1WSPA

Crystal structure of axin dix domain
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
83
structure length
83
Chain Sequence
CDSIVVAYYFCGEPIPYRTLVRGRAVTLGQFKELLTKKGSYRYYFKKVSDEFDCGVVFEEVREDEAILPVFEEKIIGKVEKVD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Signaling protein
molecule keywords Axin 1 protein
publication title Crystal structure of axin dix domain
rcsb
source organism Rattus norvegicus
total genus 15
structure length 83
sequence length 83
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2004-11-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00778 DIX DIX domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.380 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1wspA00
2D5GA 1WSPA 3PZ8A 3PZ7A 4WIPA
chains in the Genus database with same CATH superfamily
2IYDB 4H2AA 1R7SA 2IO3B 2UWQA 5EE9A 3QCAA 2LGIA 3DBRB 3Q8CA 4RNAA 3FKYA 4I6PA 2LGXA 1N61A 3ETRA 4KVGB 3H6NA 3P42A 3HRDD 4HJGE 1GB4A 1S1QB 3A33B 1OFFA 2D3CA 5AZFA 3K9PB 2C7NB 1WR6E 4BKSA 1N63A 2GLSA 2MCNB 4G50A 2N9PC 3KUCB 2BS4B 1WR1A 4ANWA 2OOBB 1N60A 4KKJA 3HK0A 1MFWA 1FCCC 4FJYA 1NDDA 4B0MA 4YTNB 5DPWA 2AWTA 2NMQA 4Q2JA 1ZPSA 2INDC 1CQVA 3RD2A 4YTPB 2XNAC 3DVNV 4RF1A 1XLOA 2LRUA 3RCZA 2QEJC 1OQQA 3SR6A 3GE8C 5GXGB 2HTHA 2BKRB 4C4VA 4P7IA 1JWBD 4HCPB 4JL9A 2JYTA 1P0RA 1XCQL 2K6DB 2BTEA 3OAWA 4IM2A 2FCMA 2O6VB 5CTRC 1QF6A 1AARA 2MBQA 4DXFA 1F2RC 1V9JA 4R3DA 2N0SB 1N62A 2GBNA 3LB8C 4TQ1A 1XLPA 1Q5WB 4ZYNA 2CHWA 4FHKA 3GB1A 3TCAA 3RNFC 4REZA 2L05A 1E10A 1WRDB 2DAFA 4NJ6A 3NG0A 4IDIA 3EFCA 2V0GA 4TKNA 4P16A 4ZRPA 4CYEA 4UDUC 5HG2A 2LRWA 4XC2A 4B9KA 5D3IB 1WGYA 4S17A 4DHJD 4NZLB 4FBJB 2K22A 2BB5A 2PW9A 4RFBA 2NR2A 2WXGA 1VJKA 3GP7A 4C7ZA 2KZRA 3VFKA 1UZXB 3QA8A 3PTFC 3PZDA 2N7JA 2GOWA 2R2QA 4A8XC 4ACFA 2BYFA 1EO6A 1XT9B 2LHDA 2AQ3B 3ML9A 2C5LC 3BVZA 1I4RA 3JVZX 3PV1A 2LFIA 2X8XX 3AU5A 3RUIB 4KZ0A 5CHVC 4WAFA 3WAPA 1L6VA 1JQ4A 2BS2B 2CJNA 4LNOA 2IGHA 3BVGA 1JWUD 4MJSB 2EKIA 5HHDG 3R7QA 3RT3B 2ZPYA 5CX3A 3ZGZA 2KWUB 4N58A 4XDCA 2G9HD 3QIJA 4RH6A 2K6QA 1IP9A 1V8CA 1OEYJ 1R4NI 3DVGY 3VQIA 1TIFA 2V3SA 4TMAB 3V61A 1V6EA 1KRHA 2WS3B 4AUQC 2L3ZA 2HJ8A 3AU4A 2KN4A 3UQAA 3QWZB 1WMHA 5GMVA 4LK0M 1GNUA 1WGGA 2KTFA 4M00A 3PZ8A 1WGRA 3M62B 1KLVA 1Q0WB 3I3TB 4II3B 3L16A 1OEYA 4ZRIA 1WM2A 4J3OD 5MPOA 3AMZA 4XDDA 2IGGA 4PYUA 4WJOA 1UBIA 2PVOD 1NBFC 1R4MB 2DZMA 2INNE 1U4AA 5G55A 2LGSA 3C19A 3A9KA 4K7SA 5BO4B 2MX2A 4C56C 3SD5A 1V5OA 2XK5B 3T9LA 1EM7A 1JWSD 2NBWB 4JX1C 5J17A 3Q8FA 2L7RA 1QOFA 1J19A 3N1XC 2BF8B 4K7UA 2BGFA 2I1KA 2K8HA 3WAOA 1J7BA 1JCKB 5BMGA 1C3TA 2LGDA 2M17A 1J0GA 2L32A 2NPTB 3T3NA 4GIVA 5FK9C 2WYQA 1NI2A 5IO9A 2XN9C 2V3PA 2KYWA 3ZNID 1SXTA 2KWDA 2KT7A 5EE3A 1JW9D 3P1MA 4L2YA 4LNNA 4LDTB 1OQYA 1MG8A 1JROA 2LVOA 3CSFA 4JWUC 4NPNA 4BBNF 2DHZA 1F52A 2V9HA 2IO1B 2D10A 3C0RB 2E6XA 1QKZA 4A55A 2G4DB 3O65B 1MHXA 4E71A 2ZVNA 1ZUD2 1WXSA 3PPAA 1T6BX 1SSNA 5IA7A 4GMVA 2FE8A 4W9HA 2KVZA 4C80A 3A1QA 2EMSA 3VTVA 1ESFA 2FNJB 3IXSA 3QJZA 2KDFB 1KFYB 2KC2A 2LUEA 1ZDXA 4LJPB 1YN3A 1QZEA 2HDEA 3FILA 1KF6B 2IO0B 1QOBA 4LTUA 4PS8A 2VRRB 3OJ3A 4XZ4A 2KNBA 4WIPA 2DZKA 2KWVB 3N9YC 1OTRB 1B1ZA 3GOEA 4ANXA 1WX7A 4MDKE 2GMIC 4ZOHC 3EECA 2YEPB 1ZKHA 1TTNA 3V3XA 4J6IA 2QJLA 5DPSA 5LNK1 3QAQA 2BKFA 2DYMA 2ICIA 2M19A 5BMIA 2J52A 2WXIA 4EZJA 5IP4D 2KOXA 3WCQA 3A9JB 4LCDE 3KW5B 3Q8EA 3IFWB 2RD0A 2W3RA 2KTRA 2Z8LA 1HA5A 2HE7A 3CMMB 2ZNVB 3VR9B 3QARA 4FADA 3NZ3A 4HEA1 1K53A 1MHHE 3NUHB 5FR3A 3NJTA 1D6EC 4A90A 4F7ZA 1STEA 1ZW7A 1ISNA 1LM8B 2DAJA 5AZHA 3P4RB 4OZBA 3ZYYX 2N1WA 2NBUA 3BYTB 4EEWA 2K3UA 4NAMA 2RPVA 1C4CA 1R4NB 3AN1A 2O6VA 1WF9A 2JQRB 2KACA 3NRZA 2KO3A 2IBIB 2WXJA 5DCNA 2D11A 1GAQB 1E5WA 2REXA 2V3NA 5D6JB 4JIOU 4F1SA 3ABVB 2AQ1B 3VAWA 2JZ3B 1P98A 3SU8X 1XQQA 1SF0A 2L0TA 1KH0A 1I42A 3EUB2 5JXVA 1K8RB 4MT5A 3VTWA 1D4BA 3DHGC 3U30A 1E9MA 2B76B 3DVNU 4FJZA 1PQSA 1P7FA 4HK2A 1MG4A 4BAXA 4IOIE 5J2RA 4WWNA 2WXMA 2FCNA 1FO4A 4W9CA 1WX8A 4M8MA 2JSVX 3Q69A 2PMVA 3A9KB 2D5GA 2ACZB 3H1UA 4OVZA 3ZXRA 4AP4C 1P7EA 3EHVA 4MSQB 1GJZA 4HVBA 2ZJDA 2KAJA 1FIQA 2VZKB 2WDTB 3N1ZC 4AOFA 4F8CB 3NY5A 1IGDA 1S3SG 1P3QU 4RF0A 2IGDA 5E6OA 4MM3B 1C76A 1WZ0A 3Q14C 4FXCA 3NVZA 1UUPA 1CJEA 4DDID 2Y5BB 1UGJA 1VLBA 2NBVB 3DQVA 1XXGA 2GBMA 2KQ4X 3V60A 2DYBA 4MJSA 2ZPNA 3RNAC 4YWGG 1TYGB 3WIMA 3MC8A 1HTOA 3ALBA 4XYCA 1ET6A 2WDQB 1CZPA 3PLVA 3H8HA 1HTQA 1GUAB 2W82A 2J7QB 1WFYA 2AL3A 4K7WA 5TR5A 2CJOA 2J4XA 5IKCM 2JU6X 1F9JA 3B08A 3RNBC 2KXJA 2L52A 4HCNB 3RN9C 3U8ZA 4HPMB 4WQMA 4LNIA 4EOYA 2CHZA 4K3CA 4TUUA 1F0ZA 2X38A 4NJCA 3W5VB 2O2VB 2PVGC 5CHFA 4NJ7A 3EFUA 2M0XA 2OEDA 2C60A 3MJ5A 2CU3A 1UBQA 5AEKB 3ZJVA 4IM3A 2I2YA 2RPQA 3FAHA 4GLSC 3AE7B 3IHPC 3VRAB 2TSSA 2MWSB 1V81A 2BBCA 1L4DB 2XK5A 3U52E 1BT0A 3I5JC 5E6JA 5TSSA 3WAMA 1R4MI 2BWFA 4RMAA 2FIFA 4DHZE 1LFDA 2NPTA 4RM9A 4HRSA 1N5WA 1TBEA 4HPPA 2NTTA 4AJWA 3PT2B 2FUG1 2KTRB 2K5PA 3PRMB 2LVPA 2JZPA 1PGBA 3QX1A 2BS3B 2ZW1A 1V49A 2GBJA 4PK1A 1WJ4A 5IOIA 2BT6A 1SJED 1T0RC 1YJIA 4I6NB 3M95A 1BMLC 1DYQA 3IG3A 1C4AA 3ZQ4A 4ZHPA 2FIDA 2YVCA 4W9JA 3NZSA 1F1HA 