1OGWA

Synthetic ubiquitin with fluoro-leu at 50 and 67
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
76
structure length
74
Chain Sequence
MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQEDGRTLSDYNIQKESTHLVLRLRGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Synthesis, Structural and Biological Studies of Ubiquitin Mutants Containing (2S, 4S)-5-Fluoroleucine Residues Strategically Placed in the Hydrophobic Core
pubmed doi rcsb
molecule tags Cell cycle
molecule keywords UBIQUITIN
total genus 19
structure length 74
sequence length 76
ec nomenclature
pdb deposition date 2003-05-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00240 ubiquitin Ubiquitin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 1ogwA00
4KSKC 2RPQA 3A33B 3CMMB 3NY5A 2EMTA 3SD5A 2KJ6A 3QQ8B 4ICUA 1YD8U 2KWUB 3RZFA 4RM8A 2HD5B 3R3MA 2FAZA 2MA9B 2JZ3B 3ALBA 2XEWA 2DYMA 2DZKA 3NOBA 4LDTD 2KC1A 3M3JA 2KWVB 2LD9A 2MW5A 4W9KA 2GBMA 1A5RA 3TJPA 1V86A 1WE6A 1SE9A 2G4SA 3V6EB 1S3SG 2PEAA 3TCAA 2R2OA 3HK0A 3VH3B 4EKUA 2KC2A 3B0AA 1RAXA 1NDDA 2G4DB 2REXA 1WGRA 2FCMA 3QK0A 4NAWB 4WQOB 2A5UA 1OEYA 3QC8B 5D94A 2JWZA 3QCAA 3Q3JA 3PRZA 4MELA 4HVBA 1XQQA 2JF5A 3DDCB 2D07B 4YL8A 2K39A 4BVUC 3N32A 1TBEA 1V5OA 3VFKA 3L13A 3ZNGC 4DHJD 1UBQA 2LASA 5DPTA 2KK8A 2ZVNA 4MGZE 3QARA 4KZ0A 1WFYA 3RZWC 3OJ3A 2KMAA 2KDFB 3IVFA 1EUVB 4IM0A 3RD2A 2ZCBA 5AEKB 5AZHA 2OOBB 3ZDTA 3DQVA 2JPHA 3A9KA 5D2MB 2A4ZA 3QWZB 3PTFC 4FLHA 1OGWA 1IYFA 2O6VB 2M0XA 3AI5A 3APCA 1WJNA 4FULA 3APDA 4RMAA 4WWNA 4KIKB 1P9DU 4KVGB 1WJ6A 4BKTA 1I35A 2L00B 4MM3A 3AU4A 3SHQA 5JHAA 2ZPNA 1ISNA 2J0KA 1WX7A 3R66C 1VCBA 4EOYA 4PYUA 3VDZA 4M0WB 2LGDA 1KM7A 1IPGA 2D10A 2LGXA 2MRPA 3A4RA 4EZJA 2N9PC 1ZGUB 1UZXB 4FBJB 2C5LC 3PRPB 5CTRC 3KUCB 2N4FA 2KANA 1E7VA 1WM3A 3MJWA 3SU8X 3V62A 4F8CB 1GJZA 3AXCA 4F1SA 2DYOA 3ZNHB 4J6IA 2FIDA 3V61A 4NQLB 2KX0A 3LDZE 1C3TA 4KZCA 3N3KB 2CHZA 3PGEA 4JGHB 2MP2B 4NAWA 2XBBC 2KXJA 1BT0A 1AARA 1QZEA 4ZRIA 5LLIA 2DZMA 4NQKE 3ZTCA 3L10B 3A9JA 3ZIMA 3P2BA 5DCNA 1GC7A 3BINA 2D11A 2KO3A 3ZVVA 4AOFA 2KKCA 3JVZX 4W9FA 4G0NB 3RUIB 4G50A 3APFA 3PPAA 5J2RA 2Z0EB 3UIPB 3PVLA 1WE7A 1E8YA 4ZDVA 4WJPA 4GGQA 3PHXB 3GOEA 1WJUA 2AL3A 1E7UA 2BWES 1WF9A 4DDGD 2IO3B 4TQ0A 2LRUA 3UQBA 3RT3B 3MTNB 1Y8RC 1OEYJ 2WDTB 3KH0A 2K8CA 2WX1A 3JSVA 5J18A 4FJZA 5E6NA 1JRUA 2NPTA 2FNJB 3WA0A 2KZRA 1XT9B 3UINB 3WAMA 2O2VA 2KFKA 1WZ3A 2KMCA 5GMVA 1P0RA 2KQ7A 3PV1A 4W9EA 1TTNA 3KVFB 4MJSB 2DENB 5CX3A 3UQAA 2WYQA 3L08A 4JQWC 3S2AA 3X0WA 2AWTA 1V6EA 1U4AA 3ECIA 1M94A 3MHSD 4HJKA 4HLEA 2KD0A 2IO0B 2KVRA 1TZ1A 2DX5B 3X23A 3QIJA 1YQBA 3LJ3A 4DK5A 4ICVA 3ONSA 2LXAA 4M8NA 3TMPB 4LDTB 3KUDB 2NBVB 4W9IA 1Q1OA 3Q3FA 5DPWA 3B08A 4GDKA 2L0FA 2N9XA 3CF6E 2LVOA 1WZ0A 2KDBA 2AL6A 3DVGY 2IY0B 3A9JB 4KSLC 4DHZE 3K9OB 3H7SA 5KHQA 1WMHB 2YLMA 2LI5A 4W9CA 2FCSA 1L7YA 2YVCA 2I1KA 3VXWA 3U8ZA 4JLCA 4B95A 2RGFA 1Q0WB 1WX9A 2KLGA 2MSED 4FJYA 1WGHA 4OVVA 2NBWB 3W1YA 4MDKE 4PS8A 1E8ZA 4BKSD 5LXHA 1WMHA 4WJNA 3CSTA 2L7RA 2AYOB 5CHWA 3ZDMC 1E90A 3ZTDA 4PS7A 2MLBA 4LJPB 3HIZA 2L3ZA 2J7QB 4RM9A 2WX0A 3T8MA 5CHVC 1VD2A 4HPLB 4IUMB 2EKEC 4EFOA 3VQIA 4HK2A 2IY1B 1WY8A 2KDEB 1WGGA 3WAPA 4DWFA 3PZDA 2B3AA 4B6WA 4ANXA 4B9KA 2K25A 2K6DB 1R4NI 2LGYA 2MBQA 4E71A 4FHKA 1EO6A 2J0MA 4IM2A 2K8HA 4KDLB 3IHPC 3H7PB 4BOSC 3NS8A 1SGHA 3M62B 1T0YA 1WI0A 2KFJA 2BKFA 4W9GA 2XK5B 2CKHB 3L17A 2NPTB 3VUXA 3AULA 1YX6B 3A1QA 3D32A 1HE8A 2GMIC 4AWJA 4IM3A 5EDSA 2MCNB 2MBHA 2GBKA 2BF8B 1E8WA 1R4MI 4DDID 5L83A 1WH3A 1PQSA 2L76A 2W9NA 4IWOA 2M4NA 5DPRA 2C9WB 1V80A 3KYCD 3QHTA 1Z2MA 3ZUNA 3QAQA 3ZO5B 3NZSA 1V9JA 3A9KB 2L05A 1XD3B 2MP2A 4I6PA 3W1SA 2PE9A 4IWPA 2C60A 4N9F4 3WALA 4A20A 2O2VB 1K8RB 4OVUA 3N30A 4G11A 4K7WA 5KHOA 3TIXA 1UH6A 3O65B 2V1YA 2FUHB 2ZPYA 2LJ5A 3QA8A 2KJHB 2AEHA 3EECA 4WWPA 2FIFA 2CU1A 4KDIC 2WWZA 3EFUA 2KWCA 3A4SC 3QJZA 4GB9A 4TKNA 2NS5A 3M95A 3DBHI 3PRMB 2CS4A 3VTWA 4I6NB 4MJSA 1J8CA 3C0RB 3RULA 2BGFA 1EF1A 5C23A 3T9LA 2I1JA 4AJWA 4HWIB 3U30A 3IFWB 3NZUA 2ZNVC 5E6OA 3UF8A 1WX8A 4PYZA 4A3OA 4AJYB 5G55A 3ZRCA 2HJ8A 2MBBB 4NJ6A 4AUQC 2KQSA 2HTHA 4FN2A 5L95C 3B1LX 3EC8A 1RFAA 3H1UA 4HDQA 2M8SA 5IAAC 1J0GA 2LVPA 2N1WA 4DBGA 1GG3A 5C1ZA 2LWPA 3L0WB 4ANUA 2CHXA 2PPHA 3RYTA 3RCZA 5AZFA 2KTRA 2UWQA 1WXAA 3VVWB 4K81A 3OJ4B 2D3GA 2N7EA 2M17A 1ZKHA 2LRWA 4ZYNA 3GZNI 2MWSB 3KUZA 3PLVA 3PHWB 4II2B 4BKSA 1GNUA 1WRDB 2FCNA 4MEMA 5JH5C 2KX3A 2JY6A 1C1YB 2ZVOA 2CHWA 3KYDD 1UD7A 1WJ4A 1UGMA 2RSUA 3DBRI 1L2NA 2RR9A 5J17A 2IBIB 1KJTA 3ZW3A 2JT4B 2RD0A 1YX5B 4BFRA 4DHZB 2BYEA 1RLFA 2KTFA 3VTUA 3PT2B 2OJRA 1Z5SB 2KNBA 2DZJA 3HHMA 2HE7A 2L0TA 4WJQA 3TBLD 2N7DA 5JHBA 4M8MA 4WAAA 3DVNU 2KJRA 2C7MB 4HDOA 3AU5A 4MGIE 4W9HA 4EZKA 5FR6A 5AZGA 2DAFA 4XZ4A 4FHJA 3H7PA 2BYFA 2NVUI 2V3SA 3NHEB 4A3PA 1UELA 2IO2B 2QHOA 3K9PB 1EF5A 2KDIA 1D3ZA 2KN5A 3M63B 2N9EB 4JIOU 3V60A 2GBRA 3VTVA 3EHVA 4LCDE 3VUWA 2BKRB 4KIKA 1G6JA 4TUUA 3R7RA 2LUEA 2GOWA 4URKA 2MQJA 2JRIB 2G45B 4NJ7A 4CHKA 4NPNA 3WIMA 1E8XA 2BWFA 2IYDB 2LVQA 3HM6X 3PLUA 3W1SC 5CHFA 2JXXA 2ZJDA 4XC2A 4K7UA 2JRHA 5E6PA 4NY0A 4HXDA 2L8JA 2ASQA 2KOXA 4KV2A 1WR1A 2NBUA 3PS6A 4GOCA 2GBJA 2J0JA 2GBNA 4GMVA 1I42A 2K8BA 3H6NA 4FA6A 3HM3A 3DCGA 5D6JB 2O6VA 1NBFC 2V4LA 5G2NA 2DZIA 2MBOA 4F7ZA 1V2YA 2KHWB 1ZW7A 2N1VA 3JYUA 3ZNZB 2C7NB 3DBSA 3L54A 4GDKB 4CYEA 1SIFA 2CR5A 2K6QA 4GXBA 4BBNF 4TV3A 1WGYA 2G3QB 2ZNVB 1IP9A 3QX1A 1WXMA 4P7IA 4II3B 1E5WA 1WGDA 4WJOA 4AP4C 1J19A 2D2QA 2ZCCA 4W9DA 4HPMB 2BPSA 1GUAB 2KLCA 3OAWA 4JL9A 2IZVB 3R7QA 4GDLA 2XK5A 3DPDA 1UBIA 3BY4B 4BKGA 1V81A 1YIWA 1MG8A 4GIVA 2MX2A 3SDLC 3JW0X 1Q5WB 1WM2A 2JUOA 2Y5BB 4GN1A 1YJ1A 1CMXB 2ZEQA 5JZEB 2NCNA 1OTRB 4LJOB 2C7HA 4NNJB 3UIOB 1LQBA 5LXIB 1WYWB 3DVNV 3IBEA 3A1QB 3ML8A 5D7GA 2Z59B 2JVCA 4PS3A 1FXTB 3ZRFA 2PJHA 3H9DA 5BO4B 4EEWA 4G3XB 3TL5A 2PE6B 4BOZB 2DHZA 1NI2A 4IC7B 3WAOA 4K7SA 4BBNC 2JZZA 2MBEA 4IG7B 1WXSA 5HKHA 1WIAA 2EMSA 3L16A 1KOTA 1LXDA 3OLMD 3DVGX 3UGBB 1LFDA 4EZLA 2FCQA 1F9JA 2DAJA 2K1FA 1P1AA 4DXAB 5TR5A 3VH4B 4E3CA 1GC6A 1RRBA 3I3TB 4GSWA 3DOWA 1KLVA 4ANVA 4K1RB 1P98A 4MSQB 3JSVB 4ANWA 1WXVA 1LM8B 2VRRB 2R2QA 2DYBA 4ZRKA 4WWOA 2IO1B 1WR6E 4ASWC 3CSFA 1V49A 4MH0E 3VUYA 3ZNID 4GU2A 2NR2A 2O6VD 5IA7A 4CO7A 4TQ1A 1V5TA 1OQYA 3IG3A 4W9JA 4MGYE 1TGZB 3ML9A 5DPSA 4DHJB 2KFKB 4HCNB 3WANA 3U7DA 2BYVE 3VAWA 2Z0DB 4X57B 2UYZB 4FJVB 4XX5A 1H8CA 2M1MA 4FADA 4IWQA 3ENEA 3V6CB 4GDLB 2ZZPB 4MSMB 4MGKE 1X1MA 4IW0A 3VHTC 3PSEB 4I6LB 4E74A 1S1QB 2LXCA 3PREA 3KW5B 3DBLI 2KTRB 4W9LA 2LZ6A 1H4RA 4HCPB 1P3QU 3ZKJC 4EUTA 4ZRJA 3ZLZA
chains in the Genus database with same CATH superfamily
