2N9LA

1h, 13c, and 15n chemical shift assignments for in-cell gb1
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
57
structure length
57
Chain Sequence
b'MGTYKLILNGKTLKGETTTEAVDAATAEKVFKQYANDNGVDGEWTYDDATKTFTVTE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Immunoglobulin G-binding protein G
publication title Improved in-cell structure determination of proteins at near-physiological concentration
pubmed doi rcsb
source organism Streptococcus sp. 'group g'
molecule tags Immune system
total genus 14
structure length 57
sequence length 57
ec nomenclature
pdb deposition date 2015-11-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01378 IgG_binding_B B domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.10 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 2n9lA00
2J53A 2EELA 4IOIE 2J52A 3V3XA 2NMQA 1F2RI 2KDMA 1EM7A 1GB4A 4KGTA 2LGIA 1PGBA 2JSVX 1YNTE 2N9KA 2I2YA 2ON8A 4D2KA 5HHDG 1YMHE 2GI9A 1UWXA 1XCQL 2ZW1A 5HFYA 4HJGE 1FCCC 1K53A 2QMTA 1IBXA 2I38A 5JXVA 5BMIA 2KACA 2JXTA 1XF5L 4KGRA 2ZW0A 2PLPA 1PGAA 3MP9A 2K0PA 1K52A 2N7JA 3GB1A 4OZAA 2JU6X 2KQ4X 1XCTL 3FILB 1F2RC 1GB1A 1C9FA 1FCLA 2JZPA 1D4BA 1PGXA 1MI0A 2JWUA 4OZCA 4WH4A 1HZ6A 2OEDA 2N9LA 1QKZA 2QSDA 4KGSA 5BMHA 2PW9A 1HEZE 2RPVA 1FD6A 1P7EA 1K51A 1MHXA 2IGDA 2LHDA 3UI3A 1MHHE 5HG2A 1P7FA 2LHEA 2PTLA 1MPEA 1KH0A 2LUMA 1Q10A 2GB1A 2KN4A 1JMLA 4HKZE 1ZXHA 5HI1A 4OZBA 4MACA 2KWDA 4IKGA 1K50A 1IGDA 2ONQA 2RMMA 1HZ5A 5BMGA 1MVKA 3FILA 2IGGA 1IBXB 2IGHA 4GLSC 1IGCA
chains in the Genus database with same CATH superfamily
3EECA 4RF1A 2J53A 2YEPB 2L05A 4FN2A 4H2AA 1F2RI 2IO1B 1FXTB 2KC2A 1VRAB 3MC9A 4NY0A 4DHJB 4GN1A 2LFIA 5E6NA 2ZEQA 2LRUA 1EO6A 1TY2A 1XCQL 4WWPA 4A9AA 4DDGD 2PE9A 4FHKA 1FM0D 2K8HA 4NAWA 1TS2A 3M62B 4F1SA 2M19A 2NS5A 5D7GA 2V3NA 1XF5L 1Q0WB 2WHIA 3L10B 3P42A 1WM2A 2N1VA 2V1YA 4LJOB 1WX9A 2OJWA 1T0YA 4B6WA 3CSFA 1F0ZA 4PS7A 2ZJDA 1C4AA 1J7AA 1XD3B 4ASWC 2Y5CA 1K52A 2I1JA 1WXQA 4FBJB 2LD9A 5AEKB 1HA5A 1KM7A 1JCKB 4TQ0A 2K39A 1OQQA 1JQ4A 1C4CA 4F8CB 3GZNI 4X57B 4N58A 4K81A 2OEDA 2R2QA 4FULA 2ACZB 1JW9D 5EE0A 1TJEA 1VCBA 3N1ZC 3PTFC 2LVQA 1YD8U 2KHWB 2NVUI 5E6PA 2WWZA 2L76A 2RSUA 3VTUA 3MHZA 2LHEA 1YN5A 3URYA 2LUMA 3IVFA 4FHJA 2BB5A 4MJSB 3IFWB 4DHZB 4A55A 4WWMA 1T0RC 3B1LX 4Q2JA 3ZJUA 1WYWB 1FRRA 3ZTCA 4MDKE 2JF5A 3IT6B 2RR9A 1OEYJ 1R7SA 2K6DB 4YTPB 1ET6A 3JYUA 5IN7A 3NS8A 1H4RA 3ZVVA 1SJED 1L5PA 2WNMA 4YSXB 4YXDB 1WWTA 1ESFA 1EM7A 3MC8A 2N9PC 1V80A 3AEGB 1ENFA 1JWAD 3X0WA 1TS4A 1YNTE 2MA9B 4GMVA 1FMAD 1CQVA 3NS1A 4IW0A 3MJ5A 1F52A 1IBXA 4O1NA 3APFA 3R2IA 4S17A 4G0NB 2XEWA 2FCMA 2ZCCA 1WFYA 5IP4D 2Z8LA 1PGAA 3GE8C 2W54A 4QAYA 2KTRA 1C78A 1QOGA 2O6VD 5TR5A 2D07B 1FCLA 3VQIA 2W55A 1YJJA 1SEBD 4IM3A 2YLMA 1R4NB 1HZ6A 4GDLB 1VJKA 1J8CA 5GMVA 1HEZE 1ZGUB 1E8XA 5HKHA 1XT9B 2QC8A 5IKCM 1GJZA 3OLMD 4K3CA 4DHZE 1EF5A 5JZEB 1FNVA 5AZFA 4LCDE 3CF6E 4NJ7A 2IYDB 3U8ZA 1TKGA 1ZXHA 3BK1A 2BWES 4NQKE 1BT0A 5FKAC 2M0XA 2LI5A 4MH0E 1ACCA 4A90A 1K50A 4YL8A 3ZDMC 5G55A 3A1QB 2K8BA 2N1WA 1UNSA 2NCNA 4CO7A 1SJHD 1E6EB 1I7HA 4HCNB 1UGMA 2IGHA 4BFRA 2GBJA 2NTSA 1BXTA 2BGFA 4BKSD 4ANUA 3WALA 4A3OA 1PGBA 2LEKA 1RFKA 3RZWC 3WCQA 3QCAA 5KHOA 3Q8CA 2AQ1B 2O6VB 4C80A 3M3JA 3B2GA 3RI7C 3R3MA 3LDZE 1N61A 1L0XB 2MWSB 2BTEA 5JXVA 1WH3A 1N5WA 2XNAC 3E9SA 3I63C 4LDTD 4FJVB 1FO4A 3VUYA 1V6EA 3DVNU 4YTNB 2K0PA 3BY4B 4W9LA 2VH1A 3ENEA 3QX1A 3RN9C 3H7SA 3V62A 5DPRA 2R61A 3LB8C 4K7UA 1Y8RC 1M94A 4P7IA 4DWFA 4E74A 3AEFB 1F2RC 2YEPF 3MFGA 4FADA 2LMCA 3EUB2 3PRPB 4KZ0A 1MFWA 4IDIA 2BW2A 2JT4B 2L32A 4FXCA 3ZUNA 3NVWA 3TMPB 2WYQA 1ISNA 1PFDA 3HVZA 1MHXA 1GAQB 1SE3A 1HQRD 3MJWA 1MHHE 4USAA 1MPEA 2V3SA 3EFCA 1GC6A 1VZ6A 2JZZA 2ZNVB 1FPYA 3AV8A 3PZDA 1L0VB 3GOEA 2WXMA 3UINB 5C2TB 2RDGA 2KVZA 1JWUD 4I6NB 5IO9A 4HEA1 2PJHA 1SBBB 3JSVB 1C4PA 1N6ZA 4L23A 1TS5A 2E3TA 3R8BA 2INPE 1C3TA 3QQ8B 1Z2MA 1D3ZA 2MJDA 2LJIA 2IDYA 4LDTB 1TIFA 2ASQA 2LGIA 2DHZA 4CQNA 2MHJA 4C00A 1D5ZC 3JVZX 4BBNF 4HDOA 3TCAA 2GI9A 4ANVA 1R4NI 2WX1A 4URKA 5HFYA 1I4RA 2KDEB 2H88B 1ET9A 3AE4B 3AU5A 4ZYNA 1FXAA 4KIKB 3KUZA 3U30A 1I42A 4HROA 3SD5A 2IBIB 4GSWA 1WGDA 1ZDVA 4LNOA 3TEXA 2JPHA 3C0RB 2N7JA 1YOVB 2CJOA 1AN8A 2KWUB 2MLBA 3SU8X 2Z59B 4NPNA 3I9V1 2DNFA 1WRDB 3BZDB 5DPSA 1MJDA 3U7ZA 2JWUA 3TEZA 2JRIB 3I5JC 3CMMB 3DWGC 3QWZB 4IWPA 3SFDB 3V61A 4XZ4A 4A3PA 5BMHA 3H7PA 3AB5A 2L8JA 3FC4A 2BYFA 2MJ3A 5KHQA 1LXDA 1JWBD 2KFKA 3PZ8A 2PPHA 2KDFB 1FFUA 1D5MC 4IWQA 2DZIA 4REZA 1QZEA 2FUG1 4TUUA 2MBEA 2KKCA 5CHVC 2ZPNA 3V05A 1KLUD 2CHWA 4IWOA 1V5OA 5H8YE 4NAWB 1WGKA 2WXFA 1V49A 2BBCA 1WZ3A 4YSZB 2JYEA 1JWSD 5G5GA 3TJPA 3BWUD 2CHZA 1EWYC 2WU5B 1PYWD 4M8NA 2GOWA 4MGYE 2JVCA 3BINA 2KWCA 4I6PA 4EZJA 2JUOA 1TZ1A 1YJIA 4OVUA 4RH6A 1SSNA 2K9XA 4HJGE 4ZRJA 4XGAB 4LNNA 2KLGA 4BZAA 3IT4B 3VUXA 1I4HA 3R66C 4M0WB 3PT2B 5EE9A 3HIZA 2CU1A 2QIEB 3UQAA 5L95C 2WXPA 2N0SB 1CJEA 1YQ4B 2C7HA 4RFBA 2K6QA 1K8RB 2KQ4X 1YX5B 2JYTA 3ZJTA 1D4BA 3N3KB 4P1BC 2QSDA 4KGSA 3VRBB 2RPVA 2WXRA 1FNUA 4LNIA 3AH7A 4B0EA 4KZCA 3IBEA 4RGNA 3ALBA 3VDZA 2Y5PA 1WGYA 4MGKE 2N9EB 5HI1A 4WWOA 3L16A 5D94A 4HVBA 1I4PA 2XK5A 3JW0X 2UWQA 4IKGA 1Y56A 2CS4A 4B0MA 3Q8AA 2HTME 2LGXA 3R2TA 2KQSA 3DVGX 1D5XC 2FCNA 1YQ3B 3ZRCA 3BK2A 1NENB 1XLPA 3P1MA 1V1OA 1V8CA 1GUAB 2PMVA 4K1RB 1IBXB 3BIID 