4DXGA

Crystal structure of staphylococcal superantigen-like protein 4 complexed with sialyl lewis x
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
194
structure length
194
Chain Sequence
EINPKFKDLRAYYTKPSLEFKNEIGIILKKWTTIRFMNVVPDYFIYKIALVGKDDKKYGEGVHRNVDVFVVLEENNYNLEKYSVGGITKSNSKKVDHKAGVRITKEDNKGTISHDVSEFKITKEQISLKELDFKLRKQLIEKNNLYGNVGSGKIVIKMKNGGKYTFELHKKLQENRMADVIDGTNIDNIEVNIK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Staphylococcal enterotoxin-like toxin
publication title Structural and functional properties of staphylococcal superantigen-like protein 4
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Sugar binding protein
total genus 52
structure length 194
sequence length 194
ec nomenclature
pdb deposition date 2012-02-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02876 Stap_Strp_tox_C Staphylococcal/Streptococcal toxin, beta-grasp domain
A PF09199 SSL_OB Staphylococcal superantigen-like OB-fold domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.110 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 4dxgA02
3.10.20.120 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 4dxgA01
1CT1D 4RGNA 3TSSA 3GP7A 1KTKA 4RFBA 1EU4A 1PZJD 3BVZA 3OWEB 1YN3A 1LTTD 1I4RA 1HA5A 1BCPC 1LT6D 1RCVD 4UDUC 5TSSA 1JWUD 1BXTA 1JCKB 2IJ0A 1BCPD 1LTRD 1FNVA 3BYTB 5ELFA 2QILA 5I4DA 1LLRD 1PTOD 1D5MC 1RF2D 1CHQD 1EWCA 4NZLB 1YN5A 1CQVA 1PTOH 1XXGA 1JQYD 1I4GA 3BZDB 3CHBD 2ICIA 1V1PA 1KLGD 4RGOS 3R8BA 1SE4A 1ET6A 1TS2A 2WV6D 3R2IA 1PZKD 4TSSA 5D3IB 3URYA 4DXFA 4BWGB 2O2LD 1EU3A 1STEA 2CHBD 2TSSA 1AW7A 1D5ZC 1HXYD 1SE3A 1SBBB 1LT4D 3DWPA 1RD9D 1D6EC 1L0XB 1HQRD 2QEJC 1PTOC 4O1NA 3R2TA 4RGTA 2NTTA 2AQ1B 1L0YB 5ELCA 1PRTC 1LTGD 1T5XD 1PRTD 1GOZA 1SJED 3DWQA 4RHSA 1EEID 1D5XC 4C56C 3EFXD 2NTSA 5FK9C 2G9HD 1S5ED 1V1PB 4L63B 3EA6A 1LTID 1S5CD 4RCOA 3V05A 1FNUA 1TY2A 1ET9A 5ELDA 3BVMA 2RDHA 1AN8A 3MC0B 4ZYSA 1PYWD 3W2DA 1FNWA 1RDPD 1TS3A 1CK1A 1EFID 2Z8LA 1I4PA 1TY0A 1EEFD 1YN4A 1ESFA 2XRSD 1UUPA 1BCPB 1B1ZA 3SEBA 1S5DD 2R61A 1LTAD 1DYQA 3MFGA 5FKAC 4L6TB 5D3DA 1BCPF 1FD7D 1LO5D 1F77A 2SEBD 1G8ZD 2XNAC 1TS5A 1PTOF 1FGBD 1KLUD 1XTCD 2RDGA 4OHJA 1B44D 2AQ2B 3BYYB 4RGMA 4RH6A 1SXTA 1LTBD 3BVGA 4RHRA 1JWSD 1HTLD 1PZID 3DWAA 1S5BD 4DXGA 1TS4A 4Z9CB 5ELEA 1I4HA 1M4VA 1I4QA 1QILA 1SJHD 1ENFA 3O13A 1DJRD 1I4XA 1MD2D 2IPKD 2J4XA 2AQ3B 1LT3D 1LT5D 1SE2A 4K6LA 1UNSA 1JR0D 1S5FD 1PTOB 5ELBA 1LTSD 2XN9C 1SEBD 1JWMD 1CHPD 1PRTB 1V1OA 3KLSX 2XRQD 1PRTF
chains in the Genus database with same CATH superfamily
3PUXA 4I6LB 2M00A 1HQMC 5I6YA 2FMCA 3UF8A 4A3CG 4GNXC 3KF6A 5T1GA 1FNVA 4KD4A 3L17A 5BMHA 4A3OA 1DOLA 1LLRD 4GNXA 2ES2A 4IFDI 2RSUA 5M3FB 3L3OC 4PZ6A 1B9MA 3OWFA 5LXIB 2UUCL 1FXIA 1GUGA 4MN3A 1LQBA 2DZIA 1Y8RC 1NI3A 1YN5A 5EE0A 5JPMC 3QR8A 3VHTC 1F2RC 3VUXA 2KHWB 4NPSA 4FN2A 4HEA1 4Y7NB 4A3CH 2WDVB 1A3VA 1PFMA 2J0KA 1C78A 4EE2A 1WJ4A 1VQ8A 2IY5B 2F0OA 1GUTA 1V9JA 1TGZB 2B2WC 3EROA 4LF7Q 2OQKA 1IL2A 1OTRB 3ZUNA 5CV4A 4HCNB 2JA6B 2MFIA 1QOGA 2ZZPB 5D6JB 3W5UB 3TZUA 3X0WA 2K8CA 1JJCB 3IAS1 2B8FA 4OIJA 3HOZG 3T13A 3NZUA 5EAYA 4DR7Q 3R2TA 1VCBA 4YSXB 2KJ6A 3GZNI 2PEAA 1WCMH 1HCZA 4I7ZC 3NWSA 3NS8A 5C1ZA 2K0PA 1EYAA 3ERSX 4GZYC 2KHJA 4G7ZC 5IOIA 2JRHA 4DUYL 2O4XA 3S1MH 5G2NA 1Y8PB 1MSHA 1XT9B 1N33Q 4XX5A 5GQOA 1SSNA 2W3SA 2N78A 1PH2A 2IW3A 4URKA 1Z6HA 5DEHA 3T3OA 3LYYA 1EY0A 2WB1B 3E9IA 4K14A 2MW5A 3ML9A 5G5GA 5JOBA 2NUCA 1EY9A 4IPDA 3DUZA 4JI4L 1AFPA 1NVID 4JI0L 4P2CB 3DHHC 1IBKQ 1G2TA 3MEHA 2HUGA 1HZ6A 2ZEQA 3H8HA 1RODA 3T51B 4IURA 2NN6H 1P7EA 4GB9A 2JX5A 3IRBA 1K3BC 4R1JA 4C3HH 1X3QA 5IOCA 1EYCA 2WNMA 2WWZA 4R8IA 2JA7B 1ZKHA 3CPWA 2QW7A 2I07B 1KDBA 4K5XA 1TIFA 3NBIA 4QUFA 3RNBC 4WFN3 2F0TA 3BVGA 4FDBA 4RF0A 4ZUIA 2VQEL 5BN3A 1W2BA 3P63A 4CHKA 4EFOA 4J15A 4JBWA 4CJ0B 4POFA 3VUWA 3SK6A 1WTPA 4K2KA 3D31A 1JORA 3UGBB 2I5LX 1Q82C 4CQNA 1TS4A 2EYPA 3GZNB 1AE2A 2WXFA 2D62A 2KNBA 1VDZA 2HHHL 4EEWA 1UAPA 1N6ZA 1ZEQX 2JXTA 1EUVB 1YQ3B 1Z5SB 1GD7A 3HKZE 3KLSA 4H44C 2INPE 1GB1A 1N36L 4R4CA 5LMUL 1J7CA 2KEDA 4H02A 5C44B 1JR0D 2RDFA 4JIOU 4P75A 3P75A 3SK4A 3D4WA 4EUTA 5EE9A 4B9WA 1K3RA 1IBMQ 1ML0D 2NN6I 2LI5A 4MM3A 3VYTA 1UBIA 5CV6A 1JALA 4KGSA 3UIPB 2WXPA 3M63B 3S9WA 1PRTF 4A3JG 2MP1A 4GOPC 1TWAB 2HE7A 2LHEA 1CT1D 1IBLQ 3GTOH 1EWYC 2BOSA 1QT9A 2K5DA 2N7EA 4ME5A 4GOPA 1EU4A 2YU9H 4HN7A 2YYZA 2VUMB 4ZRQA 1GB4A 3LGJA 1WYGA 1JWUD 3R66C 3DBRI 4HEDA 3BYTB 4ANVA 1H9SA 2M4NA 1Q46A 4J8QA 3SE0A 3G71A 4KY6A 4JI8L 1XPOA 4HPPA 2J53A 4C4VB 3GTJB 4C7YA 3F2UA 1C0AA 2KN5A 5IE8A 3BS1A 1EY6A 5KYLA 4W9KA 3K7AB 3J7A5 4BA2I 3KWLA 2F0FA 1DOXA 2LXJA 2LRUA 4TSSA 1O7YA 1I94L 1KAWA 1G91A 5KIXA 2CKHB 3DVGX 1C7YA 4L5TA 3HOZB 3CKIB 1RLFA 2D3CA 4YTMB 4KKSA 3MHZA 3OTOL 3TIXA 3U58A 2IO2B 5HKHA 4C3JB 4JPBW 3KYDD 2IO1B 3NVYA 3OW7A 1KNEA 4HDQA 5M5WH 2FCQA 1L0VB 4JW0A 2N1VA 1UELA 1WX7A 4W9DA 1JRUA 1HQRD 2ZJRA 5IP7G 1NNXA 1E8ZA 3EIVA 1TWHH 5C0XJ 3QJZA 4WWOA 3HZXA 4IUVA 3I91A 3K5LA 1V8CA 3I9V1 4EVOA 3GV3A 1S40A 2A6EC 1K51A 2EDGA 2KHIA 1S5CD 3HOVH 2J7ZA 5IP7H 2H5XA 1UBQA 4EQOA 2ZW0A 2K52A 1Q1EA 5J17A 2PW5A 2GBRA 3K6OA 2CCZA 3BZCA 2EJMA 3MAQA 2G9DA 4XQJA 5FLMG 2F0HA 