4DXGA

Crystal structure of staphylococcal superantigen-like protein 4 complexed with sialyl lewis x
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
194
structure length
194
Chain Sequence
b'EINPKFKDLRAYYTKPSLEFKNEIGIILKKWTTIRFMNVVPDYFIYKIALVGKDDKKYGEGVHRNVDVFVVLEENNYNLEKYSVGGITKSNSKKVDHKAGVRITKEDNKGTISHDVSEFKITKEQISLKELDFKLRKQLIEKNNLYGNVGSGKIVIKMKNGGKYTFELHKKLQENRMADVIDGTNIDNIEVNIK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Staphylococcal enterotoxin-like toxin
publication title Structural and functional properties of staphylococcal superantigen-like protein 4
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Sugar binding protein
total genus 52
structure length 194
sequence length 194
ec nomenclature
pdb deposition date 2012-02-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02876 Stap_Strp_tox_C Staphylococcal/Streptococcal toxin, beta-grasp domain
A PF09199 SSL_OB Staphylococcal superantigen-like OB-fold domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.110 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 4dxgA02
3.10.20.120 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 4dxgA01
3TSSA 3BVGA 4L63B 3DWAA 1EWCA 1CHPD 3EFXD 1PTOC 1PTOB 1TS4A 2XRSD 1RDPD 1YN3A 1I4QA 1GOZA 1SJHD 4TSSA 2SEBD 1BCPC 1STEA 1LTTD 1TS2A 2WV6D 1JR0D 1HXYD 2J4XA 3O13A 3R2IA 1SEBD 1I4GA 1LT6D 1QILA 1CK1A 5I4DA 1ET9A 1I4HA 2QEJC 3BYYB 1PRTB 1CHQD 1SXTA 2Z8LA 3MFGA 1PRTD 2CHBD 1ET6A 3BVMA 1KTKA 1L0XB 2R61A 5ELEA 4BWGB 5ELDA 1TS3A 1SE3A 3R8BA 1EFID 1ENFA 4NZLB 4L6TB 1FD7D 1EU3A 1D5ZC 1PTOF 2AQ2B 3MC0B 5FKAC 4Z9CB 1HQRD 1G8ZD 1I4XA 4OHJA 5ELFA 3GP7A 1UNSA 2XNAC 1LO5D 1AN8A 1LTSD 1BCPF 4O1NA 1HTLD 1FGBD 1PRTC 1M4VA 1SJED 1JWUD 2NTSA 4DXFA 3EA6A 1B44D 1LLRD 2G9HD 1LT4D 1V1PB 1LT5D 1JQYD 3R2TA 1BXTA 1F77A 2O2LD 1JCKB 4RH6A 2XN9C 5TSSA 1EEFD 1L0YB 1I4RA 1PZID 1S5DD 3DWQA 1EU4A 3URYA 1YN5A 1SE2A 1I4PA 2QILA 1TS5A 2RDHA 1HA5A 2TSSA 1T5XD 2NTTA 1DJRD 1DYQA 4RGMA 2AQ3B 4ZYSA 2RDGA 3SEBA 1RD9D 1EEID 1KLGD 1S5ED 1D5MC 1LTBD 5D3IB 5D3DA 1JWMD 4C56C 3CHBD 1LT3D 1FNWA 1PTOH 1YN4A 1RF2D 1PRTF 1LTRD 1PZKD 1V1OA 3V05A 2IJ0A 1RCVD 2AQ1B 3KLSX 3W2DA 4RCOA 2XRQD 4RGTA 1LTAD 3BVZA 1PYWD 1S5CD 2ICIA 1V1PA 1TY0A 1PTOD 1TY2A 1AW7A 1SBBB 1S5BD 5ELCA 5ELBA 3BYTB 4K6LA 1XXGA 1LTGD 1D5XC 1BCPB 1LTID 1PZJD 1CT1D 4RHSA 1BCPD 1S5FD 1D6EC 4RGOS 4RHRA 1KLUD 1CQVA 1JWSD 4RFBA 1UUPA 3OWEB 1XTCD 5FK9C 1FNUA 1ESFA 1SE4A 4UDUC 4RGNA 1MD2D 4DXGA 2IPKD 1B1ZA 3BZDB 1FNVA 3DWPA
chains in the Genus database with same CATH superfamily
4A3GG 3BVGA 4MN3A 3EUB2 3NK9A 4PMBA 1TZOA 2L1BA 3FMCA 1I3QB 1QVCA 4UP8A 2XRSD 1YX5B 3PO2G 1MHHE 2L3ZA 3F8TA 3R66C 1KIXA 2XWJB 2IGGA 4K5VA 2D9UA 4G7HC 1GUAB 2PMZB 3X3MA 4JBKA 1WGRA 1MGSA 3TP7A 3VUYA 1HXYD 2J4XA 4N8FA 3PSIA 2MQJA 2ID0A 3NUCA 2NN6G 3Q22A 3QARA 4ZYNA 4J8QA 1YHQA 3RULA 4W9CA 3T4AC 1SNMA 5GROA 3UF8A 5M5WB 4ILWA 5ELEA 3SK4A 3RLFA 2DNEA 5IOCA 2IGDA 3T8MA 1X3EA 2BS4B 3SK5A 4F7XA 1WTRA 4HDQA 5E6OA 3DVGX 1PTOF 2LGSA 5IP7G 4LWCA 4YT0B 4LFAQ 3CRKC 5IGBA 1V43A 4JX1C 5CBAE 3IRBA 2JN4A 1LM0A 3OTOL 4A3EH 1RFKA 4GGQA 3QQ8B 5F2DA 1S40A 4KKJA 4CBVA 4ACFA 1JWUD 4FF3A 2R93H 2A5UA 3OW7A 1TKYA 4WQOB 2KBNA 1VQ6A 1HTOA 1LT4D 3S2HB 1F2LA 2J42A 2O2LD 2LUEA 4REZA 3S24A 1MPEA 1NNXA 3X0WA 3Q2AC 1JICA 2JPHA 2K28A 5M5XH 2A6EC 1S5DD 1A3VA 4LMQD 3PO3B 3KYCD 3D4RA 1E5WA 4RNAA 3UDXA 2DZKA 4XZ4A 1VDVA 2PNHA 4PZ7A 4KSLC 3D8GA 3K9OB 4EQNA 3OOCA 2OJWA 5BYRA 2K33A 3QAQA 1WD0A 1PH7A 4EE2A 1SFOH 2NPTB 1BDOA 1VQJA 2H88B 3AM9A 4I6NB 2UXBQ 2LXCA 4JI8Q 4K5XA 2QSDA 4IG7B 5BYQA 1YNTE 1QCBD 3EJIA 4PT5A 3K0XA 2NVYH 4A3MB 2FINB 4L5TA 4K2KA 1RF2D 3KFUA 2MH7A 3I57A 2J53A 4P2CB 4BY1B 2Z4HA 5FLXL 2EYMA 2Z9HA 1NUCA 2KLCA 2ZEQA 3GE3C 1SN8A 2ATWA 2JF5A 2L7RA 2KDFB 4DR7Q 4ME3A 3N52A 1EFWA 4RM9A 4RMFA 3U4ZA 1A62A 5ELCA 2M17A 2WXLA 4II3B 1HTPA 4LDTD 1C8CA 2GBJA 3MAQA 1ZDVA 1PH4A 2DYBA 1F2MA 1JB7A 5BR8L 3CCVA 4RMAA 4IQZA 2IYDB 5A2QE 2INCC 1RRBA 3RN2A 2W82A 4HROA 4K81A 3PLUA 3ZYYX 3UDGA 2F0KA 5IY0A 1HZCA 1C0AA 2QIEB 2WQYB 3QHTA 4BKSD 5C5LA 2PVOD 2BOSA 1N33Q 5HGTA 4DXGA 2EKIA 4JBWA 2F03A 4DV5Q 1V5TA 3BINA 4GU2A 4XT1B 2EY5A 2KJ6A 3OYYA 3Q8DA 4MTNA 3RZFA 1TVXA 3I4NH 2EPBA 2HDMA 2V0GA 3EROA 2OT2A 1P8LA 1TGZB 4IOCA 4WRDA 3JAME 4LDTB 3PZDA 2PKOA 1X65A 2HUGA 1RJTA 1JMCA 4A3BB 4AIMA 4JYAQ 2K75A 4FVMA 2NN6I 2HJ8A 2YLMA 4L5RC 1A2TA 3W5VB 2ZT9C 1YQ3B 1RAXA 5J18A 3RZDH 3UE0A 1HNWL 1LQBA 1MJCA 3JYUA 5FJ8G 2ICEC 3S1NB 2MW5A 3S16H 3N1XC 2Z8LA 3G6EA 3HM6X 3CP0A 3B0AA 4POFA 2IZVB 1K50A 3ABVB 1QNUA 1V8CA 2K03A 1AE3A 4DUYL 1EY7A 2R61A 1WVLA 2B2WC 2IO2B 3OG5A 5ELDA 1ZEQX 4NXML 5I2XA 4R8NA 1SNPA 3S9WA 3HUIA 3PIO3 1F9JA 1EFID 2LFNA 1QVGA 1STNA 1MSGA 2G9DA 1PHJA 4OZAA 1PGAA 3RZOB 3U2SC 3TMPB 2EYPA 2F0MA 1X32A 2G5DA 3RR5A 2A74C 2H89B 2F0GA 4DAMA 4B08A 2F0PA 2JA7B 2DGYA 3HKZE 1TXYA 5CR3A 4C3HB 5LL6S 1B8AA 5HURA 4X64Q 4C7YA 4FJZA 5G2NA 2KCCA 4ZUJA 5EAYA 1VQ4A 3DBRI 1IW7D 4DBGA 4DXFA 4DFAA 3ML8A 3R7QA 3EA6A 2N7DA 1WJ6A 4HCSA 1AZQA 3ZIMA 1V1PB 1JQYD 3GTQB 1FRRA 1NVID 4MH0E 1QKZA 4DR5Q 4RH6A 1K9MC 2JUOA 4XYOA 5IT9c 2YU9B 1KNAA 3U7ZA 1QF6A 2AX5A 4IOIE 1GUNA 1PZID 4EX5A 3T16A 2DY7A 