3W5UB

Cross-linked complex between ferredoxin and ferredoxin-nadp+ reductase
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
92
structure length
92
Chain Sequence
ATYNVKLITPEGEVELQVPDDVYILDQAEEDGIDLPYSCRAGSCSSCAGKVVSGSVDQCDQSYLDDGQIADGWVLTCHAYPTSDVVIETHKE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Electron transport
molecule keywords Ferredoxin
publication title Concentration-dependent oligomerization of cross-linked complexes between ferredoxin and ferredoxin-NADP(+) reductase
pubmed doi rcsb
source organism Zea mays
total genus 20
structure length 92
sequence length 92
chains with identical sequence D, F, H
ec nomenclature
pdb deposition date 2013-02-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00111 Fer2 2Fe-2S iron-sulfur cluster binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 3w5uB00
4ZHPA 3AE5B 2K5PA 4US8A 1A70A 4JWSC 1L6VA 3EUB2 3SR6A 1T3QA 3AEEB 1WXQA 4FXCA 5GXGB 1JRPA 3B2GA 2QJLA 1AYFA 3AE3B 4US9A 4N6EB 1EWYC 2WU5B 3B9JA 1B9RA 1DGJA 1RYJA 1SF0A 1FFUA 1FXIA 3AE9B 3AB5A 3VRAB 4C7YA 1JALA 2FBWB 1E10A 3LXFA 1RWSA 3HVZA 1QF6A 2ACZB 1DOIA 2WDRB 3B2FA 1VJKA 1JWAD 5MPOA 4WQMA 1ZP0B 2QIEB 4N59A 3VR9B 1TKEA 3AEGB 1QOGA 3RPFC 1JWBD 4YSXB 2PKOA 3WCQA 1KF6B 2M19A 3FC4A 1KFYB 3ZYYX 3VRBB 1PDXA 4LTUA 5EE0A 5EE9A 2W3SA 2HTME 2G1EA 1KRHA 1VLBA 2LEKA 2W3RA 3CIRB 2PVGC 1J7CA 1FMAD 1CZPA 1L0VB 4JX1C 3AEDB 1WRIA 1ZXIA 2L83A 3AN1A 3W5UB 1OFFA 3AE6B 2MH7A 4HROA 4P6VF 1FIQA 1JW9D 1UWMA 2JQRB 1WGKA 3HRDD 1NI3A 1N60A 2N0SB 3AM9A 1V97A 1NEKB 3AECB 1XLPA 2L52A 1FM0D 1JQ4A 1FXAA 2DWQA 3AE1B 4IDIA 1SB3C 2Q5WD 3AH7A 3DWGC 3AEBB 5EE3A 5H92C 3AE2B 2BS3B 4YT0B 1AWDA 2WDVB 3P1MA 4ITKA 4ZHOA 1NYQA 2CJOA 2BT6A 1WYGA 3P4RB 2K22A 3L4PA 3PO0A 1GPXA 1XLNA 1YQ4B 2PVOD 3AEAB 1TKGA 3NRZA 3P4SB 2K9XA 2WQYB 1YQ3B 1XLQA 2KMMA 1QOAA 1VDVA 5C3JB 4YTNB 1J7AA 1QT9A 1TKYA 1ROEA 1OQQA 2OHFA 5G5HA 4YSZB 1OQRA 1NVID 2DBYA 1V8CA 2KAJA 2H88B 3CWIA 2MJEA 1WWTA 4HRSA 4WWMA 5AUIA 3W9CB 1YJJA 3AMZA 3AE7B 5EE1A 1FO4A 3P4QB 3SFEB 1E9MA 3NVYA 4YTPB 1N62A 3NVVA 1J7BA 1QOBA 1F0ZA 2CJNA 1I7HA 3LB8C 1TJEA 4USAA 3SFDB 3AV8A 4YSYB 1ZOYB 1NENB 1PUTA 1XLOA 2BS4B 2E3TA 1N61A 2Y5CA 3KWLA 4ZOHC 5H8YE 3NVZA 2WP9B 2M56B 1RM6C 3P63A 2AX5A 1DOXA 1FFVA 4YXDB 1N63A 1GAQB 5G5GA 3FAHA 3AE4B 4KX6B 1DOYA 3AE8B 1E7PB 1TYGB 1E6EB 1ZUD2 1N5XA 1FRDA 3ETRA 3NS1A 5C2TB 4C80A 4N58A 3BIID 1FRRA 1JROA 1N5WA 2W54A 3DWMA 1E0ZA 2WU2B 1L6UA 2EKIA 2MJDA 1QOFA 3AEFB 2PIAA 1IUEA 3VR8B 5AUKA 1NYRA 3W5VB 2W55A 3P4PB 4JWUC 2WLBA 2WS3B 3NVWA 4C7ZA 4A9AA 1YJIA 1R7SA 1RFKA 1CJEA 1SIJA 2B76B 2H89B 2MJ3A 3HUIA 4YTMB 1QLBB 1L5PA 1PFDA 2WDQB 2JX5A 3ABVB 1XO3A 2CU3A 2BS2B
chains in the Genus database with same CATH superfamily
3X0WA 1KH0A 1KJTA 1QKZA 2OOBB 3UINB 1P7FA 2DZJA 3AE3B 1XT9B 5IO9A 3DOWA 2KC2A 3AB5A 4C7YA 1DOIA 1JWAD 1GUAB 3VR9B 1SE4A 3WCQA 2RDGA 3ENEA 2KQ4X 2LVOA 4NJ6A 2PEAA 3O65B 2LFIA 1L0VB 3W1YA 3PPAA 2V3PA 3W2DA 4XYCA 4MELA 1C1YB 2MH7A 3AE6B 1AW7A 1I35A 2VZKB 1N60A 4RGNA 1WM3A 2IY1B 3DBHI 3URYA 2KACA 2LUMA 5AZGA 1RFAA 3ZRFA 5BO4B 1KOTA 2AQ3B 4NAMA 2IYDB 1XLNA 2KMMA 2N9LA 3GOEA 2WNMA 1TKYA 1RLFA 1OQRA 2MBHA 3KUZA 4FULA 2LJIA 1BXTA 1MHXA 3O13A 4PYZA 2L00B 3MHZA 3P4QB 1N62A 1I4QA 2MCNB 4HJGE 1HTOA 1V49A 1I4RA 1XLOA 1T5XD 2WGSA 3KLSX 2M0XA 2DHZA 1E7PB 2D07B 4DBGA 1LFDA 2JPHA 4ANUA 1WXAA 3ZJUA 2W55A 3SD5A 1SSNA 4GGQA 1V9JA 1P7EA 1PGAA 5HFYA 3HUIA 4YTMB 3W1SC 3GS2A 2PMVA 3Q3OC 1A70A 2GB1A 1WRDB 1LO5D 4XWWA 3NS8A 1EWYC 4MDKE 3PVLA 2WX0A 1PYWD 3KUDB 4RGTA 3MC8A 3DBSA 3KUCB 4ARIA 1WZ3A 3HVDA 3P2BA 1K52A 2J53A 4WH4A 3R8BA 2HTME 3DDCB 2PPHA 1I42A 3AEDB 2J7QB 3UIPB 4UDUC 2X8XX 2WHIA 4WWOA 4M00A 2XK5A 4ARCA 5HI1A 5AZFA 1FM0D 1V5OA 4E3CA 2RSUA 1ET6A 1V1PA 3MC9A 3Q8AA 4NNJB 3RNGC 4EEWA 5EE3A 4REZA 1ZE3D 1MG4A 1KM7A 2QEJC 1C76A 2D11A 2WXNA 4L2YA 2PE6B 4IW0A 2GRIA 2JRHA 3RCZA 2WXLA 3AE7B 2W82A 2JRIB 4F8CB 3ZLZA 4A3PA 2KLCA 3AXCA 4YSYB 4I6LB 1PUTA 4ZOHC 4MSQB 5C1ZA 1T0QC 4YXDB 5G5GA 3AE4B 4FBJB 3WAPA 3ETRA 1FRDA 4MH0E 4RM8A 4HCNB 3AEFB 4NQLB 2E6XA 3DVNU 3VR8B 3DBRI 3L13A 1XF5L 4ZYSA 4PT5A 1UBQA 2XK5B 3ZTCA 3R7QA 2KDFB 1WFYA 2BS2B 1CMXB 3RI7C 2K5PA 2DZKA 3DPDA 3EUB2 2L8JA 2OJRA 3PHWB 4K7SA 2IBIB 2N1VA 3EC8A 1J8CA 3VH3B 3KYCD 4B0EA 1R4MB 3TIXA 3M62B 3ZXRA 4AS1A 1JCKB 4HDOA 4MM3A 3FKYA 4HWIB 2AEHA 2MSED 1KFYB 3NZSA 5D3DA 4O1NA 4B6WA 2LGXA 3GE8C 2XNAC 3BK2A 1BT0A 2W3RA 3CIRB 1CZPA 4A8XC 1M4VA 3MJWA 2NBVB 2QILA 2KHWB 3T8MA 2BF8B 1UWMA 1L7YA 3A1QA 3RN9C 2LHEA 2QHOA 1SEBD 4KV2A 1JQ4A 1FNWA 3N3KB 4PS8A 2LXAA 3APFA 1V2YA 2R61A 3P4RB 2K22A 4MH8A 3PO0A 1XCTL 2K9XA 5C3JB 2G45B 2C7MB 2NTTA 1SE3A 1WWTA 2QSDA 1S3SG 3DCGA 1ZPSA 4KGRA 3I3TB 4MM3B 2BS4B 4DXGA 3N9YC 3KWLA 2O6VA 4ZRQA 4K7WA 4KSKC 4W9IA 3A9JA 4RM9A 2KZRA 3ZRCA 2DZMA 2ZVOA 4PYUA 2J52A 4DXFA 1JROA 2WU2B 2JYEA 3H1UA 1FNVA 2ZZPB 3IHPC 2WLBA 2WS3B 3A1QB 1YJ1A 2GMIC 2V9HA 3DVGX 4HPMB 2WXGA 3UIOB 3QWZB 5D94A 2CKHB 3LJ3A 3VFKA 1T0YA 2KVZA 2V3NA 2ZCCA 4DK5A 1RYJA 2KFKA 3U4EG 4HLEA 1QF6A 1L4ZB 1JRUA 4I6NB 4ZRIA 2NPTA 1UUPA 3PGEA 3RPFC 1HTQA 1KF6B 4M0WA 2HD5B 3VH4B 2G1EA 2O6VB 1FMAD 2ZPYA 1WMHA 4RCOA 2KMAA 1C4AA 1TBEA 2KD0A 2RDHA 3Q3NC 2WWZA 2C5LC 1TS3A 2D10A 4GOCA 1OGWA 2BS3B 5DPSA 2GI9A 4LDTB 3BYYB 4MGKE 3BVGA 2H88B 2LZ6A 4HRSA 2BB5A 3AMZA 3C8YA 3RFZB 2KFKB 4DDGD 3Q8CA 3MJ5A 3SFDB 1D3ZA 2NPTB 1WM2A 2MBBB 4XWTA 3PREA 1T6BX 2BBCA 3C0RB 2GBJA 1ENFA 4M01A 4RH6A 3QHTA 3WIMA 1WZ0A 1SJED 2BKRB 5AUKA 2K39A 5DCNA 1JWSD 1WXVA 1WH3A 4TUUA 4A9AA 1E7UA 1R7SA 1RAXA 1CJEA 1WE6A 3EA6A 1P3QU 1Q10A 4BZAA 2ZNVC 2O6VD 3EECA 3ABVB 1D5ZC 4ZHPA 3AE5B 4MGYE 5IA7A 4KSLC 5HG2A 4IWQA 5IN7A 2N1WA 4WJQA 3B9JA 2AQ1B 