3RD2A

Nip45 sumo-like domain 2
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
82
structure length
82
Chain Sequence
MHHHHHHSQQLQLRVQGKEKHQTLEVSLSRDSPLKTLMSHYEEAMGLSGRKLSFFFDGTKLSGRELPADLGMESGDLIEVWG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transcription
molecule keywords NFATC2-interacting protein
publication title DNA repair and global sumoylation are regulated by distinct Ubc9 noncovalent complexes.
pubmed doi rcsb
source organism Homo sapiens
total genus 16
structure length 82
sequence length 82
ec nomenclature
pdb deposition date 2011-03-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF11976 Rad60-SLD Ubiquitin-2 like Rad60 SUMO-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 3rd2A00
2JF5A 2K6QA 4URKA 3U8ZA 3ZDTA 3AI5A 1WYWB 4TKNA 1G6JA 2G3QB 4LJPB 1WZ3A 3L10B 1Q0WB 3QQ8B 5E6NA 2BF8B 4G50A 3EFUA 1WXMA 1Z2MA 3RCZA 3VQIA 5C1ZA 3L16A 2L00B 5L95C 3SD5A 3ZW3A 2KKCA 3DBLI 3UF8A 4HDOA 1VD2A 2XEWA 1A5RA 4W9FA 4DK5A 4DHJB 1JRUA 3L54A 2KMCA 2K1FA 3NS8A 3JSVA 2IBIB 2JWZA 4IM3A 2MP2B 2KWCA 2IO3B 3VAWA 3UQAA 4RMAA 3KYCD 3TMPB 5BO4B 3A9JB 3KUCB 1CMXB 4KSKC 5D2MB 2O6VD 3A1QA 5JHBA 3VUWA 4DBGA 2LRWA 4IW0A 3MHSD 3PLVA 5CTRC 1WF9A 1XD3B 3KH0A 3PHWB 1WZ0A 4PS7A 5L83A 1WR1A 2DYMA 3RZFA 1S1QB 4LJOB 1U4AA 4NY0A 4HVBA 4JQWC 5AZGA 1P1AA 3NOBA 3SHQA 2G4SA 2AWTA 2KQSA 4JGHB 5DPRA 1WX9A 2LGDA 4W9GA 4AOFA 4X57B 1K8RB 2ASQA 3QC8B 5J2RA 2K8HA 4NNJB 2MBHA 3A4SC 4GGQA 1RLFA 3QARA 2C7MB 1L7YA 2FIDA 3H7SA 1TGZB 4W9LA 2RD0A 4A3OA 3ML8A 2C60A 4N9F4 3RT3B 2BYFA 3P2BA 5LXHA 3HM6X 2D3GA 4DXAB 3JSVB 2KX3A 2WDTB 3PPAA 4HK2A 1MG8A 3WAPA 4DHZB 2D10A 2KLGA 4DDGD 1YD8U 3DVGY 3PGEA 1ZGUB 2WYQA 2CHZA 2IO1B 1WGYA 2JZZA 4LDTB 2LGXA 2DENB 2FCQA 4BKTA 2ZPYA 2L76A 4EZKA 4FJVB 2JY6A 3WA0A 1NI2A 4K7UA 4MM3A 2DZKA 2L05A 2ZCCA 4HXDA 3V62A 5EDSA 2KZRA 2DHZA 2GBJA 4IC7B 4IG7B 3VUXA 1GC7A 2KDEB 2V4LA 5KHOA 3V6EB 2CHWA 2RGFA 3KVFB 2ZZPB 3KUDB 3H1UA 1EO6A 1E5WA 4AJYB 2ZVNA 2M17A 3DBRI 4GXBA 5JH5C 4OVVA 3QWZB 1PQSA 1V9JA 3L17A 3ZIMA 3H7PA 2MBOA 1R4MI 3DVGX 4CYEA 1NBFC 2PPHA 4GN1A 4HPMB 5AZFA 2RPQA 5FR6A 1KM7A 3HM3A 1BT0A 4HCPB 2Z0EB 2C5LC 4G0NB 1UBQA 3DBSA 3ZO5B 3KYDD 2LJ5A 2YLMA 1P98A 4WJOA 2M8SA 5E6OA 4WAAA 2BWFA 4GSWA 2FIFA 2A5UA 2HTHA 4HCNB 4I6NB 3ZTCA 3ZNZB 4JL9A 2REXA 3TIXA 4TV3A 3ZTDA 3V6CB 2C9WB 1GG3A 3K9PB 4NAWA 4PS8A 1J0GA 1V5TA 2CR5A 2N4FA 3ZRCA 5G2NA 2GBRA 1TBEA 2O6VB 3T9LA 2EMTA 4NPNA 1C3TA 4ANXA 4ZDVA 2BKRB 2KJ6A 4ZRKA 3ZDMC 1P9DU 2FUHB 4BKGA 2BYEA 2LVQA 3ZRFA 1J19A 1LFDA 5DPWA 4GU2A 2EKEC 3VUYA 4F8CB 2G45B 2MSED 3O65B 3S2AA 4II2B 2W9NA 3RZWC 3PS6A 2FCNA 1WGRA 4KV2A 2KHWB 3LJ3A 3UINB 4DHZE 2BYVE 3QAQA 4M0WB 3QJZA 4EZJA 2LASA 3H7PB 1KJTA 4LCDE 3D32A 2QHOA 2LRUA 4BFRA 4MGYE 1I35A 3AULA 2O2VA 1E7UA 2MLBA 2D11A 1Z5SB 2HJ8A 3RULA 3UIOB 1YX6B 4ANUA 3H9DA 2NR2A 4CO7A 3M62B 4K7WA 2LUEA 1UH6A 2N9PC 3U30A 3JW0X 1WGHA 4IWOA 4XX5A 2NBWB 2UWQA 1VCBA 5D94A 4HDQA 5G55A 3ML9A 4FJYA 2L7RA 4ASWC 3ALBA 2I1JA 2LWPA 2DZIA 3ONSA 5DPSA 3Q3FA 4NAWB 2ZNVC 2GMIC 2LVPA 4KZCA 1V86A 3CMMB 2NBVB 5LXIB 4IWQA 4NJ7A 2MWSB 2KX0A 2DYOA 5GMVA 5CHWA 1WRDB 2JPHA 3AU4A 3UIPB 2ZVOA 4JLCA 2Z0DB 4ICVA 3PRZA 3TBLD 2K6DB 2WWZA 2CHXA 2L0TA 4MEMA 1IYFA 1WI0A 3V61A 2K25A 3MJWA 4TQ0A 1WR6E 3PV1A 4W9EA 2MA9B 3H6NA 2A4ZA 4XZ4A 3VFKA 1WE6A 1WMHB 1YQBA 4GOCA 2K8BA 3VHTC 4WQOB 4ZYNA 3DBHI 2O2VB 4W9JA 2KLCA 4FLHA 3DVNU 3N30A 3VDZA 1OEYA 3ZNID 1H4RA 1GJZA 5JHAA 3DDCB 3VTVA 2JXXA 2KFKA 2Z59B 3PTFC 3NHEB 3ZNHB 4EUTA 2O6VA 1V80A 2J0MA 3VXWA 4WJPA 2HE7A 2N7DA 2L3ZA 3A4RA 2MBBB 3OAWA 2KJRA 4MDKE 1I42A 3PZDA 1E7VA 3CSTA 4K7SA 2KDFB 2IY1B 2KQ7A 2KD0A 2OJRA 4M8NA 2V1YA 4MGZE 2CS4A 4DHJD 2I1KA 4FADA 4MJSA 1WE7A 2M1MA 2NVUI 1L2NA 2C7HA 4JIOU 5IA7A 2KWVB 2KMAA 2DYBA 2IO2B 3MTNB 2IYDB 1E8XA 3M3JA 4BBNC 2IY0B 4BKSD 4E71A 3BINA 1WGGA 4FULA 2KK8A 1WXVA 2R2QA 4NJ6A 4EZLA 1EUVB 3HIZA 1UBIA 1LM8B 1WJNA 1WH3A 1ZW7A 2EMSA 3OLMD 4OVUA 3SU8X 2N9XA 3I3TB 2N7EA 2J7QB 3HK0A 2CKHB 2R2OA 1FXTB 3GOEA 2KO3A 4FJZA 4WWPA 5JZEB 1UELA 1RFAA 3RYTA 1OGWA 2M4NA 4F7ZA 4BBNF 4BOZB 2KTRA 2MBQA 4IUMB 4MGIE 2KFJA 4P7IA 1WIAA 4B95A 4BVUC 4NQLB 4IWPA 2ZPNA 4F1SA 2KFKB 2PE6B 2LD9A 3JVZX 4NQKE 4FHJA 1E8WA 1WFYA 2Y5BB 3HHMA 3ZNGC 2BKFA 4RM8A 4PYZA 1V49A 2BGFA 2J0JA 3A9KA 1H8CA 3DQVA 3PT2B 5LLIA 4G11A 2XK5A 2MQJA 3RD2A 3C0RB 3PHXB 3CSFA 4MH0E 5J18A 3EECA 3X23A 1V5OA 4MJSB 1WJ4A 1IPGA 2FCSA 2GOWA 2LVOA 2JT4B 1KOTA 1IP9A 2NPTA 2KJHB 2ZEQA 4ANVA 3R66C 4TQ1A 4A20A 3RUIB 5E6PA 4LDTD 4AWJA 2KWUB 4TUUA 5D6JB 1WMHA 2LXCA 3ZLZA 4AP4C 4W9KA 3WIMA 4GIVA 1V81A 1R4NI 2ZNVB 1UGMA 1OQYA 1WX8A 4GDLB 4DWFA 3X0WA 3LDZE 1WJUA 4KSLC 2UYZB 4J6IA 3ZKJC 1E90A 2KOXA 4IM2A 4EKUA 3APCA 3IBEA 2B3AA 3U7DA 2V3SA 1YJ1A 2KTRB 2WX0A 1X1MA 1SIFA 4ZRJA 2JRHA 3L0WB 2WX1A 2OOBB 4K1RB 4WWOA 1D3ZA 1WGDA 4RM9A 1HE8A 3QIJA 4E74A 3APDA 4EEWA 3DVNV 3IFWB 3A9KB 2MX2A 3L08A 1QZEA 3N32A 3R7RA 3NZSA 2XK5B 1WM2A 3K9OB 3PREA 1M94A 2D2QA 3CF6E 5TR5A 3WAMA 4GDKA 4DDID 1GNUA 2MBEA 2DZMA 4ZRIA 2N9EB 3AU5A 5C23A 4AUQC 2BWES 5J17A 2LGYA 1P0RA 3DPDA 2KANA 2IO0B 3PRPB 1GUAB 1WY8A 2MRPA 2NPTB 4MSQB 4W9CA 1WXSA 4CHKA 5CHVC 1NDDA 3JYUA 3TL5A 3UQBA 3DOWA 1LXDA 4KIKA 2PJHA 4B9KA 1KLVA 4ANWA 4KDIC 2DX5B 1ZKHA 2FAZA 2KN5A 3WANA 4FBJB 3QA8A 3QX1A 1V6EA 4PS3A 2KC1A 2K39A 4I6PA 3NZUA 4EFOA 2IZVB 3ENEA 3WALA 2MW5A 2YVCA 2LXAA 4K81A 2AL6A 3PSEB 5AEKB 3M95A 2KTFA 1Q1OA 1WXAA 4M8MA 4GMVA 5CHFA 1E8ZA 2DAJA 2JUOA 2DZJA 4EOYA 4W9IA 4I6LB 3IHPC 2AL3A 3IG3A 4WJQA 4AJWA 4KVGB 2KDBA 3W1SC 5IAAC 2C7NB 1WX7A 3VVWB 1TTNA 1E8YA 1WJ6A 4YL8A 5DCNA 1RAXA 3QHTA 1GC6A 3TCAA 4MGKE 1UD7A 4IM0A 2NBUA 2RR9A 1UZXB 3EHVA 2LI5A 2RSUA 4FHKA 2BPSA 4KZ0A 2DAFA 2GBNA 4GDKB 2NCNA 1SGHA 3PLUA 3PVLA 2GBMA 3B1LX 4E3CA 1Q5WB 1YIWA 2MCNB 2KVRA 1EF1A 2N1WA 3UGBB 4B6WA 4W9DA 3KW5B 1J8CA 1XT9B 1XQQA 2KNBA 2XBBC 4ICUA 5D7GA 1Y8RC 4KIKB 2VRRB 3A1QB 4GDLA 4HPLB 5DPTA 3SDLC 4A3PA 4II3B 2D07B 2AYOB 2K8CA 2J0KA 3A33B 2KDIA 3ZVVA 3EC8A 4WWNA 3VH4B 3BY4B 4FA6A 3NY5A 3GZNI 3DCGA 3T8MA 3VTWA 3PRMB 3VTUA 2L8JA 2L0FA 5HKHA 1C1YB 2JVCA 3B08A 3IVFA 1LQBA 3AXCA 2ZCBA 1OTRB 2FCMA 2HD5B 5AZHA 4G3XB 2KC2A 4HJKA 4GB9A 3TJPA 2LZ6A 1EF5A 3R7QA 3B0AA 4MELA 1YX5B 1T0YA 3OJ3A 1V2YA 2ZJDA 2PEAA 1OEYJ 2MP2A 3KUZA 1ISNA 1AARA 4WJNA 1P3QU 3OJ4B 3QCAA 2JZ3B 3VH3B 4FN2A 4BKSA 1S3SG 5CX3A 3A9JA 2PE9A 3APFA 3Q3JA 2FNJB 4HWIB 2G4DB 4W9HA 2KXJA 1F9JA 2NS5A 2M0XA 2CU1A 3R3MA 3W1SA 2N1VA 3V60A 1WM3A 3ECIA 3WAOA 4MSMB 3W1YA 3QK0A 4XC2A 3M63B 4PYUA 1SE9A 3L13A 3ZUNA 4HLEA 2AEHA 3N3KB 4KDLB 4BOSC 2JRIB 2GBKA 5KHQA 1RRBA 1TZ1A
chains in the Genus database with same CATH superfamily
