3W5UB

Cross-linked complex between ferredoxin and ferredoxin-nadp+ reductase
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
92
structure length
92
Chain Sequence
ATYNVKLITPEGEVELQVPDDVYILDQAEEDGIDLPYSCRAGSCSSCAGKVVSGSVDQCDQSYLDDGQIADGWVLTCHAYPTSDVVIETHKE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ferredoxin
publication title Concentration-dependent oligomerization of cross-linked complexes between ferredoxin and ferredoxin-NADP(+) reductase
pubmed doi rcsb
source organism Zea mays
molecule tags Electron transport
total genus 20
structure length 92
sequence length 92
chains with identical sequence D, F, H
ec nomenclature
pdb deposition date 2013-02-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00111 Fer2 2Fe-2S iron-sulfur cluster binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 3w5uB00
4C7YA 2WLBA 4YTPB 1EWYC 1N61A 3AEGB 4JX1C 3B9JA 5H92C 1E9MA 3P4PB 2E3TA 3W5VB 2WDVB 3NRZA 3FAHA 4YTNB 2L83A 2QIEB 2WP9B 1PUTA 3NVWA 5EE9A 1JWAD 4US9A 1YQ4B 1GAQB 1AYFA 2KAJA 3CIRB 3NVVA 1QT9A 1KFYB 2H89B 3AN1A 1V8CA 2WS3B 2WQYB 2CU3A 2PVGC 3AE2B 3P4SB 2B76B 1E6EB 2LEKA 3HVZA 1RYJA 3AE9B 1KF6B 1VJKA 3AE3B 1SF0A 1N60A 1ZOYB 3AV8A 3VRAB 1E7PB 1ZP0B 2M19A 1QOGA 4YSYB 5EE3A 5AUKA 1E0ZA 3FC4A 4P6VF 1CZPA 1PFDA 1JQ4A 2ACZB 1QOBA 2L52A 1XLNA 1ROEA 3ABVB 2M56B 3AH7A 5EE0A 3B2GA 3ZYYX 4A9AA 2W54A 3VR8B 1GPXA 2N0SB 1TYGB 1FM0D 2W3SA 2W3RA 4FXCA 3HRDD 4N58A 4ZHOA 1N5XA 2PIAA 1WRIA 5EE1A 4US8A 4LTUA 1N62A 1TKEA 2H88B 1J7CA 2DWQA 1JRPA 1FMAD 1ZXIA 3WCQA 3VR9B 1TKGA 2JQRB 3AEAB 2PVOD 3AE8B 3AE1B 2QJLA 1L5PA 3AEFB 1DOYA 3AM9A 1CJEA 1I7HA 3ETRA 1WYGA 3L4PA 1FO4A 1FFVA 1NI3A 2FBWB 1UWMA 2Q5WD 5H8YE 1DOXA 3AB5A 5GXGB 1QF6A 3CWIA 1A70A 3LXFA 2BS3B 4USAA 2DBYA 2WDRB 3AE5B 4HRSA 4N59A 4YXDB 5C3JB 2AX5A 4C7ZA 4YTMB 2WU5B 2JX5A 4N6EB 1FXIA 1YJJA 1FRRA 3KWLA 3AMZA 1XLOA 1WGKA 4YT0B 1T3QA 1NVID 1VDVA 2WDQB 1JW9D 4ITKA 1NENB 1SB3C 1OFFA 2MJDA 1N5WA 2BT6A 4HROA 2WU2B 3AE7B 4ZHPA 5G5HA 3P1MA 4WWMA 1N63A 1R7SA 1RFKA 2PKOA 1PDXA 3NVYA 1ZUD2 1XLQA 2MJEA 3AEBB 1QOFA 1RWSA 4IDIA 2K9XA 2EKIA 4ZOHC 2CJNA 5G5GA 4WQMA 3VRBB 1L0VB 2W55A 3SFDB 2KMMA 3NVZA 4YSXB 2BS4B 2MJ3A 1SIJA 3AEEB 1E10A 1FFUA 3LB8C 3SR6A 1F0ZA 1VLBA 1KRHA 3NS1A 3AE4B 1WXQA 1XLPA 1B9RA 1NYQA 1DGJA 4JWSC 1FIQA 2MH7A 5MPOA 1J7AA 3P4RB 5C2TB 3P63A 1RM6C 4YSZB 1QLBB 2G1EA 4KX6B 4JWUC 1YQ3B 1YJIA 3EUB2 1JROA 3W9CB 1L6UA 1J7BA 5AUIA 1JWBD 1FXAA 2OHFA 3BIID 3DWMA 1JALA 1OQQA 3RPFC 3W5UB 2HTME 1L6VA 3AEDB 1TJEA 1TKYA 1V97A 2K5PA 1NEKB 1OQRA 2K22A 3AE6B 1NYRA 1IUEA 3P4QB 1FRDA 3HUIA 3SFEB 3PO0A 3DWGC 2CJOA 3AECB 1XO3A 2Y5CA 4C80A 2BS2B 1DOIA 1WWTA 1AWDA 1QOAA 3B2FA
chains in the Genus database with same CATH superfamily
3PRPB 3W5VB 2MCNB 4YTNB 2RPVA 1YQ4B 5JZEB 4NNJB 4M01A 3ZVVA 3HHMA 1KFYB 4B6WA 1GG3A 3TEYA 2N1WA 1Q0WB 1RYJA 2JRIB 4KKIA 5BO4B 4TMAB 1JQ4A 2BQQA 3DOWA 3U30A 3PLUA 4NQKE 3UI3A 3Q8EA 2W3RA 3HRDD 2KWDA 3NOBA 4C00A 2V4LA 3JYUA 1YD8U 4EZLA 1Q1OA 1SEBD 1DOYA 5E6JA 1I7HA 3M63B 4I6NB 4HPLB 1AARA 4FLHA 2DX5B 4GLSC 5C3JB 2IGGA 1HZ5A 3APDA 3RULA 3DPDA 3PVLA 1WXAA 4DXAB 2I1JA 3CSTA 2KX3A 1JW9D 4ITKA 2CKHB 3TIXA 5E6OA 1N63A 1RFKA 2OJWA 2TSSA 2NPTA 4XDCA 5EDSA 4F7ZA 4A20A 3L10B 4RFBA 1L0YB 1S1QB 1I4GA 2GBJA 3M95A 2RPQA 1XT9B 3DBLB 4BOSC 2WXJA 5D7GA 5TSSA 1QLBB 4ZDVA 1UELA 1WY8A 4DXFA 2G4DB 3DWMA 3WIMA 2GOWA 3RPFC 1L6VA 3UIPB 2EELA 2R61A 1EWYC 2KDMA 2NPTB 1NDDA 2ZEQA 3VHTC 1UF0A 1P3QU 2J53A 1KTKA 1ZW7A 2PW9A 5AEKB 1T0YA 2WX1A 3M3JA 1VJKA 4IG7B 1HE8A 2AYOB 3DBLI 4LLGM 3NUHB 3RNAC 3AH7A 4BVUC 3SDLC 2VZKB 4WJOA 2PJHA 2N9XA 3DDCB 4GU2A 4ZHOA 1WRIA 3ML8A 4A8XC 4W9EA 3RNFC 1WSPA 2DWQA 4PT5A 2MBBB 2IY0B 3VVWB 2HJ8A 3A9KA 4ANWA 2NBUA 1WE7A 4MEMA 3TCAA 1A5RA 3MC0B 3CWIA 5BMIA 1TTNA 1EF1A 4C7ZA 3ENEA 4HJGE 4N6EB 4MH0E 1FRRA 1SE4A 2ZZPB 1FNUA 5FR3A 3OLMD 4XGAB 3AE7B 3N1XC 1ACCA 2NS5A 4ZRIA 4A6QA 3NHEB 1R7SA 2QMTA 2IO3B 1E8XA 4ZYSA 1MG4A 1Z5SB 1I4XA 2KXJA 3A9KB 1ISNA 2KFKA 1E10A 4AJWA 1TBEA 2X38A 3UIOB 1I4RA 3K9OB 3Q8FA 2BWFA 2G1EA 4KZ0A 3RI7C 2JZPA 1XCQL 3NJTA 3TEXA 3MC8A 1BUIC 3T3OA 3RD2A 1C77A 1TJEA 4O1NA 4OZBA 2KN4A 4TUUA 2VRRB 3HUIA 2KT7A 3ZXVA 2ZPYA 3QIJA 2MEKA 2D5GA 3CSFA 4YTPB 2HJ1A 2L1AA 1KLUD 2DAJA 2FUHB 1TIFA 1LXDA 5C23A 1WE6A 2L83A 3WALA 4IKGA 3ZDTA 4FJZA 1IPGA 2CS4A 4BKGA 3ONSA 1P0RA 3QHTA 4AUQC 4HEA1 3AE2B 2ICIA 2LEKA 1GB4A 2N7DA 2O6VB 1L0XB 4K7WA 5DPTA 1ZP0B 1XXGA 5D94A 3QAQA 4OHJA 2AEHA 3VAWA 2W3SA 2D10A 2D07B 2ASQA 2ZVOA 4LTUA 1C4CA 2W82A 1E8ZA 1ZXIA 2I38A 2L0FA 4I6LB 3VR9B 3BYYB 1TKGA 3AE8B 3RCZA 4HPPA 1E5WA 5LLIA 3AU5A 5IAAC 2ON8A 1WYGA 5IKCM 1RRBA 4KKJA 2OJRA 3QWZB 4G0NB 4K3CA 2YEPB 2RSUA 4YTMB 1NI2A 1EO6A 3V6EB 2V3SA 2KACA 1C78A 2MSED 1YJJA 2L32A 1WJ4A 4HK2A 1Y8RC 5KHQA 1SB3C 4RM8A 4NY0A 2J0MA 1XLQA 2K8BA 2EKIA 2Y3AA 5FK9C 1L0VB 2LXCA 3V6CB 1XLPA 2UU7A 3PTFC 1ENFA 1WR6E 4DQOC 1YJ1A 3URYA 2JXXA 2N9LA 1K51A 1I42A 1UBIA 2V4IB 4ARIA 2SAKA 1OQQA 3BVMA 4C4VB 4ZRPA 2MBHA 4WH4A 5HG2A 1MFWA 2K8HA 2IGHA 1WFYA 2K1FA 3UINB 2AQ1B 3KYDD 5E6NA 2WLBA 3BY4B 4PYUA 2KDEB 1V1PB 2I1KA 2WXMA 2LGXA 2ZW1A 4HCNB 4OZAA 2NCNA 2GBRA 4K1RB 2KQ4X 2QILA 1E90A 5D3DA 4ACFA 3S2AA 4B9KA 1QOBA 2XK5A 4KGRA 2DHZA 1TS5A 1PGAA 3JVZX 2N9KA 1KOTA 2KQ7A 1I35A 4WIPA 4MGYE 1F2RI 1RAXA 4YWGG 3DHGC 1ZKHA 2L76A 3AEAB 3MHZA 2NBVB 4F8CB 2KZRA 1DYQA 3PZ8A 3SEBA 1FD6A 1FFVA 1UWMA 5DCNA 4HRSA 4FHJA 1R4MB 2XK5B 2WXRA 1T3QA 4EOYA 1NENB 1OFFA 1WXMA 2LRUA 4LJPB 3A9JA 1UZXB 4BZAA 1K52A 3O13A 1ZUD2 2PPHA 1WGRA 4ZOHC 4WURA 3L0WB 1JMLA 1CQVA 2WXLA 2ZCBA 2W55A 3SFDB 3ZNID 1MVKA 4YSXB 1KLGD 3IVFA 2V0GA 3HK0A 3DBSA 2FCQA 1J7AA 3P4RB 2SEBD 5J17A 5IO9A 4EZKA 4KGTA 4URKA 4TQ0A 