1OGWA

Synthetic ubiquitin with fluoro-leu at 50 and 67
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
76
structure length
74
Chain Sequence
MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQEDGRTLSDYNIQKESTHLVLRLRGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords UBIQUITIN
publication title Synthesis, Structural and Biological Studies of Ubiquitin Mutants Containing (2S, 4S)-5-Fluoroleucine Residues Strategically Placed in the Hydrophobic Core
pubmed doi rcsb
molecule tags Cell cycle
total genus 19
structure length 74
sequence length 76
ec nomenclature
pdb deposition date 2003-05-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00240 ubiquitin Ubiquitin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 1ogwA00
4ANXA 4RM8A 2I1JA 3QAQA 3ZRCA 2ZPNA 4E3CA 1J8CA 2C7MB 2CHZA 3U7DA 4A3PA 3QWZB 1WIAA 5D94A 3AULA 4LDTB 2C60A 1R4MI 1NBFC 2JY6A 4HCNB 1EUVB 2LVQA 2G3QB 2DENB 2V1YA 3N3KB 4MGZE 4BBNF 4BOZB 3GZNI 2D10A 1WXMA 2DYMA 3VUWA 2BYEA 5C23A 4MEMA 4G3XB 1WFYA 4FULA 3C0RB 4NPNA 2KLCA 4WWOA 3WAOA 3ZNGC 4ANWA 1F9JA 1ZGUB 2BGFA 2DZJA 2EMTA 1WGRA 2UWQA 2C7NB 2FNJB 3T8MA 5AZGA 1YJ1A 2MCNB 4ANUA 4ZDVA 4GSWA 1TGZB 2MW5A 2LD9A 2JZ3B 4DDID 2ZEQA 1VCBA 2YVCA 1WX9A 3VAWA 2OOBB 3AU5A 4WJPA 3DBRI 2FIFA 4KV2A 1WH3A 1WGGA 3M3JA 4GMVA 3LJ3A 3ZNID 3NS8A 2LWPA 5D7GA 3VXWA 2MLBA 2KFKB 2FIDA 2ZNVB 1XD3B 3DBLI 3CSTA 5CTRC 3TL5A 3V61A 2IYDB 1P98A 2O6VD 4E71A 3PLVA 3UGBB 2DZIA 3V6EB 3L08A 4ZRKA 2J0MA 2NCNA 2WYQA 2DYOA 2ZJDA 3NY5A 4TKNA 2JZZA 3KW5B 5AZFA 3VH3B 2O2VB 4J6IA 3WAMA 2C9WB 4CHKA 5J2RA 2QHOA 3ZDTA 5JHBA 1E7VA 1WR6E 1WY8A 3Q3FA 4I6LB 1WX7A 5E6OA 4BVUC 3MHSD 4IC7B 4DHJB 3IBEA 2LI5A 3CSFA 3VHTC 2V3SA 2MRPA 4ICVA 3X0WA 4TQ0A 4AJYB 4AJWA 4PS3A 1Y8RC 1H8CA 1U4AA 3L0WB 2PPHA 1UELA 4MJSB 3GOEA 3BY4B 3K9PB 3NZSA 1GNUA 4GDLB 2MBHA 2KQ7A 3B1LX 5E6NA 2FCSA 3UF8A 1WXAA 4XX5A 1ZKHA 2KDIA 1LQBA 1YX5B 2G45B 2MP2B 2K8HA 4WJOA 3QJZA 3UIOB 4HLEA 4FHJA 3RT3B 3H6NA 4F7ZA 2XK5B 2O2VA 3PREA 4ICUA 2D2QA 2MQJA 4PYZA 2KANA 4KIKB 2M0XA 5AZHA 2NPTB 4ZRJA 2JPHA 2DX5B 2M8SA 2ZNVC 3QA8A 4K7UA 1C1YB 2KK8A 1GC6A 4W9GA 2KC2A 4KSLC 4GXBA 3RD2A 3SDLC 4W9EA 1IP9A 3L16A 2JVCA 2N9XA 1SGHA 4FJYA 4EEWA 2M4NA 1UH6A 3LDZE 4W9HA 1V2YA 2BYFA 2M17A 4MJSA 2KVRA 3HIZA 3DBSA 3PHXB 1WJ4A 4GDLA 3SD5A 3CF6E 4HDOA 1I35A 3IHPC 2WX0A 3APDA 4GU2A 3HM6X 4AP4C 4XC2A 2MP2A 4W9FA 4BOSC 2WDTB 4M0WB 3RUIB 3M62B 3PRMB 4NY0A 2KJ6A 5G55A 1C3TA 1WGYA 2R2OA 3PRPB 2L05A 5IAAC 2HE7A 4LJPB 4KIKA 4EZJA 2D3GA 1V81A 3PZDA 3VDZA 5L83A 2NPTA 2KNBA 3KVFB 2FCNA 4HCPB 4LCDE 1IYFA 2L0FA 4FA6A 3DBHI 4EUTA 3WAPA 1WZ3A 2LVOA 3A1QB 5DPRA 1XQQA 1V6EA 2AEHA 1MG8A 2IO1B 2N4FA 2GBKA 2N9PC 3QQ8B 1WM3A 2JXXA 2KDEB 2REXA 1X1MA 3Q3JA 4HK2A 3VUYA 4EKUA 3A33B 3KYCD 4JLCA 4YL8A 4XZ4A 3N32A 2KFJA 2CHWA 3PHWB 2NVUI 3IFWB 4GGQA 2J0JA 2LXAA 2N7DA 3A9KB 5DCNA 3T9LA 2KD0A 3IVFA 1P3QU 5HKHA 2RR9A 2MWSB 1E8ZA 4A3OA 4B95A 4HWIB 4RM9A 4II2B 4WAAA 3AU4A 2FCQA 4NJ6A 4EZLA 5JH5C 1L7YA 1PQSA 1ZW7A 4KDLB 5C1ZA 3L17A 1M94A 2IY1B 1SE9A 2KWVB 2DZMA 3A1QA 3TIXA 4GB9A 4HVBA 3X23A 2WX1A 4FN2A 3ZLZA 2ZZPB 5DPWA 2FAZA 4IM3A 3QIJA 2D11A 4MH0E 4MSQB 2DAJA 4MM3A 3HK0A 3VVWB 4F1SA 1HE8A 5CHVC 4WQOB 4A20A 4WWNA 4HPLB 3A9KA 4B9KA 3AXCA 4E74A 3I3TB 3QARA 2G4DB 1TTNA 3EFUA 4W9LA 4FJVB 3WA0A 2N1WA 1V49A 3H9DA 3UIPB 2KO3A 2LJ5A 1EF1A 2G4SA 1EO6A 2IO0B 3ML8A 4X57B 4IM0A 1YX6B 2EMSA 4BKSA 3QC8B 3DPDA 1G6JA 4K81A 3RZWC 4TQ1A 1UD7A 4BKGA 1WI0A 4W9CA 3U8ZA 3AI5A 3N30A 3KH0A 4DDGD 1WM2A 4TV3A 2BPSA 3PV1A 4JQWC 1YIWA 2JT4B 3L13A 4GDKB 4I6PA 2L76A 3ZW3A 4NAWB 1VD2A 1J19A 1RLFA 4K7SA 3ZDMC 4DXAB 2B3AA 4W9DA 3V60A 3EC8A 2MBOA 2K8BA 3V6CB 2ZPYA 4W9KA 1WE7A 2BKRB 4IUMB 1JRUA 2LGDA 1UZXB 4DWFA 2LGYA 2KMAA 1V5OA 4FJZA 2V4LA 2JRIB 4IWOA 3KUCB 4EZKA 5AEKB 3SHQA 4G0NB 5LLIA 2J7QB 4KZCA 2KC1A 1E8YA 2KJRA 3JVZX 4LDTD 3VH4B 2RSUA 3L54A 2MA9B 3QK0A 4HDQA 3VTUA 2KN5A 4IG7B 5LXHA 5EDSA 3ZNHB 1KJTA 3M63B 2RGFA 3APCA 1V5TA 1E7UA 2KTRB 2XEWA 1LXDA 2L8JA 3ZNZB 4MSMB 3ZVVA 2CKHB 3DQVA 2EKEC 5DPSA 2IO2B 3WALA 1Z2MA 2LVPA 3NHEB 2YLMA 4GOCA 2LRWA 1V9JA 4DK5A 1WR1A 1WJ6A 2K1FA 3ML9A 3WANA 4GDKA 3OJ3A 4JIOU 2LUEA 4LJOB 4NAWA 2MBQA 1WGHA 2KDBA 1I42A 1FXTB 2MX2A 2BF8B 1Q1OA 5DPTA 4IWQA 5D2MB 4RMAA 3OAWA 2CS4A 1L2NA 2KKCA 3VTVA 4P7IA 2WWZA 3KUDB 1WYWB 4GN1A 4JGHB 3OJ4B 4MGYE 4IWPA 1OEYA 1OQYA 1WZ0A 3DCGA 2AL3A 3VQIA 4AWJA 2NS5A 1WMHB 2O6VB 2KTRA 2Z0DB 2D07B 4DBGA 5J17A 5KHQA 4MGIE 1RFAA 3ONSA 2XBBC 3W1SA 4FBJB 2JRHA 1GUAB 1H4RA 4KZ0A 1UBIA 4PS7A 2GMIC 1WF9A 1BT0A 1P0RA 1E5WA 2DAFA 3DVGY 3PGEA 3ZTDA 3B0AA 4BKTA 3RCZA 4EOYA 4OVVA 4KDIC 1T0YA 1SIFA 3MJWA 3A4SC 3PRZA 5L95C 2MSED 2LASA 3RYTA 3K9OB 3H1UA 4II3B 4DHJD 2GBNA 4N9F4 3TJPA 2RD0A 2L3ZA 3HM3A 4JL9A 2DHZA 2AWTA 3PVLA 5IA7A 2KX3A 1K8RB 2DZKA 3DVNV 1WMHA 3QX1A 2O6VA 3MTNB 3ECIA 4OVUA 2HD5B 2IY0B 2KZRA 2GOWA 3R7QA 2R2QA 3ZO5B 1XT9B 2VRRB 5G2NA 2DYBA 2C5LC 3W1YA 1J0GA 2I1KA 1EF5A 2L00B 1LM8B 3R3MA 3OLMD 4FLHA 2PE9A 5KHOA 3A9JB 2GBRA 3QHTA 3TCAA 4NQLB 2PJHA 4B6WA 1RRBA 2HTHA 5CHWA 1WE6A 2LXCA 5CHFA 3PLUA 2K8CA 3JYUA 3PPAA 3H7SA 1E8XA 3ZUNA 4M8NA 2KTFA 4G50A 3VUXA 4IM2A 1R4NI 1RAXA 2ASQA 2ZCCA 3DVGX 5J18A 3EECA 1WGDA 1WJNA 3A4RA 2IZVB 3ALBA 1P1AA 2NBUA 3V62A 2IO3B 3D32A 1KLVA 4KVGB 4ASWC 1WXSA 3BINA 3JW0X 3UQAA 4HJKA 4NQKE 1P9DU 4ZRIA 1LFDA 3PSEB 4M8MA 1YQBA 3A9JA 3L10B 4HPMB 2FCMA 2BYVE 2LZ6A 5GMVA 2K25A 2LRUA 4K7WA 4GIVA 4HXDA 4NNJB 4F8CB 4FADA 2UYZB 2CR5A 2KWUB 1S3SG 1GG3A 2KMCA 4PS8A 3ZRFA 3PS6A 3EHVA 1CMXB 2KLGA 2LGXA 1KM7A 3H7PB 2MBBB 3ZKJC 2PE6B 3O65B 4EFOA 3ENEA 3NOBA 1WJUA 2GBMA 4KSKC 1KOTA 4BBNC 5FR6A 2GBJA 4G11A 2KDFB 1Q5WB 2KX0A 5D6JB 3TMPB 4K1RB 5JHAA 1UBQA 2AYOB 2K6DB 2KJHB 4AUQC 1V86A 1WRDB 2OJRA 1OEYJ 2KFKA 3WIMA 1OTRB 2MBEA 2Y5BB 1AARA 2JF5A 4DHZB 5TR5A 3UQBA 4NJ7A 2HJ8A 2A5UA 3R66C 4MDKE 2FUHB 1OGWA 3RULA 4CYEA 2BWFA 2NR2A 1TBEA 3H7PA 4URKA 3NZUA 1NDDA 2KOXA 3JSVB 4BKSD 3RZFA 4MELA 3SU8X 5LXIB 2NBVB 2L7RA 3DDCB 2N7EA 3PT2B 1NI2A 2ZCBA 2L0TA 3S2AA 1GJZA 1TZ1A 4WJQA 5BO4B 2C7HA 2JUOA 3HHMA 2AL6A 2IBIB 1IPGA 4TUUA 4W9JA 1D3ZA 4FHKA 2RPQA 2ZVOA 1E8WA 1ISNA 5JZEB 2BKFA 3VFKA 2Z59B 1WX8A 1S1QB 3B08A 3KYDD 1A5RA 1YD8U 2KXJA 1UGMA 5E6PA 1Q0WB 2NBWB 2K6QA 3APFA 3IG3A 1GC7A 2N1VA 4ANVA 1V80A 2N9EB 2BWES 2KHWB 3DVNU 3TBLD 3ZTCA 4WWPA 2PEAA 2J0KA 2CU1A 3JSVA 2W9NA 4IW0A 2XK5A 3KUZA 4DHZE 1E90A 2M1MA 4WJNA 4BFRA 3ZIMA 4AOFA 3CMMB 4I6NB 2KQSA 2ZVNA 2JWZA 3PTFC 4PYUA 1QZEA 4W9IA 4ZYNA 3UINB 3R7RA 3W1SC 2K39A 2Z0EB 2A4ZA 3VTWA 1WXVA 3QCAA 5CX3A 1Z5SB 4MGKE 2CHXA 2KWCA 3M95A 3DOWA 3P2BA 4CO7A 3U30A
chains in the Genus database with same CATH superfamily