1QOFA 2BYTA 1PXUA 2B76B 3ULJA 2NVQH 3NBHA 1E7ZA 4KN4C 1Q12A 2O5IC 3QB3A 1KRHA 1J6QA 2FAZA 3K5OA 2B63B 1ILPA 1SNOA 1EYDA 3ZO5B 2JWZA 4EZKA 5C3WA 3NS1A 4XQNA 1N34Q 2JE6I 1B3AA 4PK1A 1XTCD 2ENBA 4IPHA 3AE9B 4OHJA 1SNMA 4DV4L 1VQ4A 1P98A 4IG7B 2EYHA 4XYCA 1IPGA 3AU7A 1K8AC 3L16A 5H8YE 2WXHA 5JJLA 1C9FA 2JPHA 4IN3A 3DWAA 3S1QB 1YJ1A 3Q8BA 1HJPA 3GTOB 2VB2X 4M00A 2NVTH 5LXHA 2BH8A 5ELEA 2YU9B 4HSPA 1D8LA 3FKIG 5M5YH 1TZ1A 3GTGH 4DFAA 5GMVA 4XDXA 3GTLH 1IKMA 2IY0B 1L1OB 1TTNA 2K32A 1EZ6A 4A3FG 4JCVE 4L5QA 4A3JB 3CW2C 4K6LA 3S1RH 2PQEA 3J7AV 3AE7B 4FJVB 5D7GA 4P74A 3IXSA 1S5FD 1MHHE 4P1CC 3P4QB 1FL0A 5CHWA 3Q22A 2LGXA 1G6PA 3CMMB 2PMZB 1SMYD 3E6ZX 4WRDA 3FKIH 3PO2H 3HGBA 2HT1A 2N7JA 2YEPF 3KLSX 1CI3M 1WTQA 1CKMA 2NVUI 1WXAA 3DBLI 1KDCA 2PI2E 4NW2A 3TSSA 1BMLC 4KKUA 1H9RA 4MEMA 3DVNV 4RMAA 4DHJD 5GAGC 3BVZA 5FLXL 4HCPB 5C2TB 3P20A 2ZXPA 1PFNA 3TEHB 2K28A 4KTAA 1TKGA 5C4HA 4A75A 2CS4A 3I72A 4AH6A 4J6IA 2WP8J 2PVOD 1F1HA 1CSQA 1RIPA 4RKBA 3MC9A 1ILQA 2CVRA 4GGQA 1TWHB 3RLNA 1WYDA 4A76A 3LWUA 1YOVB 1PTOH 1JOOA 5FO9B 1ZXTA 3M7GA 2RSOA 5IAAC 1KLGD 4RGOS 1SE4A 2C7MB 1VQ7A 2KACA 2D5DA 4OVVA 1IL8A 4PYUA 3E3XA 2SOBA 1PLFA 1XWEA 4ZDVA 2BS4B 2JA5G 3AE2B 5E6PA 1S4ZA 1VZ7A 1Q7YC 2NVXH 2O5JC 1P1AA 1FD6A 2N4FA 2F3VA 1TU2B 1WXMA 3BWUD 5BYRA 1QUQB 2Y3AA 2XK5B 1ZPSA 3MXGA 4OEMB 5E6JA 2MBEA 5BYQA 1KRSA 3S24A 1WXQA 2E2HB 3PO0A 5D94A 1LTGD 1FRDA 4MNOA 3ZRFA 4ID6A 4A3MG 1U4MA 3D4RA 2JP1A 2KCCA 2UUAQ 3S17H 1EEID 5CV7A 5A2QL 3WOFA 1X9NA 3T3NA 3NY5A 2EYJA 4E74A 2M0XA 2JQOA 1GG3A 2A19A 2EVBA 1EIGA 2QDBA 3AB5A 1F9QA 4ZRIA 4CKCA 3W1SC 2BE5D 1MKHA 3F2BA 4X65L 1U4AA 4IQZA 4P16A 2HD5B 3W1SA 3K0YA 1NSNS 4HKQA 4XYQA 2NVTB 1SYDA 1YNJD 1VQ9A 2BVCA 2YVCA 1F2RI 2IY1B 4NNJB 1VDVA 2JK8A 1O7IA 4AP4C 5DLQE 4IPCA 3GTLB 2KA7A 1NENB 4DDGD 2LXKA 1BNZA 1SGHA 3A54A 2FIFA 5CHFA 5AZGA 3S1RB 4X3KA 4HMIA 1Q90A 2XNAC 3RI7C 3AMZA 1HE8A 3F2DA 2LVQA 1X6OA 2UWQA 2YTVA 4DAVA 4JI0Q 2Y0SE 3IBEA 2A6HC 1I50H 2PNHA 3FKIB 5BR8L 3CCMA 3R7QA 4X6AH 2DYMA 3B2GA 5HI1A 2DZJA 3APDA 4LF6Q 4KDIC 2A5UA 4A3FB 3HUIA 1MVKA 3ONAB 1UWXA 2KDMA 3IT6B 2KK8A 1I4QA 4ZUJA 2MJ3A 1SJHD 3B6YA 1ZUD2 3HKSA 4DUZL 2ZJQA 1I4XA 3MEFA 3DVNU 4X62L 3Q6BA 2IPKD 4DV6L 2AQ3B 1WGDA 4GDLA 2D11A 2KFJA 3HVDA 4WQMA 4BBNF 3I5JC 1AP0A 3NVWA 2R2QA 2D2CC 2FUHB 5C6AA 2AL6A 1NEKB 5IWAL 4JI5L 2F0QA 5IYDG 4LF5Q 1PTOB 2EZVA 1YI2A 4LJOB 1WTOA 3VYUA 3OG5A 3GD7A 3E0JA 1U0LA 2EMTA 3VH4B 2NZHA 3TP6A 1E2WA 3DLLA 4K7UA 4GLAC 1F2YA 2AHOB 3GP7A 4I6PA 4BKSD 2LVOA 3RT3B 1YN3A 4TMAB 4OW0A 2B2YA 1R4MB 2NVXB 2KVMA 4KZCA 2E74C 1KM7A 1WTXA 3WA0A 5EGTA 3ZNID 1WFYA 4HK2A 1PTOD 1U4LA 3KDFA 1XTDA 3OW2A 2A8VA 2LASA 1F9JA 2AUKA 1UE6A 2SDFA 2QJLA 4NZLB 4NXML 2DJFC 3N30A 2XTIA 2MNAA 2HCCA 5DAUA 2JA5B 2LVPA 2B2TA 4FNFA 2WU2B 3A74A 3TP5A 2BA0A 3S17B 3PF5A 4DK0A 4DHZB 2LFNA 2LKVA 3V3XA 1C3TA 2IBIB 4H2AA 4W9FA 4JI2Q 5JVH3 1KLVA 3VRBB 2BYFA 4M01A 5K5PA 4YIJA 1UEAB 2K5QA 1JC7A 4RA8A 4GKJL 4KHZA 2KVRA 2Z0EB 1VQCA 2F0JA 3S2HH 5CYUA 1WGGA 1OTCA 4L23A 5IP9G 4A3MB 3NZ3A 2R92B 5IKCM 3LX0A 1WY8A 4LF7L 4O1NA 4WJ3M 1VCIA 3ERQA 1BUIC 4A3DB 2ZM6L 1HNXQ 3IFTA 2KXJA 1T9HA 3SHQA 3JAMc 1Q8KA 1VD2A 1LM8B 2G4DB 5C4JB 3ZDMC 4HJAA 1W6KA 2V9HA 2INDC 2MX2A 4DR1L 2MJEA 3FMCA 2KVZA 4BOSC 1GUSA 1WRDB 3DHGC 1H95A 3ZRCA 2YTYA 4LW1A 1ZDXA 2WXLA 3AEBB 1QCBD 1TKWB 1AN8A 1NUCA 4L8JA 4PQXA 3Q6SA 2WDQB 2IX1A 3UI3A 4TQ1A 1LYLA 2ACZB 3JYUA 2FFKB 4C4VA 1DGSA 2Z8LA 2XWBB 4A3KH 4II3B 4XWWA 1YJ9A 1NYRA 3PLVA 3RULA 4WJNA 1EIYB 2VL6A 1O78A 4BY1G 5IGGA 2EY2A 5IT9c 5GAEC 4JYAL 3M4PA 1BCPF 1FD7D 2HQEA 1IBKL 4B3TQ 1SF0A 2MBBB 3TEYA 3KJOA 4DU9A 2V4IB 5NUCA 3AQQA 4XDCA 4KGRA 3CCSA 2RKSA 5D65A 3U2SC 4A90A 3J80L 2E2JH 3AEDB 3KH0A 4N8X1 4O0AA 1RFKA 4BY1H 3P1HA 2K8HA 4NMZA 2BQQA 1S5BD 2JEAI 4PS7A 4GKKQ 4P71A 1L2NA 4MGKE 4N58A 4WURA 4B9KA 2E75C 5DPTA 4JOIC 4DV4Q 2MQJA 4X3SA 1J7BA 1GUOA 1M90C 1BBUA 1EO6A 2W54A 5EE1A 1SE2A 3IKJA 4JOIA 2LGYA 1GHKA 3K58A 3L9AX 2Z0DB 1WXVA 3JSVB 3NZSA 4HJ7A 4G3XB 2PZTA 3ZTCA 1NE3A 1SB3C 5M5XH 1CKNB 1SNDA 4Y52H 2EJGC 1OO9B 2R93H 5JZEB 3S1NH 1G2SA 4WJ4A 3M4OB 1WGHA 3J7ZC 3TEZA 4IUUA 1IZ6A 5JPNC 5TR5A 3J7YW 4JWUC 3K81C 2FINB 4XE0A 3KW5B 4DR2Q 1IYVA 3FC4A 1OQQA 4HWIB 3ZNZB 1VQNA 5GROA 2KN4A 2B3GA 2Z6KA 1R9TH 1V86A 2Z4IA 1MIUA 4NP5A 1WTVA 2Q8RE 2G45B 4A93G 3HM3A 5E6NA 2M19A 4JX1C 3KF8B 4CKBA 3J81i 3C8YA 3BZDB 2HDEA 1D1IA 1FO4A 2ICIA 3PVLA 2EY5A 1Q1OA 3A0JA 2C9OA 3HOXH 5IY0A 1CA6A 2N7DA 4M02A 2BKFA 2KJRA 2K1BA 2O2VA 1EY7A 1QZEA 3F2CA 4HR7B 5I9OA 2FMMA 1V97A 4EZLA 1EUJA 4W9EA 2E2IB 4A93H 3KVFB 3U7ZA 2ZCCA 1SE3A 4K7SA 1KOTA 4BXXG 1L1OA 3KBGA 4KHVA 2VH2A 2N0SB 1HA6A 4OZBA 2K6QA 4LUOA 1K8MA 1FVIA 1UWVA 5E1FA 3X3NA 2WXNA 3GDEA 3I73A 4IFDJ 3OPOA 4C1NI 2K39A 1SJED 2KCMA 3I4NG 5FO7B 1P3QU 3AE3B 5AZFA 2WXKA 2HIXA 2WAQE 3V60A 5DM73 1I3QH 1I5FA 3Q8EA 4HVBA 3J81L 4A8XC 2H89B 3HKZG 3DWMA 1E2VA 4RCOA 2OOBB 1BBWA 1GUNA 3RLFA 3NP8A 3KQ4A 2E2JB 1B8AA 4DNIA 3X23A 3Q3OC 4S17A 4MZ9A 2GVBA 4BY1B 3BDLA 4TVAB 3C3LA 4K0KQ 2AWOA 1WRIA 4OO1G 3RD4A 4KDLB 2WXQA 2RF4A 3RYTA 4R3DA 5M3FH 3U52E 1EEFD 3EVQA 4R4OA 5T1IA 2JA6G 3GTPB 3K57A 1UUPA 1C76A 3IVFA 2DAFA 1WJ6A 5AJ3Q 4G50A 1RKNA 2AUJD 3S15B 2PQAB 1WM2A 