1I4QA

Crystal structure of staphylococcal enterotoxin c2 at 100k crystallized at ph 6.0
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
239
structure length
234
Chain Sequence
ESQPDPTPDELHKSSEFTGTMGNMKYLYDDHYVSATKVMSVDKFLAHDLIYNISDKKLKNYDKVKTELLNEDLAKKYKDEVVDVYGSNYYVNCYFSSKDNGGKTCMYGGITKHEGNHFDNGNLQNVLIRVYENKRNTISFEVQTDKKSVTAQELDIKARNFLINKKNLYEFNSSPYETGYIKFIENNGNTFWYDMMPAPGDKFDQSKYLMMYNDNKTVDSKSVKIEVHLTTKNG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of staphylococcal enterotoxin C2 at various pH levels.
pubmed doi rcsb
molecule tags Toxin
molecule keywords ENTEROTOXIN TYPE C-2
total genus 67
structure length 234
sequence length 239
ec nomenclature
pdb deposition date 2001-02-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01123 Stap_Strp_toxin Staphylococcal/Streptococcal toxin, OB-fold domain
A PF02876 Stap_Strp_tox_C Staphylococcal/Streptococcal toxin, beta-grasp domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.110 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1i4qA01
3.10.20.120 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1i4qA02
1XTCD 4TSSA 2IPKD 1JWMD 4RFBA 1BCPC 3R8BA 3W2DA 2J4XA 2AQ1B 2AQ2B 1SJED 1D5ZC 1I4RA 2SEBD 1GOZA 1DYQA 1TY2A 5ELFA 5ELBA 5ELCA 3R2TA 3BYTB 1FNUA 5ELEA 1S5FD 5I4DA 1I4HA 3BVMA 2QEJC 1RDPD 2NTTA 1I4QA 1PYWD 1ENFA 1PRTC 1RD9D 1CK1A 1B1ZA 1AW7A 1PRTD 1SE2A 2RDHA 2WV6D 3BVGA 1UUPA 2TSSA 4RGNA 1JCKB 3MFGA 1SXTA 4L63B 4RGOS 1ESFA 1EFID 1FGBD 1JR0D 1CHQD 3TSSA 1CT1D 3O13A 4RGTA 3URYA 3KLSX 1QILA 1TY0A 4RHRA 4K6LA 1PZJD 4RHSA 1LTSD 2XN9C 1PTOD 4DXGA 1S5CD 1SE3A 1LTGD 1LTAD 1EEFD 1L0XB 1TS2A 4L6TB 1F77A 1DJRD 2ICIA 4RGMA 1PZID 3BYYB 3EFXD 1V1OA 3R2IA 2AQ3B 3DWAA 2XRSD 1LT4D 4BWGB 1KLGD 3CHBD 1EEID 1STEA 5FKAC 1SJHD 1FNVA 1FNWA 4NZLB 1BCPF 3BZDB 1TS4A 1LTID 1D5MC 1EU4A 4RCOA 1JWUD 1G8ZD 4Z9CB 4ZYSA 2XRQD 1HTLD 1PRTF 1HA5A 4O1NA 1EWCA 1T5XD 1PRTB 2QILA 1ET6A 1SE4A 5FK9C 4C56C 3BVZA 1UNSA 1LTBD 3EA6A 1HXYD 1RF2D 1LTRD 2R61A 1JQYD 1V1PB 3DWQA 1CQVA 1BXTA 1YN4A 1AN8A 1PTOB 1PZKD 1D5XC 1LO5D 1LT6D 1PTOF 1TS3A 2XNAC 1S5DD 3OWEB 1BCPD 1ET9A 1KTKA 1S5ED 1BCPB 1TS5A 2NTSA 5D3DA 5D3IB 1JWSD 1FD7D 2Z8LA 1MD2D 1V1PA 3MC0B 1L0YB 4OHJA 1PTOC 3GP7A 2G9HD 3DWPA 1I4PA 2CHBD 1YN5A 5TSSA 4RH6A 1YN3A 1PTOH 1SEBD 1LTTD 2IJ0A 4UDUC 1XXGA 2RDGA 1EU3A 1I4GA 1CHPD 1LLRD 1HQRD 1SBBB 3SEBA 1LT5D 1RCVD 1LT3D 1KLUD 1I4XA 1D6EC 1B44D 5ELDA 2O2LD 1S5BD 3V05A 4DXFA 1M4VA
chains in the Genus database with same CATH superfamily
4KLKA 5BR8L 1KXLA 1EWYC 4HN7A 3J81L 4XT3B 3TIXA 2JA6B 1A3VA 1NBWA 2CKZB 4C3IB 2KO3A 3KLRA 4JCVE 1VMPA 4ZQ3A 1WVLA 2JRHA 4FHKA 2KK8A 4E71A 5CORA 4JI0L 3S1MB 5GMVA 2JEBI 5ELFA 5EDSA 4A4IA 4IUTA 4JI5L 1R4NI 5AFWA 4POFA 1MSHA 2XWBB 4DV6Q 1V49A 3AU5A 2B2WC 3TEHB 2N9XA 1S5FD 3A0JA 3B2GA 3PIP3 3DBHI 1XNQQ 3UDXA 5KHQA 1KDBA 1PYWD 2G9DA 5FO8B 3AULA 1A3UA 2FXQA 3LB8C 2C60A 4BKSD 3AFQA 4A3MH 4M8NA 3I3CA 4EFOA 5DAUA 3L7ZC 1TYGB 2PI2E 1HJPA 1UBQA 3HOXH 2IO3B 2RVLA 1X32A 3PO3G 2KFKA 3V62A 3JAMc 2MPMA 1IGCA 3RMKC 4BFRA 1SXTA 1HZ5A 3QWZB 1G6JA 2Q8RE 3RNBC 4LFBL 4XYCA 2W3SA 2E2JB 4IKGA 4RGTA 2PW9A 4R4QA 3PRZA 3PT2B 4XE0A 2ZPYA 2N8NA 4YY3L 2CW0D 4GS3A 4P71A 4P72A 1TKGA 4M02A 2K1FA 3PPAA 4B3SL 2WKDA 2K1BA 4OIJA 4XYQA 1SE3A 1E6EB 1JWAD 1MVKA 3GZNB 5J1ZA 2LZ6A 2N9KA 2ID0A 2IO1B 2ZVOA 1J6QA 3DDCB 4YWGG 3FKYA 4MGZE 4IFDG 4EGVA 3NVYA 3IFWB 2V3NA 4RGMA 1NY4A 4II3B 4AJYB 2TMPA 1CKNA 3T4AC 4LF6Q 5FOBB 3NVVA 1XLNA 4LNOA 1FGUA 1UE1A 3KVFB 3QHTA 1ZP0B 1EEID 3MVVA 1BBWA 4N9TA 4HKZE 3ZGZA 2B2UA 1SIFA 2LVOA 3PF5A 1D2BA 1N5XA 2DENB 3HRZC 4YTNB 1FNWA 2NYZD 3DEOA 3ZXVA 2A69C 2KTFA 2WFWA 2WU5B 4LFCL 2Y5BB 2ZTCA 1JJCB 3HP3A 1JE5A 4B9WA 5EBCA 2NB0A 1JOQA 4KIKA 2J0TD 4F88A 5FLXc 4TUUA 2I1JA 1HTLD 3A55A 3UF8A 1N5WA 5BN5A 4LF8L 1QOBA 2CS4A 1OXXK 3LYYA 3HOXG 1UF0A 4BY1H 4QIWE 1LTBD 2K5VA 2V4IB 3HUIA 2KXJA 2EYLA 2J53A 4KSKC 2H5XA 4OWWB 3A74A 3PIPA 1E10A 4ZYNA 3HEJA 4DK6C 4HWIB 1EY4A 1YNNC 3I2ZA 2LASA 5C3JB 2M1MA 2C5CA 4A3GG 4X64L 2C9OA 3Q0AA 1WTQA 2PTLA 1MIUA 1MD2D 4OWTB 1VQ7A 4JI3Q 1ZYRD 2WHIA 2G4DB 4GOPB 3AE6B 2WP8J 4MM3B 2E8GA 3ZJUA 3GP7A 3VVWB 4IUPA 3AEEB 3A56A 3TEYA 1YN5A 5JJIA 2HTHA 2K6QA 5IYDG 3RMHA 4C00A 1X65A 3Q8CA 2M19A 2YVCA 2JA8H 2GI9A 2KCTA 4WAFA 3HOUG 3W1BA 3QX1A 1C3TA 5EBDA 3J80c 3AV8A 4C4VA 4N59A 1P3QU 2PPHA 3G4SA 3PQIA 3BINA 4OWXB 4GDLA 3V05A 3U8ZA 4A3IB 1B70B 4MSQB 4NAWB 2KN5A 1BVSA 3NK9A 3K5MA 1XTCD 2L0TA 3M3JA 4GLSC 1DOLA 2RD0A 3D4WA 4JI7Q 1BCPC 1WTRA 3T3OA 4KY6A 4MTNA 3NUHB 1QUQB 1W2BA 1J7CA 2KDEB 2D62A 1J8CA 3PO0A 2I2YA 2BDOA 2CW0C 5LNK1 1PVOA 3ZJYC 3EFCA 1EM7A 4M00A 4IUVA 3I4LA 4CDCC 2BB5A 1I94Q 4EZJA 1FNUA 3FRPB 1QQRA 1I4HA 2EKIA 1VQ8A 1WYGA 3FKIH 2WXMA 2R7FA 1R9TB 2OEOA 1I5FA 2NVYB 3F8TA 1WR6E 2RMMA 3X0WA 1CI3M 3QJYA 1K8OA 2V4LA 1MG4A 2F3VA 2UYZB 1STAA 5IP4D 2VRRB 1KQSA 2VQFQ 3TS0A 1YX5B 4XWWA 4QQBX 5M9OA 4BBSB 4FA6A 4UHVA 1GUOA 2NZ1D 5KNDA 2RSUA 4RGOS 4RF0A 4HTHA 3J9CA 4DXAB 3CW2C 3CC7A 1KC8C 4ZUIA 2N0SB 1HZ6A 2F4VL 1SNPA 1V81A 1SSNA 1JJGA 2VQFL 1PH2A 4MGKE 1I35A 1TWFB 4C2MH 1C8CA 4CDDC 3A33B 3T8MA 1WWTA 3GTKB 1EEFD 4QJFA 4ANXA 3SK4A 2RR9A 1IP9A 3HG9A 3CQZH 4L6TB 3K81C 