4ANXA 3ZRCA 1J8CA 2KYWA 2CHZA 4A3PA 1WIAA 1R4MB 4YXDB 4LDTB 1QLBB 3U2SC 4BOZB 3N3KB 3GB1A 1EWYC 3GZNI 1K52A 3VUWA 5C23A 2JXTA 2MH7A 5HFYA 4G3XB 3C0RB 4NPNA 2KLCA 3WAOA 1L4ZB 1YJ1A 4GSWA 1TGZB 2LD9A 1VCBA 1TS2A 2YVCA 4N59A 3VAWA 3AU5A 4WJPA 1TY0A 3DBRI 1WH3A 1DYQA 4GMVA 3ZNID 2LWPA 2KFKB 3RNGC 2ZNVB 4TMAB 3PO0A 3L08A 4LNKA 4ZOHC 2NCNA 3WAMA 5IN7A 4NZLB 5J2RA 2QHOA 3HVDA 2PMVA 1WY8A 3AE1B 4BVUC 3E56A 3Q3MC 5AUKA 4DHJB 3VHTC 2V3SA 4ICVA 4TQ0A 4PS3A 1Y8RC 4YTNB 1H8CA 1UELA 1GNUA 1V97A 1WXAA 4XX5A 4YSZB 2KDIA 4HLEA 2JX5A 4WJOA 1HQRD 2PTLA 3ETRA 3RT3B 4F7ZA 4ICUA 3PREA 3R8BA 4L1BA 3HRDD 2WNMA 2N9KA 4ACFA 1C1YB 3AEDB 4W9EA 1IP9A 3IAS1 3PZ7A 2M4NA 4W9HA 2BYFA 3Q8EA 3R2IA 3PHXB 3DBSA 1KLGD 5GXGB 2WX0A 3HM6X 2WXGA 4W9FA 2WDTB 1KH0A 4M0WB 2QDFA 2QMTA 2KJ6A 1FIQA 2R2OA 2L05A 4OVZA 2D3CA 2D3GA 1JWBD 3URYA 2FCNA 2L0FA 2BVCA 4YSXB 3A1QB 2WXKA 1V6EA 1MG8A 2JXXA 1TZOA 3AEFB 3N32A 3DWMA 3R2TA 2LXAA 1N5XA 3A9KB 4M0WA 3IVFA 1F1HA 2MWSB 2WQYB 3BYYB 2V3NA 4CQNA 4RM9A 4WAAA 1CK1A 5JH5C 1L7YA 1PQSA 2WXOA 1ZDXA 4KDLB 3L17A 3A1QA 5BYQA 1TY2A 3GP7A 2Y3AA 3HK0A 1B1ZA 1HZ5A 1FPYA 2K0PA 5CHVC 1HA5A 3A9KA 4E74A 3I3TB 1TTNA 2GRIA 3AV8A 2KQ4X 4WIPA 3AN1A 2EMSA 1JWMD 3DPDA 4K81A 1WI0A 3KH0A 2PW9A 2BPSA 1YIWA 4NAWB 2JYEA 4B0EA 4KGRA 1J19A 4DXAB 1SF0A 3NVWA 3GS2A 3EC8A 2K8BA 2WXLA 2WXFA 2JU6X 1WE7A 1WSPA 2RMMA 2LMCA 5BMIA 2LGIA 4WURA 3MFGA 3EA6A 3SHQA 4G0NB 2V4IB 1QOGA 1E8YA 5MPOA 3JVZX 1XLQA 1KJTA 4B0MA 3APCA 1FRDA 2M56B 2L8JA 2CKHB 5DPSA 2IO2B 3N20C 1WR1A 1WJ6A 2JYTA 3WANA 3OJ3A 4NAWA 3TEXA 4JWSC 1ENFA 3I9V1 2WXPA 4DXGA 1FM0D 2BT6A 4P7IA 3KUDB 4JGHB 1WZ0A 3VQIA 4AWJA 4LTUA 1AN8A 2Z0DB 4A6QA 2KT7A 2LGSA 2JRHA 1GUAB 1UBIA 3MP9A 4PS7A 4P1BC 2FBWB 1WF9A 1E5WA 2DAFA 3PGEA 1VR9A 3ZTDA 1JCKB 4EOYA 3P42A 4KDIC 4S0RA 3PRZA 1L4DB 1D5ZC 4XDDA 3RYTA 3K9OB 4N9F4 3TJPA 3HM3A 3AECB 3QX1A 1TT5B 2HD5B 1XF5L 5G5GA 2KZRA 2CU3A 3BVZA 3R7QA 1XT9B 1R7SA 5G2NA 2DYBA 1EF5A 3TCAA 2SEBD 4B6WA 1T0RC 2WDQB 2LXCA 5CHFA 3JYUA 4EE2A 4M00A 3T3OA 4G50A 4QAYA 1RAXA 2ZCCA 1JMLA 5J18A 4N58A 1WJNA 3A4RA 3V62A 2IO3B 3BVGA 4XWTA 3BINA 2KVZA 4NQKE 1ZOYB 3H8HA 1SJED 1P7EA 1GOZA 2BYVE 2LZ6A 1FEHA 2K25A 5GMVA 4NNJB 4HXDA 5H92C 4RFBA 2UYZB 3B2FA 2X38A 1LO5D 4HPPA 2NTTA 1J7BA 1S3SG 2KMCA 3ZRFA 1CMXB 2KLGA 3VRBB 3ENEA 1WJUA 2GBMA 1KOTA 3I57A 1SIJA 5FR6A 1YQ3B 1OQRA 2V9HA 1UWXA 1Q5WB 5JHAA 1UBQA 2K6DB 1V86A 2BBCA 1F2RI 2ZW0A 2MBEA 4DHZB 3UQBA 1CZPA 3U30A 1FRRA 2RDHA 1MPEA 4MDKE 1OGWA 1ZXHA 5LXIB 2L7RA 3PT2B 1NI2A 3S2AA 2L0TA 3LXFA 3Q3OC 4WJQA 2C7HA 3HHMA 2AL6A 1UUPA 4TUUA 2AX5A 1D3ZA 2RPQA 4HEA1 1ISNA 3VFKA 1WX8A 1FO4A 4DXFA 4KGTA 4XYCA 1HTQA 3RNFC 1GC7A 4J3OD 4OW0A 2KHWB 3ZTCA 4WWPA 3AEAB 4C7ZA 2W9NA 4IW0A 4DHZE 1E90A 4WJNA 4RGNA 5T8IA 1QQRA 1ET6A 2ZVNA 2RDBC 4W9IA 4PYUA 1QZEA 2Z0EB 2A4ZA 5HI1A 1WXVA 1Z5SB 1MJDA 4AS1A 3DOWA 4CO7A 5BYSA 2I1JA 3QAQA 4E3CA 2ZPNA 2C7MB 4GLSC 1ZXIA 3QWZB 2WU2B 5D94A 3GZNB 1EUVB 4MGZE 2BYEA 3TUOA 1F9JA 1ZGUB 2EMTA 3RI7C 1SEBD 4ANUA 3Q2AC 2MW5A 1YN5A 1FNVA 2ZEQA 3DBRB 5HHDG 4S17A 2OOBB 2FIFA 2QCZA 1IUEA 3M3JA 4N6EB 3P4SB 2MLBA 3BIID 3TL5A 1E6EB 3V61A 2IYDB 2O6VD 4TSSA 2KN4A 3ZYYX 3UGBB 4ZRKA 1IBXA 1JRPA 2DYOA 2ZJDA 2JZZA 5AZFA 2O2VB 2C9WB 5JHBA 1TS4A 2WDVB 3Q3FA 4I6LB 5E6OA 3RPFC 4OZBA 3MHSD 4IC7B 3IBEA 2LI5A 3HUIA 5IOIA 1D4BA 4AJWA 5IO9A 3K9PB 3NZSA 2WXQA 1XLOA 5E6NA 1GAQB 2FCSA 2MP2B 2K8HA 3UIOB 2O2VA 2D2QA 2MQJA 2KANA 4RGTA 1FCCC 4KIKB 4ZRJA 2M8SA 4HKQA 4K7UA 4GXBA 3RD2A 3SDLC 4ZRPA 4LNNA 3L16A 2JVCA 1SGHA 2L1AA 4FJYA 2QJLA 1EU4A 1PFDA 1TS5A 4HDOA 1I35A 5AUIA 1MHHE 4AP4C 2KACA 2MP2A 2GB1A 2M0AA 3RUIB 3MC8A 3M62B 2VH1A 3PRMB 4ZRQA 3N1ZC 1C3TA 1WGYA 3PRPB 3P4RB 4LJPB 4KIKA 1V81A 3PZDA 3KVFB 1IYFA 4LCDE 4FA6A 1VZ6A 1JWAD 4KKJA 1SE3A 2DWQA 1XQQA 2AEHA 3AEBB 3Q8AA 2IO1B 2N4FA 2GBKA 1FNUA 1WM3A 3Q3JA 1X1MA 4HRSA 4JLCA 4YL8A 4XZ4A 2VZKD 2NVUI 3IFWB 3ZXVA 3P63A 4A90A 1A70A 2N7DA 5DCNA 3NUHB 5D3DA 2ZW1A 3NRZA 3OG5A 3VR8B 3AU4A 2D3AA 2IGGA 4XE0A 1M94A 1SE9A 3TIXA 1DOYA 4NAMA 4FN2A 2FAZA 4US9A 2D11A 4MSQB 1BXTA 4P1CC 2YEPB 3MC0B 2N7JA 4WWNA 4HPLB 3DHGC 4WH4A 4B9KA 3QARA 1NYQA 1ZE3D 2G4DB 1JW9D 3WA0A 4W9LA 1NVID 1V49A 2LJ5A 1EF1A 2IO0B 3OWEB 3ML8A 4IM0A 1D5XC 4BKSA 3NZ3A 1KF6B 3RFZB 4BKGA 4W9CA 3I5JC 4DDGD 1WM2A 4TV3A 4KKIA 2JT4B 4GDKB 2L76A 3Q6BA 4H2AA 3ZW3A 4IKGA 1RLFA 4W9DA 3V60A 1UWMA 3V6CB 4IUMB 1JRUA 4DWFA 2KMAA 2V4LA 4EZKA 1M4VA 2J7QB 3VH4B 2RSUA 3L54A 4HDQA 3VTUA 2KN5A 3ZNHB 1LXDA 5JXVA 2LVPA 3LB8C 2YLMA 1V9JA 3NVZA 2K1FA 3ML9A 4GDKA 2ACZB 2LUEA 4LJOB 3Q8CA 2MX2A 4IWQA 2J52A 1TJEA 2CS4A 1L2NA 1UNSA 4GN1A 4IWPA 3L4PA 1KLUD 1OQYA 1WMHB 2D07B 5J17A 2WDRB 2LFIA 2XBBC 3W1SA 3FKYA 2R61A 1YQ4B 2GMIC 3SEBA 2JZPA 3ZGZA 1BT0A 1P0RA 3NVVA 1FD6A 3DVGY 3RCZA 4OVVA 3GE8C 1SIFA 3A4SC 5L95C 2LASA 3ZJTA 2GBNA 2RD0A 4JL9A 2DHZA 1QF6A 2KDMA 3PVLA 2J4XA 1WMHA 4YT0B 2I38A 2GOWA 3ZO5B 2VRRB 1FMAD 2I1KA 2L00B 1LM8B 3R3MA 5KHOA 2GBRA 3QHTA 2NMQA 2PJHA 4L23A 4C80A 2WXRA 3PLUA 3H7SA 1E8XA 1B9RA 3ZUNA 2H88B 4M8NA 2KTFA 2J42A 3KWVA 1R4NI 2ASQA 2ON8A 3DVGX 3EECA 1EU3A 1WGDA 2M19A 3ALBA 1P1AA 1OFFA 1AW7A 4KVGB 4ASWC 3UQAA 3JW0X 5FR3A 3GE3C 1FXAA 2IJ0A 1P9DU 1LFDA 1TKGA 3CWIA 1YNTE 4M8MA 4HPMB 2L83A 5BMGA 4FADA 2LRUA 1XCTL 3BYTB 3PS6A 3H7PB 4REZA 2PE6B 4EFOA 3NOBA 4WWMA 4KSKC 1PGXA 4BBNC 1XEEA 2GBJA 2WXHA 3J9CA 2W54A 3TMPB 1WRDB 1OEYJ 1JWSD 2Y5BB 5EE0A 5TR5A 4NJ7A 3R66C 2WU5B 3RULA 2BWFA 2NR2A 3H7PA 3NZUA 1NDDA 1MHXA 3RZFA 1N60A 1UF0A 2ZCBA 4ZYSA 2L32A 5BO4B 2IBIB 1WRIA 1PGAA 2BKFA 1CJEA 1TKYA 4ARIA 2Z59B 3AE4B 3KYDD 1YJJA 1UGMA 3NJTA 3Q69A 1KRHA 4XGAB 3IG3A 2N1VA 4ANVA 3DHIC 1V80A 4FXCA 4R3DA 2L52A 2PEAA 3RMKC 1DOXA 2XK5A 2QILA 3ZIMA 3P4PB 1FNWA 3CMMB 4I6NB 1HZ6A 4ARCA 1I4XA 3W1SC 2W3RA 2K39A 3QCAA 2K5PA 4A20A 3IXSA 1VJKA 2C60A 1T5XD 2LVQA 2G3QB 3Q14C 1WXMA 2DYMA 4MEMA 4LNOA 4XWWA 4FULA 4WWOA 3ZNGC 2BGFA 2VH2A 5H8YE 1WWTA 2UWQA 1DGJA 5AZGA 3AH7A 3AEGB 4PT5A 1ZPSA 3AE7B 2JZ3B 2BS3B 2INNE 1MVKA 1WX9A 1WGGA 4USAA 1AWDA 3NVYA 4A9AA 5D7GA 3VXWA 1ZDVA 1XD3B 3DBLI 3CSTA 4KX6B 3ZQ4A 1P98A 3AE2B 2DZIA 1EWCA 2J0MA 2V3PA 2IPKD 3ZXRA 5I4DA 2LEKA 3KW5B 3VH3B 3ZDTA 1E7VA 1N63A 2N0SB 2LJIA 2E3TA 1WR6E 1XCQL 3N1XC 2BQQA 1YJIA 4MACA 4K3BA 3CSFA 4ITKA 4AJYB 4O1NA 3L0WB 2WXMA 2PPHA 3I63C 3GOEA 3BY4B 4YTPB 2KQ7A 3B1LX 2RPVA 1LQBA 1YX5B 2G45B 3Q8FA 3H6NA 1IGCA 2KWDA 5AZHA 2NPTB 3QA8A 1GC6A 2KC2A 1WXQA 3EFCA 5EE1A 2M17A 2UU7A 2KVRA 1WJ4A 4C56C 3IHPC 4GU2A 4P6VF 2GI9A 5BMHA 2JSVX 4YTMB 5G55A 5IAAC 1F2RC 4EZJA 2NPTA 2PVOD 4HCPB 2BTEA 2OEDA 4EUTA 3WAPA 2LVOA 5DPRA 2BB6A 2N9PC 3QQ8B 2KDEB 2DNFA 1HTOA 4HK2A 3VUYA 4EKUA 3RNEC 2CHWA 3P1MA 3HVZA 4GGQA 2J0JA 4US8A 4LNIA 3T9LA 2TSSA 4MT5A 5EE9A 5HKHA 1IBXB 2IGHA 4B95A 4EZLA 4NJ6A 2D5GA 4ZHOA 4C00A 5C1ZA 5FK9C 2IY1B 1I4PA 1RM6C 2WXNA 2KWVB 2DZMA 2K9XA 2J53A 2E6XA 3ZLZA 5DPWA 1RWSA 1PYWD 4IM3A 2MHJA 3QIJA 2DAJA 4MH8A 2KMMA 1HE8A 5C3JB 4WQOB 3RN9C 3VR9B 4HKZE 3EFUA 3BWUD 3H9DA 3UIPB 1XO3A 2KO3A 3BVMA 2G4SA 1EO6A 1HEZE 2LHEA 1NENB 1D6EC 1XLPA 1SE4A 1BUIC 1T0SC 3N30A 3PV1A 2MJDA 3B2GA 1J7AA 1K53A 3ZDMC 5IP4D 2B3AA 2AQ1B 5LNK1 2ZPYA 4W9KA 1UZXB 2JRIB 3KUCB 5AEKB 4XDCA 5D3IB 5LLIA 4RGMA 4KZCA 2KC1A 2KJRA 4LDTD 3U7ZA 3QK0A 4YWGG 4IG7B 5LXHA 5EDSA 1Y56A 3M63B 2RGFA 1V5TA 2KTRB 2XEWA 4MSMB 3ZVVA 3P4QB 3WALA 4GOCA 1C76A 3NHEB 2LRWA 3B9JA 2QC8A 1QOAA 2WP9B 1UGJA 1I42A 1I4RA 2BF8B 2AQ3B 3Q3NC 3OAWA 2KKCA 1YN4A 5C2TB 1WYWB 3OJ4B 3DCGA 2AL3A 2MJ3A 1EM7A 1QKZA 2O6VB 3C8YA 2KTRA 4MGIE 1H4RA 2INDC 1VDVA 2Z8LA 2CJNA 1C9FA 4L2YA 1JALA 1I4HA 2PIAA 3N9YC 3MJWA 1ROEA 2MSED 3VRAB 3WCQA 3H1UA 4II3B 2WS3B 4DHJD 2L3ZA 2DLBA 2AWTA 5IA7A 2KX3A 2DZKA 3DVNV 4Q2JA 2O6VA 2INCC 4DQOC 3MTNB 3ECIA 2R2QA 3DHHC 3W1YA 1J0GA 2QEJC 4FLHA 1E7PB 1RRBA 1FFVA 4NJCA 1WE6A 1R4NB 3BZDB 4IM2A 3IT4B 4P16A 3AE5B 4LLGM 3U52E 4RF1A 1KLVA 3D32A 3V05A 1NYRA 1WXSA 2JQRB 5EE3A 4BZAA 