1T0YA

Solution structure of a ubiquitin-like domain from tubulin-binding cofactor b
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
90
structure length
90
Chain Sequence
MTEVYDLEITTNATDFPMEKKYPAGMSLNDLKKKLELVVGTTVDSMRIQLFDGDDQLKGELTDGAKSLKDLGVRDGYRIHAVDVTGGNED
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords tubulin folding cofactor B
publication title Solution Structure of a Ubiquitin-like Domain from Tubulin-binding Cofactor B.
pubmed doi rcsb
source organism Caenorhabditis elegans
molecule tags Chaperone
total genus 20
structure length 90
sequence length 90
ec nomenclature
pdb deposition date 2004-04-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14560 Ubiquitin_2 Ubiquitin-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 1t0yA00
4LCDE 5D6JB 2D2QA 2NBWB 3WAPA 2GBKA 3X0WA 2AWTA 2KWVB 2G3QB 4ICUA 1LXDA 2MBBB 3AU5A 3K9PB 3PRZA 1H4RA 2FAZA 2HE7A 3PLVA 4G50A 3AXCA 3B08A 3ECIA 4ICVA 4M0WB 3ZVVA 2QHOA 3JSVA 3D32A 4KVGB 2Z0DB 4KDIC 3CSTA 4AJWA 3ZNID 2FIFA 1YQBA 4DDID 4MELA 4EZLA 3H7PA 1WJUA 3IVFA 3DVGX 3A4SC 5DPRA 4DDGD 2V4LA 4DBGA 2MBOA 3KUZA 1E8YA 4J6IA 3HM6X 3ZIMA 3M3JA 2N7EA 2KX0A 2DAFA 2BPSA 1V9JA 4CO7A 2WDTB 4BBNF 2J7QB 4GDLA 1WJNA 3APDA 1WMHA 1GUAB 2CR5A 2JRIB 2BGFA 4FHJA 4TQ1A 3VVWB 2I1KA 2KNBA 2B3AA 2DHZA 3DVNV 1E7UA 1WYWB 4AOFA 2BYEA 3GZNI 2L0FA 3GOEA 4B6WA 3JW0X 3PS6A 3A9KA 2JUOA 4GB9A 4RMAA 4IUMB 4ANWA 2YVCA 1P3QU 5DPWA 4W9FA 1V2YA 4W9EA 3KUDB 3ZRFA 2C7NB 1OQYA 2KK8A 4IC7B 2NS5A 5J2RA 2LD9A 2VRRB 3V62A 1L2NA 1LQBA 3SD5A 3C0RB 1EF5A 4M8MA 1WE6A 1UBQA 4W9DA 4HJKA 2GBJA 2K39A 2D3GA 2MBEA 4RM9A 1IPGA 3TMPB 2WWZA 2YLMA 2ZZPB 1WGYA 2N1WA 4K7SA 5KHOA 3R7QA 3M62B 1TBEA 3V6CB 2KQ7A 2IO2B 2PEAA 5L83A 2Z0EB 3RZFA 1IYFA 2KZRA 4NAWB 4BFRA 4FJYA 4CHKA 2KOXA 1UELA 4GSWA 3PTFC 1XD3B 4W9GA 5CTRC 4WWPA 3DCGA 3VH3B 4BVUC 3N32A 3KUCB 2ZVOA 5CHWA 1S3SG 2K1FA 4I6PA 4GIVA 3QHTA 4NY0A 3JSVB 3VUYA 3NHEB 1RLFA 1NBFC 1P0RA 1P9DU 5CX3A 2KD0A 2ZCCA 4FULA 3H7PB 2HD5B 2IBIB 4FA6A 1XT9B 2LGXA 3ZKJC 4TV3A 2OJRA 4MSMB 4F8CB 5J18A 4G0NB 3VTVA 4WAAA 2FCMA 3KYDD 1WXMA 2KC2A 5LXIB 1RRBA 2WX0A 2DZIA 2PPHA 3APCA 4LDTB 1P1AA 1TTNA 2FNJB 2ZJDA 3ALBA 4W9CA 4PS7A 2KC1A 4GDLB 4PYUA 4JLCA 5D7GA 1WMHB 1WR6E 1NDDA 2MX2A 1YX5B 3A1QA 1OEYA 3KYCD 3OLMD 2D10A 4KDLB 2D11A 2MP2A 1WI0A 1GJZA 4ZRJA 4II2B 2RD0A 3ENEA 4MGIE 2K6QA 2IZVB 3A9KB 3NS8A 4OVUA 4FHKA 2V1YA 3ZDMC 1WX8A 1WRDB 3QQ8B 1UH6A 1YIWA 3H7SA 4A3OA 3ML9A 3M63B 4GDKA 1LFDA 1E5WA 2FCQA 3L0WB 3HM3A 2NVUI 3RUIB 2KDBA 4HCPB 2BKRB 4EUTA 2EMTA 3NY5A 2LGDA 4II3B 2ASQA 3Q3JA 4K7UA 2NCNA 2CHWA 3VFKA 3QC8B 3T9LA 3TCAA 2ZNVC 5JZEB 2IO1B 2N7DA 4G3XB 3UQBA 2O6VA 3AULA 4JL9A 5L95C 3DBLI 4LJOB 3B1LX 5LLIA 5JHBA 1ISNA 3AU4A 2RPQA 2KDIA 2KLGA 4W9LA 3ZTDA 4LJPB 2IY1B 3V6EB 2M4NA 1Q0WB 3LJ3A 2REXA 2JPHA 3IBEA 5AZFA 2RR9A 1E8XA 1MG8A 2J0KA 3A9JB 4KSKC 4X57B 3RCZA 4DHJB 2MWSB 1A5RA 3ZNZB 4NJ6A 3IFWB 4HDOA 4HPLB 2KANA 2IO3B 3R7RA 3VTUA 2MLBA 3V60A 3UQAA 4E74A 2L00B 2DYOA 1YJ1A 2LXAA 2A5UA 2DYBA 2KFKA 4WWNA 3U30A 3PRMB 4DXAB 2C7MB 3VUXA 2MRPA 3DVNU 2AYOB 3M95A 4MGKE 4BOSC 2KWUB 4IG7B 3MJWA 4NQLB 4RM8A 5JHAA 4HCNB 1T0YA 4IW0A 5TR5A 2MW5A 3IG3A 4BKSD 3MHSD 3RULA 3VAWA 2EMSA 4HVBA 4MSQB 2D07B 2KTRA 3APFA 3H1UA 3QWZB 3EFUA 3ZO5B 2KWCA 3EHVA 3A1QB 4EFOA 1RFAA 2MCNB 2M8SA 3VDZA 2UWQA 1WGHA 4FJVB 2FIDA 2MP2B 2DZKA 4MEMA 3SU8X 4F7ZA 2W9NA 2JWZA 2CKHB 2LASA 1YX6B 2C7HA 5C1ZA 1FXTB 1VCBA 3ZRCA 2GBNA 1TGZB 1ZGUB 2JVCA 1R4NI 2FCSA 4GU2A 1HE8A 4GDKB 3H6NA 4NJ7A 3ZNGC 2N9XA 1WR1A 4MM3A 2ZPYA 3VXWA 3BY4B 1WXVA 2MA9B 3PHXB 4W9JA 4M8NA 4B95A 3VTWA 2NR2A 4HWIB 3EC8A 2KFJA 3QCAA 2KJRA 1WJ4A 2Y5BB 5DPTA 4P7IA 2BYFA 1WX9A 5E6PA 3R3MA 1KLVA 3N3KB 4IM0A 3W1SC 2O6VB 2J0MA 5G2NA 2LI5A 4BKGA 4ANUA 4EZJA 5KHQA 2V3SA 4HXDA 3QK0A 4XC2A 3QJZA 4KZ0A 1EUVB 1SIFA 3UGBB 4YL8A 3CSFA 1SE9A 1V5TA 4OVVA 3B0AA 2JY6A 1WGRA 1YD8U 2CS4A 2KTFA 2GMIC 3NZUA 2HJ8A 3QARA 4MJSA 3L17A 4DWFA 5AEKB 3QA8A 1V86A 2KQSA 2LWPA 2MBQA 2ZCBA 3A33B 3DBRI 5D94A 1H8CA 4ANXA 3RZWC 3DDCB 3KVFB 1EF1A 3VUWA 1BT0A 5CHFA 3PT2B 3UF8A 4GN1A 2ZEQA 4KIKA 4NQKE 1WH3A 2KFKB 3KH0A 2A4ZA 2CHXA 1E8ZA 1WGDA 5C23A 4MH0E 2FUHB 1UBIA 4DK5A 4PS8A 3P2BA 1OGWA 3OAWA 2L05A 2N1VA 3ONSA 4IM2A 3RYTA 3UIPB 4EKUA 1GG3A 2JRHA 2LRUA 3DVGY 2KDEB 4BBNC 2KVRA 2NPTA 3WANA 4DHZB 1UD7A 3EECA 2KTRB 3IHPC 4K7WA 3WAMA 1E8WA 1WJ6A 2KHWB 2NBVB 4JQWC 4EZKA 4JIOU 1D3ZA 2RSUA 2N9PC 2G45B 4K81A 2LJ5A 2M17A 2LVPA 4KSLC 1I35A 1U4AA 2BWFA 2ZPNA 3DOWA 3TBLD 3O65B 1G6JA 1L7YA 3V61A 3WIMA 2WX1A 4LDTD 4DHZE 4EOYA 3HK0A 4TKNA 1UZXB 2PJHA 1WZ0A 3I3TB 1RAXA 1GC6A 2I1JA 2JZZA 5EDSA 2LUEA 1IP9A 1WF9A 2KKCA 4HPMB 3NOBA 2BWES 3ZUNA 3X23A 2DYMA 5GMVA 3A4RA 3QX1A 3VH4B 1J19A 3KW5B 5DCNA 5FR6A 2UYZB 4E3CA 1Q1OA 1Y8RC 1KOTA 3DBSA 4W9HA 2R2QA 4HDQA 4A3PA 2XEWA 2LZ6A 4NNJB 3NZSA 3TIXA 3PSEB 1WE7A 3L13A 3JVZX 2XK5A 5AZHA 4G11A 2PE6B 2GBRA 2KLCA 4XZ4A 3BINA 4IWQA 4WQOB 1PQSA 3HHMA 4GMVA 4AWJA 2C5LC 4ASWC 2IY0B 3PV1A 4MJSB 4PS3A 4TQ0A 4WJOA 4ZRIA 1QZEA 4A20A 1WIAA 2C9WB 4E71A 2MQJA 4MGZE 1OEYJ 2ZNVB 3W1SA 2L0TA 2G4DB 1J0GA 4ZRKA 1X1MA 3MTNB 4HK2A 2L76A 4KZCA 3U8ZA 4HLEA 4PYZA 1V5OA 1WZ3A 2ZVNA 4KIKB 2K6DB 1WXAA 4EEWA 4K1RB 3DBHI 3H9DA 3WA0A 2O2VA 4W9KA 4IM3A 2L8JA 3DQVA 2K8BA 1KJTA 4AUQC 2KJHB 4FJZA 4MDKE 2AL3A 1V49A 3N30A 4MGYE 4GOCA 4WWOA 4DHJD 5CHVC 2NPTB 2RGFA 5J17A 1WGGA 1GC7A 1NI2A 3PPAA 2Z59B 4F1SA 2KJ6A 1V81A 1UGMA 1S1QB 2GBMA 3CMMB 3K9OB 2CU1A 4W9IA 2DZMA 1M94A 2MBHA 3SDLC 4ANVA 2MSED 2BYVE 3PHWB 3SHQA 3ZNHB 4ZYNA 4BKSA 2AEHA 1WX7A 4WJPA 4I6LB 4FBJB 3L16A 5G55A 3LDZE 2N4FA 4JGHB 2J0JA 4WJQA 1V80A 3ZW3A 3PRPB 1P98A 1WY8A 2K25A 4I6NB 2PE9A 2LVOA 5HKHA 2WYQA 3ZDTA 3S2AA 3PGEA 2GOWA 3VQIA 2L3ZA 1Q5WB 1SGHA 4FADA 1R4MI 3A9JA 4B9KA 2DENB 3L10B 2NBUA 4NPNA 2JF5A 1TZ1A 3CF6E 2FCNA 4IWPA 3ZLZA 2N9EB 4AJYB 4CYEA 2G4SA 4N9F4 3OJ4B 2JXXA 2K8HA 1C3TA 2KX3A 2LRWA 1I42A 5JH5C 2KO3A 2IO0B 1Z2MA 3AI5A 2KN5A 2XK5B 1J8CA 3Q3FA 4URKA 2KMAA 3QAQA 5D2MB 2M1MA 3OJ3A 3TJPA 4WJNA 1EO6A 1WM2A 2BKFA 3L54A 3PLUA 2BF8B 5DPSA 3UIOB 4ZDVA 1KM7A 3VHTC 4BOZB 5IA7A 1E90A 2CHZA 2M0XA 1F9JA 1ZW7A 3JYUA 3HIZA 4FLHA 4TUUA 4KV2A 2L7RA 3U7DA 3DPDA 3PREA 2LGYA 4BKTA 4FN2A 1AARA 1CMXB 1ZKHA 2DAJA 2DZJA 4GXBA 1E7VA 2O6VD 5E6NA 1XQQA 2XBBC 3RT3B 1LM8B 2R2OA 1K8RB 2HTHA 2KXJA 3QIJA 3R66C 4IWOA 3ZTCA 5E6OA 3T8MA 2JT4B 5LXHA 5IAAC 3RD2A 2O2VB 4XX5A 3W1YA 3TL5A 2JZ3B 3L08A 4GGQA 1JRUA 5AZGA 2K8CA 4AP4C 2C60A 1VD2A 1WFYA 3PZDA 2EKEC 2DX5B 3WALA 1WXSA 1WM3A 2AL6A 2KDFB 1Z5SB 1V6EA 2OOBB 2LXCA 1GNUA 3UINB 3WAOA 1C1YB 2LVQA 3ML8A 2IYDB 5BO4B 1OTRB 4NAWA 2KMCA 3PVLA
chains in the Genus database with same CATH superfamily
