1I4QA

Crystal structure of staphylococcal enterotoxin c2 at 100k crystallized at ph 6.0
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
239
structure length
234
Chain Sequence
ESQPDPTPDELHKSSEFTGTMGNMKYLYDDHYVSATKVMSVDKFLAHDLIYNISDKKLKNYDKVKTELLNEDLAKKYKDEVVDVYGSNYYVNCYFSSKDNGGKTCMYGGITKHEGNHFDNGNLQNVLIRVYENKRNTISFEVQTDKKSVTAQELDIKARNFLINKKNLYEFNSSPYETGYIKFIENNGNTFWYDMMPAPGDKFDQSKYLMMYNDNKTVDSKSVKIEVHLTTKNG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of staphylococcal enterotoxin C2 at various pH levels.
pubmed doi rcsb
molecule tags Toxin
molecule keywords ENTEROTOXIN TYPE C-2
total genus 67
structure length 234
sequence length 239
ec nomenclature
pdb deposition date 2001-02-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01123 Stap_Strp_toxin Staphylococcal/Streptococcal toxin, OB-fold domain
A PF02876 Stap_Strp_tox_C Staphylococcal/Streptococcal toxin, beta-grasp domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.110 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1i4qA01
3.10.20.120 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1i4qA02
1TS5A 2Z8LA 1JQYD 4BWGB 1V1OA 4NZLB 4RGOS 1FD7D 3EA6A 1I4PA 3R8BA 1SXTA 2TSSA 2NTTA 1KLGD 1PRTC 1PTOD 5ELBA 1B44D 1PTOB 1S5BD 1LTTD 1LLRD 1PTOH 3BZDB 2AQ3B 1I4RA 4ZYSA 3O13A 1S5ED 2R61A 2QEJC 4L63B 3BVMA 1XXGA 2AQ1B 4RCOA 2XNAC 3BYYB 4RGTA 1TS3A 3GP7A 4DXGA 2CHBD 1PRTF 4UDUC 1LT4D 3R2IA 1EWCA 3DWQA 1RD9D 2G9HD 1SJHD 3KLSX 4OHJA 1YN5A 5FK9C 1HQRD 4C56C 1DYQA 1STEA 1LTGD 1M4VA 1ENFA 1S5CD 1BCPC 1BCPB 1LT6D 5ELEA 1DJRD 1JWMD 1LTSD 1TY0A 3URYA 1D5ZC 1D6EC 4RGNA 1I4QA 1GOZA 2RDHA 1I4HA 3BYTB 1EU3A 1T5XD 1LTRD 5D3IB 2XRQD 1TS4A 5TSSA 3R2TA 1PTOC 1MD2D 1HA5A 1LTAD 5I4DA 4RHRA 1TS2A 1PRTD 3BVGA 1ET6A 2RDGA 4DXFA 2J4XA 1SE2A 2SEBD 3MFGA 1FNUA 2XN9C 1UNSA 2WV6D 1EU4A 1UUPA 1ET9A 1XTCD 1SJED 4RFBA 1V1PA 1QILA 1SE3A 2XRSD 3SEBA 1L0YB 3DWAA 1AN8A 1BCPF 1KLUD 1FNVA 1SBBB 1F77A 1V1PB 4O1NA 1PRTB 1JCKB 3EFXD 3MC0B 1LT5D 1ESFA 1CHQD 4L6TB 5ELDA 4RGMA 1PYWD 1JWUD 2QILA 5ELFA 1SEBD 1PZID 1S5DD 1EEFD 3BVZA 5FKAC 4RHSA 1S5FD 1HTLD 4K6LA 5ELCA 2AQ2B 3W2DA 1LO5D 1I4XA 3CHBD 2IJ0A 1PZJD 3V05A 1LTBD 1RDPD 1LTID 1CQVA 1FGBD 2O2LD 1LT3D 1JR0D 1RF2D 1CT1D 1SE4A 1HXYD 4TSSA 1AW7A 2ICIA 1EFID 1TY2A 1BXTA 1D5XC 4RH6A 1I4GA 2IPKD 1G8ZD 3TSSA 1PZKD 2NTSA 1BCPD 1CK1A 5D3DA 1EEID 1CHPD 1L0XB 3DWPA 1RCVD 1KTKA 3OWEB 1JWSD 1PTOF 1D5MC 1YN4A 4Z9CB 1YN3A 1FNWA 1B1ZA
chains in the Genus database with same CATH superfamily
2JA5B 3K5MA 5C3XA 1E22A 4BWGB 4HPPA 2B3AA 2NBVB 2WAQG 4W9JA 2FMCA 3E0EA 2G45B 4HKQA 3UE1A 2WXJA 3PS6A 2V3NA 1TKWB 2IW3A 3APDA 1TGZB 1PTOD 5ELBA 3VR4A 1DM0B 1ZYRC 4EKUA 1JJCB 3NWSA 4ZRQA 4DR1L 1V43A 4DUYL 5HHDG 2O5IC 1MHWC 2IO0B 4E74A 2UUAQ 2MCNB 3Q6SA 3Q3JA 1EQTA 4R1JA 4CJ0B 3PIO3 3S14H 1SYEA 2DWQA 5C44B 2IYDB 2A68D 5D7GA 1PDQA 4ZHOA 4KD3A 1HZBA 3APFA 4US9A 3E3XA 4ZRJA 4MN3A 3LWEA 2K28A 3PVLA 2KOLA 2ZW0A 4LNIA 3EFUA 3FILA 4YWGG 1BBUA 2CJOA 3OJ3A 4ANWA 1K8GA 3WCQA 1YVCA 1OXUA 4C3IB 1TKEA 4X3TA 3RLOA 3IVFA 4YTPB 3ZQ4A 2NVUI 4BBSH 1HJPA 1RHPA 2M8SA 1XD3B 1L0WA 1TWAH 2W82A 4QIWB 4UAIA 4ME3A 3KLSA 4KY6A 2BGFA 3TZUA 3HOXH 4RAUC 3T51B 1ZP0B 1D6EC 4OX9L 4BZAA 5DPTA 2JWZA 4HJGE 3KFUA 3S24A 4KJNA 2OJWA 4KK7A 1TS4A 1FIQA 5EBCA 2KHSA 3NBHA 5D14A 2JYTA 3KYDD 4WJWA 4NY0A 1E0BA 1C4PA 2Q2IA 4DR1Q 2F0HA 4IZ8A 3S2AA 4LUOA 3KJPA 2NCNA 3J81E 1VMPA 2PW9A 1K53A 2C9OA 4CJ1B 3PO2H 3I2ZA 1UNSA 4TKNA 2A5UA 4K7WA 3CCEA 3AXCA 1U5KA 1C76A 4A3KH 3PIP3 2D5DA 1WTRA 3B0AA 1YI2A 2RR9A 5C5LA 1BCPF 1WJUA 2B2TC 5JVH3 2FXQA 3GZNB 1WCMB 1I3QH 2FHTA 4MDKE 3N3KB 4P1CC 3V2TA 3IBEA 4OWXB 3OG5A 2Q2HA 2DYBA 3DBHI 3N1XC 2DZMA 2IL8A 3Q3FA 4Q2JA 2OF1A 2YU9H 4IM0A 3DBRB 4A3FB 5ELCA 2EYFA 4P2CB 3AEEB 4HRSA 3EC8A 3J81L 2ZTEA 5G55A 1PZJD 4BKTA 4CO7A 1UAPA 1E7ZA 1WSPA 1RM6C 3PPAA 2NYZD 1HZ6A 3AFPA 3DWGC 3L10B 1WGDA 2WB1B 1RL2A 4XTCS 2I1KA 4FXDA 2JA8G 3R3OA 3W1SA 3I3CA 4DK1A 4JI0Q 2D3AA 3TSSA 4LNQA 2KWUB 1PFMA 3GV6A 3MXPA 3RZDH 1N34L 1J7BA 5JAVA 3KDFA 1LM8B 4IOIE 2NZOA 4UP8A 2N1VA 4DV1Q 2K8CA 3AECB 4XE0A 5KHQA 2N9EB 1B1ZA 5JEAH 1KL9A 1W3SA 1EYDA 1I3QB 1PFNA 2I46A 4A3DG 4R9WA 4DV3Q 5AJ3Q 2YV5A 3T53B 1TKGA 2XK5A 1YQBA 2Z6KA 3OW2A 4BBSG 2L7RA 1II3A 4A3LH 1B44D 3ZNHB 2XSCA 1L2NA 2L3ZA 4AYBE 3D0FA 3A8IE 1VLBA 4KV2A 2KCNA 3AE8B 2F52A 3K7AB 4ALPA 1E24A 4LF6L 2F0MA 4DNTB 5AZFA 1ZE3D 3NUHB 3Q3MC 1S5ED 3R93A 3C46A 1BO0A 2K33A 2ZJPA 4GKKQ 3STBD 4K6DA 4FULA 4DNRB 4M00A 1R4QB 4KHZA 2QEXA 4GNXC 1A5RA 1Z7TA 2GVBA 1KC8C 5K36H 4S0RA 3RNAC 2LXCA 1EF5A 2K03A 2BWFA 2FUG1 4KKIA 3IAYA 4C56C 3A4SC 5LL6X 2HDEA 1UZXB 1CA5A 4C1NK 3RN9C 2EY1A 3S1RH 4LF7L 1FMAD 4YIJA 3D6WA 1WD1A 3H0GB 2VXWA 1I4HA 3ZTCA 5FJ8H 4OGQC 2HIVA 1EU3A 3VYRA 1PA6A 2O6VA 1T5XD 5D3IB 2UUCL 4YL8A 2WXGA 2FIDA 4DR6Q 3R2TA 1FPYA 3CIRB 4DHZE 3DM1A 4DNIA 1HZAA 2B2UC 1WGKA 2LZ6A 3SK4A 5BO4B 5KHOA 1WJJA 1J7CA 5IN7A 3NY5A 1AYFA 5CV4A 2IO1B 4BY7H 3JVZX 2KZRA 1YNJC 3BZCA 3CMAA 1QB5D 5EBDA 2RVLA 1QOAA 1WY8A 5BN5A 4J3OD 4LNKA 4YHHQ 1UUPA 2K5HA 3KUDB 3W1GA 1HTPA 1XTCD 1CJEA 4RFBA 3WA0A 3DHGC 3ML9A 1JORA 1L0YB 3T9LA 3OTOQ 3UF8A 4WAAA 3NENA 1CM9A 3HOXB 4PZ8A 1G2SA 3B9JA 1ZYRD 