1OGWA

Synthetic ubiquitin with fluoro-leu at 50 and 67
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
76
structure length
74
Chain Sequence
MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQEDGRTLSDYNIQKESTHLVLRLRGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords UBIQUITIN
publication title Synthesis, Structural and Biological Studies of Ubiquitin Mutants Containing (2S, 4S)-5-Fluoroleucine Residues Strategically Placed in the Hydrophobic Core
pubmed doi rcsb
molecule tags Cell cycle
total genus 19
structure length 74
sequence length 76
ec nomenclature
pdb deposition date 2003-05-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00240 ubiquitin Ubiquitin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 1ogwA00
3DOWA 5JHAA 2KLCA 5J17A 2ZCCA 3WAMA 4FJYA 4WJOA 1SIFA 2KDEB 2LWPA 1T0YA 3AU4A 4AJWA 4PYUA 4MGIE 2J0JA 2BKFA 2BYVE 3N3KB 2JY6A 2DZJA 4DBGA 1TBEA 1WE7A 3AI5A 4EZLA 4FULA 4BOZB 2DHZA 2KKCA 1GC6A 2FIDA 2AYOB 2FAZA 4HPLB 2MRPA 2KD0A 3N30A 5TR5A 4GDKB 2FUHB 2JZ3B 4JLCA 2UWQA 3A1QA 2LVQA 4K7UA 2I1JA 3PHXB 2CU1A 2EMSA 3KH0A 2CS4A 4MJSA 3ZVVA 4I6PA 4ZRKA 2O6VB 2MX2A 1NI2A 4WJNA 2G4DB 1WGHA 4ZYNA 1LFDA 1YX6B 4A3OA 2KO3A 3TL5A 3VTWA 2KWUB 4PS7A 3B08A 3EFUA 2JZZA 3NZSA 5DPRA 2XBBC 3JYUA 4B6WA 3R66C 2DENB 2KTRB 4HDQA 4JL9A 4KDLB 4KSLC 2XK5A 3PT2B 3V62A 2W9NA 3SHQA 1BT0A 1XT9B 3PGEA 4IM3A 2MLBA 3VFKA 1V49A 2JUOA 1WXMA 4BBNC 1V2YA 1G6JA 4RM8A 2C7NB 4ZRJA 3DBHI 2N9PC 3PSEB 1RAXA 4MH0E 1AARA 3TBLD 2LXCA 1UELA 2AEHA 3A9JB 1Q0WB 4DDGD 1YQBA 3HK0A 2KHWB 3X0WA 3KUDB 3KW5B 2LGXA 2MBHA 3MTNB 4W9DA 2N4FA 2BPSA 2V3SA 5FR6A 3CMMB 1S1QB 4NNJB 4NQKE 4GSWA 4W9EA 4PS8A 4W9IA 4X57B 3UQAA 4KZ0A 1H8CA 1C1YB 5J18A 1OQYA 4AWJA 3TCAA 4BVUC 3RYTA 4NQLB 2PE9A 2Z0EB 4JQWC 2V4LA 1WJ6A 1WGGA 1YJ1A 2A5UA 2KK8A 3IBEA 3HHMA 3VHTC 1WI0A 3DBSA 3WANA 3L54A 4MSQB 3C0RB 1Q5WB 4AJYB 1WGYA 2IO1B 5D6JB 5D94A 1I35A 3A1QB 4BKTA 2WX0A 5L95C 2C5LC 4EUTA 1WFYA 4NJ7A 3DVNU 4MJSB 2PPHA 4NPNA 4NJ6A 4BKGA 1GJZA 3IHPC 3SDLC 5LXIB 1J19A 2KQSA 2R2OA 3VXWA 1WYWB 3JSVA 3HM6X 2JXXA 4BFRA 4MSMB 3M95A 3OLMD 4AP4C 3QA8A 1P9DU 2MP2A 3H9DA 4CYEA 3L13A 2KDFB 3PRMB 4WJQA 2DZMA 3H1UA 5J2RA 1QZEA 1FXTB 2KMAA 4WWPA 3ENEA 2C7MB 4M8NA 3R3MA 2XK5B 3PTFC 1MG8A 4G3XB 5GMVA 1IYFA 2L00B 4FN2A 1NBFC 2DAFA 1WR1A 5DPTA 1WR6E 2BWFA 3S2AA 3OJ3A 3VUWA 2G3QB 3QAQA 4IM2A 2Z59B 1KM7A 2I1KA 5KHQA 2L8JA 4MELA 4FA6A 1WZ0A 2DAJA 2PJHA 4YL8A 4RMAA 2DYBA 4GIVA 5C23A 5JZEB 4G11A 4WWNA 3RT3B 1Z5SB 3ZNGC 2LI5A 1WRDB 4EKUA 3EHVA 3JW0X 3ZNID 4IWOA 2M4NA 2LVOA 2JPHA 3PPAA 2CR5A 3GOEA 1E7VA 2GBKA 2NBVB 3RULA 2ASQA 2N9XA 3AU5A 4PYZA 4ANWA 5IAAC 1ZKHA 2KNBA 2KN5A 2NR2A 5EDSA 3OAWA 2KOXA 3I3TB 1V9JA 3DBLI 3KYCD 5C1ZA 4B95A 2KX3A 2REXA 2FIFA 3PHWB 4HCNB 3ZLZA 4K7SA 3D32A 3SD5A 3SU8X 2N1WA 2MQJA 4W9LA 1JRUA 2ZJDA 3QWZB 1PQSA 4MGKE 5E6OA 2CHZA 1V5OA 1E7UA 3HM3A 1CMXB 5CTRC 4IWQA 4AOFA 3LDZE 4HK2A 1EUVB 2HTHA 4GN1A 1EF5A 2KZRA 3U7DA 3TMPB 3H7PA 3GZNI 3KUCB 3MHSD 3NY5A 2MCNB 1WJUA 3L16A 2ZEQA 4I6LB 3K9OB 3PS6A 4IWPA 5CHWA 4ANXA 4MEMA 2JVCA 2IY1B 3QIJA 1P1AA 1IPGA 4FHKA 4FHJA 2KWVB 5AZGA 3ONSA 1E8ZA 1LXDA 2N7DA 2ZNVC 4ANVA 2DYMA 2N1VA 3KYDD 3JSVB 3VAWA 3PLVA 1L7YA 4GXBA 2MP2B 5E6PA 1E5WA 2WX1A 2QHOA 3U8ZA 1ZW7A 1NDDA 2K8BA 3M62B 3VQIA 3VTVA 2CKHB 2K39A 4G50A 2N7EA 3RZWC 4KV2A 1WF9A 2M17A 3QC8B 2R2QA 2IO2B 3H6NA 1L2NA 2ZPYA 1V5TA 1E8YA 1R4NI 1WMHA 3ZTCA 1J0GA 3T9LA 1Y8RC 1M94A 2YVCA 2KMCA 3WAPA 3APCA 2MBEA 2RGFA 2A4ZA 2D11A 3ML9A 1RFAA 1WXAA 4II3B 2HD5B 5LLIA 1LQBA 3QJZA 2D10A 4BBNF 2GBJA 2LVPA 1LM8B 2N9EB 3IG3A 1I42A 3BY4B 4XC2A 2MBOA 4A3PA 1P0RA 3A9KB 2KWCA 1UZXB 2JT4B 3MJWA 1WH3A 3QQ8B 4TQ0A 2MWSB 4HWIB 1OEYA 1WXVA 3H7SA 3W1SC 5HKHA 2ZCBA 4G0NB 1K8RB 2KC1A 4LCDE 3V60A 2D2QA 3TIXA 2BYFA 4KDIC 2JF5A 2FNJB 3PRZA 1IP9A 5CHFA 2KXJA 1OEYJ 2MBQA 1P98A 3NOBA 1WY8A 5DCNA 2LZ6A 2D07B 2RD0A 2KFKA 3RZFA 1HE8A 1UD7A 2KDIA 2GMIC 1KLVA 4K1RB 4HLEA 4II2B 5JH5C 4HJKA 2UYZB 3H7PB 4LDTD 4DHJD 5JHBA 5DPSA 2OOBB 4W9JA 1WGRA 2IY0B 4WQOB 3UIPB 1E8WA 4HVBA 1V86A 2KFJA 2ZNVB 3L0WB 2HJ8A 3APFA 2L76A 4IW0A 2K25A 4KVGB 2L7RA 3K9PB 1UH6A 2XEWA 1GG3A 2OJRA 3RD2A 2FCQA 3EC8A 1RLFA 3ZKJC 2RPQA 4ASWC 1WZ3A 2WYQA 2K8HA 3ZNHB 3VTUA 4GDLA 2KDBA 1ISNA 3O65B 3A4RA 1WMHB 4IM0A 3ZW3A 4HPMB 2KQ7A 1KOTA 2G4SA 3DCGA 5IA7A 5DPWA 4JIOU 4WAAA 3UF8A 4GMVA 3A9KA 3R7QA 4B9KA 3QARA 2IO3B 2LD9A 3N32A 2RR9A 2V1YA 4N9F4 3UGBB 3RUIB 2LRUA 4CHKA 1KJTA 1E90A 1XQQA 4XZ4A 1F9JA 1Z2MA 4LDTB 4MM3A 4DHJB 2IO0B 2HE7A 1VD2A 2GBMA 2K6QA 3QHTA 3VH4B 4EEWA 1E8XA 2KX0A 2IZVB 5AZHA 1UBIA 3DQVA 3NZUA 2FCMA 1WM2A 4IC7B 4NAWA 4AUQC 4MGZE 4ZRIA 2WWZA 2K6DB 2MSED 3ZNZB 2KJ6A 1V6EA 2GOWA 4ANUA 2NS5A 4DXAB 3ZUNA 3BINA 2DZKA 4TUUA 3VUXA 4KIKA 3UINB 2G45B 2BKRB 4DHZE 2IBIB 2AWTA 3ZIMA 4EZJA 2FCSA 2DYOA 4MDKE 2KFKB 3Q3JA 2LGYA 3NS8A 2O2VA 4GB9A 5CHVC 3AULA 4OVVA 4W9KA 4KSKC 2KVRA 3JVZX 5LXHA 4F7ZA 2J0MA 4PS3A 4GOCA 4HCPB 3V61A 4E71A 2ZVOA 3WA0A 2NPTA 1SGHA 4P7IA 2BWES 2JRIB 2NBWB 3VVWB 3PV1A 3CF6E 4ICVA 4FADA 2DZIA 3A4SC 4WWOA 3X23A 4FBJB 4GU2A 2KJRA 4M0WB 2J7QB 3PRPB 5KHOA 1WM3A 2NVUI 1SE9A 2NCNA 4GDLB 5E6NA 3L08A 3U30A 1EF1A 5D2MB 3QX1A 1VCBA 3DDCB 3Q3FA 4LJOB 4TQ1A 2D3GA 4F1SA 1WX7A 1H4RA 1YD8U 2C9WB 2M8SA 2LASA 1A5RA 1Q1OA 3CSFA 2PEAA 2ZPNA 2C60A 1U4AA 2JWZA 3T8MA 2KJHB 2LGDA 2M1MA 2B3AA 1R4MI 1XD3B 4NY0A 1WGDA 2DX5B 2MA9B 2LJ5A 2WDTB 4RM9A 2LRWA 3KVFB 3W1SA 1J8CA 2BF8B 4DWFA 3ZRCA 2MBBB 3APDA 4IUMB 4OVUA 3R7RA 3EECA 3ZO5B 4MGYE 5L83A 2KTFA 4J6IA 1RRBA 2PE6B 1WJ4A 2AL6A 2EMTA 3B0AA 3IFWB 2L0FA 3WALA 2EKEC 2BYEA 3VH3B 2VRRB 4W9CA 4NAWB 1ZGUB 2KANA 2ZVNA 3V6CB 3ZRFA 4ICUA 3WAOA 4HDOA 1TTNA 3W1YA 3KUZA 1P3QU 4KIKB 2FCNA 3VUYA 4BOSC 3HIZA 4CO7A 3ZDTA 2LUEA 2J0KA 4KZCA 1D3ZA 1TGZB 4GDKA 4TKNA 2YLMA 4K7WA 2K1FA 3PLUA 4BKSA 2K8CA 4JGHB 2L05A 2CHWA 2O2VB 3WIMA 1V81A 1OGWA 4FJVB 4GGQA 2RSUA 1V80A 1YIWA 2O6VA 3A33B 4TV3A 2BGFA 3QK0A 5AZFA 4FJZA 4EFOA 3UQBA 5G2NA 2C7HA 1GC7A 2NPTB 2AL3A 1C3TA 4I6NB 4DK5A 3OJ4B 4EOYA 1X1MA 4HXDA 2Y5BB 3DPDA 1TZ1A 5D7GA 3UIOB 2GBNA 3DVNV 1WE6A 2KTRA 3M3JA 3LJ3A 1S3SG 3ZTDA 3V6EB 4ZDVA 3B1LX 3ML8A 3CSTA 4F8CB 2L0TA 3DVGY 4W9FA 3DBRI 2ZZPB 3DVGX 2MW5A 2NBUA 4E74A 2GBRA 5G55A 2LXAA 4XX5A 4IG7B 4BKSD 1GNUA 3PVLA 1WJNA 4W9HA 4DDID 2CHXA 3PREA 4WJPA 5AEKB 1WIAA 4E3CA 2O6VD 3QCAA 5CX3A 3ALBA 3IVFA 3NHEB 2Z0DB 3ECIA 3A9JA 3P2BA 3ZDMC 1YX5B 2JRHA 3TJPA 2IYDB 4A20A 1OTRB 4M8MA 2KC2A 2M0XA 1UGMA 1WX9A 3L17A 4FLHA 3L10B 4W9GA 5BO4B 2KLGA 4K81A 4DHZB 2L3ZA 4EZKA 1WXSA 3M63B 4LJPB 3RCZA 4URKA 3AXCA 1EO6A 1WX8A 3PZDA 3VDZA 1UBQA 1GUAB
chains in the Genus database with same CATH superfamily
