3W5UB

Cross-linked complex between ferredoxin and ferredoxin-nadp+ reductase
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
92
structure length
92
Chain Sequence
ATYNVKLITPEGEVELQVPDDVYILDQAEEDGIDLPYSCRAGSCSSCAGKVVSGSVDQCDQSYLDDGQIADGWVLTCHAYPTSDVVIETHKE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Concentration-dependent oligomerization of cross-linked complexes between ferredoxin and ferredoxin-NADP(+) reductase
pubmed doi rcsb
source organism Zea mays
molecule tags Electron transport
molecule keywords Ferredoxin
total genus 20
structure length 92
sequence length 92
chains with identical sequence D, F, H
ec nomenclature
pdb deposition date 2013-02-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00111 Fer2 2Fe-2S iron-sulfur cluster binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 3w5uB00
1FXAA 1FFVA 1L6UA 1JWBD 1ZP0B 1N63A 2PIAA 2WDRB 1KFYB 2WU5B 5G5HA 1FO4A 2K9XA 3AEFB 1FRRA 3AEEB 1OQQA 1PFDA 1QOGA 1SIJA 1WYGA 1N62A 2LEKA 2WLBA 1KRHA 1YQ4B 1TJEA 2WDQB 2WS3B 5EE1A 1NEKB 1VLBA 2H89B 3KWLA 5MPOA 3AEDB 2L83A 1JQ4A 1YQ3B 1WRIA 4YSYB 2KAJA 3LB8C 1NVID 2Y5CA 1TKEA 4YSZB 1E0ZA 4C80A 1XLOA 4WWMA 1YJJA 4YT0B 5EE3A 1A70A 5EE9A 3LXFA 1V97A 1DOYA 4YSXB 3NVZA 4US8A 2W55A 4YTMB 4HROA 3AE4B 1I7HA 2W3RA 2JQRB 2M56B 4C7YA 3P4SB 4US9A 1SF0A 1PUTA 3CWIA 3DWGC 1XLPA 1ZOYB 2E3TA 1FM0D 3B2GA 3NVVA 1TKGA 2MJEA 4USAA 1QT9A 3VR8B 2CU3A 1FIQA 2MJDA 2FBWB 4WQMA 2BS2B 1RWSA 1NYRA 1WWTA 1ZUD2 2WQYB 3AE9B 1N60A 2N0SB 3AE3B 2K22A 4ZHPA 3AECB 3NS1A 2CJNA 5G5GA 1JROA 3AE5B 1QOBA 3EUB2 3B9JA 2G1EA 2PVGC 1NENB 2HTME 4KX6B 2CJOA 5AUIA 3AE2B 4JWUC 3AV8A 3VR9B 1OQRA 3W5VB 3W9CB 3AE8B 3P4RB 3HVZA 1JRPA 1JW9D 1XO3A 1KF6B 2QJLA 3AEAB 1RFKA 3ZYYX 2ACZB 2MJ3A 2QIEB 3AMZA 5H8YE 3NVWA 4YXDB 1AYFA 1GPXA 2BS3B 4YTNB 4YTPB 3WCQA 5C3JB 4P6VF 4LTUA 1E10A 3FAHA 4FXCA 1E7PB 2PKOA 4JX1C 1QOFA 3HRDD 3W5UB 3FC4A 3SR6A 1JALA 5H92C 4JWSC 1FMAD 1ROEA 5EE0A 5C2TB 4A9AA 3B2FA 1WGKA 1XLNA 4N6EB 1J7BA 1L5PA 1F0ZA 2W54A 1EWYC 2PVOD 2Q5WD 1RM6C 3P1MA 1GAQB 3VRAB 3DWMA 2BS4B 4C7ZA 3AEGB 1N61A 2M19A 1T3QA 2WP9B 3AH7A 3AE6B 1CJEA 3ETRA 1PDXA 1L6VA 3CIRB 1VDVA 3L4PA 2BT6A 4IDIA 1TKYA 1AWDA 1FXIA 1N5WA 1UWMA 1WXQA 3SFEB 1FRDA 3HUIA 4N59A 3AM9A 3PO0A 2B76B 3AB5A 1QLBB 2JX5A 1J7AA 1QOAA 3NVYA 4N58A 4ZHOA 3SFDB 1B9RA 1SB3C 1XLQA 2L52A 1CZPA 1R7SA 2AX5A 3AE7B 3VRBB 1DOXA 3BIID 1QF6A 2OHFA 2MH7A 1ZXIA 1E6EB 1N5XA 1RYJA 1NYQA 2DBYA 3P4PB 2DWQA 1NI3A 2WDVB 1J7CA 3NRZA 1FFUA 1L0VB 3AEBB 4ZOHC 2WU2B 3P63A 1YJIA 1DGJA 1V8CA 2EKIA 1E9MA 3AN1A 1JWAD 1VJKA 4ITKA 2KMMA 3AE1B 2W3SA 3ABVB 5GXGB 5AUKA 2H88B 3P4QB 1DOIA 3RPFC 2K5PA 1OFFA 4HRSA 1TYGB 1IUEA
chains in the Genus database with same CATH superfamily
3GP7A 3A1QA 4AJYB 4BFRA 1UELA 5BYSA 4FJVB 3OJ3A 3VXWA 2PE9A 2H89B 1EM7A 2D3BA 4G3XB 4YSYB 2PJHA 3R66C 3LB8C 3DCGA 2MRPA 3MTNB 2N7JA 2NPTA 2LD9A 1SEBD 1J19A 2OEDA 3CWIA 2K0PA 1T5XD 2MJEA 1QT9A 3VR8B 3V05A 5BYRA 4FHJA 1V6EA 1QOBA 2Z0DB 4WAFA 4JWUC 2RPVA 3OAWA 3W5VB 3AE8B 3C0RB 3CSTA 2KWUB 4HVBA 2BYVE 1Q1OA 3NZ3A 3ZYYX 1QILA 2INPE 3IXSA 1AYFA 2KWVB 2OJWA 4LNKA 2PKOA 3U8ZA 2QC8A 1QOFA 4ACFA 1S3SG 5G2NA 4DXGA 2DAJA 4MJSA 1ROEA 1GB4A 2I1KA 2WYQA 4II3B 1RM6C 3PS6A 2ON8A 3P1MA 2M8SA 3A1QB 3AEGB 2YLMA 3AE6B 3ALBA 4MGIE 4TKNA 1TKYA 4B0EA 2E6XA 3QX1A 5JHAA 2FCQA 2JXTA 4WIPA 1P7EA 2PE6B 3VVWB 4D2KA 3K9OB 3ML8A 2I1JA 1XF5L 2MH7A 4AP4C 1J7CA 3KH0A 1ENFA 2K1FA 2M0XA 4R3DA 2QILA 4NAWA 2VRRB 2LUEA 2OJRA 2X38A 1IP9A 1G6JA 3U2SC 2WU5B 4Q2JA 2L05A 4LJPB 3UIPB 3RULA 5J17A 4DXAB 2EMTA 1XT9B 5D6JB 4IC7B 5DPTA 2KAJA 1WIAA 5EE3A 2C60A 4I6LB 2RSUA 4WWNA 2MBOA 1IPGA 3SHQA 5E6NA 2W3RA 4BKSA 5CHWA 4C7YA 3W1SC 2V3SA 3NS8A 5IP4D 4L23A 1J8CA 2KTRA 2E3TA 1WRDB 1WM3A 3QJZA 4IM0A 4WQMA 3GS2A 5FKAC 1LM8B 4QAYA 1F2RC 4A3PA 1WFYA 1M4VA 3A4RA 4ANVA 4E3CA 3ZGZA 2UU7A 1KLVA 1YN5A 2HDEA 2KLCA 3WAOA 4NQKE 4HKQA 3A33B 5IKCM 3IVFA 3DQVA 3FC4A 1KOTA 2JYTA 1WZ3A 1FMAD 3VUWA 2KJ6A 3DBRB 2KT7A 3H6NA 1PQSA 5D2MB 2KDBA 1PDXA 1VDVA 3KLSX 3SFEB 1N5WA 2LXCA 2IGHA 2KO3A 3Q6BA 2AL6A 1TZ1A 1ISNA 5IOIA 4ZRKA 2KFKA 3BIID 2KVZA 2OHFA 4ICUA 1OQYA 3PVLA 2DBYA 3P4PB 4JL9A 1I35A 1L0VB 1FEHA 2J0MA 3RZWC 1QZEA 1WMHB 1I4HA 3TIXA 3I9V1 2KMMA 4PT5A 2LMCA 5GXGB 3IBEA 3ZLZA 2IZVB 2I2YA 2K9XA 2SAKA 1LFDA 3AEEB 2WDQB 1NEKB 5MPOA 2L83A 2IGGA 2JUOA 1NBFC 3B1LX 1STEA 2IGDA 4YSXB 1ET6A 3NVZA 2IO2B 3NJTA 3ZJUA 2JZZA 3VUXA 1XLPA 3QIJA 4EZLA 4LDTB 3QK0A 4GDLA 4A8XC 2ONQA 2WQYB 4C56C 3AE3B 4IOIE 2MCNB 2XNAC 3EUB2 3BK1A 3B9JA 4XC2A 1ZE3D 3W9CB 1OQRA 1TTNA 1JW9D 5DCNA 1TS5A 4JQWC 4LJOB 3DBLB 1RFKA 4W9LA 2JRIB 3W1SA 4P1BC 4LTUA 3W5UB 3ZKJC 3H7PB 1IBXB 2FCMA 4BAXA 3OJ4B 4N6EB 1YX6B 2L1AA 1Z2MA 1GAQB 4IG7B 3ZJTA 1MI0A 3DBLI 3L4PA 2CHZA 2IYDB 2Z8LA 4HKZE 3PO0A 4BOZB 2J4XA 4KGTA 2LHEA 4XWWA 2PEAA 2MLBA 3ZJVA 4C4VB 1CK1A 2LFIA 2WU2B 1YJIA 1K51A 1MFWA 2HE7A 4ICVA 5KHOA 3AE1B 2H88B 4DDGD 1FRRA 1FCCC 5JH5C 1VLBA 2KHWB 4EZKA 1F0ZA 1P0RA 1C1YB 1YQ4B 3N32A 2DYOA 2EELA 1JQ4A 2JXXA 4KZ0A 2KDFB 3U52E 1PGXA 2N9EB 4ARCA 4KDIC 3NUHB 1DOYA 2K6QA 1C4AA 3DVNV 5CX3A 3N1YC 2M56B 5BYQA 4US9A 3V60A 3RCZA 3KW5B 2Z0EB 1TKGA 3BYTB 3GE3C 3IAS1 2JZ3B 1FIQA 1NYRA 1P7FA 5LLIA 4ZHPA 3AE5B 3JSVB 2IO3B 2KXJA 4HLEA 5AUIA 1T0SC 4XDCA 4OVZA 5H8YE 3TSSA 1C78A 2V3PA 3FAHA 2CU1A 4BZAA 4DHJD 2AWTA 1BUIC 5EE0A 2YVCA 4M00A 4NJ6A 2BYEA 2KN5A 4I6NB 3RNEC 3VQIA 2L76A 4HCNB 1KTKA 2GBNA 1WGHA 3MHZA 4PK1A 2DNFA 1GJZA 2GI9A 3CSFA 4GMVA 4HXDA 4F8CB 2KACA 1P9DU 2LRUA 3TEYA 2FUG1 3PZDA 3SD5A 1C77A 2N1WA 3UINB 2LGXA 4ZOHC 1E9MA 3PHXB 1WX9A 1DOIA 3RPFC 1TYGB 1FXAA 1FFVA 2JWZA 2D3GA 3HIZA 3ZW3A 1E8YA 1ZW7A 2WS3B 1WYWB 4K81A 3VH4B 4TMAB 3I63C 