1WSPA

Crystal structure of axin dix domain
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
83
structure length
83
Chain Sequence
CDSIVVAYYFCGEPIPYRTLVRGRAVTLGQFKELLTKKGSYRYYFKKVSDEFDCGVVFEEVREDEAILPVFEEKIIGKVEKVD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Axin 1 protein
publication title Crystal structure of axin dix domain
rcsb
source organism Rattus norvegicus
molecule tags Signaling protein
total genus 15
structure length 83
sequence length 83
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2004-11-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00778 DIX DIX domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.380 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1wspA00
3PZ8A 3PZ7A 4WIPA 2D5GA 1WSPA
chains in the Genus database with same CATH superfamily
5IN7A 3A9JB 1LQBA 2KWVB 1X1MA 4IWPA 1I35A 4M8MA 4YT0B 2KJRA 3L4PA 2LGIA 1T6BX 2K8BA 2PVOD 3A9JA 2PVGC 3EFCA 1K52A 1LGRA 2Y5BB 1A70A 1XCQL 4E3CA 2WDRB 2MQJA 3AEBB 1KRHA 4DQOC 3QK0A 3IT6B 3R2TA 3WAPA 4C7ZA 2QILA 2WXRA 3DDCB 2IGDA 3PO0A 2V4LA 2KJ6A 5AUKA 3HVZA 2ICIA 5DPTA 3QX1A 3AE9B 2IZVB 5BYRA 4NJ6A 3PS6A 1JCKB 4OHJA 3VRBB 4FN2A 3Q3FA 4EFOA 5CTRC 4K3BA 4RGNA 1ZOYB 2V3SA 3RI7C 2G45B 1WZ0A 1SF0A 2I38A 2LD9A 3ZNID 4GLSC 2FCMA 3CIRB 4P1BC 4MGYE 1NI3A 2MHJA 1ZGUB 4YL8A 1TS4A 3H7PB 3PREA 4ARIA 1F2RI 3E56A 2MA9B 1TS5A 2K25A 1QQRA 2BVCA 3H7PA 1L0VB 2D3AA 1MPEA 1E7VA 1B9RA 1FNUA 4HJGE 4IWQA 2LVPA 4ANXA 1Q1OA 2NTSA 2MSED 2IO0B 3VHTC 5BMGA 4ANVA 3ZNGC 1YNTE 4DHJB 1HZ6A 5G2NA 1S3SG 1MHXA 3LB8C 4USAA 3WAOA 2KAJA 4ZRKA 1MFWA 4M01A 2JZZA 3KW5B 2DAFA 2QCZA 2GRIA 3AECB 2O6VD 2N4FA 1TYGB 2WX0A 2L0FA 2LEKA 4XYCA 3RN9C 2PTLA 1KH0A 1E8WA 1JWMD 5EE1A 3B2FA 3AE3B 3NY5A 3QWZB 2KQ4X 4IDIA 4BKSA 1KM7A 2FAZA 1HA5A 2V9HA 2D10A 4M0WB 5HKHA 4ANUA 5JH5C 3NVZA 2W82A 1LFDA 1XXGA 2FIDA 1UZXB 2ZCCA 1GC6A 4HPLB 2WWZA 1C9FA 3JW0X 5EE3A 2IO2B 3RT3B 3DHGC 3HK0A 4M0WA 1VRAB 4II2B 1P0RA 3HM3A 3Q3NC 2CJOA 1I4PA 4KVGB 2V3PA 1MI0A 1D4BA 4ANWA 4HDQA 1TKYA 3H6NA 3R8BA 2K8HA 1YQ4B 3ML9A 3V62A 4ASWC 3APFA 2JXXA 3ZRFA 3PSEB 3WALA 1TGZB 4JWSC 2Y5PA 2N7EA 3ZGZA 2GBRA 1E8ZA 3ZLZA 2EMTA 4OZCA 2KK8A 2L3ZA 2IY1B 2DWQA 2KDIA 1JMLA 2JVCA 3KQ4A 4RH6A 3SDLC 1C79A 4IUMB 4B6WA 1UF0A 4I6PA 3U7ZA 1SIJA 1P3QU 2RR9A 1WM2A 1QKZA 2K22A 1SE9A 5IKCM 5J18A 2H88B 1E0ZA 1EWCA 1F0ZA 4W9EA 4KGTA 3NVVA 2FIFA 5LLIA 3VQIA 1OEYA 2VH2A 3U52E 3UGBB 1WGYA 2NBUA 2LJ5A 3QA8A 4HJKA 4K7WA 2M17A 2L00B 3NZSA 3P1MA 1N63A 1FXTB 4WIPA 1R4NI 3Q8BA 3KWVA 3HVDA 3Q8AA 1V80A 3TJPA 2BB6A 4MT5A 1FNVA 3ONSA 3OG5A 1WMHB 1C4AA 1K51A 1JW9D 1AW7A 2LUMA 2KVRA 2DAJA 2PKOA 2FNJB 1FM0D 1E7PB 3Q3JA 1WMHA 3Q3OC 3PRZA 1E90A 1H8CA 2KVZA 3URYA 3C8YA 4J6IA 1VZ8A 2PE9A 2RDGA 4HEA1 1J7BA 1TZ1A 2KN5A 2RSUA 1YOVB 5KHQA 2J0KA 3ZW3A 1ISNA 3U8ZA 4WWPA 2GOWA 1FEHA 2M0XA 3PRPB 4WQMA 3V3XA 1CK1A 2WLBA 4TSSA 1EF5A 1TY2A 1JALA 3L10B 1YN5A 1R4MI 3SEBA 2L05A 2FUHB 4ZRIA 3FILB 1L6VA 3DBRI 3HRDD 1LM8B 1JROA 3A1QA 3NRZA 4ARCA 1IBXA 4YXDB 3VR9B 1FFVA 1WX7A 4KIKB 4FA6A 4P1CC 3SFDB 3X23A 4PS7A 1ET6A 1RFKA 3FAHA 2KT7A 3GE8C 1FXIA 2HTME 2XBBC 4KIKA 1KTKA 3PRMB 4J3OD 2AQ1B 5BYSA 3AEFB 4G0NB 2OOBB 1WZ3A 2KYWA 2WXGA 5C1ZA 2BW2A 1QF6A 4OVZA 2WDQB 2BWFA 2LASA 2FCNA 5DCNA 1TBEA 2MRPA 1HEZE 2QJLA 4K1RB 1Z2MA 1G6JA 2L7RA 4ZHPA 3FKYA 2KN4A 2UYZB 4MH8A 3VH4B 2CHXA 4G50A 3HM6X 4EUTA 1WGRA 4H2AA 2NCNA 2WNMA 2SAKA 4ZRQA 5L83A 1A5RA 2LGDA 3AEDB 4MJSB 1UELA 2JRIB 3IAM1 3T8MA 1V49A 2WHIA 4DHZB 1SJHD 2J0JA 5J2RA 1ZXHA 1EM7A 4MJSA 1QOGA 1QLBB 4IC7B 3VAWA 4LK0M 3ZTCA 1UUPA 4C80A 1F9JA 1AYFA 1GJZA 4HPPA 3NJTA 1SGHA 2JY6A 2KHWB 2BTEA 2I2YA 4A55A 4D2KA 2NPTB 2CHZA 2ZNVB 1STEA 1WM3A 1QT9A 4TV3A 2ZW1A 5BMIA 2MBOA 4A20A 1R4NB 2NPTA 1L7YA 2RD0A 3EA6A 4GXBA 2J7QB 4K7UA 4EOYA 3L16A 1N5XA 1F77A 2BYFA 3Q8CA 3DVGY 3KUCB 3RNAC 2NTTA 1JWAD 1MJDA 2HE7A 4E71A 3UI3A 3NHEB 2RPQA 4RNAA 2Z59B 3I57A 1Y56A 4IKGA 3MC9A 5HI1A 1V6EA 2G9HD 1F1HA 1WXSA 1XEEA 3HHMA 4DK5A 2DHZA 2JYTA 3BVZA 1XQQA 1AARA 1N62A 4LLGM 3W5UB 2KTRB 2LJIA 4XC2A 2ZJDA 5IA7A 4LDTD 2MJEA 2ONQA 1EU4A 3NS1A 2DNFA 2L0TA 2UWQA 4WQOB 3KUZA 2KTRA 4KSKC 5FK9C 1WR6E 2FCQA 1KLGD 1E7UA 2E3TA 2D2QA 1OEYJ 3PPAA 1RFAA 1UBQA 1VR9A 1WJ4A 3P4RB 3TEXA 5CHVC 1ZDVA 2TSSA 1R4MB 3LJ3A 3Q3MC 4OW0A 4ZHOA 1CMXB 4RMAA 3DBRB 1KJTA 2N9KA 2K5PA 2PEAA 4M00A 3EC8A 2J42A 1XLOA 1P7FA 2LHDA 2EMSA 1SSNA 1XLPA 2AQ3B 4RF1A 3JYUA 2N9LA 1PGAA 2Y3AA 2NVUI 4W9GA 2C60A 3TEYA 5LXHA 1J7CA 3R3MA 3N30A 2LGSA 5CX3A 4NQLB 2MJ3A 4FHJA 3AULA 1KFYB 2O6VB 4II3B 2V4IB 2KD0A 3NS8A 3ML8A 1BMLC 1YD8U 2N7DA 4REZA 2O6VA 3AE1B 2C9WB 1P98A 2WXKA 5JHBA 3QIJA 1V86A 3ZYYX 1Y8RC 1OFFA 2KLCA 3AE8B 2CU1A 2CKHB 5FR3A 1YMHE 1WGGA 1V1OA 5EDSA 4KKJA 1YQBA 3IT4B 4FJVB 1MVKA 1T0RC 3BY4B 2WP9B 1UWXA 3RNBC 2Z0DB 4ICVA 1E9MA 2GBKA 2DZIA 5LNK1 3VUXA 1J19A 4KDIC 1YJIA 1GB4A 4XDDA 3B0AA 2L1AA 2N1VA 3C19A 4NJ7A 2KQSA 1V1PB 3M95A 4F7ZA 2IY0B 3PHWB 4NY0A 2KO3A 2GB1A 2BS2B 5CHWA 2AL6A 5D6JB 4RGMA 5HHDG 1QOFA 2KNBA 3ZDMC 4MGIE 4HWIB 2G4SA 5GMVA 3RFZB 1C76A 1WJNA 4WJQA 3VTWA 4KSLC 4FLHA 3P42A 3N20C 1EUVB 3ENEA 1MHHE 1CJEA 