3FP9A 5CV9A 3OLMD 3UQAA 3QARA 1L1OB 5IYCH 2HCIA 5LMNQ 2NPTA 4B3TL 4KI0A 1ILPA 1J19A 3P4PB 4DR7L 2BB6A 2KQ3A 3S1NH 4I6NB 4FJYA 5KYIA 4AYBB 2RD0A 5C1ZA 2WXKA 4MTNA 4LNNA 1Y8RC 3N9YC 1X3GA 1FGBD 1P7EA 1SSOA 2WKDA 3ZJUA 3DBLI 2KN4A 1YX5B 2EOTA 1MI0A 3L4PA 2JU6X 2NS5A 1PH4A 3V6CB 3VRBB 3ZNZB 1BXTA 2X8XX 4B3SL 1KLVA 3GTJB 3F8TA 1E8YA 5E3FA 2R93G 3EROA 5D3DA 1IBLQ 5I6WA 3P4RB 2B2WA 2BYTA 1SYBA 4BOSC 1C1YB 2ICEC 1TT5B 4KVGB 2N8NA 4JI6Q 1GC7A 3FC4A 1DONA 2AWNA 2KJXA 3OMGA 2MHJA 1U4RA 4PZ7A 4KTAA 5E6PA 2W9NA 5KGUA 1WM3A 4BOZB 4CQNA 2IT1A 1Q10A 4ZDVA 3ERSX 4A93B 1GO3E 4ZQ3A 1WX9A 1GVPA 3F2DA 4KSKC 4XT3B 5AEKB 1N61A 1WF9A 1IP9A 2CHZA 1ENAA 1QJOA 2V4DA 3K7AH 1LTTD 2K5PA 4KKUA 4DV0Q 3RCZA 5D6JB 1LGRA 3GTQB 2EMTA 2O2VA 2WXOA 1D8LA 2N78A 1DZ1A 3APCA 1K9MC 1E2ZA 2K32A 2RSNA 2ZZPB 4J6IA 2LY7A 2E2HB 2QDLA 3U30A 3BVMA 4IUMB 5IGBA 3NOBA 2R93B 1H95A 4LFCL 4LDTD 1I35A 3J80i 2UUBL 4B3ML 3S17B 4ZRIA 2JA9A 1GUOA 4ULLA 4DXGA 5IGCA 2K39A 1Q8IA 3I7FA 4G4KA 3VAWA 1YN5A 2N55A 5LLIA 1TWHH 2KANA 1DYQA 2EYJA 1QG7A 1VQOA 1LTGD 1QQRA 1T5EA 4FVMA 1IKMA 3GTPB 1HR0Q 1KDCA 5ELEA 1VQDA 1P1AA 1WXAA 1LTSD 2DX5B 1B8AA 4XIGS 3CF5A 1SYFA 3NHHA 2SNMA 4RGNA 4RG1A 1EM7A 1UE5A 3ZVVA 3TEYA 1XNQQ 2R92B 4A3BB 3DBHB 2N7EA 1WIAA 3TP8A 1OTCA 2EMSA 2IBIB 1HNWQ 2WQYB 4G7OC 3I4MG 5C3EB 4W9FA 2HTHA 2L11A 2A6HC 4GLAC 2HDMA 2MQHA 3MFGA 1YQ3B 4EZKA 1OXXK 4B9XA 4NAWA 2K8BA 1NJIC 2PJHA 3AYHB 4BKSD 1GC6A 5EPJA 4EQPA 2Z4HA 3NEMA 4A3CG 3AI5A 1X54A 4JW0A 3H7SA 2ZJRA 3L7ZC 4JCVE 3KOJA 1PH7A 3BDOA 5COYA 2VUMG 3C1EA 1RRBA 1V1PB 2EELA 3QHTA 1E1OA 3NBIA 2GVAA 4JI4L 1FM0D 3QQ8B 5EQ0A 4B3RL 4HIOA 2NBWB 1SEBD 1EY6A 5G5HA 2UXCQ 2KUMA 1UE1A 1NSNS 3G48A 1JB7A 2SNSA 4P73A 3RMHA 2WXFA 3J9CA 1I4XA 3K57A 3SK6A 4ZK9B 1QOFA 1VQBA 1CQVA 1K52A 2OTLA 3Q3OC 4JE3B 5G5GA 2K50A 5KIXA 4FF3A 2ZXPA 1SIJA 5C6AA 1SB3C 2L12A 4A3LG 2NB0A 2RKSA 2LUMA 3UDXA 4M01A 3KYCD 1V81A 5MPOA 4I65A 3PREA 1G91A 2KDBA 2L55A 4XT1B 3Q8BA 1HFGA 4GKJQ 3ZIMA 4OW0A 3VYSA 3AB9A 2E75C 1FXIA 2MA9B 3VH3B 4AJWA 5JEAG 3UIPB 3OMCA 2JN4A 1DD2A 2JPHA 3B2GA 4C3HB 2GBJA 4LLGM 1CI3M 2L9HA 4Z9CB 4WJQA 3TRZA 3HRDD 3CMEA 1NBWA 4M8MA 4AH6A 2KDIA 3R8BA 4XYCA 4Q0FA 1R7SA 4OXPA 2C5LC 3C19A 3ZRFA 1TJEA 1X3FA 1C9FA 3OTOL 1Y1VH 3FKIB 1XQQA 4IWQA 3RNUA 2MBQA 3ULJA 1CZWA 1I5FA 2IGDA 4FNFA 1QOGA 3A5ZB 1MGSA 3BZDB 1X65A 1T6BX 1S4ZA 2R7FA 3B08A 3QA8A 4DBGA 4W9HA 1BVSA 2PNHA 3RULA 3I8ZA 1VQ7A 3M4OH 2NZ1D 2QHOA 2F0FA 4KHPQ 3DBLB 1E2VA 4MSQB 4CHKA 4QUFA 4YCUA 3QIAA 1KF6B 4W9GA 3NJTA 2QDFA 4IUUA 3IAS1 3GD7A 3RNBC 4DR5Q 1WM2A 4X66L 2XK5B 1SJHD 1XF5L 4YTMB 1V49A 4LJZC 4KIKB 1N60A 3JW0X 1H9RA 1KXLA 1ZDVA 3PUXA 1IL8A 5EJWA 2VZKB 4FJZA 2BDOA 4A3KG 1GUTA 5KRUA 2KX0A 2A68C 3CRKC 2N9KA 1F2LA 5HFYA 3PO2G 5J3BA 3CCVA 2GBKA 5C5MA 3VTVA 3RZOH 4NXML 5IODA 1E7PB 4IM3A 4JWUC 1LTRD 4LWCA 3T13A 4BAXA 4TRDA 4DR2L 3S15H 2AL6A 3ZUNA 2L0CA 4IJLA 3PO0A 4OWWB 1KM7A 3P4QB 1RFKA 1KQSA 2ONQA 4YXDB 2WXQA 5DM73 4ZLTF 3QK0A 1YD8U 4GLVB 3FAHA 1K8AC 1VQNA 5FLXE 3VR6A 2AEHA 5CHWA 2Y3AA 4RWSC 2RBMA 3EN2A 3HOYB 3E9HA 5D2MB 2ASBA 5E6OA 2Y0SB 1CTMA 2KDEB 1EL0A 1VF7A 2PKOA 3TEXA 5DCNA 3VYTA 4G3XB 3CCLA 4RGMA 1GUWA 1VZ6A 2HUGA 2QILA 1R4NB 2KTFA 3P2BA 3KQ4A 4X62Q 1F2MA 2WS3B 5C23A 2YTXA 5KYLA 5EKIA 1UF0A 3AE1B 4RF0A 4KDLB 1KFYB 4ID6A 1WXMA 2MQJA 4KHVA 4F7ZA 3Q69A 2KLCA 1DOIA 1LTID 2JSOA 3J81c 3QCAA 1UWXA 1F0ZA 1I6HH 4A3JG 1PGXA 4KZCA 2JQRB 4HJ8A 4E3CA 3M3YH 3TBLD 4RH6A 5AZHA 4NJCA 1L1OA 1XMOL 2NTSA 1KD1C 5LXHA 5CORA 2D0OA 4JI8L 2Z0EB 1MFWA 3N52A 3OWEB 2V3SA 4M02A 1YN3A 4P6VF 3TEHB 3WDNA 3EBEA 2E5LQ 2WX0A 2AMCB 1VDZA 2A5HA 1GG3A 2IX1A 3CKIB 3KUPA 4HTHA 4QUCA 4N8FA 4O42A 1VJKA 2MLBA 1YHBA 2EYOA 2F4IA 1SXTA 2LXAA 3HP3A 5ELOA 4M0WA 2NVYB 2W55A 4NJ6A 4M8AA 1P9DU 4TUUA 2KVRA 3H7PA 3P4SB 1QCBD 2CWPA 4DV7Q 1J8CA 4A3PA 3A8JE 2A8VA 4WJOA 1I4RA 3NBHB 3HOWB 1RYJA 3UDIA 1TYGB 1QF6A 1XXGA 1L6VA 3ZYYX 4AQ7A 3F2UA 1TZ1A 1FFUA 2K6DB 3SK8A 4X64L 3K58A 1PQSA 3HS0C 3M62B 2VL6A 2Q2UA 2ZXOA 4PZ6A 5IT9L 4CKBA 2R7ZH 4X3UA 2J52A 4A3MB 5FK9C 2KHJA 3DVGY 3ML8A 4RMAA 3U7DA 4DF7A 4CKCA 2PQEA 3F2BA 3SHLA 4A4IA 2LXKA 4IURA 5IWAL 1PH8A 2GRIA 2KJHB 2KMCA 3HOZH 2MSED 3SDZA 3M3YB 4GU2A 4B0EA 4EZLA 1D4BA 2OOBB 2MO1A 3ND8A 4MTKA 2IY5B 4MT5A 1X3PA 2L4NA 1N33Q 1JROA 1UE7A 4DR5L 4A3FG 4MH0E 1OFFA 5TSSA 2Q5WD 4DDID 1VQCA 5DM63 5CHFA 2Y0SE 5LNK1 3MP9A 1MD2D 2DY8A 3HVDA 4DFAA 2E76C 4W9CA 2CW0C 4NW2A 3U52E 4IUQA 3AE4B 4URKA 5EDSA 2WXLA 3ZKJC 1RAXA 1WJ4A 5CX3A 2PCFB 2JUOA 2JWUA 1SFOH 3J80L 1B3AA 1JOKA 3GDEA 1WXVA 4WURA 4KX6B 1VQGA 3U4EG 2K5DA 1HQMC 3MC0B 3CCUA 4JYAL 1UH6A 2L0TA 2KC1A 5IP9H 3L0OA 1A6XA 1Q5WB 4HJ7A 2E5LL 3SHQA 1S3SG 3RR5A 2L5TA 1WX8A 4O0AA 3TDQA 3I4LA 2UYZB 4BBNF 4IW0A 4BBSB 1GB1A 2J0TD 1LO5D 3AV8A 3PRPB 1DXMA 4USAA 4GKJL 1YJIA 2DNCA 3PO3B 4A6QA 2Q8IB 5IGEA 4MHEA 3AULA 2FCMA 4NXNQ 2ZM6L 4JI7L 4RKBA 1QZGA 4PQXA 4DAYA 4OZCA 2QCZA 1L1OC 4X57B 3V3XA 3T8MA 3QJYA 1FXAA 1PZKD 3JAML 2VUMH 3J7ZC 4FF4A 4WJ3M 2JF5A 4GN1A 1WVLA 1VRAB 4JOIC 3S1QH 3IKJA 2B2YA 2PE6B 2HE7A 1VD2A 4KGSA 2FNJB 2F0PA 1FNWA 3M4QA 1JMLA 2K3UA 4B3RQ 3W1YA 1OGWA 4JI4Q 3EQLC 3ZDMC 3TZDA 3S17H 3WOFA 1FD7D 3K80C 2OTJA 3TEWA 4JI3Q 3EVQA 2K4KA 1Q82C 4X3SA 2KQSA 