1A70A 1V97A 3Q2AC 2WDTB 4US8A 4YTMB 2KQ7A 2K39A 1TGZB 3URYA 4USAA 2XN9C 3C19A 4M0WB 1F77A 4HDQA 1WJ4A 2BWES 3A4SC 2KOXA 3IT4B 4ZRPA 4RGNA 1TY0A 4FHKA 3ZUNA 1D5MC 3AV8A 2BTEA 1XQQA 2IY1B 3DVGX 3TEXA 3ZNZB 2CHXA 3NY5A 4BKGA 4BKTA 2QJLA 4OZAA 3A9JB 1BT0A 4YWGG 3NZSA 1P98A 1L5PA 3IG3A 1SIFA 2KC2A 1UUPA 2V1YA 4RNAA 1C4PA 2O6VD 4IDIA 1WXQA 1FXIA 3KYDD 2HJ8A 3GOEA 1Q10A 5J18A 2TSSA 2O6VA 4PYZA 1GC6A 2RPQA 1WF9A 3V6EB 3WALA 1A5RA 3TJPA 2NCNA 3GZNB 1JWSD 2BYTA 4C00A 1GG3A 1FFUA 4B0MA 3NZUA 1TY2A 4A3OA 2FIFA 3ZXVA 3H8HA 4KV2A 4PS7A 5FR3A 3V61A 2W54A 1L4ZB 4E71A 2GB1A 3KUDB 3APFA 2LVOA 4BOSC 1FNWA 3VAWA 2R61A 3N20C 2INCC 2J0KA 1E0ZA 4J3OD 1WJNA 3VTUA 3UF8A 1QQRA 5CHVC 2KWDA 1D3ZA 1ZOYB 3N1XC 1FM0D 2M1MA 4NAWB 4LDTD 3ZTDA 1SGHA 3ZXRA 3DVGY 4HJGE 1V1OA 3T3OA 4B95A 4KZCA 4W9EA 3HK0A 1RAXA 4MH0E 4IUMB 4YTPB 2C7NB 2WXNA 2WXGA 2D3CA 2V0GA 3ZIMA 1NI2A 1R4MB 3B2FA 1XLNA 1KLGD 3OLMD 2HD5B 3NG0A 1YD8U 1CJEA 1L6VA 4EE2A 2N9PC 4JE3B 4KGRA 1MJDA 3U30A 3OWEB 3AM9A 4P16A 2FCNA 3NVYA 3APCA 2DX5B 4ZHOA 2GBKA 2ZNVB 2L52A 3B0AA 2N9LA 4WWOA 1UBQA 3Q14C 4JIOU 1V5OA 3AEBB 1V8CA 1WXAA 2WHIA 3AN1A 2WXIA 2LGDA 3ABVB 1B1ZA 5IN7A 4LNNA 4G11A 2WP9B 1IUEA 3L10B 1L6UA 3K9PB 2QMTA 3FILB 1JWUD 1FO4A 4HWIB 4FBJB 3PREA 3R2TA 2FUHB 4KX6B 5E6OA 3A9KA 5EE1A 4MJSB 1PGAA 1N6ZA 1JRUA 5HKHA 3DBHB 4WH4A 4YT0B 5BMIA 2MBBB 1E5WA 4W9KA 3RNCC 1SJED 3HVDA 2ZW1A 5BMHA 1UBIA 4A6QA 1ZKHA 2KLGA 3R3MA 2KDEB 3RNFC 5TSSA 1N60A 2KTFA 3AECB 1Y56A 2KJRA 4GOCA 2GMIC 3Q3NC 3DBHI 2LRWA 3QHTA 2KYWA 1JWMD 1JRPA 3E56A 3AEAB 2BGFA 3NVWA 4KSLC 3DBRI 2BQQA 4ARIA 2WNMA 1EWCA 1J7BA 5BO4B 3ONSA 3DWMA 1GC7A 3D32A 3Q8EA 3ZDTA 2DZMA 2ZCCA 1UGJA 1ZDXA 1BMLC 2BF8B 1VR9A 1WR1A 3V62A 4LNFA 2KTRB 1R7SA 4KIKA 3QCAA 3PT2B 3DOWA 1WJ6A 5JXVA 2RD0A 3NRZA 4G0NB 2BPSA 4RH6A 2UYZB 1WH3A 4CQNA 2CR5A 1LXDA 2NR2A 3QAQA 2D10A 2J53A 2NBVB 2KVRA 4FULA 3M95A 3V3XA 2K5PA 2JPHA 4HRSA 2VZKD 4XX5A 1KFYB 3AEFB 4CYEA 1OQQA 2VZKB 3MC9A 1KRHA 2DZJA 3AEDB 2V3NA 2REXA 4GGQA 2Y5CA 3Q69A 4PS3A 1FPYA 2FE8A 4DXFA 2QDFA 2JSVX 3RN9C 2BW2A 1RWSA 2AQ2B 2CJNA 1GB1A 2JRHA 4ZRIA 3RUIB 4KIKB 2MX2A 3RMKC 3W2DA 3WAPA 3H1UA 4A20A 3SR6A 2KQ4X 3IT6B 1C3TA 1E8XA 2Q5WD 2ZPNA 4NJ7A 1H8CA 4C7ZA 1FCLA 1N61A 2M19A 1YN4A 3BWUD 3Q8CA 4XDDA 1WGRA 3HM6X 2C9WB 1TS3A 2MWSB 3AB5A 1IGDA 4RM8A 2BKFA 1AW7A 1NYQA 2MEKA 2MHJA 3P63A 2FAZA 1DGJA 3RFZB 4MSMB 4IM2A 1MHHE 1K53A 4UDUC 2W3SA 4KGSA 2WXMA 5CHFA 1V49A 1M94A 1WMHA 4W9JA 1OFFA 4PYUA 2PIAA 3EHVA 5DPWA 5KHQA 4NPNA 4XZ4A 3NOBA 5AZHA 1E7UA 1YQ3B 5E6PA 4TQ0A 5EE9A 4O1NA 2N9KA 2NVUI 2Z59B 3DDCB 3IHPC 4K1RB 4F7ZA 4ZRJA 5G55A 4BBNF 1TIFA 1Z5SB 4W9IA 4B6WA 2LI5A 2N0SB 2MA9B 5HHDG 2MP2B 2MP2A 2KDIA 5LXHA 1OEYJ 5EDSA 3TEZA 1VD2A 4XGAB 4M02A 4DHJB 3X0WA 4XE0A 1XCQL 2LGSA 1F2RI 1WE7A 2GRIA 2ACZB 3ECIA 5C23A 1SBBB 2G4SA 3WCQA 3SU8X 2JY6A 2L32A 1ZPSA 2IJ0A 3UGBB 5D3IB 4S17A 1GUAB 4MH8A 1RRBA 3P42A 2PVOD 2Y3AA 3LYYA 1WZ0A 3PLUA 2PLPA 2R2QA 4REZA 4K3CA 1LO5D 2L0TA 3DHHC 4WWPA 1RLFA 2L0FA 2RDGA 5DPRA 5IA7A 1WXVA 3WA0A 3C8YA 1ZGUB 3OG5A 2KMCA 1ACCA 1TS2A 2JU6X 2RDBC 2AX5A 2PW9A 3M63B 1DOXA 1ZXIA 1N5XA 2V4IB 4MDKE 2WDVB 2K6DB 4FLHA 3J9CA 5HG2A 4JGHB 1RFAA 1YMHE 2GOWA 3L16A 2CKHB 3BVMA 5HI1A 2ZCBA 3KYCD 3ENEA 1EO6A 1ZP0B 1N63A 4N9F4 3R7QA 4EEWA 2ZEQA 2FIDA 5BMGA 4H2AA 1C79A 4IKGA 4DBGA 2BVCA 1OEYA 3SEBA 2G45B 2JT4B 2W9NA 4K7SA 3N3KB 4E74A 2W55A 3AE4B 2K8HA 2JQRB 4GN1A 1YQBA 2IPKD 3I5JC 2NBUA 2IDYA 1HQRD 1U4AA 4ZYNA 2NS5A 2PMVA 3TMPB 2FBWB 1T0YA 3DBSA 2J52A 2X8XX 1IGCA 4OVUA 1NENB 1T0QC 1TS4A 2QHOA 2JWUA 3QC8B 4B9KA 3M3JA 4JLCA 1SE4A 4TQ1A 2QEJC 2XBBC 3N30A 1YOVB 1D6EC 2XEWA 2J7QB 1MHXA 3QQ8B 1T6BX 4MGZE 5I4DA 3P2BA 1GOZA 3I3TB 4RMAA 3VRAB 2K8BA 2LJIA 4GDLB 2K3UA 3ETRA 3CIRB 3KVFB 4K7WA 3N1ZC 2LHDA 1BXTA 1FRDA 1L0YB 3RD2A 1XCTL 2BB6A 2NTTA 1QLBB 3BYYB 4WJOA 1ZDVA 1B9RA 2N7DA 1I42A 2WX1A 4KKIA 2HTHA 3PZ7A 1MVKA 1E6EB 1XXGA 2BYFA 2WXRA 1UWXA 1OTRB 1E8WA 4OHJA 1PYWD 4AUQC 1SE3A 3UQAA 4ITKA 2IBIB 2KDMA 2NTSA 4MELA 1L7YA 1WX8A 2BKRB 1JWBD 1UD7A 3R8BA 2AQ1B 1WSPA 3AU4A 1QOGA 4DHZB 4IWPA 4YL8A 1EUVB 1XD3B 2JZPA 5J2RA 1SSNA 1YJJA 3KUZA 3MHSD 3X23A 2LASA 2J0JA 3EECA 5LNK1 1VRAB 2GLSA 1SF0A 3DWGC 3T9LA 1L0XB 2DAFA 4TSSA 2CU3A 2YEPF 2L7RA 2BS2B 3W1YA 2W82A 3NS1A 1JROA 3VUYA 1C9FA 2CJOA 3Q8AA 1X1MA 1C76A 4MGYE 3ZDMC 3RI7C 2WXHA 4P6VF 5T8IA 1YX5B 3NHEB 1DYQA 1CQVA 2AL3A 2YEPB 2N4FA 1WGKA 2FCSA 5C1ZA 4GB9A 1KLUD 2BBCA 1T3QA 2DZIA 2A4ZA 2M0AA 2MBEA 1I4GA 3RNAC 1TBEA 4OVVA 2EKEC 3ZTCA 4GDKB 2WXOA 5L83A 4N59A 1J7AA 3SFDB 1SB3C 2WXLA 1XLQA 1CZPA 1F9JA 5D7GA 1QF6A 2LGIA 2I38A 3BZDB 2GBRA 5AZFA 2AYOB 3Q3FA 2ZJDA 4DQOC 1E7VA 4FA6A 4RFBA 3LJ3A 3Q8BA 2FNJB 4AOFA 3R2IA 2WDRB 4HPLB 4A90A 1PFDA 3KUCB 1WYGA 2RGFA 3WAMA 1P3QU 4BKSD 2DLBA 2PTLA 4PS8A 1YN3A 4RGMA 2LVQA 4AQ7A 2XK5B 1T0RC 1V2YA 4HROA 4AJWA 2L00B 3ZNHB 4WQOB 3WANA 4RF1A 3PSEB 4URKA 2G9HD 3SDLC 2INNE 4MGKE 4LCDE 1ZUD2 4AWJA 4IW0A 4P7IA 3TUOA 3JSVA 1VZ6A 2LGYA 2V4LA 2AQ3B 4HJKA 3O13A 3HVZA 2CS4A 1FXTB 4EKUA 5CTRC 1MG8A 1WM2A 3ZQ4A 3L13A 1HA5A 4KSKC 2QIEB 3R7RA 5FK9C 2KMAA 4NJCA 4GIVA 2B3AA 4HPPA 1WI0A 2WXQA 1JALA 4JWSC 3EFCA 4I6PA 5C2TB 1ESFA 1FNVA 3ML9A 1WR6E 4M8NA 4MSQB 1V81A 1SE9A 3B08A 2RDHA 2WXJA 1CMXB 2ASQA 2RR9A 2ZW0A 1UF0A 4W9FA 1ZXHA 2KD0A 3RNBC 1R4NB 3Q3OC 1AN8A 5JZEB 1JCKB 3UI3A 4ZDVA 2KX0A 4ANWA 2SEBD 1NI3A 4ZRQA 4RF0A 1TZOA 2M17A 4IM3A 1VJKA 2KC1A 1HEZE 1D5XC 4J6IA 4P1CC 1YIWA 4NZLB 2KJHB 2IO1B 1WGGA 2N7EA 2AEHA 1IYFA 1Q5WB 1R4NI 1HZ6A 3ZO5B 2JF5A 2LEKA 3RNGC 1TJEA 4WJPA 4FJZA 5IO9A 1HTQA 4ASWC 4RGTA 1WRIA 4YSZB 1NVID 1TKEA 3A9KB 3LXFA 3P4SB 3HM3A 3BK2A 4TV3A 3RT3B 1F52A 3AI5A 3T3NA 4M0WA 3AE9B 2MBHA 2G4DB 3E9SA 2HTME 