3RD2A

Nip45 sumo-like domain 2
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
82
structure length
82
Chain Sequence
MHHHHHHSQQLQLRVQGKEKHQTLEVSLSRDSPLKTLMSHYEEAMGLSGRKLSFFFDGTKLSGRELPADLGMESGDLIEVWG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title DNA repair and global sumoylation are regulated by distinct Ubc9 noncovalent complexes.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription
molecule keywords NFATC2-interacting protein
total genus 16
structure length 82
sequence length 82
ec nomenclature
pdb deposition date 2011-03-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF11976 Rad60-SLD Ubiquitin-2 like Rad60 SUMO-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 3rd2A00
3QWZB 3Q3JA 2UYZB 4FA6A 3R66C 4KIKA 4OVVA 2WDTB 2MSED 1KOTA 1J19A 2D3GA 2KTRB 4HCPB 2NBUA 2MBHA 1MG8A 4I6NB 4HCNB 1V2YA 2CS4A 5LXHA 3M62B 5E6NA 1WGGA 2ZNVB 4TKNA 2ZNVC 2O2VA 3NS8A 2GMIC 4GB9A 1WXSA 4EUTA 2C7MB 4LJOB 4RM9A 2IO1B 2LI5A 3AXCA 4LJPB 2O6VB 3IVFA 5J17A 2DHZA 2JRIB 2MBOA 1I35A 3ONSA 1GC6A 5DCNA 1WF9A 1C1YB 2L7RA 4W9IA 2JZZA 5DPSA 3DVNU 2J0JA 4BOSC 4GDLB 4HDQA 4MM3A 1V49A 1X1MA 4GSWA 2KKCA 1J0GA 3M63B 4MELA 3KUZA 1C3TA 3PVLA 4IM0A 1VCBA 4A3PA 1YIWA 2ZVNA 3WAPA 4W9KA 2LRWA 2DAJA 4BFRA 1P3QU 2NBWB 3UGBB 2A5UA 2FAZA 2HE7A 3DVGY 1P1AA 4ZYNA 1WR6E 3HHMA 3PRPB 1V9JA 1UBIA 2DYBA 3AI5A 3JYUA 3QIJA 1WJNA 4IUMB 1E8XA 4EFOA 4M8NA 1V5TA 1UBQA 3OLMD 4GOCA 3UF8A 2J0KA 1XQQA 4URKA 1L2NA 2KDIA 2IO3B 3KW5B 2D10A 3ZW3A 1UELA 2N9PC 1IYFA 1LXDA 4K7SA 2L05A 3AULA 1P98A 3Q3FA 4WWOA 4DHJD 4P7IA 3TBLD 3SD5A 4TQ0A 2I1JA 1I42A 1TBEA 1WFYA 1WI0A 3L54A 4JIOU 3RUIB 1YD8U 2N9XA 3NY5A 4ICUA 2MRPA 4K7UA 1J8CA 3NZSA 4PYUA 1NDDA 2LVQA 2YVCA 3TL5A 1WX9A 3A9JB 4G11A 1CMXB 3V60A 2DAFA 2MLBA 4NQKE 3PPAA 2L8JA 3B1LX 3NHEB 3OJ3A 4HLEA 1K8RB 4MSMB 3ZO5B 1OGWA 2FCQA 5KHOA 3HK0A 1OEYJ 3W1YA 2KFJA 2K6QA 2L00B 1YX6B 5D6JB 2EMTA 3VHTC 2PE6B 3SDLC 4OVUA 3H7SA 4IWQA 1LM8B 2JZ3B 4WJOA 3M95A 2MWSB 3A1QB 3BINA 4FJZA 2NPTB 4ICVA 4RMAA 2ZJDA 4XZ4A 1V86A 1WX7A 5AZHA 1WZ3A 3A9KA 2KVRA 2DZIA 3QHTA 3U30A 5D2MB 1WXVA 4CO7A 2K6DB 2ZZPB 3QAQA 3IHPC 3V61A 3DVNV 2K25A 2WWZA 5G55A 4MEMA 1WE6A 2KMAA 3SHQA 2AEHA 2GBKA 2WYQA 2M1MA 5DPTA 4G3XB 5D7GA 2IZVB 2MQJA 2RPQA 4MGZE 5EDSA 3NOBA 2BYFA 1WX8A 3CMMB 4K81A 3A4SC 4HWIB 2DX5B 4FLHA 3SU8X 4ANUA 4EZLA 5IA7A 4HPMB 4XX5A 4MDKE 2JVCA 2LVOA 3TCAA 2C9WB 1Q1OA 1OQYA 3RCZA 4PS7A 4LCDE 3H7PA 2M4NA 2PEAA 2MP2B 2N1WA 1GC7A 1YX5B 3JSVA 2L0TA 1WJ6A 4RM8A 4WQOB 2D07B 1BT0A 4KIKB 2RR9A 2K1FA 2G4DB 1Q5WB 2K8BA 4BKSD 2DZMA 2J7QB 2KFKA 2MX2A 2RD0A 3UIOB 3APCA 3DBLI 2Z0DB 2LJ5A 2BGFA 3VH3B 2LWPA 4GU2A 4DXAB 3QA8A 3ECIA 4F7ZA 1E5WA 2CR5A 4MH0E 1VD2A 1WYWB 1S1QB 2MP2A 2JT4B 3ENEA 4LDTD 4EZKA 3JVZX 4LDTB 2KANA 3DBSA 2C7NB 3C0RB 3ML8A 4KZCA 3W1SA 1YQBA 4IM2A 2EMSA 4F1SA 3DVGX 5LLIA 1SIFA 4ASWC 1GG3A 2RGFA 3T8MA 3V62A 2R2QA 4EEWA 3QK0A 4G50A 2FCMA 2BF8B 2O2VB 2MBBB 3JSVB 2JF5A 3TIXA 2V4LA 1UGMA 4I6LB 2XK5A 3N3KB 2ZVOA 4A20A 2KC1A 3DDCB 1WXAA 2IBIB 3GZNI 2GOWA 2LRUA 5C1ZA 4ZRKA 4TV3A 2FCNA 2O6VD 2ZPNA 2KFKB 4NAWA 3D32A 3I3TB 3VTUA 4BKTA 4HDOA 2J0MA 2HD5B 1WRDB 1HE8A 2KLGA 2RSUA 4JQWC 3L17A 4NPNA 3P2BA 1L7YA 1OEYA 2KZRA 2LXAA 4MGIE 2L3ZA 2M8SA 2V3SA 4NJ6A 3WA0A 4KDLB 1ZW7A 2HJ8A 2AYOB 3A4RA 3ZNGC 4B9KA 2C60A 3T9LA 5CHFA 2M0XA 2XBBC 2PE9A 2ZPYA 2LGXA 4BVUC 2C7HA 3ZRCA 4XC2A 2D11A 1NI2A 2BKFA 4BKSA 1WH3A 4FADA 2AL6A 1V80A 2JRHA 2N1VA 2Z59B 2YLMA 2CHZA 3VTVA 2DYOA 4WJQA 4BBNF 2HTHA 4FHJA 1KM7A 4I6PA 1TTNA 1E7VA 4MGYE 3VXWA 2KQ7A 2KDFB 4W9LA 2MBEA 2DENB 3PSEB 3QARA 2FNJB 1E7UA 2BPSA 2IY1B 2K8CA 3DBRI 4MGKE 5JHBA 3OJ4B 2ZCBA 1LQBA 2A4ZA 2JY6A 3PREA 1WM2A 2CHWA 4HK2A 1WMHB 3O65B 3DPDA 2BYVE 4IM3A 4NAWB 2JXXA 3N30A 4W9GA 2NS5A 3GOEA 3MHSD 4EOYA 5L83A 4WWPA 4HPLB 4AJYB 2W9NA 2JWZA 4DHZE 1IPGA 2KK8A 3B08A 3VDZA 4DHJB 2NPTA 5AZFA 2WX0A 4JL9A 3KUCB 2GBRA 4M8MA 4FULA 1Y8RC 2KDBA 3IFWB 1RRBA 1WXMA 2KD0A 3QJZA 4NNJB 3DQVA 4KVGB 3ZUNA 4ANXA 2L0FA 4HVBA 4PS3A 4E71A 2O6VA 3HM6X 1SGHA 3A1QA 1Z2MA 3HIZA 3PZDA 1KLVA 2MBQA 4WAAA 3WAMA 3PLVA 3QC8B 1UD7A 5E6PA 4AUQC 4EZJA 1XT9B 4GN1A 1S3SG 4PYZA 2QHOA 4AOFA 2KX0A 3ZDTA 3CF6E 3RT3B 4E74A 4N9F4 1WGYA 5E6OA 4AP4C 5J2RA 4KV2A 3PRZA 3EFUA 3H6NA 3H1UA 1QZEA 1RAXA 1KJTA 3ZTCA 2IO2B 3MTNB 2CHXA 1XD3B 2FUHB 1EF1A 4IWPA 2EKEC 4FJVB 2KJ6A 2PPHA 4GDKB 1UZXB 1H8CA 1P9DU 4DK5A 1GUAB 2NR2A 1WGDA 3RYTA 2I1KA 2KC2A 4W9EA 3ZIMA 4BBNC 3BY4B 4W9CA 3N32A 1M94A 1FXTB 3NZUA 4B6WA 1E8WA 3ZKJC 3PT2B 1TGZB 3KUDB 3CSFA 2PJHA 4FHKA 3KYCD 4AJWA 2CKHB 5DPRA 1EF5A 2N7EA 2BKRB 4HJKA 3VUYA 2CU1A 5JHAA 2G3QB 4GDKA 3L0WB 3WALA 3PTFC 4X57B 1AARA 4AWJA 2KWVB 3WAOA 1ZKHA 2BYEA 4NQLB 2N4FA 5CHWA 5KHQA 4IC7B 5IAAC 2MW5A 3PRMB 3HM3A 4ZRIA 2KWUB 3PGEA 5AZGA 3AU4A 1WZ0A 1WY8A 3WIMA 3ZDMC 4II3B 5J18A 3ZVVA 3IG3A 2OJRA 3L16A 2V1YA 2REXA 5CHVC 3UINB 3MJWA 4IWOA 4M0WB 2MA9B 1V81A 1G6JA 2KMCA 3A9JA 4WWNA 3TMPB 2KQSA 5LXIB 1R4NI 2ZEQA 2IY0B 2KNBA 3B0AA 3OAWA 1ZGUB 5CTRC 3VFKA 4G0NB 2ZCCA 1YJ1A 2KJRA 4YL8A 1SE9A 1UH6A 3RZFA 1EUVB 3ML9A 4GGQA 2XK5B 2KXJA 4HXDA 2IYDB 2GBJA 2LASA 1WMHA 2GBNA 4DWFA 3H7PB 1E90A 3ZLZA 5AEKB 2D2QA 2XEWA 2LVPA 3A33B 2ASQA 3IBEA 1OTRB 1RLFA 3DOWA 4ANWA 4DBGA 4TUUA 5G2NA 3KYDD 3V6CB 3K9PB 1EO6A 4ZRJA 2Z0EB 3UIPB 1T0YA 3VUXA 5FR6A 1WJ4A 3L08A 3QCAA 4J6IA 4KZ0A 4MJSA 3RZWC 5CX3A 3X0WA 5GMVA 4B95A 5L95C 2L76A 3TJPA 3LJ3A 4BKGA 3VQIA 5DPWA 3ZTDA 2LZ6A 3ZNID 2NVUI 4MSQB 4CHKA 3VAWA 3APDA 3KVFB 1PQSA 3VUWA 2VRRB 3ZNHB 2JPHA 4IG7B 4KSKC 2C5LC 4KDIC 3DBHI 3X23A 2R2OA 4WJPA 2KHWB 1WGRA 4GMVA 1E8ZA 2KDEB 4FJYA 4E3CA 4FN2A 2LXCA 2LUEA 3PHWB 5HKHA 1D3ZA 3VVWB 2FIDA 3AU5A 1IP9A 3JW0X 3KH0A 1U4AA 5TR5A 2JUOA 2Y5BB 3R7RA 2NCNA 3PLUA 5JH5C 4WJNA 5JZEB 4ANVA 1NBFC 4CYEA 1WR1A 2N9EB 5C23A 3ZNZB 2MCNB 1H4RA 2LD9A 3QX1A 3PHXB 1ISNA 4GXBA 2BWFA 5BO4B 3WANA 4JGHB 2KTRA 4GIVA 2K39A 3EC8A 1WE7A 2M17A 2IO0B 1WGHA 3R7QA 2DZJA 1A5RA 2N7DA 3RD2A 1V5OA 4W9JA 3RULA 2NBVB 1Z5SB 3L13A 3U7DA 2FCSA 4II2B 2B3AA 4TQ1A 3S2AA 3PV1A 3R3MA 2OOBB 3K9OB 3ZRFA 4FBJB 4NJ7A 2KLCA 2WX1A 4PS8A 3EECA 2KOXA 4KSLC 4W9DA 1E8YA 3H9DA 2GBMA 4DDID 2KTFA 2AL3A 3VH4B 2G45B 4ZDVA 1WJUA 2KN5A 4JLCA 4BOZB 2FIFA 3UQBA 1RFAA 4IW0A 2DZKA 2KWCA 4GDLA 3LDZE 3M3JA 2KX3A 3A9KB 2KJHB 4DHZB 3APFA 3L10B 3DCGA 4MJSB 2K8HA 2KO3A 3VTWA 3U8ZA 1P0RA 1JRUA 3W1SC 4EKUA 4K7WA 4A3OA 1V6EA 1R4MI 1Q0WB 1GJZA 2G4SA 3UQAA 1TZ1A 4W9HA 2AWTA 2BWES 1WIAA 5D94A 4DDGD 2DYMA 4K1RB 1LFDA 4W9FA 3CSTA 3QQ8B 4F8CB 3PS6A 1WM3A 4NY0A 3ALBA 1F9JA 2LGYA 2UWQA 3EHVA 1GNUA 3V6EB 2LGDA
chains in the Genus database with same CATH superfamily
