3RD2A

Nip45 sumo-like domain 2
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
82
structure length
82
Chain Sequence
MHHHHHHSQQLQLRVQGKEKHQTLEVSLSRDSPLKTLMSHYEEAMGLSGRKLSFFFDGTKLSGRELPADLGMESGDLIEVWG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title DNA repair and global sumoylation are regulated by distinct Ubc9 noncovalent complexes.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription
molecule keywords NFATC2-interacting protein
total genus 16
structure length 82
sequence length 82
ec nomenclature
pdb deposition date 2011-03-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF11976 Rad60-SLD Ubiquitin-2 like Rad60 SUMO-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 3rd2A00
2MRPA 3V6CB 2MX2A 3Q3JA 2EMTA 2IO3B 4LDTD 1WXMA 4IWQA 4FJYA 4E71A 5JH5C 5D6JB 1AARA 2N7EA 3CSTA 1GNUA 1S3SG 3L08A 1P98A 3QIJA 2IY0B 1E90A 2NBVB 2FIDA 4WJOA 4FLHA 3ONSA 1PQSA 3AULA 3UF8A 1KJTA 2MLBA 5CX3A 2MP2B 1CMXB 1WYWB 4MSQB 2C7HA 2Z0DB 2KVRA 4XZ4A 5GMVA 3WA0A 3IVFA 1H8CA 4MEMA 4RM8A 4NPNA 3VXWA 2LVOA 4BOSC 2FCQA 1RFAA 2RD0A 4GDLA 5IA7A 5IAAC 4NAWA 2LUEA 4WWPA 3VAWA 3VTVA 1GG3A 2IBIB 2D11A 2O2VA 2LWPA 2L00B 2K39A 3EECA 3PTFC 5CHFA 4DK5A 4GDKB 2KD0A 1I35A 4HPMB 2IZVB 1P9DU 3QK0A 2M8SA 1UH6A 2KOXA 1E8XA 4DHZB 3ECIA 4HXDA 2ASQA 4KVGB 4TQ0A 2N9PC 2J0MA 4ZDVA 5LXIB 2MSED 3PSEB 2KZRA 5AZGA 1FXTB 3PPAA 2FCNA 2UWQA 2ZVOA 3VUWA 2LXCA 2J0JA 2QHOA 4GIVA 3EHVA 1WH3A 2G4SA 2KWCA 3IBEA 4AWJA 2L0TA 2KXJA 1WGRA 4KSLC 4KV2A 1D3ZA 3DBHI 3SU8X 2KDBA 4ICUA 3PRZA 2A5UA 4B95A 2GBRA 1WZ0A 2XBBC 3VDZA 3WAMA 1YJ1A 2DAJA 3PLUA 2K8BA 5DPSA 2J0KA 4HPLB 1V2YA 2C7MB 4ANUA 2LGYA 2KTRB 2LGXA 4IWPA 2BKFA 2PE9A 3VUXA 3H7SA 4GGQA 3ZRFA 1WJ4A 4M0WB 2JRHA 5CHVC 4ZYNA 4PS8A 4IG7B 3RYTA 3B0AA 3R7QA 3TIXA 3UIOB 5E6OA 2CU1A 4GXBA 1R4NI 2Y5BB 2GBKA 4ASWC 3APFA 1XD3B 2AWTA 3RT3B 1WGDA 3EFUA 2KMAA 4ICVA 3LJ3A 1YX6B 1J19A 3CMMB 1V80A 3HK0A 1NI2A 5EDSA 2UYZB 2AYOB 4K1RB 2KKCA 1WY8A 1WJNA 5CTRC 3H1UA 1WX8A 4GSWA 4W9KA 5G55A 2V1YA 3ZNZB 5HKHA 2ZZPB 3SDLC 2DHZA 2IY1B 2ZJDA 3CSFA 3K9PB 3PRMB 4G11A 4WJPA 4PYZA 1HE8A 2ZNVB 3PHWB 2BPSA 1LM8B 2MP2A 2BYEA 5C1ZA 4PYUA 3AXCA 3QAQA 3TBLD 3M95A 3ZIMA 3RZFA 3DOWA 4GDLB 4OVUA 1TGZB 3U7DA 2MBBB 1WR1A 4EFOA 2LZ6A 3OJ4B 1GJZA 4W9EA 3IFWB 4DDGD 2NVUI 2WWZA 1WRDB 5AEKB 4ZRJA 1EF1A 3JVZX 3R3MA 4URKA 3KUCB 4GN1A 4NY0A 4TKNA 2KC2A 4MGKE 2LGDA 2ZVNA 4F1SA 1RLFA 2N1WA 2FAZA 2N1VA 3PREA 5DPTA 3DBSA 4AOFA 2GBNA 1EF5A 3AU4A 3LDZE 1E5WA 3NZUA 3QA8A 2IO0B 4W9LA 3AI5A 2I1KA 3ZRCA 4MELA 4GB9A 1RAXA 2KN5A 1KOTA 3A9JA 2L7RA 1SGHA 3GZNI 2CHWA 4PS7A 3JW0X 3JYUA 1WMHA 3PHXB 1Q1OA 4GU2A 3UINB 1WM2A 4HWIB 3A1QB 1Z2MA 1NBFC 3BY4B 4EZJA 4DHZE 1WI0A 3MTNB 3H7PA 4WWNA 1LXDA 2AL3A 2LJ5A 3VTWA 3H7PB 5KHQA 2DAFA 2O2VB 1IYFA 4EZLA 2N7DA 4A3PA 2CKHB 3O65B 4ANXA 2NPTA 2MA9B 2FCMA 3EC8A 4I6PA 2KK8A 3PZDA 4NJ6A 2PE6B 4BKTA 2KX0A 3A9JB 1V5TA 4GDKA 2KDFB 4W9IA 2WDTB 3ZNHB 5L83A 2JT4B 2LXAA 1GC7A 3ZO5B 5AZHA 1VD2A 3I3TB 3KYCD 2MW5A 4KDIC 4WJQA 3RCZA 1WF9A 1J0GA 2KDIA 4G3XB 1OEYJ 4NAWB 2PEAA 1WXAA 2OOBB 3KUDB 4IUMB 1UBQA 2C60A 2DX5B 2YLMA 4JIOU 1WZ3A 1ZGUB 2RPQA 3DVGX 3VFKA 3QHTA 3M62B 5LXHA 4MJSB 3PRPB 2NR2A 2G4DB 2KMCA 3DBRI 4HCNB 3VUYA 1A5RA 1T0YA 3WAOA 2D2QA 1BT0A 2WX1A 3L13A 3ML9A 2PJHA 3L16A 4XX5A 5E6NA 3U30A 3QX1A 4II3B 1YX5B 3M3JA 2GMIC 3V6EB 4FHJA 2ZCCA 4NQLB 2NS5A 3DVNU 2D3GA 4DXAB 2L0FA 2XK5A 3TMPB 4RM9A 2V3SA 2G45B 2LRWA 2VRRB 4JGHB 4X57B 1Q0WB 4F7ZA 4FN2A 2BYVE 2LD9A 2I1JA 4KDLB 1WGHA 1MG8A 4ANWA 4W9FA 4EEWA 3APCA 3D32A 2KNBA 4IWOA 2KFKA 4IW0A 3MJWA 2PPHA 4GMVA 4AJYB 2L8JA 3DQVA 1WR6E 3HM6X 2KWUB 4KZ0A 2JPHA 4BBNC 1R4MI 4EZKA 5J17A 1YD8U 2JWZA 3P2BA 1WFYA 3PT2B 5FR6A 2BGFA 2RGFA 4HDOA 1WE7A 1TBEA 2KDEB 2KJHB 2J7QB 3HHMA 1U4AA 2KO3A 3JSVB 2Z0EB 1V49A 1WJUA 4FJVB 5DPWA 2M17A 1XQQA 1JRUA 2N4FA 2JZ3B 4BFRA 4HLEA 1WMHB 3X23A 2IYDB 4JQWC 2R2QA 4JLCA 1V5OA 2BKRB 1IP9A 2HE7A 3VTUA 1WM3A 2MWSB 4B9KA 3H6NA 2BWFA 3N32A 2KX3A 4FA6A 4DWFA 2A4ZA 3OLMD 3ZVVA 2WX0A 3JSVA 2FUHB 4K7SA 2ZPYA 3R7RA 4BKSA 4K7UA 3QQ8B 2JF5A 4M8NA 2ZNVC 1NDDA 3QARA 1P0RA 2NBUA 2KWVB 4K7WA 3A4SC 2K6DB 4WQOB 4KIKA 2MCNB 4W9DA 4BKSD 4IM0A 2N9EB 5KHOA 3ZUNA 4ZRIA 4MM3A 2DENB 2GBJA 2K1FA 2XEWA 3DDCB 4G50A 4LJPB 4WWOA 2Z59B 2LASA 1E8WA 4MJSA 4G0NB 4F8CB 2KJ6A 2K8HA 3ZTCA 2HTHA 1WIAA 3PVLA 1C3TA 4HVBA 3ZNID 1UBIA 1XT9B 2K6QA 3TJPA 5D94A 1OQYA 1UD7A 1WX7A 2BWES 2DYOA 2HD5B 2K25A 3ENEA 3T8MA 2MBEA 1K8RB 4M8MA 4DBGA 2DZJA 2O6VD 1VCBA 5G2NA 1J8CA 1WJ6A 2JXXA 4FULA 3AU5A 3VHTC 3HM3A 4TQ1A 3ZNGC 4W9GA 1EO6A 1Y8RC 2DZMA 4KIKB 3ZW3A 4W9HA 1F9JA 2EKEC 2JVCA 3Q3FA 4I6LB 4FHKA 3TL5A 4EUTA 4FBJB 1H4RA 3QJZA 1RRBA 3KVFB 3KW5B 3QC8B 3WAPA 5C23A 4EKUA 4W9JA 3PS6A 2BYFA 5AZFA 4NJ7A 2MQJA 3IG3A 2O6VA 3ZLZA 3T9LA 4WAAA 3SD5A 3NZSA 2OJRA 3KYDD 3W1SA 4HDQA 3H9DA 3A9KA 2EMSA 1UGMA 4DHJD 4KZCA 2D10A 4AP4C 4AJWA 1TZ1A 2ZEQA 4BKGA 3UGBB 1C1YB 5J18A 3ZDTA 1TTNA 3NY5A 5DCNA 3RULA 3WIMA 4B6WA 5L95C 1LFDA 4YL8A 1P3QU 3L10B 3PGEA 2W9NA 3NS8A 2DZKA 5D7GA 4OVVA 4A20A 2KTFA 1Z5SB 1G6JA 3VVWB 1WX9A 1LQBA 1V9JA 3U8ZA 1YIWA 5LLIA 2FNJB 2YVCA 4WJNA 3W1YA 4BOZB 1L2NA 2WYQA 4MSMB 5D2MB 4DDID 2NBWB 4LJOB 3WANA 2LRUA 4E74A 3QCAA 3L0WB 3RD2A 4ANVA 2ZCBA 4HJKA 2KANA 1M94A 2KLGA 2RSUA 3K9OB 4RMAA 2M4NA 3UIPB 2LVQA 4W9CA 5JHAA 3A33B 2MBHA 4GOCA 1WGYA 3BINA 4DHJB 1ZW7A 3A1QA 1V86A 2B3AA 2DYMA 3B08A 2G3QB 4NNJB 2M1MA 2MBQA 3TCAA 4P7IA 2MBOA 3VH3B 1I42A 2AL6A 1E7UA 1P1AA 3N30A 2N9XA 2KFKB 3ML8A 2RR9A 1WXSA 2R2OA 2XK5B 4CYEA 1E8ZA 1QZEA 3S2AA 3X0WA 2GBMA 2L3ZA 2NCNA 2C9WB 2IO1B 3MHSD 1OEYA 3N3KB 4MGIE 4LCDE 3UQAA 3W1SC 2JY6A 4N9F4 1ISNA 2C7NB 2KQSA 3B1LX 4ZRKA 3ZTDA 4FJZA 4MDKE 4A3OA 1UELA 5DPRA 2LI5A 3V60A 3GOEA 4XC2A 1WGGA 1S1QB 3KH0A 2K8CA 2NPTB 3CF6E 3M63B 4BVUC 1ZKHA 2GOWA 3ALBA 4FADA 3PV1A 2IO2B 3C0RB 5CHWA 2KHWB 1V6EA 3VQIA 4IM3A 1SIFA 1UZXB 3OJ3A 5J2RA 3SHQA 4TUUA 3DVGY 3DVNV 4CO7A 3WALA 1KLVA 2REXA 3ZKJC 1L7YA 3R66C 5E6PA 3OAWA 4PS3A 2JRIB 1SE9A 1EUVB 4CHKA 2FIFA 3DPDA 3V61A 1X1MA 2LVPA 4KSKC 2JZZA 4MH0E 3APDA 2KJRA 4MGYE 4NQKE 4BBNF 2L76A 2V4LA 2ZPNA 2CHZA 2HJ8A 2CR5A 2CS4A 2KLCA 3NHEB 4LDTB 3QWZB 2CHXA 4HK2A 3RZWC 2DYBA 3UQBA 3A9KB 1IPGA 4IM2A 1GC6A 2D07B 4II2B 4AUQC 5JZEB 3A4RA 1KM7A 3DBLI 4JL9A 1OTRB 2FCSA 4E3CA 2O6VB 5JHBA 3DCGA 2KFJA 2KQ7A 4J6IA 4TV3A 3V62A 1GUAB 4I6NB 2KTRA 1Q5WB 2DZIA 4MGZE 3KUZA 3L17A 2L05A 4HCPB 4K81A 5BO4B 2M0XA 3IHPC 2AEHA 1E8YA 3HIZA 3RUIB 2BF8B 1V81A 3PLVA 4IC7B 5TR5A 1WE6A 3ZDMC 3L54A 2JUOA 1OGWA 2KC1A 4EOYA 1E7VA 1YQBA 1WXVA 3VH4B 2C5LC 3NOBA
chains in the Genus database with same CATH superfamily
