1T0YA

Solution structure of a ubiquitin-like domain from tubulin-binding cofactor b
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
90
structure length
90
Chain Sequence
MTEVYDLEITTNATDFPMEKKYPAGMSLNDLKKKLELVVGTTVDSMRIQLFDGDDQLKGELTDGAKSLKDLGVRDGYRIHAVDVTGGNED
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Chaperone
molecule keywords tubulin folding cofactor B
publication title Solution Structure of a Ubiquitin-like Domain from Tubulin-binding Cofactor B.
pubmed doi rcsb
source organism Caenorhabditis elegans
total genus 20
structure length 90
sequence length 90
ec nomenclature
pdb deposition date 2004-04-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14560 Ubiquitin_2 Ubiquitin-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 1t0yA00
4NAWA 4ZYNA 3DPDA 2LRUA 3BY4B 1U4AA 4MJSA 2KLCA 2W9NA 1LFDA 3PRZA 1V80A 2BYVE 5JZEB 3JSVB 4W9KA 2ZJDA 4IWQA 3PHXB 4A20A 2DHZA 2FAZA 2MQJA 3NZUA 4YL8A 2MCNB 2CHWA 2M8SA 4IC7B 3KYDD 4IM3A 3VHTC 3X23A 4WJOA 3B1LX 4F7ZA 1OEYJ 3RCZA 1OEYA 4MGIE 4MSMB 3QHTA 2G3QB 1WM2A 3AXCA 3L17A 2LZ6A 4HCPB 5DCNA 2DENB 4MGYE 1SGHA 3ENEA 3UQBA 1BT0A 4LDTB 3Q3JA 5DPTA 2N4FA 2C60A 4GSWA 4J6IA 3L08A 3RYTA 2Z0DB 1GC6A 4ICVA 2LUEA 3PLVA 1YIWA 2N7EA 4NJ7A 2L0FA 1P1AA 1WMHB 4FULA 4DHZE 2XEWA 2D11A 4ZDVA 4TQ1A 1WH3A 3APDA 2J7QB 3VQIA 3QK0A 2K8HA 3C0RB 3VAWA 1XD3B 2D10A 3H6NA 1P0RA 4TKNA 4W9DA 1E7UA 1WF9A 1KOTA 2V4LA 3IFWB 2HD5B 3ZNGC 1WX8A 2ASQA 2CKHB 4TUUA 3VDZA 2BYFA 3QWZB 3KUDB 3ML9A 1NBFC 3PREA 2NPTB 3M63B 4B95A 4GDLB 1UBQA 4II2B 1WGGA 3WAOA 4E71A 1KLVA 2G45B 3U7DA 3UQAA 2YVCA 2O2VA 4IW0A 2JF5A 4K81A 3ZTCA 1ZGUB 3TBLD 2KN5A 2LGXA 2LGDA 3UGBB 3VH3B 4PS3A 3H7PA 1C1YB 3PSEB 4GIVA 2K6DB 1WM3A 3PZDA 3V61A 3ZLZA 5KHQA 3V62A 5EDSA 2WDTB 3DVNU 3QX1A 2VRRB 1UELA 1GC7A 4ZRJA 2DZJA 4CHKA 1WJ4A 3N32A 1Q1OA 1EF5A 3DCGA 2KMCA 2WWZA 4BOZB 2DZMA 4KV2A 5D7GA 2JY6A 3VTVA 2DZIA 2BF8B 4WJQA 3HK0A 3S2AA 5DPWA 4AJYB 2LVPA 2N1VA 3PPAA 4GDKB 3JYUA 3ZKJC 2JVCA 1SIFA 2MBEA 2LD9A 1WXSA 2L7RA 1RRBA 4IG7B 4G0NB 4FLHA 2KKCA 2DZKA 2XBBC 2LI5A 2BWFA 4LJOB 4EOYA 2HTHA 5E6NA 2UYZB 2JT4B 2K6QA 4IWOA 2JUOA 1WR6E 1V5OA 2K8BA 3D32A 1GJZA 1E8WA 2BPSA 3Q3FA 4FHJA 3TIXA 2DAJA 2RPQA 4MGZE 2K25A 1TBEA 1J19A 2JZZA 3DBLI 4W9CA 2MW5A 3ZVVA 2REXA 4ASWC 2KMAA 2NS5A 3A9KA 2K1FA 3QC8B 2RD0A 3H7SA 3UIOB 4AJWA 5GMVA 2LRWA 1I35A 3KYCD 2KDBA 2PPHA 2KJHB 4HCNB 4JL9A 3WA0A 1VCBA 3EC8A 2BYEA 3EFUA 5D94A 4ANVA 1UH6A 1WY8A 4EFOA 4F8CB 3BINA 1S1QB 2N9EB 2EMTA 3L0WB 5DPRA 4IWPA 1P3QU 5CTRC 4DK5A 4FADA 1QZEA 1J8CA 2CHXA 3ONSA 1VD2A 3MHSD 1H8CA 1GNUA 3B08A 4E74A 1V49A 1E8ZA 4JGHB 1F9JA 4XZ4A 4I6NB 2CR5A 1OGWA 3IG3A 3K9PB 4IM2A 3UF8A 2KWCA 2IYDB 1CMXB 2JRIB 3IBEA 3UIPB 4GMVA 1E8YA 2KD0A 4BKGA 2D2QA 1V81A 2I1KA 2KTRA 3I3TB 5D6JB 1UZXB 3MJWA 4HPLB 2KOXA 1WJNA 3KW5B 4BKSD 2GBNA 3ZIMA 1Q5WB 3N30A 2I1JA 5JH5C 3VH4B 4PS8A 4I6LB 2KC2A 5L95C 1YX5B 2KC1A 2L3ZA 2NPTA 3L54A 1UGMA 3CSTA 2MA9B 1JRUA 4LCDE 3VVWB 2BKFA 2EMSA 2J0JA 3AU5A 2ZZPB 5LLIA 1WE7A 2O6VA 4WAAA 1WGYA 2UWQA 4BVUC 5JHBA 3PLUA 3KUZA 4FHKA 4M0WB 4EEWA 2C5LC 4B9KA 3OJ4B 2BKRB 2DX5B 2KQ7A 1Y8RC 2PE6B 1J0GA 2AWTA 2J0MA 3RZWC 4KSLC 2FIDA 3PHWB 4PYUA 2LVOA 2LXAA 5IAAC 2N1WA 2NBVB 4P7IA 3M95A 4EKUA 1RAXA 1MG8A 1GUAB 4DHJB 2KWVB 4KIKA 1LQBA 1RFAA 1L7YA 3LJ3A 4G3XB 4NJ6A 3TMPB 1IPGA 1EO6A 1XT9B 2ZCBA 3W1SC 2MP2A 2ZNVB 2KX3A 2MWSB 5E6PA 3X0WA 1YX6B 1LM8B 1NDDA 2B3AA 4BFRA 4NAWB 1WJ6A 3VUYA 2AL3A 3DBRI 3R7RA 2KDFB 3V60A 2NBUA 4MJSB 2KWUB 4A3OA 1S3SG 3L13A 1ZW7A 2HJ8A 2KHWB 4PYZA 1G6JA 4GB9A 2ZPNA 3A4SC 3PTFC 3ZDMC 3SU8X 2MBQA 4G11A 3EHVA 3H9DA 4F1SA 3HM3A 3IVFA 2KFKA 2LXCA 2IY0B 3GOEA 1WGDA 4MSQB 1PQSA 2G4DB 2JRHA 1WGHA 3H1UA 4FN2A 5AEKB 2GBMA 3ZUNA 2GBJA 2XK5A 2M4NA 4ICUA 2GBKA 2L8JA 4RM9A 2MBBB 1TZ1A 1P98A 4DXAB 3ALBA 4W9GA 2JPHA 3AU4A 5CHVC 5LXIB 5LXHA 2CU1A 1WXVA 3M3JA 4OVUA 3ZNHB 2KANA 1OTRB 5CHFA 2JXXA 3P2BA 4ANWA 2IO0B 3WAPA 2AL6A 3CSFA 3JSVA 2C9WB 3MTNB 4M8MA 2FIFA 2QHOA 2R2QA 3R66C 3WALA 3B0AA 4JLCA 3LDZE 3RZFA 4EUTA 2YLMA 3V6EB 3PGEA 3SD5A 5TR5A 3RD2A 2WYQA 3QCAA 1V86A 4NQKE 2L05A 3PRPB 2IY1B 3CMMB 3NY5A 4W9JA 2EKEC 4WQOB 4II3B 3A1QB 2RSUA 5HKHA 3ZRFA 2C7MB 2KDIA 5L83A 5AZHA 4IM0A 4EZJA 4CYEA 2KNBA 2J0KA 3AI5A 4LJPB 4HK2A 2D3GA 2CHZA 3U30A 4K1RB 4MEMA 3W1SA 1R4NI 3T8MA 2BGFA 2NVUI 1Q0WB 3QQ8B 4W9HA 1E7VA 4HXDA 1WGRA 3WANA 2PEAA 2O2VB 3ZNID 1WX7A 4OVVA 3T9LA 5C23A 1WMHA 4KSKC 2KDEB 3DBHI 2IBIB 1V6EA 1D3ZA 3ZW3A 2RGFA 1R4MI 2Z59B 5G55A 5CX3A 4DHJD 2NR2A 3APCA 3DQVA 4WJPA 2KJRA 2G4SA 4JQWC 4JIOU 3DVGY 2C7NB 4W9FA 3EECA 1NI2A 1K8RB 4HWIB 2GMIC 2L00B 2Z0EB 4KDIC 2ZVOA 4WWOA 3L16A 2ZVNA 4AOFA 1EUVB 4KVGB 4KZCA 3TL5A 2DYBA 1P9DU 4FJVB 4FJYA 1UD7A 1X1MA 2N9PC 3CF6E 3WAMA 1WIAA 2KK8A 3QA8A 2KO3A 4GDLA 3W1YA 2ZEQA 2C7HA 4W9LA 3QARA 4PS7A 4WWPA 4W9IA 3VXWA 3KUCB 2KJ6A 2KX0A 2FCNA 3ZO5B 1YD8U 3JW0X 4WJNA 4KDLB 2MSED 2L0TA 3APFA 3GZNI 3QAQA 3SDLC 3ZRCA 2KTFA 3DBSA 3KVFB 2MRPA 3N3KB 3QIJA 3R3MA 2CS4A 2FNJB 4XC2A 4FJZA 2L76A 2LJ5A 2OJRA 4ANXA 1IYFA 3NS8A 4IUMB 4AWJA 1E5WA 5D2MB 3WIMA 2WX0A 5DPSA 1Z2MA 2IZVB 3A9JB 1WJUA 2K8CA 2KVRA 3NHEB 2N7DA 2IO3B 3R7QA 1M94A 1WR1A 3A9KB 4B6WA 2GBRA 3NZSA 3UINB 1V5TA 5CHWA 1OQYA 2O6VD 3L10B 4BBNC 2KQSA 5JHAA 1L2NA 3HIZA 1EF1A 5AZFA 4GDKA 4NNJB 2A5UA 2DYOA 4HPMB 3TJPA 3ZNZB 4K7UA 5J18A 5J2RA 3M62B 5E6OA 4EZKA 4FA6A 2N9XA 3QJZA 4GXBA 2NCNA 1E90A 5FR6A 3ZTDA 1WE6A 1H4RA 4MDKE 3VTWA 1TGZB 4CO7A 3RT3B 2LASA 1WI0A 2LGYA 1C3TA 4K7WA 2R2OA 4GOCA 1E8XA 2FCMA 1WFYA 3PRMB 4N9F4 2MX2A 1GG3A 2KTRB 1V2YA 4HDOA 5C1ZA 3A1QA 2ZNVC 1WXMA 3ML8A 3DOWA 3RUIB 3K9OB 4WWNA 1A5RA 5KHOA 1WZ3A 5IA7A 3DDCB 4NY0A 1YQBA 4RMAA 4RM8A 2LWPA 1HE8A 3U8ZA 4DWFA 1UBIA 4NPNA 3ECIA 2M17A 4TV3A 1KM7A 1T0YA 1RLFA 2KZRA 4X57B 4ANUA 2IO2B 2V1YA 2O6VB 4G50A 3A33B 2ZPYA 3ZDTA 1ISNA 2MBHA 4XX5A 4DDGD 1WX9A 3AULA 2OOBB 4BKTA 2KXJA 1AARA 4W9EA 4AUQC 2NBWB 3OAWA 4HLEA 3OJ3A 2D07B 1IP9A 3O65B 4MELA 2V3SA 2IO1B 4HVBA 1ZKHA 2FUHB 4MGKE 3V6CB 1I42A 2PE9A 4EZLA 2AEHA 2DYMA 3HM6X 3A4RA 2HE7A 5BO4B 4DBGA 4FBJB 2FCQA 1V9JA 2LVQA 4BOSC 4HJKA 4KIKB 4KZ0A 3VFKA 4MH0E 4TQ0A 3PV1A 1LXDA 2KLGA 4GN1A 3NOBA 2JWZA 5J17A 2MP2B 1XQQA 3PVLA 4K7SA 3VUWA 5G2NA 1FXTB 2KFJA 2JZ3B 4E3CA 2WX1A 1TTNA 2ZCCA 5AZGA 2RR9A 4URKA 1KJTA 2FCSA 3TCAA 3HHMA 2K39A 3KH0A 4ZRKA 4MM3A 3VUXA 1WRDB 4M8NA 2Y5BB 2DAFA 3OLMD 2MBOA 3A9JA 3JVZX 4I6PA 3RULA 3SHQA 2PJHA 4DHZB 2M1MA 3IHPC 2KFKB 4HDQA 3H7PB 3DVNV 1Z5SB 4AP4C 1WXAA 1WZ0A 3DVGX 1WYWB 4LDTD 1YJ1A 4BBNF 2MLBA 4GU2A 1SE9A 2XK5B 3PT2B 4GGQA 4NQLB 4A3PA 2BWES 3PS6A 2AYOB 2A4ZA 4ZRIA 3VTUA 4DDID 2M0XA 2GOWA 4BKSA
chains in the Genus database with same CATH superfamily