2N9EB 2LRUA 3ZQ4A 5AZHA 1UGJA 4ZRKA 1RWSA 2GBMA 2WDRB 3B2FA 1TGZB 5D3IB 1UWXA 4E71A 2FCSA 3AEGB 3APCA 2EMTA 2MLBA 4B95A 2L05A 3FC4A 2N7JA 5CX3A 3P42A 5JXVA 4LJPB 1JMLA 4DHZE 4DHJB 4HJKA 5L83A 3H9DA 1SIFA 4BOSC 2N0SB 2FUHB 3H7PA 1ZKHA 3M3JA 4XDDA 4CYEA 3Q8FA 1D5MC 4WAAA 2ZEQA 2BT6A 1WYGA 2L0FA 1EF5A 5JZEB 3V62A 4KZCA 2WDTB 4EZKA 3MTNB 2WQYB 1ZW7A 3VUWA 2WXRA 3RNEC 1IBXA 2PJHA 5EE1A 3RT3B 2IO2B 4AQ7A 1E8ZA 3LB8C 2KLGA 2M56B 3P63A 1WR1A 2RPVA 3OJ4B 2SAKA 1K8RB 3IG3A 4K1RB 3VTUA 1KLUD 2AL6A 1WGGA 3W5VB 2J42A 5JH5C 1XQQA 1LXDA 3ZNHB 3PS6A 3H7PB 4KKIA 4I6PA 3QQ8B 4TSSA 3IT4B 4JWSC 1L6VA 1WXQA 3IVFA 2MHJA 1AYFA 5E6JA 5IOIA 3TEWA 3TBLD 3LDZE 4TMAB 4W9KA 5E6NA 1YX5B 2I2YA 3ZXVA 4LLGM 3ZJTA 2PKOA 1AN8A 5CHWA 2RGFA 2HJ1A 3VRBB 2RMMA 3PRPB 2DAFA 3PZ7A 1HEZE 1WRIA 3AN1A 1HZ6A 1FIQA 1NI3A 3DQVA 1XLPA 3K9PB 2JZ3B 3B1LX 1FXAA 2DWQA 5TR5A 3AE1B 3GE3C 3AH7A 4FHJA 2NCNA 3CF6E 2M17A 4W9GA 4P1BC 2V4LA 4LNOA 1WYWB 2FIDA 3U52E 4KGTA 1V80A 5G5HA 4GB9A 4DHZB 1QQRA 2L32A 2MA9B 3ZNGC 3M95A 5AUIA 3V6EB 2G3QB 3AU4A 4MEMA 1Q0WB 4USAA 2KO3A 1UGMA 1TTNA 2OJWA 1FFVA 3VUXA 3A33B 5KHQA 1E6EB 1N5XA 4RGOS 3ZIMA 3BIID 4HPLB 2BWFA 2KWVB 4IC7B 4P16A 2YEPB 2IPKD 2PIAA 1TIFA 3OLMD 2V4IB 4FHKA 4JGHB 1ISNA 4C7ZA 3NZUA 3RNAC 1S1QB 3N1YC 2JX5A 2WXIA 2DZIA 1MJDA 5GXGB 2QJLA 1WX7A 2M8SA 2LMCA 2CR5A 3VRAB 4KVGB 2EKEC 2BW2A 2IJ0A 5D7GA 1ET9A 1MI0A 1XD3B 4MJSA 4L1BA 2YEPF 1C4CA 2PW9A 1NI2A 3SHQA 2VZKD 1T0SC 2KN4A 1WGKA 2MEKA 4WQOB 4EUTA 4JL9A 4W9CA 4GXBA 3JYUA 1SB3C 4OVZA 3AE2B 4XC2A 1SJHD 3IFWB 5BMHA 4JLCA 3NRZA 4DQOC 4KZ0A 3VVWB 3NY5A 5DPRA 3DHGC 2XEWA 3RZFA 4IUMB 2DBYA 3RNFC 4HKZE 4WWMA 1VD2A 1B1ZA 1OEYA 2JVCA 2DX5B 2N4FA 3HM3A 2V3SA 1F0ZA 2NVUI 1WI0A 2WYQA 2Z0DB 2WP9B 1WIAA 2DYBA 1N63A 1GAQB 2KFJA 4MJSB 5BMGA 1TYGB 1C79A 1YN3A 3DWMA 1L6UA 1WX9A 1GJZA 1OEYJ 3VUYA 4HDQA 1GOZA 2J4XA 1R4MI 1QLBB 1KLGD 3PLVA 1PQSA 2Y3AA 3Q2AC 3NG0A 2LUEA 3SR6A 1JRPA 2C7NB 2LGYA 3FILA 4GLSC 2W9NA 4W9JA 1UELA 1FFUA 3UI3A 1EF1A 3L0WB 3CSTA 2JF5A 1JALA 1E10A 3LXFA 3HVZA 4J6IA 5MPOA 4WQMA 4R3DA 4EZJA 3A9KA 5CTRC 3L08A 2IO1B 3N1ZC 4JQWC 4C4VA 1WE7A 1GNUA 4TQ0A 4QAYA 3C19A 1VCBA 2BWES 1L0YB 2IGHA 2KXJA 4II2B 4YT0B 3EGRA 2BKFA 1GPXA 4P7IA 3ZNID 1VDVA 4ACFA 1TY0A 4IG7B 4G11A 4YSZB 1NVID 4IKGA 1H4RA 2ASQA 3FILB 3IXSA 4LNIA 1I4PA 3NVYA 2ON8A 1CK1A 2VRRB 2C60A 2FCQA 3A4RA 3NJTA 3QAQA 1TJEA 1HXYD 5EDSA 2PLPA 4N9F4 1WSPA 1Z5SB 4W9DA 3A9KB 3WAOA 3NS1A 4CHKA 2RR9A 1YD8U 3PRMB 2WXQA 1FRRA 1E8YA 2VH1A 4S17A 3EFCA 3V6CB 2KX0A 4C4VB 1JWUD 1IYFA 4GU2A 2QCZA 2WDQB 4BKTA 4YSXB 2A5UA 4EE2A 5FR3A 4OZBA 3AEEB 2MW5A 3B2GA 3H7SA 1WGRA 3Q14C 1B9RA 1SF0A 3PSEB 5C23A 4ZRJA 2FBWB 2Z8LA 1VJKA 4ZYNA 1OTRB 2GBNA 3TUOA 2MBQA 1VZ8A 1MPEA 5G2NA 1YNTE 1ZXIA 5DPTA 3J9CA 2Y5PA 4JIOU 1A5RA 1RRBA 2JQRB 1WXMA 3HRDD 1UBIA 4BFRA 3CSFA 4C56C 3ZJVA 4A90A 3AECB 2MQJA 1BUIC 5BYQA 1WGYA 4BKSA 2D3BA 1E7VA 2VH2A 1D4BA 3P4SB 1SE2A 1HZ5A 2LGDA 1IGDA 4ZDVA 2HTHA 3CWIA 3DBLB 1YN5A 4OVVA 2MJEA 3W9CB 5GMVA 2YVCA 4WJNA 3ZNZB 1T0RC 2CJNA 2BYEA 1V5TA 5LXIB 1NENB 2GOWA 3ONSA 3OG5A 2LWPA 3VXWA 1F2RC 1AARA 5G55A 4BOZB 1L4DB 2D3CA 2IO3B 4N58A 2W54A 1GG3A 3OAWA 3AU5A 3H8HA 4ICVA 4NQKE 2H89B 1R4NI 1MHHE 2ONQA 3B0AA 2CS4A 2GBRA 1WJ4A 3RZWC 1WGHA 3JW0X 2I1KA 2JU6X 1LGRA 3TSSA 4M8MA 2JWZA 1YN4A 1IP9A 2FCMA 1TKEA 4TV3A 4B0MA 1BMLC 1NDDA 2M19A 3BINA 1UZXB 3LYYA 3N1XC 2JSVX 1FD6A 4D2KA 4M8NA 1OFFA 2FCNA 3Q3MC 4LJOB 1F52A 5AEKB 2AL3A 4RNAA 2KC1A 2PTLA 2K8HA 3DWGC 2N7EA 4EFOA 3WALA 4LDTD 1VZ6A 3AEAB 4FJVB 1YQ3B 1F77A 1F9JA 1J7AA 2AQ2B 2KJ6A 3Q6BA 1SE9A 4WURA 3L17A 3ECIA 3HIZA 4GMVA 4EOYA 3GZNI 3MFGA 4BKSD 4W9LA 3UQBA 1MG8A 1HA5A 2NMQA 2DNFA 1GC6A 3NVZA 1U4AA 1FXTB 2O2VB 5HKHA 1ACCA 4FJZA 2Z0EB 2YLMA 3TCAA 3AI5A 5FKAC 3A4SC 5IKCM 4MACA 3ZKJC 1F1HA 1LQBA 2JY6A 1QZEA 4KIKA 2CU3A 2L1AA 4L23A 4ANXA 4FXCA 1K51A 1TS5A 1MVKA 3ML8A 2DLBA 3NUHB 1XCQL 1I4GA 3BZDB 2DYMA 1YOVB 4BBNF 3KW5B 1K50A 4DHJD 4LTUA 2KDMA 1GC7A 1Y8RC 2NBWB 4HROA 2V1YA 3WANA 1HE8A 4NJCA 4P6VF 4AP4C 4XZ4A 5KHOA 2ZW0A 4W9EA 2UU7A 4GN1A 2RDBC 1Q1OA 4IDIA 2JZZA 5H92C 4KDIC 2EELA 2WDVB 3P1MA 2KDEB 3DHHC 1WGDA 3AULA 2NR2A 4GDLB 4BKGA 4KIKB 3RUIB 4MGIE 1NBFC 1QOAA 3B08A 1QT9A 5TSSA 3VTWA 2KWUB 4DWFA 4IM0A 5D6JB 2FUG1 5J17A 3CMMB 1FO4A 1VR9A 2KT7A 4WWPA 3EFUA 3BK1A 1I7HA 3JSVB 4BAXA 3AV8A 4H2AA 4PS7A 2WXHA 4K7UA 1RM6C 1DOYA 2KMCA 5C2TB 1PGBA 1KTKA 4NJ7A 4OHJA 3T3OA 2I1JA 3U30A 4GIVA 1YJIA 4Q2JA 1UF0A 1N6ZA 2INDC 3N30A 1F2RI 1IPGA 4AJYB 4US9A 4FJYA 1FCLA 5FK9C 4WJOA 1FXIA 3AE9B 2AYOB 3V3XA 3Q3JA 2ACZB 4IWPA 3ZW3A 2BQQA 5IAAC 3TL5A 5D2MB 1L0XB 2GLSA 3M63B 2LJ5A 2G9HD 3ZYYX 3V61A 4A3OA 2L0TA 2W3SA 4J3OD 4EKUA 4LNFA 3HHMA 5BYRA 3BYTB 1FPYA 1V97A 1NEKB 3ZO5B 2K6QA 1XEEA 3U7DA 3AEBB 2J0MA 2CJOA 4FLHA 4A55A 3L4PA 3NOBA 4CO7A 2Z59B 3DBHB 2BYVE 4YTNB 4HCPB 3TEYA 1E8XA 3MHSD 4NZLB 4K3BA 4WWNA 3RNCC 4PS3A 4E74A 2A4ZA 1N61A 2JWUA 4JPSA 1E90A 2PE9A 2AX5A 1DOXA 3RNBC 2JUOA 2V0GA 1K53A 4IOIE 4KX6B 1TS2A 1ZXHA 3DHIC 2ZVNA 5L95C 2MJDA 4IM2A 3L16A 4W9FA 5CHVC 2LGSA 1WF9A 1Y56A 3VQIA 4P1CC 1TS4A 2X38A 4DDID 5LXHA 1L5PA 4A6QA 2K0PA 2L83A 1XO3A 5IP4D 2JXTA 2NS5A 2N7DA 2BTEA 4DXAB 1FEHA 3ZUNA 5FR6A 2KK8A 1IGCA 3SU8X 3KQ4A 1XXGA 2REXA 2ZNVB 4C00A 2MBOA 1SXTA 3RYTA 1KLVA 3L54A 2LVPA 2JYTA 2C9WB 1D5XC 5EE0A 2L7RA 1VLBA 4JX1C 2GBKA 3Q8EA 1V81A 4ANWA 2IZVB 2Y5BB 4ASWC 3IAM1 4NAWA 2ZPNA 1C9FA 5J2RA 1VZ7A 4GDKA 3UGBB 1JWMD 4X57B 3ZVVA 4BVUC 3DVGY 4BBNC 2D5GA 3PTFC 1EM7A 4RGMA 2M0AA 4KDLB 3U8ZA 1FNUA 2I38A 3K9OB 1M94A 2M1MA 4AUQC 2UYZB 4WJPA 5BMIA 1E9MA 4YTPB 3QCAA 3ZGZA 2KTFA 4MGZE 2J0KA 5J18A 3Q69A 2BGFA 3ALBA 3ZTDA 1QILA 1P0RA 1ZOYB 2D2QA 3PLUA 4LNNA 2E3TA 1V1PB 3U2SC 