4XWWA 5EE0A 2LMCA 1NEKB 3HUIA 1ZE3D 4G11A 1UGJA 2AYOB 3TIXA 4FJYA 4AJWA 4ZRPA 4AJYB 2GLSA 1OTRB 3DVNV 2BS4B 3NZ3A 3BZDB 5FR6A 3VDZA 1SJED 4BOSC 2ASQA 2KDEB 3IFWB 3H7SA 2VZKB 2QIEB 1NVID 4KV2A 3T9LA 4ZYNA 2JX5A 2UU7A 2BF8B 2E6XA 1I4XA 4YSXB 3EECA 3R66C 3APDA 1RYJA 3LYYA 5EE9A 1PDXA 2LGXA 1E8YA 3X0WA 2DENB 3WIMA 1FCLA 1N6ZA 1J8CA 3DOWA 3KUDB 4LNKA 3TMPB 5I4DA 4BFRA 3ZDTA 1WGKA 2V3NA 3QAQA 1HQRD 1TIFA 1I4QA 3I3TB 1SIFA 4US9A 1E8XA 2BKRB 1J0GA 2W54A 2L32A 3AE5B 1WRDB 2J52A 1Q5WB 1VZ6A 1J7AA 5T8IA 2MP2B 4YTMB 1VDVA 3R7QA 1P9DU 2JU6X 2KC1A 2KC2A 4OZAA 2FBWB 1F2RC 4KKIA 2MP2A 2KACA 2KX0A 4GGQA 4CQNA 2WYQA 3L0WB 3QARA 4WH4A 1Q0WB 2W3SA 3EUB2 1GG3A 3AE6B 3DQVA 5D94A 1UWMA 2KDBA 4GDKB 2I1JA 1FRDA 2REXA 4AOFA 2LUEA 4HLEA 4DWFA 4GDKA 4C7YA 3H1UA 3LDZE 1I42A 5IO9A 4BKGA 4IG7B 2KMMA 2WXQA 4I6LB 1WRIA 3DHHC 5TR5A 3MJWA 1WX8A 4GIVA 1QILA 2LI5A 1T0QC 2VZKD 4WURA 1YIWA 3Q8FA 4F1SA 2OHFA 1RLFA 4W9CA 4EZKA 2M1MA 1OQYA 4IM2A 4NQKE 3M63B 1N61A 3VR8B 2PW9A 3A4RA 3CMMB 4BOZB 4MM3B 1OQRA 3UIOB 1VD2A 2DLBA 2KWUB 4EZLA 4YWGG 4B95A 1FMAD 4XZ4A 4MM3A 3IXSA 2K6QA 1XT9B 2JQRB 5BYQA 1B1ZA 2JPHA 3RNFC 4PK1A 2RDBC 3L08A 3PHXB 3R2IA 4FBJB 4TQ0A 1C4PA 1HE8A 2JWZA 2K3UA 1CQVA 3MC8A 3MFGA 4P6VF 2Q5WD 3K9OB 4MSMB 1SXTA 2KFKB 3DBHI 1K53A 3RYTA 4P7IA 1YX6B 4TQ1A 5JXVA 3L54A 2R61A 1XLQA 3BYTB 1C1YB 2KFKA 1I4GA 3BWUD 3BVGA 3LXFA 3M3JA 2G4DB 2MJDA 5JZEB 2KOXA 1L2NA 1PFDA 3GOEA 4PS8A 1NYRA 3MP9A 3U4EG 3NOBA 2N9EB 3OJ3A 4BBNF 3RZWC 1WXVA 1E5WA 5LXIB 2BBCA 4WWMA 3SU8X 4XX5A 3FILA 1WX9A 3J9CA 1UBIA 4W9LA 1LXDA 2ZVNA 2BS3B 4XE0A 4K7SA 3AM9A 1RRBA 3H9DA 1NYQA 1WE6A 4W9IA 2G1EA 2ZNVC 2M4NA 2WXOA 2ZW0A 3DBSA 2M19A 4LDTB 4UDUC 1N5WA 1EF1A 2RGFA 3B2GA 4MSQB 4B0EA 2ACZB 1KOTA 1JQ4A 4MH0E 3AE7B 1TT5B 4X57B 2ZPNA 3E9SA 1GC7A 1V2YA 3WAMA 3VXWA 3PT2B 1SB3C 1SBBB 1JRPA 2AQ2B 4MDKE 4C4VB 2I1KA 1PYWD 4IW0A 3V60A 4LNOA 4FADA 1AWDA 3Q6BA 1D5ZC 2HD5B 2L52A 4FXCA 4RFBA 1T0SC 4MACA 4A8XC 4C4VA 2BQQA 5AZHA 3ZJUA 2K6DB 1HTOA 2LRWA 2W55A 3FC4A 1TS2A 1KF6B 2R2OA 3AE2B 4KDLB 1GPXA 2D3CA 4DXGA 1QOAA 1KLVA 4KZ0A 4L2YA 3L13A 2HJ8A 2OJWA 1CZPA 4LTUA 5D3DA 3RD2A 4XWTA 3VUWA 4W9DA 1DOXA 2J0MA 1HTQA 3I5JC 4B9KA 5G5GA 2PLPA 4GDLB 1SE3A 2J53A 2NR2A 4YTNB 2N1WA 4NAWB 3KLSX 2KWCA 5G55A 2MCNB 1ESFA 4RM8A 2FUG1 4LNNA 4HKZE 4NAWA 4O1NA 4JL9A 1M4VA 2W9NA 2C7MB 4LNFA 2SEBD 2INCC 3CWIA 2NS5A 3ZRCA 1FRRA 4WWNA 5D3IB 5HFYA 3BINA 2WGSA 4WAAA 3HIZA 3N9YC 4Q2JA 4BZAA 4NAMA 2IJ0A 3AN1A 3QCAA 3TCAA 4PYUA 2MBHA 3V61A 4DHZE 2INDC 1L5PA 3ZTDA 3W5VB 1XF5L 5IOIA 3TUOA 4XGAB 1WFYA 3AE4B 3PVLA 3DBHB 2WU2B 3TEWA 4URKA 4LJPB 2EKEC 2ZCBA 4HRSA 1M94A 2KTFA 2CR5A 2QDFA 1NDDA 1WYGA 4M02A 3W1SA 3KVFB 2M8SA 2YEPB 3PZ7A 2B3AA 2QSDA 2KFJA 3MHZA 2Z8LA 3P4QB 2RPVA 4L23A 3SR6A 1TS3A 4NZLB 3ZKJC 3OJ4B 2LZ6A 2QMTA 3WCQA 3A9KB 3ZXVA 1TKGA 1WYWB 3RZFA 5FKAC 2DZMA 2KMAA 2IO1B 2WDTB 4JWUC 4LJOB 4HPMB 4US8A 1I7HA 1L4DB 1VLBA 2LRUA 3RMKC 1WSPA 2HJ1A 3A9KA 2KKCA 2L8JA 3CF6E 2HTHA 2WXNA 3DVGX 2PMVA 5DPWA 2D3GA 3AU4A 4GSWA 2JYEA 3EGRA 4RM9A 3ZUNA 3RULA 3MHSD 5H8YE 3JVZX 5C2TB 1L4ZB 3AEGB 3L17A 2B76B 4A3PA 1N60A 4WJNA 1ET9A 3U30A 1WIAA 2MWSB 1F52A 4BVUC 2JRHA 2AEHA 2IDYA 2Y5CA 4EEWA 4HKQA 4RGTA 1L0YB 5D7GA 3K9PB 1T0YA 2NMQA 5IAAC 1XCTL 3DHIC 4FHKA 3U2SC 4CYEA 1TY0A 3GS2A 4DBGA 2XEWA 2ZPYA 3Q69A 3S2AA 3WA0A 1WWTA 2BYEA 3T3NA 4KX6B 3IBEA 3N1XC 4NPNA 4IWOA 4GU2A 5C23A 2MBEA 3TL5A 1T5XD 3PLVA 2MH7A 1RAXA 1GB1A 3ETRA 1JWSD 5C3JB 2MEKA 5KHOA 3NUHB 2JT4B 2KANA 1P1AA 2WX1A 3DCGA 2KLGA 4AS1A 4TMAB 4DXFA 2C7HA 3P63A 2N9XA 1DYQA 1C4CA 1L6UA 5AUIA 1V1PA 1WGHA 1NENB 4ZYSA 2XN9C 3BYYB 1DOYA 1C3TA 1YQ3B 1T3QA 4HDOA 3ZQ4A 2WS3B 2V0GA 4B0MA 3UIPB 3N1ZC 2YLMA 2RDHA 2BPSA 1BT0A 3WANA 4GMVA 3BVMA 1IPGA 2INNE 1IUEA 3VFKA 4GOCA 1FNWA 3W2DA 4JGHB 3RNGC 1UNSA 3AV8A 1WJ6A 3P4PB 2KWDA 2DYOA 4MGKE 2OJRA 2N9PC 4W9FA 4QAYA 1WXAA 2MLBA 2LXAA 3NZUA 1ACCA 1VZ7A 2KX3A 2AWTA 3VTUA 4ICUA 4L1BA 3DWGC 3N3KB 3AXCA 4CHKA 2XK5B 5DPSA 3QC8B 3AEEB 1I4RA 4EZJA 3AU5A 2M0AA 3P4SB 5G5HA 4S0RA 1C77A 2JF5A 1NBFC 2XK5A 4A9AA 4KZCA 1SE4A 3M62B 4F8CB 1WJUA 3H8HA 3T3OA 4WJPA 4KGRA 4ZDVA 3RCZA 3ZJTA 2IGGA 4PYZA 2WXFA 2CJNA 1XO3A 3PGEA 2DZJA 3TBLD 5HG2A 4LCDE 2BT6A 1WXQA 3APCA 2LVQA 4C00A 1TKEA 1RWSA 2XNAC 3OAWA 1R7SA 4N9F4 2IYDB 4A6QA 2WXJA 1JWUD 3CSTA 5IP4D 2KDFB 1WGDA 3VH3B 3KWLA 2K1FA 4PT5A 2AX5A 2IO3B 2KXJA 2NBWB 4HCPB 4IM0A 4TUUA 4ITKA 3AEAB 4PS3A 1D5XC 1D6EC 1FFUA 1TJEA 4WAFA 5E6NA 3B1LX 2V1YA 4FJZA 1VCBA 4W9HA 3QHTA 1YN4A 2WXIA 2VRRB 1EWYC 3N32A 3N1YC 1YJJA 2HDEA 4G3XB 3MTNB 2JUOA 1YJ1A 1YN3A 5TSSA 4DDID 3ZIMA 4HVBA 3NVYA 1UD7A 1FPYA 3KYCD 5E6PA 2GBNA 3Q8EA 3GZNI 4BKTA 2D07B 2WQYB 4R3DA 1UH6A 1TZOA 1ZDXA 1PQSA 1S1QB 3O13A 4JLCA 4W9JA 5BO4B 5DPRA 2ZZPB 2L76A 3KYDD 1GAQB 4C56C 3P2BA 2LGYA 2QEJC 1ZP0B 4DHJD 2BB5A 2JZ3B 3A4SC 4OVUA 3KH0A 1I4HA 1E6EB 3SD5A 4DDGD 4E74A 1WF9A 2BYTA 2Z0EB 3W1YA 1WXMA 2BGFA 1E10A 3DBLI 3NG0A 1GOZA 2IGHA 2LVOA 1SEBD 4A3OA 4BKSD 4I6NB 3B9JA 3ZVVA 3QQ8B 1TTNA 1ZKHA 3ZNHB 2IBIB 2ON8A 3PZ8A 3VRAB 2A5UA 2LFIA 2EKIA 1PUTA 4NNJB 1K50A 5JHAA 3DWMA 1OGWA 2K39A 1PGXA 5E6OA 2WXHA 