4DXGA

Crystal structure of staphylococcal superantigen-like protein 4 complexed with sialyl lewis x
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
194
structure length
194
Chain Sequence
EINPKFKDLRAYYTKPSLEFKNEIGIILKKWTTIRFMNVVPDYFIYKIALVGKDDKKYGEGVHRNVDVFVVLEENNYNLEKYSVGGITKSNSKKVDHKAGVRITKEDNKGTISHDVSEFKITKEQISLKELDFKLRKQLIEKNNLYGNVGSGKIVIKMKNGGKYTFELHKKLQENRMADVIDGTNIDNIEVNIK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Sugar binding protein
molecule keywords Staphylococcal enterotoxin-like toxin
publication title Structural and functional properties of staphylococcal superantigen-like protein 4
pubmed doi rcsb
source organism Staphylococcus aureus
total genus 52
structure length 194
sequence length 194
ec nomenclature
pdb deposition date 2012-02-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02876 Stap_Strp_tox_C Staphylococcal/Streptococcal toxin, beta-grasp domain
A PF09199 SSL_OB Staphylococcal superantigen-like OB-fold domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.110 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 4dxgA02
3.10.20.120 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 4dxgA01
1LTTD 1SJED 1BCPF 4DXGA 1TY0A 1BCPB 1LTGD 1M4VA 1LTSD 1LLRD 1I4HA 4OHJA 4RHSA 1LT3D 5D3IB 1EFID 1L0YB 3EA6A 4RGTA 1SE4A 3V05A 3MFGA 1RCVD 3EFXD 4NZLB 3SEBA 3BZDB 1LTAD 1V1PB 1S5FD 1PZKD 1RDPD 1STEA 1JR0D 1V1PA 1TS3A 2NTSA 3CHBD 4UDUC 1F77A 3DWPA 1ESFA 1EU3A 1HXYD 2NTTA 1CHQD 1SE2A 1YN5A 1DYQA 1GOZA 1KLUD 3MC0B 2O2LD 1AN8A 1KTKA 1FNVA 1L0XB 1ENFA 4RGNA 1D5XC 1LTID 1CHPD 1KLGD 1S5DD 4TSSA 4L63B 5FK9C 1S5ED 1JWSD 1SJHD 2TSSA 1B44D 1EU4A 1DJRD 1JCKB 1LT5D 2XRQD 1LT6D 5D3DA 1LT4D 1SBBB 5ELBA 2ICIA 1SXTA 1I4PA 2G9HD 1FNUA 1PYWD 1T5XD 3OWEB 1HA5A 1SE3A 1PRTC 3O13A 1RF2D 4Z9CB 4RHRA 1I4XA 5ELEA 3BVZA 1LTRD 3R2IA 1BCPC 1YN3A 1XXGA 1G8ZD 1I4GA 1V1OA 1QILA 1XTCD 1D6EC 1HQRD 2Z8LA 1YN4A 1UNSA 1S5BD 2AQ3B 1FNWA 1ET6A 1CQVA 1RD9D 3BVMA 2R61A 1TY2A 1CT1D 1CK1A 1FGBD 1TS4A 3DWQA 4RGOS 5ELCA 2XRSD 1EEFD 3BVGA 4C56C 2IJ0A 2CHBD 2XN9C 3URYA 1FD7D 1I4QA 3R8BA 1I4RA 1HTLD 2IPKD 1PRTF 1PTOC 3DWAA 5ELDA 4O1NA 1LO5D 4RH6A 1PZJD 1JWUD 1D5ZC 2RDHA 3GP7A 5TSSA 1EEID 1LTBD 4DXFA 2WV6D 1D5MC 1PZID 5ELFA 1JQYD 1JWMD 5FKAC 1TS2A 2XNAC 2AQ1B 1ET9A 4ZYSA 2QEJC 1UUPA 2RDGA 5I4DA 2AQ2B 4RGMA 3BYTB 3W2DA 4L6TB 3TSSA 3BYYB 1AW7A 1TS5A 1S5CD 3R2TA 4RCOA 1BXTA 1PTOD 1PRTD 2QILA 3KLSX 4RFBA 4BWGB 1B1ZA 1PTOF 1SEBD 2SEBD 1MD2D 1PTOB 1EWCA 1PTOH 1PRTB 4K6LA 1BCPD 2J4XA
chains in the Genus database with same CATH superfamily
3NWSA 4J6HA 3SDLC 1SJED 1BQQT 1CI3M 4AUQC 2D62A 1L5PA 4ARCA 2HJ8A 2PVOD 1FIQA 4L5QA 2IY5B 2A1AA 4UAIA 3H3VC 4DUYQ 3K0YA 2WDRB 2HIVA 4GOPC 2UUCL 4FXGC 3TBLD 1HTPA 1Q1BA 2R7ZB 2Z0DB 1KRSA 3GTLH 1KM7A 4DDID 3BINA 1D1IA 1X9NA 2F0EA 4IN3A 3KUCB 1N36Q 3AV8A 5GMVA 3K59A 2X6LA 1GUTA 3S2DH 1PH2A 3Q3MC 4HJ9A 1XPOA 3MXUA 4USAA 5AUIA 4BOSC 4NQKE 1PLFA 4AWJA 1IKMA 3AE8B 1GOZA 3PMFA 4HMIA 2L11A 1T3QA 1ZXHA 1P1AA 3ZXVA 2CKZB 1JMCA 1VF5C 4RGNA 4A6QA 2EYJA 2M1MA 2VUMB 1S5DD 2DNEA 4DR4Q 3VR9B 2D2QA 2MQHA 4R4IA 1QZHA 1K8GA 2RPVA 2PTLA 2A6HD 3FPPA 4GOPB 3S17H 1UF0A 4A3FB 3JAMc 1B53A 2EYPA 2YU9H 3CMAA 3I4MG 3KLWA 4EQOA 2G4SA 2LFIA 4GB9A 4NQLB 1XQQA 3SD5A 2BYEA 4FVMA 3V6CB 2HQLA 1EF5A 2PCFB 3BDCA 4NMZA 3O13A 2F0LA 3L7ZC 3DPDA 4WQOB 1GVPA 4NXNL 4A3GH 2W3SA 3TP5A 1VQ7A 1O80A 4BA1I 4P71A 5CHFA 2LFNA 2G1EA 1GO3E 1XXGA 1I94Q 3DHQA 4IC7B 4QB4A 1XLOA 4BY1H 1CTMA 2IW3A 1YIWA 1YN4A 1LFDA 1VQ8A 3DVGX 3U8ZA 3HOVG 1KXLA 3U9SA 2MEKA 2L4NA 1RD9D 2EELA 1WFQA 2KN4A 4MTKA 2MBHA 2NVYB 5ELCA 3M95A 1EWIA 3NHEB 4IJLA 2JA7B 1DOKA 2F0FA 5AUKA 1Y1VG 4JCVE 3FILA 3K81C 2DWQA 4FBJB 3Q23A 1YNJC 4FF4A 1WIAA 4HKQA 1K3BC 4KKIA 1O7ZA 2CHXA 2O5IC 3SU8X 3PV1A 1H9SA 5G55A 1X56A 2LS01 4HN7A 4DR1L 2HHHQ 2OTJA 3RI7C 4DAMA 3R66C 1G6ZA 4PT5A 1UE1A 2FXQA 1KFYB 2DZKA 3QX1A 4KX6B 1SB3C 1DONA 4HDQA 4BKSD 3QWNA 1C9FA 1ZW7A 2M56B 3RNEC 2F0OA 4BVUC 4GZYC 3A0JA 1V81A 4N9F4 2Z0SA 2A69C 3SHLA 1ENAA 2KHIA 2E5LL 4JWUC 4NJCA 1R7SA 2GOWA 1W3SA 1S5CD 4RCOA 1E1OA 2RCFA 1WTOA 1YJNA 1ZDXA 2LJIA 2MRPA 3KYDD 3ZRCA 4DWFA 4JI5Q 1CKMA 1HUNA 4ULLA 2ZPNA 1P8LA 2V9HA 3S15B 2IX3A 4YHHL 1BCPD 4EX5A 1HJPA 4OXPA 2WDVB 2ZM6L 3CF6E 4LFAQ 3VR5A 1KL9A 1XMQL 2BQQA 5LXIB 1I6HH 2F4VQ 1M4VA 1NVID 2KEDA 3Q8BA 2FJ2A 4UY8C 1ZKHA 3I57A 3IT6B 3QCAA 3ND9A 2ZVNA 5E6JA 3PZDA 4GSWA 3IRBA 2WXIA 5FLXc 3TZDA 5K36G 5M3FG 1NUCA 2VB2X 3JW0X 3ONAB 2NTSA 3K9PB 2MP2A 3HFZB 3FPUB 4UDUC 3UE0A 1GUWA 4OVZA 1WTHA 3ZQ4A 4CGYB 2BCOA 5EQ0A 5CR3A 1JROA 1SE2A 2EE1A 4BKGA 2MW5A 3AEAB 1IW7D 3F2UA 1MHXA 1OQYA 1KAWA 4I6PA 1RKNA 5T1GA 5JXVA 2A19A 2N1VA 4PYUA 4EQNA 3GTJH 3Q14C 3FEWX 2LSSA 1HR0L 2R92H 1FXTB 1UWMA 3LB8C 4M00A 3SFDB 3V61A 5E1FA 1JB7A 2NB0A 3P42A 3V60A 2G5DA 1WYGA 1JCKB 2CHZA 1QT9A 2BYFA 2W82A 1LT5D 3BZKA 3KDFB 1WE7A 4DQOC 5JZEB 1U4AA 1QOFA 4BXXG 3A4RA 5C5LA 1PYWD 5IYBG 1T5XD 2SOBA 2WAQB 3OWEB 1B9MA 1MG8A 2JVCA 3DOWA 1JRPA 4GKJQ 3D4DA 3NZ3A 3K0XA 2RHSB 1FCLA 4W9CA 1GUAB 1OXUA 4K6DA 3I55A 3BDOA 4BKTA 1XLNA 4BBRB 1ASZA 3AE4B 4JI2L 4C3HG 4A3BB 4TQ0A 1YNNC 5IP7G 1Z47A 2R7FA 1NDDA 3N1ZC 1VQ9A 2M19A 2UXBL 4MELA 3CRKC 