2N9LA

1h, 13c, and 15n chemical shift assignments for in-cell gb1
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
57
structure length
57
Chain Sequence
MGTYKLILNGKTLKGETTTEAVDAATAEKVFKQYANDNGVDGEWTYDDATKTFTVTE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords Immunoglobulin G-binding protein G
publication title Improved in-cell structure determination of proteins at near-physiological concentration
pubmed doi rcsb
source organism Streptococcus sp. 'group g'
total genus 14
structure length 57
sequence length 57
ec nomenclature
pdb deposition date 2015-11-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01378 IgG_binding_B B domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.10 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 2n9lA00
1GB4A 1EM7A 1F2RC 3GB1A 1HZ5A 1FCCC 1XCTL 2RPVA 2ONQA 4KGSA 2PLPA 2QSDA 1C9FA 3FILA 1MVKA 1YMHE 1K52A 4HKZE 1ZXHA 4IOIE 1XCQL 5HHDG 4OZBA 2QMTA 1IGDA 2LHDA 5BMGA 1P7EA 2I38A 1F2RI 5HFYA 2LHEA 5HI1A 1K50A 5BMIA 2J53A 2LGIA 4KGTA 5HG2A 1KH0A 1Q10A 2ZW0A 4D2KA 2RMMA 2KQ4X 2ON8A 4KGRA 1XF5L 1D4BA 1IBXB 2N9LA 2N7JA 4WH4A 1UWXA 1MHHE 1PGXA 2PW9A 2KWDA 1JMLA 2ZW1A 5JXVA 2KDMA 1FD6A 1MI0A 1GB1A 1K51A 1FCLA 4OZAA 2JXTA 1HEZE 2OEDA 2LUMA 2KACA 4HJGE 3MP9A 1HZ6A 1MHXA 2JSVX 2NMQA 2GI9A 1PGAA 5BMHA 1P7FA 1MPEA 2J52A 2K0PA 2JWUA 2JU6X 3UI3A 3FILB 4MACA 2JZPA 2IGDA 2GB1A 2I2YA 2KN4A 1IGCA 1K53A 4OZCA 4IKGA 1IBXA 1YNTE 4GLSC 2PTLA 2EELA 2N9KA 1PGBA 1QKZA 2IGGA 3V3XA 2IGHA
chains in the Genus database with same CATH superfamily
4HROA 3ZNGC 3UIOB 2WDQB 2LRWA 1GB4A 3ZNHB 4HCPB 1RYJA 2FAZA 5C23A 3L4PA 4G0NB 4B9KA 1VDVA 2J0JA 2KYWA 1L6VA 3R66C 2D2QA 2LVPA 3BK1A 3DVNV 3IAS1 4HKZE 1WX7A 2BGFA 4IOIE 4MGIE 3AE8B 1T5XD 3Q14C 2LHDA 4DHZB 1V5TA 2KK8A 2WWZA 3NZSA 3NVYA 1QILA 2N0SB 1QOBA 2J53A 2K8HA 2M56B 4FHKA 1C4AA 1GNUA 2RMMA 4MH8A 1AN8A 1QOGA 1GPXA 4A90A 3BVGA 1PUTA 1IBXB 1YIWA 2LZ6A 1J8CA 2LI5A 5L95C 1PGXA 4IW0A 2KWDA 2ZW1A 1YOVB 3ZQ4A 4A3PA 1NVID 2M1MA 1DYQA 1HEZE 1KLUD 1XT9B 4HPMB 3NS1A 3N3KB 3C0RB 2J4XA 2NBWB 2ACZB 2WYQA 3UF8A 4FBJB 4YSZB 2J52A 1V6EA 3VH4B 3AU5A 3K9PB 3EECA 1V5OA 1K8RB 2AQ3B 2JZ3B 1IGCA 2RSUA 3WIMA 2V3NA 2DYBA 2GBMA 3DBHB 1MFWA 4BBNF 1WGGA 2KJHB 2YVCA 3PRPB 1QKZA 2KLCA 4KX6B 3ZJTA 4JGHB 3VXWA 1OQYA 2Y5PA 3M63B 3PT2B 4ZRKA 2REXA 4C56C 3SDLC 4DQOC 3QHTA 4TMAB 4K3BA 3QX1A 4P7IA 4BKSD 3VAWA 1C9FA 1P0RA 4AJYB 4KVGB 1L0XB 1E8XA 2LFIA 2K39A 4XE0A 3P4QB 4ANWA 4KSLC 5D6JB 2CJOA 1ZE3D 1OQQA 4ZYNA 3B1LX 3T8MA 4KDIC 1I4QA 3RT3B 1PFDA 3AE2B 1T0SC 3SFDB 4D2KA 1DOYA 3DVGX 1TGZB 3A1QA 3VRBB 1FXAA 2KJRA 2KDIA 2G4DB 1L4ZB 4PYUA 1ESFA 3V62A 1JRUA 2G4SA 2M19A 2KOXA 4M0WA 4J3OD 1EF5A 2KACA 1F1HA 3HHMA 1WXQA 1NYQA 2L00B 2OHFA 5BMHA 3W1YA 4EFOA 1YN4A 4N59A 4KDLB 3PRMB 4W9JA 4RGTA 3HK0A 4DXGA 2RDGA 1OEYA 2WXLA 4DXAB 3ZDTA 3CSTA 1TKGA 3ZXVA 3PSEB 2CU3A 4GU2A 1AW7A 2AEHA 3GS2A 3HM6X 1FEHA 2AWTA 2IGHA 4M01A 1E8YA 2MBOA 2FBWB 4M00A 1EM7A 3ZUNA 1ZDVA 3DOWA 2BWES 1OQRA 2WXMA 3J9CA 2KANA 3PHXB 2BKRB 4JL9A 2HTME 4HKQA 1H4RA 4N9F4 4NJ7A 1J0GA 3TJPA 1SGHA 3QARA 5T8IA 1P7EA 3KWVA 3JW0X 1GOZA 3L08A 3ML8A 3BINA 1GC7A 2KWVB 1D5XC 4BKTA 2LRUA 3L13A 4IM3A 1WF9A 4TKNA 3IBEA 3MHZA 4ITKA 2KX0A 3KYCD 2JUOA 2N9EB 2KQ4X 2ZJDA 4GMVA 2N7JA 5G55A 1AARA 4XWTA 5E6JA 3B2FA 2KTRA 1F77A 1WXVA 2KDMA 5FK9C 3ZJVA 1ZKHA 2BQQA 4K81A 2IDYA 2DYMA 2OEDA 4W9HA 1J7CA 2LMCA 2MA9B 1VLBA 1V86A 3Q8FA 4PK1A 3RNAC 2D5GA 4YSYB 2XNAC 2Z8LA 3ZKJC 1Z2MA 1A5RA 3UI3A 4WWNA 3FILB 3DBHI 1ZOYB 1E7PB 3AE9B 2JZPA 3KYDD 1VRAB 5D94A 5HKHA 1F0ZA 1YQ4B 3B08A 3N20C 2K3UA 2D11A 4XGAB 2DENB 3M3JA 1PGBA 1WE6A 2FNJB 2JPHA 2KAJA 4GOCA 5C2TB 5GMVA 1M4VA 3A9KA 2VRRB 4XC2A 5CX3A 4FJVB 1E7UA 4W9CA 4S17A 5CHWA 3UIPB 1JCKB 2G1EA 4KIKA 3ZLZA 1XCQL 3Q8CA 3NRZA 4EE2A 1C76A 3BYTB 4MM3A 1TS3A 4JQWC 1U4AA 3HRDD 3V6CB 4KGTA 5HG2A 1ZXIA 2H88B 2GRIA 3NUHB 4CYEA 1TIFA 3APCA 4PT5A 4NJ6A 3ZRCA 1UWXA 3IFWB 4XYCA 4A6QA 1QOFA 2PW9A 2HE7A 4RGOS 4N6EB 3TBLD 4XDDA 1WSPA 4MEMA 3NVZA 2X8XX 4ICUA 1D6EC 1WH3A 4MJSA 2RGFA 1SF0A 1YJJA 5AEKB 2IY1B 1YN3A 3WAOA 1KLGD 1V1PB 1JRPA 2IGDA 1KF6B 4LDTD 1LGRA 4W9LA 3IVFA 2X38A 2BBCA 4DXFA 2JXXA 3CMMB 2M0AA 2XN9C 4BZAA 2KQSA 1WRDB 3PRZA 4YTNB 1QQRA 3V61A 2PKOA 4TV3A 3TEXA 1I7HA 1WY8A 3N30A 2IO1B 4NJCA 2Z59B 1FNUA 1TJEA 4LDTB 3BK2A 3Q8BA 3TUOA 3KVFB 1SE9A 2JX5A 1FMAD 4YTMB 2LEKA 1RFAA 2RDBC 1YX5B 2MJ3A 1XQQA 1TTNA 3TEYA 2Q5WD 3AE3B 2O2VA 4JWSC 1I4XA 3MJWA 1YN5A 4C00A 1WWTA 1EU3A 3HIZA 2BS4B 1XF5L 1D4BA 4JWUC 1R4NB 4DHJD 1WIAA 2MBHA 4RFBA 5AZFA 4JPSA 4GDKA 2MBBB 1NDDA 1Q1OA 1ROEA 5G5HA 1F52A 1I4GA 1WM2A 2BKFA 3H7PB 4HJGE 3APDA 1VZ6A 2SEBD 4PS8A 4NAMA 2JZZA 3RFZB 2WU2B 3OJ3A 2GMIC 2K0PA 3Q3NC 4EUTA 4ZHPA 1TZ1A 1E8WA 1WYGA 2FUG1 3DCGA 5DPSA 2UWQA 4ZRQA 2HDEA 2QEJC 5H92C 3TL5A 2MLBA 2KN4A 1K53A 1TYGB 4I6NB 3DBLB 3PTFC 2QJLA 3BVZA 1UD7A 3DWGC 4FJZA 3AEGB 3DHIC 2D10A 4WWOA 3JSVA 4AS1A 1OGWA 1CMXB 4WJPA 1A70A 2KFJA 2BTEA 1GC6A 2CJNA 2JF5A 1ZP0B 3X23A 4FADA 2SAKA 2AL6A 4A3OA 3DHHC 3L16A 4KKIA 5MPOA 4LTUA 1WMHB 4MSMB 4KZCA 4G50A 1IGDA 1OFFA 2MBEA 4TUUA 4EKUA 3B9JA 3R2TA 3OWEB 3ZJUA 2BVCA 4JIOU 3T3NA 3Q2AC 2WXPA 1UNSA 2KFKA 5IA7A 1H8CA 2ZW0A 3RNFC 1XLNA 2MW5A 4NAWB 1IPGA 4NY0A 2N9LA 3ZRFA 4XZ4A 3VTWA 2W3RA 3UGBB 3QIJA 1UELA 3PHWB 4HPPA 1JMLA 2JRIB 1FD6A 1MI0A 