1OGWA

Synthetic ubiquitin with fluoro-leu at 50 and 67
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
76
structure length
74
Chain Sequence
MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQEDGRTLSDYNIQKESTHLVLRLRGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Synthesis, Structural and Biological Studies of Ubiquitin Mutants Containing (2S, 4S)-5-Fluoroleucine Residues Strategically Placed in the Hydrophobic Core
pubmed doi rcsb
molecule tags Cell cycle
molecule keywords UBIQUITIN
total genus 19
structure length 74
sequence length 76
ec nomenclature
pdb deposition date 2003-05-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00240 ubiquitin Ubiquitin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 1ogwA00
2G3QB 5DPWA 1RAXA 3LDZE 3ZDTA 3QWZB 2FCMA 3V62A 3ZVVA 4MJSA 3KH0A 4IM0A 4KV2A 4NJ6A 1HE8A 2JWZA 4EZJA 2DYMA 2GOWA 2KJHB 4MM3A 4JLCA 2KJ6A 2K8CA 2R2QA 2C9WB 4MGKE 3L0WB 4GOCA 2XBBC 4PYUA 3W1YA 1FXTB 2LGXA 3CSFA 1RRBA 3EC8A 1XT9B 3M63B 1WMHB 2AEHA 1VD2A 2KC2A 4WWPA 4EEWA 5DCNA 2V4LA 1E7UA 2AL6A 2BWFA 3H6NA 1LM8B 2NPTA 5AZGA 3PT2B 1WRDB 2M0XA 4EUTA 3RT3B 1SE9A 3BY4B 3A33B 2KDFB 2BWES 1X1MA 4EZKA 3HM6X 3L16A 3PRMB 1RFAA 2M4NA 3R7RA 3QARA 2KANA 4K81A 3UIOB 3DVGX 4KVGB 2DZJA 2MBOA 3VTWA 1TGZB 2LI5A 1WE7A 1P98A 2ZNVB 2HTHA 3N32A 3H9DA 1WJ4A 4KZCA 3UGBB 2KKCA 3A4RA 1LFDA 3V60A 3T8MA 4IWQA 5LXHA 4E3CA 2J0JA 2YVCA 2L05A 1AARA 3JVZX 1WGHA 1NI2A 2AWTA 2CR5A 3ZRFA 1G6JA 1GG3A 4A3OA 3UQAA 2L0TA 4TQ1A 4MDKE 4TUUA 5D2MB 1IYFA 3AI5A 5BO4B 2GBNA 4CYEA 2HJ8A 1WJUA 2N4FA 3ZNID 3U8ZA 1T0YA 2MA9B 1EO6A 2K25A 4W9IA 1WY8A 4B6WA 4B95A 3DVGY 4PS7A 1OEYA 3KW5B 4KSKC 4FHKA 3AU5A 3RYTA 4BBNF 3DBHI 2M17A 3WAOA 2XK5A 3AU4A 4IG7B 3BINA 1E90A 4G50A 3KUDB 3OLMD 3SHQA 3V6EB 3ENEA 3QQ8B 2DAJA 2BPSA 4MH0E 2IBIB 2DYOA 4W9DA 4IWOA 1UGMA 3VFKA 1YJ1A 4EFOA 1H8CA 3DQVA 5JHAA 2L8JA 4W9EA 2DZKA 2JXXA 1WR1A 2WX0A 4DHJD 3IBEA 4BKGA 5C23A 3RZFA 2RSUA 3MTNB 2MBBB 2LGYA 3APCA 2I1KA 4FULA 3SDLC 1WR6E 4LJOB 4W9CA 3DCGA 1YX5B 3ZW3A 2KQ7A 4IWPA 4GDKA 4ANUA 3ONSA 3ZRCA 4ZRIA 2XK5B 2LVOA 3PRPB 4M0WB 5KHOA 4NY0A 2ZVNA 2VRRB 3EFUA 4E71A 4EOYA 2KDEB 3L08A 2KQSA 2MBHA 5E6OA 3K9OB 4GIVA 4I6NB 1Q5WB 2JZZA 3VVWB 1P3QU 3CMMB 4HCPB 2FCNA 3GZNI 4IM2A 3WA0A 5J2RA 2J7QB 4K7WA 2EKEC 3OJ3A 3R7QA 3DVNV 4HPLB 2N7DA 1V81A 1V2YA 2K8HA 2LRWA 1YD8U 4WJQA 4BKTA 4FADA 3NZSA 4MGYE 4AOFA 2K1FA 2D10A 3UINB 1WXSA 2CKHB 2GBJA 2LUEA 1I42A 2LXCA 1ZGUB 2CHWA 3ZKJC 4W9LA 3IFWB 1E8WA 5JZEB 3L13A 4WWOA 2ZEQA 2BF8B 4M8NA 4XZ4A 3WAPA 3H7PB 4HDQA 1KLVA 3JYUA 5LXIB 4WJPA 1NDDA 4WAAA 3PSEB 3VUWA 1I35A 2KFKA 3VH4B 3VDZA 3A4SC 2J0MA 2PEAA 2L7RA 3PLVA 1V49A 2FNJB 2KXJA 4GN1A 1BT0A 4XC2A 1R4MI 4JQWC 1WX9A 3VH3B 3WALA 4DBGA 4IM3A 2WWZA 3NHEB 3PVLA 2HE7A 3U30A 5DPSA 4BOZB 4FA6A 2C7NB 2KO3A 3A9JA 5HKHA 1WXAA 3D32A 2M1MA 2LXAA 2C60A 2MBEA 4FBJB 1ZW7A 3H7PA 2OOBB 4GXBA 3ZUNA 3VQIA 3PPAA 2KC1A 1WMHA 4FN2A 1R4NI 3A1QB 4W9HA 1H4RA 1WZ3A 4MELA 4URKA 2IO3B 2KOXA 5IAAC 2JVCA 4II2B 3ZO5B 4HDOA 2MCNB 4P7IA 3ALBA 4I6PA 3KVFB 1EF5A 4GDLA 2J0KA 5DPTA 2KLCA 2KN5A 3L17A 2CHZA 2CHXA 3RD2A 3TMPB 2L3ZA 2EMSA 4B9KA 3W1SA 2LZ6A 1OGWA 1QZEA 3RZWC 2KZRA 2BYEA 2GBRA 5CHWA 1WXMA 1V86A 2GMIC 4ICVA 5E6NA 1WF9A 3NZUA 5LLIA 4MGIE 3ZNZB 3R66C 4LCDE 4DWFA 3ZTDA 2NVUI 2C5LC 2DHZA 2Z59B 3PHXB 1YIWA 2DENB 1LQBA 1CMXB 4EZLA 3DOWA 4ANXA 4JGHB 4GB9A 4MEMA 2DZIA 1S3SG 2GBKA 4BFRA 4DDID 4DHZB 3WANA 3AXCA 2YLMA 2N1WA 1YX6B 2O6VD 2XEWA 3OAWA 4OVVA 2BYVE 4GDLB 4PS8A 2N7EA 3DBRI 3Q3JA 5C1ZA 2IZVB 2DAFA 2KVRA 3ML9A 3DVNU 3WAMA 2IY1B 4KIKA 3HHMA 2N1VA 2KX3A 1Q1OA 1WZ0A 2FAZA 3R3MA 2UYZB 2ZVOA 2D11A 3CF6E 1P0RA 2KMCA 4I6LB 4WQOB 3O65B 3HK0A 4G3XB 4G0NB 4WJOA 4X57B 3V61A 1NBFC 2N9PC 4WWNA 1F9JA 4HVBA 5JHBA 1OEYJ 3A9JB 1KOTA 3B08A 2LWPA 2LVQA 2O2VB 1OQYA 3N3KB 4GU2A 3V6CB 2KDIA 1D3ZA 4RMAA 3UQBA 2WYQA 2WDTB 2MP2A 2ZJDA 5DPRA 4BBNC 4HK2A 4IW0A 4K7UA 1U4AA 2V1YA 2KFKB 4IUMB 2ZPYA 1OTRB 2ZNVC 3QJZA 3HIZA 4NQKE 2A5UA 4RM9A 1WGRA 4ANVA 1TBEA 2DX5B 4KDLB 3QK0A 3X23A 2PJHA 2MLBA 3K9PB 3KUCB 4K1RB 4AJWA 5CHFA 2R2OA 4N9F4 5AZHA 5G55A 1J0GA 1IPGA 1WX7A 2D3GA 5D6JB 4DHJB 3VTUA 2O2VA 2W9NA 2KWCA 2LD9A 4PYZA 3SU8X 2KTRA 1WXVA 2D2QA 4LDTD 1E8ZA 1WIAA 2V3SA 3EECA 5KHQA 3A1QA 1Q0WB 1A5RA 3X0WA 1P9DU 2LRUA 1VCBA 2C7MB 3B1LX 1WH3A 4KDIC 2O6VA 3APFA 4ZYNA 3M95A 4FLHA 1GC6A 1WJ6A 1SIFA 1UZXB 1V80A 2KWUB 3AULA 4G11A 3ZNGC 3L10B 1V5TA 2KD0A 3VUYA 2FCSA 2Z0DB 3MJWA 4BOSC 5J18A 3P2BA 5IA7A 3QCAA 3QIJA 3KYDD 3HM3A 3QX1A 2OJRA 3APDA 3T9LA 3KUZA 5AZFA 1WM2A 1XD3B 2QHOA 3JW0X 3TBLD 5CX3A 2NR2A 1IP9A 2KDBA 2K6QA 4AP4C 4TQ0A 1L2NA 1MG8A 3DDCB 2KNBA 3W1SC 3ZDMC 2K39A 4JIOU 1GUAB 3I3TB 3JSVA 3PREA 1C1YB 2JRIB 2ZCCA 3C0RB 3M62B 4HWIB 3UIPB 4FJVB 1WI0A 4FJYA 4F1SA 4II3B 1EF1A 4W9JA 4HLEA 5JH5C 2C7HA 3RUIB 3DBSA 3DBLI 3L54A 2RGFA 2HD5B 4NAWB 1E5WA 5E6PA 2ASQA 3QC8B 4F8CB 1JRUA 2N9XA 1M94A 1SGHA 3QA8A 2KWVB 4DK5A 4W9GA 2K6DB 4ASWC 2ZZPB 2GBMA 4GGQA 3RULA 1Z2MA 2KTFA 2LGDA 2MW5A 1J8CA 1GC7A 2JF5A 3PV1A 3A9KB 3IHPC 2G45B 1RLFA 2K8BA 2MQJA 2NBVB 3VTVA 4DXAB 5CTRC 2KTRB 4LJPB 1Y8RC 2B3AA 4TV3A 3ZNHB 2PE6B 3VXWA 2NBUA 4GMVA 1WE6A 1Z5SB 5D94A 3VUXA 2RD0A 5EDSA 2NPTB 2DYBA 4TKNA 4GSWA 2RR9A 2KK8A 2JRHA 1GNUA 3TJPA 3ZLZA 1L7YA 3S2AA 2IYDB 2L00B 5AEKB 2MWSB 1E7VA 1UELA 2CU1A 2WX1A 3WIMA 2PE9A 4NJ7A 5FR6A 4CO7A 5L83A 5CHVC 2AYOB 3UF8A 2ZPNA 3PS6A 3NOBA 5D7GA 3TL5A 2LASA 4KIKB 3ZTCA 1WGGA 1ISNA 4NQLB 3VAWA 1UD7A 2DZMA 3OJ4B 4HXDA 4KSLC 2JT4B 3PHWB 1P1AA 1WYWB 3TCAA 2BYFA 2EMTA 3PTFC 2Z0EB 3NY5A 3NS8A 4W9KA 2FUHB 2LVPA 4BKSD 4FHJA 3ML8A 4HCNB 2O6VB 1V5OA 2JZ3B 2MSED 3H7SA 4MSMB 1EUVB 4PS3A 3N30A 2MP2B 1LXDA 2G4DB 3LJ3A 2AL3A 4F7ZA 1WJNA 4NNJB 4AUQC 4AWJA 4J6IA 2IO2B 2L0FA 3GOEA 2KHWB 2NBWB 3SD5A 4MSQB 3VHTC 2JUOA 2REXA 4RM8A 2MX2A 1KM7A 2KMAA 1PQSA 1WFYA 1UBQA 2NCNA 4FJZA 1ZKHA 1WGDA 4MGZE 4JL9A 2BKRB 3IG3A 1V9JA 2BKFA 3TIXA 1TZ1A 1YQBA 3JSVB 2D07B 1TTNA 4AJYB 4M8MA 4KZ0A 3U7DA 2UWQA 4ZRJA 4A20A 2G4SA 1S1QB 2KJRA 2LJ5A 2CS4A 5GMVA 3QAQA 1K8RB 4NAWA 4WJNA 1UH6A 1E8YA 4ZDVA 2PPHA 2RPQA 1V6EA 2MBQA 3DPDA 3M3JA 4HJKA 4GDKB 4DDGD 2L76A 3CSTA 4LDTB 2JPHA 2A4ZA 3ECIA 3IVFA 4OVUA 4ANWA 4BVUC 2ZCBA 5L95C 4IC7B 2FIFA 1WGYA 2KX0A 1XQQA 1UBIA 3ZIMA 1J19A 3B0AA 3A9KA 2IO0B 2KFJA 3KYCD 1E8XA 2JY6A 5TR5A 1GJZA 3EHVA 4MJSB 2KLGA 3PZDA 3PRZA 1WX8A 2BGFA 2M8SA 1KJTA 3PGEA 4ICUA 4W9FA 4A3PA 3MHSD 3PLUA 4BKSA 4YL8A 4EKUA 3H1UA 4NPNA 2I1JA 2FCQA 1C3TA 3QHTA 4HPMB 4DHZE 5G2NA 4E74A 2IY0B 2NS5A 4CHKA 2MRPA 5J17A 4K7SA 1WM3A 2N9EB 3RCZA 2Y5BB 2FIDA 4ZRKA 3Q3FA 4XX5A 2IO1B
chains in the Genus database with same CATH superfamily
