1I4QA

Crystal structure of staphylococcal enterotoxin c2 at 100k crystallized at ph 6.0
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
239
structure length
234
Chain Sequence
ESQPDPTPDELHKSSEFTGTMGNMKYLYDDHYVSATKVMSVDKFLAHDLIYNISDKKLKNYDKVKTELLNEDLAKKYKDEVVDVYGSNYYVNCYFSSKDNGGKTCMYGGITKHEGNHFDNGNLQNVLIRVYENKRNTISFEVQTDKKSVTAQELDIKARNFLINKKNLYEFNSSPYETGYIKFIENNGNTFWYDMMPAPGDKFDQSKYLMMYNDNKTVDSKSVKIEVHLTTKNG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ENTEROTOXIN TYPE C-2
publication title Structure of staphylococcal enterotoxin C2 at various pH levels.
pubmed doi rcsb
molecule tags Toxin
total genus 67
structure length 234
sequence length 239
ec nomenclature
pdb deposition date 2001-02-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01123 Stap_Strp_toxin Staphylococcal/Streptococcal toxin, OB-fold domain
A PF02876 Stap_Strp_tox_C Staphylococcal/Streptococcal toxin, beta-grasp domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.110 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1i4qA01
3.10.20.120 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1i4qA02
1YN4A 3BVZA 4RGTA 5ELFA 1S5DD 3SEBA 3GP7A 1SJHD 1SXTA 3V05A 1RD9D 1KLUD 1PRTD 1I4HA 5TSSA 1FNVA 1LTGD 3BVMA 1BXTA 1SBBB 5D3IB 3EFXD 1XXGA 5ELEA 1BCPB 1HTLD 3R8BA 1D5ZC 1STEA 4RH6A 1EU4A 1JQYD 4ZYSA 1KTKA 1PRTF 3BYTB 4DXGA 5ELCA 2R61A 1LTSD 4TSSA 2XN9C 2QILA 1I4PA 1LTBD 1ESFA 1QILA 2RDGA 5D3DA 5FKAC 1B1ZA 1RCVD 4RHRA 4RCOA 4DXFA 1EEID 2SEBD 1FD7D 1ET6A 1TS4A 1M4VA 1L0YB 2AQ3B 1B44D 1I4RA 1JWMD 3URYA 1LT3D 2RDHA 2IJ0A 3BVGA 3BZDB 1JWUD 1AN8A 1S5CD 1PRTC 1DYQA 1TY2A 1L0XB 4RFBA 4Z9CB 1HA5A 1LTAD 2XRSD 3W2DA 2XNAC 1DJRD 1LLRD 1UNSA 1V1PA 3R2TA 2AQ1B 5ELDA 2XRQD 1I4QA 3OWEB 1HQRD 1EEFD 1PRTB 1PZID 4RGNA 4L63B 2Z8LA 1CHPD 2O2LD 1PTOD 4OHJA 1LT5D 1RF2D 1T5XD 1JWSD 1XTCD 4RHSA 2QEJC 1PTOC 1G8ZD 1PZKD 2WV6D 1I4GA 1GOZA 1HXYD 2AQ2B 1CHQD 1D5XC 1F77A 1SE3A 3KLSX 1SE4A 1S5FD 3BYYB 3DWAA 1FNUA 1PTOF 4BWGB 2TSSA 4RGMA 1LTTD 1EWCA 2CHBD 2G9HD 2J4XA 1BCPD 4C56C 1JR0D 1V1PB 3MFGA 4K6LA 1YN3A 1BCPC 4NZLB 1S5ED 3CHBD 1LT6D 1PZJD 1RDPD 1LT4D 1ENFA 1SEBD 2IPKD 1TY0A 3DWPA 1SE2A 1AW7A 4UDUC 1PYWD 1D5MC 1BCPF 1JCKB 5FK9C 1FGBD 1KLGD 1FNWA 2NTSA 1EU3A 1PTOH 1V1OA 1LTID 3TSSA 1LTRD 3EA6A 1D6EC 1CK1A 1EFID 4L6TB 1UUPA 1ET9A 1CT1D 1S5BD 1PTOB 3DWQA 3MC0B 1TS5A 4O1NA 3R2IA 1TS3A 1YN5A 1I4XA 2ICIA 1LO5D 4RGOS 5I4DA 1CQVA 1MD2D 1SJED 5ELBA 1TS2A 2NTTA 3O13A
chains in the Genus database with same CATH superfamily
4B3SQ 2F3VA 3RNUA 2KYWA 3GP7A 2ZPNA 4IFDH 4RF0A 2ZTCA 2WAQE 1Q1BA 1PRTD 3GZNB 1C77A 4R9WA 2KMCA 3CMEA 2JA7B 4ZK9B 2AL3A 4RF1A 3B2FA 1N60A 3EFXD 1HTLD 2DY8A 2R6GA 2BWES 3OTOL 2B2YC 3AE2B 4K5VA 2Y0SG 1QWYA 2PMZE 1JROA 4ZYSA 3NSWA 4EUTA 4WORA 1X9NA 1I6HH 4N6EB 4C2MB 4FF3A 4HDOA 4MELA 4TQ1A 4D2KA 2AWOA 1CKNB 4OZAA 5CV4A 2RA4A 4C4VB 4KVGB 2D10A 2EYJA 1Y56A 4A3GH 1MJEA 3KDFB 2LZ6A 5DNFA 4RCOA 1OEYA 2D3GA 2LGIA 3VTWA 2K7VA 5KYLA 1E8XA 2BW2A 1OO9B 2FHTA 2ALYB 2VNUD 3FPUB 1SIJA 3K9PB 1H9JA 1SR3A 3PTFC 1NR4A 4WURA 3S2AA 5FO8B 1RKNA 3ER0A 5K5PA 2IO1B 4JBWA 3Q3FA 3VRAB 1N33Q 3EQLC 3X3NA 5IGCA 1V9PA 1DJRD 4Y7NB 2RVLA 1TIID 1T0YA 1AEXA 3Q24A 1SGHA 2Y5BB 2D5GA 1LUZA 1YHQA 2OEOA 4A3BB 1U4MA 1SNPA 2W3SA 3HIZA 4H0LC 2P5ZX 1A3TA 1CA6A 4GZYC 2KHWB 2KWUB 1C3TA 2QEJC 1PTOC 1RLFA 3S1RH 2WV6D 1VCBA 1V8CA 5BYQA 2KHSA 4M02A 3EN2A 4K5WA 3SR6A 1S1QB 1WYWB 4IFDJ 3CU7A 2L0FA 2KTFA 2N7JA 1RL2A 2Z4HA 2NBWB 3NUCA 3I4OA 5C3EH 1CTMA 3K6OA 2LHEA 2ZVNA 3PZ8A 2KVRA 3TEZA 2Y0SB 4BOSC 1K52A 1JB3A 1T6BX 3E9SA 1VQBA 5M3FG 1ZDVA 4ULLA 5EKLA 2J42A 2JEBI 5KEEA 2EVBA 2VY3A 4K6LA 4AQYQ 3S1NB 4PNYA 4BKSD 3FP9A 4NZLB 3IFDA 3T1HQ 2PKOA 4G7OC 5T1GA 5G3LD 4PK1A 4JYAQ 2K50A 3NEMA 4KK7A 5HHDG 4G3XB 4A3LH 1KLGD 2FCQA 4L5TA 4OO1G 4AWJA 1EYCA 2IT1A 3BK1A 2WB1E 1B3AA 3U52E 3L4PA 2Q2IA 3VA7A 1CA5A 2WNMA 1Q8IA 2Q5WD 4YL8A 2PO4A 1J7BA 3ND8A 5GAEC 4FXKC 2YU9H 1WX7A 1PFMA 3VR3A 1KAWA 2EYOA 1WTQA 2Z0EB 2EDGA 5EBCA 3AV8A 5I4DA 4KY5A 3SK8A 3RI7C 1UWMA 3RULA 3RR5A 2KACA 3I4NG 3G7LA 3BVZA 5E4WC 4A3DG 5C1ZA 3HOVG 2V3NA 2ZM6Q 3I57A 5E3FA 1IBLQ 2F0GA 2LKVA 1UGMA 4HIDA 1NY4A 5JJIA 2JA6G 4LFAL 2ZNVB 4ZHPA 2A5HA 4IUNA 5JPMC 3J9CA 3KUCB 1EQTA 3N52A 1JC7A 4B3MQ 3FKIG 3HOUH 3VR6A 4NAMA 4DR7L 3Q14C 4ANXA 4LNFA 1SNMA 3BJUA 3S1MH 3SHLA 3PCOB 3T56B 4UP9A 4LFCQ 4FBJB 3BK2A 4JVZA 4K0KL 1A2TA 1C9OA 1MSHA 4IC7B 4AQ7A 1Y1VG 1B1ZA 3W1GA 3P2BA 1J8IA 2Z0DB 3P4QB 1PH5A 2A4ZA 2MJEA 2XWBB 2ASQA 1PFBA 1R4MI 5IGDA 2B76B 3HOXH 2PW7A 3HM6X 2NVTB 3AXCA 4PQXA 2WX1A 2NN6I 4QY7A 3FRPB 1XLNA 4P73A 1DYQA 1B3QA 4GDLA 2K05A 1TVXA 2J0KA 2VH2A 4WJPA 5GXGB 3A1QA 2EY5A 4IUPA 1SYFA 4UPAA 1E8ZA 1I6VC 1ONLA 2L00B 1QZGA 3ENEA 1YIJA 4JI3L 1P7EA 4LK0M 1SSNA 3LXFA 3DVNV 2JA8B 2BQQA 2UWQA 3QA8A 1SF0A 4XDXA 2MBQA 1CUKA 3C3LA 1N5WA 2REXA 3QB3A 1TT5B 1CHPD 4JW0A 1EY5A 1WX9A 1L0WA 1Q82C 4HK2A 2F0SA 2G1EA 3L08A 3I4NB 1PGXA 1B70B 1KDCA 3NQTA 1F2RI 3HOVB 2K5HA 1TKYA 4M01A 1XPUA 1UE1A 3RN5A 2OHFA 2JA6B 4A3JH 2JJQA 3NWTA 1YJNA 5DAUA 1EIYB 3N1ZC 2JX5A 1ZKHA 2ON8A 2K04A 2XIWA 5IYCH 3I8ZA 5COYA 2LVPA 2JVCA 3FKIB 2R2QA 2B63B 1HPCA 3GTQH 2JWUA 1UEAB 1F1HA 2BDOA 2NMQA 