2MBHA 1HZAA 4R9WA 1WTWA 1PV4A 4RF1A 4X65Q 4Y7NH 1F77A 2BYVE 1TKEA 2RDGA 3SVMA 4ILWA 4P1BC 1ICWA 3GTKB 2KQSA 2ZVOA 2JA6H 2BE5C 4R4IA 2JYEA 3RUZA 1QUQA 3WIMA 2K05A 4LNNA 2EXZA 3P1MA 1LXDA 2WXMA 1N34L 2BWES 3MTSA 4YT0B 1LFDA 1B2TA 4TV3A 2HTME 3HHMA 3L08A 4AQYQ 4QMGA 2KTRA 3AEEB 1S72A 1NMFA 4FULA 4EQ5A 4DR4L 1SR3A 1YIJA 1F9SA 2WDRB 2VW9A 5KGUA 1ENCA 1ACCA 4QCLA 2SAKA 3OIPA 1PGAA 3QOJA 3AH7A 3CC2A 4F1SA 2HIVA 1V1OA 2IGGA 1VQ5A 2WLBA 3R7RA 4BKGA 3A1QB 4IO9A 2SNMA 3FILB 1SYBA 1FCCC 4LF4Q 4X62Q 3PT2B 2EY6A 2L4NA 1E7VA 2Z4HA 4X64Q 1I4RA 4IUQA 1QQRA 1K8GA 4HJGE 1D1KA 2ZTEA 4A93B 1QJOA 1OFFA 3UDGA 4AOFA 1LTRD 4USAA 3GOEA 1Q3LA 1K83B 4N9F4 3V96A 2R7ZB 3TRZA 3P4PB 1UE1A 2Q5WD 4KY7A 3H3VH 3RCZA 3CF5A 1LGRA 5IYBH 1RFAA 5I2YA 3DWGC 4ZRKA 1EWCA 1X1MA 2PCFB 2KDEB 3ZNGC 2JYOA 1TT2A 1VQJA 2EKEC 2L1BA 2VQFL 2E76C 3EGRA 1BKBA 4P7IA 1V1PA 4MIUA 1F2LA 4ANWA 1FJGQ 3E9HA 3CPFA 2NBFA 3U4ZA 5CBEE 1KD1C 1UE5A 2MLBA 3RNAC 1QVGA 1V80A 3BJUA 5C44G 3QARA 1LM0A 4LCDE 4DV0Q 1L6VA 3Q23A 4NXNQ 2MBQA 2NB0A 4NXMQ 5K36H 3QWZB 2BKRB 2QEXA 3I4NB 4MACA 2ZT9C 1YJNA 2Q2UA 2CFMA 3TEXA 4ZYNA 1PTOC 1C4QA 1T0RC 1PYBA 3PZ8A 3JAME 3HKZB 1PUTA 1V8QA 5H92C 2VUMG 2C5LC 5C44H 1KL9A 4IKGA 4GKJQ 3EFXD 4C1NK 4A3EB 4R4TA 2KTFA 4I7AA 4YWMA 2B39A 5EBDA 3EFCA 3CAMA 4ZKCB 3H3VI 1TWAH 5E7NA 4A3BG 3ONSA 1HTPA 4QJFA 4OX9L 2V3PA 2UUAL 2VUMH 2B2WA 1VS0A 3CXCA 2ZM6Q 4LDTB 1TWGH 4QY7A 1RDPD 1CQFA 1WMHB 1CM9A 1TS3A 1QZHA 4QAYA 2UU9L 4AQ7A 4EOYA 2L9HA 4DR1Q 1AYFA 1DOKA 5BO4B 3GTJH 2KFKB 2QIEB 4E3CA 5IT9E 1DONA 4C3JG 1ZGUB 2KLGA 2KMCA 3EJIA 4NB3A 3T4AC 4IZ8A 3K7AH 5L83A 2OTLA 2F0VA 3A8KE 1EL0A 1PVOA 3HOZH 1IUEA 1U5KA 1Y1VB 2A6HD 2F0NA 5CGKA 3PPAA 4PG3A 1UWMA 4C3JH 3BINA 3VR9B 4C3IG 2PE6B 3A9KB 4KZ0A 1VQPA 2GBKA 3KOJA 2G3QB 4LFAQ 3AEAB 2NMQA 3APFA 3PLUA 2L52A 4GN4B 4X66Q 2KDBA 3P4SB 4JYAQ 1SMXA 2V3NA 3T8MA 5DM63 5KNCA 1FXTB 2NBWB 4BVUC 2V4DA 2AKWB 2JZPA 2R3ZA 4W9LA 4LF6L 1CJEA 1ZXHA 2DLBA 3WALA 1QE6A 4K5VA 2PW9A 1UNSA 1MI2A 3Q3MC 3W9CB 3PUWA 2ID0A 4HTHA 1LTSD 2IHEA 3CU7A 4JI1Q 3EFUA 4JI7Q 4ARIA 2JF5A 2GLSA 4CHTB 3UINB 1U9RA 1PH7A 4BY7G 1KTKA 2B63G 3VVWB 4LF5L 2EYFA 3VDYA 5HURA 4UDUC 2BWFA 2VZKB 1W6JA 2K8BA 1VQBA 2I46A 3VR5A 1VF5C 2QKIC 2A74C 2EE1A 3H09A 4APVA 5E6OA 3HIZA 4V0BA 3KYCD 3RPFC 4ZHOA 1OQRA 3K9OB 1ISNA 4HJ9A 1YITA 3DEOA 5CORA 2B63H 1YJIA 2C7NB 5M3MG 4YY3Q 1OEYA 3HEJA 4ANXA 5KNDA 2DYBA 1EY4A 3I7FA 1T0SC 4LUVA 2VZKD 4M8NA 3NG0A 4IOAA 5G3LD 3U4VA 1Q0WB 2Z1CA 3GO5A 3S1QH 3A9JA 1R4NI 2TSSA 1WZ3A 5J3BA 2K14A 1T0YA 4W9IA 3T1YL 4WAFA 5EKIA 4B3RL 1TWGB 2OHFA 1B70B 4GDKB 4JI2L 1L0XB 2YTXA 1PQSA 1CZWA 4BFRA 4N8FA 5ELCA 1T3QA 4L5RC 2CR5A 3PGZA 4A3JH 2ONQA 2J0JA 1TWFB 3VR4A 5GAHC 4A3BB 1GOZA 1RYJA 3JSVA 1HZBA 5FLXc 4IWOA 4MSMB 4EX5A 1X65A 1D5XC 2NTSA 3A55A 3OOCA 4L63B 3TEWA 3EA6A 3N6RA 1HPCA 1LUZA 2KJXA 1WF9A 1HNXL 3NPPA 2J52A 2N9PC 2QSDA 3U9OA 2VRRB 1ET9A 1OGWA 4DAYB 1II3A 1KHIA 2A68D 5EPLA 3AN1A 3NENA 2F0PA 1Z2MA 3NOBA 3CCLA 2J0MA 4HIKA 5FR6A 1TIID 3Q0AA 1VJKA 2MP2B 4TRDA 1Q8IA 3VA7A 3C46A 2QCZA 1E1OA 3KF8A 5CBAE 3FP9A 3MFGA 5I9PA 2J7QB 1DOYA 4L6TB 1PH9A 3RMHA 4J6HA 3TS0A 1X54A 4XT1B 3ULLA 4C3IB 1WX8A 2FUG1 1R4NB 1I6HB 5IN7A 1FGBD 2Q8IB 3ABVB 2AQ2B 4KI0A 3PUYA 1E0BA 1HZ5A 3LXFA 3KBXA 3BIID 2FXQA 1CUKA 4B3TL 1H9JA 4NKLA 4KD3A 3MVVA 5EKKA 3ML8A 3ALBA 1QILA 3CRKC 3RNUA 2N88A 4G0NB 2AMCB 4A20A 4YHHQ 2KC2A 1ENAA 2WXOA 4LF8Q 1WFQA 1N62A 2GVAA 3EQLC 2E2HH 4DR6Q 4BBRG 3WAMA 1AZQA 1QVCA 3CCJA 4U68A 2VY3A 1WGRA 4GKKL 2M1MA 4BY7B 1MFWA 3N1ZC 2CH4W 5J2RA 3FRPB 4YXDB 1A2UA 4M0WB 3EBEA 3VA5A 2WGSA 4ZOHC 1IBXB 5FLMH 1JWMD 1PRTB 5LMNW 1RHPA 2Q8TA 3NRZA 4QIWE 3KLWA 4BBRH 4CDEC 3KJPA 2K5WA 3I3CA 4DR4Q 1IP9A 3T53B 5M3MB 4E6IA 4NAWB 4CGYB 4MJSA 2F3WA 3MFYA 2PQAA 4JI6L 4B3MQ 1WI0A 1XO3A 1WZ0A 3B2FA 2V4LA 3NELA 3C0RB 1E6EB 2LGIA 4YL8A 4ANUA 2L7RA 3R8BA 4DR2L 2K22A 2KJHB 2F0GA 4GMVA 4HMJA 1K0SA 4TKNA 3RR5A 1K8RB 3FKYA 1PGBA 1STEA 4GLVB 2JA8B 3RZOB 3NTIA 4A3FH 1MJEA 2O6VB 3N1XC 3L13A 2SNSA 3L54A 2L12A 3HRDD 5EDSA 2E8GA 2VQFQ 1WTRA 3CIRB 4DV1Q 5FJ8G 4O2DA 4HDOA 3MHBA 2KX3A 4OGQC 2JZZA 2A1AA 4LFBQ 2K9XA 3QA8A 2FHTA 2KCNA 2UXCQ 3DWQA 2V1YA 4BA1I 2MO1A 2FBWB 5D2MB 2L0FA 3JW0X 2OT2A 4CBVA 4EGVA 5E4WC 2ALYB 3QWNA 2O6VD 2REXA 3A1QA 3B9JA 3QCAA 1OXSC 1UF0A 2WKDA 4KIKB 3WAOA 2L83A 3CCRA 2WHIA 1EY5A 5FJ8H 1B9NA 1F2ZA 1FNUA 1Q86C 3RNCC 2QMTA 1PFDA 4DR5Q 2D0PA 2KDFB 2L00B 4EKUA 3HOYG 3E5SA 1EOVA 3W1GA 4MGYE 1A8VA 4PMWA 2L55A 2XVSA 5J22A 3QIAA 4IM2A 2DNFA 1CA5A 4LWCA 4N59A 4FF2A 1FPYA 1YNTE 4DV2Q 2KMMA 2KEEA 4JWSC 3GTMB 5JEAG 1E8WA 2DWQA 3W1YA 1GUAB 5DPSA 4DWFA 1XLNA 2CW0C 2LSSA 1Z9FA 4K0KL 4DXAB 2UYZB 1DXMA 3HOYH 2JA5H 2VS1A 2MHVA 4YWLA 1RM6C 3PRZA 1OXUA 4OX9Q 3G7LA 2R92G 3RD2A 1VQEA 1PTOF 4R8NA 1QNKA 2NVYB 3ULPA 3EC8A 1NI2A 3SFDB 1H9MA 5AJ3L 1M94A 4FO2A 2UU9Q 4A3DG 5JEAH 2D2QA 1GO3E 4S3SA 2N9LA 4BBRB 2WDTB 3T1HQ 2Q2HA 2MO0A 4A3MH 1VQ6A 2MPMA 1LV9A 1BO0A 5HY6A 2R92H 1PH4A 3S14B 1HUNA 2GA4B 1ESRA 2UXDL 4UP9A 1HNZQ 3KWVA 3PQIA 1NYQA 4A3DH 1XEEA 3L2PA 4DK5A 2KQ7A 4IWQA 3H91A 2OTJA 1R4MI 4HKZE 5C4JH 4ZLTF 1S3OA 1VQGA 3QOLA 1JWBD 2LUEA 3SR6A 3TMPB 5G55A 2YEPB 3UDXA 2XN9C 4AQYL 4KK7A 1BOSA 4DK6C 5KEEA 5CC4A 3SGIA 3TBIB 