3CMMB 2M56B 1N63A 1M4VA 3AECB 2XEWA 2DYMA 2DZKA 1HXYD 3M3JA 1FNUA 2MW5A 1TZOA 3AE4B 4WWMA 3RN9C 2VH1A 2G4SA 1ZXIA 2SAKA 2R2OA 3HK0A 3P4PB 4EKUA 2KC2A 1RAXA 1JMLA 2G4DB 3FC4A 1ZP0B 4MACA 1WGRA 3QCAA 3Q3JA 3PRZA 2D07B 4YL8A 2K39A 3AB5A 1XXGA 5IP4D 1GB4A 2KK8A 4MGZE 1YJJA 3BVMA 4KZ0A 3RD2A 3PZ8A 2BTEA 1C76A 2OOBB 2WXQA 3DQVA 3A9KA 5EE3A 2A4ZA 3APCA 1R4NB 4KVGB 1WJ6A 3MP9A 2PKOA 1NVID 3DHHC 3HVDA 1WX7A 1PUTA 3VDZA 4M0WB 2LGDA 1YNTE 2LGXA 2JU6X 3IAM1 4C56C 3A4RA 4MM3B 4EZJA 5CTRC 2N4FA 2KANA 2RDHA 1WM3A 4F8CB 4F1SA 3ZNHB 2N9KA 1N5WA 3V61A 1SJED 3PGEA 4JGHB 2XBBC 1BT0A 5DCNA 3IAS1 1QQRA 2KO3A 3ZVVA 4AOFA 3I9V1 3P4QB 4W9FA 4G0NB 3RUIB 3NVVA 2NTTA 3UIPB 1E8YA 2AL3A 2ONQA 3R2IA 4DDGD 3RT3B 3MTNB 1Y8RC 5E6NA 2FNJB 4C00A 3EA6A 4US9A 4XDCA 2PVOD 2GI9A 2AX5A 1ZDVA 5GMVA 1HTOA 2OJWA 1TTNA 1MHHE 2CJOA 4HJKA 2KD0A 4A9AA 2KVRA 3QIJA 1YQBA 4NJCA 2HTME 2WXPA 3TMPB 1JWAD 3KQ4A 4LDTB 3AE6B 5DPWA 1ZUD2 2L0FA 3CF6E 3N1ZC 2KDBA 1EWCA 2IY0B 3A9JB 4KSLC 5KHQA 4W9CA 1L7YA 3VXWA 4JLCA 1PDXA 5FR3A 2KLGA 2QIEB 5LXHA 1C4PA 2L7RA 1XEEA 4PS7A 2MLBA 1SBBB 3HIZA 4RM9A 4HPLB 4NZLB 3VQIA 2J53A 2OEDA 4OHJA 1R4NI 2LGYA 4IDIA 3UI3A 1EO6A 2J0MA 4ZOHC 2J52A 2PVGC 3IHPC 1SGHA 2CKHB 1IBXB 1I4HA 2JQRB 3VUXA 1AW7A 1HE8A 2GMIC 5EDSA 1MPEA 1WYGA 1L5PA 1R4MI 1WH3A 1PQSA 3ZQ4A 2M4NA 3NG0A 2IDYA 1Z2MA 4IOIE 3W9CB 3A9KB 3W1SA 2ZW0A 4YTPB 1NEKB 1K51A 3BZDB 1GOZA 2VH2A 1UGJA 2R61A 3EECA 4WWPA 2CU1A 3TEXA 1PGAA 2VZKB 3QJZA 2YEPF 3RNFC 2MEKA 4MJSA 3C0RB 1D6EC 1EF1A 4RNAA 3ZJTA 3BK2A 3IFWB 2ZNVC 4J3OD 4PYZA 3DWMA 4A3OA 5G55A 4AUQC 3O13A 3MFGA 3AEGB 3Q14C 3T3NA 2KMMA 2LHDA 2LVPA 2WDQB 1IUEA 4USAA 1GG3A 4L23A 2UWQA 4K81A 2M17A 5HG2A 1GNUA 2FCNA 4MEMA 4HKZE 2JY6A 2RR9A 2Y5CA 5I4DA 2LFIA 1L0VB 3LYYA 2KJRA 4FXCA 2WDRB 3AU5A 4MGIE 4UDUC 5FR6A 5AZGA 2JYEA 2NVUI 4ZRPA 1I4QA 1EF5A 1AN8A 1UWMA 4HJGE 2KDIA 1D3ZA 1P7FA 3FKYA 2BKRB 3ETRA 4KIKA 3BIID 3R7RA 2D3CA 2LUEA 2WLBA 3R2TA 4URKA 2MQJA 3AV8A 4B0EA 4NPNA 1R7SA 3WIMA 2BWFA 2LJIA 2D3BA 4XC2A 5E6PA 2JRHA 1JWBD 4NAMA 4HXDA 4GMVA 3E56A 3H6NA 4FA6A 3DCGA 3P1MA 5G2NA 4F7ZA 2YEPB 2KHWB 2N1VA 3JYUA 3ZNZB 1KTKA 4GDKB 2K6QA 2PLPA 2MH7A 1IP9A 3QX1A 1WXMA 4AP4C 2KLCA 3OAWA 2Q5WD 4HKQA 4GDLA 3DPDA 3BY4B 4BKGA 1N61A 1MG8A 2EELA 2MX2A 3JW0X 2JUOA 3BYTB 2ZEQA 1B9RA 2H89B 3P63A 1LQBA 2QCZA 2WXFA 4KGTA 1OQRA 3ML8A 4A8XC 4OZCA 3ZRFA 5BO4B 2SEBD 1EU3A 2AQ2B 4RF0A 1P7EA 2DHZA 4WURA 1WXSA 1WIAA 3NJTA 2N9LA 1F9JA 2K1FA 1P1AA 4DXAB 1RRBA 1TS2A 1KLVA 4MSQB 2WXNA 3JSVB 4ARIA 1D5XC 4TSSA 2DYBA 2J42A 4WWOA 2BB5A 1WR6E 3PO0A 3CSFA 1AWDA 4MH0E 3GS2A 3Q69A 1KLGD 4MGYE 1TGZB 1MFWA 4HCNB 3U7DA 2BYVE 3T3OA 2Z0DB 2UYZB 1FNVA 5T8IA 3KWVA 2KYWA 3V6CB 4GDLB 2IJ0A 4MGKE 1SF0A 4I6LB 3PREA 2QC8A 2W55A 2RPVA 4LK0M 4IKGA 3MC0B 2WQYB 4HCPB 3ZLZA 1FCLA 3A33B 2GRIA 2EMTA 2K9XA 3SD5A 2MJ3A 1YD8U 1JCKB 2FAZA 2MA9B 3ALBA 4XWTA 3NOBA 4LDTD 2KC1A 4W9KA 1Q10A 3U4EG 1A5RA 2H88B 1FNWA 3FILB 3MJ5A 2W82A 1OFFA 1S3SG 1C9FA 3B0AA 1D5ZC 1FD6A 2REXA 3QK0A 3NVWA 3BVGA 4MELA 4HVBA 3GE8C 1JRPA 3DBLB 1TBEA 4PT5A 1F1HA 4US8A 1UBQA 2LASA 2K3UA 3QARA 2KMAA 2KDFB 4IM0A 1A70A 2ZCBA 5AEKB 5AZHA 4XYCA 5IKCM 1I7HA 2G9HD 3QWZB 1I4GA 1V97A 1T0RC 4KIKB 4BKTA 1I35A 3C19A 1ISNA 2J0KA 1FRRA 1VCBA 1YQ4B 4PYUA 1N60A 1IPGA 4EE2A 3VRBB 4DXFA 2N9PC 1UZXB 2C5LC 2WXMA 3KUCB 3AEEB 1E7VA 2WXRA 3SU8X 3V62A 1GJZA 1N5XA 4HRSA 3AXCA 2DYOA 4M0WA 2FIDA 5FK9C 2AQ1B 3LDZE 4P1CC 1C3TA 2CHZA 2MP2B 1AARA 5C3JB 4ZRIA 4C4VA 3DBHB 4NQKE 2BVCA 1T3QA 4XE0A 3JVZX 1HZ6A 3PPAA 3HRDD 2Z0EB 4ZDVA 2L1AA 1TIFA 4GGQA 4BAXA 1JW9D 1RFKA 3PHXB 3GOEA 1F2RI 1WJUA 1E7UA 2W54A 2LRUA 2PIAA 2WDTB 3JSVA 4FJZA 1NENB 2LGIA 2NPTA 2W3RA 3UINB 3C8YA 2O2VA 2KFKA 3KVFB 4MJSB 4KKJA 2WYQA 3UQAA 3X0WA 2AWTA 3ECIA 1M94A 3MHSD 3TEZA 2IO0B 1TZ1A 2RMMA 1I4RA 2QILA 3P4SB 4DK5A 4ICVA 2LXAA 5IOIA 4GDKA 2N9XA 4DHZE 3K9OB 2JZPA 1WMHB 1VR9A 2YVCA 4B95A 2PW9A 5AUIA 4FJYA 1FFUA 4OVVA 2FE8A 4BKSD 1WMHA 1HZ5A 4WJNA 2AYOB 2X8XX 3ZTDA 1E90A 4LJPB 2WX0A 5CHVC 2EKEC 1WGGA 2JYTA 4B9KA 1C4AA 1D4BA 2CU3A 4FHKA 4IM2A 3I5JC 4N59A 2K8HA 4WIPA 3TEWA 1TKYA 5H8YE 3E9SA 2D3AA 1WI0A 1L0XB 2BKFA 4W9GA 2XK5B 1DOYA 2NPTB 3AULA 3A1QA 5AUKA 2JWUA 5JXVA 3B2GA 1UF0A 5HFYA 5DPRA 4IWOA 3Q6BA 1VJKA 1T6BX 1V80A 2N7JA 2DLBA 3ZJUA 3KLSX 2BS2B 2PE9A 2LHEA 2C60A 3WALA 4ZHOA 4OVUA 5KHOA 4G11A 4K7WA 2DWQA 3TIXA 1UH6A 4L1BA 4M00A 2LJ5A 3QA8A 4H2AA 4ITKA 1YOVB 2NTSA 2WWZA 4GB9A 3A4SC 4TKNA 3ZYYX 1PYWD 2NS5A 4JPSA 4I6NB 1J8CA 2BGFA 2WXLA 4RH6A 2K0PA 5C23A 3UF8A 1WX8A 3ZRCA 2HJ8A 2MBBB 3MC8A 5L95C 5IN7A 3SFEB 3H1UA 4HDQA 3N1XC 5IAAC 1J0GA 1R4MB 4DBGA 2LWPA 3RYTA 2PPHA 1I4XA 2KTRA 3VVWB 2D3GA 2LRWA 4ZYNA 4CO7A 4BKSA 1WRDB 5JH5C 3L4PA 2V9HA 2RSUA 3DBRI 5J17A 4WH4A 2IBIB 1L4DB 2RD0A 5BYRA 2MJEA 1RLFA 3PT2B 1Z5SB 3HHMA 2L0TA 4WJQA 5JHBA 4M8MA 5D3IB 4EZKA 1EU4A 4D2KA 2DAFA 4FHJA 2WDVB 2BYFA 1UELA 3W2DA 3RFZB 5IO9A 2N9EB 4TUUA 1FPYA 2E3TA 2JRIB 4C80A 4CHKA 1E8XA 2WXOA 3HM6X 5MPOA 5CHFA 2ZJDA 2INPE 1QOBA 1ENFA 4NY0A 2IGDA 2KOXA 4KV2A 3PS6A 1I42A 2RDBC 2GBNA 1ZOYB 3W5UB 2O6VA 1NBFC 2V4LA 4RGTA 2MBOA 3L54A 1SIFA 2CR5A 4BBNF 1RYJA 2PMVA 3AE7B 2D5GA 1E5WA 1J19A 2WP9B 4W9DA 4HPMB 2BPSA 3RNGC 1GUAB 5BYQA 1N62A 1XCTL 1VZ7A 1YJ1A 1C4CA 2XNAC 4C4VB 2BS4B 4RGNA 1YMHE 1OTRB 1WWTA 4REZA 1WYWB 3DVNV 1C77A 3U52E 3A1QB 2Y5PA 4PK1A 2KWDA 4PS3A 1JWSD 2UU7A 1RM6C 3BWUD 2PJHA 3H9DA 3NRZA 1YN3A 2DNFA 1MI0A 3Q8CA 3SR6A 1LXDA 4EZLA 2OHFA 4E3CA 4A90A 1P98A 4YT0B 4XWWA 1LM8B 2LUMA 4KGRA 5LNK1 4ZRKA 4AS1A 4JX1C 4ACFA 1V49A 1WSPA 5IA7A 1NYQA 4JWSC 4TQ1A 2INNE 4W9JA 1KFYB 1MHXA 3WANA 4XX5A 3ENEA 4IW0A 4AQ7A 2WHIA 1JWUD 5D3DA 4YWGG 4E74A 1S1QB 3KW5B 3ZXRA 3KWLA 1EM7A 3DBLI 2LZ6A 3AE5B 1P3QU 4KSKC 4WAFA 1ROEA 3QQ8B 2KWUB 3RZFA 5E6JA 2HD5B 3R3MA 5EE9A 3N9YC 4B0MA 1XLPA 2GBMA 1HEZE 3Q2AC 3TJPA 1WE6A 3ABVB 1SE9A 1FO4A 2PEAA 4OZAA 1ET9A 3VH3B 2WXKA 2E6XA 2FCMA 4NAWB 4WQOB 2A5UA 1OEYA 3QC8B 2JWZA 4OW0A 1XQQA 3DDCB 3PZ7A 1V5OA 3ZNGC 4CQNA 2ZVNA 3LXFA 1WFYA 3VR8B 3SEBA 4HPPA 4K3BA 3RI7C 3ZDTA 2IGHA 1FFVA 3P42A 3PTFC 2O6VB 1WJNA 1MVKA 3EGRA 3APDA 3R8BA 4LNNA 1EWYC 2L00B 2K5PA 1K52A 2ZPNA 1K53A 2Z8LA 3R66C 4R3DA 2M19A 1SEBD 2D10A 2MRPA 4LNFA 1F0ZA 4FBJB 1FEHA 4XDDA 1E7PB 1QOFA 4LTUA 2KQ4X 5TSSA 1VZ6A 5G5HA 4J6IA 1ET6A 2KX0A 3CIRB 4N58A 1F77A 3N3KB 4NAWA 2KXJA 1QZEA 2DZMA 1I4PA 3P2BA 3Q3MC 1IBXA 1GC7A 1CJEA 1SJHD 1XCQL 3APFA 5J2RA 4YTMB 3PVLA 2WGSA 1FXIA 3DHGC 3AM9A 2BWES 1WF9A 2AQ3B 4TQ0A 3UQBA 2WXHA 3KH0A 2K8CA 1N6ZA 2M0AA 5J18A 3DWGC 3WA0A 1XT9B 3WAMA 3I63C 1SE2A 1FIQA 1QT9A 2KMCA 3PV1A 1RWSA 2DENB 5CX3A 4ARCA 3OWEB 3S2AA 1V6EA 1U4AA 5GXGB 2FBWB 2DX5B 1CK1A 2MHJA 5C2TB 4ZYSA 3KUDB 4W9IA 3B08A 2INDC 2N0SB 2LVOA 1WZ0A 2AL6A 3H7SA 2YLMA 2LGSA 2FCSA 2I1KA 3FAHA 3BK1A 1WX9A 2MSED 1WGHA 3W1YA 2CJNA 2NBWB 1E8ZA 1XLNA 2DBYA 3ZDMC 3RPFC 3V05A 3SFDB 1VD2A 4IUMB 5G5GA 2IGGA 2KDEB 4DWFA 2B3AA 4XGAB 4KDLB 3Q3OC 3NS8A 3M62B 1T0YA 2KFJA 3L17A 3H8HA 4RGMA 3D32A 4AWJA 4IM3A 2MCNB 2W3SA 2MBHA 2BF8B 4DDID 3AEFB 2L76A 2W9NA 2C9WB 3KYCD 3QHTA 3ZUNA 3ZO5B 1V9JA 4I6PA 1XD3B 4IWPA 4N9F4 2O2VB 3N30A 4TMAB 1ZPSA 3O65B 2KT7A 4S0RA 2FUHB 2JX5A 5BMGA 2KJHB 3AEAB 2AEHA 1WRIA 2FIFA 1UUPA 1E10A 1KLUD 2WU5B 3PRMB 3VTWA 2CS4A 1TY0A 3RULA 3T9LA 2J4XA 3U2SC 5E6OA 3OG5A 3BVZA 2BS3B 3B2FA 2KN4A 2KQSA 4ZHPA 3B1LX 3EC8A 1RFAA 1ZXHA 2X38A 1T0SC 4YTNB 3NUHB 5C1ZA 3L0WB 4ANUA 3ZGZA 2CHXA 1C79A 5AZFA 3Q8BA 1WXAA 3OJ4B 3GZNI 2MWSB 3KUZA 3PLVA 3Q8FA 2KX3A 2ZVOA 1C1YB 3KYDD 1UD7A 1SE3A 1WJ4A 1UGMA 3N20C 1L2NA 2HDEA 3MHZA 1KJTA 3Q3NC 3ZW3A 2KTFA 4JWUC 2OJRA 4OVZA 2DZJA 2ON8A 1GAQB 2N7DA 5H92C 2C7MB 3EUB2 4HDOA 4DQOC 4W9HA 3RNBC 5FKAC 4XZ4A 3H7PA 4YSZB 2V3SA 3NHEB 4A3PA 2QHOA 4O1NA 1T5XD 4BZAA 4KGSA 2KN5A 4DXGA 3VTVA 4LCDE 2VZKD 1FCCC 1G6JA 3VR9B 2G45B 3DBRB 2V3NA 1VLBA 1V1PB 1HA5A 2JXXA 4K7UA 1FM0D 2B76B 4M01A 2NBUA 2L32A 3AE1B 2DZIA 4JE3B 4GXBA 1UNSA 