2JF5A 3T3NA 3V05A 1WYWB 2G3QB 1WZ3A 3L10B 3GE8C 1VR9A 3VQIA 3SD5A 3UF8A 4HDOA 2QEJC 2XNAC 3NS8A 3JSVA 1V97A 2MP2B 2IO3B 3VAWA 3UQAA 3KYCD 4RFBA 1EWCA 2BS4B 3P63A 4DBGA 4IW0A 3P4RB 4PS7A 2PIAA 2W3RA 3RZFA 1S1QB 1VZ8A 3NUHB 2WXJA 2G4SA 4JGHB 3BK1A 3R2TA 1L0YB 3QC8B 2K8HA 2FIDA 4W9LA 3BYYB 3Q3NC 1E9MA 4K3CA 2BYFA 1YNTE 2WDTB 3WAPA 4RNAA 3PGEA 1BXTA 2IO1B 2LGXA 2ZPYA 2ONQA 1KLGD 4K7UA 4HROA 3V62A 1GC7A 5D3IB 3V6EB 3KVFB 1KF6B 2ZZPB 3KUDB 5E6JA 2M17A 4GXBA 5HFYA 3QWZB 2L52A 3KWVA 3DVGX 3ABVB 2CJNA 3NVZA 5FR6A 1BT0A 1IBXB 2Z0EB 1UBQA 3FAHA 1P98A 2QIEB 2M8SA 5E6OA 4GSWA 3BYTB 2FIFA 2HTHA 4O1NA 4I6NB 2WXLA 3ZTDA 2JWUA 3K9PB 4NAWA 3H8HA 2N4FA 3AEAB 4ZOHC 3T9LA 2EMTA 4NPNA 5H8YE 1DOYA 1L6UA 1JROA 4YT0B 4BKGA 2BYEA 2SAKA 5HG2A 2WDQB 3ETRA 2W54A 2QILA 3U7ZA 4JWSC 4M0WB 3QJZA 4EZJA 2M0AA 2QHOA 2LRUA 2JX5A 1I35A 2O2VA 1Z5SB 2HJ8A 2ZW1A 4ANUA 2NR2A 4XDCA 2QDFA 4WWMA 1UH6A 1VCBA 4HDQA 1YQ3B 2L7RA 2I1JA 3ONSA 3FILA 2MHJA 1ZPSA 2LVPA 3HRDD 2PVGC 4IWQA 2MWSB 2KX0A 5C3JB 2BVCA 3UIPB 2I2YA 1C4AA 3B9JA 2Z0DB 3TBLD 3PRZA 2CHXA 4GLSC 3L4PA 2K25A 4AQ7A 4TQ0A 1TS2A 3PV1A 4W9EA 3W5VB 2A4ZA 2OJWA 1WE6A 3RMKC 3VHTC 2K8BA 1QOBA 4FLHA 3I63C 2ICIA 5JHAA 2KFKA 3R2IA 2ON8A 4WJPA 2MBBB 2KJRA 4MDKE 1E7VA 3CSTA 3GS2A 2D3BA 2KD0A 2H88B 2V1YA 2J53A 2I1KA 4C56C 1WE7A 2NVUI 2WXFA 4WIPA 3AE6B 3C8YA 3MTNB 1FCLA 5D3DA 3NG0A 3BINA 4WQMA 5IP4D 1QOFA 3OLMD 3I3TB 2J7QB 2CKHB 1FXTB 2H89B 2KO3A 1HTQA 4WWPA 1JWSD 3Q3MC 1M4VA 3RYTA 1OGWA 4F7ZA 4BBNF 1SE4A 2KTRA 4MGIE 1WIAA 2INCC 2LD9A 4NQKE 1WFYA 2Y5BB 1I4QA 3PZ8A 2TSSA 2AX5A 4RM8A 3A9KA 1H8CA 3RD2A 2XK5A 2MQJA 2IJ0A 3CSFA 3EECA 4MJSB 3ZYYX 1IPGA 1P7EA 2FCSA 1QT9A 3RFZB 2ZEQA 4TQ1A 5E6PA 5FR3A 5BMHA 4TUUA 3VR8B 4GIVA 1V81A 3IAS1 1NYRA 1UGMA 1WX8A 1C78A 2D5GA 4DWFA 1WJUA 2UYZB 2LHDA 2KOXA 4IM2A 3KQ4A 2V3SA 3AMZA 1YJ1A 1XEEA 2WX0A 4ZRJA 4XYCA 5EE9A 1HZ6A 3L0WB 2WX1A 1EU3A 1HE8A 1YN5A 3DVNV 3L08A 3R7RA 3K9OB 1WM2A 1M94A 2JSVX 1FD6A 1MG4A 1GNUA 3PZ7A 5J17A 2G1EA 3IT4B 2KANA 4RF0A 3PRPB 1GUAB 4HRSA 4CHKA 2BTEA 3TL5A 4J3OD 1KLVA 3MHZA 4KDIC 2VZKB 2DX5B 1STEA 1VRAB 2V9HA 3WANA 4I6PA 3PSEB 2GI9A 2KTFA 1WXAA 1JRPA 2JUOA 1ZE3D 5G5HA 2DZJA 4W9IA 4I6LB 2KDBA 5IAAC 5C2TB 1TKEA 1C4CA 1GC6A 4YSXB 3TCAA 1FXIA 1YJJA 2NBUA 2RR9A 5FKAC 1SB3C 2HJ1A 2LI5A 3N1YC 3P4PB 3B1LX 4YSZB 1Q5WB 2MCNB 2JYTA 2KNBA 4ICUA 4P16A 2K8CA 2BB6A 2J0KA 3ZVVA 3C19A 1XLOA 3BY4B 2G9HD 3NY5A 1IUEA 1TIFA 5HKHA 1C1YB 1LQBA 2ZCBA 1OTRB 2HD5B 4HKQA 2WLBA 3IXSA 1T0RC 4FXCA 4GB9A 1EF5A 1JWMD 3R7QA 3MC9A 3OJ3A 1V2YA 2ACZB 2ZJDA 1J7BA 1QKZA 1OEYJ 2K0PA 4XE0A 3KUZA 1AARA 1P3QU 3OJ4B 3QCAA 1MI0A 3VRBB 2PE9A 3Q3JA 1QLBB 4OZAA 2WHIA 3V60A 1WM3A 3ECIA 3TUOA 4RGOS 1SE9A 4HLEA 3N3KB 2GBKA 1RRBA 1TZ1A 2K6QA 2BS3B 4TKNA 4B0EA 1YMHE 2WXGA 1Q0WB 2BF8B 3RCZA 1N63A 1V8CA 4NZLB 2XEWA 1A5RA 1JRUA 3L54A 2KMCA 1N5XA 4XGAB 1SSNA 2IBIB 4RMAA 3A9JB 3KUCB 1CMXB 3AEEB 4KSKC 2I38A 3VUWA 3MHSD 5IOIA 3PLVA 2W3SA 3KH0A 5L83A 3PHWB 1WZ0A 1WR1A 2DYMA 2MJDA 2R61A 4LJOB 2X38A 1U4AA 1T0SC 4HVBA 1TY0A 1HXYD 3NOBA 2QCZA 1WX9A 4AOFA 4W9GA 1K8RB 2ASQA 1WRIA 3RNBC 5J2RA 2MH7A 1L4ZB 2C7MB 3H7SA 1TGZB 2RD0A 1J7AA 2LGIA 3NS1A 3RT3B 1J7CA 3JSVB 1FO4A 4HK2A 2VH2A 3EUB2 3DVGY 3TEZA 1WGYA 2DENB 2PLPA 3EGRA 2IGHA 1EO6A 1E5WA 2ZVNA 4P1CC 1R4MI 2L83A 4HPMB 4GN1A 3AV8A 3DHIC 1K52A 2RPQA 3DHGC 1AW7A 1Y56A 3DBSA 5BMGA 3Q8BA 3ZO5B 2WS3B 3KYDD 5AUKA 2KYWA 1RM6C 2LMCA 2REXA 1IGDA 1GG3A 4IOIE 2GBRA 1C76A 1TBEA 2J42A 2KJ6A 5FK9C 2FUHB 2LVQA 1ESFA 4F8CB 4N59A 4ZHPA 3S2AA 4II2B 1K51A 2W9NA 3RZWC 3I57A 5EE1A 2N0SB 2WU5B 2BBCA 4BFRA 4MGYE 3I9V1 3RULA 1B1ZA 3BVGA 3UIOB 4L23A 1HQRD 2LUEA 2DNFA 2NBWB 3ML9A 4ASWC 3ALBA 2DZIA 3CWIA 4NAWB 3OG5A 1K53A 5LXIB 1YQ4B 5GMVA 5CHWA 3AU4A 3RNFC 3VR9B 2K6DB 3W9CB 2L0TA 4USAA 4YTPB 3U4EG 1SEBD 2N9KA 2E3TA 4BZAA 3AE7B 3VFKA 3Q2AC 2V3PA 3BWUD 1YQBA 4GOCA 2Y3AA 4ZYNA 2O2VB 4W9JA 1L0XB 3VDZA 1OEYA 4KGRA 3ZNID 1GJZA 2IDYA 2JXXA 3NHEB 3PZDA 1NI3A 3FILB 2KDFB 1Q10A 2KQ7A 2OJRA 3E9SA 2K3UA 4DHJD 2HDEA 4C00A 2KMMA 2M1MA 2C7HA 2BYTA 2KWVB 2DYBA 3M3JA 4BBNC 1TS5A 4FULA 2R2QA 1EUVB 1JWBD 1WJNA 1LM8B 1WH3A 1ZW7A 2EMSA 4OVUA 4C7YA 2KQ4X 3HK0A 1PGAA 3GOEA 3P4QB 4FJZA 1I4RA 5JZEB 1A70A 4B95A 1XLNA 4NQLB 4F1SA 2KFKB 2PE6B 4S17A 1GPXA 1V49A 2BGFA 4G11A 3C0RB 3PHXB 2K5PA 4WURA 4MH0E 5J18A 4KX6B 2LHEA 2KJHB 1I4XA 2W55A 3R66C 3FKYA 2OHFA 3RUIB 4LDTD 4AWJA 3AE9B 2KWUB 4AP4C 3Q8CA 1WWTA 2ZNVB 2JZPA 5MPOA 1E0ZA 3X0WA 3N9YC 1BMLC 2K9XA 3BZDB 3ZKJC 4A8XC 2KTRB 1PYWD 1SIFA 4KKIA 1HTOA 1WGDA 4RM9A 3MJ5A 1AN8A 4EEWA 2PVOD 3IFWB 3A9KB 1QQRA 2ZW0A 2BS2B 4LNIA 4B0MA 2XK5B 3WAMA 3CF6E 5TR5A 4GDKA 4RGNA 4ZRIA 2N9EB 3AU5A 2LGYA 5BYQA 5CHVC 4ZHOA 3DOWA 4B9KA 4ANWA 2KT7A 2FAZA 1D4BA 1OQQA 2KN5A 2WXNA 4M00A 4RCOA 3U2SC 3NZUA 2BQQA 2MW5A 4K81A 2WP9B 3M95A 3TEXA 2AQ1B 3PO0A 4KGSA 1UGJA 2DAJA 3AE3B 4AJWA 3IHPC 3IG3A 4KVGB 2C7NB 2K22A 3P1MA 3VVWB 5DCNA 1RAXA 2IGDA 1UD7A 2J4XA 4IM0A 3EHVA 2NTTA 1SJHD 1L5PA 1E6EB 2DAFA 2GBNA 4JPSA 4OZBA 3PVLA 1HZ5A 2D3CA 2UU7A 4B6WA 3MC0B 3UGBB 3AE2B 3A1QB 4R3DA 4II3B 2D07B 3A33B 3RI7C 3VH4B 3GZNI 3VTWA 3PRMB 2L32A 4A90A 3N20C 1FXAA 4H2AA 1RYJA 1MPEA 1ZXHA 1T0YA 1JWUD 1ZDVA 5JXVA 5CX3A 3APFA 2FNJB 4W9HA 1N5WA 1F9JA 3W1SA 2CU1A 3R3MA 4RGMA 1K50A 4MSMB 3W1YA 3LB8C 3IAM1 3M63B 4PYUA 3ZUNA 2AEHA 4KDLB 4MM3B 4BOSC 2W82A 1QF6A 2KWDA 1AYFA 3U8ZA 3ZDTA 3AI5A 4LJPB 3QQ8B 5E6NA 2YEPB 4G50A 3EFUA 5C1ZA 2V3NA 3L16A 1DYQA 1ZUD2 2Z8LA 1OQRA 4DK5A 4CQNA 3EFCA 1V1PB 2K1FA 2JWZA 4IM3A 3AH7A 4YTNB 1R4MB 5BO4B 2O6VD 4HJGE 4JE3B 3A1QA 2LRWA 4IKGA 5CTRC 2NTSA 1WF9A 1NEKB 2DWQA 5AZGA 1I4PA 1TYGB 2J52A 4JWUC 2KQSA 5BYSA 2LGDA 3TEWA 1E10A 2MBHA 4GGQA 1RLFA 3U52E 1L7YA 1N62A 4A3OA 3ML8A 1SIJA 2C60A 1N61A 4LNNA 3N1XC 5LXHA 4DXAB 1TZOA 2KX3A 1MG8A 4DDGD 3W5UB 1ZGUB 2CHZA 5IO9A 2JZZA 1R4NB 2FCQA 1XF5L 4BKTA 3ZJVA 2L76A 1TY2A 1NI2A 4MM3A 2HTME 2KZRA 5EDSA 3VUXA 4IC7B 1UWXA 2V4LA 2CHWA 2QMTA 4AJYB 5EE3A 3DBRI 1N6ZA 1PGXA 5JH5C 4OVVA 3Q14C 1PQSA 3H7PA 1I4GA 3RNAC 4CYEA 1NBFC 2PPHA 4NAMA 1PFDA 4UDUC 1KM7A 4HCPB 2L1AA 1V1PA 2FBWB 1ZP0B 2PMVA 2YLMA 3ZTCA 1F2RI 2BWFA 2D3AA 1ROEA 3ZNZB 3TIXA 4TV3A 2V4IB 3V6CB 3AE1B 1JALA 4PS8A 2Y5PA 4L2YA 5G2NA 2O6VB 1FEHA 2WU2B 4ANXA 1FNWA 2BKRB 3ZDMC 1P9DU 5G5GA 3ZRFA 1F1HA 5EE0A 1LFDA 2LFIA 3HVDA 4GU2A 2N7JA 5DPWA 3MP9A 2G45B 2MSED 3PS6A 4LTUA 3LXFA 1WGRA 2KHWB 1MFWA 1SE2A 5IN7A 4DHZE 2BYVE 3QAQA 2LASA 1KJTA 5BYRA 3D32A 3URYA 3AULA 2D11A 1YX6B 4REZA 3H9DA 4CO7A 1XCQL 4K7WA 2N9PC 5D94A 1WGHA 4P6VF 2WXPA 5G55A 1SF0A 2WXIA 2LWPA 1QILA 5DPSA 2ZNVC 4NJ7A 1GAQB 2JPHA 2AQ3B 4JLCA 2LGSA 4ICVA 2RDHA 2WWZA 2E6XA 4A6QA 1JCKB 2RPVA 1IYFA 1WI0A 5GXGB 3V61A 3MJWA 1WR6E 4ITKA 3H6NA 1MHXA 4XZ4A 1YN3A 2KAJA 3DBHI 2KLCA 3P42A 1FRDA 2OEDA 1H4RA 3NJTA 3SEBA 3AB5A 3PTFC 4EUTA 2O6VA 3VXWA 2HE7A 2N7DA 3O13A 3NVVA 1PDXA 4JX1C 1L4DB 1JQ4A 1L0VB 2IY1B 4MGZE 1F2RC 1UF0A 2WXHA 4FADA 4M02A 4LK0M 2X8XX 2IO2B 3AE8B 4RGTA 2IYDB 1E8XA 4E71A 4DQOC 1TKGA 1WGGA 2KK8A 1EU4A 1XO3A 1WXVA 4NJ6A 4EZLA 3HIZA 2R2OA 2WXKA 3GP7A 2IGGA 3N1ZC 5H92C 1RFAA 3UI3A 1VZ7A 4A9AA 4BVUC 2MBQA 2KFJA 4P7IA 4AS1A 4IWPA 2ZPNA 3JVZX 4FHJA 3HHMA 3ZNGC 4PYZA 2J0JA 2INDC 3T3OA 3DQVA 3Q3OC 1FMAD 3X23A 4OZCA 1WJ4A 2GOWA 1IP9A 2NPTA 1QOAA 4ANVA 4A20A 2INNE 1D5XC 5D6JB 2LXCA 3B2GA 1C79A 4W9KA 3WIMA 1R4NI 1TT5B 4LLGM 1OQYA 4C80A 1NVID 4J6IA 2BW2A 1E90A 1KFYB 3APCA 2B3AA 4ACFA 1MHHE 2KN4A 2QJLA 4K1RB 2OOBB 3QIJA 4C4VA 4E74A 3APDA 4L1BA 1C9FA 2MX2A 1QZEA 3NZSA 3GZNB 2D2QA 3BVZA 1ACCA 2DZMA 3AM9A 4AUQC 1R7SA 2BWES 1CQVA 3DPDA 1PUTA 2BB5A 3EA6A 2IO0B 4Q2JA 4W9CA 4MSQB 1WXSA 3NVWA 1NDDA 3UQBA 4ARCA 1LXDA 4KIKA 3Q8EA 1T6BX 4OHJA 4EE2A 3Q69A 4WAFA 3QA8A 3QX1A 2K39A 4NJCA 3VRAB 3WALA 2MJ3A 2BT6A 2AL6A 5AEKB 4PK1A 1FNVA 3DWGC 2B76B 1E8ZA 4EOYA 4S0RA 4DXFA 4WJQA 2PTLA 3AN1A 1TTNA 1E8YA 1WJ6A 3ZGZA 5IKCM 3BIID 3QHTA 1UZXB 3R8BA 4KZ0A 4GDKB 3SR6A 