3ZO5B 3HOZB 1EO6A 3EN2A 3F2CA 2NTTA 1DYQA 4O2DA 4BY7H 4OWTB 1MJEA 1TKGA 2A6HD 2RDGA 3PGZA 1PH1A 1DOLA 1VQEA 4DHJB 4R4QA 1O7IA 1HPCA 4XDXA 2I2YA 3K59A 1ZXHA 3ONAB 4LFCL 1LT3D 5T8IA 4MGZE 3H0GH 1PH9A 5DPRA 3DEOA 2HTME 3TDQA 1YNJC 3W2DA 2ZNVC 2VQFL 5LXIB 4APVA 3PO3G 1P1AA 1ZGUB 2NWGA 1ZW7A 3DHGC 4XWTA 1OO9B 1EQRA 2K39A 2Y3AA 3VDZA 2BA1A 2XWBB 1AE2A 4IPGA 4OXPA 4A3IB 1M90C 1V80A 3UI3A 2ONQA 4LNKA 1FPYA 4KZ0A 2K5WA 3PUVA 4A3KH 3ZRFA 5IA7A 4NJ7A 2JA9A 2PZTA 2X69A 3OIQA 4C1NK 2BB6A 4A3MG 2ZJRA 2Q8IB 4DDGD 2IY0B 1NMFA 3NELA 1SYGA 3D4WA 4BY1G 1TKWB 1B1ZA 3N3KB 3NWTA 1FNVA 3LWEA 4OIJA 4OONA 1Y8PB 4RKLA 5KIXA 4HJ9A 5DNFA 3S1QH 4GDLA 5JJLA 4KSKC 4TQUS 3NVYA 2I0QA 2RA4A 1XT9B 1WJJA 4S3SA 1EWCA 4UHVA 1Y1VH 2PNRC 1WGKA 4M01A 4FA6A 3PF4A 2BE5C 2EZVA 2B76B 2MUYA 2NBUA 2R2QA 5E7NA 1WMHA 1KC8C 3J80i 1UZXB 1XLOA 1J8CA 3Q8EA 4WJNA 5G5HA 2Z0SA 1IBLQ 2E3TA 4QMGA 3U58A 4MH8A 3DHIC 2Y5CA 4OGQC 2BVCA 5CC4A 1J19A 1S1QB 1ZXIA 3CCEA 3PIP3 3ZNID 4H0LC 3SD5A 3VUXA 1PRTB 1CHQD 3NBHB 3IFTA 4K5WA 2R7ZB 1FM0D 2NB0A 3TMEA 2KX3A 2NVTB 5G3LD 3TBIB 4DNRB 3MTNB 3K6OA 2IW3A 4A3DB 5GXGB 4K7UA 1VLBA 2ZJPA 1E7ZA 1IYUA 3OMCA 1GJXA 4FN2A 3E9IA 3J80L 2L32A 1F0ZA 1QWYA 3R8BA 1TKEA 4A3BG 4TVAB 1AARA 1FD7D 2N3SA 5LMUQ 3MC0B 5DCNA 4K8JA 1T3QA 1DM0B 2E74C 3KQ4A 1A15A 1I42A 2EVBA 1F2ZA 5BO4B 1BBXC 4YWGG 5C0XJ 1TWFB 2EIFA 3M3YB 5EPJA 4A6QA 3UI2A 4GOPB 4ANXA 5C4XH 3MFYA 2G45B 1VJKA 2M56B 2R92H 2O2VB 4XQNA 4OW0A 3SHLA 4V190 3PS6A 1U5KA 1WM3A 1LLRD 3S2DH 4DR1Q 4ZK9B 4WWOA 1CA5A 2PJHA 4ZCKA 4OX9L 1IPGA 4PS3A 3PF5A 4WIPA 3HRDD 1HQMC 3MTSA 4LAAA 1IBKQ 1L1OB 4LF8Q 2MJEA 2IHFA 3L4PA 1WRDB 1I4PA 3OSOA 4DR6Q 2XBBC 1CI3M 2SNMA 1ILPA 4C2MB 3Q6SA 2V1CC 1BKBA 1W2BA 4JI7Q 4GKKQ 3PRZA 2EDGA 2JA7G 3CCLA 4XQJA 4LNOA 1GUSA 4C3HG 2JWUA 1AYFA 1I6HH 5EE9A 4FXDA 4HXDA 4HLEA 2K50A 5LHY1 3STBD 1SDFA 1ASZA 2Y5PA 3AV8A 3PQIA 1S5ED 3TEHB 4KTAA 3CF6E 1XMQQ 1JOQA 1JWMD 4W9GA 4C56C 1RLFA 1PTOH 3H94A 3RCZA 3RNBC 2BGFA 4UAIA 5I9PA 2K14A 2G1EA 3NVZA 2IJ0A 1WX8A 2M4NA 2L0CA 1CKMA 4GLVB 4JBJA 3VYRA 4HAEA 3IL8A 2XRQD 4ZKBB 1N60A 5JEAH 1N6ZA 2O6VB 2V4IB 2B2TC 4IWPA 3Q8CA 2L5TA 1CFMA 3HOZG 1E7PB 1AW7A 4DV3Q 4XX5A 3SHQA 3M9BA 3VH3B 3KLWA 2B39A 2DYMA 3DBSA 2FMCA 1HH2P 2VH2A 3N1ZC 1M1KC 3HM3A 3VTVA 2MBBB 3TN2A 5I2YA 1K8GA 2M2LA 4A3CG 1B9RA 1E0BA 4IUVA 5FK9C 3SK8A 5G55A 2NYZD 3PZ7A 2GLSA 2VXWA 5IYBH 1ENCA 4A9AA 2AKWB 3G4SA 4JI6Q 3S1MB 3N30A 1XJVA 4ODGA 4A93H 4KY5A 2QCPX 3TP8A 3H15A 2J0MA 3KUPA 4IUMB 4WURA 3MZ5A 1QB5D 3PPAA 2LGIA 3TP5A 4XWWA 2K5VA 3PIOA 3P75A 4ZLTF 4L1BA 5KNDA 4DR3L 2FCQA 5DPWA 4WJWA 4A3IG 3B2GA 4K0KQ 4AUQC 2PMZE 4KMUC 2K8HA 2B2TA 3AMZA 4NP5A 4WJ3M 3PGEA 3R2IA 2D3BA 1ET9A 1WYGA 4NPNA 3VR4A 3EECA 4C3JH 1SXTA 2ZJQA 2LJIA 1QOBA 4PZ6A 3K5NA 1XMOL 1JE5A 4HSPA 3RLOA 2F0QA 3ONSA 2D3GA 5IGEA 3E9HA 1HRJA 3DHHC 1BF4A 4BFRA 1KTKA 1B9MA 2JA8H 1TS3A 2OTJA 1IKMA 4TKOB 4DV0Q 4KKIA 2LVOA 2WGSA 5M3MH 3FILB 2DYOA 3CWIA 2A6ED 2ZVNA 2J7QB 2LRUA 4HDOA 2VZAA 1NSNS 4MNOA 4DGZA 2FXQA 4H13C 2JA6G 3SR1A 3D3RA 3TRZA 1OEYJ 3ZTDA 2BTEA 3Q23A 1PFNA 3T13A 4YHHL 4PK1A 1EQTA 2LMCA 4ULLA 3KF8A 2R7ZG 1ZE3D 2DZMA 4QGUA 4A3GH 5HFYA 3KDFB 2CQAA 4XDCA 3JAMc 3GTLH 3HP3A 2JQOA 4A3DG 1M94A 2BT6A 2LHDA 1J7BA 3PO2H 4IFDH 2XN9C 3KYHC 2NVXB 4OL7A 3TS0A 3CAMA 3H7PA 2GA4B 4MGIE 4J1MA 4KHPQ 2CHZA 5CTRC 1C77A 2WXRA 5IYCG 3HOUB 2FIDA 3AMUA 1VCIA 4FXGC 1T9HA 1XNRL 3TL5A 1J5EQ 4FULA 2MP1A 2NN6H 2ON8A 2O4XA 3EC8A 1VMCA 2W3SA 2ZCCA 1P7FA 1EIFA 3NVVA 4J3OD 4IUPA 3K81C 3A4RA 2E8GA 1HCZA 1NE3A 1UWVA 4XTCS 2YVCA 4B95A 1YEZA 1RL2A 5IWAQ 1CKNA 3C2PA 1DGSA 1J9OA 1WJ4A 1EL0A 3V2TA 1E3PA 1WYWB 2KXJA 4I6LB 4X66Q 4EOYA 4OVZA 3J7ZC 2LGDA 1CSPA 2CU1A 2KAJA 1SMXA 3DM3A 4DHZB 2MFIA 4RG1A 4DV1L 3TJPA 3LYYA 4X3SA 1WGHA 3H3VI 2KDEB 2RR9A 2BBCA 4LNNA 5K5PA 1WD1A 3L13A 4GLSC 2KHJA 3MXNA 3TSSA 2Y5BB 1R9TB 1VQMA 4JI2L 1JE4A 3ULJA 2Q2UA 2CWAA 2NVQB 2JYTA 5CGKA 2F0VA 5EPKA 4MT5A 3H3VC 5IIFA 3M7NA 3NTHA 2PCFB 1CQFA 1QOAA 3UIOB 1C1YB 2DENB 3AB9A 5C23A 1FXAA 3DVNU 4ZRKA 4DDID 3D0FA 3K9PB 2EOTA 2NZ1D 2FMMA 3ERQA 3S15B 3A54A 1D3ZA 4C3IH 1SYFA 3HZXA 4GN1A 2ZM6L 2EQSA 1HNZQ 1PH3A 4KGSA 5M5YB 4AP4C 5IT9L 4DV7L 1EM7A 1AWDA 3K5OA 3EBEA 4DUZL 4HCEA 3ECIA 1D5ZC 2LZ6A 4JPBW 4Z9CB 4LTUA 4DV2Q 5EKKA 2OOBB 1HQRD 2GRIA 1TIID 5C0XG 2XNAC 5C3EB 1ACCA 4B3TQ 3M62B 1RWSA 2D10A 3CKIB 1NMGA 3VTUA 1VR9A 4B3RQ 3PREA 1GNUA 1PRTC 4WAFA 4CKEA 5FOBB 1GUOA 1UF0A 1KRTA 2QDFA 3WIMA 1GM5A 4CJ2C 3KOJA 2RBMA 3A5ZB 3M4YA 2JQRB 3R2TA 3L10B 3N9YC 4GIVA 1O7YA 3RUIB 4A55A 1G291 5TSSA 1HZ5A 2BDOA 1L0YB 4A3FB 5L95C 1YNJD 3GTKH 1Y69U 2LKVA 2OWOA 1WJUA 1Y8RC 1T5XD 5HY6A 1WE7A 1FO4A 1SNCA 3NTKA 4RGMA 5FJ8H 2A1AA 2KTFA 5JXVA 1G6ZA 2WB1B 1EF1A 4GOPC 1WI0A 5LL6X 1K0SA 3MWYW 1VF5C 1OFFA 4GDLB 3NWSA 1D5MC 4CDDC 1DOMA 4GN4B 4YCWA 1LV9A 4JI3Q 3NRZA 2JWZA 1FNWA 1I3QH 1JJCB 2R6GA 2K6DB 2WXQA 1SNDA 4LF5Q 1LTRD 5G3LF 4U673 1LACA 3KF6A 3EHVA 2ZNVB 2DJGC 4YY3Q 1W6KA 2K25A 3WWVA 3W9CB 1L2NA 1UELA 2KACA 1L1OC 4RWSC 3HOUG 2XSCA 1S5BD 2BE5D 2K5QA 2MHVA 1T0YA 3R3OA 3AU7A 4B6WA 5HGQA 3V6EB 4DR4L 4C00A 1I35A 3PUWA 3N6RA 4DXAB 2UUCL 5KHQA 2QMTA 2KCNA 2WAQB 2JEAI 2EYHA 1KD1C 1XD3B 3TZUA 2N7JA 4WFN3 3JW0X 4JQWC 3W1GA 1G2SA 3G71A 