1WTHA 5GAHC 1HTOA 5JXVA 1GJXA 1V6EA 3GTKB 1TWAB 3DCGA 5T1IA 3B2FA 4L5QA 2JZPA 1K83B 2RQXA 3P7JA 2V3PA 4ZYSA 2N4FA 3H91A 3JAME 3I4NB 2R61A 2D5GA 1D7QA 2XNAC 1WI0A 2K7VA 4R4CA 5KEEA 2M56B 1TR5A 2Z1CA 1JW9D 2XEWA 3DEOA 2CQOA 5M3MG 5KNBA 2DZIA 3V96A 4JI2Q 1K50A 4HMJA 1OTRB 3E0JA 4KSLC 3DWQA 1JICA 4C3HH 4DAPA 4KGRA 1P3QU 3KLSX 4IUPA 4WFN3 4NXMQ 3BG3A 3D31A 2C5CA 2HQLA 2KMAA 2B2YC 5FR3A 3CF6E 1STEA 4JK1C 2DN8A 1BCPC 1JOOA 3G71A 4GZYC 2PIAA 1D5ZC 4HAEA 4H2AA 1QVFA 2KT7A 3Q8DA 3N32A 1ICWA 5EE3A 3BYTB 5GADC 3Q8EA 1WMHA 3C8YA 1VCIA 1CZGA 5EKKA 4GLXA 5JPNC 1S1QB 2Z0SA 4XGAB 5M9OA 1SR3A 2CH4W 1NI3A 4AYBG 3GTQH 2L52A 2EKIA 1H9SA 2BYFA 3NQTA 4ZKBB 3VTUA 3AEDB 1PV4A 3Q2AC 3IFTA 4FXKC 1MSHA 1IKLA 5A2QE 3Q24A 3CU7A 1K8RB 1K73C 2IO2B 3KBXA 2K8HA 3MTNB 4DHZB 3VXWA 4A3IG 3VTWA 4DKAC 3N1YC 3VFKA 4A93H 5IYDG 3NZ3A 4DV5L 2EXDA 2PLPA 1V8CA 3NVVA 2KFJA 1DOKA 2B2VC 1Y14B 3C1FA 4HJKA 2KBNA 3UE0A 1A63A 5EPLA 3SU8X 3DUZA 1SYCA 2QGQA 2R93H 4NQKE 3UDGA 1QVGA 1RLFA 2FAZA 3SFDB 3H0GG 3K81C 1VZ8A 4K2KA 3X3NA 1ASYA 4BVUC 1WMHB 4BKGA 2F0GA 5FO8B 1N5XA 3MVVA 1DOMA 2K14A 3OHXC 2B2TA 4NQLB 1WOCA 3OW7A 2MP2B 3I70A 1EWYC 3VR5A 2F4VQ 3UIOB 4A3BH 3HOVG 1VZ7A 2O6VD 1SNMA 2IDYA 2KEDA 4TSSA 5CMDA 1HEZE 3W5UB 2WU2B 3DPDA 3C2PA 5A35A 5IYCG 4DV6L 1N8RC 4IJHA 1IL2A 3GS2A 3UI2A 3MJ5A 1AZQA 4GOCA 4KKTA 3AE9B 2BW2A 4B95A 4FF2A 1ZEQX 3GE8C 1KJTA 5FLMH 2KTRB 2RDFA 4C4VA 1YNXA 1XLOA 2UXCL 2M00A 1R9TH 3ZXVA 2JA7B 2D9UA 4UHVA 3P1HA 1PH2A 3CQZB 4EFOA 3KF6A 3S2HB 1FJGQ 2NVXH 3EA6A 2EY6A 2TSSA 2IGHA 2E3TA 3EGRA 2N3SA 1UEAB 4BY1H 1XNRQ 3A5UA 2E6XA 4MZ9A 4IFDG 2PW7A 2DYMA 2J0JA 2A69C 4JI5Q 2V9HA 1LABA 1EQQA 1N6ZA 1WGGA 4Y52H 3AM9A 3N20C 4DDGD 3FKYA 5M3FH 1WFYA 3IT6B 1XYIA 4E6IA 5HI1A 1EIHA 1IYFA 1QNKA 4EOYA 5DNFA 2A73B 4QB4A 1YQ4B 2D62A 3HRZC 1WD0A 2F0TA 4KIKA 2JSVX 3AEGB 5IIFA 4GN5A 1RKNA 2OEDA 1PRTF 2CJNA 1B4OA 4CBVA 4JI1L 1YHAA 1J9OA 3MEFA 2KJRA 5K36G 2PVGC 2Q8TA 5CR3A 2M0AA 4HIDA 3ZW3A 1YBYA 1S72A 4A3GH 2MP2A 3DBSA 2EYMA 3RNEC 5NUCA 2EYLA 2CQAA 2KHWB 4LF7Q 4WH4A 4XYQA 3TMEA 3HOUG 1PH9A 3AN1A 1QZHA 3BDLA 2AUJD 1E0ZA 2H5XA 3BINA 3PLVA 4MJSA 3G7LA 1LQBA 2I5LX 3KUCB 1WZ0A 4H7BA 4YWMA 2K5NA 2G4DB 5EAYA 2UUBQ 4YCWA 4B3MQ 1BMLC 2XVSA 3Q3NC 4ASWC 5JJZA 1JE5A 4JI5L 2K0PA 4C7ZA 2F0OA 2LGXA 1JOQA 1E7UA 4LUVA 1TS2A 2BE5D 5IT9E 1HR0W 1XNRL 2AX5A 4A3DH 2B63G 3GTKH 2AWTA 5IYBH 2DY7A 4LF6Q 3K8AA 2PPHA 2XN9C 5D94A 5IAAC 2LRUA 2N9LA 4K7SA 5BN3A 1FJGL 3UQBA 1SLJA 4GXBA 1I50B 3NVYA 4YY3Q 2VNUD 1PYBA 4IUVA 2LVOA 3PHWB 3LDZE 1SE8A 5T8IA 2R92H 1AN8A 2ZW1A 1FNVA 5HY6A 2Y5BB 1MJCA 1PRTB 4JI3L 1EYGA 1TIFA 2BDNA 4ZHPA 2JA8H 5M5WH 1GUSA 2VZAA 1B9RA 1GUNA 2N7DA 1UWVA 2MWSB 2DHZA 1EWHA 1EYAA 2PYKA 4LNFA 1HTLD 2JEBI 4A3GB 4WORA 2A4ZA 3HG9A 3NE5B 4EX5A 1M94A 2KENA 4LF5Q 2BTEA 5FO7B 4K5VA 4QQBX 1SIFA 5JJLA 3QAQA 1XTDA 1JWBD 5AUIA 3K5OA 1YNND 3PO3H 2WXHA 4LF5L 1F2YA 3PF4A 4ZRPA 2JJQA 2ALYB 3NK9A 1T0SC 3VDZA 1QVCA 1TY2A 1E8WA 1RIPA 2PZTA 3D6CA 2DZKA 1I4GA 4L5SA 3GTMH 3PSIA 3J7AF 1E6EB 2VH1A 2QDBA 1CKNA 2KWVB 2LRWA 3I63C 3HIZA 2K1BA 4IC7B 1IZ6A 4NB3A 1L0XB 3SR1A 4N58A 4S17A 4V190 4TVAB 4ZUJA 2PI2A 2VB2X 2LASA 2L0FA 4RM9A 4MNOA 2FJ2A 5KNDA 3GTLH 2J53A 4YY3L 1IYUA 5L37A 1LYLA 4DHJB 2NR2A 1NYRA 4JYAQ 4RGOS 1C48A 5EKLA 2K75A 3VA5A 4A3KB 2CW0D 2INNE 3K0XA 4JOIA 1X55A 5CV7A 1Y8PB 1WTVA 2QJLA 4HROA 1A3UA 1XX8A 1JC7A 2WP9B 1SNCA 4IG7B 1BDOA 4YHHL 1TWHB 2K05A 3GE3C 3O13A 2MJEA 3MXGA 1RODA 5HURA 1KOTA 1ZKOA 4F7XA 2B63H 4YWLA 4DUZL 1N5WA 2PE9A 3TEZA 4K14A 4ZOHC 2SAKA 2JRIB 1TS3A 3A56A 3GP7A 1MPEA 2WDTB 2NBUA 1T0QC 2G9HD 4J8QA 4IWPA 3AE2B 1W6JA 1NAPA 1NR4A 2RCFA 3RLNA 1CKMA 1PUTA 2IO3B 3L17A 4GIVA 1B70B 1A70A 4YCVA 4OIKA 1KDAA 1M4VA 4O2DA 1EQVA 4R4QA 5IWAQ 1LT6D 5H1SE 1G291 5DPSA 4M0WB 3V62A 2OWOA 4LFCQ 3Q0AA 2RA4A 2L00B 1EIGA 4YSXB 5M5YB 5CV8A 4US8A 2E2IH 4DAMA 2OXPA 2UXBQ 4NAMA 1K8OA 3S1MH 4P7IA 4DK0A 1GAQB 1VS0A 4AP4C 1R9TB 4XZ4A 4K3CA 3QB3A 2FINB 1P7FA 4X64Q 1V5OA 2PPBC 4OO1G 1FFVA 3Q22A 1WTPA 2WP8J 4K3BA 2JQOA 5L95C 2OJRA 4JWSC 1HZ9A 1ZOYB 2NPTB 2ZJDA 1QE6A 2J4XA 1G6PA 5JVG3 4A3EB 2N1WA 4G57A 4QJFA 2R7DA 3AMZA 2NN6H 3N30A 4V0BA 5M3FG 1V1PA 4QL5A 3TN2A 2F0QA 1KIXA 2YTVA 4IFDH 4DV3L 3TS2A 2A69D 4FADA 1CHQD 5DEHA 3U9OA 2JA5G 5ELFA 1U4PA 3C0RB 1EF1A 3N1ZC 3W5OA 2Z6KC 2IX0A 1S5DD 2OT2A 3E56A 3MTSA 1E7VA 3QJZA 1HNXL 4JI8Q 2ZM6Q 4NXNL 1EIYB 4JI7Q 3MC8A 1SROA 3CHBD 4EUTA 3RZWC 3VH4B 5EPKA 2F0LA 2NVYH 4JVZA 4NMZA 2BB5A 3NVZA 1GXDC 3U58A 1RF2D 2C7NB 2KK8A 1PVOA 2KN5A 3H1UA 3TCAA 1AW7A 2VQEL 3M95A 5IOIA 3HOWG 4F8MA 1BR9A 1VR9A 4DR7Q 1OO9B 5C0XG 3HOZB 2WGSA 5IGDA 4B3TQ 1J6QA 1EZ6A 2QIEB 2TMPA 1VQIA 2RHQB 5M3FB 2DUDA 3BZKA 1OQQA 2INCC 1PMRA 3GB1A 1I7HA 2INDC 3M3JA 1L2FA 5CBAE 1Y1WH 4C3IG 2FFKB 2RSUA 4C1NI 4OWTB 3BVZA 3AE6B 1TS5A 1V86A 1K0RA 4MIUA 2HD3A 4DV5Q 2VQFQ 1QUQB 2BYVE 4G7HC 2MX2A 2ID0A 3S2HH 5CC4A 1WZ3A 4FYDA 4KGTA 2J7QB 1GB4A 5FLXc 1FEHA 1P8LA 2LXJA 1DGJA 1PRTC 1NMGA 4A3EH 4WJNA 2M4NA 5J39A 1B50A 1C4AA 2MW5A 1L6UA 2HCCA 4FF1A 1MVKA 2RMMA 1LLRD 3WOEA 3QR8A 3ETRA 2M9VA 3J7AV 5IYDH 4JX1C 1FRDA 1C77A 2D10A 4L63B 2XGTA 2AQ1B 4A3IH 1V97A 4WWPA 4OEMB 2A74C 1E2WA 4TQ0A 2KMMA 2NWGA 1YNJD 4PS8A 1NI2A 2HQEA 3ZRCA 