4DXGA

Crystal structure of staphylococcal superantigen-like protein 4 complexed with sialyl lewis x
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
194
structure length
194
Chain Sequence
EINPKFKDLRAYYTKPSLEFKNEIGIILKKWTTIRFMNVVPDYFIYKIALVGKDDKKYGEGVHRNVDVFVVLEENNYNLEKYSVGGITKSNSKKVDHKAGVRITKEDNKGTISHDVSEFKITKEQISLKELDFKLRKQLIEKNNLYGNVGSGKIVIKMKNGGKYTFELHKKLQENRMADVIDGTNIDNIEVNIK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural and functional properties of staphylococcal superantigen-like protein 4
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Sugar binding protein
molecule keywords Staphylococcal enterotoxin-like toxin
total genus 52
structure length 194
sequence length 194
ec nomenclature
pdb deposition date 2012-02-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02876 Stap_Strp_tox_C Staphylococcal/Streptococcal toxin, beta-grasp domain
A PF09199 SSL_OB Staphylococcal superantigen-like OB-fold domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.110 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 4dxgA02
3.10.20.120 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 4dxgA01
1HXYD 1L0XB 1PTOB 1FD7D 5ELDA 5D3IB 1KLGD 1TS4A 1LTID 1UNSA 1ESFA 1LT6D 1SJHD 1KLUD 1TS3A 1LT3D 4DXGA 4RHRA 1LTTD 1YN3A 1RDPD 5FK9C 1M4VA 2IPKD 1HA5A 4O1NA 3KLSX 1AW7A 2AQ3B 2TSSA 5ELFA 1LTAD 1SE4A 1F77A 1PZKD 1EU3A 1FNUA 3SEBA 1SXTA 4TSSA 1D5XC 4C56C 1TY0A 4RGNA 1L0YB 1DJRD 1D5ZC 2SEBD 1V1PA 1PRTD 5ELEA 1I4XA 2G9HD 1YN4A 3CHBD 3EFXD 4RFBA 1LTRD 2O2LD 3MFGA 1BCPD 1HTLD 1TS2A 4L63B 2XRSD 1FGBD 1S5FD 1TS5A 3DWQA 1RCVD 1KTKA 3BVZA 3EA6A 4DXFA 1EEID 1XTCD 2J4XA 5I4DA 1PRTC 5ELCA 1QILA 1D5MC 2XRQD 5D3DA 1BCPC 1I4HA 3TSSA 1LTBD 1JR0D 1ET9A 1HQRD 1JWMD 1PZID 3R2IA 1PYWD 2RDHA 4RHSA 1CHPD 1UUPA 1JWUD 2R61A 5ELBA 4RCOA 1PRTF 2AQ1B 4L6TB 3W2DA 1BCPB 3BYTB 1JWSD 1PTOC 1S5DD 2QILA 1DYQA 1XXGA 2RDGA 4RH6A 1CQVA 1PTOF 1I4RA 1V1PB 1ET6A 2ICIA 2QEJC 2IJ0A 5TSSA 1EFID 1BXTA 1CT1D 1I4PA 1SE3A 1RD9D 4NZLB 1LTGD 1PTOH 3BVMA 3URYA 2CHBD 4OHJA 4ZYSA 1LLRD 4Z9CB 1BCPF 1STEA 1PZJD 1D6EC 4RGMA 1S5BD 2NTTA 1PTOD 3V05A 1EEFD 1JQYD 2Z8LA 1LT5D 3MC0B 1GOZA 1CK1A 3BVGA 4RGOS 1MD2D 1FNWA 1SE2A 1TY2A 2AQ2B 1I4QA 1JCKB 3BYYB 3GP7A 1S5ED 1I4GA 1V1OA 2NTSA 1CHQD 2XNAC 3R2TA 3DWPA 1RF2D 1SEBD 3BZDB 4K6LA 4BWGB 4RGTA 2WV6D 1FNVA 3DWAA 1EU4A 1SBBB 1S5CD 1EWCA 3O13A 3OWEB 1PRTB 1LO5D 1B1ZA 1ENFA 4UDUC 3R8BA 1G8ZD 1B44D 1AN8A 1SJED 1LT4D 1LTSD 1T5XD 5FKAC 1YN5A 2XN9C
chains in the Genus database with same CATH superfamily
4BA2I 2MGSA 3GD7A 3HRZC 4KI0A 2R93H 3FKIH 3SXHA 1LT6D 5EAYA 2PZTA 3CQZB 5IYCG 1CZGA 1CI3M 1XNRQ 2G1EA 3DM3A 4X64L 1E2VA 3E9IA 4GKJQ 1IYFA 4C3JB 1M4VA 4I6PA 5IYBH 3NZUA 3ND9A 2F0KA 3S1NB 1XLQA 3VUYA 1Y1WB 3M62B 1KIXA 3VR9B 1ZE3D 5ELFA 1VD2A 2ZPYA 3TP5A 2MBBB 3I4LA 4JI4L 4A3PA 2JWZA 3A1QB 5C4ZA 2UUAL 1VZ8A 2M56B 4A8XC 3ZDMC 1FXAA 3UIPB 4AYBB 1FRDA 1CKMA 1NMGA 2JA8B 2B2UA 4CJ0B 4DUZL 1RM6C 3JAME 2E3TA 1E2WA 1MGSA 4G3XB 3Q69A 1D4BA 1Q7YC 4HMIA 3CHBD 4FVMA 2MHJA 4RFBA 1IYJB 2RHSB 4CJ2C 4L2YA 2MQJA 4S17A 4LLGM 4X3UA 1Q12A 1TS2A 1Q0WB 2W3SA 4X3SA 2B2WC 5HFYA 3MXGA 3NTKA 2JA5H 2D5GA 1EY4A 1UWMA 1WGGA 1GXDC 1RL2A 4IUTA 2INCC 4AJYB 1TWAB 5DM73 1JB3A 4YIJA 2N55A 3W5UB 3ZIMA 2N8NA 4IOCA 5IE8A 2D3CA 4YCUA 3H15A 2ZVNA 5C4XH 3K0XA 4R8IA 1LFDA 1D5MC 4IG7B 1XMOQ 4Q0FA 5FLXc 3U4VA 1VQLA 1GC6A 4US8A 1DOLA 1K0SA 1FYCA 2LVPA 4TUUA 2JA7B 2LGIA 4AJWA 1E7VA 1O7IA 4KIKA 3SK6A 1WX7A 5IKCM 2YEPF 4L6TB 2E2HH 2MCNB 3ND8A 4GZYC 2EYLA 3SK8A 1C7YA 1F2LA 4BBSH 3QIJA 3ETRA 4BFRA 3U52E 3A54A 1L6UA 1VZ6A 2MJ3A 1I4RA 4LF6Q 2RSNA 3VAWA 4AUQC 4MM3B 2IJ0A 4G57A 4HIKA 1FPYA 4A3CH 1TWCH 2IWHA 4LNOA 4HCSA 3WAPA 3NOBA 1WF9A 4MACA 4N9F4 3ZJYC 2JJQA 2HT1A 4RNAA 2EPBA 1UD7A 4EZJA 1OQQA 2WDQB 4H2AA 3TRZA 5J3BA 1Q81C 1STEA 2E2JB 3CSTA 1PZJD 4P74A 2ASBA 4REZA 2LGSA 1OO9B 1QOBA 5C4JB 3I5JC 2XTIA 1Y69U 5FLXL 1JRUA 2M9VA 3GZNB 1K28A 2D0OA 2EXDA 2MO0A 3KUZA 4TMAB 1HQMC 4C3HG 2KLCA 2K5PA 1ZP0B 1TWFB 3T1YQ 2UUBL 1GOZA 4B6WA 3AE7B 4MDKE 4R4QA 1MD2D 3A0JA 3UQAA 4CKBA 2JE6I 2KOXA 1A6XA 4PS3A 1U4MA 3ML8A 1JE5A 2BTEA 1VLBA 2NTSA 3N32A 2K25A 3DBHB 2BF8B 2CU3A 5C44G 2HTHA 4WJPA 1XPOA 4ZAIA 2NZOA 3QJZA 4GDLB 2K33A 2Q2HA 3T56B 3VR3A 2BYTA 5CORA 4GN5A 4JX1C 2UWQA 2OTJA 5BYQA 2LVOA 2LUEA 1R4MB 4BAXA 4DV4Q 4POFA 3QCAA 5GROA 3GTMH 4ULLA 1V9JA 2V4LA 1P0RA 4XYCA 4K7UA 3TMEA 2L55A 2JXMB 1N32L 1A70A 1WY8A 1GG3A 4W9IA 1UH6A 4OONA 4GKKQ 3NHHA 1H95A 4JW0A 3MAQA 3IT4B 2HIXA 3KQ4A 2Y3AA 4IOIE 4NQKE 3RZDH 3ULLA 4RHRA 1X3GA 1F9RA 4XDCA 4LF4Q 1YX5B 4AYBE 4A93B 4RCNA 5AEKB 1VZ7A 4QAYA 3AQQA 3AULA 1Z47A 1TKEA 2A68D 5E1FA 2FAZA 3RNUA 4NJCA 1EZ6A 2WB1B 5C0XG 3GTJH 3UQBA 3AE8B 3KWVA 5M5WH 4B3RQ 1X3QA 2BA1A 4NXNQ 2BH2A 3VUXA 2JRIB 2CQOA 3Q8CA 3BZCA 1TY0A 1VJKA 4DKAC 1D5ZC 1WXVA 5CV9A 3MVVA 2G9HD 1JB7A 4NXML 2JF5A 3HK0A 2GBJA 2F4IA 3F2DA 1PDXA 4JIOU 3MFGA 4K8JA 3W1GA 2Z4HA 3FDTA 3A9KA 1LM0A 2VNUD 2IX1A 5IAAC 4BBRH 2Z6KC 3FMCA 2CKHB 3D6WA 3CF5A 3S15H 2R7ZG 1QNUA 1HR0L 3E0EA 1IBKL 4ALPA 3R66C 2MHVA 2F0FA 5LMNQ 1KDBA 2WIIB 3PO2H 3AH7A 1SNMA 1CKNB 1GJXA 4PV1C 2WXNA 3V96A 3JC66 2NBVB 2WXLA 5KHQA 4A3KB 4YTPB 