1I4QA

Crystal structure of staphylococcal enterotoxin c2 at 100k crystallized at ph 6.0
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
239
structure length
234
Chain Sequence
ESQPDPTPDELHKSSEFTGTMGNMKYLYDDHYVSATKVMSVDKFLAHDLIYNISDKKLKNYDKVKTELLNEDLAKKYKDEVVDVYGSNYYVNCYFSSKDNGGKTCMYGGITKHEGNHFDNGNLQNVLIRVYENKRNTISFEVQTDKKSVTAQELDIKARNFLINKKNLYEFNSSPYETGYIKFIENNGNTFWYDMMPAPGDKFDQSKYLMMYNDNKTVDSKSVKIEVHLTTKNG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Toxin
molecule keywords ENTEROTOXIN TYPE C-2
publication title Structure of staphylococcal enterotoxin C2 at various pH levels.
pubmed doi rcsb
total genus 67
structure length 234
sequence length 239
ec nomenclature
pdb deposition date 2001-02-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01123 Stap_Strp_toxin Staphylococcal/Streptococcal toxin, OB-fold domain
A PF02876 Stap_Strp_tox_C Staphylococcal/Streptococcal toxin, beta-grasp domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.110 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1i4qA01
3.10.20.120 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1i4qA02
1L0YB 1CHQD 1BCPB 1S5CD 1BXTA 1EFID 1CQVA 1BCPF 1QILA 1HXYD 1EWCA 1V1OA 4RGNA 1FNWA 2O2LD 1YN5A 1SE4A 1TS3A 2IPKD 2XNAC 1PRTC 1T5XD 3CHBD 2XN9C 2ICIA 5I4DA 1SJHD 4C56C 3BVMA 5D3IB 5ELDA 1CT1D 1S5FD 4RH6A 3MFGA 1SXTA 2J4XA 1JWSD 1JWMD 1KLGD 1PTOD 2Z8LA 2TSSA 1AN8A 1XTCD 1ESFA 3BYYB 1D6EC 3DWQA 1SE2A 3EA6A 5ELCA 5ELBA 1TS4A 1SE3A 4BWGB 4RCOA 4Z9CB 1LT4D 1SBBB 1CHPD 1GOZA 1YN4A 1LT6D 3BZDB 5D3DA 1L0XB 3DWAA 5ELEA 1D5MC 4RHRA 4TSSA 1PYWD 1LTAD 1I4GA 4DXGA 1PTOB 1V1PB 3BYTB 2AQ2B 1JR0D 1RF2D 1UUPA 1ENFA 1PTOF 3GP7A 3R8BA 1DJRD 1LTID 1HA5A 1LTBD 4L63B 1F77A 1FNUA 1HTLD 1I4HA 2WV6D 1ET9A 1PZID 2QILA 1TY0A 3OWEB 3BVGA 2RDHA 4NZLB 1BCPC 1D5XC 1KLUD 4RGOS 2RDGA 1M4VA 1SEBD 2G9HD 2IJ0A 1MD2D 1S5DD 4RHSA 1ET6A 2CHBD 1LTSD 1G8ZD 1STEA 2NTSA 1EEID 3SEBA 2AQ3B 1RDPD 3W2DA 1CK1A 1TY2A 5FKAC 1EU4A 1I4RA 3BVZA 2XRQD 4K6LA 4UDUC 1XXGA 1JQYD 1PZJD 2AQ1B 1LLRD 1PRTD 2XRSD 3TSSA 4DXFA 4RGTA 1EU3A 1D5ZC 4OHJA 1KTKA 1TS2A 1LT5D 4RFBA 1UNSA 3O13A 5TSSA 4L6TB 1FNVA 1TS5A 2NTTA 5FK9C 3V05A 2SEBD 1FGBD 1RCVD 4O1NA 3EFXD 1LTRD 1V1PA 1BCPD 3R2IA 1I4PA 1YN3A 1LTTD 1RD9D 3DWPA 2R61A 1JCKB 1PTOC 1PRTB 1B44D 1EEFD 1LO5D 1FD7D 2QEJC 3R2TA 3MC0B 3URYA 1PZKD 1LT3D 1DYQA 1I4XA 1PRTF 1I4QA 4ZYSA 1PTOH 1B1ZA 1AW7A 1S5ED 1S5BD 5ELFA 1JWUD 1SJED 1LTGD 3KLSX 4RGMA 1HQRD
chains in the Genus database with same CATH superfamily
1BCPB 1ICWA 3CCVA 1MPEA 2LRWA 3AE6B 1EFID 5CBEE 1A3UA 1P7EA 1V81A 3I57A 3QJZA 5LXHA 4W9LA 3F8TA 2R2OA 3NHEB 4RGNA 1C4PA 5BYQA 3V62A 4DR3Q 3QARA 3H3VC 3MJ5A 3QCAA 1T5XD 3HKZG 1LGRA 2K75A 1J9OA 1NSNS 3D32A 1R4PB 3D6CA 1QLBB 1JJGA 1QVCA 2Y0SB 4IUVA 4GN4B 1IW7D 3FEWX 3K5LA 4L2YA 3J80L 2TMPA 2LKVA 1ZYRD 1I94L 1GHJA 2PMZE 1R9TH 1QVGA 1CMXB 5E4XA 3BYYB 1E8ZA 3OG5A 2C9OA 4XYQA 4YY3Q 1F0ZA 1ASYA 4GNXA 3Q3OC 3FHWA 2KN5A 1A5RA 4G0NB 4TRDA 3L4PA 5J17A 1JROA 5CORA 4A3KG 3LJ3A 2KT7A 1B3QA 4HTHA 4TSSA 1N34L 2DJGC 2ZXPA 3K81C 4WQMA 1V1PB 2L1AA 3A56A 2AWTA 2JY6A 3U7ZA 2N9PC 3VR6A 2XTIA 1QKZA 2UU9Q 2F0EA 1G2TA 2NMQA 1LTBD 4M1UB 1EYCA 4JIOU 3MP9A 2WAQG 2QMTA 3ZRFA 4YT0B 1YITA 4RGOS 1SSNA 4CYEA 2VH1A 2K04A 4APVA 2UUBQ 3AMZA 4IOAA 4AOFA 2UYZB 2EYOA 2K1BA 1NI3A 5IT9E 4ZHPA 1RDPD 3I91A 1GG3A 5BYSA 4A3GB 4EZJA 2OJRA 1D8LA 3QC8B 1FRDA 4KY7A 2QJLA 3NVZA 4JX1C 4IN3A 4UDUC 1XTDA 5C0XI 2VUMH 1FFVA 3X23A 4JL9A 5IE8A 3OAWA 5HGTA 4IWOA 3GQBA 4B9WA 1EU3A 2WAQE 1IBXB 1EWHA 3HOWB 1MI0A 3E0JA 2A6HC 2ICEC 1WJUA 4AUQC 2ZW0A 4RF0A 3IRBA 2UXDQ 2HDMA 3ZYYX 1N5WA 2KVRA 3A9JA 3JVZX 1DZ1A 3HGBA 4JVZA 3DBHB 3UE0A 2O2VB 3X0WA 4DR5L 1JE4A 1FRRA 4HPMB 2DNFA 2EYJA 3NUCA 1YI2A 2MJ8A 1N36Q 2KDIA 3R93A 4EFOA 1CFMA 3K7AH 4Q5VA 1ZOYB 2A68C 5IO9A 4A3LH 1A15A 1FD7D 2F0DA 4QIWB 2IHFA 1H9MA 3SD5A 1I4XA 4KI0A 2A1AA 4NXML 5BN5A 1WE7A 2KC1A 5J2RA 4MGYE 4X65Q 1IYUA 3VYRA 2B8FA 3C3LA 5CMDA 1CZPA 1WJNA 2KDFB 1KOTA 4BZAA 3UIOB 4V0BA 4K5XA 4PK1A 3S16B 3PUWA 2VQEL 1PFBA 1M8AA 4C00A 1Y69U 4DR1L 2DZJA 2LFNA 3AU7A 3CMAA 1C4CA 4OWXB 2KACA 2UUCQ 3BZKA 2K28A 4BVUC 1OEYJ 3ZKJC 4KJOA 1VLBA 4N8X1 4LF9Q 2JYEA 3H94A 1XLOA 3S14H 2NZOA 4R4QA 2BTEA 3P63A 4DK3C 2ALYB 5FLXL 5AUIA 2B2UC 2XN9C 3S1NB 3U4VA 4DR2Q 1X6OA 1WTWA 3H3VH 1F52A 3AULA 3N9YC 5J39A 4RH6A 3PRPB 1IL8A 5LMUQ 2MW5A 4TQUS 2IGHA 3TDQA 3SVMA 1VQKA 2DN8A 4K5WA 4OX9Q 2F4VQ 1JWMD 1QE6A 2DZKA 1HPCA 2LFIA 3SE0A 4ZKCB 1J5EL 5M9OA 4BY7H 4JI4Q 3HM6X 5LNK1 1TZ1A 4QY7A 4AQYL 1XD3B 1C4QA 1VQ9A 3DWQA 4K14A 3R7RA 2NVYH 1STGA 1LFDA 2N3SA 5C5LA 2KCNA 1SNQA 3B2FA 4PS3A 3Q3NC 5HHDG 2NZ1D 4C3HH 4YY3L 2PE9A 3NZ3A 4DQOC 2WP8J 3OMGA 2K6QA 1Q82C 1ML0D 2HUGA 4ASWC 1SNMA 3PIPA 1VQ6A 3ZRCA 5FO8B 2B2UA 2JJQA 2WXNA 3TZUA 5A2QE 4B3MQ 4K2KA 2WDTB 3GTOB 3ONAB 4C1NI 1KXLA 2NB0A 3MTNB 2D0OA 3FMCA 3GTJH 4DPGA 1STBA 3GD7A 3PO3H 2Y5PA 4TV3A 1LTLA 1CA6A 3PUZA 1F77A 3RD4A 2MBHA 3S17B 2AMCB 2XK5B 2UU9L 4KSKC 2EJFC 1BCPC 2ZM6Q 4EZLA 3C2PA 3ZXRA 1PYBA 1SEBD 2G9HD 3SGIA 3QIJA 2PPBC 1Z9FA 3STBD 2SNSA 2Y0SG 3TQYA 4HKZE 1TIID 1XPOA 1XMOL 1V49A 1YQ3B 2BA0A 1G6PA 2IGDA 2UUBL 4PYZA 1UE6A 3JAML 2QCZA 3WAPA 