2MRPA 3V6CB 2MX2A 3Q3JA 4E71A 5HHDG 4FJYA 1V1OA 3CSTA 1JROA 1MFWA 3BK1A 3UF8A 1KJTA 1K50A 1XLQA 1CMXB 4XZ4A 3WA0A 4BOSC 4NPNA 4DQOC 2FCQA 2L83A 3B2GA 3E9SA 5IO9A 1KRHA 2L00B 2K39A 5CHFA 2EELA 1C4CA 2FBWB 1D5ZC 1P9DU 1EWYC 1UH6A 1E8XA 4HXDA 2ASQA 4P6VF 4US9A 3PSEB 1FXTB 3PPAA 2ZVOA 1WH3A 1NENB 2KWCA 1SJED 2KXJA 3DBHI 3EFCA 4ICUA 2A5UA 2GBRA 2UU7A 2W3SA 3WAMA 3PLUA 1V2YA 2WXLA 1XLNA 4LNIA 4HKZE 3TUOA 3Q8BA 3ZRFA 5CHVC 4ZYNA 2K22A 2OJWA 2PIAA 4PS8A 4IG7B 3P63A 4IDIA 2GBKA 3APFA 4ICVA 3EFUA 4A6QA 3LJ3A 3HK0A 5D3IB 4YSXB 2AYOB 2KKCA 1WJNA 2N0SB 1UWMA 4GSWA 4W9KA 5G55A 2DHZA 4PYZA 1HE8A 2ZNVB 1LM8B 4N58A 3RNEC 3AXCA 3T3NA 1JCKB 3TBLD 3Q3OC 3RZFA 2Y5PA 2BYTA 1DYQA 4W9EA 3IFWB 4DDGD 2NVUI 3RMKC 4ZRJA 3JVZX 3R3MA 1R7SA 4TKNA 1IGCA 1RLFA 2BVCA 3AECB 2FAZA 5DPTA 3DBSA 4AOFA 1YMHE 1D5MC 1EF5A 3ZGZA 3DHHC 3HVDA 2KN5A 3NG0A 2L7RA 3GZNI 1QOAA 1Q1OA 2WXMA 4PT5A 3A1QB 1Z2MA 4EZJA 3AE6B 4O1NA 3MTNB 4WWNA 2AL3A 1C4PA 2IGDA 1GB4A 5EE0A 1FNUA 2CKHB 4AQ7A 4A90A 2BW2A 4BKTA 2JZPA 1V5TA 1JW9D 4GDKA 1V8CA 2WDTB 4M01A 4W9IA 3ZO5B 1SF0A 1VD2A 4LNNA 3ZJVA 1ZUD2 4G3XB 1TS2A 2KVZA 2OOBB 3KUDB 1D5XC 4JIOU 1F1HA 2YLMA 3VFKA 3QHTA 3M62B 1TY0A 4MJSB 1VZ6A 2NR2A 3P1MA 4K3CA 3W5VB 3KQ4A 3DBRI 2WQYB 4YTPB 1T0YA 1J7AA 1N5WA 3WAOA 1FD6A 3QX1A 4II3B 1YX5B 3V3XA 3V6EB 1JWBD 4NQLB 1E6EB 4DXAB 2L0FA 2XK5A 5AUKA 2LRWA 4OZBA 1WGHA 1MG8A 4W9FA 3AH7A 3D32A 3AE1B 3VR9B 2PPHA 4ITKA 3DQVA 2WXPA 4BBNC 1SE4A 2KWUB 2JPHA 1R4MI 2D5GA 4C00A 1YD8U 2WXKA 2JWZA 1RFKA 2EKIA 3P2BA 2RGFA 2KJHB 2J7QB 2KDEB 3HHMA 4ZHOA 2MJEA 5BYQA 4B0MA 1V49A 1WJUA 2RDBC 4JWSC 1JRUA 1C78A 2N4FA 2VH1A 1TS4A 2J4XA 4A9AA 1V5OA 2N7JA 3Q69A 1WM3A 1WXQA 4N59A 4XYCA 2FUHB 3R7RA 4K7UA 1EM7A 4RGNA 2JF5A 3PO0A 2WS3B 1NI3A 3A4SC 1DOYA 4W9DA 4IM0A 2N9EB 1I4RA 4ZRPA 1E8WA 4YSZB 4G0NB 4HJGE 3ZTCA 2HTHA 1C3TA 3Q6BA 1UBIA 2XN9C 4BZAA 1OQYA 1WX7A 2Z8LA 3T8MA 1FRRA 1C76A 2DZJA 1L4DB 3NZ3A 3AEGB 1J8CA 1WJ6A 2BBCA 3ZNGC 4W9GA 2DZMA 2KN4A 1F9JA 3TL5A 3B2FA 4FHKA 1LO5D 2PKOA 3QJZA 3QC8B 3KW5B 4W9JA 2WXHA 5AZFA 5GXGB 3ZLZA 3T9LA 5H8YE 2WXGA 3SD5A 2X8XX 3W1SA 4MH8A 3GZNB 2ZEQA 1TTNA 5DCNA 3WIMA 2PMVA 2IGGA 1LFDA 2DZKA 5D7GA 3VRBB 1G6JA 1V9JA 1PGXA 2WYQA 2NBWB 3QCAA 1M94A 2KLGA 4RMAA 2MBHA 4GOCA 1WGYA 1AWDA 4YSYB 1ZW7A 1SE2A 3U2SC 4NNJB 2AL6A 2KFKB 2XK5B 3AEFB 1E8ZA 1Q10A 5T8IA 1TKEA 4USAA 2KQSA 3B1LX 3CIRB 4RGMA 4YT0B 3Q8FA 4FJZA 4MDKE 2LI5A 2N9LA 1JMLA 1WGGA 2PLPA 4B0EA 3M63B 2QDFA 1C9FA 2GOWA 2KHWB 1SIFA 3OJ3A 3DVGY 3DVNV 3ZKJC 3R66C 4PS3A 2JRIB 2JYTA 3GE8C 4KSKC 2JZZA 1Y56A 4MH0E 5HFYA 2HJ8A 4LDTB 3QWZB 1SSNA 2DYBA 1DOXA 3GS2A 3TEZA 4AUQC 3RNFC 1FNWA 2KQ4X 1FIQA 4JL9A 1BXTA 5JHBA 4J6IA 3HRDD 4I6NB 1Q5WB 3IHPC 3HIZA 2LGSA 2BF8B 4LK0M 3AMZA 1ENFA 3AEBB 2K9XA 1FM0D 2EMTA 5JH5C 4IWQA 2RDGA 3ETRA 1AARA 2N7EA 1GNUA 1S3SG 3L08A 2NBVB 2WDVB 3AULA 5AUIA 2CJNA 5CX3A 2MP2B 1WYWB 4MSQB 2C7HA 2Z0DB 1H8CA 4RM8A 3IAS1 5IAAC 4NAWA 5I4DA 2QSDA 4WWPA 1GG3A 2IBIB 2B76B 2O2VA 1L0YB 2WDQB 3PTFC 4DK5A 3LB8C 1WSPA 3LYYA 4HPMB 3QK0A 3IXSA 3RNGC 4DHZB 1TZOA 2J0MA 3P4QB 3RPFC 4L2YA 4OZCA 4ARIA 1OQQA 5AZGA 2KZRA 2WXQA 2DBYA 2FCNA 2UWQA 1JWUD 2QHOA 2J0JA 3DBLB 3KWVA 3OG5A 4GIVA 2CU3A 2LUMA 1WGRA 1D3ZA 1JQ4A 2HJ1A 1YOVB 3ABVB 1YN3A 1VR9A 5EE9A 2KAJA 4RH6A 2WXOA 3H7SA 3BVMA 1ET6A 4R3DA 3R7QA 3TIXA 5E6OA 2CU1A 2Y5BB 1IBXB 3I9V1 1F52A 2AWTA 3RT3B 4C7ZA 4CQNA 1J19A 3CMMB 5EDSA 2UYZB 1VZ8A 4K1RB 3H1UA 1WX8A 4BAXA 3ZNZB 2ZZPB 3CSFA 4WJPA 2L32A 3N20C 5FK9C 2HDEA 4PYUA 2QJLA 3BYYB 4OVZA 5HG2A 3R2TA 1T6BX 3VRAB 3ZIMA 2NMQA 4OVUA 3U7DA 1KLUD 2LZ6A 3DHGC 4XWTA 4XE0A 1EF1A 3KUCB 4NY0A 1F77A 3N9YC 1LGRA 2LGDA 2ZW0A 2N1VA 2GBNA 5C2TB 4W9LA 3AI5A 2I1KA 3GE3C 5G5GA 4KGSA 1FCLA 1RAXA 1KOTA 1BUIC 2BS3B 2CHWA 3RI7C 4PS7A 1WMHA 4C56C 4GU2A 4HWIB 1NBFC 2PTLA 1YQ4B 1WI0A 3H7PB 3EA6A 4YTNB 4A3PA 1ET9A 3O65B 4ANXA 2MA9B 4I6PA 2MHJA 4NJ6A 1E10A 2LXAA 3RCZA 4KDIC 2MW5A 1WF9A 1J0GA 2K0PA 2KDIA 1F2RI 1UUPA 4NAWB 1KLGD 2DX5B 2RPQA 3U4EG 3Q8AA 1ZE3D 5IN7A 1XCQL 4ZHPA 2DLBA 1WGKA 1C79A 5BYSA 3I57A 1BT0A 3L13A 5E6NA 2PJHA 3L16A 3N1YC 3M3JA 2GMIC 1ZP0B 2AQ2B 2D3GA 4Q2JA 3NVZA 3TEYA 3HUIA 4J3OD 4F7ZA 1ZPSA 2LD9A 1DGJA 2I1JA 2TSSA 4KDLB 2LMCA 4ANWA 5FR3A 1C4AA 3H8HA 4IWOA 2KFKA 3MJWA 3PZ7A 2L8JA 3HM6X 1WR6E 1N62A 4KZ0A 1HZ6A 3RNBC 1PYWD 2KO3A 2G1EA 3JSVB 4FJVB 5DPWA 1XQQA 4N6EB 4HLEA 4HPPA 1WMHB 1IP9A 2IYDB 2R2QA 1M4VA 4C7YA 2MWSB 3H6NA 3MP9A 3N32A 3U52E 3ZVVA 1NEKB 1VJKA 2ZNVC 1P0RA 2NBUA 2KWVB 2K6DB 4BKSD 4ZRIA 1VZ7A 1I4HA 2ZW1A 4MM3A 4G50A 4LJPB 2GBJA 2K1FA 1P7FA 2KJ6A 1WIAA 3PVLA 2D3CA 1XT9B 2K6QA 2BWES 2DYOA 1V1PA 2K25A 2QIEB 1K8RB 4DBGA 1VCBA 2JXXA 3AU5A 3ZW3A 1KH0A 4W9HA 2EKEC 2JVCA 1HTOA 1H4RA 4EE2A 2BYFA 1C77A 2MQJA 2O6VA 4WAAA 2ICIA 3NUHB 3KYDD 1GPXA 3H9DA 1UGMA 1N61A 4DHJD 4KZCA 4AP4C 4AJWA 4BKGA 2KACA 5J18A 3ZDTA 2JSVX 1N5XA 5L95C 1I4GA 3AEEB 3SEBA 2W9NA 2X38A 2WHIA 4OVVA 2KTFA 5JXVA 3MJ5A 3ZXVA 1I4PA 4WJNA 4WURA 3WANA 1MPEA 3RD2A 3L0WB 1PFDA 3Q3NC 4ANVA 2KANA 3K9OB 2M4NA 3E56A 3EGRA 3SR6A 3BINA 4DHJB 3FILB 2B3AA 2DYMA 2G3QB 1T0QC 3TCAA 4P7IA 1ROEA 1I42A 2RR9A 1WXSA 3X0WA 3AEAB 2L3ZA 2C9WB 2IO1B 2FE8A 1OEYA 2M0AA 1PDXA 4JPSA 4RNAA 2K3UA 1ISNA 1NVID 4WWMA 3MHZA 4P1BC 2INDC 2WGSA 5DPRA 4H2AA 1KFYB 3V60A 4XC2A 2M19A 3W5UB 3CF6E 3ALBA 2KMMA 1VDVA 1VLBA 2WXRA 1V6EA 4IM3A 4TUUA 3WALA 1KLVA 1MHXA 3P42A 3OAWA 2Y5CA 3DPDA 4D2KA 4MACA 4BBNF 1YNTE 4NJCA 3Q8CA 2KLCA 3NHEB 1SBBB 4OZAA 3DWGC 1FMAD 4C4VB 3UQBA 3A9KB 3DWMA 1SXTA 1KM7A 3DBLI 2FCSA 3Q2AC 4TV3A 1GUAB 2ON8A 1UGJA 2JWUA 2QILA 1T3QA 2DZIA 3WCQA 4K81A 1QQRA 1ACCA 4IC7B 1WE6A 3U7ZA 3GB1A 3ZDMC 2JUOA 4RGTA 1N6ZA 1OGWA 4EOYA 1E7VA 3VH4B 2R61A 3NOBA 4ZOHC 4ZYSA 3W9CB 1I4XA 5D6JB 3QIJA 2IY0B 3MFGA 1B1ZA 4WJOA 3GP7A 4FLHA 1PQSA 1XCTL 2KVRA 3IVFA 4MEMA 4P1CC 3DBRB 4WQMA 3VXWA 1XEEA 1RFAA 1L0XB 2RD0A 2KWDA 1BMLC 1QF6A 3VAWA 2LWPA 2LEKA 5IP4D 3Q8EA 2BQQA 2KD0A 3W2DA 2GLSA 2N9KA 1GOZA 4KVGB 1KTKA 1HXYD 4GLSC 1R4NB 2MSED 2JU6X 1ZOYB 1XO3A 4RF0A 2XNAC 3EHVA 4LTUA 2G4SA 3PZ8A 2L0TA 4KV2A 1MVKA 4XWWA 4C4VA 2K8BA 2J0KA 1J7BA 4HPLB 2C7MB 2LGYA 3AN1A 2LGXA 3AE3B 2BKFA 2WU2B 4GGQA 5E6JA 2NTSA 4HEA1 1WJ4A 3P4SB 2JRHA 1TJEA 3B9JA 3UIOB 4GXBA 1R4NI 3BK2A 4ASWC 1WGDA 2KMAA 1YX6B 4P16A 1V80A 1NI2A 2ACZB 2RDHA 1CQVA 1WY8A 5CTRC 3DBHB 4JX1C 5HKHA 3K9PB 2D3BA 3PRMB 3KWLA 3PHWB 2HTME 1WYGA 5C1ZA 3OWEB 3R8BA 3DOWA 1NYQA 1TGZB 4M00A 2W82A 4EFOA 2BS2B 2WWZA 5AEKB 2KC2A 4HRSA 2V9HA 2VZKB 3PREA 3LDZE 3ZRCA 3QA8A 4YXDB 2JYEA 1STEA 4GB9A 3A9JA 1UNSA 2MEKA 4S17A 3JYUA 4KGTA 3H7PA 2I2YA 1LXDA 2LJ5A 4FXCA 3RN9C 5KHQA 2DAFA 2O2VB 1IYFA 1KF6B 2JX5A 1MG4A 1B9RA 1QOFA 2KK8A 3A9JB 2KDFB 2JT4B 1GC7A 5AZHA 3I3TB 4KKIA 1OEYJ 4TSSA 3BVGA 4IUMB 2C60A 1WZ3A 3DVGX 4LNKA 3PRPB 1R4MB 2G4DB 2KMCA 4HCNB 3AE8B 2D2QA 1XXGA 3ML9A 2AX5A 3U30A 4ZRQA 4FHJA 3VR8B 4QAYA 3DVNU 2WXJA 4MM3B 3TMPB 4RM9A 4LLGM 1Q0WB 2BYVE 1AN8A 3L4PA 4LNFA 3N1ZC 1QKZA 3APCA 5IOIA 2KNBA 4TMAB 3MC8A 1I7HA 2KDMA 2LFIA 4AS1A 4HDOA 1WE7A 2AQ1B 1CK1A 1SJHD 2JXTA 2Z0EB 3BIID 2M17A 4YTMB 2JZ3B 4BFRA 4JLCA 4RGOS 2BT6A 3VTUA 4PK1A 2DNFA 3SFDB 2BS4B 4B9KA 2KX3A 4FA6A 1PGBA 4DWFA 2A4ZA 2WX0A 3JSVA 4K7SA 4BKSA 2ZPYA 3QQ8B 4M8NA 3NRZA 1NDDA 2MJDA 1JALA 3FAHA 5MPOA 4K7WA 1JRPA 2D3AA 4KIKA 2G9HD 3ZUNA 1ESFA 1FO4A 2DENB 1QILA 2XEWA 3DDCB 2Z59B 4MJSA 4F8CB 2K8HA 1N63A 2RMMA 3V05A 4HVBA 3TJPA 5D94A 2RPVA 3ENEA 2HD5B 2MBEA 4M8MA 1A70A 3N1XC 4FULA 3VHTC 4TQ1A 1Y8RC 4KIKB 3KLSX 4L1BA 5D3DA 1RRBA 3KVFB 3WAPA 4EKUA 2W54A 5C23A 5C3JB 1I4QA 4NJ7A 3IG3A 1T0SC 4C80A 1OFFA 4KGRA 1CZPA 2AQ3B 3NZSA 1FPYA 4US8A 1YJJA 4HDQA 1XF5L 3ZXRA 1XLOA 1C1YB 1SEBD 1YJIA 2KYWA 3NY5A 3RULA 4B6WA 3L10B 3PGEA 1HEZE 3NS8A 4A20A 1WX9A 1LQBA 3U8ZA 1YIWA 1JWAD 2FNJB 2YVCA 4BOZB 1L2NA 2WNMA 4MSMB 4DDID 4E74A 2OEDA 2LRUA 2SAKA 4HJKA 3UIPB 2RSUA 5JHAA 4W9CA 3ZQ4A 2W3RA 3B08A 2M1MA 2MBOA 3VH3B 3N30A 2N9XA 3ML8A 4ACFA 2R2OA 4CYEA 