3X0WA 4K3CA 2KWVB 1MHXA 4ICUA 1H4RA 2HE7A 1JWAD 3PLVA 1WWTA 3B08A 3ECIA 4ICVA 3ZVVA 4P1CC 1PUTA 1FRRA 3CSTA 4AJWA 2FIFA 4DQOC 4DDID 3AB5A 1FXAA 1C4PA 3H7PA 1JRPA 2L52A 4J3OD 1FFUA 2QEJC 2BT6A 3M3JA 1ZPSA 2WDTB 4GDLA 3AEDB 3APDA 1WMHA 4ZOHC 2JRIB 3AEBB 2QCZA 1YMHE 2B76B 2KWDA 2MJDA 3GZNI 4ANWA 4RMAA 1C78A 1C4CA 3KUDB 4JWUC 1KF6B 4M8MA 1TIFA 3MFGA 2WXPA 3TUOA 4RM9A 2LEKA 2WWZA 1KLGD 2YLMA 1WGYA 4OZAA 2N1WA 2V0GA 5KHOA 2ICIA 2PEAA 2IO2B 2E3TA 2WXGA 2Z0EB 3RZFA 4BFRA 5I4DA 2CU3A 3PTFC 4XYCA 1ZDXA 4XDDA 1CQVA 1E7PB 3KUCB 5CHWA 4I6PA 1SF0A 2JYTA 1P9DU 2ZCCA 4FA6A 3ZKJC 4F8CB 2IDYA 2OJRA 1D4BA 1E0ZA 4RF0A 2FE8A 2BB5A 4M00A 2XN9C 1VLBA 2PPHA 3BYTB 1MVKA 1C76A 3AE3B 2M56B 3BK1A 1FXIA 1NDDA 2JQRB 3A1QA 3GS2A 3OLMD 2PVGC 4KDLB 2MP2A 2X38A 4MGIE 1SJED 1SE4A 3Q6BA 1JQ4A 4OVUA 1JMLA 3AEEB 3QQ8B 4RGOS 1UH6A 1YIWA 4A3OA 1EU4A 2W3RA 3AE7B 1E5WA 2FCQA 2WXOA 3HM3A 2WXJA 3BK2A 3UI3A 4JWSC 4HCPB 4EUTA 3NY5A 1HZ5A 2LGDA 4II3B 1HQRD 2ASQA 4K7UA 1T0SC 3QC8B 3O13A 3B1LX 2KDIA 3HVZA 4W9LA 2PTLA 3V6EB 4P1BC 2N7JA 3IBEA 3VR8B 1SE2A 3GP7A 1A5RA 2J4XA 2BB6A 3IFWB 2KANA 3DBRB 2DYOA 2A5UA 1IGCA 1N5XA 2DYBA 2X8XX 2KFKA 4DXAB 1ET6A 2KWUB 3MJWA 1FNVA 4HCNB 3AV8A 4IW0A 2MW5A 3IG3A 4L23A 3RULA 3VAWA 2EMSA 3B9JA 4MSQB 4PT5A 2VZKD 2KTRA 3H1UA 3RNGC 5BYRA 2M8SA 1QKZA 1NI3A 1WGHA 2FIDA 4MEMA 2DZKA 2YEPB 2KACA 4F7ZA 1VCBA 2BW2A 3I57A 1I4RA 1ZGUB 2FCSA 4GU2A 2WS3B 4ZHPA 1WR1A 3BY4B 4KKJA 2J53A 4C4VA 1P7FA 2KT7A 4W9JA 1WJ4A 2Y5BB 2TSSA 1OFFA 3U52E 3ZQ4A 5G2NA 1BMLC 2LI5A 2WXQA 2V3SA 1TT5B 1WXQA 4YL8A 3ABVB 1V1PA 2CS4A 4MJSA 3QA8A 2KQSA 1K53A 1EF1A 3VUWA 2ZEQA 4NQKE 5HHDG 1E8ZA 5D3IB 1AYFA 1IGDA 4EKUA 1GG3A 4OZCA 4QAYA 2NPTA 4DHZB 2RSUA 2N9PC 3EUB2 4WQMA 1L4DB 4KSLC 1I35A 2BTEA 2BWFA 3TBLD 3O65B 2WX1A 5AUIA 4EOYA 3KWLA 2NTTA 2PLPA 1WZ0A 2I1JA 3EGRA 2LGSA 5EDSA 1IP9A 3ZUNA 2Q5WD 3X23A 2PKOA 3OWEB 1N63A 1J19A 5DCNA 1RWSA 2UYZB 1Q1OA 1Y8RC 1TS5A 2QC8A 1RFKA 4W9HA 2R2QA 1UF0A 4A3PA 4NNJB 3EFCA 3TIXA 3PSEB 3AE5B 1SJHD 3JVZX 4G11A 1JW9D 4OHJA 1PQSA 4AWJA 4YSZB 5TSSA 1QZEA 5BMIA 4A20A 3Q8CA 1F77A 2C9WB 2ZNVB 3W1SA 1HTOA 1PFDA 1X1MA 3MTNB 3Q69A 4HK2A 4ZRKA 3U8ZA 4HLEA 4PYZA 1V5OA 2ZVNA 4K1RB 2Y5CA 3DBHI 3H9DA 4W9KA 1KRHA 3MP9A 2AL3A 4DHJD 1WYGA 3U4EG 3PPAA 4F1SA 2Z8LA 1UGMA 2GBMA 4N6EB 1M94A 1T3QA 1N5WA 3SHQA 3ZNHB 1LO5D 4BKSA 2AEHA 1FPYA 2GRIA 1MPEA 5D3DA 3ETRA 4FBJB 3L16A 3Q3MC 3URYA 3P1MA 1P7EA 2K25A 2PE9A 5HKHA 2WNMA 3PGEA 3C19A 3FKYA 3FC4A 1SGHA 2OJWA 4FADA 4TMAB 3FILB 2FCNA 2K3UA 2LFIA 2G4SA 3OJ4B 1RYJA 5E6JA 3AEGB 2KX3A 2KO3A 4HPPA 2WXFA 3PZ8A 2KN5A 4URKA 4HEA1 3QAQA 3N1XC 1J7CA 4WJNA 3GZNB 3UIOB 4ZDVA 3I5JC 2M0XA 2ZW0A 4FLHA 3Q14C 4BKTA 1CMXB 1AN8A 1VJKA 2M0AA 3KWVA 3R66C 4IWOA 1XEEA 3RD2A 4XX5A 3L08A 5AZGA 1VD2A 2KYWA 1WXSA 2AL6A 2KDFB 2LXCA 3RI7C 3WAOA 1C1YB 2LVQA 2IYDB 1R4NB 4KGTA 3PVLA 2GBKA 2AWTA 3AU5A 3K9PB 3PRZA 4S17A 4M0WB 1UUPA 4YTNB 4B0EA 2QHOA 2Z0DB 1MFWA 4N59A 3AH7A 2KMMA 3SFEB 2Y3AA 4DBGA 3KUZA 3ZIMA 3E9SA 2KX0A 1FIQA 2BPSA 4WWMA 4BBNF 2J7QB 1WJNA 1GUAB 1JWUD 2CR5A 3DVNV 2B3AA 1WYWB 4AOFA 2BYEA 3GOEA 3JW0X 4KKIA 4GB9A 1V2YA 2C7NB 4REZA 1L2NA 2LD9A 3SD5A 2CJNA 3W5UB 4XE0A 1QLBB 4W9DA 1IPGA 4IDIA 3TMPB 2ZZPB 4KGRA 3M62B 1TBEA 3CWIA 3V6CB 4A9AA 5L83A 4M01A 4NAWB 4CHKA 3ZYYX 2KOXA 2NTSA 1XD3B 4W9GA 2XNAC 4BVUC 1TS2A 2K1FA 1B9RA 3VUYA 4FULA 2IBIB 1OQRA 2R61A 1JWBD 4MSMB 4G0NB 2K9XA 4WAAA 2KN4A 1RRBA 2WX0A 1HA5A 2DZIA 5C3JB 4ARIA 1TKYA 5EE0A 4W9CA 2EKIA 3ALBA 4PS7A 1KLUD 2MX2A 1YQ3B 2PIAA 2D5GA 1QOAA 1WI0A 4II2B 3N20C 1F0ZA 3LYYA 4FHKA 3ZDMC 3HVDA 1WX8A 4RGTA 1T5XD 1MJDA 3ML9A 3L0WB 2DWQA 3RUIB 3KQ4A 2KDBA 3Q8AA 5HFYA 2EMTA 4YWGG 3VFKA 1ACCA 1QOBA 3IT6B 4JL9A 5L95C 3ZXRA 4BAXA 3AU4A 2W55A 2RPQA 3ZTDA 2DNFA 1Q0WB 2M4NA 3GB1A 3LJ3A 2REXA 4KSKC 3ZNZB 1KFYB 4HDOA 1R4MB 2IO3B 4A8XC 1YN3A 1SB3C 1SEBD 1YNTE 1AW7A 2LXAA 4A6QA 3DVNU 4MGKE 1V1OA 5JHAA 4HROA 1XLNA 4BKSD 2BS3B 1D5MC 4NZLB 1VZ7A 1SXTA 2D07B 3ZO5B 3QWZB 5IP4D 4EFOA 2MCNB 5BMHA 2D3AA 3VDZA 4YTPB 4RFBA 1ET9A 4UDUC 1FXTB 3ZRCA 2GBNA 1TGZB 3Q8BA 3W9CB 2WGSA 5GXGB 1R4NI 4RH6A 1QOGA 4L2YA 1HE8A 3P4SB 4JX1C 1I7HA 4NJ7A 3VXWA 3RNAC 4H2AA 1FMAD 4XWTA 3EC8A 2BYFA 3BVZA 3R3MA 1KLVA 4IM0A 4AQ7A 3RNFC 5KHQA 4HXDA 4XC2A 3QJZA 2IGGA 1EUVB 3UGBB 1GAQB 3CSFA 1SE9A 1V5TA 3B0AA 1DOIA 3NVWA 2GMIC 2HJ8A 5AEKB 3L17A 2MBQA 1H8CA 1B1ZA 3E56A 4LNNA 5CHFA 1K51A 3PT2B 3AE9B 1SSNA 1WH3A 2PMVA 3KH0A 2A4ZA 2MJEA 3OAWA 3DBHB 3ONSA 4IM2A 3RYTA 2V3PA 2JRHA 2KDEB 3T3NA 4BBNC 2EELA 3RNBC 2PW9A 1WJ6A 2AX5A 1DYQA 2G45B 2LJ5A 2M17A 2LVPA 1PGBA 2ZPNA 3WIMA 2RDBC 4DHZE 3HK0A 2WHIA 1GC6A 4MM3B 4HPMB 2I38A 2DLBA 2GI9A 4ACFA 3FILA 2G9HD 3DBSA 2LMCA 3NZSA 2KQ4X 2JWUA 1WE7A 3AEAB 1J7AA 1D5ZC 2GBRA 1YQ4B 2KLCA 4XZ4A 4IWQA 4GMVA 5G5HA 1V97A 3PV1A 2D3BA 4ZRPA 4B0MA 5EE3A 2G4DB 1TS4A 4KIKB 1YN4A 2K6DB 3NJTA 1XLOA 4IOIE 3WA0A 4YT0B 2LHEA 4AUQC 2KJHB 4FJZA 4MDKE 4GOCA 4WWOA 2WU2B 2ACZB 2RGFA 3BVGA 2IGHA 1ENFA 1WGGA 1GC7A 3AE2B 2Z59B 1FCCC 1S1QB 3CMMB 2DZMA 2HJ1A 2BYVE 2INNE 4RNAA 4ZYNA 5LNK1 4S0RA 4M0WA 2WXLA 4WJPA 3ZW3A 3RPFC 3PRPB 2RDGA 4MT5A 2LVOA 3S2AA 1Q10A 4P16A 1NYQA 4AS1A 5FR3A 1VR9A 1HTQA 1R4MI 3A9JA 5H92C 2DENB 3L10B 4NPNA 2OEDA 2JF5A 4B9KA 2N9EB 4N9F4 2I2YA 3EA6A 1C3TA 2WXHA 1TS3A 3R2IA 2WU5B 4MH8A 2XK5B 2V9HA 1J8CA 2LGIA 1ZUD2 3TJPA 2BKFA 3PLUA 3C8YA 5IA7A 2CHZA 1ZW7A 3JYUA 3HIZA 4KV2A 2L7RA 1AARA 2DZJA 4GXBA 3MC8A 3R2TA 5E6NA 1XQQA 3RT3B 1LM8B 3ZTCA 5G5GA 3T8MA 1VZ6A 1SBBB 2JT4B 5LXHA 4OW0A 2O2VB 2VH2A 1I4XA 3PZDA 2EKEC 2DX5B 2OOBB 1Z5SB 1V6EA 5BO4B 1OTRB 4NAWA 4LCDE 5D6JB 2NBWB 1LXDA 2MBBB 1TYGB 3IAM1 2FAZA 2DBYA 3T3OA 1C77A 1HZ6A 1D5XC 4KVGB 3AE1B 4KDIC 3ZNID 3U7ZA 1QQRA 4MELA 4EZLA 3DVGX 4DDGD 5DPRA 4TSSA 2HDEA 3DWGC 2V4LA 2MBOA 3HM6X 2WLBA 2DAFA 1V9JA 4CO7A 5EE9A 1L6VA 3VVWB 2BGFA 2KNBA 2D3CA 4WH4A 1FO4A 1T0QC 3GE8C 4C56C 3TEZA 2BS4B 3PS6A 2JUOA 5H8YE 5DPWA 4W9EA 3ZRFA 3NS1A 2KK8A 2WXNA 2IGDA 5J2RA 3V62A 1LQBA 3NVVA 1EF5A 4YSYB 1ESFA 1YOVB 4US8A 3PO0A 2GBJA 3ZJVA 2D3GA 1F2RC 4GLSC 3AM9A 3IXSA 4K7SA 3R7QA 4YXDB 1K52A 1NYRA 1FCLA 1IYFA 2KZRA 1TZOA 4FJYA 1UELA 1R7SA 4GSWA 1ZP0B 3DCGA 1S3SG 1C4AA 1CZPA 4GIVA 4NY0A 3JSVB 3NHEB 3BVMA 1RLFA 1QILA 3NVZA 1P0RA 3MHZA 5CX3A 1E6EB 2KD0A 2RDHA 2HD5B 4NJCA 4TV3A 5J18A 1PYWD 2FCMA 1WXMA 2KC2A 3Q3NC 5LXIB 1GB1A 4LDTB 1TTNA 1CK1A 1GB4A 1KH0A 1D6EC 4PYUA 3V05A 2LJIA 1CJEA 2QDFA 1YX5B 3KYCD 2D10A 1I4GA 4HRSA 1FM0D 3SR6A 3WCQA 4ZRJA 2RD0A 1DGJA 1MI0A 3A9KB 3NS8A 3ZJUA 1WRDB 2V3NA 3H7SA 1FNUA 1QT9A 3RNEC 4YTMB 2W3SA 3AE8B 3NRZA 1LFDA 1AWDA 4ZHOA 2PVOD 1L5PA 2BQQA 5JZEB 3UQBA 2IO1B 2N7DA 4G3XB 5EE1A 3DBLI 1ISNA 3TEYA 4LLGM 1NVID 2IJ0A 2KLGA 2JPHA 3GE3C 4LNOA 2RR9A 2J0KA 1MG8A 3A9JB 4X57B 3HRDD 1TKEA 3V3XA 2MLBA 3UQAA 2SAKA 4LNIA 4ARCA 4WWNA 3U30A 3R8BA 3VUXA 2AYOB 4BOSC 3P4PB 2FBWB 2WDQB 4HVBA 1SIJA 3EFUA 1MHHE 1RFAA 3BYYB 1JROA 2UWQA 1UNSA 3SU8X 3NVYA 2AQ2B 2JWZA 4D2KA 2LASA 1YX6B 3J9CA 1N62A 2AQ1B 4BZAA 2BBCA 3Q8FA 2JVCA 4GDKB 3ZNGC 3AE6B 2YEPF 4MM3A 2ZPYA 4C7YA 3VRAB 4M8NA 4DXGA 4HWIB 3QCAA 2JXTA 2KJRA 4OVZA 5DPTA 2KDMA 4P6VF 4A90A 3N3KB 3W1SC 5FK9C 2O6VB 4EZJA 3QK0A 3SFDB 1XXGA 1SIFA 2J52A 4OVVA 2GB1A 2JY6A 2KTFA 3FAHA 2LWPA 2ZCBA 3W5VB 3A33B 1TKGA 4ANXA 3NUHB 1M4VA 4R3DA 4KIKA 5C23A 1WGDA 2GLSA 4MH0E 3DHIC 1UBIA 1Y56A 3P2BA 1OGWA 4WIPA 2L05A 2LRUA 3DVGY 2N9KA 2KVRA 3WANA 1WRIA 4K7WA 4ZYSA 3RN9C 2KHWB 2NBVB 4JIOU 3KLSX 1YN5A 1U4AA 1G6JA 3DOWA 3V61A 4N58A 3I63C 4HKZE 1N61A 4TKNA 3TEWA 4HJGE 2PJHA 1RAXA 4A55A 1WF9A 2KKCA 1L0VB 3NOBA 1A70A 2BVCA 1XLPA 4JPSA 1E9MA 3A4RA 5GMVA 3QX1A 3KW5B 3N9YC 2H88B 3VR9B 1KOTA 1HEZE 4RCOA 1F1HA 4MACA 4HDQA 2ZW1A 2LZ6A 3AN1A 3B2FA 3L13A 2XK5A 1ZE3D 1F2RI 3P42A 2N0SB 3HHMA 2C5LC 2IY0B 4PS3A 4WJOA 4ZRIA 4L1BA 4MGZE 1OEYJ 3MJ5A 1J0GA 4KZCA 2L76A 3LXFA 2O2VA 4IM3A 2L8JA 3BIID 3DQVA 2K8BA 2RMMA 4MGYE 5CHVC 5J17A 