1L6UA 4BBSB 4FDBA 4B6WA 5CYUA 1JMCA 3FKIH 3AU4A 4NNJB 3MHSD 4A55A 4NAWB 1IYFA 2KOXA 2V4DA 4X66L 3GTKB 1TZOA 2KYWA 4XXEA 4IW0A 4IFDH 4P7IA 2KECA 4KD3A 1LLRD 3J80c 4FYDA 4KKTA 2JU6X 5DPRA 3NVYA 3T1HQ 2NWGA 3A0JA 4DAPA 2N1WA 3PVLA 5A35A 4USAA 3ZGZA 2KHJA 3MEFA 4LCDE 4K5VA 1S4ZA 3NG0A 4IM2A 2F0SA 3WDNA 2Y0SE 4IUNA 2Z4HA 5CBAE 3UDIA 1PH5A 2DZIA 5CTRC 2M8SA 2UXDL 4HPPA 2VS1A 2X38A 1Q3LA 2K03A 2GN5A 5F2DA 4A76A 3OIQA 4A4IA 4ZRPA 1B70B 1PRTB 1Q86C 4A3IB 4DR4Q 1N36L 1EEFD 4WWNA 3RNGC 4A3BH 2WDQB 4IALA 2CS4A 1GD7A 1IBLL 3DVNV 1WGDA 4LFBL 3GTLH 1Z47A 2SAKA 3JW0X 4CJ2C 3ZNID 5I9OA 4X65L 1YQ4B 5C6AA 2LXCA 3AE5B 4N6EB 2CW0C 3FVQA 4DK6C 4A3GG 3QAQA 3PF4A 5IP9H 4ZHOA 3S1RB 3E6ZX 3M3YB 5KEEA 2UUCL 2KUMA 2DAFA 3UI3A 3HOYB 4RMFA 4US8A 1SNPA 4LUVA 4IJLA 1NR2A 3TN2A 2IY1B 1F9RA 4LF9L 4LK0M 2ZTCA 2ASBA 1YJ9A 3WALA 2KWDA 4DV5Q 2KA7A 1T0SC 5AJ3Q 2BB6A 4CBVA 1U5KA 5LL6X 4DR2L 1XEEA 1TWHB 4A20A 4OXPA 3J80i 2QDLA 5LMUL 4A3JH 3UIPB 2DNEA 2F4VL 3PPAA 4OX9L 4L8JA 3QK0A 3R66C 1IGDA 1D6EC 5GQOA 4JI4L 5JJZA 2WYQA 3I9V1 2MO1A 3NS8A 3GTPB 2PI2A 3W1SC 1Q12A 2BB5A 2Q5WD 2BDNA 2YEPB 4FBJB 4FULA 1GKHA 3E3XA 4ZUJA 4RA8A 1N33L 3A5ZB 4J15A 3GE3C 1I50H 2V3SA 4W9EA 4HRSA 4OZCA 2ZJRA 4RHRA 5EPLA 2OEDA 5E7NA 3H7PB 3ICEA 4IOIE 1TBEA 4B3ML 2FNJB 1K51A 4GKJL 2W3RA 3KWLA 4P74A 4PZ6A 3VXWA 1R4MI 2F0LA 3F2DA 1P1AA 2CHWA 3AEFB 4WJQA 3MAQA 4B9KA 2K5QA 3A55A 5E1FA 4P72A 2FXQA 4HJ7A 1Q7YC 2C60A 2DLBA 4HPLB 3VH4B 1RM6C 4L5TA 2JZZA 2ZJDA 4LUOA 1IYJB 2F4IA 3BVGA 4IDIA 4LNKA 3W1SA 4QIWE 2F0HA 3MEHA 1KH0A 3MC9A 1PH3A 3A7AB 4DAYB 3G6EA 2NVXH 1ACCA 2V3NA 2ZM6L 3CSFA 3Q8FA 4PS7A 3EJIA 2Q8RE 3VTVA 1HNXL 3PLVA 1EYAA 2HHHQ 2R92B 5T1IA 4IUMB 1FIQA 4JK1C 1BUVT 3P4SB 4DV7Q 4U68A 4JOIC 5FLXc 1I4RA 3BVZA 3I4NB 3HZXA 2YU9H 2MHVA 1FO4A 4K1RB 2R93B 1YHAA 5JJKA 2L76A 3T51B 1CQFA 4OO1G 2N9EB 3U4EG 1E2VA 2KTFA 2HDEA 2O6VA 3T1HL 2E2JB 2M0AA 3TJPA 1RAXA 3AFQA 2Z0SA 2MO0A 1IKMA 1AE3A 3C0RB 2JA7H 3ZO5B 2WACA 2M0XA 4NXNQ 3GTMH 3IAS1 1WRDB 3KWVA 1C3TA 1OQRA 1WGKA 1B44D 1VCIA 3OPOA 1QUQB 1YNJD 1EQTA 2EY1A 1UWVA 3TREA 4DR6Q 3DHGC 4DR4L 3MJWA 3CRKC 4JQWC 2Z1CA 1Q1BA 2E2IB 1WTQA 2K22A 1I7HA 1GAQB 5EKLA 4MH0E 4BS9A 2EY6A 2BPSA 2PCFB 1FXAA 5ELFA 2WU5B 2RCNA 5DM73 4H7BA 5DCNA 4IKGA 4BBSG 4FVMA 1BR9A 4GN5A 4IZ8A 3RNEC 1V5OA 2R7FA 1EIHA 5AUKA 1WTHA 1Y1VG 1AP0A 4MELA 2AYOB 3H1UA 1RODA 3NBHB 1ICFB 1SE4A 4C3JB 3WWVA 2Z0DB 1RFAA 5DEHA 4GDLB 2PPHA 1HE8A 4ANWA 2RDFA 4ZRJA 3C1EA 4A3GH 1KAAA 2MJ3A 3A4RA 2L1BA 3RZFA 1QNUA 2C9WB 4OW0A 1PTOD 5KIXA 1EY8A 4JI3L 4LF5L 3ZJYC 1TKWB 1G2SA 1MSGA 2CKHB 2YVCA 4M0WA 4P6VF 3HKSA 1VMCA 4BWGB 4RCOA 1DD2A 4NMZA 4A3IG 1BKBA 2E5LQ 3HOWH 2IO0B 4MJSB 4LF7Q 3ETRA 4B3SQ 1EY4A 1RIPA 4FXCA 3T4AC 4A3EH 1A2TA 1D1KA 3BZDB 1RHPA 4ILWA 1MHHE 2PNRC 4PG3A 2KHSA 4FF2A 1H4RA 2PVGC 1WX9A 2VRRB 4TQ0A 4GLAC 2WXRA 2N0SB 3HEJA 1ZXHA 2FCNA 2BYTA 1I4GA 1MFWA 1IZ6A 1NVID 2LGIA 1VJKA 3QX1A 1O7LA 1Z6HA 5K36G 3P4QB 3VVWB 1MG4A 4JC0A 2B63B 4M01A 4ACFA 4MM3B 1XYIA 2PZWA 1WF9A 3CCLA 1KC8C 3HOYG 5KYIA 3ZQ4A 3ONSA 3RFZB 1WD0A 1PMRA 3S16H 4K81A 4ARCA 5AZFA 3DBLB 1OO9B 2MH7A 3JAMi 5G5GA 2NTSA 1NY4A 2CW0D 1PYSB 2NBVB 2WXHA 2LMCA 3ZJUA 1EOTA 1II3A 3DVGY 3ERSX 4B3TQ 1A70A 2PW5A 2HTHA 4OZAA 4MSMB 3Q0AA 2D3GA 3KJOA 4DV7L 1JRUA 2HE7A 1EF1A 4GLXA 1PDQA 3D6WA 1V43A 2CJOA 5AFWA 5IY0A 1QOGA 1VZ7A 1XXGA 4JLCA 3VUWA 4HROA 2BYFA 2KQ7A 3L16A 2EYFA 4RGTA 2MUYA 3HOXH 3FILA 3RUIB 2WB1B 4CDDC 1YBYA 3O13A 2FINB 3GTGB 1G51A 5TSSA 2NTTA 3S15B 2V1CC 3W1GA 1GUWA 1CKOA 2SEBD 3CCQA 3NEMA 5IYDH 4YL8A 3VUXA 3M4QA 3S14B 5G55A 1EY9A 4GNXB 4HAEA 5HGQA 4GMVA 2PW9A 4JBKA 1EIGA 3A9KB 2SNMA 1T9HA 1W6JA 1NNXA 3SXHA 4P73A 4DNIA 1IW7C 2M9VA 1UZXB 2ATWA 1WM2A 1M94A 1JCKB 2F3VA 4QB4A 1ZYRC 1LO5D 3RZDH 2B2TC 2JE6I 5JVH3 4OO1H 2KDBA 1JJCB 1PFDA 3GTOH 1BBUA 2OQKA 2D2CC 2ZT9C 1B9RA 4JBWA 1E7ZA 4A3CG 4US9A 4ZKBB 1S5ED 3J81L 2R92G 2BYEA 3KLSX 3D4DA 1HQRD 4C3HB 3IT6B 1K8OA 2L52A 2ZW1A 2IT1A 2L3ZA 1VZ8A 1HQMC 3I4NG 1DOMA 4J3OD 3D8GA 5D94A 2L55A 3CIRB 3CMMB 2I5MX 2L5TA 3A74A 5KHOA 5C3WA 2ZPYA 2FUHB 2R93G 4JE3B 2BVCA 2CR5A 2H88B 2B2TA 5KGUA 4I6PA 3GTJB 4IUQA 3DBRI 2K6DB 2L4NA 2KX0A 3HFZB 1Y14B 2JRIB 2O6VD 4N59A 3RLOA 4CHTB 1UH6A 3ZVVA 1KLVA 3SK6A 5E4WC 3DMUA 3DLLA 3NK9A 2Z8LA 4KMUC 1UF0A 3BY4B 1X3FA 3WANA 4BBNF 1RTOA 3EECA 3K0XA 2INPE 2OWOA 3VR4A 2QSDA 4FLHA 2B2VC 3S1MB 3D4RA 4YTNB 1ZKOA 4CJ0B 2KQ4X 3M95A 4B95A 1SYEA 4F1SA 1YHBA 4DK0A 2E5LL 4NQKE 4YXDB 3G7LA 1HFGA 4LF7L 2KK8A 3VDZA 4B3SL 4XE0A 2G9DA 3A9JB 3KQ4A 4YWLA 2AUKA 1YJIA 2AUJD 5IGDA 1SRUA 1E6EB 1KFYB 1YQBA 3Q6BA 1R4NB 1SE8A 1EYDA 1HZ6A 1IBKL 1NBWA 1FVIA 5IOIA 1F1HA 2KEEA 3BZCA 3DPDA 4R4OA 2ACZB 3E0EA 1SB3C 1TY0A 2YTXA 3OSOA 2G5DA 2IYDB 2KJ6A 5BMIA 4C3JG 1D5XC 1KLUD 4LAAA 2JA6B 2INDC 1AEXA 5IYCH 1WXSA 4AP4C 3RMKC 1MD2D 2MX2A 3H7SA 1GNUA 2J53A 1T0YA 5IT9L 3S1RH 1JW9D 1I6HB 4JBMA 4NJCA 3M3YH 3KLRA 4WWOA 1UGMA 3D31A 2K05A 5E6PA 3BDCA 3HOYH 3IG3A 4B3RQ 2WDRB 4B3TL 1PA6A 1N32Q 4UP9A 4G7ZC 3MXNA 1LQBA 3NOBA 3KF6A 1ILQA 2I1KA 5BMHA 1SGHA 2H89B 2WX0A 4IOCA 4NAMA 2B2WC 3VH3B 1YVCA 1RYJA 1TWHH 1V6EA 4XGAB 4MHEA 4WJNA 4RAUC 3ML9A 4D2KA 5IP7G 3QOLA 4HLEA 1RRBA 4L6TB 3ZDMC 4G7HC 1NJIC 2N9XA 1V1QA 4KGTA 