1OGWA

Synthetic ubiquitin with fluoro-leu at 50 and 67
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
76
structure length
74
Chain Sequence
MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQEDGRTLSDYNIQKESTHLVLRLRGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Synthesis, Structural and Biological Studies of Ubiquitin Mutants Containing (2S, 4S)-5-Fluoroleucine Residues Strategically Placed in the Hydrophobic Core
pubmed doi rcsb
molecule tags Cell cycle
molecule keywords UBIQUITIN
total genus 19
structure length 74
sequence length 76
ec nomenclature
pdb deposition date 2003-05-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00240 ubiquitin Ubiquitin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 1ogwA00
2MBOA 4HVBA 2JZ3B 3H7PB 4EZKA 4RM8A 4I6LB 3QC8B 2Y5BB 2L7RA 3B1LX 2DYOA 3PPAA 3V6CB 5C1ZA 2WDTB 3QIJA 3B0AA 4DDID 5KHQA 2KMCA 1WH3A 2OJRA 1WJ6A 2MP2A 2V3SA 2LVPA 2JT4B 3QHTA 3NZUA 3H9DA 2K6QA 4TKNA 2AWTA 4KZCA 1Q5WB 2KLGA 3APCA 5E6PA 2NCNA 1EUVB 3M95A 1EF5A 4KIKA 4M8NA 4ZDVA 3N3KB 1GUAB 2LXAA 3ZLZA 4NAWB 3K9PB 4IW0A 4LDTB 4FBJB 1WF9A 3VTUA 3A33B 3M63B 2KO3A 2FCNA 4PS3A 4A20A 2PPHA 3KVFB 2LRUA 3L17A 4GSWA 4KSLC 4RM9A 4XZ4A 4FADA 5CHFA 3VUYA 2KFKA 3C0RB 3JSVB 4TQ1A 4WWNA 1YX6B 2KKCA 1V9JA 4IUMB 2JY6A 3ZRCA 3PV1A 2K25A 1P0RA 4HCNB 4JL9A 4GDLB 1NBFC 2M8SA 4KZ0A 4E71A 1X1MA 2LGYA 5CHVC 1Q1OA 2FIFA 4BKSD 2C7NB 2KJRA 1GC6A 3ML9A 2FUHB 4HCPB 2WYQA 3VDZA 2CKHB 2V4LA 2ZVOA 4WWPA 3VTWA 4X57B 2KANA 1SGHA 3Q3FA 4W9EA 1J8CA 3DVGX 3Q3JA 2ZCBA 4WWOA 1WX9A 1QZEA 2A4ZA 4DHZE 2N9EB 1SE9A 2AL6A 2LVOA 2C60A 1GG3A 1KJTA 1TTNA 3T9LA 1WM3A 3L16A 4IWOA 1G6JA 3PGEA 2XBBC 5L95C 2NBUA 4IWQA 5DPSA 1UBQA 4BOZB 2MCNB 1E7VA 4B9KA 2KWVB 1WE7A 1R4NI 4GDKB 2JRHA 3EFUA 3OLMD 2KQSA 1V49A 2NBVB 3U7DA 4GDKA 4N9F4 4WQOB 2UWQA 2RR9A 2ZPYA 3ZTDA 1TBEA 3UGBB 2XK5B 3V62A 5LXIB 2GBMA 4DHJB 1WM2A 3O65B 4NY0A 3QARA 3WA0A 1J0GA 3RYTA 2N9PC 3TL5A 4ZRIA 4IG7B 3ONSA 3RCZA 1GJZA 1M94A 4II2B 1E5WA 1XD3B 4YL8A 5J18A 4KVGB 4LCDE 1NDDA 4JIOU 1TGZB 1WI0A 1XQQA 3PTFC 1WX8A 1L7YA 3ML8A 4HXDA 4GXBA 1Z2MA 4PYZA 4ZRKA 3WAOA 5DPWA 3NZSA 5DPTA 2REXA 3PLVA 5IAAC 3RD2A 4ZYNA 1RRBA 3ZKJC 2RGFA 4AWJA 1ZW7A 5D7GA 1C1YB 3KUCB 1WXVA 1WR1A 3DCGA 3IBEA 4BBNC 3RUIB 4DBGA 4NQLB 1WGYA 2HTHA 2KVRA 2MW5A 4P7IA 4LDTD 1A5RA 3ECIA 2LVQA 4NNJB 3NS8A 5CTRC 2GMIC 5G55A 4AOFA 2VRRB 3PSEB 4ZRJA 1V5OA 5KHOA 2DZMA 2IZVB 4AP4C 2KNBA 3WAPA 3N30A 4K1RB 3UF8A 4FLHA 1UD7A 1V2YA 1NI2A 1JRUA 2DHZA 3LDZE 2MBHA 3JYUA 2KFJA 2IO0B 2M0XA 3A9KB 2XK5A 2IO3B 3UQBA 4I6PA 3L10B 2MP2B 2RPQA 3N32A 4ANXA 4PS8A 3ZIMA 4W9GA 2GBRA 3NHEB 2KHWB 5IA7A 2CHZA 2W9NA 1I35A 2IY1B 4MELA 1ZGUB 3R7QA 2FCSA 2WWZA 4EOYA 2D11A 1P9DU 2KDFB 2KC2A 2G3QB 1SIFA 2IO1B 3GOEA 3JW0X 3PS6A 3QX1A 3ZNZB 4BFRA 1WMHB 3QJZA 1UBIA 2IO2B 5CHWA 4K7UA 2RD0A 4KDLB 1WYWB 2KZRA 4OVVA 2B3AA 1VD2A 3UIOB 2G4DB 1HE8A 2MBBB 3EHVA 4FULA 3TJPA 3W1SC 4RMAA 2KX3A 5J2RA 4KDIC 2L76A 5AZFA 2I1JA 4IWPA 4EKUA 3W1YA 1KOTA 3ENEA 5JHAA 2AEHA 3A1QB 4MGZE 4W9FA 2DZIA 2C5LC 4MH0E 3VAWA 3APDA 2BKRB 3L08A 3PHWB 2O6VA 2CHWA 5D94A 3SD5A 4A3PA 2JXXA 4ASWC 4IM0A 1H8CA 5BO4B 2JVCA 4BVUC 4ICVA 1KM7A 2LASA 3U8ZA 1IYFA 3TBLD 2BYVE 1LXDA 2NPTB 2J0KA 2BKFA 3UINB 4CHKA 1CMXB 2L8JA 4F1SA 4FJYA 4AUQC 1YIWA 2JPHA 2LUEA 1EF1A 1TZ1A 3PHXB 3P2BA 4GMVA 3CMMB 4B6WA 3SU8X 2N1WA 2K8CA 3KH0A 2M1MA 4ANUA 2V1YA 1WGHA 3ZUNA 2MA9B 4ICUA 2EKEC 5JH5C 4HJKA 3RZFA 5E6OA 1WZ0A 5LLIA 1WE6A 2K6DB 3OJ4B 4KIKB 1AARA 4NPNA 3R66C 2N1VA 2DZJA 2D2QA 2L3ZA 2ZCCA 1UH6A 2BYFA 3SHQA 4FHKA 4TUUA 1WMHA 3A4RA 4AJWA 1E8ZA 3DBRI 1YJ1A 2LD9A 2K39A 2KC1A 2BF8B 3KYDD 4II3B 4XC2A 5EDSA 3T8MA 1WR6E 4MGKE 4LJPB 2LWPA 3NOBA 1OTRB 1FXTB 2ZJDA 3TMPB 3AU5A 2ZNVC 3OJ3A 2PE9A 4A3OA 3X23A 1KLVA 5JZEB 3QWZB 1WZ3A 2N4FA 1WIAA 4FN2A 2IY0B 5G2NA 4DWFA 3EECA 3MHSD 5DCNA 3WANA 3VQIA 4DK5A 2MBQA 2GBNA 4MSQB 1WJUA 2PEAA 4GGQA 2MWSB 2NBWB 3D32A 2DX5B 1Y8RC 2L00B 3LJ3A 1OGWA 2FAZA 1P98A 2KJ6A 2M17A 2MBEA 2DAJA 4G11A 1RLFA 2Z0EB 3AI5A 1LFDA 3AULA 3QK0A 4WJQA 4WJNA 2KX0A 3M62B 4ANVA 5J17A 1Z5SB 3UQAA 2QHOA 3AU4A 3ZRFA 1MG8A 4W9JA 1EO6A 1V86A 2LGDA 3PZDA 4TQ0A 3L54A 1P3QU 5AEKB 1OEYJ 2KDIA 2BWFA 3MJWA 4MEMA 2RSUA 5AZGA 2FIDA 2FNJB 3AXCA 4JLCA 2PJHA 2KTFA 3DVGY 2KFKB 1OEYA 1WXSA 4URKA 4G50A 2JUOA 3H6NA 2O2VB 5L83A 1WXMA 3V61A 1L2NA 1IP9A 2YVCA 2ZZPB 2NVUI 3VH4B 2IYDB 4WAAA 1F9JA 3TIXA 3DOWA 2AL3A 3R7RA 3IHPC 3PREA 2WX1A 3VUXA 1I42A 4KSKC 2C9WB 1WJNA 4GDLA 2KOXA 3CSTA 1U4AA 2J0MA 4PS7A 3ZDMC 3OAWA 4FJZA 3A9JA 2UYZB 4K7WA 1WGDA 3I3TB 4W9LA 2R2QA 4FA6A 4KV2A 3A9JB 2DYMA 3R3MA 4G3XB 4XX5A 2KJHB 4WJPA 3KW5B 3CSFA 4NQKE 4HWIB 1E8YA 2A5UA 2GOWA 2LZ6A 3DPDA 4HPMB 3DBSA 3M3JA 2PE6B 2GBKA 4E3CA 2WX0A 3DQVA 3DVNU 3KYCD 4MJSB 4HK2A 3IFWB 2DYBA 5E6NA 3QCAA 4MDKE 2O6VB 5TR5A 1Q0WB 3VUWA 4BOSC 1WY8A 3EC8A 3A9KA 3RZWC 3S2AA 4ANWA 4W9IA 2ZNVB 3GZNI 4W9HA 1BT0A 1ZKHA 1E7UA 2XEWA 4K81A 2K8HA 2MRPA 3UIPB 2CHXA 2CR5A 2ZEQA 2LI5A 3K9OB 1PQSA 3APFA 2C7HA 2L05A 3ZNGC 1VCBA 2HD5B 4EZJA 4DDGD 3V6EB 3BINA 1H4RA 1YX5B 3VVWB 2NS5A 4BKSA 1RFAA 3ZNHB 3HM3A 3WAMA 3HM6X 4F8CB 5AZHA 2KN5A 3JVZX 4K7SA 1T0YA 3ZW3A 4AJYB 2KD0A 3QQ8B 2YLMA 3PRPB 4I6NB 2LJ5A 5D6JB 3RULA 2KMAA 3A4SC 3VFKA 2JRIB 2G4SA 4HDOA 4EEWA 1J19A 3PT2B 3VTVA 2D07B 4GB9A 1IPGA 4MSMB 3CF6E 3ZO5B 2K8BA 2GBJA 1YD8U 2L0TA 1WX7A 4BBNF 1WRDB 2BPSA 3TCAA 1WXAA 3QA8A 3DBHI 4B95A 4NAWA 4DHJD 4DXAB 3PLUA 1WGRA 3QAQA 4MM3A 1LM8B 2FCQA 2DZKA 1E90A 1WGGA 2CU1A 2OOBB 4FJVB 4JQWC 4IM3A 4G0NB 4LJOB 4E74A 2M4NA 1C3TA 2MX2A 3DDCB 3SDLC 4CO7A 2NPTA 1UZXB 2J0JA 1GC7A 3ZDTA 4DHZB 3KUDB 5JHBA 3BY4B 5FR6A 1YQBA 3W1SA 5D2MB 3ALBA 4GN1A 2LRWA 3ZNID 3HHMA 1V5TA 3L0WB 3HIZA 2JZZA 3V60A 2KDBA 4EZLA 4PYUA 4M8MA 2BWES 4GU2A 3WALA 2N9XA 2KK8A 4M0WB 3VH3B 2KWCA 2Z59B 3MTNB 2MQJA 3VXWA 1WJ4A 2LXCA 2MLBA 3IG3A 5HKHA 1LQBA 2BGFA 2N7EA 2I1KA 3X0WA 3ZTCA 2ASQA 2N7DA 2O2VA 1E8XA 1E8WA 4GIVA 2IBIB 2CS4A 3VHTC 1UELA 2LGXA 3A1QA 2JF5A 1R4MI 4MJSA 3ZVVA 4W9KA 3DBLI 3KUZA 4CYEA 3WIMA 1S1QB 1K8RB 1V80A 4J6IA 4WJOA 3IVFA 4W9DA 3H7SA 3U30A 2K1FA 1RAXA 2KTRA 5C23A 2JWZA 2KDEB 3H7PA 4IC7B 5DPRA 5CX3A 2ZPNA 2FCMA 5GMVA 2KTRB 1V81A 2Z0DB 1V6EA 2O6VD 2NR2A 1ISNA 4F7ZA 2DENB 2J7QB 1P1AA 4BKTA 2EMSA 2D3GA 5LXHA 3PRZA 4NJ6A 1XT9B 3HK0A 2BYEA 2HE7A 4OVUA 2KLCA 4MGYE 3H1UA 4W9CA 4MGIE 4IM2A 4HPLB 2KQ7A 1D3ZA 3RT3B 4GOCA 4EUTA 1WFYA 4HDQA 3PVLA 1OQYA 2DAFA 2L0FA 2HJ8A 2KXJA 3JSVA 3B08A 2C7MB 4BKGA 1UGMA 4EFOA 2ZVNA 4JGHB 2G45B 4FHJA 2EMTA 4TV3A 2AYOB 4NJ7A 3L13A 2MSED 1S3SG 2KWUB 4HLEA 1GNUA 3PRMB 3DVNV 2R2OA 3NY5A 2D10A
chains in the Genus database with same CATH superfamily