2ZPNA 3ZXVA 4ZHPA 3CC4A 4J1MA 2WAQG 3HG9A 2NBUA 1YNXA 1LTTD 3HVZA 3WANA 3ZJUA 4CKEA 4A55A 3PIOA 2IJ0A 2OCEA 4NDXA 3NK9A 2KFKA 4DV7L 5C4ZA 1LABA 3EHVA 1D5MC 4CDDC 1L0WA 4DNTB 3J80c 1O7ZA 4LF4L 4KGTA 4ZAIA 1L5PA 4JC0A 3FDTA 3G48A 3I2ZA 4X64L 1G291 3HOUG 4QUCA 2C35B 4FLHA 5HHDG 1TVXA 4KJOA 1RRBA 3H7PB 2PMZE 2Q2IA 2WV6D 1UZXB 3LB8C 3V6CB 1C4CA 3AMUA 4OVZA 4JBJA 1EF1A 3RUIB 1YBYA 3AYHB 3A9KA 2HDMA 2OJWA 1VQDA 2N55A 5LMNL 3I3TB 3IHPC 3QO2A 1UE7A 1YVCA 2ASQA 4A3GG 3VTUA 2JU6X 3PV0A 1WWTA 2AX5A 3H3VC 4IM3A 1FJGL 5IYDH 3ZJTA 3DWPA 1SFOH 2G1EA 3KF6B 2B2VC 2QEJC 4OWTB 1PH1A 2BGFA 3PHWB 3QAQA 1K9MC 3NTHA 2KWCA 4JI3Q 4UPAA 1L2FA 4JG2A 4NXNL 5FLXE 4DV0L 1JROA 1SNPA 1QLBB 2M0AA 4A3GH 4MGZE 2QC8A 2LJIA 3HOYB 1YQBA 5EJWA 2QF7A 4KKTA 3BDOA 3QG1A 4K8JA 1JOQA 5BN5A 2HJ8A 1A0IA 2WX0A 3T1YQ 4B6WA 4B3RQ 3CSFA 4HIMA 5C3JB 4FXKC 4OWWB 1EY8A 3MXNB 2BBCA 4Q2JA 1TY2A 3N9YC 5AUKA 3Q3JA 3M4OH 3T9LA 5C5MA 2Z9HA 4KVGB 4PZ8A 1HZCA 3VR8B 3AE4B 1CTMA 3UI2A 1EFID 5J1ZA 2KX0A 4FF1A 2EYOA 3I90A 2QHOA 3ER0A 3JC66 1A6XA 3SD5A 4A3IB 1WJNA 4H7BA 3CSTA 3I63C 2RCNA 2OJRA 2F0UA 2K75A 3PCOB 1KLUD 5IP9H 2PPHA 4LNFA 1PH3A 2L11A 1WTHA 2VNUD 3D0FA 5IODA 2LZ6A 3NUHB 4WWMA 3FEWX 1JWSD 1Y1WG 1I7HA 1YD8U 2WFWA 4V190 3MJ5A 4MSQB 2A68C 2E2IH 4DN4M 2EPBA 2N3SA 5IYCG 5J18A 5A2QE 2KT7A 4BKTA 4JBKA 1U4PA 4PYZA 3I70A 3Q8CA 3ZDTA 1SYFA 2KUMA 1OXXK 5C4XG 3J81c 1J19A 3PIO3 2KOXA 4AUQC 4XQQA 2BT6A 1V6EA 1Y1WH 4NJ6A 3VFKA 4DF7A 2LJ5A 5IO9A 4LFAL 3CCUA 3GE8C 2CHXA 2RCFA 4X66L 1AARA 3IAM1 2I5MX 5DPWA 1KNAA 1M8AA 2CWPA 2WAQB 1HR0Q 4II2B 1UEBA 5KNBA 5LL6S 1SEBD 4OWXB 2RBMA 4A4IA 4DNRB 4POGA 4HIDA 4NQLB 1C1YB 1ROEA 3T56B 2X69A 2LY7A 2JT4B 3MJWA 3A8IE 4GN1A 1VQIA 3U9SA 1VMPA 4JI1L 3Q8AA 4JI7L 3HOUB 1XX8A 1GM5A 1FM0D 3CRLC 2LXCA 2MP2A 4RNAA 1GXDC 2K01A 1K50A 1Y8NB 3M3YH 2X38A 4XIGS 1WVLA 3GTPH 2B29A 2WXJA 1SFOB 4ITKA 1NTGA 1EQTA 1RF2D 5BMIA 2VB3X 3S15H 1QKZA 3PUZA 1GC6A 4FYDA 1CQVA 3S16B 3H15A 3CQZB 4HXDA 3ZTDA 2CQAA 4DPGA 4A3GB 3ETRA 5E4XA 4IJLA 1HTOA 2MH7A 3TJPA 3UIOB 4LK1C 2I38A 1M1KC 2EYLA 3AE5B 3A7LA 3DMUA 3GTKH 4IJHA 5AEKB 4YWGG 2C7HA 4FHJA 2EQSA 1N32L 1TZOA 2FCSA 3V2TA 1V9PA 1AE3A 4YY3L 4JI6Q 5L95C 1A3TA 1VZ8A 2LEKA 2WXRA 4AWJA 4IPGA 2B3AA 4YWKA 1YJWA 2NPTB 2KCTA 4TQUS 3HK0A 4ZCKA 4P6VF 4ME3A 2JJQA 4IUTA 3SR1A 3U7DA 1H9SB 3MA2B 3MC8A 4KX6B 1PRTC 4PNYA 4CJ2C 3JVZX 1IBXA 3TBLD 2ZW1A 1WE6A 2JQRB 2K1FA 2KLCA 2D0OA 1F9PA 1L4DB 3AE6B 4IW0A 2R7ZG 2FJ2A 3L0WB 1S5ED 2MEKA 3V05A 2LHDA 1VLBA 1QOBA 2NS5A 1E5WA 2NZ1D 3E56A 5H1SE 3R93A 4NAWA 2BF8B 1WM3A 1IW7C 4DV5Q 3TP8A 1MJCA 4CO7A 1K83H 2R7ZH 3PTFC 2P5ZX 1I4PA 1TY0A 2ZXOA 3PUVA 5IGEA 3L7ZC 1IHZA 1BCPB 3DEPA 3VYSA 5JVG3 2LGSA 1VQOA 2LGDA 1Y1WB 2AWTA 1STYA 5D3DA 2FCMA 1YX6B 1G8ZD 4JK1C 3GTQH 1ZXIA 5KHOA 3SU8X 1S1QB 2KWVB 4BXXH 5KHQA 3BYYB 2WINB 3I57A 2O6VA 5C4XB 3RNFC 5EQ0A 4I6NB 1VZ6A 2KZRA 2WQYB 3KUZA 1YZ6A 2IGDA 4N6EB 3EUB2 3Q3FA 2R6GA 4Z9CB 1N5WA 4AJWA 4A3EG 1RTOA 3I4NH 1FGUA 1G51A 4WIPA 4MDKE 1TWCB 2BH2A 5EE3A 4DA2A 1XLOA 1BR9A 2ZVNA 3M3YB 4EZJA 3UE0A 4Q0FA 4HROA 3NXWA 5ISRA 3S2AA 1SAPA 4HJ8A 4C80A 4K6DA 1CMXB 4YHHL 4A3EH 3T16A 2KOLA 1YHQA 4JGHB 4LF8L 2Z0SA 4OO1H 3RZFA 1H8CA 2EJFC 4DR6L 3NE5B 4W9GA 3BK1A 3PSEB 1C79A 2UXDQ 1K52A 4N9TA 3BZKA 4WJPA 4AJYB 3G6EA 1WXSA 2FCNA 2L1AA 4LJZC 1EFWA 1LT6D 3EN2A 2XK5A 5IA7A 2I2YA 4EQPA 1Q81C 4WJWA 2N9EB 1JCKB 3W5VB 3AULA 1KQSA 3ZKJC 2R7FA 5D14A 3J80E 1RTNA 1Y1VG 1D7QA 3B0AA 3ZIMA 2NBVB 4PT5A 4JV5Q 1XF5L 3UE1A 4G11A 1JQYD 1P16A 3M95A 4X57B 4K3CA 1QG7A 1FYCA 2EOTA 2LS01 3CP0A 3H6NA 4JL9A 2BW2A 3M85A 4B3ML 1WJUA 3OJ4B 1Y1VH 1R4PB 4AIMA 1STHA 4ARCA 1KH0A 2O2LD 4DV7Q 1TJEA 4ICUA 1F52A 3VUYA 1C4PA 3I4MB 2KDIA 4NJ7A 4M8AA 5LNK1 2DJGC 4QQBX 4OO1I 2NZOA 1RD9D 1EZ8A 2F0EA 2DBYA 4F87A 3D3RA 2NYZD 2PPBC 4IFDG 4RGTA 1L0YB 4JLCA 3DBSA 2IX0A 1SIFA 1E8YA 3CWIA 5CV8A 2XWJB 5LMNQ 3GE3C 3OJ3A 1V1QA 3VH3B 3EECA 4KMUC 4AYBE 1JWAD 4C56C 3TUOA 4DV1L 2IDYA 3GTQB 1GKHA 4OONA 4NY0A 2R7DA 4REZA 4LFBL 1PHJA 2WKCA 1J5EQ 1WSPA 5DCNA 1QB5D 2UXCL 2ZJDA 5CV9A 3ZXRA 1A15A 4LNIA 3I4LA 3H9DA 1NR4A 4HRSA 3UDIA 2F0IA 4BKSA 1FNWA 4HJ5A 3CCVA 1AZPA 5AZHA 1SDFA 3F1ZA 4DR5L 4LF9L 1ESFA 2XRSD 3VR2A 3MTNB 4KSLC 1QOAA 3H7PA 3KLRA 2CW0D 4L2YA 2HQLA 2D5GA 1XQQA 1LO5D 2K04A 3TQYA 1N5XA 1KIXA 4GS3A 4IDIA 3QX1A 4DV2L 2I0QA 1C77A 4M1UB 4TUUA 3SHLA 3AFPA 2GBMA 1E8XA 2XBBC 5T8IA 5J39A 2RHSB 3FHWA 1NJIC 1HTLD 1HR0W 4F8MA 2LD9A 2CH4A 3PZ7A 3TMEA 1N63A 4TKOB 3RN5A 4KV2A 1AWDA 3B1LX 2K03A 3J81E 4OXPA 4DV3Q 1KC8C 2GMIC 2M56B 3IAYA 4LLGM 1DJRD 2EMSA 5G3LF 1XYIA 4RG1A 1FFUA 4BOZB 3TS2A 4GU2A 1JB7A 2UUBQ 4RAUC 1TWFH 3R3OA 3T1HL 4A3BH 2E3TA 5HFYA 2WS3B 2M2LA 3D32A 1B9RA 1X55A 4LUZA 4FXDA 5C5LA 3X3MA 1SYEA 2KYWA 3MXNA 1HNZL 3U4EG 4FP5D 3DBHB 3K0XA 3NHHA 1BVSA 1WCMG 1X32A 4LDTD 1A5RA 1UGJA 5DNFA 1YJJA 2HCIA 3APCA 1PH8A 1SYCA 4RGNA 4FJZA 2V0GA 1J9OA 2X6GA 3A7AB 3H6MA 1NMGA 2F52A 3AU4A 1JQ4A 1JW9D 3G4SA 2FNJB 2F03A 2MGSA 4FA6A 1CSPA 4B0EA 3AFQA 2MUYA 5IIFA 5EPKA 1VRAB 4BBSG 1JT8A 1KFYB 3P2BA 1KF6B 4LNKA 1NCVA 1STBA 1MHXA 4GDLB 3WOEA 3STBC 3IL8A 2Z59B 1EYGA 1YMHE 4C3IH 2ZTDA 1I6HH 2QDLA 1SNQA 3PV1A 1NBWA 2NN6G 3A56A 4X3TA 2PZWA 1SN8A 4N9PA 4IWPA 4C3HG 4BBSH 