3QX1A 3HK0A 2R2QA 2N9PC 3AE8B 3Q3FA 2SEBD 4XX5A 2K6DB 3I5JC 2KWCA 5I4DA 2BYTA 4OZCA 3SEBA 1SGHA 4OVUA 2KQSA 3VDZA 2INNE 4NAWB 3U7ZA 3NVWA 2RPQA 4XE0A 4GDKB 1EO6A 1PFDA 2HDEA 1E0ZA 1PGXA 4HXDA 2KJHB 1WJNA 3I63C 4US8A 1V6EA 3DBRB 1T3QA 1L2NA 2K1FA 2ZJDA 1VRAB 4N6EB 4WAFA 1DGJA 2KVRA 1V86A 1DYQA 4OZAA 1ZP0B 4HPPA 1C3TA 1JWBD 2BYFA 4YL8A 1PDXA 2WXKA 4F1SA 2IY0B 1MFWA 2QC8A 2B3AA 3RD2A 4EZLA 2DAJA 4G3XB 2PVGC 4CQNA 1YX6B 2CHXA 2CHZA 2N9KA 3SDLC 3BWUD 4WIPA 3PHXB 3UQAA 1TZ1A 2N9XA 2FE8A 3AM9A 3R66C 2LI5A 3TEZA 3ZDTA 1J19A 4JE3B 3DBLI 1GB4A 4ITKA 1FCCC 2CU1A 4LNKA 1YQ4B 2WXFA 2PVOD 4ZRPA 4AJWA 1TKGA 4RF1A 2XN9C 2G4DB 1CQVA 2WXJA 3PRZA 1C78A 3SFEB 4XDCA 3NVVA 2KNBA 1J7BA 3APDA 2J0JA 4II3B 5LLIA 2Y5CA 4KGSA 3KVFB 5JHBA 2JXXA 3WA0A 3ML9A 1WJUA 4RMAA 3E56A 2KDIA 1ZUD2 2R2OA 4MT5A 2ICIA 3W1SA 3TJPA 1E5WA 2ZCBA 4LCDE 5LNK1 2WXPA 3MC0B 1UD7A 1Q5WB 1RFKA 2ZW1A 3E9SA 3KWVA 3GB1A 3X23A 1WY8A 2K8CA 2L76A 1EU4A 4FADA 4TQ1A 4URKA 2LASA 3KH0A 1I4XA 3A9JB 1TT5B 2JZPA 1UH6A 4PK1A 3PV1A 2G4SA 4IWOA 2LVQA 1P1AA 5DPWA 3BVMA 1YQBA 2KYWA 2FIFA 2HE7A 2QIEB 2D3AA 4N59A 1C77A 1QOGA 2KQ7A 1E8WA 3NHEB 3BVZA 1TY2A 2LRWA 1J7CA 5HHDG 2IGGA 2K8BA 5JHAA 2KWDA 4HK2A 1V1OA 4ICUA 1JW9D 2C7HA 2D3GA 1GB1A 1YMHE 2INPE 1P9DU 3JVZX 1EUVB 1EU3A 5T8IA 1WX8A 2L52A 2L3ZA 2IGDA 1J0GA 4TKNA 3N32A 2NBUA 2Q5WD 1Z2MA 4K3CA 4ZHOA 1NYQA 2O2VA 3R2IA 4M0WB 4RFBA 3OJ3A 3R7RA 3IBEA 3QARA 4KKJA 1SBBB 2AWTA 2OHFA 2HJ8A 3VHTC 1WMHB 3QA8A 2KAJA 2FAZA 3IAS1 2MP2A 2KANA 2DENB 1STEA 3PT2B 1QOBA 4HKQA 2CHWA 3PZ8A 3V60A 3QJZA 4M02A 4G0NB 3R2TA 5H8YE 4LK0M 2OEDA 2RD0A 4ANVA 3FAHA 3QC8B 4IM3A 1ZDXA 3L10B 1N5WA 1R4NB 5E6PA 2EKIA 1QOFA 3I9V1 4S0RA 1NYRA 1ESFA 4G50A 2MBEA 2EMSA 1SIJA 3ZDMC 4XGAB 4RF0A 4W9HA 3TEXA 4GSWA 1LM8B 4HVBA 5CHFA 2FNJB 2WU5B 2MWSB 1UNSA 4AWJA 2UWQA 2K3UA 3WAMA 1P98A 1WR6E 3I57A 2LHDA 2WXMA 1ZDVA 2KTRA 2INCC 2WX1A 2MP2B 4MSMB 1I4HA 3H6NA 3N20C 2LD9A 2KOXA 3QIJA 2KN5A 4FN2A 5BYSA 2KJRA 1OQYA 3R3MA 4GDLA 5EE9A 2QMTA 2LXCA 1KRHA 1D6EC 3GP7A 2DYOA 2LEKA 3HM6X 2MX2A 2XBBC 3IT6B 3W5UB 4AOFA 3MP9A 4F7ZA 2IO0B 3S2AA 2M4NA 3TMPB 2TSSA 2LGIA 4A20A 3DVNV 3EHVA 3OWEB 3JSVA 2QDFA 4K81A 2JT4B 1AWDA 2KX3A 2K25A 3VAWA 2MRPA 3KYDD 1XLQA 2NTSA 1X1MA 1ROEA 1OQQA 2BVCA 3GZNB 1YIWA 3UF8A 1V8CA 4NY0A 1TZOA 3T3NA 3PZDA 1YJJA 2KDBA 4B9KA 3NZ3A 2BPSA 2WXOA 1C4PA 4HEA1 3V05A 1H8CA 4OW0A 2BB6A 2KTRB 4FA6A 1G6JA 4NPNA 5E6OA 3D32A 1WJ6A 2IDYA 1EWCA 4C80A 1ZGUB 3VTVA 3RMKC 1IUEA 1WXSA 4YWGG 3T9LA 3P4PB 3RULA 1IBXB 1HQRD 3QK0A 3Q8BA 2B76B 2KKCA 3BY4B 4JWUC 2MJ3A
chains in the Genus database with same CATH topology
1D5ZC 4ZHPA 3AE5B 2JXTA 4EE2A 5FR3A 4OZBA 1KH0A 2BTEA 1QKZA 3AEEB 5HG2A 1FEHA 1IGCA 3B2GA 1P7FA 3AE3B 3KQ4A 1XXGA 3B9JA 1B9RA 2AQ1B 1SF0A 3ZQ4A 3AB5A 1UGJA 2FBWB 4C7YA 1RWSA 1SXTA 1DOIA 2WDRB 3B2FA 2Z8LA 1VJKA 1JWAD 5D3IB 1UWXA 3VR9B 3AEGB 1SE4A 2JYTA 3WCQA 2RDGA 3FC4A 2KQ4X 1D5XC 3TUOA 2N7JA 1VZ8A 3P42A 5EE0A 5JXVA 2LFIA 1VLBA 1JMLA 1MPEA 1L0VB 4JX1C 3Q8EA 2V3PA 1YNTE 1ZXIA 3W2DA 3AE6B 2MH7A 3J9CA 2Y5PA 3IAM1 1AW7A 2JQRB 2VZKB 3HRDD 1N60A 4RGNA 2N0SB 1C9FA 1VZ7A 4C56C 3ZJVA 3URYA 4XDDA 4A90A 2KACA 3AECB 1JWMD 1BUIC 2LUMA 5BYQA 3Q8FA 1D5MC 2D5GA 1EM7A 2AQ3B 4RGMA 4NAMA 2BT6A 1WYGA 1D4BA 2M0AA 1XLNA 1FNUA 3P4SB 2I38A 1SE2A 2WQYB 2KMMA 2N9LA 1HZ5A 2WNMA 1TKYA 2WXRA 1OQRA 1IGDA 3CWIA 1YN5A 2MJEA 2LJIA 3W9CB 5BMIA 1BXTA 1MHXA 3O13A 5EE1A 1IBXA 3MHZA 3P4QB 1E9MA 4YTPB 1N62A 4AQ7A 3ZGZA 1I4QA 2CJNA 3LB8C 3Q69A 4HJGE 1QILA 1ZOYB 1NENB 1I4RA 1XLOA 1T5XD 2E3TA 1V1PB 3KLSX 2M56B 3U2SC 3P63A 1F2RC 2RPVA 2SAKA 3AE8B 1E7PB 2SEBD 1L4DB 4N58A 2W54A 5I4DA 2BYTA 4OZCA 3SEBA 1KLUD 3H8HA 3W5VB 3ZJUA 2J42A 2W55A 2INNE 4NAWB 3U7ZA 1SSNA 3NVWA 1P7EA 1PGAA 4XE0A 5HFYA 2H89B 3HUIA 4GDKB 4KKIA 4YTMB 1PFDA 1MHHE 2HDEA 2ONQA 1PGXA 2PMVA 3GS2A 1E0ZA 4TSSA 4US8A 3IT4B 1A70A 2GB1A 4JWSC 1L6VA 1T3QA 1WXQA 2JU6X 1LO5D 4XWWA 1AYFA 1VRAB 3TSSA 4N6EB 1EWYC 5E6JA 3TEWA 4WAFA 1DGJA 1PYWD 4TMAB 1YN4A 4RGTA 1DYQA 4OZAA 1ZP0B 4ARIA 2I2YA 3HVDA 1K52A 1TKEA 2J53A 4LLGM 1JWBD 4B0MA 1BMLC 2PKOA 1AN8A 4WH4A 3ZJTA 2M19A 3R8BA 3VRBB 1PDXA 2WXKA 2RMMA 2HTME 3LYYA 2JSVX 2PVGC 3PZ7A 1FD6A 3AEDB 1HEZE 1WRIA 4CQNA 3AN1A 1HZ6A 4D2KA 2N9KA 1OFFA 4UDUC 3BWUD 4WIPA 1FIQA 1NI3A 2FE8A 3AM9A 4RNAA 4ARCA 2PTLA 5HI1A 1XLPA 3TEZA 1FM0D 1FXAA 2DWQA 3AE1B 1ET6A 4JE3B 1V1PA 3Q8AA 3AH7A 3DWGC 5EE3A 4REZA 1ZE3D 1GB4A 4ITKA 1FCCC 1VZ6A 1YQ4B 2PVOD 2WXFA 3AEAB 4ZRPA 1TKGA 2QEJC 3U52E 1C76A 4KGTA 1YQ3B 2WXNA 4L2YA 4RF1A 1F77A 2XN9C 1J7AA 5G5HA 2AQ2B 1CQVA 1QQRA 2WXJA 2L32A 2GRIA 1C78A 5AUIA 2WXLA 3AE7B 3SFEB 4WURA 4XDCA 3NVVA 1J7BA 2W82A 4USAA 3MFGA 4YSYB 1PUTA 2Y5CA 1HA5A 4ZOHC 4KGSA 2NMQA 3NVZA 1FFVA 4YXDB 5G5GA 3AE4B 3E56A 1ZUD2 1E6EB 3ETRA 1N5XA 1ACCA 1FRDA 4MT5A 2ICIA 4RGOS 3W1SA 3BIID 4P16A 2YEPB 3AEFB 5FKAC 2IPKD 5LNK1 2PIAA 2WXPA 2E6XA 3VR8B 3MC0B 4MACA 1XF5L 4ZYSA 2V4IB 4C7ZA 4PT5A 1RFKA 2ZW1A 3E9SA 3KWVA 3GB1A 2JX5A 2CU3A 2BS2B 2L1AA 2WXIA 1EU4A 4L23A 2K5PA 4TQ1A 3EUB2 4FXCA 5GXGB 1I4XA 1K51A 1TS5A 2QJLA 1MVKA 2JZPA 2DLBA 3NUHB 4B0EA 1XCQL 2LMCA 3BVMA 3VRAB 4AS1A 1JCKB 1I4GA 3BZDB 2BW2A 2QIEB 4N59A 1C77A 2DYMA 2IJ0A 1QOGA 5D7GA 1ET9A 1MI0A 1KFYB 3BVZA 5D3DA 1K50A 1TY2A 4L1BA 4O1NA 2YEPF 2XNAC 1C4CA 2KDMA 2W3RA 2PW9A 3BK2A 1J7CA 3CIRB 1CZPA 4LTUA 4A8XC 1M4VA 2IGGA 2L83A 5HHDG 2KWDA 2VZKD 4HROA 1V1OA 2QILA 4NJCA 4P6VF 1JW9D 1UWMA 1GB1A 2KN4A 1WGKA 1YMHE 2MEKA 2INPE 2LHEA 2ZW0A 1EU3A 5T8IA 2L52A 1SEBD 2IGDA 1JQ4A 1FNWA 4IDIA 1SB3C 2Q5WD 4OVZA 5H92C 3AE2B 2EELA 2WDVB 3P1MA 4ZHOA 1NYQA 3R2IA 2R61A 3P4RB 2K22A 4MH8A 3PO0A 1SJHD 4RFBA 4GDLB 5BMHA 3NRZA 1XCTL 2K9XA 4DQOC 1QOAA 4KKJA 5C3JB 1SBBB 