1BUIC 3PZ7A 3UI3A 3MJWA 4NQKE 4RGTA 3TBLD 1E7VA 4EKUA 4PT5A 2KJHB 4ASWC 3B9JA 1WE6A 2K8BA 1DGJA 3OLMD 3UQBA 1E7UA 1ZDVA 4K1RB 1GC7A 3AEEB 2LEKA 2WXQA 3EC8A 3EGRA 4AWJA 3Q3NC 4EZKA 3CSTA 3KUDB 3AI5A 1MJDA 1UNSA 2PE9A 1ENFA 3J9CA 2A4ZA 3IBEA 4KGRA 4QAYA 4RGOS 1IBXB 2Z0EB 2LZ6A 4NNJB 3ZLZA 2N4FA 1L6UA 4W9KA 2G45B 2Z59B 3IAS1 2JY6A 1V1PB 2FCQA 1H8CA 4FULA 2AX5A 3ZVVA 3AE2B 2KMCA 3X23A 1JRUA 4MEMA 1GG3A 1G6JA 4KDIC 3VH4B 2MJ3A 2PE6B 3A9JA 3WANA 2KD0A 1SEBD 3ZKJC 2KDBA 4PS3A 2RDGA 2GBKA 1ZXIA 3PSEB 4RGNA 1T0QC 1P1AA 3TL5A 3TEWA 4DXAB 3ZNHB 5BYQA 1GB1A 1XEEA 2M56B 4IUMB 2JWZA 2NCNA 3CWIA 1E7PB 2KFJA 1IYFA 1SB3C 3R8BA 3PRPB 3K9OB 2FCSA 2MP2A 3M3JA 2ZCCA 4DHJB 4GDKB 1TJEA 1LGRA 3HM6X 3P4PB 2BB6A 2JT4B 1TS4A 3C8YA 2RDBC 4KSLC 4KSKC 4O1NA 4KGTA 3PO0A 2QMTA 1GC6A 1WZ3A 5J18A 2LXCA 2KK8A 1OGWA 4HROA 3NHEB 3T8MA 2I1JA 4OHJA 1YX6B 3IT6B 3NVWA 1KM7A 2KLGA 3NS1A 1ACCA 1TKGA 1AYFA 2IY0B 5H92C 2MA9B 3KH0A 5EDSA 1YQ3B 1SBBB 2KMAA 4ARIA 2MSED 4II2B 4IWPA 2G3QB 4XGAB 3GS2A 1ZOYB 2H88B 4US9A 3ONSA 4HXDA 3LDZE 2V4LA 3UINB 1WXAA 4YXDB 4L1BA 2PIAA 5LLIA 2OHFA 2JZZA 4MH8A 3DHIC 3W1SC 1AWDA 2MBHA 2A5UA 1JWAD 3MHZA 4W9EA 1M4VA 2WGSA 3PS6A 1GOZA 1IUEA 3OJ4B 4ARCA 4DDGD 3ML8A 3JSVB 4FLHA 2C7HA 1RM6C 4W9DA 3AB5A 3DHHC 1ET9A 4HKQA 1EWYC 2ZZPB 1GPXA 3AM9A 4MM3A 2AL6A 3VR8B 2M8SA 1V80A 3SFEB 3UF8A 3VDZA 2QCZA 4RM8A 1LXDA 1UWMA 4KIKB 4CQNA 2MJEA 2J0KA 4MGYE 4OVVA 5D7GA 3RPFC 1JRPA 2M4NA 3BK2A 2D07B 4HJKA 4YSYB 1SJHD 1PDXA 5HFYA 1KOTA 2QC8A 3X0WA 4YSXB 2C9WB 2ZEQA 1WSPA 1ZXHA 2Y5CA 2QILA 3KQ4A 3I9V1 2G4SA 2LJ5A 2L83A 1MPEA 2O2VA 4HLEA 2DWQA 1I4HA 2M1MA 1YN5A 2PEAA 3BIID 2W55A 2L00B 1E8XA 4NAWB 4WJQA 4DBGA 2LHEA 1AW7A 2KDEB 2V1YA 4MACA 1D3ZA 4P1CC 3V6CB 2INCC 3L4PA 4JLCA 3APCA 1SE3A 1EU4A 2V4IB 1C1YB 4YT0B 5AUIA 1L5PA 4YSZB 2CKHB 3L54A 4ZYSA 1V86A 4AS1A 4M02A 2WHIA 4KDLB 4IKGA 2VH1A 2KJ6A 1WYWB 4M0WB 1F2RI 2DNFA 2I38A 1K52A 2MEKA 2WXOA 3HVDA 1TS5A 1C4PA 4HDQA 3DVGX 4IC7B 1VDVA 2MBOA 3DBLI 1VCBA 3U7ZA 2XBBC 5C2TB 1NYQA 4ZDVA 2H89B 3AH7A 2WDRB 5BYRA 2MP2B 1L4ZB 3Q6BA 5IAAC 2D3GA 4MELA 4BFRA 1TKYA 1SIJA 2JRHA 3P4SB 1T3QA 1YN4A 2KHWB 1A70A 1JALA 2KQSA 1T0YA 1TZ1A 2KQ7A 1I4XA 3V05A 4DK5A 5E6PA 2KWCA 4N59A 5EE0A 4WURA 4I6LB 1Q10A 2BVCA 2J42A 3ZXVA 3KVFB 4L23A 2JPHA 2R61A 2IY1B 3GZNB 2MJDA 2JXTA 1HQRD 5FR6A 3QC8B 2IJ0A 5FKAC 4ITKA 5L83A 3AE6B 2OJWA 2BYTA 1ZP0B 2N1VA 1IBXA 1QOGA 4N9F4 3ZW3A 1L0YB 2WXKA 1TY0A 4RGMA 2ONQA 3SFDB 2ZVOA 2HJ1A 2C7MB 4JPSA 1FMAD 3NVYA 1V1PA 1BXTA 4W9GA 3I63C 5G2NA 3TEXA 3AEDB 2ASQA 3VVWB 4PS7A 1TZOA 4ANUA 2N9XA 2SAKA 1E8YA 3B1LX 1FCLA 3ZJTA 3ZDMC 4IM0A 1Z5SB 4B6WA 1PGAA 3ECIA 2JXXA 2GRIA 2MW5A 3N1YC 3Q3JA 4EE2A 3ZTCA 1VZ6A 2YEPF 1ROEA 1RRBA 1TS2A 4BOSC 1CMXB 2L1AA 4GDKA 1EUVB 2EELA 4A3OA 1E6EB 3PRZA 3O13A 3DOWA 3AE4B 2DX5B 4HKZE 1QLBB 2K39A 1UGMA 4WH4A 3ZJUA 5EE1A 3ENEA 1SGHA 2WQYB 4ICVA 2Z0DB 5HKHA 2HTME 1SE2A 4K81A 2RGFA 4KGSA 2DBYA 2WXNA 4BVUC 1RYJA 1YJJA 2ZW0A 2RSUA 4A6QA 3AXCA 2IZVB 1DOIA 2M0AA 5C3JB 3AEAB 3ZNGC 4W9LA 1QOAA 2PTLA 2DZJA 4WAAA 4MGIE 4GGQA 3APDA 3MC0B 2B3AA 1E0ZA 3IAM1 3KLSX 1TY2A 4GXBA 3TEZA 3W9CB 1E8WA 2N9EB 3R3MA 1FFVA 3VUWA 1QILA 2ON8A 4XWTA 1XLNA 1WM3A 4KKIA 5I4DA 2RMMA 1VD2A 2DYOA 4DHZB 2J53A 3ZO5B 5LXHA 3DCGA 4ICUA 2LI5A 1I7HA 3JSVA 1I35A 1LQBA 1WWTA 1TT5B 2WXPA 5HI1A 4AJYB 2IDYA 4GDLB 3DBLB 2NTSA 5LXIB 1YQ4B 4M8NA 4WQOB 3RULA 1NEKB 2INPE 1J8CA 2K8CA 2G1EA 2GBRA 2KVRA 1N5XA 2J0JA 2KJRA 2O6VD 4W9FA 3N32A 1YD8U 3L17A 3HUIA 4KIKA 4MH0E 3BYYB 3GE3C 2CS4A 3H9DA 3M63B 3T3OA 2PKOA 3IVFA 2MQJA 1J7CA 1OQRA 4JGHB 2N7DA 3ZRFA 1HXYD 2AQ2B 1HZ6A 4CHKA 1H4RA 3H7SA 3R2TA 2LGYA 3V6EB 1ZGUB 1D5XC 3DWMA 4IG7B 1WH3A 2JF5A 2WLBA 2IO2B 1EF1A 2EKEC 3AE5B 3D32A 3RZFA 1WIAA 2WXLA 4C00A 5JHBA 2CU1A 4YTMB 3SEBA 2LXAA 3UIPB 1EF5A 4BKTA 4BZAA 3KWLA 4HDOA 4NAWA 3H7PB 2WX1A 5CHWA 1VZ8A 4US8A 3KYCD 1PYWD 1KJTA 1RFKA 5C23A 4P6VF 3VHTC 5L95C 2GB1A 1WYGA 1I4PA 2N9KA 1WY8A 1N6ZA 3AEBB 3LYYA 4LJOB 1J7AA 1YOVB 3NZUA 3TMPB 4K3BA 4FA6A 4M0WA 2JUOA 3MC9A 4D2KA 4DQOC 4MSMB 1T0SC 2WP9B 3OWEB 3S2AA 3HM3A 2MBEA 1C9FA 3WA0A 4EUTA 1FNVA 3MFGA 3Q3FA 2QSDA 3R7RA 1FPYA 2N7EA 1WGDA 1YQBA 3PLUA 4YL8A 1I4GA 1IPGA 1P9DU 2DENB 3U7DA 1E8ZA 2KC1A 1UELA 3AE1B 4ZHOA 3NOBA 2L0FA 2KFKB 1MVKA 4ANVA 1FXTB 4WWPA 1TKEA 1FXIA 1WGKA 2QHOA 4TV3A 5KHOA 1XD3B 1SE9A 2BYEA 1YMHE 2JVCA 1L2NA 2BPSA 1JWMD 2W9NA 3VXWA 3RNGC 2HD5B 1FNWA 3B2FA 5IN7A 1K50A 4GOCA 3NS8A 3W2DA 2QDFA 4WWOA 1QQRA 2JYEA 3QHTA 1YX5B 1WXQA 2KKCA 2W3SA 4WJPA 2XEWA 5BYSA 1WI0A 1WGHA 4G3XB 3IT4B 4GN1A 1Y56A 4BBNC 3L0WB 3GZNI 1C79A 4BKSD 3RNCC 3PVLA 4FN2A 2D3BA 2WU2B 3N3KB 3UIOB 2E3TA 2RR9A 1KLGD 3VTUA 3Q2AC 3RI7C 2SEBD 4B95A 1C78A 4E3CA 4IWOA 1YIWA 3ZIMA 5JH5C 2D3AA 4URKA 3AV8A 2MRPA 4DXGA 2MBBB 3Q8BA 4LDTD 3A4RA 2J0MA 4A20A 1PFDA 2WXHA 4OZCA 3BZDB 2VH2A 2CHXA 4FHJA 2KANA 2K25A 4B0EA 2FUHB 4OW0A 4OZAA 5C1ZA 4PYZA 4MGZE 2ZCBA 4IWQA 1WE7A 2K0PA 5G5HA 1B9RA 2KN5A 5H8YE 1VR9A 4KX6B 4EFOA 3B2GA 3DBHI 3JW0X 4OVUA 3U2SC 2FAZA 1FM0D 1UD7A 2KDIA 1VZ7A 2GI9A 2WXFA 3KWVA 1A5RA 2YLMA 1ZE3D 3SDLC 3RZWC 1XLQA 1UH6A 3CF6E 1KLUD 3ZRCA 