3TEXA 1XTCD 3PZ8A 4WJOA 2DNFA 4Y7NB 4XXEA 4J6HA 1ESRA 5H1SE 2DN8A 3MA2B 3W5OA 3PTFC 3OPOA 4JBMA 1R4PB 4NKLA 2DNCA 2C7NB 3AFPA 2O2VA 3I63C 2AL3A 4IN3A 1VQ5A 1F1HA 4P72A 2HDEA 1E7VA 2JRHA 3WDNA 1I94Q 3DVGY 3EFXD 3I5JC 3FC4A 3Q69A 2RCFA 2KFKA 3U7DA 5T1GA 3GTMB 1GOZA 1OXUA 1STBA 3LGJA 1VRAB 3K8AA 2M19A 2WX0A 2FCMA 4IJHA 1JR0D 2F0NA 4DV4Q 1PXUA 2I5MX 1L1OA 3S2HH 2A68C 1JMLA 1YMHE 3B1LX 4TKNA 5C2TB 3UGBB 5CYUA 5CORA 3WCQA 3BYYB 4AWJA 2N55A 4MACA 5HKHA 2CHXA 3MFGA 2LWPA 3PO3H 1ZOYB 2DZJA 1EOVA 1IGCA 4OVUA 3HFZB 1TWAB 3RI7C 4AQYL 1EWHA 1V6EA 3LWUA 2MBQA 1TWHB 4H7BA 5C0XI 2VS1A 3MXUA 1SE3A 1QZHA 2KQ3A 2GOWA 4XYCA 4LF7L 4NZLB 1TR5A 2WXKA 4IWQA 4XYQA 3J7AF 2E2HB 4XDDA 2RF4A 1E2WA 1NAPA 1VQ8A 2JA5B 1A5RA 2OXPA 4A3MH 1UNSA 2O6VA 2KCMA 3AECB 3ALBA 4G3XB 3EIVA 4BY1H 2A19A 2N9EB 1F9SA 3SFEB 4X3TA 1T0RC 1A63A 3C46A 1WTVA 1JJGA 1NTGA 1Z5SB 1LM8B 1NBWA 4ZAIA 1O7ZA 1F2YA 3VYTA 2E2JB 2KANA 2LS01 2K6AA 1UGMA 4YCUA 2MPMA 2E5LQ 3S14B 1NDDA 3UINB 2NS5A 3NZSA 1XQQA 1U4MA 1J6QA 3CMEA 4M1UB 3P1MA 2M8SA 1Q46A 1SNOA 2UXCL 5C4JB 2WXJA 2L76A 1ZKOA 3T1HQ 1NYQA 3AE1B 1SB3C 5C3EG 3ZDMC 4LF6Q 1GC7A 1UBIA 1KAWA 4FJVB 3DPDA 2PW5A 4L5QA 4WORA 2PZUA 1V81A 2UU7A 1MSHA 2ALYB 2M0AA 1FCLA 1WE6A 5I9OA 3RT3B 4BOZB 2BYTA 2HCIA 4JPSA 2JY6A 3AU4A 3ZGZA 3H8HA 1UEAB 1PZKD 3I2ZA 1KH0A 2CVRA 4A3BH 2C5LC 3VA7A 2LGXA 2X6GA 4A3FG 1SNQA 1YJ9A 4WJ4A 1NI2A 3AEFB 2X8XX 1IZ6A 2HQEA 3F2UA 1C78A 4HIMA 3BVZA 4GXBA 1GUGA 4B9XA 2OHFA 1Y1WH 2NBFA 1TY2A 1A6XA 3E6ZX 3ER0A 5EPLA 1XXGA 3A1QA 1YJJA 4QY7A 2WB1G 1LTID 1PZJD 3R93A 1VCBA 4ID6A 5CV4A 5KRUA 2UU9Q 1B4OA 4N8X1 1CJEA 2HD5B 3FILA 1BBUA 5J22A 4TQ0A 4IUTA 5GQOA 3IHPC 1MJDA 2FBWB 4G0NB 1Q8KA 4NDXA 2Z1CA 4YWLA 2BB5A 1JB3A 1FGUA 1Z6HA 2PQAA 3PV0A 3MEHA 3HOVH 4CKCA 2JVCA 3RZOH 3JAMi 3E9SA 1KQSA 3GTPH 2MBOA 3AEBB 3KDFA 3H91A 3CC7A 1YBYA 4LF4L 2JA7H 4NXNL 1JORA 4TUUA 4C3HH 5M3FH 4HIKA 2LMCB 2AUKA 3AYHB 2M00A 2N88A 5IE8A 2F52A 2I5HA 5FO9B 4OO1G 3KF8B 3OTOQ 1NENB 2WXPA 2B8FA 2WAQG 1HUNA 1SYDA 1T5EA 1SYEA 3GTQH 3I4MB 5I6WA 2L12A 1XEEA 5I4DA 2QEJC 1WRIA 4HCNB 4V0BA 3JAML 4LCDE 3H7PB 2CHBD 1JOOA 4EZLA 2F4IA 4IALA 4YCVA 3HOZH 5GMVA 5EE0A 3HOYB 1U4LA 3A74A 1NJIC 1L0XB 4IPDA 4LFBL 4BBNC 4IURA 1R4NB 3JSVA 2J0JA 2JXXA 3P1HA 3QG1A 1EYCA 3MEFA 2DJFC 3KJOA 4A76A 1C4PA 4A3CH 1LXDA 1SYBA 2WDRB 3Q6BA 2QGQA 3KYDD 1G8ZD 5AJ3L 5FR3A 4DN4M 3K0YA 3DVNV 4W9FA 4EUTA 1CSQA 3B08A 4AH6A 4QUFA 2LVQA 4LF9L 1PVOA 1MI0A 4KZCA 1HTLD 4YTMB 1C3TA 5IYDH 2QDBA 1E7UA 4NAMA 1U4AA 1FD6A 1CKNB 5EBDA 5G5GA 3IVFA 1UAPA 1GXDC 3SE0A 2WYQA 1A2UA 3GV3A 3VYSA 4CO7A 1XNQL 4DAYB 4K3CA 2WXHA 2JX5A 4GZYC 2I1KA 1TJEA 1VF7A 3QIAA 1N32L 2R93B 1XLPA 2ZTDA 2YYZA 4HJ8A 3T1YL 2AYOB 1HZBA 3SDZA 2TSSA 2JA5G 4P1BC 1L6UA 4RAUC 3V60A 2B2VC 4P73A 1KRHA 3ITPA 2MA9B 3GZNB 2YEPB 3DBLB 5IO9A 2WXOA 2FAZA 4GSWA 4IM3A 4EZKA 5HHDG 3I8ZA 3AH7A 3P4PB 2Q5WD 4DHJD 1PV4A 4NQKE 3MXNB 2K1FA 3J9CA 2I38A 4PQXA 4BBRB 2A73B 2KOLA 2MP2A 3RMKC 1WCMB 1L2FA 1WI5A 4PS7A 2K3UA 1D2BA 1IYVA 1OEYA 1OQYA 1HZ9A 3ZW3A 2IDYA 4A4IA 1LABA 2NVYB 3M85A 3FAHA 4DF7A 4GNXB 2MHJA 1TY0A 3J81c 3I3CA 2MO0A 5CMDA 2UUAL 1EY6A 2YTXA 2R7ZH 3DUZA 1HNWQ 5L37A 2O5JC 4KIKA 2NVTH 1OTRB 5FLMG 3ML9A 5JZEB 4A3DH 4C4VB 1SYCA 3VR9B 2M1MA 4PS8A 4DNTB 4DHZE 1KLUD 1YQ4B 3L2PA 2MJDA 1RODA 3HKSA 1WXAA 2HQLA 1JJ2A 4DUYQ 2B2VA 2OF1A 2K32A 1PFDA 2V4LA 2BF8B 3APCA 4HEA1 3AEAB 3U52E 1RTOA 3Q24A 4DV6L 3SR6A 1WTHA 5HG2A 1JW9D 2BPSA 4OO1I 3IAYA 4MSQB 3VRAB 2K1BA 3CQZB 3GTGB 5IYCH 2ZW1A 1U9RA 2F0WA 2XGTA 1TWFH 5EKIA 1ILQA 5CV6A 2RD0A 3D32A 4B9WA 1QVFA 5HI1A 3T3OA 3CXCA 3NG0A 2BKFA 4MELA 1YN3A 2SEBD 5IP9G 2RPQA 3IBEA 2L0FA 3GTOH 2WXFA 1STHA 3MHBA 2KJHB 3PMFA 3H6NA 2CWPA 2WKCA 2L1AA 3P63A 3NTIA 4IUNA 1B50A 2JEBI 5CV8A 4A3JB 3OWFA 1PRTD 5E6PA 1MHWC 1STAA 1P7EA 3RZDB 4HJAA 3FKYA 4RF1A 4C2MH 3WALA 5FO8B 3BDOA 4KHVA 5KEEA 2PE9A 1HJPA 4ZRQA 4MJSA 2CFMA 2MBEA 3CPWA 3A7AB 1DOYA 3WOEA 3WA0A 3M95A 2NBVB 3GTJH 4JI5Q 3ZJUA 4BBSB 2ZPYA 2INDC 4NNJB 1SROA 3I4MG 5EE1A 1WZ0A 2JA6B 4LFCQ 1NY4A 1LYLA 2JSOA 4MDKE 1IBML 3D4DA 1N36L 3KF6B 1E6EB 4ZOHC 3M4QA 2AWTA 2VQFQ 2LJ5A 1R4MB 2K05A 4IM2A 3HOYG 5IGFA 2D3AA 2J0TD 1F77A 5IGGA 2G3QB 2WXIA 3FVQA 1VQHA 3C3LA 2VB3X 1VQKA 1GKHA 1H9RA 2KC2A 2FIFA 3P4SB 2VQEL 2UXDL 4P7IA 2IX1A 1T0SC 4KGTA 4KV6A 1XYIA 3KLSA 2C7HA 3O65B 2A5HA 3V62A 2IGHA 4W9DA 1VQNA 5EBCA 3S1MH 4DR2L 1UE6A 2RSOA 2WB1E 1LUZA 4W9IA 2LSSA 4KKUA 2K4KA 3ZKJC 4ZRIA 2CH4W 3C1FA 1V5OA 1EIYB 1YQBA 4HPPA 5DPTA 2IT1A 3C19A 1VQFA 1LTBD 2DUDA 2WACA 3X3NA 1HHVA 4B0EA 3I70A 2PYKA 4IZ8A 1Q3LA 2LI5A 3LB8C 2KFKB 4OWWB 4RKBA 2D07B 2MCNB 4JI4L 4QQBX 2VUMB 5KNBA 2R93G 2V4DA 2PPHA 4ARIA 3NEMA 3H7SA 2WU2B 2NVUI 2K9XA 2O6VD 2PE6B 4R4CA 3S17H 1W6JA 5CHVC 1G6JA 1VZ7A 3DCGA 4W9HA 5H92C 4JI0L 4JV5Q 1BCPB 3AN1A 3HVDA 4M8AA 4GDKA 3NXWA 3J7AV 2RPVA 2WAQE 3UDFA 1S5FD 1D6EC 4RGOS 2KNBA 2JRIB 2WXMA 5H8YE 4CQNA 3QO2A 2A68D 2F0UA 4BBRG 4B3SL 1K52A 5BMHA 2CKZB 1ESFA 1L0VB 2BYFA 2GBNA 1WCMG 2D5DA 4RGNA 1MD2D 1ROEA 2GI9A 3X23A 1Y14B 4CHTB 3M63B 5JPNC 3HS0C 1OXXK 1C9FA 4BAXA 1R4QB 5AFWA 2HHHQ 3W1YA 1Y56A 4JWSC 5D7GA 3HOWH 2ZW0A 1RDPD 2BWFA 3R3MA 3RNCC 3ULPA 2DX5B 4UP9A 4POGA 2PW7A 4QAYA 1UD7A 4TSSA 1E8WA 1Y1VB 