1I4QA

Crystal structure of staphylococcal enterotoxin c2 at 100k crystallized at ph 6.0
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
239
structure length
234
Chain Sequence
ESQPDPTPDELHKSSEFTGTMGNMKYLYDDHYVSATKVMSVDKFLAHDLIYNISDKKLKNYDKVKTELLNEDLAKKYKDEVVDVYGSNYYVNCYFSSKDNGGKTCMYGGITKHEGNHFDNGNLQNVLIRVYENKRNTISFEVQTDKKSVTAQELDIKARNFLINKKNLYEFNSSPYETGYIKFIENNGNTFWYDMMPAPGDKFDQSKYLMMYNDNKTVDSKSVKIEVHLTTKNG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of staphylococcal enterotoxin C2 at various pH levels.
pubmed doi rcsb
molecule tags Toxin
molecule keywords ENTEROTOXIN TYPE C-2
total genus 67
structure length 234
sequence length 239
ec nomenclature
pdb deposition date 2001-02-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01123 Stap_Strp_toxin Staphylococcal/Streptococcal toxin, OB-fold domain
A PF02876 Stap_Strp_tox_C Staphylococcal/Streptococcal toxin, beta-grasp domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.110 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1i4qA01
3.10.20.120 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1i4qA02
1UNSA 3CHBD 1SXTA 4DXFA 1D5MC 3BYTB 5TSSA 2AQ2B 1I4PA 1L0XB 1S5CD 1RCVD 1F77A 3MC0B 1B44D 3DWQA 1PRTC 1DYQA 5FKAC 2J4XA 1PTOF 1PTOC 1ESFA 1FNWA 5D3IB 3EFXD 4RGMA 1V1OA 3R8BA 3TSSA 1I4QA 1TS4A 1UUPA 1I4HA 2QEJC 3OWEB 2SEBD 1CHPD 3V05A 3MFGA 3BYYB 1KLUD 1PZKD 1SE4A 1CK1A 1ET6A 1GOZA 1JQYD 1CT1D 1PZID 2AQ1B 1ENFA 3O13A 5I4DA 1JWUD 1AN8A 1LT6D 4BWGB 3W2DA 1KTKA 1S5DD 1I4XA 1EU3A 1BCPB 2NTSA 1PTOD 5ELCA 1T5XD 1FGBD 1LTRD 4L6TB 1LTSD 1V1PA 1DJRD 4RHRA 3GP7A 1LTAD 1LT3D 1I4RA 1LT5D 1HTLD 1PRTB 3SEBA 2R61A 1TS2A 1LO5D 3R2IA 4Z9CB 1BXTA 1TS3A 1CHQD 1RD9D 1JR0D 2Z8LA 5FK9C 3URYA 1XTCD 1QILA 1HQRD 1JWMD 1TS5A 4OHJA 1B1ZA 1EU4A 3BZDB 2NTTA 2AQ3B 1PYWD 4UDUC 4C56C 1FNUA 1LTBD 5ELFA 2QILA 1CQVA 4ZYSA 1HA5A 1ET9A 1RF2D 1BCPF 1BCPC 2CHBD 2IJ0A 1LLRD 1AW7A 3R2TA 4RHSA 1PRTD 2G9HD 1JCKB 1SJED 2O2LD 5ELEA 1D5XC 1TY0A 3BVMA 1PTOH 1STEA 1LTTD 1SJHD 2XN9C 2IPKD 1LTGD 1S5FD 1D5ZC 1LT4D 3BVGA 3DWPA 1PZJD 1XXGA 1FD7D 1SBBB 2XRQD 4RCOA 1LTID 4NZLB 1L0YB 2RDGA 1EEID 1SE2A 1SE3A 2ICIA 1SEBD 1TY2A 1D6EC 1M4VA 4RGTA 1EWCA 1PRTF 2XNAC 5D3DA 1JWSD 1MD2D 5ELDA 1PTOB 1BCPD 1HXYD 1I4GA 1KLGD 1V1PB 1S5BD 1FNVA 3EA6A 1S5ED 1YN5A 4K6LA 5ELBA 4RH6A 1YN4A 4RGNA 2XRSD 3KLSX 4DXGA 1EEFD 1EFID 2RDHA 1RDPD 1YN3A 4TSSA 1G8ZD 4O1NA 2WV6D 4RFBA 2TSSA 4L63B 3BVZA 3DWAA 4RGOS
chains in the Genus database with same CATH superfamily
1TWFH 3AEBB 3RD2A 1LGRA 5K36G 5JJKA 1B3QA 3GTJH 4LFAL 2SNSA 3E5SA 3UE0A 4BY1B 3I70A 4JX1C 2E3TA 5DPWA 2VH1A 5JHAA 2NYZD 5IYBH 4JI2L 2DLBA 2NVQB 4RKBA 1PH2A 2NR2A 2JZ3B 4JBMA 5IGBA 3S1MB 3AEEB 1FNWA 1EY9A 5CBAE 4MGZE 4XXEA 2DYMA 4RMFA 2KOXA 4ZRJA 1SSNA 1I4HA 2VY3A 5CYUA 1V1QA 2KDBA 2RDBC 3PCOB 3MFGA 3BYYB 3IVFA 3KUCB 3DUZA 1L1OA 3VR4A 4B3TQ 3Q22A 2V9HA 1GUSA 3K5MA 3CCLA 2BH2A 1JRPA 1HCZA 2QGQA 2BKRB 2K52A 3KQ4A 4W9FA 2RPVA 4RWSC 4AJWA 2EJGC 4A93H 1BCPB 4DN4M 3A1QB 4JIOU 3MJWA 1L2NA 2IDYA 1X1MA 1ZDXA 2K5HA 2MX2A 3KFUA 2B76B 2NBUA 2QSDA 1UZXB 4E71A 4X64Q 1XNQL 2JA6G 3T9LA 1WWTA 1SE9A 4QJFA 3ND9A 3C2PA 3MJ5A 4FULA 4KKJA 2F0SA 4TQ1A 3A9JA 3QAQA 3J81L 4C7YA 4R4IA 2WXJA 4NMZA 1ILQA 1BXTA 1WTXA 5G5GA 3V6CB 4XQJA 2E75C 2HJ8A 3AN1A 1CSPA 3CCVA 2QMTA 5G3LF 2DYBA 3KLWA 4JYAQ 2NBVB 2MBQA 1YMHE 3S1QH 4G50A 4A3BB 2F0TA 2ZM6Q 3H0GG 1VQKA 2LKVA 1O7ZA 2RCNA 2ZNVC 3SU8X 2JYOA 4JI7L 2JA7B 4KDIC 5ELFA 3PO3G 2Y0SG 3VAWA 2HDLA 2B2UC 4QIWB 4E6IA 4H7BA 3FAHA 3D4DA 2GOWA 2O6VA 1KC8C 2YTVA 4KD4A 2NBFA 2DWQA 1BQQT 4OELB 4XT1B 2WXQA 4BXXH 4PQXA 3V6EB 2E2JH 2EPBA 3S17H 5CTRC 4JI3L 2J53A 4G7ZC 4XWWA 4CKEA 3DXJC 3S2DB 2DHZA 4NQLB 3U7DA 1D5ZC 3N9YC 4GDLA 2A6EC 3AEFB 3M7GA 2JWUA 1H9SA 2AMCB 4RCOA 3M4YA 3S2HH 5H8YE 2HCIA 2F0OA 2PLPA 3KBXA 4NJCA 1UWVA 3P4PB 4OO1H 4LF5Q 4R1JA 4PS8A 4MTNA 1BO0A 1J0GA 1V8CA 1RFAA 4NW2A 1Q90A 4R4QA 5C4XG 1VLBA 3KH0A 1SYEA 1TKEA 1YQ4B 3D4WA 4GLAC 4ACFA 3L16A 4CDCC 1VZ7A 2AL3A 3GTQB 4QIWE 2MO0A 2CQOA 4C3JH 5I6WA 5C44H 1FJGQ 4EFOA 2N78A 4R4CA 5EE9A 1WGGA 4B3SL 1YN3A 1X32A 1KRHA 2KDMA 2VW9A 1QOAA 4AYBB 4MNOA 2B2WC 2JEAI 3AE7B 1TU2B 2WP8J 4BBRB 2PPBC 1G2TA 1E7UA 2PCFB 4O1NA 3SHQA 4K5WA 1VQEA 2A74C 2JXTA 2IY1B 1Y69U 1VQMA 3DWMA 4DK0A 5FLXL 2LFIA 3S1RB 1UELA 1STHA 2K32A 2BYFA 4IUVA 4FJVB 1C3TA 4OONA 1YNND 4LMQD 1N5WA 3VH4B 3PQIA 1SF0A 5IGFA 1CKOA 5ELOA 3AEDB 4A3FB 2OTJA 2VL6A 4R4TA 3FMCA 3NP8A 2G9DA 1U0LA 2C35B 2DAJA 3RT3B 3MEHA 2UU9Q 2LRUA 2JA6B 4A4IA 3W1GA 2Z4IA 5D3IB 2RF4A 4JV5L 4NAMA 1S3SG 4ASWC 1VMCA 4X62Q 3A4SC 3CMAA 1EZ6A 3JC66 1Z5SB 3X0WA 1KDBA 3SXHA 2A69C 4OGQC 2XVSA 1TWHH 1FMAD 4BKSA 3C3LA 3VR5A 3VA7A 2AQ1B 1PH3A 3S1MH 3TMEA 5HY6A 1SMYD 5EBDA 2MP2A 4BWGB 2B8FA 3K7AH 4EVOA 2UXDL 2KN5A 3KF6B 1VQDA 4MGKE 4FJZA 4CO7A 5G55A 2FMCA 3J81c 3VTWA 2VUMG 1LTSD 1E7VA 2F3IA 3NWTA 2B3GA 3GP7A 3Q8CA 2D2CC 5IGEA 1HZCA 2HIVA 2H89B 3LJ3A 2OEDA 1G291 2WAQG 3G4SA 2V3SA 4MH8A 4LNKA 4X3KA 3VRBB 2RMMA 2EZVA 4IUNA 5C3EH 3MVVA 3CRKC 1IGDA 3FILA 1G6JA 4JYAL 2N49A 1YITA 1ZKHA 2NVQH 4KHZA 1PFDA 3RN5A 2V0GA 2AUJD 3R7QA 1XPUA 2RHSB 4H0LC 5MPOA 2KWVB 1IYUA 2K6QA 4P74A 3N3KB 3GTGH 1ISNA 