2N9LA

1h, 13c, and 15n chemical shift assignments for in-cell gb1
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
57
structure length
57
Chain Sequence
MGTYKLILNGKTLKGETTTEAVDAATAEKVFKQYANDNGVDGEWTYDDATKTFTVTE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Immunoglobulin G-binding protein G
publication title Improved in-cell structure determination of proteins at near-physiological concentration
pubmed doi rcsb
source organism Streptococcus sp. 'group g'
molecule tags Immune system
total genus 14
structure length 57
sequence length 57
ec nomenclature
pdb deposition date 2015-11-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01378 IgG_binding_B B domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.10 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 2n9lA00
5HI1A 1EM7A 1YMHE 2KQ4X 2GB1A 5BMIA 1IBXB 5BMGA 1HZ5A 2LUMA 1MHHE 2QSDA 2ZW0A 2JSVX 4KGRA 5BMHA 2LHDA 2ON8A 2IGHA 1IBXA 1K50A 1YNTE 1MHXA 1XCTL 1PGAA 1FCLA 1XCQL 4MACA 2J52A 1MPEA 2KDMA 2ONQA 2KACA 1MI0A 2N9LA 4D2KA 1HZ6A 1Q10A 2NMQA 2K0PA 1IGCA 3FILB 2N7JA 1FD6A 1K53A 1PGBA 2PLPA 2GI9A 1KH0A 2I2YA 4OZBA 1F2RC 3FILA 3GB1A 2QMTA 2I38A 2ZW1A 1QKZA 1PGXA 1ZXHA 2KWDA 2OEDA 2LHEA 5HFYA 1IGDA 4IKGA 1JMLA 4OZCA 1MVKA 1K52A 1GB4A 1F2RI 1HEZE 1K51A 2PW9A 2JXTA 2N9KA 3V3XA 2RPVA 2KN4A 2RMMA 3UI3A 2EELA 2IGGA 5HG2A 1XF5L 1D4BA 2IGDA 1GB1A 5HHDG 3MP9A 2J53A 1P7EA 1UWXA 1C9FA 2PTLA 2JZPA 4OZAA 1FCCC 4HJGE 2JWUA 4IOIE 4KGSA 2LGIA 4KGTA 4HKZE 1P7FA 4GLSC 4WH4A 5JXVA 2JU6X
chains in the Genus database with same CATH superfamily
2BQQA 2J0KA 3PZ8A 4IWPA 3VTUA 3QJZA 2D10A 2ICIA 1P0RA 1VLBA 4WJOA 1H4RA 3KWVA 1SE4A 1TZ1A 1MHHE 4EOYA 2HJ8A 4BVUC 5AUKA 2ZPNA 1GUAB 4KIKA 2WXNA 1RWSA 3IBEA 4RF0A 3TEXA 4K1RB 4JX1C 2NTTA 4M8MA 2FCMA 3ZO5B 1XEEA 3UQAA 2BYFA 3WAPA 1C4PA 4WJPA 1L6UA 2DAJA 2D2QA 1AN8A 3KUCB 3C19A 1FO4A 1F0ZA 2LVOA 4PYUA 1XQQA 3DBHI 1QZEA 2MX2A 4WWNA 2ZEQA 2G4SA 4F8CB 1L5PA 3FILB 2W55A 1D6EC 5KHOA 3ZUNA 1GOZA 2BGFA 3AEGB 2V4LA 2KVRA 5G2NA 3QAQA 3DCGA 5AZHA 4XX5A 2JVCA 2N7EA 4WURA 5EE1A 3W1YA 3L16A 3PV1A 4MELA 3N1ZC 4L2YA 3OJ3A 2QC8A 1QOBA 2KJHB 3ZW3A 4HKQA 2I38A 4MH0E 2MWSB 3Q6BA 3VHTC 5J2RA 1ZGUB 3TSSA 3AE2B 1L4ZB 2GMIC 2LXAA 1VRAB 1V81A 1K51A 4LK0M 2WXGA 4II2B 2D3CA 4ANVA 2NBUA 3QK0A 3UI3A 4MGIE 3GE3C 2KWVB 2KYWA 2D3AA 3NVYA 3TEWA 1XLPA 4GXBA 4G11A 4DHZE 3A9JB 2V9HA 4TSSA 1BT0A 2MJEA 3AE5B 1LM8B 3AM9A 3LDZE 2RD0A 1ZOYB 1L0XB 3PO0A 3DHIC 1WYGA 1E0ZA 3QARA 2LFIA 2KQ4X 5TSSA 1JQ4A 1IBXB 1DOIA 1SB3C 3MFGA 4LNNA 4LDTD 3O13A 2WXQA 3W5VB 4HEA1 4GU2A 3PHXB 1E7PB 3ZXRA 2PEAA 1TJEA 2L00B 4GDKA 3Q3MC 3RZFA 4KKJA 2KDEB 2RDBC 4NPNA 2MP2A 3BZDB 2INPE 4DQOC 4IDIA 1I42A 2KD0A 1PGBA 4I6NB 2GI9A 3Q3JA 4WAAA 3GZNB 3Q3OC 4OVVA 5GMVA 3HVZA 3U4EG 3UIPB 4TKNA 2XN9C 5LXIB 4OZCA 2V1YA 1WMHB 1MG4A 1EWYC 1N5WA 3A4SC 2CS4A 3RNBC 2RPVA 2WP9B 3KH0A 4FJYA 4XWWA 3Q3FA 2EMTA 2LJIA 3MJ5A 1B1ZA 3ONSA 1I4XA 4ZYSA 4K7WA 3Q8EA 2W9NA 5HHDG 4FHKA 4AWJA 3DBRB 4EKUA 1WGYA 2IO2B 1E7VA 4S0RA 1WSPA 2D3GA 2K8CA 4W9GA 3L10B 1C3TA 1EF1A 4XDDA 1WJ4A 2IO0B 4A6QA 4TUUA 2BWES 2JU6X 4PYZA 3H9DA 3ZDMC 1SGHA 1MJDA 1WXVA 2OHFA 3A9KA 3O65B 5AZFA 3P4SB 2KFJA 3AN1A 4DK5A 2V4IB 3ZGZA 1VCBA 1WI0A 2MA9B 3KVFB 2IGHA 4P1CC 4R3DA 3EGRA 4ZHPA 1C4AA 3RULA 2K25A 4YTNB 4C80A 2K39A 3CSFA 1FFVA 2FCQA 4HDOA 1E6EB 1HE8A 4BFRA 4OVUA 2WDQB 3W9CB 2WU5B 1EU4A 1XXGA 4C7ZA 2MBBB 2WQYB 4GIVA 2CHXA 4B0MA 1Z5SB 2WXFA 2NPTA 3GP7A 3H6NA 4WQOB 1FD6A 1OEYJ 2PLPA 3BVMA 1RFAA 2BW2A 2BVCA 3NVWA 1JWSD 1YJ1A 2ZW1A 2MH7A 1UD7A 2LD9A 2R61A 4DHZB 1V2YA 5AEKB 4KKIA 3NZ3A 1P9DU 1WXAA 2V3PA 2RR9A 2L7RA 2KMCA 4L23A 2CHWA 2M4NA 2JZZA 3OLMD 2H88B 4JIOU 1KTKA 4S17A 4W9IA 1YN3A 5EE9A 3Q8FA 3QIJA 1SJHD 2K1FA 4M01A 1AARA 3ZDTA 1V1PB 5D2MB 4OZAA 1XLNA 5LNK1 4BZAA 3HK0A 3P63A 4O1NA 4KDIC 2PIAA 2W3RA 4FJVB 3W1SC 2J4XA 3A1QA 4CHKA 1Q1OA 4C4VB 4GMVA 2QSDA 4ANUA 4F7ZA 3TUOA 4FJZA 4WJNA 3V05A 3DBRI 2KTRB 3RPFC 5IO9A 5TR5A 1KOTA 1A70A 2AEHA 3DBSA 2ZJDA 3DHHC 4JGHB 1JRUA 2DWQA 2MRPA 3S2AA 2FCSA 3ALBA 1XO3A 1C1YB 3L08A 1VZ6A 1SJED 2ONQA 1RYJA 4EZKA 1S1QB 1EF5A 2N1WA 2WXKA 2EMSA 3BVGA 2QIEB 4LJOB 4WWMA 1TS5A 4NZLB 3L0WB 2VH2A 2WXMA 4LCDE 3ENEA 3IAM1 3NVVA 3K9OB 2J0JA 4OZBA 3GB1A 3AE1B 2LZ6A 5H8YE 3RNCC 1YJIA 1TS4A 2GRIA 4GDLA 2I1JA 1J0GA 1JMLA 1WGRA 1D5MC 2NR2A 3U7DA 3TEZA 1AYFA 1L6VA 1HEZE 2K6DB 2KX0A 3PRPB 3CIRB 3NS8A 3AH7A 4A3PA 1E5WA 4J3OD 4E3CA 4DXGA 2M17A 1YQ3B 4WWOA 4EZLA 2MHJA 3DVNV 2KX3A 3I63C 2REXA 2IGDA 1TYGB 3ZVVA 5BYSA 1P7EA 4HPPA 1SSNA 1XLOA 1WJNA 2BS3B 3N9YC 4QAYA 3GOEA 1GAQB 2AQ2B 4MJSA 3IXSA 2QJLA 1WRIA 4RCOA 1DYQA 2DZKA 2WXOA 3PRMB 5EDSA 1AWDA 1ET6A 2JRHA 4IWOA 1VD2A 1I4GA 4HXDA 3H1UA 1I4HA 4DHJD 1FPYA 4KVGB 4XGAB 2HE7A 2MJ3A 2JYTA 4ZRIA 1WGGA 3NJTA 4BKSA 4M0WB 3RD2A 2UU7A 4IG7B 2L76A 4OW0A 1UGMA 5E6JA 4PS8A 3A33B 3AEBB 3LYYA 4BOSC 4XC2A 2E3TA 1CK1A 1NDDA 2K8HA 2DZMA 2WHIA 1ACCA 1FXAA 2FBWB 3P1MA 3APDA 4LNOA 4ZRPA 2L8JA 1P98A 3H7PA 3ZLZA 1EWCA 4YSXB 1HTOA 3AI5A 2LVQA 3PS6A 1M94A 3OWEB 4EE2A 5C1ZA 1B9RA 5EE0A 2WU2B 3DOWA 3A4RA 1ISNA 1R7SA 2QDFA 3BINA 2G3QB 2FIFA 1V5OA 4I6PA 3QWZB 1VJKA 1BXTA 4FN2A 3VRAB 1JWUD 5G5HA 3N3KB 1HQRD 2ZCCA 1V1OA 3QHTA 1EM7A 4HK2A 2M8SA 2JY6A 1EUVB 3U30A 3DVGY 4RM8A 3W2DA 1NEKB 2PVOD 1V49A 3R3MA 2A4ZA 4MGYE 1K8RB 2OJWA 2PE9A 2WX0A 