4PS3A 1CA6A 3GTLB 1NE3A 1HFNA 1WE6A 1Y1WB 4PMCA 3PUYA 5JHBA 1JB3A 4UP7A 4NNJB 4B6WA 1XJVA 5ISRA 3PGZA 3CC7A 1Y69U 4LFBQ 1JJGA 1WRDB 1DCZA 3OOCA 3KDFB 2MHVA 3KLWA 1I4QA 4YWKA 1TWGB 4XQNA 3RPFC 2RDBC 1O7LA 2MFIA 1HA6A 1ROEA 1SF0A 2BS3B 3NG0A 5LMUL 1XO3A 2KX3A 4WWNA 3I57A 2MUYA 5JPMC 5M3MH 4HJ9A 4KHPL 3I4NH 3DVGX 3KW5B 4ZAIA 3RZDB 4IKGA 3X0WA 1EO6A 1OXSC 3U9SA 4OO1I 4II2B 5AJ3L 3EECA 4IUNA 1F9RA 4R3DA 4F1SA 5J22A 2VQFL 3KWVA 4KLKA 1WGYA 2R6GA 1VMCA 1XPOA 1QILA 2PZUA 3A1QB 2JYEA 2WNMA 2ZNVC 1WWTA 4MELA 2K01A 1H9KA 4UP9A 1DGSA 1JT8A 1XT9B 1FL0A 1TQOA 4FXCA 3ER0A 1BOSA 1F9QA 4IFDI 4P72A 4LF4Q 3HZXA 4IPDA 5T1GA 4LF9L 3MFYA 4DR3Q 5H8YE 4NPSA 3WALA 2CCZA 2YYZA 4DV4Q 4KKJA 5C4XH 1WXSA 1DOXA 2M19A 5FKAC 4AJYB 3A7LA 5DPWA 2ENBA 1D1IA 2OEOA 2R3ZA 1YNTE 3FVQA 5FOBB 3DWMA 2AHOB 5CGKA 2ZTCA 1HNZL 1DOLA 1UE6A 1YZ6A 2IJ0A 3FKIH 4HEDA 4P75A 3GV3A 4PNYA 4HIMA 1MI2A 3OJ4B 1I94Q 1YJJA 1SE4A 2QC8A 3RZOB 1OQYA 5HGQA 1HNXQ 1V2YA 4N6EB 5BR8Q 2GOWA 4ITKA 3I4NG 1JE4A 1D5XC 3Q8AA 4NAWB 2ATWA 1MG8A 2BBCA 3K9PB 1O7ZA 2KDMA 3MHZA 4NJ7A 1BBXC 2B3GA 4BA1I 3ULPA 1XLNA 1CHPD 1L4DB 5DAUA 5M3MB 1KTKA 2C9WB 1PTOF 3J7YW 3T4AC 3U50C 1IBML 4ICVA 1WCMG 4GS3A 1VQ9A 4TQUS 3CCJA 2PVOD 3PF5A 1FYCA 5J2RA 2YEPF 2ZXRA 3ULLA 3QX1A 5C2TB 2WXPA 2NUCA 4BBRB 2I5MX 3H6MA 5IP9G 1GPXA 2BE5C 4AS1A 2FCSA 4CJ2C 3AFQA 2LWPA 5LL6S 1UGMA 1S40A 2W3SA 2OQ0A 4KV6A 2AWOA 3ZO5B 2B76B 2JX5A 3I4OA 3MJWA 5J17A 1N9WA 1E8XA 2AQ3B 1E5WA 4G0NB 4IALA 3H7PB 2WB1G 2INPE 3QOLA 1F52A 4CKEA 2PZWA 1N33L 1IW7D 1PFSA 2QEJC 2ES2A 2JA8B 2UXBL 1H8CA 4OX9Q 3G4SA 1EYCA 3I91A 2VW9A 1VQ4A 2LKVA 2E2JB 3ZJVA 1U4LA 1E9MA 4RGTA 1G51A 1STBA 4Q5VA 4ANXA 2AUKA 4FA6A 4A3IB 3UDFA 2JA7H 1NENB 4PYZA 1JQ4A 3GTPH 4QY7A 1ZPSA 1EQRA 4KZ0A 3FILB 1H9SB 2JYOA 4K1RB 2BT6A 5IP7G 3DVNU 1KABA 3SD5A 5JHAA 1X6OA 4A3DB 1IHZA 1O7IA 5TR5A 4L8JA 1HR0L 4P16A 4BBRG 3GTJH 3PTFC 1BCPB 3E5SA 3AU7A 3NTHA 2IZVB 4EEWA 2CKZB 1EOVA 3VHTC 1YJWA 4K7UA 3L54A 4DUZQ 2BH2A 2HTME 2UU9Q 1O7YA 1GOZA 1LM0A 1LUZA 1ZW7A 4JIOU 3NS1A 1J7AA 2XWJB 1GUGA 2KO3A 3ECIA 4H02A 2LUEA 1WJNA 2KOXA 4UPAA 2K6AA 4QMGA 2KFKB 3M7GA 1KRSA 2F0DA 1OEYA 2V1YA 3MWYW 3GO5A 3P75A 4DUYQ 2K1FA 3NWTA 3NZUA 4QAYA 3ONAB 3S14B 1TXYA 1XCTL 2F3IA 3AEFB 3BVGA 2KCCA 4DQOC 3PUZA 3C3LA 2AL3A 3A1QA 4PK1A 4JLCA 3A9KB 1B3QA 4DV0L 4A3OA 2PMZB 1YJ1A 1ET9A 2RSOA 2LS01 1STNA 4I7ZC 2D07B 1T3QA 5EE0A 4CDDC 1KNEA 1SBBB 1UGJA 1C9OA 3MA2B 2AKWB 2P5ZX 5GAGC 1ESFA 5E7NA 1FGUA 1MBYA 1QOBA 4FLHA 1STYA 4AQYQ 3PIPA 2IHEA 4JI6L 1XMOQ 4C3JB 3DEPA 5GQOA 1NEKB 2MBOA 1WX7A 4XC2A 1PH5A 4F88A 4C4VB 1ESRA 3D4RA 1N63A 1Y8NB 1VQKA 3MHBA 4K81A 1B7YB 2N88A 4KN4C 2Z4IA 5AFWA 2NVTH 5CV6A 3D3RA 4ODGA 2LFNA 1A0IA 2EY5A 1CT1D 2EE1A 4OVVA 1QUQA 1I42A 2ZVOA 3TP6A 3A9KA 4DK3C 4CDEC 4JV5Q 2QMTA 1YMHE 4XDXA 4GDKA 4HCEA 5EE1A 1OXVA 2VS1A 2V4LA 1VQPA 2D2CC 2E74C 1JWSD 2JRHA 3NELA 4P74A 1HUNA 1F9JA 1Y1VB 4E71A 2QF7A 3QOJA 4HSVA 4JPBW 1YOVB 2O6VB 2V4IB 1BUVT 1QOHA 4K0KL 1B9NA 1KLGD 3STBC 3HOUB 3A7AB 2D3GA 2FCNA 1X56A 4LK0M 4LK1C 4EQ5A 2DBYA 2MBEA 4GDKB 4DK5A 1OEYJ 3LGJA 4QCLA 4A55A 2BVCA 3K59A 2LD9A 2YEPB 4GDLB 4ZYNA 2C35B 3LJ3A 4DR2Q 2KLGA 3I5JC 4C3JH 3ICEA 2CH4A 3E9IA 3AE5B 2LVPA 3I4MB 5HKHA 1EWIA 3S15B 5IO9A 4FN2A 1LFDA 2JP1A 2CU1A 3CQZH 1C78A 3R3MA 2B63B 4DR6L 2F0WA 3KK7A 2W3RA 2CHBD 1MJEA 1EWCA 4FO2A 1E1TA 3QIJA 2I07B 3A33B 5FLXL 3HKZE 4LDTB 2WIIB 3VRAB 3RUZA 4QF4A 2MGSA 2PI2E 1BT0A 3T3NA 2K5VA 3NS8A 4LJPB 3NSWA 3RZFA 4LF8L 2H88B 4OONA 4JI1Q 3CW2C 2ZEQA 5CBEE 4RCNA 2WINB 1F2RI 4LF8Q 4JBWA 4HK2A 5J18A 1PDXA 3H3VI 4A90A 1NVID 1FR3A 2DNEA 2N9XA 5C3WA 3ZNGC 2F3VA 3J81i 1V80A 2JZ3B 4HPMB 1AE2A 4CYEA 2LJIA 2WB1E 1X3QA 5C0XI 3KUZA 5IT9c 3ZLZA 3H6NA 1VDVA 1NTGA 2L1BA 3QG1A 3ZNID 1LTAD 2LGDA 3TP5A 4ANVA 4IM2A 3MXUA 1Z9FA 4R8NA 4POGA 3L0WB 2D0PA 2LVQA 2EJMA 1R4NI 4G7ZC 1L0VB 4BBRH 2D3CA 4DU9A 3UGBB 3VR8B 3B1LX 3EUB2 3FEWX 3RNCC 1CKNB 2XRSD 4S3SA 1J8IA 4DAVA 3H3VH 4JL9A 3E9SA 1AH9A 3O65B 2KVMA 4A20A 2G4SA 4ZCKA 2LMCA 3PGEA 1F77A 1G6JA 5ELDA 4WIPA 1IBLL 1TU2B 3CMMB 3PCOB 4BFRA 4HN7A 4KD4A 4C00A 2ON8A 3I72A 3HHMA 1IBXA 2C7MB 3KF8B 1N32L 3L9AX 4B3SQ 1XLPA 2R92G 4KMUC 4RHSA 1K3RA 1M90C 4DV6Q 2KYWA 1UD7A 5E4XA 2HHHQ 4R4TA 3W2DA 1N34Q 1MHHE 4Y7NH 2IWHA 1K3BC 1LTLA 1C4QA 2PO4A 3HKZG 1HZCA 4ABNA 1N36Q 3U7ZA 1JMCA 2HT1A 5IYBG 1YEZA 2IGGA 3PQIA 3GQBA 2F4VL 1SGHA 2ICIA 1GUAB 1EFID 3AH7A 3M4OB 1P98A 1NNXA 2EKEC 3OYYA 3LWUA 3S1RB 5LMNL 1YNNC 4BS9A 3IL8A 1CZPA 4IOAA 1VCBA 2N7JA 3JSVA 3B6YA 4HR7B 2M0XA 2KXJA 2MP1A 1Q0WB 2G9DA 3Q8CA 3G6EA 4N8X1 1YHQA 1WCMH 5GAEC 4A3MH 3GOEA 2L76A 3JYUA 2X69A 2WWZA 5DPRA 1GNUA 5M5WB 5C4JH 4XQJA 5IA7A 2Z8LA 1RTNA 1JQYD 5I2XA 1WR6E 4JBKA 2H4OA 4APVA 1E10A 1IXRA 2PNRC 3R7QA 2NVXB 1I4PA 1ENCA 3AE3B 1BQQT 4A3GG 1CMXB 5JH5C 4X3KA 3KYHC 1I50H 3PO2B 3KLRA 3PRZA 4TV3A 2D2QA 1IGCA 1D1KA 2PQAB 3CAMA 5JJKA 2KQ7A 4ZKCB 2NVQB 5ELNA 4W9IA 3BDCA 3HKZB 1PTOB 4I7AA 4IFDJ 1HNWL 1OQRA 1FO4A 2GB1A 2KCMA 1WXQA 3ZJTA 4A3CH 1EUVB 2OHFA 2EZVA 2LFIA 2UUCQ 4K2LA 1ZXIA 2YVCA 4PYUA 2WU5B 5JJIA 4WRDA 2EVBA 1P16A 3FRPB 1Q12A 2PEAA 3KH0A 3TP7A 3RN2A 1Q90A 5C4XG 3PSEB 2B29A 2KNBA 3AEBB 4GOPB 3W5VB 3I4MH 3T1HQ 4HJAA 4RM8A 4UDUC 2E2HH 2D11A 