2WLBA 4KKJA 1QT9A 1QZEA 2PW9A 3MHSD 2NCNA 2J53A 3NVWA 1UWXA 4MGIE 1HQRD 2J52A 2PVOD 3AE5B 1TKGA 3TEWA 1D4BA 5FKAC 1AYFA 4L23A 2L52A 1K52A 1V97A 1JWSD 2J42A 4A3OA 3I63C 1MI0A 1MJDA 2H88B 3GOEA 1S1QB 2K8CA 2NPTB 1ZXIA 4BVUC 3NVYA 1AW7A 4FADA 2IO2B 3CWIA 3C0RB 5CHWA 2INNE 1UZXB 1EU3A 4CO7A 1L7YA 3FKYA 5E6PA 1CJEA 4UDUC 5BMHA 1SE9A 1EUVB 3URYA 4CHKA 3V61A 4M0WA 1X1MA 4WH4A 4NQKE 3APDA 2KJRA 2ZPNA 4LNOA 2CR5A 2CHXA 4HK2A 2WXIA 3RZWC 1IPGA 1GC6A 2D07B 4II2B 1OTRB 3AB5A 1SB3C 2O6VB 2QMTA 3DCGA 2KQ7A 3V62A 1YQ3B 2OHFA 3L17A 2L05A 5BO4B 2M0XA 1E8YA 3RUIB 5TR5A 3L54A 1TIFA 3RNCC 1YQBA 4XGAB 3BWUD 3SFEB 4LDTD 2IGHA 2IO3B 1WXMA 1FCCC 1P98A 1E90A 2FIDA 3ONSA 3UI3A 1D6EC 2MLBA 1RWSA 5GMVA 5IKCM 2LVOA 5H92C 4GDLA 4REZA 5IA7A 4IKGA 2LUEA 3VTVA 2PVGC 2D11A 3I5JC 3EECA 4XDDA 4GDKB 3FILA 1I35A 2IZVB 2M8SA 2KOXA 1EU4A 3ECIA 4TQ0A 2N9PC 3P4PB 4ZDVA 5LXIB 2IPKD 2GRIA 3VUWA 2LXCA 4AWJA 1L6UA 3IBEA 4KSLC 1T5XD 4KX6B 2KDBA 3SU8X 3PRZA 4B95A 1WZ0A 2XBBC 3VDZA 1YJ1A 2DAJA 5DPSA 4RF1A 4ANUA 2KTRB 4IWPA 3VUXA 2PE9A 2W55A 5HI1A 1FFVA 3IAM1 4M0WB 5G5HA 1TKYA 1FEHA 2WXFA 2H89B 1J7CA 3LXFA 3B0AA 3MC9A 3RYTA 2V4IB 1TS5A 1L6VA 4RCOA 1QOBA 1XD3B 2SEBD 4DXFA 2WU5B 1HZ5A 4NZLB 2BB6A 3T3OA 2V1YA 2WXNA 3SDLC 2IY1B 2ZJDA 3R2IA 4G11A 2K5PA 1E9MA 1HTQA 2BPSA 2MP2A 2BYEA 3ZJUA 1GB1A 3QAQA 3M95A 1F0ZA 4NAMA 4GDLB 1MHHE 2MBBB 1WR1A 1XLPA 1F2RC 3OJ4B 1GJZA 5EE1A 1WRDB 4URKA 4GN1A 4OHJA 1FNVA 1ZDVA 4MGKE 2ZVNA 4F1SA 2N1WA 3BVZA 4XDCA 3AU4A 4WAFA 2E6XA 1E5WA 3NZUA 2IO0B 4MELA 4HKQA 1SGHA 1TT5B 3JW0X 1FRDA 3PHXB 3UINB 1WM2A 1K51A 3BY4B 1T0RC 3O13A 4DHZE 2IJ0A 3VTWA 1L4ZB 2GB1A 3RNAC 4EZLA 2N7DA 1TS3A 2NPTA 3J9CA 3EC8A 2FCMA 3PZDA 2PE6B 1IGDA 2KX0A 3ZNHB 5L83A 2E3TA 2GI9A 3KYCD 3AM9A 4WJQA 5EE3A 5BYRA 3IT6B 2QC8A 2PEAA 1TY2A 1WXAA 3MC0B 1UBQA 1ZGUB 1WRIA 5LXHA 1TYGB 2CJOA 2LJIA 3VUYA 1A5RA 3HVZA 1YN4A 2WX1A 4XX5A 2BB5A 2ZCCA 2NS5A 2ONQA 2V3SA 2G45B 4JGHB 2VRRB 3C19A 4X57B 4FN2A 4YWGG 2M56B 1OQRA 2DWQA 1NYRA 4EEWA 2Y3AA 2YEPB 4IW0A 4GMVA 2LHDA 4AJYB 3NS1A 4EZKA 2INCC 4OW0A 5J17A 1WFYA 3PT2B 5FR6A 2BGFA 1WWTA 1ZXHA 2MJ3A 1QOGA 1TBEA 2QEJC 1U4AA 1P7EA 4JWUC 4A8XC 3X23A 4ARCA 4JQWC 2BKRB 2HE7A 5BMGA 2BWFA 4DXGA 3OLMD 2Q5WD 3AV8A 1L0VB 3ZJTA 1V1PB 1RYJA 3FC4A 3QARA 4WQOB 2MCNB 1RM6C 3AE7B 5KHOA 1UF0A 1IUEA 4WWOA 3ZYYX 2LASA 3C8YA 3ZNID 1UD7A 5LNK1 2O6VD 5G2NA 1EWCA 3HM3A 1EO6A 2NTTA 4EUTA 3Q3FA 4I6LB 4FBJB 2JQRB 1HA5A 2MH7A 2V3NA 1JWMD 1SIJA 3PS6A 3DHIC 1GAQB 2OJRA 3A9KA 2EMSA 1FFUA 2WP9B 2D10A 3RFZB 1TZ1A 2LGIA 3UGBB 1L5PA 2QCZA 4YL8A 1P3QU 1FXIA 1IBXA 1Z5SB 3BYTB 3VVWB 5LLIA 5BMIA 3W1YA 5D2MB 4LJOB 3AE4B 2ZCBA 2LVQA 1E0ZA 3A33B 2V3PA 3BZDB 3A1QA 1V86A 3Q14C 1ZDXA 1DOIA 4A55A 4S0RA 2MBQA 2VH2A 2WDRB 1E7UA 1P1AA 3TEXA 1QLBB 3S2AA 4HROA 2GBMA 4JE3B 3N3KB 4LCDE 3UQAA 3W1SC 2JY6A 2LHEA 4N9F4 3AE9B 2C7NB 4ZRKA 2INPE 3ZTDA 4IOIE 1UELA 4WIPA 3KH0A 3Q3MC 1ZKHA 3PV1A 1K53A 3P4RB 3TSSA 3VQIA 5J2RA 3SHQA 1PGAA 2REXA 4RFBA 1FXAA 1PUTA 3EUB2 3NVVA 2FIFA 3IT4B 4M02A 2LVPA 4MGYE 2L76A 2V4LA 5TSSA 2CHZA 1SE3A 2CS4A 2FUG1 4MT5A 4K3BA 2BTEA 4IM2A 2L1AA 3NJTA 5JZEB 1N60A 3A4RA 1YN5A 4E3CA 2KFJA 1VRAB 2KTRA 4MGZE 3KUZA 4HCPB 1E7PB 2AEHA 2I38A 1V81A 3PLVA 3AE2B 2KT7A 2YEPF 2IDYA 3AEDB 2KC1A 2V0GA 1WXVA 2VZKD 2C5LC
chains in the Genus database with same CATH topology
2MRPA 3V6CB 2MX2A 3Q3JA 2EMTA 2IO3B 4LDTD 1WXMA 4IWQA 4FJYA 4E71A 5JH5C 5D6JB 1AARA 2N7EA 3CSTA 1GNUA 1S3SG 3L08A 1P98A 3QIJA 2IY0B 1E90A 2NBVB 2FIDA 4WJOA 4FLHA 3ONSA 1PQSA 3AULA 3UF8A 1KJTA 2MLBA 5CX3A 2MP2B 1CMXB 1WYWB 4MSQB 2C7HA 2Z0DB 2KVRA 4XZ4A 5GMVA 3WA0A 3IVFA 1H8CA 4MEMA 4RM8A 4NPNA 3VXWA 2LVOA 4BOSC 2FCQA 1RFAA 2RD0A 4GDLA 5IA7A 5IAAC 4NAWA 2LUEA 4WWPA 3VAWA 3VTVA 1GG3A 2IBIB 2D11A 2O2VA 2LWPA 2L00B 2K39A 3EECA 3PTFC 5CHFA 4DK5A 4GDKB 2KD0A 1I35A 4HPMB 2IZVB 1P9DU 3QK0A 2M8SA 1UH6A 2KOXA 1E8XA 4DHZB 3ECIA 4HXDA 2ASQA 4KVGB 4TQ0A 2N9PC 2J0MA 4ZDVA 5LXIB 2MSED 3PSEB 2KZRA 5AZGA 1FXTB 3PPAA 2FCNA 2UWQA 2ZVOA 3VUWA 2LXCA 2J0JA 2QHOA 4GIVA 3EHVA 1WH3A 2G4SA 2KWCA 3IBEA 4AWJA 2L0TA 2KXJA 1WGRA 4KSLC 4KV2A 1D3ZA 3DBHI 3SU8X 2KDBA 4ICUA 3PRZA 2A5UA 4B95A 2GBRA 1WZ0A 2XBBC 3VDZA 3WAMA 1YJ1A 2DAJA 3PLUA 2K8BA 5DPSA 2J0KA 4HPLB 1V2YA 2C7MB 4ANUA 2LGYA 2KTRB 2LGXA 4IWPA 2BKFA 2PE9A 3VUXA 3H7SA 4GGQA 3ZRFA 1WJ4A 4M0WB 2JRHA 5CHVC 4ZYNA 4PS8A 4IG7B 3RYTA 3B0AA 3R7QA 3TIXA 3UIOB 5E6OA 2CU1A 4GXBA 1R4NI 2Y5BB 2GBKA 4ASWC 3APFA 1XD3B 2AWTA 3RT3B 1WGDA 3EFUA 2KMAA 4ICVA 3LJ3A 1YX6B 1J19A 3CMMB 1V80A 3HK0A 1NI2A 5EDSA 2UYZB 2AYOB 4K1RB 2KKCA 1WY8A 1WJNA 5CTRC 3H1UA 1WX8A 4GSWA 4W9KA 5G55A 2V1YA 3ZNZB 5HKHA 2ZZPB 3SDLC 2DHZA 2IY1B 2ZJDA 3CSFA 3K9PB 3PRMB 4G11A 4WJPA 4PYZA 1HE8A 2ZNVB 3PHWB 2BPSA 1LM8B 2MP2A 2BYEA 5C1ZA 4PYUA 3AXCA 3QAQA 3TBLD 3M95A 3ZIMA 3RZFA 3DOWA 4GDLB 4OVUA 1TGZB 3U7DA 2MBBB 1WR1A 4EFOA 2LZ6A 3OJ4B 1GJZA 4W9EA 3IFWB 4DDGD 2NVUI 2WWZA 1WRDB 5AEKB 4ZRJA 1EF1A 3JVZX 3R3MA 4URKA 3KUCB 4GN1A 4NY0A 4TKNA 2KC2A 4MGKE 2LGDA 2ZVNA 4F1SA 1RLFA 2N1WA 2FAZA 2N1VA 3PREA 5DPTA 3DBSA 4AOFA 2GBNA 1EF5A 3AU4A 3LDZE 1E5WA 3NZUA 3QA8A 2IO0B 4W9LA 3AI5A 2I1KA 3ZRCA 4MELA 4GB9A 1RAXA 2KN5A 1KOTA 3A9JA 2L7RA 1SGHA 3GZNI 2CHWA 4PS7A 3JW0X 3JYUA 1WMHA 3PHXB 1Q1OA 4GU2A 3UINB 1WM2A 4HWIB 3A1QB 1Z2MA 1NBFC 3BY4B 4EZJA 4DHZE 1WI0A 3MTNB 3H7PA 4WWNA 1LXDA 2AL3A 2LJ5A 3VTWA 3H7PB 5KHQA 2DAFA 2O2VB 1IYFA 4EZLA 2N7DA 4A3PA 2CKHB 3O65B 4ANXA 2NPTA 2MA9B 2FCMA 3EC8A 4I6PA 2KK8A 3PZDA 4NJ6A 2PE6B 4BKTA 2KX0A 3A9JB 1V5TA 4GDKA 2KDFB 4W9IA 2WDTB 3ZNHB 5L83A 2JT4B 2LXAA 1GC7A 3ZO5B 5AZHA 1VD2A 3I3TB 3KYCD 2MW5A 4KDIC 4WJQA 3RCZA 1WF9A 1J0GA 2KDIA 4G3XB 1OEYJ 4NAWB 2PEAA 1WXAA 2OOBB 3KUDB 4IUMB 1UBQA 2C60A 2DX5B 2YLMA 4JIOU 1WZ3A 1ZGUB 2RPQA 3DVGX 3VFKA 3QHTA 3M62B 5LXHA 4MJSB 3PRPB 2NR2A 2G4DB 2KMCA 3DBRI 4HCNB 3VUYA 1A5RA 1T0YA 3WAOA 2D2QA 1BT0A 2WX1A 3L13A 3ML9A 2PJHA 3L16A 4XX5A 5E6NA 3U30A 3QX1A 4II3B 1YX5B 3M3JA 2GMIC 3V6EB 4FHJA 2ZCCA 4NQLB 2NS5A 3DVNU 2D3GA 4DXAB 2L0FA 2XK5A 3TMPB 4RM9A 2V3SA 2G45B 2LRWA 2VRRB 4JGHB 4X57B 1Q0WB 4F7ZA 4FN2A 2BYVE 2LD9A 2I1JA 4KDLB 1WGHA 1MG8A 4ANWA 4W9FA 4EEWA 3APCA 3D32A 2KNBA 4IWOA 2KFKA 4IW0A 3MJWA 2PPHA 4GMVA 4AJYB 2L8JA 3DQVA 1WR6E 3HM6X 2KWUB 4KZ0A 2JPHA 4BBNC 1R4MI 4EZKA 5J17A 1YD8U 2JWZA 3P2BA 1WFYA 3PT2B 5FR6A 2BGFA 2RGFA 4HDOA 1WE7A 1TBEA 2KDEB 2KJHB 2J7QB 3HHMA 1U4AA 2KO3A 3JSVB 2Z0EB 1V49A 1WJUA 4FJVB 5DPWA 2M17A 1XQQA 1JRUA 2N4FA 2JZ3B 4BFRA 4HLEA 1WMHB 3X23A 2IYDB 4JQWC 2R2QA 4JLCA 1V5OA 2BKRB 1IP9A 2HE7A 3VTUA 1WM3A 2MWSB 4B9KA 3H6NA 2BWFA 3N32A 2KX3A 4FA6A 4DWFA 2A4ZA 3OLMD 3ZVVA 2WX0A 3JSVA 2FUHB 4K7SA 2ZPYA 3R7RA 4BKSA 4K7UA 3QQ8B 2JF5A 4M8NA 2ZNVC 1NDDA 3QARA 1P0RA 2NBUA 2KWVB 4K7WA 3A4SC 2K6DB 4WQOB 4KIKA 2MCNB 4W9DA 4BKSD 4IM0A 2N9EB 5KHOA 3ZUNA 4ZRIA 4MM3A 2DENB 2GBJA 2K1FA 2XEWA 3DDCB 4G50A 4LJPB 4WWOA 2Z59B 2LASA 1E8WA 4MJSA 4G0NB 4F8CB 2KJ6A 2K8HA 3ZTCA 2HTHA 1WIAA 3PVLA 1C3TA 4HVBA 3ZNID 1UBIA 1XT9B 2K6QA 3TJPA 5D94A 1OQYA 1UD7A 1WX7A 2BWES 2DYOA 2HD5B 2K25A 3ENEA 3T8MA 2MBEA 1K8RB 4M8MA 4DBGA 2DZJA 2O6VD 1VCBA 5G2NA 1J8CA 1WJ6A 2JXXA 4FULA 3AU5A 3VHTC 3HM3A 4TQ1A 3ZNGC 4W9GA 1EO6A 1Y8RC 2DZMA 4KIKB 3ZW3A 4W9HA 1F9JA 2EKEC 2JVCA 3Q3FA 4I6LB 4FHKA 3TL5A 4EUTA 4FBJB 1H4RA 3QJZA 1RRBA 3KVFB 3KW5B 3QC8B 3WAPA 5C23A 4EKUA 4W9JA 3PS6A 2BYFA 5AZFA 4NJ7A 2MQJA 3IG3A 2O6VA 3ZLZA 3T9LA 4WAAA 3SD5A 3NZSA 2OJRA 3KYDD 3W1SA 4HDQA 3H9DA 3A9KA 2EMSA 1UGMA 4DHJD 4KZCA 2D10A 4AP4C 4AJWA 1TZ1A 2ZEQA 4BKGA 3UGBB 1C1YB 5J18A 3ZDTA 1TTNA 3NY5A 5DCNA 3RULA 3WIMA 4B6WA 5L95C 1LFDA 4YL8A 1P3QU 3L10B 3PGEA 2W9NA 3NS8A 2DZKA 5D7GA 4OVVA 4A20A 2KTFA 1Z5SB 1G6JA 3VVWB 1WX9A 1LQBA 1V9JA 3U8ZA 1YIWA 5LLIA 2FNJB 2YVCA 4WJNA 3W1YA 4BOZB 1L2NA 2WYQA 4MSMB 5D2MB 4DDID 2NBWB 4LJOB 3WANA 2LRUA 4E74A 3QCAA 3L0WB 3RD2A 4ANVA 2ZCBA 4HJKA 2KANA 1M94A 2KLGA 2RSUA 3K9OB 4RMAA 2M4NA 3UIPB 2LVQA 4W9CA 5JHAA 3A33B 2MBHA 4GOCA 1WGYA 3BINA 4DHJB 1ZW7A 3A1QA 1V86A 2B3AA 2DYMA 3B08A 2G3QB 4NNJB 2M1MA 2MBQA 3TCAA 4P7IA 2MBOA 3VH3B 1I42A 2AL6A 1E7UA 1P1AA 3N30A 2N9XA 2KFKB 3ML8A 2RR9A 1WXSA 2R2OA 2XK5B 4CYEA 1E8ZA 1QZEA 3S2AA 3X0WA 2GBMA 2L3ZA 2NCNA 2C9WB 2IO1B 3MHSD 1OEYA 3N3KB 4MGIE 4LCDE 3UQAA 3W1SC 2JY6A 4N9F4 1ISNA 2C7NB 2KQSA 3B1LX 4ZRKA 3ZTDA 4FJZA 4MDKE 4A3OA 1UELA 5DPRA 2LI5A 3V60A 3GOEA 4XC2A 1WGGA 1S1QB 3KH0A 2K8CA 2NPTB 3CF6E 3M63B 4BVUC 1ZKHA 2GOWA 3ALBA 4FADA 3PV1A 2IO2B 3C0RB 5CHWA 2KHWB 1V6EA 3VQIA 4IM3A 1SIFA 1UZXB 3OJ3A 5J2RA 3SHQA 4TUUA 3DVGY 3DVNV 4CO7A 3WALA 1KLVA 2REXA 3ZKJC 1L7YA 3R66C 5E6PA 3OAWA 4PS3A 2JRIB 1SE9A 1EUVB 4CHKA 2FIFA 3DPDA 3V61A 1X1MA 2LVPA 4KSKC 2JZZA 4MH0E 3APDA 2KJRA 4MGYE 4NQKE 4BBNF 2L76A 2V4LA 2ZPNA 2CHZA 2HJ8A 2CR5A 2CS4A 2KLCA 3NHEB 4LDTB 3QWZB 2CHXA 4HK2A 3RZWC 2DYBA 3UQBA 3A9KB 1IPGA 4IM2A 1GC6A 2D07B 4II2B 4AUQC 5JZEB 3A4RA 1KM7A 3DBLI 4JL9A 1OTRB 2FCSA 4E3CA 2O6VB 5JHBA 3DCGA 2KFJA 2KQ7A 4J6IA 4TV3A 3V62A 1GUAB 4I6NB 2KTRA 1Q5WB 2DZIA 4MGZE 3KUZA 3L17A 2L05A 4HCPB 4K81A 5BO4B 2M0XA 3IHPC 2AEHA 1E8YA 3HIZA 3RUIB 2BF8B 1V81A 3PLVA 4IC7B 5TR5A 1WE6A 3ZDMC 3L54A 2JUOA 1OGWA 2KC1A 4EOYA 1E7VA 1YQBA 1WXVA 3VH4B 2C5LC 3NOBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2MRP A;  3V6C B;  2MX2 A;  3Q3J A;  2EMT A;  2IO3 B;  4LDT D;  1WXM A;  4IWQ A;  4FJY A;  4E71 A;  5JH5 C;  5D6J B;  1AAR A;  2N7E A;  3CST A;  1GNU A;  1S3S G;  3L08 A;  1P98 A;  3QIJ A;  2IY0 B;  1E90 A;  2NBV B;  2FID A;  4WJO A;  4FLH A;  3ONS A;  1PQS A;  3AUL A;  3UF8 A;  1KJT A;  2MLB A;  5CX3 A;  2MP2 B;  1CMX B;  1WYW B;  4MSQ B;  2C7H A;  2Z0D B;  2KVR A;  4XZ4 A;  5GMV A;  3WA0 A;  3IVF A;  1H8C A;  4MEM A;  4RM8 A;  4NPN A;  3VXW A;  2LVO A;  4BOS C;  2FCQ A;  1RFA A;  2RD0 A;  4GDL A;  5IA7 A;  5IAA C;  4NAW A;  2LUE A;  4WWP A;  3VAW A;  3VTV A;  1GG3 A;  2IBI B;  2D11 A;  2O2V A;  2LWP A;  2L00 B;  2K39 A;  3EEC A;  3PTF C;  5CHF A;  4DK5 A;  4GDK B;  2KD0 A;  1I35 A;  4HPM B;  2IZV B;  1P9D U;  3QK0 A;  2M8S A;  1UH6 A;  2KOX A;  1E8X A;  4DHZ B;  3ECI A;  4HXD A;  2ASQ A;  4KVG B;  4TQ0 A;  2N9P C;  2J0M A;  4ZDV A;  5LXI B;  2MSE D;  3PSE B;  2KZR A;  5AZG A;  1FXT B;  3PPA A;  2FCN A;  2UWQ A;  2ZVO A;  3VUW A;  2LXC A;  2J0J A;  2QHO A;  4GIV A;  3EHV A;  1WH3 A;  2G4S A;  2KWC A;  3IBE A;  4AWJ A;  2L0T A;  2KXJ A;  1WGR A;  4KSL C;  4KV2 A;  1D3Z A;  3DBH I;  3SU8 X;  2KDB A;  4ICU A;  3PRZ A;  2A5U A;  4B95 A;  2GBR A;  1WZ0 A;  2XBB C;  3VDZ A;  3WAM A;  1YJ1 A;  2DAJ A;  3PLU A;  2K8B A;  5DPS A;  2J0K A;  4HPL B;  1V2Y A;  2C7M B;  4ANU A;  2LGY A;  2KTR B;  2LGX A;  4IWP A;  2BKF A;  2PE9 A;  3VUX A;  3H7S A;  4GGQ A;  3ZRF A;  1WJ4 A;  4M0W B;  2JRH A;  5CHV C;  4ZYN A;  4PS8 A;  4IG7 B;  3RYT A;  3B0A A;  3R7Q A;  3TIX A;  3UIO B;  5E6O A;  2CU1 A;  4GXB A;  1R4N I;  2Y5B B;  2GBK A;  4ASW C;  3APF A;  1XD3 B;  2AWT A;  3RT3 B;  1WGD A;  3EFU A;  2KMA A;  4ICV A;  3LJ3 A;  1YX6 B;  1J19 A;  3CMM B;  1V80 A;  3HK0 A;  1NI2 A;  5EDS A;  2UYZ B;  2AYO B;  4K1R B;  2KKC A;  1WY8 A;  1WJN A;  5CTR C;  3H1U A;  1WX8 A;  4GSW A;  4W9K A;  5G55 A;  2V1Y A;  3ZNZ B;  5HKH A;  2ZZP B;  3SDL C;  2DHZ A;  2IY1 B;  2ZJD A;  3CSF A;  3K9P B;  3PRM B;  4G11 A;  4WJP A;  4PYZ A;  1HE8 A;  2ZNV B;  3PHW B;  2BPS A;  1LM8 B;  2MP2 A;  2BYE A;  5C1Z A;  4PYU A;  3AXC A;  3QAQ A;  3TBL D;  3M95 A;  3ZIM A;  3RZF A;  3DOW A;  4GDL B;  4OVU A;  1TGZ B;  3U7D A;  2MBB B;  1WR1 A;  4EFO A;  2LZ6 A;  3OJ4 B;  1GJZ A;  4W9E A;  3IFW B;  4DDG D;  2NVU I;  2WWZ A;  1WRD B;  5AEK B;  4ZRJ A;  1EF1 A;  3JVZ X;  3R3M A;  4URK A;  3KUC B;  4GN1 A;  4NY0 A;  4TKN A;  2KC2 A;  4MGK E;  2LGD A;  2ZVN A;  4F1S A;  1RLF A;  2N1W A;  2FAZ A;  2N1V A;  3PRE A;  5DPT A;  3DBS A;  4AOF A;  2GBN A;  1EF5 A;  3AU4 A;  3LDZ E;  1E5W A;  3NZU A;  3QA8 A;  2IO0 B;  4W9L A;  3AI5 A;  2I1K A;  3ZRC A;  4MEL A;  4GB9 A;  1RAX A;  2KN5 A;  1KOT A;  3A9J A;  2L7R A;  1SGH A;  3GZN I;  2CHW A;  4PS7 A;  3JW0 X;  3JYU A;  1WMH A;  3PHX B;  1Q1O A;  4GU2 A;  3UIN B;  1WM2 A;  4HWI B;  3A1Q B;  1Z2M A;  1NBF C;  3BY4 B;  4EZJ A;  4DHZ E;  1WI0 A;  3MTN B;  3H7P A;  4WWN A;  1LXD A;  2AL3 A;  2LJ5 A;  3VTW A;  3H7P B;  5KHQ A;  2DAF A;  2O2V B;  1IYF A;  4EZL A;  2N7D A;  4A3P A;  2CKH B;  3O65 B;  4ANX A;  2NPT A;  2MA9 B;  2FCM A;  3EC8 A;  4I6P A;  2KK8 A;  3PZD A;  4NJ6 A;  2PE6 B;  4BKT A;  2KX0 A;  3A9J B;  1V5T A;  4GDK A;  2KDF B;  4W9I A;  2WDT B;  3ZNH B;  5L83 A;  2JT4 B;  2LXA A;  1GC7 A;  3ZO5 B;  5AZH A;  1VD2 A;  3I3T B;  3KYC D;  2MW5 A;  4KDI C;  4WJQ A;  3RCZ A;  1WF9 A;  1J0G A;  2KDI A;  4G3X B;  1OEY J;  4NAW B;  2PEA A;  1WXA A;  2OOB B;  3KUD B;  4IUM B;  1UBQ A;  2C60 A;  2DX5 B;  2YLM A;  4JIO U;  1WZ3 A;  1ZGU B;  2RPQ A;  3DVG X;  3VFK A;  3QHT A;  3M62 B;  5LXH A;  4MJS B;  3PRP B;  2NR2 A;  2G4D B;  2KMC A;  3DBR I;  4HCN B;  3VUY A;  1A5R A;  1T0Y A;  3WAO A;  2D2Q A;  1BT0 A;  2WX1 A;  3L13 A;  3ML9 A;  2PJH A;  3L16 A;  4XX5 A;  5E6N A;  3U30 A;  3QX1 A;  4II3 B;  1YX5 B;  3M3J A;  2GMI C;  3V6E B;  4FHJ A;  2ZCC A;  4NQL B;  2NS5 A;  3DVN U;  2D3G A;  4DXA B;  2L0F A;  2XK5 A;  3TMP B;  4RM9 A;  2V3S A;  2G45 B;  2LRW A;  2VRR B;  4JGH B;  4X57 B;  1Q0W B;  4F7Z A;  4FN2 A;  2BYV E;  2LD9 A;  2I1J A;  4KDL B;  1WGH A;  1MG8 A;  4ANW A;  4W9F A;  4EEW A;  3APC A;  3D32 A;  2KNB A;  4IWO A;  2KFK A;  4IW0 A;  3MJW A;  2PPH A;  4GMV A;  4AJY B;  2L8J A;  3DQV A;  1WR6 E;  3HM6 X;  2KWU B;  4KZ0 A;  2JPH A;  4BBN C;  1R4M I;  4EZK A;  5J17 A;  1YD8 U;  2JWZ A;  3P2B A;  1WFY A;  3PT2 B;  5FR6 A;  2BGF A;  2RGF A;  4HDO A;  1WE7 A;  1TBE A;  2KDE B;  2KJH B;  2J7Q B;  3HHM A;  1U4A A;  2KO3 A;  3JSV B;  2Z0E B;  1V49 A;  1WJU A;  4FJV B;  5DPW A;  2M17 A;  1XQQ A;  1JRU A;  2N4F A;  2JZ3 B;  4BFR A;  4HLE A;  1WMH B;  3X23 A;  2IYD B;  4JQW C;  2R2Q A;  4JLC A;  1V5O A;  2BKR B;  1IP9 A;  2HE7 A;  3VTU A;  1WM3 A;  2MWS B;  4B9K A;  3H6N A;  2BWF A;  3N32 A;  2KX3 A;  4FA6 A;  4DWF A;  2A4Z A;  3OLM D;  3ZVV A;  2WX0 A;  3JSV A;  2FUH B;  4K7S A;  2ZPY A;  3R7R A;  4BKS A;  4K7U A;  3QQ8 B;  2JF5 A;  4M8N A;  2ZNV C;  1NDD A;  3QAR A;  1P0R A;  2NBU A;  2KWV B;  4K7W A;  3A4S C;  2K6D B;  4WQO B;  4KIK A;  2MCN B;  4W9D A;  4BKS D;  4IM0 A;  2N9E B;  5KHO A;  3ZUN A;  4ZRI A;  4MM3 A;  2DEN B;  2GBJ A;  2K1F A;  2XEW A;  3DDC B;  4G50 A;  4LJP B;  4WWO A;  2Z59 B;  2LAS A;  1E8W A;  4MJS A;  4G0N B;  4F8C B;  