2H1EA 3A5ZB 1UGMA 2BS2B 3TJPA 3V62A 2JRHA 2ZJPA 1A8VA 1RTOA 5GAEC 1PGAA 4HSVA 3CAMA 3M63B 2RHQB 1YITA 2K5WA 4DR7Q 2PZUA 4JWSC 1NEKB 1AEXA 3NPPA 2WP9B 3KJPA 4KHVA 4MTKA 2BWFA 3U4EG 4DV2L 2L1BA 1B3AA 1SDFA 3M7GA 3OWFA 4JI5L 3K58A 3C2PA 5LMNW 4B0EA 1W6KA 1I4PA 5A2QL 2FE8A 2K32A 4L5QA 4IFDG 4LF7Q 4RM9A 1EOTA 3S2HH 4PNYA 1VF7A 1K8OA 1F9JA 2V3NA 1GHKA 2MJDA 4YT0B 2B2TA 4FYDA 4MHEA 3TEHB 3D32A 4LK0M 4FBJB 4DR4Q 1Y1VH 3N9YC 5GMVA 1O7ZA 3ENEA 3NQTA 5HKHA 2K8HA 3BK2A 3RNGC 3TEYA 1SFOB 4X57B 1S5BD 3H6MA 2GBNA 3RNFC 4A55A 3H0GH 1EY7A 3I72A 5IP7H 4L5RC 3IXSA 3HOZH 1XLOA 2KQ7A 2WU5B 1WCMH 1JWAD 1XMQQ 2MP2A 3DBRB 3PSEB 3A7LA 2KOLA 3KLRA 2MNAA 5G5GA 1VQKA 2KVRA 2F4VQ 4E71A 4V0BA 5IYDG 3HOUG 5D65A 1BUVT 3DWPA 1KRHA 4PZ7A 4JYAQ 1LQBA 5HG2A 2BGFA 4WURA 3S1RB 4ANVA 1VQ6A 1Y8NB 1EY0A 1U4LA 1EUVB 2KEEA 5IGDA 3PS6A 5C23A 3O13A 4X62Q 5KHOA 1WI5A 2QEXA 4LDTD 2DLBA 1I6VC 3DVNU 2JU6X 4ZHOA 1AN8A 2KECA 2M2LA 1E2ZA 2NBWB 1MHWC 3JVZX 3KFUA 1MJEA 2LFIA 4PZ8A 1AH9A 1CKOA 4NXNL 2WDRB 4A3EH 1UBIA 4W9FA 2DY8A 2LHDA 2I5LX 3TL5A 2JSVX 3PSIA 3V6EB 3IAS1 1E90A 1ESFA 3PZDA 3TBLD 4A3KG 2I1JA 4IO9A 4DXGA 3V60A 1V49A 1UE1A 4DR4L 5KNCA 1E10A 2EMTA 4JI6Q 3PO2G 3H6NA 2AQ3B 2R7ZB 2MQHA 3ZQ4A 2Y0SB 1HR0Q 4WH4A 1FRRA 4K1RB 1F2MA 2V3PA 3S24A 2PLPA 3MJ5A 5EE0A 3HIZA 1AE3A 4WJWA 5CV6A 3MEFA 5DLQE 4PMWA 4ZCKA 2LMCA 3BIID 3R3OA 2JY6A 2YU9H 1UF0A 1ASZA 3NBHB 1KDAA 2JVCA 3G6EA 3CMMB 4JI2L 5JVH3 2B39A 2A6HD 4I6NB 1XT9B 3GTKH 3QA8A 5BR8Q 1JC7A 3UGBB 5EE9A 1WM2A 4MH8A 1C0AA 3FVQA 1NY4A 1LABA 4I7ZC 4UY8C 1GVPA 1TKWB 2P5ZX 1YNXA 3MEHA 1IBML 3S16H 1WCMB 4A93G 3T1YL 5MPOA 2RR9A 3K5MA 3SGIA 1JJCB 4Y52H 1Q82C 3AI5A 1V5OA 4KX6B 4ZUIA 2RPVA 2DAFA 2XRQD 4WORA 3AB5A 2R3ZA 2RDHA 2LWPA 1BO0A 2DUDA 3CRLC 3FRPB 3NUCA 4QIWE 5FO9B 1T0QC 1XCTL 4NQLB 4DR5Q 2V4IB 3CCLA 3NVZA 4NDXA 4MGIE 2N9PC 2KFKA 3M4QA 1L1OC 1YNJC 2TMPA 4K2KA 4BKGA 4I6LB 5BN3A 2N7DA 3KF8A 2BOSA 1K83H 1V1PB 2F0TA 4IURA 3F2CA 1ICWA 3PZ8A 3MFYA 1RYJA 1U4RA 1SIFA 4WIPA 3HHMA 3OYYA 3N1YC 3RD2A 1W3SA 5JPMC 1CJEA 2JSOA 3ZYYX 4I65A 1XNQL 5AFWA 1B70B 4R3DA 1K52A 1YNND 1V81A 2INNE 2Z59B 4RA8A 2KCTA 4J15A 4DAPA 1K3BC 2R2OA 4G11A 3NVVA 1E0ZA 4EVOA 1STBA 5M5YH 1Q5WB 2A6EC 4QJFA 1U0LA 2KUMA 3E6ZX 4A3EG 1CK1A 4NB3A 4C3HB 4XXEA 3W9CB 2UUCQ 2BBCA 1R9TB 5DPWA 1JCKB 1E22A 3PLVA 1B9RA 5FR6A 2M0AA 2WDVB 3ABVB 3R2TA 2OT2A 3OTOQ 3AE5B 1Q10A 3Q23A 1KAWA 3RLFA 2E5LQ 5JEAH 4XZ4A 4HPPA 2DENB 2FIFA 4YWLA 2R93G 3ZKJC 1GPXA 4WWOA 2LRWA 4JV5L 2K14A 4A6QA 1XCQL 3T13A 3MC9A 4NKLA 1OGWA 4IPGA 5M3MH 2DAJA 4OIJA 4FF1A 2K39A 3V6CB 3GQBA 2EYJA 3GTJB 4DK5A 2JUOA 4H0LC 5IT9c 2D3GA 3P1HA 2CH4A 1DOYA 4CHKA 1HFGA 3CU7A 1WJ6A 3FILB 2DNEA 3PF5A 1WTHA 4M02A 2JN4A 2FCMA 1UNSA 2K7VA 1C4PA 1TZOA 4LAAA 5IGGA 3EGRA 4M8NA 2V1YA 1G2TA 4DUYQ 3HOUH 5IYDH 3G6JB 3NSWA 4PMCA 1RDPD 3Q22A 3I57A 1EQRA 3HEJA 2G5DA 1DONA 2WS3B 5C3WA 1YIJA 3M3YB 4R8NA 1E9MA 1F2YA 5E6JA 4IALA 3A9JB 1Y14B 1GUOA 2IY5B 1BKBA 5CMDA 2K50A 4TSSA 4ICVA 5IIFA 4DR1Q 2VRRB 4GNXB 3O65B 1VQ9A 3FEWX 1ROEA 2NB0A 3SD5A 3L0OA 3CPWA 2N78A 1I4XA 3J81c 1NDDA 2QGQA 1F9QA 5I6YA 1C77A 1HNXL 2V0GA 3ULPA 2B29A 4HLEA 3PIPA 1QOAA 2JK8A 4ZOHC 2HCIA 1EYGA 1HTLD 1SGHA 3CCVA 1JMCA 4KGSA 4FDBA 4DV3L 2ZJQA 5G3LD 3QARA 1EIGA 1KM7A 2ZW0A 1VQGA 2EMSA 4ITKA 4DHJD 1IUEA 5IYBG 3L17A 2R7DA 3U7ZA 1NYRA 3Q3OC 1AE2A 4FN2A 3AEDB 3RI7C 4FHKA 3K5OA 2IY1B 3RN5A 2MWSB 1CSPA 3DPDA 4BZAA 3UDIA 2KKCA 1VQBA 4F8MA 5HURA 5CBEE 1UUPA 2IL8A 1R4PB 5M9OA 3PO3H 4K81A 2WXJA 4JI7Q 4UP9A 1MSGA 3AB9A 2EYPA 2KQ3A 2YYZA 1QZGA 1DYQA 5CV4A 4ZRIA 1QNKA 2KN5A 2WINB 3CRKC 5FLMG 1EM7A 2AUKA 5BN4A 1C76A 2ZCCA 3VVWB 4LF8Q 4LF9Q 2K28A 4MGKE 1VQHA 3NS8A 2WP8J 3PUWA 4OL7A 2E2HB 1PTOH 2L00B 1QVGA 4CQNA 2L4NA 5CC4A 3A55A 2FCNA 4P73A 5EDSA 4C4VA 2E5LL 3SR1A 3L10B 1A3TA 2MUYA 1Q3LA 5A35A 4A90A 2A69C 5C4HA 1FVIA 1SNCA 1YNJD 5C3XA 3ZO5B 1P1AA 3NENA 3APDA 3PO3G 1FCLA 3A4SC 1WXSA 1WGYA 1WD1A 4BBSG 4ZRPA 2EE1A 4K7SA 1C4AA 4P2CB 3CCMA 2DJFC 4WWNA 1TJEA 4ME5A 1FXIA 4P1BC 1JOKA 1X3FA 2V4DA 1N34L 1L4DB 2ZM6Q 2DN8A 2M8SA 4BOSC 1FJGQ 4A3OA 2EELA 2ID0A 1ISNA 4KSLC 3FILA 1EY6A 4JC0A 2HHHQ 3ZJTA 4EZKA 4OEMB 4F87A 4M00A 2BCOA 3CCSA 1LO5D 1ZDXA 1F0ZA 1IPGA 4TV3A 3MXNB 5EKLA 3DBHI 2LY7A 1R4QB 1U5KA 2CJNA 5IWAL 2Z9HA 4C1NI 2B3GA 3F2BA 1H9MA 2XN9C 1YN5A 3DHIC 1Z5SB 1TVXA 3ZW3A 4DR6L 2Q5WD 1VDVA 4L5TA 2AKWB 4JI8Q 1I6HB 2OHFA 5I2XA 4LNIA 1N5WA 2H5XA 1NBWA 2E75C 4CKEA 1PFNA 1TS3A 1WRDB 4ZHPA 1SSOA 1DCZA 2B2UC 1WX8A 3RZOB 1NMFA 1WYDA 2XSCA 1IBLQ 1BBXC 2I38A 2PIAA 2EVBA 1P7EA 3V61A 1K8AC 3T1HQ 1LTAD 1SE4A 2ZVOA 3PF4A 4NP5A 2PMVA 4X3TA 3NUHB 1OTRB 4HJ8A 4RMAA 4BY1B 1KF6B 1T6BX 3WDNA 5EPJA 1HFNA 3VH3B 2HHHL 3CP0A 2K75A 2Y5BB 4JG2A 4YWMA 4RF1A 3G71A 4KY7A 1NTGA 1AYFA 3SHLA 2HJ1A 2PPBC 3ZNZB 3K7UC 4DN4M 1TWGH 2CS4A 2ZNVC 3HM3A 5NUCA 2GBKA 3QIAA 4GN1A 2B8GA 5D7GA 2KJRA 4DWFA 3Q3FA 1NSNS 2BKRB 1X54A 3DWQA 1RCVD 3EN2A 2I46A 3BVZA 2M17A 2I07B 1PHJA 3TDQA 4X65L 1OEYJ 1L5PA 1CQFA 1LTBD 4LFCL 1EY8A 3P20A 2LUMA 5C0XI 3R2IA 3VYUA 4RHSA 1EWIA 3CPFA 4DXAB 1JWUD 3BINA 4UHVA 1V1QA 3W5OA 3TS0A 2IY0B 1PRTF 1KFYB 2PNHA 3FP9A 4XYOA 3OHXC 3HOXH 4C4VB 2O6VD 3UDXA 2F1MA 1CQVA 3OMGA 1ET6A 3P75A 4JI0L 4NJ7A 4M1UB 