5DPWA 3V62A 2DYMA 3NZ3A 2KJHB 2K8CA 3L0WB 4GOCA 3BVMA 1XCQL 3RI7C 1C78A 4WWPA 1VD2A 4PT5A 1LM8B 3NRZA 3EFCA 2M0XA 3RT3B 1SE9A 2R61A 1X1MA 1CZPA 3UIOB 2DZJA 2MBOA 5EE3A 3VTWA 1TGZB 3KWVA 1WE7A 1P98A 2ZNVB 2HTHA 4TSSA 1WJ4A 4KZCA 3UGBB 3T8MA 4IWQA 5LXHA 1ZP0B 2J0JA 2YVCA 1G6JA 2INNE 1B9RA 1HEZE 3EA6A 4XDCA 5BO4B 3ZXVA 2Z8LA 4YTMB 1T0YA 3SEBA 1MI0A 4PS7A 4IG7B 3V3XA 2YEPB 3W5VB 3OLMD 3ENEA 2DAJA 1QT9A 2DYOA 3GB1A 1H8CA 3ZGZA 2DZKA 2WX0A 1ET9A 2N7JA 3IBEA 3RZFA 2LGYA 2D3BA 2I1KA 1WR6E 3Q3MC 1IUEA 1MVKA 2MHJA 2KQ7A 2E3TA 4IWPA 3ONSA 5KHOA 4NY0A 3EFUA 1DOYA 1TKGA 1XLOA 1Q5WB 2M19A 3CMMB 2FCNA 3GZNI 5J2RA 2MJ3A 2ZW0A 1DOXA 5BMGA 2X8XX 2LRWA 1YD8U 4BKTA 3N20C 1I7HA 4AOFA 4N6EB 3UINB 2LUEA 2G9HD 3ZKJC 3TUOA 1FIQA 3NVZA 1ZPSA 4WWOA 2BF8B 3H7PB 2J4XA 5LXIB 4WJPA 2NTSA 3GE3C 3VUWA 3AE7B 3P1MA 1EWCA 1FRRA 2KFKA 2WXPA 4RF0A 2J0MA 3R2TA 2L7RA 1V49A 1DOIA 4XC2A 3VH3B 4S0RA 2WWZA 2HE7A 5DPSA 3Q69A 4FA6A 1WRIA 2LXAA 2MBEA 3VQIA 2KC1A 1XF5L 2LGSA 1R4NB 2W3SA 4FN2A 4JE3B 2J42A 1H4RA 2JSVX 2IO3B 1SSNA 5IAAC 4II2B 4HDOA 5BYSA 1EF5A 3AE8B 3U7ZA 4JPSA 2CHXA 2L3ZA 3W1SA 1OGWA 5CHWA 3W5UB 1L4ZB 1JCKB 1PGAA 2DENB 3I57A 4GB9A 2YLMA 4XWTA 2N1WA 4OVVA 1F1HA 2N7EA 3DBRI 1FM0D 4YSZB 3FKYA 3Q2AC 2IY1B 5I4DA 4LLGM 2N1VA 2QMTA 1Q1OA 1WZ0A 1P0RA 4G3XB 5EE1A 2N9PC 4WWNA 1GPXA 1KOTA 1WYGA 3N3KB 1VZ7A 3UQBA 2WYQA 2WDTB 2MP2A 5EE9A 4BBNC 4IW0A 2V1YA 4YSXB 2ZPYA 3KWLA 3Q3OC 2A5UA 4KKIA 3B2GA 3MFGA 1DGJA 3R8BA 1KRHA 3X23A 4AJWA 3LB8C 5G55A 1J0GA 2D3GA 1T0RC 4PYZA 2KWCA 2LD9A 3SU8X 2V9HA 4RFBA 2D2QA 1I4RA 5D3DA 3RNEC 1IGDA 2LRUA 1XO3A 3B1LX 3APFA 2E6XA 1GC6A 1WJ6A 1SIFA 1V80A 4G11A 1NENB 3L10B 2QSDA 2WNMA 3QIJA 3KYDD 3QX1A 1SF0A 1C79A 1L6VA 1KF6B 2NR2A 1NVID 3U4EG 1MG8A 2K39A 3I3TB 3JSVA 3PREA 3C0RB 1UNSA 1WI0A 1EF1A 1PYWD 5JH5C 1FNVA 4M01A 2RPVA 2L32A 1E5WA 1N60A 5E6PA 1T5XD 4HKQA 4FXCA 1JRUA 1YN3A 2N9XA 1M94A 4W9GA 2K6DB 2V3NA 1J8CA 3FC4A 1GC7A 2JF5A 3AEFB 1RLFA 2MQJA 4BZAA 3ZXRA 4TV3A 3VXWA 4GMVA 5D94A 1DYQA 1C4PA 2DYBA 4TKNA 1LGRA 2RR9A 1L7YA 5AEKB 3RPFC 1T0QC 2K0PA 1UELA 2KQ4X 2LHEA 3WIMA 4NJ7A 4YT0B 1KH0A 3P4SB 3UF8A 2ZPNA 3HUIA 3IAM1 3NOBA 4HROA 1ISNA 2DZMA 3OJ4B 2ACZB 4KSLC 3VR8B 2WXHA 1J7CA 3NJTA 2Q5WD 4MM3B 3TEYA 4W9KA 1OFFA 2O6VB 3H7SA 4PS3A 2G4DB 3LJ3A 4AUQC 2IO2B 2L0FA 3GOEA 3VR9B 2NBWB 4MSQB 2JUOA 4RM8A 2BS2B 1NI3A 2MX2A 2KMAA 4FJZA 4A55A 3IG3A 3JSVB 1YQBA 4XWWA 1TTNA 1SEBD 1F0ZA 1VRAB 4LNKA 2UWQA 1YJIA 4ZRJA 2KJRA 2WQYB 2FBWB 5GMVA 2YEPF 1RYJA 5EE0A 1UH6A 5IO9A 1V6EA 2MBQA 4HJKA 2LFIA 4GDKB 2RDGA 2L76A 2JPHA 2L83A 2CJNA 1UBIA 3Q8FA 3A9KA 2JY6A 4WWMA 3R2IA 2M8SA 1KJTA 3PGEA 1IBXA 3DBRB 3RNCC 2PTLA 2KWDA 3H1UA 2FCQA 2IJ0A 2V3PA 5G2NA 1FXAA 4DHZE 4E74A 2IY0B 4US9A 1WM3A 2KACA 2IDYA 2Y5BB 2FIDA 1TZOA 4ZRKA 2L1AA 4XX5A 2LMCA 5BMHA 4L1BA 1R7SA 1HE8A 2QIEB 2R2QA 4PYUA 1FXTB 1ZUD2 2IGHA 1I4GA 2N0SB 1RRBA 2DNFA 3MC0B 1XT9B 1WMHB 2KC2A 4EEWA 1JMLA 1E7UA 1EM7A 1V1OA 1WRDB 1FFUA 4RGOS 3BY4B 3A33B 4JWUC 2BWES 4M0WA 5IP4D 2KANA 3IT4B 3LXFA 5IKCM 2ON8A 3P63A 3J9CA 1K50A 5C2TB 3V60A 1Q10A 1I4PA 1AARA 1JWMD 5FKAC 1WGHA 2MJEA 3NVYA 3ZRFA 2GB1A 4A3OA 2L0TA 4TQ1A 1KFYB 4MDKE 4KGTA 4TUUA 2GBNA 4CYEA 2HJ8A 1WJUA 2N4FA 4WAFA 2MA9B 1EO6A 2K25A 4B95A 3DVGY 1OEYA 4KSKC 1AW7A 3RYTA 2PMVA 3ZQ4A 3DBHI 2KAJA 3BINA 3AN1A 2WXIA 1ACCA 3QQ8B 1ZOYB 1FCLA 2IBIB 1UGMA 3VFKA 3DQVA 5JHAA 1SE4A 1FNWA 1XLQA 1WR1A 4RF1A 2RSUA 3SDLC 3APCA 4FULA 4W9CA 1JRPA 2HJ1A 2BTEA 1YX5B 4RGTA 3ZW3A 1XCTL 4ANUA 3ZRCA 3KLSX 4ZRIA 2XK5B 4YTPB 2ZVNA 4E71A 4EOYA 1N6ZA 2KQSA 5E6OA 4I6NB 3NVVA 1P3QU 3WA0A 4HCPB 3AEAB 3LYYA 2N7DA 1V81A 2K8HA 3EGRA 2K1FA 1K52A 1ZGUB 3P4RB 1D5MC 3P4QB 4WURA 1K53A 3RN9C 1KLVA 1QILA 2VH1A 5LNK1 1I35A 2PLPA 1MJDA 3VDZA 3A4SC 1F52A 1SB3C 2PIAA 4IM3A 1YN5A 4NZLB 3Q6BA 4BOZB 2BT6A 3A9JA 1ENFA 5HKHA 1WXAA 2M1MA 1T0SC 2J53A 4FBJB 4GXBA 2K9XA 1XXGA 2SAKA 4MELA 4URKA 2INDC 4XGAB 4B0MA 2JVCA 3ZO5B 3VRAB 2WDVB 3BIID 5DPTA 2J0KA 2KN5A 3L17A 3ZYYX 2CHZA 2EMSA 2RDBC 2VZKD 3RZWC 4EE2A 5E6JA 3H8HA 2GBRA 2WU2B 3I9V1 2GMIC 4ICVA 1WF9A 5HFYA 4MGIE 3R66C 4LCDE 1UWMA 2Z59B 2WLBA 1LQBA 1CMXB 4EZLA 1MHXA 4ANXA 4BFRA 2DZIA 3AEBB 1HZ5A 2XEWA 1YX6B 4GDLB 4ZHPA 1D4BA 3Q3JA 2KMMA 5HHDG 3ML9A 3DVNU 3WAMA 3R3MA 4I6LB 4KGRA 2KMCA 2WXLA 3V61A 2B76B 3SFDB 3T3NA 1OEYJ 1ET6A 2JU6X 1OQYA 4GU2A 1E9MA 2ZJDA 5DPRA 4HK2A 4WIPA 1HTQA 2WXRA 2ZNVC 2KDMA 4RM9A 4ANVA 1HQRD 2DX5B 4KDLB 4LTUA 3K9PB 2R2OA 4IKGA 2JXTA 4N9F4 3VRBB 1IPGA 1WX7A 4DHJB 3Q8CA 3VTUA 2W9NA 1QQRA 1WXVA 1CK1A 1JW9D 3A1QA 1JALA 1A5RA 2WXKA 1VCBA 4ITKA 2WHIA 4Q2JA 1WH3A 3NVWA 4FLHA 2KWUB 1V5TA 2KD0A 3ZJVA 1BUIC 3NUHB 2N9KA 1C77A 2FE8A 2OJRA 4H2AA 2D3AA 1E10A 2QHOA 1GAQB 4NAMA 2KDBA 2K6QA 4AP4C 4L2YA 1SJED 3W1SC 1GUAB 2QC8A 3UIPB 4M00A 1IGCA 2WXGA 4HLEA 3DBLB 2HD5B 1FRDA 2KT7A 4LK0M 3MHZA 4F8CB 3RNGC 4DK5A 4ASWC 2GBMA 3FILA 2WGSA 1EU3A 2XN9C 2BQQA 1YQ4B 3U2SC 2BYTA 2G45B 2K8BA 4N59A 4DXAB 5CTRC 2OJWA 2KTRB 1Y8RC 1ROEA 2IPKD 1Z5SB 2M0AA 5EDSA 2NPTB 3C19A 2KK8A 3TJPA 2MWSB 2DLBA 2BW2A 5FK9C 2PE9A 4C80A 5CHVC 1F2RI 5D7GA 3TL5A 1FFVA 2RDHA 1TS4A 2JWUA 4NQLB 2JT4B 1YMHE 3Q3NC 4LNIA 3PTFC 4D2KA 1N5XA 1XLPA 2FUHB 1KLGD 4BKSD 3ML8A 4HCNB 2QJLA 4GLSC 3N30A 2MP2B 2KVZA 2AL3A 4F7ZA 1MHHE 2G1EA 2KHWB 3HVZA 1F2RC 3SD5A 1VZ8A 1KM7A 4CQNA 1JWAD 2CU3A 1WFYA 1WGDA 1V9JA 3TIXA 4AJYB 1FEHA 4M8MA 4KZ0A 3U7DA 4A20A 1K8RB 1KLUD 2PPHA 2RPQA 3CSTA 3BWUD 3P4PB 1JWUD 4LNOA 2AQ2B 2A4ZA 3IVFA 4ANWA 4BVUC 2V0GA 2V4IB 1PUTA 4IC7B 2FIFA 1XQQA 1PDXA 3AMZA 3DBHB 3IXSA 1GJZA 2KLGA 3O13A 1JQ4A 2J52A 3DHIC 2VZKB 4ICUA 3MHSD 4BKSA 4YL8A 4EKUA 4JWSC 1ZXIA 2HDEA 1GOZA 1J7AA 2N9LA 4OZBA 1QF6A 1OQRA 1ZXHA 3AE9B 2Y3AA 3ZDTA 3QWZB 4XE0A 3ZVVA 2INPE 3KH0A 4KV2A 4NJ6A 2GOWA 4AS1A 4JLCA 2KJ6A 4MGKE 2XBBC 3W1YA 2LGXA 2BS4B 2AEHA 5AUIA 5DCNA 2AL6A 2BWFA 4EUTA 2W82A 3FAHA 2KDFB 4EZKA 3HM6X 3PRMB 1RFAA 1L0YB 4K81A 4HPPA 4KVGB 4HEA1 4R3DA 1MPEA 4KX6B 3N32A 2KKCA 1LFDA 3Q8AA 3JVZX 1NI2A 4XDDA 1GG3A 2PW9A 1IYFA 5D2MB 1HA5A 2LEKA 5BMIA 1GB4A 1QOAA 2D5GA 4W9IA 1WY8A 1QOBA 4FHKA 4BBNF 4P6VF 2M17A 3WAOA 2XK5A 3AU4A 4C7ZA 3W2DA 1E90A 3V6EB 1YQ3B 1CJEA 2BPSA 4MH0E 1SBBB 4W9DA 2L8JA 4DXFA 2JXXA 1MG4A 2JZPA 3UI3A 1RFKA 4P16A 4BKGA 3MTNB 5BYQA 3DHHC 4USAA 4LJOB 3Q14C 3DCGA 1A70A 4GDKA 3PRPB 2VRRB 3AE6B 1R4MB 3L08A 2MBHA 2JX5A 4GIVA 3GZNB 4K7WA 3OJ3A 3R7QA 4HPLB 1V2YA 4WJQA 4C00A 4MGYE 1WXSA 2CKHB 1I42A 3IFWB 1E8WA 1I4XA 1T3QA 3ZJUA 1E6EB 4XZ4A 2K22A 4HDQA 5JXVA 4S17A 3JYUA 1NDDA 4WAAA 3PSEB 3VH4B 3MP9A 3PLVA 1YN4A 2FNJB 3B2FA 2KXJA 1WX9A 3WALA 2GI9A 3U30A 2MEKA 4ZHOA 1TS5A 3D32A 2C60A 3ZUNA 3PPAA 1WMHA 2WS3B 3PZ8A 1R4NI 5IN7A 2AQ1B 1MFWA 1K51A 2KOXA 3P42A 2EELA 3ALBA 4I6PA 2WXJA 3KVFB 4GDLA 4IOIE 5G5HA 1SJHD 2KLCA 3TMPB 2DWQA 3SR6A 1WXQA 3URYA 3AE1B 2KZRA 3DWGC 1WXMA 2FUG1 3AV8A 1ZDXA 1FPYA 4P1CC 1YNTE 5TSSA 5LLIA 3ZNZB 4OW0A 3ZTDA 2C5LC 2DHZA 3IT6B 3PHXB 1YIWA 4RNAA 2SEBD 4ZRPA 4MEMA 4DHZB 3WANA 2KN4A 3OAWA 2O6VD 2BYVE 5C1ZA 2AX5A 2IZVB 2DAFA 2KVRA 4REZA 3TEWA 1C4CA 1HXYD 3HHMA 2UYZB 2ZVOA 2D11A 3CF6E 4X57B 3TSSA 3O65B 2D3CA 3HK0A 4WJOA 1WWTA 1NBFC 4NJCA 2BVCA 2QILA 4HVBA 5JHBA 3B08A 4C56C 2LVQA 3V6CB 4B0EA 4K7UA 1U4AA 2KFKB 4IUMB 1OTRB 4LNNA 1TBEA 4OZAA 4IDIA 5BYRA 1SE3A 2PJHA 2MLBA 3KUCB 1NEKB 5D6JB 2O2VA 1VJKA 4LDTD 1QLBB 3EECA 5KHQA 1BXTA 3X0WA 1P9DU 1ESFA 4KDIC 2O6VA 4ZYNA 4XYCA 3M95A 3SFEB 3N1ZC 1UZXB 3AULA 3ZNGC 4A90A 3T3OA 2Z0DB 4BOSC 1P7FA 3P2BA 1TY2A 3HM3A 1WSPA 5AUKA 1D6EC 1WM2A 1QOFA 3N9YC 2OEDA 4TQ0A 4ARIA 2KNBA 3E56A 2WP9B 3M62B 4FJVB 2UU7A 1WGKA 4C4VA 3AEEB 4II3B 3RUIB 2DBYA 3L54A 1C76A 3RFZB 4NAWB 3PO0A 3GP7A 4KKJA 2ASQA 2K3UA 3QC8B 1SGHA 3RMKC 2KWVB 4YXDB 2ZZPB 4GGQA 3RULA 3TEXA 1HZ6A 2KTFA 2QCZA 3PV1A 3ETRA 3A9KB 1V1PB 4ACFA 1SE2A 2NBVB 3C8YA 3VTVA 5HI1A 4LJPB 2B3AA 2X38A 4HRSA 3BYTB 2NBUA 3VUXA 2MJDA 2H88B 2BBCA 2L00B 1SXTA 1E7VA 1FMAD 2CU1A 2JYTA 