3MTSA 3WA0A 3NG0A 4ZUJA 1BO0A 3J7ZC 4TVAB 3ND9A 1Y1VB 1VQGA 3M4QA 2HIXA 1D4BA 1WJJA 1GG3A 5MPOA 2UU9Q 2PZWA 1A6XA 5M5YB 1QG7A 4NP5A 2FUG1 3P63A 3D0FA 3ZLZA 1WGHA 1FO4A 2V9HA 2K8HA 3J7A5 4MGKE 2BS4B 1EY0A 5CV7A 3TSSA 2N9LA 3ZO5B 3AQQA 3MEHA 3FILA 3E5SA 4LTUA 1D1IA 2R3ZA 1IYFA 3H0GH 4KHVA 3MJ5A 2R93G 3AE6B 3Q2AC 1GJZA 1O80A 1R4MB 4C00A 3MC0B 3K0XA 4ZUIA 3C2PA 1RIPA 1H9SA 3ABVB 3PMFA 2HCIA 3AEFB 2JA7H 2NVQB 3IAS1 1E10A 3GQBA 4R1JA 2VZAA 3QQ8B 3NTHA 4K7SA 2AUKA 1NJIC 1N32L 1S3SG 3PO3G 4RGTA 5CC4A 4LUOA 1S5DD 2BE5D 2CU1A 3S1QB 5IN7A 3CMMB 4XTCS 4C2MH 2AYOB 1SAPA 4DFAA 3VH4B 3CCLA 3TRZA 1WSPA 3NOBA 5CMDA 2MGSA 1DM0B 1ZOYB 2MLBA 3DBHI 3QK0A 2I5HA 1QB5D 4DV0L 4QB4A 1VD2A 1E2VA 5JEAH 3X0WA 2V1CC 2J52A 1EU4A 1JQYD 1JRUA 3TQYA 3EECA 4F8CB 4MTNA 4HCSA 1HNWQ 3A8KE 3Q8CA 2KDIA 4PMWA 1U9RA 5FR3A 3H15A 3ZJTA 1NDDA 1FFVA 3K9OB 3H3VI 4Y52H 2BYTA 4JCVE 4GU2A 1ESRA 4OELB 2L4NA 1J5EL 2KECA 1XPOA 4PZ7A 1E9MA 1VMCA 1IKMA 4HDQA 3KVFB 2E8GA 2VZKB 4Y7NH 1RFKA 4GB9A 5J18A 1EYGA 2YYZA 5I9PA 3LGJA 2E5LQ 2JYEA 4A3BH 1RTOA 5LL6S 1HA5A 2JE6I 3NVWA 4NW2A 1UNSA 4IPGA 3RUZA 3UGBB 3R2TA 1VQ7A 1XJVA 2R93B 4LJZC 1CI3M 1D8LA 1MBYA 2MJ3A 5E6OA 4KD4A 4I7ZC 1WJUA 1EY7A 4US8A 3MHZA 2O2VB 2J0MA 3L17A 1XX8A 4IM3A 1HJPA 2PMVA 2IWHA 3D4RA 4DF7A 4B3TL 1NR2A 2F0UA 4QGUA 1YIWA 2C7MB 4RMFA 2KANA 1WFQA 1YNND 2J0JA 1HR0L 4EZJA 1EQVA 2RMMA 1STAA 2K01A 2LGYA 3V60A 4C3IG 5H8YE 3AULA 4WWPA 1STGA 4DXAB 1SMYC 4IUMB 4BWGB 1ZPSA 1MG8A 4GGQA 2Z4IA 4CHTB 2BBCA 1WFYA 3A9KB 1XCTL 5JEAJ 1OXUA 2G4SA 5IYBH 1F2LA 2FE8A 3MFGA 2KJ6A 4A93H 1U5KA 1EUVB 1LT6D 2I5MX 2ZJRA 4IFDI 4DHJB 2C9WB 4EQNA 3S2HH 4LDTD 1PUTA 4OWTB 2Q2TA 1WXMA 3ULLA 4JV5L 3AMZA 2E6XA 4HKZE 4UDUC 4DK0A 3N32A 3S24A 2F03A 1PXUA 2K1FA 3A8IE 3VR8B 3P1HA 1WX8A 3VTVA 4JI5L 2N88A 3KLRA 4KHZA 1XMQQ 4JPBW 4K14A 4DV2Q 1ZKOA 3E9HA 2HQLA 3D6WA 4WRDA 2YV5A 5CV9A 1P7FA 1I42A 4HIMA 5D94A 5EPKA 1K73C 1CJEA 3IFTA 4DUYQ 1EYAA 1PH2A 1GUNA 3QIJA 3RMKC 5GQOA 1RM6C 1AE3A 1X54A 4KV2A 1TS3A 3KLSA 4POFA 3S2DB 4M8NA 4URKA 2KTRA 1WI5A 4RGOS 2F0NA 1CQVA 4LF8L 2JXMB 5ELBA 3QHTA 1EUJA 4XQJA 3T1YQ 3VR9B 3O13A 1TYGB 2LGDA 3MJWA 2SOBA 3IVFA 4CJ0B 3UQAA 1SXTA 1TQOA 5I6WA 1RD9D 3UI3A 5C3JB 1KLUD 1EWYC 1VDZA 2XVSA 2EQSA 3BVMA 2WXOA 3KFUA 4ZAIA 1XXGA 3ONSA 1GB1A 3TS2A 1GAQB 4CBVA 4C3IB 2DAJA 3BDCA 5K36G 2SNSA 1MHWC 2PW9A 3K7UC 3TBIB 1M8AA 3D6CA 1YJ9A 2Z6BA 1AWDA 2V4IB 1TBEA 3VHTC 3CCMA 4YSZB 1ZEQX 2ZJPA 3L10B 3HUIA 2EMSA 4OO1H 1SNCA 4KZ0A 2BVCA 1FD7D 2KTRB 5BR8L 1HNWL 1E24A 4PYZA 4UHVA 4G7ZC 3RLOA 4BY7G 2A5UA 4M1UB 4EFOA 4OXPA 1VQ8A 1BR9A 3D4DA 4LFBQ 1MHHE 3QCAA 5E6PA 2X38A 4OIJA 3HKZE 2JA8H 3HS0C 1L0XB 1IBXA 1GXDC 1EY6A 3HVZA 5JVG3 4E3CA 4A3OA 3OLMD 3MTNB 4KI0A 1MI0A 1O7LA 1AE2A 2O6VD 3O65B 4F7XA 5BMIA 1GUAB 2RSNA 3I4NH 2KDBA 1DOYA 3N30A 1I5FA 4A3MG 3HOVH 5ELNA 2JXXA 1WTHA 1EY8A 3PO2G 2PEAA 2JA6H 4N9F4 3GTMB 2FFKB 2F3WA 1BBUA 2UU7A 4NQKE 4C3JB 4BBSB 1L7YA 1LT5D 5M5WB 2NBUA 2IW3A 1ZXIA 3RZWC 1GC6A 1VQJA 3IRBA 1YHBA 1WD1A 3FKIH 4C3HG 2D0OA 4WFN3 1UGJA 2KX0A 1NE3A 4LNIA 4K8IA 2B63H 1GJXA 4ZDVA 1RHPA 1PH7A 2DJGC 3NHHA 5DM63 1P16A 3BYYB 2OQ0A 2QJLA 5D6JB 4E74A 4ZKCB 1DD2A 1K8OA 4ZCKA 3PHXB 1Y1VH 3T8MA 3V2TA 2G9HD 2K8BA 4YCUA 2F0JA 2KQ7A 1KHIA 3W9CB 2GRIA 2EYHA 2HJ8A 4W9HA 3T4AC 5M5YH 4LNOA 3OYYA 1S5ED 1RDPD 2RF4A 2K5VA 1E0ZA 2K5NA 2BYVE 2K22A 2UXBL 2IDYA 3SHQA 1WTVA 5I9OA 3ZNHB 1SE2A 2MW5A 3R66C 4OX9Q 3STBD 4WJ3M 1BCPF 1E1TA 4EQOA 4J3OD 1FGBD 5JOBA 4AJWA 4JWSC 3K5OA 4FF4A 4J8QA 1BBWA 3L7ZC 4S3SA 4E6IA 1VQEA 4GNXA 2KVZA 5C4HA 2AMCB 3J81E 1R4NI 2NVQH 1K51A 4AYBB 2VQEL 3DQVA 3SDLC 5EE0A 1STHA 2J7ZA 1E7ZA 2XBBC 1DOIA 3G48A 2V0GA 5GMVA 3AE9B 3WAPA 2LVQA 2N7DA 2JP1A 3QJYA 3VYUA 3BDOA 1STBA 2R2OA 2WXPA 3QARA 3S1QH 1Z5SB 4HXDA 3QOLA 2FBWB 2QCZA 4A3MB 4CYEA 3CXCA 3AFPA 4A75A 1H4RA 2WWZA 3PIPA 4X6AH 5EGTA 3GTPB 3PO2B 2KHJA 4GKJL 4XDDA 3GTKB 5EE3A 2GOWA 3IT4B 1SJHD 3RD2A 2INNE 3TP8A 4DR1L 4C3HB 2Q8TA 5AJ3Q 1QZHA 2I07B 2JA9A 3CC4A 3JW0X 1YVCA 3U4ZA 1CZGA 1TXYA 5IY0A 2HUGA 4ICUA 3R8BA 3DHGC 1KC8C 5BN3A 2CVRA 4IPCA 4KHPQ 1QOBA 1MFWA 4O0AA 1V1QA 2PVGC 1KTKA 2DZIA 3SFEB 5NUCA 1UAPA 5CYUA 1VQLA 1L1OA 1HZ9A 2B2WA 1SNDA 2GBRA 4HTHA 4GN5A 1JJGA 1WI0A 3N9YC 1X1MA 2RDGA 1EIGA 2L05A 1GO3E 5EBDA 1GHJA 3MEFA 4ZRJA 1IGDA 3JAML 4RKBA 1B44D 2EPBA 5LMNW 3GTJB 3HOYG 3H94A 2EY2A 3OTOQ 1BOSA 5IE8A 1VQKA 4HPLB 2NZ1D 3ALBA 1WGKA 4KY7A 3NUHB 3CPWA 4FJZA 2R93H 4A9AA 4DK5A 1FMAD 3FPPA 3GE8C 1BUIC 4FLHA 1J6QA 2WS3B 2AHOB 3TN2A 1WGRA 4W9FA 3W2DA 1K83H 1QOGA 2PI2E 3HK0A 1WR6E 1SYDA 1B50A 4E71A 3I63C 2IX3A 1FCCC 4XWTA 3GTOB 4JC0A 4YTNB 3TUOA 1MIUA 2N49A 4PMCA 2WGSA 2HIVA 4CJ2C 2G45B 2MA9B 3AEBB 5IGGA 1C7YA 2L3ZA 4P2CB 1EF1A 1R4NB 1EZ6A 2A6HD 3A9JB 4DV5L 5G55A 3VXWA 2K1BA 1S72A 4A3KG 1ACCA 2WAQG 3GD7A 4C1NI 3PLVA 3QWNA 4DR5L 3PUZA 5DEHA 1ZGUB 1FL0A 4L5QA 3DWAA 2LRWA 1FNUA 2N1VA 2DZKA 4IW0A 4FN2A 3N20C 1LTTD 4NKLA 3MFYA 2EJGC 5HFYA 3E6ZX 3HG9A 5IP7G 1YQBA 3T16A 4BA2I 4KLKA 4X62L 3GZNI 3I4MG 3WANA 2F0QA 1BCPD 1JOQA 2RBMA 2B2UA 4G57A 1WTXA 1VF5C 2L12A 2XGTA 5BN5A 1FCLA 2ZXOA 2Z6KC 3MVVA 2WU5B 5IO9A 1UE7A 4IG7B 1ENFA 1NNXA 4B08A 1WXAA 1I50B 3G71A 2BT6A 4AS1A 1HTPA 3NQIA 2ACZB 3RCZA 3H3VH 3H1UA 