1I4QA

Crystal structure of staphylococcal enterotoxin c2 at 100k crystallized at ph 6.0
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
239
structure length
234
Chain Sequence
b'ESQPDPTPDELHKSSEFTGTMGNMKYLYDDHYVSATKVMSVDKFLAHDLIYNISDKKLKNYDKVKTELLNEDLAKKYKDEVVDVYGSNYYVNCYFSSKDNGGKTCMYGGITKHEGNHFDNGNLQNVLIRVYENKRNTISFEVQTDKKSVTAQELDIKARNFLINKKNLYEFNSSPYETGYIKFIENNGNTFWYDMMPAPGDKFDQSKYLMMYNDNKTVDSKSVKIEVHLTTKNG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ENTEROTOXIN TYPE C-2
publication title Structure of staphylococcal enterotoxin C2 at various pH levels.
pubmed doi rcsb
molecule tags Toxin
total genus 67
structure length 234
sequence length 239
ec nomenclature
pdb deposition date 2001-02-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01123 Stap_Strp_toxin Staphylococcal/Streptococcal toxin, OB-fold domain
A PF02876 Stap_Strp_tox_C Staphylococcal/Streptococcal toxin, beta-grasp domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.110 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1i4qA01
3.10.20.120 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1i4qA02
5D3DA 1PRTF 1LT3D 4DXGA 1DYQA 5TSSA 1LTAD 4Z9CB 1LTTD 1CT1D 3O13A 1T5XD 1FNVA 1SXTA 3BYYB 1D6EC 1ET9A 1JQYD 2NTSA 1KLGD 3URYA 1EWCA 5ELBA 1LT4D 2Z8LA 4L6TB 1M4VA 4RHSA 4RHRA 1D5ZC 2QEJC 1UUPA 5D3IB 1SE2A 1GOZA 1HA5A 1HXYD 1S5FD 3SEBA 1RDPD 1SEBD 1LTBD 1S5BD 1BCPC 1LT6D 1BCPB 1XTCD 1I4RA 3R8BA 1EEID 1JWSD 1EEFD 2O2LD 1D5XC 4RFBA 1JCKB 4ZYSA 1EFID 1ET6A 1PTOD 1STEA 2QILA 3BVZA 1TS3A 1L0XB 4O1NA 1FNUA 1LTGD 1CHPD 1PRTD 1PYWD 1SBBB 1I4HA 5ELCA 1RF2D 4BWGB 1LTSD 1EU3A 1JWUD 3V05A 3DWAA 1I4QA 4TSSA 3CHBD 1PTOB 1YN5A 2XRQD 1SJED 2TSSA 1F77A 1TS2A 1LLRD 2J4XA 1PRTB 1V1PB 1I4XA 1BXTA 4K6LA 3BVMA 3W2DA 1HTLD 1BCPF 5ELEA 1RD9D 1LO5D 3EA6A 5ELDA 3KLSX 5FK9C 4L63B 4C56C 3MC0B 4RGMA 2AQ1B 1FNWA 1MD2D 1LTRD 3R2TA 1SE3A 2XN9C 2RDGA 1TS5A 1FD7D 1JR0D 1L0YB 2IJ0A 3BVGA 4RH6A 5I4DA 1B44D 2XNAC 3GP7A 1TY0A 1EU4A 2ICIA 3EFXD 4RCOA 1S5DD 1S5CD 1PTOC 1V1PA 1CQVA 1PTOH 1RCVD 1D5MC 3OWEB 1CK1A 3BYTB 4DXFA 1PRTC 1TS4A 2AQ3B 3DWPA 5ELFA 1YN3A 1PZJD 1AW7A 1XXGA 1FGBD 1LTID 4NZLB 1HQRD 1PZKD 2IPKD 1I4PA 1PZID 1DJRD 1ESFA 5FKAC 1YN4A 2RDHA 1B1ZA 1KLUD 2SEBD 2NTTA 1BCPD 2R61A 3DWQA 3MFGA 3R2IA 3TSSA 1QILA 2XRSD 2AQ2B 2CHBD 1JWMD 1G8ZD 1TY2A 4UDUC 4RGOS 2G9HD 1SJHD 1UNSA 1S5ED 4RGNA 1CHQD 1LT5D 1V1OA 3BZDB 4OHJA 1AN8A 1SE4A 1PTOF 1KTKA 2WV6D 1ENFA 1I4GA 4RGTA
chains in the Genus database with same CATH superfamily
3TP7A 5H1SE 3GZNI 3UGBB 3V62A 3IRBA 4HR7B 2Z0SA 3T3OA 3H3VC 3HM6X 3LXFA 4W9FA 4DK3C 3DBLB 1XJVA 1L5PA 2KX3A 3BYYB 4GDKA 1WR6E 5JJZA 5FO7B 4TQ1A 1TKEA 3DHGC 3M63B 5D14A 4MH8A 2F0VA 4N8FA 3TEYA 1OXXK 3H09A 5D65A 5LXHA 2WXJA 4L5RC 1C4AA 4LUVA 2L5TA 2N88A 3EROA 2KDMA 4AJYB 1ZW7A 2KDFB 1BT0A 2WLBA 4X65Q 5CX3A 4BAXA 2FINB 2JA5G 1QQRA 2RA4A 2L1AA 1GB4A 4PZ8A 2N78A 4BOSC 1EFID 4ILWA 4DK0A 3HOXB 4AS1A 3KUZA 2NVTH 2JZ3B 3PO2G 2K3UA 5AFWA 4A3DB 2LJIA 1L0XB 2E74C 3IAYA 3T3NA 1A62A 1EL0A 3S2DB 5FLXc 5JAVA 1CA6A 2KD0A 3OW7A 3V61A 1F9RA 4DDGD 3Q8BA 4A3JH 1E24A 2Y0SG 3X3MA 1SSNA 3CCMA 5AZGA 2NR2A 2PQAA 4C7YA 1NJIC 4HROA 3M4OB 4J1MA 1SNOA 2B2YA 4QIWE 2PYKA 2BA1A 1PH1A 2R7ZH 1PFDA 1EUVB 3BG3A 1SIJA 1UBIA 1XEEA 2WXQA 3I9V1 3NG0A 4DDID 1F2RC 4JWUC 1VQIA 4K6LA 2VQEL 3S1MH 3ECIA 4NDXA 4YCVA 5COYA 2K1BA 5AJ3L 4BFRA 2XEWA 2Q8TA 2JX5A 3L17A 1O78A 1FR3A 2L0TA 2N9PC 3E9SA 4F88A 1CSQA 3JVZX 5G2NA 2OQ0A 3HZXA 3VVWB 3T1HL 2L15A 3M4PA 2UXBL 2MWSB 4NAWB 2KNBA 5I4DA 5IYBG 4H2AA 3CCSA 1H95A 2IGDA 1VCIA 3VR3A 2WFWA 4MTNA 5BR8Q 3I4NB 4HEA1 1DCZA 1R4PB 1V43A 3OHXC 2EELA 4JOIC 4BKGA 1DM0B 3TRZA 2Y5CA 3P2BA 4MM3B 4A93B 1EIFA 2LXAA 5F2DA 3S17H 2IBIB 3JSVB 3GO5A 3VYSA 2EYOA 5G3LD 3A56A 3BK1A 3P7JA 2VH2A 2WXOA 2K5HA 3KF6B 4LNOA 1E1OA 4I7ZC 1ESRA 5FKAC 2KHIA 3M3YH 2CHXA 3KQ4A 4NAWA 1RHPA 1VMPA 2MHVA 4PYUA 4GKJQ 3UDGA 1VQGA 4P71A 2LI5A 3N32A 1YHAA 4B3ML 3QOLA 3N1YC 2N55A 1V97A 4MIUA 3ZKJC 2UUBQ 1WJ6A 2Q8RE 1FIQA 5IGEA 1XMOQ 2X8XX 3L08A 4GGQA 2W55A 4MM3A 3ZXRA 4DR3L 3AE1B 2ZNVB 1VQJA 1WTOA 1SE4A 2V4DA 4P16A 2KYWA 3ZUNA 4NB3A 3MHZA 1VQ5A 3P1HA 3KF6A 4OELB 4C2MB 1JB7A 1K3RA 3AFPA 3EN2A 1JJ2A 2BWFA 1OXTA 1IYFA 3Q8DA 3NELA 1DGJA 5IE8A 4A3KG 3PZDA 2ZTEA 3NHHA 1LT4D 2G5DA 4XIGS 3PZ8A 4B9XA 1D8LA 4GN4B 1HNZQ 4FF2A 1KRSA 1IBKL 5JHAA 5DNFA 4Y7NH 2HHHQ 4A90A 1A2TA 3SEBA 1E90A 1A5RA 1PH8A 5CC4A 5IIFA 2RHSB 4ZK9B 2F0SA 2N0SB 1E2ZA 2IO0B 2PE6B 5GADC 2EIFA 1WCMB 2OJRA 3ZVVA 2NBFA 5JJLA 1EWHA 4LNIA 2R93B 1ZDXA 1I6HH 4A3IG 3F1ZA 5CORA 3MFYA 1KDBA 1TKWB 5EBCA 5M5YB 3KYCD 4PS3A 1R9TB 4BY7H 1WTQA 2H88B 3DWGC 2HCCA 5C5MA 3BU2A 4XYOA 4F1SA 3OMGA 3VRBB 4JWSC 1F0ZA 3VAWA 3CHBD 2VZAA 2FIFA 2Z6KA 4WFN3 3ZO5B 1QCBD 2Q8IB 1J5EQ 4X6AH 3N3KB 1QNUA 1VQOA 1UWVA 1QT9A 3K5NA 1WYGA 4A9AA 5EQ0A 1FXAA 1O80A 1PH2A 1I4XA 2JU6X 3NS8A 5L95C 3GE3C 3TJPA 3NEMA 5C44G 3KDFA 2Q2UA 1JRPA 4L63B 4B0MA 4FXGC 2NVQB 3MC9A 5EJWA 1EYCA 1WE6A 4JX1C 2OOBB 1I3QB 5ELNA 2PPHA 1LTRD 3R2TA 3K9OB 2PQEA 4JI5L 5BN3A 5FLXL 4IM0A 5T1GA 2KQ7A 2F0JA 1RRBA 5EKKA 1CQFA 4RM9A 5C3EH 1WE7A 2M2LA 2IJ0A 3BVGA 3L0OA 3J80E 2BH2A 2KWVB 2KOXA 3DVNV 1B44D 2XNAC 