5KNCA 1TJEA 4DXAB 3ZTCA 5K36H 4XC2A 5E7NA 2AL6A 2QEXA 1CQVA 2PI2A 4KHVA 1PH5A 2IWHA 1HA5A 3PUWA 3VR2A 4DV3Q 1T6BX 3UE1A 2RA4A 1UD7A 1RL2A 4JI4Q 2NVTH 4B9KA 5CV8A 3W1BA 4A3EG 4DR6L 3ZW3A 5IT9L 1YVCA 1R4NI 3A7LA 5M5WB 3FKIH 5CHVC 4ZKCB 2EYHA 4IQZA 2JN4A 1NBWA 1NDDA 3K5OA 4MH0E 3I4NH 4BOSC 2R7ZH 4B6WA 4KGSA 1B7YB 2OQ0A 1L0WA 3K6OA 3N1XC 2EE1A 2EYLA 1I94Q 2M4NA 2L8JA 4CDEC 2DBYA 3HKZB 2GBRA 4M8NA 1VDVA 1QE6A 4LDTB 2K6AA 1ZOYB 2QJLA 3Q8EA 2OHFA 1D7QA 5FR6A 3NPPA 3H94A 4ME3A 3A33B 4GKJQ 1S1QB 3KYDD 4IWQA 3WDNA 4JI8Q 4NAWB 4O0AA 2L4NA 2CH4W 2UUBL 1OQYA 1EWIA 3FHWA 2LGYA 1O78A 2E5LQ 1UNSA 4NDXA 5M3MG 4DR4Q 2JX5A 5D7GA 3F2UA 1D5MC 1N63A 3N20C 5TSSA 3S17B 1TKYA 4KIKB 4IDIA 2PMVA 1T3QA 1V5OA 3NG0A 4A55A 3M7NA 2DJGC 1RCVD 2JA5H 2ZJQA 3DWQA 3ZNZB 2NN6H 3R93A 2BS2B 4YWLA 3M3YB 1Y1WG 1YEZA 4GOCA 1DOXA 1K9MC 4DUYL 4QY7A 4UP9A 4RGMA 1OXVA 3HGBA 3AECB 3ND8A 2HQEA 1QVFA 2K9XA 4REZA 4PS7A 1IW7D 2SEBD 3FPPA 5CV5A 3TP5A 1UAPA 4B3RL 3LXFA 3MP9A 1EFWA 1STAA 4HMIA 1GO3E 2WXRA 1SE4A 1BKBA 5AJ3L 2PKOA 2JQRB 4XDCA 3TCAA 4L8JA 3CKIB 3TP7A 3PZ7A 2O4XA 3B2GA 4GKKQ 2CWPA 4HCEA 3CCMA 4GOPB 1AH9A 5EDSA 1WJUA 1Y8RC 2K1FA 1VMPA 5KHQA 1T5XD 4EGVA 1N60A 2GVAA 3I73A 2KHJA 4ME5A 4RG1A 2JY6A 1TIID 1VQCA 2KANA 3MHBA 1W6JA 4YY3L 1N33Q 2ZW0A 3HOZB 2BWES 3ZLZA 2Z0SA 2N1VA 1EF1A 2K5WA 4WJWA 3PLUA 3VDZA 1Z6HA 3PUXA 2OCEA 1YJWA 2PE9A 1Y1VG 2EYOA 3D6WA 3MHZA 1CZPA 4LF4L 3RNBC 1IYVA 1HZ9A 4DHJB 3ZYYX 2OJWA 4WIPA 2PW5A 4AP4C 1BR9A 5AFWA 1QT9A 3DBSA 5I6YA 3GTLH 2Q2TA 5J3BA 2R7ZB 4DV6Q 5IGGA 1PVOA 4QGUA 3RLNA 4TRDA 5HURA 2LGXA 1EL0A 4YXDB 1FIQA 3Q3MC 1WYGA 4OL7A 2A6HD 3Q8BA 5BO4B 1UWXA 3AE2B 3BK2A 2LUMA 1TWFB 1D2BA 1P7EA 3X3MA 3RZDH 4NJ7A 1IKMA 2Q5WD 4DAPA 2HQLA 2ZTCA 3V62A 3GTJB 2K04A 4LUOA 1FVIA 1BT0A 2G5DA 3HKZG 4GN4B 4PMCA 1MI0A 3BVGA 4IZ8A 3CC7A 4MSQB 3WCQA 4B3MQ 3RNGC 2QDBA 1MSGA 2ZVNA 4NZLB 2K6DB 1WXSA 1CM9A 4KDLB 1D6EC 1D1KA 5D3DA 2JT4B 3PO2H 2HUGA 3D8GA 1WTWA 1OEYA 4DV5Q 3Q14C 4MELA 3UI3A 1H9RA 4M02A 2WXGA 2EY2A 4QF4A 3RCZA 4TKOB 4A8XC 4A3GH 3U4ZA 1K8AC 3HOYB 4LNIA 3DVGX 2M00A 2V4IB 5M5YB 1SNDA 5BR8L 1VQ6A 1OO9B 1RDPD 1RJTA 4W9JA 4C80A 1JJGA 2MW5A 5IP7H 5C4XH 1WI0A 5DM73 1A6XA 4G57A 4ZRZA 4OWTB 5C1ZA 2AUKA 2BE5C 3F2DA 4IN3A 1FGUA 3DWGC 4PV1C 2HDEA 2WDVB 3GS2A 4S0RA 4G11A 2E74C 3I2ZA 3AE5B 1P3QU 3NVYA 5D6JB 3PF4A 2JA8H 1SXTA 2QF7A 5I2XA 2HHHQ 5GADC 3AXCA 4YL8A 4OVVA 2H1EA 3CC4A 3T1YL 3R3OA 3AEVA 1E7PB 1TZOA 1U4PA 4A3DH 3H09A 3B2FA 2I5HA 4MTKA 4KVGB 4LF6Q 4IC7B 1GUTA 4BVUC 4DBGA 1D1IA 2K4KA 1K3BC 1J9OA 5A35A 1WTPA 2NUCA 2PNHA 2GB1A 3FKIG 2QCZA 4MM3B 3C8YA 1TS4A 1C78A 2KFKA 2BS4B 3L0OA 4HK2A 2OEOA 4KN7C 4IUUA 1RRBA 2JA7H 2LXAA 4I6LB 4HSVA 2NZ1D 2LJ5A 2KOLA 4G4KA 1PZKD 3ULLA 4DNIA 4A3MB 2UUAL 4POGA 1ZEQX 2JUOA 3U4VA 3W5UB 4DUZQ 5ISRA 4X65L 3UDXA 5DLQE 5AUIA 2KC1A 1ILPA 1KNAA 1PTOD 3S14H 3BIID 3GTPH 3A8IE 3S2DH 1I3QH 3OSOA 4IPHA 2B63G 3LGJA 4FYDA 2AX5A 2BKFA 2IBIB 4RNAA 3KF8A 2NVXH 3PRPB 4A3JB 3ML8A 2KWDA 1VQ7A 1LTAD 4HPLB 3SEBA 2JA6H 1KJTA 4PMWA 2R61A 1VZ8A 2I0QA 1YHAA 2XK5A 4EUTA 4N59A 5M9OA 1JWAD 1LQBA 1YZ6A 2PI2E 4OIJA 5C4JB 2KFJA 3OAWA 4TQUS 1QOFA 1CI3M 4M0WA 4M01A 3HS0C 3RN9C 3BDLA 1MBYA 3OIPA 1B1ZA 2VUMH 2MO1A 2L00B 2KJ6A 3R3MA 2PMZB 2GRIA 4UDUC 2PQAA 5FLMH 2RSOA 2X6GA 1FNUA 1WX8A 1MPEA 1FD6A 1OQQA 4IUMB 5T8IA 2J7QB 2BDOA 4XQQA 3DQVA 1I35A 2N0SB 4JPSA 5IY0A 3NELA 3HKZE 1NSNS 3S15H 1TTNA 4MJSA 3U8ZA 1VZ6A 1HR0L 1G2SA 2KHSA 2NVUI 2JPHA 3UF8A 4LF6L 2W54A 2LXKA 1XPOA 4KSLC 4NXNL 1HZAA 4N8X1 3S9WA 1GJZA 2F0UA 4AUQC 3VTVA 4IALA 1GM5A 1WI5A 2WYQA 1LACA 3QO2A 1WIAA 2WQYB 3PO2G 3I8ZA 4F87A 1WGHA 2O2VB 4HCSA 5DM63 2WB1B 3PUVA 1EEID 2INNE 2QDLA 4XWTA 2ICIA 4CKBA 4DV5L 3HG9A 1F2MA 1IUEA 2L15A 2XK5B 3AM9A 3KYCD 2RSUA 3P4RB 2F3VA 1RFKA 4BAXA 4IG7B 2LY7A 3IHPC 2HIXA 4ZYNA 1WOCA 4B08A 3RLOA 2C7NB 2WACA 3EA6A 1XLNA 3Q3FA 4RM8A 1T5EA 2NB0A 1GAQB 3Q69A 4YSXB 2E2JB 4ITKA 4GNXB 3CF5A 2BWFA 2BQQA 1EYAA 2BYTA 1ZXIA 1Q8KA 1ASYA 1L1OB 1UGMA 1XQQA 4FDBA 4L63B 1X3FA 3JAML 2N3SA 4JI5Q 3RNFC 1E3PA 3WWVA 2DZIA 1EQQA 4R8IA 2QA4A 5CBEE 1J6QA 3KYHC 1IBLL 2HHHL 1KH0A 5IAAC 1RKNA 3ERSX 2KBNA 2R7FA 2VXWA 2IGHA 3Q6SA 3DEOA 4A3FG 2G3QB 2H4OA 5F2DA 2FCSA 5EQ0A 5C4XB 5L37A 4DAYB 4EEWA 2J42A 5FKAC 2IX1A 4DR7Q 1TWHB 2F0NA 1JJCB 2J4XA 4A3JG 1OEYJ 1PTOC 2F0KA 4ANUA 1J7AA 4FHKA 2IX3A 3TS0A 4N9PA 1HEZE 1M8AA 3HVZA 4WJ4A 3DHHC 4N9F4 4A3IB 3ZNHB 1C7YA 1KLUD 1V80A 3ZDTA 5DPTA 5G3LD 4FNFA 3HOYH 1FO4A 1CK1A 1KFYB 4YTNB 1E24A 3NQTA 4P75A 4K5XA 1PZID 2R6GA 3RD4A 3S16B 2L05A 2MBOA 3MC8A 4FLHA 4A90A 1HTQA 2NWGA 4HTHA 2EKIA 3JSVB 3U52E 4DR1L 4JOIC 5IGCA 3L2PA 3ZRCA 2P5ZX 5M3FG 5ELCA 4GKKL 5IT9E 2UUCL 4PS3A 4EKUA 4F7XA 1E6EB 3P1MA 4A3MH 2YV5A 3PRZA 3J80E 1OFFA 1XYIA 5BN4A 3DVGY 3NZ3A 1NENB 3RZDB 2Z0EB 1TS2A 3Q8FA 3T13A 4ZRQA 2CFMA 3RN2A 4GN3B 4K2LA 1KNEA 2Z6BA 4TKNA 2IHEA 5GAHC 4OZBA 1STGA 1I42A 1LM8B 2K5NA 3U9SA 1PFMA 4DK3C 1N5XA 4H2AA 1E8YA 3WAPA 1N32L 1IBKL 1C4CA 2JZPA 4C56C 4GZYC 2BBCA 2L83A 4ULLA 4UY8C 5EPLA 4KHPL 1HZ6A 3RZOB 4L1BA 4FO2A 3Q6BA 4X3UA 1NI2A 5E3FA 1YNNC 2K50A 3DVNU 2GI9A 3I56A 4L2YA 2F1MA 3N52A 1FPYA 5M5YH 2K5PA 2DY7A 3NUCA 1UH6A 2G9HD 1PHJA 2O2LD 4HWIB 3J7AF 1TY0A 4DU9A 1OTCA 