4WURA 2DZIA 1F9JA 3NZ3A 3IAM1 3P1MA 3O13A 2BPSA 1SJHD 1E90A 1I4PA 3O65B 4GDLA 5AUKA 2O6VA 1Z5SB 4HK2A 2GI9A 4TQ1A 5JHAA 3WALA 1PQSA 5BO4B 1FPYA 2JU6X 1WFYA 2K6QA 2QIEB 3R3MA 1RAXA 1C3TA 2XEWA 4B6WA 4GIVA 5JHBA 4EOYA 3KH0A 2D3BA 3BYYB 3RULA 4EZKA 1RWSA 4RM9A 3A9JB 2ZNVB 4ARCA 4HJKA 2OOBB 3VQIA 4HDQA 2KDBA 1OEYJ 2ZVNA 4AP4C 5J18A 1ZW7A 3U2SC 1TY0A 1I4HA 4NPNA 4MSQB 5C1ZA 5L83A 2XBBC 3NVVA 4WWPA 4LNIA 2DX5B 2N9PC 3GB1A 2C7NB 3PZ7A 3RD2A 1GJZA 1WYWB 1RFKA 3WAMA 4E71A 3W5VB 5JZEB 1MVKA 1K52A 1ISNA 2QHOA 4R3DA 2LXAA 4OZBA 2N1VA 4W9GA 4HVBA 4CHKA 1SE4A 1WJUA 1XO3A 3KWLA 1R4NI 2KQ7A 4GN1A 4DBGA 5I4DA 5EE3A 1NEKB 1P98A 2H89B 2VH1A 3MC9A 1RLFA 1SSNA 4WH4A 1WX8A 2ZNVC 2CU1A 2ZEQA 2IY0B 2IO0B 1QLBB 3RMKC 1XXGA 2LGYA 3I3TB 2AL3A 2LGXA 3PV1A 3QA8A 1P7FA 5IP4D 1XEEA 4CQNA 3ZNZB 3DBLI 2ZVOA 3PREA 3I57A 4B0EA 2J7QB 1NI2A 1I42A 2W3SA 2KTFA 3CSFA 2W82A 2KJ6A 3GE3C 3MHSD 3DHGC 4WQMA 3MC0B 4C80A 2HJ8A 2FCNA 1C1YB 3VVWB 2ZZPB 3AULA 4OW0A 2K25A 1T0RC 1ZXHA 3Q6BA 1QOAA 5D2MB 2XK5B 3RN9C 2V0GA 4KKJA 4OHJA 3W1SA 2WXFA 3RNCC 2EMSA 1KOTA 1LO5D 1NENB 2RPVA 3IT4B 4RM8A 4M8NA 2M8SA 1N6ZA 3NOBA 1TBEA 1TT5B 3K9OB 3QAQA 2IO3B 2MP2B 1WRIA 2ICIA 3PS6A 2BS3B 4EZJA 5H8YE 2I38A 3VUYA 3ZIMA 2MHJA 1E10A 4HDOA 5AZHA 1L4DB 5IO9A 2HD5B 2L3ZA 4K7SA 2JRHA 2DBYA 2K8BA 3QJZA 3R8BA 3BZDB 4DWFA 2AQ1B 2N9XA 3EFUA 3P4PB 5LXIB 2C9WB 1T3QA 4J6IA 4II2B 2BW2A 2BT6A 3TSSA 1SBBB 2KC2A 4WJNA 2MQJA 1JALA 4BFRA 3NHEB 2IJ0A 2V3PA 3JVZX 1N5XA 2JXTA 2Y3AA 1QT9A 4FHJA 2Y5CA 3GZNB 2HTHA 1XLOA 2NMQA 4NQKE 1FM0D 4X57B 1XD3B 4IC7B 4AUQC 4HCNB 2WLBA 2KLGA 1ET9A 3VHTC 5BYSA 2WQYB 3WA0A 3TEZA 2I2YA 1WZ3A 1CK1A 5DPWA 2JYTA 3UQAA 2PTLA 2K5PA 3RCZA 4JLCA 1NYRA 3LXFA 4F7ZA 2BWFA 2L0FA 1YJIA 2BF8B 4LCDE 3H1UA 1XCTL 1WI0A 3WAPA 2KKCA 3TEWA 4B0MA 3WANA 3IG3A 1E6EB 3OLMD 3VFKA 5E6NA 4RF1A 1LQBA 2FCMA 1N62A 1GAQB 4DDID 2WXQA 3TCAA 4MT5A 1MG8A 2LWPA 2IPKD 4XWWA 2NPTA 2C5LC 4YSXB 2J42A 2MEKA 4BOZB 2MJDA 1FIQA 1K50A 2K6DB 2LGIA 2A5UA 2W55A 1KFYB 3LJ3A 4GB9A 2GBJA 2L83A 3ZVVA 4LNNA 2CHWA 3I9V1 2MBQA 4LJPB 3KUCB 2WU5B 4IWQA 3P4RB 4W9EA 4AQ7A 2E3TA 3PVLA 1CJEA 3ZDMC 3ZTCA 4E74A 4OZAA 1IUEA 4PS3A 4TQ0A 3DWMA 1HZ6A 1SIFA 4FJYA 3URYA 1WR6E 1T6BX 2D3GA 3KQ4A 1DGJA 3U30A 2ZPYA 2DZKA 4I6LB 2MX2A 3AE5B 2GBRA 4MELA 4YL8A 5KHQA 4O1NA 5TSSA 4US8A 4IKGA 2G3QB 3IHPC 1IBXA 2JY6A 2M4NA 4ZOHC 4MH0E 1WR1A 1Y56A 4BOSC 4WAFA 1C4PA 1WGYA 5KHOA 3A1QB 1V49A 3BWUD 4RGMA 1IP9A 1RM6C 1E8ZA 2WXJA 1C78A 2RPQA 2WXIA 2K1FA 2KMMA 3HVDA 2FUHB 3BIID 4FA6A 1BXTA 3AB5A 3T9LA 1KTKA 2WP9B 4DK5A 1Q5WB 1WXAA 5JH5C 4M0WB 2KT7A 2JT4B 1JWUD 5E6PA 4W9IA 4N58A 3VUWA 5HFYA 2E6XA 1C4CA 3UQBA 2V1YA 2GBKA 1FFVA 5BMIA 3B0AA 2RD0A 3AI5A 2MSED 1G6JA 5EE9A 3GP7A 4I6PA 2AYOB 2JVCA 2KD0A 1SIJA 1GUAB 5LLIA 4JX1C 3ZYYX 4BVUC 5FR3A 2QC8A 4YWGG 1FXTB 3GZNI 1JQ4A 4US9A 4K3CA 5AZGA 2K22A 1VD2A 3ML9A 3IXSA 3RUIB 3NZUA 2KX3A 2IO2B 3UINB 4ANXA 2LASA 1ZUD2 2AX5A 1KLVA 1HXYD 1UBIA 5DPRA 5BYQA 2FIDA 3A4RA 4BKSA 2CR5A 4GLSC 2INDC 4MGZE 1HA5A 2KMAA 3QQ8B 4C4VA 4HEA1 3Q69A 3W1SC 1WGKA 4DHZE 2JYEA 3BY4B 1E5WA 2LJ5A 1C79A 4WJQA 1HZ5A 4DHJB 3NVWA 2KTRB 1FXIA 2ONQA 4A9AA 2D3CA 1TZOA 2KWUB 3VUXA 3HVZA 2VZKD 2L8JA 4ZRPA 3D32A 2V9HA 4HWIB 1BT0A 1LFDA 2WXKA 2KVRA 3N1XC 2PVOD 3NY5A 4OVVA 5HI1A 5IKCM 3GE8C 4II3B 2FCQA 2UYZB 3SHQA 3N9YC 3BVMA 1P9DU 3PPAA 3I5JC 1MJDA 4BKGA 2ON8A 4KGRA 4WQOB 4DDGD 2DHZA 4WIPA 1SE3A 1FFUA 2VZKB 4P16A 1STEA 2N7DA 2L0TA 1EU4A 3W9CB 2NPTB 2INNE 4EZLA 3B2GA 4RH6A 5IN7A 3V60A 2RDHA 3A9KB 3AN1A 1HE8A 2V4LA 3H7SA 2JSVX 1E7VA 1R4MB 1VZ8A 4A20A 2JWUA 1DOIA 4WWMA 4URKA 4KIKB 4LNOA 2WXNA 4M02A 3ZW3A 4YT0B 4GXBA 3NJTA 1YQBA 3RI7C 2GB1A 2JWZA 3PLVA 4ZYSA 4MM3B 5DPTA 5IAAC 4Q2JA 1WGRA 3ZTDA 2MRPA 3L0WB 1Y8RC 2AQ2B 2EELA 3VRAB 2YLMA 3AH7A 2NR2A 1V97A 1V9JA 2LUEA 3U4EG 3PZDA 3M95A 5GXGB 4ZRJA 1F2RC 3SFEB 2FIFA 3AEAB 4HLEA 2RR9A 1L7YA 1YQ3B 3MC8A 3Q8AA 2FE8A 1JWMD 3I63C 2BYEA 2QSDA 4IUMB 2PEAA 3PLUA 4FN2A 3QC8B 3FILA 2PVGC 3U52E 3M62B 2TSSA 3P2BA 3KUDB 4A8XC 1PYWD 2Z0DB 3ECIA 4HXDA 4MJSB 3SU8X 1M94A 4IM2A 2LHEA 3QCAA 2HJ1A 3E9SA 3VDZA 3ONSA 2G9HD 4M8MA 4K7WA 1P3QU 5D3DA 4ANUA 3Q8EA 2BB6A 1V2YA 2J0MA 1SJED 1N63A 3AXCA 2WNMA 1SEBD 3AV8A 5DCNA 3RZWC 4MDKE 2PE6B 3ZXRA 1EO6A 1WJNA 2GOWA 2M17A 1FCLA 3VR9B 5CTRC 1I4RA 4BAXA 2LUMA 4L23A 3MP9A 1MHXA 1JWBD 4XX5A 4RNAA 3WCQA 4ANVA 1WM3A 1ZDXA 4B95A 1GG3A 1UZXB 3MJ5A 3APFA 4KZ0A 3SD5A 2W9NA 3N1ZC 5FR6A 1KRHA 4CO7A 3DQVA 4OZCA 2N4FA 1ACCA 4PYZA 2ZPNA 5IOIA 2O2VB 4IWOA 1BUIC 4A55A 1YNTE 2EKIA 1VCBA 2ZCBA 1N5WA 4G11A 3DVNU 1J19A 1TKYA 2M0XA 4GDKB 5EDSA 4EEWA 1OTRB 3KUZA 2Y5BB 3E56A 2L7RA 2WX1A 4BBNC 2WX0A 4USAA 2LGSA 3PGEA 4LJOB 3KW5B 1BMLC 1B9RA 3C8YA 1V1PA 3MTNB 2QMTA 1L0YB 4C4VB 2MCNB 1LM8B 2G45B 2IZVB 3N32A 4LNKA 1F2RI 1VR9A 1XLQA 5AUIA 1FNWA 2KXJA 2NBUA 2I1KA 3V6EB 1YX6B 4KSKC 5CHFA 3P42A 3L54A 1SB3C 3QWZB 4FLHA 3Q3OC 2KC1A 1FRDA 1WXMA 1TY2A 2WXOA 2JQRB 2UU7A 3SEBA 1D3ZA 2CHZA 5D3IB 5JXVA 3JSVB 1R4MI 1GB1A 2IYDB 1DOXA 1ENFA 1D5MC 3U7DA 3RPFC 1UH6A 1AWDA 1PGAA 2KDEB 1I35A 3P63A 4FULA 2NS5A 3RNEC 1J7BA 1FNVA 1HQRD 2V4IB 1JW9D 1SE2A 3FKYA 4W9DA 2D3AA 1TKEA 3Q3MC 4REZA 3R7QA 1E9MA 2C7HA 5LXHA 1FO4A 3NG0A 3AE6B 2L1AA 2O6VD 5LNK1 3PO0A 4L2YA 4L1BA 2N9KA 2KFKB 3ZO5B 2IBIB 2BYTA 1X1MA 2V3SA 1EUVB 3L10B 2DZMA 3GOEA 3AE4B 3A33B 2N7EA 4GGQA 2K9XA 