2NCNA 1I4HA 1SGHA 3PLUA 2GBMA 1HEZE 2QC8A 2KVRA 1ZXIA 1EF1A 3AEDB 3AECB 4W9DA 1J8CA 1XT9B 1TS4A 1Y8RC 1CZPA 2AYOB 2FE8A 4HKZE 3J9CA 1XLPA 4WWNA 3AE4B 4FA6A 4OVZA 3RPFC 3DCGA 2CJOA 1F0ZA 2L8JA 2JVCA 3B08A 4PT5A 3IVFA 5AZHA 1GOZA 3TJPA 2LZ6A 1JW9D 5HI1A 1E7PB 2MP2A 1ISNA 2DLBA 2JZ3B 3VH3B 4FN2A 1S3SG 1LGRA 2G4DB 2NS5A 2M0XA 2N1VA 3WAOA 2RMMA 4XC2A 1QOGA 5KHQA 4QAYA 4URKA 1G6JA 1KH0A 2WXRA 1KLUD 1WXMA 1Z2MA 2L00B 3WCQA 5L95C 3ZW3A 2KKCA 3DBLI 1OFFA 1VD2A 4W9FA 4DHJB 4US9A 5BMIA 4RH6A 1ET9A 3DBRB 1JMLA 2KWCA 3B2FA 3GB1A 2Y5CA 3AEBB 4US8A 3TMPB 5D2MB 1WYGA 1YOVB 5JHBA 1XXGA 1FNUA 1XD3B 1D5MC 4ZRQA 3OWEB 4NY0A 4JQWC 1P1AA 4YSYB 2YEPF 3SHQA 1JWAD 2AWTA 5DPRA 1SE3A 2SEBD 2V0GA 4X57B 2LEKA 1EWYC 4DXGA 4NNJB 3A4SC 3QARA 1IBXA 2EELA 1TS3A 4N9F4 3P2BA 1TJEA 3HM6X 2D3GA 3P4SB 3PPAA 1FFUA 1B9RA 4DHZB 1FPYA 2D10A 2KLGA 1YD8U 2WDRB 3HVZA 2WYQA 4LDTB 4EZKA 4FJVB 2JY6A 3NZ3A 3WA0A 2DZKA 2L05A 2ZCCA 4HXDA 2DHZA 2GBJA 4IG7B 3W2DA 2KDEB 5KHOA 2RGFA 3H1UA 2Q5WD 4K3BA 4M0WA 1V9JA 3L17A 3ZIMA 2MBOA 2VZKD 5AZFA 4MACA 3HM3A 3ZJTA 2C5LC 1NENB 4P1BC 4G0NB 1NYQA 2LJ5A 3AE5B 4WJOA 4WAAA 2A5UA 2KVZA 1RFKA 4HCNB 2MEKA 4JL9A 2C9WB 3KLSX 1TKYA 1J0GA 1V5TA 2CR5A 3ZRCA 1C3TA 3NVYA 4ZDVA 4ZRKA 1UNSA 3DBHB 4MT5A 1J19A 2EKEC 3VUYA 3O65B 2FCNA 1ET6A 4KV2A 3LJ3A 3UINB 3DWMA 1AWDA 1C4PA 1VLBA 3H7PB 1PGBA 4LCDE 2WXQA 1E7UA 2MLBA 1WSPA 1DOXA 2IPKD 2LJIA 4N6EB 3ZJUA 3M62B 1ENFA 3U30A 2JQRB 3JW0X 4IWOA 4XX5A 2UWQA 2GLSA 1MJDA 4FJYA 1SXTA 3RNEC 3CIRB 3Q3FA 2GMIC 1VZ6A 4KZCA 1V86A 3CMMB 2NBVB 3Q6BA 2DYOA 4XWTA 1WRDB 2QSDA 2ZVOA 1T3QA 3AEGB 4MEMA 1YN4A 1VDVA 5I4DA 2MA9B 3RNCC 1GB1A 1WMHB 3LYYA 1P7FA 4WQOB 3TSSA 3DVNU 3N30A 2PW9A 1L6VA 1ZDXA 2MJEA 3DDCB 3VTVA 2INPE 2Z59B 3ZNHB 1I7HA 1V80A 2J0MA 3A4RA 1D5ZC 2L3ZA 2N9LA 3OAWA 3SFEB 3GE3C 4ZYSA 1I42A 4K7SA 4M8NA 2CS4A 3RNGC 1C77A 4MJSA 1L2NA 1VJKA 4JIOU 5IA7A 2KMAA 4YTMB 1DGJA 2WGSA 4BKSD 2IY0B 4XDDA 4KGTA 5AUIA 1UBIA 3SU8X 2N9XA 1DOIA 2N7EA 3MFGA 1FFVA 4HEA1 1UELA 1ZOYB 3RN9C 3Q8AA 2M4NA 4BOZB 4IUMB 2PKOA 1E8WA 2WQYB 4LNOA 4HPPA 2BKFA 1CK1A 4BAXA 2GRIA 1KTKA 3PT2B 3IT6B 5LLIA 1FRRA 2CU3A 2JXTA 1V5OA 2LVOA 2VH1A 2JT4B 1KOTA 1MVKA 3AEFB 1V1OA 3ZXRA 1WMHA 3ZLZA 3ZXVA 2XN9C 2KDMA 1KRHA 4LNFA 1T0QC 4GDLB 1WXQA 3LDZE 3KWLA 1BUIC 4KSLC 4YWGG 2RDGA 2WNMA 1EM7A 4LNKA 4RF1A 4D2KA 3DHHC 4EKUA 4WH4A 2FUG1 3IBEA 3MC8A 3U7DA 1X1MA 2EKIA 4ZRPA 2JRHA 4M01A 3HUIA 4N58A 4WWOA 1D3ZA 2DBYA 3N32A 3PREA 4DDID 2MBEA 5C23A 4ARIA 1FCCC 1P0RA 1FIQA 2MRPA 1WY8A 2NPTB 3FC4A 3JYUA 5TSSA 2PJHA 1CJEA 1XCTL 1N60A 2NMQA 1ZKHA 4TMAB 4FBJB 1V6EA 1RWSA 4PS3A 2KC1A 3E56A 2WXMA 4EFOA 1T5XD 2IZVB 4KKJA 3ENEA 2JYEA 2YVCA 2LXAA 2GB1A 1Q1OA 4M8MA 4GMVA 5CHFA 2AL3A 5T8IA 3W1SC 1D6EC 1WX7A 3TEYA 4YL8A 2WDVB 1GB4A 3Q8FA 4OW0A 2WXOA 4MGKE 1WGKA 4C4VB 4XWWA 2M19A 2RSUA 4FHKA 2RDBC 1LO5D 2BPSA 1F52A 4A55A 3I5JC 4E3CA 1YIWA 2N1WA 4YXDB 3KW5B 3DBLB 1F77A 1XQQA 2XBBC 1SBBB 5D7GA 3V3XA 1SJED 4KIKB 2JU6X 2VRRB 4GDLA 4HPLB 5DPTA 3NRZA 3SDLC 4A3PA 2KDIA 1UUPA 2M56B 2AQ2B 3EC8A 3SFDB 1IGCA 3T8MA 3VTUA 3BVMA 2L0FA 3AXCA 4IDIA 2FCMA 4G3XB 2KC2A 4HJKA 4C7ZA 3ZQ4A 3B0AA 4MELA 5HHDG 1HA5A 1YX5B 2PEAA 1XLQA 3BK2A 2LUMA 4TSSA 4WJNA 5LNK1 4BKSA 3A9JA 4HWIB 2KXJA 4MH8A 3QK0A 1FM0D 2KACA 3L13A 1UWMA 2JRIB 1YJIA
chains in the Genus database with same CATH topology
2JF5A 2K6QA 4URKA 3U8ZA 3ZDTA 3AI5A 1WYWB 4TKNA 1G6JA 2G3QB 4LJPB 1WZ3A 3L10B 1Q0WB 3QQ8B 5E6NA 2BF8B 4G50A 3EFUA 1WXMA 1Z2MA 3RCZA 3VQIA 5C1ZA 3L16A 2L00B 5L95C 3SD5A 3ZW3A 2KKCA 3DBLI 3UF8A 4HDOA 1VD2A 2XEWA 1A5RA 4W9FA 4DK5A 4DHJB 1JRUA 3L54A 2KMCA 2K1FA 3NS8A 3JSVA 2IBIB 2JWZA 4IM3A 2MP2B 2KWCA 2IO3B 3VAWA 3UQAA 4RMAA 3KYCD 3TMPB 5BO4B 3A9JB 3KUCB 1CMXB 4KSKC 5D2MB 2O6VD 3A1QA 5JHBA 3VUWA 4DBGA 2LRWA 4IW0A 3MHSD 3PLVA 5CTRC 1WF9A 1XD3B 3KH0A 3PHWB 1WZ0A 4PS7A 5L83A 1WR1A 2DYMA 3RZFA 1S1QB 4LJOB 1U4AA 4NY0A 4HVBA 4JQWC 5AZGA 1P1AA 3NOBA 3SHQA 2G4SA 2AWTA 2KQSA 4JGHB 5DPRA 1WX9A 2LGDA 4W9GA 4AOFA 4X57B 1K8RB 2ASQA 3QC8B 5J2RA 2K8HA 4NNJB 2MBHA 3A4SC 4GGQA 1RLFA 3QARA 2C7MB 1L7YA 2FIDA 3H7SA 1TGZB 4W9LA 2RD0A 4A3OA 3ML8A 2C60A 4N9F4 3RT3B 2BYFA 3P2BA 5LXHA 3HM6X 2D3GA 4DXAB 3JSVB 2KX3A 2WDTB 3PPAA 4HK2A 1MG8A 3WAPA 4DHZB 2D10A 2KLGA 4DDGD 1YD8U 3DVGY 3PGEA 1ZGUB 2WYQA 2CHZA 2IO1B 1WGYA 2JZZA 4LDTB 2LGXA 2DENB 2FCQA 4BKTA 2ZPYA 2L76A 4EZKA 4FJVB 2JY6A 3WA0A 1NI2A 4K7UA 4MM3A 2DZKA 2L05A 2ZCCA 4HXDA 3V62A 5EDSA 2KZRA 2DHZA 2GBJA 4IC7B 4IG7B 3VUXA 1GC7A 2KDEB 2V4LA 5KHOA 3V6EB 2CHWA 2RGFA 3KVFB 2ZZPB 3KUDB 3H1UA 1EO6A 1E5WA 4AJYB 2ZVNA 2M17A 3DBRI 4GXBA 5JH5C 4OVVA 3QWZB 1PQSA 1V9JA 3L17A 3ZIMA 3H7PA 2MBOA 1R4MI 3DVGX 4CYEA 1NBFC 2PPHA 4GN1A 4HPMB 5AZFA 2RPQA 5FR6A 1KM7A 3HM3A 1BT0A 4HCPB 2Z0EB 2C5LC 4G0NB 1UBQA 3DBSA 3ZO5B 3KYDD 2LJ5A 2YLMA 1P98A 4WJOA 2M8SA 5E6OA 4WAAA 2BWFA 4GSWA 2FIFA 2A5UA 2HTHA 4HCNB 4I6NB 3ZTCA 3ZNZB 4JL9A 2REXA 3TIXA 4TV3A 3ZTDA 3V6CB 2C9WB 1GG3A 3K9PB 4NAWA 4PS8A 1J0GA 1V5TA 2CR5A 2N4FA 3ZRCA 5G2NA 2GBRA 1TBEA 2O6VB 3T9LA 2EMTA 4NPNA 1C3TA 4ANXA 4ZDVA 2BKRB 2KJ6A 4ZRKA 3ZDMC 1P9DU 2FUHB 4BKGA 2BYEA 2LVQA 3ZRFA 1J19A 1LFDA 5DPWA 4GU2A 2EKEC 3VUYA 4F8CB 2G45B 2MSED 3O65B 3S2AA 4II2B 2W9NA 3RZWC 3PS6A 2FCNA 1WGRA 4KV2A 2KHWB 3LJ3A 3UINB 4DHZE 2BYVE 3QAQA 4M0WB 3QJZA 4EZJA 2LASA 3H7PB 1KJTA 4LCDE 3D32A 2QHOA 2LRUA 4BFRA 4MGYE 1I35A 3AULA 2O2VA 1E7UA 2MLBA 2D11A 1Z5SB 2HJ8A 3RULA 3UIOB 1YX6B 4ANUA 3H9DA 2NR2A 4CO7A 3M62B 4K7WA 2LUEA 1UH6A 2N9PC 3U30A 3JW0X 1WGHA 4IWOA 4XX5A 2NBWB 2UWQA 1VCBA 5D94A 4HDQA 5G55A 3ML9A 4FJYA 2L7RA 4ASWC 3ALBA 2I1JA 2LWPA 2DZIA 3ONSA 5DPSA 3Q3FA 4NAWB 2ZNVC 2GMIC 2LVPA 4KZCA 1V86A 3CMMB 2NBVB 5LXIB 4IWQA 4NJ7A 2MWSB 2KX0A 2DYOA 5GMVA 5CHWA 1WRDB 2JPHA 3AU4A 3UIPB 2ZVOA 4JLCA 2Z0DB 4ICVA 3PRZA 3TBLD 2K6DB 2WWZA 2CHXA 2L0TA 4MEMA 1IYFA 1WI0A 3V61A 2K25A 3MJWA 4TQ0A 1WR6E 3PV1A 4W9EA 2MA9B 3H6NA 2A4ZA 4XZ4A 3VFKA 1WE6A 1WMHB 1YQBA 4GOCA 2K8BA 3VHTC 4WQOB 4ZYNA 3DBHI 2O2VB 4W9JA 2KLCA 4FLHA 3DVNU 3N30A 3VDZA 1OEYA 3ZNID 1H4RA 1GJZA 5JHAA 3DDCB 3VTVA 2JXXA 2KFKA 2Z59B 3PTFC 3NHEB 3ZNHB 4EUTA 2O6VA 1V80A 2J0MA 3VXWA 4WJPA 2HE7A 2N7DA 2L3ZA 3A4RA 2MBBB 3OAWA 2KJRA 4MDKE 1I42A 3PZDA 1E7VA 3CSTA 4K7SA 2KDFB 2IY1B 2KQ7A 2KD0A 2OJRA 4M8NA 2V1YA 4MGZE 2CS4A 4DHJD 2I1KA 4FADA 4MJSA 1WE7A 2M1MA 2NVUI 1L2NA 2C7HA 4JIOU 5IA7A 2KWVB 2KMAA 2DYBA 2IO2B 3MTNB 2IYDB 1E8XA 3M3JA 4BBNC 2IY0B 4BKSD 4E71A 3BINA 1WGGA 4FULA 2KK8A 1WXVA 2R2QA 4NJ6A 4EZLA 1EUVB 3HIZA 1UBIA 1LM8B 1WJNA 1WH3A 1ZW7A 2EMSA 3OLMD 4OVUA 3SU8X 2N9XA 3I3TB 2N7EA 2J7QB 3HK0A 2CKHB 2R2OA 1FXTB 3GOEA 2KO3A 4FJZA 4WWPA 5JZEB 1UELA 1RFAA 3RYTA 1OGWA 2M4NA 4F7ZA 4BBNF 4BOZB 2KTRA 2MBQA 4IUMB 4MGIE 2KFJA 4P7IA 1WIAA 4B95A 4BVUC 4NQLB 4IWPA 2ZPNA 4F1SA 2KFKB 2PE6B 2LD9A 3JVZX 4NQKE 4FHJA 1E8WA 1WFYA 2Y5BB 3HHMA 3ZNGC 2BKFA 4RM8A 4PYZA 1V49A 2BGFA 2J0JA 3A9KA 1H8CA 3DQVA 3PT2B 5LLIA 4G11A 2XK5A 2MQJA 3RD2A 3C0RB 3PHXB 3CSFA 4MH0E 5J18A 3EECA 3X23A 1V5OA 4MJSB 1WJ4A 1IPGA 2FCSA 2GOWA 2LVOA 2JT4B 1KOTA 1IP9A 2NPTA 2KJHB 2ZEQA 4ANVA 3R66C 4TQ1A 4A20A 3RUIB 5E6PA 4LDTD 4AWJA 2KWUB 4TUUA 5D6JB 1WMHA 2LXCA 3ZLZA 4AP4C 4W9KA 3WIMA 4GIVA 1V81A 1R4NI 2ZNVB 1UGMA 1OQYA 1WX8A 4GDLB 4DWFA 3X0WA 3LDZE 1WJUA 4KSLC 2UYZB 4J6IA 3ZKJC 1E90A 