3A54A 2NVTB 4IPGA 2WKCA 2DZJA 4OHJA 3S1QB 3JAMi 2DGYA 3PZ7A 5BN4A 1NR2A 3MEHA 2X38A 4ANUA 1IBKL 2NBFA 2BS4B 4GOPC 2X6LA 3OIPA 5M5XB 4FHJA 1MIUA 4IO9A 1K28A 4IN3A 2WX1A 3T1YQ 2KTRA 3CSFA 4GKKL 3ZDTA 1I6HB 2K6QA 3AEAB 3PLUA 3R7RA 2M2LA 5C3JB 1TWGH 2B8GA 1XMQQ 1ZUD2 1A3TA 3U2SC 2WHIA 4FJVB 2KAJA 1PTOC 2VRRB 3EJIA 1HA5A 2V1CC 2F0UA 2F0VA 4MGKE 5I4DA 4HIKA 3SE0A 2ZCBA 5G2NA 1S3OA 1PRTD 3NHEB 1PGAA 1TVXA 4REZA 2PMVA 2BS2B 5IKCM 5IGFA 2IHFA 1C79A 1SE2A 2SEBD 2UU7A 2WXNA 3BWUD 1BUIC 4W9LA 4YT0B 2YLMA 2DJGC 2EXZA 1NCVA 1PFDA 4DXAB 3PV1A 2F0SA 2DAJA 1Q86C 2JT4B 4ILWA 2A19A 1ISNA 3DWAA 1CSQA 3LXFA 3HOYH 1JCKB 3M9BA 3MXNB 4B08A 1YITA 2J7ZA 1YJ9A 4QIWE 1ILQA 3H0GH 1ASZA 3S1NB 2CHWA 1WH3A 1JWUD 1RTOA 1TIID 2A6EC 4FHKA 1GHKA 1VQLA 3A9JA 1WTOA 1EY8A 4MM3A 3F1ZA 1Q1OA 1UBIA 4AOFA 2QCPX 1HH2P 2KHIA 1PLFA 1GJZA 1A62A 1WFQA 2EQSA 2WLBA 1F1HA 1PGBA 1MJDA 4OZAA 1STAA 4KY7A 4A9AA 5LHY1 1C4CA 2MPMA 1SNOA 3AU4A 4PMWA 3FHWA 1LT3D 1JR0D 4DV2Q 4POFA 2PTLA 1HXYD 1U0LA 2G1EA 5EGTA 4A3EG 3JSVB 3S2DB 5JOBA 4U68A 2UXDQ 2I1JA 4WQOB 4TMAB 2EJGC 3G6JB 1GHJA 3HOYG 3GZNI 3RUIB 1CK1A 3RNGC 3V60A 2JXXA 4NDXA 1K83H 2Y0SG 3DMUA 3M85A 2BPSA 3IT4B 4FXGC 1KAWA 2F0NA 4C3IH 1Y1WG 2JZZA 2KJ6A 3QWNA 3H9DA 2Z6BA 2CU3A 5LXIB 2SOBA 4NZLB 1AP0A 1FVIA 4LF9Q 3FPUB 2B2UA 3L16A 4LF4L 2JVCA 1T0YA 2Y5CA 3R66C 3ZTDA 5C0XH 3OPOA 4HEA1 3ZGZA 4XWTA 1C7YA 1BKBA 4WQMA 4FP5D 5H92C 1VQ8A 3KJOA 4GSWA 1X32A 3RLFA 5BMHA 2UWQA 3Q14C 1E3PA 3DXJC 1SE9A 4RMFA 1FCCC 2N49A 2NVQH 1AE3A 2QKIC 2GBMA 1K0SA 2XBBC 3MC9A 4H0LC 3S1MB 4K5WA 1K8MA 3BYYB 2XTIA 4BY7G 2LGSA 1U9RA 5LMUQ 4XDCA 1E8ZA 1XMQL 1WTWA 2JA5H 1QLBB 5A2QL 2ZVNA 5C4JB 5M5XH 2WACA 1RD9D 1Y56A 3X23A 4GN3B 1SMXA 4LCDE 4G11A 1IUEA 3T1YL 4KN7C 3SVMA 1WGHA 4GDLA 5I2YA 1EOTA 1WYDA 5FJ8G 1VQMA 2NN6G 3EHVA 4JGHB 3M4YA 4N9TA 1XEEA 1YIWA 5E6JA 1BNZA 1WI5A 3UI3A 4ARCA 5E4WC 3URYA 1FRRA 2H89B 3I73A 1WE7A 2YTYA 4WJPA 3HGBA 4WAFA 2PW5A 3RN5A 4BA2I 1C3TA 3T1HL 4OO1H 3OSOA 4MGIE 2UUAL 5JEAJ 1ONLA 1G6ZA 2XIWA 4NP5A 1FD6A 1V1QA 4DV7L 1GD7A 2JE6I 3LYYA 3VUYA 4GGQA 4OL7A 4BY7B 4R4OA 1ET6A 2RDGA 2JY6A 5BYSA 3HK0A 3A55A 3KBGA 4IUTA 2EDGA 4NPNA 3A8KE 3RMKC 1A8VA 3DHQA 3A0JA 4N9PA 1SYDA 3HEJA 3MHSD 4PT5A 4IPHA 4A3MG 2GMIC 1HPCA 2L83A 4WWOA 4XWWA 1SE3A 2BA1A 3NZSA 4JPSA 3GTOH 4IOCA 3NRZA 2FE8A 2RF4A 2IX3A 4DV1L 4KKSA 1E90A 2KDFB 4M8NA 4RCOA 4N59A 1Z2MA 3D32A 2F0JA 1EUJA 3J7A5 4L6TB 1J5EQ 3IFDA 5G3LF 1QZEA 5E6NA 1R4PB 1WYGA 4GLSC 1UEBA 2WDQB 3VVWB 1ZXTA 3W3AA 1EEFD 4HPLB 4L5TA 3U4VA 3DHHC 1H9JA 2GBNA 4X65L 3Q8FA 2Q8RE 1W2BA 2CS4A 4OELB 5HG2A 2R7ZB 3V05A 1PHJA 2ZCCA 1WTQA 2GA4B 2EYPA 5M5YH 1SFOB 1LV9A 2WFWA 3BK1A 2VQEQ 3ITPA 1P0RA 5I9OA 4JBMA 4W9DA 4OVZA 3K5LA 2JXMB 4HKZE 4X62L 2K52A 2WDRB 1PH1A 2B2VA 2LGYA 1CQFA 1M8AA 1VQJA 2EJFC 1TWFB 1RJTA 4A3FH 1J5EL 2R2QA 1HZ5A 3L08A 5AZGA 5GXGB 2B2WC 3RD2A 5JZEB 2IY1B 4DGZA 3NVWA 3CCRA 1EY9A 1EIFA 1SMYD 3I56A 2KC2A 2K5QA 5D65A 3IXSA 1B9MA 2I38A 3J81j 1EY7A 3RI7C 1ICFB 3E6ZX 1JRPA 2JK8A 2GI9A 4L23A 4R8IA 1MG4A 2D3BA 5CHVC 3GTOB 4RF1A 2K25A 3CCMA 3CD6A 1R4MB 4JC0A 4Y7NB 1NBFC 1ZGUB 3BIID 3UINB 1Q46A 1QKZA 4J1MA 4ME5A 2R7ZG 3I3TB 5L83A 1PFBA 3PO3G 2V0GA 1S5BD 4JBJA 1PTOH 1UWMA 2KWDA 2EPBA 4A8XC 2MH7A 2F0EA 1V9JA 1AARA 2DYOA 3HM3A 3DHIC 2MJ8A 4D2KA 5F2DA 3T56B 4ZUIA 1J0GA 2FCQA 4LMQD 1LT4D 3K5NA 1X9NA 1YJNA 2BKRB 4XQQA 2HJ1A 2CKHB 3CCQA 2L05A 4FDBA 4ZRKA 2DNFA 3CPWA 1STHA 2GBRA 3M63B 4CDFC 3FMCA 1STGA 5HGTA 3AU5A 4X66Q 1ENFA 1XPUA 2MBHA 4MJSB 2RHSB 3HOXG 1DJRD 2BOSA 3AEVA 4K8IA 1IBKQ 2REXA 2CFMA 4TKOB 5IP4D 5C4ZA 4C3JG 3WAPA 4BKSA 2RDHA 2KQ4X 1TTNA 3WIMA 3SGIA 3ZXRA 2FBWB 2ACZB 4MH8A 1A3VA 4GOPA 2F1MA 1KAAA 2MJDA 2ASQA 3QWZB 3MZ5A 2O4XA 4DWFA 5EE9A 1U4MA 2QW7A 4GNXB 2Y5PA 3L2PA 3TMPB 3ND9A 1X1MA 2J0MA 3RNFC 1CUKA 4MACA 4A3JH 1TBEA 2K9XA 4J15A 1QWYA 1FCLA 4DXFA 2JXTA 5LMNW 4BY1B 2VY3A 3PMFA 1SSNA 2XWBB 1FNUA 4P71A 4ZRZA 1C8CA 3RT3B 4DN4M 4C2MB 4J6HA 3SK5A 3HOUH 2CHXA 4KDIC 1SJED 3T3OA 3SFEB 1KRTA 3SEBA 2DENB 3TIXA 1V9PA 1L7YA 3HM6X 4ICUA 4N9F4 1VQ6A 3V6EB 1D2BA 1V8QA 1KLUD 3DDCB 2MBBB 2DJFC 4B9WA 1OXTA 2FMMA 3VUWA 1HUMA 1PYWD 1SNDA 2MO0A 3VA7A 3NXWA 1VF5C 1FXTB 1O78A 4DR4Q 2HIXA 2FUHB 1JJ2A 3K9OB 2RPVA 4YSZB 1UBQA 2UXDL 4LAAA 4RKLA 1K51A 4FBJB 2WXRA 3K7UC 5IE8A 1B53A 1WR1A 1O80A 4DV2L 1TWCH 3Q6BA 3LX0A 1LTBD 1RDPD 2H1EA 4C80A 4W9EA 1Q7YC 4JV5L 2Z9HA 3RYTA 3NTKA 2FIFA 3U8ZA 1Y8OB 3VR9B 1JWAD 4H44C 4BY1G 5IOCA 2L15A 3MXNA 2WYQA 1JALA 3PUWA 5C44H 2LI5A 2QA4A 1G8ZD 1KNAA 4PV1C 2B8FA 3N6RA 1D3ZA 3A9JB 1BCPD 4MM3B 3VDYA 3CC2A 1EY0A 4BXXH 2WDVB 1RCVD 3WAOA 1D5MC 4JG2A 2ZNVB 3TUOA 2Q2TA 2BKFA 1XPRA 5CTRC 1H4RA 2LHDA 3H94A 1TZOA 1AFPA 3EIVA 4DR4L 5FLMG 4HVBA 1VQEA 1H9MA 1V1OA 1XWEA 4LNOA 4A75A 3W9CB 2E2JH 1CSPA 2CR5A 4OZBA 1ZDXA 2R2OA 2KACA 4A76A 4ARIA 2MRPA 3H3VC 3HOVB 1L4ZB 3DBRI 4HSPA 5BMIA 4EQNA 3PRMB 1UELA 4EE2A 1HTQA 3HOVH 5CYUA 3S16H 4A3BG 1G2TA 5BYQA 1KHIA 2VB3X 3VYUA 1WRIA 4BBNC 3GTMB 2IY0B 3FPPA 3L3OC 1XNQL 4DPGA 2OCEA 5C3EG 1PH6A 3P63A 1Q8KA 3TQYA 3U4ZA 2I5HA 4R4IA 4HJ5A 1R4MI 1WJ6A 4RNAA 3H15A 1Q3LA 3BU2A 5E1FA 5IP7H 3D4WA 1HHVA 2RGFA 1EY4A 1U4AA 1ZKHA 1SMYC 3WAMA 4NKLA 1Z5SB 1Y1VG 3RD4A 2JA7G 3IFWB 5BMGA 2BWES 