2L83A 1H9KA 3VYUA 2DHZA 2BE5D 1ZXTA 2LVOA 5LHY1 1PTOH 4II3B 2WB1E 2IYDB 2UU9L 4RM8A 2F1MA 2EYHA 2LY7A 3DBRI 2FMCA 1HPCA 3IL8A 2YU9B 4IWOA 3VUXA 1LTID 5CGKA 3OIQA 2DBYA 3M62B 4ZRJA 5IO9A 1DJRD 2OEDA 3ITPA 3P4QB 5JEAJ 3S15H 1TWHB 4RF1A 4IOCA 3TCAA 2OF1A 3SK5A 3TSSA 1BCPD 1WTVA 1E5WA 4WORA 2VS1A 4OWWB 2C9WB 2O5JC 4AQ7A 5C4HA 4UP7A 4FN2A 1K8MA 2WXRA 1FM0D 3NBHB 3B9JA 2VQEQ 3HOZB 4M8MA 4OGQC 1FD6A 2VUMB 2AL3A 1B50A 4WJNA 2AWNA 4PQXA 3DMUA 1PGXA 2MHJA 2XSCA 4IW0A 5AJ3Q 5HHDG 1KC8C 2LVPA 3I3TB 3B08A 3Q8FA 4B3SL 1TWAB 4IG7B 4DUZL 5EAYA 4DHZE 4NJ6A 2RPVA 2C7NB 1F2ZA 1YITA 2WXGA 2JA8H 2BE5C 5DAUA 3T1HQ 3Q2AC 4P1CC 1Q1BA 1FNVA 5C3WA 2UXBQ 2IY1B 5HI1A 1S3SG 5L37A 4HN7A 1X6OA 1DXMA 1ICFB 5JVH3 2KDEB 4TRDA 1WMHB 2E2IB 1F1HA 4M0WB 3NBHA 1C4PA 1VQFA 4KY7A 5KRUA 2FBWB 1IYVA 2LKVA 1YHBA 2XVSA 3KK7A 4CDDC 3A54A 2PVOD 2KTFA 1SEBD 2A69D 1S5BD 1B7YB 2KVMA 3OIPA 4UP8A 2EY6A 1BCPC 5GAHC 5DLQE 2PIAA 2PPBC 3DXJC 1ASYA 4QCLA 4PMBA 1C79A 2K8HA 4JI2L 4IUPA 1WH3A 4G4KA 1WOCA 1I35A 2SNMA 3TP8A 5HGTA 1NMFA 2CQAA 2LGXA 4B3MQ 2WXLA 3I73A 4LLGM 2BQQA 4M0WA 2MSED 3W5UB 1L0WA 3GTLH 1LTGD 4IUTA 1T0YA 4KV2A 4DV3L 4TMAB 3TEZA 4KHVA 4G7ZC 4LF5Q 3VTWA 4DR3Q 1N9WA 4YIJA 2Q2TA 2KMCA 2KDBA 4N9TA 3WAOA 1XMQL 2ICEC 3BJUA 3U52E 2K8BA 3PCOB 2PW9A 4IM3A 2XRQD 5ELOA 1SJED 1SFOB 3CCLA 2KWDA 1VS0A 3X3NA 3TP5A 4IUMB 2E2HB 1TS2A 3LDZE 4MT5A 4BKSA 1CKOA 1TU2B 4A3GG 2X38A 1TT2A 3I55A 2B2YC 1BXTA 1I94L 4A3FH 3GTQH 3GD7A 1JROA 3U9OA 4LFAL 3TN2A 2WXPA 1K0RA 1H9JA 4W9CA 5BO4B 5ELDA 5A2QL 4OX9L 3KLSX 1A63A 1FFUA 3OJ3A 1J7BA 4RGMA 2WGSA 2FAZA 4YWLA 2EY5A 3A74A 1F9QA 1JMLA 1J6QA 1HNWQ 5FJ8G 3HKZB 2B39A 2A69C 2F0TA 1K8GA 3PREA 4R9WA 2DUDA 3QJZA 3AQQA 1Y8RC 4R1JA 2IO1B 2CJNA 3GS2A 2M0AA 1A3TA 4R4TA 3ND8A 1QJOA 1E7UA 3U2SC 2ICIA 1PH5A 1UWMA 4XTCS 1Z5SB 2BS4B 3CIRB 3PMFA 4P74A 5K5PA 1JT8A 4K1RB 1CKMA 2HIVA 4PZ6A 2UU7A 3MA2B 1W2BA 4R4QA 4C3HG 3EGRA 1GUNA 4LF9L 1KDAA 2V4LA 3Q14C 3Q8AA 1Y1VB 3B6YA 4B9KA 2D0PA 4US8A 3FKIB 1ZKHA 1KJTA 4YWKA 4ACFA 2KUMA 1GUSA 4ODGA 4CKCA 3AYHB 2B8FA 3RZDH 4F8CB 3GTJB 3V2TA 1KNEA 2K50A 4DR5L 4JW0A 3NY5A 4GLAC 4DV7L 4MSMB 1F2LA 2KBNA 1JJCB 5EPLA 2WU5B 1QILA 1XTDA 1U9RA 2XTIA 1WX7A 2D10A 1B3QA 1MI2A 3IVFA 1AWDA 1NNXA 1E2VA 1PH4A 3NE5B 2R7DA 4O2DA 3GTMB 5H8YE 4LUZA 3KVFB 4YCWA 1R4NB 2GMIC 4KVGB 3CRLC 2EMTA 1MG4A 3ERQA 3Q6BA 3RLFA 4XE0A 3IBEA 2F3VA 3SDZA 3S1RB 2MA9B 4JI5Q 2L76A 3N6RA 2N3SA 3S2HH 3Q24A 1SF0A 3MTNB 2B63B 4KDIC 4JI0L 5G55A 4LF6L 1H9RA 1X1MA 2V4IB 3I90A 5I9OA 4K5WA 5HFYA 5LL6X 4DGZA 2VZKB 4BBRH 3KLWA 4S0RA 4IOIE 4HMJA 1K8OA 1EIGA 1UE6A 3AB9A 1QLBB 2ZNVC 4P7IA 1T0RC 3A8IE 1EM7A 4A3MG 1K8AC 2L8JA 4A20A 2KFJA 2EOTA 4K8JA 1Y14B 3HOUG 5E6NA 2R92G 3M3JA 1VDVA 3RNEC 2M00A 3CQZH 1YJNA 1ET6A 3AB5A 3A9KB 2FIDA 1NR2A 3K5OA 1P16A 1GUAB 2LUMA 4NQKE 3UI2A 3T51B 4H7BA 2WB1B 3QIJA 1ILQA 1K51A 2G4SA 3VHTC 3NZ3A 4FVMA 1WY8A 4LTUA 2LHEA 4C80A 2HE7A 4A3BG 1H4RA 2HDMA 4BWGB 3NQTA 4BOZB 1OQRA 3KWLA 3NK9A 1X32A 1I4QA 3CKIB 4CQNA 3NUCA 1GB1A 1HR0W 4B3SQ 2D3BA 2HJ1A 1SLJA 2AKWB 4HAEA 4DUZQ 4JV5L 2CHWA 4DV0L 2HCIA 2Z4HA 2QJLA 3L54A 1KM7A 1MHHE 3VR4A 3MP9A 4MGIE 2Z6KC 4BS9A 3JAMi 1N6ZA 2ZCBA 3ZDTA 2KOLA 1Q82C 1KRHA 3Q3MC 2WIIB 3CW2C 2RKSA 4ULLA 5KGUA 3K58A 5JJIA 3B1LX 3IKJA 4JQWC 1TWGB 1NYRA 1XCQL 3BY4B 3SFDB 2IGHA 2A19A 3DBHB 4RH6A 2EXZA 3N20C 3ER0A 2Y0SE 2BCOA 3HUIA 1YX6B 5CYUA 5C5LA 1S5CD 5M3MB 1WYDA 3PUVA 1R4MB 3KH0A 2WKCA 4JI2Q 1NI3A 2I07B 2QMTA 4PZ7A 4AIMA 4BBSB 4MSQB 1F9SA 1EQTA 3H3VI 1PH6A 4IM2A 1PA6A 1ZUD2 1Y8PB 2W3RA 2NUCA 1EYAA 4K0KQ 1QKZA 5J22A 5KYIA 1C77A 2WXKA 4DV3Q 1FFVA 4NZLB 3S9WA 3CSFA 1J9OA 1RWSA 4A8XC 3A0JA 4XT1B 3H7PB 3I4MG 5EE1A 2F0DA 3A5UA 4HIOA 3K8AA 1JW9D 4M00A 4GZYC 1FO4A 4JPSA 2RD0A 4KD4A 1QUQA 2V1CC 3JW0X 4X3TA 5IOIA 4GN5A 2G9HD 3APDA 1UNSA 3RN2A 3HOWG 3IFWB 2JA7H 2ZVOA 1WRDB 4MEMA 1AN8A 3LNNA 4BY1H 1HCZA 3AULA 4WWPA 3T1YL 4WRDA 3GQBA 3VDZA 3L16A 2K5NA 2ZTDA 3BDOA 2K9XA 3L4PA 3X0WA 4MGKE 1KFYB 4PS8A 3SD5A 4BVUC 2CWPA 3HOVH 1SMXA 3PO3H 3H7PA 4MACA 1R4QB 2NVTB 2MJ3A 2VQFQ 3QWZB 2WWZA 1RTNA 3D6WA 2KN5A 1RTOA 4A3EG 5EPKA 4AYBB 5KNBA 1A2UA 4A3JB 4L6TB 1JALA 4A3LG 4QF4A 2C7HA 1NY4A 1EYGA 1WGGA 4BKSD 2QEJC 4JBWA 1QG7A 5KEEA 1VQ8A 1WGKA 2R7ZB 1NUCA 2PZTA 4S3SA 3ULJA 2JJQA 2VXWA 1L4DB 1SYBA 3OTOL 2L4NA 2UUAL 1YJ1A 1LFDA 3S1MB 2JZPA 3HFZB 3PUYA 3IT4B 1XTCD 1XWEA 1XO3A 3SU8X 4HPPA 4FNFA 1VR9A 4PK1A 1LTLA 1ML0D 4DAMA 3E6ZX 3S24A 4DR5Q 1QVFA 4DV7Q 5CMDA 1YZ6A 2GBRA 1WTHA 4X66L 1SB3C 5BYSA 4ZRZA 1T0QC 3C3LA 4QUFA 1K53A 4OW0A 1BNZA 4P72A 1EOTA 2JA6G 2N1VA 3CF5A 4RMAA 1J7AA 1ZKOA 4B95A 3KYDD 1RF2D 2ZT9C 1K83H 1VQMA 2CR5A 1VDZA 5IOCA 2F0QA 2MBEA 4NKLA 4HK2A 5C2TB 2MJ8A 3CCEA 1YN5A 4C3IH 3OWFA 2JXXA 4HKQA 2D5DA 1EZ6A 2PI2A 4HTHA 5M3FG 2CU1A 1IW7D 5FOBB 1V1PB 3MXPA 3S17B 4S17A 4ZYNA 2GVAA 4JI0Q 4WIPA 4EEWA 5IGFA 1Q5WB 2SNSA 4E74A 1NMGA 2N9KA 2WDRB 5IODA 3M3YB 1C8CA 4DU9A 3GTKH 1D7QA 1VZ8A 3AU4A 3DPDA 3HVDA 1V49A 4H0LC 1N34L 4K8IA 1FD7D 1TWFH 1PDXA 3N52A 1AP0A 1HZAA 3GP7A 1KNAA 1BUIC 3ZJUA 4AYBG 1V1PA 2XK5A 3AEAB 1GUGA 2AL6A 1CK1A 1VQCA 2PMZB 3PUWA 2O6VB 4TQUS 3NRZA 4FXCA 4AWJA 4IALA 1JE4A 1DOLA 5I9PA 2PTLA 2H4OA 1EFWA 3UDIA 4LJOB 3HIZA 1HFNA 4DV4L 