2WXIA 1WXSA 4BFRA 1D3ZA 3KLSX 4ZRJA 3Q2AC 3AXCA 1JRUA 2KK8A 1AWDA 1WM3A 1R4MI 1M4VA 1E9MA 1V49A 3VUXA 3RT3B 4M8NA 2V3PA 2WP9B 1AYFA 3TMPB 3UQBA 3I5JC 4TKNA 4MGZE 1FCLA 2KTRB 2DLBA 4LDTD 2MP2A 4HKZE 3APCA 2BTEA 4M02A 2L00B 2QCZA 2M56B 4MGKE 3VUYA 3Q8BA 1ESFA 2FCMA 3TSSA 2BB6A 4AJYB 1WGDA 2ZW0A 1GNUA 3WCQA 2C7NB 5IP4D 2QJLA 4MT5A 3SD5A 1CJEA 2G45B 3IT6B 3IBEA 2MP2B 3L17A 1IP9A 2XN9C 4USAA 4P1CC 3N1YC 3RNCC 4MSMB 3ZRCA 3AU4A 3N1ZC 2LJIA 4L23A 3VDZA 1P7FA 3BWUD 2D3AA 2L3ZA 4HROA 4AQ7A 5C1ZA 4WWMA 1FPYA 2KWVB 4DHJD 4PK1A 4XC2A 1H4RA 2MBQA 3BZDB 2GLSA 3L54A 1GB1A 2NTSA 1QKZA 1IGCA 1WXQA 2G4SA 4MACA 5HKHA 1SJHD 2WXPA 1L2NA 1F52A 1TS3A 2ZNVC 3WAOA 2IGDA 2GBMA 5D2MB 1JWUD 4EUTA 1WH3A 3W5UB 4IWQA 2D11A 4N58A 1OQRA 4GB9A 2K22A 1P1AA 1K53A 1SJED 1PGBA 2J4XA 1J19A 2CJOA 2Y5CA 1TS4A 2DZIA 2LXAA 2X8XX 1LGRA 2MBOA 3R66C 3DVGY 2WS3B 4LCDE 5G55A 2FNJB 3DHHC 2JZ3B 1SF0A 2EKEC 1C4AA 3QC8B 3Q8AA 1E7PB 3RFZB 2ACZB 4XYCA 2GI9A 4FULA 2M4NA 4A9AA 3UF8A 1EWCA 5DPRA 2C60A 4YL8A 4OVUA 1BXTA 1HEZE 4WWOA 4PS7A 4JLCA 3AM9A 3NZUA 1CK1A 3Q14C 1QF6A 2LUMA 2WU5B 2KYWA 2KTFA 2MQJA 2NVUI 4KDLB 1YN3A 4ANVA 4HDOA 1JCKB 1HTQA 2WU2B 3RZFA 3VXWA 3ZKJC 1OTRB 1WGGA 1QOFA 4IDIA 4GDKA 2CJNA 4WAFA 2REXA 5D6JB 3AULA 2GBKA 4JWSC 1ZXHA 4F1SA 2KKCA 1JALA 1MJDA 3O65B 2HTME 1SXTA 2KDIA 1LFDA 1Z2MA 3R2IA 1HZ6A 2N9PC 4PYZA 3RUIB 3Q3MC 4US9A 2CU1A 3QJZA 3NZSA 1QT9A 1E7VA 4KSLC 2EMSA 4B0MA 3VFKA 2BKFA 3HVZA 3ZQ4A 3AE3B 3W2DA 1I4PA 4S17A 3RN9C 4MELA 2DENB 4AOFA 2ONQA 2WXNA 4JL9A 1Q10A 3Q3NC 3TUOA 4DHZB 2IJ0A 1FM0D 4LK0M 3ZTCA 2LGIA 1ZDVA 1OGWA 4HVBA 1WI0A 1FNVA 5G2NA 4MGIE 1JRPA 4II2B 4BAXA 1UWXA 1NI3A 1DOXA 4IWOA 4K7UA 1YIWA 2K8CA 2IO1B 3W1SC 4A3OA 2L8JA 3KYCD 2LFIA 3QK0A 3PRMB 2BGFA 1V1OA 3Q3FA 3EFCA 2M1MA 2D2QA 1YX5B 2V1YA 1E8WA 3Q6BA 2CHWA 4JPSA 4C56C 2AL3A 3MP9A 2IY1B 4NJCA 5C2TB 4KX6B 5JHAA 2JVCA 2DAFA 3QARA 2KFJA 4IW0A 1UH6A 3W9CB 1WJUA 5IA7A 4IM3A 2PE6B 4GOCA 2FUG1 3ZNZB 4P16A 5HI1A 3R7QA 1D5MC 2KN5A 4M00A 5H92C 2WDVB 3NRZA 1HXYD 1AN8A 1RLFA 2GRIA 3OG5A 5BMGA 1ET6A 1I4HA 3DQVA 3JW0X 2CU3A 3N3KB 2DYOA 2LWPA 1TZ1A 4ZRQA 2IO0B 2JWUA 4H2AA 3R3MA 1K50A 3ABVB 5EE0A 3ZUNA 3B2GA 2INPE 1JWMD 4ZRKA 3PV1A 3ZNGC 2KFKB 1N5XA 1V86A 2KMCA 1X1MA 5BYRA 4DDID 2MRPA 2KWUB 3N20C 2KJ6A 3HVDA 4XZ4A 2AL6A 2J0KA 1T0RC 3N9YC 4KZCA 2DZKA 2M17A 4D2KA 4RMAA 2UWQA 4J6IA 2JX5A 3ZXRA 4LNFA 4FADA 4UDUC 2BWES 3CF6E 1L7YA 1F77A 2J52A 4K3BA 2FE8A 3V60A 3A4SC 4DK5A 1WGHA 2KO3A 3DVNV 2J0JA 2QSDA 5L95C 3SR6A 3LB8C 3ZNHB 1KRHA 2K3UA 4A3PA 2YLMA 4CO7A 4LNIA 2G9HD 3EUB2 2W9NA 1TGZB 4MSQB 1VR9A 2BYVE 4G3XB 3AECB 1XO3A 3BK2A 4C80A 3TBLD 4OW0A 4LNOA 2ZNVB 2E3TA 1J8CA 2IZVB 2LMCA 2V9HA 1PUTA 1JWAD 4EEWA 2Z0DB 1GAQB 3H6NA 2IYDB 4TSSA 2WXQA 1WGYA 5CHWA 4EFOA 2L7RA 5BYQA 4NPNA 3B1LX 2AQ2B 1C9FA 1C79A 2B3AA 3DBHB 2BF8B 2JZZA 4RF0A 4YSYB 3N30A 3PLVA 2LASA 4WQOB 3IXSA 4NAMA 2Z59B 2KQSA 3MFGA 3Q69A 3V62A 4OVZA 2LHEA 3I63C 3EC8A 3U4EG 3AB5A 5GXGB 4RNAA 2JYTA 4N59A 4JE3B 5E6PA 3I3TB 4GMVA 1Y56A 1XLOA 3WAMA 2WDQB 3KW5B 4IM2A 4GGQA 2VH1A 1EU3A 3DBHI 5HFYA 4IUMB 2JXTA 2LUEA 1JWSD 4HWIB 4HLEA 5G5GA 4RH6A 3B08A 1GJZA 2OEDA 3K9PB 3KH0A 2KC2A 2LZ6A 4HJKA 1BT0A 4XWTA 2N7JA 4REZA 2JF5A 1L4ZB 3BVGA 2K6QA 4E3CA 3VH3B 2L0TA 3DVGX 3M62B 3OJ4B 2LGDA 1DOIA 3FC4A 3RNEC 1MHXA 5CX3A 3UGBB 2KVZA 2KAJA 3ML9A 3MJ5A 1TY2A 4TV3A 1R4NB 3C0RB 1UBQA 2XNAC 1GC7A 4P1BC 4RF1A 3C8YA 1T0SC 1HA5A 3H7SA 1TZOA 3A9JB 5EE3A 1TY0A 1CZPA 3IHPC 3ZW3A 2W54A 4RGNA 1GPXA 2CHXA 3BVZA 3PHXB 1J7CA 1ET9A 1QILA 3RYTA 3EA6A 2PVOD 2QHOA 3ZIMA 3ETRA 1OEYA 3MHSD 4DDGD 1LM8B 3LXFA 2YEPF 1V5TA 4GDLA 5AZHA 5JHBA 2AX5A 2C7MB 3A1QA 3QX1A 2KWCA 4GIVA 3KWLA 1D6EC 4R3DA 1IGDA 3ZJTA 2IBIB 5IN7A 1V80A 4K81A 2INCC 1PDXA 2WDTB 3NVYA 3X0WA 1QQRA 2MJEA 1RWSA 4IC7B 4KVGB 3P42A 4WQMA 3V05A 1J0GA 1TT5B 2JWZA 2M8SA 4GDLB 1STEA 5MPOA 1ZE3D 1WX9A 2NR2A 3GZNB 1RM6C 1UD7A 4JWUC 1C4PA 3U2SC 1HTOA 1SGHA 4KDIC 1PQSA 2WGSA 1FXAA 1FNWA 4G50A 2WXOA 1WJNA 2JPHA 2RGFA 2C7HA 1SSNA 1RFAA 2K5PA 3AE6B 2LJ5A 2QDFA 2CHZA 2IPKD 1QOAA 2FCNA 1P7EA 4C7YA 1PGXA 2BW2A 2BKRB 3ALBA 2K25A 3KQ4A 2QIEB 5L83A 3NVWA 1WXVA 4FJYA 2DZMA 3VTVA 1D5ZC 2GB1A 3QCAA 2K0PA 3H7PA 4W9CA 2MW5A 3AE9B 3QQ8B 1SE2A 3EGRA 1V6EA 1EM7A 3OJ3A 4IWPA 2INDC 1YN5A 3GZNI 1T0QC 1YOVB 4WWNA 2KNBA 3VQIA 4LJOB 5EE1A 1Q5WB 5KHOA 2JQRB 2ZVNA 2INNE 4ICUA 4I6PA 4PS8A 1EF5A 1F2RC 3L4PA 2FBWB 2Q5WD 3OWEB 2RMMA 3H7PB 4LNKA 2DNFA 2E6XA 3FILA 4QAYA 3NG0A 5FKAC 4LDTB 1NVID 2HD5B 2BT6A 4ZHPA 4KV2A 3P1MA 2PKOA 2JYEA 3RMKC 4EE2A 3AEBB 2K9XA 5T8IA 2XBBC 2KMMA 1VD2A 2BS4B 2MJ3A 5D3IB 5HHDG 5GMVA 2G3QB 4HPMB 2MHJA 3PRZA 3ZRFA 1FIQA 1N6ZA 3FILB 2J7QB 1YQ3B 1L6UA 2VZKD 3MC9A 3RZWC 3DWGC 2A5UA 2K6DB 1WWTA 3BINA 3ECIA 4W9KA 2GMIC 4JX1C 3VTUA 3MJWA 1PYWD 4WAAA 5EE9A 4FA6A 2C5LC 4DHJB 3AN1A 1V8CA 3KVFB 2WNMA 4KIKA 2PVGC 3IG3A 4MDKE 1E7UA 2B76B 4TQ1A 2N1VA 2WXGA 1B1ZA 4OZCA 4II3B 3A33B 3VTWA 1QOGA 3IT4B 1C1YB 2LVPA 4AWJA 2L52A 4X57B 2QC8A 4GDKB 1MHHE 1LQBA 2N0SB 4JIOU 2KD0A 3LYYA 1TKEA 3LDZE 2ZPNA 1FMAD 1G6JA 2D3CA 3AEFB 3PPAA 4XDDA 3VUWA 2JUOA 2BB5A 4KIKB 1A70A 5I4DA 1WM2A 3AE5B 5LXHA 1VZ8A 3WA0A 1SE3A 1ZPSA 5BMHA 1OEYJ 4MM3A 2KMAA 1D5XC 4M0WA 5DPSA 1GC6A 4W9LA 2RDHA 1VRAB 2NMQA 3V61A 1F0ZA 3DBRB 1FFUA 1M94A 2O6VD 3ZGZA 2EMTA 1NYQA 2A4ZA 2XEWA 4BKTA 1DGJA 3P63A 3FKYA 4ARCA 5LXIB 2RDGA 1T6BX 3NY5A 4IOIE 3J9CA 4A90A 4W9JA 4BKSD 1TKYA 3TEWA 4MM3B 1NYRA 2MLBA 1KLVA 1FRDA 4M0WB 1EU4A 3HIZA 4HCPB 4NQLB 2KANA 3AEGB 3L13A 3B9JA 1ZDXA 2KOXA 4B0EA 3H1UA 3C19A 2KVRA 3AI5A 3DCGA 3B0AA 4RGOS 5JXVA 3U52E 3NVVA 1WX7A 2R2OA 1KF6B 2N4FA 3TEZA 1UGMA 1VZ6A 2WXHA 3I9V1 1N60A 3DBRI 2NBWB 3AV8A 3VRAB 1WMHA 2M19A 3E9SA 3ZO5B 