1UEAB 2KHJA 1TIFA 1LTGD 1SNQA 1TWHB 2CHBD 4R4OA 1Y8RC 3QQ8B 4XGAB 4KKSA 1YHAA 3X3NA 2FUG1 2ZCBA 2AWOA 2Q8RE 1PXUA 4LTUA 2JQOA 1EIYB 1X65A 5IYCH 2D11A 2PE6B 3I8ZA 1E1TA 4LNQA 2PW9A 3V05A 3L9AX 3HOYB 1JQYD 2BA0A 3LGJA 4L1BA 3R7RA 5JZEB 1EYCA 3BWUD 5G3LF 1HCZA 3F2UA 5CBAE 1GUTA 1SAPA 1IL2A 4OXPA 2EYFA 2L0TA 1G51A 5AZFA 2FCQA 3IVFA 2F0VA 1EIFA 4IOAA 1RF2D 5T1IA 1RJTA 2HIVA 4XYQA 2VW9A 1K0RA 1ZXHA 3IAM1 5BYSA 1HNXQ 1XMQL 2KHWB 4CGYB 4EKUA 2AX5A 4Y7NB 5JJZA 2R92H 5JOBA 2VH1A 3NQIA 1M1KC 3S17B 4A3GH 2NBFA 1CMXB 1ENFA 1ICFB 3HG9A 4F88A 4JI5Q 4N6EB 2Z4IA 4NXMQ 1WTWA 4CYEA 1MFWA 5DAUA 4XX5A 5C2TB 4ASWC 1Q46A 1JRPA 1X3EA 3S2DB 2RSUA 2WX0A 1DGSA 3TIXA 4USAA 2J42A 1F1HA 2ES2A 4IJHA 1X55A 4JI0Q 1KDCA 3D3RA 1V8QA 3ICEA 2EKEC 3MHZA 3HKZB 1X6OA 4WJNA 2ACZB 1WGDA 3IBEA 4MT5A 2L15A 1JT8A 4WQOB 3R93A 2OEOA 3EROA 1V8CA 5D6JB 3HOXB 3K7AH 5ELNA 4A3EB 3B0AA 3H3VI 1B2TA 2JPHA 1GNUA 3CC4A 2WHIA 1N63A 4DGZA 3P7JA 2KJ6A 2QSDA 2XEWA 4DHZE 4GKKL 1VQMA 2HTME 4R1JA 2M1MA 2OQKA 4A3JB 2D9UA 4C3IB 2JA9A 2WKCA 4C56C 2EOTA 3Q8DA 3NZSA 5JJKA 1MKHA 1YN4A 1SNPA 1VQFA 4DK0A 4C2MB 1MJDA 3U2SC 3U30A 1HE8A 2BVCA 1J0GA 3C1FA 1V9PA 2UXBQ 2QMTA 4K0KL 2RGFA 1Z7TA 3ONAB 3T9LA 3M3JA 3ZJVA 3RLNA 4DBGA 4Y7NH 3RFZB 4JOIC 4PYZA 3DWMA 3U58A 2B2TC 3H0GB 2FHTA 3TP6A 4BY7G 2B63B 3KBGA 4IPDA 4K5VA 5D3DA 3J81E 4A3DG 1ZGUB 5C3EG 3H7PB 3LYYA 3C19A 1STAA 2REXA 2CWAA 4NAWB 2C5LC 2SAKA 1H9RA 1YI2A 2R7FA 3TUOA 1WCMG 2VY3A 2ZEQA 3GS2A 3HOYH 3MHSD 3OJ4B 2EIFA 3W2DA 1PH5A 4EFOA 1LM8B 3I91A 2BT6A 1JWSD 1G291 3IFWB 4CHTB 4IUMB 1BQQT 2CR5A 1FXTB 3OLMD 2ICIA 2N0SB 2LXKA 1MSHA 1QCBD 3J81i 4DR6Q 4HIMA 4A3FB 4BXXG 1N32Q 3HOZG 4J3OD 1WVLA 3TMPB 1Y8PB 1SF0A 1C4CA 1WGHA 4LF6L 4Z9CB 2QDBA 2ZJRA 3N3KB 1SNOA 2ONQA 1P16A 1JALA 4NMZA 1M90C 2F0IA 1VMCA 2K0PA 3D0FA 4CKCA 2Y0SG 1X9NA 5IT9E 1ONLA 1VQIA 1N36Q 5JH5C 1L1OA 2CU1A 5IN7A 5LL6S 2ZPNA 5CV8A 3SVMA 4IZ8A 4QL5A 4WWMA 1ZOYB 4LF5Q 1Q8IA 1S5ED 2IGHA 1PMRA 4KTAA 4DK3C 2DWQA 3IT6B 3WIMA 1QT9A 4ABNA 1EF1A 2X69A 3RN9C 3GOEA 2A1AA 4J1MA 1R9TH 2MW5A 3KH0A 1WE7A 1KAAA 4JI2Q 1WMHA 3LB8C 5FJ8H 1DM0B 1WYGA 4RGTA 3AU4A 5E6PA 4O2DA 1E0BA 3N52A 4A76A 2JZPA 1BOSA 3NS1A 4A3FG 1EO6A 3VRAB 3AEEB 2IT1A 3CF6E 4O0AA 3HOWG 2KVMA 2O2VA 3I70A 4RMFA 3P42A 1HZCA 2WAQE 2MLBA 2HDMA 1PH9A 1SR3A 3AEGB 2ATWA 4JI6L 1PTOB 3CW2C 4HJ9A 3VQIA 3VDYA 4B08A 4OVZA 1N36L 5C3EB 4JBJA 4E3CA 3J80c 2B63G 3RULA 4W9EA 2KHIA 4GNXA 3H0GG 5IP7G 5FK9C 1B4OA 1OTCA 4HJGE 2IPKD 1HA5A 2E2DC 2KD0A 1TIID 4BKTA 1AW7A 3NY5A 1LACA 5IP9H 2EYMA 4BY7H 2YTYA 1D1IA 2JA6G 1JW9D 1K83B 4BBNF 4KHZA 2PE9A 2BDNA 1X3PA 3GV6A 1EYDA 5H92C 4A3GB 2MBOA 1E24A 2UXBL 1J7AA 1SE8A 2PO4A 1D5XC 1PLFA 1E5WA 1L0YB 2ALYB 4GLXA 2CKZB 2PQEA 1Q86C 5J2RA 5IGEA 2O2LD 1K8RB 2LXAA 4DV5L 3DVNV 4L63B 1H8CA 4C7ZA 1IKLA 4YCWA 4B3SQ 1SMYD 4K8IA 1GO3E 1XLPA 1S5FD 1STNA 1KTKA 5KNDA 3CC2A 4CDDC 2VUMG 4QY7A 4DXFA 3APCA 1HPCA 4ZRJA 1QOHA 2MRPA 1H4RA 2VQEL 3HP3A 1QILA 4W9LA 2EYHA 3TZDA 1J8IA 4X64Q 2IO3B 4U68A 1NJIC 3GTKB 4IWOA 3K0YA 5BO4B 4DV6L 1ET9A 4DV0L 1IHZA 2QA4A 1HZAA 3DBLI 3AEVA 2R7ZH 1SLJA 1HZ6A 4HWIB 1J6QA 3ZNHB 1BR9A 5ELOA 1E8ZA 3HZXA 1BCPB 3OG5A 3GDEA 2Y0SE 3A33B 2KDFB 1ASYA 1N60A 2JYEA 1UZXB 4RF0A 5AUIA 2B2YC 1HTQA 4BVUC 2D2CC 4KMUC 3Q14C 1MPEA 3MA2B 3A8IE 3V3XA 4K2LA 1HHVA 5J39A 3J81L 4FLHA 1XD3B 2YTXA 2AWNA 1LLRD 3UDFA 2OEDA 3AEBB 3FC4A 1FIQA 4HPMB 4EEWA 1PYSB 3G4SA 3UI2A 3HKZE 3B6YA 3W1SA 2N3SA 4DAYA 1L4ZB 5E6NA 1CM9A 1UAPA 4B95A 1ZYRD 4EE2A 4IJLA 5GAGC 1OFFA 1XQQA 5LHY1 3RZFA 3HOYG 3P4PB 2G3QB 2KDBA 3QB3A 2HD5B 4IFDI 4DV6Q 3K81C 3B1LX 3DWGC 2L32A 2IHFA 4BBRB 2EJMA 5IGCA 2EJFC 4X65Q 1C79A 2F0MA 4EX5A 3J80i 3BZDB 2O4XA 4L8JA 4S3SA 3H9DA 1KRSA 1PDQA 3A8JE 1R4MI 4FO2A 1V2YA 4KDLB 4XQQA 2F0HA 4HROA 4MGZE 1E8XA 1TKGA 1CFMA 4XTCS 5I6WA 2K5DA 5G5HA 4MEMA 3T53B 4IM3A 2RD0A 4WFN3 4ZRZA 3W1BA 3Q8BA 3H91A 3U9OA 4II3B 3OTOL 1F2RI 2MEKA 2GB1A 3RZOH 1B7YB 1WOCA 2WACA 4TKOB 2EKIA 3TN2A 2MA9B 1LTID 4TQUS 2GBMA 2NN6H 2RSOA 2K3UA 3PRPB 1HZ9A 1DOMA 3J80L 4LFCQ 3MTNB 4PG3A 4JI8L 4AOFA 4DAYB 4ZLTF 3EQLC 5E3FA 3FPUB 2VUMB 4NY0A 4X66L 2N9XA 3GTMB 2MBHA 1F77A 3PHXB 2KWDA 3CCUA 1CZWA 5F2DA 4KKJA 4LWCA 3ERSX 2RPQA 1IW7C 4C80A 3RN2A 1EQVA 3TP7A 4XC2A 2W55A 4AP4C 3VRBB 1IBMQ 5LMUL 3P4SB 2DNCA 2ZXPA 1N8RC 3M9BA 3A56A 1HNWQ 5I9OA 1VCIA 3NP8A 1V43A 1OXSC 3E3XA 1C48A 2CJOA 4GDLA 4IUQA 2VQFQ 4MH0E 4KV2A 3SK5A 2DZIA 2O6VA 3K6OA 4YY3L 5BMHA 2N9KA 4N58A 1EOVA 1WFQA 2EY5A 3WOEA 1N33Q 2A74C 2G4DB 4K3BA 2KMAA 2WXGA 4ANUA 4UP7A 3I4OA 2N9EB 2JQRB 2UUBQ 5I4DA 5IP9G 4FXDA 4PQXA 1ZKOA 2K9XA 2WAQG 1PH6A 1LXDA 4IFDJ 1I4HA 4LF5L 2Y5PA 2WNMA 2K52A 4WJQA 1Q8KA 1CHPD 3K80C 1E7UA 1YJ1A 2ASQA 5K36G 4GNXC 5JPNC 2HCCA 2WXHA 4DDGD 3L2PA 2EQSA 2ZXRA 2WB1E 1MG8A 2N49A 1ILPA 1LUZA 4HJ5A 3ZTDA 3NTIA 1XNQQ 4LJOB 2D0PA 5TR5A 3HM6X 5G2NA 1VQ4A 3TREA 2PPHA 3NHEB 1IBXB 2JWUA 3KYCD 4GU2A 2L7RA 3GTGH 2F0DA 3VA5A 3S2DH 2MBEA 4A3FH 3KWLA 4LMQD 4AYBG 2PMZB 1C1YB 2KFKB 3GTLH 2JYOA 4FXKC 4GDKA 2FXQA 2LJ5A 4GOCA 3W1YA 4BKSD 3OSOA 1UBQA 2K8BA 4XQJA 2IGDA 2N9LA 1NI3A 3ZLZA 2RA4A 1VQPA 1Y1WG 3B2FA 3KW5B 3ZTCA 2D3BA 1H9KA 3CWIA 4GOPB 3HOVG 3DEOA 4C3JG 1EWYC 1KRTA 1TY2A 1FNWA 2IDYA 1AARA 2CVRA 2JA5B 