4K7UA 3TEWA 2D5GA 1LQBA 4RGOS 1E90A 4II2B 1UZXB 2KNBA 3H7SA 3MFGA 4FJYA 1H4RA 1MG4A 4EUTA 4YXDB 2KFJA 2KK8A 3KQ4A 3L0WB 4MM3B 4HEA1 2O2VB 2LWPA 3PZ8A 4W9DA 3MJWA 4LLGM 2ICIA 2LXAA 1XEEA 2NMQA 4IWQA 4LNIA 3AH7A 3VH3B 4WAAA 1K50A 1AARA 1EU3A 1OGWA 1QKZA 1EF5A 1UWMA 4CHKA 1F1HA 2M4NA 1EU4A 4GSWA 2B76B 1K52A 2JX5A 2OOBB 3MJ5A 3Q3MC 4N58A 1YNTE 3ZNGC 3VRBB 3T8MA 4NQLB 5TR5A 2L8JA 4NY0A 3ZRCA 1WE6A 1SXTA 3VFKA 2LJ5A 5JHBA 1JWAD 1JMLA 2DENB 4L2YA 3JW0X 4HK2A 3RZFA 2QCZA 5G5HA 2KWCA 3UQBA 2MSED 3HHMA 3ZVVA 5LXIB 2WXPA 2DYBA 3PTFC 3PRPB 2QSDA 3U7ZA 1J0GA 5HFYA 4X57B 5D94A 2GBJA 2NBWB 1I7HA 2KKCA 1TT5B 4DWFA 1ET9A 2JVCA 3BY4B 4RM9A 2N1VA 2UWQA 3NVVA 4DDID 3M62B 4RCOA 3IFWB 1HZ5A 4K3BA 5G5GA 4EZJA 3QA8A 3IAM1 3PRMB 3JVZX 2DYMA 2D2QA 1UH6A 3MC8A 4A55A 1XO3A 1KF6B 4ZYSA 1V1PB 2KN4A 4MACA 2BS3B 2MBQA 5C3JB 3O65B 3AXCA 1YJ1A 3L54A 1E10A 4TUUA 2R2OA 5L95C 3HRDD 4NAMA 5D3DA 1SJHD 3LDZE 2ZZPB 4KVGB 1EWYC 3EC8A 4HPMB 4EFOA 4XYCA 3VTVA 3VDZA 2BS4B 2XK5A 4L1BA 1WXSA 4S0RA 3MC0B 4GDKA 2C7MB 3V6CB 1AWDA 4DK5A 1WGYA 3HUIA 1KM7A 1D5ZC 4HDOA 2WGSA 1VZ8A 4OZCA 2V9HA 5E6JA 1Y8RC 2C7HA 3MP9A 1I4PA 3TL5A 4JPSA 1HE8A 3CF6E 1FD6A 4ANXA 2DHZA 2PPHA 2KZRA 5AUKA 3PV1A 3N9YC 3FKYA 2WXKA 5GMVA 1SIJA 3AU5A 1N62A 3QWZB 2WWZA 5DPSA 2VH1A 1EF1A 4G50A 1FNUA 1SE2A 3WIMA 2A5UA 2ZVOA 4W9CA 1P1AA 1XLOA 4WWMA 4EOYA 5AZGA 3H7PA 4WJNA 1L2NA 2MQJA 1I4QA 2GBMA 1C4CA 1GNUA 3EA6A 3PLVA 2MJDA 4M8MA 4BVUC 3PRZA 3L08A 2C5LC 2G3QB 4MEMA 3AE2B 3Q8FA 1WX7A 2KQSA 1MPEA 2ZNVC 1K8RB 3TBLD 3AMZA 2D3AA 1GPXA 4YTNB 1I4RA 1E7PB 1HTOA 4JX1C 3PHWB 4GXBA 1S1QB 3FILA 3H9DA 4LK0M 2KX3A 2Y5PA 2LZ6A 4FADA 3BVGA 1PGBA 3RYTA 2LVPA 3PGEA 3S2AA 3UIOB 3VTWA 3KWVA 3QARA 2INDC 4ANUA 1WXMA 1VCBA 1QOAA 3GB1A 2LUMA 2KFKB 4M01A 5FR6A 1RYJA 4LNOA 4FN2A 2HJ1A 1I4XA 5IAAC 1E8ZA 2D07B 4OZBA 2KANA 2J42A 3DHIC 2EKIA 4HCPB 3GE8C 3Q3JA 4GLSC 5AEKB 2BB5A 3U7DA 2D11A 4MT5A 2K8CA 2WLBA 3EGRA 3KWLA 2IY0B 4CO7A 4W9HA 2CHWA 4C80A 3BINA 3DPDA 2WX0A 1UNSA 3U4EG 3JYUA 3DVNU 1PUTA 3APDA 2N9XA 2DZKA 3B2GA 4KKJA 2EMSA 1Q0WB 1WWTA 4BBNC 2K22A 3ZNID 4GU2A 1R4MI 4DHZE 2G1EA 2PVGC 1V1PA 3VR9B 2L3ZA 4XWTA 1VZ7A 3P4RB 2MJ3A 2MW5A 3CMMB 2VH2A 2IO0B 4IWOA 2K25A 1IBXA 3L17A 2JYEA 4FXCA 1D4BA 4MM3A 1KJTA 2O2VA 2BWFA 3DHGC 4KDLB 1UGMA 2RMMA 5H92C 2NPTB 4A9AA 3A9JA 4F1SA 3TCAA 3BVZA 4NNJB 1LGRA 4WURA 2BT6A 4AS1A 3GZNI 1L4DB 4OW0A 1WGDA 3AULA 3AE7B 1KH0A 1V86A 1V80A 3EFUA 2ZPYA 1V9JA 3ZRFA 4C4VA 2O6VB 1WJUA 3PPAA 2DWQA 1WY8A 3I57A 2ZVNA 2WXFA 4W9GA 1HXYD 2Y5BB 4WJQA 1V5TA 3P4QB 3VHTC 1NDDA
chains in the Genus database with same CATH topology
1FXAA 1FFVA 3GP7A 2PIAA 1HZ6A 2LEKA 5BYSA 1TJEA 2WS3B 2H89B 1EM7A 1YQ3B 4RGTA 1WRIA 4YSYB 3LB8C 1NVID 4YSZB 1TKEA 4TMAB 4TQ0A 5EE9A 1A70A 3LXFA 1V97A 4O1NA 2N9KA 4US8A 2N7JA 4YTMB 3P4SB 1SEBD 3BK2A 2OEDA 3CWIA 3URYA 2K0PA 1T5XD 2MJEA 4USAA 1QT9A 2XN9C 3VR8B 3T3NA 1F77A 3V05A 4M0WA 3AE9B 2N0SB 5BYRA 5HHDG 3IT4B 1QOBA 3TEZA 3E9SA 4ZRPA 2HTME 4RGNA 4WAFA 1TY0A 1D5MC 2RPVA 3AV8A 4JWUC 3TEXA 3W5VB 3TEWA 3AE8B 1XCQL 2D5GA 4XE0A 1F2RI 4RGOS 2GRIA 2QJLA 3MFGA 4OZAA 3NZ3A 3ZYYX 2ACZB 1QILA 2INPE 3IXSA 1SBBB 4YXDB 1AYFA 3WCQA 2L32A 2PKOA 3KQ4A 4MM3B 1ZPSA 4HEA1 4YWGG 1QOFA 2IJ0A 3PZ8A 5D3IB 4DXGA 1ROEA 4MH8A 1GB4A 4LLGM 2BTEA 2ICIA 3P42A 1L5PA 1XEEA 2PVOD 2Y3AA 3LYYA 2NMQA 1RM6C 2ON8A 3P1MA 1UUPA 2PLPA 4RNAA 3AEGB 4REZA 3AH7A 1K50A 3AE6B 1C4PA 1EU3A 1LO5D 1QKZA 4IDIA 1TKYA 1UWMA 1FXIA 1WXQA 2RDGA 4B0EA 2E6XA 1Q10A 3C8YA 1EU4A 2TSSA 2B76B 2JXTA 1K52A 2JX5A 4WIPA 3MJ5A 1P7EA 4N58A 4D2KA 1ACCA 1TS2A 1YNTE 2JU6X 2AX5A 3VRBB 2PW9A 1DOXA 1XF5L 2MH7A 1ZXIA 1N5XA 2V4IB 2BYTA 1JWSD 2WDVB 1J7CA 1FFUA 1SXTA 3J9CA 1ENFA 4B0MA 1TY2A 5HG2A 4R3DA 2QILA 3H8HA 1JWAD 1JMLA 1YMHE 4L2YA 3R8BA 2X38A 3BVMA 5HI1A 5FR3A 2W54A 5G5HA 1ZP0B 1N63A 3U2SC 2WU5B 1L4ZB 4Q2JA 2GB1A 2WXPA 5BMGA 4H2AA 1C79A 4IKGA 1FNWA 2QSDA 2R61A 3U7ZA 3SEBA 2KAJA 5HFYA 1E0ZA 4J3OD 5EE3A 1QQRA 2W55A 3AE4B 1I7HA 2KWDA 2W3RA 1ET9A 2JQRB 4C7YA 2IPKD 4L23A 1ZOYB 2E3TA 1FM0D 2IDYA 1HQRD 3NVVA 2PMVA 4NAWB 2FBWB 3GS2A 4WQMA 5FKAC 1F2RC 4RCOA 1HZ5A 1M4VA 5G5GA 2J52A 1IGCA 4HJGE 3ZGZA 1NENB 3IAM1 1TS4A 1V1OA 1YN5A 2JWUA 2HDEA 2DYMA 3T3OA 4A55A 1XO3A 1KF6B 4ZYSA 1V1PB 1SE4A 2KN4A 4MACA 4TQ1A 2BS3B 4HKQA 2QEJC 4YTPB 5C3JB 1E10A 2WXNA 2WXGA 1D6EC 3HRDD 2V0GA 3FC4A 4NAMA 5D3DA 2JYTA 1MHXA 1FMAD 1SJHD 1T6BX 3B2FA 1XLNA 5I4DA 1KLGD 1GOZA 1EWYC 3VRAB 2BS4B 4L1BA 2LJIA 4GDLB 2K3UA 1CJEA 3ETRA 1PDXA 1L6VA 3CIRB 1VDVA 3MC0B 3KLSX 4EE2A 4JE3B 1AWDA 1N5WA 4KGRA 3SFEB 2LHDA 1BXTA 1FRDA 1L0YB 3HUIA 1D5ZC 3AM9A 3OWEB 2IGHA 1XCTL 1VZ8A 2NTTA 2BB6A 1QLBB 4P16A 3BYYB 3NVYA 4ZHOA 1ZDVA 1B9RA 4OZCA 2L52A 2N9LA 4KKIA 3BIID 5E6JA 2OHFA 3PZ7A 1MVKA 1E6EB 1XXGA 3MP9A 1I4PA 2DBYA 2WXRA 3P4PB 1UWXA 3AEBB 1L0VB 1FEHA 1PYWD 4JPSA 4OHJA 1V8CA 1I4HA 1FD6A 1SE3A 3AN1A 4ITKA 2WXIA 3I9V1 2KMMA 2KDMA 4PT5A 2NTSA 3ABVB 2LMCA 1B1ZA 5GXGB 5AUKA 3N9YC 2WP9B 1IUEA 1L6UA 1JWBD 2QMTA 3FILB 1JWUD 1FO4A 2I2YA 2K9XA 2SAKA 2AQ1B 1WSPA 3AEEB 2WXKA 3R2TA 1QOGA 1SIJA 4KX6B 1N62A 2WDQB 5EE1A 1FNUA 1NEKB 1SE2A 5MPOA 2L83A 1PGAA 2JZPA 2IGGA 1SSNA 1XLOA 4WH4A 1YJJA 4WWMA 4YT0B 5BMIA 1STEA 2IGDA 4YSXB 1ET6A 3NVZA 1I4QA 1SJED 1C4CA 5LNK1 3HVDA 3ZJUA 2ZW1A 5BMHA 1VRAB 4A6QA 1SF0A 3DWGC 1XLPA 1L0XB 3EA6A 4TSSA 2CU3A 2YEPF 2MJDA 2BS2B 4A8XC 2ONQA 2W82A 2WQYB 5TSSA 1N60A 3AE3B 4C56C 4IOIE 3AECB 3NS1A 2XNAC 1Y56A 1JROA 1C9FA 3EUB2 3BK1A 3B9JA 1ZE3D 2CJOA 3Q8AA 3AE2B 3W9CB 1OQRA 3Q8FA 1JWMD 1JRPA 1JW9D 1MPEA 1TS5A 3E56A 1C76A 3AEAB 1RFKA 3AMZA 3NVWA 1GPXA 4YTNB 2WXHA 3W1SA 1I4RA 4P6VF 4LTUA 5T8IA 1E7PB 1DYQA 4ARIA 4JX1C 1CQVA 3W5UB 3FILA 2WNMA 1EWCA 1IBXB 