4DXGA

Crystal structure of staphylococcal superantigen-like protein 4 complexed with sialyl lewis x
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
194
structure length
194
Chain Sequence
EINPKFKDLRAYYTKPSLEFKNEIGIILKKWTTIRFMNVVPDYFIYKIALVGKDDKKYGEGVHRNVDVFVVLEENNYNLEKYSVGGITKSNSKKVDHKAGVRITKEDNKGTISHDVSEFKITKEQISLKELDFKLRKQLIEKNNLYGNVGSGKIVIKMKNGGKYTFELHKKLQENRMADVIDGTNIDNIEVNIK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural and functional properties of staphylococcal superantigen-like protein 4
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Sugar binding protein
molecule keywords Staphylococcal enterotoxin-like toxin
total genus 52
structure length 194
sequence length 194
ec nomenclature
pdb deposition date 2012-02-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02876 Stap_Strp_tox_C Staphylococcal/Streptococcal toxin, beta-grasp domain
A PF09199 SSL_OB Staphylococcal superantigen-like OB-fold domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.110 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 4dxgA02
3.10.20.120 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 4dxgA01
1ESFA 1SBBB 1LTTD 4K6LA 1I4RA 1KLUD 2TSSA 2XRQD 3MC0B 1EWCA 1JWMD 4RGTA 1CK1A 3BVMA 1EEID 5TSSA 1TY2A 2Z8LA 1LT4D 1HQRD 2WV6D 5D3DA 1S5DD 1F77A 2QEJC 1PRTF 1S5CD 1SE4A 1TS3A 1S5ED 1I4QA 3URYA 1HTLD 1PYWD 1JCKB 4O1NA 5ELDA 5ELBA 1BCPF 1FNWA 2NTTA 2IPKD 1PTOD 1AN8A 1PZJD 2G9HD 3O13A 1ET6A 1G8ZD 1QILA 2R61A 3TSSA 1L0YB 3BZDB 3DWPA 3R2IA 1TS2A 4RGMA 1YN4A 1FNVA 4TSSA 1JWUD 4L6TB 1PTOB 1V1OA 2AQ1B 1RDPD 1D5XC 4OHJA 1LTRD 1STEA 1BCPC 1B1ZA 2O2LD 1I4GA 1BXTA 1JWSD 4RHRA 3DWAA 2ICIA 1MD2D 1I4HA 3GP7A 1SE3A 1UNSA 2XNAC 1RF2D 1LT5D 1D6EC 1SEBD 1D5ZC 1BCPD 1LLRD 4Z9CB 1M4VA 5D3IB 1EFID 1PTOH 1I4XA 1SXTA 3DWQA 1PRTD 3BYYB 3BYTB 1EU3A 1CHPD 3V05A 1TS4A 1SJHD 4RGNA 3BVGA 3R2TA 4RFBA 1S5BD 4BWGB 2CHBD 1FGBD 1KLGD 4RHSA 3W2DA 1PZID 1JQYD 4UDUC 3R8BA 3BVZA 3EFXD 3KLSX 4DXFA 5ELEA 1V1PB 4RCOA 4NZLB 1ENFA 4RGOS 3EA6A 1CQVA 1UUPA 1LTSD 1V1PA 1LT3D 1XTCD 2XRSD 1B44D 1GOZA 1CHQD 2XN9C 5ELCA 1DYQA 1LTAD 4L63B 2AQ3B 1LTBD 1BCPB 4ZYSA 5I4DA 1TS5A 2AQ2B 5FKAC 1PTOF 2J4XA 3OWEB 1FD7D 1SE2A 1PTOC 1D5MC 2NTSA 1YN3A 4DXGA 1EU4A 1YN5A 1LO5D 1T5XD 1DJRD 1PZKD 2RDHA 5FK9C 1RD9D 3SEBA 5ELFA 1ET9A 2QILA 1KTKA 1SJED 3MFGA 1L0XB 1LTID 1HA5A 1LTGD 1PRTB 1RCVD 4C56C 1LT6D 1TY0A 2IJ0A 1AW7A 1HXYD 3CHBD 1CT1D 1I4PA 1JR0D 1EEFD 1PRTC 2RDGA 2SEBD 4RH6A 1FNUA 1XXGA 1S5FD
chains in the Genus database with same CATH superfamily
2N9XA 3MXNB 2Q8IB 4TMAB 1WTVA 5M5YB 1B9RA 5ELOA 2GMIC 3ZUNA 4KIKB 5JJIA 1YMHE 3BVMA 2HIXA 3A5UA 2K5HA 1WX8A 2A73B 2EY2A 3GTKH 2NN6G 1QT9A 2KTRB 5BN4A 1V81A 3RLOA 1JC7A 1F77A 3NELA 1ZXTA 4A3MH 2R7ZB 1SE4A 4DV4L 4XDCA 4ZRJA 5CTRC 1PYWD 2QKIC 5IGBA 3J81j 5ELBA 2IO0B 2LXCA 1BCPF 1SMYC 2N7EA 1KAWA 2WXLA 2C7MB 2I46A 2R2QA 1FVIA 1ZKOA 1R4MI 2K8CA 3HHMA 2N1WA 4YCUA 1L0YB 3R2IA 4LFAL 1N33L 4JG2A 4IURA 3K7UC 5C4JH 3AE5B 2CHZA 3NUHB 1L4DB 1QF6A 3H0GB 2Y5CA 3T56B 3EROA 3GV3A 3SHQA 1LM8B 2JA9A 3CPFA 3WDNA 3CP0A 4O42A 4OO1I 3Q3JA 4C3HH 1WY8A 4F7ZA 1JWSD 1UWVA 2UUBQ 4BXXH 4A93B 1WRIA 2BW2A 4LFCQ 2F4VL 2R2OA 1CFMA 2YTVA 3O65B 3RT3B 5LMUQ 4IFDG 1RFKA 4R8IA 4J8QA 1N33Q 2KANA 2WU5B 4BBRB 4C4VA 2C7NB 1MPEA 2W82A 3R7QA 5JJZA 4OGQC 2FCNA 2JRIB 1FO4A 3NTIA 1HZ6A 3MWYW 4OWWB 4BFRA 1CA5A 1K83B 4K7UA 5I6WA 1HNXL 4WRDA 4EZKA 2UUBL 4R4QA 1V49A 2DAJA 2KDEB 3U52E 4CJ0B 2BVCA 4BZAA 3N32A 4LWCA 1LTLA 3DXJC 3K5LA 3S16B 2KK8A 2ZEQA 4A93G 1EIFA 3GTQH 3AV8A 4LCDE 2I1KA 5DPTA 3P4SB 2Z9HA 5M9OA 4U673 3L2PA 2WYQA 3S1RH 2KAJA 1D1IA 2PQEA 4PZ8A 4LF6L 1HNZL 3HK0A 2ZW1A 2IYDB 3NHHA 2I1JA 3PCOB 2B8GA 3CC7A 1NYQA 5C0XH 1LTSD 2NS5A 2PPHA 3S2AA 4JGHB 2LGSA 4P73A 1V8CA 1JE4A 2RSUA 1U4PA 3K5MA 2NVYB 3CKIB 1TKGA 3L17A 3ZGZA 3X23A 1QOHA 3KF6B 4NXNQ 1VZ6A 1STYA 4C3IB 4F7XA 4P2CB 1ESRA 1EFWA 1FD7D 1SE2A 3ICEA 4HWIB 1QVFA 2O5JC 2GVAA 1A70A 2WU2B 2L0FA 4N8X1 3FRPB 4DUZL 4DR7Q 3EGRA 4N9F4 3S14B 4K0KQ 2M1MA 3MFYA 3N9YC 2HE7A 1XEEA 3U8ZA 3TEWA 4WJ4A 1SFOH 1HZCA 2FFKB 2H4OA 2WKCA 3EBEA 1JWBD 1A0IA 1WYDA 3FPUB 1RCVD 2KFJA 3L13A 4K3CA 2LRWA 1AW7A 3EFUA 3S9WA 1MG4A 3AU5A 1ZP0B 4A3OA 3X3NA 3N6RA 1IL8A 3VTUA 2NBUA 3ENEA 1N8RC 1F2ZA 3HZXA 3NRZA 4N9PA 1F0ZA 1XXGA 4M02A 1KXLA 1ZDXA 2Z0SA 4AQ7A 2IHFA 3UDXA 2EZVA 2DHZA 2K5PA 3ZRCA 3OIQA 1E90A 3A56A 3E9HA 3ZTDA 2MX2A 1LT4D 3CF6E 4L5RC 1DOKA 1PFBA 3I9V1 4DXAB 1PYBA 1UD7A 2HQLA 3VA5A 1LFDA 1PRTF 1N5WA 3NVWA 5KYLA 3RNGC 4IPHA 2BYTA 4C3JB 5J22A 1PXUA 3M4OB 4CGYB 1WCMG 1E6EB 1L6UA 4M0WA 4HIDA 3L4PA 3P1HA 3VDZA 2SOBA 1NJIC 2B2TC 4JI5L 3RLNA 4K7WA 2QCZA 1Y69U 2M9VA 4NPSA 2MNAA 1Y1VB 3H6NA 4W9IA 4XE0A 3SHLA 1PTOB 3Q14C 3UE1A 1XQQA 4EEWA 1RDPD 4ULLA 3QB3A 4YL8A 1TKWB 4X3KA 3QWZB 2EQSA 4JI3L 4DNRB 1WI0A 2I07B 2QCPX 1FJGL 4QAYA 4WWOA 4NQLB 4JOIA 3PIP3 3KF6A 3CCSA 3MXPA 1QZHA 1ICWA 4KZ0A 4W9LA 4LF9Q 4BVUC 1DGSA 1I4HA 3G4SA 2KJ6A 1OGWA 4A3IH 5IO9A 1UNSA 3AH7A 4HJKA 3GOEA 4MGKE 5CHWA 4P16A 5D94A 1Y8PB 3L08A 1Q0WB 3JYUA 3ZNGC 5EKLA 1Z47A 2KJXA 4LFBQ 1TZOA 3SDLC 1ZYRC 3DBLB 3I70A 1PTOH 2BWES 2HQEA 4DKAC 4DDGD 4TUUA 2WXPA 4XWWA 4JC0A 1OO9B 2K4KA 2LWPA 