1EWCA 4ZRJA 3BWUD 3BY4B 4GSWA 2LMCA 1JMLA 2KDMA 1FRDA 1WXMA 3DBSA 4XX5A 4XE0A 1Z2MA 5T8IA 1L0VB 3JYUA 1XCTL 3V62A 2WX0A 4C4VB 3HVZA 3HIZA 3W1YA 1I4QA 4FJVB 2LD9A 3DDCB 3EA6A 3WALA 4E74A 3AULA 2PPHA 2RDHA 1RAXA 3RMKC 2WWZA 3TEYA 1T5XD 2DLBA 1WJNA 3HHMA 2NVUI 3AE8B 2WNMA 3TJPA 3BINA 5E6NA 3Q3MC 2QIEB 3NVVA 1Q1OA 2KMMA 3ZDTA 2NS5A 3FC4A 1PUTA 2KX3A 1NENB 3E56A 3KUZA 1LO5D 2MH7A 3SHQA 1FFUA 2WDVB 2CR5A 4CO7A 5JZEB 1WX9A 4RCOA 2LVQA 4USAA 4GDLA 1EU3A 4ZRQA 2JRIB 1FRRA 2Y3AA 4BKGA 3DBRI 1HEZE 4LNFA 4G0NB 4NQLB 1QT9A 4JQWC 4JE3B 2MLBA 1NVID 2K1FA 1IGCA 1CK1A 5AUKA 1C77A 4WJNA 3TUOA 2JWUA 1L7YA 3AE3B 2AYOB 2UYZB 5D94A 2UU7A 3VH3B 1WJUA 3N20C 2PLPA 1SE4A 4X57B 3CIRB 1KTKA 3URYA 4HPLB 5BMHA 4LLGM 1UWXA 3P63A 4TSSA 4A9AA 1SIFA 2BW2A 1M94A 3U4EG 2MHJA 3KYDD 4P1BC 2L8JA 2L76A 1MI0A 3OG5A 3W5UB 3LXFA 3VUYA 2N9LA 3DWGC 4XWWA 3R2IA 3P2BA 4BOZB 3H7PA 4AQ7A 1L0XB 3E9SA 1E90A 4KV2A 1D5MC 1HZ5A 3RYTA 2IPKD 3PREA 1TGZB 4DWFA 4A3PA 4EZLA 1XO3A 2R2OA 5DPTA 2VZKD 2OJRA 4IW0A 3RNEC 1F77A 3MTNB 4ZRKA 1FXAA 3L08A 1WMHB 1V97A 1DOXA 2KLCA 1WRIA 1NYRA 2BQQA 1DOYA 4LNKA 4MGKE 2Y5PA 2ZNVC 1D5ZC 3VUXA 1V1OA 1RFAA 5AZGA 2LUMA 3QQ8B 4G11A 4KZCA 1FNUA 4NY0A 3L13A 1HE8A 3ZTDA 3MP9A 1TS3A 3TIXA 2WU5B 3ZNZB 3DBHB 1YNTE 3BK1A 3N30A 1V2YA 3APFA 3DPDA 4M01A 3QK0A 1Y8RC 3PHWB 4HWIB 1V5TA 2LJIA 3P4QB 1UF0A 3W1SA 3Q8AA 2D2QA 2BYVE 1K51A 1AN8A 2KFKA 3Q3OC 3LJ3A 3AECB 3PHXB 2LASA 3VRBB 2LWPA 5KHQA 2Q5WD 3AEFB 4N6EB 3A4SC 2EMTA 5JHAA 4WWMA 3TSSA 1RLFA 1NI3A 3I57A 2WXRA 3AE9B 3BVMA 2DZIA 2AEHA 2K9XA 4JWSC 3RFZB 3B0AA 4C7YA 1PGXA 3R66C 4S0RA 5D3DA 1RWSA 1WJ6A 3PGEA 1VRAB 5D2MB 4TQ0A 2W54A 2KX0A 1FEHA 1WXVA 1YJ1A 5DPRA 2PJHA 3A1QB 3AEGB 2JX5A 5G5GA 2BWES 2FBWB 1XF5L 4W9IA 3MHSD 3L10B 3ZUNA 3UGBB 4GB9A 1X1MA 3FILB 4GU2A 1FD6A
chains in the Genus database with same CATH topology
4H2AA 1R7SA 1JRPA 3BK2A 1GAQB 5EE9A 2LGIA 1FNVA 2V3NA 3MFGA 3Q8CA 4RNAA 2QSDA 3ABVB 1N61A 2AQ1B 3ETRA 4YSYB 1SJHD 1PDXA 1SF0A 5HFYA 1I4GA 1KH0A 3EUB2 5JXVA 4YSXB 3P42A 3HRDD 4HJGE 4MT5A 1GB4A 1OFFA 3AE1B 1D4BA 4ZHOA 1WSPA 1ZXHA 2Y5CA 2QILA 3KQ4A 1E9MA 2B76B 3I9V1 1MVKA 1P7FA 1N63A 2L83A 1MPEA 1TKEA 1FXIA 2DWQA 1WGKA 2BS4B 4IOIE 1N60A 1I4HA 2WXMA 1FO4A 1YN5A 4KKJA 1YMHE 3BIID 1FCCC 2W55A 4B0MA 4YTNB 1JWMD 4NAWB 2NMQA 1FNWA 2JSVX 4Q2JA 1ZPSA 2LHEA 3Q69A 2PMVA 3B2FA 1AW7A 1CQVA 4MACA 4YTPB 1K50A 2ACZB 2D5GA 2XNAC 4OVZA 3L4PA 3W2DA 1P7EA 1QQRA 1SE3A 4RF1A 2JYEA 1EU4A 2KAJA 1WXQA 2V4IB 1FIQA 4YT0B 1XLOA 2VZKB 2QEJC 5AUIA 1L5PA 1OQQA 1IGDA 3SR6A 2W3SA 5GXGB 5BYSA 4YSZB 4RF0A 2IGDA 4ZYSA 3IT4B 1Y56A 4MM3B 4AS1A 1C76A 1JWBD 1C79A 4FXCA 2JYTA 3NVZA 1UUPA 1CJEA 4IKGA 1XCQL 2BTEA 2WU2B 2E3TA 1KLGD 1F2RI 1UGJA 2I38A 2SEBD 1K52A 1QF6A 1C78A 1VLBA 1XXGA 2MEKA 4DXFA 1F2RC 2KQ4X 2WXOA 4R3DA 2N0SB 1N62A 3AV8A 3HVDA 4DXGA 1TS5A 3LB8C 4TQ1A 1C4PA 3Q8BA 1XLPA 4YWGG 1TYGB 1VDVA 3GB1A 3U7ZA 1PFDA 1ET6A 2WXHA 4OZCA 3BZDB 4REZA 2WDQB 1CZPA 5C2TB 1NYQA 3H8HA 2H89B 3AH7A 2WDRB 1E10A 4B0EA 2W82A 4OW0A 4OZAA 5BYRA 4IDIA 1L4ZB 2CJOA 2V0GA 2J4XA 2JU6X 4P16A 1TKYA 4ZRPA 2K0PA 2L52A 4UDUC 5HG2A 1SIJA 3P4SB 4WQMA 5G5HA 1B9RA 1T3QA 1YN4A 1A70A 2X38A 1JALA 4NJCA 5H8YE 3W5VB 1F0ZA 1VR9A 5D3IB 4KX6B 2PVGC 1I4XA 4NZLB 3V05A 3B2GA 2K22A 2BB5A 2PW9A 4N59A 2OEDA 4RFBA 4WURA 5EE0A 3U2SC 1Q10A 2WXGA 2J42A 1FM0D 2WXFA 1VZ7A 2GI9A 3KWVA 3MJ5A 1VJKA 3GP7A 2CU3A 3ZJVA 4C7ZA 4L23A 2R61A 2I2YA 2MJDA 2JXTA 1HQRD 1ZE3D 3FAHA 2IJ0A 5FKAC 1XLQA 4ITKA 4GLSC 1KLUD 3AE7B 3VRAB 2TSSA 1EWCA 3AE6B 2BBCA 3BWUD 1L4DB 2N7JA 2BYTA 2LMCA 1JMLA 2KDMA 1ZP0B 4A8XC 1FRDA 3U52E 1QOGA 1IBXA 1L0YB 2WXKA 4XE0A 5T8IA 1TY0A 1L0VB 4RGMA 5E6JA 1XCTL 5TSSA 2ONQA 3HVZA 2LHDA 2AQ3B 3SFDB 3BVZA 4JPSA 1FMAD 3NVYA 1V1PA 1I4RA 1BXTA 1I4QA 4HRSA 1N5WA 2LFIA 3EA6A 2NTTA 2RDHA 3TEXA 3AEDB 2FUG1 4WAFA 1L6VA 2K5PA 1JQ4A 1TZOA 2BS2B 2CJNA 2JZPA 2IGHA 3BVGA 1JWUD 2SAKA 3TEYA 2EKIA 1T5XD 1PGBA 5HHDG 2DLBA 2BS3B 3AE8B 2ZW1A 2WNMA 1FCLA 2BT6A 1SJED 1YJIA 2QIEB 3NVVA 2KMMA 3ZJTA 3FC4A 3ZGZA 4N58A 4XDCA 2G9HD 1BMLC 1PUTA 1DYQA 1PGAA 4RH6A 1V8CA 1NENB 3VQIA 1C4AA 3E56A 2GRIA 3ZQ4A 4ZHPA 4TMAB 1KRHA 1LO5D 2WS3B 2MH7A 4EE2A 1VZ6A 1FFUA 2WDVB 2YEPF 1BUIC 3PZ7A 1ROEA 3UI3A 2KN4A 4RCOA 4RGTA 4USAA 1EU3A 1TS2A 4LK0M 2L1AA 4ZRQA 2EELA 1FRRA 2Y3AA 3PZ8A 4PT5A 1E6EB 1HEZE 3O13A 3AE4B 3B9JA 4HKZE 1QLBB 1DGJA 1QT9A 4J3OD 5MPOA 3AMZA 4XDDA 1ZDVA 4WH4A 2IGGA 3ZJUA 3AEEB 4JE3B 1NVID 2LEKA 5EE1A 2WQYB 1IGCA 1CK1A 2PVOD 2WXQA 1C77A 5AUKA 2HTME 1SE2A 3EGRA 2INNE 4KGSA 3TUOA 2JWUA 2DBYA 2WXNA 3AE3B 1UNSA 3J9CA 1ENFA 1RYJA 1YJJA 2ZW0A 4KGRA 4C56C 2PLPA 1SE4A 4RGOS 4A6QA 1IBXB 1EM7A 1JWSD 3CIRB 1DOIA 1KTKA 2M0AA 4JX1C 3URYA 3AEAB 3Q8FA 5C3JB 1QOFA 5BMHA 1QOAA 2PTLA 4LLGM 1J7BA 1UWXA 3P63A 4TSSA 4A9AA 1JCKB 1L6UA 5BMGA 3IAS1 1V1PB 2L32A 3MC0B 3T3NA 2AX5A 2BW2A 1E0ZA 3AE2B 3IAM1 3KLSX 1TY2A 5FK9C 3TEZA 2XN9C 3U4EG 3W9CB 2V3PA 2MJ3A 1SXTA 2KWDA 5EE3A 1JW9D 1MI0A 3P1MA 4L2YA 3LXFA 3W5UB 1SEBD 1FFVA 2N9LA 3DWGC 4XWWA 3R2IA 2RDGA 1ZXIA 1QILA 2ON8A 1JROA 4JWUC 4XWTA 1XLNA 4RGNA 4KKIA 5I4DA 3TEWA 4AQ7A 2RMMA 1L0XB 2DYOA 