3RD2A

Nip45 sumo-like domain 2
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
82
structure length
82
Chain Sequence
MHHHHHHSQQLQLRVQGKEKHQTLEVSLSRDSPLKTLMSHYEEAMGLSGRKLSFFFDGTKLSGRELPADLGMESGDLIEVWG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title DNA repair and global sumoylation are regulated by distinct Ubc9 noncovalent complexes.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription
molecule keywords NFATC2-interacting protein
total genus 16
structure length 82
sequence length 82
ec nomenclature
pdb deposition date 2011-03-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF11976 Rad60-SLD Ubiquitin-2 like Rad60 SUMO-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 3rd2A00
3ZW3A 2KK8A 4EZJA 3S2AA 1YX6B 4ZRKA 3ZLZA 1WI0A 1OEYA 3DDCB 4AP4C 1GG3A 4ZRIA 2JRIB 2GBRA 1E8WA 3A9JA 4MH0E 2ZZPB 4W9HA 4ASWC 1WM2A 3LJ3A 4MM3A 3UIOB 1J8CA 3ZKJC 1NBFC 3WANA 2KDIA 2LRWA 1V9JA 2LVOA 1UH6A 2L7RA 3OJ3A 2KWUB 2MBEA 2Z0DB 2VRRB 3H7PA 3KUZA 3PHWB 4GSWA 5KHOA 4DBGA 2GBJA 2N7DA 4P7IA 3L13A 1WF9A 2M17A 4HLEA 4A3PA 1WY8A 2KC1A 2ZCBA 4LJPB 4W9CA 1PQSA 2O6VA 2GOWA 2ZVOA 2G4DB 3B0AA 4K7SA 4B95A 4FULA 4ANUA 2GBNA 2Z59B 1YJ1A 3A33B 2KOXA 3X0WA 4ANXA 2C7NB 4HPMB 2ZJDA 4PYZA 3KH0A 4K7WA 2FCQA 4MSQB 1E5WA 1Z2MA 4II2B 2N1WA 1IPGA 3PRPB 2ZNVB 2MBBB 5IA7A 2FCSA 3H9DA 3HK0A 2IO1B 2D07B 4EOYA 3ECIA 4F1SA 4HCPB 3WAPA 3T9LA 3HHMA 4GXBA 2KJRA 4HDQA 4BOSC 1WJ4A 4EZKA 1MG8A 4ZRJA 2DAFA 4JLCA 4LDTD 5DPTA 5KHQA 3MTNB 3CMMB 2MP2B 4HVBA 2V4LA 3ML8A 5JH5C 4MEMA 5DPSA 2RGFA 1WGHA 3ZRFA 5G55A 4IWQA 5E6OA 1YX5B 1V81A 3RZWC 2KFKA 3RD2A 4I6LB 2ZVNA 2AWTA 4MELA 2IY1B 3DBLI 2LJ5A 3M63B 3PHXB 2FUHB 4IM3A 4DHZE 3T8MA 3QX1A 3L54A 2R2QA 2YVCA 4IWOA 3PZDA 2ZPYA 3ZTCA 1WGGA 3DVGY 2AYOB 3DPDA 2M0XA 2KMAA 3IBEA 3AULA 2K8BA 5J17A 2IYDB 3APFA 4PS3A 1UBIA 3ZNZB 5LLIA 3SHQA 1U4AA 4KIKA 1P98A 5EDSA 1X1MA 3VVWB 4E71A 1AARA 2KC2A 3APCA 4FJZA 2C7HA 3RZFA 5L83A 2BYEA 2MBQA 2WX0A 3VH3B 1WX9A 4MJSA 3RYTA 5DPWA 1L7YA 4DHZB 3NZUA 4IWPA 2D3GA 3NOBA 2ASQA 2FIFA 2B3AA 1WX8A 1C3TA 2JVCA 2K39A 5C1ZA 2PE9A 2EMSA 2L00B 3H7SA 4GDKB 4E74A 3W1SA 5HKHA 2C60A 4YL8A 4MGZE 1TBEA 4TQ0A 3L16A 2G3QB 2G45B 4HJKA 4PS8A 2XEWA 3DBSA 3KUCB 4W9GA 3PLVA 3SU8X 4GOCA 4BOZB 1I42A 3U8ZA 2L76A 1M94A 2KTRA 4W9LA 1WE6A 2QHOA 3B1LX 4BKGA 4GDKA 4I6NB 3ONSA 3TIXA 3RCZA 2LWPA 2KFKB 3AU5A 1E8YA 4EFOA 1OEYJ 1WMHB 2FAZA 1LM8B 5CX3A 2O6VD 1WH3A 3DVGX 2HTHA 4LDTB 3NHEB 3VH4B 1E8XA 1E8ZA 4TUUA 4GB9A 3NS8A 3RULA 3QJZA 2KVRA 2KZRA 3WA0A 2J0KA 2FCMA 4WJNA 2PJHA 3HM6X 4KZ0A 2KJHB 2BF8B 4KSKC 4M8NA 2BKFA 3PS6A 4FN2A 1UZXB 1V2YA 1V80A 2JZ3B 4IW0A 2KD0A 1WFYA 3KUDB 1WJ6A 2NPTB 3V6CB 4PYUA 2NCNA 1S1QB 4K7UA 3EHVA 2JRHA 3OLMD 1GC6A 2KX3A 1TZ1A 3V62A 1LXDA 4BFRA 1NI2A 5CHWA 2K1FA 1D3ZA 4N9F4 4WWNA 2DZKA 1E90A 2JT4B 3NY5A 1NDDA 3DVNU 3ZUNA 4WWPA 3ZIMA 2PEAA 4JL9A 2HE7A 3AI5A 3QK0A 4WQOB 2MQJA 1WRDB 1YD8U 2LVPA 2DZIA 2NVUI 3TMPB 2NBWB 4W9KA 2KX0A 4IC7B 2EKEC 3PPAA 4AOFA 4MSMB 2UYZB 4IM2A 2K8HA 3H7PB 2C5LC 3QA8A 3QIJA 2N9EB 3SD5A 3H6NA 1WZ3A 1UELA 1OGWA 2KLCA 5LXIB 4K81A 3A9KA 2HD5B 4WJPA 2NR2A 2KANA 2N9PC 2LGYA 1CMXB 2K25A 3BINA 4RMAA 4IUMB 4WAAA 2IO2B 2V1YA 4BKSD 2M4NA 3QQ8B 2DAJA 2ZCCA 1YIWA 4B6WA 1QZEA 4AUQC 1P0RA 4FA6A 2WYQA 2LGDA 2ZNVC 4W9FA 2CHXA 3KYCD 4NQLB 3D32A 2BKRB 4ZDVA 4ICUA 4OVVA 3ZNGC 4G11A 3W1YA 1Q0WB 2CHZA 2IZVB 4FJYA 3R3MA 1BT0A 3UGBB 3ZNHB 2L0FA 2KO3A 2DENB 2D11A 2J7QB 5JZEB 1T0YA 1ZGUB 3DBRI 4KDLB 4KIKB 4FJVB 4I6PA 5CTRC 3SDLC 3UF8A 3IFWB 1WGDA 2DYOA 2ZEQA 4G0NB 3CF6E 3CSFA 3PLUA 4KZCA 4NJ6A 2D2QA 5FR6A 1KLVA 2EMTA 2BWES 2JUOA 4W9IA 4RM8A 3VAWA 1GUAB 1LQBA 3EECA 3ZVVA 1V49A 1R4NI 2JY6A 2YLMA 3PTFC 2LVQA 1WMHA 4A20A 5E6PA 3ZDTA 1EF1A 2MA9B 2Z0EB 4BVUC 3PT2B 2K8CA 5LXHA 3MJWA 3ZNID 3M3JA 4CYEA 3A9KB 2XK5B 3PV1A 4JQWC 3VXWA 4AJYB 2RPQA 5C23A 2KFJA 3R66C 3R7QA 2IO0B 2BYVE 3EC8A 5G2NA 3TL5A 4GDLA 3UIPB 4BKTA 1V6EA 4MGIE 4MDKE 2O2VA 5D2MB 5D6JB 4JGHB 2WWZA 3AXCA 3O65B 3TBLD 3UQBA 3VDZA 1F9JA 2GBMA 2RSUA 3IVFA 2IY0B 4G3XB 2LXCA 3EFUA 5BO4B 4WWOA 1P3QU 2K6QA 2MRPA 1GNUA 2GMIC 3AU4A 4MJSB 2G4SA 4XX5A 3QC8B 3QARA 3PVLA 2LUEA 2CS4A 4NNJB 1WZ0A 3MHSD 3L17A 2M1MA 1VD2A 1ZW7A 1JRUA 3DBHI 3KYDD 4HDOA 4ICVA 4TV3A 4AJWA 2KQ7A 1Q5WB 4NY0A 4NAWB 4GIVA 2MSED 3H1UA 3V6EB 4TQ1A 1IP9A 2JZZA 3K9PB 2CKHB 4W9EA 3ZTDA 1WE7A 2IO3B 2NPTA 3QWZB 2JF5A 1WGYA 1KM7A 3DCGA 4X57B 4FBJB 1E7VA 4KSLC 1UBQA 4FHKA 2LASA 4KV2A 4HCNB 2BWFA 4NQKE 5D94A 2C7MB 1LFDA 3JW0X 3LDZE 2CR5A 2KXJA 1R4MI 2D10A 1TTNA 2DZMA 4PS7A 4KDIC 2KWVB 1K8RB 3GZNI 2MLBA 3ALBA 2AL3A 1XD3B 2PPHA 4EZLA 3VHTC 2A4ZA 1RLFA 2O2VB 4HXDA 1WYWB 2MBHA 2N4FA 2FNJB 3DVNV 4FLHA 3VFKA 2FIDA 2DZJA 2NS5A 2V3SA 3KVFB 1WJNA 5DCNA 5D7GA 2XK5A 5E6NA 2MWSB 4BKSA 3NZSA 3N30A 1E7UA 4AWJA 4DK5A 4DHJD 2KDEB 3ZDMC 4ANVA 3OAWA 1V5TA 2JWZA 2WX1A 3WAOA 2NBVB 3DQVA 4B9KA 4URKA 2J0JA 3DOWA 1WR6E 1WXVA 2CU1A 1P9DU 4LJOB 3RUIB 4DDID 3N32A 5JHAA 3RT3B 2LGXA 5CHVC 4EKUA 2KWCA 3PREA 3VTWA 1WR1A 3ENEA 1UGMA 3V61A 1FXTB 2RD0A 3QAQA 4DXAB 4DWFA 4WJOA 3WIMA 2KNBA 3A1QB 3L0WB 2MX2A 3C0RB 3QCAA 1WGRA 4G50A 4BBNC 4J6IA 3JVZX 4M0WB 1WX7A 2BYFA 4HWIB 4NAWA 2DHZA 4NPNA 2N1VA 3V60A 4GN1A 2XBBC 2L05A 2MBOA 4KVGB 1KOTA 3K9OB 1V86A 2BGFA 1OQYA 1KJTA 3N3KB 4IG7B 4OVUA 4XC2A 4CHKA 2C9WB 3UQAA 2L0TA 2HJ8A 3HIZA 2O6VB 2OJRA 2R2OA 3A4RA 1EO6A 1EUVB 2I1JA 3TJPA 4EEWA 2FCNA 1H8CA 2M8SA 3Q3JA 1HE8A 2LD9A 2MP2A 1SGHA 2RR9A 4TKNA 3VTUA 2CHWA 4W9DA 1OTRB 2KN5A 1WXSA 2LRUA 2ZPNA 4GDLB 2LXAA 4A3OA 1GJZA 3M62B 4EUTA 5JHBA 3JSVA 4JIOU 3L08A 4RM9A 3PRZA 5TR5A 5J18A 1Y8RC 4NJ7A 1GC7A 5AEKB 2GBKA 3VUWA 1WXMA 3A4SC 4XZ4A 4F8CB 2JPHA 4K1RB 3M95A 1XQQA 1J0GA 2UWQA 2BPSA 4M8MA 1ISNA 2DYBA 3APDA 3TCAA 3BY4B 3VQIA 2DX5B 3P2BA 3R7RA 3JSVB 2KDBA 4FADA 1H4RA 1C1YB 1L2NA 2K6DB 4DHJB 2KKCA 3KW5B 2KDFB 3PRMB 3IG3A 5AZFA 1Q1OA 3JYUA 2AEHA 4LCDE 5DPRA 1S3SG 1WIAA 3ZRCA 1P1AA 3ZO5B 3L10B 1IYFA 4GMVA 3PSEB 3PGEA 2NBUA 2IBIB 3VUXA 1EF5A 4E3CA 1G6JA 4W9JA 3Q3FA 1WJUA 5L95C 2N9XA 4MGYE 2OOBB 2KMCA 2KTFA 3IHPC 3U7DA 1SE9A 2WDTB 4HK2A 2MW5A 1VCBA 3A9JB 4ANWA 3OJ4B 1ZKHA 1J19A 1WXAA 2KQSA 2KTRB 3CSTA 3ML9A 4MGKE 2LI5A 4GU2A 3HM3A 1TGZB 4WJQA 2MCNB 3WALA 1RFAA 2N7EA 2Y5BB 3WAMA 3X23A 2W9NA 5AZGA 3U30A 5J2RA 3VTVA 4GGQA 3GOEA 2JXXA 3UINB 4CO7A 3B08A 3A1QA 2KLGA 1UD7A 4IM0A 4ZYNA 5IAAC 2REXA 4HPLB 2J0MA 4DDGD 2L8JA 3VUYA 5CHFA 4BBNF 5AZHA 5GMVA 1I35A 2LZ6A 1WM3A 2PE6B 2KJ6A 4II3B 3QHTA 1XT9B 2DYMA 2L3ZA 1Z5SB 1V5OA 2A5UA 3I3TB 2AL6A 1A5RA 2I1KA 3W1SC 1RRBA 1YQBA 1SIFA 2KHWB 4FHJA 4F7ZA 1RAXA
chains in the Genus database with same CATH superfamily