4DDID 2HDMA 3IBEA 4DDGD 1CUKA 4C3JB 4YCWA 4B3TQ 3GTLB 2N7DA 3PUWA 2VW9A 2L1BA 5KIXA 3PRPB 4ZLTF 4RM8A 2QDLA 3I4NB 3SK8A 3M4PA 1SFOH 4KGTA 5G55A 2GBJA 2VQEQ 3I8ZA 1EF5A 2AHOB 3G71A 3PS6A 3DEPA 3W3AA 5EKIA 2MJDA 4BZAA 1YHAA 3DVGX 5BMGA 4DF7A 3HKZE 3NQIA 3T1YL 2MP2B 5IOCA 3IFDA 4FADA 3T56B 2DY8A 2QILA 1IXRA 5JOBA 2WKCA 3ZUNA 3MXUA 2AWNA 4YCUA 1XD3B 2LVQA 3L08A 2WS3B 1HXYD 2L9HA 1EY5A 1NTGA 2WINB 4W9EA 3W1SA 3ZNGC 1FYCA 4GKJL 3HHMA 4K7SA 2WQYB 2Y5PA 3SE0A 1PTOF 2C7MB 5IP7H 3Q8EA 5MPOA 4IJLA 3L2PA 1BCPB 3CKIB 2AMCB 3TP7A 1U4RA 2R92G 1JALA 2JQRB 4NJ6A 3KLWA 1TWAH 1VF7A 3EIVA 2KT7A 4M8MA 3R66C 1L0YB 3GZNI 1Q1EA 2Q8IB 2WDRB 2CHBD 2ZCCA 1SGHA 4JI8L 1YN3A 4ANWA 2VS1A 2AX5A 1FIQA 5BMIA 1JMCA 2E2IH 3HOWG 3NENA 3U50C 1DOIA 2BPSA 3TCAA 2JA6G 2BYEA 1UWXA 2OJRA 2ZJDA 2GBMA 4US8A 1LLRD 2LGIA 1LT5D 3W5UB 3GD7A 5AZHA 1VQLA 4DAYB 1EIGA 1E7UA 4KKTA 2LMCA 3QO2A 4BS9A 2B2TC 1I50H 1A6XA 4USAA 2O5JC 2F52A 3FILB 2B2TA 2R7ZH 4DV3L 1TZOA 1NEKB 4XQNA 4MJSA 3I5JC 4YHHL 1T0YA 3GTJH 2ZPNA 1PGAA 3H6MA 1WZ0A 4JBWA 2DN8A 5IT9E 3BVMA 2X38A 1MPEA 4DNTB 1KHIA 3GTLH 5C44B 5T8IA 3OSOA 1LV9A 1M8AA 1E0ZA 3A5UA 3CCMA 3D0FA 2EXDA 4A3FH 1MBYA 2F0TA 3IG3A 4PYZA 4DK3C 1JCKB 3K9PB 5BMHA 3GTOB 4IDIA 1MJCA 1YQ4B 3GTGH 2AWTA 1NNXA 3NZUA 1Y1VB 3L10B 1JR0D 5CYUA 2DWQA 4ME3A 4A3FG 1BO0A 1HE8A 3PHXB 2MEKA 4I65A 3I56A 3A4SC 3H3VH 3IAYA 3DXJC 3CMAA 1N60A 2JWZA 2LSSA 1HPCA 1LTAD 4XZ4A 4YTMB 5C0XI 3HOYB 2DYMA 3IT4B 4JGHB 2CH4A 3PUYA 4NPSA 4JLCA 3D6CA 2RSNA 1WGHA 3RI7C 2EJMA 2HIXA 3ULLA 3H0GH 4OIKA 3KK7A 3HVZA 3TREA 1VMCA 1PMRA 1Q12A 3HOZG 3A5ZB 2KA7A 1H9KA 3M7NA 2JE6I 2KVMA 1ZDVA 4A3BG 4P2CB 1II3A 1BUIC 2WLBA 1K3RA 3KWVA 3I7FA 3RZDB 2MQHA 3S16B 3BZKA 4WWNA 3WAOA 1WGRA 3FPUB 2A1AA 2G3QB 3GTPB 1TS4A 1QOGA 3VFKA 3ALBA 5EE9A 4HR7B 4RCOA 4YHHQ 2XIWA 1T5EA 1L0WA 2WX1A 2PNHA 1WGDA 1KDCA 1HFGA 4RG1A 1S72A 3F2BA 1I6HB 1DD2A 4P75A 4O1NA 2M56B 3QARA 5H8YE 4GDLB 2KYWA 3MC9A 1V9PA 5IWAQ 4ULLA 4EZKA 4MGIE 2JX5A 1STBA 2V0GA 3FEWX 4LNIA 1OXTA 2KQ4X 3CU7A 5C5LA 2R92H 3TJPA 3FKIG 5CBAE 5E7NA 1LT6D 2KJHB 4HEA1 4LNNA 2O6VD 3H91A 4X3KA 5IOIA 4ME5A 4HCPB 4PS7A 2HQEA 4WJ3M 1SYGA 3P75A 1YJJA 1D3ZA 2LXAA 3NTHA 4K2KA 4UP9A 4ARCA 2K8HA 3H3VI 2L76A 1E9MA 4GN4B 5CV4A 1TWCB 3PZDA 2ON8A 3IFTA 3DWPA 4IPCA 1QLBB 1WTVA 4W9IA 2E76C 4S0RA 2JA7G 2CJNA 1DZ1A 1DXMA 1UH6A 2D2QA 5EE1A 1F9PA 4BBNC 1SEBD 4DHJD 3J80L 4FHJA 1YEZA 1EUVB 2EKEC 2M00A 2DUDA 1ESRA 3ZRCA 4GXBA 4BBNF 2PO4A 1CHPD 5I9OA 3SU8X 1S4ZA 1TWGH 1TWCH 4DR3L 4G0NB 4MEMA 2XTIA 4HIMA 4FF3A 1L1OA 2O2LD 3S24A 2G4SA 1EQVA 1STHA 3DMUA 4R8NA 4IOCA 4PK1A 2O4XA 1SE9A 1Q81C 1Q82C 1X54A 4ZCKA 1V80A 1WI0A 2HCIA 1WIAA 2FBWB 2I1KA 1JWMD 4RM9A 1PH8A 3S2HH 3AE1B 4B0MA 4A3CH 2IGHA 3CF5A 2HD5B 4YCVA 1OQYA 3PLVA 4EKUA 3KDFA 1Y8NB 1U4MA 3LNNA 1Z9FA 3OJ3A 5M5WH 1NYRA 1ROEA 1V86A 4K3CA 5CHVC 2WB1G 4MH8A 3P4RB 4G57A 3NZSA 4M0WA 2JYEA 4II2B 3KBXA 1S40A 4TQ0A 3KOJA 3EHVA 5KNCA 4J8QA 1WTPA 3RFZB 2M4NA 3BVGA 2RDHA 2UXBQ 2L12A 4GNXB 3CC2A 2EMTA 1PQSA 4DQOC 1YNND 3U30A 3AU7A 2EDGA 3MFGA 2WDVB 2IYDB 1EQRA 1WX7A 1Q46A 1EL0A 2D0PA 2M2LA 4B3RL 3DLLA 4NB3A 3FVQA 1WGKA 2IY1B 4US9A 1EY6A 3TSSA 3V6CB 2DNCA 4RHRA 2PVGC 3CPFA 3NSWA 1XX8A 2E2HB 5E3FA 1P0RA 2BKRB 3C2PA 4O2DA 3S2HB 2JYOA 5J2RA 2EQSA 4XYOA 2BA0A 3P20A 3GTQH 2K03A 4ODGA 5LMNQ 1GUAB 1HZAA 1L4ZB 1WYWB 1C7YA 4JC0A 3NBIA 4DU9A 2CFMA 2QF7A 4YWMA 4A3MB 1F77A 4LF7L 3B0AA 1XMOQ 2PVOD 1PZID 2RDBC 5DPWA 2L15A 2N3SA 4DK0A 1A70A 5AEKB 3R2IA 4JVZA 2K5DA 3N1YC 4IFDH 3CCQA 3C0RB 1NI2A 1S3OA 5JH5C 1E8YA 2Z9HA 2BS4B 1WX9A 2K32A 2CR5A 2WNMA 1QF6A 4LF7Q 4KY7A 1SNDA 3Q3NC 4HXDA 2KC1A 1LTID 3A9JB 2D3AA 4C3IH 3L9AX 2BWES 1C4PA 1R7SA 2DAJA 2XBBC 4G3XB 3S1NH 3C1EA 4A3LH 3WDNA 2EYHA 2F0HA 1KF6B 3P4QB 3TUOA 4W9GA 5EE3A 3UIPB 5FK9C 2F4IA 3QCAA 1T6BX 3RN9C 3BVZA 2R92B 1WZ3A 4MNOA 1ZKOA 1ZW7A 1TT5B 3V6EB 4E3CA 4J6IA 3IAM1 4X57B 1H95A 1TS5A 4XWTA 2R2OA 4Y7NH 2B3GA 4LDTB 3ZJTA 2L4NA 3ML9A 1FD7D 1ASYA 5HY6A 1UEAB 3K57A 4X3SA 2VB3X 3KYHC 4KJNA 2BQQA 2J0MA 2JSVX 1I4PA 5E6JA 4HSVA 5TSSA 5BN3A 1FRRA 4AH6A 1WH3A 3ER0A 5EPJA 2NCNA 5FR3A 1EOVA 3W5OA 4XDDA 2QGQA 3P4PB 1WMHB 1M90C 1C78A 1VZ7A 2F0WA 2F4VQ 1PGBA 3AE2B 4DV4L 3GQBA 1JOKA 3HOYH 3S2AA 4PS8A 5C4ZA 2IZVB 2MCNB 4G7HC 3V3XA 2RBMA 4KV6A 1E3PA 5L83A 3UQBA 2JA9A 1IBML 5KRUA 5C44G 1SJED 2SEBD 1GKHA 1J7AA 1RTNA 3SFDB 2Z59B 2LXCA 3FMCA 4KZCA 3AB5A 2L05A 3KF8B 3ERSX 4YSZB 2JZ3B 4R9WA 2VZKD 1AZQA 1WY8A 5I6WA 1VQNA 3RLNA 2ZXPA 2DBYA 4JI0Q 3KF6A 3H3VC 4DR6Q 3S15B 1RD9D 1SYCA 5ELOA 2XVSA 3LWEA 2ZJPA 1B8AA 3ULPA 2MJEA 4MSMB 2WX0A 3VR6A 2WXLA 4KTAA 4MH0E 1VQFA 2CVRA 3R93A 2PQEA 1SMXA 4X62L 3NEMA 3UI2A 3L16A 4ANUA 4BBRB 4D2KA 1EO6A 1QNKA 4H0LC 1HA6A 4OL7A 4FN2A 4X64Q 1IBLL 1GPXA 1QILA 5K36G 3ZYYX 4NJCA 2K33A 1RKNA 4F8CB 4L5SA 4IN3A 1X3QA 2JXXA 3A1QA 1I50B 2INPE 2WDQB 5IGFA 2B63B 2CCZA 3C19A 2KHWB 4KV2A 2R7DA 1SDFA 5IGEA 2HHHL 4NXMQ 1RL2A 3GTKH 4A3BB 1SNMA 4CKBA 2CH4W 1ENAA 1NVID 1DOXA 1HEZE 2JY6A 2ZJRA 2UU7A 3TEXA 4LCDE 1UWMA 3UE0A 3B6YA 3RNUA 5DM63 4EVOA 3CC4A 1KLGD 2E2IB 1UAPA 2K8CA 5C4XB 2WDTB 4JL9A 4L1BA 2LY7A 1T3QA 1NDDA 3VUXA 3D4RA 4KGSA 2QCPX 1UD7A 1OGWA 4MJSB 4WURA 1EU4A 1WM2A 1P1AA 3NZ3A 5DPRA 4OGQC 