4HJKA 1WR6E 2V3NA 3AE7B 1WYDA 3HG9A 4IUUA 4B3ML 1X3PA 3IAS1 3LDZE 2B29A 3PV1A 2QC8A 1SRUA 2Z59B 2JXMB 5J39A 1FYCA 1CM9A 1GAQB 1MHXA 2KEDA 2O5IC 1HNXL 1OTCA 4OX9Q 2KHWB 1XF5L 4OZBA 2EJMA 5E4XA 4JOIA 3ICEA 4MGYE 3KWVA 4J15A 4D2KA 2EE1A 3M4PA 3PVLA 1FJGL 4K8IA 1XTDA 1IHZA 4EQPA 2IY5B 4W9LA 1EU3A 5C44B 3PCOB 4FDBA 1ZYRC 2ASBA 4N59A 1IP9A 3A4SC 2H5XA 1NCVA 1XLNA 1RM6C 3BY4B 3CCMA 2MJ8A 1R4NI 3RYTA 1JOKA 4HK2A 2FJ2A 1WWTA 2VZKB 3T3NA 1H9SA 4I7ZC 4A3JG 2HIVA 1Q7YC 2UUBL 2F0DA 3K7AB 3FEWX 2E75C 2EYOA 3U9SA 4NAWA 3PO0A 5C4XB 1OGWA 1FL0A 1SE9A 3Q3NC 1T6BX 1PH8A 2LUMA 4A3LG 1EEFD 1VQBA 1KDAA 2RMMA 3A1QB 1QOFA 1H9JA 1IL2A 3ERSX 2K22A 3DWQA 5IN7A 1PA6A 4G50A 3NE5B 4IC7B 4BBSG 4E6IA 2KN5A 4G11A 2KMCA 3B9JA 5KHOA 2AQ3B 2K8CA 4JG2A 2K04A 1ZDXA 2EMSA 1YIJA 1B3QA 3WAPA 4KKSA 3U9OA 1YJIA 2PQAB 1X55A 1VQ9A 1R9TH 4K3BA 4FBJB 2NVQH 5COYA 3ZJYC 2J7ZA 3CSTA 4QL5A 1E10A 1TQOA 3P4QB 4HIOA 3V05A 3GZNI 3QWZB 3DBLI 1JC7A 2EYFA 3DM1A 2DHZA 5AEKB 2Q2TA 4DR3Q 2L00B 3AE8B 1ZUD2 3CSFA 2UWQA 2WNMA 5DLQE 1STYA 1TTNA 3NQTA 4IFDJ 2X38A 2ICIA 4M00A 2KMAA 3PUYA 2R2OA 2XIWA 3CCRA 3E0EA 2FNJB 3BK2A 1JRPA 1WJNA 3MJ5A 3N20C 1TWGB 3S15H 2KVZA 4DAVA 3GE8C 2NR2A 3R7RA 2LY7A 3BU2A 1PDQA 3DMUA 3KBXA 3G7LA 2ZTEA 2E6XA 2E2IB 2KVRA 2YEPF 3F2BA 1XMOQ 1CQVA 1JWSD 1DZ1A 4X3UA 2RSUA 3BIID 4N6EB 2F0TA 2K52A 5CHFA 2W54A 3IT4B 2RSNA 2KD0A 3JSVB 2KZRA 1S3SG 2IPKD 2A4ZA 3ENEA 2EYLA 5C4ZA 2VUMG 3N1YC 4FJYA 2WLBA 3MXPA 3PLVA 4US9A 3FKIB 4G7ZC 4MTKA 5IP7H 4H2AA 3RNUA 4Q5VA 3AB5A 1PYSB 3S1RB 1MG4A 4KV2A 1VD2A 3CW2C 2F0FA 1YNNC 2PQEA 4F87A 4GNXC 4A93B 4QUCA 4DAYA 1OXTA 1SMYC 4YHHQ 3HEJA 1I4QA 1YI2A 4WJQA 4BA1I 2DBYA 4WJPA 2K5NA 2ZZPB 4H02A 5KNCA 1PMRA 3O13A 1HEZE 2BS3B 2WP8J 1YD8U 2F4VL 2QDLA 4NJCA 4OIKA 3VAWA 2Z0DB 4X65Q 4KX6B 5IGCA 4W9EA 2L52A 3T56B 4A3FH 2XK5B 2IHEA 2RDFA 1PFMA 2JE6I 1C76A 4YXDB 3BS1A 1ET6A 2KO3A 2EY6A 1ICFB 3HIZA 4P16A 2K5PA 1YJNA 4ANUA 4C3JB 4JVZA 1JALA 1HR0L 3IFDA 1XNRQ 4ME5A 5ELOA 2LFIA 2Z4IA 1OXVA 1FCCC 3A8JE 2PO4A 4DA2A 3GD7A 5FKAC 4XQQA 1Y1VG 2CS4A 3AEDB 2AWOA 1IXRA 2OJRA 3JVZX 3CRLC 3J81i 5K36G 2I5LX 3NSWA 4WWMA 4JI1L 2MP2B 4GNXA 3MHZA 1SGHA 3GB1A 3HOXB 1EYDA 2RQXA 1BBWA 4KGRA 3VR3A 1SJED 2NTSA 1EWIA 4NY0A 4HCPB 4X57B 4C4VA 1KABA 2G9HD 5DAUA 4BKTA 4GN3B 4P71A 1JCKB 1S3OA 1L7YA 4OO1H 1L5PA 4UY8C 1MG8A 2G4DB 3NHEB 1TT2A 4USAA 5E6NA 4KIKB 3GTLB 2AWNA 2JJQA 1GC6A 3I90A 2JU6X 1EU4A 2KVMA 3AU5A 4NB3A 5CX3A 1EYGA 2EJGC 3ZLZA 4YIJA 4URKA 1N34L 3RPFC 5C44G 3TEZA 1R4MI 2ZVOA 4DV1Q 4GKJL 3ZXVA 4FF1A 1YJWA 1AEXA 1FRDA 2CW0C 3WAOA 1IBXB 3VFKA 3SDLC 3L3OC 3FRPB 1PH5A 1HFGA 1TT5B 3SVMA 2L11A 4BZAA 2C60A 3L0WB 1EY9A 2RHQB 2DLBA 3J81E 4JI2Q 5C4XG 2CR5A 1BQQT 2WFWA 1PYBA 3A9KA 1PRTF 1D1IA 3TZDA 3KBGA 4ITKA 4FADA 1YHBA 4LUVA 3AXCA 3DWGC 3LJ3A 4ZUIA 3KLSX 3HHMA 3QOLA 1Q82C 1WZ3A 3VA5A 3B2FA 5LMNL 1PYWD 3A56A 5JVG3 5LLIA 4ZHOA 4N9TA 1WXVA 4LNQA 1KHIA 4OELB 4QJFA 1YJ1A 3H6MA 3NS8A 2PTLA 1WGYA 4B0MA 1TWAH 4UPAA 3QC8B 1N63A 2Z6KC 3PSEB 1ML0D 1Z9FA 2PMVA 1TWHH 1XCQL 2ZM6Q 2JP1A 1H4RA 1CZPA 4MJSB 1BUIC 4DV7Q 4BA2I 1NBFC 3RNFC 2KJRA 1EY5A 4DUZQ 2E2HH 1X56A 2N4FA 2JA5H 2FHTA 3RNEC 5LXHA 4L8JA 1AP0A 2GN5A 1K51A 3CU7A 1Z47A 3RLNA 2LD9A 4R4IA 3IG3A 3NUHB 1TS4A 1XWEA 3L08A 3BG3A 2QCZA 1E8ZA 3NP8A 1P3QU 1V2YA 2PI2A 1E1TA 1SLJA 1K0RA 5T1IA 3L54A 5BN5A 3E0JA 3VYUA 3VRBB 4AYBB 2DY8A 1K83B 2Q2HA 2GBRA 2LVPA 5DM73 4CJ0B 2YTVA 3BJUA 1BCPC 2WDTB 2WINB 2E2JH 2IX3A 3P4RB 1LT6D 2B2UC 3K5MA 4P1CC 4YTNB 5M5WH 2QA4A 2K01A 3S14H 1CUKA 1YX6B 2F0EA 4JL9A 1J8IA 3AE2B 3NOBA 2MBHA 1BOSA 4XT3B 2Z6KA 3FKIG 3KW5B 3DLLA 2IO3B 3W1SA 3BVMA 4IKGA 4QF4A 2RVLA 3CC4A 1K28A 1I5FA 4A93G 4X62L 4PYUA 1GUTA 4DK6C 4LNIA 4AOFA 4C3IB 1K8AC 2M0XA 3DWMA 3CC2A 3A7LA 1QUQA 4BVUC 3TEWA 3Q8FA 4HN7A 2BWES 4OHJA 3AEVA 1YZ6A 4KN7C 1D7QA 5M9OA 2H1EA 3U4EG 1LO5D 2LGYA 1LTSD 3BDCA 3CCUA 2MEKA 1KFYB 4XIGS 3UIPB 3UQBA 2GVBA 4AQ7A 1Q1BA 3QR8A 2N78A 2BH8A 2B2UA 2PI2E 5IOIA 4C3JG 5E3FA 2KK8A 4IW0A 5JJIA 3VH4B 1PDXA 2DAJA 4GDKB 2IO1B 5IP9H 4DR4Q 3OJ4B 3URYA 1YN5A 1KOTA 1WTQA 1TS5A 3TP6A 2WIIB 1F2RI 2ZXOA 2MNAA 2KWCA 1Q1EA 3AEGB 1VQOA 3NQIA 1DJRD 1GHKA 2CHWA 1O7LA 1FFUA 3ND8A 4GLAC 2ZJDA 4BXXG 2KTRA 1UBQA 3HOXG 2Y0SB 3E3XA 4L2YA 2EY2A 1WM2A 4LF6L 3BK1A 1HUMA 4LFAL 3RN5A 1ISNA 4RF0A 3K80C 4IO9A 1QQRA 2HJ1A 4TMAB 1TU2B 5C5MA 4MZ9A 5CBEE 2BCOA 1ASYA 2SAKA 3HVZA 1EY8A 4FO2A 1AZPA 1F2RC 1H8CA 1V1OA 2OQ0A 2B63B 3NY5A 1WY8A 1HR0W 1T0QC 5C6AA 4FLHA 3DOWA 2AL6A 1ZXTA 4HSVA 4RCOA 4QIWB 1CMXB 2IO0B 2SDFA 1MIUA 1TWCB 1Z7TA 3QA8A 1BUVT 4I6PA 1II3A 1MKHA 3AQQA 3I4MH 1MVKA 4IFDG 3C0RB 2IBIB 2R7DA 3M4OB 3M3JA 4JE3B 2IWHA 5FO7B 1SSOA 1I50B 3VXWA 2D5GA 1P16A 4ZRPA 3I9V1 1OQRA 4CJ1B 3HOYH 3PT2B 4AQYQ 2MRPA 1V97A 2GB1A 2UU9L 4WH4A 1SE4A 4A90A 4PMWA 1HA6A 5D65A 4IPHA 3QX1A 3L0OA 2F0LA 2KQ4X 2UXBL 1WTPA 4JI8L 1A3UA 4I65A 5E1FA 1KL9A 4LF7Q 2EJFC 1EUVB 1VQCA 2KT7A 4W9KA 2L8JA 4A8XC 4JW0A 1WX7A 1CHPD 5CV5A 1PTOC 2KDBA 1TYGB 2K0PA 2N49A 1WXSA 4DK5A 1WXMA 4I7AA 1MFWA 3S1NH 1K3BC 4ANWA 1H9SB 2KJXA 3QCAA 4DR7L 3ZQ4A 3TEYA 1STEA 1ZYRD 1YVCA 1HFNA 1V49A 4ZDVA 4ZRZA 2HDLA 1VQLA 4KDLB 4NAWB 3N32A 3H9DA 4HVBA 4IWOA 2C5CA 3S2AA 1QOHA 1FEHA 4S17A 4KKTA 1C4CA 4FHJA 