3QWZB 2EKIA 4M0WA 2G1EA 2MSED 1KOTA 4HCPB 1PUTA 3MJ5A 4HCNB 4GB9A 2GMIC 1EM7A 1WXSA 3AEDB 1I4PA 1JQ4A 3IVFA 1I35A 5DCNA 5D3IB 3GE3C 3DVNU 4HDQA 4MM3A 1V49A 1X1MA 1J0GA 3KUZA 4IM0A 4N6EB 1P3QU 4ZYNA 1WR6E 3PRPB 1QF6A 3CWIA 2I38A 1WJNA 2GRIA 4IUMB 1V5TA 4GOCA 2J0KA 1I7HA 1TY2A 2K9XA 2IO3B 2D10A 2VH1A 2N9PC 4K7SA 4B0EA 2I1JA 4JWUC 1TBEA 1WFYA 2QILA 3RUIB 2N9XA 4K7UA 4HROA 1F2RC 4PYUA 2YVCA 3NZ3A 1CMXB 1SJHD 3SFDB 3NHEB 2K3UA 5KHOA 3GP7A 4JE3B 3W1YA 2KFJA 2K6QA 1IBXB 4KX6B 1UUPA 3Q8CA 3VHTC 1JRPA 2JYEA 3NS1A 4OVUA 4EE2A 2JZ3B 1XCQL 2IJ0A 2MWSB 4XZ4A 2LMCA 1Y56A 2ZJDA 4A9AA 4MM3B 2K6DB 3V61A 3DVNV 2K25A 2WWZA 1N5WA 3BZDB 1JWAD 4Q2JA 4MGZE 2LFIA 1OQRA 5EE3A 4K81A 3A4SC 4FLHA 4A55A 4ANUA 5IA7A 2LVOA 1R4MB 3TCAA 4WIPA 3RCZA 1FRDA 1N63A 3P4PB 2PEAA 1ZP0B 2UU7A 1GC7A 2W54A 2D07B 1BT0A 1RFKA 1T3QA 4S17A 2BGFA 4DXAB 3ECIA 4F7ZA 1WGKA 2CR5A 1VD2A 1WYWB 1HTOA 3BK2A 2BT6A 4EZKA 3JVZX 1J7BA 5LLIA 2RMMA 3T8MA 4YWGG 3QK0A 1TIFA 2FCMA 2BF8B 3NVYA 2MBBB 3GB1A 2V4LA 3LB8C 3Q8AA 1WXAA 2IBIB 3GZNI 4ZRKA 4B0MA 1ET9A 2O6VD 1TS5A 2KFKB 3I3TB 4BKTA 2HD5B 2KLGA 2RDBC 1OEYA 4IDIA 1MPEA 4MGIE 2L3ZA 2M8SA 2V3SA 5FK9C 3AN1A 4NAMA 3EA6A 4KGSA 3MC9A 3TEWA 1ZDXA 3ZGZA 3T9LA 5CHFA 2ON8A 2LGXA 2JU6X 2WXOA 4P6VF 1WH3A 4FADA 2YLMA 3ZYYX 2HTHA 1SE3A 1KM7A 3VXWA 2NMQA 5EE0A 2FNJB 3GS2A 5JHBA 2QEJC 1LO5D 1LQBA 2A4ZA 2JY6A 4OZCA 3DPDA 4IM3A 3URYA 4EOYA 2QIEB 5L83A 3AE9B 4WWPA 4AJYB 2JWZA 1IPGA 3AMZA 2D5GA 5BMHA 4DHJB 5BYSA 4HEA1 2GBRA 1WXMA 4KVGB 2WDRB 4LNFA 4TMAB 3HIZA 4R3DA 1D6EC 1NENB 1Z2MA 1RM6C 3BK1A 3PZDA 4WAAA 1UD7A 4EZJA 1S3SG 2LHEA 3CF6E 2H89B 1L4ZB 5J2RA 1QQRA 3EFUA 1MHHE 3H6NA 3Q8FA 1RAXA 4P1CC 2PPHA 4GDKB 1WGDA 4W9EA 4BBNC 3MFGA 2E6XA 2WS3B 4HKQA 1M94A 1ZXHA 4B6WA 1F1HA 1E8WA 3P63A 3KYCD 2CKHB 1SSNA 2HJ1A 4HJKA 4GDKA 4AS1A 1TT5B 3L0WB 4ZHPA 4DXGA 2PLPA 5EE9A 3Q14C 2KAJA 2BYEA 5IAAC 3PRMB 4IOIE 1TS3A 3AU4A 3AEEB 3IAS1 4RCOA 3TEZA 1OQQA 2OJRA 3L16A 2REXA 3I63C 1UWMA 3N1YC 4IWOA 1TYGB 4WWNA 5BYQA 2AX5A 5LXIB 4G0NB 1YJ1A 1MI0A 2KJRA 1WWTA 1SE9A 3ZXVA 3RZFA 2N9LA 4GLSC 2GBNA 3TSSA 3H7PB 3FILB 1KF6B 1TKGA 2ASQA 1D5ZC 1OTRB 1ZE3D 5G2NA 3KYDD 1FFVA 2WXJA 2Z0EB 3AV8A 5FR6A 4B95A 4BKGA 4A6QA 5DPWA 1IBXA 1HZ6A 3KVFB 1JWBD 3BWUD 2VRRB 2C5LC 4WJPA 4GMVA 3NVZA 2KDEB 4FN2A 5HKHA 2X8XX 2BYTA 2FIDA 3KH0A 1U4AA 5MPOA 2Y5BB 5D3DA 3PLUA 1I4GA 4WJNA 4ANVA 1NBFC 4IKGA 1XF5L 1FM0D 2MCNB 2LD9A 2BWFA 2XN9C 3RNBC 2KTRA 1WGHA 3V3XA 3R7QA 1T6BX 3AE7B 4W9JA 3RULA 1Z5SB 2BQQA 1CK1A 4NJ7A 2WX1A 2LGSA 1GAQB 1JMLA 1E8YA 3HVDA 2FE8A 3VH4B 2G45B 4JLCA 2FIFA 3UQBA 4HPPA 5H8YE 4OZBA 3A9KB 3APFA 2K8HA 3W1SC 4KKIA 1V6EA 1R4MI 2JX5A 4WWMA 1FNVA 2G4SA 3R2TA 3UQAA 4W9HA 1HQRD 2AWTA 5D94A 4DDGD 4K1RB 2MH7A 3CSTA 3QQ8B 2J42A 1F9JA 2LGYA 3Q3JA 2UYZB 2QC8A 4ZRPA 4OVVA 2WDTB 4HRSA 1J19A 2D3GA 2KTRB 3FILA 5FKAC 1MG8A 3B2GA 3ZJVA 3M62B 5E6NA 1D5XC 4TKNA 2O2VA 2K22A 2KMMA 2LI5A 1JROA 5J17A 2JRIB 3E9SA 1GC6A 1WF9A 1C1YB 2ICIA 1ZXIA 4DQOC 1L6UA 2KKCA 3AE8B 3M63B 1NI3A 4A3PA 1VCBA 1YIWA 2H88B 3P4RB 4BFRA 2NBWB 3UGBB 2FAZA 4REZA 1C76A 2DYBA 3AI5A 4L23A 4N58A 4M8NA 1T0QC 3KLSX 3OLMD 4WQMA 1L2NA 2KDIA 3SR6A 1SF0A 2XNAC 2GB1A 3HVZA 2L05A 3AULA 4DHJD 3TBLD 1I42A 2MHJA 4OZAA 1ZDVA 5AUIA 4ICUA 2CU3A 3NY5A 2NTSA 4UDUC 4PK1A 1D4BA 3V60A 5BMGA 1GOZA 2MLBA 2X38A 1UNSA 2L8JA 3Q2AC 4HLEA 2FCQA 2OEDA 2IGHA 3P4SB 2EMTA 3SDLC 1J7CA 1LM8B 3BINA 2LGIA 4LNNA 1WZ3A 2KVRA 2BS3B 2WXRA 1ZOYB 4MEMA 1WE6A 1YN3A 3SHQA 2GBKA 4L2YA 3N1ZC 3IT4B 5EDSA 2BYFA 1PYWD 1WX8A 3MP9A 3I57A 4HWIB 3SU8X 4EZLA 4XX5A 4MDKE 2JVCA 2C9WB 3KQ4A 1VZ8A 1OQYA 2DBYA 3H7PA 1KRHA 2HTME 2MP2B 1QT9A 1TS2A 4O1NA 4KIKB 2RR9A 2G4DB 4BKSD 2J7QB 2KFKA 4ITKA 2LWPA 3DWGC 3BYYB 1DYQA 1E5WA 1FNUA 1S1QB 2MP2A 4US8A 3U52E 4LDTD 3AM9A 3AEFB 1C77A 2C7NB 2INDC 3C0RB 4KZCA 1YQBA 4IM2A 1SIFA 4ASWC 1GG3A 2KACA 4WAFA 3KWVA 1DGJA 1QOFA 2O2VB 4LNOA 2WXQA 4J3OD 3N3KB 3BIID 3Q3NC 4US9A 5HG2A 4LK0M 1NYRA 5C1ZA 2RPVA 4NPNA 3P2BA 2HDEA 3ZQ4A 2KZRA 3MC0B 1T0SC 5G5GA 3WA0A 4KDLB 4RNAA 2HJ8A 2WXFA 3U7ZA 2WU5B 3N9YC 3ZNGC 2ZPYA 2XBBC 2PE9A 2KT7A 1F0ZA 4BKSA 3DHGC 2AL6A 2YEPF 2Z59B 4ARCA 2CHZA 2DYOA 1E7VA 2Q5WD 3RNGC 4W9LA 3NJTA 2DENB 3PSEB 1N60A 1L4DB 3PZ8A 3QARA 2IY1B 2VH2A 2INNE 2PVOD 3H8HA 2QMTA 1WMHB 4KGRA 2N9KA 4W9GA 4HPLB 2WXHA 2KK8A 3VDZA 4A8XC 4L1BA 1EWCA 1Y8RC 2KDBA 4NNJB 2M19A 3DQVA 2MJDA 2L0FA 4PS3A 3Q8BA 5JXVA 1KLVA 1JCKB 1AW7A 5IO9A 3QC8B 4AOFA 2AQ2B 2KX0A 1FPYA 1PGBA 3RT3B 4E74A 4N9F4 1VLBA 1SE2A 3PRZA 1T5XD 1I4XA 1MG4A 1C4PA 1K53A 2FUHB 1EWYC 4IWPA 2EKEC 4FJVB 3I9V1 1IGDA 2PW9A 2BB5A 2WHIA 2MEKA 3RYTA 3ZIMA 2WXMA 3BY4B 4W9CA 3EFCA 3NZUA 2WXNA 3RMKC 1QILA 3KUDB 1EF5A 3ZXRA 2CU1A 3N1XC 4XYCA 2G3QB 3WALA 3PTFC 1CQVA 4AWJA 1K51A 2KWVB 2N4FA 5CHWA 5KHQA 1VRAB 2MW5A 3V05A 3HM3A 2KWUB 3PGEA 2AQ1B 3IT6B 3ZJTA 3ZDMC 4II3B 2WXPA 3C19A 2W3SA 5J18A 1MVKA 3AE1B 1L0VB 3MJWA 1UWXA 2KMCA 2KNBA 1ZGUB 3VFKA 1XLQA 3DBRB 1UH6A 1XEEA 4GGQA 2IYDB 2V0GA 2GBJA 1FXIA 2D2QA 2XEWA 3U2SC 3FKYA 3IBEA 4ANWA 3DOWA 4DBGA 3V6CB 4ZRJA 1T0YA 4FXCA 4MJSA 3QCAA 3X0WA 5L95C 3BVGA 2K0PA 1TJEA 3VQIA 2PVGC 3ZTDA 2LZ6A 2IDYA 4RF1A 1WYGA 3VAWA 1E6EB 3APDA 4KSKC 4KDIC 3DBHI 2R2OA 4E3CA 4C4VB 1B1ZA 2LUEA 4D2KA 1D3ZA 3AH7A 3VVWB 3AU5A 3JW0X 3DBHB 5TR5A 2NCNA 1V1OA 3T3OA 4CYEA 3DHHC 3AE4B 5C23A 5LNK1 3PHXB 2Y3AA 3VR8B 4GIVA 2M17A 2IO0B 2ZW1A 2W55A 1A5RA 1YJJA 3PO0A 4II2B 1JW9D 3EGRA 3K9OB 4FBJB 2QDFA 4PS8A 3EECA 4KSLC 3IAM1 5E6JA 2AL3A 1NVID 2KN5A 2Z8LA 2DZKA 2EELA 3M3JA 5HHDG 2KX3A 1V8CA 3L10B 1WXQA 4JPSA 4MJSB 2KO3A 3U8ZA 1FNWA 2I2YA 1MFWA 1P7EA 2BBCA 1E10A 1TZ1A 2KDMA 1WIAA 3N20C 2DYMA 2VZKD 1ET6A 4NY0A 3ALBA 1XO3A 4K3BA 2UWQA 3EHVA 3RN9C 1GNUA 2LGDA 2RDHA 4KIKA 3Q3MC 1C79A 4C7YA 2MBHA 4I6NB 1V2YA 2CS4A 3BVMA 1WGGA 3ZJUA 1SIJA 2C7MB 4RM9A 2IO1B 2R61A 2WLBA 2LUMA 1WSPA 2DHZA 4C56C 1QOGA 2J0JA 4BOSC 4GDLB 4MELA 3PVLA 3RNFC 4W9KA 2LRWA 1SB3C 2WDVB 2DAJA 2HE7A 3DVGY 1P1AA 3HHMA 3RI7C 3DHIC 1V9JA 1UBIA 3SFEB 3JYUA 2L32A 2FUG1 1E8XA 4EFOA 3I5JC 1FFUA 3ZW3A 1IYFA 3FAHA 3Q3FA 4XE0A 1FXAA 4P7IA 3SD5A 4A90A 4TQ0A 3U4EG 4MACA 1WI0A 4JIOU 1DOIA 3RNEC 2MRPA 1NDDA 3TL5A 1WX9A 3A9JB 4G11A 4NQKE 3PPAA 5IN7A 2MJEA 2QJLA 4AQ7A 3OJ3A 1K8RB 2V9HA 3ZO5B 1OGWA 1C9FA 5H92C 3HK0A 1OEYJ 2L00B 1YX6B 2PE6B 3R2IA 3TUOA 4IWQA 3M95A 4FJZA 4RMAA 3TEYA 1V86A 3A9KA 4C00A 3QHTA 1WXVA 2ZZPB 3QAQA 2LHDA 5G55A 2KMAA 2AEHA 2M1MA 5DPTA 1XXGA 4G3XB 5D7GA 2IZVB 2MQJA 2RPQA 5C2TB 5G5HA 3NOBA 1C78A 4JX1C 3CMMB 1F52A 1MJDA 1OFFA 3W9CB 2OHFA 1Q1OA 5HI1A 4RFBA 4C4VA 4PS7A 4YSYB 3ABVB 2K5PA 4WQOB 3RNCC 1K50A 4DXFA 1Q5WB 1SEBD 1XLOA 2MX2A 3APCA 3DBLI 3NG0A 1VJKA 2LJ5A 3VH3B 3PZ7A 5IOIA 3QA8A 4YSXB 1FD6A 4MH0E 2JT4B 2M0AA 2L83A 3DBSA 3OG5A 3AE2B 2EMSA 4F1SA 3DVGX 3ETRA 2RGFA 1PFDA 3V62A 3CIRB 4G50A 5HFYA 3JSVB 2JF5A 2INPE 4C80A 4ZHOA 4I6LB 2SEBD 2ZVOA 4A20A 2KC1A 1D5MC 2GOWA 2FCNA 3VTUA 4NAWA 3D32A 1WRDB 1HE8A 1IGCA 3L17A 1AWDA 4S0RA 1JWSD 2BVCA 2KN4A 2AYOB 3A4RA 3J9CA 1KH0A 2C60A 2M0XA 4BVUC 1NYQA 2C7HA 1NI2A 2BKFA 1V80A 1NEKB 2ONQA 4BBNF 4FHJA 4I6PA 1TTNA 4MGYE 2INCC 2KQ7A 1E7UA 2BPSA 2K8CA 4MGKE 3O13A 2KVZA 2ZCBA 3PREA 1N6ZA 1ZUD2 5T8IA 1WM2A 2CHWA 4HK2A 3O65B 2JXXA 3GOEA 2L52A 1JWUD 3AEGB 4DHZE 2ZW0A 2W3RA 4JL9A 3KUCB 4M8MA 2D3BA 3IFWB 1RRBA 2KD0A 3ZUNA 4ANXA 4HVBA 4E71A 5C3JB 2D3CA 2MBQA 3AE6B 4NJCA 2RDGA 4XGAB 3WAMA 3Q8EA 4PYZA 4GN1A 2JYTA 2QHOA 4YTNB 3ZDTA 3RNAC 5E6OA 1TKEA 1VR9A 4KV2A 1PDXA 4LTUA 1KJTA 3B2FA 3ZTCA 3MTNB 1XD3B 2JSVX 2WXIA 1P9DU 4LNIA 1E7PB 2I1KA 2KC2A 1EU3A 4RF0A 5IP4D 4XWWA 1FXTB 4YTMB 5IKCM 3PT2B 1L0YB 3EUB2 1LGRA 4FHKA 4YXDB 2BKRB 3VUYA 1KLGD 1N5XA 3AEBB 1L5PA 1FCCC 2BTEA 5AUKA 3RPFC 4IC7B 1VZ7A 2V3PA 3DWMA 4ZRIA 5AZGA 1I4QA 1WZ0A 1V1PB 3ZVVA 2V1YA 5CHVC 1QOBA 3AE3B 3UINB 3WCQA 4M0WB 2MA9B 3TMPB 4ZOHC 1HTQA 3B0AA 3OAWA 1B9RA 4WURA 5CTRC 2ZCCA 2W82A 2V3NA 1J7AA 3HUIA 2XK5B 1FCLA 2LASA 1WMHA 1FIQA 3ZLZA 