1CKOA 1HE8A 1FJGL 3L0OA 1KRTA 3RPFC 1FNWA 4NJ7A 3STBC 4APVA 4MZ9A 5JJZA 3KK7A 1GKHA 4IWOA 2DNCA 3AYHB 4JOIC 3S2DH 3EHVA 2CW0D 2KFKA 2PIAA 1HNZL 2KEDA 1ET9A 2K52A 3L2PA 2BH8A 1DXMA 1IBKL 3PPAA 2B39A 1GHKA 2EYMA 5G2NA 3VUXA 3H09A 2BTEA 1FPYA 2GBMA 3Q8EA 4MSMB 2K9XA 3DHIC 3KW5B 5KIXA 4HN7A 1C0AA 4HLEA 2A68D 2HJ1A 2ASBA 4ODGA 4HIOA 3Q3JA 3K80C 4TMAB 1PFNA 1TJEA 2DJFC 4WWNA 3ML9A 4UAIA 2EZVA 5ELFA 4C3IH 4RMAA 1LACA 2F0PA 1HHVA 1Y69U 3V6CB 2E75C 3TEWA 3DM3A 3PSEB 1TWHB 3PZ7A 5D3IB 1KFYB 1PV4A 2R7DA 4I7AA 3VQIA 5E7NA 1VQAA 1FEHA 2KOXA 3RZDB 5G3LF 5BO4B 1CKNA 4M8MA 3RNEC 3NWSA 1IYJB 2PMZB 3KF8A 2FMCA 4DAPA 5GAGC 2KWCA 1U4LA 1YD8U 1UWXA 1Q5WB 2JQOA 1KDAA 3I4MB 2MBEA 3KDFA 2R92G 3M7NA 3PVLA 4OZCA 5EKKA 2MEKA 3RLNA 1KJTA 4LFAQ 1JORA 2SEBD 1QOHA 3CSFA 3ML8A 4FJVB 2KBNA 1P8LA 1E5WA 1YNXA 3K81C 3GV3A 2L7RA 3RNCC 5FLMG 2INCC 3TL5A 2E76C 2IJ0A 1E7PB 4JI2L 4DR7Q 2KWDA 3LNNA 3AU5A 1XO3A 4QMGA 3SE0A 2WB1G 2K5QA 2O4XA 3SK6A 4XQNA 3RN2A 2KC1A 2JZ3B 5CV5A 2EOTA 2MP2B 2R7ZB 1SYCA 3I9V1 4PYUA 5CHWA 2E74C 3M4YA 4K0KQ 2G3QB 3GTMH 1F2YA 3QX1A 4C3JH 4BBSH 2JT4B 3OWFA 1N5XA 4G4KA 4AUQC 3OWEB 3AU4A 3NZUA 1HQRD 1WGDA 3D8GA 4DV7L 1K8AC 1DGJA 3KF8B 1RTNA 2D9UA 2MJDA 1EEFD 3K57A 4LNQA 3ZTDA 3BS1A 2BA1A 3HZXA 3N6RA 4QUFA 1ZP0B 3KH0A 3NRZA 2K32A 4Q0FA 4A3IG 4IOIE 1HZ6A 1XT9B 2AKWB 3FDTA 5C4XH 2Z59B 2LMCB 1H95A 3DCGA 3CD6A 2WDQB 2QMTA 4EQ5A 5K36H 1L0VB 1VMPA 4X66L 3MC9A 5BYSA 1IKLA 5CTRC 4IZ8A 1II3A 4LUVA 3QAQA 4JI3Q 1TWAB 2X69A 2KD0A 1XNRL 3PHWB 4J15A 2NB0A 4YT0B 4ME5A 1YX6B 4P6VF 4WJQA 1X3PA 3TMPB 2J4XA 3OW7A 3OJ3A 1Q3LA 4NXNL 4A3EG 4G0NB 3R3OA 3BWUD 4GDKA 1BCPC 1X3FA 3MZ5A 4IO9A 2R92B 3E56A 4JPSA 4LAAA 3WALA 4II2B 2BKFA 1R4QB 3F2DA 1VQ5A 1C4AA 2IPKD 2GBNA 3BZKA 2B8FA 4NJCA 4X65L 3PUYA 1K50A 2RQXA 4MSQB 1FXTB 5FK9C 1RJTA 1E90A 1Q1OA 2B2WC 1I35A 2W9NA 1E6EB 1FRRA 3SDZA 4YXDB 1DZ1A 2JY6A 5HKHA 2WB1B 5FJ8H 4A3MH 3U4VA 2KO3A 4YTPB 3ZKJC 1CK1A 3PV0A 4EEWA 1W2BA 4KIKB 2PE9A 1VDVA 5EAYA 2CW0C 1CT1D 3PO2H 3E3XA 3GTKH 3EUB2 2YTVA 3SU8X 3NXWA 1XNQL 4OO1I 1FVIA 2CJOA 4B6WA 4CHKA 1OQRA 1JE4A 1IW7C 4OEMB 4C3HH 1SE9A 4W9IA 4BFRA 1C48A 1K9MC 4HEA1 4GDKB 3J80L 2A68C 3HOWG 2FJ2A 1F52A 2NBVB 2QKIC 3J7YW 3S17B 1MPEA 2I1KA 3BY4B 4N59A 3UINB 4JIOU 4RM8A 1CZWA 3D31A 1I4HA 1OGWA 3F1ZA 4HWIB 1ASYA 4L8JA 4FHJA 4L1BA 1MSGA 2VXWA 4GLXA 3DBSA 3P7JA 4RH6A 1ML0D 4H2AA 4XZ4A 4R4OA 1PYBA 2N9XA 1N32Q 2MPMA 4BAXA 3NS1A 1Z6HA 1SLJA 2F1MA 4PS7A 2D11A 2BWFA 4K3BA 4TKNA 1LTBD 2NBFA 1VQDA 1QILA 4KZCA 4RHRA 2B2VC 2KZRA 5FO9B 3VFKA 3W1SC 5D14A 2MCNB 3WAMA 4N8X1 4DHZB 3GS2A 4A3FG 4IQZA 2F0LA 4AH6A 2AQ3B 4DV0Q 1N34L 4IDIA 2LUMA 2PPBC 3I70A 4FHKA 1WOCA 5BMHA 1S5CD 1EY4A 4GOPC 1PRTC 1SE8A 2KUMA 2B2TC 4RFBA 2K39A 3GTOH 4F1SA 5JHBA 5AZHA 4K3CA 1DONA 4IWPA 1LLRD 3KYCD 2PE6B 2IL8A 2FAZA 2KXJA 1YBYA 1PFSA 3J81j 1HRJA 1J5EQ 5IP9G 4IKGA 3HFZB 5M3FB 2V1YA 3RD4A 4FXDA 3AE3B 1QUQA 4LMQD 1Q86C 2UUBL 1XTCD 4N9PA 1JWSD 1R4PB 4RHSA 1BBXC 3HOWB 1L5PA 2Y5CA 2F0OA 3QIAA 3S9WA 1AARA 1WCMG 5IT9L 4DR6L 1HCZA 1UELA 4FXCA 2C5LC 3U7ZA 4DDGD 3M4PA 1E7UA 1FIQA 2VB3X 2K5WA 3KLSX 2WXMA 3ZTCA 2ENBA 4J1MA 1ICFB 1Y8NB 2TSSA 4RAUC 3I3CA 2D5DA 3K5LA 2K6AA 4NDXA 4KKTA 2V3SA 3CF6E 1I50H 1XMOL 1GUTA 3AE7B 4K2KA 5DPSA 3C8YA 1IPGA 4B3TQ 5JZEB 1VLBA 1YX5B 1JB7A 1U4PA 3U9SA 1TWCB 3QWZB 4FYDA 2ZW0A 4NAWA 3GB1A 3NE5B 3DVNU 1IZ6A 3W3AA 1HR0Q 1NYRA 5EPLA 2JYTA 2E3TA 3AM9A 3MC8A 5KHOA 1B9NA 2QF7A 3AEVA 4HJGE 1QUQB 3UF8A 1AW7A 3AFQA 2K5DA 3CW2C 4C1NK 4A3DB 5KGUA 4MGIE 3I2ZA 3OIPA 4JBMA 1K8MA 1VQCA 2DYOA 4GMVA 4K81A 5LXIB 1C4PA 3L13A 1UH6A 4W9LA 1FYCA 3I5JC 4HMJA 4DK6C 5E6NA 1FR3A 2RDFA 3KOJA 1EFID 2OJWA 4OWWB 5JJLA 2F3IA 1VZ7A 3B0AA 2X8XX 1D1KA 3UDIA 4P1CC 3U9OA 1MGSA 1BF4A 4JV5Q 4KSLC 4A6QA 4O1NA 3H6MA 1L4DB 3FKYA 3KWVA 1Q90A 1Z2MA 3B9JA 2N3SA 3NBHB 1TWHH 1A3VA 1KH0A 3PV1A 2FINB 4IPDA 4JI5Q 3S15B 2A73B 2DY7A 5C0XG 3H91A 4DR3L 2NTTA 2ZW1A 4NAWB 4B9KA 5LLIA 2PQAB 3SEBA 2FCMA 5J3BA 4MH0E 3RZDH 1VQFA 4HSVA 4OW0A 1NI2A 4YTMB 1FRDA 3KUDB 3TMEA 5H92C 4IWQA 1WCMB 1M1KC 3J7AV 3AE5B 3A74A 4DNRB 3MXGA 5HG2A 4DKAC 3ZNID 1RRBA 1ROEA 4OVUA 1CZPA 1WGYA 3ERQA 4LF8Q 5LMNL 3APDA 1YEZA 4ZRPA 1SDFA 3BYTB 3CIRB 2R61A 3Q23A 3C1EA 1NENB 4XYQA 2QILA 4QIWB 2M0XA 1MG4A 1VQ4A 3ZJYC 2IX0A 3DPDA 5HGTA 3AE8B 2KWVB 2V4DA 1G6PA 2R7ZH 2ZCBA 4R8NA 3W1BA 4C7ZA 1SB3C 4HROA 3LDZE 3SK4A 2I2YA 1B9RA 4I6PA 5C3WA 3K5NA 2IGDA 2K6QA 3W5VB 3RYTA 5JJKA 1XPRA 1IL2A 5CGKA 2QC8A 1G6JA 2DN8A 2ID0A 2QDFA 1P0RA 5IYDG 1SNQA 5BR8Q 1QZEA 3Q8AA 4HJKA 4MDKE 3BINA 2O2VA 1AH9A 2N7EA 2F52A 4XWWA 3KLWA 4HMIA 4RGNA 4L5SA 4IJHA 2Z8LA 4DV1L 2HD5B 2O2LD 4U68A 2E2JB 3CCVA 1TWAH 4OHJA 1T5XD 2JA5G 3MHSD 3PRPB 2LUEA 2JK8A 1LTLA 3BDLA 4KTAA 2BF8B 1UWVA 3NVVA 4BS9A 2VQFL 2Q8IB 3ZGZA 1WTOA 4NY0A 1H8CA 1EM7A 4IM2A 1HUNA 2EY6A 3GTGB 2VL6A 5J17A 3A9KA 4DU9A 4H13C 3V96A 1A8VA 3KUPA 2ZNVC 4B0EA 2FUHB 1GUSA 1F2ZA 1YI2A 2PTLA 2WLBA 3I55A 4HRSA 2L1BA 1VZ6A 5FLMH 3CP0A 2MSED 2FMMA 3NJTA 4XQQA 1RYJA 2KCCA 1Z7TA 3HEJA 1PVOA 3DWPA 2DYBA 3RZOB 2JF5A 5C3XA 3UDXA 4BY1G 5CORA 2ZJQA 3PO3B 2F4VL 2YEPB 1IBML 4MIUA 5IGFA 2L83A 2BPSA 2KQSA 3Q69A 1TKWB 3R93A 1K3RA 3PF4A 1K53A 2PNRC 2K6DB 4MGYE 3S1NH 4YWKA 3HKZG 