2D3GA 3TN2A 2D3BA 2Y5PA 4O42A 4BBNC 2Z6BA 1DM0B 2AWNA 4YCWA 1FXAA 1I6VC 1KAAA 3WDNA 3ZYYX 1NAPA 5CMDA 1HXYD 1JB3A 3M4YA 3OAWA 3N1YC 2IX3A 1HRJA 3CCQA 2K6DB 3PS6A 1VQFA 3C1FA 3F8TA 1STGA 4JBMA 2BS3B 3RMKC 1IGCA 1VF7A 2WXGA 4FBJB 1T5XD 2JXMB 3I4OA 3KDFB 1MPEA 4BY7H 1WI5A 2GI9A 2MJ8A 1N32Q 2DX5B 3RFZB 1QOHA 4QGUA 4K5WA 5COYA 3NUCA 2RPVA 4YTPB 5FOBB 1J0GA 4LNQA 2N1WA 1Q10A 1B50A 3P4RB 1LTID 1W3SA 4QIWB 3TL5A 5F2DA 4JI3L 3NWTA 1HHVA 4YSYB 2DGYA 2XGTA 4ABNA 1NDDA 3B08A 4OELB 4UAIA 3PREA 5M3MH 4IM0A 1ZYRC 2CHZA 3TCAA 4F8CB 3DHIC 3I55A 2Y0SG 3RN9C 3Q24A 2EELA 1ONLA 1H9KA 2WXIA 4KHPL 2C5CA 1JMCA 2IZVB 2JA8G 2GN5A 2EY1A 1YNNC 5KRUA 5FKAC 1D4BA 3VXWA 1KDAA 1N8RC 1ZKOA 2JY6A 3DPDA 1CKNA 2G4SA 1EWIA 4W9JA 4FVMA 4RGMA 2MQHA 1SXTA 1U4RA 1R4QB 1XNQQ 2LXAA 3FPPA 4XDDA 2JA8H 3RZOH 1XCQL 2NPTA 2V1CC 3W3AA 2D07B 3HP3A 2YLMA 4S0RA 2M9VA 2DUDA 2LWPA 2KKCA 4RCNA 4BS9A 1PYSB 3A5UA 2KQ4X 3A4SC 4JE3B 4DDID 1GVPA 2M17A 3RZDH 3AEVA 4X3UA 2JSOA 1SYGA 3QHTA 2UXBQ 1LT3D 5C3XA 1WCMB 1LT5D 2K7VA 4P72A 1YX5B 5EPJA 4UHVA 5FO8B 4H13C 3PRMB 1IXRA 1PDQA 1IYUA 1CZPA 4KKIA 5I2XA 3S1MB 4PS3A 4BAXA 2WACA 3GV6A 1A63A 3H0GG 4HIOA 3ZGZA 4HLEA 4PMBA 2K25A 4MTNA 2FE8A 4CDCC 5DPRA 1UGMA 2RVLA 2DNEA 2WB1E 4BBSB 1Y56A 4C2MH 3UQAA 1PZJD 3K8AA 3AECB 1HR0L 5TSSA 1BCPC 1DGJA 4K81A 3WAPA 1E7UA 3BG3A 2R2OA 1EQQA 1WD0A 5I4DA 5JJZA 3HOVG 1JMLA 1O7LA 2N9KA 2L32A 2RR9A 4RM9A 1D3ZA 2A4ZA 1A62A 3H0GH 3GTMH 2OWOA 1EM7A 1RL2A 2F4VQ 1P9DU 1KRTA 3H1UA 4C3HB 3A33B 1CHQD 3WWVA 1SROA 3SK8A 4LTUA 2EYMA 4K8IA 4WWPA 3TDQA 4DGZA 2RSNA 4ULLA 3OLMD 2I5HA 1ET6A 3WCQA 2KQ3A 1RJTA 2CHWA 2C9WB 2NVYH 5D3IB 3URYA 1V2YA 1EQRA 2ON8A 3AI5A 1KJTA 3DBRB 1HUMA 3M3JA 3Q2AC 4OIKA 3J9CA 1B3QA 3GS2A 1EU3A 4GOCA 3TP7A 4XTCS 1AW7A 2H4OA 1D5ZC 1LTLA 4G4KA 2LRWA 4MTKA 2K50A 3S14H 2IGHA 3VTVA 1ZW7A 1AH9A 2CKZB 1GAQB 1V81A 3AV8A 4FJYA 3J7AF 2DHZA 5CX3A 4F7ZA 3KK7A 3R3MA 2NCNA 5CTRC 1F0ZA 1FEHA 4A9AA 5EKLA 3W1BA 1PRTD 1N9WA 5JEAJ 3D4DA 1CZGA 4DR3Q 2ZNVB 3HM6X 1MGSA 4ACFA 2PO4A 5FR3A 4IUNA 1X3PA 3FVQA 3ZW3A 1J7AA 4G7HC 2G9HD 2CWAA 1DZ1A 5C23A 2Y0SB 4B3SL 2B2UC 2K33A 2O2VB 1HH2P 3N20C 1XMQQ 4D2KA 2WU5B 2RDHA 2B2UA 2F0WA 2JA9A 3Q8FA 4MT5A 3OYYA 1PMRA 2LFIA 3PO2G 1IW7D 2LUMA 2Y5CA 4RWSC 3TREA 1PH5A 1P8LA 4IALA 2ICEC 4DHJB 1KXLA 5C0XG 1PGXA 4KSKC 5IP4D 5A35A 2A69C 3RZDB 1OQYA 4XGAB 4YCVA 3A5ZB 1B1ZA 1DCZA 1S5DD 2ZXRA 3CMAA 1C8CA 4ZRPA 4DV5L 2HTHA 1XMOL 4HSVA 1E7PB 1WH3A 2KWUB 4DAPA 1Z47A 4ICVA 1WX9A 1TS5A 1WD1A 2PMVA 4LK0M 2TMPA 1RAXA 3FILA 1CKOA 4RH6A 5C0XH 1LTBD 1VQMA 3DHQA 4DKAC 4G7OC 3Q8DA 4LF9Q 2N9XA 3AB9A 4C2MB 1I35A 2F0LA 2Y5BB 5M5WB 4KJNA 4UP8A 3E9SA 3DCGA 1QVFA 2L0CA 2DY7A 1WR1A 3NJTA 1HNWQ 1MD2D 3HS0C 4OL7A 1OEYJ 2N49A 2J4XA 4HPMB 3I56A 4L5SA 3H0GB 3W5OA 4ZRZA 5IWAQ 4XYOA 4L1BA 4A3LG 3RLOA 2BDNA 2PW7A 4K3BA 5IGBA 4NPNA 3HRZC 1Y8OB 5ELBA 2JEBI 3Q3NC 3MXPA 3KUDB 3RNEC 1E24A 3DXJC 1CHPD 1DD2A 1G6JA 1K0RA 2WX1A 3ZVVA 2MJDA 2QA4A 3HOVB 2XRQD 3ITPA 4UP7A 4A3IG 3NEMA 1SIJA 1IYFA 2UUCQ 1ASYA 2L0TA 4RM8A 4A3LH 3AEGB 4ZQ3A 3OIQA 1PH6A 1HA5A 1RCVD 2I1JA 3ZJYC 2W3RA 4FADA 2IWHA 2PYKA 5HG2A 5C0XI 2GOWA 4TQ0A 2QILA 1ZOYB 3PO3G 2NVQB 3V6EB 2B8GA 1TBEA 4KY5A 3LWEA 3DQVA 5CV5A 3VYRA 4U673 4XZ4A 4IC7B 2G5DA 2KTRB 1PFBA 4Q5VA 4A3IH 5HGTA 5GADC 1XPRA 1N60A 3CCEA 4DK1A 1XXGA 4H0LC 3S2DH 3DBLB 3Q14C 3QK0A 1GJXA 5JJIA 3CHBD 3ND8A 1T0QC 1J8IA 2BB6A 2DENB 2ZTCA 4MHEA 1JJGA 3BU2A 1SNCA 1SRUA 4B0MA 2AL3A 4JV5L 2IL8A 3PO3H 3PSIA 4PMCA 1NY4A 3SFEB 4JPSA 5M9OA 2QDFA 2BYEA 4IUPA 3NVVA 5JHBA 2F1MA 1K28A 1SE8A 4RMFA 2DAJA 2XIWA 1WMHA 3K5NA 3KFUA 4W9CA 2MBOA 1EIHA 2JWUA 4DUYQ 5M5YB 1L6UA 1D6EC 3GTGB 2AYOB 5CR3A 1SE9A 2D10A 2M8SA 1JICA 3OMCA 4LMQD 1C4AA 4QL5A 2EIFA 2L8JA 4MELA 1DOMA 1FCLA 4K1RB 4JI4Q 2N8NA 2E5LL 1XLPA 2LMCB 2MSED 3E0EA 3PO2B 1V1PB 2IO3B 2NR2A 3V61A 4YSZB 1A3UA 1VMCA 1BDOA 2K5VA 1NBFC 2VH1A 4OZAA 5ELDA 1WIAA 4OVUA 3BVMA 4K2LA 1V49A 3MC0B 1EWHA 1IKLA 1B53A 2IHFA 3HOUH 3HFZB 2BTEA 1XJVA 2RDBC 3M9BA 1WGYA 3ICEA 1V43A 4LFCL 4WJQA 2MWSB 4XT3B 3SXHA 1EIFA 1J5EL 1XNRL 1FIQA 1IGDA 1MI0A 1YN4A 3IT4B 2W9NA 5JXVA 2IO0B 2L3ZA 4XC2A 2R61A 2DY8A 2VQEQ 4GNXB 2ASBA 3S16H 1YQ4B 2B2VA 2DNCA 2F0DA 3CQZH 3N32A 4NQKE 2JN4A 3C19A 4WJOA 1X56A 1MSGA 4LJPB 3SDLC 1A2TA 4K7WA 3IFDA 2HHHQ 4PS8A 5JH5C 3KUPA 1J8CA 2B2YC 3CC7A 1L7YA 1R7SA 4XWTA 1LACA 2PZUA 3PZDA 1TR5A 1PZID 5AFWA 4KHPQ 4WQOB 3H94A 2RD0A 1ZDVA 4YTNB 1N36Q 1MJDA 2KBNA 5LMUQ 5CHVC 2FIDA 1JOKA 1EOTA 3N3KB 4GLXA 3NQIA 4HCEA 1NR2A 4JVZA 1KABA 3M7NA 1P0RA 2BS2B 4F88A 4FXGC 5LHY1 3CF6E 5ELNA 2B2TC 3AE8B 4WAAA 2K5NA 1TXYA 1BBXC 1RWSA 4DV3L 1WR6E 2KD0A 3S2DB 4MGIE 3BDCA 1WE7A 5JAVA 4P73A 1IYJB 4M8MA 3U8ZA 2JZ3B 5LL6X 4CYEA 5IGFA 3CMEA 1K8OA 2UUBL 1CFMA 2F0SA 3PO3B 2PTLA 2CU1A 2H88B 4JI8Q 1TKYA 2PNRC 3AXCA 2YV5A 4RFBA 4AYBG 1T5EA 3CD6A 1MG8A 4IOIE 4MH8A 4ASWC 5JHAA 4GN3B 4LAAA 4GDKA 1OXVA 3Q69A 3N52A 1BXTA 1E10A 2VZAA 1JE4A 1WGKA 1YHAA 4ZKBB 5I6WA 1SSOA 4C00A 1XLQA 2X6LA 2MA9B 4KV6A 1I94Q 2GBJA 3GB1A 3QC8B 3ZQ4A 1X3EA 1T6BX 2CQOA 4ZK9B 1XD3B 3OTOQ 3C1EA 4HCSA 1E90A 3PIPA 2ZCBA 1BUVT 4NJCA 1I4GA 1C48A 1EQVA 3STBD 5GXGB 5IYCH 1PA6A 3J80i 2GB1A 2OXPA 4DR7L 2RA4A 2RPQA 4A3KG 3A8JE 4WORA 2KENA 