;  3ZW3 A;  1SE9 A;  2G4S A;  5DCN A;  1L7Y A;  1EUV B;  5DPW A;  5E6N A;  2D07 B;  2KFK A;  3JSV B;  1Q5W B;  3OAW A;  4I6N B;  2BWE S;  5DPT A;  3NZU A;  3PS6 A;  4X57 B;  3DCG A;  2N9P C;  3PV1 A;  1K8R B;  4ICU A;  3LDZ E;  2D10 A;  1WZ3 A;  2MA9 B;  3HM3 A;  4JGH B;  2LAS A;  4RM8 A;  4PS8 A;  2L05 A;  2LUE A;  4TKN A;  2N9E B;  1IPG A;  2CKH B;  4MJS B;  4E3C A;  3W1S A;  4G11 A;  2LJ5 A;  2KD0 A;  4HCP B;  3SHQ A;  2HJ8 A;  5CTR C;  2WWZ A;  1WGG A;  3PRE A;  2XK5 B;  1GC7 A;  1NDD A;  3AXC A;  3PGE A;  5D94 A;  1TTN A;  2BGF A;  4GXB A;  2G4D B;  1UEL A;  3WIM A;  2LGY A;  1WJ4 A;  4MGI E;  5JZE B;  2KDE B;  3L54 A;  2K39 A;  3V6E B;  3V6C B;  2LWP A;  3JVZ X;  2WX0 A;  2LVQ A;  4IM2 A;  2KJ6 A;  2MP2 B;  4LDT D;  4EUT A;  2UWQ A;  1WFY A;  2M8S A;  5HKH A;  3TCA A;  3DVG Y;  1YX6 B;  3JSV A;  3UQA A;  2DZK A;  3DDC B;  3AUL A;  2MRP A;  3PLU A;  4II3 B;  1SIF A;  4GMV A;  2O6V D;  2N4F A;  3D32 A;  1V86 A;  3VHT C;  2KTR A;  1JRU A;  3M62 B;  1WGR A;  4IWP A;  4W9F A;  4M0W B;  3KW5 B;  3PHW B;  1RAX A;  2NBW B;  2PEA A;  3CF6 E;  1E7V A;  3A33 B;  2V3S A;  4GIV A;  2GBK A;  5AZH A;  3R7Q A;  4EZK A;  1E7U A;  4WJP A;  5E6O A;  3QHT A;  1KM7 A;  3A4R A;  1UZX B;  5G2N A;  2NPT A;  2C7N B;  2KXJ A;  4GU2 A;  1OGW A;  1WM3 A;  1WYW B;  2FID A;  3ZVV A;  2ASQ A;  3K9O B;  3DBH I;  1BT0 A;  3NOB A;  3B08 A;  3H7P A;  4IM0 A;  2M17 A;  1RRB A;  1MG8 A;  3A9K B;  2XBB C;  3SD5 A;  1UGM A;  2KKC A;  3ZNG C;  5E6P A;  1R4M I;  1RLF A;  4G3X B;  2JRH A;  5CHV C;  3ZDM C;  1WIA A;  2NCN A;  3ZNH B;  2J0K A;  3PZD A;  1U4A A;  4FHJ A;  2J0M A;  3L10 B;  1P1A A;  4F8C B;  2MWS B;  4N9F 4;  4MM3 A;  1E8Z A;  1J19 A;  5DPR A;  3L0W B;  4ZRK A;  3VH3 B;  4CYE A;  2N7E A;  2ZPN A;  5JHB A;  1J0G A;  1UH6 A;  3Q3F A;  3HK0 A;  1WY8 A;  2L0T A;  5GMV A;  2IO3 B;  3DVN V;  3ZRC A;  3HM6 X;  1S1Q B;  4XX5 A;  1D3Z A;  5CHW A;  5JH5 C;  4HPL B;  4NJ7 A;  3DBS A;  2YVC A;  4BKS D;  3CSF A;  3VUX A;  1GJZ A;  3VFK A;  4URK A;  2DAJ A;  2KFK B;  2CHX A;  2ZVO A;  2MBE A;  3KYD D;  3TIX A;  1OEY J;  3QA8 A;  3C0R B;  2DYM A;  1QZE A;  2C7H A;  1P3Q U;  2FNJ B;  3JW0 X;  2BPS A;  3MTN B;  2BWF A;  4NNJ B;  1YQB A;  2I1K A;  4XC2 A;  2KMC A;  4MGY E;  2C7M B;  2QHO A;  4W9I A;  2KZR A;  3QAR A;  4CHK A;  2MLB A;  1F9J A;  4LCD E;  4TQ1 A;  3ZNI D;  2V4L A;  5LXH A;  3AU4 A;  1TZ1 A;  3IG3 A;  2UYZ B;  1WR1 A;  1LFD A;  1NBF C;  3UGB B;  2L00 B;  5L95 C;  5JHA A;  4KDI C;  2ZCC A;  5DPS A;  1IYF A;  2D3G A;  4B6W A;  5C1Z A;  1I35 A;  1P9D U;  3PT2 B;  2AWT A;  3A4S C;  4IM3 A;  1WF9 A;  1WGH A;  4DHJ B;  2RGF A;  4F1S A;  2KDI A;  4XZ4 A;  4DDG D;  4MEL A;  1TBE A;  3UIO B;  4FA6 A;  2GOW A;  2L8J A;  4DHZ E;  2WDT B;  4FBJ B;  5EDS A;  3H7S A;  3B1L X;  1EF5 A;  3NS8 A;  3IHP C;  2MW5 A;  4NPN A;  2B3A A;  4HVB A;  2AYO B;  3PVL A;  2A4Z A;  3EHV A;  4AUQ C;  2ZJD A;  2C9W B;  2KTR B;  3HIZ A;  5J2R A;  3ENE A;  5J17 A;  2GBN A;  4BKG A;  3A9J A;  4HDQ A;  2KNB A;  2WYQ A;  1M94 A;  4PS7 A;  5J18 A;  2IY0 B;  4AP4 C;  2FIF A;  2DYO A;  2L76 A;  1WE6 A;  3DVG X;  3QQ8 B;  2AEH A;  3N30 A;  2DZM A;  2Y5B B;  5D2M B;  1WX7 A;  1WZ0 A;  2KWC A;  4LJP B;  2NPT B;  2KTF A;  1VCB A;  4W9G A;  3PRM B;  1WH3 A;  4ZRI A;  4WWN A;  2K1F A;  3WAP A;  4G50 A;  1P0R A;  3OJ3 A;  4GB9 A;  2KQS A;  3DPD A;  1V6E A;  2MBQ A;  1WX9 A;  3KYC D;  3H7P B;  1NI2 A;  3APC A;  3ML9 A;  4KZC A;  4M8N A;  2IZV B;  4B95 A;  2Z0E B;  2KLC A;  3P2B A;  1WXA A;  4FUL A;  4WWP A;  3H1U A;  2RR9 A;  3T8M A;  2KK8 A;  2Z59 B;  3M3J A;  3M63 B;  2DYB A;  4EFO A;  2MQJ A;  1TGZ B;  3V60 A;  2GBM A;  2M1M A;  1YD8 U;  2L3Z A;  2D11 A;  2MBO A;  3TL5 A;  2LGD A;  3VTV A;  3ONS A;  4NAW A;  5AEK B;  1E8Y A;  2KWU B;  4DK5 A;  3VTU A;  4JLC A;  5AZG A;  3W1Y A;  4TQ0 A;  1WXV A;  1E8X A;  1XQQ A;  1CMX B;  3QJZ A;  2CHZ A;  3VVW B;  2GMI C;  2K8B A;  