2KOXA 4IM2A 4EKUA 3APCA 3IBEA 2B3AA 3U7DA 2V3SA 1YJ1A 2KTRB 2WX0A 1X1MA 1SIFA 4ZRJA 2JRHA 3L0WB 2WX1A 2OOBB 4K1RB 4WWOA 1D3ZA 1WGDA 4RM9A 1HE8A 3QIJA 4E74A 3APDA 4EEWA 3DVNV 3IFWB 3A9KB 2MX2A 3L08A 1QZEA 3N32A 3R7RA 3NZSA 2XK5B 1WM2A 3K9OB 3PREA 1M94A 2D2QA 3CF6E 5TR5A 3WAMA 4GDKA 4DDID 1GNUA 2MBEA 2DZMA 4ZRIA 2N9EB 3AU5A 5C23A 4AUQC 2BWES 5J17A 2LGYA 1P0RA 3DPDA 2KANA 2IO0B 3PRPB 1GUAB 1WY8A 2MRPA 2NPTB 4MSQB 4W9CA 1WXSA 4CHKA 5CHVC 1NDDA 3JYUA 3TL5A 3UQBA 3DOWA 1LXDA 4KIKA 2PJHA 4B9KA 1KLVA 4ANWA 4KDIC 2DX5B 1ZKHA 2FAZA 2KN5A 3WANA 4FBJB 3QA8A 3QX1A 1V6EA 4PS3A 2KC1A 2K39A 4I6PA 3NZUA 4EFOA 2IZVB 3ENEA 3WALA 2MW5A 2YVCA 2LXAA 4K81A 2AL6A 3PSEB 5AEKB 3M95A 2KTFA 1Q1OA 1WXAA 4M8MA 4GMVA 5CHFA 1E8ZA 2DAJA 2JUOA 2DZJA 4EOYA 4W9IA 4I6LB 3IHPC 2AL3A 3IG3A 4WJQA 4AJWA 4KVGB 2KDBA 3W1SC 5IAAC 2C7NB 1WX7A 3VVWB 1TTNA 1E8YA 1WJ6A 4YL8A 5DCNA 1RAXA 3QHTA 1GC6A 3TCAA 4MGKE 1UD7A 4IM0A 2NBUA 2RR9A 1UZXB 3EHVA 2LI5A 2RSUA 4FHKA 2BPSA 4KZ0A 2DAFA 2GBNA 4GDKB 2NCNA 1SGHA 3PLUA 3PVLA 2GBMA 3B1LX 4E3CA 1Q5WB 1YIWA 2MCNB 2KVRA 1EF1A 2N1WA 3UGBB 4B6WA 4W9DA 3KW5B 1J8CA 1XT9B 1XQQA 2KNBA 2XBBC 4ICUA 5D7GA 1Y8RC 4KIKB 2VRRB 3A1QB 4GDLA 4HPLB 5DPTA 3SDLC 4A3PA 4II3B 2D07B 2AYOB 2K8CA 2J0KA 3A33B 2KDIA 3ZVVA 3EC8A 4WWNA 3VH4B 3BY4B 4FA6A 3NY5A 3GZNI 3DCGA 3T8MA 3VTWA 3PRMB 3VTUA 2L8JA 2L0FA 5HKHA 1C1YB 2JVCA 3B08A 3IVFA 1LQBA 3AXCA 2ZCBA 1OTRB 2FCMA 2HD5B 5AZHA 4G3XB 2KC2A 4HJKA 4GB9A 3TJPA 2LZ6A 1EF5A 3R7QA 3B0AA 4MELA 1YX5B 1T0YA 3OJ3A 1V2YA 2ZJDA 2PEAA 1OEYJ 2MP2A 3KUZA 1ISNA 1AARA 4WJNA 1P3QU 3OJ4B 3QCAA 2JZ3B 3VH3B 4FN2A 4BKSA 1S3SG 5CX3A 3A9JA 2PE9A 3APFA 3Q3JA 2FNJB 4HWIB 2G4DB 4W9HA 2KXJA 1F9JA 2NS5A 2M0XA 2CU1A 3R3MA 3W1SA 2N1VA 3V60A 1WM3A 3ECIA 3WAOA 4MSMB 3W1YA 3QK0A 4XC2A 3M63B 4PYUA 1SE9A 3L13A 3ZUNA 4HLEA 2AEHA 3N3KB 4KDLB 4BOSC 2JRIB 2GBKA 5KHQA 1RRBA 1TZ1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2JF5 A;  2K6Q A;  4URK A;  3U8Z A;  3ZDT A;  3AI5 A;  1WYW B;  4TKN A;  1G6J A;  2G3Q B;  4LJP B;  1WZ3 A;  3L10 B;  1Q0W B;  3QQ8 B;  5E6N A;  2BF8 B;  4G50 A;  3EFU A;  1WXM A;  1Z2M A;  3RCZ A;  3VQI A;  5C1Z A;  3L16 A;  2L00 B;  5L95 C;  3SD5 A;  3ZW3 A;  2KKC A;  3DBL I;  3UF8 A;  4HDO A;  1VD2 A;  2XEW A;  1A5R A;  4W9F A;  4DK5 A;  4DHJ B;  1JRU A;  3L54 A;  2KMC A;  2K1F A;  3NS8 A;  3JSV A;  2IBI B;  2JWZ A;  4IM3 A;  2MP2 B;  2KWC A;  2IO3 B;  3VAW A;  3UQA A;  4RMA A;  3KYC D;  3TMP B;  5BO4 B;  3A9J B;  3KUC B;  1CMX B;  4KSK C;  5D2M B;  2O6V D;  3A1Q A;  5JHB A;  3VUW A;  4DBG A;  2LRW A;  4IW0 A;  3MHS D;  3PLV A;  5CTR C;  1WF9 A;  1XD3 B;  3KH0 A;  3PHW B;  1WZ0 A;  4PS7 A;  5L83 A;  1WR1 A;  2DYM A;  3RZF A;  1S1Q B;  4LJO B;  1U4A A;  4NY0 A;  4HVB A;  4JQW C;  5AZG A;  1P1A A;  3NOB A;  3SHQ A;  2G4S A;  2AWT A;  2KQS A;  4JGH B;  5DPR A;  1WX9 A;  2LGD A;  4W9G A;  4AOF A;  4X57 B;  1K8R B;  2ASQ A;  3QC8 B;  5J2R A;  2K8H A;  4NNJ B;  2MBH A;  3A4S C;  4GGQ A;  1RLF A;  3QAR A;  2C7M B;  1L7Y A;  2FID A;  3H7S A;  1TGZ B;  4W9L A;  2RD0 A;  4A3O A;  3ML8 A;  2C60 A;  4N9F 4;  3RT3 B;  2BYF A;  3P2B A;  5LXH A;  3HM6 X;  2D3G A;  4DXA B;  3JSV B;  2KX3 A;  2WDT B;  3PPA A;  4HK2 A;  1MG8 A;  3WAP A;  4DHZ B;  2D10 A;  2KLG A;  4DDG D;  1YD8 U;  3DVG Y;  3PGE A;  1ZGU B;  2WYQ A;  2CHZ A;  2IO1 B;  1WGY A;  2JZZ A;  4LDT B;  2LGX A;  2DEN B;  2FCQ A;  4BKT A;  2ZPY A;  2L76 A;  4EZK A;  4FJV B;  2JY6 A;  3WA0 A;  1NI2 A;  4K7U A;  4MM3 A;  2DZK A;  2L05 A;  2ZCC A;  4HXD A;  3V62 A;  5EDS A;  2KZR A;  2DHZ A;  2GBJ A;  4IC7 B;  4IG7 B;  3VUX A;  1GC7 A;  2KDE B;  2V4L A;  5KHO A;  3V6E B;  2CHW A;  2RGF A;  3KVF B;  2ZZP B;  3KUD B;  3H1U A;  1EO6 A;  1E5W A;  4AJY B;  2ZVN A;  2M17 A;  3DBR I;  4GXB A;  5JH5 C;  4OVV A;  3QWZ B;  1PQS A;  1V9J A;  3L17 A;  3ZIM A;  3H7P A;  2MBO A;  1R4M I;  3DVG X;  4CYE A;  1NBF C;  2PPH A;  4GN1 A;  4HPM B;  5AZF A;  2RPQ A;  5FR6 A;  1KM7 A;  3HM3 A;  1BT0 A;  4HCP B;  2Z0E B;  2C5L C;  4G0N B;  1UBQ A;  3DBS A;  3ZO5 B;  3KYD D;  2LJ5 A;  2YLM A;  1P98 A;  4WJO A;  2M8S A;  5E6O A;  4WAA A;  2BWF A;  4GSW A;  2FIF A;  2A5U A;  2HTH A;  4HCN B;  4I6N B;  3ZTC A;  3ZNZ B;  4JL9 A;  2REX A;  3TIX A;  4TV3 A;  3ZTD A;  3V6C B;  2C9W B;  1GG3 A;  3K9P B;  4NAW A;  4PS8 A;  1J0G A;  1V5T A;  2CR5 A;  2N4F A;  3ZRC A;  5G2N A;  2GBR A;  1TBE A;  2O6V B;  3T9L A;  2EMT A;  4NPN A;  1C3T A;  4ANX A;  4ZDV A;  2BKR B;  2KJ6 A;  4ZRK A;  3ZDM C;  1P9D U;  2FUH B;  4BKG A;  2BYE A;  2LVQ A;  3ZRF A;  1J19 A;  1LFD A;  5DPW A;  4GU2 A;  2EKE C;  3VUY A;  4F8C B;  2G45 B;  2MSE D;  3O65 B;  3S2A A;  4II2 B;  2W9N A;  3RZW C;  3PS6 A;  2FCN A;  1WGR A;  4KV2 A;  2KHW B;  3LJ3 A;  3UIN B;  4DHZ E;  2BYV E;  3QAQ A;  4M0W B;  3QJZ A;  4EZJ A;  2LAS A;  3H7P B;  1KJT A;  4LCD E;  3D32 A;  2QHO A;  2LRU A;  4BFR A;  4MGY E;  1I35 A;  3AUL A;  2O2V A;  1E7U A;  2MLB A;  2D11 A;  1Z5S B;  2HJ8 A;  3RUL A;  3UIO B;  1YX6 B;  4ANU A;  3H9D A;  2NR2 A;  4CO7 A;  3M62 B;  4K7W A;  2LUE A;  1UH6 A;  2N9P C;  3U30 A;  3JW0 X;  1WGH A;  4IWO A;  4XX5 A;  2NBW B;  2UWQ A;  1VCB A;  5D94 A;  4HDQ A;  5G55 A;  3ML9 A;  4FJY A;  2L7R A;  4ASW C;  3ALB A;  2I1J A;  2LWP A;  2DZI A;  3ONS A;  5DPS A;  3Q3F A;  4NAW B;  2ZNV C;  2GMI C;  2LVP A;  4KZC A;  1V86 A;  3CMM B;  2NBV B;  5LXI B;  4IWQ A;  4NJ7 A;  2MWS B;  2KX0 A;  2DYO A;  5GMV A;  5CHW A;  1WRD B;  2JPH A;  3AU4 A;  3UIP B;  2ZVO A;  4JLC A;  2Z0D B;  4ICV A;  3PRZ A;  3TBL D;  2K6D B;  2WWZ A;  2CHX A;  2L0T A;  4MEM A;  1IYF A;  1WI0 A;  3V61 A;  2K25 A;  3MJW A;  4TQ0 A;  1WR6 E;  3PV1 A;  4W9E A;  2MA9 B;  3H6N A;  2A4Z A;  4XZ4 A;  3VFK A;  1WE6 A;  1WMH B;  1YQB A;  4GOC A;  2K8B A;  3VHT C;  4WQO B;  4ZYN A;  3DBH I;  2O2V B;  4W9J A;  2KLC A;  4FLH A;  3DVN U;  3N30 A;  3VDZ A;  1OEY A;  3ZNI D;  1H4R A;  1GJZ A;  5JHA A;  3DDC B;  3VTV A;  2JXX A;  2KFK A;  2Z59 B;  3PTF C;  3NHE B;  3ZNH B;  4EUT A;  2O6V A;  1V80 A;  2J0M A;  3VXW A;  4WJP A;  2HE7 A;  2N7D A;  2L3Z A;  3A4R A;  2MBB B;  3OAW A;  2KJR A;  4MDK E;  1I42 A;  3PZD A;  1E7V A;  3CST A;  4K7S A;  2KDF B;  2IY1 B;  2KQ7 A;  2KD0 A;  2OJR A;  4M8N A;  2V1Y A;  4MGZ E;  2CS4 A;  4DHJ D;  2I1K A;  4FAD A;  4MJS A;  1WE7 A;  2M1M A;  2NVU I;  1L2N A;  2C7H A;  4JIO U;  5IA7 A;  2KWV B;  2KMA A;  2DYB A;  2IO2 B;  3MTN B;  2IYD B;  1E8X A;  3M3J A;  4BBN C;  2IY0 B;  4BKS D;  4E71 A;  3BIN A;  1WGG A;  4FUL A;  2KK8 A;  1WXV A;  2R2Q A;  4NJ6 A;  4EZL A;  1EUV B;  3HIZ A;  1UBI A;  1LM8 B;  1WJN A;  1WH3 A;  1ZW7 A;  2EMS A;  3OLM D;  4OVU A;  3SU8 X;  2N9X A;  3I3T B;  2N7E A;  2J7Q B;  3HK0 A;  2CKH B;  2R2O A;  1FXT B;  3GOE A;  2KO3 A;  4FJZ A;  4WWP A;  5JZE B;  1UEL A;  1RFA A;  3RYT A;  1OGW A;  2M4N A;  4F7Z A;  4BBN F;  4BOZ B;  2KTR A;  2MBQ A;  4IUM B;  4MGI E;  2KFJ A;  4P7I A;  1WIA A;  4B95 A;  4BVU C;  4NQL B;  4IWP A;  2ZPN A;  4F1S A;  2KFK B;  2PE6 B;  2LD9 A;  3JVZ X;  4NQK E;  4FHJ A;  1E8W A;  1WFY A;  2Y5B B;  3HHM A;  3ZNG C;  2BKF A;  4RM8 A;  4PYZ A;  1V49 A;  2BGF A;  2J0J A;  3A9K A;  1H8C A;  3DQV A;  3PT2 B;  5LLI A;  4G11 