1E90A 1EO6A 3BYTB 3UIPB 3VUXA 1WJ4A 3L08A 1CJEA 1YQ4B 4KZ0A 3RZWC 5BYRA 5GMVA 2L76A 2BW2A 3TJPA 2WP9B 4USAA 1F77A 3ZNID 2NVUI 2V4IB 4M02A 1PQSA 3VUWA 3LXFA 4OHJA 1C4AA 2KHWB 1WGRA 1E8ZA 3IXSA 4FJYA 1ENFA 1UF0A 2JUOA 3R7RA 1KFYB 3NRZA 1WR1A 1H4RA 3TEXA 1ISNA 4GXBA 3Q6BA 3WANA 2K39A 3EC8A 4RGNA 1WE7A 1HXYD 3AB5A 2N7DA 3RD2A 3U7DA 1YJIA 4TQ1A 4ZYSA 3PV1A 1DOXA 3R3MA 3ZRFA 2KLCA 2WU2B 5TSSA 4DDID 2KTFA 4ZDVA 1WJUA 2Y5PA 3T3NA 1RFAA 2KWCA 1Q10A 2TSSA 1YNTE 4WH4A 4YSZB 4ARIA 3L4PA 1JRUA 4A3OA 1UGJA 1GJZA 2BWES 4YT0B 1LFDA 4W9FA 1MHXA 1WM3A 2JXTA 1TZOA 4FA6A 4HKZE 3R66C 4MH8A 4PT5A 2WXLA 2NBUA 2PTLA 5LXHA 1VDVA 2ZNVB 2ZNVC 3NS8A 1GB1A 4EUTA 4LJOB 4LJPB 3AXCA 1YMHE 2O6VB 4M01A 2MBOA 1CZPA 3ONSA 3W5UB 1I4HA 3W2DA 2L7RA 4W9IA 5DPSA 2JZZA 1RWSA 1F2RI 4GSWA 1BXTA 1C3TA 2ZVNA 3WAPA 2A5UA 4XDDA 3QIJA 1I4RA 2BB6A 1UBQA 1ACCA 3UF8A 1XQQA 4URKA 1SXTA 3SEBA 3KW5B 1UELA 2BS4B 1LXDA 2DNFA 1P98A 4WWOA 1FMAD 3L54A 1GB4A 1V1PA 1YD8U 3MC8A 2NTTA 1J8CA 3NZSA 2LVQA 1R4NB 4RH6A 2DAFA 3BVZA 3W5VB 3B1LX 1C4CA 4MSMB 3P42A 2Y5CA 4JWSC 1QOAA 5D6JB 2CJNA 3H7SA 1TY0A 4WJOA 3A1QB 4ICVA 2NPTB 1M4VA 1WX7A 5AZHA 2DZIA 3U30A 5D2MB 4CO7A 3IHPC 3GE8C 1SBBB 2L1AA 2WYQA 1KTKA 4P16A 4MT5A 1A70A 3E56A 2DX5B 4HPMB 1K52A 4LCDE 1JWMD 2M4NA 2N1WA 1YX5B 2BS2B 3JSVA 5EE1A 2L0TA 1WJ6A 2GI9A 4RM8A 2K1FA 2K8BA 4ZRQA 1HZ5A 1JALA 2DZMA 4NZLB 2RD0A 3UIOB 1V97A 4KGTA 4HJGE 2Z0DB 1AN8A 4GU2A 4C7ZA 1GPXA 4LNKA 2YEPB 4QAYA 3ENEA 5BMIA 4LDTB 1EU4A 2KANA 5GXGB 3ML8A 3W1SA 2LEKA 3RFZB 3AECB 2KWDA 2R2QA 4EEWA 3DBLB 2ACZB 2QSDA 4N59A 3TIXA 2OJWA 1UGMA 2AQ3B 2XK5A 3DDCB 4P1BC 4RGMA 2LRUA 4TV3A 3Q3OC 1FRRA 2ZPNA 4HDOA 2J0MA 3FC4A 1ZPSA 2RSUA 4JQWC 5FR3A 1L7YA 2LXAA 2WGSA 4NJ6A 4RGTA 1ZW7A 2WDQB 2J4XA 1SJED 4B9KA 1FEHA 3ZRCA 4XC2A 2D11A 1TKYA 2JRHA 2N1VA 1E0ZA 3Q69A 1BMLC 3VTVA 4WJQA 4RGOS 2IPKD 2VZKB 2KDFB 1AYFA 2MBEA 2J53A 3DBRI 3OJ4B 2JZPA 2CJOA 2BYVE 2QCZA 4NAWB 3N30A 1YQ3B 2NS5A 2WQYB 3MHSD 1ESFA 3VRBB 2KQ4X 2W9NA 2IGDA 1DOYA 3B08A 1HA5A 2IGGA 2NPTA 5AZFA 2WX0A 4FULA 2D3AA 3QJZA 2DLBA 4TSSA 4ACFA 2O6VA 3HM6X 1SGHA 3A1QA 4M00A 1YOVB 1FO4A 4AUQC 3PLVA 5E6PA 1YN5A 1XT9B 2KYWA 3AE5B 2WXGA 1IUEA 2GLSA 1WGYA 4AP4C 2PKOA 1BUIC 3H1UA 1QZEA 3P4QB 2IO2B 2CHXA 2PIAA 1EF1A 2KJ6A 2WXKA 1UZXB 1H8CA 4DK5A 1GUAB 2NR2A 1XCTL 2JQRB 3NVVA 3N32A 4YTPB 1STEA 1E9MA 3ZKJC 1TGZB 1N61A 1KLUD 2J52A 3CSFA 2PJHA 1WRIA 4AJWA 4XWTA 5DPRA 2N7EA 1TS4A 4OVZA 1T0RC 1PGXA 2WNMA 2LJIA 3OWEB 5JHAA 3VRAB 3C8YA 3GZNB 4X57B 1AARA 3WAOA 1ZKHA 4NQLB 2PMVA 4OW0A 2JWUA 3WIMA 1WY8A 3VR9B 1L0XB 3IG3A 3NVWA 4CQNA 1PGAA 1VZ6A 1V81A 1G6JA 3AEAB 3A9JA 2KQSA 1R4NI 2ZEQA 2IY0B 1R7SA 4YL8A 1QKZA 1EUVB 3ML9A 2KXJA 4HXDA 4BAXA 5AEKB 4DWFA 2SAKA 3KWLA 2LVPA 3A33B 3HRDD 3MHZA 1RLFA 4TUUA 2G9HD 3K9PB 4J6IA 5CX3A 3LJ3A 4XDCA 4MSQB 3NUHB 4CHKA 1HEZE 2E3TA 2JPHA 3ZNHB 4IG7B 3X23A 1L6VA 1N62A 2N0SB 2LXCA 3PHWB 1IP9A 5JH5C 5JZEB 2N9EB 3ZNZB 3QX1A 1XLNA 2MJ3A 4K3CA 5BO4B 4JGHB 1SE4A 1XLPA 2DZJA 1V5OA 2NBVB 3L13A 2FCSA 2B3AA 3S2AA 2OOBB 4BZAA 2KOXA 4W9DA 3H9DA 2GBMA 2B76B 3UI3A 4BOZB 2FBWB 4IW0A 4GDLA 2N7JA 3LDZE 2KJHB 4DHZB 3DCGA 3VTWA 1P0RA 1YN4A 4H2AA 4EKUA 1QLBB 3P1MA 4K7WA 1Q0WB 3B9JA 2DWQA 4LLGM 4KKJA 1P7FA 4F8CB 3PS6A 1ROEA 5I4DA 2M56B 3R8BA 3V6EB 1RYJA 3LYYA
chains in the Genus database with same CATH topology
3QWZB 3Q3JA 2UYZB 4FA6A 3R66C 4KIKA 4OVVA 2WDTB 2MSED 1KOTA 1J19A 2D3GA 2KTRB 4HCPB 2NBUA 2MBHA 1MG8A 4I6NB 4HCNB 1V2YA 2CS4A 5LXHA 3M62B 5E6NA 1WGGA 2ZNVB 4TKNA 2ZNVC 2O2VA 3NS8A 2GMIC 4GB9A 1WXSA 4EUTA 2C7MB 4LJOB 4RM9A 2IO1B 2LI5A 3AXCA 4LJPB 2O6VB 3IVFA 5J17A 2DHZA 2JRIB 2MBOA 1I35A 3ONSA 1GC6A 5DCNA 1WF9A 1C1YB 2L7RA 4W9IA 2JZZA 5DPSA 3DVNU 2J0JA 4BOSC 4GDLB 4HDQA 4MM3A 1V49A 1X1MA 4GSWA 2KKCA 1J0GA 3M63B 4MELA 3KUZA 1C3TA 3PVLA 4IM0A 1VCBA 4A3PA 1YIWA 2ZVNA 3WAPA 4W9KA 2LRWA 2DAJA 4BFRA 1P3QU 2NBWB 3UGBB 2A5UA 2FAZA 2HE7A 3DVGY 1P1AA 4ZYNA 1WR6E 3HHMA 3PRPB 1V9JA 1UBIA 2DYBA 3AI5A 3JYUA 3QIJA 1WJNA 4IUMB 1E8XA 4EFOA 4M8NA 1V5TA 1UBQA 3OLMD 4GOCA 3UF8A 2J0KA 1XQQA 4URKA 1L2NA 2KDIA 2IO3B 3KW5B 2D10A 3ZW3A 1UELA 2N9PC 1IYFA 1LXDA 4K7SA 2L05A 3AULA 1P98A 3Q3FA 4WWOA 4DHJD 4P7IA 3TBLD 3SD5A 4TQ0A 2I1JA 1I42A 1TBEA 1WFYA 1WI0A 3L54A 4JIOU 3RUIB 1YD8U 2N9XA 3NY5A 4ICUA 2MRPA 4K7UA 1J8CA 3NZSA 4PYUA 1NDDA 2LVQA 2YVCA 3TL5A 1WX9A 3A9JB 4G11A 1CMXB 3V60A 2DAFA 2MLBA 4NQKE 3PPAA 2L8JA 3B1LX 3NHEB 3OJ3A 4HLEA 1K8RB 4MSMB 3ZO5B 1OGWA 2FCQA 5KHOA 3HK0A 1OEYJ 3W1YA 2KFJA 2K6QA 2L00B 1YX6B 5D6JB 2EMTA 3VHTC 2PE6B 3SDLC 4OVUA 3H7SA 4IWQA 1LM8B 2JZ3B 4WJOA 3M95A 2MWSB 3A1QB 3BINA 4FJZA 2NPTB 4ICVA 4RMAA 2ZJDA 4XZ4A 1V86A 1WX7A 5AZHA 1WZ3A 3A9KA 2KVRA 2DZIA 3QHTA 3U30A 5D2MB 1WXVA 4CO7A 2K6DB 2ZZPB 3QAQA 3IHPC 3V61A 3DVNV 2K25A 2WWZA 5G55A 4MEMA 1WE6A 2KMAA 3SHQA 2AEHA 2GBKA 2WYQA 2M1MA 5DPTA 4G3XB 5D7GA 2IZVB 2MQJA 2RPQA 4MGZE 5EDSA 3NOBA 2BYFA 1WX8A 3CMMB 4K81A 3A4SC 4HWIB 2DX5B 4FLHA 3SU8X 4ANUA 4EZLA 5IA7A 4HPMB 4XX5A 4MDKE 2JVCA 2LVOA 3TCAA 2C9WB 1Q1OA 1OQYA 3RCZA 4PS7A 4LCDE 3H7PA 2M4NA 2PEAA 2MP2B 2N1WA 1GC7A 1YX5B 3JSVA 2L0TA 1WJ6A 4RM8A 4WQOB 2D07B 1BT0A 4KIKB 2RR9A 2K1FA 2G4DB 1Q5WB 2K8BA 4BKSD 2DZMA 2J7QB 2KFKA 2MX2A 2RD0A 3UIOB 3APCA 3DBLI 2Z0DB 2LJ5A 2BGFA 3VH3B 2LWPA 4GU2A 4DXAB 3QA8A 3ECIA 4F7ZA 1E5WA 2CR5A 4MH0E 1VD2A 1WYWB 1S1QB 2MP2A 2JT4B 3ENEA 4LDTD 4EZKA 3JVZX 4LDTB 2KANA 3DBSA 2C7NB 3C0RB 3ML8A 4KZCA 3W1SA 1YQBA 4IM2A 2EMSA 4F1SA 3DVGX 5LLIA 1SIFA 4ASWC 1GG3A 2RGFA 3T8MA 3V62A 2R2QA 4EEWA 3QK0A 4G50A 2FCMA 2BF8B 2O2VB 2MBBB 3JSVB 2JF5A 3TIXA 2V4LA 1UGMA 4I6LB 2XK5A 3N3KB 2ZVOA 4A20A 2KC1A 3DDCB 1WXAA 2IBIB 3GZNI 2GOWA 2LRUA 5C1ZA 4ZRKA 4TV3A 2FCNA 2O6VD 2ZPNA 2KFKB 4NAWA 3D32A 3I3TB 3VTUA 4BKTA 4HDOA 2J0MA 2HD5B 1WRDB 1HE8A 2KLGA 2RSUA 4JQWC 3L17A 4NPNA 3P2BA 1L7YA 1OEYA 2KZRA 2LXAA 4MGIE 2L3ZA 2M8SA 2V3SA 4NJ6A 3WA0A 4KDLB 1ZW7A 2HJ8A 2AYOB 3A4RA 3ZNGC 4B9KA 2C60A 3T9LA 5CHFA 2M0XA 2XBBC 2PE9A 2ZPYA 2LGXA 4BVUC 2C7HA 3ZRCA 4XC2A 2D11A 1NI2A 2BKFA 4BKSA 1WH3A 4FADA 2AL6A 1V80A 2JRHA 2N1VA 2Z59B 2YLMA 2CHZA 3VTVA 2DYOA 4WJQA 4BBNF 2HTHA 4FHJA 1KM7A 4I6PA 1TTNA 1E7VA 4MGYE 3VXWA 2KQ7A 2KDFB 4W9LA 2MBEA 2DENB 3PSEB 3QARA 2FNJB 1E7UA 2BPSA 2IY1B 2K8CA 3DBRI 4MGKE 5JHBA 3OJ4B 2ZCBA 1LQBA 2A4ZA 2JY6A 3PREA 1WM2A 2CHWA 4HK2A 1WMHB 3O65B 3DPDA 2BYVE 4IM3A 4NAWB 2JXXA 3N30A 4W9GA 2NS5A 3GOEA 3MHSD 4EOYA 5L83A 4WWPA 4HPLB 4AJYB 2W9NA 2JWZA 4DHZE 1IPGA 2KK8A 3B08A 3VDZA 4DHJB 2NPTA 5AZFA 2WX0A 4JL9A 3KUCB 2GBRA 4M8MA 4FULA 1Y8RC 2KDBA 3IFWB 1RRBA 1WXMA 2KD0A 3QJZA 4NNJB 3DQVA 4KVGB 3ZUNA 4ANXA 2L0FA 4HVBA 4PS3A 4E71A 2O6VA 3HM6X 1SGHA 3A1QA 1Z2MA 3HIZA 3PZDA 1KLVA 2MBQA 4WAAA 3WAMA 3PLVA 3QC8B 1UD7A 5E6PA 4AUQC 4EZJA 1XT9B 4GN1A 1S3SG 4PYZA 2QHOA 4AOFA 2KX0A 3ZDTA 3CF6E 3RT3B 4E74A 4N9F4 1WGYA 5E6OA 4AP4C 5J2RA 4KV2A 3PRZA 3EFUA 3H6NA 3H1UA 1QZEA 1RAXA 1KJTA 3ZTCA 2IO2B 3MTNB 2CHXA 1XD3B 2FUHB 1EF1A 4IWPA 2EKEC 4FJVB 2KJ6A 2PPHA 4GDKB 1UZXB 1H8CA 1P9DU 4DK5A 1GUAB 2NR2A 1WGDA 3RYTA 2I1KA 2KC2A 4W9EA 3ZIMA 4BBNC 3BY4B 4W9CA 3N32A 1M94A 1FXTB 3NZUA 4B6WA 1E8WA 3ZKJC 3PT2B 1TGZB 3KUDB 3CSFA 2PJHA 4FHKA 3KYCD 4AJWA 2CKHB 5DPRA 1EF5A 2N7EA 2BKRB 4HJKA 3VUYA 2CU1A 5JHAA 2G3QB 4GDKA 3L0WB 3WALA 3PTFC 4X57B 1AARA 4AWJA 2KWVB 