4KIKB 3UIOB 1Q1OA 3RNAC 2MPMA 1YQ4B 1WVLA 3EIVA 4DR2L 1C1YB 1HZCA 3Q23A 5IKCM 2CU3A 3QG1A 1IW7C 2F4IA 2R61A 1IBLL 1QWYA 1FL0A 5HKHA 4NPSA 2AQ2B 4BXXG 4JV5Q 3AE3B 3MJ5A 4DV0Q 4KK7A 4GLSC 3P42A 2RHQB 5E1FA 2O6VA 2N7EA 3U30A 4L5QA 4Y7NB 4LF4L 5KNCA 1TKGA 3EUB2 2Z6BA 1S1QB 4OHJA 1A15A 5DM73 3BIID 2V3PA 2INPE 3K7AH 1PTOF 3FAHA 1KTKA 1Y1WG 3IAM1 3H0GH 3OG5A 3SK8A 4RGTA 1G51A 2VZKD 1AE3A 4BBNF 2EJGC 1H9MA 5CBAE 1AZQA 1QOGA 2LGYA 1DYQA 1C4CA 2WDVB 3MXUA 1I6HB 1XCTL 2FUHB 2NBWB 2ATWA 4NJ7A 3W1SC 1HFGA 4BY7B 4HIDA 3URYA 1STHA 2E3TA 1XLPA 1XPRA 4ANXA 4E71A 1PH9A 2Z8LA 5DEHA 2JRIB 4GDKB 4LCDE 1BKBA 1HTPA 5C4JH 4JI6L 3H6MA 2WP9B 3CCRA 3CWIA 3D4RA 1GNUA 3VA5A 1OTCA 3KUDB 3H6NA 3V6EB 3UE1A 2BS2B 3KYHC 3VA7A 1WGDA 1NAPA 3GE8C 4EQPA 3RLOA 4HJ7A 5A35A 5M9OA 3MXGA 1LT6D 1BCPB 2C35B 3C1FA 2P5ZX 3HP3A 4DV5L 1SMYD 5FLMH 5C23A 3R8BA 4IWPA 1BDOA 1SYGA 2C5LC 4EZKA 3J81E 3K5MA 2MGSA 1D5XC 4QQBX 4X57B 5IT9E 4ALPA 4IKGA 4FDBA 1NR4A 4H02A 4ZKCB 4HDQA 2LRWA 3PRPB 3CSTA 3KOJA 2D62A 4USAA 4IFDG 1FVIA 5C3EB 1JQ4A 2WNMA 1YX5B 1HQMC 1XPUA 4O42A 2VW9A 5CTRC 1WGYA 3Q6SA 4DUYL 1KQSA 4Q5VA 2IWHA 4C3JG 3T1YQ 2I5MX 4ZQ3A 1EIYB 3SR6A 3QARA 5BMIA 1PTOB 2ZJDA 5AUIA 1UEAB 4CKBA 1FYCA 4IFDI 5IP7H 4ME3A 1YMHE 4DK6C 4IWQA 4JYAL 2PQAB 2A5UA 5J2RA 5IYDG 2EYFA 1K73C 1HTLD 3K0YA 1YVCA 3NZSA 1LO5D 5EE0A 3HOYG 2LFIA 4DWFA 1Q12A 1YJJA 2M8SA 4DNTB 2OT2A 3S15B 1UF0A 3U9SA 4ZOHC 1BOSA 5AZHA 5CR3A 3C2PA 3AE6B 2LRUA 1TYGB 3GTOH 3M95A 2ALYB 2B3GA 2YYZA 3VTVA 1SMYC 2F0KA 2WP8J 4V0BA 4LK1C 5IGDA 5GROA 3TP6A 3EFUA 3I63C 2UUAQ 3ZQ4A 3QB3A 1WM3A 3DEPA 1B9RA 2LJ5A 3EFXD 2BGFA 3L0WB 5JJKA 3KBGA 3J80c 3PIP3 2WX0A 4JI8L 2WAQG 1WWTA 4X66Q 2KEDA 2NCNA 2QHOA 2JA8B 2DNFA 2ZW0A 3PIO3 4W9GA 3DCGA 1XD3B 1IYUA 1PZKD 3LWUA 2E2DC 2QGQA 1TT5B 2B2TC 3BK2A 1X55A 2KLGA 1FPYA 1VQNA 1N36L 4DR4L 2YTVA 4QB4A 2DJFC 1MGSA 1WTXA 3N30A 2BA0A 4IUVA 2IY0B 3VXWA 1E0BA 1UWXA 2ZVNA 1Z9FA 1EQQA 3B2FA 3OYYA 2GVBA 2WXHA 3OPOA 4Q0FA 1G6PA 2L32A 4AH6A 2F4VL 1UBQA 1AE2A 4R4CA 2F0PA 4NXNL 1ENFA 2ENBA 4JBJA 3D8GA 1VQDA 3G7LA 1VF5C 2RSOA 1IZ6A 5IYCG 4YHHL 2RSUA 2Y5PA 1N34Q 3DBLI 2UXDL 3PPAA 2F03A 1IKLA 3O13A 3GTLB 1CZGA 1RKNA 3PZ7A 5BN5A 4OL7A 2O2VA 3PTFC 5EGTA 1GUTA 2K5VA 2PZWA 4JK1C 4I6NB 3P1MA 1TJEA 1M4VA 5DPTA 3HOXG 1D5ZC 3CRKC 4X62L 1SE2A 2WINB 4XQQA 1HXYD 4A3DG 1EZ8A 2KK8A 1Y8OB 1D1KA 5C4XH 5JEAH 4DR2Q 2OEOA 1JC7A 4A3FB 3GTQB 3DBSA 3TBLD 4HVBA 4U68A 3DUZA 3R93A 1HA6A 1G91A 3LJ3A 2L55A 4K81A 3AFQA 1Q90A 4M8AA 5IGGA 4ARCA 5IWAL 2IX1A 1J0GA 1UAPA 1YBYA 1HEZE 2LUEA 2C5CA 4K14A 1F2YA 2A6ED 1P0RA 2BKFA 2DZMA 1Q0WB 4URKA 3IFTA 2LEKA 1DOYA 1EWYC 2F0LA 1TWCH 1SGHA 4OVVA 2RCNA 5C6AA 1RYJA 1I50H 4MH0E 4DAVA 5MPOA 4JI3L 2ZCCA 4XWWA 1QOAA 1F77A 5FO9B 3IFDA 2BS3B 3OLMD 4FO2A 1JWAD 5I6YA 1PMRA 5LLIA 2CVRA 2VNUD 2D0OA 4ANVA 3CC7A 1KAWA 3DBRB 3I4NG 2WKDA 1NTGA 3WAPA 3RZDB 1DZ1A 2LWPA 2EYLA 3OMCA 2O6VD 3KDFB 1SE3A 4QUCA 4A93G 5G5GA 1N63A 3BWUD 4XDCA 2INCC 2VRRB 3ZJYC 1CZWA 3A55A 3D31A 1EF5A 4G11A 2DJGC 3PGZA 3VTUA 1WR1A 2R2QA 2RF4A 1E8WA 1U4PA 2BW2A 2K22A 2JA5H 4DV5Q 4NNJB 3R7RA 1Q46A 4X3UA 1OFFA 3OWEB 2EKIA 4BKTA 4DXFA 2G1EA 2NZHA 4GOPB 3AECB 1FJGL 4O0AA 1ZXHA 3PO2H 4JBMA 2A6EC 2A4ZA 5K36G 4A75A 2MRPA 3S2HB 4UY8C 1AW7A 2F0UA 1XXGA 4LAAA 5IY0A 1HQRD 2F3IA 3E9IA 2Z9HA 2CH4A 4HRSA 4P2CB 2QF7A 4YY3L 4DUYQ 5J3BA 2CW0D 5IP9G 2NTTA 4BBRB 2I5LX 3RUIB 4CBVA 3I70A 2X69A 2PEAA 3AEDB 3WOFA 3DM3A 3ZIMA 4JYAQ 1IPGA 2M0XA 1WJJA 3CC4A 3S16H 4GOPA 3J80L 5M5XH 4HXDA 2IZVB 3AEFB 3H94A 4OVUA 3FEWX 1VQ6A 2EMSA 5BYQA 3HKSA 1JWBD 4MNOA 1P7FA 1IGCA 4EKUA 3A8KE 2FCSA 2GI9A 2I1JA 3A7LA 3NVWA 1CZPA 4ZHPA 1VZ6A 3CQZB 1FXIA 3B0AA 1IHZA 3Q3OC 3AM9A 3N9YC 5GAGC 1Z47A 5IYBH 1HZ5A 3AE7B 1E22A 2FMMA 1JQYD 4WWMA 3U4ZA 1YD8U 4CDFC 4ZHOA 1WCMG 3ZW3A 1NCVA 2MCNB 2J7ZA 5LL6S 4FADA 2NVYH 2E5LL 2TMPA 4OWTB 2R93G 4JI8Q 1CM9A 1X56A 5LMUL 2ZXPA 4K5VA 3J7AF 2CW0C 4GKKL 2J0JA 4KGSA 2DYBA 4DXAB 4CO7A 1H9SB 2F0WA 1T5EA 1OQYA 3U8ZA 2CWAA 3MTSA 1BVSA 1V5TA 2X6GA 4RFBA 1MSHA 1XYIA 1N36Q 4DR4Q 2ASQA 1JB3A 1MVKA 1C3TA 2B2WA 3ONSA 1PTOD 4IJHA 3FRPB 1JOQA 2J7QB 5CV7A 4R8NA 4QIWB 3PF5A 2HDEA 4IFDJ 1VQHA 2W9NA 2OXPA 4POGA 1BMLC 3K6OA 2DZIA 4ASWC 3TEWA 2E76C 1HZ6A 4B0EA 4LF8L 1XLOA 3RN9C 2F4VQ 2XBBC 2BYVE 5AUKA 4E3CA 3K9PB 1D1IA 2PW7A 2F0MA 3RNGC 3UQBA 4HJ5A 2L00B 1H9SA 3GDEA 4YHHQ 2JUOA 2MX2A 2K1FA 2UXDQ 4M1UB 2UUCL 1NYQA 1RFKA 1TTNA 1WGRA 3B2GA 1C76A 5DPWA 3W2DA 2PO4A 4IQZA 4A3KH 4OVZA 4FYDA 1RD9D 2BYFA 1IXRA 1MPEA 3A9JA 4D2KA 4FHJA 3AEGB 4LF7L 2KLCA 3UDFA 1J8IA 1V9JA 3T8MA 3WDNA 4YTPB 2HTHA 2Y3AA 1SN8A 4X62Q 3RD2A 1MIUA 2FJ2A 3AE8B 4AQYL 4YT0B 3RNUA 3RULA 1JR0D 3SGIA 3RUZA 2MQJA 4IUNA 3MXNB 4OZAA 3SK4A 2O4XA 1VJKA 3MJWA 2PNRC 2JA7B 2A5HA 3QOJA 1UELA 2Z0DB 4KKSA 4OZBA 4W9IA 5T1IA 3RNFC 5J1ZA 3VR8B 4DHJB 1PTOC 3PV0A 4BY1B 1E1TA 4H44C 1O7LA 1O7IA 5FR3A 2K5DA 4G0NB 4BBNC 3L10B 1HE8A 3X23A 1YN3A 3V60A 2RDFA 4A3IH 4K2KA 1WXAA 3A1QB 4G50A 1RM6C 3HOVB 3PO3B 1S3OA 2KCTA 5IWAQ 2WQYB 3V96A 3C8YA 3A33B 1CI3M 4JIOU 5E7NA 3HOZG 2BB6A 4DN4M 4XYQA 3UF8A 2VUMG 2JN4A 5LMNL 3RMHA 3AMZA 5D2MB 2FCNA 1A3UA 2RDHA 3KBXA 3W5OA 1MHXA 4C1NK 3PHWB 2Q2HA 3MXNA 2D3GA 2LD9A 5AZFA 1VQ9A 1PGBA 3DM1A 2XRSD 