4JOIC 5GROA 3AEDB 3PMFA 5CHWA 2OJWA 1X6OA 3PUVA 1HNZL 5M3MG 1DGJA 3MAQA 2AKWB 2HT1A 1WXQA 5IYCH 1LXDA 3PLUA 2JA5H 2FUG1 4MELA 5AJ3Q 1JW9D 1RF2D 4TQ1A 1LTRD 2QA4A 1TBEA 3I73A 4RKLA 2WACA 1AN8A 1PTOB 4MZ9A 4UY8C 4KZ0A 3S2DH 4IPDA 2FMCA 3H6NA 2JA7B 3DQVA 1EQTA 2FCSA 5DPTA 4FXCA 4KI0A 1Q90A 5KEEA 4C80A 2FIFA 4GDKB 4URKA 2L0FA 3OOCA 3Q8DA 4DUYL 2M0AA 4B08A 1O7YA 1P8LA 1F2RC 2JA8B 3KDFB 1GC6A 2C7HA 2W82A 1NUCA 1LM8B 1P7FA 3I4NH 1UGJA 3UGBB 1KNAA 1AEXA 1IYUA 1ASZA 4HLEA 4C3IG 1F2MA 5FLXL 2NZOA 4EQPA 1BBXC 2ZXRA 1M94A 3L54A 2KCNA 2VNUD 2K28A 4C3JH 2LGSA 1B44D 4R8IA 3A9JA 1VCIA 2KEEA 3VH4B 2Q2IA 2A8VA 1R4MB 3D32A 3MP9A 1M4VA 1AFPA 4GKKL 3AN1A 1D7QA 1A3TA 2EYMA 3I4OA 2WB1B 5DEHA 1XMQQ 3VUYA 3W2DA 3F2UA 1U4AA 3D6WA 3OG5A 4P73A 1I4RA 2K5WA 4U673 3PTFC 3A8JE 5CR3A 1QZHA 4HDOA 3SHQA 4J6HA 5CMDA 2HDEA 1B9MA 2NN6G 3MXGA 2FJ2A 2JPHA 1TWHH 5HHDG 1RDPD 3K7AB 1IBXB 3TP8A 2GOWA 1C76A 2VZKB 4HJ7A 4OONA 1VR9A 2KTRA 3DVNU 5JEAJ 2CJOA 3E0JA 3VHTC 4JI6L 2NVYH 2DAFA 2Y0SE 1R9TH 1V43A 2XWJB 2MJ8A 5D7GA 2X8XX 4JBJA 4W9FA 4I6PA 3WALA 4UP7A 3H8HA 2PI2A 2BGFA 3DVGY 2F0FA 1QB5D 1Z6HA 1M1KC 1EFID 4A3MG 1AYFA 5E6NA 3TEWA 1HUNA 2MFIA 4PMCA 2UU9L 1EWHA 1TY0A 4IUNA 2HUGA 5JHAA 4JV5Q 3EFUA 4CKEA 1SYDA 4BXXG 1V8CA 4GGQA 3K7UC 1KRHA 3M4OH 3K58A 2HE7A 1LTGD 3NXWA 3K0XA 3Q24A 1YBYA 3KUZA 1H8CA 4A3IH 3Q14C 3I57A 2DLBA 2ICIA 1HR0W 1Z7TA 1EFWA 3TN2A 2Z0SA 1FCCC 4KDLB 3BYYB 4DR5Q 4KD3A 2ATWA 5CV7A 1WJUA 3N6RA 4A3KH 2X69A 5KHOA 1XJVA 4OW0A 4EUTA 4N9PA 1F52A 1YIJA 3NVZA 1WGYA 2EIFA 1Q7YC 1VJKA 3W1SC 3DHQA 4DNIA 4Q5VA 2A6HC 2SDFA 4A3KB 4B3TL 4OVVA 1D1IA 3I63C 4LNKA 4DV7Q 1X3FA 3KJOA 3QOJA 1CMXB 1Y1WH 4YTPB 4BKTA 4GB9A 5C1ZA 1F0ZA 4GLVB 2JA7H 3U4VA 3KUCB 2OTJA 2C5LC 4TKNA 4C4VB 1GXDC 4S17A 1Y8PB 5KGUA 4K3BA 3RZFA 1JQYD 4K2LA 2UUAL 1EY9A 1FR3A 1BXTA 3I72A 4B9XA 3U4EG 1UZXB 3DCGA 1GUSA 1TIFA 2YEPB 2MLBA 1PDXA 5JJLA 2D3BA 4ICUA 4HMJA 2UU9Q 3ERQA 1KRSA 1QWYA 3K0YA 4DV5Q 2NPTA 3DM1A 4LF5Q 4WH4A 3MC0B 4GKJQ 5IYBG 4DPGA 4L5QA 1XPOA 2BWFA 3ITPA 2AL6A 2NVQH 3CRKC 1V8QA 4J15A 3PO2H 1FPYA 4OXPA 3RR5A 4YIJA 1YIWA 2KANA 5C4HA 1VQBA 2L1AA 4KDIC 1XXGA 2EJFC 3HM3A 2D10A 1K83B 3SEBA 1H9SB 5HKHA 1D1KA 3ZNID 3VR5A 4B3RQ 3Q3OC 2L3ZA 1I4XA 1J5EQ 3NHHA 1STNA 4DN4M 3ENEA 4XDCA 4RFBA 1JRUA 1WTXA 3AECB 2IW3A 1D5ZC 3AEFB 1SNQA 5CC4A 2PYKA 3RULA 1WFQA 2EY5A 3BYTB 4B0EA 1YVCA 4BBSG 2EOTA 2J0JA 4CBVA 5E4WC 5IT9c 4DR1L 4LF6L 2LJ5A 2KJRA 4PV1C 2N7EA 4P1CC 3RNEC 1A2TA 3BDCA 4KHPL 2IWHA 4LJZC 4CGYB 5IWAL 2B8FA 2C7NB 4ZRKA 1UELA 1SE2A 3S15H 2K5NA 1CKNB 3K80C 4MDKE 3NUCA 1FD6A 1TU2B 1WD1A 2B63G 1R4NB 2NS5A 4IC7B 3ZTDA 1D8LA 4HPLB 4JYAQ 1E7VA 1WX8A 1H9MA 3KFUA 2EELA 2ZNVB 1E2WA 3GE8C 3U7ZA 4IPGA 3H09A 4JI4L 1CT1D 3WA0A 3PVLA 2F0DA 2LHDA 4L5TA 2HQLA 1QG7A 2NUCA 4DA2A 1JWBD 2JWUA 1Z2MA 1BOSA 2XGTA 2ASQA 3ZNHB 2KDMA 2EPBA 1U9RA 3ND9A 4P7IA 4C7YA 3H94A 4JI5Q 4X66L 4I7ZC 4NP5A 1XYIA 3EFXD 1WR1A 1F9QA 3H7SA 2AQ3B 2LRUA 3JVZX 1VQMA 4ZRJA 3LXFA 1N34L 3VAWA 2F0PA 1EY7A 2A19A 3PIOA 2Q2HA 4X66Q 1H9JA 1UGMA 2A73B 3TQYA 4HSPA 5C3EH 2E3TA 3W1YA 1JT8A 4JOIA 5TR5A 1D5MC 4DAYA 2M0XA 3AEAB 3GE3C 5BYQA 4EOYA 3VXWA 1ZUD2 3BY4B 3S17H 1RFKA 2L8JA 4C7ZA 4ZYSA 3N1XC 1IW7D 4A3EB 3H15A 4K5VA 2YTYA 2V3PA 1I3QH 2IHFA 1ZDXA 1QOAA 4W9HA 2YYZA 2F0KA 2ACZB 3VYTA 4N8FA 2Z0DB 2F0OA 4BBRH 2M8SA 4NQKE 2HCCA 4M01A 2XNAC 1PXUA 2ZXOA 3OWEB 1C4QA 2H88B 3AEBB 2SNMA 1K0RA 1NR2A 5I2YA 2E5LQ 3HOWB 2DX5B 1VQDA 3ZW3A 4NKLA 4UAIA 4K6DA 2WXRA 3HKZB 4FO2A 1ACCA 1V1QA 4IM0A 4OVZA 1P7EA 3B1LX 1LUZA 3M3YH 2B2YA 2FCMA 4LJPB 1FVIA 1HNWQ 1K8GA 3CCSA 2DHZA 2V9HA 4DBGA 1GUGA 3A8IE 5L37A 1LTTD 4N6EB 5GADC 1YMHE 3SXHA 2KJ6A 3MC8A 4H7BA 3T3NA 1HQRD 2MP2A 2OF1A 1RCVD 1RYJA 1NAPA 1GAQB 1O78A 5EJWA 1N8RC 2EYOA 2N78A 4JBMA 4WWOA 5C3WA 1AE2A 2KQ3A 4FVMA 2GLSA 3R8BA 5IGBA 1B2TA 2Z0EB 2VUMH 5E4XA 1DYQA 5IKCM 1HTOA 3K6OA 2D2CC 3F1ZA 1MI0A 5C3XA 3E9IA 1ILQA 1TGZB 3D8GA 1ICWA 2KDIA 1I4QA 1OQRA 1ENFA 1PRTC 2I07B 1LYLA 4R4IA 5IP9H 3GDEA 2JT4B 3OAWA 4K7UA 1BR9A 5EAYA 1E0BA 4NNJB 1CSQA 3MXNA 2K9XA 5JZEB 3AMUA 1VQIA 1UWVA 2L32A 4KKJA 5JAVA 3MHSD 2R93G 1TJEA 1X3GA 1IHZA 1X56A 1G6ZA 1YJIA 3BWUD 4ZAIA 3S1QB 3IAS1 1ESFA 3K9OB 1XWEA 1XNRL 2K39A 3DHIC 3D4DA 3FPPA 1L4DB 1RWSA 4PG3A 3A4RA 1E8WA 4KIKB 2IO2B 4WWMA 1F9RA 4DXGA 5AJ3L 2C35B 1S5CD 4JK1C 3HOZB 1HNWL 2ZEQA 4JI1L 4TMAB 4K7WA 2Q2UA 2W3RA 1Q8KA 1TS2A 3CAMA 4ACFA 5M3FB 4LF9Q 1ZPSA 1PH3A 1DJRD 2NVUI 3CCLA 1OXSC 2ZT9C 1E5WA 4QL5A 2UWQA 3I3TB 2NVTH 3RYTA 2HD3A 4HPPA 3VUWA 2VZAA 4LK0M 2D3GA 1QCBD 3MXNB 1Q86C 4DV4Q 2KKCA 1VDZA 3L3OC 4DUYQ 4W9JA 4DV1L 4CQNA 3NP8A 1EYGA 1I6VC 1C4CA 3GV6A 4LWCA 1XT9B 1DOKA 1NJIC 2BS2B 2FINB 4OZCA 4P74A 4WWPA 3MJWA 4HCEA 1IL2A 4PYUA 4Z9CB 2OOBB 1PFMA 3GTQB 2LGDA 3A9KA 1CZGA 5JEAG 1V5OA 4WAAA 4A9AA 3HOVG 1BUVT 3I4MH 1VQ5A 1SRUA 2VY3A 1FM0D 4JG2A 2B2YC 2ZM6L 1IBKL 4DK1A 2DGYA 2RQXA 3CD6A 2CHZA 3QWNA 5FLMG 3ECIA 3EBEA 4ITKA 1YN4A 3CWIA 2K05A 4GOPC 5IE8A 2OCEA 2RSOA 4PNYA 2JVCA 4AUQC 4AJWA 1WXVA 2NN6H 4ZKBB 1I6HH 1LACA 4RKBA 5LMNW 3MXPA 4ZRIA 2HDLA 1TVXA 4DGZA 3SK6A 1EF1A 1MSGA 4M1UB 4LFAL 2K3UA 1EWIA 3DBHB 3Q2AC 3QC8B 2NVXH 3CCVA 3Q8FA 1BDOA 4BKGA 2I5HA 4JWSC 4BY1G 1LGRA 5COYA 2FCNA 1E2VA 