3E56A 2ZJRA 3C1EA 1S3SG 5I9OA 1QOGA 5J17A 1E7PB 4ZRQA 1TWAH 1EEFD 3E5SA 3A55A 3BVGA 4FLHA 4MNOA 3RMHA 5BN5A 4B3SL 2MBBB 4XQJA 1K83H 3R8BA 1WGGA 1HEZE 3FILB 1UGMA 3QJZA 5CHVC 1HTLD 4J1MA 4JIOU 2M17A 2PMVA 2Q2IA 1SSOA 2KEEA 2WKCA 4RA8A 5CMDA 2VY3A 3NUHB 4CBVA 2LMCB 2OCEA 4C3JG 3OMGA 4DXFA 3ONSA 5IO9A 4LJPB 1SIFA 2JZZA 2QSDA 2WQYB 4LNKA 4A3MG 4EQPA 4OWWB 3D6WA 1N61A 3PO3B 3NHHA 4KK7A 4U68A 2PNHA 2K8CA 2VZKB 2LGXA 2W55A 3AE6B 4KV2A 1L4ZB 3VH4B 3JAML 4A8XC 1E6EB 5M9OA 2D0PA 4OO1H 1VDZA 1FGUA 3GTQH 2NVQH 2IWHA 2SNSA 3VA5A 3HOXH 1WJ4A 1AW7A 3L9AX 2N9EB 2ZCBA 3AE7B 2RGFA 2CVRA 2D3CA 4C7ZA 2JXMB 4GIVA 1EZ6A 2KMCA 3KUZA 4W9KA 5KIXA 4WWPA 3JAME 2MHVA 3NRZA 1PRTB 1NNXA 4PMBA 2J4XA 1DD2A 1XF5L 4IOIE 3AECB 1TY0A 1SYCA 4O42A 1PH3A 1LTGD 1FPYA 5MPOA 1A0IA 5GAGC 2OWOA 2F0PA 1KHIA 2SDFA 3C2PA 1C48A 1JJCB 2D10A 2KACA 1RCVD 4KKSA 1PH7A 4RKBA 1ICWA 4KSLC 4NAWA 2KJHB 4X6AH 2N9KA 4CDDC 3GTLB 1T0RC 2KX0A 4CHKA 1D3ZA 1PZKD 2MJDA 2MP2B 3K5MA 2JF5A 5M5XH 3MC8A 2KK8A 1WTRA 3S2DB 3MXGA 2NTTA 4ASWC 1TIFA 2LI5A 1UH6A 5DPTA 4DUYL 3VH3B 2RPQA 5IT9c 4A3JG 3TIXA 3A7AB 3BWUD 2VNUD 3DVGY 3L13A 2PZWA 3I4MH 1N36L 4DAVA 3P1MA 4HPLB 4JBWA 3AM9A 4B95A 1J9OA 2JE6I 3NTKA 4EKUA 3ZNGC 1ILPA 1NEKB 2MJ3A 1M90C 3S17B 5EE1A 2A69D 2NVUI 2EY5A 3CCSA 1RJTA 2LUMA 4XYCA 2YU9B 2KC2A 2K4KA 5IGGA 2LJ5A 2OEDA 3DM1A 3MHZA 3U30A 2X6GA 2CS4A 3P4SB 1PH6A 3S2HH 1SXTA 3T9LA 2KHWB 1FFVA 2KDEB 1I4PA 1STNA 4URKA 2W54A 4IM2A 5C0XG 5M3MG 4A3GB 3SDZA 3KUDB 4DR4L 3VDZA 1D1KA 5ELEA 2R2QA 3NS8A 1YQ3B 5IWAQ 2MA9B 3HOVH 4L2YA 4R9WA 2K01A 2IHFA 1ZYRC 4UP7A 1E7UA 4CDFC 2JSVX 4KV6A 4ANUA 1V80A 4BY1B 1S3OA 4EZJA 2F3VA 2R6GA 1FVIA 2JRIB 2VRRB 5FLXL 3ZUNA 2D3BA 1Z7TA 2WAQE 2MO1A 2NMQA 2PE9A 2F0VA 1C78A 3RD2A 2WACA 4A9AA 1I94L 1CKNA 1Q90A 1GM5A 2BDOA 2B63H 3UDIA 2FAZA 2CFMA 5GADC 3PSEB 4H2AA 5IGBA 1VMCA 2M0XA 1PZJD 3W1GA 3H7SA 4RM9A 5CC4A 3S1MH 2R3ZA 1UWXA 1BVSA 4ZDVA 3FC4A 3GQBA 2F3WA 3RUZA 1QF6A 1TKWB 3NBHA 1LTLA 3NVVA 2F0SA 3ZRFA 3FKYA 5M5WH 3AU7A 1TU2B 2AQ2B 1Q81C 4QL5A 4KGSA 3P75A 3OJ4B 3DVNU 3HIZA 2P5ZX 2DENB 3PLVA 2F52A 5HURA 1IHZA 2NBVB 5IKCM 2KQ3A 4W9FA 1TWHH 1X3QA 4CJ0B 3GZNB 3H3VI 4I6NB 4LF8Q 5A2QL 5BMIA 2B2UA 1CM9A 2K8HA 3NJTA 3IVFA 5K36H 4N6EB 1I6HB 2WXGA 1GG3A 3BDLA 2VB3X 4X62Q 3IAS1 4RG1A 1UEAB 5CV5A 3SVMA 4JI5L 2F0NA 4LNIA 1NMFA 5A2QE 5FLMH 3L16A 3VTUA 1HZ9A 2IX0A 1UBQA 1KABA 1ASYA 1IBKQ 4LFAL 3A4SC 1SN8A 3HRZC 2B2WA 2F4VL 3A54A 3TEYA 1F9SA 1JJGA 3C8YA 2EVBA 3W5OA 3VR2A 2PPHA 1XCQL 1W2BA 3IG3A 1P9DU 2WXFA 2MJEA 1ILQA 4FXCA 3E3XA 1I42A 1HZAA 5DM63 4PV1C 4DV7Q 5I6WA 4HRSA 4G7OC 2CH4W 3GTJB 2FCNA 4KDLB 3G6JB 4BXXH 2R92B 4YL8A 1UD7A 4QUFA 2IGGA 4MM3A 5KRUA 2B8FA 4L63B 4X64Q 1D8LA 1SJHD 2Y0SB 3P20A 5IYBH 3HOWG 2JZ3B 1EU4A 1GC6A 3B0AA 4REZA 1IYFA 2D07B 3MXNA 2K50A 5H1SE 2M4NA 3DBSA 1YHAA 1JW9D 2K8BA 2LXCA 3DM3A 2NBUA 4J3OD 1WX9A 5E3FA 2RD0A 5G3LD 2EXDA 3DBLB 4WRDA 1QKZA 2NPTA 4C3HH 2A74C 2KDMA 3TQYA 5IP7H 1K0SA 4B3TL 1V43A 2FUHB 3CKIB 3JC66 2GBKA 3RNFC 4AJWA 5L83A 4RHRA 4Y7NB 4ZRZA 3CW2C 3BU2A 2LXAA 1XJVA 3B9JA 5KNDA 4JVZA 5J22A 2K05A 2XK5A 1JOOA 1W6JA 2FCQA 4CJ1B 3RYTA 4A3EG 1MPEA 1GUOA 2F0UA 1WJJA 1WR1A 4DDGD 2K28A 1D4BA 3TREA 2AUKA 1JOKA 4HMJA 1UNSA 3HOYH 2UU9Q 4DR7Q 1J19A 3ER0A 4DV2L 4GKJL 1CZPA 2AX5A 2RMMA 4EQ5A 4KGRA 1TKGA 2OXPA 5D2MB 1TWAB 3NXWA 4RGOS 2FIFA 3QWZB 4LNNA 3WAMA 4C3JH 1YI2A 1CKNB 1MI2A 1K83B 3URYA 3A5ZB 3OTOQ 2EYLA 4Y52H 4TQUS 4A3MH 1Q46A 5IT9L 2M00A 4CKBA 2B2UC 2MFIA 5NUCA 3M62B 3CWIA 4OELB 2RDHA 1XNRQ 1WY8A 2DAFA 3PHWB 1UEBA 1CMXB 3R7RA 3GO5A 4RWSC 2K39A 5ELFA 2L3ZA 3NBHB 3PHXB 5JJLA 1KDAA 2XNAC 1T6BX 5IT9E 3LYYA 4KY6A 4HLEA 1CA6A 2BT6A 4DN4M 3GTQB 2NVQB 2JPHA 4LDTB 3CCUA 4L6TB 4AYBB 1XCTL 3HOXB 2LRWA 3CMMB 4BKSA 4DFAA 4OIJA 4OWXB 4OZBA 3IFDA 3RD4A 3S24A 4P2CB 1K0RA 4POGA 1IGCA 2KWUB 2QC8A 3I2ZA 2BE5D 3TUOA 4XYOA 2YTVA 5BO4B 1EIHA 1VZ8A 1WZ3A 1HFGA 3KWLA 4WJNA 4B9KA 4US8A 3I91A 1BCPF 1SNQA 1Y14B 4QAYA 2ZW0A 1II3A 3FAHA 5CBEE 4P1BC 1PV4A 4DUZL 4R4QA 2N3SA 3RNGC 2B2TC 4NB3A 3T1HQ 3VRAB 4X57B 1Q7YC 1TXYA 1GHJA 1KD1C 2ZPYA 2L0FA 3RN5A 3AE3B 4KKJA 2PW9A 2KZRA 3A56A 2R93G 1STEA 2A6HC 5M5XB 2EY6A 4RM8A 4ZRKA 2WB1G 3I72A 3VYSA 3RPFC 3VXWA 2ENBA 2BDNA 3HVDA 1SR3A 3W5VB 4JL9A 1UWVA 2DHZA 4ZHOA 1F52A 4A76A 4DV1Q 2IO2B 1IBLL 3IKJA 1FJGQ 4EVOA 2O2LD 1AN8A 3PIPA 1XPRA 2J53A 3B2GA 5HGQA 3SGIA 5IY0A 2BB6A 1QOBA 3I4MB 2RVLA 5GQOA 1PH8A 1EL0A 1OEYJ 5CHWA 4APVA 4C3IH 4MM3B 4DR3Q 3AU5A 4TSSA 3W1SC 4JX1C 4PG3A 1F2RC 3K5LA 1XLPA 3AN1A 1TVXA 3MXNB 5M3MH 3I3TB 3PTFC 2G3QB 2JA8H 2ZXOA 3I73A 4JYAQ 2ZTEA 3S2HB 1YD8U 4M0WB 1IXRA 2NPTB 3GB1A 2VQFQ 2Z4IA 5COYA 3GTKH 2PLPA 3EROA 2B2YA 4DV3Q 4KHZA 1TR5A 3G7LA 1OXTA 4QQBX 2NZ1D 5BYQA 4FADA 3MJ5A 2J0KA 1Y8PB 3PF4A 1AZQA 2XK5B 4H13C 3U4EG 1J0GA 2N8NA 2DYOA 1VQOA 3HKZE 1I4GA 5C23A 4RMFA 2Z8LA 2N78A 2WWZA 2KFKA 1JMLA 2GRIA 3BVMA 2GA4B 5IWAL 1CK1A 3U4VA 1IPGA 2FINB 2K04A 1QVFA 4GOPA 3NZUA 2DZMA 4ZK9B 1KDBA 4HCSA 4S0RA 2JUOA 1I4QA 1UE7A 3AE1B 2B63B 1EY8A 3PLUA 5C4XG 1R4NI 4ITKA 3APCA 2PNRC 1KIXA 3S1MB 5IP9G 3R93A 1XO3A 2L1AA 1KNEA 1A63A 2KD0A 3TEZA 1DOMA 4DV6Q 2V4LA 3ZIMA 3PIO3 4G7ZC 4XWTA 3OYYA 1VQIA 3E9SA 5EAYA 3MJWA 4IKGA 3U52E 1SE8A 3V2TA 