3X23A 3S17H 3P4QB 1FGUA 1IBXA 4N8FA 2L8JA 4LK1C 1T3QA 3A9JA 5COYA 3S16B 1R4NI 4DAVA 5BYRA 2E74C 1EFWA 3HOZB 2KWCA 3TEZA 3BJUA 1Y56A 1WR1A 1EU4A 4HR7B 4B3SL 1TBEA 3OJ3A 1EWCA 3AXCA 4X6AH 1PRTB 2WXIA 1RODA 1C4QA 5C4JH 4DV5Q 4LF8L 1G8ZD 1BBUA 2A8VA 1NNXA 1Y1VB 2LJIA 3A74A 1Q1EA 1GHJA 1SJED 1T9HA 2F03A 4LNKA 1KOTA 1TYGB 5A2QE 3EHVA 4KZ0A 1JQ4A 2EY1A 1S3SG 2RDFA 2KFJA 5C6AA 2F0UA 1N62A 4FADA 3AE9B 3AMZA 4A3DB 3WALA 2BDOA 2E2JH 3SE0A 1P98A 1WMHB 4BY7B 2A73B 4XDXA 2UU7A 3EFCA 4XWTA 2C35B 3HOVB 5JHBA 4FJYA 3I2ZA 2X6LA 3WANA 3J7AF 4DUYL 5FR3A 2DGYA 3LWEA 4GOPA 2D10A 4HXDA 2F0LA 3A7AB 2LS01 3PUXA 1EU3A 4JGHB 2F0JA 3S9WA 4DV3Q 3RPFC 2X38A 4HJ7A 2GBRA 3ZXVA 1OXXK 5C4XB 2JZ3B 1SYCA 2WQYB 3DBSA 5C44H 5ELEA 4GN4B 1AFPA 2XK5B 4FF4A 2C7HA 3X3MA 1WH3A 2UXCQ 4LW1A 4A3JG 3S15B 1EQTA 1BCPD 4GMVA 4DR2Q 1MJCA 4I7AA 4HAEA 2PI2A 1TT5B 1C3TA 1OXTA 3B2GA 2BB6A 5CHVC 2JYTA 1ZDVA 5M5XB 3L08A 4HEA1 1JORA 1BVSA 3EA6A 1F2RC 1DXMA 2KANA 1KH0A 4LJPB 1TQOA 1YNNC 2I5HA 1PH1A 2KXJA 3VDZA 4EQOA 1BCPC 4KLKA 4H02A 2F4VL 1AP0A 4J6IA 4HSPA 1PZID 1JR0D 5DNFA 2YVCA 4JI1Q 2R61A 4GN3B 1VF5C 2OOBB 4OIKA 1J8CA 2K1FA 3K57A 4QF4A 3RD4A 5C0XH 1HRJA 2QILA 3AE1B 2F3WA 1EF5A 4JBMA 1VQDA 3BG3A 1W6JA 4HRSA 2VH2A 4OX9Q 2B8FA 1J5EQ 4NPNA 4UP8A 1EFID 2R93B 5C0XJ 2F3IA 4P6VF 3T3OA 4AH6A 2R92G 2GLSA 4JWUC 2H4OA 2HJ8A 3D31A 4NAMA 1B9NA 2K5VA 3TS2A 2XK5A 4F7ZA 3QOJA 1I94Q 1PFBA 4RGMA 2WB1G 3ZRCA 4P72A 1J19A 2KA7A 5JXVA 1BBWA 3GE3C 3SHQA 1B53A 4OZBA 1UE7A 2HUGA 1Z2MA 3PV1A 3MC0B 4RAUC 2KCMA 3M85A 4IDIA 3M4OH 1RWSA 1ENAA 5CGKA 2BQQA 3IAYA 1U4PA 1X56A 1WWTA 1C9FA 3RR5A 1WXMA 2L52A 3LDZE 5M3FG 2LRUA 1FNVA 4DPGA 3N30A 1G91A 4LUOA 3ML9A 4LCDE 1XPUA 4G4KA 3GTPB 2QW7A 1S5CD 3U4ZA 3Q24A 2QF7A 2ZTCA 1R7SA 5BR8L 1PH4A 3AE2B 4MELA 3PGZA 3TZUA 1WYWB 2LGDA 4W9KA 2KYWA 3N1XC 4HCEA 2HDEA 1B44D 4C3HH 3GV3A 1LTSD 3QR8A 3SK4A 2M19A 1KXLA 5AZHA 1UE6A 3EJIA 1Q1BA 1PH7A 5C44B 2VZKD 3DHGC 1SYFA 2BPSA 1FD7D 3IFTA 4OX9L 1ZXTA 4P75A 1TS4A 1STHA 4FP5D 4PZ6A 3Q8EA 4ZYNA 4K5XA 5ISRA 1L1OB 1TU2B 1UWXA 5DPSA 3L0WB 1J9OA 3RYTA 1M8AA 3J9CA 3BZKA 2IO2B 1X1MA 1GKHA 2K5NA 2EY2A 1P8LA 2HE7A 5DPRA 2FCSA 1WJUA 3B9JA 1EIHA 1DOXA 3ZRFA 3NWSA 4MTNA 4A3DH 4NJ6A 1PZKD 1L0WA 4QQBX 1QF6A 2WXFA 3DMUA 2XWBB 5KRUA 2PJHA 3ZVVA 3N1ZC 1DJRD 1TT2A 1PRTD 2J7ZA 3OMCA 4E6IA 3QX1A 3QG1A 1Q1OA 1GB4A 4A3LH 2K04A 3LJ3A 4ZUJA 4AIMA 4XWWA 1S4ZA 4BBNC 2L3ZA 3NG0A 5CR3A 3VYTA 5D14A 3S1QB 2KMCA 1GUWA 4LJZC 4IQZA 1VQOA 2PI2E 1ML0D 2QHOA 1L2FA 2QDFA 3D4RA 4L23A 2A69D 5ELCA 3QWZB 2IX3A 4HCPB 5AJ3L 1N6ZA 2C7MB 2WDTB 2NPTB 3CCEA 2WX1A 3TQYA 3VR2A 2K6AA 5J22A 2YU9B 3VHTC 1IYVA 3EVQA 2Q2TA 2F0PA 1PTOC 4MJSB 4DV1L 4RH6A 2BS3B 1BDOA 5C1ZA 3J81j 3E9SA 2INDC 3QWNA 5GXGB 3C0RB 1A15A 1ZEQX 4DUZQ 3GTGB 4JK1C 3AE4B 4JI3L 4NZLB 3OW2A 5BN5A 1Y8OB 2F0SA 2DZMA 1V80A 2NR2A 1J5EL 2FMCA 4GIVA 4QUFA 3FKIG 5L37A 4LUZA 3HOUB 2PMZE 4N9PA 4DR3Q 2JA6B 4BBSB 2OF1A 4A3IB 1FFVA 4II2B 1I42A 4RM8A 3APFA 1VQ7A 3P4RB 3PO3B 2RBMA 1JE4A 1P7FA 3RUIB 4OO1I 4MJSA 4YHHQ 3VR8B 2JA7H 2N4FA 1IBKQ 3BDLA 1A2TA 4A4IA 3K59A 2IGGA 2LD9A 3DEPA 1CKNA 3FHWA 2Z0EB 4ME3A 1KL9A 1V1OA 3I4NH 3EIVA 4ZQ3A 4TQ1A 5IP4D 3L16A 4BKSA 2AUJD 3KDFB 2A6ED 3S1RH 2LXCA 4IM0A 1Y1VG 1K50A 1YJJA 1SBBB 4RKLA 2NVQB 3OWEB 1D2BA 4MGYE 2KX3A 2PKOA 5E7NA 1RTNA 1SB3C 2MP1A 3AEFB 1TWGB 1G2SA 4X3KA 3KJOA 3MXUA 1IXRA 4DF7A 4HCNB 5M5YB 1E3PA 3C3LA 1WX9A 3SFDB 1HXYD 1EY9A 4OVUA 5EJWA 2DZKA 3KLSA 3I3CA 4G0NB 2XIWA 3NBHA 4LF4L 1JROA 5DPTA 3T51B 2NMQA 2XBBC 3H94A 4UAIA 1H9SB 4Q2JA 3NE5B 3AYHB 2VUMH 2KWUB 1PFDA 3KLSX 3CIRB 3JSVB 4IWQA 4QCLA 2Z0DB 3RMHA 3MZ5A 3HVZA 5EE3A 3SFEB 3WAMA 3KF8B 4IUPA 4F8CB 3PV0A 3Q2AC 4MSMB 3S2AA 4M8MA 1II3A 1B8AA 3SEBA 2D5DA 1NAPA 1QOFA 4ZKBB 4QIWB 2KJXA 1I6HH 5GAHC 3J80E 2CWPA 3RLOA 4RGNA 4JOIA 1NE3A 3OIQA 3QC8B 2PVOD 4MN3A 5EQ0A 1JOOA 1O7YA 1EUJA 4GS3A 2C60A 3H3VC 5IY0A 1LTRD 2H88B 3HKSA 3RMKC 1XX8A 1XPRA 2KCNA 4XE0A 3HUIA 1GAQB 1AWDA 4FF2A 3TCAA 1H9SA 1FGBD 1PH8A 3D6CA 3VYSA 3J7A5 2L83A 2XVSA 2BWES 2L0CA 3MXNA 5K36H 1G6JA 2EYOA 3AN1A 1PVOA 2FMMA 2HDLA 3GB1A 1SE9A 3VR4A 3PREA 3I55A 2JA6H 5GADC 1QKZA 5HGTA 2KO3A 1ZUD2 3MHBA 2LSSA 4HJKA 5T1GA 3VFKA 4YCVA 1HQRD 1YHBA 1NI2A 1PYWD 3PIO3 1XO3A 1PQSA 3PUZA 1SYDA 2WXKA 5E6OA 3T16A 4RCOA 1XTDA 3K5NA 2J52A 5T8IA 3MTSA 5DCNA 1I94L 2BE5D 1VR9A 5M5WB 1D3ZA 2IBIB 2VL6A 1PTOF 1ESRA 1OQRA 2GOWA 2ZJDA 3I73A 4QMGA 5FOBB 4OO1H 1XEEA 2JZZA 4W9CA 3T1HL 4ZRQA 1V5TA 3P1MA 3U8ZA 5GQOA 2DY7A 1GM5A 2XGTA 1VQEA 3K7AB 2D62A 2Q2IA 2NVXH 2L9HA 1EQQA 2C7NB 1N61A 1V6EA 1YD8U 2FIDA 2ZM6L 2WWZA 5LLIA 2OCEA 2KN4A 4F1SA 1O78A 1LTLA 1WE6A 3EFUA 4KIKB 4DNIA 2Q8TA 1SNDA 2A5UA 3DHQA 4M0WB 1PTOD 1OQYA 4CDFC 1QZHA 2GA4B 1FFUA 2UXDL 5KIXA 3K8AA 4JBWA 2LVQA 5CHFA 3UE1A 4J6HA 3GP7A 3KUPA 2KLGA 1I4GA 2NN6G 2K22A 1N5XA 1IW7D 2KEDA 1JOQA 2D07B 4ANXA 3RZWC 2R92B 3D4DA 2RDBC 3IFDA 2SNMA 4K6LA 3I9V1 1HNZL 4ARCA 4EOYA 4KN7C 4BS9A 1BT0A 3EUB2 1SIJA 2C9WB 5IOCA 3M95A 4B3TL 4JVZA 1ZYRC 5H1SE 4HMJA 4GSWA 4DNTB 1F2ZA 3PVLA 3VR5A 3I4NG 1S72A 4AQYQ 1F9PA 1E8WA 1N9WA 2CW0C 5FKAC 1B3QA 1QUQA 4URKA 2QC8A 4NPSA 2JA7G 1IL8A 5ELDA 2CHWA 2B3AA 5D3IB 1KLGD 2ZZPB 4JI4Q 2DYOA 3FPPA 3R3MA 3OPOA 2HD3A 4IUNA 