2KLG A;  1VD2 A;  3JYU A;  4ZYN A;  2RPQ A;  1C3T A;  3TMP B;  4KVG B;  3IVF A;  2CS4 A;  4A3P A;  1GG3 A;  1WXM A;  3VUW A;  3IFW B;  4EZL A;  4BOZ B;  1V9J A;  5G55 A;  2IBI B;  2PE6 B;  4NQL B;  3O65 B;  2BKF A;  1KJT A;  2JZ3 B;  3KUZ A;  2NBV B;  3PSE B;  4KSK C;  4E74 A;  2N9X A;  4WAA A;  2LRW A;  3RUI B;  3QWZ B;  3HHM A;  2CU1 A;  4HDO A;  4IUM B;  4W9J A;  2GBR A;  4MDK E;  2JZZ A;  1WRD B;  1C1Y B;  1RFA A;  2A5U A;  4GN1 A;  3NZS A;  4IW0 A;  2AL3 A;  2KX0 A;  3VXW A;  2KOX A;  1IP9 A;  4FLH A;  5D7G A;  3VTW A;  4WJQ A;  2LXA A;  3QCA A;  5CHF A;  2K6D B;  3ECI A;  3W1S C;  3L13 A;  4MEM A;  3ML8 A;  1EO6 A;  3TBL D;  1WXS A;  3MJW A;  4KDL B;  1WGD A;  3WA0 A;  2KFJ A;  2EKE C;  3VAW A;  5TR5 A;  1OTR B;  1WGY A;  1ZW7 A;  1V80 A;  4GDK A;  4HK2 A;  4HPM B;  3ZTD A;  4LJO B;  2WX1 A;  4I6P A;  3DQV A;  4DBG A;  4EZJ A;  4E71 A;  4K81 A;  1WJ6 A;  2DZJ A;  4W9K A;  2O6V A;  1WMH A;  4GDL A;  2DEN B;  4K7U A;  2RD0 A;  4DWF A;  4KIK A;  1A5R A;  3Q3J A;  2KHW B;  5IA7 A;  3APF A;  3UF8 A;  3EEC A;  3KVF B;  3A9J B;  4W9D A;  2JVC A;  3N3K B;  4FHK A;  4GGQ A;  4NQK E;  4MGK E;  3L17 A;  2K6Q A;  4PYU A;  3U30 A;  2ZZP B;  1T0Y A;  3PPA A;  3ZKJ C;  3A1Q A;  1WX8 A;  2BF8 B;  4MH0 E;  4PS3 A;  3WAN A;  4IG7 B;  3R66 C;  2LI5 A;  2FCN A;  4MGZ E;  4NJ6 A;  1V49 A;  1WJN A;  3X0W A;  2JWZ A;  2BYE A;  2R2O A;  2N7D A;  3DBR I;  3AI5 A;  4II2 B;  3SDL C;  3L08 A;  3QK0 A;  1V81 A;  3RYT A;  3GZN I;  4TV3 A;  1S3S G;  3OLM D;  3RZF A;  2L7R A;  4EOY A;  2PE9 A;  2MSE D;  3CMM B;  1OEY A;  2R2Q A;  2KVR A;  4NAW B;  3X23 A;  3ZDT A;  2N1W A;  2ZNV B;  4DHJ D;  3ZUN A;  4ZRJ A;  3KH0 A;  3ALB A;  3APD A;  4B9K A;  2LXC A;  3TJP A;  1Q1O A;  4BKS A;  2NS5 A;  1LM8 B;  4GSW A;  4ZDV A;  4JIO U;  3RUL A;  2KAN A;  2YLM A;  1E5W A;  3WAO A;  4KSL C;  4HJK A;  4WWO A;  2HD5 B;  3DVN U;  3L16 A;  2KC1 A;  4KZ0 A;  1I42 A;  1KLV A;  3VDZ A;  1YIW A;  3VH4 B;  2LVP A;  2JY6 A;  2KDF B;  2PPH A;  4AJY B;  5C23 A;  4BOS C;  5CX3 A;  4WJN A;  2KDB A;  4K1R B;  4HWI B;  2DZI A;  2FCS A;  2NVU I;  3PRZ A;  3PHX B;  4BVU C;  2MBH A;  3IBE A;  3AU5 A;  1YJ1 A;  2DX5 B;  1YX5 B;  3ZRF A;  2J7Q B;  4JL9 A;  2I1J A;  2C5L C;  1H8C A;  3V62 A;  3S2A A;  1Z2M A;  4HCN B;  3U7D A;  4W9C A;  2ZVN A; 
#chains in the Genus database with same CATH topology
 2LMC A;  2O2V A;  4MSM B;  1XD3 B;  3WAM A;  2KJR A;  2J52 A;  2XEW A;  4R3D A;  1R4M B;  4GDK B;  1DOX A;  3KUC B;  5T8I A;  2JXX A;  4IC7 B;  3Q69 A;  1VDV A;  1SBB B;  1WMH B;  2IO1 B;  4YTN B;  5BYR A;  4G0N B;  4S17 A;  3AE1 B;  1DGJ A;  1XF5 L;  2IO0 B;  1TS3 A;  5KHQ A;  2G9H D;  3T9L A;  2G45 B;  2KT7 A;  1IBX A;  1WI0 A;  1JQ4 A;  3UIN B;  1UBQ A;  3PTF C;  3PRP B;  3CWI A;  1KLU D;  2K25 A;  1PDX A;  2BYV E;  4YL8 A;  1XXG A;  2V1Y A;  3AED B;  1N61 A;  4GLS C;  3ZTC A;  4DDI D;  4ANV A;  1SEB D;  1V5T A;  3K9P B;  4HLE A;  2FUH B;  1WM2 A;  4A55 A;  4OVV A;  1Q10 A;  3RT3 B;  1FCL A;  2DLB A;  1UD7 A;  2WXL A;  4OZA A;  2ZNV C;  1T3Q A;  1FPY A;  2CR5 A;  2JYT A;  3QAQ A;  3OJ4 B;  3WAL A;  4DHZ B;  5JXV A;  2WXK A;  4RMA A;  1D5X C;  1E90 A;  3AE4 B;  3E9S A;  4K7S A;  5KHO A;  3H6N A;  3BIN A;  3I3T B;  1P7F A;  2LGX A;  2KX3 A;  2OED A;  5IAA C;  2LUM A;  4DXA B;  3ZJU A;  1Q0W B;  3A9K A;  2PKO A;  1HE8 A;  2KN5 A;  2WLB A;  1STE A;  2BW2 A;  3RFZ B;  1FNW A;  3QIJ A;  3EFU A;  4N6E B;  4YWG G;  4BKT A;  4D2K A;  2BYF A;  1I4G A;  3RMK C;  2WHI A;  2FCQ A;  3DBL I;  2G4S A;  5DPW A;  5E6N A;  1Q5W B;  3B2F A;  4RCO A;  1ROE A;  1AWD A;  4XE0 A;  3U4E G;  2D10 A;  2MA9 B;  2Y5C A;  2QMT A;  2N9E B;  3RNB C;  4HCP B;  3SHQ A;  2XK5 B;  5D94 A;  3EA6 A;  2E3T A;  1QLB B;  2K5P A;  1V1P A;  2JYE A;  1ZOY B;  2LGY A;  4XWW A;  2QSD A;  4C4V A;  2MP2 B;  1IGC A;  3TCA A;  3DVG Y;  3JSV A;  2MJ3 A;  4II3 B;  1SIF A;  4GMV A;  2O6V D;  3VHT C;  3N9Y C;  1JRU