A;  2XK5 A;  2MQJ A;  3RD2 A;  3C0R B;  3PHX B;  3CSF A;  4MH0 E;  5J18 A;  3EEC A;  3X23 A;  1V5O A;  4MJS B;  1WJ4 A;  1IPG A;  2FCS A;  2GOW A;  2LVO A;  2JT4 B;  1KOT A;  1IP9 A;  2NPT A;  2KJH B;  2ZEQ A;  4ANV A;  3R66 C;  4TQ1 A;  4A20 A;  3RUI B;  5E6P A;  4LDT D;  4AWJ A;  2KWU B;  4TUU A;  5D6J B;  1WMH A;  2LXC A;  3ZLZ A;  4AP4 C;  4W9K A;  3WIM A;  4GIV A;  1V81 A;  1R4N I;  2ZNV B;  1UGM A;  1OQY A;  1WX8 A;  4GDL B;  4DWF A;  3X0W A;  3LDZ E;  1WJU A;  4KSL C;  2UYZ B;  4J6I A;  3ZKJ C;  1E90 A;  2KOX A;  4IM2 A;  4EKU A;  3APC A;  3IBE A;  2B3A A;  3U7D A;  2V3S A;  1YJ1 A;  2KTR B;  2WX0 A;  1X1M A;  1SIF A;  4ZRJ A;  2JRH A;  3L0W B;  2WX1 A;  2OOB B;  4K1R B;  4WWO A;  1D3Z A;  1WGD A;  4RM9 A;  1HE8 A;  3QIJ A;  4E74 A;  3APD A;  4EEW A;  3DVN V;  3IFW B;  3A9K B;  2MX2 A;  3L08 A;  1QZE A;  3N32 A;  3R7R A;  3NZS A;  2XK5 B;  1WM2 A;  3K9O B;  3PRE A;  1M94 A;  2D2Q A;  3CF6 E;  5TR5 A;  3WAM A;  4GDK A;  4DDI D;  1GNU A;  2MBE A;  2DZM A;  4ZRI A;  2N9E B;  3AU5 A;  5C23 A;  4AUQ C;  2BWE S;  5J17 A;  2LGY A;  1P0R A;  3DPD A;  2KAN A;  2IO0 B;  3PRP B;  1GUA B;  1WY8 A;  2MRP A;  2NPT B;  4MSQ B;  4W9C A;  1WXS A;  4CHK A;  5CHV C;  1NDD A;  3JYU A;  3TL5 A;  3UQB A;  3DOW A;  1LXD A;  4KIK A;  2PJH A;  4B9K A;  1KLV A;  4ANW A;  4KDI C;  2DX5 B;  1ZKH A;  2FAZ A;  2KN5 A;  3WAN A;  4FBJ B;  3QA8 A;  3QX1 A;  1V6E A;  4PS3 A;  2KC1 A;  2K39 A;  4I6P A;  3NZU A;  4EFO A;  2IZV B;  3ENE A;  3WAL A;  2MW5 A;  2YVC A;  2LXA A;  4K81 A;  2AL6 A;  3PSE B;  5AEK B;  3M95 A;  2KTF A;  1Q1O A;  1WXA A;  4M8M A;  4GMV A;  5CHF A;  1E8Z A;  2DAJ A;  2JUO A;  2DZJ A;  4EOY A;  4W9I A;  4I6L B;  3IHP C;  2AL3 A;  3IG3 A;  4WJQ A;  4AJW A;  4KVG B;  2KDB A;  3W1S C;  5IAA C;  2C7N B;  1WX7 A;  3VVW B;  1TTN A;  1E8Y A;  1WJ6 A;  4YL8 A;  5DCN A;  1RAX A;  3QHT A;  1GC6 A;  3TCA A;  4MGK E;  1UD7 A;  4IM0 A;  2NBU A;  2RR9 A;  1UZX B;  3EHV A;  2LI5 A;  2RSU A;  4FHK A;  2BPS A;  4KZ0 A;  2DAF A;  2GBN A;  4GDK B;  2NCN A;  1SGH A;  3PLU A;  3PVL A;  2GBM A;  3B1L X;  4E3C A;  1Q5W B;  1YIW A;  2MCN B;  2KVR A;  1EF1 A;  2N1W A;  3UGB B;  4B6W A;  4W9D A;  3KW5 B;  1J8C A;  1XT9 B;  1XQQ A;  2KNB A;  2XBB C;  4ICU A;  5D7G A;  1Y8R C;  4KIK B;  2VRR B;  3A1Q B;  4GDL A;  4HPL B;  5DPT A;  3SDL C;  4A3P A;  4II3 B;  2D07 B;  2AYO B;  2K8C A;  2J0K A;  3A33 B;  2KDI A;  3ZVV A;  3EC8 A;  4WWN A;  3VH4 B;  3BY4 B;  4FA6 A;  3NY5 A;  3GZN I;  3DCG A;  3T8M A;  3VTW A;  3PRM B;  3VTU A;  2L8J A;  2L0F A;  5HKH A;  1C1Y B;  2JVC A;  3B08 A;  3IVF A;  1LQB A;  3AXC A;  2ZCB A;  1OTR B;  2FCM A;  2HD5 B;  5AZH A;  4G3X B;  2KC2 A;  4HJK A;  4GB9 A;  3TJP A;  2LZ6 A;  1EF5 A;  3R7Q A;  3B0A A;  4MEL A;  1YX5 B;  1T0Y A;  3OJ3 A;  1V2Y A;  2ZJD A;  2PEA A;  1OEY J;  2MP2 A;  3KUZ A;  1ISN A;  1AAR A;  4WJN A;  1P3Q U;  3OJ4 B;  3QCA A;  2JZ3 B;  3VH3 B;  4FN2 A;  4BKS A;  1S3S G;  5CX3 A;  3A9J A;  2PE9 A;  3APF A;  3Q3J A;  2FNJ B;  4HWI B;  2G4D B;  4W9H A;  2KXJ A;  1F9J A;  2NS5 A;  2M0X A;  2CU1 A;  3R3M A;  3W1S A;  2N1V A;  3V60 A;  1WM3 A;  3ECI A;  3WAO A;  4MSM B;  3W1Y A;  3QK0 A;  4XC2 A;  3M63 B;  4PYU A;  1SE9 A;  3L13 A;  3ZUN A;  4HLE A;  2AEH A;  3N3K B;  4KDL B;  4BOS C;  2JRI B;  2GBK A;  5KHQ A;  1RRB A;  1TZ1 A; 
#chains in the Genus database with same CATH topology
 2JF5 A;  3T3N A;  3V05 A;  1WYW B;  2G3Q B;  1WZ3 A;  3L10 B;  3GE8 C;  1VR9 A;  3VQI A;  3SD5 A;  3UF8 A;  4HDO A;  2QEJ C;  2XNA C;  3NS8 A;  3JSV A;  1V97 A;  2MP2 B;  2IO3 B;  3VAW A;  3UQA A;  3KYC D;  4RFB A;  1EWC A;  2BS4 B;  3P63 A;  4DBG A;  4IW0 A;  3P4R B;  4PS7 A;  2PIA A;  2W3R A;  3RZF A;  1S1Q B;  1VZ8 A;  3NUH B;  2WXJ A;  2G4S A;  4JGH B;  3BK1 A;  3R2T A;  1L0Y B;  3QC8 B;  2K8H A;  2FID A;  4W9L A;  3BYY B;  3Q3N C;  1E9M A;  4K3C A;  2BYF A;  1YNT E;  2WDT B;  3WAP A;  4RNA A;  3PGE A;  1BXT A;  2IO1 B;  2LGX A;  2ZPY A;  2ONQ A;  1KLG D;  4K7U A;  4HRO A;  3V62 A;  1GC7 A;  5D3I B;  3V6E B;  3KVF B;  1KF6 B;  2ZZP B;  3KUD B;  5E6J A;  2M17 A;  4GXB A;  5HFY A;  3QWZ B;  2L52 A;  3KWV A;  3DVG X;  3ABV B;  2CJN A;  3NVZ A;  5FR6 A;  1BT0 A;  1IBX B;  2Z0E B;  1UBQ A;  3FAH A;  1P98 A;  2QIE B;  2M8S A;  5E6O A;  4GSW A;  3BYT B;  2FIF A;  2HTH A;  4O1N A;  4I6N B;  2WXL A;  3ZTD A;  2JWU A;  3K9P B;  4NAW A;  3H8H A;  2N4F A;  3AEA B;  4ZOH C;  3T9L A;  2EMT A;  4NPN A;  5H8Y E;  1DOY A;  1L6U A;  1JRO A;  4YT0 B;  4BKG A;  2BYE A;  2SAK A;  5HG2 A;  2WDQ B;  3ETR A;  2W54 A;  2QIL A;  3U7Z A;  4JWS C;  4M0W B;  3QJZ A;  4EZJ A;  2M0A A;  2QHO A;  2LRU A;  2JX5 A;  1I35 A;  2O2V A;  1Z5S B;  2HJ8 A;  2ZW1 A;  4ANU A;  2NR2 A;  4XDC A;  2QDF A;  4WWM A;  1UH6 A;  1VCB A;  4HDQ A;  1YQ3 B;  2L7R A;  2I1J A;  3ONS A;  3FIL A;  2MHJ A;  1ZPS A;  2LVP A;  3HRD D;  2PVG C;  4IWQ A;  2MWS B;  2KX0 A;  5C3J B;  2BVC A;  3UIP B;  2I2Y A;  1C4A A;  3B9J A;  2Z0D B;  3TBL D;  3PRZ A;  2CHX A;  4GLS C;  3L4P A;  2K25 A;  4AQ7 A;  4TQ0 A;  1TS2 A;  3PV1 A;  4W9E A;  3W5V B;  2A4Z A;  2OJW A;  1WE6 A;  3RMK C;  3VHT C;  2K8B A;  1QOB A;  4FLH A;  3I63 C;  2ICI A;  5JHA A;  2KFK A;  3R2I A;  2ON8 A;  4WJP A;  2MBB B;  2KJR A;  4MDK E;  1E7V A;  3CST A;  3GS2 A;  2D3B A;  2KD0 A;  2H88 B;  2V1Y A;  2J53 A;  2I1K A;  4C56 C;  1WE7 A;  2NVU I;  2WXF A;  4WIP A;  3AE6 B;  3C8Y A;  3MTN B;  1FCL A;  5D3D A;  3NG0 A;  3BIN A;  4WQM A;  5IP4 D;  1QOF A;  3OLM D;  3I3T B;  2J7Q B;  2CKH B;  1FXT B;  2H89 B;  2KO3 A;  1HTQ A;  4WWP A;  1JWS D;  3Q3M C;  1M4V A;  3RYT A;  1OGW A;  4F7Z A;  4BBN F;  1SE4 A;  2KTR A;  4MGI E;  1WIA A;  2INC C;  2LD9 A;  4NQK E;  1WFY A;  2Y5B B;  1I4Q A;  3PZ8 A;  2TSS A;  2AX5 A;  4RM8 A;  3A9K A;  1H8C A;  3RD2 A;  2XK5 A;  2MQJ A;  2IJ0 A;  3CSF A;  3EEC A;  4MJS B;  3ZYY X;  1IPG A;  1P7E A;  2FCS A;  1QT9 A;  3RFZ B;  2ZEQ A;  4TQ1 A;  5E6P A;  5FR3 A;  5BMH A;  4TUU A;  3VR8 B;  4GIV A;  1V81 A;  3IAS 1;  1NYR A;  1UGM A;  1WX8 A;  1C78 A;  2D5G A;  4DWF A;  1WJU A;  2UYZ B;  2LHD A;  2KOX A;  4IM2 A;  3KQ4 A;  2V3S A;  3AMZ A;  1YJ1 A;  1XEE A;  2WX0 A;  4ZRJ A;  4XYC A;  5EE9 A;  1HZ6 A;  3L0W B;  2WX1 A;  1EU3 A;  1HE8 A;  1YN5 A;  3DVN V;  3L08 A;  3R7R A;  3K9O B;  1WM2 A;  1M94 A;  2JSV X;  1FD6 A;  1MG4 A;  1GNU A;  3PZ7 A;  5J17 A;  2G1E A;  3IT4 B;  2KAN A;  4RF0 A;  3PRP B;  1GUA B;  4HRS A;  4CHK A;  2BTE A;  3TL5 A;  4J3O D;  1KLV A;  3MHZ A;  4KDI C;  2VZK B;  2DX5 B;  1STE A;  1VRA B;  2V9H A;  3WAN A;  4I6P A;  3PSE B;  2GI9 A;  2KTF A;  1WXA A;  1JRP A;  2JUO A;  1ZE3 D;  5G5H A;  2DZJ A;  4W9I A;  4I6L B;  2KDB A;  5IAA C;  5C2T B;  1TKE A;  1C4C A;  1GC6 A;  4YSX B;  3TCA A;  1FXI A;  1YJJ A;  2NBU A;  2RR9 A;  5FKA C;  1SB3 C;  2HJ1 A;  2LI5 A;  3N1Y C;  3P4P B;  3B1L X;  4YSZ B;  1Q5W B;  2MCN B;  2JYT A;  2KNB A;  4ICU A;  4P16 A;  2K8C A;  2BB6 A;  2J0K A;  3ZVV A;  3C19 A;  1XLO A;  3BY4 B;  2G9H D;  3NY5 A;  1IUE A;  1TIF A;  5HKH A;  1C1Y B;  1LQB A;  2ZCB A;  1OTR B;  2HD5 B;  4HKQ A;  2WLB A;  3IXS A;  1T0R C;  4FXC A;  4GB9 A;  1EF5 A;  1JWM D;  3R7Q A;  3MC9 