4YHHL 4KJOA 2VZKD 5E4XA 4DQOC 1S5BD 1T0QC 2BB6A 2UXBQ 1EOVA 3J7AF 1XD3B 4A3CG 4GN4B 2WACA 3E0EA 3FAHA 5M3MG 1WTWA 1I4XA 4N9TA 2KOLA 2EYFA 1HH2P 2FCNA 3ZXVA 4MJSA 4JI7L 2BH2A 2YTYA 1BVSA 1JQ4A 3EBEA 2JA5B 3CC7A 2VQEQ 1KABA 2JSVX 1LTGD 2W54A 1UZXB 4S0RA 5J39A 2DNEA 4ID6A 1JMLA 2M8SA 3OMCA 3MP9A 2KHIA 1AZQA 4PV1C 3WDNA 3ZNZB 3ZQ4A 1QLBB 1WYDA 2UXDL 1VZ8A 3B6YA 4LF6Q 3HOZG 2IGHA 1L6VA 3QC8B 1F9RA 4DN4M 1QE6A 3UE1A 1XQQA 1ZXHA 2BKRB 1IL8A 1EYDA 4GKJQ 4XE0A 1LTSD 3ZNGC 4OL7A 4JI0L 1Y1WG 3DHHC 4DR1Q 3PT2B 1WE7A 1VQ6A 2WXRA 1EEID 4BKTA 1SNOA 3J81c 2IZVB 3LB8C 2CKZB 3VDYA 2ZEQA 5FLXE 1NI3A 1UEBA 4MJSB 3KYDD 2BYFA 2J53A 4IPHA 2NWGA 4W9DA 1S3OA 2A69D 2BE5C 2KJRA 4DHJD 1DGSA 1O78A 3ZRCA 4MN3A 3NBIA 2A1AA 1V97A 5M3FH 4YWGG 3CSTA 4N58A 4HCPB 2KVMA 4LWCA 1LTAD 4LF9L 2FIDA 3HKZB 1BT0A 4W9CA 3F2UA 3QG1A 2M0AA 2RGFA 1NMGA 3T9LA 5A2QL 4XDCA 3MXNB 1A3UA 5IA7A 1HNXL 5M3MB 2NVTH 3VYSA 5C5MA 2K28A 4MTKA 5JHAA 4CDCC 2CQOA 4WWMA 1WTRA 2W55A 4UP7A 1PZKD 1UF0A 1QCBD 2QGQA 3L3OC 1LM8B 4BZAA 1GOZA 1JWBD 4S17A 4GKKL 4WQMA 2LGXA 3ZW3A 2INDC 4H02A 2DUDA 4RGMA 1CSPA 2DGYA 2CHBD 1EL0A 1E8YA 2DHZA 1MHXA 1AZPA 5FO7B 2MBHA 3SGIA 3P4SB 4YY3L 5C4JB 3PF5A 2A6ED 4DV5Q 4A3DH 1DOKA 1Y1WB 3M3JA 3CQZB 4QF4A 4KKSA 3KYHC 3FMCA 1Q7YC 4DR5Q 1C79A 4DAYA 2QHOA 3TREA 4KGRA 1Z9FA 2ZXPA 4A90A 1B8AA 2WIIB 4PMBA 1F2RC 2BYEA 3E0JA 3LX0A 3IT6B 2PQEA 1IP9A 4X62Q 1WR1A 1HA6A 1YNNC 4KMUC 2NZOA 1YJIA 3FEWX 5IP9H 4DUZL 3D32A 4GN3B 2H89B 2LJIA 1IYVA 1WZ3A 2LASA 1Y8OB 1OXSC 4IALA 3S15H 3AN1A 4X64L 1HZBA 1PMRA 3MHBA 3L0WB 1J0GA 4AOFA 3PQIA 1N63A 2GB1A 3IHPC 1STNA 2BS2B 1WCMH 2L5TA 3J81i 1FJGQ 4WJ4A 1V80A 1WGGA 2Y5PA 3VH3B 2PZUA 5EDSA 3PZDA 2HD3A 3NVYA 2IO0B 1OTRB 3M3YB 1BMLC 1TS2A 2DZJA 3QJZA 2K8CA 3I3TB 4PT5A 2KLCA 4HJ7A 3V61A 2WU2B 5CR3A 3A7LA 5ELOA 2QEXA 4DAYB 1H9RA 1HNZQ 1SBBB 1HEZE 4BY7B 1IBKQ 2HTHA 3D4WA 4A3LG 2AUJD 3JAME 1N61A 1PH6A 3ULPA 1JE5A 4K8JA 2L8JA 2UUAL 1E3PA 1CKMA 2WXJA 2Q2UA 1PGBA 1YJJA 1ESFA 2B2YA 5KHQA 4LF6L 2N9EB 4CDDC 2PLPA 3PIP3 1F9QA 2KT7A 1TWFB 3UE0A 1TS4A 4WH4A 2IY5B 3HP3A 3JYUA 4X3KA 4DNTB 4MM3B 2W3RA 1XCQL 3BZDB 2LXJA 4JG2A 1BDOA 3B2GA 4JK1C 2G5DA 4NXML 1KOTA 2A69C 1JW9D 2K0PA 3TZUA 1WXSA 2ZTEA 1FFUA 4MT5A 3S1RB 5AUIA 3M9BA 1SSOA 5FR6A 1N9WA 2XNAC 2E2JH 1V1PA 5KRUA 4R4QA 4DV4L 5IWAL 5ELDA 3VYTA 2LGSA 5C0XH 1V86A 4KDIC 4LJPB 5CV8A 3HOUG 2IO2B 1T5EA 2L76A 4ILWA 3TCAA 2CQAA 4JI2Q 1NBFC 1WD0A 3H3VC 3A9JA 1P3QU 3GTGH 3M63B 1J8CA 4GLVB 5DPTA 4MGZE 2OJRA 1G8ZD 1WRIA 4HJAA 4IM0A 1A5RA 2RCFA 2WXQA 3QO2A 5JPNC 2OCEA 3PGEA 1WF9A 4ANUA 1G2SA 1ASZA 4AYBE 1D5XC 3KBXA 3CF5A 3EIVA 2FIFA 4I6NB 4LNNA 1SE3A 2D3CA 2KNBA 2KLGA 2MJ8A 4DV7Q 2HE7A 4II3B 1FD6A 3ZVVA 2NYZD 5EQ0A 3UDFA 2DBYA 4B95A 4X3SA 2EXZA 1UE5A 4HJ8A 1HUMA 4C56C 1N36L 3RZOH 2KFJA 1V1PB 2DZMA 3PO3H 5I6YA 1IUEA 2ZT9C 1E1OA 1TZOA 1T9HA 1EF5A 4J6IA 5G5HA 4X66Q 3DWMA 4K1RB 3M4OB 5CHFA 2EKEC 1LT4D 5EPJA 5IOCA 1TTNA 2N0SB 3AECB 1GNUA 3KQ4A 3K58A 2F0FA 1XF5L 3JC66 1BNZA 2KDMA 3RN9C 2JSOA 1XNRQ 3JSVB 2NTSA 4DR2L 1EU3A 1LTID 4O42A 1JMCA 4NXNQ 2OT2A 3GTLB 5IYDH 1N6ZA 2EXDA 1I94L 2LI5A 4CKEA 2PNHA 1HZ5A 1PFDA 5FOBB 5LMUL 4EKUA 4A8XC 1PTOB 3UI2A 2C9OA 3CKIB 2JA5H 1Y8PB 4X65Q 2L1AA 2GVAA 1KM7A 1LO5D 3ICEA 5C0XJ 4REZA 1XEEA 2MNAA 1KIXA 1X32A 1YMHE 3P4PB 5J2RA 5A35A 3NENA 2K3UA 1IGCA 2Q8RE 2IY0B 1XLQA 3I7FA 1PH8A 3N1YC 3I56A 1F9SA 3HOYB 2L0CA 2M00A 2IO3B 3EVQA 2OTJA 3U50C 2LFNA 3ZYYX 5ELEA 4JBKA 1XNQQ 1QOFA 2F4IA 2N4FA 3D3RA 4NNJB 3M62B 1BKBA 2QA4A 5J22A 1FXAA 5I2YA 4H7BA 5CBEE 4X3TA 2JPHA 4CDFC 4YWLA 1ICWA 4XX5A 2QW7A 2XN9C 4BA1I 1HTOA 2B8GA 2KKCA 3C0RB 1A15A 3DEPA 5FKAC 1UBIA 3Q22A 1RCVD 1VR9A 3HHMA 1EQQA 1JRPA 3AU7A 1F9JA 2GBKA 1KAAA 1LYLA 1KQSA 3M95A 1SYGA 3AEGB 3F2CA 2JA7G 1I4RA 2WXFA 4KN4C 1QJOA 4MH8A 1JWMD 1S40A 4LK1C 1U4AA 3F2BA 3ZIMA 2MP2A 4EZLA 3BG3A 4A3KB 1ENAA 2WAQB 2KEEA 4A3CH 1SFOB 3Q3MC 1TY2A 5AZGA 1WM3A 2IY1B 2MUYA 1WYGA 5M3MH 2L9HA 5H1SE 4FF1A 5CX3A 3VUWA 4H44C 1XWEA 1F2MA 1J7CA 2RKSA 4OZBA 2NVXB 5JEAG 4BKGA 4ZRZA 3PRZA 5IIFA 3TIXA 3K7AB 1PRTB 1N34Q 1P1AA 1J19A 4X3UA 2LWPA 4LUZA 4OONA 3G6EA 2MBBB 1TR5A 3DLLA 2LMCA 2QDBA 4JI8L 1G2TA 4BBRG 2X6LA 3PUVA 4M8AA 1PH4A 2VH1A 2AL6A 2OEDA 4LF5L 3ZRFA 5AEKB 2R7FA 3OHXC 1F77A 4R4CA 5C4JH 3CMAA 1Q10A 4EE2A 1S5FD 4CGYB 1IXRA 1T0RC 4G11A 1Y1WH 3APFA 3CQZH 2BCOA 4EX5A 4JI4L 3ZXRA 2N9PC 1IYUA 3PIO3 2E2IB 2XK5A 3PIOA 4LNKA 4QJFA 4Q5VA 3A4SC 4A3BG 4MNOA 5M5WH 2UUBQ 3WOFA 1WE6A 3K59A 4GLAC 4CJ1B 1YQ3B 1C8CA 1XTDA 4ZOHC 1YN3A 3BIID 2WP8J 4DR6Q 3DVGY 2HHHL 2LVOA 4HSPA 1GD7A 2L55A 4KY6A 4GNXC 3HVDA 1A2UA 1PH3A 3W5UB 3RNGC 2XWJB 1P98A 3T13A 3W1YA 3ZUNA 2WQYB 1L2NA 5CHVC 2A6HC 3RMHA 4BKSA 1XMOQ 1QVCA 2INPE 1GM5A 1O7ZA 2E2HB 1SRUA 4KIKA 2K25A 3J80E 4OVZA 4PS8A 5L83A 2KDFB 1D6EC 1YNJD 2V3PA 2NZHA 3M3YH 1GPXA 2KQ4X 2L52A 3Q6BA 4FXGC 5IP4D 2XK5B 2I1JA 2KN4A 3KUZA 4JI6L 3S16B 1LABA 2LFIA 3EFCA 3K8AA 2M2LA 3A5ZB 1VQMA 2JEAI 3CCQA 4BY7H 3U58A 2C35B 2UUCL 2UXCL 5IYBG 1ISNA 3GDEA 4F8MA 4DR4L 4USAA 4FP5D 1YN4A 5DPRA 2DYMA 4P75A 2X6GA 3K5MA 4A93G 3I72A 1QT9A 4W9EA 2JWZA 5JH5C 4BBRB 3E9IA 3ZJUA 2A74C 4AJYB 4KSKC 1L1OC 2K4KA 1B9MA 3H7PA 3T53B 1NEKB 1KF6B 1QF6A 3A55A 1YZ6A 2WXNA 4IUQA 