5M5WB 2MH7A 2QEJC 2AWTA 3S16H 3VTWA 4IJHA 2QDLA 2Z6BA 1ROEA 1A3TA 1JICA 5BR8L 1GUNA 3M4OH 4M01A 3OG5A 4DHJB 4FXKC 3CC7A 3CCQA 3RLFA 1BUIC 3BYYB 4QCLA 1WXVA 4D2KA 4IPGA 1K8AC 1PMRA 4KZCA 3GTOH 1TWHB 4KJOA 1E9MA 3VA7A 4B3RQ 2G45B 3S9WA 4FA6A 2M8SA 2LZ6A 4DV0Q 1CKOA 1HNWQ 2ZJDA 4I6LB 1HPCA 3Q8DA 5AZHA 2DY8A 3K7UC 1VQLA 1V86A 1BCPB 1IW7C 4PK1A 1BBWA 3TS2A 2K6DB 1N5XA 2K5NA 4RF0A 3T1YQ 4LDTD 1OEYA 4XWWA 2D9UA 2WU5B 3DHIC 4LLGM 3SEBA 1YJ1A 3WANA 3CF5A 4LF8L 1A6XA 5EPJA 2F03A 1E2WA 2LXJA 4W9DA 3RZWC 2MNAA 2E3TA 1PYBA 4PS7A 2I5HA 3NPPA 2WGSA 2B2YC 2KCNA 1YHQA 2H88B 3FP9A 5HGTA 1IYJB 4FO2A 3SK4A 1CJEA 1CHQD 3PUZA 2GBNA 2BS2B 4A3PA 2I5MX 5EE0A 1DYQA 4IUTA 2ZW1A 1HTQA 2D11A 4WJPA 2MO0A 4HIDA 1Z6HA 1MJCA 3I4NG 1AARA 1IBKL 3G48A 1AFPA 2PO4A 3IL8A 4A3OA 2I2YA 3HOZG 1ENFA 2QCPX 1DGSA 3DXJC 3I3CA 1VQ4A 5FO8B 2V3PA 1AWDA 2WXPA 1C79A 2EKEC 2IX1A 1DJRD 1TT2A 4DK3C 4V0BA 1A3VA 4QF4A 1A2UA 1Q1OA 4PS8A 2NN6G 3STBC 1LT6D 3ENEA 3RN2A 2ICIA 4DV7L 1BOSA 3ZW3A 1F0ZA 3MC9A 4HIMA 1A70A 4C3HB 4A3EH 1J5EQ 5CYUA 1FMAD 2C5CA 4K81A 2O4XA 1N32Q 4X64L 4K14A 1J6QA 4NKLA 5E6OA 3RR5A 2L5TA 5C44G 4A93G 2DX5B 2IHEA 1PHJA 3IAYA 3LXFA 4G50A 4OVUA 1WGKA 1ZXIA 2BB5A 4G7HC 1UELA 2O6VD 3NTHA 3AMZA 4GGQA 2BVCA 2F3IA 3RNCC 3GZNI 3HOYB 4KHVA 1YITA 3SXHA 1OGWA 2KFKB 2KWCA 1C0AA 1ET6A 2ATWA 3KH0A 4YIJA 2LY7A 1ZP0B 1VRAB 4LF6Q 4L5SA 4ID6A 3J7AV 5IN7A 4C3JB 1DM0B 1WGRA 4II3B 2IJ0A 3KDFA 1J7CA 3SK5A 4IZ8A 3EVQA 2C7MB 2IL8A 4LNFA 4A3MB 2B76B 3ITPA 4ZYNA 1VQFA 2UU9L 4JBKA 4DR7L 4X66L 1DOLA 1T0YA 1O78A 4IW0A 4XQQA 4WFN3 1KF6B 1EQTA 3VR8B 2LVOA 3P4RB 4X3KA 2K75A 4A4IA 1IL2A 2MSED 4W9JA 1MSHA 1P98A 2AKWB 4FP5D 2LWPA 4HXDA 1UUPA 2BKRB 2RDGA 4JE3B 2BBCA 4HCNB 3Q6SA 1XNRL 1PDXA 2Z6KA 4LF5Q 3FKIG 5BN3A 2AMCB 1JC7A 3A74A 4ABNA 2I46A 1TS5A 3PO0A 2A73B 1YBYA 1ZEQX 4H0LC 3ULJA 1C7YA 1A15A 1PGBA 5T1IA 2KOLA 4BWGB 1B1ZA 4FDBA 3KFUA 5IOIA 1QE6A 2INNE 1NBWA 1L1OA 4A3IH 5LMUQ 1IKLA 1LTTD 4DV4Q 1K9MC 3APDA 2PQAA 3OW7A 3J81c 2YTXA 1HZBA 1ML0D 4DXGA 2LMCA 4WJ3M 3DBLI 1IP9A 1QG7A 1LLRD 1PXUA 4CDCC 3J80c 1LT3D 3Q69A 1WZ0A 4OZCA 4XGAB 5AEKB 2WXKA 3EA6A 2CW0C 4IUNA 5J18A 2MBQA 2EDGA 3LWUA 4WJ4A 2EYFA 1V8CA 3TCAA 4DHJD 2F0GA 4O2DA 1I7HA 1UE5A 3DDCB 3QHTA 1H9RA 1DOIA 4M8NA 2HD3A 4AJYB 3H9DA 1E24A 2JK8A 1MHHE 2PW5A 4K8JA 2L83A 2JA5G 1EY4A 1G2TA 3T1HL 1WXAA 2Q5WD 1YN5A 4HPMB 1OXSC 3OWFA 5E6PA 2VQEQ 4POFA 1TZOA 2EJGC 1VCIA 3A8IE 3A8JE 1MJEA 3C19A 4FXDA 1VD2A 4BBSH 3TMPB 2PMZB 1SNMA 2AWNA 4LFCQ 1XEEA 5C2TB 4LAAA 3WA0A 5AJ3L 4C3IB 1SYGA 2IY0B 1PH9A 4WURA 1LTID 2XTIA 1V2YA 3WAPA 1FXIA 2W3RA 3UE1A 3J7AF 3HGBA 3Q2AC 5M3MB 4XT3B 5DEHA 4LW1A 2EYMA 4GLXA 4XC2A 3CAMA 1LQBA 1XMOQ 2JA8B 4ZLTF 4DV1L 1E1TA 1FJGL 4KDIC 2PW7A 5HI1A 4QGUA 5CBAE 5CGKA 5DPWA 2CWPA 3GTKB 3KUPA 1QVGA 4LWCA 4IFDG 5G3LF 3MZ5A 1LGRA 5EGTA 3Q3NC 4OO1I 1CFMA 2WNMA 1WD0A 2UXDQ 3AEGB 5IYDH 4JBMA 4HWIB 1NBFC 3CPWA 3HUIA 3MEFA 4S3SA 2WX1A 1V9JA 2EJMA 3VDYA 3EUB2 1G8ZD 3GV6A 3K7AH 1LYLA 2UUAL 2HDEA 1JALA 2VQFL 1SNOA 2D5DA 1WGDA 2JN4A 4UP9A 4DV3L 2C5LC 1E90A 1DOXA 1HNZQ 2KKCA 4HEDA 2Z6KC 4X3TA 1E10A 5G5HA 3BS1A 5CTRC 3QIAA 4FJYA 4W9HA 3DUZA 2B3AA 5IP9H 2E2DC 5C3EH 2ONQA 2WXJA 3VQIA 4M8AA 1FD7D 1FCCC 1L2FA 5DAUA 1C9OA 3AB9A 1B9NA 1DOYA 1EZ8A 5C4JH 2NVTH 1L1OC 1TKEA 3DWGC 1DCZA 1BO0A 1LO5D 3M4PA 3T56B 1EYGA 4NP5A 1TWCH 1A8VA 3NK9A 1AH9A 2GN5A 1Y69U 5F2DA 1F9RA 2E2IH 4AQYQ 3S16B 1LM8B 5KNBA 1VQNA 4AS1A 4YSXB 4GMVA 2LEKA 5EDSA 1SF0A 2H1EA 2BGFA 3T16A 3STBD 3ULLA 2WINB 3M4OB 1E8ZA 5IOCA 3W2DA 2JX5A 3RCZA 5HKHA 3GTMH 1OXVA 3QARA 2JZPA 1C4AA 3X3NA 4DV6L 3GTOB 1AP0A 3QK0A 3QQ8B 4IQZA 1V49A 2Y5BB 2VL6A 1I6VC 1WRIA 2R7ZG 1EQQA 1L1OB 1EWCA 3OJ3A 3BK2A 3TEWA 5DPRA 1U4PA 2PQAB 1ZOYB 3WCQA 2AHOB 2QW7A 2JA6H 4AP4C 4ZUIA 2FE8A 1N62A 2EMTA 2JWZA 5IE8A 3AI5A 3QO2A 3KBGA 4WH4A 1JWBD 2QDFA 4IPCA 1B7YB 3RZFA 5JAVA 3MFGA 2ZXRA 4JI8Q 4EZLA 2K03A 3M7GA 4DV0L 4DR5Q 2KANA 3HHMA 2UXCQ 1N60A 1WTWA 4GN1A 1CZGA 1JR0D 1T9HA 3NBIA 3D4WA 3CMEA 1R4PB 3Q8EA 2H5XA 1MJDA 4HCPB 3MHBA 2JEBI 1MG4A 1EY6A 2L00B 4IM0A 1F2RI 4C1NK 4XX5A 1KNAA 1YJIA 4A3FG 2DGYA 3SK8A 2BA0A 3T1YL 2CKHB 2H89B 4L1BA 1VQCA 4GKKQ 1KLUD 2K5WA 1HE8A 1UBIA 3S1NH 4KHPQ 1KTKA 4U673 2CJOA 4C00A 4NDXA 1FNVA 4C2MH 3NVYA 2MJ8A 2ID0A 5I2YA 4ANVA 2KUMA 1XPUA 3AB5A 3Q8AA 4CKEA 4K2KA 4E71A 2V1CC 4CJ2C 1R4NB 4QUCA 2OHFA 3PV0A 3W1YA 2J7QB 5C44H 1D7QA 1WI0A 4TUUA 1JQ4A 4R4OA 1ONLA 2N55A 3D6CA 4A3EB 1RRBA 2G9HD 5M5YH 2PMZE 3U9OA 4A3LG 5DLQE 1Y8NB 2FCMA 2L52A 3WAOA 1O7YA 3J81L 4DAYB 2JA7G 3D8GA 2C7HA 3J80L 2SAKA 2IBIB 4LF7Q 5HHDG 4NPSA 3CIRB 5IGFA 2CW0D 3HM6X 3PUVA 3DQVA 4MJSA 1QILA 2K5PA 1WGYA 4KGTA 1V1QA 4DU9A 1SGHA 1J5EL 4E74A 2AQ3B 2KJXA 3R3OA 3J81E 1WTVA 1N32L 2JYEA 4WQMA 1H95A 3J80E 1FGBD 3AH7A 4WJQA 2XRSD 5DPSA 1XNQQ 2CU3A 3QOJA 4B9XA 4ZRIA 3KF8A 3F2DA 2Y5PA 1QJOA 1WXQA 2FUG1 2B2VC 2NVXH 1B50A 4FHJA 2F0IA 1YOVB 1YX5B 4MDKE 2HCIA 2R7DA 2G4DB 2MGSA 1E8WA 2LUEA 5LMNQ 1EEID 2BE5C 2PVGC 4EE2A 4JI6Q 3FKIH 3NQTA 2GBRA 3F2BA 4P73A 1RFKA 4KVGB 1Y1VH 3RN9C 1QVCA 3E9IA 4NNJB 4CDEC 3NS1A 1C4QA 3BYTB 3TSSA 1AYFA 2WIIB 1JRUA 5EKKA 5KNCA 2WXRA 4GNXC 4I65A 4HJKA 3ZVVA 1T5EA 4LF9Q 5FLXE 1BMLC 1GNUA 4JBJA 1Q8IA 3IBEA 1IL8A 1SROA 