1YQ3B 4A3KB 2V4LA 4DR3Q 3LX0A 4RFBA 4KHPQ 5AZGA 2K5NA 1JB3A 1NVID 1E8YA 1JJGA 4C3JH 1VCBA 1JRUA 2AUJD 2E8GA 1YJ1A 4TRDA 1X1MA 1PH8A 3Q8DA 4EVOA 3NZ3A 2B2TA 3D6WA 1WTHA 3I4MG 3P2BA 4P6VF 2MP2B 1I3QH 4HPPA 4JI8L 3GS2A 4NZLB 4DV7Q 3GTMH 4DPGA 1ENCA 5ISRA 3QAQA 1EY7A 1XWEA 4FXKC 4IALA 2RVLA 3F2CA 1MKHA 2J42A 1WJNA 3K0XA 4W9DA 1GUNA 5ELCA 2F0GA 3S1NB 1NBFC 2DZKA 3NPPA 3V3XA 2A69D 5IYBH 5CV6A 3TDQA 2JUOA 3MC8A 5AZHA 4BBRG 3RCZA 2B39A 1G2TA 3PGEA 2J0TD 2ICEC 3I4NH 5KNBA 4G0NB 2DAFA 2WLBA 5C44H 2VW9A 4UP7A 2QSDA 3HOUB 4LJPB 2DGYA 2F0WA 1K0RA 4FDBA 4IUMB 2GB1A 1T5XD 3WCQA 2K0PA 4P1BC 2NN6I 4B3TL 3MHZA 5A35A 5BMHA 3H0GH 2OOBB 4C3IH 1VDVA 2D9UA 1MJEA 4A3FH 1EF5A 5DNFA 1EM7A 2ES2A 3PHXB 2LSSA 3UGBB 4K2LA 5EDSA 2C60A 1PGXA 3NZSA 2V1YA 3GTLH 3VUWA 3SGIA 4JPSA 1DGJA 3OLMD 4Y7NB 1L1OB 3J7YW 4JLCA 2FIDA 2ZW0A 1XMOQ 4US9A 3I56A 3A33B 1WTRA 4HJ5A 3HOUH 5IN7A 3MC0B 1O78A 2K33A 2KHIA 1H4RA 1JWMD 2ZZPB 2I5HA 1Z9FA 4PV1C 5AJ3L 3SD5A 2A4ZA 4JI5Q 2PMZB 4IO9A 3UDFA 5M5XH 1XPOA 2Q2TA 1TY2A 1RL2A 1QUQB 2WV6D 4MIUA 4DV2L 4B3SL 4BBNC 4LFAQ 3FKIG 2DZIA 4KY6A 4XT3B 5IGGA 3V62A 2JVCA 4IFDI 4JE3B 1P98A 3PF5A 2QHOA 2WXQA 3DWGC 5E6NA 1IZ6A 3T4AC 2DWQA 2WXFA 1DOXA 3N30A 3HOZB 2KDFB 4CYEA 3VXWA 1VS0A 1E2ZA 1KJTA 3P75A 3H3VI 3RFZB 4KKUA 2HDLA 2QMTA 4ZUIA 5FLXE 4QL5A 2LVQA 3T1HQ 4TSSA 3AU4A 3Q2AC 3ZVVA 3OOCA 4L6TB 3T1YL 2KBNA 5D14A 5D7GA 3K7AH 4K8IA 4XQJA 4Q5VA 2PYKA 3OW2A 4A3DG 1VD2A 3RD2A 2KQ7A 2Z1CA 1Q12A 1V2YA 3I90A 4CDFC 1PDXA 1F9PA 1WX9A 1LV9A 1VQOA 3PPAA 1CUKA 3QIJA 2DNCA 2QDFA 3HKSA 3S16H 4JI1L 1CKMA 1MD2D 4CJ2C 1WYGA 3QIAA 2BB6A 2NVTB 5CBAE 3ZNID 1KF6B 4KHVA 1L6VA 1EY9A 4W9EA 2RHSB 2NBWB 1DOYA 2G9DA 1EY5A 4P72A 4DK6C 2OJWA 2RA4A 2UU9Q 1FXAA 1CHPD 3T13A 4EX5A 1ILQA 3F1ZA 1L4ZB 1WFYA 1MSHA 3ECIA 4ZRIA 5I6YA 4L23A 1IPGA 5C44B 1RHPA 2DYOA 1O7LA 3Q3NC 1X3QA 4C3HB 4QUFA 1H9SB 3NP8A 1E8ZA 4B0EA 2A6EC 4XDDA 2HCIA 1PZID 1VMPA 4HCPB 1PH7A 4I6PA 2DX5B 1GD7A 1E8WA 3BVZA 2PMVA 5E6OA 2V0GA 3AE1B 3V61A 2CKZB 1JJ2A 3GDEA 1ENFA 3UQBA 4EQPA 4DAYB 3H15A 1HNWL 2RPQA 1E7UA 4PS3A 2PZWA 3WA0A 2F3VA 4XT1B 5IT9L 4FVMA 3EFCA 2KWDA 4WJOA 1JJCB 3TZUA 1B44D 1HTOA 1S40A 5C44G 2JXMB 2A74C 4BA2I 4GSWA 1GHJA 3KBXA 5H1SE 1J7BA 1PDQA 4L63B 1YJIA 5I4DA 2MCNB 2WWZA 1XO3A 2WB1G 3AECB 4JW0A 1OTRB 3GE3C 1MFWA 4AS1A 1QB5D 3N20C 4GXBA 3HOVB 2EKIA 2PO4A 2FBWB 2KQSA 4HPMB 4OX9L 3ZJUA 4P71A 4E3CA 4IM2A 2KVZA 2D5GA 4II3B 1NNXA 4K7SA 1YN5A 2NVXB 4A76A 4ZRQA 3GTLB 1RD9D 1Q1EA 1SYBA 1WJUA 2MW5A 4FBJB 5M3FB 2LJIA 1G291 4GNXC 2R93H 3PO3H 2MBOA 2JQOA 3MA2B 3Q22A 2WXJA 1DONA 1WVLA 1IL2A 4M8AA 2NVYH 3S2DH 2FHTA 1STAA 3H1UA 1I4PA 2BT6A 2B3AA 1T5EA 1WIAA 3L0OA 1Q82C 2AWTA 2ZVOA 1I50B 4EKUA 4DHJD 1NTGA 1ESFA 1SBBB 5E3FA 3VYRA 2CJOA 3ZQ4A 5IWAQ 5LL6S 3R93A 4NW2A 3VYSA 3E9SA 4FJYA 3C8YA 4AOFA 1SMXA 5IP7G 5HURA 4XYOA 3J80L 2QGQA 3LDZE 2BYFA 2LVOA 1WXVA 1H9MA 3EVQA 3W5OA 4QQBX 4AIMA 3BU2A 1IBMQ 2NVQB 1N36L 2DLBA 4A20A 3KBGA 1P16A 4A3BH 2N49A 4RNAA 5LXHA 1QOBA 4FO2A 3W3AA 3IFDA 1I4QA 4JI4L 1TWGB 1FNWA 2PTLA 4AJYB 1GUTA 2I5MX 1AN8A 4OXPA 2NUCA 2PW5A 1C4PA 3H91A 1ET6A 1G8ZD 1A2TA 1G6ZA 1K52A 3D31A 4HR7B 4J6IA 3S1MB 2JE6I 4OVUA 1EYDA 1JROA 3IT6B 1K8RB 3A1QA 3TREA 3GB1A 3I3CA 2AQ1B 3PUWA 1EQVA 2V1CC 3KJPA 5FLMH 1WTPA 1TWCH 1JE5A 3QK0A 1BR9A 4KJOA 1JWAD 2C9WB 2Q8RE 3NBHA 4JL9A 2KMAA 3L3OC 2DZMA 4K8JA 5FR6A 1UF0A 3IKJA 4DBGA 4XYCA 1QJOA 4WQOB 3NSWA 2UUAQ 1IKMA 2DYBA 3EUB2 3J80i 4POGA 1D6EC 5HKHA 4Z9CB 3RD4A 1YIJA 1EFID 2CW0C 2CR5A 3I57A 1I35A 3VRBB 2R7DA 3BYYB 2EELA 4HIKA 4G7HC 3K59A 1DCZA 3HOZH 3L10B 1JOQA 4MEMA 4DQOC 1M94A 4KY7A 1TT5B 3W5VB 3HGBA 3QC8B 4X65Q 2L32A 4XWTA 2B8FA 2CHBD 3W2DA 3HOZG 2PW7A 1WFQA 1WH3A 1XD3B 1HPCA 3CPWA 2KECA 3TP7A 2E75C 1IBLL 1CMXB 3AFQA 5ELEA 1Y8OB 1T0QC 3ML8A 2QA4A 2L00B 3NVYA 5M5WH 4RGOS 2JA5H 3EA6A 4PS7A 1V5TA 4K5WA 2D07B 4A3CG 3AMZA 5EE3A 4IFDH 4KHPL 3HOVH 5DM73 2QF7A 1PH5A 1WWTA 1STBA 4HTHA 4S3SA 3I5JC 5C4XH 3HOXH 2NPTA 3CRLC 2IL8A 1KM7A 4AP4C 2E2HB 3K0YA 2EYMA 2EYLA 3AU7A 4DFAA 3K6OA 1F9RA 1C78A 4HLEA 1KLVA 3FEWX 1JB7A 1RWSA 3I3TB 3ZO5B 3HOYG 1FXIA 1YX5B 1SFOB 3OWEB 5CHFA 2WNMA 2IGHA 1ICFB 1J8CA 5M5YH 1EU4A 4X62L 5KHOA 5M3MG 2KC1A 4I6NB 3ONSA 2LXJA 4OX9Q 1EYGA 2R92H 1IBXB 3PO2B 1V97A 4OZCA 1TWAH 1HZ5A 1LQBA 3P20A 1L0XB 1AFPA 1HA5A 1UBIA 1BF4A 4A3LH 2KN5A 1VCIA 2MJ3A 1SROA 3PV1A 2RMMA 2C35B 4KI0A 2PLPA 4XZ4A 3CRKC 5C5LA 1I5FA 1SR3A 4HIOA 1I94L 1WGKA 1Y56A 2WDQB 4RH6A 3L54A 3HOYB 3PLUA 3AEFB 2NVUI 3MEHA 3VR8B 2C5CA 2NZOA 2HJ8A 2LGXA 1ZXIA 3QX1A 4USAA 1VQGA 4OZBA 4JIOU 2JQRB 2NYZD 4I7ZC 3WWVA 1FMAD 2CKHB 1QLBB 2N9EB 4KMUC 4XC2A 1YHQA 1N9WA 5TSSA 4GN4B 2Z8LA 4R4TA 2WP9B 5CORA 3OTOQ 1JOKA 2HTHA 4FHJA 2FJ2A 3OG5A 4GDKA 2QEJC 3AULA 5J18A 4K3BA 4DV5Q 1SGHA 2FUG1 1VF5C 2RDBC 3F2BA 2WHIA 3K80C 1YIWA 2CCZA 2E5LL 2LZ6A 1V5OA 3JSVA 3RZWC 1I42A 2A5HA 5I9OA 4J1MA 2H89B 4RGMA 1II3A 4H13C 4FYDA 1E2VA 2UWQA 2WQYB 3PZDA 1VLBA 2ZTCA 2EY5A 2VL6A 4RCNA 3ULPA 3A9JB 2NPTB 4RAUC 3AEVA 1XT9B 2O2LD 5F2DA 4S17A 1I4GA 4UY8C 1FCCC 1CA6A 4RHRA 2JRHA 1GUGA 2WKDA 5BR8L 2Y5BB 2EDGA 3ZXRA 1ROEA 4R9WA 2D0OA 2XTIA 1AZQA 2NVQH 2XNAC 4ALPA 3KLSA 1V9PA 4C2MB 3HOXG 4QF4A 5C4XG 1WGHA 1SNPA 3NZUA 4LDTB 