1E0ZA 4P6VF 1AW7A 4FHKA 4HXDA 2BPSA 3Q8CA 3ZYYX 3HM3A 2DYBA 1QZEA 1UUPA 1TYGB 4US8A 1N62A 1V2YA 1VCBA 2K39A 1E8YA 3DHIC 3KWVA 4DWFA 4RGMA 1F1HA 4PS3A 3D32A 3E56A 1WYWB 5H8YE 3Q3OC 1UGJA 1WX8A 2BYFA 3APFA 4FN2A 3R2TA 2OOBB 2PMVA 3UQAA 4EZJA 1OQYA 1FXIA 3ZLZA 2Z0EB 1YNTE 1WMHB 3GS2A 1WGKA 4YT0B 1VDVA 1H8CA 1FCCC 2O6VA 1SBBB 2JU6X 1N5WA 4KGSA 2LGSA 3IAS1 4LNNA 4GSWA 2JSVX 2PEAA 5TR5A 3N32A 1P98A 2LI5A 3NS8A 1GOZA 2FIDA 1V81A 4FJVB 2LVOA 4BKSA 5AZGA 3EHVA 2WX0A 3OAWA 2HDEA 2BYEA 3LJ3A 2MBEA 3KUZA 3KUDB 5J18A 2WYQA 1K8RB 2Z8LA 3PREA 5IOIA 1JWBD 3BIID 2OHFA 2I2YA 1NEKB 2KC1A 3GP7A 2LHDA 3SFEB 4WJQA 1WJ6A 2V3NA 1T5XD 2BS2B 4JQWC 4NAWA 4K7SA 2LRWA 3PSEB 1EUVB 2JY6A 1WIAA 1SIFA 1NBFC 2FIFA 2YVCA 1E6EB 2ZCCA 5AZFA 5CHFA 3T8MA 3GE3C 5DPWA 1C3TA 3Q3JA 1V9JA 2RR9A 1XLNA 4XWWA 2NTTA 1F9JA 1D4BA 2LD9A 3VR8B 1LO5D 2PIAA 4C4VA 1MPEA 4NAWB 4KSKC 4L2YA 3ZDMC 3U7ZA 4E74A 4GXBA 4B95A 3SHQA 1FO4A 4HDQA 3IAM1 4ASWC 1V1PA 2DBYA 2WDRB 4ANUA 4YXDB 2L05A 3I57A 2KLCA 1FEHA 2D3BA 3AMZA 1WRDB 2MJDA 1IYFA 2WHIA 1GUAB 3TJPA 3V3XA 3ZTDA 2LGYA 4BBNF 2RDBC 2PLPA 1SIJA 2MA9B 1VLBA 2KX0A 3AE4B 1B9RA 3TL5A 3WAPA 2FAZA 3IFWB 1XQQA 4XX5A 2IO2B 4YSZB 5J2RA 4L1BA 5AUIA 2MX2A 2DYMA 3PT2B 2KJRA 3AEDB 3P2BA 1IUEA 1WR1A 3PZ7A 2AQ3B 3PS6A 3JSVA 3PHWB 3RNGC 2GBNA 2HE7A 2KHWB 4N9F4 3FAHA 2KDBA 4NZLB 3CIRB 2H89B 3H9DA 1HQRD 2WQYB 2AWTA 3EECA 3P4SB 4MJSA 4DHZE 1FXTB 2BBCA 2VH2A 1ZOYB 1XD3B 1WZ3A 5AUKA 3X23A 3WANA 4DBGA 4BBNC 4J3OD 1WZ0A 3JSVB 2QEJC 1KH0A 1VZ7A 3T3NA 2IDYA 1S3SG 1MG8A 4NJ6A 3ZJUA 1YQBA 1UNSA 2LVQA 3PZDA 2PE9A 4MH8A 4RCOA 4MJSB 2WWZA 2BS3B 3ZJVA 2JT4B 2WXFA 1YX6B 4W9FA 5BYSA 3SU8X 4W9IA 2KTRA 4P7IA 2D3GA 3W1SA 2JRHA 1XEEA 1BMLC 3GOEA 2DZJA 4ANXA 1C76A 1KM7A 2UYZB 4Q2JA 5JH5C 2KDFB 3NS1A 1XCTL 1SE9A 1WF9A 2MH7A 4AP4C 1MI0A 3CMMB 1R4NI 3T9LA 2N7EA 1YJIA 5FR6A 1J7BA 4S0RA 2M0XA 2HTHA 4CQNA 3HM6X 3KUCB 3GB1A 4RGTA 3R8BA 3P4QB 4XE0A 3PO0A 4W9GA 5LNK1 3B2FA 1N61A 4CYEA 3P4PB 5CHVC 2KLGA 2PTLA 3A1QB 1P9DU 4JGHB 2RD0A 4IM0A 4W9DA 1IBXA 2BVCA 2Y5BB 2Y5PA 4WJNA 4HKQA 3U7DA 1PFDA 4G11A 4BOZB 1ROEA 4M8MA 4ICVA 4FXCA 3NZ3A 4RM9A 2BYTA 3U8ZA 3BYTB 2H88B 3DVNU 4NJ7A 4FBJB 2ZJDA 3AE1B 1L5PA 2KJHB 1YMHE 4EKUA 3MTNB 4OVVA 4DXGA 4CHKA 2MWSB 1IBXB 2O2VA 2CR5A 4A55A 3PGEA 1KJTA 2WXKA 1ZGUB 1V5OA 3L08A 2C9WB 2N9EB 3W1YA 5G5HA 3EFUA 4ZYNA 3RNBC 1U4AA 4W9HA 3BK1A 3VRBB 3QA8A 2FCSA 3NVZA 3AEEB 1XF5L 4AS1A 2J42A 4WJPA 4WWPA 3A4RA 2O2VB 5CTRC 1L4DB 3L16A 1JROA 3VH4B 3H8HA 2R2QA 1YN4A 4E71A 1V97A 3GE8C 1TS2A 4GN1A 2M0AA 3R7RA 1I4QA 1CMXB
chains in the Genus database with same CATH topology
4OW0A 3AEGB 3B9JA 1M4VA 1E9MA 1ZDXA 2E3TA 3W5VB 2LMCA 4B0EA 4YTNB 2V3PA 2WP9B 1PUTA 2RPVA 4RGOS 1JWAD 5JXVA 1YQ4B 1GAQB 1AYFA 3U52E 3NVVA 4TSSA 1KFYB 2WXQA 5BYQA 3TEYA 1FCLA 2DLBA 2AQ2B 1C9FA 4HKZE 1C79A 1RYJA 1KF6B 3TEZA 2WXHA 1VZ6A 3I9V1 4KKIA 2BTEA 1N60A 4RF0A 4TMAB 3AV8A 3VRAB 4YSYB 2M19A 3E9SA 1E0ZA 4P6VF 1AW7A 1JQ4A 3Q8CA 3ZYYX 2M56B 3Q8BA 1UUPA 1ESFA 1TYGB 3Q8EA 2W3RA 3UI3A 3HRDD 2KWDA 3TSSA 2BB6A 3IXSA 4US8A 1N62A 4NAMA 2ZW0A 3KWVA 3MFGA 3WCQA 3Q69A 4OVZA 4RGMA 2LHEA 2QJLA 1SEBD 1DOYA 4MT5A 1CJEA 5E6JA 1I7HA 3E56A 3IT6B 3U4EG 5H8YE 3AB5A 5GXGB 4RNAA 1UGJA 2JYTA 2XN9C 4GLSC 4N59A 4USAA 3R2TA 2PMVA 5C3JB 4JE3B 2IGGA 1HZ5A 1FXIA 1YNTE 1Y56A 3GS2A 2LJIA 1XLOA 1WGKA 4YT0B 4L23A 1VDVA 2WDQB 1P7FA 1FCCC 1JW9D 1SBBB 3BWUD 4ITKA 2JU6X 1N5WA 4HROA 1EU3A 4KGSA 4AQ7A 3IAS1 4WWMA 1N63A 1RFKA 5HFYA 2JSVX 2TSSA 2JXTA 1JWSD 4XDCA 5G5GA 1GOZA 4RH6A 3BZDB 4RFBA 2OEDA 1GB1A 2NTSA 1L0YB 1QKZA 1IGCA 1I4GA 1WXQA 4MACA 2HDEA 1SJHD 2WXPA 4XWTA 1TS3A 2N7JA 2WXJA 4REZA 5D7GA 1L4ZB 5TSSA 1QLBB 2IGDA 2Z8LA 3BVGA 1JWUD 4DXFA 1JWBD 3BIID 2OHFA 3DWMA 3W5UB 3RPFC 1L6VA 2I2YA 4N58A 1NEKB 1OQRA 2EELA 2K22A 3GP7A 2LHDA 1K53A 1SJED 3SFEB 1PGBA 2V3NA 1T5XD 2J4XA 2CJOA 2R61A 2Y5CA 2BS2B 1DOIA 3FC4A 1TS4A 1EWYC 2KDMA 1MHXA 2KAJA 2J53A 1KTKA 3MJ5A 1TY2A 2PW9A 2WS3B 2XNAC 1E6EB 4RF1A 3C8YA 1VJKA 1SF0A 1HA5A 1C4AA 1TZOA 3Q8AA 1E7PB 5EE3A 1TY0A 1CZPA 3RFZB 2ACZB 4LLGM 3NUHB 2GI9A 1XLNA 4XWWA 2NTTA 3AH7A 4A9AA 1D4BA 2W54A 4RGNA 1EWCA 3VR8B 1GPXA 1LO5D 2VZKB 4ZHOA 2PIAA 1WRIA 1MPEA 4NAWB 4A8XC 1BXTA 1WSPA 4L2YA 1HEZE 3BVZA 1J7CA 2DWQA 4PT5A 1ET9A 1QILA 3U7ZA 3EA6A 2PVOD 3AM9A 3ETRA 1FO4A 3MC0B 1CK1A 3IAM1 3CWIA 3LXFA 1V1PA 2YEPF 5BMIA 1QF6A 2LUMA 2DBYA 2WDRB 4YXDB 3I57A 2AX5A 4C7ZA 2WU5B 4HJGE 4N6EB 1FEHA 3KWLA 1FRRA 1SE4A 1YN3A 3AMZA 1D6EC 1FNUA 4R3DA 5FR3A 1IGDA 3ZJTA 1JCKB 2MJDA 2WU2B 3AE7B 1ACCA 4A6QA 1R7SA 2QMTA 1PDXA 3NVYA 3V3XA 1QQRA 4ZYSA 2MJEA 1QOFA 1RWSA 4IDIA 1I4XA 2CJNA 3P42A 4WQMA 3V05A 2PLPA 4WAFA 1E10A 1SIJA 1VLBA 3AE4B 1B9RA 2X38A 1I4RA 4GDLB 4JWSC 3Q8FA 1STEA 5MPOA 1ZE3D 1RM6C 4YSZB 2G1EA 1ZXHA 4JWUC 1C4PA 3U2SC 2JZPA 1XCQL 3TEXA 4L1BA 5AUIA 1BUIC 2DYMA 1FXAA 1FNWA 3T3OA 2WXOA 1JALA 1C77A 2HTME 3AEDB 1SXTA 1TJEA 4O1NA 1SSNA 3AE6B 2K5PA 4OZBA 2KN4A 1IUEA 3HUIA 3PZ7A 2AQ3B 3R2IA 1HZ6A 2IPKD 2MEKA 1QOAA 2D5GA 1P7EA 4C7YA 4YTPB 1PGXA 2BW2A 2L1AA 1KLUD 3KQ4A 3FAHA 2L83A 2QIEB 4NZLB 3NVWA 4IKGA 4US9A 3CIRB 1D5ZC 1QT9A 2H89B 2GB1A 1HQRD 2WQYB 4HEA1 2K0PA 4B0MA 3AE2B 3P4SB 2ICIA 2LEKA 1GB4A 3HVZA 3AE9B 3ZQ4A 3AE3B 1L0XB 1SE2A 2BBCA 3EGRA 3W2DA 1I4PA 1ZOYB 1ZP0B 5AUKA 1EM7A 1XXGA 2ONQA 2WXNA 1Q10A 4J3OD 1YN5A 4OHJA 3TUOA 2IJ0A 1FM0D 2W3SA 3VQIA 4LK0M 2QEJC 5EE1A 2LGIA 1ZDVA 1KH0A 4LTUA 1C4CA 1VZ7A 1FNVA 3T3NA 2IDYA 1JRPA 1ZXIA 2W82A 2I38A 3VR9B 3BYYB 1TKGA 2JQRB 3ZJUA 2INNE 3AE8B 1UNSA 1UWXA 1F2RC 1WYGA 2ON8A 3L4PA 1NI3A 1DOXA 2FBWB 2Q5WD 4MH8A 4RCOA 3OWEB 2RMMA 4KKJA 2BS3B 3ZJVA 2YEPB 4YTMB 2WXFA 5BYSA 2E6XA 3FILA 2LFIA 2KACA 1C78A 5FKAC 1YJJA 2L32A 1NVID 