3X3MA 1JJ2A 3S16H 3GOEA 1P9DU 5BO4B 3EN2A 4TQUS 2BYFA 4RNAA 3PUZA 4MIUA 2CHXA 3I9V1 4UDUC 2KENA 2RDGA 3R7RA 1X1MA 2HIVA 1VQJA 4APVA 1SE8A 5G5GA 2NBWB 2KHJA 3NJTA 5IAAC 1G2TA 2J7ZA 4N8X1 4K0KL 4Q0FA 1GNUA 1SMYD 3TDQA 2LRWA 2ZZPB 3IT6B 3CCRA 1N33L 1OEYJ 4LLGM 4OVUA 1HTQA 1RM6C 4ZK9B 2BBCA 4OEMB 2KMCA 4QIWB 2MQJA 1SN8A 3TMEA 1HRJA 3NQTA 1K3BC 4K8JA 4ALPA 3MZ5A 1P98A 4B3ML 4HRSA 3J7ZC 2AWOA 3X3NA 4LF4L 1FFVA 2N9EB 1L7YA 3STBC 5ELBA 3Q23A 1N33Q 3R2TA 1ZXHA 2MBQA 2WXJA 3OJ4B 2BCOA 1WE6A 1VQ4A 3M3YB 1FEHA 4XQJA 1HNZQ 2QEJC 3RD2A 3WOEA 4KVGB 2INDC 2K5HA 2VQEL 2VL6A 4A3JG 4LF4Q 3FHWA 4JI2L 5D65A 3U7DA 2KBNA 4EEWA 4RGNA 1UUPA 3I4MG 5D2MB 3HOVH 2A6HD 5M3MH 5JPNC 1YD8U 4L63B 5CGKA 2HJ1A 3GTJB 2KACA 3U4ZA 3L4PA 3Q3MC 2MH7A 4KGRA 1NE3A 5C0XG 3M4YA 3DBLB 1PZJD 4B9KA 2BH8A 4KKUA 4R4TA 1C0AA 5M5YH 4REZA 1OTRB 3MTNB 2KD0A 4JQWC 1E90A 4DV3Q 2F0MA 2UXDQ 1CKMA 2F3WA 2YTXA 4RAUC 5FJ8H 3ETRA 1GC7A 1K8MA 3MFYA 5C5MA 4NXNL 2BYVE 5CV5A 3VYRA 3EGRA 4PMWA 1KL9A 1VZ8A 4G4KA 1IKLA 2F0GA 2SOBA 2F03A 4H02A 5FKAC 2YV5A 4A3EG 1SJHD 3OW7A 4DAVA 1B53A 1FNVA 4A76A 4UP8A 3AU4A 3CIRB 4YWKA 3BS1A 3PZ7A 1QE6A 5E6OA 1KLVA 1GD7A 2E74C 4YSXB 4YL8A 1RLFA 3OTOQ 1CSPA 1LABA 4ZRZA 4IPHA 5FLXE 2XRQD 1N62A 3CP0A 2VH2A 2R93H 3B2FA 4YSYB 5H1SE 2R2QA 1QVFA 2W9NA 4ABNA 1JROA 2HJ8A 4LMQD 4O0AA 3RUIB 4CJ2C 1XPUA 5A2QL 1EYCA 4XT1B 4JI6Q 4V0BA 1D5XC 1F2YA 1K9MC 1J0GA 3Q6SA 4XX5A 1CQFA 1ONLA 3GTOH 2OEDA 3OIQA 2WB1E 1S5ED 1C48A 3T51B 5GAGC 1H9SA 1TQOA 1ML0D 3QIJA 3UDIA 2VUMG 3Q3FA 3E6ZX 2JSOA 3VR9B 1FJGQ 2FUHB 3H7PA 4V190 4K81A 3AE7B 1FRDA 4HCSA 4RH6A 3DHGC 3M62B 3SDLC 3A7AB 4L2YA 3ZRFA 4A93G 2IJ0A 3C8YA 2A68C 2JXMB 2FAZA 1KRTA 1K28A 2A74C 3VA5A 2KX3A 1YZ6A 2R7ZB 1CZPA 3L17A 5LXHA 3UQAA 5G3LD 1YJNA 1Q3LA 1W6JA 4DR5L 3S14H 3DWGC 3OIPA 3HZXA 4KD4A 4A3EH 2DZKA 3QAQA 2LVPA 2JQOA 1L2FA 4DKAC 2KVRA 4QF4A 2WYQA 2K75A 1VDVA 1TWFH 4RWSC 2RDFA 1NR4A 4C2MB 3S9WA 2JUOA 3Q8BA 1RAXA 2J4XA 2AQ1B 1DGSA 4DNRB 1SF0A 4MACA 1GOZA 1TY2A 4TV3A 1GM5A 3JSVB 4KKIA 3VTVA 1ZE3D 1E1TA 4WQMA 2N9PC 4NAMA 1KNEA 1UE6A 1BMLC 1YQ3B 1N63A 1YI2A 3NWSA 2R93B 5GQOA 4L5RC 2V4DA 4ZUJA 2KUMA 5T1GA 4BBRG 2GBKA 3CXCA 4IURA 2W55A 3RPFC 5C0XH 1MHHE 4S3SA 2MBBB 4FJYA 3RNFC 4A3DG 4N58A 4X3UA 2QW7A 2UUAQ 4KX6B 3QOLA 1B3AA 4G7ZC 1TKEA 2Y5CA 3KYCD 3H1UA 5C4JB 3SFEB 4F7XA 2PKOA 2QEXA 4LAAA 1IKMA 3SGIA 5C6AA 5M3FG 1VQKA 3K5LA 4BVUC 4OO1H 3KLSX 4H2AA 1E2ZA 5BR8Q 3EC8A 4ILWA 4WJPA 5JHBA 5LMUQ 2KEDA 2QIEB 3VR4A 2K0PA 1TT2A 2KX0A 1L0XB 1JE4A 5C4XG 2AEHA 1WCMG 1Y1WB 2QDBA 3EQLC 5HFYA 2Q8TA 5M5YB 2V1CC 5KYLA 2DJGC 4DV6L 1N61A 2OQ0A 3DWAA 3P63A 3APFA 5D6JB 2PW7A 2REXA 5LL6X 3AB9A 3IL8A 1K52A 1WMHA 1SFOB 1EIHA 1CKOA 3E56A 4H44C 2IX1A 2RF4A 5M3MB 2KN4A 4PZ6A 3HOVB 2J7QB 2KTRB 4LTUA 2LKVA 3NTIA 2Z6KC 4QMGA 1IBXA 3E0EA 1K8RB 1MG8A 4NMZA 4QUFA 4DR4L 1O80A 1SNCA 2PZUA 4KN4C 3ZJVA 4U68A 3T53B 1ILPA 1SNOA 1EWCA 4F8MA 3M63B 4YY3Q 4A6QA 4DV7L 1S3SG 1K83H 4AIMA 2O2VA 2PE6B 2JK8A 4AYBB 4C1NI 1JC7A 2JP1A 4BY1B 4NQLB 3PO2B 1R4QB 1TS3A 1Y56A 2G45B 4WIPA 1C9FA 4BY7B 4BBSH 1DOYA 4IALA 2AUKA 1VQ9A 1TKWB 1JWSD 1JB7A 1PFBA 2YU9B 2RGFA 4A3CG 5LMUL 3K7AH 3KWLA 4W9DA 5K5PA 3ZO5B 2YLMA 1MJEA 4BY7H 5C0XJ 4H13C 4FULA 3ND8A 1L1OB 4KHVA 4DR6L 2UXBL 2LHEA 1JICA 2KMMA 3UDGA 4GDKA 3HRDD 1FL0A 2I38A 3F2DA 4MT5A 4F87A 1PH9A 3N9YC 4DV2L 4F7ZA 2NVXB 1QZEA 1D6EC 5ISRA 1GJXA 3HFZB 4WJ4A 3W5VB 1RRBA 3BZCA 3LX0A 4FXKC 3RUZA 2KOXA 5FO9B 1NSNS 4MTKA 4BA1I 2K04A 3HS0C 3E3XA 3LJ3A 4K5XA 5IYBH 4EZLA 4HAEA 2IO0B 2KCCA 3QR8A 1L0VB 1YNJC 2A5HA 4KHZA 4A3JB 4HK2A 2E2JH 1ZYRC 2IY0B 2ZW0A 5BYSA 4M8AA 1O7ZA 3I4MB 1QOFA 3E5SA 2QKIC 3GB1A 4A20A 5IODA 4XGAB 3VR2A 1AWDA 3BU2A 3RN5A 1IZ6A 2F0EA 1VQGA 2AL3A 1PLFA 1EOTA 3PCOB 4C3HG 4DR1Q 1K51A 1WOCA 2LWPA 3O65B 4LFCQ 1FFUA 3QIAA 4IFDI 1BT0A 1PH6A 2I46A 2WAQE 3OYYA 4WORA 4DAMA 2PNRC 3ZDMC 3TMPB 1Z5SB 3P7JA 3SVMA 2JA5B 5E1FA 3GTMH 3OWFA 1ZXIA 3J7AV 2UUBL 2XN9C 3NBHA 2FE8A 4NY0A 5H92C 2GRIA 2LXKA 3STBD 3QK0A 1AE3A 3A1QB 4PZ8A 4JYAL 4BAXA 4HKQA 3J7A5 4PMBA 1OO9B 2MBHA 2MGSA 3VH3B 3HOZH 4NJ7A 1E22A 4XDXA 4A3KG 2Q2TA 2KLGA 2KLCA 2MWSB 1V1OA 2OTLA 2NBUA 2XRSD 4LFAQ 4C1NK 3DBLI 2D9UA 4DUZQ 3E9HA 1GO3E 1LFDA 3WIMA 3S1QH 1BF4A 2K01A 4KK7A 2L5TA 2K52A 5CV9A 1VQOA 1FXAA 3U9OA 1OFFA 3OLMD 3T9LA 4FBJB 4FXDA 3A54A 3DBSA 1N36L 2WXKA 4NZLB 4X62Q 2K6AA 4IWPA 2INCC 5LL6S 4OO1G 4P6VF 4F1SA 4JPSA 1TIID 3VYSA 1WRDB 3KBGA 1Y8RC 4ZHOA 2WU2B 3PHWB 2SAKA 2OQKA 4W9LA 3KYDD 1PRTF 2KWCA 3RCZA 2ZJQA 1E1OA 3WCQA 2SNSA 4K1RB 4FNFA 2RCNA 2MUYA 3CCEA 3VQIA 1B3QA 2VUMB 5E6PA 1WTHA 1LTLA 1V1PB 1CQVA 1KAWA 4G50A 3HVDA 1GB4A 1EUJA 3RLOA 2Z6BA 4L8JA 2IHEA 3IVFA 4A93B 1K0SA 4GU2A 3RNAC 2K8BA 1HR0Q 1XNRQ 2R7ZG 2L7RA 1I94L 2RPQA 4OHJA 2Z4HA 2J52A 3T1HQ 1XLQA 2H89B 4EE2A 3K8AA 5EKLA 2JEAI 2L52A 3QG1A 4QGUA 3EUB2 1STYA 4BKSA 2FCQA 3AYHB 2QHOA 2PQAA 2B2VC 3BDOA 3KLSA 4TRDA 2NMQA 4NW2A 3V61A 1XCQL 3R3OA 1HZ9A 1LM0A 1KLUD 1LT3D 4UPAA 4DUZL 5CV8A 1WTWA 1Y69U 4LUOA 3ABVB 2DYBA 4DXFA 4OZAA 1A2UA 1SMYC 2XEWA 4GMVA 3J7AF 2LFNA 3S1RH 1C9OA 3PUXA 1TKYA 4NXML 2HHHQ 3SD5A 4IJHA 4XQQA 1JMLA 2DZMA 5J39A 1NI3A 1QVCA 1STGA 1PUTA 4G11A 2FFKB 4L23A 1WCMH 3JAML 5JJZA 4RMAA 4A3DB 5C4XH 