5EE9A 5J17A 1SIJA 2OJWA 2AX5A 4WJOA 3U2SC 2LWPA 2BYVE 2DZJA 3AEDB 2D5GA 1L4DB 2KKCA 2FAZA 5TR5A 4GDKB 2FUHB 2JZ3B 4JLCA 1YN3A 2LVQA 4K7UA 3PHXB 2J52A 1OQQA 1KRHA 1HTQA 2MJEA 2MX2A 2G4DB 1LFDA 2VZKB 4A3OA 3C8YA 5C3JB 3B08A 1VDVA 2XBBC 3JYUA 2WS3B 2W9NA 3SHQA 1MI0A 4IM3A 4BZAA 2MLBA 3P4RB 3VFKA 4L2YA 2JUOA 2G1EA 1N63A 2K3UA 2N9PC 1AARA 1JROA 1UELA 2AEHA 3HK0A 3KUDB 3KW5B 4W9DA 1L6UA 3AECB 2CJNA 1E6EB 5IN7A 4HKQA 3ABVB 1C1YB 4A90A 4AWJA 1FIQA 4BVUC 2V4LA 1RM6C 1K50A 1KLGD 2A5UA 2H89B 3VHTC 1E9MA 1WI0A 3WANA 2LEKA 3C0RB 1Q5WB 2JWUA 2IO1B 1I35A 5D94A 5LNK1 4NPNA 2IGDA 1GJZA 1UWMA 3SDLC 5LXIB 4MH8A 2HTME 4WURA 1HXYD 2J4XA 3H9DA 3L13A 2KDFB 1FXTB 4LNOA 4XDDA 2KMMA 3PTFC 3V3XA 1MG8A 4M00A 3VR8B 1IYFA 2N0SB 1EWYC 4RH6A 5IO9A 4IM2A 3R2IA 2Z59B 1TKGA 4MELA 1J7CA 2QC8A 2WXGA 2PJHA 1UNSA 3T3NA 4RMAA 4RNAA 1FO4A 4IKGA 3ZNGC 1WRDB 3EHVA 3ZNID 4IWOA 2MHJA 2JPHA 1GOZA 2NBVB 3VRBB 2N9XA 4PYZA 1I4PA 2JXTA 2NR2A 5EDSA 3DBLI 3LXFA 4B95A 1I4RA 2REXA 4K7SA 3D32A 3SU8X 2MQJA 2ZJDA 2Z8LA 1C9FA 1NENB 5CTRC 2NTSA 4AOFA 4IDIA 1EUVB 1N61A 1EF5A 2KZRA 3IAM1 3U7DA 3KUCB 2W3SA 4I6LB 5CHWA 4HJGE 2N7JA 1M4VA 4MEMA 2JVCA 1QOBA 1N5XA 3AEGB 4FHKA 4AQ7A 3EUB2 5AZGA 3ONSA 4K3CA 2DYMA 2N1VA 3PLVA 1L7YA 3Q6BA 4TMAB 4P6VF 3U8ZA 1NDDA 3M62B 3GZNB 2QDFA 1HEZE 1SEBD 2M17A 1ET6A 4BAXA 1SJED 2MBEA 2A4ZA 3ML9A 3LB8C 1WXAA 4A55A 3QJZA 1PDXA 3FC4A 4P1BC 3IG3A 3A9KB 2KWCA 1UZXB 2JT4B 4LNNA 5EE3A 2QSDA 2BS4B 1QF6A 2WDVB 4JPSA 3W1SC 1K8RB 1VJKA 3AM9A 2JF5A 1IP9A 1OEYJ 2BB5A 4RF0A 4K1RB 2RDBC 3BVZA 2EKIA 1LO5D 5DPSA 1WGRA 2IY0B 3BVGA 3LYYA 1E8WA 3BIID 4HVBA 2ZNVB 4PT5A 2HJ8A 3APFA 2K25A 3BZDB 1PGAA 1UH6A 3RD2A 5D3IB 1I7HA 4C7YA 3VTUA 1RFKA 1ISNA 1SJHD 1P7EA 4IM0A 4N6EB 3V05A 4GMVA 3R7QA 3N32A 2LRUA 4CHKA 1ZDXA 1KJTA 4EEWA 2GBMA 2K6QA 1E8XA 2KX0A 5AZHA 3UI3A 1J7AA 2YEPB 4IC7B 3AE3B 4NAWA 4AUQC 4NJCA 4WAFA 2K6DB 3ZNZB 2WHIA 2KJ6A 1SE2A 2NS5A 2SEBD 2G45B 4DHZE 2VH1A 1QOFA 3Q8FA 4GB9A 4A8XC 4PS3A 2X38A 4HCPB 4OHJA 1SB3C 3Q14C 4LTUA 4ICVA 3CF6E 4JWSC 3A4SC 3PRPB 1WM3A 2I2YA 3W5VB 4KGTA 1R7SA 2CJOA 2NCNA 5D2MB 4USAA 4YSYB 1HA5A 3Q3FA 1L0XB 4TQ1A 3I9V1 1TIFA 1YD8U 1AW7A 1XD3B 2MA9B 2LJ5A 3W1SA 2BF8B 3IT4B 4OVUA 4C7ZA 4EE2A 4ZYSA 5L83A 2KTFA 1D6EC 4J6IA 1EWCA 3VH3B 4NAWB 4RGMA 2QILA 2E3TA 4ICUA 1N6ZA 4OZAA 2FCNA 1V97A 4YTPB 4M02A 1TGZB 4TKNA 4YSXB 4JGHB 4B0EA 1UF0A 4EZJA 4GGQA 4TV3A 1A70A 1TY2A 4WWMA 2BGFA 3QK0A 2K0PA 4EOYA 1ROEA 3M3JA 4ZDVA 3RFZB 1XEEA 3CSTA 1P7FA 2L0TA 2V4IB 2ZZPB 2NBUA 1E0ZA 2WP9B 4E74A 5G55A 1OFFA 2LGIA 3OG5A 1VZ8A 2CHXA 3PREA 3KWLA 2OHFA 1FD6A 3B9JA 2HJ1A 1YX5B 3AV8A 4J3OD 4M8MA 2M0XA 1YJJA 4FLHA 3L10B 3WCQA 1L6VA 1TKEA 4EZKA 1WXSA 4LJPB 1TZOA 3VRAB 3PZDA 4DQOC 1UBQA 5JHAA 2DNFA 1HZ6A 2K22A 2ZCCA 1XF5L 2FBWB 3AU4A 1IGDA 4PYUA 4MGIE 2J0JA 2BKFA 2JY6A 4DBGA 4BOZB 2DHZA 2FIDA 2CS4A 3ZVVA 2WXJA 1NI3A 3MC0B 1WGHA 4ZYNA 3RNCC 3VTWA 2KWUB 3DHGC 4H2AA 2WU5B 4PS7A 1KTKA 4JE3B 5DPRA 4NZLB 1JQ4A 1MG4A 2DENB 3EFCA 1JMLA 2K9XA 2IPKD 5FK9C 3V62A 1XT9B 3PGEA 1WXMA 2RMMA 1C77A 3AE5B 3AB5A 4RM8A 4ZRJA 3DBHI 3MC9A 3PSEB 3TBLD 3TEZA 1Q0WB 1YQBA 2MBHA 2VH2A 2N4FA 2BPSA 2V3SA 5FR6A 3CMMB 4GLSC 1S1QB 4NQKE 4GSWA 4W9EA 4IOIE 1CQVA 5J18A 4YTNB 3SFEB 1OQYA 3GB1A 2KDMA 2Z0EB 4JQWC 3BK2A 3HHMA 3TSSA 4AJYB 1C79A 5FKAC 3NVVA 1WFYA 4NJ7A 2PPHA 4NJ6A 2KACA 3GE8C 1T0RC 1JRPA 2KN4A 1J19A 2R2OA 3Q2AC 1WYWB 3JSVA 3HM6X 3OLMD 1MPEA 4AP4C 2MP2A 3H1UA 2WXIA 3ENEA 2C7MB 1GB1A 3R3MA 1DYQA 4G3XB 5DPTA 2BWFA 3S2AA 3OJ3A 1XLNA 5KHQA 2L8JA 2WXFA 4L23A 2D3CA 1KF6B 2M4NA 1EU3A 4C00A 2GBKA 3RULA 2ASQA 1I4XA 3OAWA 3I3TB 1V9JA 2JYEA 2IJ0A 1VLBA 2KX3A 5I4DA 3P42A 3SD5A 1PFDA 1V5OA 1CMXB 1D5XC 1CZPA 4HK2A 4A9AA 2HTHA 3BYTB 2NMQA 2LJIA 3MHSD 3AE1B 4C4VA 5AUKA 1IPGA 2KWVB 4XWTA 3Q3MC 2LUMA 1LXDA 2N7DA 2ZNVC 1UWXA 3KYDD 3JSVB 1VRAB 5G5HA 2MP2B 1E5WA 2QHOA 1ZW7A 3ZJUA 2JQRB 2K39A 4G50A 2N7EA 3RZWC 4KV2A 2ZPYA 1E8YA 1WMHA 3ZTCA 3NS1A 1M94A 1DOXA 2AQ2B 2D11A 1RFAA 4II3B 2HD5B 3RI7C 1LQBA 2D10A 4BBNF 4XC2A 3KLSX 1WGKA 4A3PA 4OZCA 1R4NB 3MJWA 2ACZB 3TEWA 1WXVA 2PVOD 1C4CA 3H7SA 4N59A 4RFBA 3N20C 4G0NB 4LCDE 2D2QA 1PGBA 3PRZA 1ZXIA 1V1OA 5CHFA 2RD0A 1HE8A 1KLVA 4HLEA 2L1AA 4HJKA 2UYZB 1TS2A 3H8HA 2QJLA 4LDTD 2WXQA 3R2TA 4W9JA 4C4VB 4NAMA 2KFJA 3CIRB 3L0WB 3BWUD 2L76A 2WLBA 4IW0A 1NYQA 4KVGB 3K9PB 4S0RA 1GG3A 1GB4A 1FPYA 2FCQA 4Q2JA 3ZKJC 1WZ3A 3RN9C 1FXIA 3ZNHB 3ZJTA 2KDBA 4HPPA 3B2FA 3IXSA 1N60A 1WMHB 3ZW3A 1KOTA 2G4SA 4JIOU 4WAAA 3UF8A 3A9KA 2RR9A 2V1YA 3NRZA 4HEA1 1PGXA 1XQQA 5TSSA 4XZ4A 3ZXVA 1F9JA 1Z2MA 4LDTB 4MM3A 2IO0B 1VD2A 3QHTA 3VH4B 2IZVB 1UBIA 1CJEA 1BMLC 1EU4A 5HFYA 4MGZE 2WWZA 1SBBB 2MSED 3I5JC 3Q8CA 1V6EA 3N9YC 3ZUNA 3EGRA 2IDYA 2BQQA 2DZKA 3BINA 4KIKA 3UINB 3VUXA 5BYRA 4AS1A 2BKRB 3I63C 1KFYB 1QQRA 4OVVA 3HVDA 2KVRA 2DLBA 2ONQA 1JALA 3V61A 3C19A 2NPTA 3Q69A 2BWES 4P7IA 3PV1A 3IAS1 2DZIA 1VZ7A 3NVYA 5MPOA 3U30A 3L08A 3PZ8A 1YOVB 4LNIA 4B0MA 1N62A 4LJOB 1WX7A 1A5RA 1HQRD 1JWSD 3MJ5A 5EE0A 5BMIA 2B3AA 2LFIA 1WGDA 4RM9A 4MM3B 1YQ4B 3APDA 3R7RA 4ARIA 3ZGZA 4MGYE 1WJ4A 2AL6A 4OZBA 2VRRB 1ZGUB 3U4EG 1R4MB 3WAOA 2BT6A 3KUZA 4KIKB 4BOSC 2V3PA 3HIZA 3NVZA 4CO7A 4KZCA 2K1FA 2L05A 4WIPA 1V81A 1OGWA 2O6VA 3A33B 2TSSA 5AZFA 3UQBA 5G2NA 2NPTB 2QEJC 3BYYB 5E6JA 4DK5A 3OJ4B 1DOIA 3CWIA 3NUHB 1S3SG 3V6EB 4MACA 4KGRA 1PYWD 2MW5A 3GP7A 2WQYB 1K53A 1D5ZC 1GNUA 4W9HA 4WJPA 2O6VD 2I38A 5CX3A 1T0QC 2Z0DB 3ECIA 3P2BA 1QT9A 3TJPA 3N1ZC 4A20A 1OTRB 2KC2A 2KQ4X 2IGHA 2DWQA 3DBRB 1QLBB 2L3ZA 4DHZB 3M63B 3AXCA 1EO6A 1WX8A 3DOWA 3WAMA 2WXLA 2KDEB 1T0YA 1WE7A 1WWTA 3AI5A 4FULA 4S17A 4EZLA 1GC6A 2AYOB 2KD0A 3MHZA 4XDCA 4LNKA 2UWQA 2X8XX 3KH0A 4MJSA 3OWEB 4I6PA 4ZRKA 2O6VB 1WSPA 1NI2A 3RPFC 1YX6B 1AN8A 3EFUA 3NZSA 4ITKA 1TKYA 3R66C 4HDQA 1GPXA 2XK5A 1TS5A 3PT2B 3W5UB 3EA6A 4BBNC 2V9HA 1B9RA 2RDGA 2DBYA 4DDGD 3AE4B 2KHWB 2IGGA 3MTNB 2LHDA 4O1NA 4PS8A 1E10A 4YXDB 1H8CA 4OVZA 1JWBD 2PE9A 3N1XC 1WJ6A 1YJ1A 1STEA 2EELA 3IBEA 4CQNA 2LHEA 1OQRA 1WGYA 5D6JB 2J42A 3AMZA 4FXCA 1IBXA 4BKTA 2C5LC 4MJSB 2XN9C 3IHPC 5BMHA 3ETRA 1FCCC 2JXXA 4BFRA 3M95A 3QA8A 1P9DU 3PRMB 5J2RA 4REZA 2DZMA 1JW9D 2KMAA 4K3BA 5HHDG 4M8NA 2XK5B 1T0SC 2ICIA 2INCC 1RYJA 5GMVA 1NEKB 1NBFC 1WR1A 1VR9A 1FCLA 1WR6E 1T6BX 3VUWA 3RNBC 1KM7A 2JSVX 4FA6A 1WZ0A 2DAJA 4YL8A 4GIVA 5C23A 4WWNA 3RT3B 1KH0A 4XWWA 4EKUA 2BYTA 2LI5A 3JW0X 3HVZA 2K5PA 2LVOA 3PPAA 2CR5A 1SSNA 3GOEA 1E7VA 1NYRA 3AU5A 2H88B 4ANWA 5IAAC 1ZKHA 2KNBA 2KN5A 1FFUA 5BYSA 5C1ZA 3PHWB 4HCNB 3ZLZA 3E56A 2BVCA 3QWZB 1F2RC 1PQSA 2CHZA 1E7UA 4KX6B 4GN1A 2MH7A 3TMPB 1FM0D 3H7PA 3GZNI 1WJUA 3AEAB 1XLOA 1N5WA 2ZEQA 3DBLB 4IWPA 3TEXA 3PS6A 4HROA 1IBXB 2IY1B 4FHJA 2QMTA 5H8YE 1E8ZA 1SXTA 2ZW1A 4GXBA 5E6PA 1ET9A 2E6XA 3VTVA 2K8BA 3VQIA 4MT5A 3L4PA 5G5GA 2R2QA 2IO2B 2WU2B 1C76A 1V5TA 1J0GA 1V1PA 4OW0A 2KMCA 1TY0A 4JWUC 5LLIA 4LK0M 2GBJA 2V0GA 1ZE3D 2MBOA 3J9CA 1TYGB 2KVZA 3RNEC 1WH3A 3QQ8B 1ZXHA 4TQ0A 2MWSB 2JU6X 4HWIB 1OEYA 1ESFA 5HKHA 2ZCBA 1FNVA 2KC1A 3V60A 3E9SA 3TIXA 3BK1A 2PKOA 1SE4A 1K51A 2FNJB 2KXJA 2MBQA 3DWGC 1JWMD 1P98A 3NOBA 2LZ6A 4US8A 2KFKA 3RZFA 1UD7A 3O13A 5JH5C 1ZP0B 3H7PB 4DHJD 2CU3A 2PW9A 2RPVA 1V86A 4DXFA 2XEWA 2OJRA 3EC8A 1RLFA 4L1BA 2RPQA 1D4BA 4M01A 2K8HA 1FRDA 3A4RA 4RF1A 4RGNA 3URYA 1V1PB 1MHHE 4HPMB 2KQ7A 3ZQ4A 5IA7A 1UGJA 4B9KA 3QARA 2IO3B 1KLUD 1F1HA 1XO3A 2NTTA 2WNMA 2INNE 1E90A 2VZKD 4DHJB 2HE7A 2WXRA 2Y5CA 3DQVA 3NZUA 1WM2A 1JCKB 1YQ3B 4ZRIA 1FRRA 2PIAA 4ANUA 1T3QA 4DXAB 4TUUA 5BYQA 2W55A 1XCQL 2DYOA 4MDKE 2KFKB 1AYFA 2LGYA 3FAHA 3NS8A 4RGOS 2O2VA 3AULA 3JVZX 2QCZA 4E71A 2ZVOA 1SGHA 3VVWB 4FADA 4WWOA 2GRIA 2KJRA 4PK1A 1C4PA 1ENFA 3B2GA 3AE2B 3QX1A 3N1YC 2WGSA 1YMHE 1F52A 2D3GA 4F1SA 2C9WB 2M8SA 3MFGA 4N58A 2PEAA 2ZPNA 2C60A 2FE8A 3AN1A 2JWZA 1JWAD 3T8MA 2LGDA 3T3OA 3VR9B 3AEFB 2JYTA 1MVKA 3KQ4A 1BUIC 3KVFB 3RNAC 1HTOA 2HDEA 3ZRCA 1FMAD 1ZDVA 