1SB3C 1V1OA 2BT6A 4ZHPA 3W1SA 3P1MA 2PKOA 2JYEA 4EE2A 1XEEA 1XLQA 3AEBB 1BMLC 2K9XA 2EKIA 5T8IA 2Y3AA 5FK9C 1L0VB 2KMMA 1C76A 2BS4B 2MJ3A 5D3IB 5HHDG 4Q2JA 4JPSA 3NS1A 1XLPA 4C56C 1XCTL 1ENFA 1FIQA 2MH7A 3MP9A 1MI0A 4DQOC 4NJCA 5C2TB 3URYA 2N9LA 3FILB 4KX6B 1K51A 1YQ3B 1YJIA 1L6UA 1J7BA 2V4IB 2VZKD 4ARIA 2SAKA 1OQQA 3BVMA 4CQNA 4ZRPA 4WH4A 5HG2A 3W9CB 3GB1A 4RGTA 3R8BA 3P4QB 4XE0A 2IGHA 2FUG1 3PO0A 3DWGC 2AQ1B 5LNK1 1WWTA 4P16A 3B2FA 2WLBA 5HI1A 1N61A 4JX1C 1D5MC 5H92C 3P4PB 2WDVB 3NRZA 1PYWD 1V1PB 1HXYD 1AN8A 2PTLA 2GRIA 2WXMA 5EE9A 5BMGA 1ET6A 1I4HA 2ZW1A 3AN1A 1V8CA 4OZAA 2WNMA 2CU3A 2PVGC 2KQ4X 2QILA 2B76B 4TQ1A 5D3DA 2WXGA 2DYOA 1B1ZA 1IBXA 4OZCA 1QOGA 2Y5PA 4ZRQA 3IT4B 4HKQA 1PFDA 2JWUA 4H2AA 1QOBA 2L52A 1K50A 3ABVB 1ROEA 4KGRA 5EE0A 3B2GA 4GDKB 1MHHE 2INPE 1TS5A 2N0SB 1JWMD 4FXCA 3NZ3A 1PGAA 2BYTA 2N9KA 1N5XA 4WIPA 3LYYA 1TKEA 3BYTB 2H88B 1F2RI 4YWGG 5BYRA 1FMAD 3AEAB 3MHZA 3AE1B 1L5PA 3AEFB 3HVDA 1DYQA 3PZ8A 1YMHE 4XDDA 3SEBA 1FD6A 1FFVA 2BB5A 1UWMA 4DXGA 1A70A 3N9YC 5I4DA 3AE5B 4HRSA 4D2KA 1VZ8A 1IBXB 2JX5A 4A55A 1SE3A 1ZPSA 5BMHA 4UDUC 2WXKA 2WXRA 1T3QA 1NENB 1OFFA 1D5XC 4M0WA 1F77A 2J52A 5G5HA 1K52A 3O13A 1ZUD2 2FE8A 2RDHA 3BK1A 4ZOHC 4WURA 3VRBB 1VRAB 1JMLA 2NMQA 1CQVA 2WXLA 2W55A 3SFDB 3NVZA 1MVKA 2QSDA 4YSXB 1F0ZA 3AEEB 1KLGD 1FFUA 3LB8C 3SR6A 1XF5L 2V0GA 1KRHA 2K3UA 3ZGZA 4AS1A 1NYQA 2J42A 1DGJA 1J7AA 3P4RB 2SEBD 3P63A 4ARCA 1L4DB 2G9HD 3EUB2 1JROA 2RDGA 1T6BX 1VR9A 4IOIE 3J9CA 3H8HA 4KGTA 4A90A 4TQ0A 1YN4A 2WXIA 1TKYA 1V97A 3TEWA 1TS2A 4MM3B 1NYRA 1FRDA 1EU4A 2M0AA 3KLSX 3AECB 1XO3A 3BK2A 4C80A 1I4QA 1AWDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4C7Y A;  2WLB A;  4YTP B;  1EWY C;  1N61 A;  3AEG B;  4JX1 C;  3B9J A;  5H92 C;  1E9M A;  3P4P B;  2E3T A;  3W5V B;  2WDV B;  3NRZ A;  3FAH A;  4YTN B;  2L83 A;  2QIE B;  2WP9 B;  1PUT A;  3NVW A;  5EE9 A;  1JWA D;  4US9 A;  1YQ4 B;  1GAQ B;  1AYF A;  2KAJ A;  3CIR B;  3NVV A;  1QT9 A;  1KFY B;  2H89 B;  3AN1 A;  1V8C A;  2WS3 B;  2WQY B;  2CU3 A;  2PVG C;  3AE2 B;  3P4S B;  2B76 B;  1E6E B;  2LEK A;  3HVZ A;  1RYJ A;  3AE9 B;  1KF6 B;  1VJK A;  3AE3 B;  1SF0 A;  1N60 A;  1ZOY B;  3AV8 A;  3VRA B;  1E7P B;  1ZP0 B;  2M19 A;  1QOG A;  4YSY B;  5EE3 A;  5AUK A;  1E0Z A;  3FC4 A;  4P6V F;  1CZP A;  1PFD A;  1JQ4 A;  2ACZ B;  1QOB A;  2L52 A;  1XLN A;  1ROE A;  3ABV B;  2M56 B;  3AH7 A;  5EE0 A;  3B2G A;  3ZYY X;  4A9A A;  2W54 A;  3VR8 B;  1GPX A;  2N0S B;  1TYG B;  1FM0 D;  2W3S A;  2W3R A;  4FXC A;  3HRD D;  4N58 A;  4ZHO A;  1N5X A;  2PIA A;  1WRI A;  5EE1 A;  4US8 A;  4LTU A;  1N62 A;  1TKE A;  2H88 B;  1J7C A;  2DWQ A;  1JRP A;  1FMA D;  1ZXI A;  3WCQ A;  3VR9 B;  1TKG A;  2JQR B;  3AEA B;  2PVO D;  3AE8 B;  3AE1 B;  2QJL A;  1L5P A;  3AEF B;  1DOY A;  3AM9 A;  1CJE A;  1I7H A;  3ETR A;  1WYG A;  3L4P A;  1FO4 A;  1FFV A;  1NI3 A;  2FBW B;  1UWM A;  2Q5W D;  5H8Y E;  1DOX A;  3AB5 A;  5GXG B;  1QF6 A;  3CWI A;  1A70 A;  3LXF A;  2BS3 B;  4USA A;  2DBY A;  2WDR B;  3AE5 B;  4HRS A;  4N59 A;  4YXD B;  5C3J B;  2AX5 A;  4C7Z A;  4YTM B;  2WU5 B;  2JX5 A;  4N6E B;  1FXI A;  1YJJ A;  1FRR A;  3KWL A;  3AMZ A;  1XLO A;  1WGK A;  4YT0 B;  1T3Q A;  1NVI D;  1VDV A;  2WDQ B;  1JW9 D;  4ITK A;  1NEN B;  1SB3 C;  1OFF A;  2MJD A;  1N5W A;  2BT6 A;  4HRO A;  2WU2 B;  3AE7 B;  4ZHP A;  5G5H A;  3P1M A;  4WWM A;  1N63 A;  1R7S A;  1RFK A;  2PKO A;  1PDX A;  3NVY A;  1ZUD 2;  1XLQ A;  2MJE A;  3AEB B;  1QOF A;  1RWS A;  4IDI A;  2K9X A;  2EKI A;  4ZOH C;  2CJN A;  5G5G A;  4WQM A;  3VRB B;  1L0V B;  2W55 A;  3SFD B;  2KMM A;  3NVZ A;  4YSX B;  2BS4 B;  2MJ3 A;  1SIJ A;  3AEE B;  1E10 A;  1FFU A;  3LB8 C;  3SR6 A;  1F0Z A;  1VLB A;  1KRH A;  3NS1 A;  3AE4 B;  1WXQ A;  1XLP A;  1B9R A;  1NYQ A;  1DGJ A;  4JWS C;  1FIQ A;  2MH7 A;  5MPO A;  1J7A A;  3P4R B;  5C2T B;  3P63 A;  1RM6 C;  4YSZ B;  1QLB B;  2G1E A;  4KX6 B;  4JWU C;  1YQ3 B;  1YJI A;  3EUB 2;  1JRO A;  3W9C B;  1L6U A;  1J7B A;  5AUI A;  1JWB D;  1FXA A;  2OHF A;  3BII D;  3DWM A;  1JAL A;  1OQQ A;  3RPF C;  3W5U B;  2HTM E;  1L6V A;  3AED B;  1TJE A;  1TKY A;  1V97 A;  2K5P A;  1NEK B;  1OQR A;  2K22 A;  3AE6 B;  1NYR A;  1IUE A;  3P4Q B;  1FRD A;  3HUI A;  3SFE B;  3PO0 A;  3DWG C;  2CJO A;  3AEC B;  1XO3 A;  2Y5C A;  4C80 A;  2BS2 B;  1DOI A;  1WWT A;  1AWD A;  1QOA A;  3B2F A; 
#chains in the Genus database with same CATH topology
 3PRP B;  3W5V B;  2MCN B;  4YTN B;  2RPV A;  1YQ4 B;  5JZE B;  4NNJ B;  4M01 A;  3ZVV A;  3HHM A;  1KFY B;  4B6W A;  1GG3 A;  3TEY A;  2N1W A;  1Q0W B;  1RYJ A;  2JRI B;  4KKI A;  5BO4 B;  4TMA B;  1JQ4 A;  2BQQ A;  3DOW A;  3U30 A;  3PLU A;  4NQK E;  3UI3 A;  3Q8E A;  2W3R A;  3HRD D;  2KWD A;  3NOB A;  4C00 A;  2V4L A;  3JYU A;  1YD8 U;  4EZL A;  1Q1O A;  1SEB D;  1DOY A;  5E6J A;  1I7H A;  3M63 B;  4I6N B;  4HPL B;  1AAR A;  4FLH A;  2DX5 B;  4GLS C;  5C3J B;  2IGG A;  1HZ5 A;  3APD A;  3RUL A;  3DPD A;  3PVL A;  1WXA A;  4DXA B;  2I1J A;  3CST A;  2KX3 A;  1JW9 D;  4ITK A;  2CKH B;  3TIX A;  5E6O A;  1N63 A;  1RFK A;  2OJW A;  2TSS A;  2NPT A;  4XDC A;  5EDS A;  4F7Z A;  4A20 A;  3L10 B;  4RFB A;  1L0Y B;  1S1Q B;  1I4G A;  2GBJ A;  3M95 A;  2RPQ A;  1XT9 B;  3DBL B;  4BOS C;  2WXJ A;  5D7G A;  5TSS A;  1QLB B;  4ZDV A;  1UEL A;  1WY8 A;  4DXF A;  2G4D B;  3DWM A;  3WIM A;  2GOW A;  3RPF C;  1L6V A;  3UIP B;  2EEL A;  2R61 A;  1EWY C;  2KDM A;  2NPT B;  1NDD A;  2ZEQ A;  3VHT C;  1UF0 A;  1P3Q U;  2J53 A;  1KTK A;  1ZW7 A;  2PW9 A;  5AEK B;  1T0Y A;  2WX1 A;  3M3J A;  1VJK A;  4IG7 B;  1HE8 A;  2AYO B;  