2KJ6 A;  2K8H A;  3ZTC A;  2HTH A;  1WIA A;  3PVL A;  1C3T A;  4HVB A;  3ZNI D;  1UBI A;  1XT9 B;  2K6Q A;  3TJP A;  5D94 A;  1OQY A;  1UD7 A;  1WX7 A;  2BWE S;  2DYO A;  2HD5 B;  2K25 A;  3ENE A;  3T8M A;  2MBE A;  1K8R B;  4M8M A;  4DBG A;  2DZJ A;  2O6V D;  1VCB A;  5G2N A;  1J8C A;  1WJ6 A;  2JXX A;  4FUL A;  3AU5 A;  3VHT C;  3HM3 A;  4TQ1 A;  3ZNG C;  4W9G A;  1EO6 A;  1Y8R C;  2DZM A;  4KIK B;  3ZW3 A;  4W9H A;  1F9J A;  2EKE C;  2JVC A;  3Q3F A;  4I6L B;  4FHK A;  3TL5 A;  4EUT A;  4FBJ B;  1H4R A;  3QJZ A;  1RRB A;  3KVF B;  3KW5 B;  3QC8 B;  3WAP A;  5C23 A;  4EKU A;  4W9J A;  3PS6 A;  2BYF A;  5AZF A;  4NJ7 A;  2MQJ A;  3IG3 A;  2O6V A;  3ZLZ A;  3T9L A;  4WAA A;  3SD5 A;  3NZS A;  2OJR A;  3KYD D;  3W1S A;  4HDQ A;  3H9D A;  3A9K A;  2EMS A;  1UGM A;  4DHJ D;  4KZC A;  2D10 A;  4AP4 C;  4AJW A;  1TZ1 A;  2ZEQ A;  4BKG A;  3UGB B;  1C1Y B;  5J18 A;  3ZDT A;  1TTN A;  3NY5 A;  5DCN A;  3RUL A;  3WIM A;  4B6W A;  5L95 C;  1LFD A;  4YL8 A;  1P3Q U;  3L10 B;  3PGE A;  2W9N A;  3NS8 A;  2DZK A;  5D7G A;  4OVV A;  4A20 A;  2KTF A;  1Z5S B;  1G6J A;  3VVW B;  1WX9 A;  1LQB A;  1V9J A;  3U8Z A;  1YIW A;  5LLI A;  2FNJ B;  2YVC A;  4WJN A;  3W1Y A;  4BOZ B;  1L2N A;  2WYQ A;  4MSM B;  5D2M B;  4DDI D;  2NBW B;  4LJO B;  3WAN A;  2LRU A;  4E74 A;  3QCA A;  3L0W B;  3RD2 A;  4ANV A;  2ZCB A;  4HJK A;  2KAN A;  1M94 A;  2KLG A;  2RSU A;  3K9O B;  4RMA A;  2M4N A;  3UIP B;  2LVQ A;  4W9C A;  5JHA A;  3A33 B;  2MBH A;  4GOC A;  1WGY A;  3BIN A;  4DHJ B;  1ZW7 A;  3A1Q A;  1V86 A;  2B3A A;  2DYM A;  3B08 A;  2G3Q B;  4NNJ B;  2M1M A;  2MBQ A;  3TCA A;  4P7I A;  2MBO A;  3VH3 B;  1I42 A;  2AL6 A;  1E7U A;  1P1A A;  3N30 A;  2N9X A;  2KFK B;  3ML8 A;  2RR9 A;  1WXS A;  2R2O A;  2XK5 B;  4CYE A;  1E8Z A;  1QZE A;  3S2A A;  3X0W A;  2GBM A;  2L3Z A;  2NCN A;  2C9W B;  2IO1 B;  3MHS D;  1OEY A;  3N3K B;  4MGI E;  4LCD E;  3UQA A;  3W1S C;  2JY6 A;  4N9F 4;  1ISN A;  2C7N B;  2KQS A;  3B1L X;  4ZRK A;  3ZTD A;  4FJZ A;  4MDK E;  4A3O A;  1UEL A;  5DPR A;  2LI5 A;  3V60 A;  3GOE A;  4XC2 A;  1WGG A;  1S1Q B;  3KH0 A;  2K8C A;  2NPT B;  3CF6 E;  3M63 B;  4BVU C;  1ZKH A;  2GOW A;  3ALB A;  4FAD A;  3PV1 A;  2IO2 B;  3C0R B;  5CHW A;  2KHW B;  1V6E A;  3VQI A;  4IM3 A;  1SIF A;  1UZX B;  3OJ3 A;  5J2R A;  3SHQ A;  4TUU A;  3DVG Y;  3DVN V;  4CO7 A;  3WAL A;  1KLV A;  2REX A;  3ZKJ C;  1L7Y A;  3R66 C;  5E6P A;  3OAW A;  4PS3 A;  2JRI B;  1SE9 A;  1EUV B;  4CHK A;  2FIF A;  3DPD A;  3V61 A;  1X1M A;  2LVP A;  4KSK C;  2JZZ A;  4MH0 E;  3APD A;  2KJR A;  4MGY E;  4NQK E;  4BBN F;  2L76 A;  2V4L A;  2ZPN A;  2CHZ A;  2HJ8 A;  2CR5 A;  2CS4 A;  2KLC A;  3NHE B;  4LDT B;  3QWZ B;  2CHX A;  4HK2 A;  3RZW C;  2DYB A;  3UQB A;  3A9K B;  1IPG A;  4IM2 A;  1GC6 A;  2D07 B;  4II2 B;  4AUQ C;  5JZE B;  3A4R A;  1KM7 A;  3DBL I;  4JL9 A;  1OTR B;  2FCS A;  4E3C A;  2O6V B;  5JHB A;  3DCG A;  2KFJ A;  2KQ7 A;  4J6I A;  4TV3 A;  3V62 A;  1GUA B;  4I6N B;  2KTR A;  1Q5W B;  2DZI A;  4MGZ E;  3KUZ A;  3L17 A;  2L05 A;  4HCP B;  4K81 A;  5BO4 B;  2M0X A;  3IHP C;  2AEH A;  1E8Y A;  3HIZ A;  3RUI B;  2BF8 B;  1V81 A;  3PLV A;  4IC7 B;  5TR5 A;  1WE6 A;  3ZDM C;  3L54 A;  2JUO A;  1OGW A;  2KC1 A;  4EOY A;  1E7V A;  1YQB A;  1WXV A;  3VH4 B;  2C5L C;  3NOB A; 
#chains in the Genus database with same CATH topology
 2MRP A;  3V6C B;  2MX2 A;  3Q3J A;  4E71 A;  5HHD G;  4FJY A;  1V1O A;  3CST A;  1JRO A;  1MFW A;  3BK1 A;  3UF8 A;  1KJT A;  1K50 A;  1XLQ A;  1CMX B;  4XZ4 A;  3WA0 A;  4BOS C;  4NPN A;  4DQO C;  2FCQ A;  2L83 A;  3B2G A;  3E9S A;  5IO9 A;  1KRH A;  2L00 B;  2K39 A;  5CHF A;  2EEL A;  1C4C A;  2FBW B;  1D5Z C;  1P9D U;  1EWY C;  1UH6 A;  1E8X A;  4HXD A;  2ASQ A;  4P6V F;  4US9 A;  3PSE B;  1FXT B;  3PPA A;  2ZVO A;  1WH3 A;  1NEN B;  2KWC A;  1SJE D;  2KXJ A;  3DBH I;  3EFC A;  4ICU A;  2A5U A;  2GBR A;  2UU7 A;  2W3S A;  3WAM A;  3PLU A;  1V2Y A;  2WXL A;  1XLN A;  4LNI A;  4HKZ E;  3TUO A;  3Q8B A;  3ZRF A;  5CHV C;  4ZYN A;  2K22 A;  2OJW A;  2PIA A;  4PS8 A;  4IG7 B;  3P63 A;  4IDI A;  2GBK A;  3APF A;  4ICV A;  3EFU A;  4A6Q A;  3LJ3 A;  3HK0 A;  5D3I B;  4YSX B;  2AYO B;  2KKC A;  1WJN A;  2N0S B;  1UWM A;  4GSW A;  4W9K A;  5G55 A;  2DHZ A;  4PYZ A;  1HE8 A;  2ZNV B;  1LM8 B;  4N58 A;  3RNE C;  3AXC A;  3T3N A;  1JCK B;  3TBL D;  3Q3O C;  3RZF A;  2Y5P A;  2BYT A;  1DYQ A;  4W9E A;  3IFW B;  4DDG D;  2NVU I;  3RMK C;  4ZRJ A;  3JVZ X;  3R3M A;  1R7S A;  4TKN A;  1IGC A;  1RLF A;  2BVC A;  3AEC B;  2FAZ A;  5DPT A;  3DBS A;  4AOF A;  1YMH E;  1D5M C;  1EF5 A;  3ZGZ A;  3DHH C;  3HVD A;  2KN5 A;  3NG0 A;  2L7R A;  3GZN I;  1QOA A;  1Q1O A;  2WXM A;  4PT5 A;  3A1Q B;  1Z2M A;  4EZJ A;  3AE6 B;  4O1N A;  3MTN B;  4WWN A;  2AL3 A;  1C4P A;  2IGD A;  1GB4 A;  5EE0 A;  1FNU A;  2CKH B;  4AQ7 A;  4A90 A;  2BW2 A;  4BKT A;  2JZP A;  1V5T A;  1JW9 D;  4GDK A;  1V8C A;  2WDT B;  4M01 A;  4W9I A;  3ZO5 B;  1SF0 A;  1VD2 A;  4LNN A;  3ZJV A;  1ZUD 2;  4G3X B;  1TS2 A;  2KVZ A;  2OOB B;  3KUD B;  1D5X C;  4JIO U;  1F1H A;  2YLM A;  3VFK A;  3QHT A;  3M62 B;  1TY0 A;  4MJS B;  1VZ6 A;  2NR2 A;  3P1M A;  4K3C A;  3W5V B;  3KQ4 A;  3DBR I;  2WQY B;  4YTP B;  1T0Y A;  1J7A A;  1N5W A;  3WAO A;  1FD6 A;  3QX1 A;  4II3 B;  1YX5 B;  3V3X A;  3V6E B;  1JWB D;  4NQL B;  1E6E B;  4DXA B;  2L0F A;  2XK5 A;  5AUK A;  2LRW A;  4OZB A;  1WGH A;  1MG8 A;  4W9F A;  3AH7 A;  3D32 A;  3AE1 B;  3VR9 B;  2PPH A;  4ITK A;  3DQV A;  2WXP A;  4BBN C;  1SE4 A;  2KWU B;  2JPH A;  1R4M I;  2D5G A;  4C00 A;  1YD8 U;  2WXK A;  2JWZ A;  1RFK A;  2EKI A;  3P2B A;  2RGF A;  2KJH B;  2J7Q B;  2KDE B;  3HHM A;  4ZHO A;  2MJE A;  5BYQ A;  4B0M A;  1V49 A;  1WJU A;  2RDB C;  4JWS C;  1JRU A;  1C78 A;  2N4F A;  2VH1 A;  1TS4 A;  2J4X A;  4A9A A;  1V5O A;  2N7J A;  3Q69 A;  1WM3 A;  1WXQ A;  4N59 A;  4XYC A;  2FUH B;  3R7R A;  4K7U A;  1EM7 A;  4RGN A;  2JF5 A;  3PO0 A;  2WS3 B;  1NI3 A;  3A4S C;  1DOY A;  4W9D A;  4IM0 A;  2N9E B;  1I4R A;  4ZRP A;  1E8W A;  4YSZ B;  4G0N B;  4HJG E;  3ZTC A;  2HTH A;  1C3T A;  3Q6B A;  1UBI A;  2XN9 C;  4BZA A;  1OQY A;  1WX7 A;  2Z8L A;  3T8M A;  1FRR A;  1C76 A;  2DZJ A;  1L4D B;  3NZ3 A;  3AEG B;  1J8C A;  1WJ6 A;  2BBC A;  3ZNG C;  4W9G A;  2DZM A;  2KN4 A;  1F9J A;  3TL5 A;  3B2F A;  4FHK A;  1LO5 D;  2PKO A;  3QJZ A;  3QC8 B;  3KW5 B;  4W9J A;  2WXH A;  5AZF A;  5GXG B;  3ZLZ A;  3T9L A;  5H8Y E;  2WXG A;  3SD5 A;  2X8X X;  3W1S A;  4MH8 A;  3GZN B;  2ZEQ A;  1TTN A;  5DCN A;  3WIM A;  2PMV A;  2IGG A;  1LFD A;  2DZK A;  5D7G A;  3VRB B;  1G6J A;  1V9J A;  1PGX A;  2WYQ A;  2NBW B;  3QCA A;  1M94 A;  2KLG A;  4RMA A;  2MBH A;  4GOC A;  1WGY A;  1AWD A;  4YSY B;  1ZW7 A;  1SE2 A;  3U2S C;  4NNJ B;  2AL6 A;  2KFK B;  2XK5 B;  3AEF B;  1E8Z A;  1Q10 A;  5T8I A;  1TKE A;  4USA A;  2KQS A;  3B1L X;  3CIR B;  4RGM A;  4YT0 B;  3Q8F A;  4FJZ A;  4MDK E;  2LI5 A;  2N9L A;  1JML A;  1WGG A;  2PLP A;  4B0E A;  3M63 B;  2QDF A;  1C9F A;  2GOW A;  2KHW B;  1SIF A;  3OJ3 A;  3DVG Y;  3DVN V;  3ZKJ C;  3R66 C;  4PS3 A;  2JRI B;  2JYT A;  