1B9MA 1TWAB 1MVKA 2CR5A 4EQPA 4EQOA 2JSVX 4DAVA 4KKTA 3STBC 2JA5B 3HOUB 1XTDA 2X8XX 3DWPA 3FPUB 4BBSB 4KV6A 4A3JH 3FKYA 4GU2A 4XE0A 4QUCA 1AE3A 2M17A 4X3TA 4HJ7A 5AUKA 1NR4A 3HM6X 1WZ0A 3H91A 2SNMA 2N9XA 3VHTC 1SIJA 2UXDQ 1W2BA 2K14A 3CRLC 2KQSA 4DA2A 1FYCA 3CWIA 5JEAG 1UE1A 2RCFA 3GD7A 1XCQL 2JU6X 2LHDA 2MA9B 4XYCA 5GXGB 5I9OA 4LF7Q 4XTCS 5JXVA 1EFID 3NVWA 2R3ZA 4LLGM 3J81E 1U5KA 2LSSA 3PPAA 3BK1A 2LVQA 4FF3A 3NTKA 2WV6D 3NTHA 1YNTE 3B0AA 1WYWB 1EIGA 4HVBA 3AQQA 2D0OA 1E2WA 4PZ8A 4PT5A 2ZT9C 4O2DA 4DHJD 1QG7A 2VQEQ 3CHBD 1C4PA 1WRIA 2WHIA 3KK7A 4NNJB 4NJ6A 2PE6B 1S3OA 2UXCL 3K0XA 1UWMA 5IWAQ 1F2RI 5C3EG 1UEAB 1S5CD 3GTPB 4DR7L 3L3OC 3TDQA 4C3IH 4XZ4A 1PRTC 2ICEC 2EXDA 3HHMA 2B2WA 1WM3A 3MXPA 1X3EA 5HGTA 3LNNA 1WSPA 2OXPA 5C5MA 2A6ED 1NMGA 2QW7A 2HDMA 5LMUL 2D2QA 4IPDA 4F8MA 2W9NA 5BMIA 2E2HH 4DR6Q 3WOEA 1ICFB 4P1CC 3TEWA 4B0MA 2L3ZA 4S17A 2N1WA 4C2MH 1VCIA 1QZHA 1XEEA 3TJPA 1GKHA 1B2TA 2F0LA 3Q3OC 1ENFA 3K8AA 4DGZA 3DBHI 1MJEA 1I50B 1JB7A 1FEHA 2K5QA 2FNJB 5JVG3 4KZCA 3SR1A 2O5JC 1II3A 4P71A 5E6PA 1GUOA 4GN5A 1S72A 1RLFA 1P0RA 1EIHA 4DAMA 1PQSA 3T1HQ 4A3KB 1LTRD 1H4RA 4NY0A 2QC8A 2QDFA 3RUZA 1WCMB 3SDZA 1ROEA 1WMHA 3IBEA 1WF9A 1I94L 2YU9B 2NPTA 1W6KA 3LWUA 1MFWA 5BMHA 5J17A 3I91A 1MSHA 3E0JA 4HCPB 1TS3A 2D3GA 2Z8LA 5LMNL 3ML9A 3NJTA 4A3EB 1SYDA 3URYA 3V3XA 3RPFC 2ASBA 1TS5A 5I9PA 1AARA 1H9MA 2K05A 2NZHA 2UUBQ 4BBSG 1PYWD 3NVZA 3WOFA 3MA2B 4OVUA 4A3KG 2OF1A 4DV4L 1A0IA 3HVDA 2K0PA 3HK0A 5IWAL 2MSED 1NE3A 2BOSA 4X64L 1XNQQ 4NXML 2R93G 1F52A 2D3CA 4J6HA 1V86A 2MBBB 1ET9A 5FLXc 1YJ9A 3HOZG 1AW7A 2B2UA 5C44B 1O7IA 4IFDJ 1H95A 4ZHOA 1TKGA 4A3LG 4K3BA 2I2YA 5LXHA 1STEA 1PA6A 1PFSA 3TZDA 5C23A 3IT4B 1NBFC 2KACA 1XNRQ 1EUJA 1HFGA 4OO1G 1T0YA 1NMFA 4K5VA 2WXMA 4BKGA 2DZJA 1DZ1A 1HNXL 1TY2A 4JBJA 1WXMA 4JWUC 3KUDB 5DCNA 3VVWB 2KKCA 5LXIB 2F4IA 3HOUH 1V1PB 4JLCA 1S5BD 1MJDA 1RIPA 1B53A 4BXXG 1H9SB 2IY5B 2MJ3A 3TEZA 4RH6A 4JI3Q 4A3BH 3ONSA 5BYQA 1N8RC 1Y1WB 2RSNA 4QCLA 3DPDA 4DDGD 5D65A 3O65B 1WD1A 5ELNA 1NYRA 3EBEA 3E6ZX 4JBWA 4ZUJA 3KWVA 1WJ4A 2W3RA 1N6ZA 3X3NA 1B50A 2Q2IA 4A3GG 2LI5A 1Y1VB 3AE3B 1CZGA 4DXFA 1EY0A 1DGSA 2JXMB 1HRJA 4DR2L 3AEGB 3L13A 4DV7Q 4GDLB 1HPCA 2Z6KC 5C5LA 3VDYA 3GOEA 1YX5B 5EKKA 2N9LA 3VUYA 2KC2A 1VRAB 1QOHA 3I7FA 1XMQQ 1KL9A 3IXSA 2RGFA 5GQOA 2CU1A 1WR6E 4XT3B 3IAYA 5C3WA 4DR5L 5G5HA 3W1YA 3A8JE 2JVCA 3CMEA 1J5EL 5EE3A 4ZHPA 3A5UA 2KLGA 4KN4C 4HJAA 4O42A 2MCNB 3SDLC 3VH3B 4KLKA 4LNFA 2BGFA 3QCAA 4BBNC 2KVMA 1GOZA 4ID6A 1MHWC 4A75A 2KXJA 2M0XA 4YCVA 3GB1A 4MT5A 3S2AA 5I4DA 5KNDA 1D3ZA 1WRDB 1XLQA 3QX1A 3W2DA 2RVLA 2VQFL 4PK1A 3HOXG 2W3SA 1H8CA 3SE0A 3T3NA 1CTMA 1QQRA 3OW2A 3WAOA 1RYJA 2A19A 2Q2HA 3NK9A 1YHQA 1PYBA 4P6VF 3JVZX 1JE5A 1U4MA 3UDGA 2K39A 4JI0Q 1OTRB 2L0FA 4QQBX 2WIIB 4OZAA 4Z9CB 1UBIA 2E8GA 1E90A 3PHWB 3E9HA 1LV9A 1BVSA 1TQOA 1R4NB 1EY5A 3MHSD 4IWOA 2N9PC 1U4RA 2NBWB 4K8IA 3RNUA 2L32A 1HQRD 1KF6B 2MRPA 4YT0B 3L0WB 4WWPA 4YHHL 3TUOA 1WTVA 2AQ3B 1MG4A 4C3IG 4G7OC 1WZ3A 2J0MA 2LFNA 3VYSA 1GD7A 3T4AC 1R7SA 4WJNA 4BFRA 1SFOH 5M3FB 3ZDMC 3U50C 1DOIA 2F0IA 1VCBA 3M9BA 1WX9A 5EBCA 2LWPA 3E0EA 1QVCA 1MI2A 3PIP3 2NVXB 2W82A 3W5VB 2F0HA 1Y8PB 3DHIC 1BCPF 4KJOA 4FHJA 4AQYQ 2Y5PA 5CHWA 2N88A 1JCKB 1UGJA 2MUYA 3BJUA 1AWDA 2MBEA 4F1SA 4BBRH 3M4PA 3QIJA 2XN9C 5IIFA 2IHFA 1LT4D 2LS01 3GDEA 2WGSA 4V190 4KMUC 3CSFA 4LNNA 2DENB 4MGYE 3D32A 3QIAA 4JL9A 2C9OA 2AEHA 4CYEA 2G45B 1SE3A 1SEBD 4CJ2C 2FIFA 4POFA 3VXWA 1MD2D 5M5XH 2XBBC 3Q8DA 2G1EA 2GBNA 2ZM6L 3L10B 5IP7G 4YTPB 4KKSA 4DV3L 4P16A 4GSWA 5CV6A 2EOTA 2HD3A 1YN5A 1K0RA 5ELBA 1O7YA 2K5DA 2IGGA 2NPTB 4C1NI 1KDAA 2LHEA 4I6NB 1EO6A 1XO3A 2GMIC 4FP5D 1G8ZD 2KCTA 1BUVT 1AZPA 4BOZB 2PQEA 5EJWA 2WKDA 3M3JA 1KAAA 1DCZA 4PG3A 3MZ5A 2KWCA 4HSPA 4DPGA 3JAMi 2F0MA 5GMVA 1PDXA 2XSCA 5EAYA 3OIQA 2B2YA 3BYTB 2KX0A 1JC7A 3UINB 3G7LA 4JVZA 3GZNI 3PREA 2Z9HA 4GDKB 2BPSA 4AQ7A 1Y56A 4NAWA 1I7HA 3AV8A 1R9TH 3CW2C 2KJRA 3GQBA 1ESFA 4HPMB 2YTYA 3PO3B 4GIVA 2AKWB 3M95A 5EE0A 1UUPA 4B95A 2WXFA 2DYOA 3QK0A 3KF6A 2J0KA 4UP7A 1R4QB 5KYLA 1T0RC 2D62A 3CC2A 2HTME 5HGQA 3VR8B 3WALA 4OZCA 1EYDA 2MNAA 2XWJB 2BS3B 1FCCC 2LZ6A 1AFPA 4MM3A 1Z9FA 1EYGA 3HRDD 2K75A 2CKZB 4RCNA 1AZQA 3GTGB 4TQ0A 1LUZA 4JI6L 1ZW7A 2INCC 2GBJA 1GG3A 1YQ3B 3WIMA 5LMNW 1VR9A 3NY5A 4MZ9A 1QJOA 1QNKA 1DGJA 1XD3B 4HJGE 1P98A 1HTLD 2EYFA 5JJZA 2RQXA 5JJLA 1JRUA 2WXPA 4NB3A 2F3WA 1A63A 2DZMA 2C7HA 3ZVVA 3K57A 3GTMH 4XYQA 3GO5A 5KYIA 2YVCA 4A93G 3EFCA 4HXDA 4CQNA 4MEMA 5E4XA 4M0WB 1QILA 3PSEB 3I5JC 2D11A 1JWMD 2MQHA 4OHJA 3ETRA 3ENEA 3DBHB 4DK6C 2WDTB 4C3JB 2I5MX 3HOWB 1CMXB 3VR9B 2KECA 4FXCA 2B2VA 2XEWA 3K7AB 3JAME 1PV4A 3CIRB 2LMCB 2JZZA 2VRRB 1DOKA 3TP6A 1RM6C 3SGIA 3OTOQ 2PEAA 1EOVA 4ZUIA 1NAPA 4QAYA 4FJYA 1BCPC 2DNFA 2ALYB 1LLRD 3CCSA 2JRHA 4WAFA 2Q8TA 1Y1WH 1A2UA 3IL8A 2NZOA 2IO3B 2HE7A 2JA5G 3NS8A 4KI0A 4BA2I 1LTGD 1V9PA 2C5CA 3TL5A 2FCNA 3PIPA 1PZJD 4HLEA 1TXYA 4NP5A 3NZUA 1QUQB 4AIMA 1E9MA 1WTQA 3AE9B 2SAKA 2RDGA 4WQOB 1VQBA 1WE7A 1Q3LA 4WAAA 1C4AA 1G51A 2WWZA 4KIKA 3AFPA 2GA4B 2D9UA 1YJ1A 2IZVB 3P20A 5K5PA 4LFAQ 2KCMA 3ERQA 3UIPB 4XDXA 3ZIMA 3A56A 1JQ4A 5CV7A 2MWSB 5HKHA 1EIYB 3KBGA 4JV5Q 2EXZA 