3ZW3A 4NAMA 3ZLZA 1IGCA 1WI0A 1TY0A 4AP4C 4ZRIA 3DWGC 2GBRA 2QSDA 1V1PA 4MH0E 1OFFA 4W9HA 2WXGA 2LRWA 2LVOA 1V1PB 3OJ3A 1BUIC 2N7DA 3L13A 1WF9A 5IO9A 4HLEA 2UU7A 1WY8A 3AE7B 5AUIA 4YWGG 3VR8B 2GOWA 3B0AA 4K7SA 4B95A 3GB1A 4ANUA 2GBNA 1YJ1A 2W3SA 3A33B 3FAHA 1XCQL 3RN9C 4ANXA 3KH0A 2FCQA 4WURA 2D5GA 2IO1B 4EOYA 2ZW1A 4HCPB 4YSYB 1F52A 3WAPA 1YJIA 1WJ4A 5MPOA 3BK1A 4RF0A 1KTKA 1I4QA 3SFEB 1ZOYB 3BVZA 1F0ZA 2AWTA 4MELA 5BYSA 2FUHB 2JYEA 4IDIA 1F2RI 3QX1A 2L52A 3L54A 4ZRPA 1FNWA 1IBXB 3AE9B 5J17A 3TUOA 3ZNZB 5LLIA 2BBCA 5EDSA 4TSSA 4E71A 1QOFA 1YQ3B 5L83A 2MBQA 2M56B 3NOBA 1HQRD 2JVCA 5C1ZA 3H7SA 2BVCA 3W1SA 4YL8A 1TS3A 1VJKA 3ZXRA 2XEWA 5FR3A 2LEKA 1N5XA 1XXGA 1M94A 4W9LA 1NEKB 1WE6A 4BKGA 4GDKA 2BS3B 3O13A 3IT4B 2O6VD 1WH3A 4OZAA 1ZXHA 4L2YA 3WCQA 4TUUA 3QJZA 5JXVA 3MC9A 4XWWA 3WA0A 4S17A 1L0XB 1Q10A 2MEKA 4WJNA 5C2TB 2PJHA 1NVID 2BF8B 3AE2B 1V2YA 4IW0A 3EFCA 3KUDB 2ON8A 5FK9C 2E3TA 4WWNA 2ICIA 1NDDA 2IDYA 3ZUNA 3I63C 1E0ZA 4N6EB 1QOAA 1WRDB 2LVPA 2BW2A 1EM7A 2WNMA 1JRPA 4IM2A 4B0EA 1VZ8A 3C19A 2C5LC 3QA8A 3SD5A 3NVWA 3L4PA 5LXIB 4RGOS 2HD5B 4WJPA 1CMXB 4RMAA 2IO2B 2M4NA 2Z8LA 2ZCCA 1YIWA 1XCTL 4KGRA 2WYQA 2LGDA 4W9FA 4ACFA 3AEGB 3KYCD 2Q5WD 4OVVA 3ZNGC 1Q0WB 3R3MA 3UGBB 3P1MA 3GE3C 3MC8A 2D11A 2J7QB 3ETRA 2G9HD 3DBRI 1WGDA 2OJWA 3PLUA 2EMTA 1E9MA 4HROA 4RM8A 3VAWA 1JWBD 4L23A 1GUAB 1R4NI 2I38A 3P63A 5E6PA 1EF1A 2PW9A 5BMHA 3BYTB 4A6QA 3TEYA 3ZXVA 2XNAC 2B76B 1IBXA 3NG0A 2J52A 4PT5A 4AJYB 1SJHD 5C23A 1FCCC 3UIPB 4MDKE 5D2MB 3TBLD 1RM6C 2GBMA 3N1XC 1L6VA 1FRDA 5IP4D 2IY0B 1TJEA 3SR6A 2DWQA 2K6QA 4IKGA 3Q69A 1VLBA 2GMIC 1I7HA 2LUEA 3T3OA 1YJJA 2PVGC 1YQ4B 2M1MA 1HZ6A 1ZW7A 1JRUA 3KYDD 4ICVA 4TV3A 3NUHB 2WXMA 2MHJA 4NAWB 2JZZA 3K9PB 3AE5B 2NPTA 3QWZB 4B0MA 1WGYA 1E7VA 1ZDXA 1UBQA 2CU3A 2IPKD 5D94A 4HCNB 1SE2A 4YSZB 1VDVA 1WGKA 2KWVB 2H88B 1UWMA 1XD3B 1C4AA 4EZLA 3ZJUA 3VHTC 2A4ZA 2BTEA 3DVNV 3VFKA 2FIDA 2LJIA 3N30A 3IAM1 2WXQA 3OAWA 2INCC 4URKA 2CU1A 5JHAA 4EKUA 3EUB2 2LGSA 2KWCA 3RNBC 1B1ZA 3GE8C 4ITKA 1N61A 4WJOA 5FKAC 3A1QB 3MHZA 2WXLA 3C0RB 4BBNC 4O1NA 4J6IA 4XYCA 3JVZX 4M0WB 3AECB 3FKYA 2XBBC 2L05A 2MBOA 1YOVB 3K9OB 4USAA 4CHKA 4WH4A 3HIZA 3ZJVA 5TSSA 2R2OA 1P7EA 1YMHE 1H8CA 3Q3JA 2LD9A 4TKNA 2CHWA 1OTRB 2LXAA 1GJZA 1K51A 5HI1A 1UUPA 3L08A 1HEZE 5H8YE 2W55A 4F8CB 1XQQA 1BMLC 3BVMA 2WXNA 2KWDA 3ZQ4A 3TCAA 3BY4B 1L4ZB 2DX5B 3P2BA 3R7RA 2KDBA 1H4RA 1TIFA 3LYYA 2KKCA 5AZFA 2BT6A 1S3SG 3CWIA 4MH8A 3V05A 3ZO5B 4REZA 2IBIB 1EF5A 4CQNA 4E3CA 1ESFA 2GRIA 1AW7A 3P4RB 2N9XA 3GP7A 2OOBB 4P1BC 4JWUC 2KTFA 5I4DA 3OJ4B 3BYYB 1CK1A 1D6EC 1WXAA 2KMMA 3ML9A 1TGZB 1YNTE 1C4PA 1SXTA 3DHGC 3X23A 3GOEA 1L6UA 3B08A 4ZYNA 5IAAC 3ZJTA 2R61A 2K22A 2L8JA 2K0PA 1WM3A 3Q8EA 4MM3B 2L3ZA 1ZDVA 2I1KA 3W1SC 1YQBA 4FHJA 4F7ZA 3I57A 3S2AA 1WRIA 1OEYA 3AE3B 3W9CB 1HA5A 2JRIB 1DGJA 1E8WA 1HTQA 2L83A 4ASWC 2E6XA 1WM2A 1M4VA 4MM3A 2BB6A 1V9JA 4JX1C 2WQYB 2KWUB 2Z0DB 4DBGA 3U7ZA 1LGRA 2GBJA 2KC1A 1PGBA 1PQSA 2G4DB 3NVVA 1JROA 2C7NB 2L32A 2ZJDA 4RH6A 4HKQA 1SJED 2N1WA 5IA7A 3H9DA 4F1SA 1AN8A 2NTSA 3EA6A 3Q6BA 4BOSC 2K9XA 2X8XX 1MG8A 4LDTD 4JLCA 3P4SB 3FC4A 3MTNB 3E9SA 3ML8A 4MEMA 1XLNA 1CQVA 2PVOD 3ZRFA 4IWQA 1YX5B 1R7SA 4KKJA 2KFKA 4IOIE 4I6LB 2ZVNA 3U52E 2IY1B 3DBLI 3M63B 4IM3A 3T8MA 4IWOA 2ZPYA 2JYTA 1WGGA 3DVGY 1MPEA 4HJGE 3APFA 4PS3A 1KLUD 1FIQA 1KRHA 3RI7C 1X1MA 3VVWB 4FJZA 1RWSA 2WXRA 5IKCM 2WX0A 1WX9A 3RYTA 4XE0A 3NZUA 1JALA 3MP9A 1C3TA 1WX8A 2K39A 1WSPA 2C60A 3L16A 1FXIA 2G3QB 4BZAA 4PS8A 1ZPSA 4W9GA 4GOCA 1J7CA 1N63A 3ONSA 4ZOHC 1ROEA 2V3NA 4EFOA 1OEYJ 1WMHB 2JU6X 2FAZA 5CX3A 3BVGA 3BK2A 2LGIA 4LDTB 3ZYYX 5IOIA 3NS8A 1ACCA 1MJDA 2KVRA 4KSKC 4M8NA 2INPE 1V80A 1WFYA 2WGSA 2NPTB 1T0SC 5HFYA 1JWAD 1S1QB 2FBWB 2KX3A 3V62A 1TZ1A 1LXDA 2K1FA 4JPSA 4N9F4 2DZKA 2JT4B 3ZIMA 4US9A 3U4EG 3VR9B 1YD8U 2NBWB 2KX0A 1I4RA 4AOFA 2K8HA 3H7PB 3QIJA 1F2RC 1WZ3A 3BIID 3Q8AA 2KLCA 3RNGC 2NR2A 2N9PC 4RGMA 2LGYA 2K25A 4RGNA 1B9RA 4MACA 3QQ8B 3Q2AC 4BKSD 4PK1A 4AUQC 1P0RA 1VR9A 4WWMA 2ZNVC 4RGTA 3PO0A 4NQLB 4ICUA 1DOYA 1MHHE 2PKOA 1TKEA 4G11A 3U2SC 1SE3A 2DENB 1T0YA 1SBBB 3KWLA 4KDLB 1YN5A 4FJVB 4KIKB 3SDLC 3IFWB 2ZEQA 4NJ6A 4KZCA 4G0NB 2KN4A 1TZOA 3TEWA 4W9IA 3Q8FA 1LQBA 4OHJA 3PTFC 4A20A 4J3OD 3ZDTA 2DBYA 3PT2B 1LO5D 4JQWC 3VXWA 2RPQA 3R66C 2LHEA 3R7QA 2IO0B 3EC8A 3TL5A 4GDLA 4MGIE 3AXCA 3UQBA 3AB5A 4OZBA 2LXCA 1E7PB 2KAJA 3AU4A 3QC8B 3PVLA 2Y3AA 3MHSD 3DBHI 4AJWA 1C76A 2JF5A 3RNCC 3B2FA 3FILA 4KSLC 4HPPA 4FHKA 2LASA 4KV2A 2BWFA 2C7MB 3LDZE 4PS7A 1MG4A 3VRAB 4LNKA 1K8RB 3GZNI 3ALBA 3H8HA 2GI9A 1RLFA 4HXDA 2N4FA 2V3SA 2NS5A 1WJNA 1KLGD 5D7GA 2MWSB 4BKSA 5EE3A 4AWJA 4DHJD 2KDEB 4K3CA 2WX1A 2RMMA 2NBVB 3DQVA 1RFKA 1PGAA 4RCOA 2WXOA 1D5MC 1UGMA 3V61A 1SSNA 2RD0A 1Y56A 1JW9D 4AQ7A 2KNBA 1MI0A 3QCAA 1WGRA 4G50A 2XN9C 4RFBA 2BYFA 4HWIB 3V60A 1L4DB 2BGFA 2BYTA 3N3KB 3C8YA 4XC2A 3UQAA 1QOGA 2BS2B 3TJPA 2M8SA 1WXQA 1JWMD 2QMTA 1SGHA 1WXSA 3AE4B 5IN7A 3M62B 4RM9A 2PMVA 3PRZA 5J18A 5AEKB 2GBKA 4XZ4A 2VZKB 5LNK1 3HRDD 1T0RC 4M8MA 3VQIA 2AQ2B 3JSVB 1E6EB 1C1YB 4HKZE 1I4PA 3IG3A 1NENB 3VRBB 1QOBA 2K3UA 3AEBB 2NBUA 4M02A 3Q3FA 5L95C 4MGYE 1PDXA 3IHPC 1GAQB 3A9JB 2WP9B 4ANWA 1N60A 2SAKA 2WXFA 2KQSA 3DHHC 1OQQA 4C00A 2HDEA 2MCNB 4LTUA 1RFAA 2N7EA 2Y5BB 3WALA 3WAMA 4KGTA 2W9NA 2YEPF 2QJLA 2JXXA 2KLGA 4XGAB 1UD7A 1T6BX 2REXA 4HPLB 4DDGD 4BBNF 2EKIA 4K3BA 5G5GA 1I35A 2LZ6A 1I4XA 1XLQA 2PE6B 3TEXA 3QHTA 1VZ7A 1XT9B 1V5OA 2A5UA 2D3CA 3I3TB 1A5RA 3GZNB 2W82A 1C9FA 2KK8A 4EZJA 1DOIA 1YX6B 4ZRKA 1GG3A 2ZZPB 4A90A 2YEPB 3LJ3A 2RDBC 1NBFC 1PGXA 4FXCA 4P6VF 1UH6A 2MBEA 3H7PA 3Q8BA 4P7IA 2QILA 4LLGM 2M17A 3DBLB 1BXTA 4A3PA 2ZCBA 3IT6B 4LJPB 1KFYB 2O6VA 4UDUC 4FULA 2KOXA 3X0WA 1FMAD 4HPMB 4PYZA 2EELA 4K7WA 1Z2MA 3W2DA 3MC0B 4DXFA 3PRPB 2ZNVB 2MBBB 2FCSA 3V3XA 2D07B 3ECIA 3I9V1 3T9LA 3HHMA 4GXBA 4HDQA 4EZKA 1WWTA 2DAFA 4LNFA 5DPTA 4ZRJA 3EGRA 1C78A 4HVBA 2V4LA 2RGFA 1WGHA 5G55A 1DYQA 3RD2A 4EE2A 3AE6B 3PHXB 4DHZE 2R2QA 2YVCA 3PZDA 4JWSC 4YXDB 3DPDA 1QILA 1C79A 1HZ5A 3IBEA 2K8BA 3PZ8A 3P4PB 3SHQA 1AARA 2KC2A 3APCA 3RZFA 2RDGA 2BYEA 3OG5A 4YTNB 3AEAB 4MJSA 1FFUA 4DHZB 4IWPA 4A9AA 3DBHB 2V9HA 3IXSA 2B3AA 4LK0M 4GDKB 5HKHA 1UNSA 2HJ1A 4MGZE 4XWTA 1TBEA 2ONQA 2G45B 4HJKA 3DBSA 3PLVA 3SU8X 2RPVA 4BOZB 3U8ZA 1UGJA 1OQRA 1JCKB 2QHOA 1E8YA 2D3BA 4NJCA 3DVGX 2HTHA 3VH4B 1E8XA 1E8ZA 1ET9A 3R2TA 2KZRA 1QQRA 4M01A 3HM6X 4KZ0A 4M0WA 4ZHOA 1UZXB 1P7FA 3T3NA 2GB1A 3DBRB 4PYUA 4K7UA 1N62A 3NZ3A 2JRHA 1GC6A 1XEEA 2H89B 1D3ZA 1E90A 2BQQA 3AI5A 4S0RA 4WQOB 2V3PA 3Q8CA 1ENFA 2DZIA 2NVUI 3TMPB 4W9KA 4IC7B 2EKEC 3PPAA 4P1CC 2UYZB 4BAXA 3H6NA 1SB3C 4C56C 1FXAA 4ZRQA 4A8XC 4WAFA 2KANA 3BINA 2V1YA 3DHIC 3NS1A 2GLSA 2WDRB 1QF6A 4AS1A 2BKRB 4ZDVA 3W1YA 1RYJA 2IZVB 4FJYA 1BT0A 2KO3A 2VZKD 4YSXB 3BZDB 1D4BA 3PZ7A 4C4VB 1GOZA 4I6PA 3Q3NC 5CTRC 3UF8A 4DXGA 2DYOA 1KLVA 5FR6A 3R2IA 2JUOA 1UF0A 3ZVVA 2YLMA 2LVQA 3ABVB 1V1OA 2MA9B 1TS4A 2DNFA 1FM0D 3MJWA 3ZNID 3A9KB 2WU5B 1JMLA 2KFJA 1D5XC 1HXYD 5G2NA 2WXKA 3VUXA 5D6JB 2O2VA 4C7ZA 3O65B 3VDZA 1F9JA 1TKGA 3AMZA 2RSUA 3IVFA 4G3XB 3EFUA 1P3QU 2MRPA 1AYFA 4MJSB 2G4SA 4XX5A 3MJ5A 3QARA 2SEBD 4H2AA 3SFDB 2WXIA 2V0GA 4NY0A 4GIVA 2MSED 3V6EB 4TQ1A 1IP9A 3RNFC 2AQ3B 2CKHB 4W9EA 2MJEA 2IO3B 3ZTDA 4X57B 2QCZA 1C77A 2W54A 1ZUD2 1N5WA 1LFDA 2WHIA 3JW0X 5BYRA 2MJDA 2KXJA 2D10A 2DZMA 2RDHA 1QT9A 1WYWB 2FNJB 1L0VB 5HG2A 2DZJA 2JQRB 3KVFB 5DCNA 3NZSA 2DLBA 3I5JC 4DK5A 3ZDMC 1AWDA 1V8CA 4ANVA 1TY2A 1V5TA 2JWUA 2JWZA 2HTME 2J0JA 3DOWA 1WXVA 1TYGB 3RUIB 3N32A 1PUTA 4A55A 3PREA 3VTWA 2KYWA 4JE3B 1V97A 3QAQA 4DXAB 3WIMA 3RPFC 1ZE3D 2DHZA 4NPNA 4C7YA 4GN1A 1N6ZA 2KACA 1V86A 1IUEA 1KJTA 1R4MB 4OVUA 4IG7B 2C9WB 2L0TA 2MH7A 1UWXA 2HJ8A 2OJRA 1EO6A 1EUVB 1KH0A 4EEWA 1HE8A 2D3AA 2MP2A 2RR9A 3AEFB 3VTUA 2NMQA 4W9DA 2LRUA 4GDLB 4L1BA 5JHBA 3JSVA 4JIOU 1FNVA 1Y8RC 1FO4A 4GLSC 2OEDA 1F77A 