2NBUA 4AQ7A 1LT3D 5M3MG 3HGBA 1BMLC 2ZXOA 3M3YH 3CXCA 2WGSA 1EWHA 2LMCB 4ICUA 4TQ0A 5BMIA 1FL0A 1C78A 2Z6KA 1DGJA 1TWCB 3ZUNA 2NN6I 4US9A 2C9OA 2W9NA 5L95C 3GTQH 1RFAA 5HY6A 4OZAA 1YHQA 3PUYA 2Y5CA 2INPE 2KMMA 1C8CA 4ZRKA 5BMGA 1NR4A 2I5MX 3AU5A 3X0WA 3AV8A 5KYIA 3QHTA 2KTFA 1YOVB 3SU8X 1STYA 4JE3B 5C4XG 2AHOB 3H7SA 2BYVE 4WJ3M 1PYBA 2PNRC 1WTRA 4FF3A 2ZT9C 2YV5A 4JPSA 1WZ3A 5JHAA 3M4OB 2A4ZA 1STGA 2XRSD 2K03A 1GB1A 3EBEA 3C46A 3HFZB 1SYBA 2F52A 1GUGA 2MX2A 1D7QA 2D3AA 3PO2B 1XWEA 5KGUA 1UELA 2PCFB 2FFKB 2KHSA 1TWAH 4DV0Q 1VQAA 1T0RC 1TKYA 3HRDD 5HI1A 1BF4A 1R4NB 4WRDA 3TSSA 3S1MH 1I50H 2FUHB 4GLAC 1GJZA 2ENBA 2VQEQ 3NVWA 2N1VA 4C00A 4DHJB 1O7LA 1FMAD 2X8XX 3STBC 1RRBA 2RCFA 2K5QA 3CCRA 2K8CA 3L54A 2J0MA 4OWTB 3KOJA 4DR1L 3HS0C 4BY1H 3BY4B 1AZPA 2FINB 1XJVA 5L83A 3AM9A 1O80A 4KD4A 1QVFA 3W1SC 1FD6A 1B50A 4PYUA 2WKDA 1RD9D 4DK6C 4EZLA 3S2HB 3RNBC 3BVMA 3STBD 2I2YA 1SMXA 4ACFA 4A93H 4A3LG 1E1OA 4JPBW 1PA6A 4ZYSA 2SDFA 2JT4B 4OVVA 4IKGA 4A3GG 4P1CC 4R4CA 1EZ8A 4C7YA 4YXDB 2KJHB 1YBYA 1UEBA 1UWVA 4B3TQ 2FBWB 2BE5C 5IODA 2L0FA 4PS7A 1NVID 1F9SA 3ZXRA 1EEFD 3ULJA 4JQWC 2PW7A 1LT5D 2DHZA 3WCQA 3LWUA 3N20C 4RGOS 2K1BA 1K51A 4G7HC 4AQYL 2VZAA 4EQ5A 1MHXA 1PGXA 1QOGA 2MH7A 4TKNA 1QLBB 3Q6BA 3Q6SA 3DBRI 3RCZA 3D4WA 2K05A 2PYKA 4YTMB 4YSYB 4K3CA 3J7AV 3LX0A 1OXUA 2RVLA 4BWGB 1ZKHA 4DQOC 2L5TA 2NUCA 2RCNA 4EUTA 2LGYA 1NCVA 3TBIB 3I4MB 2KQSA 2CHXA 2DYBA 3OAWA 3AECB 1A62A 4YSXB 2ZNVB 2R6GA 3ONSA 5CTRC 3DUZA 1WRIA 2RQXA 4C2MH 2UUCL 4A3BG 5FJ8G 2OWOA 4HDOA 4YL8A 3UF8A 5M3FH 1PFMA 4F7XA 4A3JH 4A3MB 2KACA 4HVBA 4DNRB 4A75A 3PQIA 2A5HA 3JW0X 2KT7A 4YTNB 3BK1A 4X66Q 2GN5A 2AYOB 4A3MH 3DCGA 4Q5VA 5KYLA 1PH2A 1D1KA 1G6PA 1DOIA 1J7BA 2EXZA 1I3QH 1WFYA 1VQNA 4KV6A 1UGJA 5IWAQ 2TSSA 3OOCA 3EC8A 3RZDB 5CHWA 2N88A 1YVCA 1DOKA 4KY5A 3C8YA 4N59A 3PHWB 3NBIA 1SXTA 2CH4W 4C1NK 5JAVA 2E2IH 5DEHA 1CUKA 4U673 1L7YA 4M01A 1FO4A 1DD2A 4P7IA 1QE6A 4DAMA 3JAMi 3I7FA 2NVYB 2EZVA 1K73C 3V2TA 2J7QB 4W9GA 3H8HA 3H09A 1K53A 4W9DA 1HUMA 2LZ6A 4H13C 2K5HA 4WWPA 3ZGZA 3KLWA 1VQ5A 5DM63 2MBQA 3L4PA 2NVYH 4KGRA 4DR5L 2O2VB 2CW0D 1NBFC 1QQRA 1A3VA 1K8GA 4JL9A 4AWJA 1EEID 4EQPA 1EL0A 2UXDQ 3QAQA 3VR6A 1N33L 4JCVE 3K9OB 3VUWA 3U50C 2OTLA 1H9JA 2JEBI 2BYFA 4W9HA 5FLMH 2VS1A 3QJYA 1S1QB 2RKSA 1QJOA 4K7WA 2O5JC 3PIOA 1FCCC 2RF4A 3CSFA 2EY6A 1RLFA 4KHPL 1YJIA 4WAAA 4GLSC 5C5MA 2MSED 4LNNA 1E7PB 2DX5B 1WTVA 1HTOA 4KD3A 2NVTH 1XXGA 2KNBA 2BB5A 3CQZH 2BS4B 1QUQB 2A68C 3UINB 5HGQA 4QB4A 5TSSA 1Y1WH 1KC8C 1WIAA 3T8MA 1SE3A 3D8GA 3KBXA 5M3FB 1TWHH 2VB2X 2O6VB 2HQEA 4WAFA 5EBCA 3QO2A 4C3IG 3AE6B 2LXJA 5H8YE 4A9AA 2IX0A 3KYHC 3M4YA 5JJIA 1I50B 4BBRG 1D6EC 1VS0A 1IZ6A 4CO7A 3UIOB 3B08A 2PVGC 1LV9A 4LFBL 2IHEA 3PRMB 1KNEA 1I5FA 2UYZB 3L13A 1KNAA 1WR6E 5M3MB 5AJ3Q 3JSVA 2Z6BA 1YX6B 4IC7B 3GE8C 1FM0D 1VQ8A 1T0YA 1CHQD 4X62L 3GO5A 2N7JA 4DU9A 3NRZA 4NNJB 4BOZB 3I3TB 5FLXE 4G7OC 1IKMA 3NK9A 1KJTA 2G9DA 4HEDA 3E9HA 4DR3L 2N1WA 3VH4B 2D2QA 4DR2L 3R8BA 1XLNA 3L3OC 1MG4A 5HHDG 4DV2Q 1AZQA 1CZPA 1XF5L 3NZ3A 2DJGC 1T5XD 1ACCA 2K6DB 2KDEB 4JI3Q 4V190 1YJ9A 3AEAB 2BKFA 3P63A 1L0XB 2NWGA 3T3NA 2JA8H 3H7PA 2CHZA 4MNOA 4J8QA 5CV5A 2K4KA 3JAMc 3E5SA 1MVKA 1NR2A 2MP2B 1S3OA 2V3SA 3IL8A 1T5EA 2KQ4X 1PH3A 1P3QU 1T0SC 1IGDA 4KJOA 4C3JH 2QDLA 3BS1A 4KN4C 3UDGA 1JJGA 4L5SA 4IM2A 2ICEC 2L1AA 2KC2A 1FNUA 3KDFA 4IPCA 3H3VH 2J53A 3ITPA 3DVGY 5LXHA 4E74A 1SN8A 2JX5A 5D94A 2NVUI 5IA7A 3PCOB 4A3BH 4OZCA 2SEBD 1V1PA 4IUVA 3TP8A 5AZGA 4IW0A 2JA8G 2H89B 4DV4L 2M0XA 3OW7A 4EGVA 4WJOA 5M5XH 1V97A 3EECA 2PTLA 3S1MB 3KF6A 3ALBA 3LXFA 2V9HA 3JAML 4B3RL 1IP9A 2F3VA 4BXXH 4DR7L 4RG1A 3S14H 1TS5A 3I90A 3PO0A 2HQLA 4JBKA 2J4XA 3Q3JA 1QG7A 5IT9L 4R4IA 2IO1B 4MIUA 2GI9A 4A3IH 4KZCA 1WXAA 1WZ0A 2KVZA 2QKIC 1K3RA 5D2MB 1GC7A 1RIPA 2KWVB 3DQVA 1A5RA 5G55A 1HH2P 3IHPC 4CDCC 2MPMA 4CDEC 2XWJB 1YJWA 5C3JB 5LNK1 1VQCA 1HZ5A 2WYQA 1ZW7A 2FNJB 4LNFA 2RDGA 3HOWB 3Q8FA 3HOWH 2QEJC 3MJWA 3PMFA 4MZ9A 5IGBA 1YQ4B 3GTQB 2N7EA 3CCJA 4G50A 5EKIA 1BXTA 3WAOA 3GZNI 2M00A 3CMAA 1TR5A 1A0IA 2WXRA 1TTNA 4DA2A 3ZJUA 2PZWA 2L05A 4BY1G 3DHHC 2C5CA 3HVDA 2JA5G 3NJTA 4ZDVA 1LYLA 5CYUA 2NTTA 5EPLA 5K5PA 1CTMA 5KEEA 3I4MH 1JJ2A 2JXXA 2A6HC 3DDCB 4O42A 4MM3A 3RNCC 2Z8LA 4ILWA 1XYIA 3ZNGC 4YWGG 1L0VB 1QB5D 1WGRA 3PRZA 2UU9Q 4HDQA 3Q3MC 1UE5A 2IZVB 2Z0SA 2AQ2B 1I4QA 2X6GA 1XMOL 3OIPA 2ZTDA 1D8LA 2AWTA 3VTVA 4YWKA 2AEHA 4B9KA 2WLBA 5FO8B 3IRBA 3P2BA 1QWYA 4EQNA 4HIOA 3PLUA 3NELA 1I7HA 1ENCA 5I9PA 3CKIB 4GLVB 3PUVA 4KY6A 4A3BB 2W54A 1WTXA 1U4AA 1YQBA 3KVFB 3QOLA 4GXBA 2DZJA 2VQFL 3E56A 2I0QA 1EY5A 4OWWB 1E8YA 1E6EB 3WOFA 2UXCL 4LUVA 1JMLA 1LGRA 1C9OA 5IGFA 3I4MG 2KTRB 3GTLB 3N6RA 2AL6A 2CQAA 2ON8A 3A4RA 4APVA 4S0RA 2B2VA 5J18A 3W3AA 3IG3A 1NYQA 4ID6A 2K01A 3DWAA 1HA6A 1QZEA 3A9KB 4B0MA 1IBLL 1YJNA 3CCQA 4LF9L 1QVCA 1GD7A 1SFOH 2BYEA 1KLUD 2KBNA 5C3EH 2M4NA 2WAQB 3CC7A 1YN3A 3SR6A 3S1NH 2YTVA 1SYGA 1I3QB 1GUSA 2NZ1D 3VTWA 2E76C 1VDZA 2PQAA 4XT3B 2KZRA 2LHEA 5IOIA 4JI1L 3IKJA 2QCPX 4A3IG 4LDTB 4HKQA 4OELB 2VZKB 2Z1CA 2WXMA 1CA6A 3SDLC 4K0KQ 3FKIB 4DDID 2E8GA 2LEKA 2NVQH 2LASA 2BH8A 1HUNA 3NEMA 4W9JA 1ILQA 4B9WA 3WWVA 1WTPA 4K14A 3Q8AA 4D2KA 3EFXD 