1F9PA 1T0RC 2EIFA 2BF8B 4XX5A 5DLQE 3M4PA 4HCPB 1SNQA 3J80E 4LTUA 4A93G 3KVFB 4PMBA 3J80c 1JWMD 4LFAL 2BYEA 3PZDA 2GN5A 4EGVA 1IW7C 2WXIA 2BH8A 4II3B 4OVUA 1SRUA 1JRUA 1NY4A 3CXCA 5I9PA 2LSSA 2O5JC 2QSDA 4B0MA 2XRQD 3NUCA 1SN8A 4MGYE 1L5PA 3LNNA 1SDFA 3P42A 2VZKD 2GLSA 3AQQA 1EZ8A 4IPCA 3SDLC 1MHXA 3FDTA 4YTNB 1KDBA 4RHRA 1V5TA 4X6AH 3BY4B 4GB9A 3VQIA 2C7HA 1IBXB 3PZ8A 4RA8A 4AUQC 1CKOA 1TT2A 2PQAA 5J1ZA 3ONSA 2KA7A 2F3WA 2JA6G 2L1AA 2M1MA 4IDIA 2WV6D 4DAYB 4DA2A 3T16A 1EU4A 3CSTA 3DLLA 1BF4A 4CDCC 1SAPA 2NZHA 3DVNV 1DOYA 2G5DA 4MSMB 4WWMA 1VQAA 5BYRA 5I6YA 1EY5A 3ERQA 4O1NA 2ZT9C 4XXEA 4AIMA 4XYOA 4IQZA 4C3HG 3K0YA 3HKSA 2BQQA 2L8JA 3CCSA 1TWFH 3KF6B 4P1BC 4G50A 3GTGH 3I9V1 1W6KA 4HMIA 5K5PA 4KJOA 3VR3A 1IYVA 1QT9A 4H13C 1IBMQ 2F03A 3IAM1 3GTGB 4HCNB 1PH3A 2KECA 3W1SC 3FKIG 2C60A 2B39A 4KY5A 1Q1EA 1N36L 1Q1BA 1AEXA 4HLEA 2O2LD 2K22A 2HHHL 4CGYB 2ZPNA 2A1AA 2WXMA 2JA6B 1F2RC 1XLQA 1NUCA 1N32Q 3P20A 2IPKD 1ACCA 1N62A 3KF8A 4EQOA 1VQFA 5CV5A 2NN6I 2YU9B 5C4XB 2MEKA 2Z0DB 4MEMA 4PS7A 1HNZQ 5AUKA 1EEID 3CRLC 4EVOA 1PXUA 4X65Q 2F0KA 2VUMB 1YN4A 3L13A 1VQHA 5GMVA 4DV4L 1NDDA 4DR3L 3VR2A 1Z47A 1F9SA 2BCOA 3K6OA 3A4RA 3DQVA 2M17A 3DOWA 3H8HA 4B9KA 2N0SB 3KWLA 2NTTA 2WAQE 4HCSA 1C0AA 1IGDA 1NMFA 3Q23A 3NTIA 1MKHA 3D8GA 3S9WA 3D4DA 5GROA 3AMUA 1RFAA 3HUIA 4LJOB 2G3QB 2VH2A 1QNUA 2MJ3A 4GMVA 3V61A 2E8GA 1F2ZA 4C7YA 3ALBA 2L32A 1RWSA 4LUZA 5KNCA 1Z6HA 2PMZE 2HD5B 4L5RC 3NPPA 1WTXA 3F2CA 1X3EA 1Q81C 4EZJA 1GKHA 1MSGA 2JA6H 1BBWA 5C4HA 3QC8B 3PUVA 4K8JA 1A15A 2LMCB 4GN4B 4LFAQ 2A6HD 3X3MA 3I90A 3R2IA 2DAFA 1TWCB 4DHJD 1SNPA 4MGZE 1VQ5A 3JC66 5FO9B 2UU9L 2BA0A 1HQRD 5IGGA 3ZJYC 1WGRA 3CWIA 4WJ4A 1KH0A 1HRJA 2KEEA 2LHEA 3CP0A 2LEKA 1SYGA 3AB5A 4F8CB 1S5CD 4HDOA 1IYJB 4HWIB 3CPFA 4LFBL 2W54A 3PHXB 3W1BA 3S2DH 1TY0A 3H09A 2KKCA 2CWAA 2E2DC 4XDDA 3P1MA 3WWVA 1AWDA 3JAMc 2KWCA 3NP8A 1B2TA 2LJ5A 4M1UB 4JI2L 3MAQA 3PT2B 4JQWC 1M1KC 2O2VB 1EFWA 3OAWA 3NQIA 4QGUA 2JEAI 3TS0A 2J42A 3OWFA 4OIJA 2NMQA 1ZXHA 2KVZA 3HVZA 4I6LB 2RCNA 5C0XJ 2AYOB 2F0IA 4A3JB 3LB8C 5C3EH 4K0KQ 1KRHA 2DLBA 3IHPC 2EY2A 2OQKA 3HOZG 4K5XA 2KCTA 3AE7B 3BJUA 1IPGA 2X6GA 2RPQA 4L1BA 5FR6A 2I2YA 1YIJA 2N9PC 2EYHA 1A2UA 4L2YA 2ZTDA 3TJPA 2K04A 1HCZA 2HDLA 3EFXD 3DM3A 1LT5D 2CVRA 2ZPYA 3RFZB 1GM5A 5IY0A 4UY8C 4YSYB 3I55A 4PG3A 3HOWH 3TL5A 1XCQL 1WYWB 1ML0D 1AZPA 1PZID 4JI0L 3IRBA 2HJ8A 2WAQB 4LW1A 1LXDA 3ENEA 4HDQA 4HXDA 3WANA 1S5FD 3PIOA 2ZJQA 1TKYA 4K6LA 2LGIA 2KFKA 2AQ2B 4IWOA 3A74A 4GNXA 4DK6C 5G3LD 3TBIB 2K5WA 3M7NA 1YX6B 2MNAA 3BS1A 3TREA 4BXXG 4F87A 3OIQA 3EFCA 1A2TA 3VUXA 4CHTB 2E2IB 5BR8L 2A6ED 2KD0A 2Z59B 4AWJA 3ABVB 4TQ1A 3PV0A 1NYQA 2SDFA 4C2MH 1I6VC 5C44G 1I94L 2J0KA 3QO2A 1LACA 3S16B 4AQYL 3SR6A 4U673 3HFZB 2I0QA 4W9KA 1PYSB 3DWPA 1T9HA 3SXHA 3BK2A 1CFMA 4I6PA 4ACFA 3CC4A 3IG3A 1HE8A
chains in the Genus database with same CATH topology
2JA5B 3K5MA 5C3XA 4BWGB 4HKQA 2FMCA 2WXJA 2V3NA 1TKWB 2IW3A 1PTOD 5ELBA 3VR4A 1DM0B 1ZYRC 3NWSA 4ZRQA 1V43A 5HHDG 2O5IC 3Q6SA 1EQTA 4CJ0B 3PIO3 2DWQA 1SYEA 4ZHOA 5C44B 2A68D 5D7GA 1PDQA 4KD3A 4US9A 4MN3A 3LWEA 2K28A 2KOLA 2ZW0A 3FILA 4YWGG 2CJOA 3WCQA 1OXUA 4C3IB 1TKEA 4X3TA 4YTPB 3ZQ4A 1RHPA 2W82A 4QIWB 4UAIA 3KLSA 4KY6A 3TZUA 4RAUC 3T51B 1ZP0B 1D6EC 4HJGE 4KJNA 4KK7A 1TS4A 1FIQA 5EBCA 2KHSA 3NBHA 5D14A 2JYTA 4WJWA 1E0BA 1C4PA 2F0HA 4IZ8A 3J81E 1VMPA 2PW9A 1K53A 2C9OA 4CJ1B 1UNSA 1C76A 3PIP3 2D5DA 1WTRA 5C5LA 1BCPF 2B2TC 5JVH3 1WCMB 2FHTA 3V2TA 4Q2JA 2IL8A 2OF1A 4A3FB 5ELCA 2EYFA 4P2CB 3AEEB 4HRSA 3J81L 1PZJD 1UAPA 1WSPA 1RM6C 2NYZD 1HZ6A 3DWGC 2WB1B 4XTCS 4FXDA 3W1SA 3R3OA 3I3CA 4DK1A 3TSSA 1PFMA 3GV6A 3MXPA 1J7BA 5JAVA 4IOIE 4XE0A 3AECB 1B1ZA 5JEAH 1EYDA 1I3QB 1PFNA 2I46A 4R9WA 3T53B 1TKGA 1II3A 1B44D 2XSCA 3A8IE 1VLBA 2KCNA 3AE8B 3K7AB 2F0MA 4DNTB 1ZE3D 3NUHB 1S5ED 3R93A 3C46A 1BO0A 2K33A 4K6DA 4DNRB 1R4QB 4KHZA 1Z7TA 5K36H 2K03A 2FUG1 4KKIA 3IAYA 4C56C 5LL6X 2HDEA 1CA5A 4C1NK 2EY1A 1FMAD 4YIJA 3D6WA 1WD1A 3H0GB 2VXWA 1I4HA 4OGQC 3VYRA 1EU3A 1T5XD 5D3IB 2WXGA 3R2TA 3CIRB 3DM1A 2B2UC 1WGKA 3SK4A 1J7CA 1AYFA 5CV4A 1YNJC 1QB5D 5EBDA 2RVLA 1QOAA 4J3OD 5BN5A 1UUPA 1HTPA 1XTCD 1CJEA 4RFBA 1JORA 1L0YB 1CM9A 3HOXB 1G2SA 3B9JA 1ZYRD 5CV9A 2HCIA 4KI0A 1ILPA 3P4PB 2BB6A 2KQ3A 5KYIA 4AYBB 2WXKA 3N9YC 1FGBD 1P7EA 1SSOA 2WKDA 3ZJUA 2KN4A 2EOTA 1MI0A 3L4PA 2JU6X 3VRBB 1BXTA 3GTJB 5E3FA 3EROA 5D3DA 5I6WA 3P4RB 2B2WA 2BYTA 1SYBA 2ICEC 3FC4A 1DONA 2AWNA 2KJXA 3OMGA 1U4RA 4KTAA 5KGUA 4CQNA 2IT1A 1Q10A 4A93B 4ZQ3A 4XT3B 1N61A 1ENAA 1QJOA 2V4DA 2K5PA 1LTTD 4KKUA 3GTQB 2WXOA 1DZ1A 1E2ZA 2K32A 2RSNA 2LY7A 2E2HB 3BVMA 5IGBA 2R93B 3S17B 4ULLA 1GUOA 4DXGA 5IGCA 1Q8IA 4G4KA 1YN5A 2N55A 1DYQA 2EYJA 1QG7A 1LTGD 1QQRA 1T5EA 4FVMA 1IKMA 3GTPB 1KDCA 5ELEA 1LTSD 4XIGS 1SYFA 3NHHA 2SNMA 4RGNA 1EM7A 3TEYA 2R92B 4A3BB 3TP8A 2WQYB 4G7OC 5C3EB 2L11A 2A6HC 2HDMA 3MFGA 1YQ3B 1OXXK 4B9XA 5EPJA 4EQPA 2Z4HA 3L7ZC 5COYA 3BDOA 3C1EA 1V1PB 2EELA 3NBIA 1FM0D 5EQ0A 1SEBD 1EY6A 5G5HA 2KUMA 1NSNS 2SNSA 3RMHA 2WXFA 3J9CA 1I4XA 3K57A 3SK6A 4ZK9B 1QOFA 1CQVA 1K52A 5G5GA 4JE3B 4FF3A 5KIXA 2ZXPA 1SIJA 5C6AA 1SB3C 2L12A 2NB0A 2RKSA 2LUMA 5MPOA 4I65A 1G91A 2L55A 