2B2TA 2PIAA 3MAQA 1IYFA 1I50H 3HOUG 4A3PA 1IYJB 1TWAH 5DAUA 4C3HB 4CJ0B 3PIOA 1KQSA 1P1AA 3P1HA 2C9WB 5IN7A 2CKHB 2XWBB 1VQPA 3DBRB 3J80c 4KY7A 4FA6A 3L08A 4P2CB 1YNXA 2KN4A 4X66Q 2WX0A 4RGOS 1VQFA 1E0BA 1HA6A 5BN5A 4CBVA 3EQLC 3VTUA 1DOYA 2EJFC 1LFDA 1PGXA 3QQ8B 5CORA 4LNOA 3ULPA 4DNTB 3D0FA 1N61A 2KQ7A 3TBLD 2R2QA 4AOFA 4DR2Q 2K8CA 4YCUA 2M0AA 3DDCB 3P4QB 4DDID 4G7HC 4A3LH 2H5XA 1C79A 3TMPB 4HRSA 2MJDA 3OTOL 3HOZH 4L23A 1V43A 2K5VA 1JT8A 3E9SA 1UEBA 3RNEC 1I4QA 3AYHB 1TWGB 3CQZB 3DHQA 3VA5A 4A3KH 4DAYA 1PDQA 2WFWA 4IO9A 2MP1A 1J5EQ 4GKJL 2KHWB 2KMCA 1ENAA 1TYGB 2LGIA 4TVAB 1GXDC 3QJYA 4KV2A 4WJOA 4A9AA 4BY7H 1TZ1A 5IOCA 2F0DA 5BN3A 2MJEA 4DV0Q 1YJJA 3PO3H 1S5DD 3RMHA 2HJ1A 1HTOA 2WX1A 4U68A 4RMAA 3WAMA 1J19A 1UBQA 2GLSA 1IHZA 2VS1A 1I4RA 3MXNB 4ZCKA 3QWZB 1JB3A 4MHEA 3J80i 3A54A 2Z1CA 5C3JB 5J1ZA 2BB5A 3ER0A 2ZPYA 2DJFC 1L6VA 1VQ5A 1NY4A 3HP3A 3IT6B 4HROA 1JOKA 5EPJA 5LL6S 1AE2A 2WS3B 3R66C 5J22A 3QB3A 2D0PA 3GV6A 3I57A 4W9CA 2E2IH 2VB2X 4HR7B 2MFIA 5E4WC 4X6AH 1V97A 1XF5L 1GUGA 2EMTA 1EY8A 2ZVOA 3L4PA 4YSYB 1SE8A 2KEDA 4LF5L 5IO9A 1IGCA 1P8LA 2MEKA 2A8VA 3HOVG 2ZCBA 4M8AA 4R4OA 4PZ7A 2JP1A 2K22A 5JPMC 4ANVA 3F1ZA 3RZFA 1Q81C 1E10A 2DZKA 2L52A 2N9KA 4TUUA 1E8XA 4FBJB 5LLIA 1SJHD 2IW3A 1WJNA 3B08A 2XGTA 4MJSB 3K5NA 1AP0A 3KUPA 2E5LL 4US9A 4EQNA 4A3OA 3GE8C 1EQTA 3CPFA 2ZTEA 1FM0D 4JK1C 1NCVA 4ANWA 1ZDVA 2FINB 2F0JA 4WWOA 5EKLA 1G6PA 1VS0A 2EVBA 3J7A5 3QARA 1N36Q 3GTLB 1PRTF 3UQBA 2R93B 3EJIA 3ZJUA 2KO3A 5FJ8G 1HXYD 4IM2A 2FAZA 5IGDA 4HDOA 2O5IC 1CKMA 1QUQA 1RWSA 3J81i 3B6YA 4K1RB 5JEAH 2NVTB 5GROA 4ILWA 1E2VA 4BA1I 4AH6A 5KIXA 4YWKA 1WTRA 4PMBA 1QZGA 4A3BG 1SNMA 3DLLA 3NXWA 3ECIA 3H1UA 4W9HA 1IKLA 2F03A 1PGBA 3SR6A 3VFKA 1EY7A 2F52A 1HFNA 3EFUA 4II3B 4G3XB 3A7AB 1I4PA 5DEHA 3SFDB 1I3QB 1Q12A 3T16A 5IYCH 1GC7A 3P2BA 1BBXC 4LNQA 4MGIE 4GS3A 2F0WA 4WJ3M 3RMKC 3PO0A 2EJMA 4OVZA 3AULA 1YD8U 4DV1L 1P16A 3EGRA 4RM9A 1IBMQ 2EKEC 1K8MA 3NENA 2DNEA 3F2BA 3V05A 5BR8Q 3W3AA 1SFOB 2N8NA 2V1YA 5C0XH 2JQOA 1IL2A 1WGYA 2UYZB 4G0NB 3LYYA 4JPBW 4FXKC 4FXGC 2A68D 4DV0L 5KGUA 3U4EG 2IY0B 4MN3A 3AB5A 1WH3A 4KKIA 1NVID 1R4PB 1K3RA 4IUQA 1FFVA 1SGHA 1KTKA 2QHOA 3DHGC 4IM3A 4LWCA 4ZRIA 1G91A 2Z59B 1PXUA 1MGSA 2K28A 4JC0A 1EUVB 2VZKB 3IFWB 3OW7A 2V4DA 3OOCA 4YSZB 2JXXA 4HJKA 3N1ZC 1WMHB 5T1IA 2BE5D 2RR9A 4GGQA 5G2NA 2K7VA 3HOVB 2FJ2A 1K8RB 5FO8B 2JYEA 1U9RA 3R2IA 5IYCG 1ZXHA 5IODA 2ZW1A 1K73C 5JOBA 1X54A 5M3FH 3ICEA 2D5GA 3DMUA 2E2DC 1F9QA 2OOBB 2I1KA 3OG5A 1XTCD 1RHPA 1WR1A 3H7SA 5AEKB 2KQ4X 2JA8G 4Q2JA 2IL8A 3I4MH 3Q24A 3Q23A 4HDQA 1XWEA 4KGRA 4I6PA 4LJPB 5L83A 1BF4A 1PFBA 1VQ4A 5A2QE 4A3IH 2KD0A 3TS2A 4ARIA 1HNWQ 1YX6B 4OWXB 3DBLI 1PH7A 5CGKA 2BF8B 4GOPC 2BH8A 4BY7B 2WP9B 3GTQH 1DM0B 3R2TA 3K7UC 2KDFB 2KCNA 3A55A 2FCMA 2KDIA 2MP2B 5IYBG 3U58A 4CDDC 1E1TA 1NYQA 2KA7A 4A76A 2ZXOA 3APFA 4JE3B 4WRDA 1L2FA 1SYCA 2ES2A 5IKCM 3FC4A 1SE2A 5H92C 2CS4A 3HOWH 3BWUD 3RFZB 2M19A 5ELDA 1E8ZA 2F0EA 1ONLA 1RAXA 2IYDB 2BCOA 1E22A 4IOAA 4IOCA 1HQMC 4A3CH 1HUMA 4ICUA 2GVBA 3GZNB 4K14A 2KENA 4ZAIA 2ZXPA 3SK4A 4WURA 2X38A 4NPSA 2KLCA 1S5ED 3A5ZB 4MACA 4H13C 2GN5A 4K6LA 4M1UB 3NHHA 2IO0B 3H3VH 1PH6A 3KLSX 2KMMA 3CF6E 3JW0X 4TMAB 5AZGA 2CVRA 1I6HH 3CMMB 3CQZH 1SMXA 3WA0A 2MPMA 3AU5A 2RD0A 4UHVA 5JZEB 1B70B 3RZWC 2CW0C 4X65Q 3DWAA 4M8MA 3ZNID 5CV9A 3AE6B 4ZLTF 4C4VA 3CXCA 1VF7A 2Y0SB 3WANA 5JH5C 4J6IA 2ID0A 3DVNV 4URKA 4KX6B 4Y7NB 2WB1E 5M5XB 2ACZB 3LDZE 4L5SA 3FILB 3K80C 4MIUA 1B44D 2M1MA 1A3TA 4X3SA 3K81C 2OTLA 1UE7A 1UE5A 1YIJA 1PTOF 2L1BA 3Q2AC 4E3CA 3T53B 3JAMc 3R8BA 4ZQ3A 1B4OA 5CX3A 2LGDA 1HNZQ 1EWYC 2J0TD 4B3SQ 3HOXH 1JOQA 3T8MA 1EY4A 4A3IG 3K0YA 1NI3A 4N8FA 3UDIA 3H15A 4KTAA 1NR2A 1ET6A 5C4ZA 4DR4L 1UE6A 2JA8B 4LF4Q 5FR3A 2AWTA 3O13A 3MTNB 4W9DA 2JEBI 1OXTA 1Q7YC 2SDFA 1Y14B 3HKSA 2ZJRA 1RODA 1XLPA 1PMRA 2F0GA 2N7EA 2YEPF 1GC6A 4L6TB 3TRZA 2FIDA 1N34Q 3MXUA 4NXNQ 3ZQ4A 2EDGA 1KRSA 3H6MA 1VQ9A 2MLBA 3A9KA 1LT5D 1SNPA 5JVH3 3KJPA 3J80L 3AU7A 1FRDA 3T3OA 2B63H 4ODGA 2GBKA 3IAS1 3N32A 1TWGH 1C9OA 1KABA 5FK9C 1MKHA 1EY6A 1LYLA 2LD9A 1R4MB 1L6UA 2Z4HA 3BDCA 2OJRA 3S1NH 1FCLA 1ZP0B 3OJ4B 3AFQA 3F2CA 1F2RC 1STNA 4RF1A 1X3PA 3A9JB 1RTOA 3PIO3 3FDTA 4MDKE 2JA7G 1SROA 2M2LA 1TGZB 2B2YC 2L1AA 4DR1Q 3GTKB 2ZPNA 3AB9A 3KF8B 1C0AA 4JCVE 1M90C 1HR0W 4AYBE 3APCA 1K28A 4ZKBB 1SJED 1PH9A 2KTRA 1IXRA 1I6HB 3BVMA 3KW5B 4USAA 1F1HA 5L95C 2A4ZA 2C7MB 2WDQB 3VYTA 1HNZL 4C3JG 1IBLQ 1P7FA 1FD7D 2LJIA 4BKSD 4LF8L 4C4VB 3EROA 3TREA 4KGTA 1ZYRD 4RKLA 4JW0A 5IYDH 2A1AA 5D14A 1VQJA 2KCCA 5EGTA 2DNCA 5FO7B 3S1QB 2E2IB 2A69D 2CW0D 3NWSA 4C3HH 3K9PB 2A68C 5E6NA 1WE6A 2KFKB 1WX7A 5IA7A 2CCZA 5JPNC 3HIZA 1NUCA 3NZSA 1ASZA 4A3EH 2KNBA 1I4GA 2J52A 3NTIA 2C60A 3Q3JA 1WFQA 1FNVA 5IP9G 3M3YH 2LRWA 4II2B 3TEYA 3NOBA 1EZ8A 5KEEA 5LHY1 3PF5A 3PUYA 1N34L 1WY8A 3U30A 3S16H 4X62L 2MGSA 1E7ZA 2FXQA 4BBRG 4LUZA 1JMCA 2KZRA 5IT9c 3FRPB 4GLXA 3MEFA 4AYBG 1Q46A 4LFCL 1WJ6A 1X6OA 2B29A 4BBSH 4DHZE 1Y8OB 3KLSA 2X6LA 1QKZA 3VYUA 4W9IA 5BYRA 3KOJA 2OQKA 4A3CG 1DONA 3Q3NC 3H7PA 3RLFA 1MIUA 1CJEA 2R92H 3PSIA 2J7ZA 3G48A 2L11A 2UXBL 5TR5A 3HOWG 1G6ZA 1DYQA 2O6VB 1U4AA 4JGHB 3ZJTA 3UGBB 5T1GA 3I4LA 3HOVH 1IP9A 3TSSA 4Q0FA 4N58A 3NSWA 3P4SB 1IBML 3ZJVA 1Q1BA 3EUB2 3G71A 4HPPA 4GDKA 1N32Q 3C1FA 4JWSC 3ZTDA 1SLJA 4XX5A 4MSMB 1JQYD 4CDFC 1V2YA 1F9RA 4PZ6A 3IAM1 1PFNA 3T1YQ 3ZXVA 5LL6X 1BBWA 1F2LA 4IFDI 1X3GA 4EQ5A 1M94A 2IX0A 1TR5A 2ASQA 1JOOA 1HZ5A 2BB6A 2H88B 4OIKA 4FF2A 2LMCA 2Q8RE 3LX0A 1ZKOA 1K0SA 3I4MG 2V4LA 3VYRA 1KOTA 1V1PA 2ON8A 1DJRD 3G6JB 1JE4A 1A3VA 1MJCA 2VB3X 3D31A 3TZUA 4DNRB 3I72A 4HIMA 1FXAA 1LT3D 3CD6A 1MG8A 3VUWA 3SK5A 3IFTA 1EIFA 3I3TB 3I63C 4HN7A 1WD0A 4EZJA 2WINB 2DUDA 2CJNA 2WDRB 2E6XA 1QWYA 1F2YA 4CHKA 4JBKA 5J39A 1S40A 4HKZE 1XT9B 3NEMA 3CCEA 4DUZL 5C6AA 3J7AV 4HJ5A 3H6NA 1EU4A 2YLMA 2QKIC 2NTTA 3B9JA 3ZXRA 2QCPX 3BZCA 3LWEA 2UU7A 3E9IA 3CPWA 3RNAC 2DN8A 1SNOA 2HT1A 3EHVA 1XPRA 1HUNA 1F0ZA 1F9PA 2RBMA 1V8QA 3CCRA 4LF7L 1HNWL 3V60A 3ZRFA 3SK8A 2LXCA 5C44G 4WJPA 1NNXA 1Q0WB 2YTXA 4RHSA 3NHEB 2YU9H 2WXOA 5ELEA 3PV0A 4J1MA 3HUIA 4GOPA 1OGWA 4A20A 4JI8L 2LVOA 3DEPA 1C77A 3SVMA 2IO2B 2JYTA 4L5TA 5GAGC 1GB1A 4C3HG 4PYZA 2EMSA 1SBBB 5LMNQ 4RF0A 3FVQA 1IW7C 4WJQA 4ZRPA 3N30A 2NS5A 4XYOA 4DKAC 1B9NA 4K0KL 2HTHA 4ANXA 4Y7NH 1WGDA 4FADA 1JWSD 5IOIA 1TWCB 2F4VQ 2RKSA 2VH2A 3PRMB 4E74A 1JORA 1SIFA 2NCNA 1VQ8A 2MJ8A 1L7YA 4DV4Q 1OXSC 2WXHA 1X56A 4R9WA 4GXBA 2E76C 3STBD 2XIWA 4RGNA 2BA1A 2UU9L 4B3RQ 4GNXA 3K58A 4CKCA 3ABVB 4C3IB 2MHVA 3RR5A 2R7ZG 3BVZA 4KZ0A 4HIOA 4IWPA 5NUCA 5FJ8H 4UPAA 4DK5A 1L1OC 1F9SA 1C1YB 3I4OA 3I4NB 1PUTA 1XX8A 2AQ2B 4LFBL 1GHKA 3TEXA 2B2TC 1STYA 4LK1C 4UAIA 3T1HL 1L0XB 4LUVA 1M1KC 3MC0B 1K52A 2KDEB 3C46A 3D4RA 1VQNA 1SAPA 4S3SA 4YCWA 4YY3Q 1N33L 2DAFA 2FUG1 2NN6I 2N7DA 2JF5A 3SK6A 2WNMA 4JI1L 3I4MB 1NEKB 3EFXD 3P7JA 2KMAA 4GB9A 4PYUA 3H7PB 2WAQE 4NQKE 1V49A 1WFYA 3KLRA 1CHPD 1FL0A 1GJXA 4P73A 1XMOL 1VD2A 3PS6A 1QCBD 1Q5WB 2KTFA 4ABNA 3OWFA 1VDZA 2IT1A 4GLVB 1GUNA 4W9GA 2UWQA 2JE6I 1CFMA 3IKJA 3V2TA 5H1SE 1QOGA 1QZEA 3L17A 1LABA 1WJJA 4ZRKA 1CT1D 4C00A 4C7ZA 1GB4A 5J18A 5FO9B 1FXTB 1CSQA 1AN8A 1LT6D 4KD3A 3P75A 3S24A 1IBKQ 3HOYG 2Z0DB 2ZZPB 2PQAB 1X9NA 4K0KQ 4FF1A 1CQFA 1ZYRC 1N36L 4KHPQ 2NMQA 1Z47A 1F2ZA 3PGEA 2MHJA 1LM0A 1W3SA 1TBEA 3QC8B 3W9CB 4Q5VA 4HMJA 1ICWA 4IURA 3TP8A 1IPGA 1WXVA 2INDC 2K8HA 2JJQA 2JA9A 1ENCA 1XMQL 1TIFA 2FFKB 2RHQB 2A5HA 2NVYH 4KK7A 2I46A 3W1SA 1JR0D 4V0BA 4B3ML 4DR5Q 2ZJDA 2JK8A 2PMZE 2V1CC 4XIGS 1FRRA 4GNXC 2Y0SE 3APDA 1H9KA 4OEMB 4H02A 2WXLA 2ZNVB 1TKWB 5CHFA 1QVGA 4FXDA 3Q8AA 4JI6Q 3B1LX 2IO1B 4IM0A 5FOBB 4Y52H 2R92G 3QWNA 1LTBD 5C4JH 3MXGA 3I55A 3FKIB 3OYYA 5IE8A 1C4QA 3K59A 2VQFQ 1WTOA 3VR6A 1PH1A 3CU7A 2QILA 2R7DA 4J15A 1BOSA 2EY1A 3GTOB 4BY7G 2BW2A 2Y3AA 2L5TA 3MFYA 2LUEA 2ENBA 4JG2A 1XLOA 1PGAA 3U2SC 4EE2A 4BKTA 4JQWC 4DV1Q 4B3TL 1SR3A 3M63B 2IPKD 3S15B 1EWHA 2XRQD 1VQAA 2AWOA 5COYA 1E2ZA 3NE5B 5IP9H 3EIVA 1KXLA 1L0YB 2NN6G 4LK0M 3U7ZA 4LF8Q 1JJ2A 2F0VA 3CCQA 3PV1A 1EWCA 3TBIB 2CHWA 1X65A 2K33A 1PTOB 2INPE 4NKLA 1BCPD 3SHLA 3QOLA 2FE8A 3F8TA 2FUHB 1YQBA 1K83H 2KWUB 1ZXTA 1CA5A 3DBLB 2YEPB 2VZKD 4K7WA 4A6QA 4EZKA 2KQ3A 4AJYB 3UDFA 1OQRA 2EELA 3W5OA 2O2VA 3UIOB 4DWFA 1YHBA 3HFZB 2M9VA 3BINA 2RDHA 1V5TA 4B0EA 5DNFA 4H44C 1KD1C 3MTSA 2UUAQ 1PH8A 2CHZA 2XTIA 2F0PA 5KNBA 2KK8A 3A4RA 4F88A 1VQOA 4JOIA 3H8HA 1A3UA 3W1SC 1EYCA 4LFCQ 2KYWA 4K7UA 1K8OA 3A9KB 3DM1A 4DV2L 1X55A 2A73B 5AJ3Q 3A8KE 4K81A 2KEEA 1MHXA 5HI1A 3A1QA 3P63A 1SB3C 4JI0L 2ZTDA 2UXBQ 1C76A 3EECA 1I5FA 2DY8A 1O80A 2WXNA 3S1NB 2BYVE 2RPQA 3MXNA 4WFN3 2PVOD 1FFUA 1V1OA 1VJKA 1YIWA 4ZOHC 2QEJC 2EYMA 3CSTA 1T0QC 4BY1H 2PZTA 1Z2MA 5HFYA 4IFDG 3GTKH 3M62B 3NRZA 1C48A 5JAVA 2VQEL 3K9OB 4BBNF 2YYZA 4OXPA 4A3MG 1VQLA 4OX9L 2LGSA 1PLFA 4JI5L 4N6EB 4APVA 5C4HA 1JWUD 2FBWB 4HKQA 2ZXRA 1UF0A 3PZDA 4IOIE 3VRAB 1EU3A 1U4LA 5C0XG 3RZOH 1EM7A 4IW0A 2HD5B 1HR0Q 1FGBD 3JYUA 3X23A 4EX5A 1DOMA 1SSOA 2WXIA 1FJGL 2OWOA 3EVQA 1J7CA 2D07B 1B9RA 1KRTA 5LMUQ 1GPXA 2FMMA 1I6VC 4K8JA 1J8IA 3NS1A 3FEWX 3JSVA 2F0QA 3QA8A 1EOTA 4A93B 3NVVA 4DHZB 1RD9D 4TV3A 4I7ZC 2Q8IB 1SRUA 2FHTA 1Q1EA 2LXJA 1L4DB 2K03A 4CGYB 1WYDA 1XNRL 4FF4A 1TVXA 4EZLA 3OHXC 2WU5B 3PZ8A 1KLVA 3J81j 1S4ZA 1K51A 3AE1B 3D3RA 4DV2Q 2K3UA 3H0GB 3PLVA 2NVYB 2V3PA 4IUTA 2TMPA 3AMZA 4U673 2MH7A 4HJ9A 4KKUA 1A2TA 1RF2D 2CHBD 2UUCQ 1B3AA 2CU3A 1CKNB 1KDCA 5JEAJ 3QOJA 2ONQA 2BA0A 4BS9A 3PVLA 2JSOA 1Q82C 2L0TA 1WGKA 1PH4A 4DR3L 3Q0AA 1O7LA 1VF5C 3KUZA 4B9WA 2KVRA 3UQAA 2B3AA 1S5FD 2KT7A 4M00A 2EYPA 2WB1G 2ZEQA 1LTID 2PO4A 2WU2B 1VQGA 1JMLA 5CR3A 2MBHA 1RTNA 1NTGA 4OX9Q 4R3DA 1M4VA 4RGTA 1JWBD 3PHXB 3AEAB 5J2RA 4W9EA 1DOLA 1YNJC 3ZNGC 3M4OB 1YOVB 2VNUD 3ZUNA 2EYJA 1C9FA 4DV7L 2L55A 3OMCA 3BU2A 2F4VL 1WVLA 1BMLC 2WAQB 5CV4A 2JRIB 1A5RA 5EE1A 4ZDVA 4HIKA 3SD5A 1CKNA 1CZWA 4LTUA 4IKGA 2XRSD 3QG1A 3H3VI 2CH4A 4K6DA 5GAEC 2W55A 3KWLA 1OXXK 3BG3A 1L5PA 3VUXA 5JJIA 2V3NA 4DK1A 4C1NK 1OXUA 3I3CA 4KJNA 4TSSA 3M4QA 3RNCC 4AWJA 5A2QL 1WGRA 1QLBB 1HZBA 3RI7C 2ZJPA 4P7IA 4YIJA 2R2OA 4L5RC 4LF9Q 3D6CA 3ONAB 3IG3A 1C8CA 3QJZA 1E1OA 4NPNA 1IZ6A 1WTHA 4JI2Q 4XDDA 3R7RA 3I9V1 5IYDG 4ZK9B 4P72A 3HM3A 1WCMH 4YWGG 3QHTA 1A62A 3MC9A 1SNCA 5EKIA 1KM7A 3ALBA 3NUHB 3AE4B 2R93H 2GBMA 3OWEB 3I90A 5E6JA 3RULA 1IBXA 3S14B 4B9XA 2D3AA 3A0JA 3TN2A 4DR3Q 2B39A 3J9CA 5M3MB 1XMOQ 