4ZYNA 4ZHOA 3DPDA 2LRUA 1ZP0B 2KLCA 2Z8LA 2W9NA 5JZEB 3JSVB 1JRPA 4A20A 2DHZA 3NZUA 4YL8A 2IPKD 1MHHE 3AEDB 2V3PA 4O1NA 3VR8B 2LHDA 4F7ZA 1OEYJ 2G3QB 3AE9B 2LZ6A 5H8YE 4HCPB 2DENB 1PGBA 2BYTA 1FFUA 2WXKA 1L0VB 2J52A 3DBHB 1FPYA 1NYRA 4J6IA 1R4MB 2LUEA 3AE7B 4N58A 4FULA 4DHZE 4ZDVA 4LLGM 1FFVA 3APDA 2JSVX 3VQIA 3C0RB 3VAWA 1YJIA 2D10A 4RFBA 1E7UA 3ZNGC 2HD5B 1GAQB 3ML9A 2NPTB 2QJLA 4HPPA 4B95A 4S0RA 3U7DA 1KRHA 1C77A 1I4PA 2DWQA 2O2VA 2JF5A 1TS3A 2LGDA 3UGBB 2K6DB 1WM3A 3AMZA 3ZQ4A 2WXFA 5AUIA 3I57A 3U2SC 4CHKA 5EE9A 4YSZB 3DCGA 2KMCA 4BOZB 2DZMA 2J53A 1XO3A 2JY6A 3MC0B 5D7GA 5DPWA 3PPAA 3JYUA 3ZKJC 1AWDA 2J4XA 2JVCA 4FLHA 4LJOB 3BVZA 2ZW1A 4C00A 1K51A 2JUOA 2K8BA 5C3JB 1SF0A 1E8WA 3TIXA 2RPVA 1D5ZC 1XEEA 3H7SA 4LNFA 4N59A 4HCNB 1VCBA 4EFOA 4IWPA 2INPE 3ONSA 2INCC 1CZPA 1V49A 4US8A 1F9JA 2PTLA 3HVDA 4HRSA 2CR5A 3IG3A 2IYDB 4GMVA 1E8YA 2KD0A 1V81A 1KTKA 3I3TB 1UZXB 1WJNA 2INDC 1VRAB 3N30A 2I1JA 2IDYA 3IT6B 3VH4B 4I6LB 5L95C 1YX5B 2L3ZA 2NPTA 3L54A 3CSTA 2M56B 2MA9B 3Q8AA 1KLUD 4XWTA 3TEWA 3AU5A 2G1EA 3Q6BA 1J7AA 2BB6A 3OJ4B 2KQ7A 4JX1C 2PE6B 2ONQA 3P42A 1ZDXA 2WXGA 2R61A 4PYUA 1LO5D 4EKUA 3M95A 2BB5A 1QKZA 2KWVB 2Y5PA 1RFAA 4G3XB 4K3CA 2KYWA 4IDIA 3X0WA 2K9XA 2B3AA 4NAWB 1WJ6A 2WXPA 1T0RC 4C7YA 4A3OA 3BYTB 5FKAC 4LNOA 1YNTE 3A4SC 3PTFC 4XE0A 3SU8X 1YJJA 3HM3A 1I4QA 2KFKA 1WGDA 1PQSA 1WGHA 2GBMA 4J3OD 2XK5A 2L8JA 1XCTL 1UWXA 2JX5A 4DXAB 3ALBA 4MACA 1WXVA 4OHJA 2JXXA 3P2BA 4ANWA 2IO0B 3WALA 4EUTA 1FXIA 1C78A 3V6EB 3RD2A 2WYQA 4NQKE 3Q8CA 2L05A 3CMMB 1GPXA 2EKEC 2RSUA 5HKHA 1WRIA 2J0KA 4LJPB 2D3GA 3W1SA 4W9HA 3QQ8B 3W5VB 1E7VA 2KMMA 3WANA 2PEAA 1WX7A 2KDEB 2IBIB 3I9V1 2RGFA 4EE2A 4DHJD 5CX3A 2N9LA 1ENFA 2KJRA 1V1PA 3BVMA 3DVGY 5LNK1 3EECA 2WXNA 2GMIC 2L00B 2W54A 4AOFA 3L16A 2ZVNA 4KZCA 2WS3B 4FJVB 1HA5A 1P9DU 1FM0D 1UD7A 4Q2JA 3N1YC 1WIAA 2KK8A 3QA8A 2Y5CA 2C7HA 2MJDA 4PS7A 3AEAB 1JWMD 2FCNA 4KDLB 2MSED 2GRIA 4LNNA 2KTFA 3FAHA 2MRPA 3QIJA 3R3MA 2FNJB 2N7JA 2L76A 1FCCC 1IYFA 4IUMB 5DPSA 2GBRA 3NZSA 4OZBA 1GOZA 4XWWA 5JHAA 1L2NA 1ACCA 1V1OA 4GDKA 4B0EA 4NNJB 2A5UA 2DYOA 4WQMA 3ZNZB 4REZA 4K7UA 3O13A 5I4DA 5E6OA 4EZKA 4FA6A 3QJZA 1FCLA 2NCNA 3ZTDA 1TGZB 1YMHE 3RT3B 2LASA 3LXFA 1OQQA 1ZPSA 5CTRC 1E8XA 2MX2A 1GG3A 2KTRB 4HDOA 5FR3A 2LGIA 4UDUC 4WWNA 5KHOA 5IA7A 2QILA 2JYTA 4RMAA 2WLBA 2HDEA 2BQQA 2W82A 2RDHA 1RLFA 4ANUA 2IO2B 2V1YA 3DWGC 3TEZA 3ZGZA 1ISNA 3Q3OC 5G5HA 2KXJA 3P4PB 4KGSA 1IP9A 4MELA 3I5JC 1LGRA 5BMIA 3BYYB 4HVBA 1ZKHA 2FUHB 2EELA 4RF0A 4C80A 2WXMA 1C79A 2DYMA 4FXCA 3DBRB 2LGSA 4FBJB 3VFKA 4TQ0A 1J7CA 4GN1A 4YSXB 1AN8A 4K7SA 3VUWA 1PGAA 4KKIA 4TSSA 2WX1A 1TTNA 1OQRA 2ZCCA 2DNFA 1F77A 4M0WA 3TCAA 2K39A 3VR9B 4MM3A 1XLQA 3OLMD 2JZPA 3JVZX 4I6PA 3RULA 2MEKA 3AEGB 4DXFA 3DVNV 1MHXA 2LMCA 1QQRA 4AP4C 1WYWB 3NS1A 4LDTD 4BBNF 1SE3A 1ET6A 2IGDA 1NVID 3MP9A 3PS6A 3RNAC 1RYJA 3VTUA 3T9LA 3Q3MC 4A6QA 2KAJA 4JE3B 4MJSA 1VR9A 1TY0A 2H89B 3RPFC 2FAZA 1SBBB 3VHTC 3KYDD 3MC8A 4LTUA 3B1LX 1ESFA 1SSNA 3RCZA 1TYGB 1HTQA 4MGIE 3IAS1 1WM2A 3IAM1 5DCNA 3Q3NC 1SGHA 3UQBA 1PUTA 1B1ZA 2N4FA 4GSWA 3L08A 3P4QB 1GC6A 2WHIA 4ICVA 1VZ7A 3DWMA 1WMHB 4KGRA 1TKEA 4C7ZA 2B76B 2I2YA 4ZRQA 2WP9B 1PDXA 1WF9A 3B2FA 4A9AA 1TS4A 1KOTA 1WX8A 1UGJA 2VH2A 3VDZA 3QWZB 1NBFC 4HEA1 4PT5A 2NTTA 1UBQA 4WH4A 2G45B 3UQAA 1F0ZA 2YVCA 5JXVA 1J7BA 2K3UA 3U52E 3TBLD 2KN5A 1DOIA 3V61A 2CJOA 2M19A 5EDSA 3DVNU 3FC4A 1T3QA 4WWMA 2DZJA 1Q1OA 4NAMA 2BS3B 3BK1A 3VTVA 4OVZA 3S2AA 4AJYB 2N1VA 1WXSA 2L7RA 2LD9A 3AM9A 1QILA 2JWUA 2KKCA 2XBBC 4EOYA 4YWGG 2HTHA 2L32A 1WGKA 1V5OA 2BPSA 4P1CC 4IOIE 2RPQA 3RN9C 1KF6B 4W9CA 1J19A 2JZZA 1D4BA 3ZVVA 4ASWC 2KMAA 2NS5A 3QC8B 5GMVA 2LRWA 4HJGE 2KDBA 3WA0A 2KJHB 4H2AA 4JL9A 3EFUA 4F8CB 3V3XA 1S1QB 4HKZE 1MPEA 2EMTA 4RGTA 1P3QU 4DK5A 1QZEA 5IOIA 1GNUA 4E74A 3AEBB 1E8ZA 4I6NB 3AECB 2JRIB 3UIPB 4US9A 5D6JB 3MJWA 4HPLB 3KW5B 5JH5C 4PS8A 2ICIA 1UGMA 1JRUA 3NVZA 2QC8A 1TT5B 2O6VA 1VDVA 3WCQA 2D3AA 2IJ0A 4FHKA 1TKGA 2JYEA 2DX5B 1Y8RC 3E56A 1J0GA 4KSLC 1ZOYB 2VH1A 4KGTA 2LVOA 5IAAC 2NBVB 1QLBB 1FNVA 2QSDA 2AQ2B 3PZ7A 1FNUA 4DHJB 4KIKA 3LJ3A 2VZKD 3W1SC 3AE4B 1VZ6A 2MP2A 2KX3A 2ZNVB 1YX6B 3VRBB 5FK9C 2QDFA 5HHDG 3C19A 3TSSA 3L13A 3RNBC 1MVKA 1SJHD 1L4ZB 4R3DA 1Y56A 2MBQA 3H9DA 4RF1A 3IVFA 2LXCA 2KDMA 4HKQA 3HRDD 4RM9A 2GBKA 2MBBB 1TZ1A 4WAFA 1DGJA 4W9GA 5CHVC 1N5WA 3AE3B 5E6JA 3Q14C 3ZNHB 1OTRB 2L52A 3AE8B 2KVZA 3WAPA 4M8MA 3JSVA 1JWBD 1PGXA 2FIFA 2R2QA 2WXRA 2WDQB 3B0AA 4JLCA 1E7PB 3LDZE 2YLMA 1YQ4B 4M00A 3FILB 2LHEA 3QCAA 1V86A 4RGNA 1WYGA 3NY5A 1IUEA 3IT4B 4WQOB 4II3B 4S17A 3ZRFA 2C7MB 4IM0A 3ZYYX 4YT0B 4EZJA 1A70A 1NENB 4HK2A 1QOFA 2CHZA 4MEMA 4RCOA 2BGFA 1Q0WB 1EU4A 4MT5A 2IGGA 3ZNID 2WXLA 5C23A 4KSKC 1FXAA 2XNAC 3DBHI 1RWSA 1R4MI 3GB1A 3APCA 2K5PA 1T6BX 4JQWC 2N0SB 4W9FA 3BK2A 1L4DB 4WWOA 1EUVB 2DYBA 2PIAA 3WAMA 2N9PC 1HEZE 1BMLC 3QARA 4W9IA 4WJNA 1N5XA 3QAQA 3SDLC 3GZNI 3ZRCA 3DBLB 4M02A 2CS4A 2LJ5A 2OJRA 2LUMA 3WIMA 3P4SB 2IZVB 2KVRA 1QOAA 2N7DA 3NUHB 2IO3B 3GP7A 1FMAD 3A9KB 4B6WA 4L23A 4A8XC 5CHWA 2O6VD 3B9JA 3HIZA 3NVYA 1EF1A 5AZFA 1V97A 3TEXA 3TJPA 5J18A 1PYWD 2N9XA 4GXBA 5FR6A 1E90A 3Q8BA 2WQYB 1WI0A 1DYQA 1XLPA 1WFYA 1V2YA 1M4VA 1TS2A 4USAA 2SAKA 3LB8C 4MH8A 1WXMA 3DOWA 3K9OB 1WZ3A 4K3BA 4NY0A 1DOYA 1YQBA 2V3NA 4RM8A 4YXDB 1HE8A 3U8ZA 3NRZA 1UBIA 1WWTA 4NPNA 4X57B 1T0YA 1C4CA 3SR6A 1HXYD 2ZPYA 3ZDTA 2MBHA 4XX5A 4DDGD 5BMGA 2GI9A 4BKTA 1L5PA 2JU6X 2NBWB 3OAWA 1F52A 2D07B 3OJ3A 3O65B 1QT9A 1D5MC 1NYQA 2IO1B 1YN3A 2X8XX 1IGDA 1I42A 1XLNA 1BXTA 5BO4B 2LVQA 4BOSC 1LXDA 2KLGA 3NOBA 5D3DA 3AB5A 3GS2A 1C9FA 1FXTB 2JZ3B 4E3CA 3TUOA 5D3IB 1MFWA 5AZGA 1DOXA 4URKA 2OJWA 3HHMA 3VUXA 3RI7C 2MBOA 4YTMB 5BYQA 3SHQA 2PJHA 4HDQA 3H7PB 3DVGX 1XF5L 1YJ1A 3HUIA 2V4IB 2W55A 4XGAB 3PT2B 4NQLB 2WNMA 4WURA 4C4VB 4ZOHC 2M0XA 4DDID 2GOWA 4BKSA 4NAWA 4OZCA 1SB3C 1LFDA 4JWSC 4W9KA 2ZJDA 4IWQA 2CU3A 3PHXB 2CHWA 4IC7B 1V8CA 1JMLA 3X23A 1JWSD 4WJOA 4CQNA 3QHTA 3AXCA 5TSSA 4HROA 2WXQA 1BT0A 3V05A 4AS1A 3P4RB 3ZXRA 3PZ8A 2M0AA 2G9HD 1EM7A 2D11A 5H92C 3C8YA 4TQ1A 1FD6A 3N1ZC 2J7QB 3IXSA 3QK0A 3H6NA 1P0RA 4W9DA 2NMQA 2WGSA 2ASQA 5BMHA 4TUUA 2BYFA 1WSPA 3EA6A 1UF0A 3PREA 4GDLB 3OWEB 4II2B 1TJEA 3WAOA 4E71A 2N9KA 4IW0A 3MHZA 3ZTCA 1ZGUB 2BS2B 2ON8A 1PFDA 1N61A 3H7PA 1C1YB 2E6XA 5KHQA 1T5XD 2BS4B 2WDTB 5GXGB 4ZYSA 2W3SA 4C4VA 1WJ4A 3N32A 1IBXB 1EF5A 1L6VA 4KV2A 1ROEA 2DZIA 1N63A 4G0NB 2DZKA 2Y3AA 5E6NA 2UYZB 5AUKA 2YEPB 4P16A 2JT4B 3BVGA 2K6QA 1GJZA 3Q3FA 4FHJA 2DAJA 1I4RA 2K25A 1TBEA 2MW5A 1K50A 2EKIA 2RD0A 3UIOB 1I35A 4FADA 3EC8A 3Q2AC 2BYEA 5D94A 4ANVA 1UH6A 3BINA 2N9EB 3L0WB 1J8CA 3MHSD 3AE2B 3B08A 4JGHB 4XZ4A 3K9PB 2KWCA 3NG0A 1OFFA 5G5GA 4LK0M 2KTRA 3MFGA 1UNSA 4XDDA 4WIPA 3W2DA 3N1XC 2KOXA 4BKSD 2GBNA 3ZIMA 1Q5WB 3EGRA 2KT7A 3NVWA 1STEA 2KC1A 2PLPA 2QCZA 4L1BA 2FBWB 1N6ZA 1XCQL 1D5XC 4LCDE 3SFEB 5LLIA 1CQVA 1WE7A 4WAAA 2UWQA 3PLUA 3KUZA 4EEWA 2AWTA 3RZWC 2HJ1A 3E9SA 1WXQA 3PHWB 3L4PA 3GE8C 3ZJTA 4P7IA 5MPOA 2FE8A 5EE1A 1LQBA 4NJ6A 1IPGA 1QOBA 2KN4A 3DHIC 4BFRA 4RGMA 3VUYA 3DBRI 3R7RA 2KDFB 2XN9C 2AQ1B 2RMMA 1S3SG 2KHWB 2E3TA 1G6JA 3N20C 3RNFC 1YOVB 4ZRPA 4G11A 3EHVA 4F1SA 1T0QC 3GE3C 1SE2A 3GOEA 1L0XB 4MSQB 2G4DB 5AEKB 4LNIA 2H88B 3ZUNA 2GBJA 2M4NA 3T3NA 4ICUA 5LXIB 3AU4A 3AE5B 2CU1A 3M3JA 2KANA 5CHFA 1FIQA 2DLBA 3URYA 3R66C 2QHOA 3U7ZA 1VJKA 4RH6A 1ET9A 1FRDA 3AE1B 5TR5A 1JCKB 3PRPB 2IY1B 4W9JA 1ZE3D 3SFDB 3MJ5A 3FKYA 5L83A 4CYEA 3U30A 1R4NI 3B2GA 2NVUI 1SE4A 1E9MA 1WGRA 1E10A 2O2VB 4OVVA 2DBYA 1WMHA 3ZW3A 3TEYA 1MI0A 2Z59B 5G55A 2NR2A 3DQVA 4WJPA 2G4SA 4JIOU 4JWUC 2C7NB 2PKOA 1KFYB 2Z0EB 2WU2B 1MG4A 2ZVOA 3TL5A 4FJYA 3W1YA 3Q69A 2ZEQA 4W9LA 4WWPA 3KUCB 2KJ6A 1E0ZA 1ZXIA 1YD8U 3JW0X 3OG5A 2L0TA 3N3KB 5EE0A 4XC2A 5IKCM 1JQ4A 4AWJA 2D3BA 5D2MB 1CK1A 1Z2MA 3A9JB 2PVGC 4ZHPA 3R7QA 1M94A 1OQYA 4BBNC 2KQSA 