5AUIA 4IUMB 2QIEB 2V3NA 3EECA 3ZO5B 1DGJA 4ZRQA 2BS3B 1RRBA 3B0AA 2EMTA 5H92C 2Q5WD 3WALA 3AE8B 2BYEA 4W9CA 2KANA 1C78A 3V6CB 3NG0A 4HDOA 3W1YA 3VUYA 2OEDA 4BKSA 4KKIA 2O2VB 2WXNA 4FJVB 2RSUA 1V80A 1MJDA 4FJZA 3AE9B 1Y56A 1JWUD 3AEEB 4I6NB 1F77A 2WXPA 1X1MA 5D7GA 2Y5BB 3UIOB 4ZRPA 1WE6A 2KTRA 3LJ3A 3ZTDA 2ON8A 3B1LX 1RWSA 1K52A 1TT5B 4W9FA 2L83A 2G9HD 3DVGX 4DXGA 2W82A 2LMCA 4BKSD 3PVLA 1WJNA 4DDID 3IT6B 4ZHPA 1WIAA 3NVWA 3QCAA 3ALBA 3IVFA 3A9JA 2IYDB 3L17A 4P16A 2JX5A 2D3BA 2MJDA 2UU7A 4W9GA 5BO4B 2INDC 2KLGA 4K81A 3P4QB 4ZOHC 3VDZA 1GUAB 4RGTA 2KLCA 4FJYA 1SIFA 3Q3OC 4AJWA 2PLPA 3N3KB 3BVMA 1TBEA 2SAKA 4HPLB 5HG2A 2MRPA 3N30A 3A1QA 3AE6B 2I1JA 2CU1A 2EMSA 2W54A 1TS4A 3W2DA 3NJTA 1AWDA 4WJNA 1PUTA 5HI1A 2KO3A 3TL5A 2JZZA 1IUEA 4B6WA 1LGRA 3SFDB 4KDLB 2KTRB 4JL9A 4KSLC 3ZYYX 2PVGC 1BT0A 2FUG1 3PZ7A 3W9CB 1V49A 1V2YA 3P4SB 3SEBA 1G6JA 2C7NB 2W3RA 3P4PB 4ZHOA 1RAXA 4MH0E 2LXCA 3A9JB 2WXKA 3X0WA 2LGXA 4ARCA 4XYCA 4NNJB 3R8BA 2L52A 1F0ZA 1XCTL 4W9IA 4X57B 3U7ZA 3UQAA 4KZ0A 3DBHB 5BMGA 2D3AA 3TCAA 1FFVA 4YSZB 3RYTA 4NQLB 1WGGA 2KK8A 5FR3A 4UDUC 3DBSA 3L54A 4MSQB 1XLPA 1B1ZA 4KKJA 2ZW0A 4ACFA 3A1QB 2WX0A 5L95C 4EUTA 3DVNU 4BKGA 2M0AA 1QILA 4XE0A 2KQSA 3VXWA 4MSMB 3DHHC 1TJEA 4CYEA 3MC8A 3TUOA 1QZEA 4WWPA 3ZJVA 3AH7A 4D2KA 4LNFA 2N9KA 2L00B 4FN2A 2DAFA 5D3DA 3MP9A 3FILA 2G3QB 3QAQA 3ZXRA 2I1KA 2DYBA 1YN4A 5JZEB 4G11A 1BXTA 1T5XD 1Z5SB 3P63A 1V8CA 1SE3A 1L0YB 1SF0A 3Q8BA 2KOXA 1MHXA 3KYCD 2FIFA 2M19A 1ZUD2 1EM7A 2N1WA 4W9LA 1JRUA 3U52E 3SR6A 4C56C 4MGKE 5E6OA 3RNGC 2LGSA 3HM3A 2WDQB 4IWQA 3LDZE 2GB1A 3NY5A 2MCNB 3L16A 4ANXA 3K9OB 3QIJA 1ZOYB 1P1AA 4RCOA 4ANVA 2WXHA 1L4ZB 5IP4D 3VAWA 5IKCM 4P1CC 2WX1A 2CKHB 4XGAB 4TSSA 1NVID 1WF9A 3QC8B 1YJIA 4WH4A 3H6NA 1L2NA 3FILB 1R4NI 3T9LA 1Y8RC 5IOIA 2Y3AA 2YVCA 3WAPA 3APCA 2RGFA 1UUPA 2MJ3A 1F2RI 1FNUA 2LVPA 1LM8B 2N9EB 2M56B 1I42A 3BY4B 2KYWA 1FEHA 1P0RA 3FKYA 2GLSA 4YWGG 2BYFA 4KDIC 2J53A 2BW2A 2BS2B 5JXVA 1WY8A 5DCNA 2D07B 1IGCA 2KDIA 3RMKC 2GMIC 4II2B 1FXAA 2YEPF 5JHBA 2AQ3B 2MEKA 2OOBB 2BTEA 3GE3C 1WYGA 4WQOB 2BBCA 3UIPB 2JZPA 1DOYA 3I57A 2L7RA 2INPE 4M0WA 2WXOA 1XXGA 4ASWC 2WYQA 4LLGM 4GDLA 4YT0B 3O65B 5C2TB 4KGSA 1TS3A 1ZPSA 3DCGA 3NZ3A 5DPWA 2LD9A 1GAQB 1I4HA 4N9F4 3UGBB 3RUIB 2WDRB 1YNTE 2FCMA 1QKZA 2GOWA 1XLQA 3PO0A 3AEBB 1L0VB 1D5MC 2AWTA 2IBIB 5GXGB 3ZIMA 2FCSA 1YN5A 3Q3JA 3Q3NC 1WRIA 5CHVC 4W9KA 4KSKC 2B76B 3HRDD 5LXHA 4A6QA 4F7ZA 2J0MA 4GOCA 3WA0A 3GS2A 2JRIB 2NBWB 1E7PB 2BB6A 2KAJA 3X23A 4FBJB 3RNFC 4GU2A 4M0WB 2J7QB 5KHOA 4HKZE 1MFWA 2NVUI 1SE9A 4GDLB 5E6NA 4QAYA 1EF1A 1VCBA 5EE1A 2KWDA 4JX1C 3DDCB 1H4RA 3AE7B 2LASA 1Q1OA 3CSFA 1U4AA 3HUIA 1HZ5A 2KJHB 2M1MA 1Q10A 1R4MI 4NY0A 2DX5B 2WDTB 3P1MA 2LRWA 1J8CA 4DWFA 1QOAA 2MBBB 3TEYA 2PE6B 3IFWB 2L0FA 2EKEC 1J7BA 2ZVNA 3ZRFA 3DHIC 1TTNA 1P3QU 3ZDTA 1ACCA 2LUEA 2J0KA 4C80A 2PMVA 3DWMA 1D3ZA 4GDKA 2YLMA 4K7WA 3PLUA 2KT7A 2K8CA 1FNWA 2CHWA 3WIMA 4US9A 2GI9A 5T8IA 1YIWA 3Q8EA 3KWVA 1QOGA 4YTMB 2WXMA 4EFOA 2R61A 1I4QA 2C7HA 1GC7A 2AL3A 1C3TA 4R3DA 4HXDA 3DPDA 1TZ1A 2GBNA 3DVNV 2L32A 2Y5PA 3ML8A 1CK1A 4F8CB 3DVGY 3DBRI 1VZ6A 1I4GA 2GBRA 2LXAA 4XX5A 4IG7B 4HRSA 1WXQA 5AEKB 4WQMA 4E3CA 1L5PA 3NHEB 3ZDMC 2JRHA 1C4AA 1UGMA 1WX9A 2RDHA 2PTLA 3Q8AA 2N9LA 3RCZA 2XNAC 4URKA 2AQ1B 4WJQA
chains in the Genus database with same CATH topology
3DOWA 5JHAA 2KLCA 5J17A 2ZCCA 3WAMA 4FJYA 4WJOA 1SIFA 2KDEB 2LWPA 1T0YA 3AU4A 4AJWA 4PYUA 4MGIE 2J0JA 2BKFA 2BYVE 3N3KB 2JY6A 2DZJA 4DBGA 1TBEA 1WE7A 3AI5A 4EZLA 4FULA 4BOZB 2DHZA 2KKCA 1GC6A 2FIDA 2AYOB 2FAZA 4HPLB 2MRPA 2KD0A 3N30A 5TR5A 4GDKB 2FUHB 2JZ3B 4JLCA 2UWQA 3A1QA 2LVQA 4K7UA 2I1JA 3PHXB 2CU1A 2EMSA 3KH0A 2CS4A 4MJSA 3ZVVA 4I6PA 4ZRKA 2O6VB 2MX2A 1NI2A 4WJNA 2G4DB 1WGHA 4ZYNA 1LFDA 1YX6B 4A3OA 2KO3A 3TL5A 3VTWA 2KWUB 4PS7A 3B08A 3EFUA 2JZZA 3NZSA 5DPRA 2XBBC 3JYUA 4B6WA 3R66C 2DENB 2KTRB 4HDQA 4JL9A 4KDLB 4KSLC 2XK5A 3PT2B 3V62A 2W9NA 3SHQA 1BT0A 1XT9B 3PGEA 4IM3A 2MLBA 3VFKA 1V49A 2JUOA 1WXMA 4BBNC 1V2YA 1G6JA 4RM8A 2C7NB 4ZRJA 3DBHI 2N9PC 3PSEB 1RAXA 4MH0E 1AARA 3TBLD 2LXCA 1UELA 2AEHA 3A9JB 1Q0WB 4DDGD 1YQBA 3HK0A 2KHWB 3X0WA 3KUDB 3KW5B 2LGXA 2MBHA 3MTNB 4W9DA 2N4FA 2BPSA 2V3SA 5FR6A 3CMMB 1S1QB 4NNJB 4NQKE 4GSWA 4W9EA 4PS8A 4W9IA 4X57B 3UQAA 4KZ0A 1H8CA 1C1YB 5J18A 1OQYA 4AWJA 3TCAA 4BVUC 3RYTA 4NQLB 2PE9A 2Z0EB 4JQWC 2V4LA 1WJ6A 1WGGA 1YJ1A 2A5UA 2KK8A 3IBEA 3HHMA 3VHTC 1WI0A 3DBSA 3WANA 3L54A 4MSQB 3C0RB 1Q5WB 4AJYB 1WGYA 2IO1B 5D6JB 5D94A 1I35A 3A1QB 4BKTA 2WX0A 5L95C 2C5LC 4EUTA 1WFYA 4NJ7A 3DVNU 4MJSB 2PPHA 4NPNA 4NJ6A 4BKGA 1GJZA 3IHPC 3SDLC 5LXIB 1J19A 2KQSA 2R2OA 3VXWA 1WYWB 3JSVA 3HM6X 2JXXA 4BFRA 4MSMB 3M95A 3OLMD 4AP4C 3QA8A 1P9DU 2MP2A 3H9DA 4CYEA 3L13A 2KDFB 3PRMB 4WJQA 2DZMA 3H1UA 5J2RA 1QZEA 1FXTB 2KMAA 4WWPA 3ENEA 2C7MB 4M8NA 3R3MA 2XK5B 3PTFC 1MG8A 4G3XB 5GMVA 1IYFA 2L00B 4FN2A 1NBFC 2DAFA 1WR1A 5DPTA 1WR6E 2BWFA 3S2AA 3OJ3A 3VUWA 2G3QB 3QAQA 4IM2A 2Z59B 1KM7A 2I1KA 5KHQA 2L8JA 4MELA 4FA6A 1WZ0A 2DAJA 2PJHA 4YL8A 4RMAA 2DYBA 4GIVA 5C23A 5JZEB 4G11A 4WWNA 3RT3B 1Z5SB 3ZNGC 2LI5A 1WRDB 4EKUA 3EHVA 3JW0X 3ZNID 4IWOA 2M4NA 2LVOA 2JPHA 3PPAA 2CR5A 3GOEA 1E7VA 2GBKA 2NBVB 3RULA 2ASQA 2N9XA 3AU5A 4PYZA 4ANWA 5IAAC 1ZKHA 2KNBA 2KN5A 2NR2A 5EDSA 3OAWA 2KOXA 3I3TB 1V9JA 3DBLI 3KYCD 5C1ZA 4B95A 2KX3A 2REXA 2FIFA 3PHWB 4HCNB 3ZLZA 4K7SA 3D32A 3SD5A 3SU8X 2N1WA 2MQJA 4W9LA 1JRUA 2ZJDA 3QWZB 1PQSA 4MGKE 5E6OA 2CHZA 1V5OA 1E7UA 3HM3A 1CMXB 5CTRC 4IWQA 4AOFA 3LDZE 4HK2A 1EUVB 2HTHA 4GN1A 1EF5A 2KZRA 3U7DA 3TMPB 3H7PA 3GZNI 3KUCB 3MHSD 3NY5A 2MCNB 1WJUA 3L16A 2ZEQA 4I6LB 3K9OB 3PS6A 4IWPA 5CHWA 4ANXA 4MEMA 2JVCA 2IY1B 3QIJA 1P1AA 1IPGA 4FHKA 4FHJA 2KWVB 5AZGA 3ONSA 1E8ZA 1LXDA 2N7DA 2ZNVC 4ANVA 2DYMA 2N1VA 3KYDD 3JSVB 3VAWA 3PLVA 1L7YA 4GXBA 2MP2B 5E6PA 1E5WA 2WX1A 2QHOA 3U8ZA 1ZW7A 1NDDA 2K8BA 3M62B 3VQIA 3VTVA 2CKHB 2K39A 4G50A 2N7EA 3RZWC 4KV2A 1WF9A 2M17A 3QC8B 2R2QA 2IO2B 3H6NA 1L2NA 2ZPYA 1V5TA 1E8YA 1R4NI 1WMHA 3ZTCA 1J0GA 3T9LA 1Y8RC 1M94A 2YVCA 2KMCA 3WAPA 3APCA 2MBEA 2RGFA 2A4ZA 2D11A 3ML9A 1RFAA 1WXAA 4II3B 2HD5B 5LLIA 1LQBA 3QJZA 2D10A 4BBNF 2GBJA 2LVPA 1LM8B 2N9EB 3IG3A 1I42A 3BY4B 4XC2A 2MBOA 4A3PA 1P0RA 3A9KB 2KWCA 1UZXB 2JT4B 3MJWA 1WH3A 3QQ8B 4TQ0A 2MWSB 4HWIB 1OEYA 1WXVA 3H7SA 3W1SC 5HKHA 2ZCBA 4G0NB 1K8RB 2KC1A 4LCDE 3V60A 2D2QA 3TIXA 2BYFA 4KDIC 2JF5A 2FNJB 3PRZA 1IP9A 5CHFA 2KXJA 1OEYJ 2MBQA 1P98A 3NOBA 1WY8A 5DCNA 2LZ6A 2D07B 2RD0A 2KFKA 3RZFA 1HE8A 1UD7A 2KDIA 2GMIC 1KLVA 4K1RB 4HLEA 4II2B 5JH5C 4HJKA 2UYZB 3H7PB 4LDTD 4DHJD 5JHBA 5DPSA 2OOBB 4W9JA 1WGRA 2IY0B 4WQOB 3UIPB 1E8WA 4HVBA 1V86A 2KFJA 2ZNVB 3L0WB 2HJ8A 3APFA 2L76A 4IW0A 2K25A 4KVGB 2L7RA 3K9PB 1UH6A 2XEWA 1GG3A 2OJRA 3RD2A 2FCQA 3EC8A 1RLFA 3ZKJC 2RPQA 4ASWC 1WZ3A 2WYQA 2K8HA 3ZNHB 3VTUA 4GDLA 2KDBA 1ISNA 3O65B 3A4RA 1WMHB 4IM0A 3ZW3A 4HPMB 2KQ7A 1KOTA 2G4SA 3DCGA 5IA7A 5DPWA 4JIOU 4WAAA 3UF8A 4GMVA 3A9KA 3R7QA 4B9KA 3QARA 2IO3B 2LD9A 3N32A 2RR9A 2V1YA 4N9F4 3UGBB 3RUIB 2LRUA 4CHKA 1KJTA 1E90A 1XQQA 4XZ4A 1F9JA 1Z2MA 4LDTB 4MM3A 4DHJB 2IO0B 2HE7A 1VD2A 2GBMA 2K6QA 3QHTA 3VH4B 4EEWA 1E8XA 2KX0A 2IZVB 5AZHA 1UBIA 3DQVA 3NZUA 2FCMA 1WM2A 4IC7B 4NAWA 4AUQC 4MGZE 4ZRIA 2WWZA 2K6DB 2MSED 3ZNZB 2KJ6A 1V6EA 