2Q2HA 4ALPA 4L5RC 2B63G 2OOBB 4KV6A 2ZTEA 4ZRZA 3R3MA 2NR2A 5IKCM 1PH4A 1LTRD 1K3RA 4E71A 1Z2MA 3AB9A 2HCIA 2LHDA 3B6YA 5DPWA 3SHLA 2MBEA 4MIUA 2H4OA 4DF7A 3PIO3 4S3SA 2HT1A 1F9QA 4G50A 4JPSA 1DOXA 3URYA 2A6ED 1LT3D 4WJPA 2Z6KA 1WM3A 5C3JB 4A3JB 1K83B 2EY2A 1K53A 1VCBA 1B1ZA 1Q8IA 2KVMA 4OIJA 2KFKA 3K5NA 1FL0A 3DM3A 1TWGB 4LW1A 4KN4C 1B53A 4IUTA 5G3LF 5I6WA 2CHXA 3W3AA 4PMCA 3ECIA 1C48A 2JUOA 3FKYA 5GMVA 3GV3A 4XWTA 2D3AA 1V5TA 1M1KC 3UINB 2B29A 4K7UA 1AZPA 3CKIB 1U9RA 3RLFA 4WJ4A 3DHHC 2K0PA 2D9UA 1IUEA 1FNWA 1WD1A 2EXDA 1WTRA 4A3CH 3VAWA 2WB1G 4NKLA 3J7A5 1C9FA 4M8MA 1VQEA 1S5FD 1JJ2A 3MA2B 2GB1A 4DHJD 2JWZA 2I07B 1EUJA 2J4XA 4B08A 1ENAA 4QJFA 3Q3JA 3I4NH 4ICUA 4RMAA 2MEKA 2PQAA 3STBC 2OTJA 1WYWB 2ENBA 2UXBQ 4PT5A 5KNDA 5J18A 2R93H 2MQJA 2ZCBA 2JQRB 1JB7A 2WXMA 1LUZA 1AZQA 1WGRA 4G3XB 3GV6A 2NUCA 3RR5A 2K32A 3D0FA 4BY7G 1WXVA 3U30A 4ANXA 4GNXC 2V9HA 2VY3A 2E2JH 2UU7A 3UF8A 5A2QL 4HJ5A 2CU3A 4LF6Q 5FJ8G 1A63A 2YV5A 2WB1E 3H6NA 3NVVA 3Q8AA 1UGJA 2YU9B 1PTOB 4C3HG 2E6XA 3IVFA 3V3XA 1B9NA 1T6BX 2XBBC 1MKHA 4AYBB 1NCVA 3KVFB 5E3FA 1JALA 1TIFA 5IA7A 3A7LA 5LMNQ 4DU9A 2DHZA 3DWMA 1HA5A 1I42A 1A8VA 3K80C 2E74C 3J81c 4HVBA 1HH2P 2J0JA 2E2IH 4YTMB 4CHKA 4QGUA 2PE6B 4XYCA 4PZ7A 3AE8B 3CCEA 3QWZB 3RNFC 1F2RI 5IWAQ 3PO3G 2YTYA 3B0AA 2K52A 1GB1A 2JA7B 1WXQA 2ID0A 2M19A 1FM0D 1JICA 5DAUA 3GTMB 2EPBA 4HCSA 1NDDA 2XGTA 2M56B 3AN1A 4G57A 3GZNB 1EYGA 1VQDA 2QHOA 3NP8A 1ZDXA 4GSWA 2WU2B 3ZJTA 3SK5A 1AE2A 4Y52H 1W2BA 4DA2A 4I7ZC 4BFRA 1CKNA 1WFQA 2KCCA 4C3JH 5C23A 3FPPA 1N32L 1KRTA 1Q90A 2KN4A 3KLSA 1BVSA 2XRSD 2BWFA 3BINA 1R4QB 1VS0A 1KM7A 4OWTB 3FKIG 4R9WA 1WCMB 1DOIA 2K25A 3HVDA 4ZRIA 3M7NA 2LI5A 2IO3B 2MA9B 2VH2A 1JE5A 4IFDG 2NVQB 1GUOA 1RCVD 5IGGA 4DV3Q 1EUVB 1N61A 2J0MA 3HHMA 5TR5A 2M00A 4NJ7A 1CKMA 3HOUH 2N88A 5C4XB 1K8GA 1P16A 2UXCL 1GO3E 4JGHB 1OXXK 1RD9D 2A19A 5K5PA 2E2HH 5GADC 3RLNA 4YCUA 4RF1A 4YWGG 1WX8A 4NW2A 3CP0A 2YLMA 2BYVE 2Z4IA 2JA6G 4Y7NB 1D3ZA 3A1QA 2EJGC 1NMFA 2H5XA 5IP7H 2REXA 3J7YW 2O5JC 2PJHA 3J81i 1A0IA 4FJZA 1YD8U 2C5CA 4JI0Q 2K14A 4JI5Q 2B63H 4K0KQ 4XWWA 1L0WA 2CWPA 1FJGL 3VYTA 1N5XA 3RNAC 2RPQA 4JV5Q 3C46A 1HZ5A 3M63B 2V0GA 1DOYA 3AE4B 3A8JE 1EIFA 4A3BG 2WNMA 3PT2B 1QCBD 4ABNA 4A3EB 1D2BA 2KCTA 1IL2A 4XDCA 1BCPF 3Q8DA 1PH2A 3PMFA 2WLBA 5IT9c 3ZJVA 3K7UC 3H3VI 1C77A 4KGSA 1MSHA 2L0CA 3I72A 5T1GA 4NDXA 4TKNA 3AFPA 5IP9G 3MXGA 3CC4A 1RFKA 2WQYB 2J7QB 3T53B 3PV1A 4MTNA 2LZ6A 2MSED 3K0YA 4LNFA 2TSSA 2FCQA 1TR5A 4DUZL 2A73B 2V3PA 1XTCD 2A69D 5ELCA 4XQQA 1N63A 3BK2A 5JHAA 1O80A 3TMPB 3NWSA 5M5YH 1OEYA 1EL0A 1UAPA 1XPRA 2HIXA 2JXTA 3P20A 4BKSD 4A3JG 1CHPD 4LF4Q 3GTGH 4R3DA 3APDA 3U9SA 3NBIA 3S15H 2O6VB 1FMAD 3I90A 4IFDJ 5ELEA 1UEAB 3H15A 4OONA 1PYWD 1KIXA 4LF6L 4DR3L 1MHXA 4POGA 2D5GA 4A3OA 2IHEA 3NHHA 1SFOH 1NTGA 2KENA 2ZJQA 2DBYA 3HOXB 3P1MA 5CV6A 4GOPA 5LMNL 4EQPA 4K3BA 3CCUA 4LFAQ 2I2YA 2KO3A 3U50C 4XTCS 3VDYA 4PMBA 3KYCD 2RDHA 2F0MA 2FAZA 5IODA 5FJ8H 3KDFA 2RCFA 4N8FA 1ROEA 1J6QA 1ILPA 1FR3A 3X3MA 1S5DD 1QOFA 5BYRA 3RYTA 2KWVB 2IO2B 5IGBA 4JG2A 4K2LA 5IWAL 1N8RC 2NYZD 1YNJC 1YJ1A 2Z59B 2VW9A 1SN8A 2FIFA 4DV6Q 4FXGC 4H13C 5D14A 3VYSA 2JQOA 4LF8Q 3PGZA 3RZDB 2XIWA 1DOKA 1PGXA 1KRSA 2D3CA 4X62Q 1U4AA 2RPVA 1T0RC 4WJOA 2KDMA 3L17A 2XRQD 4BY1B 3MTSA 2NBWB 1A2UA 3P75A 3TCAA 3ALBA 2KXJA 2EDGA 2KJXA 5KYLA 1OTRB 5CV8A 2KD0A 1ISNA 4GLSC 1D5ZC 2GBRA 3TP5A 3GOEA 1TS2A 4CKBA 4EQ5A 1KNEA 2JXXA 1X3PA 1MIUA 2KHIA 3DOWA 5KRUA 2K8BA 3MWYW 3M4OH 4EVOA 1SYGA 3SR6A 2M2LA 4HIMA 4AYBG 2FIDA 3KBGA 5M3MB 3MHZA 3S1MH 4M0WB 4W9KA 1IKLA 1VQFA 4CO7A 4P75A 2ZVOA 3JYUA 4DV3L 3EQLC 2F1MA 3CCRA 4A3MB 1PTOC 5AZHA 4OZBA 1SR3A 4WJWA 5LL6S 4TQ1A 3NTKA 5BMGA 2A5HA 2C7MB 3WIMA 2R2QA 1I5FA 4X3KA 2JA7G 2KDEB 4M00A 4NQLB 1STAA 2E8GA 1WX7A 2QA4A 1SJED 1MBYA 4JI7Q 1XCQL 4JI0L 1HZAA 4P16A 2R3ZA 2XWBB 4JI5L 2JSVX 2KLGA 4HKQA 3E56A 1EY5A 2BOSA 3MXPA 1XCTL 4KKIA 1BXTA 4AYBE 3PSIA 2WXGA 3BU2A 4F7XA 2JA6H 1EWCA 3MVVA 2BWES 4C2MB 3OWFA 2D2QA 2N78A 1W3SA 5M5WB 4GKKQ 4ZDVA 4XDDA 1XLPA 2G45B 2K39A 1WCMG 2F52A 3L3OC 1I6HH 5H1SE 2JYTA 3OHXC 1SYDA 1UE1A 2CQOA 2LMCB 3MFGA 2JA5H 2KZRA 3KYDD 4GIVA 3RN9C 1QOAA 1P98A 4BKTA 5C5MA 2CWAA 2D0PA 2JF5A 5C4XG 3NY5A 3I7FA 4YWMA 2MGSA 4MACA 1XF5L 4A93B 4POFA 1VZ6A 3VTUA 4IPHA 1GUNA 4MH8A 5AEKB 4ZQ3A 2Q8IB 3FILB 3S1QB 2D11A 2DYBA 3LGJA 1IBMQ 2B8GA 4ZUIA 2A74C 4LF4L 4DHJB 1O7IA 2Q2UA 1AWDA 1K0RA 4XQNA 4NP5A 1PV4A 4YHHQ 3HOWG 1RLFA 4HEA1 5LMNW 4C80A 1FD6A 1UUPA 4A3EG 4C3IB 4R4TA 3IAYA 4EKUA 1QQRA 3S2DB 3J81j 3P4RB 3QG1A 3VTWA 2UUAQ 4H2AA 4TMAB 4C4VA 1ZXTA 2WV6D 1HTLD 1K83H 1MJCA 3P4PB 2MPMA 2BKRB 3OWEB 4CJ1B 3CPWA 5CV7A 1TWGH 1GC6A 4FNFA 1Y8NB 4LFAL 2RDGA 2A5UA 3W1YA 1VQOA 2JN4A 2V4LA 1PXUA 2B2YC 2RDBC 4F8MA 3Q8CA 4W9HA 2KQ3A 3WOFA 2RBMA 1GUGA 3AE1B 1VMPA 4DV6L 1SNDA 1WJJA 1QZHA 2N7EA 3QB3A 2EZVA 4LF8L 3Q3MC 3TUOA 4OVZA 2OXPA 3EIVA 1SYCA 3FP9A 2LHEA 2CVRA 3TEHB 1RKNA 1A6XA 3HIZA 2QDFA 1STYA 3TP8A 4MGKE 1U4PA 1C9OA 1SNOA 2DUDA 3UDGA 1E8WA 1N62A 3CXCA 2LGSA 2RSUA 1OQYA 4RFBA 4IG7B 3LB8C 2VB3X 1TWAH 2B2YA 4AS1A 1XWEA 1H9SA 5LHY1 1FNVA 3T8MA 5FK9C 3HM3A 3PGEA 3BS1A 4NY0A 4ZLTF 1BBXC 2EKIA 3KF8A 3HOXG 1TYGB 1E5WA 1I4PA 1E0ZA 