3RNCC 1L6UA 2KJ6A 3AE4B 1EM7A 1K50A 2CU1A 2NMQA 2MBHA 3PHWB 1WX7A 1I4QA 1TY2A 1ZXHA 2INCC 4I6LB 1HXYD 5G55A 3LDZE 5BYSA 4JGHB 3MC9A 2J0JA 4WJQA 1V80A 1P98A 1XO3A 1SE3A 1WY8A 2L83A 4I6NB 2JU6X 2FUG1 2WYQA 1BUIC 1ROEA 2GOWA 3VQIA 5MPOA 2N9LA 1PGXA 3VRBB 3ZLZA 2KVZA 2LRWA 1C79A 1I42A 2SEBD 5HG2A 3Q3OC 5D2MB 3OJ3A 3VH4B 1WM2A 2MJ3A 3CIRB 3L54A 1ZXIA 2BF8B 1KM7A 3VHTC 1F9JA 1E10A 3U7DA 3DPDA 3PREA 1TJEA 2ONQA 2XBBC 2MEKA 2VH1A 3QIJA 4KGSA 3TL5A 3Q8EA 3MC0B 3UINB 5HI1A 1GNUA 5T8IA 3ML8A 4LK0M 2KMCA 1UWMA 2D2QA 3WAPA 2G3QB 4DXFA 2JSVX 3SEBA 4G50A 3AXCA 2VZKB 1QOFA 3JSVA 3D32A 4RF1A 1YQBA 1L0XB 1WGKA 1WJUA 2WXMA 3IVFA 3A4SC 2QILA 4O1NA 4KX6B 2QJLA 4K3BA 1E8YA 4J6IA 2N7EA 1BXTA 1NENB 4TQ1A 3AECB 1PDXA 3LB8C 4FHJA 1IBXB 2I1KA 2DHZA 1E7UA 4CQNA 2MHJA 2L0FA 4B6WA 3A9KA 2ON8A 4IUMB 2KAJA 2YVCA 1P3QU 1EWYC 1IUEA 4W9FA 3TEXA 1C9FA 4IC7B 1OQYA 2NS5A 2VRRB 3RFZB 1LGRA 3C0RB 1EU3A 1WE6A 1UBQA 4HJKA 1JCKB 2K39A 2MBEA 1NEKB 2W82A 1F52A 3IAS1 3N1ZC 2W54A 2KQ7A 3NZ3A 1KTKA 5IO9A 1VZ8A 3DBLB 2WP9B 5CTRC 4WWPA 3VH3B 5AUKA 3N32A 2ZVOA 2QIEB 3QHTA 3B2GA 5C2TB 1FFVA 1NBFC 2H89B 1T6BX 3H7PB 1XT9B 2LGXA 3H8HA 3VTVA 4XGAB 3KYDD 4IKGA 1DOYA 4C80A 3APCA 2INPE 3N1YC 1P1AA 2FNJB 2ZJDA 2KC1A 4GDLB 4JLCA 5D7GA 1WMHB 1WR6E 4OZBA 1ZOYB 1OEYA 2D11A 3OG5A 1GJZA 3ENEA 2K6QA 1TY0A 2IZVB 2V1YA 2WXRA 4ITKA 4XWWA 1FNWA 3M63B 4GDKA 2JZPA 1L0YB 2NVUI 2BKRB 3RMKC 1ZDVA 5BYQA 3Q3JA 2QSDA 2NCNA 2CHWA 3T9LA 3TCAA 2ZNVC 3P63A 2O6VA 1GPXA 3AULA 4USAA 3HUIA 4LJOB 5IKCM 5LLIA 5JHBA 2CJOA 4XDCA 4LJPB 2IY1B 2BYTA 5AZFA 1E8XA 3RCZA 2Y5PA 4DHJB 2MWSB 4NJ6A 4HPLB 3R7RA 3VTUA 1V8CA 3V60A 4E74A 2L00B 1GOZA 1YJ1A 3PRMB 2C7MB 2MRPA 3M95A 4NQLB 4IG7B 4RM8A 2V4IB 1T0YA 5TR5A 3MHSD 1XCQL 3APFA 2KWCA 3EHVA 3A1QB 5FKAC 4FXCA 4WAFA 4ZRQA 4FJVB 2MP2B 3ZJTA 2W9NA 2CKHB 2C7HA 2WQYB 1XLQA 3P4QB 5C1ZA 3U2SC 3H6NA 4LNFA 2N9XA 2E6XA 5IN7A 1WXVA 2MA9B 3PHXB 1FEHA 4B95A 3VTWA 2NR2A 2KFJA 4RGNA 4P7IA 1WX9A 2L32A 5E6PA 4WURA 2IPKD 5JXVA 2J0MA 4BKGA 4ANUA 4LNKA 4M02A 2L1AA 4KZ0A 3AMZA 1XF5L 1WGRA 1YD8U 3QARA 3NZUA 4DWFA 1V86A 3I9V1 3DBRI 5D94A 1UWXA 3RZWC 3DDCB 3KVFB 1BT0A 3UF8A 4GN1A 1JWMD 2KFKB 1STEA 2CHXA 2J42A 1T0RC 2FUHB 3L4PA 3P4RB 4DK5A 4PS8A 1VDVA 1JALA 2N1VA 2UU7A 3UIPB 1UD7A 3EECA 5IOIA 2KTRB 3IHPC 3WAMA 1E8WA 2JYEA 4JQWC 4EZKA 1D3ZA 4K81A 4RGMA 1L7YA 4LDTD 2LHDA 2LUMA 1UZXB 3I3TB 1I4HA 2JZZA 2LUEA 4C4VB 2M19A 1RM6C 2BWES 2DYMA 1VRAB 5FR6A 4E3CA 2XEWA 4PK1A 3IT4B 1OQQA 4LTUA 1QF6A 5AZHA 2PE6B 3BINA 3ZGZA 4WQOB 3W2DA 3BWUD 1V1PB 3ZXVA 4ASWC 4MJSB 4TQ0A 3DHHC 1JWSD 1PGAA 1WIAA 2BS2B 4E71A 2MQJA 4JE3B 2L0TA 4NAMA 1MG4A 2QMTA 1WZ3A 1WXAA 2K0PA 4EEWA 1YJIA 1DOXA 4EE2A 3TSSA 1KJTA 1V49A 2G1EA 1J7BA 3N30A 2AQ3B 2NPTB 1NI2A 2RPVA 1WSPA 1V81A 2JX5A 3K9OB 3AEFB 4W9IA 3SDLC 4ANVA 1FD6A 1L4ZB 2MSED 3Q2AC 4YSXB 4US9A 2N4FA 2K5PA 3DHGC 3ZDTA 4C7ZA 2L3ZA 3NG0A 1Q5WB 2HTME 2WXIA 2NBUA 3CF6E 1TZ1A 4IWPA 4AJYB 4CYEA 2JXXA 2K8HA 2MH7A 2OHFA 1IBXA 2WDVB 5JH5C 1XCTL 1N6ZA 2IO0B 1Z2MA 3AI5A 4Q2JA 5BMGA 1FRDA 3Q3FA 2KMAA 2M1MA 1EO6A 5DPSA 4BOZB 1E90A 4TUUA 2LGYA 2WXKA 4FN2A 1ZKHA 2DAJA 1E7VA 2O6VD 1I4PA 2R2OA 1K8RB 2HTHA 2KXJA 5E6OA 2INDC 1YJJA 2K22A 3DWMA 5IAAC 3PZ7A 4C00A 3W1YA 2JZ3B 4GGQA 1JRUA 2K8CA 1EWCA 2C60A 1WFYA 4AP4C 3WALA 1WM3A 2WDRB 3BZDB 1N60A 1UGJA 4HKQA
chains in the Genus database with same CATH topology
4LCDE 5D6JB 2D2QA 2NBWB 3WAPA 2GBKA 3X0WA 2AWTA 2KWVB 2G3QB 4ICUA 1LXDA 2MBBB 3AU5A 3K9PB 3PRZA 1H4RA 2FAZA 2HE7A 3PLVA 4G50A 3AXCA 3B08A 3ECIA 4ICVA 4M0WB 3ZVVA 2QHOA 3JSVA 3D32A 4KVGB 2Z0DB 4KDIC 3CSTA 4AJWA 3ZNID 2FIFA 1YQBA 4DDID 4MELA 4EZLA 3H7PA 1WJUA 3IVFA 3DVGX 3A4SC 5DPRA 4DDGD 2V4LA 4DBGA 2MBOA 3KUZA 1E8YA 4J6IA 3HM6X 3ZIMA 3M3JA 2N7EA 2KX0A 2DAFA 2BPSA 1V9JA 4CO7A 2WDTB 4BBNF 2J7QB 4GDLA 1WJNA 3APDA 1WMHA 1GUAB 2CR5A 2JRIB 2BGFA 4FHJA 4TQ1A 3VVWB 2I1KA 2KNBA 2B3AA 2DHZA 3DVNV 1E7UA 1WYWB 4AOFA 2BYEA 3GZNI 2L0FA 3GOEA 4B6WA 3JW0X 3PS6A 3A9KA 2JUOA 4GB9A 4RMAA 4IUMB 4ANWA 2YVCA 1P3QU 5DPWA 4W9FA 1V2YA 4W9EA 3KUDB 3ZRFA 2C7NB 1OQYA 2KK8A 4IC7B 2NS5A 5J2RA 2LD9A 2VRRB 3V62A 1L2NA 1LQBA 3SD5A 3C0RB 1EF5A 4M8MA 1WE6A 1UBQA 4W9DA 4HJKA 2GBJA 2K39A 2D3GA 2MBEA 4RM9A 1IPGA 3TMPB 2WWZA 2YLMA 2ZZPB 1WGYA 2N1WA 4K7SA 5KHOA 3R7QA 3M62B 1TBEA 3V6CB 2KQ7A 2IO2B 2PEAA 5L83A 2Z0EB 3RZFA 1IYFA 2KZRA 4NAWB 4BFRA 4FJYA 4CHKA 2KOXA 1UELA 4GSWA 3PTFC 1XD3B 4W9GA 5CTRC 4WWPA 3DCGA 3VH3B 4BVUC 3N32A 3KUCB 2ZVOA 5CHWA 1S3SG 2K1FA 4I6PA 4GIVA 3QHTA 4NY0A 3JSVB 3VUYA 3NHEB 1RLFA 1NBFC 1P0RA 1P9DU 5CX3A 2KD0A 2ZCCA 4FULA 3H7PB 2HD5B 2IBIB 4FA6A 1XT9B 2LGXA 3ZKJC 4TV3A 2OJRA 4MSMB 4F8CB 5J18A 4G0NB 3VTVA 4WAAA 2FCMA 3KYDD 1WXMA 2KC2A 5LXIB 1RRBA 2WX0A 2DZIA 2PPHA 3APCA 4LDTB 1P1AA 1TTNA 2FNJB 2ZJDA 3ALBA 4W9CA 4PS7A 2KC1A 4GDLB 4PYUA 4JLCA 5D7GA 1WMHB 1WR6E 1NDDA 2MX2A 1YX5B 3A1QA 1OEYA 3KYCD 3OLMD 2D10A 4KDLB 2D11A 2MP2A 1WI0A 1GJZA 4ZRJA 4II2B 2RD0A 3ENEA 4MGIE 2K6QA 2IZVB 3A9KB 3NS8A 4OVUA 4FHKA 2V1YA 3ZDMC 1WX8A 1WRDB 3QQ8B 1UH6A 1YIWA 3H7SA 4A3OA 3ML9A 3M63B 4GDKA 1LFDA 1E5WA 2FCQA 3L0WB 3HM3A 2NVUI 3RUIB 2KDBA 4HCPB 2BKRB 4EUTA 2EMTA 3NY5A 2LGDA 4II3B 2ASQA 3Q3JA 4K7UA 2NCNA 2CHWA 3VFKA 3QC8B 3T9LA 3TCAA 2ZNVC 5JZEB 2IO1B 2N7DA 4G3XB 3UQBA 2O6VA 3AULA 4JL9A 5L95C 3DBLI 4LJOB 3B1LX 5LLIA 5JHBA 1ISNA 3AU4A 2RPQA 2KDIA 2KLGA 4W9LA 3ZTDA 4LJPB 2IY1B 3V6EB 2M4NA 1Q0WB 3LJ3A 2REXA 2JPHA 3IBEA 5AZFA 2RR9A 1E8XA 1MG8A 2J0KA 3A9JB 4KSKC 4X57B 3RCZA 4DHJB 2MWSB 1A5RA 3ZNZB 4NJ6A 3IFWB 4HDOA 4HPLB 2KANA 2IO3B 3R7RA 3VTUA 2MLBA 3V60A 3UQAA 4E74A 2L00B 2DYOA 1YJ1A 2LXAA 2A5UA 2DYBA 2KFKA 4WWNA 3U30A 3PRMB 4DXAB 2C7MB 3VUXA 2MRPA 3DVNU 2AYOB 3M95A 4MGKE 4BOSC 2KWUB 4IG7B 3MJWA 4NQLB 4RM8A 5JHAA 4HCNB 1T0YA 4IW0A 5TR5A 2MW5A 3IG3A 4BKSD 3MHSD 3RULA 3VAWA 2EMSA 4HVBA 4MSQB 2D07B 2KTRA 3APFA 3H1UA 3QWZB 3EFUA 3ZO5B 2KWCA 3EHVA 3A1QB 4EFOA 1RFAA 2MCNB 2M8SA 3VDZA 2UWQA 1WGHA 4FJVB 2FIDA 2MP2B 2DZKA 4MEMA 3SU8X 4F7ZA 2W9NA 2JWZA 2CKHB 2LASA 1YX6B 2C7HA 5C1ZA 1FXTB 1VCBA 3ZRCA 2GBNA 1TGZB 1ZGUB 2JVCA 1R4NI 2FCSA 4GU2A 1HE8A 4GDKB 3H6NA 4NJ7A 3ZNGC 2N9XA 1WR1A 4MM3A 2ZPYA 3VXWA 3BY4B 1WXVA 2MA9B 3PHXB 4W9JA 4M8NA 4B95A 3VTWA 2NR2A 4HWIB 3EC8A 2KFJA 3QCAA 2KJRA 1WJ4A 2Y5BB 5DPTA 4P7IA 2BYFA 1WX9A 5E6PA 3R3MA 1KLVA 3N3KB 4IM0A 3W1SC 2O6VB 2J0MA 5G2NA 2LI5A 4BKGA 4ANUA 4EZJA 5KHQA 2V3SA 4HXDA 3QK0A 4XC2A 3QJZA 4KZ0A 1EUVB 1SIFA 3UGBB 4YL8A 3CSFA 1SE9A 1V5TA 4OVVA 3B0AA 2JY6A 1WGRA 1YD8U 2CS4A 2KTFA 2GMIC 3NZUA 2HJ8A 3QARA 4MJSA 3L17A 4DWFA 5AEKB 3QA8A 1V86A 2KQSA 2LWPA 2MBQA 2ZCBA 3A33B 3DBRI 5D94A 1H8CA 4ANXA 3RZWC 3DDCB 3KVFB 1EF1A 3VUWA 1BT0A 5CHFA 3PT2B 3UF8A 4GN1A 2ZEQA 4KIKA 4NQKE 1WH3A 2KFKB 3KH0A 2A4ZA 2CHXA 1E8ZA 1WGDA 5C23A 4MH0E 2FUHB 1UBIA 4DK5A 4PS8A 3P2BA 1OGWA 3OAWA 2L05A 2N1VA 3ONSA 4IM2A 3RYTA 3UIPB 4EKUA 1GG3A 2JRHA 2LRUA 3DVGY 2KDEB 4BBNC 2KVRA 2NPTA 3WANA 4DHZB 1UD7A 3EECA 2KTRB 3IHPC 4K7WA 3WAMA 1E8WA 1WJ6A 2KHWB 2NBVB 4JQWC 4EZKA 4JIOU 1D3ZA 2RSUA 2N9PC 2G45B 4K81A 2LJ5A 2M17A 2LVPA 4KSLC 1I35A 1U4AA 2BWFA 2ZPNA 3DOWA 3TBLD 3O65B 1G6JA 1L7YA 3V61A 3WIMA 2WX1A 4LDTD 4DHZE 4EOYA 3HK0A 4TKNA 1UZXB 2PJHA 1WZ0A 3I3TB 1RAXA 1GC6A 2I1JA 2JZZA 5EDSA 2LUEA 1IP9A 1WF9A 2KKCA 4HPMB 3NOBA 2BWES 3ZUNA 3X23A 