1QT9A 2OHFA 5TSSA 2NTTA 2DBYA 2FUG1 1SE3A 2KAJA 4HKZE 1WWTA 4WWMA 3IAS1 2QSDA 1FO4A 1B1ZA 1VR9A 1STEA 1ZPSA 4KGRA 1QOBA 3BK1A 4HKQA 1I7HA 1F0ZA 3AV8A 3PZ8A 4H2AA 2WXHA 4MM3B 2BS4B 4DXGA 3N9YC 3KWLA 3R2TA 4ZRQA 5H8YE 4LK0M 2OEDA 2WP9B 1RM6C 1N63A 1GAQB 1DOYA 3FAHA 5BMGA 1TYGB 1C79A 1YN3A 1ZDXA 2J52A 5C2TB 4DXFA 1JROA 1N5WA 3DWMA 2WU2B 1L6UA 2EKIA 1PGBA 1QOFA 1KTKA 2JYEA 3I9V1 1FNVA 1NYRA 4OHJA 3T3OA 1ESFA 2WLBA 2WS3B 1GOZA 1YJIA 1SIJA 2J4XA 2MJ3A 4RF0A 1QLBB 4Q2JA 1KLGD 3TEXA 2Y3AA 2WXGA 3SR6A 1F2RI 1JRPA 3FILA 4US9A 4GLSC 1FCLA 2V3NA 2WU5B 5FK9C 1RYJA 1FFUA 1UNSA 1FXIA 3UI3A 2K3UA 3AE9B 3U4EG 3V3XA 1JALA 1E10A 3LXFA 3HVZA 3I57A 1L4ZB 2LHDA 1QF6A 2ACZB 2WXMA 1ZDVA 5MPOA 1UUPA 4WQMA 4R3DA 1I4HA 1L0XB 3RPFC 5BYSA 1KF6B 4M0WA 2G9HD 3ZYYX 5EE9A 2W3SA 4J3OD 2QMTA 2G1EA 1KRHA 1D6EC 3GP7A 2DYOA 2LEKA 1FMAD 4RCOA 5BYRA 1C4AA 3BYTB 3IT6B 3W5UB 3MP9A 2RDHA 2TSSA 1V97A 1NEKB 2LGIA 4TQ0A 3OWEB 1TS3A 1XEEA 1L0YB 2IGHA 3AEBB 2BS3B 3EGRA 4YT0B 1AWDA 2CJOA 4A55A 3L4PA 2GI9A 1GPXA 1XLQA 3BYYB 2NTSA 1VDVA 4YTNB 1TY0A 4YSZB 1ROEA 1OQQA 1NVID 1V8CA 3BVGA 4IKGA 2H88B 1TZOA 3T3NA 3TEYA 3FILB 2BB5A 3IXSA 4HRSA 1I4PA 1YJJA 3AMZA 3C8YA 3NZ3A 3NVYA 3RFZB 4NZLB 2ON8A 1C4PA 2WXOA 1CK1A 3Q8CA 4HEA1 3V05A 3MJ5A 4OW0A 1TJEA 3SFDB 2BB6A 1HXYD 1N61A 4XWTA 2JWUA 2PLPA 1T6BX 4JPSA 2BBCA 2AX5A 1DOXA 1WSPA 2IDYA 1EWCA 1K53A 4IOIE 1TS2A 4KX6B 1ENFA 4RH6A 2V0GA 3NS1A 4C80A 1ZXHA 1SJED 2WXQA 1FRRA 2MJDA 1IUEA 5AUKA 4YWGG 3P4PB 1Y56A 1JWSD 3VQIA 1HQRD 1IBXB 1JWUD 1TS4A 2X38A 4A9AA 3Q8BA 1R7SA 3EA6A 1CJEA 2B76B 1Q10A 1L5PA 4A6QA 2WDQB 4JWUC 3ABVB 2K0PA 1XO3A 4YSXB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4ZHP A;  3AE5 B;  2K5P A;  4US8 A;  1A70 A;  4JWS C;  1L6V A;  3EUB 2;  3SR6 A;  1T3Q A;  3AEE B;  1WXQ A;  4FXC A;  5GXG B;  1JRP A;  3B2G A;  2QJL A;  1AYF A;  3AE3 B;  4US9 A;  4N6E B;  1EWY C;  2WU5 B;  3B9J A;  1B9R A;  1DGJ A;  1RYJ A;  1SF0 A;  1FFU A;  1FXI A;  3AE9 B;  3AB5 A;  3VRA B;  4C7Y A;  1JAL A;  2FBW B;  1E10 A;  3LXF A;  1RWS A;  3HVZ A;  1QF6 A;  2ACZ B;  1DOI A;  2WDR B;  3B2F A;  1VJK A;  1JWA D;  5MPO A;  4WQM A;  1ZP0 B;  2QIE B;  4N59 A;  3VR9 B;  1TKE A;  3AEG B;  1QOG A;  3RPF C;  1JWB D;  4YSX B;  2PKO A;  3WCQ A;  1KF6 B;  2M19 A;  3FC4 A;  1KFY B;  3ZYY X;  3VRB B;  1PDX A;  4LTU A;  5EE0 A;  5EE9 A;  2W3S A;  2HTM E;  2G1E A;  1KRH A;  1VLB A;  2LEK A;  2W3R A;  3CIR B;  2PVG C;  1J7C A;  1FMA D;  1CZP A;  1L0V B;  4JX1 C;  3AED B;  1WRI A;  1ZXI A;  2L83 A;  3AN1 A;  3W5U B;  1OFF A;  3AE6 B;  2MH7 A;  4HRO A;  4P6V F;  1FIQ A;  1JW9 D;  1UWM A;  2JQR B;  1WGK A;  3HRD D;  1NI3 A;  1N60 A;  2N0S B;  3AM9 A;  1V97 A;  1NEK B;  3AEC B;  1XLP A;  2L52 A;  1FM0 D;  1JQ4 A;  1FXA A;  2DWQ A;  3AE1 B;  4IDI A;  1SB3 C;  2Q5W D;  3AH7 A;  3DWG C;  3AEB B;  5EE3 A;  5H92 C;  3AE2 B;  2BS3 B;  4YT0 B;  1AWD A;  2WDV B;  3P1M A;  4ITK A;  4ZHO A;  1NYQ A;  2CJO A;  2BT6 A;  1WYG A;  3P4R B;  2K22 A;  3L4P A;  3PO0 A;  1GPX A;  1XLN A;  1YQ4 B;  2PVO D;  3AEA B;  1TKG A;  3NRZ A;  3P4S B;  2K9X A;  2WQY B;  1YQ3 B;  1XLQ A;  2KMM A;  1QOA A;  1VDV A;  5C3J B;  4YTN B;  1J7A A;  1QT9 A;  1TKY A;  1ROE A;  1OQQ A;  2OHF A;  5G5H A;  4YSZ B;  1OQR A;  1NVI D;  2DBY A;  1V8C A;  2KAJ A;  2H88 B;  3CWI A;  2MJE A;  1WWT A;  4HRS A;  4WWM A;  5AUI A;  3W9C B;  1YJJ A;  3AMZ A;  3AE7 B;  5EE1 A;  1FO4 A;  3P4Q B;  3SFE B;  1E9M A;  3NVY A;  4YTP B;  1N62 A;  3NVV A;  1J7B A;  1QOB A;  1F0Z A;  2CJN A;  1I7H A;  3LB8 C;  1TJE A;  4USA A;  3SFD B;  3AV8 A;  4YSY B;  1ZOY B;  1NEN B;  1PUT A;  1XLO A;  2BS4 B;  2E3T A;  1N61 A;  2Y5C A;  3KWL A;  4ZOH C;  5H8Y E;  3NVZ A;  2WP9 B;  2M56 B;  1RM6 C;  3P63 A;  2AX5 A;  1DOX A;  1FFV A;  4YXD B;  1N63 A;  1GAQ B;  5G5G A;  3FAH A;  3AE4 B;  4KX6 B;  1DOY A;  3AE8 B;  1E7P B;  1TYG B;  1E6E B;  1ZUD 2;  1N5X A;  1FRD A;  3ETR A;  3NS1 A;  5C2T B;  4C80 A;  4N58 A;  3BII D;  1FRR A;  1JRO A;  1N5W A;  2W54 A;  3DWM A;  1E0Z A;  2WU2 B;  1L6U A;  2EKI A;  2MJD A;  1QOF A;  3AEF B;  2PIA A;  1IUE A;  3VR8 B;  5AUK A;  1NYR A;  3W5V B;  2W55 A;  3P4P B;  4JWU C;  2WLB A;  2WS3 B;  3NVW A;  4C7Z A;  4A9A A;  1YJI A;  1R7S A;  1RFK A;  1CJE A;  1SIJ A;  2B76 B;  2H89 B;  2MJ3 A;  3HUI A;  4YTM B;  1QLB B;  1L5P A;  1PFD A;  2WDQ B;  2JX5 A;  3ABV B;  1XO3 A;  2CU3 A;  2BS2 B; 
#chains in the Genus database with same CATH topology
 3X0W A;  1KH0 A;  1KJT A;  1QKZ A;  2OOB B;  3UIN B;  1P7F A;  2DZJ A;  3AE3 B;  1XT9 B;  5IO9 A;  3DOW A;  2KC2 A;  3AB5 A;  4C7Y A;  1DOI A;  1JWA D;  1GUA B;  3VR9 B;  1SE4 A;  3WCQ A;  2RDG A;  3ENE A;  2KQ4 X;  2LVO A;  4NJ6 A;  2PEA A;  3O65 B;  2LFI A;  1L0V B;  3W1Y A;  3PPA A;  2V3P A;  3W2D A;  4XYC A;  4MEL A;  1C1Y B;  2MH7 A;  3AE6 B;  1AW7 A;  1I35 A;  2VZK B;  1N60 A;  4RGN A;  1WM3 A;  2IY1 B;  3DBH I;  3URY A;  2KAC A;  2LUM A;  5AZG A;  1RFA A;  3ZRF A;  5BO4 B;  1KOT A;  2AQ3 B;  4NAM A;  2IYD B;  1XLN A;  2KMM A;  2N9L A;  3GOE A;  2WNM A;  1TKY A;  1RLF A;  1OQR A;  2MBH A;  3KUZ A;  4FUL A;  2LJI A;  1BXT A;  1MHX A;  3O13 A;  4PYZ A;  2L00 B;  3MHZ A;  3P4Q B;  1N62 A;  1I4Q A;  2MCN B;  4HJG E;  1HTO A;  1V49 A;  1I4R A;  1XLO A;  1T5X D;  2WGS A;  3KLS X;  2M0X A;  2DHZ A;  1E7P B;  2D07 B;  4DBG A;  1LFD A;  2JPH A;  4ANU A;  1WXA A;  3ZJU A;  2W55 A;  3SD5 A;  1SSN A;  4GGQ A;  1V9J A;  1P7E A;  1PGA A;  5HFY A;  3HUI A;  4YTM B;  3W1S C;  3GS2 A;  2PMV A;  3Q3O C;  1A70 A;  2GB1 A;  1WRD B;  1LO5 D;  4XWW A;  3NS8 A;  1EWY C;  4MDK E;  3PVL A;  2WX0 A;  1PYW D;  3KUD B;  4RGT