2KACA 2KQ4X 2K22A 3NVVA 3SEBA 1UWMA 5J2RA 3MC9A 3RNEC 1H4RA 3VTWA 1SEBD 3W5UB 4K7WA 4N9F4 1HTOA 4GLSC 2FCMA 1SJED 2INNE 3KLSX 3W9CB 3EUB2 2WXJA 2ACZB 1A5RA 3GZNB 2YEPF 1Q10A 5IO9A 2LEKA 2M17A 1KM7A 2IGHA 1CJEA 3H8HA 2TSSA 1WX9A 1GB4A 1JWAD 4BAXA 4HLEA 2WXOA 2V3SA 1N60A 2WXIA 4NZLB 3KQ4A 3NZ3A 4EZLA 2AEHA 3HM6X 3A4RA 2HE7A 2FCQA 1V9JA 2BTEA 4KZ0A 4MH0E 2QIEB 3PVLA 1XQQA 5J17A 1VZ8A 1RM6C 5G2NA 2KFJA 3P1MA 2FCSA 4QAYA 4IKGA 3KH0A 4ZRKA 4M8NA 2DAFA 3A9JA 2M1MA 2KFKB 1NEKB 1WXAA 1WZ0A 2XK5B 1C4AA 4GGQA 5EE3A 1JALA 2WU5B 3AH7A 2BWES 2AYOB 2OEDA 3ZJUA 1FRRA 2D5GA 2X38A 3BY4B 3AEEB 1U4AA 3VRAB 1FO4A 3J9CA 3PRZA 1V80A 2BYVE 3CIRB 1NI3A 1YQ3B 2MQJA 2MCNB 2M8SA 4IM3A 4N6EB 3AEFB 1OEYA 4ARCA 2MJEA 4MSMB 3L17A 4MGYE 5HG2A 1BUIC 3ENEA 1FNWA 1D6EC 5T8IA 4LDTB 3I63C 3Q3JA 3N9YC 5DPTA 3BIID 2C60A 3RYTA 1TKYA 2Z0DB 3PLVA 1YIWA 2N7EA 4NJ7A 2L0FA 1P1AA 3FILA 4P1BC 2XEWA 4D2KA 1WH3A 2K8HA 1V1PB 1XD3B 4TKNA 4ITKA 2BBCA 2V4LA 2AQ3B 3IFWB 3EFCA 2CKHB 1F2RI 3KUDB 2L1AA 2PW9A 3M63B 2V0GA 4BZAA 4OZAA 3PO0A 1L6UA 1WGGA 2ZW0A 1KLVA 4K81A 2LGXA 3VH3B 1ZDVA 4RNAA 4PS3A 2QEJC 4GIVA 3PSEB 4TMAB 3PZDA 3ZLZA 3V62A 3Q8EA 3QX1A 2VRRB 2K0PA 1UELA 1GC7A 4ZRJA 2WWZA 3AE6B 4ARIA 2BF8B 4WJQA 3HK0A 2LVPA 4GDKB 1SIFA 2MBEA 1AW7A 1RRBA 4IG7B 3BZDB 2BWFA 2LI5A 4IWOA 1WR6E 3D32A 2LFIA 2QMTA 4MGZE 3AV8A 3RNGC 3DBLI 3AN1A 1F1HA 2REXA 2BW2A 1JW9D 1ZUD2 3A9KA 2K1FA 4AJWA 3KYCD 2PPHA 2WDRB 4NJCA 1WY8A 5HI1A 5DPRA 2CHXA 2JXTA 1VD2A 2SEBD 1H8CA 1P7FA 3RFZB 1I4XA 2V9HA 1OGWA 4IM2A 3UF8A 3IBEA 1CMXB 4BKGA 2D2QA 2I1KA 3DHHC 1QOGA 4YTPB 1EU3A 2I38A 2KC2A 1YN4A 4OW0A 1I4HA 3VVWB 2BKFA 4YSYB 2EMSA 2J0JA 2ZZPB 5IN7A 4M01A 2WDVB 1WGYA 4BVUC 5JHBA 4M0WB 2C5LC 4B9KA 5C2TB 2BKRB 4MM3B 1SXTA 2J0MA 2FIDA 1HZ5A 1TS5A 2LXAA 2N1WA 4L2YA 1RAXA 1MG8A 1GUAB 3P63A 4C56C 1L7YA 3TMPB 1XT9B 1EO6A 2ZCBA 2GB1A 2MWSB 5E6PA 2D3CA 1LM8B 1NDDA 3HVZA 1HZ6A 2AL3A 1C4PA 3V60A 2NBUA 4MJSB 1XLOA 4YTNB 2L83A 2KWUB 1ZW7A 2HJ8A 4PYZA 4GB9A 2ZPNA 3ZDMC 3UI3A 2IY0B 2NTSA 1I7HA 2JRHA 3H1UA 4FN2A 1E6EB 2MJ3A 4PK1A 3ZXVA 1P98A 2JPHA 5LXHA 4OVUA 1TY2A 1HQRD 4ACFA 4A90A 1XXGA 2AL6A 2VZKB 3CSFA 2C9WB 3MTNB 4AQ7A 3Q8FA 3RZFA 1KH0A 3PGEA 2BVCA 3SD5A 1JROA 2PMVA 3ZJVA 2RDGA 5HFYA 3KWVA 2OHFA 3ETRA 3A1QB 2KDIA 3T3OA 5AZHA 4KX6B 4XYCA 2KNBA 3AI5A 4K1RB 3T8MA 4HXDA 5IP4D 4XDCA 1C76A 1SIJA 1V6EA 1D3ZA 4LNKA 1NI2A 3R2TA 1K8RB 4HWIB 2MH7A 4KDIC 4KVGB 1T0SC 1X1MA 3CF6E 1RFKA 2KO3A 4GDLA 3U4EG 3VXWA 2Q5WD 2KX0A 3ZO5B 1MJDA 3APFA 3RMKC 3R2IA 3DBSA 2UU7A 3KVFB 1VLBA 4FJZA 1KLGD 3CWIA 4KKJA 4ANXA 3NS8A 1E5WA 1YN5A 2WX0A 1EWYC 1WJUA 2K8CA 3NHEB 1I4GA 1R4NB 1WR1A 2GLSA 1IBXA 2FUG1 3UINB 1P7EA 1V5TA 3L10B 5BYSA 2PVOD 1EWCA 4HPMB 2J42A 1L0YB 3M62B 1WE6A 4CO7A 4MDKE 1UUPA 2LGYA 3ABVB 1C3TA 2KWDA 2R2OA 4GOCA 3PRMB 2HTME 5C1ZA 5BYRA 2CJNA 3A1QA 4B0MA 2ZNVC 3ML8A 3RUIB 2WXHA 3DDCB 4JPSA 2LWPA 4DWFA 4DQOC 3ECIA 2JQRB 4TV3A 2KZRA 2O6VB 4G50A 3A33B 3AULA 3KWLA 2OOBB 1ZXHA 3DHGC 2LJIA 1AARA 4W9EA 4AUQC 1GB1A 4DXGA 4MGKE 1K52A 3V6CB 1IGCA 2PE9A 4A55A 4RGOS 2MHJA 4DBGA 4HJKA 4KIKB 3PV1A 2BT6A 3BWUD 2W3RA 2JWZA 2MP2B 1AYFA 1FEHA 1TZOA 2RR9A 1KJTA 3LYYA 2RDBC 1F2RC 1B9RA 3R8BA 1WRDB 2Y5BB 3NJTA 4P6VF 2AX5A 4DHZB 3IHPC 1Z5SB 1QF6A 2MLBA 4GU2A 1SE9A 1N62A 3RNCC 1TIFA 1R7SA 4A3PA 2A4ZA 4ZRIA 1JWUD 1K53A
chains in the Genus database with same CATH topology
4NAWA 4ZYNA 3DPDA 2LRUA 3BY4B 1U4AA 4MJSA 2KLCA 2W9NA 1LFDA 3PRZA 1V80A 2BYVE 5JZEB 3JSVB 4W9KA 2ZJDA 4IWQA 3PHXB 4A20A 2DHZA 2FAZA 2MQJA 3NZUA 4YL8A 2MCNB 2CHWA 2M8SA 4IC7B 3KYDD 4IM3A 3VHTC 3X23A 4WJOA 3B1LX 4F7ZA 1OEYJ 3RCZA 1OEYA 4MGIE 4MSMB 3QHTA 2G3QB 1WM2A 3AXCA 3L17A 2LZ6A 4HCPB 5DCNA 2DENB 4MGYE 1SGHA 3ENEA 3UQBA 1BT0A 4LDTB 3Q3JA 5DPTA 2N4FA 2C60A 4GSWA 4J6IA 3L08A 3RYTA 2Z0DB 1GC6A 4ICVA 2LUEA 3PLVA 1YIWA 2N7EA 4NJ7A 2L0FA 1P1AA 1WMHB 4FULA 4DHZE 2XEWA 2D11A 4ZDVA 4TQ1A 1WH3A 3APDA 2J7QB 3VQIA 3QK0A 2K8HA 3C0RB 3VAWA 1XD3B 2D10A 3H6NA 1P0RA 4TKNA 4W9DA 1E7UA 1WF9A 1KOTA 2V4LA 3IFWB 2HD5B 3ZNGC 1WX8A 2ASQA 2CKHB 4TUUA 3VDZA 2BYFA 3QWZB 3KUDB 3ML9A 1NBFC 3PREA 2NPTB 3M63B 4B95A 4GDLB 1UBQA 4II2B 1WGGA 3WAOA 4E71A 1KLVA 2G45B 3U7DA 3UQAA 2YVCA 2O2VA 4IW0A 2JF5A 4K81A 3ZTCA 1ZGUB 3TBLD 2KN5A 2LGXA 2LGDA 3UGBB 3VH3B 4PS3A 3H7PA 1C1YB 3PSEB 4GIVA 2K6DB 1WM3A 3PZDA 3V61A 3ZLZA 5KHQA 3V62A 5EDSA 2WDTB 3DVNU 3QX1A 2VRRB 1UELA 1GC7A 4ZRJA 2DZJA 4CHKA 1WJ4A 3N32A 1Q1OA 1EF5A 3DCGA 2KMCA 2WWZA 4BOZB 2DZMA 4KV2A 5D7GA 2JY6A 3VTVA 2DZIA 2BF8B 4WJQA 3HK0A 3S2AA 5DPWA 4AJYB 2LVPA 2N1VA 3PPAA 4GDKB 3JYUA 3ZKJC 2JVCA 1SIFA 2MBEA 2LD9A 1WXSA 2L7RA 1RRBA 4IG7B 4G0NB 4FLHA 2KKCA 2DZKA 2XBBC 2LI5A 2BWFA 4LJOB 4EOYA 2HTHA 5E6NA 2UYZB 2JT4B 2K6QA 4IWOA 2JUOA 1WR6E 1V5OA 2K8BA 3D32A 1GJZA 1E8WA 2BPSA 3Q3FA 4FHJA 3TIXA 2DAJA 2RPQA 4MGZE 2K25A 1TBEA 1J19A 2JZZA 3DBLI 4W9CA 2MW5A 3ZVVA 2REXA 4ASWC 2KMAA 2NS5A 3A9KA 2K1FA 3QC8B 2RD0A 3H7SA 3UIOB 4AJWA 5GMVA 2LRWA 1I35A 3KYCD 2KDBA 2PPHA 2KJHB 4HCNB 4JL9A 3WA0A 1VCBA 3EC8A 2BYEA 3EFUA 5D94A 4ANVA 1UH6A 1WY8A 4EFOA 4F8CB 3BINA 1S1QB 2N9EB 2EMTA 3L0WB 5DPRA 4IWPA 1P3QU 5CTRC 4DK5A 4FADA 1QZEA 1J8CA 2CHXA 3ONSA 1VD2A 3MHSD 1H8CA 1GNUA 3B08A 4E74A 1V49A 1E8ZA 4JGHB 1F9JA 4XZ4A 4I6NB 2CR5A 1OGWA 3IG3A 3K9PB 4IM2A 3UF8A 2KWCA 2IYDB 1CMXB 2JRIB 3IBEA 3UIPB 4GMVA 1E8YA 2KD0A 4BKGA 2D2QA 1V81A 2I1KA 2KTRA 3I3TB 5D6JB 1UZXB 3MJWA 4HPLB 2KOXA 1WJNA 3KW5B 4BKSD 2GBNA 3ZIMA 1Q5WB 3N30A 2I1JA 5JH5C 3VH4B 4PS8A 4I6LB 2KC2A 5L95C 1YX5B 2KC1A 2L3ZA 2NPTA 3L54A 1UGMA 3CSTA 2MA9B 1JRUA 4LCDE 3VVWB 2BKFA 2EMSA 2J0JA 3AU5A 2ZZPB 5LLIA 1WE7A 2O6VA 4WAAA 1WGYA 2UWQA 4BVUC 5JHBA 3PLUA 3KUZA 4FHKA 4M0WB 4EEWA 2C5LC 4B9KA 3OJ4B 2BKRB 2DX5B 2KQ7A 1Y8RC 2PE6B 1J0GA 2AWTA 2J0MA 3RZWC 4KSLC 2FIDA 3PHWB 4PYUA 2LVOA 2LXAA 5IAAC 2N1WA 2NBVB 4P7IA 3M95A 4EKUA 1RAXA 1MG8A 1GUAB 4DHJB 2KWVB 4KIKA 1LQBA 1RFAA 1L7YA 3LJ3A 4G3XB 4NJ6A 3TMPB 1IPGA 1EO6A 1XT9B 2ZCBA 3W1SC 2MP2A 2ZNVB 2KX3A 2MWSB 5E6PA 3X0WA 1YX6B 1LM8B 1NDDA 2B3AA 4BFRA 4NAWB 1WJ6A 3VUYA 2AL3A 3DBRI 3R7RA 2KDFB 3V60A 2NBUA 4MJSB 2KWUB 4A3OA 1S3SG 3L13A 1ZW7A 2HJ8A 2KHWB 4PYZA 1G6JA 4GB9A 2ZPNA 3A4SC 3PTFC 3ZDMC 3SU8X 2MBQA 4G11A 3EHVA 3H9DA 4F1SA 3HM3A 3IVFA 2KFKA 2LXCA 2IY0B 3GOEA 1WGDA 4MSQB 1PQSA 2G4DB 2JRHA 1WGHA 3H1UA 4FN2A 5AEKB 2GBMA 3ZUNA 2GBJA 2XK5A 2M4NA 4ICUA 2GBKA 2L8JA 4RM9A 2MBBB 1TZ1A 1P98A 4DXAB 3ALBA 4W9GA 2JPHA 3AU4A 5CHVC 5LXIB 5LXHA 2CU1A 1WXVA 3M3JA 4OVUA 3ZNHB 2KANA 1OTRB 5CHFA 2JXXA 3P2BA 4ANWA 2IO0B 3WAPA 2AL6A 3CSFA 3JSVA 2C9WB 3MTNB 4M8MA 2FIFA 2QHOA 2R2QA 3R66C 3WALA 3B0AA 4JLCA 3LDZE 3RZFA 4EUTA 2YLMA 3V6EB 3PGEA 3SD5A 5TR5A 3RD2A 2WYQA 3QCAA 1V86A 4NQKE 2L05A 3PRPB 2IY1B 3CMMB 3NY5A 4W9JA 2EKEC 4WQOB 4II3B 3A1QB 2RSUA 5HKHA 3ZRFA 2C7MB 2KDIA 5L83A 5AZHA 4IM0A 4EZJA 4CYEA 2KNBA 2J0KA 3AI5A 4LJPB 4HK2A 2D3GA 2CHZA 3U30A 4K1RB 4MEMA 3W1SA 1R4NI 3T8MA 2BGFA 2NVUI 1Q0WB 3QQ8B 4W9HA 1E7VA 4HXDA 1WGRA 3WANA 2PEAA 2O2VB 3ZNID 1WX7A 4OVVA 3T9LA 5C23A 1WMHA 4KSKC 2KDEB 3DBHI 2IBIB 1V6EA 1D3ZA 3ZW3A 2RGFA 1R4MI 2Z59B 5G55A 5CX3A 4DHJD 2NR2A 3APCA 3DQVA 4WJPA 2KJRA 2G4SA 4JQWC 4JIOU 3DVGY 2C7NB 4W9FA 3EECA 1NI2A 1K8RB 4HWIB 2GMIC 2L00B 2Z0EB 4KDIC 2ZVOA 4WWOA 3L16A 2ZVNA 4AOFA 1EUVB 4KVGB 4KZCA 3TL5A 2DYBA 