4LK0M 2YEPB 1WGKA 2Y5PA 4N6EB 1J7BA 3BVGA 2L1AA 1PGBA 1GAQB 3DWMA 3ZJTA 1KLUD 2BBCA 3Q8EA 1T3QA 2M0AA 3KWVA 1I4GA 1MI0A 3L4PA 4GDKB 1UGJA 2WXOA 1ZDXA 2Z8LA 4N59A 4HKZE 1BMLC 3PO0A 2J4XA 1J7AA 1QOAA 4KGTA 2LHEA 4XWWA 3SFDB 1VR9A 3GB1A 2LUMA 1SB3C 2WXLA 1XLQA 1CZPA 1R7SA 3ZJVA 5D7GA 1QF6A 2LGIA 2I38A 3BZDB 1CK1A 1RYJA 5JXVA 3NRZA 2LFIA 2WU2B 4RH6A 1YJIA 4CQNA 1K51A 4DQOC 1I4XA 4RFBA 3AE1B 2J53A 4OZBA 2H88B 2J42A 3Q8BA 3V3XA 2K5PA 2EKIA 1FRRA 1FCCC 2VZKD 4HRSA 1VLBA 4GLSC 3R2IA 1F0ZA 2WDRB 1KFYB 2BB5A 4A90A 3AEFB 4MT5A 1OQQA 1PFDA 2VZKB 2WLBA 1WYGA 1KRHA 1YQ4B 2DLBA 2PTLA 3EGRA 1YN3A 2DYOA 2EELA 3AEDB 3KWLA 2V3NA 4RGMA 1JQ4A 3U52E 1PGXA 2Y5CA 4ARCA 4C80A 3NUHB 3Q69A 1DOYA 1UNSA 4AQ7A 3U4EG 1C4AA 4HROA 5BYQA 2M56B 2FE8A 4US9A 1PUTA 4DXFA 2JSVX 4RF1A 3B2GA 1TKGA 3BYTB 3IAS1 4KKJA 2BW2A 2G9HD 1FIQA 1RWSA 2AQ2B 1NYRA 2INNE 1P7FA 1WWTA 1ZUD2 2K22A 4ZHPA 2CJNA 3TUOA 3AE5B 1VZ6A 2G1EA 2PVGC 1GB1A 1V1PA 5AUIA 3VR9B 2AQ3B 3O13A 1VZ7A 3HVZA 3P4RB 4XWTA 3ZQ4A 4XDCA 1HA5A 4OVZA 2MJ3A 2QIEB 5H8YE 3TSSA 5FK9C 3W2DA 1IBXA 4NJCA 1C78A 2JYEA 2V3PA 3FAHA 4FXCA 1D4BA 2WXQA 3SR6A 2RMMA 1JALA 5H92C 4JWSC 1BUIC 5EE0A 2KQ4X 5C2TB 4A9AA 3IT6B 1ESFA 1FNVA 2Q5WD 3BVZA 3VQIA 4C7ZA 1FCLA 1KTKA 1N61A 2M19A 3MHZA 1YN4A 3BWUD 3Q8CA 4XDDA 4WURA 2BT6A 4AS1A 2RDHA 2WXJA 1L4DB 4OW0A 2GI9A 1TS3A 2ZW0A 3AB5A 1IGDA 1ZXHA 2KACA 3AE7B 1AN8A 1KH0A 3TEYA 1JCKB 1AW7A 2FUG1 3UI3A 1NYQA 2MEKA 1C77A 2SEBD 2DWQA 1NI3A 4ZOHC 4ZRQA 4RF0A 3P63A 3I57A 1DGJA 1TZOA 2WXFA 3RFZB 1HXYD 1E9MA 1MHHE 1VJKA 1K53A 1HEZE 1D5XC 4UDUC 2W3SA 4KGSA 2WXMA 4NZLB 3P4QB 1DOIA 3RPFC 1OFFA 1TYGB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1FXA A;  1FFV A;  1L6U A;  1JWB D;  1ZP0 B;  1N63 A;  2PIA A;  2WDR B;  1KFY B;  2WU5 B;  5G5H A;  1FO4 A;  2K9X A;  3AEF B;  1FRR A;  3AEE B;  1OQQ A;  1PFD A;  1QOG A;  1SIJ A;  1WYG A;  1N62 A;  2LEK A;  2WLB A;  1KRH A;  1YQ4 B;  1TJE A;  2WDQ B;  2WS3 B;  5EE1 A;  1NEK B;  1VLB A;  2H89 B;  3KWL A;  5MPO A;  3AED B;  2L83 A;  1JQ4 A;  1YQ3 B;  1WRI A;  4YSY B;  2KAJ A;  3LB8 C;  1NVI D;  2Y5C A;  1TKE A;  4YSZ B;  1E0Z A;  4C80 A;  1XLO A;  4WWM A;  1YJJ A;  4YT0 B;  5EE3 A;  1A70 A;  5EE9 A;  3LXF A;  1V97 A;  1DOY A;  4YSX B;  3NVZ A;  4US8 A;  2W55 A;  4YTM B;  4HRO A;  3AE4 B;  1I7H A;  2W3R A;  2JQR B;  2M56 B;  4C7Y A;  3P4S B;  4US9 A;  1SF0 A;  1PUT A;  3CWI A;  3DWG C;  1XLP A;  1ZOY B;  2E3T A;  1FM0 D;  3B2G A;  3NVV A;  1TKG A;  2MJE A;  4USA A;  1QT9 A;  3VR8 B;  2CU3 A;  1FIQ A;  2MJD A;  2FBW B;  4WQM A;  2BS2 B;  1RWS A;  1NYR A;  1WWT A;  1ZUD 2;  2WQY B;  3AE9 B;  1N60 A;  2N0S B;  3AE3 B;  2K22 A;  4ZHP A;  3AEC B;  3NS1 A;  2CJN A;  5G5G A;  1JRO A;  3AE5 B;  1QOB A;  3EUB 2;  3B9J A;  2G1E A;  2PVG C;  1NEN B;  2HTM E;  4KX6 B;  2CJO A;  5AUI A;  3AE2 B;  4JWU C;  3AV8 A;  3VR9 B;  1OQR A;  3W5V B;  3W9C B;  3AE8 B;  3P4R B;  3HVZ A;  1JRP A;  1JW9 D;  1XO3 A;  1KF6 B;  2QJL A;  3AEA B;  1RFK A;  3ZYY X;  2ACZ B;  2MJ3 A;  2QIE B;  3AMZ A;  5H8Y E;  3NVW A;  4YXD B;  1AYF A;  1GPX A;  2BS3 B;  4YTN B;  4YTP B;  3WCQ A;  5C3J B;  4P6V F;  4LTU A;  1E10 A;  3FAH A;  4FXC A;  1E7P B;  2PKO A;  4JX1 C;  1QOF A;  3HRD D;  3W5U B;  3FC4 A;  3SR6 A;  1JAL A;  5H92 C;  4JWS C;  1FMA D;  1ROE A;  5EE0 A;  5C2T B;  4A9A A;  3B2F A;  1WGK A;  1XLN A;  4N6E B;  1J7B A;  1L5P A;  1F0Z A;  2W54 A;  1EWY C;  2PVO D;  2Q5W D;  1RM6 C;  3P1M A;  1GAQ B;  3VRA B;  3DWM A;  2BS4 B;  4C7Z A;  3AEG B;  1N61 A;  2M19 A;  1T3Q A;  2WP9 B;  3AH7 A;  3AE6 B;  1CJE A;  3ETR A;  1PDX A;  1L6V A;  3CIR B;  1VDV A;  3L4P A;  2BT6 A;  4IDI A;  1TKY A;  1AWD A;  1FXI A;  1N5W A;  1UWM A;  1WXQ A;  3SFE B;  1FRD A;  3HUI A;  4N59 A;  3AM9 A;  3PO0 A;  2B76 B;  3AB5 A;  1QLB B;  2JX5 A;  1J7A A;  1QOA A;  3NVY A;  4N58 A;  4ZHO A;  3SFD B;  1B9R A;  1SB3 C;  1XLQ A;  2L52 A;  1CZP A;  1R7S A;  2AX5 A;  3AE7 B;  3VRB B;  1DOX A;  3BII D;  1QF6 A;  2OHF A;  2MH7 A;  1ZXI A;  1E6E B;  1N5X A;  1RYJ A;  1NYQ A;  2DBY A;  3P4P B;  2DWQ A;  1NI3 A;  2WDV B;  1J7C A;  3NRZ A;  1FFU A;  1L0V B;  3AEB B;  4ZOH C;  2WU2 B;  3P63 A;  1YJI A;  1DGJ A;  1V8C A;  2EKI A;  1E9M A;  3AN1 A;  1JWA D;  1VJK A;  4ITK A;  2KMM A;  3AE1 B;  2W3S A;  3ABV B;  5GXG B;  5AUK A;  2H88 B;  3P4Q B;  1DOI A;  3RPF C;  2K5P A;  1OFF A;  4HRS A;  1TYG B;  1IUE A; 
#chains in the Genus database with same CATH topology
 3GP7 A;  3A1Q A;  4AJY B;  4BFR A;  1UEL A;  5BYS A;  4FJV B;  3OJ3 A;  3VXW A;  2PE9 A;  2H89 B;  1EM7 A;  2D3B A;  4G3X B;  4YSY B;  2PJH A;  3R66 C;  3LB8 C;  3DCG A;  2MRP A;  3MTN B;  2N7J A;  2NPT A;  2LD9 A;  1SEB D;  1J19 A;  2OED A;  3CWI A;  2K0P A;  1T5X D;  2MJE A;  1QT9 A;  3VR8 B;  3V05 A;  5BYR A;  4FHJ A;  1V6E A;  1QOB A;  2Z0D B;  4WAF A;  4JWU C;  2RPV A;  3OAW A;  3W5V B;  3AE8 B;  3C0R B;  3CST A;  2KWU B;  4HVB A;  2BYV E;  1Q1O A;  3NZ3 A;  3ZYY X;  1QIL A;  2INP E;  3IXS A;  1AYF A;  2KWV B;  2OJW A;  4LNK A;  2PKO A;  3U8Z A;  2QC8 A;  1QOF A;  4ACF A;  1S3S G;  5G2N A;  4DXG A;  2DAJ A;  4MJS A;  1ROE A;  1GB4 A;  2I1K A;  2WYQ A;  4II3 B;  1RM6 C;  3PS6 A;  2ON8 A;  3P1M A;  2M8S A;  3A1Q B;  3AEG B;  2YLM A;  3AE6 B;  3ALB A;  4MGI E;  4TKN A;  1TKY A;  4B0E A;  2E6X A;  3QX1 A;  5JHA A;  2FCQ A;  2JXT A;  4WIP A;  1P7E A;  2PE6 B;  3VVW B;  4D2K A;  3K9O B;  3ML8 A;  2I1J A;  1XF5 L;  2MH7 A;  4AP4 C;  1J7C A;  3KH0 A;  1ENF A;  2K1F A;  2M0X A;  4R3D A;  2QIL A;  4NAW A;  2VRR B;  2LUE A;  2OJR A;  2X38 A;  1IP9 A;  1G6J A;  3U2S C;  2WU5 B;  4Q2J A;  2L05 A;  4LJP B;  3UIP B;  