1WXMA 3A4SC 2JPHA 4K1RB 1J0GA 3HVZA 5D3DA 3OWEB 2BB5A 2G1EA 4Q2JA 2K5PA 5T8IA 3AEEB 4FADA 1T0QC 2K6DB 2WLBA 4DHJB 2KDFB 3PRMB 3P42A 4LCDE 2N9LA 3BWUD 1VZ6A 3PSEB 3PGEA 4W9JA 1WJUA 3NJTA 4DQOC 1SE9A 2WDTB 4HK2A 2LHDA 1VCBA 1ZKHA 3NVYA 5E6JA 1T3QA 1ZP0B 3CSTA 4GU2A 3HM3A 4WJQA 5AZGA 5J2RA 3VTVA 1I4HA 3MFGA 2FUG1 3UINB 3B9JA 3VUYA 2WDQB 5AZHA 2BS4B 2KJ6A 2DYMA 2AL6A 5C3JB 2VH2A 4YT0B 1SE4A 3DDCB 5H92C 2PIAA 1XF5L 4LNNA 3A9JA 3UIOB 1J8CA 3ZKJC 5EE1A 1NYQA 2KQ4X 2KDIA 3WANA 2L7RA 4GSWA 3PHWB 3KUZA 2VRRB 5KHOA 4QAYA 1TKYA 2AX5A 2JSVX 1SEBD 4W9CA 2ZVOA 1SIJA 2Z59B 3Q14C 1YN3A 2IGHA 1SF0A 4MSQB 1E5WA 4ARIA 4II2B 1IPGA 3AN1A 1FCLA 1GB4A 2INDC 3HK0A 1FFVA 4MT5A 5HHDG 2KJRA 2JX5A 5KHQA 3CMMB 2MP2B 5JH5C 5BYQA 5DPSA 3N1ZC 1ET6A 5AUKA 2PLPA 2J4XA 1JQ4A 5E6OA 1V81A 3RZWC 4WQMA 4WIPA 4HRSA 1QKZA 2LJ5A 2LUMA 2QIEB 1I4GA 1K52A 3DWMA 2LFIA 3TEZA 4YTPB 1K50A 3ZTCA 5D3IB 2AYOB 1F1HA 2M0XA 1J7AA 2KMAA 3NVZA 3AULA 2IYDB 2I2YA 1UBIA 1U4AA 4KIKA 1P98A 1XLOA 2FE8A 5GXGB 1K53A 2C7HA 2KVZA 3W5UB 4KKIA 2QC8A 3VH3B 5DPWA 1L7YA 1JWSD 2D3GA 2ASQA 2FIFA 2M19A 5BMIA 2PE9A 2EMSA 2L00B 4E74A 4D2KA 1EWCA 4TQ0A 2JXTA 3KUCB 1I42A 2L76A 4M00A 2KTRA 3W5VB 3B1LX 4YTMB 4I6NB 3TIXA 2W3RA 3RCZA 2LWPA 2KFKB 3AU5A 2WU2B 3AE1B 1LM8B 3NHEB 4GB9A 3AM9A 3RULA 4N59A 2QDFA 2J0KA 2FCMA 3KLSX 5EE0A 2KJHB 2BKFA 1TT5B 3PS6A 4FN2A 2NTTA 2JZ3B 2KD0A 1WJ6A 3V6CB 1XO3A 2NCNA 3EHVA 1HTOA 3OLMD 2TSSA 2IJ0A 4BFRA 1NI2A 5CHWA 3NY5A 3DVNU 4WWPA 2PEAA 4JL9A 2HE7A 3QK0A 1FRRA 4KX6B 4RF1A 1DOXA 2MQJA 1CJEA 2LMCA 1ZXIA 2IGGA 1KF6B 1IGDA 4MSMB 2N9EB 3CIRB 1UELA 2MJ3A 1OGWA 4US8A 4K81A 3A9KA 2WS3B 4IUMB 4WAAA 2DAJA 1GB1A 2INNE 3Q3OC 4XDDA 4B6WA 1QZEA 4FA6A 2KDMA 2WXPA 2CHXA 1FNUA 3D32A 4HEA1 2CHZA 3ZNHB 2L0FA 3LB8C 4LNOA 5JZEB 1L0YB 4XDCA 1ZGUB 3AE8B 1TS5A 3RMKC 3CF6E 3CSFA 2D2QA 2BWES 3ZGZA 3EECA 3Q3MC 1V49A 2JY6A 1WMHA 4KGSA 4ARCA 2Z0EB 4BVUC 1NYRA 2CJNA 3UI3A 2K8CA 3N9YC 5LXHA 4CYEA 3M3JA 2XK5B 3PV1A 3AH7A 2BYVE 4BKTA 1V6EA 4JGHB 2WWZA 3HUIA 2WXJA 3GS2A 3E56A 4NZLB 2CJOA 3N1YC 4LNIA 4OZCA 5BO4B 2AQ1B 4WWOA 1FPYA 1GNUA 1QLBB 2CS4A 5EE9A 1YN4A 4NNJB 1WZ0A 2Y5CA 3L17A 1VD2A 4HDOA 1R4NB 2M0AA 2KQ7A 1MFWA 1Q5WB 3H1UA 1WE7A 4FBJB 3DCGA 1KM7A 1D5ZC 1FEHA 4NQKE 2N0SB 2QEJC 2CR5A 1R4MI 2J42A 1TTNA 1PFDA 2IGDA 4KDIC 2MLBA 1GPXA 2AL3A 2PPHA 1A70A 2O2VB 2MBHA 3NRZA 3KWVA 4FLHA 4N58A 2XK5A 5E6NA 1MHXA 1E7UA 2ACZB 2WXHA 3WAOA 4B9KA 1WR6E 3LXFA 1WYGA 1P9DU 4LJOB 5G5HA 4DDID 1J7BA 3RT3B 2LGXA 5CHVC 1WR1A 3ENEA 1JWUD 1CZPA 1FXTB 1PYWD 4DWFA 3N20C 3L0WB 2MX2A 1EU4A 2N9KA 1WX7A 2ZW0A 4NAWA 2N1VA 3B2GA 3IAS1 4KVGB 1KOTA 1STEA 3HVDA 1OQYA 4OW0A 3RFZB 2N7JA 2O6VB 3A4RA 3RNEC 2I1JA 4ZYSA 1C4CA 2FCNA 1EWYC 2KT7A 4TMAB 2JZPA 2KN5A 2ZPNA 4A3OA 2L1AA 4C4VA 4EUTA 5TR5A 4NJ7A 1GC7A 1EU3A 3VUWA 1L5PA 3R8BA 4R3DA 2PTLA 3M95A 2UWQA 2BPSA 1ISNA 2DYBA 3APDA 1TS2A 1VRAB 1XLPA 1L2NA 4P16A 3KW5B 3TSSA 1Q1OA 3JYUA 2AEHA 3P4QB 5DPRA 1WIAA 2J53A 3ZRCA 1NI3A 1P1AA 3L10B 1IYFA 4GMVA 3J9CA 1G6JA 1FD6A 3KQ4A 3SEBA 3URYA 2VH1A 2KMCA 3AEDB 5BMGA 3U7DA 3AV8A 2MW5A 1MVKA 1T5XD 4C80A 1J19A 4RNAA 2KTRB 4MGKE 2LI5A 4OVZA 1E10A 3U30A 4GGQA 2Y5PA 4CO7A 3A1QA 4IM0A 2J0MA 3FILB 2X38A 5CHFA 5GMVA 4ZHPA 3RNAC 4II3B 2V4IB 1Z5SB 2WDVB 2OHFA 1RRBA 1SIFA 2KHWB 1RAXA
chains in the Genus database with same CATH topology
3ZW3A 2KK8A 4EZJA 3S2AA 1YX6B 4ZRKA 3ZLZA 1WI0A 1OEYA 3DDCB 4AP4C 1GG3A 4ZRIA 2JRIB 2GBRA 1E8WA 3A9JA 4MH0E 2ZZPB 4W9HA 4ASWC 1WM2A 3LJ3A 4MM3A 3UIOB 1J8CA 3ZKJC 1NBFC 3WANA 2KDIA 2LRWA 1V9JA 2LVOA 1UH6A 2L7RA 3OJ3A 2KWUB 2MBEA 2Z0DB 2VRRB 3H7PA 3KUZA 3PHWB 4GSWA 5KHOA 4DBGA 2GBJA 2N7DA 4P7IA 3L13A 1WF9A 2M17A 4HLEA 4A3PA 1WY8A 2KC1A 2ZCBA 4LJPB 4W9CA 1PQSA 2O6VA 2GOWA 2ZVOA 2G4DB 3B0AA 4K7SA 4B95A 4FULA 4ANUA 2GBNA 2Z59B 1YJ1A 3A33B 2KOXA 3X0WA 4ANXA 2C7NB 4HPMB 2ZJDA 4PYZA 3KH0A 4K7WA 2FCQA 4MSQB 1E5WA 1Z2MA 4II2B 2N1WA 1IPGA 3PRPB 2ZNVB 2MBBB 5IA7A 2FCSA 3H9DA 3HK0A 2IO1B 2D07B 4EOYA 3ECIA 4F1SA 4HCPB 3WAPA 3T9LA 3HHMA 4GXBA 2KJRA 4HDQA 4BOSC 1WJ4A 4EZKA 1MG8A 4ZRJA 2DAFA 4JLCA 4LDTD 5DPTA 5KHQA 3MTNB 3CMMB 2MP2B 4HVBA 2V4LA 3ML8A 5JH5C 4MEMA 5DPSA 2RGFA 1WGHA 3ZRFA 5G55A 4IWQA 5E6OA 1YX5B 1V81A 3RZWC 2KFKA 3RD2A 4I6LB 2ZVNA 2AWTA 4MELA 2IY1B 3DBLI 2LJ5A 3M63B 3PHXB 2FUHB 4IM3A 4DHZE 3T8MA 3QX1A 3L54A 2R2QA 2YVCA 4IWOA 3PZDA 2ZPYA 3ZTCA 1WGGA 3DVGY 2AYOB 3DPDA 2M0XA 2KMAA 3IBEA 3AULA 2K8BA 5J17A 2IYDB 3APFA 4PS3A 1UBIA 3ZNZB 5LLIA 3SHQA 1U4AA 4KIKA 1P98A 5EDSA 1X1MA 3VVWB 4E71A 1AARA 2KC2A 3APCA 4FJZA 2C7HA 3RZFA 5L83A 2BYEA 2MBQA 2WX0A 3VH3B 1WX9A 4MJSA 3RYTA 5DPWA 1L7YA 4DHZB 3NZUA 4IWPA 2D3GA 3NOBA 2ASQA 2FIFA 2B3AA 1WX8A 1C3TA 2JVCA 2K39A 5C1ZA 2PE9A 2EMSA 2L00B 3H7SA 4GDKB 4E74A 3W1SA 5HKHA 2C60A 4YL8A 4MGZE 1TBEA 4TQ0A 3L16A 2G3QB 2G45B 4HJKA 4PS8A 2XEWA 3DBSA 3KUCB 4W9GA 3PLVA 3SU8X 4GOCA 4BOZB 1I42A 3U8ZA 2L76A 1M94A 2KTRA 4W9LA 1WE6A 2QHOA 3B1LX 4BKGA 4GDKA 4I6NB 3ONSA 3TIXA 3RCZA 2LWPA 2KFKB 3AU5A 1E8YA 4EFOA 1OEYJ 1WMHB 2FAZA 1LM8B 5CX3A 2O6VD 1WH3A 3DVGX 2HTHA 4LDTB 3NHEB 3VH4B 1E8XA 1E8ZA 4TUUA 4GB9A 3NS8A 3RULA 3QJZA 2KVRA 2KZRA 3WA0A 2J0KA 2FCMA 4WJNA 2PJHA 3HM6X 4KZ0A 2KJHB 2BF8B 4KSKC 4M8NA 2BKFA 3PS6A 4FN2A 1UZXB 1V2YA 1V80A 2JZ3B 4IW0A 2KD0A 1WFYA 3KUDB 1WJ6A 2NPTB 3V6CB 4PYUA 2NCNA 1S1QB 4K7UA 3EHVA 2JRHA 3OLMD 1GC6A 2KX3A 1TZ1A 3V62A 1LXDA 4BFRA 1NI2A 5CHWA 2K1FA 1D3ZA 4N9F4 4WWNA 2DZKA 1E90A 2JT4B 3NY5A 1NDDA 3DVNU 3ZUNA 4WWPA 3ZIMA 2PEAA 4JL9A 2HE7A 3AI5A 3QK0A 4WQOB 2MQJA 1WRDB 1YD8U 2LVPA 2DZIA 2NVUI 3TMPB 2NBWB 4W9KA 2KX0A 4IC7B 2EKEC 3PPAA 4AOFA 4MSMB 2UYZB 4IM2A 2K8HA 3H7PB 2C5LC 3QA8A 3QIJA 2N9EB 3SD5A 3H6NA 1WZ3A 1UELA 1OGWA 2KLCA 5LXIB 4K81A 3A9KA 2HD5B 4WJPA 2NR2A 2KANA 2N9PC 2LGYA 1CMXB 2K25A 3BINA 4RMAA 4IUMB 4WAAA 2IO2B 2V1YA 4BKSD 2M4NA 3QQ8B 2DAJA 2ZCCA 1YIWA 4B6WA 1QZEA 4AUQC 1P0RA 4FA6A 2WYQA 2LGDA 2ZNVC 4W9FA 2CHXA 3KYCD 4NQLB 3D32A 2BKRB 4ZDVA 4ICUA 4OVVA 3ZNGC 4G11A 3W1YA 1Q0WB 2CHZA 2IZVB 4FJYA 3R3MA 1BT0A 3UGBB 3ZNHB 2L0FA 2KO3A 2DENB 2D11A 2J7QB 5JZEB 1T0YA 1ZGUB 3DBRI 4KDLB 4KIKB 4FJVB 4I6PA 5CTRC 3SDLC 3UF8A 3IFWB 1WGDA 2DYOA 2ZEQA 4G0NB 3CF6E 3CSFA 3PLUA 4KZCA 4NJ6A 2D2QA 5FR6A 1KLVA 2EMTA 2BWES 2JUOA 4W9IA 4RM8A 3VAWA 1GUAB 1LQBA 3EECA 3ZVVA 1V49A 1R4NI 2JY6A 2YLMA 3PTFC 2LVQA 1WMHA 4A20A 5E6PA 3ZDTA 1EF1A 2MA9B 2Z0EB 4BVUC 3PT2B 2K8CA 5LXHA 3MJWA 3ZNID 3M3JA 4CYEA 3A9KB 2XK5B 3PV1A 4JQWC 3VXWA 4AJYB 2RPQA 5C23A 2KFJA 3R66C 3R7QA 2IO0B 2BYVE 3EC8A 5G2NA 3TL5A 4GDLA 3UIPB 4BKTA 1V6EA 4MGIE 4MDKE 2O2VA 5D2MB 5D6JB 4JGHB 2WWZA 3AXCA 3O65B 3TBLD 3UQBA 3VDZA 1F9JA 2GBMA 2RSUA 3IVFA 2IY0B 4G3XB 2LXCA 3EFUA 5BO4B 4WWOA 1P3QU 2K6QA 2MRPA 1GNUA 2GMIC 3AU4A 4MJSB 2G4SA 4XX5A 3QC8B 3QARA 3PVLA 2LUEA 2CS4A 4NNJB 1WZ0A 3MHSD 3L17A 2M1MA 1VD2A 1ZW7A 1JRUA 3DBHI 3KYDD 4HDOA 4ICVA 4TV3A 4AJWA 2KQ7A 1Q5WB 4NY0A 4NAWB 4GIVA 2MSED 3H1UA 3V6EB 4TQ1A 1IP9A 2JZZA 3K9PB 2CKHB 4W9EA 3ZTDA 1WE7A 2IO3B 2NPTA 3QWZB 2JF5A 1WGYA 1KM7A 3DCGA 4X57B 4FBJB 1E7VA 4KSLC 1UBQA 4FHKA 2LASA 4KV2A 4HCNB 2BWFA 4NQKE 5D94A 2C7MB 1LFDA 3JW0X 3LDZE 2CR5A 2KXJA 1R4MI 2D10A 1TTNA 2DZMA 4PS7A 4KDIC 2KWVB 1K8RB 3GZNI 2MLBA 3ALBA 2AL3A 1XD3B 2PPHA 4EZLA 3VHTC 2A4ZA 1RLFA 2O2VB 4HXDA 1WYWB 2MBHA 2N4FA 2FNJB 3DVNV 