4CO7A 3N1YC 5FR6A 2LASA 3RNFC 4KIKB 3ZTCA 1WGGA 3VAWA 1UD7A 4HXDA 1N5WA 1P1AA 1WYWB 1RM6C 3TCAA 2BYFA 2EMTA 3CIRB 2NMQA 1ZE3D 3NS8A 4OZCA 3BVGA 5H92C 3Q8BA 1V5OA 1N62A 4MSMB 1EUVB 2RMMA 1FO4A 2WDRB 2EKIA 4NNJB 3BK2A 1E7PB 1UUPA 4PK1A 3Q8EA 2REXA 2WXMA 1UBQA 1ZKHA 2WDQB 1T6BX 2BKRB 3AE4B 2D07B 1F77A 2G4SA 2LJ5A 4RH6A 4NAWA 4O1NA 1E8YA 3DPDA 3M3JA 4DDGD 1L6UA 4LDTB 4OVUA 3ECIA 2ZCBA 1WGYA 2AQ3B 3ZIMA 3B0AA 3RNAC 2KFJA 3KYCD 1V1PA 3EHVA 3PZDA 3E9SA 1WX8A 2BGFA 3N1XC 2WXFA 4W9FA 5D3IB 3PLUA 3DWMA 1VDVA 1I4QA 1C3TA 4YWGG 1N61A 2NS5A 5T8IA 4CHKA 2MRPA 3U52E 5G5GA 2G3QB 1RAXA 3LDZE 2FCMA 4MJSA 3KQ4A 4IM0A 2JWZA 1HTOA 4EZJA 1V97A 1L0VB 4UDUC 4MM3A 2C9WB 3CSFA 3BVZA 3EC8A 3M63B 4QAYA 4HJGE 2V4LA 1B1ZA 2NPTA 3H6NA 3PZ7A 5AZGA 3PT2B 2QDFA 2TSSA 3GE8C 5C3JB 3RNBC 3AB5A 1UF0A 3L16A 2M4NA 3R7RA 3QARA 3DVGX 4MT5A 4ARCA 3W9CB 2HTME 2LI5A 3H9DA 3A4RA 3BZDB 4E3CA 1E0ZA 2L05A 2AWTA 2CR5A 2GRIA 3ABVB 3UQAA 4ZOHC 3AI5A 3ZNID 3U8ZA 2JQRB 4B6WA 1AYFA 3AEGB 3KW5B 3AU5A 3TEZA 4G50A 3KUDB 4YSYB 3SHQA 2BB6A 1J7BA 3NG0A 4IWOA 4EFOA 1YJ1A 3BYYB 4W9EA 4DHJD 5C23A 3MJ5A 2MBBB 1QOGA 2BS3B 2LVOA 3AE5B 4M0WB 2KDEB 3K9OB 1SIJA 3I63C 1I4HA 2JZZA 3VVWB 1ZDVA 4IM2A 2J7QB 2LHDA 1PFDA 2EKEC 3DVNV 3HVDA 4FADA 1TKEA 2NTTA 3NZSA 5IOIA 5MPOA 2D10A 2GBJA 2LXCA 2CHWA 4A9AA 4W9LA 5JZEB 3L13A 2ZEQA 4M8NA 3WAPA 4L23A 3WCQA 2PKOA 3V05A 4US8A 3MC9A 1PGXA 4BAXA 1STEA 4RGNA 3MC8A 4WH4A 2PEAA 3OWEB 4DBGA 4GN1A 1BT0A 1R4MI 4JQWC 1KTKA 4K3BA 3PVLA 3NHEB 2KYWA 2C7NB 2KO3A 1TIFA 2ICIA 2PVGC 1TT5B 1ZW7A 3H7PA 2OOBB 1L5PA 3A1QB 4W9HA 1WZ3A 1AWDA 1N63A 1NYRA 2MCNB 4P7IA 2JYEA 4RGMA 1FXIA 2WXQA 3RD2A 4B9KA 2LZ6A 1QZEA 4LNFA 2BYEA 1V86A 1EU4A 5E6NA 1TYGB 3NZUA 4DWFA 1JWBD 2NVUI 1EWYC 4KGSA 2W3RA 3DOWA 4JGHB 2Y5PA 1S3SG 2GBKA 4DDID 3AXCA 1RWSA 1YJJA 1VZ6A 3AECB 1TS2A 2QEJC 4PS8A 4M02A 4KIKA 2KX3A 2FAZA 4WQOB 1CQVA 2Y5CA 1D5ZC 4G0NB 1F9JA 3A9JB 1FD6A 2LWPA 2O2VB 3GS2A 1D3ZA 2KDIA 3AE2B 2W54A 2LGIA 3B9JA 4RMAA 1FCCC 5H8YE 3AM9A 1UGJA 3QJZA 3HIZA 4NQKE 1WGRA 1XEEA 3QK0A 2LUMA 4K1RB 2IGDA 5CHFA 5AZHA 2H89B 5FR3A 2M56B 2XNAC 2KTRA 4MACA 1E8ZA 1WIAA 2V3SA 2LJIA 1Q0WB 2C7MB 3AEDB 3VUYA 2L52A 2FCSA 3MJWA 4DQOC 5J18A 5IA7A 3AH7A 1D5XC 3QCAA 4ZYSA 1V8CA 2ONQA 3APDA 3T9LA 3KUZA 5AZFA 1XD3B 3JW0X 3TBLD 5CX3A 1FNUA 1IP9A 1L2NA 3DDCB 1VR9A 3ZDMC 4JIOU 1C4AA 1C1YB 2JRIB 2ZCCA 4HWIB 2VH2A 4FJYA 4F1SA 1NYQA 2I38A 4W9JA 3IAS1 2C7HA 2W55A 3DBSA 2IGGA 3DBLI 2RGFA 1TKYA 1Y56A 4J3OD 3BK1A 2PVOD 1LO5D 3QA8A 2BB5A 1BMLC 1UWXA 1Z2MA 2LGDA 2MW5A 3IHPC 3CWIA 1VLBA 2K5PA 4C4VB 4K3CA 3OG5A 3ZNHB 4OVZA 2PE6B 1WE6A 2RD0A 1YOVB 4GSWA 1GNUA 2JRHA 2GLSA 3ZLZA 3S2AA 2IYDB 3DHGC 1GB1A 1OQQA 2WX1A 5L83A 2AYOB 2MH7A 1QKZA 3PS6A 3HRDD 4YTNB 1JWSD 1L0XB 3PHWB 4JX1C 4TMAB 5GXGB 2Z0EB 4OHJA 3NY5A 2LVPA 4N58A 4FHJA 1TY0A 4DXGA 2JZ3B 2MSED 1LXDA 2ZW1A 1WJNA 4AWJA 4J6IA 3VHTC 4WQMA 3ZJTA 1AN8A 4C7YA 4MGZE 1PQSA 2NCNA 1P7EA 4A8XC 4JL9A 2INCC 1L4DB 2BKFA 1TZ1A 1C9FA 2WXNA 4MH8A 2WU5B 1S1QB 1PGBA 4A6QA 2CS4A 5HG2A 3QAQA 3AE3B 1IBXB 4WJNA 4ZDVA 4AQ7A 4ZRQA 2WXOA 3FILB 5L95C 1XLNA 2KX0A 1M4VA 3NS1A 1J19A 3L4PA 1JROA 2IO0B 1E8XA 5TR5A 4P1BC 2CJOA 4HKZE 4MJSB 3PRZA 3EUB2 1TJEA 2OHFA 4A3PA 4NPNA 2I1JA 4RCOA 2I2YA 3QHTA 4HPMB 5J17A 4K7SA 3I5JC 2N9EB 3RCZA 1TS3A 3Q3FA 2IO1B
chains in the Genus database with same CATH topology
2G3QB 5DPWA 1RAXA 3LDZE 3ZDTA 3QWZB 2FCMA 3V62A 3ZVVA 4MJSA 3KH0A 4IM0A 4KV2A 4NJ6A 1HE8A 2JWZA 4EZJA 2DYMA 2GOWA 2KJHB 4MM3A 4JLCA 2KJ6A 2K8CA 2R2QA 2C9WB 4MGKE 3L0WB 4GOCA 2XBBC 4PYUA 3W1YA 1FXTB 2LGXA 3CSFA 1RRBA 3EC8A 1XT9B 3M63B 1WMHB 2AEHA 1VD2A 2KC2A 4WWPA 4EEWA 5DCNA 2V4LA 1E7UA 2AL6A 2BWFA 3H6NA 1LM8B 2NPTA 5AZGA 3PT2B 1WRDB 2M0XA 4EUTA 3RT3B 1SE9A 3BY4B 3A33B 2KDFB 2BWES 1X1MA 4EZKA 3HM6X 3L16A 3PRMB 1RFAA 2M4NA 3R7RA 3QARA 2KANA 4K81A 3UIOB 3DVGX 4KVGB 2DZJA 2MBOA 3VTWA 1TGZB 2LI5A 1WE7A 1P98A 2ZNVB 2HTHA 3N32A 3H9DA 1WJ4A 4KZCA 3UGBB 2KKCA 3A4RA 1LFDA 3V60A 3T8MA 4IWQA 5LXHA 4E3CA 2J0JA 2YVCA 2L05A 1AARA 3JVZX 1WGHA 1NI2A 2AWTA 2CR5A 3ZRFA 1G6JA 1GG3A 4A3OA 3UQAA 2L0TA 4TQ1A 4MDKE 4TUUA 5D2MB 1IYFA 3AI5A 5BO4B 2GBNA 4CYEA 2HJ8A 1WJUA 2N4FA 3ZNID 3U8ZA 1T0YA 2MA9B 1EO6A 2K25A 4W9IA 1WY8A 4B6WA 4B95A 3DVGY 4PS7A 1OEYA 3KW5B 4KSKC 4FHKA 3AU5A 3RYTA 4BBNF 3DBHI 2M17A 3WAOA 2XK5A 3AU4A 4IG7B 3BINA 1E90A 4G50A 3KUDB 3OLMD 3SHQA 3V6EB 3ENEA 3QQ8B 2DAJA 2BPSA 4MH0E 2IBIB 2DYOA 4W9DA 4IWOA 1UGMA 3VFKA 1YJ1A 4EFOA 1H8CA 3DQVA 5JHAA 2L8JA 4W9EA 2DZKA 2JXXA 1WR1A 2WX0A 4DHJD 3IBEA 4BKGA 5C23A 3RZFA 2RSUA 3MTNB 2MBBB 2LGYA 3APCA 2I1KA 4FULA 3SDLC 1WR6E 4LJOB 4W9CA 3DCGA 1YX5B 3ZW3A 2KQ7A 4IWPA 4GDKA 4ANUA 3ONSA 3ZRCA 4ZRIA 2XK5B 2LVOA 3PRPB 4M0WB 5KHOA 4NY0A 2ZVNA 2VRRB 3EFUA 4E71A 4EOYA 2KDEB 3L08A 2KQSA 2MBHA 5E6OA 3K9OB 4GIVA 4I6NB 1Q5WB 2JZZA 3VVWB 1P3QU 3CMMB 4HCPB 2FCNA 3GZNI 4IM2A 3WA0A 5J2RA 2J7QB 4K7WA 2EKEC 3OJ3A 3R7QA 3DVNV 4HPLB 2N7DA 1V81A 1V2YA 2K8HA 2LRWA 1YD8U 4WJQA 4BKTA 4FADA 3NZSA 4MGYE 4AOFA 2K1FA 2D10A 3UINB 1WXSA 2CKHB 2GBJA 2LUEA 1I42A 2LXCA 1ZGUB 2CHWA 3ZKJC 4W9LA 3IFWB 1E8WA 5JZEB 3L13A 4WWOA 2ZEQA 2BF8B 4M8NA 4XZ4A 3WAPA 3H7PB 4HDQA 1KLVA 3JYUA 5LXIB 4WJPA 1NDDA 4WAAA 3PSEB 3VUWA 1I35A 2KFKA 3VH4B 3VDZA 3A4SC 2J0MA 2PEAA 2L7RA 3PLVA 1V49A 2FNJB 2KXJA 4GN1A 1BT0A 4XC2A 1R4MI 4JQWC 1WX9A 3VH3B 3WALA 4DBGA 4IM3A 2WWZA 3NHEB 3PVLA 2HE7A 3U30A 5DPSA 4BOZB 4FA6A 2C7NB 2KO3A 3A9JA 5HKHA 1WXAA 3D32A 2M1MA 2LXAA 2C60A 2MBEA 4FBJB 1ZW7A 3H7PA 2OOBB 4GXBA 3ZUNA 3VQIA 3PPAA 2KC1A 1WMHA 4FN2A 1R4NI 3A1QB 4W9HA 1H4RA 1WZ3A 4MELA 4URKA 2IO3B 2KOXA 5IAAC 2JVCA 4II2B 3ZO5B 4HDOA 2MCNB 4P7IA 3ALBA 4I6PA 3KVFB 1EF5A 4GDLA 2J0KA 5DPTA 2KLCA 2KN5A 3L17A 2CHZA 2CHXA 3RD2A 3TMPB 2L3ZA 2EMSA 4B9KA 3W1SA 2LZ6A 1OGWA 1QZEA 3RZWC 2KZRA 2BYEA 2GBRA 5CHWA 1WXMA 1V86A 2GMIC 4ICVA 5E6NA 1WF9A 3NZUA 5LLIA 4MGIE 3ZNZB 3R66C 4LCDE 4DWFA 3ZTDA 2NVUI 2C5LC 2DHZA 2Z59B 3PHXB 1YIWA 2DENB 1LQBA 1CMXB 4EZLA 3DOWA 4ANXA 4JGHB 4GB9A 4MEMA 2DZIA 1S3SG 2GBKA 4BFRA 4DDID 4DHZB 3WANA 3AXCA 2YLMA 2N1WA 1YX6B 2O6VD 2XEWA 3OAWA 4OVVA 2BYVE 4GDLB 4PS8A 2N7EA 3DBRI 3Q3JA 5C1ZA 2IZVB 2DAFA 2KVRA 3ML9A 3DVNU 3WAMA 2IY1B 4KIKA 3HHMA 2N1VA 2KX3A 1Q1OA 1WZ0A 2FAZA 3R3MA 2UYZB 2ZVOA 2D11A 3CF6E 1P0RA 2KMCA 4I6LB 4WQOB 3O65B 3HK0A 4G3XB 4G0NB 4WJOA 4X57B 3V61A 1NBFC 2N9PC 4WWNA 1F9JA 4HVBA 5JHBA 1OEYJ 3A9JB 1KOTA 3B08A 2LWPA 2LVQA 2O2VB 1OQYA 3N3KB 4GU2A 3V6CB 2KDIA 1D3ZA 4RMAA 3UQBA 2WYQA 2WDTB 2MP2A 2ZJDA 5DPRA 4BBNC 4HK2A 4IW0A 4K7UA 1U4AA 2V1YA 2KFKB 4IUMB 2ZPYA 1OTRB 2ZNVC 3QJZA 3HIZA 4NQKE 2A5UA 4RM9A 1WGRA 4ANVA 1TBEA 2DX5B 4KDLB 3QK0A 3X23A 2PJHA 2MLBA 3K9PB 3KUCB 4K1RB 4AJWA 5CHFA 2R2OA 4N9F4 5AZHA 5G55A 1J0GA 1IPGA 1WX7A 2D3GA 5D6JB 4DHJB 3VTUA 2O2VA 2W9NA 2KWCA 2LD9A 4PYZA 3SU8X 2KTRA 1WXVA 2D2QA 4LDTD 1E8ZA 1WIAA 2V3SA 3EECA 5KHQA 3A1QA 1Q0WB 1A5RA 3X0WA 1P9DU 2LRUA 1VCBA 2C7MB 3B1LX 1WH3A 4KDIC 2O6VA 3APFA 4ZYNA 3M95A 4FLHA 1GC6A 1WJ6A 1SIFA 1UZXB 1V80A 2KWUB 3AULA 4G11A 3ZNGC 3L10B 1V5TA 2KD0A 3VUYA 2FCSA 2Z0DB 3MJWA 4BOSC 5J18A 3P2BA 5IA7A 3QCAA 3QIJA 3KYDD 3HM3A 3QX1A 2OJRA 3APDA 3T9LA 3KUZA 5AZFA 1WM2A 1XD3B 2QHOA 3JW0X 3TBLD 5CX3A 2NR2A 1IP9A 2KDBA 2K6QA 4AP4C 4TQ0A 1L2NA 1MG8A 3DDCB 2KNBA 3W1SC 3ZDMC 2K39A 4JIOU 