2MBOA 4HVBA 4M01A 3H7PB 2Y5BB 1HEZE 2PKOA 1KLGD 3PPAA 2WXPA 3RMKC 3V6CB 2PLPA 2MP2A 2V3SA 4C80A 3QHTA 2HTME 2GRIA 2KLGA 3EUB2 3N3KB 1FIQA 2KYWA 4NAWB 2KO3A 2FCNA 4A20A 3KVFB 3L17A 4XZ4A 3VUYA 1I4HA 1EU4A 2KFKA 3C0RB 4WWNA 1YX6B 5EE0A 1V9JA 2JY6A 3ZRCA 3MHZA 4JL9A 4GDLB 4KZ0A 1L0XB 2LGYA 1Q1OA 2FIFA 3MFGA 3DWMA 2BBCA 1L5PA 3GP7A 3DBHB 1FCLA 3VDZA 2ZVOA 1RYJA 1SGHA 1V1PB 4W9EA 2QIEB 3ABVB 1DOYA 2JSVX 1NENB 2RMMA 2AX5A 4A90A 2C60A 2INCC 3L16A 1SXTA 1AWDA 1G6JA 2XBBC 5L95C 2N9LA 1UBQA 2W3RA 2AQ2B 2K22A 1R4MB 2KQSA 3U7DA 4WQOB 2WXQA 2XK5B 2GBMA 5D3DA 4DHJB 3O65B 4M0WA 4KX6B 4ZRIA 3ONSA 5J18A 4LCDE 1TGZB 4OW0A 1XQQA 1WX8A 4GXBA 4PYZA 4ZRKA 1GOZA 1ET9A 3PLVA 1FXIA 2WXKA 3Q2AC 3DCGA 3IBEA 1E10A 3RUIB 4HPPA 1HZ6A 1D5XC 1WGYA 1YOVB 2KVRA 2WXGA 1SE3A 4LDTD 4K3CA 3ECIA 5G55A 4A9AA 3Q8CA 3SR6A 2W82A 4ZRJA 1V5OA 2VZKD 2KNBA 4BZAA 1OFFA 2AQ3B 3RNCC 2N7JA 4LNIA 1UD7A 1V2YA 1NI2A 1JRUA 2RDHA 2DBYA 2V4IB 3JYUA 4RGMA 2LMCA 3Q6BA 2MP2B 4K3BA 4PS8A 5BMIA 1I35A 2W9NA 4XYCA 1ZGUB 4EOYA 1UWXA 2D11A 1P9DU 2KDFB 3BK1A 3OWEB 1SIFA 3GOEA 3ZYYX 1D4BA 1WMHB 1UBIA 3U2SC 2WXRA 4YSYB 2W3SA 3EHVA 4RMAA 1KRHA 2BS2B 5AZFA 1YJJA 2YEPB 5JHAA 4W9FA 2AEHA 3A1QB 4MGZE 1C77A 3PHWB 3I63C 2JXXA 1V8CA 2V3NA 1H8CA 2JVCA 3U8ZA 1IYFA 3TBLD 2BYVE 4HKZE 3NVVA 1YIWA 2Y5PA 2JPHA 2LUEA 4ZRQA 2MJEA 4LNFA 2V1YA 2MA9B 5LLIA 3R66C 2N1VA 2D2QA 3B2GA 4XDCA 4FHKA 1E8ZA 3HRDD 2K39A 2KC1A 3KYDD 5EDSA 4LJPB 2LWPA 3NOBA 4N59A 5C2TB 4NAMA 4NJCA 4XDDA 1FM0D 1MI0A 2IY0B 5G2NA 2Z8LA 4DK5A 5HG2A 3RNBC 4MSQB 2GBNA 1WJUA 4REZA 2MWSB 2D3CA 1Y8RC 1LO5D 4US8A 1QOAA 2WXHA 2M17A 2XNAC 1MHXA 1IUEA 2ZW0A 4WJNA 3AEAB 1Z5SB 3UQAA 2QHOA 3ZRFA 3AE6B 4M00A 5AEKB 4MEMA 2FIDA 2FNJB 3RNEC 4MM3B 2PJHA 4URKA 4G50A 3H6NA 1EU3A 3IXSA 4LNKA 3WCQA 2ZZPB 2IDYA 3TIXA 2JU6X 1T6BX 2QC8A 3PREA 2WX1A 1I42A 4KSKC 4RF1A 4GDLA 3ZDMC 3OAWA 3NVYA 4K7WA 3I3TB 2IPKD 1J7CA 1J7BA 4WJPA 3CSFA 1WRIA 3Q3NC 2LZ6A 2GBKA 2LHEA 1NI3A 3IFWB 1Q0WB 1WY8A 3EC8A 4W9IA 2K8HA 3UIPB 2WNMA 2LI5A 2C7HA 2L05A 4P16A 4GLSC 4BKSA 3WAMA 3HM6X 4F8CB 1QOFA 1CZPA 1C76A 1T0YA 3Q3MC 1RM6C 3RULA 3A4SC 3VTVA 2D07B 3ZO5B 2K8BA 2AQ1B 2GBJA 1TKGA 3V05A 2DNFA 2JYTA 3TCAA 2BPSA 2X8XX 2V0GA 1MG4A 4DXAB 3PLUA 1GAQB 3W9CB 3SFDB 4FJVB 2SAKA 3BK2A 2M4NA 3AE7B 1UZXB 4DHZB 5JHBA 5FR6A 4ZHPA 2GLSA 3W1SA 2KQ4X 1V5TA 3HIZA 2BYTA 2N9XA 4ARCA 3IG3A 5HKHA 3AE5B 3X0WA 2I1KA 2ASQA 2YEPF 2N7DA 4C4VB 1SSNA 1E8WA 2IJ0A 4GIVA 2IBIB 3RN9C 4ZOHC 1GB1A 1R4MI 3ZVVA 4HRSA 3DBLI 3IVFA 1RAXA 2KTRA 3AEEB 3LYYA 2BB5A 2ZPNA 1QILA 1ISNA 3HVDA 2J7QB 1L0VB 1K52A 2WU2B 3H1UA 4W9CA 1WXQA 3RFZB 4HPLB 1D3ZA 3P1MA 1WFYA 1F2RI 4BKGA 1UGMA 3TEWA 2G45B 2EMTA 3Q8BA 1S3SG 1C79A 1YN5A 1XEEA 2ON8A 4I6LB 2L7RA 2DYOA 5C1ZA 2WDTB 4DDID 2KMCA 1WH3A 1JWSD 1WJ6A 2I2YA 2K0PA 3BVMA 3H9DA 2FE8A 2K6QA 2MJ3A 3NZUA 4TKNA 4KZCA 1GPXA 1ZOYB 2DLBA 2L52A 1YN4A 3APCA 5E6PA 3MC8A 4ZDVA 1AW7A 1WSPA 4LDTB 4DQOC 4FBJB 3GB1A 4KSLC 2LRUA 4GSWA 5CHFA 5IOIA 4IUMB 1P0RA 4HCNB 3FKYA 1NBFC 2M8SA 3Q8FA 4E71A 1X1MA 5CHVC 3AEDB 4C00A 1I4QA 2KJRA 1TY2A 1DOXA 5IN7A 2FUHB 2CKHB 3VTWA 3U4EG 3C8YA 2MJDA 1L4ZB 3Q3JA 2ZCBA 5EE3A 3ZXVA 2KVZA 2BQQA 1QZEA 1SE9A 2AL6A 1N6ZA 1KJTA 1TTNA 2WLBA 1QT9A 4IWOA 5DPSA 4IWQA 2H89B 2MCNB 1E7VA 2WXOA 1SE4A 4AQ7A 3DHIC 3TEXA 2NTTA 2RR9A 3AM9A 3UGBB 4PT5A 5LXIB 1E0ZA 4B0EA 3T3OA 3QARA 4YTNB 4II2B 1NDDA 1VZ6A 4JE3B 4JIOU 4HXDA 1L7YA 1FO4A 3WAOA 5IAAC 2REXA 3RD2A 1VZ7A 4ZYNA 2IGHA 2INPE 3KUCB 1WR1A 2R61A 4BBNC 4DBGA 1HXYD 4XWWA 2MW5A 1A5RA 5FK9C 2DZMA 1E6EB 4AP4C 2WXJA 1TY0A 1V97A 4K1RB 3UF8A 2DHZA 2D3AA 3LDZE 2MBHA 4HEA1 2KFJA 2XK5A 3L10B 4ANXA 2QJLA 4W9GA 1N5WA 1QQRA 2CHZA 1PGAA 2WWZA 3SFEB 3JW0X 3PS6A 5CHWA 1V1PA 4K7UA 2RD0A 1WYWB 2FBWB 2KZRA 4O1NA 3UIOB 1XCTL 2G4DB 2RDGA 4IKGA 4RCOA 4Q2JA 2MBBB 3TJPA 1XXGA 5J2RA 1C4PA 2I1JA 4EKUA 2JQRB 1KOTA 3ENEA 2WDRB 2C5LC 3APDA 3L08A 2O6VA 5D94A 4A3PA 3SD5A 4IM0A 2D5GA 1KM7A 2HJ1A 3ETRA 2L8JA 3AEBB 2WP9B 4F1SA 2LJIA 1OQRA 4B6WA 1FNWA 3SU8X 4BAXA 2N1WA 3KH0A 2M1MA 4ICUA 2EKEC 2I38A 4PK1A 5JH5C 3BZDB 5E6OA 3OJ4B 4YTMB 1SF0A 5EE9A 3RI7C 2ZCCA 5BYQA 3A4RA 2M19A 1CQVA 4II3B 1P7FA 1WR6E 2QSDA 1F77A 1OTRB 2WGSA 3W5VB 2ZJDA 3TMPB 3AU5A 2ZNVC 2PE9A 4A3OA 5JZEB 2N4FA 1WIAA 4DWFA 3EECA 1HA5A 3WANA 3AEGB 2NBWB 1B1ZA 3D32A 2DX5B 1N5XA 3GZNB 1LGRA 3CWIA 2DAJA 3FILA 4G11A 3AI5A 1LFDA 1Q10A 3AULA 2KX0A 3M62B 3AV8A 4N58A 1MG8A 1ZXIA 4OHJA 2LGDA 4MH8A 3Q8EA 3NUHB 3I9V1 3MJWA 5AZGA 4JLCA 2KFKB 4IOIE 2WHIA 4XE0A 3FAHA 2JUOA 2O2VB 4RH6A 1WXMA 1ET6A 1IP9A 3VH4B 2IYDB 4WAAA 2LEKA 1F9JA 1NYQA 3DWGC 3R7RA 3IHPC 3GS2A 4RGNA 3CSTA 4FJZA 2ONQA 2WU5B 4FA6A 2R2QA 2DYMA 3R3MA 4XX5A 2QEJC 4C56C 1L0YB 1YQ4B 3KW5B 4HWIB 1ZDXA 1E8YA 2GOWA 3DPDA 3M3JA 2PE6B 3DVNU 3DQVA 4HK2A 1D5ZC 1BUIC 1E9MA 2O6VB 4HKQA 1EWCA 4ZYSA 4BOSC 1C9FA 1TS2A 3A9KA 1N62A 2X38A 3GZNI 1BT0A 2MRPA 1QLBB 4DXGA 3CIRB 4OZAA 3ZNGC 3OG5A 2NS5A 1JCKB 3ZNHB 1YJIA 3JVZX 2L1AA 4K7SA 4AJYB 2KD0A 1QOBA 2KMAA 1EWYC 2JRIB 1SB3C 2NTSA 5HFYA 1AYFA 1MVKA 4GB9A 3CF6E 1YD8U 1UGJA 1WYGA 4MT5A 2KWDA 3E56A 1WXAA 1FNUA 3QA8A 4B95A 1TYGB 2DZKA 1E90A 4P1BC 1WGGA 2JXTA 4LJOB 4E74A 4G0NB 3W2DA 2MX2A 1D6EC 4CO7A 2NPTA 1GC7A 3ZDTA 1HZ5A 3KUDB 1YQBA 3ALBA 3HHMA 4USAA 1T3QA 1A70A 4HJGE 2JZZA 3V60A 2KDBA 2RDBC 4PYUA 3IT4B 4GU2A 3WALA 4C7ZA 4M0WB 4C7YA 2MQJA 1HTQA 1WJ4A 2V9HA 4OZBA 2BGFA 4YXDB 2O2VA 1FRDA 3PZ7A 3N1XC 3A1QA 2JF5A 3DBLB 3KWVA 3EFCA 1S1QB 1K8RB 1V80A 4OVZA 4WJOA 3H7SA 2PW9A 2K1FA 5DPRA 1UUPA 2FCMA 5GMVA 2KTRB 1V81A 2Z0DB 5MPOA 1V6EA 1FXAA 4F7ZA 1P1AA 2EMSA 2Q5WD 4NJ6A 1JWAD 4YSZB 4MGYE 1KLUD 1JQ4A 1XLOA 2WS3B 1BMLC 5H8YE 4IM2A 3RT3B 4GOCA 3B9JA 4A55A 1FMAD 4EUTA 2Y3AA 2L0FA 3TEZA 2ZVNA 4JGHB 2AYOB 4NJ7A 2MSED 3ZJUA 5AUKA 1QKZA 4RGTA 1SBBB 2WXNA 4RM8A 4P1CC 3B1LX 4A6QA 1P7EA 5G5HA 1M4VA 3QIJA 3B0AA 1JROA 5KHQA 2INDC 1C78A 2LVPA 4L2YA 2JT4B 1YQ3B 2AWTA 3AE9B 3TSSA 2VZKB 3N1YC 1GUAB 2LXAA 3K9PB 2GI9A 3VTUA 3A33B 4D2KA 1XCQL 2PPHA 4FADA 1MPEA 3C19A 5H92C 2KKCA 3PV1A 2H88B 3VRBB 3VR8B 4BKSD 3NRZA 4X57B 2KANA 1XF5L 3DBRB 4J3OD 3DVGX 3SEBA 1L4DB 4WWOA 1IGDA 1ESFA 1YN3A 5BMGA 2KWVB 4GDKB 3EFUA 2G1EA 1V49A 2IGGA 3EGRA 4N9F4 2ZPYA 3LXFA 2BTEA 1TBEA 1TZOA 1VLBA 3WA0A 1J0GA 4RF0A 2N9PC 3TL5A 1KH0A 2CJNA 3RCZA 1GJZA 2LUMA 1M94A 4YL8A 1XD3B 4KVGB 3ML8A 1Z2MA 1RRBA 1C4CA 3ZKJC 2RGFA 3NG0A 4AWJA 1ZW7A 3P4PB 3RNFC 1WXVA 1VDVA 4NQLB 2M56B 2HTHA 5E6JA 1R7SA 3B2FA 2LVQA 1I4XA 3NS8A 5CTRC 2GMIC 4KKJA 4AOFA 3PSEB 5BMHA 5KHOA 2IZVB 2KT7A 3MJ5A 3N30A 4FLHA 2EELA 1DOIA 2M0XA 2IO0B 2IO3B 1ACCA 4I6PA 2RPQA 3N32A 3ZIMA 5I4DA 2GBRA 3NHEB 5IA7A 2ZW1A 2IY1B 2VH1A 3R7QA 1NYRA 2FCSA 2WQYB 2G3QB 2IO1B 3ZNZB 3EA6A 3RNAC 4BFRA 2HDEA 3QJZA 2OEDA 4OVVA 2B3AA 2LFIA 1FCCC 1HE8A 3I57A 3NVWA 2L76A 2ACZB 3P4RB 2MEKA 2QMTA 2QILA 3VAWA 2CHWA 4ASWC 4A8XC 1I4GA 5BO4B 2W54A 1N61A 4YSXB 4MACA 1K51A 1XLPA 1LXDA 2NPTB 3UINB 1ZUD2 4CHKA 5IO9A 4FJYA 5EE1A 2EKIA 3PHXB 1FNVA 1TZ1A 2XN9C 3GE3C 3CMMB 3FILB 3P2BA 4GMVA 3U7ZA 4RGOS 4ANUA 3ZUNA 1I4RA 1BXTA 4US9A 1ENFA 3RZFA 1WE6A 2K6DB 4KIKB 1AARA 4NPNA 4LLGM 2BVCA 5C3JB 1UH6A 3SHQA 5AUIA 5IP4D 1OQQA 4AJWA 1SEBD 3DBRI 2LD9A 1NVID 2BF8B 4MGKE 1UNSA 3OJ3A 1J7AA 2WXLA 1Y56A 2B76B 2PEAA 1QF6A 2CJOA 2FAZA 2MBEA 1SE2A 4IDIA 2Z0EB 4WJQA 5J17A 4ANVA 1XLQA 3AU4A 1EO6A 1V86A 3PZDA 4TQ0A 3L54A 2N0SB 1F52A 1P3QU 1OEYJ 2KDIA 2RSUA 3RNGC 5L83A 1L2NA 2SEBD 3IAS1 4TMAB 2NVUI 3BIID 2WDVB 2AL3A 3AE3B 3N20C 3VUXA 1RWSA 5FKAC 2KOXA 3E9SA 1FD6A 1U4AA 2J0MA 4PS7A 1MFWA 1T0SC 2UYZB 1WGDA 4W9LA 3A9JB 2BB6A 1IBXB 1JWBD 3MP9A 1I7HA 3AECB 4NQKE 4HPMB 2A5UA 1YNTE 2Y5CA 3DBSA 4CQNA 3IT6B 4H2AA 2KMMA 5E6NA 3QCAA 4MDKE 2QDFA 5TR5A 1CK1A 3RZWC 4ANWA 1FFVA 2ZNVB 1N63A 4W9HA 4K81A 2XEWA 2CHXA 2ZEQA 3Q69A 3APFA 1VCBA 1XLNA 1L6UA 1CJEA 4EZJA 3AE4B 3HM3A 3VR9B 2OHFA 5AZHA 3HUIA 2WXMA 5GXGB 3PRPB 4I6NB 2LJ5A 3VFKA 4KKIA 2G4SA 4HDOA 4EEWA 4WQMA 