4FLHA 3VFKA 2FIDA 2DZJA 2NS5A 2V3SA 3KVFB 1WJNA 5DCNA 5D7GA 2XK5A 5E6NA 2MWSB 4BKSA 3NZSA 3N30A 1E7UA 4AWJA 4DK5A 4DHJD 2KDEB 3ZDMC 4ANVA 3OAWA 1V5TA 2JWZA 2WX1A 3WAOA 2NBVB 3DQVA 4B9KA 4URKA 2J0JA 3DOWA 1WR6E 1WXVA 2CU1A 1P9DU 4LJOB 3RUIB 4DDID 3N32A 5JHAA 3RT3B 2LGXA 5CHVC 4EKUA 2KWCA 3PREA 3VTWA 1WR1A 3ENEA 1UGMA 3V61A 1FXTB 2RD0A 3QAQA 4DXAB 4DWFA 4WJOA 3WIMA 2KNBA 3A1QB 3L0WB 2MX2A 3C0RB 3QCAA 1WGRA 4G50A 4BBNC 4J6IA 3JVZX 4M0WB 1WX7A 2BYFA 4HWIB 4NAWA 2DHZA 4NPNA 2N1VA 3V60A 4GN1A 2XBBC 2L05A 2MBOA 4KVGB 1KOTA 3K9OB 1V86A 2BGFA 1OQYA 1KJTA 3N3KB 4IG7B 4OVUA 4XC2A 4CHKA 2C9WB 3UQAA 2L0TA 2HJ8A 3HIZA 2O6VB 2OJRA 2R2OA 3A4RA 1EO6A 1EUVB 2I1JA 3TJPA 4EEWA 2FCNA 1H8CA 2M8SA 3Q3JA 1HE8A 2LD9A 2MP2A 1SGHA 2RR9A 4TKNA 3VTUA 2CHWA 4W9DA 1OTRB 2KN5A 1WXSA 2LRUA 2ZPNA 4GDLB 2LXAA 4A3OA 1GJZA 3M62B 4EUTA 5JHBA 3JSVA 4JIOU 3L08A 4RM9A 3PRZA 5TR5A 5J18A 1Y8RC 4NJ7A 1GC7A 5AEKB 2GBKA 3VUWA 1WXMA 3A4SC 4XZ4A 4F8CB 2JPHA 4K1RB 3M95A 1XQQA 1J0GA 2UWQA 2BPSA 4M8MA 1ISNA 2DYBA 3APDA 3TCAA 3BY4B 3VQIA 2DX5B 3P2BA 3R7RA 3JSVB 2KDBA 4FADA 1H4RA 1C1YB 1L2NA 2K6DB 4DHJB 2KKCA 3KW5B 2KDFB 3PRMB 3IG3A 5AZFA 1Q1OA 3JYUA 2AEHA 4LCDE 5DPRA 1S3SG 1WIAA 3ZRCA 1P1AA 3ZO5B 3L10B 1IYFA 4GMVA 3PSEB 3PGEA 2NBUA 2IBIB 3VUXA 1EF5A 4E3CA 1G6JA 4W9JA 3Q3FA 1WJUA 5L95C 2N9XA 4MGYE 2OOBB 2KMCA 2KTFA 3IHPC 3U7DA 1SE9A 2WDTB 4HK2A 2MW5A 1VCBA 3A9JB 4ANWA 3OJ4B 1ZKHA 1J19A 1WXAA 2KQSA 2KTRB 3CSTA 3ML9A 4MGKE 2LI5A 4GU2A 3HM3A 1TGZB 4WJQA 2MCNB 3WALA 1RFAA 2N7EA 2Y5BB 3WAMA 3X23A 2W9NA 5AZGA 3U30A 5J2RA 3VTVA 4GGQA 3GOEA 2JXXA 3UINB 4CO7A 3B08A 3A1QA 2KLGA 1UD7A 4IM0A 4ZYNA 5IAAC 2REXA 4HPLB 2J0MA 4DDGD 2L8JA 3VUYA 5CHFA 4BBNF 5AZHA 5GMVA 1I35A 2LZ6A 1WM3A 2PE6B 2KJ6A 4II3B 3QHTA 1XT9B 2DYMA 2L3ZA 1Z5SB 1V5OA 2A5UA 3I3TB 2AL6A 1A5RA 2I1KA 3W1SC 1RRBA 1YQBA 1SIFA 2KHWB 4FHJA 4F7ZA 1RAXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3ZW3 A;  2KK8 A;  4EZJ A;  3S2A A;  1YX6 B;  4ZRK A;  3ZLZ A;  1WI0 A;  1OEY A;  3DDC B;  4AP4 C;  1GG3 A;  4ZRI A;  2JRI B;  2GBR A;  1E8W A;  3A9J A;  4MH0 E;  2ZZP B;  4W9H A;  4ASW C;  1WM2 A;  3LJ3 A;  4MM3 A;  3UIO B;  1J8C A;  3ZKJ C;  1NBF C;  3WAN A;  2KDI A;  2LRW A;  1V9J A;  2LVO A;  1UH6 A;  2L7R A;  3OJ3 A;  2KWU B;  2MBE A;  2Z0D B;  2VRR B;  3H7P A;  3KUZ A;  3PHW B;  4GSW A;  5KHO A;  4DBG A;  2GBJ A;  2N7D A;  4P7I A;  3L13 A;  1WF9 A;  2M17 A;  4HLE A;  4A3P A;  1WY8 A;  2KC1 A;  2ZCB A;  4LJP B;  4W9C A;  1PQS A;  2O6V A;  2GOW A;  2ZVO A;  2G4D B;  3B0A A;  4K7S A;  4B95 A;  4FUL A;  4ANU A;  2GBN A;  2Z59 B;  1YJ1 A;  3A33 B;  2KOX A;  3X0W A;  4ANX A;  2C7N B;  4HPM B;  2ZJD A;  4PYZ A;  3KH0 A;  4K7W A;  2FCQ A;  4MSQ B;  1E5W A;  1Z2M A;  4II2 B;  2N1W A;  1IPG A;  3PRP B;  2ZNV B;  2MBB B;  5IA7 A;  2FCS A;  3H9D A;  3HK0 A;  2IO1 B;  2D07 B;  4EOY A;  3ECI A;  4F1S A;  4HCP B;  3WAP A;  3T9L A;  3HHM A;  4GXB A;  2KJR A;  4HDQ A;  4BOS C;  1WJ4 A;  4EZK A;  1MG8 A;  4ZRJ A;  2DAF A;  4JLC A;  4LDT D;  5DPT A;  5KHQ A;  3MTN B;  3CMM B;  2MP2 B;  4HVB A;  2V4L A;  3ML8 A;  5JH5 C;  4MEM A;  5DPS A;  2RGF A;  1WGH A;  3ZRF A;  5G55 A;  4IWQ A;  5E6O A;  1YX5 B;  1V81 A;  3RZW C;  2KFK A;  3RD2 A;  4I6L B;  2ZVN A;  2AWT A;  4MEL A;  2IY1 B;  3DBL I;  2LJ5 A;  3M63 B;  3PHX B;  2FUH B;  4IM3 A;  4DHZ E;  3T8M A;  3QX1 A;  3L54 A;  2R2Q A;  2YVC A;  4IWO A;  3PZD A;  2ZPY A;  3ZTC A;  1WGG A;  3DVG Y;  2AYO B;  3DPD A;  2M0X A;  2KMA A;  3IBE A;  3AUL A;  2K8B A;  5J17 A;  2IYD B;  3APF A;  4PS3 A;  1UBI A;  3ZNZ B;  5LLI A;  3SHQ A;  1U4A A;  4KIK A;  1P98 A;  5EDS A;  1X1M A;  3VVW B;  4E71 A;  1AAR A;  2KC2 A;  3APC A;  4FJZ A;  2C7H A;  3RZF A;  5L83 A;  2BYE A;  2MBQ A;  2WX0 A;  3VH3 B;  1WX9 A;  4MJS A;  3RYT A;  5DPW A;  1L7Y A;  4DHZ B;  3NZU A;  4IWP A;  2D3G A;  3NOB A;  2ASQ A;  2FIF A;  2B3A A;  1WX8 A;  1C3T A;  2JVC A;  2K39 A;  5C1Z A;  2PE9 A;  2EMS A;  2L00 B;  3H7S A;  4GDK B;  4E74 A;  3W1S A;  5HKH A;  2C60 A;  4YL8 A;  4MGZ E;  1TBE A;  4TQ0 A;  3L16 A;  2G3Q B;  2G45 B;  4HJK A;  4PS8 A;  2XEW A;  3DBS A;  3KUC B;  4W9G A;  3PLV A;  3SU8 X;  4GOC A;  4BOZ B;  1I42 A;  3U8Z A;  2L76 A;  1M94 A;  2KTR A;  4W9L A;  1WE6 A;  2QHO A;  3B1L X;  4BKG A;  4GDK A;  4I6N B;  3ONS A;  3TIX A;  3RCZ A;  2LWP A;  2KFK B;  3AU5 A;  1E8Y A;  4EFO A;  1OEY J;  1WMH B;  2FAZ A;  1LM8 B;  5CX3 A;  2O6V D;  1WH3 A;  3DVG X;  2HTH A;  4LDT B;  3NHE B;  3VH4 B;  1E8X A;  1E8Z A;  4TUU A;  4GB9 A;  3NS8 A;  3RUL A;  3QJZ A;  2KVR A;  2KZR A;  3WA0 A;  2J0K A;  2FCM A;  4WJN A;  2PJH A;  3HM6 X;  4KZ0 A;  2KJH B;  2BF8 B;  4KSK C;  4M8N A;  2BKF A;  3PS6 A;  4FN2 A;  1UZX B;  1V2Y A;  1V80 A;  2JZ3 B;  4IW0 A;  2KD0 A;  1WFY A;  3KUD B;  1WJ6 A;  2NPT B;  3V6C B;  4PYU A;  2NCN A;  1S1Q B;  4K7U A;  3EHV A;  2JRH A;  3OLM D;  1GC6 A;  2KX3 A;  1TZ1 A;  3V62 A;  1LXD A;  4BFR A;  1NI2 A;  5CHW A;  2K1F A;  1D3Z A;  4N9F 4;  4WWN A;  2DZK A;  1E90 A;  2JT4 B;  3NY5 A;  1NDD A;  3DVN U;  3ZUN A;  4WWP A;  3ZIM A;  2PEA A;  4JL9 A;  2HE7 A;  3AI5 A;  3QK0 A;  4WQO B;  2MQJ A;  1WRD B;  1YD8 U;  2LVP A;  2DZI A;  2NVU I;  3TMP B;  2NBW B;  4W9K A;  2KX0 A;  4IC7 B;  2EKE C;  3PPA A;  4AOF A;  4MSM B;  2UYZ B;  4IM2 A;  2K8H A;  3H7P B;  2C5L C;  3QA8 A;  3QIJ A;  2N9E B;  3SD5 A;  3H6N A;  1WZ3 A;  1UEL A;  1OGW A;  2KLC A;  5LXI B;  4K81 A;  3A9K A;  2HD5 B;  4WJP A;  2NR2 A;  2KAN A;  2N9P C;  2LGY A;  1CMX B;  2K25 A;  3BIN A;  4RMA A;  4IUM B;  4WAA A;  2IO2 B;  2V1Y A;  4BKS D;  2M4N A;  3QQ8 B;  2DAJ A;  2ZCC A;  1YIW A;  4B6W A;  1QZE A;  4AUQ C;  1P0R A;  4FA6 A;  2WYQ A;  2LGD A;  2ZNV C;  4W9F A;  2CHX A;  3KYC D;  4NQL B;  3D32 A;  2BKR B;  4ZDV A;  4ICU A;  4OVV A;  3ZNG C;  4G11 A;  3W1Y A;  1Q0W B;  2CHZ A;  2IZV B;  4FJY A;  3R3M A;  1BT0 A;  3UGB B;  3ZNH B;  2L0F A;  2KO3 A;  2DEN B;  2D11 A;  2J7Q B;  5JZE B;  1T0Y A;  1ZGU B;  3DBR I;  4KDL B;  4KIK B;  4FJV B;  4I6P A;  5CTR C;  3SDL C;  3UF8 A;  3IFW B;  1WGD A;  2DYO A;  2ZEQ A;  4G0N B;  3CF6 E;  3CSF A;  3PLU A;  4KZC A;  4NJ6 A;  2D2Q A;  5FR6 A;  1KLV A;  2EMT A;  2BWE S;  2JUO A;  4W9I A;  4RM8 A;  3VAW A;  1GUA B;  1LQB A;  3EEC A;  3ZVV A;  1V49 A;  1R4N I;  2JY6 A;  2YLM A;  3PTF C;  2LVQ A;  1WMH A;  4A20 A;  5E6P A;  3ZDT A;  1EF1 A;  2MA9 B;  2Z0E B;  4BVU C;  3PT2 B;  2K8C A;  5LXH A;  3MJW A;  3ZNI D;  3M3J A;  4CYE A;  3A9K B;  2XK5 B;  3PV1 A;  4JQW C;  3VXW A;  4AJY B;  2RPQ A;  5C23 A;  2KFJ A;  3R66 C;  3R7Q A;  2IO0 B;  2BYV E;  3EC8 A;  5G2N A;  3TL5 A;  4GDL A;  3UIP B;  4BKT A;  1V6E A;  4MGI E;  4MDK E;  2O2V A;  5D2M B;  5D6J B;  4JGH B;  2WWZ A;  3AXC A;  3O65 B;  3TBL D;  3UQB A;  3VDZ A;  1F9J A;  2GBM A;  2RSU A;  3IVF A;  2IY0 B;  4G3X B;  2LXC A;  3EFU A;  5BO4 B;  4WWO A;  1P3Q U;  2K6Q A;  2MRP A;  1GNU A;  2GMI C;  3AU4 A;  4MJS B;  2G4S A;  4XX5 A;  3QC8 B;  3QAR A;  3PVL A;  2LUE A;  2CS4 A;  4NNJ B;  1WZ0 A;  3MHS D;  3L17 A;  2M1M A;  1VD2 A;  1ZW7 A;  1JRU A;  3DBH I;  3KYD D;  4HDO A;  4ICV A;  4TV3 A;  4AJW A;  2KQ7 A;  1Q5W B;  4NY0 A;  4NAW B;  4GIV A;  2MSE D;  3H1U A;  3V6E B;  