2DYMA 5GMVA 3A4RA 3QX1A 3VH4B 1J19A 3KW5B 5DCNA 5FR6A 2UYZB 4E3CA 1Q1OA 1Y8RC 1KOTA 3DBSA 4W9HA 2R2QA 4HDQA 4A3PA 2XEWA 2LZ6A 4NNJB 3NZSA 3TIXA 3PSEB 1WE7A 3L13A 3JVZX 2XK5A 5AZHA 4G11A 2PE6B 2GBRA 2KLCA 4XZ4A 3BINA 4IWQA 4WQOB 1PQSA 3HHMA 4GMVA 4AWJA 2C5LC 4ASWC 2IY0B 3PV1A 4MJSB 4PS3A 4TQ0A 4WJOA 4ZRIA 1QZEA 4A20A 1WIAA 2C9WB 4E71A 2MQJA 4MGZE 1OEYJ 2ZNVB 3W1SA 2L0TA 2G4DB 1J0GA 4ZRKA 1X1MA 3MTNB 4HK2A 2L76A 4KZCA 3U8ZA 4HLEA 4PYZA 1V5OA 1WZ3A 2ZVNA 4KIKB 2K6DB 1WXAA 4EEWA 4K1RB 3DBHI 3H9DA 3WA0A 2O2VA 4W9KA 4IM3A 2L8JA 3DQVA 2K8BA 1KJTA 4AUQC 2KJHB 4FJZA 4MDKE 2AL3A 1V49A 3N30A 4MGYE 4GOCA 4WWOA 4DHJD 5CHVC 2NPTB 2RGFA 5J17A 1WGGA 1GC7A 1NI2A 3PPAA 2Z59B 4F1SA 2KJ6A 1V81A 1UGMA 1S1QB 2GBMA 3CMMB 3K9OB 2CU1A 4W9IA 2DZMA 1M94A 2MBHA 3SDLC 4ANVA 2MSED 2BYVE 3PHWB 3SHQA 3ZNHB 4ZYNA 4BKSA 2AEHA 1WX7A 4WJPA 4I6LB 4FBJB 3L16A 5G55A 3LDZE 2N4FA 4JGHB 2J0JA 4WJQA 1V80A 3ZW3A 3PRPB 1P98A 1WY8A 2K25A 4I6NB 2PE9A 2LVOA 5HKHA 2WYQA 3ZDTA 3S2AA 3PGEA 2GOWA 3VQIA 2L3ZA 1Q5WB 1SGHA 4FADA 1R4MI 3A9JA 4B9KA 2DENB 3L10B 2NBUA 4NPNA 2JF5A 1TZ1A 3CF6E 2FCNA 4IWPA 3ZLZA 2N9EB 4AJYB 4CYEA 2G4SA 4N9F4 3OJ4B 2JXXA 2K8HA 1C3TA 2KX3A 2LRWA 1I42A 5JH5C 2KO3A 2IO0B 1Z2MA 3AI5A 2KN5A 2XK5B 1J8CA 3Q3FA 4URKA 2KMAA 3QAQA 5D2MB 2M1MA 3OJ3A 3TJPA 4WJNA 1EO6A 1WM2A 2BKFA 3L54A 3PLUA 2BF8B 5DPSA 3UIOB 4ZDVA 1KM7A 3VHTC 4BOZB 5IA7A 1E90A 2CHZA 2M0XA 1F9JA 1ZW7A 3JYUA 3HIZA 4FLHA 4TUUA 4KV2A 2L7RA 3U7DA 3DPDA 3PREA 2LGYA 4BKTA 4FN2A 1AARA 1CMXB 1ZKHA 2DAJA 2DZJA 4GXBA 1E7VA 2O6VD 5E6NA 1XQQA 2XBBC 3RT3B 1LM8B 2R2OA 1K8RB 2HTHA 2KXJA 3QIJA 3R66C 4IWOA 3ZTCA 5E6OA 3T8MA 2JT4B 5LXHA 5IAAC 3RD2A 2O2VB 4XX5A 3W1YA 3TL5A 2JZ3B 3L08A 4GGQA 1JRUA 5AZGA 2K8CA 4AP4C 2C60A 1VD2A 1WFYA 3PZDA 2EKEC 2DX5B 3WALA 1WXSA 1WM3A 2AL6A 2KDFB 1Z5SB 1V6EA 2OOBB 2LXCA 1GNUA 3UINB 3WAOA 1C1YB 2LVQA 3ML8A 2IYDB 5BO4B 1OTRB 4NAWA 2KMCA 3PVLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4LCD E;  5D6J B;  2D2Q A;  2NBW B;  3WAP A;  2GBK A;  3X0W A;  2AWT A;  2KWV B;  2G3Q B;  4ICU A;  1LXD A;  2MBB B;  3AU5 A;  3K9P B;  3PRZ A;  1H4R A;  2FAZ A;  2HE7 A;  3PLV A;  4G50 A;  3AXC A;  3B08 A;  3ECI A;  4ICV A;  4M0W B;  3ZVV A;  2QHO A;  3JSV A;  3D32 A;  4KVG B;  2Z0D B;  4KDI C;  3CST A;  4AJW A;  3ZNI D;  2FIF A;  1YQB A;  4DDI D;  4MEL A;  4EZL A;  3H7P A;  1WJU A;  3IVF A;  3DVG X;  3A4S C;  5DPR A;  4DDG D;  2V4L A;  4DBG A;  2MBO A;  3KUZ A;  1E8Y A;  4J6I A;  3HM6 X;  3ZIM A;  3M3J A;  2N7E A;  2KX0 A;  2DAF A;  2BPS A;  1V9J A;  4CO7 A;  2WDT B;  4BBN F;  2J7Q B;  4GDL A;  1WJN A;  3APD A;  1WMH A;  1GUA B;  2CR5 A;  2JRI B;  2BGF A;  4FHJ A;  4TQ1 A;  3VVW B;  2I1K A;  2KNB A;  2B3A A;  2DHZ A;  3DVN V;  1E7U A;  1WYW B;  4AOF A;  2BYE A;  3GZN I;  2L0F A;  3GOE A;  4B6W A;  3JW0 X;  3PS6 A;  3A9K A;  2JUO A;  4GB9 A;  4RMA A;  4IUM B;  4ANW A;  2YVC A;  1P3Q U;  5DPW A;  4W9F A;  1V2Y A;  4W9E A;  3KUD B;  3ZRF A;  2C7N B;  1OQY A;  2KK8 A;  4IC7 B;  2NS5 A;  5J2R A;  2LD9 A;  2VRR B;  3V62 A;  1L2N A;  1LQB A;  3SD5 A;  3C0R B;  1EF5 A;  4M8M A;  1WE6 A;  1UBQ A;  4W9D A;  4HJK A;  2GBJ A;  2K39 A;  2D3G A;  2MBE A;  4RM9 A;  1IPG A;  3TMP B;  2WWZ A;  2YLM A;  2ZZP B;  1WGY A;  2N1W A;  4K7S A;  5KHO A;  3R7Q A;  3M62 B;  1TBE A;  3V6C B;  2KQ7 A;  2IO2 B;  2PEA A;  5L83 A;  2Z0E B;  3RZF A;  1IYF A;  2KZR A;  4NAW B;  4BFR A;  4FJY A;  4CHK A;  2KOX A;  1UEL A;  4GSW A;  3PTF C;  1XD3 B;  4W9G A;  5CTR C;  4WWP A;  3DCG A;  3VH3 B;  4BVU C;  3N32 A;  3KUC B;  2ZVO A;  5CHW A;  1S3S G;  2K1F A;  4I6P A;  4GIV A;  3QHT A;  4NY0 A;  3JSV B;  3VUY A;  3NHE B;  1RLF A;  1NBF C;  1P0R A;  1P9D U;  5CX3 A;  2KD0 A;  2ZCC A;  4FUL A;  3H7P B;  2HD5 B;  2IBI B;  4FA6 A;  1XT9 B;  2LGX A;  3ZKJ C;  4TV3 A;  2OJR A;  4MSM B;  4F8C B;  5J18 A;  4G0N B;  3VTV A;  4WAA A;  2FCM A;  3KYD D;  1WXM A;  2KC2 A;  5LXI B;  1RRB A;  2WX0 A;  2DZI A;  2PPH A;  3APC A;  4LDT B;  1P1A A;  1TTN A;  2FNJ B;  2ZJD A;  3ALB A;  4W9C A;  4PS7 A;  2KC1 A;  4GDL B;  4PYU A;  4JLC A;  5D7G A;  1WMH B;  1WR6 E;  1NDD A;  2MX2 A;  1YX5 B;  3A1Q A;  1OEY A;  3KYC D;  3OLM D;  2D10 A;  4KDL B;  2D11 A;  2MP2 A;  1WI0 A;  1GJZ A;  4ZRJ A;  4II2 B;  2RD0 A;  3ENE A;  4MGI E;  2K6Q A;  2IZV B;  3A9K B;  3NS8 A;  4OVU A;  4FHK A;  2V1Y A;  3ZDM C;  1WX8 A;  1WRD B;  3QQ8 B;  1UH6 A;  1YIW A;  3H7S A;  4A3O A;  3ML9 A;  3M63 B;  4GDK A;  1LFD A;  1E5W A;  2FCQ A;  3L0W B;  3HM3 A;  2NVU I;  3RUI B;  2KDB A;  4HCP B;  2BKR B;  4EUT A;  2EMT A;  3NY5 A;  2LGD A;  4II3 B;  2ASQ A;  3Q3J A;  4K7U A;  2NCN A;  2CHW A;  3VFK A;  3QC8 B;  3T9L A;  3TCA A;  2ZNV C;  5JZE B;  2IO1 B;  2N7D A;  4G3X B;  3UQB A;  2O6V A;  3AUL A;  4JL9 A;  5L95 C;  3DBL I;  4LJO B;  3B1L X;  5LLI A;  5JHB A;  1ISN A;  3AU4 A;  2RPQ A;  2KDI A;  2KLG A;  4W9L A;  3ZTD A;  4LJP B;  2IY1 B;  3V6E B;  2M4N A;  1Q0W B;  3LJ3 A;  2REX A;  2JPH A;  3IBE A;  5AZF A;  2RR9 A;  1E8X A;  1MG8 A;  2J0K A;  3A9J B;  4KSK C;  4X57 B;  3RCZ A;  4DHJ B;  2MWS B;  1A5R A;  3ZNZ B;  4NJ6 A;  3IFW B;  4HDO A;  4HPL B;  2KAN A;  2IO3 B;  3R7R A;  3VTU A;  2MLB A;  3V60 A;  3UQA A;  4E74 A;  2L00 B;  2DYO A;  1YJ1 A;  2LXA A;  2A5U A;  2DYB A;  2KFK A;  4WWN A;  3U30 A;  3PRM B;  4DXA B;  2C7M B;  3VUX A;  2MRP A;  3DVN U;  2AYO B;  3M95 A;  4MGK E;  4BOS C;  2KWU B;  4IG7 B;  3MJW A;  4NQL B;  4RM8 A;  5JHA A;  4HCN B;  1T0Y A;  4IW0 A;  5TR5 A;  2MW5 A;  3IG3 A;  4BKS D;  3MHS D;  3RUL A;  3VAW A;  2EMS A;  4HVB A;  4MSQ B;  2D07 B;  2KTR A;  3APF A;  3H1U A;  3QWZ B;  3EFU A;  3ZO5 B;  2KWC A;  3EHV A;  3A1Q B;  4EFO A;  1RFA A;  2MCN B;  2M8S A;  3VDZ A;  2UWQ A;  1WGH A;  4FJV B;  2FID A;  2MP2 B;  2DZK A;  4MEM A;  3SU8 X;  4F7Z A;  2W9N A;  2JWZ A;  2CKH B;  2LAS A;  1YX6 B;  2C7H A;  5C1Z A;  1FXT B;  1VCB A;  3ZRC A;  2GBN A;  1TGZ B;  1ZGU B;  2JVC A;  1R4N I;  2FCS A;  4GU2 A;  1HE8 A;  4GDK B;  3H6N A;  4NJ7 A;  3ZNG C;  2N9X A;  1WR1 A;  4MM3 A;  2ZPY A;  3VXW A;  3BY4 B;  1WXV A;  2MA9 B;  3PHX B;  4W9J A;  4M8N A;  4B95 A;  3VTW A;  2NR2 A;  4HWI B;  3EC8 A;  2KFJ A;  3QCA A;  2KJR A;  1WJ4 A;  2Y5B B;  5DPT A;  4P7I A;  2BYF A;  1WX9 A;  5E6P A;  3R3M A;  1KLV A;  3N3K B;  4IM0 A;  3W1S C;  2O6V B;  2J0M A;  5G2N A;  2LI5 A;  4BKG A;  4ANU A;  4EZJ A;  5KHQ A;  2V3S A;  4HXD A;  3QK0 A;  4XC2 A;  3QJZ A;  4KZ0 A;  1EUV B;  1SIF A;  3UGB B;  4YL8 A;  3CSF A;  1SE9 A;  1V5T A;  4OVV A;  3B0A A;  2JY6 A;  1WGR A;  1YD8 U;  2CS4 A;  2KTF A;  2GMI C;  3NZU A;  2HJ8 A;  3QAR A;  4MJS A;  3L17 A;  4DWF A;  5AEK B;  3QA8 A;  1V86 A;  2KQS A;  2LWP A;  2MBQ A;  2ZCB A;  3A33 B;  3DBR I;  5D94 A;  1H8C A;  4ANX A;  3RZW C;  3DDC B;  3KVF B;  1EF1 A;  3VUW A;  1BT0 A;  5CHF A;  3PT2 B;  3UF8 A;  4GN1 A;  2ZEQ A;  4KIK A;  4NQK E;  1WH3 A;  2KFK B;  3KH0 A;  2A4Z A;  2CHX A;  1E8Z A;  1WGD A;  5C23 A;  4MH0 E;  2FUH B;  1UBI A;  4DK5 A;  4PS8 A;  3P2B A;  1OGW A;  3OAW A;  2L05 A;  2N1V A;  3ONS A;  4IM2 A;  3RYT A;  3UIP B;  4EKU A;  1GG3 A;  2JRH A;  2LRU A;  3DVG Y;  2KDE B;  4BBN C;  2KVR A;  2NPT A;  3WAN A;  4DHZ B;  1UD7 A;  3EEC A;  