1HE8A 4W9KA 5C23A 4WURA 1UELA 2G1EA 1IPGA 3RCZA 4JGHB 2IO0B 3V3XA 2KOXA 1GB4A 1QT9A 2JSVX 2D3GA 2DYOA 3Q3JA 1WXAA 1VLBA 2KFJA 3ZNZB 2KTRB 1I4XA 2ON8A 4OVZA 1NI2A 4EKUA 2SEBD 2M1MA 1FCCC 4JL9A 2KWVB 5C1ZA 1ZE3D 2I38A 1SE4A 2LVOA 1FEHA 4P6VF 1F1HA 4DXAB 1WJNA 5LXIB 3VH4B 2BKFA 1WM3A 3J9CA 2KJRA 3Q6BA 3MP9A 1TYGB 2BKRB 4RCOA 5D3IB 2IO3B 4OHJA 4DXGA 3AXCA 3VFKA 2JU6X 2O2VA 4BOZB 2L83A 1GB1A 2LGSA 2LJ5A 2G9HD 4LTUA 4WH4A 3P63A 1GPXA 1YN4A 4EE2A 3L08A 1E7PB 2BS3B 3AMZA 2JX5A 1WX7A 2RGFA 2MBHA 1FD6A 1ROEA 1VZ8A 2KXJA 3DHHC 3LJ3A 5HG2A 4GIVA 2L0TA 4A20A 2GB1A 3ZRFA 3Q3NC 2D3AA 3BYYB 2EMTA 2C60A 3AE8B 3N30A 4M0WA 3A33B 1NDDA 2WDVB 3RPFC 1QOAA 4ZRPA 3P4PB 3L0WB 4W9CA 4N6EB 2WLBA 2WQYB 4ICUA 1IGCA 2RPQA 1UUPA 1WR6E 5BYSA 3H9DA 1WE6A 3AN1A 4BOSC 2NMQA 3DHIC 1E10A 2G4DB 2BWFA 1I4QA 3Q8EA 2WDRB 4AS1A 3QK0A 2WXGA 2EKIA 2QCZA 4G11A 5FK9C 2LASA 4LLGM 3ZQ4A 3VR8B 4NJCA 2D3CA 3AE1B 1DOIA 2GRIA 1QOFA 2EKEC 3N1YC 5AZHA 2V0GA 2C7NB 3AE3B 2G3QB 4OZAA 4TSSA 2KX3A 3FILB 1TS3A 1YIWA 1C9FA 1PGXA 4ZDVA 4OZCA 3SDLC 2DZKA 3H6NA 1UF0A 2K22A 2BF8B 2KAJA 4HPPA 2PEAA 2E6XA 4M02A 1VD2A 4M01A 4LJPB 3VRAB 3DHGC 5LNK1 4FJYA 4AP4C 4R3DA 4F7ZA 2MEKA 4HKZE 3DPDA 4J3OD 3TSSA 2ZVNA 4AQ7A 3RNGC 3SHQA 4DQOC 1A5RA 2ZNVC 1EU4A 4WQOB 3SFEB 2KO3A 1WIAA 5CX3A 3UGBB 2FBWB 2B3AA 1IGDA 4XWTA 1JRPA 2GMIC 2ICIA 2V3PA 2IGGA 3Q3MC 3ZKJC 2MP2B 1Z5SB 1TBEA 5D6JB 3OG5A 2KN5A 2FCSA 2CHXA 2AEHA 3P4QB 2MH7A 4NQLB 5LLIA 4BVUC 4AWJA 4RMAA 3A9KA 3KLSX 3KYDD 3Q8FA 1C77A 2J0MA 1IP9A 1ZKHA 2L7RA 1GC7A 3V6EB 1EF1A 1E8WA 1OQRA 2MSED 5DPTA 3H7PB 2BYVE 1GNUA 2N7EA 3W1SA 1TKYA 2M17A 2UYZB 3B0AA 2MBOA 3EC8A 3AEBB 2K25A 2KFKB 3VAWA 3ECIA 1JROA 5JHBA 1L6UA 2KLCA 1QOBA 2WXIA 1AYFA 1XLNA 1DGJA 1DOXA 3DWMA 4MELA 2JXXA 3BYTB 1L0YB 2A5UA 3KQ4A 3AE5B 2KZRA 1T5XD 1SF0A 3NUHB 3P4RB 3HVDA 4E3CA 1K51A 1UGJA 2AL3A 3IAM1 2AQ2B 5LXHA 5EE1A 3VVWB 1ZP0B 1P7FA 4XX5A 1L2NA 4KSKC 2ZPYA 3ONSA 1L7YA 3N32A 3AULA 4UDUC 1R4MB 3T9LA 4ITKA 2BQQA 2M8SA 1IUEA 2KANA 3M95A 3AECB 1NVID 3DBHB 2HDEA 3HHMA 3S2AA 1TKEA 4N59A 2D10A 4ANWA 3ZNHB 4TV3A 2Y5BB 1WGRA 4E71A 4HK2A 1MVKA 5FR6A 3FILA 3SEBA 4XC2A 2DYBA 4LK0M 3QIJA 2LWPA 4GLSC 5AZGA 4RNAA 2KD0A 3RNEC 3UQBA 2G45B 1M4VA 2Q5WD 5MPOA 4W9IA 2LZ6A 1STEA 4NNJB 2BT6A 2ZZPB 4G50A 1AWDA 3DBSA 4P16A 1L4ZB 5FR3A 3VUWA 4HKQA 3CWIA 2D2QA 2PIAA 1XLQA 2BVCA 2KJ6A 3ETRA 4HXDA 4GDKA 1VR9A 4YTMB 2KMCA 4ZOHC 3VR9B 4IM2A 3PVLA 4IM0A 3DBLB 2FCQA 1N5XA 1E8ZA 3ZYYX 1OGWA 4IUMB 1Q5WB 5E6JA 2MP2A 2L3ZA 3PHXB 2AX5A 2XK5B 2PKOA 1S3SG 2KJHB 3RNFC 2TSSA 2PE6B 1SIFA 1QF6A 3KUDB 1BMLC 1T0QC 4BKGA 2WDQB 2LXCA 2OHFA 5CHFA 2AYOB 2BS4B 1XXGA 3H8HA 2D11A 2KWDA 3DVNV 2WXJA 1HTQA 2D5GA 2X8XX 3L54A 4KVGB 3HK0A 2KMMA 2KVRA 1V1PB 4ZRKA 3QA8A 2NBVB 3TL5A 2RMMA 4YT0B 2WS3B 3T8MA 2MBQA 2JRHA 2CJNA 1DYQA 1ZPSA 1UD7A 1G6JA 3W5VB 3DOWA 3ZW3A 3RZFA 4IOIE 2C5LC 2J7QB 2OOBB 4LNKA 2M4NA 4EOYA 3FKYA 1AW7A 4RGOS 3AEEB 2WXQA 3I3TB 3N20C 2O2VB 4XDCA 2W82A 3PHWB 5DCNA 3CSTA 1P3QU 3HM6X 2QDFA 1K53A 2RDHA 3ML8A 4A6QA 3Q69A 2HJ1A 4MGZE 3V6CB 1NYQA 3DDCB 2M0AA 4XYCA 3U2SC 2IY1B 1WJ4A 2V9HA 3VH3B 1JALA 3Q3FA 3UIOB 1RLFA 4B95A 1OFFA 1XCTL 4II2B 4WWNA 4MEMA 1E8YA 4C56C 2ZVOA 2HJ8A 1E90A 4KKIA 3RYTA 4PK1A 4WAFA 2L0FA 3I57A 2OJRA 3DBHI 1WZ0A 4ZHOA 4JX1C 1P9DU 3HM3A 4ZRIA 1PQSA 1FRDA 2IGDA 2WXLA 3PREA 2KK8A 2PTLA 3AEAB 3E56A 3KW5B 5IOIA 3A4SC 1Q1OA 3UIPB 3ZJVA 2J0KA 2IO2B 3EA6A 2VZKD 4EFOA 2MJEA 5DPWA 2Y3AA 3AI5A 3A9JB 3AM9A 5E6OA 2C9WB 4A8XC 3RMKC 1V5TA 1EUVB 4II3B 3WANA 3GE3C 4FJZA 4GB9A 1X1MA 1WY8A 3PO0A 4JWUC 2WXKA 2HTHA 3EHVA 3GS2A 2KDMA 2HD5B 1SXTA 2N9KA 1WGHA 1WXVA 3U4EG 3QC8B 3N1XC 4RM9A 3T3OA 3PSEB 2WXOA 2N9XA 4ZYSA 3Q3OC 2KACA 2JXTA 2JZ3B 4ZRQA 2RDBC 4N9F4 3DBRB 3W1YA 1MG4A 2MCNB 1KJTA 5J18A 1WRIA 2L1AA 2QJLA 1V1PA 2LRWA 4HPMB 3QHTA 3WAOA 2GLSA 3D32A 3H1UA 3NZSA 1TZOA 1LGRA 2VZKB 1FNWA 1QKZA 3OWEB 3ZDTA 1N63A 2UU7A 3HRDD 3B9JA 2MRPA 4AJWA 4MM3A 1RWSA 1WMHA 3PZ7A 1U4AA 3KYCD 4K7SA 5BO4B 4DK5A 2QILA 3MC0B 4W9GA 5J2RA 1L6VA 1T0SC 4MACA 4M00A 4AJYB 3VXWA 4G3XB 4JPSA 2KDBA 2K1FA 1C1YB 3A9KB 1D6EC 4FLHA 2FIDA 3PGEA 4KDLB 3WIMA 2Z0EB 2G4SA 4WJQA 1HZ5A 1RM6C 1F77A 3R7RA 5G5HA 2KQ7A 2KTFA 3APDA 3RULA 5D3DA 3KWLA 1NEKB 2ZCBA 2J52A 3Q2AC 4NZLB 2MX2A 1TTNA 3PLUA 4PYZA 4WJPA 3O65B 2NTTA 1TT5B 2JQRB 3RNCC 2KDIA 4K7WA 1ZUD2 1I4GA 4L2YA 1T3QA 3Q8BA 4ARCA 2QMTA 1E9MA 2XN9C 5BMIA 4KGRA 4US9A 3C8YA 2YVCA 1V9JA 2PLPA 2WGSA 2MBBB 3NZ3A 2NPTA 2DZJA 3A9JA 3AE9B 4W9EA 3OAWA 3AEDB 5C3JB 1E0ZA 1C76A 3HUIA 4W9DA 1AARA 4MSMB 3PRZA 3WA0A 2PW9A 5I4DA 4EZKA 3GP7A 2JWZA 3WAPA 1KOTA 2IJ0A 4RGTA 4FA6A 3KVFB 3VTWA 2V4LA 3L13A 4RM8A 1CK1A 2L52A 1B9RA 1GG3A 3IXSA 1ZXIA 2CU3A 2DENB 1KH0A 2LGDA 4OZBA 2KYWA 2INNE 3ZXVA 4TKNA 4JE3B 1VZ7A 2DYMA 1IYFA 4HRSA 1P98A 1WJ6A 3ZXRA 1WI0A 1LM8B 1KFYB 3K9PB 4C4VA 1RRBA 3AU4A 3NJTA 3DBRI 4XE0A 2BS2B 1FIQA 2N4FA 2BB6A 2Z0DB 4GDKB 2CR5A 4GOCA 2XBBC 3PRMB 2DBYA 3KWVA 4RF0A 4WJNA 5EDSA 4GGQA 1WYGA 4D2KA 3O13A 4JWSC 4PYUA 4ACFA 4XWWA 4ICVA 2INCC 3U7DA 5AUIA 1S1QB 1QLBB 1KRHA 1VDVA 4B9KA 2FE8A 5TSSA 1WXMA 2K8CA 1WX8A 2J42A 4MH8A 1J7CA 1RAXA 2DLBA 5D2MB 1YX6B 3W9CB 5CTRC 3FAHA 4NAMA 3NVZA 4KDIC 4IG7B 2BPSA 4OVVA 2GBRA 2FUHB 1KTKA 1E7VA 2N9LA 1P0RA 2QHOA 4W9FA 2W9NA 3TIXA 2REXA 5JHAA 1CMXB 4HPLB 5H92C 3RT3B 3RNAC 1BUIC 3B08A 2LHDA 3VHTC 5GXGB 2LGYA 