3WAOA 1ZKHA 2BYEA 4NQLB 2N4FA 5CHWA 5KHQA 4IC7B 5IAAC 2MW5A 3PRMB 3HM3A 4ZRIA 2KWUB 3PGEA 5AZGA 3AU4A 1WZ0A 1WY8A 3WIMA 3ZDMC 4II3B 5J18A 3ZVVA 3IG3A 2OJRA 3L16A 2V1YA 2REXA 5CHVC 3UINB 3MJWA 4IWOA 4M0WB 2MA9B 1V81A 1G6JA 2KMCA 3A9JA 4WWNA 3TMPB 2KQSA 5LXIB 1R4NI 2ZEQA 2IY0B 2KNBA 3B0AA 3OAWA 1ZGUB 5CTRC 3VFKA 4G0NB 2ZCCA 1YJ1A 2KJRA 4YL8A 1SE9A 1UH6A 3RZFA 1EUVB 3ML9A 4GGQA 2XK5B 2KXJA 4HXDA 2IYDB 2GBJA 2LASA 1WMHA 2GBNA 4DWFA 3H7PB 1E90A 3ZLZA 5AEKB 2D2QA 2XEWA 2LVPA 3A33B 2ASQA 3IBEA 1OTRB 1RLFA 3DOWA 4ANWA 4DBGA 4TUUA 5G2NA 3KYDD 3V6CB 3K9PB 1EO6A 4ZRJA 2Z0EB 3UIPB 1T0YA 3VUXA 5FR6A 1WJ4A 3L08A 3QCAA 4J6IA 4KZ0A 4MJSA 3RZWC 5CX3A 3X0WA 5GMVA 4B95A 5L95C 2L76A 3TJPA 3LJ3A 4BKGA 3VQIA 5DPWA 3ZTDA 2LZ6A 3ZNID 2NVUI 4MSQB 4CHKA 3VAWA 3APDA 3KVFB 1PQSA 3VUWA 2VRRB 3ZNHB 2JPHA 4IG7B 4KSKC 2C5LC 4KDIC 3DBHI 3X23A 2R2OA 4WJPA 2KHWB 1WGRA 4GMVA 1E8ZA 2KDEB 4FJYA 4E3CA 4FN2A 2LXCA 2LUEA 3PHWB 5HKHA 1D3ZA 3VVWB 2FIDA 3AU5A 1IP9A 3JW0X 3KH0A 1U4AA 5TR5A 2JUOA 2Y5BB 3R7RA 2NCNA 3PLUA 5JH5C 4WJNA 5JZEB 4ANVA 1NBFC 4CYEA 1WR1A 2N9EB 5C23A 3ZNZB 2MCNB 1H4RA 2LD9A 3QX1A 3PHXB 1ISNA 4GXBA 2BWFA 5BO4B 3WANA 4JGHB 2KTRA 4GIVA 2K39A 3EC8A 1WE7A 2M17A 2IO0B 1WGHA 3R7QA 2DZJA 1A5RA 2N7DA 3RD2A 1V5OA 4W9JA 3RULA 2NBVB 1Z5SB 3L13A 3U7DA 2FCSA 4II2B 2B3AA 4TQ1A 3S2AA 3PV1A 3R3MA 2OOBB 3K9OB 3ZRFA 4FBJB 4NJ7A 2KLCA 2WX1A 4PS8A 3EECA 2KOXA 4KSLC 4W9DA 1E8YA 3H9DA 2GBMA 4DDID 2KTFA 2AL3A 3VH4B 2G45B 4ZDVA 1WJUA 2KN5A 4JLCA 4BOZB 2FIFA 3UQBA 1RFAA 4IW0A 2DZKA 2KWCA 4GDLA 3LDZE 3M3JA 2KX3A 3A9KB 2KJHB 4DHZB 3APFA 3L10B 3DCGA 4MJSB 2K8HA 2KO3A 3VTWA 3U8ZA 1P0RA 1JRUA 3W1SC 4EKUA 4K7WA 4A3OA 1V6EA 1R4MI 1Q0WB 1GJZA 2G4SA 3UQAA 1TZ1A 4W9HA 2AWTA 2BWES 1WIAA 5D94A 4DDGD 2DYMA 4K1RB 1LFDA 4W9FA 3CSTA 3QQ8B 4F8CB 3PS6A 1WM3A 4NY0A 3ALBA 1F9JA 2LGYA 2UWQA 3EHVA 1GNUA 3V6EB 2LGDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3QWZ B;  3Q3J A;  2UYZ B;  4FA6 A;  3R66 C;  4KIK A;  4OVV A;  2WDT B;  2MSE D;  1KOT A;  1J19 A;  2D3G A;  2KTR B;  4HCP B;  2NBU A;  2MBH A;  1MG8 A;  4I6N B;  4HCN B;  1V2Y A;  2CS4 A;  5LXH A;  3M62 B;  5E6N A;  1WGG A;  2ZNV B;  4TKN A;  2ZNV C;  2O2V A;  3NS8 A;  2GMI C;  4GB9 A;  1WXS A;  4EUT A;  2C7M B;  4LJO B;  4RM9 A;  2IO1 B;  2LI5 A;  3AXC A;  4LJP B;  2O6V B;  3IVF A;  5J17 A;  2DHZ A;  2JRI B;  2MBO A;  1I35 A;  3ONS A;  1GC6 A;  5DCN A;  1WF9 A;  1C1Y B;  2L7R A;  4W9I A;  2JZZ A;  5DPS A;  3DVN U;  2J0J A;  4BOS C;  4GDL B;  4HDQ A;  4MM3 A;  1V49 A;  1X1M A;  4GSW A;  2KKC A;  1J0G A;  3M63 B;  4MEL A;  3KUZ A;  1C3T A;  3PVL A;  4IM0 A;  1VCB A;  4A3P A;  1YIW A;  2ZVN A;  3WAP A;  4W9K A;  2LRW A;  2DAJ A;  4BFR A;  1P3Q U;  2NBW B;  3UGB B;  2A5U A;  2FAZ A;  2HE7 A;  3DVG Y;  1P1A A;  4ZYN A;  1WR6 E;  3HHM A;  3PRP B;  1V9J A;  1UBI A;  2DYB A;  3AI5 A;  3JYU A;  3QIJ A;  1WJN A;  4IUM B;  1E8X A;  4EFO A;  4M8N A;  1V5T A;  1UBQ A;  3OLM D;  4GOC A;  3UF8 A;  2J0K A;  1XQQ A;  4URK A;  1L2N A;  2KDI A;  2IO3 B;  3KW5 B;  2D10 A;  3ZW3 A;  1UEL A;  2N9P C;  1IYF A;  1LXD A;  4K7S A;  2L05 A;  3AUL A;  1P98 A;  3Q3F A;  4WWO A;  4DHJ D;  4P7I A;  3TBL D;  3SD5 A;  4TQ0 A;  2I1J A;  1I42 A;  1TBE A;  1WFY A;  1WI0 A;  3L54 A;  4JIO U;  3RUI B;  1YD8 U;  2N9X A;  3NY5 A;  4ICU A;  2MRP A;  4K7U A;  1J8C A;  3NZS A;  4PYU A;  1NDD A;  2LVQ A;  2YVC A;  3TL5 A;  1WX9 A;  3A9J B;  4G11 A;  1CMX B;  3V60 A;  2DAF A;  2MLB A;  4NQK E;  3PPA A;  2L8J A;  3B1L X;  3NHE B;  3OJ3 A;  4HLE A;  1K8R B;  4MSM B;  3ZO5 B;  1OGW A;  2FCQ A;  5KHO A;  3HK0 A;  1OEY J;  3W1Y A;  2KFJ A;  2K6Q A;  2L00 B;  1YX6 B;  5D6J B;  2EMT A;  3VHT C;  2PE6 B;  3SDL C;  4OVU A;  3H7S A;  4IWQ A;  1LM8 B;  2JZ3 B;  4WJO A;  3M95 A;  2MWS B;  3A1Q B;  3BIN A;  4FJZ A;  2NPT B;  4ICV A;  4RMA A;  2ZJD A;  4XZ4 A;  1V86 A;  1WX7 A;  5AZH A;  1WZ3 A;  3A9K A;  2KVR A;  2DZI A;  3QHT A;  3U30 A;  5D2M B;  1WXV A;  4CO7 A;  2K6D B;  2ZZP B;  3QAQ A;  3IHP C;  3V61 A;  3DVN V;  2K25 A;  2WWZ A;  5G55 A;  4MEM A;  1WE6 A;  2KMA A;  3SHQ A;  2AEH A;  2GBK A;  2WYQ A;  2M1M A;  5DPT A;  4G3X B;  5D7G A;  2IZV B;  2MQJ A;  2RPQ A;  4MGZ E;  5EDS A;  3NOB A;  2BYF A;  1WX8 A;  3CMM B;  4K81 A;  3A4S C;  4HWI B;  2DX5 B;  4FLH A;  3SU8 X;  4ANU A;  4EZL A;  5IA7 A;  4HPM B;  4XX5 A;  4MDK E;  2JVC A;  2LVO A;  3TCA A;  2C9W B;  1Q1O A;  1OQY A;  3RCZ A;  4PS7 A;  4LCD E;  3H7P A;  2M4N A;  2PEA A;  2MP2 B;  2N1W A;  1GC7 A;  1YX5 B;  3JSV A;  2L0T A;  1WJ6 A;  4RM8 A;  4WQO B;  2D07 B;  1BT0 A;  4KIK B;  2RR9 A;  2K1F A;  2G4D B;  1Q5W B;  2K8B A;  4BKS D;  2DZM A;  2J7Q B;  2KFK A;  2MX2 A;  2RD0 A;  3UIO B;  3APC A;  3DBL I;  2Z0D B;  2LJ5 A;  2BGF A;  3VH3 B;  2LWP A;  4GU2 A;  4DXA B;  3QA8 A;  3ECI A;  4F7Z A;  1E5W A;  2CR5 A;  4MH0 E;  1VD2 A;  1WYW B;  1S1Q B;  2MP2 A;  2JT4 B;  3ENE A;  4LDT D;  4EZK A;  3JVZ X;  4LDT B;  2KAN A;  3DBS A;  2C7N B;  3C0R B;  3ML8 A;  4KZC A;  3W1S A;  1YQB A;  4IM2 A;  2EMS A;  4F1S A;  3DVG X;  5LLI A;  1SIF A;  4ASW C;  1GG3 A;  2RGF A;  3T8M A;  3V62 A;  2R2Q A;  4EEW A;  3QK0 A;  4G50 A;  2FCM A;  2BF8 B;  2O2V B;  2MBB B;  3JSV B;  2JF5 A;  3TIX A;  2V4L A;  1UGM A;  4I6L B;  2XK5 A;  3N3K B;  2ZVO A;  4A20 A;  2KC1 A;  3DDC B;  1WXA A;  2IBI B;  3GZN I;  2GOW A;  2LRU A;  5C1Z A;  4ZRK A;  4TV3 A;  2FCN A;  2O6V D;  2ZPN A;  2KFK B;  4NAW A;  3D32 A;  3I3T B;  3VTU A;  4BKT A;  4HDO A;  2J0M A;  2HD5 B;  1WRD B;  1HE8 A;  2KLG A;  2RSU A;  4JQW C;  3L17 A;  4NPN A;  3P2B A;  1L7Y A;  1OEY A;  2KZR A;  2LXA A;  4MGI E;  2L3Z A;  2M8S A;  2V3S A;  4NJ6 A;  3WA0 A;  4KDL B;  1ZW7 A;  2HJ8 A;  2AYO B;  3A4R A;  3ZNG C;  4B9K A;  2C60 A;  3T9L A;  5CHF A;  2M0X A;  2XBB C;  2PE9 A;  2ZPY A;  2LGX A;  4BVU C;  2C7H A;  3ZRC A;  4XC2 A;  2D11 A;  1NI2 A;  2BKF A;  4BKS A;  1WH3 A;  4FAD A;  2AL6 A;  1V80 A;  2JRH A;  2N1V A;  2Z59 B;  2YLM A;  2CHZ A;  3VTV A;  2DYO A;  4WJQ A;  4BBN F;  2HTH A;  4FHJ A;  1KM7 A;  4I6P A;  1TTN A;  1E7V A;  4MGY E;  3VXW A;  2KQ7 A;  2KDF B;  4W9L A;  2MBE A;  2DEN B;  3PSE B;  3QAR A;  2FNJ B;  1E7U A;  2BPS A;  2IY1 B;  2K8C A;  3DBR I;  4MGK E;  5JHB A;  3OJ4 B;  2ZCB A;  1LQB A;  2A4Z A;  2JY6 A;  3PRE A;  1WM2 A;  2CHW A;  4HK2 A;  1WMH B;  3O65 B;  3DPD A;  2BYV E;  4IM3 A;  4NAW B;  2JXX A;  3N30 A;  4W9G A;  2NS5 A;  3GOE A;  3MHS D;  4EOY A;  5L83 A;  4WWP A;  4HPL B;  4AJY B;  2W9N A;  2JWZ A;  4DHZ E;  1IPG A;  2KK8 A;  3B08 A;  3VDZ A;  4DHJ B;  2NPT A;  5AZF A;  2WX0 A;  4JL9 A;  3KUC B;  2GBR A;  4M8M A;  4FUL A;  1Y8R C;  2KDB A;  3IFW B;  1RRB A;  1WXM A;  2KD0 A;  3QJZ A;  4NNJ B;  3DQV A;  4KVG B;  3ZUN A;  4ANX A;  2L0F A;  4HVB A;  4PS3 A;  4E71 A;  2O6V A;  3HM6 X;  1SGH A;  3A1Q A;  1Z2M A;  3HIZ A;  3PZD A;  1KLV A;  2MBQ A;  4WAA A;  3WAM A;  3PLV A;  3QC8 B;  1UD7 A;  5E6P A;  4AUQ C;  4EZJ A;  1XT9 B;  4GN1 A;  1S3S G;  4PYZ A;  2QHO A;  4AOF A;  2KX0 A;  3ZDT A;  3CF6 E;  3RT3 B;  4E74 A;  4N9F 4;  1WGY A;  5E6O A;  4AP4 C;  5J2R A;  4KV2 A;  3PRZ A;  3EFU A;  3H6N A;  3H1U A;  1QZE A;  1RAX A;  1KJT A;  3ZTC A;  2IO2 B;  3MTN B;  