3Q8AA 1FMAD 4BOZB 2KFJA 4LUVA 1I3QB 5CBEE 4GN1A 5IP7G 2F3IA 2WXOA 5ELEA 5I4DA 1F1HA 3DHHC 1RODA 1E7ZA 1VS0A 4WJOA 3NHEB 1VLBA 3TS2A 3ML8A 2JXTA 2OT2A 5JPMC 4IWOA 2DZJA 3HK0A 2QCZA 4JI8Q 3ZXRA 1PRTD 1VQPA 4Y7NB 4OX9L 4ZRPA 2GB1A 1X3EA 3HGBA 1PGXA 5C23A 3RZWC 3DBRI 4J3OD 1WM3A 1WFYA 1EYAA 5LHY1 2KZRA 1VQCA 1PV4A 3T13A 2ES2A 1YJ1A 3N3KB 1WCMB 1A8VA 1B4OA 4GKKQ 2B76B 4IUQA 1CJEA 4JI7L 3J81c 1CZWA 2ZVNA 4DHZE 3S1RB 1PTOD 2NZHA 3PO3B 3J7YW 2JN4A 1F9JA 5BYRA 2F1MA 1Q5WB 3RN2A 3S1NB 5IT9L 2IY5B 1E7PB 1IGDA 3K5OA 3AE4B 1G51A 1UE5A 5KYIA 2N55A 5GAEC 1WXMA 1V97A 4MGYE 3VR8B 2I0QA 1FXTB 5JVH3 4FF4A 4POGA 2PPBC 1L6UA 2EJGC 1X3PA 4HIOA 4BWGB 4JI1Q 1J9OA 1HHVA 2QMTA 1N32L 3LDZE 2B8GA 2Z6KA 4GNXA 1EYDA 4FLHA 2BH2A 4LF5L 1T0QC 1KIXA 2YEPF 4ZDVA 3R7QA 4KN7C 1BCPF 1YX6B 1JORA 1QNUA 5I9PA 2O5IC 3VDZA 4IOIE 4R4OA 4FJVB 3DBRB 1JWUD 1N32Q 4R3DA 1G8ZD 5DM73 1MHXA 3NS1A 5D94A 2E6XA 3VTWA 3TRZA 4LUZA 3UE1A 3NOBA 4ZHPA 1PRTB 1IL8A 3HKSA 3J81j 2LJIA 1HNXQ 2EYJA 3JAME 3D31A 4R1JA 4HJGE 4I6LB 4JX1C 4A3JH 1K73C 2M17A 4DHZB 1UE7A 1Z47A 1PYBA 3HKZG 3J80E 1X9NA 1LO5D 1KD1C 1HFNA 3VYUA 3AE9B 1V9JA 3N32A 2PMZB 5J3BA 2D5DA 2WXNA 1J8IA 1J19A 4DR2L 1JRPA 3MTSA 4JBKA 1NENB 5EPLA 4CHTB 2Z1CA 4R4CA 2KQSA 5IA7A 4AQYQ 4KMUC 1F9SA 2DNEA 1B7YB 2NN6I 4EQNA 4LNQA 3T1YQ 4IW0A 4A3GB 2KWVB 3Q69A 4ICVA 3ZKJC 1I4GA 1G291 3FAHA 4LK1C 1ISNA 2NBVB 1Q0WB 2NPTB 1DONA 2MX2A 5HG2A 3WAPA 2PMVA 1IYJB 4JV5L 3HIZA 2EMSA 1IPGA 2CWPA 2BVCA 1I42A 3HOUB 4WJNA 4Y52H 3GTMB 4NPNA 2AQ2B 5AUKA 3ZDTA 1ZEQX 2JJQA 1CFMA 1GB1A 4DV5L 5ELCA 1I7HA 4LNFA 1Q8IA 2PMZE 4C3HB 4CYEA 2G5DA 4BXXH 3OW2A 4HJKA 2NTTA 3TBLD 4JWUC 5EGTA 1N34Q 4HJ5A 1ENCA 2Q5WD 4DV0L 2B3AA 2OHFA 1CK1A 2PCFB 4TKOB 1XTDA 4X6AH 2BDNA 2X6GA 5NUCA 5M3FH 1PH7A 1VQEA 2JA5G 2LFIA 5KNBA 1XEEA 2Y3AA 4AYBE 3P2BA 1WJ6A 1C77A 1TXYA 3JW0X 3MJ5A 4DR4Q 5HI1A 3ZIMA 2A69D 2ZTDA 1GUWA 3HM6X 4ZOHC 2E2HH 1YQBA 4DR3Q 1Q1BA 1DOMA 1CHQD 3WWVA 4EQOA 4IFDJ 1NYQA 1G2SA 2A5UA 1TR5A 2GMIC 2ZCBA 1K50A 2C9WB 3PSEB 1IUEA 3NS8A 4QUCA 2N9LA 1EQQA 4IO9A 1FJGL 2N1VA 4A90A 1JOOA 2BE5C 5HGTA 1X55A 2DY7A 4XXEA 1OXVA 3CCJA 1V2YA 2UUCQ 4N9F4 2WAQG 1XCTL 1EZ6A 1JQ4A 1EIYB 5I6YA 3A7LA 3ICEA 3Q22A 3GTPH 1O7IA 4IM3A 3NRZA 4FYDA 1V5TA 2K5QA 4JIOU 3TEZA 3Q3JA 3RZDH 2CHWA 5GAHC 1PDQA 4GLXA 3APDA 3B9JA 1F2LA 4A3OA 1PYSB 4IUUA 2G1EA 4GSWA 2F0QA 5J22A 2GBNA 1EY8A 3H0GB 3MHZA 1WGGA 2YU9H 2JF5A 1H9RA 4TVAB 4FF2A 4GNXC 3I4NG 3EECA 4GOPA 2KFKB 3M7GA 4MM3A 1TWHB 2FIDA 2EYFA 1ET6A 4C56C 4FF1A 1TWGB 2WWZA 4DV0Q 4CO7A 2N88A 4HIDA 2N49A 4PQXA 5IP9G 3OTOL 1RFAA 1HZCA 3WANA 5J17A 3PGZA 5LMNL 1VRAB 1GUTA 2F0SA 3PV0A 4WJQA 4W9KA 3BK1A 4IOAA 1BCPD 1NBFC 3RZOB 3ZLZA 2L0CA 4HJ8A 5D3DA 4HVBA 2MHVA 2K22A 1W6KA 3RT3B 3S14B 5IGGA 2IX3A 4M0WB 5C44H 2LEKA 3TBIB 5IGCA 2UXCQ 2BTEA 2RHSB 4I7AA 3AH7A 1SSOA 3TZDA 3GS2A 5M5XB 4WFN3 4HDQA 2EZVA 2MSED 2J0KA 1T9HA 3UDFA 1P16A 1F2ZA 3C1FA 1SBBB 1EIFA 1EY0A 1NMGA 5I2XA 1QZGA 2UXCL 1L5PA 2ICEC 4FP5D 3NG0A 1D4BA 1L6VA 2CQAA 3GV3A 5IO9A 5CTRC 4CKCA 1A63A 4WJWA 5AZGA 1G91A 4O42A 5EQ0A 1MKHA 2F0LA 2IPKD 2D5GA 2PQAB 2MJ3A 1VCBA 2FMMA 5FR6A 3KQ4A 1YHBA 3G48A 1G6PA 2CKHB 2O6VA 5C3EB 5FJ8G 2MO0A 1R4PB 1GVPA 2F0UA 5LLIA 5C4JH 3P4SB 3MA2B 2NBFA 1SIJA 3MEFA 3E9SA 2PZTA 3NY5A 1E8XA 4LW1A 4P1BC 4CJ0B 1KM7A 2K14A 2EY1A 3FDTA 3KW5B 3DVNV 1B1ZA 1AW7A 4AOFA 1KOTA 5AZFA 3I91A 4DV1Q 4KY5A 5J18A 2KNBA 1U4PA 3TP5A 3AQQA 1WJNA 3N1ZC 1GHJA 1BBUA 4A3LG 4XIGS 3NPPA 4KSLC 3W9CB 3P1MA 1XLOA 2PLPA 4KJOA 4RCNA 2D3CA 3GTGB 1BQQT 2I5LX 2BKFA 2CU3A 2ONQA 1FCLA 1IW7C 4GN5A 1PH1A 4AWJA 4A3BH 3OMGA 3VA7A 4QB4A 2ZTEA 5FO7B 5IIFA 2BF8B 5EPKA 3TP6A 1Y1VG 2RA4A 4A3FB 3I90A 2AUJD 5BN4A 3EROA 4RMFA 2KCMA 2KMAA 3VTUA 1FO4A 1YNXA 4A55A 3B08A 1KH0A 3NTKA 2E5LL 2L55A 4JW0A 3N20C 1HR0L 5EKKA 1XNQL 2KVZA 4IUMB 2WIIB 5M5XH 1XPRA 1SYFA 3J81E 2K7VA 2ENBA 1STEA 1U4LA 3HOYG 2F0NA 2GBRA 4A8XC 4OZBA 1RIPA 3C46A 2HTME 3BZDB 1VQAA 2JZZA 2B39A 2DJFC 3I70A 1LQBA 2JZPA 3RNCC 2CWAA 2GN5A 2Y0SB 3R3MA 1SYEA 3CQZB 1WYDA 4DR7L 3VR3A 3MHBA 3NBHB 1IYVA 2AYOB 4YT0B 3RZOH 4P16A 1QJOA 1T5XD 3KF8A 3T16A 2F0JA 1QUQA 2P5ZX 3G7LA 4OO1I 4K5WA 1PFDA 1S1QB 3BIID 3DOWA 5G2NA 4B3SQ 4DR7Q 1SLJA 4LF9L 2V1YA 3OHXC 2R61A 3M9BA 1DCZA 2RCFA 4XTCS 1XMOL 2MA9B 2KDFB 4NAWA 1WXSA 4ZKCB 2NVQB 3OMCA 1YHQA 1JB3A 3DPDA 2CQOA 4YWLA 5HGQA 1IBMQ 1OQQA 1A15A 3BK2A 3U2SC 1KTKA 2D11A 3WAMA 1SB3C 3BJUA 2NTSA 5FLMH 2XSCA 2QSDA 3X23A 1U0LA 5D3IB 1QVGA 4DK5A 4FXGC 1GG3A 1V1PA 1MGSA 2Z4IA 1PA6A 5DCNA 1PTOC 1J7BA 3FKIB 3VRAB 3ZQ4A 2UUBQ 2E2DC 5JEAH 1W3SA 5CV6A 1A0IA 3DWMA 1TZ1A 1E24A 4DWFA 4AP4C 3MEHA 1XF5L 1EZ8A 2BB6A 2K50A 2OWOA 5IY0A 3KUPA 1N6ZA 5JXVA 4JE3B 2DNFA 4LF8Q 2LGXA 4HCNB 1S5BD 3P1HA 2RHQB 2MBOA 1SAPA 4HEDA 3SR1A 1WF9A 2GA4B 3SDZA 1IBLQ 2DZIA 2XK5B 4WQOB 3PIO3 2KAJA 3H9DA 5A2QE 2MP1A 2K5PA 1N36Q 1AH9A 3APCA 1QT9A 5G5HA 1OEYA 1HUMA 1RJTA 3AEVA 2N7JA 1A62A 1WI5A 2NR2A 4IZ8A 1KJTA 4A75A 3IHPC 1KAAA 4NXNQ 1ICFB 4JI3L 3PF4A 1PH4A 1Y14B 1Y8OB 3BDLA 3K5NA 1ZXTA 1RTOA 2BW2A 2KQ7A 4IQZA 1WRIA 4HPMB 3IKJA 1VD2A 2VB2X 2WV6D 3ULJA 4HJ9A 2TSSA 3GO5A 4PT5A 2O2VB 2EYPA 2RKSA 3M4OB 2LD9A 4C3HH 3NE5B 2PJHA 3G6JB 3CPWA 1FGBD 3AMZA 3L0WB 1Q10A 1Y1WG 1AP0A 