1P9DU 4FJVB 4FJYA 1UD7A 1X1MA 2N9PC 3CF6E 3WAMA 1WIAA 2KK8A 3QA8A 2KO3A 4GDLA 3W1YA 2ZEQA 2C7HA 4W9LA 3QARA 4PS7A 4WWPA 4W9IA 3VXWA 3KUCB 2KJ6A 2KX0A 2FCNA 3ZO5B 1YD8U 3JW0X 4WJNA 4KDLB 2MSED 2L0TA 3APFA 3GZNI 3QAQA 3SDLC 3ZRCA 2KTFA 3DBSA 3KVFB 2MRPA 3N3KB 3QIJA 3R3MA 2CS4A 2FNJB 4XC2A 4FJZA 2L76A 2LJ5A 2OJRA 4ANXA 1IYFA 3NS8A 4IUMB 4AWJA 1E5WA 5D2MB 3WIMA 2WX0A 5DPSA 1Z2MA 2IZVB 3A9JB 1WJUA 2K8CA 2KVRA 3NHEB 2N7DA 2IO3B 3R7QA 1M94A 1WR1A 3A9KB 4B6WA 2GBRA 3NZSA 3UINB 1V5TA 5CHWA 1OQYA 2O6VD 3L10B 4BBNC 2KQSA 5JHAA 1L2NA 3HIZA 1EF1A 5AZFA 4GDKA 4NNJB 2A5UA 2DYOA 4HPMB 3TJPA 3ZNZB 4K7UA 5J18A 5J2RA 3M62B 5E6OA 4EZKA 4FA6A 2N9XA 3QJZA 4GXBA 2NCNA 1E90A 5FR6A 3ZTDA 1WE6A 1H4RA 4MDKE 3VTWA 1TGZB 4CO7A 3RT3B 2LASA 1WI0A 2LGYA 1C3TA 4K7WA 2R2OA 4GOCA 1E8XA 2FCMA 1WFYA 3PRMB 4N9F4 2MX2A 1GG3A 2KTRB 1V2YA 4HDOA 5C1ZA 3A1QA 2ZNVC 1WXMA 3ML8A 3DOWA 3RUIB 3K9OB 4WWNA 1A5RA 5KHOA 1WZ3A 5IA7A 3DDCB 4NY0A 1YQBA 4RMAA 4RM8A 2LWPA 1HE8A 3U8ZA 4DWFA 1UBIA 4NPNA 3ECIA 2M17A 4TV3A 1KM7A 1T0YA 1RLFA 2KZRA 4X57B 4ANUA 2IO2B 2V1YA 2O6VB 4G50A 3A33B 2ZPYA 3ZDTA 1ISNA 2MBHA 4XX5A 4DDGD 1WX9A 3AULA 2OOBB 4BKTA 2KXJA 1AARA 4W9EA 4AUQC 2NBWB 3OAWA 4HLEA 3OJ3A 2D07B 1IP9A 3O65B 4MELA 2V3SA 2IO1B 4HVBA 1ZKHA 2FUHB 4MGKE 3V6CB 1I42A 2PE9A 4EZLA 2AEHA 2DYMA 3HM6X 3A4RA 2HE7A 5BO4B 4DBGA 4FBJB 2FCQA 1V9JA 2LVQA 4BOSC 4HJKA 4KIKB 4KZ0A 3VFKA 4MH0E 4TQ0A 3PV1A 1LXDA 2KLGA 4GN1A 3NOBA 2JWZA 5J17A 2MP2B 1XQQA 3PVLA 4K7SA 3VUWA 5G2NA 1FXTB 2KFJA 2JZ3B 4E3CA 2WX1A 1TTNA 2ZCCA 5AZGA 2RR9A 4URKA 1KJTA 2FCSA 3TCAA 3HHMA 2K39A 3KH0A 4ZRKA 4MM3A 3VUXA 1WRDB 4M8NA 2Y5BB 2DAFA 3OLMD 2MBOA 3A9JA 3JVZX 4I6PA 3RULA 3SHQA 2PJHA 4DHZB 2M1MA 3IHPC 2KFKB 4HDQA 3H7PB 3DVNV 1Z5SB 4AP4C 1WXAA 1WZ0A 3DVGX 1WYWB 4LDTD 1YJ1A 4BBNF 2MLBA 4GU2A 1SE9A 2XK5B 3PT2B 4GGQA 4NQLB 4A3PA 2BWES 3PS6A 2AYOB 2A4ZA 4ZRIA 3VTUA 4DDID 2M0XA 2GOWA 4BKSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4NAW A;  4ZYN A;  3DPD A;  2LRU A;  3BY4 B;  1U4A A;  4MJS A;  2KLC A;  2W9N A;  1LFD A;  3PRZ A;  1V80 A;  2BYV E;  5JZE B;  3JSV B;  4W9K A;  2ZJD A;  4IWQ A;  3PHX B;  4A20 A;  2DHZ A;  2FAZ A;  2MQJ A;  3NZU A;  4YL8 A;  2MCN B;  2CHW A;  2M8S A;  4IC7 B;  3KYD D;  4IM3 A;  3VHT C;  3X23 A;  4WJO A;  3B1L X;  4F7Z A;  1OEY J;  3RCZ A;  1OEY A;  4MGI E;  4MSM B;  3QHT A;  2G3Q B;  1WM2 A;  3AXC A;  3L17 A;  2LZ6 A;  4HCP B;  5DCN A;  2DEN B;  4MGY E;  1SGH A;  3ENE A;  3UQB A;  1BT0 A;  4LDT B;  3Q3J A;  5DPT A;  2N4F A;  2C60 A;  4GSW A;  4J6I A;  3L08 A;  3RYT A;  2Z0D B;  1GC6 A;  4ICV A;  2LUE A;  3PLV A;  1YIW A;  2N7E A;  4NJ7 A;  2L0F A;  1P1A A;  1WMH B;  4FUL A;  4DHZ E;  2XEW A;  2D11 A;  4ZDV A;  4TQ1 A;  1WH3 A;  3APD A;  2J7Q B;  3VQI A;  3QK0 A;  2K8H A;  3C0R B;  3VAW A;  1XD3 B;  2D10 A;  3H6N A;  1P0R A;  4TKN A;  4W9D A;  1E7U A;  1WF9 A;  1KOT A;  2V4L A;  3IFW B;  2HD5 B;  3ZNG C;  1WX8 A;  2ASQ A;  2CKH B;  4TUU A;  3VDZ A;  2BYF A;  3QWZ B;  3KUD B;  3ML9 A;  1NBF C;  3PRE A;  2NPT B;  3M63 B;  4B95 A;  4GDL B;  1UBQ A;  4II2 B;  1WGG A;  3WAO A;  4E71 A;  1KLV A;  2G45 B;  3U7D A;  3UQA A;  2YVC A;  2O2V A;  4IW0 A;  2JF5 A;  4K81 A;  3ZTC A;  1ZGU B;  3TBL D;  2KN5 A;  2LGX A;  2LGD A;  3UGB B;  3VH3 B;  4PS3 A;  3H7P A;  1C1Y B;  3PSE B;  4GIV A;  2K6D B;  1WM3 A;  3PZD A;  3V61 A;  3ZLZ A;  5KHQ A;  3V62 A;  5EDS A;  2WDT B;  3DVN U;  3QX1 A;  2VRR B;  1UEL A;  1GC7 A;  4ZRJ A;  2DZJ A;  4CHK A;  1WJ4 A;  3N32 A;  1Q1O A;  1EF5 A;  3DCG A;  2KMC A;  2WWZ A;  4BOZ B;  2DZM A;  4KV2 A;  5D7G A;  2JY6 A;  3VTV A;  2DZI A;  2BF8 B;  4WJQ A;  3HK0 A;  3S2A A;  5DPW A;  4AJY B;  2LVP A;  2N1V A;  3PPA A;  4GDK B;  3JYU A;  3ZKJ C;  2JVC A;  1SIF A;  2MBE A;  2LD9 A;  1WXS A;  2L7R A;  1RRB A;  4IG7 B;  4G0N B;  4FLH A;  2KKC A;  2DZK A;  2XBB C;  2LI5 A;  2BWF A;  4LJO B;  4EOY A;  2HTH A;  5E6N A;  2UYZ B;  2JT4 B;  2K6Q A;  4IWO A;  2JUO A;  1WR6 E;  1V5O A;  2K8B A;  3D32 A;  1GJZ A;  1E8W A;  2BPS A;  3Q3F A;  4FHJ A;  3TIX A;  2DAJ A;  2RPQ A;  4MGZ E;  2K25 A;  1TBE A;  1J19 A;  2JZZ A;  3DBL I;  4W9C A;  2MW5 A;  3ZVV A;  2REX A;  4ASW C;  2KMA A;  2NS5 A;  3A9K A;  2K1F A;  3QC8 B;  2RD0 A;  3H7S A;  3UIO B;  4AJW A;  5GMV A;  2LRW A;  1I35 A;  3KYC D;  2KDB A;  2PPH A;  2KJH B;  4HCN B;  4JL9 A;  3WA0 A;  1VCB A;  3EC8 A;  2BYE A;  3EFU A;  5D94 A;  4ANV A;  1UH6 A;  1WY8 A;  4EFO A;  4F8C B;  3BIN A;  1S1Q B;  2N9E B;  2EMT A;  3L0W B;  5DPR A;  4IWP A;  1P3Q U;  5CTR C;  4DK5 A;  4FAD A;  1QZE A;  1J8C A;  2CHX A;  3ONS A;  1VD2 A;  3MHS D;  1H8C A;  1GNU A;  3B08 A;  4E74 A;  1V49 A;  1E8Z A;  4JGH B;  1F9J A;  4XZ4 A;  4I6N B;  2CR5 A;  1OGW A;  3IG3 A;  3K9P B;  4IM2 A;  3UF8 A;  2KWC A;  2IYD B;  1CMX B;  2JRI B;  3IBE A;  3UIP B;  4GMV A;  1E8Y A;  2KD0 A;  4BKG A;  2D2Q A;  1V81 A;  2I1K A;  2KTR A;  3I3T B;  5D6J B;  1UZX B;  3MJW A;  4HPL B;  2KOX A;  1WJN A;  3KW5 B;  4BKS D;  2GBN A;  3ZIM A;  1Q5W B;  3N30 A;  2I1J A;  5JH5 C;  3VH4 B;  4PS8 A;  4I6L B;  2KC2 A;  5L95 C;  1YX5 B;  2KC1 A;  2L3Z A;  2NPT A;  3L54 A;  1UGM A;  3CST A;  2MA9 B;  1JRU A;  4LCD E;  3VVW B;  2BKF A;  2EMS A;  2J0J A;  3AU5 A;  2ZZP B;  5LLI A;  1WE7 A;  2O6V A;  4WAA A;  1WGY A;  2UWQ A;  4BVU C;  5JHB A;  3PLU A;  3KUZ A;  4FHK A;  4M0W B;  4EEW A;  2C5L C;  4B9K A;  3OJ4 B;  2BKR B;  2DX5 B;  2KQ7 A;  1Y8R C;  2PE6 B;  1J0G A;  2AWT A;  2J0M A;  3RZW C;  4KSL C;  2FID A;  3PHW B;  4PYU A;  2LVO A;  2LXA A;  5IAA C;  2N1W A;  2NBV B;  4P7I A;  3M95 A;  4EKU A;  1RAX A;  1MG8 A;  1GUA B;  4DHJ B;  2KWV B;  4KIK A;  1LQB A;  1RFA A;  1L7Y A;  3LJ3 A;  4G3X B;  4NJ6 A;  3TMP B;  1IPG A;  1EO6 A;  1XT9 B;  2ZCB A;  3W1S C;  2MP2 A;  2ZNV B;  2KX3 A;  2MWS B;  5E6P A;  3X0W A;  1YX6 B;  1LM8 B;  1NDD A;  2B3A A;  4BFR A;  4NAW B;  1WJ6 A;  3VUY A;  2AL3 A;  3DBR I;  3R7R A;  2KDF B;  3V60 A;  2NBU A;  4MJS B;  2KWU B;  4A3O A;  1S3S G;  3L13 A;  1ZW7 A;  2HJ8 A;  2KHW B;  4PYZ A;  1G6J A;  4GB9 A;  2ZPN A;  3A4S C;  3PTF C;  3ZDM C;  3SU8 X;  2MBQ A;  4G11 A;  3EHV A;  3H9D A;  4F1S A;  3HM3 A;  3IVF A;  2KFK A;  2LXC A;  2IY0 B;  3GOE A;  1WGD A;  4MSQ B;  1PQS A;  2G4D B;  2JRH A;  1WGH A;  3H1U A;  4FN2 A;  5AEK B;  2GBM A;  3ZUN A;  2GBJ A;  2XK5 A;  2M4N A;  4ICU A;  2GBK A;  2L8J A;  4RM9 A;  2MBB B;  1TZ1 A;  1P98 A;  4DXA B;  3ALB A;  4W9G A;  2JPH A;  3AU4 A;  5CHV C;  5LXI B;  5LXH A;  2CU1 A;  1WXV A;  3M3J A;  4OVU A;  3ZNH B;  2KAN A;  1OTR B;  5CHF A;  2JXX A;  3P2B A;  4ANW A;  2IO0 B;  3WAP A;  2AL6 A;  3CSF A;  3JSV A;  2C9W B;  3MTN B;  4M8M A;  2FIF A;  2QHO A;  2R2Q A;  3R66 C;  3WAL A;  3B0A A;  4JLC A;  3LDZ E;  3RZF A;  4EUT A;  2YLM A;  3V6E B;  3PGE A;  3SD5 A;  5TR5 A;  3RD2 A;  2WYQ A;  3QCA A;  1V86 A;  4NQK E;  2L05 A;  3PRP B;  2IY1 B;  3CMM B;  3NY5 A;  4W9J A;  2EKE C;  4WQO B;  4II3 B;  3A1Q B;  2RSU A;  5HKH A;  3ZRF A;  2C7M B;  2KDI A;  5L83 A;  5AZH A;  4IM0 A;  4EZJ A;  4CYE A;  2KNB A;  2J0K A;  3AI5 A;  4LJP B;  4HK2 A;  2D3G A;  2CHZ A;  3U30 A;  4K1R B;  4MEM A;  3W1S A;  1R4N I;  3T8M A;  2BGF A;  2NVU I;  1Q0W B;  3QQ8 B;  