3GE8 C;  4KSK C;  2JZZ A;  1Y56 A;  4MH0 E;  5HFY A;  2HJ8 A;  4LDT B;  3QWZ B;  1SSN A;  2DYB A;  1DOX A;  3GS2 A;  3TEZ A;  4AUQ C;  3RNF C;  1FNW A;  2KQ4 X;  1FIQ A;  4JL9 A;  1BXT A;  5JHB A;  4J6I A;  3HRD D;  4I6N B;  1Q5W B;  3IHP C;  3HIZ A;  2LGS A;  2BF8 B;  4LK0 M;  3AMZ A;  1ENF A;  3AEB B;  2K9X A;  1FM0 D;  2EMT A;  5JH5 C;  4IWQ A;  2RDG A;  3ETR A;  1AAR A;  2N7E A;  1GNU A;  1S3S G;  3L08 A;  2NBV B;  2WDV B;  3AUL A;  5AUI A;  2CJN A;  5CX3 A;  2MP2 B;  1WYW B;  4MSQ B;  2C7H A;  2Z0D B;  1H8C A;  4RM8 A;  3IAS 1;  5IAA C;  4NAW A;  5I4D A;  2QSD A;  4WWP A;  1GG3 A;  2IBI B;  2B76 B;  2O2V A;  1L0Y B;  2WDQ B;  3PTF C;  4DK5 A;  3LB8 C;  1WSP A;  3LYY A;  4HPM B;  3QK0 A;  3IXS A;  3RNG C;  4DHZ B;  1TZO A;  2J0M A;  3P4Q B;  3RPF C;  4L2Y A;  4OZC A;  4ARI A;  1OQQ A;  5AZG A;  2KZR A;  2WXQ A;  2DBY A;  2FCN A;  2UWQ A;  1JWU D;  2QHO A;  2J0J A;  3DBL B;  3KWV A;  3OG5 A;  4GIV A;  2CU3 A;  2LUM A;  1WGR A;  1D3Z A;  1JQ4 A;  2HJ1 A;  1YOV B;  3ABV B;  1YN3 A;  1VR9 A;  5EE9 A;  2KAJ A;  4RH6 A;  2WXO A;  3H7S A;  3BVM A;  1ET6 A;  4R3D A;  3R7Q A;  3TIX A;  5E6O A;  2CU1 A;  2Y5B B;  1IBX B;  3I9V 1;  1F52 A;  2AWT A;  3RT3 B;  4C7Z A;  4CQN A;  1J19 A;  3CMM B;  5EDS A;  2UYZ B;  1VZ8 A;  4K1R B;  3H1U A;  1WX8 A;  4BAX A;  3ZNZ B;  2ZZP B;  3CSF A;  4WJP A;  2L32 A;  3N20 C;  5FK9 C;  2HDE A;  4PYU A;  2QJL A;  3BYY B;  4OVZ A;  5HG2 A;  3R2T A;  1T6B X;  3VRA B;  3ZIM A;  2NMQ A;  4OVU A;  3U7D A;  1KLU D;  2LZ6 A;  3DHG C;  4XWT A;  4XE0 A;  1EF1 A;  3KUC B;  4NY0 A;  1F77 A;  3N9Y C;  1LGR A;  2LGD A;  2ZW0 A;  2N1V A;  2GBN A;  5C2T B;  4W9L A;  3AI5 A;  2I1K A;  3GE3 C;  5G5G A;  4KGS A;  1FCL A;  1RAX A;  1KOT A;  1BUI C;  2BS3 B;  2CHW A;  3RI7 C;  4PS7 A;  1WMH A;  4C56 C;  4GU2 A;  4HWI B;  1NBF C;  2PTL A;  1YQ4 B;  1WI0 A;  3H7P B;  3EA6 A;  4YTN B;  4A3P A;  1ET9 A;  3O65 B;  4ANX A;  2MA9 B;  4I6P A;  2MHJ A;  4NJ6 A;  1E10 A;  2LXA A;  3RCZ A;  4KDI C;  2MW5 A;  1WF9 A;  1J0G A;  2K0P A;  2KDI A;  1F2R I;  1UUP A;  4NAW B;  1KLG D;  2DX5 B;  2RPQ A;  3U4E G;  3Q8A A;  1ZE3 D;  5IN7 A;  1XCQ L;  4ZHP A;  2DLB A;  1WGK A;  1C79 A;  5BYS A;  3I57 A;  1BT0 A;  3L13 A;  5E6N A;  2PJH A;  3L16 A;  3N1Y C;  3M3J A;  2GMI C;  1ZP0 B;  2AQ2 B;  2D3G A;  4Q2J A;  3NVZ A;  3TEY A;  3HUI A;  4J3O D;  4F7Z A;  1ZPS A;  2LD9 A;  1DGJ A;  2I1J A;  2TSS A;  4KDL B;  2LMC A;  4ANW A;  5FR3 A;  1C4A A;  3H8H A;  4IWO A;  2KFK A;  3MJW A;  3PZ7 A;  2L8J A;  3HM6 X;  1WR6 E;  1N62 A;  4KZ0 A;  1HZ6 A;  3RNB C;  1PYW D;  2KO3 A;  2G1E A;  3JSV B;  4FJV B;  5DPW A;  1XQQ A;  4N6E B;  4HLE A;  4HPP A;  1WMH B;  1IP9 A;  2IYD B;  2R2Q A;  1M4V A;  4C7Y A;  2MWS B;  3H6N A;  3MP9 A;  3N32 A;  3U52 E;  3ZVV A;  1NEK B;  1VJK A;  2ZNV C;  1P0R A;  2NBU A;  2KWV B;  2K6D B;  4BKS D;  4ZRI A;  1VZ7 A;  1I4H A;  2ZW1 A;  4MM3 A;  4G50 A;  4LJP B;  2GBJ A;  2K1F A;  1P7F A;  2KJ6 A;  1WIA A;  3PVL A;  2D3C A;  1XT9 B;  2K6Q A;  2BWE S;  2DYO A;  1V1P A;  2K25 A;  2QIE B;  1K8R B;  4DBG A;  1VCB A;  2JXX A;  3AU5 A;  3ZW3 A;  1KH0 A;  4W9H A;  2EKE C;  2JVC A;  1HTO A;  1H4R A;  4EE2 A;  2BYF A;  1C77 A;  2MQJ A;  2O6V A;  4WAA A;  2ICI A;  3NUH B;  3KYD D;  1GPX A;  3H9D A;  1UGM A;  1N61 A;  4DHJ D;  4KZC A;  4AP4 C;  4AJW A;  4BKG A;  2KAC A;  5J18 A;  3ZDT A;  2JSV X;  1N5X A;  5L95 C;  1I4G A;  3AEE B;  3SEB A;  2W9N A;  2X38 A;  2WHI A;  4OVV A;  2KTF A;  5JXV A;  3MJ5 A;  3ZXV A;  1I4P A;  4WJN A;  4WUR A;  3WAN A;  1MPE A;  3RD2 A;  3L0W B;  1PFD A;  3Q3N C;  4ANV A;  2KAN A;  3K9O B;  2M4N A;  3E56 A;  3EGR A;  3SR6 A;  3BIN A;  4DHJ B;  3FIL B;  2B3A A;  2DYM A;  2G3Q B;  1T0Q C;  3TCA A;  4P7I A;  1ROE A;  1I42 A;  2RR9 A;  1WXS A;  3X0W A;  3AEA B;  2L3Z A;  2C9W B;  2IO1 B;  2FE8 A;  1OEY A;  2M0A A;  1PDX A;  4JPS A;  4RNA A;  2K3U A;  1ISN A;  1NVI D;  4WWM A;  3MHZ A;  4P1B C;  2IND C;  2WGS A;  5DPR A;  4H2A A;  1KFY B;  3V60 A;  4XC2 A;  2M19 A;  3W5U B;  3CF6 E;  3ALB A;  2KMM A;  1VDV A;  1VLB A;  2WXR A;  1V6E A;  4IM3 A;  4TUU A;  3WAL A;  1KLV A;  1MHX A;  3P42 A;  3OAW A;  2Y5C A;  3DPD A;  4D2K A;  4MAC A;  4BBN F;  1YNT E;  4NJC A;  3Q8C A;  2KLC A;  3NHE B;  1SBB B;  4OZA A;  3DWG C;  1FMA D;  4C4V B;  3UQB A;  3A9K B;  3DWM A;  1SXT A;  1KM7 A;  3DBL I;  2FCS A;  3Q2A C;  4TV3 A;  1GUA B;  2ON8 A;  1UGJ A;  2JWU A;  2QIL A;  1T3Q A;  2DZI A;  3WCQ A;  4K81 A;  1QQR A;  1ACC A;  4IC7 B;  1WE6 A;  3U7Z A;  3GB1 A;  3ZDM C;  2JUO A;  4RGT A;  1N6Z A;  1OGW A;  4EOY A;  1E7V A;  3VH4 B;  2R61 A;  3NOB A;  4ZOH C;  4ZYS A;  3W9C B;  1I4X A;  5D6J B;  3QIJ A;  2IY0 B;  3MFG A;  1B1Z A;  4WJO A;  3GP7 A;  4FLH A;  1PQS A;  1XCT L;  2KVR A;  3IVF A;  4MEM A;  4P1C C;  3DBR B;  4WQM A;  3VXW A;  1XEE A;  1RFA A;  1L0X B;  2RD0 A;  2KWD A;  1BML C;  1QF6 A;  3VAW A;  2LWP A;  2LEK A;  5IP4 D;  3Q8E A;  2BQQ A;  2KD0 A;  3W2D A;  2GLS A;  2N9K A;  1GOZ A;  4KVG B;  1KTK A;  1HXY D;  4GLS C;  1R4N B;  2MSE D;  2JU6 X;  1ZOY B;  1XO3 A;  4RF0 A;  2XNA C;  3EHV A;  4LTU A;  2G4S A;  3PZ8 A;  2L0T A;  4KV2 A;  1MVK A;  4XWW A;  4C4V A;  2K8B A;  2J0K A;  1J7B A;  4HPL B;  2C7M B;  2LGY A;  3AN1 A;  2LGX A;  3AE3 B;  2BKF A;  2WU2 B;  4GGQ A;  5E6J A;  2NTS A;  4HEA 1;  1WJ4 A;  3P4S B;  2JRH A;  1TJE A;  3B9J A;  3UIO B;  4GXB A;  1R4N I;  3BK2 A;  4ASW C;  1WGD A;  2KMA A;  1YX6 B;  4P16 A;  1V80 A;  1NI2 A;  2ACZ B;  2RDH A;  1CQV A;  1WY8 A;  5CTR C;  3DBH B;  4JX1 C;  5HKH A;  3K9P B;  2D3B A;  3PRM B;  3KWL A;  3PHW B;  2HTM E;  1WYG A;  5C1Z A;  3OWE B;  3R8B A;  3DOW A;  1NYQ A;  1TGZ B;  4M00 A;  2W82 A;  4EFO A;  2BS2 B;  2WWZ A;  5AEK B;  2KC2 A;  4HRS A;  2V9H A;  2VZK B;  3PRE A;  3LDZ E;  3ZRC A;  3QA8 A;  4YXD B;  2JYE A;  1STE A;  4GB9 A;  3A9J A;  1UNS A;  2MEK A;  4S17 A;  3JYU A;  4KGT A;  3H7P A;  2I2Y A;  1LXD A;  2LJ5 A;  4FXC A;  3RN9 C;  5KHQ A;  2DAF A;  2O2V B;  1IYF A;  1KF6 B;  2JX5 A;  1MG4 A;  1B9R A;  1QOF A;  2KK8 A;  3A9J B;  2KDF B;  2JT4 B;  1GC7 A;  5AZH A;  3I3T B;  4KKI A;  1OEY J;  4TSS A;  3BVG A;  4IUM B;  2C60 A;  1WZ3 A;  3DVG X;  4LNK A;  3PRP B;  1R4M B;  2G4D B;  2KMC A;  4HCN B;  3AE8 B;  2D2Q A;  1XXG A;  3ML9 A;  2AX5 A;  3U30 A;  4ZRQ A;  4FHJ A;  3VR8 B;  4QAY A;  3DVN U;  2WXJ A;  4MM3 B;  3TMP B;  4RM9 A;  4LLG M;  1Q0W B;  2BYV E;  1AN8 A;  3L4P A;  4LNF A;  3N1Z C;  1QKZ A;  3APC A;  5IOI A;  2KNB A;  4TMA B;  3MC8 A;  1I7H A;  2KDM A;  2LFI A;  4AS1 A;  4HDO A;  1WE7 A;  2AQ1 B;  1CK1 A;  1SJH D;  2JXT A;  2Z0E B;  3BII D;  2M17 A;  4YTM B;  2JZ3 B;  4BFR A;  4JLC A;  4RGO S;  2BT6 A;  3VTU A;  4PK1 A;  2DNF A;  3SFD B;  2BS4 B;  4B9K A;  2KX3 A;  4FA6 A;  1PGB A;  4DWF A;  2A4Z A;  2WX0 A;  3JSV A;  4K7S A;  4BKS A;  2ZPY A;  3QQ8 B;  4M8N A;  3NRZ A;  1NDD A;  2MJD A;  1JAL A;  3FAH A;  5MPO A;  4K7W A;  1JRP A;  2D3A A;  4KIK A;  2G9H D;  3ZUN A;  1ESF A;  1FO4 A;  2DEN B;  1QIL A;  2XEW A;  3DDC B;  2Z59 B;  4MJS A;  4F8C B;  2K8H A;  1N63 A;  2RMM A;  3V05 A;  4HVB A;  3TJP A;  5D94 A;  2RPV A;  3ENE A;  2HD5 B;  2MBE A;  