3KUCB 4YTMB 4MDKE 3TRZA 4J15A 1L1OC 3NOBA 2WFWA 3DBHI 1I4XA 5LL6X 3S14H 4GKJQ 1HFNA 1XF5L 1X32A 4MTNA 2GLSA 3WAMA 2DN8A 4JBMA 1WD1A 3IAYA 4FF4A 2Y3AA 2F03A 2PPBC 4RGNA 5FO9B 2V4DA 2ZXPA 1MGSA 3CCLA 1P1AA 3KWVA 3TUOA 3AE9B 2M4NA 4B9KA 1MJCA 2F1MA 1U9RA 4K2KA 3S15H 1Q8KA 4DV0Q 3JW0X 2Q2IA 2P5ZX 4AYBG 5D6JB 3CCEA 3BWUD 4EZJA 3Q6BA 3HOXB 5C4XB 4MSMB 2UU7A 3A9JA 3RZFA 4HVBA 5T8IA 3DEPA 1SNMA 4PQXA 2WDRB 3P42A 4WURA 4WFN3 2EE1A 2PKOA 2PJHA 3NS8A 2DY7A 2K8BA 3NVVA 4DR4Q 3CCMA 4K6DA 1G51A 1IXRA 4WWPA 5CGKA 3K57A 2KTFA 1VQAA 2KVRA 3VR9B 4RF0A 1OQQA 4A3GB 1SYGA 4HJGE 2OT2A 5FLXL 3PV0A 2IX1A 2JN4A 2IHEA 2CWAA 4BXXG 2PW9A 3IFWB 2BA0A 1SIJA 1PTOF 4DR2Q 3MHBA 2KOXA 1SYEA 2LASA 1B3QA 5DCNA 2D3GA 2L0TA 3IAS1 5C3EG 4B3TQ 2NR2A 2L7RA 4IUUA 3Q8FA 5ELNA 2N9KA 5FK9C 3CWIA 1YJJA 1FM0D 5AEKB 2QILA 2WDVB 1C7YA 4JI6L 1A3TA 1FR3A 2YTXA 3ZJTA 1PMRA 1YVCA 3U50C 1J5EQ 4LLGM 5HGQA 4YWKA 1STNA 2A1AA 2K39A 1JR0D 3TS0A 1PRTC 2SEBD 1K9MC 2C7HA 3DVNU 4A3MG 2E5LQ 3WALA 4ILWA 2JXXA 4KZCA 3HRDD 2L11A 3B6YA 1VQ6A 1H95A 3NBIA 4MNOA 4GNXA 4DV5L 2EMTA 2CH4W 4K6LA 4JI4Q 2IO2B 4YHHL 5AZFA 4US8A 1L1OA 1HZAA 2W54A 4A6QA 1UBQA 2IY0B 3JAML 3APDA 4KDLB 4IPGA 1V80A 2N3SA 2F0UA 3AE4B 2GVBA 3I4OA 2Y0SB 3QA8A 3DBRI 4BS9A 1YZ6A 1YBYA 2WB1B 2JYEA 1VZ7A 1S5ED 3F8TA 3VR2A 1V86A 3JSVB 1A2UA 1PH6A 2MH7A 5JZEB 3DM3A 4LUZA 1QNUA 2JYOA 1QVGA 1GNUA 3ABVB 2G9HD 2UU9L 4JI6Q 1ZGUB 2IBIB 4YCWA 4WJ3M 5JPNC 3NXWA 4DUYL 4LF7L 2BA1A 1CSPA 2ZJQA 3E3XA 4TQ0A 2E2JH 2M19A 2J0MA 4YIJA 4IM0A 2D62A 1N34L 3PO2G 2K6QA 1B9MA 3SE0A 5LNK1 4BBRH 1B50A 3QOLA 1D5XC 1JOOA 2B63G 5IYBG 3W5UB 3I4NG 1Q8IA 4JI2L 3QJYA 4BKGA 3RNCC 3PF4A 2BBCA 2AWOA 1PGBA 1TVXA 1JRPA 2F0PA 2KCNA 5DPSA 4JI3Q 3W1SC 1C9FA 1KOTA 3M3YB 4YSYB 3GP7A 4LJZC 1HUMA 1NI3A 1LM0A 2AMCB 4DK1A 3JAMi 1FRRA 1Z2MA 4P7IA 1BOSA 1OTCA 4DR6L 4I7AA 2RGFA 1U4AA 5EPJA 4JV5Q 4PYZA 4ME5A 3M7GA 3DWQA 3SVMA 1PH3A 3GTGH 2WX1A 1L2NA 2WAQE 1D8LA 2WAQB 4GOCA 4AQYL 1SJHD 3WOFA 1QKZA 5G55A 3LWEA 1OEYA 1S5BD 3M4QA 1TIFA 4IKGA 1EYCA 4RHSA 1FL0A 1BNZA 1T0RC 4OWXB 4HCSA 4GLSC 2F0QA 2SNSA 4JV5L 2MBEA 4XQNA 4FHKA 4RCOA 1WXMA 5E6JA 3MJWA 4OO1G 2B2YA 3S2HH 2N55A 2B2YC 5D65A 1XLPA 3RNFC 1XTCD 1D4BA 2LXKA 2XRSD 1N61A 1BMLC 1SNDA 1B3AA 1LACA 2PNHA 1J7CA 2LXAA 2RF4A 4X3SA 2JPHA 1LTBD 1EIHA 1VQDA 1NI2A 2NZHA 1QWYA 1X65A 4O2DA 1IYJB 2L1BA 1EY0A 4AQYQ 2J4XA 4OEMB 2VXWA 2YU9B 4ANXA 2ZJPA 3OAWA 2Q2HA 4OVVA 3S17B 1UWXA 4IOCA 5LHY1 4B0MA 3DM1A 1RODA 1UGMA 4CDDC 4I6LB 4HDOA 1B53A 1H9JA 5J17A 3BG3A 3E0JA 3N52A 4QUCA 4C3JG 3VDYA 1ONLA 1E0ZA 1WCMB 3HOWB 1TQOA 2CQOA 3DVNV 4HCEA 3DQVA 3KUDB 3QARA 3PO3B 2K8HA 2XRQD 4WAAA 4CQNA 4ZRPA 1WTWA 3VH4B 3BDLA 4X66Q 2UXCQ 3H9DA 1YI2A 1ML0D 1A3VA 4YY3L 1QE6A 1HZBA 2BGFA 3ND8A 4RMFA 4HROA 4B3RL 3C0RB 3RUIB 2LFNA 4DK0A 3Q6SA 5K36H 4TV3A 1GUSA 4DU9A 4H44C 1C9OA 1BUVT 1KRTA 4IC7B 4DV1Q 1QQRA 3T3OA 5IE8A 5FJ8G 2HHHQ 2PZTA 1N6ZA 1XNRL 2IGGA 1SYDA 3BDCA 3HP3A 2M56B 3ONAB 1SF0A 5IP9G 4OHJA 1R7SA 4PZ7A 2F4VQ 1WTOA 1TTNA 3KW5B 4DV1L 4B3MQ 3T1HL 2BDNA 1UE5A 3NEMA 5DM63 4DR4L 4GIVA 1SE3A 4PS8A 1XX8A 3KDFA 3AEDB 3BINA 1D1KA 3LYYA 2EOTA 1VQ4A 3GZNB 3U9SA 4NQKE 1E5WA 2AWNA 3E0EA 4LUVA 2Q5WD 1D5ZC 1LLRD 3KDFB 5CV4A 4S0RA 2VH2A 1VDZA 2Z4HA 1Q46A 3KFUA 2X6LA 4JI1Q 1TS4A 4ABNA 4DV0L 2L8JA 1SB3C 3OPOA 4NDXA 2YYZA 1L0WA 4JI8Q 5DPRA 3J80E 4C80A 1J9OA 5MPOA 2Q2UA 2A6HC 1FFUA 2KX0A 2K1FA 3A8JE 5FO8B 1GM5A 1EZ6A 4UDUC 2W3RA 2WXIA 5G5HA 4DWFA 3N1XC 2PE6B 3H7PB 5HHDG 3OYYA 2BCOA 3PUVA 3RN2A 1E24A 1F9SA 3V2TA 5JHBA 3HFZB 3AE7B 1V1PA 3I4NB 4IJHA 1PUTA 2O2VB 2L52A 1CZPA 1YITA 1BKBA 4KLKA 3FP9A 2AUKA 1Q81C 3MC9A 2O4XA 2KO3A 5EAYA 1MSGA 3QQ8B 2GN5A 1K0SA 4ZYSA 2QEXA 2HUGA 2EXZA 3LB8C 1X3EA 2AQ2B 4H7BA 4KKTA 4APVA 2KJRA 3JVZX 3UINB 1EO6A 1JQ4A 4A3KH 1XTDA 1PTOC 4MH8A 1EY4A 1YJWA 3ZNZB 1KAAA 3D4WA 4GKKQ 2ZCBA 3RNBC 3RLFA 2RDHA 4RKBA 2J0JA 3D6CA 5I2YA 1W3SA 1KRSA 4ZAIA 4ACFA 2JF5A 2MJEA 4KX6B 2ZXOA 1TZ1A 3G71A 5A2QE 5IIFA 2PVGC 3FKYA 4LNQA 1FYCA 4JVZA 3MTSA 3OTOL 4IW0A 1NMFA 4ANUA 2F4IA 3OWFA 1IGDA 4ZDVA 1J6QA 4A3GG 1TWAB 4J3OD 1GUOA 2X6GA 5IP7H 3T9LA 4RGTA 1WMHA 1TXYA 2N9LA 3TMPB 1CZWA 5JEAJ 5IWAL 5T1GA 5NUCA 1GC7A 2V3SA 4UP8A 5HFYA 1X6OA 3SK8A 4OIJA 3U9OA 1MI2A 3PREA 2YEPF 4DR6Q 3I4LA 2MQHA 1HTLD 3D4DA 1DM0B 2CS4A 4GDLA 2F3WA 5I2XA 1PTOD 2W3SA 1O7ZA 2L0CA 5KRUA 4YHHQ 4A3PA 1KNAA 3H7PA 1C4QA 4ZQ3A 4EGVA 4CKCA 2JZPA 4TQUS 3RZOH 3BK2A 4JI2Q 1PFDA 3V96A 2D10A 3QG1A 2WXOA 3CC4A 1C48A 2KWUB 4QIWE 4IJLA 1TKEA 4MACA 2BDOA 4DNIA 1GAQB 4M8MA 4XIGS 3G6EA 2INDC 2E6XA 2K1BA 4W9GA 1V1QA 4JYAQ 2VQFQ 4NY0A 1K83H 2Y0SG 2OWOA 1U4LA 3GTKB 1V43A 1EF1A 2PQAB 4ME3A 1RF2D 5C6AA 2Z59B 4B9WA 3HM6X 2KLCA 4FF2A 5GQOA 1KHIA 1ZXHA 2GBJA 5D3IB 1IBLQ 2F0SA 4N8FA 1OQRA 2LVPA 4XDXA 3QCAA 3W1SA 5GAHC 3BYTB 4MTKA 1EU3A 2L15A 2VUMH 5D2MB 3JC66 4A3KG 4ICUA 1WE6A 3A9KB 1FJGQ 2TMPA 4KD3A 3P1MA 4LTUA 3U4EG 1F2YA 1TBEA 4ZHPA 3ERSX 5IA7A 1KLGD 1GJZA 1M90C 2B2VA 2Z0EB 3K5NA 2WIIB 4LJOB 4KDIC 1R4NI 3PT2B 1BQQT 1J19A 3NQTA 5AFWA 5E1FA 3DBHB 1TWHB 1VQKA 3HOVG 4L5TA 1X55A 1V1PB 2LI5A 2K03A 1MVKA 4LF8L 4JBJA 4W9HA 1IKLA 4ARCA 2O6VB 4QY7A 1LT3D 3GQBA 1AYFA 4YTNB 2F52A 2BWFA 4E71A 5K36G 2BOSA 3I2ZA 5KIXA 1VJKA 3EHVA 