4GLSC 1SN8A 3A74A 3J7YW 2D5DA 3N6RA 3AE8B 4QUFA 1AYFA 4X66L 4WWNA 2I07B 4I65A 4IJHA 4LFBQ 1BUIC 2EIFA 4YHHQ 4A3GB 2DX5B 3GTMB 1I4XA 2NTSA 3H0GH 2L0CA 4A3DB 1QOBA 1FXIA 4R8NA 5JHBA 2LEKA 1LXDA 2CQAA 2Y5CA 1J8CA 2VUMB 1X3QA 4RHRA 3L7ZC 1PRTB 4OO1I 1WCMG 1K53A 2BYEA 3VQIA 2PW9A 4YWMA 4LDTD 1YJIA 1KIXA 4ICVA 3E3XA 2MQJA 1CHQD 1K8GA 2JWZA 1ZUD2 4RAUC 3NBIA 4IUPA 1XJVA 3QR8A 1EF5A 1BNZA 1T0SC 1YJNA 5KRUA 3KDFA 2CJOA 3GE3C 2N7JA 1XCTL 4A3DG 5D2MB 4BZAA 2KUMA 2EQSA 4JI7Q 1E5WA 4LW1A 4HEA1 2E2HB 4LF9L 3PGZA 1QF6A 4W9KA 2VZAA 3RYTA 1Q10A 4DUYQ 5AZHA 2HCCA 4C2MB 1HH2P 4ZYSA 3M85A 1YNJD 1QNUA 2IJ0A 3T56B 3C19A 3IFDA 4QB4A 4IPGA 1WXAA 1PRTD 4LAAA 3PMFA 2WKCA 1V81A 1DD2A 4X57B 2FCQA 3H9DA 4K7SA 3ZKJC 3BDOA 1LTTD 1VQHA 4KSKC 2IGDA 1IBXB 3VR3A 3EN2A 2B2VC 5EPKA 1ML0D 1A70A 3OMGA 1CA6A 2KAJA 1GHJA 1XXGA 2M8SA 2M56B 1DXMA 5DPSA 1IL8A 3HEJA 3NQIA 3S1RH 2Z6KA 2UXCQ 3ZGZA 2F0FA 3RUIB 4QMGA 3DOWA 1ACCA 2ZCCA 5BMGA 1GUAB 4CJ1B 5C3EB 2PVGC 1JALA 3V61A 4UP8A 4HAEA 2WXKA 4D2KA 1KLGD 4GMVA 2PZUA 1E8WA 2DGYA 4AQYL 1H9JA 2ATWA 3CAMA 4NXMQ 1GVPA 2BVCA 3SFEB 3KDFB 3TIXA 2N55A 3NBHA 2KJHB 1KHIA 1EEFD 3CCJA 3DCGA 2KHIA 1Q8IA 4HJ8A 1JICA 4W9LA 1ZGUB 4FN2A 1GNUA 2BT6A 3L54A 1SNQA 4RFBA 1HJPA 1YBYA 2TSSA 2WLBA 3DM3A 2BTEA 1ZPSA 5E1FA 1Z7TA 4ARCA 2SOBA 4XGAB 3OLMD 2L76A 5KHOA 4DV6L 2CHXA 3U9OA 5FLXE 2A6HC 4RA8A 5C3XA 4KY6A 1CUKA 1V6EA 1TWCH 2L9HA 3GV3A 1JROA 1HE8A 4PNYA 5BYSA 5M5WH 1F77A 4DF7A 2CWAA 2LASA 4OW0A 1HTPA 2PZWA 1SDFA 1YI2A 4K3CA 1Q1OA 1Y1VH 2N4FA 4FVMA 2K8BA 1E0ZA 4P1BC 2X69A 2KTRB 4GN1A 5DPRA 3TQYA 2G4DB 1QB5D 3KJOA 5C0XI 2EY6A 1BBUA 1SYBA 3M4OH 4WH4A 3C0RB 1B8AA 1BDOA 1F9JA 3MWYW 1V9JA 2QIEB 2Y5BB 4L5QA 3KVFB 4HCNB 2PYKA 3GTOH 2L7RA 4US8A 2I5LX 1KAWA 1R4MI 4J3OD 3PUZA 3NBHB 4IFDH 2AYOB 3J7ZC 3P42A 4QL5A 5FLMG 3E56A 4BY1G 3LB8C 1EQVA 1Q86C 1VQIA 3HOXB 4LJZC 2KJXA 4OWWB 4LCDE 5LNK1 4LJOB 3FP9A 1L0VB 2O6VD 1PYSB 3AMUA 3CP0A 1N9WA 2G4SA 2KX3A 3BZKA 1JW9D 5HHDG 1ZE3D 1LO5D 1ESRA 3ULJA 5D94A 3AU4A 3N1YC 4ALPA 1WXQA 1LTLA 4XQNA 1HNXQ 2L12A 3BZDB 2K01A 3CCUA 3L9AX 5IP4D 4DFAA 3K5LA 4IPCA 2C5LC 2REXA 2LVPA 2D3BA 4EOYA 2BDNA 2B63B 4KY5A 1AEXA 2RDFA 4F7ZA 5E6OA 3G6EA 4WQMA 4YTMB 5M3MH 1T9HA 4I7AA 3IRBA 4N9TA 1P9DU 2K25A 2PTLA 5C2TB 3V96A 4DQOC 4JI4L 3OPOA 3PT2B 2Q2UA 1N62A 1NJIC 3ZO5B 4JI1Q 1L4ZB 3AH7A 1D5XC 3OJ3A 1PTOH 1SYGA 1K83B 3UI2A 2PW7A 4A3FH 3ITPA 1WM2A 1A8VA 1SMYC 2AWNA 1A15A 2J0JA 3BY4B 3DBRI 3C1EA 3EC8A 3TEHB 1Y8NB 5C0XJ 2PPHA 4K2KA 5AZFA 1HHVA 2D10A 1FR3A 2PJHA 2I38A 2XNAC 2AHOB 2R92B 2A5UA 2PNRC 1J7BA 3I4NG 1MHHE 1TT2A 3PTFC 4CHTB 2B8GA 5HG2A 3HRZC 3H3VC 1EQRA 1D8LA 4IJLA 4HEDA 3ZJYC 1R9TB 1TT5B 4AS1A 2EY5A 4WORA 1K50A 1YN4A 5CC4A 4DXGA 2KVZA 3PO2B 3T51B 1D4BA 1STBA 2K1BA 4J8QA 3BS1A 2N9EB 5CMDA 3HZXA 1GUWA 4WWMA 2I1JA 5I2YA 3AI5A 4HIDA 3S2HB 1SYFA 4F8CB 2OT2A
chains in the Genus database with same CATH topology
3AEBB 5K36G 2SNSA 3E5SA 4BY1B 4JX1C 3I70A 2E3TA 2NYZD 2DLBA 2NVQB 4RKBA 5IGBA 3S1MB 3AEEB 1FNWA 1EY9A 5CBAE 4XXEA 2DYMA 1SSNA 1I4HA 5CYUA 3MFGA 3BYYB 3DUZA 3VR4A 3Q22A 1GUSA 3K5MA 1JRPA 1HCZA 3KQ4A 2RPVA 4RWSC 2EJGC 1BCPB 4DN4M 2IDYA 1ZDXA 2B76B 2QSDA 1WWTA 3ND9A 3C2PA 3MJ5A 4KKJA 2F0SA 4TQ1A 4C7YA 3J81L 2WXJA 4NMZA 1ILQA 1BXTA 1WTXA 5G5GA 4XQJA 2E75C 3AN1A 2QMTA 5G3LF 1YMHE 4A3BB 2F0TA 2LKVA 1O7ZA 2JYOA 2JA7B 5ELFA 2HDLA 2B2UC 4QIWB 4E6IA 4H7BA 3FAHA 3D4DA 4KD4A 2NBFA 2DWQA 1BQQT 2WXQA 4XT1B 4PQXA 2EPBA 2J53A 4G7ZC 4XWWA 4CKEA 3DXJC 3S2DB 1D5ZC 3N9YC 2A6EC 3AEFB 3M7GA 2JWUA 1H9SA 4RCOA 3M4YA 5H8YE 2HCIA 2F0OA 2PLPA 3KBXA 4NJCA 3P4PB 4OO1H 1BO0A 1V8CA 4NW2A 1Q90A 1VLBA 1SYEA 1TKEA 1YQ4B 3D4WA 1VZ7A 3GTQB 5I6WA 5EE9A 1YN3A 1X32A 1KRHA 2KDMA 1QOAA 4AYBB 2B2WC 2JEAI 3AE7B 2PPBC 1TU2B 2WP8J 4BBRB 1G2TA 2PCFB 4O1NA 4K5WA 2A74C 2JXTA 1Y69U 3DWMA 4DK0A 5FLXL 2LFIA 3S1RB 1STHA 2K32A 4IUVA 1YNND 4LMQD 1N5WA 1SF0A 5IGFA 3AEDB 4A3FB 3FMCA 3NP8A 2G9DA 3MEHA 2JA6B 2Z4IA 5D3IB 4NAMA 1VMCA 1EZ6A 1KDBA 3SXHA 2A69C 4OGQC 2XVSA 1FMAD 3C3LA 3VR5A 3VA7A 2AQ1B 3TMEA 1SMYD 5EBDA 4BWGB 2B8FA 4EVOA 2FMCA 1LTSD 3NWTA 3GP7A 3Q8CA 2D2CC 5IGEA 2H89B 2OEDA 1G291 4MH8A 3VRBB 4X3KA 2RMMA 2EZVA 4IUNA 3MVVA 3CRKC 1IGDA 3FILA 4KHZA 1PFDA 2V0GA 2AUJD 5MPOA 4H0LC 1IYUA 1TJEA 5LNK1 5KNCA 5K36H 1CQVA 4KHVA 2IWHA 1HA5A 3PUWA 3VR2A 1T6BX 2RA4A 5CV8A 5IT9L 3A7LA 5M5WB 4ZKCB 2EYHA 4IQZA 3K5OA 3K6OA 2EE1A 2EYLA 2DBYA 3HKZB 1VDVA 1QE6A 2K6AA 1ZOYB 2QJLA 2OHFA 3NPPA 3H94A 3WDNA 4NAWB 2L4NA 1O78A 1UNSA 4NDXA 2JX5A 5D7GA 3F2UA 1D5MC 1N63A 5TSSA 3S17B 1TKYA 4IDIA 2PMVA 1T3QA 4A55A 3M7NA 1RCVD 3DWQA 2NN6H 3R93A 2BS2B 3M3YB 1DOXA 4RGMA 1OXVA 3HGBA 3AECB 3ND8A 2HQEA 2K9XA 4REZA 1IW7D 2SEBD 3FPPA 5CV5A 3TP5A 1UAPA 3LXFA 3MP9A 4HROA 1STAA 4HMIA 2WXRA 1SE4A 2PKOA 2JQRB 4XDCA 4L8JA 3CKIB 3TP7A 3PZ7A 2O4XA 3B2GA 4HCEA 1VMPA 1T5XD 4EGVA 1N60A 3I73A 4ME5A 1TIID 3MHBA 1W6JA 2ZW0A 3HOZB 2K5WA 4WJWA 1Z6HA 3PUXA 2EYOA 3D6WA 3MHZA 1CZPA 1IYVA 3ZYYX 4WIPA 2PW5A 1BR9A 5AFWA 1QT9A 5I6YA 2R7ZB 5IGGA 4YXDB 5HURA 4TRDA 1EL0A 1FIQA 1WYGA 4OL7A 2A6HD 3Q8BA 1UWXA 3AE2B 3BK2A 2LUMA 1TWFB 1D2BA 1P7EA 3X3MA 1IKMA 2Q5WD 4DAPA 3GTJB 2K04A 4PMCA 1MI0A 3BVGA 4IZ8A 3WCQA 2QDBA 1MSGA 4NZLB 