4IUUA 4HIDA 3LNNA 4JYAL 4FULA 1N34Q 2QJLA 2KX0A 2KC1A 3W5VB 2O5IC 1RHPA 4JI7L 2JXTA 2W82A 4NAWA 1FR3A 4KK7A 1HEZE 1U9RA 3DBLB 5J1ZA 1TGZB 4RKBA 1V86A 2F0OA 1GUNA 3F8TA 4YHHL 2KTRA 3T4AC 1XTCD 3DXJC 4LFBQ 1PRTC 2LKVA 3HOXG 2DBYA 1K8MA 1VQJA 3K9PB 2Q8IB 1JICA 3CD6A 1J7CA 1XNRL 1RAXA 4HKZE 3HKZG 3NTHA 3ZNID 2B2YA 4KJNA 5EKKA 1FEHA 3C1EA 2LI5A 3PTFC 2ZW1A 5CX3A 3ER0A 3AU7A 4B9XA 1F52A 2CCZA 1DZ1A 2NS5A 4OWXB 2AQ1B 4IWPA 4LF7L 4GKJL 1WJ4A 4DK1A 3M7NA 3KK7A 5EGTA 2PQAB 1HR0W 4DFAA 2UUAQ 3RNAC 4MSQB 2VXWA 1P9DU 4R4TA 2NVTB 1WJJA 2GVAA 4DV1Q 1IGCA 3A1QA 4XDDA 3RT3B 3NWTA 2L12A 2AMCB 3URYA 2R2QA 3JYUA 3MP9A 5LXIB 4K6DA 4OHJA 3WA0A 4KHPQ 2OXPA 1BUIC 1BCPF 1PFSA 4GOPC 3U7DA 1ZXIA 2LFNA 3A5UA 2IW3A 4QGUA 1RKNA 1GUAB 1JWBD 2B63H 4GB9A 2F0NA 1E7ZA 2B2WA 2KDMA 4IN3A 2L76A 4TVAB 4JLCA 1HNZQ 2WU2B 5FO7B 2GVBA 2F0GA 5LMNL 4PMBA 1YNTE 2OJRA 5I2YA 5JVG3 4KKIA 2SNSA 3L7ZC 2XNAC 2F0WA 3UE0A 2B2VC 4G7ZC 4IFDH 1YMHE 3DLLA 4DV7L 2WV6D 4CJ1B 3RUZA 1SRUA 3KF6B 4KVGB 2BW2A 2MO1A 1A63A 4FXGC 4P71A 3NXWA 4YY3Q 4C3IH 3I4NB 3NVYA 4FXCA 4PS8A 4M8AA 1HTPA 4UDUC 2F0EA 4B3MQ 3AFQA 3KYDD 1HNWL 1SYEA 2KCCA 2GMIC 2K6QA 4FHJA 4R9WA 2NVXB 4N9TA 5CV7A 3AMUA 5JEAG 1TWFH 4HN7A 1L6VA 4H44C 4XT1B 3HOVH 1Z6HA 5IO9A 2DNFA 2ZTEA 1M94A 4FJVB 1SJHD 3GTOB 2IYDB 1KABA 3BDOA 3CMEA 5E4WC 5E4XA 1LTTD 2MJEA 1TXYA 1KD1C 1K9MC 4LFAL 5JJLA 2WXPA 4HPLB 2J0TD 4O1NA 4KKTA 1VCBA 3RNEC 1EYAA 2B76B 1WGKA 3MXPA 1SROA 2AL3A 3SDZA 4OW0A 1MHHE 3GTOH 4DHZB 3VA7A 2OJWA 2PEAA 4OO1G 2WFWA 4GGQA 1Z9FA 1RFKA 1ZPSA 2NPTA 2NCNA 4FNFA 1FJGL 3DM1A 3KUDB 3BU2A 1WTOA 3S14B 1MIUA 3DOWA 2L11A 1IYUA 2EDGA 2YLMA 4HK2A 2RMMA 1YIWA 3DVGX 1MBYA 1NUCA 5EBDA 3ECIA 4JV5Q 1L2NA 2MJ8A 1HJPA 2JP1A 1G6ZA 1KQSA 4H7BA 1PUTA 3TEWA 1YZ6A 5LMUQ 1VRAB 4UPAA 1KHIA 4BA1I 4IPHA 4POGA 4A20A 5KNBA 1PGBA 3ERQA 3S1QH 1BNZA 2Q2UA 5C5LA 4ODGA 3Q0AA 2KK8A 3PT2B 4PT5A 4RWSC 5LL6X 4LFAQ 1WD0A 2J0JA 4OGQC 3QK0A 4ZKCB 1JWMD 2UU9L 4A3MG 5EPKA 4NW2A 2WXOA 5ELBA 2KDIA 1WXQA 2E2IB 4WQMA 2G45B 1I35A 3M4PA 3J7ZC 3BYTB 4K5WA 1SSNA 2MFIA 3FAHA 1S5DD 4ARIA 1VMPA 3F1ZA 3Q3NC 2DYMA 4TRDA 4KGTA 4KDIC 1W2BA 4YSZB 4QUCA 2F0QA 4HJAA 3MC8A 2KAJA 4WJ4A 4ANWA 1CT1D 2V1CC 4FA6A 1S40A 3G48A 3ZDTA 1CA5A 4FJZA 1X32A 1PV4A 1NENB 1B9MA 3FKYA 2PW5A 3AFPA 5EE1A 2WXQA 4HTHA 1WJNA 2LGXA 1SMYC 2YEPB 4XQNA 4ZK9B 3PIP3 3K5LA 3PGEA 4PK1A 1MI2A 4XIGS 2KENA 1WTQA 1MI0A 2QIEB 3J7YW 1Q90A 2QCZA 5AUKA 3GTPH 2NYZD 3E0JA 1WM3A 3KUCB 4DV7Q 3I63C 4KSKC 2VB3X 1YEZA 1CSQA 1YQ3B 2I1KA 3BDCA 3BVGA 1TZ1A 4KKUA 1SE2A 2W3RA 2IO0B 5JEAJ 3BYYB 3VYRA 4AS1A 4A3KH 4B3ML 3AE3B 3I56A 3TEXA 2SOBA 3U9SA 4M0WA 1SEBD 2GRIA 3VXWA 4N8X1 1OEYA 2E6XA 2NZHA 2J0KA 4A3CG 3H1UA 3PZ7A 3MWYW 4GDKB 5J17A 3PPAA 2EJGC 1KLVA 1WI0A 3A8KE 2A19A 2FJ2A 1B1ZA 1HZBA 3VTUA 1OXVA 2CFMA 4CBVA 2JEAI 2OQ0A 3R7QA 3UI3A 1WSPA 1A2UA 2G4SA 1LT4D 4P16A 3G7LA 1A3UA
chains in the Genus database with same CATH topology
4BA2I 2MGSA 3GD7A 3HRZC 4KI0A 3SXHA 1LT6D 2PZTA 3CQZB 1CZGA 1CI3M 2G1EA 1E2VA 4C3JB 1M4VA 3ND9A 2F0KA 3S1NB 1XLQA 3VR9B 1Y1WB 1ZE3D 5ELFA 3TP5A 3I4LA 5C4ZA 1VZ8A 2M56B 4A8XC 1FXAA 4AYBB 1FRDA 2JA8B 2B2UA 4CJ0B 1RM6C 3JAME 2E3TA 1E2WA 1MGSA 1D4BA 3Q69A 4HMIA 3CHBD 4FVMA 4RFBA 4CJ2C 4L2YA 4LLGM 4X3UA 1Q12A 1TS2A 2W3SA 4X3SA 2B2WC 5HFYA 3MXGA 3NTKA 2D5GA 1EY4A 1UWMA 1GXDC 4IUTA 1TWAB 5DM73 1JB3A 4YIJA 2N55A 3W5UB 4R8IA 1D5MC 4Q0FA 4US8A 1DOLA 1FYCA 2JA7B 2LGIA 3SK6A 2YEPF 4L6TB 3ND8A 4GZYC 2EYLA 3SK8A 1F2LA 3ETRA 3U52E 3A54A 1L6UA 1VZ6A 2MJ3A 1I4RA 2RSNA 4MM3B 2IJ0A 4G57A 2IWHA 4HCSA 4MACA 4RNAA 2EPBA 1OQQA 2WDQB 4H2AA 1STEA 2E2JB 1PZJD 4REZA 1OO9B 1QOBA 5C4JB 1Y69U 5FLXL 2M9VA 4TMAB 1HQMC 4C3HG 2K5PA 1ZP0B 1TWFB 1GOZA 3AE7B 1MD2D 4CKBA 2JE6I 1A6XA 1U4MA 2BTEA 1VLBA 2NTSA 2CU3A 4ZAIA 4GDLB 2BYTA 2K33A 3VR3A 3T56B 5CORA 4JX1C 5BYQA 4ULLA 3TMEA 2L55A 2JXMB 1A70A 3NHHA 3MAQA 3IT4B 3KQ4A 2Y3AA 4IOIE 4RHRA 4XDCA 1F9RA 4A93B 4RCNA 1VZ7A 1Z47A 1TKEA 2A68D 5E1FA 4NJCA 1EZ6A 2WB1B 5C0XG 3AE8B 3KWVA 1X3QA 2BA1A 3Q8CA 1VJKA 1TY0A 1D5ZC 5CV9A 3MVVA 2G9HD 2F4IA 1PDXA 3MFGA 4K8JA 2Z4HA 3FDTA 2VNUD 2IX1A 3FMCA 3D6WA 1QNUA 2MHVA 2F0FA 1KDBA 2WIIB 3AH7A 1SNMA 1GJXA 4PV1C 2WXNA 3V96A 2WXLA 4A3KB 4YTPB 2H1EA 2BS2B 1RTOA 1PGAA 4HSVA 2K5WA 2PZUA 4JWSC 1NEKB 1AEXA 3NPPA 2WP9B 4KHVA 3U4EG 2L1BA 1B3AA 1SDFA 3M7GA 3OWFA 3K58A 3C2PA 4B0EA 1W6KA 1I4PA 5A2QL 2FE8A 2K32A 4IFDG 1EOTA 1K8OA 4PNYA 1VF7A 4YT0B 3TEYA 2V3NA 1GHKA 2MJDA 2B2TA 4FYDA 4MHEA 4LK0M 3N9YC 1O7ZA 3NQTA 3BK2A 1SFOB 1S5BD 3H6MA 4A55A 3I72A 1EY7A 3IXSA 1XLOA 2WU5B 1JWAD 3A7LA 2KOLA 3KLRA 5G5GA 4V0BA 5D65A 1BUVT 3DWPA 1KRHA 5HG2A 4WURA 3S1RB 1Y8NB 1EY0A 1U4LA 2KEEA 5IGDA 3O13A 2DLBA 1I6VC 2JU6X 4ZHOA 1AN8A 2KECA 2M2LA 1E2ZA 2LFIA 2WDRB 2DY8A 2LHDA 2JSVX 3IAS1 1ESFA 4DXGA 5KNCA 1E10A 2AQ3B 2R7ZB 3ZQ4A 2Y0SB 4WH4A 1FRRA 1F2MA 2V3PA 2PLPA 3MJ5A 5EE0A 4WJWA 5CV6A 4PMWA 2LMCA 3BIID 3R3OA 1KDAA 5JVH3 2B39A 2A6HD 1JC7A 5EE9A 4MH8A 3FVQA 1LABA 4I7ZC 1TKWB 3MEHA 1WCMB 5MPOA 3K5MA 4KX6B 4ZUIA 2RPVA 2XRQD 4WORA 3AB5A 2R3ZA 2RDHA 1BO0A 3CRLC 3FRPB 3NUCA 5FO9B 1XCTL 2V4IB 3NVZA 4NDXA 4K2KA 1YNJC 2TMPA 5BN3A 3KF8A 2BOSA 1V1PB 2F0TA 4IURA 1ICWA 3PZ8A 3MFYA 1RYJA 1U4RA 4WIPA 