3C19A 4ZRIA 1WYGA 1L0YB 1SE2A 2QIEB 1YMHE 4K7WA 4GIVA 3MJ5A 2CR5A 2KWUB 1GG3A 3FAHA 2HJ1A 2LGXA 2MBBB 3ZKJC 1SB3C 3ABVB 4G11A 2VZKB 1YOVB 1VLBA 2KDFB 3AE6B 2KX0A 5D6JB 4K1RB 2AYOB 2KJHB 4AUQC 4LNFA 2OJRA 2KFKA 1LGRA 1OTRB 3W5UB 3KWLA 1AARA 4RH6A 3EUB2 2A5UA 4K3CA 4URKA 4MELA 4RCOA 2NBVB 1JQ4A 1TZ1A 2JUOA 2G9HD 4W9JA 1QILA 1E8WA 3TEWA 2I2YA 1T3QA 1S1QB 1XLNA 1YD8U 5E6PA 1Q0WB 1SSNA 2K6QA 1KTKA 1TS3A 3RNBC 2N9EB 1T6BX 2G1EA 2BWES 1CQVA 2J0KA 2W82A 3SFDB 4BFRA 4PK1A 3DBHB 2KQSA 3IT6B 2JWZA 3PTFC 4ZYNA 2MJEA 3UINB 4MGKE 1L0VB 2CHXA 4RMAA 1E9MA 4BAXA 4RM8A 2WGSA 2OHFA 1SBBB 3U7DA 4RNAA 3UI3A 3AULA 1R4MI 1NBFC 2JY6A 4HCNB 2V1YA 4BBNF 1F52A 2DENB 3AEEB 4IOIE 2D10A 4M01A 2K3UA 4JX1C 1WFYA 4ANWA 2DZJA 1VZ7A 1WGRA 2C7NB 2FNJB 3T8MA 1L0XB 2YEPF 2MCNB 1K51A 4ZDVA 1VRAB 4DDID 1V1PB 4RGOS 2DBYA 2AQ2B 4OZAA 3LYYA 4KV2A 1F0ZA 2RDGA 3LJ3A 2K22A 3NS8A 1SXTA 1I4GA 2JWUA 1C4PA 3DBLB 3BK2A 2FIDA 3SR6A 3T3NA 4JPSA 5CTRC 1BMLC 5HG2A 4E71A 3PLVA 3V6EB 1PDXA 2CJOA 2WYQA 1WGKA 1QOFA 3NY5A 4TKNA 4CHKA 4J6IA 2HTME 3FILB 1V1PA 4HJGE 1KFYB 1P7FA 1WX7A 2WXIA 1N61A 3X0WA 2MRPA 1TKEA 1HXYD 4WAFA 1U4AA 3AE9B 1F77A 4MJSB 4GDLB 2MBHA 4IDIA 1XXGA 3UF8A 1L6VA 1AYFA 1ZKHA 3QJZA 4FHJA 2XK5B 4PYZA 3U4EG 1TIFA 3FILA 1JWUD 2M0XA 2JPHA 2DX5B 2ZNVC 2OJWA 2PVGC 2KK8A 4W9GA 4KSLC 1PUTA 4LK0M 1L5PA 2N9XA 5E6JA 4EEWA 1UH6A 3LDZE 1V2YA 4MJSA 3HIZA 4GDLA 3SD5A 3CF6E 4AQ7A 1MFWA 1QT9A 3APDA 1T0QC 4XC2A 4BOSC 4NY0A 2HE7A 5L83A 4OHJA 3VDZA 3MHZA 2KNBA 3DBHI 1ACCA 2EKIA 1WZ3A 3AB5A 3PZ8A 4YSYB 3AE3B 3RNCC 2REXA 3IAM1 3AM9A 3A33B 3KYCD 2EELA 2MEKA 4MM3B 2KFJA 3PHWB 1STEA 1ZP0B 2ONQA 2Y5PA 3DWGC 1FCLA 2D3BA 2HDEA 2KD0A 1P3QU 2B76B 2RR9A 1E8ZA 2H89B 4A3OA 4HWIB 4II2B 2X8XX 2FCQA 1ZW7A 2N9LA 3W9CB 4RF0A 4GB9A 1RYJA 4HVBA 3X23A 2WX1A 2ZZPB 1ET9A 5TSSA 4MH0E 4MM3A 3VVWB 4F1SA 3N1YC 1DOIA 3AXCA 2BS4B 4FJVB 2N1WA 4C7YA 1QOBA 1NEKB 3SFEB 4X57B 3W5VB 1YX6B 1ESFA 2Q5WD 3AE8B 3QC8B 1G6JA 2LUMA 3RZWC 4TQ1A 1UD7A 2LHDA 3U8ZA 3AI5A 4JQWC 2IDYA 3L13A 4I6PA 1NI3A 1VD2A 4K7SA 1Q10A 2MBOA 2SAKA 2BKRB 3CIRB 2LGDA 2LGYA 1V5OA 4FJZA 4IWOA 2MA9B 4JE3B 1C4AA 5FKAC 1YN3A 2GLSA 3ZNZB 1E7UA 3DQVA 1I7HA 2EKEC 3E9SA 3V3XA 1Z2MA 4DK5A 2W3SA 4JIOU 2MBQA 1WGHA 2KDBA 1FXTB 1Q1OA 5DPTA 5D2MB 2WLBA 2QSDA 3VTVA 5IKCM 3KLSX 1MG4A 3RNAC 2WWZA 1L6UA 2ICIA 1V8CA 4MGYE 1OEYA 2NS5A 5KHQA 4DBGA 2BW2A 1RFAA 3ONSA 1C4CA 4FBJB 4OZCA 4KZ0A 2FUG1 3B0AA 4BKTA 1T0YA 3TSSA 4D2KA 1OQQA 2BS2B 1N62A 2WHIA 1RFKA 1SJHD 1K8RB 1FFUA 1JROA 4OVUA 2IY0B 1MI0A 2C5LC 3OLMD 2PE9A 3TEZA 3A9JB 3EGRA 4NQLB 1K50A 2HTHA 1C79A 5G5HA 2XNAC 5CHWA 2K8CA 3PPAA 3VUXA 2IGDA 3MC9A 2V0GA 2IZVB 2NBUA 1D5MC 3ZJVA 4HJKA 2BYTA 1FXIA 3PSEB 1YQBA 3A9JA 3L10B 2FCMA 5BYRA 4F8CB 1PGBA 1VZ8A 4PS8A 3EHVA 1KM7A 4UDUC 3O65B 4ZHPA 1GPXA 3BK1A 4HROA 1E0ZA 1IGDA 4JWUC 1ZUD2 3WIMA 1GB4A 2INPE 4A8XC 3W2DA 2JF5A 1I4QA 1J7CA 3TEYA 2HJ8A 4CYEA 2FUHB 1V1OA 1TBEA 2W55A 2KOXA 4BKSD 3JSVB 3SU8X 3DDCB 2N7EA 2FE8A 4C4VB 1N6ZA 1GJZA 1IPGA 3FC4A 4FHKA 2ZVOA 4WQMA 5JZEB 2XN9C 3ZJUA 2BB5A 3KQ4A 4KGSA 3NS1A 1E10A 3B08A 1A5RA 1GB1A 2KXJA 3Q8BA 2NBWB 3APFA 4A55A 2PLPA 2KAJA 3DVNU 3TBLD 2CU1A 3JSVA 2Y5CA 3O13A 3KUZA 2M1MA 4AOFA 2PKOA 1N5WA 4C4VA 1C77A 2WXJA 2NTSA 3NG0A 3R7RA 3VTWA 1TYGB 5CX3A 1C78A 2KWCA 3M95A 3P2BA 4M02A 3AMZA
chains in the Genus database with same CATH topology
4ANXA 4RM8A 2I1JA 3QAQA 3ZRCA 2ZPNA 4E3CA 1J8CA 2C7MB 2CHZA 3U7DA 4A3PA 3QWZB 1WIAA 5D94A 3AULA 4LDTB 2C60A 1R4MI 1NBFC 2JY6A 4HCNB 1EUVB 2LVQA 2G3QB 2DENB 2V1YA 3N3KB 4MGZE 4BBNF 4BOZB 3GZNI 2D10A 1WXMA 2DYMA 3VUWA 2BYEA 5C23A 4MEMA 4G3XB 1WFYA 4FULA 3C0RB 4NPNA 2KLCA 4WWOA 3WAOA 3ZNGC 4ANWA 1F9JA 1ZGUB 2BGFA 2DZJA 2EMTA 1WGRA 2UWQA 2C7NB 2FNJB 3T8MA 5AZGA 1YJ1A 2MCNB 4ANUA 4ZDVA 4GSWA 1TGZB 2MW5A 2LD9A 2JZ3B 4DDID 2ZEQA 1VCBA 2YVCA 1WX9A 3VAWA 2OOBB 3AU5A 4WJPA 3DBRI 2FIFA 4KV2A 1WH3A 1WGGA 3M3JA 4GMVA 3LJ3A 3ZNID 3NS8A 2LWPA 5D7GA 3VXWA 2MLBA 2KFKB 2FIDA 2ZNVB 1XD3B 3DBLI 3CSTA 5CTRC 3TL5A 3V61A 2IYDB 1P98A 2O6VD 4E71A 3PLVA 3UGBB 2DZIA 3V6EB 3L08A 4ZRKA 2J0MA 2NCNA 2WYQA 2DYOA 2ZJDA 3NY5A 4TKNA 2JZZA 3KW5B 5AZFA 3VH3B 2O2VB 4J6IA 3WAMA 2C9WB 4CHKA 5J2RA 2QHOA 3ZDTA 5JHBA 1E7VA 1WR6E 1WY8A 3Q3FA 4I6LB 1WX7A 5E6OA 4BVUC 3MHSD 4IC7B 4DHJB 3IBEA 2LI5A 3CSFA 3VHTC 2V3SA 2MRPA 4ICVA 3X0WA 4TQ0A 4AJYB 4AJWA 4PS3A 1Y8RC 1H8CA 1U4AA 3L0WB 2PPHA 1UELA 4MJSB 3GOEA 3BY4B 3K9PB 3NZSA 1GNUA 4GDLB 2MBHA 2KQ7A 3B1LX 5E6NA 2FCSA 3UF8A 1WXAA 4XX5A 1ZKHA 2KDIA 1LQBA 1YX5B 2G45B 2MP2B 2K8HA 4WJOA 3QJZA 3UIOB 4HLEA 4FHJA 3RT3B 3H6NA 4F7ZA 2XK5B 2O2VA 3PREA 4ICUA 2D2QA 2MQJA 4PYZA 2KANA 4KIKB 2M0XA 5AZHA 2NPTB 4ZRJA 2JPHA 2DX5B 2M8SA 2ZNVC 3QA8A 4K7UA 1C1YB 2KK8A 1GC6A 4W9GA 2KC2A 4KSLC 4GXBA 3RD2A 3SDLC 4W9EA 1IP9A 3L16A 2JVCA 2N9XA 1SGHA 4FJYA 4EEWA 2M4NA 1UH6A 3LDZE 4W9HA 1V2YA 2BYFA 2M17A 4MJSA 2KVRA 3HIZA 3DBSA 3PHXB 1WJ4A 4GDLA 3SD5A 3CF6E 4HDOA 1I35A 3IHPC 2WX0A 3APDA 4GU2A 3HM6X 4AP4C 4XC2A 2MP2A 4W9FA 4BOSC 2WDTB 4M0WB 3RUIB 3M62B 3PRMB 4NY0A 2KJ6A 5G55A 1C3TA 1WGYA 2R2OA 3PRPB 2L05A 5IAAC 2HE7A 4LJPB 4KIKA 4EZJA 2D3GA 1V81A 3PZDA 3VDZA 5L83A 2NPTA 2KNBA 3KVFB 2FCNA 4HCPB 4LCDE 1IYFA 2L0FA 4FA6A 3DBHI 4EUTA 3WAPA 1WZ3A 2LVOA 3A1QB 5DPRA 1XQQA 1V6EA 2AEHA 1MG8A 2IO1B 2N4FA 2GBKA 2N9PC 3QQ8B 1WM3A 2JXXA 2KDEB 2REXA 1X1MA 3Q3JA 4HK2A 3VUYA 4EKUA 3A33B 3KYCD 4JLCA 4YL8A 4XZ4A 3N32A 2KFJA 2CHWA 3PHWB 2NVUI 3IFWB 4GGQA 2J0JA 2LXAA 2N7DA 3A9KB 5DCNA 3T9LA 2KD0A 3IVFA 1P3QU 5HKHA 2RR9A 2MWSB 1E8ZA 4A3OA 4B95A 4HWIB 4RM9A 4II2B 4WAAA 3AU4A 2FCQA 4NJ6A 4EZLA 5JH5C 1L7YA 1PQSA 1ZW7A 4KDLB 5C1ZA 3L17A 1M94A 2IY1B 1SE9A 2KWVB 2DZMA 3A1QA 3TIXA 4GB9A 4HVBA 3X23A 2WX1A 4FN2A 3ZLZA 2ZZPB 5DPWA 2FAZA 4IM3A 3QIJA 2D11A 4MH0E 4MSQB 2DAJA 4MM3A 3HK0A 3VVWB 4F1SA 1HE8A 5CHVC 4WQOB 4A20A 4WWNA 4HPLB 3A9KA 4B9KA 3AXCA 4E74A 3I3TB 3QARA 2G4DB 1TTNA 3EFUA 4W9LA 4FJVB 3WA0A 2N1WA 1V49A 3H9DA 3UIPB 2KO3A 2LJ5A 1EF1A 2G4SA 1EO6A 2IO0B 3ML8A 4X57B 4IM0A 1YX6B 2EMSA 4BKSA 3QC8B 3DPDA 1G6JA 4K81A 3RZWC 4TQ1A 1UD7A 4BKGA 1WI0A 4W9CA 3U8ZA 3AI5A 3N30A 3KH0A 4DDGD 1WM2A 4TV3A 2BPSA 3PV1A 4JQWC 1YIWA 2JT4B 3L13A 4GDKB 4I6PA 2L76A 3ZW3A 4NAWB 1VD2A 1J19A 1RLFA 4K7SA 3ZDMC 4DXAB 2B3AA 4W9DA 3V60A 3EC8A 2MBOA 2K8BA 3V6CB 2ZPYA 4W9KA 1WE7A 2BKRB 4IUMB 1JRUA 2LGDA 1UZXB 4DWFA 2LGYA 2KMAA 1V5OA 4FJZA 2V4LA 2JRIB 4IWOA 3KUCB 4EZKA 5AEKB 3SHQA 4G0NB 5LLIA 2J7QB 4KZCA 2KC1A 1E8YA 2KJRA 3JVZX 4LDTD 3VH4B 2RSUA 3L54A 2MA9B 3QK0A 4HDQA 3VTUA 2KN5A 4IG7B 5LXHA 5EDSA 3ZNHB 1KJTA 3M63B 2RGFA 3APCA 1V5TA 1E7UA 2KTRB 2XEWA 1LXDA 2L8JA 3ZNZB 4MSMB 3ZVVA 2CKHB 3DQVA 2EKEC 5DPSA 2IO2B 3WALA 1Z2MA 2LVPA 3NHEB 2YLMA 4GOCA 2LRWA 1V9JA 4DK5A 1WR1A 1WJ6A 2K1FA 3ML9A 3WANA 4GDKA 3OJ3A 4JIOU 2LUEA 4LJOB 4NAWA 2MBQA 1WGHA 2KDBA 1I42A 1FXTB 2MX2A 2BF8B 1Q1OA 5DPTA 4IWQA 5D2MB 4RMAA 3OAWA 2CS4A 1L2NA 2KKCA 3VTVA 4P7IA 2WWZA 3KUDB 1WYWB 4GN1A 4JGHB 3OJ4B 4MGYE 4IWPA 1OEYA 1OQYA 1WZ0A 3DCGA 2AL3A 3VQIA 4AWJA 2NS5A 1WMHB 2O6VB 2KTRA 2Z0DB 2D07B 4DBGA 5J17A 5KHQA 4MGIE 1RFAA 3ONSA 2XBBC 3W1SA 4FBJB 2JRHA 1GUAB 1H4RA 4KZ0A 1UBIA 4PS7A 2GMIC 1WF9A 1BT0A 1P0RA 1E5WA 2DAFA 3DVGY 3PGEA 3ZTDA 3B0AA 4BKTA 3RCZA 4EOYA 4OVVA 4KDIC 1T0YA 1SIFA 3MJWA 3A4SC 3PRZA 5L95C 2MSED 2LASA 3RYTA 