3ECIA 4FHKA 4IOCA 5C4XH 2PI2A 4DAYA 1I50B 2PLPA 4DAMA 1GPXA 1VR9A 3TZDA 1FRRA 1OXTA 2CHBD 2INCC 1GUWA 2F4IA 1N33L 1HFNA 1SBBB 1H4RA 3PF4A 1TWCH 3FAHA 2BA1A 3HOWG 3L0OA 2MRPA 1V5TA 1QWYA 3VR3A 4J3OD 3DVGY 3VAWA 2AQ1B 2RQXA 1N61A 2PJHA 1O80A 2RMMA 4MH0E 3L10B 4RHSA 2ZJPA 2KANA 2BPSA 3L4PA 1BQQT 1Y14B 1HFGA 3K5MA 1MBYA 5FK9C 4QF4A 1EF5A 5KYIA 3HOWH 2KWDA 3ND9A 2JSVX 4KN7C 2XEWA 3U30A 4MM3B 1QNUA 4F7XA 3QQ8B 2OQ0A 1VQKA 3V62A 2CJNA 3MHSD 3M62B 1I42A 3A9JB 1GC7A 1PYWD 3M4QA 3W2DA 2AEHA 3IFWB 3P42A 5BYSA 2L05A 2K5HA 4GOPB 2ZPYA 1ZYRD 4CJ1B 2INNE 1CK1A 3MP9A 5AUIA 1VQAA 4HAEA 2PKOA 4US9A 4B08A 3UDFA 2R93G 3I4MG 1MHWC 3SEBA 1G6ZA 1DYQA 2JVCA 1TQOA 3OMGA 2QCPX 4B3SQ 4M0WA 1YNND 3MWYW 3VQIA 2SEBD 2L15A 2BCOA 2WIIB 4DHZE 5C3EG 2HJ1A 3GQBA 3JAMi 2K3UA 2PVGC 4RHRA 4GSWA 1B4OA 2J0TD 2JXXA 3I4MH 1X3GA 4HPLB 3DM1A 1FFVA 5MPOA 2H1EA 3NQTA 1IBML 1SLJA 4B9XA 1Q5WB 1YIWA 2J42A 3HOXG 1I4HA 4G57A 3S2HB 3D6WA 1M4VA 1A70A 1DOIA 2Z6KC 3A4RA 4B95A 1Z7TA 1XMOQ 3O13A 1STNA 2ZNVC 1X3FA 1STAA 5C3EH 1IBLL 1XNQL 1TYGB 4GN5A 5IGDA 3K59A 2UU7A 5EBCA 3AU5A 1GNUA 2JUOA 1E0ZA 1QZGA 1UH6A 3QIJA 4IUMB 2Q2TA 1YHBA 4AYBB 2KECA 3J81j 1SMYC 3PIP3 4FF4A 4YCUA 1VQLA 3VRAB 3UQBA 2BDOA 1BF4A 4GIVA 5BMGA 3NHEB 3P7JA 1XPUA 2MHJA 2X8XX 1AEXA 2UXBL 3LJ3A 1UD7A 4KLKA 2W82A 4NAMA 1TT5B 5LLIA 4WH4A 2OEOA 2RGFA 3JAML 1L1OC 3D6CA 1JRPA 1GJZA 3OWEB 4BZAA 2CJOA 4RKLA 3SDZA 5ELFA 1BCPD 2IT1A 1B7YB 1JJ2A 5JJKA 4ZRJA 2ATWA 1E22A 3IG3A 4A3KB 3K80C 3VTWA 4PV1C 3OSOA 2OEDA 3NBHB 5E3FA 2PE9A 1S3SG 4FXCA 2L5TA 2RHQB 2I1KA 3ENEA 4W9HA 2D9UA 4A3PA 4WWNA 3NSWA 3KYHC 1F9RA 4QB4A 4R4QA 1P7FA 2KO3A 4AS1A 1E1TA 2A6ED 4KIKA 1TS2A 3R2IA 3MZ5A 1PZKD 5M3FG 2F0MA 4ALPA 2A5HA 2A73B 2F4VL 1YEZA 4DXFA 4BWGB 3HOWB 1WOCA 3LNNA 1E9MA 2DZMA 2K4KA 3K9PB 4GLSC 2DZKA 2BB5A 3KUCB 5HGQA 5IT9L 3LDZE 2EXDA 5IGCA 3DDCB 2GRIA 3PHXB 1LT4D 2VXWA 1XCTL 3RZWC 3U50C 1FR3A 1Y69U 2NWGA 5ELOA 2V3SA 2WP9B 4US8A 4MJSB 1HEZE 4ODGA 1D2BA 3PGEA 2NTTA 2K5PA 4A6QA 2XSCA 4DK3C 4XXEA 2KAJA 3H7SA 1WJJA 4C7ZA 4LNOA 1ZP0B 1HZ9A 2CU3A 1K53A 1HTQA 2GBNA 5M5XB 2EKIA 3QJYA 1L4ZB 3NTKA 3BY4B 5G5HA 1GHJA 4FF3A 5BN4A 1C9OA 3OHXC 2KHSA 4DR3L 1K73C 3G6JB 3S1NB 2R93B 3AEFB 4JQWC 4ZYSA 3ZJVA 3RN2A 1YNJC 2JYTA 4E71A 5L37A 4KKJA 2PIAA 2E5LQ 2WB1G 1XMQL 4CDFC 5C3EB 5BR8Q 2MCNB 3D8GA 1QF6A 2A69D 1R9TB 1LTAD 2QGQA 3C2PA 1PDXA 3PMFA 2E2DC 3K7UC 1JE5A 4DBGA 2K6AA 2HD3A 1ASZA 3HOXB 1B44D 2OF1A 4HJKA 3VR6A 4UY8C 3VDZA 1ZE3D 5IYBG 1E2ZA 2DYOA 4DUZQ 4IFDH 4LFCQ 2W55A 1F2MA 4DV6Q 4PZ7A 3PRPB 1XNRQ 2JA7G 4OZCA 3RNGC 4DXGA 2IYDB 3I8ZA 4EQNA 3BK2A 3DOWA 3FPUB 4I65A 4JI5Q 3DBHI 1ENFA 3NVZA 1MG4A 3AM9A 1BT0A 1VQHA 3AE1B 1PFSA 1E3PA 2JRIB 2D3AA 4DQOC 2C60A 1WYWB 2L76A 3ZNHB 2JA7H 5K36G 2LMCA 3DM3A 3SK5A 4GXBA 1ICFB 2E6XA 2KC1A 3ZLZA 1V5OA 1I3QB 1HNWL 2F0KA 3MXUA 2WYQA 2DN8A 2KMAA 2F3IA 1Q1BA 1FMAD 3O65B 2HDLA
chains in the Genus database with same CATH topology
3PUXA 2M00A 1HQMC 5I6YA 2FMCA 5T1GA 1FNVA 4KD4A 5BMHA 1DOLA 1LLRD 4IFDI 5M3FB 3L3OC 1B9MA 3OWFA 1FXIA 1GUGA 4MN3A 1NI3A 1YN5A 5EE0A 5JPMC 1F2RC 4HEA1 4Y7NB 2WDVB 1A3VA 1PFMA 1C78A 4EE2A 2F0OA 1GUTA 2B2WC 3EROA 5CV4A 2JA6B 1QOGA 3W5UB 3TZUA 3IAS1 2B8FA 4OIJA 3T13A 3R2TA 4YSXB 1HCZA 4I7ZC 3NWSA 2K0PA 1EYAA 4GZYC 4G7ZC 2O4XA 1Y8PB 1MSHA 1SSNA 2W3SA 3T3OA 2IW3A 1Z6HA 5DEHA 3LYYA 1EY0A 2WB1B 4K14A 5G5GA 5JOBA 2NUCA 1EY9A 3DUZA 1AFPA 1NVID 4P2CB 1G2TA 3MEHA 2HUGA 1HZ6A 3H8HA 1RODA 3T51B 4IURA 2NN6H 1P7EA 2JX5A 1X3QA 5IOCA 1EYCA 2WNMA 4R8IA 2JA7B 2I07B 1KDBA 4K5XA 3NBIA 4QUFA 4WFN3 2F0TA 3BVGA 4RF0A 4ZUIA 3P63A 5BN3A 4JBWA 4CJ0B 3SK6A 1WTPA 4K2KA 3D31A 1JORA 4CQNA 1TS4A 2EYPA 2WXFA 2D62A 1VDZA 1UAPA 1ZEQX 2JXTA 1YQ3B 2INPE 4H44C 3KLSA 1GB1A 1J7CA 2KEDA 5C44B 1JR0D 2RDFA 3P75A 3SK4A 3D4WA 5EE9A 4B9WA 1ML0D 2NN6I 3VYTA 4KGSA 5CV6A 1JALA 2WXPA 3S9WA 1PRTF 2MP1A 2LHEA 1TWAB 1CT1D 1EWYC 2BOSA 1QT9A 2K5DA 5BMIA 4ME5A 1EU4A 4HN7A 2YYZA 2VUMB 4ZRQA 1GB4A 1WYGA 1JWUD 4HEDA 3BYTB 1H9SA 4J8QA 3SE0A 4KY6A 4C7YA 2J53A 3GTJB 3F2UA 3BS1A 1EY6A 5KYLA 3K7AB 4BA2I 3KWLA 2F0FA 1DOXA 4TSSA 1O7YA 1G91A 5KIXA 3HOZB 3CKIB 4YTMB 4KKSA 3MHZA 4C3JB 3NVYA 3OW7A 1KNEA 1L0VB 1HQRD 5C0XJ 3HZXA 4IUVA 3I91A 3K5LA 1V8CA 3I9V1 4EVOA 3GV3A 2A6EC 1K51A 2EDGA 1S5CD 2J7ZA 4EQOA 2ZW0A 1Q1EA 2PW5A 3K6OA 2EJMA 3MAQA 2G9DA 4XQJA 2F0HA 1QOFA 2BYTA 1PXUA 2B76B 3NBHA 4KN4C 1Q12A 2O5IC 3QB3A 1KRHA 3K5OA 2B63B 1ILPA 1SNOA 1EYDA 5C3WA 3NS1A 4XQNA 2JE6I 1B3AA 1XTCD 2ENBA 3AE9B 4OHJA 1SNMA 2EYHA 3AU7A 5H8YE 2WXHA 1C9FA 4IN3A 3DWAA 3S1QB 3Q8BA 3GTOB 2VB2X 5ELEA 2YU9B 4HSPA 4DFAA 4XDXA 1IKMA 2K32A 1EZ6A 4A3JB 4K6LA 3J7AV 2PQEA 3AE7B 5D7GA 3IXSA 1S5FD 1MHHE 3P4QB 3Q22A 2PMZB 1SMYD 3E6ZX 4WRDA 3HGBA 2N7JA 2YEPF 3KLSX 1CI3M 1WTQA 1KDCA 4NW2A 3TSSA 1BMLC 4KKUA 1H9RA 3BVZA 5FLXL 5C2TB 3P20A 2ZXPA 1PFNA 2K28A 4KTAA 1TKGA 5C4HA 3I72A 2WP8J 2PVOD 4RKBA 1ILQA 2CVRA 1TWHB 3LWUA 1PTOH 1JOOA 5FO9B 1ZXTA 3M7GA 2RSOA 1KLGD 4RGOS 1SE4A 2KACA 2D5DA 1IL8A 2SOBA 1PLFA 1XWEA 2BS4B 3AE2B 1S4ZA 1VZ7A 2O5JC 1FD6A 5BYRA 2F3VA 1TU2B 3BWUD 2Y3AA 1ZPSA 3MXGA 5E6JA 5BYQA 1WXQA 2E2HB 3PO0A 1LTGD 1FRDA 4ID6A 1U4MA 3D4RA 2JP1A 2KCCA 1EEID 5CV7A 5A2QL 3WOFA 3T3NA 2EYJA 2EVBA 