3AEDB 3TIXA 1FCCC 4F8CB 3H7PA 3OAWA 4LLGM 1EWYC 1AYFA 3OJ4B 2DYOA 4KGSA 4K1RB 2WS3B 4UDUC 4YTPB 3W2DA 4ICVA 4AWJA 1V81A 4GDLB 1WE7A 4W9FA 4ASWC 2O6VB 3QK0A 2KZRA 4XDCA 4RF0A 3RNBC 1KJTA 2KDFB 3CF6E 2OJRA 3HUIA 3N1YC 3X0WA 5EE0A 1CZPA 4RCOA 3V05A 1R7SA 3LDZE 1JROA 1Q10A 3IT6B 2R61A 2C7MB 4HPLB 1VZ7A 5G5GA 1SXTA 3EA6A 4TSSA 3KLSX 1LXDA 2ASQA 3EFCA 2QCZA 1Q0WB 3VTUA 1JWSD 3EGRA 2I1JA 3AM9A 1ZPSA 2DZJA 2GLSA 2R2OA 3ABVB 3AEEB 3Q3FA 1WMHA 1XLPA 4F1SA 2BS2B 4RMAA 1L6UA 2NTTA 3FAHA 3CWIA 3EUB2 2W54A 3CIRB 3ENEA 4G3XB 1PDXA 2BYFA 3W5UB 3Q3JA 1WX9A 3RYTA 2MWSB 1UUPA 5D7GA 4H2AA 2LVQA 4MACA 3AECB 2WGSA 2KMCA 2QILA 1N61A 4NZLB 4FXCA 4P1BC 4ARIA 3H6NA 3ALBA 1EWCA 4NAWA 3C19A 5J2RA 5EE1A 1TS2A 4GSWA 1L2NA 2Z0EB 3VR8B 2BB5A 3DBRB 1V1OA 1YD8U 2YEPB 3TMPB 1UBQA 1L0VB 4NQLB 3P4SB 1ZGUB 2NBVB 3MFGA 1FRRA 2VH2A 2LD9A 2K8CA 2PIAA 1NBFC 3R2IA 2GBNA 3ZNID 1MG4A 2WXRA 2YEPF 2MH7A 1HTOA 3ETRA 4LNFA 4ACFA 4AJWA 5HHDG 3RNGC 4IM0A 1CQVA 4IDIA 1QF6A 4ZHOA 3DBSA 3H9DA 4HRSA 3A9JA 1QZEA 2DAFA 2PJHA 5FKAC 1TS5A 2MJEA 5G2NA 1J7AA 2WDTB 3LB8C 1JWAD 2L05A 2QDFA 4E3CA 3EHVA 1V80A 2N1WA 2INPE 2BYVE 3HM3A 4P6VF 4AOFA 2NCNA 2LVOA 2NTSA 2PMVA 2EKEC 3DDCB 3JYUA 2CS4A 3H8HA 2WXGA 2J0KA 2ZCCA 1KM7A 4MGYE 2L52A 4WAAA 1UGJA 1UWMA 2LGDA 3U8ZA 2FCSA 1WXSA 1WJ4A 4C7ZA 4OVUA 4ZDVA 5BYRA 4ZRIA 4JE3B 3A4SC 4P1CC 1RRBA 1C77A 2KNBA 3OG5A 2CHXA 1P1AA 4PS7A 1ET6A 2A4ZA 3AE1B 1L5PA 2WDVB 1WGDA 3AMZA 1S3SG 4OVZA 3V3XA 2DLBA 2WXHA 3PZ8A 3L17A 1UGMA 3S2AA 4WJOA 4KV2A 4K7UA 3NS8A 2WHIA 1WJ6A 2OJWA 4RGNA 2PLPA 4MGKE 1WZ0A 1YMHE 3DVGY 5TR5A 5BMGA 1VJKA 1NI3A 4C7YA 3T3OA 1T0QC 3SR6A 2PPHA 3R7RA 2EMTA 1KH0A 1YJ1A 1TS4A 1V8CA 4LK0M 4S0RA 5CHVC 3FC4A 2XK5A 3ZGZA 3LYYA 2R2QA 1MHHE 2L76A 2B3AA 1HTQA 3AEFB 1E0ZA 1K51A 2KVZA 3AEBB 3EC8A 5C3JB 4QAYA 2INCC 2LJIA 4W9KA 2KWCA 2WDRB 2MP2A 3U7ZA 3VTVA 5E6OA 3AE7B 1MPEA 2KHWB 2L32A 1WGHA 1UF0A 1T0YA 1N60A 2KN5A 2B76B 2DNFA 2LXCA 1D5ZC 3DBRI 5J17A 2CKHB 1S1QB 2DWQA 2KO3A 4YXDB 1IYFA 4NNJB 1B1ZA 4IG7B 1EF1A 2IGGA 3AU4A 3RZFA 3VH3B 2C60A 2PE9A 3DPDA 2D07B 2NVUI 4IWPA 2DAJA
chains in the Genus database with same CATH topology
4HROA 1QQRA 2WDQB 1GB4A 2PKOA 1YJIA 1RYJA 1N5WA 3L4PA 1TKYA 3TEXA 1I7HA 4GDKB 1XCTL 4NJCA 1VDVA 3E56A 1FNUA 1TJEA 1L6VA 3TEWA 4USAA 4B0MA 1E6EB 3BK2A 3BK1A 3Q8BA 4HKZE 3IAS1 3TUOA 1BMLC 1B9RA 4IOIE 3C8YA 1V1PA 3AE8B 4RF1A 2JX5A 1N62A 1GAQB 1FMAD 1L0YB 1T5XD 2QMTA 2WXQA 4MT5A 2LHDA 4YTMB 2LEKA 2IPKD 4XWWA 2MJ3A 1F2RI 4YSXB 2J42A 3NVYA 3TEYA 1QILA 1VR9A 1XLQA 2MEKA 2MJDA 1FIQA 1K50A 1FNWA 1QOBA 2N0SB 2Q5WD 3AE3B 2J53A 2LGIA 4JWSC 2M56B 1I4XA 1YN5A 1C4AA 2W55A 2RMMA 4MH8A 1WWTA 1AN8A 1EU3A 1KFYB 1QOGA 1GPXA 2L83A 3P42A 4A90A 2BS4B 3BVGA 1SB3C 1XF5L 1PUTA 1D4BA 1IBXB 4JWUC 1FRDA 3I9V1 1TY2A 4RFBA 1PGXA 2JQRB 2WXOA 3SEBA 4JPSA 2KWDA 2ZW1A 5JXVA 5D3IB 3ZQ4A 2WU5B 3P4RB 1ROEA 2E3TA 4AQ7A 1GB1A 1CJEA 1NVID 1DOXA 1ENFA 1D5MC 5G5HA 1I4GA 4OZAA 1IUEA 1DYQA 1HEZE 1KLUD 4TQ0A 3RPFC 3DWMA 3NS1A 4HJGE 1HZ6A 1VZ6A 2SEBD 4NAMA 2J4XA 3RFZB 3URYA 1AWDA 1PGAA 1T6BX 2ACZB 2WU2B 4YSZB 3P63A 2J52A 2K0PA 1J7BA 3KQ4A 4ZHPA 1FNVA 1DGJA 1HQRD 1WYGA 2FUG1 2V4IB 1JW9D 1SE2A 4ZRQA 2HDEA 3AE5B 2QEJC 2AQ3B 5H92C 4O1NA 1TKEA 2KN4A 4REZA 1IGCA 1E9MA 1K53A 1TYGB 5TSSA 4US8A 4IKGA 2V3NA 1FO4A 1IBXA 3AE6B 2L1AA 2QJLA 3BVZA 5LNK1 3DWGC 3PO0A 4L2YA 4L1BA 4ZOHC 3AEGB 2N9KA 1Y56A 1QKZA 4WAFA 2BYTA 4KX6B 1C4PA 3ZJTA 3BWUD 4AS1A 4RGMA 3AE4B 2Y5PA 1A70A 1RM6C 2K9XA 3AEDB 2WXJA 2BTEA 2CJNA 1C78A 1FCCC 1ZP0B 4C56C 2WXIA 4LLGM 1EWYC 2KMMA 4DQOC 1AYFA 2SAKA 3HVDA 4TMAB 2DYOA 3BIID 4KGSA 1BXTA 2WS3B 3AB5A 4UDUC 1KTKA 4KKIA 4LTUA 2WP9B 4YTPB 3W2DA 5MPOA 1C9FA 1L0XB 2LFIA 4GDLB 4XE0A 1JWUD 3P4QB 1IGDA 2CJOA 4N58A 1OFFA 4XDCA 4RF0A 1ZE3D 1OQQA 3B9JA 3R2TA 3OWEB 5HFYA 2E6XA 1C4CA 3ZJUA 1I4QA 3HUIA 3T3NA 1FFVA 5BMIA 5EE0A 1CZPA 1PFDA 3AE2B 4RCOA 2WXPA 1R7SA 1UNSA 3V05A 1JROA 5EE9A 3SFDB 1Q10A 2ZW0A 4D2KA 3IT6B 3GP7A 1DOYA 2R61A 1XLNA 1VZ7A 5G5GA 4NAWB 1SXTA 3EA6A 4TSSA 3VRBB 2N9LA 1FXAA 3KLSX 1SIJA 1JWSD 2W3RA 3EGRA 1L4ZB 3AM9A 1ZPSA 4JX1C 3ZYYX 1JMLA 5FR3A 1ESFA 3ABVB 4YWGG 1FD6A 3AEEB 1JQ4A 1MI0A 4WURA 4US9A 1XLPA 3NZ3A 2M19A 2BS2B 3IAM1 3O13A 3P1MA 2K22A 4M0WA 1SJHD 1I4PA 4J3OD 1L6UA 2NTTA 3FAHA 3CWIA 2KACA 3EUB2 2W54A 3CIRB 5AUKA 2GI9A 1WXQA 4TQ1A 1PDXA 1NYQA 2OHFA 5BMHA 3IXSA 3W5UB 1YN4A 4N59A 2JU6X 4RGTA 2QIEB 1UUPA 5D7GA 4H2AA 1ZUD2 4MACA 2AX5A 3AECB 2QILA 4DXGA 2RDGA 1N61A 4NZLB 1HXYD 3BYYB 4FXCA 4ARIA 1RWSA 5BYQA 1EWCA 2WXLA 4ARCA 5EE1A 1TS2A 1TKGA 3VQIA 3VR8B 2BB5A 4GLSC 1HA5A 2CU3A 3U2SC 1TY0A 1AW7A 3GS2A 1V1OA 1I4HA 1FEHA 4HEA1 3Q69A 1WGKA 2IGHA 2YEPB 2FBWB 2JYEA 3NVVA 1C79A 1L0VB 1EM7A 1ZDVA 3GB1A 3P4SB 1HZ5A 3PZ7A 3MFGA 1FRRA 1OQRA 2WXMA 3J9CA 3NVWA 2PIAA 3R2IA 1RFKA 1FXIA 2ONQA 4A9AA 2HTME 2WXRA 4HKQA 3W5VB 1TZOA 2YEPF 3HVZA 2MH7A 2VZKD 3ETRA 4ZRPA 1MVKA 1K52A 5HHDG 4R3DA 4OZBA 5T8IA 1P7EA 2WXKA 1CQVA 3KWVA 1GOZA 4IDIA 1QF6A 2PVOD 4ZHOA 1D5XC 4HRSA 5FKAC 5HI1A 1SE4A 1TS5A 2MJEA 1J7AA 1XO3A 3LB8C 1JWAD 3KWLA 3MHZA 3N9YC 3BVMA 4ITKA 5I4DA 2INPE 2KQ4X 2ON8A 4KGRA 5EE3A 1NEKB 2H89B 4P6VF 4WIPA 2N7JA 1SE3A 1SSNA 4WH4A 2NTSA 4XWTA 2PMVA 1FFUA 2VZKB 4P16A 1STEA 3H8HA 2WXGA 5E6JA 3B2FA 1F77A 5FK9C 2KDMA 1QLBB 1EU4A 3W9CB 3ZJVA 2L52A 1XXGA 2INNE 2IDYA 2DYMA 3B2GA 4RH6A 1UGJA 