5FO8B 1IBKQ 2H5XA 4NP5A 2K33A 2E2JH 1E7VA 2K05A 2V1YA 1ICWA 3AI5A 4APVA 4LNKA 2GA4B 2ZPNA 4GMVA 4L23A 2V0GA 5C44H 2WX1A 2KQ4X 3A1QA 2NVUI 3FHWA 1SNDA 3A7AB 4OZCA 1B53A 3W1YA 1YIJA 2ES2A 2BYEA 4KX6B 3W5VB 1N5XA 1C4QA 4CHTB 3WCQA 3P4PB 2QDLA 1LTTD 1NI2A 2D3AA 1T5XD 1V1QA 1XLQA 3EFCA 1PLFA 1GKHA 4PG3A 2NTSA 2K01A 3SVMA 2INNE 4EFOA 1EY8A 5JHBA 4ME5A 1K83B 1OGWA 2NB0A 3SXHA 2WXNA 1E10A 1QOHA 4CJ1B 2KJXA 4YTNB 2QKIC 1L0VB 1JE5A 4B9WA 4C3IB 1FJGQ 5EE9A 1GJZA 3G71A 4J8QA 4OIKA 3DHHC 4FJZA 2JYOA 3A4RA 4IPGA 2Y5BB 3NVVA 2GBNA 2CQOA 2XGTA 4PYZA 1I4RA 4JCVE 1EEFD 2O2LD 3K7UC 3GTKB 2KVZA 1SDFA 1FNUA 2DZKA 5EKLA 2EKEC 3NVZA 1A8VA 1STBA 1TWFB 3T9LA 2ON8A 3E0JA 2N8NA 3HG9A 4E6IA 1IBML 4OO1G 2B8GA 1D2BA 3ML9A 3P63A 3CPFA 1LTSD 1EU3A 4LJZC 2RDBC 4KSKC 4CJ0B 2OHFA 3HKZG 2EJFC 4J15A 2UU9Q 4WJPA 3CAMA 4LUOA 2YV5A 4I7AA 1ISNA 1YOVB 1A0IA 1OO9B 3TIXA 3QCAA 4JL9A 1LM8B 2NN6G 1LV9A 4ZAIA 4OO1I 2AYOB 4KTAA 1M8AA 2G3QB 2KHSA 3ZXVA 5CV5A 2G9DA 2ZW1A 1ZXIA 4FF3A 2LASA 3ALBA 3ENEA 1GVPA 1FNWA 4A3CG 2R3ZA 2DYOA 2J42A 3EECA 2NN6I 1WJNA 5C0XG 1OXUA 2E5LQ 1Y1VG 1GHJA 3CMEA 3HK0A 4L2YA 1Z7TA 4JG2A 3NPPA 3FKIG 4XWTA 3I56A 4GKKQ 1ZOYB 4HIMA 2D11A 3DWMA 3PVLA 2A74C 2WXIA 1BBWA 1O7YA 3BDLA 3K7AB 2ZM6L 4MELA 4UHVA 5C0XI 1C9OA 3H0GB 1N8RC 3I91A 3S14H 1WI0A 1RL2A 3LB8C 3WIMA 3S1NH 4FLHA 3C0RB 4XDXA 1VD2A 2KXJA 4LNFA 4YSXB 1RAXA 2GB1A 3S2AA 1VQBA 1TBEA 2I46A 4DR1L 3TBIB 4CDEC 4KKJA 2Q2IA 3J7YW 1TIID 4LF8Q 1N33L 3ZGZA 3PSEB 4PMCA 4DK5A 1AEXA 3UE0A 3R2IA 4FBJB 5E4XA 4LFBL 1KXLA 4NMZA 4DR6L 2CHBD 1WTPA 2PJHA 5C4JB 2WHIA 4A3GH 1Q86C 1SRUA 4NQLB 2B63G 4LW1A 3FPUB 4CDCC 5HURA 1F2MA 2UUCQ 4DHZB 4EZLA 4RCNA 1YIWA 4A3PA 1QUQB 4XQNA 1E7ZA 2MO0A 3KLSA 4GOPC 1RCVD 3KUPA 5FJ8H 4LF7Q 3OSOA 2NPTA 2WAQE 3NJTA 1EO6A 1VQ7A 2LMCA 2BYTA 3OW2A 2B2TA 4HJKA 5TSSA 5KHOA 1PFNA 4AQYQ 3LX0A 4EQ5A 4XT3B 4KGRA 2K32A 2AUJD 3VDYA 4GLXA 1XMQQ 3CU7A 3RPFC 1G6JA 3Q8EA 1IL8A 1UEBA 2VY3A 4IZ8A 1PH3A 2VH1A 2PCFB 1SR3A 4RHRA 4C3HH 5JVG3 1YHQA 5T8IA 5E6OA 4X3KA 1AFPA 5EPJA 1B9MA 1STNA 2KVRA 2JEBI 1I94Q 2WB1G 5D7GA 1RDPD 2NVXH 4LFAQ 3L9AX 3GTGH 1WYWB 4OX9Q 1MHWC 3BZKA 4ZCKA 3IAS1 5BN4A 4LJPB 2B76B 4TUUA 2K5QA 3ZNZB 3NUHB 2GLSA 2JF5A 1I7HA 5CHVC 1V2YA 1S40A 2ZEQA 1T0SC 1J19A 3GTOB 2CS4A 2K0PA 1XPOA 4KV6A 3J81c 2B2WC 1OTRB 1UE5A 1ZYRD 4JC0A 5IT9c 4I6LB 4KGTA 2C9OA 2JWUA 1O7ZA 2LS01 2KC1A 2SOBA 2I38A 3MHBA 2ACZB 1CKNB 3ZNGC 2AEHA 4LF9Q 4L8JA 4GS3A 1U0LA 1F2RI 1P8LA 1AH9A 3Q8CA 1S72A 2MW5A 1A6XA 1J8CA 1IBXB 1FCLA 2XWBB 1K50A 4XGAB 1KOTA 1IYJB 2KQ3A 3HHMA 3VYRA 1EOVA 3GV6A 3DHIC 5IA7A 2B29A 2I1KA 5M3MG 1K8RB 3NENA 2F0HA 4X64L 1WZ0A 2AQ1B 3JYUA 4GU2A 4WJOA 4EZJA 4DHJD 1D4BA 2B2VA 4NY0A 3S1QH 4BBSG 4KZCA 4MZ9A 4JGHB 4HEDA 1UGJA 3EJIA 4IOAA 3DBHI 5DPRA 1VQ4A 1CKNA 3V6CB 2IHFA 4A3MH 1HJPA 3OAWA 2Z1CA 3PO0A 1L2FA 1QVCA 2K6DB 4UAIA 3CPWA 1R4MI 3VQIA 2ZXOA 3K0XA 2K25A 3ZNHB 1IBXA 3HOUH 4A55A 2R92H 1GO3E 1V5OA 2AX5A 1XNQL 3NXWA 2G45B 1LM0A 1K9MC 4DQOC 1ZYRC 3P75A 2XK5B 4WAFA 2MP1A 1J7CA 1PZJD 4L5SA 4WJWA 4LF6Q 1PYBA 1NBFC 3U7DA 4A3BH 2QDBA 1KH0A 4W9LA 4DV1L 4XDDA 1C7YA 2HTME 1TVXA 2LFNA 3TREA 2AWTA 4ICUA 1KIXA 1GAQB 1L7YA 1WGHA 1TXYA 4K7UA 1NENB 3KF8B 1YNND 2RSNA 4V190 2M4NA 2AUKA 5CHFA 2WXMA 4DV2L 3DEOA 2V3SA 3FP9A 1CHQD 4RGNA 4JBKA 2M19A 2PKOA 1ZGUB 4A4IA 5C4XB 3DHQA 2I0QA 2UXCL 4FA6A 3V3XA 1I4GA 4A3JG 4RNAA 4WWOA 3F2DA 5H92C 3TZUA 4RF0A 2RMMA 4DXGA 4W9EA 2MNAA 1LTAD 2R7ZG 3FMCA 3GZNB 3H3VH 5JH5C 1Y56A 3KF8A 4KLKA 5DCNA 4LK0M 4DFAA 1D6EC 1ET9A 4EOYA 1XF5L 1SNPA 2JQRB 2MEKA 4CGYB 1XT9B 3VFKA 1CTMA 2L7RA 3G4SA 1TWCB 2IO2B 4DNIA 3H8HA 1I50B 1E0ZA 4HSVA 2JSVX 2YTXA 4RG1A 2K75A 4WJ4A 2KENA 1VLBA 4NPNA 3I57A 5BMGA 4YTMB 2MFIA 5GQOA 1LTBD 1MSGA 2A1AA 4K7SA 1XMOL 2DGYA 3JAME 3RNCC 4U673 4ARIA 1YNNC 4DR1Q 4R4OA 2HD5B 3I4MH 2LGIA 2LHDA 3VUYA 2HD3A 2EZVA 4ABNA 5J17A 4BZAA 2GBJA 3D32A 4DF7A 4LFBQ 1E6EB 4ITKA 4ICVA 1JMCA 1NVID 1TS3A 2NS5A 3C19A 3UI3A 4X3SA 3TQYA 3HOWH 3KLRA 3H7SA 3ZRCA 2BPSA 1CHPD 4YCUA 1T6BX 4PS7A 4KN7C 1SBBB 1I4HA 3RZFA 3I7FA 3QC8B 4ZUJA 4KMUC 2JA5B 1FEHA 1EQRA 3K81C 2DYMA 5EKIA 4WJQA 2EYMA 2FNJB 2AMCB 2BF8B 3PO2B 5HGQA 4M8NA 1WF9A 1SYFA 2NYZD 4A3EH 3BVMA 3HEJA 1ZPSA 4XYCA 4C7ZA 2BB5A 2BVCA 4N9F4 4LWCA 5FK9C 1NSNS 4DK1A 4WURA 1DGSA 1E2WA 2Y0SB 3VYTA 4DV6L 4A3LH 3J81L 4NJCA 2OQKA 4JI4L 1E8YA 5IT9L 2JT4B 1WRIA 1EY6A 2SAKA 4A76A 5C0XJ 2D2QA 2UWQA 2K4KA 3J7A5 4HSPA 3CC2A 5E3FA 3HM3A 2DAJA 3PT2B 1QF6A 3L2PA 3S16B 5M5XB 1EU4A 1M90C 2RQXA 4DR7L 2XWJB 2WYQA 1YQ3B 5C4ZA 2KANA 2EDGA 2RVLA 1E7PB 2KAJA 1B9NA 3TEXA 2J0TD 5GAEC 3U4VA 3QR8A 2OJWA 4IN3A 1TS4A 2AQ3B 2PE9A 2JXTA 1J5EL 5IP4D 2K5PA 2FHTA 2JZZA 3K57A 2JA6H 2E8GA 2F0IA 1IGDA 3AXCA 4GIVA 2ONQA 5EDSA 1D3ZA 3VR6A 3TZDA 1PZID 3K5LA 1U4MA 1ESFA 3P4RB 1YJ9A 1K28A 4J6HA 1W6KA 4ZLTF 1KF6B 2JE6I 3H9DA 3I5JC 4YWGG 5M5WH 1KLUD 1GM5A 3AEEB 3QA8A 1ZEQX 2BDNA 1E8ZA 4ZRIA 1Q81C 2FUG1 1VQEA 1WJ4A 2ZJPA 5M3FH 4W9JA 3LGJA 2NVYB 3J80i 3F2BA 2MJEA 3RLNA 2DZJA 4ZDVA 3OTOQ 3CCVA 4BA2I 4Q2JA 2K52A 1RJTA 3BZDB 4BY7G 4RAUC 3PQIA 2MH7A 5BYRA 4F7ZA 1TZOA 1EUJA 2BDOA 3WALA 2BOSA 2DY7A 4X64Q 2OWOA 1FCCC 1P98A 1TZ1A 1WX8A 1PDQA 1PRTF 3AV8A 2IL8A 1Z6HA 3QQ8B 3ZJVA 1LUZA 