4B95A 2KDBA 5J18A 2PJHA 3LJ3A 2AL3A 1S3SG 2NMQA 2L1AA 4RGMA 2WX1A 2L52A 5FR6A 3ECIA 3Q8CA 2PKOA 2YLMA 2VZKD 3GS2A 2D3BA 3TL5A 1KH0A 4HDQA 1L0YB 4TV3A 3HM3A 3PT2B 2BF8B 3TBLD 3ZXVA 5BO4B 2OEDA 2BKFA 4NQLB 2XBBC 4ASWC 3U2SC 1TIFA 2OJRA 5D7GA 4ZYNA 4K7UA 3V6CB 1Y56A 2VZKB 2VRRB 1CQVA 1FXIA 4OHJA 1R4MB 2LGYA 1T6BX 1Q5WB 4DDID 4EFOA 1XF5L 4RH6A 2MBOA 3WAMA 4PK1A 1I35A 5I4DA 1UWXA 4WWPA 4HWIB 4A20A 1FCCC 4KGSA 1V9JA 1YX5B 1TKEA 1GG3A 3AU4A 4RGOS 3BWUD 1FXTB 3OG5A 4ANXA 1KLGD 2IO1B 1WJUA 4IM0A 2J0MA 1C78A 3V60A 3AE8B 1OFFA 1DOXA 3X23A 1UH6A 1ZP0B 4Q2JA 2L0FA 1WJ6A 2IPKD 2HD5B 2TSSA 2LHDA 3KUZA 1HXYD 2CKHB 3ZRCA 3QX1A 4MACA 1WXQA 1YOVB 3WCQA 3UIOB 5FKAC 4BKTA 1E8WA 4RGTA 1YIWA 1FM0D 1KM7A 2GOWA 1V97A 3NG0A 4YSYB 3AECB 3L54A 5CHFA 4ITKA 2K0PA 4W9JA 1JCKB 5T8IA 3TIXA 4YSZB 3RNGC 2I2YA 2WDVB 2NBVB 2R2OA 1WR6E 3KUDB 2DHZA 4MSQB 4B6WA 2AYOB 1KRHA 4LDTB 2JQRB 1KLUD 4DXAB 1JALA 2DAFA 2FIDA 1FIQA 1JWAD 2Y3AA 3AE7B 1SE2A 1XT9B 1F52A 4LLGM 4GSWA 2KFKB 3NZSA 4I6LB 2ZVNA 2LMCA 5HG2A 4FXCA 4IWQA 1E8YA 4HROA 2W82A 2E6XA 1WM3A 1ZXIA 3TCAA 3R8BA 2N0SB 2KHWB 1TKGA 4HJGE 5AZGA 2FE8A 2GBMA 2LI5A 1R4MI 1EU3A 5HI1A 1HA5A 4N59A 5BMIA 3RT3B 2C5LC 2X8XX 4WAFA 1WR1A 4NJCA 3ETRA 1D5XC 1DGJA 2C60A 2EKIA 1UGJA 5BMHA 1RRBA 4ZRJA 3SEBA 3URYA 2ON8A 2N9EB 2KK8A 1V80A 1XCTL 3PZDA 3ZQ4A 2WNMA 3PVLA 1ZW7A 2FUHB 1ET9A 2WDTB 2WXIA 3VTVA 3MHSD 2BPSA 2O6VA 3FKYA 2HTME 3CSTA 1MI0A 1E10A 2WS3B 3RUIB 4NJ7A 2LRUA 2DENB 4LNKA 5CHWA 3AMZA 2JYEA 4WQMA 4NY0A 2JPHA 3RN9C 4MT5A 3NZUA 3VTWA 4HJKA 3T3NA 3LB8C 1QKZA 2LHEA 5HFYA 1FRRA 1WX9A 2UWQA 2VH1A 3IT6B 2N9KA 2AQ3B 5D3IB 4W9CA 3DVGX 1N63A 4B9KA 3BIID 3RNFC 2EELA 2KLGA 1VDVA 3JSVB 4YL8A 5LLIA 2BYEA 2NBWB 3N30A 1YN4A 3N1XC 4CYEA 4IOIE 3EECA 3RMKC 4N9F4 1KF6B 2DYOA 4GB9A 4KIKB 5FR3A 3EC8A 2KOXA 2AX5A 3QA8A 2O2VA 3MJWA 3SD5A 4C00A 1UWMA 3AULA 4YTPB 1ZKHA 2G1EA 4FHJA 2MSED 4USAA 2G9HD 2KO3A 3C8YA 2ZW0A 3ZRFA 2GBKA 2KNBA 1IUEA 3J9CA 2KQSA 4KGRA 4K3BA 4C7YA 1T3QA 1H8CA 2JX5A 1NBFC 4IM2A 2BTEA 3Q69A 2KVZA 1PGAA 2KXJA 3BYYB 4K7SA 2NCNA 3KQ4A 1QT9A 2SAKA 5DPRA 1ROEA 2KACA 5GXGB 2JUOA 3CF6E 4MGKE 2AWTA 4GGQA 2K3UA 2LJ5A 1A5RA 2CHZA 3DWGC 3ZYYX 4W9EA 4JWSC 2J7QB 1D3ZA 3FILA 2L32A 3TEYA 1TTNA 2LGDA 4C56C 1WRDB 1WGDA 2Y5PA 1N62A 1WH3A 2Z0DB 3R2IA 4II3B 3APFA 5IKCM 5E6NA 4HPLB 2GBNA 2KN5A 2C7MB 4W9LA 4J6IA 2IY1B 1SE9A 1RAXA 4YWGG 3ZTDA 1KLVA 3VUXA 4EZJA 4DWFA 4RFBA 3WALA 4MM3B 4G50A 1OEYA 2LGIA 2FNJB 4HVBA 1TY2A 2QEJC 4IM3A 2N9PC 3W1SA 3A9JA 1ZE3D 3P2BA 2BKRB 1UELA 2KDIA 3WIMA 2BYTA 1TBEA 3RYTA 2XK5B 3QQ8B 1I4RA 3OAWA 1VZ7A 3AE6B 1CJEA 1NI3A 3L13A 3H8HA 3M3JA 3VVWB 1TT5B 5JHAA 2MP2B 1IBXA 1C79A 3RZWC 1V6EA 2CJNA 1KJTA 1VR9A 2MJDA 1PFDA 2B76B 1AW7A 1MPEA 3JYUA 3RNAC 1D5ZC 3MTNB 4NAWB 2JWZA 1CMXB 3Q14C 4DXFA 5DPWA 3SU8X 1HZ6A 2DNFA 3W5UB 4ZHOA 3U7ZA 1LQBA 4TQ0A 2PPHA 4ICUA 1YQ4B 1TGZB 4HLEA 1OQRA 1SE3A 4M02A 1UF0A 1J7AA 2WXLA 4XE0A 2DYMA 2KC2A 2L05A 2PVGC 2J42A 1GC6A 4NJ6A 2DX5B 2KWDA 4BBNF 2K22A 3RFZB 4ANWA 4ZOHC 2INNE 1F2RI 1RLFA 4TMAB 1YD8U 3PLUA 2Y5BB 1E90A 4DHJB 4AJYB 4DDGD 2HJ1A 1E8ZA 1WY8A 3TMPB 1WMHA 1JROA 3ZKJC 3UF8A 3MP9A 3NS1A 4A8XC 2WXPA 5KHQA 1BUIC 3VQIA 2NVUI 2Y5CA 2LUEA 4W9DA 4HCPB 3A9KB 4A90A 2V3NA 4HKZE 1TZOA 3SR6A 3RCZA 3I9V1 4GLSC 2LXCA 2PMVA 2JT4B 1YMHE 4A55A 2GBJA 2X38A 3NVZA 4L1BA 3AV8A 1IYFA 3B2FA 3V6EB 4E74A 4BOZB 3AXCA 4PS7A 1MG8A 3HHMA 1GNUA 1WX7A 5E6OA 4NQKE 2IO3B 5D94A 1PDXA 3VUYA 1IP9A 2NPTB 4BKGA 1TY0A 5C23A 2KQ7A 3HIZA 4W9KA 1WZ0A 1C77A 2AL6A 3T9LA 1WIAA 1E7UA 3ML8A 1QOAA 1QLBB 3DVNU 4RGNA 4WJQA 1GC7A 2ZNVB 2KZRA 3VH4B 1MFWA 1UZXB 4KSLC 2M0AA 3UGBB 1WGHA 2EKEC 2L0TA 1ZPSA 4XWTA 3SFDB 5JH5C 1F2RC 2JXXA 3AU5A 3D32A 2Z0EB 4AOFA 2H89B 1GB4A 2KLCA 1KFYB 1WX8A 2N7DA 1V86A 4WIPA 3WA0A 1GPXA 2HDEA 5CHVC 1Y8RC 3HVDA 1V8CA 4JWUC 1L4DB 5AUIA 2BS4B 2ASQA 3ZJTA 1FNWA 2A5UA 3MHZA 1TKYA 3X0WA 2B3AA 3BY4B 4PS3A 3SFEB 2PTLA 1T5XD 5J17A 3A1QB 2JWUA 2MQJA 4F1SA 2CU1A 4FULA 3ZNHB 3UQBA 3VUWA 2C9WB 1V1PA 3I3TB 3B2GA 1E8XA 3KLSX 2NS5A 2N4FA 3VR8B 2K5PA 1WE6A 3AEEB 3PZ7A 3NOBA 2QHOA 3LXFA 4M00A 5D6JB 4BBNC 3EFUA 4C4VA 4XYCA 2Z8LA 4JE3B 1LFDA 1LO5D 1WGKA 2IY0B 2J52A 2KTRA 5D3DA 4ARCA 1NYRA 3M63B 1Q0WB 4P6VF 2LGXA 2N9LA 3VRBB 3PPAA 4REZA 1WZ3A 1UNSA 2W3SA 3M62B 3Q3NC 5CX3A 2D5GA 3DHGC 4GDLB 5JHBA 1V5TA 4A9AA 3WAOA 3HM6X 3NY5A 4XDCA 4LTUA 4MDKE 2RSUA 3EUB2 5C2TB 1J19A 2DBYA 2KTFA 1WF9A 1XD3B 4IC7B 1SF0A 1ZXHA 2WXJA 2M1MA 1XLQA 3AE3B 3NUHB 1QOFA 1IGDA 1F77A 2N1VA 2D07B 2JRIB 3C0RB 5L95C 1NYQA 3PSEB 2INDC 2IBIB 2I1KA 1J8CA 2MCNB 2MW5A 4MM3A 3BVZA 1E9MA 3U52E 2IJ0A 1Z2MA 4LNFA 1OQQA 3DBLI 1EO6A 2LVPA 3VFKA 3L17A 3P4RB 1N5XA 3ZJVA 2JZPA 4MJSB 1YJJA 1C4CA 3UINB 1SEBD 4BKSD 2KAJA 5DPTA 4WH4A 2XK5A 1N60A 2C7NB 4FLHA 2AQ1B 1F1HA 2RDGA 3RNEC 5IP4D 3BK1A 1QILA 4W9HA 1DOYA 2JSVX 3NRZA 1C76A 1YQBA 1GJZA 4XZ4A 1I4PA 1L2NA 1K50A 4KZCA 1FNVA 4NAWA 5DPSA 4FA6A 4K81A 1STEA 3MC8A 5CTRC 2LWPA 2KDMA 1I4QA 5FK9C 1G6JA 4ZRQA 3P42A 4JLCA 1UBIA 1IGCA 4KSKC 2N9XA 1J7CA 4YTMB 2M0XA 3WANA 1FNUA 1K53A 3M95A 3I5JC 3H7PB 4M0WA 1SIFA 4M8NA 4MH8A 4X57B 5E6PA 3Q8AA 2ZNVC 2KANA 4P1BC 1HTQA 4HRSA 1F9JA 2IZVB 3IT4B 3VR9B 4FADA 4N58A 1WFYA 1YX6B 1PQSA 2PW9A 1JWMD 2V3SA 2L3ZA 3PREA 1JWBD 3P4PB 3DWMA 2BYVE 1IPGA 4PT5A 1GB1A 5BYRA 1QQRA 3MC9A 2GBRA 2WLBA 1OQYA 1P7FA 4KV2A 4RF1A 4KZ0A 