2CHX A;  1XD3 B;  2FUH B;  1EF1 A;  4IWP A;  2EKE C;  4FJV B;  2KJ6 A;  2PPH A;  4GDK B;  1UZX B;  1H8C A;  1P9D U;  4DK5 A;  1GUA B;  2NR2 A;  1WGD A;  3RYT A;  2I1K A;  2KC2 A;  4W9E A;  3ZIM A;  4BBN C;  3BY4 B;  4W9C A;  3N32 A;  1M94 A;  1FXT B;  3NZU A;  4B6W A;  1E8W A;  3ZKJ C;  3PT2 B;  1TGZ B;  3KUD B;  3CSF A;  2PJH A;  4FHK A;  3KYC D;  4AJW A;  2CKH B;  5DPR A;  1EF5 A;  2N7E A;  2BKR B;  4HJK A;  3VUY A;  2CU1 A;  5JHA A;  2G3Q B;  4GDK A;  3L0W B;  3WAL A;  3PTF C;  4X57 B;  1AAR A;  4AWJ A;  2KWV B;  3WAO A;  1ZKH A;  2BYE A;  4NQL B;  2N4F A;  5CHW A;  5KHQ A;  4IC7 B;  5IAA C;  2MW5 A;  3PRM B;  3HM3 A;  4ZRI A;  2KWU B;  3PGE A;  5AZG A;  3AU4 A;  1WZ0 A;  1WY8 A;  3WIM A;  3ZDM C;  4II3 B;  5J18 A;  3ZVV A;  3IG3 A;  2OJR A;  3L16 A;  2V1Y A;  2REX A;  5CHV C;  3UIN B;  3MJW A;  4IWO A;  4M0W B;  2MA9 B;  1V81 A;  1G6J A;  2KMC A;  3A9J A;  4WWN A;  3TMP B;  2KQS A;  5LXI B;  1R4N I;  2ZEQ A;  2IY0 B;  2KNB A;  3B0A A;  3OAW A;  1ZGU B;  5CTR C;  3VFK A;  4G0N B;  2ZCC A;  1YJ1 A;  2KJR A;  4YL8 A;  1SE9 A;  1UH6 A;  3RZF A;  1EUV B;  3ML9 A;  4GGQ A;  2XK5 B;  2KXJ A;  4HXD A;  2IYD B;  2GBJ A;  2LAS A;  1WMH A;  2GBN A;  4DWF A;  3H7P B;  1E90 A;  3ZLZ A;  5AEK B;  2D2Q A;  2XEW A;  2LVP A;  3A33 B;  2ASQ A;  3IBE A;  1OTR B;  1RLF A;  3DOW A;  4ANW A;  4DBG A;  4TUU A;  5G2N A;  3KYD D;  3V6C B;  3K9P B;  1EO6 A;  4ZRJ A;  2Z0E B;  3UIP B;  1T0Y A;  3VUX A;  5FR6 A;  1WJ4 A;  3L08 A;  3QCA A;  4J6I A;  4KZ0 A;  4MJS A;  3RZW C;  5CX3 A;  3X0W A;  5GMV A;  4B95 A;  5L95 C;  2L76 A;  3TJP A;  3LJ3 A;  4BKG A;  3VQI A;  5DPW A;  3ZTD A;  2LZ6 A;  3ZNI D;  2NVU I;  4MSQ B;  4CHK A;  3VAW A;  3APD A;  3KVF B;  1PQS A;  3VUW A;  2VRR B;  3ZNH B;  2JPH A;  4IG7 B;  4KSK C;  2C5L C;  4KDI C;  3DBH I;  3X23 A;  2R2O A;  4WJP A;  2KHW B;  1WGR A;  4GMV A;  1E8Z A;  2KDE B;  4FJY A;  4E3C A;  4FN2 A;  2LXC A;  2LUE A;  3PHW B;  5HKH A;  1D3Z A;  3VVW B;  2FID A;  3AU5 A;  1IP9 A;  3JW0 X;  3KH0 A;  1U4A A;  5TR5 A;  2JUO A;  2Y5B B;  3R7R A;  2NCN A;  3PLU A;  5JH5 C;  4WJN A;  5JZE B;  4ANV A;  1NBF C;  4CYE A;  1WR1 A;  2N9E B;  5C23 A;  3ZNZ B;  2MCN B;  1H4R A;  2LD9 A;  3QX1 A;  3PHX B;  1ISN A;  4GXB A;  2BWF A;  5BO4 B;  3WAN A;  4JGH B;  2KTR A;  4GIV A;  2K39 A;  3EC8 A;  1WE7 A;  2M17 A;  2IO0 B;  1WGH A;  3R7Q A;  2DZJ A;  1A5R A;  2N7D A;  3RD2 A;  1V5O A;  4W9J A;  3RUL A;  2NBV B;  1Z5S B;  3L13 A;  3U7D A;  2FCS A;  4II2 B;  2B3A A;  4TQ1 A;  3S2A A;  3PV1 A;  3R3M A;  2OOB B;  3K9O B;  3ZRF A;  4FBJ B;  4NJ7 A;  2KLC A;  2WX1 A;  4PS8 A;  3EEC A;  2KOX A;  4KSL C;  4W9D A;  1E8Y A;  3H9D A;  2GBM A;  4DDI D;  2KTF A;  2AL3 A;  3VH4 B;  2G45 B;  4ZDV A;  1WJU A;  2KN5 A;  4JLC A;  4BOZ B;  2FIF A;  3UQB A;  1RFA A;  4IW0 A;  2DZK A;  2KWC A;  4GDL A;  3LDZ E;  3M3J A;  2KX3 A;  3A9K B;  2KJH B;  4DHZ B;  3APF A;  3L10 B;  3DCG A;  4MJS B;  2K8H A;  2KO3 A;  3VTW A;  3U8Z A;  1P0R A;  1JRU A;  3W1S C;  4EKU A;  4K7W A;  4A3O A;  1V6E A;  1R4M I;  1Q0W B;  1GJZ A;  2G4S A;  3UQA A;  1TZ1 A;  4W9H A;  2AWT A;  2BWE S;  1WIA A;  5D94 A;  4DDG D;  2DYM A;  4K1R B;  1LFD A;  4W9F A;  3CST A;  3QQ8 B;  4F8C B;  3PS6 A;  1WM3 A;  4NY0 A;  3ALB A;  1F9J A;  2LGY A;  2UWQ A;  3EHV A;  1GNU A;  3V6E B;  2LGD A; 
#chains in the Genus database with same CATH topology
 3QWZ B;  2EKI A;  4M0W A;  2G1E A;  2MSE D;  1KOT A;  4HCP B;  1PUT A;  3MJ5 A;  4HCN B;  4GB9 A;  2GMI C;  1EM7 A;  1WXS A;  3AED B;  1I4P A;  1JQ4 A;  3IVF A;  1I35 A;  5DCN A;  5D3I B;  3GE3 C;  3DVN U;  4HDQ A;  4MM3 A;  1V49 A;  1X1M A;  1J0G A;  3KUZ A;  4IM0 A;  4N6E B;  1P3Q U;  4ZYN A;  1WR6 E;  3PRP B;  1QF6 A;  3CWI A;  2I38 A;  1WJN A;  2GRI A;  4IUM B;  1V5T A;  4GOC A;  2J0K A;  1I7H A;  1TY2 A;  2K9X A;  2IO3 B;  2D10 A;  2VH1 A;  2N9P C;  4K7S A;  4B0E A;  2I1J A;  4JWU C;  1TBE A;  1WFY A;  2QIL A;  3RUI B;  2N9X A;  4K7U A;  4HRO A;  1F2R C;  4PYU A;  2YVC A;  3NZ3 A;  1CMX B;  1SJH D;  3SFD B;  3NHE B;  2K3U A;  5KHO A;  3GP7 A;  4JE3 B;  3W1Y A;  2KFJ A;  2K6Q A;  1IBX B;  4KX6 B;  1UUP A;  3Q8C A;  3VHT C;  1JRP A;  2JYE A;  3NS1 A;  4OVU A;  4EE2 A;  2JZ3 B;  1XCQ L;  2IJ0 A;  2MWS B;  4XZ4 A;  2LMC A;  1Y56 A;  2ZJD A;  4A9A A;  4MM3 B;  2K6D B;  3V61 A;  3DVN V;  2K25 A;  2WWZ A;  1N5W A;  3BZD B;  1JWA D;  4Q2J A;  4MGZ E;  2LFI A;  1OQR A;  5EE3 A;  4K81 A;  3A4S C;  4FLH A;  4A55 A;  4ANU A;  5IA7 A;  2LVO A;  1R4M B;  3TCA A;  4WIP A;  3RCZ A;  1FRD A;  1N63 A;  3P4P B;  2PEA A;  1ZP0 B;  2UU7 A;  1GC7 A;  2W54 A;  2D07 B;  1BT0 A;  1RFK A;  1T3Q A;  4S17 A;  2BGF A;  4DXA B;  3ECI A;  4F7Z A;  1WGK A;  2CR5 A;  1VD2 A;  1WYW B;  1HTO A;  3BK2 A;  2BT6 A;  4EZK A;  3JVZ X;  1J7B A;  5LLI A;  2RMM A;  3T8M A;  4YWG G;  3QK0 A;  1TIF A;  2FCM A;  2BF8 B;  3NVY A;  2MBB B;  3GB1 A;  2V4L A;  3LB8 C;  3Q8A A;  1WXA A;  2IBI B;  3GZN I;  4ZRK A;  4B0M A;  1ET9 A;  2O6V D;  1TS5 A;  2KFK B;  3I3T B;  4BKT A;  2HD5 B;  2KLG A;  2RDB C;  1OEY A;  4IDI A;  1MPE A;  4MGI E;  2L3Z A;  2M8S A;  2V3S A;  5FK9 C;  3AN1 A;  4NAM A;  3EA6 A;  4KGS A;  3MC9 A;  3TEW A;  1ZDX A;  3ZGZ A;  3T9L A;  5CHF A;  2ON8 A;  2LGX A;  2JU6 X;  2WXO A;  4P6V F;  1WH3 A;  4FAD A;  2YLM A;  3ZYY X;  2HTH A;  1SE3 A;  1KM7 A;  3VXW A;  2NMQ A;  5EE0 A;  2FNJ B;  3GS2 A;  5JHB A;  2QEJ C;  1LO5 D;  1LQB A;  2A4Z A;  2JY6 A;  4OZC A;  3DPD A;  4IM3 A;  3URY A;  4EOY A;  2QIE B;  5L83 A;  3AE9 B;  4WWP A;  4AJY B;  2JWZ A;  1IPG A;  3AMZ A;  2D5G A;  5BMH A;  4DHJ B;  5BYS A;  4HEA 1;  2GBR A;  1WXM A;  4KVG B;  2WDR B;  4LNF A;  4TMA B;  3HIZ A;  4R3D A;  1D6E C;  1NEN B;  1Z2M A;  1RM6 C;  3BK1 A;  3PZD A;  4WAA A;  1UD7 A;  4EZJ A;  1S3S G;  2LHE A;  3CF6 E;  2H89 B;  1L4Z B;  5J2R A;  1QQR A;  3EFU A;  1MHH E;  3H6N A;  3Q8F A;  1RAX A;  4P1C C;  2PPH A;  4GDK B;  1WGD A;  4W9E A;  4BBN C;  3MFG A;  2E6X A;  2WS3 B;  4HKQ A;  1M94 A;  1ZXH A;  4B6W A;  1F1H A;  1E8W A;  3P63 A;  3KYC D;  2CKH B;  1SSN A;  2HJ1 A;  4HJK A;  4GDK A;  4AS1 A;  1TT5 B;  3L0W B;  4ZHP A;  4DXG A;  2PLP A;  5EE9 A;  3Q14 C;  2KAJ A;  2BYE A;  5IAA C;  3PRM B;  4IOI E;  1TS3 A;  3AU4 A;  3AEE B;  3IAS 1;  4RCO A;  3TEZ A;  1OQQ A;  2OJR A;  3L16 A;  2REX A;  3I63 C;  1UWM A;  3N1Y C;  4IWO A;  1TYG B;  4WWN A;  5BYQ A;  2AX5 A;  5LXI B;  4G0N B;  1YJ1 A;  1MI0 A;  2KJR A;  1WWT A;  1SE9 A;  3ZXV A;  3RZF A;  2N9L A;  4GLS C;  2GBN A;  3TSS A;  3H7P B;  3FIL B;  1KF6 B;  1TKG A;  2ASQ A;  1D5Z C;  1OTR B;  1ZE3 D;  5G2N A;  3KYD D;  1FFV A;  2WXJ A;  2Z0E B;  3AV8 A;  5FR6 A;  4B95 A;  4BKG A;  4A6Q A;  5DPW A;  1IBX A;  1HZ6 A;  3KVF B;  1JWB D;  3BWU D;  2VRR B;  2C5L C;  4WJP A;  4GMV A;  3NVZ A;  2KDE B;  4FN2 A;  5HKH A;  2X8X X;  2BYT A;  2FID A;  3KH0 A;  1U4A A;  5MPO A;  2Y5B B;  5D3D A;  3PLU A;  1I4G A;  4WJN A;  4ANV A;  1NBF C;  4IKG A;  1XF5 L;  1FM0 D;  2MCN B;  2LD9 A;  2BWF A;  2XN9 C;  3RNB C;  2KTR A;  1WGH A;  3V3X A;  3R7Q A;  1T6B X;  3AE7 B;  4W9J A;  3RUL A;  1Z5S B;  2BQQ A;  1CK1 A;  4NJ7 A;  2WX1 A;  2LGS A;  1GAQ B;  1JML A;  