3E9SA 5BYQA 2J53A 2E6XA 1QKZA 4A55A 1GB1A 1D5MC 1HZ5A 1MHXA 1XEEA 2IPKD 1ZUD2 2M56B 1T6BX 1I7HA 1E7PB 1SSNA 3CWIA 1SB3C 1WWTA 1XO3A 3R8BA 2FE8A 2VZKD 2WXPA 1F77A 5HI1A 2IDYA 1FXAA 1V97A 4GDLB 2NTSA 1YQ4B 1DOXA 4C80A 4GDKB 1NEKB 1TJEA 1NYRA 1WRIA 1ESFA 1DOYA 2INPE 2Y5PA 3P4PB 2G1EA 2BB6A 1TS4A 3C8YA 3IXSA 1D5ZC 1N5XA 1V1OA 1KFYB 1ZDXA 4O1NA 2LUMA 4KGTA 1YN3A 3HUIA 3PO0A 2QMTA 3BYYB 1FNUA 2HDEA 3FILA 1KF6B 1QOBA 4LTUA 3T3OA 2PKOA 3MP9A 1TS3A 4HROA 1J7CA 2WU5B 4WIPA 1OQRA 4OHJA 3N9YC 3IT6B 3NVWA 1YNTE 1B1ZA 3BK1A 1HXYD 3NS1A 1ACCA 1TKGA 1AYFA 2AQ2B 5H92C 4ZOHC 2YEPB 1YQ3B 1SBBB 2LJIA 3P4QB 3W1SA 1HZ6A 3V3XA 3Q8AA 4ARIA 2QJLA 3R2TA 5LNK1 1K51A 1D5XC 1AN8A 3DWMA 2WLBA 3AECB 2DYMA 2ICIA 2M19A 5BMIA 2J52A 3VRBB 2WXIA 3GS2A 1ZOYB 2H88B 2Q5WD 3AE5B 3AEFB 4US9A 2WXLA 4N6EB 3WCQA 3Q8EA 4YXDB 3SEBA 4YTMB 4WWMA 4L1BA 3TSSA 2PIAA 2W3RA 3KWLA 1NI3A 2OHFA 2Z8LA 3I57A 1HA5A 4MH8A 2WXRA 1AWDA 3AE9B 1VZ8A 3BVMA 3VR9B 4US8A 3NZ3A 4JWSC 2K9XA 1JWAD 3RFZB 3MHZA 4HEA1 1K53A 1M4VA 1MHHE 3NUHB 5FR3A 1PYWD 1D6EC 1RFKA 4A90A 4C7YA 4P6VF 1GOZA 1IUEA 1PGXA 4ARCA 1STEA 2GB1A 1WYGA 5D3DA 1I4PA 1RWSA 1RM6C 2N9KA 3P4RB 4OZBA 3AB5A 1ET9A 1VRAB 3ZYYX 4HKQA 1EWYC 3AEBB 4TQ0A 3AM9A 1GPXA 3LYYA 2W54A 3BYTB 1J7AA 3VR8B 1FEHA 2K3UA 4NAMA 2RPVA 3AEGB 1C4CA 3SFEB 2JX5A 5G5GA 3AN1A 4M0WA 2JQRB 2FBWB 1XF5L 1UWMA 2KACA 3NRZA 4D2KA 4DQOC 2WXJA 4CQNA 2MJEA 5D7GA 2WP9B 3OWEB 3FILB 1FD6A 1C9FA 3RPFC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2D5G A;  1WSP A;  3PZ8 A;  3PZ7 A;  4WIP A; 
#chains in the Genus database with same CATH topology
 2IYD B;  4H2A A;  1R7S A;  2IO3 B;  2UWQ A;  5EE9 A;  3QCA A;  2LGI A;  3DBR B;  3Q8C A;  4RNA A;  3FKY A;  4I6P A;  2LGX A;  1N61 A;  3ETR A;  4KVG B;  3H6N A;  3P42 A;  3HRD D;  4HJG E;  1GB4 A;  1S1Q B;  3A33 B;  1OFF A;  2D3C A;  5AZF A;  3K9P B;  2C7N B;  1WR6 E;  4BKS A;  1N63 A;  2GLS A;  2MCN B;  4G50 A;  2N9P C;  3KUC B;  2BS4 B;  1WR1 A;  4ANW A;  2OOB B;  1N60 A;  4KKJ A;  3HK0 A;  1MFW A;  1FCC C;  4FJY A;  1NDD A;  4B0M A;  4YTN B;  5DPW A;  2AWT A;  2NMQ A;  4Q2J A;  1ZPS A;  2IND C;  1CQV A;  3RD2 A;  4YTP B;  2XNA C;  3DVN V;  4RF1 A;  1XLO A;  2LRU A;  3RCZ A;  2QEJ C;  1OQQ A;  3SR6 A;  3GE8 C;  5GXG B;  2HTH A;  2BKR B;  4C4V A;  4P7I A;  1JWB D;  4HCP B;  4JL9 A;  2JYT A;  1P0R A;  1XCQ L;  2K6D B;  2BTE A;  3OAW A;  4IM2 A;  2FCM A;  2O6V B;  5CTR C;  1QF6 A;  1AAR A;  2MBQ A;  4DXF A;  1F2R C;  1V9J A;  4R3D A;  2N0S B;  1N62 A;  2GBN A;  3LB8 C;  4TQ1 A;  1XLP A;  1Q5W B;  4ZYN A;  2CHW A;  4FHK A;  3GB1 A;  3TCA A;  3RNF C;  4REZ A;  2L05 A;  1E10 A;  1WRD B;  2DAF A;  4NJ6 A;  3NG0 A;  4IDI A;  3EFC A;  2V0G A;  4TKN A;  4P16 A;  4ZRP A;  4CYE A;  4UDU C;  5HG2 A;  2LRW A;  4XC2 A;  4B9K A;  5D3I B;  1WGY A;  4S17 A;  4DHJ D;  4NZL B;  4FBJ B;  2K22 A;  2BB5 A;  2PW9 A;  4RFB A;  2NR2 A;  2WXG A;  1VJK A;  3GP7 A;  4C7Z A;  2KZR A;  3VFK A;  1UZX B;  3QA8 A;  3PTF C;  3PZD A;  2N7J A;  2GOW A;  2R2Q A;  4A8X C;  4ACF A;  2BYF A;  1EO6 A;  1XT9 B;  2LHD A;  2AQ3 B;  3ML9 A;  2C5L C;  3BVZ A;  1I4R A;  3JVZ X;  3PV1 A;  2LFI A;  2X8X X;  3AU5 A;  3RUI B;  4KZ0 A;  5CHV C;  4WAF A;  3WAP A;  1L6V A;  1JQ4 A;  2BS2 B;  2CJN A;  4LNO A;  2IGH A;  3BVG A;  1JWU D;  4MJS B;  2EKI A;  5HHD G;  3R7Q A;  3RT3 B;  2ZPY A;  5CX3 A;  3ZGZ A;  2KWU B;  4N58 A;  4XDC A;  2G9H D;  3QIJ A;  4RH6 A;  2K6Q A;  1IP9 A;  1V8C A;  1OEY J;  1R4N I;  3DVG Y;  3VQI A;  1TIF A;  2V3S A;  4TMA B;  3V61 A;  1V6E A;  1KRH A;  2WS3 B;  4AUQ C;  2L3Z A;  2HJ8 A;  3AU4 A;  2KN4 A;  3UQA A;  3QWZ B;  1WMH A;  5GMV A;  4LK0 M;  1GNU A;  1WGG A;  2KTF A;  4M00 A;  3PZ8 A;  1WGR A;  3M62 B;  1KLV A;  1Q0W B;  3I3T B;  4II3 B;  3L16 A;  1OEY A;  4ZRI A;  1WM2 A;  4J3O D;  5MPO A;  3AMZ A;  4XDD A;  2IGG A;  4PYU A;  4WJO A;  1UBI A;  2PVO D;  1NBF C;  1R4M B;  2DZM A;  2INN E;  1U4A A;  5G55 A;  2LGS A;  3C19 A;  3A9K A;  4K7S A;  5BO4 B;  2MX2 A;  4C56 C;  3SD5 A;  1V5O A;  2XK5 B;  3T9L A;  1EM7 A;  1JWS D;  2NBW B;  4JX1 C;  5J17 A;  3Q8F A;  2L7R A;  1QOF A;  1J19 A;  3N1X C;  2BF8 B;  4K7U A;  2BGF A;  2I1K A;  2K8H A;  3WAO A;  1J7B A;  1JCK B;  5BMG A;  1C3T A;  2LGD A;  2M17 A;  1J0G A;  2L32 A;  2NPT B;  3T3N A;  4GIV A;  5FK9 C;  2WYQ A;  1NI2 A;  5IO9 A;  2XN9 C;  2V3P A;  2KYW A;  3ZNI D;  1SXT A;  2KWD A;  2KT7 A;  5EE3 A;  1JW9 D;  3P1M A;  4L2Y A;  4LNN A;  4LDT B;  1OQY A;  1MG8 A;  1JRO A;  2LVO A;  3CSF A;  4JWU C;  4NPN A;  4BBN F;  2DHZ A;  1F52 A;  2V9H A;  2IO1 B;  2D10 A;  3C0R B;  2E6X A;  1QKZ A;  4A55 A;  2G4D B;  3O65 B;  1MHX A;  4E71 A;  2ZVN A;  1ZUD 2;  1WXS A;  3PPA A;  1T6B X;  1SSN A;  5IA7 A;  4GMV A;  2FE8 A;  4W9H A;  2KVZ A;  4C80 A;  3A1Q A;  2EMS A;  3VTV A;  1ESF A;  2FNJ B;  3IXS A;  3QJZ A;  2KDF B;  1KFY B;  2KC2 A;  2LUE A;  1ZDX A;  4LJP B;  1YN3 A;  1QZE A;  2HDE A;  3FIL A;  1KF6 B;  2IO0 B;  1QOB A;  4LTU A;  4PS8 A;  2VRR B;  3OJ3 A;  4XZ4 A;  2KNB A;  4WIP A;  2DZK A;  2KWV B;  3N9Y C;  