4KDLB 3PGEA 3L4PA 5BYQA 2UYZB 2BT6A 5BMGA 3V62A 2RGFA 1J7BA 2ZCBA 3BK2A 2W54A 3PTFC 4GN1A 2M56B 3K9PB 4DBGA 3OJ4B 3MC0B 1VZ8A 1FFUA 1XCQL 3QC8B 2WWZA 2BBCA 3KYCD 1WE7A 3IG3A 4IW0A 2V0GA 2WXRA 4D2KA 2YEPB 4CO7A 1P1AA 1WM2A 4ARIA 4OVZA 4EEWA 1ESFA 1QOGA 2K8BA 2N7JA 3AB5A 5IOIA 1T0RC 4A3OA 4URKA 3VDZA 2MLBA 2KKCA 1WWTA 3T3OA 3GZNI 2DYBA 2HTHA 3ABVB 4JL9A 1T0SC 2SEBD 3ZNGC 3PHWB 2IYDB 2KJ6A 4BAXA 3V61A 3B9JA 1OGWA 1U4AA 4ZDVA 3E9SA 2FCNA 1QF6A 3HUIA 2IGGA 3Q2AC 3FAHA 1TS3A 3TJPA 2WGSA 2QILA 1RFKA 1C9FA 1NVID 2YEPF 3CWIA 3VH3B 1NENB 3APCA 1R4NB 3DDCB 3R7QA 2KC1A 3I57A 2ZVOA 3GE8C 2GB1A 2CJOA 2ZZPB 5H92C 1M4VA 5G5GA 5L83A 2JZ3B 4MSMB 1P3QU 3CMMB 3EHVA 3NHEB 4US9A 3AE4B 4YXDB 3ML9A 2ACZB 3RI7C 2K6QA 5C3JB 3N20C 2G4DB 2Z59B 2YVCA 4UDUC 1MHXA 1T0YA 2FUG1 1WXSA 4GOCA 4W9FA 2XNAC 3B1LX 1WYWB 2FAZA 3N1YC 4HCNB 4AJWA 4GDKB 4MEMA 1PUTA 1Q10A 4RNAA 3AE9B 1OTRB 3IFWB 4KX6B 1YN5A 4RMAA 1SBBB 5IAAC 2WXHA 1BMLC 1L0VB 2QMTA 3EA6A 3KW5B 1K52A 3JW0X 5JZEB 1ZDXA 4US8A 2CU3A 2BS2B 3VAWA 5G55A 3V3XA 2KN4A 1L7YA 1ZDVA 3BYTB 2DZJA 4CQNA 1SIJA 2QCZA 2IDYA 3IVFA 1CZPA 3FC4A 1JRPA 2LGSA 4JPSA 4JQWC 4LNIA 1D4BA 1TS2A 3HRDD 3R66C 2CR5A 3DQVA 2J53A 3N32A 4ACFA 2KJRA 3B08A 2KFKA 4LJPB 2LEKA 1UUPA 3VXWA 1SXTA 4KGTA 2O6VD 1NI2A 3ZNID 2KT7A 1FMAD 2BWFA 5JXVA 4ZRKA 4NAMA 2RPQA 4NNJB 2BB6A 3DPDA 2DLBA 1HZ5A 2KDFB 2JF5A 2KMAA 2LASA 3DBHB 4G3XB 2LUMA 3R2TA 3P4QB 3IAS1 5LXHA 3PLVA 3B0AA 1N61A 2O6VB 4EUTA 5EE3A 2MBEA 1YNTE 2MEKA 3R7RA 1RM6C 5IA7A 1ENFA 1FCLA 2WYQA 3PRZA 5DCNA 1R4NI 1ZUD2 4H2AA 1I7HA 3AEDB 3ZIMA 2C7HA 2RDHA 1FRDA 2MBHA 3AEAB 3ZNZB 1UBQA 2Q5WD 1N6ZA 2L83A 1PYWD 1JW9D 2XEWA 1WXMA 3ZTCA 5HKHA 2KWUB 2K9XA 2BB5A 2INCC 2G45B 4HPMB 2NTSA 4P16A 3SDLC 2OOBB 1LXDA 3H7SA 2WDRB 4E71A 3U8ZA 2ZPYA 1PGXA 4N6EB 2MBQA 4IKGA 4B0EA 1MVKA 1LGRA 4YT0B 3Q8BA 2LRWA 3SHQA 2JXTA 1FEHA 1T0QC 3EFCA 3KYDD 4K3CA 2PE6B 3JVZX 3E56A 2RMMA 1X1MA 2KWCA 5IN7A 3DBLB 3ZJUA 4IUMB 4TQ1A 2DZIA 3QCAA 4RM9A 4G0NB 4AS1A 3IHPC 4ICVA 3AEFB 3KWLA 2GLSA 2R2QA 5MPOA 2D11A 2M19A 4AUQC 2O2VB 3T8MA 4FBJB 4MGZE 2KMMA 4P7IA 3JSVA 4AP4C 4AQ7A
chains in the Genus database with same CATH topology
1GAQB 2AQ2B 5FR3A 3PZ8A 2AX5A 2AQ1B 2RDGA 3IXSA 2QJLA 1WRIA 2ICIA 1VLBA 3BK1A 1QILA 1UWMA 4YTPB 2G1EA 3KWVA 4RCOA 1SE4A 1DYQA 1MHHE 2WXOA 4USAA 2G9HD 1AWDA 5AUKA 1DOYA 1ET6A 3C8YA 2ZW0A 1IUEA 3J9CA 2JSVX 3NRZA 2WXNA 1RWSA 1C76A 4KGRA 4RF0A 3TEXA 1I4GA 1I4PA 4C7YA 1T3QA 1K50A 2JX5A 4JX1C 2BTEA 1FNVA 1I4HA 3Q69A 1PGAA 3BYYB 2MJ3A 2NTTA 1STEA 2JYTA 1XEEA 3KQ4A 1C4PA 1QT9A 2SAKA 1L6UA 1ROEA 2KDMA 1AN8A 1I4QA 2KACA 5GXGB 5FK9C 1FO4A 1F0ZA 4ZRQA 3P42A 1IGCA 1L5PA 4OW0A 3FILB 1J7CA 2K3UA 2W55A 1D6EC 5E6JA 4YTMB 1GOZA 1FNUA 1K53A 3AEBB 3AEGB 3LYYA 2E3TA 1CK1A 3DWGC 4M0WA 1ACCA 3ZYYX 4JWSC 4WURA 1FXAA 5EE1A 2FBWB 4MH8A 3FILA 3P1MA 4L2YA 2L32A 3Q8AA 3TEYA 1QOBA 4HKQA 4C56C 2I38A 4ZRPA 3TSSA 3AE2B 2Y5PA 4HRSA 1L4ZB 1EWCA 4YSXB 1N62A 1VRAB 3IT4B 3VR9B 4N58A 1K51A 3R2IA 3OWEB 4LK0M 4EE2A 2WXGA 1B9RA 2PW9A 1JWMD 5EE0A 2WU2B 3UI3A 1JWBD 3P4PB 3DWMA 1R7SA 4PT5A 1GB1A 4YWGG 5BYRA 3NVYA 1QQRA 3TEWA 4RFBA 1XLPA 4MM3B 2WLBA 4TSSA 1VJKA 1BXTA 2MJEA 3VRAB 1JWUD 3AE5B 2LGIA 5G5HA 1P7FA 4RF1A 3AM9A 1ZOYB 1L0XB 3PO0A 1HQRD 1TY2A 2QEJC 1WYGA 1V1OA 1E0ZA 1EM7A 3W1SA 1ZE3D 2LFIA 3L4PA 2KQ4X 5BYQA 5TSSA 1JQ4A 2BT6A 1IBXB 1DOIA 5BMGA 1J7BA 1SB3C 3MFGA 2BYTA 3O13A 3BK2A 2WXQA 3W5VB 1I4RA 1VZ7A 2W54A 3AE6B 1CJEA 1NI3A 4HEA1 1E7PB 3H8HA 2M56B 1NEKB 3W2DA 1TJEA 2PVOD 3MC0B 1IBXA 1C79A 1VZ8A 1FFUA 1XCQL 2CJNA 1VR9A 4KKJA 2MJDA 1PFDA 2B76B 1AW7A 2BBCA 1MPEA 1D5ZC 4NAWB 2V0GA 2WXRA 3BZDB 4DXFA 2INPE 4D2KA 4DQOC 4IDIA 2YEPB 4ARIA 1HZ6A 2NMQA 4RGMA 2L1AA 3W5UB 4OVZA 1ESFA 1QOGA 4ZHOA 2L52A 3U7ZA 2N7JA 3AB5A 4TQ0A 3Q8CA 2PKOA 1PGBA 2VZKD 3GS2A 1YQ4B 2GI9A 1KH0A 1OQRA 1SE3A 1WWTA 1J7AA 3T3OA 1L0YB 2WXLA 3HVZA 3U4EG 4XE0A 3ABVB 2DYMA 2PVGC 2J42A 2KWDA 2OEDA 2XN9C 2SEBD 2K22A 4OZCA 3RFZB 3U2SC 4ZOHC 2INNE 1N5WA 1EWYC 1F2RI 4TMAB 5D7GA 1Y56A 3B9JA 2VZKB 1CQVA 2RPVA 1FXIA 2WP9B 4OHJA 3E9SA 4XWWA 1T6BX 1QF6A 3HUIA 2LJIA 2IGGA 3FAHA 1B1ZA 1XF5L 3MJ5A 1TS3A 1I4XA 4RH6A 4ZYSA 1JROA 3Q8EA 5HHDG 3MP9A 2QILA 3NS1A 5I4DA 4A8XC 2WXPA 1BUIC 1RFKA 1UWXA 1C9FA 1NVID 1WSPA 3VQIA 2Y5CA 2YEPF 1FCCC 4A90A 3CWIA 4KGSA 2V3NA 4HKZE 1TZOA 1TKEA 3SR6A 3I9V1 4GLSC 4RGOS 3BWUD 4XDDA 1KLGD 1NENB 4A6QA 2PMVA 2JU6X 1C78A 3I57A 1YMHE 4A55A 3AE8B 1OFFA 2GB1A 2CJOA 2X38A 5H92C 3NVZA 1DOXA 2OHFA 4L1BA 1M4VA 5G5GA 3AV8A 1ZP0B 3B2FA 4Q2JA 3P4SB 4US9A 2IPKD 3AN1A 3AE4B 4YXDB 2ACZB 2TSSA 2LHDA 2V4IB 3ZGZA 5C3JB 2IGHA 4R3DA 1HXYD 3EGRA 1C4AA 4ZHPA 4UDUC 1MHXA 2FUG1 4YTNB 4MACA 4C80A 1WXQA 3WCQA 1PDXA 1FFVA 5FKAC 1E6EB 2XNAC 4RGTA 1TY0A 1FM0D 2WDQB 1C77A 1V97A 4YSYB 3W9CB 2WU5B 1EU4A 3AECB 4GDKB 1PUTA 1XXGA 1Q10A 4ITKA 4C7ZA 4RGNA 1QOAA 1QLBB 2K0PA 2WQYB 4RNAA 3AE9B 4B0MA 2WXFA 3GP7A 1JCKB 1FD6A 2M0AA 2PLPA 4KX6B 5T8IA 1YN5A 3BVMA 4YSZB 1SBBB 1ZPSA 2I2YA 2BW2A 4XWTA 2WDVB 2WXHA 3SFDB 1F2RC 1BMLC 1L0VB 2QMTA 3NVWA 1KRHA 1JWSD 2ZW1A 2MH7A 3EA6A 2JQRB 1KLUD 1JALA 2R61A 2H89B 1FIQA 4KKIA 1K52A 1GB4A 1ZDXA 4US8A 1JWAD 1KFYB 2Y3AA 3NZ3A 2V3PA 3AE7B 2CU3A 2BS2B 1SE2A 4WIPA 3V3XA 1GPXA 2HDEA 4L23A 2KN4A 4LLGM 1ZDVA 3BYTB 3HVDA 4CQNA 1V8CA 1SIJA 2H88B 4JWUC 1L4DB 2IDYA 2LMCA 1CZPA 4FXCA 5AUIA 1KTKA 3FC4A 