3HKZB 2L55A 4ZUJA 3IRBA 1BCPB 2K75A 4R3DA 4DR2L 3TP5A 4YSXB 2J53A 4K14A 1PV4A 1C79A 3U58A 2PI2A 1KFYB 1H9RA 4KSLC 4NNJB 2B2WC 2NTSA 1WGRA 4A3DH 1GC6A 4NXNL 1C76A 1XLOA 4F1SA 2A6HD 1A3UA 3K5OA 2JT4B 1LO5D 3R7RA 2F0LA 1CJEA 2J0KA 5BYRA 4M01A 1NDDA 4C7YA 3ZRFA 1HEZE 3CCRA 4GS3A 3CD6A 1B70B 1LTGD 5CV9A 2FAZA 4R4IA 1WJ6A 2L3ZA 3PRPB 3TL5A 1IBXA 1R4MB 1J0GA 2E2IH 2PQAA 2BE5D 3T53B 2K14A 2G45B 2LD9A 3ZNHB 1ZE3D 4FULA 2MA9B 1Q1BA 2K7VA 1VQ8A 2K3UA 3H3VC 2NN6H 2KHJA 3AQQA 3CW2C 1I4RA 3QJZA 5KEEA 2FXQA 1XMQQ 4DV4Q 3HKZE 1P8LA 3VHTC 2G1EA 1SDFA 3PIPA 1NENB 2D3CA 4IUQA 5J1ZA 3RNUA 3FKIB 3K9OB 1S5DD 4GU2A 3IT4B 3UQAA 2L5TA 4DV6L 2CWPA 3RI7C 2R6GA 3G7LA 1FEHA 3VVWB 3IXSA 4O1NA 5JEAH 3W1GA 1HR0W 3MJ5A 1TWCB 4Q0FA 2IPKD 1QNKA 3E9IA 1GVPA 2BYVE 2JSVX 2UXDQ 3TBLD 4REZA 4G50A 1R9TH 1U4MA 4BKSD 1WJ4A 3HOWG 4QJFA 3S17H 3CIRB 4O0AA 2K9XA 2AX5A 4ANWA 4BBNF 3M85A 4WJNA 3DDCB 3KUPA 3DEOA 3PLVA 3KYDD 1VQPA 2R7ZH 4LAAA 2X38A 2E2DC 4MGIE 2ZTEA 4W9FA 3A74A 2YLMA 4HXDA 1OXSC 4HPLB 5C2TB 3CMEA 2ICIA 2KVMA 2SAKA 3PRZA 4G3XB 4K1RB 2KC2A 1EY8A 2RHQB 3PO3G 4JQWC 2UXDL 3R3OA 4BBSG 1WM3A 1GXDC 3VYTA 4IG7B 2ZNVB 3A55A 1SEBD 4LMQD 2YVCA 2MHVA 4DR1Q 3KWLA 5BMIA 4ZRKA 3VRAB 5LMUL 4N9TA 5DLQE 3I4MH 1VQBA 4LFCL 2N7DA 1E8XA 3KYHC 3CSFA 3E6ZX 2IY5B 4PMWA 4NP5A 2EYHA 1NUCA 1WJJA 3J7A5 4WWNA 5IYDH 2LGYA 1N32Q 3DVGY 1JQYD 1BDOA 1Z7TA 4JWUC 1K51A 4LNNA 1I94Q 2VUMB 1CI3M 2FIFA 4YWGG 1N32L 2DENB 4PK1A 1I50H 4UHVA 2PZUA 2IO1B 2B3GA 2LY7A 4CDEC 5LMNL 5JJLA 2I38A 3QOJA 4XYQA 3KLWA 4WJWA 3FMCA 5EBDA 1JW9D 3AEGB 4LF4L 4RMAA 3M7NA 1UEBA 1MG8A 2ZJDA 1PFMA 4PT5A 3CCJA 4A4IA 2HD5B 2L76A 4DR1L 2XN9C 3AN1A 2D5DA 2CW0D 1UE7A 3PQIA 4KJNA 4C4VB 2IY1B 3Q0AA 2KA7A 4G57A 4U68A 5FKAC 2KQ3A 2VUMG 1YHBA 2B2UC 4RG1A 1D5MC 1VQ9A 4LF5L 3T3NA 3S24A 3TZDA 1G6JA 1KD1C 1AZPA 5FLXc 1G91A 2KCCA 3V60A 2E2JB 2BS4B 3AMUA 4DAMA 4PYUA 3HRZC 1VQIA 2RKSA 1V9JA 2HDMA 2LHDA 2LJ5A 3L16A 3W1YA 1H8CA 2F0IA 5LLIA 4BBSH 2D0PA 3EECA 4L5QA 4A8XC 1DXMA 3VYUA 1EEFD 1S3SG 1WZ3A 3R3MA 1FNUA 3ND9A 3VUYA 4HMJA 2L1AA 1LTTD 4IPCA 2TSSA 1KLUD 5C3EH 2N7JA 3PRMB 2ZXRA 2WXNA 3GE8C 4IZ8A 2Z6KA 4BOSC 3OJ3A 1UEAB 5HY6A 4ICVA 3X0WA 1PGAA 3BZKA 1EL0A 3HOWH 2B63B 2WXHA 2EY6A 1O7YA 1IBML 3A8KE 1K28A 3GTOB 5T1IA 2BS2B 5JH5C 3WAPA 3D3RA 2LUMA 3RYTA 2K25A 2PEAA 5H92C 3STBC 5JEAG 3JAMc 4CKEA 1K8GA 1E7PB 3KQ4A 1B4OA 1E7ZA 4H02A 2LGIA 2N1VA 2CU1A 4M0WB 3BZDB 1E0BA 4KK7A 3VR3A 1YJNA 1DZ1A 2LRUA 1V1OA 4UAIA 4V0BA 1CSQA 1I6VC 3QR8A 4Y52H 2A8VA 2DBYA 2FCSA 3LJ3A 4K5XA 3CAMA 2GBRA 4G7ZC 1RTNA 1ZUD2 4BOZB 2BKFA 1M8AA 1Q90A 3DHGC 1UELA 2A69C 2LHEA 5E4XA 3PZ8A 3VR4A 4II2B 4IOIE 4DGZA 4AYBE 3VR6A 4KN4C 4F88A 4HJ8A 4EQNA 3I8ZA 2PVOD 1XNRQ 4IUNA 3H6MA 4WJQA 4HDQA 3PVLA 3GTMB 1FCLA 5LMNQ 2INPE 4MGYE 3B08A 4DUYQ 1HTQA 2KACA 3NQIA 3BVGA 2KEEA 4LF8Q 4HJ9A 1Q5WB 3DCGA 3SFDB 4EUTA 3PUXA 2JA7G 3MHSD 3TJPA 3UI3A 1SE8A 2E2IB 1LXDA 3RZDH 2C9OA 5GADC 1VQ5A 2MP1A 3MP9A 3PZ7A 4BKTA 3X3MA 1WYWB 4KGSA 1IP9A 4P75A 1SAPA 3J81c 1AARA 4JI0Q 3HUIA 1HTPA 4JWSC 2A6ED 4F8CB 2VB2X 1FIQA 3A54A 3ZJYC 5EPKA 2MP2A 4WWMA 2KDBA 1CKOA 2B2WA 1Q86C 3C1FA 1N63A 2AEHA 4A3FB 4HEDA 2SNMA 3TP8A 4A9AA 1AE2A 4A75A 4WJPA 1D3ZA 4GOPA 2AQ3B 2LKVA 2XK5B 2A68D 2EYJA 4W9KA 2HIVA 1HR0Q 1B8AA 1V6EA 2KKCA 4XGAB 2AHOB 1KH0A 1WF9A 2D2CC 4DXGA 3CC2A 4K5VA 2GA4B 4F8MA 3A5ZB 4IWOA 1HNXQ 1PZKD 2LMCA 4ZLTF 2CH4A 3SDZA 2JWUA 3OHXC 1EIYB 1S4ZA 1HZ9A 2CVRA 2FMMA 2N88A 4XQQA 1O80A 1WGYA 2AL6A 1I7HA 2BYEA 5C4HA 2K5VA 5JVH3 2KT7A 2IJ0A 4C00A 2DNEA 4L8JA 4MJSB 1SN8A 1VZ8A 1H9SA 1XPUA 2WXKA 1HQMC 3CQZH 3M3JA 4WIPA 4OL7A 2MHJA 5HG2A 3HKZG 1D7QA 2AYOB 1G2SA 4IUPA 1X54A 2F3IA 5GAEC 1K8OA 3GO5A 1NR2A 3SK5A 2UUCQ 1CKNA 1YNND 1EY6A 3B2FA 5IYCG 2XWJB 4GLAC 1EEID 4YWMA 3STBD 4LUOA 3RNEC 1EYAA 5CV5A 4GKJL 2XK5A 3RMKC 1HQRD 2KFKA 3NENA 3M9BA 5IT9E 5BN3A 1F2RI 3AYHB 4H2AA 4N59A 4N58A 2FCQA 3PSIA 1QUQA 1HCZA 1GUAB 5ELDA 3ULJA 3CCUA 5AJ3Q 2NTTA 4HCNB 1OFFA 1BBWA 1C0AA 2JA5G 1YN4A 2DNFA 3UI2A 1FNVA 2K5DA 1WGGA 1HA6A 3P4PB 4RWSC 5CC4A 3GTJB 5IOCA 4DK5A 2QJLA 1Q10A 1Z5SB 2J52A 2DY8A 2LUEA 2M00A 4IWPA 2KWVB 4A3JH 3U7ZA 5EKKA 2K5WA 5BR8Q 3UE0A 1XNQQ 1PA6A 2H5XA 4RA8A 3ULLA 1BXTA 2MJ8A 2MO0A 4A3GH 4K81A 1UE6A 4KN7C 2OHFA 4FXCA 2RSNA 4JK1C 2JA6B 1YNTE 1WXAA 1N34Q 2GBKA 3DHQA 1N5XA 2VZKD 4A3LG 1XCQL 3L0WB 2ZM6L 4LF6Q 5G2NA 2VY3A 1IW7C 3M95A 1K3RA 4HSVA 2R92G 1IBKQ 4DR7L 4HKQA 4ODGA 2JP1A 3VTVA 1NMGA 2M17A 4OWTB 4B3ML 4L5SA 2EYPA 4IFDJ 5M3MH 2KDMA 2KWCA 2X8XX 4AWJA 3CCVA 2ASQA 2JXTA 3NG0A 5C3JB 4ZCKA 3DHIC 3FDTA 4MSQB 4OELB 2MUYA 3A7AB 5CV8A 4RKLA 5EQ0A 3RR5A 1F2MA 3FAHA 3A9KA 3PSEB 1E10A 2WINB 1L7YA 1L2FA 2LEKA 5FLMG 4BAXA 3S1QH 1A62A 4GDLB 4NXMQ 3EFXD 3T51B 1E1OA 4ZKCB 2N0SB 5L83A 5FJ8H 2CJNA 4JBWA 2OTJA 1K3BC 2INNE 2HCCA 3FC4A 3J81E 4IOAA 1O7IA 4W9JA 1YD8U 1GOZA 4A3DB 3SR6A 2VQEL 1CHQD 4JI7L 1TR5A 1VQJA 4KV6A 1S72A 1W6JA 3TCAA 2F0KA 1LYLA 4PMBA 2O6VD 1DYQA 2GRIA 4NJ6A 4A55A 1SYFA 2KD0A 2MWSB 2IO3B 2JA6H 2RR9A 4DHZE 4BY1H 1TIID 2MLBA 3Q3OC 1E7VA 4A3JG 2GI9A 2RQXA 5BMGA 5C0XI 5C3EB 5DPWA 2JX5A 3MZ5A 4HK2A 1RLFA 1TJEA 3RN9C 2J7QB 2FUHB 1PFSA 1SIFA 2A5UA 3D0FA 2C5LC 2KLGA 2MQJA 3IAM1 1P3QU 3A4SC 2QW7A 3ZDMC 1GB4A 4MM3A 