1SE2A 2IPKD 4HROA 2WXMA 4N58A 1KLUD 3QJZA 3ZXRA 4GB9A 4BBNC 4AP4C 2JSVX 2K9XA 4HK2A 2OEDA 3TSSA 3IVFA 1D5MC 2A4ZA 2JZPA 4NJCA 3A33B 2YVCA 3JSVB 4JX1C 1JRUA 4GN1A 1VJKA 1ROEA 2PIAA 2KDMA 3D32A 4S17A 2K8CA 4K81A 1MG8A 1EU3A 3ABVB 1ZUD2 3JSVA 2LWPA 3UF8A 4YSZB 1HZ5A 3DPDA 1DOIA 3GE3C 3A1QB 4ACFA 1NI2A 1IBXB 5J17A 2N7JA 2EELA 3MC0B 1XLNA 4OZBA 2L83A 3IAS1 1GNUA 3VTVA 3SFEB 3B08A 2KQ7A 1Z5SB 2JWUA 3RNCC 1H4RA 4N6EB 3ECIA 3CSFA 5MPOA 4JIOU 3MJ5A 4DXAB 2O2VB 4WWOA 3IG3A 3R7RA 2MW5A 4EE2A 2ZVOA 4FULA 2DZKA 3UINB 1FO4A 4IM3A 4MELA 2NBVB 1IGDA 2O2VA 2H89B 3W9CB 1IP9A 1V5OA 1ZXIA 2QHOA 2CHWA 3RNEC 4HXDA 5D2MB 4P16A 3OLMD 3Q2AC 5AZFA 1YX5B 3DVNU 4K3CA 5AZGA 2KZRA 1GUAB 3BK2A 1LO5D 1UGMA 4XDCA 1HXYD 1WR1A 3W1SC 2MX2A 2DX5B 3TEZA 4HCNB 1Q10A 3AMZA 3GZNB 2GI9A 2C7NB 1WE7A 3C0RB 5E6JA 1IYFA 3NVWA 2PJHA 4WJOA 4A90A 2DYBA 1FIQA 1FXAA 3RUIB 3GP7A 4BAXA 2M56B 2W3RA 4LNIA 3V6CB 2YEPF 4GDLA 4N59A 1D3ZA 2K0PA 3VVWB 3DBLB 1QOBA 2VH1A 1OQQA 1EO6A 2KMCA 3AH7A 1V81A 4MEMA 4IOIE 1V97A 1BUIC 3GB1A 2DYMA 2CU3A 2JXTA 5H92C 3ALBA 1IGCA 2RMMA 2KJHB 1ZW7A 4AQ7A 4EKUA 2LXCA 3IHPC 4CO7A 2BKFA 1ENFA 3V6EB 3AB5A 1DGJA 3ZNZB 4TKNA 3I63C 3UQBA 2QC8A 1PGBA 2AL3A 2WU5B 3SHQA 2J4XA 4OVVA 2G3QB 1BXTA 3U7DA 3PTFC 4JE3B 4ZRJA 4AWJA 3PV1A 1WH3A 4ZOHC 2R2QA 1FD6A 1U4AA 2WXLA 4MGZE 2GBJA 2WXPA 3PZDA 4AUQC 2DBYA 4RGOS 2D11A 2CS4A 3ZO5B 1K8RB 3V05A 1V9JA 3PLUA 2ZEQA 2GBMA 2LHEA 2D3BA 4YSYB 3RPFC 4KGSA 3OWEB 1WI0A 5GXGB 2FCSA 2GMIC 1MG4A 2MBQA 3I9V1 2D5GA 4RCOA 5CHFA 1C78A 3Q14C 1RM6C 3UQAA 1V8CA 1AN8A 2BYVE 2PE6B 2C5LC 3O65B 2X38A 1FCCC 2N0SB 1JWBD 3AI5A 3EHVA 2BWES 1WY8A 1P7EA 3VUYA 1QZEA 3BK1A 5BMHA 2WDVB 2MBBB 2FE8A 2PPHA 2X8XX 1ZPSA 4M8NA 4RF0A 3ZJVA 5L95C 1L0XB 4W9KA 3EFUA 4YTPB 5AEKB 2INPE 4JQWC 1V5TA 4JPSA 3BIID 1XD3B
chains in the Genus database with same CATH topology
1CQVA 3MFGA 5HG2A 4P6VF 4YT0B 2BT6A 2Q5WD 1WXQA 2BTEA 3L4PA 2LGIA 1T6BX 2PVOD 4A55A 2I2YA 1SXTA 4D2KA 1TKEA 1K53A 2PVGC 4TQ1A 1RWSA 1K52A 2XNAC 5JXVA 1R7SA 1STEA 1QT9A 2ZW1A 5BMIA 2R61A 4A6QA 1A70A 1XLQA 1JWUD 1XCQL 2WXJA 3BYTB 2WDRB 3EA6A 3AEBB 1KRHA 3KWLA 1I4GA 1F77A 1N5XA 2AX5A 3BWUD 3Q8CA 4PT5A 4DQOC 3BVGA 3LXFA 2NTTA 3IT6B 3R2TA 4C7ZA 1JWAD 2QILA 2WXRA 2MJDA 2IGDA 3PO0A 3UI3A 4RNAA 3I57A 1Y56A 1PFDA 4IKGA 1NYRA 3MP9A 4ITKA 3AEAB 5AUKA 3HVZA 3U4EG 2ICIA 5HI1A 1D5XC 1D6EC 1FFUA 1TJEA 2G9HD 4WAFA 1XEEA 3AE9B 5BYRA 2BBCA 2JYTA 4WWMA 3FILA 1JCKB 4OHJA 3VRBB 3BVZA 3J9CA 4RGNA 1YN4A 2WXIA 1ZOYB 1EWYC 1N62A 2BS3B 4XE0A 4LLGM 1YJJA 2I38A 1SF0A 2HDEA 3W5UB 3AM9A 2LJIA 1YN3A 5TSSA 1NYQA 4GLSC 3NVYA 2MJEA 2ONQA 2G1EA 1EU4A 3NS1A 3CIRB 2WXOA 2ZW0A 3Q8EA 1NI3A 5FK9C 2WQYB 4R3DA 1TS4A 2M19A 1TZOA 1KLGD 1ZDXA 4UDUC 4ARIA 1F2RI 1N5WA 2E3TA 3E56A 3O13A 1VR9A 3P4RB 1TS5A 3TEXA 1GAQB 1QQRA 3B2GA 4C56C 1ZDVA 2TSSA 4B0EA 2ACZB 1L0VB 1JQ4A 1MPEA 4OW0A 1B9RA 2QEJC 4ZHOA 1ZP0B 1FNUA 3AE7B 2BB5A 4HJGE 3E9SA 1I4HA 2NTSA 2N9KA 1SB3C 1E6EB 2K5PA 1SBBB 5BMGA 1JRPA 1YNTE 2BYTA 1HZ6A 2AQ2B 2J42A 1E10A 1MHXA 3LB8C 4USAA 1XLOA 1P7FA 1GOZA 1PYWD 2LHDA 2IGHA 1AWDA 2KAJA 1SSNA 1D5ZC 1SEBD 1XLPA 2AQ3B 2L52A 3B9JA 4FXCA 4RFBA 4RF1A 4MACA 2GRIA 4A8XC 3AECB 2N9LA 1PGAA 2Y3AA 1TYGB 3ZJUA 3TEYA 2LEKA 2ON8A 3PZ8A 1J7CA 2W55A 3FC4A 1TS2A 2PTLA 3VRAB 1KF6B 3AE2B 1KH0A 1GPXA 2LFIA 2EKIA 2MJ3A 1XO3A 1PUTA 4DXGA 1JWMD 1QOAA 5EE1A 1KFYB 4L2YA 1K50A 3DWMA 3B2FA 3AE3B 2KQ4X 1PGXA 2V4IB 1CZPA 2WXHA 4IDIA 1SE2A 2IPKD 4HROA 2WXMA 4LTUA 5D3DA 1HA5A 4N58A 4XWTA 1BMLC 1DOXA 3NVZA 1KLUD 2W82A 4REZA 1XXGA 5G5GA 2JSVX 2PLPA 4GDLB 1SE3A 2K9XA 2OEDA 1C9FA 2J53A 3AE1B 5EE3A 4YTNB 3TSSA 4NAWB 1D5MC 3KLSX 2WXKA 2JZPA 4M0WA 4NJCA 1VRAB 1ESFA 4JX1C 3ZYYX 1OFFA 1VJKA 1ROEA 2CJOA 2FUG1 2PIAA 1I4PA 2KDMA 3AE8B 2V3PA 1MI0A 1D4BA 4HKZE 5FR3A 1YMHE 4O1NA 1EU3A 1V1OA 1TKYA 3ABVB 3R8BA 1M4VA 1ZUD2 4KKJA 1YQ4B 3IT4B 1MVKA 2SEBD 2WP9B 3CWIA 1HZ5A 4YSZB 1UWXA 1FRRA 1DOIA 5D3IB 1E9MA 5HFYA 3N9YC 5LNK1 4Q2JA 4NAMA 2IJ0A 3AN1A 4JWSC 1YJIA 2Y5PA 1GB4A 4XDDA 3ZGZA 2L1AA 1IBXB 1V1PB 2N7JA 1L5PA 2EELA 3MC0B 4OZCA 2GB1A 2BS2B 1XLNA 4OZBA 2L83A 3IAS1 3W5VB 1XF5L 2DWQA 3SFEB 3TUOA 4RGMA 5HHDG 1QOFA 3AE4B 1JMLA 3KQ4A 4RH6A 1C79A 2WU2B 2JWUA 3TEWA 4N6EB 4HRSA 5MPOA 3MJ5A 3RFZB 1C76A 3U7ZA 1WYGA 1SIJA 4EE2A 3W1SA 1QKZA 1FO4A 2K22A 2YEPB 3P42A 3PZ7A 2H88B 1E0ZA 1EWCA 1F0ZA 1MHHE 1CJEA 4KGTA 4XWWA 1IGDA 3NVVA 2QSDA 5EE0A 3MHZA 2LMCA 2H89B 3VQIA 3W9CB 1NEKB 3HUIA 1ZE3D 2Z8LA 3P4QB 3U52E 2RPVA 4L23A 1UGJA 3SR6A 1TS3A 1ZXIA 4NZLB 2QMTA 4ZRPA 3WCQA 4P16A 3P1MA 2BS4B 3NZ3A 1N63A 3BZDB 1SJED 1TKGA 5FKAC 4JWUC 3BK2A 4US8A 1I7HA 1L4DB 1LO5D 4WIPA 3Q8BA 2VZKB 1VLBA 1WSPA 4XDCA 3KWVA 3HVDA 3Q8AA 2QIEB 1NVID 1HXYD 2WXNA 2BB6A 3TEZA 2PMVA 4MT5A 1FNVA 1Q10A 2JX5A 3AMZA 2GI9A 2JYEA 1C4AA 1K51A 2E6XA 1JW9D 3EGRA 1I4XA 5E6JA 5H8YE 4YSXB 5C2TB 1AW7A 2LUMA 1L4ZB 3AEGB 1RYJA 3LYYA 2PKOA 3NVWA 5EE9A 2B76B 1N60A 1E7PB 1FM0D 1ET9A 1PDXA 4A90A 3URYA 1FIQA 3C8YA 2IDYA 2Y5CA 1FXAA 1VZ8A 2RDGA 4HEA1 3GP7A 4RGTA 4HKQA 1FCLA 1L0YB 2M56B 5D7GA 5I4DA 2W3RA 1J7BA 2NMQA 1XCTL 1WGKA 2V3NA 1HQRD 1I4QA 3U2SC 1TY0A 2YEPF 