1JRPA 3PT2B 4MSMB 1UWMA 4EE2A 1FRRA 4BBNF 3GE8C 3DBHI 2OJWA 1WGRA 1LM8B 3BVGA 2FCQA 3NZ3A 2OOBB 2CU1A 3DDCB 3SDLC 2J0JA 4WAFA 3TUOA 5D2MB 1JWMD 4DXFA 3L0WB 2BW2A 2BWES 1JMLA 5G5GA 1SJED 3J9CA 2KK8A 3R2IA 1FPYA 1T0RC 2LXCA 2MLBA 1QOGA 2N7EA 3ZTCA 3KQ4A 5FR3A 3DHGC 3VHTC 1UELA 4MJSA 3KUZA 3WIMA 2QCZA 4J6IA 3U30A 4W9DA 3AE8B 5C23A 2JWZA 2KDEB 3H7PA 3Q8AA 1C4AA 4WURA 2NR2A 1STEA 2KACA 4BKTA 4S0RA 3P4SB 1XT9B 2BYEA 2HE7A 3T3NA 1T5XD 1HTOA 1WGKA 2KQ7A 4YTPB 3P4QB 4HDQA 3PVLA 2HJ8A 2KXJA 3JSVA 3B08A 2G9HD 4OZCA 4EFOA 1D5MC 2KWUB 1GNUA 4JWSC 2R2OA 1PGXA 2IGDA 1YMHE 2JZ3B 4EZKA 3AEFB 3QC8B 4JX1C 2OJRA 3NS1A 1GB4A 1ZXHA 1Q5WB 2NCNA 1JALA 4QAYA 1EUVB 3M95A 1EF5A 2J4XA 3BWUD 4KIKA 4M8NA 1PUTA 3ZLZA 4IW0A 5T8IA 1WF9A 3M63B 4PS3A 4RM9A 3ZJVA 1IGCA 3I5JC 3JSVB 4TQ1A 4WH4A 3UI3A 3U52E 2K25A 1L6VA 5JXVA 5LNK1 2BS3B 2C7NB 1GC6A 3ML9A 4HCPB 2WYQA 2RPVA 2V4LA 4WWPA 2J53A 1IBXA 2WXFA 3Q3FA 4ZHOA 1J8CA 1ROEA 2E3TA 1WX9A 2WDQB 4LTUA 2A4ZA 1MHHE 4DHZE 1TS5A 4R3DA 2N9EB 2LVOA 1GG3A 3T9LA 1WM3A 5BYSA 4P6VF 3PGEA 2NBUA 4BOZB 4B9KA 1ZPSA 1WE7A 1R4NI 5HHDG 3AN1A 2JRHA 3OLMD 4LNNA 4KGRA 2NBVB 4GDKA 2ICIA 2UWQA 3ZTDA 3V62A 2MH7A 1WM2A 2E6XA 2KAJA 3L4PA 4NY0A 3ZJTA 3RYTA 4IG7B 1E5WA 4M02A 3N9YC 1NEKB 1WI0A 3PTFC 3FC4A 5DPWA 3NZSA 5DPTA 1FFUA 1T0QC 5D7GA 1KTKA 1C1YB 4FXCA 3Q14C 3PZ8A 2KN4A 1AN8A 3HVZA 4ARIA 4P7IA 4L1BA 3Q3OC 4NNJB 2WXIA 1HQRD 2JZPA 2VRRB 2JWUA 4WIPA 3ZGZA 5HI1A 1PYWD 3WAPA 2PVOD 2K9XA 3A9KB 3UQBA 2DWQA 1FEHA 2M0AA 4JWUC 2KHWB 4MELA 1SIJA 2KC2A 1K50A 1SJHD 2JYEA 3QX1A 4KGSA 2IO2B 3AE1B 4KDLB 1VD2A 4NZLB 1KFYB 4FULA 3W1SC 2KX3A 4KDIC 4IWPA 3RPFC 3W1YA 3NJTA 2D3BA 1TKEA 2DZIA 4MH0E 2BKRB 3AMZA 1VRAB 3TEYA 4LK0M 2FUG1 4BVUC 4ICVA 1ZDVA 2LASA 3LB8C 2J0KA 2BKFA 3BVZA 1CMXB 2JX5A 4AUQC 1EF1A 2PVGC 4UDUC 2K8CA 1V1OA 1WWTA 1WGHA 3AE2B 3ZQ4A 4HJKA 1WZ0A 2DZJA 2L3ZA 4ZRPA 2BYFA 4TUUA 1WMHA 3DHHC 1YJ1A 4XC2A 3T8MA 3MC9A 2KDMA 1FXTB 1DYQA 3X23A 2LGSA 1KLVA 3QWZB 1WZ3A 2PTLA 1TS3A 4FN2A 3MHSD 4JPSA 5DCNA 3VQIA 2MBQA 1E7PB 4GGQA 1F0ZA 3V3XA 3LJ3A 2L00B 3AB5A 1OGWA 4N6EB 1P98A 2KJ6A 4AS1A 1RLFA 3QK0A 4W9JA 3P42A 3KLSX 2BWFA 3R2TA 1PGBA 3AXCA 1DGJA 2LGIA 2KTFA 1B9RA 3DVGY 1OEYA 1WXSA 3ZXRA 3BYTB 3V61A 2N9KA 3PO0A 1F2RC 2YVCA 1JW9D 3DOWA 1JWUD 3R8BA 2C9WB 1WJNA 1TT5B 3H8HA 2J42A 1EM7A 3A9JA 2PMVA 3BYYB 4L23A 4KV2A 4KGTA 4G3XB 2TSSA 2KJHB 1KF6B 3IAM1 4E3CA 2WX0A 3KYCD 4MJSB 4ITKA 2L32A 2DYBA 2NMQA 2L83A 4YT0B 2V3PA 1UF0A 3VUWA 3S2AA 1TJEA 4RNAA 1ZKHA 1E7UA 2K5PA 2CR5A 3K9OB 1PQSA 1TKYA 5IKCM 2HD5B 4DDGD 3V6EB 3BINA 1K53A 4XGAB 1H4RA 1YX5B 3VVWB 1RFAA 2KN5A 4XWTA 3ZW3A 3VRAB 3QQ8B 2YLMA 5D6JB 2INNE 1J19A 3MC0B 4HROA 2VH2A 1IPGA 4RFBA 4TSSA 2MHJA 3N1ZC 4YWGG 2L0TA 2BS4B 1WX7A 3NVZA 1WRDB 1TIFA 4NAWA 1XO3A 4DHJD 1F1HA 1I4PA 3P63A 3QAQA 4MM3A 2GB1A 3URYA 4JQWC 2K3UA 5D3IB 4IM3A 1C3TA 1VR9A 3BY4B 4GN1A 2LRWA 3ZNID 3W5UB 4EZLA 4M8MA 2W55A 1MJDA 3VH3B 2KWCA 2Z59B 3MTNB 3VXWA 1VZ8A 1ZE3D 1LQBA 1VJKA 1E8XA 2CS4A 4C4VA 1PFDA 1R4NB 2LGXA 5BYRA 4W9KA 4CYEA 4LNOA 4IC7B 3KWLA 5CX3A 3AH7A 3O13A 1ZP0B 2O6VD 4WWMA 2DENB 2D3GA 5LXHA 3PRZA 3HK0A 4OVUA 1RFKA 1PDXA 2KLCA 4MGIE 1TS4A 1N60A 2UU7A 2J52A 4ACFA 2PIAA 2BT6A 5TSSA 1OQYA 2DAFA 2CU3A 2C7MB 4FHJA 4TV3A 3L13A 4HLEA 3PRMB 3DVNV 4S17A 2LHDA 4B0MA 3NY5A 2D10A
chains in the Genus database with same CATH topology
2MBOA 4HVBA 2JZ3B 3H7PB 4EZKA 4RM8A 4I6LB 3QC8B 2Y5BB 2L7RA 3B1LX 2DYOA 3PPAA 3V6CB 5C1ZA 2WDTB 3QIJA 3B0AA 4DDID 5KHQA 2KMCA 1WH3A 2OJRA 1WJ6A 2MP2A 2V3SA 2LVPA 2JT4B 3QHTA 3NZUA 3H9DA 2K6QA 4TKNA 2AWTA 4KZCA 1Q5WB 2KLGA 3APCA 5E6PA 2NCNA 1EUVB 3M95A 1EF5A 4KIKA 4M8NA 4ZDVA 3N3KB 1GUAB 2LXAA 3ZLZA 4NAWB 3K9PB 4IW0A 4LDTB 4FBJB 1WF9A 3VTUA 3A33B 3M63B 2KO3A 2FCNA 4PS3A 4A20A 2PPHA 3KVFB 2LRUA 3L17A 4GSWA 4KSLC 4RM9A 4XZ4A 4FADA 5CHFA 3VUYA 2KFKA 3C0RB 3JSVB 4TQ1A 4WWNA 1YX6B 2KKCA 1V9JA 4IUMB 2JY6A 3ZRCA 3PV1A 2K25A 1P0RA 4HCNB 4JL9A 4GDLB 1NBFC 2M8SA 4KZ0A 4E71A 1X1MA 2LGYA 5CHVC 1Q1OA 2FIFA 4BKSD 2C7NB 2KJRA 1GC6A 3ML9A 2FUHB 4HCPB 2WYQA 3VDZA 2CKHB 2V4LA 2ZVOA 4WWPA 3VTWA 4X57B 2KANA 1SGHA 3Q3FA 4W9EA 1J8CA 3DVGX 3Q3JA 2ZCBA 4WWOA 1WX9A 1QZEA 2A4ZA 4DHZE 2N9EB 1SE9A 2AL6A 2LVOA 2C60A 1GG3A 1KJTA 1TTNA 3T9LA 1WM3A 3L16A 4IWOA 1G6JA 3PGEA 2XBBC 5L95C 2NBUA 4IWQA 5DPSA 1UBQA 4BOZB 2MCNB 1E7VA 4B9KA 2KWVB 1WE7A 1R4NI 4GDKB 2JRHA 3EFUA 3OLMD 2KQSA 1V49A 2NBVB 3U7DA 4GDKA 4N9F4 4WQOB 2UWQA 2RR9A 2ZPYA 3ZTDA 1TBEA 3UGBB 2XK5B 3V62A 5LXIB 2GBMA 4DHJB 1WM2A 3O65B 4NY0A 3QARA 3WA0A 1J0GA 3RYTA 2N9PC 3TL5A 4ZRIA 4IG7B 3ONSA 3RCZA 1GJZA 1M94A 4II2B 1E5WA 1XD3B 4YL8A 5J18A 4KVGB 4LCDE 1NDDA 4JIOU 1TGZB 1WI0A 1XQQA 3PTFC 1WX8A 1L7YA 3ML8A 4HXDA 4GXBA 1Z2MA 4PYZA 4ZRKA 3WAOA 5DPWA 3NZSA 5DPTA 2REXA 3PLVA 5IAAC 3RD2A 4ZYNA 1RRBA 3ZKJC 2RGFA 4AWJA 1ZW7A 5D7GA 1C1YB 3KUCB 1WXVA 1WR1A 3DCGA 3IBEA 4BBNC 3RUIB 4DBGA 4NQLB 1WGYA 2HTHA 2KVRA 2MW5A 4P7IA 4LDTD 1A5RA 3ECIA 2LVQA 4NNJB 3NS8A 5CTRC 2GMIC 5G55A 4AOFA 2VRRB 3PSEB 4ZRJA 1V5OA 5KHOA 2DZMA 2IZVB 4AP4C 2KNBA 3WAPA 3N30A 4K1RB 3UF8A 4FLHA 1UD7A 1V2YA 1NI2A 1JRUA 2DHZA 3LDZE 2MBHA 3JYUA 2KFJA 2IO0B 2M0XA 3A9KB 2XK5A 2IO3B 3UQBA 4I6PA 3L10B 2MP2B 2RPQA 3N32A 4ANXA 4PS8A 3ZIMA 4W9GA 2GBRA 3NHEB 2KHWB 5IA7A 2CHZA 2W9NA 1I35A 2IY1B 4MELA 1ZGUB 3R7QA 2FCSA 2WWZA 4EOYA 2D11A 1P9DU 2KDFB 2KC2A 2G3QB 1SIFA 2IO1B 3GOEA 3JW0X 3PS6A 3QX1A 3ZNZB 4BFRA 1WMHB 3QJZA 1UBIA 2IO2B 5CHWA 4K7UA 2RD0A 4KDLB 1WYWB 2KZRA 4OVVA 2B3AA 1VD2A 3UIOB 2G4DB 1HE8A 2MBBB 3EHVA 4FULA 3TJPA 3W1SC 4RMAA 2KX3A 5J2RA 4KDIC 2L76A 5AZFA 2I1JA 4IWPA 4EKUA 3W1YA 1KOTA 3ENEA 5JHAA 2AEHA 3A1QB 4MGZE 4W9FA 2DZIA 2C5LC 4MH0E 3VAWA 3APDA 2BKRB 3L08A 3PHWB 2O6VA 2CHWA 5D94A 3SD5A 4A3PA 2JXXA 4ASWC 4IM0A 1H8CA 5BO4B 2JVCA 4BVUC 4ICVA 1KM7A 2LASA 3U8ZA 1IYFA 3TBLD 2BYVE 1LXDA 2NPTB 2J0KA 2BKFA 3UINB 4CHKA 1CMXB 2L8JA 4F1SA 4FJYA 4AUQC 1YIWA 2JPHA 2LUEA 1EF1A 1TZ1A 3PHXB 3P2BA 4GMVA 3CMMB 4B6WA 3SU8X 2N1WA 2K8CA 3KH0A 2M1MA 4ANUA 2V1YA 1WGHA 3ZUNA 2MA9B 4ICUA 2EKEC 5JH5C 4HJKA 3RZFA 5E6OA 1WZ0A 5LLIA 1WE6A 2K6DB 3OJ4B 4KIKB 1AARA 4NPNA 3R66C 2N1VA 2DZJA 2D2QA 2L3ZA 2ZCCA 1UH6A 2BYFA 3SHQA 4FHKA 4TUUA 1WMHA 3A4RA 4AJWA 1E8ZA 3DBRI 1YJ1A 2LD9A 2K39A 2KC1A 2BF8B 3KYDD 4II3B 4XC2A 5EDSA 3T8MA 1WR6E 4MGKE 4LJPB 2LWPA 3NOBA 1OTRB 1FXTB 2ZJDA 3TMPB 3AU5A 2ZNVC 3OJ3A 2PE9A 4A3OA 3X23A 1KLVA 5JZEB 3QWZB 1WZ3A 2N4FA 1WIAA 4FN2A 2IY0B 5G2NA 4DWFA 3EECA 3MHSD 5DCNA 3WANA 3VQIA 4DK5A 2MBQA 2GBNA 4MSQB 1WJUA 2PEAA 4GGQA 2MWSB 2NBWB 3D32A 2DX5B 1Y8RC 2L00B 3LJ3A 1OGWA 2FAZA 1P98A 2KJ6A 2M17A 2MBEA 2DAJA 4G11A 1RLFA 2Z0EB 3AI5A 1LFDA 3AULA 3QK0A 4WJQA 4WJNA 2KX0A 3M62B 4ANVA 5J17A 1Z5SB 3UQAA 2QHOA 3AU4A 3ZRFA 1MG8A 4W9JA 1EO6A 1V86A 2LGDA 3PZDA 4TQ0A 3L54A 1P3QU 5AEKB 1OEYJ 2KDIA 2BWFA 3MJWA 4MEMA 2RSUA 5AZGA 2FIDA 2FNJB 3AXCA 4JLCA 2PJHA 2KTFA 3DVGY 2KFKB 1OEYA 1WXSA 4URKA 4G50A 2JUOA 3H6NA 2O2VB 5L83A 1WXMA 3V61A 1L2NA 1IP9A 2YVCA 2ZZPB 2NVUI 3VH4B 2IYDB 4WAAA 1F9JA 3TIXA 3DOWA 2AL3A 3R7RA 3IHPC 3PREA 2WX1A 3VUXA 1I42A 4KSKC 2C9WB 1WJNA 4GDLA 2KOXA 3CSTA 1U4AA 2J0MA 4PS7A 3ZDMC 3OAWA 4FJZA 3A9JA 2UYZB 4K7WA 1WGDA 3I3TB 4W9LA 2R2QA 4FA6A 4KV2A 3A9JB 2DYMA 3R3MA 4G3XB 4XX5A 2KJHB 4WJPA 3KW5B 3CSFA 4NQKE 4HWIB 1E8YA 2A5UA 2GOWA 