1JMLA 1H8CA 2AWTA 1SGHA 4L1BA 5L83A 4EEWA 1MG8A 2WU2B 2D3BA 2QEJC 2IZVB 2HE7A 2KT7A 1OTRB 1EWCA 3L4PA 3IAS1 1YQBA 3MHSD 1XLOA 3ZGZA 5EE3A 1WR1A 5BYQA 3C19A 3EFUA 1CZPA 4W9HA 3V60A 1WE7A 2ONQA 4ANXA 3PLVA 1KLGD 3EGRA 2DX5B 2NR2A 4MJSA 1YJ1A 3UF8A 1N62A 5BYRA 1WF9A 4YWGG 2A4ZA 4KGTA 4KX6B 3WAMA 5G2NA 3ZO5B 3PV1A 4EZLA 4US8A 2W3SA 3NVYA 1UWXA 1ZW7A 1SE9A 3DCGA 2I1KA 1UBIA 1DOYA 1E5WA 2FIFA 4WIPA 2LXAA 1HTOA 3LYYA 2ZW0A 4NJ6A 2JY6A 2GBNA 5T8IA 4PT5A 3OJ3A 1PDXA 2C7MB 4OW0A 1LFDA 3AE2B 2J0JA 4HDQA 1WGGA 3ZLZA 4HJKA 1HXYD 3RFZB 4GXBA 3B2FA 3CIRB 3NOBA 4W9JA 1XEEA 3ML9A 2W3RA 1SIJA 2L00B 1P7EA 2VRRB 3U52E 3LXFA 3AE7B 2EMSA 3NG0A 2KN4A 1B1ZA 1NYRA 4DDID 4M8MA 4HWIB 3T3NA 4DBGA 4PS3A 2NBUA 1WXSA 4GDLA 1QQRA 1WSPA 4EUTA 5IA7A 3NHEB 3M63B 3SR6A 3W5UB 3QAQA 3VTVA 1UZXB 3P2BA 1F9JA 3ZNGC 2SAKA 4CHKA 1T6BX 5BMGA 1OQYA 3RNBC 4LNFA 4WQMA 1TGZB 1ZOYB 3Q14C 1FXIA 4HCPB 1E7UA 4I6LB 3A1QA 2I2YA 1WJUA 2GBKA 1XQQA 1YMHE 3IHPC 5IAAC 2ZW1A 4XDDA 3APCA 1LQBA 1EU3A 3BVMA 4JQWC 2IY0B 2R2OA 2DZMA 2MW5A 4MM3B 1UWMA 1WMHB 1TY0A 1KLVA 4BKTA 5CHWA 1RYJA 2O6VA 4KSLC 1SE2A 3ZTDA 1A70A 3TEWA 1MI0A 5AUKA 4ZHPA 4C7ZA 5JH5C 1NI3A 4AOFA 2RD0A 1UBQA 2WDTB 2IPKD 2K5PA 3KH0A 3ZNID 1V97A 4TQ1A 3TBLD 3P4SB 4IC7B 1JWMD 4MSQB 3UI3A 2LVPA 1YN3A 3NY5A 2FAZA 1QILA 1C79A 1R4MI 1XO3A 2KX0A 2DAJA 2NBWB 1L4DB 2X38A 2KNBA 3R7QA 3GZNB 3RUIB 2WP9B 4TMAB 4MT5A 3A4RA 3DQVA 2H89B 4PS8A 1RFAA 4DXFA 3TUOA 1PUTA 2BYTA 1GOZA 2EELA 4BKSA 4JLCA 2KMAA 2KC1A 3TEYA 3X23A 1V86A 2BYEA 4S0RA 3W1SC 2NPTB 1JRUA 2MQJA 3W2DA 5HHDG 2DWQA 3NRZA 3JSVA 3MTNB 2INDC 1V81A 3AE6B 2LUEA 3DVGY 4K3BA 4BBNC 4RGMA 3K9OB 3PPAA 3PS6A 1J7BA 3DBLI 4MGIE 1P1AA 3GB1A 3ABVB 3BVZA 2PVGC 3NVVA 4DHJD 4J6IA 1LO5D 3L17A 4WJOA 1I35A 2JZPA 4WAAA 2V4IB 1OEYA 2N7DA 1N60A 4JIOU 4ARIA 2WXNA 1UH6A 4HLEA 3BVGA 4KIKA 2FNJB 3QARA 1KF6B 4YSYB 4KKJA 1FFVA 4CYEA 2CKHB 3ZIMA 4C4VB 2AL6A 4KV2A 4P1CC 3IG3A 4GU2A 2AQ3B 5J17A 2DAFA 3KUCB 1Q10A 1ZDXA 2VH2A 1SB3C 4AUQC 1NBFC 4C7YA 2M56B 3RD2A 2J4XA 2WXHA 2B76B 2WX0A 3N9YC 3OJ4B 3QJZA 2PVOD 3NZUA 1J0GA 1V2YA 2K3UA 2GBMA 4BAXA 1J19A
chains in the Genus database with same CATH topology
1FIQA 3BWUD 4RF1A 2J53A 4RNAA 2YEPB 2BB6A 1EWYC 1M4VA 2Q5WD 4GDKB 2WU5B 5MPOA 1PYWD 4H2AA 1F2RI 2DBYA 1STEA 3KWVA 4RF0A 2BT6A 1VRAB 1AWDA 1WYGA 4D2KA 1YJIA 4P16A 2LFIA 4RH6A 1L4ZB 3O13A 5FR3A 4JWSC 1SSNA 1TY2A 1XCQL 2K9XA 4A9AA 4XWWA 4HJGE 4HKQA 1FM0D 3CWIA 1TS2A 5AUIA 2M19A 2PIAA 3IT4B 1XLQA 5D7GA 1QLBB 2V3NA 1XF5L 1I4HA 3P42A 1KRHA 1VDVA 2FE8A 5EE9A 3ETRA 5TSSA 2QIEB 1VR9A 1F0ZA 4YTMB 2J42A 4MH8A 2DLBA 1C4AA 1J7CA 1J7AA 2WXPA 2N0SB 1CJEA 4ZOHC 2Y5CA 1K52A 3VR9B 1WXQA 1YQ4B 3W9CB 1HA5A 4RFBA 1JCKB 4TQ0A 2KQ4X 3FAHA 1N5XA 2JYTA 4NAMA 3NVZA 3ZJTA 3ZYYX 1D4BA 1OQQA 1JQ4A 1C4CA 4N58A 5E6JA 1KTKA 2OEDA 2AX5A 2ACZB 2N9LA 1JW9D 2PKOA 2QSDA 4KGSA 5EE0A 1TJEA 3VRBB 1JWSD 2RPVA 5H92C 2WXRA 1FNUA 3AH7A 2TSSA 4B0EA 1BUIC 2LHDA 4RGNA 1QF6A 1BMLC 3MHZA 2LHEA 2Y5PA 1YN5A 3URYA 2WDQB 5GXGB 2LUMA 2OHFA 2BB5A 1JMLA 2BS4B 4A55A 4L1BA 1XXGA 4WWMA 5HI1A 3H8HA 2WU2B 2QEJC 2KWDA 2WXJA 1EWCA 3L4PA 3IAS1 1I4PA 4Q2JA 3ZJUA 2D5GA 4IKGA 1XLOA 3ZGZA 5EE3A 2KMMA 1FRRA 1Y56A 4B0MA 3Q8AA 2HTME 5BYQA 1CZPA 1V1PB 3R2TA 3IT6B 1D5XC 1R7SA 1YQ3B 2ONQA 4YTPB 3BK2A 1ET6A 1NENB 2RMMA 1XLPA 3P1MA 4YT0B 1V1OA 1V8CA 1KLGD 2WS3B 2PMVA 3EGRA 2CJNA 1IBXB 1DYQA 1ZPSA 3BIID 1SJED 3W5VB 1L5PA 4WURA 2WNMA 2G1EA 4IOIE 4YSXB 1N62A 5BYRA 3V3XA 4YXDB 4YWGG 1WWTA 1ESFA 1EM7A 1GB4A 1QT9A 3AEGB 4KGTA 1ENFA 1JWAD 2JSVX 1TS4A 1AW7A 1YNTE 2DYOA 4KX6B 4RGOS 3AEEB 1VLBA 2ON8A 1I4XA 2WXQA 4OVZA 1FMAD 1CQVA 4XDCA 2W82A 2SEBD 4US8A 2W3SA 3NS1A 3NVYA 1UWXA 3MJ5A 1FCCC 1K53A 1ZE3D 2RDHA 1DOYA 2I38A 1SE4A 1IBXA 1FEHA 4O1NA 3R2IA 4P6VF 4WIPA 4A6QA 3Q69A 3LYYA 1NYQA 2ZW0A 2M0AA 2Z8LA 3U2SC 3J9CA 5T8IA 1PGAA 3MP9A 1TYGB 4PT5A 2W54A 4RCOA 5D3IB 4OHJA 1JALA 1PDXA 4DXGA 1OFFA 4OW0A 2JU6X 1C78A 3AE2B 1QOGA 2L83A 1XCTL 1GB1A 1FCLA 3VQIA 2W55A 1YJJA 2G9HD 1SEBD 4C56C 4LTUA 1HXYD 4WH4A 3RFZB 3P63A 1GPXA 1YN4A 3B2FA 1HZ6A 4KKIA 4GDLB 3CIRB 1VJKA 4EE2A 4WAFA 1XEEA 3I57A 2W3RA 1E7PB 2BS3B 1SIJA 2JX5A 3AMZA 4ZHOA 1HEZE 4JX1C 1FD6A 1P7EA 1FRDA 3U52E 2IGDA 2WXLA 1ROEA 1VZ8A 3LXFA 1FNVA 5HG2A 2PTLA 3AE7B 3AEAB 3E56A 2GB1A 2KN4A 1B1ZA 1NYRA 1TKGA 1ZXHA 3BYYB 3ZJVA 3T3NA 3BK1A 3EA6A 2VZKD 5FKAC 3AE8B 1ACCA 1QQRA 1WSPA 4A90A 4M0WA 1K50A 2MJEA 2Y3AA 3SR6A 2WDVB 3W5UB 3RPFC 3AM9A 1QOAA 1UNSA 4ZRPA 1SJHD 4A8XC 2SAKA 1E6EB 3P4PB 1I7HA 1T6BX 5BMGA 4N6EB 2WLBA 2WQYB 2IGHA 1IGCA 1UUPA 2NTSA 1BXTA 3PO0A 4JWUC 4WQMA 5BYSA 2WXKA 3AN1A 3GS2A 1ZOYB 2NMQA 1E10A 2KDMA 1FXIA 1PGBA 2LEKA 1SXTA 1I4QA 3Q8EA 1RFKA 2N9KA 2WDRB 3WCQA 4AS1A 2I2YA 3Q8CA 2WXGA 2EKIA 2AQ1B 1YMHE 4C80A 3B2GA 3U4EG 1N61A 1L0XB 2ZW1A 5FK9C 3T3OA 4XDDA 2WXOA 1EU3A 4ZYSA 3BVMA 2BTEA 5JXVA 4LLGM 3ZQ4A 1N5WA 2KACA 2JXTA 2XNAC 4ZRQA 3VR8B 3E9SA 4NJCA 3AE1B 1DOIA 2GRIA 1QOFA 1WRIA 1FO4A 2L1AA 2V0GA 4MM3B 1UWMA 1TY0A 2QJLA 2K0PA 4YTNB 3AE3B 1V1PA 4OZAA 4TSSA 2R61A 1RYJA 3LB8C 3FILB 1TS3A 1F2RC 3AEFB 2YEPF 3MFGA 1C9FA 1SE2A 1A70A 1PGXA 3TEWA 1MI0A 2LMCA 1TZOA 4OZCA 5AUKA 3EUB2 2VZKB 4ZHPA 4C7ZA 1NI3A 2K22A 1FNWA 4IDIA 1QKZA 2KAJA 2BW2A 2L32A 4FXCA 2IPKD 3OWEB 2K5PA 3NVWA 1N63A 2E6XA 1V97A 3HRDD 4TQ1A 3B9JA 3P4SB 5G5GA 1PFDA 3HVZA 1JWMD 1MHXA 1RWSA 