3RUL A;  5J17 A;  4DXA B;  2EMT A;  1XT9 B;  5D6J B;  4IC7 B;  5DPT A;  2KAJ A;  1WIA A;  5EE3 A;  2C60 A;  4I6L B;  2RSU A;  4WWN A;  2MBO A;  1IPG A;  3SHQ A;  5E6N A;  2W3R A;  4BKS A;  5CHW A;  4C7Y A;  3W1S C;  2V3S A;  3NS8 A;  5IP4 D;  4L23 A;  1J8C A;  2KTR A;  2E3T A;  1WRD B;  1WM3 A;  3QJZ A;  4IM0 A;  4WQM A;  3GS2 A;  5FKA C;  1LM8 B;  4QAY A;  1F2R C;  4A3P A;  1WFY A;  1M4V A;  3A4R A;  4ANV A;  4E3C A;  3ZGZ A;  2UU7 A;  1KLV A;  1YN5 A;  2HDE A;  2KLC A;  3WAO A;  4NQK E;  4HKQ A;  3A33 B;  5IKC M;  3IVF A;  3DQV A;  3FC4 A;  1KOT A;  2JYT A;  1WZ3 A;  1FMA D;  3VUW A;  2KJ6 A;  3DBR B;  2KT7 A;  3H6N A;  1PQS A;  5D2M B;  2KDB A;  1PDX A;  1VDV A;  3KLS X;  3SFE B;  1N5W A;  2LXC A;  2IGH A;  2KO3 A;  3Q6B A;  2AL6 A;  1TZ1 A;  1ISN A;  5IOI A;  4ZRK A;  2KFK A;  3BII D;  2KVZ A;  2OHF A;  4ICU A;  1OQY A;  3PVL A;  2DBY A;  3P4P B;  4JL9 A;  1I35 A;  1L0V B;  1FEH A;  2J0M A;  3RZW C;  1QZE A;  1WMH B;  1I4H A;  3TIX A;  3I9V 1;  2KMM A;  4PT5 A;  2LMC A;  5GXG B;  3IBE A;  3ZLZ A;  2IZV B;  2I2Y A;  2K9X A;  2SAK A;  1LFD A;  3AEE B;  2WDQ B;  1NEK B;  5MPO A;  2L83 A;  2IGG A;  2JUO A;  1NBF C;  3B1L X;  1STE A;  2IGD A;  4YSX B;  1ET6 A;  3NVZ A;  2IO2 B;  3NJT A;  3ZJU A;  2JZZ A;  3VUX A;  1XLP A;  3QIJ A;  4EZL A;  4LDT B;  3QK0 A;  4GDL A;  4A8X C;  2ONQ A;  2WQY B;  4C56 C;  3AE3 B;  4IOI E;  2MCN B;  2XNA C;  3EUB 2;  3BK1 A;  3B9J A;  4XC2 A;  1ZE3 D;  3W9C B;  1OQR A;  1TTN A;  1JW9 D;  5DCN A;  1TS5 A;  4JQW C;  4LJO B;  3DBL B;  1RFK A;  4W9L A;  2JRI B;  3W1S A;  4P1B C;  4LTU A;  3W5U B;  3ZKJ C;  3H7P B;  1IBX B;  2FCM A;  4BAX A;  3OJ4 B;  4N6E B;  1YX6 B;  2L1A A;  1Z2M A;  1GAQ B;  4IG7 B;  3ZJT A;  1MI0 A;  3DBL I;  3L4P A;  2CHZ A;  2IYD B;  2Z8L A;  4HKZ E;  3PO0 A;  4BOZ B;  2J4X A;  4KGT A;  2LHE A;  4XWW A;  2PEA A;  2MLB A;  3ZJV A;  4C4V B;  1CK1 A;  2LFI A;  2WU2 B;  1YJI A;  1K51 A;  1MFW A;  2HE7 A;  4ICV A;  5KHO A;  3AE1 B;  2H88 B;  4DDG D;  1FRR A;  1FCC C;  5JH5 C;  1VLB A;  2KHW B;  4EZK A;  1F0Z A;  1P0R A;  1C1Y B;  1YQ4 B;  3N32 A;  2DYO A;  2EEL A;  1JQ4 A;  2JXX A;  4KZ0 A;  2KDF B;  3U52 E;  1PGX A;  2N9E B;  4ARC A;  4KDI C;  3NUH B;  1DOY A;  2K6Q A;  1C4A A;  3DVN V;  5CX3 A;  3N1Y C;  2M56 B;  5BYQ A;  4US9 A;  3V60 A;  3RCZ A;  3KW5 B;  2Z0E B;  1TKG A;  3BYT B;  3GE3 C;  3IAS 1;  2JZ3 B;  1FIQ A;  1NYR A;  1P7F A;  5LLI A;  4ZHP A;  3AE5 B;  3JSV B;  2IO3 B;  2KXJ A;  4HLE A;  5AUI A;  1T0S C;  4XDC A;  4OVZ A;  5H8Y E;  3TSS A;  1C78 A;  2V3P A;  3FAH A;  2CU1 A;  4BZA A;  4DHJ D;  2AWT A;  1BUI C;  5EE0 A;  2YVC A;  4M00 A;  4NJ6 A;  2BYE A;  2KN5 A;  4I6N B;  3RNE C;  3VQI A;  2L76 A;  4HCN B;  1KTK A;  2GBN A;  1WGH A;  3MHZ A;  4PK1 A;  2DNF A;  1GJZ A;  2GI9 A;  3CSF A;  4GMV A;  4HXD A;  4F8C B;  2KAC A;  1P9D U;  2LRU A;  3TEY A;  2FUG 1;  3PZD A;  3SD5 A;  1C77 A;  2N1W A;  3UIN B;  2LGX A;  4ZOH C;  1E9M A;  3PHX B;  1WX9 A;  1DOI A;  3RPF C;  1TYG B;  1FXA A;  1FFV A;  2JWZ A;  2D3G A;  3HIZ A;  3ZW3 A;  1E8Y A;  1ZW7 A;  2WS3 B;  1WYW B;  4K81 A;  3VH4 B;  4TMA B;  3I63 C;  1A70 A;  1V97 A;  3Q2A C;  2WDT B;  4US8 A;  4YTM B;  2KQ7 A;  2K39 A;  1TGZ B;  3URY A;  4USA A;  2XN9 C;  3C19 A;  4M0W B;  1F77 A;  4HDQ A;  1WJ4 A;  2BWE S;  3A4S C;  2KOX A;  3IT4 B;  4ZRP A;  4RGN A;  1TY0 A;  4FHK A;  3ZUN A;  1D5M C;  3AV8 A;  2BTE A;  1XQQ A;  2IY1 B;  3DVG X;  3TEX A;  3ZNZ B;  2CHX A;  3NY5 A;  4BKG A;  4BKT A;  2QJL A;  4OZA A;  3A9J B;  1BT0 A;  4YWG G;  3NZS A;  1P98 A;  1L5P A;  3IG3 A;  1SIF A;  2KC2 A;  1UUP A;  2V1Y A;  4RNA A;  1C4P A;  2O6V D;  4IDI A;  1WXQ A;  1FXI A;  3KYD D;  2HJ8 A;  3GOE A;  1Q10 A;  5J18 A;  2TSS A;  2O6V A;  4PYZ A;  1GC6 A;  2RPQ A;  1WF9 A;  3V6E B;  3WAL A;  1A5R A;  3TJP A;  2NCN A;  3GZN B;  1JWS D;  2BYT A;  4C00 A;  1GG3 A;  1FFU A;  4B0M A;  3NZU A;  1TY2 A;  4A3O A;  2FIF A;  3ZXV A;  3H8H A;  4KV2 A;  4PS7 A;  5FR3 A;  3V61 A;  2W54 A;  1L4Z B;  4E71 A;  2GB1 A;  3KUD B;  3APF A;  2LVO A;  4BOS C;  1FNW A;  3VAW A;  2R61 A;  3N20 C;  2INC C;  2J0K A;  1E0Z A;  4J3O D;  1WJN A;  3VTU A;  3UF8 A;  1QQR A;  5CHV C;  2KWD A;  1D3Z A;  1ZOY B;  3N1X C;  1FM0 D;  2M1M A;  4NAW B;  4LDT D;  3ZTD A;  1SGH A;  3ZXR A;  3DVG Y;  4HJG E;  1V1O A;  3T3O A;  4B95 A;  4KZC A;  4W9E A;  3HK0 A;  1RAX A;  4MH0 E;  4IUM B;  4YTP B;  2C7N B;  2WXN A;  2WXG A;  2D3C A;  2V0G A;  3ZIM A;  1NI2 A;  1R4M B;  3B2F A;  1XLN A;  1KLG D;  3OLM D;  2HD5 B;  3NG0 A;  1YD8 U;  1CJE A;  1L6V A;  4EE2 A;  2N9P C;  4JE3 B;  4KGR A;  1MJD A;  3U30 A;  3OWE B;  3AM9 A;  4P16 A;  2FCN A;  3NVY A;  3APC A;  2DX5 B;  4ZHO A;  2GBK A;  2ZNV B;  2L52 A;  3B0A A;  2N9L A;  4WWO A;  1UBQ A;  3Q14 C;  4JIO U;  1V5O A;  3AEB B;  1V8C A;  1WXA A;  2WHI A;  3AN1 A;  2WXI A;  2LGD A;  3ABV B;  1B1Z A;  5IN7 A;  4LNN A;  4G11 A;  2WP9 B;  1IUE A;  3L10 B;  1L6U A;  3K9P B;  2QMT A;  3FIL B;  1JWU D;  1FO4 A;  4HWI B;  4FBJ B;  3PRE A;  3R2T A;  2FUH B;  4KX6 B;  5E6O A;  3A9K A;  5EE1 A;  4MJS B;  1PGA A;  1N6Z A;  1JRU A;  5HKH A;  3DBH B;  4WH4 A;  4YT0 B;  5BMI A;  2MBB B;  1E5W A;  4W9K A;  3RNC C;  1SJE D;  3HVD A;  2ZW1 A;  5BMH A;  1UBI A;  4A6Q A;  1ZKH A;  2KLG A;  3R3M A;  2KDE B;  3RNF C;  5TSS A;  1N60 A;  2KTF A;  3AEC B;  1Y56 A;  2KJR A;  4GOC A;  2GMI C;  3Q3N C;  3DBH I;  2LRW A;  3QHT A;  2KYW A;  1JWM D;  1JRP A;  3E56 A;  3AEA B;  2BGF A;  3NVW A;  4KSL C;  3DBR I;  2BQQ A;  4ARI A;  2WNM A;  1EWC A;  1J7B A;  5BO4 B;  3ONS A;  3DWM A;  1GC7 A;  3D32 A;  3Q8E