4W9H A;  1E7V A;  4HXD A;  1WGR A;  3WAN A;  2PEA A;  2O2V B;  3ZNI D;  1WX7 A;  4OVV A;  3T9L A;  5C23 A;  1WMH A;  4KSK C;  2KDE B;  3DBH I;  2IBI B;  1V6E A;  1D3Z A;  3ZW3 A;  2RGF A;  1R4M I;  2Z59 B;  5G55 A;  5CX3 A;  4DHJ D;  2NR2 A;  3APC A;  3DQV A;  4WJP A;  2KJR A;  2G4S A;  4JQW C;  4JIO U;  3DVG Y;  2C7N B;  4W9F A;  3EEC A;  1NI2 A;  1K8R B;  4HWI B;  2GMI C;  2L00 B;  2Z0E B;  4KDI C;  2ZVO A;  4WWO A;  3L16 A;  2ZVN A;  4AOF A;  1EUV B;  4KVG B;  4KZC A;  3TL5 A;  2DYB A;  1P9D U;  4FJV B;  4FJY A;  1UD7 A;  1X1M A;  2N9P C;  3CF6 E;  3WAM A;  1WIA A;  2KK8 A;  3QA8 A;  2KO3 A;  4GDL A;  3W1Y A;  2ZEQ A;  2C7H A;  4W9L A;  3QAR A;  4PS7 A;  4WWP A;  4W9I A;  3VXW A;  3KUC B;  2KJ6 A;  2KX0 A;  2FCN A;  3ZO5 B;  1YD8 U;  3JW0 X;  4WJN A;  4KDL B;  2MSE D;  2L0T A;  3APF A;  3GZN I;  3QAQ A;  3SDL C;  3ZRC A;  2KTF A;  3DBS A;  3KVF B;  2MRP A;  3N3K B;  3QIJ A;  3R3M A;  2CS4 A;  2FNJ B;  4XC2 A;  4FJZ A;  2L76 A;  2LJ5 A;  2OJR A;  4ANX A;  1IYF A;  3NS8 A;  4IUM B;  4AWJ A;  1E5W A;  5D2M B;  3WIM A;  2WX0 A;  5DPS A;  1Z2M A;  2IZV B;  3A9J B;  1WJU A;  2K8C A;  2KVR A;  3NHE B;  2N7D A;  2IO3 B;  3R7Q A;  1M94 A;  1WR1 A;  3A9K B;  4B6W A;  2GBR A;  3NZS A;  3UIN B;  1V5T A;  5CHW A;  1OQY A;  2O6V D;  3L10 B;  4BBN C;  2KQS A;  5JHA A;  1L2N A;  3HIZ A;  1EF1 A;  5AZF A;  4GDK A;  4NNJ B;  2A5U A;  2DYO A;  4HPM B;  3TJP A;  3ZNZ B;  4K7U A;  5J18 A;  5J2R A;  3M62 B;  5E6O A;  4EZK A;  4FA6 A;  2N9X A;  3QJZ A;  4GXB A;  2NCN A;  1E90 A;  5FR6 A;  3ZTD A;  1WE6 A;  1H4R A;  4MDK E;  3VTW A;  1TGZ B;  4CO7 A;  3RT3 B;  2LAS A;  1WI0 A;  2LGY A;  1C3T A;  4K7W A;  2R2O A;  4GOC A;  1E8X A;  2FCM A;  1WFY A;  3PRM B;  4N9F 4;  2MX2 A;  1GG3 A;  2KTR B;  1V2Y A;  4HDO A;  5C1Z A;  3A1Q A;  2ZNV C;  1WXM A;  3ML8 A;  3DOW A;  3RUI B;  3K9O B;  4WWN A;  1A5R A;  5KHO A;  1WZ3 A;  5IA7 A;  3DDC B;  4NY0 A;  1YQB A;  4RMA A;  4RM8 A;  2LWP A;  1HE8 A;  3U8Z A;  4DWF A;  1UBI A;  4NPN A;  3ECI A;  2M17 A;  4TV3 A;  1KM7 A;  1T0Y A;  1RLF A;  2KZR A;  4X57 B;  4ANU A;  2IO2 B;  2V1Y A;  2O6V B;  4G50 A;  3A33 B;  2ZPY A;  3ZDT A;  1ISN A;  2MBH A;  4XX5 A;  4DDG D;  1WX9 A;  3AUL A;  2OOB B;  4BKT A;  2KXJ A;  1AAR A;  4W9E A;  4AUQ C;  2NBW B;  3OAW A;  4HLE A;  3OJ3 A;  2D07 B;  1IP9 A;  3O65 B;  4MEL A;  2V3S A;  2IO1 B;  4HVB A;  1ZKH A;  2FUH B;  4MGK E;  3V6C B;  1I42 A;  2PE9 A;  4EZL A;  2AEH A;  2DYM A;  3HM6 X;  3A4R A;  2HE7 A;  5BO4 B;  4DBG A;  4FBJ B;  2FCQ A;  1V9J A;  2LVQ A;  4BOS C;  4HJK A;  4KIK B;  4KZ0 A;  3VFK A;  4MH0 E;  4TQ0 A;  3PV1 A;  1LXD A;  2KLG A;  4GN1 A;  3NOB A;  2JWZ A;  5J17 A;  2MP2 B;  1XQQ A;  3PVL A;  4K7S A;  3VUW A;  5G2N A;  1FXT B;  2KFJ A;  2JZ3 B;  4E3C A;  2WX1 A;  1TTN A;  2ZCC A;  5AZG A;  2RR9 A;  4URK A;  1KJT A;  2FCS A;  3TCA A;  3HHM A;  2K39 A;  3KH0 A;  4ZRK A;  4MM3 A;  3VUX A;  1WRD B;  4M8N A;  2Y5B B;  2DAF A;  3OLM D;  2MBO A;  3A9J A;  3JVZ X;  4I6P A;  3RUL A;  3SHQ A;  2PJH A;  4DHZ B;  2M1M A;  3IHP C;  2KFK B;  4HDQ A;  3H7P B;  3DVN V;  1Z5S B;  4AP4 C;  1WXA A;  1WZ0 A;  3DVG X;  1WYW B;  4LDT D;  1YJ1 A;  4BBN F;  2MLB A;  4GU2 A;  1SE9 A;  2XK5 B;  3PT2 B;  4GGQ A;  4NQL B;  4A3P A;  2BWE S;  3PS6 A;  2AYO B;  2A4Z A;  4ZRI A;  3VTU A;  4DDI D;  2M0X A;  2GOW A;  4BKS A; 
#chains in the Genus database with same CATH topology
 4ZYN A;  4ZHO A;  3DPD A;  2LRU A;  1ZP0 B;  2KLC A;  2Z8L A;  2W9N A;  5JZE B;  3JSV B;  1JRP A;  4A20 A;  2DHZ A;  3NZU A;  4YL8 A;  2IPK D;  1MHH E;  3AED B;  2V3P A;  4O1N A;  3VR8 B;  2LHD A;  4F7Z A;  1OEY J;  2G3Q B;  3AE9 B;  2LZ6 A;  5H8Y E;  4HCP B;  2DEN B;  1PGB A;  2BYT A;  1FFU A;  2WXK A;  1L0V B;  2J52 A;  3DBH B;  1FPY A;  1NYR A;  4J6I A;  1R4M B;  2LUE A;  3AE7 B;  4N58 A;  4FUL A;  4DHZ E;  4ZDV A;  4LLG M;  1FFV A;  3APD A;  2JSV X;  3VQI A;  3C0R B;  3VAW A;  1YJI A;  2D10 A;  4RFB A;  1E7U A;  3ZNG C;  2HD5 B;  1GAQ B;  3ML9 A;  2NPT B;  2QJL A;  4HPP A;  4B95 A;  4S0R A;  3U7D A;  1KRH A;  1C77 A;  1I4P A;  2DWQ A;  2O2V A;  2JF5 A;  1TS3 A;  2LGD A;  3UGB B;  2K6D B;  1WM3 A;  3AMZ A;  3ZQ4 A;  2WXF A;  5AUI A;  3I57 A;  3U2S C;  4CHK A;  5EE9 A;  4YSZ B;  3DCG A;  2KMC A;  4BOZ B;  2DZM A;  2J53 A;  1XO3 A;  2JY6 A;  3MC0 B;  5D7G A;  5DPW A;  3PPA A;  3JYU A;  3ZKJ C;  1AWD A;  2J4X A;  2JVC A;  4FLH A;  4LJO B;  3BVZ A;  2ZW1 A;  4C00 A;  1K51 A;  2JUO A;  2K8B A;  5C3J B;  1SF0 A;  1E8W A;  3TIX A;  2RPV A;  1D5Z C;  1XEE A;  3H7S A;  4LNF A;  4N59 A;  4HCN B;  1VCB A;  4EFO A;  4IWP A;  2INP E;  3ONS A;  2INC C;  1CZP A;  1V49 A;  4US8 A;  1F9J A;  2PTL A;  3HVD A;  4HRS A;  2CR5 A;  3IG3 A;  2IYD B;  4GMV A;  1E8Y A;  2KD0 A;  1V81 A;  1KTK A;  3I3T B;  1UZX B;  1WJN A;  2IND C;  1VRA B;  3N30 A;  2I1J A;  2IDY A;  3IT6 B;  3VH4 B;  4I6L B;  5L95 C;  1YX5 B;  2L3Z A;  2NPT A;  3L54 A;  3CST A;  2M56 B;  2MA9 B;  3Q8A A;  1KLU D;  4XWT A;  3TEW A;  3AU5 A;  2G1E A;  3Q6B A;  1J7A A;  2BB6 A;  3OJ4 B;  2KQ7 A;  4JX1 C;  2PE6 B;  2ONQ A;  3P42 A;  1ZDX A;  2WXG A;  2R61 A;  4PYU A;  1LO5 D;  4EKU A;  3M95 A;  2BB5 A;  1QKZ A;  2KWV B;  2Y5P A;  1RFA A;  4G3X B;  4K3C A;  2KYW A;  4IDI A;  3X0W A;  2K9X A;  2B3A A;  4NAW B;  1WJ6 A;  2WXP A;  1T0R C;  4C7Y A;  4A3O A;  3BYT B;  5FKA C;  4LNO A;  1YNT E;  3A4S C;  3PTF C;  4XE0 A;  3SU8 X;  1YJJ A;  3HM3 A;  1I4Q A;  2KFK A;  1WGD A;  1PQS A;  1WGH A;  2GBM A;  4J3O D;  2XK5 A;  2L8J A;  1XCT L;  1UWX A;  2JX5 A;  4DXA B;  3ALB A;  4MAC A;  1WXV A;  4OHJ A;  2JXX A;  3P2B A;  4ANW A;  2IO0 B;  3WAL A;  4EUT A;  1FXI A;  1C78 A;  3V6E B;  3RD2 A;  2WYQ A;  4NQK E;  3Q8C A;  2L05 A;  3CMM B;  1GPX A;  2EKE C;  2RSU A;  5HKH A;  1WRI A;  2J0K A;  4LJP B;  2D3G A;  3W1S A;  4W9H A;  3QQ8 B;  3W5V B;  1E7V A;  2KMM A;  3WAN A;  2PEA A;  1WX7 A;  2KDE B;  2IBI B;  3I9V 1;  2RGF A;  4EE2 A;  4DHJ D;  5CX3 A;  2N9L A;  1ENF A;  2KJR A;  1V1P A;  3BVM A;  3DVG Y;  5LNK 1;  3EEC A;  2WXN A;  2GMI C;  2L00 B;  2W54 A;  4AOF A;  3L16 A;  2ZVN A;  4KZC A;  2WS3 B;  4FJV B;  1HA5 A;  1P9D U;  1FM0 D;  1UD7 A;  4Q2J A;  3N1Y C;  1WIA A;  2KK8 A;  3QA8 A;  2Y5C A;  2C7H A;  2MJD A;  4PS7 A;  3AEA B;  1JWM D;  2FCN A;  4KDL B;  2MSE D;  2GRI A;  4LNN A;  2KTF A;  3FAH A;  2MRP A;  3QIJ A;  3R3M A;  2FNJ B;  2N7J A;  2L76 A;  1FCC C;  1IYF A;  4IUM B;  5DPS A;  2GBR A;  3NZS A;  4OZB A;  1GOZ A;  4XWW A;  5JHA A;  1L2N A;  1ACC A;  1V1O A;  4GDK A;  4B0E A;  4NNJ B;  2A5U A;  2DYO A;  4WQM A;  3ZNZ B;  4REZ A;  4K7U A;  3O13 A;  5I4D A;  5E6O A;  4EZK A;  4FA6 A;  3QJZ A;  1FCL A;  2NCN A;  3ZTD A;  1TGZ B;  1YMH E;  3RT3 B;  2LAS A;  3LXF A;  1OQQ A;  1ZPS A;  5CTR C;  1E8X A;  2MX2 A;  1GG3 A;  2KTR B;  4HDO A;  5FR3 A;  2LGI A;  4UDU C;  4WWN A;  5KHO A;  5IA7 A;  2QIL A;  2JYT A;  4RMA A;  2WLB A;  2HDE A;  2BQQ A;  2W82 A;  2RDH A;  1RLF A;  4ANU A;  2IO2 B;  2V1Y A;  3DWG C;  3TEZ A;  3ZGZ A;  1ISN A;  3Q3O C;  5G5H A;  2KXJ A;  3P4P B;  4KGS A;  1IP9 A;  4MEL A;  3I5J C;  1LGR A;  5BMI A;  3BYY B;  4HVB A;  1ZKH A;  2FUH B;  2EEL A;  4RF0 