5JPMC 1CJEA 2JSOA 3ZYYX 4I65A 5AFWA 4R3DA 1K52A 1YNND 2INNE 4RA8A 1E0ZA 4DAPA 3NVVA 4EVOA 1STBA 2A6EC 3E6ZX 2KUMA 1CK1A 4C3HB 4XXEA 3W9CB 2BBCA 1R9TB 1JCKB 1B9RA 2M0AA 2WDVB 3ABVB 3R2TA 2OT2A 3AE5B 1Q10A 3Q23A 3RLFA 5JEAH 1GPXA 4A6QA 1XCQL 3T13A 4NKLA 4OIJA 4FF1A 3GQBA 2EYJA 3GTJB 4H0LC 3P1HA 1DOYA 1HFGA 3CU7A 3FILB 2DNEA 1UNSA 2K7VA 1C4PA 1TZOA 4LAAA 5IGGA 3EGRA 1G2TA 3G6JB 3NSWA 4PMCA 1RDPD 3Q22A 3I57A 3HEJA 1DONA 2WS3B 5C3WA 3M3YB 4R8NA 1E9MA 1F2YA 5E6JA 4IALA 1GUOA 5CMDA 4TSSA 5IIFA 3FEWX 1ROEA 2NB0A 1I4XA 5I6YA 1F9QA 1C77A 2V0GA 1QOAA 4ZOHC 2HCIA 1HTLD 4KGSA 5G3LD 1EIGA 2ZW0A 4ITKA 1IUEA 3U7ZA 1NYRA 3AEDB 3K5OA 4F8MA 5HURA 5CBEE 1UUPA 2IL8A 1R4PB 5M9OA 2WXJA 1MSGA 3AB9A 2EYPA 2KQ3A 2YYZA 1DYQA 5CV4A 1QNKA 2WINB 3CRKC 1EM7A 2AUKA 5BN4A 1C76A 2K28A 2WP8J 3PUWA 4OL7A 2E2HB 1PTOH 4CQNA 2L4NA 5CC4A 3A55A 3SR1A 1A3TA 2MUYA 1Q3LA 5A35A 4A90A 2A69C 5C4HA 1SNCA 1YNJD 5C3XA 1FCLA 1WD1A 4ZRPA 2EE1A 1C4AA 4P2CB 1TJEA 4ME5A 1FXIA 1JOKA 2V4DA 1L4DB 2DN8A 2EELA 2ID0A 3FILA 1EY6A 3ZJTA 4F87A 2BCOA 1LO5D 1ZDXA 1F0ZA 5EKLA 2LY7A 1R4QB 2CJNA 4C1NI 1H9MA 2XN9C 1YN5A 1TVXA 2Q5WD 1VDVA 1I6HB 2OHFA 5I2XA 1N5WA 2E75C 4CKEA 1PFNA 1TS3A 4ZHPA 1SSOA 1DCZA 2B2UC 3RZOB 2XSCA 1BBXC 2I38A 2PIAA 2EVBA 1P7EA 1LTAD 1SE4A 4NP5A 2PMVA 4X3TA 3NUHB 4BY1B 1KF6B 1T6BX 3WDNA 5EPJA 1HFNA 4RF1A 4KY7A 1AYFA 3SHLA 2PPBC 4DN4M 5NUCA 3QIAA 2B8GA 5D7GA 1NSNS 3DWQA 1RCVD 2I46A 3BVZA 2I07B 3TDQA 1L5PA 1CQFA 1LTBD 2LUMA 1EY8A 3P20A 5C0XI 3R2IA 3VYUA 4RHSA 1JWUD 1PRTF 1KFYB 4XYOA 3OHXC 2F1MA 1CQVA 3OMGA 1ET6A 3P75A 1UEAB 4M1UB 1LTGD 1SNQA 1TWHB 2CHBD 4KKSA 3X3NA 2FUG1 2AWOA 2Q8RE 1PXUA 4LTUA 3I8ZA 2PW9A 3V05A 3L9AX 3HOYB 1JQYD 2BA0A 4L1BA 1EYCA 3BWUD 5G3LF 1HCZA 3F2UA 5CBAE 1GUTA 1SAPA 2EYFA 2F0VA 3IAM1 1RF2D 5T1IA 1RJTA 5BYSA 4XYQA 1ZXHA 4CGYB 2AX5A 4Y7NB 5JJZA 5JOBA 3NQIA 3S17B 2NBFA 1ENFA 3HG9A 4F88A 4N6EB 2Z4IA 1WTWA 5DAUA 5C2TB 1JRPA 3S2DB 4USAA 2J42A 1KDCA 3D3RA 1V8QA 3MHZA 3HKZB 2ACZB 4MT5A 3R93A 2OEOA 3EROA 1V8CA 3HOXB 4A3EB 1B2TA 1N63A 4DGZA 3P7JA 2QSDA 2HTME 4A3JB 2D9UA 4C3IB 2WKCA 4C56C 2EOTA 1YN4A 1SNPA 4DK0A 4C2MB 3U2SC 3C1FA 2QMTA 1Z7TA 3ONAB 3ZJVA 3RFZB 3DWMA 2B2TC 3H0GB 2FHTA 3TP6A 2B63B 3KBGA 4K5VA 5D3DA 3J81E 3LYYA 1STAA 4NAWB 2SAKA 1H9RA 3TUOA 3GS2A 3W2DA 3I91A 2BT6A 1JWSD 1G291 4CHTB 1BQQT 2ICIA 2N0SB 1MSHA 1QCBD 4A3FB 4J3OD 1WVLA 1Y8PB 1SF0A 1C4CA 4Z9CB 2QDBA 1SNOA 2ONQA 1JALA 4NMZA 2F0IA 1VMCA 2K0PA 4CKCA 5IT9E 1ONLA 5LL6S 5CV8A 3SVMA 4IZ8A 4WWMA 1ZOYB 1Q8IA 1S5ED 2IGHA 1PMRA 4KTAA 2DWQA 1QT9A 4ABNA 2X69A 4J1MA 1KAAA 3LB8C 1DM0B 1WYGA 4RGTA 1E0BA 3N52A 2JZPA 1BOSA 3NS1A 3VRAB 3AEEB 2IT1A 2KVMA 3I70A 3P42A 2HDMA 3AEGB 1PTOB 3VQIA 4B08A 4OVZA 5C3EB 5FK9C 1B4OA 4HJGE 2IPKD 1HA5A 2E2DC 1TIID 1AW7A 1LACA 2EYMA 1D1IA 1JW9D 1K83B 4KHZA 2BDNA 1X3PA 3GV6A 1EYDA 5H92C 4A3GB 1J7AA 2PO4A 1D5XC 1PLFA 1L0YB 2PQEA 5IGEA 2O2LD 4L63B 4C7ZA 1IKLA 1SMYD 4K8IA 1XLPA 1S5FD 1STNA 5KNDA 1KTKA 4DXFA 1HPCA 1QOHA 3HP3A 1QILA 2EYHA 3TZDA 1J8IA 4U68A 3GTKB 3K0YA 1ET9A 1IHZA 1HZ6A 1BR9A 3HZXA 1BCPB 1N60A 2JYEA 4RF0A 5AUIA 2B2YC 2D2CC 4KMUC 1MPEA 3MA2B 3A8IE 3V3XA 4K2LA 1HHVA 5J39A 3J81L 2AWNA 1LLRD 2OEDA 3AEBB 3FC4A 1FIQA 3UI2A 3W1SA 4DAYA 1L4ZB 1CM9A 1UAPA 1ZYRD 4EE2A 1OFFA 5LHY1 3P4PB 3QB3A 4IFDI 3DWGC 2L32A 4BBRB 2EJMA 5IGCA 2EJFC 1C79A 2F0MA 3BZDB 2O4XA 4L8JA 4S3SA 1PDQA 3A8JE 4FO2A 4XQQA 2F0HA 4HROA 1TKGA 1CFMA 4XTCS 5I6WA 2K5DA 5G5HA 3T53B 4WFN3 4ZRZA 3Q8BA 3H91A 3U9OA 1F2RI 2MEKA 2GB1A 2WACA 4TKOB 2EKIA 3TN2A 1LTID 4TQUS 2NN6H 2RSOA 2K3UA 3J80L 1DOMA 4ZLTF 3EQLC 5E3FA 3FPUB 2VUMB 3GTMB 1F77A 2KWDA 1CZWA 5F2DA 4KKJA 4C80A 1IW7C 1EQVA 3TP7A 2W55A 3VRBB 3P4SB 2DNCA 2ZXPA 3A56A 5I9OA 1VCIA 1V43A 3NP8A 1OXSC 1C48A 2CJOA 4IUQA 3SK5A 3K6OA 5BMHA 2N9KA 4N58A 2EY5A 3WOEA 2A74C 2WXGA 2JQRB 5I4DA 4FXDA 4PQXA 1ZKOA 2K9XA 4IFDJ 1I4HA 2Y5PA 2WNMA 1CHPD 5K36G 5JPNC 2HCCA 2WXHA 2ZXRA 1ILPA 3NTIA 1IBXB 2JWUA 2F0DA 3VA5A 3KWLA 4LMQD 2PMZB 2JYOA 4FXKC 3OSOA 4XQJA 2IGDA 2N9LA 1NI3A 2RA4A 3B2FA 1H9KA 3CWIA 3DEOA 4C3JG 1EWYC 1TY2A 1FNWA 2IDYA 2CVRA 2JA5B 3P4QB 1IBXA 4LK1C 1T3QA 5BYRA 5COYA 3S16B 4DAVA 2E74C 3TEZA 3HOZB 1Y56A 1EU4A 4HR7B 1EWCA 2WXIA 1PRTB 1RODA 1C4QA 1G8ZD 1Y1VB 2LJIA 1Q1EA 1GHJA 1SJED 2F03A 1TYGB 5A2QE 1JQ4A 2EY1A 2RDFA 5C6AA 2F0UA 1N62A 3AE9B 3AMZA 4A3DB 2BDOA 3SE0A 4BY7B 2A73B 4XDXA 4XWTA 3HOVB 2X6LA 5FR3A 3J7AF 3LWEA 2F0LA 3A7AB 2LS01 3PUXA 1EU3A 2F0JA 3S9WA 3RPFC 2X38A 1OXXK 5C4XB 2WQYB 1SYCA 5ELEA 1AFPA 4FF4A 3X3MA 3S15B 1EQTA 1BCPD 4HAEA 1OXTA 3B2GA 2BB6A 2JYTA 1ZDVA 5M5XB 4HEA1 1JORA 3EA6A 1F2RC 1DXMA 1KH0A 1TQOA 1YNNC 4EQOA 1BCPC 1AP0A 4HSPA 1JR0D 1PZID 5DNFA 2R61A 1VF5C 4OIKA 3K57A 4QF4A 3RD4A 5C0XH 1HRJA 2QILA 3AE1B 2F3WA 3BG3A 1W6JA 4HRSA 2B8FA 1EFID 2R93B 5C0XJ 4P6VF 3T3OA 4JWUC 2H4OA 3D31A 4NAMA 1B9NA 3QOJA 1PFBA 4RGMA 2KA7A 5JXVA 1B53A 4OZBA 2HUGA 3MC0B 4RAUC 3M85A 1RWSA 1ENAA 5CGKA 1C9FA 3IAYA 1U4PA 1WWTA 2L52A 1FNVA 1G91A 4G4KA 3GTPB 1R7SA 1S5CD 3AE2B 3Q24A 2QF7A 3IT6B 3TZUA 4HCEA 2HDEA 1B44D 3GV3A 1LTSD 3SK4A 2M19A 3EJIA 1Q1BA 5C44B 2VZKD 1SYFA 1FD7D 3IFTA 1ZXTA 1TS4A 1STHA 4FP5D 3Q8EA 4K5XA 5ISRA 1TU2B 1UWXA 1J9OA 1M8AA 3J9CA 2EY2A 3B9JA 