A;  3OJ3 A;  1V2Y A;  2ACZ B;  2ZJD A;  1J7B A;  1QKZ A;  1OEY J;  2K0P A;  4XE0 A;  3KUZ A;  1AAR A;  1P3Q U;  3OJ4 B;  3QCA A;  1MI0 A;  3VRB B;  2PE9 A;  3Q3J A;  1QLB B;  4OZA A;  2WHI A;  3V60 A;  1WM3 A;  3ECI A;  3TUO A;  4RGO S;  1SE9 A;  4HLE A;  3N3K B;  2GBK A;  1RRB A;  1TZ1 A;  2K6Q A;  2BS3 B;  4TKN A;  4B0E A;  1YMH E;  2WXG A;  1Q0W B;  2BF8 B;  3RCZ A;  1N63 A;  1V8C A;  4NZL B;  2XEW A;  1A5R A;  1JRU A;  3L54 A;  2KMC A;  1N5X A;  4XGA B;  1SSN A;  2IBI B;  4RMA A;  3A9J B;  3KUC B;  1CMX B;  3AEE B;  4KSK C;  2I38 A;  3VUW A;  3MHS D;  5IOI A;  3PLV A;  2W3S A;  3KH0 A;  5L83 A;  3PHW B;  1WZ0 A;  1WR1 A;  2DYM A;  2MJD A;  2R61 A;  4LJO B;  2X38 A;  1U4A A;  1T0S C;  4HVB A;  1TY0 A;  1HXY D;  3NOB A;  2QCZ A;  1WX9 A;  4AOF A;  4W9G A;  1K8R B;  2ASQ A;  1WRI A;  3RNB C;  5J2R A;  2MH7 A;  1L4Z B;  2C7M B;  3H7S A;  1TGZ B;  2RD0 A;  1J7A A;  2LGI A;  3NS1 A;  3RT3 B;  1J7C A;  3JSV B;  1FO4 A;  4HK2 A;  2VH2 A;  3EUB 2;  3DVG Y;  3TEZ A;  1WGY A;  2DEN B;  2PLP A;  3EGR A;  2IGH A;  1EO6 A;  1E5W A;  2ZVN A;  4P1C C;  1R4M I;  2L83 A;  4HPM B;  4GN1 A;  3AV8 A;  3DHI C;  1K52 A;  2RPQ A;  3DHG C;  1AW7 A;  1Y56 A;  3DBS A;  5BMG A;  3Q8B A;  3ZO5 B;  2WS3 B;  3KYD D;  5AUK A;  2KYW A;  1RM6 C;  2LMC A;  2REX A;  1IGD A;  1GG3 A;  4IOI E;  2GBR A;  1C76 A;  1TBE A;  2J42 A;  2KJ6 A;  5FK9 C;  2FUH B;  2LVQ A;  1ESF A;  4F8C B;  4N59 A;  4ZHP A;  3S2A A;  4II2 B;  1K51 A;  2W9N A;  3RZW C;  3I57 A;  5EE1 A;  2N0S B;  2WU5 B;  2BBC A;  4BFR A;  4MGY E;  3I9V 1;  3RUL A;  1B1Z A;  3BVG A;  3UIO B;  4L23 A;  1HQR D;  2LUE A;  2DNF A;  2NBW B;  3ML9 A;  4ASW C;  3ALB A;  2DZI A;  3CWI A;  4NAW B;  3OG5 A;  1K53 A;  5LXI B;  1YQ4 B;  5GMV A;  5CHW A;  3AU4 A;  3RNF C;  3VR9 B;  2K6D B;  3W9C B;  2L0T A;  4USA A;  4YTP B;  3U4E G;  1SEB D;  2N9K A;  2E3T A;  4BZA A;  3AE7 B;  3VFK A;  3Q2A C;  2V3P A;  3BWU D;  1YQB A;  4GOC A;  2Y3A A;  4ZYN A;  2O2V B;  4W9J A;  1L0X B;  3VDZ A;  1OEY A;  4KGR A;  3ZNI D;  1GJZ A;  2IDY A;  2JXX A;  3NHE B;  3PZD A;  1NI3 A;  3FIL B;  2KDF B;  1Q10 A;  2KQ7 A;  2OJR A;  3E9S A;  2K3U A;  4DHJ D;  2HDE A;  4C00 A;  2KMM A;  2M1M A;  2C7H A;  2BYT A;  2KWV B;  2DYB A;  3M3J A;  4BBN C;  1TS5 A;  4FUL A;  2R2Q A;  1EUV B;  1JWB D;  1WJN A;  1LM8 B;  1WH3 A;  1ZW7 A;  2EMS A;  4OVU A;  4C7Y A;  2KQ4 X;  3HK0 A;  1PGA A;  3GOE A;  3P4Q B;  4FJZ A;  1I4R A;  5JZE B;  1A70 A;  4B95 A;  1XLN A;  4NQL B;  4F1S A;  2KFK B;  2PE6 B;  4S17 A;  1GPX A;  1V49 A;  2BGF A;  4G11 A;  3C0R B;  3PHX B;  2K5P A;  4WUR A;  4MH0 E;  5J18 A;  4KX6 B;  2LHE A;  2KJH B;  1I4X A;  2W55 A;  3R66 C;  3FKY A;  2OHF A;  3RUI B;  4LDT D;  4AWJ A;  3AE9 B;  2KWU B;  4AP4 C;  3Q8C A;  1WWT A;  2ZNV B;  2JZP A;  5MPO A;  1E0Z A;  3X0W A;  3N9Y C;  1BML C;  2K9X A;  3BZD B;  3ZKJ C;  4A8X C;  2KTR B;  1PYW D;  1SIF A;  4KKI A;  1HTO A;  1WGD A;  4RM9 A;  3MJ5 A;  1AN8 A;  4EEW A;  2PVO D;  3IFW B;  3A9K B;  1QQR A;  2ZW0 A;  2BS2 B;  4LNI A;  4B0M A;  2XK5 B;  3WAM A;  3CF6 E;  5TR5 A;  4GDK A;  4RGN A;  4ZRI A;  2N9E B;  3AU5 A;  2LGY A;  5BYQ A;  5CHV C;  4ZHO A;  3DOW A;  4B9K A;  4ANW A;  2KT7 A;  2FAZ A;  1D4B A;  1OQQ A;  2KN5 A;  2WXN A;  4M00 A;  4RCO A;  3U2S C;  3NZU A;  2BQQ A;  2MW5 A;  4K81 A;  2WP9 B;  3M95 A;  3TEX A;  2AQ1 B;  3PO0 A;  4KGS A;  1UGJ A;  2DAJ A;  3AE3 B;  4AJW A;  3IHP C;  3IG3 A;  4KVG B;  2C7N B;  2K22 A;  3P1M A;  3VVW B;  5DCN A;  1RAX A;  2IGD A;  1UD7 A;  2J4X A;  4IM0 A;  3EHV A;  2NTT A;  1SJH D;  1L5P A;  1E6E B;  2DAF A;  2GBN A;  4JPS A;  4OZB A;  3PVL A;  1HZ5 A;  2D3C A;  2UU7 A;  4B6W A;  3MC0 B;  3UGB B;  3AE2 B;  3A1Q B;  4R3D A;  4II3 B;  2D07 B;  3A33 B;  3RI7 C;  3VH4 B;  3GZN I;  3VTW A;  3PRM B;  2L32 A;  4A90 A;  3N20 C;  1FXA A;  4H2A A;  1RYJ A;  1MPE A;  1ZXH A;  1T0Y A;  1JWU D;  1ZDV A;  5JXV A;  5CX3 A;  3APF A;  2FNJ B;  4W9H A;  1N5W A;  1F9J A;  3W1S A;  2CU1 A;  3R3M A;  4RGM A;  1K50 A;  4MSM B;  3W1Y A;  3LB8 C;  3IAM 1;  3M63 B;  4PYU A;  3ZUN A;  2AEH A;  4KDL B;  4MM3 B;  4BOS C;  2W82 A;  1QF6 A;  2KWD A;  1AYF A;  3U8Z A;  3ZDT A;  3AI5 A;  4LJP B;  3QQ8 B;  5E6N A;  2YEP B;  4G50 A;  3EFU A;  5C1Z A;  2V3N A;  3L16 A;  1DYQ A;  1ZUD 2;  2Z8L A;  1OQR A;  4DK5 A;  4CQN A;  3EFC A;  1V1P B;  2K1F A;  2JWZ A;  4IM3 A;  3AH7 A;  4YTN B;  1R4M B;  5BO4 B;  2O6V D;  4HJG E;  4JE3 B;  3A1Q A;  2LRW A;  4IKG A;  5CTR C;  2NTS A;  1WF9 A;  1NEK B;  2DWQ A;  5AZG A;  1I4P A;  1TYG B;  2J52 A;  4JWU C;  2KQS A;  5BYS A;  2LGD A;  3TEW A;  1E10 A;  2MBH A;  4GGQ A;  1RLF A;  3U52 E;  1L7Y A;  1N62 A;  4A3O A;  3ML8 A;  1SIJ A;  2C60 A;  1N61 A;  4LNN A;  3N1X C;  5LXH A;  4DXA B;  1TZO A;  2KX3 A;  1MG8 A;  4DDG D;  3W5U B;  1ZGU B;  2CHZ A;  5IO9 A;  2JZZ A;  1R4N B;  2FCQ A;  1XF5 L;  4BKT A;  3ZJV A;  2L76 A;  1TY2 A;  1NI2 A;  4MM3 A;  2HTM E;  2KZR A;  5EDS A;  3VUX A;  4IC7 B;  1UWX A;  2V4L A;  2CHW A;  2QMT A;  4AJY B;  5EE3 A;  3DBR I;  1N6Z A;  1PGX A;  5JH5 C;  4OVV A;  3Q14 C;  1PQS A;  3H7P A;  1I4G A;  3RNA C;  4CYE A;  1NBF C;  2PPH A;  4NAM A;  1PFD A;  4UDU C;  1KM7 A;  4HCP B;  2L1A A;  1V1P A;  2FBW B;  1ZP0 B;  2PMV A;  2YLM A;  3ZTC A;  1F2R I;  2BWF A;  2D3A A;  1ROE A;  3ZNZ B;  3TIX A;  4TV3 A;  2V4I B;  3V6C B;  3AE1 B;  1JAL A;  4PS8 A;  2Y5P A;  4L2Y A;  5G2N A;  2O6V B;  1FEH A;  2WU2 B;  4ANX A;  1FNW A;  2BKR B;  3ZDM C;  1P9D U;  5G5G A;  3ZRF A;  1F1H A;  5EE0 A;  1LFD A;  2LFI A;  3HVD A;  4GU2 A;  2N7J A;  5DPW A;  3MP9 A;  2G45 B;  2MSE D;  3PS6 A;  4LTU A;  3LXF A;  1WGR A;  2KHW B;  1MFW A;  1SE2 A;  5IN7 A;  4DHZ E;  2BYV E;  3QAQ A;  2LAS A;  1KJT A;  5BYR A;  3D32 A;  3URY A;  3AUL A;  2D11 A;  1YX6 B;  4REZ A;  3H9D A;  4CO7 A;  1XCQ L;  4K7W A;  2N9P C;  5D94 A;  1WGH A;  4P6V F;  2WXP A;  5G55 A;  1SF0 A;  2WXI A;  2LWP A;  1QIL A;  5DPS A;  2ZNV C;  4NJ7 A;  1GAQ B;  2JPH A;  2AQ3 B;  4JLC A;  2LGS A;  4ICV A;  2RDH A;  2WWZ A;  2E6X A;  4A6Q A;  1JCK B;  2RPV A;  1IYF A;  1WI0 A;  5GXG B;  3V61 A;  3MJW A;  1WR6 E;  4ITK A;  3H6N A;  1MHX A;  4XZ4 A;  1YN3 A;  2KAJ A;  3DBH I;  2KLC A;  3P42 A;  1FRD A;  2OED A;  1H4R A;  3NJT A;  3SEB A;  3AB5 A;  3PTF C;  4EUT A;  2O6V A;  3VXW A;  2HE7 A;  2N7D A;  3O13 A;  3NVV A;  1PDX A;  4JX1 C;  1L4D B;  1JQ4 A;  1L0V B;  2IY1 B;  4MGZ E;  1F2R C;  1UF0 A;  2WXH A;  4FAD A;  4M02 A;  4LK0 M;  2X8X X;  2IO2 B;  3AE8 B;  4RGT A;  2IYD B;  1E8X A;  4E71 A;  4DQO C;  1TKG A;  1WGG A;  2KK8 A;  1EU4 A;  1XO3 A;  1WXV A;  4NJ6 A;  4EZL A;  3HIZ A;  2R2O A;  2WXK A;  3GP7 A;  2IGG A;  3N1Z C;  5H92 C;  1RFA A;  3UI3 A;  1VZ7 A;  4A9A A;  4BVU C;  2MBQ A;  2KFJ A;  4P7I A;  4AS1 A;  4IWP A;  2ZPN A;  3JVZ X;  4FHJ A;  3HHM A;  3ZNG C;  4PYZ A;  2J0J A;  2IND C;  3T3O A;  3DQV A;  3Q3O C;  1FMA D;  3X23 A;  4OZC A;  1WJ4 A;  2GOW A;  1IP9 A;  2NPT A;  1QOA A;  4ANV A;  4A20 A;  2INN E;  1D5X C;  5D6J B;  2LXC A;  3B2G A;  1C79 A;  4W9K A;  3WIM A;  1R4N I;  1TT5 B;  4LLG M;  1OQY A;  4C80 A;  1NVI D;  4J6I A;  2BW2 A;  1E90 A;  1KFY B;  3APC A;  2B3A