5LMNW 1DOXA 2L4NA 2BYVE 3GQBA 4KJOA 4KHZA 5JVH3 1WH3A 4WQMA 1N33L 4NW2A 2UXCQ 3IFWB 4EVOA 2ES2A 2REXA 4DV5L 5GADC 5A2QL 1WTWA 3PRPB 4GN5A 2ACZB 4NPSA 3LNNA 4AYBG 1Q86C 2MX2A 4K2LA 2EMTA 1DOKA 4BBRH 2HCCA 2HE7A 4PYZA 2RDBC 3AE9B 3U8ZA 1TBEA 1UWMA 2LHEA 3GP7A 1WCMH 3KVFB 3U30A 2CH4A 4X3KA 1XPOA 3I55A 5C1ZA 1U4PA 2KWUB 1JQ4A 2B3AA 4JYAL 5DM63 4LJOB 2EY1A 2YU9H 1D8LA 3A5UA 1M4VA 2B2YC 3VR5A 4CDCC 2KLGA 1STGA 4G4KA 2W3RA 3T9LA 1U4RA 4K7SA 3BZCA 3TIXA 5DEHA 4P6VF 3KK7A 1U0LA 4C3IG 4BKGA 2SNSA 1Y8OB 3HGBA 4IOAA 1L4DB 4NMZA 4BBNF 1FVIA 1V9PA 4MHEA 3F2DA 2RDHA 3SGIA 3KWLA 5IAAC 2F0IA 4F1SA 5MPOA 1EY0A 2V1YA 1EIGA 2MQHA 1A70A 3V61A 5FLXE 1E90A 1QG7A 1XCTL 3D6CA 3SEBA 1F52A 1FR3A 1P0RA 3DQVA 3CQZH 4PMCA 3GTGH 1NYRA 3CMAA 2PEAA 4JLCA 5D3IB 3FHWA 3ZXRA 5C3WA 4IFDI 1E9MA 2XTIA 3CHBD 1YN4A 3K58A 4KY6A 1IL8A 3PUZA 4LF4Q 2CU3A 4E3CA 4X64L 3H3VH 3BZKA 4IJLA 3KJPA 4NXNQ 3TREA 3A9JA 4A3EB 4M0WB 1Y8NB 2KENA 1F9QA 3AE6B 4O42A 1VZ8A 2XK5A 5EQ0A 2B2YA 4A3IH 4FHKA 1SSNA 4DR5L 3NZ3A 4FNFA 1WX9A 5BR8Q 1YNND 3U50C 4ALPA 1WTXA 1E2VA 2I46A 3BYTB 1SMYD 3H09A 4K6LA 3E56A 3VQIA 2AHOB 3FDTA 4A3JH 3J7A5 2Y0SG 3DHQA 1Q10A 3C8YA 5M5XB 2A69C 1Y1WB 1VQGA 1QLBB 4LW1A 4R1JA 2KQSA 2K5DA 4K6DA 5E4WC 5E6JA 3FPPA 4UP7A 4ZRJA 1E24A 3L16A 3Q3MC 4R3DA 4A3LH 4B9KA 1G2TA 4LFBQ 2B63G 4KK7A 5KYIA 1KDCA 4E74A 3NZUA 3L9AX 1SFOB 3OLMD 4BBSH 1N5XA 2F3IA 2CQOA 1UWXA 3I4OA 2WKDA 1GJZA 1V9JA 1VDZA 2WXGA 3Q14C 3D31A 2JA6H 2QHOA 3IT6B 5AJ3Q 2KOXA 3HOVB 2R7FA 1Q81C 1LTLA 2L55A 2INNE 2K8BA 2L05A 4HPMB 2JYEA 1J0GA 4MIUA 2WWZA 4LF9Q 1PQSA 3GTPB 1MI2A 2WDQB 4GS3A 5A35A 2AMCB 2WV6D 1LTTD 4DNIA 2VNUD 1S72A 5DPSA 5M3FB 1SEBD 5ELNA 4QB4A 1Q5WB 1I4GA 1QILA 1CK1A 1NR2A 3VVWB 1XNQQ 1QT9A 2ASQA 1I7HA 3RMHA 1X54A 2DAFA 4NJ6A 4F8CB 4A20A 1GB4A 1N32Q 2ZPNA 4KD4A 4Q0FA 2LRWA 1IBXA 2TMPA 2AEHA 4NXMQ 2KKCA 1WOCA 3T1YQ 1E8XA 4MM3A 3P7JA 3A33B 4CHKA 1YITA 2W9NA 1S4ZA 2M9VA 1JROA 1EWYC 4PG3A 1C4QA 4P74A 2J52A 4TV3A 4FF2A 3M3YH 3PRMB 1QZGA 1DONA 2GVAA 4EEWA 2AQ2B 2B2WA 1EQQA 1XLQA 1AFPA 3I4NB 1N9WA 4A75A 4QCLA 3VR2A 1Q12A 1J7AA 3GV6A 1HTQA 4JI5L 3SXHA 2CW0D 3A9KB 1FFVA 2VUMH 2MGSA 1IBLL 3D6WA 1FGBD 1VMPA 3MC9A 3OIPA 2KYWA 1A0IA 2JZZA 4HJGE 1CZGA 4GOCA 3W3AA 2IX0A 4RA8A 2CJNA 3AE5B 4HRSA 2V3SA 2FUHB 2Q8TA 4RCNA 4R8IA 1V86A 2N9KA 3CIRB 2F3VA 2N9LA 2UUAQ 3OMGA 1N8RC 2D62A 1K8RB 3S16B 2NBWB 4C1NI 3WOFA 1SE2A 1EIHA 2BA0A 3KUDB 1QE6A 5EJWA 4IM0A 1YHAA 4ZYSA 4OVVA 2L15A 4DV6Q 1EEID 1F9RA 1VS0A 4LK1C 5LMUL 2I1JA 4YL8A 4YSYB 4C7ZA 5D14A 4S0RA 4X6AH 2YV5A 3DEPA 2QW7A 4WWPA 1GUWA 3ZUNA 3AEEB 4DK0A 1X6OA 4OWXB 3Q0AA 3DBHB 3PHXB 3QIJA 2OQKA 1EZ8A 1SE8A 4HEDA 1JWBD 1EY4A 1B3AA 4DR1L 1O80A 5K36H 4YSXB 1GB1A 3RN9C 2OTLA 1WR1A 1SBBB 4CDFC 3QB3A 1N62A 5JHBA 1A8VA 1B70B 3J7YW 1JRUA 4DU9A 1RYJA 1WXQA 1G6PA 1IBKL 3RZWC 2INPE 2KHSA 4LF8L 1TZ1A 1CT1D 2KFJA 2FE8A 2R3ZA 1WFYA 4DR6L 1BCPD 2N1VA 2LXJA 4O0AA 1G91A 4YWMA 3VHTC 4JI7L 4JV5L 3OWEB 4GKKL 2ZXPA 4FXKC 4HMIA 4HR7B 4KD3A 1FNUA 4HPLB 2MLBA 1WFQA 5D2MB 2KC1A 4BY7B 2KWVB 4A3EG 5BMIA 4Y52H 1B9NA 3ND9A 4W9JA 1QUQB 2VH1A 5C44H 1XMQL 1IUEA 2W55A 3L7ZC 2EXDA 3UQAA 3CD6A 4US8A 1B53A 3DWAA 4F8MA 1VQIA 1Z2MA 4JK1C 3OAWA 2KEEA 1GG3A 4OEMB 2HHHL 3H0GB 4U68A 5I6YA 4XC2A 2NCNA 2KCTA 5C0XH 2P5ZX 2GMIC 2F3WA 4AYBE 1IBMQ 4FP5D 3V3XA 3VR8B 3VUWA 1Y1WG 1BMLC 3K7AH 1TS2A 1N36Q 3E5SA 4DV3L 1KRSA 2H4OA 5AZGA 1RKNA 3J80E 4EFOA 3JC66 4II2B 1CZWA 4JOIC 1D1KA 4HMJA 1F9PA 1V8QA 1WGGA 4Q2JA 3OJ3A 3RD2A 2KWDA 1OXSC 3GTOB 2VL6A 2VQEQ 3G48A 5EKLA 2UXDQ 3UDIA 3I91A 4A3KB 4JIOU 5JH5C 4HKQA 4PV1C 1H9MA 4K14A 4PNYA 4DKAC 5KYLA 4JI6L 2KECA 1B7YB 2Q2IA 2C35B 3HOVG 1RFAA 3ZJTA 4DK3C 3A55A 2KTRB 5CV9A 4DR2Q 4L6TB 2N1WA 5LNK1 4ZKCB 4HJ7A 3MXGA 1GO3E 5JEAJ 3S1QB 1C4AA 5BN3A 4N9F4 2KA7A 3P42A 4HJ5A 2BYEA 5M3FG 2C9OA 1SF0A 1J7CA 4LLGM 5GAEC 3A8IE 1KAAA 2FCNA 1X3GA 3GO5A 4KY7A 3GTJB 3AE4B 4WAAA 1X3QA 1EQVA 4K0KL 2XEWA 1CTMA 2NVXH 5C3JB 2PLPA 4JI4Q 4IUQA 4BOSC 2VZKD 1EYAA 1D4BA 1I6VC 2D11A 1B44D 1UGJA 4HKZE 1BXTA 2N8NA 3V96A 3UE1A 3HOUH 1TWGH 2KX0A 1FXTB 1I4RA 5NUCA 1DCZA 4JC0A 2E2IH 2JYOA 5CV7A 4JI0Q 2PPBC 1JWAD 1HZAA 1C7YA 2OEDA 4ASWC 3I4NG 2YTYA 4DV0L 2K5HA 2WHIA 4B3SQ 2D2CC 3NJTA 4MGKE 4DWFA 2BDNA 3CF5A 1R7SA 4G7OC 1RD9D 2Y0SE 3I72A 1LGRA 3Q8BA 3FKIH 1K73C 1KDBA 1KLGD 4L5SA 2RHSB 4RM8A 3S1RH 2JXTA 1DOIA 4XGAB 5C3XA 1BNZA 3T53B 2CCZA 2WP9B 1ZPSA 3Q8AA 4CKBA 5IYDG 3Q3JA 1PGXA 4ARCA 2C9WB 1RCVD 2N9PC 5BN4A 3ULLA 2R92B 4QIWE 3LXFA 3Q3OC 4EQ5A 1KXLA 4ICVA 4RGTA 1SIFA 3RNAC 2QF7A 1S5CD 1PTOD 3S2DB 1UH6A 1IYFA 4B3MQ 1GHJA 2VB2X 1X3FA 2HT1A 4A3PA 2FCSA 4KHPL 2L83A 2ZCBA 3CCQA 1HNXQ 1AH9A 2BW2A 4WWNA 3KH0A 2XVSA 3CCSA 4OZCA 2OEOA 1KNEA 4RFBA 3CCJA 3VR6A 5J2RA 3S17B 3FPUB 1NI3A 3MC8A 1J5EL 3NVWA 4EQOA 1FMAD 3BWUD 4UDUC 2NZOA 3SU8X 3ZDTA 2F1MA 2KHIA 5J1ZA 2NPTA 2B8GA 2NUCA 1I6HB 3HRZC 3DWPA 5TR5A 1FJGQ 5FLXc 1KJTA 1GD7A 2FFKB 4CDEC 4N9PA 1P9DU 2LXAA 4YTPB 2KQ7A 1EOTA 5JOBA 2MWSB 2V9HA 4BS9A 2MJ3A 1PTOB 4CYEA 2EXZA 2QEXA 4BXXH 2KDIA 3AE3B 1ENAA 3HOXH 3W5UB 5IWAL 2E2DC 2LEKA 5EE3A 3NPPA 1RHPA 4AJYB 3LX0A 3TQYA 3MHSD 1N61A 2UUBQ 2RKSA 1SIJA 2KDMA 4KDIC 3HOWB 4HTHA 4F7ZA 3AFQA 4X66L 1PH2A 4FYDA 4F88A 2LXKA 3ZRCA 