A;  3ZDT A;  2DZM A;  2ZCC A;  1UGJ A;  1ZDX A;  1BML C;  2BF8 B;  1VR9 A;  1WR1 A;  3V62 A;  4LNF A;  2KTR B;  1R7S A;  4KIK A;  3QCA A;  3PT2 B;  3DOW A;  1WJ6 A;  5JXV A;  2RD0 A;  3NRZ A;  4G0N B;  2BPS A;  4RH6 A;  2UYZ B;  1WH3 A;  4CQN A;  2CR5 A;  1LXD A;  2NR2 A;  3QAQ A;  2D10 A;  2J53 A;  2NBV B;  2KVR A;  4FUL A;  3M95 A;  3V3X A;  2K5P A;  2JPH A;  4HRS A;  2VZK D;  4XX5 A;  1KFY B;  3AEF B;  4CYE A;  1OQQ A;  2VZK B;  3MC9 A;  1KRH A;  2DZJ A;  3AED B;  2V3N A;  2REX A;  4GGQ A;  2Y5C A;  3Q69 A;  4PS3 A;  1FPY A;  2FE8 A;  4DXF A;  2QDF A;  2JSV X;  3RN9 C;  2BW2 A;  1RWS A;  2AQ2 B;  2CJN A;  1GB1 A;  2JRH A;  4ZRI A;  3RUI B;  4KIK B;  2MX2 A;  3RMK C;  3W2D A;  3WAP A;  3H1U A;  4A20 A;  3SR6 A;  2KQ4 X;  3IT6 B;  1C3T A;  1E8X A;  2Q5W D;  2ZPN A;  4NJ7 A;  1H8C A;  4C7Z A;  1FCL A;  1N61 A;  2M19 A;  1YN4 A;  3BWU D;  3Q8C A;  4XDD A;  1WGR A;  3HM6 X;  2C9W B;  1TS3 A;  2MWS B;  3AB5 A;  1IGD A;  4RM8 A;  2BKF A;  1AW7 A;  1NYQ A;  2MEK A;  2MHJ A;  3P63 A;  2FAZ A;  1DGJ A;  3RFZ B;  4MSM B;  4IM2 A;  1MHH E;  1K53 A;  4UDU C;  2W3S A;  4KGS A;  2WXM A;  5CHF A;  1V49 A;  1M94 A;  1WMH A;  4W9J A;  1OFF A;  4PYU A;  2PIA A;  3EHV A;  5DPW A;  5KHQ A;  4NPN A;  4XZ4 A;  3NOB A;  5AZH A;  1E7U A;  1YQ3 B;  5E6P A;  4TQ0 A;  5EE9 A;  4O1N A;  2N9K A;  2NVU I;  2Z59 B;  3DDC B;  3IHP C;  4K1R B;  4F7Z A;  4ZRJ A;  5G55 A;  4BBN F;  1TIF A;  1Z5S B;  4W9I A;  4B6W A;  2LI5 A;  2N0S B;  2MA9 B;  5HHD G;  2MP2 B;  2MP2 A;  2KDI A;  5LXH A;  1OEY J;  5EDS A;  3TEZ A;  1VD2 A;  4XGA B;  4M02 A;  4DHJ B;  3X0W A;  4XE0 A;  1XCQ L;  2LGS A;  1F2R I;  1WE7 A;  2GRI A;  2ACZ B;  3ECI A;  5C23 A;  1SBB B;  2G4S A;  3WCQ A;  3SU8 X;  2JY6 A;  2L32 A;  1ZPS A;  2IJ0 A;  3UGB B;  5D3I B;  4S17 A;  1GUA B;  4MH8 A;  1RRB A;  3P42 A;  2PVO D;  2Y3A A;  3LYY A;  1WZ0 A;  3PLU A;  2PLP A;  2R2Q A;  4REZ A;  4K3C A;  1LO5 D;  2L0T A;  3DHH C;  4WWP A;  1RLF A;  2L0F A;  2RDG A;  5DPR A;  5IA7 A;  1WXV A;  3WA0 A;  3C8Y A;  1ZGU B;  3OG5 A;  2KMC A;  1ACC A;  1TS2 A;  2JU6 X;  2RDB C;  2AX5 A;  2PW9 A;  3M63 B;  1DOX A;  1ZXI A;  1N5X A;  2V4I B;  4MDK E;  2WDV B;  2K6D B;  4FLH A;  3J9C A;  5HG2 A;  4JGH B;  1RFA A;  1YMH E;  2GOW A;  3L16 A;  2CKH B;  3BVM A;  5HI1 A;  2ZCB A;  3KYC D;  3ENE A;  1EO6 A;  1ZP0 B;  1N63 A;  4N9F 4;  3R7Q A;  4EEW A;  2ZEQ A;  2FID A;  5BMG A;  4H2A A;  1C79 A;  4IKG A;  4DBG A;  2BVC A;  1OEY A;  3SEB A;  2G45 B;  2JT4 B;  2W9N A;  4K7S A;  3N3K B;  4E74 A;  2W55 A;  3AE4 B;  2K8H A;  2JQR B;  4GN1 A;  1YQB A;  2IPK D;  3I5J C;  2NBU A;  2IDY A;  1HQR D;  1U4A A;  4ZYN A;  2NS5 A;  2PMV A;  3TMP B;  2FBW B;  1T0Y A;  3DBS A;  2J52 A;  2X8X X;  1IGC A;  4OVU A;  1NEN B;  1T0Q C;  1TS4 A;  2QHO A;  2JWU A;  3QC8 B;  4B9K A;  3M3J A;  4JLC A;  1SE4 A;  4TQ1 A;  2QEJ C;  2XBB C;  3N30 A;  1YOV B;  1D6E C;  2XEW A;  2J7Q B;  1MHX A;  3QQ8 B;  1T6B X;  4MGZ E;  5I4D A;  3P2B A;  1GOZ A;  3I3T B;  4RMA A;  3VRA B;  2K8B A;  2LJI A;  4GDL B;  2K3U A;  3ETR A;  3CIR B;  3KVF B;  4K7W A;  3N1Z C;  2LHD A;  1BXT A;  1FRD A;  1L0Y B;  3RD2 A;  1XCT L;  2BB6 A;  2NTT A;  1QLB B;  3BYY B;  4WJO A;  1ZDV A;  1B9R A;  2N7D A;  1I42 A;  2WX1 A;  4KKI A;  2HTH A;  3PZ7 A;  1MVK A;  1E6E B;  1XXG A;  2BYF A;  2WXR A;  1UWX A;  1OTR B;  1E8W A;  4OHJ A;  1PYW D;  4AUQ C;  1SE3 A;  3UQA A;  4ITK A;  2IBI B;  2KDM A;  2NTS A;  4MEL A;  1L7Y A;  1WX8 A;  2BKR B;  1JWB D;  1UD7 A;  3R8B A;  2AQ1 B;  1WSP A;  3AU4 A;  1QOG A;  4DHZ B;  4IWP A;  4YL8 A;  1EUV B;  1XD3 B;  2JZP A;  5J2R A;  1SSN A;  1YJJ A;  3KUZ A;  3MHS D;  3X23 A;  2LAS A;  2J0J A;  3EEC A;  5LNK 1;  1VRA B;  2GLS A;  1SF0 A;  3DWG C;  3T9L A;  1L0X B;  2DAF A;  4TSS A;  2CU3 A;  2YEP F;  2L7R A;  2BS2 B;  3W1Y A;  2W82 A;  3NS1 A;  1JRO A;  3VUY A;  1C9F A;  2CJO A;  3Q8A A;  1X1M A;  1C76 A;  4MGY E;  3ZDM C;  3RI7 C;  2WXH A;  4P6V F;  5T8I A;  1YX5 B;  3NHE B;  1DYQ A;  1CQV A;  2AL3 A;  2YEP B;  2N4F A;  1WGK A;  2FCS A;  5C1Z A;  4GB9 A;  1KLU D;  2BBC A;  1T3Q A;  2DZI A;  2A4Z A;  2M0A A;  2MBE A;  1I4G A;  3RNA C;  1TBE A;  4OVV A;  2EKE C;  3ZTC A;  4GDK B;  2WXO A;  5L83 A;  4N59 A;  1J7A A;  3SFD B;  1SB3 C;  2WXL A;  1XLQ A;  1CZP A;  1F9J A;  5D7G A;  1QF6 A;  2LGI A;  2I38 A;  3BZD B;  2GBR A;  5AZF A;  2AYO B;  3Q3F A;  2ZJD A;  4DQO C;  1E7V A;  4FA6 A;  4RFB A;  3LJ3 A;  3Q8B A;  2FNJ B;  4AOF A;  3R2I A;  2WDR B;  4HPL B;  4A90 A;  1PFD A;  3KUC B;  1WYG A;  2RGF A;  3WAM A;  1P3Q U;  4BKS D;  2DLB A;  2PTL A;  4PS8 A;  1YN3 A;  4RGM A;  2LVQ A;  4AQ7 A;  2XK5 B;  1T0R C;  1V2Y A;  4HRO A;  4AJW A;  2L00 B;  3ZNH B;  4WQO B;  3WAN A;  4RF1 A;  3PSE B;  4URK A;  2G9H D;  3SDL C;  2INN E;  4MGK E;  4LCD E;  1ZUD 2;  4AWJ A;  4IW0 A;  4P7I A;  3TUO A;  3JSV A;  1VZ6 A;  2LGY A;  2V4L A;  2AQ3 B;  4HJK A;  3O13 A;  3HVZ A;  2CS4 A;  1FXT B;  4EKU A;  5CTR C;  1MG8 A;  1WM2 A;  3ZQ4 A;  3L13 A;  1HA5 A;  4KSK C;  2QIE B;  3R7R A;  5FK9 C;  2KMA A;  4NJC A;  4GIV A;  2B3A A;  4HPP A;  1WI0 A;  2WXQ A;  1JAL A;  4JWS C;  3EFC A;  4I6P A;  5C2T B;  1ESF A;  1FNV A;  3ML9 A;  1WR6 E;  4M8N A;  4MSQ B;  1V81 A;  1SE9 A;  3B08 A;  2RDH A;  2WXJ A;  1CMX B;  2ASQ A;  2RR9 A;  2ZW0 A;  1UF0 A;  4W9F A;  1ZXH A;  2KD0 A;  3RNB C;  1R4N B;  3Q3O C;  1AN8 A;  5JZE B;  1JCK B;  3UI3 A;  4ZDV A;  2KX0 A;  4ANW A;  2SEB D;  1NI3 A;  4ZRQ A;  4RF0 A;  1TZO A;  2M17 A;  4IM3 A;  1VJK A;  2KC1 A;  1HEZ E;  1D5X C;  4J6I A;  4P1C C;  1YIW A;  4NZL B;  2KJH B;  2IO1 B;  1WGG A;  2N7E