2OEDA 1J7CA 2RDHA 3AN1A 1UWMA 2LMCA 1VLBA 2JSVX 3Q8FA 1VZ8A 2D5GA 4YSYB 1P7FA 2XNAC 2Z8LA 4C7ZA 1XEEA 4CQNA 2JWUA 3UI3A 1DOIA 3FILB 4WWMA 5BYRA 1ZOYB 1E7PB 2WXNA 3I57A 3AE9B 2JZPA 4YT0B 4B0EA 1VRAB 4JE3B 2GB1A 2W3SA 4ZYSA 1F0ZA 1C77A 2W82A 4MM3B 1YQ4B 4WQMA 3MC0B 4Q2JA 1ET6A 4C80A 2K3UA 2AQ2B 3AE1B 2EELA 3VRAB 3AH7A 1L5PA 1PGBA 2WDVB 4OW0A 3AMZA 4OVZA 3V3XA 1V97A 1ZXHA 1QOAA 2KAJA 2DLBA 3U4EG 2WXHA 3PZ8A 2V0GA 5GXGB 4KKJA 4OHJA 3W1SA 1F2RC 3SFEB 3AEAB 5C2TB 2WXFA 1M4VA 1LO5D 1NENB 2RPVA 3IT4B 1YQ3B 3Q8AA 2FE8A 1JWMD 4RGNA 2PLPA 2QSDA 1JCKB 3FILA 2PVGC 1YMHE 2G1EA 1XCQL 3U52E 1WRIA 2ICIA 2TSSA 3Q8CA 4A8XC 2BS3B 1PYWD 3NRZA 5H8YE 5BMGA 4EE2A 2I38A 1VJKA 1C76A 1NI3A 3BYTB 4C7YA 3T3OA 1E10A 3SR6A 2LHEA 1L4DB 1TS3A 3E9SA 2G9HD 3HRDD 2DBYA 5D3DA 4KGTA 5HG2A 1ZXIA 2H88B 1KH0A 3Q8EA 2BB6A 2GRIA 1TS4A 3BZDB 3NUHB 2AQ1B 3R8BA 1V8CA 4LK0M 1SJED 1N63A 3P4PB 4PT5A 2WNMA 3FC4A 1SEBD 1T3QA 3AV8A 3ZGZA 2BW2A 2BT6A 3LYYA 1UWXA 1MHHE 4A6QA 3TSSA 1QOFA 1SBBB 2PW9A 3AEFB 1E0ZA 1JALA 4RGOS 4N6EB 2IJ0A 4XDDA 1WSPA 2V3PA 1K51A 3AEBB 1FCLA 1N5XA 3VR9B 5C3JB 2JXTA 1I4RA 2LJIA 2Y3AA 2LUMA 1QT9A 2WDRB 3NVZA 4L23A 3MP9A 2Y5CA 1MHXA 3U7ZA 1JWBD 1XLOA 2NMQA 4RNAA 3WCQA 1ZDXA 1FM0D 1D6EC 3AE7B 1MPEA 2L32A 1SF0A 1YJJA 3MJ5A 1N60A 1YN3A 1KLGD 1V1PB 2WLBA 1ET9A 1JRPA 2B76B 2IGDA 5BYSA 1D5ZC 2WQYB 1KF6B 1KRHA 3TEZA 2I2YA 4OZCA 1CK1A 1ACCA 2DWQA 2X38A 4YXDB 1BUIC 4A55A 1YNTE 2JYTA 2BBCA 2PTLA 2K5PA 4DXFA 2M0AA 2XN9C 2EKIA 1B1ZA 2IGGA 1NYRA 5AUIA 3LXFA 4YTNB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1GB4 A;  1EM7 A;  1F2R C;  3GB1 A;  1HZ5 A;  1FCC C;  1XCT L;  2RPV A;  2ONQ A;  4KGS A;  2PLP A;  2QSD A;  1C9F A;  3FIL A;  1MVK A;  1YMH E;  1K52 A;  4HKZ E;  1ZXH A;  4IOI E;  1XCQ L;  5HHD G;  4OZB A;  2QMT A;  1IGD A;  2LHD A;  5BMG A;  1P7E A;  2I38 A;  1F2R I;  5HFY A;  2LHE A;  5HI1 A;  1K50 A;  5BMI A;  2J53 A;  2LGI A;  4KGT A;  5HG2 A;  1KH0 A;  1Q10 A;  2ZW0 A;  4D2K A;  2RMM A;  2KQ4 X;  2ON8 A;  4KGR A;  1XF5 L;  1D4B A;  1IBX B;  2N9L A;  2N7J A;  4WH4 A;  1UWX A;  1MHH E;  1PGX A;  2PW9 A;  2KWD A;  1JML A;  2ZW1 A;  5JXV A;  2KDM A;  1FD6 A;  1MI0 A;  1GB1 A;  1K51 A;  1FCL A;  4OZA A;  2JXT A;  1HEZ E;  2OED A;  2LUM A;  2KAC A;  4HJG E;  3MP9 A;  1HZ6 A;  1MHX A;  2JSV X;  2NMQ A;  2GI9 A;  1PGA A;  5BMH A;  1P7F A;  1MPE A;  2J52 A;  2K0P A;  2JWU A;  2JU6 X;  3UI3 A;  3FIL B;  4MAC A;  2JZP A;  2IGD A;  2GB1 A;  2I2Y A;  2KN4 A;  1IGC A;  1K53 A;  4OZC A;  4IKG A;  1IBX A;  1YNT E;  4GLS C;  2PTL A;  2EEL A;  2N9K A;  1PGB A;  1QKZ A;  2IGG A;  3V3X A;  2IGH A; 
#chains in the Genus database with same CATH topology
 4HRO A;  3ZNG C;  3UIO B;  2WDQ B;  2LRW A;  1GB4 A;  3ZNH B;  4HCP B;  1RYJ A;  2FAZ A;  5C23 A;  3L4P A;  4G0N B;  4B9K A;  1VDV A;  2J0J A;  2KYW A;  1L6V A;  3R66 C;  2D2Q A;  2LVP A;  3BK1 A;  3DVN V;  3IAS 1;  4HKZ E;  1WX7 A;  2BGF A;  4IOI E;  4MGI E;  3AE8 B;  1T5X D;  3Q14 C;  2LHD A;  4DHZ B;  1V5T A;  2KK8 A;  2WWZ A;  3NZS A;  3NVY A;  1QIL A;  2N0S B;  1QOB A;  2J53 A;  2K8H A;  2M56 B;  4FHK A;  1C4A A;  1GNU A;  2RMM A;  4MH8 A;  1AN8 A;  1QOG A;  1GPX A;  4A90 A;  3BVG A;  1PUT A;  1IBX B;  1YIW A;  2LZ6 A;  1J8C A;  2LI5 A;  5L95 C;  1PGX A;  4IW0 A;  2KWD A;  2ZW1 A;  1YOV B;  3ZQ4 A;  4A3P A;  1NVI D;  2M1M A;  1DYQ A;  1HEZ E;  1KLU D;  1XT9 B;  4HPM B;  3NS1 A;  3N3K B;  3C0R B;  2J4X A;  2NBW B;  2ACZ B;  2WYQ A;  3UF8 A;  4FBJ B;  4YSZ B;  2J52 A;  1V6E A;  3VH4 B;  3AU5 A;  3K9P B;  3EEC A;  1V5O A;  1K8R B;  2AQ3 B;  2JZ3 B;  1IGC A;  2RSU A;  3WIM A;  2V3N A;  2DYB A;  2GBM A;  3DBH B;  1MFW A;  4BBN F;  1WGG A;  2KJH B;  2YVC A;  3PRP B;  1QKZ A;  2KLC A;  4KX6 B;  3ZJT A;  4JGH B;  3VXW A;  1OQY A;  2Y5P A;  3M63 B;  3PT2 B;  4ZRK A;  2REX A;  4C56 C;  3SDL C;  4DQO C;  3QHT A;  4TMA B;  4K3B A;  3QX1 A;  4P7I A;  4BKS D;  3VAW A;  1C9F A;  1P0R A;  4AJY B;  4KVG B;  1L0X B;  1E8X A;  2LFI A;  2K39 A;  4XE0 A;  3P4Q B;  4ANW A;  4KSL C;  5D6J B;  2CJO A;  1ZE3 D;  1OQQ A;  4ZYN A;  3B1L X;  3T8M A;  4KDI C;  1I4Q A;  3RT3 B;  1PFD A;  3AE2 B;  1T0S C;  3SFD B;  4D2K A;  1DOY A;  3DVG X;  1TGZ B;  3A1Q A;  3VRB B;  1FXA A;  2KJR A;  2KDI A;  2G4D B;  1L4Z B;  4PYU A;  1ESF A;  3V62 A;  1JRU A;  2G4S A;  2M19 A;  2KOX A;  4M0W A;  4J3O D;  1EF5 A;  2KAC A;  1F1H A;  3HHM A;  1WXQ A;  1NYQ A;  2L00 B;  2OHF A;  5BMH A;  3W1Y A;  4EFO A;  1YN4 A;  4N59 A;  4KDL B;  3PRM B;  4W9J A;  4RGT A;  3HK0 A;  4DXG A;  2RDG A;  1OEY A;  2WXL A;  4DXA B;  3ZDT A;  3CST A;  1TKG A;  3ZXV A;  3PSE B;  2CU3 A;  4GU2 A;  1AW7 A;  2AEH A;  3GS2 A;  3HM6 X;  1FEH A;  2AWT A;  2IGH A;  4M01 A;  1E8Y A;  2MBO A;  2FBW B;  4M00 A;  1EM7 A;  3ZUN A;  1ZDV A;  3DOW A;  2BWE S;  1OQR A;  2WXM A;  3J9C A;  2KAN A;  3PHX B;  2BKR B;  4JL9 A;  2HTM E;  4HKQ A;  1H4R A;  4N9F 4;  4NJ7 A;  1J0G A;  3TJP A;  1SGH A;  3QAR A;  5T8I A;  1P7E A;  3KWV A;  3JW0 X;  1GOZ A;  3L08 A;  3ML8 A;  3BIN A;  1GC7 A;  2KWV B;  1D5X C;  4BKT A;  2LRU A;  3L13 A;  4IM3 A;  1WF9 A;  4TKN A;  3IBE A;  3MHZ A;  4ITK A;  2KX0 A;  3KYC D;  2JUO A;  2N9E B;  2KQ4 X;  2ZJD A;  4GMV A;  2N7J A;  5G55 A;  1AAR A;  4XWT A;  5E6J A;  3B2F A;  2KTR A;  