3PZ7A 3VRAB 5LNK1 1GAQB 1SE3A 3UI3A 1HQRD 1YN3A 1MHHE 4USAA 1QILA 1MPEA 1C79A 4R3DA 2QILA 2MEKA 4HKZE 3MC0B 1VZ6A 4J3OD 1L6VA 1XO3A 3TSSA 4MACA 3AV8A 1L0VB 2WXMA 4AQ7A 4DQOC 1L4DB 1EU4A 5C2TB 2RDGA 2X38A 3SFEB 1JWUD 4JPSA 2FBWB 4HEA1 2WP9B 4TMAB 1IGDA 4XWTA 4MT5A 1SBBB 1D6EC 2H89B 1C4PA 1HZ5A 4L23A 1JRPA 1RM6C 1TS5A 4DXFA 1F77A 2ICIA 2E3TA 2V3PA 2IGGA 5G5HA 3R8BA 3TUOA 1PUTA 2INPE 2BYTA 5D3DA 2MJDA 3KWLA 1GOZA 1NEKB 2LJIA 2EELA 2J52A 2IDYA 4NZLB 3TEYA 2LGIA 3P4QB 4CQNA 2MH7A 1D5ZC 3W2DA 5HHDG 2DWQA 2NTTA 2GI9A 2JQRB 3KLSX 3NRZA 3Q8FA 1C77A 1ZUD2 1I4GA 4L2YA 5HFYA 1T3QA 3Q8BA 3AE6B 4ARCA 2QMTA 1E9MA 1I4RA 2XN9C 5BMIA 2H88B 1ET9A 3AE4B 4KGRA 1OQRA 4US9A 1FXAA 3C8YA 4RGMA 1J7BA 4HROA 3W1SA 1TKYA 2PLPA 1ZDVA 3TEXA 3NZ3A 2N7JA 3GB1A 3ABVB 2CJOA 3AEBB 2PVGC 3BVZA 1AN8A 3AE9B 3NVVA 1LO5D 1JROA 3AEDB 5C3JB 1E0ZA 1C76A 1L6UA 3HUIA 3I9V1 3BZDB 2JZPA 1QOBA 2V4IB 2WXIA 1AYFA 3U7ZA 1XLNA 2JWUA 1DGJA 3TEZA 1DOXA 1N60A 3DWMA 3BYTB 1L0YB 3KQ4A 4ARIA 2WXNA 3DWGC 3AE5B 3SFDB 3BVGA 1T5XD 5BMHA 2PW9A 3AB5A 5I4DA 3GP7A 1KF6B 1SF0A 4KKJA 4YSYB 1FFVA 2IJ0A 3FC4A 4RGTA 3NUHB 3P4RB 3HVDA 2MJ3A 1K51A 1UGJA 3IAM1 2AQ2B 1CK1A 2L52A 5EE1A 1ZP0B 1B9RA 1JWBD 3IXSA 1P7FA 1ZXIA 3PZ8A 2CU3A 2AQ3B 1KH0A 1Q10A 1ZDXA 1FFUA 1D5MC 4OZBA 1SB3C 2INNE 4UDUC 4REZA 2FUG1 4C7YA 2M56B 4ITKA 4JE3B 1VZ7A 2J4XA 2DYMA 1IUEA 2WXHA 2B76B 4HRSA 3AECB 1NVID 3N9YC 1KLUD 3V05A 2PVOD 1KFYB 2HDEA 1TKEA 4N59A 2K3UA 1MVKA 5H8YE 3FILA 4NAWB 1WGKA 3SEBA 2WXFA 2BBCA 4XE0A 4YSZB 4LK0M 2JYEA 2BS2B 4GLSC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2J53 A;  2EEL A;  4IOI E;  2J52 A;  3V3X A;  2NMQ A;  1F2R I;  2KDM A;  1EM7 A;  1GB4 A;  4KGT A;  2LGI A;  1PGB A;  2JSV X;  1YNT E;  2N9K A;  2I2Y A;  2ON8 A;  4D2K A;  5HHD G;  1YMH E;  2GI9 A;  1UWX A;  1XCQ L;  2ZW1 A;  5HFY A;  4HJG E;  1FCC C;  1K53 A;  2QMT A;  1IBX A;  2I38 A;  5JXV A;  5BMI A;  2KAC A;  2JXT A;  1XF5 L;  4KGR A;  2ZW0 A;  2PLP A;  1PGA A;  3MP9 A;  2K0P A;  1K52 A;  2N7J A;  3GB1 A;  4OZA A;  2JU6 X;  2KQ4 X;  1XCT L;  3FIL B;  1F2R C;  1GB1 A;  1C9F A;  1FCL A;  2JZP A;  1D4B A;  1PGX A;  1MI0 A;  2JWU A;  4OZC A;  4WH4 A;  1HZ6 A;  2OED A;  2N9L A;  1QKZ A;  2QSD A;  4KGS A;  5BMH A;  2PW9 A;  1HEZ E;  2RPV A;  1FD6 A;  1P7E A;  1K51 A;  1MHX A;  2IGD A;  2LHD A;  3UI3 A;  1MHH E;  5HG2 A;  1P7F A;  2LHE A;  2PTL A;  1MPE A;  1KH0 A;  2LUM A;  1Q10 A;  2GB1 A;  2KN4 A;  1JML A;  4HKZ E;  1ZXH A;  5HI1 A;  4OZB A;  4MAC A;  2KWD A;  4IKG A;  1K50 A;  1IGD A;  2ONQ A;  2RMM A;  1HZ5 A;  5BMG A;  1MVK A;  3FIL A;  2IGG A;  1IBX B;  2IGH A;  4GLS C;  1IGC A; 
#chains in the Genus database with same CATH topology
 3EEC A;  4RF1 A;  2J53 A;  2YEP B;  2L05 A;  4FN2 A;  4H2A A;  1F2R I;  2IO1 B;  1FXT B;  2KC2 A;  1VRA B;  3MC9 A;  4NY0 A;  4DHJ B;  4GN1 A;  2LFI A;  5E6N A;  2ZEQ A;  2LRU A;  1EO6 A;  1TY2 A;  1XCQ L;  4WWP A;  4A9A A;  4DDG D;  2PE9 A;  4FHK A;  1FM0 D;  2K8H A;  4NAW A;  1TS2 A;  3M62 B;  4F1S A;  2M19 A;  2NS5 A;  5D7G A;  2V3N A;  1XF5 L;  1Q0W B;  2WHI A;  3L10 B;  3P42 A;  1WM2 A;  2N1V A;  2V1Y A;  4LJO B;  1WX9 A;  2OJW A;  1T0Y A;  4B6W A;  3CSF A;  1F0Z A;  4PS7 A;  2ZJD A;  1C4A A;  1J7A A;  1XD3 B;  4ASW C;  2Y5C A;  1K52 A;  2I1J A;  1WXQ A;  4FBJ B;  2LD9 A;  5AEK B;  1HA5 A;  1KM7 A;  1JCK B;  4TQ0 A;  2K39 A;  1OQQ A;  1JQ4 A;  1C4C A;  4F8C B;  3GZN I;  4X57 B;  4N58 A;  4K81 A;  2OED A;  2R2Q A;  4FUL A;  2ACZ B;  1JW9 D;  5EE0 A;  1TJE A;  1VCB A;  3N1Z C;  3PTF C;  2LVQ A;  1YD8 U;  2KHW B;  2NVU I;  5E6P A;  2WWZ A;  2L76 A;  2RSU A;  3VTU A;  3MHZ A;  2LHE A;  1YN5 A;  3URY A;  2LUM A;  3IVF A;  4FHJ A;  2BB5 A;  4MJS B;  3IFW B;  4DHZ B;  4A55 A;  4WWM A;  1T0R C;  3B1L X;  4Q2J A;  3ZJU A;  1WYW B;  1FRR A;  3ZTC A;  4MDK E;  2JF5 A;  3IT6 B;  2RR9 A;  1OEY J;  1R7S A;  2K6D B;  4YTP B;  1ET6 A;  3JYU A;  5IN7 A;  3NS8 A;  1H4R A;  3ZVV A;  1SJE D;  1L5P A;  2WNM A;  4YSX B;  4YXD B;  1WWT A;  1ESF A;  1EM7 A;  3MC8 A;  2N9P C;  1V80 A;  3AEG B;  1ENF A;  1JWA D;  3X0W A;  1TS4 A;  1YNT E;  2MA9 B;  4GMV A;  1FMA D;  1CQV A;  3NS1 A;  4IW0 A;  3MJ5 A;  1F52 A;  1IBX A;  4O1N A;  3APF A;  3R2I A;  4S17 A;  4G0N B;  2XEW A;  2FCM A;  2ZCC A;  1WFY A;  5IP4 D;  2Z8L A;  1PGA A;  3GE8 C;  2W54 A;  4QAY A;  2KTR A;  1C78 A;  1QOG A;  2O6V D;  5TR5 A;  2D07 B;  1FCL A;  3VQI A;  2W55 A;  1YJJ A;  1SEB D;  4IM3 A;  2YLM A;  1R4N B;  1HZ6 A;  4GDL B;  1VJK A;  1J8C A;  5GMV A;  1HEZ E;  1ZGU B;  1E8X A;  5HKH A;  1XT9 B;  2QC8 A;  5IKC M;  1GJZ A;  3OLM D;  4K3C A;  4DHZ E;  1EF5 A;  5JZE B;  1FNV A;  5AZF A;  4LCD E;  3CF6 E;  4NJ7 A;  2IYD B;  3U8Z A;  1TKG A;  1ZXH A;  3BK1 A;  2BWE S;  4NQK E;  1BT0 A;  5FKA C;  2M0X A;  2LI5 A;  4MH0 E;  1ACC A;  4A90 A;  1K50 A;  4YL8 A;  3ZDM C;  5G55 A;  3A1Q B;  2K8B A;  2N1W A;  1UNS A;  2NCN A;  4CO7 A;  1SJH D;  1E6E B;  1I7H A;  4HCN B;  1UGM A;  2IGH A;  4BFR A;  2GBJ A;  2NTS A;  1BXT A;  2BGF A;  4BKS D;  4ANU A;  3WAL A;  4A3O A;  1PGB A;  2LEK A;  1RFK A;  3RZW C;  3WCQ A;  3QCA A;  5KHO A;  3Q8C A;  2AQ1 B;  2O6V B;  4C80 A;  3M3J A;  3B2G A;  3RI7 C;  3R3M A;  3LDZ E;  1N61 A;  1L0X B;  2MWS B;  2BTE A;  5JXV A;  1WH3 A;  1N5W A;  2XNA