2N7DA 1U4MA 1UELA 2E3TA 1L2FA 3CF6E 1JMLA 2GBNA 5BR8Q 3NZSA 4KLKA 3CMEA 5IYDG 1EIYB 1PRTF 3I4OA 3IXSA 2WXIA 1HUMA 4WWMA 1PTOH 3VHTC 3JSVA 4XT1B 1F2YA 4X6AH 4JI6Q 2LWPA 2WDVB 2IBIB 2JA9A 1AFPA 1B3AA 1S5BD 2BE5D 2NVTH 3APFA 2ES2A 3UDXA 2CQAA 4Q0FA 2VB2X 1SROA 3PQIA 4U673 2HJ1A 1M90C 1L1OA 3S9WA 1S5CD 2R7ZB 2FMMA 3GB1A 1K8MA 4UP7A 3EVQA 4BY1G 1FXTB 5JXVA 3TBIB 1TWCB 1KRHA 2DYOA 4HCPB 1CJEA 3AE2B 1PH7A 4QUCA 4GN1A 2NBFA 2LD9A 3EN2A 1XNQQ 3V96A 1GHKA 3V6EB 1HR0Q 3AEDB 2CKZB 4KTAA 4GKKL 4DDGD 4R8NA 5HY6A 3CPFA 1KABA 3I70A 1RWSA 2LS01 3VYUA 3BWUD 4IPCA 1UWMA 4HMJA 1IGCA 3SK8A 2I0QA 2JZPA 3OJ3A 1F9JA 1QNKA 1V8QA 4DWFA 3FC4A 3MXNB 1GXDC 1XLQA 1ESFA 3KF6B 4HJ8A 1JOKA 1SE2A 3G6JB 1WGHA 4KV2A 3NXWA 4CGYB 4A3MG 4FJYA 3DXJC 4MZ9A 1WR6E 2BBCA 2UWQA 1VQLA 3DBHI 1SMYC 4X57B 1NUCA 1WCMH 3ITPA 4H02A 3L2PA 3U2SC 4X64Q 1G6ZA 3SHQA 4DNTB 2YEPF 1SLJA 2JA8B 1JB3A 2PIAA 4DV2Q 2NVQH 1IBML 2B3AA 2HJ8A 3JAMc 2NN6G 3DCGA 2NPTA 1LTAD 4A8XC 3HP3A 5C4XH 1SSOA 3H91A 5D7GA 4DV5L 3BG3A 4LUZA 3ZLZA 4G7OC 4UPAA 2K8CA 4Y7NH 3AECB 1X3GA 2R6GA 5C4ZA 5AJ3L 1R7SA 4QAYA 3RULA 5FO9B 1PZID 5IAAC 2LJ5A 4RM9A 2KFKB 2Y3AA 2GMIC 4WURA 4YCWA 4DBGA 1HUNA 2Y5CA 1RTNA 2JXMB 5DNFA 4DGZA 1J0GA 3HOUB 3I3CA 2WWZA 4IPDA 2A6EC 2F03A 4RKBA 2E2HB 3QJYA 2RGFA 4JI8Q 1SF0A 2M4NA 2SDFA 5IYCG 2LXAA 1WGGA 5FKAC 1TY2A 1OXSC 3PIP3 3VFKA 2L0TA 1V9JA 3SU8X 2ZEQA 3ZTCA 1KQSA 2F0FA 3PUXA 4QF4A 4DV0Q 3TSSA 3IFDA 4WAAA 3U7DA 2HIVA 4EQOA 3S2AA 4N9F4 3L7ZC 3DUZA 1UNSA 3M85A 2M17A 1QOHA 5M5XH 3PRMB 2PQAB 1TS5A 1V2YA 2OJWA 3E9SA 3CWIA 5MPOA 3RNBC 3Q22A 3T56B 4GDKA 3M4PA 3EFXD 2AKWB 3C1FA 3PHXB 3R2IA 4OO1I 1EWYC 4O0AA 4F87A 1YN3A 4ZOHC 2HHHL 1E9MA 1UEBA 1K3BC 1X54A 1WYGA 4QL5A 2MRPA 4F7ZA 5BR8L 3NS1A 3RUZA 1C4AA 3NVWA 2X69A 2WKCA 4BBRB 1C76A 1LM0A 2KEDA 4MN3A 4IJHA 5M5YB 2LGDA 1B2TA 4LMQD 4JPBW 3A5UA 1EO6A 4LJZC 1PH8A 4G4KA 2EXZA 1AH9A 4AJWA 5JPNC 4JYAQ 4KD4A 3Q14C 4GB9A 1X65A 2QGQA 2GBMA 1DM0B 3OOCA 2LEKA 2NCNA 1LACA 1XJVA 2EKEC 2RSOA 4EX5A 2DWQA 1UWXA 2KTRA 3GDEA 4DV1Q 2ICIA 1FCCC 3I4MB 4C56C 5D3IB 4NXNL 4BA1I 1CT1D 1SFOB 2GOWA 5EBDA 4LNQA 3ABVB 1GPXA 4ANVA 3BDOA 4DR6L 4BY1H 3J9CA 2L8JA 3BK1A 4TKOB 3RCZA 3TEXA 1CKNB 3HOZB 3T3OA 1MHWC 2PYKA 5ELBA 1GM5A 1VQHA 2LVPA 5EPJA 4FF3A 4A3DH 2FCSA 1NYRA 1SBBB 1JRPA 1X3EA 5JJLA 3LNNA 3LXFA 2LUMA 2DNCA 3MXUA 1GOZA 4OWWB 5CV9A 1PGAA 2MHJA 4KY5A 2JP1A 3PV0A 5GROA 2IWHA 5KNBA 2OTLA 5ISRA 5M3MH 1TKYA 4LFCQ 1WJ6A 2DY8A 4FXDA 5JZEB 2AQ2B 3KOJA 3PUVA 1HNWQ 2DYMA 4V190 2FJ2A 4A3MH 2R7ZG 4HJGE 1EQVA 4GZYC 2CH4A 3S2HB 5FR6A 3P2BA 5H8YE 1WE6A 3TBLD 2K8HA 5C44B 2BKFA 3DM1A 5EE0A 3NELA 3HKZB 3A1QB 5CHFA 1WZ0A 1T0QC 1BBWA 2AWOA 1O7YA 4GKJQ 1HA6A 1C0AA 2WXQA 1P8LA 3M4OB 1E24A 2K33A 5KNCA 2BDOA 2NN6H 4BA2I 1ET6A 1NAPA 4DNRB 5JJIA 5EDSA 1QZGA 1CSPA 1X55A 3D4WA 3ULJA 4S0RA 2MCNB 3OJ4B 4L5SA 4ZRQA 2P5ZX 1SIFA 4CDCC 4KSLC 3TIXA 1X56A 4C2MH 2PLPA 4J1MA 3PF5A 5M5WH 1A62A 4W9GA 1WOCA 4A3KB 4MT5A 4DDID 1KD1C 2G4DB 3N1XC 1PZJD 2PNHA 2I38A 1VQBA 4DAYA 4WIPA 2JA8G 1G291 3GTQB 2AHOB 3AM9A 1WTVA 5M3FB 1XLNA 1P0RA 4A3FB 2LVOA 1GUSA 3OTOQ 4ODGA 1H9JA 1V86A 5CV5A 4E6IA 2MBQA 3AE9B 3V05A 4AIMA 3U8ZA 4A93H 5EBCA 2XWJB 2OF1A 1P7FA 4LDTD 1S3OA 4OVUA 1QZEA 4XX5A 2L83A 4HWIB 3S1QH 2WX1A 2E76C 4GOCA 1UE5A 1XX8A 1SMYD 3UE1A 1TT2A 3QOJA 2JA5B 1TTNA 1JOOA 1ZKHA 2A69C 1HZCA 3DEPA 3P42A 1Y8PB 4ZYSA 4HMIA 1I94Q 1EQQA 4KY6A 4P2CB 3HOUG 2BT6A 4HK2A 1RL2A 1VQNA 2KKCA 2Z6KC 3A8IE 3NE5B 4C3IH 1K8AC 2EOTA 2RVLA 3S2DH 1CZGA 3ZNZB 5G5HA 1HFNA 1C79A 1L0YB 3CU7A 2W9NA 2BCOA 3VRBB 2JEBI 4GOPB 1DXMA 3LYYA 3ZNHB 3NWTA 1V1OA 3I2ZA 1HR0W 4I65A 2EE1A 1Q1OA 3KDFB 2O2LD 4YIJA 5BN3A 1X3QA 1PDXA 2A4ZA 2BGFA 3N32A 3X3NA 2XNAC 2MJDA 2KAJA 1WR1A 1SDFA 3NQIA 1N6ZA 4JCVE 4XT3B 2BW2A 1UBIA 2IW3A 3H8HA 1JQ4A 4IUUA 1VQ5A 3ND8A 1KL9A 3DHQA 1ESRA 1H9KA 4DV1L 4QCLA 2NZHA 1G91A 3TZDA 3ZXVA 2MLBA 2JWUA 5H92C 1QVFA 3Q2AC 3KUZA 2CCZA 1BQQT 4L23A 5EPKA 2EMSA 3T1YQ 4DV4Q 1MVKA 2KLCA 1E7UA 2WXPA 3I8ZA 1SYBA 3A4SC 1JC7A 1F2RC 3WOEA 2OCEA 4LTUA 5EAYA 1WIAA 4GDLA 3W9CB 5D3DA 3EUB2 3H0GB 1V8CA 4BBRG 1B50A 1ZW7A 2IDYA 2PVOD 2M1MA 2F3WA 2ZXOA 4FF1A 3CSTA 1PQSA 3G71A 4YCVA 4H44C 4LFCL 2DX5B 5IN7A 1ENFA 3L08A 3M4YA 1VQJA 3OMCA 3DBSA 1H8CA 1QF6A 4L63B 4MJSA 3T3NA 1TWAB 2C35B 4R1JA 1O7ZA 2R7DA 1V80A 5DPSA 2OT2A 3I4MG 4M02A 1M4VA 2Y5BB 4CKCA 5D65A 1L7YA 3P1HA 4XQJA 2IO1B 2F0TA 1VQIA 1YHQA 5C0XG 2R7ZH 1EEID 4F88A 3SEBA 5EKIA 4MM3A 3VR3A 1TWCH 3HOZG 2EQSA 1XT9B 4C1NK 3RZOB 2WXKA 1Y8RC 1NR4A 3NPPA 2K7VA 1JWAD 2PO4A 2NVTB 4A3PA 2VQEQ 4DR1Q 5IGFA 3J7AV 1OFFA 3RZWC 3ZIMA 4LK1C 5J1ZA 3TP6A 4F8CB 3PRZA 1E1TA 1YNXA 2I46A 4KGRA 1E2WA 4FJVB 3OTOL 3AEBB 1NBFC 2XVSA 5FOBB 5C44G 4CDEC 3DDCB 5J22A 4L5QA 2F0GA 2QKIC 4XC2A 3NTIA 2WFWA 2JA8H 2PKOA 3AEGB 1HTQA 3MC0B 1BNZA 1BO0A 1J5EQ 1WMHA 1PH6A 4AQYQ 1L4ZB 3K9OB 2G1EA 3PSEB 3RPFC 4B3RL 1R4MB 3T9LA 4M8AA 2SOBA 3CCSA 1LYLA 1WFYA 4C7YA 4P71A 1LTGD 2RQXA 5HG2A 4RGMA 2HCCA 1J19A 2OHFA 1WYDA 1CHQD 4C4VB 1YIJA 3A9KA 3DBLI 4FN2A 3RT3B 1QILA 1ZGUB 3PO2B 4WRDA 2DENB 2NS5A 4LJPB 3HKZE 3C8YA 1Y1WB 3IBEA 4HIOA 2LGXA 3IFWB 3V60A 2ZPNA 5C0XJ 3E5SA 1YNND 2AX5A 5M3FG 4K8IA 4A3FG 3UI2A 2BQQA 1F2MA 4QMGA 1SXTA 4KZCA 