A;  4M0W B;  3PHW B;  3A33 B;  4EZK A;  5AZH A;  2GBK A;  4WJP A;  5E6O A;  1KM7 A;  3AE3 B;  1JWM D;  1UZX B;  2NPT A;  3H8H A;  1WM3 A;  3HVZ A;  1N62 A;  5BYS A;  3K9O B;  4ITK A;  1BT0 A;  3NOB A;  5I4D A;  1RRB A;  2XBB C;  2XN9 C;  1MI0 A;  3LB8 C;  4G3X B;  2NCN A;  2WXI A;  1UNS A;  2IGD A;  4N9F 4;  1E8Z A;  3VH3 B;  1SE4 A;  2N7E A;  2Q5W D;  5H92 C;  3Q3F A;  3HK0 A;  5GMV A;  1TKY A;  3DVN V;  1S1Q B;  5CHW A;  1MFW A;  1GJZ A;  3ZXV A;  2KFK B;  2CHX A;  2ZVO A;  1P7E A;  4MAC A;  3P4S B;  2DYM A;  1QZE A;  1P3Q U;  1ZUD 2;  2FNJ B;  3IAS 1;  1B1Z A;  2OJW A;  4XC2 A;  2KMC A;  4MGY E;  2QHO A;  3PZ8 A;  4CHK A;  1TKG A;  1F9J A;  4LCD E;  3ZNI D;  1TZ1 A;  3IG3 A;  1WR1 A;  5L95 C;  2J42 A;  1IYF A;  2M0A A;  4B6W A;  2CU3 A;  3A4S C;  1WGH A;  3NVV A;  2KDI A;  4MEL A;  4FA6 A;  3MC9 A;  5HFY A;  1SE2 A;  4FBJ B;  5IO9 A;  3N1Y C;  2M19 A;  3B1L X;  2J53 A;  2B76 B;  4NPN A;  4HVB A;  2AYO B;  2LJI A;  4DXF A;  2C9W B;  2GBN A;  3A9J A;  4HDQ A;  2ON8 A;  2FIF A;  5EE1 A;  3VR9 B;  2L76 A;  1WE6 A;  4ARC A;  3N30 A;  1VCB A;  2NTT A;  2Z8L A;  3DPD A;  3AE9 B;  2MJE A;  1WX9 A;  3KYC D;  3IT6 B;  4US9 A;  2J4X A;  3H1U A;  2BB5 A;  2SEB D;  3V60 A;  2GBM A;  2M1M A;  2L3Z A;  1RWS A;  2MBO A;  2V4I B;  3TL5 A;  4NAW A;  5EE0 A;  3T3O A;  4A90 A;  2SAK A;  3W1Y A;  4L2Y A;  1NEN B;  3QJZ A;  3VVW B;  4JWS C;  2KLG A;  2WGS A;  4KKI A;  4ZHP A;  2DBY A;  4ZRP A;  3V3X A;  1N63 A;  5G55 A;  3R8B A;  2WXH A;  3KUZ A;  4KSK C;  2N9X A;  4WAA A;  4LNO A;  1YJJ A;  4YT0 B;  2MHJ A;  4HDO A;  4IUM B;  1MVK A;  1TIF A;  4MDK E;  1C1Y B;  1RFA A;  2A5U A;  2Y5P A;  3VXW A;  3BVZ A;  5AUI A;  1OQQ A;  4JWU C;  5CHF A;  3ECI A;  3W1S C;  1FO4 A;  3MJW A;  2V3N A;  4XDC A;  4OHJ A;  3WA0 A;  2KFJ A;  3VAW A;  5TR5 A;  1ZW7 A;  1B9R A;  2GI9 A;  1BUI C;  3DQV A;  3U52 E;  4DBG A;  2DZJ A;  1XEE A;  2CJO A;  2DEN B;  4KIK A;  5C2T B;  3Q3J A;  3APF A;  4YTP B;  1EWC A;  3FKY A;  2JVC A;  4NQK E;  4MH8 A;  3FIL A;  3A1Q A;  1AW7 A;  3TUO A;  4MH0 E;  1L0V B;  5GXG B;  1ZE3 D;  2QC8 A;  1TKE A;  3X0W A;  1WJN A;  2JWZ A;  1VR9 A;  4IOI E;  3DBR I;  3SDL C;  1KTK A;  3QK0 A;  4P1B C;  2PE9 A;  1OEY A;  1D6E C;  2KVR A;  2ZNV B;  4DHJ D;  3ZUN A;  3Q3N C;  2IDY A;  3KH0 A;  2PW9 A;  2CJN A;  4IDI A;  3AEG B;  4OW0 A;  2EEL A;  1CK1 A;  4BKS A;  2NS5 A;  1LM8 B;  4JIO U;  2KAN A;  1E5W A;  4KSL C;  4HJK A;  1JWU D;  2MH7 A;  4KZ0 A;  2AX5 A;  1KLV A;  3VDZ A;  1C4C A;  2JY6 A;  1I4P A;  2WU2 B;  5C23 A;  1MPE A;  4US8 A;  2M56 B;  3AE6 B;  3Q3O C;  5CX3 A;  3KWL A;  4BVU C;  2MBH A;  1SE3 A;  1H8C A;  4MSQ B;  3DBH B;  1SGH A;  3DOW A;  1Z5S B;  1EU4 A;  2K8H A;  4WIP A;  2HTH A;  4LDT B;  4RGN A;  2KC2 A;  3C8Y A;  2LZ6 A;  1WXQ A;  4GDL B;  2W82 A;  1CZP A;  2JRI B;  5HI1 A;  3SU8 X;  3M95 A;  1WWT A;  1EWY C;  4HEA 1;  4AWJ A;  3QC8 B;  5L83 A;  1XO3 A;  2KJH B;  3RNG C;  1F77 A;  1JW9 D;  3AB5 A;  2JF5 A;  5HHD G;  1T0R C;  1MHX A;  1GUA B;  4RM9 A;  4J3O D;  3P4P B;  2ZW1 A;  3RZW C;  1GC6 A;  2AL6 A;  4J6I A;  3GP7 A;  2ZCB A;  4FJV B;  2KWV B;  1P98 A;  1ISN A;  1GOZ A;  4FJZ A;  1WJU A;  1FEH A;  1QQR A;  5EE3 A;  3Q6B A;  1FMA D;  1I4X A;  2GBJ A;  2IO2 B;  3AM9 A;  2REX A;  1WGK A;  2JT4 B;  3AE2 B;  5FR3 A;  2JUO A;  2CHW A;  1EU3 A;  4WJO A;  4KKJ A;  1WR6 E;  3RCZ A;  2LFI A;  3I9V 1;  3LJ3 A;  2K8C A;  4NY0 A;  1QKZ A;  2K9X A;  2DAF A;  4BBN C;  2IYD B;  4FN2 A;  2LEK A;  2ZPY A;  3UI3 A;  3LYY A;  3U8Z A;  1ACC A;  4ASW C;  2W9N A;  4IWQ A;  1FXT B;  2L0F A;  2KAC A;  3TEW A;  1N60 A;  1ZP0 B;  2K0P A;  3CST A;  4C00 A;  2RDB C;  3N32 A;  1L2N A;  4JQW C;  1Y8R C;  2OOB B;  4USA A;  4W9L A;  1JML A;  3Q14 C;  3H9D A;  4TUU A;  4AJW A;  3NVW A;  1FXI A;  1SB3 C;  4A20 A;  2FCM A;  2QJL A;  4CQN A;  3ZW3 A;  5DCN A;  1PGB A;  2WXN A;  4C7Z A;  3JSV B;  3OAW A;  5G5G A;  2BWE S;  1UGJ A;  2RDH A;  5DPT A;  2V0G A;  3DCG A;  2N9P C;  4M01 A;  3PV1 A;  4QAY A;  3URY A;  4ICU A;  2KN4 A;  3Q8C A;  1WZ3 A;  3HM3 A;  3LDZ E;  4JGH B;  4NZL B;  1KFY B;  4BAX A;  1SIJ A;  1ESF A;  2L05 A;  1IPG A;  4MJS B;  2LJ5 A;  2KD0 A;  2HJ8 A;  3AXC A;  1TTN A;  2BQQ A;  4GXB A;  3RNE C;  2G4D B;  3ABV B;  4UDU C;  2K39 A;  3JVZ X;  1VLB A;  4LNI A;  4EUT A;  2UWQ A;  2M8S A;  4ZRQ A;  3UQA A;  3AUL A;  4RH6 A;  1V86 A;  1WGR A;  4IWP A;  4W9F A;  2FE8 A;  3KW5 B;  1RAX A;  2NBW B;  2PEA A;  3CF6 E;  2E6X A;  2V3S A;  2D3A A;  2W55 A;  1D5Z C;  1FCC C;  4XYC A;  1C9F A;  1I7H A;  1VZ6 A;  2WDV B;  2FID A;  3H7P A;  4IM0 A;  1V8C A;  1NI3 A;  1WRI A;  3RNA C;  3SD5 A;  2KKC A;  3ZNG C;  1R4M I;  2KWD A;  2ONQ A;  3AEB B;  5CHV C;  3ZDM C;  5AUK A;  3ZNH B;  2J0K A;  1R7S A;  2PLP A;  4FHJ A;  4MM3 A;  1J8C A;  2ZPN A;  1FM0 D;  1UH6 A;  1WY8 A;  3HM6 X;  4XX5 A;  3AN1 A;  4HPL B;  3DBS A;  2YVC A;  1HTO A;  4BKS D;  2MBE A;  3KYD D;  2GB1 A;  3C0R B;  3BZD B;  3MP9 A;  2C7H A;  2WXG A;  3ETR A;  3JW0 X;  2BPS A;  3MTN B;  3DWG C;  1L5P A;  4NNJ B;  2I1K A;  1K50 A;  3QAR A;  1TY0 A;  1KLG D;  1AN8 A;  3AU4 A;  1NBF C;  1FIQ A;  2L00 B;  5C1Z A;  4ACF A;  3PT2 B;  2AWT A;  1WF9 A;  3U7Z A;  2RGF A;  4XZ4 A;  4XDD A;  2GOW A;  1TS5 A;  5IN7 A;  3SFD B;  2ZW0 A;  1EM7 A;  2PVO D;  3NS8 A;  1FRR A;  1ZPS A;  3N1X C;  4YXD B;  2A4Z A;  3EHV A;  1QF6 A;  4AUQ C;  3HIZ A;  2KTR B;  2G1E A;  5J2R A;  1MHH E;  3ENE A;  5J17 A;  1YN4 A;  1ET9 A;  2WYQ A;  4PS7 A;  2DYO A;  2Y5B B;  1PGX A;  1WX7 A;  1CJE A;  1WZ0 A;  4TMA B;  1N6Z A;  2KWC A;  2KTF A;  1WSP A;  5H8Y E;  4W9G A;  1WH3 A;  1D5M C;  3WAP A;  1HXY D;  1P0R A;  3OJ3 A;  1V6E A;  1NI2 A;  3PZ7 A;  4KZC A;  3P2B A;  3T8M A;  2GLS A;  1GB4 A;  3TEX A;  3M3J A;  4HKZ E;  4EFO A;  2MQJ A;  1TGZ B;  1FNV A;  2LGD A;  1JAL A;  4K3C A;  3VTV A;  5AZG A;  3RNF C;  1I4Q A;  2K8B A;  1VD2 A;  2RPQ A;  2CS4 A;  4A3P A;  2NMQ A;  1JWS D;  1HZ6 A;  1GG3 A;  3VUW A;  1L4D B;  4EZL A;  2IBI B;  1XCQ L;  2PE6 B;  2R61 A;  2BKF A;  2JZ3 B;  2NBV B;  2XNA C;  2X8X X;  3RUI B;  3QWZ B;  1R4N B;  1TS4 A;  2INN E;  1JWA D;  4N59 A;  2IGH A;  3OWE B;  1HEZ E;  4IW0 A;  2AL3 A;  2KX0 A;  1IP9 A;  5IP4 D;  5D7G A;  4WJQ A;  3N1Z C;  1ET6 A;  4MEM A;  4L23 A;  1EO6 A;  2PIA A;  4KDL B;  4L1B A;  4HPM B;  4GDK A;  4I6P A;  1V97 A;  4W9K A;  1WMH A;  2RD0 A;  2KHW B;  3HRD D;  3R2T A;  3N3K B;  2KVZ A;  3BYT B;  3DHH C;  2BF8 B;  4PS3 A;  2TSS A;  4IG7 B;  2AQ2 B;  3R66 C;  2LI5 A;  4MGZ E;  2WQY B;  3OG5 A;  2R2O A;  3AE5 B;  2N7D A;  4II2 B;  4Q2J A;  1S3S G;  3OLM D;  3RZF A;  4EOY A;  3CMM B;  1VJK A;  3X23 A;  3RN9 C;  3ALB A;  2LXC A;  4GSW A;  1DOI A;  2I2Y A;  1NYQ A;  2WXJ A;  2HD5 B;  3DVN U;  1OFF A;  1I42 A;  1YIW A;  2LVP A;  3RNC C;  4WJN A;  2VH2 A;  2D3C A;  4HJG E;  3PHX B;  1OQR A;  3IBE A;  1YX5 B;  2J7Q B;  2NTS A;  3Q8B A;  2ACZ B;  2H89 B;  2HTM E;  3V62 A;  2KMA A;  1IGD A;  3ZIM A;  4I6L B;  3MHS D;  1I4H A;  5HG2 A;  1UBI A;  4BBN F;  3PLV A;  5FR6 A;  2MX2 A;  1PGA A;  2FAZ A;  2X38 A;  3VQI A;  3BWU D;  3VUY A;  3GS2 A;  1ZGU B;  2M4N A;  1FFU A;  2O6V B;  5LXI B;  2BTE A;  4S0R A;  2JSV X;  2KQ7 A;  5BYQ A;  4RGO S;  3GOE A;  1TT5 B;  3RD2 A;  2EMT A;  4K7W A;  3BK2 A;  3UQB A;  3B0A A;  1H4R A;  2N1V A;  4GOC A;  3IT4 B;  3VR8 B;  2J0J A;  1TJE A;  4M8M A;  4LK0 M;  2XK5 A;  4HKQ A;  2LRU A;  2BVC A;  3LXF A;  4ANX A;  2W3R A;  3V61 A;  3AEA B;  1V2Y A;  1BML C;  5E6J A;  5D3I B;  3ZO5 B;  1UUP A;  5IKC M;  5D6J B;  2ZEQ A;  2MP2 A;  4M00 A;  1QOF A;  3BY4 B;  4TSS A;  1ZKH A;  2LVO A;  3I63 C;  4OZB A;  3L4P A;  3BII D;  4IWO A;  4M0W A;  3CIR B;  3P4R B;  2WXP A;  2K22 A;  1IUE A;  3Q8F A;  2NR2 A;  3VRA B;  2KO3 A;  2LHE A;  1SSN A;  1PQS A;  3P63 A;  5FKA C;  1LXD A;  1X1M A;  2O2V B;  2INP E;  2RMM A;  1XLP A;  3QX1 A;  1GNU A;  3NS1 A;  