C;  3E9S A;  3I63 C;  4LDT D;  4FJV B;  1FO4 A;  3VUY A;  1V6E A;  3DVN U;  4YTN B;  2K0P A;  3BY4 B;  4W9L A;  2VH1 A;  3ENE A;  3QX1 A;  3RN9 C;  3H7S A;  3V62 A;  5DPR A;  2R61 A;  3LB8 C;  4K7U A;  1Y8R C;  1M94 A;  4P7I A;  4DWF A;  4E74 A;  3AEF B;  1F2R C;  2YEP F;  3MFG A;  4FAD A;  2LMC A;  3EUB 2;  3PRP B;  4KZ0 A;  1MFW A;  4IDI A;  2BW2 A;  2JT4 B;  2L32 A;  4FXC A;  3ZUN A;  3NVW A;  3TMP B;  2WYQ A;  1ISN A;  1PFD A;  3HVZ A;  1MHX A;  1GAQ B;  1SE3 A;  1HQR D;  3MJW A;  1MHH E;  4USA A;  1MPE A;  2V3S A;  3EFC A;  1GC6 A;  1VZ6 A;  2JZZ A;  2ZNV B;  1FPY A;  3AV8 A;  3PZD A;  1L0V B;  3GOE A;  2WXM A;  3UIN B;  5C2T B;  2RDG A;  2KVZ A;  1JWU D;  4I6N B;  5IO9 A;  4HEA 1;  2PJH A;  1SBB B;  3JSV B;  1C4P A;  1N6Z A;  4L23 A;  1TS5 A;  2E3T A;  3R8B A;  2INP E;  1C3T A;  3QQ8 B;  1Z2M A;  1D3Z A;  2MJD A;  2LJI A;  2IDY A;  4LDT B;  1TIF A;  2ASQ A;  2LGI A;  2DHZ A;  4CQN A;  2MHJ A;  4C00 A;  1D5Z C;  3JVZ X;  4BBN F;  4HDO A;  3TCA A;  2GI9 A;  4ANV A;  1R4N I;  2WX1 A;  4URK A;  5HFY A;  1I4R A;  2KDE B;  2H88 B;  1ET9 A;  3AE4 B;  3AU5 A;  4ZYN A;  1FXA A;  4KIK B;  3KUZ A;  3U30 A;  1I42 A;  4HRO A;  3SD5 A;  2IBI B;  4GSW A;  1WGD A;  1ZDV A;  4LNO A;  3TEX A;  2JPH A;  3C0R B;  2N7J A;  1YOV B;  2CJO A;  1AN8 A;  2KWU B;  2MLB A;  3SU8 X;  2Z59 B;  4NPN A;  3I9V 1;  2DNF A;  1WRD B;  3BZD B;  5DPS A;  1MJD A;  3U7Z A;  2JWU A;  3TEZ A;  2JRI B;  3I5J C;  3CMM B;  3DWG C;  3QWZ B;  4IWP A;  3SFD B;  3V61 A;  4XZ4 A;  4A3P A;  5BMH A;  3H7P A;  3AB5 A;  2L8J A;  3FC4 A;  2BYF A;  2MJ3 A;  5KHQ A;  1LXD A;  1JWB D;  2KFK A;  3PZ8 A;  2PPH A;  2KDF B;  1FFU A;  1D5M C;  4IWQ A;  2DZI A;  4REZ A;  1QZE A;  2FUG 1;  4TUU A;  2MBE A;  2KKC A;  5CHV C;  2ZPN A;  3V05 A;  1KLU D;  2CHW A;  4IWO A;  1V5O A;  5H8Y E;  4NAW B;  1WGK A;  2WXF A;  1V49 A;  2BBC A;  1WZ3 A;  4YSZ B;  2JYE A;  1JWS D;  5G5G A;  3TJP A;  3BWU D;  2CHZ A;  1EWY C;  2WU5 B;  1PYW D;  4M8N A;  2GOW A;  4MGY E;  2JVC A;  3BIN A;  2KWC A;  4I6P A;  4EZJ A;  2JUO A;  1TZ1 A;  1YJI A;  4OVU A;  4RH6 A;  1SSN A;  2K9X A;  4HJG E;  4ZRJ A;  4XGA B;  4LNN A;  2KLG A;  4BZA A;  3IT4 B;  3VUX A;  1I4H A;  3R66 C;  4M0W B;  3PT2 B;  5EE9 A;  3HIZ A;  2CU1 A;  2QIE B;  3UQA A;  5L95 C;  2WXP A;  2N0S B;  1CJE A;  1YQ4 B;  2C7H A;  4RFB A;  2K6Q A;  1K8R B;  2KQ4 X;  1YX5 B;  2JYT A;  3ZJT A;  1D4B A;  3N3K B;  4P1B C;  2QSD A;  4KGS A;  3VRB B;  2RPV A;  2WXR A;  1FNU A;  4LNI A;  3AH7 A;  4B0E A;  4KZC A;  3IBE A;  4RGN A;  3ALB A;  3VDZ A;  2Y5P A;  1WGY A;  4MGK E;  2N9E B;  5HI1 A;  4WWO A;  3L16 A;  5D94 A;  4HVB A;  1I4P A;  2XK5 A;  3JW0 X;  2UWQ A;  4IKG A;  1Y56 A;  2CS4 A;  4B0M A;  3Q8A A;  2HTM E;  2LGX A;  3R2T A;  2KQS A;  3DVG X;  1D5X C;  2FCN A;  1YQ3 B;  3ZRC A;  3BK2 A;  1NEN B;  1XLP A;  3P1M A;  1V1O A;  1V8C A;  1GUA B;  2PMV A;  4K1R B;  1IBX B;  3BII D;  1HE8 A;  4W9K A;  5C23 A;  4WUR A;  1UEL A;  2G1E A;  1IPG A;  3RCZ A;  4JGH B;  2IO0 B;  3V3X A;  2KOX A;  1GB4 A;  1QT9 A;  2JSV X;  2D3G A;  2DYO A;  3Q3J A;  1WXA A;  1VLB A;  2KFJ A;  3ZNZ B;  2KTR B;  1I4X A;  2ON8 A;  4OVZ A;  1NI2 A;  4EKU A;  2SEB D;  2M1M A;  1FCC C;  4JL9 A;  2KWV B;  5C1Z A;  1ZE3 D;  2I38 A;  1SE4 A;  2LVO A;  1FEH A;  4P6V F;  1F1H A;  4DXA B;  1WJN A;  5LXI B;  3VH4 B;  2BKF A;  1WM3 A;  3J9C A;  2KJR A;  3Q6B A;  3MP9 A;  1TYG B;  2BKR B;  4RCO A;  5D3I B;  2IO3 B;  4OHJ A;  4DXG A;  3AXC A;  3VFK A;  2JU6 X;  2O2V A;  4BOZ B;  2L83 A;  1GB1 A;  2LGS A;  2LJ5 A;  2G9H D;  4LTU A;  4WH4 A;  3P63 A;  1GPX A;  1YN4 A;  4EE2 A;  3L08 A;  1E7P B;  2BS3 B;  3AMZ A;  2JX5 A;  1WX7 A;  2RGF A;  2MBH A;  1FD6 A;  1ROE A;  1VZ8 A;  2KXJ A;  3DHH C;  3LJ3 A;  5HG2 A;  4GIV A;  2L0T A;  4A20 A;  2GB1 A;  3ZRF A;  3Q3N C;  2D3A A;  3BYY B;  2EMT A;  2C60 A;  3AE8 B;  3N30 A;  4M0W A;  3A33 B;  1NDD A;  2WDV B;  3RPF C;  1QOA A;  4ZRP A;  3P4P B;  3L0W B;  4W9C A;  4N6E B;  2WLB A;  2WQY B;  4ICU A;  1IGC A;  2RPQ A;  1UUP A;  1WR6 E;  5BYS A;  3H9D A;  1WE6 A;  3AN1 A;  4BOS C;  2NMQ A;  3DHI C;  1E10 A;  2G4D B;  2BWF A;  1I4Q A;  3Q8E A;  2WDR B;  4AS1 A;  3QK0 A;  2WXG A;  2EKI A;  2QCZ A;  4G11 A;  5FK9 C;  2LAS A;  4LLG M;  3ZQ4 A;  3VR8 B;  4NJC A;  2D3C A;  3AE1 B;  1DOI A;  2GRI A;  1QOF A;  2EKE C;  3N1Y C;  5AZH A;  2V0G A;  2C7N B;  3AE3 B;  2G3Q B;  4OZA A;  4TSS A;  2KX3 A;  3FIL B;  1TS3 A;  1YIW A;  1C9F A;  1PGX A;  4ZDV A;  4OZC A;  3SDL C;  2DZK A;  3H6N A;  1UF0 A;  2K22 A;  2BF8 B;  2KAJ A;  4HPP A;  2PEA A;  2E6X A;  4M02 A;  1VD2 A;  4M01 A;  4LJP B;  3VRA B;  3DHG C;  5LNK 1;  4FJY A;  4AP4 C;  4R3D A;  4F7Z A;  2MEK A;  4HKZ E;  3DPD A;  4J3O D;  3TSS A;  2ZVN A;  4AQ7 A;  3RNG C;  3SHQ A;  4DQO C;  1A5R A;  2ZNV C;  1EU4 A;  4WQO B;  3SFE B;  2KO3 A;  1WIA A;  5CX3 A;  3UGB B;  2FBW B;  2B3A A;  1IGD A;  4XWT A;  1JRP A;  2GMI C;  2ICI A;  2V3P A;  2IGG A;  3Q3M C;  3ZKJ C;  2MP2 B;  1Z5S B;  1TBE A;  5D6J B;  3OG5 A;  2KN5 A;  2FCS A;  2CHX A;  2AEH A;  3P4Q B;  2MH7 A;  4NQL B;  5LLI A;  4BVU C;  4AWJ A;  4RMA A;  3A9K A;  3KLS X;  3KYD D;  3Q8F A;  1C77 A;  2J0M A;  1IP9 A;  1ZKH A;  2L7R A;  1GC7 A;  3V6E B;  1EF1 A;  1E8W A;  1OQR