4XT1B 3Q8BA 1HFGA 4OW0A 3VYSA 3AB9A 2E75C 1FXIA 5JEAG 3OMCA 1DD2A 3B2GA 4C3HB 4LLGM 1CI3M 2L9HA 4Z9CB 3HRDD 3R8BA 4Q0FA 1R7SA 1TJEA 1C9FA 3FKIB 1CZWA 2IGDA 4FNFA 1QOGA 1MGSA 3BZDB 1T6BX 1S4ZA 3I8ZA 2NZ1D 2F0FA 1E2VA 4QUFA 3QIAA 1KF6B 4IUUA 3IAS1 3GD7A 1SJHD 1XF5L 4YTMB 4LJZC 1N60A 1H9RA 1ZDVA 3PUXA 1IL8A 5EJWA 2VZKB 2BDOA 1GUTA 5KRUA 2A68C 3CRKC 2N9KA 1F2LA 5HFYA 5C5MA 5IODA 1E7PB 4JWUC 1LTRD 3T13A 4TRDA 2L0CA 3PO0A 3P4QB 1RFKA 2ONQA 4YXDB 2WXQA 5DM73 4ZLTF 3FAHA 5FLXE 3VR6A 2Y3AA 4RWSC 2RBMA 3HOYB 2Y0SB 1CTMA 1EL0A 1VF7A 2PKOA 3TEXA 3VYTA 4RGMA 1GUWA 1VZ6A 2HUGA 2QILA 3KQ4A 1F2MA 2WS3B 5KYLA 5EKIA 3AE1B 4RF0A 1KFYB 4ID6A 4KHVA 3Q69A 1DOIA 1LTID 2JSOA 1F0ZA 1UWXA 1PGXA 2JQRB 4RH6A 4NJCA 2NTSA 5CORA 3N52A 3OWEB 1YN3A 4P6VF 3WDNA 1VDZA 2A5HA 2IX1A 3CKIB 3KUPA 4HTHA 4QUCA 4O42A 1VJKA 2EYOA 2F4IA 1SXTA 3HP3A 4M0WA 2NVYB 2W55A 4M8AA 3P4SB 1QCBD 3A8JE 1I4RA 3HOWB 1RYJA 1TYGB 1QF6A 1XXGA 1L6VA 3ZYYX 4AQ7A 3F2UA 1FFUA 3SK8A 3K58A 3HS0C 2ZXOA 5IT9L 4CKBA 4X3UA 2J52A 4A3MB 5FK9C 4DF7A 4CKCA 2PQEA 3SHLA 4IURA 2GRIA 3SDZA 3M3YB 4B0EA 1D4BA 3ND8A 4MT5A 1X3PA 2L4NA 1JROA 1OFFA 5TSSA 2Q5WD 5DM63 5LNK1 3MP9A 1MD2D 2DY8A 3HVDA 4DFAA 2E76C 2CW0C 4NW2A 3U52E 4IUQA 3AE4B 2WXLA 2PCFB 2JWUA 3J80L 1B3AA 1JOKA 4WURA 4KX6B 3U4EG 2K5DA 1HQMC 3MC0B 1A6XA 2L5TA 3TDQA 3I4LA 4BBSB 1GB1A 2J0TD 1LO5D 3AV8A 4USAA 1DXMA 1YJIA 2DNCA 3PO3B 4A6QA 2Q8IB 5IGEA 4MHEA 4RKBA 4PQXA 4DAYA 4OZCA 3V3XA 3QJYA 1FXAA 1PZKD 3JAML 4FF4A 1WVLA 1VRAB 3IKJA 2B2YA 4KGSA 2F0PA 1FNWA 1JMLA 2K3UA 3EQLC 3TZDA 3WOFA 1FD7D 3TEWA 3EVQA 4X3SA 5JXVA 1GJXA 3GTKB 1TWAB 5T1IA 3B2FA 2JZPA 1K83B 2RQXA 3P7JA 2V3PA 4ZYSA 3H91A 3JAME 3I4NB 2R61A 2D5GA 2XNAC 2K7VA 5KEEA 2M56B 1TR5A 2Z1CA 1JW9D 3DEOA 5KNBA 3V96A 1K50A 4HMJA 3E0JA 3DWQA 1JICA 4DAPA 4KGRA 3KLSX 4IUPA 4WFN3 3BG3A 3D31A 2C5CA 2B2YC 5FR3A 1STEA 4JK1C 2DN8A 1BCPC 1JOOA 4GZYC 2PIAA 1D5ZC 4HAEA 4H2AA 1ICWA 5EE3A 3BYTB 3Q8EA 3C8YA 1VCIA 1CZGA 5EKKA 5JPNC 5M9OA 1NI3A 2L52A 2EKIA 1H9SA 3NQTA 4ZKBB 3AEDB 3IFTA 4FXKC 1MSHA 1IKLA 5A2QE 3Q24A 3CU7A 3KBXA 3NZ3A 2PLPA 1V8CA 3NVVA 1DOKA 2B2VC 3C1FA 5EPLA 3DUZA 1SYCA 3SFDB 1VZ8A 4K2KA 3X3NA 2F0GA 5FO8B 1N5XA 3MVVA 1DOMA 3OHXC 2B2TA 3OW7A 3I70A 1EWYC 3VR5A 1VZ7A 1SNMA 2IDYA 2KEDA 4TSSA 5CMDA 1HEZE 3W5UB 2WU2B 3C2PA 5A35A 3GS2A 3UI2A 3MJ5A 1AZQA 4KKTA 3AE9B 2BW2A 4FF2A 1ZEQX 2RDFA 1XLOA 2M00A 2JA7B 2D9UA 3P1HA 3CQZB 3S2HB 3EA6A 2EY6A 2TSSA 2IGHA 2E3TA 3EGRA 1UEAB 2E6XA 2DYMA 4IFDG 2PW7A 2A69C 1LABA 3AM9A 3IT6B 1XYIA 4E6IA 5HI1A 1EIHA 1QNKA 5DNFA 2A73B 4QB4A 1YQ4B 2D62A 3HRZC 1WD0A 2F0TA 2JSVX 3AEGB 5IIFA 1RKNA 2OEDA 1PRTF 2CJNA 1B4OA 4CBVA 1J9OA 5K36G 2PVGC 2Q8TA 5CR3A 2M0AA 2EYMA 5NUCA 2EYLA 2CQAA 4WH4A 4XYQA 3TMEA 3AN1A 3BDLA 2AUJD 3G7LA 4H7BA 1BMLC 2XVSA 5JJZA 2K0PA 4C7ZA 2F0OA 1JOQA 1TS2A 2BE5D 5IT9E 2AX5A 2DY7A 2XN9C 2N9LA 5BN3A 1I50B 3NVYA 2VNUD 4IUVA 5T8IA 1AN8A 2ZW1A 1FNVA 1PRTB 2BDNA 4ZHPA 1GUSA 1B9RA 1GUNA 1EWHA 1EYAA 2PYKA 1HTLD 2JEBI 4A3GB 4WORA 3HG9A 3NE5B 2BTEA 5FO7B 4K5VA 1JWBD 5AUIA 3K5OA 1YNND 2WXHA 1F2YA 4ZRPA 3NK9A 1TY2A 2PZTA 3D6CA 1I4GA 3J7AF 1E6EB 2QDBA 2K1BA 1L0XB 3SR1A 4N58A 4V190 4ZUJA 2VB2X 2FJ2A 5KNDA 2J53A 1IYUA 1NYRA 4RGOS 1C48A 5EKLA 3VA5A 4A3KB 2CW0D 2INNE 5CV7A 1Y8PB 1WTVA 2QJLA 4HROA 1A3UA 1XX8A 1JC7A 2WP9B 1SNCA 1BDOA 1TWHB 2K05A 3O13A 2MJEA 3MXGA 1RODA 5HURA 1ZKOA 4F7XA 1N5WA 3TEZA 4K14A 4ZOHC 2SAKA 1TS3A 3A56A 3GP7A 1MPEA 2G9HD 4J8QA 3AE2B 1W6JA 1NAPA 1NR4A 1PUTA 1A70A 4OIKA 1KDAA 1M4VA 1EQVA 1LT6D 1G291 3Q0AA 2RA4A 1EIGA 4YSXB 5M5YB 5CV8A 4US8A 2OXPA 4NAMA 1K8OA 4DK0A 1GAQB 1R9TB 3QB3A 2FINB 1P7FA 2PPBC 4OO1G 1FFVA 3Q22A 1WTPA 2WP8J 4JWSC 1ZOYB 1QE6A 2J4XA 5JVG3 4A3EB 4G57A 3AMZA 2NN6H 4V0BA 1V1PA 3TN2A 2F0QA 4IFDH 2A69D 1CHQD 5DEHA 3U9OA 5ELFA 1U4PA 2IX0A 1S5DD 2OT2A 3E56A 3MTSA 3CHBD 5EPKA 2F0LA 2BB5A 4NMZA 3NVZA 1GXDC 1RF2D 1AW7A 4F8MA 1BR9A 1VR9A 1OO9B 5C0XG 3HOZB 5IGDA 1EZ6A 2QIEB 2TMPA 5M3FB 1OQQA 1PMRA 3GB1A 1I7HA 5CBAE 4C3IG 2FFKB 4C1NI 3BVZA 3AE6B 1TS5A 4MIUA 4G7HC 4KGTA 2ID0A 5CC4A 4FYDA 1GB4A 1FEHA 1DGJA 1PRTC 5J39A 1B50A 1C4AA 1L6UA 2HCCA 4FF1A 1MVKA 2RMMA 1LLRD 3WOEA 3ETRA 2M9VA 3J7AV 4JX1C 1FRDA 1C77A 4L63B 2AQ1B 1V97A 2A74C 1E2WA 2KMMA 2NWGA 1YNJD 2HQEA 1CA6A 3GTLB 1HFNA 1Y1WB 4PMCA 3PUYA 1JB3A 5ISRA 1Y69U 1DCZA 3OOCA 2MHVA 1I4QA 1TWGB 4XQNA 3RPFC 1O7LA 1HA6A 1ROEA 1SF0A 2BS3B 1XO3A 3I57A 2MUYA 5JPMC 4IKGA 4ZAIA 3RZDB 1OXSC 3U9SA 4OO1I 4IUNA 1F9RA 4R3DA 5J22A 3KWVA 2R6GA 1VMCA 1QILA 2PZUA 2JYEA 2WNMA 1WWTA 2K01A 1H9KA 1TQOA 4FXCA 1BOSA 1F9QA 4IFDI 3HZXA 5T1GA 5H8YE 4TQ0A 3MFYA 2YYZA 4KKJA 1DOXA 2M19A 5FKAC 3A7LA 2ENBA 1D1IA 2OEOA 2R3ZA 1YNTE 3FVQA 5FOBB 3DWMA 5CGKA 1DOLA 4HEDA 2IJ0A 3GV3A 4PNYA 1MI2A 1YJJA 1SE4A 3RZOB 4N6EB 4ITKA 4NAWB 1JE4A 1D5XC 3Q8AA 2BBCA 1O7ZA 2KDMA 3MHZA 1BBXC 4BA1I 1XLNA 1CHPD 1L4DB 5DAUA 5M3MB 1KTKA 1PTOF 3J7YW 3T4AC 4TQUS 2PVOD 1FYCA 2YEPF 2ZXRA 5C2TB 2WXPA 2NUCA 4BBRB 3H6MA 1GPXA 2BE5C 4AS1A 4CJ2C 5LL6S 2W3SA 4KV6A 2AWOA 2B76B 2JX5A 2AQ3B 4IALA 2INPE 3QOLA 4CKEA 2PZWA 2JA8B 1IW7D 2QEJC 1EYCA 3I91A 2E2JB 3ZJVA 2LKVA 1U4LA 1E9MA 4RGTA 4Q5VA 1STBA 2AUKA 4A3IB 1NENB 1JQ4A 1ZPSA 3FILB 1H9SB 2JYOA 2BT6A 1KABA 