3APCA 2KO3A 4HPMB 2LSSA 1B8AA 3WAMA 2MBBB 4OXPA 2ASBA 1V9PA 2ZXRA 2F3WA 2BKRB 2PNHA 2JPHA 2GOWA 1PXUA 1JRUA 4ZRQA 3G6EA 1GG3A 3E5SA 2QIEB 3AE9B 2K7VA 1XNQQ 2KDIA 3WA0A 3EHVA 3PHXB 2O2VB 1STGA 4POFA 2ZPYA 1ROEA 1WXSA 5C3EG 4CYEA 1FRDA 3ZTCA 4A3KB 4DV1Q 3K80C 1M1KC 1EEID 3CMAA 2YLMA 2YVCA 1F9JA 5D6JB 4BXXH 4JI7L 4KZ0A 4MGYE 3AEVA 1WFYA 3IXSA 4RA8A 4NAMA 5CV9A 3NSWA 4DV2Q 3D3RA 4TVAB 4DPGA 1DOIA 4GNXB 1RFAA 1PUTA 3APFA 4KKTA 1GD7A 1Y1WH 2IX0A 5IGCA 3Q0AA 4R8IA 2IHEA 5G5HA 4DKAC 2MO1A 2UXCQ 2F0EA 2IW3A 1SNMA 4JVZA 3Q3JA 4QJFA 1SE8A 1BQQT 2W54A 1QOFA 4IDIA 1IUEA 3UIPB 2X6LA 1LLRD 4DV4Q 4A3IB 1PRTB 2DX5B 3RZOH 1TKYA 2KZRA 3ZJTA 2MBHA 4C56C 3QX1A 3ZDMC 4HJ9A 2KWUB 1IBLQ 1GUWA 4GNXA 3TMPB 1HTOA 2XIWA 2XN9C 1BBUA 2GBMA 1WJUA 4TQ0A 1SYDA 2J53A 2J52A 2B2VC 4LF4Q 2JA8G 2E2JB 1YJIA 2EXDA 4W9KA 2LXJA 5CV6A 4EQOA 3GOEA 1MFWA 2LVQA 2RR9A 3N1XC 1W6JA 1YNXA 1TY0A 2CH4W 4LF5L 5C44B 3HKZE 4CHKA 2IX3A 2IO3B 4M02A 1LGRA 4WJ3M 2D9UA 3JSVA 3U4EG 1FMAD 4N59A 2RPQA 1IP9A 5C3JB 5DPSA 2YEPF 2NMQA 2KT7A 4HIKA 4IFDH 3WOEA 1FGBD 3G6JB 3DQVA 2KHWB 1Q10A 2PVGC 2WDQB 2HT1A 3VRAB 1WTRA 1HNXL 3SHQA 4C3JH 1DONA 1SE9A 1B1ZA 2WS3B 4JI6Q 4HCPB 4H13C 1HNWL 2E6XA 3T53B 3KUCB 1KD1C 3VR9B 1E3PA 4P1BC 4F8MA 4K3BA 1TY2A 3RD4A 2DNCA 5I2XA 4TV3A 1UZXB 1L4ZB 1C9FA 1PFMA 5IYDH 4K5XA 4HKZE 1S5ED 3BZCA 3HOYH 2SDFA 2J0MA 2Z4IA 1L1OC 4EX5A 3AH7A 3OOCA 1VQAA 4B08A 1GC7A 1CJEA 4ANWA 4DV6Q 1DOKA 4JI4Q 3GTPH 5I6WA 3STBD 4L5TA 5FR6A 2MUYA 3ZTDA 1CT1D 1F9PA 1ILPA 3QHTA 4KHPL 3KJOA 3GV3A 4A3FG 4ANUA 2D3CA 2L12A 1X9NA 5CV8A 1PQSA 1KLGD 4DR7Q 1BUVT 5JPNC 4RHSA 4IJLA 2N49A 3MVVA 2QDFA 3VH4B 3ZLZA 4KJOA 2IGGA 1HA5A 1P9DU 4FXDA 2KMMA 3NVYA 4GSWA 3VR2A 3ULPA 2YEPB 3CCUA 4NW2A 3HGBA 2BBCA 1QZEA 1B3AA 3HVZA 1GXDC 4G7OC 2KKCA 4DNRB 4I6PA 4KKUA 4IURA 3SFEB 3TS2A 1JCKB 4FULA 5FLXE 2FCMA 2N7JA 1KHIA 1V8CA 1ENAA 4K2LA 1T9HA 1CUKA 4KN4C 4CJ2C 4JE3B 2JA9A 3NQIA 4PV1C 3AE4B 3CMMB 2KJHB 3M4QA 4GN3B 4QGUA 3STBC 1YNTE 3R7QA 4A3OA 4II2B 2NZOA 2N9EB 4NXML 4AOFA 2KCNA 4FJVB 1EY0A 4KI0A 5IYCH 3BS1A 3S14B 2TSSA 3S1NB 4IPDA 2J4XA 2KC2A 1N60A 4RKLA 4HDOA 3PS6A 1K52A 1QOBA 2JY6A 2Z0EB 4LNNA 4FP5D 3EA6A 2INDC 2EY1A 3TDQA 3MC0B 2KTRB 1A3VA 4N58A 4IC7B 2EE1A 3NP8A 3T13A 1MD2D 1XNRL 4AP4C 3HOXH 3ULLA 1HZ9A 3A9JB 2BH8A 2AHOB 4A3DH 2UYZB 2DN8A 4A3GB 2K8CA 3I2ZA 4YWMA 3S2DH 4AJWA 1EY9A 1U4AA 2JQOA 3MAQA 4C1NI 1I42A 5HY6A 4NXNQ 4FHKA 4FF1A 1SIFA 1WXVA 2LGSA 3M4OH 5D94A 4BBRG 3IHPC 3QO2A 3T56B 4MJSB 2R2OA 4R4IA 4FXKC 4JI7Q 3CCQA 2EVBA 2KTRA 1QZHA 3M9BA 1OEYJ 1L6VA 1P3QU 1TQOA 5C1ZA 1PFBA 4B3RL 1T3QA 1VRAB 3J7AV 1HR0L 2K6QA 3A5ZB 4LNQA 2F0OA 4ZRPA 1BBXC 3ML8A 1K3BC 2KQSA 5GXGB 3W3AA 3J7ZC 2MJDA 4K7WA 3RR5A 2HIXA 3K59A 3MFGA 2EQSA 3DWQA 3M85A 1RIPA 3W1SA 4C3HB 1JWMD 1G8ZD 3TMEA 2PW5A 4QL5A 3FC4A 4UDUC 4RGOS 3RMKC 4OIJA 1PV4A 2QA4A 1MJDA 4MJSA 1L6UA 3AU5A 2NVXB 2QCZA 4KY5A 3FILB 3GTGB 4MDKE 3KFUA 3I4NH 5IN7A 2K39A 3D4WA 2L1BA 2V9HA 4ZUIA 4A93H 5D3DA 4US9A 1LT3D 2QSDA 1WMHA 1YI2A 4IO9A 2K14A 2LZ6A 2YTYA 3E9HA 5IGBA 3GB1A 1SXTA 4B3TL 4K0KL 2Q5WD 2QC8A 4DAYB 2KA7A 4PNYA 4KJNA 2W82A 2DWQA 1U4LA 3R3MA 4LDTB 1WIAA 1V6EA 3R66C 3EQLC 4JI3Q 3FILA 1C78A 4XC2A 5D3IB 2B2UA 1BO0A 5K36H 1GOZA 1WD0A 1WSPA 3PUZA 3UQAA 4AYBE 1EY4A 1UE1A 3Q69A 2CCZA 2A8VA 3PRZA 5C3XA 1MJEA 5A2QE 1V8QA 1QZGA 1E8XA 1HNXQ 5IP9H 4LFCL 2ZZPB 3BDCA 3QWNA 4W9HA 4DAYA 4C2MH 4ZYSA 4Y52H 2M17A 4WWNA 1QVGA 3MHSD 3P20A 3CP0A 3S1QB 4MTKA 3NTKA 1HUMA 2RGFA 2L0CA 3H91A 4O1NA 1HZBA 4HJ8A 1HUNA 3PRMB 2VQFL 4YSZB 1PRTD 2PI2E 4A3MB 4XZ4A 3RCZA 3FPPA 1NBWA 1G2SA 1EWIA 1Q8IA 1P1AA 1N61A 4KY6A 1VQPA 3HOUB 3V05A 4ZRKA 1Q8KA 2R92B 1UD7A 3PLUA 4XQJA 5HG2A 1VMCA 1DOMA 4KSLC 3ERSX 1HRJA 2KN4A 4F7XA 5JPMC 3E56A 2J0KA 4GN1A 3W1GA 1EY5A 4KHPQ 2JA7G 4G7HC 4AUQC 4P75A 5ELEA 1MI0A 4A3BB 1R7SA 1ZDVA 2N9LA 3RI7C 1HTQA 4YY3Q 4GDLB 4BY1G 3VR5A 2MBOA 1WCMH 1WX9A 2HQLA 3O65B 3MEFA 2I2YA 2JK8A 4XX5A 2R93H 5KHQA 3RN5A 3M7NA 1NEKB 1PVOA 4QMGA 3U58A 5M5YH 4GNXC 3HOVG 3PO3G 1L0YB 2BT6A 1R9TH 2GRIA 2QEXA 2FE8A 3A4SC 3AMUA 1U5KA 3L7ZC 2M1MA 2K03A 3KWVA 5JXVA 1A70A 2NZ1D 1NE3A 1X54A 3W1BA 5ISRA 3E0EA 3CF6E 1X65A 3FDTA 2R6GA 1B2TA 4TKOB 3T16A 1LABA 2F0NA 1PRTC 3DWPA 5ELFA 3DVNU 4GDLA 2IY5B 4J6IA 3TL5A 1LACA 1KRTA 3EC8A 1VCBA 2V3NA 2KCMA 1IL2A 5KNDA 4GXBA 4L1BA 1EQVA 4DA2A 4IPHA 3DVGY 4OWXB 2L52A 2IT1A 2NVQH 2PMZE 1Q1EA 1H8CA 2A6HD 4EVOA 1PYSB 1I3QH 1KABA 1N5WA 3DLLA 4NXMQ 3NBIA 1MKHA 3F8TA 1GHKA 1VZ7A 2GBKA 1CSPA 3BINA 4W9DA 4WQMA 2F52A 3LWEA 3CCJA 3PGEA 2WU2B 1SYEA 1SJHD 3MWYW 1XX8A 5LMUQ 1EF1A 2B3AA 3AEBB 1V86A 1KAAA 1UGMA 5E6PA 2FXQA 3RT3B 1V81A 1K0SA 2D5GA 1TIFA 2GN5A 1VQLA 1G2TA 1HH2P 1Q3LA 2C7MB 1OQQA 2PLPA 3I3CA 1AARA 1VF7A 3I4MB 1QB5D 2PZUA 1XNRQ 2L0FA 1GUOA 1F52A 2MLBA 1TR5A 1G6ZA 2N4FA 3CXCA 4C3IG 4KHZA 1L2NA 3FKYA 2YU9H 2NPTB 1BR9A 2JWZA 2H1EA 2VB3X 3HOWB 2QCPX 4REZA 1CFMA 2LMCB 1GC6A 2MBQA 2ID0A 1TWHH 2DNEA 1JJGA 3PIPA 1EWCA 5ELBA 3R3OA 4WQOB 3AN1A 4GOCA 2QW7A 3QK0A 3AE5B 5I2YA 2HQEA 3PIOA 3L13A 4WAAA 4EE2A 1MJCA 1S5FD 1W3SA 4K6DA 2K5WA 1R4NI 1WD1A 3CD6A 3HOZH 2A6HC 4B3RQ 2JVCA 2VUMH 1HR0Q 4MN3A 2HJ8A 3QAQA 2KECA 4MHEA 4JI1L 4A3EB 4WH4A 3AU7A 4ZKBB 1KL9A 4EQNA 3A9KA 3DVGX 