A;  3MC8 A;  3DBS A;  3KUC B;  4ARI A;  1WZ3 A;  3HVD A;  3P2B A;  1K52 A;  2J53 A;  4WH4 A;  3R8B A;  2HTM E;  3DDC B;  2PPH A;  1I42 A;  3AED B;  2J7Q B;  3UIP B;  4UDU C;  2X8X X;  2WHI A;  4WWO A;  4M00 A;  2XK5 A;  4ARC A;  5HI1 A;  5AZF A;  1FM0 D;  1V5O A;  4E3C A;  2RSU A;  1ET6 A;  1V1P A;  3MC9 A;  3Q8A A;  4NNJ B;  3RNG C;  4EEW A;  5EE3 A;  4REZ A;  1ZE3 D;  1MG4 A;  1KM7 A;  2QEJ C;  1C76 A;  2D11 A;  2WXN A;  4L2Y A;  2PE6 B;  4IW0 A;  2GRI A;  2JRH A;  3RCZ A;  2WXL A;  3AE7 B;  2W82 A;  2JRI B;  4F8C B;  3ZLZ A;  4A3P A;  2KLC A;  3AXC A;  4YSY B;  4I6L B;  1PUT A;  4ZOH C;  4MSQ B;  5C1Z A;  1T0Q C;  4YXD B;  5G5G A;  3AE4 B;  4FBJ B;  3WAP A;  3ETR A;  1FRD A;  4MH0 E;  4RM8 A;  4HCN B;  3AEF B;  4NQL B;  2E6X A;  3DVN U;  3VR8 B;  3DBR I;  3L13 A;  1XF5 L;  4ZYS A;  4PT5 A;  1UBQ A;  2XK5 B;  3ZTC A;  3R7Q A;  2KDF B;  1WFY A;  2BS2 B;  1CMX B;  3RI7 C;  2K5P A;  2DZK A;  3DPD A;  3EUB 2;  2L8J A;  2OJR A;  3PHW B;  4K7S A;  2IBI B;  2N1V A;  3EC8 A;  1J8C A;  3VH3 B;  3KYC D;  4B0E A;  1R4M B;  3TIX A;  3M62 B;  3ZXR A;  4AS1 A;  1JCK B;  4HDO A;  4MM3 A;  3FKY A;  4HWI B;  2AEH A;  2MSE D;  1KFY B;  3NZS A;  5D3D A;  4O1N A;  4B6W A;  2LGX A;  3GE8 C;  2XNA C;  3BK2 A;  1BT0 A;  2W3R A;  3CIR B;  1CZP A;  4A8X C;  1M4V A;  3MJW A;  2NBV B;  2QIL A;  2KHW B;  3T8M A;  2BF8 B;  1UWM A;  1L7Y A;  3A1Q A;  3RN9 C;  2LHE A;  2QHO A;  1SEB D;  4KV2 A;  1JQ4 A;  1FNW A;  3N3K B;  4PS8 A;  2LXA A;  3APF A;  1V2Y A;  2R61 A;  3P4R B;  2K22 A;  4MH8 A;  3PO0 A;  1XCT L;  2K9X A;  5C3J B;  2G45 B;  2C7M B;  2NTT A;  1SE3 A;  1WWT A;  2QSD A;  1S3S G;  3DCG A;  1ZPS A;  4KGR A;  3I3T B;  4MM3 B;  2BS4 B;  4DXG A;  3N9Y C;  3KWL A;  2O6V A;  4ZRQ A;  4K7W A;  4KSK C;  4W9I A;  3A9J A;  4RM9 A;  2KZR A;  3ZRC A;  2DZM A;  2ZVO A;  4PYU A;  2J52 A;  4DXF A;  1JRO A;  2WU2 B;  2JYE A;  3H1U A;  1FNV A;  2ZZP B;  3IHP C;  2WLB A;  2WS3 B;  3A1Q B;  1YJ1 A;  2GMI C;  2V9H A;  3DVG X;  4HPM B;  2WXG A;  3UIO B;  3QWZ B;  5D94 A;  2CKH B;  3LJ3 A;  3VFK A;  1T0Y A;  2KVZ A;  2V3N A;  2ZCC A;  4DK5 A;  1RYJ A;  2KFK A;  3U4E G;  4HLE A;  1QF6 A;  1L4Z B;  1JRU A;  4I6N B;  4ZRI A;  2NPT A;  1UUP A;  3PGE A;  3RPF C;  1HTQ A;  1KF6 B;  4M0W A;  2HD5 B;  3VH4 B;  2G1E A;  2O6V B;  1FMA D;  2ZPY A;  1WMH A;  4RCO A;  2KMA A;  1C4A A;  1TBE A;  2KD0 A;  2RDH A;  3Q3N C;  2WWZ A;  2C5L C;  1TS3 A;  2D10 A;  4GOC A;  1OGW A;  2BS3 B;  5DPS A;  2GI9 A;  4LDT B;  3BYY B;  4MGK E;  3BVG A;  2H88 B;  2LZ6 A;  4HRS A;  2BB5 A;  3AMZ A;  3C8Y A;  3RFZ B;  2KFK B;  4DDG D;  3Q8C A;  3MJ5 A;  3SFD B;  1D3Z A;  2NPT B;  1WM2 A;  2MBB B;  4XWT A;  3PRE A;  1T6B X;  2BBC A;  3C0R B;  2GBJ A;  1ENF A;  4M01 A;  4RH6 A;  3QHT A;  3WIM A;  1WZ0 A;  1SJE D;  2BKR B;  5AUK A;  2K39 A;  5DCN A;  1JWS D;  1WXV A;  1WH3 A;  4TUU A;  4A9A A;  1E7U A;  1R7S A;  1RAX A;  1CJE A;  1WE6 A;  3EA6 A;  1P3Q U;  1Q10 A;  4BZA A;  2ZNV C;  2O6V D;  3EEC A;  3ABV B;  1D5Z C;  4ZHP A;  3AE5 B;  4MGY E;  5IA7 A;  4KSL C;  5HG2 A;  4IWQ A;  5IN7 A;  2N1W A;  4WJQ A;  3B9J A;  2AQ1 B;  2N9E B;  2LRU A;  3ZQ4 A;  5AZH A;  1UGJ A;  4ZRK A;  1RWS A;  2GBM A;  2WDR B;  3B2F A;  1TGZ B;  5D3I B;  1UWX A;  4E71 A;  2FCS A;  3AEG B;  3APC A;  2EMT A;  2MLB A;  4B95 A;  2L05 A;  3FC4 A;  2N7J A;  5CX3 A;  3P42 A;  5JXV A;  4LJP B;  1JML A;  4DHZ E;  4DHJ B;  4HJK A;  5L83 A;  3H9D A;  1SIF A;  4BOS C;  2N0S B;  2FUH B;  3H7P A;  1ZKH A;  3M3J A;  4XDD A;  4CYE A;  3Q8F A;  1D5M C;  4WAA A;  2ZEQ A;  2BT6 A;  1WYG A;  2L0F A;  1EF5 A;  5JZE B;  3V62 A;  4KZC A;  2WDT B;  4EZK A;  3MTN B;  2WQY B;  1ZW7 A;  3VUW A;  2WXR A;  3RNE C;  1IBX A;  2PJH A;  5EE1 A;  3RT3 B;  2IO2 B;  4AQ7 A;  1E8Z A;  3LB8 C;  2KLG A;  2M56 B;  3P63 A;  1WR1 A;  2RPV A;  3OJ4 B;  2SAK A;  1K8R B;  3IG3 A;  4K1R B;  3VTU A;  1KLU D;  2AL6 A;  1WGG A;  3W5V B;  2J42 A;  5JH5 C;  1XQQ A;  1LXD A;  3ZNH B;  3PS6 A;  3H7P B;  4KKI A;  4I6P A;  3QQ8 B;  4TSS A;  3IT4 B;  4JWS C;  1L6V A;  1WXQ A;  3IVF A;  2MHJ A;  1AYF A;  5E6J A;  5IOI A;  3TEW A;  3TBL D;  3LDZ E;  4TMA B;  4W9K A;  5E6N A;  1YX5 B;  2I2Y A;  3ZXV A;  4LLG M;  3ZJT A;  2PKO A;  1AN8 A;  5CHW A;  2RGF A;  2HJ1 A;  3VRB B;  2RMM A;  3PRP B;  2DAF A;  3PZ7 A;  1HEZ E;  1WRI A;  3AN1 A;  1HZ6 A;  1FIQ A;  1NI3 A;  3DQV A;  1XLP A;  3K9P B;  2JZ3 B;  3B1L X;  1FXA A;  2DWQ A;  5TR5 A;  3AE1 B;  3GE3 C;  3AH7 A;  4FHJ A;  2NCN A;  3CF6 E;  2M17 A;  4W9G A;  4P1B C;  2V4L A;  4LNO A;  1WYW B;  2FID A;  3U52 E;  4KGT A;  1V80 A;  5G5H A;  4GB9 A;  4DHZ B;  1QQR A;  2L32 A;  2MA9 B;  3ZNG C;  3M95 A;  5AUI A;  3V6E B;  2G3Q B;  3AU4 A;  4MEM A;  1Q0W B;  4USA A;  2KO3 A;  1UGM A;  1TTN A;  2OJW A;  1FFV A;  3VUX A;  3A33 B;  5KHQ A;  1E6E B;  1N5X A;  4RGO S;  3ZIM A;  3BII D;  4HPL B;  2BWF A;  2KWV B;  4IC7 B;  4P16 A;  2YEP B;  2IPK D;  2PIA A;  1TIF A;  3OLM D;  2V4I B;  4FHK A;  4JGH B;  1ISN A;  4C7Z A;  3NZU A;  3RNA C;  1S1Q B;  3N1Y C;  2JX5 A;  2WXI A;  2DZI A;  1MJD A;  5GXG B;  2QJL A;  1WX7 A;  2M8S A;  2LMC A;  2CR5 A;  3VRA B;  4KVG B;  2EKE C;  2BW2 A;  2IJ0 A;  5D7G A;  1ET9 A;  1MI0 A;  1XD3 B;  4MJS A;  4L1B A;  2YEP F;  1C4C A;  2PW9 A;  1NI2 A;  3SHQ A;  2VZK D;  1T0S C;  2KN4 A;  1WGK A;  2MEK A;  4WQO B;  4EUT A;  4JL9 A;  4W9C A;  4GXB A;  3JYU A;  1SB3 C;  4OVZ A;  3AE2 B;  4XC2 A;  1SJH D;  3IFW B;  5BMH A;  4JLC A;  3NRZ A;  4DQO C;  4KZ0 A;  3VVW B;  3NY5 A;  5DPR A;  3DHG C;  2XEW A;  3RZF A;  4IUM B;  2DBY A;  3RNF C;  4HKZ E;  4WWM A;  1VD2 