1OTR B;  1B1Z A;  3GOE A;  4ANX A;  1WX7 A;  4MDK E;  2GMI C;  4ZOH C;  3EEC A;  2YEP B;  1ZKH A;  1TTN A;  3V3X A;  4J6I A;  2QJL A;  5DPS A;  5LNK 1;  3QAQ A;  2BKF A;  2DYM A;  2ICI A;  2M19 A;  5BMI A;  2J52 A;  2WXI A;  4EZJ A;  5IP4 D;  2KOX A;  3WCQ A;  3A9J B;  4LCD E;  3KW5 B;  3Q8E A;  3IFW B;  2RD0 A;  2W3R A;  2KTR A;  2Z8L A;  1HA5 A;  2HE7 A;  3CMM B;  2ZNV B;  3VR9 B;  3QAR A;  4FAD A;  3NZ3 A;  4HEA 1;  1K53 A;  1MHH E;  3NUH B;  5FR3 A;  3NJT A;  1D6E C;  4A90 A;  4F7Z A;  1STE A;  1ZW7 A;  1ISN A;  1LM8 B;  2DAJ A;  5AZH A;  3P4R B;  4OZB A;  3ZYY X;  2N1W A;  2NBU A;  3BYT B;  4EEW A;  2K3U A;  4NAM A;  2RPV A;  1C4C A;  1R4N B;  3AN1 A;  2O6V A;  1WF9 A;  2JQR B;  2KAC A;  3NRZ A;  2KO3 A;  2IBI B;  2WXJ A;  5DCN A;  2D11 A;  1GAQ B;  1E5W A;  2REX A;  2V3N A;  5D6J B;  4JIO U;  4F1S A;  3ABV B;  2AQ1 B;  3VAW A;  2JZ3 B;  1P98 A;  3SU8 X;  1XQQ A;  1SF0 A;  2L0T A;  1KH0 A;  1I42 A;  3EUB 2;  5JXV A;  1K8R B;  4MT5 A;  3VTW A;  1D4B A;  3DHG C;  3U30 A;  1E9M A;  2B76 B;  3DVN U;  4FJZ A;  1PQS A;  1P7F A;  4HK2 A;  1MG4 A;  4BAX A;  4IOI E;  5J2R A;  4WWN A;  2WXM A;  2FCN A;  1FO4 A;  4W9C A;  1WX8 A;  4M8M A;  2JSV X;  3Q69 A;  2PMV A;  3A9K B;  2D5G A;  2ACZ B;  3H1U A;  4OVZ A;  3ZXR A;  4AP4 C;  1P7E A;  3EHV A;  4MSQ B;  1GJZ A;  4HVB A;  2ZJD A;  2KAJ A;  1FIQ A;  2VZK B;  2WDT B;  3N1Z C;  4AOF A;  4F8C B;  3NY5 A;  1IGD A;  1S3S G;  1P3Q U;  4RF0 A;  2IGD A;  5E6O A;  4MM3 B;  1C76 A;  1WZ0 A;  3Q14 C;  4FXC A;  3NVZ A;  1UUP A;  1CJE A;  4DDI D;  2Y5B B;  1UGJ A;  1VLB A;  2NBV B;  3DQV A;  1XXG A;  2GBM A;  2KQ4 X;  3V60 A;  2DYB A;  4MJS A;  2ZPN A;  3RNA C;  4YWG G;  1TYG B;  3WIM A;  3MC8 A;  1HTO A;  3ALB A;  4XYC A;  1ET6 A;  2WDQ B;  1CZP A;  3PLV A;  3H8H A;  1HTQ A;  1GUA B;  2W82 A;  2J7Q B;  1WFY A;  2AL3 A;  4K7W A;  5TR5 A;  2CJO A;  2J4X A;  5IKC M;  2JU6 X;  1F9J A;  3B08 A;  3RNB C;  2KXJ A;  2L52 A;  4HCN B;  3RN9 C;  3U8Z A;  4HPM B;  4WQM A;  4LNI A;  4EOY A;  2CHZ A;  4K3C A;  4TUU A;  1F0Z A;  2X38 A;  4NJC A;  3W5V B;  2O2V B;  2PVG C;  5CHF A;  4NJ7 A;  3EFU A;  2M0X A;  2OED A;  2C60 A;  3MJ5 A;  2CU3 A;  1UBQ A;  5AEK B;  3ZJV A;  4IM3 A;  2I2Y A;  2RPQ A;  3FAH A;  4GLS C;  3AE7 B;  3IHP C;  3VRA B;  2TSS A;  2MWS B;  1V81 A;  2BBC A;  1L4D B;  2XK5 A;  3U52 E;  1BT0 A;  3I5J C;  5E6J A;  5TSS A;  3WAM A;  1R4M I;  2BWF A;  4RMA A;  2FIF A;  4DHZ E;  1LFD A;  2NPT A;  4RM9 A;  4HRS A;  1N5W A;  1TBE A;  4HPP A;  2NTT A;  4AJW A;  3PT2 B;  2FUG 1;  2KTR B;  2K5P A;  3PRM B;  2LVP A;  2JZP A;  1PGB A;  3QX1 A;  2BS3 B;  2ZW1 A;  1V49 A;  2GBJ A;  4PK1 A;  1WJ4 A;  5IOI A;  2BT6 A;  1SJE D;  1T0R C;  1YJI A;  4I6N B;  3M95 A;  1BML C;  1DYQ A;  3IG3 A;  1C4A A;  3ZQ4 A;  4ZHP A;  2FID A;  2YVC A;  4W9J A;  3NZS A;  1F1H A;  1BUI C;  3PZ7 A;  3UI3 A;  3MJW A;  4NQK E;  4RGT A;  3TBL D;  1E7V A;  4EKU A;  4PT5 A;  2KJH B;  4ASW C;  3B9J A;  1WE6 A;  2K8B A;  1DGJ A;  3OLM D;  3UQB A;  1E7U A;  1ZDV A;  4K1R B;  1GC7 A;  3AEE B;  2LEK A;  2WXQ A;  3EC8 A;  3EGR A;  4AWJ A;  3Q3N C;  4EZK A;  3CST A;  3KUD B;  3AI5 A;  1MJD A;  1UNS A;  2PE9 A;  1ENF A;  3J9C A;  2A4Z A;  3IBE A;  4KGR A;  4QAY A;  4RGO S;  1IBX B;  2Z0E B;  2LZ6 A;  4NNJ B;  3ZLZ A;  2N4F A;  1L6U A;  4W9K A;  2G45 B;  2Z59 B;  3IAS 1;  2JY6 A;  1V1P B;  2FCQ A;  1H8C A;  4FUL A;  2AX5 A;  3ZVV A;  3AE2 B;  2KMC A;  3X23 A;  1JRU A;  4MEM A;  1GG3 A;  1G6J A;  4KDI C;  3VH4 B;  2MJ3 A;  2PE6 B;  3A9J A;  3WAN A;  2KD0 A;  1SEB D;  3ZKJ C;  2KDB A;  4PS3 A;  2RDG A;  2GBK A;  1ZXI A;  3PSE B;  4RGN A;  1T0Q C;  1P1A A;  3TL5 A;  3TEW A;  4DXA B;  3ZNH B;  5BYQ A;  1GB1 A;  1XEE A;  2M56 B;  4IUM B;  2JWZ A;  2NCN A;  3CWI A;  1E7P B;  2KFJ A;  1IYF A;  1SB3 C;  3R8B A;  3PRP B;  3K9O B;  2FCS A;  2MP2 A;  3M3J A;  2ZCC A;  4DHJ B;  4GDK B;  1TJE A;  1LGR A;  3HM6 X;  3P4P B;  2BB6 A;  2JT4 B;  1TS4 A;  3C8Y A;  2RDB C;  4KSL C;  4KSK C;  4O1N A;  4KGT A;  3PO0 A;  2QMT A;  1GC6 A;  1WZ3 A;  5J18 A;  2LXC A;  2KK8 A;  1OGW A;  4HRO A;  3NHE B;  3T8M A;  2I1J A;  4OHJ A;  1YX6 B;  3IT6 B;  3NVW A;  1KM7 A;  2KLG A;  3NS1 A;  1ACC A;  1TKG A;  1AYF A;  2IY0 B;  5H92 C;  2MA9 B;  3KH0 A;  5EDS A;  1YQ3 B;  1SBB B;  2KMA A;  4ARI A;  2MSE D;  4II2 B;  4IWP A;  2G3Q B;  4XGA B;  3GS2 A;  1ZOY B;  2H88 B;  4US9 A;  3ONS A;  4HXD A;  3LDZ E;  2V4L A;  3UIN B;  1WXA A;  4YXD B;  4L1B A;  2PIA A;  5LLI A;  2OHF A;  2JZZ A;  4MH8 A;  3DHI C;  3W1S C;  1AWD A;  2MBH A;  2A5U A;  1JWA D;  3MHZ A;  4W9E A;  1M4V A;  2WGS A;  3PS6 A;  1GOZ A;  1IUE A;  3OJ4 B;  4ARC A;  4DDG D;  3ML8 A;  3JSV B;  4FLH A;  2C7H A;  1RM6 C;  4W9D A;  3AB5 A;  3DHH C;  1ET9 A;  4HKQ A;  1EWY C;  2ZZP B;  1GPX A;  3AM9 A;  4MM3 A;  2AL6 A;  3VR8 B;  2M8S A;  1V80 A;  3SFE B;  3UF8 A;  3VDZ A;  2QCZ A;  4RM8 A;  1LXD A;  1UWM A;  4KIK B;  4CQN A;  2MJE A;  2J0K A;  4MGY E;  4OVV A;  5D7G A;  3RPF C;  1JRP A;  2M4N A;  3BK2 A;  2D07 B;  4HJK A;  