4A3IB 2K14A 1ENCA 4F8CB 3QAQA 2ZJQA 1C3TA 3P63A 2AWOA 2IT1A 4B0EA 1L0YB 5JVH3 4A3DG 5EPKA 3JYUA 4ICUA 4LF4Q 1WF9A 3L4PA 3P4PB 3E0EA 4P74A 4MGKE 3PS6A 3Q0AA 1XT9B 3A33B 3JSVA 4B3MQ 2QGQA 3VRBB 1OO9B 1TS3A 4H02A 1I50H 2K1BA 3S1QH 2YEPF 3ZTDA 1SNDA 4KY5A 4GNXB 2HHHL 1VF7A 2JT4B 3TL5A 2X8XX 5CV8A 4F8MA 2HDMA 2HUGA 4F87A 4BBSB 4DNTB 2AL6A 2BS4B 4IWPA 5E7NA 2KA7A 1OFFA 3ZJTA 2KVRA 2WAQG 1WJNA 5M3FH 3NENA 4K5XA 1KH0A 1WFYA 2L0CA 4A3KG 1WMHB 1L7YA 5JVG3 1KLGD 1IGDA 2BH8A 3NG0A 4IFDH 1NYRA 1BF4A 4A3CG 1K8MA 3R7QA 4KD4A 1VJKA 4QY7A 4DAPA 3G4SA 2VQEL 2O5JC 3CQZH 4BBRG 3FDTA 3GS2A 5D7GA 2J0TD 4A3BG 1ACCA 1F2YA 5EPLA 1RHPA 1M94A 4IM3A 4JV5Q 4HJ7A 5IGDA 2BWFA 1H9KA 2ZXPA 1Y8RC 2AEHA 2K33A 1NAPA 2OF1A 2HQEA 4ZUJA 2KLCA 3L17A 1S40A 4OZAA 5CORA 4AH6A 1XMOL 2YTYA 4JLCA 1GKHA 4P1CC 2EYOA 1MGSA 1J7BA 1WM3A 1EM7A 3K7AB 4LNQA 2HJ1A 2ON8A 4MJSB 4CHTB 1FXAA 2E6XA 4ZOHC 4FJVB 5C1ZA 2VS1A 4K5VA 2KC1A 1EYDA 5LXHA 3X0WA 2WHIA 1S5BD 5BMHA 3OPOA 1IBMQ 2VXWA 2F0TA 2O6VA 2B2TA 4XXEA 2R61A 1TY2A 3AXCA 2WDQB 2RQXA 3DWQA 5LMNW 4WORA 3HKZB 5C3EB 3KF8B 3W1BA 4C56C 2UUBQ 4M0WA 4L8JA 4V190 2RSNA 2NVTB 1EOTA 2IPKD 5C4JB 3IFTA 1F1HA 3QB3A 4O1NA 4O0AA 4YCVA 1LV9A 1WTQA 4RF1A 3JVZX 1IZ6A 1HNZL 3SK6A 5KYLA 1OTCA 1PGXA 2JXXA 1TWCB 4JGHB 3PT2B 2EYHA 3I70A 1YJ9A 4JPSA 2E2IB 4A90A 2NCNA 3MWYW 3DEPA 2L05A 2CWAA 1RFAA 2OQ0A 1E2ZA 3M4YA 4WWNA 1WR6E 4LFBQ 1LABA 2QA4A 2IO0B 3B08A 4NJ6A 3W1SA 3HK0A 1F2LA 4P72A 3GTMB 2RBMA 1VMPA 1EYCA 1VCBA 1EY0A 3ZNID 1L6VA 2JA9A 1UGJA 1ZUD2 2ZTCA 3CC4A 4N8X1 2A4ZA 2DYMA 3RFZB 3QG1A 1VQBA 4X3UA 4B08A 3D31A 3C1FA 5JOBA 1RYJA 1SEBD 4ARIA 4MH0E 1MD2D 4L5RC 2PE6B 3T3OA 3Q22A 4RNAA 2EJFC 1Z9FA 5CV6A 2JA6B 2GVAA 1WH3A 5A35A 2IDYA 5DNFA 2V4IB 3PQIA 5IYCG 2WX0A 5E6NA 4RCNA 4M02A 4DXAB 5D3IB 5JHBA 1Q1EA 4MN3A 4KSKC 2FNJB 2KLGA 2H4OA 2KDIA 1NY4A 4YWLA 4DNRB 3R3MA 3JSVB 4AIMA 1SFOH 3HM3A 1L2NA 4IUUA 3TJPA 1PFBA 3AE5B 1BR9A 2YEPB 4WAFA 2E75C 4K8IA 2A6EC 1YJJA 3JAMi 4DNIA 3HVZA 4GU2A 1Q82C 1RM6C 2QJLA 2NZHA 4HROA 3CRLC 3HKSA 3V6EB 4BBNF 4JI8L 1B4OA 2HIXA 3RT3B 2WB1E 3ZJUA 4DR5L 3S1NB 1Z2MA 4L5TA 2UXCL 3VR6A 4C7YA 1MVKA 2XVSA 3UI3A 4C2MB 3NEMA 3V62A 3K58A 4ME3A 3PO2G 1M1KC 1JT8A 3CSFA 3EGRA 1PA6A 4A3LH 5JH5C 4HJGE 4TVAB 2LKVA 4GKKL 2KNBA 1IUEA 5C44B 1E8YA 3GE8C 4DR1Q 3AULA 4ZHPA 4DA2A 4BY1G 4KHPL 4A3JH 3Q8FA 2B39A 3M9BA 2K22A 1FRDA 5G2NA 5M5YB 4R1JA 1FNUA 1TJEA 3MFYA 4Z9CB 1HZ6A 2TMPA 2XIWA 5KEEA 1TBEA 4RMAA 2V0GA 4KJNA 3QA8A 4JOIC 1YJWA 5L37A 2KTFA 4KTAA 1FO4A 4CKCA 2BOSA 4BY7G 3X23A 1V1OA 1R4MB 3UQBA 4HSPA 2BKFA 2K5VA 3NE5B 4HDOA 3L08A 4JI7Q 2O6VB 1G291 4BOZB 4LMQD 3KBXA 5C0XH 2DAJA 1WVLA 1EIFA 2OQKA 2F0QA 1A3UA 1JE5A 4DK5A 4LF7L 4RKLA 1VQGA 5CX3A 4TMAB 2NVXB 1G2SA 2HTME 3Q24A 5C5MA 1Q0WB 4HR7B 4WJWA 4GLSC 3MP9A 3UINB 2VH2A 2OJWA 2JP1A 5FR3A 1R4QB 3HOVB 3MVVA 5GAHC 4KD3A 1N9WA 3BZCA 4ODGA 1JJ2A 2E76C 1YHBA 2LGSA 2ZVOA 3L0WB 3FKIB 1XNQL 4GDKA 4II2B 4BFRA 1JQYD 2F0JA 4P75A 2QEXA 2WS3B 1K8RB 2ZZPB 3U2SC 3IHPC 4LTUA 5IGCA 3MAQA 1VQ5A 5C0XJ 4S17A 4DPGA 1Y1VB 4ZYSA 2QF7A 4BAXA 3I8ZA 2WLBA 1K53A 4GDLA 4LUZA 3Q3FA 2NYZD 2HE7A 4RGMA 5ELNA 5JJIA 1FRRA 1AE3A 2W9NA 1YQBA 2WU2B 4JI6L 4IO9A 1X1MA 1WSPA 4A55A 2JJQA 1WRDB 4EUTA 1RIPA 1Q8KA 4YY3Q 2E2JH 1YNXA 4MHEA 4N58A 4RFBA 4A3DH 2J7ZA 2PJHA 5D65A 3C0RB 4BBNC 4W9IA 3GP7A 3GDEA 4DK1A 2DBYA 3EFCA 4IG7B 3MTSA 2L76A 4HK2A 3ZJVA 3OAWA 1SRUA 4OHJA 1I4HA 4EOYA 2ZT9C 4HEA1 3GTGH 4DR2Q 4JI0Q 3DBRB 5IA7A 1I3QH 4MZ9A 4KI0A 4OGQC 3UI2A 4AOFA 4OVVA 1NI2A 1STBA 4K2LA 4JI2Q 2I38A 3S1QB 2R92G 1WX8A 3PUXA 2KQ7A 1ICFB 5IGEA 2QKIC 1U9RA 2Y0SG 4NAMA 3TBIB 2VH1A 2JYTA 3ML8A 4A3KH 3O65B 5JPMC 4EGVA 4OWTB 3A5UA 2WXLA 2B8GA 4HTHA 4XTCS 2RSUA 3F8TA 4B3ML 3LJ3A 1Q86C 5M3FB 4P16A 2X69A 2JQOA 4X65Q 3MEHA 3NP8A 1TWFH 3M3JA 4XIGS 5KHOA 3K6OA 2HD5B 4A20A 4I7AA 3DHHC 1L4DB 4YTNB 3CQZB 3VFKA 4HJ8A 1YVCA 3RZOH 3IAM1 1NYQA 5GROA 1Y1WG 4K5WA 2KN5A 5HY6A 3T8MA 4EZKA 4HJ5A 3OMCA 1C8CA 3L54A 1CUKA 2KDBA 2CCZA 4X62L 4XDXA 4W9LA 3ZXRA 5BMGA 4G4KA 3RUIB 1RLFA 5KGUA 2WDTB 2KCCA 3HOWH 2D5GA 1L6UA 4IOCA 2BWES 1STAA 3AEFB 2BTEA 4YTMB 5JPNC 1CQFA 1EIYB 3EECA 3HOUG 3AEEB 3EHVA 1HQRD 2M2LA 2KOXA 1E5WA 4PNYA 3A9JB 2D3GA 4P6VF 4LUVA 4JI1Q 4OX9Q 1TS4A 1VQAA 2IO3B 1BT0A 5CV9A 4MEMA 1MI0A 3VVWB 4ANWA 2A6ED 3E0JA 1HH2P 2XN9C 5BYRA 1I4RA 1XD3B 1SYFA 4OO1G 3BY4B 1KQSA 2JRHA 4G57A 4RH6A 2M9VA 4AYBG 2DNFA 4FN2A 1V97A 3U7ZA 1IBML 2AL3A 4DR6Q 5TSSA 3DHGC 3M63B 5TR5A 1JB3A 1D5MC 4GDKB 3AE9B 2JYOA 4K3CA 3L3OC 2DLBA 3H7PB 1HR0W 4KIKB 4E6IA 2UUBL 4H7BA 3GV3A 3K8AA 2BW2A 3CCMA 4GDLB 1GXDC 2DY7A 1H9MA 1GB1A 1H4RA 2F1MA 1C1YB 2BS3B 2HT1A 3F1ZA 4B9WA 3TMEA 4JQWC 3R2TA 5IYCH 2L8JA 1PTOD 2ZTDA 2JXTA 5J3BA 4R4CA 2FMMA 1K50A 4UPAA 1B3QA 3DVNV 3KJOA 4PZ6A 1KRTA 3H0GG 3TZUA 4GS3A 4K6LA 3FMCA 2DNCA 4NXMQ 4LFBL 1SAPA 2R2OA 3SR1A 4PS3A 3A7LA 3TP6A 3H91A 2J42A 1I35A 2I0QA 5C3XA 1YN3A 1SSNA 3OIPA 3N32A 2MHJA 2CHWA 3A9KA 3I4OA 2RR9A 1Y8OB 4N8FA 1MFWA 3UDGA 3OTOL 1CSQA 2PQEA 4IUMB 3SFEB 3UQAA 3Q3OC 3EFXD 3NUCA 1SFOB 5KYIA 1C4PA 4KKUA 4XQNA 2K5DA 1JOQA 2INPE 2Z9HA 2PEAA 1S5FD 1RDPD 2OT2A 2KX3A 2GLSA 2N4FA 2JEAI 1O7LA 3A1QA 2MP1A 2O2VA 3PRZA 2EPBA 2L9HA 2ES2A 5I9PA 4M8MA 1EUVB 3TN2A 3ETRA 