A;  4ACF A;  1MHH E;  2KN4 A;  2QJL A;  4K1R B;  2OOB B;  3QIJ A;  4C4V A;  4E74 A;  3APD A;  4L1B A;  1C9F A;  2MX2 A;  1QZE A;  3NZS A;  3GZN B;  2D2Q A;  3BVZ A;  1ACC A;  2DZM A;  3AM9 A;  4AUQ C;  1R7S A;  2BWE S;  1CQV A;  3DPD A;  1PUT A;  2BB5 A;  3EA6 A;  2IO0 B;  4Q2J A;  4W9C A;  4MSQ B;  1WXS A;  3NVW A;  1NDD A;  3UQB A;  4ARC A;  1LXD A;  4KIK A;  3Q8E A;  1T6B X;  4OHJ A;  4EE2 A;  3Q69 A;  4WAF A;  3QA8 A;  3QX1 A;  2K39 A;  4NJC A;  3VRA B;  3WAL A;  2MJ3 A;  2BT6 A;  2AL6 A;  5AEK B;  4PK1 A;  1FNV A;  3DWG C;  2B76 B;  1E8Z A;  4EOY A;  4S0R A;  4DXF A;  4WJQ A;  2PTL A;  3AN1 A;  1TTN A;  1E8Y A;  1WJ6 A;  3ZGZ A;  5IKC M;  3BII D;  3QHT A;  1UZX B;  3R8B A;  4KZ0 A;  4GDK B;  3SR6 A;  2NCN A;  1I4H A;  1SGH A;  3PLU A;  2GBM A;  1HEZ E;  2QC8 A;  2KVR A;  1ZXI A;  1EF1 A;  3AED B;  3AEC B;  4W9D A;  1J8C A;  1XT9 B;  1TS4 A;  1Y8R C;  1CZP A;  2AYO B;  2FE8 A;  4HKZ E;  3J9C A;  1XLP A;  4WWN A;  3AE4 B;  4FA6 A;  4OVZ A;  3RPF C;  3DCG A;  2CJO A;  1F0Z A;  2L8J A;  2JVC A;  3B08 A;  4PT5 A;  3IVF A;  5AZH A;  1GOZ A;  3TJP A;  2LZ6 A;  1JW9 D;  5HI1 A;  1E7P B;  2MP2 A;  1ISN A;  2DLB A;  2JZ3 B;  3VH3 B;  4FN2 A;  1S3S G;  1LGR A;  2G4D B;  2NS5 A;  2M0X A;  2N1V A;  3WAO A;  2RMM A;  4XC2 A;  1QOG A;  5KHQ A;  4QAY A;  4URK A;  1G6J A;  1KH0 A;  2WXR A;  1KLU D;  1WXM A;  1Z2M A;  2L00 B;  3WCQ A;  5L95 C;  3ZW3 A;  2KKC A;  3DBL I;  1OFF A;  1VD2 A;  4W9F A;  4DHJ B;  4US9 A;  5BMI A;  4RH6 A;  1ET9 A;  3DBR B;  1JML A;  2KWC A;  3B2F A;  3GB1 A;  2Y5C A;  3AEB B;  4US8 A;  3TMP B;  5D2M B;  1WYG A;  1YOV B;  5JHB A;  1XXG A;  1FNU A;  1XD3 B;  1D5M C;  4ZRQ A;  3OWE B;  4NY0 A;  4JQW C;  1P1A A;  4YSY B;  2YEP F;  3SHQ A;  1JWA D;  2AWT A;  5DPR A;  1SE3 A;  2SEB D;  2V0G A;  4X57 B;  2LEK A;  1EWY C;  4DXG A;  4NNJ B;  3A4S C;  3QAR A;  1IBX A;  2EEL A;  1TS3 A;  4N9F 4;  3P2B A;  1TJE A;  3HM6 X;  2D3G A;  3P4S B;  3PPA A;  1FFU A;  1B9R A;  4DHZ B;  1FPY A;  2D10 A;  2KLG A;  1YD8 U;  2WDR B;  3HVZ A;  2WYQ A;  4LDT B;  4EZK A;  4FJV B;  2JY6 A;  3NZ3 A;  3WA0 A;  2DZK A;  2L05 A;  2ZCC A;  4HXD A;  2DHZ A;  2GBJ A;  4IG7 B;  3W2D A;  2KDE B;  5KHO A;  2RGF A;  3H1U A;  2Q5W D;  4K3B A;  4M0W A;  1V9J A;  3L17 A;  3ZIM A;  2MBO A;  2VZK D;  5AZF A;  4MAC A;  3HM3 A;  3ZJT A;  2C5L C;  1NEN B;  4P1B C;  4G0N B;  1NYQ A;  2LJ5 A;  3AE5 B;  4WJO A;  4WAA A;  2A5U A;  2KVZ A;  1RFK A;  4HCN B;  2MEK A;  4JL9 A;  2C9W B;  3KLS X;  1TKY A;  1J0G A;  1V5T A;  2CR5 A;  3ZRC A;  1C3T A;  3NVY A;  4ZDV A;  4ZRK A;  1UNS A;  3DBH B;  4MT5 A;  1J19 A;  2EKE C;  3VUY A;  3O65 B;  2FCN A;  1ET6 A;  4KV2 A;  3LJ3 A;  3UIN B;  3DWM A;  1AWD A;  1C4P A;  1VLB A;  3H7P B;  1PGB A;  4LCD E;  2WXQ A;  1E7U A;  2MLB A;  1WSP A;  1DOX A;  2IPK D;  2LJI A;  4N6E B;  3ZJU A;  3M62 B;  1ENF A;  3U30 A;  2JQR B;  3JW0 X;  4IWO A;  4XX5 A;  2UWQ A;  2GLS A;  1MJD A;  4FJY A;  1SXT A;  3RNE C;  3CIR B;  3Q3F A;  2GMI C;  1VZ6 A;  4KZC A;  1V86 A;  3CMM B;  2NBV B;  3Q6B A;  2DYO A;  4XWT A;  1WRD B;  2QSD A;  2ZVO A;  1T3Q A;  3AEG B;  4MEM A;  1YN4 A;  1VDV A;  5I4D A;  2MA9 B;  3RNC C;  1GB1 A;  1WMH B;  3LYY A;  1P7F A;  4WQO B;  3TSS A;  3DVN U;  3N30 A;  2PW9 A;  1L6V A;  1ZDX A;  2MJE A;  3DDC B;  3VTV A;  2INP E;  2Z59 B;  3ZNH B;  1I7H A;  1V80 A;  2J0M A;  3A4R A;  1D5Z C;  2L3Z A;  2N9L A;  3OAW A;  3SFE B;  3GE3 C;  4ZYS A;  1I42 A;  4K7S A;  4M8N A;  2CS4 A;  3RNG C;  1C77 A;  4MJS A;  1L2N A;  1VJK A;  4JIO U;  5IA7 A;  2KMA A;  4YTM B;  1DGJ A;  2WGS A;  4BKS D;  2IY0 B;  4XDD A;  4KGT A;  5AUI A;  1UBI A;  3SU8 X;  2N9X A;  1DOI A;  2N7E A;  3MFG A;  1FFV A;  4HEA 1;  1UEL A;  1ZOY B;  3RN9 C;  3Q8A A;  2M4N A;  4BOZ B;  4IUM B;  2PKO A;  1E8W A;  2WQY B;  4LNO A;  4HPP A;  2BKF A;  1CK1 A;  4BAX A;  2GRI A;  1KTK A;  3PT2 B;  3IT6 B;  5LLI A;  1FRR A;  2CU3 A;  2JXT A;  1V5O A;  2LVO A;  2VH1 A;  2JT4 B;  1KOT A;  1MVK A;  3AEF B;  1V1O A;  3ZXR A;  1WMH A;  3ZLZ A;  3ZXV A;  2XN9 C;  2KDM A;  1KRH A;  4LNF A;  1T0Q C;  4GDL B;  1WXQ A;  3LDZ E;  3KWL A;  1BUI C;  4KSL C;  4YWG G;  2RDG A;  2WNM A;  1EM7 A;  4LNK A;  4RF1 A;  4D2K A;  3DHH C;  4EKU A;  4WH4 A;  2FUG 1;  3IBE A;  3MC8 A;  3U7D A;  1X1M A;  2EKI A;  4ZRP A;  2JRH A;  4M01 A;  3HUI A;  4N58 A;  4WWO A;  1D3Z A;  2DBY A;  3N32 A;  3PRE A;  4DDI D;  2MBE A;  5C23 A;  4ARI A;  1FCC C;  1P0R A;  1FIQ A;  2MRP A;  1WY8 A;  2NPT B;  3FC4 A;  3JYU A;  5TSS A;  2PJH A;  1CJE A;  1XCT L;  1N60 A;  2NMQ A;  1ZKH A;  4TMA B;  4FBJ B;  1V6E A;  1RWS A;  4PS3 A;  2KC1 A;  3E56 A;  2WXM A;  4EFO A;  1T5X D;  2IZV B;  4KKJ A;  3ENE A;  2JYE A;  2YVC A;  2LXA A;  2GB1 A;  1Q1O A;  4M8M A;  4GMV A;  5CHF A;  2AL3 A;  5T8I A;  3W1S C;  1D6E C;  1WX7 A;  3TEY A;  4YL8 A;  2WDV B;  1GB4 A;  3Q8F A;  4OW0 A;  2WXO A;  4MGK E;  1WGK A;  4C4V B;  4XWW A;  2M19 A;  2RSU A;  4FHK A;  2RDB C;  1LO5 D;  2BPS A;  1F52 A;  4A55 A;  3I5J C;  4E3C A;  1YIW A;  2N1W A;  4YXD B;  3KW5 B;  3DBL B;  1F77 A;  1XQQ A;  2XBB C;  1SBB B;  5D7G A;  3V3X A;  1SJE D;  4KIK B;  2JU6 X;  2VRR B;  4GDL A;  4HPL B;  5DPT A;  3NRZ A;  3SDL C;  4A3P A;  2KDI A;  1UUP A;  2M56 B;  2AQ2 B;  3EC8 A;  3SFD B;  1IGC A;  3T8M A;  3VTU A;  3BVM A;  2L0F A;  3AXC A;  4IDI A;  2FCM A;  4G3X B;  2KC2 A;  4HJK A;  4C7Z A;  3ZQ4 A;  3B0A A;  4MEL A;  5HHD G;  1HA5 A;  1YX5 B;  2PEA A;  1XLQ A;  3BK2 A;  2LUM A;  4TSS A;  4WJN A;  5LNK 1;  4BKS A;  3A9J A;  4HWI B;  2KXJ A;  4MH8 A;  3QK0 A;  1FM0 D;  2KAC A;  3L13 A;  1UWM A;  2JRI B;  1YJI A; 
#chains in the Genus database with same CATH homology
 2JF5 A;  2K6Q A;  4URK A;  3U8Z A;  3ZDT A;  3AI5 A;  1WYW B;  4TKN A;  1G6J A;  2G3Q B;  4LJP B;  1WZ3 A;  3L10 B;  1Q0W B;  3QQ8 B;  5E6N A;  2BF8 B;  4G50 A;  3EFU A;  1WXM A;  1Z2M A;  3RCZ A;  3VQI A;  5C1Z A;  3L16 A;  2L00 B;  5L95 C;  3SD5 A;  3ZW3 A;  2KKC A;  3DBL I;  3UF8 A;  4HDO A;  1VD2 A;  2XEW A;  1A5R A;  4W9F A;  4DK5 A;  4DHJ B;  1JRU A;  3L54 A;  2KMC A;  2K1F A;  3NS8 A;  3JSV A;  2IBI B;  2JWZ A;  4IM3 A;  2MP2 B;  2KWC A;  2IO3 B;  3VAW A;  3UQA A;  4RMA A;  3KYC D;  3TMP B;  5BO4 B;  3A9J B;  3KUC B;  1CMX B;  4KSK C;  5D2M B;  2O6V D;  3A1Q A;  5JHB A;  3VUW A;  4DBG A;  2LRW A;  4IW0 A;  3MHS D;  3PLV A;  5CTR C;  1WF9 A;  1XD3 B;  3KH0 A;  3PHW B;  1WZ0 A;  4PS7 A;  5L83 A;  1WR1 A;  2DYM A;  3RZF A;  1S1Q B;  4LJO B;  1U4A A;  4NY0 A;  4HVB A;  4JQW C;  5AZG A;  1P1A A;  3NOB A;  3SHQ A;  2G4S A;  2AWT A;  2KQS A;  4JGH B;  5DPR A;  1WX9 A;  2LGD A;  4W9G A;  4AOF A;  4X57 B;  1K8R B;  2ASQ A;  3QC8 B;  5J2R A;  2K8H A;  4NNJ B;  2MBH A;  3A4S C;  4GGQ A;  1RLF A;  3QAR A;  2C7M B;  1L7Y A;  2FID A;  3H7S A;  1TGZ B;  4W9L A;  2RD0 A;  4A3O A;  3ML8 A;  2C60 A;  4N9F 4;  3RT3 B;  2BYF A;  3P2B A;  5LXH A;  3HM6 X;  2D3G A;  4DXA B;  3JSV B;  2KX3 A;  2WDT B;  3PPA A;  4HK2 A;  1MG8 A;  3WAP A;  4DHZ B;  2D10 A;  2KLG A;  4DDG D;  1YD8 U;  3DVG Y;  3PGE A;  1ZGU B;  2WYQ A;  2CHZ A;  2IO1 B;  1WGY A;  2JZZ A;  4LDT B;  2LGX A;  2DEN B;  2FCQ A;  4BKT A;  2ZPY