3P7JA 2XEWA 4XDXA 3EHVA 4C7ZA 3M7GA 1JWSD 1KLGD 2ZTDA 4GU2A 2VZAA 2WKDA 3T16A 4XYOA 2F0WA 1KNAA 3EFCA 1VF7A 3ND9A 4AH6A 1N9WA 3GO5A 3T1YL 4DV4L 2KC2A 1K0SA 1XMOQ 2JA5G 1LT4D 5HKHA 1E0BA 3ER0A 3DVNU 4KIKA 3DEOA 1E3PA 3N6RA 5JEAH 3R7QA 1KDAA 1FYCA 3VR2A 4FF4A 3EBEA 3SFDB 1H9SB 3A54A 4ZYNA 3AH7A 4WORA 4ITKA 1D5MC 1Y8OB 5JVG3 4YSYB 4X66Q 3R3OA 1ASZA 3HOVB 2JZ3B 3W5VB 1EY6A 2VQFQ 3KF8B 2J0TD 3CCJA 1WVLA 3KUCB 3L54A 4HCNB 1PTOF 2BA1A 3CRLC 3GP7A 1T5EA 3A8KE 1DJRD 4B0MA 4DHZB 4KX6B 1U0LA 1YMHE 1YJNA 1N60A 4QQBX 2N7JA 5M5XB 3EGRA 2F0NA 1GC7A 2KFJA 5C4JB 3ZNGC 2EY5A 3JSVB 4HDQA 4IO9A 3UQAA 4ME3A 4BBRH 4GOPC 4AWJA 2K3UA 1HZ9A 5BN4A 2JVCA 4RHSA 3J7AF 2UXBL 2QIEB 5AZGA 2HDLA 1OXTA 3K58A 2ONQA 1LTSD 4GXBA 1L1OB 3ZUNA 1J8CA 1IXRA 1MI2A 4MSQB 4OGQC 4HIKA 4PYUA 3ULLA 3HRZC 1PGBA 4GN3B 1IBLQ 2F0QA 3KLWA 1CK1A 2BE5C 4K8JA 3M9BA 4LFBQ 4K7WA 3AQQA 1S40A 3I73A 1SIJA 1PHJA 5KHQA 1PFMA 3TMEA 4DUYQ 3AB5A 1D7QA 2KX3A 2K5DA 3I4MH 2CHZA 2WXJA 3TS2A 3H0GG 3OYYA 5C3EH 4LWCA 1BF4A 2BF8B 4OL7A 5C0XH 1CUKA 3TS0A 1FEHA 1PFSA 4II2B 5C1ZA 1S3SG 1UD7A 1D1IA 3HOZH 1HZBA 2QC8A 4GLVB 1TU2B 4K6DA 5GAGC 5C2TB 2RKSA 3QWNA 4ANUA 1VQGA 3CD6A 1YX6B 5LXIB 4N9PA 1P3QU 3V61A 1K50A 5CGKA 1XO3A 3N20C 3QQ8B 3B08A 4NJ6A 3K59A 1CSQA 1HJPA 3KBXA 2JRHA 2W55A 1GB4A 4KHZA 4IFDI 4WQOB 1YEZA 3ERQA 4HN7A 1R4NI 1STNA 2AL3A 4A90A 4JBJA 4QUFA 2NPTB 2C5LC 2L32A 3K9PB 4XZ4A 2K50A 4A3DB 4H0LC 1XNRQ 1YJJA 2J0KA 3S2HH 1XMQQ 1UE7A 4LDTB 4PQXA 1E2ZA 5C44H 2WXFA 5IYBG 1N33Q 4UY8C 1CQVA 4KJNA 2EYHA 2L15A 2MP1A 2F3IA 3WCQA 3E9IA 1WH3A 1WTOA 3NENA 1YN5A 3IHPC 1BUIC 2F0VA 3AU5A 3HK0A 2MP2A 2DJFC 4EZKA 2N8NA 3BDLA 4HDOA 4O42A 4KZ0A 2EIFA 5ELDA 1WTPA 1KF6B 4K3CA 3N1YC 5JHBA 2K5HA 5DM63 2QW7A 2X8XX 2F0PA 3N3KB 3L9AX 3I56A 4X3SA 4YSZB 3I63C 1AN8A 2PZUA 4A3KH 5EKKA 3W5OA 3J80E 3K5MA 4GGQA 3EA6A 3WAMA 1VQ4A 1HNZQ 4K0KL 1HNXQ 1ZPSA 1I3QH 1B9MA 3GTQH 3LX0A 2K5NA 1Q8KA 4JV5L 1WSPA 2FE8A 2JSOA 3PLUA 4FHJA 2CFMA 4Q2JA 5M3FH 2GBKA 1EZ6A 1MGSA 4A3FH 3TRZA 2VNUD 1YN4A 3PS6A 5IP4D 1TWFB 4CQNA 1J7BA 2LXKA 2PW7A 2N9KA 4RWSC 2DGYA 2VZKD 2CU1A 4BOZB 1QJOA 4GDKB 2K6AA 2E75C 2FMCA 4EQNA 3TEZA 4DAMA 1Y1VB 2VXWA 2N9LA 3RMHA 1DONA 2PMVA 2VQFL 3B1LX 2KBNA 5D6JB 1U4LA 3ZW3A 2MBBB 3R8BA 2WP9B 1F9PA 1LTID 1HHVA 1VQ7A 2HD5B 3PO2G 2PZTA 2KHWB 2ZNVB 4HJKA 1Q5WB 3QA8A 3QR8A 1Y1WG 3PZDA 1QB5D 4NZLB 3U9OA 3VR8B 4RG1A 4PMWA 1WWTA 4ZK9B 2N4FA 4LLGM 4NB3A 2KANA 1YNTE 5HFYA 2F0JA 3HG9A 5DLQE 2CHBD 5C3XA 2J42A 3DVGX 3KK7A 2IY5B 1G8ZD 3T13A 2L11A 1NI2A 3KFUA 4HIDA 4IPGA 2HTME 4PV1C 3HUIA 1VR9A 2KMAA 3KW5B 4KVGB 1K9MC 3DBRB 1GUAB 3NRZA 3U4ZA 3HVZA 1PFNA 3CQZB 3F2CA 1AYFA 2KTRB 5E6JA 1KJTA 1TT5B 4DXFA 4HJ9A 2PI2E 4DUYL 3NSWA 2K5PA 3FDTA 3PZ8A 2EYLA 4OHJA 2N49A 4HCEA 5G3LD 1LT5D 3PHWB 1OGWA 3HOVG 1WGYA 3Q23A 3N30A 1G6JA 2KVZA 5GAEC 3E9HA 1ONLA 1V1PA 4KKJA 2IX1A 4ZCKA 2IY0B 1GVPA 4FHKA 1WJ4A 1IPGA 4HEDA 3H0GH 1E8YA 4YTPB 1E8XA 3D3RA 3RN2A 1DOLA 1DYQA 3SDLC 4I7AA 4JI3Q 4LF5Q 1SAPA 1E90A 4X62L 4FO2A 4IUPA 4LNNA 2O5IC 1AW7A 1ZDVA 3LDZE 1IP9A 3CF5A 4MGIE 4RKLA 1JWUD 2D10A 1EY0A 5EE3A 1ZE3D 4J6IA 1E10A 1Q46A 1XNRL 3Q3FA 1XMQL 4II3B 4A9AA 1CM9A 1X1MA 3GZNI 1GUTA 1VDZA 1HXYD 2GVAA 2RHQB 4S17A 4W9CA 4DHZE 1L1OC 3G48A 1X9NA 3H09A 2A6HD 5J3BA 2WXLA 3N1ZC 3L0OA 1OQQA 3DWGC 2Z9HA 3AE3B 3CHBD 3FRPB 1HTPA 2D07B 2WGSA 1SJHD 5FLXE 1E22A 3PUYA 5IGCA 3RNCC 3ULPA 1IBXA 4YWKA 5CV4A 3KUPA 4MGZE 5IYBH 1L6VA 3RZOH 1WTXA 3CAMA 2FFKB 2A68D 2LXJA 1PH1A 3DQVA 4DK1A 2KCMA 1J7CA 3AV8A 1QG7A 2L9HA 3EC8A 2KWCA 1EOVA 4AJYB 1FFUA 2O2VA 4WH4A 4XIGS 3AEAB 1UBQA 4JI7L 2LGYA 1TKGA 3H9DA 1HNZL 4BKGA 4KN7C 4W9FA 1VQPA 2RF4A 2C7NB 2FUG1 4HJAA 3NUHB 3QHTA 1HEZE 4MDKE 1MJDA 4DK5A 1LM8B 4A3DG 3IT4B 2N1VA 1C8CA 1MG8A 4EEWA 1FXIA 3O65B 2IGGA 5IOCA 3CW2C 1EF5A 1WRIA 4N9TA 2QEXA 2VL6A 2EVBA 2JYOA 2L7RA 2RA4A 1OXUA 5M3MG 2ZZPB 1FNUA 5BO4B 4BAXA 2MWSB 1YX5B 1QWYA 5EE9A 3NJTA 4E3CA 4JWSC 5C4HA 5D2MB 1XPUA 3F2UA 3PIOA 1VQMA 2KNBA 4JOIA 3G4SA 2JK8A 4KHPQ 4I6LB 1FPYA 3RI7C 2F0OA 1VDVA 5ELNA 3JAME 2GI9A 3PO2H 1SMXA 4JI1Q 2GVBA 3W2DA 4DN4M 3PTFC 5EQ0A 1Y1WH 1K8RB 1EU4A 4OIKA 1IYVA 1ZUD2 4KKSA 4EE2A 2LJIA 1E1OA 4YHHL 5IIFA 2E2DC 3F2BA 1R9TB 4BXXG 1CTMA 1JQYD 2RSNA 1TJEA 2DAJA 2L12A 3GE8C 1NENB 3SK4A 2PQEA 1L5PA 2GLSA 1HCZA 4TVAB 3GS2A 2K5WA 5CHVC 3UDFA 2UUAL 4RM8A 2K4KA 3L10B 4DAVA 1T3QA 1E7PB 3BIID 3MHBA 4R4IA 3J7ZC 2MJEA 2K5VA 4R4CA 4NPSA 1FGBD 4KK7A 4PZ8A 4FA6A 2NVUI 1YOVB 2DY7A 3RNUA 3AI5A 4IM3A 1BCPD 4HSVA 2BS2B 2EELA 4IWQA 3F1ZA 4ZAIA 1GJXA 1WI0A 4B9XA 5JPMC 1PLFA 2R61A 3FPUB 1V97A 2ZCCA 1V9PA 4KHVA 2PTLA 2W54A 4W9IA 2QEJC 2IX3A 5EGTA 4JW0A 4A93G 2JX5A 1LABA 2XK5A 1I4QA 3HOVH 1EWIA 4OVVA 3ENEA 1Q1EA 2G4SA 2HQEA 1DCZA 3ZDTA 1F2ZA 3PREA 1CZWA 2I5HA 3SR1A 1NYQA 2ZNVC 4KKUA 4OEMB 2FHTA 4J8QA 2G3QB 3B2GA 5L95C 3VRAB 4RNAA 2J7ZA 2FCMA 1I6VC 1C78A 5C4JH 4PS8A 4ARIA 3QIAA 3APCA 1F2LA 5T8IA 1WI5A 4C3IG 1A3TA 2Q2TA 3AEVA 1YIWA 3VR5A 4NAWA 2B3GA 4PNYA 3DHIC 1RJTA 2IPKD 5L37A 4IC7B 1PRTC 1Q81C 3KJPA 1JORA 1DGJA 1E7VA 2VUMB 1VRAB 4HSPA 2OQ0A 3K57A 1IBKQ 2ZVNA 3MFYA 2DZMA 1O78A 3L0WB 2LASA 2WINB 1J8IA 2A8VA 1KDBA 2K1FA 1C7YA 1K28A 4X3UA 2V4IB 4BOSC 3N52A 1BDOA 2W82A 4UP8A 2BH8A 1AARA 