1E8Y A;  3HVD A;  2FE8 A;  3VH4 B;  2G45 B;  4JLC A;  2FIF A;  3UQB A;  4HPP A;  5H8Y E;  4OZB A;  3A9K B;  3APF A;  2K8H A;  3W1S C;  4KKI A;  1V6E A;  1R4M I;  2JX5 A;  4WWM A;  1FNV A;  2G4S A;  3R2T A;  3UQA A;  4W9H A;  1HQR D;  2AWT A;  5D94 A;  4DDG D;  4K1R B;  2MH7 A;  3CST A;  3QQ8 B;  2J42 A;  1F9J A;  2LGY A;  3Q3J A;  2UYZ B;  2QC8 A;  4ZRP A;  4OVV A;  2WDT B;  4HRS A;  1J19 A;  2D3G A;  2KTR B;  3FIL A;  5FKA C;  1MG8 A;  3B2G A;  3ZJV A;  3M62 B;  5E6N A;  1D5X C;  4TKN A;  2O2V A;  2K22 A;  2KMM A;  2LI5 A;  1JRO A;  5J17 A;  2JRI B;  3E9S A;  1GC6 A;  1WF9 A;  1C1Y B;  2ICI A;  1ZXI A;  4DQO C;  1L6U A;  2KKC A;  3AE8 B;  3M63 B;  1NI3 A;  4A3P A;  1VCB A;  1YIW A;  2H88 B;  3P4R B;  4BFR A;  2NBW B;  3UGB B;  2FAZ A;  4REZ A;  1C76 A;  2DYB A;  3AI5 A;  4L23 A;  4N58 A;  4M8N A;  1T0Q C;  3KLS X;  3OLM D;  4WQM A;  1L2N A;  2KDI A;  3SR6 A;  1SF0 A;  2XNA C;  2GB1 A;  3HVZ A;  2L05 A;  3AUL A;  4DHJ D;  3TBL D;  1I42 A;  2MHJ A;  4OZA A;  1ZDV A;  5AUI A;  4ICU A;  2CU3 A;  3NY5 A;  2NTS A;  4UDU C;  4PK1 A;  1D4B A;  3V60 A;  5BMG A;  1GOZ A;  2MLB A;  2X38 A;  1UNS A;  2L8J A;  3Q2A C;  4HLE A;  2FCQ A;  2OED A;  2IGH A;  3P4S B;  2EMT A;  3SDL C;  1J7C A;  1LM8 B;  3BIN A;  2LGI A;  4LNN A;  1WZ3 A;  2KVR A;  2BS3 B;  2WXR A;  1ZOY B;  4MEM A;  1WE6 A;  1YN3 A;  3SHQ A;  2GBK A;  4L2Y A;  3N1Z C;  3IT4 B;  5EDS A;  2BYF A;  1PYW D;  1WX8 A;  3MP9 A;  3I57 A;  4HWI B;  3SU8 X;  4EZL A;  4XX5 A;  4MDK E;  2JVC A;  2C9W B;  3KQ4 A;  1VZ8 A;  1OQY A;  2DBY A;  3H7P A;  1KRH A;  2HTM E;  2MP2 B;  1QT9 A;  1TS2 A;  4O1N A;  4KIK B;  2RR9 A;  2G4D B;  4BKS D;  2J7Q B;  2KFK A;  4ITK A;  2LWP A;  3DWG C;  3BYY B;  1DYQ A;  1E5W A;  1FNU A;  1S1Q B;  2MP2 A;  4US8 A;  3U52 E;  4LDT D;  3AM9 A;  3AEF B;  1C77 A;  2C7N B;  2IND C;  3C0R B;  4KZC A;  1YQB A;  4IM2 A;  1SIF A;  4ASW C;  1GG3 A;  2KAC A;  4WAF A;  3KWV A;  1DGJ A;  1QOF A;  2O2V B;  4LNO A;  2WXQ A;  4J3O D;  3N3K B;  3BII D;  3Q3N C;  4US9 A;  5HG2 A;  4LK0 M;  1NYR A;  5C1Z A;  2RPV A;  4NPN A;  3P2B A;  2HDE A;  3ZQ4 A;  2KZR A;  3MC0 B;  1T0S C;  5G5G A;  3WA0 A;  4KDL B;  4RNA A;  2HJ8 A;  2WXF A;  3U7Z A;  2WU5 B;  3N9Y C;  3ZNG C;  2ZPY A;  2XBB C;  2PE9 A;  2KT7 A;  1F0Z A;  4BKS A;  3DHG C;  2AL6 A;  2YEP F;  2Z59 B;  4ARC A;  2CHZ A;  2DYO A;  1E7V A;  2Q5W D;  3RNG C;  4W9L A;  3NJT A;  2DEN B;  3PSE B;  1N60 A;  1L4D B;  3PZ8 A;  3QAR A;  2IY1 B;  2VH2 A;  2INN E;  2PVO D;  3H8H A;  2QMT A;  1WMH B;  4KGR A;  2N9K A;  4W9G A;  4HPL B;  2WXH A;  2KK8 A;  3VDZ A;  4A8X C;  4L1B A;  1EWC A;  1Y8R C;  2KDB A;  4NNJ B;  2M19 A;  3DQV A;  2MJD A;  2L0F A;  4PS3 A;  3Q8B A;  5JXV A;  1KLV A;  1JCK B;  1AW7 A;  5IO9 A;  3QC8 B;  4AOF A;  2AQ2 B;  2KX0 A;  1FPY A;  1PGB A;  3RT3 B;  4E74 A;  4N9F 4;  1VLB A;  1SE2 A;  3PRZ A;  1T5X D;  1I4X A;  1MG4 A;  1C4P A;  1K53 A;  2FUH B;  1EWY C;  4IWP A;  2EKE C;  4FJV B;  3I9V 1;  1IGD A;  2PW9 A;  2BB5 A;  2WHI A;  2MEK A;  3RYT A;  3ZIM A;  2WXM A;  3BY4 B;  4W9C A;  3EFC A;  3NZU A;  2WXN A;  3RMK C;  1QIL A;  3KUD B;  1EF5 A;  3ZXR A;  2CU1 A;  3N1X C;  4XYC A;  2G3Q B;  3WAL A;  3PTF C;  1CQV A;  4AWJ A;  1K51 A;  2KWV B;  2N4F A;  5CHW A;  5KHQ A;  1VRA B;  2MW5 A;  3V05 A;  3HM3 A;  2KWU B;  3PGE A;  2AQ1 B;  3IT6 B;  3ZJT A;  3ZDM C;  4II3 B;  2WXP A;  3C19 A;  2W3S A;  5J18 A;  1MVK A;  3AE1 B;  1L0V B;  3MJW A;  1UWX A;  2KMC A;  2KNB A;  1ZGU B;  3VFK A;  1XLQ A;  3DBR B;  1UH6 A;  1XEE A;  4GGQ A;  2IYD B;  2V0G A;  2GBJ A;  1FXI A;  2D2Q A;  2XEW A;  3U2S C;  3FKY A;  3IBE A;  4ANW A;  3DOW A;  4DBG A;  3V6C B;  4ZRJ A;  1T0Y A;  4FXC A;  4MJS A;  3QCA A;  3X0W A;  5L95 C;  3BVG A;  2K0P A;  1TJE A;  3VQI A;  2PVG C;  3ZTD A;  2LZ6 A;  2IDY A;  4RF1 A;  1WYG A;  3VAW A;  1E6E B;  3APD A;  4KSK C;  4KDI C;  3DBH I;  2R2O A;  4E3C A;  4C4V B;  1B1Z A;  2LUE A;  4D2K A;  1D3Z A;  3AH7 A;  3VVW B;  3AU5 A;  3JW0 X;  3DBH B;  5TR5 A;  2NCN A;  1V1O A;  3T3O A;  4CYE A;  3DHH C;  3AE4 B;  5C23 A;  5LNK 1;  3PHX B;  2Y3A A;  3VR8 B;  4GIV A;  2M17 A;  2IO0 B;  2ZW1 A;  2W55 A;  1A5R A;  1YJJ A;  3PO0 A;  4II2 B;  1JW9 D;  3EGR A;  3K9O B;  4FBJ B;  2QDF A;  4PS8 A;  3EEC A;  4KSL C;  3IAM 1;  5E6J A;  2AL3 A;  1NVI D;  2KN5 A;  2Z8L A;  2DZK A;  2EEL A;  3M3J A;  5HHD G;  2KX3 A;  1V8C A;  3L10 B;  1WXQ A;  4JPS A;  4MJS B;  2KO3 A;  3U8Z A;  1FNW A;  2I2Y A;  1MFW A;  1P7E A;  2BBC A;  1E10 A;  1TZ1 A;  2KDM A;  1WIA A;  3N20 C;  2DYM A;  2VZK D;  1ET6 A;  4NY0 A;  3ALB A;  1XO3 A;  4K3B A;  2UWQ A;  3EHV A;  3RN9 C;  1GNU A;  2LGD A;  2RDH A;  4KIK A;  3Q3M C;  1C79 A;  4C7Y A;  2MBH A;  4I6N B;  1V2Y A;  2CS4 A;  3BVM A;  1WGG A;  3ZJU A;  1SIJ A;  2C7M B;  4RM9 A;  2IO1 B;  2R61 A;  2WLB A;  2LUM A;  1WSP A;  2DHZ A;  4C56 C;  1QOG A;  2J0J A;  4BOS C;  4GDL B;  4MEL A;  3PVL A;  3RNF C;  4W9K A;  2LRW A;  1SB3 C;  2WDV B;  2DAJ A;  2HE7 A;  3DVG Y;  1P1A A;  3HHM A;  3RI7 C;  3DHI C;  1V9J A;  1UBI A;  3SFE B;  3JYU A;  2L32 A;  2FUG 1;  1E8X A;  4EFO A;  3I5J C;  1FFU A;  3ZW3 A;  1IYF A;  3FAH A;  3Q3F A;  4XE0 A;  1FXA A;  4P7I A;  3SD5 A;  4A90 A;  4TQ0 A;  3U4E G;  4MAC A;  1WI0 A;  4JIO U;  1DOI A;  3RNE C;  2MRP A;  1NDD A;  3TL5 A;  1WX9 A;  3A9J B;  4G11 A;  4NQK E;  3PPA A;  5IN7 A;  2MJE A;  2QJL A;  4AQ7 A;  3OJ3 A;  1K8R B;  2V9H A;  3ZO5 B;  1OGW A;  1C9F A;  5H92 C;  3HK0 A;  1OEY J;  2L00 B;  1YX6 B;  2PE6 B;  3R2I A;  3TUO A;  4IWQ A;  3M95 A;  4FJZ A;  4RMA A;  3TEY A;  1V86 A;  3A9K A;  4C00 A;  3QHT A;  1WXV A;  2ZZP B;  3QAQ A;  2LHD A;  5G55 A;  2KMA A;  2AEH A;  2M1M A;  5DPT A;  1XXG A;  4G3X B;  5D7G A;  2IZV B;  2MQJ A;  2RPQ A;  5C2T B;  5G5H A;  3NOB A;  1C78 A;  4JX1 C;  3CMM B;  1F52 A;  1MJD A;  1OFF A;  3W9C B;  2OHF A;  1Q1O A;  5HI1 A;  4RFB A;  4C4V A;  4PS7 A;  4YSY B;  3ABV B;  2K5P A;  4WQO B;  3RNC C;  1K50 A;  4DXF A;  1Q5W B;  1SEB D;  1XLO A;  2MX2 A;  3APC A;  3DBL I;  3NG0 A;  1VJK A;  2LJ5 A;  3VH3 B;  3PZ7 A;  5IOI A;  3QA8 A;  4YSX B;  1FD6 A;  4MH0 E;  2JT4 B;  2M0A A;  2L83 A;  3DBS A;  3OG5 A;  3AE2 B;  2EMS A;  4F1S A;  3DVG X;  3ETR A;  2RGF A;  1PFD A;  3V62 A;  3CIR B;  4G50 A;  5HFY A;  3JSV B;  2JF5 A;  2INP E;  4C80 A;  4ZHO A;  4I6L B;  2SEB D;  2ZVO A;  4A20 A;  2KC1 A;  1D5M C;  2GOW A;  2FCN A;  3VTU A;  4NAW A;  3D32 A;  1WRD B;  1HE8 A;  1IGC A;  3L17 A;  1AWD A;  4S0R A;  1JWS D;  2BVC A;  2KN4 A;  2AYO B;  3A4R A;  3J9C A;  1KH0 A;  2C60 A;  2M0X A;  4BVU C;  1NYQ A;  2C7H A;  1NI2 A;  2BKF A;  1V80 A;  1NEK B;  2ONQ A;  4BBN F;  4FHJ A;  4I6P A;  1TTN A;  4MGY E;  2INC C;  2KQ7 A;  1E7U A;  2BPS A;  2K8C A;  4MGK E;  3O13 A;  2KVZ A;  2ZCB A;  3PRE A;  1N6Z A;  1ZUD 2;  5T8I A;  1WM2 A;  2CHW A;  4HK2 A;  3O65 B;  2JXX A;  3GOE A;  2L52 A;  1JWU D;  3AEG B;  4DHZ E;  2ZW0 A;  2W3R A;  4JL9 A;  3KUC B;  4M8M A;  2D3B A;  3IFW B;  1RRB A;  2KD0 A;  3ZUN A;  4ANX A;  4HVB A;  4E71 A;  5C3J B;  2D3C A;  2MBQ A;  3AE6 B;  4NJC A;  2RDG A;  4XGA B;  3WAM A;  3Q8E A;  4PYZ A;  4GN1 A;  2JYT A;  2QHO A;  4YTN B;  