4M8M A;  1A70 A;  3N1X C;  4FUL A;  3VHT C;  4TQ1 A;  1Y8R C;  4KIK B;  3KLS X;  4L1B A;  5D3D A;  1RRB A;  3KVF B;  3WAP A;  4EKU A;  2W54 A;  5C23 A;  5C3J B;  1I4Q A;  4NJ7 A;  3IG3 A;  1T0S C;  4C80 A;  1OFF A;  4KGR A;  1CZP A;  2AQ3 B;  3NZS A;  1FPY A;  4US8 A;  1YJJ A;  4HDQ A;  1XF5 L;  3ZXR A;  1XLO A;  1C1Y B;  1SEB D;  1YJI A;  2KYW A;  3NY5 A;  3RUL A;  4B6W A;  3L10 B;  3PGE A;  1HEZ E;  3NS8 A;  4A20 A;  1WX9 A;  1LQB A;  3U8Z A;  1YIW A;  1JWA D;  2FNJ B;  2YVC A;  4BOZ B;  1L2N A;  2WNM A;  4MSM B;  4DDI D;  4E74 A;  2OED A;  2LRU A;  2SAK A;  4HJK A;  3UIP B;  2RSU A;  5JHA A;  4W9C A;  3ZQ4 A;  2W3R A;  3B08 A;  2M1M A;  2MBO A;  3VH3 B;  3N30 A;  2N9X A;  3ML8 A;  4ACF A;  2R2O A;  4CYE A;  2WLB A;  4KKJ A;  1QT9 A;  1QZE A;  2PW9 A;  3MHS D;  2NCN A;  2J53 A;  3NVW A;  1UWX A;  4MGI E;  1HQR D;  2J52 A;  2PVO D;  3AE5 B;  1TKG A;  3TEW A;  1D4B A;  5FKA C;  1AYF A;  4L23 A;  2L52 A;  1K52 A;  1V97 A;  1JWS D;  2J42 A;  4A3O A;  3I63 C;  1MI0 A;  1MJD A;  2H88 B;  3GOE A;  1S1Q B;  2K8C A;  2NPT B;  1ZXI A;  4BVU C;  3NVY A;  1AW7 A;  4FAD A;  2IO2 B;  3CWI A;  3C0R B;  5CHW A;  2INN E;  1UZX B;  1EU3 A;  4CO7 A;  1L7Y A;  3FKY A;  5E6P A;  1CJE A;  4UDU C;  5BMH A;  1SE9 A;  1EUV B;  3URY A;  4CHK A;  3V61 A;  4M0W A;  1X1M A;  4WH4 A;  4NQK E;  3APD A;  2KJR A;  2ZPN A;  4LNO A;  2CR5 A;  2CHX A;  4HK2 A;  2WXI A;  3RZW C;  1IPG A;  1GC6 A;  2D07 B;  4II2 B;  1OTR B;  3AB5 A;  1SB3 C;  2O6V B;  2QMT A;  3DCG A;  2KQ7 A;  3V62 A;  1YQ3 B;  2OHF A;  3L17 A;  2L05 A;  5BO4 B;  2M0X A;  1E8Y A;  3RUI B;  5TR5 A;  3L54 A;  1TIF A;  3RNC C;  1YQB A;  4XGA B;  3BWU D;  3SFE B;  4LDT D;  2IGH A;  2IO3 B;  1WXM A;  1FCC C;  1P98 A;  1E90 A;  2FID A;  3ONS A;  3UI3 A;  1D6E C;  2MLB A;  1RWS A;  5GMV A;  5IKC M;  2LVO A;  5H92 C;  4GDL A;  4REZ A;  5IA7 A;  4IKG A;  2LUE A;  3VTV A;  2PVG C;  2D11 A;  3I5J C;  3EEC A;  4XDD A;  4GDK B;  3FIL A;  1I35 A;  2IZV B;  2M8S A;  2KOX A;  1EU4 A;  3ECI A;  4TQ0 A;  2N9P C;  3P4P B;  4ZDV A;  5LXI B;  2IPK D;  2GRI A;  3VUW A;  2LXC A;  4AWJ A;  1L6U A;  3IBE A;  4KSL C;  1T5X D;  4KX6 B;  2KDB A;  3SU8 X;  3PRZ A;  4B95 A;  1WZ0 A;  2XBB C;  3VDZ A;  1YJ1 A;  2DAJ A;  5DPS A;  4RF1 A;  4ANU A;  2KTR B;  4IWP A;  3VUX A;  2PE9 A;  2W55 A;  5HI1 A;  1FFV A;  3IAM 1;  4M0W B;  5G5H A;  1TKY A;  1FEH A;  2WXF A;  2H89 B;  1J7C A;  3LXF A;  3B0A A;  3MC9 A;  3RYT A;  2V4I B;  1TS5 A;  1L6V A;  4RCO A;  1QOB A;  1XD3 B;  2SEB D;  4DXF A;  2WU5 B;  1HZ5 A;  4NZL B;  2BB6 A;  3T3O A;  2V1Y A;  2WXN A;  3SDL C;  2IY1 B;  2ZJD A;  3R2I A;  4G11 A;  2K5P A;  1E9M A;  1HTQ A;  2BPS A;  2MP2 A;  2BYE A;  3ZJU A;  1GB1 A;  3QAQ A;  3M95 A;  1F0Z A;  4NAM A;  4GDL B;  1MHH E;  2MBB B;  1WR1 A;  1XLP A;  1F2R C;  3OJ4 B;  1GJZ A;  5EE1 A;  1WRD B;  4URK A;  4GN1 A;  4OHJ A;  1FNV A;  1ZDV A;  4MGK E;  2ZVN A;  4F1S A;  2N1W A;  3BVZ A;  4XDC A;  3AU4 A;  4WAF A;  2E6X A;  1E5W A;  3NZU A;  2IO0 B;  4MEL A;  4HKQ A;  1SGH A;  1TT5 B;  3JW0 X;  1FRD A;  3PHX B;  3UIN B;  1WM2 A;  1K51 A;  3BY4 B;  1T0R C;  3O13 A;  4DHZ E;  2IJ0 A;  3VTW A;  1L4Z B;  2GB1 A;  3RNA C;  4EZL A;  2N7D A;  1TS3 A;  2NPT A;  3J9C A;  3EC8 A;  2FCM A;  3PZD A;  2PE6 B;  1IGD A;  2KX0 A;  3ZNH B;  5L83 A;  2E3T A;  2GI9 A;  3KYC D;  3AM9 A;  4WJQ A;  5EE3 A;  5BYR A;  3IT6 B;  2QC8 A;  2PEA A;  1TY2 A;  1WXA A;  3MC0 B;  1UBQ A;  1ZGU B;  1WRI A;  5LXH A;  1TYG B;  2CJO A;  2LJI A;  3VUY A;  1A5R A;  3HVZ A;  1YN4 A;  2WX1 A;  4XX5 A;  2BB5 A;  2ZCC A;  2NS5 A;  2ONQ A;  2V3S A;  2G45 B;  4JGH B;  2VRR B;  3C19 A;  4X57 B;  4FN2 A;  4YWG G;  2M56 B;  1OQR A;  2DWQ A;  1NYR A;  4EEW A;  2Y3A A;  2YEP B;  4IW0 A;  4GMV A;  2LHD A;  4AJY B;  3NS1 A;  4EZK A;  2INC C;  4OW0 A;  5J17 A;  1WFY A;  3PT2 B;  5FR6 A;  2BGF A;  1WWT A;  1ZXH A;  2MJ3 A;  1QOG A;  1TBE A;  2QEJ C;  1U4A A;  1P7E A;  4JWU C;  4A8X C;  3X23 A;  4ARC A;  4JQW C;  2BKR B;  2HE7 A;  5BMG A;  2BWF A;  4DXG A;  3OLM D;  2Q5W D;  3AV8 A;  1L0V B;  3ZJT A;  1V1P B;  1RYJ A;  3FC4 A;  3QAR A;  4WQO B;  2MCN B;  1RM6 C;  3AE7 B;  5KHO A;  1UF0 A;  1IUE A;  4WWO A;  3ZYY X;  2LAS A;  3C8Y A;  3ZNI D;  1UD7 A;  5LNK 1;  2O6V D;  5G2N A;  1EWC A;  3HM3 A;  1EO6 A;  2NTT A;  4EUT A;  3Q3F A;  4I6L B;  4FBJ B;  2JQR B;  1HA5 A;  2MH7 A;  2V3N A;  1JWM D;  1SIJ A;  3PS6 A;  3DHI C;  1GAQ B;  2OJR A;  3A9K A;  2EMS A;  1FFU A;  2WP9 B;  2D10 A;  3RFZ B;  1TZ1 A;  2LGI A;  3UGB B;  1L5P A;  2QCZ A;  4YL8 A;  1P3Q U;  1FXI A;  1IBX A;  1Z5S B;  3BYT B;  3VVW B;  5LLI A;  5BMI A;  3W1Y A;  5D2M B;  4LJO B;  3AE4 B;  2ZCB A;  2LVQ A;  1E0Z A;  3A33 B;  2V3P A;  3BZD B;  3A1Q A;  1V86 A;  3Q14 C;  1ZDX A;  1DOI A;  4A55 A;  4S0R A;  2MBQ A;  2VH2 A;  2WDR B;  1E7U A;  1P1A A;  3TEX A;  1QLB B;  3S2A A;  4HRO A;  2GBM A;  4JE3 B;  3N3K B;  4LCD E;  3UQA A;  3W1S C;  2JY6 A;  2LHE A;  4N9F 4;  3AE9 B;  2C7N B;  4ZRK A;  2INP E;  3ZTD A;  4IOI E;  1UEL A;  4WIP A;  3KH0 A;  3Q3M C;  1ZKH A;  3PV1 A;  1K53 A;  3P4R B;  3TSS A;  3VQI A;  5J2R A;  3SHQ A;  1PGA A;  2REX A;  4RFB A;  1FXA A;  1PUT A;  3EUB 2;  3NVV A;  2FIF A;  3IT4 B;  4M02 A;  2LVP A;  4MGY E;  2L76 A;  2V4L A;  5TSS A;  2CHZ A;  1SE3 A;  2CS4 A;  2FUG 1;  4MT5 A;  4K3B A;  2BTE A;  4IM2 A;  2L1A A;  3NJT A;  5JZE B;  1N60 A;  3A4R A;  1YN5 A;  4E3C A;  2KFJ A;  1VRA B;  2KTR A;  4MGZ E;  3KUZ A;  4HCP B;  1E7P B;  2AEH A;  2I38 A;  1V81 A;  3PLV A;  3AE2 B;  2KT7 A;  2YEP F;  2IDY A;  3AED B;  2KC1 A;  2V0G A;  1WXV A;  2VZK D;  2C5L C; 
#chains in the Genus database with same CATH homology
 2MRP A;  3V6C B;  2MX2 A;  3Q3J A;  2EMT A;  2IO3 B;  4LDT D;  1WXM A;  4IWQ A;  4FJY A;  4E71 A;  5JH5 C;  5D6J B;  1AAR A;  2N7E A;  3CST A;  1GNU A;  1S3S G;  3L08 A;  1P98 A;  3QIJ A;  2IY0 B;  1E90 A;  2NBV B;  2FID A;  4WJO A;  4FLH A;  3ONS A;  1PQS A;  3AUL A;  3UF8 A;  1KJT A;  2MLB A;  5CX3 A;  2MP2 B;  1CMX B;  1WYW B;  4MSQ B;  2C7H A;  2Z0D B;  2KVR A;  4XZ4 A;  5GMV A;  3WA0 A;  3IVF A;  1H8C A;  4MEM A;  4RM8 A;  4NPN A;  3VXW A;  2LVO A;  4BOS C;  2FCQ A;  1RFA A;  2RD0 A;  4GDL A;  5IA7 A;  5IAA C;  4NAW A;  2LUE A;  4WWP A;  3VAW A;  3VTV A;  1GG3 A;  2IBI B;  2D11 A;  2O2V A;  2LWP A;  2L00 B;  2K39 A;  3EEC A;  3PTF C;  5CHF A;  4DK5 A;  4GDK B;  2KD0 A;  1I35 A;  4HPM B;  2IZV B;  1P9D U;  3QK0 A;  2M8S A;  1UH6 A;  2KOX A;  1E8X A;  4DHZ B;  3ECI A;  4HXD A;  2ASQ A;  4KVG B;  4TQ0 A;  2N9P C;  2J0M A;  4ZDV A;  5LXI B;  2MSE D;  3PSE B;  2KZR A;  5AZG A;  1FXT B;  3PPA A;  2FCN A;  2UWQ A;  2ZVO A;  3VUW A;  2LXC A;  2J0J A;  2QHO A;  4GIV A;  3EHV A;  1WH3 A;  2G4S A;  2KWC A;  3IBE A;  4AWJ A;  2L0T A;  2KXJ A;  1WGR A;  4KSL C;  4KV2 A;  1D3Z A;  3DBH I;  3SU8 X;  2KDB A;  4ICU A;  3PRZ A;  2A5U A;  4B95 A;  2GBR A;  1WZ0 A;  2XBB C;  3VDZ A;  3WAM A;  1YJ1 A;  2DAJ A;  3PLU A;  2K8B A;  5DPS A;  2J0K A;  4HPL B;  1V2Y A;  2C7M B;  4ANU A;  2LGY A;  2KTR B;  2LGX A;  4IWP A;  2BKF A;  2PE9 A;  3VUX A;  3H7S A;  4GGQ A;  3ZRF A;  1WJ4 A;  4M0W B;  2JRH A;  5CHV