1EIHA 1TWFH 1JOKA 3OJ4B 3LWEA 3IBEA 5AFWA 3GTPH 4DR3Q 4KKUA 3GV6A 2C5CA 2G9DA 4TRDA 3Q3OC 4CO7A 1I3QB 3A5UA 4KKIA 1Q46A 3DEOA 4GXBA 2H5XA 1PYSB 2ZTDA 4ZHOA 4A3IB 2EE1A 3IKJA 1PH1A 3EROA 2GBJA 3S14B 5LMNQ 5L37A 2ZVOA 2IHEA 2ONQA 3TS0A 3NELA 3TDQA 4Z9CB 3EC8A 3T51B 3H7PB 1F0ZA 1X55A 2PYKA 1A63A 5D7GA 4DV6L 4N8FA 2I5LX 2LD9A 5IT9E 4QQBX 2KCMA 4HVBA 4X57B 1FGUA 3RT3B 5EKIA 3GTJH 5M9OA 4KKJA 2DX5B 5C2TB 1T3QA 3MWYW 4LLGM 1X3QA 5C44G 4A3EB 2KK8A 3M7GA 5DCNA 3OW2A 2NS5A 2ZPYA 3Q0AA 5HI1A 4ITKA 1LFDA 2CR5A 4FJYA 3PUWA 3FHWA 2KDEB 4FADA 2LSSA 3W5OA 4LF4L 5AZFA 5HURA 3GE3C 4EZKA 4NMZA 4A93B 1EIFA 2A19A 3S2HB 1SYEA 1U0LA 2B2UC 3DHQA 3WOEA 4P1BC 5CBAE 1WXQA 1KD1C 1ILQA 2Y0SE 4LF7L 3H7SA 2N55A 3PREA 5KNBA 5GAHC 3VR2A 2Z9HA 3TJPA 3M4OH 2L0TA 5IGEA 4BXXG 1MI2A 2D62A 4J6HA 4JI1L 4DV1Q 2JA8G 1L4ZB 5AUKA 1HZAA 1PA6A 1N62A 3APCA 4B3RL 4C7YA 2OXPA 4HJ5A 1V2YA 2VQFQ 1P9DU 2K14A 3A7AB 3KJOA 1NMFA 3GTLH 3PSIA 2ZZPB 1PHJA 1R9TB 4HPMB 5DLQE 4GLSC 5ISRA 1FM0D 2EIFA 4ZQ3A 1D5MC 3AE4B 1ZW7A 1NAPA 4RKLA 4DNIA 4JGHB 1PTOH 4M0WA 2E2DC 2HCCA 3VVWB 1LXDA 2LS01 4B3SL 2MFIA 2RCNA 2RSOA 1TZ1A 1WM2A 2F0EA 5DPWA 2B63G 3EA6A 4WIPA 4ZRIA 1QNKA 1VQIA 1YNJC 1V43A 4WAAA 2G4DB 1LV9A 3ZJVA 4DHZE 4YCVA 2HTME 3NBHA 5M5XB 4AP4C 3ERSX 3HOYH 1JALA 2CWPA 2MBOA 2WDVB 1C78A 5D65A 4OGQC 1MD2D 2F4VQ 4DGZA 1HFGA 1IBMQ 3OIQA 5C44B 1TU2B 1JT8A 2PQAA 2EELA 4R8IA 2KX3A 1X6OA 4A3FB 2ZXRA 2Q2HA 2V4LA 1CQFA 1NCVA 4YHHQ 1YJWA 4IURA 4GN1A 2VS1A 3HKSA 4XT3B 4DAVA 1EWHA 4V190 2D3AA 2WXGA 1G91A 3UQBA 1AP0A 4M0WB 1H9MA 4TV3A 3T3OA 5C0XI 1DOXA 5LXHA 1H9KA 2IHFA 2PZTA 3SD5A 4JI7Q 4DXGA 4ANVA 4GS3A 3H9DA 1NTGA 3VYRA 1XLPA 4TKOB 2RD0A 2MWSB 1I4PA 2PJHA 1N33L 2NN6G 3MA2B 4IUUA 4DWFA 1OFFA 4JE3B 2IX1A 2JZPA 3V6EB 2M9VA 4A3KH 1V6EA 3V62A 1SFOH 3EGRA 4PS3A 1GC7A 3MXUA 1YNTE 4XGAB 1D7QA 1MJCA 1MKHA 4R4IA 2W82A 1NUCA 3N3KB 2HT1A 3Q8DA 2UXDQ 2HDEA 3MAQA 4B0MA 1SMYD 1PQSA 2NVXH 3A8JE 1STYA 5C4ZA 5IP7H 1ZDXA 4HPPA 2MP1A 3K7AH 3I4MH 4JI0Q 1V49A 2N1WA 3R7RA 4GDLB 2GA4B 2GMIC 2XRSD 3IFWB 2H88B 2VUMG 2OWOA 1QOAA 3A1QB 1B2TA 1X56A 2AQ1B 2JN4A 2FXQA 5E1FA 3LJ3A 3PRMB 1V9JA 2WKCA 2MX2A 5LHY1 3VAWA 4IOCA 3BU2A 3M85A 2K03A 4JQWC 3P20A 2YEPF 3AI5A 4I65A 4R4TA 1YITA 2JZZA 1XYIA 2HDLA 4AQYL 1Q81C 2E2IH 3KF6A 2M19A 3TEHB 3T1HL 4LF9Q 2PW5A 4WJWA 1WJNA 3NZ3A 4A55A 4L5RC 3OG5A 2CHZA 1KRSA 4IUVA 4JYAL 1ZXTA 3NP8A 4BVUC 4XIGS 2JQRB 3A54A 3X3MA 1HNXQ 5FLXc 4P16A 2KC2A 2XSCA 4ACFA 2RSUA 1E7VA 4A3PA 1E2ZA 2QSDA 4HCNB 3H8HA 3PUXA 5BYRA 4JWUC 1Q0WB 2EYPA 5EE1A 4V0BA 2A8VA 4F88A 1YHAA 4GKKQ 4FULA 2E2HH 1VF7A 2CS4A 1OQQA 3P4RB 1PYWD 2KCTA 1J9OA 2QCPX 4MEMA 4OWXB 4GOCA 3RUIB 4ARIA 2Z0SA 3I90A 3KF6B 2ATWA 1E22A 4MACA 2O5IC 1Q1EA 3U8ZA 2QDLA 2ZM6L 4YY3Q 3S16H 2B3GA 1IBLL 1TGZB 4DA2A 4KDLB 5DM73 2R92H 3R3MA 3RFZB 1C9FA 4WWOA 4L6TB 5GROA 1UUPA 3FILB 4ZRQA 3QR8A 4QIWE 2C7HA 4JX1C 2VUMB 5BN4A 1SMXA 3ONAB 4B3ML 4HR7B 4A20A 1E0BA 4IJLA 4BBRH 2ICIA 1IHZA 4JL9A 1H9SB 5CV6A 1VQOA 4BBNF 4IUTA 2N9KA 4DPGA 3IXSA 5J1ZA 4LFCL 4WJNA 4QUCA 1VQNA 2LEKA 3VTUA 4DUZQ 3V05A 4ASWC 3BZCA 1ENCA 3IG3A 5JXVA 1B7YB 1PLFA 1BXTA 4X64Q 1GUWA 1CSQA 4K2LA 2L32A 4EOYA 3RLFA 3GOEA 3UDGA 4R3DA 3P75A 2FNJB 4W9JA 1HTQA 2L15A 4PG3A 2HQEA 1I3QH 1R7SA 2RPVA 4KJNA 4LDTB 2CWAA 3AEDB 2LXCA 1SN8A 3NS8A 3S17H 1X3GA 3OOCA 4A3IH 2GN5A 2K75A 1L6UA 5D3DA 3S14H 1K83B 2I38A 1SROA 4ZYNA 1VCIA 3ITPA 2D3BA 4OIKA 4L2YA 3NHEB 3L16A 4RG1A 3HRZC 2BDNA 1XLOA 3URYA 2I46A 1FXIA 3RNFC 5A2QE 1WJ6A 2WDRB 1AN8A 3DWGC 4K7UA 2RHSB 4ZLTF 2UUAQ 1KNEA 5HY6A 4RNAA 4A3EH 1PDXA 3FVQA 4KN7C 4ICVA 4KV6A 4FNFA 2LHDA 2PVOD 4ZKBB 4P7IA 5T1IA 4DK3C 1D3ZA 2KCNA 2CHWA 3MXNA 2XRQD 4WQOB 4NPNA 4XYOA 2CU3A 4FF2A 1G51A 1PZID 2CJNA 3DBHB 3HM3A 2Z1CA 3QOJA 2ES2A 4NXMQ 1RF2D 2N8NA 3JAMc 3PS6A 2F0DA 1KXLA 4DV3Q 1BQQT 2BGFA 2EJMA 1TT2A 1N8RC 2O6VA 4CQNA 2RR9A 4YCWA 3AH7A 2IYDB 4BY1B 2AQ2B 1LM0A 2NVYB 2KQ3A 4NB3A 4DV4Q 2GI9A 5IWAQ 3DM1A 2ZJDA 1GUOA 2UU9L 1J7AA 2CKHB 4IFDG 2MHVA 3DOWA 3KWLA 5IAAC 1NSNS 1EWCA 1EZ8A 3PGZA 1BUVT 1LGRA 1R9TH 4HEDA 1JR0D 1ZYRD 3HOWH 1NVID 3JVZX 3A4RA 2HDMA 3C19A 4ABNA 4F87A 2OOBB 5G5GA 4NPSA 4L23A 1OEYJ 3KBGA 3VR4A 4C3JG 4BBSG 2WFWA 3N1XC 4YWMA 4YSYB 4NQLB 4HJ9A 1QVFA 3AEEB 3LWUA 4US9A 1F9PA 1YJ1A 3ULJA 1WTPA 3UIPB 3CWIA 4YIJA 5LL6X 3G4SA 4M00A 4A3GG 4HCEA 1WH3A 2KA7A 2Z6KA 2FCSA 2O6VB 1A62A 5JVH3 1C4CA 5C4XG 4P71A 4RCNA 5M5XH 1N36Q 1EO6A 4IOAA 5EE9A 5IKCM 1WJ4A 2NUCA 5F2DA 1B53A 2JYOA 1TWCH 4JLCA 4YSXB 3SXHA 5C44H 2F0KA 2KENA 1M94A 1CM9A 3HOZB 5KNDA 3DWQA 4A3FH 4ARCA 1JOOA 4JOIA 1HFNA 5T8IA 3F8TA 1E8WA 1MJDA 1NBWA 1SJED 2J0TD 4AIMA 4DR2Q 2MH7A 1VQ9A 2OF1A 1VQPA 5KYIA 2CH4W 3NY5A 2MO1A 2I0QA 1E2WA 4FO2A 1M90C 1EOTA 4B9WA 3AMUA 1SYBA 3CPFA 1I94Q 2WKDA 2JXTA 3NPPA 5BMGA 1FNVA 3SK5A 2YVCA 3DUZA 1TWGB 5IODA 5LMUQ 4BXXH 4UP8A 3DBRI 4AYBG 3AEAB 2C7NB 1D5ZC 5IGBA 2O5JC 1JWAD 1YQ4B 3LYYA 1K0SA 4WJOA 3MXPA 5E6JA 3U2SC 1STEA 3L9AX 3I4LA 5FLXL 2Y3AA 3IL8A 1OQYA 4JBJA 3U30A 3PLUA 2D2QA 1PGAA 2E5LL 2DLBA 5ELCA 5FJ8G 4TSSA 3CCSA 4Q2JA 3DDCB 3TBLD 1HQMC 5C3EG 5IOIA 2F0TA 2NCNA 1V5OA 4A76A 3JAMi 1I6HB 2D2CC 2F0HA 3IAYA 4LJOB 1V8QA 1ET6A 2LY7A 2TMPA 4P74A 2OQKA 3SR1A 3HRDD 1L0YB 2F0IA 