1EIGA 2QDBA 3AB5A 1F9QA 4CKCA 2BE5D 4IQZA 4P16A 3W1SA 3K0YA 1NSNS 4HKQA 4XYQA 2NVTB 1SYDA 1YNJD 1F2RI 1VDVA 3GTLB 2KA7A 1NENB 1BNZA 3A54A 3S1RB 4X3KA 4HMIA 1Q90A 2XNAC 3AMZA 4DAVA 2A6HC 3FKIB 2DYMA 3B2GA 5HI1A 4A3FB 3HUIA 1MVKA 3ONAB 1UWXA 2KDMA 3IT6B 1I4QA 4ZUJA 2MJ3A 1SJHD 1ZUD2 1I4XA 2IPKD 2AQ3B 4WQMA 3HVDA 1AP0A 3NVWA 2D2CC 5C6AA 1NEKB 2F0QA 1PTOB 2EZVA 1WTOA 3VYUA 3GD7A 3E0JA 3TP6A 1E2WA 1F2YA 3GP7A 1YN3A 4TMAB 4OW0A 2B2YA 2NVXB 2KVMA 2E74C 1WTXA 5EGTA 1PTOD 1U4LA 2QJLA 2AUKA 2SDFA 4NZLB 2HCCA 5DAUA 2JA5B 2B2TA 4FNFA 2WU2B 3TP5A 2BA0A 3S17B 4DK0A 2LFNA 2LKVA 3V3XA 4H2AA 5JVH3 3VRBB 5K5PA 4YIJA 1UEAB 2K5QA 1JC7A 4RA8A 4KHZA 2F0JA 4L23A 5CYUA 4A3MB 3NZ3A 2R92B 3LX0A 4O1NA 1VCIA 3ERQA 1BUIC 4A3DB 3IFTA 5C4JB 1W6KA 2MJEA 3FMCA 1GUSA 1ZDXA 2WXLA 3AEBB 1QCBD 4PQXA 1TKWB 1AN8A 1NUCA 4L8JA 3Q6SA 2WDQB 2IX1A 3UI3A 4TQ1A 2ACZB 2FFKB 2Z8LA 2XWBB 4XWWA 1NYRA 5IGGA 1O78A 2EY2A 1BCPF 1FD7D 2HQEA 1SF0A 3TEYA 4DU9A 2V4IB 5NUCA 4XDCA 4KGRA 3U2SC 2RKSA 5D65A 4A90A 3J80L 3AEDB 1RFKA 3P1HA 4NMZA 1S5BD 2JEAI 4WURA 4N58A 2E75C 4X3SA 1J7BA 1GUOA 2W54A 5EE1A 1SE2A 3IKJA 1GHKA 3K58A 3L9AX 2PZTA 1SB3C 1SNDA 2EJGC 1OO9B 1G2SA 3M4OB 3TEZA 4IUUA 5JPNC 3J7YW 4JWUC 2FINB 4XE0A 1IYVA 3FC4A 1OQQA 2KN4A 2Z4IA 4NP5A 1WTVA 2Q8RE 2M19A 4JX1C 4CKBA 3C8YA 1FO4A 3BZDB 2HDEA 1D1IA 2ICIA 2EY5A 2C9OA 1CA6A 2K1BA 1EY7A 4HR7B 5I9OA 2FMMA 1V97A 2E2IB 3U7ZA 1SE3A 4KHVA 3KBGA 2N0SB 1HA6A 4OZBA 1K8MA 5E1FA 3X3NA 2WXNA 3I73A 4IFDJ 3OPOA 4C1NI 1SJED 5FO7B 3AE3B 2WXKA 5DM73 3Q8EA 3J81L 4A8XC 2H89B 3DWMA 1E2VA 4RCOA 1GUNA 3RLFA 3NP8A 3KQ4A 2E2JB 4BY1B 3BDLA 3C3LA 2AWOA 1WRIA 4OO1G 3RD4A 2WXQA 4R3DA 3U52E 1EEFD 3EVQA 3GTPB 5T1IA 1C76A 3K57A 1UUPA 1RKNA 2AUJD 3S15B 4R9WA 1WTWA 4RF1A 1F77A 1TKEA 2RDGA 3SVMA 4ILWA 1ICWA 3GTKB 2BE5C 2JYEA 3RUZA 2K05A 2EXZA 3P1MA 2WXMA 3MTSA 4YT0B 1B2TA 2HTME 3AEEB 4QMGA 1F9SA 2WDRB 5KGUA 1ENCA 1ACCA 4QCLA 2SAKA 3OIPA 1PGAA 3QOJA 3AH7A 1V1OA 2IGGA 2WLBA 3FILB 2SNMA 1SYBA 1FCCC 2EY6A 2L4NA 2Z4HA 1I4RA 4IUQA 1QQRA 4HJGE 1D1KA 4A93B 1OFFA 1QJOA 1LTRD 4USAA 1Q3LA 1K83B 3V96A 2R7ZB 3P4PB 2Q5WD 4KY7A 3DWGC 5I2YA 1EWCA 2PCFB 2JYOA 1TT2A 2L1BA 3EGRA 2E76C 1V1PA 4MIUA 1F2LA 2NBFA 5CBEE 1L6VA 3Q23A 2NB0A 5K36H 4MACA 3I4NB 2ZT9C 3TEXA 1PTOC 1C4QA 3PZ8A 3JAME 3HKZB 1PUTA 1V8QA 5H92C 4IKGA 3EFXD 4C1NK 4A3EB 2B39A 5EBDA 4ZKCB 1HTPA 2V3PA 2B2WA 1RDPD 1CQFA 1CM9A 1TS3A 4AQ7A 2L9HA 1AYFA 1DOKA 2QIEB 5IT9E 1DONA 4C3JG 3EJIA 3T4AC 4IZ8A 2F0VA 3A8KE 1EL0A 1IUEA 5CGKA 1Y1VB 2A6HD 2F0NA 1UWMA 3VR9B 4C3IG 3AEAB 2NMQA 2L52A 3P4SB 2V3NA 5DM63 5KNCA 2V4DA 2JZPA 2R3ZA 1CJEA 1ZXHA 2DLBA 1QE6A 4K5VA 2PW9A 1UNSA 1MI2A 3W9CB 3PUWA 2ID0A 4HTHA 1LTSD 3CU7A 4ARIA 4CHTB 1U9RA 1KTKA 2EYFA 5HURA 4UDUC 2VZKB 1W6JA 2I46A 3VR5A 1VF5C 2QKIC 2A74C 2EE1A 3H09A 4V0BA 3RPFC 4ZHOA 1OQRA 3DEOA 5CORA 1YJIA 3HEJA 5KNDA 1EY4A 2VZKD 5G3LD 2Z1CA 3GO5A 2TSSA 4WAFA 5EKIA 1TWGB 2OHFA 4GDKB 1L0XB 1CZWA 5ELCA 1T3QA 2ONQA 1TWFB 3VR4A 4A3BB 1RYJA 1GOZA 1D5XC 2NTSA 3A55A 3OOCA 4L63B 3TEWA 3EA6A 3N6RA 1HPCA 2KJXA 2J52A 3NPPA 2QSDA 3U9OA 1ET9A 1II3A 2A68D 5EPLA 3AN1A 2F0PA 1TIID 3Q0AA 1VJKA 4TRDA 1Q8IA 3VA7A 3C46A 3KF8A 5CBAE 3MFGA 5I9PA 1DOYA 4L6TB 3RMHA 4J6HA 4XT1B 4C3IB 2FUG1 1I6HB 1FGBD 2Q8IB 3ABVB 2AQ2B 4KI0A 3PUYA 1E0BA 1HZ5A 3LXFA 3KBXA 3BIID 1H9JA 4NKLA 4KD3A 3MVVA 5EKKA 1QILA 3CRKC 2N88A 1ENAA 2WXOA 1N62A 3EQLC 1AZQA 4U68A 4BY7B 3FRPB 4YXDB 1A2UA 1IBXB 3VA5A 4ZOHC 1JWMD 1PRTB 1RHPA 2Q8TA 3NRZA 2K5WA 3I3CA 3T53B 5M3MB 4E6IA 4NAWB 4CGYB 2F3WA 3MFYA 1XO3A 3B2FA 1E6EB 2LGIA 3R8BA 2K22A 2F0GA 4HMJA 1PGBA 1STEA 2JA8B 3RZOB 3NTIA 2SNSA 2L12A 3HRDD 1WTRA 3CIRB 3MHBA 4OGQC 2K9XA 2FHTA 2KCNA 3DWQA 4BA1I 2FBWB 2OT2A 4CBVA 4EGVA 5E4WC 3QWNA 3B9JA 1OXSC 2WKDA 2L83A 1EY5A 1B9NA 1F2ZA 1FNUA 2QMTA 1PFDA 3E5SA 4PMWA 2L55A 2XVSA 5J22A 3QIAA 1CA5A 4N59A 4FF2A 1YNTE 4JWSC 2KMMA 2KEEA 3GTMB 5JEAG 2DWQA 1XLNA 2CW0C 1DXMA 2MHVA 1RM6C 1OXUA 3G7LA 1PTOF 4R8NA 1QNKA 2NVYB 3SFDB 1H9MA 4FO2A 5JEAH 4S3SA 2N9LA 4BBRB 2MPMA 1LV9A 1BO0A 3S14B 1HUNA 2GA4B 1ESRA 3KWVA 1NYQA 1XEEA 3H91A 4HKZE 4ZLTF 3QOLA 1JWBD 3SR6A 2YEPB 2XN9C 4KK7A 1BOSA 5KEEA 5CC4A 3TBIB 4ZHPA 4J1MA 3HG9A 1LTTD 3HVZA 3ZJUA 4CKEA 4A55A 2IJ0A 4NDXA 3NK9A 5C4ZA 1LABA 1D5MC 4DNTB 1O7ZA 4ZAIA 1L5PA 3FDTA 1G291 4QUCA 5HHDG 1TVXA 4KJOA 2WV6D 3LB8C 1C4CA 3AMUA 4OVZA 2HDMA 2N55A 3QO2A 2JU6X 3PV0A 1WWTA 2AX5A 3H3VC 3ZJTA 3DWPA 2G1EA 2B2VC 2QEJC 3NTHA 1QLBB 5FLXE 1JROA 2M0AA 1SNPA 2LJIA 3HOYB 5EJWA 2QF7A 4KKTA 3BDOA 3QG1A 4K8JA 1JOQA 5BN5A 5C3JB 4FXKC 4Q2JA 1EY8A 2BBCA 1TY2A 3N9YC 5AUKA 5C5MA 3VR8B 3AE4B 1CTMA 3UI2A 1EFID 5J1ZA 4FF1A 2EYOA 3I90A 1A6XA 4A3IB 4H7BA 2F0UA 1KLUD 2L11A 2VNUD 5IODA 3NUHB 4WWMA 3FEWX 1JWSD 1I7HA 3MJ5A 4V190 2A68C 4DN4M 2EPBA 5A2QE 1U4PA 3I70A 3Q8CA 1SYFA 2KUMA 1OXXK 3PIO3 4XQQA 2BT6A 4DF7A 3IAM1 1KNAA 1M8AA 2WAQB 5KNBA 5LL6S 1SEBD 4DNRB 2RBMA 1ROEA 3T56B 2X69A 2LY7A 3A8IE 3U9SA 1VMPA 3Q8AA 3HOUB 1XX8A 1FM0D 4RNAA 3CRLC 1GXDC 2K01A 1K50A 1Y8NB 2X38A 4XIGS 1WVLA 4ITKA 2WXJA 1SFOB 1EQTA 1RF2D 2VB3X 1QKZA 3PUZA 4FYDA 1CQVA 3S16B 3CQZB 2CQAA 4A3GB 3ETRA 5E4XA 2MH7A 4LK1C 2I38A 2EYLA 3AE5B 3A7LA 3DMUA 4YWGG 1TZOA 3V2TA 1A3TA 1VZ8A 