2GOWA 4ANUA 2NS5A 4DXAB 3ZUNA 3BINA 2DZKA 4TUUA 3VUXA 4KIKA 3UINB 2G45B 2BKRB 4DHZE 2IBIB 2AWTA 3ZIMA 4EZJA 2FCSA 2DYOA 4MDKE 2KFKB 3Q3JA 2LGYA 3NS8A 2O2VA 4GB9A 5CHVC 3AULA 4OVVA 4W9KA 4KSKC 2KVRA 3JVZX 5LXHA 4F7ZA 2J0MA 4PS3A 4GOCA 4HCPB 3V61A 4E71A 2ZVOA 3WA0A 2NPTA 1SGHA 4P7IA 2BWES 2JRIB 2NBWB 3VVWB 3PV1A 3CF6E 4ICVA 4FADA 2DZIA 3A4SC 4WWOA 3X23A 4FBJB 4GU2A 2KJRA 4M0WB 2J7QB 3PRPB 5KHOA 1WM3A 2NVUI 1SE9A 2NCNA 4GDLB 5E6NA 3L08A 3U30A 1EF1A 5D2MB 3QX1A 1VCBA 3DDCB 3Q3FA 4LJOB 4TQ1A 2D3GA 4F1SA 1WX7A 1H4RA 1YD8U 2C9WB 2M8SA 2LASA 1A5RA 1Q1OA 3CSFA 2PEAA 2ZPNA 2C60A 1U4AA 2JWZA 3T8MA 2KJHB 2LGDA 2M1MA 2B3AA 1R4MI 1XD3B 4NY0A 1WGDA 2DX5B 2MA9B 2LJ5A 2WDTB 4RM9A 2LRWA 3KVFB 3W1SA 1J8CA 2BF8B 4DWFA 3ZRCA 2MBBB 3APDA 4IUMB 4OVUA 3R7RA 3EECA 3ZO5B 4MGYE 5L83A 2KTFA 4J6IA 1RRBA 2PE6B 1WJ4A 2AL6A 2EMTA 3B0AA 3IFWB 2L0FA 3WALA 2EKEC 2BYEA 3VH3B 2VRRB 4W9CA 4NAWB 1ZGUB 2KANA 2ZVNA 3V6CB 3ZRFA 4ICUA 3WAOA 4HDOA 1TTNA 3W1YA 3KUZA 1P3QU 4KIKB 2FCNA 3VUYA 4BOSC 3HIZA 4CO7A 3ZDTA 2LUEA 2J0KA 4KZCA 1D3ZA 1TGZB 4GDKA 4TKNA 2YLMA 4K7WA 2K1FA 3PLUA 4BKSA 2K8CA 4JGHB 2L05A 2CHWA 2O2VB 3WIMA 1V81A 1OGWA 4FJVB 4GGQA 2RSUA 1V80A 1YIWA 2O6VA 3A33B 4TV3A 2BGFA 3QK0A 5AZFA 4FJZA 4EFOA 3UQBA 5G2NA 2C7HA 1GC7A 2NPTB 2AL3A 1C3TA 4I6NB 4DK5A 3OJ4B 4EOYA 1X1MA 4HXDA 2Y5BB 3DPDA 1TZ1A 5D7GA 3UIOB 2GBNA 3DVNV 1WE6A 2KTRA 3M3JA 3LJ3A 1S3SG 3ZTDA 3V6EB 4ZDVA 3B1LX 3ML8A 3CSTA 4F8CB 2L0TA 3DVGY 4W9FA 3DBRI 2ZZPB 3DVGX 2MW5A 2NBUA 4E74A 2GBRA 5G55A 2LXAA 4XX5A 4IG7B 4BKSD 1GNUA 3PVLA 1WJNA 4W9HA 4DDID 2CHXA 3PREA 4WJPA 5AEKB 1WIAA 4E3CA 2O6VD 3QCAA 5CX3A 3ALBA 3IVFA 3NHEB 2Z0DB 3ECIA 3A9JA 3P2BA 3ZDMC 1YX5B 2JRHA 3TJPA 2IYDB 4A20A 1OTRB 4M8MA 2KC2A 2M0XA 1UGMA 1WX9A 3L17A 4FLHA 3L10B 4W9GA 5BO4B 2KLGA 4K81A 4DHZB 2L3ZA 4EZKA 1WXSA 3M63B 4LJPB 3RCZA 4URKA 3AXCA 1EO6A 1WX8A 3PZDA 3VDZA 1UBQA 1GUAB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3DOW A;  5JHA A;  2KLC A;  5J17 A;  2ZCC A;  3WAM A;  4FJY A;  4WJO A;  1SIF A;  2KDE B;  2LWP A;  1T0Y A;  3AU4 A;  4AJW A;  4PYU A;  4MGI E;  2J0J A;  2BKF A;  2BYV E;  3N3K B;  2JY6 A;  2DZJ A;  4DBG A;  1TBE A;  1WE7 A;  3AI5 A;  4EZL A;  4FUL A;  4BOZ B;  2DHZ A;  2KKC A;  1GC6 A;  2FID A;  2AYO B;  2FAZ A;  4HPL B;  2MRP A;  2KD0 A;  3N30 A;  5TR5 A;  4GDK B;  2FUH B;  2JZ3 B;  4JLC A;  2UWQ A;  3A1Q A;  2LVQ A;  4K7U A;  2I1J A;  3PHX B;  2CU1 A;  2EMS A;  3KH0 A;  2CS4 A;  4MJS A;  3ZVV A;  4I6P A;  4ZRK A;  2O6V B;  2MX2 A;  1NI2 A;  4WJN A;  2G4D B;  1WGH A;  4ZYN A;  1LFD A;  1YX6 B;  4A3O A;  2KO3 A;  3TL5 A;  3VTW A;  2KWU B;  4PS7 A;  3B08 A;  3EFU A;  2JZZ A;  3NZS A;  5DPR A;  2XBB C;  3JYU A;  4B6W A;  3R66 C;  2DEN B;  2KTR B;  4HDQ A;  4JL9 A;  4KDL B;  4KSL C;  2XK5 A;  3PT2 B;  3V62 A;  2W9N A;  3SHQ A;  1BT0 A;  1XT9 B;  3PGE A;  4IM3 A;  2MLB A;  3VFK A;  1V49 A;  2JUO A;  1WXM A;  4BBN C;  1V2Y A;  1G6J A;  4RM8 A;  2C7N B;  4ZRJ A;  3DBH I;  2N9P C;  3PSE B;  1RAX A;  4MH0 E;  1AAR A;  3TBL D;  2LXC A;  1UEL A;  2AEH A;  3A9J B;  1Q0W B;  4DDG D;  1YQB A;  3HK0 A;  2KHW B;  3X0W A;  3KUD B;  3KW5 B;  2LGX A;  2MBH A;  3MTN B;  4W9D A;  2N4F A;  2BPS A;  2V3S A;  5FR6 A;  3CMM B;  1S1Q B;  4NNJ B;  4NQK E;  4GSW A;  4W9E A;  4PS8 A;  4W9I A;  4X57 B;  3UQA A;  4KZ0 A;  1H8C A;  1C1Y B;  5J18 A;  1OQY A;  4AWJ A;  3TCA A;  4BVU C;  3RYT A;  4NQL B;  2PE9 A;  2Z0E B;  4JQW C;  2V4L A;  1WJ6 A;  1WGG A;  1YJ1 A;  2A5U A;  2KK8 A;  3IBE A;  3HHM A;  3VHT C;  1WI0 A;  3DBS A;  3WAN A;  3L54 A;  4MSQ B;  3C0R B;  1Q5W B;  4AJY B;  1WGY A;  2IO1 B;  5D6J B;  5D94 A;  1I35 A;  3A1Q B;  4BKT A;  2WX0 A;  5L95 C;  2C5L C;  4EUT A;  1WFY A;  4NJ7 A;  3DVN U;  4MJS B;  2PPH A;  4NPN A;  4NJ6 A;  4BKG A;  1GJZ A;  3IHP C;  3SDL C;  5LXI B;  1J19 A;  2KQS A;  2R2O A;  3VXW A;  1WYW B;  3JSV A;  3HM6 X;  2JXX A;  4BFR A;  4MSM B;  3M95 A;  3OLM D;  4AP4 C;  3QA8 A;  1P9D U;  2MP2 A;  3H9D A;  4CYE A;  3L13 A;  2KDF B;  3PRM B;  4WJQ A;  2DZM A;  3H1U A;  5J2R A;  1QZE A;  1FXT B;  2KMA A;  4WWP A;  3ENE A;  2C7M B;  4M8N A;  3R3M A;  2XK5 B;  3PTF C;  1MG8 A;  4G3X B;  5GMV A;  1IYF A;  2L00 B;  4FN2 A;  1NBF C;  2DAF A;  1WR1 A;  5DPT A;  1WR6 E;  2BWF A;  3S2A A;  3OJ3 A;  3VUW A;  2G3Q B;  3QAQ A;  4IM2 A;  2Z59 B;  1KM7 A;  2I1K A;  5KHQ A;  2L8J A;  4MEL A;  4FA6 A;  1WZ0 A;  2DAJ A;  2PJH A;  4YL8 A;  4RMA A;  2DYB A;  4GIV A;  5C23 A;  5JZE B;  4G11 A;  4WWN A;  3RT3 B;  1Z5S B;  3ZNG C;  2LI5 A;  1WRD B;  4EKU A;  3EHV A;  3JW0 X;  3ZNI D;  4IWO A;  2M4N A;  2LVO A;  2JPH A;  3PPA A;  2CR5 A;  3GOE A;  1E7V A;  2GBK A;  2NBV B;  3RUL A;  2ASQ A;  2N9X A;  3AU5 A;  4PYZ A;  4ANW A;  5IAA C;  1ZKH A;  2KNB A;  2KN5 A;  2NR2 A;  5EDS A;  3OAW A;  2KOX A;  3I3T B;  1V9J A;  3DBL I;  3KYC D;  5C1Z A;  4B95 A;  2KX3 A;  2REX A;  2FIF A;  3PHW B;  4HCN B;  3ZLZ A;  4K7S A;  3D32 A;  3SD5 A;  3SU8 X;  2N1W A;  2MQJ A;  4W9L A;  1JRU A;  2ZJD A;  3QWZ B;  1PQS A;  4MGK E;  5E6O A;  2CHZ A;  1V5O A;  1E7U A;  3HM3 A;  1CMX B;  5CTR C;  4IWQ A;  4AOF A;  3LDZ E;  4HK2 A;  1EUV B;  2HTH A;  4GN1 A;  1EF5 A;  2KZR A;  3U7D A;  3TMP B;  3H7P A;  3GZN I;  3KUC B;  3MHS D;  3NY5 A;  2MCN B;  1WJU A;  3L16 A;  2ZEQ A;  4I6L B;  3K9O B;  3PS6 A;  4IWP A;  5CHW A;  4ANX A;  4MEM A;  2JVC A;  2IY1 B;  3QIJ A;  1P1A A;  1IPG A;  4FHK A;  4FHJ A;  2KWV B;  5AZG A;  3ONS A;  1E8Z A;  1LXD A;  2N7D A;  2ZNV C;  4ANV A;  2DYM A;  2N1V A;  3KYD D;  3JSV B;  3VAW A;  3PLV A;  1L7Y A;  4GXB A;  2MP2 B;  5E6P A;  1E5W A;  2WX1 A;  2QHO A;  3U8Z A;  1ZW7 A;  1NDD A;  2K8B A;  3M62 B;  3VQI A;  3VTV A;  2CKH B;  2K39 A;  4G50 A;  2N7E A;  3RZW C;  4KV2 A;  1WF9 A;  2M17 A;  3QC8 B;  2R2Q A;  2IO2 B;  3H6N A;  1L2N A;  2ZPY A;  1V5T A;  1E8Y A;  1R4N I;  1WMH A;  3ZTC A;  1J0G A;  3T9L A;  1Y8R C;  1M94 A;  2YVC A;  2KMC A;  3WAP A;  3APC A;  2MBE A;  2RGF A;  2A4Z A;  2D11 A;  3ML9 A;  1RFA A;  1WXA A;  4II3 B;  2HD5 B;  5LLI A;  1LQB A;  3QJZ A;  2D10 A;  4BBN F;  2GBJ A;  2LVP A;  1LM8 B;  2N9E B;  3IG3 A;  1I42 A;  3BY4 B;  4XC2 A;  2MBO A;  4A3P A;  1P0R A;  3A9K B;  2KWC A;  1UZX B;  2JT4 B;  3MJW A;  1WH3 A;  3QQ8 B;  4TQ0 A;  2MWS B;  4HWI B;  1OEY A;  1WXV A;  3H7S A;  3W1S C;  5HKH A;  2ZCB A;  4G0N B;  1K8R B;  2KC1 A;  4LCD E;  3V60 A;  2D2Q A;  3TIX A;  2BYF A;  4KDI C;  2JF5 A;  2FNJ B;  3PRZ A;  1IP9 A;  5CHF A;  2KXJ A;  1OEY J;  2MBQ A;  1P98 A;  3NOB A;  1WY8 A;  5DCN A;  2LZ6 A;  2D07 B;  2RD0 A;  2KFK A;  3RZF A;  1HE8 A;  1UD7 A;  2KDI A;  2GMI C;  1KLV A;  4K1R B;  4HLE A;  4II2 B;  5JH5 C;  4HJK A;  2UYZ B;  3H7P B;  4LDT D;  4DHJ D;  5JHB A;  5DPS A;  2OOB B;  4W9J A;  1WGR A;  2IY0 B;  4WQO B;  3UIP B;  1E8W A;  4HVB A;  1V86 A;  2KFJ A;  2ZNV B;  3L0W B;  2HJ8 A;  3APF A;  2L76 A;  4IW0 A;  2K25 A;  4KVG B;  2L7R A;  3K9P B;  1UH6 A;  2XEW A;  1GG3 A;  2OJR A;  3RD2 A;  2FCQ A;  3EC8 A;  1RLF A;  3ZKJ C;  2RPQ A;  4ASW C;  1WZ3 A;  2WYQ A;  2K8H A;  3ZNH B;  3VTU A;  4GDL A;  2KDB A;  1ISN A;  3O65 B;  3A4R A;  1WMH B;  4IM0 A;  3ZW3 A;  4HPM B;  2KQ7 A;  1KOT A;  2G4S A;  3DCG A;  