2IYDB 3PO2H 1B70B 3L10B 1X65A 2NS5A 1J8CA 2L32A 4YWGG 5EE3A 3KYCD 4TKOB 2FCSA 2R93H 2REXA 3KQ4A 5JEAG 1STYA 2SNMA 5AZGA 2AUJD 1JWSD 5LL6X 3RULA 4K7SA 3VR3A 2Q8RE 3T4AC 1HTOA 1NSNS 2GBMA 2JQRB 4N9TA 1FL0A 1JWAD 3D0FA 3AEVA 1C4CA 3W9CB 5ELBA 4A3JB 3RNUA 4JC0A 1GJXA 4ZRPA 1WCMG 1M8AA 2N0SB 3FVQA 3PRPB 1HA5A 1TWGH 3M85A 4BY7H 3MXPA 3WWVA 2DZIA 2EY2A 2Y5CA 4FF2A 4KY7A 3ULPA 4C1NI 3BVZA 3WALA 2Q2HA 4IURA 3VYRA 1LTRD 4DGZA 1PH1A 4K0KQ 3K5NA 3R2IA 1OTRB 1V5OA 3GTPH 1HZ5A 1YNTE 2F4IA 1T0QC 1ZDVA 2B63G 4NJ7A 2KBNA 4ZRJA 2Y3AA 2RA4A 3J7YW 4W9GA 2K52A 1XTCD 5J1ZA 1A2TA 2MUYA 3L0OA 2ZNVC 1WI5A 1PUTA 3TS0A 3FRPB 3E9HA 4F1SA 2FFKB 1WTXA 1CT1D 1GAQB 2LVQA 2RDFA 1GUSA 4I7ZC 4ALPA 1O7IA 2J0MA 4IPDA 3T53B 3W5UB 2E8GA 2CHBD 2KMMA 3WIMA 1VDVA 1PRTF 3MHSD 4DR3L 5LL6S 1AE2A 1AEXA 1WTPA 5BYSA 3L2PA 2B29A 4JI7L 1HRJA 4PZ8A 2VZAA 1ZKOA 1OQQA 2KJ6A 2G9DA 4DAYA 1RAXA 1YMHE 4JYAL 1SYDA 4YCWA 4TRDA 4G3XB 3PCOB 1IBXA 4WAAA 3HP3A 2ZNVB 1N34Q 2ICEC 2K7VA 1VR9A 4DK0A 3KLSA 1X3PA 5C4XH 4HKZE 1QWYA 1F9QA 3ERSX 4F88A 4JPBW 2NN6I 1CSPA 2IO1B 3NSWA 1TIID 3T3NA 1MHWC 2DN8A 4Q5VA 1D2BA 2UU7A 2YLMA 1JE4A 3VR4A 1J8IA 1BXTA 3J81j 2E2JB 5LLIA 3RLNA 1SLJA 1E7VA 4JK1C 2LHEA 4A3DB 1B2TA 2SEBD 1WGHA 5FLMG 3I9V1 5AFWA 4ZQ3A 1EO6A 1RTNA 2PI2E 1X3GA 2XGTA 4LJZC 3CCLA 1SMYC 1OQRA 1KRHA 4OL7A 3LGJA 1RL2A 1HFNA 2CU1A 1F2MA 2EOTA 4B3TQ 3GTGB 3A9KB 4GOCA 4YY3L 1SE4A 3OIQA 4OEMB 4BZAA 1RODA 1I3QB 2GMIC 4H44C 4XDDA 3S1RH 2K32A 2GB1A 1BUVT 1LTAD 3UIOB 1X3FA 3H6NA 1V1PA 2E2HH 3CCVA 3A1QB 1HQMC 2C9WB 3WDNA 4ZCKA 2O2VB 1ZXTA 3WOEA 3S2AA 4IOAA 1R4MI 2KFJA 1ESFA 4DV2Q 4A3KB 5H8YE 4DR2L 4JI0L 3ZDMC 5EJWA 1X32A 2B2VA 3ND8A 4Y7NH 1R9TH 1TZ1A 5IODA 4NY0A 3H09A 4TV3A 3CPFA 2D3AA 3OHXC 1NE3A 1YEZA 3PVLA 4YT0B 1L0XB 1Y1WH 1TWFB 2K0PA 3M3YH 3PGEA 5FOBB 2XSCA 4F7ZA 2YV5A 4C4VA 1X55A 5EBCA 4B3RL 4J6IA 3BJUA 1U4MA 3RZOB 1P7FA 2KTRA 4R8IA 1IYVA 1SIJA 3S14H 4K7UA 4MACA 1HNWL 2KAJA 2BH2A 5IP4D 1H8CA 1PFSA 3J7ZC 1Q3LA 2C9OA 3KJPA 4FF1A 1F9PA 3HOYG 4X65L 2VUMG 3I4NH 2I5LX 4JI4Q 2KVZA 3P1HA 2L55A 3HOUH 1PRTC 2IGHA 1RF2D 3HOZH 3H1UA 3ZNHB 1Z5SB 4GNXA 3OW2A 1H9SB 3HOWB 4LJOB 3D3RA 1G91A 3IT4B 4MGZE 1I5FA 2N9PC 2F0HA 4YCUA 4QIWB 5JJZA 1RTOA 1DXMA 2NN6H 4DV5Q 3KVFB 1VZ7A 2KDFB 2KO3A 3AFQA 2PKOA 5J39A 1B9RA 1T0SC 1WMHA 4HJAA 2KWVB 1CQVA 2N7DA 2NR2A 1GUGA 1KLVA 3HS0C 2WYQA 1WD1A 3OOCA 3MA2B 3F2CA 4DUZQ 1V5TA 4A93H 4G11A 3K80C 1HCZA 4TQ1A 1LACA 3NTIA 1N63A 3DBRI 3QJYA 5C4ZA 1SDFA 1NI3A 4BA2I 3PUYA 1D5ZC 3K57A 1CZWA 4JI1L 1LTBD 4MTNA 5DM73 4OX9L 3KYHC 3KK7A 1G6JA 1STGA 5CV7A 1QQRA 1KC8C 1SNCA 3DBHB 1IBXB 1TS2A 1QB5D 3M4QA 3J7A5 2AQ1B 1PGAA 3H15A 4PYZA 4XE0A 4ZAIA 2N49A 3M7NA 1E0BA 1IBLQ 5HFYA 2NUCA 3NOBA 3DCGA 2PZUA 3H0GH 4DR6L 3APFA 2EQSA 3KF6A 3I63C 3Q8CA 3TEXA 2RCNA 4DHZB 2LHDA 1YNJD 3TDQA 1FYCA 4IFDI 2IY1B 3OLMD 2QILA 5KHQA 1W6KA 3UF8A 5L95C 2K5QA 2Z4HA 1K51A 3T13A 1BNZA 4AQ7A 1PTOH 1QZGA 5I4DA 5E4WC 1NENB 1X54A 3CC2A 3QC8B 4WIPA 5J2RA 3I4LA 2CH4A 2M0AA 4LF6L 4MGYE 1WYDA 1LTSD 1SNPA 3ZO5B 1EFID 3PPAA 2KQSA 1XYIA 1KDCA 1XTDA 5I2XA 1E22A 2CR5A 3V05A 5LHY1 2KJRA 3I5JC 2XEWA 1Y56A 3PF5A 2Q2TA 2PYKA 3NY5A 3RLOA 1U4RA 4NXML 2WXQA 3BZDB 2N7JA 3VTVA 2A68C 1V1PB 4C3IG 1N33Q 1VLBA 2QIEB 2A5HA 3CD6A 1EY9A 1F77A 2DJGC 2WFWA 2Z1CA 3N3KB 4JI3Q 1EF1A 3UIPB 1HNXQ 4YSZB 1HXYD 5JEAH 1TGZB 1WXSA 1KOTA 3VYTA 1HUMA 2JA8G 3PO2B 2IZVB 1SYEA 1YX6B 2KT7A 4C80A 1U4LA 3TP7A 4QJFA 2WP8J 1P7EA 1EIGA 1WWTA 3IFWB 3TEHB 1P3QU 1PH4A 1L0VB 4PZ7A 3UDXA 4LF5L 2R93B 4HSVA 4DBGA 4GN5A 4IALA 2EZVA 3GD7A 5FO7B 1WCMH 3QR8A 1FFUA 4C4VB 2KMAA 2WB1B 2EIFA 1S5ED 2GBJA 2HCCA 4JW0A 2KTRB 2MCNB 2JA5H 4CO7A 2PZTA 4HCEA 4KLKA 5JJKA 5D3DA 1QOAA 3N9YC 5LMUL 1Q12A 4DV4L 1F2ZA 1VQ6A 2LGIA 2LGYA 5JEAJ 4EFOA 1TWGB 4GN4B 3WOFA 4FYDA 4BY7B 4DKAC 1HA6A 4B6WA 1YZ6A 3X3MA 2INCC 4K3BA 5BR8Q 1HHVA 2MBEA 1ZPSA 1SMYD 5D14A 4KN4C 5FJ8G 3EC8A 3GTPB 4K7WA 3H94A 1L0WA 4DF7A 3EFUA 2D0OA 3BIID 1JORA 4XDCA 1VQPA 4XT1B 2KCMA 4FJZA 2QMTA 4IWQA 3ZKJC 3ALBA 4IUQA 3N30A 2LGDA 1EQVA 3AEDB 2KHSA 3ZNZB 3J9CA 5K5PA 4DK6C 2FHTA 2KENA 5JHAA 4K0KL 5EKIA 4MH8A 5ISRA 3PREA 2A5UA 4LFCL 1TKYA 1VQDA 3ERQA 4ME5A 1CA5A 3FHWA 3OSOA 2C7NB 2QHOA 1OXXK 4UHVA 4QIWE 2FMCA 4YWKA 1P0RA 3DLLA 3EIVA 3N1XC 3AE2B 1UE6A 4KMUC 1QNKA 3ZJYC 3U4ZA 3NVZA 2BA1A 3TP8A 4MSMB 2J52A 2VZKD 1YNND 3VYUA 1X3EA 4YXDB 2C35B 4MSQB 4GXBA 4K1RB 1TYGB 1EFWA 4IFDJ 2LRUA 2D2CC 2YVCA 1LXDA 1FEHA 2NBWB 4NAWB 1GPXA 2V3NA 3CCRA 4YSYB 1MSGA 1BKBA 5C4XB 4HIKA 1ZE3D 1TT5B 2Z59B 2N88A 1P16A 2N9LA 2UXDL 4ZKCB 3KF6B 2K3UA 1HZCA 2B3GA 2WP9B 2I07B 2L12A 4US9A 3ZTCA 1EQRA 3PO3G 2I1KA 1PRTD 1VQHA 3QOLA 1EUJA 3SR6A 4GLVB 1E8XA 2ACZB 2BPSA 1PTOF 5BN4A 1EY5A 2UUCQ 2I1JA 1N34L 4IWOA 4B0MA 5C3JB 2KVMA 3ML9A 3I7FA 3RZDH 3U50C 3E6ZX 3BG3A 2KECA 3BK1A 4EEWA 3AFPA 2MX2A 4JOIA 2F0MA 1QUQA 2XWBB 1DGJA 4PQXA 2K1FA 4E3CA 4RGTA 3I90A 4KN7C 1K52A 4IPHA 4DHZE 3Q3JA 1EWHA 1F9JA 3S1RB 4NZLB 3AU4A 2BYTA 2YYZA 2R7ZH 1N5WA 1BBXC 1EY7A 2XBBC 3LDZE 1XX8A 3P2BA 2E2HB 2CJNA 3EBEA 3CHBD 4Q0FA 2BYVE 2N9XA 1QLBB 3DWPA 3EJIA 3MTNB 1GJZA 1C76A 1EU3A 5I6YA 2FBWB 2ZCCA 1R9TB 3VUYA 5C0XI 4AQYL 3NVWA 5CV4A 3MC0B 1MBYA 2V4DA 3W3AA 2Q2UA 5D6JB 4HIOA 4L23A 3HEJA 