3K9OB 3H1UA 4II3B 4DHJD 2GBNA 4N9F4 3TJPA 2RD0A 2L3ZA 3HM3A 4JL9A 2DHZA 2AWTA 3PVLA 5IA7A 2KX3A 1K8RB 2DZKA 3DVNV 1WMHA 3QX1A 2O6VA 3MTNB 3ECIA 4OVUA 2HD5B 2IY0B 2KZRA 2GOWA 3R7QA 2R2QA 3ZO5B 1XT9B 2VRRB 5G2NA 2DYBA 2C5LC 3W1YA 1J0GA 2I1KA 1EF5A 2L00B 1LM8B 3R3MA 3OLMD 4FLHA 2PE9A 5KHOA 3A9JB 2GBRA 3QHTA 3TCAA 4NQLB 2PJHA 4B6WA 1RRBA 2HTHA 5CHWA 1WE6A 2LXCA 5CHFA 3PLUA 2K8CA 3JYUA 3PPAA 3H7SA 1E8XA 3ZUNA 4M8NA 2KTFA 4G50A 3VUXA 4IM2A 1R4NI 1RAXA 2ASQA 2ZCCA 3DVGX 5J18A 3EECA 1WGDA 1WJNA 3A4RA 2IZVB 3ALBA 1P1AA 2NBUA 3V62A 2IO3B 3D32A 1KLVA 4KVGB 4ASWC 1WXSA 3BINA 3JW0X 3UQAA 4HJKA 4NQKE 1P9DU 4ZRIA 1LFDA 3PSEB 4M8MA 1YQBA 3A9JA 3L10B 4HPMB 2FCMA 2BYVE 2LZ6A 5GMVA 2K25A 2LRUA 4K7WA 4GIVA 4HXDA 4NNJB 4F8CB 4FADA 2UYZB 2CR5A 2KWUB 1S3SG 1GG3A 2KMCA 4PS8A 3ZRFA 3PS6A 3EHVA 1CMXB 2KLGA 2LGXA 1KM7A 3H7PB 2MBBB 3ZKJC 2PE6B 3O65B 4EFOA 3ENEA 3NOBA 1WJUA 2GBMA 4KSKC 1KOTA 4BBNC 5FR6A 2GBJA 4G11A 2KDFB 1Q5WB 2KX0A 5D6JB 3TMPB 4K1RB 5JHAA 1UBQA 2AYOB 2K6DB 2KJHB 4AUQC 1V86A 1WRDB 2OJRA 1OEYJ 2KFKA 3WIMA 1OTRB 2MBEA 2Y5BB 1AARA 2JF5A 4DHZB 5TR5A 3UQBA 4NJ7A 2HJ8A 2A5UA 3R66C 4MDKE 2FUHB 1OGWA 3RULA 4CYEA 2BWFA 2NR2A 1TBEA 3H7PA 4URKA 3NZUA 1NDDA 2KOXA 3JSVB 4BKSD 3RZFA 4MELA 3SU8X 5LXIB 2NBVB 2L7RA 3DDCB 2N7EA 3PT2B 1NI2A 2ZCBA 2L0TA 3S2AA 1GJZA 1TZ1A 4WJQA 5BO4B 2C7HA 2JUOA 3HHMA 2AL6A 2IBIB 1IPGA 4TUUA 4W9JA 1D3ZA 4FHKA 2RPQA 2ZVOA 1E8WA 1ISNA 5JZEB 2BKFA 3VFKA 2Z59B 1WX8A 1S1QB 3B08A 3KYDD 1A5RA 1YD8U 2KXJA 1UGMA 5E6PA 1Q0WB 2NBWB 2K6QA 3APFA 3IG3A 1GC7A 2N1VA 4ANVA 1V80A 2N9EB 2BWES 2KHWB 3DVNU 3TBLD 3ZTCA 4WWPA 2PEAA 2J0KA 2CU1A 3JSVA 2W9NA 4IW0A 2XK5A 3KUZA 4DHZE 1E90A 2M1MA 4WJNA 4BFRA 3ZIMA 4AOFA 3CMMB 4I6NB 2KQSA 2ZVNA 2JWZA 3PTFC 4PYUA 1QZEA 4W9IA 4ZYNA 3UINB 3R7RA 3W1SC 2K39A 2Z0EB 2A4ZA 3VTWA 1WXVA 3QCAA 5CX3A 1Z5SB 4MGKE 2CHXA 2KWCA 3M95A 3DOWA 3P2BA 4CO7A 3U30A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4ANX A;  4RM8 A;  2I1J A;  3QAQ A;  3ZRC A;  2ZPN A;  4E3C A;  1J8C A;  2C7M B;  2CHZ A;  3U7D A;  4A3P A;  3QWZ B;  1WIA A;  5D94 A;  3AUL A;  4LDT B;  2C60 A;  1R4M I;  1NBF C;  2JY6 A;  4HCN B;  1EUV B;  2LVQ A;  2G3Q B;  2DEN B;  2V1Y A;  3N3K B;  4MGZ E;  4BBN F;  4BOZ B;  3GZN I;  2D10 A;  1WXM A;  2DYM A;  3VUW A;  2BYE A;  5C23 A;  4MEM A;  4G3X B;  1WFY A;  4FUL A;  3C0R B;  4NPN A;  2KLC A;  4WWO A;  3WAO A;  3ZNG C;  4ANW A;  1F9J A;  1ZGU B;  2BGF A;  2DZJ A;  2EMT A;  1WGR A;  2UWQ A;  2C7N B;  2FNJ B;  3T8M A;  5AZG A;  1YJ1 A;  2MCN B;  4ANU A;  4ZDV A;  4GSW A;  1TGZ B;  2MW5 A;  2LD9 A;  2JZ3 B;  4DDI D;  2ZEQ A;  1VCB A;  2YVC A;  1WX9 A;  3VAW A;  2OOB B;  3AU5 A;  4WJP A;  3DBR I;  2FIF A;  4KV2 A;  1WH3 A;  1WGG A;  3M3J A;  4GMV A;  3LJ3 A;  3ZNI D;  3NS8 A;  2LWP A;  5D7G A;  3VXW A;  2MLB A;  2KFK B;  2FID A;  2ZNV B;  1XD3 B;  3DBL I;  3CST A;  5CTR C;  3TL5 A;  3V61 A;  2IYD B;  1P98 A;  2O6V D;  4E71 A;  3PLV A;  3UGB B;  2DZI A;  3V6E B;  3L08 A;  4ZRK A;  2J0M A;  2NCN A;  2WYQ A;  2DYO A;  2ZJD A;  3NY5 A;  4TKN A;  2JZZ A;  3KW5 B;  5AZF A;  3VH3 B;  2O2V B;  4J6I A;  3WAM A;  2C9W B;  4CHK A;  5J2R A;  2QHO A;  3ZDT A;  5JHB A;  1E7V A;  1WR6 E;  1WY8 A;  3Q3F A;  4I6L B;  1WX7 A;  5E6O A;  4BVU C;  3MHS D;  4IC7 B;  4DHJ B;  3IBE A;  2LI5 A;  3CSF A;  3VHT C;  2V3S A;  2MRP A;  4ICV A;  3X0W A;  4TQ0 A;  4AJY B;  4AJW A;  4PS3 A;  1Y8R C;  1H8C A;  1U4A A;  3L0W B;  2PPH A;  1UEL A;  4MJS B;  3GOE A;  3BY4 B;  3K9P B;  3NZS A;  1GNU A;  4GDL B;  2MBH A;  2KQ7 A;  3B1L X;  5E6N A;  2FCS A;  3UF8 A;  1WXA A;  4XX5 A;  1ZKH A;  2KDI A;  1LQB A;  1YX5 B;  2G45 B;  2MP2 B;  2K8H A;  4WJO A;  3QJZ A;  3UIO B;  4HLE A;  4FHJ A;  3RT3 B;  3H6N A;  4F7Z A;  2XK5 B;  2O2V A;  3PRE A;  4ICU A;  2D2Q A;  2MQJ A;  4PYZ A;  2KAN A;  4KIK B;  2M0X A;  5AZH A;  2NPT B;  4ZRJ A;  2JPH A;  2DX5 B;  2M8S A;  2ZNV C;  3QA8 A;  4K7U A;  1C1Y B;  2KK8 A;  1GC6 A;  4W9G A;  2KC2 A;  4KSL C;  4GXB A;  3RD2 A;  3SDL C;  4W9E A;  1IP9 A;  3L16 A;  2JVC A;  2N9X A;  1SGH A;  4FJY A;  4EEW A;  2M4N A;  1UH6 A;  3LDZ E;  4W9H A;  1V2Y A;  2BYF A;  2M17 A;  4MJS A;  2KVR A;  3HIZ A;  3DBS A;  3PHX B;  1WJ4 A;  4GDL A;  3SD5 A;  3CF6 E;  4HDO A;  1I35 A;  3IHP C;  2WX0 A;  3APD A;  4GU2 A;  3HM6 X;  4AP4 C;  4XC2 A;  2MP2 A;  4W9F A;  4BOS C;  2WDT B;  4M0W B;  3RUI B;  3M62 B;  3PRM B;  4NY0 A;  2KJ6 A;  5G55 A;  1C3T A;  1WGY A;  2R2O A;  3PRP B;  2L05 A;  5IAA C;  2HE7 A;  4LJP B;  4KIK A;  4EZJ A;  2D3G A;  1V81 A;  3PZD A;  3VDZ A;  5L83 A;  2NPT A;  2KNB A;  3KVF B;  2FCN A;  4HCP B;  4LCD E;  1IYF A;  2L0F A;  4FA6 A;  3DBH I;  4EUT A;  3WAP A;  1WZ3 A;  2LVO A;  3A1Q B;  5DPR A;  1XQQ A;  1V6E A;  2AEH A;  1MG8 A;  2IO1 B;  2N4F A;  2GBK A;  2N9P C;  3QQ8 B;  1WM3 A;  2JXX A;  2KDE B;  2REX A;  1X1M A;  3Q3J A;  4HK2 A;  3VUY A;  4EKU A;  3A33 B;  3KYC D;  4JLC A;  4YL8 A;  4XZ4 A;  3N32 A;  2KFJ A;  2CHW A;  3PHW B;  2NVU I;  3IFW B;  4GGQ A;  2J0J A;  2LXA A;  2N7D A;  3A9K B;  5DCN A;  3T9L A;  2KD0 A;  3IVF A;  1P3Q U;  5HKH A;  2RR9 A;  2MWS B;  1E8Z A;  4A3O A;  4B95 A;  4HWI B;  4RM9 A;  4II2 B;  4WAA A;  3AU4 A;  2FCQ A;  4NJ6 A;  4EZL A;  5JH5 C;  1L7Y A;  1PQS A;  1ZW7 A;  4KDL B;  5C1Z A;  3L17 A;  1M94 A;  2IY1 B;  1SE9 A;  2KWV B;  2DZM A;  3A1Q A;  3TIX A;  4GB9 A;  4HVB A;  3X23 A;  2WX1 A;  4FN2 A;  3ZLZ A;  2ZZP B;  5DPW A;  2FAZ A;  4IM3 A;  3QIJ A;  2D11 A;  4MH0 E;  4MSQ B;  2DAJ A;  4MM3 A;  3HK0 A;  3VVW B;  4F1S A;  1HE8 A;  5CHV C;  4WQO B;  4A20 A;  4WWN A;  4HPL B;  3A9K A;  4B9K A;  3AXC A;  4E74 A;  3I3T B;  3QAR A;  2G4D B;  1TTN A;  3EFU A;  4W9L A;  4FJV B;  3WA0 A;  2N1W A;  1V49 A;  3H9D A;  3UIP B;  2KO3 A;  2LJ5 A;  1EF1 A;  2G4S A;  1EO6 A;  2IO0 B;  3ML8 A;  4X57 B;  4IM0 A;  1YX6 B;  2EMS A;  4BKS A;  3QC8 B;  3DPD A;  1G6J A;  4K81 A;  3RZW C;  4TQ1 A;  1UD7 A;  4BKG A;  1WI0 A;  4W9C A;  3U8Z A;  3AI5 A;  3N30 A;  3KH0 A;  4DDG D;  1WM2 A;  4TV3 A;  2BPS A;  3PV1 A;  4JQW C;  1YIW A;  2JT4 B;  3L13 A;  4GDK B;  4I6P A;  2L76 A;  3ZW3 A;  4NAW B;  1VD2 A;  1J19 A;  1RLF A;  4K7S A;  3ZDM C;  4DXA B;  2B3A A;  4W9D A;  3V60 A;  3EC8 A;  2MBO A;  2K8B A;  3V6C B;  2ZPY A;  4W9K A;  1WE7 A;  2BKR B;  4IUM B;  1JRU A;  2LGD A;  1UZX B;  4DWF A;  2LGY A;  2KMA A;  1V5O A;  4FJZ A;  2V4L A;  2JRI B;  4IWO A;  3KUC B;  4EZK A;  5AEK B;  3SHQ A;  4G0N B;  5LLI A;  2J7Q B;  4KZC A;  2KC1 A;  1E8Y A;  2KJR A;  3JVZ X;  4LDT D;  3VH4 B;  2RSU A;  3L54 A;  2MA9 B;  3QK0 A;  4HDQ A;  3VTU A;  2KN5 A;  4IG7 B;  5LXH A;  5EDS A;  3ZNH B;  1KJT A;  3M63 B;  2RGF A;  3APC A;  1V5T A;  1E7U A;  2KTR B;  2XEW A;  1LXD A;  2L8J A;  3ZNZ B;  4MSM B;  3ZVV A;  2CKH B;  3DQV A;  2EKE C;  5DPS A;  2IO2 B;  3WAL A;  1Z2M A;  2LVP A;  3NHE B;  2YLM A;  4GOC A;  2LRW A;  1V9J A;  4DK5 A;  1WR1 A;  1WJ6 A;  2K1F A;  3ML9 A;  3WAN A;  4GDK A;  3OJ3 A;  4JIO U;  2LUE A;  4LJO B;  4NAW A;  2MBQ A;  1WGH A;  2KDB A;  1I42 A;  1FXT B;  2MX2 A;  2BF8 B;  1Q1O A;  5DPT A;  4IWQ A;  5D2M B;  4RMA A;  3OAW A;  2CS4 A;  1L2N A;  2KKC A;  3VTV A;  4P7I A;  2WWZ A;  3KUD B;  1WYW B;  