A;  2AEH A;  1IYF A;  1Q5W B;  1R4N I;  1HZ6 A;  3ZO5 B;  2JF5 A;  2LEK A;  3RNG C;  1TJE A;  4WJP A;  4FJZ A;  5IO9 A;  1HTQ A;  4ASW C;  4RGT A;  1WRI A;  4YSZ B;  1NVI D;  1TKE A;  3A9K B;  3LXF A;  3P4S B;  3HM3 A;  3BK2 A;  4TV3 A;  3RT3 B;  1F52 A;  3AI5 A;  3T3N A;  4M0W A;  3AE9 B;  2MBH A;  2G4D B;  3E9S A;  2HTM E;  4K7U A;  3TEW A;  2D5G A;  1LQB A;  4RGO S;  1E90 A;  4II2 B;  1UZX B;  2KNB A;  3H7S A;  3MFG A;  4FJY A;  1H4R A;  1MG4 A;  4EUT A;  4YXD B;  2KFJ A;  2KK8 A;  3KQ4 A;  3L0W B;  4MM3 B;  4HEA 1;  2O2V B;  2LWP A;  3PZ8 A;  4W9D A;  3MJW A;  4LLG M;  2ICI A;  2LXA A;  1XEE A;  2NMQ A;  4IWQ A;  4LNI A;  3AH7 A;  3VH3 B;  4WAA A;  1K50 A;  1AAR A;  1EU3 A;  1OGW A;  1QKZ A;  1EF5 A;  1UWM A;  4CHK A;  1F1H A;  2M4N A;  1EU4 A;  4GSW A;  2B76 B;  1K52 A;  2JX5 A;  2OOB B;  3MJ5 A;  3Q3M C;  4N58 A;  1YNT E;  3ZNG C;  3VRB B;  3T8M A;  4NQL B;  5TR5 A;  2L8J A;  4NY0 A;  3ZRC A;  1WE6 A;  1SXT A;  3VFK A;  2LJ5 A;  5JHB A;  1JWA D;  1JML A;  2DEN B;  4L2Y A;  3JW0 X;  4HK2 A;  3RZF A;  2QCZ A;  5G5H A;  2KWC A;  3UQB A;  2MSE D;  3HHM A;  3ZVV A;  5LXI B;  2WXP A;  2DYB A;  3PTF C;  3PRP B;  2QSD A;  3U7Z A;  1J0G A;  5HFY A;  4X57 B;  5D94 A;  2GBJ A;  2NBW B;  1I7H A;  2KKC A;  1TT5 B;  4DWF A;  1ET9 A;  2JVC A;  3BY4 B;  4RM9 A;  2N1V A;  2UWQ A;  3NVV A;  4DDI D;  3M62 B;  4RCO A;  3IFW B;  1HZ5 A;  4K3B A;  5G5G A;  4EZJ A;  3QA8 A;  3IAM 1;  3PRM B;  3JVZ X;  2DYM A;  2D2Q A;  1UH6 A;  3MC8 A;  4A55 A;  1XO3 A;  1KF6 B;  4ZYS A;  1V1P B;  2KN4 A;  4MAC A;  2BS3 B;  2MBQ A;  5C3J B;  3O65 B;  3AXC A;  1YJ1 A;  3L54 A;  1E10 A;  4TUU A;  2R2O A;  5L95 C;  3HRD D;  4NAM A;  5D3D A;  1SJH D;  3LDZ E;  2ZZP B;  4KVG B;  1EWY C;  3EC8 A;  4HPM B;  4EFO A;  4XYC A;  3VTV A;  3VDZ A;  2BS4 B;  2XK5 A;  4L1B A;  1WXS A;  4S0R A;  3MC0 B;  4GDK A;  2C7M B;  3V6C B;  1AWD A;  4DK5 A;  1WGY A;  3HUI A;  1KM7 A;  1D5Z C;  4HDO A;  2WGS A;  1VZ8 A;  4OZC A;  2V9H A;  5E6J A;  1Y8R C;  2C7H A;  3MP9 A;  1I4P A;  3TL5 A;  4JPS A;  1HE8 A;  3CF6 E;  1FD6 A;  4ANX A;  2DHZ A;  2PPH A;  2KZR A;  5AUK A;  3PV1 A;  3N9Y C;  3FKY A;  2WXK A;  5GMV A;  1SIJ A;  3AU5 A;  1N62 A;  3QWZ B;  2WWZ A;  5DPS A;  2VH1 A;  1EF1 A;  4G50 A;  1FNU A;  1SE2 A;  3WIM A;  2A5U A;  2ZVO A;  4W9C A;  1P1A A;  1XLO A;  4WWM A;  4EOY A;  5AZG A;  3H7P A;  4WJN A;  1L2N A;  2MQJ A;  1I4Q A;  2GBM A;  1C4C A;  1GNU A;  3EA6 A;  3PLV A;  2MJD A;  4M8M A;  4BVU C;  3PRZ A;  3L08 A;  2C5L C;  2G3Q B;  4MEM A;  3AE2 B;  3Q8F A;  1WX7 A;  2KQS A;  1MPE A;  2ZNV C;  1K8R B;  3TBL D;  3AMZ A;  2D3A A;  1GPX A;  4YTN B;  1I4R A;  1E7P B;  1HTO A;  4JX1 C;  3PHW B;  4GXB A;  1S1Q B;  3FIL A;  3H9D A;  4LK0 M;  2KX3 A;  2Y5P A;  2LZ6 A;  4FAD A;  3BVG A;  1PGB A;  3RYT A;  2LVP A;  3PGE A;  3S2A A;  3UIO B;  3VTW A;  3KWV A;  3QAR A;  2IND C;  4ANU A;  1WXM A;  1VCB A;  1QOA A;  3GB1 A;  2LUM A;  2KFK B;  4M01 A;  5FR6 A;  1RYJ A;  4LNO A;  4FN2 A;  2HJ1 A;  1I4X A;  5IAA C;  1E8Z A;  2D07 B;  4OZB A;  2KAN A;  2J42 A;  3DHI C;  2EKI A;  4HCP B;  3GE8 C;  3Q3J A;  4GLS C;  5AEK B;  2BB5 A;  3U7D A;  2D11 A;  4MT5 A;  2K8C A;  2WLB A;  3EGR A;  3KWL A;  2IY0 B;  4CO7 A;  4W9H A;  2CHW A;  4C80 A;  3BIN A;  3DPD A;  2WX0 A;  1UNS A;  3U4E G;  3JYU A;  3DVN U;  1PUT A;  3APD A;  2N9X A;  2DZK A;  3B2G A;  4KKJ A;  2EMS A;  1Q0W B;  1WWT A;  4BBN C;  2K22 A;  3ZNI D;  4GU2 A;  1R4M I;  4DHZ E;  2G1E A;  2PVG C;  1V1P A;  3VR9 B;  2L3Z A;  4XWT A;  1VZ7 A;  3P4R B;  2MJ3 A;  2MW5 A;  3CMM B;  2VH2 A;  2IO0 B;  4IWO A;  2K25 A;  1IBX A;  3L17 A;  2JYE A;  4FXC A;  1D4B A;  4MM3 A;  1KJT A;  2O2V A;  2BWF A;  3DHG C;  4KDL B;  1UGM A;  2RMM A;  5H92 C;  2NPT B;  4A9A A;  3A9J A;  4F1S A;  3TCA A;  3BVZ A;  4NNJ B;  1LGR A;  4WUR A;  2BT6 A;  4AS1 A;  3GZN I;  1L4D B;  4OW0 A;  1WGD A;  3AUL A;  3AE7 B;  1KH0 A;  1V86 A;  1V80 A;  3EFU A;  2ZPY A;  1V9J A;  3ZRF A;  4C4V A;  2O6V B;  1WJU A;  3PPA A;  2DWQ A;  1WY8 A;  3I57 A;  2ZVN A;  2WXF A;  4W9G A;  1HXY D;  2Y5B B;  4WJQ A;  1V5T A;  3P4Q B;  3VHT C;  1NDD A; 
#chains in the Genus database with same CATH homology
 1FXA A;  1FFV A;  3GP7 A;  2PIA A;  1HZ6 A;  2LEK A;  5BYS A;  1TJE A;  2WS3 B;  2H89 B;  1EM7 A;  1YQ3 B;  4RGT A;  1WRI A;  4YSY B;  3LB8 C;  1NVI D;  4YSZ B;  1TKE A;  4TMA B;  4TQ0 A;  5EE9 A;  1A70 A;  3LXF A;  1V97 A;  4O1N A;  2N9K A;  4US8 A;  2N7J A;  4YTM B;  3P4S B;  1SEB D;  3BK2 A;  2OED A;  3CWI A;  3URY A;  2K0P A;  1T5X D;  2MJE A;  4USA A;  1QT9 A;  2XN9 C;  3VR8 B;  3T3N A;  1F77 A;  3V05 A;  4M0W A;  3AE9 B;  2N0S B;  5BYR A;  5HHD G;  3IT4 B;  1QOB A;  3TEZ A;  3E9S A;  4ZRP A;  2HTM E;  4RGN A;  4WAF A;  1TY0 A;  1D5M C;  2RPV A;  3AV8 A;  4JWU C;  3TEX A;  3W5V B;  3TEW A;  3AE8 B;  1XCQ L;  2D5G A;  4XE0 A;  1F2R I;  4RGO S;  2GRI A;  2QJL A;  3MFG A;  4OZA A;  3NZ3 A;  3ZYY X;  2ACZ B;  1QIL A;  2INP E;  3IXS A;  1SBB B;  4YXD B;  1AYF A;  3WCQ A;  2L32 A;  2PKO A;  3KQ4 A;  4MM3 B;  1ZPS A;  4HEA 1;  4YWG G;  1QOF A;  2IJ0 A;  3PZ8 A;  5D3I B;  4DXG A;  1ROE A;  4MH8 A;  1GB4 A;  4LLG M;  2BTE A;  2ICI A;  3P42 A;  1L5P A;  1XEE A;  2PVO D;  2Y3A A;  3LYY A;  2NMQ A;  1RM6 C;  2ON8 A;  3P1M A;  1UUP A;  2PLP A;  4RNA A;  3AEG B;  4REZ A;  3AH7 A;  1K50 A;  3AE6 B;  1C4P A;  1EU3 A;  1LO5 D;  1QKZ A;  4IDI A;  1TKY A;  1UWM A;  1FXI A;  1WXQ A;  2RDG A;  4B0E A;  2E6X A;  1Q10 A;  3C8Y A;  1EU4 A;  2TSS A;  2B76 B;  2JXT A;  1K52 A;  2JX5 A;  4WIP A;  3MJ5 A;  1P7E A;  4N58 A;  4D2K A;  1ACC A;  