1CM9A 1D6EC 1D1KA 5D3DA 2HUGA 3D8GA 1WTWA 3UI3A 1H9RA 2WXGA 2EY2A 4QF4A 4TKOB 4A8XC 3HOYB 2M00A 2V4IB 5M5YB 1SNDA 1OO9B 1RDPD 1RJTA 4C80A 5DM73 1A6XA 4G57A 4ZRZA 2AUKA 2BE5C 4IN3A 3DWGC 4PV1C 2HDEA 2WDVB 3GS2A 2E74C 3AE5B 3NVYA 1SXTA 2QF7A 5I2XA 2H1EA 3R3OA 1E7PB 1TZOA 1U4PA 3H09A 3B2FA 1GUTA 1D1IA 5A35A 1J9OA 2GB1A 1WTPA 2NUCA 4MM3B 3C8YA 1TS4A 1C78A 2BS4B 2OEOA 4KN7C 4IUUA 4HSVA 2NZ1D 2KOLA 4G4KA 1PZKD 4A3MB 1ZEQX 3W5UB 5ISRA 5AUIA 1ILPA 1KNAA 1PTOD 3BIID 3A8IE 3OSOA 4FYDA 4RNAA 2AX5A 3KF8A 4A3JB 2KWDA 1LTAD 3SEBA 4PMWA 2R61A 1VZ8A 4N59A 5M9OA 1JWAD 4OIJA 5C4JB 4TQUS 1QOFA 1CI3M 4M0WA 3HS0C 3BDLA 1MBYA 3OIPA 1B1ZA 2PMZB 2GRIA 4UDUC 2RSOA 2X6GA 1FNUA 1FD6A 1MPEA 1OQQA 5T8IA 2BDOA 4XQQA 2N0SB 4JPSA 1NSNS 1VZ6A 1G2SA 2KHSA 2W54A 3S9WA 2F0UA 4IALA 1LACA 3QO2A 2WQYB 3I8ZA 4F87A 4HCSA 5DM63 2WB1B 3PUVA 1EEID 2INNE 4XWTA 2ICIA 4CKBA 1IUEA 3HG9A 1F2MA 3AM9A 3P4RB 2F3VA 1RFKA 2LY7A 4B08A 2WACA 3EA6A 1XLNA 1T5EA 2NB0A 1GAQB 4YSXB 2E2JB 4ITKA 1EYAA 2BYTA 1ZXIA 4L63B 3JAML 4R8IA 5CBEE 1KH0A 1RKNA 2VXWA 2IGHA 3Q6SA 3DEOA 2H4OA 5F2DA 5EQ0A 5C4XB 2J42A 5FKAC 2IX1A 1TWHB 2F0NA 2J4XA 1PTOC 2F0KA 1J7AA 2IX3A 1HEZE 4N9PA 1M8AA 3HVZA 4A3IB 1KLUD 5G3LD 4FNFA 1FO4A 1CK1A 1KFYB 4YTNB 3NQTA 3RD4A 4K5XA 1PZID 2R6GA 3Q69A 3S16B 4A90A 2NWGA 4HTHA 2EKIA 3U52E 5IGCA 5ELCA 5IT9E 4F7XA 1E6EB 3P1MA 3J80E 1OFFA 1XYIA 5BN4A 3NZ3A 1NENB 3RZDB 1TS2A 3Q8FA 3T13A 4ZRQA 4K2LA 1KNEA 4OZBA 1STGA 1N5XA 3U9SA 1PFMA 4H2AA 1C4CA 2JZPA 4C56C 4GZYC 2BBCA 2L83A 4ULLA 5EPLA 1HZ6A 3RZOB 4L1BA 4FO2A 4X3UA 5E3FA 1YNNC 2GI9A 4L2YA 2F1MA 3N52A 2K5PA 2DY7A 3NUCA 2G9HD 2O2LD 3J7AF 1TY0A 4DU9A 1MVKA 1B9MA 1TWAB 4EQPA 4EQOA 2JSVX 4DAVA 4KKTA 2JA5B 3HOUB 3DWPA 3FPUB 4BBSB 4KV6A 4XE0A 4QUCA 4X3TA 5AUKA 1NR4A 3H91A 2SNMA 1SIJA 3CRLC 4DA2A 1FYCA 3CWIA 5JEAG 3GD7A 2JU6X 2LHDA 1XCQL 5GXGB 5I9OA 5JXVA 4XTCS 1EFID 3NVWA 2R3ZA 4LLGM 3J81E 3BK1A 4FF3A 3NTKA 2WV6D 3NTHA 1YNTE 1EIGA 1E2WA 4PT5A 2ZT9C 1QG7A 3CHBD 1C4PA 1WRIA 3KK7A 1UWMA 1F2RI 1UEAB 1S5CD 3GTPB 3L3OC 3TDQA 1PRTC 2ICEC 2B2WA 3MXPA 5HGTA 3LNNA 1WSPA 2OXPA 5C5MA 2A6ED 2HDMA 4F8MA 5BMIA 3WOEA 3TEWA 4B0MA 1XEEA 1VCIA 1B2TA 2F0LA 1ENFA 4DGZA 1I50B 1FEHA 2K5QA 5JVG3 3SR1A 2O5JC 1II3A 1GUOA 1EIHA 4A3KB 1LTRD 3RUZA 1WCMB 3SDZA 1ROEA 2YU9B 1W6KA 3LWUA 5BMHA 3I91A 1MSHA 3E0JA 1TS3A 2Z8LA 4A3EB 1SYDA 3URYA 3V3XA 3RPFC 1TS5A 5I9PA 1H9MA 2K05A 1PYWD 3NVZA 3WOFA 3MA2B 2OF1A 3HVDA 2K0PA 2BOSA 4J6HA 1ET9A 1AW7A 2B2UA 5C44B 4IFDJ 4ZHOA 1TKGA 2I2YA 1STEA 3TZDA 3IT4B 2KACA 4OO1G 1HFGA 4K5VA 2WXMA 1DZ1A 1TY2A 4JWUC 2F4IA 1V1PB 1S5BD 1B53A 1H9SB 2MJ3A 3TEZA 4RH6A 5BYQA 1Y1WB 2RSNA 4QCLA 5D65A 1WD1A 1NYRA 3E6ZX 4JBWA 4ZUJA 3KWVA 2W3RA 3X3NA 1B50A 1Y1VB 3AE3B 1CZGA 4DXFA 1EY0A 1HRJA 2JXMB 3AEGB 1HPCA 5C5LA 5EKKA 2N9LA 1VRAB 1QOHA 3IXSA 4XT3B 3IAYA 5C3WA 5G5HA 3A8JE 5EE3A 4ZHPA 4KN4C 4O42A 2KVMA 1GOZA 4ID6A 3GB1A 4MT5A 5I4DA 5KNDA 1XLQA 3W2DA 2RVLA 2W3SA 3SE0A 3T3NA 1CTMA 1QQRA 1RYJA 3NK9A 4P6VF 1U4MA 2WIIB 4OZAA 4Z9CB 1LV9A 1TQOA 1EY5A 1U4RA 4K8IA 2L32A 1HQRD 1KF6B 4YT0B 3TUOA 1WTVA 2AQ3B 4C3IG 4G7OC 2LFNA 3VYSA 3T4AC 1R7SA 5M3FB 1DOIA 2F0IA 5EBCA 3PIP3 2NVXB 1MI2A 2W82A 3W5VB 2F0HA 1Y8PB 1BCPF 4KJOA 2Y5PA 2N88A 1JCKB 1UGJA 2MUYA 1AWDA 2XN9C 5IIFA 1LT4D 2LS01 4V190 4KMUC 3QIAA 2C9OA 1SE3A 1SEBD 4CJ2C 1MD2D 2G1EA 4YTPB 4KKSA 4P16A 5CV6A 2EOTA 1YN5A 5ELBA 1O7YA 2K5DA 2IGGA 4C1NI 1KDAA 2LHEA 1XO3A 4FP5D 1G8ZD 1AZPA 1BUVT 2PQEA 5EJWA 2WKDA 1KAAA 1DCZA 3MZ5A 4HSPA 2F0MA 1PDXA 2XSCA 3OIQA 2B2YA 3BYTB 1JC7A 3G7LA 4GDKB 4AQ7A 1Y56A 1I7HA 3AV8A 3GQBA 1ESFA 3PO3B 5EE0A 1UUPA 2WXFA 2DYOA 1R4QB 5KYLA 2D62A 2HTME 3VR8B 4OZCA 1EYDA 2XWJB 2BS3B 1FCCC 1AFPA 3HRDD 4RCNA 1AZQA 3GTGB 4TQ0A 1YQ3B 1VR9A 1QJOA 1QNKA 1DGJA 4HJGE 1HTLD 2EYFA 5JJZA 2RQXA 2WXPA 2F3WA 3K57A 4XYQA 3GO5A 5KYIA 4CQNA 5E4XA 1QILA 1JWMD 4OHJA 3ETRA 4C3JB 3HOWB 3VR9B 2KECA 4FXCA 2B2VA 3K7AB 3JAME 3CIRB 2LMCB 1DOKA 3TP6A 1RM6C 4ZUIA 1NAPA 1BCPC 1LLRD 4WAFA 2Q8TA 1A2UA 3IL8A 4KI0A 4BA2I 1LTGD 2C5CA 1PZJD 4NP5A 1E9MA 1WTQA 3AE9B 2SAKA 2RDGA 1Q3LA 1C4AA 2GA4B 2D9UA 3P20A 5K5PA 3ERQA 1JQ4A 4XDXA 3A56A 5CV7A 3KBGA 2EXZA 2B2TA 2PIAA 3MAQA 5DAUA 4C3HB 4CJ0B 3P1HA 2XWBB 4KY7A 4P2CB 2KN4A 4RGOS 1E0BA 1HA6A 5BN5A 4CBVA 3EQLC 1DOYA 2EJFC 1PGXA 5CORA 4DNTB 1N61A 3P4QB 2M0AA 4G7HC 1C79A 4HRSA 2MJDA 4L23A 1V43A 3E9SA 1I4QA 1TWGB 3CQZB 3DHQA 3VA5A 4DAYA 1PDQA 2MP1A 2LGIA 1ENAA 1TYGB 4A9AA 1GXDC 3QJYA 5IOCA 2F0DA 5BN3A 2MJEA 1YJJA 1S5DD 3RMHA 4U68A 1IHZA 1I4RA 1JB3A 4MHEA 5C3JB 3A54A 2Z1CA 5J1ZA 2BB5A 1L6VA 3HP3A 3IT6B 1JOKA 5EPJA 5LL6S 2WS3B 5J22A 3QB3A 3I57A 3GV6A 2VB2X 4HR7B 5E4WC 1V97A 1XF5L 1GUGA 3L4PA 1EY8A 4YSYB 2KEDA 1IGCA 2MEKA 4M8AA 2JP1A 2K22A 5JPMC 1E10A 2L52A 2N9KA 1SJHD 2IW3A 3K5NA 1AP0A 3KUPA 4US9A 4EQNA 1EQTA 1FM0D 4JK1C 1NCVA 1ZDVA 2FINB 2F0JA 5EKLA 2EVBA 3GTLB 1PRTF 2R93B 3EJIA 3ZJUA 1HXYD 5IGDA 2O5IC 1RWSA 5JEAH 2NVTB 4ILWA 1E2VA 4BA1I 5KIXA 1WTRA 4PMBA 1SNMA 3NXWA 1IKLA 2F03A 1PGBA 3SR6A 1EY7A 1HFNA 3A7AB 1I4PA 5DEHA 3SFDB 1I3QB 1Q12A 3T16A 1BBXC 2F0WA 3PO0A 2EJMA 4OVZA 3EGRA 1K8MA 2DNEA 3V05A 3W3AA 1SFOB 5C0XH 3LYYA 4FXKC 4FXGC 2A68D 5KGUA 3U4EG 4MN3A 3AB5A 4KKIA 1NVID 1R4PB 