1F77 A;  1WXV A;  2KDM A;  5FK9 C;  3ZJV A;  1ZKH A;  2BQQ A;  4K81 A;  2IDY A;  2DYM A;  2OED A;  4W9H A;  1J7C A;  2LMC A;  2MA9 B;  1VLB A;  1V86 A;  3Q8F A;  4PK1 A;  3RNA C;  2D5G A;  4YSY B;  2XNA C;  2Z8L A;  3ZKJ C;  1Z2M A;  1A5R A;  3UI3 A;  4WWN A;  3FIL B;  3DBH I;  1ZOY B;  1E7P B;  3AE9 B;  2JZP A;  3KYD D;  1VRA B;  5D94 A;  5HKH A;  1F0Z A;  1YQ4 B;  3B08 A;  3N20 C;  2K3U A;  2D11 A;  4XGA B;  2DEN B;  3M3J A;  1PGB A;  1WE6 A;  2FNJ B;  2JPH A;  2KAJ A;  4GOC A;  5C2T B;  5GMV A;  1M4V A;  3A9K A;  2VRR B;  4XC2 A;  5CX3 A;  4FJV B;  1E7U A;  4W9C A;  4S17 A;  5CHW A;  3UIP B;  1JCK B;  2G1E A;  4KIK A;  3ZLZ A;  1XCQ L;  3Q8C A;  3NRZ A;  4EE2 A;  1C76 A;  3BYT B;  4MM3 A;  1TS3 A;  4JQW C;  1U4A A;  3HRD D;  3V6C B;  4KGT A;  5HG2 A;  1ZXI A;  2H88 B;  2GRI A;  3NUH B;  4CYE A;  1TIF A;  3APC A;  4PT5 A;  4NJ6 A;  3ZRC A;  1UWX A;  3IFW B;  4XYC A;  4A6Q A;  1QOF A;  2PW9 A;  2HE7 A;  4RGO S;  4N6E B;  3TBL D;  4XDD A;  1WSP A;  4MEM A;  3NVZ A;  2X8X X;  4ICU A;  1D6E C;  1WH3 A;  4MJS A;  2RGF A;  1SF0 A;  1YJJ A;  5AEK B;  2IY1 B;  1YN3 A;  3WAO A;  1KLG D;  1V1P B;  1JRP A;  2IGD A;  1KF6 B;  4LDT D;  1LGR A;  4W9L A;  3IVF A;  2X38 A;  2BBC A;  4DXF A;  2JXX A;  3CMM B;  2M0A A;  2XN9 C;  4BZA A;  2KQS A;  1WRD B;  3PRZ A;  4YTN B;  1QQR A;  3V61 A;  2PKO A;  4TV3 A;  3TEX A;  1I7H A;  1WY8 A;  3N30 A;  2IO1 B;  4NJC A;  2Z59 B;  1FNU A;  1TJE A;  4LDT B;  3BK2 A;  3Q8B A;  3TUO A;  3KVF B;  1SE9 A;  2JX5 A;  1FMA D;  4YTM B;  2LEK A;  1RFA A;  2RDB C;  1YX5 B;  2MJ3 A;  1XQQ A;  1TTN A;  3TEY A;  2Q5W D;  3AE3 B;  2O2V A;  4JWS C;  1I4X A;  3MJW A;  1YN5 A;  4C00 A;  1WWT A;  1EU3 A;  3HIZ A;  2BS4 B;  1XF5 L;  1D4B A;  4JWU C;  1R4N B;  4DHJ D;  1WIA A;  2MBH A;  4RFB A;  5AZF A;  4JPS A;  4GDK A;  2MBB B;  1NDD A;  1Q1O A;  1ROE A;  5G5H A;  1F52 A;  1I4G A;  1WM2 A;  2BKF A;  3H7P B;  4HJG E;  3APD A;  1VZ6 A;  2SEB D;  4PS8 A;  4NAM A;  2JZZ A;  3RFZ B;  2WU2 B;  3OJ3 A;  2GMI C;  2K0P A;  3Q3N C;  4EUT A;  4ZHP A;  1TZ1 A;  1E8W A;  1WYG A;  2FUG 1;  3DCG A;  5DPS A;  2UWQ A;  4ZRQ A;  2HDE A;  2QEJ C;  5H92 C;  3TL5 A;  2MLB A;  2KN4 A;  1K53 A;  1TYG B;  4I6N B;  3DBL B;  3PTF C;  2QJL A;  3BVZ A;  1UD7 A;  3DWG C;  4FJZ A;  3AEG B;  3DHI C;  2D10 A;  4WWO A;  3JSV A;  4AS1 A;  1OGW A;  1CMX B;  4WJP A;  1A70 A;  2KFJ A;  2BTE A;  1GC6 A;  2CJN A;  2JF5 A;  1ZP0 B;  3X23 A;  4FAD A;  2SAK A;  2AL6 A;  4A3O A;  3DHH C;  3L16 A;  4KKI A;  5MPO A;  4LTU A;  1WMH B;  4MSM B;  4KZC A;  4G50 A;  1IGD A;  1OFF A;  2MBE A;  4TUU A;  4EKU A;  3B9J A;  3R2T A;  3OWE B;  3ZJU A;  2BVC A;  4JIO U;  3T3N A;  3Q2A C;  2WXP A;  1UNS A;  2KFK A;  5IA7 A;  1H8C A;  2ZW0 A;  3RNF C;  1XLN A;  2MW5 A;  4NAW B;  1IPG A;  4NY0 A;  2N9L A;  3ZRF A;  4XZ4 A;  3VTW A;  2W3R A;  3UGB B;  3QIJ A;  1UEL A;  3PHW B;  4HPP A;  1JML A;  2JRI B;  1FD6 A;  1MI0 A;  4WUR A;  2DZI A;  1F9J A;  3NZ3 A;  3IAM 1;  3P1M A;  3O13 A;  2BPS A;  1SJH D;  1E90 A;  1I4P A;  3O65 B;  4GDL A;  5AUK A;  2O6V A;  1Z5S B;  4HK2 A;  2GI9 A;  4TQ1 A;  5JHA A;  3WAL A;  1PQS A;  5BO4 B;  1FPY A;  2JU6 X;  1WFY A;  2K6Q A;  2QIE B;  3R3M A;  1RAX A;  1C3T A;  2XEW A;  4B6W A;  4GIV A;  5JHB A;  4EOY A;  3KH0 A;  2D3B A;  3BYY B;  3RUL A;  4EZK A;  1RWS A;  4RM9 A;  3A9J B;  2ZNV B;  4ARC A;  4HJK A;  2OOB B;  3VQI A;  4HDQ A;  2KDB A;  1OEY J;  2ZVN A;  4AP4 C;  5J18 A;  1ZW7 A;  3U2S C;  1TY0 A;  1I4H A;  4NPN A;  4MSQ B;  5C1Z A;  5L83 A;  2XBB C;  3NVV A;  4WWP A;  4LNI A;  2DX5 B;  2N9P C;  3GB1 A;  2C7N B;  3PZ7 A;  3RD2 A;  1GJZ A;  1WYW B;  1RFK A;  3WAM A;  4E71 A;  3W5V B;  5JZE B;  1MVK A;  1K52 A;  1ISN A;  2QHO A;  4R3D A;  2LXA A;  4OZB A;  2N1V A;  4W9G A;  4HVB A;  4CHK A;  1SE4 A;  1WJU A;  1XO3 A;  3KWL A;  1R4N I;  2KQ7 A;  4GN1 A;  4DBG A;  5I4D A;  5EE3 A;  1NEK B;  1P98 A;  2H89 B;  2VH1 A;  3MC9 A;  1RLF A;  1SSN A;  4WH4 A;  1WX8 A;  2ZNV C;  2CU1 A;  2ZEQ A;  2IY0 B;  2IO0 B;  1QLB B;  3RMK C;  1XXG A;  2LGY A;  3I3T B;  2AL3 A;  2LGX A;  3PV1 A;  3QA8 A;  1P7F A;  5IP4 D;  1XEE A;  4CQN A;  3ZNZ B;  3DBL I;  2ZVO A;  3PRE A;  3I57 A;  4B0E A;  2J7Q B;  1NI2 A;  1I42 A;  2W3S A;  2KTF A;  3CSF A;  2W82 A;  2KJ6 A;  3GE3 C;  3MHS D;  3DHG C;  4WQM A;  3MC0 B;  4C80 A;  2HJ8 A;  2FCN A;  1C1Y B;  3VVW B;  2ZZP B;  3AUL A;  4OW0 A;  2K25 A;  1T0R C;  1ZXH A;  3Q6B A;  1QOA A;  5D2M B;  2XK5 B;  3RN9 C;  2V0G A;  4KKJ A;  4OHJ A;  3W1S A;  2WXF A;  3RNC C;  2EMS A;  1KOT A;  1LO5 D;  1NEN B;  2RPV A;  3IT4 B;  4RM8 A;  4M8N A;  2M8S A;  1N6Z A;  3NOB A;  1TBE A;  1TT5 B;  3K9O B;  3QAQ A;  2IO3 B;  2MP2 B;  1WRI A;  2ICI A;  3PS6 A;  2BS3 B;  4EZJ A;  5H8Y E;  2I38 A;  3VUY A;  3ZIM A;  2MHJ A;  1E10 A;  4HDO A;  5AZH A;  1L4D B;  5IO9 A;  2HD5 B;  2L3Z A;  4K7S A;  2JRH A;  2DBY A;  2K8B A;  3QJZ A;  3R8B A;  3BZD B;  4DWF A;  2AQ1 B;  2N9X A;  3EFU A;  3P4P B;  5LXI B;  2C9W B;  1T3Q A;  4J6I A;  4II2 B;  2BW2 A;  2BT6 A;  3TSS A;  1SBB B;  2KC2 A;  4WJN A;  2MQJ A;  1JAL A;  4BFR A;  3NHE B;  2IJ0 A;  2V3P A;  3JVZ X;  1N5X A;  2JXT A;  2Y3A A;  1QT9 A;  4FHJ A;  2Y5C A;  3GZN B;  2HTH A;  1XLO A;  2NMQ A;  4NQK E;  1FM0 D;  4X57 B;  1XD3 B;  4IC7 B;  4AUQ C;  4HCN B;  2WLB A;  2KLG A;  1ET9 A;  3VHT C;  5BYS A;  2WQY B;  3WA0 A;  3TEZ A;  2I2Y A;  1WZ3 A;  1CK1 A;  5DPW A;  2JYT A;  3UQA A;  2PTL A;  2K5P A;  3RCZ A;  4JLC A;  1NYR A;  3LXF A;  4F7Z A;  2BWF A;  2L0F A;  1YJI A;  2BF8 B;  4LCD E;  3H1U A;  1XCT L;  1WI0 A;  3WAP A;  2KKC A;  3TEW A;  4B0M A;  3WAN A;  3IG3 A;  1E6E B;  3OLM D;  3VFK A;  5E6N A;  4RF1 A;  1LQB A;  2FCM A;  1N62 A;  1GAQ B;  4DDI D;  2WXQ A;  3TCA A;  4MT5 A;  1MG8 A;  2LWP A;  2IPK D;  4XWW A;  2NPT A;  2C5L C;  4YSX B;  2J42 A;  2MEK A;  4BOZ B;  2MJD A;  1FIQ A;  1K50 A;  2K6D B;  2LGI A;  2A5U A;  2W55 A;  1KFY B;  3LJ3 A;  4GB9 A;  2GBJ A;  2L83 A;  3ZVV A;  4LNN A;  2CHW A;  3I9V 1;  2MBQ A;  4LJP B;  3KUC B;  2WU5 B;  4IWQ A;  3P4R B;  4W9E A;  4AQ7 A;  2E3T A;  3PVL A;  1CJE A;  3ZDM C;  3ZTC A;  4E74 A;  4OZA A;  1IUE A;  4PS3 A;  4TQ0 A;  3DWM A;  1HZ6 A;  1SIF A;  4FJY A;  3URY A;  1WR6 E;  1T6B X;  2D3G A;  3KQ4 A;  1DGJ A;  3U30 A;  2ZPY A;  2DZK A;  4I6L B;  2MX2 A;  3AE5 B;  2GBR A;  4MEL A;  4YL8 A;  5KHQ A;  4O1N A;  5TSS A;  4US8 A;  4IKG A;  2G3Q B;  3IHP C;  1IBX A;  2JY6 A;  2M4N A;  4ZOH C;  4MH0 E;  1WR1 A;  1Y56 A;  4BOS C;  4WAF A;  1C4P A;  1WGY A;  5KHO A;  3A1Q B;  1V49 A;  3BWU D;  4RGM A;  1IP9 A;  1RM6 C;  1E8Z A;  2WXJ A;  1C78 A;  2RPQ A;  2WXI A;  2K1F A;  2KMM A;  3HVD A;  2FUH B;  3BII D;  4FA6 A;  1BXT A;  3AB5 A;  3T9L A;  1KTK A;  2WP9 B;  4DK5 A;  1Q5W B;  1WXA A;  5JH5 C;  4M0W B;  2KT7 A;  2JT4 B;  1JWU D;  5E6P A;  4W9I A;  4N58 A;  3VUW A;  5HFY A;  2E6X A;  1C4C A;  3UQB A;  2V1Y A;  2GBK A;  1FFV A;  5BMI A;  3B0A A;  2RD0 A;  3AI5 A;  2MSE D;  1G6J A;  5EE9 A;  3GP7 A;  4I6P A;  2AYO B;  2JVC A;  2KD0 A;  1SIJ A;  1GUA B;  5LLI A;  4JX1 C;  3ZYY X;  4BVU C;  5FR3 A;  2QC8 A;  4YWG G;  1FXT B;  3GZN I;  1JQ4 A;  4US9 A;  4K3C A;  5AZG A;  2K22 A;  1VD2 A;  3ML9 A;  3IXS A;  3RUI B;  3NZU A;  2KX3 A;  2IO2 B;  3UIN B;  4ANX A;  2LAS A;  1ZUD 2;  2AX5 A;  1KLV A;  1HXY D;  1UBI A;  5DPR A;  5BYQ A;  2FID A;  3A4R A;  4BKS A;  2CR5 A;  4GLS C;  2IND C;  4MGZ E;  1HA5 A;  2KMA A;  3QQ8 B;  4C4V A;  4HEA 1;  3Q69 A;  3W1S C;  1WGK A;  4DHZ E;  2JYE A;  3BY4 B;  1E5W A;  2LJ5 A;  1C79 A;  4WJQ A;  1HZ5 A;  4DHJ B;  3NVW A;  2KTR B;  1FXI A;  2ONQ A;  4A9A A;  2D3C A;  1TZO A;  2KWU B;  3VUX A;  3HVZ A;  2VZK D;  2L8J A;  4ZRP A;  3D32 A;  2V9H A;  4HWI B;  1BT0 A;  1LFD A;  2WXK A;  2KVR A;  3N1X C;  2PVO D;  3NY5 A;  4OVV A;  5HI1 A;  5IKC M;  3GE8 C;  4II3 B;  2FCQ A;  2UYZ B;  3SHQ A;  3N9Y C;  3BVM A;  1P9D U;  3PPA A;  3I5J C;  1MJD A;  4BKG A;  2ON8 A;  4KGR A;  4WQO B;  4DDG D;  2DHZ A;  4WIP A;  1SE3 A;  1FFU A;  2VZK B;  4P16 A;  1STE A;  2N7D A;  2L0T A;  1EU4 A;  3W9C B;  2NPT B;  2INN E;  4EZL A;  3B2G A;  4RH6 A;  5IN7 A;  3V60 A;  2RDH A;  3A9K B;  3AN1 A;  1HE8 A;  2V4L A;  3H7S A;  2JSV X;  1E7V A;  1R4M B;  1VZ8 A;  4A20 A;  2JWU A;  1DOI A;  4WWM A;  4URK A;  4KIK B;  4LNO A;  2WXN A;  4M02 A;  3ZW3 A;  4YT0 B;  4GXB A;  3NJT A;  1YQB A;  3RI7 C;  2GB1 A;  2JWZ A;  3PLV A;  4ZYS A;  4MM3 B;  5DPT A;  5IAA C;  4Q2J A;  1WGR A;  3ZTD A;  2MRP A;  3L0W B;  1Y8R C;  2AQ2 B;  2EEL A;  3VRA B;  2YLM A;  3AH7 A;  2NR2 A;  1V97 A;  1V9J A;  2LUE A;  3U4E G;  3PZD A;  3M95 A;  5GXG B;  4ZRJ A;  1F2R C;  3SFE B;  2FIF A;  3AEA B;  4HLE A;  2RR9 A;  1L7Y A;  1YQ3 B;  3MC8 A;  3Q8A A;  2FE8 A;  1JWM D;  3I63 C;  2BYE A;  2QSD A;  4IUM B;  2PEA A;  3PLU A;  4FN2 A;  3QC8 B;  3FIL A;  2PVG C;  3U52 E;  3M62 B;  2TSS A;  3P2B A;  3KUD B;  4A8X C;  1PYW D;  2Z0D B;  3ECI A;  4HXD A;  4MJS B;  3SU8 X;  1M94 A;  4IM2 A;  2LHE A;  3QCA A;  2HJ1 A;  3E9S A;  3VDZ A;  3ONS A;  2G9H D;  4M8M A;  4K7W A;  1P3Q U;  5D3D A;  4ANU A;  3Q8E A;  2BB6 A;  1V2Y A;  2J0M A;  1SJE D;  1N63 A;  3AXC A;  2WNM A;  1SEB D;  3AV8 A;  5DCN A;  3RZW C;  4MDK E;  2PE6 B;  3ZXR A;  1EO6 A;  1WJN A;  2GOW A;  2M17 A;  1FCL A;  3VR9 B;  5CTR C;  1I4R A;  4BAX A;  2LUM A;  4L23 A;  3MP9 A;  1MHX A;  1JWB D;  4XX5 A;  4RNA A;  3WCQ A;  4ANV A;  1WM3 A;  1ZDX A;  4B95 A;  1GG3 A;  1UZX B;  3MJ5 A;  3APF A;  4KZ0 A;  3SD5 A;  2W9N A;  3N1Z C;  5FR6 A;  1KRH A;  4CO7 A;  3DQV A;  4OZC A;  2N4F A;  1ACC A;  4PYZ A;  2ZPN A;  5IOI A;  2O2V B;  4IWO A;  1BUI C;  4A55 A;  1YNT E;  2EKI A;  1VCB A;  2ZCB A;  1N5W A;  4G11 A;  3DVN U;  1J19 A;  1TKY A;  2M0X A;  4GDK B;  5EDS A;  4EEW A;  1OTR B;  3KUZ A;  2Y5B B;  3E56 A;  2L7R A;  2WX1 A;  4BBN C;  2WX0 A;  4USA A;  2LGS A;  3PGE A;  4LJO B;  3KW5 B;  1BML C;  1B9R A;  3C8Y A;  1V1P A;  3MTN B;  2QMT A;  1L0Y B;  4C4V B;  2MCN B;  1LM8 B;  2G45 B;  2IZV B;  3N32 A;  4LNK A;  1F2R I;  1VR9 A;  1XLQ A;  5AUI A;  1FNW A;  2KXJ A;  2NBU A;  2I1K A;  3V6E B;  1YX6 B;  4KSK C;  5CHF A;  3P42 A;  3L54 A;  1SB3 C;  3QWZ B;  4FLH A;  3Q3O C;  2KC1 A;  1FRD A;  1WXM A;  1TY2 A;  2WXO A;  2JQR B;  2UU7 A;  3SEB A;  1D3Z A;  2CHZ A;  5D3I B;  5JXV A;  3JSV B;  1R4M I;  1GB1 A;  2IYD B;  1DOX A;  1ENF A;  1D5M C;  3U7D A;  3RPF C;  1UH6 A;  1AWD A;  1PGA A;  2KDE B;  1I35 A;  3P63 A;  4FUL A;  2NS5 A;  3RNE C;  1J7B A;  1FNV A;  1HQR D;  2V4I B;  1JW9 D;  1SE2 A;  