1IGCA 1VDVA 2ZNVB 4RCOA 1AYFA 4II3B 2D2QA 1SXTA 4JL9A 3N1YC 1ZE3D 1UBIA 1V81A 1YIWA 1BXTA 1WM2A 2Y5BB 3HUIA 3J9CA 4GN1A 1CMXB 1TKEA 1PGXA 2NCNA 4LJOB 2C7HA 3UIOB 1UWXA 2Z59B 2JVCA 4RGOS 2KACA 3BYYB 3ZXVA 4EEWA 2WXGA 1NI2A 4IC7B 2ZW1A 4BBNC 4K7SA 1V1OA 2JZZA 2MBEA 5HKHA 2EMSA 3OLMD 1HQRD 3UGBB 1LFDA 2FCQA 2DAJA 2PTLA 5TR5A 3VH4B 1GC6A 3AE3B 3I3TB 4N6EB 4K1RB 1TS5A 3NS1A 5BMIA 4ANWA 1WGKA 1E9MA 1DYQA 1YN5A 1YQ3B 2XN9C 3RNCC 4ASWC 3HVZA 4LNKA 3ZNID 2I38A 3P4RB 1BMLC 4DHJB 1QLBB 2KFKB 1NI3A 4X57B 1H8CA 1TY2A 1GPXA 2ZZPB 1X1MA 3PSEB 2LXCA 2GLSA 2IPKD 3ZKJC 4ZRJA 4LNIA 4MH8A 2RPQA 3NY5A 4C7YA 2KJ6A 4ICUA 1C78A 3W5VB 1PFDA 1Y56A 2QEJC 2QSDA 4RM8A 2JZ3B 1YJIA 2KWVB 2LD9A 3MC9A 1V86A 4YXDB 3V6EB 3TCAA 1L6VA 3NVZA 1NDDA 3CWIA 4A55A 5D94A 2JF5A 4BVUC 3N32A 3VFKA 3L13A 4DHJD 5DPTA 1CZPA 3RZWC 3OJ3A 5EE0A 3IVFA 1EUVB 1JWMD 3AN1A 1DOIA 1CQVA 2JPHA 5D2MB 3I57A 4FLHA 1OGWA 1IYFA 2M0XA 3AI5A 4FULA 4RMAA 4WWNA 1QKZA 4LNOA 1P9DU 4MM3A 3AU4A 3SHQA 5JHAA 1TT5B 2GB1A 3RMKC 1SE4A 4EOYA 2BYTA 1KM7A 2JSVX 1ZGUB 3PRPB 3MJWA 4HROA 4NQLB 1LO5D 4KZCA 2WNMA 2V0GA 1BUIC 5LLIA 3ZTCA 3L10B 3A9JA 3ZIMA 1HTQA 1B1ZA 3BINA 2INCC 2D11A 3TUOA 2KKCA 4OZBA 4G50A 1WE7A 2LMCA 4WJPA 2WU2B 1YN4A 4M02A 2RDGA 2IO3B 3AE2B 5HHDG 2ACZB 1OEYJ 2WX1A 2ICIA 1JRUA 2KZRA 3IXSA 1WZ3A 2Y3AA 4KX6B 1P0RA 2KQ7A 4W9EA 2I2YA 2QJLA 3L08A 4JQWC 1OQQA 4HLEA 3GE3C 3X23A 3LJ3A 3ONSA 4M8NA 4RFBA 2V3PA 2NBVB 1Q1OA 3Q3FA 2KVZA 3DVGY 5EE1A 2LI5A 3U8ZA 1TKGA 1TJEA 2RGFA 1Q0WB 1FMAD 1IGDA 4MDKE 4PS8A 3CSTA 1ZDXA 5CHWA 1NYRA 1XLQA 2J7QB 2L3ZA 3T8MA 1D5MC 4EFOA 2BQQA 4HK2A 2IY1B 1WY8A 3WAPA 3AH7A 3PZDA 1V8CA 3TEYA 4B6WA 1DGJA 4ANXA 2K25A 2K6DB 2MBQA 4E71A 3FILA 3H7PB 4BOSC 3GB1A 1J7AA 1XO3A 3V3XA 4GLSC 1YX6B 2HJ1A 2EKIA 1J7CA 3RNAC 2GBKA 1E8WA 3Q8AA 2LEKA 5L83A 4S17A 3NZ3A 3QAQA 2BW2A 3NZSA 2L05A 2MP2A 2QMTA 2TSSA 4HEA1 4A6QA 4A20A 1K8RB 1V1PA 1L6UA 3GZNB 2V1YA 1MJDA 1STEA 2ZPYA 1L0YB 1SB3C 3GP7A 4KDIC 3EFUA 2KWCA 3M95A 3DBHI 1KH0A 2JXTA 2KDMA 2NMQA 2I1JA 4AJWA 4HWIB 3U30A 3NZUA 2BT6A 4AJYB 1L4ZB 4NJ6A 3AEBB 2HTHA 4FN2A 1XF5L 2M8SA 4WQMA 2N1WA 1KF6B 3RCZA 5HI1A 2BBCA 1SIJA 2WXJA 2N7EA 2L83A 1ZKHA 1FXAA 3DHIC 3PHWB 4II2B 4P6VF 2KAJA 2CHWA 4RF1A 3IT6B 1QF6A 1SSNA 4LLGM 2V4IB 2JT4B 4BFRA 1YX5B 4DHZB 2QDFA 2BYEA 1F52A 4L2YA 1ACCA 3VTUA 4P1BC 2KNBA 2WXIA 2HE7A 3TBLD 1VRAB 3AEDB 4WAAA 3DVNU 1QOGA 1QOAA 3B9JA 4K3CA 4MT5A 1FRDA 3K9PB 2IO2B 1J7BA 4P16A 1JROA 3M63B 4JIOU 3V60A 2GBRA 3EHVA 3VUWA 2GOWA 1T0QC 4NJ7A 3NVYA 2IYDB 2LVQA 5BMHA 3PLUA 4YSYB 3W1SC 4Q2JA 1TS4A 2BB6A 3TSSA 3IT4B 2L8JA 2ASQA 1WR1A 4GOCA 2GBJA 2J0JA 2K8BA 3HM3A 5D6JB 1MG4A 3WCQA 1K50A 1V2YA 1ZW7A 2C7NB 3DBSA 4CYEA 4TV3A 1WGYA 2G3QB 5BYSA 1WXQA 4P7IA 1DOXA 4WJOA 1WGDA 2ZCCA 1JQ4A 1TS3A 2IZVB 3R7QA 2XK5A 4GIVA 3SDLC 1Q5WB 5JZEB 2WS3B 4NNJB 5LXIB 2FUG1 3IBEA 5D7GA 1GB1A 1FXTB 3URYA 3RNEC 4C7ZA 4G3XB 4YSXB 3TL5A 4ZRQA 2PE6B 3VRAB 1XLOA 4BOZB 3ZJVA 4QAYA 3WAOA 2G1EA 4IG7B 3L16A 1KOTA 3DVGX 2MJDA 1E0ZA 3AE9B 4GSWA 1E6EB 3DOWA 4ANVA 3EFCA 1WXVA 2L52A 2R2QA 2VRRB 2K22A 2IO1B 1LGRA 3LB8C 3VUYA 4KKIA 4GU2A 2NR2A 2O6VD 1F2RC 3Q8EA 1V5TA 1OQYA 3IG3A 1QILA 1PGBA 3ML9A 5DPSA 3AMZA 3VAWA 1TYGB 4FJVB 2M1MA 3AE8B 4FADA 1JALA 4IWQA 1ESFA 3U7ZA 1KRHA 4MSMB 1VZ8A 3VHTC 2KTRB 4W9LA 1H4RA 4EUTA
chains in the Genus database with same CATH topology
4KSKC 2RPQA 3A33B 3CMMB 3NY5A 2EMTA 3SD5A 2KJ6A 3QQ8B 4ICUA 1YD8U 2KWUB 3RZFA 4RM8A 2HD5B 3R3MA 2FAZA 2MA9B 2JZ3B 3ALBA 2XEWA 2DYMA 2DZKA 3NOBA 4LDTD 2KC1A 3M3JA 2KWVB 2LD9A 2MW5A 4W9KA 2GBMA 1A5RA 3TJPA 1V86A 1WE6A 1SE9A 2G4SA 3V6EB 1S3SG 2PEAA 3TCAA 2R2OA 3HK0A 3VH3B 4EKUA 2KC2A 3B0AA 1RAXA 1NDDA 2G4DB 2REXA 1WGRA 2FCMA 3QK0A 4NAWB 4WQOB 2A5UA 1OEYA 3QC8B 5D94A 2JWZA 3QCAA 3Q3JA 3PRZA 4MELA 4HVBA 1XQQA 2JF5A 3DDCB 2D07B 4YL8A 2K39A 4BVUC 3N32A 1TBEA 1V5OA 3VFKA 3L13A 3ZNGC 4DHJD 1UBQA 2LASA 5DPTA 2KK8A 2ZVNA 4MGZE 3QARA 4KZ0A 1WFYA 3RZWC 3OJ3A 2KMAA 2KDFB 3IVFA 1EUVB 4IM0A 3RD2A 2ZCBA 5AEKB 5AZHA 2OOBB 3ZDTA 3DQVA 2JPHA 3A9KA 5D2MB 2A4ZA 3QWZB 3PTFC 4FLHA 1OGWA 1IYFA 2O6VB 2M0XA 3AI5A 3APCA 1WJNA 4FULA 3APDA 4RMAA 4WWNA 4KIKB 1P9DU 4KVGB 1WJ6A 4BKTA 1I35A 2L00B 4MM3A 3AU4A 3SHQA 5JHAA 2ZPNA 1ISNA 2J0KA 1WX7A 3R66C 1VCBA 4EOYA 4PYUA 3VDZA 4M0WB 2LGDA 1KM7A 1IPGA 2D10A 2LGXA 2MRPA 3A4RA 4EZJA 2N9PC 1ZGUB 1UZXB 4FBJB 2C5LC 3PRPB 5CTRC 3KUCB 2N4FA 2KANA 1E7VA 1WM3A 3MJWA 3SU8X 3V62A 4F8CB 1GJZA 3AXCA 4F1SA 2DYOA 3ZNHB 4J6IA 2FIDA 3V61A 4NQLB 2KX0A 3LDZE 1C3TA 4KZCA 3N3KB 2CHZA 3PGEA 4JGHB 2MP2B 4NAWA 2XBBC 2KXJA 1BT0A 1AARA 1QZEA 4ZRIA 5LLIA 2DZMA 4NQKE 3ZTCA 3L10B 3A9JA 3ZIMA 3P2BA 5DCNA 1GC7A 3BINA 2D11A 2KO3A 3ZVVA 4AOFA 2KKCA 3JVZX 4W9FA 4G0NB 3RUIB 4G50A 3APFA 3PPAA 5J2RA 2Z0EB 3UIPB 3PVLA 1WE7A 1E8YA 4ZDVA 4WJPA 4GGQA 3PHXB 3GOEA 1WJUA 2AL3A 1E7UA 2BWES 1WF9A 4DDGD 2IO3B 4TQ0A 2LRUA 3UQBA 3RT3B 3MTNB 1Y8RC 1OEYJ 2WDTB 3KH0A 2K8CA 2WX1A 3JSVA 5J18A 4FJZA 5E6NA 1JRUA 2NPTA 2FNJB 3WA0A 2KZRA 1XT9B 3UINB 3WAMA 2O2VA 2KFKA 1WZ3A 2KMCA 5GMVA 1P0RA 2KQ7A 3PV1A 4W9EA 1TTNA 3KVFB 4MJSB 2DENB 5CX3A 3UQAA 2WYQA 3L08A 4JQWC 3S2AA 3X0WA 2AWTA 1V6EA 1U4AA 3ECIA 1M94A 3MHSD 4HJKA 4HLEA 2KD0A 2IO0B 2KVRA 1TZ1A 2DX5B 3X23A 3QIJA 1YQBA 3LJ3A 4DK5A 4ICVA 3ONSA 2LXAA 4M8NA 3TMPB 4LDTB 3KUDB 2NBVB 4W9IA 1Q1OA 3Q3FA 5DPWA 3B08A 4GDKA 2L0FA 2N9XA 3CF6E 2LVOA 1WZ0A 2KDBA 2AL6A 3DVGY 2IY0B 3A9JB 4KSLC 4DHZE 3K9OB 3H7SA 5KHQA 1WMHB 2YLMA 2LI5A 4W9CA 2FCSA 1L7YA 2YVCA 2I1KA 3VXWA 3U8ZA 4JLCA 4B95A 2RGFA 1Q0WB 1WX9A 2KLGA 2MSED 4FJYA 1WGHA 4OVVA 2NBWB 3W1YA 4MDKE 4PS8A 1E8ZA 4BKSD 5LXHA 1WMHA 4WJNA 3CSTA 2L7RA 2AYOB 5CHWA 3ZDMC 1E90A 3ZTDA 4PS7A 2MLBA 4LJPB 3HIZA 2L3ZA 2J7QB 4RM9A 2WX0A 3T8MA 5CHVC 1VD2A 4HPLB 4IUMB 2EKEC 4EFOA 3VQIA 4HK2A 2IY1B 1WY8A 2KDEB 1WGGA 3WAPA 4DWFA 3PZDA 2B3AA 4B6WA 4ANXA 4B9KA 2K25A 2K6DB 1R4NI 2LGYA 2MBQA 4E71A 4FHKA 1EO6A 2J0MA 4IM2A 2K8HA 4KDLB 3IHPC 3H7PB 4BOSC 3NS8A 1SGHA 3M62B 1T0YA 1WI0A 2KFJA 2BKFA 4W9GA 2XK5B 2CKHB 3L17A 2NPTB 3VUXA 3AULA 1YX6B 3A1QA 3D32A 1HE8A 2GMIC 4AWJA 4IM3A 5EDSA 2MCNB 2MBHA 2GBKA 2BF8B 1E8WA 1R4MI 4DDID 5L83A 1WH3A 1PQSA 2L76A 2W9NA 4IWOA 2M4NA 5DPRA 2C9WB 1V80A 3KYCD 3QHTA 1Z2MA 3ZUNA 3QAQA 3ZO5B 3NZSA 1V9JA 3A9KB 2L05A 1XD3B 2MP2A 4I6PA 3W1SA 2PE9A 4IWPA 2C60A 4N9F4 3WALA 4A20A 2O2VB 1K8RB 4OVUA 3N30A 4G11A 4K7WA 5KHOA 3TIXA 1UH6A 3O65B 2V1YA 2FUHB 2ZPYA 2LJ5A 3QA8A 2KJHB 2AEHA 3EECA 4WWPA 2FIFA 2CU1A 4KDIC 2WWZA 3EFUA 2KWCA 3A4SC 3QJZA 4GB9A 4TKNA 2NS5A 3M95A 3DBHI 3PRMB 2CS4A 3VTWA 4I6NB 4MJSA 1J8CA 3C0RB 3RULA 2BGFA 1EF1A 5C23A 3T9LA 2I1JA 4AJWA 4HWIB 3U30A 3IFWB 3NZUA 2ZNVC 5E6OA 3UF8A 1WX8A 4PYZA 4A3OA 4AJYB 5G55A 3ZRCA 2HJ8A 2MBBB 4NJ6A 4AUQC 2KQSA 2HTHA 4FN2A 5L95C 3B1LX 3EC8A 1RFAA 3H1UA 4HDQA 2M8SA 5IAAC 1J0GA 2LVPA 2N1WA 4DBGA 1GG3A 5C1ZA 2LWPA 3L0WB 4ANUA 2CHXA 2PPHA 3RYTA 3RCZA 5AZFA 2KTRA 2UWQA 1WXAA 3VVWB 4K81A 3OJ4B 2D3GA 2N7EA 2M17A 1ZKHA 2LRWA 4ZYNA 3GZNI 2MWSB 3KUZA 3PLVA 3PHWB 4II2B 4BKSA 1GNUA 1WRDB 2FCNA 4MEMA 5JH5C 2KX3A 2JY6A 1C1YB 2ZVOA 2CHWA 3KYDD 1UD7A 1WJ4A 1UGMA 2RSUA 3DBRI 1L2NA 2RR9A 5J17A 2IBIB 1KJTA 3ZW3A 2JT4B 2RD0A 1YX5B 4BFRA 4DHZB 2BYEA 1RLFA 2KTFA 3VTUA 3PT2B 2OJRA 1Z5SB 2KNBA 2DZJA 3HHMA 2HE7A 2L0TA 4WJQA 3TBLD 2N7DA 5JHBA 