4BY7G 5M5YH 1C79A 3IKJA 4ICUA 3RNGC 2RCNA 3DXJC 1P98A 1LFDA 3TCAA 4X65L 2UYZB 1H9KA 3K7UC 1WIAA 3K57A 3IAM1 5JAVA 1QNKA 4EGVA 2VY3A 4FXCA 3BDLA 2N0SB 1Q0WB 3H1UA 1EUJA 2QKIC 3H0GG 3ZVVA 2D0PA 4DAPA 1GPXA 3NENA 1PH6A 5C3EH 1ENFA 4LK0M 4GMVA 4M0WA 2DZIA 3OW2A 5EGTA 1UE5A 1SAPA 1EF5A 1E0ZA 3I3TB 3C1EA 5ELFA 5IP4D 4KVGB 3NHHA 3HKZB 2EKEC 3NBIA 5GAHC 3A9JB 4YSZB 4O1NA 1E8YA 1GVPA 3QJYA 1Q1OA 3VDYA 4K1RB 2CKHB 2MSED 1E1OA 1A3TA 1RTNA 3KLRA 1WSPA 4A3KG 1IYJB 2HTHA 1LT5D 1NR4A 3ZNGC 4BKSA 2KUMA 2Z6BA 4LUZA 3U4VA 4M8MA 2AUJD 3ZJVA 4DQOC 1XPRA 3A0JA 3W1BA 3GOEA 4EKUA 1O78A 1HNZL 5IODA 4AS1A 1G51A 4MSMB 2JA8B 1C9OA 4ZHPA 1DD2A 3PUXA 5M3MB 3WAMA 2ZXRA 3PIPA 2A69D 2HD3A 2RGFA 1BO0A 4DV2L 4R4OA 1W3SA 1PLFA 1IW7C 2F0OA 5D3DA 1IGDA 1YIWA 2JZPA 4LJPB 4A3OA 3J81j 3I73A 1DXMA 1CA6A 4B3TL 4M8NA 1PFSA 4H44C 1YOVB 1PGBA 4CGYB 2X6LA 4B3RL 5ISRA 3EVQA 5AUIA 4K7WA 1K83H 5JPMC 1UE7A 1HE8A 4A3GB 2D2QA 1LTAD 5FR6A 1KLVA 4R4TA 3EFUA 1V1PA 1WTOA 2IY1B 3QJZA 4DK1A 1Q8IA 5ELBA 4HIDA 4GB9A 5IGDA 2F4VQ 3PO2B 2N7EA 2I07B 3J81L 1LTGD 3DBHI 1PFBA 2A6HC 4J6IA 3VTWA 2EELA 3P20A 1L6VA 1ZP0B 3TBLD 1XPUA 4Y7NH 3EFCA 4RHSA 4IDIA 1ICWA 3DDCB 2FUG1 3SFDB 4RHRA 3PHWB 1UUPA 4MM3B 1ONLA 1VQPA 3GS2A 3OHXC 4ANVA 3RD4A 1TIFA 2F0JA 2G4SA 4R9WA 2N9XA 2WXNA 5J17A 4TRDA 1HR0Q 3GTMH 1Q90A 2R92G 5JJKA 2PVGC 2JSVX 3QOJA 4L63B 4JI3L 5D6JB 2BKRB 1VQAA 5GAGC 3NS1A 4LF5L 2WDVB 4TQ1A 1BR9A 3MP9A 3I4LA 4JI1Q 4L23A 3TUOA 4C80A 5BYSA 2K7VA 4YY3L 1C48A 1B2TA 1SJHD 1M8AA 4ABNA 5IT9E 3KUZA 1BVSA 2MO1A 3F1ZA 2F0SA 1BT0A 2JT4B 3IXSA 3FP9A 3WANA 4NQLB 1I4HA 1FIQA 4G57A 2NMQA 3W1SC 2NZHA 5AZHA 2VW9A 2PW9A 2HIXA 2VRRB 5L83A 1IKLA 5J3BA 2Z0EB 1NEKB 3Q3FA 1N34Q 5EDSA 1PUTA 3SK6A 4BWGB 3ETRA 4GKJQ 4LNFA 1K8OA 4E71A 4EZJA 4JGHB 3EQLC 5IKCM 3K5LA 3DBRB 2GBMA 2B3GA 3A8KE 5C4HA 1I94L 5JEAG 3T51B 1E22A 1I4XA 2WU5B 3HOWG 4XE0A 4LUOA 1EZ6A 1SR3A 2EYJA 4IPCA 2B63H 1AN8A 1RIPA 4GLXA 5JHAA 2D0OA 1BCPF 4KLKA 2F0HA 2BH2A 1TWCH 4DV4L 1H95A 2SOBA 2LASA 1QOGA 2Q8RE 4LJZC 3M4OH 2DWQA 4KN4C 2PIAA 5CHWA 5LMNQ 3ZNZB 3I56A 1YNXA 1WMHB 3APDA 3MJWA 4DPGA 1KF6B 3NBHA 3QWNA 5C4JH 4JWUC 3RFZB 3MVVA 1I50H 1V1QA 5IYBG 1K53A 4PZ8A 3J80c 1CKOA 3M7GA 3HK0A 1MBYA 3GDEA 3AI5A 2WS3B 5FLMH 1QJOA 2QJLA 2QILA 4M02A 5AZFA 1HA5A 2BS2B 3I7FA 1L0WA 2GBKA 4HWIB 4KJNA 3RUZA 1X9NA 1L4ZB 2PZWA 1KM7A 3HKZG 5KGUA 1OQQA 2OCEA 2L9HA 1FXIA 2A8VA 2BQQA 3EGRA 3APFA 4KI0A 1VQDA 1K8MA 3KUCB 4GOPA 3AULA 2ZTCA 1N5WA 2JK8A 3B6YA 4YWKA 3QK0A 3ZNHB 1E2ZA 1K3RA 2AQ1B 1VQ7A 1VZ6A 1XX8A 3TS2A 2E76C 2ENBA 1DGJA 5D94A 1ZKHA 2JZ3B 3L17A 4FF4A 2J0KA 2K6QA 1HZ6A 1QZEA 2D3CA 2E5LL 2UUCQ 3CPFA 2JA8G 5BMGA 2CJOA 3P2BA 1D5XC 1UEBA 1JT8A 5M3MG 3GTKB 1X1MA 1XO3A 3ZTCA 3STBC 1UE1A 3T1HL 4MEMA 4N58A 2WX1A 2KMMA 3V6CB 4JCVE 1WF9A 2C7MB 4AJWA 1WGDA 3CMMB 3G6JB 3BZDB 2IL8A 2L0TA 4P75A 4X62Q 5AUKA 5JJZA 2V3PA 2KN4A 4ZQ3A
chains in the Genus database with same CATH topology
3BVGA 4MN3A 3EUB2 3NK9A 4PMBA 1TZOA 2L1BA 3FMCA 1I3QB 2XRSD 1MHHE 2XWJB 2IGGA 4K5VA 2D9UA 4G7HC 2PMZB 3X3MA 1MGSA 3TP7A 1HXYD 2J4XA 2ID0A 3NUCA 2NN6G 3Q22A 4J8QA 3T4AC 1SNMA 5M5WB 4ILWA 5ELEA 3SK4A 3RLFA 2DNEA 5IOCA 2IGDA 2BS4B 3SK5A 4F7XA 1WTRA 1PTOF 4YT0B 3CRKC 5IGBA 1V43A 4JX1C 5CBAE 1RFKA 5F2DA 4KKJA 4CBVA 1JWUD 4FF3A 3OW7A 1TKYA 2J42A 1LT4D 3S2HB 1F2LA 2O2LD 4REZA 1MPEA 1JICA 2K28A 2A6EC 1S5DD 1A3VA 4LMQD 3PO3B 3D4RA 4RNAA 1VDVA 3D8GA 4EQNA 3OOCA 5BYRA 2K33A 1WD0A 4EE2A 1BDOA 2H88B 3AM9A 4K5XA 2QSDA 5BYQA 1YNTE 1QCBD 3EJIA 4PT5A 4A3MB 2MH7A 2FINB 3I57A 4K2KA 1RF2D 2J53A 4P2CB 4BY1B 2Z4HA 5FLXL 2EYMA 1NUCA 3N52A 2WXLA 5ELCA 1HTPA 1C8CA 3MAQA 1ZDVA 1F2MA 4IQZA 5A2QE 2W82A 4HROA 3ZYYX 2F0KA 2WQYB 2QIEB 5C5LA 2PVOD 2BOSA 5HGTA 4DXGA 2EKIA 4JBWA 2F03A 4XT1B 2EY5A 1TVXA 2EPBA 2HDMA 2V0GA 3EROA 2OT2A 4WRDA 3JAME 2PKOA 2HUGA 1RJTA 4A3BB 4FVMA 2NN6I 1A2TA 3W5VB 2ZT9C 1YQ3B 3S1NB 2ICEC 2Z8LA 3ABVB 1K50A 1QNUA 1V8CA 2K03A 1EY7A 2R61A 1WVLA 2B2WC 5ELDA 1ZEQX 5I2XA 4R8NA 1SNPA 3S9WA 3HUIA 3PIO3 1EFID 2LFNA 1STNA 1MSGA 2G9DA 4OZAA 1PGAA 3RZOB 3U2SC 2EYPA 2F0MA 1X32A 2A74C 2H89B 2F0GA 4B08A 2F0PA 2JA7B 5CR3A 4C3HB 5LL6S 5HURA 4C7YA 2KCCA 4ZUJA 1IW7D 4DXFA 4DFAA 3EA6A 4HCSA 1AZQA 1V1PB 1JQYD 3GTQB 1FRRA 1NVID 1QKZA 4RH6A 4XYOA 2YU9B 1KNAA 3U7ZA 1QF6A 2AX5A 4IOIE 1GUNA 1PZID 3T16A 2DY7A 3HOZB 2NTTA 1DYQA 1TKGA 2A6HD 2RDGA 1DOLA 1HPCA 4XDXA 2I2YA 3K59A 1ZXHA 3ONAB 1LT3D 5T8IA 3DEOA 2HTME 3TDQA 1YNJC 3W2DA 2NWGA 4XWTA 1OO9B 2Y3AA 2BA1A 2XWBB 4A3IB 3UI3A 2ONQA 2K5WA 3PUVA 2PZTA 2X69A 3OIQA 4C1NK 2BB6A 2Q8IB 1SYGA 3D4WA 1TKWB 1B1ZA 3NWTA 5KIXA 4OIJA 1FNVA 3LWEA 1Y8PB 4RKLA 5DNFA 4TQUS 3NVYA 2RA4A 4S3SA 1EWCA 1WGKA 2PNRC 2BE5C 2EZVA 2B76B 2MUYA 1XLOA 3Q8EA 5G5HA 2E3TA 4QMGA 4MH8A 2Y5CA 4OGQC 5CC4A 1ZXIA 3PIP3 4H0LC 1PRTB 1CHQD 4K5WA 3IFTA 2R7ZB 1FM0D 2NB0A 3TMEA 2NVTB 5G3LD 3TBIB 4DNRB 3K6OA 2IW3A 4A3DB 5GXGB 1VLBA 1IYUA 3OMCA 1GJXA 3J80L 2L32A 1F0ZA 1QWYA 3R8BA 1TKEA 1FD7D 3MC0B 4K8JA 1T3QA 1DM0B 2E74C 3KQ4A 1A15A 2EVBA 1F2ZA 1BBXC 4YWGG 5C0XJ 1TWFB 3M3YB 5EPJA 4A6QA 3UI2A 3MFYA 4OW0A 1VJKA 2M56B 4XQNA 3SHLA 4V190 1LLRD 4ZK9B 1CA5A 4WIPA 3HRDD 1HQMC 3MTSA 4LAAA 3L4PA 2MJEA 1I4PA 3OSOA 1CI3M 2SNMA 1ILPA 