A;  2L76 A;  4EZK A;  4FJV B;  2JY6 A;  3WA0 A;  1NI2 A;  4K7U A;  4MM3 A;  2DZK A;  2L05 A;  2ZCC A;  4HXD A;  3V62 A;  5EDS A;  2KZR A;  2DHZ A;  2GBJ A;  4IC7 B;  4IG7 B;  3VUX A;  1GC7 A;  2KDE B;  2V4L A;  5KHO A;  3V6E B;  2CHW A;  2RGF A;  3KVF B;  2ZZP B;  3KUD B;  3H1U A;  1EO6 A;  1E5W A;  4AJY B;  2ZVN A;  2M17 A;  3DBR I;  4GXB A;  5JH5 C;  4OVV A;  3QWZ B;  1PQS A;  1V9J A;  3L17 A;  3ZIM A;  3H7P A;  2MBO A;  1R4M I;  3DVG X;  4CYE A;  1NBF C;  2PPH A;  4GN1 A;  4HPM B;  5AZF A;  2RPQ A;  5FR6 A;  1KM7 A;  3HM3 A;  1BT0 A;  4HCP B;  2Z0E B;  2C5L C;  4G0N B;  1UBQ A;  3DBS A;  3ZO5 B;  3KYD D;  2LJ5 A;  2YLM A;  1P98 A;  4WJO A;  2M8S A;  5E6O A;  4WAA A;  2BWF A;  4GSW A;  2FIF A;  2A5U A;  2HTH A;  4HCN B;  4I6N B;  3ZTC A;  3ZNZ B;  4JL9 A;  2REX A;  3TIX A;  4TV3 A;  3ZTD A;  3V6C B;  2C9W B;  1GG3 A;  3K9P B;  4NAW A;  4PS8 A;  1J0G A;  1V5T A;  2CR5 A;  2N4F A;  3ZRC A;  5G2N A;  2GBR A;  1TBE A;  2O6V B;  3T9L A;  2EMT A;  4NPN A;  1C3T A;  4ANX A;  4ZDV A;  2BKR B;  2KJ6 A;  4ZRK A;  3ZDM C;  1P9D U;  2FUH B;  4BKG A;  2BYE A;  2LVQ A;  3ZRF A;  1J19 A;  1LFD A;  5DPW A;  4GU2 A;  2EKE C;  3VUY A;  4F8C B;  2G45 B;  2MSE D;  3O65 B;  3S2A A;  4II2 B;  2W9N A;  3RZW C;  3PS6 A;  2FCN A;  1WGR A;  4KV2 A;  2KHW B;  3LJ3 A;  3UIN B;  4DHZ E;  2BYV E;  3QAQ A;  4M0W B;  3QJZ A;  4EZJ A;  2LAS A;  3H7P B;  1KJT A;  4LCD E;  3D32 A;  2QHO A;  2LRU A;  4BFR A;  4MGY E;  1I35 A;  3AUL A;  2O2V A;  1E7U A;  2MLB A;  2D11 A;  1Z5S B;  2HJ8 A;  3RUL A;  3UIO B;  1YX6 B;  4ANU A;  3H9D A;  2NR2 A;  4CO7 A;  3M62 B;  4K7W A;  2LUE A;  1UH6 A;  2N9P C;  3U30 A;  3JW0 X;  1WGH A;  4IWO A;  4XX5 A;  2NBW B;  2UWQ A;  1VCB A;  5D94 A;  4HDQ A;  5G55 A;  3ML9 A;  4FJY A;  2L7R A;  4ASW C;  3ALB A;  2I1J A;  2LWP A;  2DZI A;  3ONS A;  5DPS A;  3Q3F A;  4NAW B;  2ZNV C;  2GMI C;  2LVP A;  4KZC A;  1V86 A;  3CMM B;  2NBV B;  5LXI B;  4IWQ A;  4NJ7 A;  2MWS B;  2KX0 A;  2DYO A;  5GMV A;  5CHW A;  1WRD B;  2JPH A;  3AU4 A;  3UIP B;  2ZVO A;  4JLC A;  2Z0D B;  4ICV A;  3PRZ A;  3TBL D;  2K6D B;  2WWZ A;  2CHX A;  2L0T A;  4MEM A;  1IYF A;  1WI0 A;  3V61 A;  2K25 A;  3MJW A;  4TQ0 A;  1WR6 E;  3PV1 A;  4W9E A;  2MA9 B;  3H6N A;  2A4Z A;  4XZ4 A;  3VFK A;  1WE6 A;  1WMH B;  1YQB A;  4GOC A;  2K8B A;  3VHT C;  4WQO B;  4ZYN A;  3DBH I;  2O2V B;  4W9J A;  2KLC A;  4FLH A;  3DVN U;  3N30 A;  3VDZ A;  1OEY A;  3ZNI D;  1H4R A;  1GJZ A;  5JHA A;  3DDC B;  3VTV A;  2JXX A;  2KFK A;  2Z59 B;  3PTF C;  3NHE B;  3ZNH B;  4EUT A;  2O6V A;  1V80 A;  2J0M A;  3VXW A;  4WJP A;  2HE7 A;  2N7D A;  2L3Z A;  3A4R A;  2MBB B;  3OAW A;  2KJR A;  4MDK E;  1I42 A;  3PZD A;  1E7V A;  3CST A;  4K7S A;  2KDF B;  2IY1 B;  2KQ7 A;  2KD0 A;  2OJR A;  4M8N A;  2V1Y A;  4MGZ E;  2CS4 A;  4DHJ D;  2I1K A;  4FAD A;  4MJS A;  1WE7 A;  2M1M A;  2NVU I;  1L2N A;  2C7H A;  4JIO U;  5IA7 A;  2KWV B;  2KMA A;  2DYB A;  2IO2 B;  3MTN B;  2IYD B;  1E8X A;  3M3J A;  4BBN C;  2IY0 B;  4BKS D;  4E71 A;  3BIN A;  1WGG A;  4FUL A;  2KK8 A;  1WXV A;  2R2Q A;  4NJ6 A;  4EZL A;  1EUV B;  3HIZ A;  1UBI A;  1LM8 B;  1WJN A;  1WH3 A;  1ZW7 A;  2EMS A;  3OLM D;  4OVU A;  3SU8 X;  2N9X A;  3I3T B;  2N7E A;  2J7Q B;  3HK0 A;  2CKH B;  2R2O A;  1FXT B;  3GOE A;  2KO3 A;  4FJZ A;  4WWP A;  5JZE B;  1UEL A;  1RFA A;  3RYT A;  1OGW A;  2M4N A;  4F7Z A;  4BBN F;  4BOZ B;  2KTR A;  2MBQ A;  4IUM B;  4MGI E;  2KFJ A;  4P7I A;  1WIA A;  4B95 A;  4BVU C;  4NQL B;  4IWP A;  2ZPN A;  4F1S A;  2KFK B;  2PE6 B;  2LD9 A;  3JVZ X;  4NQK E;  4FHJ A;  1E8W A;  1WFY A;  2Y5B B;  3HHM A;  3ZNG C;  2BKF A;  4RM8 A;  4PYZ A;  1V49 A;  2BGF A;  2J0J A;  3A9K A;  1H8C A;  3DQV A;  3PT2 B;  5LLI A;  4G11 A;  2XK5 A;  2MQJ A;  3RD2 A;  3C0R B;  3PHX B;  3CSF A;  4MH0 E;  5J18 A;  3EEC A;  3X23 A;  1V5O A;  4MJS B;  1WJ4 A;  1IPG A;  2FCS A;  2GOW A;  2LVO A;  2JT4 B;  1KOT A;  1IP9 A;  2NPT A;  2KJH B;  2ZEQ A;  4ANV A;  3R66 C;  4TQ1 A;  4A20 A;  3RUI B;  5E6P A;  4LDT D;  4AWJ A;  2KWU B;  4TUU A;  5D6J B;  1WMH A;  2LXC A;  3ZLZ A;  4AP4 C;  4W9K A;  3WIM A;  4GIV A;  1V81 A;  1R4N I;  2ZNV B;  1UGM A;  1OQY A;  1WX8 A;  4GDL B;  4DWF A;  3X0W A;  3LDZ E;  1WJU A;  4KSL C;  2UYZ B;  4J6I A;  3ZKJ C;  1E90 A;  2KOX A;  4IM2 A;  4EKU A;  3APC A;  3IBE A;  2B3A A;  3U7D A;  2V3S A;  1YJ1 A;  2KTR B;  2WX0 A;  1X1M A;  1SIF A;  4ZRJ A;  2JRH A;  3L0W B;  2WX1 A;  2OOB B;  4K1R B;  4WWO A;  1D3Z A;  1WGD A;  4RM9 A;  1HE8 A;  3QIJ A;  4E74 A;  3APD A;  4EEW A;  3DVN V;  3IFW B;  3A9K B;  2MX2 A;  3L08 A;  1QZE A;  3N32 A;  3R7R A;  3NZS A;  2XK5 B;  1WM2 A;  3K9O B;  3PRE A;  1M94 A;  2D2Q A;  3CF6 E;  5TR5 A;  3WAM A;  4GDK A;  4DDI D;  1GNU A;  2MBE A;  2DZM A;  4ZRI A;  2N9E B;  3AU5 A;  5C23 A;  4AUQ C;  2BWE S;  5J17 A;  2LGY A;  1P0R A;  3DPD A;  2KAN A;  2IO0 B;  3PRP B;  1GUA B;  1WY8 A;  2MRP A;  2NPT B;  4MSQ B;  4W9C A;  1WXS A;  4CHK A;  5CHV C;  1NDD A;  3JYU A;  3TL5 A;  3UQB A;  3DOW A;  1LXD A;  4KIK A;  2PJH A;  4B9K A;  1KLV A;  4ANW A;  4KDI C;  2DX5 B;  1ZKH A;  2FAZ A;  2KN5 A;  3WAN A;  4FBJ B;  3QA8 A;  3QX1 A;  1V6E A;  4PS3 A;  2KC1 A;  2K39 A;  4I6P A;  3NZU A;  4EFO A;  2IZV B;  3ENE A;  3WAL A;  2MW5 A;  2YVC A;  2LXA A;  4K81 A;  2AL6 A;  3PSE B;  5AEK B;  3M95 A;  2KTF A;  1Q1O A;  1WXA A;  4M8M A;  4GMV A;  5CHF A;  1E8Z A;  2DAJ A;  2JUO A;  2DZJ A;  4EOY A;  4W9I A;  4I6L B;  3IHP C;  2AL3 A;  3IG3 A;  4WJQ A;  4AJW A;  4KVG B;  2KDB A;  3W1S C;  5IAA C;  2C7N B;  1WX7 A;  3VVW B;  1TTN A;  1E8Y A;  1WJ6 A;  4YL8 A;  5DCN A;  1RAX A;  3QHT A;  1GC6 A;  3TCA A;  4MGK E;  1UD7 A;  4IM0 A;  2NBU A;  2RR9 A;  1UZX B;  3EHV A;  2LI5 A;  2RSU A;  4FHK A;  2BPS A;  4KZ0 A;  2DAF A;  2GBN A;  4GDK B;  2NCN A;  1SGH A;  3PLU A;  3PVL A;  2GBM A;  3B1L X;  4E3C A;  1Q5W B;  1YIW A;  2MCN B;  2KVR A;  1EF1 A;  2N1W A;  3UGB B;  4B6W A;  4W9D A;  3KW5 B;  1J8C A;  1XT9 B;  1XQQ A;  2KNB A;  2XBB C;  4ICU A;  5D7G A;  1Y8R C;  4KIK B;  2VRR B;  3A1Q B;  4GDL A;  4HPL B;  5DPT A;  3SDL C;  4A3P A;  4II3 B;  2D07 B;  2AYO B;  2K8C A;  2J0K A;  3A33 B;  2KDI A;  3ZVV A;  3EC8 A;  4WWN A;  3VH4 B;  3BY4 B;  4FA6 A;  3NY5 A;  3GZN I;  3DCG A;  3T8M A;  3VTW A;  3PRM B;  3VTU A;  2L8J A;  2L0F A;  5HKH A;  1C1Y B;  2JVC A;  3B08 A;  3IVF A;  1LQB A;  3AXC A;  2ZCB A;  1OTR B;  2FCM A;  2HD5 B;  5AZH A;  4G3X B;  2KC2 A;  4HJK A;  4GB9 A;  3TJP A;  2LZ6 A;  1EF5 A;  3R7Q A;  3B0A A;  4MEL A;  1YX5 B;  1T0Y A;  3OJ3 A;  1V2Y A;  2ZJD A;  2PEA A;  1OEY J;  2MP2 A;  3KUZ A;  1ISN A;  1AAR A;  4WJN A;  1P3Q U;  3OJ4 B;  3QCA A;  2JZ3 B;  3VH3 B;  4FN2 A;  4BKS A;  1S3S G;  5CX3 A;  3A9J A;  2PE9 A;  3APF A;  3Q3J A;  2FNJ B;  4HWI B;  2G4D B;  4W9H A;  2KXJ A;  1F9J A;  2NS5 A;  2M0X A;  2CU1 A;  3R3M A;  3W1S A;  2N1V A;  3V60 A;  1WM3 A;  3ECI A;  3WAO A;  4MSM B;  3W1Y A;  3QK0 A;  4XC2 A;  3M63 B;  4PYU A;  1SE9 A;  3L13 A;  3ZUN A;  4HLE A;  2AEH A;  3N3K B;  4KDL B;  4BOS C;  2JRI B;  2GBK A;  5KHQ A;  1RRB A;  1TZ1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...