3URYA 2B29A 2WAQB 3O13A 3J81i 4LJOB 2EVBA 4J1MA 3IRBA 4ARIA 4NDXA 5CX3A 3CMEA 2ZM6Q 1IBKQ 3VRBB 2KC2A 3SHLA 4B3MQ 1C4AA 3V2TA 2LI5A 3T1HL 2A68D 2MW5A 3UIOB 1FXIA 4RF1A 4GN3B 3PZ8A 2KECA 2KOLA 3MWYW 5DLQE 2BT6A 2R3ZA 1XQQA 5JJKA 4HIKA 3H0GG 3NWTA 2E75C 4FDBA 1E8ZA 2LGYA 4GZYC 2N4FA 3QA8A 4IWQA 3CSTA 3CHBD 4CHKA 1VQHA 4JI2Q 2MBEA 4EQ5A 2J42A 2WGSA 3KUDB 4GOCA 2N1WA 3OPOA 3TL5A 1VF5C 4JPBW 2LUMA 2KJXA 1HH2P 5DNFA 1AZPA 1T0SC 5A35A 2FNJB 2KDBA 2BS3B 4AYBG 2L11A 2D07B 1ZKHA 2LXJA 3NVWA 3PO2G 2JRIB 3AE8B 5GXGB 4E74A 1VQ6A 4K0KQ 3IXSA 4BY7G 1SE4A 4AS1A 4RA8A 5M5WB 3C3LA 1CA6A 1B9RA 3ZNZB 1WD0A 4BA2I 1L1OC 1MFWA 3CCUA 3AE3B 2BA1A 3V96A 2EXZA 3LGJA 3CRLC 4PS3A 3Q6BA 2WXFA 1CM9A 1YNTE 1PZKD 2MO1A 4MHEA 2PE9A 4ASWC 1OTCA 1S5DD 2K4KA 4LDTD 1KABA 3HOXB 5CHFA 3M4QA 3VDYA 2NWGA 3EVQA 1YNJD 1HZBA 2GVBA 2H4OA 2IL8A 3ZTCA 3SK5A 1NMFA 3U9SA 4AQ7A 1F2RI 3S2DB 3N52A 1PTOH 5JVG3 1B50A 1EU3A 3D3RA 2K25A 3AFPA 1YITA 2ALYB 2NVTB 3QJZA 2INNE 1NCVA 3HOUH 2WXGA 2D0OA 5C3EG 2DYOA 3AM9A 3DUZA 5ELDA 1SYBA 1GHKA 3A8KE 1K53A 3HOWH 1UBIA 5IGDA 2X6LA 3L13A 2GVAA 4TSSA 3UI3A 4XC2A 5L95C 3BG3A 3J80i 2MHJA 3A9KB 2CU1A 1PFNA 1PHJA 2VH1A 2UXDL 3JC66 4ANVA 2WP9B 1GJZA 2B2WA 4HJAA 2UUCL 4EX5A 4YXDB 3CF6E 3W1GA 4A3GH 4W9CA 2FHTA 4A3IG 1QKZA 2RPVA 4HMIA 1R4MI 1MHWC 3PRMB 4Q2JA 3U52E 1HCZA 2F0VA 4X65Q 1IYFA 1HNXL 2EY2A 1ZGUB 4IG7B 1SROA 4OELB 1KDAA 3I55A 3KJPA 1BKBA 2B2UC 5IYCG 2ZW1A 3PREA 2WXQA 1AARA 1H4RA 1WJ4A 1HQMC 2B63H 3RNGC 1XLPA 1A5RA 4CDFC 4X65L 4GIVA 2QJLA 4A3DH 2ZNVC 4WRDA 3DM3A 2F0IA 4A3PA 3QB3A 3LWUA 1J5EL 4K6LA 1XMQL 4RHSA 4I6NB 1GUNA 1LTSD 4DFAA 4OX9Q 1YJ9A 2LUEA 1PFSA 2V3SA 2WXIA 5G3LF 2R6GA 1SR3A 4B95A 3ONAB 4K14A 1WE7A 2EE1A 3K59A 1WSPA 2K6DB 2KHSA 2QDFA 2XK5A 1KFYB 3P42A 5C2TB 2BYTA 3JSVA 2IBIB 2IX0A 1Q1OA 3CSFA 4ID6A 3KF6B 3AE5B 2OXPA 2Y0SG 4CDEC 3M95A 1LT4D 1DM0B 2MRPA 4GLAC 1Y1VH 2WXHA 1T0RC 1MI2A 2JYTA 2I5MX 3N30A 3CMMB 3S1MH 1RHPA 4K8IA 3RLFA 4C3JG 3F2CA 5K36H 4G7OC 1QOHA 2W54A 3RD4A 3TZUA 2JA6H 1U5KA 2ASBA 2QC8A 4A93H 1WJJA 1TTNA 2YTVA 3JAMi 4IM2A 4KKSA 5AUIA 3FP9A 3M85A 1B9NA 1HA5A 4QY7A 3AXCA 1MJDA 4DV2Q 1N9WA 3PO3H 3KH0A 3PGEA 1CTMA 1WTOA 1UNSA 2A6ED 4DAPA 3NELA 3EA6A 4X3TA 5ELNA 1C1YB 1VZ6A 1WXAA 2WXPA 3FILA 2A6EC 2L00B 3H7PB 3DWQA 3WOFA 5DPSA 1V6EA 3SR6A 4B6WA 5HURA 1PH5A 4HROA 4QAYA 2KHIA 3PV1A 3G6EA 2IT1A 1UEBA 1ET9A 1HTPA 2EY6A 2LMCB 3AI5A 3JYUA 4FJZA 1O7LA 3U58A 2BOSA 3S17B 2IGGA 2O6VB 5EE0A 3V60A 1OXUA 2IGDA 2Z8LA 4PZ7A 4LFBQ 3PSIA 5D14A 4CJ1B 1XO3A 2M9VA 2PIAA 5T1IA 3AEGB 3ZVVA 1L2NA 2G9HD 2LS01 2PZWA 1CA5A 2H1EA 2KWUB 2B2VA 1ZOYB 1C79A 1BNZA 2JU6X 4KHPQ 4QCLA 3L0OA 4BOSC 2BE5D 3FC4A 4DR2Q 2PW5A 3EJIA 2MNAA 1K8AC 2L83A 2PEAA 2KWDA 1YJWA 2A4ZA 3UINB 4AQYL 5F2DA 3QQ8B 4ZRQA 5LXIB 3ONSA 4DHJB 4MN3A 2JA8G 1TWAB 4E6IA 2VXWA 1YOVB 2IDYA 5IN7A 4JI4Q 5IYDH
chains in the Genus database with same CATH topology
1EWYC 4HN7A 3J81L 4XT3B 2JA6B 1A3VA 4C3IB 4M0WA 3KLRA 4ZQ3A 1VMPA 1WVLA 5CORA 3S1MB 2JEBI 5ELFA 4IUTA 5AFWA 1MSHA 2XWBB 2B2WC 1S5FD 3B2GA 3PIP3 1KDBA 1PYWD 2G9DA 5FO8B 1A3UA 3LB8C 3I3CA 5DAUA 3L7ZC 1TYGB 4A6QA 2RVLA 1X32A 2MPMA 1IGCA 1SXTA 1HZ5A 2Q8RE 2W3SA 2E2JB 4IKGA 4RGTA 2PW9A 4XE0A 2CW0D 1TKGA 2WKDA 2K1BA 4OIJA 4XYQA 1SE3A 1E6EB 1JWAD 1MVKA 5J1ZA 2N9KA 2ID0A 4YWGG 4IFDG 4EGVA 3NVYA 2V3NA 4RGMA 2TMPA 3T4AC 5FOBB 3NVVA 1XLNA 1ZP0B 1EEID 3MVVA 4N9TA 4HKZE 3ZGZA 2B2UA 1D2BA 1N5XA 3HRZC 4YTNB 1FNWA 2NYZD 3DEOA 2A69C 2WU5B 3HP3A 4B9WA 1JOQA 5EBCA 2NB0A 2J0TD 4F88A 1HTLD 3A55A 1N5WA 5BN5A 1QOBA 3LYYA 1OXXK 1LTBD 2V4IB 3HUIA 2EYLA 2J53A 1E10A 3HEJA 1EY4A 1YNNC 5C3JB 2C5CA 2C9OA 3Q0AA 1WTQA 2PTLA 1MD2D 3ZJUA 1ZYRD 4MM3B 3AE6B 2WP8J 3GP7A 4IUPA 3AEEB 3A56A 3TEYA 1YN5A 3RMHA 3Q8CA 2M19A 2GI9A 4WAFA 5EBDA 3AV8A 4N59A 3V05A 4A3IB 4NAWB 3NK9A 3K5MA 1XTCD 4GLSC 1DOLA 3D4WA 1BCPC 1WTRA 3T3OA 4KY6A 3NUHB 1J7CA 2D62A 3PO0A 2I2YA 2BDOA 2CW0C 5LNK1 1EM7A 4IUVA 3I4LA 2BB5A 1FNUA 3FRPB 1QQRA 1I4HA 2EKIA 1WYGA 2WXMA 1R9TB 2OEOA 2RMMA 2NVYB 2BTEA 1CI3M 3QJYA 1K8OA 2F3VA 1STAA 4XWWA 5M9OA 4BBSB 1GUOA 2NZ1D 5KNDA 4RGOS 4RF0A 4HTHA 3J9CA 4ZUIA 2N0SB 1HZ6A 1SNPA 1SSNA 1TWFB 1C8CA 1WWTA 3GTKB 1EEFD 3SK4A 3HG9A 4L6TB 2HDMA 4C3JB 3GTLB 3PUWA 2L1BA 5KIXA 4ZLTF 3I4NB 3SK8A 4KGTA 3I8ZA 3DEPA 3W3AA 5EKIA 2MJDA 5BMGA 4DF7A 3NQIA 5IOCA 3IFDA 3T56B 2DY8A 2QILA 5JOBA 2WKCA 3MXUA 2AWNA 2WS3B 1HXYD 2L9HA 1EY5A 3W1SA 2WINB 1FYCA 2WQYB 2Y5PA 3SE0A 1PTOF 3Q8EA 5MPOA 1BCPB 3CKIB 3TP7A 1U4RA 1JALA 2JQRB 1VF7A 1L0YB 1Q1EA 2Q8IB 2WDRB 2CHBD 1YN3A 2AX5A 1FIQA 5BMIA 1DOIA 1UWXA 4US8A 1LLRD 2LGIA 1LT5D 3W5UB 3GD7A 1EIGA 4KKTA 2LMCA 3QO2A 4BS9A 2B2TC 1A6XA 4USAA 2O5JC 3FILB 2B2TA 1TZOA 1NEKB 4XQNA 1PGAA 3H6MA 4JBWA 2DN8A 5IT9E 3BVMA 2X38A 1MPEA 4DNTB 5C44B 5T8IA 1LV9A 3OSOA 1M8AA 1E0ZA 1MBYA 2F0TA 1JCKB 5BMHA 3GTOB 4IDIA 1YQ4B 1Y1VB 1JR0D 5CYUA 2DWQA 1BO0A 2MEKA 4I65A 3IAYA 3DXJC 1N60A 1HPCA 1LTAD 4YTMB 5C0XI 3HOYB 2DYMA 3IT4B 3PUYA 3D6CA 2RSNA 2EJMA 4OIKA 3KK7A 3HVZA 1VMCA 1PMRA 1Q12A 2KA7A 1H9KA 3M7NA 2JE6I 2KVMA 1ZDVA 4P2CB 1II3A 1BUIC 2WLBA 3KWVA 3S16B 3RZDB 3FPUB 3GTPB 1TS4A 1QOGA 5EE9A 4HR7B 4RCOA 2XIWA 1T5EA 1KDCA 1HFGA 1DD2A 1I6HB 4O1NA 2M56B 5H8YE 