3DBL I;  4LLG M;  3NUH B;  3RNA C;  3AH7 A;  4BVU C;  3SDL C;  2VZK B;  4WJO A;  2PJH A;  2N9X A;  3DDC B;  4GU2 A;  4ZHO A;  1WRI A;  3ML8 A;  4A8X C;  4W9E A;  3RNF C;  1WSP A;  2DWQ A;  4PT5 A;  2MBB B;  2IY0 B;  3VVW B;  2HJ8 A;  3A9K A;  4ANW A;  2NBU A;  1WE7 A;  4MEM A;  3TCA A;  1A5R A;  3MC0 B;  3CWI A;  5BMI A;  1TTN A;  1EF1 A;  4C7Z A;  3ENE A;  4HJG E;  4N6E B;  4MH0 E;  1FRR A;  1SE4 A;  2ZZP B;  1FNU A;  5FR3 A;  3OLM D;  4XGA B;  3AE7 B;  3N1X C;  1ACC A;  2NS5 A;  4ZRI A;  4A6Q A;  3NHE B;  1R7S A;  2QMT A;  2IO3 B;  1E8X A;  4ZYS A;  1MG4 A;  1Z5S B;  1I4X A;  2KXJ A;  3A9K B;  1ISN A;  2KFK A;  1E10 A;  4AJW A;  1TBE A;  2X38 A;  3UIO B;  1I4R A;  3K9O B;  3Q8F A;  2BWF A;  2G1E A;  4KZ0 A;  3RI7 C;  2JZP A;  1XCQ L;  3NJT A;  3TEX A;  3MC8 A;  1BUI C;  3T3O A;  3RD2 A;  1C77 A;  1TJE A;  4O1N A;  4OZB A;  2KN4 A;  4TUU A;  2VRR B;  3HUI A;  2KT7 A;  3ZXV A;  2ZPY A;  3QIJ A;  2MEK A;  2D5G A;  3CSF A;  4YTP B;  2HJ1 A;  2L1A A;  1KLU D;  2DAJ A;  2FUH B;  1TIF A;  1LXD A;  5C23 A;  1WE6 A;  2L83 A;  3WAL A;  4IKG A;  3ZDT A;  4FJZ A;  1IPG A;  2CS4 A;  4BKG A;  3ONS A;  1P0R A;  3QHT A;  4AUQ C;  4HEA 1;  3AE2 B;  2ICI A;  2LEK A;  1GB4 A;  2N7D A;  2O6V B;  1L0X B;  4K7W A;  5DPT A;  1ZP0 B;  1XXG A;  5D94 A;  3QAQ A;  4OHJ A;  2AEH A;  3VAW A;  2W3S A;  2D10 A;  2D07 B;  2ASQ A;  2ZVO A;  4LTU A;  1C4C A;  2W82 A;  1E8Z A;  1ZXI A;  2I38 A;  2L0F A;  4I6L B;  3VR9 B;  3BYY B;  1TKG A;  3AE8 B;  3RCZ A;  4HPP A;  1E5W A;  5LLI A;  3AU5 A;  5IAA C;  2ON8 A;  1WYG A;  5IKC M;  1RRB A;  4KKJ A;  2OJR A;  3QWZ B;  4G0N B;  4K3C A;  2YEP B;  2RSU A;  4YTM B;  1NI2 A;  1EO6 A;  3V6E B;  2V3S A;  2KAC A;  1C78 A;  2MSE D;  1YJJ A;  2L32 A;  1WJ4 A;  4HK2 A;  1Y8R C;  5KHQ A;  1SB3 C;  4RM8 A;  4NY0 A;  2J0M A;  1XLQ A;  2K8B A;  2EKI A;  2Y3A A;  5FK9 C;  1L0V B;  2LXC A;  3V6C B;  1XLP A;  2UU7 A;  3PTF C;  1ENF A;  1WR6 E;  4DQO C;  1YJ1 A;  3URY A;  2JXX A;  2N9L A;  1K51 A;  1I42 A;  1UBI A;  2V4I B;  4ARI A;  2SAK A;  1OQQ A;  3BVM A;  4C4V B;  4ZRP A;  2MBH A;  4WH4 A;  5HG2 A;  1MFW A;  2K8H A;  2IGH A;  1WFY A;  2K1F A;  3UIN B;  2AQ1 B;  3KYD D;  5E6N A;  2WLB A;  3BY4 B;  4PYU A;  2KDE B;  1V1P B;  2I1K A;  2WXM A;  2LGX A;  2ZW1 A;  4HCN B;  4OZA A;  2NCN A;  2GBR A;  4K1R B;  2KQ4 X;  2QIL A;  1E90 A;  5D3D A;  4ACF A;  3S2A A;  4B9K A;  1QOB A;  2XK5 A;  4KGR A;  2DHZ A;  1TS5 A;  1PGA A;  3JVZ X;  2N9K A;  1KOT A;  2KQ7 A;  1I35 A;  4WIP A;  4MGY E;  1F2R I;  1RAX A;  4YWG G;  3DHG C;  1ZKH A;  2L76 A;  3AEA B;  3MHZ A;  2NBV B;  4F8C B;  2KZR A;  1DYQ A;  3PZ8 A;  3SEB A;  1FD6 A;  1FFV A;  1UWM A;  5DCN A;  4HRS A;  4FHJ A;  1R4M B;  2XK5 B;  2WXR A;  1T3Q A;  4EOY A;  1NEN B;  1OFF A;  1WXM A;  2LRU A;  4LJP B;  3A9J A;  1UZX B;  4BZA A;  1K52 A;  3O13 A;  1ZUD 2;  2PPH A;  1WGR A;  4ZOH C;  4WUR A;  3L0W B;  1JML A;  1CQV A;  2WXL A;  2ZCB A;  2W55 A;  3SFD B;  3ZNI D;  1MVK A;  4YSX B;  1KLG D;  3IVF A;  2V0G A;  3HK0 A;  3DBS A;  2FCQ A;  1J7A A;  3P4R B;  2SEB D;  5J17 A;  5IO9 A;  4EZK A;  4KGT A;  4URK A;  4TQ0 A;  2WXI A;  1WXS A;  4BFR A;  1D3Z A;  3KLS X;  4ZRJ A;  3Q2A C;  3AXC A;  1JRU A;  2KK8 A;  1AWD A;  1WM3 A;  1R4M I;  1M4V A;  1E9M A;  1V49 A;  3VUX A;  3RT3 B;  4M8N A;  2V3P A;  2WP9 B;  1AYF A;  3TMP B;  3UQB A;  3I5J C;  4TKN A;  4MGZ E;  1FCL A;  2KTR B;  2DLB A;  4LDT D;  2MP2 A;  4HKZ E;  3APC A;  2BTE A;  4M02 A;  2L00 B;  2QCZ A;  2M56 B;  4MGK E;  3VUY A;  3Q8B A;  1ESF A;  2FCM A;  3TSS A;  2BB6 A;  4AJY B;  1WGD A;  2ZW0 A;  1GNU A;  3WCQ A;  2C7N B;  5IP4 D;  2QJL A;  4MT5 A;  3SD5 A;  1CJE A;  2G45 B;  3IT6 B;  3IBE A;  2MP2 B;  3L17 A;  1IP9 A;  2XN9 C;  4USA A;  4P1C C;  3N1Y C;  3RNC C;  4MSM B;  3ZRC A;  3AU4 A;  3N1Z C;  2LJI A;  4L23 A;  3VDZ A;  1P7F A;  3BWU D;  2D3A A;  2L3Z A;  4HRO A;  4AQ7 A;  5C1Z A;  4WWM A;  1FPY A;  2KWV B;  4DHJ D;  4PK1 A;  4XC2 A;  1H4R A;  2MBQ A;  3BZD B;  2GLS A;  3L54 A;  1GB1 A;  2NTS A;  1QKZ A;  1IGC A;  1WXQ A;  2G4S A;  4MAC A;  5HKH A;  1SJH D;  2WXP A;  1L2N A;  1F52 A;  1TS3 A;  2ZNV C;  3WAO A;  2IGD A;  2GBM A;  5D2M B;  1JWU D;  4EUT A;  1WH3 A;  3W5U B;  4IWQ A;  2D11 A;  4N58 A;  1OQR A;  4GB9 A;  2K22 A;  1P1A A;  1K53 A;  1SJE D;  1PGB A;  2J4X A;  1J19 A;  2CJO A;  2Y5C A;  1TS4 A;  2DZI A;  2LXA A;  2X8X X;  1LGR A;  2MBO A;  3R66 C;  3DVG Y;  2WS3 B;  4LCD E;  5G55 A;  2FNJ B;  3DHH C;  2JZ3 B;  1SF0 A;  2EKE C;  1C4A A;  3QC8 B;  3Q8A A;  1E7P B;  3RFZ B;  2ACZ B;  4XYC A;  2GI9 A;  4FUL A;  2M4N A;  4A9A A;  3UF8 A;  1EWC A;  5DPR A;  2C60 A;  4YL8 A;  4OVU A;  1BXT A;  1HEZ E;  4WWO A;  4PS7 A;  4JLC A;  3AM9 A;  3NZU A;  1CK1 A;  3Q14 C;  1QF6 A;  2LUM A;  2WU5 B;  2KYW A;  2KTF A;  2MQJ A;  2NVU I;  4KDL B;  1YN3 A;  4ANV A;  4HDO A;  1JCK B;  1HTQ A;  2WU2 B;  3RZF A;  3VXW A;  3ZKJ C;  1OTR B;  1WGG A;  1QOF A;  4IDI A;  4GDK A;  2CJN A;  4WAF A;  2REX A;  5D6J B;  3AUL A;  2GBK A;  4JWS C;  1ZXH A;  4F1S A;  2KKC A;  1JAL A;  1MJD A;  3O65 B;  2HTM E;  1SXT A;  2KDI A;  1LFD A;  1Z2M A;  3R2I A;  1HZ6 A;  2N9P C;  4PYZ A;  3RUI B;  3Q3M C;  4US9 A;  2CU1 A;  3QJZ A;  3NZS A;  1QT9 A;  1E7V A;  4KSL C;  2EMS A;  4B0M A;  3VFK A;  2BKF A;  3HVZ A;  3ZQ4 A;  3AE3 B;  3W2D A;  1I4P A;  4S17 A;  3RN9 C;  4MEL A;  2DEN B;  4AOF A;  2ONQ A;  2WXN A;  4JL9 A;  1Q10 A;  3Q3N C;  3TUO A;  4DHZ B;  2IJ0 A;  1FM0 D;  4LK0 M;  3ZTC A;  2LGI A;  1ZDV A;  1OGW A;  4HVB A;  1WI0 A;  1FNV A;  5G2N A;  4MGI E;  1JRP A;  4II2 B;  4BAX A;  1UWX