2KTR B;  3IHP C;  4K7W A;  3WAM A;  1E8W A;  1WJ6 A;  2KHW B;  2NBV B;  4JQW C;  4EZK A;  4JIO U;  1D3Z A;  2RSU A;  2N9P C;  2G45 B;  4K81 A;  2LJ5 A;  2M17 A;  2LVP A;  4KSL C;  1I35 A;  1U4A A;  2BWF A;  2ZPN A;  3DOW A;  3TBL D;  3O65 B;  1G6J A;  1L7Y A;  3V61 A;  3WIM A;  2WX1 A;  4LDT D;  4DHZ E;  4EOY A;  3HK0 A;  4TKN A;  1UZX B;  2PJH A;  1WZ0 A;  3I3T B;  1RAX A;  1GC6 A;  2I1J A;  2JZZ A;  5EDS A;  2LUE A;  1IP9 A;  1WF9 A;  2KKC A;  4HPM B;  3NOB A;  2BWE S;  3ZUN A;  3X23 A;  2DYM A;  5GMV A;  3A4R A;  3QX1 A;  3VH4 B;  1J19 A;  3KW5 B;  5DCN A;  5FR6 A;  2UYZ B;  4E3C A;  1Q1O A;  1Y8R C;  1KOT A;  3DBS A;  4W9H A;  2R2Q A;  4HDQ A;  4A3P A;  2XEW A;  2LZ6 A;  4NNJ B;  3NZS A;  3TIX A;  3PSE B;  1WE7 A;  3L13 A;  3JVZ X;  2XK5 A;  5AZH A;  4G11 A;  2PE6 B;  2GBR A;  2KLC A;  4XZ4 A;  3BIN A;  4IWQ A;  4WQO B;  1PQS A;  3HHM A;  4GMV A;  4AWJ A;  2C5L C;  4ASW C;  2IY0 B;  3PV1 A;  4MJS B;  4PS3 A;  4TQ0 A;  4WJO A;  4ZRI A;  1QZE A;  4A20 A;  1WIA A;  2C9W B;  4E71 A;  2MQJ A;  4MGZ E;  1OEY J;  2ZNV B;  3W1S A;  2L0T A;  2G4D B;  1J0G A;  4ZRK A;  1X1M A;  3MTN B;  4HK2 A;  2L76 A;  4KZC A;  3U8Z A;  4HLE A;  4PYZ A;  1V5O A;  1WZ3 A;  2ZVN A;  4KIK B;  2K6D B;  1WXA A;  4EEW A;  4K1R B;  3DBH I;  3H9D A;  3WA0 A;  2O2V A;  4W9K A;  4IM3 A;  2L8J A;  3DQV A;  2K8B A;  1KJT A;  4AUQ C;  2KJH B;  4FJZ A;  4MDK E;  2AL3 A;  1V49 A;  3N30 A;  4MGY E;  4GOC A;  4WWO A;  4DHJ D;  5CHV C;  2NPT B;  2RGF A;  5J17 A;  1WGG A;  1GC7 A;  1NI2 A;  3PPA A;  2Z59 B;  4F1S A;  2KJ6 A;  1V81 A;  1UGM A;  1S1Q B;  2GBM A;  3CMM B;  3K9O B;  2CU1 A;  4W9I A;  2DZM A;  1M94 A;  2MBH A;  3SDL C;  4ANV A;  2MSE D;  2BYV E;  3PHW B;  3SHQ A;  3ZNH B;  4ZYN A;  4BKS A;  2AEH A;  1WX7 A;  4WJP A;  4I6L B;  4FBJ B;  3L16 A;  5G55 A;  3LDZ E;  2N4F A;  4JGH B;  2J0J A;  4WJQ A;  1V80 A;  3ZW3 A;  3PRP B;  1P98 A;  1WY8 A;  2K25 A;  4I6N B;  2PE9 A;  2LVO A;  5HKH A;  2WYQ A;  3ZDT A;  3S2A A;  3PGE A;  2GOW A;  3VQI A;  2L3Z A;  1Q5W B;  1SGH A;  4FAD A;  1R4M I;  3A9J A;  4B9K A;  2DEN B;  3L10 B;  2NBU A;  4NPN A;  2JF5 A;  1TZ1 A;  3CF6 E;  2FCN A;  4IWP A;  3ZLZ A;  2N9E B;  4AJY B;  4CYE A;  2G4S A;  4N9F 4;  3OJ4 B;  2JXX A;  2K8H A;  1C3T A;  2KX3 A;  2LRW A;  1I42 A;  5JH5 C;  2KO3 A;  2IO0 B;  1Z2M A;  3AI5 A;  2KN5 A;  2XK5 B;  1J8C A;  3Q3F A;  4URK A;  2KMA A;  3QAQ A;  5D2M B;  2M1M A;  3OJ3 A;  3TJP A;  4WJN A;  1EO6 A;  1WM2 A;  2BKF A;  3L54 A;  3PLU A;  2BF8 B;  5DPS A;  3UIO B;  4ZDV A;  1KM7 A;  3VHT C;  4BOZ B;  5IA7 A;  1E90 A;  2CHZ A;  2M0X A;  1F9J A;  1ZW7 A;  3JYU A;  3HIZ A;  4FLH A;  4TUU A;  4KV2 A;  2L7R A;  3U7D A;  3DPD A;  3PRE A;  2LGY A;  4BKT A;  4FN2 A;  1AAR A;  1CMX B;  1ZKH A;  2DAJ A;  2DZJ A;  4GXB A;  1E7V A;  2O6V D;  5E6N A;  1XQQ A;  2XBB C;  3RT3 B;  1LM8 B;  2R2O A;  1K8R B;  2HTH A;  2KXJ A;  3QIJ A;  3R66 C;  4IWO A;  3ZTC A;  5E6O A;  3T8M A;  2JT4 B;  5LXH A;  5IAA C;  3RD2 A;  2O2V B;  4XX5 A;  3W1Y A;  3TL5 A;  2JZ3 B;  3L08 A;  4GGQ A;  1JRU A;  5AZG A;  2K8C A;  4AP4 C;  2C60 A;  1VD2 A;  1WFY A;  3PZD A;  2EKE C;  2DX5 B;  3WAL A;  1WXS A;  1WM3 A;  2AL6 A;  2KDF B;  1Z5S B;  1V6E A;  2OOB B;  2LXC A;  1GNU A;  3UIN B;  3WAO A;  1C1Y B;  2LVQ A;  3ML8 A;  2IYD B;  5BO4 B;  1OTR B;  4NAW A;  2KMC A;  3PVL A; 
#chains in the Genus database with same CATH topology
 3X0W A;  4K3C A;  2KWV B;  1MHX A;  4ICU A;  1H4R A;  2HE7 A;  1JWA D;  3PLV A;  1WWT A;  3B08 A;  3ECI A;  4ICV A;  3ZVV A;  4P1C C;  1PUT A;  1FRR A;  3CST A;  4AJW A;  2FIF A;  4DQO C;  4DDI D;  3AB5 A;  1FXA A;  1C4P A;  3H7P A;  1JRP A;  2L52 A;  4J3O D;  1FFU A;  2QEJ C;  2BT6 A;  3M3J A;  1ZPS A;  2WDT B;  4GDL A;  3AED B;  3APD A;  1WMH A;  4ZOH C;  2JRI B;  3AEB B;  2QCZ A;  1YMH E;  2B76 B;  2KWD A;  2MJD A;  3GZN I;  4ANW A;  4RMA A;  1C78 A;  1C4C A;  3KUD B;  4JWU C;  1KF6 B;  4M8M A;  1TIF A;  3MFG A;  2WXP A;  3TUO A;  4RM9 A;  2LEK A;  2WWZ A;  1KLG D;  2YLM A;  1WGY A;  4OZA A;  2N1W A;  2V0G A;  5KHO A;  2ICI A;  2PEA A;  2IO2 B;  2E3T A;  2WXG A;  2Z0E B;  3RZF A;  4BFR A;  5I4D A;  2CU3 A;  3PTF C;  4XYC A;  1ZDX A;  4XDD A;  1CQV A;  1E7P B;  3KUC B;  5CHW A;  4I6P A;  1SF0 A;  2JYT A;  1P9D U;  2ZCC A;  4FA6 A;  3ZKJ C;  4F8C B;  2IDY A;  2OJR A;  1D4B A;  1E0Z A;  4RF0 A;  2FE8 A;  2BB5 A;  4M00 A;  2XN9 C;  1VLB A;  2PPH A;  3BYT B;  1MVK A;  1C76 A;  3AE3 B;  2M56 B;  3BK1 A;  1FXI A;  1NDD A;  2JQR B;  3A1Q A;  3GS2 A;  3OLM D;  2PVG C;  4KDL B;  2MP2 A;  2X38 A;  4MGI E;  1SJE D;  1SE4 A;  3Q6B A;  1JQ4 A;  4OVU A;  1JML A;  3AEE B;  3QQ8 B;  4RGO S;  1UH6 A;  1YIW A;  4A3O A;  1EU4 A;  2W3R A;  3AE7 B;  1E5W A;  2FCQ A;  2WXO A;  3HM3 A;  2WXJ A;  3BK2 A;  3UI3 A;  4JWS C;  4HCP B;  4EUT A;  3NY5 A;  1HZ5 A;  2LGD A;  4II3 B;  1HQR D;  2ASQ A;  4K7U A;  1T0S C;  3QC8 B;  3O13 A;  3B1L X;  2KDI A;  3HVZ A;  4W9L A;  2PTL A;  3V6E B;  4P1B C;  2N7J A;  3IBE A;  3VR8 B;  1SE2 A;  3GP7 A;  1A5R A;  2J4X A;  2BB6 A;  3IFW B;  2KAN A;  3DBR B;  2DYO A;  2A5U A;  1IGC A;  1N5X A;  2DYB A;  2X8X X;  2KFK A;  4DXA B;  1ET6 A;  2KWU B;  3MJW A;  1FNV A;  4HCN B;  3AV8 A;  4IW0 A;  2MW5 A;  3IG3 A;  4L23 A;  3RUL A;  3VAW A;  2EMS A;  3B9J A;  4MSQ B;  4PT5 A;  2VZK D;  2KTR A;  3H1U A;  3RNG C;  5BYR A;  2M8S A;  1QKZ A;  1NI3 A;  1WGH A;  2FID A;  4MEM A;  2DZK A;  2YEP B;  2KAC A;  4F7Z A;  1VCB A;  2BW2 A;  3I57 A;  1I4R A;  1ZGU B;  2FCS A;  4GU2 A;  2WS3 B;  4ZHP A;  1WR1 A;  3BY4 B;  4KKJ A;  2J53 A;  4C4V A;  1P7F A;  2KT7 A;  4W9J A;  1WJ4 A;  2Y5B B;  2TSS A;  1OFF A;  3U52 E;  3ZQ4 A;  5G2N A;  1BML C;  2LI5 A;  2WXQ A;  2V3S A;  1TT5 B;  1WXQ A;  4YL8 A;  3ABV B;  1V1P A;  2CS4 A;  4MJS A;  3QA8 A;  2KQS A;  1K53 A;  1EF1 A;  3VUW A;  2ZEQ A;  4NQK E;  5HHD G;  1E8Z A;  5D3I B;  1AYF A;  1IGD A;  4EKU A;  1GG3 A;  4OZC A;  4QAY A;  2NPT A;  4DHZ B;  2RSU A;  2N9P C;  3EUB 2;  4WQM A;  1L4D B;  4KSL C;  1I35 A;  2BTE A;  2BWF A;  3TBL D;  3O65 B;  2WX1 A;  5AUI A;  4EOY A;  3KWL A;  2NTT A;  2PLP A;  1WZ0 A;  2I1J A;  3EGR A;  2LGS A;  5EDS A;  1IP9 A;  3ZUN A;  2Q5W D;  3X23 A;  2PKO A;  3OWE B;  1N63 A;  1J19 A;  5DCN A;  1RWS A;  2UYZ B;  1Q1O A;  1Y8R C;  1TS5 A;  2QC8 A;  1RFK A;  4W9H A;  2R2Q A;  1UF0 A;  4A3P A;  4NNJ B;  3EFC A;  3TIX A;  3PSE B;  3AE5 B;  1SJH D;  3JVZ X;  4G11 A;  1JW9 D;  4OHJ A;  1PQS A;  4AWJ A;  4YSZ B;  5TSS A;  1QZE A;  5BMI A;  4A20 A;  3Q8C A;  1F77 A;  2C9W B;  2ZNV B;  3W1S A;  1HTO A;  1PFD A;  1X1M A;  3MTN B;  3Q69 A;  4HK2 A;  4ZRK A;  3U8Z A;  4HLE A;  4PYZ A;  1V5O A;  2ZVN A;  4K1R B;  2Y5C A;  3DBH I;  3H9D A;  4W9K A;  1KRH A;  3MP9 A;  2AL3 A;  4DHJ D;  1WYG A;  3U4E G;  3PPA A;  4F1S A;  2Z8L A;  1UGM A;  2GBM A;  4N6E B;  1M94 A;  1T3Q A;  1N5W A;  3SHQ A;  3ZNH B;  1LO5 D;  4BKS A;  2AEH A;  1FPY A;  2GRI A;  1MPE A;  5D3D A;  3ETR A;  4FBJ B;  3L16 A;  3Q3M C;  3URY A;  3P1M A;  1P7E A;  2K25 A;  2PE9 A;  5HKH A;  2WNM A;  3PGE A;  3C19 A;  3FKY A;  3FC4 A;  1SGH A;  2OJW A;  4FAD A;  4TMA B;  3FIL B;  2FCN A;  2K3U A;  2LFI