4GDLB 4ULLA 2JX5A 1STBA 2V0GA 3FEWX 1OXTA 2KQ4X 3CU7A 5C5LA 5CBAE 1LT6D 4HEA1 3H91A 4X3KA 4ME5A 2HQEA 1SYGA 3P75A 1YJJA 3NTHA 4K2KA 4ARCA 1E9MA 5CV4A 1TWCB 2ON8A 3IFTA 3DWPA 1QLBB 1WTVA 2E76C 2CJNA 5EE1A 1DZ1A 1DXMA 1F9PA 1SEBD 3J80L 2M00A 1ESRA 2PO4A 1CHPD 5I9OA 1S4ZA 4FF3A 2O2LD 1STHA 1EQVA 3DMUA 4R8NA 2O4XA 2HCIA 2FBWB 1JWMD 3AE1B 4B0MA 2IGHA 1Y8NB 1U4MA 3LNNA 1NYRA 1ROEA 4MH8A 3P4RB 4G57A 2JYEA 3KBXA 4TQ0A 5KNCA 4J8QA 1WTPA 3RFZB 3BVGA 2RDHA 2L12A 4DQOC 1YNND 3AU7A 2EDGA 3MFGA 2WDVB 1EL0A 2M2LA 1WGKA 3FVQA 4US9A 1EY6A 3TSSA 2DNCA 4RHRA 2PVGC 3NSWA 1XX8A 2E2HB 5E3FA 3C2PA 3S2HB 2JYOA 4XYOA 2BA0A 3P20A 2K03A 4ODGA 1L4ZB 3NBIA 4DU9A 2QF7A 4A3MB 1F77A 2PVOD 1PZID 4DK0A 1A70A 3R2IA 2K5DA 4IFDH 2BS4B 2K32A 2WNMA 1QF6A 4KY7A 1SNDA 1LTID 3L9AX 1C4PA 1R7SA 3C1EA 3WDNA 2EYHA 2F0HA 1KF6B 3P4QB 3TUOA 5EE3A 5FK9C 2F4IA 1T6BX 3BVZA 2R92B 1ZKOA 3IAM1 1TS5A 4XWTA 3ZJTA 2L4NA 1FD7D 1UEAB 3K57A 4X3SA 2VB3X 4KJNA 2JSVX 5E6JA 1I4PA 4HSVA 5TSSA 5BN3A 1FRRA 5EPJA 5FR3A 4XDDA 3P4PB 1C78A 1VZ7A 2F0WA 1PGBA 3AE2B 3GQBA 1JOKA 5C4ZA 4G7HC 3V3XA 2RBMA 4KV6A 5KRUA 1SJED 2SEBD 1J7AA 1RTNA 3SFDB 3FMCA 3AB5A 4YSZB 4R9WA 2VZKD 1AZQA 5I6WA 2DBYA 2ZXPA 3H3VC 3S15B 1RD9D 1SYCA 2XVSA 3LWEA 2MJEA 3VR6A 2WXLA 4KTAA 2CVRA 3R93A 2PQEA 3UI2A 4BBRB 4D2KA 1QNKA 4H0LC 1HA6A 4OL7A 1GPXA 1QILA 5K36G 3ZYYX 4NJCA 2K33A 1RKNA 4IN3A 1X3QA 1I50B 2INPE 2WDQB 5IGFA 2B63B 1SDFA 5IGEA 4A3BB 1SNMA 4CKBA 1NVID 1ENAA 1DOXA 1HEZE 3TEXA 1UWMA 5DM63 4EVOA 1KLGD 2E2IB 1UAPA 5C4XB 4L1BA 2LY7A 1T3QA 3D4RA 4KGSA 2QCPX 4WURA 1EU4A 3NZ3A 4OGQC 3AEDB 3PMFA 3PUVA 1DGJA 3MAQA 1WXQA 2FUG1 1JW9D 1RF2D 4TQ1A 1LTRD 3I73A 4RKLA 2WACA 1AN8A 1PTOB 2FMCA 2JA7B 1EQTA 4FXCA 4KI0A 1Q90A 5KEEA 4C80A 4GDKB 3OOCA 2M0AA 4B08A 1O7YA 1F2RC 2JA8B 2W82A 1NUCA 1P7FA 1UGJA 1KNAA 1AEXA 1IYUA 4C3IG 1F2MA 5FLXL 4EQPA 1BBXC 2ZXRA 2KCNA 2VNUD 2K28A 1B44D 4R8IA 1VCIA 2KEEA 3MP9A 1M4VA 1AFPA 3AN1A 1A3TA 2EYMA 2WB1B 5DEHA 3W2DA 3F2UA 3D6WA 1I4RA 2K5WA 4U673 3A8JE 5CR3A 4J6HA 5CMDA 2HDEA 1B9MA 2NN6G 3MXGA 2FJ2A 5HHDG 1RDPD 3K7AB 1IBXB 3TP8A 1C76A 2VZKB 1VR9A 5JEAJ 2CJOA 3E0JA 1V43A 2XWJB 2MJ8A 5D7GA 3H8HA 2F0FA 1QB5D 1Z6HA 1EFID 1AYFA 3TEWA 1HUNA 4PMCA 1EWHA 1TY0A 4IUNA 2HUGA 4CKEA 1SYDA 1V8CA 1KRHA 3K58A 1LTGD 3NXWA 3Q24A 3I57A 2DLBA 2ICIA 1Z7TA 1FCCC 3TN2A 3BYYB 4KD3A 5CV7A 3N6RA 2X69A 4OW0A 4N9PA 3NVZA 1VJKA 3DHQA 4Q5VA 2A6HC 2SDFA 4A3KB 1D1IA 3QOJA 4YTPB 1F0ZA 1GXDC 1Y8PB 5KGUA 1JQYD 4K2LA 1EY9A 1FR3A 1BXTA 3I72A 4B9XA 3U4EG 1GUSA 2YEPB 1PDXA 4HMJA 3ERQA 3K0YA 1QWYA 3DM1A 4WH4A 3MC0B 3ITPA 3CRKC 1V8QA 4YIJA 5C4HA 2L1AA 1XXGA 2EJFC 1K83B 3SEBA 1H9SB 1D1KA 3VR5A 1I4XA 3NHHA 1STNA 4DN4M 4XDCA 4RFBA 1WTXA 3AECB 2IW3A 1D5ZC 3AEFB 1SNQA 5CC4A 2PYKA 2EY5A 4B0EA 3BYTB 2EOTA 4CBVA 5E4WC 4PV1C 1A2TA 3BDCA 2IWHA 4LJZC 4CGYB 2B8FA 1SE2A 3NUCA 1FD6A 1TU2B 1WD1A 1H9MA 2EELA 1E2WA 3U7ZA 3H09A 1CT1D 2F0DA 2LHDA 1QG7A 2NUCA 4DA2A 1JWBD 2JWUA 1BOSA 2KDMA 2EPBA 1U9RA 3ND9A 4C7YA 3H94A 4I7ZC 4NP5A 1XYIA 3EFXD 1F9QA 2AQ3B 3LXFA 2F0PA 1EY7A 1H9JA 2A73B 4HSPA 2E3TA 1D5MC 4DAYA 3AEAB 5BYQA 1ZUD2 1RFKA 4C7ZA 4ZYSA 1IW7D 4A3EB 4K5VA 2V3PA 1ZDXA 1QOAA 2YYZA 2F0KA 2ACZB 3VYTA 2F0OA 2HCCA 2XNAC 1PXUA 2ZXOA 3OWEB 1C4QA 2H88B 3AEBB 2SNMA 1NR2A 5I2YA 3HOWB 4NKLA 4UAIA 4K6DA 2WXRA 3HKZB 4FO2A 1ACCA 4OVZA 1P7EA 2B2YA 1GUGA 3A8IE 4N6EB 1LTTD 1YMHE 3SXHA 3T3NA 4H7BA 1HQRD 2OF1A 1RCVD 1RYJA 1NAPA 1GAQB 1O78A 5EJWA 2EYOA 5C3WA 2KQ3A 4FVMA 3R8BA 5IGBA 1B2TA 5E4XA 1DYQA 3K6OA 2D2CC 1MI0A 5C3XA 1ILQA 3D8GA 1ICWA 1I4QA 1OQRA 1ENFA 1PRTC 2I07B 1BR9A 1E0BA 2K9XA 3MXNA 3AMUA 2L32A 4KKJA 5JAVA 1TJEA 1YJIA 1IHZA 1G6ZA 3IAS1 3BWUD 4ZAIA 3S1QB 1ESFA 1XWEA 3D4DA 3FPPA 1L4DB 1RWSA 4WWMA 1F9RA 4DXGA 3HOZB 1S5CD 4JK1C 4TMAB 2W3RA 1TS2A 5M3FB 1ZPSA 1DJRD 1OXSC 2ZT9C 4LK0M 1QCBD 1VDZA 3L3OC 4CQNA 3NP8A 1I6VC 1C4CA 3GV6A 2BS2B 1DOKA 2FINB 4OZCA 4HCEA 4Z9CB 1PFMA 3GTQB 1CZGA 5JEAG 4A9AA 1BUVT 1FM0D 2B2YC 4DK1A 2RQXA 3QWNA 4ITKA 1YN4A 3CWIA 2K05A 2RSOA 4PNYA 2NN6H 4ZKBB 1LACA 4RKBA 3MXPA 2HDLA 1TVXA 4DGZA 3SK6A 1MSGA 4M1UB 2K3UA 3Q8FA 1BDOA 4JWSC 5COYA 1E2VA 3X3MA 4TQUS 4RNAA 3PUZA 4MIUA 3I9V1 4UDUC 2RDGA 5G5GA 1G2TA 2J7ZA 4Q0FA 1SMYD 3TDQA 3IT6B 4LLGM 1RM6C 4ZK9B 2BBCA 4QIWB 3TMEA 1HRJA 3NQTA 4K8JA 3MZ5A 4HRSA 2AWOA 3X3NA 1FFVA 5ELBA 3Q23A 1ZXHA 3R2TA 2WXJA 2BCOA 3M3YB 1FEHA 4XQJA 2QEJC 3WOEA 5D65A 4RGNA 1UUPA 2A6HD 5JPNC 3L4PA 4L63B 5CGKA 2KACA 3GTJB 2MH7A 4KGRA 5C0XG 3M4YA 1PZJD 4KKUA 4REZA 2F0MA 2F3WA 4RAUC 3ETRA 1K8MA 3MFYA 5C5MA 5CV5A 3VYRA 3EGRA 4PMWA 1VZ8A 4G4KA 1IKLA 2F0GA 2SOBA 2F03A 5FKAC 1SJHD 3OW7A 4DAVA 1B53A 1FNVA 3CIRB 3BS1A 3PZ7A 1QE6A 2E74C 4YSXB 1LABA 4ZRZA 5FLXE 2XRQD 1N62A 3B2FA 4YSYB 4ABNA 1JROA 4LMQD 4CJ2C 5A2QL 1EYCA 4XT1B 4V0BA 1D5XC 1F2YA 3Q6SA 1CQFA 1ONLA 3OIQA 1S5ED 1C48A 3T51B 1H9SA 1TQOA 1ML0D 3E6ZX 2JSOA 3VR9B 4V190 3AE7B 1FRDA 4HCSA 4RH6A 3A7AB 4L2YA 2IJ0A 3C8YA 2A68C 2JXMB 2A74C 3VA5A 2R7ZB 1CZPA 5G3LD 1Q3LA 1W6JA 3DWGC 3OIPA 3HZXA 4KD4A 4QF4A 1VDVA 4RWSC 4C2MB 2RDFA 1NR4A 3Q8BA 3S9WA 2J4XA 2AQ1B 4DNRB 1SF0A 4MACA 1GOZA 1TY2A 4KKIA 1ZE3D 4WQMA 4NAMA 1KNEA 1BMLC 1YQ3B 1N63A 3NWSA 2R93B 2V4DA 4ZUJA 2KUMA 5T1GA 4IURA 2W55A 