1GUAB 3I3TB 3JSVA 3PREA 1C1YB 2JRIB 2ZCCA 3C0RB 3M62B 4HWIB 3UIPB 4FJVB 1WI0A 4FJYA 4F1SA 4II3B 1EF1A 4W9JA 4HLEA 5JH5C 2C7HA 3RUIB 3DBSA 3DBLI 3L54A 2RGFA 2HD5B 4NAWB 1E5WA 5E6PA 2ASQA 3QC8B 4F8CB 1JRUA 2N9XA 1M94A 1SGHA 3QA8A 2KWVB 4DK5A 4W9GA 2K6DB 4ASWC 2ZZPB 2GBMA 4GGQA 3RULA 1Z2MA 2KTFA 2LGDA 2MW5A 1J8CA 1GC7A 2JF5A 3PV1A 3A9KB 3IHPC 2G45B 1RLFA 2K8BA 2MQJA 2NBVB 3VTVA 4DXAB 5CTRC 2KTRB 4LJPB 1Y8RC 2B3AA 4TV3A 3ZNHB 2PE6B 3VXWA 2NBUA 4GMVA 1WE6A 1Z5SB 5D94A 3VUXA 2RD0A 5EDSA 2NPTB 2DYBA 4TKNA 4GSWA 2RR9A 2KK8A 2JRHA 1GNUA 3TJPA 3ZLZA 1L7YA 3S2AA 2IYDB 2L00B 5AEKB 2MWSB 1E7VA 1UELA 2CU1A 2WX1A 3WIMA 2PE9A 4NJ7A 5FR6A 4CO7A 5L83A 5CHVC 2AYOB 3UF8A 2ZPNA 3PS6A 3NOBA 5D7GA 3TL5A 2LASA 4KIKB 3ZTCA 1WGGA 1ISNA 4NQLB 3VAWA 1UD7A 2DZMA 3OJ4B 4HXDA 4KSLC 2JT4B 3PHWB 1P1AA 1WYWB 3TCAA 2BYFA 2EMTA 3PTFC 2Z0EB 3NY5A 3NS8A 4W9KA 2FUHB 2LVPA 4BKSD 4FHJA 3ML8A 4HCNB 2O6VB 1V5OA 2JZ3B 2MSED 3H7SA 4MSMB 1EUVB 4PS3A 3N30A 2MP2B 1LXDA 2G4DB 3LJ3A 2AL3A 4F7ZA 1WJNA 4NNJB 4AUQC 4AWJA 4J6IA 2IO2B 2L0FA 3GOEA 2KHWB 2NBWB 3SD5A 4MSQB 3VHTC 2JUOA 2REXA 4RM8A 2MX2A 1KM7A 2KMAA 1PQSA 1WFYA 1UBQA 2NCNA 4FJZA 1ZKHA 1WGDA 4MGZE 4JL9A 2BKRB 3IG3A 1V9JA 2BKFA 3TIXA 1TZ1A 1YQBA 3JSVB 2D07B 1TTNA 4AJYB 4M8MA 4KZ0A 3U7DA 2UWQA 4ZRJA 4A20A 2G4SA 1S1QB 2KJRA 2LJ5A 2CS4A 5GMVA 3QAQA 1K8RB 4NAWA 4WJNA 1UH6A 1E8YA 4ZDVA 2PPHA 2RPQA 1V6EA 2MBQA 3DPDA 3M3JA 4HJKA 4GDKB 4DDGD 2L76A 3CSTA 4LDTB 2JPHA 2A4ZA 3ECIA 3IVFA 4OVUA 4ANWA 4BVUC 2ZCBA 5L95C 4IC7B 2FIFA 1WGYA 2KX0A 1XQQA 1UBIA 3ZIMA 1J19A 3B0AA 3A9KA 2IO0B 2KFJA 3KYCD 1E8XA 2JY6A 5TR5A 1GJZA 3EHVA 4MJSB 2KLGA 3PZDA 3PRZA 1WX8A 2BGFA 2M8SA 1KJTA 3PGEA 4ICUA 4W9FA 4A3PA 3MHSD 3PLUA 4BKSA 4YL8A 4EKUA 3H1UA 4NPNA 2I1JA 2FCQA 1C3TA 3QHTA 4HPMB 4DHZE 5G2NA 4E74A 2IY0B 2NS5A 4CHKA 2MRPA 5J17A 4K7SA 1WM3A 2N9EB 3RCZA 2Y5BB 2FIDA 4ZRKA 3Q3FA 4XX5A 2IO1B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2G3Q B;  5DPW A;  1RAX A;  3LDZ E;  3ZDT A;  3QWZ B;  2FCM A;  3V62 A;  3ZVV A;  4MJS A;  3KH0 A;  4IM0 A;  4KV2 A;  4NJ6 A;  1HE8 A;  2JWZ A;  4EZJ A;  2DYM A;  2GOW A;  2KJH B;  4MM3 A;  4JLC A;  2KJ6 A;  2K8C A;  2R2Q A;  2C9W B;  4MGK E;  3L0W B;  4GOC A;  2XBB C;  4PYU A;  3W1Y A;  1FXT B;  2LGX A;  3CSF A;  1RRB A;  3EC8 A;  1XT9 B;  3M63 B;  1WMH B;  2AEH A;  1VD2 A;  2KC2 A;  4WWP A;  4EEW A;  5DCN A;  2V4L A;  1E7U A;  2AL6 A;  2BWF A;  3H6N A;  1LM8 B;  2NPT A;  5AZG A;  3PT2 B;  1WRD B;  2M0X A;  4EUT A;  3RT3 B;  1SE9 A;  3BY4 B;  3A33 B;  2KDF B;  2BWE S;  1X1M A;  4EZK A;  3HM6 X;  3L16 A;  3PRM B;  1RFA A;  2M4N A;  3R7R A;  3QAR A;  2KAN A;  4K81 A;  3UIO B;  3DVG X;  4KVG B;  2DZJ A;  2MBO A;  3VTW A;  1TGZ B;  2LI5 A;  1WE7 A;  1P98 A;  2ZNV B;  2HTH A;  3N32 A;  3H9D A;  1WJ4 A;  4KZC A;  3UGB B;  2KKC A;  3A4R A;  1LFD A;  3V60 A;  3T8M A;  4IWQ A;  5LXH A;  4E3C A;  2J0J A;  2YVC A;  2L05 A;  1AAR A;  3JVZ X;  1WGH A;  1NI2 A;  2AWT A;  2CR5 A;  3ZRF A;  1G6J A;  1GG3 A;  4A3O A;  3UQA A;  2L0T A;  4TQ1 A;  4MDK E;  4TUU A;  5D2M B;  1IYF A;  3AI5 A;  5BO4 B;  2GBN A;  4CYE A;  2HJ8 A;  1WJU A;  2N4F A;  3ZNI D;  3U8Z A;  1T0Y A;  2MA9 B;  1EO6 A;  2K25 A;  4W9I A;  1WY8 A;  4B6W A;  4B95 A;  3DVG Y;  4PS7 A;  1OEY A;  3KW5 B;  4KSK C;  4FHK A;  3AU5 A;  3RYT A;  4BBN F;  3DBH I;  2M17 A;  3WAO A;  2XK5 A;  3AU4 A;  4IG7 B;  3BIN A;  1E90 A;  4G50 A;  3KUD B;  3OLM D;  3SHQ A;  3V6E B;  3ENE A;  3QQ8 B;  2DAJ A;  2BPS A;  4MH0 E;  2IBI B;  2DYO A;  4W9D A;  4IWO A;  1UGM A;  3VFK A;  1YJ1 A;  4EFO A;  1H8C A;  3DQV A;  5JHA A;  2L8J A;  4W9E A;  2DZK A;  2JXX A;  1WR1 A;  2WX0 A;  4DHJ D;  3IBE A;  4BKG A;  5C23 A;  3RZF A;  2RSU A;  3MTN B;  2MBB B;  2LGY A;  3APC A;  2I1K A;  4FUL A;  3SDL C;  1WR6 E;  4LJO B;  4W9C A;  3DCG A;  1YX5 B;  3ZW3 A;  2KQ7 A;  4IWP A;  4GDK A;  4ANU A;  3ONS A;  3ZRC A;  4ZRI A;  2XK5 B;  2LVO A;  3PRP B;  4M0W B;  5KHO A;  4NY0 A;  2ZVN A;  2VRR B;  3EFU A;  4E71 A;  4EOY A;  2KDE B;  3L08 A;  2KQS A;  2MBH A;  5E6O A;  3K9O B;  4GIV A;  4I6N B;  1Q5W B;  2JZZ A;  3VVW B;  1P3Q U;  3CMM B;  4HCP B;  2FCN A;  3GZN I;  4IM2 A;  3WA0 A;  5J2R A;  2J7Q B;  4K7W A;  2EKE C;  3OJ3 A;  3R7Q A;  3DVN V;  4HPL B;  2N7D A;  1V81 A;  1V2Y A;  2K8H A;  2LRW A;  1YD8 U;  4WJQ A;  4BKT A;  4FAD A;  3NZS A;  4MGY E;  4AOF A;  2K1F A;  2D10 A;  3UIN B;  1WXS A;  2CKH B;  2GBJ A;  2LUE A;  1I42 A;  2LXC A;  1ZGU B;  2CHW A;  3ZKJ C;  4W9L A;  3IFW B;  1E8W A;  5JZE B;  3L13 A;  4WWO A;  2ZEQ A;  2BF8 B;  4M8N A;  4XZ4 A;  3WAP A;  3H7P B;  4HDQ A;  1KLV A;  3JYU A;  5LXI B;  4WJP A;  1NDD A;  4WAA A;  3PSE B;  3VUW A;  1I35 A;  2KFK A;  3VH4 B;  3VDZ A;  3A4S C;  2J0M A;  2PEA A;  2L7R A;  3PLV A;  1V49 A;  2FNJ B;  2KXJ A;  4GN1 A;  1BT0 A;  4XC2 A;  1R4M I;  4JQW C;  1WX9 A;  3VH3 B;  3WAL A;  4DBG A;  4IM3 A;  2WWZ A;  3NHE B;  3PVL A;  2HE7 A;  3U30 A;  5DPS A;  4BOZ B;  4FA6 A;  2C7N B;  2KO3 A;  3A9J A;  5HKH A;  1WXA A;  3D32 A;  2M1M A;  2LXA A;  2C60 A;  2MBE A;  4FBJ B;  1ZW7 A;  3H7P A;  2OOB B;  4GXB A;  3ZUN A;  3VQI A;  3PPA A;  2KC1 A;  1WMH A;  4FN2 A;  1R4N I;  3A1Q B;  4W9H A;  1H4R A;  1WZ3 A;  4MEL A;  4URK A;  2IO3 B;  2KOX A;  5IAA C;  2JVC A;  4II2 B;  3ZO5 B;  4HDO A;  2MCN B;  4P7I A;  3ALB A;  4I6P A;  3KVF B;  1EF5 A;  4GDL A;  2J0K A;  5DPT A;  2KLC A;  2KN5 A;  3L17 A;  2CHZ A;  2CHX A;  3RD2 A;  3TMP B;  2L3Z A;  2EMS A;  4B9K A;  3W1S A;  2LZ6 A;  1OGW A;  1QZE A;  3RZW C;  2KZR A;  2BYE A;  2GBR A;  5CHW A;  1WXM A;  1V86 A;  2GMI C;  4ICV A;  5E6N A;  1WF9 A;  3NZU A;  5LLI A;  4MGI E;  3ZNZ B;  3R66 C;  4LCD E;  4DWF A;  3ZTD A;  2NVU I;  2C5L C;  2DHZ A;  2Z59 B;  3PHX B;  1YIW A;  2DEN B;  1LQB A;  1CMX B;  4EZL A;  3DOW A;  4ANX A;  4JGH B;  4GB9 A;  4MEM A;  2DZI A;  1S3S G;  2GBK A;  4BFR A;  4DDI D;  4DHZ B;  3WAN A;  3AXC A;  2YLM A;  2N1W A;  1YX6 B;  2O6V D;  2XEW A;  3OAW A;  4OVV A;  2BYV E;  4GDL B;  4PS8 A;  2N7E A;  3DBR I;  3Q3J A;  5C1Z A;  2IZV B;  2DAF A;  2KVR A;  3ML9 A;  3DVN U;  3WAM A;  2IY1 B;  4KIK A;  3HHM A;  2N1V A;  2KX3 A;  1Q1O A;  1WZ0 A;  2FAZ A;  3R3M A;  2UYZ B;  2ZVO A;  2D11 A;  3CF6 E;  1P0R A;  2KMC A;  4I6L B;  4WQO B;  3O65 B;  3HK0 A;  4G3X B;  4G0N B;  4WJO A;  4X57 B;  3V61 A;  1NBF C;  2N9P C;  4WWN A;  1F9J A;  4HVB A;  5JHB A;  1OEY J;  3A9J B;  1KOT A;  3B08 A;  2LWP A;  2LVQ A;  2O2V B;  1OQY A;  3N3K B;  4GU2 A;  3V6C B;  2KDI A;  1D3Z A;  4RMA A;  3UQB A;  2WYQ A;  2WDT B;  2MP2 A;  2ZJD A;  5DPR A;  4BBN C;  4HK2 A;  4IW0 A;  4K7U A;  1U4A A;  2V1Y A;  2KFK B;  4IUM B;  2ZPY A;  1OTR B;  2ZNV C;  3QJZ A;  3HIZ A;  4NQK E;  2A5U A;  4RM9 A;  1WGR A;  4ANV A;  1TBE A;  2DX5 B;  4KDL B;  3QK0 A;  3X23 A;  2PJH A;  2MLB A;  3K9P B;  3KUC B;  4K1R B;  4AJW A;  5CHF A;  2R2O A;  4N9F 4;  5AZH A;  5G55 A;  1J0G A;  1IPG A;  1WX7 A;  2D3G A;  5D6J B;  4DHJ B;  3VTU A;  2O2V A;  2W9N A;  2KWC A;  2LD9 A;  4PYZ A;  3SU8 X;  2KTR A;  1WXV A;  2D2Q A;  4LDT D;  1E8Z A;  1WIA A;  2V3S A;  3EEC A;  5KHQ A;  3A1Q A;  1Q0W B;  1A5R A;  3X0W A;  1P9D U;  2LRU A;  1VCB A;  2C7M B;  3B1L X;  1WH3 