4OVZA 4X3UA 1J7AA 1AEXA 2ZVNA 3NY5A 5C3WA 2BKRB 1GUWA 2HHHL 1PQSA 1NBWA 3CHBD 3RUZA 3T1YQ 4C3HG 4KV2A 2G5DA 2VQFL 4HSPA 1NE3A 2LS01 4DR5L 1X3GA 1EIGA 1SRUA 1KDAA 1S5FD 3M63B 1I6HB 1HH2P 1QZGA 1QOAA 1QG7A 1TKYA 2WGSA 2IW3A 1EWCA 2F0MA 1VR9A 5LMNW 1CM9A 1Y1WH 1KC8C 3GTGB 3TP6A 3ERQA 3UDGA 2JU6X 3RULA 4V190 2KJHB 3NS1A 4TKNA 4QCLA 2N4FA 3F2DA 2DJGC 2F0FA 3KYCD 5JXVA 2MO1A 3S2DB 2KNBA 3ALBA 4GDKB 3TBIB 2UUCL 3M3YH 2DYMA 3PMFA 1A6XA 3J81i 4A3EG 3DBRB 3BJUA 3P7JA 2XVSA 1F9JA 1QILA 2VB3X 5JHAA 3SU8X 1IYUA 1DOIA 3AE2B 1ZOYB 2NVXH 1GHKA 1C3TA 1Y1VG 2Z6BA 4TKOB 1YNXA 3R66C 4IQZA 2V3NA 1PYSB 1OXTA 4Q2JA 2ZM6Q 2EVBA 3S1RB 5EE0A 4NPNA 4ZOHC 1PLFA 1T0SC 5M3FG 3S1NH 1GKHA 2ACZB 3DWAA 5C4JB 2A68C 2MBHA 3BK1A 3VTWA 4LF7Q 1K8AC 3AI5A 3H09A 2VZAA 1QOFA 1T6BX 2MRPA 1BO0A 1YEZA 4R4CA 2Q8TA 3DVGX 3C2PA 2R93G 1M4VA 4NJCA 1SXTA 5GAGC 3PHWB 2EJGC 2WAQG 3V05A 1RIPA 5IYDG 4A3BB 5JPMC 3DUZA 4C1NI 2NVTH 1RM6C 1BUIC 2BPSA 3HVZA 3ML9A 3VR5A 3CU7A 4YCVA 1N62A 2B2VC 3H8HA 1UH6A 4CJ1B 1EZ8A 3SK6A 2O6VA 1NCVA 1C1YB 2JYTA 5KYIA 1K8MA 2N78A 4KKIA 1XYIA 2MPMA 4P1CC 4HMIA 4A90A 2RSOA 1NY4A 4WAFA 4OO1H 4KHZA 4B6WA 1Y8NB 3IVFA 3J81L 2EIFA 5G5GA 1AE3A 4DV3L 2OF1A 1SNQA 2NBVB 1LTAD 2ID0A 2WACA 1PH4A 2IT1A 3Q69A 3D32A 5BN5A 5CBEE 1SSNA 2QIEB 1V8QA 1Y1WB 1OEYJ 1F9QA 2M0AA 2Z0DB 2L4NA 5GXGB 2PNRC 3L9AX 2AKWB 3MXUA 1RYJA 4BY7G 1JALA 2B76B 2WDTB 1E22A 4FF1A 3KH0A 3KF8A 3A1QB 5E7NA 4MELA 4DF7A 1PH9A 2MJDA 3HOUG 3UIPB 3KOJA 4TVAB 3GTPB 3QHTA 1J8IA 4JBKA 3L7ZC 1RRBA 2VRRB 1ET9A 2H1EA 3KK7A 4MH0E 2F0HA 3AXCA 3NBHB 3PTFC 1HNZQ 2JA7B 4C56C 2YEPB 5BO4B 4ZHOA 3BDOA 4DHJB 4A3FG 1CT1D 4C3IG 1ZDVA 3AE3B 1VQFA 1Y1WG 3U2SC 2PE9A 4WH4A 2VQEQ 1KQSA 2JWZA 4IUTA 2L12A 4DHZB 3IG3A 4OW0A 2JK8A 4C1NK 3GTOH 4GN1A 3MXNA 1P7EA 3I63C 2SDFA 1E9MA 4KGTA 1BVSA 4HN7A 4ID6A 3ZYYX 2WS3B 4PG3A 1F2RC 2KHSA 4I65A 2GBNA 2OQ0A 3CCQA 2OTLA 3S15B 3DOWA 2KCMA 4GGQA 3FVQA 3CQZB 5C23A 5M3FH 1ASYA 3AE8B 2KHWB 1JMLA 2R61A 1NYRA 1SNCA 2CFMA 2XGTA 3M4PA 4BBSB 1TU2B 2L83A 2IX3A 3HIZA 1ZEQX 2UUAL 5M3MB 1GJXA 3UIOB 3V6EB 3ZIMA 4IN3A 1IW7D 3D8GA 5GROA 1I6HH 3PIOA 1HE8A 1GG3A 1OXUA 1YNJD 3CXCA 4A3EH 3AB5A 1XPRA 1TWFB 3H3VH 1YQBA 3I55A 3I7FA 4HEA1 5CHVC 1XNQL 1R4PB 3RPFC 3OSOA 3ZW3A 1IYFA 4WORA 1IHZA 1U5KA 2EKEC 2JJQA 2K5QA 1WTXA 2RDFA 3H0GG 1FPYA 2B29A 2FMCA 4A3IG 2E3TA 4XXEA 5FO7B 4AH6A 2F0EA 1E2WA 3TEXA 2EXDA 1L0VB 4HJ7A 1XCTL 3CF5A 4NAWB 2ALYB 4LF4Q 4W9CA 1JORA 1ZYRD 2UXBQ 2WX0A 1SNOA 1FGBD 5EGTA 2VS1A 4GLXA 1BBUA 1AH9A 2NMQA 4RM8A 3ZLZA 2E76C 3G48A 1AP0A 4AJWA 3K58A 5AUKA 1CZGA 5C0XG 1MI0A 3KLSX 1CQFA 4NKLA 5E4WC 4DXFA 3G6JB 5CMDA 1R9TB 1UGJA 3EJIA 5IODA 4ITKA 2ONQA 5LXIB 3K7AB 1EQRA 3BY4B 3ZXVA 5FOBB 3FHWA 3OW7A 1WI5A 4KD4A 4A3IB 1D2BA 2INCC 1WCMH 1K73C 1Q1OA 1TWHH 4GN3B 3DMUA 4A93H 4BY1G 3J9CA 2K50A 2JA6G 1XMQL 1YJ9A 1SSOA 1TS5A 3SFEB 4X6AH 3APCA 2V4IB 1VQHA 3C1EA 2ATWA 5G3LF 1YN3A 3CMAA 1NR4A 4DK3C 2ENBA 4E74A 4M8NA 1Y1VH 1DJRD 1C4CA 3APFA 4OZAA 4LNKA 1KTKA 1FD6A 2L9HA 4UP9A 2KMCA 2X69A 1Z6HA 1F52A 1ZPSA 4B3RQ 1LT6D 1HR0L 4B08A 2M8SA 3RNAC 2JY6A 2WXRA 4G7OC 3TMEA 1X56A 4LNFA 1Q7YC 2DJFC 5IYCH 1EWYC 3MVVA 2M2LA 2JA8B 4KTAA 4DV7L 1PFNA 2RBMA 4GZYC 1IUEA 5C1ZA 5BYSA 2F0OA 4TQ1A 3OIPA 3RN5A 3PS6A 4DV6Q 3KLRA 3HOYH 4NAWA 1K50A 4Y7NH 4X64Q 1NAPA 2XIWA 3KUZA 5D3DA 3MAQA 5KNDA 4GOPC 2LFIA 3ZTCA 2KMMA 3P63A 2G4SA 1P9DU 1JCKB 4C7ZA 4GMVA 1LABA 3J80c 2AL3A 3B0AA 4BY7B 1KABA 2OCEA 4A3CH 2XEWA 3NE5B 3B1LX 2K28A 5BYQA 3HS0C 3OJ4B 4EOYA 2H88B 3K81C 1WRDB 1TS2A 3SR1A 2K32A 2ZJRA 4UPAA 3KVFB 2KYWA 3HEJA 2IDYA 4KSKC 5CX3A 5J39A 2L05A 4ARIA 2CQAA 3I91A 1BCPC 2I0QA 1PVOA 2JZ3B 1WZ0A 4LF9L 5H8YE 3MXGA 5K5PA 5DAUA 2E2HH 1GB1A 1EOVA 3TEHB 3VA7A 4GNXB 2K6DB 5COYA 4CHKA 3K8AA 3M4OH 1BT0A 3FPPA 1BBXC 1RTOA 2Y0SE 4ZKBB 4A3MB 4DV3Q 4A3EB 3RZOB 5TR5A 2V9HA 3H7SA 2PMZE 3J7ZC 3GTPH 3AEBB 2F0TA 1CKNB 2MFIA 4DAPA 5C0XJ 4BA1I 2IZVB 4XTCS 2WXGA 2RD0A 2OEOA 1Y8RC 2FE8A 2JA7H 1E1TA 1F2LA 3VUXA 2K52A 4EQOA 1YQ4B 1KRHA 3VH3B 3GTJH 1ASZA 1YX6B 3N1ZC 1OXXK 2I2YA 3TS2A 1UZXB 4LK0M 1HJPA 1XLQA 5L37A 2MEKA 4MJSA 4N6EB 3A4RA 1NEKB 4CDCC 3FILA 2KXJA 2ZT9C 4KY5A 4ZK9B 3JAME 2CU3A 4EQ5A 5KHQA 3FILB 5JVG3 1TT2A 4LK1C 3HG9A 3J7AF 2R3ZA 3E56A 1DOMA 2B2UA 2PI2E 1JICA 4HKZE 1WM2A 4IUVA 3GV6A 5IP4D 5HI1A 1TGZB 1QCBD 4A3BG 3ZKJC 2KZRA 1C4AA 1X3PA 3UDIA 3C3LA 2OEDA 3H94A 2R93B 2K04A 2UYZB 4IWQA 4ANVA 1A5RA 4POFA 2NZ1D 3NHEB 3Q3MC 5JJKA 1DD2A 1MBYA 2JEAI 1WX7A 1WXSA 2RCNA 4FP5D 1R4NB 1RKNA 3SEBA 4LF5Q 3M4YA 4DUZQ 2HTME 1VQMA 4WQMA 4DDID 1KDCA 3A8IE 1SJED 3B2GA 4NB3A 2EJMA 2MSED 1HUNA 1PRTB 1LTID 1QZEA 2MBBB 1YNJC 5J3BA 1TY0A 3LXFA 4GKKL 4JOIC 1RFAA 4X64L 1MIUA 3DPDA 3EC8A 3OMGA 4IPDA 4URKA 3TQYA 2FNJB 4IDIA 1ILPA 2ZPYA 3PO0A 4HRSA 2BTEA 1EOTA 2QDBA 4YT0B 5IGEA 1TYGB 2GBMA 5M5WB 5C3XA 2JA5B 3S2HB 1CK1A 1HRJA 3IL8A 4HIMA 1WSPA 4B3SQ 2VNUD 4GOPB 5GMVA 1G6PA 2CHWA 2KQ4X 5IOIA 2EYFA 2NBFA 1S3OA 1U0LA 4EZLA 2K01A 2F0JA 2RCFA 4JCVE 3CSTA 4BKSA 2IGDA 4MZ9A 4B95A 2NB0A 1UE1A 3QO2A 4HAEA 1F1HA 4LNIA 1XMOL 2D3BA 4FN2A 4DR5Q 1PZJD 2F0VA 5KGUA 3O13A 1XLNA 2JSOA 4KKSA 3TSSA 3VFKA 3DWPA 3LGJA 4G11A 2JEBI 4X57B 4YTPB 3WIMA 3MEFA 3BZCA 3P4RB 5IKCM 3NVZA 2D11A 5DEHA 