4M8MA 4WAAA 3DVNU 2KJRA 2C7MB 4HDOA 3AU5A 4MGIE 4W9HA 4EZKA 5FR6A 5AZGA 2DAFA 4XZ4A 4FHJA 3H7PA 2BYFA 2NVUI 2V3SA 3NHEB 4A3PA 1UELA 2IO2B 2QHOA 3K9PB 1EF5A 2KDIA 1D3ZA 2KN5A 3M63B 2N9EB 4JIOU 3V60A 2GBRA 3VTVA 3EHVA 4LCDE 3VUWA 2BKRB 4KIKA 1G6JA 4TUUA 3R7RA 2LUEA 2GOWA 4URKA 2MQJA 2JRIB 2G45B 4NJ7A 4CHKA 4NPNA 3WIMA 1E8XA 2BWFA 2IYDB 2LVQA 3HM6X 3PLUA 3W1SC 5CHFA 2JXXA 2ZJDA 4XC2A 4K7UA 2JRHA 5E6PA 4NY0A 4HXDA 2L8JA 2ASQA 2KOXA 4KV2A 1WR1A 2NBUA 3PS6A 4GOCA 2GBJA 2J0JA 2GBNA 4GMVA 1I42A 2K8BA 3H6NA 4FA6A 3HM3A 3DCGA 5D6JB 2O6VA 1NBFC 2V4LA 5G2NA 2DZIA 2MBOA 4F7ZA 1V2YA 2KHWB 1ZW7A 2N1VA 3JYUA 3ZNZB 2C7NB 3DBSA 3L54A 4GDKB 4CYEA 1SIFA 2CR5A 2K6QA 4GXBA 4BBNF 4TV3A 1WGYA 2G3QB 2ZNVB 1IP9A 3QX1A 1WXMA 4P7IA 4II3B 1E5WA 1WGDA 4WJOA 4AP4C 1J19A 2D2QA 2ZCCA 4W9DA 4HPMB 2BPSA 1GUAB 2KLCA 3OAWA 4JL9A 2IZVB 3R7QA 4GDLA 2XK5A 3DPDA 1UBIA 3BY4B 4BKGA 1V81A 1YIWA 1MG8A 4GIVA 2MX2A 3SDLC 3JW0X 1Q5WB 1WM2A 2JUOA 2Y5BB 4GN1A 1YJ1A 1CMXB 2ZEQA 5JZEB 2NCNA 1OTRB 4LJOB 2C7HA 4NNJB 3UIOB 1LQBA 5LXIB 1WYWB 3DVNV 3IBEA 3A1QB 3ML8A 5D7GA 2Z59B 2JVCA 4PS3A 1FXTB 3ZRFA 2PJHA 3H9DA 5BO4B 4EEWA 4G3XB 3TL5A 2PE6B 4BOZB 2DHZA 1NI2A 4IC7B 3WAOA 4K7SA 4BBNC 2JZZA 2MBEA 4IG7B 1WXSA 5HKHA 1WIAA 2EMSA 3L16A 1KOTA 1LXDA 3OLMD 3DVGX 3UGBB 1LFDA 4EZLA 2FCQA 1F9JA 2DAJA 2K1FA 1P1AA 4DXAB 5TR5A 3VH4B 4E3CA 1GC6A 1RRBA 3I3TB 4GSWA 3DOWA 1KLVA 4ANVA 4K1RB 1P98A 4MSQB 3JSVB 4ANWA 1WXVA 1LM8B 2VRRB 2R2QA 2DYBA 4ZRKA 4WWOA 2IO1B 1WR6E 4ASWC 3CSFA 1V49A 4MH0E 3VUYA 3ZNID 4GU2A 2NR2A 2O6VD 5IA7A 4CO7A 4TQ1A 1V5TA 1OQYA 3IG3A 4W9JA 4MGYE 1TGZB 3ML9A 5DPSA 4DHJB 2KFKB 4HCNB 3WANA 3U7DA 2BYVE 3VAWA 2Z0DB 4X57B 2UYZB 4FJVB 4XX5A 1H8CA 2M1MA 4FADA 4IWQA 3ENEA 3V6CB 4GDLB 2ZZPB 4MSMB 4MGKE 1X1MA 4IW0A 3VHTC 3PSEB 4I6LB 4E74A 1S1QB 2LXCA 3PREA 3KW5B 3DBLI 2KTRB 4W9LA 2LZ6A 1H4RA 4HCPB 1P3QU 3ZKJC 4EUTA 4ZRJA 3ZLZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4KSK C;  2RPQ A;  3A33 B;  3CMM B;  3NY5 A;  2EMT A;  3SD5 A;  2KJ6 A;  3QQ8 B;  4ICU A;  1YD8 U;  2KWU B;  3RZF A;  4RM8 A;  2HD5 B;  3R3M A;  2FAZ A;  2MA9 B;  2JZ3 B;  3ALB A;  2XEW A;  2DYM A;  2DZK A;  3NOB A;  4LDT D;  2KC1 A;  3M3J A;  2KWV B;  2LD9 A;  2MW5 A;  4W9K A;  2GBM A;  1A5R A;  3TJP A;  1V86 A;  1WE6 A;  1SE9 A;  2G4S A;  3V6E B;  1S3S G;  2PEA A;  3TCA A;  2R2O A;  3HK0 A;  3VH3 B;  4EKU A;  2KC2 A;  3B0A A;  1RAX A;  1NDD A;  2G4D B;  2REX A;  1WGR A;  2FCM A;  3QK0 A;  4NAW B;  4WQO B;  2A5U A;  1OEY A;  3QC8 B;  5D94 A;  2JWZ A;  3QCA A;  3Q3J A;  3PRZ A;  4MEL A;  4HVB A;  1XQQ A;  2JF5 A;  3DDC B;  2D07 B;  4YL8 A;  2K39 A;  4BVU C;  3N32 A;  1TBE A;  1V5O A;  3VFK A;  3L13 A;  3ZNG C;  4DHJ D;  1UBQ A;  2LAS A;  5DPT A;  2KK8 A;  2ZVN A;  4MGZ E;  3QAR A;  4KZ0 A;  1WFY A;  3RZW C;  3OJ3 A;  2KMA A;  2KDF B;  3IVF A;  1EUV B;  4IM0 A;  3RD2 A;  2ZCB A;  5AEK B;  5AZH A;  2OOB B;  3ZDT A;  3DQV A;  2JPH A;  3A9K A;  5D2M B;  2A4Z A;  3QWZ B;  3PTF C;  4FLH A;  1OGW A;  1IYF A;  2O6V B;  2M0X A;  3AI5 A;  3APC A;  1WJN A;  4FUL A;  3APD A;  4RMA A;  4WWN A;  4KIK B;  1P9D U;  4KVG B;  1WJ6 A;  4BKT A;  1I35 A;  2L00 B;  4MM3 A;  3AU4 A;  3SHQ A;  5JHA A;  2ZPN A;  1ISN A;  2J0K A;  1WX7 A;  3R66 C;  1VCB A;  4EOY A;  4PYU A;  3VDZ A;  4M0W B;  2LGD A;  1KM7 A;  1IPG A;  2D10 A;  2LGX A;  2MRP A;  3A4R A;  4EZJ A;  2N9P C;  1ZGU B;  1UZX B;  4FBJ B;  2C5L C;  3PRP B;  5CTR C;  3KUC B;  2N4F A;  2KAN A;  1E7V A;  1WM3 A;  3MJW A;  3SU8 X;  3V62 A;  4F8C B;  1GJZ A;  3AXC A;  4F1S A;  2DYO A;  3ZNH B;  4J6I A;  2FID A;  3V61 A;  4NQL B;  2KX0 A;  3LDZ E;  1C3T A;  4KZC A;  3N3K B;  2CHZ A;  3PGE A;  4JGH B;  2MP2 B;  4NAW A;  2XBB C;  2KXJ A;  1BT0 A;  1AAR A;  1QZE A;  4ZRI A;  5LLI A;  2DZM A;  4NQK E;  3ZTC A;  3L10 B;  3A9J A;  3ZIM A;  3P2B A;  5DCN A;  1GC7 A;  3BIN A;  2D11 A;  2KO3 A;  3ZVV A;  4AOF A;  2KKC A;  3JVZ X;  4W9F A;  4G0N B;  3RUI B;  4G50 A;  3APF A;  3PPA A;  5J2R A;  2Z0E B;  3UIP B;  3PVL A;  1WE7 A;  1E8Y A;  4ZDV A;  4WJP A;  4GGQ A;  3PHX B;  3GOE A;  1WJU A;  2AL3 A;  1E7U A;  2BWE S;  1WF9 A;  4DDG D;  2IO3 B;  4TQ0 A;  2LRU A;  3UQB A;  3RT3 B;  3MTN B;  1Y8R C;  1OEY J;  2WDT B;  3KH0 A;  2K8C A;  2WX1 A;  3JSV A;  5J18 A;  4FJZ A;  5E6N A;  1JRU A;  2NPT A;  2FNJ B;  3WA0 A;  2KZR A;  1XT9 B;  3UIN B;  3WAM A;  2O2V A;  2KFK A;  1WZ3 A;  2KMC A;  5GMV A;  1P0R A;  2KQ7 A;  3PV1 A;  4W9E A;  1TTN A;  3KVF B;  4MJS B;  2DEN B;  5CX3 A;  3UQA A;  2WYQ A;  3L08 A;  4JQW C;  3S2A A;  3X0W A;  2AWT A;  1V6E A;  1U4A A;  3ECI A;  1M94 A;  3MHS D;  4HJK A;  4HLE A;  2KD0 A;  2IO0 B;  2KVR A;  1TZ1 A;  2DX5 B;  3X23 A;  3QIJ A;  1YQB A;  3LJ3 A;  4DK5 A;  4ICV A;  3ONS A;  2LXA A;  4M8N A;  3TMP B;  4LDT B;  3KUD B;  2NBV B;  4W9I A;  1Q1O A;  3Q3F A;  5DPW A;  3B08 A;  4GDK A;  2L0F A;  2N9X A;  3CF6 E;  2LVO A;  1WZ0 A;  2KDB A;  2AL6 A;  3DVG Y;  2IY0 B;  3A9J B;  4KSL C;  4DHZ E;  3K9O B;  3H7S A;  5KHQ A;  1WMH B;  2YLM A;  2LI5 A;  4W9C A;  2FCS A;  1L7Y A;  2YVC A;  2I1K A;  3VXW A;  3U8Z A;  4JLC A;  4B95 A;  2RGF A;  1Q0W B;  1WX9 A;  2KLG A;  2MSE D;  4FJY A;  1WGH A;  4OVV A;  2NBW B;  3W1Y A;  4MDK E;  4PS8 A;  1E8Z A;  4BKS D;  5LXH A;  1WMH A;  4WJN A;  3CST A;  2L7R A;  2AYO B;  5CHW A;  3ZDM C;  1E90 A;  3ZTD A;  4PS7 A;  2MLB A;  4LJP B;  3HIZ A;  2L3Z A;  2J7Q B;  4RM9 A;  2WX0 A;  3T8M A;  5CHV C;  1VD2 A;  4HPL B;  4IUM B;  2EKE C;  4EFO A;  3VQI A;  4HK2 A;  2IY1 B;  1WY8 A;  2KDE B;  1WGG A;  3WAP A;  4DWF A;  3PZD A;  2B3A A;  4B6W A;  4ANX A;  4B9K A;  2K25 A;  2K6D B;  1R4N I;  2LGY A;  2MBQ A;  4E71 A;  4FHK A;  1EO6 A;  2J0M A;  4IM2 A;  2K8H A;  4KDL B;  3IHP C;  3H7P B;  4BOS C;  3NS8 A;  1SGH A;  3M62 B;  1T0Y A;  1WI0 A;  2KFJ A;  2BKF A;  4W9G A;  2XK5 B;  2CKH B;  3L17 A;  2NPT B;  3VUX A;  3AUL A;  1YX6 B;  3A1Q A;  3D32 A;  1HE8 A;  2GMI C;  4AWJ A;  4IM3 A;  5EDS A;  2MCN B;  2MBH A;  2GBK A;  2BF8 B;  1E8W A;  1R4M I;  4DDI D;  5L83 A;  1WH3 A;  1PQS A;  2L76 A;  2W9N A;  4IWO A;  2M4N A;  5DPR A;  2C9W B;  1V80 A;  3KYC D;  3QHT A;  1Z2M A;  3ZUN A;  3QAQ A;  3ZO5 B;  3NZS A;  1V9J A;  3A9K B;  2L05 A;  1XD3 B;  2MP2 A;  4I6P A;  3W1S A;  2PE9 A;  4IWP A;  2C60 A;  4N9F 4;  3WAL A;  4A20 A;  2O2V B;  1K8R B;  4OVU A;  3N30 A;  4G11 A;  4K7W A;  5KHO A;  3TIX A;  1UH6 A;  3O65 B;  2V1Y A;  2FUH B;  2ZPY A;  2LJ5 A;  3QA8 A;  2KJH B;  2AEH A;  3EEC A;  4WWP A;  2FIF A;  2CU1 A;  4KDI C;  2WWZ A;  3EFU A;  2KWC A;  3A4S C;  3QJZ A;  4GB9 A;  4TKN A;  2NS5 A;  3M95 A;  3DBH I;  3PRM B;  2CS4 A;  3VTW A;  4I6N B;  4MJS A;  1J8C A;  3C0R B;  3RUL A;  2BGF A;  1EF1 A;  5C23 A;  3T9L A;  2I1J A;  4AJW A;  4HWI B;  3U30 A;  3IFW B;  3NZU A;  2ZNV C;  5E6O A;  3UF8 A;  1WX8 A;  4PYZ A;  4A3O A;  4AJY B;  5G55 A;  3ZRC A;  2HJ8 A;  2MBB B;  4NJ6 A;  4AUQ C;  2KQS A;  2HTH A;  4FN2 A;  5L95 C;  3B1L X;  3EC8 A;  1RFA A;  3H1U A;  4HDQ A;  2M8S A;  5IAA C;  1J0G A;  2LVP A;  2N1W A;  4DBG A;  1GG3 A;  5C1Z A;  2LWP A;  3L0W B;  4ANU A;  2CHX A;  2PPH A;  3RYT A;  3RCZ A;  5AZF A;  2KTR A;  2UWQ A;  1WXA A;  3VVW B;  4K81 A;  3OJ4 