A;  2MSE D;  5DPT A;  3H7P B;  2BYV E;  1GNU A;  2N7E A;  3W1S A;  1TKY A;  2M17 A;  2UYZ B;  3B0A A;  2MBO A;  3EC8 A;  3AEB B;  2K25 A;  2KFK B;  3VAW A;  3ECI A;  1JRO A;  5JHB A;  1L6U A;  2KLC A;  1QOB A;  2WXI A;  1AYF A;  1XLN A;  1DGJ A;  1DOX A;  3DWM A;  4MEL A;  2JXX A;  3BYT B;  1L0Y B;  2A5U A;  3KQ4 A;  3AE5 B;  2KZR A;  1T5X D;  1SF0 A;  3NUH B;  3P4R B;  3HVD A;  4E3C A;  1K51 A;  1UGJ A;  2AL3 A;  3IAM 1;  2AQ2 B;  5LXH A;  5EE1 A;  3VVW B;  1ZP0 B;  1P7F A;  4XX5 A;  1L2N A;  4KSK C;  2ZPY A;  3ONS A;  1L7Y A;  3N32 A;  3AUL A;  4UDU C;  1R4M B;  3T9L A;  4ITK A;  2BQQ A;  2M8S A;  1IUE A;  2KAN A;  3M95 A;  3AEC B;  1NVI D;  3DBH B;  2HDE A;  3HHM A;  3S2A A;  1TKE A;  4N59 A;  2D10 A;  4ANW A;  3ZNH B;  4TV3 A;  2Y5B B;  1WGR A;  4E71 A;  4HK2 A;  1MVK A;  5FR6 A;  3FIL A;  3SEB A;  4XC2 A;  2DYB A;  4LK0 M;  3QIJ A;  2LWP A;  4GLS C;  5AZG A;  4RNA A;  2KD0 A;  3RNE C;  3UQB A;  2G45 B;  1M4V A;  2Q5W D;  5MPO A;  4W9I A;  2LZ6 A;  1STE A;  4NNJ B;  2BT6 A;  2ZZP B;  4G50 A;  1AWD A;  3DBS A;  4P16 A;  1L4Z B;  5FR3 A;  3VUW A;  4HKQ A;  3CWI A;  2D2Q A;  2PIA A;  1XLQ A;  2BVC A;  2KJ6 A;  3ETR A;  4HXD A;  4GDK A;  1VR9 A;  4YTM B;  2KMC A;  4ZOH C;  3VR9 B;  4IM2 A;  3PVL A;  4IM0 A;  3DBL B;  2FCQ A;  1N5X A;  1E8Z A;  3ZYY X;  1OGW A;  4IUM B;  1Q5W B;  5E6J A;  2MP2 A;  2L3Z A;  3PHX B;  2AX5 A;  2XK5 B;  2PKO A;  1S3S G;  2KJH B;  3RNF C;  2TSS A;  2PE6 B;  1SIF A;  1QF6 A;  3KUD B;  1BML C;  1T0Q C;  4BKG A;  2WDQ B;  2LXC A;  2OHF A;  5CHF A;  2AYO B;  2BS4 B;  1XXG A;  3H8H A;  2D11 A;  2KWD A;  3DVN V;  2WXJ A;  1HTQ A;  2D5G A;  2X8X X;  3L54 A;  4KVG B;  3HK0 A;  2KMM A;  2KVR A;  1V1P B;  4ZRK A;  3QA8 A;  2NBV B;  3TL5 A;  2RMM A;  4YT0 B;  2WS3 B;  3T8M A;  2MBQ A;  2JRH A;  2CJN A;  1DYQ A;  1ZPS A;  1UD7 A;  1G6J A;  3W5V B;  3DOW A;  3ZW3 A;  3RZF A;  4IOI E;  2C5L C;  2J7Q B;  2OOB B;  4LNK A;  2M4N A;  4EOY A;  3FKY A;  1AW7 A;  4RGO S;  3AEE B;  2WXQ A;  3I3T B;  3N20 C;  2O2V B;  4XDC A;  2W82 A;  3PHW B;  5DCN A;  3CST A;  1P3Q U;  3HM6 X;  2QDF A;  1K53 A;  2RDH A;  3ML8 A;  4A6Q A;  3Q69 A;  2HJ1 A;  4MGZ E;  3V6C B;  1NYQ A;  3DDC B;  2M0A A;  4XYC A;  3U2S C;  2IY1 B;  1WJ4 A;  2V9H A;  3VH3 B;  1JAL A;  3Q3F A;  3UIO B;  1RLF A;  4B95 A;  1OFF A;  1XCT L;  4II2 B;  4WWN A;  4MEM A;  1E8Y A;  4C56 C;  2ZVO A;  2HJ8 A;  1E90 A;  4KKI A;  3RYT A;  4PK1 A;  4WAF A;  2L0F A;  3I57 A;  2OJR A;  3DBH I;  1WZ0 A;  4ZHO A;  4JX1 C;  1P9D U;  3HM3 A;  4ZRI A;  1PQS A;  1FRD A;  2IGD A;  2WXL A;  3PRE A;  2KK8 A;  2PTL A;  3AEA B;  3E56 A;  3KW5 B;  5IOI A;  3A4S C;  1Q1O A;  3UIP B;  3ZJV A;  2J0K A;  2IO2 B;  3EA6 A;  2VZK D;  4EFO A;  2MJE A;  5DPW A;  2Y3A A;  3AI5 A;  3A9J B;  3AM9 A;  5E6O A;  2C9W B;  4A8X C;  3RMK C;  1V5T A;  1EUV B;  4II3 B;  3WAN A;  3GE3 C;  4FJZ A;  4GB9 A;  1X1M A;  1WY8 A;  3PO0 A;  4JWU C;  2WXK A;  2HTH A;  3EHV A;  3GS2 A;  2KDM A;  2HD5 B;  1SXT A;  2N9K A;  1WGH A;  1WXV A;  3U4E G;  3QC8 B;  3N1X C;  4RM9 A;  3T3O A;  3PSE B;  2WXO A;  2N9X A;  4ZYS A;  3Q3O C;  2KAC A;  2JXT A;  2JZ3 B;  4ZRQ A;  2RDB C;  4N9F 4;  3DBR B;  3W1Y A;  1MG4 A;  2MCN B;  1KJT A;  5J18 A;  1WRI A;  2L1A A;  2QJL A;  1V1P A;  2LRW A;  4HPM B;  3QHT A;  3WAO A;  2GLS A;  3D32 A;  3H1U A;  3NZS A;  1TZO A;  1LGR A;  2VZK B;  1FNW A;  1QKZ A;  3OWE B;  3ZDT A;  1N63 A;  2UU7 A;  3HRD D;  3B9J A;  2MRP A;  4AJW A;  4MM3 A;  1RWS A;  1WMH A;  3PZ7 A;  1U4A A;  3KYC D;  4K7S A;  5BO4 B;  4DK5 A;  2QIL A;  3MC0 B;  4W9G A;  5J2R A;  1L6V A;  1T0S C;  4MAC A;  4M00 A;  4AJY B;  3VXW A;  4G3X B;  4JPS A;  2KDB A;  2K1F A;  1C1Y B;  3A9K B;  1D6E C;  4FLH A;  2FID A;  3PGE A;  4KDL B;  3WIM A;  2Z0E B;  2G4S A;  4WJQ A;  1HZ5 A;  1RM6 C;  1F77 A;  3R7R A;  5G5H A;  2KQ7 A;  2KTF A;  3APD A;  3RUL A;  5D3D A;  3KWL A;  1NEK B;  2ZCB A;  2J52 A;  3Q2A C;  4NZL B;  2MX2 A;  1TTN A;  3PLU A;  4PYZ A;  4WJP A;  3O65 B;  2NTT A;  1TT5 B;  2JQR B;  3RNC C;  2KDI A;  4K7W A;  1ZUD 2;  1I4G A;  4L2Y A;  1T3Q A;  3Q8B A;  4ARC A;  2QMT A;  1E9M A;  2XN9 C;  5BMI A;  4KGR A;  4US9 A;  3C8Y A;  2YVC A;  1V9J A;  2PLP A;  2WGS A;  2MBB B;  3NZ3 A;  2NPT A;  2DZJ A;  3A9J A;  3AE9 B;  4W9E A;  3OAW A;  3AED B;  5C3J B;  1E0Z A;  1C76 A;  3HUI A;  4W9D A;  1AAR A;  4MSM B;  3PRZ A;  3WA0 A;  2PW9 A;  5I4D A;  4EZK A;  3GP7 A;  2JWZ A;  3WAP A;  1KOT A;  2IJ0 A;  4RGT A;  4FA6 A;  3KVF B;  3VTW A;  2V4L A;  3L13 A;  4RM8 A;  1CK1 A;  2L52 A;  1B9R A;  1GG3 A;  3IXS A;  1ZXI A;  2CU3 A;  2DEN B;  1KH0 A;  2LGD A;  4OZB A;  2KYW A;  2INN E;  3ZXV A;  4TKN A;  4JE3 B;  1VZ7 A;  2DYM A;  1IYF A;  4HRS A;  1P98 A;  1WJ6 A;  3ZXR A;  1WI0 A;  1LM8 B;  1KFY B;  3K9P B;  4C4V A;  1RRB A;  3AU4 A;  3NJT A;  3DBR I;  4XE0 A;  2BS2 B;  1FIQ A;  2N4F A;  2BB6 A;  2Z0D B;  4GDK B;  2CR5 A;  4GOC A;  2XBB C;  3PRM B;  2DBY A;  3KWV A;  4RF0 A;  4WJN A;  5EDS A;  4GGQ A;  1WYG A;  4D2K A;  3O13 A;  4JWS C;  4PYU A;  4ACF A;  4XWW A;  4ICV A;  2INC C;  3U7D A;  5AUI A;  1S1Q B;  1QLB B;  1KRH A;  1VDV A;  4B9K A;  2FE8 A;  5TSS A;  1WXM A;  2K8C A;  1WX8 A;  2J42 A;  4MH8 A;  1J7C A;  1RAX A;  2DLB A;  5D2M B;  1YX6 