4JI6L 2CH4W 2D3BA 1TS4A 1EZ8A 2IX0A 5I2YA 1IHZA 3TP7A 1BMLC 2F0KA 5GAHC 4O2DA 3K7AB 1LT6D 4N58A 1L0XB 1PVOA 1S72A 1ZP0B 3DWAA 1H9RA 3VR9B 5FR3A 1GJZA 3MZ5A 4DFAA 2W3SA 1VF5C 3SDZA 1WXAA 3BYTB 1XNQL 4HXDA 3I55A 1HR0L 2LRUA 3S1NH 3U52E 1EY7A 4LNIA 5EJWA 5C3EB 4L1BA 4M8NA 2WIIB 2NN6I 2JT4B 4EOYA 1ZXIA 1BOSA 1ET9A 4LJOB 2MNAA 1P9DU 1WMHB 1B7YB 4E74A 2Z0EB 2LY7A 5EE1A 3K6OA 1JOQA 3A33B 5I9PA 2VZKB 4WJ3M 2IJ0A 3AYHB 5FO7B 2L0FA 2RD0A 1Y56A 1W6KA 3AMUA 1NEKB 1TXYA 1STEA 4OELB 4B0EA 4FADA 2WS3B 2AQ3B 4X64L 1TGZB 2PMZB 4KHPL 5CX3A 4DV2L 1U4RA 5CR3A 4K6LA 3S24A 4BY7B 4JI1L 1MJEA 1NMGA 2GRIA 1Q10A 4A6QA 2X6GA 3SFEB 3V2TA 4P1CC 2AQ1B 2NVYB 2KWUB 4IM0A 3Q69A 4NPNA 4R8IA 2MFIA 2WHIA 4FXKC 1ENCA 5FLMG 1ZEQX 3TL5A 2V1YA 3S17H 4ME5A 4MTKA 4ULLA 2EYPA 4JI2Q 1YJWA 4G11A 4RCNA 1YNNC 3M62B 3Q8EA 1SNCA 1VQAA 3EROA 2KOLA 2X6LA 3H6MA 3H7PA 5DPTA 4JWUC 2K9XA 4KIKB 4BXXH 1L2NA 1SE9A 4WAFA 1LTTD 4GS3A 1FCLA 1SYFA 2N55A 3KYHC 3KUDB 3VUYA 2GBJA 1TWFH 4DKAC 4DXAB 3PO3B 4J6HA 2YYZA 4BBSH 4JI8L 3TEWA 1PZKD 1HRJA 1NE3A 3UGBB 1QOBA 1WY8A 3CC2A 2LVQA 1YZ6A 1Y1VH 1S1QB 1OTCA 2JEAI 3GTKH 4DR7Q 2INCC 2K01A 2KMMA 3Q6SA 2RHSB 1I3QB 4ID6A 5G2NA 4DV0L 2ASQA 3PZ7A 4AQ7A 5CC4A 4UHVA 3K5OA 1KAWA 3OW7A 1H95A 5E6NA 1OXVA 5NUCA 5L83A 3JC66 3VA5A 3ML8A 4HR7B 3FKIB 1TVXA 4MNOA 1JT8A 1TS3A 2BS3B 2I1JA 2WAQB 3NQTA 4WWPA 3Q8BA 2BS4B 1CA5A 4IWPA 4W9DA 5E6OA 1Q0WB 2QDBA 4IURA 3VA7A 1L4DB 2D62A 5I4DA 3IKJA 4LNOA 5I2XA 3BVMA 4YSXB 1LV9A 1JWBD 3OW2A 5HURA 2MBOA 4A3IH 5I6YA 3UQBA 3AEEB 2OEOA 2C7HA 2RMMA 3WAOA 3ZTDA 2B2VA 4UAIA 3CC7A 1VQCA 3CQZH 3EFUA 5JAVA 1D4BA 4EGVA 3HS0C 2J52A 2B76B 3I4LA 4W9JA 1SE3A 2I5LX 4Z9CB 3OIPA 5JOBA 5K36H 2QCPX 4CDFC 3LWEA 5CHWA 1N34Q 1QUQA 2Z6BA 3K8AA 1CI3M 4JYAL 1WZ3A 2KMCA 3L13A 2EJMA 4A3BB 5GXGB 2XSCA 3C19A 4DXGA 1FGUA 2LSSA 2KJHB 1WXMA 4X3TA 5JEAG 3GTLB 1JR0D 1RF2D 4EUTA 2CJNA 4KDLB 3HRDD 1X32A 1Z7TA 3RN5A 2IL8A 2L05A 3TEYA 1QT9A 1I4HA 2F0IA 3I5JC 2QILA 1I35A 3CCMA 2EYMA 2GA4B 2O4XA 1EQRA 1VQ8A 1EFWA 2VUMG 1STHA 1HTOA 3NBHA 2FBWB 3MC8A 3OLMD 3NZUA 1TKEA 3IL8A 3Q24A 2UXCQ 1B4OA 3GTPH 1B8AA 2WXOA 4FP5D 3V6CB 4REZA 3WA0A 2AEHA 2AL6A 2L00B 4URKA 4ICVA 3BJUA 3IAM1 2BH2A 3FAHA 1A3VA 4BKSA 1EM7A 3NTHA 4MEMA 2MP2B 2B2WA 1FJGQ 1C1YB 1Z5SB 2HD3A 3LWUA 1LXDA 2INNE 2QF7A 1J7AA 2NBUA 4BBNC 5IGEA 1HNWL 1K52A 1TQOA 1F9SA 1KDCA 1PRTD 2H1EA 4A75A 2EMTA 1DGSA 2ON8A 3RD2A 4A3LG 4ZRKA 1KTKA 3IFTA 2IZVB 2KJRA 2PEAA 1XQQA 3M3JA 2B39A 4TUUA 3PO0A 2KQSA 3AXCA 4DR5Q 1I50B 4IQZA 5COYA 5ELOA 3QO2A 2AWNA 2Q8TA 3U58A 2Q2IA 1K73C 3W5UB 4CKEA 4I6NB 4K7SA 4O1NA 5C3EG 4JI2L 2D5DA 1PUTA 4P1BC 2ZXRA 2ZJPA 3VQIA 3DWPA 2R92H 2MQHA 1L0VB 1KHIA 3I3TB 2RR9A 2YTVA 4KDIC 5LLIA 3W1BA 4NXMQ 5HI1A 3R2TA 5FLMH 4DUZQ 1PH9A 2JPHA 2F0UA 1VD2A 5JEAJ 3AE7B 4WFN3 3B9JA 1BT0A 2HQLA 2LUEA 2NVXB 3KH0A 5JH5C 3PCOB 3J81E 4DR7L
chains in the Genus database with same CATH topology
1BCPB 1ICWA 3AE6B 1MPEA 1EFID 5CBEE 1A3UA 1P7EA 3I57A 5BYQA 4RGNA 1C4PA 3H3VC 3MJ5A 1T5XD 1J9OA 1NSNS 1R4PB 3D6CA 1QLBB 2Y0SB 4IUVA 1IW7D 3FEWX 3K5LA 4L2YA 3J80L 2TMPA 2LKVA 1ZYRD 1GHJA 5E4XA 3BYYB 2C9OA 4XYQA 1F0ZA 4TRDA 3L4PA 1JROA 5CORA 4HTHA 4TSSA 2ZXPA 4WQMA 1V1PB 2L1AA 3A56A 3U7ZA 3VR6A 1QKZA 2F0EA 1G2TA 2NMQA 1LTBD 4M1UB 1EYCA 3MP9A 2QMTA 4YT0B 4RGOS 1SSNA 2K04A 3AMZA 2EYOA 2K1BA 1NI3A 5IT9E 4ZHPA 1RDPD 3I91A 5BYSA 4A3GB 1FRDA 4KY7A 2QJLA 3NVZA 4JX1C 4IN3A 4UDUC 5C0XI 1FFVA 5HGTA 3GQBA 4B9WA 1EU3A 1IBXB 1EWHA 3HOWB 1MI0A 3E0JA 2A6HC 2ICEC 2ZW0A 4RF0A 2HDMA 3ZYYX 1N5WA 1DZ1A 3HGBA 1FRRA 1JE4A 2EYJA 3NUCA 2MJ8A 3R93A 1CFMA 4Q5VA 1ZOYB 2A68C 1A15A 1FD7D 2F0DA 4QIWB 1H9MA 1I4XA 4KI0A 5BN5A 1IYUA 3VYRA 2B8FA 3C3LA 5CMDA 1CZPA 4V0BA 4K5XA 3S16B 3PUWA 1PFBA 1M8AA 1Y69U 2LFNA 3AU7A 1C4CA 2KACA 2K28A 4KJOA 1VLBA 2JYEA 3H94A 1XLOA 2BTEA 3P63A 5FLXL 5AUIA 2B2UC 2XN9C 3S1NB 3N9YC 1WTWA 5J39A 4RH6A 1IL8A 4TQUS 2IGHA 3TDQA 3SVMA 2LFIA 2DN8A 4K5WA 1JWMD 1QE6A 1HPCA 3SE0A 4ZKCB 5M9OA 5LNK1 1C4QA 3DWQA 4K14A 1STGA 5C5LA 2KCNA 1SNQA 3B2FA 5HHDG 2NZ1D 3NZ3A 4DQOC 2WP8J 3OMGA 1ML0D 2HUGA 1SNMA 5FO8B 2B2UA 2WXNA 3TZUA 5A2QE 4K2KA 3GTOB 3ONAB 4C1NI 2NB0A 3FMCA 1STBA 3GD7A 2Y5PA 1CA6A 3PUZA 1F77A 3RD4A 3S17B 2EJFC 1BCPC 3C2PA 1SEBD 2G9HD 4HKZE 2PPBC 2SNSA 1TIID 1YQ3B 2BA0A 2IGDA 3JAML 1L6UA 4BBSB 5CYUA 4A55A 4NAWB 2V4DA 3GTKB 1TZOA 4XXEA 4IFDH 2KECA 4KD3A 1LLRD 4FYDA 4KKTA 2JU6X 3NVYA 2NWGA 4DAPA 5A35A 4USAA 3ZGZA 4K5VA 1S4ZA 2F0SA 3WDNA 4IUNA 2Z4HA 5CBAE 2X38A 1Q3LA 2K03A 5F2DA 3OIQA 4ZRPA 1PRTB 4A3IB 1EEFD 2WDQB 4IALA 1Z47A 2SAKA 4CJ2C 5I9OA 1YQ4B 5C6AA 3AE5B 4N6EB 2CW0C 3FVQA 4ZHOA 3S1RB 3E6ZX 3M3YB 5KEEA 2KUMA 3UI3A 3HOYB 4US8A 1SNPA 4LK0M 1NR2A 3TN2A 1F9RA 2KWDA 2KA7A 2BB6A 4CBVA 5LL6X 1XEEA 1TWHB 2DNEA 4L8JA 1IGDA 1D6EC 5JJZA 3I9V1 3GTPB 1Q12A 2BB5A 2Q5WD 2BDNA 2YEPB 4ZUJA 4RA8A 4HRSA 4OZCA 4RHRA 5EPLA 2OEDA 4IOIE 1K51A 2W3RA 3KWLA 2F0LA 3AEFB 3MAQA 2K5QA 3A55A 5E1FA 2DLBA 1RM6C 3W1SA 2F4IA 3BVGA 4IDIA 2F0HA 3MEHA 1KH0A 3A7AB 2V3NA 1ACCA 3Q8FA 3EJIA 2Q8RE 1EYAA 2R92B 5T1IA 1FIQA 4JK1C 1BUVT 3P4SB 4U68A 1I4RA 3BVZA 3I4NB 3HZXA 2MHVA 1FO4A 2R93B 3T51B 1CQFA 4OO1G 3U4EG 1E2VA 2HDEA 2E2JB 2M0AA 1IKMA 2WACA 3IAS1 3KWVA 1OQRA 