3FKY A;  4W9D A;  2D3A A;  1TKE A;  3Q3M C;  4REZ A;  3R7Q A;  1E9M A;  2C7H A;  5LXH A;  1FO4 A;  3NG0 A;  3AE6 B;  2L1A A;  2O6V D;  5LNK 1;  3PO0 A;  4L2Y A;  4L1B A;  2N9K A;  2KFK B;  3ZO5 B;  2IBI B;  2BYT A;  1X1M A;  2V3S A;  1EUV B;  3L10 B;  2DZM A;  3GOE A;  3AE4 B;  3A33 B;  2N7E A;  4GGQ A;  2K9X A;  3AED B;  3TIX A;  1FCC C;  4F8C B;  3H7P A;  3OAW A;  4LLG M;  1EWY C;  1AYF A;  3OJ4 B;  2DYO A;  4KGS A;  4K1R B;  2WS3 B;  4UDU C;  4YTP B;  3W2D A;  4ICV A;  4AWJ A;  1V81 A;  4GDL B;  1WE7 A;  4W9F A;  4ASW C;  2O6V B;  3QK0 A;  2KZR A;  4XDC A;  4RF0 A;  3RNB C;  1KJT A;  2KDF B;  3CF6 E;  2OJR A;  3HUI A;  3N1Y C;  3X0W A;  5EE0 A;  1CZP A;  4RCO A;  3V05 A;  1R7S A;  3LDZ E;  1JRO A;  1Q10 A;  3IT6 B;  2R61 A;  2C7M B;  4HPL B;  1VZ7 A;  5G5G A;  1SXT A;  3EA6 A;  4TSS A;  3KLS X;  1LXD A;  2ASQ A;  3EFC A;  2QCZ A;  1Q0W B;  3VTU A;  1JWS D;  3EGR A;  2I1J A;  3AM9 A;  1ZPS A;  2DZJ A;  2GLS A;  2R2O A;  3ABV B;  3AEE B;  3Q3F A;  1WMH A;  1XLP A;  4F1S A;  2BS2 B;  4RMA A;  1L6U A;  2NTT A;  3FAH A;  3CWI A;  3EUB 2;  2W54 A;  3CIR B;  3ENE A;  4G3X B;  1PDX A;  2BYF A;  3W5U B;  3Q3J A;  1WX9 A;  3RYT A;  2MWS B;  1UUP A;  5D7G A;  4H2A A;  2LVQ A;  4MAC A;  3AEC B;  2WGS A;  2KMC A;  2QIL A;  1N61 A;  4NZL B;  4FXC A;  4P1B C;  4ARI A;  3H6N A;  3ALB A;  1EWC A;  4NAW A;  3C19 A;  5J2R A;  5EE1 A;  1TS2 A;  4GSW A;  1L2N A;  2Z0E B;  3VR8 B;  2BB5 A;  3DBR B;  1V1O A;  1YD8 U;  2YEP B;  3TMP B;  1UBQ A;  1L0V B;  4NQL B;  3P4S B;  1ZGU B;  2NBV B;  3MFG A;  1FRR A;  2VH2 A;  2LD9 A;  2K8C A;  2PIA A;  1NBF C;  3R2I A;  2GBN A;  3ZNI D;  1MG4 A;  2WXR A;  2YEP F;  2MH7 A;  1HTO A;  3ETR A;  4LNF A;  4ACF A;  4AJW A;  5HHD G;  3RNG C;  4IM0 A;  1CQV A;  4IDI A;  1QF6 A;  4ZHO A;  3DBS A;  3H9D A;  4HRS A;  3A9J A;  1QZE A;  2DAF A;  2PJH A;  5FKA C;  1TS5 A;  2MJE A;  5G2N A;  1J7A A;  2WDT B;  3LB8 C;  1JWA D;  2L05 A;  2QDF A;  4E3C A;  3EHV A;  1V80 A;  2N1W A;  2INP E;  2BYV E;  3HM3 A;  4P6V F;  4AOF A;  2NCN A;  2LVO A;  2NTS A;  2PMV A;  2EKE C;  3DDC B;  3JYU A;  2CS4 A;  3H8H A;  2WXG A;  2J0K A;  2ZCC A;  1KM7 A;  4MGY E;  2L52 A;  4WAA A;  1UGJ A;  1UWM A;  2LGD A;  3U8Z A;  2FCS A;  1WXS A;  1WJ4 A;  4C7Z A;  4OVU A;  4ZDV A;  5BYR A;  4ZRI A;  4JE3 B;  3A4S C;  4P1C C;  1RRB A;  1C77 A;  2KNB A;  3OG5 A;  2CHX A;  1P1A A;  4PS7 A;  1ET6 A;  2A4Z A;  3AE1 B;  1L5P A;  2WDV B;  1WGD A;  3AMZ A;  1S3S G;  4OVZ A;  3V3X A;  2DLB A;  2WXH A;  3PZ8 A;  3L17 A;  1UGM A;  3S2A A;  4WJO A;  4KV2 A;  4K7U A;  3NS8 A;  2WHI A;  1WJ6 A;  2OJW A;  4RGN A;  2PLP A;  4MGK E;  1WZ0 A;  1YMH E;  3DVG Y;  5TR5 A;  5BMG A;  1VJK A;  1NI3 A;  4C7Y A;  3T3O A;  1T0Q C;  3SR6 A;  2PPH A;  3R7R A;  2EMT A;  1KH0 A;  1YJ1 A;  1TS4 A;  1V8C A;  4LK0 M;  4S0R A;  5CHV C;  3FC4 A;  2XK5 A;  3ZGZ A;  3LYY A;  2R2Q A;  1MHH E;  2L76 A;  2B3A A;  1HTQ A;  3AEF B;  1E0Z A;  1K51 A;  2KVZ A;  3AEB B;  3EC8 A;  5C3J B;  4QAY A;  2INC C;  2LJI A;  4W9K A;  2KWC A;  2WDR B;  2MP2 A;  3U7Z A;  3VTV A;  5E6O A;  3AE7 B;  1MPE A;  2KHW B;  2L32 A;  1WGH A;  1UF0 A;  1T0Y A;  1N60 A;  2KN5 A;  2B76 B;  2DNF A;  2LXC A;  1D5Z C;  3DBR I;  5J17 A;  2CKH B;  1S1Q B;  2DWQ A;  2KO3 A;  4YXD B;  1IYF A;  4NNJ B;  1B1Z A;  4IG7 B;  1EF1 A;  2IGG A;  3AU4 A;  3RZF A;  3VH3 B;  2C60 A;  2PE9 A;  3DPD A;  2D07 B;  2NVU I;  4IWP A;  2DAJ A; 
#chains in the Genus database with same CATH homology
 4HRO A;  1QQR A;  2WDQ B;  1GB4 A;  2PKO A;  1YJI A;  1RYJ A;  1N5W A;  3L4P A;  1TKY A;  3TEX A;  1I7H A;  4GDK B;  1XCT L;  4NJC A;  1VDV A;  3E56 A;  1FNU A;  1TJE A;  1L6V A;  3TEW A;  4USA A;  4B0M A;  1E6E B;  3BK2 A;  3BK1 A;  3Q8B A;  4HKZ E;  3IAS 1;  3TUO A;  1BML C;  1B9R A;  4IOI E;  3C8Y A;  1V1P A;  3AE8 B;  4RF1 A;  2JX5 A;  1N62 A;  1GAQ B;  1FMA D;  1L0Y B;  1T5X D;  2QMT A;  2WXQ A;  4MT5 A;  2LHD A;  4YTM B;  2LEK A;  2IPK D;  4XWW A;  2MJ3 A;  1F2R I;  4YSX B;  2J42 A;  3NVY A;  3TEY A;  1QIL A;  1VR9 A;  1XLQ A;  2MEK A;  2MJD A;  1FIQ A;  1K50 A;  1FNW A;  1QOB A;  2N0S B;  2Q5W D;  3AE3 B;  2J53 A;  2LGI A;  4JWS C;  2M56 B;  1I4X A;  1YN5 A;  1C4A A;  2W55 A;  2RMM A;  4MH8 A;  1WWT A;  1AN8 A;  1EU3 A;  1KFY B;  1QOG A;  1GPX A;  2L83 A;  3P42 A;  4A90 A;  2BS4 B;  3BVG A;  1SB3 C;  1XF5 L;  1PUT A;  1D4B A;  1IBX B;  4JWU C;  1FRD A;  3I9V 1;  1TY2 A;  4RFB A;  1PGX A;  2JQR B;  2WXO A;  3SEB A;  4JPS A;  2KWD A;  2ZW1 A;  5JXV A;  5D3I B;  3ZQ4 A;  2WU5 B;  3P4R B;  1ROE A;  2E3T A;  4AQ7 A;  1GB1 A;  1CJE A;  1NVI D;  1DOX A;  1ENF A;  1D5M C;  5G5H A;  1I4G A;  4OZA A;  1IUE A;  1DYQ A;  1HEZ E;  1KLU D;  4TQ0 A;  3RPF C;  3DWM A;  3NS1 A;  4HJG E;  1HZ6 A;  1VZ6 A;  2SEB D;  4NAM A;  2J4X A;  3RFZ B;  3URY A;  1AWD A;  1PGA A;  1T6B X;  2ACZ B;  2WU2 B;  4YSZ B;  3P63 A;  2J52 A;  2K0P A;  1J7B A;  3KQ4 A;  4ZHP A;  1FNV A;  1DGJ A;  1HQR D;  1WYG A;  2FUG 1;  2V4I B;  1JW9 D;  1SE2 A;  4ZRQ A;  2HDE A;  3AE5 B;  2QEJ C;  2AQ3 B;  5H92 C;  4O1N A;  1TKE A;  2KN4 A;  4REZ A;  1IGC A;  1E9M A;  1K53 A;  1TYG B;  5TSS A;  4US8 A;  4IKG A;  2V3N A;  1FO4 A;  1IBX A;  3AE6 B;  2L1A A;  2QJL A;  3BVZ A;  5LNK 1;  3DWG C;  3PO0 