3ZDT A;  3RNA C;  5E6O A;  1TKE A;  1VR9 A;  4KV2 A;  1PDX A;  4LTU A;  1KJT A;  3B2F A;  3ZTC A;  3MTN B;  1XD3 B;  2JSV X;  2WXI A;  1P9D U;  4LNI A;  1E7P B;  2I1K A;  2KC2 A;  1EU3 A;  4RF0 A;  5IP4 D;  4XWW A;  1FXT B;  4YTM B;  5IKC M;  3PT2 B;  1L0Y B;  3EUB 2;  1LGR A;  4FHK A;  4YXD B;  2BKR B;  3VUY A;  1KLG D;  1N5X A;  3AEB B;  1L5P A;  1FCC C;  2BTE A;  5AUK A;  3RPF C;  4IC7 B;  1VZ7 A;  2V3P A;  3DWM A;  4ZRI A;  5AZG A;  1I4Q A;  1WZ0 A;  1V1P B;  3ZVV A;  2V1Y A;  5CHV C;  1QOB A;  3AE3 B;  3UIN B;  3WCQ A;  4M0W B;  2MA9 B;  3TMP B;  4ZOH C;  1HTQ A;  3B0A A;  3OAW A;  1B9R A;  4WUR A;  5CTR C;  2ZCC A;  2W82 A;  2V3N A;  1J7A A;  3HUI A;  2XK5 B;  1FCL A;  2LAS A;  1WMH A;  1FIQ A;  3ZLZ A;  1E90 A;  1EO6 A;  3BYT B;  3UIP B;  3VUX A;  1WJ4 A;  3L08 A;  1CJE A;  1YQ4 B;  4KZ0 A;  3RZW C;  5BYR A;  5GMV A;  2L76 A;  2BW2 A;  3TJP A;  2WP9 B;  4USA A;  1F77 A;  3ZNI D;  2NVU I;  2V4I B;  4M02 A;  1PQS A;  3VUW A;  3LXF A;  4OHJ A;  1C4A A;  2KHW B;  1WGR A;  1E8Z A;  3IXS A;  4FJY A;  1ENF A;  1UF0 A;  2JUO A;  3R7R A;  1KFY B;  3NRZ A;  1WR1 A;  1H4R A;  3TEX A;  1ISN A;  4GXB A;  3Q6B A;  3WAN A;  2K39 A;  3EC8 A;  4RGN A;  1WE7 A;  1HXY D;  3AB5 A;  2N7D A;  3RD2 A;  3U7D A;  1YJI A;  4TQ1 A;  4ZYS A;  3PV1 A;  1DOX A;  3R3M A;  3ZRF A;  2KLC A;  2WU2 B;  5TSS A;  4DDI D;  2KTF A;  4ZDV A;  1WJU A;  2Y5P A;  3T3N A;  1RFA A;  2KWC A;  1Q10 A;  2TSS A;  1YNT E;  4WH4 A;  4YSZ B;  4ARI A;  3L4P A;  1JRU A;  4A3O A;  1UGJ A;  1GJZ A;  2BWE S;  4YT0 B;  1LFD A;  4W9F A;  1MHX A;  1WM3 A;  2JXT A;  1TZO A;  4FA6 A;  4HKZ E;  3R66 C;  4MH8 A;  4PT5 A;  2WXL A;  2NBU A;  2PTL A;  5LXH A;  1VDV A;  2ZNV B;  2ZNV C;  3NS8 A;  1GB1 A;  4EUT A;  4LJO B;  4LJP B;  3AXC A;  1YMH E;  2O6V B;  4M01 A;  2MBO A;  1CZP A;  3ONS A;  3W5U B;  1I4H A;  3W2D A;  2L7R A;  4W9I A;  5DPS A;  2JZZ A;  1RWS A;  1F2R I;  4GSW A;  1BXT A;  1C3T A;  2ZVN A;  3WAP A;  2A5U A;  4XDD A;  3QIJ A;  1I4R A;  2BB6 A;  1UBQ A;  1ACC A;  3UF8 A;  1XQQ A;  4URK A;  1SXT A;  3SEB A;  3KW5 B;  1UEL A;  2BS4 B;  1LXD A;  2DNF A;  1P98 A;  4WWO A;  1FMA D;  3L54 A;  1GB4 A;  1V1P A;  1YD8 U;  3MC8 A;  2NTT A;  1J8C A;  3NZS A;  2LVQ A;  1R4N B;  4RH6 A;  2DAF A;  3BVZ A;  3W5V B;  3B1L X;  1C4C A;  4MSM B;  3P42 A;  2Y5C A;  4JWS C;  1QOA A;  5D6J B;  2CJN A;  3H7S A;  1TY0 A;  4WJO A;  3A1Q B;  4ICV A;  2NPT B;  1M4V A;  1WX7 A;  5AZH A;  2DZI A;  3U30 A;  5D2M B;  4CO7 A;  3IHP C;  3GE8 C;  1SBB B;  2L1A A;  2WYQ A;  1KTK A;  4P16 A;  4MT5 A;  1A70 A;  3E56 A;  2DX5 B;  4HPM B;  1K52 A;  4LCD E;  1JWM D;  2M4N A;  2N1W A;  1YX5 B;  2BS2 B;  3JSV A;  5EE1 A;  2L0T A;  1WJ6 A;  2GI9 A;  4RM8 A;  2K1F A;  2K8B A;  4ZRQ A;  1HZ5 A;  1JAL A;  2DZM A;  4NZL B;  2RD0 A;  3UIO B;  1V97 A;  4KGT A;  4HJG E;  2Z0D B;  1AN8 A;  4GU2 A;  4C7Z A;  1GPX A;  4LNK A;  2YEP B;  4QAY A;  3ENE A;  5BMI A;  4LDT B;  1EU4 A;  2KAN A;  5GXG B;  3ML8 A;  3W1S A;  2LEK A;  3RFZ B;  3AEC B;  2KWD A;  2R2Q A;  4EEW A;  3DBL B;  2ACZ B;  2QSD A;  4N59 A;  3TIX A;  2OJW A;  1UGM A;  2AQ3 B;  2XK5 A;  3DDC B;  4P1B C;  4RGM A;  2LRU A;  4TV3 A;  3Q3O C;  1FRR A;  2ZPN A;  4HDO A;  2J0M A;  3FC4 A;  1ZPS A;  2RSU A;  4JQW C;  5FR3 A;  1L7Y A;  2LXA A;  2WGS A;  4NJ6 A;  4RGT A;  1ZW7 A;  2WDQ B;  2J4X A;  1SJE D;  4B9K A;  1FEH A;  3ZRC A;  4XC2 A;  2D11 A;  1TKY A;  2JRH A;  2N1V A;  1E0Z A;  3Q69 A;  1BML C;  3VTV A;  4WJQ A;  4RGO S;  2IPK D;  2VZK B;  2KDF B;  1AYF A;  2MBE A;  2J53 A;  3DBR I;  3OJ4 B;  2JZP A;  2CJO A;  2BYV E;  2QCZ A;  4NAW B;  3N30 A;  1YQ3 B;  2NS5 A;  2WQY B;  3MHS D;  1ESF A;  3VRB B;  2KQ4 X;  2W9N A;  2IGD A;  1DOY A;  3B08 A;  1HA5 A;  2IGG A;  2NPT A;  5AZF A;  2WX0 A;  4FUL A;  2D3A A;  3QJZ A;  2DLB A;  4TSS A;  4ACF A;  2O6V A;  3HM6 X;  1SGH A;  3A1Q A;  4M00 A;  1YOV B;  1FO4 A;  4AUQ C;  3PLV A;  5E6P A;  1YN5 A;  1XT9 B;  2KYW A;  3AE5 B;  2WXG A;  1IUE A;  2GLS A;  1WGY A;  4AP4 C;  2PKO A;  1BUI C;  3H1U A;  1QZE A;  3P4Q B;  2IO2 B;  2CHX A;  2PIA A;  1EF1 A;  2KJ6 A;  2WXK A;  1UZX B;  1H8C A;  4DK5 A;  1GUA B;  2NR2 A;  1XCT L;  2JQR B;  3NVV A;  3N32 A;  4YTP B;  1STE A;  1E9M A;  3ZKJ C;  1TGZ B;  1N61 A;  1KLU D;  2J52 A;  3CSF A;  2PJH A;  1WRI A;  4AJW A;  4XWT A;  5DPR A;  2N7E A;  1TS4 A;  4OVZ A;  1T0R C;  1PGX A;  2WNM A;  2LJI A;  3OWE B;  5JHA A;  3VRA B;  3C8Y A;  3GZN B;  4X57 B;  1AAR A;  3WAO A;  1ZKH A;  4NQL B;  2PMV A;  4OW0 A;  2JWU A;  3WIM A;  1WY8 A;  3VR9 B;  1L0X B;  3IG3 A;  3NVW A;  4CQN A;  1PGA A;  1VZ6 A;  1V81 A;  1G6J A;  3AEA B;  3A9J A;  2KQS A;  1R4N I;  2ZEQ A;  2IY0 B;  1R7S A;  4YL8 A;  1QKZ A;  1EUV B;  3ML9 A;  2KXJ A;  4HXD A;  4BAX A;  5AEK B;  4DWF A;  2SAK A;  3KWL A;  2LVP A;  3A33 B;  3HRD D;  3MHZ A;  1RLF A;  4TUU A;  2G9H D;  3K9P B;  4J6I A;  5CX3 A;  3LJ3 A;  4XDC A;  4MSQ B;  3NUH B;  4CHK A;  1HEZ E;  2E3T A;  2JPH A;  3ZNH B;  4IG7 B;  3X23 A;  1L6V A;  1N62 A;  2N0S B;  2LXC A;  3PHW B;  1IP9 A;  5JH5 C;  5JZE B;  2N9E B;  3ZNZ B;  3QX1 A;  1XLN A;  2MJ3 A;  4K3C A;  5BO4 B;  4JGH B;  1SE4 A;  1XLP A;  2DZJ A;  1V5O A;  2NBV B;  3L13 A;  2FCS A;  2B3A A;  3S2A A;  2OOB B;  4BZA A;  2KOX A;  4W9D A;  3H9D A;  2GBM A;  2B76 B;  3UI3 A;  4BOZ B;  2FBW B;  4IW0 A;  4GDL A;  2N7J A;  3LDZ E;  2KJH B;  4DHZ B;  3DCG A;  3VTW A;  1P0R A;  1YN4 A;  4H2A A;  4EKU A;  1QLB B;  3P1M A;  4K7W A;  1Q0W B;  3B9J A;  2DWQ A;  4LLG M;  4KKJ A;  1P7F A;  4F8C B;  3PS6 A;  1ROE A;  5I4D A;  2M56 B;  3R8B A;  3V6E B;  1RYJ A;  3LYY A; 
#chains in the Genus database with same CATH homology
 3QWZ B;  3Q3J A;  2UYZ B;  4FA6 A;  3R66 C;  4KIK A;  4OVV A;  2WDT B;  2MSE D;  1KOT A;  1J19 A;  2D3G A;  2KTR B;  4HCP B;  2NBU A;  2MBH A;  1MG8 A;  4I6N B;  4HCN B;  1V2Y A;  2CS4 A;  5LXH A;  3M62 B;  5E6N A;  1WGG A;  2ZNV B;  4TKN A;  2ZNV C;  2O2V A;  3NS8 A;  2GMI C;  4GB9 A;  1WXS A;  4EUT A;  2C7M B;  4LJO B;  4RM9 A;  2IO1 B;  2LI5 A;  3AXC A;  4LJP B;  2O6V B;  3IVF A;  5J17 A;  2DHZ A;  2JRI B;  2MBO A;  1I35 A;  3ONS A;  1GC6 A;  5DCN A;  1WF9 A;  1C1Y B;  2L7R A;  4W9I A;  2JZZ A;  5DPS A;  3DVN U;  2J0J A;  4BOS C;  4GDL B;  4HDQ A;  4MM3 A;  1V49 A;  1X1M A;  4GSW A;  2KKC A;  1J0G A;  3M63 B;  4MEL A;  3KUZ A;  1C3T A;  3PVL A;  4IM0 A;  1VCB A;  4A3P A;  1YIW A;  2ZVN A;  3WAP A;  4W9K A;  2LRW A;  2DAJ A;  4BFR A;  1P3Q U;  2NBW B;  3UGB B;  2A5U A;  2FAZ A;  2HE7 A;  3DVG Y;  1P1A A;  4ZYN A;  1WR6 E;  3HHM A;  3PRP B;  1V9J A;  1UBI A;  2DYB A;  3AI5 A;  3JYU A;  3QIJ A;  1WJN A;  4IUM B;  1E8X A;  4EFO A;  4M8N A;  1V5T A;  1UBQ A;  3OLM D;  4GOC A;  3UF8 A;  2J0K A;  1XQQ A;  4URK A;  1L2N A;  2KDI A;  2IO3 B;  3KW5 B;  2D10 A;  3ZW3 A;  1UEL A;  2N9P C;  1IYF A;  1LXD A;  4K7S A;  2L05 A;  3AUL A;  1P98 A;  3Q3F A;  4WWO A;  4DHJ D;  4P7I A;  3TBL D;  3SD5 A;  4TQ0 A;  2I1J A;  1I42 A;  1TBE A;  1WFY A;  1WI0 A;  3L54 A;  4JIO U;  3RUI B;  1YD8 U;  2N9X A;  3NY5 A;  4ICU A;  2MRP A;  4K7U A;  1J8C A;  3NZS A;  4PYU A;  1NDD A;  2LVQ A;  2YVC A;  3TL5 A;  1WX9 