5IA7 A;  5DPW A;  4JIO U;  4WAA A;  3UF8 A;  4GMV A;  3A9K A;  3R7Q A;  4B9K A;  3QAR A;  2IO3 B;  2LD9 A;  3N32 A;  2RR9 A;  2V1Y A;  4N9F 4;  3UGB B;  3RUI B;  2LRU A;  4CHK A;  1KJT A;  1E90 A;  1XQQ A;  4XZ4 A;  1F9J A;  1Z2M A;  4LDT B;  4MM3 A;  4DHJ B;  2IO0 B;  2HE7 A;  1VD2 A;  2GBM A;  2K6Q A;  3QHT A;  3VH4 B;  4EEW A;  1E8X A;  2KX0 A;  2IZV B;  5AZH A;  1UBI A;  3DQV A;  3NZU A;  2FCM A;  1WM2 A;  4IC7 B;  4NAW A;  4AUQ C;  4MGZ E;  4ZRI A;  2WWZ A;  2K6D B;  2MSE D;  3ZNZ B;  2KJ6 A;  1V6E A;  2GOW A;  4ANU A;  2NS5 A;  4DXA B;  3ZUN A;  3BIN A;  2DZK A;  4TUU A;  3VUX A;  4KIK A;  3UIN B;  2G45 B;  2BKR B;  4DHZ E;  2IBI B;  2AWT A;  3ZIM A;  4EZJ A;  2FCS A;  2DYO A;  4MDK E;  2KFK B;  3Q3J A;  2LGY A;  3NS8 A;  2O2V A;  4GB9 A;  5CHV C;  3AUL A;  4OVV A;  4W9K A;  4KSK C;  2KVR A;  3JVZ X;  5LXH A;  4F7Z A;  2J0M A;  4PS3 A;  4GOC A;  4HCP B;  3V61 A;  4E71 A;  2ZVO A;  3WA0 A;  2NPT A;  1SGH A;  4P7I A;  2BWE S;  2JRI B;  2NBW B;  3VVW B;  3PV1 A;  3CF6 E;  4ICV A;  4FAD A;  2DZI A;  3A4S C;  4WWO A;  3X23 A;  4FBJ B;  4GU2 A;  2KJR A;  4M0W B;  2J7Q B;  3PRP B;  5KHO A;  1WM3 A;  2NVU I;  1SE9 A;  2NCN A;  4GDL B;  5E6N A;  3L08 A;  3U30 A;  1EF1 A;  5D2M B;  3QX1 A;  1VCB A;  3DDC B;  3Q3F A;  4LJO B;  4TQ1 A;  2D3G A;  4F1S A;  1WX7 A;  1H4R A;  1YD8 U;  2C9W B;  2M8S A;  2LAS A;  1A5R A;  1Q1O A;  3CSF A;  2PEA A;  2ZPN A;  2C60 A;  1U4A A;  2JWZ A;  3T8M A;  2KJH B;  2LGD A;  2M1M A;  2B3A A;  1R4M I;  1XD3 B;  4NY0 A;  1WGD A;  2DX5 B;  2MA9 B;  2LJ5 A;  2WDT B;  4RM9 A;  2LRW A;  3KVF B;  3W1S A;  1J8C A;  2BF8 B;  4DWF A;  3ZRC A;  2MBB B;  3APD A;  4IUM B;  4OVU A;  3R7R A;  3EEC A;  3ZO5 B;  4MGY E;  5L83 A;  2KTF A;  4J6I A;  1RRB A;  2PE6 B;  1WJ4 A;  2AL6 A;  2EMT A;  3B0A A;  3IFW B;  2L0F A;  3WAL A;  2EKE C;  2BYE A;  3VH3 B;  2VRR B;  4W9C A;  4NAW B;  1ZGU B;  2KAN A;  2ZVN A;  3V6C B;  3ZRF A;  4ICU A;  3WAO A;  4HDO A;  1TTN A;  3W1Y A;  3KUZ A;  1P3Q U;  4KIK B;  2FCN A;  3VUY A;  4BOS C;  3HIZ A;  4CO7 A;  3ZDT A;  2LUE A;  2J0K A;  4KZC A;  1D3Z A;  1TGZ B;  4GDK A;  4TKN A;  2YLM A;  4K7W A;  2K1F A;  3PLU A;  4BKS A;  2K8C A;  4JGH B;  2L05 A;  2CHW A;  2O2V B;  3WIM A;  1V81 A;  1OGW A;  4FJV B;  4GGQ A;  2RSU A;  1V80 A;  1YIW A;  2O6V A;  3A33 B;  4TV3 A;  2BGF A;  3QK0 A;  5AZF A;  4FJZ A;  4EFO A;  3UQB A;  5G2N A;  2C7H A;  1GC7 A;  2NPT B;  2AL3 A;  1C3T A;  4I6N B;  4DK5 A;  3OJ4 B;  4EOY A;  1X1M A;  4HXD A;  2Y5B B;  3DPD A;  1TZ1 A;  5D7G A;  3UIO B;  2GBN A;  3DVN V;  1WE6 A;  2KTR A;  3M3J A;  3LJ3 A;  1S3S G;  3ZTD A;  3V6E B;  4ZDV A;  3B1L X;  3ML8 A;  3CST A;  4F8C B;  2L0T A;  3DVG Y;  4W9F A;  3DBR I;  2ZZP B;  3DVG X;  2MW5 A;  2NBU A;  4E74 A;  2GBR A;  5G55 A;  2LXA A;  4XX5 A;  4IG7 B;  4BKS D;  1GNU A;  3PVL A;  1WJN A;  4W9H A;  4DDI D;  2CHX A;  3PRE A;  4WJP A;  5AEK B;  1WIA A;  4E3C A;  2O6V D;  3QCA A;  5CX3 A;  3ALB A;  3IVF A;  3NHE B;  2Z0D B;  3ECI A;  3A9J A;  3P2B A;  3ZDM C;  1YX5 B;  2JRH A;  3TJP A;  2IYD B;  4A20 A;  1OTR B;  4M8M A;  2KC2 A;  2M0X A;  1UGM A;  1WX9 A;  3L17 A;  4FLH A;  3L10 B;  4W9G A;  5BO4 B;  2KLG A;  4K81 A;  4DHZ B;  2L3Z A;  4EZK A;  1WXS A;  3M63 B;  4LJP B;  3RCZ A;  4URK A;  3AXC A;  1EO6 A;  1WX8 A;  3PZD A;  3VDZ A;  1UBQ A;  1GUA B; 
#chains in the Genus database with same CATH topology
 5EE9 A;  5J17 A;  1SIJ A;  2OJW A;  2AX5 A;  4WJO A;  3U2S C;  2LWP A;  2BYV E;  2DZJ A;  3AED B;  2D5G A;  1L4D B;  2KKC A;  2FAZ A;  5TR5 A;  4GDK B;  2FUH B;  2JZ3 B;  4JLC A;  1YN3 A;  2LVQ A;  4K7U A;  3PHX B;  2J52 A;  1OQQ A;  1KRH A;  1HTQ A;  2MJE A;  2MX2 A;  2G4D B;  1LFD A;  2VZK B;  4A3O A;  3C8Y A;  5C3J B;  3B08 A;  1VDV A;  2XBB C;  3JYU A;  2WS3 B;  2W9N A;  3SHQ A;  1MI0 A;  4IM3 A;  4BZA A;  2MLB A;  3P4R B;  3VFK A;  4L2Y A;  2JUO A;  2G1E A;  1N63 A;  2K3U A;  2N9P C;  1AAR A;  1JRO A;  1UEL A;  2AEH A;  3HK0 A;  3KUD B;  3KW5 B;  4W9D A;  1L6U A;  3AEC B;  2CJN A;  1E6E B;  5IN7 A;  4HKQ A;  3ABV B;  1C1Y B;  4A90 A;  4AWJ A;  1FIQ A;  4BVU C;  2V4L A;  1RM6 C;  1K50 A;  1KLG D;  2A5U A;  2H89 B;  3VHT C;  1E9M A;  1WI0 A;  3WAN A;  2LEK A;  3C0R B;  1Q5W B;  2JWU A;  2IO1 B;  1I35 A;  5D94 A;  5LNK 1;  4NPN A;  2IGD A;  1GJZ A;  1UWM A;  3SDL C;  5LXI B;  4MH8 A;  2HTM E;  4WUR A;  1HXY D;  2J4X A;  3H9D A;  3L13 A;  2KDF B;  1FXT B;  4LNO A;  4XDD A;  2KMM A;  3PTF C;  3V3X A;  1MG8 A;  4M00 A;  3VR8 B;  1IYF A;  2N0S B;  1EWY C;  4RH6 A;  5IO9 A;  4IM2 A;  3R2I A;  2Z59 B;  1TKG A;  4MEL A;  1J7C A;  2QC8 A;  2WXG A;  2PJH A;  1UNS A;  3T3N A;  4RMA A;  4RNA A;  1FO4 A;  4IKG A;  3ZNG C;  1WRD B;  3EHV A;  3ZNI D;  4IWO A;  2MHJ A;  2JPH A;  1GOZ A;  2NBV B;  3VRB B;  2N9X A;  4PYZ A;  1I4P A;  2JXT A;  2NR2 A;  5EDS A;  3DBL I;  3LXF A;  4B95 A;  1I4R A;  2REX A;  4K7S A;  3D32 A;  3SU8 X;  2MQJ A;  2ZJD A;  2Z8L A;  1C9F A;  1NEN B;  5CTR C;  2NTS A;  4AOF A;  4IDI A;  1EUV B;  1N61 A;  1EF5 A;  2KZR A;  3IAM 1;  3U7D A;  3KUC B;  2W3S A;  4I6L B;  5CHW A;  4HJG E;  2N7J A;  1M4V A;  4MEM A;  2JVC A;  1QOB A;  1N5X A;  3AEG B;  4FHK A;  4AQ7 A;  3EUB 2;  5AZG A;  3ONS A;  4K3C A;  2DYM A;  2N1V A;  3PLV A;  1L7Y A;  3Q6B A;  4TMA B;  4P6V F;  3U8Z A;  1NDD A;  3M62 B;  3GZN B;  2QDF A;  1HEZ E;  1SEB D;  2M17 A;  1ET6 A;  4BAX A;  1SJE D;  2MBE A;  2A4Z A;  3ML9 A;  3LB8 C;  1WXA A;  4A55 A;  3QJZ A;  1PDX A;  3FC4 A;  4P1B C;  3IG3 A;  3A9K B;  2KWC A;  1UZX B;  2JT4 B;  4LNN A;  5EE3 A;  2QSD A;  2BS4 B;  1QF6 A;  2WDV B;  4JPS A;  3W1S C;  1K8R B;  1VJK A;  3AM9 A;  2JF5 A;  1IP9 A;  1OEY J;  2BB5 A;  4RF0 A;  4K1R B;  2RDB C;  3BVZ A;  2EKI A;  1LO5 D;  5DPS A;  1WGR A;  2IY0 B;  3BVG A;  3LYY A;  1E8W A;  3BII D;  4HVB A;  2ZNV B;  4PT5 A;  2HJ8 A;  3APF A;  2K25 A;  3BZD B;  1PGA A;  1UH6 A;  3RD2 A;  5D3I B;  1I7H A;  4C7Y A;  3VTU A;  1RFK A;  1ISN A;  1SJH D;  1P7E A;  4IM0 A;  4N6E B;  3V05 A;  4GMV A;  3R7Q A;  3N32 A;  2LRU A;  4CHK A;  1ZDX A;  1KJT A;  4EEW A;  2GBM A;  2K6Q A;  1E8X A;  2KX0 A;  5AZH A;  3UI3 A;  1J7A A;  2YEP B;  4IC7 B;  3AE3 B;  4NAW A;  4AUQ C;  4NJC A;  4WAF A;  2K6D B;  3ZNZ B;  2WHI A;  2KJ6 A;  1SE2 A;  2NS5 A;  2SEB D;  2G45 B;  4DHZ E;  2VH1 A;  1QOF A;  3Q8F A;  4GB9 A;  4A8X C;  4PS3 A;  2X38 A;  4HCP B;  4OHJ A;  1SB3 C;  3Q14 C;  4LTU A;  4ICV A;  3CF6 E;  4JWS C;  3A4S C;  3PRP B;  1WM3 A;  2I2Y A;  3W5V B;  4KGT A;  1R7S A;  2CJO A;  2NCN A;  5D2M B;  4USA A;  4YSY B;  1HA5 A;  3Q3F A;  1L0X B;  4TQ1 A;  3I9V 1;  1TIF A;  1YD8 U;  1AW7 A;  1XD3 B;  2MA9 B;  2LJ5 A;  3W1S A;  2BF8 B;  3IT4 B;  4OVU A;  4C7Z A;  4EE2 A;  4ZYS A;  5L83 A;  2KTF A;  1D6E C;  4J6I A;  1EWC A;  3VH3 B;  4NAW B;  4RGM A;  2QIL A;  2E3T A;  4ICU A;  1N6Z A;  4OZA A;  2FCN A;  1V97 A;  4YTP B;  4M02 A;  1TGZ B;  4TKN A;  4YSX B;  4JGH B;  4B0E A;  1UF0 A;  4EZJ A;  4GGQ A;  4TV3 A;  1A70 A;  1TY2 A;  4WWM A;  2BGF A;  3QK0 A;  2K0P A;  4EOY A;  1ROE A;  3M3J A;  4ZDV A;  3RFZ B;  1XEE A;  3CST A;  1P7F A;  2L0T A;  2V4I B;  2ZZP B;  2NBU A;  1E0Z A;  2WP9 B;  4E74 