A;  1NI3 A;  1DOX A;  4IWO A;  4K7U A;  1YIW A;  2K8C A;  2IO1 B;  3W1S C;  4A3O A;  2L8J A;  3KYC D;  2LFI A;  3QK0 A;  3PRM B;  2BGF A;  1V1O A;  3Q3F A;  3EFC A;  2M1M A;  2D2Q A;  1YX5 B;  2V1Y A;  1E8W A;  3Q6B A;  2CHW A;  4JPS A;  4C56 C;  2AL3 A;  3MP9 A;  2IY1 B;  4NJC A;  5C2T B;  4KX6 B;  5JHA A;  2JVC A;  2DAF A;  3QAR A;  2KFJ A;  4IW0 A;  1UH6 A;  3W9C B;  1WJU A;  5IA7 A;  4IM3 A;  2PE6 B;  4GOC A;  2FUG 1;  3ZNZ B;  4P16 A;  5HI1 A;  3R7Q A;  1D5M C;  2KN5 A;  4M00 A;  5H92 C;  2WDV B;  3NRZ A;  1HXY D;  1AN8 A;  1RLF A;  2GRI A;  3OG5 A;  5BMG A;  1ET6 A;  1I4H A;  3DQV A;  3JW0 X;  2CU3 A;  3N3K B;  2DYO A;  2LWP A;  1TZ1 A;  4ZRQ A;  2IO0 B;  2JWU A;  4H2A A;  3R3M A;  1K50 A;  3ABV B;  5EE0 A;  3ZUN A;  3B2G A;  2INP E;  1JWM D;  4ZRK A;  3PV1 A;  3ZNG C;  2KFK B;  1N5X A;  1V86 A;  2KMC A;  1X1M A;  5BYR A;  4DDI D;  2MRP A;  2KWU B;  3N20 C;  2KJ6 A;  3HVD A;  4XZ4 A;  2AL6 A;  2J0K A;  1T0R C;  3N9Y C;  4KZC A;  2DZK A;  2M17 A;  4D2K A;  4RMA A;  2UWQ A;  4J6I A;  2JX5 A;  3ZXR A;  4LNF A;  4FAD A;  4UDU C;  2BWE S;  3CF6 E;  1L7Y A;  1F77 A;  2J52 A;  4K3B A;  2FE8 A;  3V60 A;  3A4S C;  4DK5 A;  1WGH A;  2KO3 A;  3DVN V;  2J0J A;  2QSD A;  5L95 C;  3SR6 A;  3LB8 C;  3ZNH B;  1KRH A;  2K3U A;  4A3P A;  2YLM A;  4CO7 A;  4LNI A;  2G9H D;  3EUB 2;  2W9N A;  1TGZ B;  4MSQ B;  1VR9 A;  2BYV E;  4G3X B;  3AEC B;  1XO3 A;  3BK2 A;  4C80 A;  3TBL D;  4OW0 A;  4LNO A;  2ZNV B;  2E3T A;  1J8C A;  2IZV B;  2LMC A;  2V9H A;  1PUT A;  1JWA D;  4EEW A;  2Z0D B;  1GAQ B;  3H6N A;  2IYD B;  4TSS A;  2WXQ A;  1WGY A;  5CHW A;  4EFO A;  2L7R A;  5BYQ A;  4NPN A;  3B1L X;  2AQ2 B;  1C9F A;  1C79 A;  2B3A A;  3DBH B;  2BF8 B;  2JZZ A;  4RF0 A;  4YSY B;  3N30 A;  3PLV A;  2LAS A;  4WQO B;  3IXS A;  4NAM A;  2Z59 B;  2KQS A;  3MFG A;  3Q69 A;  3V62 A;  4OVZ A;  2LHE A;  3I63 C;  3EC8 A;  3U4E G;  3AB5 A;  5GXG B;  4RNA A;  2JYT A;  4N59 A;  4JE3 B;  5E6P A;  3I3T B;  4GMV A;  1Y56 A;  1XLO A;  3WAM A;  2WDQ B;  3KW5 B;  4IM2 A;  4GGQ A;  2VH1 A;  1EU3 A;  3DBH I;  5HFY A;  4IUM B;  2JXT A;  2LUE A;  1JWS D;  4HWI B;  4HLE A;  5G5G A;  4RH6 A;  3B08 A;  1GJZ A;  2OED A;  3K9P B;  3KH0 A;  2KC2 A;  2LZ6 A;  4HJK A;  1BT0 A;  4XWT A;  2N7J A;  4REZ A;  2JF5 A;  1L4Z B;  3BVG A;  2K6Q A;  4E3C A;  3VH3 B;  2L0T A;  3DVG X;  3M62 B;  3OJ4 B;  2LGD A;  1DOI A;  3FC4 A;  3RNE C;  1MHX A;  5CX3 A;  3UGB B;  2KVZ A;  2KAJ A;  3ML9 A;  3MJ5 A;  1TY2 A;  4TV3 A;  1R4N B;  3C0R B;  1UBQ A;  2XNA C;  1GC7 A;  4P1B C;  4RF1 A;  3C8Y A;  1T0S C;  1HA5 A;  3H7S A;  1TZO A;  3A9J B;  5EE3 A;  1TY0 A;  1CZP A;  3IHP C;  3ZW3 A;  2W54 A;  4RGN A;  1GPX A;  2CHX A;  3BVZ A;  3PHX B;  1J7C A;  1ET9 A;  1QIL A;  3RYT A;  3EA6 A;  2PVO D;  2QHO A;  3ZIM A;  3ETR A;  1OEY A;  3MHS D;  4DDG D;  1LM8 B;  3LXF A;  2YEP F;  1V5T A;  4GDL A;  5AZH A;  5JHB A;  2AX5 A;  2C7M B;  3A1Q A;  3QX1 A;  2KWC A;  4GIV A;  3KWL A;  1D6E C;  4R3D A;  1IGD A;  3ZJT A;  2IBI B;  5IN7 A;  1V80 A;  4K81 A;  2INC C;  1PDX A;  2WDT B;  3NVY A;  3X0W A;  1QQR A;  2MJE A;  1RWS A;  4IC7 B;  4KVG B;  3P42 A;  4WQM A;  3V05 A;  1J0G A;  1TT5 B;  2JWZ A;  2M8S A;  4GDL B;  1STE A;  5MPO A;  1ZE3 D;  1WX9 A;  2NR2 A;  3GZN B;  1RM6 C;  1UD7 A;  4JWU C;  1C4P A;  3U2S C;  1HTO A;  1SGH A;  4KDI C;  1PQS A;  2WGS A;  1FXA A;  1FNW A;  4G50 A;  2WXO A;  1WJN A;  2JPH A;  2RGF A;  2C7H A;  1SSN A;  1RFA A;  2K5P A;  3AE6 B;  2LJ5 A;  2QDF A;  2CHZ A;  2IPK D;  1QOA A;  2FCN A;  1P7E A;  4C7Y A;  1PGX A;  2BW2 A;  2BKR B;  3ALB A;  2K25 A;  3KQ4 A;  2QIE B;  5L83 A;  3NVW A;  1WXV A;  4FJY A;  2DZM A;  3VTV A;  1D5Z C;  2GB1 A;  3QCA A;  2K0P A;  3H7P A;  4W9C A;  2MW5 A;  3AE9 B;  3QQ8 B;  1SE2 A;  3EGR A;  1V6E A;  1EM7 A;  3OJ3 A;  4IWP A;  2IND C;  1YN5 A;  3GZN I;  1T0Q C;  1YOV B;  4WWN A;  2KNB A;  3VQI A;  4LJO B;  5EE1 A;  1Q5W B;  5KHO A;  2JQR B;  2ZVN A;  2INN E;  4ICU A;  4I6P A;  4PS8 A;  1EF5 A;  1F2R C;  3L4P A;  2FBW B;  2Q5W D;  3OWE B;  2RMM A;  3H7P B;  4LNK A;  2DNF A;  2E6X A;  3FIL A;  4QAY A;  3NG0 A;  5FKA C;  4LDT B;  1NVI D;  2HD5 B;  2BT6 A;  4ZHP A;  4KV2 A;  3P1M A;  2PKO A;  2JYE A;  3RMK C;  4EE2 A;  3AEB B;  2K9X A;  5T8I A;  2XBB C;  2KMM A;  1VD2 A;  2BS4 B;  2MJ3 A;  5D3I B;  5HHD G;  5GMV A;  2G3Q B;  4HPM B;  2MHJ A;  3PRZ A;  3ZRF A;  1FIQ A;  1N6Z A;  3FIL B;  2J7Q B;  1YQ3 B;  1L6U A;  2VZK D;  3MC9 A;  3RZW C;  3DWG C;  2A5U A;  2K6D B;  1WWT A;  3BIN A;  3ECI A;  4W9K A;  2GMI C;  4JX1 C;  3VTU A;  3MJW A;  1PYW D;  4WAA A;  5EE9 A;  4FA6 A;  2C5L C;  4DHJ B;  3AN1 A;  1V8C A;  3KVF B;  2WNM A;  4KIK A;  2PVG C;  3IG3 A;  4MDK E;  1E7U A;  2B76 B;  4TQ1 A;  2N1V A;  2WXG A;  1B1Z A;  4OZC A;  4II3 B;  3A33 B;  3VTW A;  1QOG A;  3IT4 B;  1C1Y B;  2LVP A;  4AWJ A;  2L52 A;  4X57 B;  2QC8 A;  4GDK B;  1MHH E;  1LQB A;  2N0S B;  4JIO U;  2KD0 A;  3LYY A;  1TKE A;  3LDZ E;  2ZPN A;  1FMA D;  1G6J A;  2D3C A;  3AEF B;  3PPA A;  4XDD A;  3VUW A;  2JUO A;  2BB5 A;  4KIK B;  1A70 A;  5I4D A;  1WM2 A;  3AE5 B;  5LXH A;  1VZ8 A;  3WA0 A;  1SE3 A;  1ZPS A;  5BMH A;  1OEY J;  4MM3 A;  2KMA A;  1D5X C;  4M0W A;  5DPS A;  1GC6 A;  4W9L A;  2RDH A;  1VRA B;  2NMQ A;  3V61 A;  1F0Z A;  3DBR B;  1FFU A;  1M94 A;  2O6V D;  3ZGZ A;  2EMT A;  1NYQ A;  2A4Z A;  2XEW A;  4BKT A;  1DGJ A;  3P63 A;  3FKY A;  4ARC A;  5LXI B;  2RDG A;  1T6B X;  3NY5 A;  4IOI E;  3J9C A;  4A90 A;  4W9J A;  4BKS D;  1TKY A;  3TEW A;  4MM3 B;  1NYR A;  2MLB A;  1KLV A;  1FRD A;  4M0W B;  1EU4 A;  3HIZ A;  4HCP