3GS2A 4US9A 3Q69A 4N59A 1WWTA 2K0PA 3T3NA 4KX6B 1QOBA 1FEHA 2W54A 2L32A 1OQQA 3AH7A 4WQMA 3V3XA 3AE5B 1CK1A 2J52A 2WLBA 1T5XD 4TSSA 4IOIE 1TY2A 1VZ6A 1BUIC 1JALA 1V97A 2MH7A 3GB1A 2DYMA 1J7AA 5T8IA 1GB1A 3ETRA 1JWSD 5C3JB 4YTMB 2CU3A 1VDVA 2JXTA 2MEKA 3NUHB 1YN5A 5H92C 1IGCA 2RMMA 4AQ7A 2JU6X 3SEBA 1ENFA 3AB5A 4OZAA 1DGJA 1F2RC 2FBWB 4KKIA 3FILB 2KACA 1L6VA 4CQNA 1PGBA 3HRDD 4AS1A 4WH4A 4TMAB 1JROA 2W3SA 3EUB2 2WU5B 2J4XA 3NRZA 3P63A 3AE6B 4DXFA 4ARCA 1DYQA 1C4CA 1BXTA 1L6UA 1UWMA 1IBXA 5AUIA 4JE3B 1V1PA 3VR9B 4YXDB 1FFVA 3SFDB 1NENB 4GDKB 4ZYSA 2XN9C 3BYYB 1ET6A 1FRDA 1RFKA 4ZOHC 3FAHA 1DOYA 1FD6A 1YQ3B 2WXLA 1FXIA 2HTME 1T3QA 2WXPA 3ZQ4A 2WS3B 2V0GA 1KTKA 4B0MA 4J3OD 4C7YA 2AQ1B 5BYSA 3AEFB 2DBYA 4RGOS 2RDHA 2WXGA 2BW2A 1QF6A 2KMMA 4OVZA 2WXQA 3V05A 2WDQB 3BVMA 1WRIA 2LHEA 2INNE 4YSYB 1HEZE 3RPFC 2QJLA 4KGSA 3OWEB 1IUEA 5GXGB 1FNWA 3W2DA 1QILA 3I9V1 2D5GA 4RCOA 2VZKD 4WURA 1UNSA 3Q8FA 2OHFA 1C78A 3AV8A 3P4PB 4ZHPA 1RM6C 2KWDA 1V8CA 2DYOA 2KN4A 1AN8A 1N61A 3VR8B 2PW9A 4MH8A 1ACCA 1VZ7A 4MM3B 4L1BA 1OQRA 2X38A 3DWGC 4H2AA 1FCCC 2N0SB 2DLBA 1JWBD 2WNMA 4YWGG 2SAKA 1FMAD 1P7EA 3AEEB 4ZRQA 3BK1A 1I4RA 5BMHA 2WDVB 2FE8A 3AEDB 3IXSA 2M0AA 3IAM1 3P4SB 5G5HA 1ZPSA 1C77A 2JQRB 5BYQA 1B1ZA 4A9AA 1SE4A 3H8HA 4RF0A 3T3OA 1SJHD 3ZJVA 4KGRA 3ZJTA 1ZXHA 2IGGA 1L0XB 1EM7A 2WXFA 3R2IA 4YTPB 1QOGA 1C4PA 2INPE 1QLBB 4TQ0A 4LK0M 1UUPA 3BIID 4JPSA 4C80A 2CJNA 2K3UA 1AYFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3PZ8 A;  3PZ7 A;  4WIP A;  2D5G A;  1WSP A; 
#chains in the Genus database with same CATH topology
 5IN7 A;  3A9J B;  1LQB A;  2KWV B;  1X1M A;  4IWP A;  1I35 A;  4M8M A;  4YT0 B;  2KJR A;  3L4P A;  2LGI A;  1T6B X;  2K8B A;  2PVO D;  3A9J A;  2PVG C;  3EFC A;  1K52 A;  1LGR A;  2Y5B B;  1A70 A;  1XCQ L;  4E3C A;  2WDR B;  2MQJ A;  3AEB B;  1KRH A;  4DQO C;  3QK0 A;  3IT6 B;  3R2T A;  3WAP A;  4C7Z A;  2QIL A;  2WXR A;  3DDC B;  2IGD A;  3PO0 A;  2V4L A;  2KJ6 A;  5AUK A;  3HVZ A;  2ICI A;  5DPT A;  3QX1 A;  3AE9 B;  2IZV B;  5BYR A;  4NJ6 A;  3PS6 A;  1JCK B;  4OHJ A;  3VRB B;  4FN2 A;  3Q3F A;  4EFO A;  5CTR C;  4K3B A;  4RGN A;  1ZOY B;  2V3S A;  3RI7 C;  2G45 B;  1WZ0 A;  1SF0 A;  2I38 A;  2LD9 A;  3ZNI D;  4GLS C;  2FCM A;  3CIR B;  4P1B C;  4MGY E;  1NI3 A;  2MHJ A;  1ZGU B;  4YL8 A;  1TS4 A;  3H7P B;  3PRE A;  4ARI A;  1F2R I;  3E56 A;  2MA9 B;  1TS5 A;  2K25 A;  1QQR A;  2BVC A;  3H7P A;  1L0V B;  2D3A A;  1MPE A;  1E7V A;  1B9R A;  1FNU A;  4HJG E;  4IWQ A;  2LVP A;  4ANX A;  1Q1O A;  2NTS A;  2MSE D;  2IO0 B;  3VHT C;  5BMG A;  4ANV A;  3ZNG C;  1YNT E;  4DHJ B;  1HZ6 A;  5G2N A;  1S3S G;  1MHX A;  3LB8 C;  4USA A;  3WAO A;  2KAJ A;  4ZRK A;  1MFW A;  4M01 A;  2JZZ A;  3KW5 B;  2DAF A;  2QCZ A;  2GRI A;  3AEC B;  2O6V D;  2N4F A;  1TYG B;  2WX0 A;  2L0F A;  2LEK A;  4XYC A;  3RN9 C;  2PTL A;  1KH0 A;  1E8W A;  1JWM D;  5EE1 A;  3B2F A;  3AE3 B;  3NY5 A;  3QWZ B;  2KQ4 X;  4IDI A;  4BKS A;  1KM7 A;  2FAZ A;  1HA5 A;  2V9H A;  2D10 A;  4M0W B;  5HKH A;  4ANU A;  5JH5 C;  3NVZ A;  2W82 A;  1LFD A;  1XXG A;  2FID A;  1UZX B;  2ZCC A;  1GC6 A;  4HPL B;  2WWZ A;  1C9F A;  3JW0 X;  5EE3 A;  2IO2 B;  3RT3 B;  3DHG C;  3HK0 A;  4M0W A;  1VRA B;  4II2 B;  1P0R A;  3HM3 A;  3Q3N C;  2CJO A;  1I4P A;  4KVG B;  2V3P A;  1MI0 A;  1D4B A;  4ANW A;  4HDQ A;  1TKY A;  3H6N A;  3R8B A;  2K8H A;  1YQ4 B;  3ML9 A;  3V62 A;  4ASW C;  3APF A;  2JXX A;  3ZRF A;  3PSE B;  3WAL A;  1TGZ B;  4JWS C;  2Y5P A;  2N7E A;  3ZGZ A;  2GBR A;  1E8Z A;  3ZLZ A;  2EMT A;  4OZC A;  2KK8 A;  2L3Z A;  2IY1 B;  2DWQ A;  2KDI A;  1JML A;  2JVC A;  3KQ4 A;  4RH6 A;  3SDL C;  1C79 A;  4IUM B;  4B6W A;  1UF0 A;  4I6P A;  3U7Z A;  1SIJ A;  1P3Q U;  2RR9 A;  1WM2 A;  1QKZ A;  2K22 A;  1SE9 A;  5IKC M;  5J18 A;  2H88 B;  1E0Z A;  1EWC A;  1F0Z A;  4W9E A;  4KGT A;  3NVV A;  2FIF A;  5LLI A;  3VQI A;  1OEY A;  2VH2 A;  3U52 E;  3UGB B;  1WGY A;  2NBU A;  2LJ5 A;  3QA8 A;  4HJK A;  4K7W A;  2M17 A;  2L00 B;  3NZS A;  3P1M A;  1N63 A;  1FXT B;  4WIP A;  1R4N I;  3Q8B A;  3KWV A;  3HVD A;  3Q8A A;  1V80 A;  3TJP A;  2BB6 A;  4MT5 A;  1FNV A;  3ONS A;  3OG5 A;  1WMH B;  1C4A A;  1K51 A;  1JW9 D;  1AW7 A;  2LUM A;  2KVR A;  2DAJ A;  2PKO A;  2FNJ B;  1FM0 D;  1E7P B;  3Q3J A;  1WMH A;  3Q3O C;  3PRZ A;  1E90 A;  1H8C A;  2KVZ A;  3URY A;  3C8Y A;  4J6I A;  1VZ8 A;  2PE9 A;  2RDG A;  4HEA 1;  1J7B A;  1TZ1 A;  2KN5 A;  2RSU A;  1YOV B;  5KHQ A;  2J0K A;  3ZW3 A;  1ISN A;  3U8Z A;  4WWP A;  2GOW A;  1FEH A;  2M0X A;  3PRP B;  4WQM A;  3V3X A;  1CK1 A;  2WLB A;  4TSS A;  1EF5 A;  1TY2 A;  1JAL A;  3L10 B;  1YN5 A;  1R4M I;  3SEB A;  2L05 A;  2FUH B;  4ZRI A;  3FIL B;  1L6V A;  3DBR I;  3HRD D;  1LM8 B;  1JRO A;  3A1Q A;  3NRZ A;  4ARC A;  1IBX A;  4YXD B;  3VR9 B;  1FFV A;  1WX7 A;  4KIK B;  4FA6 A;  4P1C C;  3SFD B;  3X23 A;  4PS7 A;  1ET6 A;  1RFK A;  3FAH A;  2KT7 A;  3GE8 C;  1FXI A;  2HTM E;  2XBB C;  4KIK A;  1KTK A;  3PRM B;  4J3O D;  2AQ1 B;  5BYS A;  3AEF B;  