A;  2G4S A;  3OJ4 B;  1RYJ A;  5E6J A;  3AEG B;  2KX3 A;  2KO3 A;  4HPP A;  2WXF A;  3PZ8 A;  2KN5 A;  4URK A;  4HEA 1;  3QAQ A;  3N1X C;  1J7C A;  4WJN A;  3GZN B;  3UIO B;  4ZDV A;  3I5J C;  2M0X A;  2ZW0 A;  4FLH A;  3Q14 C;  4BKT A;  1CMX B;  1AN8 A;  1VJK A;  2M0A A;  3KWV A;  3R66 C;  4IWO A;  1XEE A;  3RD2 A;  4XX5 A;  3L08 A;  5AZG A;  1VD2 A;  2KYW A;  1WXS A;  2AL6 A;  2KDF B;  2LXC A;  3RI7 C;  3WAO A;  1C1Y B;  2LVQ A;  2IYD B;  1R4N B;  4KGT A;  3PVL A;  2GBK A;  2AWT A;  3AU5 A;  3K9P B;  3PRZ A;  4S17 A;  4M0W B;  1UUP A;  4YTN B;  4B0E A;  2QHO A;  2Z0D B;  1MFW A;  4N59 A;  3AH7 A;  2KMM A;  3SFE B;  2Y3A A;  4DBG A;  3KUZ A;  3ZIM A;  3E9S A;  2KX0 A;  1FIQ A;  2BPS A;  4WWM A;  4BBN F;  2J7Q B;  1WJN A;  1GUA B;  1JWU D;  2CR5 A;  3DVN V;  2B3A A;  1WYW B;  4AOF A;  2BYE A;  3GOE A;  3JW0 X;  4KKI A;  4GB9 A;  1V2Y A;  2C7N B;  4REZ A;  1L2N A;  2LD9 A;  3SD5 A;  2CJN A;  3W5U B;  4XE0 A;  1QLB B;  4W9D A;  1IPG A;  4IDI A;  3TMP B;  2ZZP B;  4KGR A;  3M62 B;  1TBE A;  3CWI A;  3V6C B;  4A9A A;  5L83 A;  4M01 A;  4NAW B;  4CHK A;  3ZYY X;  2KOX A;  2NTS A;  1XD3 B;  4W9G A;  2XNA C;  4BVU C;  1TS2 A;  2K1F A;  1B9R A;  3VUY A;  4FUL A;  2IBI B;  1OQR A;  2R61 A;  1JWB D;  4MSM B;  4G0N B;  2K9X A;  4WAA A;  2KN4 A;  1RRB A;  2WX0 A;  1HA5 A;  2DZI A;  5C3J B;  4ARI A;  1TKY A;  5EE0 A;  4W9C A;  2EKI A;  3ALB A;  4PS7 A;  1KLU D;  2MX2 A;  1YQ3 B;  2PIA A;  2D5G A;  1QOA A;  1WI0 A;  4II2 B;  3N20 C;  1F0Z A;  3LYY A;  4FHK A;  3ZDM C;  3HVD A;  1WX8 A;  4RGT A;  1T5X D;  1MJD A;  3ML9 A;  3L0W B;  2DWQ A;  3RUI B;  3KQ4 A;  2KDB A;  3Q8A A;  5HFY A;  2EMT A;  4YWG G;  3VFK A;  1ACC A;  1QOB A;  3IT6 B;  4JL9 A;  5L95 C;  3ZXR A;  4BAX A;  3AU4 A;  2W55 A;  2RPQ A;  3ZTD A;  2DNF A;  1Q0W B;  2M4N A;  3GB1 A;  3LJ3 A;  2REX A;  4KSK C;  3ZNZ B;  1KFY B;  4HDO A;  1R4M B;  2IO3 B;  4A8X C;  1YN3 A;  1SB3 C;  1SEB D;  1YNT E;  1AW7 A;  2LXA A;  4A6Q A;  3DVN U;  4MGK E;  1V1O A;  5JHA A;  4HRO A;  1XLN A;  4BKS D;  2BS3 B;  1D5M C;  4NZL B;  1VZ7 A;  1SXT A;  2D07 B;  3ZO5 B;  3QWZ B;  5IP4 D;  4EFO A;  2MCN B;  5BMH A;  2D3A A;  3VDZ A;  4YTP B;  4RFB A;  1ET9 A;  4UDU C;  1FXT B;  3ZRC A;  2GBN A;  1TGZ B;  3Q8B A;  3W9C B;  2WGS A;  5GXG B;  1R4N I;  4RH6 A;  1QOG A;  4L2Y A;  1HE8 A;  3P4S B;  4JX1 C;  1I7H A;  4NJ7 A;  3VXW A;  3RNA C;  4H2A A;  1FMA D;  4XWT A;  3EC8 A;  2BYF A;  3BVZ A;  3R3M A;  1KLV A;  4IM0 A;  4AQ7 A;  3RNF C;  5KHQ A;  4HXD A;  4XC2 A;  3QJZ A;  2IGG A;  1EUV B;  3UGB B;  1GAQ B;  3CSF A;  1SE9 A;  1V5T A;  3B0A A;  1DOI A;  3NVW A;  2GMI C;  2HJ8 A;  5AEK B;  3L17 A;  2MBQ A;  1H8C A;  1B1Z A;  3E56 A;  4LNN A;  5CHF A;  1K51 A;  3PT2 B;  3AE9 B;  1SSN A;  1WH3 A;  2PMV A;  3KH0 A;  2A4Z A;  2MJE A;  3OAW A;  3DBH B;  3ONS A;  4IM2 A;  3RYT A;  2V3P A;  2JRH A;  2KDE B;  3T3N A;  4BBN C;  2EEL A;  3RNB C;  2PW9 A;  1WJ6 A;  2AX5 A;  1DYQ A;  2G45 B;  2LJ5 A;  2M17 A;  2LVP A;  1PGB A;  2ZPN A;  3WIM A;  2RDB C;  4DHZ E;  3HK0 A;  2WHI A;  1GC6 A;  4MM3 B;  4HPM B;  2I38 A;  2DLB A;  2GI9 A;  4ACF A;  3FIL A;  2G9H D;  3DBS A;  2LMC A;  3NZS A;  2KQ4 X;  2JWU A;  1WE7 A;  3AEA B;  1J7A A;  1D5Z C;  2GBR A;  1YQ4 B;  2KLC A;  4XZ4 A;  4IWQ A;  4GMV A;  5G5H A;  1V97 A;  3PV1 A;  2D3B A;  4ZRP A;  4B0M A;  5EE3 A;  2G4D B;  1TS4 A;  4KIK B;  1YN4 A;  2K6D B;  3NJT A;  1XLO A;  4IOI E;  3WA0 A;  4YT0 B;  2LHE A;  4AUQ C;  2KJH B;  4FJZ A;  4MDK E;  4GOC A;  4WWO A;  2WU2 B;  2ACZ B;  2RGF A;  3BVG A;  2IGH A;  1ENF A;  1WGG A;  1GC7 A;  3AE2 B;  2Z59 B;  1FCC C;  1S1Q B;  3CMM B;  2DZM A;  2HJ1 A;  2BYV E;  2INN E;  4RNA A;  4ZYN A;  5LNK 1;  4S0R A;  4M0W A;  2WXL A;  4WJP A;  3ZW3 A;  3RPF C;  3PRP B;  2RDG A;  4MT5 A;  2LVO A;  3S2A A;  1Q10 A;  4P16 A;  1NYQ A;  4AS1 A;  5FR3 A;  1VR9 A;  1HTQ A;  1R4M I;  3A9J A;  5H92 C;  2DEN B;  3L10 B;  4NPN A;  2OED A;  2JF5 A;  4B9K A;  2N9E B;  4N9F 4;  2I2Y A;  3EA6 A;  1C3T A;  2WXH A;  1TS3 A;  3R2I A;  2WU5 B;  4MH8 A;  2XK5 B;  2V9H A;  1J8C A;  2LGI A;  1ZUD 2;  3TJP A;  2BKF A;  3PLU A;  3C8Y A;  5IA7 A;  2CHZ A;  1ZW7 A;  3JYU A;  3HIZ A;  4KV2 A;  2L7R A;  1AAR A;  2DZJ A;  4GXB A;  3MC8 A;  3R2T A;  5E6N A;  1XQQ A;  3RT3 B;  1LM8 B;  3ZTC A;  5G5G A;  3T8M A;  1VZ6 A;  1SBB B;  2JT4 B;  5LXH A;  4OW0 A;  2O2V B;  2VH2 A;  1I4X A;  3PZD A;  2EKE C;  2DX5 B;  2OOB B;  1Z5S B;  1V6E A;  5BO4 B;  1OTR B;  4NAW A;  4LCD E;  5D6J B;  2NBW B;  1LXD A;  2MBB B;  1TYG B;  3IAM 1;  2FAZ A;  2DBY A;  3T3O A;  1C77 A;  1HZ6 A;  1D5X C;  4KVG B;  3AE1 B;  4KDI C;  3ZNI D;  3U7Z A;  1QQR A;  4MEL A;  4EZL A;  3DVG X;  4DDG D;  5DPR A;  4TSS A;  2HDE A;  3DWG C;  2V4L A;  2MBO A;  3HM6 X;  2WLB A;  2DAF A;  1V9J A;  4CO7 A;  5EE9 A;  1L6V A;  3VVW B;  2BGF A;  2KNB A;  2D3C A;  4WH4 A;  1FO4 A;  1T0Q C;  3GE8 C;  4C56 C;  3TEZ A;  2BS4 B;  3PS6 A;  2JUO A;  5H8Y E;  5DPW A;  4W9E A;  3ZRF A;  3NS1 A;  2KK8 A;  2WXN A;  2IGD A;  5J2R A;  3V62 A;  1LQB A;  3NVV A;  1EF5 A;  4YSY B;  1ESF A;  1YOV B;  4US8 A;  3PO0 A;  2GBJ A;  3ZJV A;  2D3G A;  1F2R C;  4GLS C;  3AM9 A;  3IXS A;  4K7S A;  3R7Q A;  4YXD B;  1K52 A;  1NYR A;  1FCL A;  1IYF A;  2KZR A;  1TZO A;  4FJY A;  1UEL A;  1R7S A;  4GSW A;  1ZP0 B;  3DCG A;  1S3S G;  1C4A A;  1CZP A;  4GIV A;  4NY0 A;  3JSV B;  3NHE B;  3BVM A;  1RLF A;  1QIL A;  3NVZ A;  1P0R A;  3MHZ A;  5CX3 A;  1E6E B;  2KD0 A;  2RDH A;  2HD5 B;  4NJC A;  4TV3 A;  5J18 A;  1PYW D;  2FCM A;  1WXM A;  2KC2 A;  3Q3N C;  5LXI B;  1GB1 A;  4LDT B;  1TTN A;  1CK1 A;  1GB4 A;  1KH0 A;  1D6E C;  4PYU A;  3V05 A;  2LJI A;  1CJE A;  2QDF A;  1YX5 B;  3KYC D;  2D10 A;  1I4G A;  4HRS A;  1FM0 D;  3SR6 A;  3WCQ A;  4ZRJ A;  2RD0 A;  1DGJ A;  1MI0 A;  3A9K B;  3NS8 A;  3ZJU A;  1WRD B;  2V3N A;  3H7S A;  1FNU A;  1QT9 A;  3RNE C;  4YTM B;  2W3S A;  3AE8 B;  3NRZ A;  1LFD A;  1AWD A;  4ZHO A;  2PVO D;  1L5P A;  2BQQ A;  5JZE B;  3UQB A;  2IO1 B;  2N7D A;  4G3X B;  5EE1 A;  3DBL I;  1ISN A;  3TEY A;  4LLG M;  1NVI D;  2IJ0 A;  2KLG A;  2JPH A;  3GE3 C;  4LNO A;  2RR9 A;  2J0K A;  1MG8 A;  3A9J B;  4X57 B;  3HRD D;  1TKE A;  3V3X A;  2MLB A;  3UQA A;  2SAK A;  4LNI A;  4ARC A;  4WWN A;  3U30 A;  3R8B A;  3VUX A;  2AYO B;  4BOS C;  3P4P B;  2FBW B;  2WDQ B;  4HVB A;  1SIJ A;  3EFU A;  1MHH E;  1RFA A;  3BYY B;  1JRO A;  2UWQ A;  1UNS A;  3SU8 X;  3NVY A;  2AQ2 B;  2JWZ A;  4D2K A;  2LAS A;  1YX6 B;  3J9C A;  1N62 A;  2AQ1 B;  4BZA A;  2BBC A;  3Q8F A;  2JVC A;  4GDK B;  3ZNG C;  3AE6 B;  2YEP F;  4MM3 A;  2ZPY A;  4C7Y A;  3VRA B;  4M8N A;  4DXG A;  4HWI B;  3QCA A;  2JXT A;  2KJR A;  4OVZ A;  5DPT A;  2KDM A;  4P6V F;  4A90 A;  3N3K B;  3W1S C;  5FK9 C;  2O6V B;  4EZJ A;  3QK0 A;  3SFD B;  1XXG A;  1SIF A;  2J52 A;  4OVV A;  2GB1 A;  2JY6 A;  2KTF A;  3FAH A;  2LWP A;  2ZCB A;  3W5V B;  3A33 B;  1TKG A;  4ANX A;  3NUH B;  1M4V A;  4R3D A;  4KIK A;  5C23 A;  1WGD A;  2GLS A;  4MH0 E;  3DHI C;  1UBI A;  1Y56 A;  3P2B A;  1OGW A;  4WIP A;  2L05 A;  2LRU A;  3DVG Y;  2N9K A;  2KVR A;  3WAN A;  1WRI A;  4K7W A;  4ZYS A;  3RN9 