4A3DB 1IHZA 4L8JA 4P16A 1BCPB 3E5SA 3AU7A 3NTHA 2HTME 1O7YA 1GOZA 3NS1A 1J7AA 2XWJB 1GUGA 2K6AA 4QMGA 3M7GA 2F0DA 3MWYW 3GO5A 3P75A 3NWTA 3ONAB 3S14B 1XCTL 3AEFB 3BVGA 2KCCA 4DQOC 3PUZA 3C3LA 2PMZB 1ET9A 2RSOA 2LS01 1STNA 4I7ZC 1T3QA 5EE0A 1KNEA 1SBBB 1UGJA 3MA2B 1ESFA 1MBYA 1QOBA 1STYA 4C3JB 3DEPA 1NEKB 4F88A 1ESRA 3D4RA 1N63A 1Y8NB 3MHBA 2N88A 2Z4IA 4KN4C 5AFWA 5CV6A 3D3RA 4ODGA 2LFNA 2EY5A 1CT1D 2EE1A 3TP6A 2QMTA 1YMHE 4XDXA 4HCEA 5EE1A 1OXVA 2D2CC 2E74C 1JWSD 1HUNA 1Y1VB 2QF7A 3QOJA 4HSVA 2V4IB 1BUVT 1QOHA 1B9NA 1KLGD 3HOUB 4LK0M 3A7AB 4LK1C 2DBYA 4GDKB 4A55A 4QCLA 3K59A 2YEPB 4GDLB 3AE5B 3I4MB 3S15B 2JP1A 1C78A 2B63B 2F0WA 3KK7A 2W3RA 2CHBD 1EWCA 4FO2A 2I07B 5FLXL 3VRAB 2WIIB 3RUZA 4QF4A 2MGSA 3T3NA 3NSWA 2H88B 5CBEE 4RCNA 2WINB 1F2RI 4JBWA 1PDXA 4A90A 1NVID 1FR3A 2DNEA 5C3WA 2F3VA 2LJIA 1X3QA 5C0XI 1VDVA 2L1BA 3QG1A 1LTAD 3TP5A 3MXUA 4R8NA 2EJMA 4G7ZC 1L0VB 4DU9A 3VR8B 3EUB2 3FEWX 1J8IA 2XRSD 4S3SA 4DAVA 3E9SA 2KVMA 2LMCA 1F77A 5ELDA 4WIPA 1TU2B 4HN7A 4KD4A 2ON8A 3I72A 1IBXA 3L9AX 1XLPA 4KMUC 4RHSA 5E4XA 3W2DA 1MHHE 2IWHA 1C4QA 2PO4A 3U7ZA 4ABNA 2IGGA 3GQBA 2ICIA 1EFID 3AH7A 3M4OB 3LWUA 3S1RB 1CZPA 1YNNC 4BS9A 3IL8A 2N7JA 4HR7B 2MP1A 2G9DA 3Q8CA 2X69A 5M5WB 4XQJA 2Z8LA 1RTNA 1JQYD 5I2XA 2H4OA 1E10A 2PNRC 2NVXB 1I4PA 1ENCA 3AE3B 1BQQT 4X3KA 3PO2B 3KLRA 1IGCA 1D1KA 4ZKCB 2NVQB 3BDCA 3HKZB 1PTOB 1OQRA 4IFDJ 1FO4A 2GB1A 1WXQA 3ZJTA 2OHFA 2EZVA 2LFIA 4K2LA 1ZXIA 2WU5B 4WRDA 2EVBA 3FRPB 1Q12A 3TP7A 1Q90A 3AEBB 3W5VB 4UDUC 3A54A 2NVTB 2WKCA 4OHJA 3S1QB 3PZ7A 5BN4A 1NR2A 3MEHA 2X38A 2NBFA 2BS4B 2X6LA 3OIPA 5M5XB 4IN3A 1I6HB 3AEAB 2M2LA 5C3JB 2B8GA 1ZUD2 1A3TA 3U2SC 2KAJA 1PTOC 3EJIA 1HA5A 2F0UA 2F0VA 5I4DA 3SE0A 1PRTD 4REZA 1PGAA 1TVXA 2PMVA 2BS2B 5IGFA 1C79A 1SE2A 2SEBD 2WXNA 3BWUD 1BUIC 4YT0B 2EXZA 1NCVA 1PFDA 2F0SA 4ILWA 3DWAA 3LXFA 1JCKB 4B08A 2J7ZA 1ILQA 3S1NB 1JWUD 1RTOA 1TIID 2A6EC 1GHKA 1WTOA 1EY8A 2QCPX 1PLFA 2WLBA 1PGBA 4A9AA 4OZAA 1STAA 4KY7A 5LHY1 1C4CA 2MPMA 1SNOA 4PMWA 2PTLA 1LT3D 1JR0D 1HXYD 2G1EA 5EGTA 3S2DB 5JOBA 4U68A 4TMAB 2EJGC 3G6JB 1GHJA 1CK1A 4NDXA 3DMUA 3M85A 3IT4B 4FXGC 2F0NA 3QWNA 2CU3A 2SOBA 4NZLB 1AP0A 3FPUB 2B2UA 2Y5CA 5C0XH 3OPOA 4HEA1 3ZGZA 4XWTA 4WQMA 4FP5D 5H92C 5BMHA 1X32A 3RLFA 3DXJC 1FCCC 2QKIC 4H0LC 3S1MB 4K5WA 1K8MA 3BYYB 1U9RA 4XDCA 1WTWA 1QLBB 5A2QL 5C4JB 2WACA 1RD9D 1Y56A 1IUEA 4KN7C 3SVMA 5I2YA 1EOTA 2NN6G 3M4YA 4N9TA 1XEEA 5E6JA 1BNZA 3UI3A 4ARCA 5E4WC 3URYA 1FRRA 2H89B 3I73A 4WAFA 3HGBA 2PW5A 4BA2I 4OO1H 3OSOA 5JEAJ 1ONLA 1G6ZA 2XIWA 4NP5A 1FD6A 2JE6I 3LYYA 4OL7A 4BY7B 1ET6A 2RDGA 5BYSA 3A55A 3KBGA 4IUTA 2EDGA 3A8KE 3DHQA 4N9PA 1SYDA 3HEJA 4PT5A 2L83A 1HPCA 4XWWA 1SE3A 2BA1A 4JPSA 3NRZA 2FE8A 2IX3A 4KKSA 4N59A 4RCOA 2F0JA 4L6TB 3IFDA 5G3LF 1R4PB 1WYGA 4GLSC 2WDQB 1ZXTA 3W3AA 1EEFD 1H9JA 3Q8FA 2Q8RE 5HG2A 2R7ZB 3V05A 1WTQA 2GA4B 2EYPA 1SFOB 1LV9A 3BK1A 3ITPA 5I9OA 4OVZA 3K5LA 2JXMB 4HKZE 2WDRB 2B2VA 1CQFA 1M8AA 2EJFC 1TWFB 1RJTA 1HZ5A 5GXGB 2B2WC 4DGZA 3NVWA 1EY9A 1SMYD 2K5QA 5D65A 3IXSA 1B9MA 2I38A 1EY7A 3E6ZX 1JRPA 4L23A 2GI9A 4R8IA 3GTOB 4RF1A 4Y7NB 3BIID 1QKZA 4J1MA 4ME5A 2V0GA 1PFBA 1S5BD 2KWDA 1PTOH 1UWMA 2EPBA 4A8XC 2MH7A 2F0EA 2DYOA 2MJ8A 4D2KA 5F2DA 3T56B 4ZUIA 4LMQD 1LT4D 3K5NA 4XQQA 1STHA 3FMCA 1STGA 5HGTA 1ENFA 1DJRD 2BOSA 4K8IA 4TKOB 5C4ZA 4C3JG 2RDHA 2KQ4X 2FBWB 2ACZB 4MH8A 1A3VA 2F1MA 1KAAA 2MJDA 3MZ5A 2O4XA 5EE9A 1U4MA 2Y5PA 3ND9A 4MACA 1FCLA 2K9XA 1QWYA 4DXFA 2JXTA 4BY1B 3PMFA 1SSNA 2XWBB 1FNUA 4ZRZA 1C8CA 4DN4M 4C2MB 4J6HA 3SK5A 1SJED 3T3OA 3SFEB 3SEBA 1D2BA 1V8QA 1KLUD 4B9WA 1OXTA 2FMMA 1HUMA 1PYWD 1SNDA 3VA7A 3NXWA 1VF5C 1O78A 2RPVA 4YSZB 4LAAA 4RKLA 1K51A 2WXRA 1B53A 1O80A 4C80A 3LX0A 1LTBD 1RDPD 2H1EA 3NTKA 3VR9B 1Y8OB 1JWAD 4H44C 5IOCA 3MXNA 1JALA 3PUWA 1G8ZD 1KNAA 4PV1C 2B8FA 3N6RA 4MM3B 1BCPD 1EY0A 2WDVB 1RCVD 1D5MC 3TUOA 2LHDA 3H94A 1TZOA 1AFPA 1H9MA 1V1OA 1XWEA 3W9CB 4OZBA 1ZDXA 2KACA 4ARIA 3H3VC 3HOVB 1L4ZB 4HSPA 5BMIA 4EQNA 4EE2A 5CYUA 1G2TA 5BYQA 2VB3X 3VYUA 1WRIA 3GTMB 3FPPA 3L3OC 3P63A 4RNAA 1Q3LA 5E1FA 3D4WA 1HHVA 1EY4A 1SMYC 4NKLA 3RD4A 5BMGA 1F9PA 1SNQA 3J80E 4LTUA 4PMBA 1JWMD 4EGVA 1IW7C 2WXIA 5I9PA 2O5JC 2QSDA 4B0MA 2XRQD 3NUCA 1L5PA 3LNNA 1SDFA 3P42A 2VZKD 1EZ8A 1MHXA 3FDTA 4YTNB 1KDBA 4RHRA 3VQIA 1IBXB 3PZ8A 4RA8A 1TT2A 5J1ZA 2KA7A 2F3WA 2L1AA 4IDIA 2WV6D 4DA2A 3T16A 1EU4A 1BF4A 1SAPA 1DOYA 4WWMA 5BYRA 5I6YA 1EY5A 3ERQA 4O1NA 2ZT9C 4XXEA 4C3HG 4XYOA 4IQZA 3K0YA 3I9V1 1W6KA 4HMIA 5K5PA 4KJOA 3VR3A 1IYVA 1QT9A 4H13C 2F03A 3IAM1 3GTGB 2KECA 2B39A 4KY5A 1Q1EA 1Q1BA 1AEXA 2O2LD 2K22A 4CGYB 2WXMA 2JA6B 1F2RC 1XLQA 1NUCA 3P20A 2IPKD 1ACCA 1N62A 2YU9B 3KF8A 4EQOA 5CV5A 2NN6I 2MEKA 5C4XB 5AUKA 1EEID 3CRLC 4EVOA 1PXUA 2F0KA 2VUMB 1YN4A 3VR2A 1Z47A 1F9SA 2BCOA 3K6OA 3H8HA 2N0SB 3KWLA 2NTTA 4HCSA 1IGDA 3Q23A 3NTIA 3D8GA 3S9WA 3HUIA 3D4DA 3AMUA 1E0ZA 1QNUA 2MJ3A 1F2ZA 4C7YA 2L32A 1RWSA 5KNCA 1Z6HA 3NPPA 1WTXA 1MSGA 5C4HA 3PUVA 4K8JA 1A15A 2LMCB 3X3MA 2A6HD 3I90A 3R2IA 1TWCB 1SNPA 5FO9B 2BA0A 1HQRD 5IGGA 3CWIA 1KH0A 1HRJA 2KEEA 2LHEA 2LEKA 1SYGA 3AB5A 1S5CD 2W54A 1TY0A 3H09A 2E2DC 4XDDA 3P1MA 1AWDA 3NP8A 1B2TA 4M1UB 3MAQA 3NQIA 2JEAI