1WGKA 1B44D 1VCIA 3OPOA 1YNJD 1EQTA 2EY1A 3CRKC 2Z1CA 1Q1BA 2E2IB 1WTQA 1I7HA 1GAQB 5EKLA 4BS9A 2EY6A 2PCFB 1FXAA 5ELFA 2WU5B 5DM73 4H7BA 4IKGA 4FVMA 1BR9A 4IZ8A 1EIHA 5AUKA 1AP0A 1RODA 1SE4A 4C3JB 5DEHA 4GDLB 2RDFA 3C1EA 1KAAA 2MJ3A 2L1BA 1QNUA 4OW0A 1PTOD 5KIXA 1EY8A 1TKWB 1G2SA 1MSGA 4M0WA 4P6VF 4BWGB 1VMCA 1DD2A 4RCOA 4NMZA 3ETRA 1EY4A 4FXCA 3T4AC 1A2TA 1D1KA 3BZDB 1RHPA 4ILWA 1MHHE 2PNRC 2KHSA 4FF2A 2PVGC 4TQ0A 2WXRA 2N0SB 3HEJA 1ZXHA 2BYTA 1I4GA 1NVID 2LGIA 1VJKA 1O7LA 1Z6HA 5K36G 3P4QB 2B63B 4MM3B 1XYIA 2PZWA 5KYIA 3ZQ4A 3RFZB 1WD0A 1PMRA 4ARCA 1OO9B 2MH7A 5G5GA 2NTSA 2CW0D 2WXHA 3ZJUA 2LMCA 1EOTA 1II3A 1A70A 2PW5A 4OZAA 3Q0AA 1PDQA 3D6WA 1V43A 2CJOA 5AFWA 1QOGA 1VZ7A 1XXGA 4HROA 2EYFA 4RGTA 2MUYA 3FILA 2WB1B 3O13A 2FINB 3GTGB 5TSSA 2NTTA 3S15B 1GUWA 2SEBD 3S14B 1EY9A 4HAEA 2PW9A 1EIGA 2SNMA 1W6JA 3SXHA 1IW7C 2M9VA 1JCKB 2F3VA 4QB4A 1ZYRC 1LO5D 2B2TC 2JE6I 5JVH3 4OO1H 1PFDA 2D2CC 2ZT9C 1B9RA 4JBWA 4US9A 4ZKBB 1S5ED 3J81L 3KLSX 3D4DA 4C3HB 1HQRD 3IT6B 1K8OA 2L52A 2ZW1A 2IT1A 1VZ8A 1HQMC 1DOMA 4J3OD 3D8GA 2L55A 3CIRB 2L5TA 5C3WA 4JE3B 2H88B 2B2TA 5KGUA 3GTJB 4IUQA 2L4NA 4N59A 4CHTB 3SK6A 5E4WC 3DMUA 3NK9A 2Z8LA 4KMUC 1RTOA 2INPE 3VR4A 2QSDA 2B2VC 3S1MB 3D4RA 4YTNB 1ZKOA 4CJ0B 2KQ4X 1SYEA 4DK0A 4YXDB 3G7LA 1HFGA 4XE0A 2G9DA 3KQ4A 2AUKA 1YJIA 2AUJD 5IGDA 1E6EB 1KFYB 1EYDA 1HZ6A 2KEEA 5HFYA 2ACZB 1SB3C 1TY0A 3OSOA 5BMIA 4C3JG 1D5XC 1KLUD 4LAAA 2JA6B 1AEXA 1MD2D 2J53A 5IT9L 1JW9D 1I6HB 4NJCA 3KLRA 3D31A 2K05A 3BDCA 2WDRB 4G7ZC 3MXNA 1ILQA 5BMHA 2H89B 4NAMA 2B2WC 1RYJA 4MHEA 4RAUC 4D2KA 3QOLA 4L6TB 4G7HC 4KGTA 4KV6A 4ZRZA 1LTRD 3AB9A 2HCIA 2LHDA 3SHLA 4MIUA 2H4OA 4DF7A 3PIO3 4S3SA 4JPSA 1F9QA 1DOXA 3URYA 2A6ED 1LT3D 5C3JB 4A3JB 1K83B 2EY2A 1K53A 1B1ZA 1Q8IA 2KVMA 4OIJA 3K5NA 5I6WA 1TWGB 4KN4C 5G3LF 1B53A 4IUTA 3W3AA 4PMCA 1C48A 3GV3A 4XWTA 1AZPA 3CKIB 1U9RA 3RLFA 2K0PA 2D9UA 1IUEA 1FNWA 1WD1A 1WTRA 4NKLA 1C9FA 1S5FD 3MA2B 2GB1A 2I07B 2J4XA 4B08A 1ENAA 2MEKA 2ENBA 4PT5A 5KNDA 2JQRB 2WXMA 1AZQA 3GV6A 2NUCA 2K32A 5A2QL 2CU3A 3NVVA 3Q8AA 1UGJA 2YU9B 1PTOB 4C3HG 2E6XA 3V3XA 1B9NA 1T6BX 4AYBB 1NCVA 5E3FA 1JALA 3A7LA 4DU9A 3DWMA 1HA5A 2E74C 4YTMB 3AE8B 1F2RI 1GB1A 2JA7B 1WXQA 2ID0A 2M19A 1FM0D 1JICA 5DAUA 3GTMB 2EPBA 4HCSA 2M56B 3AN1A 4G57A 3NP8A 1ZDXA 2WU2B 3ZJTA 3SK5A 4DA2A 4I7ZC 2KCCA 3FPPA 2KN4A 1Q90A 3KLSA 2XRSD 1R4QB 4R9WA 1WCMB 1DOIA 3HVDA 3M7NA 4IFDG 2NVQB 1GUOA 1RCVD 5IGGA 1N61A 2M00A 2N88A 5C4XB 1OXXK 1RD9D 5K5PA 4RF1A 4YWGG 4NW2A 2Z4IA 4Y7NB 2EJGC 3J7YW 2O5JC 2C5CA 4XWWA 3VYTA 1N5XA 3C46A 1HZ5A 1DOYA 2V0GA 3AE4B 3A8JE 2WNMA 1QCBD 4ABNA 4A3EB 1D2BA 4XDCA 1BCPF 3PMFA 2WLBA 3ZJVA 1C77A 4KGSA 1MSHA 2L0CA 3I72A 5T1GA 4NDXA 3MXGA 1RFKA 2WQYB 3T53B 3K0YA 2TSSA 1TR5A 2A73B 2V3PA 1XTCD 2A69D 5ELCA 4XQQA 1N63A 3BK2A 1O80A 3NWSA 1EL0A 1UAPA 2JXTA 3P20A 1CHPD 4R3DA 3U9SA 3NBIA 1FMAD 3I90A 4IFDJ 5ELEA 1UEAB 1PYWD 1MHXA 2D5GA 3NHHA 2DBYA 3HOXB 3P1MA 5CV6A 4EQPA 2I2YA 4XTCS 4PMBA 2RDHA 2F0MA 5IODA 1ROEA 1ILPA 1FR3A 3X3MA 1S5DD 1QOFA 5BYRA 5IGBA 4K2LA 2NYZD 1YNJC 4FXGC 4H13C 5D14A 3VYSA 3RZDB 2XIWA 1DOKA 1PGXA 2RPVA 2KDMA 2XRQD 4BY1B 3MTSA 1A2UA 3P75A 2EDGA 2KJXA 5KYLA 5CV8A 4GLSC 1D5ZC 3TP5A 1TS2A 4CKBA 1KNEA 1X3PA 5KRUA 3MWYW 4EVOA 1SYGA 3SR6A 2M2LA 3KBGA 5M3MB 3MHZA 1IKLA 3EQLC 2F1MA 4A3MB 1PTOC 4OZBA 4WJWA 5LL6S 4TQ1A 3NTKA 5BMGA 2A5HA 4X3KA 1STAA 1SJED 1MBYA 1XCQL 4P16A 2R3ZA 2XWBB 2JSVX 4HKQA 3E56A 1EY5A 2BOSA 3MXPA 1XCTL 4KKIA 1BXTA 2WXGA 4F7XA 1EWCA 3MVVA 4C2MB 3OWFA 5M5WB 4XDDA 1XLPA 2JYTA 3L3OC 3OHXC 1SYDA 3MFGA 2LMCB 1QOAA 5C5MA 2MGSA 4MACA 1XF5L 4A93B 1VZ6A 1GUNA 4MH8A 4ZQ3A 2Q8IB 3FILB 3S1QB 2B8GA 4ZUIA 2A74C 1AWDA 4XQNA 4NP5A 4HEA1 4C80A 1FD6A 1UUPA 4C3IB 3IAYA 1QQRA 3S2DB 3P4RB 3QG1A 4H2AA 4TMAB 1ZXTA 2WV6D 1HTLD 3P4PB 2MPMA 3OWEB 4CJ1B 5CV7A 4FNFA 1Y8NB 2RDGA 1PXUA 2B2YC 4F8MA 3Q8CA 2KQ3A 3WOFA 2RBMA 1GUGA 3AE1B 1VMPA 1SNDA 3QB3A 2EZVA 3TUOA 4OVZA 2OXPA 1SYCA 2LHEA 2CVRA 1RKNA 1A6XA 1STYA 3TP8A 1U4PA 1SNOA 1N62A 4RFBA 4AS1A 3LB8C 2VB3X 2B2YA 1XWEA 1H9SA 5LHY1 1FNVA 5FK9C 3BS1A 4ZLTF 1BBXC 2EKIA 3KF8A 1TYGB 1I4PA 1E0ZA 1U4MA 2E3TA 1JMLA 4WWMA 1PRTF 3IXSA 2WXIA 1HUMA 1PTOH 4XT1B 1F2YA 2WDVB 1AFPA 1B3AA 1S5BD 2BE5D 2CQAA 4Q0FA 2VB2X 4U673 3S9WA 1S5CD 2R7ZB 2FMMA 3GB1A 1K8MA 3EVQA 5JXVA 3TBIB 1TWCB 1KRHA 2DYOA 1CJEA 3AE2B 4QUCA 2NBFA 3V96A 1GHKA 3AEDB 4KTAA 4R8NA 1KABA 3I70A 1RWSA 2LS01 3VYUA 3BWUD 1UWMA 4HMJA 1IGCA 3SK8A 2JZPA 1QNKA 1V8QA 3FC4A 1GXDC 1XLQA 1ESFA 1JOKA 1SE2A 3G6JB 3NXWA 4CGYB 3DXJC 2BBCA 1SMYC 1NUCA 3ITPA 3U2SC 1G6ZA 4DNTB 2YEPF 2JA8B 1JB3A 2PIAA 2NN6G 1LTAD 4A8XC 3HP3A 1SSOA 3H91A 5D7GA 3BG3A 4G7OC 3AECB 2R6GA 5C4ZA 1R7SA 5FO9B 1PZID 2Y3AA 4WURA 1HUNA 2Y5CA 1RTNA 2JXMB 5DNFA 4DGZA 3HOUB 3I3CA 2A6EC 2F03A 4RKBA 2E2HB 3QJYA 1SF0A 2SDFA 5FKAC 1TY2A 1OXSC 3PIP3 2F0FA 3PUXA 4QF4A 3TSSA 3IFDA 4EQOA 3L7ZC 3DUZA 1UNSA 3M85A 1QOHA 1TS5A 3E9SA 3CWIA 5MPOA 3Q22A 3T56B 3EFXD 3C1FA 3R2IA 4OO1I 1EWYC 4F87A 1YN3A 4ZOHC 1E9MA 1WYGA 3NS1A 3RUZA 1C4AA 3NVWA 2X69A 2WKCA 4BBRB 1C76A 2KEDA 4MN3A 5M5YB 1B2TA 4LMQD 4LJZC 4G4KA 2EXZA 5JPNC 4KD4A 1DM0B 3OOCA 2LEKA 1LACA 2RSOA 2DWQA 1UWXA 2ICIA 1FCCC 3I4MB 