B;  2D3G A;  2N7E A;  2M17 A;  1ZKH A;  2LRW A;  4ZYN A;  3GZN I;  2MWS B;  3KUZ A;  3PLV A;  3PHW B;  4II2 B;  4BKS A;  1GNU A;  1WRD B;  2FCN A;  4MEM A;  5JH5 C;  2KX3 A;  2JY6 A;  1C1Y B;  2ZVO A;  2CHW A;  3KYD D;  1UD7 A;  1WJ4 A;  1UGM A;  2RSU A;  3DBR I;  1L2N A;  2RR9 A;  5J17 A;  2IBI B;  1KJT A;  3ZW3 A;  2JT4 B;  2RD0 A;  1YX5 B;  4BFR A;  4DHZ B;  2BYE A;  1RLF A;  2KTF A;  3VTU A;  3PT2 B;  2OJR A;  1Z5S B;  2KNB A;  2DZJ A;  3HHM A;  2HE7 A;  2L0T A;  4WJQ A;  3TBL D;  2N7D A;  5JHB A;  4M8M A;  4WAA A;  3DVN U;  2KJR A;  2C7M B;  4HDO A;  3AU5 A;  4MGI E;  4W9H A;  4EZK A;  5FR6 A;  5AZG A;  2DAF A;  4XZ4 A;  4FHJ A;  3H7P A;  2BYF A;  2NVU I;  2V3S A;  3NHE B;  4A3P A;  1UEL A;  2IO2 B;  2QHO A;  3K9P B;  1EF5 A;  2KDI A;  1D3Z A;  2KN5 A;  3M63 B;  2N9E B;  4JIO U;  3V60 A;  2GBR A;  3VTV A;  3EHV A;  4LCD E;  3VUW A;  2BKR B;  4KIK A;  1G6J A;  4TUU A;  3R7R A;  2LUE A;  2GOW A;  4URK A;  2MQJ A;  2JRI B;  2G45 B;  4NJ7 A;  4CHK A;  4NPN A;  3WIM A;  1E8X A;  2BWF A;  2IYD B;  2LVQ A;  3HM6 X;  3PLU A;  3W1S C;  5CHF A;  2JXX A;  2ZJD A;  4XC2 A;  4K7U A;  2JRH A;  5E6P A;  4NY0 A;  4HXD A;  2L8J A;  2ASQ A;  2KOX A;  4KV2 A;  1WR1 A;  2NBU A;  3PS6 A;  4GOC A;  2GBJ A;  2J0J A;  2GBN A;  4GMV A;  1I42 A;  2K8B A;  3H6N A;  4FA6 A;  3HM3 A;  3DCG A;  5D6J B;  2O6V A;  1NBF C;  2V4L A;  5G2N A;  2DZI A;  2MBO A;  4F7Z A;  1V2Y A;  2KHW B;  1ZW7 A;  2N1V A;  3JYU A;  3ZNZ B;  2C7N B;  3DBS A;  3L54 A;  4GDK B;  4CYE A;  1SIF A;  2CR5 A;  2K6Q A;  4GXB A;  4BBN F;  4TV3 A;  1WGY A;  2G3Q B;  2ZNV B;  1IP9 A;  3QX1 A;  1WXM A;  4P7I A;  4II3 B;  1E5W A;  1WGD A;  4WJO A;  4AP4 C;  1J19 A;  2D2Q A;  2ZCC A;  4W9D A;  4HPM B;  2BPS A;  1GUA B;  2KLC A;  3OAW A;  4JL9 A;  2IZV B;  3R7Q A;  4GDL A;  2XK5 A;  3DPD A;  1UBI A;  3BY4 B;  4BKG A;  1V81 A;  1YIW A;  1MG8 A;  4GIV A;  2MX2 A;  3SDL C;  3JW0 X;  1Q5W B;  1WM2 A;  2JUO A;  2Y5B B;  4GN1 A;  1YJ1 A;  1CMX B;  2ZEQ A;  5JZE B;  2NCN A;  1OTR B;  4LJO B;  2C7H A;  4NNJ B;  3UIO B;  1LQB A;  5LXI B;  1WYW B;  3DVN V;  3IBE A;  3A1Q B;  3ML8 A;  5D7G A;  2Z59 B;  2JVC A;  4PS3 A;  1FXT B;  3ZRF A;  2PJH A;  3H9D A;  5BO4 B;  4EEW A;  4G3X B;  3TL5 A;  2PE6 B;  4BOZ B;  2DHZ A;  1NI2 A;  4IC7 B;  3WAO A;  4K7S A;  4BBN C;  2JZZ A;  2MBE A;  4IG7 B;  1WXS A;  5HKH A;  1WIA A;  2EMS A;  3L16 A;  1KOT A;  1LXD A;  3OLM D;  3DVG X;  3UGB B;  1LFD A;  4EZL A;  2FCQ A;  1F9J A;  2DAJ A;  2K1F A;  1P1A A;  4DXA B;  5TR5 A;  3VH4 B;  4E3C A;  1GC6 A;  1RRB A;  3I3T B;  4GSW A;  3DOW A;  1KLV A;  4ANV A;  4K1R B;  1P98 A;  4MSQ B;  3JSV B;  4ANW A;  1WXV A;  1LM8 B;  2VRR B;  2R2Q A;  2DYB A;  4ZRK A;  4WWO A;  2IO1 B;  1WR6 E;  4ASW C;  3CSF A;  1V49 A;  4MH0 E;  3VUY A;  3ZNI D;  4GU2 A;  2NR2 A;  2O6V D;  5IA7 A;  4CO7 A;  4TQ1 A;  1V5T A;  1OQY A;  3IG3 A;  4W9J A;  4MGY E;  1TGZ B;  3ML9 A;  5DPS A;  4DHJ B;  2KFK B;  4HCN B;  3WAN A;  3U7D A;  2BYV E;  3VAW A;  2Z0D B;  4X57 B;  2UYZ B;  4FJV B;  4XX5 A;  1H8C A;  2M1M A;  4FAD A;  4IWQ A;  3ENE A;  3V6C B;  4GDL B;  2ZZP B;  4MSM B;  4MGK E;  1X1M A;  4IW0 A;  3VHT C;  3PSE B;  4I6L B;  4E74 A;  1S1Q B;  2LXC A;  3PRE A;  3KW5 B;  3DBL I;  2KTR B;  4W9L A;  2LZ6 A;  1H4R A;  4HCP B;  1P3Q U;  3ZKJ C;  4EUT A;  4ZRJ A;  3ZLZ A; 
#chains in the Genus database with same CATH topology
 3CMM B;  2M56 B;  1N63 A;  1M4V A;  3AEC B;  2XEW A;  2DYM A;  2DZK A;  1HXY D;  3M3J A;  1FNU A;  2MW5 A;  1TZO A;  3AE4 B;  4WWM A;  3RN9 C;  2VH1 A;  2G4S A;  1ZXI A;  2SAK A;  2R2O A;  3HK0 A;  3P4P B;  4EKU A;  2KC2 A;  1RAX A;  1JML A;  2G4D B;  3FC4 A;  1ZP0 B;  4MAC A;  1WGR A;  3QCA A;  3Q3J A;  3PRZ A;  2D07 B;  4YL8 A;  2K39 A;  3AB5 A;  1XXG A;  5IP4 D;  1GB4 A;  2KK8 A;  4MGZ E;  1YJJ A;  3BVM A;  4KZ0 A;  3RD2 A;  3PZ8 A;  2BTE A;  1C76 A;  2OOB B;  2WXQ A;  3DQV A;  3A9K A;  5EE3 A;  2A4Z A;  3APC A;  1R4N B;  4KVG B;  1WJ6 A;  3MP9 A;  2PKO A;  1NVI D;  3DHH C;  3HVD A;  1WX7 A;  1PUT A;  3VDZ A;  4M0W B;  2LGD A;  1YNT E;  2LGX A;  2JU6 X;  3IAM 1;  4C56 C;  3A4R A;  4MM3 B;  4EZJ A;  5CTR C;  2N4F A;  2KAN A;  2RDH A;  1WM3 A;  4F8C B;  4F1S A;  3ZNH B;  2N9K A;  1N5W A;  3V61 A;  1SJE D;  3PGE A;  4JGH B;  2XBB C;  1BT0 A;  5DCN A;  3IAS 1;  1QQR A;  2KO3 A;  3ZVV A;  4AOF A;  3I9V 1;  3P4Q B;  4W9F A;  4G0N B;  3RUI B;  3NVV A;  2NTT A;  3UIP B;  1E8Y A;  2AL3 A;  2ONQ A;  3R2I A;  4DDG D;  3RT3 B;  3MTN B;  1Y8R C;  5E6N A;  2FNJ B;  4C00 A;  3EA6 A;  4US9 A;  4XDC A;  2PVO D;  2GI9 A;  2AX5 A;  1ZDV A;  5GMV A;  1HTO A;  2OJW A;  1TTN A;  1MHH E;  2CJO A;  4HJK A;  2KD0 A;  4A9A A;  2KVR A;  3QIJ A;  1YQB A;  4NJC A;  2HTM E;  2WXP A;  3TMP B;  1JWA D;  3KQ4 A;  4LDT B;  3AE6 B;  5DPW A;  1ZUD 2;  2L0F A;  3CF6 E;  3N1Z C;  2KDB A;  1EWC A;  2IY0 B;  3A9J B;  4KSL C;  5KHQ A;  4W9C A;  1L7Y A;  3VXW A;  4JLC A;  1PDX A;  5FR3 A;  2KLG A;  2QIE B;  5LXH A;  1C4P A;  2L7R A;  1XEE A;  4PS7 A;  2MLB A;  1SBB B;  3HIZ A;  4RM9 A;  4HPL B;  4NZL B;  3VQI A;  2J53 A;  2OED A;  4OHJ A;  1R4N I;  2LGY A;  4IDI A;  3UI3 A;  1EO6 A;  2J0M A;  4ZOH C;  2J52 A;  2PVG C;  3IHP C;  1SGH A;  2CKH B;  1IBX B;  1I4H A;  2JQR B;  3VUX A;  1AW7 A;  1HE8 A;  2GMI C;  5EDS A;  1MPE A;  1WYG A;  1L5P A;  1R4M I;  1WH3 A;  1PQS A;  3ZQ4 A;  2M4N A;  3NG0 A;  2IDY A;  1Z2M A;  4IOI E;  3W9C B;  3A9K B;  3W1S A;  2ZW0 A;  4YTP B;  1NEK B;  1K51 A;  3BZD B;  1GOZ A;  2VH2 A;  1UGJ A;  2R61 A;  3EEC A;  4WWP A;  2CU1 A;  3TEX A;  1PGA A;  2VZK B;  3QJZ A;  2YEP F;  3RNF C;  2MEK A;  4MJS A;  3C0R B;  1D6E C;  1EF1 A;  4RNA A;  3ZJT A;  3BK2 A;  3IFW B;  2ZNV C;  4J3O D;  4PYZ A;  3DWM A;  4A3O A;  5G55 A;  4AUQ C;  3O13 A;  3MFG A;  3AEG B;  3Q14 C;  3T3N A;  2KMM A;  2LHD A;  2LVP A;  2WDQ B;  1IUE A;  4USA A;  1GG3 A;  4L23 A;  2UWQ A;  4K81 A;  2M17 A;  5HG2 A;  1GNU A;  2FCN A;  4MEM A;  4HKZ E;  2JY6 A;  2RR9 A;  2Y5C A;  5I4D A;  2LFI A;  1L0V B;  3LYY A;  2KJR A;  4FXC A;  2WDR B;  3AU5 A;  4MGI E;  4UDU C;  5FR6 A;  5AZG A;  2JYE A;  2NVU I;  4ZRP A;  1I4Q A;  1EF5 A;  1AN8 A;  1UWM A;  4HJG E;  2KDI A;  1D3Z A;  1P7F A;  3FKY A;  2BKR B;  3ETR A;  4KIK A;  3BII D;  3R7R A;  2D3C A;  2LUE A;  2WLB A;  3R2T A;  4URK A;  2MQJ A;  3AV8 A;  4B0E A;  4NPN A;  1R7S A;  3WIM A;  2BWF A;  2LJI A;  2D3B A;  4XC2 A;  5E6P A;  2JRH A;  1JWB D;  4NAM A;  4HXD A;  4GMV A;  3E56 A;  3H6N A;  4FA6 A;  3DCG A;  3P1M A;  5G2N A;  4F7Z A;  2YEP B;  2KHW B;  2N1V A;  3JYU A;  3ZNZ B;  1KTK A;  4GDK B;  2K6Q A;  2PLP A;  2MH7 A;  1IP9 A;  3QX1 A;  1WXM A;  4AP4 C;  2KLC A;  3OAW A;  2Q5W D;  4HKQ A;  4GDL A;  3DPD A;  3BY4 B;  4BKG A;  1N61 A;  1MG8 A;  2EEL A;  2MX2 A;  3JW0 X;  2JUO A;  3BYT B;  2ZEQ A;  1B9R A;  2H89 B;  3P63 A;  1LQB A;  2QCZ A;  2WXF A;  4KGT A;  1OQR A;  3ML8 A;  4A8X C;  4OZC A;  3ZRF A;  5BO4 B;  2SEB D;  1EU3 A;  2AQ2 B;  4RF0 A;  1P7E A;  2DHZ A;  4WUR A;  1WXS A;  1WIA A;  3NJT A;  2N9L A;  1F9J A;  2K1F A;  1P1A A;  4DXA B;  1RRB A;  1TS2 A;  1KLV A;  4MSQ B;  2WXN A;  3JSV B;  4ARI A;  1D5X C;  4TSS