4G0N B;  2OOB B;  1WZ3 A;  2KYW A;  2WXG A;  5C1Z A;  2BW2 A;  1QF6 A;  4OVZ A;  2WDQ B;  2BWF A;  2LAS A;  2FCN A;  5DCN A;  1TBE A;  2MRP A;  1HEZ E;  2QJL A;  4K1R B;  1Z2M A;  1G6J A;  2L7R A;  4ZHP A;  3FKY A;  2KN4 A;  2UYZ B;  4MH8 A;  3VH4 B;  2CHX A;  4G50 A;  3HM6 X;  4EUT A;  1WGR A;  4H2A A;  2NCN A;  2WNM A;  2SAK A;  4ZRQ A;  5L83 A;  1A5R A;  2LGD A;  3AED B;  4MJS B;  1UEL A;  2JRI B;  3IAM 1;  3T8M A;  1V49 A;  2WHI A;  4DHZ B;  1SJH D;  2J0J A;  5J2R A;  1ZXH A;  1EM7 A;  4MJS A;  1QOG A;  1QLB B;  4IC7 B;  3VAW A;  4LK0 M;  3ZTC A;  1UUP A;  4C80 A;  1F9J A;  1AYF A;  1GJZ A;  4HPP A;  3NJT A;  1SGH A;  2JY6 A;  2KHW B;  2BTE A;  2I2Y A;  4A55 A;  4D2K A;  2NPT B;  2CHZ A;  2ZNV B;  1STE A;  1WM3 A;  1QT9 A;  4TV3 A;  2ZW1 A;  5BMI A;  2MBO A;  4A20 A;  1R4N B;  2NPT A;  1L7Y A;  2RD0 A;  3EA6 A;  4GXB A;  2J7Q B;  4K7U A;  4EOY A;  3L16 A;  1N5X A;  1F77 A;  2BYF A;  3Q8C A;  3DVG Y;  3KUC B;  3RNA C;  2NTT A;  1JWA D;  1MJD A;  2HE7 A;  4E71 A;  3UI3 A;  3NHE B;  2RPQ A;  4RNA A;  2Z59 B;  3I57 A;  1Y56 A;  4IKG A;  3MC9 A;  5HI1 A;  1V6E A;  2G9H D;  1F1H A;  1WXS A;  1XEE A;  3HHM A;  4DK5 A;  2DHZ A;  2JYT A;  3BVZ A;  1XQQ A;  1AAR A;  1N62 A;  4LLG M;  3W5U B;  2KTR B;  2LJI A;  4XC2 A;  2ZJD A;  5IA7 A;  4LDT D;  2MJE A;  2ONQ A;  1EU4 A;  3NS1 A;  2DNF A;  2L0T A;  2UWQ A;  4WQO B;  3KUZ A;  2KTR A;  4KSK C;  5FK9 C;  1WR6 E;  2FCQ A;  1KLG D;  1E7U A;  2E3T A;  2D2Q A;  1OEY J;  3PPA A;  1RFA A;  1UBQ A;  1VR9 A;  1WJ4 A;  3P4R B;  3TEX A;  5CHV C;  1ZDV A;  2TSS A;  1R4M B;  3LJ3 A;  3Q3M C;  4OW0 A;  4ZHO A;  1CMX B;  4RMA A;  3DBR B;  1KJT A;  2N9K A;  2K5P A;  2PEA A;  4M00 A;  3EC8 A;  2J42 A;  1XLO A;  1P7F A;  2LHD A;  2EMS A;  1SSN A;  1XLP A;  2AQ3 B;  4RF1 A;  3JYU A;  2N9L A;  1PGA A;  2Y3A A;  2NVU I;  4W9G A;  2C60 A;  3TEY A;  5LXH A;  1J7C A;  3R3M A;  3N30 A;  2LGS A;  5CX3 A;  4NQL B;  2MJ3 A;  4FHJ A;  3AUL A;  1KFY B;  2O6V B;  4II3 B;  2V4I B;  2KD0 A;  3NS8 A;  3ML8 A;  1BML C;  1YD8 U;  2N7D A;  4REZ A;  2O6V A;  3AE1 B;  2C9W B;  1P98 A;  2WXK A;  5JHB A;  3QIJ A;  1V86 A;  3ZYY X;  1Y8R C;  1OFF A;  2KLC A;  3AE8 B;  2CU1 A;  2CKH B;  5FR3 A;  1YMH E;  1WGG A;  1V1O A;  5EDS A;  4KKJ A;  1YQB A;  3IT4 B;  4FJV B;  1MVK A;  1T0R C;  3BY4 B;  2WP9 B;  1UWX A;  3RNB C;  2Z0D B;  4ICV A;  1E9M A;  2GBK A;  2DZI A;  5LNK 1;  3VUX A;  1J19 A;  4KDI C;  1YJI A;  1GB4 A;  4XDD A;  3B0A A;  2L1A A;  2N1V A;  3C19 A;  4NJ7 A;  2KQS A;  1V1P B;  3M95 A;  4F7Z A;  2IY0 B;  3PHW B;  4NY0 A;  2KO3 A;  2GB1 A;  2BS2 B;  5CHW A;  2AL6 A;  5D6J B;  4RGM A;  5HHD G;  1QOF A;  2KNB A;  3ZDM C;  4MGI E;  4HWI B;  2G4S A;  5GMV A;  3RFZ B;  1C76 A;  1WJN A;  4WJQ A;  3VTW A;  4KSL C;  4FLH A;  3P42 A;  3N20 C;  1EUV B;  3ENE A;  1MHH E;  1CJE A;  4XWW A;  5EE0 A;  2LMC A;  1NEK B;  3HUI A;  1ZE3 D;  4G11 A;  1UGJ A;  2AYO B;  3TIX A;  4FJY A;  4AJW A;  4ZRP A;  4AJY B;  2GLS A;  1OTR B;  3DVN V;  2BS4 B;  3NZ3 A;  3BZD B;  5FR6 A;  3VDZ A;  1SJE D;  4BOS C;  2ASQ A;  2KDE B;  3IFW B;  3H7S A;  2VZK B;  2QIE B;  1NVI D;  4KV2 A;  3T9L A;  4ZYN A;  2JX5 A;  2UU7 A;  2BF8 B;  2E6X A;  1I4X A;  4YSX B;  3EEC A;  3R66 C;  3APD A;  1RYJ A;  3LYY A;  5EE9 A;  1PDX A;  2LGX A;  1E8Y A;  3X0W A;  2DEN B;  3WIM A;  1FCL A;  1N6Z A;  1J8C A;  3DOW A;  3KUD B;  4LNK A;  3TMP B;  5I4D A;  4BFR A;  3ZDT A;  1WGK A;  2V3N A;  3QAQ A;  1HQR D;  1TIF A;  1I4Q A;  3I3T B;  1SIF A;  4US9 A;  1E8X A;  2BKR B;  1J0G A;  2W54 A;  2L32 A;  3AE5 B;  1WRD B;  2J52 A;  1Q5W B;  1VZ6 A;  1J7A A;  5T8I A;  2MP2 B;  4YTM B;  1VDV A;  3R7Q A;  1P9D U;  2JU6 X;  2KC1 A;  2KC2 A;  4OZA A;  2FBW B;  1F2R C;  4KKI A;  2MP2 A;  2KAC A;  2KX0 A;  4GGQ A;  4CQN A;  2WYQ A;  3L0W B;  3QAR A;  4WH4 A;  1Q0W B;  2W3S A;  3EUB 2;  1GG3 A;  3AE6 B;  3DQV A;  5D94 A;  1UWM A;  2KDB A;  4GDK B;  2I1J A;  1FRD A;  2REX A;  4AOF A;  2LUE A;  4HLE A;  4DWF A;  4GDK A;  4C7Y A;  3H1U A;  3LDZ E;  1I42 A;  5IO9 A;  4BKG A;  4IG7 B;  2KMM A;  2WXQ A;  4I6L B;  1WRI A;  3DHH C;  5TR5 A;  3MJW A;  1WX8 A;  4GIV A;  1QIL A;  2LI5 A;  1T0Q C;  2VZK D;  4WUR A;  1YIW A;  3Q8F A;  4F1S A;  2OHF A;  1RLF A;  4W9C A;  4EZK A;  2M1M A;  1OQY A;  4IM2 A;  4NQK E;  3M63 B;  1N61 A;  3VR8 B;  2PW9 A;  3A4R A;  3CMM B;  4BOZ B;  4MM3 B;  1OQR A;  3UIO B;  1VD2 A;  2DLB A;  2KWU B;  4EZL A;  4YWG G;  4B95 A;  1FMA D;  4XZ4 A;  4MM3 A;  3IXS A;  2K6Q A;  1XT9 B;  2JQR B;  5BYQ A;  1B1Z A;  2JPH A;  3RNF C;  4PK1 A;  2RDB C;  3L08 A;  3PHX B;  3R2I A;  4FBJ B;  4TQ0 A;  1C4P A;  1HE8 A;  2JWZ A;  2K3U A;  1CQV A;  3MC8 A;  3MFG A;  4P6V F;  2Q5W D;  3K9O B;  4MSM B;  1SXT A;  2KFK B;  3DBH I;  1K53 A;  3RYT A;  4P7I A;  1YX6 B;  4TQ1 A;  5JXV A;  3L54 A;  2R61 A;  1XLQ A;  3BYT B;  1C1Y B;  2KFK A;  1I4G A;  3BWU D;  3BVG A;  3LXF A;  3M3J A;  2G4D B;  2MJD A;  5JZE B;  2KOX A;  1L2N A;  1PFD A;  3GOE A;  4PS8 A;  1NYR A;  3MP9 A;  3U4E G;  3NOB A;  2N9E B;  