2IX0A 1M1KC 3EN2A 5EBCA 2R92B 4BY7H 4GB9A 3QWNA 3VQIA 1LTRD 2EJFC 2Z4IA 3AEAB 4FNFA 2OJRA 2PIAA 3BS1A 1LUZA 4PMCA 3LWUA 2E74C 1A63A 5IY0A 4QGUA 1WTQA 4E6IA 2HDEA 2ASBA 1ACCA 3AEEB 2Y5PA 4JYAL 4OONA 2O5IC 5CV7A 4CBVA 2J7ZA 2JA8G 4L2YA 3TEZA 3NJTA 5C4ZA 4HJAA 4CHTB 2KX3A 1LT5D 1XJVA 1AWDA 1IYVA 2LMCB 2KFKB 2JZZA 3WOEA 3AB9A 3Q8EA 2RPVA 3K9PB 1PRTD 5M5XB 2BE5C 4G4KA 4X3TA 3PIO3 1VQCA 4DV2Q 1WOCA 4KKJA 4NMZA 3HM3A 2YU9H 2M0XA 4DNTB 3PGZA 4BWGB 2EY1A 1X9NA 2BS3B 1UAPA 4DA2A 4H0LC 2Z6KC 1GPXA 1FRDA 4FXGC 2IWHA 4X65L 5KNCA 4AYBB 5IT9c 1WXQA 4AUQC 4KVGB 1SE9A 2N8NA 4NAMA 2R7FA 3Q23A 1FXTB 1P0RA 3VAWA 2WB1E 2QDLA 3GZNI 1MHHE 3SK4A 3T16A 1CQVA 1SMYD 4DAVA 3E5SA 2FCMA 1UUPA 5C5MA 4MT5A 1T3QA 4DAYA 2KUMA 1ZW7A 4YSZB 4MHEA 1KNEA 2A19A 1A15A 1B2TA 1R4QB 1X3FA 2D3AA 4FADA 2UXBL 4R1JA 1TWFH 3DHHC 1KDBA 5EJWA 4IM3A 5CYUA 2R7ZG 1U4RA 4ZYNA 4OIKA 4GLVB 4EFOA 3PO2H 5FR3A 1B9NA 2I5LX 3GD7A 3PUZA 5IP9H 5IGCA 3IFTA 1QVCA 1N60A 1KIXA 4QB4A 1MHXA 3AFPA 1FFVA 3T8MA 1C77A 4FJVB 2ON8A 3RZDB 1VQEA 3DLLA 2WP8J 3MFGA 3KJOA 1T0YA 2KEDA 3TIXA 1RAXA 4YXDB 2V3PA 5L95C 3AM9A 4MN3A 1ENAA 1HXYD 3U7DA 3SXHA 5IAAC 2BH8A 4QIWB 3U4VA 3TN2A 2RDGA 4ASWC 2BH2A 1ISNA 2EYOA 5EKIA 1WR6E 3D4RA 4BY1B 2DZJA 5EE9A 4CO7A 2EMSA 3Q8AA 4L1BA 3I73A 4FA6A 2F0DA 3TEYA 2W55A 1PHJA 2ZPNA 2KCTA 4ZRZA 2KN4A 3F2UA 4LNOA 4RM9A 4R4OA 3PUYA 5IGDA 1VRAB 4YY3Q 1IGCA 3W9CB 1VMCA 1S5CD 3WANA 2GOWA 1TS3A 1JMCA 3URYA 1EQQA 3OMCA 2KTRA 2W9NA 2ZTDA 5G3LD 3DBSA 4M1UB 2OXPA 2CHXA 3ER0A 3ITPA 1STHA 4P74A 1W2BA 5J2RA 4PNYA 1YHAA 4DN4M 3ZDTA 2OQKA 4X62Q 1A8VA 2KOLA 3FKIH 3C19A 4YWLA 1EUVB 4CKBA 1JWUD 4LDTD 1P7FA 1LGRA 3N1YC 3NUCA 1L5PA 4MGZE 2FINB 1SLJA 4B9XA 3IHPC 1WD0A 1STGA 1T9HA 4PZ6A 3U4ZA 4C2MH 1OXVA 1STEA 4KGRA 1B1ZA 1EWHA 5IGFA 3C46A 2QC8A 1YNNC 3CMMB 3N3KB 1ZKHA 2VZKB 2K05A 1VQ7A 1WR1A 1MHWC 2BQQA 3I4MB 1TWGH 3V6CB 2MGSA 3A7LA 2KDIA 2YTYA 3NTKA 4GN5A 4FF3A 3ETRA 3RMHA 5EE1A 1FGUA 1K53A 1Q3LA 2VH1A 3NWTA 1I3QB 1BCPD 1PH2A 5HGTA 1C8CA 4D2KA 1WE7A 1HFGA 1EWIA 4MM3B 3KF8B 4RF1A 5A2QL 4KIKA 5EPLA 3BIID 1CTMA 5JOBA 5I9PA 2LGDA 3R2TA 4JI0L 1MJDA 4R8NA 1HHVA 2REXA 3IBEA 1VF7A 3R8BA 4JX1C 2NWGA 4A3JB 4JI7Q 1VQNA 4FXDA 3NK9A 1EQTA 2O2VA 1IBKL 4DR3L 2G4DB 2D2QA 2K6AA 4NJ7A 4JPBW 3GTQB 2F0NA 1DOLA 4X66L 2UXCL 3Q8CA 1H9KA 1Y14B 1NSNS 1HNWQ 1KL9A 1YOVB 3MTNB 1JT8A 3S1QB 2HT1A 2BB5A 1EUJA 3I72A 3AE6B 5AUIA 4LFBL 3Q8BA 2MBQA 1RJTA 4NXML 5E6PA 3ZJVA 3Q24A 2NCNA 5CR3A 2HJ1A 2PCFB 2WXMA 1UWMA 2N9PC 4EE2A 2XBBC 1B7YB 1QOGA 3HVDA 4LW1A 3DWMA 3P4QB 2B63H 2BF8B 2DUDA 3UF8A 3WAOA 2K22A 1PH1A 1OQYA 1S1QB 4M00A 4XX5A 2KENA 2ZCCA 2XSCA 2ZNVC 1J5EL 2XWBB 5ELFA 3DBLI 2EPBA 1SYCA 3NTHA 3B9JA 3J7AV 2JA8H 3EIVA 1WGDA 3EQLC 2YV5A 1W6KA 4J6HA 2HD3A 3S1MH 2G3QB 4FJZA 3U30A 3M62B 4FLHA 1N36Q 3LNNA 3Q3FA 1E3PA 4K0KL 4QMGA 3W1BA 3A0JA 4F87A 1WMHB 1GO3E 1VQLA 5JAVA 3NWSA
chains in the Genus database with same CATH topology
2Q8IB 4TMAB 1WTVA 5M5YB 1B9RA 1YMHE 3BVMA 2A73B 2EY2A 2NN6G 1QT9A 5BN4A 1JC7A 1F77A 1ZXTA 2R7ZB 1SE4A 4XDCA 1PYWD 2QKIC 5IGBA 5ELBA 2WXLA 1BCPF 1SMYC 2I46A 1ZKOA 1L0YB 3R2IA 4IURA 3NUHB 3AE5B 1L4DB 1QF6A 3H0GB 2Y5CA 3T56B 3EROA 3GV3A 3WDNA 4O42A 4OO1I 1JWSD 4A93B 1WRIA 2BW2A 1CFMA 4IFDG 1RFKA 4R8IA 4J8QA 2WU5B 4BBRB 1MPEA 2W82A 5JJZA 4OGQC 1FO4A 3NTIA 1HZ6A 3MWYW 1CA5A 1K83B 5I6WA 4WRDA 3U52E 4CJ0B 3DXJC 3K5LA 3S16B 3AV8A 3P4SB 5M9OA 4U673 2KAJA 1D1IA 2PQEA 2ZW1A 3NHHA 1NYQA 2B8GA 5C0XH 1LTSD 1V8CA 1JE4A 1U4PA 3K5MA 2NVYB 3CKIB 1TKGA 3ZGZA 1QOHA 1VZ6A 1STYA 4C3IB 4F7XA 4P2CB 1ESRA 1FD7D 1SE2A 2O5JC 1A70A 2WU2B 3FRPB 3EGRA 3S14B 3MFYA 3N9YC 1XEEA 3TEWA 2H4OA 2FFKB 2WKCA 1JWBD 3FPUB 1RCVD 1AW7A 3S9WA 1ZP0B 3X3NA 3N6RA 1IL8A 3NRZA 1F2ZA 3HZXA 4N9PA 1F0ZA 1XXGA 1ZDXA 4AQ7A 2K5PA 2EZVA 3OIQA 3A56A 1LT4D 1DOKA 1PFBA 3I9V1 3VA5A 1PRTF 1N5WA 3NVWA 5KYLA 2BYTA 4C3JB 5J22A 1PXUA 3M4OB 4CGYB 1E6EB 1L6UA 4M0WA 3L4PA 3P1HA 2SOBA 2B2TC 1Y69U 2M9VA 4XE0A 1Y1VB 3SHLA 1PTOB 1RDPD 4ULLA 3QB3A 1TKWB 4X3KA 4DNRB 2I07B 2QCPX 3PIP3 3MXPA 1ICWA 1I4HA 1UNSA 3AH7A 4P16A 1Y8PB 5EKLA 1Z47A 2KJXA 1TZOA 1ZYRC 3I70A 1PTOH 2HQEA 2WXPA 4XWWA 1OO9B 1YQ3B 4A3KB 3LX0A 4RFBA 1JB3A 1NVID 2AUJD 4TRDA 4EVOA 3NZ3A 2B2TA 3D6WA 4P6VF 4NZLB 3GS2A 5ISRA 1ENCA 1EY7A 1XWEA 4FXKC 4IALA 2RVLA 2J42A 1GUNA 5ELCA 2F0GA 3S1NB 3NPPA 3V3XA 2A69D 5CV6A 3TDQA 2B39A 1G2TA 2J0TD 2ICEC 5KNBA 2WLBA 2QSDA 3HOUB 2F0WA 2GB1A 1T5XD 3WCQA 2K0PA 2NN6I 3MHZA 5A35A 5BMHA 1VDVA 2D9UA 5DNFA 1EM7A 4K2LA 1PGXA 4JPSA 1DGJA 4Y7NB 3J7YW 2ZW0A 4US9A 1WTRA 3MC0B 1O78A 2K33A 1JWMD 4PV1C 2PMZB 1TY2A 4MIUA 2WV6D 4KY6A 4XT3B 5IGGA 4IFDI 4JE3B 3DWGC 2WXQA 3T4AC 2DWQA 2WXFA 1DOXA 3HOZB 1E2ZA 3P75A 3RFZB 4KKUA 2HDLA 2QMTA 4ZUIA 5FLXE 4TSSA 3OOCA 4L6TB 5D7GA 5D14A 4K8IA 4XQJA 4Q5VA 2PYKA 2Z1CA 1Q12A 2BTEA 3I90A 1PDXA 1F9PA 1LV9A 2DNCA 1MD2D 4CJ2C 1WYGA 3QIAA 2BB6A 2NVTB 5CBAE 1KF6B 4KHVA 1L6VA 1EY9A 1DOYA 2G9DA 1EY5A 2RA4A 1FXAA 1CHPD 3T13A 1L4ZB 1ILQA 1MSHA 5I6YA 4L23A 5C44B 1RHPA 2DYOA 1O7LA 1X3QA 4C3HB 4QUFA 1H9SB 3NP8A 4B0EA 2A6EC 4XDDA 2HCIA 1PZID 1VMPA 3BVZA 2PMVA 2V0GA 3AE1B 1ENFA 4EQPA 2PZWA 2F3VA 4XT1B 5IT9L 4FVMA 2KWDA 3TZUA 1B44D 2JXMB 2A74C 4BA2I 1GHJA 3KBXA 1J7BA 1PDQA 4L63B 1YJIA 5I4DA 1XO3A 3AECB 4AS1A 1QB5D 3HOVB 2EKIA 2PO4A 2FBWB 3ZJUA 2D5GA 1YN5A 2NVXB 4ZRQA 3GTLB 1RD9D 1Q1EA 1SYBA 5M3FB 2LJIA 1G291 3MA2B 3Q22A 2WXJA 1DONA 1WVLA 4M8AA 2FHTA 1STAA 1I4PA 2BT6A 1T5EA 1I50B 3VYRA 1ESFA 1SBBB 5E3FA 2CJOA 3ZQ4A 5LL6S 3R93A 4NW2A 3VYSA 3E9SA 3C8YA 5HURA 4XYOA 3J80L 1H9MA 3EVQA 2NVQB 2DLBA 3KBGA 4RNAA 1QOBA 4FO2A 3W3AA 3IFDA 1I4QA 1TWGB 1FNWA 2PTLA 1GUTA 1AN8A 2NUCA 2PW5A 1C4PA 3H91A 1ET6A 1G8ZD 1A2TA 1G6ZA 1K52A 3D31A 4HR7B 3S1MB 2JE6I 1EYDA 1JROA 3IT6B 3GB1A 3I3CA 2AQ1B 3PUWA 1EQVA 1WTPA 1BR9A 4KJOA 1JWAD 2Q8RE 3NBHA 3L3OC 4K8JA 3IKJA 1QJOA 3NSWA 3EUB2 1IKMA 1D6EC 4Z9CB 3RD4A 1EFID 2CW0C 3I57A 3VRBB 3BYYB 2EELA 4G7HC 3K59A 1DCZA 1JOQA 4DQOC 4KY7A 3W5VB 3HGBA 2L32A 4XWTA 2B8FA 2CHBD 3W2DA 2PW7A 1HPCA 2KECA 3TP7A 2E75C 5ELEA 1Y8OB 3NVYA 4RGOS 3EA6A 4K5WA 5EE3A 3AMZA 4IFDH 5DM73 2QF7A 1WWTA 1STBA 4HTHA 4S3SA 3CRLC 2IL8A 2E2HB 3K0YA 2EYMA 4DFAA 2EYLA 3AU7A 3K6OA 1F9RA 1C78A 3FEWX 1RWSA 1FXIA 1SFOB 3OWEB 2WNMA 2IGHA 1EU4A 1IBXB 3PO2B 1V97A 4OZCA 1HZ5A 3P20A 1L0XB 1AFPA 1HA5A 2MJ3A 1BF4A 1VCIA 2RMMA 4KI0A 2PLPA 3CRKC 5C5LA 2WDQB 1WGKA 1Y56A 4RH6A 3HOYB 3AEFB 3VR8B 3MEHA 2C5CA 1ZXIA 4USAA 4OZBA 2JQRB 2NYZD 4I7ZC 1FMAD 1QLBB 4KMUC 5TSSA 2Z8LA 2WP9B 5CORA 1JOKA 2FJ2A 2QEJC 2FUG1 1VF5C 2A5HA 5I9OA 4J1MA 2H89B 4RGMA 1II3A 4H13C 4FYDA 1E2VA 2WQYB 1VLBA 2EY5A 4RCNA 4RAUC 2O2LD 5F2DA 1I4GA 1FCCC 1CA6A 4RHRA 1GUGA 2WKDA 2EDGA 1ROEA 4R9WA 1AZQA 2XNAC 3KLSA 4C2MB 4QF4A 1SNPA 4YTMB 1I4XA 5LL6X 1XF5L 1HFNA 1X32A 2DN8A 1WD1A 3IAYA 4FF4A 2Y3AA 2F03A 2PPBC 4RGNA 5FO9B 2V4DA 2ZXPA 1MGSA 3KWVA 3TUOA 3AE9B 2F1MA 1U9RA 4K2KA 3BWUD 3HOXB 5C4XB 5T8IA 3DEPA 1SNMA 4PQXA 2WDRB 3P42A 4WURA 4WFN3 2EE1A 2PKOA 2DY7A 3NVVA 4K6DA 5CGKA 3K57A 3VR9B 4RF0A 1OQQA 4A3GB 1SYGA 4HJGE 2OT2A 5FLXL 3PV0A 2IX1A 2PW9A 2BA0A 1SIJA 1PTOF 3MHBA 1SYEA 3IAS1 4IUUA 3Q8FA 2N9KA 5FK9C 3CWIA 1YJJA 1FM0D 2QILA 2WDVB 1A3TA 1FR3A 3ZJTA 1PMRA 4LLGM 1STNA 1JR0D 1PRTC 2SEBD 4ILWA 3HRDD 2L11A 3NBIA 4K6LA 4US8A 2W54A 4A6QA 3JAML 3AE4B 2F0UA 2Y0SB 4BS9A 2WB1B 2JYEA 1VZ7A 1S5ED 3VR2A 1A2UA 2MH7A 1QNUA 2JYOA 3ABVB 2G9HD 5JPNC 3NXWA 2BA1A 4TQ0A 2M19A 4YIJA 2D62A 1B9MA 3SE0A 5LNK1 1B50A 3QOLA 1D5XC 1JOOA 3W5UB 1Q8IA 3QJYA 2BBCA 2AWOA 1PGBA 1TVXA 1JRPA 2F0PA 2KCNA 1C9FA 3M3YB 4YSYB 3GP7A 4LJZC 1HUMA 1NI3A 4DK1A 1FRRA 1BOSA 5EPJA 4ME5A 3M7GA 3DWQA 3SVMA 2WAQB 1SJHD 3WOFA 1QKZA 3LWEA 1S5BD 4IKGA 1EYCA 4RHSA 1BNZA 4HCSA 4GLSC 2F0QA 2SNSA 4XQNA 4RCOA 5E6JA 4OO1G 2B2YA 2N55A 2B2YC 5D65A 1XLPA 1D4BA 1XTCD 2XRSD 1N61A 1BMLC 1SNDA 1B3AA 1LACA 1J7CA 4X3SA 1LTBD 1EIHA 1QWYA 2L1BA 1EY0A 2J4XA 2VXWA 2YU9B 3S17B 1UWXA 5LHY1 4B0MA 3DM1A 1RODA 1B53A 1H9JA 3BG3A 3E0JA 3N52A 4QUCA 4C3JG 1ONLA 1E0ZA 1WCMB 3HOWB 1TQOA 4HCEA 3PO3B 2XRQD 4CQNA 4ZRPA 1WTWA 3BDLA 1ML0D 1A3VA 1QE6A 3ND8A 4HROA 2LFNA 4DK0A 3Q6SA 5K36H 1GUSA 4DU9A 4H44C 1BUVT 1QQRA 3T3OA 2PZTA 2IGGA 1SYDA 3BDCA 3HP3A 2M56B 3ONAB 1SF0A 4OHJA 1R7SA 1WTOA 2BDNA 5DM63 1SE3A 1XX8A 3AEDB 1D1KA 3LYYA 2EOTA 3U9SA 2AWNA 2Q5WD 1D5ZC 1LLRD 5CV4A 1VDZA 2Z4HA 2X6LA 1TS4A 4ABNA 1SB3C 3OPOA 4NDXA 2YYZA 3J80E 4C80A 1J9OA 5MPOA 2A6HC 1FFUA 3A8JE 5FO8B 1EZ6A 4UDUC 2W3RA 2WXIA 5G5HA 5HHDG 2BCOA 3PUVA 1F9SA 3V2TA 3AE7B 3I4NB 1V1PA 1PUTA 2L52A 1CZPA 2AUKA 2O4XA 1MSGA 3LB8C 4ZYSA 2HUGA 2EXZA 2AQ2B 4H7BA 4KKTA 1JQ4A 1PTOC 4MH8A 1EY4A 1KAAA 3D4WA 3RLFA 2RDHA 4RKBA 3D6CA 5I2YA 4ZAIA 4KX6B 2MJEA 2ZXOA 5A2QE 5IIFA 2PVGC 1FYCA 3MTSA 2F4IA 3OWFA 1IGDA 1TWAB 4J3OD 1GUOA 2X6GA 4RGTA 2N9LA 1CZWA 5JEAJ 5T1GA 5NUCA 5HFYA 3SK8A 4OIJA 3U9OA 1MI2A 2YEPF 3I4LA 1HTLD 3D4DA 1DM0B 2F3WA 5I2XA 1PTOD 2W3SA 1O7ZA 5KRUA 2L0CA 1KNAA 1C4QA 4ZQ3A 4EGVA 4CKCA 2JZPA 4TQUS 3BK2A 1PFDA 3V96A 3QG1A 2WXOA 1C48A 1TKEA 4MACA 2BDOA 1GAQB 4XIGS 2E6XA 2K1BA 1U4LA 3GTKB 1V43A 1RF2D 5C6AA 4B9WA 4FF2A 1ZXHA 5D3IB 2F0SA 1OQRA 4XDXA 3W1SA 3BYTB 1EU3A 2TMPA 4KD3A 3P1MA 4LTUA 3U4EG 1F2YA 4ZHPA 1KLGD 2B2VA 3K5NA 2WIIB 1BQQT 3NQTA 5AFWA 5E1FA 1TWHB 1V1PB 2K03A 1MVKA 1IKLA 4ARCA 1LT3D 3GQBA 1AYFA 4YTNB 5K36G 2BOSA 5KIXA 1VJKA 3HKZB 2L55A 4ZUJA 1BCPB 4R3DA 3TP5A 4YSXB 2J53A 4K14A 1C79A 1KFYB 1H9RA 2B2WC 2NTSA 1C76A 1XLOA 2A6HD 1A3UA 3K5OA 1LO5D 2F0LA 1CJEA 5BYRA 4C7YA 1HEZE 1LTGD 5CV9A 1IBXA 2BE5D 3T53B 1ZE3D 1Q1BA 2K7VA 2K3UA 3H3VC 2NN6H 1I4RA 5KEEA 2G1EA 1SDFA 1NENB 4IUQA 5J1ZA 3FKIB 1S5DD 3IT4B 2L5TA 2R6GA 3G7LA 1FEHA 3IXSA 4O1NA 5JEAH 3MJ5A 1TWCB 4Q0FA 2IPKD 1QNKA 2JSVX 4REZA 1U4MA 3CIRB 2K9XA 2AX5A 3M85A 3KUPA 3DEOA 2X38A 4LAAA 2E2DC 5C2TB 1OXSC 2ICIA 2KVMA 2SAKA 1EY8A 3R3OA 1GXDC 3VYTA 3A55A 1SEBD 4LMQD 2MHVA 3KWLA 5BMIA 3VRAB 4N9TA 3E6ZX 4PMWA 4NP5A 2EYHA 1NUCA 1JQYD 1BDOA 1Z7TA 4JWUC 1K51A 2VUMB 1CI3M 4YWGG 2PZUA 2LY7A 2I38A 3QOJA 4XYQA 4WJWA 3FMCA 5EBDA 1JW9D 3AEGB 3M7NA 1PFMA 4PT5A 2XN9C 3AN1A 2D5DA 2CW0D 4KJNA 3Q0AA 2KA7A 4G57A 4U68A 5FKAC 2KQ3A 2B2UC 1D5MC 3T3NA 3TZDA 1AZPA 1G91A 2KCCA 2E2JB 2BS4B 3AMUA 3HRZC 2RKSA 2LHDA 2HDMA 2F0IA 4A8XC 1DXMA 3VYUA 1EEFD 1FNUA 3ND9A 4HMJA 2L1AA 1LTTD 2TSSA 1KLUD 2N7JA 2ZXRA 2WXNA 4IZ8A 1UEAB 1PGAA 1EL0A 2B63B 2WXHA 2EY6A 1O7YA 3A8KE 2BS2B 3GTOB 5T1IA 3D3RA 2LUMA 5H92C 5JEAG 1E7PB 3KQ4A 4CKEA 1B4OA 2LGIA 3BZDB 1E0BA 