A;  4C80 A;  2WXM A;  1C79 A;  2DYM A;  4FXC A;  3DBR B;  2LGS A;  4FBJ B;  3VFK A;  4TQ0 A;  1J7C A;  4GN1 A;  4YSX B;  1AN8 A;  4K7S A;  3VUW A;  1PGA A;  4KKI A;  4TSS A;  2WX1 A;  1TTN A;  1OQR A;  2ZCC A;  2DNF A;  1F77 A;  4M0W A;  3TCA A;  2K39 A;  3VR9 B;  4MM3 A;  1XLQ A;  3OLM D;  2JZP A;  3JVZ X;  4I6P A;  3RUL A;  2MEK A;  3AEG B;  4DXF A;  3DVN V;  1MHX A;  2LMC A;  1QQR A;  4AP4 C;  1WYW B;  3NS1 A;  4LDT D;  4BBN F;  1SE3 A;  1ET6 A;  2IGD A;  1NVI D;  3MP9 A;  3PS6 A;  3RNA C;  1RYJ A;  3VTU A;  3T9L A;  3Q3M C;  4A6Q A;  2KAJ A;  4JE3 B;  4MJS A;  1VR9 A;  1TY0 A;  2H89 B;  3RPF C;  2FAZ A;  1SBB B;  3VHT C;  3KYD D;  3MC8 A;  4LTU A;  3B1L X;  1ESF A;  1SSN A;  3RCZ A;  1TYG B;  1HTQ A;  4MGI E;  3IAS 1;  1WM2 A;  3IAM 1;  5DCN A;  3Q3N C;  1SGH A;  3UQB A;  1PUT A;  1B1Z A;  2N4F A;  4GSW A;  3L08 A;  3P4Q B;  1GC6 A;  2WHI A;  4ICV A;  1VZ7 A;  3DWM A;  1WMH B;  4KGR A;  1TKE A;  4C7Z A;  2B76 B;  2I2Y A;  4ZRQ A;  2WP9 B;  1PDX A;  1WF9 A;  3B2F A;  4A9A A;  1TS4 A;  1KOT A;  1WX8 A;  1UGJ A;  2VH2 A;  3VDZ A;  3QWZ B;  1NBF C;  4HEA 1;  4PT5 A;  2NTT A;  1UBQ A;  4WH4 A;  2G45 B;  3UQA A;  1F0Z A;  2YVC A;  5JXV A;  1J7B A;  2K3U A;  3U52 E;  3TBL D;  2KN5 A;  1DOI A;  3V61 A;  2CJO A;  2M19 A;  5EDS A;  3DVN U;  3FC4 A;  1T3Q A;  4WWM A;  2DZJ A;  1Q1O A;  4NAM A;  2BS3 B;  3BK1 A;  3VTV A;  4OVZ A;  3S2A A;  4AJY B;  2N1V A;  1WXS A;  2L7R A;  2LD9 A;  3AM9 A;  1QIL A;  2JWU A;  2KKC A;  2XBB C;  4EOY A;  4YWG G;  2HTH A;  2L32 A;  1WGK A;  1V5O A;  2BPS A;  4P1C C;  4IOI E;  2RPQ A;  3RN9 C;  1KF6 B;  4W9C A;  1J19 A;  2JZZ A;  1D4B A;  3ZVV A;  4ASW C;  2KMA A;  2NS5 A;  3QC8 B;  5GMV A;  2LRW A;  4HJG E;  2KDB A;  3WA0 A;  2KJH B;  4H2A A;  4JL9 A;  3EFU A;  4F8C B;  3V3X A;  1S1Q B;  4HKZ E;  1MPE A;  2EMT A;  4RGT A;  1P3Q U;  4DK5 A;  1QZE A;  5IOI A;  1GNU A;  4E74 A;  3AEB B;  1E8Z A;  4I6N B;  3AEC B;  2JRI B;  3UIP B;  4US9 A;  5D6J B;  3MJW A;  4HPL B;  3KW5 B;  5JH5 C;  4PS8 A;  2ICI A;  1UGM A;  1JRU A;  3NVZ A;  2QC8 A;  1TT5 B;  2O6V A;  1VDV A;  3WCQ A;  2D3A A;  2IJ0 A;  4FHK A;  1TKG A;  2JYE A;  2DX5 B;  1Y8R C;  3E56 A;  1J0G A;  4KSL C;  1ZOY B;  2VH1 A;  4KGT A;  2LVO A;  5IAA C;  2NBV B;  1QLB B;  1FNV A;  2QSD A;  2AQ2 B;  3PZ7 A;  1FNU A;  4DHJ B;  4KIK A;  3LJ3 A;  2VZK D;  3W1S C;  3AE4 B;  1VZ6 A;  2MP2 A;  2KX3 A;  2ZNV B;  1YX6 B;  3VRB B;  5FK9 C;  2QDF A;  5HHD G;  3C19 A;  3TSS A;  3L13 A;  3RNB C;  1MVK A;  1SJH D;  1L4Z B;  4R3D A;  1Y56 A;  2MBQ A;  3H9D A;  4RF1 A;  3IVF A;  2LXC A;  2KDM A;  4HKQ A;  3HRD D;  4RM9 A;  2GBK A;  2MBB B;  1TZ1 A;  4WAF A;  1DGJ A;  4W9G A;  5CHV C;  1N5W A;  3AE3 B;  5E6J A;  3Q14 C;  3ZNH B;  1OTR B;  2L52 A;  3AE8 B;  2KVZ A;  3WAP A;  4M8M A;  3JSV A;  1JWB D;  1PGX A;  2FIF A;  2R2Q A;  2WXR A;  2WDQ B;  3B0A A;  4JLC A;  1E7P B;  3LDZ E;  2YLM A;  1YQ4 B;  4M00 A;  3FIL B;  2LHE A;  3QCA A;  1V86 A;  4RGN A;  1WYG A;  3NY5 A;  1IUE A;  3IT4 B;  4WQO B;  4II3 B;  4S17 A;  3ZRF A;  2C7M B;  4IM0 A;  3ZYY X;  4YT0 B;  4EZJ A;  1A70 A;  1NEN B;  4HK2 A;  1QOF A;  2CHZ A;  4MEM A;  4RCO A;  2BGF A;  1Q0W B;  1EU4 A;  4MT5 A;  2IGG A;  3ZNI D;  2WXL A;  5C23 A;  4KSK C;  1FXA A;  2XNA C;  3DBH I;  1RWS A;  1R4M I;  3GB1 A;  3APC A;  2K5P A;  1T6B X;  4JQW C;  2N0S B;  4W9F A;  3BK2 A;  1L4D B;  4WWO A;  1EUV B;  2DYB A;  2PIA A;  3WAM A;  2N9P C;  1HEZ E;  1BML C;  3QAR A;  4W9I A;  4WJN A;  1N5X A;  3QAQ A;  3SDL C;  3GZN I;  3ZRC A;  3DBL B;  4M02 A;  2CS4 A;  2LJ5 A;  2OJR A;  2LUM A;  3WIM A;  3P4S B;  2IZV B;  2KVR A;  1QOA A;  2N7D A;  3NUH B;  2IO3 B;  3GP7 A;  1FMA D;  3A9K B;  4B6W A;  4L23 A;  4A8X C;  5CHW A;  2O6V D;  3B9J A;  3HIZ A;  3NVY A;  1EF1 A;  5AZF A;  1V97 A;  3TEX A;  3TJP A;  5J18 A;  1PYW D;  2N9X A;  4GXB A;  5FR6 A;  1E90 A;  3Q8B A;  2WQY B;  1WI0 A;  1DYQ A;  1XLP A;  1WFY A;  1V2Y A;  1M4V A;  1TS2 A;  4USA A;  2SAK A;  3LB8 C;  4MH8 A;  1WXM A;  3DOW A;  3K9O B;  1WZ3 A;  4K3B A;  4NY0 A;  1DOY A;  1YQB A;  2V3N A;  4RM8 A;  4YXD B;  1HE8 A;  3U8Z A;  3NRZ A;  1UBI A;  1WWT A;  4NPN A;  4X57 B;  1T0Y A;  1C4C A;  3SR6 A;  1HXY D;  2ZPY A;  3ZDT A;  2MBH A;  4XX5 A;  4DDG D;  5BMG A;  2GI9 A;  4BKT A;  1L5P A;  2JU6 X;  2NBW B;  3OAW A;  1F52 A;  2D07 B;  3OJ3 A;  3O65 B;  1QT9 A;  1D5M C;  1NYQ A;  2IO1 B;  1YN3 A;  2X8X X;  1IGD A;  1I42 A;  1XLN A;  1BXT A;  5BO4 B;  2LVQ A;  4BOS C;  1LXD A;  2KLG A;  3NOB A;  5D3D A;  3AB5 A;  3GS2 A;  1C9F A;  1FXT B;  2JZ3 B;  4E3C A;  3TUO A;  5D3I B;  1MFW A;  5AZG A;  1DOX A;  4URK A;  2OJW A;  3HHM A;  3VUX A;  3RI7 C;  2MBO A;  4YTM B;  5BYQ A;  3SHQ A;  2PJH A;  4HDQ A;  3H7P B;  3DVG X;  1XF5 L;  1YJ1 A;  3HUI A;  2V4I B;  2W55 A;  4XGA B;  3PT2 B;  4NQL B;  2WNM A;  4WUR A;  4C4V B;  4ZOH C;  2M0X A;  4DDI D;  2GOW A;  4BKS A;  4NAW A;  4OZC A;  1SB3 C;  1LFD A;  4JWS C;  4W9K A;  2ZJD A;  4IWQ A;  2CU3 A;  3PHX B;  2CHW A;  4IC7 B;  1V8C A;  1JML A;  3X23 A;  1JWS D;  4WJO A;  4CQN A;  3QHT A;  3AXC A;  5TSS A;  4HRO A;  2WXQ A;  1BT0 A;  3V05 A;  4AS1 A;  3P4R B;  3ZXR A;  3PZ8 A;  2M0A A;  2G9H D;  1EM7 A;  2D11 A;  5H92 C;  3C8Y A;  4TQ1 A;  1FD6 A;  3N1Z C;  2J7Q B;  3IXS A;  3QK0 A;  3H6N A;  1P0R A;  4W9D A;  2NMQ A;  2WGS A;  2ASQ A;  5BMH A;  4TUU A;  2BYF A;  1WSP A;  3EA6 A;  1UF0 A;  3PRE A;  4GDL B;  3OWE B;  4II2 B;  1TJE A;  3WAO A;  4E71 A;  2N9K A;  4IW0 A;  3MHZ A;  3ZTC A;  1ZGU B;  2BS2 B;  2ON8 A;  1PFD A;  1N61 A;  3H7P A;  1C1Y B;  2E6X A;  5KHQ A;  1T5X D;  2BS4 B;  2WDT B;  5GXG B;  4ZYS A;  2W3S A;  4C4V A;  1WJ4 A;  3N32 A;  1IBX B;  1EF5 A;  1L6V A;  4KV2 A;  1ROE A;  2DZI A;  1N63 A;  4G0N B;  2DZK A;  2Y3A A;  5E6N A;  2UYZ B;  5AUK A;  2YEP B;  4P16 A;  2JT4 B;  3BVG A;  2K6Q A;  1GJZ A;  3Q3F A;  4FHJ A;  2DAJ A;  1I4R A;  2K25 A;  1TBE A;  2MW5 A;  1K50 A;  2EKI A;  2RD0 A;  3UIO B;  1I35 A;  4FAD A;  3EC8 A;  3Q2A C;  2BYE A;  5D94 A;  4ANV A;  1UH6 A;  3BIN A;  2N9E B;  3L0W B;  1J8C A;  3MHS D;  3AE2 B;  3B08 A;  4JGH B;  4XZ4 A;  3K9P B;  2KWC A;  3NG0 A;  1OFF A;  5G5G A;  4LK0 M;  2KTR A;  3MFG A;  1UNS A;  4XDD A;  4WIP A;  3W2D A;  3N1X C;  2KOX A;  4BKS D;  2GBN A;  3ZIM A;  1Q5W B;  3EGR A;  2KT7 A;  3NVW A;  1STE A;  2KC1 A;  2PLP A;  2QCZ A;  4L1B A;  2FBW B;  1N6Z A;  1XCQ L;  1D5X C;  4LCD E;  3SFE B;  5LLI A;  1CQV A;  1WE7 A;  4WAA A;  2UWQ A;  3PLU A;  3KUZ A;  4EEW A;  2AWT A;  3RZW C;  2HJ1 A;  3E9S A;  1WXQ A;  3PHW B;  3L4P A;  3GE8 C;  3ZJT A;  4P7I A;  5MPO A;  2FE8 A;  5EE1 A;  1LQB A;  4NJ6 A;  1IPG A;  1QOB A;  2KN4 A;  3DHI C;  4BFR A;  4RGM A;  3VUY A;  3DBR I;  3R7R A;  2KDF B;  2XN9 C;  2AQ1 B;  2RMM A;  1S3S G;  2KHW B;  2E3T A;  1G6J A;  3N20 C;  3RNF C;  1YOV B;  4ZRP A;  4G11 A;  3EHV A;  4F1S A;  1T0Q C;  3GE3 C;  1SE2 A;  3GOE A;  1L0X B;  4MSQ B;  2G4D B;  5AEK B;  4LNI A;  2H88 B;  3ZUN A;  2GBJ A;  2M4N A;  3T3N A;  4ICU A;  5LXI B;  3AU4 A;  3AE5 B;  2CU1 A;  3M3J A;  2KAN A;  5CHF A;  1FIQ A;  2DLB A;  3URY A;  3R66 C;  2QHO A;  3U7Z A;  1VJK A;  4RH6 A;  1ET9 A;  1FRD