2LZ6A 3DPDA 4HPMB 3DBSA 3M3JA 2PE6B 2GBKA 4E3CA 2WX0A 3DQVA 3DVNU 3KYCD 4MJSB 4HK2A 3IFWB 2DYBA 5E6NA 3QCAA 4MDKE 2O6VB 5TR5A 1Q0WB 3VUWA 4BOSC 1WY8A 3EC8A 3A9KA 3RZWC 3S2AA 4ANWA 4W9IA 2ZNVB 3GZNI 4W9HA 1BT0A 1ZKHA 1E7UA 2XEWA 4K81A 2K8HA 2MRPA 3UIPB 2CHXA 2CR5A 2ZEQA 2LI5A 3K9OB 1PQSA 3APFA 2C7HA 2L05A 3ZNGC 1VCBA 2HD5B 4EZJA 4DDGD 3V6EB 3BINA 1H4RA 1YX5B 3VVWB 2NS5A 4BKSA 1RFAA 3ZNHB 3HM3A 3WAMA 3HM6X 4F8CB 5AZHA 2KN5A 3JVZX 4K7SA 1T0YA 3ZW3A 4AJYB 2KD0A 3QQ8B 2YLMA 3PRPB 4I6NB 2LJ5A 5D6JB 3RULA 2KMAA 3A4SC 3VFKA 2JRIB 2G4SA 4HDOA 4EEWA 1J19A 3PT2B 3VTVA 2D07B 4GB9A 1IPGA 4MSMB 3CF6E 3ZO5B 2K8BA 2GBJA 1YD8U 2L0TA 1WX7A 4BBNF 1WRDB 2BPSA 3TCAA 1WXAA 3QA8A 3DBHI 4B95A 4NAWA 4DHJD 4DXAB 3PLUA 1WGRA 3QAQA 4MM3A 1LM8B 2FCQA 2DZKA 1E90A 1WGGA 2CU1A 2OOBB 4FJVB 4JQWC 4IM3A 4G0NB 4LJOB 4E74A 2M4NA 1C3TA 2MX2A 3DDCB 3SDLC 4CO7A 2NPTA 1UZXB 2J0JA 1GC7A 3ZDTA 4DHZB 3KUDB 5JHBA 3BY4B 5FR6A 1YQBA 3W1SA 5D2MB 3ALBA 4GN1A 2LRWA 3ZNID 3HHMA 1V5TA 3L0WB 3HIZA 2JZZA 3V60A 2KDBA 4EZLA 4PYUA 4M8MA 2BWES 4GU2A 3WALA 2N9XA 2KK8A 4M0WB 3VH3B 2KWCA 2Z59B 3MTNB 2MQJA 3VXWA 1WJ4A 2LXCA 2MLBA 3IG3A 5HKHA 1LQBA 2BGFA 2N7EA 2I1KA 3X0WA 3ZTCA 2ASQA 2N7DA 2O2VA 1E8XA 1E8WA 4GIVA 2IBIB 2CS4A 3VHTC 1UELA 2LGXA 3A1QA 2JF5A 1R4MI 4MJSA 3ZVVA 4W9KA 3DBLI 3KUZA 4CYEA 3WIMA 1S1QB 1K8RB 1V80A 4J6IA 4WJOA 3IVFA 4W9DA 3H7SA 3U30A 2K1FA 1RAXA 2KTRA 5C23A 2JWZA 2KDEB 3H7PA 4IC7B 5DPRA 5CX3A 2ZPNA 2FCMA 5GMVA 2KTRB 1V81A 2Z0DB 1V6EA 2O6VD 2NR2A 1ISNA 4F7ZA 2DENB 2J7QB 1P1AA 4BKTA 2EMSA 2D3GA 5LXHA 3PRZA 4NJ6A 1XT9B 3HK0A 2BYEA 2HE7A 4OVUA 2KLCA 4MGYE 3H1UA 4W9CA 4MGIE 4IM2A 4HPLB 2KQ7A 1D3ZA 3RT3B 4GOCA 4EUTA 1WFYA 4HDQA 3PVLA 1OQYA 2DAFA 2L0FA 2HJ8A 2KXJA 3JSVA 3B08A 2C7MB 4BKGA 1UGMA 4EFOA 2ZVNA 4JGHB 2G45B 4FHJA 2EMTA 4TV3A 2AYOB 4NJ7A 3L13A 2MSED 1S3SG 2KWUB 4HLEA 1GNUA 3PRMB 3DVNV 2R2OA 3NY5A 2D10A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2MBO A;  4HVB A;  2JZ3 B;  3H7P B;  4EZK A;  4RM8 A;  4I6L B;  3QC8 B;  2Y5B B;  2L7R A;  3B1L X;  2DYO A;  3PPA A;  3V6C B;  5C1Z A;  2WDT B;  3QIJ A;  3B0A A;  4DDI D;  5KHQ A;  2KMC A;  1WH3 A;  2OJR A;  1WJ6 A;  2MP2 A;  2V3S A;  2LVP A;  2JT4 B;  3QHT A;  3NZU A;  3H9D A;  2K6Q A;  4TKN A;  2AWT A;  4KZC A;  1Q5W B;  2KLG A;  3APC A;  5E6P A;  2NCN A;  1EUV B;  3M95 A;  1EF5 A;  4KIK A;  4M8N A;  4ZDV A;  3N3K B;  1GUA B;  2LXA A;  3ZLZ A;  4NAW B;  3K9P B;  4IW0 A;  4LDT B;  4FBJ B;  1WF9 A;  3VTU A;  3A33 B;  3M63 B;  2KO3 A;  2FCN A;  4PS3 A;  4A20 A;  2PPH A;  3KVF B;  2LRU A;  3L17 A;  4GSW A;  4KSL C;  4RM9 A;  4XZ4 A;  4FAD A;  5CHF A;  3VUY A;  2KFK A;  3C0R B;  3JSV B;  4TQ1 A;  4WWN A;  1YX6 B;  2KKC A;  1V9J A;  4IUM B;  2JY6 A;  3ZRC A;  3PV1 A;  2K25 A;  1P0R A;  4HCN B;  4JL9 A;  4GDL B;  1NBF C;  2M8S A;  4KZ0 A;  4E71 A;  1X1M A;  2LGY A;  5CHV C;  1Q1O A;  2FIF A;  4BKS D;  2C7N B;  2KJR A;  1GC6 A;  3ML9 A;  2FUH B;  4HCP B;  2WYQ A;  3VDZ A;  2CKH B;  2V4L A;  2ZVO A;  4WWP A;  3VTW A;  4X57 B;  2KAN A;  1SGH A;  3Q3F A;  4W9E A;  1J8C A;  3DVG X;  3Q3J A;  2ZCB A;  4WWO A;  1WX9 A;  1QZE A;  2A4Z A;  4DHZ E;  2N9E B;  1SE9 A;  2AL6 A;  2LVO A;  2C60 A;  1GG3 A;  1KJT A;  1TTN A;  3T9L A;  1WM3 A;  3L16 A;  4IWO A;  1G6J A;  3PGE A;  2XBB C;  5L95 C;  2NBU A;  4IWQ A;  5DPS A;  1UBQ A;  4BOZ B;  2MCN B;  1E7V A;  4B9K A;  2KWV B;  1WE7 A;  1R4N I;  4GDK B;  2JRH A;  3EFU A;  3OLM D;  2KQS A;  1V49 A;  2NBV B;  3U7D A;  4GDK A;  4N9F 4;  4WQO B;  2UWQ A;  2RR9 A;  2ZPY A;  3ZTD A;  1TBE A;  3UGB B;  2XK5 B;  3V62 A;  5LXI B;  2GBM A;  4DHJ B;  1WM2 A;  3O65 B;  4NY0 A;  3QAR A;  3WA0 A;  1J0G A;  3RYT A;  2N9P C;  3TL5 A;  4ZRI A;  4IG7 B;  3ONS A;  3RCZ A;  1GJZ A;  1M94 A;  4II2 B;  1E5W A;  1XD3 B;  4YL8 A;  5J18 A;  4KVG B;  4LCD E;  1NDD A;  4JIO U;  1TGZ B;  1WI0 A;  1XQQ A;  3PTF C;  1WX8 A;  1L7Y A;  3ML8 A;  4HXD A;  4GXB A;  1Z2M A;  4PYZ A;  4ZRK A;  3WAO A;  5DPW A;  3NZS A;  5DPT A;  2REX A;  3PLV A;  5IAA C;  3RD2 A;  4ZYN A;  1RRB A;  3ZKJ C;  2RGF A;  4AWJ A;  1ZW7 A;  5D7G A;  1C1Y B;  3KUC B;  1WXV A;  1WR1 A;  3DCG A;  3IBE A;  4BBN C;  3RUI B;  4DBG A;  4NQL B;  1WGY A;  2HTH A;  2KVR A;  2MW5 A;  4P7I A;  4LDT D;  1A5R A;  3ECI A;  2LVQ A;  4NNJ B;  3NS8 A;  5CTR C;  2GMI C;  5G55 A;  4AOF A;  2VRR B;  3PSE B;  4ZRJ A;  1V5O A;  5KHO A;  2DZM A;  2IZV B;  4AP4 C;  2KNB A;  3WAP A;  3N30 A;  4K1R B;  3UF8 A;  4FLH A;  1UD7 A;  1V2Y A;  1NI2 A;  1JRU A;  2DHZ A;  3LDZ E;  2MBH A;  3JYU A;  2KFJ A;  2IO0 B;  2M0X A;  3A9K B;  2XK5 A;  2IO3 B;  3UQB A;  4I6P A;  3L10 B;  2MP2 B;  2RPQ A;  3N32 A;  4ANX A;  4PS8 A;  3ZIM A;  4W9G A;  2GBR A;  3NHE B;  2KHW B;  5IA7 A;  2CHZ A;  2W9N A;  1I35 A;  2IY1 B;  4MEL A;  1ZGU B;  3R7Q A;  2FCS A;  2WWZ A;  4EOY A;  2D11 A;  1P9D U;  2KDF B;  2KC2 A;  2G3Q B;  1SIF A;  2IO1 B;  3GOE A;  3JW0 X;  3PS6 A;  3QX1 A;  3ZNZ B;  4BFR A;  1WMH B;  3QJZ A;  1UBI A;  2IO2 B;  5CHW A;  4K7U A;  2RD0 A;  4KDL B;  1WYW B;  2KZR A;  4OVV A;  2B3A A;  1VD2 A;  3UIO B;  2G4D B;  1HE8 A;  2MBB B;  3EHV A;  4FUL A;  3TJP A;  3W1S C;  4RMA A;  2KX3 A;  5J2R A;  4KDI C;  2L76 A;  5AZF A;  2I1J A;  4IWP A;  4EKU A;  3W1Y A;  1KOT A;  3ENE A;  5JHA A;  2AEH A;  3A1Q B;  4MGZ E;  4W9F A;  2DZI A;  2C5L C;  4MH0 E;  3VAW A;  3APD A;  2BKR B;  3L08 A;  3PHW B;  2O6V A;  2CHW A;  5D94 A;  3SD5 A;  4A3P A;  2JXX A;  4ASW C;  4IM0 A;  1H8C A;  5BO4 B;  2JVC A;  4BVU C;  4ICV A;  1KM7 A;  2LAS A;  3U8Z A;  1IYF A;  3TBL D;  2BYV E;  1LXD A;  2NPT B;  2J0K A;  2BKF A;  3UIN B;  4CHK A;  1CMX B;  2L8J A;  4F1S A;  4FJY A;  4AUQ C;  1YIW A;  2JPH A;  2LUE A;  1EF1 A;  1TZ1 A;  3PHX B;  3P2B A;  4GMV A;  3CMM B;  4B6W A;  3SU8 X;  2N1W A;  2K8C A;  3KH0 A;  2M1M A;  4ANU A;  2V1Y A;  1WGH A;  3ZUN A;  2MA9 B;  4ICU A;  2EKE C;  5JH5 C;  4HJK A;  3RZF A;  5E6O A;  1WZ0 A;  5LLI A;  1WE6 A;  2K6D B;  3OJ4 B;  4KIK B;  1AAR A;  4NPN A;  3R66 C;  2N1V A;  2DZJ A;  2D2Q A;  2L3Z A;  2ZCC A;  1UH6 A;  2BYF A;  3SHQ A;  4FHK A;  4TUU A;  1WMH A;  3A4R A;  4AJW A;  1E8Z A;  3DBR I;  1YJ1 A;  2LD9 A;  2K39 A;  2KC1 A;  2BF8 B;  3KYD D;  4II3 B;  4XC2 A;  5EDS A;  3T8M A;  1WR6 E;  4MGK E;  4LJP B;  2LWP A;  3NOB A;  1OTR B;  1FXT B;  2ZJD A;  3TMP B;  3AU5 A;  2ZNV C;  3OJ3 A;  2PE9 A;  4A3O A;  3X23 A;  1KLV A;  5JZE B;  3QWZ B;  1WZ3 A;  2N4F A;  1WIA A;  4FN2 A;  2IY0 B;  5G2N A;  4DWF A;  3EEC A;  3MHS D;  5DCN A;  3WAN A;  3VQI A;  4DK5 A;  2MBQ A;  2GBN A;  4MSQ B;  1WJU A;  2PEA A;  4GGQ A;  2MWS B;  2NBW B;  3D32 A;  2DX5 B;  1Y8R C;  2L00 B;  3LJ3 A;  1OGW A;  2FAZ A;  1P98 A;  2KJ6 A;  2M17 A;  2MBE A;  2DAJ A;  4G11 A;  1RLF A;  2Z0E B;  3AI5 A;  1LFD A;  3AUL A;  3QK0 A;  4WJQ A;  4WJN A;  2KX0 A;  3M62 B;  4ANV A;  5J17 A;  1Z5S B;  3UQA A;  2QHO A;  3AU4 A;  3ZRF A;  1MG8 A;  4W9J A;  1EO6 A;  1V86 A;  2LGD A;  3PZD A;  4TQ0 A;  3L54 A;  1P3Q U;  5AEK B;  1OEY J;  2KDI A;  2BWF A;  3MJW A;  4MEM A;  2RSU A;  5AZG A;  2FID A;  2FNJ B;  3AXC A;  4JLC A;  2PJH A;  2KTF A;  3DVG Y;  2KFK B;  1OEY A;  1WXS A;  4URK A;  4G50 A;  2JUO A;  3H6N A;  2O2V