A;  4KDI C;  2O6V A;  3APF A;  4ZYN A;  3M95 A;  4FLH A;  1GC6 A;  1WJ6 A;  1SIF A;  1UZX B;  1V80 A;  2KWU B;  3AUL A;  4G11 A;  3ZNG C;  3L10 B;  1V5T A;  2KD0 A;  3VUY A;  2FCS A;  2Z0D B;  3MJW A;  4BOS C;  5J18 A;  3P2B A;  5IA7 A;  3QCA A;  3QIJ A;  3KYD D;  3HM3 A;  3QX1 A;  2OJR A;  3APD A;  3T9L A;  3KUZ A;  5AZF A;  1WM2 A;  1XD3 B;  2QHO A;  3JW0 X;  3TBL D;  5CX3 A;  2NR2 A;  1IP9 A;  2KDB A;  2K6Q A;  4AP4 C;  4TQ0 A;  1L2N A;  1MG8 A;  3DDC B;  2KNB A;  3W1S C;  3ZDM C;  2K39 A;  4JIO U;  1GUA B;  3I3T B;  3JSV A;  3PRE A;  1C1Y B;  2JRI B;  2ZCC A;  3C0R B;  3M62 B;  4HWI B;  3UIP B;  4FJV B;  1WI0 A;  4FJY A;  4F1S A;  4II3 B;  1EF1 A;  4W9J A;  4HLE A;  5JH5 C;  2C7H A;  3RUI B;  3DBS A;  3DBL I;  3L54 A;  2RGF A;  2HD5 B;  4NAW B;  1E5W A;  5E6P A;  2ASQ A;  3QC8 B;  4F8C B;  1JRU A;  2N9X A;  1M94 A;  1SGH A;  3QA8 A;  2KWV B;  4DK5 A;  4W9G A;  2K6D B;  4ASW C;  2ZZP B;  2GBM A;  4GGQ A;  3RUL A;  1Z2M A;  2KTF A;  2LGD A;  2MW5 A;  1J8C A;  1GC7 A;  2JF5 A;  3PV1 A;  3A9K B;  3IHP C;  2G45 B;  1RLF A;  2K8B A;  2MQJ A;  2NBV B;  3VTV A;  4DXA B;  5CTR C;  2KTR B;  4LJP B;  1Y8R C;  2B3A A;  4TV3 A;  3ZNH B;  2PE6 B;  3VXW A;  2NBU A;  4GMV A;  1WE6 A;  1Z5S B;  5D94 A;  3VUX A;  2RD0 A;  5EDS A;  2NPT B;  2DYB A;  4TKN A;  4GSW A;  2RR9 A;  2KK8 A;  2JRH A;  1GNU A;  3TJP A;  3ZLZ A;  1L7Y A;  3S2A A;  2IYD B;  2L00 B;  5AEK B;  2MWS B;  1E7V A;  1UEL A;  2CU1 A;  2WX1 A;  3WIM A;  2PE9 A;  4NJ7 A;  5FR6 A;  4CO7 A;  5L83 A;  5CHV C;  2AYO B;  3UF8 A;  2ZPN A;  3PS6 A;  3NOB A;  5D7G A;  3TL5 A;  2LAS A;  4KIK B;  3ZTC A;  1WGG A;  1ISN A;  4NQL B;  3VAW A;  1UD7 A;  2DZM A;  3OJ4 B;  4HXD A;  4KSL C;  2JT4 B;  3PHW B;  1P1A A;  1WYW B;  3TCA A;  2BYF A;  2EMT A;  3PTF C;  2Z0E B;  3NY5 A;  3NS8 A;  4W9K A;  2FUH B;  2LVP A;  4BKS D;  4FHJ A;  3ML8 A;  4HCN B;  2O6V B;  1V5O A;  2JZ3 B;  2MSE D;  3H7S A;  4MSM B;  1EUV B;  4PS3 A;  3N30 A;  2MP2 B;  1LXD A;  2G4D B;  3LJ3 A;  2AL3 A;  4F7Z A;  1WJN A;  4NNJ B;  4AUQ C;  4AWJ A;  4J6I A;  2IO2 B;  2L0F A;  3GOE A;  2KHW B;  2NBW B;  3SD5 A;  4MSQ B;  3VHT C;  2JUO A;  2REX A;  4RM8 A;  2MX2 A;  1KM7 A;  2KMA A;  1PQS A;  1WFY A;  1UBQ A;  2NCN A;  4FJZ A;  1ZKH A;  1WGD A;  4MGZ E;  4JL9 A;  2BKR B;  3IG3 A;  1V9J A;  2BKF A;  3TIX A;  1TZ1 A;  1YQB A;  3JSV B;  2D07 B;  1TTN A;  4AJY B;  4M8M A;  4KZ0 A;  3U7D A;  2UWQ A;  4ZRJ A;  4A20 A;  2G4S A;  1S1Q B;  2KJR A;  2LJ5 A;  2CS4 A;  5GMV A;  3QAQ A;  1K8R B;  4NAW A;  4WJN A;  1UH6 A;  1E8Y A;  4ZDV A;  2PPH A;  2RPQ A;  1V6E A;  2MBQ A;  3DPD A;  3M3J A;  4HJK A;  4GDK B;  4DDG D;  2L76 A;  3CST A;  4LDT B;  2JPH A;  2A4Z A;  3ECI A;  3IVF A;  4OVU A;  4ANW A;  4BVU C;  2ZCB A;  5L95 C;  4IC7 B;  2FIF A;  1WGY A;  2KX0 A;  1XQQ A;  1UBI A;  3ZIM A;  1J19 A;  3B0A A;  3A9K A;  2IO0 B;  2KFJ A;  3KYC D;  1E8X A;  2JY6 A;  5TR5 A;  1GJZ A;  3EHV A;  4MJS B;  2KLG A;  3PZD A;  3PRZ A;  1WX8 A;  2BGF A;  2M8S A;  1KJT A;  3PGE A;  4ICU A;  4W9F A;  4A3P A;  3MHS D;  3PLU A;  4BKS A;  4YL8 A;  4EKU A;  3H1U A;  4NPN A;  2I1J A;  2FCQ A;  1C3T A;  3QHT A;  4HPM B;  4DHZ E;  5G2N A;  4E74 A;  2IY0 B;  2NS5 A;  4CHK A;  2MRP A;  5J17 A;  4K7S A;  1WM3 A;  2N9E B;  3RCZ A;  2Y5B B;  2FID A;  4ZRK A;  3Q3F A;  4XX5 A;  2IO1 B; 
#chains in the Genus database with same CATH topology
 5DPW A;  3V62 A;  2DYM A;  3NZ3 A;  2KJH B;  2K8C A;  3L0W B;  4GOC A;  3BVM A;  1XCQ L;  3RI7 C;  1C78 A;  4WWP A;  1VD2 A;  4PT5 A;  1LM8 B;  3NRZ A;  3EFC A;  2M0X A;  3RT3 B;  1SE9 A;  2R61 A;  1X1M A;  1CZP A;  3UIO B;  2DZJ A;  2MBO A;  5EE3 A;  3VTW A;  1TGZ B;  3KWV A;  1WE7 A;  1P98 A;  2ZNV B;  2HTH A;  4TSS A;  1WJ4 A;  4KZC A;  3UGB B;  3T8M A;  4IWQ A;  5LXH A;  1ZP0 B;  2J0J A;  2YVC A;  1G6J A;  2INN E;  1B9R A;  1HEZ E;  3EA6 A;  4XDC A;  5BO4 B;  3ZXV A;  2Z8L A;  4YTM B;  1T0Y A;  3SEB A;  1MI0 A;  4PS7 A;  4IG7 B;  3V3X A;  2YEP B;  3W5V B;  3OLM D;  3ENE A;  2DAJ A;  1QT9 A;  2DYO A;  3GB1 A;  1H8C A;  3ZGZ A;  2DZK A;  2WX0 A;  1ET9 A;  2N7J A;  3IBE A;  3RZF A;  2LGY A;  2D3B A;  2I1K A;  1WR6 E;  3Q3M C;  1IUE A;  1MVK A;  2MHJ A;  2KQ7 A;  2E3T A;  4IWP A;  3ONS A;  5KHO A;  4NY0 A;  3EFU A;  1DOY A;  1TKG A;  1XLO A;  1Q5W B;  2M19 A;  3CMM B;  2FCN A;  3GZN I;  5J2R A;  2MJ3 A;  2ZW0 A;  1DOX A;  5BMG A;  2X8X X;  2LRW A;  1YD8 U;  4BKT A;  3N20 C;  1I7H A;  4AOF A;  4N6E B;  3UIN B;  2LUE A;  2G9H D;  3ZKJ C;  3TUO A;  1FIQ A;  3NVZ A;  1ZPS A;  4WWO A;  2BF8 B;  3H7P B;  2J4X A;  5LXI B;  4WJP A;  2NTS A;  3GE3 C;  3VUW A;  3AE7 B;  3P1M A;  1EWC A;  1FRR A;  2KFK A;  2WXP A;  4RF0 A;  2J0M A;  3R2T A;  2L7R A;  1V49 A;  1DOI A;  4XC2 A;  3VH3 B;  4S0R A;  2WWZ A;  2HE7 A;  5DPS A;  3Q69 A;  4FA6 A;  1WRI A;  2LXA A;  2MBE A;  3VQI A;  2KC1 A;  1XF5 L;  2LGS A;  1R4N B;  2W3S A;  4FN2 A;  4JE3 B;  2J42 A;  1H4R A;  2JSV X;  2IO3 B;  1SSN A;  5IAA C;  4II2 B;  4HDO A;  5BYS A;  1EF5 A;  3AE8 B;  3U7Z A;  4JPS A;  2CHX A;  2L3Z A;  3W1S A;  1OGW A;  5CHW A;  3W5U B;  1L4Z B;  1JCK B;  1PGA A;  2DEN B;  3I57 A;  4GB9 A;  2YLM A;  4XWT A;  2N1W A;  4OVV A;  1F1H A;  2N7E A;  3DBR I;  1FM0 D;  4YSZ B;  3FKY A;  3Q2A C;  2IY1 B;  5I4D A;  4LLG M;  2N1V A;  2QMT A;  1Q1O A;  1WZ0 A;  1P0R A;  4G3X B;  5EE1 A;  2N9P C;  4WWN A;  1GPX A;  1KOT A;  1WYG A;  3N3K B;  1VZ7 A;  3UQB A;  2WYQ A;  2WDT B;  2MP2 A;  5EE9 A;  4BBN C;  4IW0 A;  2V1Y A;  4YSX B;  2ZPY A;  3KWL A;  3Q3O C;  2A5U A;  4KKI A;  3B2G A;  3MFG A;  1DGJ A;  3R8B A;  1KRH A;  3X23 A;  4AJW A;  3LB8 C;  5G55 A;  1J0G A;  2D3G A;  1T0R C;  4PYZ A;  2KWC A;  2LD9 A;  3SU8 X;  2V9H A;  4RFB A;  2D2Q A;  1I4R A;  5D3D A;  3RNE C;  1IGD A;  2LRU A;  1XO3 A;  3B1L X;  3APF A;  2E6X A;  1GC6 A;  1WJ6 A;  1SIF A;  1V80 A;  4G11 A;  1NEN B;  3L10 B;  2QSD A;  2WNM A;  3QIJ A;  3KYD D;  3QX1 A;  1SF0 A;  1C79 A;  1L6V A;  1KF6 B;  2NR2 A;  1NVI D;  3U4E G;  1MG8 A;  2K39 A;  3I3T B;  3JSV A;  3PRE A;  3C0R B;  1UNS A;  1WI0 A;  1EF1 A;  1PYW D;  5JH5 C;  1FNV A;  4M01 A;  2RPV A;  2L32 A;  1E5W A;  1N60 A;  5E6P A;  1T5X D;  4HKQ A;  4FXC A;  1JRU A;  1YN3 A;  2N9X A;  1M94 A;  4W9G A;  2K6D B;  2V3N A;  1J8C A;  3FC4 A;  1GC7 A;  2JF5 A;  3AEF B;  1RLF A;  2MQJ A;  4BZA A;  3ZXR A;  4TV3 A;  3VXW A;  4GMV A;  5D94 A;  1DYQ A;  1C4P A;  2DYB A;  4TKN A;  1LGR A;  2RR9 A;  1L7Y A;  5AEK B;  3RPF C;  1T0Q C;  2K0P A;  1UEL A;  2KQ4 X;  2LHE A;  3WIM A;  4NJ7 A;  4YT0 B;  1KH0 A;  3P4S B;  3UF8 A;  2ZPN A;  3HUI A;  3IAM 1;  3NOB A;  4HRO A;  1ISN A;  2DZM A;  3OJ4 B;  2ACZ B;  4KSL C;  3VR8 B;  2WXH A;  1J7C A;  3NJT A;  2Q5W D;  4MM3 B;  3TEY A;  4W9K A;  1OFF A;  2O6V B;  3H7S A;  4PS3 A;  2G4D B;  3LJ3 A;  4AUQ C;  2IO2 B;  2L0F A;  3GOE A;  3VR9 B;  2NBW B;  4MSQ B;  2JUO A;  4RM8 A;  2BS2 B;  1NI3 A;  2MX2 A;  2KMA A;  4FJZ A;  4A55 A;  3IG3 A;  3JSV B;  1YQB A;  4XWW A;  1TTN A;  1SEB D;  1F0Z A;  1VRA B;  4LNK A;  2UWQ A;  1YJI A;  4ZRJ A;  2KJR A;  2WQY B;  2FBW B;  5GMV A;  2YEP F;  1RYJ A;  5EE0 A;  1UH6 A;  5IO9 A;  1V6E A;  2MBQ A;  4HJK A;  2LFI A;  4GDK B;  2RDG A;  2L76 A;  2JPH A;  2L83 A;  2CJN A;  1UBI A;  3Q8F A;  3A9K A;  2JY6 A;  4WWM A;  3R2I A;  2M8S A;  1KJT A;  3PGE A;  1IBX A;  3DBR B;  3RNC C;  2PTL A;  2KWD A;  3H1U A;  2FCQ A;  2IJ0 A;  2V3P A;  5G2N A;  1FXA A;  4DHZ E;  4E74 A;  2IY0 B;  4US9 A;  1WM3 A;  2KAC A;  2IDY A;  2Y5B B;  2FID A;  1TZO A;  4ZRK A;  2L1A A;  4XX5 A;  2LMC A;  5BMH A;  4L1B A;  1R7S A;  1HE8 A;  2QIE B;  2R2Q A;  4PYU A;  1FXT B;  1ZUD 2;  2IGH A;  1I4G A;  2N0S B;  1RRB A;  2DNF A;  3MC0 B;  1XT9 B;  1WMH B;  2KC2 A;  4EEW A;  1JML A;  1E7U A;  1EM7 A;  1V1O A;  1WRD B;  1FFU A;  4RGO S;  3BY4 B;  3A33 B;  4JWU C;  2BWE S;  4M0W A;  5IP4 D;  2KAN A;  3IT4 B;  3LXF A;  5IKC M;  2ON8 A;  3P63 A;  3J9C A;  1K50 A;  5C2T B;  3V60 A;  1Q10 A;  1I4P A;  1AAR A;  1JWM D;  5FKA C;  1WGH A;  2MJE A;  3NVY A;  3ZRF A;  2GB1 A;  4A3O A;  2L0T A;  4TQ1 A;  1KFY B;  4MDK E;  4KGT A;  4TUU A;  2GBN A;  4CYE A;  2HJ8 A;  1WJU A;  2N4F A;  4WAF A;  2MA9 B;  1EO6 A;  2K25 A;  4B95 A;  3DVG Y;  1OEY A;  4KSK C;  1AW7 A;  3RYT A;  2PMV A;  3ZQ4 A;  3DBH I;  2KAJ A;  3BIN A;  3AN1 A;  2WXI A;  1ACC A;  3QQ8 B;  1ZOY B;  1FCL A;  2IBI B;  1UGM A;  3VFK A;  3DQV A;  5JHA A;  1SE4 A;  1FNW A;  1XLQ A;  1WR1 A;  4RF1 A;  2RSU A;  3SDL C;  3APC A;  4FUL A;  4W9C A;  1JRP A;  2HJ1 A;  2BTE A;  1YX5 B;  4RGT A;  3ZW3 A;  1XCT L;  4ANU A;  3ZRC A;  3KLS X;  4ZRI A;  2XK5 B;  4YTP B;  2ZVN A;  4E71 A;  4EOY A;  1N6Z A;  2KQS A;  5E6O A;  4I6N B;  3NVV A;  1P3Q U;  3WA0 A;  4HCP B;  3AEA B;  3LYY A;  2N7D A;  1V81 A;  2K8H A;  3EGR A;  2K1F A;  1K52 A;  1ZGU B;  3P4R B;  1D5M C;  3P4Q B;  4WUR A;  1K53 A;  3RN9 C;  1KLV A;  1QIL A;  2VH1 A;  5LNK 1;  1I35 A;  2PLP A;  1MJD A;  3VDZ A;  3A4S C;  1F52 A;  1SB3 C;  2PIA A;  4IM3 A;  1YN5 A;  4NZL B;  3Q6B A;  4BOZ B;  2BT6 A;  3A9J A;  1ENF A;  5HKH A;  1WXA A;  2M1M A;  1T0S C;  2J53 A;  4FBJ B;  4GXB A;  2K9X A;  1XXG A;  2SAK A;  4MEL A;  4URK A;  2IND C;  4XGA B;  4B0M A;  2JVC A;  3ZO5 B;  3VRA B;  2WDV B;  3BII D;  5DPT A;  2J0K A;  2KN5 A;  3L17 A;  3ZYY X;  2CHZ A;  2EMS A;  2RDB C;  2VZK D;  3RZW C;  4EE2 A;  5E6J A;  3H8H A;  2GBR A;  2WU2 B;  3I9V 1;  2GMI C;  4ICV A;  1WF9 A;  5HFY A;  4MGI E;  3R66 C;  4LCD E;  1UWM A;  2Z59 B;  2WLB A;  1LQB A;  1CMX B;  4EZL A;  1MHX A;  4ANX A;  4BFR A;  2DZI A;  3AEB B;  1HZ5 A;  2XEW A;  1YX6 B;  4GDL B;  4ZHP A;  1D4B A;  3Q3J A;  2KMM A;  5HHD G;  3ML9 A;  3DVN U;  3WAM A;  3R3M A;  4I6L B;  4KGR A;  2KMC A;  2WXL A;  3V61 A;  2B76 B;  3SFD B;  3T3N A;  1OEY J;  1ET6 A;  2JU6 X;  1OQY A;  4GU2 A;  1E9M A;  2ZJD A;  5DPR A;  4HK2 A;  4WIP A;  1HTQ A;  2WXR A;  2ZNV C;  2KDM A;  4RM9 A;  4ANV A;  1HQR D;  2DX5 B;  4KDL B;  4LTU A;  3K9P B;  2R2O A;  4IKG A;  2JXT A;  4N9F 4;  3VRB B;  1IPG A;  1WX7 A;  4DHJ B;  3Q8C A;  3VTU A;  2W9N A;  1QQR A;  1WXV A;  1CK1 A;  1JW9 D;  3A1Q A;  1JAL A;  1A5R A;  2WXK A;  1VCB A;  4ITK A;  2WHI A;  4Q2J A;  1WH3 A;  3NVW A;  4FLH A;  2KWU B;  1V5T A;  2KD0 A;  3ZJV A;  1BUI C;  3NUH B;  2N9K A;  1C77 A;  2FE8 A;  2OJR A;  4H2A A;  2D3A A;  1E10 A;  2QHO A;  1GAQ B;  4NAM A;  2KDB A;  2K6Q A;  4AP4 C;  4L2Y A;  1SJE D;  3W1S C;  1GUA B;  2QC8 A;  3UIP B;  4M00 A;  1IGC A;  2WXG A;  4HLE A;  3DBL B;  2HD5 B;  1FRD A;  2KT7 A;  4LK0 M;  3MHZ A;  4F8C B;  3RNG C;  4DK5 A;  4ASW C;  2GBM A;  3FIL A;  2WGS A;  1EU3 A;  2XN9 C;  2BQQ A;  1YQ4 B;  3U2S C;  2BYT A;  2G45 B;  2K8B A;  4N59 A;  4DXA B;  5CTR C;  2OJW A;  2KTR B;  1Y8R C;  1ROE A;  2IPK D;  1Z5S B;  2M0A A;  5EDS A;  2NPT B;  3C19 A;  2KK8 A;  3TJP A;  2MWS B;  2DLB A;  2BW2 A;  5FK9 C;  2PE9 A;  4C80 A;  5CHV C;  1F2R I;  5D7G A;  3TL5 A;  1FFV A;  2RDH A;  1TS4 A;  2JWU A;  4NQL B;  2JT4 B;  1YMH E;  3Q3N C;  4LNI A;  3PTF C;  4D2K A;  1N5X A;  1XLP A;  2FUH B;  1KLG D;  4BKS D;  3ML8 A;  4HCN B;  2QJL A;  4GLS C;  3N30 A;  2MP2 B;  2KVZ A;  2AL3 A;  4F7Z A;  1MHH E;  2G1E A;  2KHW B;  3HVZ A;  1F2R C;  3SD5 A;  1VZ8 A;  1KM7 A;  4CQN A;  1JWA D;  2CU3 A;  1WFY A;  1WGD A;  1V9J A;  3TIX A;  4AJY B;  1FEH A;  4M8M A;  4KZ0 A;  3U7D A;  4A20 A;  1K8R B;  1KLU D;  2PPH A;  2RPQ A;  3CST A;  3BWU D;  3P4P B;  1JWU D;  4LNO A;  2AQ2 B;  2A4Z A;  3IVF A;  4ANW A;  4BVU C;  2V0G A;  2V4I B;  1PUT A;  4IC7 B;  2FIF A;  1XQQ A;  1PDX A;  3AMZ A;  3DBH B;  3IXS A;  1GJZ A;  2KLG A;  3O13 A;  1JQ4 A;  2J52 A;  3DHI C;  2VZK B;  4ICU A;  3MHS D;  4BKS A;  4YL8 A;  4EKU A;  4JWS C;  1ZXI A;  2HDE A;  1GOZ A;  1J7A A;  2N9L A;  4OZB A;  1QF6 A;  1OQR A;  1ZXH A;  3AE9 B;  2Y3A A;  3ZDT A;  3QWZ B;  4XE0 A;  3ZVV A;  2INP E;  3KH0 A;  4KV2 A;  4NJ6 A;  2GOW A;  4AS1 A;  4JLC A;  2KJ6 A;  4MGK E;  2XBB C;  3W1Y A;  2LGX A;  2BS4 B;  2AEH A;  5AUI A;  5DCN A;  2AL6 A;  2BWF A;  4EUT A;  2W82 A;  3FAH A;  2KDF B;  4EZK A;  3HM6 X;  3PRM B;  1RFA A;  1L0Y B;  4K81 A;  4HPP A;  4KVG B;  4HEA 1;  4R3D A;  1MPE A;  4KX6 B;  3N32 A;  2KKC A;  1LFD A;  3Q8A A;  3JVZ X;  1NI2 A;  4XDD A;  1GG3 A;  2PW9 A;  1IYF A;  5D2M B;  1HA5 A;  2LEK A;  5BMI A;  1GB4 A;  1QOA A;  2D5G A;  4W9I A;  1WY8 A;  1QOB A;  4FHK A;  4BBN F;  4P6V F;  2M17 A;  3WAO A;  2XK5 A;  3AU4 A;  4C7Z A;  3W2D A;  1E90 A;  3V6E B;  1YQ3 B;  1CJE A;  2BPS A;  4MH0 E;  1SBB B;  4W9D A;  2L8J A;  4DXF A;  2JXX A;  1MG4 A;  2JZP A;  3UI3 A;  1RFK A;  4P16 A;  4BKG A;  3MTN B;  5BYQ A;  3DHH C;  4USA A;  4LJO B;  3Q14 C;  3DCG A;  1A70 A;  4GDK A;  3PRP B;  2VRR B;  3AE6 B;  1R4M B;  3L08 A;  2MBH A;  2JX5 A;  4GIV A;  3GZN B;  4K7W A;  3OJ3 A;  3R7Q A;  4HPL B;  1V2Y A;  4WJQ A;  4C00 A;  4MGY E;  1WXS A;  2CKH B;  1I42 A;  3IFW B;  1E8W A;  1I4X A;  1T3Q A;  3ZJU A;  1E6E B;  4XZ4 A;  2K22 A;  4HDQ A;  5JXV A;  4S17 A;  3JYU A;  1NDD A;  4WAA A;  3PSE B;  3VH4 B;  3MP9 A;  3PLV A;  1YN4 A;  2FNJ B;  3B2F A;  2KXJ A;  1WX9 A;  3WAL A;  2GI9 A;  3U30 A;  2MEK A;  4ZHO A;  1TS5 A;  3D32 A;  2C60 A;  3ZUN A;  3PPA A;  1WMH A;  2WS3 B;  3PZ8 A;  1R4N I;  5IN7 A;  2AQ1 B;  1MFW A;  1K51 A;  2KOX A;  3P42 A;  2EEL A;  3ALB A;  4I6P A;  2WXJ A;  3KVF B;  4GDL A;  4IOI E;  5G5H A;  1SJH D;  2KLC A;  3TMP B;  2DWQ A;  3SR6 A;  1WXQ A;  3URY A;  3AE1 B;  2KZR A;  3DWG C;  1WXM A;  2FUG 1;  3AV8 A;  1ZDX A;  1FPY A;  4P1C C;  1YNT E;  5TSS A;  5LLI A;  3ZNZ B;  4OW0 A;  3ZTD A;  2C5L C;  2DHZ A;  3IT6 B;  3PHX B;  1YIW A;  4RNA A;  2SEB D;  4ZRP A;  4MEM A;  4DHZ B;  3WAN A;  2KN4 A;  3OAW A;  2O6V D;  2BYV E;  5C1Z A;  2AX5 A;  2IZV B;  2DAF A;  2KVR A;  4REZ A;  3TEW A;  1C4C A;  1HXY D;  3HHM A;  2UYZ B;  2ZVO A;  2D11 A;  3CF6 E;  4X57 B;  3TSS A;  3O65 B;  2D3C A;  3HK0 A;  4WJO A;  1WWT A;  1NBF C;  4NJC A;  2BVC A;  2QIL A;  4HVB A;  5JHB A;  3B08 A;  4C56 C;  2LVQ A;  3V6C B;  4B0E A;  4K7U A;  1U4A A;  2KFK B;  4IUM B;  1OTR B;  4LNN A;  1TBE A;  4OZA A;  4IDI A;  5BYR A;  1SE3 A;  2PJH A;  2MLB A;  3KUC B;  1NEK B;  5D6J B;  2O2V A;  1VJK A;  4LDT D;  1QLB B;  3EEC A;  5KHQ A;  1BXT A;  3X0W A;  1P9D U;  1ESF A;  4KDI C;  2O6V A;  4ZYN A;  4XYC A;  3M95 A;  3SFE B;  3N1Z C;  1UZX B;  