4GN1 A;  4JGH B;  3OJ4 B;  4MGY E;  4IWP A;  1OEY A;  1OQY A;  1WZ0 A;  3DCG A;  2AL3 A;  3VQI A;  4AWJ A;  2NS5 A;  1WMH B;  2O6V B;  2KTR A;  2Z0D B;  2D07 B;  4DBG A;  5J17 A;  5KHQ A;  4MGI E;  1RFA A;  3ONS A;  2XBB C;  3W1S A;  4FBJ B;  2JRH A;  1GUA B;  1H4R A;  4KZ0 A;  1UBI A;  4PS7 A;  2GMI C;  1WF9 A;  1BT0 A;  1P0R A;  1E5W A;  2DAF A;  3DVG Y;  3PGE A;  3ZTD A;  3B0A A;  4BKT A;  3RCZ A;  4EOY A;  4OVV A;  4KDI C;  1T0Y A;  1SIF A;  3MJW A;  3A4S C;  3PRZ A;  5L95 C;  2MSE D;  2LAS A;  3RYT A;  3K9O B;  3H1U A;  4II3 B;  4DHJ D;  2GBN A;  4N9F 4;  3TJP A;  2RD0 A;  2L3Z A;  3HM3 A;  4JL9 A;  2DHZ A;  2AWT A;  3PVL A;  5IA7 A;  2KX3 A;  1K8R B;  2DZK A;  3DVN V;  1WMH A;  3QX1 A;  2O6V A;  3MTN B;  3ECI A;  4OVU A;  2HD5 B;  2IY0 B;  2KZR A;  2GOW A;  3R7Q A;  2R2Q A;  3ZO5 B;  1XT9 B;  2VRR B;  5G2N A;  2DYB A;  2C5L C;  3W1Y A;  1J0G A;  2I1K A;  1EF5 A;  2L00 B;  1LM8 B;  3R3M A;  3OLM D;  4FLH A;  2PE9 A;  5KHO A;  3A9J B;  2GBR A;  3QHT A;  3TCA A;  4NQL B;  2PJH A;  4B6W A;  1RRB A;  2HTH A;  5CHW A;  1WE6 A;  2LXC A;  5CHF A;  3PLU A;  2K8C A;  3JYU A;  3PPA A;  3H7S A;  1E8X A;  3ZUN A;  4M8N A;  2KTF A;  4G50 A;  3VUX A;  4IM2 A;  1R4N I;  1RAX A;  2ASQ A;  2ZCC A;  3DVG X;  5J18 A;  3EEC A;  1WGD A;  1WJN A;  3A4R A;  2IZV B;  3ALB A;  1P1A A;  2NBU A;  3V62 A;  2IO3 B;  3D32 A;  1KLV A;  4KVG B;  4ASW C;  1WXS A;  3BIN A;  3JW0 X;  3UQA A;  4HJK A;  4NQK E;  1P9D U;  4ZRI A;  1LFD A;  3PSE B;  4M8M A;  1YQB A;  3A9J A;  3L10 B;  4HPM B;  2FCM A;  2BYV E;  2LZ6 A;  5GMV A;  2K25 A;  2LRU A;  4K7W A;  4GIV A;  4HXD A;  4NNJ B;  4F8C B;  4FAD A;  2UYZ B;  2CR5 A;  2KWU B;  1S3S G;  1GG3 A;  2KMC A;  4PS8 A;  3ZRF A;  3PS6 A;  3EHV A;  1CMX B;  2KLG A;  2LGX A;  1KM7 A;  3H7P B;  2MBB B;  3ZKJ C;  2PE6 B;  3O65 B;  4EFO A;  3ENE A;  3NOB A;  1WJU A;  2GBM A;  4KSK C;  1KOT A;  4BBN C;  5FR6 A;  2GBJ A;  4G11 A;  2KDF B;  1Q5W B;  2KX0 A;  5D6J B;  3TMP B;  4K1R B;  5JHA A;  1UBQ A;  2AYO B;  2K6D B;  2KJH B;  4AUQ C;  1V86 A;  1WRD B;  2OJR A;  1OEY J;  2KFK A;  3WIM A;  1OTR B;  2MBE A;  2Y5B B;  1AAR A;  2JF5 A;  4DHZ B;  5TR5 A;  3UQB A;  4NJ7 A;  2HJ8 A;  2A5U A;  3R66 C;  4MDK E;  2FUH B;  1OGW A;  3RUL A;  4CYE A;  2BWF A;  2NR2 A;  1TBE A;  3H7P A;  4URK A;  3NZU A;  1NDD A;  2KOX A;  3JSV B;  4BKS D;  3RZF A;  4MEL A;  3SU8 X;  5LXI B;  2NBV B;  2L7R A;  3DDC B;  2N7E A;  3PT2 B;  1NI2 A;  2ZCB A;  2L0T A;  3S2A A;  1GJZ A;  1TZ1 A;  4WJQ A;  5BO4 B;  2C7H A;  2JUO A;  3HHM A;  2AL6 A;  2IBI B;  1IPG A;  4TUU A;  4W9J A;  1D3Z A;  4FHK A;  2RPQ A;  2ZVO A;  1E8W A;  1ISN A;  5JZE B;  2BKF A;  3VFK A;  2Z59 B;  1WX8 A;  1S1Q B;  3B08 A;  3KYD D;  1A5R A;  1YD8 U;  2KXJ A;  1UGM A;  5E6P A;  1Q0W B;  2NBW B;  2K6Q A;  3APF A;  3IG3 A;  1GC7 A;  2N1V A;  4ANV A;  1V80 A;  2N9E B;  2BWE S;  2KHW B;  3DVN U;  3TBL D;  3ZTC A;  4WWP A;  2PEA A;  2J0K A;  2CU1 A;  3JSV A;  2W9N A;  4IW0 A;  2XK5 A;  3KUZ A;  4DHZ E;  1E90 A;  2M1M A;  4WJN A;  4BFR A;  3ZIM A;  4AOF A;  3CMM B;  4I6N B;  2KQS A;  2ZVN A;  2JWZ A;  3PTF C;  4PYU A;  1QZE A;  4W9I A;  4ZYN A;  3UIN B;  3R7R A;  3W1S C;  2K39 A;  2Z0E B;  2A4Z A;  3VTW A;  1WXV A;  3QCA A;  5CX3 A;  1Z5S B;  4MGK E;  2CHX A;  2KWC A;  3M95 A;  3DOW A;  3P2B A;  4CO7 A;  3U30 A; 
#chains in the Genus database with same CATH topology
 4ANX A;  3ZRC A;  1J8C A;  2KYW A;  2CHZ A;  4A3P A;  1WIA A;  1R4M B;  4YXD B;  4LDT B;  1QLB B;  3U2S C;  4BOZ B;  3N3K B;  3GB1 A;  1EWY C;  3GZN I;  1K52 A;  3VUW A;  5C23 A;  2JXT A;  2MH7 A;  5HFY A;  4G3X B;  3C0R B;  4NPN A;  2KLC A;  3WAO A;  1L4Z B;  1YJ1 A;  4GSW A;  1TGZ B;  2LD9 A;  1VCB A;  1TS2 A;  2YVC A;  4N59 A;  3VAW A;  3AU5 A;  4WJP A;  1TY0 A;  3DBR I;  1WH3 A;  1DYQ A;  4GMV A;  3ZNI D;  2LWP A;  2KFK B;  3RNG C;  2ZNV B;  4TMA B;  3PO0 A;  3L08 A;  4LNK A;  4ZOH C;  2NCN A;  3WAM A;  5IN7 A;  4NZL B;  5J2R A;  2QHO A;  3HVD A;  2PMV A;  1WY8 A;  3AE1 B;  4BVU C;  3E56 A;  3Q3M C;  5AUK A;  4DHJ B;  3VHT C;  2V3S A;  4ICV A;  4TQ0 A;  4PS3 A;  1Y8R C;  4YTN B;  1H8C A;  1UEL A;  1GNU A;  1V97 A;  1WXA A;  4XX5 A;  4YSZ B;  2KDI A;  4HLE A;  2JX5 A;  4WJO A;  1HQR D;  2PTL A;  3ETR A;  3RT3 B;  4F7Z A;  4ICU A;  3PRE A;  3R8B A;  4L1B A;  3HRD D;  2WNM A;  2N9K A;  4ACF A;  1C1Y B;  3AED B;  4W9E A;  1IP9 A;  3IAS 1;  3PZ7 A;  2M4N A;  4W9H A;  2BYF A;  3Q8E A;  3R2I A;  3PHX B;  3DBS A;  1KLG D;  5GXG B;  2WX0 A;  3HM6 X;  2WXG A;  4W9F A;  2WDT B;  1KH0 A;  4M0W B;  2QDF A;  2QMT A;  2KJ6 A;  1FIQ A;  2R2O A;  2L05 A;  4OVZ A;  2D3C A;  2D3G A;  1JWB D;  3URY A;  2FCN A;  2L0F A;  2BVC A;  4YSX B;  3A1Q B;  2WXK A;  1V6E A;  1MG8 A;  2JXX A;  1TZO A;  3AEF B;  3N32 A;  3DWM A;  3R2T A;  2LXA A;  1N5X A;  3A9K B;  4M0W A;  3IVF A;  1F1H A;  2MWS B;  2WQY B;  3BYY B;  2V3N A;  4CQN A;  4RM9 A;  4WAA A;  1CK1 A;  5JH5 C;  1L7Y A;  1PQS A;  2WXO A;  1ZDX A;  4KDL B;  3L17 A;  3A1Q A;  5BYQ A;  1TY2 A;  3GP7 A;  2Y3A A;  3HK0 A;  1B1Z A;  1HZ5 A;  1FPY A;  2K0P A;  5CHV C;  1HA5 A;  3A9K A;  4E74 A;  3I3T B;  1TTN A;  2GRI A;  3AV8 A;  2KQ4 X;  4WIP A;  3AN1 A;  2EMS A;  1JWM D;  3DPD A;  4K81 A;  1WI0 A;  3KH0 A;  2PW9 A;  2BPS A;  1YIW A;  4NAW B;  2JYE A;  4B0E A;  4KGR A;  1J19 A;  4DXA B;  1SF0 A;  3NVW A;  3GS2 A;  3EC8 A;  2K8B A;  2WXL A;  2WXF A;  2JU6 X;  1WE7 A;  1WSP A;  2RMM A;  2LMC A;  5BMI A;  2LGI A;  4WUR A;  3MFG A;  3EA6 A;  3SHQ A;  4G0N B;  2V4I B;  1QOG A;  1E8Y A;  5MPO A;  3JVZ X;  1XLQ A;  1KJT A;  4B0M A;  3APC A;  1FRD A;  2M56 B;  2L8J A;  2CKH B;  5DPS A;  2IO2 B;  3N20 C;  1WR1 A;  1WJ6 A;  2JYT A;  3WAN A;  3OJ3 A;  4NAW A;  3TEX A;  4JWS C;  1ENF A;  3I9V 1;  2WXP A;  4DXG A;  1FM0 D;  2BT6 A;  4P7I A;  3KUD B;  4JGH B;  1WZ0 A;  3VQI A;  4AWJ A;  4LTU A;  1AN8 A;  2Z0D B;  4A6Q A;  2KT7 A;  2LGS A;  2JRH A;  1GUA B;  1UBI A;  3MP9 A;  4PS7 A;  4P1B C;  2FBW B;  1WF9 A;  1E5W A;  2DAF A;  3PGE A;  1VR9 A;  3ZTD A;  1JCK B;  4EOY A;  3P42 A;  4KDI C;  4S0R A;  3PRZ A;  1L4D B;  1D5Z C;  4XDD A;  3RYT A;  3K9O B;  4N9F 4;  3TJP A;  3HM3 A;  3AEC B;  3QX1 A;  1TT5 B;  2HD5 B;  1XF5 L;  5G5G A;  2KZR A;  2CU3 A;  3BVZ A;  3R7Q A;  1XT9 B;  1R7S A;  5G2N A;  2DYB A;  1EF5 A;  3TCA A;  2SEB D;  4B6W A;  1T0R C;  2WDQ B;  2LXC A;  5CHF A;  3JYU A;  4EE2 A;  4M00 A;  3T3O A;  4G50 A;  4QAY A;  1RAX A;  2ZCC A;  1JML A;  5J18 A;  4N58 A;  1WJN A;  3A4R A;  3V62 A;  2IO3 B;  3BVG A;  4XWT A;  3BIN A;  2KVZ A;  4NQK E;  1ZOY B;  3H8H A;  1SJE D;  1P7E A;  1GOZ A;  2BYV E;  2LZ6 A;  1FEH A;  2K25 A;  5GMV A;  4NNJ B;  4HXD A;  5H92 C;  4RFB A;  2UYZ B;  3B2F A;  2X38 A;  1LO5 D;  4HPP A;  2NTT A;  1J7B A;  1S3S G;  2KMC A;  3ZRF A;  1CMX B;  2KLG A;  3VRB B;  3ENE A;  1WJU A;  2GBM A;  1KOT A;  3I57 A;  1SIJ A;  5FR6 A;  1YQ3 B;  1OQR A;  2V9H A;  1UWX A;  1Q5W B;  5JHA A;  1UBQ A;  2K6D B;  1V86 A;  2BBC A;  1F2R I;  2ZW0 A;  2MBE A;  4DHZ B;  3UQB A;  1CZP A;  3U30 A;  1FRR A;  2RDH A;  1MPE A;  4MDK E;  1OGW A;  1ZXH A;  5LXI B;  2L7R A;  3PT2 B;  1NI2 A;  3S2A A;  2L0T