A;  5G55 A;  1OFF A;  2LGI A;  3OG5 A;  1VZ8 A;  2CHX A;  3PRE A;  3KWL A;  2OHF A;  1FD6 A;  3B9J A;  2HJ1 A;  1YX5 B;  3AV8 A;  4J3O D;  4M8M A;  2M0X A;  1YJJ A;  4FLH A;  3L10 B;  3WCQ A;  1L6V A;  1TKE A;  4EZK A;  1WXS A;  4LJP B;  1TZO A;  3VRA B;  3PZD A;  4DQO C;  1UBQ A;  5JHA A;  2DNF A;  1HZ6 A;  2K22 A;  2ZCC A;  1XF5 L;  2FBW B;  3AU4 A;  1IGD A;  4PYU A;  4MGI E;  2J0J A;  2BKF A;  2JY6 A;  4DBG A;  4BOZ B;  2DHZ A;  2FID A;  2CS4 A;  3ZVV A;  2WXJ A;  1NI3 A;  3MC0 B;  1WGH A;  4ZYN A;  3RNC C;  3VTW A;  2KWU B;  3DHG C;  4H2A A;  2WU5 B;  4PS7 A;  1KTK A;  4JE3 B;  5DPR A;  4NZL B;  1JQ4 A;  1MG4 A;  2DEN B;  3EFC A;  1JML A;  2K9X A;  2IPK D;  5FK9 C;  3V62 A;  1XT9 B;  3PGE A;  1WXM A;  2RMM A;  1C77 A;  3AE5 B;  3AB5 A;  4RM8 A;  4ZRJ A;  3DBH I;  3MC9 A;  3PSE B;  3TBL D;  3TEZ A;  1Q0W B;  1YQB A;  2MBH A;  2VH2 A;  2N4F A;  2BPS A;  2V3S A;  5FR6 A;  3CMM B;  4GLS C;  1S1Q B;  4NQK E;  4GSW A;  4W9E A;  4IOI E;  1CQV A;  5J18 A;  4YTN B;  3SFE B;  1OQY A;  3GB1 A;  2KDM A;  2Z0E B;  4JQW C;  3BK2 A;  3HHM A;  3TSS A;  4AJY B;  1C79 A;  5FKA C;  3NVV A;  1WFY A;  4NJ7 A;  2PPH A;  4NJ6 A;  2KAC A;  3GE8 C;  1T0R C;  1JRP A;  2KN4 A;  1J19 A;  2R2O A;  3Q2A C;  1WYW B;  3JSV A;  3HM6 X;  3OLM D;  1MPE A;  4AP4 C;  2MP2 A;  3H1U A;  2WXI A;  3ENE A;  2C7M B;  1GB1 A;  3R3M A;  1DYQ A;  4G3X B;  5DPT A;  2BWF A;  3S2A A;  3OJ3 A;  1XLN A;  5KHQ A;  2L8J A;  2WXF A;  4L23 A;  2D3C A;  1KF6 B;  2M4N A;  1EU3 A;  4C00 A;  2GBK A;  3RUL A;  2ASQ A;  1I4X A;  3OAW A;  3I3T B;  1V9J A;  2JYE A;  2IJ0 A;  1VLB A;  2KX3 A;  5I4D A;  3P42 A;  3SD5 A;  1PFD A;  1V5O A;  1CMX B;  1D5X C;  1CZP A;  4HK2 A;  4A9A A;  2HTH A;  3BYT B;  2NMQ A;  2LJI A;  3MHS D;  3AE1 B;  4C4V A;  5AUK A;  1IPG A;  2KWV B;  4XWT A;  3Q3M C;  2LUM A;  1LXD A;  2N7D A;  2ZNV C;  1UWX A;  3KYD D;  3JSV B;  1VRA B;  5G5H A;  2MP2 B;  1E5W A;  2QHO A;  1ZW7 A;  3ZJU A;  2JQR B;  2K39 A;  4G50 A;  2N7E A;  3RZW C;  4KV2 A;  2ZPY A;  1E8Y A;  1WMH A;  3ZTC A;  3NS1 A;  1M94 A;  1DOX A;  2AQ2 B;  2D11 A;  1RFA A;  4II3 B;  2HD5 B;  3RI7 C;  1LQB A;  2D10 A;  4BBN F;  4XC2 A;  3KLS X;  1WGK A;  4A3P A;  4OZC A;  1R4N B;  3MJW A;  2ACZ B;  3TEW A;  1WXV A;  2PVO D;  1C4C A;  3H7S A;  4N59 A;  4RFB A;  3N20 C;  4G0N B;  4LCD E;  2D2Q A;  1PGB A;  3PRZ A;  1ZXI A;  1V1O A;  5CHF A;  2RD0 A;  1HE8 A;  1KLV A;  4HLE A;  2L1A A;  4HJK A;  2UYZ B;  1TS2 A;  3H8H A;  2QJL A;  4LDT D;  2WXQ A;  3R2T A;  4W9J A;  4C4V B;  4NAM A;  2KFJ A;  3CIR B;  3L0W B;  3BWU D;  2L76 A;  2WLB A;  4IW0 A;  1NYQ A;  4KVG B;  3K9P B;  4S0R A;  1GG3 A;  1GB4 A;  1FPY A;  2FCQ A;  4Q2J A;  3ZKJ C;  1WZ3 A;  3RN9 C;  1FXI A;  3ZNH B;  3ZJT A;  2KDB A;  4HPP A;  3B2F A;  3IXS A;  1N60 A;  1WMH B;  3ZW3 A;  1KOT A;  2G4S A;  4JIO U;  4WAA A;  3UF8 A;  3A9K A;  2RR9 A;  2V1Y A;  3NRZ A;  4HEA 1;  1PGX A;  1XQQ A;  5TSS A;  4XZ4 A;  3ZXV A;  1F9J A;  1Z2M A;  4LDT B;  4MM3 A;  2IO0 B;  1VD2 A;  3QHT A;  3VH4 B;  2IZV B;  1UBI A;  1CJE A;  1BML C;  1EU4 A;  5HFY A;  4MGZ E;  2WWZ A;  1SBB B;  2MSE D;  3I5J C;  3Q8C A;  1V6E A;  3N9Y C;  3ZUN A;  3EGR A;  2IDY A;  2BQQ A;  2DZK A;  3BIN A;  4KIK A;  3UIN B;  3VUX A;  5BYR A;  4AS1 A;  2BKR B;  3I63 C;  1KFY B;  1QQR A;  4OVV A;  3HVD A;  2KVR A;  2DLB A;  2ONQ A;  1JAL A;  3V61 A;  3C19 A;  2NPT A;  3Q69 A;  2BWE S;  4P7I A;  3PV1 A;  3IAS 1;  2DZI A;  1VZ7 A;  3NVY A;  5MPO A;  3U30 A;  3L08 A;  3PZ8 A;  1YOV B;  4LNI A;  4B0M A;  1N62 A;  4LJO B;  1WX7 A;  1A5R A;  1HQR D;  1JWS D;  3MJ5 A;  5EE0 A;  5BMI A;  2B3A A;  2LFI A;  1WGD A;  4RM9 A;  4MM3 B;  1YQ4 B;  3APD A;  3R7R A;  4ARI A;  3ZGZ A;  4MGY E;  1WJ4 A;  2AL6 A;  4OZB A;  2VRR B;  1ZGU B;  3U4E G;  1R4M B;  3WAO A;  2BT6 A;  3KUZ A;  4KIK B;  4BOS C;  2V3P A;  3HIZ A;  3NVZ A;  4CO7 A;  4KZC A;  2K1F A;  2L05 A;  4WIP A;  1V81 A;  1OGW A;  2O6V A;  3A33 B;  2TSS A;  5AZF A;  3UQB A;  5G2N A;  2NPT B;  2QEJ C;  3BYY B;  5E6J A;  4DK5 A;  3OJ4 B;  1DOI A;  3CWI A;  3NUH B;  1S3S G;  3V6E B;  4MAC A;  4KGR A;  1PYW D;  2MW5 A;  3GP7 A;  2WQY B;  1K53 A;  1D5Z C;  1GNU A;  4W9H A;  4WJP A;  2O6V D;  2I38 A;  5CX3 A;  1T0Q C;  2Z0D B;  3ECI A;  3P2B A;  1QT9 A;  3TJP A;  3N1Z C;  4A20 A;  1OTR B;  2KC2 A;  2KQ4 X;  2IGH A;  2DWQ A;  3DBR B;  1QLB B;  2L3Z A;  4DHZ B;  3M63 B;  3AXC A;  1EO6 A;  1WX8 A;  3DOW A;  3WAM A;  2WXL A;  2KDE B;  1T0Y A;  1WE7 A;  1WWT A;  3AI5 A;  4FUL A;  4S17 A;  4EZL A;  1GC6 A;  2AYO B;  2KD0 A;  3MHZ A;  4XDC A;  4LNK A;  2UWQ A;  2X8X X;  3KH0 A;  4MJS A;  3OWE B;  4I6P A;  4ZRK A;  2O6V B;  1WSP A;  1NI2 A;  3RPF C;  1YX6 B;  1AN8 A;  3EFU A;  3NZS A;  4ITK A;  1TKY A;  3R66 C;  4HDQ A;  1GPX A;  2XK5 A;  1TS5 A;  3PT2 B;  3W5U B;  3EA6 A;  4BBN C;  2V9H A;  1B9R A;  2RDG A;  2DBY A;  4DDG D;  3AE4 B;  2KHW B;  2IGG A;  3MTN B;  2LHD A;  4O1N A;  4PS8 A;  1E10 A;  4YXD B;  1H8C A;  4OVZ A;  1JWB D;  2PE9 A;  3N1X C;  1WJ6 A;  1YJ1 A;  1STE A;  2EEL A;  3IBE A;  4CQN A;  2LHE A;  1OQR A;  1WGY A;  5D6J B;  2J42 A;  3AMZ A;  4FXC A;  1IBX A;  4BKT A;  2C5L C;  4MJS B;  2XN9 C;  3IHP C;  5BMH A;  3ETR A;  1FCC C;  2JXX A;  4BFR A;  3M95 A;  3QA8 A;  1P9D U;  3PRM B;  5J2R A;  4REZ A;  2DZM A;  1JW9 D;  2KMA A;  4K3B A;  5HHD G;  4M8N A;  2XK5 B;  1T0S C;  2ICI A;  2INC C;  1RYJ A;  5GMV A;  1NEK B;  1NBF C;  1WR1 A;  1VR9 A;  1FCL A;  1WR6 E;  1T6B X;  3VUW A;  3RNB C;  1KM7 A;  2JSV X;  4FA6 A;  1WZ0 A;  2DAJ A;  4YL8 A;  4GIV A;  5C23 A;  4WWN A;  3RT3 B;  1KH0 A;  4XWW A;  4EKU A;  2BYT A;  2LI5 A;  3JW0 X;  3HVZ A;  2K5P A;  2LVO A;  3PPA A;  2CR5 A;  1SSN A;  3GOE A;  1E7V A;  1NYR A;  3AU5 A;  2H88 B;  4ANW A;  5IAA C;  1ZKH A;  2KNB A;  2KN5 A;  1FFU A;  5BYS A;  5C1Z A;  3PHW B;  4HCN B;  3ZLZ A;  3E56 A;  2BVC A;  3QWZ B;  1F2R C;  1PQS A;  2CHZ A;  1E7U A;  4KX6 B;  4GN1 A;  2MH7 A;  3TMP B;  1FM0 D;  3H7P A;  3GZN I;  1WJU A;  3AEA B;  1XLO A;  1N5W A;  2ZEQ A;  3DBL B;  4IWP A;  3TEX A;  3PS6 A;  4HRO A;  1IBX B;  2IY1 B;  4FHJ A;  2QMT A;  5H8Y E;  1E8Z A;  1SXT A;  2ZW1 A;  4GXB A;  5E6P A;  1ET9 A;  2E6X A;  3VTV A;  2K8B A;  3VQI A;  4MT5 A;  3L4P A;  5G5G A;  2R2Q A;  2IO2 B;  2WU2 B;  1C76 A;  1V5T A;  1J0G A;  1V1P A;  4OW0 A;  2KMC A;  1TY0 A;  4JWU C;  5LLI A;  4LK0 M;  2GBJ A;  2V0G A;  1ZE3 D;  2MBO A;  3J9C A;  1TYG B;  2KVZ A;  3RNE C;  1WH3 A;  3QQ8 B;  1ZXH A;  4TQ0 A;  2MWS B;  2JU6 X;  4HWI B;  1OEY A;  1ESF A;  5HKH A;  2ZCB A;  1FNV A;  2KC1 A;  3V60 A;  3E9S A;  3TIX A;  3BK1 A;  2PKO A;  1SE4 A;  1K51 A;  2FNJ B;  2KXJ A;  2MBQ A;  3DWG C;  1JWM D;  1P98 A;  3NOB A;  2LZ6 A;  4US8 A;  2KFK A;  3RZF A;  1UD7 A;  3O13 A;  5JH5 C;  1ZP0 B;  3H7P B;  4DHJ D;  2CU3 A;  2PW9 A;  2RPV A;  1V86 A;  4DXF A;  2XEW A;  2OJR A;  3EC8 A;  1RLF A;  4L1B A;  2RPQ A;  1D4B A;  4M01 A;  2K8H A;  1FRD A;  3A4R A;  4RF1 A;  4RGN A;  3URY A;  1V1P B;  1MHH E;  4HPM B;  2KQ7 A;  3ZQ4 A;  5IA7 A;  1UGJ A;  4B9K A;  3QAR A;  2IO3 B;  1KLU D;  1F1H A;  1XO3 A;  2NTT A;  2WNM A;  2INN E;  1E90 A;  2VZK D;  4DHJ B;  