A;  3A9J B;  4G11 A;  1CMX B;  3V60 A;  2DAF A;  2MLB A;  4NQK E;  3PPA A;  2L8J A;  3B1L X;  3NHE B;  3OJ3 A;  4HLE A;  1K8R B;  4MSM B;  3ZO5 B;  1OGW A;  2FCQ A;  5KHO A;  3HK0 A;  1OEY J;  3W1Y A;  2KFJ A;  2K6Q A;  2L00 B;  1YX6 B;  5D6J B;  2EMT A;  3VHT C;  2PE6 B;  3SDL C;  4OVU A;  3H7S A;  4IWQ A;  1LM8 B;  2JZ3 B;  4WJO A;  3M95 A;  2MWS B;  3A1Q B;  3BIN A;  4FJZ A;  2NPT B;  4ICV A;  4RMA A;  2ZJD A;  4XZ4 A;  1V86 A;  1WX7 A;  5AZH A;  1WZ3 A;  3A9K A;  2KVR A;  2DZI A;  3QHT A;  3U30 A;  5D2M B;  1WXV A;  4CO7 A;  2K6D B;  2ZZP B;  3QAQ A;  3IHP C;  3V61 A;  3DVN V;  2K25 A;  2WWZ A;  5G55 A;  4MEM A;  1WE6 A;  2KMA A;  3SHQ A;  2AEH A;  2GBK A;  2WYQ A;  2M1M A;  5DPT A;  4G3X B;  5D7G A;  2IZV B;  2MQJ A;  2RPQ A;  4MGZ E;  5EDS A;  3NOB A;  2BYF A;  1WX8 A;  3CMM B;  4K81 A;  3A4S C;  4HWI B;  2DX5 B;  4FLH A;  3SU8 X;  4ANU A;  4EZL A;  5IA7 A;  4HPM B;  4XX5 A;  4MDK E;  2JVC A;  2LVO A;  3TCA A;  2C9W B;  1Q1O A;  1OQY A;  3RCZ A;  4PS7 A;  4LCD E;  3H7P A;  2M4N A;  2PEA A;  2MP2 B;  2N1W A;  1GC7 A;  1YX5 B;  3JSV A;  2L0T A;  1WJ6 A;  4RM8 A;  4WQO B;  2D07 B;  1BT0 A;  4KIK B;  2RR9 A;  2K1F A;  2G4D B;  1Q5W B;  2K8B A;  4BKS D;  2DZM A;  2J7Q B;  2KFK A;  2MX2 A;  2RD0 A;  3UIO B;  3APC A;  3DBL I;  2Z0D B;  2LJ5 A;  2BGF A;  3VH3 B;  2LWP A;  4GU2 A;  4DXA B;  3QA8 A;  3ECI A;  4F7Z A;  1E5W A;  2CR5 A;  4MH0 E;  1VD2 A;  1WYW B;  1S1Q B;  2MP2 A;  2JT4 B;  3ENE A;  4LDT D;  4EZK A;  3JVZ X;  4LDT B;  2KAN A;  3DBS A;  2C7N B;  3C0R B;  3ML8 A;  4KZC A;  3W1S A;  1YQB A;  4IM2 A;  2EMS A;  4F1S A;  3DVG X;  5LLI A;  1SIF A;  4ASW C;  1GG3 A;  2RGF A;  3T8M A;  3V62 A;  2R2Q A;  4EEW A;  3QK0 A;  4G50 A;  2FCM A;  2BF8 B;  2O2V B;  2MBB B;  3JSV B;  2JF5 A;  3TIX A;  2V4L A;  1UGM A;  4I6L B;  2XK5 A;  3N3K B;  2ZVO A;  4A20 A;  2KC1 A;  3DDC B;  1WXA A;  2IBI B;  3GZN I;  2GOW A;  2LRU A;  5C1Z A;  4ZRK A;  4TV3 A;  2FCN A;  2O6V D;  2ZPN A;  2KFK B;  4NAW A;  3D32 A;  3I3T B;  3VTU A;  4BKT A;  4HDO A;  2J0M A;  2HD5 B;  1WRD B;  1HE8 A;  2KLG A;  2RSU A;  4JQW C;  3L17 A;  4NPN A;  3P2B A;  1L7Y A;  1OEY A;  2KZR A;  2LXA A;  4MGI E;  2L3Z A;  2M8S A;  2V3S A;  4NJ6 A;  3WA0 A;  4KDL B;  1ZW7 A;  2HJ8 A;  2AYO B;  3A4R A;  3ZNG C;  4B9K A;  2C60 A;  3T9L A;  5CHF A;  2M0X A;  2XBB C;  2PE9 A;  2ZPY A;  2LGX A;  4BVU C;  2C7H A;  3ZRC A;  4XC2 A;  2D11 A;  1NI2 A;  2BKF A;  4BKS A;  1WH3 A;  4FAD A;  2AL6 A;  1V80 A;  2JRH A;  2N1V A;  2Z59 B;  2YLM A;  2CHZ A;  3VTV A;  2DYO A;  4WJQ A;  4BBN F;  2HTH A;  4FHJ A;  1KM7 A;  4I6P A;  1TTN A;  1E7V A;  4MGY E;  3VXW A;  2KQ7 A;  2KDF B;  4W9L A;  2MBE A;  2DEN B;  3PSE B;  3QAR A;  2FNJ B;  1E7U A;  2BPS A;  2IY1 B;  2K8C A;  3DBR I;  4MGK E;  5JHB A;  3OJ4 B;  2ZCB A;  1LQB A;  2A4Z A;  2JY6 A;  3PRE A;  1WM2 A;  2CHW A;  4HK2 A;  1WMH B;  3O65 B;  3DPD A;  2BYV E;  4IM3 A;  4NAW B;  2JXX A;  3N30 A;  4W9G A;  2NS5 A;  3GOE A;  3MHS D;  4EOY A;  5L83 A;  4WWP A;  4HPL B;  4AJY B;  2W9N A;  2JWZ A;  4DHZ E;  1IPG A;  2KK8 A;  3B08 A;  3VDZ A;  4DHJ B;  2NPT A;  5AZF A;  2WX0 A;  4JL9 A;  3KUC B;  2GBR A;  4M8M A;  4FUL A;  1Y8R C;  2KDB A;  3IFW B;  1RRB A;  1WXM A;  2KD0 A;  3QJZ A;  4NNJ B;  3DQV A;  4KVG B;  3ZUN A;  4ANX A;  2L0F A;  4HVB A;  4PS3 A;  4E71 A;  2O6V A;  3HM6 X;  1SGH A;  3A1Q A;  1Z2M A;  3HIZ A;  3PZD A;  1KLV A;  2MBQ A;  4WAA A;  3WAM A;  3PLV A;  3QC8 B;  1UD7 A;  5E6P A;  4AUQ C;  4EZJ A;  1XT9 B;  4GN1 A;  1S3S G;  4PYZ A;  2QHO A;  4AOF A;  2KX0 A;  3ZDT A;  3CF6 E;  3RT3 B;  4E74 A;  4N9F 4;  1WGY A;  5E6O A;  4AP4 C;  5J2R A;  4KV2 A;  3PRZ A;  3EFU A;  3H6N A;  3H1U A;  1QZE A;  1RAX A;  1KJT A;  3ZTC A;  2IO2 B;  3MTN B;  2CHX A;  1XD3 B;  2FUH B;  1EF1 A;  4IWP A;  2EKE C;  4FJV B;  2KJ6 A;  2PPH A;  4GDK B;  1UZX B;  1H8C A;  1P9D U;  4DK5 A;  1GUA B;  2NR2 A;  1WGD A;  3RYT A;  2I1K A;  2KC2 A;  4W9E A;  3ZIM A;  4BBN C;  3BY4 B;  4W9C A;  3N32 A;  1M94 A;  1FXT B;  3NZU A;  4B6W A;  1E8W A;  3ZKJ C;  3PT2 B;  1TGZ B;  3KUD B;  3CSF A;  2PJH A;  4FHK A;  3KYC D;  4AJW A;  2CKH B;  5DPR A;  1EF5 A;  2N7E A;  2BKR B;  4HJK A;  3VUY A;  2CU1 A;  5JHA A;  2G3Q B;  4GDK A;  3L0W B;  3WAL A;  3PTF C;  4X57 B;  1AAR A;  4AWJ A;  2KWV B;  3WAO A;  1ZKH A;  2BYE A;  4NQL B;  2N4F A;  5CHW A;  5KHQ A;  4IC7 B;  5IAA C;  2MW5 A;  3PRM B;  3HM3 A;  4ZRI A;  2KWU B;  3PGE A;  5AZG A;  3AU4 A;  1WZ0 A;  1WY8 A;  3WIM A;  3ZDM C;  4II3 B;  5J18 A;  3ZVV A;  3IG3 A;  2OJR A;  3L16 A;  2V1Y A;  2REX A;  5CHV C;  3UIN B;  3MJW A;  4IWO A;  4M0W B;  2MA9 B;  1V81 A;  1G6J A;  2KMC A;  3A9J A;  4WWN A;  3TMP B;  2KQS A;  5LXI B;  1R4N I;  2ZEQ A;  2IY0 B;  2KNB A;  3B0A A;  3OAW A;  1ZGU B;  5CTR C;  3VFK A;  4G0N B;  2ZCC A;  1YJ1 A;  2KJR A;  4YL8 A;  1SE9 A;  1UH6 A;  3RZF A;  1EUV B;  3ML9 A;  4GGQ A;  2XK5 B;  2KXJ A;  4HXD A;  2IYD B;  2GBJ A;  2LAS A;  1WMH A;  2GBN A;  4DWF A;  3H7P B;  1E90 A;  3ZLZ A;  5AEK B;  2D2Q A;  2XEW A;  2LVP A;  3A33 B;  2ASQ A;  3IBE A;  1OTR B;  1RLF A;  3DOW A;  4ANW A;  4DBG A;  4TUU A;  5G2N A;  3KYD D;  3V6C B;  3K9P B;  1EO6 A;  4ZRJ A;  2Z0E B;  3UIP B;  1T0Y A;  3VUX A;  5FR6 A;  1WJ4 A;  3L08 A;  3QCA A;  4J6I A;  4KZ0 A;  4MJS A;  3RZW C;  5CX3 A;  3X0W A;  5GMV A;  4B95 A;  5L95 C;  2L76 A;  3TJP A;  3LJ3 A;  4BKG A;  3VQI A;  5DPW A;  3ZTD A;  2LZ6 A;  3ZNI D;  2NVU I;  4MSQ B;  4CHK A;  3VAW A;  3APD A;  3KVF B;  1PQS A;  3VUW A;  2VRR B;  3ZNH B;  2JPH A;  4IG7 B;  4KSK C;  2C5L C;  4KDI C;  3DBH I;  3X23 A;  2R2O A;  4WJP A;  2KHW B;  1WGR A;  4GMV A;  1E8Z A;  2KDE B;  4FJY A;  4E3C A;  4FN2 A;  2LXC A;  2LUE A;  3PHW B;  5HKH A;  1D3Z A;  3VVW B;  2FID A;  3AU5 A;  1IP9 A;  3JW0 X;  3KH0 A;  1U4A A;  5TR5 A;  2JUO A;  2Y5B B;  3R7R A;  2NCN A;  3PLU A;  5JH5 C;  4WJN A;  5JZE B;  4ANV A;  1NBF C;  4CYE A;  1WR1 A;  2N9E B;  5C23 A;  3ZNZ B;  2MCN B;  1H4R A;  2LD9 A;  3QX1 A;  3PHX B;  1ISN A;  4GXB A;  2BWF A;  5BO4 B;  3WAN A;  4JGH B;  2KTR A;  4GIV A;  2K39 A;  3EC8 A;  1WE7 A;  2M17 A;  2IO0 B;  1WGH A;  3R7Q A;  2DZJ A;  1A5R A;  2N7D A;  3RD2 A;  1V5O A;  4W9J A;  3RUL A;  2NBV B;  1Z5S B;  3L13 A;  3U7D A;  2FCS A;  4II2 B;  2B3A A;  4TQ1 A;  3S2A A;  3PV1 A;  3R3M A;  2OOB B;  3K9O B;  3ZRF A;  4FBJ B;  4NJ7 A;  2KLC A;  2WX1 A;  4PS8 A;  3EEC A;  2KOX A;  4KSL C;  4W9D A;  1E8Y A;  3H9D A;  2GBM A;  4DDI D;  2KTF A;  2AL3 A;  3VH4 B;  2G45 B;  4ZDV A;  1WJU A;  2KN5 A;  4JLC A;  4BOZ B;  2FIF A;  3UQB A;  1RFA A;  4IW0 A;  2DZK A;  2KWC A;  4GDL A;  3LDZ E;  3M3J A;  2KX3 A;  3A9K B;  2KJH B;  4DHZ B;  3APF A;  3L10 B;  3DCG A;  4MJS B;  2K8H A;  2KO3 A;  3VTW A;  3U8Z A;  1P0R A;  1JRU A;  3W1S C;  4EKU A;  4K7W A;  4A3O A;  1V6E A;  1R4M I;  1Q0W B;  1GJZ A;  2G4S A;  3UQA A;  1TZ1 A;  4W9H A;  2AWT A;  2BWE S;  1WIA A;  5D94 A;  4DDG D;  2DYM A;  4K1R B;  1LFD A;  4W9F A;  3CST A;  3QQ8 B;  4F8C B;  3PS6 A;  1WM3 A;  4NY0 A;  3ALB A;  1F9J A;  2LGY A;  2UWQ A;  3EHV A;  1GNU A;  3V6E B;  2LGD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...