A;  2DYB A;  2J42 A;  4WWO A;  2BB5 A;  1WR6 E;  3PO0 A;  3CSF A;  1AWD A;  4MH0 E;  3GS2 A;  3Q69 A;  1KLG D;  4MGY E;  1TGZ B;  1MFW A;  4HCN B;  3U7D A;  2BYV E;  3T3O A;  2Z0D B;  2UYZ B;  1FNV A;  5T8I A;  3KWV A;  2KYW A;  3V6C B;  4GDL B;  2IJ0 A;  4MGK E;  1SF0 A;  4I6L B;  3PRE A;  2QC8 A;  2W55 A;  2RPV A;  4LK0 M;  4IKG A;  3MC0 B;  2WQY B;  4HCP B;  3ZLZ A;  1FCL A;  3A33 B;  2GRI A;  2EMT A;  2K9X A;  3SD5 A;  2MJ3 A;  1YD8 U;  1JCK B;  2FAZ A;  2MA9 B;  3ALB A;  4XWT A;  3NOB A;  4LDT D;  2KC1 A;  4W9K A;  1Q10 A;  3U4E G;  1A5R A;  2H88 B;  1FNW A;  3FIL B;  3MJ5 A;  2W82 A;  1OFF A;  1S3S G;  1C9F A;  3B0A A;  1D5Z C;  1FD6 A;  2REX A;  3QK0 A;  3NVW A;  3BVG A;  4MEL A;  4HVB A;  3GE8 C;  1JRP A;  3DBL B;  1TBE A;  4PT5 A;  1F1H A;  4US8 A;  1UBQ A;  2LAS A;  2K3U A;  3QAR A;  2KMA A;  2KDF B;  4IM0 A;  1A70 A;  2ZCB A;  5AEK B;  5AZH A;  4XYC A;  5IKC M;  1I7H A;  2G9H D;  3QWZ B;  1I4G A;  1V97 A;  1T0R C;  4KIK B;  4BKT A;  1I35 A;  3C19 A;  1ISN A;  2J0K A;  1FRR A;  1VCB A;  1YQ4 B;  4PYU A;  1N60 A;  1IPG A;  4EE2 A;  3VRB B;  4DXF A;  2N9P C;  1UZX B;  2C5L C;  2WXM A;  3KUC B;  3AEE B;  1E7V A;  2WXR A;  3SU8 X;  3V62 A;  1GJZ A;  1N5X A;  4HRS A;  3AXC A;  2DYO A;  4M0W A;  2FID A;  5FK9 C;  2AQ1 B;  3LDZ E;  4P1C C;  1C3T A;  2CHZ A;  2MP2 B;  1AAR A;  5C3J B;  4ZRI A;  4C4V A;  3DBH B;  4NQK E;  2BVC A;  1T3Q A;  4XE0 A;  3JVZ X;  1HZ6 A;  3PPA A;  3HRD D;  2Z0E B;  4ZDV A;  2L1A A;  1TIF A;  4GGQ A;  4BAX A;  1JW9 D;  1RFK A;  3PHX B;  3GOE A;  1F2R I;  1WJU A;  1E7U A;  2W54 A;  2LRU A;  2PIA A;  2WDT B;  3JSV A;  4FJZ A;  1NEN B;  2LGI A;  2NPT A;  2W3R A;  3UIN B;  3C8Y A;  2O2V A;  2KFK A;  3KVF B;  4MJS B;  4KKJ A;  2WYQ A;  3UQA A;  3X0W A;  2AWT A;  3ECI A;  1M94 A;  3MHS D;  3TEZ A;  2IO0 B;  1TZ1 A;  2RMM A;  1I4R A;  2QIL A;  3P4S B;  4DK5 A;  4ICV A;  2LXA A;  5IOI A;  4GDK A;  2N9X A;  4DHZ E;  3K9O B;  2JZP A;  1WMH B;  1VR9 A;  2YVC A;  4B95 A;  2PW9 A;  5AUI A;  4FJY A;  1FFU A;  4OVV A;  2FE8 A;  4BKS D;  1WMH A;  1HZ5 A;  4WJN A;  2AYO B;  2X8X X;  3ZTD A;  1E90 A;  4LJP B;  2WX0 A;  5CHV C;  2EKE C;  1WGG A;  2JYT A;  4B9K A;  1C4A A;  1D4B A;  2CU3 A;  4FHK A;  4IM2 A;  3I5J C;  4N59 A;  2K8H A;  4WIP A;  3TEW A;  1TKY A;  5H8Y E;  3E9S A;  2D3A A;  1WI0 A;  1L0X B;  2BKF A;  4W9G A;  2XK5 B;  1DOY A;  2NPT B;  3AUL A;  3A1Q A;  5AUK A;  2JWU A;  5JXV A;  3B2G A;  1UF0 A;  5HFY A;  5DPR A;  4IWO A;  3Q6B A;  1VJK A;  1T6B X;  1V80 A;  2N7J A;  2DLB A;  3ZJU A;  3KLS X;  2BS2 B;  2PE9 A;  2LHE A;  2C60 A;  3WAL A;  4ZHO A;  4OVU A;  5KHO A;  4G11 A;  4K7W A;  2DWQ A;  3TIX A;  1UH6 A;  4L1B A;  4M00 A;  2LJ5 A;  3QA8 A;  4H2A A;  4ITK A;  1YOV B;  2NTS A;  2WWZ A;  4GB9 A;  3A4S C;  4TKN A;  3ZYY X;  1PYW D;  2NS5 A;  4JPS A;  4I6N B;  1J8C A;  2BGF A;  2WXL A;  4RH6 A;  2K0P A;  5C23 A;  3UF8 A;  1WX8 A;  3ZRC A;  2HJ8 A;  2MBB B;  3MC8 A;  5L95 C;  5IN7 A;  3SFE B;  3H1U A;  4HDQ A;  3N1X C;  5IAA C;  1J0G A;  1R4M B;  4DBG A;  2LWP A;  3RYT A;  2PPH A;  1I4X A;  2KTR A;  3VVW B;  2D3G A;  2LRW A;  4ZYN A;  4CO7 A;  4BKS A;  1WRD B;  5JH5 C;  3L4P A;  2V9H A;  2RSU A;  3DBR I;  5J17 A;  4WH4 A;  2IBI B;  1L4D B;  2RD0 A;  5BYR A;  2MJE A;  1RLF A;  3PT2 B;  1Z5S B;  3HHM A;  2L0T A;  4WJQ A;  5JHB A;  4M8M A;  5D3I B;  4EZK A;  1EU4 A;  4D2K A;  2DAF A;  4FHJ A;  2WDV B;  2BYF A;  1UEL A;  3W2D A;  3RFZ B;  5IO9 A;  2N9E B;  4TUU A;  1FPY A;  2E3T A;  2JRI B;  4C80 A;  4CHK A;  1E8X A;  2WXO A;  3HM6 X;  5MPO A;  5CHF A;  2ZJD A;  2INP E;  1QOB A;  1ENF A;  4NY0 A;  2IGD A;  2KOX A;  4KV2 A;  3PS6 A;  1I42 A;  2RDB C;  2GBN A;  1ZOY B;  3W5U B;  2O6V A;  1NBF C;  2V4L A;  4RGT A;  2MBO A;  3L54 A;  1SIF A;  2CR5 A;  4BBN F;  1RYJ A;  2PMV A;  3AE7 B;  2D5G A;  1E5W A;  1J19 A;  2WP9 B;  4W9D A;  4HPM B;  2BPS A;  3RNG C;  1GUA B;  5BYQ A;  1N62 A;  1XCT L;  1VZ7 A;  1YJ1 A;  1C4C A;  2XNA C;  4C4V B;  2BS4 B;  4RGN A;  1YMH E;  1OTR B;  1WWT A;  4REZ A;  1WYW B;  3DVN V;  1C77 A;  3U52 E;  3A1Q B;  2Y5P A;  4PK1 A;  2KWD A;  4PS3 A;  1JWS D;  2UU7 A;  1RM6 C;  3BWU D;  2PJH A;  3H9D A;  3NRZ A;  1YN3 A;  2DNF A;  1MI0 A;  3Q8C A;  3SR6 A;  1LXD A;  4EZL A;  2OHF A;  4E3C A;  4A90 A;  1P98 A;  4YT0 B;  4XWW A;  1LM8 B;  2LUM A;  4KGR A;  5LNK 1;  4ZRK A;  4AS1 A;  4JX1 C;  4ACF A;  1V49 A;  1WSP A;  5IA7 A;  1NYQ A;  4JWS C;  4TQ1 A;  2INN E;  4W9J A;  1KFY B;  1MHX A;  3WAN A;  4XX5 A;  3ENE A;  4IW0 A;  4AQ7 A;  2WHI A;  1JWU D;  5D3D A;  4YWG G;  4E74 A;  1S1Q B;  3KW5 B;  3ZXR A;  3KWL A;  1EM7 A;  3DBL I;  2LZ6 A;  3AE5 B;  1P3Q U;  4KSK C;  4WAF A;  1ROE A;  3QQ8 B;  2KWU B;  3RZF A;  5E6J A;  2HD5 B;  3R3M A;  5EE9 A;  3N9Y C;  4B0M A;  1XLP A;  2GBM A;  1HEZ E;  3Q2A C;  3TJP A;  1WE6 A;  3ABV B;  1SE9 A;  1FO4 A;  2PEA A;  4OZA A;  1ET9 A;  3VH3 B;  2WXK A;  2E6X A;  2FCM A;  4NAW B;  4WQO B;  2A5U A;  1OEY A;  3QC8 B;  2JWZ A;  4OW0 A;  1XQQ A;  3DDC B;  3PZ7 A;  1V5O A;  3ZNG C;  4CQN A;  2ZVN A;  3LXF A;  1WFY A;  3VR8 B;  3SEB A;  4HPP A;  4K3B A;  3RI7 C;  3ZDT A;  2IGH A;  1FFV A;  3P42 A;  3PTF C;  2O6V B;  1WJN A;  1MVK A;  3EGR A;  3APD A;  3R8B A;  4LNN A;  1EWY C;  2L00 B;  2K5P A;  1K52 A;  2ZPN A;  1K53 A;  2Z8L A;  3R66 C;  4R3D A;  2M19 A;  1SEB D;  2D10 A;  2MRP A;  4LNF A;  1F0Z A;  4FBJ B;  1FEH A;  4XDD A;  1E7P B;  1QOF A;  4LTU A;  2KQ4 X;  5TSS A;  1VZ6 A;  5G5H A;  4J6I A;  1ET6 A;  2KX0 A;  3CIR B;  4N58 A;  1F77 A;  3N3K B;  4NAW A;  2KXJ A;  1QZE A;  2DZM A;  1I4P A;  3P2B A;  3Q3M C;  1IBX A;  1GC7 A;  1CJE A;  1SJH D;  1XCQ L;  3APF A;  5J2R A;  4YTM B;  3PVL A;  2WGS A;  1FXI A;  3DHG C;  3AM9 A;  2BWE S;  1WF9 A;  2AQ3 B;  4TQ0 A;  3UQB A;  2WXH A;  3KH0 A;  2K8C A;  1N6Z A;  2M0A A;  5J18 A;  3DWG C;  3WA0 A;  1XT9 B;  3WAM A;  3I63 C;  1SE2 A;  1FIQ A;  1QT9 A;  2KMC A;  3PV1 A;  1RWS A;  2DEN B;  5CX3 A;  4ARC A;  3OWE B;  3S2A A;  1V6E A;  1U4A A;  5GXG B;  2FBW B;  2DX5 B;  1CK1 A;  2MHJ A;  5C2T B;  4ZYS A;  3KUD B;  4W9I A;  3B08 A;  2IND C;  2N0S B;  2LVO A;  1WZ0 A;  2AL6 A;  3H7S A;  2YLM A;  2LGS A;  2FCS A;  2I1K A;  3FAH A;  3BK1 A;  1WX9 A;  2MSE D;  1WGH A;  3W1Y A;  2CJN A;  2NBW B;  1E8Z A;  1XLN A;  2DBY A;  3ZDM C;  3RPF C;  3V05 A;  3SFD B;  1VD2 A;  4IUM B;  5G5G A;  2IGG A;  2KDE B;  4DWF A;  2B3A A;  4XGA B;  4KDL B;  3Q3O C;  3NS8 A;  3M62 B;  1T0Y A;  2KFJ A;  3L17 A;  3H8H A;  4RGM A;  3D32 A;  4AWJ A;  4IM3 A;  2MCN B;  2W3S A;  2MBH A;  2BF8 B;  4DDI D;  3AEF B;  2L76 A;  2W9N A;  2C9W B;  3KYC D;  3QHT A;  3ZUN A;  3ZO5 B;  1V9J A;  4I6P A;  1XD3 B;  4IWP A;  4N9F 4;  2O2V B;  3N30 A;  4TMA B;  1ZPS A;  3O65 B;  2KT7 A;  4S0R A;  2FUH B;  2JX5 A;  5BMG A;  2KJH B;  3AEA B;  2AEH A;  1WRI A;  2FIF A;  1UUP A;  1E10 A;  1KLU D;  2WU5 B;  3PRM B;  3VTW A;  2CS4 A;  1TY0 A;  3RUL A;  3T9L A;  2J4X A;  3U2S C;  5E6O A;  3OG5 A;  3BVZ A;  2BS3 B;  3B2F A;  2KN4 A;  2KQS A;  4ZHP A;  3B1L X;  3EC8 A;  1RFA A;  1ZXH A;  2X38 A;  1T0S C;  4YTN B;  3NUH B;  5C1Z A;  3L0W B;  4ANU A;  3ZGZ A;  2CHX A;  