B;  5L83 A;  1WXM A;  3V61 A;  1L2N A;  1IP9 A;  2YVC A;  2ZZP B;  2NVU I;  3VH4 B;  2IYD B;  4WAA A;  1F9J A;  3TIX A;  3DOW A;  2AL3 A;  3R7R A;  3IHP C;  3PRE A;  2WX1 A;  3VUX A;  1I42 A;  4KSK C;  2C9W B;  1WJN A;  4GDL A;  2KOX A;  3CST A;  1U4A A;  2J0M A;  4PS7 A;  3ZDM C;  3OAW A;  4FJZ A;  3A9J A;  2UYZ B;  4K7W A;  1WGD A;  3I3T B;  4W9L A;  2R2Q A;  4FA6 A;  4KV2 A;  3A9J B;  2DYM A;  3R3M A;  4G3X B;  4XX5 A;  2KJH B;  4WJP A;  3KW5 B;  3CSF A;  4NQK E;  4HWI B;  1E8Y A;  2A5U A;  2GOW A;  2LZ6 A;  3DPD A;  4HPM B;  3DBS A;  3M3J A;  2PE6 B;  2GBK A;  4E3C A;  2WX0 A;  3DQV A;  3DVN U;  3KYC D;  4MJS B;  4HK2 A;  3IFW B;  2DYB A;  5E6N A;  3QCA A;  4MDK E;  2O6V B;  5TR5 A;  1Q0W B;  3VUW A;  4BOS C;  1WY8 A;  3EC8 A;  3A9K A;  3RZW C;  3S2A A;  4ANW A;  4W9I A;  2ZNV B;  3GZN I;  4W9H A;  1BT0 A;  1ZKH A;  1E7U A;  2XEW A;  4K81 A;  2K8H A;  2MRP A;  3UIP B;  2CHX A;  2CR5 A;  2ZEQ A;  2LI5 A;  3K9O B;  1PQS A;  3APF A;  2C7H A;  2L05 A;  3ZNG C;  1VCB A;  2HD5 B;  4EZJ A;  4DDG D;  3V6E B;  3BIN A;  1H4R A;  1YX5 B;  3VVW B;  2NS5 A;  4BKS A;  1RFA A;  3ZNH B;  3HM3 A;  3WAM A;  3HM6 X;  4F8C B;  5AZH A;  2KN5 A;  3JVZ X;  4K7S A;  1T0Y A;  3ZW3 A;  4AJY B;  2KD0 A;  3QQ8 B;  2YLM A;  3PRP B;  4I6N B;  2LJ5 A;  5D6J B;  3RUL A;  2KMA A;  3A4S C;  3VFK A;  2JRI B;  2G4S A;  4HDO A;  4EEW A;  1J19 A;  3PT2 B;  3VTV A;  2D07 B;  4GB9 A;  1IPG A;  4MSM B;  3CF6 E;  3ZO5 B;  2K8B A;  2GBJ A;  1YD8 U;  2L0T A;  1WX7 A;  4BBN F;  1WRD B;  2BPS A;  3TCA A;  1WXA A;  3QA8 A;  3DBH I;  4B95 A;  4NAW A;  4DHJ D;  4DXA B;  3PLU A;  1WGR A;  3QAQ A;  4MM3 A;  1LM8 B;  2FCQ A;  2DZK A;  1E90 A;  1WGG A;  2CU1 A;  2OOB B;  4FJV B;  4JQW C;  4IM3 A;  4G0N B;  4LJO B;  4E74 A;  2M4N A;  1C3T A;  2MX2 A;  3DDC B;  3SDL C;  4CO7 A;  2NPT A;  1UZX B;  2J0J A;  1GC7 A;  3ZDT A;  4DHZ B;  3KUD B;  5JHB A;  3BY4 B;  5FR6 A;  1YQB A;  3W1S A;  5D2M B;  3ALB A;  4GN1 A;  2LRW A;  3ZNI D;  3HHM A;  1V5T A;  3L0W B;  3HIZ A;  2JZZ A;  3V60 A;  2KDB A;  4EZL A;  4PYU A;  4M8M A;  2BWE S;  4GU2 A;  3WAL A;  2N9X A;  2KK8 A;  4M0W B;  3VH3 B;  2KWC A;  2Z59 B;  3MTN B;  2MQJ A;  3VXW A;  1WJ4 A;  2LXC A;  2MLB A;  3IG3 A;  5HKH A;  1LQB A;  2BGF A;  2N7E A;  2I1K A;  3X0W A;  3ZTC A;  2ASQ A;  2N7D A;  2O2V A;  1E8X A;  1E8W A;  4GIV A;  2IBI B;  2CS4 A;  3VHT C;  1UEL A;  2LGX A;  3A1Q A;  2JF5 A;  1R4M I;  4MJS A;  3ZVV A;  4W9K A;  3DBL I;  3KUZ A;  4CYE A;  3WIM A;  1S1Q B;  1K8R B;  1V80 A;  4J6I A;  4WJO A;  3IVF A;  4W9D A;  3H7S A;  3U30 A;  2K1F A;  1RAX A;  2KTR A;  5C23 A;  2JWZ A;  2KDE B;  3H7P A;  4IC7 B;  5DPR A;  5CX3 A;  2ZPN A;  2FCM A;  5GMV A;  2KTR B;  1V81 A;  2Z0D B;  1V6E A;  2O6V D;  2NR2 A;  1ISN A;  4F7Z A;  2DEN B;  2J7Q B;  1P1A A;  4BKT A;  2EMS A;  2D3G A;  5LXH A;  3PRZ A;  4NJ6 A;  1XT9 B;  3HK0 A;  2BYE A;  2HE7 A;  4OVU A;  2KLC A;  4MGY E;  3H1U A;  4W9C A;  4MGI E;  4IM2 A;  4HPL B;  2KQ7 A;  1D3Z A;  3RT3 B;  4GOC A;  4EUT A;  1WFY A;  4HDQ A;  3PVL A;  1OQY A;  2DAF A;  2L0F A;  2HJ8 A;  2KXJ A;  3JSV A;  3B08 A;  2C7M B;  4BKG A;  1UGM A;  4EFO A;  2ZVN A;  4JGH B;  2G45 B;  4FHJ A;  2EMT A;  4TV3 A;  2AYO B;  4NJ7 A;  3L13 A;  2MSE D;  1S3S G;  2KWU B;  4HLE A;  1GNU A;  3PRM B;  3DVN V;  2R2O A;  3NY5 A;  2D10 A; 
#chains in the Genus database with same CATH topology
 2MBO A;  4HVB A;  4M01 A;  3H7P B;  2Y5B B;  1HEZ E;  2PKO A;  1KLG D;  3PPA A;  2WXP A;  3RMK C;  3V6C B;  2PLP A;  2MP2 A;  2V3S A;  4C80 A;  3QHT A;  2HTM E;  2GRI A;  2KLG A;  3EUB 2;  3N3K B;  1FIQ A;  2KYW A;  4NAW B;  2KO3 A;  2FCN A;  4A20 A;  3KVF B;  3L17 A;  4XZ4 A;  3VUY A;  1I4H A;  1EU4 A;  2KFK A;  3C0R B;  4WWN A;  1YX6 B;  5EE0 A;  1V9J A;  2JY6 A;  3ZRC A;  3MHZ A;  4JL9 A;  4GDL B;  4KZ0 A;  1L0X B;  2LGY A;  1Q1O A;  2FIF A;  3MFG A;  3DWM A;  2BBC A;  1L5P A;  3GP7 A;  3DBH B;  1FCL A;  3VDZ A;  2ZVO A;  1RYJ A;  1SGH A;  1V1P B;  4W9E A;  2QIE B;  3ABV B;  1DOY A;  2JSV X;  1NEN B;  2RMM A;  2AX5 A;  4A90 A;  2C60 A;  2INC C;  3L16 A;  1SXT A;  1AWD A;  1G6J A;  2XBB C;  5L95 C;  2N9L A;  1UBQ A;  2W3R A;  2AQ2 B;  2K22 A;  1R4M B;  2KQS A;  3U7D A;  4WQO B;  2WXQ A;  2XK5 B;  2GBM A;  5D3D A;  4DHJ B;  3O65 B;  4M0W A;  4KX6 B;  4ZRI A;  3ONS A;  5J18 A;  4LCD E;  1TGZ B;  4OW0 A;  1XQQ A;  1WX8 A;  4GXB A;  4PYZ A;  4ZRK A;  1GOZ A;  1ET9 A;  3PLV A;  1FXI A;  2WXK A;  3Q2A C;  3DCG A;  3IBE A;  1E10 A;  3RUI B;  4HPP A;  1HZ6 A;  1D5X C;  1WGY A;  1YOV B;  2KVR A;  2WXG A;  1SE3 A;  4LDT D;  4K3C A;  3ECI A;  5G55 A;  4A9A A;  3Q8C A;  3SR6 A;  2W82 A;  4ZRJ A;  1V5O A;  2VZK D;  2KNB A;  4BZA A;  1OFF A;  2AQ3 B;  3RNC C;  2N7J A;  4LNI A;  1UD7 A;  1V2Y A;  1NI2 A;  1JRU A;  2RDH A;  2DBY A;  2V4I B;  3JYU A;  4RGM A;  2LMC A;  3Q6B A;  2MP2 B;  4K3B A;  4PS8 A;  5BMI A;  1I35 A;  2W9N A;  4XYC A;  1ZGU B;  4EOY A;  1UWX A;  2D11 A;  1P9D U;  2KDF B;  3BK1 A;  3OWE B;  1SIF A;  3GOE A;  3ZYY X;  1D4B A;  1WMH B;  1UBI A;  3U2S C;  2WXR A;  4YSY B;  2W3S A;  3EHV A;  4RMA A;  1KRH A;  2BS2 B;  5AZF A;  1YJJ A;  2YEP B;  5JHA A;  4W9F A;  2AEH A;  3A1Q B;  4MGZ E;  1C77 A;  3PHW B;  3I63 C;  2JXX A;  1V8C A;  2V3N A;  1H8C A;  2JVC A;  3U8Z A;  1IYF A;  3TBL D;  2BYV E;  4HKZ E;  3NVV A;  1YIW A;  2Y5P A;  2JPH A;  2LUE A;  4ZRQ A;  2MJE A;  4LNF A;  2V1Y A;  2MA9 B;  5LLI A;  3R66 C;  2N1V A;  2D2Q A;  3B2G A;  4XDC A;  4FHK A;  1E8Z A;  3HRD D;  2K39 A;  2KC1 A;  3KYD D;  5EDS A;  4LJP B;  2LWP A;  3NOB A;  4N59 A;  5C2T B;  4NAM A;  4NJC A;  4XDD A;  1FM0 D;  1MI0 A;  2IY0 B;  5G2N A;  2Z8L A;  4DK5 A;  5HG2 A;  3RNB C;  4MSQ B;  2GBN A;  1WJU A;  4REZ A;  2MWS B;  2D3C A;  1Y8R C;  1LO5 D;  4US8 A;  1QOA A;  2WXH A;  2M17 A;  2XNA C;  1MHX A;  1IUE A;  2ZW0 A;  4WJN A;  3AEA B;  1Z5S B;  3UQA A;  2QHO A;  3ZRF A;  3AE6 B;  4M00 A;  5AEK B;  4MEM A;  2FID A;  2FNJ B;  3RNE C;  4MM3 B;  2PJH A;  4URK A;  4G50 A;  3H6N A;  1EU3 A;  3IXS A;  4LNK A;  3WCQ A;  2ZZP B;  2IDY A;  3TIX A;  2JU6 X;  1T6B X;  2QC8 A;  3PRE A;  2WX1 A;  1I42 A;  4KSK C;  4RF1 A;  4GDL A;  3ZDM C;  3OAW A;  3NVY A;  4K7W A;  3I3T B;  2IPK D;  1J7C A;  1J7B A;  4WJP A;  3CSF A;  1WRI A;  3Q3N C;  2LZ6 A;  2GBK A;  2LHE A;  1NI3 A;  3IFW B;  1Q0W B;  1WY8 A;  3EC8 A;  4W9I A;  2K8H A;  3UIP B;  2WNM A;  2LI5 A;  2C7H A;  2L05 A;  4P16 A;  4GLS C;  4BKS A;  3WAM A;  3HM6 X;  4F8C B;  1QOF A;  1CZP A;  1C76 A;  1T0Y A;  3Q3M C;  1RM6 C;  3RUL A;  3A4S C;  3VTV A;  2D07 B;  3ZO5 B;  2K8B A;  2AQ1 B;  2GBJ A;  1TKG A;  3V05 A;  2DNF A;  2JYT A;  3TCA A;  2BPS A;  2X8X X;  2V0G A;  1MG4 A;  4DXA B;  3PLU A;  1GAQ B;  3W9C B;  3SFD B;  4FJV B;  2SAK A;  3BK2 A;  2M4N A;  3AE7 B;  1UZX B;  4DHZ B;  5JHB A;  5FR6 A;  4ZHP A;  2GLS A;  3W1S A;  2KQ4 X;  1V5T A;  3HIZ A;  2BYT A;  2N9X A;  4ARC A;  3IG3 A;  5HKH A;  3AE5 B;  3X0W A;  2I1K A;  2ASQ A;  2YEP F;  2N7D A;  4C4V B;  1SSN A;  1E8W A;  2IJ0 A;  4GIV A;  2IBI B;  3RN9 C;  4ZOH C;  1GB1 A;  1R4M I;  3ZVV A;  4HRS A;  3DBL I;  3IVF A;  1RAX A;  2KTR A;  3AEE B;  3LYY