1P7EA 1TWAH 2WXFA 4LMQD 1SSOA 1ASZA 4KKIA 4JLCA 2N9XA 2HUGA 4PMWA 3JAMc 3KJPA 2OCEA 3VUWA 1LXDA 3LYYA 1STEA 1N32L 3J9CA 5LNK1 2KCCA 4F87A 2OTJA 4KD3A 5J39A 2KWCA 3NTHA 1JOOA 4FJYA 5LXIB 3E3XA 4UP9A 5KIXA 2IDYA 5ELCA 3ZRFA 2E2IH 2JP1A 2RBMA 2KHJA 3ND9A 3I72A 1WXMA 1SNQA 5G3LF 3J81j 5LMNW 2VL6A 1PHJA 5DM63 1C0AA 1JORA 1UE7A 5KYLA 4JPBW 3Q3FA 4P6VF 1WM2A 5IAAC 2JA6B 3IT6B 1OXVA 2K6AA 5LMNQ 4B3TQ 3TEHB 2N1WA 3NZUA 1MBYA 1PH7A 1FRRA 2JXMB 2KACA 3J81i 1ZP0B 2K28A 4XXEA 3H0GG 4BA1I 2FCQA 5NUCA 5M5WB 1WTWA 3U50C 1X3QA 2PMVA 2KX0A 5M3FB 3UDXA 1TS5A 4HCNB 3ABVB 2D2CC 2I5HA 3I4LA 4HCSA 1YNJD 2A68D 2W3SA 4RKBA 3RZWC 4JOIA 4GB9A 4RCOA 1BF4A 3D4DA 1CQVA 2L9HA 4R3DA 1TGZB 1D5MC 3SR1A 3BYTB 1SFOH 4LFCQ 2M56B 2E2HH 2JYTA 1VQKA 1B4OA 3G48A 1ONLA 2LXKA 1Y69U 1GPXA 5E4WC 2VB2X 1AZPA 1B70B 3Q22A 4OO1H 3EBEA 4X65L 2D07B 1EIHA 2REXA 3M4YA 3VH3B 3C46A 4C4VB 5FLMG 1IKMA 1SYCA 1YJWA 3SE0A 3A8JE 3UINB 4TKNA 3TS0A 3F2UA 2EJMA 1I6VC 2NN6H 2E75C 4G3XB 2MP2B 2KMAA 2KEEA 1PGAA 2EPBA 1JICA 1WZ3A 4RWSC 1LT5D 1V1OA 3PUXA 2G4DB 2WDTB 1KLVA 5CHWA 3AE2B 1AYFA 1L1OB 2WV6D 2OTLA 4A3CH 1EYDA 2KJ6A 3HS0C 3M7GA 4LDTD 1GJXA 2O5IC 5C0XH 1S4ZA 3RFZB 4DBGA 2EY2A 1Y1VH 4HJAA 1Y8NB 1YNJC 2A68C 3PLVA 2L11A 4Z9CB 5GMVA 3FKIH 3L3OC 5IP7G 4C4VA 5AEKB 1NDDA 2WACA 3NTIA 3WANA 1IBMQ 2JEAI 2CJOA 1UH6A 4HPLB 5L83A 3GTJH 2MP2A 4GLVB 1Y1WB 3F2CA 3TUOA 3IG3A 4HMIA 3RYTA 2JYEA 1UUPA 3QIAA 1L1OA 3OJ4B 3ZNID 1X3EA 2M9VA 4B6WA 2LXCA 3GTMH 1M94A 1MG8A 2C60A 4C00A 2R7FA 3ZYYX 3NWTA 3RZOB 2JRHA 2B2UC 2Z59B 4K3CA 4HWIB 1FGUA 5BR8L 2H89B 4N8X1 1JWSD 3H15A 1LQBA 3S1RH 2ZJQA 1XLNA 1C48A 1RODA 1STYA 4N9PA 5CBEE 2DAFA 3MC8A 1EY7A 2EYPA 4G57A 3DDCB 1QE6A 2HDLA 2QILA 3BVZA 2B63H 3KW5B 3NWSA 3RNBC 1V80A 1RLFA 1YQBA 5BMHA 4QAYA 4DAPA 3P4SB 4YL8A 1PYWD 1JOKA 1ACCA 4P73A 1XQQA 1WI5A 2NBVB 4HLEA 2K04A 2ZM6Q 1HHVA 1JWUD 2CFMA 4GKJL 3DWAA 5E6JA 4TSSA 2RCFA 3U7ZA 4N6EB 1SAPA 2CKZB 1QNKA 2BTEA 2UUBL 4M01A 3PSIA 2DLBA 3ETRA 1DD2A 3D0FA 5J18A 1BCPF 3JAML 4ID6A 4EGVA 1N33Q 2KJRA 1E9MA 2CKHB 2L3ZA 3QJYA 3FVQA 3Q3NC 2MQHA 4FF4A 4C3JB 3MZ5A 1SROA 1KDCA 1X3GA 3D6CA 1Q7YC 1CA5A 4DR6Q 4UPAA 1ENCA 2DENB 5EE3A 3SK6A 3SDLC 2ZJRA 4I65A 1X3PA 2RDGA 2LGDA 1PFSA 3W9CB 3PF4A 3C1EA 4J3OD 5TR5A 5CV4A 1DOXA 5EBDA 2FFKB 3T4AC 4CKEA 2KFKB 2L05A 3H1UA 3HRDD 1X3FA 4JI1Q 4YSYB 3HOYB 1S5DD 2F0FA 3NS1A 2F0GA 3WWVA 2NWGA 3ONAB 4KIKA 1WFQA 4OEMB 1HNZL 4YXDB 3GTPB 4HJGE 2HHHL 4IPCA 1N32Q 4RMFA 1G291 5JOBA 1WXQA 1OXSC 4OONA 4MGZE 2IPKD 1FXTB 1I4PA 3N1ZC 2A73B 3HRZC 1CMXB 1I5FA 5JEAG 5C4XG 1YN4A 1ZE3D 3EVQA 3PV1A 1STAA 2BWES 1OEYA 1TWGH 2SEBD 2KFKA 4QY7A 1LYLA 2JSOA 3I4OA 3MEHA 4IUUA 4EUTA 4KDLB 2WAQB 3NHEB 1SNCA 3DOWA 4IUQA 5JZEB 3I8ZA 2NBUA 2DY8A 2CHZA 2N7DA 3ICEA 1U4RA 3SHLA 4PT5A 1YEZA 5M3MH 2EYJA 3NOBA 1N62A 4A6QA 1II3A 3JC66 2ZTCA 2AWOA 1Z2MA 4HCEA 4BBSH
chains in the Genus database with same CATH topology
3TP7A 4HR7B 3T3OA 3H3VC 3LXFA 1L5PA 3BYYB 5JJZA 5FO7B 4TQ1A 1TKEA 5D14A 4MH8A 2F0VA 3TEYA 1OXXK 3H09A 5D65A 2WXJA 1C4AA 2L5TA 2N88A 3EROA 2KDMA 2WLBA 2FINB 1QQRA 2RA4A 2L1AA 1GB4A 1EFID 4ILWA 4DK0A 3HOXB 4AS1A 2K3UA 5AFWA 4A3DB 2LJIA 1L0XB 2E74C 3IAYA 3T3NA 1EL0A 3S2DB 5JAVA 1CA6A 3OW7A 1F9RA 3Q8BA 1SSNA 3X3MA 4C7YA 4HROA 3M4OB 4J1MA 1SNOA 2B2YA 2PYKA 2BA1A 1PFDA 1XEEA 1SIJA 3BG3A 3I9V1 2WXQA 1F2RC 4JWUC 4K6LA 4NDXA 5COYA 2K1BA 2Q8TA 2JX5A 1O78A 1FR3A 3E9SA 4F88A 3HZXA 4NAWB 5I4DA 4H2AA 2IGDA 1VCIA 3VR3A 4HEA1 3I4NB 1DCZA 1R4PB 1V43A 3OHXC 2EELA 1DM0B 2Y5CA 4MM3B 4A93B 5F2DA 3GO5A 3VYSA 2EYOA 5G3LD 3A56A 3BK1A 3P7JA 2WXOA 4I7ZC 1ESRA 5FKAC 3KQ4A 1RHPA 1VMPA 2MHVA 3QOLA 2N55A 1V97A 4MIUA 2Q8RE 1FIQA 5IGEA 2W55A 3AE1B 1WTOA 1SE4A 2V4DA 4P16A 3MHZA 3P1HA 4C2MB 1OXTA 1DGJA 3NHHA 1LT4D 4XIGS 3PZ8A 4B9XA 4FF2A 5DNFA 4A90A 1A2TA 3SEBA 5CC4A 5IIFA 4ZK9B 2N0SB 2F0SA 1E2ZA 1WCMB 2NBFA 1EWHA 2R93B 1ZDXA 5CORA 3MFYA 1KDBA 1TKWB 5EBCA 5M5YB 1R9TB 2H88B 1WTQA 3DWGC 2HCCA 5C5MA 4XYOA 3OMGA 3VRBB 4JWSC 1F0ZA 3CHBD 4WFN3 1QCBD 2Q8IB 1QNUA 1QT9A 1WYGA 4A9AA 3K5NA 5EQ0A 1FXAA 1O80A 1I4XA 2JU6X 1JRPA 4L63B 4B0MA 4FXGC 2NVQB 5EJWA 1EYCA 4JX1C 1I3QB 1LTRD 3R2TA 2PQEA 5FLXL 5BN3A 5T1GA 2F0JA 5EKKA 1CQFA 2M2LA 2IJ0A 3BVGA 3J80E 1B44D 2XNAC 2L83A 1H9KA 3VYUA 2BE5D 1ZXTA 5LHY1 1PTOH 2F1MA 2EYHA 2LY7A 2FMCA 1HPCA 3IL8A 2YU9B 1LTID 5CGKA 3OIQA 2DBYA 1DJRD 2OEDA 3ITPA 3P4QB 5JEAJ 4RF1A 1TWHB 2OF1A 3SK5A 3TSSA 1BCPD 1WTVA 4WORA 4AQ7A 2O5JC 5C4HA 1K8MA 2WXRA 1FM0D 3B9JA 3HOZB 4OGQC 1FD6A 2VUMB 1B50A 2AWNA 4PQXA 3DMUA 1PGXA 2XSCA 5HHDG 3Q8FA 1TWAB 2RPVA 2WXGA 1F2ZA 2BE5C 5DAUA 1Q1BA 1FNVA 5C3WA 5HI1A 4HN7A 1DXMA 5JVH3 4TRDA 2E2IB 3NBHA 1C4PA 5KRUA 4KY7A 2FBWB 1IYVA 2LKVA 2XVSA 3KK7A 3A54A 2PVOD 1SEBD 2A69D 1S5BD 2KVMA 3OIPA 2EY6A 1BCPC 2PIAA 2PPBC 3DXJC 4QCLA 4PMBA 1C79A 4IUPA 4G4KA 2SNMA 3TP8A 5HGTA 2CQAA 4LLGM 2WXLA 3I73A 4M0WA 3W5UB 1LTGD 4IUTA 4TMAB 4KHVA 4G7ZC 4YIJA 4N9TA 2ICEC 3U52E 2PW9A 2XRQD 1SJED 1SFOB 2KWDA 3X3NA 3TP5A 2E2HB 1TS2A 4MT5A 1TU2B 2X38A 1TT2A 2B2YC 1BXTA 3BWUD 3GD7A 1JROA 3U9OA 2WXPA 3TN2A 1H9JA 5ELDA 5A2QL 3KLSX 1FFUA 1J7BA 4RGMA 2EY5A 1JMLA 1F9QA 3HKZB 2B39A 2A69C 2F0TA 4R9WA 2CJNA 3GS2A 2M0AA 1A3TA 3ND8A 1QJOA 3U2SC 