4KK7A 3VR3A 1DZ1A 1V1OA 4UAIA 4V0BA 1I6VC 2DBYA 4K5XA 4G7ZC 1RTNA 1ZUD2 1M8AA 1Q90A 2A69C 2LHEA 5E4XA 3PZ8A 3VR4A 4IOIE 4DGZA 3VR6A 4KN4C 4F88A 4EQNA 3I8ZA 2PVOD 4IUNA 3H6MA 3GTMB 1FCLA 2INPE 2KACA 3NQIA 3BVGA 2KEEA 3SFDB 3PUXA 3UI3A 2E2IB 2C9OA 2MP1A 3MP9A 3PZ7A 3X3MA 4KGSA 1SAPA 3HUIA 1HTPA 4JWSC 2A6ED 2VB2X 1FIQA 3A54A 5EPKA 4WWMA 2B2WA 1N63A 3C1FA 4A3FB 4HEDA 2SNMA 3TP8A 4A9AA 2AQ3B 2LKVA 2A68D 2EYJA 1KH0A 2D2CC 4DXGA 4K5VA 2GA4B 4F8MA 1PZKD 2LMCA 4ZLTF 3SDZA 2JWUA 3OHXC 1S4ZA 2FMMA 2CVRA 2N88A 4XQQA 1O80A 1I7HA 5C4HA 5JVH3 2IJ0A 2DNEA 4L8JA 1VZ8A 1H9SA 2WXKA 1HQMC 4WIPA 4OL7A 5HG2A 1G2SA 4IUPA 1K8OA 3GO5A 1NR2A 3SK5A 1YNND 1EY6A 3B2FA 2XWJB 1EEID 1EYAA 5CV5A 1HQRD 5IT9E 4H2AA 4N59A 5BN3A 1F2RI 4N58A 1HCZA 5ELDA 2NTTA 1OFFA 1YN4A 3UI2A 1FNVA 2K5DA 1HA6A 3P4PB 4RWSC 5CC4A 3GTJB 5IOCA 2QJLA 1Q10A 2J52A 2DY8A 2M00A 3U7ZA 5EKKA 2K5WA 4RA8A 1BXTA 2MJ8A 4KN7C 2OHFA 4FXCA 2RSNA 4JK1C 2JA6B 1YNTE 3DHQA 1N5XA 2VZKD 1XCQL 1IW7C 4HSVA 4HKQA 4ODGA 2JP1A 2KDMA 4IFDJ 2EYPA 2JXTA 5C3JB 3FDTA 2MUYA 3A7AB 5CV8A 4RKLA 5EQ0A 3FAHA 1F2MA 1E10A 2WINB 2LEKA 4GDLB 3EFXD 3T51B 4ZKCB 2N0SB 2CJNA 4JBWA 2INNE 2HCCA 3FC4A 3J81E 1GOZA 4A3DB 3SR6A 1CHQD 1TR5A 4KV6A 1W6JA 4PMBA 2F0KA 1DYQA 2GRIA 4A55A 1SYFA 1TIID 2GI9A 2RQXA 5BMGA 5C0XI 5C3EB 2JX5A 3MZ5A 1TJEA 3IAM1 1GB4A 4OVZA 4X3UA 1J7AA 1AEXA 5C3WA 1GUWA 3CHBD 3RUZA 4C3HG 4HSPA 2LS01 1EIGA 1KDAA 1S5FD 1I6HB 1QOAA 1QG7A 1TKYA 2IW3A 1EWCA 2F0MA 1VR9A 1CM9A 3GTGB 3TP6A 3ERQA 2JU6X 4V190 3NS1A 4QCLA 2F0FA 5JXVA 3S2DB 4GDKB 3TBIB 2DYMA 3PMFA 1A6XA 3P7JA 2XVSA 1QILA 2VB3X 1IYUA 1DOIA 3AE2B 1ZOYB 1GHKA 4TKOB 4IQZA 2V3NA 1OXTA 4Q2JA 2EVBA 3S1RB 5EE0A 4ZOHC 1PLFA 2ACZB 3DWAA 5C4JB 2A68C 3BK1A 3H09A 1QOFA 1T6BX 1BO0A 2Q8TA 3C2PA 1M4VA 4NJCA 1SXTA 2EJGC 3V05A 4A3BB 5JPMC 3DUZA 4C1NI 1RM6C 1BUIC 3HVZA 3VR5A 3CU7A 1N62A 2B2VC 3H8HA 4CJ1B 1EZ8A 3SK6A 1NCVA 2JYTA 5KYIA 1K8MA 4KKIA 1XYIA 2MPMA 4HMIA 4A90A 2RSOA 4WAFA 4OO1H 4KHZA 1Y8NB 3J81L 5G5GA 2OF1A 1SNQA 1LTAD 2ID0A 2WACA 2IT1A 3Q69A 5BN5A 5CBEE 1SSNA 2QIEB 1V8QA 1Y1WB 1F9QA 2M0AA 2L4NA 5GXGB 2PNRC 3L9AX 3MXUA 1RYJA 2B76B 1JALA 4FF1A 3KF8A 4DF7A 2MJDA 3GTPB 1J8IA 3L7ZC 1ET9A 2H1EA 3KK7A 2F0HA 2YEPB 2JA7B 4C56C 4ZHOA 3BDOA 1CT1D 4C3IG 1ZDVA 3AE3B 3U2SC 4WH4A 4IUTA 2L12A 4OW0A 4C1NK 3MXNA 1P7EA 2SDFA 1E9MA 4KGTA 4HN7A 4ID6A 3ZYYX 2WS3B 1F2RC 2KHSA 4I65A 3S15B 3FVQA 3CQZB 3AE8B 1JMLA 2R61A 1NYRA 1SNCA 4BBSB 1TU2B 2L83A 2IX3A 1ZEQX 5M3MB 1GJXA 4IN3A 1IW7D 3D8GA 1OXUA 1YNJD 3AB5A 1TWFB 4HEA1 1R4PB 3RPFC 3OSOA 4WORA 1IHZA 2K5QA 1WTXA 2RDFA 2FMCA 2E3TA 4XXEA 5FO7B 2F0EA 1E2WA 3TEXA 1L0VB 1XCTL 4NAWB 1JORA 1ZYRD 1SNOA 1FGBD 5EGTA 2NMQA 2E76C 1AP0A 3K58A 5AUKA 1CZGA 5C0XG 1MI0A 3KLSX 1CQFA 4NKLA 5E4WC 4DXFA 1R9TB 3G6JB 5CMDA 1UGJA 3EJIA 5IODA 4ITKA 2ONQA 3K7AB 5FOBB 3OW7A 4A3IB 4KD4A 1D2BA 3DMUA 3J9CA 1SSOA 1TS5A 3SFEB 2V4IB 3C1EA 5G3LF 1YN3A 1NR4A 2ENBA 1DJRD 1C4CA 4OZAA 1KTKA 1FD6A 2L9HA 2X69A 1Z6HA 1ZPSA 1LT6D 4B08A 2WXRA 4G7OC 3TMEA 1EWYC 3MVVA 2M2LA 2JA8B 4KTAA 1PFNA 2RBMA 4GZYC 1IUEA 5BYSA 2F0OA 4TQ1A 3OIPA 3KLRA 1K50A 1NAPA 2XIWA 5D3DA 3MAQA 5KNDA 2LFIA 2KMMA 3P63A 1JCKB 4C7ZA 1LABA 4BY7B 1KABA 5BYQA 3NE5B 2K28A 3HS0C 2H88B 1TS2A 3SR1A 2K32A 3HEJA 2IDYA 5J39A 4ARIA 2CQAA 3I91A 1BCPC 5H8YE 3MXGA 5K5PA 5DAUA 1GB1A 3VA7A 5COYA 3FPPA 1BBXC 1RTOA 4ZKBB 4A3MB 4A3EB 3RZOB 3AEBB 2F0TA 4DAPA 5C0XJ 4BA1I 4XTCS 2WXGA 2OEOA 2FE8A 1F2LA 1YQ4B 4EQOA 1KRHA 1OXXK 2I2YA 4LK0M 1XLQA 2MEKA 4N6EB 1NEKB 3FILA 2ZT9C 3JAME 4KY5A 4ZK9B 2CU3A 3FILB 5JVG3 1TT2A 4LK1C 3HG9A 3J7AF 2R3ZA 3E56A 1DOMA 2B2UA 4HKZE 1JICA 4IUVA 3GV6A 5HI1A 1QCBD 1C4AA 1X3PA 3C3LA 2OEDA 3H94A 2R93B 2K04A 2NZ1D 1DD2A 1MBYA 2JEAI 4FP5D 1RKNA 3SEBA 3M4YA 2HTME 4WQMA 1KDCA 3A8IE 1SJED 3B2GA 2EJMA 1HUNA 1PRTB 1LTID 1YNJC 1TY0A 3LXFA 3OMGA 4IDIA 1ILPA 3PO0A 4HRSA 1EOTA 2QDBA 4YT0B 5IGEA 1TYGB 5M5WB 5C3XA 2JA5B 3S2HB 1CK1A 1HRJA 3IL8A 1WSPA 2VNUD 2KQ4X 2EYFA 2NBFA 2K01A 2F0JA 2IGDA 2NB0A 3QO2A 4HAEA 1PZJD 2F0VA 5KGUA 3O13A 1XLNA 2JSOA 4KKSA 3TSSA 3DWPA 2JEBI 4YTPB 3P4RB 3NVZA 5DEHA 2IX0A 5EBCA 2R92B 3QWNA 3VQIA 1LTRD 2EJFC 2Z4IA 3AEAB 4FNFA 2PIAA 3BS1A 4PMCA 3LWUA 2E74C 1WTQA 4E6IA 2HDEA 1ACCA 3AEEB 2Y5PA 2O5IC 3TEZA 5CV7A 4CBVA 2J7ZA 4L2YA 5C4ZA 4CHTB 1LT5D 1AWDA 1IYVA 2LMCB 3WOEA 3AB9A 3Q8EA 2RPVA 1PRTD 5M5XB 2BE5C 4G4KA 4X3TA 3PIO3 4KKJA 4NMZA 4DNTB 4BWGB 2EY1A 2BS3B 1UAPA 4DA2A 4H0LC 1GPXA 1FRDA 4FXGC 2IWHA 1WXQA 5KNCA 4AYBB 4NAMA 3Q23A 1MHHE 3SK4A 3T16A 1CQVA 1SMYD 4DAVA 3E5SA 4MT5A 1UUPA 5C5MA 1T3QA 4DAYA 2KUMA 4YSZB 4MHEA 1KNEA 1A15A 1B2TA 1R4QB 1KDBA 5EJWA 5CYUA 1U4RA 4OIKA 5FR3A 1B9NA 3GD7A 3PUZA 5IGCA 3IFTA 1N60A 4QB4A 1MHXA 1FFVA 1C77A 2ON8A 3RZDB 2WP8J 3MFGA 2KEDA 4YXDB 2V3PA 3AM9A 4MN3A 1ENAA 1HXYD 3SXHA 4QIWB 3TN2A 2RDGA 5EE9A 2EYOA 5EKIA 3D4RA 4BY1B 3Q8AA 4L1BA 3I73A 2F0DA 3TEYA 2W55A 4ZRZA 2KN4A 3F2UA 3PUYA 5IGDA 1VRAB 1IGCA 3W9CB 1VMCA 1S5CD 1TS3A 3URYA 3OMCA 5G3LD 4M1UB 2OXPA 3ITPA 1STHA 4PNYA 4DN4M 2KOLA 4CKBA 1JWUD 1P7FA 3NUCA 1L5PA 2FINB 4B9XA 1WD0A 1STGA 1OXVA 1STEA 4KGRA 1B1ZA 1EWHA 5IGFA 3C46A 1YNNC 2VZKB 2K05A 3I4MB 2MGSA 3A7LA 3NTKA 5EE1A 4FF3A 3ETRA 3RMHA 1K53A 1Q3LA 3NWTA</