A;  2BB5 A;  2ZPN A;  1QIL A;  1ISN A;  3HVD A;  2J7Q B;  1L0V B;  1K52 A;  2WU2 B;  3H1U A;  4W9C A;  1WXQ A;  3RFZ B;  4HPL B;  1D3Z A;  3P1M A;  1WFY A;  1F2R I;  4BKG A;  1UGM A;  3TEW A;  2G45 B;  2EMT A;  3Q8B A;  1S3S G;  1C79 A;  1YN5 A;  1XEE A;  2ON8 A;  4I6L B;  2L7R A;  2DYO A;  5C1Z A;  2WDT B;  4DDI D;  2KMC A;  1WH3 A;  1JWS D;  1WJ6 A;  2I2Y A;  2K0P A;  3BVM A;  3H9D A;  2FE8 A;  2K6Q A;  2MJ3 A;  3NZU A;  4TKN A;  4KZC A;  1GPX A;  1ZOY B;  2DLB A;  2L52 A;  1YN4 A;  3APC A;  5E6P A;  3MC8 A;  4ZDV A;  1AW7 A;  1WSP A;  4LDT B;  4DQO C;  4FBJ B;  3GB1 A;  4KSL C;  2LRU A;  4GSW A;  5CHF A;  5IOI A;  4IUM B;  1P0R A;  4HCN B;  3FKY A;  1NBF C;  2M8S A;  3Q8F A;  4E71 A;  1X1M A;  5CHV C;  3AED B;  4C00 A;  1I4Q A;  2KJR A;  1TY2 A;  1DOX A;  5IN7 A;  2FUH B;  2CKH B;  3VTW A;  3U4E G;  3C8Y A;  2MJD A;  1L4Z B;  3Q3J A;  2ZCB A;  5EE3 A;  3ZXV A;  2KVZ A;  2BQQ A;  1QZE A;  1SE9 A;  2AL6 A;  1N6Z A;  1KJT A;  1TTN A;  2WLB A;  1QT9 A;  4IWO A;  5DPS A;  4IWQ A;  2H89 B;  2MCN B;  1E7V A;  2WXO A;  1SE4 A;  4AQ7 A;  3DHI C;  3TEX A;  2NTT A;  2RR9 A;  3AM9 A;  3UGB B;  4PT5 A;  5LXI B;  1E0Z A;  4B0E A;  3T3O A;  3QAR A;  4YTN B;  4II2 B;  1NDD A;  1VZ6 A;  4JE3 B;  4JIO U;  4HXD A;  1L7Y A;  1FO4 A;  3WAO A;  5IAA C;  2REX A;  3RD2 A;  1VZ7 A;  4ZYN A;  2IGH A;  2INP E;  3KUC B;  1WR1 A;  2R61 A;  4BBN C;  4DBG A;  1HXY D;  4XWW A;  2MW5 A;  1A5R A;  5FK9 C;  2DZM A;  1E6E B;  4AP4 C;  2WXJ A;  1TY0 A;  1V97 A;  4K1R B;  3UF8 A;  2DHZ A;  2D3A A;  3LDZ E;  2MBH A;  4HEA 1;  2KFJ A;  2XK5 A;  3L10 B;  4ANX A;  2QJL A;  4W9G A;  1N5W A;  1QQR A;  2CHZ A;  1PGA A;  2WWZ A;  3SFE B;  3JW0 X;  3PS6 A;  5CHW A;  1V1P A;  4K7U A;  2RD0 A;  1WYW B;  2FBW B;  2KZR A;  4O1N A;  3UIO B;  1XCT L;  2G4D B;  2RDG A;  4IKG A;  4RCO A;  4Q2J A;  2MBB B;  3TJP A;  1XXG A;  5J2R A;  1C4P A;  2I1J A;  4EKU A;  2JQR B;  1KOT A;  3ENE A;  2WDR B;  2C5L C;  3APD A;  3L08 A;  2O6V A;  5D94 A;  4A3P A;  3SD5 A;  4IM0 A;  2D5G A;  1KM7 A;  2HJ1 A;  3ETR A;  2L8J A;  3AEB B;  2WP9 B;  4F1S A;  2LJI A;  1OQR A;  4B6W A;  1FNW A;  3SU8 X;  4BAX A;  2N1W A;  3KH0 A;  2M1M A;  4ICU A;  2EKE C;  2I38 A;  4PK1 A;  5JH5 C;  3BZD B;  5E6O A;  3OJ4 B;  4YTM B;  1SF0 A;  5EE9 A;  3RI7 C;  2ZCC A;  5BYQ A;  3A4R A;  2M19 A;  1CQV A;  4II3 B;  1P7F A;  1WR6 E;  2QSD A;  1F77 A;  1OTR B;  2WGS A;  3W5V B;  2ZJD A;  3TMP B;  3AU5 A;  2ZNV C;  2PE9 A;  4A3O A;  5JZE B;  2N4F A;  1WIA A;  4DWF A;  3EEC A;  1HA5 A;  3WAN A;  3AEG B;  2NBW B;  1B1Z A;  3D32 A;  2DX5 B;  1N5X A;  3GZN B;  1LGR A;  3CWI A;  2DAJ A;  3FIL A;  4G11 A;  3AI5 A;  1LFD A;  1Q10 A;  3AUL A;  2KX0 A;  3M62 B;  3AV8 A;  4N58 A;  1MG8 A;  1ZXI A;  4OHJ A;  2LGD A;  4MH8 A;  3Q8E A;  3NUH B;  3I9V 1;  3MJW A;  5AZG A;  4JLC A;  2KFK B;  4IOI E;  2WHI A;  4XE0 A;  3FAH A;  2JUO A;  2O2V B;  4RH6 A;  1WXM A;  1ET6 A;  1IP9 A;  3VH4 B;  2IYD B;  4WAA A;  2LEK A;  1F9J A;  1NYQ A;  3DWG C;  3R7R A;  3IHP C;  3GS2 A;  4RGN A;  3CST A;  4FJZ A;  2ONQ A;  2WU5 B;  4FA6 A;  2R2Q A;  2DYM A;  3R3M A;  4XX5 A;  2QEJ C;  4C56 C;  1L0Y B;  1YQ4 B;  3KW5 B;  4HWI B;  1ZDX A;  1E8Y A;  2GOW A;  3DPD A;  3M3J A;  2PE6 B;  3DVN U;  3DQV A;  4HK2 A;  1D5Z C;  1BUI C;  1E9M A;  2O6V B;  4HKQ A;  1EWC A;  4ZYS A;  4BOS C;  1C9F A;  1TS2 A;  3A9K A;  1N62 A;  2X38 A;  3GZN I;  1BT0 A;  2MRP A;  1QLB B;  4DXG A;  3CIR B;  4OZA A;  3ZNG C;  3OG5 A;  2NS5 A;  1JCK B;  3ZNH B;  1YJI A;  3JVZ X;  2L1A A;  4K7S A;  4AJY B;  2KD0 A;  1QOB A;  2KMA A;  1EWY C;  2JRI B;  1SB3 C;  2NTS A;  5HFY A;  1AYF A;  1MVK A;  4GB9 A;  3CF6 E;  1YD8 U;  1UGJ A;  1WYG A;  4MT5 A;  2KWD A;  3E56 A;  1WXA A;  1FNU A;  3QA8 A;  4B95 A;  1TYG B;  2DZK A;  1E90 A;  4P1B C;  1WGG A;  2JXT A;  4LJO B;  4E74 A;  4G0N B;  3W2D A;  2MX2 A;  1D6E C;  4CO7 A;  2NPT A;  1GC7 A;  3ZDT A;  1HZ5 A;  3KUD B;  1YQB A;  3ALB A;  3HHM A;  4USA A;  1T3Q A;  1A70 A;  4HJG E;  2JZZ A;  3V60 A;  2KDB A;  2RDB C;  4PYU A;  3IT4 B;  4GU2 A;  3WAL A;  4C7Z A;  4M0W B;  4C7Y A;  2MQJ A;  1HTQ A;  1WJ4 A;  2V9H A;  4OZB A;  2BGF A;  4YXD B;  2O2V A;  1FRD A;  3PZ7 A;  3N1X C;  3A1Q A;  2JF5 A;  3DBL B;  3KWV A;  3EFC A;  1S1Q B;  1K8R B;  1V80 A;  4OVZ A;  4WJO A;  3H7S A;  2PW9 A;  2K1F A;  5DPR A;  1UUP A;  2FCM A;  5GMV A;  2KTR B;  1V81 A;  2Z0D B;  5MPO A;  1V6E A;  1FXA A;  4F7Z A;  1P1A A;  2EMS A;  2Q5W D;  4NJ6 A;  1JWA D;  4YSZ B;  4MGY E;  1KLU D;  1JQ4 A;  1XLO A;  2WS3 B;  1BML C;  5H8Y E;  4IM2 A;  3RT3 B;  4GOC A;  3B9J A;  4A55 A;  1FMA D;  4EUT A;  2Y3A A;  2L0F A;  3TEZ A;  2ZVN A;  4JGH B;  2AYO B;  4NJ7 A;  2MSE D;  3ZJU A;  5AUK A;  1QKZ A;  4RGT A;  1SBB B;  2WXN A;  4RM8 A;  4P1C C;  3B1L X;  4A6Q A;  1P7E A;  5G5H A;  1M4V A;  3QIJ A;  3B0A A;  1JRO A;  5KHQ A;  2IND C;  1C78 A;  2LVP A;  4L2Y A;  2JT4 B;  1YQ3 B;  2AWT A;  3AE9 B;  3TSS A;  2VZK B;  3N1Y C;  1GUA B;  2LXA A;  3K9P B;  2GI9 A;  3VTU A;  3A33 B;  4D2K A;  1XCQ L;  2PPH A;  4FAD A;  1MPE A;  3C19 A;  5H92 C;  2KKC A;  3PV1 A;  2H88 B;  3VRB B;  3VR8 B;  4BKS D;  3NRZ A;  4X57 B;  2KAN A;  1XF5 L;  3DBR B;  4J3O D;  3DVG X;  3SEB A;  1L4D B;  4WWO A;  1IGD A;  1ESF A;  1YN3 A;  5BMG A;  2KWV B;  4GDK B;  3EFU A;  2G1E A;  1V49 A;  2IGG A;  3EGR A;  4N9F 4;  2ZPY A;  3LXF A;  2BTE A;  1TBE A;  1TZO A;  1VLB A;  3WA0 A;  1J0G A;  4RF0 A;  2N9P C;  3TL5 A;  1KH0 A;  2CJN A;  3RCZ A;  1GJZ A;  2LUM A;  1M94 A;  4YL8 A;  1XD3 B;  4KVG B;  3ML8 A;  1Z2M A;  1RRB A;  1C4C A;  3ZKJ C;  2RGF A;  3NG0 A;  4AWJ A;  1ZW7 A;  3P4P B;  3RNF C;  1WXV A;  1VDV A;  4NQL B;  2M56 B;  2HTH A;  5E6J A;  1R7S A;  3B2F A;  2LVQ A;  1I4X A;  3NS8 A;  5CTR C;  2GMI C;  4KKJ A;  4AOF A;  3PSE B;  5BMH A;  5KHO A;  2IZV B;  2KT7 A;  3MJ5 A;  3N30 A;  4FLH A;  2EEL A;  1DOI A;  2M0X A;  2IO0 B;  2IO3 B;  1ACC A;  4I6P A;  2RPQ A;  3N32 A;  3ZIM A;  5I4D A;  2GBR A;  3NHE B;  5IA7 A;  2ZW1 A;  2IY1 B;  2VH1 A;  3R7Q A;  1NYR A;  2FCS A;  2WQY B;  2G3Q B;  2IO1 B;  3ZNZ B;  3EA6 A;  3RNA C;  4BFR A;  2HDE A;  3QJZ A;  2OED A;  4OVV A;  2B3A A;  2LFI A;  1FCC C;  1HE8 A;  3I57 A;  3NVW A;  2L76 A;  2ACZ B;  3P4R B;  2MEK A;  2QMT A;  2QIL A;  3VAW A;  2CHW A;  4ASW C;  4A8X C;  1I4G A;  5BO4 B;  2W54 A;  1N61 A;  4YSX B;  4MAC A;  1K51 A;  1XLP A;  1LXD A;  2NPT B;  3UIN B;  1ZUD 2;  4CHK A;  5IO9 A;  4FJY A;  5EE1 A;  2EKI A;  3PHX B;  1FNV A;  1TZ1 A;  2XN9 C;  3GE3 C;  3CMM B;  3FIL B;  3P2B A;  4GMV A;  3U7Z A;  4RGO S;  4ANU A;  3ZUN A;  1I4R A;  1BXT A;  4US9 A;  1ENF A;  3RZF A;  1WE6 A;  2K6D B;  4KIK B;  1AAR A;  4NPN A;  4LLG M;  2BVC A;  5C3J B;  1UH6 A;  3SHQ A;  5AUI A;  5IP4 D;  1OQQ A;  4AJW A;  1SEB D;  3DBR I;  2LD9 A;  1NVI D;  2BF8 B;  4MGK E;  1UNS A;  3OJ3 A;  1J7A A;  2WXL A;  1Y56 A;  2B76 B;  2PEA A;  1QF6 A;  2CJO A;  2FAZ A;  2MBE A;  1SE2 A;  4IDI A;  2Z0E B;  4WJQ A;  5J17 A;  4ANV A;  1XLQ A;  3AU4 A;  1EO6 A;  1V86 A;  3PZD A;  4TQ0 A;  3L54 A;  2N0S B;  1F52 A;  1P3Q U;  1OEY J;  2KDI A;  2RSU A;  3RNG C;  5L83 A;  1L2N A;  2SEB D;  3IAS 1;  