1C79 A;  5AZF A;  3Q8B A;  1WXA A;  3OJ4 B;  3GZN I;  2MWS B;  3KUZ A;  3PLV A;  3Q8F A;  2KX3 A;  2ZVO A;  1C1Y B;  3KYD D;  1UD7 A;  1SE3 A;  1WJ4 A;  1UGM A;  3N20 C;  1L2N A;  2HDE A;  3MHZ A;  1KJT A;  3Q3N C;  3ZW3 A;  2KTF A;  4JWU C;  2OJR A;  4OVZ A;  2DZJ A;  2ON8 A;  1GAQ B;  2N7D A;  5H92 C;  2C7M B;  3EUB 2;  4HDO A;  4DQO C;  4W9H A;  3RNB C;  5FKA C;  4XZ4 A;  3H7P A;  4YSZ B;  2V3S A;  3NHE B;  4A3P A;  2QHO A;  4O1N A;  1T5X D;  4BZA A;  4KGS A;  2KN5 A;  4DXG A;  3VTV A;  4LCD E;  2VZK D;  1FCC C;  1G6J A;  3VR9 B;  2G45 B;  3DBR B;  2V3N A;  1VLB A;  1V1P B;  1HA5 A;  2JXX A;  4K7U A;  1FM0 D;  2B76 B;  4M01 A;  2NBU A;  2L32 A;  3AE1 B;  2DZI A;  4JE3 B;  4GXB A;  1UNS A;  1IGC A;  1VDV A;  2ZNV B;  4RCO A;  1AYF A;  4II3 B;  2D2Q A;  1SXT A;  4JL9 A;  3N1Y C;  1ZE3 D;  1UBI A;  1V81 A;  1YIW A;  1BXT A;  1WM2 A;  2Y5B B;  3HUI A;  3J9C A;  4GN1 A;  1CMX B;  1TKE A;  1PGX A;  2NCN A;  4LJO B;  2C7H A;  3UIO B;  1UWX A;  2Z59 B;  2JVC A;  4RGO S;  2KAC A;  3BYY B;  3ZXV A;  4EEW A;  2WXG A;  1NI2 A;  4IC7 B;  2ZW1 A;  4BBN C;  4K7S A;  1V1O A;  2JZZ A;  2MBE A;  5HKH A;  2EMS A;  3OLM D;  1HQR D;  3UGB B;  1LFD A;  2FCQ A;  2DAJ A;  2PTL A;  5TR5 A;  3VH4 B;  1GC6 A;  3AE3 B;  3I3T B;  4N6E B;  4K1R B;  1TS5 A;  3NS1 A;  5BMI A;  4ANW A;  1WGK A;  1E9M A;  1DYQ A;  1YN5 A;  1YQ3 B;  2XN9 C;  3RNC C;  4ASW C;  3HVZ A;  4LNK A;  3ZNI D;  2I38 A;  3P4R B;  1BML C;  4DHJ B;  1QLB B;  2KFK B;  1NI3 A;  4X57 B;  1H8C A;  1TY2 A;  1GPX A;  2ZZP B;  1X1M A;  3PSE B;  2LXC A;  2GLS A;  2IPK D;  3ZKJ C;  4ZRJ A;  4LNI A;  4MH8 A;  2RPQ A;  3NY5 A;  4C7Y A;  2KJ6 A;  4ICU A;  1C78 A;  3W5V B;  1PFD A;  1Y56 A;  2QEJ C;  2QSD A;  4RM8 A;  2JZ3 B;  1YJI A;  2KWV B;  2LD9 A;  3MC9 A;  1V86 A;  4YXD B;  3V6E B;  3TCA A;  1L6V A;  3NVZ A;  1NDD A;  3CWI A;  4A55 A;  5D94 A;  2JF5 A;  4BVU C;  3N32 A;  3VFK A;  3L13 A;  4DHJ D;  5DPT A;  1CZP A;  3RZW C;  3OJ3 A;  5EE0 A;  3IVF A;  1EUV B;  1JWM D;  3AN1 A;  1DOI A;  1CQV A;  2JPH A;  5D2M B;  3I57 A;  4FLH A;  1OGW A;  1IYF A;  2M0X A;  3AI5 A;  4FUL A;  4RMA A;  4WWN A;  1QKZ A;  4LNO A;  1P9D U;  4MM3 A;  3AU4 A;  3SHQ A;  5JHA A;  1TT5 B;  2GB1 A;  3RMK C;  1SE4 A;  4EOY A;  2BYT A;  1KM7 A;  2JSV X;  1ZGU B;  3PRP B;  3MJW A;  4HRO A;  4NQL B;  1LO5 D;  4KZC A;  2WNM A;  2V0G A;  1BUI C;  5LLI A;  3ZTC A;  3L10 B;  3A9J A;  3ZIM A;  1HTQ A;  1B1Z A;  3BIN A;  2INC C;  2D11 A;  3TUO A;  2KKC A;  4OZB A;  4G50 A;  1WE7 A;  2LMC A;  4WJP A;  2WU2 B;  1YN4 A;  4M02 A;  2RDG A;  2IO3 B;  3AE2 B;  5HHD G;  2ACZ B;  1OEY J;  2WX1 A;  2ICI A;  1JRU A;  2KZR A;  3IXS A;  1WZ3 A;  2Y3A A;  4KX6 B;  1P0R A;  2KQ7 A;  4W9E A;  2I2Y A;  2QJL A;  3L08 A;  4JQW C;  1OQQ A;  4HLE A;  3GE3 C;  3X23 A;  3LJ3 A;  3ONS A;  4M8N A;  4RFB A;  2V3P A;  2NBV B;  1Q1O A;  3Q3F A;  2KVZ A;  3DVG Y;  5EE1 A;  2LI5 A;  3U8Z A;  1TKG A;  1TJE A;  2RGF A;  1Q0W B;  1FMA D;  1IGD A;  4MDK E;  4PS8 A;  3CST A;  1ZDX A;  5CHW A;  1NYR A;  1XLQ A;  2J7Q B;  2L3Z A;  3T8M A;  1D5M C;  4EFO A;  2BQQ A;  4HK2 A;  2IY1 B;  1WY8 A;  3WAP A;  3AH7 A;  3PZD A;  1V8C A;  3TEY A;  4B6W A;  1DGJ A;  4ANX A;  2K25 A;  2K6D B;  2MBQ A;  4E71 A;  3FIL A;  3H7P B;  4BOS C;  3GB1 A;  1J7A A;  1XO3 A;  3V3X A;  4GLS C;  1YX6 B;  2HJ1 A;  2EKI A;  1J7C A;  3RNA C;  2GBK A;  1E8W A;  3Q8A A;  2LEK A;  5L83 A;  4S17 A;  3NZ3 A;  3QAQ A;  2BW2 A;  3NZS A;  2L05 A;  2MP2 A;  2QMT A;  2TSS A;  4HEA 1;  4A6Q A;  4A20 A;  1K8R B;  1V1P A;  1L6U A;  3GZN B;  2V1Y A;  1MJD A;  1STE A;  2ZPY A;  1L0Y B;  1SB3 C;  3GP7 A;  4KDI C;  3EFU A;  2KWC A;  3M95 A;  3DBH I;  1KH0 A;  2JXT A;  2KDM A;  2NMQ A;  2I1J A;  4AJW A;  4HWI B;  3U30 A;  3NZU A;  2BT6 A;  4AJY B;  1L4Z B;  4NJ6 A;  3AEB B;  2HTH A;  4FN2 A;  1XF5 L;  2M8S A;  4WQM A;  2N1W A;  1KF6 B;  3RCZ A;  5HI1 A;  2BBC A;  1SIJ A;  2WXJ A;  2N7E A;  2L83 A;  1ZKH A;  1FXA A;  3DHI C;  3PHW B;  4II2 B;  4P6V F;  2KAJ A;  2CHW A;  4RF1 A;  3IT6 B;  1QF6 A;  1SSN A;  4LLG M;  2V4I B;  2JT4 B;  4BFR A;  1YX5 B;  4DHZ B;  2QDF A;  2BYE A;  1F52 A;  4L2Y A;  1ACC A;  3VTU A;  4P1B C;  2KNB A;  2WXI A;  2HE7 A;  3TBL D;  1VRA B;  3AED B;  4WAA A;  3DVN U;  1QOG A;  1QOA A;  3B9J A;  4K3C A;  4MT5 A;  1FRD A;  3K9P B;  2IO2 B;  1J7B A;  4P16 A;  1JRO A;  3M63 B;  4JIO U;  3V60 A;  2GBR A;  3EHV A;  3VUW A;  2GOW A;  1T0Q C;  4NJ7 A;  3NVY A;  2IYD B;  2LVQ A;  5BMH A;  3PLU A;  4YSY B;  3W1S C;  4Q2J A;  1TS4 A;  2BB6 A;  3TSS A;  3IT4 B;  2L8J A;  2ASQ A;  1WR1 A;  4GOC A;  2GBJ A;  2J0J A;  2K8B A;  3HM3 A;  5D6J B;  1MG4 A;  3WCQ A;  1K50 A;  1V2Y A;  1ZW7 A;  2C7N B;  3DBS A;  4CYE A;  4TV3 A;  1WGY A;  2G3Q B;  5BYS A;  1WXQ A;  4P7I A;  1DOX A;  4WJO A;  1WGD A;  2ZCC A;  1JQ4 A;  1TS3 A;  2IZV B;  3R7Q A;  2XK5 A;  4GIV A;  3SDL C;  1Q5W B;  5JZE B;  2WS3 B;  4NNJ B;  5LXI B;  2FUG 1;  3IBE A;  5D7G A;  1GB1 A;  1FXT B;  3URY A;  3RNE C;  4C7Z A;  4G3X B;  4YSX B;  3TL5 A;  4ZRQ A;  2PE6 B;  3VRA B;  1XLO A;  4BOZ B;  3ZJV A;  4QAY A;  3WAO A;  2G1E A;  4IG7 B;  3L16 A;  1KOT A;  3DVG X;  2MJD A;  1E0Z A;  3AE9 B;  4GSW A;  1E6E B;  3DOW A;  4ANV A;  3EFC A;  1WXV A;  2L52 A;  2R2Q A;  2VRR B;  2K22 A;  2IO1 B;  1LGR A;  3LB8 C;  3VUY A;  4KKI A;  4GU2 A;  2NR2 A;  2O6V D;  1F2R C;  3Q8E A;  1V5T A;  1OQY A;  3IG3 A;  1QIL A;  1PGB A;  3ML9 A;  5DPS A;  3AMZ A;  3VAW A;  1TYG B;  4FJV B;  2M1M A;  3AE8 B;  4FAD A;  1JAL A;  4IWQ A;  1ESF A;  3U7Z A;  1KRH A;  4MSM B;  1VZ8 A;  3VHT C;  2KTR B;  4W9L A;  1H4R A;  4EUT A; 
#chains in the Genus database with same CATH homology
 4KSK C;  2RPQ A;  3A33 B;  3CMM B;  3NY5 A;  2EMT A;  3SD5 A;  2KJ6 A;  3QQ8 B;  4ICU A;  1YD8 U;  2KWU B;  3RZF A;  4RM8 A;  2HD5 B;  3R3M A;  2FAZ A;  2MA9 B;  2JZ3 B;  3ALB A;  2XEW A;  2DYM A;  2DZK A;  3NOB A;  4LDT D;  2KC1 A;  3M3J A;  2KWV B;  2LD9 A;  2MW5 A;  4W9K A;  2GBM A;  1A5R A;  3TJP A;  1V86 A;  1WE6 A;  1SE9 A;  2G4S A;  3V6E B;  1S3S G;  2PEA A;  3TCA A;  2R2O A;  3HK0 A;  3VH3 B;  4EKU A;  2KC2 A;  3B0A A;  1RAX A;  1NDD A;  2G4D B;  2REX A;  1WGR A;  2FCM A;  3QK0 A;  4NAW B;  4WQO B;  2A5U A;  1OEY A;  3QC8 B;  5D94 A;  2JWZ A;  3QCA A;  3Q3J A;  3PRZ A;  4MEL A;  4HVB A;  1XQQ A;  2JF5 A;  3DDC B;  2D07 B;  4YL8 A;  2K39 A;  4BVU C;  3N32 A;  1TBE A;  1V5O A;  3VFK A;  3L13 A;  3ZNG C;  4DHJ D;  1UBQ A;  2LAS A;  5DPT A;  2KK8 A;  2ZVN A;  4MGZ E;  3QAR A;  4KZ0 A;  1WFY A;  3RZW C;  3OJ3 A;  2KMA A;  2KDF B;  3IVF A;  1EUV B;  4IM0 A;  3RD2 A;  2ZCB A;  5AEK B;  5AZH A;  2OOB B;  3ZDT A;  3DQV A;  2JPH A;  3A9K A;  5D2M B;  2A4Z A;  3QWZ B;  3PTF C;  4FLH A;  1OGW A;  1IYF A;  2O6V B;  2M0X A;  3AI5 A;  3APC A;  1WJN A;  4FUL A;  3APD A;  4RMA A;  4WWN A;  4KIK B;  1P9D U;  4KVG B;  1WJ6 A;  4BKT A;  1I35 A;  2L00 B;  4MM3 A;  3AU4 A;  3SHQ A;  5JHA A;  2ZPN A;  1ISN A;  2J0K A;  1WX7 A;  3R66 C;  1VCB A;  4EOY A;  4PYU A;  3VDZ A;  4M0W B;  2LGD A;  1KM7 A;  1IPG A;  2D10 A;  2LGX A;  2MRP A;  3A4R A;  4EZJ A;  2N9P C;  1ZGU B;  1UZX B;  4FBJ B;  2C5L C;  3PRP