4YSY B;  1SJH D;  1PDX A;  5HFY A;  1KOT A;  2QC8 A;  3X0W A;  4YSX B;  2C9W B;  2ZEQ A;  1WSP A;  1ZXH A;  2Y5C A;  2QIL A;  3KQ4 A;  3I9V 1;  2G4S A;  2LJ5 A;  2L83 A;  1MPE A;  2O2V A;  4HLE A;  2DWQ A;  1I4H A;  2M1M A;  1YN5 A;  2PEA A;  3BII D;  2W55 A;  2L00 B;  1E8X A;  4NAW B;  4WJQ A;  4DBG A;  2LHE A;  1AW7 A;  2KDE B;  2V1Y A;  4MAC A;  1D3Z A;  4P1C C;  3V6C B;  2INC C;  3L4P A;  4JLC A;  3APC A;  1SE3 A;  1EU4 A;  2V4I B;  1C1Y B;  4YT0 B;  5AUI A;  1L5P A;  4YSZ B;  2CKH B;  3L54 A;  4ZYS A;  1V86 A;  4AS1 A;  4M02 A;  2WHI A;  4KDL B;  4IKG A;  2VH1 A;  2KJ6 A;  1WYW B;  4M0W B;  1F2R I;  2DNF A;  2I38 A;  1K52 A;  2MEK A;  2WXO A;  3HVD A;  1TS5 A;  1C4P A;  4HDQ A;  3DVG X;  4IC7 B;  1VDV A;  2MBO A;  3DBL I;  1VCB A;  3U7Z A;  2XBB C;  5C2T B;  1NYQ A;  4ZDV A;  2H89 B;  3AH7 A;  2WDR B;  5BYR A;  2MP2 B;  1L4Z B;  3Q6B A;  5IAA C;  2D3G A;  4MEL A;  4BFR A;  1TKY A;  1SIJ A;  2JRH A;  3P4S B;  1T3Q A;  1YN4 A;  2KHW B;  1A70 A;  1JAL A;  2KQS A;  1T0Y A;  1TZ1 A;  2KQ7 A;  1I4X A;  3V05 A;  4DK5 A;  5E6P A;  2KWC A;  4N59 A;  5EE0 A;  4WUR A;  4I6L B;  1Q10 A;  2BVC A;  2J42 A;  3ZXV A;  3KVF B;  4L23 A;  2JPH A;  2R61 A;  2IY1 B;  3GZN B;  2MJD A;  2JXT A;  1HQR D;  5FR6 A;  3QC8 B;  2IJ0 A;  5FKA C;  4ITK A;  5L83 A;  3AE6 B;  2OJW A;  2BYT A;  1ZP0 B;  2N1V A;  1IBX A;  1QOG A;  4N9F 4;  3ZW3 A;  1L0Y B;  2WXK A;  1TY0 A;  4RGM A;  2ONQ A;  3SFD B;  2ZVO A;  2HJ1 A;  2C7M B;  4JPS A;  1FMA D;  3NVY A;  1V1P A;  1BXT A;  4W9G A;  3I63 C;  5G2N A;  3TEX A;  3AED B;  2ASQ A;  3VVW B;  4PS7 A;  1TZO A;  4ANU A;  2N9X A;  2SAK A;  1E8Y A;  3B1L X;  1FCL A;  3ZJT A;  3ZDM C;  4IM0 A;  1Z5S B;  4B6W A;  1PGA A;  3ECI A;  2JXX A;  2GRI A;  2MW5 A;  3N1Y C;  3Q3J A;  4EE2 A;  3ZTC A;  1VZ6 A;  2YEP F;  1ROE A;  1RRB A;  1TS2 A;  4BOS C;  1CMX B;  2L1A A;  4GDK A;  1EUV B;  2EEL A;  4A3O A;  1E6E B;  3PRZ A;  3O13 A;  3DOW A;  3AE4 B;  2DX5 B;  4HKZ E;  1QLB B;  2K39 A;  1UGM A;  4WH4 A;  3ZJU A;  5EE1 A;  3ENE A;  1SGH A;  2WQY B;  4ICV A;  2Z0D B;  5HKH A;  2HTM E;  1SE2 A;  4K81 A;  2RGF A;  4KGS A;  2DBY A;  2WXN A;  4BVU C;  1RYJ A;  1YJJ A;  2ZW0 A;  2RSU A;  4A6Q A;  3AXC A;  2IZV B;  1DOI A;  2M0A A;  5C3J B;  3AEA B;  3ZNG C;  4W9L A;  1QOA A;  2PTL A;  2DZJ A;  4WAA A;  4MGI E;  4GGQ A;  3APD A;  3MC0 B;  2B3A A;  1E0Z A;  3IAM 1;  3KLS X;  1TY2 A;  4GXB A;  3TEZ A;  3W9C B;  1E8W A;  2N9E B;  3R3M A;  1FFV A;  3VUW A;  1QIL A;  2ON8 A;  4XWT A;  1XLN A;  1WM3 A;  4KKI A;  5I4D A;  2RMM A;  1VD2 A;  2DYO A;  4DHZ B;  2J53 A;  3ZO5 B;  5LXH A;  3DCG A;  4ICU A;  2LI5 A;  1I7H A;  3JSV A;  1I35 A;  1LQB A;  1WWT A;  1TT5 B;  2WXP A;  5HI1 A;  4AJY B;  2IDY A;  4GDL B;  3DBL B;  2NTS A;  5LXI B;  1YQ4 B;  4M8N A;  4WQO B;  3RUL A;  1NEK B;  2INP E;  1J8C A;  2K8C A;  2G1E A;  2GBR A;  2KVR A;  1N5X A;  2J0J A;  2KJR A;  2O6V D;  4W9F A;  3N32 A;  1YD8 U;  3L17 A;  3HUI A;  4KIK A;  4MH0 E;  3BYY B;  3GE3 C;  2CS4 A;  3H9D A;  3M63 B;  3T3O A;  2PKO A;  3IVF A;  2MQJ A;  1J7C A;  1OQR A;  4JGH B;  2N7D A;  3ZRF A;  1HXY D;  2AQ2 B;  1HZ6 A;  4CHK A;  1H4R A;  3H7S A;  3R2T A;  2LGY A;  3V6E B;  1ZGU B;  1D5X C;  3DWM A;  4IG7 B;  1WH3 A;  2JF5 A;  2WLB A;  2IO2 B;  1EF1 A;  2EKE C;  3AE5 B;  3D32 A;  3RZF A;  1WIA A;  2WXL A;  4C00 A;  5JHB A;  2CU1 A;  4YTM B;  3SEB A;  2LXA A;  3UIP B;  1EF5 A;  4BKT A;  4BZA A;  3KWL A;  4HDO A;  4NAW A;  3H7P B;  2WX1 A;  5CHW A;  1VZ8 A;  4US8 A;  3KYC D;  1PYW D;  1KJT A;  1RFK A;  5C23 A;  4P6V F;  3VHT C;  5L95 C;  2GB1 A;  1WYG A;  1I4P A;  2N9K A;  1WY8 A;  1N6Z A;  3AEB B;  3LYY A;  4LJO B;  1J7A A;  1YOV B;  3NZU A;  3TMP B;  4K3B A;  4FA6 A;  4M0W A;  2JUO A;  3MC9 A;  4D2K A;  4DQO C;  4MSM B;  1T0S C;  2WP9 B;  3OWE B;  3S2A A;  3HM3 A;  2MBE A;  1C9F A;  3WA0 A;  4EUT A;  1FNV A;  3MFG A;  3Q3F A;  2QSD A;  3R7R A;  1FPY A;  2N7E A;  1WGD A;  1YQB A;  3PLU A;  4YL8 A;  1I4G A;  1IPG A;  1P9D U;  2DEN B;  3U7D A;  1E8Z A;  2KC1 A;  1UEL A;  3AE1 B;  4ZHO A;  3NOB A;  2L0F A;  2KFK B;  1MVK A;  4ANV A;  1FXT B;  4WWP A;  1TKE A;  1FXI A;  1WGK A;  2QHO A;  4TV3 A;  5KHO A;  1XD3 B;  1SE9 A;  2BYE A;  1YMH E;  2JVC A;  1L2N A;  2BPS A;  1JWM D;  2W9N A;  3VXW A;  3RNG C;  2HD5 B;  1FNW A;  3B2F A;  5IN7 A;  1K50 A;  4GOC A;  3NS8 A;  3W2D A;  2QDF A;  4WWO A;  1QQR A;  2JYE A;  3QHT A;  1YX5 B;  1WXQ A;  2KKC A;  2W3S A;  4WJP A;  2XEW A;  5BYS A;  1WI0 A;  1WGH A;  4G3X B;  3IT4 B;  4GN1 A;  1Y56 A;  4BBN C;  3L0W B;  3GZN I;  1C79 A;  4BKS D;  3RNC C;  3PVL A;  4FN2 A;  2D3B A;  2WU2 B;  3N3K B;  3UIO B;  2E3T A;  2RR9 A;  1KLG D;  3VTU A;  3Q2A C;  3RI7 C;  2SEB D;  4B95 A;  1C78 A;  4E3C A;  4IWO A;  1YIW A;  3ZIM A;  5JH5 C;  2D3A A;  4URK A;  3AV8 A;  2MRP A;  4DXG A;  2MBB B;  3Q8B A;  4LDT D;  3A4R A;  2J0M A;  4A20 A;  1PFD A;  2WXH A;  4OZC A;  3BZD B;  2VH2 A;  2CHX A;  4FHJ A;  2KAN A;  2K25 A;  4B0E A;  2FUH B;  4OW0 A;  4OZA A;  5C1Z A;  4PYZ A;  4MGZ E;  2ZCB A;  4IWQ A;  1WE7 A;  2K0P A;  5G5H A;  1B9R A;  2KN5 A;  5H8Y E;  1VR9 A;  4KX6 B;  4EFO A;  3B2G A;  3DBH I;  3JW0 X;  4OVU A;  3U2S C;  2FAZ A;  1FM0 D;  1UD7 A;  2KDI A;  1VZ7 A;  2GI9 A;  2WXF A;  3KWV A;  1A5R A;  2YLM A;  1ZE3 D;  3SDL C;  3RZW C;  1XLQ A;  1UH6 A;  3CF6 E;  1KLU D;  3ZRC A;  1EWC A;  4ZRJ A;  3BWU D;  3BY4 B;  4GSW A;  2LMC A;  1JML A;  2KDM A;  1FRD A;  1WXM A;  3DBS A;  4XX5 A;  4XE0 A;  1Z2M A;  5T8I A;  1L0V B;  3JYU A;  1XCT L;  3V62 A;  2WX0 A;  4C4V B;  3HVZ A;  3HIZ A;  3W1Y A;  1I4Q A;  4FJV B;  2LD9 A;  3DDC B;  3EA6 A;  3WAL A;  4E74 A;  3AUL A;  2PPH A;  2RDH A;  1RAX A;  3RMK C;  2WWZ A;  3TEY A;  1T5X D;  2DLB A;  1WJN A;  3HHM A;  2NVU I;  3AE8 B;  2WNM A;  3TJP A;  3BIN A;  5E6N A;  3Q3M C;  2QIE B;  3NVV A;  1Q1O A;  2KMM A;  3ZDT A;  2NS5 A;  3FC4 A;  1PUT A;  2KX3 A;  1NEN B;  3E56 A;  3KUZ A;  1LO5 D;  2MH7 A;  3SHQ A;  1FFU A;  2WDV B;  2CR5 A;  4CO7 A;  5JZE B;  1WX9 A;  4RCO A;  2LVQ A;  4USA A;  4GDL A;  1EU3 A;  4ZRQ A;  2JRI B;  1FRR A;  2Y3A A;  4BKG A;  3DBR I;  1HEZ E;  4LNF A;  4G0N B;  4NQL B;  1QT9 A;  4JQW C;  4JE3 B;  2MLB A;  1NVI D;  2K1F A;  1IGC A;  1CK1 A;  5AUK A;  1C77 A;  4WJN A;  3TUO A;  2JWU A;  1L7Y A;  3AE3 B;  2AYO B;  2UYZ B;  5D94 A;  2UU7 A;  3VH3 B;  1WJU A;  3N20 C;  2PLP A;  1SE4 A;  4X57 B;  3CIR B;  1KTK A;  3URY A;  4HPL B;  5BMH A;  4LLG M;  1UWX A;  3P63 A;  4TSS A;  4A9A A;  1SIF A;  2BW2 A;  1M94 A;  3U4E G;  2MHJ A;  3KYD D;  4P1B C;  2L8J A;  2L76 A;  1MI0 A;  3OG5 A;  3W5U B;  3LXF A;  3VUY A;  2N9L A;  3DWG C;  4XWW A;  3R2I A;  3P2B A;  4BOZ B;  3H7P A;  4AQ7 A;  1L0X B;  3E9S A;  1E90 A;  4KV2 A;  1D5M C;  1HZ5 A;  3RYT A;  2IPK D;  3PRE A;  1TGZ B;  4DWF A;  4A3P A;  4EZL A;  1XO3 A;  2R2O A;  5DPT A;  2VZK D;  2OJR A;  4IW0 A;  3RNE C;  1F77 A;  3MTN B;  4ZRK A;  1FXA A;  3L08 A;  1WMH B;  1V97 A;  1DOX A;  2KLC A;  1WRI A;  1NYR A;  2BQQ A;  1DOY A;  4LNK A;  4MGK E;  2Y5P A;  2ZNV C;  1D5Z C;  3VUX A;  1V1O A;  1RFA A;  5AZG A;  2LUM A;  3QQ8 B;  4G11 A;  4KZC A;  1FNU A;  4NY0 A;  3L13 A;  1HE8 A;  3ZTD A;  3MP9 A;  1TS3 A;  3TIX A;  2WU5 B;  3ZNZ B;  3DBH B;  1YNT E;  3BK1 A;  3N30 A;  1V2Y A;  3APF A;  3DPD A;  4M01 A;  3QK0 A;  1Y8R C;  3PHW B;  4HWI B;  1V5T A;  2LJI A;  3P4Q B;  1UF0 A;  3W1S A;  3Q8A A;  2D2Q A;  2BYV E;  1K51 A;  1AN8 A;  2KFK A;  3Q3O C;  3LJ3 A;  3AEC B;  3PHX B;  2LAS A;  3VRB B;  2LWP A;  5KHQ A;  2Q5W D;  3AEF B;  4N6E B;  3A4S C;  2EMT A;  5JHA A;  4WWM A;  3TSS A;  1RLF A;  1NI3 A;  3I57 A;  2WXR A;  3AE9 B;  3BVM A;  2DZI A;  2AEH A;  2K9X A;  4JWS C;  3RFZ B;  3B0A A;  4C7Y A;  1PGX A;  3R66 C;  4S0R A;  5D3D A;  1RWS A;  1WJ6 A;  3PGE A;  1VRA B;  5D2M B;  4TQ0 A;  2W54 A;  2KX0 A;  1FEH A;  1WXV A;  1YJ1 A;  5DPR A;  2PJH A;  3A1Q B;  3AEG B;  2JX5 A;  5G5G A;  2BWE S;  2FBW B;  1XF5 L;  4W9I A;  3MHS D;  3L10 B;  3ZUN A;  3UGB B;  4GB9 A;  1X1M A;  3FIL B;  4GU2 A;  1FD6 A; 
#chains in the Genus database with same CATH homology
 4H2A A;  1R7S A;  1JRP A;  3BK2 A;  1GAQ B;  5EE9 A;  2LGI A;  1FNV A;  2V3N A;  3MFG A;  3Q8C A;  4RNA A;  2QSD A;  3ABV B;  1N61 A;  2AQ1 B;  3ETR A;  4YSY B;  1SJH D;  1PDX A;  1SF0 A;  5HFY A;  1I4G A;  1KH0 A;  3EUB 2;  5JXV A;  4YSX B;  3P42 A;  3HRD D;  4HJG E;  4MT5 A;  1GB4 A;  1OFF A;  3AE1 B;  1D4B A;  4ZHO A;  1WSP A;  1ZXH A;  2Y5C A;  2QIL A;  3KQ4 A;  1E9M A;  2B76 B;  3I9V 1;  1MVK A;  1P7F A;  1N63 A;  2L83 A;  1MPE A;  1TKE A;  1FXI A;  2DWQ A;  1WGK A;  2BS4 B;  4IOI E;  1N60 A;  1I4H A;  2WXM A;  1FO4 A;  1YN5 A;  4KKJ A;  1YMH E;  3BII D;  1FCC C;  2W55 A;  4B0M A;  4YTN B;  1JWM D;  4NAW B;  2NMQ A;  1FNW A;  2JSV X;  4Q2J A;  1ZPS A;  2LHE A;  3Q69 A;  2PMV A;  3B2F A;  1AW7 A;  1CQV A;  4MAC A;  4YTP B;  1K50 A;  2ACZ B;  2D5G A;  2XNA C;  4OVZ A;  3L4P A;  3W2D A;  1P7E A;  1QQR A;  1SE3 A;  4RF1 A;  2JYE A;  1EU4 A;  2KAJ A;  1WXQ A;  2V4I B;  1FIQ A;  4YT0 B;  1XLO A;  2VZK B;  2QEJ C;  5AUI A;  1L5P A;  1OQQ A;  1IGD A;  3SR6 A;  2W3S A;  5GXG B;  5BYS A;  4YSZ B;  4RF0 A;  2IGD A;  4ZYS A;  3IT4 B;  1Y56 A;  4MM3 B;  4AS1 A;  1C76 A;  1JWB D;  1C79 A;  4FXC A;  2JYT A;  3NVZ A;  1UUP A;  1CJE A;  4IKG A;  1XCQ L;  2BTE A;  2WU2 B;  2E3T A;  1KLG D;  1F2R I;  1UGJ A;  2I38 A;  2SEB D;  1K52 A;  1QF6 A;  1C78 A;  1VLB A;  1XXG A;  2MEK A;  4DXF A;  1F2R C;  2KQ4 X;  2WXO A;  4R3D A;  2N0S B;  1N62 A;  3AV8 A;  3HVD A;  4DXG A;  1TS5 A;  3LB8 C;  4TQ1 A;  1C4P A;  3Q8B A;  1XLP A;  4YWG G;  1TYG B;  1VDV A;  3GB1 A;  3U7Z A;  1PFD A;  1ET6 A;  2WXH A;  4OZC A;  3BZD B;  4REZ A;  2WDQ B;  1CZP A;  5C2T B;  1NYQ A;  3H8H A;  2H89 B;  3AH7 A;  2WDR B;  1E10 A;  4B0E A;  2W82 A;  4OW0 A;  4OZA A;  5BYR A;  4IDI A;  1L4Z B;  2CJO A;  2V0G A;  2J4X A;  2JU6 X;  4P16 A;  1TKY A;  4ZRP A;  2K0P A;  2L52 A;  4UDU C;  5HG2 A;  1SIJ A;  3P4S B;  4WQM A;  5G5H A;  1B9R A;  1T3Q A;  1YN4 A;  1A70 A;  2X38 A;  1JAL A;  4NJC A;  5H8Y E;  