4TMA B;  2NVU I;  3BII D;  2WDV B;  2AL3 A;  3AE3 B;  3N20 C;  3VUX A;  1RWS A;  5FKA C;  2KOX A;  3E9S A;  1FD6 A;  1U4A A;  2J0M A;  4PS7 A;  1MFW A;  1T0S C;  2UYZ B;  1WGD A;  4W9L A;  3A9J B;  2BB6 A;  1IBX B;  1JWB D;  3MP9 A;  1I7H A;  3AEC B;  4NQK E;  4HPM B;  2A5U A;  1YNT E;  2Y5C A;  3DBS A;  4CQN A;  3IT6 B;  4H2A A;  2KMM A;  5E6N A;  3QCA A;  4MDK E;  2QDF A;  5TR5 A;  1CK1 A;  3RZW C;  4ANW A;  1FFV A;  2ZNV B;  1N63 A;  4W9H A;  4K81 A;  2XEW A;  2CHX A;  2ZEQ A;  3Q69 A;  3APF A;  1VCB A;  1XLN A;  1L6U A;  1CJE A;  4EZJ A;  3AE4 B;  3HM3 A;  3VR9 B;  2OHF A;  5AZH A;  3HUI A;  2WXM A;  5GXG B;  3PRP B;  4I6N B;  2LJ5 A;  3VFK A;  4KKI A;  2G4S A;  4HDO A;  4EEW A;  4WQM A;  1JRP A;  3PT2 B;  4MSM B;  1UWM A;  4EE2 A;  1FRR A;  4BBN F;  3GE8 C;  3DBH I;  2OJW A;  1WGR A;  1LM8 B;  3BVG A;  2FCQ A;  3NZ3 A;  2OOB B;  2CU1 A;  3DDC B;  3SDL C;  2J0J A;  4WAF A;  3TUO A;  5D2M B;  1JWM D;  4DXF A;  3L0W B;  2BW2 A;  2BWE S;  1JML A;  5G5G A;  1SJE D;  3J9C A;  2KK8 A;  3R2I A;  1FPY A;  1T0R C;  2LXC A;  2MLB A;  1QOG A;  2N7E A;  3ZTC A;  3KQ4 A;  5FR3 A;  3DHG C;  3VHT C;  1UEL A;  4MJS A;  3KUZ A;  3WIM A;  2QCZ A;  4J6I A;  3U30 A;  4W9D A;  3AE8 B;  5C23 A;  2JWZ A;  2KDE B;  3H7P A;  3Q8A A;  1C4A A;  4WUR A;  2NR2 A;  1STE A;  2KAC A;  4BKT A;  4S0R A;  3P4S B;  1XT9 B;  2BYE A;  2HE7 A;  3T3N A;  1T5X D;  1HTO A;  1WGK A;  2KQ7 A;  4YTP B;  3P4Q B;  4HDQ A;  3PVL A;  2HJ8 A;  2KXJ A;  3JSV A;  3B08 A;  2G9H D;  4OZC A;  4EFO A;  1D5M C;  2KWU B;  1GNU A;  4JWS C;  2R2O A;  1PGX A;  2IGD A;  1YMH E;  2JZ3 B;  4EZK A;  3AEF B;  3QC8 B;  4JX1 C;  2OJR A;  3NS1 A;  1GB4 A;  1ZXH A;  1Q5W B;  2NCN A;  1JAL A;  4QAY A;  1EUV B;  3M95 A;  1EF5 A;  2J4X A;  3BWU D;  4KIK A;  4M8N A;  1PUT A;  3ZLZ A;  4IW0 A;  5T8I A;  1WF9 A;  3M63 B;  4PS3 A;  4RM9 A;  3ZJV A;  1IGC A;  3I5J C;  3JSV B;  4TQ1 A;  4WH4 A;  3UI3 A;  3U52 E;  2K25 A;  1L6V A;  5JXV A;  5LNK 1;  2BS3 B;  2C7N B;  1GC6 A;  3ML9 A;  4HCP B;  2WYQ A;  2RPV A;  2V4L A;  4WWP A;  2J53 A;  1IBX A;  2WXF A;  3Q3F A;  4ZHO A;  1J8C A;  1ROE A;  2E3T A;  1WX9 A;  2WDQ B;  4LTU A;  2A4Z A;  1MHH E;  4DHZ E;  1TS5 A;  4R3D A;  2N9E B;  2LVO A;  1GG3 A;  3T9L A;  1WM3 A;  5BYS A;  4P6V F;  3PGE A;  2NBU A;  4BOZ B;  4B9K A;  1ZPS A;  1WE7 A;  1R4N I;  5HHD G;  3AN1 A;  2JRH A;  3OLM D;  4LNN A;  4KGR A;  2NBV B;  4GDK A;  2ICI A;  2UWQ A;  3ZTD A;  3V62 A;  2MH7 A;  1WM2 A;  2E6X A;  2KAJ A;  3L4P A;  4NY0 A;  3ZJT A;  3RYT A;  4IG7 B;  1E5W A;  4M02 A;  3N9Y C;  1NEK B;  1WI0 A;  3PTF C;  3FC4 A;  5DPW A;  3NZS A;  5DPT A;  1FFU A;  1T0Q C;  5D7G A;  1KTK A;  1C1Y B;  4FXC A;  3Q14 C;  3PZ8 A;  2KN4 A;  1AN8 A;  3HVZ A;  4ARI A;  4P7I A;  4L1B A;  3Q3O C;  4NNJ B;  2WXI A;  1HQR D;  2JZP A;  2VRR B;  2JWU A;  4WIP A;  3ZGZ A;  5HI1 A;  1PYW D;  3WAP A;  2PVO D;  2K9X A;  3A9K B;  3UQB A;  2DWQ A;  1FEH A;  2M0A A;  4JWU C;  2KHW B;  4MEL A;  1SIJ A;  2KC2 A;  1K50 A;  1SJH D;  2JYE A;  3QX1 A;  4KGS A;  2IO2 B;  3AE1 B;  4KDL B;  1VD2 A;  4NZL B;  1KFY B;  4FUL A;  3W1S C;  2KX3 A;  4KDI C;  4IWP A;  3RPF C;  3W1Y A;  3NJT A;  2D3B A;  1TKE A;  2DZI A;  4MH0 E;  2BKR B;  3AMZ A;  1VRA B;  3TEY A;  4LK0 M;  2FUG 1;  4BVU C;  4ICV A;  1ZDV A;  2LAS A;  3LB8 C;  2J0K A;  2BKF A;  3BVZ A;  1CMX B;  2JX5 A;  4AUQ C;  1EF1 A;  2PVG C;  4UDU C;  2K8C A;  1V1O A;  1WWT A;  1WGH A;  3AE2 B;  3ZQ4 A;  4HJK A;  1WZ0 A;  2DZJ A;  2L3Z A;  4ZRP A;  2BYF A;  4TUU A;  1WMH A;  3DHH C;  1YJ1 A;  4XC2 A;  3T8M A;  3MC9 A;  2KDM A;  1FXT B;  1DYQ A;  3X23 A;  2LGS A;  1KLV A;  3QWZ B;  1WZ3 A;  2PTL A;  1TS3 A;  4FN2 A;  3MHS D;  4JPS A;  5DCN A;  3VQI A;  2MBQ A;  1E7P B;  4GGQ A;  1F0Z A;  3V3X A;  3LJ3 A;  2L00 B;  3AB5 A;  1OGW A;  4N6E B;  1P98 A;  2KJ6 A;  4AS1 A;  1RLF A;  3QK0 A;  4W9J A;  3P42 A;  3KLS X;  2BWF A;  3R2T A;  1PGB A;  3AXC A;  1DGJ A;  2LGI A;  2KTF A;  1B9R A;  3DVG Y;  1OEY A;  1WXS A;  3ZXR A;  3BYT B;  3V61 A;  2N9K A;  3PO0 A;  1F2R C;  2YVC A;  1JW9 D;  3DOW A;  1JWU D;  3R8B A;  2C9W B;  1WJN A;  1TT5 B;  3H8H A;  2J42 A;  1EM7 A;  3A9J A;  2PMV A;  3BYY B;  4L23 A;  4KV2 A;  4KGT A;  4G3X B;  2TSS A;  2KJH B;  1KF6 B;  3IAM 1;  4E3C A;  2WX0 A;  3KYC D;  4MJS B;  4ITK A;  2L32 A;  2DYB A;  2NMQ A;  2L83 A;  4YT0 B;  2V3P A;  1UF0 A;  3VUW A;  3S2A A;  1TJE A;  4RNA A;  1ZKH A;  1E7U A;  2K5P A;  2CR5 A;  3K9O B;  1PQS A;  1TKY A;  5IKC M;  2HD5 B;  4DDG D;  3V6E B;  3BIN A;  1K53 A;  4XGA B;  1H4R A;  1YX5 B;  3VVW B;  1RFA A;  2KN5 A;  4XWT A;  3ZW3 A;  3VRA B;  3QQ8 B;  2YLM A;  5D6J B;  2INN E;  1J19 A;  3MC0 B;  4HRO A;  2VH2 A;  1IPG A;  4RFB A;  4TSS A;  2MHJ A;  3N1Z C;  4YWG G;  2L0T A;  2BS4 B;  1WX7 A;  3NVZ A;  1WRD B;  1TIF A;  4NAW A;  1XO3 A;  4DHJ D;  1F1H A;  1I4P A;  3P63 A;  3QAQ A;  4MM3 A;  2GB1 A;  3URY A;  4JQW C;  2K3U A;  5D3I B;  4IM3 A;  1C3T A;  1VR9 A;  3BY4 B;  4GN1 A;  2LRW A;  3ZNI D;  3W5U B;  4EZL A;  4M8M A;  2W55 A;  1MJD A;  3VH3 B;  2KWC A;  2Z59 B;  3MTN B;  3VXW A;  1VZ8 A;  1ZE3 D;  1LQB A;  1VJK A;  1E8X A;  2CS4 A;  4C4V A;  1PFD A;  1R4N B;  2LGX A;  5BYR A;  4W9K A;  4CYE A;  4LNO A;  4IC7 B;  3KWL A;  5CX3 A;  3AH7 A;  3O13 A;  1ZP0 B;  2O6V D;  4WWM A;  2DEN B;  2D3G A;  5LXH A;  3PRZ A;  3HK0 A;  4OVU A;  1RFK A;  1PDX A;  2KLC A;  4MGI E;  1TS4 A;  1N60 A;  2UU7 A;  2J52 A;  4ACF A;  2PIA A;  2BT6 A;  5TSS A;  1OQY A;  2DAF A;  2CU3 A;  2C7M B;  4FHJ A;  4TV3 A;  3L13 A;  4HLE A;  3PRM B;  3DVN V;  4S17 A;  2LHD A;  4B0M A;  3NY5 A;  2D10 A; 
#chains in the Genus database with same CATH homology
 2MBO A;  4HVB A;  2JZ3 B;  3H7P B;  4EZK A;  4RM8 A;  4I6L B;  3QC8 B;  2Y5B B;  2L7R A;  3B1L X;  2DYO A;  3PPA A;  3V6C B;  5C1Z A;  2WDT B;  3QIJ A;  3B0A A;  4DDI D;  5KHQ A;  2KMC A;  1WH3 A;  2OJR A;  1WJ6 A;  2MP2 A;  2V3S A;  2LVP A;  2JT4 B;  3QHT A;  3NZU A;  3H9D A;  2K6Q A;  4TKN A;  2AWT A;  4KZC A;  1Q5W B;  2KLG A;  3APC A;  5E6P A;  2NCN A;  1EUV B;  3M95 A;  1EF5 A;  4KIK A;  4M8N A;  4ZDV A;  3N3K B;  1GUA B;  2LXA A;  3ZLZ A;  4NAW B;  3K9P B;  4IW0 A;  4LDT B;  4FBJ B;  1WF9 A;  3VTU A;  3A33 B;  3M63 B;  2KO3 A;  2FCN A;  4PS3 A;  4A20 A;  2PPH A;  3KVF B;  2LRU A;  3L17 A;  4GSW A;  4KSL C;  4RM9 A;  4XZ4 A;  4FAD A;  5CHF A;  3VUY A;  2KFK A;  3C0R B;  3JSV B;  4TQ1 A;  4WWN A;  1YX6 B;  2KKC A;  1V9J A;  4IUM B;  2JY6 A;  3ZRC A;  3PV1 A;  2K25 A;  1P0R A;  4HCN B;  4JL9 A;  4GDL B;  1NBF C;  2M8S A;  4KZ0 A;  4E71 A;  1X1M A;  2LGY A;  5CHV C;  1Q1O A;  2FIF A;  4BKS D;  2C7N B;  2KJR A;  1GC6 A;  3ML9 A;  2FUH B;  4HCP B;  2WYQ A;  3VDZ A;  2CKH B;  2V4L A;  2ZVO A;  4WWP A;  3VTW A;  4X57 B;  2KAN A;  1SGH A;  3Q3F A;  4W9E A;  1J8C A;  3DVG X;  3Q3J A;  2ZCB A;  4WWO A;  1WX9 A;  1QZE A;  2A4Z A;  4DHZ E;  2N9E B;  1SE9 A;  2AL6 A;  2LVO A;  2C60 A;  1GG3 A;  1KJT A;  1TTN A;  3T9L A;  1WM3 A;  3L16 A;  4IWO A;  1G6J A;  3PGE A;  2XBB C;  5L95 C;  2NBU A;  4IWQ A;  5DPS A;  1UBQ A;  4BOZ B;  2MCN B;  1E7V A;  4B9K A;  2KWV B;  1WE7 A;  1R4N I;  4GDK B;  2JRH