2HE7 A;  2WXR A;  2Y5C A;  3DQV A;  3NZU A;  1WM2 A;  1JCK B;  1YQ3 B;  4ZRI A;  1FRR A;  2PIA A;  4ANU A;  1T3Q A;  4DXA B;  4TUU A;  5BYQ A;  2W55 A;  1XCQ L;  2DYO A;  4MDK E;  2KFK B;  1AYF A;  2LGY A;  3FAH A;  3NS8 A;  4RGO S;  2O2V A;  3AUL A;  3JVZ X;  2QCZ A;  4E71 A;  2ZVO A;  1SGH A;  3VVW B;  4FAD A;  4WWO A;  2GRI A;  2KJR A;  4PK1 A;  1C4P A;  1ENF A;  3B2G A;  3AE2 B;  3QX1 A;  3N1Y C;  2WGS A;  1YMH E;  1F52 A;  2D3G A;  4F1S A;  2C9W B;  2M8S A;  3MFG A;  4N58 A;  2PEA A;  2ZPN A;  2C60 A;  2FE8 A;  3AN1 A;  2JWZ A;  1JWA D;  3T8M A;  2LGD A;  3T3O A;  3VR9 B;  3AEF B;  2JYT A;  1MVK A;  3KQ4 A;  1BUI C;  3KVF B;  3RNA C;  1HTO A;  2HDE A;  3ZRC A;  1FMA D;  1ZDV A;  5AUI A;  4IUM B;  2QIE B;  2V3N A;  3EEC A;  3ZO5 B;  1DGJ A;  4ZRQ A;  2BS3 B;  1RRB A;  3B0A A;  2EMT A;  5H92 C;  2Q5W D;  3WAL A;  3AE8 B;  2BYE A;  4W9C A;  2KAN A;  1C78 A;  3V6C B;  3NG0 A;  4HDO A;  3W1Y A;  3VUY A;  2OED A;  4BKS A;  4KKI A;  2O2V B;  2WXN A;  4FJV B;  2RSU A;  1V80 A;  1MJD A;  4FJZ A;  3AE9 B;  1Y56 A;  1JWU D;  3AEE B;  4I6N B;  1F77 A;  2WXP A;  1X1M A;  5D7G A;  2Y5B B;  3UIO B;  4ZRP A;  1WE6 A;  2KTR A;  3LJ3 A;  3ZTD A;  2ON8 A;  3B1L X;  1RWS A;  1K52 A;  1TT5 B;  4W9F A;  2L83 A;  2G9H D;  3DVG X;  4DXG A;  2W82 A;  2LMC A;  4BKS D;  3PVL A;  1WJN A;  4DDI D;  3IT6 B;  4ZHP A;  1WIA A;  3NVW A;  3QCA A;  3ALB A;  3IVF A;  3A9J A;  2IYD B;  3L17 A;  4P16 A;  2JX5 A;  2D3B A;  2MJD A;  2UU7 A;  4W9G A;  5BO4 B;  2IND C;  2KLG A;  4K81 A;  3P4Q B;  4ZOH C;  3VDZ A;  1GUA B;  4RGT A;  2KLC A;  4FJY A;  1SIF A;  3Q3O C;  4AJW A;  2PLP A;  3N3K B;  3BVM A;  1TBE A;  2SAK A;  4HPL B;  5HG2 A;  2MRP A;  3N30 A;  3A1Q A;  3AE6 B;  2I1J A;  2CU1 A;  2EMS A;  2W54 A;  1TS4 A;  3W2D A;  3NJT A;  1AWD A;  4WJN A;  1PUT A;  5HI1 A;  2KO3 A;  3TL5 A;  2JZZ A;  1IUE A;  4B6W A;  1LGR A;  3SFD B;  4KDL B;  2KTR B;  4JL9 A;  4KSL C;  3ZYY X;  2PVG C;  1BT0 A;  2FUG 1;  3PZ7 A;  3W9C B;  1V49 A;  1V2Y A;  3P4S B;  3SEB A;  1G6J A;  2C7N B;  2W3R A;  3P4P B;  4ZHO A;  1RAX A;  4MH0 E;  2LXC A;  3A9J B;  2WXK A;  3X0W A;  2LGX A;  4ARC A;  4XYC A;  4NNJ B;  3R8B A;  2L52 A;  1F0Z A;  1XCT L;  4W9I A;  4X57 B;  3U7Z A;  3UQA A;  4KZ0 A;  3DBH B;  5BMG A;  2D3A A;  3TCA A;  1FFV A;  4YSZ B;  3RYT A;  4NQL B;  1WGG A;  2KK8 A;  5FR3 A;  4UDU C;  3DBS A;  3L54 A;  4MSQ B;  1XLP A;  1B1Z A;  4KKJ A;  2ZW0 A;  4ACF A;  3A1Q B;  2WX0 A;  5L95 C;  4EUT A;  3DVN U;  4BKG A;  2M0A A;  1QIL A;  4XE0 A;  2KQS A;  3VXW A;  4MSM B;  3DHH C;  1TJE A;  4CYE A;  3MC8 A;  3TUO A;  1QZE A;  4WWP A;  3ZJV A;  3AH7 A;  4D2K A;  4LNF A;  2N9K A;  2L00 B;  4FN2 A;  2DAF A;  5D3D A;  3MP9 A;  3FIL A;  2G3Q B;  3QAQ A;  3ZXR A;  2I1K A;  2DYB A;  1YN4 A;  5JZE B;  4G11 A;  1BXT A;  1T5X D;  1Z5S B;  3P63 A;  1V8C A;  1SE3 A;  1L0Y B;  1SF0 A;  3Q8B A;  2KOX A;  1MHX A;  3KYC D;  2FIF A;  2M19 A;  1ZUD 2;  1EM7 A;  2N1W A;  4W9L A;  1JRU A;  3U52 E;  3SR6 A;  4C56 C;  4MGK E;  5E6O A;  3RNG C;  2LGS A;  3HM3 A;  2WDQ B;  4IWQ A;  3LDZ E;  2GB1 A;  3NY5 A;  2MCN B;  3L16 A;  4ANX A;  3K9O B;  3QIJ A;  1ZOY B;  1P1A A;  4RCO A;  4ANV A;  2WXH A;  1L4Z B;  5IP4 D;  3VAW A;  5IKC M;  4P1C C;  2WX1 A;  2CKH B;  4XGA B;  4TSS A;  1NVI D;  1WF9 A;  3QC8 B;  1YJI A;  4WH4 A;  3H6N A;  1L2N A;  3FIL B;  1R4N I;  3T9L A;  1Y8R C;  5IOI A;  2Y3A A;  2YVC A;  3WAP A;  3APC A;  2RGF A;  1UUP A;  2MJ3 A;  1F2R I;  1FNU A;  2LVP A;  1LM8 B;  2N9E B;  2M56 B;  1I42 A;  3BY4 B;  2KYW A;  1FEH A;  1P0R A;  3FKY A;  2GLS A;  4YWG G;  2BYF A;  4KDI C;  2J53 A;  2BW2 A;  2BS2 B;  5JXV A;  1WY8 A;  5DCN A;  2D07 B;  1IGC A;  2KDI A;  3RMK C;  2GMI C;  4II2 B;  1FXA A;  2YEP F;  5JHB A;  2AQ3 B;  2MEK A;  2OOB B;  2BTE A;  3GE3 C;  1WYG A;  4WQO B;  2BBC A;  3UIP B;  2JZP A;  1DOY A;  3I57 A;  2L7R A;  2INP E;  4M0W A;  2WXO A;  1XXG A;  4ASW C;  2WYQ A;  4LLG M;  4GDL A;  4YT0 B;  3O65 B;  5C2T B;  4KGS A;  1TS3 A;  1ZPS A;  3DCG A;  3NZ3 A;  5DPW A;  2LD9 A;  1GAQ B;  1I4H A;  4N9F 4;  3UGB B;  3RUI B;  2WDR B;  1YNT E;  2FCM A;  1QKZ A;  2GOW A;  1XLQ A;  3PO0 A;  3AEB B;  1L0V B;  1D5M C;  2AWT A;  2IBI B;  5GXG B;  3ZIM A;  2FCS A;  1YN5 A;  3Q3J A;  3Q3N C;  1WRI A;  5CHV C;  4W9K A;  4KSK C;  2B76 B;  3HRD D;  5LXH A;  4A6Q A;  4F7Z A;  2J0M A;  4GOC A;  3WA0 A;  3GS2 A;  2JRI B;  2NBW B;  1E7P B;  2BB6 A;  2KAJ A;  3X23 A;  4FBJ B;  3RNF C;  4GU2 A;  4M0W B;  2J7Q B;  5KHO A;  4HKZ E;  1MFW A;  2NVU I;  1SE9 A;  4GDL B;  5E6N A;  4QAY A;  1EF1 A;  1VCB A;  5EE1 A;  2KWD A;  4JX1 C;  3DDC B;  1H4R A;  3AE7 B;  2LAS A;  1Q1O A;  3CSF A;  1U4A A;  3HUI A;  1HZ5 A;  2KJH B;  2M1M A;  1Q10 A;  1R4M I;  4NY0 A;  2DX5 B;  2WDT B;  3P1M A;  2LRW A;  1J8C A;  4DWF A;  1QOA A;  2MBB B;  3TEY A;  2PE6 B;  3IFW B;  2L0F A;  2EKE C;  1J7B A;  2ZVN A;  3ZRF A;  3DHI C;  1TTN A;  1P3Q U;  3ZDT A;  1ACC A;  2LUE A;  2J0K A;  4C80 A;  2PMV A;  3DWM A;  1D3Z A;  4GDK A;  2YLM A;  4K7W A;  3PLU A;  2KT7 A;  2K8C A;  1FNW A;  2CHW A;  3WIM A;  4US9 A;  2GI9 A;  5T8I A;  1YIW A;  3Q8E A;  3KWV A;  1QOG A;  4YTM B;  2WXM A;  4EFO A;  2R61 A;  1I4Q A;  2C7H A;  1GC7 A;  2AL3 A;  1C3T A;  4R3D A;  4HXD A;  3DPD A;  1TZ1 A;  2GBN A;  3DVN V;  2L32 A;  2Y5P A;  3ML8 A;  1CK1 A;  4F8C B;  3DVG Y;  3DBR I;  1VZ6 A;  1I4G A;  2GBR A;  2LXA A;  4XX5 A;  4IG7 B;  4HRS A;  1WXQ A;  5AEK B;  4WQM A;  4E3C A;  1L5P A;  3NHE B;  3ZDM C;  2JRH A;  1C4A A;  1UGM A;  1WX9 A;  2RDH A;  2PTL A;  3Q8A A;  2N9L A;  3RCZ A;  2XNA C;  4URK A;  2AQ1 B;  4WJQ A; 
#chains in the Genus database with same CATH homology
 3DOW A;  5JHA A;  2KLC A;  5J17 A;  2ZCC A;  3WAM A;  4FJY A;  4WJO A;  1SIF A;  2KDE B;  2LWP A;  1T0Y A;  3AU4 A;  4AJW A;  4PYU A;  4MGI E;  2J0J A;  2BKF A;  2BYV E;  3N3K B;  2JY6 A;  2DZJ A;  4DBG A;  1TBE A;  1WE7 A;  3AI5 A;  4EZL A;  4FUL A;  4BOZ B;  2DHZ A;  2KKC A;  1GC6 A;  2FID A;  2AYO B;  2FAZ A;  4HPL B;  2MRP A;  2KD0 A;  3N30 A;  5TR5 A;  4GDK B;  2FUH B;  2JZ3 B;  4JLC A;  2UWQ A;  3A1Q A;  2LVQ A;  4K7U A;  2I1J A;  3PHX B;  2CU1 A;  2EMS A;  3KH0 A;  2CS4 A;  4MJS A;  3ZVV A;  4I6P A;  4ZRK A;  2O6V B;  2MX2 A;  1NI2 A;  4WJN A;  2G4D B;  1WGH A;  4ZYN A;  1LFD A;  1YX6 B;  4A3O A;  2KO3 A;  3TL5 A;  3VTW A;  2KWU B;  4PS7 A;  3B08 A;  3EFU A;  2JZZ A;  3NZS A;  5DPR A;  2XBB C;  3JYU A;  4B6W A;  3R66 C;  2DEN B;  2KTR B;  4HDQ A;  4JL9 A;  4KDL B;  4KSL C;  2XK5 A;  3PT2 B;  3V62 A;  2W9N A;  3SHQ A;  1BT0 A;  1XT9 B;  3PGE A;  4IM3 A;  2MLB A;  3VFK A;  1V49 A;  2JUO A;  1WXM A;  4BBN C;  1V2Y A;  1G6J A;  4RM8 A;  2C7N B;  4ZRJ A;  3DBH I;  2N9P C;  3PSE B;  1RAX A;  4MH0 E;  1AAR A;  3TBL D;  2LXC A;  1UEL A;  2AEH A;  3A9J B;  1Q0W B;  4DDG D;  1YQB A;  3HK0 A;  2KHW B;  3X0W A;  3KUD B;  3KW5 B;  2LGX A;  2MBH A;  3MTN B;  4W9D A;  2N4F A;  2BPS A;  2V3S A;  5FR6 A;  3CMM B;  1S1Q B;  4NNJ B;  4NQK E;  4GSW A;  4W9E A;  4PS8 A;  4W9I A;  4X57 B;  3UQA A;  4KZ0 A;  1H8C A;  1C1Y B;  5J18 A;  1OQY A;  4AWJ A;  3TCA A;  4BVU C;  3RYT A;  4NQL B;  2PE9 A;  2Z0E