4MM3A 4C80A 2N78A 3Q8BA 2QIEB 4PZ8A 1C4QA 1CMXB 1JJ2A 1LT3D 2RDHA 3BVGA 4CDEC 2H1EA 3VR5A 4A3GB 1AYFA 4KGTA 1RWSA 1RODA 1WWTA 5C6AA 5C4XB 1IBXB 1OTCA 1ILPA 1TKGA 2JRIB 2WP9B 2PI2A 2PCFB 1X65A 2KJXA 3VRBB 1I4QA 1OXTA 2KJHB 2NPTA 5I2XA 2WXLA 2WINB 3FC4A 3H6NA 2ICEC 4QAYA 1K8RB 2D07B 1Y8RC 1WMHA 4EVOA 1W6JA 2OTLA 3NTIA 1QNUA 2F0MA 2CHXA 2JU6X 2AWTA 1B4OA 1QVGA 2GVBA 2NVUI 2ZCCA 3A56A 3SFDB 1K28A 2BOSA 1CHQD 1EY9A 2F0WA 1PDQA 4P72A 4KGSA 3TP6A 4A4IA 3T3NA 1PTOF 4DV3L 4NJ6A 2NN6H 1LQBA 2PPHA 2H4OA 4PZ6A 1XMQL 2B29A 4DV2L 4XT1B 1W3SA 4JI8Q 4LCDE 1GB4A 2L11A 3Q6SA 3ZDMC 1ZYRC 5C3EB 1PZJD 1WRDB 2LXAA 1EQRA 4GSWA 3B1LX 4DUYL 2NPTB 4HAEA 4LF5Q 2MQHA 5EJWA 3RNAC 1SEBD 1Z47A 3DBRB 1TY0A 1D2BA 2YTXA 2VW9A 4XXEA 1YOVB 2WHIA 1WMHB 3JSVA 1CFMA 1JCKB 3ETRA 3U4EG 3NVZA 2EJFC 4JI4Q 3AB9A 2VUMH 5JAVA 5HGQA 3T1YL 4I6LB 2JUOA 2M56B 2WXKA 3TZDA 4U673 1G6ZA 1QKZA 3CCRA 2WXHA 4GNXB 4RA8A 3HOXG 3TEYA 3TP5A 1RFAA 2LRUA 5D2MB 3OAWA 4BBNC 1Y14B 2BS3B 2HHHQ 4O2DA 4G50A 1VQHA 3HGBA 3WAOA 4K7WA 3NTKA 1TS5A 4RWSC 3R2IA 4POGA 3EFUA 1YN5A 4IN3A 1TKEA 3G6JB 1WY8A 2A6EC 3J81L 1UD7A 1UE6A 4W9KA 5GADC 4FDBA 2M1MA 1AFPA 1VJKA 3B08A 4DAMA 1X3EA 2XEWA 2YU9B 3OPOA 5TSSA 1WIAA 3L54A 4ANWA 3GO5A 1WZ0A 4BOZB 3UIOB 4MHEA 2M4NA 3U7DA 4TUUA 5L95C 3Q8FA 1BCPB 3CC2A 3WWVA 2KAJA 2B3AA 4JI6Q 2WXIA 3TP7A 1Q12A 1V5TA 2MRPA 1DOMA 3NK9A 4WAFA 1OXXK 1ZE3D 3V3XA 1PRTF 1GVPA 4A3JG 1WVLA 2UUCQ 4LFBL 2UXCQ 2RDBC 4DR4Q 2MHJA 2MQJA 1L1OB 3OMGA 5IYCG 4UY8C 3X23A 3HOUB 3ZDTA 4QL5A 4DXFA 3WIMA 2VB2X 2KMMA 1OXVA 4KD3A 1ZUD2 3J80c 1T0SC 1A70A 1M4VA 3S1MB 2DNFA 3NZSA 4HKQA 3DXJC 3P42A 3K0YA 4LW1A 3VA5A 3DBLI 1VRAB 2VRRB 3IAM1 5TR5A 1JWUD 2CCZA 2K33A 1K0RA 1DOLA 2B2VA 2DWQA 3W1SA 3PO0A 4GIVA 4K5XA 4XC2A 5C5LA 2EY1A 2SNMA 4HIKA 1V81A 2DAFA 1I7HA 2K5PA 3HOXB 3SVMA 1KRHA 2LJ5A 4CKBA 2KN5A 4GOPA 2M17A 5C23A 2B2TA 2RHQB 3I73A 2AWNA 4TQUS 3H0GG 4BY1H 3C1FA 1TIFA 1SIFA 2NVYH 4L63B 5LNK1 2F0VA 3VUYA 2BB5A 1C1YB 1PTOD 2IGGA 2EKIA 2AX5A 3TEXA 2WX0A 4ZRKA 4W9GA 1I4GA 1S4ZA 3I91A 4ALPA 2JRHA 1KNAA 2SAKA 1HXYD 1Q8KA 3ECIA 4DV6Q 4XYCA 2R7ZG 1U4RA 4K6DA 3CRKC 4ME3A 3A33B 3Q3NC 2UYZB 1SE4A 3A0JA 4RM9A 1W6KA 4OX9L 3CCEA 1K8GA 1PH9A 1K3BC 2BA0A 2SDFA 3DVGX 2IBIB 2D0PA 1RAXA 2CFMA 2WYQA 2YLMA 2EYLA 1IW7D 2GLSA 1JICA 4A3JB 2J7QB 4G7HC 1HR0W 4LF4Q 3VDZA 1G291 3DMUA 4TQ0A 4KX6B 1KL9A 4EQPA 4GOPB 3CHBD 3RZFA 1KLVA 5KNCA 2C60A 3WCQA 4FVMA 1VS0A 4B9XA 3CCJA 1DCZA 3KJPA 3GTQB 2LXKA 1HZCA 2MO0A 2CH4A 3EJIA 1GUGA 4LF7Q 3CAMA 2NR2A 5IT9c 3CCUA 1O7IA 2EMTA 2WDTB 1O7YA 3R7QA 4DDID 1V1OA 3HOZH 1KDBA 4JI1Q 3AB5A 4DBGA 1EWIA 2AEHA 3P1MA 3C46A 1LTRD 1MVKA 2XTIA 4OVVA 4B3RQ 4CKCA 1NYQA 3AE1B 4EGVA 5AJ3L 1EFWA 1C76A 3OSOA 2KFKB 4C4VA 4FA6A 4QCLA 4DK1A 2KMAA 2DENB 1L2FA 1QQRA 1A0IA 4KHPL 2RPQA 3DBLB 3J80i 1TWGH 3CRLC 4F7ZA 3H0GB 1WXVA 3RNBC 1UBQA 1JJCB
chains in the Genus database with same CATH topology
2F3VA 3GP7A 4IFDH 4RF0A 1Q1BA 1PRTD 1C77A 4R9WA 2JA7B 4ZK9B 4RF1A 3B2FA 1N60A 3EFXD 1HTLD 2DY8A 2R6GA 2B2YC 3AE2B 4K5VA 1JROA 1QWYA 4ZYSA 3NSWA 4WORA 4N6EB 4C2MB 4FF3A 4TQ1A 4D2KA 2AWOA 4OZAA 5CV4A 2RA4A 2EYJA 1Y56A 5DNFA 4RCOA 2LGIA 2K7VA 5KYLA 2BW2A 1OO9B 2FHTA 2VNUD 3FPUB 1SIJA 1H9JA 1NR4A 4WURA 5FO8B 1RKNA 5K5PA 3VRAB 4JBWA 3EQLC 3X3NA 5IGCA 1DJRD 4Y7NB 2RVLA 1TIID 1AEXA 3Q24A 2D5GA 2OEOA 4A3BB 1U4MA 1SNPA 2W3SA 4H0LC 1A3TA 1CA6A 4GZYC 2QEJC 1PTOC 2WV6D 1V8CA 5BYQA 2KHSA 4K5WA 3SR6A 4IFDJ 3CU7A 2N7JA 2Z4HA 3NUCA 2LHEA 1CTMA 3K6OA 3PZ8A 3TEZA 2Y0SB 1K52A 1JB3A 1T6BX 3E9SA 1ZDVA 4ULLA 5EKLA 2J42A 2JEBI 5KEEA 2EVBA 4K6LA 3S1NB 4PNYA 4NZLB 3IFDA 2PKOA 4G7OC 5T1GA 5G3LD 4KK7A 5HHDG 1KLGD 4OO1G 1EYCA 2IT1A 3BK1A 1B3AA 3U52E 3L4PA 3VA7A 1CA5A 2WNMA 1Q8IA 2Q5WD 2PO4A 1J7BA 3ND8A 4FXKC 1PFMA 3VR3A 1WTQA 2EYOA 2EDGA 5EBCA 3AV8A 5I4DA 4KY5A 3SK8A 1UWMA 2KACA 3G7LA 3BVZA 5E4WC 2V3NA 3I57A 5E3FA 2F0GA 2LKVA 4ZHPA 2A5HA 4IUNA 5JPMC 3J9CA 1EQTA 3N52A 1JC7A 3VR6A 4NAMA 1SNMA 3SHLA 3T56B 3BK2A 4AQ7A 1A2TA 1MSHA 1B1ZA 1J8IA 3P4QB 2MJEA 2XWBB 1PFBA 5IGDA 2B76B 2PW7A 2NVTB 4PQXA 2NN6I 3FRPB 1XLNA 1DYQA 2K05A 1TVXA 5GXGB 2EY5A 4IUPA 1SYFA 1I6VC 1ONLA 1P7EA 4LK0M 1SSNA 3LXFA 2JA8B 1SF0A 4XDXA 3C3LA 1N5WA 3QB3A 1CHPD 1EY5A 2F0SA 2G1EA 3I4NB 1PGXA 1KDCA 1F2RI 3NQTA 1TKYA 3HOVB 2OHFA 2JA6B 3NWTA 5DAUA 2JX5A 2ON8A 2K04A 2XIWA 3I8ZA 5COYA 3FKIB 2B63B 1HPCA 2JWUA 1UEAB 2BDOA 2NMQA 3MTSA 4ZUJA 1BO0A 3ND9A 1Y1VB 1D4BA 5MPOA 2PZWA 1A6XA 5M5YB 1QG7A 4NP5A 2FUG1 3P63A 1FO4A 2BS4B 1EY0A 5CV7A 3TSSA 2N9LA 3MEHA 3FILA 3E5SA 4LTUA 1D1IA 2R3ZA 4KHVA 3MJ5A 3AE6B 1O80A 3MC0B 4ZUIA 3C2PA 1H9SA 3ABVB 3PMFA 2HCIA 3AEFB 2NVQB 3IAS1 1E10A 3GQBA 3NTHA 2AUKA 4RGTA 5CC4A 1S5DD 2BE5D 3S1QB 4XTCS 1SAPA 4DFAA 1WSPA 5CMDA 2MGSA 1DM0B 1ZOYB 1QB5D 4QB4A 1E2VA 5JEAH 2J52A 1EU4A 1JQYD 4HCSA 3A8KE 3Q8CA 4PMWA 1U9RA 5FR3A 3ZJTA 1FFVA 2BYTA 1ESRA 2L4NA 2KECA 1E9MA 1VMCA 1IKMA 2VZKB 1RFKA 2YYZA 5I9PA 2JYEA 1RTOA 5LL6S 1HA5A 2JE6I 3NVWA 4NW2A 1UNSA 3RUZA 3R2TA 2R93B 4LJZC 1CI3M 1MBYA 2MJ3A 4KD4A 4I7ZC 1EY7A 4US8A 3MHZA 1XX8A 2PMVA 2IWHA 3D4RA 4DF7A 1NR2A 2F0UA 1YNND 1EQVA 2RMMA 1STAA 2K01A 4C3IG 5H8YE 1STGA 1SMYC 4BWGB 1ZPSA 2Z4IA 4CHTB 2BBCA 1XCTL 5JEAJ 1OXUA 1F2LA 