B;  4NQL B;  2KAN A;  3AEG B;  3L13 A;  3B9J A;  1ZDX A;  2KOX A;  4B0E A;  3H1U A;  3C19 A;  2KVR A;  3AI5 A;  3DCG A;  3B0A A;  4RGO S;  5JXV A;  3U52 E;  3NVV A;  1WX7 A;  2R2O A;  1KF6 B;  2N4F A;  3TEZ A;  1UGM A;  1VZ6 A;  2WXH A;  3I9V 1;  1N60 A;  3DBR I;  2NBW B;  3AV8 A;  3VRA B;  1WMH A;  2M19 A;  3E9S A;  3ZO5 B;  1E0Z A;  4P6V F;  1AW7 A;  4FHK A;  4HXD A;  2BPS A;  3Q8C A;  3ZYY X;  3HM3 A;  2DYB A;  1QZE A;  1UUP A;  1TYG B;  4US8 A;  1N62 A;  1V2Y A;  1VCB A;  2K39 A;  1E8Y A;  3DHI C;  3KWV A;  4DWF A;  4RGM A;  1F1H A;  4PS3 A;  3D32 A;  3E56 A;  1WYW B;  5H8Y E;  3Q3O C;  1UGJ A;  1WX8 A;  2BYF A;  3APF A;  4FN2 A;  3R2T A;  2OOB B;  2PMV A;  3UQA A;  4EZJ A;  1OQY A;  1FXI A;  3ZLZ A;  2Z0E B;  1YNT E;  1WMH B;  3GS2 A;  1WGK A;  4YT0 B;  1VDV A;  1H8C A;  1FCC C;  2O6V A;  1SBB B;  2JU6 X;  1N5W A;  4KGS A;  2LGS A;  3IAS 1;  4LNN A;  4GSW A;  2JSV X;  2PEA A;  5TR5 A;  3N32 A;  1P98 A;  2LI5 A;  3NS8 A;  1GOZ A;  2FID A;  1V81 A;  4FJV B;  2LVO A;  4BKS A;  5AZG A;  3EHV A;  2WX0 A;  3OAW A;  2HDE A;  2BYE A;  3LJ3 A;  2MBE A;  3KUZ A;  3KUD B;  5J18 A;  2WYQ A;  1K8R B;  2Z8L A;  3PRE A;  5IOI A;  1JWB D;  3BII D;  2OHF A;  2I2Y A;  1NEK B;  2KC1 A;  3GP7 A;  2LHD A;  3SFE B;  4WJQ A;  1WJ6 A;  2V3N A;  1T5X D;  2BS2 B;  4JQW C;  4NAW A;  4K7S A;  2LRW A;  3PSE B;  1EUV B;  2JY6 A;  1WIA A;  1SIF A;  1NBF C;  2FIF A;  2YVC A;  1E6E B;  2ZCC A;  5AZF A;  5CHF A;  3T8M A;  3GE3 C;  5DPW A;  1C3T A;  3Q3J A;  1V9J A;  2RR9 A;  1XLN A;  4XWW A;  2NTT A;  1F9J A;  1D4B A;  2LD9 A;  3VR8 B;  1LO5 D;  2PIA A;  4C4V A;  1MPE A;  4NAW B;  4KSK C;  4L2Y A;  3ZDM C;  3U7Z A;  4E74 A;  4GXB A;  4B95 A;  3SHQ A;  1FO4 A;  4HDQ A;  3IAM 1;  4ASW C;  1V1P A;  2DBY A;  2WDR B;  4ANU A;  4YXD B;  2L05 A;  3I57 A;  2KLC A;  1FEH A;  2D3B A;  3AMZ A;  1WRD B;  2MJD A;  1IYF A;  2WHI A;  1GUA B;  3TJP A;  3V3X A;  3ZTD A;  2LGY A;  4BBN F;  2RDB C;  2PLP A;  1SIJ A;  2MA9 B;  1VLB A;  2KX0 A;  3AE4 B;  1B9R A;  3TL5 A;  3WAP A;  2FAZ A;  3IFW B;  1XQQ A;  4XX5 A;  2IO2 B;  4YSZ B;  5J2R A;  4L1B A;  5AUI A;  2MX2 A;  2DYM A;  3PT2 B;  2KJR A;  3AED B;  3P2B A;  1IUE A;  1WR1 A;  3PZ7 A;  2AQ3 B;  3PS6 A;  3JSV A;  3PHW B;  3RNG C;  2GBN A;  2HE7 A;  2KHW B;  4N9F 4;  3FAH A;  2KDB A;  4NZL B;  3CIR B;  2H89 B;  3H9D A;  1HQR D;  2WQY B;  2AWT A;  3EEC A;  3P4S B;  4MJS A;  4DHZ E;  1FXT B;  2BBC A;  2VH2 A;  1ZOY B;  1XD3 B;  1WZ3 A;  5AUK A;  3X23 A;  3WAN A;  4DBG A;  4BBN C;  4J3O D;  1WZ0 A;  3JSV B;  2QEJ C;  1KH0 A;  1VZ7 A;  3T3N A;  2IDY A;  1S3S G;  1MG8 A;  4NJ6 A;  3ZJU A;  1YQB A;  1UNS A;  2LVQ A;  3PZD A;  2PE9 A;  4MH8 A;  4RCO A;  4MJS B;  2WWZ A;  2BS3 B;  3ZJV A;  2JT4 B;  2WXF A;  1YX6 B;  4W9F A;  5BYS A;  3SU8 X;  4W9I A;  2KTR A;  4P7I A;  2D3G A;  3W1S A;  2JRH A;  1XEE A;  1BML C;  3GOE A;  2DZJ A;  4ANX A;  1C76 A;  1KM7 A;  2UYZ B;  4Q2J A;  5JH5 C;  2KDF B;  3NS1 A;  1XCT L;  1SE9 A;  1WF9 A;  2MH7 A;  4AP4 C;  1MI0 A;  3CMM B;  1R4N I;  3T9L A;  2N7E A;  1YJI A;  5FR6 A;  1J7B A;  4S0R A;  2M0X A;  2HTH A;  4CQN A;  3HM6 X;  3KUC B;  3GB1 A;  4RGT A;  3R8B A;  3P4Q B;  4XE0 A;  3PO0 A;  4W9G A;  5LNK 1;  3B2F A;  1N61 A;  4CYE A;  3P4P B;  5CHV C;  2KLG A;  2PTL A;  3A1Q B;  1P9D U;  4JGH B;  2RD0 A;  4IM0 A;  4W9D A;  1IBX A;  2BVC A;  2Y5B B;  2Y5P A;  4WJN A;  4HKQ A;  3U7D A;  1PFD A;  4G11 A;  4BOZ B;  1ROE A;  4M8M A;  4ICV A;  4FXC A;  3NZ3 A;  4RM9 A;  2BYT A;  3U8Z A;  3BYT B;  2H88 B;  3DVN U;  4NJ7 A;  4FBJ B;  2ZJD A;  3AE1 B;  1L5P A;  2KJH B;  1YMH E;  4EKU A;  3MTN B;  4OVV A;  4DXG A;  4CHK A;  2MWS B;  1IBX B;  2O2V A;  2CR5 A;  4A55 A;  3PGE A;  1KJT A;  2WXK A;  1ZGU B;  1V5O A;  3L08 A;  2C9W B;  2N9E B;  3W1Y A;  5G5H A;  3EFU A;  4ZYN A;  3RNB C;  1U4A A;  4W9H A;  3BK1 A;  3VRB B;  3QA8 A;  2FCS A;  3NVZ A;  3AEE B;  1XF5 L;  4AS1 A;  2J42 A;  4WJP A;  4WWP A;  3A4R A;  2O2V B;  5CTR C;  1L4D B;  3L16 A;  1JRO A;  3VH4 B;  3H8H A;  2R2Q A;  1YN4 A;  4E71 A;  1V97 A;  3GE8 C;  1TS2 A;  4GN1 A;  2M0A A;  3R7R A;  1I4Q A;  1CMX B; 
#chains in the Genus database with same CATH homology
 4OW0 A;  3AEG B;  3B9J A;  1M4V A;  1E9M A;  1ZDX A;  2E3T A;  3W5V B;  2LMC A;  4B0E A;  4YTN B;  2V3P A;  2WP9 B;  1PUT A;  2RPV A;  4RGO S;  1JWA D;  5JXV A;  1YQ4 B;  1GAQ B;  1AYF A;  3U52 E;  3NVV A;  4TSS A;  1KFY B;  2WXQ A;  5BYQ A;  3TEY A;  1FCL A;  2DLB A;  2AQ2 B;  1C9F A;  4HKZ E;  1C79 A;  1RYJ A;  1KF6 B;  3TEZ A;  2WXH A;  1VZ6 A;  3I9V 1;  4KKI A;  2BTE A;  1N60 A;  4RF0 A;  4TMA B;  3AV8 A;  3VRA B;  4YSY B;  2M19 A;  3E9S A;  1E0Z A;  4P6V F;  1AW7 A;  1JQ4 A;  3Q8C A;  3ZYY X;  2M56 B;  3Q8B A;  1UUP A;  1ESF A;  1TYG B;  3Q8E A;  2W3R A;  3UI3 A;  3HRD D;  2KWD A;  3TSS A;  2BB6 A;  3IXS A;  4US8 A;  1N62 A;  4NAM A;  2ZW0 A;  3KWV A;  3MFG A;  3WCQ A;  3Q69 A;  4OVZ A;  4RGM A;  2LHE A;  2QJL A;  1SEB D;  1DOY A;  4MT5 A;  1CJE A;  5E6J A;  1I7H A;  3E56 A;  3IT6 B;  3U4E G;  5H8Y E;  3AB5 A;  5GXG B;  4RNA A;  1UGJ A;  2JYT A;  2XN9 C;  4GLS C;  4N59 A;  4USA A;  3R2T A;  2PMV A;  5C3J B;  4JE3 B;  2IGG A;  1HZ5 A;  1FXI A;  1YNT E;  1Y56 A;  3GS2 A;  2LJI A;  1XLO A;  1WGK A;  4YT0 B;  4L23 A;  1VDV A;  2WDQ B;  1P7F A;  1FCC C;  1JW9 D;  1SBB B;  3BWU D;  4ITK A;  2JU6 X;  1N5W A;  4HRO A;  1EU3 A;  4KGS A;  4AQ7 A;  3IAS 1;  4WWM A;  1N63 A;  1RFK A;  5HFY A;  2JSV X;  2TSS A;  2JXT A;  1JWS D;  4XDC A;  5G5G A;  1GOZ A;  4RH6 A;  3BZD B;  4RFB A;  2OED A;  1GB1 A;  2NTS A;  1L0Y B;  1QKZ A;  