A;  3AE1 B;  5TR5 A;  1JCK B;  3PRP B;  2IY1 B;  4W9J A;  1ZE3 D;  3SFD B;  3MJ5 A;  3FKY A;  5L83 A;  4CYE A;  3U30 A;  1R4N I;  3B2G A;  2NVU I;  1SE4 A;  1E9M A;  1WGR A;  1E10 A;  2O2V B;  4OVV A;  2DBY A;  1WMH A;  3ZW3 A;  3TEY A;  1MI0 A;  2Z59 B;  5G55 A;  2NR2 A;  3DQV A;  4WJP A;  2G4S A;  4JIO U;  4JWU C;  2C7N B;  2PKO A;  1KFY B;  2Z0E B;  2WU2 B;  1MG4 A;  2ZVO A;  3TL5 A;  4FJY A;  3W1Y A;  3Q69 A;  2ZEQ A;  4W9L A;  4WWP A;  3KUC B;  2KJ6 A;  1E0Z A;  1ZXI A;  1YD8 U;  3JW0 X;  3OG5 A;  2L0T A;  3N3K B;  5EE0 A;  4XC2 A;  5IKC M;  1JQ4 A;  4AWJ A;  2D3B A;  5D2M B;  1CK1 A;  1Z2M A;  3A9J B;  2PVG C;  4ZHP A;  3R7Q A;  1M94 A;  1OQY A;  4BBN C;  2KQS A;  2KAC A;  2KQ4 X;  2K22 A;  3NVV A;  3SEB A;  1UWM A;  5J2R A;  3MC9 A;  3RNE C;  1H4R A;  3VTW A;  1SEB D;  3W5U B;  4K7W A;  4N9F 4;  1HTO A;  4GLS C;  2FCM A;  1SJE D;  2INN E;  3KLS X;  3W9C B;  3EUB 2;  2WXJ A;  2ACZ B;  1A5R A;  3GZN B;  2YEP F;  1Q10 A;  5IO9 A;  2LEK A;  2M17 A;  1KM7 A;  2IGH A;  1CJE A;  3H8H A;  2TSS A;  1WX9 A;  1GB4 A;  1JWA D;  4BAX A;  4HLE A;  2WXO A;  2V3S A;  1N60 A;  2WXI A;  4NZL B;  3KQ4 A;  3NZ3 A;  4EZL A;  2AEH A;  3HM6 X;  3A4R A;  2HE7 A;  2FCQ A;  1V9J A;  2BTE A;  4KZ0 A;  4MH0 E;  2QIE B;  3PVL A;  1XQQ A;  5J17 A;  1VZ8 A;  1RM6 C;  5G2N A;  2KFJ A;  3P1M A;  2FCS A;  4QAY A;  4IKG A;  3KH0 A;  4ZRK A;  4M8N A;  2DAF A;  3A9J A;  2M1M A;  2KFK B;  1NEK B;  1WXA A;  1WZ0 A;  2XK5 B;  1C4A A;  4GGQ A;  5EE3 A;  1JAL A;  2WU5 B;  3AH7 A;  2BWE S;  2AYO B;  2OED A;  3ZJU A;  1FRR A;  2D5G A;  2X38 A;  3BY4 B;  3AEE B;  1U4A A;  3VRA B;  1FO4 A;  3J9C A;  3PRZ A;  1V80 A;  2BYV E;  3CIR B;  1NI3 A;  1YQ3 B;  2MQJ A;  2MCN B;  2M8S A;  4IM3 A;  4N6E B;  3AEF B;  1OEY A;  4ARC A;  2MJE A;  4MSM B;  3L17 A;  4MGY E;  5HG2 A;  1BUI C;  3ENE A;  1FNW A;  1D6E C;  5T8I A;  4LDT B;  3I63 C;  3Q3J A;  3N9Y C;  5DPT A;  3BII D;  2C60 A;  3RYT A;  1TKY A;  2Z0D B;  3PLV A;  1YIW A;  2N7E A;  4NJ7 A;  2L0F A;  1P1A A;  3FIL A;  4P1B C;  2XEW A;  4D2K A;  1WH3 A;  2K8H A;  1V1P B;  1XD3 B;  4TKN A;  4ITK A;  2BBC A;  2V4L A;  2AQ3 B;  3IFW B;  3EFC A;  2CKH B;  1F2R I;  3KUD B;  2L1A A;  2PW9 A;  3M63 B;  2V0G A;  4BZA A;  4OZA A;  3PO0 A;  1L6U A;  1WGG A;  2ZW0 A;  1KLV A;  4K81 A;  2LGX A;  3VH3 B;  1ZDV A;  4RNA A;  4PS3 A;  2QEJ C;  4GIV A;  3PSE B;  4TMA B;  3PZD A;  3ZLZ A;  3V62 A;  3Q8E A;  3QX1 A;  2VRR B;  2K0P A;  1UEL A;  1GC7 A;  4ZRJ A;  2WWZ A;  3AE6 B;  4ARI A;  2BF8 B;  4WJQ A;  3HK0 A;  2LVP A;  4GDK B;  1SIF A;  2MBE A;  1AW7 A;  1RRB A;  4IG7 B;  3BZD B;  2BWF A;  2LI5 A;  4IWO A;  1WR6 E;  3D32 A;  2LFI A;  2QMT A;  4MGZ E;  3AV8 A;  3RNG C;  3DBL I;  3AN1 A;  1F1H A;  2REX A;  2BW2 A;  1JW9 D;  1ZUD 2;  3A9K A;  2K1F A;  4AJW A;  3KYC D;  2PPH A;  2WDR B;  4NJC A;  1WY8 A;  5HI1 A;  5DPR A;  2CHX A;  2JXT A;  1VD2 A;  2SEB D;  1H8C A;  1P7F A;  3RFZ B;  1I4X A;  2V9H A;  1OGW A;  4IM2 A;  3UF8 A;  3IBE A;  1CMX B;  4BKG A;  2D2Q A;  2I1K A;  3DHH C;  1QOG A;  4YTP B;  1EU3 A;  2I38 A;  2KC2 A;  1YN4 A;  4OW0 A;  1I4H A;  3VVW B;  2BKF A;  4YSY B;  2EMS A;  2J0J A;  2ZZP B;  5IN7 A;  4M01 A;  2WDV B;  1WGY A;  4BVU C;  5JHB A;  4M0W B;  2C5L C;  4B9K A;  5C2T B;  2BKR B;  4MM3 B;  1SXT A;  2J0M A;  2FID A;  1HZ5 A;  1TS5 A;  2LXA A;  2N1W A;  4L2Y A;  1RAX A;  1MG8 A;  1GUA B;  3P63 A;  4C56 C;  1L7Y A;  3TMP B;  1XT9 B;  1EO6 A;  2ZCB A;  2GB1 A;  2MWS B;  5E6P A;  2D3C A;  1LM8 B;  1NDD A;  3HVZ A;  1HZ6 A;  2AL3 A;  1C4P A;  3V60 A;  2NBU A;  4MJS B;  1XLO A;  4YTN B;  2L83 A;  2KWU B;  1ZW7 A;  2HJ8 A;  4PYZ A;  4GB9 A;  2ZPN A;  3ZDM C;  3UI3 A;  2IY0 B;  2NTS A;  1I7H A;  2JRH A;  3H1U A;  4FN2 A;  1E6E B;  2MJ3 A;  4PK1 A;  3ZXV A;  1P98 A;  2JPH A;  5LXH A;  4OVU A;  1TY2 A;  1HQR D;  4ACF A;  4A90 A;  1XXG A;  2AL6 A;  2VZK B;  3CSF A;  2C9W B;  3MTN B;  4AQ7 A;  3Q8F A;  3RZF A;  1KH0 A;  3PGE A;  2BVC A;  3SD5 A;  1JRO A;  2PMV A;  3ZJV A;  2RDG A;  5HFY A;  3KWV A;  2OHF A;  3ETR A;  3A1Q B;  2KDI A;  3T3O A;  5AZH A;  4KX6 B;  4XYC A;  2KNB A;  3AI5 A;  4K1R B;  3T8M A;  4HXD A;  5IP4 D;  4XDC A;  1C76 A;  1SIJ A;  1V6E A;  1D3Z A;  4LNK A;  1NI2 A;  3R2T A;  1K8R B;  4HWI B;  2MH7 A;  4KDI C;  4KVG B;  1T0S C;  1X1M A;  3CF6 E;  1RFK A;  2KO3 A;  4GDL A;  3U4E G;  3VXW A;  2Q5W D;  2KX0 A;  3ZO5 B;  1MJD A;  3APF A;  3RMK C;  3R2I A;  3DBS A;  2UU7 A;  3KVF B;  1VLB A;  4FJZ A;  1KLG D;  3CWI A;  4KKJ A;  4ANX A;  3NS8 A;  1E5W A;  1YN5 A;  2WX0 A;  1EWY C;  1WJU A;  2K8C A;  3NHE B;  1I4G A;  1R4N B;  1WR1 A;  2GLS A;  1IBX A;  2FUG 1;  3UIN B;  1P7E A;  1V5T A;  3L10 B;  5BYS A;  2PVO D;  1EWC A;  4HPM B;  2J42 A;  1L0Y B;  3M62 B;  1WE6 A;  4CO7 A;  4MDK E;  1UUP A;  2LGY A;  3ABV B;  1C3T A;  2KWD A;  2R2O A;  4GOC A;  3PRM B;  2HTM E;  5C1Z A;  5BYR A;  2CJN A;  3A1Q A;  4B0M A;  2ZNV C;  3ML8 A;  3RUI B;  2WXH A;  3DDC B;  4JPS A;  2LWP A;  4DWF A;  4DQO C;  3ECI A;  2JQR B;  4TV3 A;  2KZR A;  2O6V B;  4G50 A;  3A33 B;  3AUL A;  3KWL A;  2OOB B;  1ZXH A;  3DHG C;  2LJI A;  1AAR A;  4W9E A;  4AUQ C;  1GB1 A;  4DXG A;  4MGK E;  1K52 A;  3V6C B;  1IGC A;  2PE9 A;  4A55 A;  4RGO S;  2MHJ A;  4DBG A;  4HJK A;  4KIK B;  3PV1 A;  2BT6 A;  3BWU D;  2W3R A;  2JWZ A;  2MP2 B;  1AYF A;  1FEH A;  1TZO A;  2RR9 A;  1KJT A;  3LYY A;  2RDB C;  1F2R C;  1B9R A;  3R8B A;  1WRD B;  2Y5B B;  3NJT A;  4P6V F;  2AX5 A;  4DHZ B;  3IHP C;  1Z5S B;  1QF6 A;  2MLB A;  4GU2 A;  1SE9 A;  1N62 A;  3RNC C;  1TIF A;  1R7S A;  4A3P A;  2A4Z A;  4ZRI A;  1JWU D;  1K53 A; 
#chains in the Genus database with same CATH homology
 4NAW A;  4ZYN A;  3DPD A;  2LRU A;  3BY4 B;  1U4A A;  4MJS A;  2KLC A;  2W9N A;  1LFD A;  3PRZ A;  1V80 A;  2BYV E;  5JZE B;  3JSV B;  4W9K A;  2ZJD A;  4IWQ A;  3PHX B;  4A20 A;  2DHZ A;  2FAZ A;  2MQJ A;  3NZU A;  4YL8 A;  2MCN B;  2CHW A;  2M8S A;  4IC7 B;  3KYD D;  4IM3 A;  3VHT C;  3X23 A;  4WJO A;  3B1L X;  4F7Z A;  1OEY J;  3RCZ A;  1OEY A;  4MGI E;  4MSM B;  3QHT A;  2G3Q B;  1WM2 A;  3AXC A;  3L17 A;  2LZ6 A;  4HCP B;  5DCN A;  2DEN B;  4MGY E;  1SGH A;  3ENE A;  3UQB A;  1BT0 A;  4LDT B;  3Q3J A;  5DPT A;  2N4F A;  2C60 A;  4GSW A;  4J6I A;  3L08 A;  3RYT A;  2Z0D B;  1GC6 A;  4ICV A;  2LUE A;  3PLV A;  1YIW A;  2N7E A;  4NJ7 A;  2L0F A;  1P1A A;  1WMH B;  4FUL A;  4DHZ E;  2XEW A;  2D11 A;  4ZDV A;  4TQ1 A;  1WH3 A;  3APD A;  2J7Q B;  3VQI A;  3QK0 A;  2K8H A;  3C0R B;  3VAW A;  1XD3 B;  2D10 A;  3H6N A;  1P0R A;  4TKN A;  4W9D A;  1E7U A;  1WF9 A;  1KOT A;  2V4L A;  3IFW B;  2HD5 B;  3ZNG C;  1WX8 A;  2ASQ A;  2CKH B;  4TUU A;  3VDZ A;  2BYF A;  3QWZ B;  3KUD B;  3ML9 A;  1NBF C;  3PRE A;  2NPT B;  3M63 B;  4B95 A;  4GDL B;  1UBQ A;  4II2 B;  1WGG A;  3WAO A;  4E71 A;  1KLV A;  2G45 B;  3U7D A;  3UQA A;  2YVC A;  2O2V A;  4IW0 A;  2JF5 A;  4K81 A;  3ZTC A;  1ZGU B;  3TBL D;  2KN5 A;  2LGX A;  2LGD A;  3UGB B;  3VH3 B;  4PS3 A;  3H7P A;  1C1Y B;  3PSE B;  4GIV A;  2K6D B;  1WM3 A;  3PZD A;  3V61 A;  3ZLZ A;  5KHQ A;  3V62 A;  5EDS A;  2WDT B;  3DVN U;  3QX1 A;  2VRR B;  