4R8NA 4F7XA 3EN2A 3G6EA 1Y1WB 4ACFA 3DMUA 4UP8A 1PFMA 3U58A 1D5XC 3M3YB 2JWUA 4Q2JA 3RNAC 1V9PA 5FK9C 4NXNQ 2VUMH 4X66Q 3A8KE 1B44D 2EMSA 3S14B 3C3LA 3H3VH 4R3DA 3HZXA 4A3FH 2Q8IB 1SBBB 2DJFC 1UAPA 1IYUA 1VQJA 1EWYC 2GI9A 3PRMB 1GHKA 3KOJA 2DUDA 3I4NB 1SYBA 1PYSB 2XWJB 4MT5A 3HOUB 2L0TA 3ZDTA 4HPPA 4X3SA 1SE3A 1NMGA 2EY1A 4QMGA 3HOZB 2LXKA 2IGDA 2RDBC 2NZOA 4LNOA 2OEOA 2RSOA 2NWGA 2ASBA 1I4XA 4YWMA 1B3AA 3NQIA 1A62A 2K6QA 3CU7A 3SHQA 2KCTA 4N9PA 3DWMA 1K8OA 4FNFA 4TKNA 3H8HA 2C60A 1TTNA 2OOBB 4WWOA 4A3GG 3ICEA 4JI4L 3P7JA 5IIFA 4KKTA 4CYEA 2WKDA 3EQLC 4XYQA 1FNWA 2L1BA 2VW9A 2LD9A 2A68D 1RWSA 2EKIA 1U0LA 2B2WC 1J7AA 4PMCA 2NVYH 1ESRA 1MIUA 4A93B 2MPMA 5LNK1 2JA7H 1B8AA 1S1QB 1K73C 4FULA 4DV5L 5H92C 3DWAA 1PTOC 1UZXB 3B2FA 5C3WA 2JU6X 5T8IA 4W9EA 1E0ZA 1ZYRD 1YIJA 5D94A 2UWQA 2K6AA 4NW2A 2E5LQ 1GC7A 1YQ4B 3GE3C 1EYAA 4OW0A 1S4ZA 1A5RA 4LK1C 1NR4A 3T51B 4OONA 5FKAC 1WJUA 3GOEA 4MGIE 4ILWA 3PSIA 4WWMA 1FD6A 3N52A 2JY6A 3Q6BA 3J81i 4A3IG 2INDC 1BBUA 4LK0M 3RNBC 1GB4A 3TRZA 2WXOA 3ZGZA 2WXHA 3J80i 4YHHQ 2AYOB 1WE6A 2ZM6Q 2KWDA 5E4XA 3A9JA 3H0GB 2X38A 1U5KA 1XMQQ 3U7DA 2RF4A 5AJ3Q 2ZEQA 3B1LX 3CP0A 1SE9A 3DEOA 3I56A 1FR3A 1TQOA 2MBOA 3AQQA 4IUVA 1NJIC 1NR2A 1WJ6A 3VUXA 4YTPB 3KLSX 5FR6A 1PTOB 2L7RA 5C6AA 4PMWA 3NELA 1PFNA 1QNUA 3LX0A 4RAUC 3S15H 3D4RA 1NTGA 4WJOA 4JWSC 2CQOA 4KZ0A 2BF8B 2Z0EB 3B6YA 4RHSA 1QCBD 1QUQB 1NCVA 3LNNA 2V1YA 3H7PA 4KIKA 3PIP3 2PI2A 1XWEA 1ISNA 4ICVA 4BBSG 4FF3A 2N1WA 3KW5B 1K3RA 2F0DA 1FM0D 4JG2A 1LM0A 1WM2A 1XLQA 1AZPA 5GXGB 5LMNL 2UUAQ 2V3SA 4J15A 1VS0A 3PGZA 2OTLA 3CSTA 1HR0Q 1N8RC 4HAEA 3G71A 5EBDA 2PIAA 5EE9A 4MIUA 1QOHA 1E2VA 2KHJA 3RMKC 3PIOA 2E74C 2Y0SE 3CCEA 2PPBC 4G0NB 4BS9A 3N20C 2UYZB 1V8QA 4A75A 1WYWB 1N33L 1GD7A 1Q10A 1QZEA 3NWTA 2DYBA 1LUZA 5FO9B 1WCMB 1CHPD 2ASQA 4CQNA 2MQJA 3AMUA 4JI3L 2L15A 3N6RA 3PUWA 3LWEA 1BDOA 2TSSA 1PDQA 3HG9A 5IYDG 1HNXL 2KYWA 3KWVA 4LF9L 2JA5B 3P4QB 3ECIA 2QDBA 4OIKA 5GAEC 1G6PA 1H9JA 1N6ZA 2XRQD 3ZYYX 4GN3B 2Q8TA 3IXSA 5FJ8H 1LT4D 2J0JA 2CQAA 2F0KA 2RKSA 1I50B 1S72A 3DBHI 1VQMA 3HRDD 4NPNA 5HG2A 5DCNA 1E7ZA 3VHTC 4P7IA 1WXMA 2ALYB 2UXBQ 2KQ4X 3CXCA 4XZ4A 1KAAA 1SMXA 3K5OA 1PFDA 3V3XA 2NBFA 4LF4L 3HKZG 5C3EG 3PZ8A 4A3CH 1BCPC 4B3SQ 1K28A 4BBRH 3PZ7A 3H6MA 3VUWA 3V96A 4A3BH 3ABVB 1D6EC 1ZGUB 3K9OB 3VAWA 4LCDE 4HVBA 4IDIA 3AEBB 1WOCA 2K5HA 4GLAC 5ELOA 3N1YC 1PQSA 1PH5A 1WX7A 4R4TA 3D32A 4ZKBB 3UDFA 1DZ1A 2HTHA 4N59A 4J8QA 5ELDA 1Q5WB 1VQKA 3CCJA 1JWUD 1VQEA 2GVBA 2ZJPA 4ANXA 2WXNA 2WV6D 2K25A 1C77A 1G51A 2F0WA 4LUOA 2HDLA 1EOVA 1PZID 4AYBE 1JWMD 5C4HA 4JV5L 3C46A 3PO3H 1ET9A 2MWSB 5AZFA 1KJTA 2K9XA 3AYHB 2JA6G 2QCZA 1X6OA 1E3PA 2JSOA 2WXMA 2N7EA 4FHKA 3ZLZA 2RHQB 3QIJA 2LASA 1MKHA 3SE0A 5IAAC 1V6EA 1PVOA 5G5GA 2DZJA 4IUPA 2FIDA 2OJRA 1VZ6A 1STHA 2MLBA 2EXZA 3KLRA 3NZSA 2A8VA 3UGBB 2LVPA 4M1UB 3RZDB 5EKLA 2KXJA 3HOXG
chains in the Genus database with same CATH topology
3NWSA 4J6HA 1SJED 1BQQT 1CI3M 2D62A 1L5PA 4ARCA 2PVOD 1FIQA 4UAIA 3H3VC 3K0YA 2WDRB 4FXGC 1HTPA 1Q1BA 2R7ZB 1D1IA 2F0EA 4IN3A 3AV8A 3K59A 2X6LA 1GUTA 3MXUA 4USAA 5AUIA 1PLFA 1IKMA 3AE8B 1GOZA 3PMFA 4HMIA 2L11A 1T3QA 1ZXHA 1VF5C 4RGNA 4A6QA 2EYJA 2VUMB 1S5DD 2DNEA 3VR9B 2RPVA 2PTLA 2A6HD 3FPPA 4A3FB 1B53A 2EYPA 4EQOA 2LFIA 4FVMA 2PCFB 3BDCA 4NMZA 3O13A 2F0LA 3L7ZC 2W3SA 3TP5A 1O80A 4BA1I 2LFNA 2G1EA 1XXGA 3DHQA 4QB4A 1XLOA 1CTMA 2IW3A 1YN4A 3U9SA 2MEKA 2L4NA 1RD9D 2EELA 2KN4A 2NVYB 5ELCA 2JA7B 1DOKA 2F0FA 5AUKA 3FILA 2DWQA 3Q23A 1YNJC 4FF4A 4HKQA 4KKIA 1O7ZA 2O5IC 1H9SA 2LS01 4HN7A 1G6ZA 4PT5A 1KFYB 4KX6B 1SB3C 1DONA 3QWNA 1C9FA 2M56B 2F0OA 4GZYC 2A69C 3SHLA 1ENAA 4JWUC 4NJCA 1R7SA 1S5CD 4RCOA 1WTOA 2LJIA 1ZDXA 1HUNA 4ULLA 3S15B 2IX3A 1BCPD 2WDVB 3VR5A 1M4VA 1NVID 2KEDA 3Q8BA 2FJ2A 5E6JA 3I57A 3IT6B 3ND9A 2WXIA 3TZDA 5K36G 1NUCA 2VB2X 3ONAB 2NTSA 3FPUB 4UDUC 1GUWA 4OVZA 3ZQ4A 4CGYB 2BCOA 5EQ0A 5CR3A 1JROA 1SE2A 2EE1A 3AEAB 1IW7D 3F2UA 1MHXA 5JXVA 1RKNA 5T1GA 4EQNA 3SFDB 3FEWX 1UWMA 3LB8C 5E1FA 2NB0A 3P42A 1WYGA 1JCKB 1QT9A 2W82A 1LT5D 4DQOC 1QOFA 5C5LA 1PYWD 1T5XD 2SOBA 2WAQB 3OWEB 1B9MA 1JRPA 3D4DA 3NZ3A 1FCLA 1OXUA 4K6DA 3BDOA 1XLNA 4BBRB 3AE4B 4A3BB 4C3HG 4TQ0A 1YNNC 1Z47A 2M19A 3CRKC 3E56A 3C1EA 5I9OA 1QOGA 1E7PB 4ZRQA 1EEFD 3E5SA 3A55A 3BVGA 3RMHA 5BN5A 4XQJA 3R8BA 3FILB 1HEZE 1HTLD 4J1MA 2PMVA 1SSOA 2KEEA 2WKCA 4RA8A 5CMDA 3NUHB 4CBVA 4DXFA 2LMCB 4C3JG 3OMGA 2QSDA 2WQYB 4EQPA 1N61A 3D6WA 2VZKB 3PO3B 3NHHA 4KK7A 4U68A 3AE6B 2W55A 1L4ZB 3JAML 4A8XC 1E6EB 5M9OA 4OO1H 1VDZA 2IWHA 2SNSA 3VA5A 1AW7A 3L9AX 3AE7B 2CVRA 4C7ZA 2JXMB 1EZ6A 5KIXA 3JAME 2MHVA 3NRZA 1PRTB 4PMBA 2J4XA 1DD2A 1XF5L 4IOIE 3AECB 1TY0A 1SYCA 4O42A 1LTGD 5MPOA 3C2PA 2F0PA 2SDFA 1C48A 2KACA 1RCVD 4KKSA 4RKBA 1ICWA 2N9KA 3GTLB 1PZKD 2MJDA 3K5MA 1WTRA 3S2DB 3MXGA 2NTTA 3A7AB 3BWUD 2VNUD 2PZWA 4DAVA 3P1MA 4JBWA 3AM9A 1J9OA 2JE6I 3NTKA 1ILPA 1NEKB 2MJ3A 3S17B 5EE1A 2A69D 2EY5A 1RJTA 2LUMA 2YU9B 2OEDA 5IGGA 3DM1A 3MHZA 2X6GA 3P4SB 1SXTA 1FFVA 1I4PA 1STNA 2W54A 5C0XG 4A3GB 3SDZA 1D1KA 5ELEA 1YQ3B 4L2YA 4R9WA 2K01A 1ZYRC 2JSVX 4KV6A 4BY1B 2F3VA 2R6GA 5FLXL 1Z7TA 2NMQA 2F0VA 1C78A 2WACA 4A9AA 1Q90A 2BDOA 4H2AA 5IGBA 1VMCA 