4C56C 5D3IB 4BA1I 1SFOB 1CT1D 5EBDA 3ABVB 1GPXA 3BDOA 3J9CA 3BK1A 4TKOB 3TEXA 3T3OA 3HOZB 2PYKA 5ELBA 5EPJA 4FF3A 1NYRA 1SBBB 1JRPA 3LNNA 3LXFA 2LUMA 2DNCA 3MXUA 1GOZA 1PGAA 5CV9A 4KY5A 2JP1A 3PV0A 2IWHA 5KNBA 5ISRA 1TKYA 2DY8A 4FXDA 2AQ2B 3PUVA 2DYMA 4V190 2FJ2A 4HJGE 1EQVA 4GZYC 3S2HB 5H8YE 5C44B 5EE0A 3DM1A 3HKZB 2AWOA 1HA6A 1O7YA 2WXQA 3M4OB 2K33A 5KNCA 2BDOA 2NN6H 4BA2I 1ET6A 1NAPA 4DNRB 3D4WA 4ZRQA 2PLPA 4J1MA 4A3KB 4MT5A 1PZJD 2I38A 4WIPA 4DAYA 1G291 3GTQB 3AM9A 1WTVA 5M3FB 1XLNA 4A3FB 1GUSA 3AE9B 4ODGA 1H9JA 5CV5A 4E6IA 3V05A 5EBCA 2XWJB 2OF1A 1P7FA 2L83A 2E76C 1XX8A 1SMYD 2JA5B 1TT2A 3QOJA 1JOOA 2A69C 3DEPA 3P42A 1Y8PB 4ZYSA 4HMIA 4KY6A 4P2CB 2BT6A 3A8IE 3NE5B 2EOTA 2RVLA 1CZGA 5G5HA 1HFNA 1C79A 1L0YB 3CU7A 3VRBB 2BCOA 2JEBI 1DXMA 3LYYA 3NWTA 1V1OA 4I65A 2EE1A 2O2LD 4YIJA 5BN3A 1X3QA 1PDXA 3X3NA 2XNAC 2MJDA 2KAJA 1SDFA 3NQIA 4XT3B 2BW2A 2IW3A 3H8HA 1JQ4A 4IUUA 3ND8A 3DHQA 1ESRA 1H9KA 4QCLA 1G91A 3TZDA 2JWUA 5H92C 4L23A 1BQQT 5EPKA 2WXPA 1MVKA 3I8ZA 1SYBA 1JC7A 1F2RC 3WOEA 4LTUA 3W9CB 5D3DA 3EUB2 3H0GB 1V8CA 1B50A 2IDYA 2PVOD 2F3WA 2ZXOA 4FF1A 4H44C 1ENFA 3M4YA 3OMCA 1QF6A 4L63B 3T3NA 1TWAB 1O7ZA 2OT2A 1M4VA 4CKCA 5D65A 3P1HA 4XQJA 2F0TA 5C0XG 1EEID 4F88A 3SEBA 5EKIA 3VR3A 4C1NK 3RZOB 2WXKA 1NR4A 3NPPA 2K7VA 1JWAD 2PO4A 2NVTB 5IGFA 3J7AV 1OFFA 4LK1C 5J1ZA 3TP6A 2I46A 4KGRA 1E2WA 3AEBB 2XVSA 5FOBB 5J22A 2F0GA 2QKIC 3NTIA 2PKOA 3AEGB 3MC0B 1BNZA 1BO0A 1L4ZB 2G1EA 3RPFC 4M8AA 2SOBA 4C7YA 1LTGD 2RQXA 5HG2A 4RGMA 2HCCA 2OHFA 1CHQD 1QILA 3PO2B 4WRDA 3C8YA 1Y1WB 5C0XJ 3E5SA 1YNND 2AX5A 4K8IA 3UI2A 1F2MA 4QMGA 1SXTA 3P7JA 4XDXA 4C7ZA 3M7GA 1JWSD 1KLGD 2WKDA 3T16A 4XYOA 2F0WA 1KNAA 1VF7A 3ND9A 3GO5A 1LT4D 1E0BA 3DEOA 3N6RA 5JEAH 1KDAA 3VR2A 1FYCA 4FF4A 3SFDB 1H9SB 3A54A 3AH7A 4WORA 4ITKA 1D5MC 1Y8OB 5JVG3 4YSYB 3R3OA 3HOVB 3W5VB 1EY6A 2J0TD 1WVLA 1PTOF 2BA1A 3CRLC 3GP7A 1T5EA 3A8KE 1DJRD 4B0MA 4KX6B 1YMHE 1N60A 2N7JA 5M5XB 3EGRA 2F0NA 5C4JB 2EY5A 2K3UA 2QIEB 5BN4A 1E10A 4RHSA 3J7AF 2HDLA 1OXTA 3K58A 2ONQA 1LTSD 1MI2A 4OGQC 3HRZC 1PGBA 2F0QA 1CK1A 2BE5C 4K8JA 1SIJA 3I73A 1PFMA 3TMEA 3AB5A 2K5DA 2WXJA 1BF4A 4OL7A 5C0XH 1FEHA 1D1IA 1TU2B 4K6DA 5C2TB 2RKSA 3QWNA 4N9PA 1K50A 5CGKA 1XO3A 3K59A 2W55A 1GB4A 3KBXA 4KHZA 4IFDI 3ERQA 4HN7A 1STNA 4A90A 4QUFA 2L32A 4A3DB 4H0LC 1YJJA 4PQXA 1E2ZA 2WXFA 1CQVA 4KJNA 2EYHA 2MP1A 3WCQA 1WTOA 1YN5A 1BUIC 2F0VA 3BDLA 4O42A 1KF6B 5ELDA 1WTPA 5DM63 2F0PA 3L9AX 4X3SA 4YSZB 1AN8A 2PZUA 5EKKA 3J80E 3K5MA 3EA6A 1ZPSA 1B9MA 3LX0A 1WSPA 2FE8A 2JSOA 4Q2JA 1EZ6A 1MGSA 2VNUD 1YN4A 4CQNA 1TWFB 1J7BA 2PW7A 2N9KA 4RWSC 2VZKD 1QJOA 4GDKB 2K6AA 2E75C 2FMCA 4EQNA 3TEZA 1Y1VB 2VXWA 2N9LA 3RMHA 1DONA 2PMVA 1U4LA 3R8BA 2WP9B 1F9PA 1LTID 1HHVA 2PZTA 1QB5D 4NZLB 3U9OA 3VR8B 4PMWA 1WWTA 4ZK9B 4LLGM 1YNTE 2F0JA 3HG9A 2CHBD 5C3XA 2J42A 3KK7A 1G8ZD 3T13A 2L11A 2HTME 4PV1C 3HUIA 1VR9A 3NRZA 3HVZA 1PFNA 3CQZB 1AYFA 5E6JA 4DXFA 2K5PA 3NSWA 3FDTA 3PZ8A 2EYLA 4OHJA 4HCEA 5G3LD 1LT5D 3Q23A 1ONLA 1V1PA 4KKJA 2IX1A 4HEDA 4YTPB 3D3RA 1DOLA 1DYQA 1SAPA 4FO2A 4IUPA 2O5IC 1AW7A 1ZDVA 4RKLA 1JWUD 1EY0A 5EE3A 1ZE3D 4A9AA 1CM9A 1GUTA 1VDZA 1HXYD 3H09A 2A6HD 2WXLA 1OQQA 3DWGC 3AE3B 3CHBD 3FRPB 1HTPA 1SJHD 5FLXE 3PUYA 5IGCA 1IBXA 5CV4A 3KUPA 1L6VA 1WTXA 2FFKB 2A68D 4DK1A 1J7CA 3AV8A 1QG7A 2L9HA 1FFUA 4WH4A 4XIGS 3AEAB 1TKGA 4KN7C 2FUG1 3NUHB 1HEZE 3IT4B 1C8CA 1FXIA 2IGGA 5IOCA 1WRIA 4N9TA 2EVBA 2JYOA 2RA4A 1OXUA 1FNUA 1QWYA 5EE9A 4JWSC 5C4HA 3F2UA 2F0OA 1VDVA 3JAME 2GI9A 3W2DA 4DN4M 5EQ0A 1EU4A 4OIKA 1IYVA 1ZUD2 4KKSA 4EE2A 2LJIA 5IIFA 2E2DC 1R9TB 1TJEA 4JWUC 1CTMA 1JQYD 2RSNA 2L12A 1NENB 3SK4A 2PQEA 1L5PA 1HCZA 3GS2A 2K5WA 4DAVA 1T3QA 1E7PB 3BIID 3MHBA 2MJEA 1FGBD 4KK7A 2DY7A 1BCPD 4HSVA 2BS2B 2EELA 4ZAIA 1GJXA 1V97A 5JPMC 4B9XA 1PLFA 2R61A 3FPUB 4KHVA 2PTLA 2W54A 2QEJC 2IX3A 5EGTA 2JX5A 1LABA 1I4QA 1Q1EA 2HQEA 1DCZA 1F2ZA 1CZWA 1NYQA 3SR1A 4KKUA 2FHTA 4J8QA 3B2GA 3VRAB 4RNAA 2J7ZA 1I6VC 1C78A 4ARIA 3QIAA 1F2LA 4C3IG 1A3TA 3VR5A 4PNYA 1RJTA 2IPKD 1PRTC 1JORA 1DGJA 1VRAB 2VUMB 4HSPA 3K57A 3MFYA 1O78A 2WINB 1J8IA 1KDBA 4X3UA 2V4IB 3N52A 1BDOA 2W82A 1TS4A 1EZ8A 2IX0A 5I2YA 1IHZA 3TP7A 1BMLC 2F0KA 3K7AB 1LT6D 4N58A 1L0XB 3VR9B 1ZP0B 3DWAA 1H9RA 5FR3A 3MZ5A 4DFAA 2W3SA 1VF5C 3SDZA 3BYTB 3U52E 1EY7A 4L1BA 5EJWA 5C3EB 2WIIB 2NN6I 1ZXIA 1BOSA 1ET9A 2LY7A 5EE1A 3K6OA 1JOQA 5I9PA 2VZKB 2IJ0A 5FO7B 1Y56A 1W6KA 3AMUA 1NEKB 4B0EA 1STEA 2WS3B 2AQ3B 2PMZB 1U4RA 5CR3A 4K6LA 4BY7B 2GRIA 1Q10A 4A6QA 2X6GA 3SFEB 3V2TA 2AQ1B 2NVYB 3Q69A 4R8IA 4FXKC 1ENCA 1ZEQX 4ME5A 4ULLA 2EYPA 4RCNA 1YNNC 3Q8EA 1SNCA 3EROA 2KOLA 2X6LA 3H6MA 2K9XA 4WAFA 1LTTD 1FCLA 1SYFA 2N55A 3PO3B 4J6HA 2YYZA 3TEWA 1PZKD 1HRJA 1QOBA 2JEAI 2KMMA 2K01A 3Q6SA 1I3QB 4ID6A 3PZ7A 4AQ7A 5CC4A 3K5OA 3OW7A 1OXVA 5NUCA 3VA5A 4HR7B 3FKIB 1TVXA 2BS3B 1TS3A 2WAQB 3NQTA 3Q8BA 2BS4B 1CA5A 2QDBA 4IURA 3VA7A 1L4DB 2D62A 5I4DA 3IKJA 5I2XA 3BVMA 4YSXB 1LV9A 1JWBD 5HURA 5I6YA 3AEEB 2OEOA 2RMMA 2B2VA 4UAIA 1D4BA 5JAVA 4EGVA 3HS0C 2J52A 2B76B 3I4LA 1SE3A 4Z9CB 3OIPA 5JOBA 5K36H 2QCPX 3LWEA 1CI3M 2EJMA 4A3BB 5GXGB 2XSCA 4DXGA 4X3TA 5JEAG 3GTLB 1JR0D 1RF2D 2CJNA 3HRDD 1X32A 1Z7TA 2IL8A 3TEYA