B;  4JQW C;  2V4L A;  1WJ6 A;  1WGG A;  1YJ1 A;  2A5U A;  2KK8 A;  3IBE A;  3HHM A;  3VHT C;  1WI0 A;  3DBS A;  3WAN A;  3L54 A;  4MSQ B;  3C0R B;  1Q5W B;  4AJY B;  1WGY A;  2IO1 B;  5D6J B;  5D94 A;  1I35 A;  3A1Q B;  4BKT A;  2WX0 A;  5L95 C;  2C5L C;  4EUT A;  1WFY A;  4NJ7 A;  3DVN U;  4MJS B;  2PPH A;  4NPN A;  4NJ6 A;  4BKG A;  1GJZ A;  3IHP C;  3SDL C;  5LXI B;  1J19 A;  2KQS A;  2R2O A;  3VXW A;  1WYW B;  3JSV A;  3HM6 X;  2JXX A;  4BFR A;  4MSM B;  3M95 A;  3OLM D;  4AP4 C;  3QA8 A;  1P9D U;  2MP2 A;  3H9D A;  4CYE A;  3L13 A;  2KDF B;  3PRM B;  4WJQ A;  2DZM A;  3H1U A;  5J2R A;  1QZE A;  1FXT B;  2KMA A;  4WWP A;  3ENE A;  2C7M B;  4M8N A;  3R3M A;  2XK5 B;  3PTF C;  1MG8 A;  4G3X B;  5GMV A;  1IYF A;  2L00 B;  4FN2 A;  1NBF C;  2DAF A;  1WR1 A;  5DPT A;  1WR6 E;  2BWF A;  3S2A A;  3OJ3 A;  3VUW A;  2G3Q B;  3QAQ A;  4IM2 A;  2Z59 B;  1KM7 A;  2I1K A;  5KHQ A;  2L8J A;  4MEL A;  4FA6 A;  1WZ0 A;  2DAJ A;  2PJH A;  4YL8 A;  4RMA A;  2DYB A;  4GIV A;  5C23 A;  5JZE B;  4G11 A;  4WWN A;  3RT3 B;  1Z5S B;  3ZNG C;  2LI5 A;  1WRD B;  4EKU A;  3EHV A;  3JW0 X;  3ZNI D;  4IWO A;  2M4N A;  2LVO A;  2JPH A;  3PPA A;  2CR5 A;  3GOE A;  1E7V A;  2GBK A;  2NBV B;  3RUL A;  2ASQ A;  2N9X A;  3AU5 A;  4PYZ A;  4ANW A;  5IAA C;  1ZKH A;  2KNB A;  2KN5 A;  2NR2 A;  5EDS A;  3OAW A;  2KOX A;  3I3T B;  1V9J A;  3DBL I;  3KYC D;  5C1Z A;  4B95 A;  2KX3 A;  2REX A;  2FIF A;  3PHW B;  4HCN B;  3ZLZ A;  4K7S A;  3D32 A;  3SD5 A;  3SU8 X;  2N1W A;  2MQJ A;  4W9L A;  1JRU A;  2ZJD A;  3QWZ B;  1PQS A;  4MGK E;  5E6O A;  2CHZ A;  1V5O A;  1E7U A;  3HM3 A;  1CMX B;  5CTR C;  4IWQ A;  4AOF A;  3LDZ E;  4HK2 A;  1EUV B;  2HTH A;  4GN1 A;  1EF5 A;  2KZR A;  3U7D A;  3TMP B;  3H7P A;  3GZN I;  3KUC B;  3MHS D;  3NY5 A;  2MCN B;  1WJU A;  3L16 A;  2ZEQ A;  4I6L B;  3K9O B;  3PS6 A;  4IWP A;  5CHW A;  4ANX A;  4MEM A;  2JVC A;  2IY1 B;  3QIJ A;  1P1A A;  1IPG A;  4FHK A;  4FHJ A;  2KWV B;  5AZG A;  3ONS A;  1E8Z A;  1LXD A;  2N7D A;  2ZNV C;  4ANV A;  2DYM A;  2N1V A;  3KYD D;  3JSV B;  3VAW A;  3PLV A;  1L7Y A;  4GXB A;  2MP2 B;  5E6P A;  1E5W A;  2WX1 A;  2QHO A;  3U8Z A;  1ZW7 A;  1NDD A;  2K8B A;  3M62 B;  3VQI A;  3VTV A;  2CKH B;  2K39 A;  4G50 A;  2N7E A;  3RZW C;  4KV2 A;  1WF9 A;  2M17 A;  3QC8 B;  2R2Q A;  2IO2 B;  3H6N A;  1L2N A;  2ZPY A;  1V5T A;  1E8Y A;  1R4N I;  1WMH A;  3ZTC A;  1J0G A;  3T9L A;  1Y8R C;  1M94 A;  2YVC A;  2KMC A;  3WAP A;  3APC A;  2MBE A;  2RGF A;  2A4Z A;  2D11 A;  3ML9 A;  1RFA A;  1WXA A;  4II3 B;  2HD5 B;  5LLI A;  1LQB A;  3QJZ A;  2D10 A;  4BBN F;  2GBJ A;  2LVP A;  1LM8 B;  2N9E B;  3IG3 A;  1I42 A;  3BY4 B;  4XC2 A;  2MBO A;  4A3P A;  1P0R A;  3A9K B;  2KWC A;  1UZX B;  2JT4 B;  3MJW A;  1WH3 A;  3QQ8 B;  4TQ0 A;  2MWS B;  4HWI B;  1OEY A;  1WXV A;  3H7S A;  3W1S C;  5HKH A;  2ZCB A;  4G0N B;  1K8R B;  2KC1 A;  4LCD E;  3V60 A;  2D2Q A;  3TIX A;  2BYF A;  4KDI C;  2JF5 A;  2FNJ B;  3PRZ A;  1IP9 A;  5CHF A;  2KXJ A;  1OEY J;  2MBQ A;  1P98 A;  3NOB A;  1WY8 A;  5DCN A;  2LZ6 A;  2D07 B;  2RD0 A;  2KFK A;  3RZF A;  1HE8 A;  1UD7 A;  2KDI A;  2GMI C;  1KLV A;  4K1R B;  4HLE A;  4II2 B;  5JH5 C;  4HJK A;  2UYZ B;  3H7P B;  4LDT D;  4DHJ D;  5JHB A;  5DPS A;  2OOB B;  4W9J A;  1WGR A;  2IY0 B;  4WQO B;  3UIP B;  1E8W A;  4HVB A;  1V86 A;  2KFJ A;  2ZNV B;  3L0W B;  2HJ8 A;  3APF A;  2L76 A;  4IW0 A;  2K25 A;  4KVG B;  2L7R A;  3K9P B;  1UH6 A;  2XEW A;  1GG3 A;  2OJR A;  3RD2 A;  2FCQ A;  3EC8 A;  1RLF A;  3ZKJ C;  2RPQ A;  4ASW C;  1WZ3 A;  2WYQ A;  2K8H A;  3ZNH B;  3VTU A;  4GDL A;  2KDB A;  1ISN A;  3O65 B;  3A4R A;  1WMH B;  4IM0 A;  3ZW3 A;  4HPM B;  2KQ7 A;  1KOT A;  2G4S A;  3DCG A;  5IA7 A;  5DPW A;  4JIO U;  4WAA A;  3UF8 A;  4GMV A;  3A9K A;  3R7Q A;  4B9K A;  3QAR A;  2IO3 B;  2LD9 A;  3N32 A;  2RR9 A;  2V1Y A;  4N9F 4;  3UGB B;  3RUI B;  2LRU A;  4CHK A;  1KJT A;  1E90 A;  1XQQ A;  4XZ4 A;  1F9J A;  1Z2M A;  4LDT B;  4MM3 A;  4DHJ B;  2IO0 B;  2HE7 A;  1VD2 A;  2GBM A;  2K6Q A;  3QHT A;  3VH4 B;  4EEW A;  1E8X A;  2KX0 A;  2IZV B;  5AZH A;  1UBI A;  3DQV A;  3NZU A;  2FCM A;  1WM2 A;  4IC7 B;  4NAW A;  4AUQ C;  4MGZ E;  4ZRI A;  2WWZ A;  2K6D B;  2MSE D;  3ZNZ B;  2KJ6 A;  1V6E A;  2GOW A;  4ANU A;  2NS5 A;  4DXA B;  3ZUN A;  3BIN A;  2DZK A;  4TUU A;  3VUX A;  4KIK A;  3UIN B;  2G45 B;  2BKR B;  4DHZ E;  2IBI B;  2AWT A;  3ZIM A;  4EZJ A;  2FCS A;  2DYO A;  4MDK E;  2KFK B;  3Q3J A;  2LGY A;  3NS8 A;  2O2V A;  4GB9 A;  5CHV C;  3AUL A;  4OVV A;  4W9K A;  4KSK C;  2KVR A;  3JVZ X;  5LXH A;  4F7Z A;  2J0M A;  4PS3 A;  4GOC A;  4HCP B;  3V61 A;  4E71 A;  2ZVO A;  3WA0 A;  2NPT A;  1SGH A;  4P7I A;  2BWE S;  2JRI B;  2NBW B;  3VVW B;  3PV1 A;  3CF6 E;  4ICV A;  4FAD A;  2DZI A;  3A4S C;  4WWO A;  3X23 A;  4FBJ B;  4GU2 A;  2KJR A;  4M0W B;  2J7Q B;  3PRP B;  5KHO A;  1WM3 A;  2NVU I;  1SE9 A;  2NCN A;  4GDL B;  5E6N A;  3L08 A;  3U30 A;  1EF1 A;  5D2M B;  3QX1 A;  1VCB A;  3DDC B;  3Q3F A;  4LJO B;  4TQ1 A;  2D3G A;  4F1S A;  1WX7 A;  1H4R A;  1YD8 U;  2C9W B;  2M8S A;  2LAS A;  1A5R A;  1Q1O A;  3CSF A;  2PEA A;  2ZPN A;  2C60 A;  1U4A A;  2JWZ A;  3T8M A;  2KJH B;  2LGD A;  2M1M A;  2B3A A;  1R4M I;  1XD3 B;  4NY0 A;  1WGD A;  2DX5 B;  2MA9 B;  2LJ5 A;  2WDT B;  4RM9 A;  2LRW A;  3KVF B;  3W1S A;  1J8C A;  2BF8 B;  4DWF A;  3ZRC A;  2MBB B;  3APD A;  4IUM B;  4OVU A;  3R7R A;  3EEC A;  3ZO5 B;  4MGY E;  5L83 A;  2KTF A;  4J6I A;  1RRB A;  2PE6 B;  1WJ4 A;  2AL6 A;  2EMT A;  3B0A A;  3IFW B;  2L0F A;  3WAL A;  2EKE C;  2BYE A;  3VH3 B;  2VRR B;  4W9C A;  4NAW B;  1ZGU B;  2KAN A;  2ZVN A;  3V6C B;  3ZRF A;  4ICU A;  3WAO A;  4HDO A;  1TTN A;  3W1Y A;  3KUZ A;  1P3Q U;  4KIK B;  2FCN A;  3VUY A;  4BOS C;  3HIZ A;  4CO7 A;  3ZDT A;  2LUE A;  2J0K A;  4KZC A;  1D3Z A;  1TGZ B;  4GDK A;  4TKN A;  2YLM A;  4K7W A;  2K1F A;  3PLU A;  4BKS A;  2K8C A;  4JGH B;  2L05 A;  2CHW A;  2O2V B;  3WIM A;  1V81 A;  1OGW A;  4FJV B;  4GGQ A;  2RSU A;  1V80 A;  1YIW A;  2O6V A;  3A33 B;  4TV3 A;  2BGF A;  3QK0 A;  5AZF A;  4FJZ A;  4EFO A;  3UQB A;  5G2N A;  2C7H A;  1GC7 A;  2NPT B;  2AL3 A;  1C3T A;  4I6N B;  4DK5 A;  3OJ4 B;  4EOY A;  1X1M A;  4HXD A;  2Y5B B;  3DPD A;  1TZ1 A;  5D7G A;  3UIO B;  2GBN A;  3DVN V;  1WE6 A;  2KTR A;  3M3J A;  3LJ3 A;  1S3S G;  3ZTD A;  3V6E B;  4ZDV A;  3B1L X;  3ML8 A;  3CST A;  4F8C B;  2L0T A;  3DVG Y;  4W9F A;  3DBR I;  2ZZP B;  3DVG X;  2MW5 A;  2NBU A;  4E74 A;  2GBR A;  5G55 A;  2LXA A;  4XX5 A;  4IG7 B;  4BKS D;  1GNU A;  3PVL A;  1WJN A;  4W9H A;  4DDI D;  2CHX A;  3PRE A;  4WJP A;  5AEK B;  1WIA A;  4E3C A;  2O6V D;  3QCA A;  5CX3 A;  3ALB A;  3IVF A;  3NHE B;  2Z0D B;  3ECI A;  3A9J A;  3P2B A;  3ZDM C;  1YX5 B;  2JRH A;  3TJP A;  2IYD B;  4A20 A;  1OTR B;  4M8M A;  2KC2 A;  2M0X A;  1UGM A;  1WX9 A;  3L17 A;  4FLH A;  3L10 B;  4W9G A;  5BO4 B;  2KLG A;  4K81 A;  4DHZ B;  2L3Z A;  4EZK A;  1WXS A;  3M63 B;  4LJP B;  3RCZ A;  4URK A;  3AXC A;  1EO6 A;  1WX8 A;  3PZD A;  3VDZ A;  1UBQ A;  1GUA B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...