4TQ1 A;  1IP9 A;  2JZZ A;  3K9P B;  2CKH B;  4W9E A;  3ZTD A;  1WE7 A;  2IO3 B;  2NPT A;  3QWZ B;  2JF5 A;  1WGY A;  1KM7 A;  3DCG A;  4X57 B;  4FBJ B;  1E7V A;  4KSL C;  1UBQ A;  4FHK A;  2LAS A;  4KV2 A;  4HCN B;  2BWF A;  4NQK E;  5D94 A;  2C7M B;  1LFD A;  3JW0 X;  3LDZ E;  2CR5 A;  2KXJ A;  1R4M I;  2D10 A;  1TTN A;  2DZM A;  4PS7 A;  4KDI C;  2KWV B;  1K8R B;  3GZN I;  2MLB A;  3ALB A;  2AL3 A;  1XD3 B;  2PPH A;  4EZL A;  3VHT C;  2A4Z A;  1RLF A;  2O2V B;  4HXD A;  1WYW B;  2MBH A;  2N4F A;  2FNJ B;  3DVN V;  4FLH A;  3VFK A;  2FID A;  2DZJ A;  2NS5 A;  2V3S A;  3KVF B;  1WJN A;  5DCN A;  5D7G A;  2XK5 A;  5E6N A;  2MWS B;  4BKS A;  3NZS A;  3N30 A;  1E7U A;  4AWJ A;  4DK5 A;  4DHJ D;  2KDE B;  3ZDM C;  4ANV A;  3OAW A;  1V5T A;  2JWZ A;  2WX1 A;  3WAO A;  2NBV B;  3DQV A;  4B9K A;  4URK A;  2J0J A;  3DOW A;  1WR6 E;  1WXV A;  2CU1 A;  1P9D U;  4LJO B;  3RUI B;  4DDI D;  3N32 A;  5JHA A;  3RT3 B;  2LGX A;  5CHV C;  4EKU A;  2KWC A;  3PRE A;  3VTW A;  1WR1 A;  3ENE A;  1UGM A;  3V61 A;  1FXT B;  2RD0 A;  3QAQ A;  4DXA B;  4DWF A;  4WJO A;  3WIM A;  2KNB A;  3A1Q B;  3L0W B;  2MX2 A;  3C0R B;  3QCA A;  1WGR A;  4G50 A;  4BBN C;  4J6I A;  3JVZ X;  4M0W B;  1WX7 A;  2BYF A;  4HWI B;  4NAW A;  2DHZ A;  4NPN A;  2N1V A;  3V60 A;  4GN1 A;  2XBB C;  2L05 A;  2MBO A;  4KVG B;  1KOT A;  3K9O B;  1V86 A;  2BGF A;  1OQY A;  1KJT A;  3N3K B;  4IG7 B;  4OVU A;  4XC2 A;  4CHK A;  2C9W B;  3UQA A;  2L0T A;  2HJ8 A;  3HIZ A;  2O6V B;  2OJR A;  2R2O A;  3A4R A;  1EO6 A;  1EUV B;  2I1J A;  3TJP A;  4EEW A;  2FCN A;  1H8C A;  2M8S A;  3Q3J A;  1HE8 A;  2LD9 A;  2MP2 A;  1SGH A;  2RR9 A;  4TKN A;  3VTU A;  2CHW A;  4W9D A;  1OTR B;  2KN5 A;  1WXS A;  2LRU A;  2ZPN A;  4GDL B;  2LXA A;  4A3O A;  1GJZ A;  3M62 B;  4EUT A;  5JHB A;  3JSV A;  4JIO U;  3L08 A;  4RM9 A;  3PRZ A;  5TR5 A;  5J18 A;  1Y8R C;  4NJ7 A;  1GC7 A;  5AEK B;  2GBK A;  3VUW A;  1WXM A;  3A4S C;  4XZ4 A;  4F8C B;  2JPH A;  4K1R B;  3M95 A;  1XQQ A;  1J0G A;  2UWQ A;  2BPS A;  4M8M A;  1ISN A;  2DYB A;  3APD A;  3TCA A;  3BY4 B;  3VQI A;  2DX5 B;  3P2B A;  3R7R A;  3JSV B;  2KDB A;  4FAD A;  1H4R A;  1C1Y B;  1L2N A;  2K6D B;  4DHJ B;  2KKC A;  3KW5 B;  2KDF B;  3PRM B;  3IG3 A;  5AZF A;  1Q1O A;  3JYU A;  2AEH A;  4LCD E;  5DPR A;  1S3S G;  1WIA A;  3ZRC A;  1P1A A;  3ZO5 B;  3L10 B;  1IYF A;  4GMV A;  3PSE B;  3PGE A;  2NBU A;  2IBI B;  3VUX A;  1EF5 A;  4E3C A;  1G6J A;  4W9J A;  3Q3F A;  1WJU A;  5L95 C;  2N9X A;  4MGY E;  2OOB B;  2KMC A;  2KTF A;  3IHP C;  3U7D A;  1SE9 A;  2WDT B;  4HK2 A;  2MW5 A;  1VCB A;  3A9J B;  4ANW A;  3OJ4 B;  1ZKH A;  1J19 A;  1WXA A;  2KQS A;  2KTR B;  3CST A;  3ML9 A;  4MGK E;  2LI5 A;  4GU2 A;  3HM3 A;  1TGZ B;  4WJQ A;  2MCN B;  3WAL A;  1RFA A;  2N7E A;  2Y5B B;  3WAM A;  3X23 A;  2W9N A;  5AZG A;  3U30 A;  5J2R A;  3VTV A;  4GGQ A;  3GOE A;  2JXX A;  3UIN B;  4CO7 A;  3B08 A;  3A1Q A;  2KLG A;  1UD7 A;  4IM0 A;  4ZYN A;  5IAA C;  2REX A;  4HPL B;  2J0M A;  4DDG D;  2L8J A;  3VUY A;  5CHF A;  4BBN F;  5AZH A;  5GMV A;  1I35 A;  2LZ6 A;  1WM3 A;  2PE6 B;  2KJ6 A;  4II3 B;  3QHT A;  1XT9 B;  2DYM A;  2L3Z A;  1Z5S B;  1V5O A;  2A5U A;  3I3T B;  2AL6 A;  1A5R A;  2I1K A;  3W1S C;  1RRB A;  1YQB A;  1SIF A;  2KHW B;  4FHJ A;  4F7Z A;  1RAX A; 
#chains in the Genus database with same CATH topology
 3ZW3 A;  4NAM A;  3ZLZ A;  1IGC A;  1WI0 A;  1TY0 A;  4AP4 C;  4ZRI A;  3DWG C;  2GBR A;  2QSD A;  1V1P A;  4MH0 E;  1OFF A;  4W9H A;  2WXG A;  2LRW A;  2LVO A;  1V1P B;  3OJ3 A;  1BUI C;  2N7D A;  3L13 A;  1WF9 A;  5IO9 A;  4HLE A;  2UU7 A;  1WY8 A;  3AE7 B;  5AUI A;  4YWG G;  3VR8 B;  2GOW A;  3B0A A;  4K7S A;  4B95 A;  3GB1 A;  4ANU A;  2GBN A;  1YJ1 A;  2W3S A;  3A33 B;  3FAH A;  1XCQ L;  3RN9 C;  4ANX A;  3KH0 A;  2FCQ A;  4WUR A;  2D5G A;  2IO1 B;  4EOY A;  2ZW1 A;  4HCP B;  4YSY B;  1F52 A;  3WAP A;  1YJI A;  1WJ4 A;  5MPO A;  3BK1 A;  4RF0 A;  1KTK A;  1I4Q A;  3SFE B;  1ZOY B;  3BVZ A;  1F0Z A;  2AWT A;  4MEL A;  5BYS A;  2FUH B;  2JYE A;  4IDI A;  1F2R I;  3QX1 A;  2L52 A;  3L54 A;  4ZRP A;  1FNW A;  1IBX B;  3AE9 B;  5J17 A;  3TUO A;  3ZNZ B;  5LLI A;  2BBC A;  5EDS A;  4TSS A;  4E71 A;  1QOF A;  1YQ3 B;  5L83 A;  2MBQ A;  2M56 B;  3NOB A;  1HQR D;  2JVC A;  5C1Z A;  3H7S A;  2BVC A;  3W1S A;  4YL8 A;  1TS3 A;  1VJK A;  3ZXR A;  2XEW A;  5FR3 A;  2LEK A;  1N5X A;  1XXG A;  1M94 A;  4W9L A;  1NEK B;  1WE6 A;  4BKG A;  4GDK A;  2BS3 B;  3O13 A;  3IT4 B;  2O6V D;  1WH3 A;  4OZA A;  1ZXH A;  4L2Y A;  3WCQ A;  4TUU A;  3QJZ A;  5JXV A;  3MC9 A;  4XWW A;  3WA0 A;  4S17 A;  1L0X B;  1Q10 A;  2MEK A;  4WJN A;  5C2T B;  2PJH A;  1NVI D;  2BF8 B;  3AE2 B;  1V2Y A;  4IW0 A;  3EFC A;  3KUD B;  2ON8 A;  5FK9 C;  2E3T A;  4WWN A;  2ICI A;  1NDD A;  2IDY A;  3ZUN A;  3I63 C;  1E0Z A;  4N6E B;  1QOA A;  1WRD B;  2LVP A;  2BW2 A;  1EM7 A;  2WNM A;  1JRP A;  4IM2 A;  4B0E A;  1VZ8 A;  3C19 A;  2C5L C;  3QA8 A;  3SD5 A;  3NVW A;  3L4P A;  5LXI B;  4RGO S;  2HD5 B;  4WJP A;  1CMX B;  4RMA A;  2IO2 B;  2M4N A;  2Z8L A;  2ZCC A;  1YIW A;  1XCT L;  4KGR A;  2WYQ A;  2LGD A;  4W9F A;  4ACF A;  3AEG B;  3KYC D;  2Q5W D;  4OVV A;  3ZNG C;  1Q0W B;  3R3M A;  3UGB B;  3P1M A;  3GE3 C;  3MC8 A;  2D11 A;  2J7Q B;  3ETR A;  2G9H D;  3DBR I;  1WGD A;  2OJW A;  3PLU A;  2EMT A;  1E9M A;  4HRO A;  4RM8 A;  3VAW A;  1JWB D;  4L23 A;  1GUA B;  1R4N I;  2I38 A;  3P63 A;  5E6P A;  1EF1 A;  2PW9 A;  5BMH A;  3BYT B;  4A6Q A;  3TEY A;  3ZXV A;  2XNA C;  2B76 B;  1IBX A;  3NG0 A;  2J52 A;  4PT5 A;  4AJY B;  1SJH D;  5C23 A;  1FCC C;  3UIP B;  4MDK E;  5D2M B;  3TBL D;  1RM6 C;  2GBM A;  3N1X C;  1L6V A;  1FRD A;  5IP4 D;  2IY0 B;  1TJE A;  3SR6 A;  2DWQ A;  2K6Q A;  4IKG A;  3Q69 A;  1VLB A;  2GMI C;  1I7H A;  2LUE A;  3T3O A;  1YJJ A;  2PVG C;  1YQ4 B;  2M1M A;  1HZ6 A;  1ZW7 A;  1JRU A;  3KYD D;  4ICV A;  4TV3 A;  3NUH B;  2WXM A;  2MHJ A;  4NAW B;  2JZZ A;  3K9P B;  3AE5 B;  2NPT A;  3QWZ B;  4B0M A;  1WGY A;  1E7V A;  1ZDX A;  1UBQ A;  2CU3 A;  2IPK D;  5D94 A;  4HCN B;  1SE2 A;  4YSZ B;  1VDV A;  1WGK A;  2KWV B;  2H88 B;  1UWM A;  1XD3 B;  1C4A A;  4EZL A;  3ZJU A;  3VHT C;  2A4Z A;  2BTE A;  3DVN V;  3VFK A;  2FID A;  2LJI A;  3N30 A;  3IAM 1;  2WXQ A;  3OAW A;  2INC C;  4URK A;  2CU1 A;  5JHA A;  4EKU A;  3EUB 2;  2LGS A;  2KWC A;  3RNB C;  1B1Z A;  3GE8 C;  4ITK A;  1N61 A;  4WJO A;  5FKA C;  3A1Q B;  3MHZ A;  2WXL A;  3C0R B;  4BBN C;  4O1N A;  4J6I A;  4XYC A;  3JVZ X;  4M0W B;  3AEC B;  3FKY A;  2XBB C;  2L05 A;  2MBO A;  1YOV B;  3K9O B;  4USA A;  4CHK A;  4WH4 A;  3HIZ A;  3ZJV A;  5TSS A;  2R2O A;  1P7E A;  1YMH E;  1H8C A;  3Q3J A;  2LD9 A;  4TKN A;  2CHW A;  1OTR B;  2LXA A;  1GJZ A;  1K51 A;  5HI1 A;  1UUP A;  3L08 A;  1HEZ E;  5H8Y E;  2W55 A;  4F8C B;  1XQQ A;  1BML C;  3BVM A;  2WXN A;  2KWD A;  3ZQ4 A;  3TCA A;  3BY4 B;  1L4Z B;  2DX5 B;  3P2B A;  3R7R A;  2KDB A;  1H4R A;  1TIF A;  3LYY A;  2KKC A;  5AZF A;  2BT6 A;  1S3S G;  3CWI A;  4MH8 A;  3V05 A;  3ZO5 B;  4REZ A;  2IBI B;  1EF5 A;  4CQN A;  4E3C A;  1ESF A;  2GRI A;  1AW7 A;  