A;  3LXF A;  3Q3O C;  4WJQ A;  2C7H A;  3HHM A;  2AL6 A;  1UUP A;  4TUU A;  2AX5 A;  1D3Z A;  2RPQ A;  4HEA 1;  1ISN A;  3VFK A;  1WX8 A;  1FO4 A;  4DXF A;  4KGT A;  4XYC A;  1HTQ A;  3RNF C;  1GC7 A;  4J3O D;  4OW0 A;  2KHW B;  3ZTC A;  4WWP A;  3AEA B;  4C7Z A;  2W9N A;  4IW0 A;  4DHZ E;  1E90 A;  4WJN A;  4RGN A;  5T8I A;  1QQR A;  1ET6 A;  2ZVN A;  2RDB C;  4W9I A;  4PYU A;  1QZE A;  2Z0E B;  2A4Z A;  5HI1 A;  1WXV A;  1Z5S B;  1MJD A;  4AS1 A;  3DOW A;  4CO7 A;  5BYS A;  2I1J A;  3QAQ A;  4E3C A;  2ZPN A;  2C7M B;  4GLS C;  1ZXI A;  3QWZ B;  2WU2 B;  5D94 A;  3GZN B;  1EUV B;  4MGZ E;  2BYE A;  3TUO A;  1F9J A;  1ZGU B;  2EMT A;  3RI7 C;  1SEB D;  4ANU A;  3Q2A C;  2MW5 A;  1YN5 A;  1FNV A;  2ZEQ A;  3DBR B;  5HHD G;  4S17 A;  2OOB B;  2FIF A;  2QCZ A;  1IUE A;  3M3J A;  4N6E B;  3P4S B;  2MLB A;  3BII D;  3TL5 A;  1E6E B;  3V61 A;  2IYD B;  2O6V D;  4TSS A;  2KN4 A;  3ZYY X;  3UGB B;  4ZRK A;  1IBX A;  1JRP A;  2DYO A;  2ZJD A;  2JZZ A;  5AZF A;  2O2V B;  2C9W B;  5JHB A;  1TS4 A;  2WDV B;  3Q3F A;  4I6L B;  5E6O A;  3RPF C;  4OZB A;  3MHS D;  4IC7 B;  3IBE A;  2LI5 A;  3HUI A;  5IOI A;  1D4B A;  4AJW A;  5IO9 A;  3K9P B;  3NZS A;  2WXQ A;  1XLO A;  5E6N A;  1GAQ B;  2FCS A;  2MP2 B;  2K8H A;  3UIO B;  2O2V A;  2D2Q A;  2MQJ A;  2KAN A;  4RGT A;  1FCC C;  4KIK B;  4ZRJ A;  2M8S A;  4HKQ A;  4K7U A;  4GXB A;  3RD2 A;  3SDL C;  4ZRP A;  4LNN A;  3L16 A;  2JVC A;  1SGH A;  2L1A A;  4FJY A;  2QJL A;  1EU4 A;  1PFD A;  1TS5 A;  4HDO A;  1I35 A;  5AUI A;  1MHH E;  4AP4 C;  2KAC A;  2MP2 A;  2GB1 A;  2M0A A;  3RUI B;  3MC8 A;  3M62 B;  2VH1 A;  3PRM B;  4ZRQ A;  3N1Z C;  1C3T A;  1WGY A;  3PRP B;  3P4R B;  4LJP B;  4KIK A;  1V81 A;  3PZD A;  3KVF B;  1IYF A;  4LCD E;  4FA6 A;  1VZ6 A;  1JWA D;  4KKJ A;  1SE3 A;  2DWQ A;  1XQQ A;  2AEH A;  3AEB B;  3Q8A A;  2IO1 B;  2N4F A;  2GBK A;  1FNU A;  1WM3 A;  3Q3J A;  1X1M A;  4HRS A;  4JLC A;  4YL8 A;  4XZ4 A;  2VZK D;  2NVU I;  3IFW B;  3ZXV A;  3P63 A;  4A90 A;  1A70 A;  2N7D A;  5DCN A;  3NUH B;  5D3D A;  2ZW1 A;  3NRZ A;  3OG5 A;  3VR8 B;  3AU4 A;  2D3A A;  2IGG A;  4XE0 A;  1M94 A;  1SE9 A;  3TIX A;  1DOY A;  4NAM A;  4FN2 A;  2FAZ A;  4US9 A;  2D11 A;  4MSQ B;  1BXT A;  4P1C C;  2YEP B;  3MC0 B;  2N7J A;  4WWN A;  4HPL B;  3DHG C;  4WH4 A;  4B9K A;  3QAR A;  1NYQ A;  1ZE3 D;  2G4D B;  1JW9 D;  3WA0 A;  4W9L A;  1NVI D;  1V49 A;  2LJ5 A;  1EF1 A;  2IO0 B;  3OWE B;  3ML8 A;  4IM0 A;  1D5X C;  4BKS A;  3NZ3 A;  1KF6 B;  3RFZ B;  4BKG A;  4W9C A;  3I5J C;  4DDG D;  1WM2 A;  4TV3 A;  4KKI A;  2JT4 B;  4GDK B;  2L76 A;  3Q6B A;  4H2A A;  3ZW3 A;  4IKG A;  1RLF A;  4W9D A;  3V60 A;  1UWM A;  3V6C B;  4IUM B;  1JRU A;  4DWF A;  2KMA A;  2V4L A;  4EZK A;  1M4V A;  2J7Q B;  3VH4 B;  2RSU A;  3L54 A;  4HDQ A;  3VTU A;  2KN5 A;  3ZNH B;  1LXD A;  5JXV A;  2LVP A;  3LB8 C;  2YLM A;  1V9J A;  3NVZ A;  2K1F A;  3ML9 A;  4GDK A;  2ACZ B;  2LUE A;  4LJO B;  3Q8C A;  2MX2 A;  4IWQ A;  2J52 A;  1TJE A;  2CS4 A;  1L2N A;  1UNS A;  4GN1 A;  4IWP A;  3L4P A;  1KLU D;  1OQY A;  1WMH B;  2D07 B;  5J17 A;  2WDR B;  2LFI A;  2XBB C;  3W1S A;  3FKY A;  2R61 A;  1YQ4 B;  2GMI C;  3SEB A;  2JZP A;  3ZGZ A;  1BT0 A;  1P0R A;  3NVV A;  1FD6 A;  3DVG Y;  3RCZ A;  4OVV A;  3GE8 C;  1SIF A;  3A4S C;  5L95 C;  2LAS A;  3ZJT A;  2GBN A;  2RD0 A;  4JL9 A;  2DHZ A;  1QF6 A;  2KDM A;  3PVL A;  2J4X A;  1WMH A;  4YT0 B;  2I38 A;  2GOW A;  3ZO5 B;  2VRR B;  1FMA D;  2I1K A;  2L00 B;  1LM8 B;  3R3M A;  5KHO A;  2GBR A;  3QHT A;  2NMQ A;  2PJH A;  4L23 A;  4C80 A;  2WXR A;  3PLU A;  3H7S A;  1E8X A;  1B9R A;  3ZUN A;  2H88 B;  4M8N A;  2KTF A;  2J42 A;  3KWV A;  1R4N I;  2ASQ A;  2ON8 A;  3DVG X;  3EEC A;  1EU3 A;  1WGD A;  2M19 A;  3ALB A;  1P1A A;  1OFF A;  1AW7 A;  4KVG B;  4ASW C;  3UQA A;  3JW0 X;  5FR3 A;  3GE3 C;  1FXA A;  2IJ0 A;  1P9D U;  1LFD A;  1TKG A;  3CWI A;  1YNT E;  4M8M A;  4HPM B;  2L83 A;  5BMG A;  4FAD A;  2LRU A;  1XCT L;  3BYT B;  3PS6 A;  3H7P B;  4REZ A;  2PE6 B;  4EFO A;  3NOB A;  4WWM A;  4KSK C;  1PGX A;  4BBN C;  1XEE A;  2GBJ A;  2WXH A;  3J9C A;  2W54 A;  3TMP B;  1WRD B;  1OEY J;  1JWS D;  2Y5B B;  5EE0 A;  5TR5 A;  4NJ7 A;  3R66 C;  2WU5 B;  3RUL A;  2BWF A;  2NR2 A;  3H7P A;  3NZU A;  1NDD A;  1MHX A;  3RZF A;  1N60 A;  1UF0 A;  2ZCB A;  4ZYS A;  2L32 A;  5BO4 B;  2IBI B;  1WRI A;  1PGA A;  2BKF A;  1CJE A;  1TKY A;  4ARI A;  2Z59 B;  3AE4 B;  3KYD D;  1YJJ A;  1UGM A;  3NJT A;  3Q69 A;  1KRH A;  4XGA B;  3IG3 A;  2N1V A;  4ANV A;  3DHI C;  1V80 A;  4FXC A;  4R3D A;  2L52 A;  2PEA A;  3RMK C;  1DOX A;  2XK5 A;  2QIL A;  3ZIM A;  3P4P B;  1FNW A;  3CMM B;  4I6N B;  1HZ6 A;  4ARC A;  1I4X A;  3W1S C;  2W3R A;  2K39 A;  3QCA A;  2K5P A;  4A20 A;  3IXS A;  1VJK A;  2C60 A;  1T5X D;  2LVQ A;  2G3Q B;  3Q14 C;  1WXM A;  2DYM A;  4MEM A;  4LNO A;  4XWW A;  4FUL A;  4WWO A;  3ZNG C;  2BGF A;  2VH2 A;  5H8Y E;  1WWT A;  2UWQ A;  1DGJ A;  5AZG A;  3AH7 A;  3AEG B;  4PT5 A;  1ZPS A;  3AE7 B;  2JZ3 B;  2BS3 B;  2INN E;  1MVK A;  1WX9 A;  1WGG A;  4USA A;  1AWD A;  3NVY A;  4A9A A;  5D7G A;  3VXW A;  1ZDV A;  1XD3 B;  3DBL I;  3CST A;  4KX6 B;  3ZQ4 A;  1P98 A;  3AE2 B;  2DZI A;  1EWC A;  2J0M A;  2V3P A;  2IPK D;  3ZXR A;  5I4D A;  2LEK A;  3KW5 B;  3VH3 B;  3ZDT A;  1E7V A;  1N63 A;  2N0S B;  2LJI A;  2E3T A;  1WR6 E;  1XCQ L;  3N1X C;  2BQQ A;  1YJI A;  4MAC A;  4K3B A;  3CSF A;  4ITK A;  4AJY B;  4O1N A;  3L0W B;  2WXM A;  2PPH A;  3I63 C;  3GOE A;  3BY4 B;  4YTP B;  2KQ7 A;  3B1L X;  2RPV A;  1LQB A;  1YX5 B;  2G45 B;  3Q8F A;  3H6N A;  1IGC A;  2KWD A;  5AZH A;  2NPT B;  3QA8 A;  1GC6 A;  2KC2 A;  1WXQ A;  3EFC A;  5EE1 A;  2M17 A;  2UU7 A;  2KVR A;  1WJ4 A;  4C56 C;  3IHP C;  4GU2 A;  4P6V F;  2GI9 A;  5BMH A;  2JSV X;  4YTM B;  5G55 A;  5IAA C;  1F2R C;  4EZJ A;  2NPT A;  2PVO D;  4HCP B;  2BTE A;  2OED A;  4EUT A;  3WAP A;  2LVO A;  5DPR A;  2BB6 A;  2N9P C;  3QQ8 B;  2KDE B;  2DNF A;  1HTO A;  4HK2 A;  3VUY A;  4EKU A;  3RNE C;  2CHW A;  3P1M A;  3HVZ A;  4GGQ A;  2J0J A;  4US8 A;  4LNI A;  3T9L A;  2TSS A;  4MT5 A;  5EE9 A;  5HKH A;  1IBX B;  2IGH A;  4B95 A;  4EZL A;  4NJ6 A;  2D5G A;  4ZHO A;  4C00 A;  5C1Z A;  5FK9 C;  2IY1 B;  1I4P A;  1RM6 C;  2WXN A;  2KWV B;  2DZM A;  2K9X A;  2J53 A;  2E6X A;  3ZLZ A;  5DPW A;  1RWS A;  1PYW D;  4IM3 A;  2MHJ A;  3QIJ A;  2DAJ A;  4MH8 A;  2KMM A;  1HE8 A;  5C3J B;  4WQO B;  3RN9 C;  3VR9 B;  4HKZ E;  3EFU A;  3BWU D;  3H9D A;  3UIP B;  1XO3 A;  2KO3 A;  3BVM A;  2G4S A;  1EO6 A;  1HEZ E;  2LHE A;  1NEN B;  1D6E C;  1XLP A;  1SE4 A;  1BUI C;  1T0S C;  3N30 A;  3PV1 A;  2MJD A;  3B2G A;  1J7A A;  1K53 A;  3ZDM C;  5IP4 D;  2B3A A;  2AQ1 B;  5LNK 1;  2ZPY A;  4W9K A;  1UZX B;  2JRI B;  3KUC B;  5AEK B;  4XDC A;  5D3I B;  5LLI A;  4RGM A;  4KZC A;  2KC1 A;  2KJR A;  4LDT D;  3U7Z A;  3QK0 A;  4YWG G;  4IG7 B;  5LXH A;  5EDS A;  1Y56 A;  3M63 B;  2RGF A;  1V5T A;  2KTR B;  2XEW A;  4MSM B;  3ZVV A;  3P4Q B;  3WAL A;  4GOC A;  1C76 A;  3NHE B;  2LRW A;  3B9J A;  2QC8 A;  1QOA A;  2WP9 B;  1UGJ A;  1I42 A;  1I4R A;  2BF8 B;  2AQ3 B;  