A;  1B1Z A;  1OEY A;  2JVC A;  2DX5 B;  2N4F A;  3HM3 A;  2V3S A;  1F0Z A;  2NVU I;  1WI0 A;  2WYQ A;  2Z0D B;  2WP9 B;  1WIA A;  2DYB A;  1N63 A;  1GAQ B;  2KFJ A;  4MJS B;  5BMG A;  1TYG B;  1C79 A;  1YN3 A;  3DWM A;  1L6U A;  1WX9 A;  1GJZ A;  1OEY J;  3VUY A;  4HDQ A;  1GOZ A;  2J4X A;  1R4M I;  1QLB B;  1KLG D;  3PLV A;  1PQS A;  2Y3A A;  3Q2A C;  3NG0 A;  2LUE A;  3SR6 A;  1JRP A;  2C7N B;  2LGY A;  3FIL A;  4GLS C;  2W9N A;  4W9J A;  1UEL A;  1FFU A;  3UI3 A;  1EF1 A;  3L0W B;  3CST A;  2JF5 A;  1JAL A;  1E10 A;  3LXF A;  3HVZ A;  4J6I A;  5MPO A;  4WQM A;  4R3D A;  4EZJ A;  3A9K A;  5CTR C;  3L08 A;  2IO1 B;  3N1Z C;  4JQW C;  4C4V A;  1WE7 A;  1GNU A;  4TQ0 A;  4QAY A;  3C19 A;  1VCB A;  2BWE S;  1L0Y B;  2IGH A;  2KXJ A;  4II2 B;  4YT0 B;  3EGR A;  2BKF A;  1GPX A;  4P7I A;  3ZNI D;  1VDV A;  4ACF A;  1TY0 A;  4IG7 B;  4G11 A;  4YSZ B;  1NVI D;  4IKG A;  1H4R A;  2ASQ A;  3FIL B;  3IXS A;  4LNI A;  1I4P A;  3NVY A;  2ON8 A;  1CK1 A;  2VRR B;  2C60 A;  2FCQ A;  3A4R A;  3NJT A;  3QAQ A;  1TJE A;  1HXY D;  5EDS A;  2PLP A;  4N9F 4;  1WSP A;  1Z5S B;  4W9D A;  3A9K B;  3WAO A;  3NS1 A;  4CHK A;  2RR9 A;  1YD8 U;  3PRM B;  2WXQ A;  1FRR A;  1E8Y A;  2VH1 A;  4S17 A;  3EFC A;  3V6C B;  2KX0 A;  4C4V B;  1JWU D;  1IYF A;  4GU2 A;  2QCZ A;  2WDQ B;  4BKT A;  4YSX B;  2A5U A;  4EE2 A;  5FR3 A;  4OZB A;  3AEE B;  2MW5 A;  3B2G A;  3H7S A;  1WGR A;  3Q14 C;  1B9R A;  1SF0 A;  3PSE B;  5C23 A;  4ZRJ A;  2FBW B;  2Z8L A;  1VJK A;  4ZYN A;  1OTR B;  2GBN A;  3TUO A;  2MBQ A;  1VZ8 A;  1MPE A;  5G2N A;  1YNT E;  1ZXI A;  5DPT A;  3J9C A;  2Y5P A;  4JIO U;  1A5R A;  1RRB A;  2JQR B;  1WXM A;  3HRD D;  1UBI A;  4BFR A;  3CSF A;  4C56 C;  3ZJV A;  4A90 A;  3AEC B;  2MQJ A;  1BUI C;  5BYQ A;  1WGY A;  4BKS A;  2D3B A;  1E7V A;  2VH2 A;  1D4B A;  3P4S B;  1SE2 A;  1HZ5 A;  2LGD A;  1IGD A;  4ZDV A;  2HTH A;  3CWI A;  3DBL B;  1YN5 A;  4OVV A;  2MJE A;  3W9C B;  5GMV A;  2YVC A;  4WJN A;  3ZNZ B;  1T0R C;  2CJN A;  2BYE A;  1V5T A;  5LXI B;  1NEN B;  2GOW A;  3ONS A;  3OG5 A;  2LWP A;  3VXW A;  1F2R C;  1AAR A;  5G55 A;  4BOZ B;  1L4D B;  2D3C A;  2IO3 B;  4N58 A;  2W54 A;  1GG3 A;  3OAW A;  3AU5 A;  3H8H A;  4ICV A;  4NQK E;  2H89 B;  1R4N I;  1MHH E;  2ONQ A;  3B0A A;  2CS4 A;  2GBR A;  1WJ4 A;  3RZW C;  1WGH A;  3JW0 X;  2I1K A;  2JU6 X;  1LGR A;  3TSS A;  4M8M A;  2JWZ A;  1YN4 A;  1IP9 A;  2FCM A;  1TKE A;  4TV3 A;  4B0M A;  1BML C;  1NDD A;  2M19 A;  3BIN A;  1UZX B;  3LYY A;  3N1X C;  2JSV X;  1FD6 A;  4D2K A;  4M8N A;  1OFF A;  2FCN A;  3Q3M C;  4LJO B;  1F52 A;  5AEK B;  2AL3 A;  4RNA A;  2KC1 A;  2PTL A;  2K8H A;  3DWG C;  2N7E A;  4EFO A;  3WAL A;  4LDT D;  1VZ6 A;  3AEA B;  4FJV B;  1YQ3 B;  1F77 A;  1F9J A;  1J7A A;  2AQ2 B;  2KJ6 A;  3Q6B A;  1SE9 A;  4WUR A;  3L17 A;  3ECI A;  3HIZ A;  4GMV A;  4EOY A;  3GZN I;  3MFG A;  4BKS D;  4W9L A;  3UQB A;  1MG8 A;  1HA5 A;  2NMQ A;  2DNF A;  1GC6 A;  3NVZ A;  1U4A A;  1FXT B;  2O2V B;  5HKH A;  1ACC A;  4FJZ A;  2Z0E B;  2YLM A;  3TCA A;  3AI5 A;  5FKA C;  3A4S C;  5IKC M;  4MAC A;  3ZKJ C;  1F1H A;  1LQB A;  2JY6 A;  1QZE A;  4KIK A;  2CU3 A;  2L1A A;  4L23 A;  4ANX A;  4FXC A;  1K51 A;  1TS5 A;  1MVK A;  3ML8 A;  2DLB A;  3NUH B;  1XCQ L;  1I4G A;  3BZD B;  2DYM A;  1YOV B;  4BBN F;  3KW5 B;  1K50 A;  4DHJ D;  4LTU A;  2KDM A;  1GC7 A;  1Y8R C;  2NBW B;  4HRO A;  2V1Y A;  3WAN A;  1HE8 A;  4NJC A;  4P6V F;  4AP4 C;  4XZ4 A;  5KHO A;  2ZW0 A;  4W9E A;  2UU7 A;  4GN1 A;  2RDB C;  1Q1O A;  4IDI A;  2JZZ A;  5H92 C;  4KDI C;  2EEL A;  2WDV B;  3P1M A;  2KDE B;  3DHH C;  1WGD A;  3AUL A;  2NR2 A;  4GDL B;  4BKG A;  4KIK B;  3RUI B;  4MGI E;  1NBF C;  1QOA A;  3B08 A;  1QT9 A;  5TSS A;  3VTW A;  2KWU B;  4DWF A;  4IM0 A;  5D6J B;  2FUG 1;  5J17 A;  3CMM B;  1FO4 A;  1VR9 A;  2KT7 A;  4WWP A;  3EFU A;  3BK1 A;  1I7H A;  3JSV B;  4BAX A;  3AV8 A;  4H2A A;  4PS7 A;  2WXH A;  4K7U A;  1RM6 C;  1DOY A;  2KMC A;  5C2T B;  1PGB A;  1KTK A;  4NJ7 A;  4OHJ A;  3T3O A;  2I1J A;  3U30 A;  4GIV A;  1YJI A;  4Q2J A;  1UF0 A;  1N6Z A;  2IND C;  3N30 A;  1F2R I;  1IPG A;  4AJY B;  4US9 A;  4FJY A;  1FCL A;  5FK9 C;  4WJO A;  1FXI A;  3AE9 B;  2AYO B;  3V3X A;  3Q3J A;  2ACZ B;  4IWP A;  3ZW3 A;  2BQQ A;  5IAA C;  3TL5 A;  5D2M B;  1L0X B;  2GLS A;  3M63 B;  2LJ5 A;  2G9H D;  3ZYY X;  3V61 A;  4A3O A;  2L0T A;  2W3S A;  4J3O D;  4EKU A;  4LNF A;  3HHM A;  5BYR A;  3BYT B;  1FPY A;  1V97 A;  1NEK B;  3ZO5 B;  2K6Q A;  1XEE A;  3U7D A;  3AEB B;  2J0M A;  2CJO A;  4FLH A;  4A55 A;  3L4P A;  3NOB A;  4CO7 A;  2Z59 B;  3DBH B;  2BYV E;  4YTN B;  4HCP B;  3TEY A;  1E8X A;  3MHS D;  4NZL B;  4K3B A;  4WWN A;  3RNC C;  4PS3 A;  4E74 A;  2A4Z A;  1N61 A;  2JWU A;  4JPS A;  1E90 A;  2PE9 A;  2AX5 A;  1DOX A;  3RNB C;  2JUO A;  2V0G A;  1K53 A;  4IOI E;  4KX6 B;  1TS2 A;  1ZXH A;  3DHI C;  2ZVN A;  5L95 C;  2MJD A;  4IM2 A;  3L16 A;  4W9F A;  5CHV C;  2LGS A;  1WF9 A;  1Y56 A;  3VQI A;  4P1C C;  1TS4 A;  2X38 A;  4DDI D;  5LXH A;  1L5P A;  4A6Q A;  2K0P A;  2L83 A;  1XO3 A;  5IP4 D;  2JXT A;  2NS5 A;  2N7D A;  2BTE A;  4DXA B;  1FEH A;  3ZUN A;  5FR6 A;  2KK8 A;  1IGC A;  3SU8 X;  3KQ4 A;  1XXG A;  2REX A;  2ZNV B;  4C00 A;  2MBO A;  1SXT A;  3RYT A;  1KLV A;  3L54 A;  2LVP A;  2JYT A;  2C9W B;  1D5X C;  5EE0 A;  2L7R A;  1VLB A;  4JX1 C;  2GBK A;  3Q8E A;  1V81 A;  4ANW A;  2IZV B;  2Y5B B;  4ASW C;  3IAM 1;  4NAW A;  2ZPN A;  1C9F A;  5J2R A;  1VZ7 A;  4GDK A;  3UGB B;  1JWM D;  4X57 B;  3ZVV A;  4BVU C;  3DVG Y;  4BBN C;  2D5G A;  3PTF