A;  4L2Y A;  4L1B A;  4ZOH C;  3AEG B;  2N9K A;  1Y56 A;  1QKZ A;  4WAF A;  2BYT A;  4KX6 B;  1C4P A;  3ZJT A;  3BWU D;  4AS1 A;  4RGM A;  3AE4 B;  2Y5P A;  1A70 A;  1RM6 C;  2K9X A;  3AED B;  2WXJ A;  2BTE A;  2CJN A;  1C78 A;  1FCC C;  1ZP0 B;  4C56 C;  2WXI A;  4LLG M;  1EWY C;  2KMM A;  4DQO C;  1AYF A;  2SAK A;  3HVD A;  4TMA B;  2DYO A;  3BII D;  4KGS A;  1BXT A;  2WS3 B;  3AB5 A;  4UDU C;  1KTK A;  4KKI A;  4LTU A;  2WP9 B;  4YTP B;  3W2D A;  5MPO A;  1C9F A;  1L0X B;  2LFI A;  4GDL B;  4XE0 A;  1JWU D;  3P4Q B;  1IGD A;  2CJO A;  4N58 A;  1OFF A;  4XDC A;  4RF0 A;  1ZE3 D;  1OQQ A;  3B9J A;  3R2T A;  3OWE B;  5HFY A;  2E6X A;  1C4C A;  3ZJU A;  1I4Q A;  3HUI A;  3T3N A;  1FFV A;  5BMI A;  5EE0 A;  1CZP A;  1PFD A;  3AE2 B;  4RCO A;  2WXP A;  1R7S A;  1UNS A;  3V05 A;  1JRO A;  5EE9 A;  3SFD B;  1Q10 A;  2ZW0 A;  4D2K A;  3IT6 B;  3GP7 A;  1DOY A;  2R61 A;  1XLN A;  1VZ7 A;  5G5G A;  4NAW B;  1SXT A;  3EA6 A;  4TSS A;  3VRB B;  2N9L A;  1FXA A;  3KLS X;  1SIJ A;  1JWS D;  2W3R A;  3EGR A;  1L4Z B;  3AM9 A;  1ZPS A;  4JX1 C;  3ZYY X;  1JML A;  5FR3 A;  1ESF A;  3ABV B;  4YWG G;  1FD6 A;  3AEE B;  1JQ4 A;  1MI0 A;  4WUR A;  4US9 A;  1XLP A;  3NZ3 A;  2M19 A;  2BS2 B;  3IAM 1;  3O13 A;  3P1M A;  2K22 A;  4M0W A;  1SJH D;  1I4P A;  4J3O D;  1L6U A;  2NTT A;  3FAH A;  3CWI A;  2KAC A;  3EUB 2;  2W54 A;  3CIR B;  5AUK A;  2GI9 A;  1WXQ A;  4TQ1 A;  1PDX A;  1NYQ A;  2OHF A;  5BMH A;  3IXS A;  3W5U B;  1YN4 A;  4N59 A;  2JU6 X;  4RGT A;  2QIE B;  1UUP A;  5D7G A;  4H2A A;  1ZUD 2;  4MAC A;  2AX5 A;  3AEC B;  2QIL A;  4DXG A;  2RDG A;  1N61 A;  4NZL B;  1HXY D;  3BYY B;  4FXC A;  4ARI A;  1RWS A;  5BYQ A;  1EWC A;  2WXL A;  4ARC A;  5EE1 A;  1TS2 A;  1TKG A;  3VQI A;  3VR8 B;  2BB5 A;  4GLS C;  1HA5 A;  2CU3 A;  3U2S C;  1TY0 A;  1AW7 A;  3GS2 A;  1V1O A;  1I4H A;  1FEH A;  4HEA 1;  3Q69 A;  1WGK A;  2IGH A;  2YEP B;  2FBW B;  2JYE A;  3NVV A;  1C79 A;  1L0V B;  1EM7 A;  1ZDV A;  3GB1 A;  3P4S B;  1HZ5 A;  3PZ7 A;  3MFG A;  1FRR A;  1OQR A;  2WXM A;  3J9C A;  3NVW A;  2PIA A;  3R2I A;  1RFK A;  1FXI A;  2ONQ A;  4A9A A;  2HTM E;  2WXR A;  4HKQ A;  3W5V B;  1TZO A;  2YEP F;  3HVZ A;  2MH7 A;  2VZK D;  3ETR A;  4ZRP A;  1MVK A;  1K52 A;  5HHD G;  4R3D A;  4OZB A;  5T8I A;  1P7E A;  2WXK A;  1CQV A;  3KWV A;  1GOZ A;  4IDI A;  1QF6 A;  2PVO D;  4ZHO A;  1D5X C;  4HRS A;  5FKA C;  5HI1 A;  1SE4 A;  1TS5 A;  2MJE A;  1J7A A;  1XO3 A;  3LB8 C;  1JWA D;  3KWL A;  3MHZ A;  3N9Y C;  3BVM A;  4ITK A;  5I4D A;  2INP E;  2KQ4 X;  2ON8 A;  4KGR A;  5EE3 A;  1NEK B;  2H89 B;  4P6V F;  4WIP A;  2N7J A;  1SE3 A;  1SSN A;  4WH4 A;  2NTS A;  4XWT A;  2PMV A;  1FFU A;  2VZK B;  4P16 A;  1STE A;  3H8H A;  2WXG A;  5E6J A;  3B2F A;  1F77 A;  5FK9 C;  2KDM A;  1QLB B;  1EU4 A;  3W9C B;  3ZJV A;  2L52 A;  1XXG A;  2INN E;  2IDY A;  2DYM A;  3B2G A;  4RH6 A;  1UGJ A;  2OED A;  1J7C A;  2RDH A;  3AN1 A;  1UWM A;  2LMC A;  1VLB A;  2JSV X;  3Q8F A;  1VZ8 A;  2D5G A;  4YSY B;  1P7F A;  2XNA C;  2Z8L A;  4C7Z A;  1XEE A;  4CQN A;  2JWU A;  3UI3 A;  1DOI A;  3FIL B;  4WWM A;  5BYR A;  1ZOY B;  1E7P B;  2WXN A;  3I57 A;  3AE9 B;  2JZP A;  4YT0 B;  4B0E A;  1VRA B;  4JE3 B;  2GB1 A;  2W3S A;  4ZYS A;  1F0Z A;  1C77 A;  2W82 A;  4MM3 B;  1YQ4 B;  4WQM A;  3MC0 B;  4Q2J A;  1ET6 A;  4C80 A;  2K3U A;  2AQ2 B;  3AE1 B;  2EEL A;  3VRA B;  3AH7 A;  1L5P A;  1PGB A;  2WDV B;  4OW0 A;  3AMZ A;  4OVZ A;  3V3X A;  1V97 A;  1ZXH A;  1QOA A;  2KAJ A;  2DLB A;  3U4E G;  2WXH A;  3PZ8 A;  2V0G A;  5GXG B;  4KKJ A;  4OHJ A;  3W1S A;  1F2R C;  3SFE B;  3AEA B;  5C2T B;  2WXF A;  1M4V A;  1LO5 D;  1NEN B;  2RPV A;  3IT4 B;  1YQ3 B;  3Q8A A;  2FE8 A;  1JWM D;  4RGN A;  2PLP A;  2QSD A;  1JCK B;  3FIL A;  2PVG C;  1YMH E;  2G1E A;  1XCQ L;  3U52 E;  1WRI A;  2ICI A;  2TSS A;  3Q8C A;  4A8X C;  2BS3 B;  1PYW D;  3NRZ A;  5H8Y E;  5BMG A;  4EE2 A;  2I38 A;  1VJK A;  1C76 A;  1NI3 A;  3BYT B;  4C7Y A;  3T3O A;  1E10 A;  3SR6 A;  2LHE A;  1L4D B;  1TS3 A;  3E9S A;  2G9H D;  3HRD D;  2DBY A;  5D3D A;  4KGT A;  5HG2 A;  1ZXI A;  2H88 B;  1KH0 A;  3Q8E A;  2BB6 A;  2GRI A;  1TS4 A;  3BZD B;  3NUH B;  2AQ1 B;  3R8B A;  1V8C A;  4LK0 M;  1SJE D;  1N63 A;  3P4P B;  4PT5 A;  2WNM A;  3FC4 A;  1SEB D;  1T3Q A;  3AV8 A;  3ZGZ A;  2BW2 A;  2BT6 A;  3LYY A;  1UWX A;  1MHH E;  4A6Q A;  3TSS A;  1QOF A;  1SBB B;  2PW9 A;  3AEF B;  1E0Z A;  1JAL A;  4RGO S;  4N6E B;  2IJ0 A;  4XDD A;  1WSP A;  2V3P A;  1K51 A;  3AEB B;  1FCL A;  1N5X A;  3VR9 B;  5C3J B;  2JXT A;  1I4R A;  2LJI A;  2Y3A A;  2LUM A;  1QT9 A;  2WDR B;  3NVZ A;  4L23 A;  3MP9 A;  2Y5C A;  1MHX A;  3U7Z A;  1JWB D;  1XLO A;  2NMQ A;  4RNA A;  3WCQ A;  1ZDX A;  1FM0 D;  1D6E C;  3AE7 B;  1MPE A;  2L32 A;  1SF0 A;  1YJJ A;  3MJ5 A;  1N60 A;  1YN3 A;  1KLG D;  1V1P B;  2WLB A;  1ET9 A;  1JRP A;  2B76 B;  2IGD A;  5BYS A;  1D5Z C;  2WQY B;  1KF6 B;  1KRH A;  3TEZ A;  2I2Y A;  4OZC A;  1CK1 A;  1ACC A;  2DWQ A;  2X38 A;  4YXD B;  1BUI C;  4A55 A;  1YNT E;  2JYT A;  2BBC A;  2PTL A;  2K5P A;  4DXF A;  2M0A A;  2XN9 C;  2EKI A;  1B1Z A;  2IGG A;  1NYR A;  5AUI A;  3LXF A;  4YTN B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...