3Q3N C;  3OAW A;  2KKC A;  1YN4 A;  5C2T B;  1WYW B;  3OJ4 B;  3DCG A;  2AL3 A;  2MJ3 A;  1EM7 A;  1QKZ A;  2O6V B;  3C8Y A;  2KTR A;  4MGI E;  1H4R A;  2IND C;  1VDV A;  2Z8L A;  2CJN A;  1C9F A;  4L2Y A;  1JAL A;  1I4H A;  2PIA A;  3N9Y C;  3MJW A;  1ROE A;  2MSE D;  3VRA B;  3WCQ A;  3H1U A;  4II3 B;  2WS3 B;  4DHJ D;  2L3Z A;  2DLB A;  2AWT A;  5IA7 A;  2KX3 A;  2DZK A;  3DVN V;  4Q2J A;  2O6V A;  2INC C;  4DQO C;  3MTN B;  3ECI A;  2R2Q A;  3DHH C;  3W1Y A;  1J0G A;  2QEJ C;  4FLH A;  1E7P B;  1RRB A;  1FFV A;  4NJC A;  1WE6 A;  1R4N B;  3BZD B;  4IM2 A;  3IT4 B;  4P16 A;  3AE5 B;  4LLG M;  3U52 E;  4RF1 A;  1KLV A;  3D32 A;  3V05 A;  1NYR A;  1WXS A;  2JQR B;  5EE3 A;  4BZA A;  3C19 A;  4ZRI A;  1WYG A;  1L0Y B;  1SE2 A;  2QIE B;  1YMH E;  4K7W A;  4GIV A;  3MJ5 A;  2CR5 A;  2KWU B;  1GG3 A;  3FAH A;  2HJ1 A;  2LGX A;  2MBB B;  3ZKJ C;  1SB3 C;  3ABV B;  4G11 A;  2VZK B;  1YOV B;  1VLB A;  2KDF B;  3AE6 B;  2KX0 A;  5D6J B;  4K1R B;  2AYO B;  2KJH B;  4AUQ C;  4LNF A;  2OJR A;  2KFK A;  1LGR A;  1OTR B;  3W5U B;  3KWL A;  1AAR A;  4RH6 A;  3EUB 2;  2A5U A;  4K3C A;  4URK A;  4MEL A;  4RCO A;  2NBV B;  1JQ4 A;  1TZ1 A;  2JUO A;  2G9H D;  4W9J A;  1QIL A;  1E8W A;  3TEW A;  2I2Y A;  1T3Q A;  1S1Q B;  1XLN A;  1YD8 U;  5E6P A;  1Q0W B;  1SSN A;  2K6Q A;  1KTK A;  1TS3 A;  3RNB C;  2N9E B;  1T6B X;  2G1E A;  2BWE S;  1CQV A;  2J0K A;  2W82 A;  3SFD B;  4BFR A;  4PK1 A;  3DBH B;  2KQS A;  3IT6 B;  2JWZ A;  3PTF C;  4ZYN A;  2MJE A;  3UIN B;  4MGK E;  1L0V B;  2CHX A;  4RMA A;  1E9M A;  4BAX A;  4RM8 A;  2WGS A;  2OHF A;  1SBB B;  3U7D A;  4RNA A;  3UI3 A;  3AUL A;  1R4M I;  1NBF C;  2JY6 A;  4HCN B;  2V1Y A;  4BBN F;  1F52 A;  2DEN B;  3AEE B;  4IOI E;  2D10 A;  4M01 A;  2K3U A;  4JX1 C;  1WFY A;  4ANW A;  2DZJ A;  1VZ7 A;  1WGR A;  2C7N B;  2FNJ B;  3T8M A;  1L0X B;  2YEP F;  2MCN B;  1K51 A;  4ZDV A;  1VRA B;  4DDI D;  1V1P B;  4RGO S;  2DBY A;  2AQ2 B;  4OZA A;  3LYY A;  4KV2 A;  1F0Z A;  2RDG A;  3LJ3 A;  2K22 A;  3NS8 A;  1SXT A;  1I4G A;  2JWU A;  1C4P A;  3DBL B;  3BK2 A;  2FID A;  3SR6 A;  3T3N A;  4JPS A;  5CTR C;  1BML C;  5HG2 A;  4E71 A;  3PLV A;  3V6E B;  1PDX A;  2CJO A;  2WYQ A;  1WGK A;  1QOF A;  3NY5 A;  4TKN A;  4CHK A;  4J6I A;  2HTM E;  3FIL B;  1V1P A;  4HJG E;  1KFY B;  1P7F A;  1WX7 A;  2WXI A;  1N61 A;  3X0W A;  2MRP A;  1TKE A;  1HXY D;  4WAF A;  1U4A A;  3AE9 B;  1F77 A;  4MJS B;  4GDL B;  2MBH A;  4IDI A;  1XXG A;  3UF8 A;  1L6V A;  1AYF A;  1ZKH A;  3QJZ A;  4FHJ A;  2XK5 B;  4PYZ A;  3U4E G;  1TIF A;  3FIL A;  1JWU D;  2M0X A;  2JPH A;  2DX5 B;  2ZNV C;  2OJW A;  2PVG C;  2KK8 A;  4W9G A;  4KSL C;  1PUT A;  4LK0 M;  1L5P A;  2N9X A;  5E6J A;  4EEW A;  1UH6 A;  3LDZ E;  1V2Y A;  4MJS A;  3HIZ A;  4GDL A;  3SD5 A;  3CF6 E;  4AQ7 A;  1MFW A;  1QT9 A;  3APD A;  1T0Q C;  4XC2 A;  4BOS C;  4NY0 A;  2HE7 A;  5L83 A;  4OHJ A;  3VDZ A;  3MHZ A;  2KNB A;  3DBH I;  1ACC A;  2EKI A;  1WZ3 A;  3AB5 A;  3PZ8 A;  4YSY B;  3AE3 B;  3RNC C;  2REX A;  3IAM 1;  3AM9 A;  3A33 B;  3KYC D;  2EEL A;  2MEK A;  4MM3 B;  2KFJ A;  3PHW B;  1STE A;  1ZP0 B;  2ONQ A;  2Y5P A;  3DWG C;  1FCL A;  2D3B A;  2HDE A;  2KD0 A;  1P3Q U;  2B76 B;  2RR9 A;  1E8Z A;  2H89 B;  4A3O A;  4HWI B;  4II2 B;  2X8X X;  2FCQ A;  1ZW7 A;  2N9L A;  3W9C B;  4RF0 A;  4GB9 A;  1RYJ A;  4HVB A;  3X23 A;  2WX1 A;  2ZZP B;  1ET9 A;  5TSS A;  4MH0 E;  4MM3 A;  3VVW B;  4F1S A;  3N1Y C;  1DOI A;  3AXC A;  2BS4 B;  4FJV B;  2N1W A;  4C7Y A;  1QOB A;  1NEK B;  3SFE B;  4X57 B;  3W5V B;  1YX6 B;  1ESF A;  2Q5W D;  3AE8 B;  3QC8 B;  1G6J A;  2LUM A;  3RZW C;  4TQ1 A;  1UD7 A;  2LHD A;  3U8Z A;  3AI5 A;  4JQW C;  2IDY A;  3L13 A;  4I6P A;  1NI3 A;  1VD2 A;  4K7S A;  1Q10 A;  2MBO A;  2SAK A;  2BKR B;  3CIR B;  2LGD A;  2LGY A;  1V5O A;  4FJZ A;  4IWO A;  2MA9 B;  4JE3 B;  1C4A A;  5FKA C;  1YN3 A;  2GLS A;  3ZNZ B;  1E7U A;  3DQV A;  1I7H A;  2EKE C;  3E9S A;  3V3X A;  1Z2M A;  4DK5 A;  2W3S A;  4JIO U;  2MBQ A;  1WGH A;  2KDB A;  1FXT B;  1Q1O A;  5DPT A;  5D2M B;  2WLB A;  2QSD A;  3VTV A;  5IKC M;  3KLS X;  1MG4 A;  3RNA C;  2WWZ A;  1L6U A;  2ICI A;  1V8C A;  4MGY E;  1OEY A;  2NS5 A;  5KHQ A;  4DBG A;  2BW2 A;  1RFA A;  3ONS A;  1C4C A;  4FBJ B;  4OZC A;  4KZ0 A;  2FUG 1;  3B0A A;  4BKT A;  1T0Y A;  3TSS A;  4D2K A;  1OQQ A;  2BS2 B;  1N62 A;  2WHI A;  1RFK A;  1SJH D;  1K8R B;  1FFU A;  1JRO A;  4OVU A;  2IY0 B;  1MI0 A;  2C5L C;  3OLM D;  2PE9 A;  3TEZ A;  3A9J B;  3EGR A;  4NQL B;  1K50 A;  2HTH A;  1C79 A;  5G5H A;  2XNA C;  5CHW A;  2K8C A;  3PPA A;  3VUX A;  2IGD A;  3MC9 A;  2V0G A;  2IZV B;  2NBU A;  1D5M C;  3ZJV A;  4HJK A;  2BYT A;  1FXI A;  3PSE B;  1YQB A;  3A9J A;  3L10 B;  2FCM A;  5BYR A;  4F8C B;  1PGB A;  1VZ8 A;  4PS8 A;  3EHV A;  1KM7 A;  4UDU C;  3O65 B;  4ZHP A;  1GPX A;  3BK1 A;  4HRO A;  1E0Z A;  1IGD A;  4JWU C;  1ZUD 2;  3WIM A;  1GB4 A;  2INP E;  4A8X C;  3W2D A;  2JF5 A;  1I4Q A;  1J7C A;  3TEY A;  2HJ8 A;  4CYE A;  2FUH B;  1V1O A;  1TBE A;  2W55 A;  2KOX A;  4BKS D;  3JSV B;  3SU8 X;  3DDC B;  2N7E A;  2FE8 A;  4C4V B;  1N6Z A;  1GJZ A;  1IPG A;  3FC4 A;  4FHK A;  2ZVO A;  4WQM A;  5JZE B;  2XN9 C;  3ZJU A;  2BB5 A;  3KQ4 A;  4KGS A;  3NS1 A;  1E10 A;  3B08 A;  1A5R A;  1GB1 A;  2KXJ A;  3Q8B A;  2NBW B;  3APF A;  4A55 A;  2PLP A;  2KAJ A;  3DVN U;  3TBL D;  2CU1 A;  3JSV A;  2Y5C A;  3O13 A;  3KUZ A;  2M1M A;  4AOF A;  2PKO A;  1N5W A;  4C4V A;  1C77 A;  2WXJ A;  2NTS A;  3NG0 A;  3R7R A;  3VTW A;  1TYG B;  5CX3 A;  1C78 A;  2KWC A;  3M95 A;  3P2B A;  4M02 A;  3AMZ A; 
#chains in the Genus database with same CATH homology
 4ANX A;  4RM8 A;  2I1J A;  3QAQ A;  3ZRC A;  2ZPN A;  4E3C A;  1J8C A;  2C7M B;  2CHZ A;  3U7D A;  4A3P A;  3QWZ B;  1WIA A;  5D94 A;  3AUL A;  4LDT B;  2C60 A;  1R4M I;  1NBF C;  2JY6 A;  4HCN B;  1EUV B;  2LVQ A;  2G3Q B;  2DEN B;  2V1Y A;  3N3K B;  4MGZ E;  4BBN F;  4BOZ B;  3GZN I;  2D10 A;  1WXM A;  2DYM A;  3VUW A;  2BYE A;  5C23 A;  4MEM A;  4G3X B;  1WFY A;  4FUL A;  3C0R B;  4NPN A;  2KLC A;  4WWO A;  3WAO A;  3ZNG C;  4ANW A;  1F9J A;  1ZGU B;  2BGF A;  2DZJ A;  2EMT A;  1WGR A;  2UWQ A;  2C7N B;  2FNJ B;  3T8M A;  5AZG A;  1YJ1 A;  2MCN B;  4ANU A;  4ZDV A;  4GSW A;  1TGZ B;  2MW5 A;  2LD9 A;  2JZ3 B;  4DDI D;  2ZEQ A;  1VCB A;  2YVC A;  1WX9 A;  3VAW A;  2OOB B;  3AU5 A;  4WJP A;  3DBR I;  2FIF A;  4KV2 A;  1WH3 A;  1WGG A;  3M3J A;  4GMV A;  3LJ3 A;  3ZNI D;  3NS8 A;  2LWP A;  5D7G A;  3VXW A;  2MLB A;  2KFK B;  2FID A;  2ZNV B;  1XD3 B;  3DBL I;  3CST A;  5CTR C;  3TL5 A;  3V61 A;  2IYD B;  1P98 A;  2O6V D;  4E71 A;  3PLV A;  3UGB B;  2DZI A;  3V6E B;  3L08 A;  4ZRK A;  2J0M A;  2NCN A;  2WYQ A;  2DYO A;  2ZJD A;  3NY5 A;  4TKN A;  2JZZ A;  3KW5 B;  5AZF A;  3VH3 B;  2O2V B;  4J6I A;  3WAM A;  2C9W B;  4CHK A;  5J2R A;  2QHO A;  3ZDT A;  5JHB A;  1E7V A;  1WR6 E;  1WY8 A;  3Q3F A;  4I6L B;  1WX7 A;  5E6O A;  4BVU C;  3MHS D;  4IC7 B;  4DHJ B;  3IBE A;  2LI5 A;  3CSF A;  3VHT C;  2V3S A;  2MRP A;  4ICV A;  3X0W A;  4TQ0 A;  4AJY B;  4AJW A;  4PS3 A;  1Y8R C;  1H8C A;  1U4A