2ICI A;  3V05 A;  2OJR A;  3P1M A;  3W2D A;  3ZGZ A;  1ZDV A;  4FAD A;  1LQB A;  3J9C A;  4RGM A;  3ZLZ A;  1WE7 A;  2L32 A;  2G3Q B;  1GAQ B;  2IY1 B;  2VRR B;  3W9C B;  4AOF A;  2WXM A;  3EC8 A;  1JRP A;  1SE9 A;  1L7Y A;  1T0Q C;  1RFK A;  4WH4 A;  1L6U A;  2D07 B;  2KFK A;  2QIL A;  3NG0 A;  4I6N B;  1C78 A;  2KDM A;  3FC4 A;  3PS6 A;  4X57 B;  1K8R B;  1IBX B;  3HVD A;  2LAS A;  4PS8 A;  3ZQ4 A;  2LUE A;  4TKN A;  4G11 A;  4YSZ B;  2WWZ A;  1WGG A;  3PRE A;  3PGE A;  1GC7 A;  2MJD A;  2BGF A;  1HTQ A;  5JZE B;  4MGI E;  2KDE B;  4EE2 A;  3E56 A;  2LWP A;  3I5J C;  2WX0 A;  2LVQ A;  4IM2 A;  1WFY A;  2V3P A;  4P1C C;  4AQ7 A;  3D32 A;  3AEE B;  4XWT A;  1KH0 A;  4ARI A;  4GIV A;  3R7Q A;  1E7U A;  4A6Q A;  4BZA A;  3QHT A;  5G2N A;  4GU2 A;  2KXJ A;  1OGW A;  4C7Y A;  2JWU A;  3ZVV A;  1C4P A;  3DBH I;  1MG8 A;  1TY2 A;  2FBW B;  3A9K B;  1UGM A;  3MJ5 A;  3PZD A;  1U4A A;  2J0M A;  1A70 A;  1P1A A;  1WYG A;  5JHB A;  3L0W B;  4CYE A;  3GZN B;  2L0T A;  3ZYY X;  2IO3 B;  3SFE B;  3ZRC A;  4C56 C;  1D3Z A;  2QIE B;  4NJ7 A;  3CSF A;  3VUX A;  3VFK A;  4URK A;  2DAJ A;  4B0M A;  2WXO A;  2JZP A;  4ZOH C;  1T6B X;  1GB1 A;  2BWF A;  1HA5 A;  1YQB A;  3N20 C;  4W9I A;  1VZ8 A;  2KZR A;  1Y56 A;  4PK1 A;  1N5X A;  3KLS X;  3TSS A;  1DOY A;  2V4L A;  5LXH A;  2UYZ B;  3BVG A;  4MT5 A;  3SEB A;  5JHA A;  4KDI C;  1TZO A;  4JPS A;  1P9D U;  1V1P B;  4IM3 A;  4RGT A;  4DHJ B;  4F1S A;  1TBE A;  3UIO B;  2L8J A;  3HUI A;  4C4V B;  5EDS A;  4P6V F;  3IHP C;  2N0S B;  2JU6 X;  2MW5 A;  2ZJD A;  1SJE D;  2DNF A;  3NVY A;  1E10 A;  2KNB A;  1M94 A;  5J18 A;  2IY0 B;  4AP4 C;  3QQ8 B;  2AEH A;  1FFV A;  2DZM A;  4LJP B;  2NPT B;  3PRM B;  3AEF B;  4WWN A;  2K1F A;  4G50 A;  4GB9 A;  1E9M A;  2KQS A;  4P16 A;  3APC A;  3ML9 A;  1YN5 A;  4M8N A;  2IZV B;  2Y3A A;  3AMZ A;  4B95 A;  1L0X B;  4FUL A;  1WXA A;  2RR9 A;  4C80 A;  2KK8 A;  4KX6 B;  3M63 B;  2DYB A;  2D11 A;  3ZXR A;  1D4B A;  4DK5 A;  3VTU A;  1LGR A;  2WXQ A;  4TQ0 A;  3I57 A;  1TS2 A;  1YNT E;  1XQQ A;  1CMX B;  2CHZ A;  2GMI C;  1C3T A;  1J7C A;  4WUR A;  1WXM A;  4BOZ B;  2KAJ A;  1KJT A;  3PSE B;  2L1A A;  4E74 A;  2LRW A;  5IOI A;  4OZC A;  1XLN A;  1GPX A;  2WDR B;  3HHM A;  4AS1 A;  1QOG A;  4K3B A;  4W9J A;  2GBR A;  2VH1 A;  1WRD B;  4GN1 A;  2KOX A;  3VTW A;  3QCA A;  1QOA A;  2QEJ C;  3L13 A;  1WXS A;  3AE7 B;  1QOB A;  1WGD A;  2BBC A;  1KF6 B;  1OTR B;  4HK2 A;  2WP9 B;  1V80 A;  3ZTD A;  4EZJ A;  4E71 A;  2W3S A;  4DXG A;  4K81 A;  2IND C;  3W5V B;  4GDL A;  4DWF A;  2RPV A;  5G5H A;  3UF8 A;  3KVF B;  3A9J B;  4W9D A;  3DBL B;  4GGQ A;  4MGK E;  3L17 A;  2K6Q A;  4PYU A;  3U30 A;  1NVI D;  1T0Y A;  4YTM B;  3C19 A;  3WAN A;  4JE3 B;  1V49 A;  1E6E B;  1L4Z B;  1YOV B;  3AI5 A;  3L08 A;  2K3U A;  3RYT A;  2L7R A;  3U2S C;  2MSE D;  2R2Q A;  4NAW B;  2UU7 A;  3ZDT A;  1K51 A;  4KGT A;  3TJP A;  4ZDV A;  2YLM A;  3MHZ A;  1C76 A;  2KQ4 X;  2KDF B;  2PPH A;  4AJY B;  1RYJ A;  1ZXH A;  2VZK D;  2HDE A;  3MC8 A;  2KDB A;  4K1R B;  2FCS A;  3AU5 A;  1YJ1 A;  2DX5 B;  4N58 A;  3ZRF A;  1ZXI A;  2I1J A;  4DQO C;  3RI7 C;  3S2A A;  1L6V A;  2OHF A;  4HCN B;  5MPO A;  1PFD A;  4W9C A;  2ZVN A;  2DHZ A;  1SXT A;  4PYZ A;  2W54 A;  1MG4 A;  5BO4 B;  2MCN B;  2BS4 B;  1CQV A;  2PJH A;  2MBB B;  4NAM A;  3ZNZ B;  4W9E A;  4FJY A;  4KV2 A;  1F0Z A;  2LHD A;  1XT9 B;  4KIK B;  1OQY A;  1F2R C;  2BKR B;  3ZJV A;  4EEW A;  3R7R A;  4OVU A;  1KOT A;  1YJI A;  3FIL B;  3A1Q B;  4YSX B;  3B2G A;  3R3M A;  4F7Z A;  2RSU A;  1F1H A;  3EGR A;  1J7A A;  1G6J A;  1PYW D;  4P7I A;  4MJS A;  4ANU A;  2C60 A;  3IXS A;  3NHE B;  2Z0D B;  3BK1 A;  3UIP B;  3BVM A;  3KUD B;  3GB1 A;  2LD9 A;  1MJD A;  3P42 A;  1E8W A;  4A3O A;  5BMH A;  4LNF A;  2QDF A;  4FXC A;  2NBU A;  3NJT A;  1SF0 A;  5EE9 A;  3AEC B;  3DWM A;  3KWV A;  3TEY A;  1V5O A;  2BYT A;  1T5X D;  3DHI