3OJ3 A;  4BBN F;  3RZW C;  1WXV A;  1E5W A;  5LXI B;  2BBC A;  4WWM A;  3SU8 X;  4XX5 A;  3FIL A;  1WX9 A;  3J9C A;  1UBI A;  4W9L A;  1LXD A;  2ZVN A;  2BS3 B;  4XE0 A;  4K7S A;  3AM9 A;  1RRB A;  3H9D A;  1NYQ A;  1WE6 A;  4W9I A;  2G1E A;  2ZNV C;  2M4N A;  2WXO A;  2ZW0 A;  3DBS A;  2M19 A;  4LDT B;  4UDU C;  1N5W A;  1EF1 A;  2RGF A;  3B2G A;  4MSQ B;  4B0E A;  2ACZ B;  1KOT A;  1JQ4 A;  4MH0 E;  3AE7 B;  1TT5 B;  4X57 B;  2ZPN A;  3E9S A;  1GC7 A;  1V2Y A;  3WAM A;  3VXW A;  3PT2 B;  1SB3 C;  1SBB B;  1JRP A;  2AQ2 B;  4MDK E;  4C4V B;  2I1K A;  1PYW D;  4IW0 A;  3V60 A;  4LNO A;  4FAD A;  1AWD A;  3Q6B A;  1D5Z C;  2HD5 B;  2L52 A;  4FXC A;  4RFB A;  1T0S C;  4MAC A;  4A8X C;  4C4V A;  2BQQ A;  5AZH A;  3ZJU A;  2K6D B;  1HTO A;  2LRW A;  2W55 A;  3FC4 A;  1TS2 A;  1KF6 B;  2R2O A;  3AE2 B;  4KDL B;  1GPX A;  2D3C A;  4DXG A;  1QOA A;  1KLV A;  4KZ0 A;  4L2Y A;  3L13 A;  2HJ8 A;  2OJW A;  1CZP A;  4LTU A;  5D3D A;  3RD2 A;  4XWT A;  3VUW A;  4W9D A;  1DOX A;  2J0M A;  1HTQ A;  3I5J C;  4B9K A;  5G5G A;  2PLP A;  4GDL B;  1SE3 A;  2J53 A;  2NR2 A;  4YTN B;  2N1W A;  4NAW B;  3KLS X;  2KWC A;  5G55 A;  2MCN B;  1ESF A;  4RM8 A;  2FUG 1;  4LNN A;  4HKZ E;  4NAW A;  4O1N A;  4JL9 A;  1M4V A;  2W9N A;  2C7M B;  4LNF A;  2SEB D;  2INC C;  3CWI A;  2NS5 A;  3ZRC A;  1FRR A;  4WWN A;  5D3I B;  5HFY A;  3BIN A;  2WGS A;  4WAA A;  3HIZ A;  3N9Y C;  4Q2J A;  4BZA A;  4NAM A;  2IJ0 A;  3AN1 A;  3QCA A;  3TCA A;  4PYU A;  2MBH A;  3V61 A;  4DHZ E;  2IND C;  1L5P A;  3ZTD A;  3W5V B;  1XF5 L;  5IOI A;  3TUO A;  4XGA B;  1WFY A;  3AE4 B;  3PVL A;  3DBH B;  2WU2 B;  3TEW A;  4URK A;  4LJP B;  2EKE C;  2ZCB A;  4HRS A;  1M94 A;  2KTF A;  2CR5 A;  2QDF A;  1NDD A;  1WYG A;  4M02 A;  3W1S A;  3KVF B;  2M8S A;  2YEP B;  3PZ7 A;  2B3A A;  2QSD A;  2KFJ A;  3MHZ A;  2Z8L A;  3P4Q B;  2RPV A;  4L23 A;  3SR6 A;  1TS3 A;  4NZL B;  3ZKJ C;  3OJ4 B;  2LZ6 A;  2QMT A;  3WCQ A;  3A9K B;  3ZXV A;  1TKG A;  1WYW B;  3RZF A;  5FKA C;  2DZM A;  2KMA A;  2IO1 B;  2WDT B;  4JWU C;  4LJO B;  4HPM B;  4US8 A;  1I7H A;  1L4D B;  1VLB A;  2LRU A;  3RMK C;  1WSP A;  2HJ1 A;  3A9K A;  2KKC A;  2L8J A;  3CF6 E;  2HTH A;  2WXN A;  3DVG X;  2PMV A;  5DPW A;  2D3G A;  3AU4 A;  4GSW A;  2JYE A;  3EGR A;  4RM9 A;  3ZUN A;  3RUL A;  3MHS D;  5H8Y E;  3JVZ X;  5C2T B;  1L4Z B;  3AEG B;  3L17 A;  2B76 B;  4A3P A;  1N60 A;  4WJN A;  1ET9 A;  3U30 A;  1WIA A;  2MWS B;  1F52 A;  4BVU C;  2JRH A;  2AEH A;  2IDY A;  2Y5C A;  4EEW A;  4HKQ A;  4RGT A;  1L0Y B;  5D7G A;  3K9P B;  1T0Y A;  2NMQ A;  5IAA C;  1XCT L;  3DHI C;  4FHK A;  3U2S C;  4CYE A;  1TY0 A;  3GS2 A;  4DBG A;  2XEW A;  2ZPY A;  3Q69 A;  3S2A A;  3WA0 A;  1WWT A;  2BYE A;  3T3N A;  4KX6 B;  3IBE A;  3N1X C;  4NPN A;  4IWO A;  4GU2 A;  5C23 A;  2MBE A;  3TL5 A;  1T5X D;  3PLV A;  2MH7 A;  1RAX A;  1GB1 A;  3ETR A;  1JWS D;  5C3J B;  2MEK A;  5KHO A;  3NUH B;  2JT4 B;  2KAN A;  1P1A A;  2WX1 A;  3DCG A;  2KLG A;  4AS1 A;  4TMA B;  4DXF A;  2C7H A;  3P63 A;  2N9X A;  1DYQ A;  1C4C A;  1L6U A;  5AUI A;  1V1P A;  1WGH A;  1NEN B;  4ZYS A;  2XN9 C;  3BYY B;  1DOY A;  1C3T A;  1YQ3 B;  1T3Q A;  4HDO A;  3ZQ4 A;  2WS3 B;  2V0G A;  4B0M A;  3UIP B;  3N1Z C;  2YLM A;  2RDH A;  2BPS A;  1BT0 A;  3WAN A;  4GMV A;  3BVM A;  1IPG A;  2INN E;  1IUE A;  3VFK A;  4GOC A;  1FNW A;  3W2D A;  4JGH B;  3RNG C;  1UNS A;  3AV8 A;  1WJ6 A;  3P4P B;  2KWD A;  2DYO A;  4MGK E;  2OJR A;  2N9P C;  4W9F A;  4QAY A;  1WXA A;  2MLB A;  2LXA A;  3NZU A;  1ACC A;  1VZ7 A;  2KX3 A;  2AWT A;  3VTU A;  4ICU A;  4L1B A;  3DWG C;  3N3K B;  3AXC A;  4CHK A;  2XK5 B;  5DPS A;  3QC8 B;  3AEE B;  1I4R A;  4EZJ A;  3AU5 A;  2M0A A;  3P4S B;  5G5H A;  4S0R A;  1C77 A;  2JF5 A;  1NBF C;  2XK5 A;  4A9A A;  4KZC A;  1SE4 A;  3M62 B;  4F8C B;  1WJU A;  3H8H A;  3T3O A;  4WJP A;  4KGR A;  4ZDV A;  3RCZ A;  3ZJT A;  2IGG A;  4PYZ A;  2WXF A;  2CJN A;  1XO3 A;  3PGE A;  2DZJ A;  3TBL D;  5HG2 A;  4LCD E;  2BT6 A;  1WXQ A;  3APC A;  2LVQ A;  4C00 A;  1TKE A;  1RWS A;  2XNA C;  3OAW A;  1R7S A;  4N9F 4;  2IYD B;  4A6Q A;  2WXJ A;  1JWU D;  3CST A;  5IP4 D;  2KDF B;  1WGD A;  3VH3 B;  3KWL A;  2K1F A;  4PT5 A;  2AX5 A;  2IO3 B;  2KXJ A;  2NBW B;  4HCP B;  4IM0 A;  4TUU A;  4ITK A;  3AEA B;  4PS3 A;  1D5X C;  1D6E C;  1FFU A;  1TJE A;  4WAF A;  5E6N A;  3B1L X;  2V1Y A;  4FJZ A;  1VCB A;  4W9H A;  3QHT A;  1YN4 A;  2WXI A;  2VRR B;  1EWY C;  3N32 A;  3N1Y C;  1YJJ A;  2HDE A;  4G3X B;  3MTN B;  2JUO A;  1YJ1 A;  1YN3 A;  5TSS A;  4DDI D;  3ZIM A;  4HVB A;  3NVY A;  1UD7 A;  1FPY A;  3KYC D;  5E6P A;  2GBN A;  3Q8E A;  3GZN I;  4BKT A;  2D07 B;  2WQY B;  4R3D A;  1UH6 A;  1TZO A;  1ZDX A;  1PQS A;  1S1Q B;  3O13 A;  4JLC A;  4W9J A;  5BO4 B;  5DPR A;  2ZZP B;  2L76 A;  3KYD D;  1GAQ B;  4C56 C;  3P2B A;  2LGY A;  2QEJ C;  1ZP0 B;  4DHJ D;  2BB5 A;  2JZ3 B;  3A4S C;  4OVU A;  3KH0 A;  1I4H A;  1E6E B;  3SD5 A;  4DDG D;  4E74 A;  1WF9 A;  2BYT A;  2Z0E B;  3W1Y