2ICIA 1UWMA 4XTCS 2BS4B 3CIRB 3PMFA 5K5PA 3MA2B 4C3HG 3EGRA 1GUNA 1KDAA 3Q8AA 1Y1VB 4US8A 3FKIB 2KUMA 1GUSA 4ODGA 4CKCA 2B8FA 3GTJB 3V2TA 1KNEA 1F2LA 2WU5B 5EPLA 1QILA 1U9RA 1MI2A 1AWDA 1E2VA 3NE5B 3GTMB 5H8YE 3CRLC 3ERQA 4XE0A 3RLFA 2F3VA 3SDZA 3S1RB 3N6RA 3Q24A 1SF0A 2B63B 1H9RA 2V4IB 3I90A 5I9OA 4K5WA 5HFYA 5LL6X 4DGZA 2VZKB 4IOIE 4HMJA 1K8OA 1EIGA 3AB9A 1QLBB 3A8IE 1EM7A 2EOTA 4K8JA 1VDVA 2M00A 1ET6A 3AB5A 1NR2A 3K5OA 2LUMA 3UI2A 3T51B 4H7BA 2WB1B 1ILQA 1K51A 3NZ3A 4FVMA 4C80A 4LTUA 2LHEA 2HDMA 4BWGB 3NQTA 1OQRA 3KWLA 3NK9A 1X32A 1I4QA 3CKIB 4CQNA 3NUCA 1GB1A 4HAEA 2QJLA 2HCIA 2Z4HA 1MHHE 3VR4A 3MP9A 4BS9A 2KOLA 1KRHA 2WIIB 2RKSA 4ULLA 5KGUA 3K58A 3IKJA 1TWGB 1NYRA 1XCQL 3SFDB 2IGHA 4RH6A 2EXZA 2BCOA 3HUIA 5CYUA 5C5LA 1S5CD 5M3MB 3PUVA 2WKCA 1NI3A 2I07B 2QMTA 4BBSB 1F9SA 1EQTA 1ZUD2 1Y8PB 2W3RA 2NUCA 1EYAA 1QKZA 5J22A 5KYIA 1C77A 2WXKA 4NZLB 1FFVA 3S9WA 1J9OA 1RWSA 4A8XC 4XT1B 5EE1A 2F0DA 1JW9D 4GZYC 1FO4A 4JPSA 4KD4A 4X3TA 2G9HD 1UNSA 1AN8A 3LNNA 1HCZA 4WRDA 3GQBA 3BDOA 2K9XA 3L4PA 1KFYB 4MACA 1R4QB 2NVTB 2MJ3A 1RTNA 3D6WA 1RTOA 5EPKA 4AYBB 5KNBA 1A2UA 4A3JB 4L6TB 1JALA 4QF4A 2QEJC 4JBWA 1QG7A 5KEEA 1WGKA 2R7ZB 1NUCA 2PZTA 4S3SA 1L4DB 2VXWA 1SYBA 2L4NA 3S1MB 2JZPA 3PUYA 3IT4B 1XTCD 1XWEA 1XO3A 4FNFA 1VR9A 1ML0D 3E6ZX 5CMDA 1SB3C 5BYSA 4ZRZA 3C3LA 4QUFA 1K53A 4OW0A 1BNZA 1EOTA 1J7AA 1ZKOA 1RF2D 2ZT9C 1VDZA 5IOCA 2F0QA 4NKLA 5C2TB 2MJ8A 1YN5A 4HKQA 3OWFA 2D5DA 1EZ6A 4HTHA 1IW7D 5FOBB 1V1PB 3MXPA 3S17B 4WIPA 5IGFA 2SNSA 2N9KA 2WDRB 5IODA 3M3YB 1C8CA 4DU9A 1VZ8A 3HVDA 4H0LC 4K8IA 1FD7D 1PDXA 3N52A 1AP0A 3GP7A 1KNAA 1BUIC 3ZJUA 1V1PA 3AEAB 1GUGA 1CK1A 3PUWA 2PMZB 3NRZA 4FXCA 4TQUS 4IALA 1JE4A 1DOLA 5I9PA 2PTLA 2H4OA 1HFNA 2MPMA 1YQ4B 1WVLA 3Q23A 2CU3A 3QG1A 1IW7C 2F4IA 2R61A 1QWYA 2AQ2B 3AE3B 3MJ5A 4KK7A 4GLSC 3P42A 5E1FA 4Y7NB 5KNCA 1TKGA 3EUB2 4OHJA 1A15A 5DM73 3BIID 2V3PA 2INPE 1PTOF 3FAHA 1KTKA 3IAM1 3SK8A 4RGTA 2VZKD 2EJGC 1H9MA 5CBAE 1AZQA 1QOGA 1DYQA 1C4CA 2WDVB 3MXUA 1I6HB 1XCTL 1HFGA 4BY7B 3URYA 1STHA 2E3TA 1XLPA 2Z8LA 5DEHA 4GDKB 1HTPA 3H6MA 2WP9B 3CWIA 3D4RA 3VA5A 2BS2B 3VA7A 1NAPA 4EQPA 5A35A 5M9OA 3MXGA 1LT6D 1BCPB 3C1FA 3TEZA 3HP3A 1SMYD 3R8BA 1BDOA 1SYGA 3J81E 3K5MA 2MGSA 1D5XC 5IT9E 4IKGA 1NR4A 4ZKCB 2D62A 4USAA 4IFDG 5C3EB 1JQ4A 2WNMA 1HQMC 4O42A 3Q6SA 4Q5VA 2IWHA 4C3JG 3SR6A 4ZQ3A 5BMIA 1PTOB 5AUIA 1UEAB 4CKBA 1FYCA 4IFDI 1YMHE 2EYFA 1HTLD 3K0YA 1LO5D 5EE0A 2LFIA 1Q12A 1YJJA 4DNTB 2OT2A 3S15B 3U9SA 4ZOHC 1BOSA 5CR3A 3C2PA 3AE6B 1TYGB 2YYZA 1SMYC 2F0KA 2WP8J 4V0BA 4LK1C 5IGDA 3ZQ4A 3TP6A 3QB3A 1B9RA 3DEPA 3EFXD 3KBGA 3PIP3 1WWTA 2KEDA 2ZW0A 2JA8B 3PIO3 1IYUA 1PZKD 3LWUA 2E2DC 2B2TC 3BK2A 4QB4A 1MGSA 1WTXA 2BA0A 4IUVA 1E0BA 1UWXA 3B2FA 2WXHA 3OPOA 4Q0FA 2L32A 2F0PA 1ENFA 2ENBA 3D8GA 3G7LA 1VF5C 2RSOA 2Y5PA 2F03A 1IKLA 3O13A 3GTLB 1CZGA 1RKNA 3PZ7A 5BN5A 4OL7A 5EGTA 1GUTA 2PZWA 4JK1C 3P1MA 1TJEA 1M4VA 1D5ZC 3CRKC 1SE2A 2WINB 4XQQA 1HXYD 1EZ8A 1Y8OB 1D1KA 5JEAH 4A3FB 3GTQB 2OEOA 1JC7A 4U68A 3DUZA 3R93A 1HA6A 1G91A 2L55A 1Q90A 4M8AA 5IGGA 4ARCA 2IX1A 1UAPA 1HEZE 2C5CA 4K14A 1F2YA 2A6ED 3IFTA 2LEKA 1DOYA 1EWYC 2F0LA 5C6AA 1RYJA 4DAVA 5MPOA 4XWWA 1QOAA 1F77A 5FO9B 3IFDA 2BS3B 4FO2A 1JWAD 5I6YA 1PMRA 2CVRA 2VNUD 2WKDA 3RZDB 1DZ1A 2EYLA 3OMCA 1SE3A 4QUCA 5G5GA 1N63A 4XDCA 1CZWA 3A55A 3D31A 1U4PA 2BW2A 2K22A 4X3UA 1OFFA 3OWEB 2EKIA 4DXFA 2G1EA 3AECB 1ZXHA 2A6EC 5K36G 3S2HB 1AW7A 2F0UA 1XXGA 4LAAA 1HQRD 4HRSA 4P2CB 2QF7A 2CW0D 2NTTA 4BBRB 4CBVA 3I70A 2X69A 3AEDB 3WOFA 3J80L 3AEFB 3H94A 3FEWX 5BYQA 1JWBD 1P7FA 1IGCA 3A8KE 2GI9A 3A7LA 3NVWA 1CZPA 4ZHPA 1VZ6A 3CQZB 1FXIA 1IHZA 3AM9A 3N9YC 1Z47A 1HZ5A 3AE7B 2FMMA 1JQYD 4WWMA 4ZHOA 1NCVA 2J7ZA 5LL6S 2TMPA 1CM9A 2ZXPA 4K5VA 3J7AF 2CW0C 4KGSA 1H9SB 2F0WA 1T5EA 3MTSA 2X6GA 4RFBA 1MSHA 1XYIA 1JB3A 1MVKA 2B2WA 1PTOD 1JOQA 3FRPB 5CV7A 4R8NA 4QIWB 2HDEA 4IFDJ 2OXPA 1BMLC 3K6OA 3TEWA 2E76C 1HZ6A 4B0EA 1XLOA 5AUKA 1D1IA 2PW7A 2F0MA 1H9SA 4M1UB 1NYQA 1RFKA 3B2GA 1C76A 3W2DA 2PO4A 4IQZA 4OVZA 4FYDA 1RD9D 1MPEA 4D2KA 3AEGB 1J8IA 3WDNA 4YTPB 2Y3AA 2FJ2A 3AE8B 4YT0B 1JR0D 3RUZA 4IUNA 4OZAA 3SK4A 2O4XA 1VJKA 2PNRC 2JA7B 2A5HA 3QOJA 4OZBA 3VR8B 4KKSA 5T1IA 5J1ZA 1PTOC 3PV0A 4BY1B 4H44C 1O7LA 5FR3A 2K5DA 1YN3A 2RDFA 4K2KA 1RM6C 3HOVB 3PO3B 2WQYB 3V96A 3C8YA 1CI3M 2BB6A 4DN4M 4XYQA 3RMHA 3AMZA 1A3UA 2RDHA 3KBXA 1MHXA 4C1NK 3MXNA 1PGBA 3DM1A 2XRSD 5FO8B 4NP5A 2K33A 2K05A 1ICWA 2GA4B 4L23A 2V0GA 2KQ4X 1SNDA 3A7AB 4OZCA 1B53A 4KX6B 3W5VB 1N5XA 1C4QA 4CHTB 3WCQA 3P4PB 1LTTD 1T5XD 1XLQA 1PLFA 2NTSA 2K01A 3SVMA 2INNE 1EY8A 4ME5A 1K83B 2NB0A 3SXHA 2WXNA 1E10A 1QOHA 4CJ1B 2KJXA 4YTNB 2QKIC 1L0VB 4B9WA 4C3IB 5EE9A 4J8QA 4OIKA 2JYOA 3NVVA 1I4RA 1EEFD 2O2LD 3GTKB 1SDFA 1FNUA 5EKLA 3NVZA 1STBA 1TWFB 2ON8A 3E0JA 4E6IA 3HG9A 1D2BA 4OO1G 2B8GA 3P63A 1LTSD 1EU3A 4LJZC 4CJ0B 2OHFA 2EJFC 1OO9B 2NN6G 1LV9A 4ZAIA 4OO1I 4KTAA 1M8AA 2KHSA 5CV5A 2G9DA 2ZW1A 1ZXIA 4FF3A 1FNWA 2R3ZA 2DYOA 2J42A 2NN6I 5C0XG 1OXUA 1GHJA 4L2YA 1Z7TA 3NPPA 4XWTA 1ZOYB 3DWMA 2A74C 2WXIA 1O7YA 3BDLA 3K7AB 5C0XI 3H0GB 3I91A 3LB8C 4XDXA 4YSXB 2GB1A 2I46A 3TBIB 4KKJA 3J7YW 1TIID 3ZGZA 4PMCA 1AEXA 3R2IA 5E4XA 4NMZA 