1UEL A;  1GC7 A;  4ZRJ A;  2DZJ A;  4CHK A;  1WJ4 A;  3N32 A;  1Q1O A;  1EF5 A;  3DCG A;  2KMC A;  2WWZ A;  4BOZ B;  2DZM A;  4KV2 A;  5D7G A;  2JY6 A;  3VTV A;  2DZI A;  2BF8 B;  4WJQ A;  3HK0 A;  3S2A A;  5DPW A;  4AJY B;  2LVP A;  2N1V A;  3PPA A;  4GDK B;  3JYU A;  3ZKJ C;  2JVC A;  1SIF A;  2MBE A;  2LD9 A;  1WXS A;  2L7R A;  1RRB A;  4IG7 B;  4G0N B;  4FLH A;  2KKC A;  2DZK A;  2XBB C;  2LI5 A;  2BWF A;  4LJO B;  4EOY A;  2HTH A;  5E6N A;  2UYZ B;  2JT4 B;  2K6Q A;  4IWO A;  2JUO A;  1WR6 E;  1V5O A;  2K8B A;  3D32 A;  1GJZ A;  1E8W A;  2BPS A;  3Q3F A;  4FHJ A;  3TIX A;  2DAJ A;  2RPQ A;  4MGZ E;  2K25 A;  1TBE A;  1J19 A;  2JZZ A;  3DBL I;  4W9C A;  2MW5 A;  3ZVV A;  2REX A;  4ASW C;  2KMA A;  2NS5 A;  3A9K A;  2K1F A;  3QC8 B;  2RD0 A;  3H7S A;  3UIO B;  4AJW A;  5GMV A;  2LRW A;  1I35 A;  3KYC D;  2KDB A;  2PPH A;  2KJH B;  4HCN B;  4JL9 A;  3WA0 A;  1VCB A;  3EC8 A;  2BYE A;  3EFU A;  5D94 A;  4ANV A;  1UH6 A;  1WY8 A;  4EFO A;  4F8C B;  3BIN A;  1S1Q B;  2N9E B;  2EMT A;  3L0W B;  5DPR A;  4IWP A;  1P3Q U;  5CTR C;  4DK5 A;  4FAD A;  1QZE A;  1J8C A;  2CHX A;  3ONS A;  1VD2 A;  3MHS D;  1H8C A;  1GNU A;  3B08 A;  4E74 A;  1V49 A;  1E8Z A;  4JGH B;  1F9J A;  4XZ4 A;  4I6N B;  2CR5 A;  1OGW A;  3IG3 A;  3K9P B;  4IM2 A;  3UF8 A;  2KWC A;  2IYD B;  1CMX B;  2JRI B;  3IBE A;  3UIP B;  4GMV A;  1E8Y A;  2KD0 A;  4BKG A;  2D2Q A;  1V81 A;  2I1K A;  2KTR A;  3I3T B;  5D6J B;  1UZX B;  3MJW A;  4HPL B;  2KOX A;  1WJN A;  3KW5 B;  4BKS D;  2GBN A;  3ZIM A;  1Q5W B;  3N30 A;  2I1J A;  5JH5 C;  3VH4 B;  4PS8 A;  4I6L B;  2KC2 A;  5L95 C;  1YX5 B;  2KC1 A;  2L3Z A;  2NPT A;  3L54 A;  1UGM A;  3CST A;  2MA9 B;  1JRU A;  4LCD E;  3VVW B;  2BKF A;  2EMS A;  2J0J A;  3AU5 A;  2ZZP B;  5LLI A;  1WE7 A;  2O6V A;  4WAA A;  1WGY A;  2UWQ A;  4BVU C;  5JHB A;  3PLU A;  3KUZ A;  4FHK A;  4M0W B;  4EEW A;  2C5L C;  4B9K A;  3OJ4 B;  2BKR B;  2DX5 B;  2KQ7 A;  1Y8R C;  2PE6 B;  1J0G A;  2AWT A;  2J0M A;  3RZW C;  4KSL C;  2FID A;  3PHW B;  4PYU A;  2LVO A;  2LXA A;  5IAA C;  2N1W A;  2NBV B;  4P7I A;  3M95 A;  4EKU A;  1RAX A;  1MG8 A;  1GUA B;  4DHJ B;  2KWV B;  4KIK A;  1LQB A;  1RFA A;  1L7Y A;  3LJ3 A;  4G3X B;  4NJ6 A;  3TMP B;  1IPG A;  1EO6 A;  1XT9 B;  2ZCB A;  3W1S C;  2MP2 A;  2ZNV B;  2KX3 A;  2MWS B;  5E6P A;  3X0W A;  1YX6 B;  1LM8 B;  1NDD A;  2B3A A;  4BFR A;  4NAW B;  1WJ6 A;  3VUY A;  2AL3 A;  3DBR I;  3R7R A;  2KDF B;  3V60 A;  2NBU A;  4MJS B;  2KWU B;  4A3O A;  1S3S G;  3L13 A;  1ZW7 A;  2HJ8 A;  2KHW B;  4PYZ A;  1G6J A;  4GB9 A;  2ZPN A;  3A4S C;  3PTF C;  3ZDM C;  3SU8 X;  2MBQ A;  4G11 A;  3EHV A;  3H9D A;  4F1S A;  3HM3 A;  3IVF A;  2KFK A;  2LXC A;  2IY0 B;  3GOE A;  1WGD A;  4MSQ B;  1PQS A;  2G4D B;  2JRH A;  1WGH A;  3H1U A;  4FN2 A;  5AEK B;  2GBM A;  3ZUN A;  2GBJ A;  2XK5 A;  2M4N A;  4ICU A;  2GBK A;  2L8J A;  4RM9 A;  2MBB B;  1TZ1 A;  1P98 A;  4DXA B;  3ALB A;  4W9G A;  2JPH A;  3AU4 A;  5CHV C;  5LXI B;  5LXH A;  2CU1 A;  1WXV A;  3M3J A;  4OVU A;  3ZNH B;  2KAN A;  1OTR B;  5CHF A;  2JXX A;  3P2B A;  4ANW A;  2IO0 B;  3WAP A;  2AL6 A;  3CSF A;  3JSV A;  2C9W B;  3MTN B;  4M8M A;  2FIF A;  2QHO A;  2R2Q A;  3R66 C;  3WAL A;  3B0A A;  4JLC A;  3LDZ E;  3RZF A;  4EUT A;  2YLM A;  3V6E B;  3PGE A;  3SD5 A;  5TR5 A;  3RD2 A;  2WYQ A;  3QCA A;  1V86 A;  4NQK E;  2L05 A;  3PRP B;  2IY1 B;  3CMM B;  3NY5 A;  4W9J A;  2EKE C;  4WQO B;  4II3 B;  3A1Q B;  2RSU A;  5HKH A;  3ZRF A;  2C7M B;  2KDI A;  5L83 A;  5AZH A;  4IM0 A;  4EZJ A;  4CYE A;  2KNB A;  2J0K A;  3AI5 A;  4LJP B;  4HK2 A;  2D3G A;  2CHZ A;  3U30 A;  4K1R B;  4MEM A;  3W1S A;  1R4N I;  3T8M A;  2BGF A;  2NVU I;  1Q0W B;  3QQ8 B;  4W9H A;  1E7V A;  4HXD A;  1WGR A;  3WAN A;  2PEA A;  2O2V B;  3ZNI D;  1WX7 A;  4OVV A;  3T9L A;  5C23 A;  1WMH A;  4KSK C;  2KDE B;  3DBH I;  2IBI B;  1V6E A;  1D3Z A;  3ZW3 A;  2RGF A;  1R4M I;  2Z59 B;  5G55 A;  5CX3 A;  4DHJ D;  2NR2 A;  3APC A;  3DQV A;  4WJP A;  2KJR A;  2G4S A;  4JQW C;  4JIO U;  3DVG Y;  2C7N B;  4W9F A;  3EEC A;  1NI2 A;  1K8R B;  4HWI B;  2GMI C;  2L00 B;  2Z0E B;  4KDI C;  2ZVO A;  4WWO A;  3L16 A;  2ZVN A;  4AOF A;  1EUV B;  4KVG B;  4KZC A;  3TL5 A;  2DYB A;  1P9D U;  4FJV B;  4FJY A;  1UD7 A;  1X1M A;  2N9P C;  3CF6 E;  3WAM A;  1WIA A;  2KK8 A;  3QA8 A;  2KO3 A;  4GDL A;  3W1Y A;  2ZEQ A;  2C7H A;  4W9L A;  3QAR A;  4PS7 A;  4WWP A;  4W9I A;  3VXW A;  3KUC B;  2KJ6 A;  2KX0 A;  2FCN A;  3ZO5 B;  1YD8 U;  3JW0 X;  4WJN A;  4KDL B;  2MSE D;  2L0T A;  3APF A;  3GZN I;  3QAQ A;  3SDL C;  3ZRC A;  2KTF A;  3DBS A;  3KVF B;  2MRP A;  3N3K B;  3QIJ A;  3R3M A;  2CS4 A;  2FNJ B;  4XC2 A;  4FJZ A;  2L76 A;  2LJ5 A;  2OJR A;  4ANX A;  1IYF A;  3NS8 A;  4IUM B;  4AWJ A;  1E5W A;  5D2M B;  3WIM A;  2WX0 A;  5DPS A;  1Z2M A;  2IZV B;  3A9J B;  1WJU A;  2K8C A;  2KVR A;  3NHE B;  2N7D A;  2IO3 B;  3R7Q A;  1M94 A;  1WR1 A;  3A9K B;  4B6W A;  2GBR A;  3NZS A;  3UIN B;  1V5T A;  5CHW A;  1OQY A;  2O6V D;  3L10 B;  4BBN C;  2KQS A;  5JHA A;  1L2N A;  3HIZ A;  1EF1 A;  5AZF A;  4GDK A;  4NNJ B;  2A5U A;  2DYO A;  4HPM B;  3TJP A;  3ZNZ B;  4K7U A;  5J18 A;  5J2R A;  3M62 B;  5E6O A;  4EZK A;  4FA6 A;  2N9X A;  3QJZ A;  4GXB A;  2NCN A;  1E90 A;  5FR6 A;  3ZTD A;  1WE6 A;  1H4R A;  4MDK E;  3VTW A;  1TGZ B;  4CO7 A;  3RT3 B;  2LAS A;  1WI0 A;  2LGY A;  1C3T A;  4K7W A;  2R2O A;  4GOC A;  1E8X A;  2FCM A;  1WFY A;  3PRM B;  4N9F 4;  2MX2 A;  1GG3 A;  2KTR B;  1V2Y A;  4HDO A;  5C1Z A;  3A1Q A;  2ZNV C;  1WXM A;  3ML8 A;  3DOW A;  3RUI B;  3K9O B;  4WWN A;  1A5R A;  5KHO A;  1WZ3 A;  5IA7 A;  3DDC B;  4NY0 A;  1YQB A;  4RMA A;  4RM8 A;  2LWP A;  1HE8 A;  3U8Z A;  4DWF A;  1UBI A;  4NPN A;  3ECI A;  2M17 A;  4TV3 A;  1KM7 A;  1T0Y A;  1RLF A;  2KZR A;  4X57 B;  4ANU A;  2IO2 B;  2V1Y A;  2O6V B;  4G50 A;  3A33 B;  2ZPY A;  3ZDT A;  1ISN A;  2MBH A;  4XX5 A;  4DDG D;  1WX9 A;  3AUL A;  2OOB B;  4BKT A;  2KXJ A;  1AAR A;  4W9E A;  4AUQ C;  2NBW B;  3OAW A;  4HLE A;  3OJ3 A;  2D07 B;  1IP9 A;  3O65 B;  4MEL A;  2V3S A;  2IO1 B;  4HVB A;  1ZKH A;  2FUH B;  4MGK E;  3V6C B;  1I42 A;  2PE9 A;  4EZL A;  2AEH A;  2DYM A;  3HM6 X;  3A4R A;  2HE7 A;  5BO4 B;  4DBG A;  4FBJ B;  2FCQ A;  1V9J A;  2LVQ A;  4BOS C;  4HJK A;  4KIK B;  4KZ0 A;  3VFK A;  4MH0 E;  4TQ0 A;  3PV1 A;  1LXD A;  2KLG A;  4GN1 A;  3NOB A;  2JWZ A;  5J17 A;  2MP2 B;  1XQQ A;  3PVL A;  4K7S A;  3VUW A;  5G2N A;  1FXT B;  2KFJ A;  2JZ3 B;  4E3C A;  2WX1 A;  1TTN A;  2ZCC A;  5AZG A;  2RR9 A;  4URK A;  1KJT A;  2FCS A;  3TCA A;  3HHM A;  2K39 A;  3KH0 A;  4ZRK A;  4MM3 A;  3VUX A;  1WRD B;  4M8N A;  2Y5B B;  2DAF A;  3OLM D;  2MBO A;  3A9J A;  3JVZ X;  4I6P A;  3RUL A;  3SHQ A;  2PJH A;  4DHZ B;  2M1M A;  3IHP C;  2KFK B;  4HDQ A;  3H7P B;  3DVN V;  1Z5S B;  4AP4 C;  1WXA A;  1WZ0 A;  3DVG X;  1WYW B;  4LDT D;  1YJ1 A;  4BBN F;  2MLB A;  4GU2 A;  1SE9 A;  2XK5 B;  3PT2 B;  4GGQ A;  4NQL B;  4A3P A;  2BWE S;  3PS6 A;  2AYO B;  2A4Z A;  4ZRI A;  3VTU A;  4DDI D;  2M0X A;  2GOW A;  4BKS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...