1PZJD 5CC4A 2R3ZA 1UWXA 3FC4A 3GQBA 2F3WA 3RUZA 1QF6A 1TKWB 3NBHA 3NVVA 2F0SA 3AU7A 1TU2B 2AQ2B 4KGSA 3P75A 5HURA 1IHZA 2KQ3A 1X3QA 4CJ0B 5BMIA 5A2QL 2B2UA 1CM9A 5K36H 4N6EB 1I6HB 2WXGA 3BDLA 2VB3X 3IAS1 1UEAB 5CV5A 3SVMA 2F0NA 5A2QE 2IX0A 1KABA 3HRZC 2B2WA 3A54A 3TEYA 1F9SA 3C8YA 2EVBA 3VR2A 1XCQL 2WXFA 2MJEA 1ILQA 4FXCA 5DM63 4PV1C 5I6WA 4HRSA 4G7OC 3GTJB 3G6JB 2R92B 4QUFA 2IGGA 5KRUA 2B8FA 4L63B 1SJHD 2Y0SB 3P20A 4REZA 1EU4A 3MXNA 1JW9D 4J3OD 5E3FA 5G3LD 4WRDA 1QKZA 2A74C 2KDMA 1V43A 3CKIB 4RHRA 4Y7NB 4ZRZA 3B9JA 5KNDA 5J22A 2K05A 1JOOA 1W6JA 4CJ1B 1MPEA 1GUOA 2F0UA 1D4BA 2K28A 2AUKA 1JOKA 4HMJA 1UNSA 2AX5A 1CZPA 2RMMA 4KGRA 1TKGA 2OXPA 1TWAB 3NXWA 4RGOS 1MI2A 1K83B 3URYA 2EYLA 4TQUS 5IT9L 2M00A 4CKBA 2B2UC 5NUCA 3CWIA 2RDHA 3GO5A 4RWSC 5ELFA 1KDAA 2XNAC 1T6BX 5IT9E 3LYYA 4KY6A 1CA6A 2BT6A 4DN4M 3GTQB 2NVQB 4L6TB 4AYBB 1XCTL 3HOXB 4DFAA 4OIJA 4OZBA 3IFDA 3RD4A 4P2CB 1IGCA 2BE5D 3TUOA 4XYOA 1EIHA 1VZ8A 3KWLA 1HFGA 4US8A 3I91A 1BCPF 1SNQA 2ZW0A 1II3A 3FAHA 5CBEE 2B2TC 3VRAB 1GHJA 3AE3B 4KKJA 2PW9A 3A56A 1STEA 2A6HC 5M5XB 2EY6A 3I72A 3VYSA 3RPFC 2ENBA 2BDNA 3HVDA 3W5VB 4ZHOA 3IKJA 4EVOA 2O2LD 1AN8A 3B2GA 2J53A 2BB6A 1QOBA 3I4MB 2RVLA 1EL0A 4MM3B 4TSSA 4JX1C 1F2RC 3K5LA 1XLPA 3AN1A 1TVXA 2ZXOA 3I73A 3S2HB 3GB1A 2Z4IA 5COYA 2PLPA 3EROA 2B2YA 4KHZA 1TR5A 3G7LA 1OXTA 2NZ1D 5BYQA 3MJ5A 1Y8PB 1AZQA 4H13C 3U4EG 2DYOA 1I4GA 2Z8LA 1JMLA 2GRIA 3BVMA 2GA4B 1CK1A 2FINB 2K04A 4ZK9B 1KDBA 4HCSA 1I4QA 3AE1B 2B63B 1EY8A 4ITKA 2PNRC 3S1MB 3R93A 1XO3A 2L1AA 1KNEA 3TEZA 1DOMA 3PIO3 4G7ZC 4XWTA 3E9SA 4IKGA 3U52E 3V2TA 5M5WB 2MH7A 2QEJC 1ROEA 1A3TA 1JICA 1GUNA 4FXKC 1BUIC 3RLFA 3BYYB 4QCLA 4D2KA 1PMRA 1TWHB 4KJOA 1E9MA 3VA7A 3S9WA 1HPCA 2DY8A 1BCPB 1IW7C 1N5XA 4RF0A 4XWWA 2D9UA 2WU5B 4LLGM 3SEBA 1A6XA 5EPJA 2F03A 1E2WA 2E3TA 3NPPA 2B2YC 2KCNA 2H88B 5HGTA 4FO2A 3SK4A 1CJEA 1CHQD 3PUZA 2BS2B 5EE0A 1DYQA 4IUTA 2ZW1A 1Z6HA 2I2YA 1AFPA 2PO4A 3IL8A 1ENFA 2QCPX 3DXJC 3I3CA 5FO8B 2V3PA 1AWDA 1C79A 2IX1A 1DJRD 1TT2A 4V0BA 1A3VA 4QF4A 1A2UA 2NN6G 1LT6D 2ICIA 1BOSA 1F0ZA 1A70A 4C3HB 5CYUA 1FMAD 2C5CA 2O4XA 4K14A 4NKLA 2L5TA 3IAYA 3LXFA 1WGKA 1ZXIA 2BB5A 4G7HC 3NTHA 3AMZA 3HOYB 4KHVA 3SXHA 1ET6A 4YIJA 2LY7A 1ZP0B 1VRAB 4ID6A 3J7AV 4C3JB 1DM0B 2IJ0A 1J7CA 3SK5A 4IZ8A 3EVQA 2IL8A 4A3MB 2B76B 3ITPA 1DOLA 1O78A 4XQQA 4WFN3 1KF6B 1EQTA 3VR8B 3P4RB 4X3KA 1MSHA 4FP5D 1UUPA 2RDGA 4JE3B 2BBCA 3Q6SA 1PDXA 5BN3A 1JC7A 4ABNA 3PO0A 2I46A 1TS5A 2A73B 1ZEQX 4H0LC 1A15A 1PGBA 5T1IA 2KOLA 4BWGB 1B1ZA 1QE6A 2INNE 1IKLA 1LTTD 3OW7A 4DXGA 1ML0D 2LMCA 1QG7A 1LLRD 1PXUA 4OZCA 1LT3D 3Q69A 2WXKA 3EA6A 2CW0C 4IUNA 2EDGA 3LWUA 2EYFA 1V8CA 2F0GA 1I7HA 1H9RA 1DOIA 1MHHE 2PW5A 4K8JA 2L83A 2Q5WD 1EY4A 1G2TA 1YN5A 1OXSC 3OWFA 1TZOA 2EJGC 1VCIA 3A8IE 3A8JE 4FXDA 2PMZB 1SNMA 2AWNA 5C2TB 1XEEA 4LAAA 4C3IB 1SYGA 4WURA 1LTID 1FXIA 2W3RA 3J7AF 3HGBA 5M3MB 4XT3B 5DEHA 2EYMA 2JA8B 4ZLTF 2PW7A 5HI1A 5CBAE 5CGKA 3GTKB 3KUPA 4IFDG 5G3LF 3MZ5A 5EGTA 4OO1I 1CFMA 2WNMA 1WD0A 3AEGB 3HUIA 4S3SA 2EJMA 3EUB2 1G8ZD 3GV6A 2HDEA 1JALA 1SNOA 2D5DA 1DOXA 4HEDA 4X3TA 1E10A 5G5HA 3BS1A 3QIAA 3DUZA 2E2DC 2ONQA 2WXJA 3VQIA 4M8AA 1FD7D 1FCCC 5DAUA 3AB9A 1DOYA 1B9NA 1EZ8A 3DWGC 1TKEA 1DCZA 1BO0A 1LO5D 3T56B 4NP5A 3NK9A 1Y69U 5F2DA 1F9RA 3S16B 5KNBA 4AS1A 4YSXB 2LEKA 1SF0A 2H1EA 3T16A 2WINB 3M4OB 5IOCA 3W2DA 2JX5A 1OXVA 2JZPA 1C4AA 3X3NA 3GTOB 1AP0A 4IQZA 1WRIA 1I6VC 1EWCA 3BK2A 3TEWA 1U4PA 1ZOYB 3WCQA 4ZUIA 2FE8A 1N62A 3QO2A 3KBGA 1JWBD 5JAVA 3MFGA 2ZXRA 2K03A 3M7GA 1N60A 1WTWA 1CZGA 1JR0D 3NBIA 3D4WA 1R4PB 3Q8EA 3MHBA 2JEBI 1EY6A 1F2RI 4C1NK 1KNAA 1YJIA 3SK8A 2BA0A 2H89B 4L1BA 1KLUD 2K5WA 1KTKA 4U673 2CJOA 4NDXA 1FNVA 3NVYA 2MJ8A 2ID0A 5I2YA 2KUMA 3AB5A 3Q8AA 4CKEA 4K2KA 4CJ2C 4QUCA 2OHFA 3PV0A 1JQ4A 1ONLA 2N55A 3D6CA 4A3EB 2G9HD 3U9OA 1Y8NB 2L52A 1O7YA 3J81L 3D8GA 2SAKA 3J80L 5HHDG 3CIRB 5IGFA 2CW0D 3PUVA 1QILA 2K5PA 4KGTA 4DU9A 2AQ3B 2KJXA 3R3OA 3J81E 1WTVA 2JYEA 4WQMA 3J80E 1FGBD 3AH7A 2XRSD 2CU3A 3QOJA 4B9XA 3KF8A 2Y5PA 1QJOA 1WXQA 2FUG1 2B2VC 1B50A 2F0IA 2HCIA 2MGSA 1EEID 2BE5C 2PVGC 4EE2A 3NQTA 1RFKA 3NS1A 1C4QA 3BYTB 3TSSA 1AYFA 2WIIB 5EKKA 5KNCA 2WXRA 4I65A 1T5EA 5FLXE 1BMLC 1Q8IA 1IL8A 4A3IB 1ENCA 3P63A 2AWOA 2IT1A 4B0EA 1L0YB 5JVH3 5EPKA 3L4PA 3P4PB 3Q0AA 3VRBB 1OO9B 1TS3A 2YEPF 2K1BA 1SNDA 4KY5A 1VF7A 5CV8A 4F8MA 2HDMA 2HUGA 4F87A 4BBSB 4DNTB 2BS4B 2KA7A 1OFFA 3ZJTA 4K5XA 1KH0A 2L0CA 5JVG3 1KLGD 1IGDA 4IFDH 1NYRA 1BF4A 1K8MA 4KD4A 1VJKA 4DAPA 4WH4A 2O5JC 3GS2A 5D7GA 3FDTA 2J0TD 1ACCA 1F2YA 5EPLA 1RHPA 5IGDA 1H9KA 2ZXPA 2K33A 1NAPA 2OF1A 2HQEA 4ZUJA 4OZAA 5CORA 2EYOA 1MGSA 1J7BA 1EM7A 3K7AB 2ON8A 4CHTB 1FXAA 2E6XA 4ZOHC 4K5VA 1EYDA 1S5BD 5BMHA 3OPOA 2VXWA 2F0TA 2B2TA 4XXEA 2R61A 1TY2A 2WDQB 2RQXA 3DWQA 4WORA 3HKZB 5C3EB 4C56C 4M0WA 4L8JA 4V190 2RSNA 2NVTB 1EOTA 2IPKD 5C4JB 3IFTA 3QB3A 4O1NA 1LV9A 1WTQA 4RF1A 3SK6A 5KYLA 1PGXA 1TWCB 2EYHA 3I70A 4JPSA 2E2IB 4A90A 3MWYW 3DEPA 1E2ZA 3M4YA 1LABA 3W1SA 1F2LA 3GTMB 2RBMA 1VMPA 1EYCA 1EY0A 1L6VA 1UGJA 1ZUD2 3RFZB 2DYMA 3QG1A 4X3UA 4B08A 3D31A 3C1FA 5JOBA 1RYJA 1SEBD 4ARIA 1MD2D 3T3OA 3Q22A 4RNAA 2EJFC 2JA6B 5CV6A 2IDYA 2V4IB 5A35A 5DNFA 4RCNA 5D3IB 