3P4R B;  2N9X A;  3GP7 A;  2OOB B;  4P1B C;  4JWU C;  2KTF A;  5I4D A;  3OJ4 B;  3BYY B;  1CK1 A;  1D6E C;  1WXA A;  2KMM A;  3ML9 A;  1TGZ B;  1YNT E;  1C4P A;  1SXT A;  3DHG C;  3X23 A;  3GOE A;  1L6U A;  3B08 A;  4ZYN A;  5IAA C;  3ZJT A;  2R61 A;  2K22 A;  2L8J A;  2K0P A;  1WM3 A;  3Q8E A;  4MM3 B;  2L3Z A;  1ZDV A;  2I1K A;  3W1S C;  1YQB A;  4FHJ A;  4F7Z A;  3I57 A;  3S2A A;  1WRI A;  1OEY A;  3AE3 B;  3W9C B;  1HA5 A;  2JRI B;  1DGJ A;  1E8W A;  1HTQ A;  2L83 A;  4ASW C;  2E6X A;  1WM2 A;  1M4V A;  4MM3 A;  2BB6 A;  1V9J A;  4JX1 C;  2WQY B;  2KWU B;  2Z0D B;  4DBG A;  3U7Z A;  1LGR A;  2GBJ A;  2KC1 A;  1PGB A;  1PQS A;  2G4D B;  3NVV A;  1JRO A;  2C7N B;  2L32 A;  2ZJD A;  4RH6 A;  4HKQ A;  1SJE D;  2N1W A;  5IA7 A;  3H9D A;  4F1S A;  1AN8 A;  2NTS A;  3EA6 A;  3Q6B A;  4BOS C;  2K9X A;  2X8X X;  1MG8 A;  4LDT D;  4JLC A;  3P4S B;  3FC4 A;  3MTN B;  3E9S A;  3ML8 A;  4MEM A;  1XLN A;  1CQV A;  2PVO D;  3ZRF A;  4IWQ A;  1YX5 B;  1R7S A;  4KKJ A;  2KFK A;  4IOI E;  4I6L B;  2ZVN A;  3U52 E;  2IY1 B;  3DBL I;  3M63 B;  4IM3 A;  3T8M A;  4IWO A;  2ZPY A;  2JYT A;  1WGG A;  3DVG Y;  1MPE A;  4HJG E;  3APF A;  4PS3 A;  1KLU D;  1FIQ A;  1KRH A;  3RI7 C;  1X1M A;  3VVW B;  4FJZ A;  1RWS A;  2WXR A;  5IKC M;  2WX0 A;  1WX9 A;  3RYT A;  4XE0 A;  3NZU A;  1JAL A;  3MP9 A;  1C3T A;  1WX8 A;  2K39 A;  1WSP A;  2C60 A;  3L16 A;  1FXI A;  2G3Q B;  4BZA A;  4PS8 A;  1ZPS A;  4W9G A;  4GOC A;  1J7C A;  1N63 A;  3ONS A;  4ZOH C;  1ROE A;  2V3N A;  4EFO A;  1OEY J;  1WMH B;  2JU6 X;  2FAZ A;  5CX3 A;  3BVG A;  3BK2 A;  2LGI A;  4LDT B;  3ZYY X;  5IOI A;  3NS8 A;  1ACC A;  1MJD A;  2KVR A;  4KSK C;  4M8N A;  2INP E;  1V80 A;  1WFY A;  2WGS A;  2NPT B;  1T0S C;  5HFY A;  1JWA D;  1S1Q B;  2FBW B;  2KX3 A;  3V62 A;  1TZ1 A;  1LXD A;  2K1F A;  4JPS A;  4N9F 4;  2DZK A;  2JT4 B;  3ZIM A;  4US9 A;  3U4E G;  3VR9 B;  1YD8 U;  2NBW B;  2KX0 A;  1I4R A;  4AOF A;  2K8H A;  3H7P B;  3QIJ A;  1F2R C;  1WZ3 A;  3BII D;  3Q8A A;  2KLC A;  3RNG C;  2NR2 A;  2N9P C;  4RGM A;  2LGY A;  2K25 A;  4RGN A;  1B9R A;  4MAC A;  3QQ8 B;  3Q2A C;  4BKS D;  4PK1 A;  4AUQ C;  1P0R A;  1VR9 A;  4WWM A;  2ZNV C;  4RGT A;  3PO0 A;  4NQL B;  4ICU A;  1DOY A;  1MHH E;  2PKO A;  1TKE A;  4G11 A;  3U2S C;  1SE3 A;  2DEN B;  1T0Y A;  1SBB B;  3KWL A;  4KDL B;  1YN5 A;  4FJV B;  4KIK B;  3SDL C;  3IFW B;  2ZEQ A;  4NJ6 A;  4KZC A;  4G0N B;  2KN4 A;  1TZO A;  3TEW A;  4W9I A;  3Q8F A;  1LQB A;  4OHJ A;  3PTF C;  4A20 A;  4J3O D;  3ZDT A;  2DBY A;  3PT2 B;  1LO5 D;  4JQW C;  3VXW A;  2RPQ A;  3R66 C;  2LHE A;  3R7Q A;  2IO0 B;  3EC8 A;  3TL5 A;  4GDL A;  4MGI E;  3AXC A;  3UQB A;  3AB5 A;  4OZB A;  2LXC A;  1E7P B;  2KAJ A;  3AU4 A;  3QC8 B;  3PVL A;  2Y3A A;  3MHS D;  3DBH I;  4AJW A;  1C76 A;  2JF5 A;  3RNC C;  3B2F A;  3FIL A;  4KSL C;  4HPP A;  4FHK A;  2LAS A;  4KV2 A;  2BWF A;  2C7M B;  3LDZ E;  4PS7 A;  1MG4 A;  3VRA B;  4LNK A;  1K8R B;  3GZN I;  3ALB A;  3H8H A;  2GI9 A;  1RLF A;  4HXD A;  2N4F A;  2V3S A;  2NS5 A;  1WJN A;  1KLG D;  5D7G A;  2MWS B;  4BKS A;  5EE3 A;  4AWJ A;  4DHJ D;  2KDE B;  4K3C A;  2WX1 A;  2RMM A;  2NBV B;  3DQV A;  1RFK A;  1PGA A;  4RCO A;  2WXO A;  1D5M C;  1UGM A;  3V61 A;  1SSN A;  2RD0 A;  1Y56 A;  1JW9 D;  4AQ7 A;  2KNB A;  1MI0 A;  3QCA A;  1WGR A;  4G50 A;  2XN9 C;  4RFB A;  2BYF A;  4HWI B;  3V60 A;  1L4D B;  2BGF A;  2BYT A;  3N3K B;  3C8Y A;  4XC2 A;  3UQA A;  1QOG A;  2BS2 B;  3TJP A;  2M8S A;  1WXQ A;  1JWM D;  2QMT A;  1SGH A;  1WXS A;  3AE4 B;  5IN7 A;  3M62 B;  4RM9 A;  2PMV A;  3PRZ A;  5J18 A;  5AEK B;  2GBK A;  4XZ4 A;  2VZK B;  5LNK 1;  3HRD D;  1T0R C;  4M8M A;  3VQI A;  2AQ2 B;  3JSV B;  1E6E B;  1C1Y B;  4HKZ E;  1I4P A;  3IG3 A;  1NEN B;  3VRB B;  1QOB A;  2K3U A;  3AEB B;  2NBU A;  4M02 A;  3Q3F A;  5L95 C;  4MGY E;  1PDX A;  3IHP C;  1GAQ B;  3A9J B;  2WP9 B;  4ANW A;  1N60 A;  2SAK A;  2WXF A;  2KQS A;  3DHH C;  1OQQ A;  4C00 A;  2HDE A;  2MCN B;  4LTU A;  1RFA A;  2N7E A;  2Y5B B;  3WAL A;  3WAM A;  4KGT A;  2W9N A;  2YEP F;  2QJL A;  2JXX A;  2KLG A;  4XGA B;  1UD7 A;  1T6B X;  2REX A;  4HPL B;  4DDG D;  4BBN F;  2EKI A;  4K3B A;  5G5G A;  1I35 A;  2LZ6 A;  1I4X A;  1XLQ A;  2PE6 B;  3TEX A;  3QHT A;  1VZ7 A;  1XT9 B;  1V5O A;  2A5U A;  2D3C A;  3I3T B;  1A5R A;  3GZN B;  2W82 A;  1C9F A;  2KK8 A;  4EZJ A;  1DOI A;  1YX6 B;  4ZRK A;  1GG3 A;  2ZZP B;  4A90 A;  2YEP B;  3LJ3 A;  2RDB C;  1NBF C;  1PGX A;  4FXC A;  4P6V F;  1UH6 A;  2MBE A;  3H7P A;  3Q8B A;  4P7I A;  2QIL A;  4LLG M;  2M17 A;  3DBL B;  1BXT A;  4A3P A;  2ZCB A;  3IT6 B;  4LJP B;  1KFY B;  2O6V A;  4UDU C;  4FUL A;  2KOX A;  3X0W A;  1FMA D;  4HPM B;  4PYZ A;  2EEL A;  4K7W A;  1Z2M A;  3W2D A;  3MC0 B;  4DXF A;  3PRP B;  2ZNV B;  2MBB B;  2FCS A;  3V3X A;  2D07 B;  3ECI A;  3I9V 1;  3T9L A;  3HHM A;  4GXB A;  4HDQ A;  4EZK A;  1WWT A;  2DAF A;  4LNF A;  5DPT A;  4ZRJ A;  3EGR A;  1C78 A;  4HVB A;  2V4L A;  2RGF A;  1WGH A;  5G55 A;  1DYQ A;  3RD2 A;  4EE2 A;  3AE6 B;  3PHX B;  4DHZ E;  2R2Q A;  2YVC A;  3PZD A;  4JWS C;  4YXD B;  3DPD A;  1QIL A;  1C79 A;  1HZ5 A;  3IBE A;  2K8B A;  3PZ8 A;  3P4P B;  3SHQ A;  1AAR A;  2KC2 A;  3APC A;  3RZF A;  2RDG A;  2BYE A;  3OG5 A;  4YTN B;  3AEA B;  4MJS A;  1FFU A;  4DHZ B;  4IWP A;  4A9A A;  3DBH B;  2V9H A;  3IXS A;  2B3A A;  4LK0 M;  4GDK B;  5HKH A;  1UNS A;  2HJ1 A;  4MGZ E;  4XWT A;  1TBE A;  2ONQ A;  2G45 B;  4HJK A;  3DBS A;  3PLV A;  3SU8 X;  2RPV A;  4BOZ B;  3U8Z A;  1UGJ A;  1OQR A;  1JCK B;  2QHO A;  1E8Y A;  2D3B A;  4NJC A;  3DVG X;  2HTH A;  3VH4 B;  1E8X A;  1E8Z A;  1ET9 A;  3R2T A;  2KZR A;  1QQR A;  4M01 A;  3HM6 X;  4KZ0 A;  4M0W A;  4ZHO A;  1UZX B;  1P7F A;  3T3N A;  2GB1 A;  3DBR B;  4PYU A;  4K7U A;  1N62 A;  3NZ3 A;  2JRH A;  1GC6 A;  1XEE A;  2H89 B;  1D3Z A;  1E90 A;  2BQQ A;  3AI5 A;  4S0R A;  4WQO B;  2V3P A;  3Q8C A;  1ENF A;  2DZI A;  2NVU I;  3TMP B;  4W9K A;  4IC7 B;  2EKE C;  3PPA A;  4P1C C;  2UYZ B;  4BAX A;  3H6N A;  1SB3 C;  4C56 C;  1FXA A;  4ZRQ A;  4A8X C;  4WAF A;  2KAN A;  3BIN A;  2V1Y A;  3DHI C;  3NS1 A;  2GLS A;  2WDR B;  1QF6 A;  4AS1 A;  2BKR B;  4ZDV A;  3W1Y A;  1RYJ A;  2IZV B;  4FJY A;  1BT0 A;  2KO3 A;  2VZK D;  4YSX B;  3BZD B;  1D4B A;  3PZ7 A;  4C4V B;  1GOZ A;  4I6P A;  3Q3N C;  5CTR C;  3UF8 A;  4DXG A;  2DYO A;  1KLV A;  5FR6 A;  3R2I A;  2JUO A;  1UF0 A;  3ZVV A;  2YLM A;  2LVQ A;  3ABV B;  1V1O A;  2MA9 B;  1TS4 A;  2DNF A;  1FM0 D;  3MJW A;  3ZNI D;  3A9K B;  2WU5 B;  1JML A;  2KFJ A;  1D5X C;  1HXY D;  5G2N A;  2WXK A;  3VUX A;  5D6J B;  2O2V A;  4C7Z A;  3O65 B;  3VDZ A;  1F9J A;  1TKG A;  3AMZ A;  2RSU A;  3IVF A;  4G3X B;  3EFU A;  1P3Q U;  2MRP A;  1AYF A;  4MJS B;  2G4S A;  4XX5 A;  3MJ5 A;  3QAR A;  2SEB D;  4H2A A;  3SFD B;  2WXI A;  2V0G A;  4NY0 A;  4GIV A;  2MSE D;  3V6E B;  4TQ1 A;  1IP9 A;  3RNF C;  2AQ3 B;  2CKH B;  4W9E A;  2MJE A;  2IO3 B;  3ZTD A;  4X57 B;  2QCZ A;  1C77 A;  2W54 A;  1ZUD 2;  1N5W A;  1LFD A;  2WHI A;  3JW0 X;  5BYR A;  2MJD A;  2KXJ A;  2D10 A;  2DZM A;  2RDH A;  1QT9 A;  1WYW B;  