2CHBD 1WTPA 5C4JB 3FPUB 5HURA 1F2MA 4RCNA 4XQNA 3KLSA 1RCVD 3KUPA 3OSOA 2LMCA 2BYTA 2B2TA 5TSSA 1PFNA 3LX0A 4XT3B 4KGRA 2K32A 2AUJD 3CU7A 3RPFC 3Q8EA 1IL8A 4IZ8A 2PCFB 4RHRA 5JVG3 5T8IA 4X3KA 1AFPA 5EPJA 1B9MA 1STNA 2JEBI 5D7GA 1RDPD 3L9AX 3IAS1 5BN4A 2B76B 2K5QA 3NUHB 1I7HA 3GTOB 2K0PA 4KV6A 2B2WC 1ZYRD 2C9OA 2JWUA 1O7ZA 2LS01 2SOBA 2I38A 3MHBA 2ACZB 4L8JA 1F2RI 3Q8CA 1A6XA 1IBXB 1FCLA 2XWBB 1K50A 2KQ3A 3VYRA 3GV6A 2F0HA 2AQ1B 1D4BA 2B2VA 4HEDA 1UGJA 3EJIA 2Z1CA 3PO0A 4UAIA 3VQIA 2ZXOA 1IBXA 4A55A 2AX5A 3NXWA 4DQOC 1ZYRC 3P75A 4WAFA 2MP1A 1J7CA 1PZJD 4WJWA 2QDBA 1KH0A 4XDDA 2HTME 1TVXA 2LFNA 1GAQB 1NENB 1YNND 2RSNA 4V190 2AUKA 2WXMA 3DEOA 4RGNA 1CHQD 2M19A 2PKOA 5C4XB 3DHQA 3V3XA 1I4GA 4RNAA 5H92C 3TZUA 4RF0A 2RMMA 4DXGA 1LTAD 3FMCA 1Y56A 3KF8A 4LK0M 4DFAA 1D6EC 1ET9A 1XF5L 1SNPA 2JQRB 2MEKA 4CGYB 1CTMA 1TWCB 3H8HA 1I50B 1E0ZA 4HSVA 2JSVX 1VLBA 5BMGA 3I57A 4YTMB 1LTBD 1MSGA 3JAME 4U673 4ARIA 1YNNC 2LGIA 2LHDA 2EZVA 4ABNA 4DF7A 1E6EB 4ITKA 1NVID 1TS3A 3UI3A 4X3SA 3KLRA 1CHPD 1T6BX 4KN7C 1SBBB 1I4HA 4ZUJA 4KMUC 2JA5B 1FEHA 2DYMA 5EKIA 2EYMA 3PO2B 1SYFA 2NYZD 3BVMA 3HEJA 1ZPSA 4C7ZA 2BB5A 5FK9C 1NSNS 4DK1A 4WURA 1E2WA 2Y0SB 3VYTA 4NJCA 3J81L 5IT9L 1WRIA 1EY6A 2SAKA 5C0XJ 4HSPA 5E3FA 1QF6A 3S16B 5M5XB 1EU4A 2RQXA 2XWJB 1YQ3B 5C4ZA 2KAJA 2EDGA 2RVLA 1E7PB 1B9NA 3TEXA 2J0TD 4IN3A 1TS4A 2AQ3B 2JXTA 2K5PA 2FHTA 3K57A 2F0IA 1IGDA 2ONQA 3VR6A 3TZDA 1PZID 3K5LA 1U4MA 1ESFA 3P4RB 4J6HA 1KF6B 1W6KA 4ZLTF 2JE6I 4YWGG 3AEEB 1KLUD 1ZEQX 2BDNA 2FUG1 2NVYB 2MJEA 4BA2I 4Q2JA 1RJTA 3BZDB 4RAUC 2MH7A 5BYRA 1TZOA 2BDOA 2BOSA 2DY7A 1FCCC 1PDQA 1PRTF 3AV8A 2IL8A 1Z6HA 3ZJVA 2ZXRA 2F3WA 1PXUA 4ZRQA 3E5SA 2QIEB 3AE9B 2K7VA 1STGA 1ROEA 1FRDA 4A3KB 1EEID 3IXSA 4RA8A 4NAMA 5CV9A 3NSWA 3D3RA 1DOIA 1PUTA 4KKTA 2IX0A 5IGCA 3Q0AA 4R8IA 5G5HA 2F0EA 2IW3A 1SNMA 1BQQT 2W54A 1QOFA 4IDIA 1IUEA 2X6LA 1LLRD 4A3IB 1PRTB 1TKYA 3ZJTA 4C56C 1GUWA 2XIWA 2XN9C 4TQ0A 1SYDA 2J53A 2J52A 2B2VC 2E2JB 1YJIA 5CV6A 4EQOA 1W6JA 1TY0A 5C44B 2IX3A 2D9UA 3U4EG 1FMAD 4N59A 5C3JB 2YEPF 2NMQA 4IFDH 3WOEA 1FGBD 3G6JB 1Q10A 2PVGC 2WDQB 3VRAB 1WTRA 1DONA 1B1ZA 2WS3B 4H13C 2E6XA 3T53B 3VR9B 4F8MA 1TY2A 3RD4A 2DNCA 5I2XA 1C9FA 1L4ZB 1PFMA 4K5XA 4HKZE 1S5ED 2SDFA 2Z4IA 3AH7A 3OOCA 4B08A 1CJEA 1DOKA 5I6WA 2MUYA 1CT1D 1F9PA 1ILPA 3GV3A 2L12A 5CV8A 1KLGD 1BUVT 5JPNC 4RHSA 3MVVA 4KJOA 2IGGA 1HA5A 4FXDA 2KMMA 3NVYA 3VR2A 2YEPB 4NW2A 3HGBA 2BBCA 1B3AA 3HVZA 1GXDC 4G7OC 4DNRB 4KKUA 4IURA 3SFEB 1JCKB 5FLXE 2N7JA 1V8CA 1ENAA 4K2LA 4CJ2C 4KN4C 4JE3B 3NQIA 4PV1C 3AE4B 1YNTE 2KCNA 1EY0A 4KI0A 3BS1A 3S14B 2TSSA 3S1NB 2J4XA 1N60A 4RKLA 1K52A 1QOBA 4FP5D 3EA6A 2EY1A 3TDQA 3MC0B 4N58A 1A3VA 2EE1A 3NP8A 3T13A 1MD2D 2DN8A 4A3GB 1EY9A 3MAQA 4C1NI 4FF1A 3QO2A 3T56B 4FXKC 2EVBA 1L6VA 1TQOA 1PFBA 4ZRPA 1T3QA 1VRAB 3J7AV 2F0OA 1BBXC 5GXGB 3W3AA 2MJDA 3K59A 3MFGA 3DWQA 3M85A 3W1SA 4C3HB 1JWMD 1G8ZD 3TMEA 2PW5A 3FC4A 4UDUC 4RGOS 4OIJA 1L6UA 2NVXB 3FILB 4KY5A 3GTGB 3D4WA 2L1BA 4ZUIA 5D3DA 4US9A 1LT3D 2QSDA 5IGBA 3GB1A 1SXTA 2Q5WD 2KA7A 4PNYA 4KJNA 2W82A 2DWQA 1U4LA 3EQLC 3FILA 1C78A 5D3IB 2B2UA 1BO0A 5K36H 1GOZA 1WD0A 1WSPA 3PUZA 1EY4A 3Q69A 5C3XA 5A2QE 1V8QA 3BDCA 3QWNA 4DAYA 4ZYSA 3P20A 3S1QB 3NTKA 1HUMA 2L0CA 3H91A 4O1NA 1HUNA 4YSZB 1PRTD 4A3MB 3FPPA 1G2SA 1Q8IA 1N61A 4KY6A 3HOUB 3V05A 2R92B 4XQJA 5HG2A 1VMCA 1DOMA 1HRJA 2KN4A 4F7XA 5JPMC 3E56A 1EY5A 4G7HC 1ZDVA 5ELEA 1MI0A 4A3BB 1R7SA 2N9LA 4GDLB 3VR5A 2I2YA 3M7NA 1NEKB 4QMGA 2BT6A 1L0YB 2GRIA 2FE8A 3AMUA 3L7ZC 2K03A 3KWVA 5JXVA 1A70A 2NZ1D 5ISRA 3FDTA 2R6GA 1B2TA 4TKOB 3T16A 1LABA 2F0NA 1PRTC 3DWPA 5ELFA 1LACA 2V3NA 4L1BA 5KNDA 1EQVA 4DA2A 2L52A 2IT1A 1Q1EA 2A6HD 4EVOA 1KABA 1N5WA 1VZ7A 3NBIA 1GHKA 4WQMA 3LWEA 2WU2B 1SYEA 1SJHD 3MWYW 1XX8A 3AEBB 1KAAA 2D5GA 1G2TA 1Q3LA 2PLPA 1OQQA 3I3CA 1VF7A 3I4MB 1QB5D 2PZUA 4KGTA 1GUOA 1TR5A 1G6ZA 4C3IG 4KHZA 1BR9A 2H1EA 2VB3X 3HOWB 2QCPX 4REZA 1CFMA 2LMCB 2ID0A 2DNEA 1EWCA 5ELBA 3R3OA 3AN1A 3AE5B 5I2YA 2HQEA 4EE2A 1S5FD 4K6DA 2K5WA 1WD1A 2A6HC 4MN3A 2KECA 4MHEA 4A3EB 4WH4A 3AU7A 4ZKBB 4EQNA 1P7EA 2WXFA 4LMQD 1SSOA 4KKIA 2HUGA 4PMWA 3LYYA 1STEA 3J9CA 5LNK1 2KCCA 4F87A 4KD3A 5J39A 3NTHA 1JOOA 5KIXA 2IDYA 5ELCA 2JP1A 2RBMA 3ND9A 3I72A 1SNQA 5G3LF 5DM63 1JORA 5KYLA 4P6VF 2JA6B 3IT6B 1OXVA 2K6AA 1MBYA 1FRRA 2KACA 2JXMB 1ZP0B 2K28A 4XXEA 4BA1I 5NUCA 5M5WB 1WTWA 1X3QA 2PMVA 5M3FB 1TS5A 3ABVB 2D2CC 3I4LA 4HCSA 1YNJD 2A68D 2W3SA 4RKBA 4RCOA 1BF4A 3D4DA 1CQVA 2L9HA 4R3DA 1D5MC 3SR1A 3BYTB 2M56B 2JYTA 1B4OA 1ONLA 1Y69U 1GPXA 5E4WC 2VB2X 1AZPA 3Q22A 4OO1H 1EIHA 3M4YA 3C46A 1IKMA 1SYCA 3SE0A 3A8JE 3F2UA 2EJMA 1I6VC 2NN6H 2E75C 2KEEA 1PGAA 2EPBA 1JICA 4RWSC 1LT5D 1V1OA 3PUXA 3AE2B 1AYFA 2WV6D 1EYDA 3HS0C 3M7GA 1GJXA 2O5IC 5C0XH 1S4ZA 3RFZB 2EY2A 1Y8NB 1YNJC 2A68C 2L11A 4Z9CB 3L3OC 2WACA 3NTIA 2JEAI 2CJOA 1Y1WB 3TUOA 4HMIA 2JYEA 1UUPA 3QIAA 2M9VA 3RZOB 3ZYYX 3NWTA 2B2UC 2H89B 1JWSD 1XLNA 1C48A 1RODA 1STYA 4N9PA 5CBEE 1EY7A 2EYPA 4G57A 1QE6A 2HDLA 2QILA 3BVZA 3NWSA 5BMHA 4DAPA 3P4SB 1PYWD 1JOKA 1ACCA 2K04A 1HHVA 1JWUD 5E6JA 3DWAA 4TSSA 3U7ZA 4N6EB 1SAPA 1QNKA 2BTEA 2DLBA 3ETRA 1DD2A 1BCPF 3JAML 4ID6A 4EGVA 1E9MA 3QJYA