1Q1EA 4MN3A 2H4OA 4DNRB 4IUUA 1PFBA 3AE5B 1BR9A 2YEPB 4WAFA 2E75C 4K8IA 2A6EC 1YJJA 3HVZA 1RM6C 2QJLA 4HROA 3CRLC 1B4OA 3ZJUA 3S1NB 3VR6A 4C7YA 1MVKA 2XVSA 3UI3A 4C2MB 3K58A 3EGRA 4HJGE 2LKVA 1IUEA 5C44B 4ZHPA 4DA2A 3Q8FA 2B39A 2K22A 1FRDA 5M5YB 1FNUA 1TJEA 3MFYA 4Z9CB 1HZ6A 2TMPA 2XIWA 5KEEA 2V0GA 4KJNA 4KTAA 1FO4A 4CKCA 2BOSA 1V1OA 4HSPA 3NE5B 1G291 4LMQD 3KBXA 5C0XH 1WVLA 2F0QA 1A3UA 4RKLA 4TMAB 2NVXB 1G2SA 2HTME 3Q24A 5C5MA 4HR7B 4WJWA 4GLSC 3MP9A 2JP1A 5FR3A 1R4QB 3HOVB 3MVVA 4KD3A 4ODGA 2E76C 3FKIB 1JQYD 2F0JA 2WS3B 3U2SC 4LTUA 5IGCA 3MAQA 5C0XJ 1Y1VB 4ZYSA 2QF7A 3I8ZA 2WLBA 1K53A 2NYZD 4RGMA 1FRRA 2WU2B 4A55A 1WSPA 4N58A 4MHEA 4RFBA 2J7ZA 5D65A 3GP7A 4DK1A 2DBYA 3MTSA 3ZJVA 4OHJA 1I4HA 2ZT9C 4HEA1 4OGQC 4KI0A 3UI2A 1STBA 4K2LA 2I38A 3S1QB 3PUXA 5IGEA 2QKIC 1U9RA 4NAMA 3TBIB 2JYTA 5JPMC 4EGVA 2WXLA 2B8GA 4HTHA 4XTCS 5M3FB 4P16A 2X69A 3MEHA 3NP8A 4XIGS 3K6OA 1L4DB 4YTNB 3CQZB 3IAM1 1NYQA 4K5WA 3OMCA 1C8CA 4XDXA 5BMGA 4G4KA 5KGUA 2KCCA 2D5GA 1L6UA 1STAA 3AEFB 2BTEA 4YTMB 5JPNC 1CQFA 3AEEB 1HQRD 2M2LA 4PNYA 4P6VF 1TS4A 5CV9A 1MI0A 2A6ED 3E0JA 2XN9C 5BYRA 1I4RA 1SYFA 4OO1G 4G57A 4RH6A 2M9VA 1V97A 3U7ZA 5TSSA 1JB3A 1D5MC 4GDKB 3AE9B 2JYOA 3L3OC 2DLBA 4E6IA 4H7BA 3GV3A 2BW2A 4GDLB 1GXDC 2DY7A 1H9MA 1GB1A 2F1MA 2BS3B 4B9WA 3TMEA 3R2TA 1PTOD 2JXTA 1K50A 2FMMA 3TZUA 4K6LA 3FMCA 2DNCA 1SAPA 3SR1A 3A7LA 3TP6A 3H91A 2J42A 5C3XA 1YN3A 1SSNA 3OIPA 1Y8OB 3SFEB 2PQEA 3EFXD 3NUCA 1SFOB 5KYIA 1C4PA 4KKUA 4XQNA 2K5DA 1JOQA 2INPE 1S5FD 1RDPD 2OT2A 2JEAI 1O7LA 2MP1A 2EPBA 2L9HA 5I9PA 3TN2A 3ETRA 2L32A 4YWGG 5EE3A 4TKOB 3KQ4A 5JEAG 1STYA 2SNMA 2AUJD 1JWSD 5LL6X 3VR3A 2Q8RE 3T4AC 1NSNS 2JQRB 4N9TA 1JWAD 1C4CA 3W9CB 5ELBA 4A3JB 1GJXA 4ZRPA 1M8AA 2N0SB 3FVQA 1HA5A 3M85A 3MXPA 2EY2A 2Y5CA 4FF2A 4KY7A 4C1NI 3BVZA 4IURA 3VYRA 4DGZA 1LTRD 2WXPA 3K5NA 3R2IA 1HZ5A 1YNTE 2F4IA 1ZDVA 2Y3AA 2RA4A 3J7YW 5J1ZA 1XTCD 1A2TA 2MUYA 1PUTA 3FRPB 2FFKB 1WTXA 1CT1D 1GAQB 2RDFA 1GUSA 4I7ZC 3T53B 3W5UB 2CHBD 2KMMA 1VDVA 1PRTF 5BYSA 5LL6S 1AEXA 1WTPA 1HRJA 1ZKOA 1OQQA 2G9DA 4DAYA 1YMHE 1SYDA 4TRDA 1IBXA 3HP3A 2ICEC 2K7VA 1VR9A 4DK0A 3KLSA 1X3PA 4HKZE 1QWYA 1F9QA 4F88A 2NN6I 3NSWA 1TIID 3T3NA 4Q5VA 2DN8A 1D2BA 1JE4A 3VR4A 1J8IA 1BXTA 2E2JB 2LHEA 4JK1C 4A3DB 1B2TA 2SEBD 3I9V1 5AFWA 4ZQ3A 1RTNA 4LJZC 1SMYC 1OQRA 1KRHA 4OL7A 1HFNA 1F2MA 2EOTA 3GTGB 1SE4A 3OIQA 1RODA 1I3QB 4H44C 4XDDA 2K32A 2GB1A 1BUVT 1LTAD 1V1PA 1HQMC 3WDNA 1ZXTA 3WOEA 1ESFA 5H8YE 4A3KB 5EJWA 1X32A 2B2VA 3ND8A 5IODA 3H09A 3OHXC 4YT0B 1L0XB 1TWFB 2K0PA 5FOBB 2XSCA 5EBCA 1U4MA 3RZOB 1P7FA 4MACA 4R8IA 1IYVA 1SIJA 2KAJA 1Q3LA 2C9OA 4FF1A 1F9PA 3P1HA 2L55A 2IGHA 1PRTC 1RF2D 1H9SB 3HOWB 3D3RA 1G91A 3IT4B 2F0HA 4QIWB 5JJZA 1RTOA 1DXMA 2NN6H 1VZ7A 2PKOA 5J39A 1B9RA 1CQVA 1GUGA 3HS0C 1WD1A 3OOCA 3MA2B 1HCZA 4TQ1A 1LACA 3NTIA 1N63A 3QJYA 5C4ZA 1SDFA 1NI3A 4BA2I 3PUYA 1D5ZC 3K57A 1CZWA 1LTBD 5DM73 3KK7A 1STGA 5CV7A 1QQRA 1SNCA 1IBXB 1TS2A 1QB5D 2AQ1B 1PGAA 4XE0A 4ZAIA 3M7NA 1E0BA 5HFYA 2NUCA 2PZUA 3Q8CA 3TEXA 2LHDA 1YNJD 3TDQA 1FYCA 4IFDI 2QILA 1W6KA 2K5QA 2Z4HA 1K51A 3T13A 1BNZA 4AQ7A 1PTOH 5I4DA 5E4WC 1NENB 4WIPA 3I4LA 2M0AA 1LTSD 1SNPA 1EFID 1XYIA 1KDCA 5I2XA 3V05A 5LHY1 1Y56A 2PYKA 1U4RA 2WXQA 3BZDB 2N7JA 2A68C 1V1PB 4C3IG 1VLBA 2QIEB 2A5HA 1EY9A 1F77A 2Z1CA 4YSZB 1HXYD 5JEAH 3VYTA 1HUMA 3PO2B 1SYEA 4C80A 1U4LA 3TP7A 2WP8J 1P7EA 1EIGA 1WWTA 1L0VB 2R93B 4HSVA 4IALA 2EZVA 3GD7A 5FO7B 1FFUA 2WB1B 1S5ED 2HCCA 2PZTA 4HCEA 5D3DA 1QOAA 3N9YC 1Q12A 2LGIA 1F2ZA 5JEAJ 1TWGB 3WOFA 4FYDA 4BY7B 1HA6A 3X3MA 1HHVA 1ZPSA 1SMYD 5D14A 4KN4C 3GTPB 3H94A 4DF7A 3BIID 4XDCA 1JORA 4XT1B 2QMTA 4IUQA 1EQVA 3AEDB 2KHSA 3J9CA 5K5PA 2FHTA 5EKIA 4MH8A 5ISRA 1TKYA 3ERQA 4ME5A 1CA5A 3OSOA 1OXXK 2FMCA 3AE2B 4KMUC 1QNKA 3NVZA 2BA1A 3TP8A 2J52A 2VZKD 1YNND 3VYUA 4YXDB 1TYGB 4IFDJ 2D2CC 1FEHA 4NAWB 1GPXA 2V3NA 4YSYB 1MSGA 5C4XB 1ZE3D 2N88A 2N9LA 4ZKCB 2K3UA 2WP9B 2I07B 2L12A 4US9A 1PRTD 3QOLA 3SR6A 2ACZB 1PTOF 5BN4A 1EY5A 4B0MA 5C3JB 2KVMA 3E6ZX 3BG3A 2KECA 3BK1A 2F0MA 2XWBB 1DGJA 4PQXA 4RGTA 3I90A 4KN7C 1K52A 1EWHA 4NZLB 3S1RB 2BYTA 2YYZA 1N5WA 1BBXC 1EY7A 1XX8A 2E2HB 2CJNA 3CHBD 4Q0FA 1QLBB 3DWPA 3EJIA 1C76A 1EU3A 5I6YA 2FBWB 1R9TB 5C0XI 3NVWA 5CV4A 3MC0B 1MBYA 2V4DA 3W3AA 4L23A 3HEJA 4R8NA 4F7XA 1Y1WB 3DMUA 2JWUA 1PFMA 3M3YB 1D5XC 4Q2JA 5FK9C 3A8KE 1B44D 3S14B 3C3LA 4R3DA 3HZXA 2Q8IB 1SBBB 1UAPA 1IYUA 1EWYC 2GI9A 1GHKA 3I4NB 1SYBA 2XWJB 4MT5A 3HOUB 4X3SA 1SE3A 2EY1A 4QMGA 3HOZB 2IGDA 2OEOA 2RSOA 2NWGA 1I4XA 1B3AA 3NQIA 3CU7A 4N9PA 3DWMA 1K8OA 4FNFA 3H8HA 3P7JA 5IIFA 4KKTA 2WKDA 3EQLC 4XYQA 1FNWA 2L1BA 2A68D 1RWSA 2EKIA 2B2WC 1J7AA 4PMCA 1ESRA 4A93B 2MPMA 5LNK1 5H92C 3DWAA 1PTOC 3B2FA 5C3WA 2JU6X 5T8IA 1E0ZA 1ZYRD 2K6AA 4NW2A 1YQ4B 1EYAA 4OW0A 1S4ZA 4LK1C 1NR4A 3T51B 5FKAC 4ILWA 1FD6A 4WWMA 3N52A 1GB4A 4LK0M 2WXOA 3ZGZA 2WXHA 2KWDA 5E4XA 3H0GB 2X38A 3DEOA 1FR3A 1TQOA 4IUVA 1NR2A 4YTPB 3KLSX 1PTOB 5C6AA 4PMWA 1PFNA 1QNUA 3LX0A 4RAUC 3D4RA 4JWSC 4RHSA 1QCBD 1NCVA 3LNNA 3PIP3 1XWEA 4FF3A 2F0DA 1FM0D 1XLQA 1AZPA 5GXGB 4HAEA 5EBDA 2PIAA 5EE9A 4MIUA 1QOHA 1E2VA 2E74C 2PPBC 4BS9A 1V8QA 1Q10A 3NWTA 5FO9B 1WCMB 1CHPD 4CQNA 3AMUA