A;  3L0W B;  2PPH A;  1UEL A;  4MJS B;  3GOE A;  3BY4 B;  3K9P B;  3NZS A;  1GNU A;  4GDL B;  2MBH A;  2KQ7 A;  3B1L X;  5E6N A;  2FCS A;  3UF8 A;  1WXA A;  4XX5 A;  1ZKH A;  2KDI A;  1LQB A;  1YX5 B;  2G45 B;  2MP2 B;  2K8H A;  4WJO A;  3QJZ A;  3UIO B;  4HLE A;  4FHJ A;  3RT3 B;  3H6N A;  4F7Z A;  2XK5 B;  2O2V A;  3PRE A;  4ICU A;  2D2Q A;  2MQJ A;  4PYZ A;  2KAN A;  4KIK B;  2M0X A;  5AZH A;  2NPT B;  4ZRJ A;  2JPH A;  2DX5 B;  2M8S A;  2ZNV C;  3QA8 A;  4K7U A;  1C1Y B;  2KK8 A;  1GC6 A;  4W9G A;  2KC2 A;  4KSL C;  4GXB A;  3RD2 A;  3SDL C;  4W9E A;  1IP9 A;  3L16 A;  2JVC A;  2N9X A;  1SGH A;  4FJY A;  4EEW A;  2M4N A;  1UH6 A;  3LDZ E;  4W9H A;  1V2Y A;  2BYF A;  2M17 A;  4MJS A;  2KVR A;  3HIZ A;  3DBS A;  3PHX B;  1WJ4 A;  4GDL A;  3SD5 A;  3CF6 E;  4HDO A;  1I35 A;  3IHP C;  2WX0 A;  3APD A;  4GU2 A;  3HM6 X;  4AP4 C;  4XC2 A;  2MP2 A;  4W9F A;  4BOS C;  2WDT B;  4M0W B;  3RUI B;  3M62 B;  3PRM B;  4NY0 A;  2KJ6 A;  5G55 A;  1C3T A;  1WGY A;  2R2O A;  3PRP B;  2L05 A;  5IAA C;  2HE7 A;  4LJP B;  4KIK A;  4EZJ A;  2D3G A;  1V81 A;  3PZD A;  3VDZ A;  5L83 A;  2NPT A;  2KNB A;  3KVF B;  2FCN A;  4HCP B;  4LCD E;  1IYF A;  2L0F A;  4FA6 A;  3DBH I;  4EUT A;  3WAP A;  1WZ3 A;  2LVO A;  3A1Q B;  5DPR A;  1XQQ A;  1V6E A;  2AEH A;  1MG8 A;  2IO1 B;  2N4F A;  2GBK A;  2N9P C;  3QQ8 B;  1WM3 A;  2JXX A;  2KDE B;  2REX A;  1X1M A;  3Q3J A;  4HK2 A;  3VUY A;  4EKU A;  3A33 B;  3KYC D;  4JLC A;  4YL8 A;  4XZ4 A;  3N32 A;  2KFJ A;  2CHW A;  3PHW B;  2NVU I;  3IFW B;  4GGQ A;  2J0J A;  2LXA A;  2N7D A;  3A9K B;  5DCN A;  3T9L A;  2KD0 A;  3IVF A;  1P3Q U;  5HKH A;  2RR9 A;  2MWS B;  1E8Z A;  4A3O A;  4B95 A;  4HWI B;  4RM9 A;  4II2 B;  4WAA A;  3AU4 A;  2FCQ A;  4NJ6 A;  4EZL A;  5JH5 C;  1L7Y A;  1PQS A;  1ZW7 A;  4KDL B;  5C1Z A;  3L17 A;  1M94 A;  2IY1 B;  1SE9 A;  2KWV B;  2DZM A;  3A1Q A;  3TIX A;  4GB9 A;  4HVB A;  3X23 A;  2WX1 A;  4FN2 A;  3ZLZ A;  2ZZP B;  5DPW A;  2FAZ A;  4IM3 A;  3QIJ A;  2D11 A;  4MH0 E;  4MSQ B;  2DAJ A;  4MM3 A;  3HK0 A;  3VVW B;  4F1S A;  1HE8 A;  5CHV C;  4WQO B;  4A20 A;  4WWN A;  4HPL B;  3A9K A;  4B9K A;  3AXC A;  4E74 A;  3I3T B;  3QAR A;  2G4D B;  1TTN A;  3EFU A;  4W9L A;  4FJV B;  3WA0 A;  2N1W A;  1V49 A;  3H9D A;  3UIP B;  2KO3 A;  2LJ5 A;  1EF1 A;  2G4S A;  1EO6 A;  2IO0 B;  3ML8 A;  4X57 B;  4IM0 A;  1YX6 B;  2EMS A;  4BKS A;  3QC8 B;  3DPD A;  1G6J A;  4K81 A;  3RZW C;  4TQ1 A;  1UD7 A;  4BKG A;  1WI0 A;  4W9C A;  3U8Z A;  3AI5 A;  3N30 A;  3KH0 A;  4DDG D;  1WM2 A;  4TV3 A;  2BPS A;  3PV1 A;  4JQW C;  1YIW A;  2JT4 B;  3L13 A;  4GDK B;  4I6P A;  2L76 A;  3ZW3 A;  4NAW B;  1VD2 A;  1J19 A;  1RLF A;  4K7S A;  3ZDM C;  4DXA B;  2B3A A;  4W9D A;  3V60 A;  3EC8 A;  2MBO A;  2K8B A;  3V6C B;  2ZPY A;  4W9K A;  1WE7 A;  2BKR B;  4IUM B;  1JRU A;  2LGD A;  1UZX B;  4DWF A;  2LGY A;  2KMA A;  1V5O A;  4FJZ A;  2V4L A;  2JRI B;  4IWO A;  3KUC B;  4EZK A;  5AEK B;  3SHQ A;  4G0N B;  5LLI A;  2J7Q B;  4KZC A;  2KC1 A;  1E8Y A;  2KJR A;  3JVZ X;  4LDT D;  3VH4 B;  2RSU A;  3L54 A;  2MA9 B;  3QK0 A;  4HDQ A;  3VTU A;  2KN5 A;  4IG7 B;  5LXH A;  5EDS A;  3ZNH B;  1KJT A;  3M63 B;  2RGF A;  3APC A;  1V5T A;  1E7U A;  2KTR B;  2XEW A;  1LXD A;  2L8J A;  3ZNZ B;  4MSM B;  3ZVV A;  2CKH B;  3DQV A;  2EKE C;  5DPS A;  2IO2 B;  3WAL A;  1Z2M A;  2LVP A;  3NHE B;  2YLM A;  4GOC A;  2LRW A;  1V9J A;  4DK5 A;  1WR1 A;  1WJ6 A;  2K1F A;  3ML9 A;  3WAN A;  4GDK A;  3OJ3 A;  4JIO U;  2LUE A;  4LJO B;  4NAW A;  2MBQ A;  1WGH A;  2KDB A;  1I42 A;  1FXT B;  2MX2 A;  2BF8 B;  1Q1O A;  5DPT A;  4IWQ A;  5D2M B;  4RMA A;  3OAW A;  2CS4 A;  1L2N A;  2KKC A;  3VTV A;  4P7I A;  2WWZ A;  3KUD B;  1WYW B;  4GN1 A;  4JGH B;  3OJ4 B;  4MGY E;  4IWP A;  1OEY A;  1OQY A;  1WZ0 A;  3DCG A;  2AL3 A;  3VQI A;  4AWJ A;  2NS5 A;  1WMH B;  2O6V B;  2KTR A;  2Z0D B;  2D07 B;  4DBG A;  5J17 A;  5KHQ A;  4MGI E;  1RFA A;  3ONS A;  2XBB C;  3W1S A;  4FBJ B;  2JRH A;  1GUA B;  1H4R A;  4KZ0 A;  1UBI A;  4PS7 A;  2GMI C;  1WF9 A;  1BT0 A;  1P0R A;  1E5W A;  2DAF A;  3DVG Y;  3PGE A;  3ZTD A;  3B0A A;  4BKT A;  3RCZ A;  4EOY A;  4OVV A;  4KDI C;  1T0Y A;  1SIF A;  3MJW A;  3A4S C;  3PRZ A;  5L95 C;  2MSE D;  2LAS A;  3RYT A;  3K9O B;  3H1U A;  4II3 B;  4DHJ D;  2GBN A;  4N9F 4;  3TJP A;  2RD0 A;  2L3Z A;  3HM3 A;  4JL9 A;  2DHZ A;  2AWT A;  3PVL A;  5IA7 A;  2KX3 A;  1K8R B;  2DZK A;  3DVN V;  1WMH A;  3QX1 A;  2O6V A;  3MTN B;  3ECI A;  4OVU A;  2HD5 B;  2IY0 B;  2KZR A;  2GOW A;  3R7Q A;  2R2Q A;  3ZO5 B;  1XT9 B;  2VRR B;  5G2N A;  2DYB A;  2C5L C;  3W1Y A;  1J0G A;  2I1K A;  1EF5 A;  2L00 B;  1LM8 B;  3R3M A;  3OLM D;  4FLH A;  2PE9 A;  5KHO A;  3A9J B;  2GBR A;  3QHT A;  3TCA A;  4NQL B;  2PJH A;  4B6W A;  1RRB A;  2HTH A;  5CHW A;  1WE6 A;  2LXC A;  5CHF A;  3PLU A;  2K8C A;  3JYU A;  3PPA A;  3H7S A;  1E8X A;  3ZUN A;  4M8N A;  2KTF A;  4G50 A;  3VUX A;  4IM2 A;  1R4N I;  1RAX A;  2ASQ A;  2ZCC A;  3DVG X;  5J18 A;  3EEC A;  1WGD A;  1WJN A;  3A4R A;  2IZV B;  3ALB A;  1P1A A;  2NBU A;  3V62 A;  2IO3 B;  3D32 A;  1KLV A;  4KVG B;  4ASW C;  1WXS A;  3BIN A;  3JW0 X;  3UQA A;  4HJK A;  4NQK E;  1P9D U;  4ZRI A;  1LFD A;  3PSE B;  4M8M A;  1YQB A;  3A9J A;  3L10 B;  4HPM B;  2FCM A;  2BYV E;  2LZ6 A;  5GMV A;  2K25 A;  2LRU A;  4K7W A;  4GIV A;  4HXD A;  4NNJ B;  4F8C B;  4FAD A;  2UYZ B;  2CR5 A;  2KWU B;  1S3S G;  1GG3 A;  2KMC A;  4PS8 A;  3ZRF A;  3PS6 A;  3EHV A;  1CMX B;  2KLG A;  2LGX A;  1KM7 A;  3H7P B;  2MBB B;  3ZKJ C;  2PE6 B;  3O65 B;  4EFO A;  3ENE A;  3NOB A;  1WJU A;  2GBM A;  4KSK C;  1KOT A;  4BBN C;  5FR6 A;  2GBJ A;  4G11 A;  2KDF B;  1Q5W B;  2KX0 A;  5D6J B;  3TMP B;  4K1R B;  5JHA A;  1UBQ A;  2AYO B;  2K6D B;  2KJH B;  4AUQ C;  1V86 A;  1WRD B;  2OJR A;  1OEY J;  2KFK A;  3WIM A;  1OTR B;  2MBE A;  2Y5B B;  1AAR A;  2JF5 A;  4DHZ B;  5TR5 A;  3UQB A;  4NJ7 A;  2HJ8 A;  2A5U A;  3R66 C;  4MDK E;  2FUH B;  1OGW A;  3RUL A;  4CYE A;  2BWF A;  2NR2 A;  1TBE A;  3H7P A;  4URK A;  3NZU A;  1NDD A;  2KOX A;  3JSV B;  4BKS D;  3RZF A;  4MEL A;  3SU8 X;  5LXI B;  2NBV B;  2L7R A;  3DDC B;  2N7E A;  3PT2 B;  1NI2 A;  2ZCB A;  2L0T A;  3S2A A;  1GJZ A;  1TZ1 A;  4WJQ A;  5BO4 B;  2C7H A;  2JUO A;  3HHM A;  2AL6 A;  2IBI B;  1IPG A;  4TUU A;  4W9J A;  1D3Z A;  4FHK A;  2RPQ A;  2ZVO A;  1E8W A;  1ISN A;  5JZE B;  2BKF A;  3VFK A;  2Z59 B;  1WX8 A;  1S1Q B;  3B08 A;  3KYD D;  1A5R A;  1YD8 U;  2KXJ A;  1UGM A;  5E6P A;  1Q0W B;  2NBW B;  2K6Q A;  3APF A;  3IG3 A;  1GC7 A;  2N1V A;  4ANV A;  1V80 A;  2N9E B;  2BWE S;  2KHW B;  3DVN U;  3TBL D;  3ZTC A;  4WWP A;  2PEA A;  2J0K A;  2CU1 A;  3JSV A;  2W9N A;  4IW0 A;  2XK5 A;  3KUZ A;  4DHZ E;  1E90 A;  2M1M A;  4WJN A;  4BFR A;  3ZIM A;  4AOF A;  3CMM B;  4I6N B;  2KQS A;  2ZVN A;  2JWZ A;  3PTF C;  4PYU A;  1QZE A;  4W9I A;  4ZYN A;  3UIN B;  3R7R A;  3W1S C;  2K39 A;  2Z0E B;  2A4Z A;  3VTW A;  1WXV A;  3QCA A;  5CX3 A;  1Z5S B;  4MGK E;  2CHX A;  2KWC A;  3M95 A;  3DOW A;  3P2B A;  4CO7 A;  3U30 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...