A;  1WXM A;  2BGF A;  1E10 A;  3DBL I;  3NG0 A;  1GOZ A;  2IGH A;  2LVO A;  1SEB D;  4A3O A;  4BKS D;  4I6N B;  3B9J A;  3ZVV A;  3QQ8 B;  1TTN A;  1ZKH A;  3ZNH B;  2IBI B;  2ON8 A;  3PZ8 A;  3VRA B;  2A5U A;  2LFI A;  2EKI A;  1PUT A;  4NNJ B;  1K50 A;  5JHA A;  3DWM A;  1OGW A;  2K39 A;  1PGX A;  5E6O A;  2WXH A;  1SE2 A;  2IPK D;  4HRO A;  2WXM A;  4N58 A;  1KLU D;  3QJZ A;  3ZXR A;  4GB9 A;  4BBN C;  4AP4 C;  2JSV X;  2K9X A;  4HK2 A;  2OED A;  3TSS A;  3IVF A;  1D5M C;  2A4Z A;  2JZP A;  4NJC A;  3A33 B;  2YVC A;  3JSV B;  4JX1 C;  1JRU A;  4GN1 A;  1VJK A;  1ROE A;  2PIA A;  2KDM A;  3D32 A;  4S17 A;  2K8C A;  4K81 A;  1MG8 A;  1EU3 A;  3ABV B;  1ZUD 2;  3JSV A;  2LWP A;  3UF8 A;  4YSZ B;  1HZ5 A;  3DPD A;  1DOI A;  3GE3 C;  3A1Q B;  4ACF A;  1NI2 A;  1IBX B;  5J17 A;  2N7J A;  2EEL A;  3MC0 B;  1XLN A;  4OZB A;  2L83 A;  3IAS 1;  1GNU A;  3VTV A;  3SFE B;  3B08 A;  2KQ7 A;  1Z5S B;  2JWU A;  3RNC C;  1H4R A;  4N6E B;  3ECI A;  3CSF A;  5MPO A;  4JIO U;  3MJ5 A;  4DXA B;  2O2V B;  4WWO A;  3IG3 A;  3R7R A;  2MW5 A;  4EE2 A;  2ZVO A;  4FUL A;  2DZK A;  3UIN B;  1FO4 A;  4IM3 A;  4MEL A;  2NBV B;  1IGD A;  2O2V A;  2H89 B;  3W9C B;  1IP9 A;  1V5O A;  1ZXI A;  2QHO A;  2CHW A;  3RNE C;  4HXD A;  5D2M B;  4P16 A;  3OLM D;  3Q2A C;  5AZF A;  1YX5 B;  3DVN U;  4K3C A;  5AZG A;  2KZR A;  1GUA B;  3BK2 A;  1LO5 D;  1UGM A;  4XDC A;  1HXY D;  1WR1 A;  3W1S C;  2MX2 A;  2DX5 B;  3TEZ A;  4HCN B;  1Q10 A;  3AMZ A;  3GZN B;  2GI9 A;  2C7N B;  1WE7 A;  3C0R B;  5E6J A;  1IYF A;  3NVW A;  2PJH A;  4WJO A;  4A90 A;  2DYB A;  1FIQ A;  1FXA A;  3RUI B;  3GP7 A;  4BAX A;  2M56 B;  2W3R A;  4LNI A;  3V6C B;  2YEP F;  4GDL A;  4N59 A;  1D3Z A;  2K0P A;  3VVW B;  3DBL B;  1QOB A;  2VH1 A;  1OQQ A;  1EO6 A;  2KMC A;  3AH7 A;  1V81 A;  4MEM A;  4IOI E;  1V97 A;  1BUI C;  3GB1 A;  2DYM A;  2CU3 A;  2JXT A;  5H92 C;  3ALB A;  1IGC A;  2RMM A;  2KJH B;  1ZW7 A;  4AQ7 A;  4EKU A;  2LXC A;  3IHP C;  4CO7 A;  2BKF A;  1ENF A;  3V6E B;  3AB5 A;  1DGJ A;  3ZNZ B;  4TKN A;  3I63 C;  3UQB A;  2QC8 A;  1PGB A;  2AL3 A;  2WU5 B;  3SHQ A;  2J4X A;  4OVV A;  2G3Q B;  1BXT A;  3U7D A;  3PTF C;  4JE3 B;  4ZRJ A;  4AWJ A;  3PV1 A;  1WH3 A;  4ZOH C;  2R2Q A;  1FD6 A;  1U4A A;  2WXL A;  4MGZ E;  2GBJ A;  2WXP A;  3PZD A;  4AUQ C;  2DBY A;  4RGO S;  2D11 A;  2CS4 A;  3ZO5 B;  1K8R B;  3V05 A;  1V9J A;  3PLU A;  2ZEQ A;  2GBM A;  2LHE A;  2D3B A;  4YSY B;  3RPF C;  4KGS A;  3OWE B;  1WI0 A;  5GXG B;  2FCS A;  2GMI C;  1MG4 A;  2MBQ A;  3I9V 1;  2D5G A;  4RCO A;  5CHF A;  1C78 A;  3Q14 C;  1RM6 C;  3UQA A;  1V8C A;  1AN8 A;  2BYV E;  2PE6 B;  2C5L C;  3O65 B;  2X38 A;  1FCC C;  2N0S B;  1JWB D;  3AI5 A;  3EHV A;  2BWE S;  1WY8 A;  1P7E A;  3VUY A;  1QZE A;  3BK1 A;  5BMH A;  2WDV B;  2MBB B;  2FE8 A;  2PPH A;  2X8X X;  1ZPS A;  4M8N A;  4RF0 A;  3ZJV A;  5L95 C;  1L0X B;  4W9K A;  3EFU A;  4YTP B;  5AEK B;  2INP E;  4JQW C;  1V5T A;  4JPS A;  3BII D;  1XD3 B; 
#chains in the Genus database with same CATH homology
 1CQV A;  3MFG A;  5HG2 A;  4P6V F;  4YT0 B;  2BT6 A;  2Q5W D;  1WXQ A;  2BTE A;  3L4P A;  2LGI A;  1T6B X;  2PVO D;  4A55 A;  2I2Y A;  1SXT A;  4D2K A;  1TKE A;  1K53 A;  2PVG C;  4TQ1 A;  1RWS A;  1K52 A;  2XNA C;  5JXV A;  1R7S A;  1STE A;  1QT9 A;  2ZW1 A;  5BMI A;  2R61 A;  4A6Q A;  1A70 A;  1XLQ A;  1JWU D;  1XCQ L;  2WXJ A;  3BYT B;  2WDR B;  3EA6 A;  3AEB B;  1KRH A;  3KWL A;  1I4G A;  1F77 A;  1N5X A;  2AX5 A;  3BWU D;  3Q8C A;  4PT5 A;  4DQO C;  3BVG A;  3LXF A;  2NTT A;  3IT6 B;  3R2T A;  4C7Z A;  1JWA D;  2QIL A;  2WXR A;  2MJD A;  2IGD A;  3PO0 A;  3UI3 A;  4RNA A;  3I57 A;  1Y56 A;  1PFD A;  4IKG A;  1NYR A;  3MP9 A;  4ITK A;  3AEA B;  5AUK A;  3HVZ A;  3U4E G;  2ICI A;  5HI1 A;  1D5X C;  1D6E C;  1FFU A;  1TJE A;  2G9H D;  4WAF A;  1XEE A;  3AE9 B;  5BYR A;  2BBC A;  2JYT A;  4WWM A;  3FIL A;  1JCK B;  4OHJ A;  3VRB B;  3BVZ A;  3J9C A;  4RGN A;  1YN4 A;  2WXI A;  1ZOY B;  1EWY C;  1N62 A;  2BS3 B;  4XE0 A;  4LLG M;  1YJJ A;  2I38 A;  1SF0 A;  2HDE A;  3W5U B;  3AM9 A;  2LJI A;  1YN3 A;  5TSS A;  1NYQ A;  4GLS C;  3NVY A;  2MJE A;  2ONQ A;  2G1E A;  1EU4 A;  3NS1 A;  3CIR B;  2WXO A;  2ZW0 A;  3Q8E A;  1NI3 A;  5FK9 C;  2WQY B;  4R3D A;  1TS4 A;  2M19 A;  1TZO A;  1KLG D;  1ZDX A;  4UDU C;  4ARI A;  1F2R I;  1N5W A;  2E3T A;  3E56 A;  3O13 A;  1VR9 A;  3P4R B;  1TS5 A;  3TEX A;  1GAQ B;  1QQR A;  3B2G A;  4C56 C;  1ZDV A;  2TSS A;  4B0E A;  2ACZ B;  1L0V B;  1JQ4 A;  1MPE A;  4OW0 A;  1B9R A;  2QEJ C;  4ZHO A;  1ZP0 B;  1FNU A;  3AE7 B;  2BB5 A;  4HJG E;  3E9S A;  1I4H A;  2NTS A;  2N9K A;  1SB3 C;  1E6E B;  2K5P A;  1SBB B;  5BMG A;  1JRP A;  1YNT E;  2BYT A;  1HZ6 A;  2AQ2 B;  2J42 A;  1E10 A;  1MHX A;  3LB8 C;  4USA A;  1XLO A;  1P7F A;  1GOZ A;  1PYW D;  2LHD A;  2IGH A;  1AWD A;  2KAJ A;  1SSN A;  1D5Z C;  1SEB D;  1XLP A;  2AQ3 B;  2L52 A;  3B9J A;  4FXC A;  4RFB A;  4RF1 A;  4MAC A;  2GRI A;  4A8X C;  3AEC B;  2N9L A;  1PGA A;  