2FNJ B;  1L0V B;  5HG2 A;  2DZJ A;  2JQR B;  3KVF B;  5DCN A;  3NZS A;  2DLB A;  3I5J C;  4DK5 A;  3ZDM C;  1AWD A;  1V8C A;  4ANV A;  1TY2 A;  1V5T A;  2JWU A;  2JWZ A;  2HTM E;  2J0J A;  3DOW A;  1WXV A;  1TYG B;  3RUI B;  3N32 A;  1PUT A;  4A55 A;  3PRE A;  3VTW A;  2KYW A;  4JE3 B;  1V97 A;  3QAQ A;  4DXA B;  3WIM A;  3RPF C;  1ZE3 D;  2DHZ A;  4NPN A;  4C7Y A;  4GN1 A;  1N6Z A;  2KAC A;  1V86 A;  1IUE A;  1KJT A;  1R4M B;  4OVU A;  4IG7 B;  2C9W B;  2L0T A;  2MH7 A;  1UWX A;  2HJ8 A;  2OJR A;  1EO6 A;  1EUV B;  1KH0 A;  4EEW A;  1HE8 A;  2D3A A;  2MP2 A;  2RR9 A;  3AEF B;  3VTU A;  2NMQ A;  4W9D A;  2LRU A;  4GDL B;  4L1B A;  5JHB A;  3JSV A;  4JIO U;  1FNV A;  1Y8R C;  1FO4 A;  4GLS C;  2OED A;  1F77 A;  1WXM A;  3A4S C;  2JPH A;  4K1R B;  1J0G A;  3HVZ A;  5D3D A;  3OWE B;  2BB5 A;  2G1E A;  4Q2J A;  2K5P A;  5T8I A;  3AEE B;  4FAD A;  1T0Q C;  2K6D B;  2WLB A;  4DHJ B;  2KDF B;  3PRM B;  3P42 A;  4LCD E;  2N9L A;  3BWU D;  1VZ6 A;  3PSE B;  3PGE A;  4W9J A;  1WJU A;  3NJT A;  4DQO C;  1SE9 A;  2WDT B;  4HK2 A;  2LHD A;  1VCB A;  1ZKH A;  3NVY A;  5E6J A;  1T3Q A;  1ZP0 B;  3CST A;  4GU2 A;  3HM3 A;  4WJQ A;  5AZG A;  5J2R A;  3VTV A;  1I4H A;  3MFG A;  2FUG 1;  3UIN B;  3B9J A;  3VUY A;  2WDQ B;  5AZH A;  2BS4 B;  2KJ6 A;  2DYM A;  2AL6 A;  5C3J B;  2VH2 A;  4YT0 B;  1SE4 A;  3DDC B;  5H92 C;  2PIA A;  1XF5 L;  4LNN A;  3A9J A;  3UIO B;  1J8C A;  3ZKJ C;  5EE1 A;  1NYQ A;  2KQ4 X;  2KDI A;  3WAN A;  2L7R A;  4GSW A;  3PHW B;  3KUZ A;  2VRR B;  5KHO A;  4QAY A;  1TKY A;  2AX5 A;  2JSV X;  1SEB D;  4W9C A;  2ZVO A;  1SIJ A;  2Z59 B;  3Q14 C;  1YN3 A;  2IGH A;  1SF0 A;  4MSQ B;  1E5W A;  4ARI A;  4II2 B;  1IPG A;  3AN1 A;  1FCL A;  1GB4 A;  2IND C;  3HK0 A;  1FFV A;  4MT5 A;  5HHD G;  2KJR A;  2JX5 A;  5KHQ A;  3CMM B;  2MP2 B;  5JH5 C;  5BYQ A;  5DPS A;  3N1Z C;  1ET6 A;  5AUK A;  2PLP A;  2J4X A;  1JQ4 A;  5E6O A;  1V81 A;  3RZW C;  4WQM A;  4WIP A;  4HRS A;  1QKZ A;  2LJ5 A;  2LUM A;  2QIE B;  1I4G A;  1K52 A;  3DWM A;  2LFI A;  3TEZ A;  4YTP B;  1K50 A;  3ZTC A;  5D3I B;  2AYO B;  1F1H A;  2M0X A;  1J7A A;  2KMA A;  3NVZ A;  3AUL A;  2IYD B;  2I2Y A;  1UBI A;  1U4A A;  4KIK A;  1P98 A;  1XLO A;  2FE8 A;  5GXG B;  1K53 A;  2C7H A;  2KVZ A;  3W5U B;  4KKI A;  2QC8 A;  3VH3 B;  5DPW A;  1L7Y A;  1JWS D;  2D3G A;  2ASQ A;  2FIF A;  2M19 A;  5BMI A;  2PE9 A;  2EMS A;  2L00 B;  4E74 A;  4D2K A;  1EWC A;  4TQ0 A;  2JXT A;  3KUC B;  1I42 A;  2L76 A;  4M00 A;  2KTR A;  3W5V B;  3B1L X;  4YTM B;  4I6N B;  3TIX A;  2W3R A;  3RCZ A;  2LWP A;  2KFK B;  3AU5 A;  2WU2 B;  3AE1 B;  1LM8 B;  3NHE B;  4GB9 A;  3AM9 A;  3RUL A;  4N59 A;  2QDF A;  2J0K A;  2FCM A;  3KLS X;  5EE0 A;  2KJH B;  2BKF A;  1TT5 B;  3PS6 A;  4FN2 A;  2NTT A;  2JZ3 B;  2KD0 A;  1WJ6 A;  3V6C B;  1XO3 A;  2NCN A;  3EHV A;  1HTO A;  3OLM D;  2TSS A;  2IJ0 A;  4BFR A;  1NI2 A;  5CHW A;  3NY5 A;  3DVN U;  4WWP A;  2PEA A;  4JL9 A;  2HE7 A;  3QK0 A;  1FRR A;  4KX6 B;  4RF1 A;  1DOX A;  2MQJ A;  1CJE A;  2LMC A;  1ZXI A;  2IGG A;  1KF6 B;  1IGD A;  4MSM B;  2N9E B;  3CIR B;  1UEL A;  2MJ3 A;  1OGW A;  4US8 A;  4K81 A;  3A9K A;  2WS3 B;  4IUM B;  4WAA A;  2DAJ A;  1GB1 A;  2INN E;  3Q3O C;  4XDD A;  4B6W A;  1QZE A;  4FA6 A;  2KDM A;  2WXP A;  2CHX A;  1FNU A;  3D32 A;  4HEA 1;  2CHZ A;  3ZNH B;  2L0F A;  3LB8 C;  4LNO A;  5JZE B;  1L0Y B;  4XDC A;  1ZGU B;  3AE8 B;  1TS5 A;  3RMK C;  3CF6 E;  3CSF A;  2D2Q A;  2BWE S;  3ZGZ A;  3EEC A;  3Q3M C;  1V49 A;  2JY6 A;  1WMH A;  4KGS A;  4ARC A;  2Z0E B;  4BVU C;  1NYR A;  2CJN A;  3UI3 A;  2K8C A;  3N9Y C;  5LXH A;  4CYE A;  3M3J A;  2XK5 B;  3PV1 A;  3AH7 A;  2BYV E;  4BKT A;  1V6E A;  4JGH B;  2WWZ A;  3HUI A;  2WXJ A;  3GS2 A;  3E56 A;  4NZL B;  2CJO A;  3N1Y C;  4LNI A;  4OZC A;  5BO4 B;  2AQ1 B;  4WWO A;  1FPY A;  1GNU A;  1QLB B;  2CS4 A;  5EE9 A;  1YN4 A;  4NNJ B;  1WZ0 A;  2Y5C A;  3L17 A;  1VD2 A;  4HDO A;  1R4N B;  2M0A A;  2KQ7 A;  1MFW A;  1Q5W B;  3H1U A;  1WE7 A;  4FBJ B;  3DCG A;  1KM7 A;  1D5Z C;  1FEH A;  4NQK E;  2N0S B;  2QEJ C;  2CR5 A;  1R4M I;  2J42 A;  1TTN A;  1PFD A;  2IGD A;  4KDI C;  2MLB A;  1GPX A;  2AL3 A;  2PPH A;  1A70 A;  2O2V B;  2MBH A;  3NRZ A;  3KWV A;  4FLH A;  4N58 A;  2XK5 A;  5E6N A;  1MHX A;  1E7U A;  2ACZ B;  2WXH A;  3WAO A;  4B9K A;  1WR6 E;  3LXF A;  1WYG A;  1P9D U;  4LJO B;  5G5H A;  4DDI D;  1J7B A;  3RT3 B;  2LGX A;  5CHV C;  1WR1 A;  3ENE A;  1JWU D;  1CZP A;  1FXT B;  1PYW D;  4DWF A;  3N20 C;  3L0W B;  2MX2 A;  1EU4 A;  2N9K A;  1WX7 A;  2ZW0 A;  4NAW A;  2N1V A;  3B2G A;  3IAS 1;  4KVG B;  1KOT A;  1STE A;  3HVD A;  1OQY A;  4OW0 A;  3RFZ B;  2N7J A;  2O6V B;  3A4R A;  3RNE C;  2I1J A;  4ZYS A;  1C4C A;  2FCN A;  1EWY C;  2KT7 A;  4TMA B;  2JZP A;  2KN5 A;  2ZPN A;  4A3O A;  2L1A A;  4C4V A;  4EUT A;  5TR5 A;  4NJ7 A;  1GC7 A;  1EU3 A;  3VUW A;  1L5P A;  3R8B A;  4R3D A;  2PTL A;  3M95 A;  2UWQ A;  2BPS A;  1ISN A;  2DYB A;  3APD A;  1TS2 A;  1VRA B;  1XLP A;  1L2N A;  4P16 A;  3KW5 B;  3TSS A;  1Q1O A;  3JYU A;  2AEH A;  3P4Q B;  5DPR A;  1WIA A;  2J53 A;  3ZRC A;  1NI3 A;  1P1A A;  3L10 B;  1IYF A;  4GMV A;  3J9C A;  1G6J A;  1FD6 A;  3KQ4 A;  3SEB A;  3URY A;  2VH1 A;  2KMC A;  3AED B;  5BMG A;  3U7D A;  3AV8 A;  2MW5 A;  1MVK A;  1T5X D;  4C80 A;  1J19 A;  4RNA A;  2KTR B;  4MGK E;  2LI5 A;  4OVZ A;  1E10 A;  3U30 A;  4GGQ A;  2Y5P A;  4CO7 A;  3A1Q A;  4IM0 A;  2J0M A;  3FIL B;  2X38 A;  5CHF A;  5GMV A;  4ZHP A;  3RNA C;  4II3 B;  2V4I B;  1Z5S B;  2WDV B;  2OHF A;  1RRB A;  1SIF A;  2KHW B;  1RAX A; 
#chains in the Genus database with same CATH homology
 3ZW3 A;  2KK8 A;  4EZJ A;  3S2A A;  1YX6 B;  4ZRK A;  3ZLZ A;  1WI0 A;  1OEY A;  3DDC B;  4AP4 C;  1GG3 A;  4ZRI A;  2JRI B;  2GBR A;  1E8W A;  3A9J A;  4MH0 E;  2ZZP B;  4W9H A;  4ASW C;  1WM2 A;  3LJ3 A;  4MM3 A;  3UIO B;  1J8C A;  3ZKJ C;  1NBF C;  3WAN A;  2KDI A;  2LRW A;  1V9J A;  2LVO A;  1UH6 A;  2L7R A;  3OJ3 A;  2KWU B;  2MBE A;  2Z0D B;  2VRR B;  3H7P A;  3KUZ A;  3PHW B;  4GSW A;  5KHO A;  4DBG A;  2GBJ A;  2N7D A;  4P7I A;  3L13 A;  1WF9 A;  2M17 A;  4HLE A;  4A3P A;  1WY8 A;  2KC1 A;  2ZCB A;  4LJP B;  4W9C A;  1PQS A;  2O6V A;  2GOW A;  2ZVO A;  2G4D B;  3B0A A;  4K7S A;  4B95 A;  4FUL A;  4ANU A;  2GBN A;  2Z59 B;  1YJ1 A;  3A33 B;  2KOX A;  3X0W A;  4ANX A;  2C7N B;  4HPM B;  2ZJD A;  4PYZ A;  3KH0 A;  4K7W A;  2FCQ A;  4MSQ B;  1E5W A;  1Z2M A;  4II2 B;  2N1W A;  1IPG A;  3PRP B;  2ZNV B;  2MBB B;  5IA7 A;  2FCS A;  3H9D A;  3HK0 A;  2IO1 B;  2D07 B;  4EOY A;  3ECI A;  4F1S A;  4HCP B;  3WAP A;  3T9L A;  3HHM A;  4GXB A;  2KJR A;  4HDQ A;  4BOS C;  1WJ4 A;  4EZK A;  1MG8 A;  4ZRJ A;  2DAF A;  4JLC A;  4LDT D;  5DPT A;  5KHQ A;  3MTN B;  3CMM B;  2MP2 B;  4HVB A;  2V4L A;  3ML8 A;  5JH5 C;  4MEM A;  5DPS A;  2RGF A;  1WGH A;  3ZRF A;  5G55 A;  4IWQ A;  5E6O A;  1YX5 B;  1V81 A;  3RZW C;  2KFK A;  3RD2 A;  4I6L B;  2ZVN A;  2AWT A;  4MEL A;  2IY1 B;  3DBL I;  2LJ5 A;  3M63 B;  3PHX B;  2FUH B;  4IM3 A;  4DHZ E;  3T8M A;  3QX1 A;  3L54 A;  2R2Q A;  2YVC A;  4IWO A;  3PZD