B;  3W9C B;  5CTR C;  3FAH A;  4NAM A;  3NVZ A;  4KDI C;  4IG7 B;  2BPS A;  4OVV A;  2GBR A;  2FUH B;  1KTK A;  1E7V A;  2N9L A;  1P0R A;  2QHO A;  4W9F A;  2W9N A;  3TIX A;  2REX A;  5JHA A;  1CMX B;  4HPL B;  5H92 C;  3RT3 B;  3RNA C;  1BUI C;  3B08 A;  2LHD A;  3VHT C;  5GXG B;  2LGY A;  1JML A;  1H8C A;  2AWT A;  1SGH A;  4L1B A;  5L83 A;  4EEW A;  1MG8 A;  2WU2 B;  2D3B A;  2QEJ C;  2IZV B;  2HE7 A;  2KT7 A;  1OTR B;  1EWC A;  3L4P A;  3IAS 1;  1YQB A;  3MHS D;  1XLO A;  3ZGZ A;  5EE3 A;  1WR1 A;  5BYQ A;  3C19 A;  3EFU A;  1CZP A;  4W9H A;  3V60 A;  1WE7 A;  2ONQ A;  4ANX A;  3PLV A;  1KLG D;  3EGR A;  2DX5 B;  2NR2 A;  4MJS A;  1YJ1 A;  3UF8 A;  1N62 A;  5BYR A;  1WF9 A;  4YWG G;  2A4Z A;  4KGT A;  4KX6 B;  3WAM A;  5G2N A;  3ZO5 B;  3PV1 A;  4EZL A;  4US8 A;  2W3S A;  3NVY A;  1UWX A;  1ZW7 A;  1SE9 A;  3DCG A;  2I1K A;  1UBI A;  1DOY A;  1E5W A;  2FIF A;  4WIP A;  2LXA A;  1HTO A;  3LYY A;  2ZW0 A;  4NJ6 A;  2JY6 A;  2GBN A;  5T8I A;  4PT5 A;  3OJ3 A;  1PDX A;  2C7M B;  4OW0 A;  1LFD A;  3AE2 B;  2J0J A;  4HDQ A;  1WGG A;  3ZLZ A;  4HJK A;  1HXY D;  3RFZ B;  4GXB A;  3B2F A;  3CIR B;  3NOB A;  4W9J A;  1XEE A;  3ML9 A;  2W3R A;  1SIJ A;  2L00 B;  1P7E A;  2VRR B;  3U52 E;  3LXF A;  3AE7 B;  2EMS A;  3NG0 A;  2KN4 A;  1B1Z A;  1NYR A;  4DDI D;  4M8M A;  4HWI B;  3T3N A;  4DBG A;  4PS3 A;  2NBU A;  1WXS A;  4GDL A;  1QQR A;  1WSP A;  4EUT A;  5IA7 A;  3NHE B;  3M63 B;  3SR6 A;  3W5U B;  3QAQ A;  3VTV A;  1UZX B;  3P2B A;  1F9J A;  3ZNG C;  2SAK A;  4CHK A;  1T6B X;  5BMG A;  1OQY A;  3RNB C;  4LNF A;  4WQM A;  1TGZ B;  1ZOY B;  3Q14 C;  1FXI A;  4HCP B;  1E7U A;  4I6L B;  3A1Q A;  2I2Y A;  1WJU A;  2GBK A;  1XQQ A;  1YMH E;  3IHP C;  5IAA C;  2ZW1 A;  4XDD A;  3APC A;  1LQB A;  1EU3 A;  3BVM A;  4JQW C;  2IY0 B;  2R2O A;  2DZM A;  2MW5 A;  4MM3 B;  1UWM A;  1WMH B;  1TY0 A;  1KLV A;  4BKT A;  5CHW A;  1RYJ A;  2O6V A;  4KSL C;  1SE2 A;  3ZTD A;  1A70 A;  3TEW A;  1MI0 A;  5AUK A;  4ZHP A;  4C7Z A;  5JH5 C;  1NI3 A;  4AOF A;  2RD0 A;  1UBQ A;  2WDT B;  2IPK D;  2K5P A;  3KH0 A;  3ZNI D;  1V97 A;  4TQ1 A;  3TBL D;  3P4S B;  4IC7 B;  1JWM D;  4MSQ B;  3UI3 A;  2LVP A;  1YN3 A;  3NY5 A;  2FAZ A;  1QIL A;  1C79 A;  1R4M I;  1XO3 A;  2KX0 A;  2DAJ A;  2NBW B;  1L4D B;  2X38 A;  2KNB A;  3R7Q A;  3GZN B;  3RUI B;  2WP9 B;  4TMA B;  4MT5 A;  3A4R A;  3DQV A;  2H89 B;  4PS8 A;  1RFA A;  4DXF A;  3TUO A;  1PUT A;  2BYT A;  1GOZ A;  2EEL A;  4BKS A;  4JLC A;  2KMA A;  2KC1 A;  3TEY A;  3X23 A;  1V86 A;  2BYE A;  4S0R A;  3W1S C;  2NPT B;  1JRU A;  2MQJ A;  3W2D A;  5HHD G;  2DWQ A;  3NRZ A;  3JSV A;  3MTN B;  2IND C;  1V81 A;  3AE6 B;  2LUE A;  3DVG Y;  4K3B A;  4BBN C;  4RGM A;  3K9O B;  3PPA A;  3PS6 A;  1J7B A;  3DBL I;  4MGI E;  1P1A A;  3GB1 A;  3ABV B;  3BVZ A;  2PVG C;  3NVV A;  4DHJ D;  4J6I A;  1LO5 D;  3L17 A;  4WJO A;  1I35 A;  2JZP A;  4WAA A;  2V4I B;  1OEY A;  2N7D A;  1N60 A;  4JIO U;  4ARI A;  2WXN A;  1UH6 A;  4HLE A;  3BVG A;  4KIK A;  2FNJ B;  3QAR A;  1KF6 B;  4YSY B;  4KKJ A;  1FFV A;  4CYE A;  2CKH B;  3ZIM A;  4C4V B;  2AL6 A;  4KV2 A;  4P1C C;  3IG3 A;  4GU2 A;  2AQ3 B;  5J17 A;  2DAF A;  3KUC B;  1Q10 A;  1ZDX A;  2VH2 A;  1SB3 C;  4AUQ C;  1NBF C;  4C7Y A;  2M56 B;  3RD2 A;  2J4X A;  2WXH A;  2B76 B;  2WX0 A;  3N9Y C;  3OJ4 B;  3QJZ A;  2PVO D;  3NZU A;  1J0G A;  1V2Y A;  2K3U A;  2GBM A;  4BAX A;  1J19 A; 
#chains in the Genus database with same CATH homology
 1FIQ A;  3BWU D;  4RF1 A;  2J53 A;  4RNA A;  2YEP B;  2BB6 A;  1EWY C;  1M4V A;  2Q5W D;  4GDK B;  2WU5 B;  5MPO A;  1PYW D;  4H2A A;  1F2R I;  2DBY A;  1STE A;  3KWV A;  4RF0 A;  2BT6 A;  1VRA B;  1AWD A;  1WYG A;  4D2K A;  1YJI A;  4P16 A;  2LFI A;  4RH6 A;  1L4Z B;  3O13 A;  5FR3 A;  4JWS C;  1SSN A;  1TY2 A;  1XCQ L;  2K9X A;  4A9A A;  4XWW A;  4HJG E;  4HKQ A;  1FM0 D;  3CWI A;  1TS2 A;  5AUI A;  2M19 A;  2PIA A;  3IT4 B;  1XLQ A;  5D7G A;  1QLB B;  2V3N A;  1XF5 L;  1I4H A;  3P42 A;  1KRH A;  1VDV A;  2FE8 A;  5EE9 A;  3ETR A;  5TSS A;  2QIE B;  1VR9 A;  1F0Z A;  4YTM B;  2J42 A;  4MH8 A;  2DLB A;  1C4A A;  1J7C A;  1J7A A;  2WXP A;  2N0S B;  1CJE A;  4ZOH C;  2Y5C A;  1K52 A;  3VR9 B;  1WXQ A;  1YQ4 B;  3W9C B;  1HA5 A;  4RFB A;  1JCK B;  4TQ0 A;  2KQ4 X;  3FAH A;  1N5X A;  2JYT A;  4NAM A;  3NVZ A;  3ZJT A;  3ZYY X;  1D4B A;  1OQQ A;  1JQ4 A;  1C4C A;  4N58 A;  5E6J A;  1KTK A;  2OED A;  2AX5 A;  2ACZ B;  2N9L A;  1JW9 D;  2PKO A;  2QSD A;  4KGS A;  5EE0 A;  1TJE A;  3VRB B;  1JWS D;  2RPV A;  5H92 C;  2WXR A;  1FNU A;  3AH7 A;  2TSS A;  4B0E A;  1BUI C;  2LHD A;  4RGN A;  1QF6 A;  1BML C;  3MHZ A;  2LHE A;  2Y5P A;  1YN5 A;  3URY A;  2WDQ B;  5GXG B;  2LUM A;  2OHF A;  2BB5 A;  1JML A;  2BS4 B;  4A55 A;  4L1B A;  1XXG A;  4WWM A;  5HI1 A;  3H8H A;  2WU2 B;  2QEJ C;  2KWD A;  2WXJ A;  1EWC A;  3L4P A;  3IAS 1;  1I4P A;  4Q2J A;  3ZJU A;  2D5G A;  4IKG A;  1XLO A;  3ZGZ A;  5EE3 A;  2KMM A;  1FRR A;  1Y56 A;  4B0M A;  3Q8A A;  2HTM E;  5BYQ A;  1CZP A;  1V1P B;  3R2T A;  3IT6 B;  1D5X C;  1R7S A;  1YQ3 B;  2ONQ A;  4YTP B;  3BK2 A;  1ET6 A;  1NEN B;  2RMM A;  1XLP A;  3P1M A;  4YT0 B;  1V1O A;  1V8C A;  1KLG D;  2WS3 B;  2PMV A;  3EGR A;  