C;  1EM7 A;  4RGM A;  2M0A A;  4KDL B;  3U8Z A;  1FNU A;  2I38 A;  3K9O B;  1M94 A;  2M1M A;  4AUQ C;  2UYZ B;  4WJP A;  5BMI A;  1E9M A;  4YTP B;  3QCA A;  3ZGZ A;  2KTF A;  4MGZ E;  2J0K A;  5J18 A;  3Q69 A;  2BGF A;  3ALB A;  3ZTD A;  1QIL A;  1P0R A;  1ZOY B;  2D2Q A;  3PLU A;  4LNN A;  2E3T A;  1V1P B;  3U2S C;  3QX1 A;  3HK0 A;  2R2Q A;  2N9P C;  3AE8 B;  3Q3F A;  2SEB D;  4XX5 A;  2K6D B;  3I5J C;  2KWC A;  5I4D A;  2BYT A;  4OZC A;  3SEB A;  1SGH A;  4OVU A;  2KQS A;  3VDZ A;  2INN E;  4NAW B;  3U7Z A;  3NVW A;  2RPQ A;  4XE0 A;  4GDK B;  1EO6 A;  1PFD A;  2HDE A;  1E0Z A;  1PGX A;  4HXD A;  2KJH B;  1WJN A;  3I63 C;  4US8 A;  1V6E A;  3DBR B;  1T3Q A;  1L2N A;  2K1F A;  2ZJD A;  1VRA B;  4N6E B;  4WAF A;  1DGJ A;  2KVR A;  1V86 A;  1DYQ A;  4OZA A;  1ZP0 B;  4HPP A;  1C3T A;  1JWB D;  2BYF A;  4YL8 A;  1PDX A;  2WXK A;  4F1S A;  2IY0 B;  1MFW A;  2QC8 A;  2B3A A;  3RD2 A;  4EZL A;  2DAJ A;  4G3X B;  2PVG C;  4CQN A;  1YX6 B;  2CHX A;  2CHZ A;  2N9K A;  3SDL C;  3BWU D;  4WIP A;  3PHX B;  3UQA A;  1TZ1 A;  2N9X A;  2FE8 A;  3AM9 A;  3R66 C;  2LI5 A;  3TEZ A;  3ZDT A;  1J19 A;  4JE3 B;  3DBL I;  1GB4 A;  4ITK A;  1FCC C;  2CU1 A;  4LNK A;  1YQ4 B;  2WXF A;  2PVO D;  4ZRP A;  4AJW A;  1TKG A;  4RF1 A;  2XN9 C;  2G4D B;  1CQV A;  2WXJ A;  3PRZ A;  1C78 A;  3SFE B;  4XDC A;  3NVV A;  2KNB A;  1J7B A;  3APD A;  2J0J A;  4II3 B;  5LLI A;  2Y5C A;  4KGS A;  3KVF B;  5JHB A;  2JXX A;  3WA0 A;  3ML9 A;  1WJU A;  4RMA A;  3E56 A;  2KDI A;  1ZUD 2;  2R2O A;  4MT5 A;  2ICI A;  3W1S A;  3TJP A;  1E5W A;  2ZCB A;  4LCD E;  5LNK 1;  2WXP A;  3MC0 B;  1UD7 A;  1Q5W B;  1RFK A;  2ZW1 A;  3E9S A;  3KWV A;  3GB1 A;  3X23 A;  1WY8 A;  2K8C A;  2L76 A;  1EU4 A;  4FAD A;  4TQ1 A;  4URK A;  2LAS A;  3KH0 A;  1I4X A;  3A9J B;  1TT5 B;  2JZP A;  1UH6 A;  4PK1 A;  3PV1 A;  2G4S A;  4IWO A;  2LVQ A;  1P1A A;  5DPW A;  3BVM A;  1YQB A;  2KYW A;  2FIF A;  2HE7 A;  2QIE B;  2D3A A;  4N59 A;  1C77 A;  1QOG A;  2KQ7 A;  1E8W A;  3NHE B;  3BVZ A;  1TY2 A;  2LRW A;  1J7C A;  5HHD G;  2IGG A;  2K8B A;  5JHA A;  2KWD A;  4HK2 A;  1V1O A;  4ICU A;  1JW9 D;  2C7H A;  2D3G A;  1GB1 A;  1YMH E;  2INP E;  1P9D U;  3JVZ X;  1EUV B;  1EU3 A;  5T8I A;  1WX8 A;  2L52 A;  2L3Z A;  2IGD A;  1J0G A;  4TKN A;  3N32 A;  2NBU A;  2Q5W D;  1Z2M A;  4K3C A;  4ZHO A;  1NYQ A;  2O2V A;  3R2I A;  4M0W B;  4RFB A;  3OJ3 A;  3R7R A;  3IBE A;  3QAR A;  4KKJ A;  1SBB B;  2AWT A;  2OHF A;  2HJ8 A;  3VHT C;  1WMH B;  3QA8 A;  2KAJ A;  2FAZ A;  3IAS 1;  2MP2 A;  2KAN A;  2DEN B;  1STE A;  3PT2 B;  1QOB A;  4HKQ A;  2CHW A;  3PZ8 A;  3V60 A;  3QJZ A;  4M02 A;  4G0N B;  3R2T A;  5H8Y E;  4LK0 M;  2OED A;  2RD0 A;  4ANV A;  3FAH A;  3QC8 B;  4IM3 A;  1ZDX A;  3L10 B;  1N5W A;  1R4N B;  5E6P A;  2EKI A;  1QOF A;  3I9V 1;  4S0R A;  1NYR A;  1ESF A;  4G50 A;  2MBE A;  2EMS A;  1SIJ A;  3ZDM C;  4XGA B;  4RF0 A;  4W9H A;  3TEX A;  4GSW A;  1LM8 B;  4HVB A;  5CHF A;  2FNJ B;  2WU5 B;  2MWS B;  1UNS A;  4AWJ A;  2UWQ A;  2K3U A;  3WAM A;  1P98 A;  1WR6 E;  3I57 A;  2LHD A;  2WXM A;  1ZDV A;  2KTR A;  2INC C;  2WX1 A;  2MP2 B;  4MSM B;  1I4H A;  3H6N A;  3N20 C;  2LD9 A;  2KOX A;  3QIJ A;  2KN5 A;  4FN2 A;  5BYS A;  2KJR A;  1OQY A;  3R3M A;  4GDL A;  5EE9 A;  2QMT A;  2LXC A;  1KRH A;  1D6E C;  3GP7 A;  2DYO A;  2LEK A;  3HM6 X;  2MX2 A;  2XBB C;  3IT6 B;  3W5U B;  4AOF A;  3MP9 A;  4F7Z A;  2IO0 B;  3S2A A;  2M4N A;  3TMP B;  2TSS A;  2LGI A;  4A20 A;  3DVN V;  3EHV A;  3OWE B;  3JSV A;  2QDF A;  4K81 A;  2JT4 B;  1AWD A;  2KX3 A;  2K25 A;  3VAW A;  2MRP A;  3KYD D;  1XLQ A;  2NTS A;  1X1M A;  1ROE A;  1OQQ A;  2BVC A;  3GZN B;  1YIW A;  3UF8 A;  1V8C A;  4NY0 A;  1TZO A;  3T3N A;  3PZD A;  1YJJ A;  2KDB A;  4B9K A;  3NZ3 A;  2BPS A;  2WXO A;  1C4P A;  4HEA 1;  3V05 A;  1H8C A;  4OW0 A;  2BB6 A;  2KTR B;  4FA6 A;  1G6J A;  4NPN A;  5E6O A;  3D32 A;  1WJ6 A;  2IDY A;  1EWC A;  4C80 A;  1ZGU B;  3VTV A;  3RMK C;  1IUE A;  1WXS A;  4YWG G;  3T9L A;  3P4P B;  3RUL A;  1IBX B;  1HQR D;  3QK0 A;  3Q8B A;  2B76 B;  2KKC A;  3BY4 B;  4JWU C;  2MJ3 A; 
#chains in the Genus database with same CATH homology
 1D5Z C;  4ZHP A;  3AE5 B;  2JXT A;  4EE2 A;  5FR3 A;  4OZB A;  1KH0 A;  2BTE A;  1QKZ A;  3AEE B;  5HG2 A;  1FEH A;  1IGC A;  3B2G A;  1P7F A;  3AE3 B;  3KQ4 A;  1XXG A;  3B9J A;  1B9R A;  2AQ1 B;  1SF0 A;  3ZQ4 A;  3AB5 A;  1UGJ A;  2FBW B;  4C7Y A;  1RWS A;  1SXT A;  1DOI A;  2WDR B;  3B2F A;  2Z8L A;  1VJK A;  1JWA D;  5D3I B;  1UWX A;  3VR9 B;  3AEG B;  1SE4 A;  2JYT A;  3WCQ A;  2RDG A;  3FC4 A;  2KQ4 X;  1D5X C;  3TUO A;  2N7J A;  1VZ8 A;  3P42 A;  5EE0 A;  5JXV A;  2LFI A;  1VLB A;  1JML A;  1MPE A;  1L0V B;  4JX1 C;  3Q8E A;  2V3P A;  1YNT E;  1ZXI A;  3W2D A;  3AE6 B;  2MH7 A;  3J9C A;  2Y5P A;  3IAM 1;  1AW7 A;  2JQR B;  2VZK B;  3HRD D;  1N60 A;  4RGN A;  2N0S B;  1C9F A;  1VZ7 A;  4C56 C;  3ZJV A;  3URY A;  4XDD A;  4A90 A;  2KAC A;  3AEC B;  1JWM D;  1BUI C;  2LUM A;  5BYQ A;  3Q8F A;  1D5M C;  2D5G A;  1EM7 A;  2AQ3 B;  4RGM A;  4NAM A;  2BT6 A;  1WYG A;  1D4B A;  2M0A A;  1XLN A;  1FNU A;  3P4S B;  2I38 A;  1SE2 A;  2WQY B;  2KMM A;  2N9L A;  1HZ5 A;  2WNM A;  1TKY A;  2WXR A;  1OQR A;  1IGD A;  3CWI A;  1YN5 A;  2MJE A;  2LJI A;  3W9C B;  5BMI A;  1BXT A;  1MHX A;  3O13 A;  5EE1 A;  1IBX A;  3MHZ A;  3P4Q B;  1E9M A;  4YTP B;  1N62 A;  4AQ7 A;  3ZGZ A;  1I4Q A;  2CJN A;  3LB8 C;  3Q69 A;  4HJG E;  1QIL A;  1ZOY B;  1NEN B;  1I4R A;  1XLO A;  1T5X D;  2E3T A;  1V1P B;  3KLS X;  2M56 B;  3U2S C;  3P63 A;  