C;  4ZYN A;  4PS8 A;  4IG7 B;  3RYT A;  3B0A A;  3R7Q A;  3TIX A;  3UIO B;  5E6O A;  2CU1 A;  4GXB A;  1R4N I;  2Y5B B;  2GBK A;  4ASW C;  3APF A;  1XD3 B;  2AWT A;  3RT3 B;  1WGD A;  3EFU A;  2KMA A;  4ICV A;  3LJ3 A;  1YX6 B;  1J19 A;  3CMM B;  1V80 A;  3HK0 A;  1NI2 A;  5EDS A;  2UYZ B;  2AYO B;  4K1R B;  2KKC A;  1WY8 A;  1WJN A;  5CTR C;  3H1U A;  1WX8 A;  4GSW A;  4W9K A;  5G55 A;  2V1Y A;  3ZNZ B;  5HKH A;  2ZZP B;  3SDL C;  2DHZ A;  2IY1 B;  2ZJD A;  3CSF A;  3K9P B;  3PRM B;  4G11 A;  4WJP A;  4PYZ A;  1HE8 A;  2ZNV B;  3PHW B;  2BPS A;  1LM8 B;  2MP2 A;  2BYE A;  5C1Z A;  4PYU A;  3AXC A;  3QAQ A;  3TBL D;  3M95 A;  3ZIM A;  3RZF A;  3DOW A;  4GDL B;  4OVU A;  1TGZ B;  3U7D A;  2MBB B;  1WR1 A;  4EFO A;  2LZ6 A;  3OJ4 B;  1GJZ A;  4W9E A;  3IFW B;  4DDG D;  2NVU I;  2WWZ A;  1WRD B;  5AEK B;  4ZRJ A;  1EF1 A;  3JVZ X;  3R3M A;  4URK A;  3KUC B;  4GN1 A;  4NY0 A;  4TKN A;  2KC2 A;  4MGK E;  2LGD A;  2ZVN A;  4F1S A;  1RLF A;  2N1W A;  2FAZ A;  2N1V A;  3PRE A;  5DPT A;  3DBS A;  4AOF A;  2GBN A;  1EF5 A;  3AU4 A;  3LDZ E;  1E5W A;  3NZU A;  3QA8 A;  2IO0 B;  4W9L A;  3AI5 A;  2I1K A;  3ZRC A;  4MEL A;  4GB9 A;  1RAX A;  2KN5 A;  1KOT A;  3A9J A;  2L7R A;  1SGH A;  3GZN I;  2CHW A;  4PS7 A;  3JW0 X;  3JYU A;  1WMH A;  3PHX B;  1Q1O A;  4GU2 A;  3UIN B;  1WM2 A;  4HWI B;  3A1Q B;  1Z2M A;  1NBF C;  3BY4 B;  4EZJ A;  4DHZ E;  1WI0 A;  3MTN B;  3H7P A;  4WWN A;  1LXD A;  2AL3 A;  2LJ5 A;  3VTW A;  3H7P B;  5KHQ A;  2DAF A;  2O2V B;  1IYF A;  4EZL A;  2N7D A;  4A3P A;  2CKH B;  3O65 B;  4ANX A;  2NPT A;  2MA9 B;  2FCM A;  3EC8 A;  4I6P A;  2KK8 A;  3PZD A;  4NJ6 A;  2PE6 B;  4BKT A;  2KX0 A;  3A9J B;  1V5T A;  4GDK A;  2KDF B;  4W9I A;  2WDT B;  3ZNH B;  5L83 A;  2JT4 B;  2LXA A;  1GC7 A;  3ZO5 B;  5AZH A;  1VD2 A;  3I3T B;  3KYC D;  2MW5 A;  4KDI C;  4WJQ A;  3RCZ A;  1WF9 A;  1J0G A;  2KDI A;  4G3X B;  1OEY J;  4NAW B;  2PEA A;  1WXA A;  2OOB B;  3KUD B;  4IUM B;  1UBQ A;  2C60 A;  2DX5 B;  2YLM A;  4JIO U;  1WZ3 A;  1ZGU B;  2RPQ A;  3DVG X;  3VFK A;  3QHT A;  3M62 B;  5LXH A;  4MJS B;  3PRP B;  2NR2 A;  2G4D B;  2KMC A;  3DBR I;  4HCN B;  3VUY A;  1A5R A;  1T0Y A;  3WAO A;  2D2Q A;  1BT0 A;  2WX1 A;  3L13 A;  3ML9 A;  2PJH A;  3L16 A;  4XX5 A;  5E6N A;  3U30 A;  3QX1 A;  4II3 B;  1YX5 B;  3M3J A;  2GMI C;  3V6E B;  4FHJ A;  2ZCC A;  4NQL B;  2NS5 A;  3DVN U;  2D3G A;  4DXA B;  2L0F A;  2XK5 A;  3TMP B;  4RM9 A;  2V3S A;  2G45 B;  2LRW A;  2VRR B;  4JGH B;  4X57 B;  1Q0W B;  4F7Z A;  4FN2 A;  2BYV E;  2LD9 A;  2I1J A;  4KDL B;  1WGH A;  1MG8 A;  4ANW A;  4W9F A;  4EEW A;  3APC A;  3D32 A;  2KNB A;  4IWO A;  2KFK A;  4IW0 A;  3MJW A;  2PPH A;  4GMV A;  4AJY B;  2L8J A;  3DQV A;  1WR6 E;  3HM6 X;  2KWU B;  4KZ0 A;  2JPH A;  4BBN C;  1R4M I;  4EZK A;  5J17 A;  1YD8 U;  2JWZ A;  3P2B A;  1WFY A;  3PT2 B;  5FR6 A;  2BGF A;  2RGF A;  4HDO A;  1WE7 A;  1TBE A;  2KDE B;  2KJH B;  2J7Q B;  3HHM A;  1U4A A;  2KO3 A;  3JSV B;  2Z0E B;  1V49 A;  1WJU A;  4FJV B;  5DPW A;  2M17 A;  1XQQ A;  1JRU A;  2N4F A;  2JZ3 B;  4BFR A;  4HLE A;  1WMH B;  3X23 A;  2IYD B;  4JQW C;  2R2Q A;  4JLC A;  1V5O A;  2BKR B;  1IP9 A;  2HE7 A;  3VTU A;  1WM3 A;  2MWS B;  4B9K A;  3H6N A;  2BWF A;  3N32 A;  2KX3 A;  4FA6 A;  4DWF A;  2A4Z A;  3OLM D;  3ZVV A;  2WX0 A;  3JSV A;  2FUH B;  4K7S A;  2ZPY A;  3R7R A;  4BKS A;  4K7U A;  3QQ8 B;  2JF5 A;  4M8N A;  2ZNV C;  1NDD A;  3QAR A;  1P0R A;  2NBU A;  2KWV B;  4K7W A;  3A4S C;  2K6D B;  4WQO B;  4KIK A;  2MCN B;  4W9D A;  4BKS D;  4IM0 A;  2N9E B;  5KHO A;  3ZUN A;  4ZRI A;  4MM3 A;  2DEN B;  2GBJ A;  2K1F A;  2XEW A;  3DDC B;  4G50 A;  4LJP B;  4WWO A;  2Z59 B;  2LAS A;  1E8W A;  4MJS A;  4G0N B;  4F8C B;  2KJ6 A;  2K8H A;  3ZTC A;  2HTH A;  1WIA A;  3PVL A;  1C3T A;  4HVB A;  3ZNI D;  1UBI A;  1XT9 B;  2K6Q A;  3TJP A;  5D94 A;  1OQY A;  1UD7 A;  1WX7 A;  2BWE S;  2DYO A;  2HD5 B;  2K25 A;  3ENE A;  3T8M A;  2MBE A;  1K8R B;  4M8M A;  4DBG A;  2DZJ A;  2O6V D;  1VCB A;  5G2N A;  1J8C A;  1WJ6 A;  2JXX A;  4FUL A;  3AU5 A;  3VHT C;  3HM3 A;  4TQ1 A;  3ZNG C;  4W9G A;  1EO6 A;  1Y8R C;  2DZM A;  4KIK B;  3ZW3 A;  4W9H A;  1F9J A;  2EKE C;  2JVC A;  3Q3F A;  4I6L B;  4FHK A;  3TL5 A;  4EUT A;  4FBJ B;  1H4R A;  3QJZ A;  1RRB A;  3KVF B;  3KW5 B;  3QC8 B;  3WAP A;  5C23 A;  4EKU A;  4W9J A;  3PS6 A;  2BYF A;  5AZF A;  4NJ7 A;  2MQJ A;  3IG3 A;  2O6V A;  3ZLZ A;  3T9L A;  4WAA A;  3SD5 A;  3NZS A;  2OJR A;  3KYD D;  3W1S A;  4HDQ A;  3H9D A;  3A9K A;  2EMS A;  1UGM A;  4DHJ D;  4KZC A;  2D10 A;  4AP4 C;  4AJW A;  1TZ1 A;  2ZEQ A;  4BKG A;  3UGB B;  1C1Y B;  5J18 A;  3ZDT A;  1TTN A;  3NY5 A;  5DCN A;  3RUL A;  3WIM A;  4B6W A;  5L95 C;  1LFD A;  4YL8 A;  1P3Q U;  3L10 B;  3PGE A;  2W9N A;  3NS8 A;  2DZK A;  5D7G A;  4OVV A;  4A20 A;  2KTF A;  1Z5S B;  1G6J A;  3VVW B;  1WX9 A;  1LQB A;  1V9J A;  3U8Z A;  1YIW A;  5LLI A;  2FNJ B;  2YVC A;  4WJN A;  3W1Y A;  4BOZ B;  1L2N A;  2WYQ A;  4MSM B;  5D2M B;  4DDI D;  2NBW B;  4LJO B;  3WAN A;  2LRU A;  4E74 A;  3QCA A;  3L0W B;  3RD2 A;  4ANV A;  2ZCB A;  4HJK A;  2KAN A;  1M94 A;  2KLG A;  2RSU A;  3K9O B;  4RMA A;  2M4N A;  3UIP B;  2LVQ A;  4W9C A;  5JHA A;  3A33 B;  2MBH A;  4GOC A;  1WGY A;  3BIN A;  4DHJ B;  1ZW7 A;  3A1Q A;  1V86 A;  2B3A A;  2DYM A;  3B08 A;  2G3Q B;  4NNJ B;  2M1M A;  2MBQ A;  3TCA A;  4P7I A;  2MBO A;  3VH3 B;  1I42 A;  2AL6 A;  1E7U A;  1P1A A;  3N30 A;  2N9X A;  2KFK B;  3ML8 A;  2RR9 A;  1WXS A;  2R2O A;  2XK5 B;  4CYE A;  1E8Z A;  1QZE A;  3S2A A;  3X0W A;  2GBM A;  2L3Z A;  2NCN A;  2C9W B;  2IO1 B;  3MHS D;  1OEY A;  3N3K B;  4MGI E;  4LCD E;  3UQA A;  3W1S C;  2JY6 A;  4N9F 4;  1ISN A;  2C7N B;  2KQS A;  3B1L X;  4ZRK A;  3ZTD A;  4FJZ A;  4MDK E;  4A3O A;  1UEL A;  5DPR A;  2LI5 A;  3V60 A;  3GOE A;  4XC2 A;  1WGG A;  1S1Q B;  3KH0 A;  2K8C A;  2NPT B;  3CF6 E;  3M63 B;  4BVU C;  1ZKH A;  2GOW A;  3ALB A;  4FAD A;  3PV1 A;  2IO2 B;  3C0R B;  5CHW A;  2KHW B;  1V6E A;  3VQI A;  4IM3 A;  1SIF A;  1UZX B;  3OJ3 A;  5J2R A;  3SHQ A;  4TUU A;  3DVG Y;  3DVN V;  4CO7 A;  3WAL A;  1KLV A;  2REX A;  3ZKJ C;  1L7Y A;  3R66 C;  5E6P A;  3OAW A;  4PS3 A;  2JRI B;  1SE9 A;  1EUV B;  4CHK A;  2FIF A;  3DPD A;  3V61 A;  1X1M A;  2LVP A;  4KSK C;  2JZZ A;  4MH0 E;  3APD A;  2KJR A;  4MGY E;  4NQK E;  4BBN F;  2L76 A;  2V4L A;  2ZPN A;  2CHZ A;  2HJ8 A;  2CR5 A;  2CS4 A;  2KLC A;  3NHE B;  4LDT B;  3QWZ B;  2CHX A;  4HK2 A;  3RZW C;  2DYB A;  3UQB A;  3A9K B;  1IPG A;  4IM2 A;  1GC6 A;  2D07 B;  4II2 B;  4AUQ C;  5JZE B;  3A4R A;  1KM7 A;  3DBL I;  4JL9 A;  1OTR B;  2FCS A;  4E3C A;  2O6V B;  5JHB A;  3DCG A;  2KFJ A;  2KQ7 A;  4J6I A;  4TV3 A;  3V62 A;  1GUA B;  4I6N B;  2KTR A;  1Q5W B;  2DZI A;  4MGZ E;  3KUZ A;  3L17 A;  2L05 A;  4HCP B;  4K81 A;  5BO4 B;  2M0X A;  3IHP C;  2AEH A;  1E8Y A;  3HIZ A;  3RUI B;  2BF8 B;  1V81 A;  3PLV A;  4IC7 B;  5TR5 A;  1WE6 A;  3ZDM C;  3L54 A;  2JUO A;  1OGW A;  2KC1 A;  4EOY A;  1E7V A;  1YQB A;  1WXV A;  3VH4 B;  2C5L C;  3NOB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...