A;  3EFU A;  3OLM D;  2KQS A;  1V49 A;  2NBV B;  3U7D A;  4GDK A;  4N9F 4;  4WQO B;  2UWQ A;  2RR9 A;  2ZPY A;  3ZTD A;  1TBE A;  3UGB B;  2XK5 B;  3V62 A;  5LXI B;  2GBM A;  4DHJ B;  1WM2 A;  3O65 B;  4NY0 A;  3QAR A;  3WA0 A;  1J0G A;  3RYT A;  2N9P C;  3TL5 A;  4ZRI A;  4IG7 B;  3ONS A;  3RCZ A;  1GJZ A;  1M94 A;  4II2 B;  1E5W A;  1XD3 B;  4YL8 A;  5J18 A;  4KVG B;  4LCD E;  1NDD A;  4JIO U;  1TGZ B;  1WI0 A;  1XQQ A;  3PTF C;  1WX8 A;  1L7Y A;  3ML8 A;  4HXD A;  4GXB A;  1Z2M A;  4PYZ A;  4ZRK A;  3WAO A;  5DPW A;  3NZS A;  5DPT A;  2REX A;  3PLV A;  5IAA C;  3RD2 A;  4ZYN A;  1RRB A;  3ZKJ C;  2RGF A;  4AWJ A;  1ZW7 A;  5D7G A;  1C1Y B;  3KUC B;  1WXV A;  1WR1 A;  3DCG A;  3IBE A;  4BBN C;  3RUI B;  4DBG A;  4NQL B;  1WGY A;  2HTH A;  2KVR A;  2MW5 A;  4P7I A;  4LDT D;  1A5R A;  3ECI A;  2LVQ A;  4NNJ B;  3NS8 A;  5CTR C;  2GMI C;  5G55 A;  4AOF A;  2VRR B;  3PSE B;  4ZRJ A;  1V5O A;  5KHO A;  2DZM A;  2IZV B;  4AP4 C;  2KNB A;  3WAP A;  3N30 A;  4K1R B;  3UF8 A;  4FLH A;  1UD7 A;  1V2Y A;  1NI2 A;  1JRU A;  2DHZ A;  3LDZ E;  2MBH A;  3JYU A;  2KFJ A;  2IO0 B;  2M0X A;  3A9K B;  2XK5 A;  2IO3 B;  3UQB A;  4I6P A;  3L10 B;  2MP2 B;  2RPQ A;  3N32 A;  4ANX A;  4PS8 A;  3ZIM A;  4W9G A;  2GBR A;  3NHE B;  2KHW B;  5IA7 A;  2CHZ A;  2W9N A;  1I35 A;  2IY1 B;  4MEL A;  1ZGU B;  3R7Q A;  2FCS A;  2WWZ A;  4EOY A;  2D11 A;  1P9D U;  2KDF B;  2KC2 A;  2G3Q B;  1SIF A;  2IO1 B;  3GOE A;  3JW0 X;  3PS6 A;  3QX1 A;  3ZNZ B;  4BFR A;  1WMH B;  3QJZ A;  1UBI A;  2IO2 B;  5CHW A;  4K7U A;  2RD0 A;  4KDL B;  1WYW B;  2KZR A;  4OVV A;  2B3A A;  1VD2 A;  3UIO B;  2G4D B;  1HE8 A;  2MBB B;  3EHV A;  4FUL A;  3TJP A;  3W1S C;  4RMA A;  2KX3 A;  5J2R A;  4KDI C;  2L76 A;  5AZF A;  2I1J A;  4IWP A;  4EKU A;  3W1Y A;  1KOT A;  3ENE A;  5JHA A;  2AEH A;  3A1Q B;  4MGZ E;  4W9F A;  2DZI A;  2C5L C;  4MH0 E;  3VAW A;  3APD A;  2BKR B;  3L08 A;  3PHW B;  2O6V A;  2CHW A;  5D94 A;  3SD5 A;  4A3P A;  2JXX A;  4ASW C;  4IM0 A;  1H8C A;  5BO4 B;  2JVC A;  4BVU C;  4ICV A;  1KM7 A;  2LAS A;  3U8Z A;  1IYF A;  3TBL D;  2BYV E;  1LXD A;  2NPT B;  2J0K A;  2BKF A;  3UIN B;  4CHK A;  1CMX B;  2L8J A;  4F1S A;  4FJY A;  4AUQ C;  1YIW A;  2JPH A;  2LUE A;  1EF1 A;  1TZ1 A;  3PHX B;  3P2B A;  4GMV A;  3CMM B;  4B6W A;  3SU8 X;  2N1W A;  2K8C A;  3KH0 A;  2M1M A;  4ANU A;  2V1Y A;  1WGH A;  3ZUN A;  2MA9 B;  4ICU A;  2EKE C;  5JH5 C;  4HJK A;  3RZF A;  5E6O A;  1WZ0 A;  5LLI A;  1WE6 A;  2K6D B;  3OJ4 B;  4KIK B;  1AAR A;  4NPN A;  3R66 C;  2N1V A;  2DZJ A;  2D2Q A;  2L3Z A;  2ZCC A;  1UH6 A;  2BYF A;  3SHQ A;  4FHK A;  4TUU A;  1WMH A;  3A4R A;  4AJW A;  1E8Z A;  3DBR I;  1YJ1 A;  2LD9 A;  2K39 A;  2KC1 A;  2BF8 B;  3KYD D;  4II3 B;  4XC2 A;  5EDS A;  3T8M A;  1WR6 E;  4MGK E;  4LJP B;  2LWP A;  3NOB A;  1OTR B;  1FXT B;  2ZJD A;  3TMP B;  3AU5 A;  2ZNV C;  3OJ3 A;  2PE9 A;  4A3O A;  3X23 A;  1KLV A;  5JZE B;  3QWZ B;  1WZ3 A;  2N4F A;  1WIA A;  4FN2 A;  2IY0 B;  5G2N A;  4DWF A;  3EEC A;  3MHS D;  5DCN A;  3WAN A;  3VQI A;  4DK5 A;  2MBQ A;  2GBN A;  4MSQ B;  1WJU A;  2PEA A;  4GGQ A;  2MWS B;  2NBW B;  3D32 A;  2DX5 B;  1Y8R C;  2L00 B;  3LJ3 A;  1OGW A;  2FAZ A;  1P98 A;  2KJ6 A;  2M17 A;  2MBE A;  2DAJ A;  4G11 A;  1RLF A;  2Z0E B;  3AI5 A;  1LFD A;  3AUL A;  3QK0 A;  4WJQ A;  4WJN A;  2KX0 A;  3M62 B;  4ANV A;  5J17 A;  1Z5S B;  3UQA A;  2QHO A;  3AU4 A;  3ZRF A;  1MG8 A;  4W9J A;  1EO6 A;  1V86 A;  2LGD A;  3PZD A;  4TQ0 A;  3L54 A;  1P3Q U;  5AEK B;  1OEY J;  2KDI A;  2BWF A;  3MJW A;  4MEM A;  2RSU A;  5AZG A;  2FID A;  2FNJ B;  3AXC A;  4JLC A;  2PJH A;  2KTF A;  3DVG Y;  2KFK B;  1OEY A;  1WXS A;  4URK A;  4G50 A;  2JUO A;  3H6N A;  2O2V B;  5L83 A;  1WXM A;  3V61 A;  1L2N A;  1IP9 A;  2YVC A;  2ZZP B;  2NVU I;  3VH4 B;  2IYD B;  4WAA A;  1F9J A;  3TIX A;  3DOW A;  2AL3 A;  3R7R A;  3IHP C;  3PRE A;  2WX1 A;  3VUX A;  1I42 A;  4KSK C;  2C9W B;  1WJN A;  4GDL A;  2KOX A;  3CST A;  1U4A A;  2J0M A;  4PS7 A;  3ZDM C;  3OAW A;  4FJZ A;  3A9J A;  2UYZ B;  4K7W A;  1WGD A;  3I3T B;  4W9L A;  2R2Q A;  4FA6 A;  4KV2 A;  3A9J B;  2DYM A;  3R3M A;  4G3X B;  4XX5 A;  2KJH B;  4WJP A;  3KW5 B;  3CSF A;  4NQK E;  4HWI B;  1E8Y A;  2A5U A;  2GOW A;  2LZ6 A;  3DPD A;  4HPM B;  3DBS A;  3M3J A;  2PE6 B;  2GBK A;  4E3C A;  2WX0 A;  3DQV A;  3DVN U;  3KYC D;  4MJS B;  4HK2 A;  3IFW B;  2DYB A;  5E6N A;  3QCA A;  4MDK E;  2O6V B;  5TR5 A;  1Q0W B;  3VUW A;  4BOS C;  1WY8 A;  3EC8 A;  3A9K A;  3RZW C;  3S2A A;  4ANW A;  4W9I A;  2ZNV B;  3GZN I;  4W9H A;  1BT0 A;  1ZKH A;  1E7U A;  2XEW A;  4K81 A;  2K8H A;  2MRP A;  3UIP B;  2CHX A;  2CR5 A;  2ZEQ A;  2LI5 A;  3K9O B;  1PQS A;  3APF A;  2C7H A;  2L05 A;  3ZNG C;  1VCB A;  2HD5 B;  4EZJ A;  4DDG D;  3V6E B;  3BIN A;  1H4R A;  1YX5 B;  3VVW B;  2NS5 A;  4BKS A;  1RFA A;  3ZNH B;  3HM3 A;  3WAM A;  3HM6 X;  4F8C B;  5AZH A;  2KN5 A;  3JVZ X;  4K7S A;  1T0Y A;  3ZW3 A;  4AJY B;  2KD0 A;  3QQ8 B;  2YLM A;  3PRP B;  4I6N B;  2LJ5 A;  5D6J B;  3RUL A;  2KMA A;  3A4S C;  3VFK A;  2JRI B;  2G4S A;  4HDO A;  4EEW A;  1J19 A;  3PT2 B;  3VTV A;  2D07 B;  4GB9 A;  1IPG A;  4MSM B;  3CF6 E;  3ZO5 B;  2K8B A;  2GBJ A;  1YD8 U;  2L0T A;  1WX7 A;  4BBN F;  1WRD B;  2BPS A;  3TCA A;  1WXA A;  3QA8 A;  3DBH I;  4B95 A;  4NAW A;  4DHJ D;  4DXA B;  3PLU A;  1WGR A;  3QAQ A;  4MM3 A;  1LM8 B;  2FCQ A;  2DZK A;  1E90 A;  1WGG A;  2CU1 A;  2OOB B;  4FJV B;  4JQW C;  4IM3 A;  4G0N B;  4LJO B;  4E74 A;  2M4N A;  1C3T A;  2MX2 A;  3DDC B;  3SDL C;  4CO7 A;  2NPT A;  1UZX B;  2J0J A;  1GC7 A;  3ZDT A;  4DHZ B;  3KUD B;  5JHB A;  3BY4 B;  5FR6 A;  1YQB A;  3W1S A;  5D2M B;  3ALB A;  4GN1 A;  2LRW A;  3ZNI D;  3HHM A;  1V5T A;  3L0W B;  3HIZ A;  2JZZ A;  3V60 A;  2KDB A;  4EZL A;  4PYU A;  4M8M A;  2BWE S;  4GU2 A;  3WAL A;  2N9X A;  2KK8 A;  4M0W B;  3VH3 B;  2KWC A;  2Z59 B;  3MTN B;  2MQJ A;  3VXW A;  1WJ4 A;  2LXC A;  2MLB A;  3IG3 A;  5HKH A;  1LQB A;  2BGF A;  2N7E A;  2I1K A;  3X0W A;  3ZTC A;  2ASQ A;  2N7D A;  2O2V A;  1E8X A;  1E8W A;  4GIV A;  2IBI B;  2CS4 A;  3VHT C;  1UEL A;  2LGX A;  3A1Q A;  2JF5 A;  1R4M I;  4MJS A;  3ZVV A;  4W9K A;  3DBL I;  3KUZ A;  4CYE A;  3WIM A;  1S1Q B;  1K8R B;  1V80 A;  4J6I A;  4WJO A;  3IVF A;  4W9D A;  3H7S A;  3U30 A;  2K1F A;  1RAX A;  2KTR A;  5C23 A;  2JWZ A;  2KDE B;  3H7P A;  4IC7 B;  5DPR A;  5CX3 A;  2ZPN A;  2FCM A;  5GMV A;  2KTR B;  1V81 A;  2Z0D B;  1V6E A;  2O6V D;  2NR2 A;  1ISN A;  4F7Z A;  2DEN B;  2J7Q B;  1P1A A;  4BKT A;  2EMS A;  2D3G A;  5LXH A;  3PRZ A;  4NJ6 A;  1XT9 B;  3HK0 A;  2BYE A;  2HE7 A;  4OVU A;  2KLC A;  4MGY E;  3H1U A;  4W9C A;  4MGI E;  4IM2 A;  4HPL B;  2KQ7 A;  1D3Z A;  3RT3 B;  4GOC A;  4EUT A;  1WFY A;  4HDQ A;  3PVL A;  1OQY A;  2DAF A;  2L0F A;  2HJ8 A;  2KXJ A;  3JSV A;  3B08 A;  2C7M B;  4BKG A;  1UGM A;  4EFO A;  2ZVN A;  4JGH B;  2G45 B;  4FHJ A;  2EMT A;  4TV3 A;  2AYO B;  4NJ7 A;  3L13 A;  2MSE D;  1S3S G;  2KWU B;  4HLE A;  1GNU A;  3PRM B;  3DVN V;  2R2O A;  3NY5 A;  2D10 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...