1F2R C;  2RPV A;  2SAK A;  3AE8 B;  1E7P B;  2SEB D;  1L4D B;  4N58 A;  2W54 A;  5I4D A;  2BYT A;  4OZC A;  3SEB A;  1KLU D;  3H8H A;  3W5V B;  3ZJU A;  2J42 A;  2W55 A;  2INN E;  4NAW B;  3U7Z A;  1SSN A;  3NVW A;  1P7E A;  1PGA A;  4XE0 A;  5HFY A;  2H89 B;  3HUI A;  4GDK B;  4KKI A;  4YTM B;  1PFD A;  1MHH E;  2HDE A;  2ONQ A;  1PGX A;  2PMV A;  3GS2 A;  1E0Z A;  4TSS A;  4US8 A;  3IT4 B;  1A70 A;  2GB1 A;  4JWS C;  1L6V A;  1T3Q A;  1WXQ A;  2JU6 X;  1LO5 D;  4XWW A;  1AYF A;  1VRA B;  3TSS A;  4N6E B;  1EWY C;  5E6J A;  3TEW A;  4WAF A;  1DGJ A;  1PYW D;  4TMA B;  1YN4 A;  4RGT A;  1DYQ A;  4OZA A;  1ZP0 B;  4ARI A;  2I2Y A;  3HVD A;  1K52 A;  1TKE A;  2J53 A;  4LLG M;  1JWB D;  4B0M A;  1BML C;  2PKO A;  1AN8 A;  4WH4 A;  3ZJT A;  2M19 A;  3R8B A;  3VRB B;  1PDX A;  2WXK A;  2RMM A;  2HTM E;  3LYY A;  2JSV X;  2PVG C;  3PZ7 A;  1FD6 A;  3AED B;  1HEZ E;  1WRI A;  4CQN A;  3AN1 A;  1HZ6 A;  4D2K A;  2N9K A;  1OFF A;  4UDU C;  3BWU D;  4WIP A;  1FIQ A;  1NI3 A;  2FE8 A;  3AM9 A;  4RNA A;  4ARC A;  2PTL A;  5HI1 A;  1XLP A;  3TEZ A;  1FM0 D;  1FXA A;  2DWQ A;  3AE1 B;  1ET6 A;  4JE3 B;  1V1P A;  3Q8A A;  3AH7 A;  3DWG C;  5EE3 A;  4REZ A;  1ZE3 D;  1GB4 A;  4ITK A;  1FCC C;  1VZ6 A;  1YQ4 B;  2PVO D;  2WXF A;  3AEA B;  4ZRP A;  1TKG A;  2QEJ C;  3U52 E;  1C76 A;  4KGT A;  1YQ3 B;  2WXN A;  4L2Y A;  4RF1 A;  1F77 A;  2XN9 C;  1J7A A;  5G5H A;  2AQ2 B;  1CQV A;  1QQR A;  2WXJ A;  2L32 A;  2GRI A;  1C78 A;  5AUI A;  2WXL A;  3AE7 B;  3SFE B;  4WUR A;  4XDC A;  3NVV A;  1J7B A;  2W82 A;  4USA A;  3MFG A;  4YSY B;  1PUT A;  2Y5C A;  1HA5 A;  4ZOH C;  4KGS A;  2NMQ A;  3NVZ A;  1FFV A;  4YXD B;  5G5G A;  3AE4 B;  3E56 A;  1ZUD 2;  1E6E B;  3ETR A;  1N5X A;  1ACC A;  1FRD A;  4MT5 A;  2ICI A;  4RGO S;  3W1S A;  3BII D;  4P16 A;  2YEP B;  3AEF B;  5FKA C;  2IPK D;  5LNK 1;  2PIA A;  2WXP A;  2E6X A;  3VR8 B;  3MC0 B;  4MAC A;  1XF5 L;  4ZYS A;  2V4I B;  4C7Z A;  4PT5 A;  1RFK A;  2ZW1 A;  3E9S A;  3KWV A;  3GB1 A;  2JX5 A;  2CU3 A;  2BS2 B;  2L1A A;  2WXI A;  1EU4 A;  4L23 A;  2K5P A;  4TQ1 A;  3EUB 2;  4FXC A;  5GXG B;  1I4X A;  1K51 A;  1TS5 A;  2QJL A;  1MVK A;  2JZP A;  2DLB A;  3NUH B;  4B0E A;  1XCQ L;  2LMC A;  3BVM A;  3VRA B;  4AS1 A;  1JCK B;  1I4G A;  3BZD B;  2BW2 A;  2QIE B;  4N59 A;  1C77 A;  2DYM A;  2IJ0 A;  1QOG A;  5D7G A;  1ET9 A;  1MI0 A;  1KFY B;  3BVZ A;  5D3D A;  1K50 A;  1TY2 A;  4L1B A;  4O1N A;  2YEP F;  2XNA C;  1C4C A;  2KDM A;  2W3R A;  2PW9 A;  3BK2 A;  1J7C A;  3CIR B;  1CZP A;  4LTU A;  4A8X C;  1M4V A;  2IGG A;  2L83 A;  5HHD G;  2KWD A;  2VZK D;  4HRO A;  1V1O A;  2QIL A;  4NJC A;  4P6V F;  1JW9 D;  1UWM A;  1GB1 A;  2KN4 A;  1WGK A;  1YMH E;  2MEK A;  2INP E;  2LHE A;  2ZW0 A;  1EU3 A;  5T8I A;  2L52 A;  1SEB D;  2IGD A;  1JQ4 A;  1FNW A;  4IDI A;  1SB3 C;  2Q5W D;  4OVZ A;  5H92 C;  3AE2 B;  2EEL A;  2WDV B;  3P1M A;  4ZHO A;  1NYQ A;  3R2I A;  2R61 A;  3P4R B;  2K22 A;  4MH8 A;  3PO0 A;  1SJH D;  4RFB A;  4GDL B;  5BMH A;  3NRZ A;  1XCT L;  2K9X A;  4DQO C;  1QOA A;  4KKJ A;  5C3J B;  1SBB B;  1QT9 A;  2OHF A;  5TSS A;  2NTT A;  2DBY A;  2FUG 1;  1SE3 A;  2KAJ A;  4HKZ E;  1WWT A;  4WWM A;  3IAS 1;  2QSD A;  1FO4 A;  1B1Z A;  1VR9 A;  1STE A;  1ZPS A;  4KGR A;  1QOB A;  3BK1 A;  4HKQ A;  1I7H A;  1F0Z A;  3AV8 A;  3PZ8 A;  4H2A A;  2WXH A;  4MM3 B;  2BS4 B;  4DXG A;  3N9Y C;  3KWL A;  3R2T A;  4ZRQ A;  5H8Y E;  4LK0 M;  2OED A;  2WP9 B;  1RM6 C;  1N63 A;  1GAQ B;  1DOY A;  3FAH A;  5BMG A;  1TYG B;  1C79 A;  1YN3 A;  1ZDX A;  2J52 A;  5C2T B;  4DXF A;  1JRO A;  1N5W A;  3DWM A;  2WU2 B;  1L6U A;  2EKI A;  1PGB A;  1QOF A;  1KTK A;  2JYE A;  3I9V 1;  1FNV A;  1NYR A;  4OHJ A;  3T3O A;  1ESF A;  2WLB A;  2WS3 B;  1GOZ A;  1YJI A;  1SIJ A;  2J4X A;  2MJ3 A;  4RF0 A;  1QLB B;  4Q2J A;  1KLG D;  3TEX A;  2Y3A A;  2WXG A;  3SR6 A;  1F2R I;  1JRP A;  3FIL A;  4US9 A;  4GLS C;  1FCL A;  2V3N A;  2WU5 B;  5FK9 C;  1RYJ A;  1FFU A;  1UNS A;  1FXI A;  3UI3 A;  2K3U A;  3AE9 B;  3U4E G;  3V3X A;  1JAL A;  1E10 A;  3LXF A;  3HVZ A;  3I57 A;  1L4Z B;  2LHD A;  1QF6 A;  2ACZ B;  2WXM A;  1ZDV A;  5MPO A;  1UUP A;  4WQM A;  4R3D A;  1I4H A;  1L0X B;  3RPF C;  5BYS A;  1KF6 B;  4M0W A;  2G9H D;  3ZYY X;  5EE9 A;  2W3S A;  4J3O D;  2QMT A;  2G1E A;  1KRH A;  1D6E C;  3GP7 A;  2DYO A;  2LEK A;  1FMA D;  4RCO A;  5BYR A;  1C4A A;  3BYT B;  3IT6 B;  3W5U B;  3MP9 A;  2RDH A;  2TSS A;  1V97 A;  1NEK B;  2LGI A;  4TQ0 A;  3OWE B;  1TS3 A;  1XEE A;  1L0Y B;  2IGH A;  3AEB B;  2BS3 B;  3EGR A;  4YT0 B;  1AWD A;  2CJO A;  4A55 A;  3L4P A;  2GI9 A;  1GPX A;  1XLQ A;  3BYY B;  2NTS A;  1VDV A;  4YTN B;  1TY0 A;  4YSZ B;  1ROE A;  1OQQ A;  1NVI D;  1V8C A;  3BVG A;  4IKG A;  2H88 B;  1TZO A;  3T3N A;  3TEY A;  3FIL B;  2BB5 A;  3IXS A;  4HRS A;  1I4P A;  1YJJ A;  3AMZ A;  3C8Y A;  3NZ3 A;  3NVY A;  3RFZ B;  4NZL B;  2ON8 A;  1C4P A;  2WXO A;  1CK1 A;  3Q8C A;  4HEA 1;  3V05 A;  3MJ5 A;  4OW0 A;  1TJE A;  3SFD B;  2BB6 A;  1HXY D;  1N61 A;  4XWT A;  2JWU A;  2PLP A;  1T6B X;  4JPS A;  2BBC A;  2AX5 A;  1DOX A;  1WSP A;  2IDY A;  1EWC A;  1K53 A;  4IOI E;  1TS2 A;  4KX6 B;  1ENF A;  4RH6 A;  2V0G A;  3NS1 A;  4C80 A;  1ZXH A;  1SJE D;  2WXQ A;  1FRR A;  2MJD A;  1IUE A;  5AUK A;  4YWG G;  3P4P B;  1Y56 A;  1JWS D;  3VQI A;  1HQR D;  1IBX B;  1JWU D;  1TS4 A;  2X38 A;  4A9A A;  3Q8B A;  1R7S A;  3EA6 A;  1CJE A;  2B76 B;  1Q10 A;  1L5P A;  4A6Q A;  2WDQ B;  4JWU C;  3ABV B;  2K0P A;  1XO3 A;  4YSX B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...