1IGC A;  1I4G A;  1WXQ A;  4MAC A;  2HDE A;  1SJH D;  2WXP A;  4XWT A;  1TS3 A;  2N7J A;  2WXJ A;  4REZ A;  5D7G A;  1L4Z B;  5TSS A;  1QLB B;  2IGD A;  2Z8L A;  3BVG A;  1JWU D;  4DXF A;  1JWB D;  3BII D;  2OHF A;  3DWM A;  3W5U B;  3RPF C;  1L6V A;  2I2Y A;  4N58 A;  1NEK B;  1OQR A;  2EEL A;  2K22 A;  3GP7 A;  2LHD A;  1K53 A;  1SJE D;  3SFE B;  1PGB A;  2V3N A;  1T5X D;  2J4X A;  2CJO A;  2R61 A;  2Y5C A;  2BS2 B;  1DOI A;  3FC4 A;  1TS4 A;  1EWY C;  2KDM A;  1MHX A;  2KAJ A;  2J53 A;  1KTK A;  3MJ5 A;  1TY2 A;  2PW9 A;  2WS3 B;  2XNA C;  1E6E B;  4RF1 A;  3C8Y A;  1VJK A;  1SF0 A;  1HA5 A;  1C4A A;  1TZO A;  3Q8A A;  1E7P B;  5EE3 A;  1TY0 A;  1CZP A;  3RFZ B;  2ACZ B;  4LLG M;  3NUH B;  2GI9 A;  1XLN A;  4XWW A;  2NTT A;  3AH7 A;  4A9A A;  1D4B A;  2W54 A;  4RGN A;  1EWC A;  3VR8 B;  1GPX A;  1LO5 D;  2VZK B;  4ZHO A;  2PIA A;  1WRI A;  1MPE A;  4NAW B;  4A8X C;  1BXT A;  1WSP A;  4L2Y A;  1HEZ E;  3BVZ A;  1J7C A;  2DWQ A;  4PT5 A;  1ET9 A;  1QIL A;  3U7Z A;  3EA6 A;  2PVO D;  3AM9 A;  3ETR A;  1FO4 A;  3MC0 B;  1CK1 A;  3IAM 1;  3CWI A;  3LXF A;  1V1P A;  2YEP F;  5BMI A;  1QF6 A;  2LUM A;  2DBY A;  2WDR B;  4YXD B;  3I57 A;  2AX5 A;  4C7Z A;  2WU5 B;  4HJG E;  4N6E B;  1FEH A;  3KWL A;  1FRR A;  1SE4 A;  1YN3 A;  3AMZ A;  1D6E C;  1FNU A;  4R3D A;  5FR3 A;  1IGD A;  3ZJT A;  1JCK B;  2MJD A;  2WU2 B;  3AE7 B;  1ACC A;  4A6Q A;  1R7S A;  2QMT A;  1PDX A;  3NVY A;  3V3X A;  1QQR A;  4ZYS A;  2MJE A;  1QOF A;  1RWS A;  4IDI A;  1I4X A;  2CJN A;  3P42 A;  4WQM A;  3V05 A;  2PLP A;  4WAF A;  1E10 A;  1SIJ A;  1VLB A;  3AE4 B;  1B9R A;  2X38 A;  1I4R A;  4GDL B;  4JWS C;  3Q8F A;  1STE A;  5MPO A;  1ZE3 D;  1RM6 C;  4YSZ B;  2G1E A;  1ZXH A;  4JWU C;  1C4P A;  3U2S C;  2JZP A;  1XCQ L;  3TEX A;  4L1B A;  5AUI A;  1BUI C;  2DYM A;  1FXA A;  1FNW A;  3T3O A;  2WXO A;  1JAL A;  1C77 A;  2HTM E;  3AED B;  1SXT A;  1TJE A;  4O1N A;  1SSN A;  3AE6 B;  2K5P A;  4OZB A;  2KN4 A;  1IUE A;  3HUI A;  3PZ7 A;  2AQ3 B;  3R2I A;  1HZ6 A;  2IPK D;  2MEK A;  1QOA A;  2D5G A;  1P7E A;  4C7Y A;  4YTP B;  1PGX A;  2BW2 A;  2L1A A;  1KLU D;  3KQ4 A;  3FAH A;  2L83 A;  2QIE B;  4NZL B;  3NVW A;  4IKG A;  4US9 A;  3CIR B;  1D5Z C;  1QT9 A;  2H89 B;  2GB1 A;  1HQR D;  2WQY B;  4HEA 1;  2K0P A;  4B0M A;  3AE2 B;  3P4S B;  2ICI A;  2LEK A;  1GB4 A;  3HVZ A;  3AE9 B;  3ZQ4 A;  3AE3 B;  1L0X B;  1SE2 A;  2BBC A;  3EGR A;  3W2D A;  1I4P A;  1ZOY B;  1ZP0 B;  5AUK A;  1EM7 A;  1XXG A;  2ONQ A;  2WXN A;  1Q10 A;  4J3O D;  1YN5 A;  4OHJ A;  3TUO A;  2IJ0 A;  1FM0 D;  2W3S A;  3VQI A;  4LK0 M;  2QEJ C;  5EE1 A;  2LGI A;  1ZDV A;  1KH0 A;  4LTU A;  1C4C A;  1VZ7 A;  1FNV A;  3T3N A;  2IDY A;  1JRP A;  1ZXI A;  2W82 A;  2I38 A;  3VR9 B;  3BYY B;  1TKG A;  2JQR B;  3ZJU A;  2INN E;  3AE8 B;  1UNS A;  1UWX A;  1F2R C;  1WYG A;  2ON8 A;  3L4P A;  1NI3 A;  1DOX A;  2FBW B;  2Q5W D;  4MH8 A;  4RCO A;  3OWE B;  2RMM A;  4KKJ A;  2BS3 B;  3ZJV A;  2YEP B;  4YTM B;  2WXF A;  5BYS A;  2E6X A;  3FIL A;  2LFI A;  2KAC A;  1C78 A;  5FKA C;  1YJJ A;  2L32 A;  1NVI D;  1SB3 C;  1V1O A;  2BT6 A;  4ZHP A;  3W1S A;  3P1M A;  2PKO A;  2JYE A;  4EE2 A;  1XEE A;  1XLQ A;  3AEB B;  1BML C;  2K9X A;  2EKI A;  5T8I A;  2Y3A A;  5FK9 C;  1L0V B;  2KMM A;  1C76 A;  2BS4 B;  2MJ3 A;  5D3I B;  5HHD G;  4Q2J A;  4JPS A;  3NS1 A;  1XLP A;  4C56 C;  1XCT L;  1ENF A;  1FIQ A;  2MH7 A;  3MP9 A;  1MI0 A;  4DQO C;  4NJC A;  5C2T B;  3URY A;  2N9L A;  3FIL B;  4KX6 B;  1K51 A;  1YQ3 B;  1YJI A;  1L6U A;  1J7B A;  2V4I B;  2VZK D;  4ARI A;  2SAK A;  1OQQ A;  3BVM A;  4CQN A;  4ZRP A;  4WH4 A;  5HG2 A;  3W9C B;  3GB1 A;  4RGT A;  3R8B A;  3P4Q B;  4XE0 A;  2IGH A;  2FUG 1;  3PO0 A;  3DWG C;  2AQ1 B;  5LNK 1;  1WWT A;  4P16 A;  3B2F A;  2WLB A;  5HI1 A;  1N61 A;  4JX1 C;  1D5M C;  5H92 C;  3P4P B;  2WDV B;  3NRZ A;  1PYW D;  1V1P B;  1HXY D;  1AN8 A;  2PTL A;  2GRI A;  2WXM A;  5EE9 A;  5BMG A;  1ET6 A;  1I4H A;  2ZW1 A;  3AN1 A;  1V8C A;  4OZA A;  2WNM A;  2CU3 A;  2PVG C;  2KQ4 X;  2QIL A;  2B76 B;  4TQ1 A;  5D3D A;  2WXG A;  2DYO A;  1B1Z A;  1IBX A;  4OZC A;  1QOG A;  2Y5P A;  4ZRQ A;  3IT4 B;  4HKQ A;  1PFD A;  2JWU A;  4H2A A;  1QOB A;  2L52 A;  1K50 A;  3ABV B;  1ROE A;  4KGR A;  5EE0 A;  3B2G A;  4GDK B;  1MHH E;  2INP E;  1TS5 A;  2N0S B;  1JWM D;  4FXC A;  3NZ3 A;  1PGA A;  2BYT A;  2N9K A;  1N5X A;  4WIP A;  3LYY A;  1TKE A;  3BYT B;  2H88 B;  1F2R I;  4YWG G;  5BYR A;  1FMA D;  3AEA B;  3MHZ A;  3AE1 B;  1L5P A;  3AEF B;  3HVD A;  1DYQ A;  3PZ8 A;  1YMH E;  4XDD A;  3SEB A;  1FD6 A;  1FFV A;  2BB5 A;  1UWM A;  4DXG A;  1A70 A;  3N9Y C;  5I4D A;  3AE5 B;  4HRS A;  4D2K A;  1VZ8 A;  1IBX B;  2JX5 A;  4A55 A;  1SE3 A;  1ZPS A;  5BMH A;  4UDU C;  2WXK A;  2WXR A;  1T3Q A;  1NEN B;  1OFF A;  1D5X C;  4M0W A;  1F77 A;  2J52 A;  5G5H A;  1K52 A;  3O13 A;  1ZUD 2;  2FE8 A;  2RDH A;  3BK1 A;  4ZOH C;  4WUR A;  3VRB B;  1VRA B;  1JML A;  2NMQ A;  1CQV A;  2WXL A;  2W55 A;  3SFD B;  3NVZ A;  1MVK A;  2QSD A;  4YSX B;  1F0Z A;  3AEE B;  1KLG D;  1FFU A;  3LB8 C;  3SR6 A;  1XF5 L;  2V0G A;  1KRH A;  2K3U A;  3ZGZ A;  4AS1 A;  1NYQ A;  2J42 A;  1DGJ A;  1J7A A;  3P4R B;  2SEB D;  3P63 A;  4ARC A;  1L4D B;  2G9H D;  3EUB 2;  1JRO A;  2RDG A;  1T6B X;  1VR9 A;  4IOI E;  3J9C A;  3H8H A;  4KGT A;  4A90 A;  4TQ0 A;  1YN4 A;  2WXI A;  1TKY A;  1V97 A;  3TEW A;  1TS2 A;  4MM3 B;  1NYR A;  1FRD A;  1EU4 A;  2M0A A;  3KLS X;  3AEC B;  1XO3 A;  3BK2 A;  4C80 A;  1I4Q A;  1AWD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...