4IUQA 1FFVA 1KTKA 1G91A 1PXUA 1MGSA 2K28A 2VZKB 3OW7A 2V4DA 3OOCA 4YSZB 5T1IA 2BE5D 2K7VA 3HOVB 2FJ2A 5FO8B 2JYEA 1U9RA 3R2IA 1ZXHA 5IODA 2ZW1A 5JOBA 2D5GA 3DMUA 2E2DC 1F9QA 1XTCD 1RHPA 2KQ4X 4Q2JA 2IL8A 3Q24A 3Q23A 1XWEA 4KGRA 1BF4A 1PFBA 5A2QE 4ARIA 5CGKA 4BY7B 2WP9B 1DM0B 3R2TA 2KCNA 3A55A 1NYQA 2KA7A 2ZXOA 4JE3B 4WRDA 1SYCA 3FC4A 1SE2A 5H92C 3BWUD 3RFZB 2M19A 5ELDA 2F0EA 1ONLA 2BCOA 1HQMC 1HUMA 4K14A 4ZAIA 2ZXPA 3SK4A 4WURA 2X38A 1S5ED 4MACA 4H13C 4K6LA 4M1UB 3NHHA 2KMMA 4TMAB 3KLSX 2CVRA 2MPMA 2CW0C 3DWAA 5CV9A 3AE6B 4ZLTF 1VF7A 2Y0SB 2ID0A 4KX6B 4Y7NB 5M5XB 2ACZB 3FILB 4MIUA 1B44D 1A3TA 4X3SA 1PTOF 2L1BA 3T53B 3R8BA 4ZQ3A 1B4OA 1EWYC 2J0TD 1JOQA 1EY4A 1NI3A 3K0YA 4KTAA 1NR2A 1ET6A 5C4ZA 2JA8B 5FR3A 3O13A 2JEBI 1OXTA 2SDFA 1RODA 1XLPA 1PMRA 2F0GA 2YEPF 4L6TB 3MXUA 3ZQ4A 2EDGA 3H6MA 1LT5D 1SNPA 5JVH3 1FRDA 3J80L 3AU7A 3T3OA 4ODGA 3IAS1 1KABA 5FK9C 1EY6A 1L6UA 2Z4HA 3BDCA 1FCLA 1ZP0B 1F2RC 1STNA 4RF1A 1X3PA 1RTOA 3PIO3 3FDTA 2M2LA 2B2YC 2L1AA 3GTKB 3AB9A 4ZKBB 1SJED 1I6HB 4USAA 3BVMA 2WDQB 3VYTA 4C3JG 1P7FA 1FD7D 2LJIA 3EROA 4KGTA 1ZYRD 4RKLA 5D14A 5FO7B 2KCCA 5EGTA 3S1QB 2DNCA 2E2IB 2A69D 2CW0D 3NWSA 2A68C 5JPNC 1NUCA 1I4GA 2J52A 3NTIA 1FNVA 3TEYA 1EZ8A 5KEEA 5LHY1 3PUYA 2MGSA 3FRPB 1Y8OB 3KLSA 2X6LA 1QKZA 3VYUA 5BYRA 1DONA 3RLFA 1CJEA 2J7ZA 2L11A 1G6ZA 1DYQA 3ZJTA 5T1GA 3I4LA 3TSSA 4Q0FA 4N58A 3NSWA 3P4SB 3ZJVA 1Q1BA 3EUB2 3C1FA 4JWSC 1JQYD 1F9RA 3IAM1 1PFNA 5LL6X 1F2LA 4IFDI 2BB6A 2H88B 2IX0A 1TR5A 1JOOA 1HZ5A 4OIKA 4FF2A 2LMCA 2Q8RE 3LX0A 1ZKOA 3VYRA 1V1PA 2ON8A 1DJRD 1JE4A 1A3VA 2VB3X 3D31A 3G6JB 3TZUA 4DNRB 3I72A 1FXAA 1LT3D 3SK5A 3IFTA 4HN7A 1WD0A 2WINB 2CJNA 2WDRB 2E6XA 1QWYA 1F2YA 5J39A 4HKZE 5C6AA 3J7AV 1EU4A 2QKIC 2NTTA 3B9JA 2QCPX 3LWEA 2DN8A 1SNOA 1HUNA 1F0ZA 1F9PA 2RBMA 1V8QA 3SK8A 4RHSA 2WXOA 5ELEA 3PV0A 4J1MA 3HUIA 3DEPA 1C77A 3SVMA 2JYTA 1GB1A 4C3HG 1SBBB 4RF0A 3FVQA 1IW7C 4ZRPA 4XYOA 1B9NA 1JWSD 1TWCB 2RKSA 1JORA 2MJ8A 1OXSC 2WXHA 4R9WA 2E76C 2XIWA 4RGNA 2BA1A 3K58A 4CKCA 3ABVB 4C3IB 2MHVA 3BVZA 5NUCA 1F9SA 3I4NB 1PUTA 1XX8A 2AQ2B 1GHKA 3TEXA 2B2TC 1STYA 4LK1C 4UAIA 1L0XB 3MC0B 1K52A 3C46A 3D4RA 4KGSA 1SAPA 4S3SA 2FUG1 2NN6I 3SK6A 2WNMA 3I4MB 1NEKB 3EFXD 3P7JA 3KLRA 1CHPD 1GJXA 1QCBD 4ABNA 3OWFA 1VDZA 2IT1A 1GUNA 2JE6I 1CFMA 3IKJA 3V2TA 1QOGA 1GB4A 1LABA 1CT1D 4C7ZA 5FO9B 1AN8A 1LT6D 4KD3A 3P75A 4FF1A 1CQFA 1ZYRC 2NMQA 1Z47A 1F2ZA 3W9CB 4Q5VA 4HMJA 1ICWA 4IURA 3TP8A 1ENCA 2FFKB 2A5HA 4KK7A 3W1SA 2I46A 1JR0D 4V0BA 4XIGS 1FRRA 1H9KA 2WXLA 1TKWB 3Q8AA 4FXDA 5FOBB 3QWNA 1LTBD 3MXGA 3K59A 3FKIB 1WTOA 4A3GB 1C4QA 3VR6A 3CU7A 2QILA 3GTOB 1BOSA 2EY1A 2BW2A 2Y3AA 3Q8EA 2L5TA 3MFYA 4EE2A 2ENBA 1XLOA 1PGAA 3U2SC 2IPKD 3S15B 1EWHA 2XRQD 2AWOA 5COYA 1E2ZA 3NE5B 1L0YB 2NN6G 4LK0M 3U7ZA 2F0VA 1EWCA 3TBIB 2K33A 1PTOB 2INPE 4NKLA 1BCPD 3SHLA 3QOLA 2FE8A 1ZXTA 1CA5A 2YEPB 2VZKD 4A6QA 2KQ3A 1OQRA 2EELA 2M9VA 2RDHA 4B0EA 5DNFA 4H44C 3MTSA 2F0PA 5KNBA 4F88A 3H8HA 1A3UA 1EYCA 1K8OA 3DM1A 2A73B 3A8KE 2KEEA 1MHXA 5HI1A 3P63A 1SB3C 1C76A 2WXNA 2DY8A 1O80A 3S1NB 3MXNA 4WFN3 2PVOD 1FFUA 1V1OA 1VJKA 4ZOHC 2QEJC 2EYMA 2PZTA 5HFYA 4IFDG 3NRZA 1C48A 5JAVA 2YYZA 1PLFA 4N6EB 5C4HA 1JWUD 2FBWB 4HKQA 2ZXRA 4IOIE 3VRAB 1EU3A 1U4LA 5C0XG 1EM7A 1FGBD 1DOMA 1SSOA 2WXIA 3EVQA 1J7CA 1B9RA 1GPXA 2FMMA 1I6VC 4K8JA 1J8IA 3NS1A 3FEWX 2F0QA 1EOTA 4A93B 3NVVA 1RD9D 4I7ZC 2Q8IB 2FHTA 1Q1EA 1L4DB 2K03A 4CGYB 4FF4A 1TVXA 3OHXC 2WU5B 3PZ8A 1S4ZA 1K51A 3AE1B 3D3RA 2K3UA 3H0GB 2NVYB 2V3PA 4IUTA 2TMPA 3AMZA 4U673 2MH7A 4KKUA 1A2TA 1RF2D 2CHBD 1B3AA 2CU3A 1KDCA 5JEAJ 3QOJA 2ONQA 2BA0A 4BS9A 2JSOA 1WGKA 3Q0AA 1O7LA 1VF5C 4B9WA 1S5FD 2EYPA 1LTID 2PO4A 2WU2B 1JMLA 5CR3A 1RTNA 4R3DA 1M4VA 4RGTA 1JWBD 3AEAB 1DOLA 1YNJC 3M4OB 1C9FA 2VNUD 2EYJA 2L55A 3OMCA 1BMLC 1WVLA 2WAQB 5CV4A 5EE1A 1CZWA 4LTUA 4IKGA 2XRSD 3QG1A 4K6DA 2W55A 3KWLA 1OXXK 3BG3A 1L5PA 2V3NA 4DK1A 4C1NK 1OXUA 3I3CA 4KJNA 4TSSA 5A2QL 1QLBB 4YIJA 3D6CA 3ONAB 1C8CA 4XDDA 3I9V1 4ZK9B 4YWGG 1SNCA 5EKIA 3NUHB 3AE4B 3OWEB 3I90A 5E6JA 1IBXA 3S14B 4B9XA 3TN2A 2B39A 3J9CA 5M3MB 4GLSC 3J7YW 2D5DA 3N6RA 3AE8B 4QUFA 1AYFA 2I07B 4I65A 1BUIC 3GTMB 1I4XA 2NTSA 2L0CA 4A3DB 1QOBA 1FXIA 4R8NA 2LEKA 2CQAA 2Y5CA 2VUMB 1X3QA 4RHRA 3L7ZC 1PRTB 4OO1I 1K53A 3VQIA 2PW9A 1YJIA 1CHQD 1ZUD2 4RAUC 3NBIA 4IUPA 1BNZA 5KRUA 2CJOA 2N7JA 1XCTL 2KUMA 4HEA1 2E2HB 1QF6A 1Q10A 2HCCA 4C2MB 3M85A 4ZYSA 1YNJD 1QNUA 2IJ0A 3T56B 3IFDA 4QB4A 1PRTD 4LAAA 3PMFA 2WKCA 1DD2A 3BDOA 1LTTD 1IBXB 2IGDA 3VR3A 5EPKA 2B2VC 1ML0D 1A70A 1CA6A 3OMGA 2KAJA 1GHJA 1XXGA 2M56B 1DXMA 1IL8A 3HEJA 3NQIA 3ZGZA 2F0FA 4QMGA 1ACCA 5BMGA 4CJ1B 5C3EB 2PVGC 1JALA 2WXKA 4HAEA 4D2KA 1KLGD 2PZUA 1H9JA 3SFEB 2N55A 3NBHA 1EEFD 1Q8IA 1JICA 2BT6A 1SNQA 4RFBA 2TSSA 2WLBA 2BTEA 1ZPSA 5E1FA 1Z7TA 4ARCA 2SOBA 3U9OA 5FLXE 2A6HC 4RA8A 5C3XA 4KY6A 2L9HA 3GV3A 1JROA 4PNYA 5BYSA 1F77A 4DF7A 4OW0A 1HTPA 2PZWA 1SDFA 4FVMA 1E0ZA 2X69A 1QB5D 4WH4A 5C0XI 2EY6A 1SYBA 1BDOA 2QIEB 3MWYW 2PYKA 4US8A 4J3OD 3PUZA 4IFDH 3P42A 3E56A 3LB8C 1EQVA 3HOXB 4LJZC 2KJXA 1L0VB 3AMUA 5HHDG 1JW9D 1ZE3D 1LO5D 1ESRA 1WXQA 4XQNA 2L12A 3BZDB 2K01A 3L9AX 4DFAA 3K5LA 2BDNA 2B63B 4KY5A 1AEXA