3W5V B;  1F0Z A;  1VR9 A;  5D3I B;  4KX6 B;  2PVG C;  1I4X A;  4NZL B;  3V05 A;  3B2G A;  2K22 A;  2BB5 A;  2PW9 A;  4N59 A;  2OED A;  4RFB A;  4WUR A;  5EE0 A;  3U2S C;  1Q10 A;  2WXG A;  2J42 A;  1FM0 D;  2WXF A;  1VZ7 A;  2GI9 A;  3KWV A;  3MJ5 A;  1VJK A;  3GP7 A;  2CU3 A;  3ZJV A;  4C7Z A;  4L23 A;  2R61 A;  2I2Y A;  2MJD A;  2JXT A;  1HQR D;  1ZE3 D;  3FAH A;  2IJ0 A;  5FKA C;  1XLQ A;  4ITK A;  4GLS C;  1KLU D;  3AE7 B;  3VRA B;  2TSS A;  1EWC A;  3AE6 B;  2BBC A;  3BWU D;  1L4D B;  2N7J A;  2BYT A;  2LMC A;  1JML A;  2KDM A;  1ZP0 B;  4A8X C;  1FRD A;  3U52 E;  1QOG A;  1IBX A;  1L0Y B;  2WXK A;  4XE0 A;  5T8I A;  1TY0 A;  1L0V B;  4RGM A;  5E6J A;  1XCT L;  5TSS A;  2ONQ A;  3HVZ A;  2LHD A;  2AQ3 B;  3SFD B;  3BVZ A;  4JPS A;  1FMA D;  3NVY A;  1V1P A;  1I4R A;  1BXT A;  1I4Q A;  4HRS A;  1N5W A;  2LFI A;  3EA6 A;  2NTT A;  2RDH A;  3TEX A;  3AED B;  2FUG 1;  4WAF A;  1L6V A;  2K5P A;  1JQ4 A;  1TZO A;  2BS2 B;  2CJN A;  2JZP A;  2IGH A;  3BVG A;  1JWU D;  2SAK A;  3TEY A;  2EKI A;  1T5X D;  1PGB A;  5HHD G;  2DLB A;  2BS3 B;  3AE8 B;  2ZW1 A;  2WNM A;  1FCL A;  2BT6 A;  1SJE D;  1YJI A;  2QIE B;  3NVV A;  2KMM A;  3ZJT A;  3FC4 A;  3ZGZ A;  4N58 A;  4XDC A;  2G9H D;  1BML C;  1PUT A;  1DYQ A;  1PGA A;  4RH6 A;  1V8C A;  1NEN B;  3VQI A;  1C4A A;  3E56 A;  2GRI A;  3ZQ4 A;  4ZHP A;  4TMA B;  1KRH A;  1LO5 D;  2WS3 B;  2MH7 A;  4EE2 A;  1VZ6 A;  1FFU A;  2WDV B;  2YEP F;  1BUI C;  3PZ7 A;  1ROE A;  3UI3 A;  2KN4 A;  4RCO A;  4RGT A;  4USA A;  1EU3 A;  1TS2 A;  4LK0 M;  2L1A A;  4ZRQ A;  2EEL A;  1FRR A;  2Y3A A;  3PZ8 A;  4PT5 A;  1E6E B;  1HEZ E;  3O13 A;  3AE4 B;  3B9J A;  4HKZ E;  1QLB B;  1DGJ A;  1QT9 A;  4J3O D;  5MPO A;  3AMZ A;  4XDD A;  1ZDV A;  4WH4 A;  2IGG A;  3ZJU A;  3AEE B;  4JE3 B;  1NVI D;  2LEK A;  5EE1 A;  2WQY B;  1IGC A;  1CK1 A;  2PVO D;  2WXQ A;  1C77 A;  5AUK A;  2HTM E;  1SE2 A;  3EGR A;  2INN E;  4KGS A;  3TUO A;  2JWU A;  2DBY A;  2WXN A;  3AE3 B;  1UNS A;  3J9C A;  1ENF A;  1RYJ A;  1YJJ A;  2ZW0 A;  4KGR A;  4C56 C;  2PLP A;  1SE4 A;  4RGO S;  4A6Q A;  1IBX B;  1EM7 A;  1JWS D;  3CIR B;  1DOI A;  1KTK A;  2M0A A;  4JX1 C;  3URY A;  3AEA B;  3Q8F A;  5C3J B;  1QOF A;  5BMH A;  1QOA A;  2PTL A;  4LLG M;  1J7B A;  1UWX A;  3P63 A;  4TSS A;  4A9A A;  1JCK B;  1L6U A;  5BMG A;  3IAS 1;  1V1P B;  2L32 A;  3MC0 B;  3T3N A;  2AX5 A;  2BW2 A;  1E0Z A;  3AE2 B;  3IAM 1;  3KLS X;  1TY2 A;  5FK9 C;  3TEZ A;  2XN9 C;  3U4E G;  3W9C B;  2V3P A;  2MJ3 A;  1SXT A;  2KWD A;  5EE3 A;  1JW9 D;  1MI0 A;  3P1M A;  4L2Y A;  3LXF A;  3W5U B;  1SEB D;  1FFV A;  2N9L A;  3DWG C;  4XWW A;  3R2I A;  2RDG A;  1ZXI A;  1QIL A;  2ON8 A;  1JRO A;  4JWU C;  4XWT A;  1XLN A;  4RGN A;  4KKI A;  5I4D A;  3TEW A;  4AQ7 A;  2RMM A;  1L0X B;  2DYO A;  3E9S A;  5BYQ A;  2J53 A;  2E6X A;  1QKZ A;  4A55 A;  1GB1 A;  1D5M C;  1HZ5 A;  1MHX A;  1XEE A;  2IPK D;  1ZUD 2;  2M56 B;  1T6B X;  1I7H A;  1E7P B;  1SSN A;  3CWI A;  1SB3 C;  1WWT A;  1XO3 A;  3R8B A;  2FE8 A;  2VZK D;  2WXP A;  1F77 A;  5HI1 A;  2IDY A;  1FXA A;  1V97 A;  4GDL B;  2NTS A;  1YQ4 B;  1DOX A;  4C80 A;  4GDK B;  1NEK B;  1TJE A;  1NYR A;  1WRI A;  1ESF A;  1DOY A;  2INP E;  2Y5P A;  3P4P B;  2G1E A;  2BB6 A;  1TS4 A;  3C8Y A;  3IXS A;  1D5Z C;  1N5X A;  1V1O A;  1KFY B;  1ZDX A;  4O1N A;  2LUM A;  4KGT A;  1YN3 A;  3HUI A;  3PO0 A;  2QMT A;  3BYY B;  1FNU A;  2HDE A;  3FIL A;  1KF6 B;  1QOB A;  4LTU A;  3T3O A;  2PKO A;  3MP9 A;  1TS3 A;  4HRO A;  1J7C A;  2WU5 B;  4WIP A;  1OQR A;  4OHJ A;  3N9Y C;  3IT6 B;  3NVW A;  1YNT E;  1B1Z A;  3BK1 A;  1HXY D;  3NS1 A;  1ACC A;  1TKG A;  1AYF A;  2AQ2 B;  5H92 C;  4ZOH C;  2YEP B;  1YQ3 B;  1SBB B;  2LJI A;  3P4Q B;  3W1S A;  1HZ6 A;  3V3X A;  3Q8A A;  4ARI A;  2QJL A;  3R2T A;  5LNK 1;  1K51 A;  1D5X C;  1AN8 A;  3DWM A;  2WLB A;  3AEC B;  2DYM A;  2ICI A;  2M19 A;  5BMI A;  2J52 A;  3VRB B;  2WXI A;  3GS2 A;  1ZOY B;  2H88 B;  2Q5W D;  3AE5 B;  3AEF B;  4US9 A;  2WXL A;  4N6E B;  3WCQ A;  3Q8E A;  4YXD B;  3SEB A;  4YTM B;  4WWM A;  4L1B A;  3TSS A;  2PIA A;  2W3R A;  3KWL A;  1NI3 A;  2OHF A;  2Z8L A;  3I57 A;  1HA5 A;  4MH8 A;  2WXR A;  1AWD A;  3AE9 B;  1VZ8 A;  3BVM A;  3VR9 B;  4US8 A;  3NZ3 A;  4JWS C;  2K9X A;  1JWA D;  3RFZ B;  3MHZ A;  4HEA 1;  1K53 A;  1M4V A;  1MHH E;  3NUH B;  5FR3 A;  1PYW D;  1D6E C;  1RFK A;  4A90 A;  4C7Y A;  4P6V F;  1GOZ A;  1IUE A;  1PGX A;  4ARC A;  1STE A;  2GB1 A;  1WYG A;  5D3D A;  1I4P A;  1RWS A;  1RM6 C;  2N9K A;  3P4R B;  4OZB A;  3AB5 A;  1ET9 A;  1VRA B;  3ZYY X;  4HKQ A;  1EWY C;  3AEB B;  4TQ0 A;  3AM9 A;  1GPX A;  3LYY A;  2W54 A;  3BYT B;  1J7A A;  3VR8 B;  1FEH A;  2K3U A;  4NAM A;  2RPV A;  3AEG B;  1C4C A;  3SFE B;  2JX5 A;  5G5G A;  3AN1 A;  4M0W A;  2JQR B;  2FBW B;  1XF5 L;  1UWM A;  2KAC A;  3NRZ A;  4D2K A;  4DQO C;  2WXJ A;  4CQN A;  2MJE A;  5D7G A;  2WP9 B;  3OWE B;  3FIL B;  1FD6 A;  1C9F A;  3RPF C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...