5HG2A 1JRPA 1YN3A 2BS4B 5EE9A 4JPSA 1D4BA 3Q8FA 1TS2A 3ZJTA 1FNWA 1SJHD 3MHZA 1TKYA 3HRDD 4HROA 2W82A 2E6XA 2J53A 1ZXIA 3SFEB 3R8BA 2PTLA 2N0SB 1V1PB 1T5XD 4OZAA 1TKGA 1XLNA 2LEKA 1UUPA 5LNK1 4HJGE 2JWUA 2FE8A 1SXTA 4KGTA 3P63A 1FMAD 4O1NA 5JXVA 2PIAA 2W3RA 4NAMA 1EU3A 5HI1A 1HA5A 2BB6A 1V1PA 2J4XA 4N59A 5BMIA 2DLBA 1HZ5A 4WAFA 3B2GA 2LUMA 3R2TA 3KLSX 3P4QB 2QSDA 4NJCA 3ETRA 1D5XC 1DGJA 3VR8B 3IAS1 2EKIA 1UGJA 3TUOA 2K5PA 3V05A 5BMHA 3AEEB 3RPFC 3SEBA 3PZ7A 3URYA 2ON8A 1N61A 5EE3A 3LXFA 1YNTE 2MEKA 1RM6C 1A70A 1XCTL 3ZQ4A 1ENFA 1FCLA 2WNMA 2Z8LA 4JE3B 1LO5D 1WGKA 2DWQA 2J52A 1ZUD2 1ET9A 1XO3A 1I7HA 2WXIA 3AEDB 4H2AA 5D3DA 4ARCA 1VZ6A 1NYRA 1SJED 2ONQA 2RDHA 1RYJA 1FRDA 4P6VF 2HTME 3AEAB 1MI0A 2N9LA 3VRBB 2WXKA 2Q5WD 2L83A 4REZA 1PYWD 1JW9D 3BVGA 1E10A 1UNSA 2QIEB 2WS3B 2W3SA 4WWMA 1TS5A 2D5GA 4NZLB 2K9XA 2WXMA 2BB5A 3AMZA 4GDLB 4A9AA 2JYEA 3IAM1 3NVVA 4XDCA 4WQMA 2NTSA 4LTUA 4P16A 4OZBA 3EUB2 5C2TB 2DBYA 3GB1A 4MT5A 3AE1B 2WDRB 5H8YE 1YJIA 3T3NA 1SF0A 1TS4A 3LB8C 1QKZA 1PGXA 1ZXHA 2GRIA 2WXJA 4N6EB 2LHEA 5HFYA 1XLQA 3AE3B 1QOFA 1IGDA 1F77A 1JMLA 3NUHB 1D5MC 1MVKA 4IKGA 1FRRA 4B0EA 3TEZA 1AYFA 1L6VA 1HEZE 3IT6B 4YT0B 1NYQA 3Q8BA 3CIRB 3AH7A 2JXTA 1FEHA 2N9KA 2AQ3B 5D3IB 3E56A 4J3OD 1N63A 3BVZA 1E9MA 4DXGA 3U52E 2RMMA 1YQ3B 2IJ0A 3BIID 2EELA 1OQQA 1VDVA 3ZJUA 4TQ1A 4AS1A 2IGDA 1TYGB 3AEFB 3KWLA 5BYSA 1P7EA 3P4RB 1N5XA 5MPOA 1SSNA 3ZJVA 1YN4A 2JZPA 2M19A 1YJJA 1XLOA 1C4CA 4IOIE 1SEBD 2KMMA 2BS3B 2KAJA 3N9YC 4WH4A 1KF6B 4AQ7A 2DYOA 1N60A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5HI1 A;  1EM7 A;  1YMH E;  2KQ4 X;  2GB1 A;  5BMI A;  1IBX B;  5BMG A;  1HZ5 A;  2LUM A;  1MHH E;  2QSD A;  2ZW0 A;  2JSV X;  4KGR A;  5BMH A;  2LHD A;  2ON8 A;  2IGH A;  1IBX A;  1K50 A;  1YNT E;  1MHX A;  1XCT L;  1PGA A;  1FCL A;  1XCQ L;  4MAC A;  2J52 A;  1MPE A;  2KDM A;  2ONQ A;  2KAC A;  1MI0 A;  2N9L A;  4D2K A;  1HZ6 A;  1Q10 A;  2NMQ A;  2K0P A;  1IGC A;  3FIL B;  2N7J A;  1FD6 A;  1K53 A;  1PGB A;  2PLP A;  2GI9 A;  1KH0 A;  2I2Y A;  4OZB A;  1F2R C;  3FIL A;  3GB1 A;  2QMT A;  2I38 A;  2ZW1 A;  1QKZ A;  1PGX A;  1ZXH A;  2KWD A;  2OED A;  2LHE A;  5HFY A;  1IGD A;  4IKG A;  1JML A;  4OZC A;  1MVK A;  1K52 A;  1GB4 A;  1F2R I;  1HEZ E;  1K51 A;  2PW9 A;  2JXT A;  2N9K A;  3V3X A;  2RPV A;  2KN4 A;  2RMM A;  3UI3 A;  2EEL A;  2IGG A;  5HG2 A;  1XF5 L;  1D4B A;  2IGD A;  1GB1 A;  5HHD G;  3MP9 A;  2J53 A;  1P7E A;  1UWX A;  1C9F A;  2PTL A;  2JZP A;  4OZA A;  1FCC C;  4HJG E;  2JWU A;  4IOI E;  4KGS A;  2LGI A;  4KGT A;  4HKZ E;  1P7F A;  4GLS C;  4WH4 A;  5JXV A;  2JU6 X; 
#chains in the Genus database with same CATH topology
 2BQQ A;  2J0K A;  3PZ8 A;  4IWP A;  3VTU A;  3QJZ A;  2D10 A;  2ICI A;  1P0R A;  1VLB A;  4WJO A;  1H4R A;  3KWV A;  1SE4 A;  1TZ1 A;  1MHH E;  4EOY A;  2HJ8 A;  4BVU C;  5AUK A;  2ZPN A;  1GUA B;  4KIK A;  2WXN A;  1RWS A;  3IBE A;  4RF0 A;  3TEX A;  4K1R B;  4JX1 C;  2NTT A;  4M8M A;  2FCM A;  3ZO5 B;  1XEE A;  3UQA A;  2BYF A;  3WAP A;  1C4P A;  4WJP A;  1L6U A;  2DAJ A;  2D2Q A;  1AN8 A;  3KUC B;  3C19 A;  1FO4 A;  1F0Z A;  2LVO A;  4PYU A;  1XQQ A;  3DBH I;  1QZE A;  2MX2 A;  4WWN A;  2ZEQ A;  2G4S A;  4F8C B;  1L5P A;  3FIL B;  2W55 A;  1D6E C;  5KHO A;  3ZUN A;  1GOZ A;  2BGF A;  3AEG B;  2V4L A;  2KVR A;  5G2N A;  3QAQ A;  3DCG A;  5AZH A;  4XX5 A;  2JVC A;  2N7E A;  4WUR A;  5EE1 A;  3W1Y A;  3L16 A;  3PV1 A;  4MEL A;  3N1Z C;  4L2Y A;  3OJ3 A;  2QC8 A;  1QOB A;  2KJH B;  3ZW3 A;  4HKQ A;  2I38 A;  4MH0 E;  2MWS B;  3Q6B A;  3VHT C;  5J2R A;  1ZGU B;  3TSS A;  3AE2 B;  1L4Z B;  2GMI C;  2LXA A;  1VRA B;  1V81 A;  1K51 A;  4LK0 M;  2WXG A;  4II2 B;  2D3C A;  4ANV A;  2NBU A;  3QK0 A;  3UI3 A;  4MGI E;  3GE3 C;  2KWV B;  2KYW A;  2D3A A;  3NVY A;  3TEW A;  1XLP A;  4GXB A;  4G11 A;  4DHZ E;  3A9J B;  2V9H A;  4TSS A;  1BT0 A;  2MJE A;  3AE5 B;  1LM8 B;  3AM9 A;  3LDZ E;  2RD0 A;  1ZOY B;  1L0X B;  3PO0 A;  3DHI C;  1WYG A;  1E0Z A;  3QAR A;  2LFI A;  2KQ4 X;  5TSS A;  1JQ4 A;  1IBX B;  1DOI A;  1SB3 C;  3MFG A;  4LNN A;  4LDT D;  3O13 A;  2WXQ A;  3W5V B;  4HEA 1;  4GU2 A;  3PHX B;  1E7P B;  3ZXR A;  2PEA A;  1TJE A;  2L00 B;  4GDK A;  3Q3M C;  3RZF A;  4KKJ A;  2KDE B;  2RDB C;  4NPN A;  2MP2 A;  3BZD B;  2INP E;  4DQO C;  4IDI A;  1I42 A;  2KD0 A;  1PGB A;  4I6N B;  2GI9 A;  3Q3J A;  4WAA A;  3GZN B;  3Q3O C;  4OVV A;  5GMV A;  3HVZ A;  3U4E G;  3UIP B;  4TKN A;  2XN9 C;  5LXI B;  4OZC A;  2V1Y A;  1WMH B;  1MG4 A;  1EWY C;  1N5W A;  3A4S C;  2CS4 A;  3RNB C;  2RPV A;  2WP9 B;  3KH0 A;  4FJY A;  4XWW A;  3Q3F A;  2EMT A;  2LJI A;  3MJ5 A;  1B1Z A;  3ONS A;  1I4X A;  4ZYS A;  4K7W A;  3Q8E A;  2W9N A;  5HHD G;  4FHK A;  4AWJ A;  3DBR B;  4EKU A;  1WGY A;  2IO2 B;  1E7V A;  4S0R A;  1WSP A;  2D3G A;  2K8C A;  4W9G A;  3L10 B;  1C3T A;  1EF1 A;  4XDD A;  1WJ4 A;  2IO0 B;  4A6Q A;  4TUU A;  2BWE S;  2JU6 X;  4PYZ A;  3H9D A;  3ZDM C;  1SGH A;  1MJD A;  1WXV A;  2OHF A;  3A9K A;  3O65 B;  5AZF A;  3P4S B;  2KFJ A;  3AN1 A;  4DK5 A;  2V4I B;  3ZGZ A;  1VCB A;  1WI0 A;  2MA9 B;  3KVF B;  2IGH A;  4P1C C;  4R3D A;  3EGR A;  4ZHP A;  1C4A A;  3RUL A;  2K25 A;  4YTN B;  4C80 A;  2K39 A;  3CSF A;  1FFV A;  2FCQ A;  4HDO A;  1E6E B;  1HE8 A;  4BFR A;  4OVU A;  2WDQ B;  3W9C B;  2WU5 B;  1EU4 A;  1XXG A;  4C7Z A;  2MBB B;  2WQY B;  4GIV A;  2CHX A;  4B0M A;  1Z5S B;  2WXF A;  2NPT A;  3GP7 A;  3H6N A;  4WQO B;  1FD6 A;  1OEY J;  2PLP A;  3BVM A;  1RFA A;  2BW2 A;  2BVC A;  3NVW A;  1JWS D;  1YJ1 A;  2ZW1 A;  2MH7 A;  1UD7 A;  2LD9 A;  2R61 A;  4DHZ B;  1V2Y A;  5AEK B;  4KKI A;  3NZ3 A;  1P9D U;  1WXA A;  2V3P A;  2RR9 A;  2L7R A;  2KMC A;  4L23 A;  2CHW A;  2M4N A;  2JZZ A;  3OLM D;  2H88 B;  4JIO U;  1KTK A;  4S17 A;  4W9I A;  1YN3 A;  5EE9 A;  3Q8F A;  3QIJ A;  1SJH D;  2K1F A;  4M01 A;  1AAR A;  3ZDT A;  1V1P B;  5D2M B;  4OZA A;  1XLN A;  5LNK 1;  4BZA A;  3HK0 A;  3P63 A;  4O1N A;  4KDI C;  2PIA A;  2W3R A;  4FJV B;  3W1S C;  2J4X A;  3A1Q A;  4CHK A;  1Q1O A;  4C4V B;  4GMV A;  2QSD A;  4ANU A;  4F7Z A;  3TUO A;  4FJZ A;  4WJN A;  3V05 A;  3DBR I;  2KTR B;  3RPF C;  5IO9 A;  5TR5 A;  1KOT A;  1A70 A;  2AEH A;  3DBS A;  2ZJD A;  3DHH C;  4JGH B;  1JRU A;  2DWQ A;  2MRP A;  3S2A A;  2FCS A;  3ALB A;  1XO3 A;  1C1Y B;  3L08 A;  1VZ6 A;  1SJE D;  2ONQ A;  1RYJ A;  4EZK A;  1S1Q B;  1EF5 A;  2N1W A;  2WXK A;  2EMS A;  3BVG A;  2QIE B;  4LJO B;  4WWM A;  1TS5 A;  4NZL B;  3L0W B;  2VH2 A;  2WXM A;  4LCD E;  3ENE A;  3IAM 1;  3NVV A;  3K9O B;  2J0J A;  4OZB A;  3GB1 A;  3AE1 B;  2LZ6 A;  5H8Y E;  3RNC C;  1YJI A;  1TS4 A;  2GRI A;  4GDL A;  2I1J A;  1J0G A;  1JML A;  1WGR A;  1D5M C;  2NR2 A;  3U7D A;  3TEZ A;  1AYF A;  1L6V A;  1HEZ E;  2K6D B;  2KX0 A;  3PRP B;  3CIR B;  3NS8 A;  3AH7 A;  4A3P A;  1E5W A;  4J3O D;  4E3C A;  4DXG A;  2M17 A;  1YQ3 B;  4WWO A;  4EZL A;  2MHJ A;  3DVN V;  2KX3 A;  3I63 C;  2REX A;  2IGD A;  1TYG B;  3ZVV A;  5BYS A;  1P7E A;  4HPP A;  1SSN A;  1XLO A;  1WJN A;  2BS3 B;  3N9Y C;  4QAY A;  3GOE A;  1GAQ B;  2AQ2 B;  4MJS A;  3IXS A;  2QJL A;  1WRI A;  4RCO A;  1DYQ A;  2DZK A;  2WXO A;  3PRM B;  5EDS A;  1AWD A;  1ET6 A;  2JRH A;  4IWO A;  1VD2 A;  1I4G A;  4HXD A;  3H1U A;  1I4H A;  4DHJ D;  1FPY A;  4KVG B;  4XGA B;  2HE7 A;  2MJ3 A;  2JYT A;  4ZRI A;  1WGG A;  3NJT A;  4BKS A;  4M0W B;  3RD2 A;  2UU7 A;  4IG7 B;  2L76 A;  4OW0 A;  1UGM A;  5E6J A;  4PS8 A;  3A33 B;  3AEB B;  3LYY A;  4BOS C;  4XC2 A;  2E3T A;  1CK1 A;  1NDD A;  2K8H A;  2DZM A;  2WHI A;  1ACC A;  1FXA A;  2FBW B;  3P1M A;  3APD A;  4LNO A;  4ZRP A;  2L8J A;  1P98 A;  3H7P A;  3ZLZ A;  1EWC A;  4YSX B;  1HTO A;  3AI5 A;  2LVQ A;  3PS6 A;  1M94 A;  3OWE B;  4EE2 A;  5C1Z A;  1B9R A;  5EE0 A;  2WU2 B;  3DOW A;  3A4R A;  1ISN A;  1R7S A;  2QDF A;  3BIN A;  2G3Q B;  2FIF A;  1V5O A;  4I6P A;  3QWZ B;  1VJK A;  1BXT A;  4FN2 A;  3VRA B;  1JWU D;  5G5H A;  3N3K B;  1HQR D;  2ZCC A;  1V1O A;  3QHT A;  1EM7 A;  4HK2 A;  2M8S A;  2JY6 A;  1EUV B;  3U30 A;  3DVG Y;  4RM8 A;  3W2D A;  1NEK B;  2PVO D;  1V49 A;  3R3M A;  2A4Z A;  4MGY E;  1K8R B;  2OJW A;  2PE9 A;  2WX0 A;  4B95 A;  2KDB A;  5J18 A;  2PJH A;  3LJ3 A;  2AL3 A;  1S3S G;  2NMQ A;  2L1A A;  4RGM A;  2WX1 A;  2L52 A;  5FR6 A;  3ECI A;  3Q8C A;  2PKO A;  2YLM A;  2VZK D;  3GS2 A;  2D3B A;  3TL5 A;  1KH0 A;  4HDQ A;  1L0Y B;  4TV3 A;  3HM3 A;  3PT2 B;  2BF8 B;  3TBL D;  3ZXV A;  5BO4 B;  2OED A;  2BKF A;  4NQL B;  2XBB C;  4ASW C;  3U2S C;  1TIF A;  2OJR A;  5D7G A;  4ZYN A;  4K7U A;  3V6C B;  1Y56 A;  2VZK B;  2VRR B;  1CQV A;  1FXI A;  4OHJ A;  1R4M B;  2LGY A;  1T6B X;  1Q5W B;  4DDI D;  4EFO A;  1XF5 L;  4RH6 A;  2MBO A;  3WAM A;  4PK1 A;  1I35 A;  5I4D A;  1UWX A;  4WWP A;  4HWI B;  4A20 A;  1FCC C;  4KGS A;  1V9J A;  1YX5 B;  1TKE A;  1GG3 A;  3AU4 A;  4RGO S;  3BWU D;  1FXT B;  3OG5 A;  4ANX A;  1KLG D;  2IO1 B;  1WJU A;  4IM0 A;  2J0M A;  1C78 A;  3V60 A;  3AE8 B;  1OFF A;  1DOX A;  3X23 A;  1UH6 A;  1ZP0 B;  4Q2J A;  2L0F A;  1WJ6 A;  2IPK D;  2HD5 B;  2TSS A;  2LHD A;  3KUZ A;  1HXY D;  2CKH B;  3ZRC A;  3QX1 A;  4MAC A;  1WXQ A;  1YOV B;  3WCQ A;  3UIO B;  5FKA C;  4BKT A;  1E8W A;  4RGT A;  1YIW A;  1FM0 D;  1KM7 A;  2GOW A;  1V97 A;  3NG0 A;  4YSY B;  3AEC B;  3L54 A;  5CHF A;  4ITK A;  2K0P A;  4W9J A;  1JCK B;  5T8I A;  3TIX A;  4YSZ B;  3RNG C;  2I2Y A;  2WDV B;  2NBV B;  2R2O A;  1WR6 E;  3KUD B;  2DHZ A;  4MSQ B;  4B6W A;  2AYO B;  1KRH A;  4LDT B;  2JQR B;  1KLU D;  4DXA B;  1JAL A;  2DAF A;  2FID A;  1FIQ A;  1JWA D;  2Y3A A;  3AE7 B;  1SE2 A;  1XT9 B;  1F52 A;  4LLG M;  4GSW A;  2KFK B;  3NZS A;  4I6L B;  2ZVN A;  2LMC A;  5HG2 A;  4FXC A;  4IWQ A;  1E8Y A;  4HRO A;  2W82 A;  2E6X A;  1WM3 A;  1ZXI A;  3TCA A;  3R8B A;  2N0S B;  2KHW B;  1TKG A;  4HJG E;  5AZG A;  2FE8 A;  2GBM A;  2LI5 A;  1R4M I;  1EU3 A;  5HI1 A;  1HA5 A;  4N59 A;  5BMI A;  3RT3 B;  2C5L C;  2X8X X;  4WAF A;  1WR1 A;  4NJC A;  3ETR A;  1D5X C;  1DGJ A;  2C60 A;  2EKI A;  1UGJ A;  5BMH A;  1RRB A;  4ZRJ A;  3SEB A;  3URY A;  2ON8 A;  2N9E B;  2KK8 A;  1V80 A;  1XCT L;  3PZD A;  3ZQ4 A;  2WNM A;  3PVL A;  1ZW7 A;  2FUH B;  1ET9 A;  2WDT B;  2WXI A;  3VTV A;  3MHS D;  2BPS A;  2O6V A;  3FKY A;  2HTM E;  3CST A;  1MI0 A;  1E10 A;  2WS3 B;  3RUI B;  4NJ7 A;  2LRU A;  2DEN B;  4LNK A;  5CHW A;  3AMZ A;  2JYE A;  4WQM A;  4NY0 A;  2JPH A;  3RN9 C;  4MT5 A;  3NZU A;  3VTW A;  4HJK A;  3T3N A;  3LB8 C;  1QKZ A;  2LHE A;  5HFY A;  1FRR A;  1WX9 A;  2UWQ A;  2VH1 A;  3IT6 B;  2N9K A;  2AQ3 B;  5D3I B;  4W9C A;  3DVG X;  1N63 A;  4B9K A;  3BII D;  3RNF C;  2EEL A;  2KLG A;  1VDV A;  3JSV B;  4YL8 A;  5LLI A;  2BYE A;  2NBW B;  3N30 A;  1YN4 A;  3N1X C;  4CYE A;  4IOI E;  3EEC A;  3RMK C;  4N9F 4;  1KF6 B;  2DYO A;  4GB9 A;  4KIK B;  5FR3 A;  3EC8 A;  2KOX A;  2AX5 A;  3QA8 A;  2O2V A;  3MJW A;  3SD5 A;  4C00 A;  1UWM A;  3AUL A;  4YTP B;  1ZKH A;  2G1E A;  4FHJ A;  2MSE D;  4USA A;  2G9H D;  2KO3 A;  3C8Y A;  2ZW0 A;  3ZRF A;  2GBK A;  2KNB A;  1IUE A;  3J9C A;  2KQS A;  4KGR A;  4K3B A;  4C7Y A;  1T3Q A;  1H8C A;  2JX5 A;  1NBF C;  4IM2 A;  2BTE A;  3Q69 A;  2KVZ A;  1PGA A;  2KXJ A;  3BYY B;  4K7S A;  2NCN A;  3KQ4 A;  1QT9 A;  2SAK A;  5DPR A;  1ROE A;  2KAC A;  5GXG B;  2JUO A;  3CF6 E;  4MGK E;  2AWT A;  4GGQ A;  2K3U A;  2LJ5 A;  1A5R A;  2CHZ A;  3DWG C;  3ZYY X;  4W9E A;  4JWS C;  2J7Q B;  1D3Z A;  3FIL A;  2L32 A;  3TEY A;  1TTN A;  2LGD A;  4C56 C;  1WRD B;  1WGD A;  2Y5P A;  1N62 A;  1WH3 A;  2Z0D B;  3R2I A;  4II3 B;  3APF A;  5IKC M;  5E6N A;  4HPL B;  2GBN A;  2KN5 A;  2C7M B;  4W9L A;  4J6I A;  2IY1 B;  1SE9 A;  1RAX A;  4YWG G;  3ZTD A;  1KLV A;  3VUX A;  4EZJ A;  4DWF A;  4RFB A;  3WAL A;  4MM3 B;  4G50 A;  1OEY A;  2LGI A;  2FNJ B;  4HVB A;  1TY2 A;  2QEJ C;  4IM3 A;  2N9P C;  3W1S A;  3A9J A;  1ZE3 D;  3P2B A;  2BKR B;  1UEL A;  2KDI A;  3WIM A;  2BYT A;  1TBE A;  3RYT A;  2XK5 B;  3QQ8 B;  1I4R A;  3OAW A;  1VZ7 A;  3AE6 B;  1CJE A;  1NI3 A;  3L13 A;  3H8H A;  3M3J A;  3VVW B;  1TT5 B;  5JHA A;  2MP2 B;  1IBX A;  1C79 A;  3RZW C;  1V6E A;  2CJN A;  1KJT A;  1VR9 A;  2MJD A;  1PFD A;  2B76 B;  1AW7 A;  1MPE A;  3JYU A;  3RNA C;  1D5Z C;  3MTN B;  4NAW B;  2JWZ A;  1CMX B;  3Q14 C;  4DXF A;  5DPW A;  3SU8 X;  1HZ6 A;  2DNF A;  3W5U B;  4ZHO A;  3U7Z A;  1LQB A;  4TQ0 A;  2PPH A;  4ICU A;  1YQ4 B;  1TGZ B;  4HLE A;  1OQR A;  1SE3 A;  4M02 A;  1UF0 A;  1J7A A;  2WXL A;  4XE0 A;  2DYM A;  2KC2 A;  2L05 A;  2PVG C;  2J42 A;  1GC6 A;  4NJ6 A;  2DX5 B;  2KWD A;  4BBN F;  2K22 A;  3RFZ B;  4ANW A;  4ZOH C;  2INN E;  1F2R I;  1RLF A;  4TMA B;  1YD8 U;  3PLU A;  2Y5B B;  1E90 A;  4DHJ B;  4AJY B;  4DDG D;  2HJ1 A;  1E8Z A;  1WY8 A;  3TMP B;  1WMH A;  1JRO A;  3ZKJ C;  3UF8 A;  3MP9 A;  3NS1 A;  4A8X C;  2WXP A;  5KHQ A;  1BUI C;  3VQI A;  2NVU I;  2Y5C A;  2LUE A;  4W9D A;  4HCP B;  3A9K B;  4A90 A;  2V3N A;  4HKZ E;  1TZO A;  3SR6 A;  3RCZ A;  3I9V 1;  4GLS C;  2LXC A;  2PMV A;  2JT4 B;  1YMH E;  4A55 A;  2GBJ A;  2X38 A;  3NVZ A;  4L1B A;  3AV8 A;  1IYF A;  3B2F A;  3V6E B;  4E74 A;  4BOZ B;  3AXC A;  4PS7 A;  1MG8 A;  3HHM A;  1GNU A;  1WX7 A;  5E6O A;  4NQK E;  2IO3 B;  5D94 A;  1PDX A;  3VUY A;  1IP9 A;  2NPT B;  4BKG A;  1TY0 A;  5C23 A;  2KQ7 A;  3HIZ A;  4W9K A;  1WZ0 A;  1C77 A;  2AL6 A;  3T9L A;  1WIA A;  1E7U A;  3ML8 A;  1QOA A;  1QLB B;  3DVN U;  4RGN A;  4WJQ A;  1GC7 A;  2ZNV B;  2KZR A;  3VH4 B;  1MFW A;  1UZX B;  4KSL C;  2M0A A;  3UGB B;  1WGH A;  2EKE C;  2L0T A;  1ZPS A;  4XWT A;  3SFD B;  5JH5 C;  1F2R C;  2JXX A;  3AU5 A;  3D32 A;  2Z0E B;  4AOF A;  2H89 B;  1GB4 A;  2KLC A;  1KFY B;  1WX8 A;  2N7D A;  1V86 A;  4WIP A;  3WA0 A;  1GPX A;  2HDE A;  5CHV C;  1Y8R C;  3HVD A;  1V8C A;  4JWU C;  1L4D B;  5AUI A;  2BS4 B;  2ASQ A;  3ZJT A;  1FNW A;  2A5U A;  3MHZ A;  1TKY A;  3X0W A;  2B3A A;  3BY4 B;  4PS3 A;  3SFE B;  2PTL A;  1T5X D;  5J17 A;  3A1Q B;  2JWU A;  2MQJ A;  4F1S A;  2CU1 A;  4FUL A;  3ZNH B;  3UQB A;  3VUW A;  2C9W B;  1V1P A;  3I3T B;  3B2G A;  1E8X A;  3KLS X;  2NS5 A;  2N4F A;  3VR8 B;  2K5P A;  1WE6 A;  3AEE B;  3PZ7 A;  3NOB A;  2QHO A;  3LXF A;  4M00 A;  5D6J B;  4BBN C;  3EFU A;  4C4V A;  4XYC A;  2Z8L A;  4JE3 B;  1LFD A;  1LO5 D;  1WGK A;  2IY0 B;  2J52 A;  2KTR A;  5D3D A;  4ARC A;  1NYR A;  3M63 B;  1Q0W B;  4P6V F;  2LGX A;  2N9L A;  3VRB B;  3PPA A;  4REZ A;  1WZ3 A;  1UNS A;  2W3S A;  3M62 B;  3Q3N C;  5CX3 A;  2D5G A;  3DHG C;  4GDL B;  5JHB A;  1V5T A;  4A9A A;  3WAO A;  3HM6 X;  3NY5 A;  4XDC A;  4LTU A;  4MDK E;  2RSU A;  3EUB 2;  5C2T B;  1J19 A;  2DBY A;  2KTF A;  1WF9 A;  1XD3 B;  4IC7 B;  1SF0 A;  1ZXH A;  2WXJ A;  2M1M A;  1XLQ A;  3AE3 B;  3NUH B;  1QOF A;  1IGD A;  1F77 A;  2N1V A;  2D07 B;  2JRI B;  3C0R B;  5L95 C;  1NYQ A;  3PSE B;  2IND C;  2IBI B;  2I1K A;  1J8C A;  2MCN B;  2MW5 A;  4MM3 A;  3BVZ A;  1E9M A;  3U52 E;  2IJ0 A;  1Z2M A;  4LNF A;  1OQQ A;  3DBL I;  1EO6 A;  2LVP A;  3VFK A;  3L17 A;  3P4R B;  1N5X A;  3ZJV A;  2JZP A;  4MJS B;  1YJJ A;  1C4C A;  3UIN B;  1SEB D;  4BKS D;  2KAJ A;  5DPT A;  4WH4 A;  2XK5 A;  1N60 A;  2C7N B;  4FLH A;  2AQ1 B;  1F1H A;  2RDG A;  3RNE C;  5IP4 D;  3BK1 A;  1QIL A;  4W9H A;  1DOY A;  2JSV X;  3NRZ A;  1C76 A;  1YQB A;  1GJZ A;  4XZ4 A;  1I4P A;  1L2N A;  1K50 A;  4KZC A;  1FNV A;  4NAW A;  5DPS A;  4FA6 A;  4K81 A;  1STE A;  3MC8 A;  5CTR C;  2LWP A;  2KDM A;  1I4Q A;  5FK9 C;  1G6J A;  4ZRQ A;  3P42 A;  4JLC A;  1UBI A;  1IGC A;  4KSK C;  2N9X A;  1J7C A;  4YTM B;  2M0X A;  3WAN A;  1FNU A;  1K53 A;  3M95 A;  3I5J C;  3H7P B;  4M0W A;  1SIF A;  4M8N A;  4MH8 A;  4X57 B;  5E6P A;  3Q8A A;  2ZNV C;  2KAN A;  4P1B C;  