3RPFC 5C0XH 1MHHE 4S3SA 4N58A 4X3UA 4KX6B 3QOLA 1B3AA 4G7ZC 1TKEA 2Y5CA 5C4JB 3SFEB 4F7XA 2PKOA 1IKMA 4LAAA 5C6AA 3K5LA 4OO1H 3KLSX 4H2AA 1E2ZA 4ILWA 2KEDA 2QIEB 3VR4A 2K0PA 1TT2A 1L0XB 1JE4A 1Y1WB 2QDBA 3EQLC 5HFYA 2Q8TA 5M5YB 5KYLA 1N61A 3DWAA 3P63A 2PW7A 5LL6X 3AB9A 3IL8A 1K52A 1SFOB 1EIHA 3E56A 4H44C 2IX1A 5M3MB 2KN4A 3HOVB 4LTUA 2LKVA 3NTIA 4QMGA 1IBXA 4NMZA 4QUFA 1O80A 1SNCA 2PZUA 4KN4C 3ZJVA 4U68A 3T53B 1ILPA 1SNOA 1EWCA 4F8MA 4C1NI 4AYBB 1JC7A 2JP1A 4BY1B 3PO2B 1R4QB 1TS3A 1Y56A 4WIPA 1C9FA 4BY7B 1DOYA 4IALA 2AUKA 1TKWB 1JWSD 1PFBA 2YU9B 3KWLA 5K5PA 5C0XJ 4H13C 3ND8A 4KHVA 2LHEA 1JICA 2KMMA 3HRDD 2I38A 4MT5A 4F87A 3N9YC 2NVXB 1D6EC 5ISRA 1GJXA 3W5VB 3LX0A 4FXKC 3RUZA 5FO9B 1NSNS 4BA1I 2K04A 3HS0C 4K5XA 4HAEA 2KCCA 1L0VB 1YNJC 2A5HA 4KHZA 4A3JB 1ZYRC 2ZW0A 5BYSA 4M8AA 1O7ZA 3I4MB 1QOFA 3E5SA 2QKIC 3GB1A 5IODA 3VR2A 1AWDA 2F0EA 1PLFA 1EOTA 4C3HG 1K51A 1FFUA 3QIAA 4IFDI 2I46A 4WORA 2PNRC 3P7JA 3SVMA 2JA5B 5E1FA 1ZXIA 3OWFA 2FE8A 3J7AV 2XN9C 3NBHA 5H92C 2GRIA 4HKQA 4PMBA 1OO9B 2MGSA 4XDXA 1V1OA 2XRSD 4C1NK 2D9UA 1BF4A 2K01A 4KK7A 2L5TA 5CV9A 1OFFA 1FXAA 3U9OA 4FXDA 3A54A 4NZLB 2WXKA 2K6AA 5LL6S 4OO1G 4P6VF 4JPSA 1TIID 3VYSA 3KBGA 4ZHOA 2WU2B 2SAKA 1PRTF 3WCQA 2SNSA 4FNFA 2MUYA 3VQIA 2VUMB 1V1PB 1CQVA 3HVDA 1GB4A 4L8JA 4A93B 4OHJA 2Z4HA 2J52A 1XLQA 2H89B 4EE2A 5EKLA 2JEAI 2L52A 3QG1A 3EUB2 1STYA 2B2VC 3BDOA 3KLSA 4TRDA 2NMQA 4NW2A 1XCQL 3R3OA 1LT3D 1WTWA 1KLUD 5CV8A 1Y69U 3ABVB 4DXFA 4OZAA 1A2UA 1SMYC 3J7AF 2LFNA 3PUXA 1TKYA 1JMLA 4XQQA 5J39A 1NI3A 1STGA 1PUTA 2FFKB 4L23A 3JAML 5JJZA 4A3DB 3Q8AA 1FMAD 1I3QB 5CBEE 2WXOA 5ELEA 5I4DA 1RODA 1VLBA 2JXTA 2OT2A 5JPMC 1PRTD 4Y7NB 4ZRPA 2GB1A 3HGBA 1PGXA 4J3OD 1EYAA 5LHY1 3T13A 1WCMB 1B4OA 2B76B 4IUQA 1CJEA 1CZWA 3S1RB 1PTOD 3PO3B 3J7YW 5BYRA 2F1MA 3S1NB 5IT9L 1E7PB 1IGDA 3K5OA 3AE4B 1V97A 5KYIA 2N55A 3VR8B 5JVH3 4FF4A 2PPBC 1L6UA 2EJGC 1X3PA 4BWGB 1J9OA 1HHVA 2QMTA 2B8GA 1EYDA 2YEPF 4KN7C 1BCPF 1JORA 1QNUA 5I9PA 2O5IC 4IOIE 1JWUD 4R3DA 1G8ZD 5DM73 1MHXA 3NS1A 2E6XA 4ZHPA 1PRTB 1IL8A 2LJIA 2EYJA 3JAME 3D31A 4HJGE 4JX1C 1Z47A 3J80E 1LO5D 1HFNA 3VYUA 3AE9B 2PMZB 2D5DA 2WXNA 1J8IA 1JRPA 3MTSA 1NENB 5EPLA 4CHTB 2Z1CA 4KMUC 4EQNA 1F9SA 2DNEA 2NN6I 4A3GB 3Q69A 1I4GA 1G291 3FAHA 4LK1C 1DONA 5HG2A 2PMVA 3HOUB 3GTMB 2AQ2B 5AUKA 1ZEQX 1CFMA 1GB1A 5ELCA 1I7HA 1Q8IA 4C3HB 2NTTA 4JWUC 5EGTA 2Q5WD 1ENCA 2OHFA 1CK1A 2PCFB 4TKOB 2LFIA 2BDNA 2X6GA 5NUCA 2Y3AA 5KNBA 1XEEA 1C77A 3MJ5A 5HI1A 2A69D 1GUWA 4ZOHC 1Q1BA 1DOMA 1CHQD 4EQOA 4IFDJ 1NYQA 1G2SA 1TR5A 1K50A 1IUEA 4QUCA 2N9LA 4A90A 1JOOA 2BE5C 5HGTA 2DY7A 4XXEA 1OXVA 1XCTL 1EZ6A 1JQ4A 5I6YA 3A7LA 3Q22A 3NRZA 4FYDA 2K5QA 3TEZA 1PDQA 3B9JA 1F2LA 4IUUA 2G1EA 2F0QA 5J22A 1EY8A 3H0GB 3MHZA 1H9RA 4FF2A 3M7GA 1TWHB 2EYFA 1ET6A 4C56C 4FF1A 1TWGB 2N88A 4PQXA 1VRAB 1GUTA 2F0SA 3PV0A 3BK1A 1BCPD 3RZOB 2L0CA 5D3DA 2MHVA 2K22A 1W6KA 3S14B 5IGGA 2IX3A 2LEKA 3TBIB 5IGCA 3AH7A 1SSOA 3TZDA 3GS2A 5M5XB 4WFN3 2EZVA 1F2ZA 3C1FA 1SBBB 1EY0A 5I2XA 1L5PA 2ICEC 4FP5D 1D4BA 1L6VA 2CQAA 3GV3A 4CKCA 4WJWA 1G91A 4O42A 5EQ0A 2F0LA 2D5GA 2IPKD 2MJ3A 2FMMA 3KQ4A 5C3EB 1R4PB 2F0UA 3P4SB 3MA2B 2NBFA 1SIJA 3E9SA 2PZTA 4CJ0B 2EY1A 3FDTA 1B1ZA 1AW7A 3I91A 4KY5A 1U4PA 3TP5A 1GHJA 4XIGS 3NPPA 3W9CB 3P1MA 1XLOA 2PLPA 4KJOA 4RCNA 3GTGB 1BQQT 1FCLA 2CU3A 2ONQA 1IW7C 2OEDA 3OMGA 3VA7A 4QB4A 5FO7B 5IIFA 5EPKA 3TP6A 2RA4A 4A3FB 3I90A 2AUJD 5BN4A 3EROA 1FO4A 4A55A 1KH0A 3NTKA 2L55A 5EKKA 2WIIB 1SYFA 3J81E 2K7VA 2ENBA 1STEA 1U4LA 4A8XC 2F0NA 4OZBA 3C46A 2HTME 3BZDB 2B39A 2JZPA 3I70A 2Y0SB 1SYEA 3CQZB 3VR3A 3MHBA 1IYVA 4YT0B 4P16A 1QJOA 1T5XD 3KF8A 3T16A 2F0JA 3G7LA 4OO1I 1PFDA 4K5WA 3BIID 3OHXC 2R61A 1DCZA 4XTCS 4ZKCB 2NVQB 3OMCA 1JB3A 3BK2A 1OQQA 3U2SC 1A15A 1KTKA 1SB3C 2NTSA 2QSDA 2XSCA 5D3IB 4FXGC 1V1PA 1MGSA 2Z4IA 3ZQ4A 1PTOC 1J7BA 3FKIB 3VRAB 2E2DC 5JEAH 5CV6A 3DWMA 3MEHA 1XF5L 1EZ8A 2BB6A 3KUPA 5JXVA 4JE3B 1S5BD 3P1HA 1SAPA 4HEDA 3SR1A 2GA4B 3SDZA 3PIO3 2KAJA 5A2QE 2MP1A 2K5PA 1QT9A 5G5HA 1HUMA 1RJTA 2N7JA 4IZ8A 1KAAA 1Y8OB 3BDLA 3K5NA 1ZXTA 1RTOA 2BW2A 4IQZA 1WRIA 3IKJA 2VB2X 2WV6D 4PT5A 2TSSA 3GO5A 2EYPA 2RKSA 3M4OB 3NE5B 3G6JB 1FGBD 3AMZA 1Q10A 1AP0A 3URYA 2WAQB 3O13A 2EVBA 4J1MA 4ARIA 4NDXA 3VRBB 3SHLA 1C4AA 3V2TA 2A68D 1FXIA 4RF1A 3PZ8A 2KECA 2KOLA 3MWYW 2BT6A 2R3ZA 3NWTA 2E75C 4GZYC 3CHBD 2J42A 3OPOA 1VF5C 2LUMA 2KJXA 5DNFA 1AZPA 5A35A 2BS3B 2L11A 3NVWA 3AE8B 5GXGB 3IXSA 1SE4A 4AS1A 4RA8A 5M5WB 3C3LA 1CA6A 1B9RA 1WD0A 4BA2I 3AE3B 2BA1A 3V96A 2EXZA 3CRLC 2WXFA 1CM9A 1YNTE 1PZKD 4MHEA 1S5DD 1KABA 3HOXB 2NWGA 3EVQA 1YNJD 2H4OA 2IL8A 3SK5A 3U9SA 4AQ7A 1F2RI 3S2DB 3N52A 1PTOH 5JVG3 1B50A 1EU3A 3D3RA 2NVTB 2INNE 1NCVA 2WXGA 2DYOA 3AM9A 3DUZA 5ELDA 1SYBA 1GHKA 3A8KE 1K53A 5IGDA 2X6LA 4TSSA 3UI3A 3BG3A 1PFNA 2WP9B 2B2WA 4YXDB 2FHTA 1QKZA 2RPVA 4HMIA 4Q2JA 3U52E 1HCZA 2F0VA 2EY2A 1KDAA 2B2UC 2ZW1A 2WXQA 1HQMC 1XLPA 2QJLA 4WRDA 2F0IA 3QB3A 3LWUA 4K6LA 4RHSA 1GUNA 1LTSD 4DFAA 2WXIA 5G3LF 2R6GA 3ONAB 4K14A 2EE1A 3K59A 1WSPA 2KHSA 2BYTA 1KFYB 3P42A 5C2TB 2IX0A 4ID6A 3AE5B 2OXPA 1LT4D 1DM0B 2WXHA 1MI2A 2JYTA 1RHPA 4K8IA 3RLFA 4C3JG 5K36H 4G7OC 1QOHA 2W54A 3RD4A 3TZUA