C;  2KHW B;  2NBV B;  4JIO U;  3KLS X;  1YN5 A;  1U4A A;  1G6J A;  3DOW A;  3V61 A;  4N58 A;  3I63 C;  4HKZ E;  1N61 A;  4TKN A;  3TEW A;  4HJG E;  2PJH A;  1RAX A;  4A55 A;  1WF9 A;  2KKC A;  1L0V B;  3NOB A;  1A70 A;  2BVC A;  1XLP A;  4JPS A;  1E9M A;  3A4R A;  5GMV A;  3QX1 A;  3KW5 B;  3N9Y C;  2H88 B;  3VR9 B;  1KOT A;  1HEZ E;  4RCO A;  1F1H A;  4MAC A;  4HDQ A;  2ZW1 A;  2LZ6 A;  3AN1 A;  3B2F A;  3L13 A;  2XK5 A;  1ZE3 D;  1F2R I;  3P42 A;  2N0S B;  3HHM A;  2C5L C;  2IY0 B;  4PS3 A;  4WJO A;  4ZRI A;  4L1B A;  4MGZ E;  1OEY J;  3MJ5 A;  1J0G A;  4KZC A;  2L76 A;  3LXF A;  2O2V A;  4IM3 A;  2L8J A;  3BII D;  3DQV A;  2K8B A;  2RMM A;  4MGY E;  5CHV C;  5J17 A;  3RNC C;  1L6U A;  2KJ6 A;  3AE4 B;  1EM7 A;  1K50 A;  2CU1 A;  2NMQ A;  2MBH A;  3PHW B;  1WX7 A;  1I4Q A;  1TY2 A;  1ZXH A;  2INC C;  4I6L B;  1HXY D;  5G55 A;  3LDZ E;  5BYS A;  4JGH B;  3MC9 A;  2J0J A;  4WJQ A;  1V80 A;  1P98 A;  1XO3 A;  1SE3 A;  1WY8 A;  2L83 A;  4I6N B;  2JU6 X;  2FUG 1;  2WYQ A;  1BUI C;  1ROE A;  2GOW A;  3VQI A;  5MPO A;  2N9L A;  1PGX A;  3VRB B;  3ZLZ A;  2KVZ A;  2LRW A;  1C79 A;  1I42 A;  2SEB D;  5HG2 A;  3Q3O C;  5D2M B;  3OJ3 A;  3VH4 B;  1WM2 A;  2MJ3 A;  3CIR B;  3L54 A;  1ZXI A;  2BF8 B;  1KM7 A;  3VHT C;  1F9J A;  1E10 A;  3U7D A;  3DPD A;  3PRE A;  1TJE A;  2ONQ A;  2XBB C;  2MEK A;  2VH1 A;  3QIJ A;  4KGS A;  3TL5 A;  3Q8E A;  3MC0 B;  3UIN B;  5HI1 A;  1GNU A;  5T8I A;  3ML8 A;  4LK0 M;  2KMC A;  1UWM A;  2D2Q A;  3WAP A;  2G3Q B;  4DXF A;  2JSV X;  3SEB A;  4G50 A;  3AXC A;  2VZK B;  1QOF A;  3JSV A;  3D32 A;  4RF1 A;  1YQB A;  1L0X B;  1WGK A;  1WJU A;  2WXM A;  3IVF A;  3A4S C;  2QIL A;  4O1N A;  4KX6 B;  2QJL A;  4K3B A;  1E8Y A;  4J6I A;  2N7E A;  1BXT A;  1NEN B;  4TQ1 A;  3AEC B;  1PDX A;  3LB8 C;  4FHJ A;  1IBX B;  2I1K A;  2DHZ A;  1E7U A;  4CQN A;  2MHJ A;  2L0F A;  4B6W A;  3A9K A;  2ON8 A;  4IUM B;  2KAJ A;  2YVC A;  1P3Q U;  1EWY C;  1IUE A;  4W9F A;  3TEX A;  1C9F A;  4IC7 B;  1OQY A;  2NS5 A;  2VRR B;  3RFZ B;  1LGR A;  3C0R B;  1EU3 A;  1WE6 A;  1UBQ A;  4HJK A;  1JCK B;  2K39 A;  2MBE A;  1NEK B;  2W82 A;  1F52 A;  3IAS 1;  3N1Z C;  2W54 A;  2KQ7 A;  3NZ3 A;  1KTK A;  5IO9 A;  1VZ8 A;  3DBL B;  2WP9 B;  5CTR C;  4WWP A;  3VH3 B;  5AUK A;  3N32 A;  2ZVO A;  2QIE B;  3QHT A;  3B2G A;  5C2T B;  1FFV A;  1NBF C;  2H89 B;  1T6B X;  3H7P B;  1XT9 B;  2LGX A;  3H8H A;  3VTV A;  4XGA B;  3KYD D;  4IKG A;  1DOY A;  4C80 A;  3APC A;  2INP E;  3N1Y C;  1P1A A;  2FNJ B;  2ZJD A;  2KC1 A;  4GDL B;  4JLC A;  5D7G A;  1WMH B;  1WR6 E;  4OZB A;  1ZOY B;  1OEY A;  2D11 A;  3OG5 A;  1GJZ A;  3ENE A;  2K6Q A;  1TY0 A;  2IZV B;  2V1Y A;  2WXR A;  4ITK A;  4XWW A;  1FNW A;  3M63 B;  4GDK A;  2JZP A;  1L0Y B;  2NVU I;  2BKR B;  3RMK C;  1ZDV A;  5BYQ A;  3Q3J A;  2QSD A;  2NCN A;  2CHW A;  3T9L A;  3TCA A;  2ZNV C;  3P63 A;  2O6V A;  1GPX A;  3AUL A;  4USA A;  3HUI A;  4LJO B;  5IKC M;  5LLI A;  5JHB A;  2CJO A;  4XDC A;  4LJP B;  2IY1 B;  2BYT A;  5AZF A;  1E8X A;  3RCZ A;  2Y5P A;  4DHJ B;  2MWS B;  4NJ6 A;  4HPL B;  3R7R A;  3VTU A;  1V8C A;  3V60 A;  4E74 A;  2L00 B;  1GOZ A;  1YJ1 A;  3PRM B;  2C7M B;  2MRP A;  3M95 A;  4NQL B;  4IG7 B;  4RM8 A;  2V4I B;  1T0Y A;  5TR5 A;  3MHS D;  1XCQ L;  3APF A;  2KWC A;  3EHV A;  3A1Q B;  5FKA C;  4FXC A;  4WAF A;  4ZRQ A;  4FJV B;  2MP2 B;  3ZJT A;  2W9N A;  2CKH B;  2C7H A;  2WQY B;  1XLQ A;  3P4Q B;  5C1Z A;  3U2S C;  3H6N A;  4LNF A;  2N9X A;  2E6X A;  5IN7 A;  1WXV A;  2MA9 B;  3PHX B;  1FEH A;  4B95 A;  3VTW A;  2NR2 A;  2KFJ A;  4RGN A;  4P7I A;  1WX9 A;  2L32 A;  5E6P A;  4WUR A;  2IPK D;  5JXV A;  2J0M A;  4BKG A;  4ANU A;  4LNK A;  4M02 A;  2L1A A;  4KZ0 A;  3AMZ A;  1XF5 L;  1WGR A;  1YD8 U;  3QAR A;  3NZU A;  4DWF A;  1V86 A;  3I9V 1;  3DBR I;  5D94 A;  1UWX A;  3RZW C;  3DDC B;  3KVF B;  1BT0 A;  3UF8 A;  4GN1 A;  1JWM D;  2KFK B;  1STE A;  2CHX A;  2J42 A;  1T0R C;  2FUH B;  3L4P A;  3P4R B;  4DK5 A;  4PS8 A;  1VDV A;  1JAL A;  2N1V A;  2UU7 A;  3UIP B;  1UD7 A;  3EEC A;  5IOI A;  2KTR B;  3IHP C;  3WAM A;  1E8W A;  2JYE A;  4JQW C;  4EZK A;  1D3Z A;  4K81 A;  4RGM A;  1L7Y A;  4LDT D;  2LHD A;  2LUM A;  1UZX B;  3I3T B;  1I4H A;  2JZZ A;  2LUE A;  4C4V B;  2M19 A;  1RM6 C;  2BWE S;  2DYM A;  1VRA B;  5FR6 A;  4E3C A;  2XEW A;  4PK1 A;  3IT4 B;  1OQQ A;  4LTU A;  1QF6 A;  5AZH A;  2PE6 B;  3BIN A;  3ZGZ A;  4WQO B;  3W2D A;  3BWU D;  1V1P B;  3ZXV A;  4ASW C;  4MJS B;  4TQ0 A;  3DHH C;  1JWS D;  1PGA A;  1WIA A;  2BS2 B;  4E71 A;  2MQJ A;  4JE3 B;  2L0T A;  4NAM A;  1MG4 A;  2QMT A;  1WZ3 A;  1WXA A;  2K0P A;  4EEW A;  1YJI A;  1DOX A;  4EE2 A;  3TSS A;  1KJT A;  1V49 A;  2G1E A;  1J7B A;  3N30 A;  2AQ3 B;  2NPT B;  1NI2 A;  2RPV A;  1WSP A;  1V81 A;  2JX5 A;  3K9O B;  3AEF B;  4W9I A;  3SDL C;  4ANV A;  1FD6 A;  1L4Z B;  2MSE D;  3Q2A C;  4YSX B;  4US9 A;  2N4F A;  2K5P A;  3DHG C;  3ZDT A;  4C7Z A;  2L3Z A;  3NG0 A;  1Q5W B;  2HTM E;  2WXI A;  2NBU A;  3CF6 E;  1TZ1 A;  4IWP A;  4AJY B;  4CYE A;  2JXX A;  2K8H A;  2MH7 A;  2OHF A;  1IBX A;  2WDV B;  5JH5 C;  1XCT L;  1N6Z A;  2IO0 B;  1Z2M A;  3AI5 A;  4Q2J A;  5BMG A;  1FRD A;  3Q3F A;  2KMA A;  2M1M A;  1EO6 A;  5DPS A;  4BOZ B;  1E90 A;  4TUU A;  2LGY A;  2WXK A;  4FN2 A;  1ZKH A;  2DAJ A;  1E7V A;  2O6V D;  1I4P A;  2R2O A;  1K8R B;  2HTH A;  2KXJ A;  5E6O A;  2IND C;  1YJJ A;  2K22 A;  3DWM A;  5IAA C;  3PZ7 A;  4C00 A;  3W1Y A;  2JZ3 B;  4GGQ A;  1JRU A;  2K8C A;  1EWC A;  2C60 A;  1WFY A;  4AP4 C;  3WAL A;  1WM3 A;  2WDR B;  3BZD B;  1N60 A;  1UGJ A;  4HKQ A; 
#chains in the Genus database with same CATH homology
 4LCD E;  5D6J B;  2D2Q A;  2NBW B;  3WAP A;  2GBK A;  3X0W A;  2AWT A;  2KWV B;  2G3Q B;  4ICU A;  1LXD A;  2MBB B;  3AU5 A;  3K9P B;  3PRZ A;  1H4R A;  2FAZ A;  2HE7 A;  3PLV A;  4G50 A;  3AXC A;  3B08 A;  3ECI A;  4ICV A;  4M0W B;  3ZVV A;  2QHO A;  3JSV A;  3D32 A;  4KVG B;  2Z0D B;  4KDI C;  3CST A;  4AJW A;  3ZNI D;  2FIF A;  1YQB A;  4DDI D;  4MEL A;  4EZL A;  3H7P A;  1WJU A;  3IVF A;  3DVG X;  3A4S C;  5DPR A;  4DDG D;  2V4L A;  4DBG A;  2MBO A;  3KUZ A;  1E8Y A;  4J6I A;  3HM6 X;  3ZIM A;  3M3J A;  2N7E A;  2KX0 A;  2DAF A;  2BPS A;  1V9J A;  4CO7 A;  2WDT B;  4BBN F;  2J7Q B;  4GDL A;  1WJN A;  3APD A;  1WMH A;  1GUA B;  2CR5 A;  2JRI B;  2BGF A;  4FHJ A;  4TQ1 A;  3VVW B;  2I1K A;  2KNB A;  2B3A A;  2DHZ A;  3DVN V;  1E7U A;  1WYW B;  4AOF A;  2BYE A;  3GZN I;  2L0F A;  3GOE A;  4B6W A;  3JW0 X;  3PS6 A;  3A9K A;  2JUO A;  4GB9 A;  4RMA A;  4IUM B;  4ANW A;  2YVC A;  1P3Q U;  5DPW A;  4W9F A;  1V2Y A;  4W9E A;  3KUD B;  3ZRF A;  2C7N B;  1OQY A;  2KK8 A;  4IC7 B;  2NS5 A;  5J2R A;  2LD9 A;  2VRR B;  3V62 A;  1L2N A;  1LQB A;  3SD5 A;  3C0R B;  1EF5 A;  4M8M A;  1WE6 A;  1UBQ A;  4W9D A;  4HJK A;  2GBJ A;  2K39 A;  2D3G A;  2MBE A;  4RM9 A;  1IPG A;  3TMP B;  2WWZ A;  2YLM A;  2ZZP B;  1WGY A;  2N1W A;  4K7S A;  5KHO A;  3R7Q A;  3M62 B;  1TBE A;  3V6C B;  2KQ7 A;  2IO2 B;  2PEA A;  5L83 A;  2Z0E B;  3RZF A;  1IYF A;  2KZR A;  4NAW B;  4BFR A;  4FJY A;  4CHK A;  2KOX A;  