2FE8A 3MFGA 1LT6D 4IFDI 4EQNA 1PUTA 3AMZA 2E6XA 4HKZE 4UDUC 4DK0A 2F03A 1PXUA 3A8IE 3VR8B 3P1HA 2N88A 3KLRA 4KHZA 4K14A 1ZKOA 3D6WA 4WRDA 1P7FA 5CV9A 5EPKA 1CJEA 3IFTA 1EYAA 1GUNA 1RM6C 1TS3A 3KLSA 3S2DB 4RGOS 2F0NA 1CQVA 2JXMB 5ELBA 4XQJA 3VR9B 3O13A 1TYGB 2SOBA 4CJ0B 1SXTA 1TQOA 5I6WA 1RD9D 3UI3A 5C3JB 1KLUD 1EWYC 1VDZA 2XVSA 3BVMA 2WXOA 4ZAIA 1XXGA 1GB1A 1GAQB 4CBVA 4C3IB 3BDCA 5K36G 2SNSA 2PW9A 3TBIB 1M8AA 3D6CA 1AWDA 2V4IB 4YSZB 1ZEQX 3HUIA 4OO1H 1SNCA 1FD7D 4G7ZC 4M1UB 1BR9A 3D4DA 1MHHE 2X38A 4OIJA 1IBXA 3HS0C 1L0XB 1GXDC 1EY6A 3HVZA 5JVG3 4KI0A 1MI0A 1O7LA 5BMIA 4F7XA 2RSNA 1DOYA 1EY8A 3GTMB 2FFKB 2F3WA 4C3JB 4BBSB 1LT5D 5M5WB 2IW3A 1ZXIA 1WD1A 4C3HG 4WFN3 1UGJA 4K8IA 1GJXA 1RHPA 3NHHA 5DM63 3BYYB 2QJLA 4ZKCB 1DD2A 1K8OA 3V2TA 2G9HD 2F0JA 3W9CB 2GRIA 2EYHA 3T4AC 1S5ED 1RDPD 1E0ZA 2K22A 2IDYA 1WTVA 5I9OA 1SE2A 1BCPF 4EQOA 4J3OD 1FGBD 5JOBA 4JWSC 3K5OA 4FF4A 4J8QA 3L7ZC 4S3SA 4E6IA 5C4HA 3J81E 1K51A 4AYBB 5EE0A 1STHA 2J7ZA 2V0GA 1DOIA 3AE9B 2WXPA 2JP1A 3QJYA 3VYUA 3BDOA 1STBA 3QOLA 2FBWB 4A3MB 5EGTA 3GTPB 3PO2B 4XDDA 3GTKB 5EE3A 3IT4B 1SJHD 2INNE 3TP8A 4C3HB 2Q8TA 2I07B 1CZGA 2HUGA 3R8BA 5BN3A 2CVRA 1QOBA 2PVGC 1KTKA 3SFEB 5NUCA 1UAPA 5CYUA 2B2WA 1SNDA 4HTHA 3N9YC 2RDGA 1EIGA 5EBDA 1GHJA 1IGDA 3JAML 4RKBA 1B44D 2EPBA 3GTJB 3H94A 2EY2A 1BOSA 2NZ1D 1WGKA 4KY7A 3NUHB 4A9AA 1FMAD 3FPPA 1BUIC 2WS3B 3TN2A 3W2DA 1QOGA 1SYDA 1B50A 2IX3A 1FCCC 4XWTA 3GTOB 4YTNB 3TUOA 4PMCA 4CJ2C 3AEBB 5IGGA 4P2CB 1EZ6A 2A6HD 2K1BA 1ACCA 3GD7A 4C1NI 3QWNA 3PUZA 5DEHA 3DWAA 1FNUA 1LTTD 4NKLA 3MFYA 2EJGC 5HFYA 3E6ZX 3HG9A 3T16A 4BA2I 2F0QA 1BCPD 1JOQA 2RBMA 2B2UA 4G57A 1WTXA 1VF5C 2L12A 5BN5A 1FCLA 2ZXOA 3MVVA 2WU5B 1ENFA 4B08A 1I50B 2BT6A 4AS1A 1HTPA 3NQIA 2ACZB 3RPFC 1FNWA 5JJZA 3KK7A 2DNCA 2CW0D 2PIAA 2KEDA 1ET9A 1DXMA 2B39A 1GHKA 2EYMA 3H09A 2BTEA 3Q8EA 2K9XA 5KIXA 4HN7A 2A68D 4ODGA 4TMAB 1PFNA 1TJEA 4UAIA 2EZVA 5ELFA 1LACA 2F0PA 1HHVA 1Y69U 2E75C 3TEWA 1TWHB 3PZ7A 5D3IB 1KFYB 3VQIA 1FEHA 3RZDB 5G3LF 3NWSA 2PMZB 3KF8A 4DAPA 2FMCA 1U4LA 1UWXA 1KDAA 3I4MB 3M7NA 4OZCA 5EKKA 2MEKA 1JORA 2SEBD 1QOHA 3GV3A 2E76C 2IJ0A 1E7PB 2KWDA 3LNNA 1XO3A 4QMGA 3SE0A 3SK6A 2K5QA 2O4XA 4XQNA 4WIPA 5CV5A 2EOTA 3I9V1 2R7ZB 1SYCA 2E74C 3M4YA 1F2YA 3OWFA 1N5XA 4G4KA 3OWEB 1HQRD 3D8GA 1DGJA 2MJDA 1RTNA 2D9UA 1EEFD 3K57A 3BS1A 2BA1A 3HZXA 3N6RA 4QUFA 1ZP0B 3NRZA 2K32A 4Q0FA 4IOIE 1HZ6A 3FDTA 2LMCB 2WDQB 2QMTA 5K36H 1L0VB 1VMPA 5BYSA 1IKLA 4IZ8A 1II3A 1TWAB 2X69A 4YT0B 2NB0A 4ME5A 4P6VF 1X3PA 2J4XA 3OW7A 1Q3LA 3R3OA 3BWUD 1BCPC 3MZ5A 2R92B 4JPSA 3E56A 4LAAA 1R4QB 1C4AA 2IPKD 2B8FA 4NJCA 3PUYA 1K50A 2RQXA 5FK9C 1RJTA 2B2WC 1E6EB 1FRRA 3SDZA 4YXDB 1DZ1A 2WB1B 4YTPB 1CK1A 3PV0A 1VDVA 2CW0C 1CT1D 3EUB2 3NXWA 4OO1I 2CJOA 1OQRA 1JE4A 1IW7C 1C48A 4HEA1 4GDKB 3J80L 2A68C 2FJ2A 2QKIC 3J7YW 3S17B 1MPEA 4N59A 1CZWA 3D31A 1I4HA 4L8JA 4L1BA 1MSGA 2VXWA 3P7JA 4RH6A 1ML0D 4H2AA 2MPMA 3NS1A 1Z6HA 2F1MA 1LTBD 2NBFA 1QILA 4RHRA 2B2VC 5FO9B 5D14A 3GS2A 4IQZA 2F0LA 2AQ3B 4IDIA 2LUMA 2PPBC 3I70A 5BMHA 1S5CD 1EY4A 1PRTC 2KUMA 2B2TC 4RFBA 1DONA 1LLRD 2IL8A 1HRJA 4IKGA 5M3FB 3RD4A 4FXDA 3AE3B 4LMQD 1XTCD 4N9PA 1JWSD 1R4PB 4RHSA 1BBXC 3HOWB 1L5PA 2Y5CA 2F0OA 3QIAA 3S9WA 3HVDA 5IT9L 4FXCA 1HCZA 3U7ZA 1FIQA 2VB3X 2K5WA 3KLSX 2WXMA 2ENBA 4J1MA 1Y8NB 2TSSA 4RAUC 3I3CA 2D5DA 3K5LA 2K6AA 4NDXA 4KKTA 1GUTA 3AE7B 4K2KA 3C8YA 1VLBA 1U4PA 3U9SA 1TWCB 4FYDA 2ZW0A 3GB1A 3NE5B 3W3AA 1NYRA 2JYTA 5EPLA 2E3TA 3AM9A 1B9NA 2QF7A 4HJGE 1AW7A 2K5DA 4C1NK 4A3DB 5KGUA 3OIPA 1K8MA 2DYOA 1C4PA 1FYCA 4HMJA 1FR3A 2RDFA 1EFID 1VZ7A 1D1KA 3U9OA 1MGSA 1BF4A 4A6QA 4O1NA 3H6MA 1L4DB 3KWVA 1Q90A 3B9JA 1A3VA 1KH0A 2FINB 3S15B 2A73B 2DY7A 5C0XG 3H91A 2ZW1A 2NTTA 4NAWB 3SEBA 4OW0A 4YTMB 4HSVA 1FRDA 3TMEA 5H92C 1WCMB 3J7AV 3AE5B 4DNRB 3MXGA 5HG2A 1ROEA 1CZPA 3ERQA 4ZRPA 1SDFA 3BYTB 3CIRB 2R61A 3Q23A 3C1EA 1NENB 4XYQA 2QILA 4QIWB 2IX0A 5HGTA 3AE8B 2V4DA 4R8NA 4C7ZA 1SB3C 4HROA 3SK4A 2I2YA 1B9RA 5C3WA 3K5NA 2IGDA 3W5VB 5CGKA 2DN8A 2ID0A 1SNQA 3Q8AA 4XWWA 4HMIA 4RGNA 2Z8LA 2O2LD 4U68A 2E2JB 4OHJA 1T5XD 3BDLA 4KTAA 3NVVA 4BS9A 2Q8IB 3ZGZA 1WTOA 1EM7A 1HUNA 2EY6A 3GTGB 4DU9A 4H13C 3V96A 3KUPA 4B0EA 1GUSA 1F2ZA 2PTLA 2WLBA 4HRSA 2L1BA 1VZ6A 2FMMA 4XQQA 1RYJA 2KCCA 1Z7TA 3HEJA 3DWPA 3RZOB 5C3XA 5CORA 3PO3B 2YEPB 4MIUA 5IGFA 2L83A 3Q69A 1TKWB 3R93A 1K53A 2PNRC 4KJOA 2VZKD 5E4XA 4DQOC 1S5BD 2BB6A 3J7AF 2WACA 3FAHA 1WTWA 1I4XA 4N9TA 2KOLA 2EYFA 1JQ4A 2JA5B 1KABA 2JSVX 1LTGD 2W54A 5J39A 2DNEA 4ID6A 1JMLA 3OMCA 3MP9A 1AZQA 4PV1C 3WDNA 3ZQ4A 1QLBB 1VZ8A 2IGHA 1L6VA 1F9RA 4DN4M 1QE6A 1ZXHA 1IL8A 1EYDA 4XE0A 1LTSD 4OL7A 2WXRA 1EEID 1SNOA 3LB8C 5FLXE 1NI3A 2J53A 2NWGA 2A69D 2BE5C 1O78A 4MN3A 3NBIA 1V97A 4YWGG 4N58A 2KVMA 1LTAD 3HKZB 3F2UA 3QG1A 2M0AA 5A2QL 4XDCA 1A3UA 5M3MB 3VYSA 5C5MA 2K28A 4WWMA 1WTRA 2W55A 1PZKD 1QCBD 3L3OC 1GOZA 1JWBD 4WQMA 4RGMA 1EL0A 2CHBD 1MHXA 1AZPA 5FO7B 3P4SB 5C4JB 2A6ED 1DOKA 1Y1WB 3CQZB 4QF4A 4KKSA 3FMCA 1C79A 4DAYA 4KGRA 2ZXPA 4A90A 2WIIB 4PMBA 1F2RC 3E0JA 3LX0A 3IT6B 2PQEA 1HA6A 1YNNC 4KMUC 1YJIA 3FEWX 2H89B 2LJIA 1IYVA 3AN1A 1Y8OB 1OXSC 4IALA 1PMRA 3MHBA 1N63A 2GB1A 1STNA 2BS2B 2L5TA 2Y5PA 