2LEKA 2WXRA 4TQUS 4P6VF 4IUTA 3SR1A 1H9SB 3MA2B 4KX6B 1PRTC 4PNYA 4CJ2C 1IBXA 2ZW1A 2JQRB 1F9PA 1L4DB 3AE6B 2FJ2A 1S5ED 2MEKA 3V05A 2LHDA 1VLBA 1QOBA 2NZ1D 3E56A 3R93A 1IW7C 3TP8A 1I4PA 1TY0A 2ZXOA 3PUVA 5IGEA 3L7ZC 1IHZA 1BCPB 3DEPA 3VYSA 5JVG3 1Y1WB 1STYA 5D3DA 1G8ZD 4JK1C 1ZXIA 3BYYB 2WINB 3I57A 5C4XB 5EQ0A 1VZ6A 2WQYB 2IGDA 4N6EB 3EUB2 2R6GA 4Z9CB 1N5WA 1RTOA 4WIPA 1TWCB 5EE3A 4DA2A 1XLOA 1BR9A 3M3YB 4Q0FA 4HROA 3NXWA 5ISRA 1SAPA 4C80A 4K6DA 3T16A 2KOLA 4OO1H 2EJFC 3NE5B 3BK1A 1C79A 1K52A 4N9TA 2L1AA 4LJZC 1LT6D 2I2YA 4EQPA 4WJWA 1JCKB 3W5VB 5D14A 3J80E 1RTNA 4PT5A 1XF5L 1JQYD 1QG7A 1FYCA 2EOTA 2LS01 2BW2A 3M85A 4ARCA 1R4PB 1STHA 1KH0A 2O2LD 1TJEA 1C4PA 3I4MB 4M8AA 5LNK1 4OO1I 1RD9D 1EZ8A 2F0EA 2DBYA 4F87A 3D3RA 2NYZD 2PPBC 4IFDG 4RGTA 1L0YB 2IX0A 3CWIA 5CV8A 2XWJB 4KMUC 1JWAD 4C56C 3TUOA 2IDYA 3GTQB 4REZA 2WKCA 1WSPA 1QB5D 5CV9A 1A15A 3I4LA 1NR4A 4HRSA 2F0IA 1FNWA 1AZPA 1SDFA 1ESFA 2XRSD 3VR2A 1QOAA 3KLRA 2CW0D 4L2YA 2D5GA 1LO5D 2K04A 1N5XA 4IDIA 1C77A 4M1UB 3SHLA 5T8IA 5J39A 1HTLD 4F8MA 3PZ7A 3TMEA 1N63A 4TKOB 1AWDA 2K03A 3J81E 2M56B 3IAYA 4LLGM 1DJRD 5G3LF 1XYIA 1FFUA 4RAUC 3R3OA 2E3TA 5HFYA 2WS3B 2M2LA 1B9RA 4FXDA 5C5LA 3X3MA 1SYEA 3MXNA 3U4EG 4FP5D 3NHHA 1X32A 1UGJA 5DNFA 1YJJA 2HCIA 1SYCA 4RGNA 2V0GA 1J9OA 2X6GA 3A7AB 3H6MA 1JQ4A 1JW9D 2F03A 2MGSA 4B0EA 2MUYA 5IIFA 5EPKA 1VRAB 1KFYB 1KF6B 1NCVA 1STBA 1MHXA 4GDLB 3WOEA 3IL8A 1YMHE 1SNQA 2NN6G 3A56A 4X3TA 2PZWA 4N9PA 4C3HG 3TN2A 2Y5PA 4O42A 1DM0B 2AWNA 1FXAA 1I6VC 1KAAA 3WDNA 3ZYYX 1NAPA 5CMDA 1HXYD 1JB3A 3M4YA 2IX3A 1HRJA 3C1FA 1STGA 2BS3B 1IGCA 1VF7A 2WXGA 1T5XD 2JXMB 1MPEA 2GI9A 2MJ8A 3RFZB 1QOHA 4K5WA 5COYA 3NUCA 2RPVA 4YTPB 5FOBB 1Q10A 1B50A 3P4RB 1LTID 4QIWB 5F2DA 3NWTA 1HHVA 4YSYB 4ABNA 4UAIA 1ZYRC 3Q24A 2EELA 1ONLA 1H9KA 2WXIA 2C5CA 2EY1A 1YNNC 5KRUA 5FKAC 1D4BA 1KDAA 1ZKOA 4FVMA 4RGMA 1SXTA 1U4RA 1R4QB 3FPPA 4XDDA 1XCQL 3W3AA 3HP3A 2M9VA 4RCNA 4BS9A 2KQ4X 4JE3B 4X3UA 2JSOA 1SYGA 1LT3D 5C3XA 1WCMB 1LT5D 2K7VA 5EPJA 5FO8B 4H13C 1PDQA 1IYUA 1CZPA 4KKIA 5I2XA 3S1MB 2WACA 3GV6A 3ZGZA 4PMBA 2FE8A 2RVLA 2DNEA 4BBSB 1Y56A 1PZJD 3AECB 5TSSA 1BCPC 1DGJA 3BG3A 1WD0A 5I4DA 5JJZA 1JMLA 1O7LA 2N9KA 2L32A 1EM7A 4C3HB 1CHQD 3SK8A 4LTUA 2EYMA 4K8IA 3TDQA 4DGZA 2RSNA 4ULLA 1ET6A 3WCQA 2KQ3A 1RJTA 5D3IB 3URYA 2ON8A 1HUMA 4OIKA 3J9CA 3GS2A 1EU3A 3TP7A 4XTCS 1AW7A 2H4OA 1D5ZC 4G4KA 2IGHA 3AV8A 1GAQB 3J7AF 3KK7A 1F0ZA 1FEHA 4A9AA 5EKLA 1PRTD 5JEAJ 3D4DA 1CZGA 5FR3A 1MGSA 2PO4A 4IUNA 1X3PA 3FVQA 1J7AA 4G7HC 2G9HD 1DZ1A 2Y0SB 2B2UC 2K33A 4D2KA 2WU5B 2RDHA 2B2UA 2F0WA 3Q8FA 4MT5A 2LFIA 1PMRA 1IW7D 2LUMA 2Y5CA 4RWSC 4IALA 2ICEC 5C0XG 1PGXA 5A35A 2A69C 3RZDB 1C8CA 1B1ZA 1DCZA 1S5DD 2ZXRA 4ZRPA 1E7PB 4HSVA 4DAPA 1Z47A 1TS5A 1WD1A 2PMVA 4LK0M 2TMPA 3FILA 4RH6A 5C0XH 1LTBD 3DHQA 4G7OC 3AB9A 4C2MB 2F0LA 5M5WB 4KJNA 3E9SA 2L0CA 2DY7A 1MD2D 3HS0C 4OL7A 2J4XA 3H0GB 4ZRZA 4XYOA 4L1BA 2BDNA 2PW7A 5IGBA 3HRZC 1Y8OB 5ELBA 2JEBI 3MXPA 3DXJC 1DD2A 1CHPD 2MJDA 3HOVB 2XRQD 3ITPA 1SIJA 3AEGB 4ZQ3A 3OIQA 1HA5A 1RCVD 2W3RA 2IWHA 2PYKA 5HG2A 5C0XI 4TQ0A 2QILA 1ZOYB 2NVQB 2B8GA 4KY5A 3LWEA 5CV5A 3VYRA 4U673 1PFBA 4Q5VA 1N60A 5HGTA 4KGTA 4DK1A 1XXGA 4H0LC 1GJXA 2BB6A 3CHBD 3ND8A 1J8IA 4MHEA 1SNCA 4B0MA 2IL8A 4PMCA 3SFEB 4JPSA 5M9OA 3NVVA 4IUPA 2F1MA 2XIWA 3K5NA 1EIHA 2JWUA 5M5YB 1L6UA 1D6EC 3GTGB 5CR3A 1JICA 3OMCA 4LMQD 1C4AA 1DOMA 1FCLA 1XLPA 2LMCB 3PO2B 4YSZB 1V1PB 1A3UA 1VMCA 1BDOA 4OZAA 5ELDA 3BVMA 4K2LA 3MC0B 1EWHA 1IKLA 1B53A 2BTEA 1V43A 4XT3B 3SXHA 1FIQA 1IGDA 1MI0A 1YN4A 3IT4B 5JXVA 2R61A 2DY8A 1YQ4B 2B2VA 2DNCA 2F0DA 1MSGA 1A2TA 3IFDA 3KUPA 2B2YC 4XWTA 1R7SA 1LACA 2PZUA 1TR5A 1PZID 5AFWA 3H94A 1ZDVA 4YTNB 1JOKA 1EOTA 3M7NA 3NQIA 4HCEA 1NR2A 2BS2B 1KABA 4F88A 4FXGC 5LHY1 2B2TC 3AE8B 1BBXC 1RWSA 3S2DB 3BDCA 5JAVA 5LL6X 5IGFA 1K8OA 1CFMA 2F0SA 3PO3B 2PTLA 2H88B 1TKYA 2PNRC 4IOIE 4RFBA 1T5EA 4MH8A 4LAAA 1OXVA 3Q69A 3N52A 1BXTA 1E10A 1JE4A 1WGKA 4ZKBB 5I6WA 1SSOA 1XLQA 2X6LA 4KV6A 3GB1A 3ZQ4A 1T6BX 4ZK9B 3C1EA 4HCSA 1BUVT 4NJCA 1I4GA 1C48A 1EQVA 5GXGB 2GB1A 2OXPA 2RA4A 3A8JE 4WORA 4DAYA 1I50B 2PLPA 1GPXA 1VR9A 3TZDA 1FRRA 1OXTA 2CHBD 1GUWA 2F4IA 1HFNA 1SBBB 3FAHA 2BA1A 1QWYA 3VR3A 4J3OD 2AQ1B 2RQXA 1N61A 1O80A 2RMMA 4RHSA 3L4PA 1BQQT 1HFGA 3K5MA 1MBYA 5FK9C 4QF4A 5KYIA 2KWDA 3ND9A 2JSVX 4KN7C 4MM3B 1QNUA 4F7XA 2CJNA 1PYWD 3W2DA 3P42A 5BYSA 1ZYRD 4CJ1B 2INNE 1CK1A 3MP9A 5AUIA 4HAEA 2PKOA 4US9A 4B08A 3SEBA 1G6ZA 1DYQA 1TQOA 3OMGA 2QCPX 4M0WA 1YNND 3MWYW 3VQIA 2SEBD 2BCOA 2WIIB 3GQBA 2K3UA 2PVGC 4RHRA 1B4OA 2J0TD 3DM1A 1FFVA 5MPOA 2H1EA 3NQTA 2J42A 4B9XA 1I4HA 4G57A 3S2HB 1M4VA 3D6WA 1A70A 1DOIA 1Z7TA 3O13A 1STNA 1STAA 1TYGB 5IGDA 3K59A 5EBCA 1E0ZA 4AYBB 2KECA 4FF4A 1SMYC 3PIP3 3VRAB 2BDOA 1BF4A 5BMGA 3P7JA 1AEXA 4NAMA 2W82A 4WH4A 2OEOA 3JAML 3D6CA 1JRPA 3OWEB 2CJOA 4RKLA 3SDZA 5ELFA 1BCPD 2IT1A 4A3KB 4PV1C 3OSOA 2OEDA 5E3FA 4FXCA 2L5TA 2D9UA 3NSWA 4QB4A 1F9RA 1P7FA 4AS1A 2A6ED 1TS2A 3R2IA 3MZ5A 1PZKD 2F0MA 2A5HA 2A73B 4DXFA 4BWGB 3HOWB 3LNNA 1E9MA 4GLSC 2BB5A 5IT9L 5IGCA 2GRIA 1LT4D 2VXWA 1XCTL 1FR3A 1Y69U 2NWGA 2WP9B 4US8A 1HEZE 4ODGA 1D2BA 4A6QA 2NTTA 2K5PA 2XSCA 4XXEA 2KAJA 4C7ZA