1HTQ A;  4HRS A;  1F9J A;  2IZV B;  3IT4 B;  3VR9 B;  4FAD A;  4N58 A;  1WFY A;  1YX6 B;  1PQS A;  2PW9 A;  1JWM D;  2V3S A;  2L3Z A;  3PRE A;  1JWB D;  3P4P B;  3DWM A;  2BYV E;  1IPG A;  4PT5 A;  1GB1 A;  5BYR A;  1QQR A;  3MC9 A;  2GBR A;  2WLB A;  1OQY A;  1P7F A;  4KV2 A;  4RF1 A;  4KZ0 A;  4KDL B;  3PGE A;  3L4P A;  5BYQ A;  2UYZ B;  2BT6 A;  5BMG A;  3V62 A;  2RGF A;  1J7B A;  2ZCB A;  3BK2 A;  2W54 A;  3PTF C;  4GN1 A;  2M56 B;  3K9P B;  4DBG A;  3OJ4 B;  3MC0 B;  1VZ8 A;  1FFU A;  1XCQ L;  3QC8 B;  2WWZ A;  2BBC A;  3KYC D;  1WE7 A;  3IG3 A;  4IW0 A;  2V0G A;  2WXR A;  4D2K A;  2YEP B;  4CO7 A;  1P1A A;  1WM2 A;  4ARI A;  4OVZ A;  4EEW A;  1ESF A;  1QOG A;  2K8B A;  2N7J A;  3AB5 A;  5IOI A;  1T0R C;  4A3O A;  4URK A;  3VDZ A;  2MLB A;  2KKC A;  1WWT A;  3T3O A;  3GZN I;  2DYB A;  2HTH A;  3ABV B;  4JL9 A;  1T0S C;  2SEB D;  3ZNG C;  3PHW B;  2IYD B;  2KJ6 A;  4BAX A;  3V61 A;  3B9J A;  1OGW A;  1U4A A;  4ZDV A;  3E9S A;  2FCN A;  1QF6 A;  3HUI A;  2IGG A;  3Q2A C;  3FAH A;  1TS3 A;  3TJP A;  2WGS A;  2QIL A;  1RFK A;  1C9F A;  1NVI D;  2YEP F;  3CWI A;  3VH3 B;  1NEN B;  3APC A;  1R4N B;  3DDC B;  3R7Q A;  2KC1 A;  3I57 A;  2ZVO A;  3GE8 C;  2GB1 A;  2CJO A;  2ZZP B;  5H92 C;  1M4V A;  5G5G A;  5L83 A;  2JZ3 B;  4MSM B;  1P3Q U;  3CMM B;  3EHV A;  3NHE B;  4US9 A;  3AE4 B;  4YXD B;  3ML9 A;  2ACZ B;  3RI7 C;  2K6Q A;  5C3J B;  3N20 C;  2G4D B;  2Z59 B;  2YVC A;  4UDU C;  1MHX A;  1T0Y A;  2FUG 1;  1WXS A;  4GOC A;  4W9F A;  2XNA C;  3B1L X;  1WYW B;  2FAZ A;  3N1Y C;  4HCN B;  4AJW A;  4GDK B;  4MEM A;  1PUT A;  1Q10 A;  4RNA A;  3AE9 B;  1OTR B;  3IFW B;  4KX6 B;  1YN5 A;  4RMA A;  1SBB B;  5IAA C;  2WXH A;  1BML C;  1L0V B;  2QMT A;  3EA6 A;  3KW5 B;  1K52 A;  3JW0 X;  5JZE B;  1ZDX A;  4US8 A;  2CU3 A;  2BS2 B;  3VAW A;  5G55 A;  3V3X A;  2KN4 A;  1L7Y A;  1ZDV A;  3BYT B;  2DZJ A;  4CQN A;  1SIJ A;  2QCZ A;  2IDY A;  3IVF A;  1CZP A;  3FC4 A;  1JRP A;  2LGS A;  4JPS A;  4JQW C;  4LNI A;  1D4B A;  1TS2 A;  3HRD D;  3R66 C;  2CR5 A;  3DQV A;  2J53 A;  3N32 A;  4ACF A;  2KJR A;  3B08 A;  2KFK A;  4LJP B;  2LEK A;  1UUP A;  3VXW A;  1SXT A;  4KGT A;  2O6V D;  1NI2 A;  3ZNI D;  2KT7 A;  1FMA D;  2BWF A;  5JXV A;  4ZRK A;  4NAM A;  2RPQ A;  4NNJ B;  2BB6 A;  3DPD A;  2DLB A;  1HZ5 A;  2KDF B;  2JF5 A;  2KMA A;  2LAS A;  3DBH B;  4G3X B;  2LUM A;  3R2T A;  3P4Q B;  3IAS 1;  5LXH A;  3PLV A;  3B0A A;  1N61 A;  2O6V B;  4EUT A;  5EE3 A;  2MBE A;  1YNT E;  2MEK A;  3R7R A;  1RM6 C;  5IA7 A;  1ENF A;  1FCL A;  2WYQ A;  3PRZ A;  5DCN A;  1R4N I;  1ZUD 2;  4H2A A;  1I7H A;  3AED B;  3ZIM A;  2C7H A;  2RDH A;  1FRD A;  2MBH A;  3AEA B;  3ZNZ B;  1UBQ A;  2Q5W D;  1N6Z A;  2L83 A;  1PYW D;  1JW9 D;  2XEW A;  1WXM A;  3ZTC A;  5HKH A;  2KWU B;  2K9X A;  2BB5 A;  2INC C;  2G45 B;  4HPM B;  2NTS A;  4P16 A;  3SDL C;  2OOB B;  1LXD A;  3H7S A;  2WDR B;  4E71 A;  3U8Z A;  2ZPY A;  1PGX A;  4N6E B;  2MBQ A;  4IKG A;  4B0E A;  1MVK A;  1LGR A;  4YT0 B;  3Q8B A;  2LRW A;  3SHQ A;  2JXT A;  1FEH A;  1T0Q C;  3EFC A;  3KYD D;  4K3C A;  2PE6 B;  3JVZ X;  3E56 A;  2RMM A;  1X1M A;  2KWC A;  5IN7 A;  3DBL B;  3ZJU A;  4IUM B;  4TQ1 A;  2DZI A;  3QCA A;  4RM9 A;  4G0N B;  4AS1 A;  3IHP C;  4ICV A;  3AEF B;  3KWL A;  2GLS A;  2R2Q A;  5MPO A;  2D11 A;  2M19 A;  4AUQ C;  2O2V B;  3T8M A;  4FBJ B;  4MGZ E;  2KMM A;  4P7I A;  3JSV A;  4AP4 C;  4AQ7 A; 
#chains in the Genus database with same CATH homology
 1GAQ B;  2AQ2 B;  5FR3 A;  3PZ8 A;  2AX5 A;  2AQ1 B;  2RDG A;  3IXS A;  2QJL A;  1WRI A;  2ICI A;  1VLB A;  3BK1 A;  1QIL A;  1UWM A;  4YTP B;  2G1E A;  3KWV A;  4RCO A;  1SE4 A;  1DYQ A;  1MHH E;  2WXO A;  4USA A;  2G9H D;  1AWD A;  5AUK A;  1DOY A;  1ET6 A;  3C8Y A;  2ZW0 A;  1IUE A;  3J9C A;  2JSV X;  3NRZ A;  2WXN A;  1RWS A;  1C76 A;  4KGR A;  4RF0 A;  3TEX A;  1I4G A;  1I4P A;  4C7Y A;  1T3Q A;  1K50 A;  2JX5 A;  4JX1 C;  2BTE A;  1FNV A;  1I4H A;  3Q69 A;  1PGA A;  3BYY B;  2MJ3 A;  2NTT A;  1STE A;  2JYT A;  1XEE A;  3KQ4 A;  1C4P A;  1QT9 A;  2SAK A;  1L6U A;  1ROE A;  2KDM A;  1AN8 A;  1I4Q A;  2KAC A;  5GXG B;  5FK9 C;  1FO4 A;  1F0Z A;  4ZRQ A;  3P42 A;  1IGC A;  1L5P A;  4OW0 A;  3FIL B;  1J7C A;  2K3U A;  2W55 A;  1D6E C;  5E6J A;  4YTM B;  1GOZ A;  1FNU A;  1K53 A;  3AEB B;  3AEG B;  3LYY A;  2E3T A;  1CK1 A;  3DWG C;  4M0W A;  1ACC A;  3ZYY X;  4JWS C;  4WUR A;  1FXA A;  5EE1 A;  2FBW B;  4MH8 A;  3FIL A;  3P1M A;  4L2Y A;  2L32 A;  3Q8A A;  3TEY A;  1QOB A;  4HKQ A;  4C56 C;  2I38 A;  4ZRP A;  3TSS A;  3AE2 B;  2Y5P A;  4HRS A;  1L4Z B;  1EWC A;  4YSX B;  1N62 A;  1VRA B;  3IT4 B;  3VR9 B;  4N58 A;  1K51 A;  3R2I A;  3OWE B;  4LK0 M;  4EE2 A;  2WXG A;  1B9R A;  2PW9 A;  1JWM D;  5EE0 A;  2WU2 B;  3UI3 A;  1JWB D;  3P4P B;  3DWM A;  1R7S A;  4PT5 A;  1GB1 A;  4YWG G;  5BYR A;  3NVY A;  1QQR A;  3TEW A;  4RFB A;  1XLP A;  4MM3 B;  2WLB A;  4TSS A;  1VJK A;  1BXT A;  2MJE A;  3VRA B;  1JWU D;  3AE5 B;  2LGI A;  5G5H A;  1P7F A;  4RF1 A;  3AM9 A;  1ZOY B;  1L0X B;  3PO0 A;  1HQR D;  1TY2 A;  2QEJ C;  1WYG A;  1V1O A;  1E0Z A;  1EM7 A;  3W1S A;  1ZE3 D;  2LFI A;  3L4P A;  2KQ4 X;  5BYQ A;  5TSS A;  1JQ4 A;  2BT6 A;  1IBX B;  1DOI A;  