4C2MB 3Q6SA 2EDGA 4XQJA 1GUSA 4C3HG 2JWUA 1AYFA 5EE9A 4FXDA 2Y5PA 5LHY1 3AV8A 1SDFA 1S5ED 4KTAA 1JOQA 1JWMD 4C56C 1PTOH 3H94A 4UAIA 5I9PA 2G1EA 3NVZA 2IJ0A 2L0CA 3VYRA 4HAEA 3IL8A 2XRQD 4ZKBB 1N60A 5JEAH 2V4IB 2B2TC 3Q8CA 2L5TA 1CFMA 1E7PB 1AW7A 2B39A 2DYMA 2FMCA 3TN2A 5I2YA 2M2LA 1B9RA 1E0BA 4IUVA 5FK9C 3SK8A 2NYZD 3PZ7A 2VXWA 1ENCA 4A9AA 3S1MB 4ODGA 4KY5A 2QCPX 3TP8A 3KUPA 4WURA 3MZ5A 1QB5D 2LGIA 3TP5A 4XWWA 3P75A 4ZLTF 4L1BA 5KNDA 4WJWA 3B2GA 4KMUC 2B2TA 3AMZA 4NP5A 3R2IA 1ET9A 1WYGA 3VR4A 1SXTA 2LJIA 1QOBA 3K5NA 4HSPA 2F0QA 5IGEA 1HRJA 1BF4A 1KTKA 1B9MA 1TS3A 1IKMA 4TKOB 4KKIA 3FILB 2DYOA 3CWIA 2A6ED 1NSNS 4DGZA 4H13C 3SR1A 3D3RA 2BTEA 3Q23A 1PFNA 3T13A 1EQTA 2LMCA 4ULLA 3KF8A 1ZE3D 5HFYA 2CQAA 4XDCA 2BT6A 3HP3A 2LHDA 1J7BA 4IFDH 2XN9C 2NVXB 4OL7A 2GA4B 4J1MA 1C77A 2WXRA 3HOUB 3AMUA 1VCIA 4FXGC 2MP1A 2NN6H 2ON8A 2O4XA 1VMCA 2W3SA 1P7FA 4J3OD 3NVVA 4IUPA 1HCZA 4XTCS 3C2PA 1J9OA 1EL0A 3V2TA 4OVZA 2KAJA 3LYYA 4X3SA 2BBCA 5K5PA 1WD1A 4GLSC 3MXNA 3TSSA 1R9TB 1JE4A 2NVQB 2JYTA 5CGKA 2F0VA 5EPKA 4MT5A 3H3VC 5IIFA 3M7NA 3NTHA 2PCFB 1CQFA 1QOAA 3AB9A 1FXAA 2EOTA 2NZ1D 2FMMA 3ERQA 3S15B 3A54A 1SYFA 3HZXA 4KGSA 5M5YB 5IT9L 1EM7A 1AWDA 3K5OA 4HCEA 1D5ZC 4Z9CB 4LTUA 5EKKA 1HQRD 2GRIA 1TIID 5C0XG 2XNAC 5C3EB 1ACCA 1RWSA 3CKIB 1VR9A 1PRTC 4WAFA 4CKEA 5FOBB 1GUOA 4CJ2C 2RBMA 3M4YA 2JQRB 3N9YC 3R2TA 4A55A 1O7YA 1G291 5TSSA 1HZ5A 2BDOA 1L0YB 4A3FB 1YNJD 1Y69U 2LKVA 1T5XD 1FO4A 1SNCA 3NTKA 4RGMA 5JXVA 1G6ZA 2WB1B 5LL6X 3MWYW 1VF5C 1OFFA 4GDLB 3NWSA 1D5MC 1DOMA 1LV9A 3NRZA 1FNWA 2R6GA 2WXQA 1SNDA 1LTRD 5G3LF 4U673 1LACA 3W9CB 1W6KA 2KACA 4RWSC 2XSCA 1S5BD 2BE5D 2K5QA 2MHVA 3R3OA 3AU7A 3PUWA 3N6RA 2QMTA 2KCNA 2WAQB 2JEAI 2EYHA 3TZUA 2N7JA 4WFN3 3TEXA 1G2SA 1XTCD 3PZ8A 4Y7NB 4XXEA 4J6HA 1ESRA 2DN8A 3MA2B 3OPOA 1R4PB 4NKLA 2DNCA 4IN3A 2HDEA 3WDNA 3EFXD 3FC4A 3Q69A 5T1GA 3GTMB 1GOZA 1OXUA 1STBA 1VRAB 2M19A 1JR0D 2F0NA 1PXUA 1JMLA 1YMHE 2A68C 3WCQA 5C2TB 5CYUA 5CORA 3BYYB 2N55A 4MACA 3MFGA 1ZOYB 1IGCA 1TWAB 1EWHA 3LWUA 1TWHB 4H7BA 5C0XI 3MXUA 1SE3A 2KQ3A 4NZLB 1TR5A 2WXKA 4XYQA 3J7AF 2E2HB 4XDDA 1E2WA 1NAPA 2JA5B 2OXPA 1UNSA 3AECB 1F9SA 3SFEB 4X3TA 3C46A 1WTVA 4ZAIA 1F2YA 1O7ZA 3VYTA 2E2JB 2LS01 2K6AA 2MPMA 3S14B 1U4MA 4M1UB 3P1MA 1SNOA 5C4JB 2WXJA 1ZKOA 1NYQA 3AE1B 1SB3C 2PW5A 4WORA 2PZUA 1MSHA 2M0AA 1FCLA 5I9OA 2BYTA 2HCIA 4JPSA 3ZGZA 3H8HA 1UEAB 1PZKD 1KH0A 2CVRA 3VA7A 2X6GA 3AEFB 1SNQA 2HQEA 3F2UA 1C78A 3BVZA 1GUGA 4B9XA 2OHFA 2NBFA 1TY2A 1A6XA 3E6ZX 5EPLA 1XXGA 1YJJA 1LTID 1PZJD 3R93A 4ID6A 5CV4A 5KRUA 1CJEA 1B4OA 3FILA 5J22A 4TQ0A 4IUTA 2FBWB 4NDXA 2Z1CA 2BB5A 1JB3A 1Z6HA 3PV0A 3MEHA 4CKCA 3E9SA 3AEBB 3H91A 1JORA 2LMCB 2AUKA 4C80A 2M00A 2N88A 4OO1G 5FO9B 1NENB 2WXPA 2B8FA 1HUNA 1SYDA 1T5EA 1SYEA 3I4MB 5I6WA 2L12A 1XEEA 5I4DA 2QEJC 1WRIA 4V0BA 3JAML 2CHBD 1JOOA 2F4IA 4IALA 5EE0A 3HOYB 1U4LA 1L0XB 4IURA 3P1HA 3QG1A 1EYCA 1C4PA 1SYBA 2WDRB 1G8ZD 5FR3A 4DN4M 3K0YA 4QUFA 1MI0A 1HTLD 4YTMB 2QDBA 4NAMA 1FD6A 5EBDA 5G5GA 1UAPA 1GXDC 3SE0A 1A2UA 3GV3A 3VYSA 2WXHA 2JX5A 4GZYC 1TJEA 1VF7A 3QIAA 2R93B 1XLPA 2YYZA 3SDZA 2TSSA 1L6UA 4RAUC 2B2VC 1KRHA 3ITPA 2YEPB 2WXOA 5HHDG 3I8ZA 3AH7A 3P4PB 2Q5WD 3J9CA 2I38A 4PQXA 4BBRB 2A73B 2KOLA 1WCMB 2K3UA 1D2BA 1IYVA 2IDYA 1LABA 2NVYB 3M85A 3FAHA 4DF7A 1TY0A 3I3CA 5CMDA 1EY6A 2O5JC 3DUZA 1SYCA 3VR9B 4DNTB 1KLUD 1YQ4B 2MJDA 1RODA 1PFDA 2B2VA 2OF1A 2K32A 4HEA1 3U52E 3AEAB 1RTOA 3Q24A 3SR6A 5HG2A 1JW9D 4OO1I 3IAYA 3VRAB 2K1BA 3CQZB 3GTGB 2ZW1A 1U9RA 2F0WA 5EKIA 1ILQA 5CV6A 4B9WA 5HI1A 3T3OA 1YN3A 2SEBD 2WXFA 1STHA 3MHBA 3PMFA 2WKCA 2L1AA 3P63A 3NTIA 4IUNA 1B50A 2JEBI 5CV8A 4A3JB 3OWFA 1PRTD 1STAA 1P7EA 3RZDB 4RF1A 5FO8B 3BDOA 4KHVA 5KEEA 4ZRQA 3A7AB 1DOYA 3WOEA 3ZJUA 4BBSB 5EE1A 2JA6B 2JSOA 3D4DA 1E6EB 4ZOHC 2K05A 5IGFA 2J0TD 1F77A 5IGGA 2WXIA 3FVQA 3C3LA 2VB3X 3P4SB 1H9RA 2IX1A 4KGTA 4KV6A 1XYIA 3KLSA 2A5HA 2IGHA 5EBCA 2RSOA 4KKUA 3C1FA 2IT1A 2WACA 1LTBD 3X3NA 1HHVA 4B0EA 3I70A 2PYKA 4IZ8A 1Q3LA 3LB8C 4RKBA 2VUMB 5KNBA 2V4DA 4ARIA 2WU2B 2K9XA 1W6JA 1VZ7A 5H92C 1BCPB 3AN1A 3HVDA 4M8AA 3NXWA 3J7AV 2RPVA 4CQNA 1S5FD 1D6EC 4RGOS 2WXMA 5H8YE 3QO2A 2A68D 2F0UA 1K52A 5BMHA 1L0VB 1ESFA 2D5DA 4RGNA 1MD2D 1ROEA 2GI9A 4CHTB 5JPNC 3HS0C 1OXXK 1C9FA 1R4QB 5AFWA 1Y56A 4JWSC 5D7GA 2ZW0A 1RDPD 2PW7A 4TSSA 1Y1VB 2V3NA 3AE7B 3IAS1 3HG9A 4IUUA 1X3PA 2JXMB 5J39A 1FYCA 1CM9A 1GAQB 1MHXA 2KEDA 2O5IC 1XF5L 4OZBA 2EJMA 5E4XA 3KWVA 4D2KA 2EE1A 4K8IA 1IHZA 4EQPA 1EU3A 5C44B 4N59A 1ZYRC 1XLNA 1NCVA 1RM6C 2MJ8A 1JOKA 2FJ2A 1WWTA 2VZKB 3T3NA 1H9SA 4I7ZC 2F0DA 3K7AB 3FEWX 2E75C 2EYOA 3U9SA 3PO0A 5C4XB 1T6BX 2LUMA 1EEFD 1KDAA 2RMMA 1QOFA 1H9JA 2K22A 3DWQA 3NE5B 4E6IA 3B9JA 2AQ3B 2K04A 1ZDXA 4KKSA 3U9OA 1YJIA 5COYA 2J7ZA 1E10A 1TQOA 3P4QB 3V05A 1JC7A 2EYFA 3DM1A 3AE8B 1ZUD2 2WNMA 1STYA 3NQTA 4IFDJ 2X38A 2ICIA 3PUYA 2XIWA 3BK2A 1JRPA 3MJ5A 1TWGB 4DAVA 2LY7A 3KBXA 1PDQA 3DMUA 2E6XA 3G7LA 2E2IB 2YEPF 1CQVA 1JWSD 1DZ1A 4X3UA 3BIID 4N6EB 2F0TA 2W54A 3IT4B 2RSNA 2IPKD 2EYLA 5C4ZA 2WLBA 3MXPA 4US9A 3FKIB 4G7ZC 4H2AA 4Q5VA 3AB5A 3S1RB 4A93B 2F0FA 1YNNC 2PQEA 4F87A 4QUCA 4DAYA 1OXTA 1SMYC 3HEJA 1I4QA 4BA1I 2DBYA 5KNCA 1PMRA 3O13A 1HEZE 