A;  2ZPY A;  3ZTC A;  1WGG A;  3DVG Y;  2AYO B;  3DPD A;  2M0X A;  2KMA A;  3IBE A;  3AUL A;  2K8B A;  5J17 A;  2IYD B;  3APF A;  4PS3 A;  1UBI A;  3ZNZ B;  5LLI A;  3SHQ A;  1U4A A;  4KIK A;  1P98 A;  5EDS A;  1X1M A;  3VVW B;  4E71 A;  1AAR A;  2KC2 A;  3APC A;  4FJZ A;  2C7H A;  3RZF A;  5L83 A;  2BYE A;  2MBQ A;  2WX0 A;  3VH3 B;  1WX9 A;  4MJS A;  3RYT A;  5DPW A;  1L7Y A;  4DHZ B;  3NZU A;  4IWP A;  2D3G A;  3NOB A;  2ASQ A;  2FIF A;  2B3A A;  1WX8 A;  1C3T A;  2JVC A;  2K39 A;  5C1Z A;  2PE9 A;  2EMS A;  2L00 B;  3H7S A;  4GDK B;  4E74 A;  3W1S A;  5HKH A;  2C60 A;  4YL8 A;  4MGZ E;  1TBE A;  4TQ0 A;  3L16 A;  2G3Q B;  2G45 B;  4HJK A;  4PS8 A;  2XEW A;  3DBS A;  3KUC B;  4W9G A;  3PLV A;  3SU8 X;  4GOC A;  4BOZ B;  1I42 A;  3U8Z A;  2L76 A;  1M94 A;  2KTR A;  4W9L A;  1WE6 A;  2QHO A;  3B1L X;  4BKG A;  4GDK A;  4I6N B;  3ONS A;  3TIX A;  3RCZ A;  2LWP A;  2KFK B;  3AU5 A;  1E8Y A;  4EFO A;  1OEY J;  1WMH B;  2FAZ A;  1LM8 B;  5CX3 A;  2O6V D;  1WH3 A;  3DVG X;  2HTH A;  4LDT B;  3NHE B;  3VH4 B;  1E8X A;  1E8Z A;  4TUU A;  4GB9 A;  3NS8 A;  3RUL A;  3QJZ A;  2KVR A;  2KZR A;  3WA0 A;  2J0K A;  2FCM A;  4WJN A;  2PJH A;  3HM6 X;  4KZ0 A;  2KJH B;  2BF8 B;  4KSK C;  4M8N A;  2BKF A;  3PS6 A;  4FN2 A;  1UZX B;  1V2Y A;  1V80 A;  2JZ3 B;  4IW0 A;  2KD0 A;  1WFY A;  3KUD B;  1WJ6 A;  2NPT B;  3V6C B;  4PYU A;  2NCN A;  1S1Q B;  4K7U A;  3EHV A;  2JRH A;  3OLM D;  1GC6 A;  2KX3 A;  1TZ1 A;  3V62 A;  1LXD A;  4BFR A;  1NI2 A;  5CHW A;  2K1F A;  1D3Z A;  4N9F 4;  4WWN A;  2DZK A;  1E90 A;  2JT4 B;  3NY5 A;  1NDD A;  3DVN U;  3ZUN A;  4WWP A;  3ZIM A;  2PEA A;  4JL9 A;  2HE7 A;  3AI5 A;  3QK0 A;  4WQO B;  2MQJ A;  1WRD B;  1YD8 U;  2LVP A;  2DZI A;  2NVU I;  3TMP B;  2NBW B;  4W9K A;  2KX0 A;  4IC7 B;  2EKE C;  3PPA A;  4AOF A;  4MSM B;  2UYZ B;  4IM2 A;  2K8H A;  3H7P B;  2C5L C;  3QA8 A;  3QIJ A;  2N9E B;  3SD5 A;  3H6N A;  1WZ3 A;  1UEL A;  1OGW A;  2KLC A;  5LXI B;  4K81 A;  3A9K A;  2HD5 B;  4WJP A;  2NR2 A;  2KAN A;  2N9P C;  2LGY A;  1CMX B;  2K25 A;  3BIN A;  4RMA A;  4IUM B;  4WAA A;  2IO2 B;  2V1Y A;  4BKS D;  2M4N A;  3QQ8 B;  2DAJ A;  2ZCC A;  1YIW A;  4B6W A;  1QZE A;  4AUQ C;  1P0R A;  4FA6 A;  2WYQ A;  2LGD A;  2ZNV C;  4W9F A;  2CHX A;  3KYC D;  4NQL B;  3D32 A;  2BKR B;  4ZDV A;  4ICU A;  4OVV A;  3ZNG C;  4G11 A;  3W1Y A;  1Q0W B;  2CHZ A;  2IZV B;  4FJY A;  3R3M A;  1BT0 A;  3UGB B;  3ZNH B;  2L0F A;  2KO3 A;  2DEN B;  2D11 A;  2J7Q B;  5JZE B;  1T0Y A;  1ZGU B;  3DBR I;  4KDL B;  4KIK B;  4FJV B;  4I6P A;  5CTR C;  3SDL C;  3UF8 A;  3IFW B;  1WGD A;  2DYO A;  2ZEQ A;  4G0N B;  3CF6 E;  3CSF A;  3PLU A;  4KZC A;  4NJ6 A;  2D2Q A;  5FR6 A;  1KLV A;  2EMT A;  2BWE S;  2JUO A;  4W9I A;  4RM8 A;  3VAW A;  1GUA B;  1LQB A;  3EEC A;  3ZVV A;  1V49 A;  1R4N I;  2JY6 A;  2YLM A;  3PTF C;  2LVQ A;  1WMH A;  4A20 A;  5E6P A;  3ZDT A;  1EF1 A;  2MA9 B;  2Z0E B;  4BVU C;  3PT2 B;  2K8C A;  5LXH A;  3MJW A;  3ZNI D;  3M3J A;  4CYE A;  3A9K B;  2XK5 B;  3PV1 A;  4JQW C;  3VXW A;  4AJY B;  2RPQ A;  5C23 A;  2KFJ A;  3R66 C;  3R7Q A;  2IO0 B;  2BYV E;  3EC8 A;  5G2N A;  3TL5 A;  4GDL A;  3UIP B;  4BKT A;  1V6E A;  4MGI E;  4MDK E;  2O2V A;  5D2M B;  5D6J B;  4JGH B;  2WWZ A;  3AXC A;  3O65 B;  3TBL D;  3UQB A;  3VDZ A;  1F9J A;  2GBM A;  2RSU A;  3IVF A;  2IY0 B;  4G3X B;  2LXC A;  3EFU A;  5BO4 B;  4WWO A;  1P3Q U;  2K6Q A;  2MRP A;  1GNU A;  2GMI C;  3AU4 A;  4MJS B;  2G4S A;  4XX5 A;  3QC8 B;  3QAR A;  3PVL A;  2LUE A;  2CS4 A;  4NNJ B;  1WZ0 A;  3MHS D;  3L17 A;  2M1M A;  1VD2 A;  1ZW7 A;  1JRU A;  3DBH I;  3KYD D;  4HDO A;  4ICV A;  4TV3 A;  4AJW A;  2KQ7 A;  1Q5W B;  4NY0 A;  4NAW B;  4GIV A;  2MSE D;  3H1U A;  3V6E B;  4TQ1 A;  1IP9 A;  2JZZ A;  3K9P B;  2CKH B;  4W9E A;  3ZTD A;  1WE7 A;  2IO3 B;  2NPT A;  3QWZ B;  2JF5 A;  1WGY A;  1KM7 A;  3DCG A;  4X57 B;  4FBJ B;  1E7V A;  4KSL C;  1UBQ A;  4FHK A;  2LAS A;  4KV2 A;  4HCN B;  2BWF A;  4NQK E;  5D94 A;  2C7M B;  1LFD A;  3JW0 X;  3LDZ E;  2CR5 A;  2KXJ A;  1R4M I;  2D10 A;  1TTN A;  2DZM A;  4PS7 A;  4KDI C;  2KWV B;  1K8R B;  3GZN I;  2MLB A;  3ALB A;  2AL3 A;  1XD3 B;  2PPH A;  4EZL A;  3VHT C;  2A4Z A;  1RLF A;  2O2V B;  4HXD A;  1WYW B;  2MBH A;  2N4F A;  2FNJ B;  3DVN V;  4FLH A;  3VFK A;  2FID A;  2DZJ A;  2NS5 A;  2V3S A;  3KVF B;  1WJN A;  5DCN A;  5D7G A;  2XK5 A;  5E6N A;  2MWS B;  4BKS A;  3NZS A;  3N30 A;  1E7U A;  4AWJ A;  4DK5 A;  4DHJ D;  2KDE B;  3ZDM C;  4ANV A;  3OAW A;  1V5T A;  2JWZ A;  2WX1 A;  3WAO A;  2NBV B;  3DQV A;  4B9K A;  4URK A;  2J0J A;  3DOW A;  1WR6 E;  1WXV A;  2CU1 A;  1P9D U;  4LJO B;  3RUI B;  4DDI D;  3N32 A;  5JHA A;  3RT3 B;  2LGX A;  5CHV C;  4EKU A;  2KWC A;  3PRE A;  3VTW A;  1WR1 A;  3ENE A;  1UGM A;  3V61 A;  1FXT B;  2RD0 A;  3QAQ A;  4DXA B;  4DWF A;  4WJO A;  3WIM A;  2KNB A;  3A1Q B;  3L0W B;  2MX2 A;  3C0R B;  3QCA A;  1WGR A;  4G50 A;  4BBN C;  4J6I A;  3JVZ X;  4M0W B;  1WX7 A;  2BYF A;  4HWI B;  4NAW A;  2DHZ A;  4NPN A;  2N1V A;  3V60 A;  4GN1 A;  2XBB C;  2L05 A;  2MBO A;  4KVG B;  1KOT A;  3K9O B;  1V86 A;  2BGF A;  1OQY A;  1KJT A;  3N3K B;  4IG7 B;  4OVU A;  4XC2 A;  4CHK A;  2C9W B;  3UQA A;  2L0T A;  2HJ8 A;  3HIZ A;  2O6V B;  2OJR A;  2R2O A;  3A4R A;  1EO6 A;  1EUV B;  2I1J A;  3TJP A;  4EEW A;  2FCN A;  1H8C A;  2M8S A;  3Q3J A;  1HE8 A;  2LD9 A;  2MP2 A;  1SGH A;  2RR9 A;  4TKN A;  3VTU A;  2CHW A;  4W9D A;  1OTR B;  2KN5 A;  1WXS A;  2LRU A;  2ZPN A;  4GDL B;  2LXA A;  4A3O A;  1GJZ A;  3M62 B;  4EUT A;  5JHB A;  3JSV A;  4JIO U;  3L08 A;  4RM9 A;  3PRZ A;  5TR5 A;  5J18 A;  1Y8R C;  4NJ7 A;  1GC7 A;  5AEK B;  2GBK A;  3VUW A;  1WXM A;  3A4S C;  4XZ4 A;  4F8C B;  2JPH A;  4K1R B;  3M95 A;  1XQQ A;  1J0G A;  2UWQ A;  2BPS A;  4M8M A;  1ISN A;  2DYB A;  3APD A;  3TCA A;  3BY4 B;  3VQI A;  2DX5 B;  3P2B A;  3R7R A;  3JSV B;  2KDB A;  4FAD A;  1H4R A;  1C1Y B;  1L2N A;  2K6D B;  4DHJ B;  2KKC A;  3KW5 B;  2KDF B;  3PRM B;  3IG3 A;  5AZF A;  1Q1O A;  3JYU A;  2AEH A;  4LCD E;  5DPR A;  1S3S G;  1WIA A;  3ZRC A;  1P1A A;  3ZO5 B;  3L10 B;  1IYF A;  4GMV A;  3PSE B;  3PGE A;  2NBU A;  2IBI B;  3VUX A;  1EF5 A;  4E3C A;  1G6J A;  4W9J A;  3Q3F A;  1WJU A;  5L95 C;  2N9X A;  4MGY E;  2OOB B;  2KMC A;  2KTF A;  3IHP C;  3U7D A;  1SE9 A;  2WDT B;  4HK2 A;  2MW5 A;  1VCB A;  3A9J B;  4ANW A;  3OJ4 B;  1ZKH A;  1J19 A;  1WXA A;  2KQS A;  2KTR B;  3CST A;  3ML9 A;  4MGK E;  2LI5 A;  4GU2 A;  3HM3 A;  1TGZ B;  4WJQ A;  2MCN B;  3WAL A;  1RFA A;  2N7E A;  2Y5B B;  3WAM A;  3X23 A;  2W9N A;  5AZG A;  3U30 A;  5J2R A;  3VTV A;  4GGQ A;  3GOE A;  2JXX A;  3UIN B;  4CO7 A;  3B08 A;  3A1Q A;  2KLG A;  1UD7 A;  4IM0 A;  4ZYN A;  5IAA C;  2REX A;  4HPL B;  2J0M A;  4DDG D;  2L8J A;  3VUY A;  5CHF A;  4BBN F;  5AZH A;  5GMV A;  1I35 A;  2LZ6 A;  1WM3 A;  2PE6 B;  2KJ6 A;  4II3 B;  3QHT A;  1XT9 B;  2DYM A;  2L3Z A;  1Z5S B;  1V5O A;  2A5U A;  3I3T B;  2AL6 A;  1A5R A;  2I1K A;  3W1S C;  1RRB A;  1YQB A;  1SIF A;  2KHW B;  4FHJ A;  4F7Z A;  1RAX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...