1EIHA 1DOXA 3NWSA 1PZKD 1QF6A 2WXFA 3DMUA 2XWBB 5KRUA 1DJRD 1TT2A 1PRTD 2J7ZA 3OMCA 4E6IA 3QG1A 1GB4A 2K04A 4ZUJA 4XWWA 1S4ZA 5CR3A 3VYTA 5D14A 3S1QB 1GUWA 4LJZC 4IQZA 1ML0D 3D4RA 4L23A 2A69D 5ELCA 2IX3A 3VR2A 2K6AA 5J22A 2YU9B 1IYVA 3EVQA 2F0PA 1PTOC 4RH6A 2BS3B 1BDOA 3E9SA 3QWNA 5GXGB 1A15A 1ZEQX 3AE4B 3GTGB 4JK1C 4NZLB 5BN5A 1Y8OB 2F0SA 2FMCA 4QUFA 3HOUB 4N9PA 2JA6B 4BBSB 2OF1A 4A3IB 1FFVA 3P4RB 3PO3B 2RBMA 1JE4A 1P7FA 4OO1I 3VR8B 3BDLA 1A2TA 3K59A 2IGGA 3DEPA 1V1OA 4ZQ3A 4TQ1A 2AUJD 2A6ED 1K50A 1YJJA 1SBBB 4RKLA 2NVQB 3OWEB 1D2BA 2PKOA 1RTNA 1SB3C 2MP1A 3AEFB 1TWGB 1G2SA 4X3KA 3MXUA 4DF7A 5M5YB 3C3LA 3SFDB 1HXYD 1EY9A 5EJWA 3KLSA 3I3CA 2XIWA 3NBHA 1JROA 3T51B 2NMQA 3H94A 4UAIA 1H9SB 4Q2JA 3NE5B 1PFDA 3KLSX 3CIRB 5EE3A 3SFEB 4QCLA 3HVZA 3RMHA 3MZ5A 4IUPA 3PV0A 1II3A 3SEBA 2D5DA 1NAPA 1QOFA 4ZKBB 4QIWB 2KJXA 3J80E 4RGNA 3OIQA 2PVOD 4MN3A 5EQ0A 1JOOA 1O7YA 3H3VC 1LTRD 2H88B 1XX8A 2KCNA 4XE0A 3HUIA 1GAQB 1AWDA 4FF2A 1H9SA 1FGBD 3D6CA 3VYSA 2L83A 2XVSA 2L0CA 3MXNA 5K36H 2EYOA 3AN1A 2FMMA 2HDLA 3GB1A 3VR4A 1QKZA 5HGTA 1ZUD2 3MHBA 5T1GA 1HQRD 3PIO3 1PYWD 1XO3A 3PUZA 1SYDA 2WXKA 3T16A 4RCOA 3K5NA 2J52A 5T8IA 3MTSA 2BE5D 1VR9A 5M5WB 1PTOF 1ESRA 1OQRA 3I73A 4QMGA 5FOBB 4OO1H 1XEEA 4ZRQA 3P1MA 2DY7A 3K7AB 2D62A 2L9HA 1N61A 2KN4A 1O78A 2Q8TA 1SNDA 3DHQA 1PTOD 2GA4B 1FFUA 5KIXA 4JBWA 3KUPA 3GP7A 4J6HA 1I4GA 2NN6G 2K22A 1N5XA 1IW7D 2KEDA 1JOQA 2R92B 3D4DA 3IFDA 2SNMA 4K6LA 3I9V1 4ARCA 4KN7C 4BS9A 3EUB2 1SIJA 5IOCA 1ZYRC 4HMJA 4DNTB 1F2ZA 3VR5A 1F9PA 2CW0C 5FKAC 1IL8A 5ELDA 5D3IB 1KLGD 2DYOA 3FPPA 3OPOA 4IUNA 4AQ7A 1LT3D 3HGBA 1BMLC 2ZXOA 4TQ0A 1EWHA 2LMCB 5BMIA 1C78A 1DGJA 1TWCB 2NN6I 4US9A 2C9OA 4OZAA 3PUYA 2Y5CA 2INPE 2KMMA 1C8CA 5BMGA 1NR4A 3AV8A 5KYIA 1STYA 4JE3B 2PNRC 1WTRA 4FF3A 2ZT9C 4JPSA 3M4OB 1STGA 2XRSD 2K03A 1GB1A 3C46A 1SYBA 1GUGA 3PO2B 1XWEA 5KGUA 2PCFB 2FFKB 2KHSA 5HI1A 1TKYA 3HRDD 1BF4A 4WRDA 3TSSA 2ENBA 3NVWA 1O7LA 1FMAD 2K5QA 3HS0C 1AZPA 2FINB 3AM9A 1O80A 4KD4A 1FD6A 1B50A 2WKDA 1RD9D 2I2YA 3S2HB 3BVMA 4ZYSA 2SDFA 4IKGA 1EZ8A 4C7YA 4YXDB 2FBWB 2BE5C 5IODA 1NVID 1F9SA 1EEFD 2PW7A 1LT5D 3WCQA 3LWUA 4RGOS 2K1BA 1K51A 4G7HC 1MHXA 1PGXA 1QOGA 2MH7A 1QLBB 3Q6SA 3D4WA 2K05A 2PYKA 4YTMB 4YSYB 3J7AV 3LX0A 1OXUA 2RVLA 4BWGB 4DQOC 2L5TA 2NUCA 1NCVA 3TBIB 3I4MB 3AECB 4YSXB 2R6GA 3DUZA 1WRIA 2RQXA 1PFMA 4F7XA 4A3MB 2KACA 4DNRB 2A5HA 4YTNB 3BK1A 4Q5VA 5KYLA 1D1KA 1DOIA 1J7BA 2EXZA 4KV6A 1UGJA 2TSSA 3OOCA 3RZDB 2N88A 1DOKA 4KY5A 3C8YA 4N59A 3NBIA 1SXTA 4C1NK 5JAVA 5DEHA 4U673 1FO4A 1DD2A 1QE6A 2EZVA 2NVYB 3V2TA 3H8HA 3H09A 1K53A 1HUMA 3ZGZA 4H13C 5DM63 3L4PA 4KGRA 2CW0D 1QQRA 1A3VA 1EEID 4EQPA 1EL0A 3VR6A 1H9JA 2JEBI 3QJYA 2RKSA 1QJOA 2O5JC 1FCCC 2EY6A 1YJIA 4GLSC 5C5MA 1E7PB 1WTVA 4KD3A 1XXGA 2BB5A 2BS4B 2A68C 4QB4A 5TSSA 1SE3A 3D8GA 3KBXA 5M3FB 2VB2X 2HQEA 4WAFA 5EBCA 3QO2A 4C3IG 3AE6B 5H8YE 4A9AA 2IX0A 3M4YA 1I50B 1D6EC 2PVGC 1LV9A 1KNEA 1KNAA 5M3MB 1FM0D 1CHQD 2N7JA 3GO5A 3NRZA 4DU9A 5FLXE 4G7OC 1IKMA 3NK9A 2G9DA 4HEDA 3R8BA 1XLNA 3L3OC 5HHDG 1AZQA 1CZPA 1XF5L 3NZ3A 1T5XD 1ACCA 3P63A 4V190 3AEAB 1L0XB 2NWGA 3T3NA 4J8QA 5CV5A 3E5SA 1MVKA 1NR2A 3IL8A 1T5EA 2KQ4X 1IGDA 4KJOA 3BS1A 4KN4C 2ICEC 2L1AA 1FNUA 2J53A 3ITPA 2JX5A 4OZCA 2SEBD 1V1PA 4IUVA 3TP8A 2H89B 3OW7A 4EGVA 1V97A 2PTLA 3S1MB 3LXFA 3JAML 2F3VA 1TS5A 3I90A 3PO0A 2J4XA 1QG7A 5IT9L 4MIUA 2GI9A 2QKIC 2MPMA 2XWJB 5C3JB 5LNK1 1HZ5A 2RDGA 3HOWB 3Q8FA 2QEJC 4IDIA 3PMFA 5IGBA 1YQ4B 3GTQB 5EKIA 1BXTA 2M00A 1TR5A 2WXRA 4DA2A 3ZJUA 2PZWA 2C5CA 3HVDA 5CYUA 2NTTA 5EPLA 5K5PA 1CTMA 5KEEA 2A6HC 4O42A 2Z8LA 4ILWA 1XYIA 4YWGG 1L0VB 1QB5D 2AQ2B 1I4QA 2X6GA 3OIPA 2WLBA 5FO8B 1QWYA 4EQNA 1I7HA 1ENCA 5I9PA 3CKIB 4KY6A 3PUVA 4A3BB 2W54A 1WTXA 3QOLA 3E56A 1EY5A 1E6EB 3WOFA 1JMLA 5IGFA 3GTLB 3N6RA 2ON8A 2CQAA 2B2VA 3W3AA 1NYQA 4ID6A 2K01A 3DWAA 1HA6A 4B0MA 1KLUD 2WAQB 1YN3A 3SR6A 1SYGA 1I3QB 1GUSA 2NZ1D 2E76C 1VDZA 4XT3B 2LHEA 3IKJA 2QCPX 4HKQA 2VZKB 2Z1CA 2WXMA 1CA6A 3FKIB 2LEKA 1HUNA 1ILQA 4B9WA 1WTPA 4K14A 3Q8AA 4D2KA 3EFXD 4IUUA 3LNNA 2QJLA 3W5VB 2O5IC 1RHPA 2JXTA 2W82A 1FR3A 4KK7A 1HEZE 1U9RA 5J1ZA 4RKBA 2F0OA 1GUNA 3T4AC 1XTCD 3DXJC 1PRTC 2LKVA 2DBYA 1K8MA 2Q8IB 1JICA 1J7CA 4HKZE 3NTHA 2B2YA 4KJNA 5EKKA 1FEHA 3C1EA 2ZW1A 3AU7A 4B9XA 1DZ1A 2AQ1B 4DK1A 3M7NA 3KK7A 5EGTA 4DFAA 2VXWA 2NVTB 1IGCA 4XDDA 3NWTA 2L12A 3URYA 3MP9A 4K6DA 4OHJA 2OXPA 1BUIC 1BCPF 1ZXIA 2LFNA 2IW3A 1RKNA 1JWBD 2F0NA 2B2WA 2KDMA 4IN3A 2WU2B 5FO7B 1YNTE 2F0GA 4PMBA 5I2YA 5JVG3 4KKIA 2SNSA 3L7ZC 2XNAC 2F0WA 2B2VC 4G7ZC 4IFDH 1YMHE 2WV6D 4CJ1B 3RUZA 2BW2A 4FXCA 4FXGC 3NVYA 3NXWA 3I4NB 4M8AA 1HTPA 4UDUC 2F0EA 1SYEA 2KCCA 4R9WA 2NVXB 4N9TA 5CV7A 3AMUA 5JEAG 4HN7A 1L6VA 4H44C 4XT1B 1Z6HA 3GTOB 1SJHD 1KABA 3BDOA 5E4WC 5E4XA 1LTTD 2MJEA 2WXPA 2J0TD 4O1NA 4KKTA 1EYAA 2B76B 1WGKA 3MXPA 3SDZA 4OW0A 1MHHE 3VA7A 4OO1G 1ZPSA 1RFKA 4FNFA 3DM1A 1WTOA 3S14B 2L11A 1IYUA 2EDGA 2RMMA 1MBYA 1NUCA 5EBDA 2MJ8A 2JP1A 1G6ZA 3TEWA 4H7BA 1PUTA 1VRAB 4BA1I 5KNBA 1PGBA 3ERQA 1BNZA 5C5LA 4ODGA 3Q0AA 4PT5A 4RWSC 5LL6X 1WD0A 4OGQC 4ZKCB 1JWMD 5EPKA 4NW2A 2WXOA 5ELBA 1WXQA 2E2IB 4WQMA 3BYTB 4K5WA 1SSNA 3FAHA 1S5DD 4ARIA 1VMPA 2DYMA</