B;  5CTR C;  3KUC B;  2N4F A;  2KAN A;  1E7V A;  1WM3 A;  3MJW A;  3SU8 X;  3V62 A;  4F8C B;  1GJZ A;  3AXC A;  4F1S A;  2DYO A;  3ZNH B;  4J6I A;  2FID A;  3V61 A;  4NQL B;  2KX0 A;  3LDZ E;  1C3T A;  4KZC A;  3N3K B;  2CHZ A;  3PGE A;  4JGH B;  2MP2 B;  4NAW A;  2XBB C;  2KXJ A;  1BT0 A;  1AAR A;  1QZE A;  4ZRI A;  5LLI A;  2DZM A;  4NQK E;  3ZTC A;  3L10 B;  3A9J A;  3ZIM A;  3P2B A;  5DCN A;  1GC7 A;  3BIN A;  2D11 A;  2KO3 A;  3ZVV A;  4AOF A;  2KKC A;  3JVZ X;  4W9F A;  4G0N B;  3RUI B;  4G50 A;  3APF A;  3PPA A;  5J2R A;  2Z0E B;  3UIP B;  3PVL A;  1WE7 A;  1E8Y A;  4ZDV A;  4WJP A;  4GGQ A;  3PHX B;  3GOE A;  1WJU A;  2AL3 A;  1E7U A;  2BWE S;  1WF9 A;  4DDG D;  2IO3 B;  4TQ0 A;  2LRU A;  3UQB A;  3RT3 B;  3MTN B;  1Y8R C;  1OEY J;  2WDT B;  3KH0 A;  2K8C A;  2WX1 A;  3JSV A;  5J18 A;  4FJZ A;  5E6N A;  1JRU A;  2NPT A;  2FNJ B;  3WA0 A;  2KZR A;  1XT9 B;  3UIN B;  3WAM A;  2O2V A;  2KFK A;  1WZ3 A;  2KMC A;  5GMV A;  1P0R A;  2KQ7 A;  3PV1 A;  4W9E A;  1TTN A;  3KVF B;  4MJS B;  2DEN B;  5CX3 A;  3UQA A;  2WYQ A;  3L08 A;  4JQW C;  3S2A A;  3X0W A;  2AWT A;  1V6E A;  1U4A A;  3ECI A;  1M94 A;  3MHS D;  4HJK A;  4HLE A;  2KD0 A;  2IO0 B;  2KVR A;  1TZ1 A;  2DX5 B;  3X23 A;  3QIJ A;  1YQB A;  3LJ3 A;  4DK5 A;  4ICV A;  3ONS A;  2LXA A;  4M8N A;  3TMP B;  4LDT B;  3KUD B;  2NBV B;  4W9I A;  1Q1O A;  3Q3F A;  5DPW A;  3B08 A;  4GDK A;  2L0F A;  2N9X A;  3CF6 E;  2LVO A;  1WZ0 A;  2KDB A;  2AL6 A;  3DVG Y;  2IY0 B;  3A9J B;  4KSL C;  4DHZ E;  3K9O B;  3H7S A;  5KHQ A;  1WMH B;  2YLM A;  2LI5 A;  4W9C A;  2FCS A;  1L7Y A;  2YVC A;  2I1K A;  3VXW A;  3U8Z A;  4JLC A;  4B95 A;  2RGF A;  1Q0W B;  1WX9 A;  2KLG A;  2MSE D;  4FJY A;  1WGH A;  4OVV A;  2NBW B;  3W1Y A;  4MDK E;  4PS8 A;  1E8Z A;  4BKS D;  5LXH A;  1WMH A;  4WJN A;  3CST A;  2L7R A;  2AYO B;  5CHW A;  3ZDM C;  1E90 A;  3ZTD A;  4PS7 A;  2MLB A;  4LJP B;  3HIZ A;  2L3Z A;  2J7Q B;  4RM9 A;  2WX0 A;  3T8M A;  5CHV C;  1VD2 A;  4HPL B;  4IUM B;  2EKE C;  4EFO A;  3VQI A;  4HK2 A;  2IY1 B;  1WY8 A;  2KDE B;  1WGG A;  3WAP A;  4DWF A;  3PZD A;  2B3A A;  4B6W A;  4ANX A;  4B9K A;  2K25 A;  2K6D B;  1R4N I;  2LGY A;  2MBQ A;  4E71 A;  4FHK A;  1EO6 A;  2J0M A;  4IM2 A;  2K8H A;  4KDL B;  3IHP C;  3H7P B;  4BOS C;  3NS8 A;  1SGH A;  3M62 B;  1T0Y A;  1WI0 A;  2KFJ A;  2BKF A;  4W9G A;  2XK5 B;  2CKH B;  3L17 A;  2NPT B;  3VUX A;  3AUL A;  1YX6 B;  3A1Q A;  3D32 A;  1HE8 A;  2GMI C;  4AWJ A;  4IM3 A;  5EDS A;  2MCN B;  2MBH A;  2GBK A;  2BF8 B;  1E8W A;  1R4M I;  4DDI D;  5L83 A;  1WH3 A;  1PQS A;  2L76 A;  2W9N A;  4IWO A;  2M4N A;  5DPR A;  2C9W B;  1V80 A;  3KYC D;  3QHT A;  1Z2M A;  3ZUN A;  3QAQ A;  3ZO5 B;  3NZS A;  1V9J A;  3A9K B;  2L05 A;  1XD3 B;  2MP2 A;  4I6P A;  3W1S A;  2PE9 A;  4IWP A;  2C60 A;  4N9F 4;  3WAL A;  4A20 A;  2O2V B;  1K8R B;  4OVU A;  3N30 A;  4G11 A;  4K7W A;  5KHO A;  3TIX A;  1UH6 A;  3O65 B;  2V1Y A;  2FUH B;  2ZPY A;  2LJ5 A;  3QA8 A;  2KJH B;  2AEH A;  3EEC A;  4WWP A;  2FIF A;  2CU1 A;  4KDI C;  2WWZ A;  3EFU A;  2KWC A;  3A4S C;  3QJZ A;  4GB9 A;  4TKN A;  2NS5 A;  3M95 A;  3DBH I;  3PRM B;  2CS4 A;  3VTW A;  4I6N B;  4MJS A;  1J8C A;  3C0R B;  3RUL A;  2BGF A;  1EF1 A;  5C23 A;  3T9L A;  2I1J A;  4AJW A;  4HWI B;  3U30 A;  3IFW B;  3NZU A;  2ZNV C;  5E6O A;  3UF8 A;  1WX8 A;  4PYZ A;  4A3O A;  4AJY B;  5G55 A;  3ZRC A;  2HJ8 A;  2MBB B;  4NJ6 A;  4AUQ C;  2KQS A;  2HTH A;  4FN2 A;  5L95 C;  3B1L X;  3EC8 A;  1RFA A;  3H1U A;  4HDQ A;  2M8S A;  5IAA C;  1J0G A;  2LVP A;  2N1W A;  4DBG A;  1GG3 A;  5C1Z A;  2LWP A;  3L0W B;  4ANU A;  2CHX A;  2PPH A;  3RYT A;  3RCZ A;  5AZF A;  2KTR A;  2UWQ A;  1WXA A;  3VVW B;  4K81 A;  3OJ4 B;  2D3G A;  2N7E A;  2M17 A;  1ZKH A;  2LRW A;  4ZYN A;  3GZN I;  2MWS B;  3KUZ A;  3PLV A;  3PHW B;  4II2 B;  4BKS A;  1GNU A;  1WRD B;  2FCN A;  4MEM A;  5JH5 C;  2KX3 A;  2JY6 A;  1C1Y B;  2ZVO A;  2CHW A;  3KYD D;  1UD7 A;  1WJ4 A;  1UGM A;  2RSU A;  3DBR I;  1L2N A;  2RR9 A;  5J17 A;  2IBI B;  1KJT A;  3ZW3 A;  2JT4 B;  2RD0 A;  1YX5 B;  4BFR A;  4DHZ B;  2BYE A;  1RLF A;  2KTF A;  3VTU A;  3PT2 B;  2OJR A;  1Z5S B;  2KNB A;  2DZJ A;  3HHM A;  2HE7 A;  2L0T A;  4WJQ A;  3TBL D;  2N7D A;  5JHB A;  4M8M A;  4WAA A;  3DVN U;  2KJR A;  2C7M B;  4HDO A;  3AU5 A;  4MGI E;  4W9H A;  4EZK A;  5FR6 A;  5AZG A;  2DAF A;  4XZ4 A;  4FHJ A;  3H7P A;  2BYF A;  2NVU I;  2V3S A;  3NHE B;  4A3P A;  1UEL A;  2IO2 B;  2QHO A;  3K9P B;  1EF5 A;  2KDI A;  1D3Z A;  2KN5 A;  3M63 B;  2N9E B;  4JIO U;  3V60 A;  2GBR A;  3VTV A;  3EHV A;  4LCD E;  3VUW A;  2BKR B;  4KIK A;  1G6J A;  4TUU A;  3R7R A;  2LUE A;  2GOW A;  4URK A;  2MQJ A;  2JRI B;  2G45 B;  4NJ7 A;  4CHK A;  4NPN A;  3WIM A;  1E8X A;  2BWF A;  2IYD B;  2LVQ A;  3HM6 X;  3PLU A;  3W1S C;  5CHF A;  2JXX A;  2ZJD A;  4XC2 A;  4K7U A;  2JRH A;  5E6P A;  4NY0 A;  4HXD A;  2L8J A;  2ASQ A;  2KOX A;  4KV2 A;  1WR1 A;  2NBU A;  3PS6 A;  4GOC A;  2GBJ A;  2J0J A;  2GBN A;  4GMV A;  1I42 A;  2K8B A;  3H6N A;  4FA6 A;  3HM3 A;  3DCG A;  5D6J B;  2O6V A;  1NBF C;  2V4L A;  5G2N A;  2DZI A;  2MBO A;  4F7Z A;  1V2Y A;  2KHW B;  1ZW7 A;  2N1V A;  3JYU A;  3ZNZ B;  2C7N B;  3DBS A;  3L54 A;  4GDK B;  4CYE A;  1SIF A;  2CR5 A;  2K6Q A;  4GXB A;  4BBN F;  4TV3 A;  1WGY A;  2G3Q B;  2ZNV B;  1IP9 A;  3QX1 A;  1WXM A;  4P7I A;  4II3 B;  1E5W A;  1WGD A;  4WJO A;  4AP4 C;  1J19 A;  2D2Q A;  2ZCC A;  4W9D A;  4HPM B;  2BPS A;  1GUA B;  2KLC A;  3OAW A;  4JL9 A;  2IZV B;  3R7Q A;  4GDL A;  2XK5 A;  3DPD A;  1UBI A;  3BY4 B;  4BKG A;  1V81 A;  1YIW A;  1MG8 A;  4GIV A;  2MX2 A;  3SDL C;  3JW0 X;  1Q5W B;  1WM2 A;  2JUO A;  2Y5B B;  4GN1 A;  1YJ1 A;  1CMX B;  2ZEQ A;  5JZE B;  2NCN A;  1OTR B;  4LJO B;  2C7H A;  4NNJ B;  3UIO B;  1LQB A;  5LXI B;  1WYW B;  3DVN V;  3IBE A;  3A1Q B;  3ML8 A;  5D7G A;  2Z59 B;  2JVC A;  4PS3 A;  1FXT B;  3ZRF A;  2PJH A;  3H9D A;  5BO4 B;  4EEW A;  4G3X B;  3TL5 A;  2PE6 B;  4BOZ B;  2DHZ A;  1NI2 A;  4IC7 B;  3WAO A;  4K7S A;  4BBN C;  2JZZ A;  2MBE A;  4IG7 B;  1WXS A;  5HKH A;  1WIA A;  2EMS A;  3L16 A;  1KOT A;  1LXD A;  3OLM D;  3DVG X;  3UGB B;  1LFD A;  4EZL A;  2FCQ A;  1F9J A;  2DAJ A;  2K1F A;  1P1A A;  4DXA B;  5TR5 A;  3VH4 B;  4E3C A;  1GC6 A;  1RRB A;  3I3T B;  4GSW A;  3DOW A;  1KLV A;  4ANV A;  4K1R B;  1P98 A;  4MSQ B;  3JSV B;  4ANW A;  1WXV A;  1LM8 B;  2VRR B;  2R2Q A;  2DYB A;  4ZRK A;  4WWO A;  2IO1 B;  1WR6 E;  4ASW C;  3CSF A;  1V49 A;  4MH0 E;  3VUY A;  3ZNI D;  4GU2 A;  2NR2 A;  2O6V D;  5IA7 A;  4CO7 A;  4TQ1 A;  1V5T A;  1OQY A;  3IG3 A;  4W9J A;  4MGY E;  1TGZ B;  3ML9 A;  5DPS A;  4DHJ B;  2KFK B;  4HCN B;  3WAN A;  3U7D A;  2BYV E;  3VAW A;  2Z0D B;  4X57 B;  2UYZ B;  4FJV B;  4XX5 A;  1H8C A;  2M1M A;  4FAD A;  4IWQ A;  3ENE A;  3V6C B;  4GDL B;  2ZZP B;  4MSM B;  4MGK E;  1X1M A;  4IW0 A;  3VHT C;  3PSE B;  4I6L B;  4E74 A;  1S1Q B;  2LXC A;  3PRE A;  3KW5 B;  3DBL I;  2KTR B;  4W9L A;  2LZ6 A;  1H4R A;  4HCP B;  1P3Q U;  3ZKJ C;  4EUT A;  4ZRJ A;  3ZLZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...