C;  3AV8 A;  4XGA B;  2D2Q A;  2HJ1 A;  2AQ1 B;  1R4N I;  2JPH A;  1K53 A;  1AAR A;  2EMS A;  5D3D A;  5AZF A;  2M0X A;  4W9H A;  2IGG A;  2HE7 A;  1JRO A;  5LLI A;  2GRI A;  4ANW A;  1E7P B;  3BYY B;  3ZJT A;  2WXF A;  1EF1 A;  3NY5 A;  2PTL A;  4ICV A;  1LO5 D;  1YQ4 B;  4WQO B;  1VZ7 A;  4HXD A;  4BFR A;  3TEZ A;  1JCK B;  4CO7 A;  2PMV A;  3GE8 C;  1EUV B;  4WAF A;  3NUH B;  3NZU A;  2BS2 B;  2QCZ A;  2AQ3 B;  4RM8 A;  2VZK B;  4ZYS A;  3EFC A;  2CKH B;  4E3C A;  3W1S A;  2D3B A;  5CTR C;  2BS3 B;  3B9J A;  1NDD A;  4RFB A;  4B0E A;  1L0Y B;  1J7B A;  1UEL A;  3WIM A;  1N5W A;  2WDQ B;  1WJ4 A;  3L54 A;  1PUT A;  3V6E B;  3V6C B;  2BT6 A;  2KJ6 A;  4LDT D;  5HKH A;  1K52 A;  4NJC A;  1YX6 B;  2DZK A;  3DDC B;  2MRP A;  3PLU A;  4LLG M;  2N4F A;  3NRZ A;  2KTR A;  3M62 B;  2N7J A;  1FRD A;  4YSY B;  1E0Z A;  2DWQ A;  3KQ4 A;  1E7V A;  2H88 B;  2WXR A;  3NVZ A;  3A4R A;  2IJ0 A;  2C7N B;  4KGS A;  3SR6 A;  4REZ A;  1WYW B;  2ASQ A;  2N9L A;  1AYF A;  3B08 A;  2M17 A;  2KYW A;  2EKI A;  3EUB 2;  1RLF A;  5E6P A;  2JRH A;  3MFG A;  2JQR B;  1WIA A;  1FD6 A;  4WWM A;  3L10 B;  3DBR B;  4F8C B;  2MWS B;  2RDG A;  4EKU A;  3Q3M C;  1J19 A;  5DPR A;  4ZRK A;  1J0G A;  4IKG A;  1C79 A;  4A9A A;  1TYG B;  3PO0 A;  5JH5 C;  1NEK B;  2JX5 A;  1HQR D;  1XLQ A;  2WU5 B;  3TIX A;  1OEY J;  3QA8 A;  2WS3 B;  2I38 A;  3T3N A;  1ENF A;  2C7M B;  1T0S C;  4WQM A;  3Q8E A;  2MLB A;  4TQ1 A;  1LFD A;  2INC C;  3UGB B;  2BB6 A;  3W5U B;  1FNU A;  4PT5 A;  2ZCC A;  5DPS A;  2D3G A;  1I35 A;  1UWM A;  4HPP A;  1HZ5 A;  3WCQ A;  1V1O A;  4DDG D;  4DHZ E;  2WDT B;  1VRA B;  3H7S A;  1EF5 A;  4JX1 C;  2L83 A;  3VRB B;  1DYQ A;  2B3A A;  3NZ3 A;  3PVL A;  4O1N A;  1YQ3 B;  1NYR A;  4BKG A;  3DVG X;  1KRH A;  5D2M B;  4ZRI A;  2MBQ A;  3H7P B;  2Z0E B;  2KLC A;  4WWP A;  2Z59 B;  3RPF C;  2V9H A;  1YD8 U;  3ONS A;  5AEK B;  1M4V A;  4MM3 B;  5FK9 C;  1E8Y A;  2KWU B;  4JLC A;  2LGS A;  1XLO A;  4ZHO A;  1WXV A;  4LNN A;  1E8X A;  1C77 A;  3JYU A;  2JXT A;  4H2A A;  4ZYN A;  3AE8 B;  3TMP B;  4KVG B;  3IVF A;  2YEP B;  3IFW B;  1V9J A;  4NQL B;  3O65 B;  2MEK A;  3AH7 A;  2PVG C;  2CU1 A;  2FUG 1;  5C3J B;  2JZZ A;  1YMH E;  3NZS A;  4FLH A;  2LXA A;  2YEP F;  4RF0 A;  2K6D B;  3ML8 A;  3TBL D;  2EKE C;  1WGY A;  4M02 A;  5LNK 1;  2IPK D;  4LJO B;  2WX1 A;  5BMG A;  1WJ6 A;  3GE3 C;  2O6V A;  4K7U A;  1A5R A;  4RF1 A;  1C4A A;  5IA7 A;  1F52 A;  3EEC A;  3DHG C;  3MC0 B;  4FHK A;  4HRS A;  2ZZP B;  3PPA A;  3ZKJ C;  1RM6 C;  1JWB D;  2D5G A;  1WX8 A;  1I4R A;  1SJH D;  1ZDX A;  4HRO A;  1QT9 A;  2FCN A;  4NJ6 A;  1UF0 A;  4OVZ A;  2BYE A;  2LGI A;  2KMM A;  4KGR A;  2N9K A;  1V81 A;  3GZN I;  2L52 A;  4TV3 A;  3IAM 1;  3O13 A;  3P4Q B;  2N1W A;  4LNK A;  4A8X C;  3Q8A A;  4ZRJ A;  5BMI A;  3Q2A C;  3APD A;  4B9K A;  1F2R I;  1Q1O A;  5TSS A;  3RUL A;  1XCT L;  1YN3 A;  3WAO A;  1QIL A;  4WWO A;  3L16 A;  2KC1 A;  3R2I A;  4RNA A;  4LTU A;  3VH4 B;  1FXA A;  4BOS C;  2WNM A;  4HWI B;  2DZI A;  2NVU I;  3PRZ A;  1UWX A;  4JL9 A;  2C5L C;  3FAH A;  1Z2M A;  1BXT A;  3U7D A; 
#chains in the Genus database with same CATH homology
 2DHZ A;  2KMA A;  3ZIM A;  2O2V A;  4MSQ B;  4I6L B;  3MHS D;  1SGH A;  4MSM B;  3DOW A;  4PYZ A;  1Z5S B;  1UBI A;  1XD3 B;  2K8H A;  4BBN F;  3WAM A;  2KJR A;  3PLV A;  2XEW A;  5BO4 B;  5FR6 A;  2MX2 A;  2MCN B;  2HTH A;  2PJH A;  2MBB B;  4GDK B;  2FAZ A;  3VQI A;  3KUC B;  4LDT B;  3ZNZ B;  2JXX A;  2KC2 A;  4IC7 B;  4W9E A;  3VUY A;  4FJY A;  1ZGU B;  2LZ6 A;  2M4N A;  4KV2 A;  2O6V B;  1XT9 B;  1WMH B;  4GDL B;  2IO1 B;  5LXI B;  4KIK B;  1OQY A;  2KQ7 A;  4G0N B;  2JRI B;  3SU8 X;  3M95 A;  2BKR B;  2IO0 B;  3GOE A;  5KHQ A;  4AWJ A;  4EEW A;  3QC8 B;  2G45 B;  3RD2 A;  3T9L A;  4EKU A;  2KJH B;  3R7R A;  4OVU A;  5L83 A;  2EMT A;  1KOT A;  4K7W A;  3A1Q B;  2JF5 A;  3UQB A;  3R3M A;  4F7Z A;  