2PZUA 3NVYA 3M3YB 1BMLC 1TS2A 4PT5A 2WU2B 5CR3A 3A7LA 1H9RA 1SBBB 1HEZE 4BY7B 3D4WA 2AUJD 3JAME 1N61A 4K8JA 2WXJA 1PGBA 1YJJA 1ESFA 2B2YA 2PLPA 3PIP3 1F9QA 1TWFB 1TS4A 4WH4A 3HP3A 4X3KA 4DNTB 4MM3B 2W3RA 1XCQL 3BZDB 1BDOA 3B2GA 4JK1C 2A69C 1JW9D 2K0PA 3TZUA 1FFUA 4MT5A 3S1RB 5AUIA 1SSOA 2XNAC 1V1PA 5KRUA 5ELDA 3VYTA 5C0XH 5CV8A 1T5EA 4ILWA 2CQAA 1WD0A 3H3VC 1G8ZD 1WRIA 2WXQA 3QO2A 5JPNC 1G2SA 1D5XC 3KBXA 1SE3A 2MJ8A 1FD6A 2NYZD 5EQ0A 2DBYA 4X3SA 2EXZA 1HUMA 4C56C 1V1PB 5I6YA 1IUEA 2ZT9C 1TZOA 5G5HA 3DWMA 3M4OB 1LT4D 5EPJA 5IOCA 2N0SB 3AECB 3KQ4A 3K58A 2F0FA 1XF5L 2KDMA 1BNZA 2JSOA 2NTSA 1EU3A 1LTID 4O42A 2OT2A 3GTLB 4CKEA 1HZ5A 1PFDA 5FOBB 4A8XC 1PTOB 3UI2A 2C9OA 3CKIB 1Y8PB 2L1AA 1LO5D 5C0XJ 4REZA 1XEEA 1X32A 1YMHE 3P4PB 5A35A 2K3UA 1IGCA 2Q8RE 1XLQA 1F9SA 3HOYB 2L0CA 2M00A 3EVQA 2LFNA 3ZYYX 5ELEA 1QOFA 2F4IA 3D3RA 5J22A 1FXAA 5I2YA 4H7BA 5CBEE 4X3TA 1ICWA 2XN9C 4BA1I 2B8GA 1A15A 3DEPA 5FKAC 3Q22A 1RCVD 1VR9A 1JRPA 3AU7A 1KAAA 1SYGA 3AEGB 2WXFA 1I4RA 4MH8A 4KN4C 1QJOA 1JWMD 4LK1C 3BG3A 4A3KB 1ENAA 2WAQB 2KEEA 1SFOB 1TY2A 2MUYA 1WYGA 2L9HA 4FF1A 4H44C 1XWEA 1F2MA 1J7CA 2RKSA 4OZBA 2NVXB 5JEAG 4ZRZA 5IIFA 3K7AB 1PRTB 4X3UA 1TR5A 2LMCA 2QDBA 1G2TA 2X6LA 3PUVA 4M8AA 2OEDA 3OHXC 1F77A 1Q10A 4EE2A 1S5FD 4CGYB 2BCOA 1IYUA 3PIO3 2E2IB 4Q5VA 3WOFA 1YQ3B 3K59A 4CJ1B 1C8CA 4ZOHC 1YN3A 3BIID 2WP8J 4HSPA 2L55A 4KY6A 1A2UA 3W5UB 2XWJB 3T13A 2WQYB 2A6HC 3RMHA 2INPE 1O7ZA 2E2HB 3J80E 4OVZA 1D6EC 1YNJD 2V3PA 1GPXA 2KQ4X 2L52A 4FXGC 2KN4A 3S16B 1LABA 2LFIA 2M2LA 2JEAI 4F8MA 4USAA 4FP5D 1YN4A 2DYMA 2X6GA 3K5MA 1QT9A 3I72A 4BBRB 3ZJUA 2A74C 1B9MA 3T53B 1NEKB 1KF6B 1QF6A 3A55A 2WXNA 4IUQA 1EIHA 1JOKA 3LWEA 5AFWA 4KKUA 3GV6A 2C5CA 2G9DA 4TRDA 1I3QB 4KKIA 3DEOA 4ZHOA 4A3IB 2EE1A 3IKJA 3EROA 3S14B 2ONQA 3TDQA 4Z9CB 3T51B 1F0ZA 2PYKA 5D7GA 5IT9E 5EKIA 5M9OA 4KKJA 5C2TB 1T3QA 3MWYW 4LLGM 1X3QA 4A3EB 3M7GA 5HI1A 3Q0AA 4ITKA 3PUWA 5HURA 4NMZA 4A93B 3S2HB 1SYEA 3DHQA 2B2UC 3WOEA 5CBAE 1WXQA 1ILQA 2N55A 5KNBA 3VR2A 5IGEA 1MI2A 2D62A 4J6HA 1L4ZB 5AUKA 1N62A 4C7YA 2OXPA 3A7AB 1R9TB 4GLSC 5ISRA 1FM0D 4ZQ3A 1D5MC 3AE4B 1NAPA 4RKLA 1PTOH 4M0WA 2E2DC 2HCCA 2LS01 2RSOA 2F0EA 3EA6A 1QNKA 1YNJC 1V43A 3ZJVA 1LV9A 2HTME 3NBHA 5M5XB 1JALA 2WDVB 1C78A 5D65A 4OGQC 1MD2D 4DGZA 1HFGA 2EELA 3OIQA 5C44B 1TU2B 4R8IA 4A3FB 2ZXRA 1CQFA 1NCVA 4IURA 4XT3B 4DAVA 1EWHA 4V190 2WXGA 1G91A 1AP0A 1H9MA 3T3OA 5C0XI 1DOXA 1H9KA 2PZTA 4DXGA 3VYRA 1XLPA 4TKOB 1I4PA 2NN6G 3MA2B 4IUUA 1OFFA 4JE3B 2IX1A 2JZPA 2M9VA 3EGRA 3MXUA 1YNTE 2W82A 1NUCA 2HDEA 3MAQA 4B0MA 1SMYD 3A8JE 1STYA 5C4ZA 1ZDXA 2MP1A 4GDLB 2GA4B 2XRSD 2H88B 1QOAA 1B2TA 2AQ1B 5E1FA 2WKCA 5LHY1 3M85A 2K03A 3P20A 2YEPF 4I65A 1XYIA 2HDLA 2M19A 2PW5A 4WJWA 4A55A 3NZ3A 4IUVA 1ZXTA 3NP8A 4XIGS 2JQRB 3A54A 3X3MA 4P16A 2XSCA 1E2ZA 2QSDA 3H8HA 3PUXA 5BYRA 4JWUC 5EE1A 2EYPA 4V0BA 4F88A 1VF7A 1OQQA 3P4RB 1PYWD 1J9OA 2QCPX 4ARIA 3I90A 4MACA 2O5IC 1Q1EA 4DA2A 5DM73 1C9FA 3RFZB 4L6TB 4ZRQA 1UUPA 3FILB 4JX1C 2VUMB 5BN4A 3ONAB 4HR7B 1E0BA 2ICIA 1IHZA 1H9SB 5CV6A 4IUTA 2N9KA 3IXSA 5J1ZA 4QUCA 2LEKA 3V05A 1ENCA 5JXVA 1PLFA 1BXTA 1GUWA 2L32A 4K2LA 3RLFA 4R3DA 3P75A 2HQEA 1R7SA 2RPVA 4KJNA 3AEDB 3OOCA 1L6UA 5D3DA 1K83B 2I38A 1VCIA 3ITPA 4OIKA 4L2YA 3HRZC 2BDNA 1XLOA 3URYA 2I46A 1FXIA 5A2QE 3DWGC 2WDRB 1AN8A 4ZLTF 1KNEA 4RNAA 1PDXA 3FVQA 4KN7C 4KV6A 4FNFA 2LHDA 2PVOD 4ZKBB 5T1IA 2KCNA 3MXNA 2XRQD 4XYOA 2CU3A 4FF2A 1PZID 2CJNA 2Z1CA 3QOJA 1RF2D 2F0DA 1BQQT 2EJMA 1TT2A 4CQNA 3AH7A 4BY1B 2AQ2B 2GI9A 2NVYB 2KQ3A 3DM1A 1GUOA 1J7AA 4IFDG 2MHVA 3KWLA 1NSNS 1EWCA 1EZ8A 1BUVT 4HEDA 1JR0D 1ZYRD 1NVID 2HDMA 4ABNA 4F87A 5G5GA 4L23A 3KBGA 3VR4A 4C3JG 4YSYB 3AEEB 4US9A 3LWUA 1F9PA 1WTPA 3CWIA 4YIJA 5LL6X 4HCEA 2KA7A 5JVH3 1C4CA 5EE9A 4RCNA 2NUCA 5F2DA 1B53A 2JYOA 4YSXB 3SXHA 2F0KA 1CM9A 3HOZB 5KNDA 3DWQA 4ARCA 1JOOA 1HFNA 5T8IA 2J0TD 1SJED 2MH7A 2OF1A 5KYIA 1E2WA 4FO2A 1EOTA 4B9WA 3AMUA 1SYBA 2JXTA 2WKDA 3NPPA 5BMGA 1FNVA 3SK5A 3DUZA 1TWGB 5IODA 3AEAB 1D5ZC 5IGBA 2O5JC 1JWAD 1YQ4B 3LYYA 5E6JA 3MXPA 3U2SC 1STEA 3L9AX 3I4LA 5FLXL 2Y3AA 3IL8A 1PGAA 2DLBA 5ELCA 4TSSA 4Q2JA 1HQMC 2F0TA 1I6HB 2D2CC 2F0HA 3IAYA 1V8QA 1ET6A 2LY7A 2TMPA 3SR1A 3HRDD 1L0YB 2F0IA 4C80A 3Q8BA 2QIEB 1C4QA 1LT3D 2RDHA 3BVGA 4A3GB 2H1EA 3VR5A 1AYFA 4KGTA 1RWSA 1RODA 1WWTA 5C6AA 5C4XB 1IBXB 1ILPA 1TKGA 2WP9B 2PCFB 2KJXA 3VRBB 1I4QA 1OXTA 2WXLA 5I2XA 2WINB 3FC4A 2ICEC 4EVOA 1W6JA 3NTIA 1QNUA 2F0MA 2JU6X 1B4OA 3A56A 3SFDB 2F0WA 2BOSA 1CHQD 1EY9A 1PDQA 4KGSA 3T3NA 3TP6A 1PTOF 2NN6H 2H4OA 4XT1B 1GB4A 2L11A 3Q6SA 1ZYRC 5C3EB 1PZJD 4HAEA 5EJWA 1SEBD 1Z47A 1TY0A 1D2BA 4XXEA 1CFMA 1JCKB 3ETRA 3U4EG 3NVZA 2EJFC 3AB9A 5JAVA 2M56B 2WXKA 3TZDA 4U673 1G6ZA 1QKZA 2WXHA 4RA8A 3TEYA 3TP5A 2BS3B 3HGBA 3NTKA 1TS5A 4RWSC 3R2IA 1YN5A 4IN3A 1TKEA 3G6JB 2A6EC 3J81L 1AFPA 1VJKA 2YU9B 3OPOA 5TSSA 3GO5A 4MHEA 3Q8FA 1BCPB 2KAJA 2WXIA 3TP7A 1Q12A 1DOMA 3NK9A 4WAFA 1OXXK 1ZE3D 3V3XA 1PRTF 1WVLA 3OMGA 3HOUB 4DXFA 2VB2X 2KMMA 1OXVA 4KD3A 1ZUD2 1A70A 1M4VA 3S1MB 4HKQA 3DXJC 3P42A 3K0YA 3VA5A 1VRAB 3IAM1 1JWUD 2K33A 1DOLA 2B2VA 2DWQA 3W1SA 3PO0A 4K5XA 5C5LA 2EY1A 2SNMA 1I7HA 2K5PA 3HOXB 3SVMA 1KRHA 4CKBA