3AUL A;  3ZNG C;  4A90 A;  3T3O A;  2Z0D B;  4BOS C;  1P7F A;  3P2B A;  1TY2 A;  3HM3 A;  1WSP A;  5AUK A;  1D6E C;  1WM2 A;  1QOF A;  3N9Y C;  2OED A;  4TQ0 A;  4ARI A;  2KNB A;  3E56 A;  2WP9 B;  3M62 B;  4FJV B;  2UU7 A;  1WGK A;  4C4V A;  3AEE B;  4II3 B;  3RUI B;  2DBY A;  3L54 A;  1C76 A;  3RFZ B;  4NAW B;  3PO0 A;  3GP7 A;  4KKJ A;  2ASQ A;  2K3U A;  3QC8 B;  1SGH A;  3RMK C;  2KWV B;  4YXD B;  2ZZP B;  4GGQ A;  3RUL A;  3TEX A;  1HZ6 A;  2KTF A;  2QCZ A;  3PV1 A;  3ETR A;  3A9K B;  1V1P B;  4ACF A;  1SE2 A;  2NBV B;  3C8Y A;  3VTV A;  5HI1 A;  4LJP B;  2B3A A;  2X38 A;  4HRS A;  3BYT B;  2NBU A;  3VUX A;  2MJD A;  2H88 B;  2BBC A;  2L00 B;  1SXT A;  1E7V A;  1FMA D;  2CU1 A;  2JYT A;  4CO7 A;  3N1Y C;  5FR6 A;  2LAS A;  3RNF C;  4KIK B;  3ZTC A;  1WGG A;  3VAW A;  1UD7 A;  4HXD A;  1N5W A;  1P1A A;  1WYW B;  1RM6 C;  3TCA A;  2BYF A;  2EMT A;  3CIR B;  2NMQ A;  1ZE3 D;  3NS8 A;  4OZC A;  3BVG A;  5H92 C;  3Q8B A;  1V5O A;  1N62 A;  4MSM B;  1EUV B;  2RMM A;  1FO4 A;  2WDR B;  2EKI A;  4NNJ B;  3BK2 A;  1E7P B;  1UUP A;  4PK1 A;  3Q8E A;  2REX A;  2WXM A;  1UBQ A;  1ZKH A;  2WDQ B;  1T6B X;  2BKR B;  3AE4 B;  2D07 B;  1F77 A;  2G4S A;  2LJ5 A;  4RH6 A;  4NAW A;  4O1N A;  1E8Y A;  3DPD A;  3M3J A;  4DDG D;  1L6U A;  4LDT B;  4OVU A;  3ECI A;  2ZCB A;  1WGY A;  2AQ3 B;  3ZIM A;  3B0A A;  3RNA C;  2KFJ A;  3KYC D;  1V1P A;  3EHV A;  3PZD A;  3E9S A;  1WX8 A;  2BGF A;  3N1X C;  2WXF A;  4W9F A;  5D3I B;  3PLU A;  3DWM A;  1VDV A;  1I4Q A;  1C3T A;  4YWG G;  1N61 A;  2NS5 A;  5T8I A;  4CHK A;  2MRP A;  3U52 E;  5G5G A;  2G3Q B;  1RAX A;  3LDZ E;  2FCM A;  4MJS A;  3KQ4 A;  4IM0 A;  2JWZ A;  1HTO A;  4EZJ A;  1V97 A;  1L0V B;  4UDU C;  4MM3 A;  2C9W B;  3CSF A;  3BVZ A;  3EC8 A;  3M63 B;  4QAY A;  4HJG E;  2V4L A;  1B1Z A;  2NPT A;  3H6N A;  3PZ7 A;  5AZG A;  3PT2 B;  2QDF A;  2TSS A;  3GE8 C;  5C3J B;  3RNB C;  3AB5 A;  1UF0 A;  3L16 A;  2M4N A;  3R7R A;  3QAR A;  3DVG X;  4MT5 A;  4ARC A;  3W9C B;  2HTM E;  2LI5 A;  3H9D A;  3A4R A;  3BZD B;  4E3C A;  1E0Z A;  2L05 A;  2AWT A;  2CR5 A;  2GRI A;  3ABV B;  3UQA A;  4ZOH C;  3AI5 A;  3ZNI D;  3U8Z A;  2JQR B;  4B6W A;  1AYF A;  3AEG B;  3KW5 B;  3AU5 A;  3TEZ A;  4G50 A;  3KUD B;  4YSY B;  3SHQ A;  2BB6 A;  1J7B A;  3NG0 A;  4IWO A;  4EFO A;  1YJ1 A;  3BYY B;  4W9E A;  4DHJ D;  5C23 A;  3MJ5 A;  2MBB B;  1QOG A;  2BS3 B;  2LVO A;  3AE5 B;  4M0W B;  2KDE B;  3K9O B;  1SIJ A;  3I63 C;  1I4H A;  2JZZ A;  3VVW B;  1ZDV A;  4IM2 A;  2J7Q B;  2LHD A;  1PFD A;  2EKE C;  3DVN V;  3HVD A;  4FAD A;  1TKE A;  2NTT A;  3NZS A;  5IOI A;  5MPO A;  2D10 A;  2GBJ A;  2LXC A;  2CHW A;  4A9A A;  4W9L A;  5JZE B;  3L13 A;  2ZEQ A;  4M8N A;  3WAP A;  4L23 A;  3WCQ A;  2PKO A;  3V05 A;  4US8 A;  3MC9 A;  1PGX A;  4BAX A;  1STE A;  4RGN A;  3MC8 A;  4WH4 A;  2PEA A;  3OWE B;  4DBG A;  4GN1 A;  1BT0 A;  1R4M I;  4JQW C;  1KTK A;  4K3B A;  3PVL A;  3NHE B;  2KYW A;  2C7N B;  2KO3 A;  1TIF A;  2ICI A;  2PVG C;  1TT5 B;  1ZW7 A;  3H7P A;  2OOB B;  1L5P A;  3A1Q B;  4W9H A;  1WZ3 A;  1AWD A;  1N63 A;  1NYR A;  2MCN B;  4P7I A;  2JYE A;  4RGM A;  1FXI A;  2WXQ A;  3RD2 A;  4B9K A;  2LZ6 A;  1QZE A;  4LNF A;  2BYE A;  1V86 A;  1EU4 A;  5E6N A;  1TYG B;  3NZU A;  4DWF A;  1JWB D;  2NVU I;  1EWY C;  4KGS A;  2W3R A;  3DOW A;  4JGH B;  2Y5P A;  1S3S G;  2GBK A;  4DDI D;  3AXC A;  1RWS A;  1YJJ A;  1VZ6 A;  3AEC B;  1TS2 A;  2QEJ C;  4PS8 A;  4M02 A;  4KIK A;  2KX3 A;  2FAZ A;  4WQO B;  1CQV A;  2Y5C A;  1D5Z C;  4G0N B;  1F9J A;  3A9J B;  1FD6 A;  2LWP A;  2O2V B;  3GS2 A;  1D3Z A;  2KDI A;  3AE2 B;  2W54 A;  2LGI A;  3B9J A;  4RMA A;  1FCC C;  5H8Y E;  3AM9 A;  1UGJ A;  3QJZ A;  3HIZ A;  4NQK E;  1WGR A;  1XEE A;  3QK0 A;  2LUM A;  4K1R B;  2IGD A;  5CHF A;  5AZH A;  2H89 B;  5FR3 A;  2M56 B;  2XNA C;  2KTR A;  4MAC A;  1E8Z A;  1WIA A;  2V3S A;  2LJI A;  1Q0W B;  2C7M B;  3AED B;  3VUY A;  2L52 A;  2FCS A;  3MJW A;  4DQO C;  5J18 A;  5IA7 A;  3AH7 A;  1D5X C;  3QCA A;  4ZYS A;  1V8C A;  2ONQ A;  3APD A;  3T9L A;  3KUZ A;  5AZF A;  1XD3 B;  3JW0 X;  3TBL D;  5CX3 A;  1FNU A;  1IP9 A;  1L2N A;  3DDC B;  1VR9 A;  3ZDM C;  4JIO U;  1C4A A;  1C1Y B;  2JRI B;  2ZCC A;  4HWI B;  2VH2 A;  4FJY A;  4F1S A;  1NYQ A;  2I38 A;  4W9J A;  3IAS 1;  2C7H A;  2W55 A;  3DBS A;  2IGG A;  3DBL I;  2RGF A;  1TKY A;  1Y56 A;  4J3O D;  3BK1 A;  2PVO D;  1LO5 D;  3QA8 A;  2BB5 A;  1BML C;  1UWX A;  1Z2M A;  2LGD A;  2MW5 A;  3IHP C;  3CWI A;  1VLB A;  2K5P A;  4C4V B;  4K3C A;  3OG5 A;  3ZNH B;  4OVZ A;  2PE6 B;  1WE6 A;  2RD0 A;  1YOV B;  4GSW A;  1GNU A;  2JRH A;  2GLS A;  3ZLZ A;  3S2A A;  2IYD B;  3DHG C;  1GB1 A;  1OQQ A;  2WX1 A;  5L83 A;  2AYO B;  2MH7 A;  1QKZ A;  3PS6 A;  3HRD D;  4YTN B;  1JWS D;  1L0X B;  3PHW B;  4JX1 C;  4TMA B;  5GXG B;  2Z0E B;  4OHJ A;  3NY5 A;  2LVP A;  4N58 A;  4FHJ A;  1TY0 A;  4DXG A;  2JZ3 B;  2MSE D;  1LXD A;  2ZW1 A;  1WJN A;  4AWJ A;  4J6I A;  3VHT C;  4WQM A;  3ZJT A;  1AN8 A;  4C7Y A;  4MGZ E;  1PQS A;  2NCN A;  1P7E A;  4A8X C;  4JL9 A;  2INC C;  1L4D B;  2BKF A;  1TZ1 A;  1C9F A;  2WXN A;  4MH8 A;  2WU5 B;  1S1Q B;  1PGB A;  4A6Q A;  2CS4 A;  5HG2 A;  3QAQ A;  3AE3 B;  1IBX B;  4WJN A;  4ZDV A;  4AQ7 A;  4ZRQ A;  2WXO A;  3FIL B;  5L95 C;  1XLN A;  2KX0 A;  1M4V A;  3NS1 A;  1J19 A;  3L4P A;  1JRO A;  2IO0 B;  1E8X A;  5TR5 A;  4P1B C;  2CJO A;  4HKZ E;  4MJS B;  3PRZ A;  3EUB 2;  1TJE A;  2OHF A;  4A3P A;  4NPN A;  2I1J A;  4RCO A;  2I2Y A;  3QHT A;  4HPM B;  5J17 A;  4K7S A;  3I5J C;  2N9E B;  3RCZ A;  1TS3 A;  3Q3F A;  2IO1 B; 
#chains in the Genus database with same CATH homology
 2G3Q B;  5DPW A;  1RAX A;  3LDZ E;  3ZDT A;  3QWZ B;  2FCM A;  3V62 A;  3ZVV A;  4MJS A;  3KH0 A;  4IM0 A;  4KV2 A;  4NJ6 A;  1HE8 A;  2JWZ A;  4EZJ A;  2DYM A;  2GOW A;  2KJH B;  4MM3 A;  4JLC A;  2KJ6 A;  2K8C A;  2R2Q A;  2C9W B;  4MGK E;  3L0W B;  4GOC A;  2XBB C;  4PYU A;  3W1Y A;  1FXT B;  2LGX A;  3CSF A;  1RRB A;  3EC8 A;  1XT9 B;  3M63 B;  1WMH B;  2AEH A;  1VD2 A;  2KC2 A;  4WWP A;  4EEW A;  5DCN A;  2V4L A;  1E7U A;  2AL6 A;  2BWF A;  3H6N A;  1LM8 B;  2NPT A;  5AZG A;  3PT2 B;  1WRD B;  2M0X A;  4EUT A;  3RT3 B;  1SE9 A;  3BY4 B;  3A33 B;  2KDF B;  2BWE S;  1X1M A;  4EZK A;  3HM6 X;  3L16 A;  3PRM B;  1RFA A;  2M4N A;  3R7R A;  3QAR A;  2KAN A;  4K81 A;  3UIO B;  3DVG X;  4KVG B;  2DZJ A;  2MBO A;  3VTW A;  1TGZ B;  2LI5 A;  1WE7 A;  1P98 A;  2ZNV B;  2HTH A;  3N32 A;  3H9D A;  1WJ4 A;  4KZC A;  3UGB B;  2KKC A;  3A4R A;  1LFD A;  3V60 A;  3T8M A;  4IWQ A;  5LXH A;  4E3C A;  2J0J A;  2YVC A;  2L05 A;  1AAR A;  3JVZ X;  1WGH A;  1NI2 A;  2AWT A;  2CR5 A;  3ZRF A;  1G6J A;  1GG3 A;  4A3O A;  3UQA A;  2L0T A;  4TQ1 A;  4MDK E;  4TUU A;  5D2M B;  1IYF A;  3AI5 A;  5BO4 B;  2GBN A;  4CYE A;  2HJ8 A;  1WJU A;  2N4F A;  3ZNI D;  3U8Z A;  1T0Y A;  2MA9 B;  1EO6 A;  2K25 A;  4W9I A;  1WY8 A;  4B6W A;  4B95 A;  3DVG Y;  4PS7 A;  1OEY A;  3KW5 B;  4KSK C;  4FHK A;  3AU5 A;  3RYT A;  4BBN F;  3DBH I;  2M17 A;  3WAO A;  2XK5 A;  3AU4 A;  4IG7 B;  3BIN A;  1E90 A;  4G50 A;  3KUD B;  3OLM