5BMG A;  1J7B A;  1SB3 C;  3MFG A;  2BYT A;  3O13 A;  3BK2 A;  2WXQ A;  3W5V B;  1I4R A;  1VZ7 A;  2W54 A;  3AE6 B;  1CJE A;  1NI3 A;  4HEA 1;  1E7P B;  3H8H A;  2M56 B;  1NEK B;  3W2D A;  1TJE A;  2PVO D;  3MC0 B;  1IBX A;  1C79 A;  1VZ8 A;  1FFU A;  1XCQ L;  2CJN A;  1VR9 A;  4KKJ A;  2MJD A;  1PFD A;  2B76 B;  1AW7 A;  2BBC A;  1MPE A;  1D5Z C;  4NAW B;  2V0G A;  2WXR A;  3BZD B;  4DXF A;  2INP E;  4D2K A;  4DQO C;  4IDI A;  2YEP B;  4ARI A;  1HZ6 A;  2NMQ A;  4RGM A;  2L1A A;  3W5U B;  4OVZ A;  1ESF A;  1QOG A;  4ZHO A;  2L52 A;  3U7Z A;  2N7J A;  3AB5 A;  4TQ0 A;  3Q8C A;  2PKO A;  1PGB A;  2VZK D;  3GS2 A;  1YQ4 B;  2GI9 A;  1KH0 A;  1OQR A;  1SE3 A;  1WWT A;  1J7A A;  3T3O A;  1L0Y B;  2WXL A;  3HVZ A;  3U4E G;  4XE0 A;  3ABV B;  2DYM A;  2PVG C;  2J42 A;  2KWD A;  2OED A;  2XN9 C;  2SEB D;  2K22 A;  4OZC A;  3RFZ B;  3U2S C;  4ZOH C;  2INN E;  1N5W A;  1EWY C;  1F2R I;  4TMA B;  5D7G A;  1Y56 A;  3B9J A;  2VZK B;  1CQV A;  2RPV A;  1FXI A;  2WP9 B;  4OHJ A;  3E9S A;  4XWW A;  1T6B X;  1QF6 A;  3HUI A;  2LJI A;  2IGG A;  3FAH A;  1B1Z A;  1XF5 L;  3MJ5 A;  1TS3 A;  1I4X A;  4RH6 A;  4ZYS A;  1JRO A;  3Q8E A;  5HHD G;  3MP9 A;  2QIL A;  3NS1 A;  5I4D A;  4A8X C;  2WXP A;  1BUI C;  1RFK A;  1UWX A;  1C9F A;  1NVI D;  1WSP A;  3VQI A;  2Y5C A;  2YEP F;  1FCC C;  4A90 A;  3CWI A;  4KGS A;  2V3N A;  4HKZ E;  1TZO A;  1TKE A;  3SR6 A;  3I9V 1;  4GLS C;  4RGO S;  3BWU D;  4XDD A;  1KLG D;  1NEN B;  4A6Q A;  2PMV A;  2JU6 X;  1C78 A;  3I57 A;  1YMH E;  4A55 A;  3AE8 B;  1OFF A;  2GB1 A;  2CJO A;  2X38 A;  5H92 C;  3NVZ A;  1DOX A;  2OHF A;  4L1B A;  1M4V A;  5G5G A;  3AV8 A;  1ZP0 B;  3B2F A;  4Q2J A;  3P4S B;  4US9 A;  2IPK D;  3AN1 A;  3AE4 B;  4YXD B;  2ACZ B;  2TSS A;  2LHD A;  2V4I B;  3ZGZ A;  5C3J B;  2IGH A;  4R3D A;  1HXY D;  3EGR A;  1C4A A;  4ZHP A;  4UDU C;  1MHX A;  2FUG 1;  4YTN B;  4MAC A;  4C80 A;  1WXQ A;  3WCQ A;  1PDX A;  1FFV A;  5FKA C;  1E6E B;  2XNA C;  4RGT A;  1TY0 A;  1FM0 D;  2WDQ B;  1C77 A;  1V97 A;  4YSY B;  3W9C B;  2WU5 B;  1EU4 A;  3AEC B;  4GDK B;  1PUT A;  1XXG A;  1Q10 A;  4ITK A;  4C7Z A;  4RGN A;  1QOA A;  1QLB B;  2K0P A;  2WQY B;  4RNA A;  3AE9 B;  4B0M A;  2WXF A;  3GP7 A;  1JCK B;  1FD6 A;  2M0A A;  2PLP A;  4KX6 B;  5T8I A;  1YN5 A;  3BVM A;  4YSZ B;  1SBB B;  1ZPS A;  2I2Y A;  2BW2 A;  4XWT A;  2WDV B;  2WXH A;  3SFD B;  1F2R C;  1BML C;  1L0V B;  2QMT A;  3NVW A;  1KRH A;  1JWS D;  2ZW1 A;  2MH7 A;  3EA6 A;  2JQR B;  1KLU D;  1JAL A;  2R61 A;  2H89 B;  1FIQ A;  4KKI A;  1K52 A;  1GB4 A;  1ZDX A;  4US8 A;  1JWA D;  1KFY B;  2Y3A A;  3NZ3 A;  2V3P A;  3AE7 B;  2CU3 A;  2BS2 B;  1SE2 A;  4WIP A;  3V3X A;  1GPX A;  2HDE A;  4L23 A;  2KN4 A;  4LLG M;  1ZDV A;  3BYT B;  3HVD A;  4CQN A;  1V8C A;  1SIJ A;  2H88 B;  4JWU C;  1L4D B;  2IDY A;  2LMC A;  1CZP A;  4FXC A;  5AUI A;  1KTK A;  3FC4 A;  5HG2 A;  1JRP A;  1YN3 A;  2BS4 B;  5EE9 A;  4JPS A;  1D4B A;  3Q8F A;  1TS2 A;  3ZJT A;  1FNW A;  1SJH D;  3MHZ A;  1TKY A;  3HRD D;  4HRO A;  2W82 A;  2E6X A;  2J53 A;  1ZXI A;  3SFE B;  3R8B A;  2PTL A;  2N0S B;  1V1P B;  1T5X D;  4OZA A;  1TKG A;  1XLN A;  2LEK A;  1UUP A;  5LNK 1;  4HJG E;  2JWU A;  2FE8 A;  1SXT A;  4KGT A;  3P63 A;  1FMA D;  4O1N A;  5JXV A;  2PIA A;  2W3R A;  4NAM A;  1EU3 A;  5HI1 A;  1HA5 A;  2BB6 A;  1V1P A;  2J4X A;  4N59 A;  5BMI A;  2DLB A;  1HZ5 A;  4WAF A;  3B2G A;  2LUM A;  3R2T A;  3KLS X;  3P4Q B;  2QSD A;  4NJC A;  3ETR A;  1D5X C;  1DGJ A;  3VR8 B;  3IAS 1;  2EKI A;  1UGJ A;  3TUO A;  2K5P A;  3V05 A;  5BMH A;  3AEE B;  3RPF C;  3SEB A;  3PZ7 A;  3URY A;  2ON8 A;  1N61 A;  5EE3 A;  3LXF A;  1YNT E;  2MEK A;  1RM6 C;  1A70 A;  1XCT L;  3ZQ4 A;  1ENF A;  1FCL A;  2WNM A;  2Z8L A;  4JE3 B;  1LO5 D;  1WGK A;  2DWQ A;  2J52 A;  1ZUD 2;  1ET9 A;  1XO3 A;  1I7H A;  2WXI A;  3AED B;  4H2A A;  5D3D A;  4ARC A;  1VZ6 A;  1NYR A;  1SJE D;  2ONQ A;  2RDH A;  1RYJ A;  1FRD A;  4P6V F;  2HTM E;  3AEA B;  1MI0 A;  2N9L A;  3VRB B;  2WXK A;  2Q5W D;  2L83 A;  4REZ A;  1PYW D;  1JW9 D;  3BVG A;  1E10 A;  1UNS A;  2QIE B;  2WS3 B;  2W3S A;  4WWM A;  1TS5 A;  2D5G A;  4NZL B;  2K9X A;  2WXM A;  2BB5 A;  3AMZ A;  4GDL B;  4A9A A;  2JYE A;  3IAM 1;  3NVV A;  4XDC A;  4WQM A;  2NTS A;  4LTU A;  4P16 A;  4OZB A;  3EUB 2;  5C2T B;  2DBY A;  3GB1 A;  4MT5 A;  3AE1 B;  2WDR B;  5H8Y E;  1YJI A;  3T3N A;  1SF0 A;  1TS4 A;  3LB8 C;  1QKZ A;  1PGX A;  1ZXH A;  2GRI A;  2WXJ A;  4N6E B;  2LHE A;  5HFY A;  1XLQ A;  3AE3 B;  1QOF A;  1IGD A;  1F77 A;  1JML A;  3NUH B;  1D5M C;  1MVK A;  4IKG A;  1FRR A;  4B0E A;  3TEZ A;  1AYF A;  1L6V A;  1HEZ E;  3IT6 B;  4YT0 B;  1NYQ A;  3Q8B A;  3CIR B;  3AH7 A;  2JXT A;  1FEH A;  2N9K A;  2AQ3 B;  5D3I B;  3E56 A;  4J3O D;  1N63 A;  3BVZ A;  1E9M A;  4DXG A;  3U52 E;  2RMM A;  1YQ3 B;  2IJ0 A;  3BII D;  2EEL A;  1OQQ A;  1VDV A;  3ZJU A;  4TQ1 A;  4AS1 A;  2IGD A;  1TYG B;  3AEF B;  3KWL A;  5BYS A;  1P7E A;  3P4R B;  1N5X A;  5MPO A;  1SSN A;  3ZJV A;  1YN4 A;  2JZP A;  2M19 A;  1YJJ A;  1XLO A;  1C4C A;  4IOI E;  1SEB D;  2KMM A;  2BS3 B;  2KAJ A;  3N9Y C;  4WH4 A;  1KF6 B;  4AQ7 A;  2DYO A;  1N60 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...