1WI0 A;  1GUA B;  3B0A A;  2RSU A;  3UIN B;  1H4R A;  1UBQ A;  2N1V A;  3PTF C;  4GOC A;  4RM9 A;  3PRP B;  1G6J A;  2K25 A;  4P7I A;  3RZW C;  2BYV E;  4MJS A;  2J0J A;  2C60 A;  4ANU A;  4YL8 A;  2V1Y A;  1GC6 A;  2AL6 A;  3NHE B;  2Z0D B;  4J6I A;  4M8M A;  3UIP B;  2XK5 A;  2ZCB A;  4FJV B;  2KWV B;  3KUD B;  1P98 A;  3ZTC A;  1ISN A;  4DDI D;  2LRU A;  4ANV A;  2LD9 A;  1V5T A;  4ANX A;  3K9P B;  3V61 A;  4HLE A;  4FJZ A;  2FUH B;  1WJU A;  1E8W A;  1WM2 A;  4A3O A;  1V2Y A;  4OVV A;  3ZO5 B;  2GBJ A;  5D6J B;  3RT3 B;  2ZEQ A;  2MP2 A;  1UD7 A;  2NBU A;  3BY4 B;  1ZKH A;  2ZNV C;  2LVO A;  2IO2 B;  2REX A;  2CR5 A;  3QAQ A;  1V5O A;  3OJ4 B;  3WAL A;  2JT4 B;  4DHZ B;  4IWO A;  4RMA A;  2JUO A;  2CHW A;  1E90 A;  2D2Q A;  1R4N I;  2JPH A;  4K7S A;  4WJO A;  1AAR A;  1WR6 E;  2EMS A;  3RCZ A;  5KHO A;  2NR2 A;  2K8C A;  3H6N A;  3LJ3 A;  4NY0 A;  5AZF A;  3BIN A;  3I3T B;  2DAF A;  2KO3 A;  2LGX A;  2KX3 A;  2M0X A;  4BBN C;  2IYD B;  4FN2 A;  5IAA C;  4DXA B;  4W9H A;  2ZPY A;  2HE7 A;  1Q0W B;  5LLI A;  1PQS A;  4ANW A;  3U8Z A;  4ASW C;  3A9K A;  2W9N A;  1LXD A;  1X1M A;  1EF1 A;  4IWQ A;  3NY5 A;  1FXT B;  2L0F A;  2O2V B;  3QX1 A;  1GNU A;  1HE8 A;  2OJR A;  3CST A;  4ICV A;  2KN5 A;  4FAD A;  3N32 A;  1L2N A;  1LQB A;  4JQW C;  1Y8R C;  2OOB B;  3ZLZ A;  1WE7 A;  3QIJ A;  3EFU A;  2G3Q B;  2IY1 B;  4W9L A;  4WQO B;  4BKT A;  2BYF A;  4BFR A;  4HXD A;  2VRR B;  3H9D A;  2FCQ A;  4TUU A;  4AJW A;  4CO7 A;  4AOF A;  1J8C A;  4A20 A;  3EC8 A;  2FCM A;  3DBL I;  3ZW3 A;  1SE9 A;  2G4S A;  5DCN A;  1L7Y A;  1EUV B;  5DPW A;  5E6N A;  2D07 B;  2KFK A;  3JSV B;  1Q5W B;  3OAW A;  4I6N B;  2BWE S;  5DPT A;  3NZU A;  3PS6 A;  4X57 B;  3DCG A;  2N9P C;  3PV1 A;  1K8R B;  4ICU A;  3LDZ E;  2D10 A;  1WZ3 A;  2MA9 B;  3HM3 A;  4JGH B;  2LAS A;  4RM8 A;  4PS8 A;  2L05 A;  2LUE A;  4TKN A;  2N9E B;  1IPG A;  2CKH B;  4MJS B;  4E3C A;  3W1S A;  4G11 A;  2LJ5 A;  2KD0 A;  4HCP B;  3SHQ A;  2HJ8 A;  5CTR C;  2WWZ A;  1WGG A;  3PRE A;  2XK5 B;  1GC7 A;  1NDD A;  3AXC A;  3PGE A;  5D94 A;  1TTN A;  2BGF A;  4GXB A;  2G4D B;  1UEL A;  3WIM A;  2LGY A;  1WJ4 A;  4MGI E;  5JZE B;  2KDE B;  3L54 A;  2K39 A;  3V6E B;  3V6C B;  2LWP A;  3JVZ X;  2WX0 A;  2LVQ A;  4IM2 A;  2KJ6 A;  2MP2 B;  4LDT D;  4EUT A;  2UWQ A;  1WFY A;  2M8S A;  5HKH A;  3TCA A;  3DVG Y;  1YX6 B;  3JSV A;  3UQA A;  2DZK A;  3DDC B;  3AUL A;  2MRP A;  3PLU A;  4II3 B;  1SIF A;  4GMV A;  2O6V D;  2N4F A;  3D32 A;  1V86 A;  3VHT C;  2KTR A;  1JRU A;  3M62 B;  1WGR A;  4IWP A;  4W9F A;  4M0W B;  3KW5 B;  3PHW B;  1RAX A;  2NBW B;  2PEA A;  3CF6 E;  1E7V A;  3A33 B;  2V3S A;  4GIV A;  2GBK A;  5AZH A;  3R7Q A;  4EZK A;  1E7U A;  4WJP A;  5E6O A;  3QHT A;  1KM7 A;  3A4R A;  1UZX B;  5G2N A;  2NPT A;  2C7N B;  2KXJ A;  4GU2 A;  1OGW A;  1WM3 A;  1WYW B;  2FID A;  3ZVV A;  2ASQ A;  3K9O B;  3DBH I;  1BT0 A;  3NOB A;  3B08 A;  3H7P A;  4IM0 A;  2M17 A;  1RRB A;  1MG8 A;  3A9K B;  2XBB C;  3SD5 A;  1UGM A;  2KKC A;  3ZNG C;  5E6P A;  1R4M I;  1RLF A;  4G3X B;  2JRH A;  5CHV C;  3ZDM C;  1WIA A;  2NCN A;  3ZNH B;  2J0K A;  3PZD A;  1U4A A;  4FHJ A;  2J0M A;  3L10 B;  1P1A A;  4F8C B;  2MWS B;  4N9F 4;  4MM3 A;  1E8Z A;  1J19 A;  5DPR A;  3L0W B;  4ZRK A;  3VH3 B;  4CYE A;  2N7E A;  2ZPN A;  5JHB A;  1J0G A;  1UH6 A;  3Q3F A;  3HK0 A;  1WY8 A;  2L0T A;  5GMV A;  2IO3 B;  3DVN V;  3ZRC A;  3HM6 X;  1S1Q B;  4XX5 A;  1D3Z A;  5CHW A;  5JH5 C;  4HPL B;  4NJ7 A;  3DBS A;  2YVC A;  4BKS D;  3CSF A;  3VUX A;  1GJZ A;  3VFK A;  4URK A;  2DAJ A;  2KFK B;  2CHX A;  2ZVO A;  2MBE A;  3KYD D;  3TIX A;  1OEY J;  3QA8 A;  3C0R B;  2DYM A;  1QZE A;  2C7H A;  1P3Q U;  2FNJ B;  3JW0 X;  2BPS A;  3MTN B;  2BWF A;  4NNJ B;  1YQB A;  2I1K A;  4XC2 A;  2KMC A;  4MGY E;  2C7M B;  2QHO A;  4W9I A;  2KZR A;  3QAR A;  4CHK A;  2MLB A;  1F9J A;  4LCD E;  4TQ1 A;  3ZNI D;  