2Y3A A;  1TYG B;  3ZJU A;  3TEY A;  2LEK A;  2ON8 A;  3PZ8 A;  1J7C A;  2W55 A;  3FC4 A;  1TS2 A;  2PTL A;  3VRA B;  1KF6 B;  3AE2 B;  1KH0 A;  1GPX A;  2LFI A;  2EKI A;  2MJ3 A;  1XO3 A;  1PUT A;  4DXG A;  1JWM D;  1QOA A;  5EE1 A;  1KFY B;  4L2Y A;  1K50 A;  3DWM A;  3B2F A;  3AE3 B;  2KQ4 X;  1PGX A;  2V4I B;  1CZP A;  2WXH A;  4IDI A;  1SE2 A;  2IPK D;  4HRO A;  2WXM A;  4LTU A;  5D3D A;  1HA5 A;  4N58 A;  4XWT A;  1BML C;  1DOX A;  3NVZ A;  1KLU D;  2W82 A;  4REZ A;  1XXG A;  5G5G A;  2JSV X;  2PLP A;  4GDL B;  1SE3 A;  2K9X A;  2OED A;  1C9F A;  2J53 A;  3AE1 B;  5EE3 A;  4YTN B;  3TSS A;  4NAW B;  1D5M C;  3KLS X;  2WXK A;  2JZP A;  4M0W A;  4NJC A;  1VRA B;  1ESF A;  4JX1 C;  3ZYY X;  1OFF A;  1VJK A;  1ROE A;  2CJO A;  2FUG 1;  2PIA A;  1I4P A;  2KDM A;  3AE8 B;  2V3P A;  1MI0 A;  1D4B A;  4HKZ E;  5FR3 A;  1YMH E;  4O1N A;  1EU3 A;  1V1O A;  1TKY A;  3ABV B;  3R8B A;  1M4V A;  1ZUD 2;  4KKJ A;  1YQ4 B;  3IT4 B;  1MVK A;  2SEB D;  2WP9 B;  3CWI A;  1HZ5 A;  4YSZ B;  1UWX A;  1FRR A;  1DOI A;  5D3I B;  1E9M A;  5HFY A;  3N9Y C;  5LNK 1;  4Q2J A;  4NAM A;  2IJ0 A;  3AN1 A;  4JWS C;  1YJI A;  2Y5P A;  1GB4 A;  4XDD A;  3ZGZ A;  2L1A A;  1IBX B;  1V1P B;  2N7J A;  1L5P A;  2EEL A;  3MC0 B;  4OZC A;  2GB1 A;  2BS2 B;  1XLN A;  4OZB A;  2L83 A;  3IAS 1;  3W5V B;  1XF5 L;  2DWQ A;  3SFE B;  3TUO A;  4RGM A;  5HHD G;  1QOF A;  3AE4 B;  1JML A;  3KQ4 A;  4RH6 A;  1C79 A;  2WU2 B;  2JWU A;  3TEW A;  4N6E B;  4HRS A;  5MPO A;  3MJ5 A;  3RFZ B;  1C76 A;  3U7Z A;  1WYG A;  1SIJ A;  4EE2 A;  3W1S A;  1QKZ A;  1FO4 A;  2K22 A;  2YEP B;  3P42 A;  3PZ7 A;  2H88 B;  1E0Z A;  1EWC A;  1F0Z A;  1MHH E;  1CJE A;  4KGT A;  4XWW A;  1IGD A;  3NVV A;  2QSD A;  5EE0 A;  3MHZ A;  2LMC A;  2H89 B;  3VQI A;  3W9C B;  1NEK B;  3HUI A;  1ZE3 D;  2Z8L A;  3P4Q B;  3U52 E;  2RPV A;  4L23 A;  1UGJ A;  3SR6 A;  1TS3 A;  1ZXI A;  4NZL B;  2QMT A;  4ZRP A;  3WCQ A;  4P16 A;  3P1M A;  2BS4 B;  3NZ3 A;  1N63 A;  3BZD B;  1SJE D;  1TKG A;  5FKA C;  4JWU C;  3BK2 A;  4US8 A;  1I7H A;  1L4D B;  1LO5 D;  4WIP A;  3Q8B A;  2VZK B;  1VLB A;  1WSP A;  4XDC A;  3KWV A;  3HVD A;  3Q8A A;  2QIE B;  1NVI D;  1HXY D;  2WXN A;  2BB6 A;  3TEZ A;  2PMV A;  4MT5 A;  1FNV A;  1Q10 A;  2JX5 A;  3AMZ A;  2GI9 A;  2JYE A;  1C4A A;  1K51 A;  2E6X A;  1JW9 D;  3EGR A;  1I4X A;  5E6J A;  5H8Y E;  4YSX B;  5C2T B;  1AW7 A;  2LUM A;  1L4Z B;  3AEG B;  1RYJ A;  3LYY A;  2PKO A;  3NVW A;  5EE9 A;  2B76 B;  1N60 A;  1E7P B;  1FM0 D;  1ET9 A;  1PDX A;  4A90 A;  3URY A;  1FIQ A;  3C8Y A;  2IDY A;  2Y5C A;  1FXA A;  1VZ8 A;  2RDG A;  4HEA 1;  3GP7 A;  4RGT A;  4HKQ A;  1FCL A;  1L0Y B;  2M56 B;  5D7G A;  5I4D A;  2W3R A;  1J7B A;  2NMQ A;  1XCT L;  1WGK A;  2V3N A;  1HQR D;  1I4Q A;  3U2S C;  1TY0 A;  2YEP F;  3GS2 A;  4US9 A;  3Q69 A;  4N59 A;  1WWT A;  2K0P A;  3T3N A;  4KX6 B;  1QOB A;  1FEH A;  2W54 A;  2L32 A;  1OQQ A;  3AH7 A;  4WQM A;  3V3X A;  3AE5 B;  1CK1 A;  2J52 A;  2WLB A;  1T5X D;  4TSS A;  4IOI E;  1TY2 A;  1VZ6 A;  1BUI C;  1JAL A;  1V97 A;  2MH7 A;  3GB1 A;  2DYM A;  1J7A A;  5T8I A;  1GB1 A;  3ETR A;  1JWS D;  5C3J B;  4YTM B;  2CU3 A;  1VDV A;  2JXT A;  2MEK A;  3NUH B;  1YN5 A;  5H92 C;  1IGC A;  2RMM A;  4AQ7 A;  2JU6 X;  3SEB A;  1ENF A;  3AB5 A;  4OZA A;  1DGJ A;  1F2R C;  2FBW B;  4KKI A;  3FIL B;  2KAC A;  1L6V A;  4CQN A;  1PGB A;  3HRD D;  4AS1 A;  4WH4 A;  4TMA B;  1JRO A;  2W3S A;  3EUB 2;  2WU5 B;  2J4X A;  3NRZ A;  3P63 A;  3AE6 B;  4DXF A;  4ARC A;  1DYQ A;  1C4C A;  1BXT A;  1L6U A;  1UWM A;  1IBX A;  5AUI A;  4JE3 B;  1V1P A;  3VR9 B;  4YXD B;  1FFV A;  3SFD B;  1NEN B;  4GDK B;  4ZYS A;  2XN9 C;  3BYY B;  1ET6 A;  1FRD A;  1RFK A;  4ZOH C;  3FAH A;  1DOY A;  1FD6 A;  1YQ3 B;  2WXL A;  1FXI A;  2HTM E;  1T3Q A;  2WXP A;  3ZQ4 A;  2WS3 B;  2V0G A;  1KTK A;  4B0M A;  4J3O D;  4C7Y A;  2AQ1 B;  5BYS A;  3AEF B;  2DBY A;  4RGO S;  2RDH A;  2WXG A;  2BW2 A;  1QF6 A;  2KMM A;  4OVZ A;  2WXQ A;  3V05 A;  2WDQ B;  3BVM A;  1WRI A;  2LHE A;  2INN E;  4YSY B;  1HEZ E;  3RPF C;  2QJL A;  4KGS A;  3OWE B;  1IUE A;  5GXG B;  1FNW A;  3W2D A;  1QIL A;  3I9V 1;  2D5G A;  4RCO A;  2VZK D;  4WUR A;  1UNS A;  3Q8F A;  2OHF A;  1C78 A;  3AV8 A;  3P4P B;  4ZHP A;  1RM6 C;  2KWD A;  1V8C A;  2DYO A;  2KN4 A;  1AN8 A;  1N61 A;  3VR8 B;  2PW9 A;  4MH8 A;  1ACC A;  1VZ7 A;  4MM3 B;  4L1B A;  1OQR A;  2X38 A;  3DWG C;  4H2A A;  1FCC C;  2N0S B;  2DLB A;  1JWB D;  2WNM A;  4YWG G;  2SAK A;  1FMA D;  1P7E A;  3AEE B;  4ZRQ A;  3BK1 A;  1I4R A;  5BMH A;  2WDV B;  2FE8 A;  3AED B;  3IXS A;  2M0A A;  3IAM 1;  3P4S B;  5G5H A;  1ZPS A;  1C77 A;  2JQR B;  5BYQ A;  1B1Z A;  4A9A A;  1SE4 A;  3H8H A;  4RF0 A;  3T3O A;  1SJH D;  3ZJV A;  4KGR A;  3ZJT A;  1ZXH A;  2IGG A;  1L0X B;  1EM7 A;  2WXF A;  3R2I A;  4YTP B;  1QOG A;  1C4P A;  2INP E;  1QLB B;  4TQ0 A;  4LK0 M;  1UUP A;  3BII D;  4JPS A;  4C80 A;  2CJN A;  2K3U A;  1AYF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...