1UEL A;  4GSW A;  3PTF C;  1XD3 B;  4W9G A;  5CTR C;  4WWP A;  3DCG A;  3VH3 B;  4BVU C;  3N32 A;  3KUC B;  2ZVO A;  5CHW A;  1S3S G;  2K1F A;  4I6P A;  4GIV A;  3QHT A;  4NY0 A;  3JSV B;  3VUY A;  3NHE B;  1RLF A;  1NBF C;  1P0R A;  1P9D U;  5CX3 A;  2KD0 A;  2ZCC A;  4FUL A;  3H7P B;  2HD5 B;  2IBI B;  4FA6 A;  1XT9 B;  2LGX A;  3ZKJ C;  4TV3 A;  2OJR A;  4MSM B;  4F8C B;  5J18 A;  4G0N B;  3VTV A;  4WAA A;  2FCM A;  3KYD D;  1WXM A;  2KC2 A;  5LXI B;  1RRB A;  2WX0 A;  2DZI A;  2PPH A;  3APC A;  4LDT B;  1P1A A;  1TTN A;  2FNJ B;  2ZJD A;  3ALB A;  4W9C A;  4PS7 A;  2KC1 A;  4GDL B;  4PYU A;  4JLC A;  5D7G A;  1WMH B;  1WR6 E;  1NDD A;  2MX2 A;  1YX5 B;  3A1Q A;  1OEY A;  3KYC D;  3OLM D;  2D10 A;  4KDL B;  2D11 A;  2MP2 A;  1WI0 A;  1GJZ A;  4ZRJ A;  4II2 B;  2RD0 A;  3ENE A;  4MGI E;  2K6Q A;  2IZV B;  3A9K B;  3NS8 A;  4OVU A;  4FHK A;  2V1Y A;  3ZDM C;  1WX8 A;  1WRD B;  3QQ8 B;  1UH6 A;  1YIW A;  3H7S A;  4A3O A;  3ML9 A;  3M63 B;  4GDK A;  1LFD A;  1E5W A;  2FCQ A;  3L0W B;  3HM3 A;  2NVU I;  3RUI B;  2KDB A;  4HCP B;  2BKR B;  4EUT A;  2EMT A;  3NY5 A;  2LGD A;  4II3 B;  2ASQ A;  3Q3J A;  4K7U A;  2NCN A;  2CHW A;  3VFK A;  3QC8 B;  3T9L A;  3TCA A;  2ZNV C;  5JZE B;  2IO1 B;  2N7D A;  4G3X B;  3UQB A;  2O6V A;  3AUL A;  4JL9 A;  5L95 C;  3DBL I;  4LJO B;  3B1L X;  5LLI A;  5JHB A;  1ISN A;  3AU4 A;  2RPQ A;  2KDI A;  2KLG A;  4W9L A;  3ZTD A;  4LJP B;  2IY1 B;  3V6E B;  2M4N A;  1Q0W B;  3LJ3 A;  2REX A;  2JPH A;  3IBE A;  5AZF A;  2RR9 A;  1E8X A;  1MG8 A;  2J0K A;  3A9J B;  4KSK C;  4X57 B;  3RCZ A;  4DHJ B;  2MWS B;  1A5R A;  3ZNZ B;  4NJ6 A;  3IFW B;  4HDO A;  4HPL B;  2KAN A;  2IO3 B;  3R7R A;  3VTU A;  2MLB A;  3V60 A;  3UQA A;  4E74 A;  2L00 B;  2DYO A;  1YJ1 A;  2LXA A;  2A5U A;  2DYB A;  2KFK A;  4WWN A;  3U30 A;  3PRM B;  4DXA B;  2C7M B;  3VUX A;  2MRP A;  3DVN U;  2AYO B;  3M95 A;  4MGK E;  4BOS C;  2KWU B;  4IG7 B;  3MJW A;  4NQL B;  4RM8 A;  5JHA A;  4HCN B;  1T0Y A;  4IW0 A;  5TR5 A;  2MW5 A;  3IG3 A;  4BKS D;  3MHS D;  3RUL A;  3VAW A;  2EMS A;  4HVB A;  4MSQ B;  2D07 B;  2KTR A;  3APF A;  3H1U A;  3QWZ B;  3EFU A;  3ZO5 B;  2KWC A;  3EHV A;  3A1Q B;  4EFO A;  1RFA A;  2MCN B;  2M8S A;  3VDZ A;  2UWQ A;  1WGH A;  4FJV B;  2FID A;  2MP2 B;  2DZK A;  4MEM A;  3SU8 X;  4F7Z A;  2W9N A;  2JWZ A;  2CKH B;  2LAS A;  1YX6 B;  2C7H A;  5C1Z A;  1FXT B;  1VCB A;  3ZRC A;  2GBN A;  1TGZ B;  1ZGU B;  2JVC A;  1R4N I;  2FCS A;  4GU2 A;  1HE8 A;  4GDK B;  3H6N A;  4NJ7 A;  3ZNG C;  2N9X A;  1WR1 A;  4MM3 A;  2ZPY A;  3VXW A;  3BY4 B;  1WXV A;  2MA9 B;  3PHX B;  4W9J A;  4M8N A;  4B95 A;  3VTW A;  2NR2 A;  4HWI B;  3EC8 A;  2KFJ A;  3QCA A;  2KJR A;  1WJ4 A;  2Y5B B;  5DPT A;  4P7I A;  2BYF A;  1WX9 A;  5E6P A;  3R3M A;  1KLV A;  3N3K B;  4IM0 A;  3W1S C;  2O6V B;  2J0M A;  5G2N A;  2LI5 A;  4BKG A;  4ANU A;  4EZJ A;  5KHQ A;  2V3S A;  4HXD A;  3QK0 A;  4XC2 A;  3QJZ A;  4KZ0 A;  1EUV B;  1SIF A;  3UGB B;  4YL8 A;  3CSF A;  1SE9 A;  1V5T A;  4OVV A;  3B0A A;  2JY6 A;  1WGR A;  1YD8 U;  2CS4 A;  2KTF A;  2GMI C;  3NZU A;  2HJ8 A;  3QAR A;  4MJS A;  3L17 A;  4DWF A;  5AEK B;  3QA8 A;  1V86 A;  2KQS A;  2LWP A;  2MBQ A;  2ZCB A;  3A33 B;  3DBR I;  5D94 A;  1H8C A;  4ANX A;  3RZW C;  3DDC B;  3KVF B;  1EF1 A;  3VUW A;  1BT0 A;  5CHF A;  3PT2 B;  3UF8 A;  4GN1 A;  2ZEQ A;  4KIK A;  4NQK E;  1WH3 A;  2KFK B;  3KH0 A;  2A4Z A;  2CHX A;  1E8Z A;  1WGD A;  5C23 A;  4MH0 E;  2FUH B;  1UBI A;  4DK5 A;  4PS8 A;  3P2B A;  1OGW A;  3OAW A;  2L05 A;  2N1V A;  3ONS A;  4IM2 A;  3RYT A;  3UIP B;  4EKU A;  1GG3 A;  2JRH A;  2LRU A;  3DVG Y;  2KDE B;  4BBN C;  2KVR A;  2NPT A;  3WAN A;  4DHZ B;  1UD7 A;  3EEC A;  2KTR B;  3IHP C;  4K7W A;  3WAM A;  1E8W A;  1WJ6 A;  2KHW B;  2NBV B;  4JQW C;  4EZK A;  4JIO U;  1D3Z A;  2RSU A;  2N9P C;  2G45 B;  4K81 A;  2LJ5 A;  2M17 A;  2LVP A;  4KSL C;  1I35 A;  1U4A A;  2BWF A;  2ZPN A;  3DOW A;  3TBL D;  3O65 B;  1G6J A;  1L7Y A;  3V61 A;  3WIM A;  2WX1 A;  4LDT D;  4DHZ E;  4EOY A;  3HK0 A;  4TKN A;  1UZX B;  2PJH A;  1WZ0 A;  3I3T B;  1RAX A;  1GC6 A;  2I1J A;  2JZZ A;  5EDS A;  2LUE A;  1IP9 A;  1WF9 A;  2KKC A;  4HPM B;  3NOB A;  2BWE S;  3ZUN A;  3X23 A;  2DYM A;  5GMV A;  3A4R A;  3QX1 A;  3VH4 B;  1J19 A;  3KW5 B;  5DCN A;  5FR6 A;  2UYZ B;  4E3C A;  1Q1O A;  1Y8R C;  1KOT A;  3DBS A;  4W9H A;  2R2Q A;  4HDQ A;  4A3P A;  2XEW A;  2LZ6 A;  4NNJ B;  3NZS A;  3TIX A;  3PSE B;  1WE7 A;  3L13 A;  3JVZ X;  2XK5 A;  5AZH A;  4G11 A;  2PE6 B;  2GBR A;  2KLC A;  4XZ4 A;  3BIN A;  4IWQ A;  4WQO B;  1PQS A;  3HHM A;  4GMV A;  4AWJ A;  2C5L C;  4ASW C;  2IY0 B;  3PV1 A;  4MJS B;  4PS3 A;  4TQ0 A;  4WJO A;  4ZRI A;  1QZE A;  4A20 A;  1WIA A;  2C9W B;  4E71 A;  2MQJ A;  4MGZ E;  1OEY J;  2ZNV B;  3W1S A;  2L0T A;  2G4D B;  1J0G A;  4ZRK A;  1X1M A;  3MTN B;  4HK2 A;  2L76 A;  4KZC A;  3U8Z A;  4HLE A;  4PYZ A;  1V5O A;  1WZ3 A;  2ZVN A;  4KIK B;  2K6D B;  1WXA A;  4EEW A;  4K1R B;  3DBH I;  3H9D A;  3WA0 A;  2O2V A;  4W9K A;  4IM3 A;  2L8J A;  3DQV A;  2K8B A;  1KJT A;  4AUQ C;  2KJH B;  4FJZ A;  4MDK E;  2AL3 A;  1V49 A;  3N30 A;  4MGY E;  4GOC A;  4WWO A;  4DHJ D;  5CHV C;  2NPT B;  2RGF A;  5J17 A;  1WGG A;  1GC7 A;  1NI2 A;  3PPA A;  2Z59 B;  4F1S A;  2KJ6 A;  1V81 A;  1UGM A;  1S1Q B;  2GBM A;  3CMM B;  3K9O B;  2CU1 A;  4W9I A;  2DZM A;  1M94 A;  2MBH A;  3SDL C;  4ANV A;  2MSE D;  2BYV E;  3PHW B;  3SHQ A;  3ZNH B;  4ZYN A;  4BKS A;  2AEH A;  1WX7 A;  4WJP A;  4I6L B;  4FBJ B;  3L16 A;  5G55 A;  3LDZ E;  2N4F A;  4JGH B;  2J0J A;  4WJQ A;  1V80 A;  3ZW3 A;  3PRP B;  1P98 A;  1WY8 A;  2K25 A;  4I6N B;  2PE9 A;  2LVO A;  5HKH A;  2WYQ A;  3ZDT A;  3S2A A;  3PGE A;  2GOW A;  3VQI A;  2L3Z A;  1Q5W B;  1SGH A;  4FAD A;  1R4M I;  3A9J A;  4B9K A;  2DEN B;  3L10 B;  2NBU A;  4NPN A;  2JF5 A;  1TZ1 A;  3CF6 E;  2FCN A;  4IWP A;  3ZLZ A;  2N9E B;  4AJY B;  4CYE A;  2G4S A;  4N9F 4;  3OJ4 B;  2JXX A;  2K8H A;  1C3T A;  2KX3 A;  2LRW A;  1I42 A;  5JH5 C;  2KO3 A;  2IO0 B;  1Z2M A;  3AI5 A;  2KN5 A;  2XK5 B;  1J8C A;  3Q3F A;  4URK A;  2KMA A;  3QAQ A;  5D2M B;  2M1M A;  3OJ3 A;  3TJP A;  4WJN A;  1EO6 A;  1WM2 A;  2BKF A;  3L54 A;  3PLU A;  2BF8 B;  5DPS A;  3UIO B;  4ZDV A;  1KM7 A;  3VHT C;  4BOZ B;  5IA7 A;  1E90 A;  2CHZ A;  2M0X A;  1F9J A;  1ZW7 A;  3JYU A;  3HIZ A;  4FLH A;  4TUU A;  4KV2 A;  2L7R A;  3U7D A;  3DPD A;  3PRE A;  2LGY A;  4BKT A;  4FN2 A;  1AAR A;  1CMX B;  1ZKH A;  2DAJ A;  2DZJ A;  4GXB A;  1E7V A;  2O6V D;  5E6N A;  1XQQ A;  2XBB C;  3RT3 B;  1LM8 B;  2R2O A;  1K8R B;  2HTH A;  2KXJ A;  3QIJ A;  3R66 C;  4IWO A;  3ZTC A;  5E6O A;  3T8M A;  2JT4 B;  5LXH A;  5IAA C;  3RD2 A;  2O2V B;  4XX5 A;  3W1Y A;  3TL5 A;  2JZ3 B;  3L08 A;  4GGQ A;  1JRU A;  5AZG A;  2K8C A;  4AP4 C;  2C60 A;  1VD2 A;  1WFY A;  3PZD A;  2EKE C;  2DX5 B;  3WAL A;  1WXS A;  1WM3 A;  2AL6 A;  2KDF B;  1Z5S B;  1V6E A;  2OOB B;  2LXC A;  1GNU A;  3UIN B;  3WAO A;  1C1Y B;  2LVQ A;  3ML8 A;  2IYD B;  5BO4 B;  1OTR B;  4NAW A;  2KMC A;  3PVL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...