2V4L A;  5LXH A;  3AU4 A;  1TZ1 A;  3IG3 A;  2UYZ B;  1WR1 A;  1LFD A;  1NBF C;  3UGB B;  2L00 B;  5L95 C;  5JHA A;  4KDI C;  2ZCC A;  5DPS A;  1IYF A;  2D3G A;  4B6W A;  5C1Z A;  1I35 A;  1P9D U;  3PT2 B;  2AWT A;  3A4S C;  4IM3 A;  1WF9 A;  1WGH A;  4DHJ B;  2RGF A;  4F1S A;  2KDI A;  4XZ4 A;  4DDG D;  4MEL A;  1TBE A;  3UIO B;  4FA6 A;  2GOW A;  2L8J A;  4DHZ E;  2WDT B;  4FBJ B;  5EDS A;  3H7S A;  3B1L X;  1EF5 A;  3NS8 A;  3IHP C;  2MW5 A;  4NPN A;  2B3A A;  4HVB A;  2AYO B;  3PVL A;  2A4Z A;  3EHV A;  4AUQ C;  2ZJD A;  2C9W B;  2KTR B;  3HIZ A;  5J2R A;  3ENE A;  5J17 A;  2GBN A;  4BKG A;  3A9J A;  4HDQ A;  2KNB A;  2WYQ A;  1M94 A;  4PS7 A;  5J18 A;  2IY0 B;  4AP4 C;  2FIF A;  2DYO A;  2L76 A;  1WE6 A;  3DVG X;  3QQ8 B;  2AEH A;  3N30 A;  2DZM A;  2Y5B B;  5D2M B;  1WX7 A;  1WZ0 A;  2KWC A;  4LJP B;  2NPT B;  2KTF A;  1VCB A;  4W9G A;  3PRM B;  1WH3 A;  4ZRI A;  4WWN A;  2K1F A;  3WAP A;  4G50 A;  1P0R A;  3OJ3 A;  4GB9 A;  2KQS A;  3DPD A;  1V6E A;  2MBQ A;  1WX9 A;  3KYC D;  3H7P B;  1NI2 A;  3APC A;  3ML9 A;  4KZC A;  4M8N A;  2IZV B;  4B95 A;  2Z0E B;  2KLC A;  3P2B A;  1WXA A;  4FUL A;  4WWP A;  3H1U A;  2RR9 A;  3T8M A;  2KK8 A;  2Z59 B;  3M3J A;  3M63 B;  2DYB A;  4EFO A;  2MQJ A;  1TGZ B;  3V60 A;  2GBM A;  2M1M A;  1YD8 U;  2L3Z A;  2D11 A;  2MBO A;  3TL5 A;  2LGD A;  3VTV A;  3ONS A;  4NAW A;  5AEK B;  1E8Y A;  2KWU B;  4DK5 A;  3VTU A;  4JLC A;  5AZG A;  3W1Y A;  4TQ0 A;  1WXV A;  1E8X A;  1XQQ A;  1CMX B;  3QJZ A;  2CHZ A;  3VVW B;  2GMI C;  2K8B A;  2KLG A;  1VD2 A;  3JYU A;  4ZYN A;  2RPQ A;  1C3T A;  3TMP B;  4KVG B;  3IVF A;  2CS4 A;  4A3P A;  1GG3 A;  1WXM A;  3VUW A;  3IFW B;  4EZL A;  4BOZ B;  1V9J A;  5G55 A;  2IBI B;  2PE6 B;  4NQL B;  3O65 B;  2BKF A;  1KJT A;  2JZ3 B;  3KUZ A;  2NBV B;  3PSE B;  4KSK C;  4E74 A;  2N9X A;  4WAA A;  2LRW A;  3RUI B;  3QWZ B;  3HHM A;  2CU1 A;  4HDO A;  4IUM B;  4W9J A;  2GBR A;  4MDK E;  2JZZ A;  1WRD B;  1C1Y B;  1RFA A;  2A5U A;  4GN1 A;  3NZS A;  4IW0 A;  2AL3 A;  2KX0 A;  3VXW A;  2KOX A;  1IP9 A;  4FLH A;  5D7G A;  3VTW A;  4WJQ A;  2LXA A;  3QCA A;  5CHF A;  2K6D B;  3ECI A;  3W1S C;  3L13 A;  4MEM A;  3ML8 A;  1EO6 A;  3TBL D;  1WXS A;  3MJW A;  4KDL B;  1WGD A;  3WA0 A;  2KFJ A;  2EKE C;  3VAW A;  5TR5 A;  1OTR B;  1WGY A;  1ZW7 A;  1V80 A;  4GDK A;  4HK2 A;  4HPM B;  3ZTD A;  4LJO B;  2WX1 A;  4I6P A;  3DQV A;  4DBG A;  4EZJ A;  4E71 A;  4K81 A;  1WJ6 A;  2DZJ A;  4W9K A;  2O6V A;  1WMH A;  4GDL A;  2DEN B;  4K7U A;  2RD0 A;  4DWF A;  4KIK A;  1A5R A;  3Q3J A;  2KHW B;  5IA7 A;  3APF A;  3UF8 A;  3EEC A;  3KVF B;  3A9J B;  4W9D A;  2JVC A;  3N3K B;  4FHK A;  4GGQ A;  4NQK E;  4MGK E;  3L17 A;  2K6Q A;  4PYU A;  3U30 A;  2ZZP B;  1T0Y A;  3PPA A;  3ZKJ C;  3A1Q A;  1WX8 A;  2BF8 B;  4MH0 E;  4PS3 A;  3WAN A;  4IG7 B;  3R66 C;  2LI5 A;  2FCN A;  4MGZ E;  4NJ6 A;  1V49 A;  1WJN A;  3X0W A;  2JWZ A;  2BYE A;  2R2O A;  2N7D A;  3DBR I;  3AI5 A;  4II2 B;  3SDL C;  3L08 A;  3QK0 A;  1V81 A;  3RYT A;  3GZN I;  4TV3 A;  1S3S G;  3OLM D;  3RZF A;  2L7R A;  4EOY A;  2PE9 A;  2MSE D;  3CMM B;  1OEY A;  2R2Q A;  2KVR A;  4NAW B;  3X23 A;  3ZDT A;  2N1W A;  2ZNV B;  4DHJ D;  3ZUN A;  4ZRJ A;  3KH0 A;  3ALB A;  3APD A;  4B9K A;  2LXC A;  3TJP A;  1Q1O A;  4BKS A;  2NS5 A;  1LM8 B;  4GSW A;  4ZDV A;  4JIO U;  3RUL A;  2KAN A;  2YLM A;  1E5W A;  3WAO A;  4KSL C;  4HJK A;  4WWO A;  2HD5 B;  3DVN U;  3L16 A;  2KC1 A;  4KZ0 A;  1I42 A;  1KLV A;  3VDZ A;  1YIW A;  3VH4 B;  2LVP A;  2JY6 A;  2KDF B;  2PPH A;  4AJY B;  5C23 A;  4BOS C;  5CX3 A;  4WJN A;  2KDB A;  4K1R B;  4HWI B;  2DZI A;  2FCS A;  2NVU I;  3PRZ A;  3PHX B;  4BVU C;  2MBH A;  3IBE A;  3AU5 A;  1YJ1 A;  2DX5 B;  1YX5 B;  3ZRF A;  2J7Q B;  4JL9 A;  2I1J A;  2C5L C;  1H8C A;  3V62 A;  3S2A A;  1Z2M A;  4HCN B;  3U7D A;  4W9C A;  2ZVN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...