2BS3B 2WP8J 4NJCA 4OIKA 4KX6B 5IGCA 2L52A 3T56B 2RDFA 1PFMA 2JE6I 1C76A 4YXDB 3BS1A 1ET6A 4P16A 2EY6A 2K5PA 4C3JB 1JALA 3IFDA 4ME5A 2LFIA 2Z4IA 1OXVA 1FCCC 3A8JE 2PO4A 4DA2A 3GD7A 5FKAC 4XQQA 3AEDB 2AWOA 3CRLC 5K36G 3NSWA 4WWMA 3MHZA 3GB1A 3HOXB 1EYDA 2RQXA 4KGRA 3VR3A 1SJED 2NTSA 1KABA 2G9HD 5DAUA 1JCKB 4OO1H 1L5PA 4USAA 1TT2A 3GTLB 2AWNA 3I90A 2JU6X 1EU4A 2KVMA 2EJGC 4YIJA 3RPFC 3TEZA 4FF1A 1AEXA 1FRDA 2CW0C 1IBXB 3L3OC 3FRPB 1HFGA 3SVMA 2L11A 1EY9A 2DLBA 3J81E 1BQQT 1PRTF 1D1IA 3TZDA 3KBGA 4ITKA 3DWGC 4ZUIA 3KLSX 3QOLA 3VA5A 3B2FA 1PYWD 3A56A 5JVG3 4ZHOA 4N9TA 3H6MA 2PTLA 4B0MA 1N63A 1ML0D 2PMVA 1XCQL 2JP1A 1CZPA 1BUIC 4BA2I 1EY5A 2FHTA 4L8JA 1AP0A 1K51A 3CU7A 1Z47A 3NUHB 1TS4A 1XWEA 3BG3A 3NP8A 5T1IA 3VRBB 5BN5A 3E0JA 3VYUA 4AYBB 2DY8A 1K83B 5DM73 4CJ0B 1BCPC 2WINB 2IX3A 3P4RB 1LT6D 2B2UC 3K5MA 4YTNB 2K01A 2F0EA 1J8IA 3AE2B 1BOSA 4XT3B 3W1SA 3BVMA 4IKGA 4QF4A 2RVLA 1GUTA 4C3IB 3DWMA 3A7LA 3TEWA 3Q8FA 4HN7A 4OHJA 4KN7C 5M9OA 2H1EA 3U4EG 1LO5D 1LTSD 3BDCA 2MEKA 1KFYB 4XIGS 4AQ7A 1Q1BA 2B2UA 4C3JG 5E3FA 1PDXA 4GDKB 3URYA 1YN5A 1WTQA 1TS5A 3TP6A 2WIIB 1F2RI 2ZXOA 1Q1EA 3AEGB 3NQIA 1DJRD 1GHKA 1O7LA 1FFUA 3ND8A 2Y0SB 4L2YA 2EY2A 3BK1A 1HUMA 4RF0A 4TMAB 1QQRA 1TU2B 5C5MA 5CBEE 2BCOA 3HVZA 2SAKA 1EY8A 4FO2A 1AZPA 1F2RC 1V1OA 2B63B 5C6AA 1ZXTA 4HSVA 4RCOA 4QIWB 2SDFA 1TWCB 1Z7TA 1BUVT 1II3A 1MVKA 4IFDG 3M4OB 4JE3B 2IWHA 5FO7B 1SSOA 1I50B 2D5GA 4ZRPA 3I9V1 1OQRA 4CJ1B 1V97A 2GB1A 4WH4A 1SE4A 4A90A 4PMWA 1HA6A 5D65A 2F0LA 2KQ4X 1WTPA 1A3UA 4I65A 5E1FA 2EJFC 4A8XC 1CHPD 5CV5A 1PTOC 1TYGB 2K0PA 1H9SB 2KJXA 3ZQ4A 3TEYA 1STEA 1ZYRD 1HFNA 4ZRZA 2HDLA 4NAWB 2C5CA 1QOHA 1FEHA 4KKTA 1C4CA 1DOXA 2L4NA 3GQBA 4KJOA 4KHZA 5JVH3 4WQMA 4NW2A 4EVOA 5A2QL 1WTWA 2ACZB 3LNNA 4K2LA 1DOKA 2HCCA 3AE9B 1UWMA 2LHEA 3GP7A 4X3KA 1U4PA 1JQ4A 5DM63 2EY1A 1M4VA 2B2YC 3VR5A 2W3RA 1STGA 4G4KA 1U4RA 5DEHA 4P6VF 3KK7A 4C3IG 2SNSA 1Y8OB 3HGBA 1L4DB 4NMZA 4MHEA 2RDHA 3KWLA 2F0IA 5MPOA 1EY0A 1EIGA 1A70A 5FLXE 1QG7A 1XCTL 3D6CA 3SEBA 1FR3A 4PMCA 1NYRA 5D3IB 5C3WA 4IFDI 1E9MA 3CHBD 1YN4A 3K58A 4KY6A 1IL8A 3PUZA 2CU3A 4A3EB 1Y8NB 1F9QA 3AE6B 4O42A 1VZ8A 5EQ0A 2B2YA 1SSNA 3NZ3A 4FNFA 1YNND 1WTXA 3VQIA 1E2VA 2I46A 3BYTB 1SMYD 3H09A 4K6LA 3E56A 3FDTA 3DHQA 1Q10A 3C8YA 5M5XB 2A69C 1Y1WB 1QLBB 2K5DA 4K6DA 5E4WC 5E6JA 3FPPA 4R3DA 1G2TA 4KK7A 5KYIA 1KDCA 3L9AX 1SFOB 1N5XA 1UWXA 2WKDA 1VDZA 2WXGA 3D31A 3IT6B 3HOVB 2INNE 2L55A 2JYEA 4MIUA 3GTPB 1MI2A 2WDQB 5A35A 2WV6D 1LTTD 2VNUD 5M3FB 1SEBD 4QB4A 1I4GA 1QILA 1CK1A 1NR2A 1QT9A 1I7HA 3RMHA 1GB4A 4KD4A 4Q0FA 1IBXA 2TMPA 3P7JA 1S4ZA 2M9VA 1JROA 1EWYC 2J52A 1C4QA 4FF2A 1DONA 2AQ2B 2B2WA 1XLQA 1AFPA 3I4NB 4QCLA 3VR2A 1Q12A 1J7AA 3GV6A 3SXHA 2CW0D 1FFVA 2MGSA 3D6WA 1FGBD 1VMPA 3OIPA 4HJGE 1CZGA 3W3AA 2IX0A 4RA8A 2CJNA 3AE5B 4HRSA 2Q8TA 4RCNA 4R8IA 2N9KA 3CIRB 2F3VA 2N9LA 3OMGA 2D62A 3S16B 4C1NI 3WOFA 1SE2A 1EIHA 2BA0A 1QE6A 5EJWA 4ZYSA 1EEID 1F9RA 4LK1C 4YSYB 4C7ZA 5D14A 3DEPA 1GUWA 3AEEB 4DK0A 3Q0AA 1EZ8A 4HEDA 1JWBD 1EY4A 1B3AA 1O80A 5K36H 4YSXB 1GB1A 1SBBB 3QB3A 1N62A 3J7YW 1RYJA 4DU9A 1WXQA 2INPE 2KHSA 1CT1D 2FE8A 2R3ZA 1BCPD 1G91A 3OWEB 2ZXPA 4FXKC 4HMIA 4HR7B 4KD3A 1FNUA 4BY7B 5BMIA 1B9NA 3ND9A 2W55A 1IUEA 3L7ZC 4US8A 1B53A 3DWAA 4F8MA 4JK1C 2KEEA 3H0GB 5I6YA 4U68A 5C0XH 2F3WA 3VR8B 4FP5D 3V3XA 1BMLC 1TS2A 3E5SA 2H4OA 1RKNA 3J80E 1CZWA 1D1KA 4HMJA 1F9PA 1V8QA 4Q2JA 2KWDA 1OXSC 3GTOB 5EKLA 3I91A 4A3KB 4HKQA 4PV1C 1H9MA 4K14A 4PNYA 5KYLA 2KECA 3ZJTA 3A55A 5CV9A 4L6TB 5LNK1 4ZKCB 3MXGA 5JEAJ 3S1QB 1C4AA 5BN3A 2KA7A 3P42A 2C9OA 1SF0A 1J7CA 4LLGM 3A8IE 1KAAA 3GO5A 4KY7A 3GTJB 3AE4B 1X3QA 1EQVA 1CTMA 5C3JB 2PLPA 4IUQA 2VZKD 1EYAA 1D4BA 1I6VC 1B44D 1UGJA 4HKZE 1BXTA 3V96A 1I4RA 5NUCA 1DCZA 2JYOA 5CV7A 2PPBC 1JWAD 2OEDA 2D2CC 2BDNA 1R7SA 4G7OC 1RD9D 3I72A 3Q8BA 1KDBA 1KLGD 2JXTA 1DOIA 5C3XA 1BNZA 3T53B 2WP9B 1ZPSA 3Q8AA 4CKBA 1PGXA 4ARCA 1RCVD 3LXFA 5BN4A 2R92B 4RGTA 2QF7A 1S5CD 1PTOD 3S2DB 1GHJA 2VB2X 2L83A 2BW2A 2XVSA 4OZCA 2OEOA 1KNEA 4RFBA 3VR6A 3S17B 3FPUB 1NI3A 3NVWA 4EQOA 1FMAD 3BWUD 4UDUC 2F1MA 5J1ZA 2B8GA 2NUCA 1I6HB 3HRZC 3DWPA 2FFKB 4N9PA 4YTPB 1EOTA 5JOBA 4BS9A 2MJ3A 1PTOB 2EXZA 3AE3B 1ENAA 3W5UB 2E2DC 2LEKA 5EE3A 3NPPA 1RHPA 3LX0A 1N61A 2RKSA 1SIJA 2KDMA 3HOWB 4HTHA 4FYDA 4F88A 1C79A 3IKJA 3DXJC 1H9KA 3K57A 3IAM1 5JAVA 1QNKA 4EGVA 4FXCA 3BDLA 2N0SB 2QKIC 4DAPA 1GPXA 1ENFA 4LK0M 4M0WA 5EGTA 1SAPA 1E0ZA 3C1EA 5ELFA 3NHHA 3HKZB 3NBIA 4YSZB 4O1NA 3QJYA 1A3TA 1RTNA 3KLRA 1WSPA 1LT5D 1NR4A 2KUMA 3ZJVA 2AUJD 4DQOC 1O78A 5IODA 4AS1A 2JA8B 4ZHPA 1DD2A 3PUXA 5M3MB 2ZXRA 2A69D 1BO0A 1PLFA 1IW7C 2F0OA 5D3DA 1IGDA 2JZPA 3I73A 1DXMA 1CA6A 4H44C 1PGBA 4CGYB 2X6LA 5ISRA 3EVQA 5AUIA 5JPMC 4A3GB 1LTAD 1V1PA 1WTOA 4DK1A 1Q8IA 5ELBA 5IGDA 3PO2B 2I07B 3J81L 1LTGD 1PFBA 2A6HC 2EELA 3P20A 1L6VA 1ZP0B 4IDIA 4RHSA 1ICWA 2FUG1 3SFDB 4RHRA 1UUPA 4MM3B 1ONLA 3GS2A 3OHXC 3RD4A 2F0JA 4R9WA 2WXNA 4TRDA 1Q90A 2PVGC 2JSVX 3QOJA 4L63B 3NS1A 2WDVB 4TQ1A 1BR9A 3MP9A 3I4LA 4L23A 3TUOA 5BYSA 2K7VA 1C48A 1B2TA 1SJHD 1M8AA 4ABNA 5IT9E 2F0SA 3IXSA 1I4HA 1FIQA 4G57A 2NMQA 2PW9A 1IKLA 1NEKB 1PUTA 3SK6A 4BWGB 3ETRA 1K8OA 3EQLC 3K5LA 3A8KE 5C4HA