D;  3SHQ A;  3V6E B;  3ENE A;  3QQ8 B;  2DAJ A;  2BPS A;  4MH0 E;  2IBI B;  2DYO A;  4W9D A;  4IWO A;  1UGM A;  3VFK A;  1YJ1 A;  4EFO A;  1H8C A;  3DQV A;  5JHA A;  2L8J A;  4W9E A;  2DZK A;  2JXX A;  1WR1 A;  2WX0 A;  4DHJ D;  3IBE A;  4BKG A;  5C23 A;  3RZF A;  2RSU A;  3MTN B;  2MBB B;  2LGY A;  3APC A;  2I1K A;  4FUL A;  3SDL C;  1WR6 E;  4LJO B;  4W9C A;  3DCG A;  1YX5 B;  3ZW3 A;  2KQ7 A;  4IWP A;  4GDK A;  4ANU A;  3ONS A;  3ZRC A;  4ZRI A;  2XK5 B;  2LVO A;  3PRP B;  4M0W B;  5KHO A;  4NY0 A;  2ZVN A;  2VRR B;  3EFU A;  4E71 A;  4EOY A;  2KDE B;  3L08 A;  2KQS A;  2MBH A;  5E6O A;  3K9O B;  4GIV A;  4I6N B;  1Q5W B;  2JZZ A;  3VVW B;  1P3Q U;  3CMM B;  4HCP B;  2FCN A;  3GZN I;  4IM2 A;  3WA0 A;  5J2R A;  2J7Q B;  4K7W A;  2EKE C;  3OJ3 A;  3R7Q A;  3DVN V;  4HPL B;  2N7D A;  1V81 A;  1V2Y A;  2K8H A;  2LRW A;  1YD8 U;  4WJQ A;  4BKT A;  4FAD A;  3NZS A;  4MGY E;  4AOF A;  2K1F A;  2D10 A;  3UIN B;  1WXS A;  2CKH B;  2GBJ A;  2LUE A;  1I42 A;  2LXC A;  1ZGU B;  2CHW A;  3ZKJ C;  4W9L A;  3IFW B;  1E8W A;  5JZE B;  3L13 A;  4WWO A;  2ZEQ A;  2BF8 B;  4M8N A;  4XZ4 A;  3WAP A;  3H7P B;  4HDQ A;  1KLV A;  3JYU A;  5LXI B;  4WJP A;  1NDD A;  4WAA A;  3PSE B;  3VUW A;  1I35 A;  2KFK A;  3VH4 B;  3VDZ A;  3A4S C;  2J0M A;  2PEA A;  2L7R A;  3PLV A;  1V49 A;  2FNJ B;  2KXJ A;  4GN1 A;  1BT0 A;  4XC2 A;  1R4M I;  4JQW C;  1WX9 A;  3VH3 B;  3WAL A;  4DBG A;  4IM3 A;  2WWZ A;  3NHE B;  3PVL A;  2HE7 A;  3U30 A;  5DPS A;  4BOZ B;  4FA6 A;  2C7N B;  2KO3 A;  3A9J A;  5HKH A;  1WXA A;  3D32 A;  2M1M A;  2LXA A;  2C60 A;  2MBE A;  4FBJ B;  1ZW7 A;  3H7P A;  2OOB B;  4GXB A;  3ZUN A;  3VQI A;  3PPA A;  2KC1 A;  1WMH A;  4FN2 A;  1R4N I;  3A1Q B;  4W9H A;  1H4R A;  1WZ3 A;  4MEL A;  4URK A;  2IO3 B;  2KOX A;  5IAA C;  2JVC A;  4II2 B;  3ZO5 B;  4HDO A;  2MCN B;  4P7I A;  3ALB A;  4I6P A;  3KVF B;  1EF5 A;  4GDL A;  2J0K A;  5DPT A;  2KLC A;  2KN5 A;  3L17 A;  2CHZ A;  2CHX A;  3RD2 A;  3TMP B;  2L3Z A;  2EMS A;  4B9K A;  3W1S A;  2LZ6 A;  1OGW A;  1QZE A;  3RZW C;  2KZR A;  2BYE A;  2GBR A;  5CHW A;  1WXM A;  1V86 A;  2GMI C;  4ICV A;  5E6N A;  1WF9 A;  3NZU A;  5LLI A;  4MGI E;  3ZNZ B;  3R66 C;  4LCD E;  4DWF A;  3ZTD A;  2NVU I;  2C5L C;  2DHZ A;  2Z59 B;  3PHX B;  1YIW A;  2DEN B;  1LQB A;  1CMX B;  4EZL A;  3DOW A;  4ANX A;  4JGH B;  4GB9 A;  4MEM A;  2DZI A;  1S3S G;  2GBK A;  4BFR A;  4DDI D;  4DHZ B;  3WAN A;  3AXC A;  2YLM A;  2N1W A;  1YX6 B;  2O6V D;  2XEW A;  3OAW A;  4OVV A;  2BYV E;  4GDL B;  4PS8 A;  2N7E A;  3DBR I;  3Q3J A;  5C1Z A;  2IZV B;  2DAF A;  2KVR A;  3ML9 A;  3DVN U;  3WAM A;  2IY1 B;  4KIK A;  3HHM A;  2N1V A;  2KX3 A;  1Q1O A;  1WZ0 A;  2FAZ A;  3R3M A;  2UYZ B;  2ZVO A;  2D11 A;  3CF6 E;  1P0R A;  2KMC A;  4I6L B;  4WQO B;  3O65 B;  3HK0 A;  4G3X B;  4G0N B;  4WJO A;  4X57 B;  3V61 A;  1NBF C;  2N9P C;  4WWN A;  1F9J A;  4HVB A;  5JHB A;  1OEY J;  3A9J B;  1KOT A;  3B08 A;  2LWP A;  2LVQ A;  2O2V B;  1OQY A;  3N3K B;  4GU2 A;  3V6C B;  2KDI A;  1D3Z A;  4RMA A;  3UQB A;  2WYQ A;  2WDT B;  2MP2 A;  2ZJD A;  5DPR A;  4BBN C;  4HK2 A;  4IW0 A;  4K7U A;  1U4A A;  2V1Y A;  2KFK B;  4IUM B;  2ZPY A;  1OTR B;  2ZNV C;  3QJZ A;  3HIZ A;  4NQK E;  2A5U A;  4RM9 A;  1WGR A;  4ANV A;  1TBE A;  2DX5 B;  4KDL B;  3QK0 A;  3X23 A;  2PJH A;  2MLB A;  3K9P B;  3KUC B;  4K1R B;  4AJW A;  5CHF A;  2R2O A;  4N9F 4;  5AZH A;  5G55 A;  1J0G A;  1IPG A;  1WX7 A;  2D3G A;  5D6J B;  4DHJ B;  3VTU A;  2O2V A;  2W9N A;  2KWC A;  2LD9 A;  4PYZ A;  3SU8 X;  2KTR A;  1WXV A;  2D2Q A;  4LDT D;  1E8Z A;  1WIA A;  2V3S A;  3EEC A;  5KHQ A;  3A1Q A;  1Q0W B;  1A5R A;  3X0W A;  1P9D U;  2LRU A;  1VCB A;  2C7M B;  3B1L X;  1WH3 A;  4KDI C;  2O6V A;  3APF A;  4ZYN A;  3M95 A;  4FLH A;  1GC6 A;  1WJ6 A;  1SIF A;  1UZX B;  1V80 A;  2KWU B;  3AUL A;  4G11 A;  3ZNG C;  3L10 B;  1V5T A;  2KD0 A;  3VUY A;  2FCS A;  2Z0D B;  3MJW A;  4BOS C;  5J18 A;  3P2B A;  5IA7 A;  3QCA A;  3QIJ A;  3KYD D;  3HM3 A;  3QX1 A;  2OJR A;  3APD A;  3T9L A;  3KUZ A;  5AZF A;  1WM2 A;  1XD3 B;  2QHO A;  3JW0 X;  3TBL D;  5CX3 A;  2NR2 A;  1IP9 A;  2KDB A;  2K6Q A;  4AP4 C;  4TQ0 A;  1L2N A;  1MG8 A;  3DDC B;  2KNB A;  3W1S C;  3ZDM C;  2K39 A;  4JIO U;  1GUA B;  3I3T B;  3JSV A;  3PRE A;  1C1Y B;  2JRI B;  2ZCC A;  3C0R B;  3M62 B;  4HWI B;  3UIP B;  4FJV B;  1WI0 A;  4FJY A;  4F1S A;  4II3 B;  1EF1 A;  4W9J A;  4HLE A;  5JH5 C;  2C7H A;  3RUI B;  3DBS A;  3DBL I;  3L54 A;  2RGF A;  2HD5 B;  4NAW B;  1E5W A;  5E6P A;  2ASQ A;  3QC8 B;  4F8C B;  1JRU A;  2N9X A;  1M94 A;  1SGH A;  3QA8 A;  2KWV B;  4DK5 A;  4W9G A;  2K6D B;  4ASW C;  2ZZP B;  2GBM A;  4GGQ A;  3RUL A;  1Z2M A;  2KTF A;  2LGD A;  2MW5 A;  1J8C A;  1GC7 A;  2JF5 A;  3PV1 A;  3A9K B;  3IHP C;  2G45 B;  1RLF A;  2K8B A;  2MQJ A;  2NBV B;  3VTV A;  4DXA B;  5CTR C;  2KTR B;  4LJP B;  1Y8R C;  2B3A A;  4TV3 A;  3ZNH B;  2PE6 B;  3VXW A;  2NBU A;  4GMV A;  1WE6 A;  1Z5S B;  5D94 A;  3VUX A;  2RD0 A;  5EDS A;  2NPT B;  2DYB A;  4TKN A;  4GSW A;  2RR9 A;  2KK8 A;  2JRH A;  1GNU A;  3TJP A;  3ZLZ A;  1L7Y A;  3S2A A;  2IYD B;  2L00 B;  5AEK B;  2MWS B;  1E7V A;  1UEL A;  2CU1 A;  2WX1 A;  3WIM A;  2PE9 A;  4NJ7 A;  5FR6 A;  4CO7 A;  5L83 A;  5CHV C;  2AYO B;  3UF8 A;  2ZPN A;  3PS6 A;  3NOB A;  5D7G A;  3TL5 A;  2LAS A;  4KIK B;  3ZTC A;  1WGG A;  1ISN A;  4NQL B;  3VAW A;  1UD7 A;  2DZM A;  3OJ4 B;  4HXD A;  4KSL C;  2JT4 B;  3PHW B;  1P1A A;  1WYW B;  3TCA A;  2BYF A;  2EMT A;  3PTF C;  2Z0E B;  3NY5 A;  3NS8 A;  4W9K A;  2FUH B;  2LVP A;  4BKS D;  4FHJ A;  3ML8 A;  4HCN B;  2O6V B;  1V5O A;  2JZ3 B;  2MSE D;  3H7S A;  4MSM B;  1EUV B;  4PS3 A;  3N30 A;  2MP2 B;  1LXD A;  2G4D B;  3LJ3 A;  2AL3 A;  4F7Z A;  1WJN A;  4NNJ B;  4AUQ C;  4AWJ A;  4J6I A;  2IO2 B;  2L0F A;  3GOE A;  2KHW B;  2NBW B;  3SD5 A;  4MSQ B;  3VHT C;  2JUO A;  2REX A;  4RM8 A;  2MX2 A;  1KM7 A;  2KMA A;  1PQS A;  1WFY A;  1UBQ A;  2NCN A;  4FJZ A;  1ZKH A;  1WGD A;  4MGZ E;  4JL9 A;  2BKR B;  3IG3 A;  1V9J A;  2BKF A;  3TIX A;  1TZ1 A;  1YQB A;  3JSV B;  2D07 B;  1TTN A;  4AJY B;  4M8M A;  4KZ0 A;  3U7D A;  2UWQ A;  4ZRJ A;  4A20 A;  2G4S A;  1S1Q B;  2KJR A;  2LJ5 A;  2CS4 A;  5GMV A;  3QAQ A;  1K8R B;  4NAW A;  4WJN A;  1UH6 A;  1E8Y A;  4ZDV A;  2PPH A;  2RPQ A;  1V6E A;  2MBQ A;  3DPD A;  3M3J A;  4HJK A;  4GDK B;  4DDG D;  2L76 A;  3CST A;  4LDT B;  2JPH A;  2A4Z A;  3ECI A;  3IVF A;  4OVU A;  4ANW A;  4BVU C;  2ZCB A;  5L95 C;  4IC7 B;  2FIF A;  1WGY A;  2KX0 A;  1XQQ A;  1UBI A;  3ZIM A;  1J19 A;  3B0A A;  3A9K A;  2IO0 B;  2KFJ A;  3KYC D;  1E8X A;  2JY6 A;  5TR5 A;  1GJZ A;  3EHV A;  4MJS B;  2KLG A;  3PZD A;  3PRZ A;  1WX8 A;  2BGF A;  2M8S A;  1KJT A;  3PGE A;  4ICU A;  4W9F A;  4A3P A;  3MHS D;  3PLU A;  4BKS A;  4YL8 A;  4EKU A;  3H1U A;  4NPN A;  2I1J A;  2FCQ A;  1C3T A;  3QHT A;  4HPM B;  4DHZ E;  5G2N A;  4E74 A;  2IY0 B;  2NS5 A;  4CHK A;  2MRP A;  5J17 A;  4K7S A;  1WM3 A;  2N9E B;  3RCZ A;  2Y5B B;  2FID A;  4ZRK A;  3Q3F A;  4XX5 A;  2IO1 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...