1TS2 A;  1YNT E;  2JU6 X;  2AX5 A;  3VRB B;  2PW9 A;  1DOX A;  1XF5 L;  2MH7 A;  1ZXI A;  1N5X A;  2V4I B;  2BYT A;  1JWS D;  2WDV B;  1J7C A;  1FFU A;  1SXT A;  3J9C A;  1ENF A;  4B0M A;  1TY2 A;  5HG2 A;  4R3D A;  2QIL A;  3H8H A;  1JWA D;  1JML A;  1YMH E;  4L2Y A;  3R8B A;  2X38 A;  3BVM A;  5HI1 A;  5FR3 A;  2W54 A;  5G5H A;  1ZP0 B;  1N63 A;  3U2S C;  2WU5 B;  1L4Z B;  4Q2J A;  2GB1 A;  2WXP A;  5BMG A;  4H2A A;  1C79 A;  4IKG A;  1FNW A;  2QSD A;  2R61 A;  3U7Z A;  3SEB A;  2KAJ A;  5HFY A;  1E0Z A;  4J3O D;  5EE3 A;  1QQR A;  2W55 A;  3AE4 B;  1I7H A;  2KWD A;  2W3R A;  1ET9 A;  2JQR B;  4C7Y A;  2IPK D;  4L23 A;  1ZOY B;  2E3T A;  1FM0 D;  2IDY A;  1HQR D;  3NVV A;  2PMV A;  4NAW B;  2FBW B;  3GS2 A;  4WQM A;  5FKA C;  1F2R C;  4RCO A;  1HZ5 A;  1M4V A;  5G5G A;  2J52 A;  1IGC A;  4HJG E;  3ZGZ A;  1NEN B;  3IAM 1;  1TS4 A;  1V1O A;  1YN5 A;  2JWU A;  2HDE A;  2DYM A;  3T3O A;  4A55 A;  1XO3 A;  1KF6 B;  4ZYS A;  1V1P B;  1SE4 A;  2KN4 A;  4MAC A;  4TQ1 A;  2BS3 B;  4HKQ A;  2QEJ C;  4YTP B;  5C3J B;  1E10 A;  2WXN A;  2WXG A;  1D6E C;  3HRD D;  2V0G A;  3FC4 A;  4NAM A;  5D3D A;  2JYT A;  1MHX A;  1FMA D;  1SJH D;  1T6B X;  3B2F A;  1XLN A;  5I4D A;  1KLG D;  1GOZ A;  1EWY C;  3VRA B;  2BS4 B;  4L1B A;  2LJI A;  4GDL B;  2K3U A;  1CJE A;  3ETR A;  1PDX A;  1L6V A;  3CIR B;  1VDV A;  3MC0 B;  3KLS X;  4EE2 A;  4JE3 B;  1AWD A;  1N5W A;  4KGR A;  3SFE B;  2LHD A;  1BXT A;  1FRD A;  1L0Y B;  3HUI A;  1D5Z C;  3AM9 A;  3OWE B;  2IGH A;  1XCT L;  1VZ8 A;  2NTT A;  2BB6 A;  1QLB B;  4P16 A;  3BYY B;  3NVY A;  4ZHO A;  1ZDV A;  1B9R A;  4OZC A;  2L52 A;  2N9L A;  4KKI A;  3BII D;  5E6J A;  2OHF A;  3PZ7 A;  1MVK A;  1E6E B;  1XXG A;  3MP9 A;  1I4P A;  2DBY A;  2WXR A;  3P4P B;  1UWX A;  3AEB B;  1L0V B;  1FEH A;  1PYW D;  4JPS A;  4OHJ A;  1V8C A;  1I4H A;  1FD6 A;  1SE3 A;  3AN1 A;  4ITK A;  2WXI A;  3I9V 1;  2KMM A;  2KDM A;  4PT5 A;  2NTS A;  3ABV B;  2LMC A;  1B1Z A;  5GXG B;  5AUK A;  3N9Y C;  2WP9 B;  1IUE A;  1L6U A;  1JWB D;  2QMT A;  3FIL B;  1JWU D;  1FO4 A;  2I2Y A;  2K9X A;  2SAK A;  2AQ1 B;  1WSP A;  3AEE B;  2WXK A;  3R2T A;  1QOG A;  1SIJ A;  4KX6 B;  1N62 A;  2WDQ B;  5EE1 A;  1FNU A;  1NEK B;  1SE2 A;  5MPO A;  2L83 A;  1PGA A;  2JZP A;  2IGG A;  1SSN A;  1XLO A;  4WH4 A;  1YJJ A;  4WWM A;  4YT0 B;  5BMI A;  1STE A;  2IGD A;  4YSX B;  1ET6 A;  3NVZ A;  1I4Q A;  1SJE D;  1C4C A;  5LNK 1;  3HVD A;  3ZJU A;  2ZW1 A;  5BMH A;  1VRA B;  4A6Q A;  1SF0 A;  3DWG C;  1XLP A;  1L0X B;  3EA6 A;  4TSS A;  2CU3 A;  2YEP F;  2MJD A;  2BS2 B;  4A8X C;  2ONQ A;  2W82 A;  2WQY B;  5TSS A;  1N60 A;  3AE3 B;  4C56 C;  4IOI E;  3AEC B;  3NS1 A;  2XNA C;  1Y56 A;  1JRO A;  1C9F A;  3EUB 2;  3BK1 A;  3B9J A;  1ZE3 D;  2CJO A;  3Q8A A;  3AE2 B;  3W9C B;  1OQR A;  3Q8F A;  1JWM D;  1JRP A;  1JW9 D;  1MPE A;  1TS5 A;  3E56 A;  1C76 A;  3AEA B;  1RFK A;  3AMZ A;  3NVW A;  1GPX A;  4YTN B;  2WXH A;  3W1S A;  1I4R A;  4P6V F;  4LTU A;  5T8I A;  1E7P B;  1DYQ A;  4ARI A;  4JX1 C;  1CQV A;  3W5U B;  3FIL A;  2WNM A;  1EWC A;  1IBX B;  4LK0 M;  2YEP B;  1WGK A;  2Y5P A;  4N6E B;  1J7B A;  3BVG A;  2L1A A;  1PGB A;  1GAQ B;  3DWM A;  3ZJT A;  1KLU D;  2BBC A;  3Q8E A;  1T3Q A;  2M0A A;  3KWV A;  1I4G A;  1MI0 A;  3L4P A;  4GDK B;  1UGJ A;  2WXO A;  1ZDX A;  2Z8L A;  4N59 A;  4HKZ E;  1BML C;  3PO0 A;  2J4X A;  1J7A A;  1QOA A;  4KGT A;  2LHE A;  4XWW A;  3SFD B;  1VR9 A;  3GB1 A;  2LUM A;  1SB3 C;  2WXL A;  1XLQ A;  1CZP A;  1R7S A;  3ZJV A;  5D7G A;  1QF6 A;  2LGI A;  2I38 A;  3BZD B;  1CK1 A;  1RYJ A;  5JXV A;  3NRZ A;  2LFI A;  2WU2 B;  4RH6 A;  1YJI A;  4CQN A;  1K51 A;  4DQO C;  1I4X A;  4RFB A;  3AE1 B;  2J53 A;  4OZB A;  2H88 B;  2J42 A;  3Q8B A;  3V3X A;  2K5P A;  2EKI A;  1FRR A;  1FCC C;  2VZK D;  4HRS A;  1VLB A;  4GLS C;  3R2I A;  1F0Z A;  2WDR B;  1KFY B;  2BB5 A;  4A90 A;  3AEF B;  4MT5 A;  1OQQ A;  1PFD A;  2VZK B;  2WLB A;  1WYG A;  1KRH A;  1YQ4 B;  2DLB A;  2PTL A;  3EGR A;  1YN3 A;  2DYO A;  2EEL A;  3AED B;  3KWL A;  2V3N A;  4RGM A;  1JQ4 A;  3U52 E;  1PGX A;  2Y5C A;  4ARC A;  4C80 A;  3NUH B;  3Q69 A;  1DOY A;  1UNS A;  4AQ7 A;  3U4E G;  1C4A A;  4HRO A;  5BYQ A;  2M56 B;  2FE8 A;  4US9 A;  1PUT A;  4DXF A;  2JSV X;  4RF1 A;  3B2G A;  1TKG A;  3BYT B;  3IAS 1;  4KKJ A;  2BW2 A;  2G9H D;  1FIQ A;  1RWS A;  2AQ2 B;  1NYR A;  2INN E;  1P7F A;  1WWT A;  1ZUD 2;  2K22 A;  4ZHP A;  2CJN A;  3TUO A;  3AE5 B;  1VZ6 A;  2G1E A;  2PVG C;  1GB1 A;  1V1P A;  5AUI A;  3VR9 B;  2AQ3 B;  3O13 A;  1VZ7 A;  3HVZ A;  3P4R B;  4XWT A;  3ZQ4 A;  4XDC A;  1HA5 A;  4OVZ A;  2MJ3 A;  2QIE B;  5H8Y E;  3TSS A;  5FK9 C;  3W2D A;  1IBX A;  4NJC A;  1C78 A;  2JYE A;  2V3P A;  3FAH A;  4FXC A;  1D4B A;  2WXQ A;  3SR6 A;  2RMM A;  1JAL A;  5H92 C;  4JWS C;  1BUI C;  5EE0 A;  2KQ4 X;  5C2T B;  4A9A A;  3IT6 B;  1ESF A;  1FNV A;  2Q5W D;  3BVZ A;  3VQI A;  4C7Z A;  1FCL A;  1KTK A;  1N61 A;  2M19 A;  3MHZ A;  1YN4 A;  3BWU D;  3Q8C A;  4XDD A;  4WUR A;  2BT6 A;  4AS1 A;  2RDH A;  2WXJ A;  1L4D B;  4OW0 A;  2GI9 A;  1TS3 A;  2ZW0 A;  3AB5 A;  1IGD A;  1ZXH A;  2KAC A;  3AE7 B;  1AN8 A;  1KH0 A;  3TEY A;  1JCK B;  1AW7 A;  2FUG 1;  3UI3 A;  1NYQ A;  2MEK A;  1C77 A;  2SEB D;  2DWQ A;  1NI3 A;  4ZOH C;  4ZRQ A;  4RF0 A;  3P63 A;  3I57 A;  1DGJ A;  1TZO A;  2WXF A;  3RFZ B;  1HXY D;  1E9M A;  1MHH E;  1VJK A;  1K53 A;  1HEZ E;  1D5X C;  4UDU C;  2W3S A;  4KGS A;  2WXM A;  4NZL B;  3P4Q B;  1DOI A;  3RPF C;  1OFF A;  1TYG B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...