2CJN A;  1IBX B;  1DYQ A;  1ZPS A;  3BII D;  1SJE D;  3W5V B;  1L5P A;  4WUR A;  2WNM A;  2G1E A;  4IOI E;  4YSX B;  1N62 A;  5BYR A;  3V3X A;  4YXD B;  4YWG G;  1WWT A;  1ESF A;  1EM7 A;  1GB4 A;  1QT9 A;  3AEG B;  4KGT A;  1ENF A;  1JWA D;  2JSV X;  1TS4 A;  1AW7 A;  1YNT E;  2DYO A;  4KX6 B;  4RGO S;  3AEE B;  1VLB A;  2ON8 A;  1I4X A;  2WXQ A;  4OVZ A;  1FMA D;  1CQV A;  4XDC A;  2W82 A;  2SEB D;  4US8 A;  2W3S A;  3NS1 A;  3NVY A;  1UWX A;  3MJ5 A;  1FCC C;  1K53 A;  1ZE3 D;  2RDH A;  1DOY A;  2I38 A;  1SE4 A;  1IBX A;  1FEH A;  4O1N A;  3R2I A;  4P6V F;  4WIP A;  4A6Q A;  3Q69 A;  3LYY A;  1NYQ A;  2ZW0 A;  2M0A A;  2Z8L A;  3U2S C;  3J9C A;  5T8I A;  1PGA A;  3MP9 A;  1TYG B;  4PT5 A;  2W54 A;  4RCO A;  5D3I B;  4OHJ A;  1JAL A;  1PDX A;  4DXG A;  1OFF A;  4OW0 A;  2JU6 X;  1C78 A;  3AE2 B;  1QOG A;  2L83 A;  1XCT L;  1GB1 A;  1FCL A;  3VQI A;  2W55 A;  1YJJ A;  2G9H D;  1SEB D;  4C56 C;  4LTU A;  1HXY D;  4WH4 A;  3RFZ B;  3P63 A;  1GPX A;  1YN4 A;  3B2F A;  1HZ6 A;  4KKI A;  4GDL B;  3CIR B;  1VJK A;  4EE2 A;  4WAF A;  1XEE A;  3I57 A;  2W3R A;  1E7P B;  2BS3 B;  1SIJ A;  2JX5 A;  3AMZ A;  4ZHO A;  1HEZ E;  4JX1 C;  1FD6 A;  1P7E A;  1FRD A;  3U52 E;  2IGD A;  2WXL A;  1ROE A;  1VZ8 A;  3LXF A;  1FNV A;  5HG2 A;  2PTL A;  3AE7 B;  3AEA B;  3E56 A;  2GB1 A;  2KN4 A;  1B1Z A;  1NYR A;  1TKG A;  1ZXH A;  3BYY B;  3ZJV A;  3T3N A;  3BK1 A;  3EA6 A;  2VZK D;  5FKA C;  3AE8 B;  1ACC A;  1QQR A;  1WSP A;  4A90 A;  4M0W A;  1K50 A;  2MJE A;  2Y3A A;  3SR6 A;  2WDV B;  3W5U B;  3RPF C;  3AM9 A;  1QOA A;  1UNS A;  4ZRP A;  1SJH D;  4A8X C;  2SAK A;  1E6E B;  3P4P B;  1I7H A;  1T6B X;  5BMG A;  4N6E B;  2WLB A;  2WQY B;  2IGH A;  1IGC A;  1UUP A;  2NTS A;  1BXT A;  3PO0 A;  4JWU C;  4WQM A;  5BYS A;  2WXK A;  3AN1 A;  3GS2 A;  1ZOY B;  2NMQ A;  1E10 A;  2KDM A;  1FXI A;  1PGB A;  2LEK A;  1SXT A;  1I4Q A;  3Q8E A;  1RFK A;  2N9K A;  2WDR B;  3WCQ A;  4AS1 A;  2I2Y A;  3Q8C A;  2WXG A;  2EKI A;  2AQ1 B;  1YMH E;  4C80 A;  3B2G A;  3U4E G;  1N61 A;  1L0X B;  2ZW1 A;  5FK9 C;  3T3O A;  4XDD A;  2WXO A;  1EU3 A;  4ZYS A;  3BVM A;  2BTE A;  5JXV A;  4LLG M;  3ZQ4 A;  1N5W A;  2KAC A;  2JXT A;  2XNA C;  4ZRQ A;  3VR8 B;  3E9S A;  4NJC A;  3AE1 B;  1DOI A;  2GRI A;  1QOF A;  1WRI A;  1FO4 A;  2L1A A;  2V0G A;  4MM3 B;  1UWM A;  1TY0 A;  2QJL A;  2K0P A;  4YTN B;  3AE3 B;  1V1P A;  4OZA A;  4TSS A;  2R61 A;  1RYJ A;  3LB8 C;  3FIL B;  1TS3 A;  1F2R C;  3AEF B;  2YEP F;  3MFG A;  1C9F A;  1SE2 A;  1A70 A;  1PGX A;  3TEW A;  1MI0 A;  2LMC A;  1TZO A;  4OZC A;  5AUK A;  3EUB 2;  2VZK B;  4ZHP A;  4C7Z A;  1NI3 A;  2K22 A;  1FNW A;  4IDI A;  1QKZ A;  2KAJ A;  2BW2 A;  2L32 A;  4FXC A;  2IPK D;  3OWE B;  2K5P A;  3NVW A;  1N63 A;  2E6X A;  1V97 A;  3HRD D;  4TQ1 A;  3B9J A;  3P4S B;  5G5G A;  1PFD A;  3HVZ A;  1JWM D;  1MHX A;  1RWS A;  3PZ7 A;  3VRA B;  5LNK 1;  1GAQ B;  1SE3 A;  3UI3 A;  1HQR D;  1YN3 A;  1MHH E;  4USA A;  1QIL A;  1MPE A;  1C79 A;  4R3D A;  2QIL A;  2MEK A;  4HKZ E;  3MC0 B;  1VZ6 A;  4J3O D;  1L6V A;  1XO3 A;  3TSS A;  4MAC A;  3AV8 A;  1L0V B;  2WXM A;  4AQ7 A;  4DQO C;  1L4D B;  1EU4 A;  5C2T B;  2RDG A;  2X38 A;  3SFE B;  1JWU D;  4JPS A;  2FBW B;  4HEA 1;  2WP9 B;  4TMA B;  1IGD A;  4XWT A;  4MT5 A;  1SBB B;  1D6E C;  2H89 B;  1C4P A;  1HZ5 A;  4L23 A;  1JRP A;  1RM6 C;  1TS5 A;  4DXF A;  1F77 A;  2ICI A;  2E3T A;  2V3P A;  2IGG A;  5G5H A;  3R8B A;  3TUO A;  1PUT A;  2INP E;  2BYT A;  5D3D A;  2MJD A;  3KWL A;  1GOZ A;  1NEK B;  2LJI A;  2EEL A;  2J52 A;  2IDY A;  4NZL B;  3TEY A;  2LGI A;  3P4Q B;  4CQN A;  2MH7 A;  1D5Z C;  3W2D A;  5HHD G;  2DWQ A;  2NTT A;  2GI9 A;  2JQR B;  3KLS X;  3NRZ A;  3Q8F A;  1C77 A;  1ZUD 2;  1I4G A;  4L2Y A;  5HFY A;  1T3Q A;  3Q8B A;  3AE6 B;  4ARC A;  2QMT A;  1E9M A;  1I4R A;  2XN9 C;  5BMI A;  2H88 B;  1ET9 A;  3AE4 B;  4KGR A;  1OQR A;  4US9 A;  1FXA A;  3C8Y A;  4RGM A;  1J7B A;  4HRO A;  3W1S A;  1TKY A;  2PLP A;  1ZDV A;  3TEX A;  3NZ3 A;  2N7J A;  3GB1 A;  3ABV B;  2CJO A;  3AEB B;  2PVG C;  3BVZ A;  1AN8 A;  3AE9 B;  3NVV A;  1LO5 D;  1JRO A;  3AED B;  5C3J B;  1E0Z A;  1C76 A;  1L6U A;  3HUI A;  3I9V 1;  3BZD B;  2JZP A;  1QOB A;  2V4I B;  2WXI A;  1AYF A;  3U7Z A;  1XLN A;  2JWU A;  1DGJ A;  3TEZ A;  1DOX A;  1N60 A;  3DWM A;  3BYT B;  1L0Y B;  3KQ4 A;  4ARI A;  2WXN A;  3DWG C;  3AE5 B;  3SFD B;  3BVG A;  1T5X D;  5BMH A;  2PW9 A;  3AB5 A;  5I4D A;  3GP7 A;  1KF6 B;  1SF0 A;  4KKJ A;  4YSY B;  1FFV A;  2IJ0 A;  3FC4 A;  4RGT A;  3NUH B;  3P4R B;  3HVD A;  2MJ3 A;  1K51 A;  1UGJ A;  3IAM 1;  2AQ2 B;  1CK1 A;  2L52 A;  5EE1 A;  1ZP0 B;  1B9R A;  1JWB D;  3IXS A;  1P7F A;  1ZXI A;  3PZ8 A;  2CU3 A;  2AQ3 B;  1KH0 A;  1Q10 A;  1ZDX A;  1FFU A;  1D5M C;  4OZB A;  1SB3 C;  2INN E;  4UDU C;  4REZ A;  2FUG 1;  4C7Y A;  2M56 B;  4ITK A;  4JE3 B;  1VZ7 A;  2J4X A;  2DYM A;  1IUE A;  2WXH A;  2B76 B;  4HRS A;  3AEC B;  1NVI D;  3N9Y C;  1KLU D;  3V05 A;  2PVO D;  1KFY B;  2HDE A;  1TKE A;  4N59 A;  2K3U A;  1MVK A;  5H8Y E;  3FIL A;  4NAW B;  1WGK A;  3SEB A;  2WXF A;  2BBC A;  4XE0 A;  4YSZ B;  4LK0 M;  2JYE A;  2BS2 B;  4GLS C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...